4MXVA

Structure of lymphotoxin alpha bound to anti-lta fab
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
144
structure length
137
Chain Sequence
b'KPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lymphotoxin-alpha
publication title Dimerization of LT beta R by LT alpha 1 beta 2 is necessary and sufficient for signal transduction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/immune system
total genus 22
structure length 137
sequence length 144
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2013-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4mxvA00
4GIQA 1TNRA 1D0GA 4G4FA 3URFA 2TNFA 2KA3A 4E4SA 1U5ZA 1PK6B 1DU3D 2ZPXA 2HEWF 4QQPA 2R6QA 4MSVA 3TWIA 4QQLA 4G3YC 2WNUA 1OSGA 1JH5A 4MXWA 3WD5A 2WNVA 2WNVC 5L19A 1C3HA 1D4VB 4NN0A 5BNQA 5L36A 1OQDA 1TNFA 3B93A 2JG8A 3B94A 4OUSA 1OQEA 4KGGA 2Q8OA 4TWTA 1U5XA 4F3JA 3K51A 3ME2A 4EN0A 3B9IA 2RE9A 2O0OA 2JG9B 4DB5A 2QDNA 3FC0A 4N90A 2AZ5A 2JG9C 2RJLA 2TUNA 4KG8A 5HBAA 1PK6A 1PK6C 3QD6A 1DG6A 5TSWA 1JTZX 3TYJA 2Z5WA 1RJ7A 4KGQA 4TSVA 4QPYA 1O91A 2E7AA 3AB0A 4DOUA 2HEYF 3V56A 2HEVF 4QQOA 5KWRA 4E4DX 3IT8A 2R32A 4HT1T 2JG9A 4QQ2A 3K48A 4OUMA 1XU1A 5KC6A 4QQHA 3MI8A 4MXVA 5KC5A 4RSUA 1I9RA 2QE3A 2WNUB 1KD7A 4MXWB 2WNVB 2RJKA 3QBQA 1A8MA 1GR3A 1C28A 2R30A 1U5YA 2WNUC 2OIIA 1RJ8A 2JG8B 1D2QA 1S55A 1WCKA 3LKJA 4J6GA 4D7YA 1XU2A 2X29A 1KXGA 3ALQA 3L9JT 2JG8C 4OULA 1ALYA 2ZJCA 1IQAA 5CIRA 2Q1MA
chains in the Genus database with same CATH superfamily
4MGQA 4AVSA 2VW2A 4N9HA 4LMFA 3T30A 2QQLA 4GH4A 4PQQA 2VO5A 4QT6A 4XAEA 4AAXA 3SH5A 4NIDA 4RD7A 1RUH1 1PM7A 1ST8A 2VZOA 1OLRA 1R1ZA 5FPLA 3WUDA 4ET7A 4ZS2A 2GU9A 3BTAA 4MADA 5JOYA 2FDGA 1OH3A 5KXEA 1BVP1 5IJRA 3PU3A 4XDOA 1UKRA 1KITA 1IKQA 3ZXGA 3B00A 5ABJB 2BZDA 2JKXA 3D8CA 3VHPA 2DVBA 3POJA 5EP9A 3N36A 4K1YA 3S5AA 1V70A 5K0UA 4QAWA 3ELNA 5ABJC 1VB2A 3AZZA 3LFMA 2FHRA 5D8AA 1DHKB 2JG8A 1PMJX 2W92A 2VMCA 1WW5A 4TWTA 1SQ4A 4Q0QA 2BQPA 4INDA 3S6PA 3SCGA 1W8HA 5IWFA 1ZBE2 3WZ1A 4EN0A 5BNOB 5HXMA 1GZTA 1SZBA 2RE9A 1R082 2XVGA 5I0TA 3LSDA 1R092 1RXFA 2C24A 1IPKA 3ZMOA 4ZXKA 1Q8VA 2Q8CA 3VD5A 3I59B 4BISA 2FD8A 4DUVA 3MDPA 5I8YA 2Q0AA 4P9JA 3T4VA 2VOKA 3ZSMA 1VBC1 3R6SA 4HKLA 5EV7A 5FY5A 4NIGA 4BQWA 5FZHA 5DDJ2 1QH7A 2NLRA 2XJSA 3B69A 2WJSA 5BNNB 3DCQA 3SXWA 1GYKA 1LGNA 1G86A 1E5IA 4AVBA 3DKWA 5BPXA 1W6MB 1GNYA 2PAEA 2ZX2A 5LBCA 5BNNC 4FFIA 2ZTNA 1VBD1 4IEOA 2WS92 2HWF2 3J8F3 2EIGA 4DOUA 1COV3 2V72A 4L8QA 2VNVA 1O3QA 3MLJA 2X5IA 4P9YA 1KDKA 1OURA 1POV3 3I49A 4QX2A 2Y6JA 4JRLA 4L0PA 4BA6A 4DXZA 2DUOA 1KJRA 1PGL1 4DUWA 4MVTA 1W8OA 2A75A 4GH4B 5A3TA 3OGSA 1AR62 3SC7X 2ZOEB 3K48A 4HLTA 4CUGA 2GMMA 4CU8A 3UGGA 1CJDA 1FPN3 3H42B 4J1XA 4CCMA 3EMRA 5FP4A 3TN92 4QHZA 4QGLA 2YPJA 2JICA 1STMA 4CCCA 2H6BA 3GJAA 5F7UA 1GZWA 2RJKA 4NHKA 2VMGA 2DVDA 4KL1A 5FZKA 5FPBA 3KVBA 4IL7A 3PUHA 4YLZA 4HK9A 3LPGA 4FXKB 2AUYA 4Q4V3 1OPOA 5K0UB 3HMYA 4B3NA 1S0FA 5D8AB 5I8SA 2JG8B 5FCCA 3W21A 2DV9A 4OI1A 4YM0A 5CU1A 4YGDA 3HN1A 1W3XA 1YQ6A 2PHTA 4K40A 4QM8A 2QDRA 5K0UC 2FDFA 4GWNA 5D8AC 4FSJA 3Q8AA 2JG8C 1UAIA 3OPWA 4HL0A 4COWA 2C6SA 4QPGC 1XJAA 4XZPA 5FUPA 3IN9A 2HYXA 1XSQA 4FPYA 4U36A 1D0GA 3LA2A 4RA0A 1GWMA 1WBLA 4ATEA 5H9SA 1LESA 1PZ7A 2I2SA 1AR82 4Q29A 2R041 1RXGA 3APBA 3MW3A 1UX7A 4IEQA 4YW1A 3HEIA 1TME1 3AYDA 3NJVA 3QOPA 2OZJA 4DIQA 1P8JA 4RGKA 2WNVC 3DN7A 4K21A 4CUCA 2X09A 2R071 5L9BA 2W47A 4HG6B 2D43A 2ZKNA 4LKFA 3S30A 3WDTA 4WBBA 1Q8QA 2X5IB 3VZJA 5C71A 4PQ9A 2IXCA 2DFCA 1VE0A 2MEV3 3SCHA 4QX7A 3MZHA 2BP6A 1HDKA 1Z7S3 1Y3TA 1RUJ1 2O8OA 3PVEA 4LHNA 4PF5A 3K75B 3WINE 4DB5A 3FC0A 4EWAA 5CG8A 2X5IC 1DQ2A 2RMU3 3VBUA 1CONA 4I09A 4BK4A 4FVVA 2WAAA 1QDOA 2CWSA 4FP2A 1EY2A 3V65A 4DEVA 1JXNA 2PMWB 1POV0 2RDSA 4IGPA 3D6EA 3VKLA 4CP0A 3IDEA 1HJFA 1N3QA 4FT8A 1GZWB 2WKKA 4XUPA 5K7PA 5FQ0A 4HVRA 3VBFA 1YXWA 5CFDA 3R4DB 4RGGA 4GAZA 1HW5A 5DUVA 1DLCA 2HWC3 2CGPA 4Q1RA 4GB31 4CYDA 2QQMA 2ZZQA 4LKSA 5JAXA 2ET7A 4MGYE 1W8ZA 1AX2A 3AYEA 4MZUA 3ENRA 4KU8A 3WNKA 5I8TA 1HRI3 1S0BA 1YUDA 2VR4A 3OPZA 5FK7A 1XRUA 1R1A1 4M3CA 1WBFA 1SDDB 4QDRA 1OXCA 1NKGA 2RS33 1DGRN 1HB2A 1C8NA 4OI2A 2BNOA 1PNGA 3AKRA 1LHVA 1Q56A 2J1VA 3NV1A 2D3SA 4KBZA 1SBEA 4DXTA 2J42A 1FV2A 4UXAA 1NX9A 2VOWA 3I3BA 2DFBA 4LTAA 4OI0A 1AZDA 2ZMKA 1APNA 3QBQA 2DBNA 5HV0A 2HH9A 2XLGA 3PDQA 1NG0A 1VMFA 3I2JA 1RJ8A 3VBRA 4M4RA 4Q0VA 4QXKA 3C3VA 5FRAA 1OUXA 1O59A 3WF3A 5HCHA 1VBB2 4LHLA 4D7YA 2X29A 2CV6A 1ULDA 1KXGA 2EXJA 2HWD3 3PNAA 3ALQA 4JQRA 4BZ4A 5JCTA 4NUBA 2NQYA 5FWEA 3T4HB 3O1PA 1W6PB 1Y9MA 3VBOA 3VKMA 4AFAA 1VPHA 2CAUA 1QJU3 1S0CA 4DQAA 2A6WA 3VBUB 2XBO3 3URFA 3C7GA 3JD73 3KHCA 1WCUA 4FTSA 5FKCA 3OTFA 3AM2A 1FXZA 1Q43A 2E33A 2EXHA 1OMIA 2CTVA 1FATA 3VBUC 1T6BX 3IIIA 1DYPA 2VAUA 3IIAA 1NA1A 4XEZA 1S0IA 2VNRA 1CZVA 2PAKA 2VG9A 5FQ0B 3VBFB 3LSEA 5CFDB 5FY7A 5A7OA 2J1AA 4JCKA 3LEGA 3W9AA 4Q4W1 1BK1A 1YHFA 1TNFA 4KGGA 4N53A 4LBJA 3K51A 2Y8KA 3VBFC 5CFDC 2W39A 2WABA 1DGWA 2AEZA 2IVIB 5ANNA 3PVOA 3H9AA 5DUUA 4M3CB 5G04L 3AJZA 2P3KA 1DZRA 5FYTA 4NR1A 3WDWA 5FOBB 2VULA 1PO13 3AMNA 4LBNA 1VBE3 3WUCA 2QQWA 4Q4Y2 1DQ4A 3CHXA 3HQXA 4JGYA 1QOSA 2UY9A 3QLQA 1HQWA 3OBTA 3WNLA 1SACA 5F8PA 5LK5A 2LALA 3AKQA 1J59A 3FJSA 2VQTA 5JR2A 3R4UA 1JU3A 3MO4A 1WA4A 4A3XA 2QJVA 1GOGA 2VBDA 5FYYA 1CGPA 5FXXA 4BM8A 1J58A 4JDMA 2VD7A 2PYTA 2QBXA 1XYOA 3VBRB 4IW3A 2E31A 1VR3A 1SFNA 5FZ8A 4IEZA 1LNSA 2VUDA 2WBKA 4BQYA 2OQ6A 1PNFA 2HEYF 1WCSA 4CEWC 2D6MA 3VBRC 1NE4A 3CBNA 4NPLA 1E5HA 3VBOB 2VZ3A 4B4RA 5JOZA 2L9LA 3IT8A 4XJ8A 3BI3A 2JG9A 3GM8A 3KZ4C 4YW6A 4LUKA 3ACLA 5I0DA 2NYYA 3T3YA 3E6BA 3VBOC 1RUD2 5E88A 4Z2WA 4LOSA 1ASJ2 1FI2A 1PVC3 4S2GA 4Z82A 5FMOS 3WXPA 1LOFC 1EAH1 1BZWA 1I9RA 1UYYA 2ZABA 5JUVA 4XF4A 1BXHA 5D21A 1RUF2 1NA1B 4BK5A 1JW6A 3HQUA 4FFFA 4LBMA 5J36A 4NO4A 1JYVA 2NM1A 5FZOA 4P02B 2WRAA 5HCBA 3U37A 2VUJA 1H6XA 3FN9A 4Z8BA 1QJY1 2FCVA 1BEV2 1IS4A 1OOPA 2P6CA 1AYM1 2DTYA 4N53B 2NMOA 1YIFA 2GNTA 3A21A 4FPEA 4PJYA 4WZFA 3DV8A 1QJX1 1VALA 3Q9OA 5CVRA 5A6YA 1CPMA 3MUY1 1RUH3 3V64A 4GD4A 5FYSA 1UX6A 3OCPA 3UV9A 2ZGRA 3BCWA 3M1HA 1UMZA 4UFHA 2FDJA 5EJ1B 1W0OA 4CRQA 1DQ6A 4OCTA 4NRPA 1H2KA 5F39A 4QKNA 4FOYA 4P9LA 3WNPA 3TRSB 5JPMB 2RDRA 4JGYB 1SLIA 1RUC2 5L7OC 4M0HA 4AK3A 3F95A 4MSVA 3WLUA 3RZZA 2DVFA 2GALA 4JGYC 3UK9A 4UYBA 3JBG1 3A0KA 3IMNA 1RUG2 3E6CC 2Y33A 4W4ZA 1LHWA 5B4XA 2SLIA 4QKDA 1ONAA 4ZU5A 1RHI1 1NCRA 1WW7A 5T5LA 1D4VB 1RINA 3D5OA 2Y38A 1WCQA 4LK7A 2V09A 5FYMA 5JZGC 1XYPA 2ETEA 2HWE1 1VMHA 1US2A 3Q8CA 4HBNA 4OUSA 1AYN1 5GLUA 3AVSA 2Q8OA 1SFYA 5GLWA 2ZXQA 3I2GA 4AHZA 4JRAA 1RTVA 2WNEA 4IEWA 3J7LA 4JQTA 2VMFA 1GMMA 1VBC3 2ZS6B 4I02A 1GLHA 1KS5A 2JG9B 1MACA 1J1TA 1ZA4A 4QDQA 1N1TA 2VTXA 1W8NA 2BEOA 3KT1A 4CU6A 1JZ8A 1X8EA 5F3CA 1W9TA 4XUTA 2JG9C 1W3VA 3WQ0A 2D6OX 3PJQA 5A3MA 3IPVA 5T5JA 1Q8SA 4YM1A 1GUIA 3VZKA 2OUHA 5FMOL 4YM3A 2EALA 4JC1A 1DQ1A 2E6VA 2VU9A 4QB1A 1VBD3 2XOMA 3I54A 2Y60A 4BIFA 3NWKA 5FZOB 4GWIA 4YW5A 4JVAA 2W1QA 2WWUA 3ZSEA 5IYYA 5T54A 1CJPA 1I5ZA 1OOPB 3BU0A 4EN7B 3THPA 4YW2A 1YQ2A 2WL1A 2ZGTA 2Y26A 3I2OA 3A4UA 2WO2A 1C1FA 2Z79A 2IXHA 4XIKA 3J7MA 4XW3A 1LENA 1OI6A 1OOPC 2ENRA 2WIIB 4Y4YA 2AEYA 3WQBA 4B4QA 4YSFA 2B8MA 3NL1A 4RN5A 4PLMA 4AFCA 4BOWA 4H7MA 4Y24A 3FUQA 2VVDA 1JOPA 1VBA1 4FPHA 3SH4A 5IK7A 2ZGQA 5EYYA 1YFYA 3VHNA 3WY6A 1MVQA 2UYBA 4MH0E 1SLCA 4MXVA 2RR12 4YYOA 2HWF1 1RUNA 2WSVA 1O4YA 1WD3A 2D97A 3AFGA 3CF6E 4IGQA 2P3YA 4SLIA 2GNBA 4COZA 5F37A 2LRPA 2PHXA 3VZMA 1QQP2 2XQRA 4E9KA 2V73A 2R062 4PHZA 1XE7A 2VZQA 1A8MA 4DS0A 1NCRB 2ZX1A 2Y6GA 4HONA 2XDVA 3MFCA 3WW1A 1N1SA 4OFGA 1U5YA 1UOJA 2ZX0A 1IKPA 1D2QA 5J3UA 5LA1A 3KCYA 4A7YA 1IS6A 1DP0A 1ZZ9A 5FO8B 1NCRC 2ZGPA 1JS9A 3GZEA 1J3QA 2OKXA 1WMXA 5FUIA 1ENRA 3H0OA 1JZ7A 3SKJE 4HKWA 1H2LA 3ZLIA 4UW4A 1N47A 1G6NA 4Q1PA 2N7GA 2ZJCA 4UFJA 1JOJA 4O7XA 2W68A 2ZEXA 5FWJA 1GQGA 4IEVA 4H14A 1TNRA 1TME3 2YB7A 1HKDA 3GGLA 4Q4X2 5IK8A 3VB9A 3SMHA 4AF9A 3DEMA 4DNYA 2D5HA 2ZAHA 4XQDA 2KA3A 2XONA 4XILA 1PZ9A 5CB7A 2R0FA 3LEMA 3IPVB 2A1XA 5LBFA 4A45A 4ZHNA 2VTXJ 3UKTA 3C8XA 1N1VA 4N7IA 2ZAAA 4Y5Z0 5DAVA 2R073 4A7ZA 4FCAA 4OMDA 3GDBA 3BPSA 4XC9A 3O14A 2J1UA 2Z69A 2LUWA 3PMEA 4XFCA 3LE0A 3RYKA 3ZYGA 3GCXA 2AREA 3KV9A 2A7AA 4KBBA 1CZTA 2XJPA 4LEJA 4HPKA 1AR71 4MOAA 4ISRA 1JUHA 3VHOA 3J7HA 2IWGB 3L2HA 4QMAA 5FZ6A 3MUZ1 4NRMA 1RUJ3 3UJOA 2PQSA 3JB8A 1POQA 4YFZA 5LCWL 1N3OA 3WG3A 2W08A 2PN5A 1JN2P 2YU1A 1RUE2 3WX5A 2ARCA 2VZSA 4EN9B 5AVPA 4P08A 4QDSA 2QDNA 4FQZA 1OA3A 1PMHX 2EAAA 1F4AA 3OEBA 3CDZB 4XETA 1ZBA1 3HN3A 3N7MA 2XGXA 3GZTB 4XACA 4LA2A 4XFBA 4Y1VA 2JDNA 1PK6A 3KQRA 1G9FA 1Q8PA 1PZ8A 2FMYA 2VXRA 3ZIXA 4CP2A 1HRV2 2VOTA 4GB33 3NV2A 1ZZ6A 3KT7A 4EWEA 3RYRA 3KCCA 4HKOA 5IFPA 4FFHA 2E7AA 1OHFA 1H9PA 1WA6X 1R1A3 1NZIA 3I2KA 1OQ1A 5I0SA 1IS3A 3J7NA 2HWB2 1S0EA 3P5BA 4Y1YA 3BOWA 1HJGA 1RB8G 4QQOA 2YC0A 5C5TA 5J96B 4ZU7A 2ZGMA 2IXKA 2E7QA 1PHMA 5JDBA 3MIBA 2PHLA 2X10A 5IVJA 3ZSLA 1GNHA 4W65A 1BJQA 5F5QA 3S7EA 1GBGA 1KS4A 1D0HA 5EXOA 3ZDVA 4Y4RA 1NQDA 5C8CA 2YPDA 3TNQA 3ZVXA 3SNMA 1Y9GA 5AC93 1V6MA 3U10A 1H8TC 1O4ZA 5F9TA 3WP5A 3MIGA 1GZ9A 3NKTA 4YZ4A 1BHGA 2VNGA 3ETQA 1G7YA 1N3PA 1QOTA 2XWBB 3AXDA 4HPKB 1A3KA 4GQ7A 4LIUA 4B4PA 5FOJB 5IT6A 4NVPA 4ASMB 3AMMA 4R9BA 4K6BA 3MLKA 2JEMA 4A44A 4LKDA 3TB0A 1JI6A 1W9WA 1WCKA 3OBZA 1UYZA 3SEPA 2EF6A 1CD3G 4E2GA 4WVVA 5IVFA 3M8LA 1ULEA 3P6BA 3GHNA 1ZREA 4EE2A 1VAVA 5ACA1 1PO21 4BH9A 2XLFA 4GIQA 2H6CA 4GXLA 1H2MA 4PF1A 3AP7A 4JHTA 1IPJA 3IAQA 4SBVA 4CP1A 2TNFA 4Q8KA 1DIWA 2BNNA 2H0BA 2HLEA 5FZBA 4KH9A 2B9VA 1QDCA 2Y6LA 1C57A 4B7EA 4Y1XA 3RWKX 3VZLA 4E4SA 1F15A 1FMD1 1OPMA 1PK6B 2WZR3 3E5QA 4UFKA 3RQ0A 3WVJA 3AMPA 2CY6A 2Y0IA 5C9AA 4AEMA 1VBB1 4Q4W3 3WQ7A 3T09A 3WNNA 1OSGA 1DZTA 3R05A 1UMHA 4CCKA 5GKAC 5L73A 1V9U2 1FT9A 1V6KA 4LIVA 5DQ0A 4CXYA 4C1WA 4FO9A 3J8F2 2VXJA 2VNOA 1COV2 4AVVA 4XJUA 1NXD1 3POBA 4FQ4A 3HT1A 2ET1A 2JB8A 4DFSA 2DU1A 2ZZJA 1VJ2A 2VM9A 4IE5A 1UW8A 4IE0A 4KI5M 4WVZA 1LHOA 3ZR5A 1G9DA 2FMDA 1YRZA 2JD4A 3GHMA 1UNBA 2Q30A 3A23A 3LAGA 4L97A 1LOBA 1PX4A 3OPTA 4P9GA 2NZ9A 1FPN2 3LDBA 4IE7A 3P3PA 5FZGA 2F6BA 1PVXA 5FY8A 3THDA 5C8CB 5CEHA 3OUIA 4XMAA 3WG1A 3UL2A 1ZRRA 2QQIA 1QGLA 3QD6A 2VW0A 1Y9QA 4AE2A 4RHV1 3FHQA 5C8CC 2CDPA 4Q4V2 5FIXA 2B5HA 1ODMA 5JI9A 2G9GA 4XUQA 4CDUA 3O1MA 5T50A 3PURA 5EQUA 1PIV3 1W9YA 2RM21 4N9IA 4E2QA 3KHBA 5F2SA 1A6CA 3WCSA 3U75A 3GZAA 5FY0A 3LZZA 3E1F1 4W50A 5BNOC 5H9PA 2HEVF 4ZONA 5J1XA 1LAJA 1LOEA 4GULA 3GYDA 2MNGA 1HB1A 4NHXA 2QQNA 2WZPP 4ZKTB 2BV4A 2W2IA 4HT1T 1LCLA 4K20A 1EAH3 3ES1A 3N7LA 3WSOA 5F5AA 2BVVA 1JODA 4LNVA 1I5PA 1AR91 3DF0A 4FPJA 2E7TA 4F83A 2DUPA 4XBNA 3W5MA 3BVCA 5C9AB 5CKMA 2VC9A 2ZCWA 3PU8A 4FPOB 3ZFFA 3M3CA 3POEA 5GM0A 1QJY3 3PTYA 3JXSA 5A7PA 1ZZCA 1XB9A 3I3QA 1AYM3 1NY71 1OC1A 3HQRA 1D7PM 1UOFA 4F8AA 5C9AC 2EAKA 4FAHA 3HJRA 5T3NA 4JX0A 1QJX3 4NPMA 3V0AA 3ZFEA 1UQXA 1EPZA 2D7FA 2RS51 3KGZA 4AGGA 3O1RA 2WDBA 1LOAA 4PIYA 3MIFA 2AYHA 2ARBA 3NJZA 5DABA 3KSCA 1WKYA 2MEV2 1PGW2 1YFWA 2VCMA 1KEXA 1VAKA 1Z7S2 3GBWA 3LPFA 1O8SA 3KS7A 1O5UA 1QY4A 2RMU2 2OA2A 1JYIA 2BU9A 4BU2A 3WDYA 1E57A 1BBT1 4ISQA 4GH4C 3ZO0B 4CSWA 1IGOA 2YGMA 2A71A 2RG4A 3JBG3 5HCAA 3AVRA 1LOGA 3VD3A 2GN7A 4HSLA 5CYYA 5DN2A 4NOTA 4C8DA 2YXSA 4PLNA 1RHI3 2FCUA 1SCSA 1WW6A 4DZGA 3AP6A 4TLGA 1FOD2 1O6UA 4LO8A 1GQHA 2IFWA 3SEEA 2HWE3 1Q8OA 3WD5A 4E27A 3AZXA 1AYN3 4QPWA 4RGAA 5FYUA 4C0BA 1EV11 5DAQA 4HN1A 4CDUB 2B42B 3AKSA 4QWNA 4AI8A 2W5FA 1H1MA 1U5IA 3JQWA 5A6ZA 2O8QA 4EN6B 1RMU1 3N7JA 1YC61 1OQEA 1QJFA 2NMNA 3ILRA 5SV8A 1ZZBA 3CLPA 1R64A 5EJ3A 4AQ2A 4FPFA 2Y34A 1D4M1 1HRI2 2R49A 5KXCA 3CJIA 4KWUA 2GC2A 4HXCA 2RS32 3VBHA 4META 4QD2A 3D0JA 3VZOA 5A70A 5C7GA 2JE7A 2JB4A 2VVEA 3IDAA 4RS5A 4L92A 5FLJA 3DUIA 1CZSA 4HMZA 2BBVA 1ZBE3 2D93A 1L7LA 2ADEA 2O14A 1NAEA 1R093 3AK0A 5FZDA 2K9ZA 1W9SA 4ZPIA 4COVA 5GALA 5FDBA 5BY5A 5D2AA 2YY1A 3ZFFB 1US3A 1OVSA 3EJKA 1UMIA 4YGBA 4J25A 3BTZA 1KFXL 2ZHKA 3N3HA 3V0AB 3ZFFC 3ZFEB 2HBUA 2Q8DA 5FREA 2R16A 5IAVA 4OHZA 2VMDA 4PBPA 1BMV1 2HWD2 4A4AA 4ZU4A 1W6PA 2OZ6A 2VQUA 4AI0A 3VKNA 2WA3A 2E51A 1VBA3 5T5OA 3Q8BA 1UU6A 1XOYA 1RIRA 2J1TA 1QJU2 2VZRA 3KLSA 5KWRA 1XPWA 2BRTA 2LROA 1TMF1 2P37A 3I8TA 3WV6A 4E4DX 2XBO2 2JJ6A 4QQ2A 3WQ1A 3WEZA 3JD72 3RS6A 2HWF3 5FY9A 1ND2A 3WF1A 5DMYA 1W0PA 4YW7A 3LIHA 4BMBA 1ODNA 4CDWA 4D7SA 4QX5A 5CADA 5F32A 3T2OA 1C1LA 1UN1A 3NAPA 5A1FA 3N9PA 4B8EA 2ZEYA 2GZWA 1FV3A 1OD5A 5ANQA 2DYCA 4Q5OA 3CU7A 1XNKA 1SLBA 4JAAA 4AQTA 4YZ1A 3ZXJA 1REDA 3NKGA 2JWPA 5A1AA 4NE9A 1RVF2 1VRH1 3HAGA 2RDNA 1YYNA 3ON7A 3MLLA 4Q26A 3WF4A 2A6VA 3R0RA 1MEC1 1W8TA 3NQHA 3CMGA 4H55A 1DGWX 1XNCA 3DYMA 5K4LA 2V4AA 4UBGA 3WW3A 2EA7A 2PLV1 2Z4FA 5DZGA 3ZN5A 1OKOA 3NRUA 4RL7A 5E16A 4AHWA 2K2SA 3O1VA 3JU9A 3ZYHA 3AFKA 1G9BA 4X8PA 5GZEA 2CGOA 2GMPA 4P9IA 3CJIB 2QVSB 2RR11 2PA7A 3VBHB 1WMDA 4PIXA 2OT7A 5GLZA 4UFLA 1JYWA 1VBE2 4RS5B 4UW3A 4LO5B 2GH8A 2PQQA 1K3IA 2VECA 3RJRA 4AZZA 3CJIC 5A32A 4QKFA 4LULA 2BBAA 2BOIA 3VBHC 2FZ2A 2JKBA 3HOBA 3BIWE 4MGKE 1WLDA 3NW4A 1CWPA 5LA9A 2FDKA 1TE1B 1ZYBA 4QQPA 1AR73 4Q0PA 5DZEA 4LLFA 1EUTA 1RUI2 5AC91 2WNUA 2PHFA 1ENSA 3VLBB 4D94A 4BLIA 3VDDA 4I0AA 1LEMA 1WUVA 1MS3A 1KRIA 3B93A 4L2NA 4AFBA 1QWRA 1U5XA 2WFF1 1HXS2 1C8M1 1ULFA 3MV11 5A3UA 4HZFA 4OHWA 2A5ZA 2XH6A 1W03A 5LBEA 5GZDA 3K2OA 5JXJA 1RITA 2FDIA 3I2IA 2D6KA 1NUKA 2ZHNA 4Y22A 1ZBA3 3AZYA 4EQVA 1EP0A 2ZGOA 1ND2B 3CKHA 4CDWB 2HYKA 4M4PA 4N90A 5FZ4A 3FLTA 3C2UA 3WNMA 2AC1A 3B5LB 3NAPB 1DBNA 5LRSA 5LB6A 3DYPA 5KBFA 1ND2C 1IZ3A 3E97A 2XWJB 4IXLA 4N8MA 5FBJA 4CDWC 1WGPA 1H4GA 1W2UA 2WZR1 3FUOA 4GMP0 2DUQA 2DVGA 1ZVFA 2G4IA 5C5UA 2ARAA 3A22A 3U14A 4LHKA 4XVHA 5J98B 4XURA 2CNAA 4XYXA 5T5PA 2VCBA 2YFZA 1HX6A 3G6JB 4E2SA 4E4HA 3EBRA 3I2DA 2JE9A 4R9DA 3POIA 3RZHA 3AB0A 4MX3A 1LULA 4Z07A 1RUH2 2WQ4A 5KHJA 2OS2A 1W04A 2Q5TA 2VMHA 3ILFA 4GKYA 1LKNA 3VZNA 4K8RB 4YM2A 5EPAA 4QU1A 4NIHA 5A3LA 4UFIA 2GN3A 3BGAA 3AP9A 5FZ7A 5A32B 4DMIA 3VDCA 3UKNA 2ZEZA 4QU2A 1HQNA 3ZYPA 4OUMA 1UY2A 1XNDA 5H9QA 4KWLA 3THCA 5KC5A 2G1MA 2VVFA 2GDFA 3AMQA 1UO9A 4RSUA 3BPZA 3VUOA 4R9CA 3X29B 3PLQA 5FBZA 3OD0A 3RZLA 2C0ZA 2WNUB 4CA9A 1KD7A 4WM8A 3GBFA 3IDBB 2ZEWA 2C26A 3BOPA 2D3PA 4AAPA 3VDDB 3H8RA 4LLOA 5LEKA 1MVEA 2P5BA 4X6RB 4ONUA 4I0WB 1NCQA 2WNUC 2FCTA 4ZS3A 2P34A 2Q8EA 3WP4A 5ACA3 2VQAA 1PO23 5IFTA 1PIV1 1W90A 1UY1A 1YWKA 2VUAA 3ACFA 1XXNA 3VDDC 4AFMA 1J83A 1VBC2 1K12A 2BFUS 4Y26A 4BLJA 4Y22B 3RZMA 3ST7A 1PX3A 1FMD3 2WWSA 3WDUA 3MICA 3TBDA 1VBB3 1IPSA 3CEWA 5KR7A 2UYAA 3THTA 4HANA 2CU5A 3AC0A 5IAXA 1DU3D 2GP3A 2JDMA 1VBD2 2VZ1A 4FTEA 4YW3A 1HB4A 1NA1C 3ATGA 2GNMA 5ERLA 1G9AA 2B4KA 2RS11 1ZRIA 1O3SA 4KWJA 2W52A 5FTTC 1ZM1A 1AL21 1LJ7A 3LEIA 1PGL2 3RWNA 3CZJA 1MS8A 3W5NA 2JX9A 4R52A 3B94A 2VOXA 2JDZA 2W9XA 4N53C 1UOGA 4R4XA 3OY8A 2RDQA 4BIOA 2K46A 1A34A 3ACHA 4ZZ5A 2PHDA 4XJAA 2WA4A 4ES9A 1WW4A 3U0ZA 2D3RA 5CNAA 1GOHA 4L11A 1M06G 3P1IA 5DZFA 1LGBA 2Q1FA 1LGCA 1S1AA 2DWRA 4HN0A 4AI2A 3VD9A 2UY8A 4UF0A 1V9U1 2RV9A 2ZMLA 5FPXA 1W06A 3B7MA 4HSJA 3POSA 4PI0A 3ZDSA 4BWOA 4CCOA 5F3EA 4Z92B 4RHV3 2G19A 1K5MA 4MLOA 4HFSA 4CE8A 5C8WA 4IEYA 1FNYA 1SG3A 2Y6KA 5JR7B 1DQ0A 3FX3A 2OX0A 3JUUA 3D0SA 4WM8B 2RM23 2XUEA 1FAYA 1REFA 4BMEA 2EXKA 5ISLA 3KD4A 4YG6A 3K4DA 4TSVA 2C9KA 1NCQB 5KXBA 2RHPA 1VIWB 4WM8C 3RVHA 4AI1A 3O1SA 2NPIA 2YC2A 2ARXA 4D6RA 1W2NA 2P17A 2R042 1IOAA 3WG2A 4Z2AA 1NCQC 3WT3A 4AFDA 2R7EB 2QTWB 1AR93 1IQDC 4AVCA 1TME2 2CHHA 3B9CA 3C7EA 5SV5A 1HQLA 2R32A 2BFUL 1MZEA 3L2YA 3PJYA 1SBFA 4H7LA 1XQNA 3RNSA 2BW8A 3PMSA 4LR4A 2BYVE 1ZBE1 2JENA 2CGNA 1W05A 2R072 1W6QA 2WZ8A 3HD8B 3ZOIA 1FYUA 1R081 2D6LX 2PHWA 1R091 3VHRA 3EHKA 1QH6A 5GJ6A 2RS53 2EVXA 4YGCA 2ZGSA 3AYAA 3FMGA 3HR9A 5LK7B 1KDMA 1H0BA 4M0NA 3RZJA 4MO3M 3LQCA 2R0HA 1VP6A 2P3JA 3N9MA 4XFIA 1K42A 1SHWB 1LHUA 5HV4A 2BWAA 1X9TA 3OUJA 4HK8A 2KR2A 5DDJ1 1RUJ2 1CX1A 3KV5A 3H7JA 1CVNA 1UY4A 3ZKYA 4J6GA 4CDQA 3VBSA 3OY8B 2UWBA 1BBT3 1HLCA 1W8FA 4S2DA 1F31A 3H1WA 1YFXA 2ZGKA 4OULA 1IQAA 2WO1A 2LW8A 4GMP1 5EZWA 2LS6A 3ZSJA 2YUEA 5BNPA 2WS91 4S2HA 4UF0B 4X8NA 5CKNA 2JDYA 4XIOA 2ZACA 3BYWA 1UXZA 1K5MB 3I7DA 1X82A 3T2QA 2XR4A 2D5FA 5FMCA 1U5ZA 1EV13 5IVYA 4P14A 4CDXA 4CVUA 3M3EA 1QXRA 4GB32 2CSGA 3M7AA 4NAMA 1RMU3 1K5MC 1ZZ8A 1G8WA 4L9BA 2XVLA 5FLHA 3OBRA 1AR61 3FL7A 1AUYA 1C3HA 5FYZA 4BQXA 3TAYA 3ABZA 2D40A 1D4M3 2QFEA 2YZ4A 3EB7A 4D69A 4LT5A 1R1A2 3B02A 2QUOA 4TXWA 1L7QA 4FPGA 3H3LA 4MHUA 3TN91 1BKZA 3HNMA 2KD7A 2XMLA 2XQXA 1PMIA 4KNCA 5DUWA 3NNMA 5FV3A 4FFGA 4YPJA 2O0OA 3JB4C 2GC1A 2EICA 1UY3A 1FOD1 5FP3A 3T08A 2BVBA 3SHRA 4QPIA 2A6YA 5CA6A 2YROA 3K3OA 4I3GA 1URXA 4LQRA 5JIUA 2C9AA 3WF0A 4QGMA 4A6OA 3B01A 4DEQA 4DO0A 5T55A 2AZ5A 1W6QB 2Q1ZB 3H8XA 5JVVA 1DFQA 4UOJA 1QHDA 3MIDA 4JV4A 2J1SA 3LIGA 1UIKA 1Y43B 3VDBA 4XXAA 1UPIA 4AEDA 1LU2A 2B39A 1CX4A 1Z0HA 2X8KA 3WP6A 1BK0A 1AR81 4BB3A 3BTXA 2A6XA 2B9UA 4AG4A 4AR2A 4AHYA 4CZSA 1JYTA 3ASIA 1TMF3 5FPZA 5C4WA 3T0BA 4CDQB 1ULGA 5FP7A 1H4HA 3SCFA 3VBSB 2MPFA 4IV1A 3GALA 4NIAA 5KHHA 2BDRA 3EQEA 4I2OA 3ZPOA 4CDQC 1GP6A 3VBSC 3EYPA 2VCCA 3BN6A 3DGTA 5BNPB 1VRBA 1MS5A 2PHRA 3H50A 5FP8A 2VBPA 4DRVA 3IAPA 4QX0A 3ACGA 4FPLA 1VRH3 1CR7A 4D6QA 1XU1A 5KC6A 1UYXA 4Q4W2 4LK6A 1MEC3 1X36A 4QQHA 4CDXB 4GWMA 2BTVC 3TEZA 3VKFC 1CQ9A 3NNLA 3AJYA 2BGCA 2CDOA 1ZRCA 2E63A 2PLV3 3O0WA 5LA0A 5EWSA 1ENQA 4URTA 5GZFA 1T6GC 4AGVA 4YWAA 4EYUA 2Y64A 4A7KA 4XUOA 4CDXC 5F5CA 4D3WA 2YGLA 1UKGA 4FOWA 2VGDA 2RR13 2YDEA 4MYEA 4NHMA 4XXPA 5A1LA 5BUVA 4FPKA 5F1RA 1VMJA 5CBLA 3RG0A 2X53S 3TEXA 4Y3OA 2R063 4QHBA 2WT2A 4C0HA 3J4UH 4XFAA 2V5DA 3TNPB 2VL4A 3M3OA 1SLLA 1V6OA 3L9JT 4RR3A 2NN8A 3C7HA 4W6WA 2W0XA 2VJXA 3FZ3A 1RVF1 4QPIB 1J84A 4E8DA 3RMXA 5JSRA 1AHSA 3NJXA 1H9WA 4IEPA 5JXGA 1JUIA 2XXZA 5IK5A 4G4FA 5GZCA 3MPBA 5F5IA 3CL1A 5J09A 3LDRA 3MF6A 1V6JA 2W94A 3AP5A 1W6OA 3KGLA 3ES4A 4QPIC 3BB6A 3INAA 4WVWA 1A78A 1YCIA 3NVCA 1EPWA 2G9FA 4AEDB 2WQZC 4Q4X3 4BQ3A 3CIHA 3S57A 5L19A 5CISA 4COUA 2WFF3 4DUXA 1C8M3 4KQ7A 1W2OA 2WLQA 1F4HA 3H3UA 4I30A 5CAZA 3M70A 4AEDC 2E26A 5BNQA 2VZVA 5C4WB 3AZWA 3K77A 4OHVA 2JD9A 5F6KA 1WMEA 2WR9A 5FK8A 1KQRA 3QH7A 4IV1B 2OUJA 4CCDA 4COYA 2YG0A 5FZFA 1EAH2 3ZXFA 4MV2A 1RUI1 4LO6B 4JKLA 4IV1C 4S2FA 3OBAA 2ZGUA 5J7MA 2VPVA 3LF7A 2Q4SA 3N4MA 4DY5A 4AEJA 2JIJA 4EWDA 4OHXA 4LKEA 4JTNA 4XE9A 2DBIA 5FZLA 1QJY2 3T2TA 2XL9A 1PK6C 3KM5A 3H1YA 1BVVA 1AYM2 2XUMA 1HXS1 4LE3A 1NOVA 4QGNA 4QB2A 4XCAA 4YZ3A 2ZGLA 4GA9A 5BXXA 1C4RA 4PDWA 4QX3A 2A6ZA 4IUGA 5LASA 1RJ7A 1UD1A 5FZAA 1NYWA 3KVAA 4IQPA 4PT6A 4IESA 4UAPA 4QHOA 5CKQA 2R1BA 2WYFA 1O91A 2E53A 2VE1A 1YO8A 3UKVA 1UPSA 2VY0A 4RR3B 1QKQA 3D3AA 2WQ8A 5G05L 2DURA 1F5JA 4UW5A 2ES3A 2DF7A 2W91A 4URAA 3U4XA 1YLLA 1ZX5A 5J48A 3JBG2 2E32A 4RR3C 1LEDA 4BCUA 3KV4A 5I0RA 2A3YA 4XHBA 3SITA 1MZ6A 3MYXA 1RHI2 1W6OB 2O1QA 2D6PA 3ZM8A 4E8CA 3MEPA 4LO7A 1MZ5A 2HWE2 4XDQA 1AXZA 1AYN2 4FP3A 4BXFA 4XJWA 2XPJA 3N35A 5LW9A 1HV1A 3AZVA 4Q4Y1 2EIBA 1H30A 1WLWA 3AL5A 5FO7B 5LRRA 4EROA 1GOFA 1GQPA 1C28A 2BJSA 5T52A 1OT5A 4UT5A 2XG3A 3T1MA 4BQ5A 1VB4A 4HOOA 2Y0OA 1Y4WA 4XBQA 5E6HA 4AVTA 4CPBA 4Z1VA 5C3PA 1LB2A 3OSDA 3HNYM 3FE5A 1AX1A 1O8PA 5HCFA 4XZUG 5A7QA 3RYPA 2DCZA 5IK4A 4PI2A 3R4SA 2DVAA 5FZ9A 4IE6A 1NT0A 3AKTA 3MW2A 3P3NA 1K45A 1GNZA 3BUCA 1ALYA 4QM9A 2EIDA 4QPGA 2I07B 3PVNA 5FZ0A 5GLTA 3IM0A 5K8SA 4I3PA 4Q0SA 2XKOA 3I2HA 3LOIA 1SPPA 4KWKA 4OZOA 3QH6A 4CTEA 3I97A 2JDAA 3QCWA 4AYUA 5FY4A 1M4WA 2PHUA 3ZFGA 3MFAA 2RS13 2PAMA 1UYPA 4UWDA 1DQ5A 4LHSA 4XF9A 4Y20A 1OA4A 2Z42A 1AL23 4DXRA 1C5IA 1CIWA 4N43A 4R9AA 3C7OA 3USSA 5C3RA 1BQPA 5F6LB 1JYNA 5A6QA 4BE3A 4PDWB 2WNVA 1JBCA 3IDCB 5D1IA 1RUD1 2VBBA 3ZXAC 1QOOA 1ASJ1 1S0DA 4W6XA 2YU2A 1W39A 3NSTA 4CEYA 4PDWC 4LXLA 3LD8A 2GH2A 1RUF1 1VBA2 3FLRA 4UBHA 3HT2A 3WOGA 1V9U3 3B9IA 1W6NA 3OGVA 2BGPA 4R8HA 1QNYA 5A6XA 3VKOA 3F2ZA 5A3PA 1BEV1 2XL7A 5C6CA 5CG9A 1UU5A 4AQ6A 1SDWA 4QKBA 4YVWA 4P00B 2D98A 4V2VA 4OQ9A 4AI3A 5EJZB 3ZYRA 5A3WA 4AOCA 3DYOA 2V4VA 4LBLA 1QMJA 5FZMA 5DG2A 1S2KA 2HWC2 1IG3A 5A33A 4LITA 3PUAA 2CL2A 3ECQA 2P1BA 2Z5WA 3B3QE 3PIJA 3WW2A 3NNGA 1QXPA 3IZOA 3RRDA 4ORFA 3I3EA 4CDUC 1W99A 1RUC1 2P6HA 2XJRA 4OQ8A 3KF5A 2YBSA 2P2KA 2JDHA 5IHRA 1BYHA 1VAMA 1J3PA 1YI9A 2IFRA 4XQWA 1MS0A 3MGUA 4AXOA 4NROA 5C3SA 2XB6C 3A7QA 3QACA 1LU1A 1RUG1 3D82A 4ITCA 1UWWA 2WT0A 1OLMA 1UXXX 4I0BA 4FPCA 1W9FA 2IXIA 3LEKA 4P5HA 4QPGB 1QIQA 3PHMA 1CAWA 1R083 3W20A 1TG7A 1SPPB 2XJUA 2BPA2 2GAUA 1QJZA 3ZN4A 3LGRA 5JXIA 2PFWA 3ZFGB 1BCXA 4A41A 1AR72 4ZZ8A 2GMEA 4Y20B 2IVJA 1GANA 3M2MA 3DL3A 5FAXA 3O1OA 1DZQA 2QE3A 2XKPA 2DCYA 4N43B 4Y33A 1S0JA 5DDJ3 2W46A 3ZFGC 2WNVB 3NMBA 1UZVA 4YRDA 1UL9A 3FWEA 1GR3A 3SQOA 2XJVA 3NO8A 5DAXA 4N43C 1KJLA 3ZFEC 3WNOA 2R30A 5F3IA 4CEYB 4XCBA 1LHNA 2KXLA 4JHZA 4GMP3 4QXHA 5JIAA 3FLPA 3LKJA 4LOTA 1QEXA 4DRRA 3ZXLA 2WS93 4BDVB 4CPBD 3CQOA 1W6NB 2XVKA 4A3ZA 5CZKA 5I93A 1ZBA2 1V6NA 5E1RA 5H9RA 4UFMA 4MHRA 3U11A 2DTWA 3GZUC 2PELA 4CEYC 4ASLA 1X8MA 3KCXA 4XMIA 4CU9A 4XHXA 4ATFA 4PCRA 2YYOA 3IWZA 1OKQA 1TVGA 5C70A 4MGSA 4YVWB 5LY1A 4CCLA 4JZRA 2YHJA 3N9LA 1OFSA 1W8WA 1AR63 1W8UA 5KXDA 5IVVA 5JXHA 1ZRFA 3M3QA 2XLAA 2V5YA 3VL8A 5A33B 4YVWC 3BODA 4WV8A 1XC6A 3TWIA 3AL6A 4KMQA 3CNAA 3TN93 1A8DA 2VOVA 5FXVA 1V00A 4BXSV 3VD7A 3FFZA 4NN0A 2NP0A 2ZA9A 4XPVA 1L3JA 3HVDA 4Y1ZA 5JSPA 1OQDA 5L36A 2J7MA 3FFQA 1IS5A 1GU3A 4NJ4A 4IE4A 3ZPYA 2ADDA 3V0BA 5F3GA 1FOD3 4WM7A 4BYYA 1PO12 1GSLA 2W3JA 2XHKA 1MS1A 1QQP1 3GBGA 2R061 3I2FA 4MGIE 4XJ9A 1CAWB 1SLAA 5IVBA 2IZWA 4RS5C 1OFNA 2UU8A 1QNWA 4YVSA 1SMVA 4F7ZA 3RZKA 5FZCA 1ZRDA 1RL3A 3ORJA 5AVAA 2YV8A 1H1IA 2CYFA 1LOCA 2RJLA 1CPNA 5E8AA 5GZGA 1UY0A 3K4ZA 1GV9A 3ROUA 1OA2A 1AR83 4OLLA 3ITQA 1WMFA 4B7KA 4AW7A 2W1SA 1RUOA 1AF9A 1NLQA 3LWCA 1PM4A 3OF1A 4DINB 2A3XA 3O1UA 3SH3A 3H1MA 4Q4X1 2HBTA 4N7UA 3KQ4B 1KFUL 2TBVA 2W95A 4EV0A 3HNBM 4XFHA 5IVEA 1W0NA 5ACA2 1PO22 2WUHA 1UZYA 3U4SA 2BGOA 2RJ2A 2X05A 4QPYA 3USUA 2ORZA 3ZYIB 1XSRA 5EHDA 3WG4A 1DGRA 4EZ4A 2F4LA 1GZCA 2FQPA 1GFF2 1MR5A 2PXJA 5LY2A 4XTPA 3RI9A 3V56A 4CEWA 5E89A 2H0VA 3UT0A 1JMUB 1PVC2 1FMD2 5I91A 1JYXA 4NPRA 5JOXA 4X6QB 1UZ0A 1REEA 3ACIA 1AXKA 3E5XA 4CU7A 1OBNA 3PUQA 4MGTA 5FR3A 5KHKA 1DYOA 4XFGA 4BJ0A 5HPOA 2P3IA 1E5RA 1ZNPA 1ACCA 1H6YA 4LUMA 1GKBA 4IERA 3NAPC 4TN7A 2WT1A 2BWCA 5DAWA 1V6IA 1LOFA 2QQUA 4NWVA 4U2AA 5FYCA 1PGSA 1RUE1 1OLME 2AH2A 2R1DA 2ZX3A 3E6DA 4XABA 4HVQA 5IVCA 2VH9A 5FY1A 4FBFA 1GWKA 5EFUA 1XE0A 4G9SB 3HWJA 5DG1A 3LA7A 4BPZA 1UOBA 3OGGA 1YFUA 5LEJA 5FO9B 1SBDA 3GXUA 3PTRB 3V0BB 1ULOA 3N9OA 3POGA 4WM7B 4EJRA 3DKQA 1RVF3 3WF2A 5EIYB 1YJLA 3C7FA 3POYA 1GP4A 4CXWA 3VD4A 1HRV1 1OLQA 5A80A 1U12A 5DAPA 4XF3A 4LORA 4WM7C 3UNPA 4QXCA 2EIEA 1HN0A 3OG2A 4YVSB 3NV4A 1O3TA 1HN1A 4YW4A 2WZEA 4RHV2 2OVUA 3HBZA 1BLZA 2W1UA 4WZCA 4EZHA 4YG3A 3ZYJB 2HWB1 1SFPA 4XTMA 4QX1A 3JQXA 4YVSC 3ZN6A 5L7OA 1ENXA 1CESA 2ZPXA 1QJEA 2RM22 4K9SA 4QXBA 1W2AX 1XNBA 2SBAA 1C5HA 3AXEA 3DPRA 5FZ1A 1MQTA 1ULCA 4G3YC 4CP9A 1F5FA 3ZKUA 1B09A 5LBBA 5LZ6A 4YGEA 2P4EA 1QF3A 1DGLA 5K9YA 2GSYA 1YI7A 3WHUA 1XNTA 4K1ZA 1S4CA 3USUB 3OEAA 4IGOA 3HPNA 5JZGA 5FMBA 1RUI3 4LPLA 4F3JA 1MS9A 4GJZA 1AR92 4CEWB 3ME2A 4QB6A 1Y7BA 4D0QA 2HKXA 1E5SA 3G7DA 1X7NA 2DCJA 1K5JA 4OYUA 4PLOA 4B1LA 3OOXA 2ZMNA 2WYSA 4O9GA 5JMCA 1CAXA 4M00A 1NY72 1HXS3 4R4ZA 1QU0A 2VCAA 4NRQA 5FPAA 5A7WA 3ETPA 1DDLA 4QX8A 1AX0A 2BUKA 1EYBA 2I74A 4KG8A 1AJOA 2RS52 1O7FA 3EO6A 3GF6A 2EXIA 2FDHA 4LO4B 1S0GA 1N1YA 4C1XA 1DG6A 1YQ8A 3SKVA 2RVAA 2TEPA 4J1WA 5JI7A 3ZXDA 1JTZX 3TYJA 1CAVA 1NLRA 2ZX4A 1SEFA 3OYWA 4FXGB 4DPNA 2GNDA 2A73B 4C90A 4NAOA 4XBLA 5FPVA 3RMYA 3LOBA 2OYZA 3E5UA 4XF1A 1JYCA 3A0NA 3ZMNA 2Z2SB 4M3CE 2JDKA 5B2GB 2JDUA 4V1PA 2XJQA 1KGYA 1NZCA 1XYNA 1BBT2 4NWWA 1ZZ7A 2QKDA 3O0XA 5FLIA 5BYNA 5FZIA 1CN1A 1I6XA 3MIHA 2VMIA 5JMOA 1GWLA 3OB8A 3SISA 3J8F1 1WD4A 3ZXEA 1COV1 1YJKA 1DLLA 2WO7A 1RYYA 4OVEA 4ES8A 5CFCA 3LFIA 1FNZA 4JDOA 4Q8LA 4CUBA 4ZY9A 2W1WA 1EV12 1JZ6A 1POV1 2ZBJA 3POFA 4E4ZA 1W28A 4YNIA 3ZN6B 4YZ2A 5L7OB 1SCRA 1OD3A 4Q4Y3 2WNOA 3S0MA 3GNEA 3LA3A 3S7IA 5FJKA 4BHPA 1RMU2 2VW1A 3DPRB 3LB9A 5FXWA 3RJ2X 1JZ5A 1JZ3A 1MQTB 4CP9B 2VZPA 2OQ7A 1Q3EA 2W87A 1D4M2 1X50A 4AEKA 3J26N 1FPN1 2AR6A 5JPNB 2CAVA 5IUQA 4NHLA 3DPRC 3ZXKA 4CCNA 3KB5A 3OJBA 5A7SA 3TEYA 1MQTC 3OGRA 4XFFA 5JZGB 2QQKA 3K3NA 4ZXEA 5JOWA 2AENA 2BNMA 3O7OA 2YBKA 4IDZA 5FYVA 5FZ3A 2WINB 2WAOA 1XU2A 1UIJA 2C1FA 1OVPA 4O9EA 5J37A 1OF4A 4Q4V1 4V2WA 2Y6HA 3W58A 1UF2C 1NXMA 4GWJA 3T2PA 5CIRA 2DCKA 1WLTA 2Q1MA 1CAXB 4GKXA 3AP4A 4K3UA 3JZVA 4AWDA 2J1RA 5A7WB 4NMIA 3CJXA 3UJQA 1YQ5A 1HIXA 4UI9L 4YARA 4MG2A 4NIIA 5M0TA 1RUD3 2HEWF 1ASJ3 4RQPA 1RC6A 1JOBA 2G9ZA 5DUXA 5FUNA 4XQ4A 3WHTA 4UW6A 4Q2FA 4DXSA 5AFEA 1H1AA 1BMV2 2WN3A 1CAVB 3KMHA 3H8OA 1IG0A 2A3WA 1JH5A 2E9QA 3OYWB 1WLCA 1RUF3 3N7KA 4MXWA 3ZX7A 1TZOA 3OD4A 4KU7A 2YC4A 5IATA 5LWBA 4OUEA 1TMF2 1S2EA 1L7RA 4B1MA 1SLTA 4IEUA 2WO3A 2UURA 3TOJA 5KHGA 4O65A 1BEV3 2VTFA 4B29A 2OXBA 5L9VA 3T0DA 1JU4A 1NQJA 5FZEA 3H3ZA 3BIEA 2ERFA 2OW4A 3I4IA 1AL0G 1EUUA 5A3OA 2IUWA 2OPKA 2UWAA 4LE4A 4D8MA 5CFCB 3RZGA 1XNAA 4A42A 5AFBA 2WC2A 1VRH2 4PIZA 2FZ1A 4Y1UA 1AXYA 4XDPA 4KG0A 4RFT0 2JIGA 1MEC2 3KF3A 5FXZA 5HI0A 2MEV1 1WCDJ 5CFCC 1ND3A 4Q0UA 1PGW1 2QCSB 1Z7S1 3Q8EA 1NE6A 2PLV2 3MHZA 1RUC3 1UU4A 2RMU1 2XJTA 4MUVA 4ARXA 4YFWA 4M01A 4AHXA 4XF0A 1LODA 5LA2A 5FKBA 2ID4A 3K46A 2J1EA 3IBMA 3UGFA 4XUNA 1RUG3 3M3IA 4AL9A 3HBKA 3T0AA 2FBEA 2AACA 3N9NA 5C3OA 4AQSA 5JLVA 4IV3A 4OI4A 4HETA 4W6YA 4D6SA 2I45A 3MF9A 3ZSKA 5FJHA 2VUCA 2LTNA 2QQPA 3KT4A 2DCTA 2WN2A 3LDKA 1Q5OA 2BERA 3O0VA 4IETA 5IW0A 4GZ9A 2HWC1 2A70A 2ATFA 4GJYA 2MHFA 4A2UA 4LA3A 5AC92 3FBYA 4EN8B 1DCSA 3DECA 4LBQA 2R043 2DU0A 2ZKLA 1LECA 4CXXA 2QQOA 3N9QA 1YIPA 1HRI1 2ZHLA 3O5SA 4P9XA 4WVMA 1W2TA 1B35A 1RGSA 3T1LA 1G9CA 3MI8A 2QQVA 3NV3A 4RQPB 2RS31 1QXJA 2Y6FA 1CAUA 1O5LA 4JKMA 5A7NA 4BQ1A 1OH4A 2HJIA 3GCWA 2WFF2 3NNJA 4JGZA 2ZHMA 1C8M2 1V6LA 5FYHA 4MXWB 4P5YA 1H8TA 1XE8A 1J3RA 1I3HA 2GC3A 3BALA 3BU7A 3FBMA 3I3DA 2CWMA 1MS4A 3AYCA 5APAA 3S5QA 4RQPC 3W59A 1F8VA 4FOVA 2YBPA 1LR5A 2XHNA 4GALA 3U78A 4YG0A 5LATA 2JECA 1JHJA 1WWYA 3VL9A 5FYBA 3CZUA 3WDXA 1S55A 4LBKA 5C3QA 2UWCA 2IC1A 5DPNA 3EXUA 2LM3A 3VV1A 3NJYA 4Y5SA 4P9WA 2KM2A 3AX4A 3HIFA 3KWVA 3RSJA 1O3RA 3OGJA 3WCRA 2GC0A 2YFUA 4ASKA 2WZR2 4NHYA 4LBOA 5FYIA 5BV6A 3J9SA 1TEIA 1HV0A 3WDVA 5BNPC 3IMMA 4CCEA 1YQCA 3ILNA 2HWD1 2IXJA 1Z78A 1YNAA 5B4NA 1ND3B 3ZYFA 2ILMA 1QJU1 2JE8A 2OPWA 4Y5TA 3WP3A 1F2NA 2R6QA 2XBO1 4JKKA 4QQLA 4BQ4A 3VGIA 3JD71 3MW4A 1ZA7A 3WR0A 1I1EA 1ND3C 1V0AA 2D44A 2J22A 5FP9A 4YZ5A 5A3NA 4W8JA 3FHAA 3UESA 1QQP3 4RYDA 1X9PA 3WW4A 3RFRA 3O12A 3M4FA 4XJZA 1ULPA 3ZIWA 3D4KA 3Q8FA 4IV3B 3RDIA 1XBFA 2WWJA 1AVBA 1MPXA 3AMHA 4BQ2A 3IB3A 4H2AA 4CCJA 4IEXA 1F35A 5KHIA 2QQJA 3I3MA 4IV3C 2AGSA 3JCIA 3UYJA 3RPQA 1LTEA 3PIGA 4TYSA 4LBQB 3LCPA 3H7YA 3FHIB 2QNKA 2GP5A 2B46X 1S2BA 2WFPA 4H3WA 3NNFA 4WVMB 2TUNA 1HB3A 1B35B 1WZXA 1MZFA 3GJBA 4A6SA 5HBAA 1CAUB 3ZR6A 3RI8A 1PO11 1PIV2 4JGZB 5JSOA 3OUHA 1VBE1 2B45X 1JZ2A 3PUSA 5TSWA 1H8TB 3TEWA 2WLPA 5ABJA 2YMZA 1B35C 3MBWA 3VN4A 3POWA 5HXVA 1UZZA 2F4PA 4KGQA 1UCXA 2C5DA 4JGZC 4XAAA 2VZTA 1AJKA 3K4AA 1OF3A 5C4WC 1TQ5A 1IHMA 5FFOC 1GP5A 4HVOA 3WNXA 2WSUA 3AKPA 3RGBA 3VDAA 5BNOA 1UZWA 3PL0A 4TZDA 4FI9A 4CUAA 1T2XA 4JDNA 4LJHA 3UGHA 1O4TA 2B7YA 5L9RA 4AVAA 4OZXA 2QZ3A 3PVBB 4Q27A 1RUE3 1H2NA 1GICA 4JTOA 4D7TA 2IXLA 3I59A 1CIYA 4I01A 3MPPG 3H8UA 1FX5A 2RS12 4TLFA 5F2WA 4ARYA 1NLSA 3KV6A 3SLIA 5FPUA 1H8VA 2PTMA 1JHNA 1AL22 1JZ4A 4LBQD 1QJX2 4M3CF 1OUSA 5FMDA 1F9KA 4FOQA 2VZUA 3DXUA 4RFRB 4AI9A 2VQ0A 5BNNA 4O61A 4PBOA 4DY3A 3IKWA 4AGRA 2K0GA 3BKZA 1PVC1 5EYXA 5C33A 4TTGA 1W6MA 2QZ2A 2D6NA 1HRV3 2BOJA 4OHYA 5JWPA 4K7JA 2OIIA 2ORXA 4MGZE 5I0UA 1YEWA 5GLVA 1U0AA 2JXAA 1DYKA 1VLNA 2DDUA 5DXDA 3MIEA 3BTYA 1DF0A 1J1LA 2ZGNA 3CO2A 3U1XA 4FAGA 3PUIA 3UETA 2F17A 2JDPA 1D2SA 2VMEA 4C91A 4FTBA 4L99A 4OMCA 2C4XA 3U07A 2HWB3 3ZYBA 1X33A 3MV01 3DXTA 4K8FA 1LRHA 4XOGA 3O1TA
chains in the Genus database with same CATH topology
4AVSA 2VW2A 4N9HA 4GH4A 4QT6A 3SH5A 4RD7A 1RUH1 1PM7A 1OLRA 1R1ZA 3WUDA 5JOYA 2GU9A 3BTAA 5KXEA 1BVP1 1UKRA 1KITA 1IKQA 3ZXGA 3B00A 5ABJB 3D8CA 3VHPA 2DVBA 3N36A 4K1YA 1V70A 5K0UA 3ELNA 5ABJC 1VB2A 3AZZA 5D8AA 2FHRA 1DHKB 2JG8A 1WW5A 4TWTA 1SQ4A 4Q0QA 2BQPA 4INDA 3S6PA 3SCGA 5BNOB 1ZBE2 3WZ1A 4EN0A 5I0TA 2RE9A 1R082 2XVGA 3LSDA 1R092 1IPKA 3ZMOA 4ZXKA 1Q8VA 3I59B 3MDPA 5I8YA 2Q0AA 4P9JA 2VOKA 3ZSMA 1VBC1 3R6SA 4HKLA 5EV7A 5DDJ2 1QH7A 2NLRA 2XJSA 3B69A 2WJSA 5BNNB 3SXWA 1GYKA 1LGNA 1G86A 4AVBA 3DKWA 5BPXA 1W6MB 2PAEA 2ZX2A 5BNNC 2ZTNA 1VBD1 4IEOA 2WS92 2HWF2 3J8F3 2EIGA 4DOUA 1COV3 4L8QA 1O3QA 3MLJA 2X5IA 4P9YA 1KDKA 1POV3 4DXZA 4JRLA 4BA6A 2DUOA 1KJRA 1PGL1 4MVTA 2A75A 4GH4B 1AR62 2ZOEB 3K48A 4HLTA 2GMMA 1CJDA 1FPN3 4J1XA 3TN92 4QGLA 2YPJA 2JICA 2H6BA 1GZWA 2RJKA 4NHKA 2VMGA 2DVDA 4KL1A 4IL7A 4YLZA 4HK9A 4FXKB 2AUYA 4Q4V3 1OPOA 5K0UB 3HMYA 4B3NA 1S0FA 5D8AB 5I8SA 2JG8B 5FCCA 2DV9A 4OI1A 4YM0A 5CU1A 4YGDA 3HN1A 4K40A 2PHTA 4QM8A 5K0UC 2QDRA 4GWNA 5D8AC 4FSJA 4COWA 2JG8C 1UAIA 4HL0A 4QPGC 4XZPA 3IN9A 4FPYA 4U36A 1D0GA 3LA2A 4RA0A 1WBLA 4ATEA 5H9SA 1LESA 1PZ7A 2I2SA 1AR82 4Q29A 2R041 3APBA 3MW3A 4IEQA 4YW1A 1TME1 3AYDA 3QOPA 2OZJA 2WNVC 3DN7A 4K21A 2R071 2D43A 2ZKNA 3S30A 3WDTA 4WBBA 1Q8QA 2X5IB 3VZJA 4PQ9A 2IXCA 2DFCA 2MEV3 3SCHA 3MZHA 1HDKA 1Z7S3 1Y3TA 1RUJ1 2O8OA 3PVEA 4LHNA 4PF5A 3WINE 4DB5A 4EWAA 3FC0A 5CG8A 2X5IC 1DQ2A 2RMU3 3VBUA 1CONA 4I09A 4FVVA 1QDOA 2CWSA 4FP2A 1EY2A 3V65A 1JXNA 1POV0 3D6EA 3VKLA 4CP0A 3IDEA 4FT8A 1N3QA 1GZWB 2WKKA 5K7PA 5FQ0A 4HVRA 3VBFA 1YXWA 5CFDA 3R4DB 4RGGA 1HW5A 5DUVA 2HWC3 2CGPA 4Q1RA 4GB31 4CYDA 2ZZQA 5JAXA 2ET7A 4MGYE 1AX2A 3AYEA 4MZUA 3ENRA 4KU8A 5I8TA 1HRI3 1S0BA 1YUDA 3OPZA 1XRUA 1R1A1 4M3CA 1WBFA 2RS33 1DGRN 1C8NA 4OI2A 2BNOA 1PNGA 3AKRA 1LHVA 1Q56A 3NV1A 2D3SA 1SBEA 1FV2A 4UXAA 2VOWA 4LTAA 2DFBA 4OI0A 1AZDA 2ZMKA 1APNA 3QBQA 2XLGA 1NG0A 1RJ8A 3VBRA 4Q0VA 4QXKA 3C3VA 5FRAA 1VBB2 4LHLA 4D7YA 2X29A 2CV6A 1ULDA 1KXGA 2EXJA 2HWD3 3PNAA 3ALQA 4JQRA 4BZ4A 5JCTA 2NQYA 1W6PB 3VBOA 3VKMA 4AFAA 2CAUA 1QJU3 1S0CA 4DQAA 2A6WA 3VBUB 2XBO3 3URFA 3JD73 4FTSA 3OTFA 3AM2A 1FXZA 1Q43A 2EXHA 1OMIA 2CTVA 1FATA 3VBUC 1DYPA 3IIAA 1NA1A 4XEZA 1S0IA 2VNRA 2PAKA 2VG9A 5FQ0B 3VBFB 3LSEA 5CFDB 4JCKA 3W9AA 4Q4W1 1BK1A 1YHFA 1TNFA 4KGGA 4N53A 4LBJA 3K51A 3VBFC 5CFDC 2W39A 1DGWA 3PVOA 3H9AA 5DUUA 4M3CB 3AJZA 2P3KA 1DZRA 4NR1A 3WDWA 5FOBB 2VULA 1PO13 3AMNA 4LBNA 1VBE3 3WUCA 4Q4Y2 1DQ4A 3HQXA 4JGYA 1QOSA 2UY9A 3QLQA 1HQWA 3OBTA 1SACA 5LK5A 2LALA 3AKQA 1J59A 3FJSA 3R4UA 1WA4A 4A3XA 2QJVA 1CGPA 4BM8A 1J58A 4JDMA 2PYTA 1XYOA 3VBRB 1VR3A 1SFNA 4IEZA 1PNFA 2HEYF 1WCSA 4CEWC 2D6MA 3VBRC 1NE4A 3VBOB 4B4RA 5JOZA 4XJ8A 3IT8A 2JG9A 3KZ4C 4LUKA 3ACLA 2NYYA 3E6BA 3VBOC 1RUD2 5E88A 4Z2WA 1ASJ2 1FI2A 1PVC3 4S2GA 4Z82A 5FMOS 3WXPA 1LOFC 1EAH1 1BZWA 1I9RA 2ZABA 4XF4A 1BXHA 1RUF2 1NA1B 1JW6A 5J36A 4LBMA 4NO4A 2NM1A 5HCBA 2VUJA 4Z8BA 1QJY1 1BEV2 1IS4A 1OOPA 1AYM1 2DTYA 4N53B 2NMOA 1YIFA 2GNTA 4FPEA 4PJYA 4WZFA 3DV8A 1QJX1 1VALA 3Q9OA 5CVRA 1CPMA 1RUH3 3V64A 1UX6A 3OCPA 3UV9A 2ZGRA 3BCWA 3M1HA 1UMZA 4CRQA 1W0OA 1DQ6A 1H2KA 4FOYA 4P9LA 3TRSB 5JPMB 4JGYB 1SLIA 1RUC2 5L7OC 4M0HA 4AK3A 4MSVA 3WLUA 3RZZA 2DVFA 2GALA 4JGYC 3UK9A 3JBG1 3A0KA 3IMNA 1RUG2 3E6CC 1LHWA 2SLIA 1ONAA 4ZU5A 1RHI1 1NCRA 1WW7A 5T5LA 1D4VB 1RINA 3D5OA 2Y38A 2V09A 5JZGC 1XYPA 2ETEA 2HWE1 4HBNA 4OUSA 5GLUA 2Q8OA 1AYN1 1SFYA 5GLWA 4AHZA 4JRAA 1RTVA 2WNEA 4IEWA 1VBC3 2ZS6B 4I02A 1GLHA 1KS5A 2JG9B 1MACA 1J1TA 1ZA4A 1N1TA 2BEOA 3KT1A 1X8EA 2JG9C 3WQ0A 2D6OX 3PJQA 5A3MA 3IPVA 5T5JA 1Q8SA 4YM1A 3VZKA 4YM3A 2OUHA 5FMOL 2EALA 4JC1A 2VU9A 1DQ1A 2E6VA 1VBD3 3I54A 4BIFA 3NWKA 4YW5A 4JVAA 3ZSEA 5T54A 1CJPA 1I5ZA 1OOPB 4EN7B 3THPA 4YW2A 2WL1A 2ZGTA 2Y26A 3A4UA 1C1FA 2Z79A 2IXHA 4XIKA 4XW3A 1LENA 1OI6A 1OOPC 2ENRA 2WIIB 4Y4YA 4B4QA 4YSFA 2B8MA 3NL1A 4AFCA 4PLMA 4BOWA 4H7MA 4Y24A 3FUQA 2VVDA 1VBA1 4FPHA 3SH4A 5IK7A 2ZGQA 5EYYA 1YFYA 3VHNA 3WY6A 1MVQA 2UYBA 4MH0E 1SLCA 4MXVA 2RR12 4YYOA 2HWF1 1RUNA 2WSVA 1O4YA 1WD3A 2D97A 3AFGA 3CF6E 4COZA 4SLIA 2GNBA 2PHXA 3VZMA 1QQP2 4E9KA 2V73A 2R062 1XE7A 1A8MA 4DS0A 1NCRB 2ZX1A 3MFCA 3WW1A 1N1SA 4OFGA 1U5YA 2ZX0A 1IKPA 1D2QA 5J3UA 3KCYA 4A7YA 1IS6A 1ZZ9A 5FO8B 1NCRC 2ZGPA 1J3QA 1ENRA 3H0OA 4HKWA 1H2LA 4UW4A 1N47A 1G6NA 4Q1PA 2N7GA 2ZJCA 1JOJA 2W68A 1GQGA 4IEVA 4H14A 1TNRA 1TME3 1HKDA 4Q4X2 5IK8A 3SMHA 4AF9A 4DNYA 2D5HA 2ZAHA 4XQDA 2KA3A 4XILA 1PZ9A 5CB7A 2R0FA 3IPVB 3UKTA 1N1VA 4N7IA 2ZAAA 4Y5Z0 2R073 4A7ZA 4FCAA 3O14A 2Z69A 2LUWA 3PMEA 4XFCA 3RYKA 3ZYGA 2AREA 2A7AA 4KBBA 2XJPA 4LEJA 4HPKA 1AR71 4ISRA 1JUHA 3VHOA 2IWGB 3L2HA 4QMAA 1RUJ3 3UJOA 3JB8A 4YFZA 1N3OA 3WG3A 2W08A 2PN5A 1JN2P 1RUE2 3WX5A 4EN9B 5AVPA 2QDNA 4FQZA 1OA3A 2EAAA 4XETA 1ZBA1 3N7MA 2XGXA 3GZTB 4XFBA 4LA2A 4Y1VA 1PK6A 3KQRA 1G9FA 1Q8PA 1PZ8A 2FMYA 2VXRA 3ZIXA 4CP2A 1HRV2 4GB33 3NV2A 1ZZ6A 3KT7A 4EWEA 3RYRA 3KCCA 4HKOA 2E7AA 1OHFA 1H9PA 1R1A3 1OQ1A 5I0SA 1IS3A 2HWB2 1S0EA 4Y1YA 3BOWA 4QQOA 2YC0A 5J96B 4ZU7A 2ZGMA 2IXKA 2E7QA 1PHMA 5JDBA 3MIBA 2PHLA 3ZSLA 1GNHA 4W65A 1BJQA 5F5QA 3S7EA 1GBGA 1KS4A 1D0HA 5EXOA 1NQDA 5C8CA 3TNQA 3ZVXA 3SNMA 5AC93 1V6MA 3U10A 1H8TC 1O4ZA 5F9TA 3WP5A 3MIGA 1GZ9A 3NKTA 4YZ4A 2VNGA 3ETQA 1G7YA 1N3PA 1QOTA 2XWBB 3AXDA 4HPKB 1A3KA 4GQ7A 4B4PA 5IT6A 5FOJB 4NVPA 4ASMB 3AMMA 4R9BA 4K6BA 3MLKA 2JEMA 3TB0A 1WCKA 2EF6A 1CD3G 4E2GA 4WVVA 3M8LA 1ULEA 1ZREA 3GHNA 1VAVA 5ACA1 1PO21 4BH9A 2XLFA 4GIQA 2H6CA 4GXLA 1H2MA 3AP7A 4CP1A 1IPJA 4SBVA 2TNFA 4Q8KA 1DIWA 2BNNA 2H0BA 4KH9A 1QDCA 4E4SA 1C57A 4B7EA 4Y1XA 3VZLA 1OPMA 1FMD1 1PK6B 2WZR3 3E5QA 3RQ0A 3WVJA 5C9AA 3AMPA 2CY6A 2Y0IA 4AEMA 1VBB1 4Q4W3 3WQ7A 1OSGA 1DZTA 3R05A 5GKAC 5L73A 1V9U2 1FT9A 1V6KA 4C1WA 4FO9A 3J8F2 2VNOA 1COV2 4AVVA 4XJUA 1NXD1 4FQ4A 3HT1A 2ET1A 4DFSA 2DU1A 2ZZJA 1VJ2A 1UW8A 4WVZA 1LHOA 1G9DA 2FMDA 1YRZA 2JD4A 3GHMA 2Q30A 3LAGA 4L97A 1LOBA 4P9GA 2NZ9A 1FPN2 3P3PA 2F6BA 1PVXA 5C8CB 4XMAA 3WG1A 3UL2A 1ZRRA 1QGLA 3QD6A 2VW0A 1Y9QA 4AE2A 4RHV1 5C8CC 4Q4V2 2B5HA 5JI9A 2G9GA 4CDUA 5T50A 1PIV3 2RM21 4N9IA 4E2QA 1A6CA 3WCSA 3GZAA 3LZZA 5BNOC 5H9PA 2HEVF 1LOEA 4GULA 3GYDA 2MNGA 4ZKTB 2WZPP 4HT1T 1LCLA 4K20A 1EAH3 3ES1A 3N7LA 2BVVA 4LNVA 1AR91 3DF0A 4FPJA 2E7TA 4F83A 2DUPA 4XBNA 5C9AB 2ZCWA 4FPOB 3ZFFA 3M3CA 5GM0A 1QJY3 3PTYA 1ZZCA 1AYM3 1NY71 4F8AA 5C9AC 2EAKA 4FAHA 5T3NA 1QJX3 3V0AA 3ZFEA 1EPZA 2D7FA 2RS51 3KGZA 4AGGA 1LOAA 4PIYA 3MIFA 2AYHA 2ARBA 3NJZA 3KSCA 2MEV2 1PGW2 1YFWA 1Z7S2 1VAKA 3GBWA 3KS7A 1O5UA 1QY4A 2RMU2 2OA2A 1JYIA 3WDYA 1E57A 1BBT1 4ISQA 4GH4C 3ZO0B 1IGOA 2YGMA 2A71A 3JBG3 5HCAA 1LOGA 2GN7A 4HSLA 4NOTA 2YXSA 4PLNA 1RHI3 1WW6A 1SCSA 4DZGA 3AP6A 1FOD2 4LO8A 1GQHA 2IFWA 4E27A 2HWE3 1Q8OA 3WD5A 3AZXA 1AYN3 4RGAA 4C0BA 1EV11 4HN1A 4CDUB 2B42B 3AKSA 4AI8A 1H1MA 1U5IA 3JQWA 2O8QA 4EN6B 1RMU1 3N7JA 1OQEA 2NMNA 3ILRA 5SV8A 4AQ2A 1ZZBA 3CLPA 5EJ3A 4FPFA 1D4M1 1HRI2 2R49A 5KXCA 3CJIA 2GC2A 2RS32 3VBHA 4META 4QD2A 3D0JA 3VZOA 2JE7A 2VVEA 4RS5A 4L92A 5FLJA 3DUIA 4HMZA 2BBVA 1ZBE3 2D93A 3AK0A 1R093 2K9ZA 4COVA 5GALA 5FDBA 5BY5A 2YY1A 3ZFFB 4YGBA 3EJKA 1KFXL 2ZHKA 3N3HA 3V0AB 3ZFFC 3ZFEB 5FREA 2R16A 4OHZA 4PBPA 1BMV1 2HWD2 4ZU4A 1W6PA 2OZ6A 4AI0A 3VKNA 2WA3A 2E51A 1VBA3 5T5OA 1UU6A 3KLSA 1RIRA 1QJU2 5KWRA 1TMF1 2P37A 3I8TA 3WV6A 4E4DX 2XBO2 2JJ6A 4QQ2A 3WQ1A 3JD72 3RS6A 2HWF3 1ND2A 1W0PA 4BMBA 4CDWA 4D7SA 4QX5A 5CADA 1C1LA 1UN1A 3NAPA 4B8EA 2GZWA 1FV3A 1OD5A 4AQTA 2DYCA 4YZ1A 3CU7A 1SLBA 1XNKA 4JAAA 3ZXJA 1REDA 3NKGA 1RVF2 1VRH1 3HAGA 4Q26A 1YYNA 3MLLA 2A6VA 3R0RA 1MEC1 4H55A 1DGWX 1XNCA 4UBGA 3WW3A 2EA7A 2PLV1 5DZGA 3ZN5A 4AHWA 4RL7A 5E16A 2K2SA 3JU9A 3AFKA 1G9BA 4X8PA 5GZEA 2CGOA 2GMPA 4P9IA 3CJIB 2QVSB 2RR11 2PA7A 3VBHB 1WMDA 4PIXA 5GLZA 1VBE2 4RS5B 4UW3A 4LO5B 2GH8A 2PQQA 2VECA 3RJRA 5A32A 3CJIC 4LULA 3VBHC 2FZ2A 2JKBA 3BIWE 4MGKE 1WLDA 3NW4A 1TE1B 1ZYBA 4QQPA 1AR73 4Q0PA 5DZEA 4LLFA 1RUI2 5AC91 2WNUA 2PHFA 1ENSA 3VLBB 4D94A 4BLIA 3VDDA 4I0AA 1LEMA 1WUVA 1MS3A 1KRIA 3B93A 4L2NA 4AFBA 1QWRA 1U5XA 2WFF1 1HXS2 1C8M1 1ULFA 4HZFA 4OHWA 2A5ZA 2XH6A 5GZDA 1RITA 2D6KA 2ZHNA 4Y22A 1ZBA3 3AZYA 1EP0A 2ZGOA 1ND2B 4CDWB 2HYKA 4N90A 3FLTA 3C2UA 3NAPB 3B5LB 5LRSA 1DBNA 5KBFA 1ND2C 1IZ3A 3E97A 2XWJB 4IXLA 4CDWC 1WGPA 2WZR1 1H4GA 1W2UA 3FUOA 4GMP0 2DUQA 2DVGA 1ZVFA 2G4IA 4LHKA 5J98B 2CNAA 4XYXA 5T5PA 1HX6A 3G6JB 4E2SA 3EBRA 3I2DA 2JE9A 4R9DA 3AB0A 4MX3A 1LULA 4Z07A 1RUH2 2WQ4A 5KHJA 2Q5TA 2VMHA 3ILFA 4GKYA 1LKNA 3VZNA 4YM2A 5A3LA 2GN3A 5A32B 3AP9A 3UKNA 4QU2A 3ZYPA 1HQNA 4OUMA 1XNDA 5H9QA 4KWLA 5KC5A 2VVFA 2GDFA 3AMQA 4RSUA 3BPZA 3VUOA 4R9CA 3X29B 3PLQA 5FBZA 3OD0A 2C0ZA 2WNUB 1KD7A 4WM8A 3GBFA 3IDBB 3BOPA 2D3PA 3VDDB 4LLOA 5LEKA 1MVEA 4X6RB 4ONUA 4I0WB 1NCQA 2WNUC 2P34A 3WP4A 5ACA3 2VQAA 1PO23 1PIV1 1YWKA 2VUAA 1XXNA 3VDDC 4AFMA 1VBC2 2BFUS 4Y26A 4BLJA 4Y22B 3ST7A 2WWSA 1FMD3 3WDUA 3MICA 3TBDA 1VBB3 3CEWA 2UYAA 3THTA 4HANA 1DU3D 1VBD2 4FTEA 4YW3A 1NA1C 3ATGA 2GNMA 1G9AA 2RS11 1O3SA 4KWJA 2W52A 5FTTC 1ZM1A 1AL21 1LJ7A 1PGL2 3RWNA 1MS8A 2JX9A 4R52A 3B94A 2VOXA 2JDZA 4N53C 4R4XA 3OY8A 4BIOA 2PHDA 4XJAA 2WA4A 4ES9A 1WW4A 3U0ZA 2D3RA 5CNAA 4L11A 1M06G 4AI2A 5DZFA 1LGBA 1LGCA 1S1AA 2DWRA 4HN0A 2UY8A 1V9U1 2ZMLA 5FPXA 3B7MA 4HSJA 3ZDSA 3POSA 4BWOA 4Z92B 4RHV3 1K5MA 4MLOA 4HFSA 5C8WA 4IEYA 1FNYA 5JR7B 1DQ0A 3FX3A 3JUUA 3D0SA 4WM8B 2RM23 1FAYA 1REFA 4BMEA 2EXKA 3KD4A 4YG6A 4TSVA 1NCQB 5KXBA 2RHPA 1VIWB 4WM8C 4AI1A 2NPIA 2ARXA 2P17A 2R042 1IOAA 3WG2A 1NCQC 3WT3A 4AFDA 1AR93 4AVCA 1TME2 3B9CA 5SV5A 1HQLA 2R32A 2BFUL 1MZEA 3L2YA 3PJYA 1SBFA 4H7LA 1XQNA 3RNSA 2BW8A 3PMSA 4LR4A 2BYVE 1ZBE1 2JENA 2CGNA 2R072 3HD8B 1W6QA 1FYUA 1R081 2D6LX 2PHWA 1R091 3VHRA 3EHKA 1QH6A 5GJ6A 2RS53 2EVXA 4YGCA 2ZGSA 3AYAA 3FMGA 3HR9A 5LK7B 1KDMA 1H0BA 4M0NA 2R0HA 1VP6A 2P3JA 4XFIA 1LHUA 2BWAA 4HK8A 5DDJ1 1RUJ2 3H7JA 1CVNA 4J6GA 4CDQA 3VBSA 3OY8B 2UWBA 1BBT3 1HLCA 4S2DA 1F31A 3H1WA 1YFXA 2ZGKA 4OULA 1IQAA 4GMP1 5EZWA 3ZSJA 2YUEA 5BNPA 2WS91 4S2HA 4X8NA 4XIOA 2ZACA 1K5MB 3I7DA 1X82A 2D5FA 1U5ZA 1EV13 4P14A 4CDXA 3M3EA 1QXRA 4GB32 3M7AA 1RMU3 1K5MC 1ZZ8A 1G8WA 4L9BA 2XVLA 5FLHA 3OBRA 1AR61 1AUYA 1C3HA 3TAYA 2D40A 1D4M3 2QFEA 2YZ4A 4D69A 4LT5A 1R1A2 3B02A 2QUOA 4FPGA 3TN91 1BKZA 5DUWA 1PMIA 4KNCA 2O0OA 3JB4C 2GC1A 1FOD1 2BVBA 3SHRA 4QPIA 2A6YA 5CA6A 2YROA 4I3GA 1URXA 5JIUA 2C9AA 4QGMA 3B01A 5T55A 2AZ5A 1W6QB 2Q1ZB 5JVVA 1DFQA 1QHDA 3MIDA 4JV4A 1UIKA 1Y43B 4XXAA 1UPIA 4AEDA 1LU2A 2B39A 1CX4A 1Z0HA 2X8KA 3WP6A 1AR81 2A6XA 2B9UA 4AG4A 4AHYA 4CZSA 3ASIA 1TMF3 5FPZA 5C4WA 4CDQB 1ULGA 3SCFA 1H4HA 3VBSB 2MPFA 4IV1A 3GALA 5KHHA 3EQEA 4I2OA 4CDQC 3VBSC 3DGTA 5BNPB 1MS5A 2PHRA 3H50A 4DRVA 4FPLA 1VRH3 1CR7A 1XU1A 5KC6A 4Q4W2 4QQHA 1MEC3 1X36A 4CDXB 4GWMA 2BTVC 3VKFC 1CQ9A 3AJYA 2BGCA 1ZRCA 2E63A 2PLV3 3O0WA 5EWSA 1ENQA 4URTA 5GZFA 1T6GC 4AGVA 4A7KA 4CDXC 4D3WA 2YGLA 1UKGA 4FOWA 2VGDA 2RR13 2YDEA 4MYEA 4NHMA 4XXPA 5BUVA 4FPKA 5F1RA 5CBLA 3RG0A 2X53S 2R063 4QHBA 2WT2A 4C0HA 3J4UH 4XFAA 3TNPB 3M3OA 1SLLA 1V6OA 3L9JT 4RR3A 2NN8A 4W6WA 2W0XA 3FZ3A 1RVF1 4QPIB 3RMXA 5JSRA 1AHSA 5IK5A 1H9WA 4IEPA 1JUIA 4G4FA 5GZCA 3MPBA 3CL1A 5J09A 3MF6A 1V6JA 3AP5A 3KGLA 1W6OA 3ES4A 4QPIC 3BB6A 3INAA 4WVWA 1A78A 1YCIA 3NVCA 1EPWA 2G9FA 4AEDB 2WQZC 4Q4X3 5L19A 4COUA 2WFF3 1C8M3 4KQ7A 2WLQA 3H3UA 4I30A 5CAZA 3M70A 4AEDC 5BNQA 5C4WB 3AZWA 4OHVA 5F6KA 1WMEA 1KQRA 3QH7A 4IV1B 2OUJA 4COYA 1EAH2 3ZXFA 4MV2A 1RUI1 4LO6B 4IV1C 4S2FA 2ZGUA 5J7MA 2VPVA 2Q4SA 3N4MA 4DY5A 4AEJA 4EWDA 4OHXA 4JTNA 4XE9A 1QJY2 3T2TA 2XL9A 1PK6C 3KM5A 3H1YA 1BVVA 1AYM2 2XUMA 1HXS1 4LE3A 1NOVA 4QGNA 4YZ3A 2ZGLA 4GA9A 5BXXA 1C4RA 4PDWA 2A6ZA 1RJ7A 1UD1A 1NYWA 4IQPA 4IESA 2R1BA 1O91A 2E53A 1YO8A 3UKVA 1UPSA 2VY0A 4RR3B 1QKQA 2DURA 1F5JA 4UW5A 2ES3A 2DF7A 3U4XA 1YLLA 1ZX5A 5J48A 3JBG2 4RR3C 1LEDA 4BCUA 5I0RA 2A3YA 4XHBA 3SITA 1MZ6A 3MYXA 1RHI2 1W6OB 2O1QA 2D6PA 3MEPA 4LO7A 1MZ5A 2HWE2 4XDQA 1AXZA 1AYN2 4FP3A 2XPJA 4XJWA 3N35A 1HV1A 3AZVA 4Q4Y1 1H30A 1WLWA 5FO7B 5LRRA 4EROA 5T52A 1C28A 3T1MA 2XG3A 1VB4A 2Y0OA 4XBQA 4Z1VA 4AVTA 1LB2A 3FE5A 1AX1A 5HCFA 3RYPA 2DCZA 5IK4A 3R4SA 2DVAA 3AKTA 3MW2A 3P3NA 1GNZA 1ALYA 4QM9A 5K8SA 4QPGA 2I07B 3PVNA 5GLTA 3IM0A 4I3PA 4Q0SA 2XKOA 3LOIA 4KWKA 3QH6A 4CTEA 3QCWA 4AYUA 1M4WA 2PHUA 3ZFGA 3MFAA 2RS13 2PAMA 1DQ5A 4XF9A 4Y20A 1OA4A 2Z42A 1AL23 1C5IA 1CIWA 4N43A 4R9AA 3USSA 1BQPA 5F6LB 4BE3A 4PDWB 2WNVA 1JBCA 3IDCB 5D1IA 1RUD1 3ZXAC 1QOOA 1ASJ1 1S0DA 4W6XA 1W39A 3NSTA 4CEYA 4PDWC 2GH2A 1RUF1 1VBA2 3FLRA 4UBHA 3HT2A 3WOGA 1V9U3 3B9IA 1W6NA 4R8HA 1QNYA 3VKOA 1BEV1 2XL7A 5C6CA 5CG9A 1UU5A 4AQ6A 1SDWA 4YVWA 4AI3A 2D98A 3ZYRA 4LBLA 1QMJA 5DG2A 1S2KA 2HWC2 5A33A 2CL2A 3ECQA 2Z5WA 3B3QE 3WW2A 1QXPA 3RRDA 4ORFA 4CDUC 1RUC1 2XJRA 2P2KA 1BYHA 1VAMA 1J3PA 1YI9A 2IFRA 4XQWA 1MS0A 3MGUA 4AXOA 2XB6C 3QACA 1LU1A 1RUG1 3D82A 4ITCA 2WT0A 4I0BA 4FPCA 2IXIA 4P5HA 4QPGB 3PHMA 1CAWA 1R083 2XJUA 2BPA2 2GAUA 1QJZA 3ZN4A 3LGRA 2PFWA 3ZFGB 1BCXA 1AR72 2GMEA 4Y20B 3M2MA 1GANA 3DL3A 5FAXA 1DZQA 2QE3A 2XKPA 2DCYA 4N43B 1S0JA 5DDJ3 3ZFGC 2WNVB 4YRDA 1UL9A 3FWEA 1GR3A 2XJVA 3NO8A 4N43C 1KJLA 3ZFEC 2R30A 4CEYB