3WR0A

Structure of hyperthermophilic family 12 endocellulase mutant from pyrococcus furiosus
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
270
structure length
270
Chain Sequence
KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQEVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTAFGTPSTTSAHLEWWITNITLTPLDRPLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoglucanase A
publication title Structure of hyperthermophilic family 12 endocellulase mutant from Pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
total genus 75
structure length 270
sequence length 270
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wr0A00
1HV1A 1XYOA 4HK9A 1C5IA 1KS5A 1C5HA 3AKRA 3RI8A 1F5JA 2VGDA 1QH7A 1XYPA 3AKQA 1OA3A 4S2HA 3LGRA 3AMNA 2JENA 1OA4A 3VZKA 3VZMA 2DCZA 4S2GA 1XNDA 1XYNA 1XNBA 2DFBA 3VHPA 1UU6A 5HXVA 3VL9A 4XPVA 3WQ1A 1IGOA 1OLRA 1REEA 2B42B 2DCKA 3WR0A 1H1AA 3O7OA 3B5LB 5K7PA 1PVXA 3VLBB 3HD8B 1UKRA 1OLQA 2JICA 3AMQA 1YNAA 2DCYA 1H4HA 3WP6A 2VUJA 3AMHA 1XNKA 1XXNA 3AKSA 3EXUA 4S2DA 1NLRA 2QZ2A 2VULA 3WY6A 1W2UA 1BK1A 3WQ7A 2D97A 5K9YA 3WP5A 2VG9A 1HIXA 4HKLA 1H4GA 2DFCA 3VGIA 1H8VA 4HKOA 3WP4A 3WXPA 3AKTA 4HK8A 3VZOA 3MF9A 1REDA 3VZNA 3WQ0A 3M4FA 1BCXA 2F6BA 1KS4A 3B7MA 4NPRA 2BWAA 1QH6A 3VZLA 2B45X 2NLRA 3MFCA 1T6GC 1REFA 2Z79A 2D98A 3VZJA 3AMPA 1ENXA 1XNCA 4S2FA 5EJ3A 1OA2A 3AMMA 2C1FA 1TE1B 1HV0A 1UU5A 3WP3A 2DCJA 4IXLA 3MF6A 1M4WA 2QZ3A 4XQDA 1BVVA 3WT3A 3LB9A 2BWCA 2BW8A 1UU4A 4XQ4A 3VHOA 3MFAA 3ZSEA 2JEMA 1AXKA 3WX5A 2NQYA 3VL8A 1H0BA 2BVVA 3AKPA 2B46X 4HKWA 4XQWA 3RI9A 3VHNA 4H7MA
chains in the Genus database with same CATH superfamily
4YW1A 3IIAA 4AHXA 2JKBA 4QU2A 1F5JA 3POYA 5KWRA 1H2MA 3I2FA 1WMDA 3DYMA 4PLNA 2LRPA 1H6XA 4OZOA 1OD3A 4FPOB 2WAAA 3RDIA 2L9LA 4BU2A 1C1FA 5FZEA 3AZYA 1QJEA 2Y8KA 4YRDA 3NAPA 4B4PA 4BJ0A 5FYUA 4E8DA 1S0FA 4IESA 4XFAA 1UOBA 3Q8CA 4NRPA 4UW3A 3M3CA 5SV8A 5FV3A 1UXXX 3LOIA 3ZSLA 1JZ6A 4QD2A 4YW3A 4P5YA 4MGSA 1QQP2 4DEVA 1RINA 5BPXA 4CDXB 5A7QA 2D40A 4XFFA 4RL7A 4BH9A 2P3IA 1PX4A 3DL3A 1JMUB 4KG0A 4LTAA 3USSA 4RFT0 4AHYA 3P3PA 2R16A 3PIGA 3P6BA 5G05L 2BRTA 4OI1A 4NUBA 2YFUA 5T5LA 4IE0A 5AC91 2ZGRA 2Y6GA 1NX9A 4LBQA 1YCIA 2PHLA 4WM8C 2GC2A 2D7FA 3SEPA 1MACA 1YIFA 2GSYA 4I3PA 4FPHA 2DVGA 4XBNA 3WG2A 4UFKA 4NIDA 1RUF1 1UW8A 5FZ8A 2FDHA 3C7EA 1KFUL 1PZ9A 2D3PA 1K5MC 3BODA 5BNPC 2ETEA 1UYZA 3AKSA 2E33A 3BYWA 1OH3A 2IVJA 2DVFA 2R041 1J3PA 2ZKLA 4PI0A 4N43B 4TYSA 5J7MA 2WLQA 3CZJA 3WDWA 1S4CA 2WQ4A 5ANQA 3WF4A 2HBTA 3W20A 1I6XA 2JDKA 2RS33 2ZGKA 3CMGA 3OEAA 5G04L 1E5SA 5FZMA 2GNMA 5GKAC 5JR7B 1APNA 5FUIA 1KJRA 1XC6A 3ZXAC 5F6KA 2FDGA 1ENQA 2OIIA 1XBFA 3UK9A 1RVF3 4LORA 4P9JA 5J96B 5FZFA 1GOFA 1AR93 1LJ7A 2GP3A 2N7GA 2VMDA 2YU1A 3MUZ1 4PJYA 1SLCA 3MW2A 2VU9A 4Z2WA 4EE2A 3RZHA 5FY0A 5KXBA 1UY4A 3OTFA 3WOGA 5KHJA 1LU2A 1V9U2 5FYIA 1SBFA 3AVRA 5EJZB 2OUHA 3OPTA 2E32A 4JC1A 1HQLA 5A7WB 3WUCA 2ZA9A 4HPKA 4IEYA 5FRAA 5A33A 4S2FA 3TN92 1VAKA 4HLTA 5ABJC 2RDNA 3AL6A 5LY1A 3U11A 5CG8A 4QQOA 3ZDVA 5A32A 2EIEA 3POFA 1UX7A 4BQ5A 5CEHA 1IS4A 3D8CA 1HQWA 3VKNA 1EV11 1PIV1 3WCRA 3KGLA 4QGNA 1GU3A 3WVJA 2QQKA 3ZYGA 3ABZA 3HN1A 4X8PA 3THCA 3JB4C 4CP9A 3VHOA 4HL0A 4PDWC 4XMIA 2OW4A 5FZCA 4QWNA 5T52A 3AC0A 3H42B 4HBNA 2PLV1 1OFNA 2O1QA 4NIIA 4GWMA 1S0GA 4A6SA 1LULA 1QXRA 4EJRA 1ZRFA 3GHNA 4GH4C 3J7LA 1HB3A 2WT1A 2HWC2 1OFSA 2UWAA 3VDDB 1GZWA 2A70A 3DXTA 4H7MA 5FK8A 2GC1A 2LS6A 5KC6A 1W05A 2MEV1 5LCWL 1TME2 3ZFFA 4LEJA 4MX3A 1WCQA 3KS7A 4AGGA 1OPMA 1QHDA 3AMNA 4QXHA 3WUDA 5CISA 1S0BA 4JRAA 3KSCA 3P5BA 5M0TA 3ZYRA 2PHUA 5FMBA 3VD7A 2VL4A 4CUCA 2VE1A 3K4ZA 4LJHA 5EQUA 4Q4Y3 3KT4A 2CWSA 4MO3M 5FP8A 2BNNA 5FY9A 1LECA 1N1VA 2C9KA 4AYUA 3W59A 5L73A 3BU7A 2R062 4P5HA 1UN1A 2D6LX 1REEA 3QBQA 4QGMA 1A3KA 2FMDA 4QPGB 2Q8OA 5ANNA 2HWB3 4B3NA 2WZR2 3B69A 4RYDA 2RJ2A 2QUOA 3LWCA 4H2AA 4QQ2A 3RG0A 4FPFA 1G9DA 5CFCB 3S5AA 5J37A 1RUJ2 4XF4A 1PVXA 4GB31 2ZX2A 2CAVA 4XFIA 1F8VA 4DMIA 5IATA 2TEPA 5FDBA 5FZKA 1RUE3 5K0UC 1AX0A 3LA2A 3QD6A 4JX0A 4RR3A 4AAXA 1RVF1 4KWUA 2VUJA 2W46A 1G9CA 3H8OA 3PMSA 1AR91 1ND3B 3T0DA 1W8FA 1X8MA 5F6LB 1ONAA 3ST7A 5CKNA 1Q56A 2VTXA 1OOPA 1ALYA 4HANA 2ARAA 5IAXA 1XQNA 1GYKA 3PL0A 4IE7A 5DUWA 3WY6A 3IZOA 5C3OA 4IE5A 1U5IA 3CU7A 3WQ7A 1WLDA 2AREA 1RUC3 4OI4A 3S7IA 3GBWA 3GBFA 4UBGA 3SXWA 2PQQA 4FPJA 4META 4TLFA 1ZREA 4Q4W2 5F9TA 5CAZA 2W1SA 1CAUA 1FNZA 2AENA 3O14A 4P9LA 5H9SA 1XB9A 3AYEA 2QNKA 3CL1A 3CIHA 3VV1A 1Q8QA 3NNLA 4XF1A 1COV3 1HDKA 3ZSJA 1HB4A 2VZUA 5BNNB 1KS4A 1H8TB 1RUI2 1IQDC 2GH2A 2WN3A 3KD4A 3QLQA 5IUQA 3PVNA 2FZ2A 4COUA 5FXVA 4OMCA 1QQP1 2ZGUA 4QM8A 2QVSB 3N7JA 3ZFGB 1SLLA 3RJ2X 2E26A 1BQPA 4LKSA 5CADA 3G7DA 2A71A 3N4MA 1GP5A 3ACLA 3M70A 3POEA 4N7UA 1NA1B 4P9YA 3W58A 3ZPOA 1RXFA 4DS0A 1PO12 4KWLA 2G4IA 2ADEA 1CGPA 1C28A 4JHTA 4IGQA 2VCCA 4YW6A 5FKCA 2X5IB 4BK4A 2XOMA 4FOWA 3UKVA 5GZGA 4XHXA 4XUQA 1ZZCA 4IE6A 2VZTA 3LDBA 3WSOA 1YIPA 3VBFA 4Q4Y1 2JDZA 1JN2P 5IVBA 3INAA 4A7ZA 1ZBA3 4G4FA 4HFSA 5GLUA 4AVBA 4PQ9A 4QKBA 4C0HA 3H3LA 3RI9A 4Z07A 3VBSC 4XXPA 4A6OA 4MGYE 2PYTA 1A8MA 2PELA 2P6CA 1S2BA 1UOFA 3OCPA 4XDOA 4AQ2A 2VXJA 5LRSA 1ZRCA 2UWBA 1C5HA 3DUIA 1XYPA 2A7AA 1FPN2 3THTA 3IM0A 5FXZA 4XURA 5H9PA 5IVCA 3ZR6A 4BISA 1WBFA 1RUE1 2CL2A 1AZDA 3LEIA 1V9U1 1VLNA 2CWMA 3HQXA 4FP3A 5C4WB 2ZHKA 2VY0A 4DY5A 4FBFA 1MZEA 3VBUB 4XF3A 1G86A 3TN91 1W39A 2VMHA 4WBBA 3JQXA 5LA2A 4FXGB 4AEDA 5IHRA 4OUSA 4YZ5A 1W9SA 1DYKA 1RL3A 2XBO2 4NROA 4NMIA 4BOWA 1ASJ2 3BIEA 3PTRB 5LEJA 2QQNA 4IV3B 2Q8EA 3MZHA 1UQXA 2XLGA 1RUC1 3A21A 2LW8A 1ZRRA 2VNGA 3M2MA 2X05A 4O65A 2FD8A 4NPMA 4CP0A 1TNRA 1W8ZA 3WF3A 2F4PA 1BBT2 1QDOA 4CDWB 5JWPA 1CWPA 3AK0A 3AMHA 4I0AA 2ARCA 4QPIB 5CFDC 1ULPA 4FFIA 4NOTA 2PHRA 2IFRA 3THPA 3IT8A 4CSWA 4JQTA 3I3QA 2VMIA 4XTMA 1WMEA 5JUVA 3V65A 1JYNA 1Z7S2 1TZOA 3RMXA 1F4HA 2EIDA 3AL5A 2VZ3A 2DF7A 1JZ5A 2NPIA 1ULCA 2YY1A 4QX3A 2JJ6A 2XGXA 5HV4A 5GM0A 4QB2A 4QKDA 4HT1T 1CAVA 1FMD2 2OA2A 2TBVA 4LK7A 4XCBA 1CONA 1ZBE3 4KI5M 1J58A 4CP1A 4AI8A 2AC1A 4HK8A 4LNVA 3G6JB 1CJDA 3VBOB 5C8CB 4ES9A 2W1UA 5K0UA 3SH3A 1X33A 4AAPA 3AZWA 3RNSA 4XFCA 3TBDA 4FOQA 2R061 1OUXA 4YVSB 1LGNA 4NIHA 2GNDA 2WZR1 2CDOA 4NHKA 4M0HA 1GWMA 3RZZA 3UESA 1XNCA 3IIIA 1RUJ1 1DG6A 3ILFA 3H3UA 4IEZA 4BQWA 1Q8PA 4QX2A 2V73A 3AMMA 3BN6A 1GWLA 3M3IA 4PF1A 2IUWA 1VBA3 5K8SA 4FCAA 1KD7A 3K2OA 5DQ0A 4A44A 2DTYA 1BMV2 4QPGC 5KHHA 3T0BA 1MS4A 5EV7A 4RA0A 2Y38A 1UO9A 4LXLA 1H6YA 5A3UA 5FYSA 2JKXA 1V70A 2RM22 2WSVA 2W47A 4XF0A 4WVMB 3SITA 3SCHA 4K3UA 2NQYA 1JODA 2CY6A 1LHWA 2YU2A 3AKPA 2E31A 2B46X 4XQWA 1BEV2 2J7MA 2PQSA 1O3RA 5FYTA 1AR83 1OBNA 1HV1A 2QQMA 3LAGA 4XZPA 2A1XA 2R072 4Q4W1 5T5PA 4Y5TA 4B8EA 4TLGA 3Q8BA 5DZEA 4QPYA 1B35B 3KT1A 4FQ4A 1RUG3 1CPNA 3O1TA 1GZTA 3UGFA 4UWDA 1JYCA 1GMMA 4YGEA 4BXFA 5I8YA 3VD4A 3H1WA 4QX8A 1TMF3 5DDJ2 5CG9A 3UL2A 5JCTA 1RUI1 1AR73 2ADDA 2VW2A 3MI8A 4FPLA 4A3XA 1WMFA 4RGKA 5EYYA 2WRAA 4KNCA 1R092 5B4XA 2H6CA 2ZCWA 2K46A 1UU6A 4XETA 1IKQA 4CDXA 5A3OA 1EAH1 3HMYA 5A3WA 2WNVC 4MGTA 2JDHA 3GDBA 2EVXA 4SLIA 4BE3A 5LA0A 1PO11 2LTNA 2Q1ZB 2WA3A 3E1F1 1EPZA 5JIAA 3U37A 2WUHA 4LA2A 3T30A 1JZ4A 3WV6A 1NE6A 1ZVFA 3HBKA 3NWKA 2XJPA 1J3QA 2J1SA 4Q4V3 1FNYA 4YZ1A 2A75A 2QQOA 5LW9A 4LA3A 1ZRIA 5I0DA 1SFYA 2DU1A 1TQ5A 3POGA 2YZ4A 5D8AC 4N43A 5A7SA 3E5QA 2FCUA 4NO4A 3ACIA 1WLWA 5IK5A 1JZ3A 4V2WA 4NHMA 3RWNA 3KT7A 4PBPA 4AI0A 3C7HA 3GYDA 1XU2A 2CGNA 2ZGTA 1S2KA 4XF9A 2VZOA 3H0OA 3M7AA 1S55A 3CKHA 2WQ8A 3EO6A 3J9SA 3WNXA 3MLLA 5GZEA 1FPN1 3AP6A 1AF9A 5HCAA 4E2QA 1CESA 2ZXQA 2MNGA 2HKXA 3ZX7A 1NLQA 3DECA 2NM1A 3N9NA 3HNMA 1FAYA 5A1AA 2PAKA 3JBG3 1IPKA 2P4EA 1QJX2 5DXDA 1REDA 1QXPA 3DKQA 3UT0A 3I7DA 4Q26A 3FL7A 1SPPA 3MIEA 5A7NA 3MIHA 1EUTA 3I8TA 4G9SB 3LF7A 1AL23 2NLRA 3VD9A 1LHVA 5IJRA 2XBO1 4GXLA 4ATEA 2RE9A 2HWE3 2WFF3 4IL7A 1W3VA 2VOKA 1BVP1 1V6IA 2YUEA 4NVPA 3T2PA 2WKKA 1D7PM 2A3XA 2P5BA 5LB6A 4BQ1A 1DZRA 1QOTA 2P3KA 3VBUC 3JB8A 4QB1A 4NIAA 2WZ8A 3NRUA 2B8MA 1WCUA 3HQRA 4CCDA 2P17A 1BBT1 2GP5A 4NJ4A 1QWRA 4XUNA 3QH7A 4RQPC 3WDTA 4CXXA 3O0XA 5FFOC 3I3BA 1ULFA 2C5DA 2D43A 3RFRA 2WDBA 3OOXA 1CZTA 1F31A 1OMIA 2WNEA 2J1EA 2QQLA 2K2SA 4LBJA 4CCEA 2D6OX 4E8CA 1PK6C 1TMF1 2LUWA 4RS5C 5IVYA 4FVVA 4KWKA 3D4KA 5ACA1 2VVDA 1LOBA 2GDFA 1W04A 4Y4YA 5IVFA 3HBZA 1NYWA 1N1TA 4NAMA 1Z7S1 4TSVA 4C1WA 3IN9A 3ZXJA 5ACA3 3T09A 1VRBA 1HB2A 1OVSA 5JSOA 2IXIA 4AE2A 1QJU3 2JG8B 3U0ZA 3RZLA 1W8HA 1UKGA 4M3CB 4MUVA 1QJY1 1YJKA 5F7UA 1QGLA 3U1XA 2VUCA 1NXD1 1VBD3 5I0TA 1CVNA 5F39A 4BMEA 2RJLA 3NAPC 4QT6A 4MHRA 1VBE2 3SHRA 4AI9A 1RUH3 3ES1A 2XH6A 3ZSMA 3K77A 4TN7A 1N3QA 1SCRA 4QPGA 3HR9A 1WCSA 4J1XA 1PMJX 4FFGA 1VBB2 1W8UA 2W2IA 4QDSA 1UIKA 2WYSA 4DPNA 5CFCA 2I45A 4LO7A 2XQRA 3APBA 2KA3A 3VKOA 4AW7A 4INDA 4DZGA 2O0OA 2A73B 1IHMA 4CXWA 3H1MA 1UOGA 5C8CC 3H3ZA 4PLOA 2RS53 5FPVA 2HJIA 1R082 2VUDA 1OLQA 4J25A 1C8M2 1L7LA 5FZ7A 2ZMKA 4JDOA 3AMQA 4F7ZA 1ODMA 5LASA 4XTPA 4Y33A 2A3WA 2YC0A 2RS13 4XFHA 2RM21 3JUUA 3LQCA 2WYFA 3CLPA 3F95A 3V0AB 1EPWA 1NE4A 5FZ9A 1MZ6A 1EUUA 1GQHA 1GR3A 4BLIA 4F3JA 2CU5A 1ND2B 2ZEYA 4XILA 2UY8A 1BEV1 3WDXA 1ZZ7A 5KXDA 2HWD3 4IETA 4ZU4A 1CIYA 4LBMA 2YMZA 2HLEA 1UZZA 3HWJA 3WP5A 4K8RB 2WNVA 3UKNA 4FAGA 3U4SA 3AFKA 3LE0A 5JMOA 2XLFA 1AR63 3EYPA 1AX1A 5BNNA 5DMYA 1LCLA 1H8TA 4W50A 4E4HA 4DUWA 2RDRA 1IZ3A 1C57A 1JH5A 2DDUA 1OQEA 3U4XA 3TRSB 4AWDA 2D5HA 1J83A 4DY3A 4QB6A 1XSQA 3BPSA 5D8AA 3R4UA 3AXEA 5EZWA 4YZ4A 1ENXA 2DUPA 2IVIB 1JUIA 4ZONA 4MGQA 3RYPA 3WLUA 4KWJA 2A6ZA 5JSPA 4FPCA 5C71A 3N36A 3TEWA 1SZBA 4GKYA 4O9EA 1TE1B 1SDWA 2X5IA 3C8XA 4YZ2A 3GGLA 5IFTA 5LATA 2G9GA 4DOUA 4OQ8A 1TEIA 4JAAA 4Q2FA 4BQ4A 2QZ3A 4YLZA 2QQPA 1YI7A 1VBD1 4UW4A 1O4ZA 2W08A 5GLZA 3N7MA 4L11A 4CP2A 3ZO0B 1UF2C 1CAXA 3GZUC 1OXCA 1RUF3 5APAA 1MQTC 3J7NA 3AP5A 4XJZA 3I59A 4PIXA 1EY2A 1Y9QA 2R043 1A8DA 4P9GA 1X8EA 2JIJA 1RITA 4E4SA 2BZDA 2Y0IA 4LHLA 2WO2A 2OX0A 3CF6E 3U78A 3OUHA 3ZFFC 4B1MA 4YARA 2KR2A 2VO5A 1NCQB 3HT1A 4OUEA 2WSUA 3KCCA 1XYOA 1C5IA 1US3A 3POSA 3BUCA 1ST8A 4UBHA 4LHSA 4CU7A 4LHNA 3EB7A 4S2HA 5L9BA 2VMEA 1CAWB 1WD3A 4QGLA 2JENA 1OA4A 1QJX1 3VBUA 1SQ4A 1WCDJ 1N1SA 3NKTA 3NW4A 3ZSKA 5FCCA 4B4QA 4E4ZA 3WG3A 4D3WA 3WDYA 4ASLA 5I0RA 5DG2A 3JXSA 4OYUA 1MS0A 1UY3A 5C70A 1AYM2 3KV6A 5HXVA 3T1LA 3WQ1A 4L92A 2XLAA 1VP6A 5DAPA 2WT0A 1PK6A 3OPWA 4GZ9A 3WR0A 3QOPA 2NZ9A 2WS93 4FPKA 1JYXA 1GICA 5FZBA 1JZ8A 1LHOA 5FYHA 5GALA 4CDWA 1L3JA 4R4XA 4XJAA 1EV13 5EYXA 1PIV3 2NYYA 4RR3C 3ON7A 1T6BX 1AXYA 2Y6FA 4LKEA 4YGDA 3W9AA 2WWUA 5I8TA 3VD3A 2QBXA 4QPIA 4CEWB 2DCYA 1HXS2 3U14A 1AR61 2RHPA 3WP6A 4DRRA 2BOIA 3LEGA 5LZ6A 1OOPC 3T4VA 3FHIB 1NQJA 3SEEA 3UYJA 1DGWA 2PLV3 2WA4A 3IDBB 4CCKA 1LHNA 4EQVA 5A3LA 1NT0A 2H0VA 2CAUA 2VW1A 4PIYA 4I02A 3HNBM 4FPYA 2RG4A 3OGSA 4JTNA 2Z42A 4R9DA 2RR13 2V72A 3O1UA 1PGL2 2ZGNA 4XBQA 3ZXGA 4MGIE 2MEV3 2PMWB 5GZCA 1PVC3 4JKKA 4Q0PA 3IMNA 3O1VA 2IFWA 2ZKNA 2VNVA 1VBE1 3VBOA 5C8CA 4P08A 4PIZA 4BWOA 3WP4A 5FWEA 2JECA 2YBSA 5IVVA 4M3CF 2NP0A 4HN1A 4Y1VA 1FOD2 5DAQA 2ARXA 1R1A2 3WQ0A 4LO8A 4LPLA 2G19A 5JAXA 1LOCA 2PHFA 2QE3A 1LR5A 4E27A 3FUOA 3B7MA 5JZGB 4LK6A 3HN3A 2Y0OA 3MPPG 4JVAA 4WVVA 4MLOA 4AR2A 1QIQA 3J8F3 4L8QA 5T54A 5JOYA 1ULOA 2J42A 2YFZA 3TOJA 4ZS2A 1AX2A 5T55A 2PHTA 1DIWA 2XDVA 1NZCA 2X09A 2BGPA 3JZVA 3PMEA 2BP6A 4GB33 3U10A 4IW3A 2JE8A 1M06G 1C8M1 1OLMA 3KQRA 3UV9A 1UIJA 2Q8CA 3ZYJB 3RJRA 4AVCA 5DAXA 3ZDSA 3B02A 1UYPA 2RJKA 3KF3A 2LROA 3AZZA 4H7LA 2ZEWA 3UNPA 2ZHNA 4URTA 5IAVA 1DLLA 2VZ1A 3KZ4C 4DNYA 1PO22 3LB9A 1TVGA 1W0PA 2BW8A 3MBWA 4NRMA 3TYJA 1HRV2 1HX6A 3VBFC 3KV5A 2D3RA 4XQ4A 2FDFA 1YO8A 2WO7A 4HN0A 1OF4A 2VTFA 4Q1RA 1W06A 1OH4A 3ZXFA 1Q8OA 3CHXA 2W0XA 3RS6A 3ILNA 4LE4A 2JDYA 5BYNA 4CEYB 1JOBA 2VMCA 5BNOC 2OT7A 4Q1PA 4W6YA 1B35A 1W6NB 1S0DA 2XJRA 3ACGA 3LA3A 4EZ4A 1YHFA 2WS91 4CU9A 1YYNA 2G9FA 1W2TA 2VGDA 1QH7A 3K3NA 4GJYA 1JYTA 1DHKB 2OZ6A 1UAIA 3OY8B 3NV3A 1SLTA 4L97A 4N9IA 4M0NA 5D2AA 3D0SA 2AEZA 4AI2A 3POWA 3KHCA 3LCPA 4U2AA 1DP0A 2YG0A 2Y6KA 3FHAA 1OVPA 1CX4A 2ZMNA 4AEDC 4YVWB 1QQP3 1XNAA 3I54A 3IBMA 1AUYA 1OLRA 5FYBA 1DQ6A 1MQTA 2DCKA 5A1LA 4FSJA 4Y5SA 5H9RA 4Y1YA 1CPMA 4IE4A 5L7OC 5K7PA 3RWKX 2I74A 2VZQA 2RR11 1LB2A 1K42A 1ZNPA 1Y9MA 4L0PA 4RFRB 4X8NA 1PVC1 1YQ8A 2RVAA 2ZX0A 4ARXA 2TNFA 2XUEA 2JICA 3L2HA 4FTBA 2EAAA 3ZLIA 3VBHB 2BNOA 1PZ8A 2ZZQA 3MV11 5F5IA 4CDQC 1ZX5A 2IXKA 4WV8A 2NMOA 3A0KA 1S0JA 2EAKA 5FYZA 3WW3A 4BHPA 1QXJA 4QX5A 1QNWA 2W1WA 1RMU2 4UFIA 3VKFC 2VOTA 2HEYF 3KWVA 1W0NA 2VCBA 2JD4A 2VZVA 3J8F1 1RJ8A 3E97A 2PXJA 3HQUA 1J1LA 1UWWA 3I2GA 1RC6A 1UPIA 5JXJA 2OYZA 3IAQA 1AYN2 1OURA 3TNQA 1HIXA 1NCRB 2BYVE 4Y4RA 5CBLA 2Y6HA 3GM8A 3M3EA 4I01A 4CCCA 4HKOA 1PGW2 4BK5A 4X6QB 2R49A 1W8TA 1V9U3 3OPZA 2Q8DA 2CGPA 1LEMA 3CJIB 4AFAA 1NCQC 1POQA 1BHGA 2ET1A 1IQAA 5KXCA 4TTGA 2RDQA 5A6ZA 3M4FA 5LBFA 1W9YA 1AYM1 3WNNA 3RYKA 3W5NA 3VBRB 4W6WA 2ZABA 2B45X 5JOWA 3TN93 1T6GC 2UY9A 4I0WB 3EJKA 2Z79A 2Q30A 2D98A 4ZY9A 3AMPA 4NHYA 4YW4A 3O1PA 3S57A 4UFJA 2D6PA 4D6SA 4FPGA 4D8MA 5FMOS 2BJSA 1ULGA 1YI9A 5FP7A 2E51A 1L7RA 1A34A 2C0ZA 3T0AA 3SKJE 3UGHA 4NR1A 3UJQA 1KXGA 1P8JA 4OZXA 4BDVB 4QQHA 5F5QA 1J59A 4JKMA 2XL9A 1RGSA 4K1YA 3CBNA 1UU4A 5T3NA 3N9QA 4JDMA 1BKZA 1WUVA 2ORZA 3C7GA 5C5UA 1JYIA 2TUNA 3ZSEA 2XVGA 1UY1A 2HWC3 4IEXA 3O5SA 5FP4A 2JG8A 1AXKA 3E5UA 3NSTA 4M3CA 1PGL1 1H0BA 1H9WA 2WWJA 1Z0HA 1TME3 3JD72 1FV3A 2DVDA 4Y3OA 2D6MA 5DZGA 3OD0A 4WM7B 1GUIA 3R0RA 3ZYFA 1RJ7A 1KS5A 1U5XA 4AZZA 2GN3A 3N9OA 4K21A 5A7PA 5A7OA 2X29A 4ZZ5A 3LGRA 4O61A 2E53A 2RMU2 1ENRA 1TNFA 4JV4A 3P1IA 5J98B 3VZKA 1C1LA 4ITCA 3SQOA 4CDXC 1LOAA 4FO9A 3PU8A 2R063 2HWF2 1KITA 2GC0A 4K1ZA 4NPLA 5E88A 5JLVA 3H7JA 1XNBA 1SBDA 3VUOA 2WZR3 1FT9A 3H7YA 1W99A 3ACHA 3AYAA 4N53B 1RUJ3 1RUD2 2XKPA 2JG9B 3VD5A 3WG1A 1WMXA 3B5LB 3H9AA 2LALA 3KMHA 3WCSA 4AHWA 3LFIA 5L9VA 3AP7A 3HD8B 3RMYA 2R32A 5BNOA 2R6QA 1OC1A 3DKWA 1URXA 3FC0A 2WWSA 4H55A 1F15A 4QX0A 3V0AA 1PO21 3GCWA 4AI1A 1HRV1 4N43C 4H14A 1JW6A 4DXZA 4XHBA 4A4AA 4EN6B 4DFSA 5BUVA 1LOGA 1ND2A 3WW4A 1ZZ8A 2J22A 3J26N 2JDUA 3IDEA 2YV8A 4S2DA 1R1ZA 1NLRA 3W21A 1WW6A 2WAOA 4QX7A 1RYYA 1N47A 2QCSB 1W2UA 4J1WA 1XU1A 4Q4W3 1V6KA 3E6CC 3POBA 3TEXA 5DPNA 5FYCA 4FTEA 1J84A 1W03A 3NO8A 4JGZB 1C3HA 5A6XA 1H1IA 5L7OA 1KQRA 1YQ2A 3AX4A 3KV9A 4YM2A 3RYRA 3ZYBA 1XNTA 4Q29A 2QQVA 1RUI3 1D4M2 1F5FA 1G7YA 1W2NA 4Y20B 3NJYA 4ZU7A 1W6QB 4MGZE 2YGLA 2E7AA 1IG0A 4CDQA 4DO0A 3C7OA 4CE8A 2DU0A 1EAH3 3O1MA 1I5PA 4XXAA 2HWC1 3VZJA 5HV0A 4NIGA 1I5ZA 4KG8A 1BXHA 2XB6C 1OA2A 1FXZA 3V0BB 1E57A 4I0BA 1PO13 2JB4A 4L99A 1TME1 2R1BA 4RSUA 5F3GA 3S0MA 3Q8EA 2C24A 5FQ0B 4Q8LA 4XW3A 1AR82 1S2EA 4C1XA 2YHJA 3MW4A 3ITQA 4LO5B 5FBJA 3J4UH 3MF6A 3DN7A 4E2SA 1CX1A 4JDNA 1MS1A 3KQ4B 4BA6A 3LPFA 2OXBA 3N35A 3I2OA 3VDDC 5FY7A 4XJWA 1RMU1 4R52A 1X7NA 2DV9A 4QKFA 2Y6JA 3KHBA 5DUUA 1NCQA 1WWYA 5JI9A 4BQ3A 4XE9A 3ZN4A 1N3OA 4F83A 3ORJA 3ZN5A 2VAUA 1DU3D 4XJ9A 3ZKYA 1FPN3 1AYN1 2VOVA 3BOPA 5EFUA 1HRI2 5JPMB 3WG4A 1L7QA 3OYWA 3GNEA 4K7JA 3I49A 1DQ1A 1FATA 5FZ6A 3ZYIB 3MICA 2WJSA 2OPWA 2DBNA 2W94A 3AP9A 2DCZA 2DUQA 2DWRA 2JE7A 5FREA 1U0AA 2E6VA 5GZFA 5KXEA 1CIWA 2EXIA 3E6BA 3BCWA 3C3VA 5CFCC 1ZZBA 4LBQB 2CNAA 4K40A 2UU8A 4QMAA 3ZXEA 2XBO3 3MHZA 2WNUB 5C5TA 2K0GA 3RZKA 4OHYA 1KGYA 2W5FA 4CXYA 4JQRA 1MVQA 1DGRA 2WLPA 1ULDA 2VQUA 3AP4A 1H1AA 3CJIC 2EALA 5FZHA 4D6QA 3I97A 1LKNA 1ND3C 2ZJCA 4CRQA 4CEWA 3BGAA 4BXSV 2BGOA 3VBRC 1BBT3 4QHZA 5JXHA 1PM7A 3ZFEB 1OPOA 1JU4A 1ZYBA 5LBBA 1Y4WA 4MHUA 4HG6B 4K6BA 4LE3A 5FJKA 3LZZA 4L2NA 5FMOL 5F3EA 4ZZ8A 1HQNA 5FZ1A 3OB8A 2DUOA 3PDQA 3VKLA 4CDUB 1Y3TA 4KH9A 1U5ZA 2JD9A 4JZRA 4ASKA 5JOXA 2WIIB 1GANA 4I30A 5C8WA 2BU9A 5F5AA 1IS5A 1Z7S3 2JDAA 3JD71 4AI3A 5A3PA 2VULA 4OCTA 4AQTA 2RV9A 3NV4A 1V0AA 1IKPA 1DQ5A 1XOYA 1W9FA 1QJY3 2QKDA 4HPKB 4AEJA 5JOZA 1FMD3 4CCMA 1VBC2 3FLRA 5BNNC 3VDBA 1H8TC 3RSJA 2RMU1 1OKOA 2BUKA 4EN8B 1X82A 1GBGA 1RXGA 2A6WA 2IXCA 4TWTA 5A32B 4QHOA 3ZFGC 2W3JA 2A6VA 5HI0A 2HWF1 4MV2A 5IVEA 1RB8G 3MF9A 1POV3 2GN7A 4LO6B 4OHXA 3MV01 4WM7C 4PQQA 5DN2A 2AGSA 1DZTA 1SMVA 4NPRA 1OQDA 3M1HA 1NA1C 3VZLA 4CCOA 1RUD1 4CP9B 4XJUA 1H9PA 4QHBA 4P00B 5KHKA 2WC2A 3M3OA 1JXNA 4O9GA 3PURA 1UMZA 2X5IC 2YC2A 1SACA 2XUMA 4UI9L 4UW6A 1X9PA 3DYPA 4N90A 5ACA2 1YFUA 2XG3A 5EP9A 1MEC2 1HV0A 3KLSA 1YEWA 2EA7A 3JQWA 2Z4FA 4Q8KA 1O5LA 1CN1A 2VMGA 5SV5A 1JYVA 2YGMA 3LSDA 4J6GA 3ENRA 5BXXA 2WINB 2RM23 1NKGA 2HEWF 4HVRA 4A45A 1X50A 2A5ZA 2VUAA 3ACFA 3AVSA 2D6NA 4DXRA 4LHKA 4CEYA 1VRH2 2C26A 3MDPA 5A7WA 4YYOA 4COVA 2X53S 1LRHA 1W6NA 1Q43A 2VTXJ 3I2IA 1ODNA 1BEV3 2XONA 1W6PB 4IV1B 4AVTA 4XBLA 5I0UA 4Q4X2 2W39A 2R073 1EP0A 1S0EA 4BYYA 2GNTA 1CZSA 3PNAA 1ASJ1 5ISLA 3DPRB 4BB3A 2VQTA 4MXVA 5C4WC 4YG3A 1RUOA 3ELNA 1WW5A 2C9AA 3J7MA 2HYKA 3D5OA 5L36A 2VR4A 1STMA 2ZGOA 2KXLA 1HN1A 3LDKA 5DDJ3 4D6RA 2ZTNA 2ZEZA 3OJBA 4BCUA 1BJQA 4TXWA 4HVQA 5C33A 1FV2A 1QU0A 1HLCA 1R093 2X8KA 4IEVA 2FCTA 4Y24A 3VZMA 1RHI2 4AFDA 1JUHA 3WNLA 4WZCA 1Q8VA 1UL9A 3I3EA 2QQIA 2BBVA 2AYHA 2NMNA 4OUMA 4IV3C 3TNPB 1VMJA 1Y9GA 2VJXA 3RGBA 3Q9OA 3HIFA 3VL9A 2ERFA 2OS2A 3VDDA 1UX6A 2FQPA 3CQOA 3ZN6B 2PFWA 1CJPA 4QQLA 2ZX4A 2ZS6B 4CDWC 1HJFA 2JWPA 3FLPA 4Z1VA 3NV2A 3SNMA 1BK0A 3ZIXA 3VBHA 4BQYA 4BQXA 1HB1A 2XKOA 1UKRA 4OVEA 4QPIC 1VMFA 3MPBA 1JU3A 2WR9A 1FMD1 3BTAA 3FFQA 4C8DA 2VD7A 3HJRA 4LR4A 5F2WA 3WW2A 2XJTA 2ORXA 3D0JA 5FPXA 3WF1A 2KD7A 2W95A 4XFGA 4LUMA 3SKVA 3VDCA 4BQ2A 2QQJA 5IYYA 2HH9A 5CKMA 1D2QA 3WZ1A 1I1EA 1POV1 2XWBB 2AUYA 4LLFA 2EF6A 2OQ7A 2FMYA 1U5YA 1W3XA 2W68A 1GP6A 4QXBA 4YW2A 2VM9A 4MOAA 3FBYA 1DYPA 3LEKA 2QZ2A 1V6LA 4WM8B 5KHIA 2BDRA 4E9KA 4JRLA 5CA6A 1IS6A 2FZ1A 4NN0A 4ES8A 3VBOC 5K9YA 2VG9A 4ISQA 1SG3A 2V5DA 5LY2A 1K5MB 3K51A 4FXKB 5BNPB 3CJIA 2G9ZA 4D0QA 4YVSC 5A6YA 2D93A 4G3YC 1H4GA 2BPA2 1QJX3 1ND3A 1KJLA 2QDNA 3KF5A 2P2KA 4GKXA 2E7QA 1UXZA 5F3CA 2IXHA 3AKTA 3VBRA 5AC92 2GAUA 4ZXKA 4P9WA 3VZOA 3FWEA 5KR7A 1QY4A 4RHV2 2C6SA 1SBEA 2EXKA 4MGKE 2OKXA 3S5QA 4UF0B 3VN4A 2AACA 4WVWA 2ZACA 3RRDA 2Y34A 4D69A 1REFA 2ZMLA 3ALQA 5K4LA 3B94A 2EXHA 3CZUA 5C3RA 4XUTA 2R071 2V4VA 1FI2A 5DAVA 4DXSA 3W5MA 3T3YA 3SH4A 2ILMA 2YROA 3WDUA 1GNZA 4W8JA 1UD1A 5GLVA 5JXIA 5IK7A 2WNUC 1IOAA 2ZZJA 2CYFA 3PVOA 1M4WA 3ZOIA 1F4AA 2UURA 2BVBA 5DDJ1 4COWA 3O12A 4HSJA 2Y26A 4LIVA 5ABJB 1LESA 1VJ2A 5DABA 1R091 3H8UA 1YC61 4ONUA 1E5IA 3NNGA 1W0OA 4HZFA 4M00A 5FK7A 1O4TA 3ZFGA 1GP4A 3HEIA 4CCNA 4GALA 5A3MA 1Q8SA 1B35C 2OQ6A 2VQ0A 4WM7A 3WX5A 3O1OA 5KHGA 3R4DB 1GKBA 1QOOA 2BFUS 1NA1A 4MG2A 1VBC1 4PDWB 1UOJA 1O91A 1VBE3 3E6DA 5FJHA 3KCYA 4K8FA 5EHDA 5LEKA 1HN0A 1LODA 2KM2A 3I2JA 2FDJA 4BLJA 5FO8B 4GH4B 4X6RB 5HBAA 3WHUA 4XCAA 3BOWA 3C2UA 3ZXDA 2Q4SA 2WO3A 4QDQA 5HCFA 3GCXA 4CUAA 1YFYA 4NHXA 1XNDA 1Y7BA 3URFA 4R9AA 1VPHA 2JG9A 2B9UA 1OQ1A 1AHSA 2EIBA 1E5HA 4XPVA 1IGOA 5IK4A 2Q0AA 5C3SA 2ZGPA 2O8OA 1R083 1UZVA 2JX9A 3OBAA 1QOSA 1WD4A 1MEC1 1IS3A 4FPEA 4MXWB 5E1RA 5J3UA 1C8M3 1SEFA 3LFMA 1O4YA 4ZXEA 4LKDA 3VLBB 5IWFA 4IERA 1CZVA 2E9QA 4A7YA 4LOTA 4UAPA 4MH0E 4QAWA 5C4WA 4ORFA 4F8AA 4NRQA 5A80A 1H4HA 2OPKA 1GNYA 4OHVA 1SCSA 5IT6A 1CAVB 5B4NA 3O1RA 3AJZA 4CTEA 1O5UA 1D0GA 1SFNA 4PLMA 2OVUA 2CV6A 4PT6A 4Q4X1 5FO7B 1SLBA 1UCXA 2DVBA 2ENRA 3EXUA 2P3JA 5FP3A 4AQ6A 5J1XA 4Z92B 5FBZA 5I8SA 4IV3A 3PIJA 4JGZA 1NXMA 5JI7A 4XYXA 2D97A 2P37A 4V1PA 2IZWA 1EYBA 3N3HA 2FCVA 2PHWA 2RS32 1OKQA 4Y20A 4KMQA 3BTXA 1W6QA 1H8VA 3ZYPA 1RHI1 4EWEA 1KFXL 2YBKA 3DPRC 2VH9A 2W52A 4NWVA 1RVF2 1W6MB 1AR92 3NVCA 4UT5A 3N7LA 2CSGA 3MLJA 3GZAA 5C3QA 4MADA 5HCHA 2UYAA 1W6OB 2AH2A 5I0SA 3V0BA 3WHTA 3HNYM 1YQ5A 1OT5A 4AL9A 5C9AB 2XJQA 5FQ0A 2Q5TA 3NJXA 3PUHA 4IUGA 2BNMA 1F2NA 1JHNA 4QM9A 4QPWA 3THDA 4OULA 1W28A 3HAGA 3BU0A 5LBCA 4W6XA 2ZBJA 2ZHLA 5H9QA 1UU5A 5FLJA 3T4HB 5A70A 2DCJA 3OGJA 4D94A 2WT2A 5CNAA 4LBOA 2VOXA 4IGPA 1BVVA 3FJSA 1A6CA 2WBKA 4YVSA 1O8SA 4BIFA 3DYOA 2JG8C 3B9IA 1DLCA 1S1AA 4DRVA 2AEYA 2XWJB 4MVTA 1VBB1 3M3QA 2B39A 1PZ7A 4EROA 4P14A 2FDIA 2B4KA 3KCXA 3PUQA 4DQAA 4IGOA 2BVVA 3WD5A 5FMDA 1AXZA 1OHFA 2VOWA 4NE9A 1YUDA 1PNFA 1R081 2ATFA 1I3HA 4W4ZA 4AK3A 1UMHA 3HVDA 4FP2A 4HONA 3ZMNA 1QEXA 4AOCA 2R1DA 2Y6LA 1MS3A 3POJA 3VBSB 4C90A 4RHV1 1W9WA 1H2LA 4GWJA 3LOBA 3LKJA 2WNUA 3I2DA 1AYM3 1BYHA 1DZQA 1KDKA 1XRUA 1FYUA 1GLHA 3ES4A 3DXUA 4WVMA 5KBFA 3FBMA 2XJUA 2VBPA 1JYWA 3T08A 4YFZA 3FMGA 1C4RA 3NMBA 2Y64A 4Q0QA 2VCMA 4Q4Y2 4XACA 2A6XA 3AZXA 1H1MA 3CDZB 4GMP3 2FDKA 1DQ0A 3KVBA 3U75A 1G9FA 5FKBA 4XFBA 3JU9A 3ZFEA 2QQWA 3FFZA 3OUIA 4AF9A 3GBGA 3L2YA 2HWB2 4JGYB 4R9CA 5D21A 5GLTA 1HXS3 2F17A 1O3SA 4CDUA 3ZXLA 4KU7A 3ETPA 5F5CA 1ND2C 3WDVA 2AZ5A 2V5YA 3ILRA 4XUPA 1W2AX 3O0VA 2CTVA 2ZHMA 1JZ2A 2YC4A 2WZEA 1I9RA 4XC9A 1RUE2 4WZFA 1W8WA 4AVVA 1XNKA 2ARBA 1LOEA 4ASMB 3EHKA 3QCWA 3RZGA 2VZSA 3KM5A 5FP9A 1LOFA 3BIWE 3MW3A 5D1IA 4B7KA 1JTZX 1AVBA 1SPPB 1E5RA 5FZDA 3R4SA 1XE0A 4IEQA 3IPVB 4FOVA 4LITA 4Q0SA 4A7KA 1PHMA 5CFDB 5JMCA 4DEQA 1VMHA 4K9SA 5AVAA 5DAWA 4XVHA 5CYYA 4UYBA 3LDRA 1FOD3 1RUC2 5LRRA 1R1A3 2BFUL 3AZVA 4GWIA 4R8HA 4R9BA 4KQ7A 4AVSA 4OFGA 1YRZA 5T5OA 3D3AA 1VALA 3T2OA 1SFPA 1YLLA 4QQPA 3UJOA 4CUGA 1MPXA 1K45A 1COV2 2Z2SB 2Z5WA 3ASIA 2J1TA 2QQUA 2XR4A 1O3TA 1ENSA 2VC9A 3NV1A 3KVAA 3ZR5A 1JHJA 1LU1A 4LO4B 4N7IA 1PMHX 1JOJA 4EZHA 4M01A 1J3RA 2ZPXA 1ACCA 5F3IA 5FMCA 4CCJA 3DF0A 2XJSA 1PO23 4QKNA 2ZX1A 3I3MA 3V64A 2ZAAA 3VHRA 1HRV3 4KL1A 3S7EA 5FLHA 2XJVA 2ZAHA 4IV1A 2BWCA 3GJBA 1W6PA 3NQHA 1AL0G 5C3PA 1YWKA 5FYMA 2VECA 3DPRA 4A3ZA 3AJYA 2B9VA 1UZYA 3O0WA 3PU3A 4IEOA 5FZIA 4LQRA 4BMBA 3ZKUA 1H30A 5EXOA 2YYOA 1O6UA 2EICA 3DGTA 3HPNA 1OD5A 4IEWA 4GMP1 2D6KA 1ZBA2 1XJAA 2RS31 3AKRA 3LD8A 1B09A 3T1MA 3TEZA 3U07A 1O59A 3X29B 3NKGA 3S6PA 1W8NA 1HXS1 3H50A 4AFBA 1O8PA 2ZGMA 2D44A 3FN9A 1WLCA 1XE8A 3OBRA 4CZSA 5A3TA 4OHWA 2SLIA 2YBPA 3T2QA 4P9XA 5E16A 5JSRA 1MS5A 2JIGA 3DCQA 3K4AA 3ZN6A 4CU6A 3OGVA 1D0HA 4Y1UA 3ZXKA 3ZM8A 1MS8A 1ZZ6A 4LKFA 4TZDA 3OUJA 3PVBB 5FY5A 2G1MA 4SBVA 2A6YA 1DQ2A 3AYDA 4PHZA 3IDCB 4Y1ZA 4KU8A 3RVHA 2B42B 1POV0 1GV9A 4LIUA 3R6SA 3WF0A 4CEWC 4ZHNA 1KDMA 2BOJA 1GNHA 1PMIA 2I07B 3FZ3A 2R7EB 1DFQA 2PHXA 5FXXA 4XZUG 1UMIA 3LIGA 4JKLA 1MVEA 3BTZA 3H8RA 2MPFA 4XAEA 5C9AC 1SHWB 1YNAA 1MZFA 3F2ZA 1FOD1 5HPOA 1VE0A 1R1A1 2WNVB 2ID4A 5A3NA 4GWNA 2F4LA 4Z2AA 4LOSA 2YPJA 1RMU3 1ULEA 2QJVA 3RPQA 1AJKA 2H6BA 5IFPA 1SDDB 3BB6A 4WM8A 1XXNA 1VAVA 2PTMA 1BLZA 5LK5A 1X9TA 1FX5A 4AXOA 5FZOB 5C6CA 1CQ9A 4UFLA 3H1YA 1WKYA 4E2GA 1D2SA 1K5MA 3ZMOA 5BNPA 1W2OA 1EAH2 1KEXA 1AYN3 2XVLA 3K46A 5D8AB 1V6MA 2CGOA 5CVRA 3FUQA 1S0IA 3Q8AA 4UFHA 5JZGC 3NJZA 2CHHA 3P3NA 4CVUA 1CR7A 3AXDA 3FLTA 4XIKA 2FHRA 2ZX3A 4Y22B 3FHQA 4UF0A 2V09A 4GQ7A 4Y1XA 1V6JA 1WA6X 3WNKA 5BY5A 3LPGA 2GU9A 3N9MA 2I2SA 4P02B 4YGBA 2W87A 1ZBE2 2PN5A 1NUKA 5LBEA 5E6HA 3USUB 2O8QA 3GJAA 3VB9A 1CAXB 1GQPA 5J36A 1WCKA 1UY2A 3K3OA 3MIBA 3CO2A 5GJ6A 3WQBA 3I59B 4V2VA 1LNSA 2P1BA 1UPSA 1C8NA 2VBBA 2BGCA 2HWB1 3NL1A 5FAXA 4HSLA 2D3SA 5FY1A 2C1FA 1DQ4A 3ETQA 2W91A 4W65A 4IEUA 2YXSA 3LIHA 5ABJA 4GAZA 1K5JA 1W90A 1IPSA 4YM0A 4GD4A 4JTOA 4D7YA 4CEYC 4XQDA 1N3PA 4LMFA 3D82A 1VBA2 1AJOA 3B00A 2W1QA 3N9PA 4N9HA 3KB5A 2BERA 2HEVF 2R30A 4JGYC 1QJFA 3NNMA 3UETA 3JD73 2XPJA 1QKQA 2GMMA 4RQPB 3ZIWA 5FIXA 2B5HA 4PDWA 4ZU5A 5JXGA 1VIWB 2Y60A 4LUKA 2ZEXA 3VHNA 1LEDA 5IVJA 5JR2A 1QMJA 4YW5A 1PK6B 1Q5OA 2XVKA 4HK9A 3HT2A 4GH4A 4E4DX 5JIUA 3RI8A 4RS5B 2RMU3 1LAJA 5FZGA 4RN5A 4YVWC 2GALA 4AQSA 3E5XA 4COZA 4HETA 5F32A 2DVAA 2HWF3 2PAEA 1RUG2 2A3YA 5HCBA 3TB0A 3OGGA 3B01A 3GF6A 1NOVA 2QFEA 1COV1 1RUD3 1XYNA 1TMF2 2DFBA 2K9ZA 4MXWA 1AR72 2DCTA 4Y26A 3TEYA 3NAPB 1F9KA 5JDBA 3BI3A 4UW5A 2XQXA 4LLOA 2EXJA 5JVVA 3VBHC 3ZVXA 5FY4A 1W8OA 2VCAA 5B2GB 3I2KA 3WNOA 1IPJA 2VQAA 1CAWA 3OF1A 1QJY2 2DURA 4N8MA 1DGWX 4HXCA 2EIGA 5CU1A 2VVEA 1PGW1 1K12A 3OSDA 3K48A 1PX3A 1HW5A 1OF3A 2AR6A 4IDZA 2WO1A 3ATGA 1VR3A 4UOJA 2YPDA 4Y5Z0 4Q4V2 1BZWA 3HOBA 3ROUA 4XIOA 5F8PA 4AG4A 3BTYA 1ZZ9A 3A0NA 5GZDA 1PGSA 4MYEA 1NCRC 3C7FA 5FPUA 1MZ5A 3WNPA 2UWCA 4K20A 1GZCA 5LA9A 1NZIA 2XHKA 4BM8A 1ASJ3 4GA9A 1ZBA1 2XMLA 3MYXA 3AB0A 5FZLA 4DUVA 2WFPA 3SLIA 1ZA7A 2W9XA 5A1FA 2GNBA 5FLIA 4URAA 2BQPA 4Q5OA 4M4RA 2J1RA 1HKDA 4OQ9A 1U12A 2B7YA 2R0HA 1JI6A 2X10A 3OBZA 3A22A 5FZ0A 1WBLA 1Z78A 2P3YA 4HKLA 4IQPA 1DDLA 1D4M3 4AEMA 1W6MA 2DFCA 3CJXA 3OBTA 3VGIA 5DUVA 3EQEA 1QF3A 1R64A 3MUY1 3PUSA 4BPZA 3WXPA 1V6NA 1YFWA 4M4PA 1W6OA 4KBBA 3OGRA 4ZPIA 4CCLA 4OHZA 1VAMA 4Q27A 5C9AA 4OMDA 3PVEA 5L19A 5FUPA 4B7EA 3A23A 5EIYB 3JBG2 2DYCA 5IK8A 4QXCA 1YQ6A 3PUIA 4FFHA 5T5JA 1D4VB 3K4DA 2ZGSA 3FE5A 1XE7A 3N9LA 1AL22 2E7TA 1OI6A 5EPAA 5FZ3A 2YB7A 4YNIA 2WFF2 2HWE2 1GFF2 2VXRA 5A33B 3I3DA 2OZJA 2PHDA 3MO4A 3T2TA 3DEMA 1MR5A 4LT5A 1ZA4A 3I2HA 4JHZA 2PA7A 4HMZA 5JZGA 3ME2A 2Q1MA 3WEZA 5J48A 5J09A 4MSVA 1TG7A 2WABA 2YDEA 3WNMA 5FWJA 3B93A 3JCIA 4RD7A 5FYYA 2GH8A 3KV4A 4OI2A 4CPBD 3J7HA 4PCRA 4EN7B 4QU1A 3SCFA 1Y43B 4OLLA 3VL8A 5JPNB 1ZRDA 1HRI3 3UKTA 5FOJB 1DBNA 2JXAA 4HKWA 5TSWA 1WLTA 3B9CA 2JDMA 5FPBA 4ATFA 4R4ZA 5AVPA 2J1VA 1MQTB 1WZXA 1NY72 2WNOA 3SH5A 1SLIA 2DBIA 3VBSA 4YG6A 3AKQA 2XXZA 1QJU2 3NNFA 3GXUA 1CD3G 2D5FA 1GZWB 4NWWA 1V6OA 1GZ9A 1UZWA 4COYA 2WQZC 4PF5A 4N53C 2VNRA 2ES3A 3ZFFB 2BV4A 4HVOA 3A4UA 1BMV1 1ZBE1 1LHUA 1VBD2 2GMEA 3RQ0A 4UXAA 2JG9C 4S2GA 2LM3A 2GZWA 3TWIA 3K75B 4AGVA 1RUH2 2H0BA 3OG2A 3VHPA 1OLME 3BALA 3PTYA 5E89A 1RUNA 1PNGA 5DZFA 4JGYA 4I09A 4O7XA 2SBAA 2HYXA 1DGRN 4XMAA 5HXMA 3PJYA 3I4IA 3OY8A 3OD4A 3AM2A 4YW7A 2RS52 1VBA1 3QACA 3LA7A 1QDCA 1D4M1 1NAEA 2VVFA 4Q0VA 3OEBA 3SISA 4YVWA 2JDNA 2UYBA 4YGCA 3ZYHA 1LGBA 5L9RA 1J1TA 4UFMA 2RS12 4RR3B 3IPVA 5A6QA 4JGZC 3LSEA 3AFGA 3PLQA 5CFDA 1GQGA 1H2KA 4B29A 1VBC3 4LBQD 1OOPB 4KGGA 2HWD2 4DINB 3B3QE 1AR81 4ISRA 1NQDA 5FO9B 1WGPA 1LGCA 4EV0A 1V00A 1OSGA 1VB4A 4YSFA 5LWBA 1PM4A 1WW7A 1RUG1 1O3QA 2ZGQA 4YM1A 2VBDA 2Y33A 1US2A 4XUOA 3VZNA 1AR62 1N1YA 1CAUB 1GOHA 4JCKA 1BCXA 1AR71 3IAPA 4FI9A 3R05A 4DB5A 5FXWA 1YJLA 3CEWA 1UNBA 3QH6A 4EN9B 5FPAA 4NHLA 4AEKA 1LENA 3M8LA 5LA1A 5EJ3A 1MEC3 1JZ7A 1X36A 4EWDA 1XPWA 1HRI1 1NCRA 5AFEA 1K3IA 5CB7A 4BIOA 4QX1A 5T50A 4PI2A 3IDAA 4I2OA 5FZAA 5FPZA 1RTVA 3NJVA 2WZPP 3WP3A 2JE9A 1GSLA 4GMP0 1G9AA 2IC1A 4U36A 2FBEA 1VRH3 2BTVC 3NNJA 1DGLA 1Q3EA 3GALA 4IEPA 5F1RA 4L9BA 4CUBA 4LBLA 4Q4V1 1A78A 4YWAA 3ZPYA 4FTSA 1UYXA 5BNQA 2J1UA 5IW0A 3H8XA 3ECQA 4HOOA 3MFAA 4Q4X3 3GZTB 4KBZA 4Z82A 4Z8BA 3KGZA 3BKZA 1RUF2 2JEMA 2VZRA 1GWKA 4OI0A 1UYYA 4RGAA 2E63A 4FT8A 2PAMA 3VBFB 2R042 1T2XA 1YFXA 3N7KA 4PBOA 5F2SA 1DCSA 5FTTC 1YQCA 1S0CA 4CU8A 2OUJA 1XSRA 2VNOA 5CKQA 1OA3A 3GHMA 4FQZA 4YG0A 4EN0A 1RHI3 3SMHA 2O14A 5BNOB 1G8WA 3IMMA 1G6NA 4AGRA 5I93A 5LK7B 3VDAA 2ZOEB 3JBG1 4QXKA 4XDQA 4ZS3A 4ZKTB 5AFBA 1JOPA 3SC7X 5KC5A 3WF2A 4B4RA 5FUNA 5I91A 4XJ8A 4XAAA 5FZ4A 5FYVA 1AL21 3ZFEC 3MIFA 3POIA 2WFF1 2HWE1 4LBKA 3RZJA 3O7OA 2Z69A 4GULA 3V56A 3IKWA 4CDUC 1LTEA 2WL1A 2WS92 4AEDB 2V4AA 1QNYA 2MHFA 5FPLA 1ZM1A 4A2UA 1RIRA 3VKMA 2WN2A 1W9TA 2JB8A 2VMFA 3SCGA 1EV12 1QJZA 1PIV2 4M3CE 5L7OB 1LOFC 5FZOA 4FOYA 4YPJA 1VBB3 3O1SA 2VW0A 3MEPA 3BVCA 4N53A 3MIGA 2DTWA 4DXTA 2P6HA 4D7TA 4DIQA 4YZ3A 2PLV2 3D6EA 4CDQB 5DG1A 2BBAA 3PHMA 1BK1A 2BEOA 1HJGA 1NY71 1O7FA 2R0FA 2IWGB 2Q1FA 3LEMA 3PUAA 2IXLA 3EMRA 4Y22A 5CZKA 4CA9A 2VZPA 5ERLA 2P34A 1NG0A 1QJU1 4QDRA 4XOGA 5EJ1B 2RR12 1F35A 4ARYA 4AVAA 5AC93 2MEV2 1MS9A 1PVC2 1JBCA 3A7QA 3TAYA 4MZUA 2CDPA 3Q8FA 4RHV3 3USUA 4Q0UA 5C7GA 3AYCA 5BV6A 1VRH1 1RUH1 4EWAA 4AHZA 4XDPA 2GC3A 3BPZA 1JS9A 4KGQA 3S30A 2F6BA 2HBUA 3IWZA 2BWAA 4XABA 1QH6A 3GZEA 2GMPA 4FFFA 4AFCA 4YM3A 3MFCA 4NAOA 1H2NA 4H3WA 4A41A 3MGUA 4ET7A 1KRIA 5K0UB 4LULA 3L9JT 4GIQA 2XHNA 2VPVA 4B1LA 3J8F2 4P9IA 4XEZA 5FR3A 3RZMA 1VB2A 2XL7A 3DV8A 5EWSA 3MIDA 1GOGA 2ZGLA 3MLKA 2ET7A 2RS51 4CPBA 2J1AA 4DUXA 1G9BA 5GLWA 2QDRA 4YFWA 1SLAA 4GB32 4BZ4A 4IV1C 1WW4A 4IXLA 4LBNA 1OUSA 4C0BA 3OYWB 2C4XA 5F37A 4AFMA 3WT3A 4A42A 4FAHA 4I3GA 2JDPA 4RQPA 4WVZA 2RS11 5DUXA 3EBRA 3FX3A 2W92A 1DF0A 4GJZA 2RDSA 1WA4A 1UZ0A 2IXJA 3UGGA 1IG3A 4CYDA 5FY8A 3PJQA 1DYOA 5CIRA 3WINE 1NLSA 3IB3A 3WW1A 3CNAA 5E8AA 4C91A 1UY0A 4RS5A 1YXWA 4RGGA 5FOBB 2HWD1 2NN8A 4D7SA 4EYUA 2QTWB
chains in the Genus database with same CATH topology
4YW1A 3IIAA 4AHXA 2JKBA 4QU2A 1F5JA 3POYA 5KWRA 1H2MA 1WMDA 4PLNA 4FPOB 3RDIA 1C1FA 3AZYA 4YRDA 3NAPA 4B4PA 1S0FA 4IESA 4XFAA 4UW3A 3M3CA 5SV8A 3LOIA 3ZSLA 4QD2A 4YW3A 1QQP2 1RINA 5BPXA 4CDXB 2D40A 4XFFA 4RL7A 4BH9A 2P3IA 3DL3A 4KG0A 4LTAA 3USSA 4AHYA 4RFT0 3P3PA 2R16A 4OI1A 5T5LA 5AC91 2ZGRA 4LBQA 1YCIA 2PHLA 4WM8C 2GC2A 2D7FA 1MACA 1YIFA 2GSYA 4I3PA 4FPHA 2DVGA 4XBNA 3WG2A 1RUF1 1UW8A 1KFUL 1PZ9A 2D3PA 1K5MC 3BODA 5BNPC 2ETEA 3AKSA 2DVFA 2R041 1J3PA 2ZKLA 4N43B 4TYSA 5J7MA 2WLQA 3WDWA 2WQ4A 1I6XA 2RS33 2ZGKA 5GKAC 5JR7B 2GNMA 1APNA 1KJRA 3ZXAC 5F6KA 1ENQA 2OIIA 3UK9A 1RVF3 4P9JA 5J96B 1AR93 1LJ7A 2N7GA 4PJYA 1SLCA 3MW2A 2VU9A 4Z2WA 5KXBA 3OTFA 3WOGA 5KHJA 1LU2A 1V9U2 1SBFA 2OUHA 4JC1A 1HQLA 3WUCA 2ZA9A 4HPKA 4IEYA 5FRAA 5A33A 4S2FA 3TN92 1VAKA 4HLTA 5ABJC 5CG8A 3U11A 4QQOA 5A32A 1IS4A 3D8CA 1HQWA 3VKNA 1EV11 1PIV1 3WCRA 3KGLA 4QGNA 3WVJA 3ZYGA 3HN1A 4X8PA 3JB4C 3VHOA 4HL0A 4PDWC 4XMIA 2OW4A 5T52A 4HBNA 2PLV1 1OFNA 2O1QA 4GWMA 1S0GA 1LULA 1QXRA 4EJRA 1ZRFA 3GHNA 4GH4C 2WT1A 2HWC2 1OFSA 2UWAA 3VDDB 1GZWA 2A70A 4H7MA 5KC6A 2GC1A 2MEV1 1TME2 3ZFFA 4LEJA 4MX3A 3KS7A 4AGGA 1OPMA 1QHDA 3AMNA 3WUDA 1S0BA 4JRAA 3KSCA 3ZYRA 2PHUA 4Q4Y3 3KT4A 2CWSA 2BNNA 1LECA 1N1VA 4AYUA 3W59A 5L73A 3BU7A 2R062 4P5HA 1UN1A 2D6LX 1REEA 3QBQA 4QGMA 1A3KA 2FMDA 4QPGB 2Q8OA 4B3NA 2HWB3 2WZR2 3B69A 1G9DA 2QUOA 3LWCA 4QQ2A 3RG0A 4FPFA 5CFCB 5J37A 1RUJ2 4XF4A 1PVXA 4GB31 2ZX2A 2CAVA 4XFIA 1F8VA 4DMIA 2TEPA 5FDBA 5K0UC 1RUE3 1AX0A 3LA2A 3QD6A 4RR3A 1RVF1 1G9CA 2VUJA 3PMSA 1AR91 1ND3B 1X8MA 5F6LB 1ONAA 3ST7A 1Q56A 1OOPA 1ALYA 4HANA 1XQNA 1GYKA 5DUWA 3WY6A 1U5IA 3CU7A 3WQ7A 1WLDA 2AREA 1RUC3 4OI4A 3S7IA 3GBWA 3GBFA 4UBGA 3SXWA 2PQQA 4FPJA 4META 4TLFA 1ZREA 4Q4W2 5F9TA 5CAZA 1CAUA 1FNZA 2AENA 3O14A 4P9LA 5H9SA 3AYEA 2QNKA 3CL1A 3VV1A 1Q8QA 4XF1A 1COV3 1HDKA 3ZSJA 5BNNB 1KS4A 1H8TB 1RUI2 2GH2A 5IUQA 3QLQA 3KD4A 2FZ2A 3PVNA 4COUA 1QQP1 2ZGUA 4QM8A 2QVSB 3N7JA 3ZFGB 1SLLA 3RJ2X 1BQPA 5CADA 3G7DA 2A71A 3N4MA 3ACLA 3M70A 4N7UA 3W58A 1NA1B 4P9YA 4DS0A 1PO12 4KWLA 2G4IA 1CGPA 1C28A 2X5IB 4FOWA 5GZGA 3UKVA 4XHXA 1ZZCA 1YIPA 3VBFA 4Q4Y1 2JDZA 1JN2P 3INAA 4A7ZA 1ZBA3 4G4FA 4HFSA 5GLUA 4AVBA 4PQ9A 4C0HA 3RI9A 4Z07A 3VBSC 4XXPA 4MGYE 2PYTA 1A8MA 2PELA 1S2BA 3OCPA 5LRSA 1ZRCA 4AQ2A 2UWBA 1C5HA 3DUIA 1XYPA 2A7AA 1FPN2 3THTA 3IM0A 5H9PA 1WBFA 1RUE1 2CL2A 1AZDA 1V9U1 1VLNA 2CWMA 3HQXA 4FP3A 5C4WB 2ZHKA 2VY0A 4DY5A 4FBFA 1MZEA 3VBUB 4XF3A 1G86A 3TN91 1W39A 2VMHA 4WBBA 3JQXA 4FXGB 4AEDA 4OUSA 4YZ5A 1DYKA 1RL3A 2XBO2 4BOWA 1ASJ2 5LEJA 4IV3B 3MZHA 2XLGA 1RUC1 1ZRRA 2VNGA 3M2MA 4CP0A 1TNRA 2F4PA 1BBT2 1QDOA 4CDWB 5JWPA 3AK0A 3AMHA 4I0AA 4QPIB 5CFDC 4NOTA 2PHRA 2IFRA 3THPA 3IT8A 4XTMA 2VMIA 1WMEA 3V65A 1Z7S2 3RMXA 2DF7A 2NPIA 1ULCA 2YY1A 2JJ6A 2XGXA 5GM0A 4HT1T 1CAVA 1FMD2 2OA2A 2TBVA 1CONA 1ZBE3 1J58A 4CP1A 4AI8A 4HK8A 4LNVA 3G6JB 1CJDA 3VBOB 5C8CB 4ES9A 5K0UA 3SH3A 1X33A 3AZWA 3RNSA 4XFCA 3TBDA 4FOQA 2R061 4YVSB 1LGNA 2GNDA 2WZR1 4NHKA 4M0HA 3RZZA 1XNCA 1RUJ1 1DG6A 3ILFA 3H3UA 4IEZA 1Q8PA 2V73A 3AMMA 3M3IA 1VBA3 5K8SA 4FCAA 1KD7A 2DTYA 1BMV2 4QPGC 5KHHA 1MS4A 5EV7A 4RA0A 2Y38A 1V70A 2RM22 2WSVA 4XF0A 4WVMB 3SITA 3SCHA 4K3UA 2NQYA 2CY6A 1LHWA 3AKPA 2B46X 4XQWA 1BEV2 1O3RA 1AR83 4XZPA 1HV1A 3LAGA 4B8EA 2R072 4Q4W1 5T5PA 5DZEA 4QPYA 1B35B 3KT1A 4FQ4A 1RUG3 1CPNA 1JYCA 4YGEA 5I8YA 3H1WA 1TMF3 5DDJ2 5CG9A 3UL2A 5JCTA 1RUI1 1AR73 2VW2A 3MI8A 4FPLA 4A3XA 1WMFA 5EYYA 4KNCA 1R092 2H6CA 2ZCWA 1UU6A 4XETA 1IKQA 4CDXA 1EAH1 3HMYA 2WNVC 2EVXA 4SLIA 4BE3A 1PO11 2LTNA 2Q1ZB 2WA3A 1EPZA 5JIAA 4LA2A 3WV6A 1NE6A 1ZVFA 3NWKA 2XJPA 1J3QA 4Q4V3 1FNYA 4YZ1A 2A75A 4LA3A 1SFYA 2DU1A 1TQ5A 5D8AC 2YZ4A 4N43A 3E5QA 4NO4A 1WLWA 5IK5A 4NHMA 3RWNA 3KT7A 4PBPA 4AI0A 3GYDA 1XU2A 2CGNA 2ZGTA 1S2KA 4XF9A 3H0OA 3M7AA 1S55A 3EO6A 3J9SA 3WNXA 3MLLA 5GZEA 1FPN1 3AP6A 1AF9A 5HCAA 4E2QA 1CESA 2MNGA 2HKXA 3ZX7A 2NM1A 1FAYA 2PAKA 3JBG3 1IPKA 5DXDA 1QJX2 1REDA 1QXPA 3I7DA 4Q26A 3MIEA 3MIHA 3I8TA 4G9SB 1AL23 2NLRA 1LHVA 2XBO1 4GXLA 4ATEA 2RE9A 2HWE3 2WFF3 4IL7A 2VOKA 1BVP1 1V6IA 2YUEA 4NVPA 2WKKA 2A3XA 4BQ1A 1DZRA 1QOTA 2P3KA 3VBUC 3JB8A 2B8MA 2P17A 1BBT1 1QWRA 3QH7A 4RQPC 3WDTA 3O0XA 5FFOC 1ULFA 2C5DA 2D43A 1F31A 1OMIA 2WNEA 4LBJA 2K2SA 2D6OX 1PK6C 1TMF1 2LUWA 4RS5C 4FVVA 4KWKA 3D4KA 2VVDA 1LOBA 2GDFA 4Y4YA 3HBZA 1NYWA 1N1TA 1Z7S1 4TSVA 4C1WA 3IN9A 3ZXJA 5ACA3 5JSOA 2IXIA 4AE2A 2JG8B 1QJU3 3U0ZA 1UKGA 4M3CB 4MUVA 1QJY1 1YJKA 1QGLA 1NXD1 1VBD3 5I0TA 1CVNA 4BMEA 2RJLA 3NAPC 4QT6A 1VBE2 3SHRA 1RUH3 3ES1A 2XH6A 3ZSMA 1N3QA 1SCRA 4QPGA 3HR9A 1WCSA 4J1XA 1VBB2 4DPNA 5CFCA 1UIKA 2I45A 4LO7A 3APBA 2KA3A 3VKOA 4AW7A 4INDA 4DZGA 2O0OA 2A73B 1IHMA 3H1MA 5C8CC 3H3ZA 4PLOA 2RS53 2HJIA 1R082 1OLQA 1C8M2 2ZMKA 4JDOA 3AMQA 4F7ZA 4XTPA 2A3WA 2YC0A 2RS13 4XFHA 2RM21 3JUUA 3CLPA 3V0AB 1EPWA 1NE4A 1MZ6A 4BLIA 1GQHA 1GR3A 4F3JA 1ND2B 4XILA 3WDXA 2UY8A 1BEV1 5KXDA 1ZZ7A 2HWD3 4IETA 4ZU4A 4LBMA 2YMZA 1UZZA 3HWJA 3WP5A 2WNVA 3UKNA 4FAGA 3AFKA 2XLFA 1AR63 1AX1A 5BNNA 1LCLA 1H8TA 1IZ3A 1C57A 1JH5A 1OQEA 3U4XA 3TRSB 4AWDA 2D5HA 4DY3A 5D8AA 3R4UA 3AXEA 5EZWA 4YZ4A 1ENXA 2DUPA 3RYPA 1JUIA 5JSPA 3WLUA 4KWJA 2A6ZA 4FPCA 3N36A 4GKYA 4O9EA 1TE1B 1SDWA 2X5IA 4YZ2A 2G9GA 4DOUA 1TEIA 4JAAA 4Q2FA 2QZ3A 4YLZA 2QQPA 1YI7A 1VBD1 4UW4A 1O4ZA 2W08A 5GLZA 3N7MA 4L11A 4CP2A 3ZO0B 1UF2C 1CAXA 3GZUC 1RUF3 1MQTC 3AP5A 4XJZA 3I59A 4PIXA 1EY2A 1Y9QA 2R043 1A8DA 4P9GA 1X8EA 1RITA 4E4SA 2Y0IA 4LHLA 3CF6E 3ZFFC 4YARA 3HT1A 1NCQB 2WSUA 3KCCA 1XYOA 1C5IA 3POSA 4UBHA 4LHNA 4S2HA 4C91A 1CAWB 1WD3A 4QGLA 2JENA 1OA4A 1QJX1 3VBUA 1SQ4A 1WCDJ 1N1SA 3NKTA 3NW4A 3ZSKA 5FCCA 4B4QA 4E4ZA 3WG3A 4D3WA 3WDYA 4ASLA 5I0RA 5DG2A 1MS0A 1AYM2 5HXVA 3T1LA 3WQ1A 4L92A 2XLAA 1VP6A 2WT0A 1PK6A 3WR0A 3QOPA 2NZ9A 2WS93 4FPKA 1GICA 1LHOA 5GALA 4CDWA 1L3JA 4R4XA 4XJAA 1EV13 5EYXA 1PIV3 2NYYA 4RR3C 5I8TA 1AXYA 4YGDA 3W9AA 4QPIA 4CEWB 2DCYA 1HXS2 1AR61 2RHPA 3WP6A 4DRRA 1OOPC 3FHIB 1NQJA 1DGWA 2PLV3 2WA4A 3IDBB 1LHNA 5A3LA 2H0VA 2CAUA 2VW1A 4PIYA 4I02A 4FPYA 4R9DA 4JTNA 2Z42A 2RR13 1PGL2 2ZGNA 4XBQA 3ZXGA 4MGIE 2MEV3 5GZCA 1PVC3 4Q0PA 3IMNA 2IFWA 2ZKNA 1VBE1 3VBOA 5C8CA 4PIZA 4BWOA 3WP4A 2JECA 2NP0A 4M3CF 4HN1A 4Y1VA 1FOD2 2ARXA 1R1A2 3WQ0A 4LO8A 5JAXA 1LOCA 2PHFA 2QE3A 1LR5A 4E27A 3FUOA 3B7MA 5JZGB 2Y0OA 3MPPG 4JVAA 4WVVA 4MLOA 3J8F3 4L8QA 5T54A 5JOYA 3TOJA 1AX2A 5T55A 2PHTA 1DIWA 3JZVA 1NZCA 3PMEA 4GB33 3U10A 1M06G 1C8M1 3KQRA 3UV9A 1UIJA 3ZYJB 3RJRA 4AVCA 3ZDSA 3B02A 2RJKA 4H7LA 3AZZA 2ZHNA 4URTA 1DLLA 3KZ4C 4DNYA 1PO22 3LB9A 1W0PA 2BW8A 3TYJA 3VBFC 1HRV2 1HX6A 4XQ4A 2D3RA 1YO8A 4HN0A 4Q1RA 3ZXFA 1Q8OA 2W0XA 3RS6A 3ILNA 4LE4A 5BYNA 4CEYB 5BNOC 4Q1PA 4W6YA 1B35A 1W6NB 1S0DA 2XJRA 3LA3A 1YHFA 2WS91 1YYNA 2G9FA 2VGDA 1QH7A 1DHKB 2OZ6A 1UAIA 3OY8B 3NV3A 1SLTA 4L97A 4N9IA 4M0NA 3D0SA 4AI2A 3POWA 3LCPA 4U2AA 1CX4A 2ZMNA 4AEDC 4YVWB 1QQP3 3I54A 3IBMA 1AUYA 1OLRA 1DQ6A 1MQTA 2DCKA 4FSJA 5H9RA 4Y1YA 1CPMA 5L7OC 5K7PA 2I74A 2RR11 1LB2A 1ZNPA 4X8NA 1PVC1 2ZX0A 2TNFA 3L2HA 2JICA 4FTBA 2EAAA 3VBHB 2BNOA 1PZ8A 2ZZQA 4CDQC 1ZX5A 2IXKA 4WV8A 2NMOA 3A0KA 1S0JA 2EAKA 4BHPA 3WW3A 1QXJA 4QX5A 1QNWA 1RMU2 3VKFC 2HEYF 2JD4A 3J8F1 1RJ8A 3E97A 1J1LA 1RC6A 1UPIA 2OYZA 1AYN2 3TNQA 1HIXA 1NCRB 2BYVE 5CBLA 3M3EA 4I01A 4HKOA 1PGW2 2CGPA 4X6QB 2R49A 1V9U3 3OPZA 1LEMA 3CJIB 4AFAA 1NCQC 2ET1A 1IQAA 5KXCA 3M4FA 1AYM1 3RYKA 3VBRB 4W6WA 2ZABA 2B45X 5JOWA 3TN93 1T6GC 2UY9A 4I0WB 3EJKA 2Z79A 2Q30A 2D98A 3AMPA 4YW4A 2D6PA 4FPGA 5FMOS 1ULGA 1YI9A 2E51A 2C0ZA 4NR1A 3UJQA 1KXGA 4OZXA 4QQHA 5F5QA 1J59A 2XL9A 1RGSA 4K1YA 5T3NA 1UU4A 4JDMA 1BKZA 1WUVA 1JYIA 2TUNA 3ZSEA 2XVGA 4IEXA 2HWC3 3O5SA 2JG8A 1AXKA 3E5UA 3NSTA 4M3CA 1PGL1 1H0BA 1H9WA 1Z0HA 1TME3 3JD72 1FV3A 2DVDA 2D6MA 5DZGA 3OD0A 4WM7B 3R0RA 1RJ7A 1KS5A 1U5XA 2GN3A 4K21A 2X29A 3LGRA 2E53A 2RMU2 1ENRA 1TNFA 4JV4A 5J98B 3VZKA 1C1LA 4ITCA 4CDXC 1LOAA 4FO9A 4K1ZA 2R063 2HWF2 1KITA 2GC0A 5E88A 5JLVA 3H7JA 1XNBA 1SBDA 3VUOA 2WZR3 1FT9A 3H7YA 3AYAA 4N53B 1RUJ3 1RUD2 2XKPA 2JG9B 3WG1A 3B5LB 4AHWA 3H9AA 2LALA 3KMHA 3WCSA 3AP7A 3HD8B 3RMYA 2R32A 5BNOA 2R6QA 3DKWA 1URXA 3FC0A 2WWSA 4H55A 3V0AA 1PO21 4AI1A 1HRV1 4N43C 4H14A 1JW6A 4DXZA 4XHBA 4EN6B 4DFSA 5BUVA 1LOGA 1ND2A 3WW4A 1ZZ8A 3J26N 3IDEA 2YV8A 4S2DA 1R1ZA 1NLRA 1WW6A 2QCSB 1N47A 1W2UA 4J1WA 1XU1A 4Q4W3 1V6KA 3E6CC 4FTEA 3NO8A 4JGZB 1C3HA 5L7OA 1H1IA 1KQRA 3AX4A 4YM2A 3RYRA 4Q29A 1RUI3 1D4M2 1F5FA 1G7YA 4Y20B 4ZU7A 1W6QB 4MGZE 2YGLA 2E7AA 4CDQA 2DU0A 1EAH3 3VZJA 4XXAA 2HWC1 1I5ZA 4KG8A 1BXHA 2XB6C 1OA2A 1FXZA 3V0BB 1E57A 4I0BA 1PO13 4L99A 4RSUA 1TME1 2R1BA 3S0MA 5FQ0B 4Q8LA 4XW3A 1AR82 4C1XA 2YHJA 3MW4A 4LO5B 3J4UH 3MF6A 3DN7A 4E2SA 4JDNA 1MS1A 4BA6A 3N35A 3VDDC 4XJWA 1RMU1 4R52A 1X7NA 2DV9A 5DUUA 1NCQA 5JI9A 4XE9A 3ZN4A 1N3OA 4F83A 3ZN5A 1DU3D 4XJ9A 1FPN3 1AYN1 2VOVA 3BOPA 5EFUA 1HRI2 5JPMB 3WG4A 3OYWA 3GNEA 4K7JA 1DQ1A 1FATA 3ZYIB 3MICA 2WJSA 3AP9A 2DCZA 2DUQA 2DWRA 2JE7A 5FREA 1U0AA 2E6VA 5GZFA 1CIWA 2EXIA 3E6BA 3BCWA 3C3VA 5CFCC 1ZZBA 4LBQB 2CNAA 4K40A 2UU8A 4QMAA 3ZXEA 2XBO3 2WNUB 2K0GA 4OHYA 4JQRA 1MVQA 1DGRA 2WLPA 1ULDA 3AP4A 1H1AA 3CJIC 2EALA 1LKNA 1ND3C 2ZJCA 4CRQA 4CEWA 3VBRC 1BBT3 1PM7A 3ZFEB 1OPOA 1ZYBA 4LE3A 4K6BA 3LZZA 4L2NA 5FMOL 1HQNA 2DUOA 3VKLA 4CDUB 1Y3TA 4KH9A 1U5ZA 5JOXA 2WIIB 1GANA 4I30A 5C8WA 1IS5A 1Z7S3 3JD71 4AI3A 2VULA 4AQTA 3NV4A 1IKPA 1DQ5A 2QKDA 4AEJA 1QJY3 4HPKB 5JOZA 1FMD3 1VBC2 3FLRA 5BNNC 1H8TC 3RSJA 2RMU1 2BUKA 4EN8B 1X82A 1GBGA 2IXCA 2A6WA 4TWTA 5A32B 3ZFGC 2A6VA 5HI0A 2HWF1 4MV2A 1RB8G 3MF9A 1POV3 2GN7A 4LO6B 4OHXA 4WM7C 2AGSA 1DZTA 1SMVA 4NPRA 1OQDA 3M1HA 1NA1C 3VZLA 1RUD1 4XJUA 1H9PA 4QHBA 5KHKA 2WC2A 3M3OA 1JXNA 4O9GA 1UMZA 2X5IC 4UW6A 1SACA 2XUMA 4N90A 5ACA2 1YFUA 2XG3A 1MEC2 1HV0A 3KLSA 2EA7A 3JQWA 4Q8KA 1O5LA 1CN1A 2VMGA 5SV5A 2YGMA 3LSDA 4J6GA 3ENRA 5BXXA 2WINB 2RM23 2HEWF 4HVRA 1X50A 2A5ZA 2VUAA 2D6NA 4LHKA 4CEYA 1VRH2 4YYOA 3MDPA 4COVA 2X53S 1LRHA 1W6NA 1Q43A 4IV1B 1BEV3 1W6PB 4AVTA 4XBLA 5I0UA 4Q4X2 2W39A 2R073 1EP0A 1S0EA 4BYYA 2GNTA 3PNAA 1ASJ1 3DPRB 4MXVA 5C4WC 4YG3A 1RUOA 3ELNA 1WW5A 2C9AA 2HYKA 3D5OA 5L36A 2ZGOA 2KXLA 5DDJ3 2ZTNA 3OJBA 4BCUA 1BJQA 4HVQA 5C33A 1FV2A 1QU0A 1HLCA 1R093 2X8KA 4IEVA 3VZMA 4Y24A 4AFDA 1RHI2 1JUHA 4WZCA 1Q8VA 1UL9A 2BBVA 2NMNA 2AYHA 4OUMA 4IV3C 3TNPB 3Q9OA 3HIFA 3VL9A 2ERFA 3VDDA 3ZN6B 1UX6A 2FQPA 2PFWA 1CJPA 4QQLA 2ZX4A 2ZS6B 4CDWC 3FLPA 4Z1VA 3NV2A 3SNMA 3ZIXA 3VBHA 2XKOA 1UKRA 4OVEA 4QPIC 3MPBA 1FMD1 3BTAA 3FFQA 4LR4A 3WW2A 2XJTA 3D0JA 5FPXA 4XFGA 4LUMA 1D2QA 3WZ1A 1I1EA 1POV1 2XWBB 2AUYA 4LLFA 2EF6A 2FMYA 1U5YA 2W68A 4YW2A 3FBYA 1DYPA 2QZ2A 1V6LA 4WM8B 5KHIA 4E9KA 4JRLA 5CA6A 1IS6A 2FZ1A 4NN0A 4ES8A 3VBOC 5K9YA 2VG9A 4ISQA 1K5MB 3K51A 4FXKB 5BNPB 3CJIA 4YVSC 2D93A 4G3YC 1H4GA 2BPA2 1QJX3 1ND3A 1KJLA 2QDNA 4GKXA 2P2KA 1BMV1 2E7QA 2IXHA 3AKTA 3VBRA 5AC92 2GAUA 4ZXKA 4P9WA 3VZOA 3FWEA 1QY4A 4RHV2 2EXKA 1SBEA 4MGKE 3VN4A 4WVWA 2ZACA 3RRDA 4D69A 1REFA 2ZMLA 3ALQA 3B94A 2EXHA 2R071 1FI2A 3SH4A 2ILMA 2YROA 3WDUA 1GNZA 1UD1A 5GLVA 5IK7A 2WNUC 1IOAA 2ZZJA 2CYFA 3PVOA 1M4WA 2UURA 2BVBA 5DDJ1 4COWA 3O12A 4HSJA 2Y26A 5ABJB 1LESA 1VJ2A 1R091 3H8UA 4ONUA 4M00A 1W0OA 4HZFA 3ZFGA 1O4TA 5A3MA 4GALA 1Q8SA 1B35C 2VQ0A 4WM7A 3WX5A 5KHGA 3R4DB 1GKBA 1QOOA 2BFUS 1NA1A 1VBC1 4PDWB 1O91A 1VBE3 3E6DA 3KCYA 4K8FA 5LEKA 1LODA 2KM2A 4BLJA 5FO8B 4GH4B 4X6RB 5HBAA 3WHUA 3BOWA 3C2UA 3ZXDA 2Q4SA 5HCFA 1YFYA 1XNDA 1Y7BA 3URFA 4R9AA 2JG9A 2B9UA 1OQ1A 1AHSA 4XPVA 5IK4A 1IGOA 2Q0AA 2ZGPA 2O8OA 1R083 2JX9A 1QOSA 1WD4A 1MEC1 1IS3A 4FPEA 4MXWB 5E1RA 5J3UA 1C8M3 1SEFA 1O4YA 3VLBB 4IERA 2E9QA 4A7YA 4MH0E 5C4WA 4ORFA 4F8AA 1H4HA 2OPKA 4OHVA 1SCSA 5IT6A 1CAVB 3AJZA 4CTEA 1O5UA 1D0GA 1SFNA 4PLMA 2OVUA 2CV6A 4Q4X1 5FO7B 1SLBA 1UCXA 2DVBA 2ENRA 3EXUA 2P3JA 4AQ6A 4Z92B 5FBZA 5I8SA 4IV3A 4JGZA 1NXMA 5JI7A 4XYXA 2D97A 2P37A 4V1PA 2IZWA 1EYBA 3N3HA 2PHWA 2RS32 1OKQA 4Y20A 1W6QA 1H8VA 3ZYPA 1RHI1 4EWEA 1KFXL 3DPRC 2VH9A 2W52A 4NWVA 1RVF2 1W6MB 1AR92 3NVCA 3N7LA 3MLJA 3GZAA 2UYAA 1W6OB 2AH2A 5I0SA 3V0BA 3WHTA 5C9AB 2XJQA 5FQ0A 2Q5TA 2BNMA 1F2NA 1JHNA 4QM9A 4OULA 3HAGA 4W6XA 2ZBJA 2ZHLA 5H9QA 1UU5A 5FLJA 2DCJA 3OGJA 4D94A 2WT2A 5CNAA 4LBOA 2VOXA 1BVVA 3FJSA 1A6CA 4BIFA 4YVSA 2JG8C 3B9IA 4DRVA 1S1AA 2XWJB 4MVTA 1VBB1 3M3QA 2B39A 1PZ7A 4EROA 4P14A 3KCXA 4DQAA 2BVVA 3WD5A 1AXZA 1OHFA 2VOWA 1YUDA 1PNFA 1R081 2ATFA 1I3HA 4AK3A 4FP2A 3ZMNA 2R1DA 1MS3A 3VBSB 4C90A 4RHV1 1H2LA 3LOBA 3LKJA 2WNUA 3I2DA 1AYM3 1BYHA 1DZQA 1KDKA 1XRUA 1FYUA 1GLHA 3ES4A 4WVMA 5KBFA 3FBMA 2XJUA 4YFZA 3FMGA 1C4RA 4Q0QA 4Q4Y2 2A6XA 3AZXA 1H1MA 4GMP3 1DQ0A 1G9FA 4XFBA 3JU9A 3ZFEA 3FFZA 4AF9A 3GBGA 3L2YA 2HWB2 4JGYB 4R9CA 5GLTA 1HXS3 1O3SA 4CDUA 3ZXLA 4KU7A 3WDVA 1ND2C 2AZ5A 2V5YA 3ILRA 3O0VA 2CTVA 2ZHMA 1I9RA 1RUE2 4WZFA 4AVVA 1XNKA 2ARBA 1LOEA 4ASMB 3EHKA 3QCWA 3KM5A 4B7KA 1LOFA 3BIWE 3MW3A 5D1IA 1JTZX 1AVBA 3R4SA 4IEQA 3IPVB 4FOVA 4Q0SA 4A7KA 1PHMA 5CFDB 5JMCA 4K9SA 5AVAA 1FOD3 1RUC2 5LRRA 1R1A3 2BFUL 3AZVA 4R8HA 4R9BA 4KQ7A 4AVSA 4OFGA 1YRZA 5T5OA