4MXVA

Structure of lymphotoxin alpha bound to anti-lta fab
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
144
structure length
137
Chain Sequence
KPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/immune system
molecule keywords Lymphotoxin-alpha
publication title Dimerization of LT beta R by LT alpha 1 beta 2 is necessary and sufficient for signal transduction.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 137
sequence length 144
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2013-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4mxvA00
4MXWB 4KGGA 2E7AA 2QE3A 4NN0A 1D0GA 2JG9A 4QQPA 2OIIA 2AZ5A 4TSVA 5TSWA 1OQEA 2O0OA 4QQHA 3L9JT 1OQDA 4QPYA 4DB5A 4E4DX 4D7YA 3MI8A 4MXWA 2WNUB 1JTZX 2Q1MA 3LKJA 2JG9C 2X29A 4G4FA 1A8MA 1IQAA 1TNRA 3QD6A 3WD5A 1DU3D 1PK6B 1D2QA 1O91A 4DOUA 2WNUA 3B9IA 4G3YC 5KC5A 1XU2A 1ALYA 4MSVA 4F3JA 5HBAA 2ZPXA 1OSGA 1KXGA 1XU1A 5BNQA 3B94A 1DG6A 1PK6A 3IT8A 1U5ZA 2WNUC 3ME2A 5L36A 1I9RA 2QDNA 3TWIA 3ALQA 3B93A 3QBQA 4E4SA 4GIQA 1D4VB 5CIRA 4QQLA 1KD7A 1WCKA 1PK6C 3K51A 4J6GA 4OUMA 2R30A 1GR3A 2RJLA 2HEWF 3URFA 1C28A 4N90A 5KC6A 2WNVA 2JG8B 1TNFA 1S55A 4MXVA 1U5YA 4EN0A 4OULA 5L19A 2R32A 4KGQA 2HEYF 1U5XA 3FC0A 3V56A 1C3HA 4HT1T 2WNVB 3K48A 2Q8OA 2ZJCA 2WNVC 2JG8A 2TNFA 2Z5WA 4OUSA 1RJ8A 2KA3A 2HEVF 4KG8A 3AB0A 3TYJA 4TWTA 5KWRA 4QQ2A 2JG9B 1JH5A 2RE9A 1RJ7A 4RSUA 2TUNA 2JG8C 4QQOA 2R6QA 2RJKA
chains in the Genus database with same CATH superfamily
2GNMA 3FLRA 1GKBA 1YJKA 1Q8PA 4UF0B 4XFHA 1QMJA 1KS5A 1EUUA 4IEYA 3WNXA 4DY5A 5EWSA 2YGLA 2OZJA 1XRUA 4AWDA 1ND3C 2PHXA 4KMQA 1YFYA 2HWF3 2VCCA 3L9JT 5IWFA 3ZSJA 3WOGA 4CTEA 1G9FA 4BPZA 4D7YA 4DXZA 3TRSB 1VJ2A 4EJRA 2ZACA 3EMRA 1YI7A 4KWJA 5F5AA 1CQ9A 3LFMA 2XXZA 4CU7A 4C90A 2RJ2A 1AR82 1TMF1 2ZAHA 3AM2A 3GYDA 2P5BA 2C4XA 3VBUC 1W9FA 1RUC3 2CNAA 3BALA 3H1WA 2DTWA 3KGZA 1GZ9A 4B4QA 4GQ7A 2QCSB 1L3JA 4DINB 4MADA 1PO13 3ZN6B 2VVFA 2XL7A 4PCRA 1S4CA 3O1OA 1V6KA 3M4FA 1CAVB 1QF3A 5B2GB 5JWPA 1CX1A 4FCAA 1VIWB 3VBFA 5FYUA 1BQPA 3MF9A 1SEFA 3KHCA 5EP9A 2ENRA 3K2OA 4E27A 1AJOA 2EXJA 2NYYA 5CKMA 4PIXA 1JOPA 2D6NA 4NE9A 5BNNB 3JD73 1FATA 3BGAA 3VKFC 4IEOA 3TBDA 4CVUA 4ZU7A 2ARXA 5BNQA 3LDBA 5HV0A 1VR3A 1W2AX 1DP0A 2UWBA 2GAUA 1VAKA 4OYUA 5F1RA 5FK7A 1Q5OA 2OUHA 1J84A 3IT8A 2Y33A 3AP4A 5FZCA 1LHVA 3AX4A 2ZGUA 4Z92B 5L36A 2VTFA 3A7QA 4M01A 1OKOA 2IXKA 5C3RA 4XZUG 4KL1A 1W9WA 4U36A 5EHDA 3SCGA 3FN9A 4YW3A 5FPXA 4IGPA 2VULA 1ZZ6A 1O3TA 1QJU1 1WWYA 3T0BA 5K0UA 3ZYFA 1PO22 1QOOA 2W1QA 2VC9A 4IV1B 3RJ2X 4YZ4A 1VBC1 5GLZA 3H8RA 3UGFA 4LBOA 2JEMA 4AHXA 1REEA 3CZJA 1SBEA 4JDNA 4Q4V1 5EV7A 3NQHA 4C1XA 1PVC3 3W59A 2A6VA 4FPHA 4K3UA 4FI9A 4Q4Y2 4YZ3A 5FZ9A 2RG4A 1RHI2 4AQ6A 1HJFA 2DBNA 5C3PA 2GALA 3MFAA 3OBRA 2ZEYA 1US3A 3CDZB 3CJIC 4HVOA 2G1MA 5A7NA 1DYOA 2QKDA 5FP9A 2J1UA 1BHGA 2Y60A 1X50A 3H3ZA 3VHOA 1RUNA 3ETPA 4XAAA 4WM8A 1WZXA 2ZA9A 3PIGA 1OFNA 1H2LA 3LE0A 2YY1A 4D7SA 1LEDA 4C91A 1TE1B 4XFAA 5DG2A 2AR6A 2JB8A 1KGYA 1T6GC 1W9SA 3ZX7A 4GWMA 5GZCA 3THDA 2RDSA 5IATA 1NOVA 3HVDA 5I0TA 1Z7S3 4IEVA 5KWRA 1ONAA 1S0JA 2HH9A 1CZTA 3AP9A 1H4GA 1JW6A 1ND3A 2RE9A 4NPMA 2ZGTA 3FX3A 5ABJC 3HEIA 1QDCA 2W0XA 2ZOEB 3O1RA 5SV5A 1EPZA 2HWE2 2DBIA 2YU1A 3I97A 2WINB 2RS52 2PQSA 4UAPA 3AVSA 3RMYA 1DGRN 1VBE2 1OBNA 1W6MA 2RMU2 3WDTA 2DVBA 2Q5TA 1MS1A 3POYA 4NHXA 5LA0A 1UW8A 2HWF1 5A3NA 3VBUA 2OW4A 5KXDA 4XCBA 1W39A 4GXLA 1O4YA 1YO8A 2O0OA 4JGZB 4XVHA 1K5MC 4LMFA 4Y22B 3DL3A 3WP4A 2VZSA 4Q27A 5F3EA 1SLIA 1KFXL 1UOFA 4Y20B 3VD9A 1GWMA 1HRV2 1SBDA 3F95A 5H9PA 4MXWA 2J1VA 3N7KA 2WNUB 3W9AA 5FRAA 3W5NA 5IW0A 4WBBA 2X5IB 3HN3A 1RUC1 3WQBA 2G4IA 3FL7A 2UYBA 1VAMA 2WN2A 5FAXA 5JDBA 3AMHA 3GF6A 4XCAA 1HQWA 1PO11 3ES4A 2ZMKA 1JI6A 4FP2A 4P9GA 1YFXA 1ULFA 3H50A 2RDRA 4HSJA 4IEZA 1JHJA 2XUEA 1TNRA 3CU7A 5FTTC 3ZYIB 4AAPA 1UY3A 2JDNA 1BBT1 4KBZA 5C9AC 1GP4A 2O8OA 3NV2A 4FQZA 1TQ5A 3PMEA 4ISRA 4TLFA 4XQWA 4ZU5A 4QMAA 4XACA 4LIUA 2HJIA 4MSVA 1N47A 3JD71 5FP3A 3JQXA 2QQKA 1W6NA 4PBPA 1WLCA 2C26A 3SLIA 1OVPA 2XH6A 1OA4A 2Y6HA 3IIAA 1N3QA 2J1AA 5DQ0A 1PIV3 5BNOC 2VG9A 3ZFEB 4QHBA 1S0IA 4IEPA 4L97A 1GOGA 2QDNA 1OFSA 3CZUA 3V0BB 3KSCA 1Q3EA 3AP7A 3HQXA 4A42A 3GZAA 4DRRA 2ZBJA 4LTAA 5C8CC 4RFRB 2YGMA 2YDEA 4GH4B 3Q8CA 4JTNA 1CJPA 1ZRCA 3WNKA 2VMEA 1QH6A 2BGCA 3OBTA 3BTYA 2VGDA 1H6YA 3CJIA 4MHUA 4NMIA 4XOGA 4NOTA 3RFRA 4BHPA 1J83A 2Y38A 3OG2A 4YGEA 4X8PA 2ZHMA 3EB7A 2B45X 4YGBA 1VRH2 4CP2A 3AXDA 1PVC1 1S1AA 1VALA 3LDKA 4W6YA 4ZHNA 3OPZA 1KQRA 4MXVA 5KHHA 5LBBA 2BVVA 5FMCA 4JRLA 5J3UA 3V0AA 5LATA 4NO4A 2A7AA 2XJSA 1W2UA 3ACFA 4LKDA 1UQXA 4Q1PA 1ZNPA 2YB7A 3ATGA 5IJRA 5J96B 3TN92 3RJRA 2PHTA 4YZ1A 4MZUA 2BOIA 1SHWB 4HANA 2DVGA 1AXZA 4IQPA 4ZZ5A 2WYSA 1Y4WA 3GDBA 1O5UA 5ABJA 4RS5C 1HKDA 2WNEA 4ZS2A 3I7DA 4I0AA 3PJYA 1KITA 4KG8A 2XKOA 3A4UA 2XL9A 4QM8A 1OH3A 2WS91 3ZXJA 4YG3A 3MPBA 1QJZA 5HPOA 2ZGLA 5JSRA 3H3UA 4AL9A 1AR63 3IPVA 3RNSA 1HRI1 4Q5OA 1JZ7A 1RJ7A 4FTEA 4O7XA 4DUVA 3ZYGA 1K5MA 3AYAA 2ZX2A 5FO8B 4CU9A 2QTWB 5JI9A 2FHRA 4C0HA 3DKQA 3L2HA 1Q8VA 5BY5A 1N1TA 2DF7A 1POV0 3T0AA 5L7OB 1NLQA 1XE0A 1WD3A 2W52A 4RR3C 3IKWA 4AGVA 1GMMA 2Z42A 4QQHA 4RHV2 1XNBA 4F7ZA 5APAA 3KV4A 4K40A 5C9AA 3R4UA 5IVJA 4XEZA 4LBMA 1CGPA 4E8DA 2JICA 2EAKA 5F6KA 1DIWA 4OHWA 4CDUB 4CRQA 3ZVXA 4RQPC 3EXUA 2UWAA 3Q8AA 3TNPB 2X29A 5AFBA 1OURA 2BP6A 2Y26A 3ZKUA 2D98A 4S2GA 5C5TA 3B9IA 3ZXAC 1IKQA 2JDPA 2BW8A 1VAVA 3NNMA 3UETA 4XUOA 5LB6A 2ZGMA 4P9LA 3ABZA 5HBAA 1IG3A 2Y64A 4IUGA 2UU8A 2WYFA 1OF3A 5C8CA 1PIV1 4ES9A 1S2KA 2EXIA 5A1FA 3B02A 1UU4A 2JDAA 3I3MA 1H6XA 2BU9A 1JYCA 5IAXA 2VAUA 1R083 2YU2A 3WF1A 5LEKA 1YJLA 1IQDC 1WLTA 2N7GA 2Z4FA 3WF2A 4GIQA 5DZGA 4AFMA 1MS0A 3DKWA 5DUUA 1UL9A 1W6QA 2PAMA 1VB2A 4H2AA 3A0KA 3WNMA 2HBTA 4GB33 1UZVA 3VLBB 2ORXA 3PUIA 1V9U3 1YQ2A 2VMIA 1ULGA 3M3QA 4K7JA 1Y9GA 4R9CA 2RJLA 1ZRDA 3PTYA 3FUQA 1UX7A 5C3OA 2LS6A 4A6OA 4RS5A 4YW5A 4GMP0 1X9TA 3MICA 2EIEA 1ASJ2 1MZ6A 2QBXA 5F3GA 3RG0A 1YYNA 4WVWA 2WO2A 3WF3A 3VZLA 3CEWA 4BISA 1OC1A 4P9XA 2Z79A 3BN6A 2XMLA 2Y6GA 3VZOA 4BCUA 2L9LA 2Y8KA 4QDRA 4HXCA 3O5SA 1U0AA 4UFLA 1COV1 4A7ZA 4L8QA 2WQ8A 2A70A 3K46A 3R4SA 4P9WA 2XQXA 3WP5A 4LE3A 1EYBA 1JYWA 5T5LA 1DGLA 1A3KA 4QPIC 4Q4W1 1SDDB 5GLVA 3MUY1 3U75A 4BM8A 1JZ4A 4IV1C 2QFEA 2A5ZA 3OGSA 3JU9A 1AR61 1JUIA 3VBSB 5IFPA 2HWD2 4MH0E 4WVMA 2QQLA 1JZ8A 1UZWA 4RR3A 1O4TA 4B4RA 1QJX1 5T5JA 1D4M2 3VKMA 2EIBA 2JE7A 5LW9A 4BJ0A 1YIFA 3OBAA 2CL2A 5IK8A 1RUI3 4QPWA 3ZSEA 4J1XA 1XJAA 4KI5M 2FDFA 2FDGA 4FFIA 1ND3B 4NROA 3W21A 4YG6A 3GZEA 1BMV1 4XTPA 5LK7B 4NAOA 4RQPA 5JUVA 5ACA3 3VDDB 3K75B 4ITCA 3OGGA 3ZYJB 2JDMA 4B1LA 3LSEA 2ZZJA 5FWJA 2ILMA 1EAH1 2QZ2A 2VZ3A 1W6MB 2R7EB 5JOWA 1DQ6A 1ST8A 1JMUB 3WF0A 2NPIA 1JTZX 2R042 5DUVA 1H8VA 5FZAA 2P34A 1OOPC 1G6NA 3VBUB 3GBFA 2VZ1A 5A7SA 4KU7A 2JDKA 2VY0A 3BU7A 3MIDA 4YG0A 3OGJA 1TMF2 3WNLA 1NCQB 3QH7A 2W9XA 4JCKA 1AHSA 1WCQA 2ID4A 5F3CA 1D2QA 5JZGC 2GC1A 4P08A 2VUDA 1EV13 3DYMA 4H55A 2XG3A 1OH4A 3MIBA 5FY4A 2IVJA 2VMHA 1ALYA 5I8TA 5FBZA 2WZ8A 4IE6A 1RUF2 1NQDA 2FQPA 2UY8A 2JE9A 3HD8B 3NNLA 5E1RA 4LO6B 3ZN6A 4ISQA 1C4RA 4M3CE 3B7MA 1CAVA 4ATEA 5CADA 2X53S 1R081 2WNUC 3AYCA 2EXHA 4AI2A 4DY3A 2X5IC 3U37A 4CUCA 2A3XA 1DQ2A 3ALQA 1KS4A 3B5LB 4LUKA 1H9WA 3QBQA 3SMHA 3O1TA 2B9UA 3J7HA 1VRBA 2B4KA 4Z8BA 2B39A 2VW2A 3DGTA 4GB31 4K1ZA 3EO6A 4BYYA 1V9U1 3OUIA 2IXLA 3O1MA 1YI9A 4DUWA 4XBNA 5FZ8A 1G9CA 4UXAA 2WFF3 3WP3A 2VD7A 3LEIA 1LU1A 3MYXA 1ZZ8A 2R062 1PGSA 2HWB3 3WSOA 1GUIA 4FTSA 1AL0G 4ZS3A 5JR2A 5DZFA 4AHYA 2AH2A 1WW4A 2XWBB 4QPIA 3ZFEC 3OGVA 2ZTNA 2JDHA 2ZGKA 3ZDSA 4CUBA 4IV1A 4MO3M 3SC7X 2WWSA 3FBMA 4M0NA 4WVVA 4EN7B 4PLOA 1PZ7A 1DFQA 4XQ4A 3OY8B 3OB8A 5JOXA 1NAEA 1UF2C 4P9JA 4Z2WA 3ZSKA 1DQ5A 4BQWA 3VHPA 2ZMNA 5CISA 4NPLA 2KA3A 4GH4C 2VBDA 2EIDA 2WJSA 5AVAA 3USUA 4AZZA 5E8AA 3ZXKA 1WMDA 4OHZA 3O1VA 2VUCA 1QOTA 1FV3A 1LHOA 4EV0A 1Y9QA 1LOBA 2VTXJ 3FWEA 3B01A 5A3LA 4NIDA 2IXHA 1CD3G 5K8SA 2K9ZA 2JDYA 4QQOA 2FDJA 2JWPA 4U2AA 1CPMA 1DBNA 1RUI1 4WM7B 3C7HA 1PZ8A 2NQYA 3ES1A 1W8NA 3KB5A 5JIUA 3SH3A 3K3NA 1C8M3 3I2OA 5ACA1 1OOPA 3W20A 1IKPA 4QQPA 1QNYA 1HIXA 2BGPA 1QQP3 1CONA 1N1SA 3BCWA 3LZZA 3THPA 2Y0OA 3RPQA 4BH9A 1WBLA 1JYXA 3M3EA 4LBKA 5IVBA 2ZGSA 5JZGA 5T3NA 1UMIA 5E16A 4LT5A 3I2KA 2VQTA 4QM9A 1VB4A 3PU8A 1JUHA 3PLQA 1LOAA 3NMBA 4JGYB 3ZFFB 4CCLA 1G9AA 3N9LA 3LOBA 3KCCA 1XNDA 3KHBA 3T08A 2VVDA 1VP6A 3HJRA 5JR7B 4LEJA 2R49A 4Y22A 3OOXA 1SZBA 3WW4A 4UI9L 2VZTA 4Y20A 1OA3A 1EV11 2OXBA 1XE7A 2DUOA 4L2NA 4X6RB 4YW6A 2WAAA 1RMU1 2WNUA 2ZMLA 5T52A 4G3YC 5L73A 2X5IA 3IDCB 4D7TA 5A1AA 1HW5A 3J4UH 1G86A 1ULDA 4XIOA 5FLIA 3E1F1 5ANNA 4DXRA 1GP6A 3A0NA 3LF7A 1FI2A 1YNAA 2RS33 1KXGA 3OYWB 1O4ZA 2ZGRA 3JD72 2WKKA 5BNOB 1PGW2 5KR7A 4MGQA 1MEC3 2HWC3 4CA9A 2GU9A 3O1UA 2GMMA 3N3HA 5KXEA 2QJVA 3HOBA 2NMOA 3ZYBA 4CDUC 1UU6A 3T09A 4HZFA 3KD4A 4FVVA 2DVFA 2F4LA 1ENSA 2CSGA 1L7QA 1CZVA 5FZFA 2YBPA 4N7IA 1Q8OA 3WG2A 1YEWA 2IXCA 3PUSA 3T2PA 3ZFEA 4BZ4A 4E2GA 1ULEA 4HKLA 2JXAA 4OI4A 4Y26A 1H1MA 3V0BA 5FZGA 3TB0A 2YC0A 1YQ5A 2ARBA 3FFQA 3S7IA 5FYMA 2HWB1 1MS5A 4LBQB 4R9AA 1BZWA 5CG8A 4N90A 2VCMA 4JAAA 5F3IA 3KZ4C 2F6BA 2JECA 4ZZ8A 5FUPA 2BDRA 4GH4A 4OULA 3T2TA 1UIJA 1UU5A 2ZZQA 2R1DA 1PVC2 1ZBA2 5G05L 4BU2A 4H14A 4FOVA 4AEDC 5F5IA 1W06A 3EBRA 2OQ7A 3ASIA 2WN3A 3AYEA 1QXRA 1SLAA 2AREA 2E63A 3CKHA 1QY4A 4E2SA 3D5OA 4YVSB 4G9SB 2ZX4A 3GBWA 1LENA 2D6KA 4DXSA 1M06G 3KV6A 3NKTA 3P1IA 1NT0A 4V2VA 1RGSA 3MIHA 2Q8DA 5J48A 3G6JB 5GKAC 1YXWA 1SDWA 1WCUA 1Z7S2 4Q0SA 5A6QA 2XBO3 4FPJA 1QOSA 3T30A 1WD4A 2ZABA 3HT2A 3PVEA 3KQ4B 4HKOA 4LHSA 3MV11 3JCIA 4GALA 3MGUA 1GICA 1QJY3 1KDKA 5DMYA 1C8M1 5CFDC 2FDKA 2J7MA 2E7AA 1MS3A 4WVMB 2P6HA 1LECA 4LJHA 3T1MA 4INDA 1AR93 1O8PA 1OD3A 3MIGA 5EIYB 5FOBB 3DECA 4H7LA 3R6SA 4YZ2A 1RUE3 3WG4A 5LEJA 1DCSA 4NHKA 3WHUA 4HN0A 5C5UA 2WABA 2DVDA 3DYOA 4FXKB 3LA7A 4LQRA 3MFCA 4Q0UA 3AZYA 4M4RA 3VBSC 1LGBA 1GZWB 3E6DA 1V0AA 3M7AA 3JZVA 1REDA 3PVOA 4NHLA 2VOVA 2DWRA 4I2OA 3I3QA 3ZXDA 1QXPA 4G4FA 4IE0A 1A8MA 4M3CF 4EE2A 3RZJA 5EJ3A 3KV5A 1H0BA 4S2HA 5F39A 3VBOB 4YW7A 1W8OA 2MNGA 3J7LA 5A3OA 1XNAA 1LAJA 1VBB2 1X8EA 1W04A 2J1SA 2J22A 2D97A 2EAAA 1PMJX 3NSTA 2QNKA 4CEWB 1O3RA 1GWKA 1EY2A 1MS9A 3VZNA 1DF0A 4CDUA 3ILRA 1NY71 2DVAA 3EQEA 2RS31 1MS8A 1IPKA 3S7EA 3VDDC 2F17A 4CPBA 5HV4A 3WNPA 3KM5A 1MEC1 2HWC1 4OUEA 3E5QA 4D0QA 4FOWA 3RZMA 5FYSA 1FOD3 4FPKA 5FXVA 4LPLA 4SBVA 3UK9A 3VN4A 1PIV2 4Q4X2 4CCNA 1YQ8A 4QB2A 4QX3A 1I9RA 3D8CA 4N9HA 4OQ8A 4XJWA 2VBPA 2W87A 2XDVA 3RWKX 1XOYA 1ZA7A 1NX9A 4GWJA 1HJGA 4PQ9A 3KGLA 4LKSA 5DAWA 1NXMA 1NCQC 1G7YA 4Y1ZA 3E6CC 2D3SA 1A6CA 4IEUA 1BBT3 4LBLA 2J1TA 5DAQA 3KCYA 5A1LA 2WZR3 3M3CA 4XFFA 3ORJA 5LA9A 4JDOA 4AEDA 1CX4A 5T5PA 1HLCA 2BQPA 3ZR6A 1RYYA 4Q1RA 2A75A 2YPDA 2C9KA 2OQ6A 4LK7A 2W92A 4Q0PA 4CP9B 4JHZA 2O14A 2A6YA 4A3XA 2SBAA 1FPN2 3OD0A 1B09A 1QDOA 2HEYF 1PGL2 2VR4A 1LOGA 3FC0A 1L7RA 1C3HA 1NZIA 3OPWA 3POJA 2C6SA 4R9DA 1LHUA 4HT1T 5FUNA 3AK0A 1RTVA 4LBQD 3LIHA 2ZJCA 1GOHA 4N7UA 4TN7A 2E51A 5D1IA 5F9TA 3BU0A 1GWLA 4RN5A 4QPIB 4FPLA 4QT6A 2RHPA 5FZ6A 2D5FA 1DQ4A 2JE8A 4OHYA 4RGGA 5EFUA 3AB0A 2RS11 5CFDA 3ECQA 4DQAA 3JBG3 4XF9A 2XBO1 2E9QA 4LNVA 3C7OA 4XDOA 2FMDA 2CGNA 1AR62 3USUB 1LNSA 2W1UA 5FYTA 1QJY1 1NCRB 1X33A 4HLTA 2ZGQA 2I07B 3LA3A 4XETA 5FR3A 1APNA 1AYM3 1D2SA 1LCLA 1HV0A 1R1A3 3DYPA 1AR91 5L9RA 3VBSA 5GJ6A 2ZKLA 2XJPA 3LWCA 2ZEZA 3IMMA 4NIGA 1RUE1 3IB3A 1VLNA 4IV3C 1N1YA 4QXHA 4IETA 4Y5Z0 4D6SA 2WO3A 2D6MA 2MEV1 1V00A 1QH7A 3MI8A 3I2FA 1FXZA 1GYKA 1OOPB 2WS93 2XUMA 2ZXQA 4XILA 3AKRA 4JC1A 3VD4A 3UYJA 4I30A 1HRI3 5GZFA 3K4AA 3VDDA 4FSJA 2CWSA 4HFSA 1ENQA 4YGDA 3N4MA 3D4KA 1LHWA 1NG0A 4WM7C 4QB1A 3Q8EA 1OPMA 5JZGB 2PAKA 1W90A 3NNFA 3HNYM 1Q56A 3C7EA 4KWKA 5FY9A 1I5PA 1Z0HA 4HBNA 4JQRA 5A3PA 3D3AA 2P6CA 3T1LA 4AFBA 2JD9A 4MLOA 1FOD1 4CEYC 1QWRA 1LOCA 1WCSA 3O14A 4O9GA 5F2SA 4I3GA 1NCQA 4QAWA 1K3IA 2D40A 3WY6A 4BQ4A 3N7MA 5FFOC 4QWNA 4GWIA 4QD2A 1U5ZA 3GXUA 4A7KA 4UW5A 3ZFFC 1JN2P 2PTMA 4JGYC 1CJDA 1UY0A 2GC0A 1FMD3 2DCTA 3ZKYA 2WLQA 4HONA 1IG0A 1NXD1 1UMHA 2VNGA 4Y4YA 1XYNA 1AYN3 1DGWX 3MIFA 3PHMA 5F37A 2WZR1 1JS9A 1PNFA 4CDXB 4C0BA 4Q26A 4GB32 4YW2A 4QGNA 5IHRA 1O8SA 4K1YA 3HPNA 4ASKA 1V9U2 2UY9A 4HVRA 4AQ2A 3VL8A 2P3IA 1QJEA 1WMFA 1TNFA 4ET7A 3PNAA 3SHRA 4EROA 2UURA 3THCA 4E4ZA 2XONA 4EN6B 3ZXLA 2BFUS 2ATFA 2W47A 1C1FA 5L9BA 2W3JA 5F6LB 1RIRA 2E7TA 4B4PA 1JYNA 5K4LA 2VQ0A 1DLLA 2VPVA 1XC6A 5F2WA 4R8HA 1EUTA 2CDPA 2Z69A 1SACA 3D0SA 4CCEA 2BVBA 1ZZCA 3WQ1A 4Q8KA 1NZCA 4UOJA 2ES3A 4QHZA 2VUAA 4BA6A 4HKWA 2WZEA 3JBG1 5JOYA 3OGRA 2BFUL 4YZ5A 2VNVA 4EN8B 5FP7A 5K9YA 1YHFA 2XPJA 1ULPA 3JB8A 4CP1A 3OY8A 4JKKA 2YHJA 1JH5A 1H30A 4Q2FA 2EXKA 2X09A 4HSLA 1UXZA 2VOKA 4IV3A 1Y9MA 4FXGB 3CL1A 2V5YA 5E88A 3BTAA 1AYM1 1R1A1 4ONUA 4A45A 2PN5A 3HNBM 1RUI2 4XUPA 4XMIA 3U78A 5LWBA 3NJZA 3WXPA 4W65A 3PDQA 2X8KA 4SLIA 4NRMA 1CAXB 1COV3 3KVAA 3WW1A 1LULA 4AFCA 5F32A 3HMYA 4RA0A 4AVCA 1S0CA 5T54A 1ZZBA 3T0DA 4YVSC 3QOPA 4WM7A 3MW3A 2GC3A 4XE9A 4L99A 5I0UA 2I74A 4Q4W3 1UYZA 4C8DA 5GZGA 4XABA 2HBUA 2JB4A 4Y4RA 3VD5A 4NRPA 3SXWA 2OUJA 1RUJ2 1DLCA 1XNTA 4DMIA 4D6QA 1S2EA 5FYHA 4EWDA 1QJX3 2QDRA 5FY8A 5AC92 4J1WA 3POEA 1OLQA 1UYPA 2Y6FA 2GP5A 5C3SA 2VMGA 1J3RA 3MW4A 1YC61 3SEPA 1RVF2 4EWAA 1PX3A 5KC5A 4FFGA 1EV12 3ZFFA 3WVJA 4JGYA 1ZRFA 5IVCA 2XLAA 2PLV3 4QXBA 2GP3A 5JOZA 1LEMA 2X10A 2VNOA 4FPFA 4QX0A 4Y1VA 1EAH3 4Q4Y3 3HQRA 3PURA 1RHI3 3T2QA 1AR72 3UKNA 2G19A 2P17A 3NWKA 3U10A 5DUWA 3I49A 1FMD1 1F35A 5I0DA 5JXHA 3LEGA 4GKYA 4UW6A 1ZZ7A 2OZ6A 2GNTA 2WBKA 3X29B 1AYN1 2BNOA 3ZSMA 3OYWA 1AL21 4M3CB 2GZWA 4META 4WV8A 5DAXA 4MGZE 3G7DA 4B3NA 4CDWB 4AW7A 4COYA 5BNOA 5C6CA 3VBOC 4FPEA 2WQ4A 3MHZA 4A41A 1OKQA 3EYPA 1NQJA 2A6WA 1SQ4A 3M2MA 5FCCA 4BQXA 4CEWC 3H8OA 3I2DA 4XFGA 2OVUA 3E6BA 2WFF2 2AEYA 1K45A 1ZA4A 2K0GA 2QQUA 1E57A 3H1MA 1MR5A 1W3XA 2LROA 3ACGA 3INAA 5I91A 4NIHA 5FMOL 3SCHA 5J36A 2KM2A 1LRHA 3LB9A 2ZGNA 3S57A 4RGKA 3ZN4A 1JZ3A 3GNEA 4AEDB 4BIFA 4MG2A 1VBE3 4S2FA 3UJQA 4AYUA 2PQQA 3PUAA 3ZSLA 4A4AA 1BK1A 5JPMB 2BJSA 2D6LX 5FYVA 2ZEXA 4LBQA 3O1PA 1POV3 3RYPA 3VB9A 4AAXA 3U4SA 1ZX5A 1VMFA 4PLNA 2ZKNA 5IT6A 3RDIA 5F5QA 1D0HA 3QLQA 1HRV3 4P02B 4RYDA 4CYDA 2VXJA 4JX0A 1LODA 2QQVA 3PU3A 3ACHA 4LOTA 5DG1A 5CB7A 4D8MA 3S5QA 4TZDA 3LDRA 4LLFA 4TYSA 2PHFA 1R093 4ORFA 4QDSA 4AE2A 1GOFA 1F15A 3T3YA 3SITA 2ARAA 1HN1A 1SG3A 3CJXA 3J7NA 4QXKA 5HXMA 4YVSA 4AG4A 5CFDB 1RXFA 5CNAA 1DQ0A 1UOBA 2RR13 5CZKA 1C1LA 1IS6A 1CN1A 3PVBB 1PM7A 2TEPA 1ZREA 3VHNA 4LO7A 1BJQA 2I2SA 1AX1A 1QQP2 3CBNA 4UW3A 1BVP1 4Y24A 5FZDA 3U11A 4COWA 1ND2B 1HB4A 4CUAA 4ZKTB 1W05A 3ZXGA 3GZTB 1JXNA 1CWPA 1W6PA 2DCKA 4NVPA 2YC4A 5FPBA 4IEQA 1OLME 4AEKA 4QPGC 2V5DA 1XPWA 2V73A 5T5OA 2GN3A 1GU3A 2LUWA 1QHDA 5FXZA 1H2NA 3GZUC 2W68A 4EWEA 4CU8A 4ATFA 5FP4A 1B35C 1IQAA 2HKXA 2WLPA 1I1EA 1NCRC 3WD5A 1WW7A 1C8NA 5J7MA 4ZXKA 1O91A 4UFJA 2D6OX 2VCBA 3M70A 2JKBA 4TTGA 4JV4A 3DF0A 5FWEA 4D6RA 1GZWA 2PLV1 4XC9A 1RUG3 4FT8A 4YPJA 4LULA 1IHMA 1VRH3 4XUTA 3C7GA 1HB3A 2W1WA 3MLLA 4E9KA 1QKQA 1OSGA 3E5XA 3ZXEA 3GCWA 4Q4Y1 4YW4A 3UGGA 1RHI1 2RS32 5FDBA 1BK0A 4MUVA 4XUNA 2WT0A 3VBOA 1W2OA 4GMP3 1UY2A 1US2A 1W0PA 5IVYA 2GH8A 1AX0A 4I09A 2FZ1A 3TN93 4BQ1A 4CEWA 3U4XA 2Q1ZB 2D44A 2PYTA 2DURA 2Z2SB 4YM0A 4FP3A 4BOWA 1F4HA 2DCJA 1OHFA 2C9AA 3M1HA 1WKYA 4QKNA 5B4XA 4MGTA 1F5FA 4CCJA 1UO9A 3LIGA 4Z07A 4W6WA 3H1YA 3IDEA 3ILNA 3RYRA 4D94A 1DZQA 1H1AA 2A1XA 4E8CA 2Q0AA 3OEBA 3LPFA 3AJYA 1BLZA 4KU8A 4NRQA 1RMU3 4OUMA 4P5HA 4R4ZA 4ARXA 2Y6JA 1TVGA 3IDBB 4DPNA 5EPAA 5A70A 5FP8A 1XYPA 4CPBD 4RD7A 3UJOA 5KHJA 1BVVA 2QVSB 1YUDA 4B7KA 1LOFC 1JU4A 5KC6A 4LBJA 2EVXA 4AR2A 4EYUA 1DHKB 4LITA 4EN0A 2G9GA 1GBGA 3MLJA 2ET1A 1VBE1 2R32A 3LA2A 1MACA 2Y6KA 1QEXA 1GP5A 3LEKA 2AENA 4FBFA 1LESA 2BBAA 2YFUA 4IEWA 4LXLA 4YVWC 3C3VA 5FKCA 4ARYA 3WG1A 2IXIA 4IGOA 1POV1 3O0XA 4YRDA 1ZM1A 3WV6A 3J8F3 5SV8A 5L9VA 4Y1XA 5E89A 4H3WA 4CP9A 3GALA 1S2BA 2TNFA 3DEMA 1UOJA 1UKRA 4IXLA 1X7NA 1HRV1 3A21A 1ZVFA 3RSJA 4DFSA 2ZGOA 1POQA 4OMCA 4CDXC 3KMHA 4LA2A 1UX6A 4XPVA 1QJU2 1WGPA 1R091 2XLFA 1DZRA 3BYWA 2NP0A 2W91A 3HT1A 4AI1A 4HPKB 3NJVA 4P9IA 1VBC2 1WMXA 4HMZA 2AC1A 4XJZA 5A7OA 3RS6A 2XBO2 3OSDA 1PMHX 3NO8A 3FMGA 1R64A 3Q9OA 4CU6A 2PXJA 4QDQA 2HYXA 4Q4V2 4Z82A 5CAZA 1GSLA 3J26N 3VD7A 3ZFGC 1GFF2 1ULOA 2VZVA 4YM2A 2RR11 4XYXA 1JBCA 2LW8A 4Y3OA 1XQNA 4N53C 5FPUA 4BK5A 1JU3A 2AACA 3HBZA 4QPGA 1J59A 1OD5A 3HBKA 4IV3B 2OIIA 3IIIA 4AHWA 1JODA 1REFA 3E5UA 4TSVA 1PNGA 3SKVA 1S0GA 3AKPA 3VZKA 5DPNA 3VD3A 1JYTA 3VBHB 1B35A 1PHMA 4NAMA 1O7FA 1NCRA 2EICA 5IVFA 4LA3A 2VZUA 3WZ1A 2XVLA 1Q8SA 3R05A 5FZLA 4AXOA 3CIHA 5BV6A 4Y1YA 4TLGA 1IZ3A 3LKJA 4O9EA 2P4EA 3UT0A 4S2DA 2ADDA 2LALA 3OPTA 2FMYA 2LTNA 1MZEA 2P3KA 3KWVA 5EYXA 5IUQA 1W9TA 3FHQA 3QD6A 5GZDA 1ZBE3 1P8JA 2BNMA 3AP6A 1PK6B 4FAHA 1XB9A 5JSPA 4ASLA 3B69A 5LBFA 1RUG1 1HN0A 4XF4A 4MOAA 1VRH1 2WWJA 1W8HA 1HQLA 5D2AA 4CEYB 5D8AB 2ZX3A 3K4ZA 2VH9A 2KD7A 2HWF2 4HG6B 4XBLA 1N3OA 1ASJ3 4GMP1 2E53A 2Q8CA 3NNGA 1RC6A 4M0HA 3TN91 4EQVA 4IW3A 4HK8A 4LKFA 4O65A 4XMAA 5A32B 3ZYRA 4CDQB 5C7GA 2EA7A 2RM23 4YSFA 4YM3A 3EJKA 3JB4C 2PHWA 2YPJA 1RUC2 3OTFA 4JDMA 5JIAA 1LOFA 3H7YA 5FO9B 4ZPIA 1STMA 2Q30A 1RUOA 1PO12 3J9SA 2CGOA 3KCXA 5LY2A 5JAXA 5GZEA 3FLTA 4YVWA 5FXWA 1BBT2 2WZR2 3N9PA 2A73B 4OLLA 1H2KA 4LHNA 4FPOB 5LBCA 3WCRA 4BE3A 4BIOA 4E2QA 1C5IA 2JJ6A 2JKXA 4L9BA 1DDLA 1D4M3 1N1VA 4NIIA 1U5YA 2BZDA 3WNOA 4EZ4A 1OF4A 4KGQA 2LRPA 4YNIA 1UY1A 4CDXA 5JMOA 2CWMA 4K8RB 3BPSA 3K77A 3RI8A 1MZFA 1WLDA 3J8F1 4NUBA 5JI7A 4LOSA 2YG0A 1XNCA 1ZYBA 3N9OA 2B42B 1FYUA 2P2KA 3WW3A 1MZ5A 3WQ7A 5BYNA 2DFBA 3ZXFA 3NAPC 1AVBA 2J1RA 1V6NA 4AOCA 4CDWC 4XURA 5A6XA 2C0ZA 3ZFGA 3P5BA 3GJBA 3O0WA 4NPRA 1ZRIA 4WVZA 4B29A 3P6BA 4N53A 1G9DA 2FZ2A 3KQRA 2P37A 5IK7A 3GJAA 3I3EA 1BEV3 5DN2A 2JG9B 2JIGA 4R4XA 2OKXA 1X36A 3GCXA 2TUNA 4F8AA 2YXSA 3KS7A 5FY1A 3S0MA 2RJKA 5EQUA 1Y7BA 5J37A 5E6HA 4YFZA 1LKNA 3CQOA 2BERA 4FFFA 5DAPA 1K5JA 4YWAA 5FIXA 3W5MA 5CKNA 1VBD3 1NLSA 4CUGA 3ACLA 3WEZA 4UBGA 1X9PA 3IBMA 1V6MA 4XAEA 4BQ3A 1R1A2 2PELA 3ZMNA 3KVBA 4GJYA 5AFEA 2VM9A 3N7JA 1RUF3 5BNPC 4UFIA 1KFUL 1WCDJ 2YMZA 5CU1A 2WA4A 2WAOA 3AYDA 4BDVB 4IEXA 2VVEA 5F5CA 2AGSA 2PA7A 4PF5A 3WQ0A 5JXIA 3N9NA 2W39A 1SBFA 2RS13 4I3PA 1QIQA 1Y3TA 3QACA 5DABA 5FO7B 3FJSA 1LR5A 2BTVC 2WS92 2Y34A 3H0OA 3LOIA 3PVNA 2XKPA 1ULCA 2YROA 4OI0A 2TBVA 1CAXA 4XJAA 4N43B 4P5YA 1HRI2 3ZIXA 5H9SA 1LU2A 1ZBE1 4YARA 1RUD3 1XYOA 1W6PB 4MGYE 3WNNA 4H7MA 4PJYA 1OA2A 2ADEA 4BLJA 3I8TA 2R1BA 1KEXA 1NE4A 2W46A 3WLUA 4Q8LA 1HDKA 4GKXA 3VDAA 2R063 3BOWA 3W58A 1ASJ1 2VJXA 4YW1A 4QGMA 3CF6E 5LY1A 3RZHA 3OUHA 2E6VA 1U12A 3MEPA 2MEV3 5JXJA 2NN8A 1DG6A 1ND2C 3PJQA 4NR1A 2O8QA 3O7OA 5LA2A 1W6OB 4MGSA 4ZXEA 5IYYA 3HIFA 1IPJA 2XR4A 2RM21 4HETA 4TXWA 1HQNA 4HVQA 2CU5A 1GZCA 1MQTB 5A7WB 3RVHA 2XVGA 4XBQA 3WT3A 4E4SA 1C5HA 4AF9A 4FOQA 1D4VB 1T2XA 1SLTA 3A23A 3NV1A 2RDQA 3DPRB 3OJBA 5M0TA 3PTRB 3SQOA 5A3UA 3FUOA 2J1EA 2G9ZA 1GANA 2YBKA 1OVSA 3POIA 3H9AA 4BXSV 2HWD1 3HWJA 4Q0VA 4LKEA 3DCQA 1OI6A 1D7PM 1H2MA 2DUPA 1D4M1 4MYEA 3ON7A 3BOPA 4CE8A 1C28A 2J42A 1GZTA 2JG8B 3PUQA 4RL7A 2WT1A 1CR7A 3OUJA 3NAPA 2R073 4M3CA 4QKDA 4CDWA 5FBJA 3WDXA 2RVAA 1RXGA 2BWCA 2FCVA 4XF1A 1UYXA 5HCFA 1SCRA 3ZPYA 1XXNA 1HX6A 1VBA3 1DYKA 1GNZA 5FZOB 1E5RA 3WX5A 2GNBA 3AC0A 3LGRA 4QXCA 4PBOA 3OCPA 3A22A 1F5JA 3M3OA 5LRRA 5LZ6A 4LIVA 1FAYA 1A78A 2DFCA 2GN7A 4UW4A 1NA1B 2VOWA 4OUSA 2VZQA 2VBBA 3OBZA 5DDJ3 3HR9A 5JPNB 2V09A 3D82A 5I8YA 2R041 3M3IA 1PMIA 1BEV1 3U07A 4URTA 3AL5A 4I0WB 1UN1A 2KR2A 2XQRA 5DXDA 4NHMA 5BNPA 5GALA 2VZPA 3MO4A 2CHHA 5HCAA 2KXLA 2R6QA 1MPXA 2H6BA 3GHNA 2E31A 2FDHA 1VBD1 1O6UA 1FNYA 2W2IA 1OLRA 1SMVA 1HXS3 5KHGA 2OA2A 5GM0A 3KT7A 3K4DA 2QE3A 4BK4A 5FY7A 4M4PA 1RUF1 4DNYA 4L11A 5TSWA 1E5HA 5EJ1B 4BQYA 3VGIA 5IK5A 2VECA 4XIKA 1COV2 5DAVA 5FXXA 2YV8A 4KQ7A 1V6OA 4R9BA 3ZDVA 4BMBA 3I3BA 4LUMA 2XHKA 4ASMB 1FNZA 2EF6A 4EN9B 2VQAA 5AVPA 2WQZC 2CAVA 2VL4A 3AXEA 4PLMA 4QPGB 4Q4W2 3MLKA 4K20A 1UAIA 1J1TA 5FZIA 2PFWA 4PHZA 3LQCA 4UYBA 1HB2A 5FJHA 3N9MA 3VKOA 1B35B 1RUD1 3N9QA 1QJX2 2PHLA 5FZMA 3SH5A 1ND2A 4DZGA 4CCKA 4WZFA 1AUYA 4FTBA 2ZHKA 3BVCA 1FX5A 4UWDA 2GMPA 1RUH3 4HK9A 3RYKA 3UNPA 1XU2A 1YQ6A 1W03A 2R061 2Y0IA 2CY6A 1BMV2 5ERLA 3HNMA 2PLV2 4I0BA 1NLRA 4XTMA 3VBHC 4B8EA 5KHKA 1I3HA 2C24A 1ZBA3 3Q8FA 5GLTA 1EAH2 3NNJA 4XFCA 5FZ7A 1TME3 2OYZA 3POFA 2V72A 4CSWA 5A3TA 4URAA 4LBNA 2JIJA 1XE8A 2JDUA 2CGPA 4IDZA 3LD8A 2XJUA 4KWUA 3J7MA 5CFCB 2XOMA 1NKGA 4JZRA 1PK6C 4D3WA 4LE4A 1UYYA 3I2HA 5ANQA 3JUUA 3RZGA 2R30A 1GR3A 3ZYPA 5J1XA 4YM1A 4XHBA 1H1IA 2H0VA 3URFA 2K46A 1J3QA 2QQNA 2AYHA 1X82A 2R071 5D8AC 3U0ZA 1OT5A 3AP5A 2VU9A 4X6QB 1AF9A 3NVCA 1VBA1 4KWLA 1KJLA 5A3WA 3U14A 3AFGA 4YVWB 3H8XA 2BEOA 1O3QA 1KRIA 1DGWA 5FZBA 4HOOA 3FHAA 1U5XA 5FLHA 1SLCA 4OZOA 5FQ0B 3V56A 1R082 4CDQC 1UZ0A 3V65A 2CDOA 3T4HB 3ELNA 4AVTA 1ZZ9A 3IMNA 1LGNA 5DDJ1 1AL23 1I6XA 3WR0A 5CBLA 1CAUB 3N35A 5FYCA 5I8SA 4AK3A 2D43A 1GV9A 5CG9A 4LO4B 1BYHA 2GNDA 4FPCA 2XB6C 4NWWA 2OT7A 3H42B 5FZ0A 4LO5B 1DGRA 1DQ1A 1DZTA 2ERFA 2UYAA 3AMPA 3APBA 4R52A 1R092 5A3MA 1V6LA 3TEZA 2QQOA 3ZFGB 1CAWB 2E33A 4QX2A 4CZSA 1HXS1 2B9VA 2V4VA 3AVRA 4N53B 1VBB3 2WSUA 3IAQA 3M8LA 4KGGA 2B7YA 3PUHA 5JMCA 4QU2A 1D0GA 3E97A 1YQCA 3AL6A 2RR12 5FPVA 4HPKA 2D7FA 3VL9A 1PGW1 2DYCA 3POWA 2XJVA 2GH2A 2O1QA 3I2GA 2XWJB 3LAGA 4PT6A 3THTA 3BKZA 2XJTA 1T6BX 2DDUA 2CV6A 2R16A 4Q4X3 5F7UA 3ZPOA 1QJFA 5FZ4A 1AR83 1GQGA 3T4VA 2Q1MA 5CA6A 2C1FA 1TZOA 2JG9C 2PHRA 3FLPA 4QX8A 4BB3A 2A3YA 2BRTA 2VMDA 3BB6A 4K21A 4XJ9A 2ORZA 3VBHA 5IAVA 3VKLA 3TOJA 4XXAA 3VBRC 4DXTA 3RZLA 2WFPA 3FBYA 1CIYA 1RUH1 1YFWA 4V2WA 5FZKA 3ZYHA 5A33B 5FUIA 3RZKA 1LB2A 1NYWA 3WG3A 3IWZA 1WA6X 4P00B 5FYYA 4GWNA 4LHKA 3VKNA 5ACA2 3LFIA 1RUG2 4CXXA 1EPWA 1OMIA 5IVVA 1F8VA 3GM8A 5LRSA 4OZXA 1ZBA1 4PDWB 3B94A 2GMEA 4MGKE 3WF4A 4AI3A 3I2IA 5FYBA 1FPN3 4AVBA 1PK6A 4Y33A 1TME1 1YLLA 3NJXA 4Q0QA 4LR4A 4NWVA 2R0HA 1QXJA 2VMCA 3TWIA 5C4WB 4Y1UA 3BTXA 3F2ZA 3C2UA 5FREA 5G04L 4CEYA 5D8AA 1WMEA 4N43C 2W1SA 4FQ4A 3NW4A 1Q8QA 4GJZA 4QX7A 3ZM8A 1F31A 2E7QA 1PO23 1SPPB 3CMGA 2DCYA 1JOJA 1XSQA 1E5IA 3K51A 4J6GA 5FZEA 2GC2A 5A32A 1Z7S1 4AI9A 4CDQA 1RMU2 4Z1VA 2XLGA 1CIWA 4COVA 2C5DA 3KV9A 5CEHA 4GAZA 2QQJA 2Q4SA 2VW1A 1MVQA 1W8WA 3BI3A 2WC2A 1S55A 4ZY9A 3SH4A 3P3PA 3NKGA 1IS3A 5J09A 4BQ2A 1XBFA 3VV1A 4QU1A 5FPAA 5F8PA 1J1LA 3AZWA 4LLOA 5JLVA 4AI0A 4AVVA 3BTZA 3POGA 3WDYA 1KDMA 1MQTC 5EZWA 2ET7A 3K48A 5J98B 2WO1A 3NAPB 5FMOS 2WNVC 3ILFA 2QQIA 3ITQA 3J8F2 3MV01 1RJ8A 4F83A 3POBA 3DPRC 1F9KA 1TEIA 2D93A 2HEVF 3PMSA 2OX0A 4D69A 4B7EA 5GLWA 1H8TC 1WW6A 3B9CA 2W94A 3UL2A 3ENRA 3ETQA 2GDFA 1VMJA 2SLIA 2EALA 3EHKA 4PF1A 5A6ZA 4N8MA 2FCUA 1UCXA 5FYIA 3WDVA 1DYPA 2PHDA 4ZU4A 4XDPA 2JG8C 2HWE3 2HWB2 5D21A 2V4AA 2RS53 3LSDA 1GNHA 5LK5A 1VBB1 5K7PA 3WUDA 2RMU3 1UPSA 3UGHA 1WUVA 1UZYA 1Y43B 2OS2A 5FZHA 3MDPA 4CP0A 4AGRA 2A71A 1VPHA 2W5FA 1HV1A 5HI0A 5BNPB 1JZ6A 2JG9A 3O12A 2VO5A 1O3SA 4ZONA 2AZ5A 4XDQA 1GLHA 2WSVA 5A7PA 3RMXA 1UXXX 4FPYA 2QQPA 4E4HA 1NA1C 5FLJA 4IE5A 1OQDA 4DB5A 4N9IA 2VZOA 3IN9A 1PVXA 4BLIA 4Q4X1 3VBRA 2BGOA 1AR81 2NZ9A 3DUIA 3VBFB 2FCTA 3UKTA 1M4WA 4DRVA 1ZRRA 1WA4A 4W50A 2H6CA 5FOJB 2DUQA 1E5SA 3V64A 1LTEA 1IGOA 4IERA 4OVEA 1W0NA 4XQDA 4A3ZA 3H8UA 1IS5A 3KT4A 3I54A 4OHVA 3TAYA 2UWCA 2BWAA 2QQWA 3P3NA 4BXFA 1L7LA 1YRZA 1ZBE2 1V6IA 1H9PA 2JD4A 4GA9A 3HN1A 2ARCA 1C8M2 1ODMA 4HL0A 4LORA 2VQUA 5HXVA 4DIQA 2B8MA 4O61A 1W2TA 3RZZA 1FT9A 4N43A 5BNNC 5BXXA 2IFRA 3AMQA 1F2NA 4BWOA 1FPN1 1PGL1 1W28A 4FFHA 4LK6A 5CVRA 2CYFA 5K0UB 1OXCA 3ME2A 4KH9A 3RGBA 2BBVA 4FOYA 2ZGPA 2P1BA 3D0JA 3ACIA 5BUVA 5IK4A 2IWGB 3B3QE 4QGLA 2RM22 2FD8A 5FMDA 2WRAA 3BPZA 5LASA 5C71A 4DUXA 3I4IA 5JSOA 3HAGA 1IOAA 5LBEA 1PO21 1SFYA 2AEZA 2F4PA 2H0BA 4COUA 2G9FA 5ISLA 1W6OA 3AKTA 4QHOA 4BQ5A 5LCWL 5A7QA 3NRUA 1MQTA 1XSRA 2WZPP 5A7WA 2WDBA 4QKBA 1ODNA 3I59A 4P14A 5FV3A 3QCWA 2NLRA 2HLEA 2RV9A 2WNVA 1NY72 3POSA 4WM8B 5BPXA 2QZ3A 4IE7A 3DPRA 3MIEA 4PIYA 4JTOA 4AGGA 5L19A 1MEC2 2AUYA 2BOJA 2DCZA 2HWC2 3H3LA 5CKQA 1H8TA 1QU0A 1SLBA 1I5ZA 5I93A 1URXA 2XJQA 2Q8EA 1VMHA 3O0VA 4C1WA 3RRDA 1J3PA 1RB8G 2VTXA 5H9QA 4AQTA 3WDWA 2JG8A 3WINE 2ZX0A 3TEXA 1A34A 3MPPG 5T50A 5CFCC 1PM4A 1S0BA 3C8XA 1W0OA 3NL1A 5HCHA 3ST7A 1W2NA 3BIWE 3CO2A 5I0RA 4DEVA 1SFNA 3GHMA 2WO7A 3PIJA 4CCCA 3WP6A 1HB1A 1UPIA 4I01A 1AJKA 5FZOA 2WUHA 4UF0A 5FKBA 4Y5SA 1RUJ3 3FE5A 4XFIA 4NIAA 2BNNA 4OFGA 2HWE1 1BEV2 1W9YA 2A6ZA 4RSUA 4XXPA 2RS51 5LA1A 3S5AA 4PI0A 5AC93 3NV3A 2WL1A 1NA1A 4KNCA 2IUWA 2CTVA 4W8JA 3N36A 2RMU1 3ZMOA 4PI2A 4AEJA 1A8DA 3VZMA 4BMEA 3OD4A 5FYZA 3OF1A 4UT5A 3B00A 2YC2A 2VZRA 2E26A 4MXWB 3MBWA 5T55A 1RVF3 1GQHA 1N3PA 1VBD2 1BCXA 1BXHA 1LJ7A 2DTYA 3GBGA 4K8FA 4RGAA 4B1MA 4XHXA 1IS4A 2EIGA 5CYYA 4RHV3 2VE1A 3I2JA 2QQMA 4V1PA 3TEWA 2JDZA 1CVNA 3ZOIA 2XGXA 4JGZC 1YFUA 1ENXA 2VUJA 1UD1A 4XFBA 4KBBA 2YYOA 4AFDA 3SEEA 2P3YA 1AR73 3L2YA 3CHXA 2RS12 4FAGA 3HQUA 3MUZ1 1W6NB 2CAUA 1AXYA 2K2SA 5BNNA 4PQQA 1UMZA 3I3DA 5A6YA 2WWUA 1RL3A 4L0PA 4DEQA 4ES8A 3SCFA 4UBHA 3MZHA 1QJY2 1RUD2 1RITA 3WDUA 3RQ0A 3VDCA 1W8TA 3WHTA 4K6BA 1IPSA 1V6JA 4A2UA 2A3WA 5DZEA 1X8MA 2VOTA 3LEMA 2RDNA 3PL0A 4F3JA 5C70A 1AR92 1S0FA 1LOEA 1ENRA 1WLWA 2DU1A 4MHRA 3IDAA 1C57A 1RUE2 2Q1FA 4MVTA 4XUQA 4JRAA 5FZ3A 4CCOA 2MEV2 4E4DX 4YLZA 3KF3A 3CJIB 1YWKA 1OQ1A 4KG0A 3LCPA 3WW2A 1CZSA 2ZS6B 2YZ4A 3AMMA 1OUXA 3B93A 2YFZA 5CIRA 2A6XA 4XF0A 4XJUA 3WUCA 3ZR5A 4YGCA 4AHZA 3O1SA 4QQLA 5H9RA 2BV4A 4IE4A 1KD7A 1U5IA 3DXUA 1UIKA 1WCKA 2XVKA 4M00A 2DU0A 3V0AB 1GQPA 2ZHNA 1O5LA 2BYVE 2WT2A 1VE0A 1O59A 4PIZA 1QGLA 4K9SA 2JX9A 3D6EA 2IC1A 3DV8A 3FHIB 4NHYA 5ABJB 2IZWA 2XJRA 4GZ9A 1KJRA 5KBFA 4PDWC 4JKMA 4YYOA 5CFCA 2FDIA 3CNAA 1FOD2 2ZX1A 5HCBA 2R072 2MPFA 2P3JA 5EYYA 3NV4A 3IAPA 4DO0A 1VBA2 3KF5A 5FY5A 4FO9A 4NJ4A 3JXSA 5C4WC 1AX2A 3IPVB 4W6XA 3UKVA 1W8UA 1JYIA 2ETEA 5FK8A 1K5MB 3CLPA 2NM1A 3UESA 3AMNA 3Q8BA 4LO8A 1UY4A 4IL7A 3KT1A 4UFHA 3WCSA 5JCTA 3VZJA 4JHTA 4JQTA 4CXWA 1RINA 5C33A 2E32A 5DDJ2 1RUJ1 1JYVA 2HWD3 5FQ0A 4XJ8A 4AI8A 5DUXA 1V70A 2WNOA 4CCDA 2D3PA 4L92A 5AC91 2IFWA 1JHNA 1G9BA 2XHNA 5FJKA 4LHLA 4CCMA 5C3QA 2BUKA 4JGZA 1EP0A 4IGQA 5FPZA 4DS0A 3AKSA 1CAUA 2MHFA 3JQWA 5I0SA 5C9AB 5KXBA 5FMBA 3K3OA 1RVF1 4Z2AA 2HYKA 2YUEA 3AZXA 4UFKA 1HXS2 1QNWA 4NN0A 1SFPA 1UOGA 4RHV1 3SNMA 4XF3A 4UFMA 5L7OC 2VOXA 1UKGA 2YBSA 1OQEA 3H7JA 1Z78A 4AVSA 3DXTA 4Q29A 1CAWA 4QPYA 1Q43A 4WZCA 4HN1A 1AR71 2B5HA 2ZHLA 3MW2A 4EZHA 2R043 3DN7A 1XNKA 4MV2A 3JBG2 4MGIE 1S0DA 4P9YA 1PX4A 1CESA 3ZN5A 4IESA 1LGCA 5C8WA 3AJZA 1K12A 1TMF3 2PHUA 2OPKA 2W08A 5C8CB 5EXOA 1CPNA 5GLUA 3VBRB 4JVAA 5JXGA 2VMFA 3AKQA 3NJYA 1W8FA 1J58A 1DU3D 3VUOA 4OQ9A 3GGLA 4W4ZA 4DOUA 1AYM2 3OEAA 2W95A 4A7YA 2WFF1 2R0FA 1LHNA 4FPGA 4I02A 1TG7A 2Y6LA 1RUH2 2WA3A 2ZPXA 4GULA 3R0RA 4OHXA 2X05A 1OUSA 1UZZA 1FV2A 1OPOA 1XU1A 2VNRA 2D6PA 2VXRA 1W6QB 4AVAA 3U1XA 3USSA 3BUCA 1R1ZA 1OLMA 1W8ZA 2NMNA 3RWNA 1WBFA 5EJZB 5IVEA 2B46X 2JENA 2PMWB 5A33A 3VBFC 1AXKA 2PAEA 3C7FA 5KXCA 4QKFA 3FFZA 1SCSA 3S30A 1TME2 4XW3A 1UWWA 2DV9A 1ACCA 3AFKA 2I45A 4RS5B 4X8NA 3T2OA 4QX5A 2QUOA 4PDWA 3IZOA 4QX1A 3TNQA 1UNBA 4YFWA 1G8WA 3SKJE 1QJU3 2ZAAA 4A6SA 2ZEWA 1JZ2A 5C4WA 1YIPA 1H4HA 3VDBA 2GSYA 2IVIB 3RI9A 3SISA 2HEWF 2VW0A 5IFTA 1VBC3 3KLSA 3ZLIA 1W3VA 4AEMA 4Y5TA 4Q4V3 5KHIA 4CXYA 1GNYA 2IXJA 2ZCWA 3R4DB 1JOBA 1NUKA 1SPPA 4OMDA 3LPGA 3ROUA 3UV9A 5K0UC 1JZ5A 2D5HA 3ZIWA 1W99A 5FZ1A 1YCIA 5FPLA 4AFAA 4OI2A 3I59B 1WW5A 4QB6A 4J25A 4MX3A 4RFT0 2WNVB 2BPA2 3VHRA 4RR3B 1QQP1 2FBEA 1FMD2 2VCAA 3FZ3A 2Q8OA 2OPWA 4A44A 3AZZA 2Z5WA 5FY0A 3IM0A 2WIIB 1H8TB 4JKLA 1AYN2 1AL22 1AZDA 5B4NA 3QH6A 3S6PA 4OI1A 4AQSA 2D3RA 3TYJA 4GD4A 1SLLA 1MS4A 4TWTA 1F4AA 4QQ2A 1K42A 4COZA 3BIEA 4RQPB 5L7OA 3N7LA 1PZ9A 4WM8C 3TEYA 3AZVA 5A80A 4OCTA 4XZPA 1BKZA 2LM3A 5JVVA 3ZO0B 2WR9A 1MVEA 1NE6A 3BODA 1S0EA 3MF6A
chains in the Genus database with same CATH topology
2GNMA 3FLRA 1GKBA 1YJKA 1Q8PA 3WNXA 4XFHA 1QMJA 1KS5A 4IEYA 4DY5A 5EWSA 2YGLA 2OZJA 1XRUA 4AWDA 1ND3C 2PHXA 1YFYA 2HWF3 4CTEA 3L9JT 3ZSJA 3WOGA 1G9FA 4BPZA 4D7YA 4DXZA 3TRSB 1VJ2A 4EJRA 2ZACA 1YI7A 4KWJA 1CQ9A 4C90A 1AR82 1TMF1 2ZAHA 3AM2A 3GYDA 3VBUC 3H1WA 1RUC3 2CNAA 3BALA 4B4QA 2DTWA 3KGZA 1GZ9A 4GQ7A 2QCSB 1L3JA 4DINB 1PO13 3ZN6B 2VVFA 2XL7A 4PCRA 1V6KA 3M4FA 1CAVB 1QF3A 5B2GB 5JWPA 4FCAA 1VIWB 3VBFA 1BQPA 3MF9A 1SEFA 2ENRA 4E27A 1AJOA 2EXJA 2NYYA 4PIXA 2D6NA 5BNNB 3JD73 1FATA 3VKFC 4ZU7A 4IEOA 3TBDA 2ARXA 5BNQA 1VR3A 2UWBA 2GAUA 1VAKA 5F1RA 1Q5OA 2OUHA 3IT8A 3AP4A 1LHVA 3AX4A 2ZGUA 4Z92B 5L36A 4M01A 2IXKA 4KL1A 4U36A 3SCGA 4YW3A 5FPXA 2VULA 1ZZ6A 1O3TA 1QJU1 5K0UA 1PO22 1QOOA 4IV1B 3RJ2X 4YZ4A 1VBC1 5GLZA 4LBOA 2JEMA 4AHXA 1REEA 1SBEA 4JDNA 4Q4V1 5EV7A 4C1XA 1PVC3 3W59A 2A6VA 4FPHA 4K3UA 4Q4Y2 4YZ3A 1RHI2 4AQ6A 2GALA 3MFAA 3OBRA 3CJIC 4HVOA 2QKDA 3VHOA 1X50A 3H3ZA 1RUNA 4WM8A 2ZA9A 1OFNA 1H2LA 2YY1A 4D7SA 1LEDA 4C91A 1TE1B 4XFAA 5DG2A 2AR6A 1T6GC 3ZX7A 5GZCA 4GWMA 1NOVA 5I0TA 1Z7S3 4IEVA 5KWRA 1ONAA 1S0JA 3AP9A 1H4GA 1JW6A 1ND3A 2RE9A 2ZGTA 3FX3A 5ABJC 1QDCA 2W0XA 2ZOEB 5SV5A 1EPZA 2HWE2 2WINB 2RS52 3RMYA 1DGRN 1VBE2 1W6MA 3WDTA 2RMU2 2DVBA 2Q5TA 1MS1A 3POYA 1UW8A 2HWF1 3VBUA 2OW4A 5KXDA 1W39A 4GXLA 1O4YA 1YO8A 2O0OA 4JGZB 1K5MC 4Y22B 3DL3A 3WP4A 4Q27A 1SLIA 1KFXL 4Y20B 1SBDA 1HRV2 5H9PA 4MXWA 3N7KA 2WNUB 3W9AA 5FRAA 4WBBA 2X5IB 1RUC1 2G4IA 2UYBA 1VAMA 5FAXA 5JDBA 3AMHA 3GF6A 1HQWA 1PO11 3ES4A 2ZMKA 4FP2A 4P9GA 1YFXA 1ULFA 3H50A 4IEZA 4HSJA 1JYIA 3CU7A 1TNRA 5FTTC 3ZYIB 1BBT1 5C9AC 2O8OA 3NV2A 4FQZA 4ISRA 1TQ5A 3PMEA 4TLFA 4XQWA 4ZU5A 4QMAA 2HJIA 4MSVA 1N47A 3JD71 3JQXA 1W6NA 4PBPA 1WLCA 3SLIA 2XH6A 1OA4A 3IIAA 1N3QA 5BNOC 1PIV3 2VG9A 3ZFEB 4QHBA 1S0IA 4IEPA 4L97A 2QDNA 1OFSA 3V0BB 3KSCA 1Q3EA 3AP7A 3HQXA 3GZAA 4DRRA 2ZBJA 4LTAA 5C8CC 2YGMA 2YDEA 4GH4B 4JTNA 1CJPA 1ZRCA 1QH6A 2BGCA 3OBTA 2VGDA 3CJIA 4XOGA 4NOTA 4BHPA 2Y38A 4YGEA 4X8PA 2ZHMA 2B45X 4YGBA 1VRH2 4CP2A 3AXDA 1PVC1 1S1AA 1VALA 4W6YA 3OPZA 1KQRA 4MXVA 5KHHA 2BVVA 4JRLA 5J3UA 3V0AA 4NO4A 2A7AA 2XJSA 1W2UA 4Q1PA 1ZNPA 3ATGA 5J96B 3TN92 3RJRA 2PHTA 4YZ1A 4MZUA 4HANA 2DVGA 1AXZA 4IQPA 1O5UA 5ABJA 4RS5C 1HKDA 2WNEA 3I7DA 4I0AA 3PJYA 1KITA 4KG8A 2XKOA 3A4UA 2XL9A 4QM8A 3ZXJA 2WS91 4YG3A 3MPBA 1QJZA 2ZGLA 5JSRA 3H3UA 1AR63 3IPVA 3RNSA 1HRI1 1RJ7A 4FTEA 3ZYGA 1K5MA 3AYAA 2ZX2A 5FO8B 5JI9A 2FHRA 4C0HA 3L2HA 1Q8VA 5BY5A 1N1TA 2DF7A 1POV0 5L7OB 1WD3A 2W52A 4RR3C 3IKWA 4AGVA 2Z42A 4QQHA 4RHV2 1XNBA 4F7ZA 4K40A 5C9AA 3R4UA 4XEZA 4LBMA 1CGPA 2JICA 2EAKA 5F6KA 1DIWA 4OHWA 4CDUB 4CRQA 3ZVXA 4RQPC 3EXUA 2UWAA 3TNPB 2X29A 5AFBA 2Y26A 2D98A 4S2GA 3B9IA 3ZXAC 1IKQA 2BW8A 1VAVA 2ZGMA 4P9LA 5HBAA 2UU8A 5C8CA 1PIV1 4ES9A 1S2KA 2EXIA 3B02A 1UU4A 1JYCA 1R083 5LEKA 1YJLA 1WLTA 2N7GA 4GIQA 5DZGA 4AFMA 1MS0A 3DKWA 5DUUA 1UL9A 1W6QA 2PAMA 1VB2A 3A0KA 4GB33 3VLBB 1V9U3 2VMIA 1ULGA 3M3QA 4K7JA 4R9CA 2RJLA 1ZRDA 3PTYA 3FUQA 4RS5A 4YW5A 4GMP0 3MICA 1ASJ2 1MZ6A 3RG0A 1YYNA 4WVWA 3VZLA 3CEWA 4P9XA 2Z79A 3VZOA 4BCUA 3O5SA 1U0AA 1COV1 4A7ZA 4L8QA 2A70A 3R4SA 4P9WA 3WP5A 4LE3A 1EYBA 5T5LA 1DGLA 1A3KA 4QPIC 4Q4W1 5GLVA 4BM8A 4IV1C 2QFEA 2A5ZA 3JU9A 1AR61 1JUIA 3VBSB 2HWD2 4MH0E 4WVMA 4RR3A 4B4RA 1O4TA 1QJX1 5T5JA 1D4M2 3VKMA 2JE7A 1YIFA 2CL2A 5IK8A 1RUI3 3ZSEA 4J1XA 1ND3B 4YG6A 1BMV1 4XTPA 5LK7B 4RQPA 5ACA3 3VDDB 4ITCA 3OGGA 3ZYJB 3LSEA 2ZZJA 2ILMA 1EAH1 2QZ2A 1W6MB 5JOWA 1DQ6A 2NPIA 1JTZX 2R042 5DUVA 1H8VA 2P34A 1OOPC 1G6NA 3VBUB 3GBFA 4KU7A 2VY0A 3BU7A 3MIDA 4YG0A 3OGJA 1TMF2 1NCQB 3QH7A 4JCKA 1AHSA 1D2QA 5JZGC 2GC1A 1EV13 4H55A 2XG3A 3MIBA 2VMHA 1ALYA 5I8TA 5FBZA 1RUF2 1NQDA 2FQPA 2UY8A 2JE9A 3HD8B 5E1RA 4LO6B 3ZN6A 4ISQA 1C4RA 4M3CE 3B7MA 1CAVA 4ATEA 5CADA 2X53S 1R081 2WNUC 3AYCA 2EXHA 4AI2A 4DY3A 2X5IC 2A3XA 1DQ2A 3ALQA 1KS4A 3B5LB 4LUKA 1H9WA 3QBQA 3SMHA 2B9UA 4Z8BA 2B39A 2VW2A 3DGTA 4GB31 4K1ZA 3EO6A 4BYYA 1V9U1 2IXLA 1YI9A 1G9CA 4XBNA 4UXAA 2WFF3 3WP3A 1LU1A 3MYXA 1ZZ8A 2R062 1PGSA 2HWB3 4FTSA 1AL0G 5DZFA 4AHYA 2AH2A 1WW4A 2XWBB 4QPIA 3ZFEC 2ZTNA 2ZGKA 3ZDSA 4IV1A 2WWSA 3FBMA 4M0NA 4WVVA 4EN7B 4PLOA 1PZ7A 1DFQA 4XQ4A 3OY8B 5JOXA 1UF2C 4P9JA 4Z2WA 3ZSKA 1DQ5A 3VHPA 2ZMNA 2KA3A 4GH4C 2WJSA 3USUA 5AVAA 5E8AA 3ZXKA 1WMDA 4OHZA 1QOTA 1FV3A 1LHOA 4EV0A 1Y9QA 1LOBA 3FWEA 3B01A 5A3LA 2IXHA 1CD3G 5K8SA 2K9ZA 4QQOA 4U2AA 1CPMA 1DBNA 1RUI1 4WM7B 1PZ8A 2NQYA 3ES1A 3KB5A 5JIUA 3SH3A 1C8M3 5ACA1 1OOPA 1IKPA 4QQPA 1QNYA 1HIXA 1QQP3 1CONA 1N1SA 3BCWA 3LZZA 3THPA 2Y0OA 3RPQA 4BH9A 1WBLA 3M3EA 4LBKA 2ZGSA 5JZGA 5T3NA 5E16A 4LT5A 4QM9A 1VB4A 1JUHA 3PLQA 1LOAA 4JGYB 3ZFFB 1G9AA 3LOBA 3KCCA 1XNDA 2VVDA 1VP6A 5JR7B 4LEJA 2R49A 4Y22A 3WW4A 4Y20A 1OA3A 1EV11 1XE7A 2DUOA 4L2NA 4X6RB 1RMU1 2WNUA 2ZMLA 5T52A 4G3YC 5L73A 2X5IA 3IDCB 4D7TA 1HW5A 3J4UH 1G86A 1ULDA 4XIOA 5FLIA 3A0NA 1FI2A 1YNAA 2RS33 1KXGA 3OYWB 1O4ZA 2ZGRA 3JD72 2WKKA 5BNOB 1PGW2 1MEC3 2HWC3 2GU9A 2GMMA 3N3HA 5KXEA 2QJVA 2NMOA 4CDUC 1UU6A 4HZFA 3KD4A 4FVVA 2DVFA 1ENSA 3WG2A 4N7IA 1Q8OA 3ZFEA 4E2GA 2IXCA 4BZ4A 1ULEA 4HKLA 2JXAA 4OI4A 4Y26A 1H1MA 3V0BA 3TB0A 2YC0A 2ARBA 3FFQA 3S7IA 2HWB1 1MS5A 4LBQB 4R9AA 1BZWA 5CG8A 4N90A 4JAAA 3KZ4C 2F6BA 2JECA 4GH4A 4OULA 3T2TA 1UIJA 1UU5A 2ZZQA 2R1DA 1PVC2 1ZBA2 4H14A 4FOVA 4AEDC 3EBRA 3ASIA 3AYEA 1QXRA 1SLAA 2AREA 2E63A 1QY4A 4E2SA 3D5OA 4YVSB 4G9SB 2ZX4A 3GBWA 1LENA 2D6KA 1M06G 3NKTA 1RGSA 3MIHA 5J48A 3G6JB 5GKAC 1YXWA 1SDWA 4Q0SA 1Z7S2 2XBO3 4FPJA 1QOSA 1WD4A 2ZABA 3HT2A 3PVEA 4HKOA 3JCIA 4GALA 3MGUA 1GICA 1QJY3 1KDKA 1C8M1 5CFDC 2E7AA 1MS3A 4WVMB 1LECA 3T1MA 4INDA 1AR93 3MIGA 5FOBB 4H7LA 3R6SA 4YZ2A 1RUE3 3WG4A 5LEJA 4NHKA 3WHUA 4HN0A 2DVDA 4FXKB 4Q0UA 3LA7A 3MFCA 3AZYA 3VBSC 1LGBA 1GZWB 3E6DA 3M7AA 3JZVA 1REDA 3PVOA 4NHLA 2VOVA 2DWRA 4I2OA 3ZXDA 1QXPA 4G4FA 4M3CF 1A8MA 5EJ3A 1H0BA 4S2HA 3VBOB 2MNGA 1VBB2 1X8EA 2D97A 2EAAA 3NSTA 2QNKA 4CEWB 1O3RA 1EY2A 1MS9A 3VZNA 1DF0A 4CDUA 3ILRA 1NY71 2DVAA 3EQEA 2RS31 1MS8A 1IPKA 3S7EA 3VDDC 3KM5A 1MEC1 2HWC1 3E5QA 4FOWA 1FOD3 4FPKA 4SBVA 3UK9A 3VN4A 1PIV2 4Q4X2 1I9RA 3D8CA 4N9HA 4XJWA 4PQ9A 3KGLA 1NXMA 1NCQC 1G7YA 4Y1ZA 3E6CC 2D3SA 1A6CA 4IEUA 1BBT3 4LBLA 3KCYA 2WZR3 3M3CA 4XFFA 4JDOA 4AEDA 1CX4A 5T5PA 1HLCA 2BQPA 4Q1RA 2A75A 4Q0PA 2A6YA 4A3XA 2SBAA 1FPN2 3OD0A 1B09A 1QDOA 2HEYF 1PGL2 1LOGA 3FC0A 1C3HA 4R9DA 1LHUA 4HT1T 3AK0A 1RTVA 4LBQD 2ZJCA 4N7UA 5F9TA 2E51A 5D1IA 4QPIB 4FPLA 4QT6A 2RHPA 4OHYA 2D5FA 1DQ4A 4RGGA 5EFUA 3AB0A 2RS11 5CFDA 3ECQA 4DQAA 3JBG3 4XF9A 2XBO1 2E9QA 4LNVA 2FMDA 2CGNA 1AR62 3USUB 1QJY1 1NCRB 1X33A 4HLTA 2ZGQA 2I07B 3LA3A 4XETA 1APNA 1AYM3 1D2SA 1LCLA 1HV0A 1R1A3 1AR91 3VBSA 5GJ6A 2ZKLA 2XJPA 3LWCA 1RUE1 1VLNA 4IV3C 1N1YA 4IETA 4Y5Z0 2D6MA 2MEV1 1V00A 1QH7A 3MI8A 1FXZA 1GYKA 1OOPB 2WS93 2XUMA 4XILA 3AKRA 4JC1A 4I30A 1HRI3 5GZFA 3VDDA 4FSJA 2CWSA 4HFSA 1ENQA 4YGDA 3N4MA 3D4KA 1LHWA 1NG0A 4WM7C 1OPMA 5JZGB 2PAKA 1Q56A 4KWKA 1Z0HA 4HBNA 4JQRA 3T1LA 4AFBA 4MLOA 1FOD1 4CEYC 1QWRA 1LOCA 1WCSA 3O14A 4O9GA 4I3GA 1NCQA 2D40A 3WY6A 3N7MA 5FFOC 4QD2A 1U5ZA 4A7KA 4UW5A 3ZFFC 1JN2P 2PTMA 4JGYC 1CJDA 2GC0A 1FMD3 2DCTA 2WLQA 1NXD1 4Y4YA 2VNGA 1XYNA 1AYN3 1DGWX 3MIFA 3PHMA 2WZR1 1PNFA 4CDXB 4C0BA 4Q26A 4GB32 4YW2A 4QGNA 4K1YA 1V9U2 2UY9A 4HVRA 4AQ2A 3VL8A 2P3IA 1WMFA 1TNFA 3PNAA 3SHRA 4EROA 2UURA 4E4ZA 4EN6B 3ZXLA 2BFUS 2ATFA 1C1FA 5F6LB 1RIRA 2E7TA 4B4PA 2VQ0A 1DLLA 2VPVA 4R8HA 2Z69A 3D0SA 1SACA 2BVBA 1ZZCA 3WQ1A 4Q8KA 1NZCA 2ES3A 4BA6A 2VUAA 4HKWA 3JBG1 5JOYA 2BFUL 4YZ5A 4EN8B 5K9YA 1YHFA 2XPJA 3JB8A 4CP1A 3OY8A 2YHJA 1JH5A 1H30A 4Q2FA 2EXKA 4HSLA 4IV3A 2VOKA 4FXGB 3CL1A 2V5YA 5E88A 3BTAA 1AYM1 1R1A1 4ONUA 2PN5A 1RUI2 4XMIA 3NJZA 3WXPA 4W65A 2X8KA 4SLIA 1CAXB 1COV3 3WW1A 4AFCA 1LULA 3HMYA 4RA0A 4AVCA 1S0CA 5T54A 1ZZBA 4YVSC 3QOPA 4WM7A 3MW3A 2GC3A 4XE9A 4L99A 5I0UA 2I74A 4Q4W3 5GZGA 3SXWA 2OUJA 1RUJ2 4DMIA 4EWDA 1QJX3 2QDRA 5AC92 4J1WA 1OLQA 2VMGA 1J3RA 3MW4A 1RVF2 4EWAA 5KC5A 1EV12 3ZFFA 3WVJA 4JGYA 1ZRFA 2XLAA 2PLV3 5JOZA 1LEMA 2VNOA 4FPFA 4Y1VA 1EAH3 4Q4Y3 1RHI3 1AR72 3UKNA 2P17A 3NWKA 3U10A 5DUWA 1FMD1 4GKYA 4UW6A 1ZZ7A 2OZ6A 2GNTA 3X29B 3ZSMA 1AYN1 2BNOA 4AK3A 3OYWA 1AL21 4M3CB 2GZWA 4META 4WV8A 4CDWB 4MGZE 3G7DA 5BNOA 5C6CA 4AW7A 4COYA 3VBOC 4FPEA 2WQ4A 1OKQA 3M2MA 1NQJA 2A6WA 1SQ4A 5FCCA 4CEWC 3I2DA 4XFGA 2OVUA 3E6BA 2WFF2 1ZA4A 2K0GA 3INAA 1E57A 3H1MA 1MR5A 5I91A 5FMOL 3SCHA 5J36A 2KM2A 1LRHA 3LB9A 2ZGNA 3ZN4A 3GNEA 4AEDB 4BIFA 1VBE3 4S2FA 3UJQA 4AYUA 2PQQA 3ZSLA 1BK1A 5JPMB 2D6LX 4LBQA 1POV3 3RYPA 1ZX5A 4PLNA 2ZKNA 5IT6A 3RDIA 5F5QA 1D0HA 3QLQA 1HRV3 4CYDA 1LODA 5CB7A 5DG1A 4TZDA 4LLFA 4TYSA 2PHFA 1R093 4ORFA 4AE2A 3SITA 3CJXA 4QXKA 4YVSA 4AG4A 5CFDB 5CNAA 1DQ0A 2RR13 1C1LA 1IS6A 1CN1A 3PVBB 1PM7A 2TEPA 1ZREA 3VHNA 4LO7A 1BJQA 2I2SA 1AX1A 1QQP2 5IUQA 4UW3A 1BVP1 4Y24A 3U11A 4COWA 1ND2B 4ZKTB 3ZXGA 3GZTB 1JXNA 1W6PA 2DCKA 4NVPA 4IEQA 4AEKA 4QPGC 2V73A 5T5OA 2GN3A 2LUWA 1QHDA 1H2NA 3GZUC 2W68A 4EWEA 4ATFA 1B35C 1IQAA 2HKXA 2WLPA 1I1EA 1NCRC 3WD5A 1WW7A 1C8NA 5J7MA 4ZXKA 1O91A 2D6OX 3M70A 2JKBA 4JV4A 3DF0A 1GZWA 2PLV1 1RUG3 4FT8A 4B3NA 4LULA 1IHMA 1VRH3 3MLLA 4E9KA 1QKQA 1OSGA 3E5XA 3ZXEA 4Q4Y1 4YW4A 1RHI1 2RS32 5FDBA 4MUVA 2WT0A 3VBOA 4GMP3 1W0PA 2GH8A 1AX0A 4I09A 2FZ1A 3TN93 4BQ1A 4CEWA 3U4XA 2Q1ZB 2D44A 2PYTA 2DURA 2Z2SB 4YM0A 4FP3A 4BOWA 2DCJA 1OHFA 2C9AA 3M1HA 1F5FA 4Z07A 4W6WA 3H1YA 3IDEA 3ILNA 3RYRA 4D94A 1DZQA 1H1AA 2Q0AA 4KU8A 3AJYA 4R4ZA 4OUMA 1RMU3 4P5HA 4DPNA 3IDBB 1XYPA 4RD7A 3UJOA 5KHJA 1BVVA 2QVSB 1YUDA 4B7KA 1LOFC 5KC6A 4LBJA 2EVXA 1DHKB 4EN0A 2G9GA 1GBGA 3MLJA 2ET1A 1VBE1 2R32A 3LA2A 1MACA 2AENA 4FBFA 1LESA 4IEWA 4YVWC 3C3VA 3WG1A 2IXIA 1POV1 3O0XA 4YRDA 1ZM1A 3WV6A 3J8F3 5SV8A 4Y1XA 5E89A 4H3WA 3GALA 1S2BA 2TNFA 4IXLA 1UKRA 1X7NA 1HRV1 1ZVFA 3RSJA 4DFSA 2ZGOA 4CDXC 3KMHA 4LA2A 1UX6A 4XPVA 1QJU2 1WGPA 1R091 2XLFA 1DZRA 2NP0A 3HT1A 4AI1A 4HPKB 4P9IA 3RS6A 1VBC2 4HMZA 4XJZA 2XBO2 3NO8A 3FMGA 3Q9OA 4Q4V2 4Z82A 5CAZA 1GSLA 3J26N 3ZFGC 1GFF2 4YM2A 2RR11 4XYXA 1JBCA 1XQNA 4N53C 3HBZA 4QPGA 1J59A 1OD5A 4IV3B 2OIIA 4AHWA 1REFA 3E5UA 4TSVA 1PNGA 3VZKA 1S0GA 3AKPA 3VBHB 1B35A 1PHMA 1O7FA 1NCRA 4LA3A 3WZ1A 2XVLA 1Q8SA 3R05A 4AXOA 5BV6A 4Y1YA 1IZ3A 3LKJA 4O9EA 4S2DA 2LALA 2FMYA 2LTNA 1MZEA 2P3KA 5EYXA 5GZDA 3QD6A 1ZBE3 3AP6A 2BNMA 5JSPA 1PK6B 4FAHA 4ASLA 3B69A 1RUG1 4XF4A 1VRH1 1HQLA 4CEYB 5D8AB 2ZX3A 2VH9A 2HWF2 4XBLA 1N3OA 1ASJ3 4GMP1 2E53A 1RC6A 4M0HA 3TN91 5A32B 4HK8A 4XMAA 3ZYRA 4CDQB 2EA7A 2RM23 4YSFA 4YM3A 3EJKA 3JB4C 2PHWA 2YPJA 1RUC2 3OTFA 4JDMA 5JIAA 1LOFA 3H7YA 5FO9B 2Q30A 1RUOA 1PO12 3J9SA 2CGOA 3KCXA 5JAXA 5GZEA 3FLTA 4YVWA 1BBT2 2WZR2 2A73B 4OLLA 1H2KA 4LHNA 4FPOB 3WCRA 4BE3A 4BIOA 4E2QA 1C5IA 2JJ6A 1DDLA 4L9BA 1D4M3 1N1VA 1U5YA 4KGQA 4YNIA 4CDXA 2CWMA 3RI8A 1MZFA 1WLDA 3J8F1 5JI7A 1XNCA 1ZYBA 2B42B 1FYUA 2P2KA 3WW3A 1MZ5A 3WQ7A 5BYNA 2DFBA 3ZXFA 3NAPC 1AVBA 1V6NA 4CDWC 2C0ZA 3ZFGA 4NPRA 3O0WA 4WVZA 4B29A 1G9DA 4N53A 2FZ2A 3KQRA 2P37A 5IK7A 1BEV3 2JG9B 4R4XA 1X36A 2TUNA 4F8AA 2YXSA 3KS7A 3S0MA 2RJKA 1Y7BA 5J37A 4YFZA 1LKNA 1VBD3 1NLSA 3ACLA 4UBGA 3IBMA 1V6MA 1R1A2 2PELA 3ZMNA 5AFEA 3N7JA 1RUF3 5BNPC 1KFUL 1WCDJ 2YMZA 5CU1A 2WA4A 3AYDA 4E4DX 4IEXA 2VVEA 2AGSA 2PA7A 4PF5A 3WQ0A 2W39A 1SBFA 2RS13 4I3PA 1Y3TA 3QACA 5FO7B 3FJSA 1LR5A 2BTVC 2WS92 3LOIA 3H0OA 3PVNA 2XKPA 1ULCA 2YROA 4OI0A 2TBVA 1CAXA 4XJAA 4N43B 1HRI2 3ZIXA 5H9SA 1LU2A 1ZBE1 4YARA 1RUD3 1XYOA 1W6PB 4MGYE 4H7MA 4PJYA 1OA2A 4BLJA 3I8TA 2R1BA 1NE4A 3WLUA 4Q8LA 1HDKA 4GKXA 2R063 3BOWA 3W58A 1ASJ1 4YW1A 4QGMA 3CF6E 2E6VA 1U12A 3MEPA 2MEV3 2NN8A 1DG6A 1ND2C 3PJQA 4NR1A 2O8QA 3O7OA 1W6OB 3HIFA 1IPJA 2RM21 4HETA 4HVQA 1HQNA 1GZCA 1MQTB 2XVGA 4XBQA 3WT3A 4E4SA 1C5HA 4AF9A 4FOQA 1D4VB 1SLTA 3NV1A 3DPRB 3OJBA 3FUOA 1GANA 3H9AA 2HWD1 3HWJA 4Q0VA 1OI6A 1H2MA 2DUPA 1D4M1 4MYEA 3BOPA 1C28A 2JG8B 4RL7A 2WT1A 1CR7A 3NAPA 2R073 4M3CA 4CDWA 3WDXA 5HCFA 2BWCA 4XF1A 3ZPYA 1SCRA 1XXNA 1HX6A 1VBA3 1DYKA 1GNZA 3WX5A 2GNBA 3LGRA 4PBOA 3OCPA 3M3OA 1F5JA 5LRRA 1FAYA 1A78A 2DFCA 2GN7A 4UW4A 1NA1B 2VOWA 4OUSA 5DDJ3 3HR9A 5JPNB 2V09A 3D82A 5I8YA 2R041 3M3IA 1PMIA 1BEV1 3U07A 4URTA 4I0WB 1UN1A 5DXDA 4NHMA 5BNPA 5GALA 5HCAA 2KXLA 2R6QA 2H6BA 3GHNA 1VBD1 1FNYA 1OLRA 1SMVA 1HXS3 5KHGA 2OA2A 5GM0A 3KT7A 2QE3A 1RUF1 4DNYA 4L11A 5TSWA 5IK5A 3VGIA 2VECA 4XIKA 1COV2 2YV8A 4KQ7A 1V6OA 4R9BA 4BMBA 4LUMA 2XHKA 4ASMB 1FNZA 2EF6A 4EN9B 2VQAA 5AVPA 2WQZC 2CAVA 4QPGB 3AXEA 4PLMA 4Q4W2 3MLKA 4K20A 1UAIA 1J1TA 2PFWA 3VKOA 1B35B 1RUD1 1QJX2 2PHLA 3SH5A 1ND2A 4DZGA 4WZFA 1AUYA 4FTBA 2ZHKA 1FX5A 2GMPA 1RUH3 4HK9A 3RYKA 1XU2A 2R061 2Y0IA 2CY6A 1BMV2 2PLV2 4I0BA 1NLRA 4XTMA 3VBHC 4B8EA 5KHKA 1I3HA 1ZBA3 5GLTA 1EAH2 4XFCA 1TME3 2OYZA 4LBNA 1XE8A 2CGPA 2XJUA 5CFCB 1PK6C 4D3WA 4LE4A 3JUUA 2R30A 1GR3A 3ZYPA 4YM1A 4XHBA 1H1IA 2H0VA 3URFA 3U0ZA 1J3QA 2AYHA 1X82A 2R071 5D8AC 3AP5A 2VU9A 4X6QB 1AF9A 3NVCA 1VBA1 4KWLA 1KJLA 3AFGA 4YVWB 2BEOA 1O3QA 1KRIA 1DGWA 1U5XA 5FLHA 1SLCA 5FQ0B 3V56A 1R082 4CDQC 3V65A 3ELNA 4AVTA 1ZZ9A 3IMNA 1LGNA 5DDJ1 1AL23 1I6XA 3WR0A 5CBLA 1CAUB 3N35A 5I8SA 2D43A 1GV9A 5CG9A 4LO4B 1BYHA 2GNDA