3WR0A

Structure of hyperthermophilic family 12 endocellulase mutant from pyrococcus furiosus
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
270
structure length
270
Chain Sequence
KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQEVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTAFGTPSTTSAHLEWWITNITLTPLDRPLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase A
publication title Structure of hyperthermophilic family 12 endocellulase mutant from Pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 75
structure length 270
sequence length 270
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wr0A00
3VHOA 3VZLA 2DFBA 4NPRA 1XNKA 3VZJA 1HV0A 1OA3A 2DCZA 2DCJA 3M4FA 2VG9A 1YNAA 1H0BA 1OA2A 1OLRA 1W2UA 1M4WA 4XPVA 1XYNA 3VL8A 3EXUA 3AMHA 3WY6A 2NLRA 3WP3A 1NLRA 2BWCA 3WP4A 1UU6A 4XQWA 3VGIA 2B42B 1H8VA 2B45X 1REEA 1PVXA 1KS5A 1XNCA 1OLQA 1H4HA 2B46X 4S2GA 2JEMA 2DFCA 3WR0A 4HKOA 3LB9A 2VUJA 3WQ0A 3WQ1A 4H7MA 3MFAA 2F6BA 2VULA 4IXLA 3AKSA 5K9YA 1HIXA 3B5LB 3AKTA 3VL9A 1XXNA 3AMQA 3B7MA 1QH6A 3VZKA 3AMPA 1REFA 3O7OA 3WP5A 5EJ3A 3LGRA 1T6GC 3WQ7A 3VLBB 2QZ2A 4XQDA 1XYPA 2BWAA 2D97A 5HXVA 1H1AA 1XYOA 1QH7A 3AMMA 1F5JA 4HK9A 3RI9A 1AXKA 2JENA 3VZNA 2NQYA 1BK1A 4HKLA 3MFCA 3HD8B 2D98A 1C5HA 1REDA 3MF9A 4HKWA 1OA4A 1ENXA 3WT3A 3AKQA 1BCXA 1TE1B 2DCYA 2DCKA 5K7PA 2C1FA 3VZMA 3AMNA 4S2FA 2JICA 3WXPA 4HK8A 3VHPA 1BVVA 1IGOA 1H4GA 1KS4A 3VHNA 4S2DA 2VGDA 4XQ4A 1XNBA 1HV1A 1UU4A 2BVVA 3WP6A 3RI8A 3MF6A 3ZSEA 3WX5A 2Z79A 1UU5A 2QZ3A 1C5IA 1UKRA 4S2HA 3AKRA 2BW8A 3AKPA 1XNDA 3VZOA
chains in the Genus database with same CATH superfamily
2XMLA 1ULCA 5KXCA 1F2NA 1J3QA 1LOFC 2RJ2A 2BVBA 1GOFA 1OBNA 1DP0A 1I1EA 1J83A 3O1VA 3O1MA 1JZ2A 3UGGA 1YNAA 2JDYA 4K6BA 1RMU3 4LKEA 1AR81 1LB2A 1AR82 2ZX1A 1M4WA 3W58A 4A2UA 4B1LA 2KR2A 5CISA 1DGWX 2A6WA 4R4ZA 4AGGA 2D43A 4N43A 1QXJA 1W06A 3ZXFA 3LA3A 4TSVA 4M3CA 1RVF2 4LO7A 3CJIB 2OQ6A 4ZZ8A 1U5XA 1BLZA 4ORFA 1UY3A 2MEV3 4GMP3 1IG0A 1OLQA 2IXCA 3KV4A 3KM5A 3OUJA 3H8OA 1RB8G 2DFCA 4J25A 3ZKUA 1S2KA 4J1XA 3LSDA 3WR0A 4HKOA 2J1EA 4AEJA 2RS31 1FYUA 3JBG2 1HLCA 1V6IA 1E5RA 5LRSA 5A33A 3CDZB 3U10A 1VRH2 2D44A 3B5LB 3GNEA 3WZ1A 3ZSMA 3OYWA 1GWMA 4Z07A 5L7OC 1GQPA 3CLPA 3BN6A 2DWRA 2GMEA 3JD72 4N53C 2IFWA 3GJAA 3AMQA 4CXYA 5J48A 2VCMA 1HB4A 1FOD2 2GN3A 2NM1A 2ZX2A 2R071 3VKNA 1H9PA 2H6CA 1IS4A 2XB6C 3O7OA 3RS6A 3KVBA 3TRSB 1POQA 3WG3A 3WHUA 1JMUB 3M1HA 4PI2A 4TN7A 4BM8A 3I49A 5ANQA 1LHWA 1COV1 2H0VA 5D8AB 2D97A 1VPHA 4D6RA 3ASIA 3FHAA 3SXWA 3PUQA 1N3OA 2WWSA 2W39A 5A7WA 4CXXA 1QJU3 4RL7A 5C8CA 5FPVA 4AQSA 2ZEYA 4CEYC 4IE4A 4DS0A 2JENA 4LO4B 4AFBA 5I91A 1AF9A 2XVKA 5IVJA 2EIGA 3N9OA 1AR63 5A7PA 4K21A 1URXA 1CX1A 2OUJA 4Q4V1 2E26A 5A6QA 3HAGA 4EN0A 3CF6E 1GANA 4MXWA 2JE7A 5FPUA 4CCCA 2DUPA 1RUE1 2CNAA 3I7DA 3VDAA 5J7MA 5FPAA 3AX4A 5LK5A 3WG2A 4A7ZA 1ZVFA 2JDMA 5FLJA 4BXFA 1QXRA 1H2MA 3ATGA 5F9TA 1BVVA 1ZBE3 3OJBA 4K9SA 2DVGA 3ZPOA 1LNSA 1UPSA 1XNBA 2Y33A 3OSDA 4DQAA 1F4HA 1K45A 2RMU1 4ARXA 1K5MC 3H3ZA 5FZDA 3ACIA 5LBCA 3QH7A 5KXBA 5TSWA 1QJZA 2YC2A 1VBD2 2K0GA 1UY0A 2O0OA 3LWCA 3TNQA 2BW8A 4XDQA 2H0BA 3LCPA 3THDA 2DUQA 3O1OA 1KITA 4MUVA 2PAEA 2V72A 5FKBA 4AAXA 1GP5A 4YGCA 4ZS2A 3K3OA 4P9LA 5HPOA 4OCTA 5EZWA 2QDRA 3E97A 5CA6A 3CJIA 4LUKA 5FRAA 1F31A 2BUKA 3NJXA 4LE3A 4XUPA 3WDYA 3WF3A 2UY9A 2D5FA 1K5JA 3JXSA 3H7YA 1BXHA 3I3BA 3ZXLA 3EXUA 5JMOA 1CIWA 2XJQA 3VB9A 2XG3A 2RJLA 1CZSA 1UMHA 4CDXB 4RA0A 2TBVA 5H9QA 1R1A1 4NAOA 4YGEA 1B35B 3H8RA 2ZEZA 3IZOA 4P00B 1FPN3 3HNMA 2PHUA 1PVXA 3D8CA 4NWVA 1UXZA 2WQ8A 3B9IA 3UJQA 1QXPA 3SKVA 1MVQA 4N7UA 2Y64A 3BTAA 4IEOA 2C26A 4OUMA 4YZ2A 4Y1UA 1LAJA 4Z2AA 1GWLA 2VUJA 3LB9A 3OOXA 3WINE 5FZMA 3WF0A 4W8JA 4URTA 4DXRA 4L9BA 1CAWB 4O61A 1NCQA 5M0TA 4D3WA 1YHFA 2WZEA 3EO6A 3VBUA 3S5AA 3CEWA 3ZYPA 4LBLA 2JDHA 5D8AA 3M3QA 2VZPA 3PVOA 4YSFA 2RR11 2CAVA 3FUOA 4IEQA 3CO2A 2GP5A 4FXKB 4SLIA 1MS8A 3FX3A 3BGAA 4BHPA 5F37A 1EV12 4NIAA 3AP4A 2OT7A 1F9KA 1XC6A 1POV1 3MLJA 2WZR2 4KQ7A 3BCWA 1W28A 4CRQA 1D4VB 1NA1B 2G19A 3KF3A 3NJVA 2EXIA 1Q3EA 3N7KA 3O1UA 4XDPA 4PDWB 1EY2A 4UOJA 2OPWA 4IV3A 1ULGA 3NJZA 2W47A 2VC9A 3GDBA 2XLFA 1L7RA 4QAWA 1FMD2 4AEDC 4NIHA 1JHJA 2BDRA 4LBNA 3NNMA 5JIUA 5A7OA 1YFYA 3POYA 3TNPB 5DAXA 1O7FA 2WFF2 4FOYA 2VVDA 4TLGA 1Q8SA 2B9UA 4AK3A 1ND3B 3ZYFA 5FPBA 5LW9A 5LB6A 4XBNA 3M2MA 3G7DA 2GAUA 2Y0OA 4COVA 2X53S 2PA7A 1T2XA 3NL1A 1Y4WA 3ZDSA 2QQVA 1AX1A 2R061 2W3JA 3ITQA 4RQPA 2XH6A 1QQP1 1ODNA 2ATFA 1R083 4LKFA 2VBDA 2WINB 5FY7A 3QACA 5ABJC 1D2QA 4IGPA 3RRDA 2P17A 4YLZA 2UWCA 4KWUA 4AVSA 4EWDA 2HWD1 1RUG2 2HWD2 2WKKA 3AZVA 3MF6A 1NAEA 1HN1A 4Q4W1 2ZGSA 3T30A 4AGVA 2W1QA 5IVCA 1QJY3 1OUSA 4PCRA 1LGNA 1N1VA 1QJEA 1GUIA 1SACA 3AP7A 3VHOA 4EN7B 4YVWB 3SITA 2JECA 4FPLA 3THCA 3U37A 1WMFA 2WT1A 3T0BA 2WLPA 5BNNC 4EQVA 2AENA 2VQAA 5F2SA 1ZNPA 4LQRA 3MIGA 2WNUB 3R0RA 3RYPA 1SCSA 1GICA 2WAAA 5KHKA 4Q8KA 3RMXA 1PGSA 2BTVC 1AX0A 4QU2A 1VBC1 3WF2A 3A4UA 4H2AA 4QQOA 4QKNA 2Q0AA 4H7LA 4QDSA 2YBPA 1JI6A 5FUNA 1W2OA 2GMPA 4AI9A 3AYAA 4F3JA 1ZREA 5J37A 5E89A 2JDKA 4D69A 3WNNA 1ST8A 3JBG3 3VGIA 1DF0A 1A34A 1A8DA 1CAWA 1PGL1 1S0EA 2BOJA 3GCXA 1H8VA 1HB1A 1VRH3 2KD7A 3OUIA 5IAVA 4WZCA 4FTBA 1KS5A 5A3TA 4GJYA 3JD73 1UMIA 4MXVA 2B46X 2YY1A 1GBGA 1W03A 2BNMA 3AK0A 1YYNA 1ZRFA 3QLQA 1PIV3 2JG9C 2RS52 3CNAA 5BNOC 2VZOA 2HEYF 2D5HA 2ZX0A 1YWKA 2W9XA 3ZSJA 5F5QA 5IUQA 1CR7A 3AKSA 1JYTA 4PHZA 3MICA 3UKNA 4PDWA 4JHTA 4A4AA 3Q8BA 2JDUA 1C4RA 1X82A 4XF1A 2YG0A 1XE8A 3I3EA 1ENSA 1PM4A 3LSEA 4B29A 5A1FA 1XRUA 1XOYA 1S4CA 1X33A 4YVSB 1HXS2 1V0AA 1REFA 2YMZA 3HQUA 1RHI1 3DEMA 4K8FA 5GJ6A 2C5DA 4Y1ZA 4AEKA 3WQ7A 5FZIA 3KT7A 1ZM1A 1W05A 1GZCA 3ABZA 2Z2SB 5IVBA 1UYXA 1MEC1 3RZHA 1LOEA 1ND3A 3AJZA 1STMA 4LJHA 4UWDA 4YG0A 5A6YA 5LY2A 3ZM8A 2Q30A 1S1AA 3RVHA 1UW8A 4XMIA 2CL2A 5A32A 4ZPIA 3FN9A 1CAXA 4HN0A 4XF4A 1MZEA 4I0AA 1XJAA 2HWF2 2ZMNA 5FZ8A 5KHIA 2QE3A 4K7JA 3WV6A 3BODA 1ND2C 2B5HA 2EXKA 2C6SA 3FBMA 3J8F3 3VHRA 2VW2A 4ZXEA 1YXWA 2UU8A 3USSA 4BE3A 4Y4YA 3UJOA 5DMYA 3EHKA 1DG6A 4GKXA 5FXVA 1JOBA 5CAZA 5LA1A 2Z69A 2LS6A 1W6QB 4GJZA 1VBD3 4P9JA 3VHPA 4RFRB 1OD5A 2A5ZA 1KS4A 1N1TA 4S2DA 1D0HA 1H6YA 5D2AA 4YVWA 3W5MA 5C70A 1B09A 3L2YA 1VIWB 3RYRA 1JYWA 2Z5WA 2DBNA 3WG1A 1JHNA 4WM7C 3M3CA 4ZZ5A 4Q26A 1C57A 2QQLA 2WNUA 2WN2A 2XBO1 2XJTA 3K2OA 2Y6LA 1OH4A 1C3HA 2QQOA 1RUD1 3LIHA 4XF3A 3J26N 5T5LA 3C7EA 1BBT1 5L36A 1JYXA 2E9QA 1RITA 3AJYA 3KHCA 1S0GA 1NXD1 4MGQA 4YM2A 1LHVA 2IXHA 3I2GA 3ZXGA 1SFYA 2ZGMA 3SEPA 4B1MA 1O8PA 2DVAA 2XHKA 1VBB3 4EE2A 2J22A 2ET7A 3I97A 2OYZA 3AFKA 1UXXX 3INAA 4XAEA 3IDCB 5E16A 5FO8B 3WD5A 2VTXJ 1HB2A 3HR9A 3IMMA 3MIDA 3OTFA 4CEWC 3PUIA 3BU7A 5SV8A 2LW8A 4I3GA 3I2JA 1PK6C 2VNOA 3AXEA 3W21A 1AYN1 1KDMA 4GD4A 1H30A 1G9FA 3ZOIA 3HOBA 3J7LA 3ZFEC 1N1YA 4LA2A 1GP6A 1NYWA 1W8UA 2FCTA 1A78A 2P4EA 1FXZA 1HW5A 3VDDC 4GH4A 1NT0A 2HWC2 4TYSA 1EV13 3ZN6B 4GB32 2F6BA 4YGDA 4YVSA 1VP6A 3TN91 2UYAA 5DG1A 2E6VA 3WW4A 4AVVA 1UZYA 2JJ6A 4DIQA 3LA7A 5FYZA 1ACCA 3VDCA 2BU9A 2WA4A 1FAYA 4F7ZA 4FOVA 4MHUA 4QX5A 5JPMB 4CDQA 2V4AA 1OD3A 1O6UA 2D3RA 4NHKA 4QB2A 5LA0A 1JZ5A 1QF3A 1HJGA 1FMD3 2VNGA 4XVHA 4CUCA 4QX7A 3N3HA 4BPZA 1CAUA 2JD4A 3AYEA 4J6GA 3P5BA 4RGAA 3WEZA 3O1SA 2XUEA 4LNVA 1QEXA 2WFF3 3VBFC 4XFHA 1CZVA 4CDWA 4DEQA 1W6OB 1JU4A 5JOWA 1JYVA 1FNYA 5JUVA 3FL7A 3MO4A 1CX4A 4GA9A 1MS5A 1UOBA 2G9FA 5JLVA 5JXHA 2NP0A 3LOBA 1CWPA 3LA2A 2P3JA 3WCSA 3KWVA 2NQYA 4JGZC 1PMJX 2VPVA 3KSCA 3ZFGA 1W6QA 1RUJ1 2E7TA 4A3XA 4AQTA 1PVC1 1MS9A 4FPHA 3VD5A 2GC1A 1MQTA 4CDUA 1AR72 1EAH3 3Q8EA 2O1QA 2E7AA 2F4LA 1XE7A 4AHXA 1AR91 2BYVE 4MX3A 3GHMA 4HSLA 1CQ9A 1GZWB 2WT0A 3NNJA 2E31A 3LF7A 3JUUA 2ZS6B 4L8QA 1RUG3 4NPMA 1JOPA 1PZ7A 5T5PA 5EYXA 5FXWA 5LY1A 4WVMA 4JDMA 4XC9A 5HI0A 3I59B 2MEV1 1H2NA 2A6YA 2I74A 2Q1ZB 4BDVB 3FLRA 4AI0A 1GLHA 1ZRRA 4KU7A 2JE8A 3SH4A 3I4IA 1IKPA 2ILMA 2P6CA 5KC6A 4WVZA 5F3IA 4DEVA 1EUUA 1XNTA 3KLSA 1WWYA 4FP3A 4W65A 3UKVA 3ZDVA 5JXJA 3V64A 1PNFA 5KXDA 1RXFA 2VOKA 1PO23 3IN9A 4S2HA 3RFRA 4BB3A 4BQWA 4E9KA 1YQ2A 2BNNA 3URFA 5FP9A 1UZZA 4NUBA 4C91A 1XNKA 3ZYBA 3VZJA 3FC0A 2BBVA 4XFAA 3OB8A 2X29A 1ZBA2 2MPFA 2B9VA 4O9GA 3WSOA 1J59A 4HT1T 2ZKLA 2Q1MA 4QPGB 3M3OA 4EN6B 3RWNA 2ZBJA 1RUI2 1LCLA 2XQRA 2A71A 5DG2A 3GGLA 3LAGA 2R30A 2WWUA 2P3IA 4FAGA 1V6KA 4AFAA 5I0DA 1NLRA 1HRI2 3ZN6A 2PHLA 4KG8A 1RYYA 2VUAA 2Q4SA 5FZEA 4B7KA 2BERA 4WM8B 3F2ZA 5IAXA 1QNYA 2HH9A 4LBMA 1LENA 2JEMA 2ZKNA 2VMCA 3OPZA 1Z7S1 4JAAA 4W6YA 1PGW1 5J36A 1ULPA 4G4FA 1LTEA 2KM2A 5K8SA 3WQBA 4LULA 5FZ9A 1HXS3 4IE6A 1H2LA 3O1PA 4TZDA 5FBJA 3UK9A 2XXZA 4AVTA 2ZMKA 5C9AB 2A70A 4E8DA 3RZKA 1OF3A 2W08A 5GZDA 5FP8A 2P37A 3N9QA 4P9IA 5JDBA 1W6OA 5FXXA 2IWGB 3RSJA 3ZFFC 1U5IA 3B93A 4IETA 3VZKA 2LUWA 4E27A 2HWE1 2ZACA 1YQ5A 5DDJ1 2CTVA 3KVAA 1LHNA 2QQNA 4QT6A 4AFCA 3FWEA 4LKDA 4UF0A 5ERLA 1I6XA 2HWF3 1FV2A 2DVFA 2OQ7A 2QZ2A 4HFSA 4N43B 4QPYA 4A3ZA 3K51A 1ZZ9A 4V2VA 5GZFA 2ZTNA 4QHOA 3S57A 1J3PA 4JGYC 1YQ6A 3AMMA 1RUNA 5KBFA 2E32A 4XETA 3KQ4B 1TME1 2WNVB 5DAVA 5JAXA 3SCFA 3MIBA 4JDNA 3VZNA 1UWWA 2FZ1A 5FJKA 3MFCA 4FPJA 4XF0A 2D6LX 4DUWA 3I59A 2XHNA 2ZAHA 5K0UA 5F39A 1RUF1 2V09A 1RUF2 4XYXA 5EPAA 1PMHX 5FK7A 4M01A 1LECA 1V9U1 1W0PA 1U12A 1V9U2 2G9ZA 2TNFA 3JB4C 4MH0E 1GZ9A 2WN3A 1W2TA 1C1FA 3OYWB 3ES4A 2ZGTA 5CYYA 1W8WA 5DZFA 2WO3A 2Y38A 4CE8A 2R16A 1FT9A 2WNEA 2OZ6A 3ZXEA 5JMCA 3NAPC 4XTMA 5IFPA 1BHGA 3C7FA 2RS12 4AVBA 2IZWA 1GMMA 1HV1A 3N4MA 1ASJ1 3FFQA 4P9GA 3W5NA 3RZJA 4QX1A 1NX9A 4RS5C 1WD4A 3POJA 4HONA 1UKRA 4QPGA 3WG4A 3E5UA 1DGRA 1AL23 1MPXA 5CFCC 3U1XA 1HRV1 4KG0A 4R9AA 4XABA 1ZRCA 4HMZA 3VBRA 1CPMA 1UQXA 2QFEA 2XWJB 1N47A 3ALQA 5A7WB 2DYCA 4PQ9A 4OQ8A 4Y3OA 4FOWA 1DZRA 5I8TA 1YLLA 2DCZA 5FP4A 5JR7B 1LRHA 1NY71 1NY72 1OA2A 4IV1A 4IQPA 4KGGA 1OPMA 3H7JA 3T3YA 3IM0A 5C4WC 2AZ5A 3N9MA 4HG6B 3WY6A 2WFPA 1DQ6A 4MXWB 5LCWL 3MZHA 3K4AA 2Y34A 3POFA 3WCRA 4CXWA 3NKTA 1W6PA 4CVUA 5I8YA 5J3UA 2VE1A 3Q8CA 1XU2A 4MGIE 4XCBA 3ZXAC 4FPEA 2HWC3 1XNAA 4GB33 1RUH2 4N8MA 2IXIA 4EN9B 1SQ4A 1W6NB 2O14A 3MW2A 4DXZA 5BNQA 5F3GA 3MEPA 3ZO0B 1QJX3 5C9AA 3VBSC 4U36A 2P3KA 3WUCA 1WCKA 3MIEA 3BIWE 3DGTA 4XFFA 5IT6A 3OGRA 3PDQA 4XZPA 5T50A 2A6XA 3VBHA 2LROA 2PAMA 1RINA 2C24A 2H6BA 1W04A 5DZGA 3B01A 1L7QA 3NW4A 3E1F1 2X5IC 4NMIA 4P9WA 3WNLA 5LA9A 1LOFA 4ATEA 2W91A 4WV8A 1NCRC 1POV0 4LBQD 4SBVA 4XEZA 1FV3A 4LLFA 4YGBA 4FPOB 2XVGA 4ATFA 1UOFA 1VAMA 3AL6A 3OF1A 3VBOC 4P5YA 4YW4A 4QWNA 2X8KA 4U2AA 2WNVA 3WNXA 2JB8A 3TEWA 2W92A 3IBMA 1O4ZA 2VBPA 3LZZA 3B02A 4CP1A 5D21A 2C0ZA 1QDCA 2A1XA 3I8TA 1XYPA 3GXUA 3O1RA 5LZ6A 1QJY1 4YW7A 4DY3A 2RS32 1H1AA 2ZX3A 1VRBA 5GM0A 4BXSV 1AR73 1LGBA 2W46A 3M3EA 4UFMA 3DECA 4INDA 3BUCA 4IEXA 3PNAA 1C8M3 4TWTA 1UYZA 2FDFA 2R0FA 3VD3A 4Y1XA 2FMDA 1GR3A 3LDKA 3HD8B 2NPIA 1RXGA 3ZSKA 4D94A 3AZYA 2D3SA 2A3YA 1BEV1 2WYFA 1BEV2 1OA4A 3D0SA 4M3CF 5IWFA 4E2GA 2R072 2VUCA 3L9JT 2PELA 1BCXA 2DTYA 4N53A 5IK4A 5HCFA 3LEGA 1NCQB 4XFIA 4KWKA 5I0TA 5JOXA 4OMCA 2WZPP 5A3UA 3VBUB 4K1ZA 1COV2 1R093 1UX6A 3MW4A 5CKQA 4ASMB 4QKBA 1JYCA 2Y6FA 4R9BA 1O3TA 2CAUA 3I2OA 2QTWB 5FLIA 4MGZE 3UL2A 3AYDA 5T5OA 5F3CA 1WCDJ 4OI4A 5GLVA 4Q2FA 4LEJA 2VZ3A 3BU0A 3ZSEA 1SEFA 1ZBA3 2Z79A 3GBWA 2ENRA 1RC6A 3P6BA 5FREA 4YPJA 1DBNA 3F95A 4CCEA 4DRVA 5IVVA 4IV3B 2B7YA 4CEYA 3ENRA 3DPRC 2GN7A 3HMYA 4Q4V2 3N35A 1V00A 1RUI3 4FFGA 3DYOA 1S0IA 4URAA 1HQNA 1SLTA 1UYPA 4AOCA 3VZLA 5C8WA 2BFUL 4ISQA 2A7AA 1UIJA 1ZA7A 1AHSA 3NV1A 1RUE2 1I9RA 1GWKA 1S0FA 1KRIA 5FYVA 5FYYA 3QD6A 4I2OA 1GP4A 1LGCA 2I45A 2RVAA 2ET1A 2HJIA 1PM7A 1RGSA 4RHV3 1W6NA 2QJVA 3D5OA 5JIAA 2CWSA 3WUDA 1EP0A 3B69A 3PUHA 1QU0A 4XE9A 3A22A 5G04L 2JG8C 1SLLA 3TB0A 4BQXA 5B2GB 2P1BA 3PHMA 4CPBA 4RFT0 1X9TA 2RMU2 2VOXA 5EIYB 4FT8A 4GKYA 4YG6A 5JWPA 1UZVA 3OGJA 4COZA 1CJPA 1BYHA 4XOGA 3DUIA 4MO3M 3C7HA 4RQPB 3WNKA 1NQJA 3OEAA 1RUC1 1Y9QA 5FLHA 1SFNA 1K5MA 4LR4A 2XOMA 5J98B 2BNOA 4EROA 4H55A 3DXTA 4FQ4A 4KU8A 1HB3A 4QDRA 3C7GA 1DHKB 3A0NA 3ZMOA 5JR2A 4GWNA 3MYXA 3N7LA 5H9SA 1V6OA 2XQXA 4QKFA 3NJYA 3NVCA 3WQ1A 5HV4A 3ILFA 2AGSA 1PO13 4KWLA 4FXGB 2GC3A 5ABJB 3BIEA 5K9YA 1WW5A 3T0AA 1KJRA 2FDHA 5CVRA 1H8TB 5A7SA 2G4IA 4HVQA 5DAQA 4C0BA 4PQQA 3W20A 1M06G 3AXDA 2BGPA 1WA4A 1Y7BA 1KFUL 2VCBA 1VAVA 3WDWA 4GWJA 2XJRA 1R1A2 4P14A 3WHTA 2WO1A 1SPPA 2P5BA 3PVNA 2VO5A 4XACA 2GALA 1ZRDA 4XZUG 2JDAA 3AM2A 3EQEA 4YG3A 5LBBA 3DCQA 1SDDB 4BJ0A 1TNRA 3OBZA 5LA2A 4ET7A 1W9SA 3B94A 2VW1A 5F7UA 4R8HA 2QKDA 5FK8A 4DINB 2ZJCA 4JQTA 3QBQA 1QH7A 5IK5A 3BTYA 1F5JA 3WNOA 3I3QA 1LOCA 1O4TA 3FHIB 2ZXQA 1J3RA 1NE4A 1SDWA 2JIJA 3ES1A 5FZBA 2DV9A 1BVP1 2RR12 2P6HA 4UW3A 2WAOA 2WS93 1C5HA 4QX8A 3RWKX 5GZGA 1OT5A 4FOQA 4NHXA 1DGLA 5J96B 3O1TA 2ZEWA 3OGGA 1OH3A 4M00A 3DYPA 1O3QA 1JYIA 2PQSA 3HBZA 5A80A 3AKQA 2OW4A 2RS13 1IS6A 2JDPA 4WVWA 5FYHA 4A6SA 2ZHKA 4QQHA 2B8MA 1KDKA 1OHFA 1VJ2A 2GMMA 4MVTA 2WDBA 5T5JA 3THTA 3AMNA 2JICA 4UFIA 1KEXA 5FOBB 1W3XA 4AF9A 1IGOA 3WW2A 1UOGA 4HPKA 1W8ZA 2VMFA 3MPBA 5GZCA 1UL9A 3HJRA 1DGWA 4ASLA 4GALA 5FPZA 1S0CA 5A3LA 2PLV3 4PLOA 2BVVA 4XXPA 2PN5A 2VXRA 3ON7A 4EYUA 3P3PA 3P3NA 4AEDA 1YI7A 4W6WA 3UGHA 1UKGA 3HQRA 5FUPA 1APNA 3AKRA 4MOAA 3WVJA 4F8AA 1JBCA 4FBFA 5C3RA 1RTVA 1D4M1 4L92A 1OLME 2NMOA 1WMEA 4DOUA 2V5YA 4IEVA 2DFBA 1WLTA 4O65A 1L3JA 5A32B 5HBAA 2J1RA 3CZJA 1CAXB 1C1LA 2YZ4A 1NLQA 3ECQA 3UYJA 3NQHA 4FO9A 1QIQA 2R062 1XYNA 1QQP2 2Y6KA 1HJFA 4QM9A 1WCQA 3MLLA 1DCSA 3KT4A 2ZHMA 5BUVA 1OVSA 2ADDA 2WIIB 2WT2A 4XXAA 4O7XA 3WP3A 2Q1FA 5DZEA 4OUSA 1F15A 5T55A 4Q0UA 4A7YA 2RM21 2Z4FA 3FZ3A 5FYCA 4XQWA 5EJ1B 1KFXL 4RGGA 5BPXA 3D3AA 2OZJA 1AR83 4Q4W2 5E1RA 4OI1A 4DPNA 5FZ4A 3RZGA 3PURA 1H8TA 1BQPA 1FNZA 2WSUA 5FTTC 2ZX4A 3U07A 2PHFA 3NNFA 2A6ZA 5GKAC 5GLUA 1LU2A 1O8SA 3K48A 3ZR5A 2IXLA 1EAH1 1G9BA 1EPZA 1RVF3 2XJSA 4YFWA 3BPSA 3IPVA 4KBZA 5F8PA 5LEKA 5A3OA 2WZ8A 5BNNA 1W8OA 2YUEA 2HYXA 3R6SA 2EICA 4ISRA 4FSJA 4WM7B 1W9WA 1VBC2 3GM8A 4LHNA 2D40A 3TEZA 3U0ZA 3KQRA 4CDXC 5ACA1 2BOIA 4QPIB 4Q1RA 1D2SA 2RS33 2XJPA 2R7EB 1B35C 3QCWA 4B8EA 3BPZA 1PGL2 1IPKA 1Y3TA 4Q1PA 5E88A 2WR9A 1AL0G 1NZCA 3H42B 3O12A 4W6XA 3TOJA 2W95A 3VLBB 1PO21 5GALA 4NOTA 3LPGA 2BWAA 5FZOA 4Y26A 1QJFA 1TMF1 1XU1A 5SV5A 5HCBA 4LE4A 4LBOA 2BV4A 1FOD3 1SLBA 3WNMA 2X09A 5C3QA 2R073 2WSVA 3KT1A 2VW0A 2JG9A 1AXKA 1JS9A 2YGLA 3E6DA 3H1MA 4R4XA 4D8MA 5BNOA 1AXZA 1BK1A 2HKXA 2UYBA 2VZVA 4HKLA 1COV3 1PK6B 2DBIA 2VMGA 4N9HA 4JX0A 4Y22B 3UGFA 3ETPA 2VQTA 4JKKA 4QB6A 1QOTA 1LHOA 1JW6A 5FY1A 4Y1VA 2VH9A 3UNPA 2O8QA 3FBYA 4GH4B 4QMAA 2EIBA 4HOOA 4QXCA 5A3NA 2P2KA 1NA1C 1RHI2 3IDBB 3DV8A 5F5AA 2FHRA 1VB4A 2QQKA 4XJ9A 5L9VA 4LOSA 5ABJA 3VDDB 4E2QA 4PDWC 4Z92B 3ZXDA 4CCNA 3OPWA 4I09A 4BQYA 4COUA 2W2IA 1MEC2 2L9LA 4CDQB 1AVBA 2CWMA 3T0DA 1JN2P 3RJ2X 4Q4V3 4BIOA 1J58A 1LU1A 4CCJA 2ZHLA 1DYPA 2BFUS 1VLNA 1QOSA 1CAUB 4YW5A 1SZBA 1CAVB 1RUE3 1NG0A 3FLPA 3KCYA 2D6MA 3H8UA 1UD1A 5AC91 1UU5A 1VBA1 1VBA2 3GJBA 5HCAA 1ZRIA 4IW3A 2K9ZA 5BNPB 5E8AA 1VMJA 1AYM1 1ND3C 4CDWB 5CG8A 3BALA 2RE9A 5A7QA 3OG2A 2XLAA 1C28A 3B9CA 3ZMNA 4XW3A 2W87A 5FYIA 2RMU3 4UW6A 2GZWA 2WQ4A 4NHMA 3BOWA 3ZFGB 4B3NA 4DRRA 1OLRA 2FMYA 2VMHA 5GZEA 1YFXA 2FDIA 4LHLA 3VD7A 4YM3A 1VBE1 4NE9A 3HT1A 5FZ6A 3VKLA 4JTNA 3RZZA 1MQTB 4CDUB 4AVAA 4JGZB 5C33A 3K3NA 3H8XA 3HEIA 4QGMA 3CU7A 3ZN4A 1ZYBA 5E6HA 3NV2A 2Q8EA 4A41A 3H50A 3PJQA 4CU6A 2W52A 3MUZ1 1O5LA 3OD4A 3KCCA 2GDFA 2XBO2 4WVMB 3S7IA 5LEJA 1X36A 2OXBA 1RUD2 3O14A 3VKOA 5EJZB 4LT5A 4NRMA 1BBT2 3K46A 1YCIA 4WM7A 4YVWC 3PLQA 1UYYA 4IEUA 2E33A 2YFZA 2R041 1W8FA 1LEMA 4QPIA 1EYBA 1QOOA 3H1YA 4YW2A 2X05A 4UI9L 3GYDA 1VB2A 3MV11 5L9BA 1Q8PA 1R1A3 2WNUC 4UW4A 4Y33A 1U0AA 2A73B 3C3VA 3KCXA 2HBTA 3AKTA 1MZ5A 2QQIA 4KH9A 3VL9A 1PZ8A 1WMDA 4DO0A 4DXTA 2XWBB 3SLIA 5C5TA 5CIRA 4Q27A 4O9EA 1AYN2 4GAZA 3WF4A 2B4KA 5FYUA 1MS1A 4CU8A 4UFKA 5IW0A 4CEWA 4EWEA 3J9SA 2GSYA 1T6GC 2CV6A 1PK6A 4Y22A 2C9KA 3VN4A 5FZFA 2KA3A 2RR13 1AL21 1YJKA 4FAHA 1YRZA 3TEYA 4PIXA 1YC61 1DZQA 3IB3A 1SCRA 2VNRA 3ZFEA 4Q4X1 4Y5TA 1P8JA 3TN92 3RI9A 3FLTA 1POV3 2WZR3 1CIYA 1YFUA 3AP5A 3ZYHA 3VDDA 1MS4A 3OEBA 3N9LA 5GLWA 2JDZA 1LEDA 1PHMA 1OKOA 1RL3A 4TLFA 1OXCA 1RUOA 3ORJA 3MI8A 5LRRA 2HWB1 4YVSC 5FY5A 4Q4Y1 5DAWA 4BQ4A 4F83A 1CAVA 1SLAA 2E7QA 1UCXA 4JTOA 4PIYA 4E4SA 1H2KA 2Q5TA 3NO8A 1N3QA 3AFGA 4MYEA 4KL1A 3U4SA 1LOGA 4XJZA 4ZHNA 4Q0PA 5BNPA 5LBFA 3DF0A 2BEOA 1QJX1 2BP6A 3VHNA 2FDGA 1QGLA 2ZCWA 3SCHA 1OFNA 2J1SA 5FPXA 5JOZA 2HEWF 4I0BA 2HYKA 3BI3A 1Y9GA 3VBFA 4NJ4A 4D6SA 4LTAA 3EBRA 1OURA 3JB8A 3ZFFB 4OQ9A 1RMU1 4UF0B 1RUJ2 3LDBA 2R063 2W0XA 4OLLA 4QU1A 4Y20A 5C7GA 1QQP3 5KHGA 1W6MB 1PVC2 2EAAA 3RZMA 1ALYA 4Q0QA 2VR4A 2W1UA 4JGZA 2VOVA 3C8XA 3AVSA 2VY0A 1D0GA 3E6BA 4X6RB 2A3XA 1AR92 5C3PA 1H1IA 1JTZX 1GQGA 4IGQA 5DUWA 1UZ0A 2HWD3 3LOIA 4J1WA 4JQRA 1W2UA 4JGYB 2BRTA 2AEYA 2Y6GA 3HN3A 4Q4W3 5FPLA 3VL8A 4CA9A 2FD8A 5K0UB 4GMP1 2EXJA 2MEV2 4N9IA 4QGNA 4KWJA 2C9AA 2EF6A 1A8MA 2MHFA 1IPSA 4I02A 4Y24A 2AUYA 4UAPA 5A6ZA 4FI9A 2AEZA 5LBEA 5IFTA 1CJDA 1OQ1A 4QD2A 4YZ4A 1UF2C 4QX2A 1C8M1 1QY4A 1J84A 1V6NA 4W50A 4K20A 5KHHA 3UV9A 4N7IA 4L0PA 4YW3A 1ZZ6A 1US3A 4I0WB 1H4HA 4G3YC 1ULDA 1VBC3 4FP2A 4ASKA 4ZS3A 3POSA 4QXKA 5DQ0A 5I0UA 3AZZA 3D82A 4QXBA 1OOPC 5FYMA 2ARXA 3WLUA 3WQ0A 3ZKYA 3NAPB 1R1ZA 1A6CA 2JWPA 3HIFA 2WQZC 2BZDA 3WDTA 2VCAA 5F6KA 4OI0A 2QDNA 5FJHA 1GNZA 2VVEA 3W59A 3L2HA 3WDVA 1IS5A 3VBRB 5J09A 2XJVA 2DF7A 4CP2A 2VXJA 4FQZA 2RDQA 4C8DA 3BVCA 5DUXA 3RQ0A 4DMIA 4IE0A 4I3PA 5AFBA 3ZIWA 4COWA 2RS53 4EV0A 2VMEA 5CFDB 1VE0A 2XVLA 2LTNA 1QJU1 4MV2A 2YC0A 4IV1B 5CZKA 2YU2A 2MNGA 4C1XA 1OQEA 4UYBA 1ULEA 2XL9A 3UKTA 3ACLA 4YW1A 4H14A 5A3MA 2A75A 4QQPA 5FQ0B 2SLIA 4Y5Z0 1AR61 1H6XA 1Z7S2 1PGW2 4CP9B 1W39A 1W6PB 1D7PM 2DURA 1JUHA 1QHDA 2QCSB 4AZZA 3S0MA 2ETEA 2Q8CA 3T2TA 3ZR6A 1RHI3 1W2AX 2WC2A 4QHZA 4OHVA 4EZ4A 4MADA 4XMAA 1SBEA 2IVJA 3PMEA 3USUA 4OFGA 3VBHB 1OF4A 3MF9A 1ZBE1 3POWA 1OI6A 4HKWA 1GNHA 1MEC3 3SC7X 2C4XA 5FWEA 1CPNA 2RDRA 5FP7A 2GNTA 4P9YA 5JPNB 4QPWA 1XPWA 2AH2A 2CSGA 2HWE2 5DDJ2 2ARCA 2RDSA 1TE1B 1J1LA 3T1MA 2DCKA 4YM1A 3ZFFA 1VMFA 2GH2A 1H1MA 4YZ5A 4W4ZA 5BXXA 5A70A 4ZKTB 1WD3A 2X5IB 1W6MA 1S0JA 1IPJA 3PVBB 4BQ5A 5GLZA 4LBKA 3POGA 4QX0A 5L9RA 1W8NA 1NCRB 3W9AA 1UNBA 1TME2 3GALA 1W0OA 2VNVA 3V56A 4PT6A 3RI8A 3ZIXA 1MS3A 3WX5A 2QZ3A 2VD7A 4JGYA 2GNBA 5FCCA 3GBFA 5CB7A 1XNDA 2CGPA 1W9TA 3KD4A 4MHRA 2PHXA 1O59A 2D3PA 2CDPA 4UFHA 1YO8A 4NPRA 1DFQA 2QUOA 3TBDA 1HV0A 5KC5A 1DQ0A 1Q43A 3VD9A 4XUOA 4AE2A 2WO2A 4CYDA 1FPN1 2XBO3 5CNAA 1CONA 2F4PA 3BYWA 1RUD3 4XFGA 3M7AA 3AMHA 1BBT3 1X50A 4YFZA 5L7OB 4AHWA 4NIGA 4RR3C 4UBHA 2VOWA 4MSVA 4N53B 2VJXA 2Y6HA 2NLRA 1JZ3A 1W8TA 3EYPA 4LHKA 1ASJ2 2UWBA 2WWJA 4Q29A 4JZRA 3NAPA 1G9AA 5EHDA 5D1IA 3AP9A 4BQ1A 3LDRA 3LKJA 1W9YA 1Q8VA 4CP0A 4LMFA 1REEA 3VUOA 4LXLA 1HRV2 2ZGLA 3OY8B 4JKMA 2PHDA 3OGSA 4RS5A 2BPA2 4LUMA 3OGVA 2WS91 5CFCA 1VR3A 5CFDA 1WKYA 1F5FA 1OLMA 3ZYJB 1NKGA 3IKWA 1IHMA 2XKOA 5FZKA 4H7MA 4NRQA 2W5FA 3A7QA 4HXCA 4MZUA 4CEYB 1YJLA 1A3KA 5FQ0A 2J1TA 3BB6A 3D6EA 4ES9A 2NMNA 1E5HA 2AYHA 3ACHA 5J1XA 2DCTA 2DU1A 1JODA 4MGTA 4CP9A 1Z0HA 3ELNA 2D6PA 3VDBA 2EIDA 2I2SA 2PYTA 3O0XA 1JH5A 1K3IA 3DPRB 4ZU7A 2QQPA 5C4WA 2OX0A 5IK8A 1F8VA 4LO8A 2ARAA 4GQ7A 3TN93 3CHXA 4WM8C 3WOGA 1SHWB 4XCAA 1UX7A 4PIZA 4R9CA 3M70A 4IERA 4BH9A 1AZDA 1SG3A 3SCGA 4AHZA 2W1SA 3RMYA 1F4AA 4RD7A 3PUAA 4AYUA 2ARBA 4BK5A 1JU3A 3AZWA 1UY1A 4HK9A 4N90A 4ONUA 3O0VA 1G9DA 1TG7A 3LIGA 3ILRA 3H9AA 3FE5A 1K5MB 4FFIA 4PF5A 4M4PA 2GH8A 2QQMA 4XUTA 2X5IA 3JCIA 3DKQA 1H9WA 3R4SA 1R081 1VALA 1NCRA 5BYNA 3U78A 2XGXA 1O3RA 2AREA 5HXMA 1MS0A 2P34A 3ZPYA 3OCPA 4HANA 5A7NA 2D93A 2D6KA 2GP3A 4LOTA 3U14A 5K7PA 4OHXA 1LOAA 2QNKA 3ACGA 4XFBA 3VZMA 1IQDC 2J1AA 4N43C 4PBPA 3VBOA 4UW5A 5KR7A 1MZ6A 1O3SA 1RUJ3 2BJSA 4CPBD 4QX3A 4K8RB 2VVFA 1QJY2 1PVC3 5H9PA 1AUYA 2K46A 2YV8A 3IDAA 1Y9MA 1WMXA 1G86A 4AWDA 3KHBA 2WNVC 2XUMA 3Q8AA 4A42A 1SPPB 1AR93 5FKCA 1UMZA 2JIGA 4PBOA 4CCMA 5FR3A 5IYYA 3C7OA 1BJQA 4DZGA 2E53A 2YXSA 3M8LA 1RVF1 3T08A 4M0HA 2K2SA 4MGKE 4AI2A 5FY0A 4IE7A 5L7OA 3GBGA 3ZYRA 5ANNA 1DIWA 4BYYA 3ACFA 4BZ4A 2VQUA 5A3WA 2WLQA 4OHZA 5L19A 2DCJA 1LULA 3SQOA 1DZTA 4BQ3A 1E57A 3JBG1 1H0BA 4XBLA 4LKSA 4JC1A 4GULA 4YM0A 5C71A 1VRH1 3AVRA 3ZVXA 1HX6A 3HNYM 2YU1A 1LESA 3OY8A 1IZ3A 1GQHA 1ONAA 3VKMA 1QKQA 1KXGA 3SH3A 1CGPA 2ZZJA 1S0DA 3JD71 3PU8A 4YARA 5FYTA 1KGYA 2XKPA 1PIV1 3PJYA 1PIV2 4HL0A 4QXHA 2OUHA 4A45A 4BISA 3POBA 3LFMA 5FP3A 5FDBA 1FOD1 2RDNA 1JZ7A 2LM3A 4YRDA 1LOBA 2R0HA 4IEYA 1E5SA 1V6LA 4HZFA 3P1IA 3JQWA 1S55A 3WDUA 1CESA 1WW7A 3NWKA 3NV4A 4HPKB 3ROUA 5C8CC 3N9PA 1GYKA 5I8SA 2ERFA 4NN0A 1HQWA 4MGSA 3DPRA 3SKJE 4CZSA 1CD3G 1HRI3 2V73A 4AEDB 2UY8A 4QB1A 1I5PA 3HQXA 4D7YA 5C3OA 4Y5SA 1ULFA 4ES8A 5FZ3A 2ES3A 5FZ0A 3S30A 1QWRA 2Y26A 1Z7S3 4ZXKA 3U75A 2JG8A 4LBQA 3FMGA 1QNWA 3HT2A 4GWMA 1RUC2 4PI0A 4KMQA 2YPJA 4P5HA 4AEMA 2XJUA 2VTXA 2ZMLA 2EIEA 4UT5A 1GSLA 3J8F1 2ZGKA 3J8F2 2J1UA 3LQCA 3T4HB 3K4ZA 2EAKA 3H3UA 4D7SA 1SLCA 3V0AB 1XQNA 2HWE3 3KZ4C 5DDJ3 4CSWA 1J1TA 2P3YA 3DXUA 1ULOA 3V0BB 3PU3A 5EWSA 1ENQA 4FPKA 2GC2A 2NZ9A 4RN5A 1OQDA 2CGNA 2Q8OA 4D6QA 5JSRA 1R64A 1VBD1 3CL1A 4LIUA 4NHLA 4NWWA 5FYBA 5JSPA 2RV9A 5CADA 4L11A 3OBRA 1LKNA 3CJIC 1WLWA 3H0OA 5FUIA 4JDOA 1DYKA 3IWZA 1TME3 4JVAA 3IPVB 4BLIA 4QKDA 4FPGA 5BNNB 4BWOA 3WXPA 5DN2A 3SMHA 4HK8A 2NN8A 1W9FA 4Q5OA 1SLIA 3K75B 1RUF3 2D6OX 2W68A 1O4YA 4FFHA 1V9U3 4Q0SA 1FX5A 2WO7A 3T2OA 5CU1A 1W8HA 2Y60A 2RJKA 3SNMA 2ZAAA 2NYYA 2QBXA 4NPLA 1VBB1 1TNFA 1VBB2 2GC0A 4XILA 4I01A 5FZOB 5IATA 3VZOA 4FTSA 5FWJA 3D4KA 4A7KA 2FBEA 1NCQC 1WLDA 2JKBA 4AL9A 2JG9B 3VBUC 1ASJ3 5BNOB 1ZZBA 2VG9A 5D8AC 4CU7A 4DXSA 1IQAA 3C2UA 4JCKA 1KQRA 4M4RA 4NAMA 4GIQA 4OI2A 1HRV3 4NVPA 1S2BA 1U5YA 2JB4A 5JZGB 1CVNA 5JI7A 4JHZA 1OMIA 2ZZQA 4LHSA 3A23A 1EV11 3ILNA 1SBDA 1V6MA 1UU6A 3IIIA 3WP4A 4Y1YA 1W90A 4IV3C 1OFSA 2WZR1 3JZVA 3CQOA 1D4M2 3KV9A 3B00A 1XNCA 2J7MA 3R4UA 4JV4A 5BY5A 1OC1A 3CKHA 5FZLA 2ZGUA 5FZGA 1HDKA 1GOHA 3HVDA 4LORA 3HPNA 3SH5A 3WNPA 2VU9A 1FMD1 4PJYA 4XJUA 4UFLA 1YQCA 3I2HA 1LJ7A 4NIDA 1RUH3 1XB9A 4BQ2A 1GOGA 1HIXA 1MACA 2TUNA 5F6LB 3E5QA 1NZIA 4LO5B 2JD9A 3FFZA 1U5ZA 3HNBM 5FV3A 3POIA 2JX9A 4AGRA 2WFF1 3RG0A 2ZOEB 4WVVA 5I0RA 2OVUA 1XSRA 1ND2B 2ID4A 4KGQA 1VMHA 2RM22 5F5CA 5ISLA 2UURA 5CEHA 3V0AA 4Q8LA 4RQPC 2FCUA 4XUNA 4BOWA 4ZY9A 2WNOA 5L73A 3V0BA 3LD8A 3LGRA 1US2A 5C6CA 5JI9A 2D7FA 5EV7A 4PF1A 4AQ2A 1F35A 3TEXA 4LPLA 1XSQA 1AJOA 1EAH2 1G9CA 3K4DA 3N7JA 5FZ1A 3VV1A 3E6CC 3OBTA 4CCDA 3PIJA 4LK6A 2WYSA 1H8TC 1RUG1 3I2IA 2YBKA 3T4VA 4P08A 5FBZA 5DXDA 5FY9A 4AI8A 4DFSA 1DGRN 2V5DA 5ACA2 1G8WA 3GCWA 5FAXA 4K1YA 5FZCA 3S5QA 1NQDA 2BBAA 2IUWA 2R49A 3UETA 2V4VA 4ITCA 4OHYA 2OS2A 4CDXA 4XTPA 4XAAA 3EJKA 1RJ7A 1TVGA 2W1WA 1OKQA 2BGCA 1B35A 1PO22 2R6QA 3U11A 4NROA 3T1LA 2WA3A 5JXGA 3KMHA 1NXMA 4A44A 4HLTA 1TMF2 1ENRA 2IXJA 1BEV3 4XIOA 1WZXA 3LEMA 4XQ4A 2GU9A 4M3CE 2XDVA 2Y8KA 2XR4A 4CEWB 2B39A 2R1BA 2FCVA 1GKBA 3CBNA 1C5IA 4DNYA 4Z8BA 5C5UA 3MDPA 1GV9A 3RPQA 4COYA 3H1WA 3MHZA 5KHJA 2XONA 1CZTA 3GZUC 2VMIA 3CZUA 1Q5OA 2ZGOA 3KB5A 3N7MA 3ZFEB 4AG4A 4GMP0 2YDEA 4AR2A 5JZGA 4BU2A 2RS51 5CBLA 3KS7A 5EYYA 3OD0A 2YGMA 3J4UH 5AVPA 2E63A 1NA1A 2TEPA 3MBWA 1X7NA 4EZHA 2AC1A 4KI5M 2YPDA 1UN1A 5T52A 4AW7A 5FO9B 1JOJA 2HEVF 5HCHA 2WRAA 4NO4A 5AC92 1TZOA 1OUXA 1UOJA 3APBA 3N9NA 4Z1VA 1HXS1 4CTEA 4DB5A 1WCUA 2B45X 2JE9A 4E4HA 1NE6A 3B3QE 2DU0A 1AYM2 3RDIA 1BKZA 1L7LA 1DU3D 4AFDA 1KJLA 1PNGA 4S2GA 4E8CA 1QMJA 5LATA 1BZWA 1ND2A 1WBLA 1WW4A 2IFRA 3IMNA 3O0WA 4FPCA 4KNCA 4LLOA 3VBFB 2CY6A 4EWAA 1EPWA 1PX3A 2CYFA 4OHWA 3MFAA 4ZU4A 1LR5A 4WBBA 3UT0A 4D7TA 4XDOA 4Y20B 1W2NA 2E51A 1RUC3 2J42A 3MGUA 3Q8FA 5LASA 1VBE2 2FQPA 5EFUA 3J7NA 2HWF1 1XXNA 4E4ZA 2JKXA 2JDNA 3IDEA 4MG2A 4XJ8A 4YWAA 1IG3A 2GNMA 2G1MA 1BMV1 1BMV2 3DL3A 3E5XA 5A1AA 2PHTA 2PXJA 2DDUA 1HN0A 5GLTA 2AACA 2YFUA 1SFPA 1WGPA 1ZA4A 4BLJA 3LEIA 2Q8DA 4XHXA 3IT8A 5FZAA 3VKFC 3AC0A 3AL5A 2Y0IA 3GZTB 3ST7A 4AAPA 4QGLA 5DABA 4CCOA 2X10A 4Y4RA 2R042 2ZEXA 5HXVA 3WDXA 3BKZA 3SISA 2ZA9A 3RJRA 5AVAA 5AFEA 1YIFA 2OPKA 3HBKA 5FMOL 5F32A 1Y43B 5JZGC 4OZOA 4XFCA 3MPPG 4QQLA 2W94A 4QHBA 2QQUA 4X8PA 4A6OA 3CIHA 5F2WA 3HWJA 5HV0A 4IEPA 2D98A 4TTGA 4I30A 3KV5A 3ZX7A 3I2DA 4QPIC 5FMCA 1K42A 2VZUA 1LODA 2ZHNA 3PIGA 1FI2A 2ZGRA 2G9GA 1NOVA 2ADEA 2QVSB 5FMBA 3GZEA 3M3IA 3WT3A 1HKDA 2PTMA 2DUOA 5FZHA 4WZFA 3MW3A 4K3UA 5FZ7A 2C1FA 3MLKA 4GXLA 3SEEA 2VZQA 1O5UA 1OOPB 3MUY1 1GFF2 1AL22 3T09A 2EALA 1H4GA 4AI3A 3AB0A 3D0JA 4Q4X2 2XPJA 2Y6JA 5FO7B 5F3EA 3T2QA 4B7EA 5FXZA 1NLSA 1TQ5A 3TYJA 3RNSA 4HETA 3WP6A 2FDKA 3ZN5A 3PUSA 3NNLA 4HSJA 5IHRA 3J7MA 1YIPA 4P02B 2DTWA 3GZAA 1YFWA 2WL1A 4RGKA 4CCKA 4V1PA 3I2KA 4GH4C 4LA3A 4C1WA 1ZZ7A 5H9RA 1JYNA 2VAUA 3AZXA 4YZ1A 1PZ9A 2HWB2 1G6NA 4Q4Y2 1WW6A 2DVBA 1V6JA 4UXAA 1OA3A 3WW1A 3PL0A 3M4FA 2HWC1 3U4XA 2RHPA 3JU9A 4GB31 1IKQA 2PHRA 3USUB 4IL7A 4UBGA 4CDQC 3N36A 5KXEA 2WJSA 3J7HA 4IE5A 5LK7B 1D4M3 1QJX2 1UY4A 2D6NA 3EB7A 3LPFA 3MIHA 2VZTA 4OMDA 4LO6B 4XIKA 1Q8OA 2XLGA 2ZGQA 3MV01 4K40A 5KWRA 3BTXA 3RZLA 1GZTA 4META 1S2EA 2I07B 2BGOA 1RMU2 2WUHA 1ODMA 3A0KA 3PVEA 5BNPC 4FVVA 4B4PA 4CDWC 2VM9A 3NV3A 4FCAA 4M0NA 1E5IA 4OVEA 1JZ6A 2FZ2A 4B4QA 5FFOC 5G05L 3S7EA 4BK4A 4ZONA 3T2PA 1MZFA 3ZFGC 2RM23 2SBAA 3QH6A 4IXLA 2VULA 4CUBA 3NKGA 4E4DX 5LWBA 4X8NA 2PQQA 3OPTA 3HN1A 3LE0A 4BCUA 1MQTC 4CDUC 2YB7A 4QDQA 2EXHA 2YHJA 5EP9A 3PMSA 1X8EA 1N1SA 3B7MA 4L99A 4RSUA 1HQLA 2N7GA 1AR71 3AYCA 4FFFA 4FTEA 5DAPA 2PFWA 1VAKA 4DY5A 4IESA 4EN8B 1JXNA 1C8M2 1XBFA 4ZU5A 3S6PA 5T54A 5DPNA 4OYUA 4AFMA 3KGZA 1W99A 2YYOA 1DQ4A 1JUIA 4HN1A 4CUAA 4L97A 3DN7A 4LIVA 2OKXA 4BMEA 2A6VA 4Z82A 2YC4A 5ACA3 2CHHA 4KBBA 3H3LA 5CKMA 4UFJA 1SBFA 2PAKA 4OULA 4RR3B 4V2WA 4AVCA 5FY8A 1LHUA 4LK7A 1RJ8A 1OOPA 1UIKA 1UO9A 4PLNA 3FHQA 4MLOA 4RS5B 1R091 4D0QA 1R092 2HLEA 1REDA 5CFCB 3UESA 4YNIA 1TMF3 1DQ1A 2HBUA 1QJU2 4AI1A 4JRLA 5I0SA 5IVEA 4IGOA 1RIRA 2VTFA 4BA6A 2DCYA 4XBQA 1N3PA 5DUVA 2QQWA 3GF6A 1ZBA1 2R32A 4FPYA 3BTZA 2YBSA 3NSTA 4S2FA 1AR62 2IVIB 4IEZA 3KV6A 5EQUA 3ZLIA 2ZGPA 4NRPA 1RUI1 4XF9A 3RYKA 1PX4A 5FIXA 5FOJB 3Q9OA 5C4WB 2FDJA 2CU5A 3JQXA 4HVOA 4ARYA 5JCTA 5JVVA 1DLCA 4P9XA 1NUKA 4FPFA 1WBFA 5FYSA 3QOPA 3R4DB 4XJAA 1JZ8A 5K4LA 1HRI1 5IVFA 2Z42A 2WBKA 1O91A 3K77A 4G9SB 4PLMA 4RHV1 2CGOA 4RHV2 4QM8A 3AKPA 1ZBE2 3ZXKA 1IOAA 1PMIA 4GWIA 4EJRA 2ORZA 2XL7A 1MVEA 1DYOA 3VBSB 4CUGA 1C8NA 5T3NA 1CN1A 1DLLA 1FATA 3LFIA 4X6QB 3ZSLA 3NRUA 2VOTA 1V70A 3VD4A 1AXYA 1GU3A 1EUTA 4XJWA 5A1LA 2RG4A 4YZ3A 5FMDA 5AC93 2BQPA 1UZWA 2VECA 1VBA3 2F17A 2EVXA 3A21A 4XPVA 1UY2A 3O5SA 2VL4A 4BMBA 4CCLA 4XUQA 1GNYA 5JOYA 1AYM3 4Q0VA 1IS3A 4AQ6A 4AHYA 3IIAA 2A3WA 2CDOA 2LRPA 1I5ZA 3NNGA 2BWCA 1YEWA 2VQ0A 3CJXA 1W0NA 3IAPA 3FUQA 1PO11 3POEA 1PO12 3VBOB 2B42B 1DQ2A 2ZPXA 5CG9A 1X8MA 1VBE3 1ZX5A 3AP6A 2PMWB 1YQ8A 3I2FA 3PTYA 2VBBA 3EMRA 5A3PA 5APAA 1Z78A 5I93A 3IAQA 3NMBA 1AX2A 4JRAA 1WLCA 3DYMA 5IVYA 4AXOA 4M3CB 1FPN2 1GZWA 5K0UC 2LALA 1DQ5A 4XHBA 2IC1A 2WABA 3PTRB 3WF1A 4H3WA 4L2NA 2O8OA 4OUEA 4IEWA 3TWIA 3RGBA 1YI9A 1DDLA 3X29B 5B4NA 2R043 3CMGA 2ZGNA 3KF5A 1QH6A 5F5IA 1Q56A 5FMOS 5DUUA 4DUVA 3WW3A 2IXKA 1QDOA 4RR3A 5A33B 3AMPA 3WP5A 5EJ3A 2VUDA 4YYOA 2DVDA 5IK7A 3DKWA 4HVRA 4LITA 5FY4A 5JSOA 1TEIA 4XURA 2YROA 4XQDA 2VZSA 3ZYGA 1OSGA 1WCSA 2WS92 1T6BX 1WA6X 1ZZ8A 2JXAA 3ME2A 2VCCA 2J1VA 1XE0A 2QQJA 4JKLA 3KGLA 5A6XA 1UAIA 1XYOA 2PHWA 2AR6A 4QPGC 4YW6A 1KD7A 4NHYA 3THPA 4C0HA 1AYN3 5F1RA 2RS11 3I3DA 1SMVA 2VMDA 5EXOA 4BIFA 3OBAA 3ETQA 4Z2WA 4DUXA 2OIIA 4HBNA 5BV6A 3VBRC 2UWAA 3ZYIB 3GHNA 5B4XA 2KXLA 3R05A 5IJRA 3G6JB 4E2SA 5CFDC 1K12A 3I54A 3OUHA 1G7YA 4IUGA 5C3SA 4NIIA 5CKNA 5JXIA 1UPIA 4IV1C 4Q4X3 1ENXA 3TAYA 5C8CB 2PLV1 1YUDA 2PLV2 4GZ9A 3MIFA 2R1DA 2VZ1A 3I3MA 1JZ4A 3BOPA 1OVPA 2GNDA 4OZXA 4B4RA 4NR1A 1S0BA 1WUVA 1MR5A 4WM8A 1BK0A 4R52A 1I3HA 3VBSA 2VGDA 2ORXA 3SHRA 2JG8B 4LBQB 2HWB3 4Q4Y3 4IDZA 1Q8QA 1UU4A 2ZABA 3LEKA 4RYDA 1ZZCA 4TXWA 3V65A 4CU9A 5C9AC 2VZRA 1OPOA 2EA7A 1RUH1 3VBHC 3FJSA 1X9PA 4R9DA 2OA2A 1W3VA 4MGYE 3ZXJA 1R082 4QQ2A 4C90A 4LBJA 1AJKA
chains in the Genus database with same CATH topology
1ULCA 5KXCA 1F2NA 1J3QA 1LOFC 2BVBA 1I1EA 1YNAA 4K6BA 1RMU3 1LB2A 1AR81 1AR82 2ZX1A 1M4WA 3W58A 4A2UA 1DGWX 2A6WA 4R4ZA 4AGGA 2D43A 4N43A 1QXJA 3ZXFA 3LA3A 4TSVA 4M3CA 1RVF2 4LO7A 3CJIB 1U5XA 4ORFA 4GMP3 2MEV3 1OLQA 2IXCA 1RB8G 3KM5A 2DFCA 1S2KA 4J1XA 3LSDA 3WR0A 4HKOA 4AEJA 2RS31 1FYUA 3JBG2 1HLCA 1V6IA 5LRSA 5A33A 3U10A 1VRH2 2D44A 3B5LB 3GNEA 3WZ1A 3ZSMA 3OYWA 5L7OC 4Z07A 3CLPA 3JD72 2DWRA 2GMEA 4N53C 2IFWA 3AMQA 5J48A 2GN3A 1FOD2 2NM1A 2ZX2A 2R071 3VKNA 1H9PA 2H6CA 1IS4A 2XB6C 3O7OA 3RS6A 3TRSB 3WG3A 3WHUA 3M1HA 4BM8A 1LHWA 1COV1 2H0VA 5D8AB 2D97A 3ASIA 3SXWA 1N3OA 2WWSA 2W39A 1QJU3 4RL7A 5C8CA 4AQSA 4CEYC 4DS0A 2JENA 4LO4B 4AFBA 5I91A 1AF9A 2XVKA 2EIGA 1AR63 4K21A 1URXA 2OUJA 4Q4V1 3HAGA 4EN0A 3CF6E 1GANA 4MXWA 2JE7A 2DUPA 1RUE1 2CNAA 3I7DA 5J7MA 3WG2A 3AX4A 5LK5A 4A7ZA 1ZVFA 5FLJA 1QXRA 1H2MA 3ATGA 5F9TA 1BVVA 1ZBE3 3OJBA 4K9SA 2DVGA 1UPSA 1XNBA 4DQAA 2RMU1 1K5MC 3H3ZA 3QH7A 5KXBA 5TSWA 1QJZA 1VBD2 2K0GA 2O0OA 3TNQA 3LWCA 2BW8A 4XDQA 2H0BA 3LCPA 2DUQA 1KITA 4MUVA 2PAEA 4YGCA 4P9LA 5EZWA 2QDRA 3E97A 5CA6A 3CJIA 4LUKA 5FRAA 1F31A 2BUKA 4LE3A 3WDYA 5KXDA 2UY9A 2D5FA 3H7YA 1BXHA 3ZXLA 3EXUA 1CIWA 2XJQA 2XG3A 2RJLA 4CDXB 4RA0A 2TBVA 5H9QA 1R1A1 4YGEA 1B35B 1FPN3 2PHUA 1PVXA 3D8CA 4NWVA 3B9IA 3UJQA 1QXPA 1MVQA 4N7UA 3BTAA 4IEOA 4OUMA 4YZ2A 4Y1UA 3LB9A 2VUJA 3WINE 4URTA 4L9BA 1CAWB 1NCQA 4D3WA 1YHFA 3EO6A 3VBUA 3CEWA 3ZYPA 4LBLA 5D8AA 3M3QA 3PVOA 4YSFA 2RR11 2CAVA 3FUOA 4IEQA 3CO2A 4FXKB 4SLIA 1MS8A 3FX3A 4BHPA 1EV12 3AP4A 1F9KA 1POV1 3MLJA 2WZR2 4KQ7A 3BCWA 4CRQA 1D4VB 1NA1B 2EXIA 1Q3EA 3N7KA 4PDWB 1EY2A 4IV3A 1ULGA 3NJZA 2XLFA 1FMD2 4AEDC 4LBNA 5JIUA 1YFYA 3POYA 3TNPB 1O7FA 2WFF2 4FOYA 2VVDA 1Q8SA 2B9UA 4AK3A 1ND3B 4XBNA 3M2MA 3G7DA 2GAUA 2Y0OA 4COVA 2X53S 2PA7A 3NL1A 3ZDSA 1AX1A 2R061 4RQPA 2XH6A 1QQP1 2ATFA 1R083 2WINB 3QACA 5ABJC 1D2QA 3RRDA 2P17A 4YLZA 2UWCA 4AVSA 4EWDA 2HWD1 1RUG2 2HWD2 2WKKA 3AZVA 3MF6A 4Q4W1 2ZGSA 4AGVA 1QJY3 4PCRA 1LGNA 1N1VA 3VHOA 1SACA 3AP7A 4EN7B 4YVWB 3SITA 2JECA 4FPLA 1WMFA 2WT1A 2WLPA 5BNNC 2AENA 2VQAA 1ZNPA 3MIGA 2WNUB 3R0RA 3RYPA 1SCSA 1GICA 4Q8KA 3RMXA 1PGSA 2BTVC 1AX0A 4QU2A 1VBC1 3A4UA 4QQOA 2Q0AA 4H7LA 2GMPA 3AYAA 4F3JA 1ZREA 5J37A 5E89A 4D69A 3JBG3 3VGIA 1DF0A 1PGL1 1A8DA 1CAWA 1S0EA 1H8VA 1VRH3 4WZCA 4FTBA 1KS5A 4MXVA 3JD73 1ZRFA 2B46X 2YY1A 1GBGA 2BNMA 3AK0A 1YYNA 3QLQA 1PIV3 2JG9C 2RS52 3CNAA 5BNOC 2HEYF 2D5HA 2ZX0A 1YWKA 3ZSJA 5F5QA 5IUQA 1CR7A 3AKSA 3MICA 3UKNA 4PDWA 1C4RA 1X82A 4XF1A 1XE8A 1ENSA 3LSEA 4B29A 1XRUA 1X33A 4YVSB 1HXS2 1REFA 2YMZA 1RHI1 4K8FA 5GJ6A 2C5DA 4Y1ZA 4AEKA 3WQ7A 3KT7A 1ZM1A 1GZCA 2Z2SB 1MEC1 1LOEA 1ND3A 3AJZA 4YG0A 2Q30A 1S1AA 5A32A 1UW8A 4XMIA 2CL2A 1CAXA 4HN0A 4XF4A 1MZEA 4I0AA 2ZMNA 2HWF2 5KHIA 2QE3A 4K7JA 3WV6A 3BODA 1ND2C 2B5HA 2EXKA 3FBMA 3J8F3 3VHRA 2VW2A 1YXWA 2UU8A 3USSA 4BE3A 4Y4YA 3UJOA 3EHKA 1DG6A 4GKXA 5CAZA 2Z69A 1W6QB 1VBD3 4P9JA 3VHPA 1OD5A 2A5ZA 1KS4A 1N1TA 4S2DA 1D0HA 4YVWA 1B09A 3L2YA 1VIWB 3RYRA 2Z5WA 3WG1A 1JHNA 4WM7C 3M3CA 4Q26A 1C57A 2WNUA 2XBO1 2XJTA 1C3HA 4XF3A 1RUD1 3J26N 5T5LA 5L36A 1BBT1 2E9QA 1RITA 3AJYA 1S0GA 1NXD1 4YM2A 1LHVA 2IXHA 3ZXGA 1SFYA 2ZGMA 2DVAA 2XHKA 1VBB3 2ET7A 2OYZA 3AFKA 3INAA 3IDCB 5E16A 3WD5A 3HR9A 3MIDA 3OTFA 4CEWC 3BU7A 5SV8A 4I3GA 1PK6C 2VNOA 3AXEA 1AYN1 1KDMA 1H30A 1G9FA 3ZFEC 1N1YA 4LA2A 1NYWA 1A78A 1FXZA 1HW5A 3VDDC 4GH4A 2HWC2 4TYSA 1EV13 3ZN6B 4GB32 2F6BA 4YGDA 4YVSA 1VP6A 3TN91 2UYAA 5DG1A 2E6VA 3WW4A 4AVVA 1UZYA 2JJ6A 3LA7A 2WA4A 1FAYA 4F7ZA 4FOVA 4QX5A 5JPMB 4CDQA 2D3RA 4NHKA 1QF3A 1FMD3 2VNGA 3N3HA 4BPZA 1CAUA 2JD4A 3AYEA 4J6GA 4RGAA 4LNVA 2WFF3 3VBFC 4XFHA 4CDWA 1W6OB 5JOWA 1FNYA 1CX4A 4GA9A 1MS5A 5JLVA 2G9FA 2NP0A 3LOBA 3LA2A 2P3JA 3WCSA 2NQYA 4JGZC 3KSCA 2VPVA 3ZFGA 1W6QA 1RUJ1 2E7TA 4A3XA 4AQTA 1PVC1 1MS9A 4FPHA 2GC1A 1MQTA 4CDUA 1AR72 1EAH3 2O1QA 2E7AA 4AHXA 1XE7A 1AR91 2BYVE 4MX3A 3GHMA 4HSLA 1CQ9A 2WT0A 1GZWB 3JUUA 2ZS6B 4L8QA 1RUG3 1PZ7A 5T5PA 5EYXA 4WVMA 4JDMA 5HI0A 3I59B 2MEV1 1H2NA 2A6YA 2I74A 2Q1ZB 3FLRA 4AI0A 1GLHA 1ZRRA 4KU7A 3SH4A 3I4IA 1IKPA 2ILMA 5KC6A 4WVZA 3KLSA 4FP3A 4W65A 3UKVA 3V64A 1PNFA 2VOKA 1PO23 3IN9A 4S2HA 4E9KA 2BNNA 3URFA 1UZZA 4C91A 1XNKA 3VZJA 3FC0A 2BBVA 4XFAA 2X29A 1ZBA2 2MPFA 4O9GA 1J59A 4HT1T 2ZKLA 2Q1MA 4QPGB 3M3OA 4EN6B 3RWNA 2ZBJA 1RUI2 1LCLA 2A71A 5DG2A 3LAGA 2R30A 2P3IA 4FAGA 1V6KA 4AFAA 1NLRA 1HRI2 3ZN6A 2PHLA 4KG8A 2VUAA 2Q4SA 4B7KA 4WM8B 1QNYA 4LBMA 1LENA 2JEMA 2ZKNA 3OPZA 1Z7S1 4JAAA 4W6YA 1PGW1 5J36A 4G4FA 1LTEA 2KM2A 5K8SA 4LULA 1HXS3 1H2LA 4TZDA 3UK9A 4AVTA 2ZMKA 5C9AB 2A70A 2W08A 5GZDA 2P37A 4P9IA 5JDBA 1W6OA 3RSJA 2IWGB 3ZFFC 1U5IA 3B93A 4IETA 3VZKA 2LUWA 4E27A 2HWE1 2ZACA 5DDJ1 2CTVA 1LHNA 4QT6A 4AFCA 3FWEA 1I6XA 2HWF3 1FV2A 2DVFA 2QZ2A 4HFSA 4N43B 4QPYA 3K51A 1ZZ9A 5GZFA 2ZTNA 1J3PA 4JGYC 3AMMA 1RUNA 5KBFA 4XETA 1TME1 2WNVB 5JAXA 3SCFA 3MIBA 4JDNA 3VZNA 2FZ1A 3MFCA 4FPJA 4XF0A 2D6LX 3I59A 2ZAHA 5K0UA 1RUF1 2V09A 1RUF2 4XYXA 4M01A 1LECA 1V9U1 1W0PA 1U12A 1V9U2 2TNFA 3JB4C 4MH0E 1GZ9A 1C1FA 3OYWB 3ES4A 2ZGTA 5DZFA 2Y38A 2R16A 1FT9A 2WNEA 2OZ6A 3ZXEA 5JMCA 3NAPC 4XTMA 2RS12 4AVBA 2IZWA 1HV1A 3N4MA 1ASJ1 3FFQA 4P9GA 4RS5C 1WD4A 4QPGA 1UKRA 3WG4A 3E5UA 1DGRA 1AL23 5CFCC 1HRV1 4KG0A 4R9AA 1ZRCA 4HMZA 3VBRA 1CPMA 2XWJB 2QFEA 3ALQA 1N47A 2DYCA 4PQ9A 4FOWA 1DZRA 5I8TA 1YLLA 2DCZA 5JR7B 1LRHA 1NY71 1NY72 1OA2A 4IV1A 4IQPA 4KGGA 1OPMA 3H7JA 3IM0A 5C4WC 2AZ5A 3WY6A 2WFPA 1DQ6A 4MXWB 3MZHA 5I8YA 3WCRA 5J3UA 3NKTA 1W6PA 1XU2A 4MGIE 3ZXAC 4FPEA 2HWC3 4GB33 1RUH2 2IXIA 4EN9B 1SQ4A 1W6NB 3MW2A 4DXZA 5BNQA 3MEPA 3ZO0B 1QJX3 5C9AA 3VBSC 4U36A 2P3KA 3WUCA 1WCKA 3MIEA 3BIWE 3DGTA 4XFFA 5IT6A 5T50A 4XZPA 3VBHA 2A6XA 2PAMA 1RINA 2H6BA 5DZGA 3B01A 3NW4A 2X5IC 4P9WA 1LOFA 4ATEA 4WV8A 1NCRC 1POV0 4LBQD 4SBVA 4XEZA 1FV3A 4LLFA 4YGBA 4FPOB 2XVGA 4ATFA 1VAMA 3OF1A 3VBOC 4YW4A 2X8KA 4U2AA 2WNVA 3WNXA 3IBMA 1O4ZA 3LZZA 3B02A 4CP1A 2C0ZA 1QDCA 3I8TA 1XYPA 1QJY1 4DY3A 2RS32 1H1AA 2ZX3A 5GM0A 1AR73 1LGBA 3M3EA 4INDA 4IEXA 3PNAA 1C8M3 4TWTA 2R0FA 4Y1XA 2FMDA 1GR3A 3HD8B 2NPIA 3ZSKA 4D94A 3AZYA 2D3SA 2A3YA 1BEV1 1BEV2 1OA4A 3D0SA 4M3CF 4E2GA 2R072 3L9JT 2PELA 1BCXA 2DTYA 4N53A 5IK4A 5HCFA 1NCQB 4XFIA 4KWKA 5I0TA 5JOXA 2WZPP 3VBUB 4K1ZA 1COV2 1R093 1UX6A 3MW4A 4ASMB 1JYCA 4R9BA 1O3TA 2CAUA 5FLIA 4MGZE 3UL2A 3AYDA 5T5OA 1WCDJ 4OI4A 5GLVA 4Q2FA 4LEJA 3ZSEA 1SEFA 1ZBA3 2Z79A 3GBWA 2ENRA 1RC6A 5FREA 4DRVA 1DBNA 4IV3B 2B7YA 4CEYA 3ENRA 3DPRC 2GN7A 3HMYA 4Q4V2 3N35A 1V00A 1RUI3 5FO8B 5KHKA 1S0IA 1HQNA 1SLTA 5C8WA 3VZLA 2BFUL 4ISQA 2A7AA 1UIJA 1AHSA 3NV1A 1RUE2 1I9RA 1KRIA 1S0FA 3QD6A 4I2OA 1LGCA 2I45A 2ET1A 2HJIA 1PM7A 1RGSA 4RHV3 1W6NA 2QJVA 3D5OA 5JIAA 2CWSA 3WUDA 1EP0A 3B69A 3TB0A 1QU0A 4XE9A 2JG8C 1SLLA 5B2GB 3PHMA 4RFT0 2RMU2 2VOXA 4FT8A 4GKYA 4YG6A 5JWPA 3OGJA 4COZA 1CJPA 1BYHA 4XOGA 3DUIA 4RQPB 1NQJA 1RUC1 1Y9QA 5FLHA 1SFNA 1K5MA 4LR4A 5J98B 2BNOA 4EROA 4H55A 4FQ4A 4KU8A 3ZMOA 1DHKB 3A0NA 4GWNA 3MYXA 3N7LA 5H9SA 1V6OA 3NVCA 3WQ1A 3ILFA 2AGSA 1PO13 4KWLA 4FXGB 2GC3A 5ABJB 5K9YA 1WW5A 1KJRA 5CVRA 1H8TB 4HVQA 2G4IA 4C0BA 1M06G 3AXDA 1WA4A 1Y7BA 1KFUL 1VAVA 3WDWA 2XJRA 1R1A2 4P14A 3WHTA 3PVNA 1ZRDA 2GALA 3AM2A 4YG3A 3EQEA 1TNRA 3B94A 2VW1A 4R8HA 2QKDA 4DINB 2ZJCA 3QBQA 1QH7A 5IK5A 1F5JA 1LOCA 1O4TA 3FHIB 1J3RA 1NE4A 1SDWA 3ES1A 2DV9A 1BVP1 2RR12 4UW3A 2WS93 1C5HA 5GZGA 4FOQA 1DGLA 5J96B 1O3QA 3OGGA 4M00A 1JYIA 3HBZA 3AKQA 2OW4A 2RS13 1IS6A 4WVWA 2ZHKA 4QQHA 2B8MA 1KDKA 1OHFA 1VJ2A 2GMMA 4MVTA 5T5JA 3THTA 3AMNA 2JICA 5FOBB 4AF9A 1IGOA 3WW2A 4HPKA 3MPBA 5GZCA 1UL9A 1DGWA 4ASLA 4GALA 5FPZA 1S0CA 5A3LA 2PLV3 4PLOA 2BVVA 4XXPA 2PN5A 2VXRA 3P3PA 3P3NA 4AEDA 1YI7A 4W6WA 1UKGA 3WVJA 4F8AA 1APNA 3AKRA 4FBFA 1JBCA 1RTVA 1D4M1 4L92A 2NMOA 1WMEA 4DOUA 2V5YA 4IEVA 2DFBA 1WLTA 1L3JA 5A32B 5HBAA 1CAXB 1C1LA 2YZ4A 3ECQA 4FO9A 2R062 1XYNA 1QQP2 4QM9A 3MLLA 3KT4A 2ZHMA 5BUVA 2WIIB 2WT2A 4XXAA 3WP3A 5DZEA 4OUSA 5T55A 4Q0UA 4A7YA 2RM21 3FZ3A 4XQWA 5ABJA 1KFXL 4RGGA 5BPXA 4Q4W2 2OZJA 1AR83 4OI1A 5E1RA 4DPNA 1H8TA 1BQPA 1FNZA 2WSUA 5FTTC 2ZX4A 3U07A 2PHFA 2A6ZA 5GKAC 5GLUA 1LU2A 3K48A 2IXLA 1EAH1 1G9BA 1EPZA 1RVF3 2XJSA 4YFWA 3IPVA 5LEKA 5BNNA 2YUEA 3R6SA 4ISRA 4FSJA 4WM7B 1VBC2 4LHNA 2D40A 3U0ZA 3KQRA 4CDXC 5ACA1 4QPIB 4Q1RA 1D2SA 2RS33 2XJPA 4B8EA 1B35C 3QCWA 3BPZA 1PGL2 1IPKA 1Y3TA 4Q1PA 5E88A 1AL0G 1NZCA 3O12A 4W6XA 3TOJA 3VLBB 1PO21 5GALA 4NOTA 2BWAA 4Y26A 1TMF1 1XU1A 5SV5A 5HCBA 4LE4A 4LBOA 1FOD3 1SLBA 2R073 2WSVA 3KT1A 2VW0A 2JG9A 1AXKA 3H1MA 2YGLA 3E6DA 4R4XA 5BNOA 1AXZA 1BK1A 2HKXA 2UYBA 4HKLA 5JZGC 1COV3 1PK6B 2VMGA 4N9HA 4Y22B 1QOTA 1LHOA 1JW6A 4Y1VA 2VH9A 2O8QA 3FBYA 4GH4B 4QMAA 2P2KA 1NA1C 1RHI2 3IDBB 3DV8A 2FHRA 1VB4A 4XJ9A 3VDDB 4E2QA 4PDWC 4Z92B 3ZXDA 4I09A 4COUA 1MEC2 4CDQB 1AVBA 2CWMA 1JN2P 3RJ2X 4Q4V3 4BIOA 1J58A 1LU1A 2ZHLA 1DYPA 2BFUS 1VLNA 1QOSA 1CAUB 4YW5A 1CAVB 1RUE3 1NG0A 3FLPA 3KCYA 2D6MA 3H8UA 1UD1A 5AC91 1UU5A 1VBA1 1VBA2 5HCAA 2K9ZA 5BNPB 5E8AA 1AYM1 1ND3C 4CDWB 5CG8A 3BALA 2RE9A 2XLAA 1C28A 3B9CA 3ZMNA 4XW3A 2RMU3 4UW6A 2GZWA 2WQ4A 4NHMA 3BOWA 3ZFGB 4B3NA 4DRRA 1OLRA 2FMYA 2VMHA 5GZEA 1YFXA 4LHLA 4YM3A 1VBE1 3HT1A 3VKLA 5C33A 4JTNA 3RZZA 1MQTB 4CDUB 4AVAA 4JGZB 4QGMA 3CU7A 3ZN4A 1ZYBA 3NV2A 3H50A 3PJQA 2W52A 1O5LA 3OD4A 3KCCA 2GDFA 2XBO2 4WVMB 3S7IA 5LEJA 1X36A 4LT5A 1RUD2 3O14A 3VKOA 1BBT2 1YCIA 4WM7A 4YVWC 3PLQA 4IEUA 2R041 1LEMA 4QPIA 1EYBA 1QOOA 3H1YA 4YW2A 3GYDA 1VB2A 1Q8PA 1R1A3 2WNUC 4UW4A 1U0AA 2A73B 3C3VA 3KCXA 3AKTA 1MZ5A 4KH9A 3VL9A 1PZ8A 1WMDA 2XWBB 3SLIA 5CIRA 4Q27A 4O9EA 1AYN2 1MS1A 4EWEA 4CEWA 3J9SA 2GSYA 1T6GC 2CV6A 1PK6A 4Y22A 3VN4A 2KA3A 2RR13 1AL21 1YJKA 4FAHA 1YRZA 4PIXA 1DZQA 1SCRA 2VNRA 3ZFEA 4Q4X1 3TN92 3RI9A 3FLTA 1POV3 2WZR3 1YFUA 3AP5A 3VDDA 1MS4A 5GLWA 2JDZA 1LEDA 1PHMA 1RL3A 4TLFA 1RUOA 3MI8A 5LRRA 2HWB1 4YVSC 4Q4Y1 4F83A 1CAVA 1SLAA 2E7QA 1UCXA 4JTOA 4PIYA 4E4SA 1H2KA 2Q5TA 3NO8A 1N3QA 3AFGA 4MYEA 4KL1A 1LOGA 4XJZA 4Q0PA 5BNPA 3DF0A 2BEOA 1QJX1 3VHNA 1QGLA 2ZCWA 3SCHA 1OFNA 5FPXA 5JOZA 2HEWF 4I0BA 2HYKA 3VBFA 4LTAA 3EBRA 3JB8A 3ZFFB 1RMU1 1RUJ2 4Y20A 2R063 2W0XA 4OLLA 1QQP3 5KHGA 1W6MB 1PVC2 2EAAA 1ALYA 4Q0QA 4JGZA 2VOVA 4X6RB 2VY0A 1D0GA 3E6BA 2A3XA 1AR92 1H1IA 1JTZX 1GQGA 5DUWA 3LOIA 2HWD3 4J1WA 4JQRA 1W2UA 4JGYB 4Q4W3 3VL8A 5K0UB 4GMP1 2EXJA 2MEV2 4N9IA 4QGNA 4KWJA 2C9AA 2EF6A 1A8MA 2MHFA 4I02A 4Y24A 2AUYA 1CJDA 1OQ1A 4QD2A 4YZ4A 1UF2C 5KHHA 1C8M1 1QY4A 1V6NA 4K20A 3UV9A 4N7IA 4YW3A 1ZZ6A 4I0WB 1H4HA 4G3YC 1ULDA 1VBC3 4FP2A 3POSA 4QXKA 5I0UA 3AZZA 3D82A 1OOPC 3WLUA 2ARXA 3WQ0A 3NAPB 1R1ZA 1A6CA 3HIFA 4OI0A 2WQZC 3WDTA 5F6KA 2QDNA 1GNZA 2VVEA 3W59A 3L2HA 3WDVA 1IS5A 3VBRB 5J09A 2XJVA 2DF7A 4CP2A 4FQZA 5DUXA 5AFBA 3RQ0A 4DMIA 4I3PA 3ZIWA 4COWA 2RS53 4EV0A 5CFDB 2XVLA 2LTNA 1QJU1 4MV2A 2YC0A 4IV1B 4C1XA 2MNGA 1OQEA 1ULEA 2XL9A 3UKTA 3ACLA 4YW1A 4H14A 5A3MA 2A75A 4QQPA 5FQ0B 2SLIA 4Y5Z0 1AR61 1Z7S2 1PGW2 1W39A 1W6PB 2DURA 1JUHA 1QHDA 2QCSB 3S0MA 2ETEA 3T2TA 1RHI3 2WC2A 4OHVA 4XMAA 1SBEA 3PMEA 3USUA 4OFGA 3VBHB 3MF9A 3POWA 1ZBE1 4HKWA 1OI6A 1GNHA 1MEC3 1CPNA 2GNTA 4P9YA 5JPNB 2AH2A 2HWE2 5DDJ2 1TE1B 1J1LA 3T1MA 2DCKA 4YM1A 3ZFFA 2GH2A 1H1MA 4YZ5A 5BXXA 4ZKTB 1WD3A 2X5IB 1W6MA 1S0JA 1IPJA 3PVBB 5GLZA 4LBKA 1NCRB 3W9AA 1TME2 3GALA 1W0OA 3V56A 3RI8A 3ZIXA 1MS3A 3WX5A 2QZ3A 4JGYA 2GNBA 5FCCA 3GBFA 5CB7A 1XNDA 2CGPA 3KD4A 2PHXA 2D3PA 1YO8A 4NPRA 1DFQA 2QUOA 3TBDA 1HV0A 5KC5A 1DQ0A 1Q43A 4AE2A 4CYDA 2XBO3 1FPN1 5CNAA 1CONA 2F4PA 1RUD3 4XFGA 3M7AA 3AMHA 1BBT3 1X50A 4YFZA 5L7OB 4AHWA 4RR3C 4UBHA 2VOWA 4MSVA 4N53B 2NLRA 4LHKA 4Q29A 1ASJ2 2UWBA 3NAPA 1G9AA 5D1IA 3AP9A 4BQ1A 3LKJA 1Q8VA 4CP0A 1REEA 3VUOA 1HRV2 2ZGLA 3OY8B 2PHDA 4RS5A 2BPA2 4LUMA 2WS91 5CFCA 1VR3A 5CFDA 1F5FA 3ZYJB 3IKWA 1IHMA 2XKOA 4H7MA 4MZUA 4CEYB 1YJLA 1A3KA 5FQ0A 3BB6A 3D6EA 4ES9A 2NMNA 2AYHA 2DCTA 2DU1A 1Z0HA 3ELNA 2D6PA 2I2SA 2PYTA 3O0XA 2QQPA 1JH5A 3DPRB 4ZU7A 5C4WA 1F8VA 5IK8A 4LO8A 4GQ7A 3TN93 4WM8C 3WOGA 4PIZA 4R9CA 3M70A 4IERA 4BH9A 1AZDA 3SCGA 4AHZA 3RMYA 4RD7A 4AYUA 2ARBA 3AZWA 4N90A 4HK9A 4ONUA 3O0VA 1G9DA 3ILRA 3H9AA 3FE5A 1K5MB 4PF5A 2GH8A 2X5IA 3JCIA 1H9WA 3R4SA 1R081 1VALA 1NCRA 5BYNA 2XGXA 1O3RA 2AREA 1MS0A 2P34A 3ZPYA 3OCPA 4HANA 2D93A 2D6KA 5K7PA 4OHXA 1LOAA 2QNKA 4XFBA 3VZMA 4N43C 4PBPA 3VBOA 4UW5A 1MZ6A 1O3SA 1RUJ3 2VVFA 1QJY2 1PVC3 5H9PA 1AUYA 2YV8A 1G86A 4AWDA 2WNVC 2XUMA 1AR93 1UMZA 4PBOA 1BJQA 4DZGA 2E53A 2YXSA 3M8LA 1RVF1 4M0HA 2K2SA 4MGKE 4AI2A 5L7OA 3GBGA 3ZYRA 1DIWA 4BYYA 4BZ4A 2WLQA 4OHZA 5L19A 2DCJA 1LULA 1DZTA 1E57A 3JBG1 1H0BA 4XBLA 4JC1A 4GULA 4YM0A 1VRH1 3ZVXA 1HX6A 1LESA 3OY8A 1IZ3A 1GQHA 1ONAA 3VKMA 1QKQA 1KXGA 3SH3A 1CGPA 2ZZJA 1S0DA 3JD71 4YARA 2XKPA 1PIV1 3PJYA 1PIV2 4HL0A 2OUHA 5FDBA 1FOD1 2LM3A 4YRDA 1LOBA 2R0HA 4IEYA 1V6LA 4HZFA 3JQWA 1S55A 3WDUA 1CESA 1WW7A 3NWKA 3NV4A 4HPKB 3ROUA 5C8CC 1GYKA 5I8SA 2ERFA 4NN0A 1HQWA 3DPRA 4CZSA 1CD3G 1HRI3 2V73A 4AEDB 2UY8A 3HQXA 4D7YA 1ULFA 4ES8A 2ES3A 3S30A 1QWRA 2Y26A 1Z7S3 4ZXKA 2JG8A 4LBQA 3FMGA 1QNWA 3HT2A 4GWMA 1RUC2