3WDVA

The complex structure of ptlic16a with cellotetraose
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
298
structure length
298
Chain Sequence
EFYHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGEIDIIEGVNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKFNAQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-1,4-glucanase
publication title Structural and mutagenetic analyses of a 1,3-1,4-beta-glucanase from Paecilomyces thermophila
pubmed doi rcsb
source organism Paecilomyces
molecule tags Hydrolase
total genus 73
structure length 298
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wdvA00
5T5PA 2ZHMA 3SISA 1W6PB 3M3QA 5GLVA 3WG4A 2ZGRA 1DQ5A 5FREA 2R0HA 4NOTA 4XYXA 2OW4A 3LSDA 3WV6A 1V6NA 2JD4A 3USUA 1QNWA 4AYUA 1UN1A 3AP6A 1YI7A 2C9AA 1OFSA 3L2YA 2AR6A 3ATGA 4XTPA 2YZ4A 1LTEA 2A75A 2ERFA 3MW3A 4ATFA 3RMYA 1N1VA 2R49A 4YGBA 4Q1PA 2NN8A 2PHFA 2VW0A 5EYYA 5GZEA 4OZXA 1JBCA 3IPVB 5F9TA 5GLWA 4XTMA 4XZPA 1AXKA 2P3JA 1FATA 4YW5A 4DQAA 2ZGOA 3SLIA 1KJLA 5H9RA 3N7LA 3T2TA 2TEPA 1WLWA 5CA6A 1ULGA 2A6VA 4FOWA 5IK7A 5AVAA 1W6NA 1BQPA 1FNYA 1KITA 4M3CB 2ZGQA 1IS6A 1BZWA 2ZHKA 1BJQA 5JLVA 3WNXA 3ZSJA 2ZGPA 3W58A 5H9SA 2DUOA 2ZGKA 5DUUA 4Y24A 5F5QA 5T52A 4YZ5A 1RIRA 2A3YA 4U36A 3UJOA 1LOGA 1DLLA 1C4RA 2JE7A 2YROA 1JN2P 2NMOA 5KXCA 1LGBA 1IS5A 1FAYA 4YM2A 3OYWB 3N35A 5KXBA 4UW3A 3AXEA 1MVEA 2D7FA 4LBJA 1MS5A 5DG2A 4XDQA 2YMZA 5BYNA 1AX0A 2SLIA 1KDKA 4ASMB 2G4IA 1A78A 4YGEA 3BOPA 3RG0A 2XB6C 1UAIA 3QCWA 1CESA 4Y1UA 3T1LA 5HCAA 4XMAA 1LHWA 4DPNA 1AVBA 3NV1A 3B00A 3AFKA 2P2KA 2WJSA 3WUCA 1SLCA 1W6PA 2ZZJA 4FPFA 5IUQA 1W6OB 4XHXA 3R4UA 4YFWA 2YV8A 1DZQA 1UL9A 2V73A 1MS8A 4CTEA 2FMDA 5DZFA 1C1LA 2ZGUA 1AF9A 1CR7A 2R0FA 4ITCA 1V00A 1GZCA 4FPLA 4YM1A 4K21A 3W59A 3HMYA 1ZM1A 3AXDA 3SH5A 3DUIA 2A6WA 3FLTA 4ISRA 5GZCA 4YW4A 1LODA 1UX6A 1GV9A 3M1HA 3AZXA 1QDCA 4WVWA 1IKQA 2DWRA 3AZWA 4WVVA 3IPVA 1AJOA 3MW4A 3POWA 2AUYA 1VLNA 2ZMKA 4UW6A 3IMNA 2ZAAA 1J1TA 4XJUA 4YW1A 3BIWE 1DQ0A 3LCPA 2OUJA 2ZBJA 5L73A 2WSUA 4IQPA 2GALA 5GLTA 5GZDA 2DVAA 2EXIA 3ZXEA 4AGRA 3KQRA 1ULEA 1OKQA 1IS3A 1XQNA 3ZSMA 4FOVA 4M3CA 2A6ZA 4XHBA 4XJ9A 3N36A 4R9AA 1V6IA 1S0GA 1N47A 4LBNA 3RMXA 5HCFA 3NWKA 3A0KA 3WUDA 4TZDA 3FLPA 4F83A 4YLZA 3ZVXA 1W6QB 3VUOA 3O0WA 4GKYA 2ES3A 3R4SA 4LBQD 3V64A 1W0PA 2PELA 3OYWA 4LBLA 3WOGA 1ENRA 2AGSA 1Q56A 2GNDA 1WW7A 4M00A 2D6MA 4BMEA 4XIKA 3BTAA 5DG1A 3NV2A 1PZ8A 4Q8LA 3RQ0A 4BPZA 4XBNA 1Q8OA 2GN3A 3FUOA 1KDMA 2R1BA 2E6VA 2DVFA 3NV3A 4H55A 4YGCA 3VKNA 4CZSA 1GZWB 5CAZA 3N3HA 4YG6A 4XJ8A 4FPJA 1UKGA 1YIFA 1Q8SA 3WHUA 4D69A 5IK8A 3B9CA 1W6OA 1A3KA 1FX5A 1LESA 2EXJA 1G9DA 1FNZA 1MACA 3OPZA 4GWNA 1GSLA 4GALA 1CJPA 4P9YA 2OVUA 3NV4A 4PQ9A 2SBAA 5CNAA 2I2SA 4AVTA 5DUWA 2H0BA 2WT2A 1LOBA 1ENQA 1SBEA 1S0DA 1BKZA 3PVNA 2GN7A 3AP9A 3I4IA 1JOJA 1JUIA 5E88A 4UW4A 1S0FA 2A3WA 1QOSA 4FPYA 4PF5A 3WG2A 2HYKA 2UWAA 1HQWA 2GNBA 2NYYA 1TEIA 1BYHA 1ULCA 1Q8VA 2P3IA 1GZ9A 2ZMNA 3WHTA 1DQ2A 3AJYA 1DQ4A 4P14A 2CNAA 4LBQB 5JOXA 2JECA 1Q8QA 1N1SA 2PHTA 2ZGNA 4FP3A 1G9CA 1MS1A 4W65A 3WDWA 3U4XA 1WW6A 2DTWA 5JOWA 1D2SA 1UPSA 2CYFA 1GYKA 4P9WA 1DGLA 2ZA9A 2EXHA 3AYCA 1WBFA 5CB7A 1QU0A 5T50A 2CL2A 1AJKA 4YFZA 1CN1A 3B69A 4AGGA 1G86A 3VKFC 1YYNA 4UW5A 1DQ1A 2W39A 5GZGA 3OY8B 3N7JA 1LHUA 3A4UA 3ASIA 1U0AA 1S0BA 1LULA 1W6QA 3AJZA 3WDTA 2EF6A 1GKBA 4K1ZA 1VALA 2ZABA 2VUAA 1A8DA 1S0JA 1QKQA 3O0VA 1SFYA 1LJ7A 2B7YA 4GWMA 1MR5A 2AREA 4Y22B 1ENSA 5T5JA 2JKBA 1HQLA 4GKXA 4YM3A 4XXPA 1CONA 3ZSKA 3A0NA 2GMEA 2EXKA 2NM1A 1LCLA 4XIOA 1JHNA 5DXDA 2R16A 2WQZC 1LU1A 1W6MB 1FYUA 4SLIA 1GZWA 4AWDA 4KBBA 5IT6A 1PZ7A 2OUHA 2FHRA 3D4KA 1V6LA 2AENA 2CTVA 5EYXA 4YW2A 1LOCA 5IK4A 1S0EA 2UWBA 1D0HA 1ULFA 2VY0A 4M3CE 4YM0A 1CPMA 2EAKA 1QOTA 1S0IA 3ENRA 1SBDA 4R9BA 3R05A 1WBLA 3JUUA 4Y1XA 5H9PA 4C1WA 1G8WA 1SCRA 5H9QA 2A3XA 2CY6A 1LGCA 1WD3A 1GANA 1SACA 4WV8A 5EWSA 5T5OA 4MYEA 1V6JA 2AYHA 2KM2A 1FV3A 1WLCA 2NMNA 4FOYA 3PJQA 4YZ3A 1AZDA 3ZSLA 3AZVA 1GLHA 3ZXFA 2GNMA 4YG0A 1LEDA 2ZGSA 2GNTA 4HANA 1GICA 1WLDA 3N7MA 4JCKA 3JU9A 3ZPYA 3INAA 5GLZA 4R9DA 3N7KA 2YY1A 3WVJA 1HLCA 5JOYA 2ARXA 2VW1A 3AP4A 4LBQA 3FFZA 3ZYRA 4WZFA 3ZYPA 2DUQA 2ZGMA 2D43A 2WNEA 5SV8A 4XBQA 4DRRA 3WCSA 1JYIA 3VKOA 3RRDA 2E53A 1KQRA 4ZXKA 1I1EA 1RINA 1WCSA 2W68A 4L8QA 3OY8A 2W08A 4Z8BA 3AX4A 1IOAA 1LOFC 2VXRA 4Q8KA 1WD4A 4XOGA 3ZXKA 3IM0A 4FVVA 5DZGA 4PBOA 4AVSA 2RHPA 2WT0A 3WZ1A 1N1TA 1CPNA 2D3PA 2GDFA 4R9CA 3OGGA 2LALA 5LK5A 3V0AB 1N3OA 4Y22A 4YW3A 1VIWB 3WG3A 3V0BB 2DTYA 3SNMA 2YXSA 3ZXJA 4FPKA 1LOFA 1KRIA 2ZGTA 4XILA 5DUXA 3FUQA 3O12A 2W52A 1W6MA 5GM0A 1HDKA 1R1ZA 3WDUA 1MZ6A 3AYAA 2UU8A 2DVGA 1HKDA 3UJQA 4Y20B 1YXWA 1DYKA 1MVQA 3FLRA 3SH3A 1GNHA 2R1DA 3APBA 1MS9A 2VH9A 4CRQA 2NZ9A 3M3EA 3RS6A 1QOOA 2A5ZA 4AGVA 1UMZA 4Q2FA 3OBRA 3TAYA 2EALA 4BMBA 3WDVA 1Z0HA 2Q5TA 1KJRA 3SH4A 3UL2A 2ZMLA 1MS3A 3ILNA 3OJBA 4JRAA 3WCRA 3H0OA 1LECA 3ZXLA 3M2MA 5GJ6A 3M3CA 4ATEA 1Z78A 2WKKA 5GZFA 1C57A 1URXA 1NLSA 3B01A 4FQZA 2ARBA 3GNEA 2A71A 1O4YA 1QGLA 1LENA 1MZ5A 3T1MA 4LBKA 5FRAA 4FPGA 1Q8PA 1F5FA 1N3QA 4PCRA 5T5LA 3RSJA 1H30A 2DUPA 2V5YA 3SITA 3D5OA 4BOWA 3AYDA 1H9WA 3IN9A 3QLQA 2WT1A 1SBFA 3LSEA 4GA9A 2NP0A 2CWMA 4ZKTB 2ZHLA 3PVOA 4K20A 4Q1RA 5GLUA 3WDXA 5EXOA 5DZEA 3WLUA 3V65A 1EPWA 2ZGLA 1AXZA 1PZ9A 3HR9A 3ILRA 4FPOB 1N1YA 1WUVA 3HN1A 2PHRA 2D44A 1WW5A 1DQ6A 1V6MA 1WW4A 2AH2A 3VV1A 2DU1A 4BLJA 1VAMA 3POSA 4Q26A 3WG1A 3AP5A 1QDOA 2DURA 1LU2A 3AK0A 2JJ6A 5T54A 2WSVA 1C1FA 2GMPA 2ZACA 2A6XA 4GXLA 1JW6A 1LHOA 5HCBA 1MS4A 1YO8A 4I30A 3V0AA 2ZKNA 1DFQA 3VKLA 2PHXA 1S0CA 4PBPA 2D6NA 4YZ1A 4FPCA 5JOZA 3V0BA 3AP7A 2D6OX 3OBTA 5E8AA 3O0XA 2P37A 3AYEA 4XJWA 5KXEA 4XJZA 2D6PA 3C2UA 4Y1YA 2UWCA 3PVEA 2JE9A 4FPEA 1UZZA 4XXAA 4FQ4A 2LTNA 3D6EA 4Y1ZA 4YG3A 5CBLA 1G9FA 2BQPA 2E51A 2ENRA 4BLIA 3POYA 5IK5A 2E7QA 4Y20A 3DGTA 3IKWA 1LHNA 1LOEA 3ILFA 4YGDA 4AVVA 2DYCA 1QNYA 2EIGA 4BM8A 4YZ2A 5JMCA 1AX1A 4YZ4A 1F31A 2JDZA 2D3RA 1APNA 1IS4A 4LBMA 4Y26A 1AX2A 1BXHA 5JVVA 2ZHNA 1QMJA 3AZYA 5GALA 1JXNA 2DU0A 4NO4A 4XJAA 3USUB 1GNZA 1V6KA 3FBYA 4FOQA 2A70A 4C1XA 2A7AA 2E7TA 1YRZA 2P34A 1DHKB 4XMIA 2DV9A 1SLAA 1JYCA 1NXD1 2XG3A 5KXDA 1SLTA 1SLBA 1SLIA 1QF3A 3UK9A 1IKPA 1G9AA 3BODA 1ULDA 2DVBA 2WLQA 5T55A 2VU9A 4DRVA 4FPHA 1DYPA 4U2AA 3KM5A 5JDBA 1O4ZA 1V6OA 1LEMA 3MW2A 2CWSA 4Y1VA 1I3HA 3M3OA 1Y7BA 1RITA 3WDYA 1ZA4A 1W0OA 1VAVA 1W6NB 1N3PA 1G7YA 3Q9OA 4K1YA 4TYSA 2A6YA 4Q27A 3CNAA 2GMMA 4P9XA 3I8TA 1H9PA 3PMEA 4DS0A 1UZYA 1CIWA 3GALA 4FP2A 1LOAA 2DVDA 1CVNA 4ISQA 4XBLA 2D6KA 1MS0A 3VKMA 1OQ1A 4M01A 4LBOA 2PHWA 2P3KA 1S1AA 4RL7A 1X50A 1FV2A 1ONAA 4RA0A 3MPPG 2PHUA 3TB0A 1LHVA 1AXYA 3AZZA 4HL0A 1G9BA 1LGNA 1F9KA 1SLLA 2UURA 1DIWA 2D6LX 4BQ1A 3B3QE 2D3SA 1CQ9A 1GBGA 4M3CF 4DFSA 4XE9A 5DUVA 2VW2A 1B09A 1SCSA 2C5DA 3MEPA 5E89A 1DBNA 4JC1A 2Z42A 3O5SA
chains in the Genus database with same CATH superfamily
1L3JA 2ZHMA 5F5IA 3SISA 1W6PB 3M3QA 4S2FA 4QB2A 3JXSA 1W2OA 3WG4A 5C3PA 1DQ5A 2B42B 2XLGA 2LROA 4URTA 3KV9A 4NOTA 4META 4XYXA 1O3TA 1WWYA 1YJKA 2DCYA 1FMD2 3CEWA 3K3NA 4IV1B 1WA6X 3LA7A 2XOMA 4FT8A 4AYUA 2OQ7A 3AL5A 4Q5OA 1YFXA 1SZBA 4HK9A 4GH4C 3BUCA 1L7RA 4JGZB 1F4AA 2JXAA 3VD3A 3AFGA 2VZUA 2HWD2 4XTPA 4OI1A 1SPPB 1CAUB 3RZGA 1DZRA 4NRQA 2YFUA 5ANQA 1VBD2 4Q1PA 1OA4A 5FPUA 2VW0A 4XDPA 3ETQA 3DYPA 4OZXA 4ZY9A 4XF1A 2CV6A 4XEZA 2RS31 3HWJA 4QKBA 5IFTA 1RUC3 2P3JA 4S2GA 2ZGOA 3H8RA 5LEKA 3CBNA 2VCAA 1S2EA 5FPBA 1XNTA 3M3IA 2WYFA 1ULGA 2A6VA 5FZFA 5IK7A 2CGPA 4BQXA 3O1MA 4YVSA 4IEQA 1DG6A 1Y4WA 2Q8OA 3I2DA 4M3CB 2ZGQA 1IS6A 2WR9A 2ZHKA 1PX3A 3KV5A 3NL1A 1CWPA 3WNXA 2KA3A 4IUGA 2Y6LA 3NNLA 4YZ5A 4FO9A 5FKCA 3UJOA 2Y6GA 4AEDB 1OPOA 1C4RA 2QBXA 4QQHA 3L9JT 5LBFA 2X5IC 1W8ZA 1K3IA 1QJZA 2BWCA 5FJHA 2FZ2A 2UY8A 1OI6A 3HQUA 4IEPA 3WQBA 4LBJA 2H0VA 1RMU1 1XNCA 3LZZA 4NMIA 3RWNA 4BE3A 1AX0A 1Y9GA 4MGIE 1BK1A 1O3RA 1QY4A 2CHHA 4MGYE 3W20A 3N9MA 5C8WA 1UPIA 4A41A 1A78A 2VE1A 1HN1A 2FCUA 3BOPA 1FXZA 1W2UA 4LHNA 2J42A 4RSUA 3GGLA 3MF9A 4BK5A 4C0HA 5HCAA 4IV1C 1H1MA 2JG8B 1GP4A 3NV1A 4N7IA 4CDWB 3FC0A 5LASA 2BZDA 4FTSA 4JGZC 1SLCA 2AEZA 2ZZJA 5IUQA 1W6OB 4Q0PA 3AKTA 4O61A 4J25A 4IETA 2GC2A 2G9GA 4ONUA 3T4VA 4B4RA 4Q0QA 5FPAA 3R6SA 2ZAHA 3EQEA 1C1LA 4LKEA 2CAVA 2QQKA 1AF9A 3I2HA 4R52A 4EZHA 1RTVA 1GZCA 2GU9A 2WQ8A 3KV4A 4FPLA 4K21A 1OD5A 4CXWA 5A7NA 3SC7X 3ACHA 1W9YA 3DUIA 1JZ6A 4ZHNA 1ND3B 3VBOB 3B94A 3CJIA 4JGYB 5GZCA 2BTVC 4YW4A 1AR72 2JICA 1I5ZA 2CGNA 1TNRA 1LODA 1TVGA 5FZAA 1QJY3 3AZXA 4WVWA 5FPXA 1IKQA 4XF3A 4AFDA 3N9QA 3Q8BA 4INDA 4QX1A 3B9IA 1JZ5A 1AJOA 2QQVA 3MW4A 2AUYA 5F39A 5E6HA 4PHZA 2ZAAA 5LATA 4XJUA 2OT7A 1QJX3 4NAOA 3BIWE 1DQ0A 3LCPA 2OUJA 4YW1A 4AEDC 2RDSA 5JZGA 3U0ZA 4FTEA 2WSUA 5BPXA 2XBO1 5A6QA 2WS92 4XCBA 5F3IA 1OF3A 2DVAA 3PUIA 1ULEA 2PHLA 4A6OA 5A3OA 4AOCA 2XVGA 1EAH3 4FOVA 5DAXA 4A3ZA 5EP9A 4A2UA 2WZR2 4AVAA 3UNPA 4JAAA 5IVCA 1PGL2 2GAUA 2VZTA 5IJRA 1GQPA 4CYDA 5HCFA 3NWKA 3A0KA 4QM9A 3WUDA 4TZDA 1TMF2 4XFHA 3BPZA 4YLZA 3VUOA 2JG8C 4R4XA 5FYIA 2ES3A 4CDWC 3E5XA 4W4ZA 3OYWA 4LNVA 1Q56A 2GNDA 3NVCA 4M00A 4PI2A 3VL8A 1UQXA 4CSWA 3J8F2 4GQ7A 5DG1A 1PZ8A 1XOYA 3ZLIA 2G9FA 5JXGA 2W92A 4S2HA 4XBNA 2GN3A 3PU8A 3M70A 2E6VA 4H55A 3VKNA 4EV0A 4TN7A 1C5IA 3N3HA 5A7WA 5LY1A 1ND3C 1Q8SA 3VBOC 2XUEA 4JGYC 4UAPA 2BV4A 1A3KA 1HRV1 1PM4A 1FNZA 1Y43B 4GALA 2QQOA 4P9YA 3TEXA 2FDIA 3NV4A 3LF7A 1HN0A 4PQ9A 4BQ2A 5ISLA 2HWD3 2VZ1A 4CPBD 3KVAA 3T2QA 2VMGA 1QJU2 2WNUA 3MIEA 4AEMA 2RS12 1AR81 1RHI3 1VBA2 4OHWA 4FPYA 2GSYA 2XJTA 3LPGA 1R64A 1EV11 4H14A 2WL1A 4CCEA 4CP0A 5FY9A 4BIFA 1BYHA 2ETEA 4XFCA 1Q8VA 5BNQA 3I3QA 3D82A 4CDQA 4ZONA 4QMAA 2CDOA 2JECA 4FP3A 4NN0A 5DDJ1 1ZZCA 4IE5A 2LM3A 2EAAA 5FY4A 2CYFA 4MOAA 1DGLA 2ZA9A 5CB7A 1CZSA 1HB3A 5FZ8A 4E9KA 5L19A 1JZ7A 2CL2A 5JR2A 5FZ3A 1YIPA 3ZSEA 5CYYA 5JMOA 1CN1A 1WCUA 3M7AA 1OOPA 3ZYJB 1K5JA 4AI1A 1YYNA 3IDAA 3BVCA 5FZ9A 3RZLA 3H3ZA 3J7LA 1JYNA 1PMJX 4QB1A 2Z2SB 4NHYA 3ASIA 3QD6A 1NCRA 1S0BA 4HXCA 5F3CA 1LULA 2B5HA 1JUHA 2BNNA 3C7GA 1YLLA 2VUAA 3K46A 4WBBA 4DIQA 4NRMA 3IDCB 5A1AA 2HKXA 3O14A 5HXVA 2X53S 1HXS1 1W39A 3VD5A 5T5JA 1RUJ2 4GKXA 2W94A 4CU6A 3WQ0A 5K7PA 2EXKA 1RUNA 1CAXB 1LCLA 2JDHA 2XQXA 4XIOA 5JXHA 2FDFA 3UYJA 2WO3A 1W6MB 3QH6A 5T54A 5FZOB 3J9SA 1GZWA 1R091 1SQ4A 4AWDA 3C7OA 3D8CA 4JDNA 1GWKA 1PZ7A 1XYPA 3GHNA 3MO4A 1C8M3 4KWLA 4Y33A 1POQA 3JB4C 1BCXA 5EYXA 2HWE2 2W2IA 4BQ4A 2VY0A 5F5AA 4YM0A 2A73B 3ZYBA 1AR73 4W6WA 1W03A 1STMA 3ENRA 3OB8A 1VMFA 4MV2A 4LE3A 4XPVA 1OFNA 5H9QA 2BFUS 3ALQA 2ZZQA 3HNBM 5T5OA 1GANA 4WV8A 5BNPB 2NQYA 3RI9A 3RDIA 1V6JA 1FV3A 2VMEA 3ZXFA 3AZVA 1GLHA 2GNMA 4E2SA 4MG2A 5FOJB 2J1EA 4OFGA 5DAPA 5TSWA 4AI2A 4FFHA 5GLZA 2PYTA 4LHKA 2YY1A 3WVJA 2VZVA 4S2DA 2VW1A 1QQP3 5IATA 2FDGA 2PLV2 5AC91 1W05A 4NWWA 4UFJA 2TUNA 5IVJA 5ABJA 1W2TA 3HD8B 4HSJA 3UT0A 1TMF3 4AF9A 3D0SA 3RRDA 1YQCA 4XUNA 4ZXKA 5C4WB 3OD4A 5J48A 1I1EA 3VHRA 2XMLA 3IAPA 2HWB1 2VO5A 4CU9A 4M0HA 2W08A 5HCHA 1IOAA 1NX9A 2MNGA 2WC2A 5FZCA 3NSTA 2HH9A 3J8F3 4L11A 4GWIA 3ZXKA 5DZGA 4W50A 3E6CC 3RZHA 2EIDA 4ZU4A 5CVRA 1U5XA 2QE3A 1GQGA 1D4M1 1DCSA 3QACA 4PDWA 5FCCA 2GDFA 5C9AA 2LALA 2VZQA 5FYCA 2WFF2 2WA3A 4Y22A 2E7AA 3WG3A 4AW7A 4CPBA 2K9ZA 2XJRA 4IEWA 4OUSA 2MPFA 2FDJA 1H2NA 3ZXJA 3BPSA 1LOFA 1OUSA 4XILA 3T0DA 5FP9A 1JYWA 4B8EA 4O65A 3FUQA 2W52A 4IEOA 3PMSA 1R1ZA 3U14A 5CIRA 1MZ6A 4XQ4A 4KI5M 1EUTA 3JCIA 3PTYA 5BNPC 1QJU3 3HNMA 4Y20B 1MVQA 5FYHA 2HWC2 2RS13 3APBA 3VZJA 2VH9A 2E26A 3M3EA 4RGAA 2Y64A 3E97A 2A5ZA 1E5RA 4J1XA 4Q2FA 1ASJ3 1EUUA 2EALA 1R082 1VBC2 2RMU3 5F8PA 4AAXA 2Q5TA 3UL2A 3LOBA 3KCXA 3ILNA 1KS4A 2BVVA 5J09A 1S55A 2EICA 4F8AA 2B46X 2Z4FA 5I0DA 3RGBA 3ZMOA 1ACCA 4QU2A 1URXA 2Q4SA 3AVRA 1SMVA 3P3PA 4QDQA 4FQZA 3KV6A 5FY5A 3ZFFB 4E8CA 5C4WC 4G9SB 2BGPA 4MXWA 5FQ0B 3T08A 1MZ5A 3T1MA 4LBKA 1F5JA 5FRAA 3VBRB 3NNGA 5LRSA 2GC0A 5T5LA 2V5YA 4YARA 1H9WA 1UY3A 2AEYA 2ILMA 1W3VA 2WT1A 3CDZB 3LSEA 3Q8AA 1WLTA 5FYYA 2CWMA 2ZHLA 3JD71 3T09A 2YU2A 2K2SA 3JB8A 3WLUA 5JSOA 2YC4A 4MVTA 4ZZ5A 4N9IA 1EPWA 5D8AB 2WZEA 3UKNA 2XVKA 2OQ6A 1W04A 1AXZA 2BRTA 1ZBA2 1N1YA 4I02A 1VBE3 2RV9A 4BK4A 4IEUA 2OPWA 4KWJA 1V6MA 2AH2A 4BLJA 1R1A1 3NO8A 2VBDA 4I0BA 4COYA 2R061 1PK6A 1C5HA 4Q4V3 2P3YA 2ZACA 4GXLA 3SCHA 1YO8A 5FUPA 3LE0A 4I30A 3V0AA 2VNVA 2ZKNA 1REFA 4FI9A 1W8WA 3LAGA 2JB8A 4PBPA 4XUPA 2VUDA 4W8JA 5EJ3A 3ZDSA 4BIOA 3O7OA 1K5MB 5FBJA 3AYEA 5FZLA 4XJWA 1BBT1 2YC0A 1O4TA 4LOTA 4QM8A 2F6BA 3PVEA 5AFBA 5FR3A 2B8MA 2E33A 1NCQB 1PHMA 2D98A 5I0RA 4FQ4A 4QPIA 3D6EA 4RQPB 4YG3A 2ENRA 5IK5A 1JYTA 2E7QA 4RN5A 3E6BA 1ENXA 4IE4A 1JZ3A 4P08A 3H42B 3ITQA 1LOEA 2R042 4LO7A 2HEYF 3ZFFC 5FKBA 1AX1A 3FHQA 4OI4A 1VR3A 1APNA 2ZCWA 3VBRC 5C33A 5L36A 4AHYA 5G05L 2ZHNA 5BNOB 3AZYA 5GALA 1W8OA 2DU0A 4NO4A 3USUB 4Q4Y3 3OCPA 3VZKA 5FP7A 4WVMB 2A7AA 1YQ2A 2PLV3 3ZYFA 5IAVA 5HV4A 2K0GA 2P34A 4CEWA 2RJKA 5D8AC 5K0UA 1DHKB 3EXUA 5IVFA 1M06G 1SFNA 3M4FA 1LKNA 1NXD1 2Z69A 1RUE2 1SLTA 1XE0A 4N90A 1H4HA 5HXMA 4QPGB 4XF0A 4COWA 3UK9A 2JG9B 1W8HA 3C8XA 4LO5B 4IE6A 3DXTA 5FMDA 5T55A 2VU9A 3ZYGA 2NPIA 3KMHA 4FPHA 4U2AA 5JDBA 5GKAC 1UWWA 2W87A 3WP6A 4CCMA 1MZEA 1H2MA 2XHNA 1UZ0A 4HZFA 3VLBB 1RITA 4KMQA 3WDYA 1W0OA 1AR63 3VBSB 1K5MC 1PVXA 4XUTA 4A7ZA 2BFUL 3ABZA 3AMQA 1DGWA 1D4VB 5M0TA 1NCQC 4QD2A 1HIXA 1CIWA 4FP2A 1LOAA 4RQPC 1CVNA 2VOXA 2D6KA 2DF7A 1DF0A 4Q4X1 5F7UA 4UI9L 1UNBA 2P3KA 1BEV3 2ZEXA 2YPDA 1KD7A 4RL7A 4GZ9A 5FZ4A 4BA6A 1J1LA 2HWC3 4C0BA 3TB0A 4Z1VA 3I3BA 2N7GA 1RJ7A 3AZZA 4E2GA 2FQPA 3IWZA 1PO21 3UETA 3RYPA 1H2KA 2DBNA 1BMV2 2VBBA 4BQ1A 4EE2A 2QQNA 5BNOC 4IGOA 1CQ9A 1GBGA 4M3CF 4DFSA 3I3MA 5LA0A 1B09A 4OHYA 4D6RA 3MEPA 1AR93 5E89A 3U10A 1JODA 4BXFA 1JZ4A 1CD3G 3O5SA 3JQWA 3E5QA 3E5UA 2XL9A 1TQ5A 5DPNA 4LQRA 4HVOA 5FK8A 4DXRA 3ZXAC 4BJ0A 4QPGC 3ZN4A 2JG9C 4AQTA 3RZKA 1QNWA 4HN1A 4HKOA 3VB9A 2W91A 3VDAA 1YFYA 1VBB1 1YI7A 4RS5B 3PL0A 3GBGA 1J3PA 5I0UA 3L2YA 2AR6A 2QZ3A 4CEYB 1E5SA 3BCWA 3WP4A 3QOPA 2YZ4A 2A75A 2WNOA 5LBBA 4EWDA 5LB6A 3WX5A 5FMCA 3VBSC 1F4HA 1RUOA 2I07B 5FYZA 3TN93 2B39A 2NN8A 3ACGA 4KGGA 4ZS3A 1WA4A 3HQRA 4QXCA 1IPKA 5F9TA 3IPVB 4AE2A 2XWBB 1ZBA3 1AXKA 3FHIB 4GULA 3NNMA 4UFKA 2IXHA 1KJLA 2V09A 4LOSA 3T3YA 4AFCA 1PIV2 5A3NA 2ET7A 5I8TA 2TEPA 1AYN1 1J3QA 1REDA 4FOWA 4LO8A 1K42A 5CFDA 2Z5WA 4E4DX 3CL1A 1ZVFA 4EN9B 2WWSA 1BZWA 1JU4A 4NWVA 3ZSJA 4AHZA 4IV3B 4EQVA 1QHDA 5F5QA 1ZBE2 1KEXA 5J96B 2A3YA 4HN0A 1DLLA 2BDRA 3M8LA 1AL23 4P9IA 4DUVA 2JE7A 2R071 2YROA 3SQOA 2NMOA 1NQDA 1ZYBA 4AVCA 4QX2A 3KS7A 4YM2A 4E4ZA 4UW3A 4JRLA 3MIHA 4JKMA 1UMIA 2IXCA 2XR4A 4ASMB 3OTFA 2DCZA 1XNKA 5EPAA 3BGAA 4LA3A 1PGW2 1W9WA 4LITA 5J37A 4GMP1 1FOD1 2TNFA 2VOWA 5JIUA 4QB6A 4XETA 1LHWA 1AVBA 1YQ6A 1SDWA 2WJSA 4RS5C 4QKDA 4BCUA 4CEYC 4NIDA 4LULA 4FPFA 2ZXQA 1DZQA 1OUXA 2HLEA 3LFMA 2PN5A 1AUYA 3WF4A 4B29A 2G1MA 1V00A 4QHBA 3ZKUA 4YM1A 3W59A 1RUE3 3MZHA 3SH5A 3G7DA 3LEIA 4XZUG 2YG0A 4AHWA 4FFFA 2WN3A 1CJDA 3ACFA 1FMD1 4I3GA 3WXPA 4J6GA 3M1HA 2L9LA 3JBG1 3AZWA 2DWRA 1WMFA 3POGA 4IV3C 1VLNA 2ZMKA 4LJHA 4LO6B 2J1SA 1J1TA 4LR4A 5HV0A 5L73A 2ZBJA 4A3XA 4MXWB 1XSRA 3CF6E 2Y34A 1VBD1 4IQPA 2GALA 2ADEA 4XFFA 1QJX2 1RVF3 4AGRA 3VZMA 4JHZA 1XQNA 3MLLA 2C1FA 4ZPIA 1PVC3 4AHXA 4CDUA 4XF9A 2YBPA 1NE6A 1ZX5A 5IYYA 2R32A 4XJ9A 3OOXA 1QH7A 3N36A 4D6SA 4D7YA 3MIDA 1UOFA 4R9AA 1JI6A 4FBFA 1YC61 4UFIA 3RMXA 3A23A 3HIFA 1W6QB 5LRRA 3R4SA 2PELA 4Z07A 2AGSA 4SBVA 4BMEA 4Q4W2 3J26N 4ES8A 1VRH3 3NJZA 3BKZA 2OS2A 1UY1A 1GP6A 5A33A 1O3QA 1W8NA 5FYUA 3FUOA 3OF1A 1W8TA 4YVWA 1KDMA 1M4WA 3KD4A 4NPMA 2YUEA 2DVFA 3NV3A 5FTTC 3SKVA 1TG7A 4CZSA 4XJ8A 4FPJA 5FUNA 5J3UA 4NHMA 4D69A 4PI0A 4Y5TA 4PLNA 1FX5A 1LESA 5FXVA 1MACA 3OPZA 3MBWA 3VDDA 4FXGB 4CA9A 4A7YA 4CCKA 5HBAA 1NY72 3H8XA 1OT5A 4LIVA 2OVUA 3GZAA 3H1YA 3K48A 2I2SA 4H7LA 3ZXGA 5CFCA 3MIGA 5LEJA 2XQRA 5DUWA 3I59B 3FJSA 1SBEA 1S0DA 4K8FA 4M0NA 5FAXA 5CKNA 4GWJA 3AP9A 1KFXL 1NG0A 1JUIA 2W1SA 3NKGA 5CEHA 3DL3A 1Y9QA 4UW4A 4YNIA 1QOSA 1RHI2 2HYKA 1HQWA 3PUAA 1PIV3 1YUDA 1TEIA 2XKOA 5FXZA 4P00B 2C26A 3LEKA 3S7IA 5L9VA 3N4MA 4QAWA 1CIYA 2ZMNA 2NLRA 4PJYA 3AJYA 1IZ3A 2RM22 3WHTA 1DGWX 1DQ4A 1HRI2 2CNAA 2HBTA 3K3OA 3MUZ1 4LBQB 4P14A 3VGIA 1Q8QA 4JZRA 2FZ1A 4W65A 1MEC2 4RD7A 3I2KA 3SEPA 3WNOA 1IGOA 1POV1 1ZBE3 3H9AA 4QGLA 1D2SA 1COV3 1W90A 5JOWA 4P9WA 1FPN1 3AYCA 1WBFA 1QU0A 2XJVA 2VXJA 1AJKA 2JWPA 3B69A 2X8KA 5FYBA 1G86A 2WS91 4RGGA 4YW7A 4X6RB 4QXHA 3MHZA 4R8HA 3HQXA 3KHBA 3N7JA 4B7KA 3O1OA 1LHUA 3A4UA 5FPLA 1J84A 2XJSA 5HI0A 3AKPA 3T4HB 4AAPA 2WZR1 4K1ZA 3WINE 2FDKA 1Y9MA 4NAMA 4HMZA 2D97A 4EROA 1A8DA 1S0JA 4DINB 3H50A 1QKQA 3H3UA 5C71A 1SFYA 1LJ7A 4K40A 4GWMA 1MR5A 4QXBA 1XYNA 1S2KA 4HKWA 5C70A 1B35A 1XYOA 2JKBA 2ZEYA 5FYMA 2Q8EA 3THDA 3WQ7A 2VOVA 4XXPA 5DAQA 2GMEA 2RJLA 2WYSA 2RS53 1JHNA 2R16A 4YGEA 1RYYA 3GF6A 5FY0A 3POBA 4EN8B 3WW2A 2OUHA 4A42A 2VBPA 4NPLA 4NR1A 4UF0A 1HB2A 4A7KA 2UYBA 3RYRA 3KSCA 4CP2A 1JZ8A 1C8M2 1D0HA 2VAUA 3GJAA 5D21A 4BISA 4M3CE 4XACA 3H8UA 2EAKA 1CPMA 1S0IA 5FZBA 2R6QA 2P17A 3GBWA 1SBDA 4ZU5A 4BHPA 2BBVA 3R05A 4CUGA 5H9PA 3CZUA 2DFCA 4OUMA 1LGCA 4A44A 4I0WB 1WMDA 3S57A 1HJFA 2Q0AA 5EWSA 4QQPA 5F32A 4J1WA 1F15A 1ULOA 2QJVA 5FO7B 2AYHA 4LA2A 4FOYA 5FY1A 1OA3A 5C8CA 2VVFA 1LEDA 1PM7A 2ZPXA 1ND2B 4ET7A 1WLDA 1VBA1 2YGLA 3JU9A 3ZPYA 1OQEA 4R9DA 4WM8B 5F6KA 5FMBA 4MGZE 3UGGA 1US2A 5EHDA 4COVA 2ARXA 3AP4A 4CCOA 4FXKB 3ZYRA 4WM7B 3ZR5A 2J1RA 1RGSA 2DUQA 4QQ2A 1RUH3 3PLQA 1QQP2 1QWRA 4N7UA 3IB3A 2D43A 4BH9A 4CP9A 4OHVA 4Y5Z0 1NOVA 4TLFA 1W8FA 2WNVA 3K51A 2YYOA 3JZVA 4DY3A 3ZFGB 1WCSA 3OY8A 4LHLA 4Q4W3 1RUG3 4DMIA 1EPZA 1IHMA 1NAEA 2XPJA 1Q5OA 4XOGA 3VBHB 2QQPA 4FVVA 5ACA1 4IEYA 1UY0A 1P8JA 4DXSA 4AVSA 2RHPA 2WT0A 4N53B 4DZGA 2RR11 2WWJA 3DPRB 3R4DB 1N1TA 2C0ZA 4MH0E 5LK5A 4GAZA 1VIWB 3V0BB 2ZEWA 4EN6B 3SNMA 3ZFEB 5JI9A 2Y38A 2Y60A 4FPKA 3TOJA 2ORXA 3OG2A 2ZGTA 3I2GA 5DUXA 3U1XA 5BNNA 4BQ5A 4CUAA 5FBZA 1QXPA 3O12A 1CX4A 5GM0A 1RUJ1 2CSGA 3WDUA 3GZEA 4BU2A 4B1LA 4AXOA 1UU4A 1H0BA 2O14A 2RJ2A 2UU8A 3AYAA 3KB5A 4GB31 4MGSA 5EQUA 5AVPA 1YXWA 1DYKA 3ST7A 1XNBA 4QPWA 1GNHA 4N43B 1MQTA 1MS9A 1QEXA 4CRQA 1RB8G 2J22A 3THTA 1DZTA 1ND2C 3RS6A 3O1UA 3S30A 2IXKA 5J98B 1UMZA 5A3UA 1NXMA 5EV7A 4WM8C 3HT2A 2D93A 2HWE1 1ZZ8A 4KWKA 1ASJ2 3SH4A 4YSFA 4RR3B 1VP6A 1IPJA 1MS3A 2RMU2 4WM7C 3OJBA 4JRAA 3WCRA 3H0OA 4OUEA 3ACIA 2RM23 2OZJA 1HRI3 2LW8A 4FAHA 1H4GA 1XXNA 2XLFA 2MEV3 1TE1B 5GJ6A 1MEC3 4EN0A 3ZYHA 4CDXB 3B01A 3SHRA 2ZTNA 1Z7S3 2AZ5A 2WLPA 3GNEA 3OUIA 1O4YA 4MZUA 3ZFGC 1LENA 2R7EB 5A6XA 3KZ4C 3GM8A 4I01A 4IDZA 4PCRA 3RSJA 3CLPA 1H30A 5JCTA 5C5UA 3VBHC 3FWEA 2Y26A 5LW9A 1J3RA 2WN2A 1SBFA 4PIYA 2ZEZA 2NP0A 4XAAA 4ZKTB 4FSJA 3PVOA 4N53C 2WRAA 3DPRC 4Q1RA 4DO0A 4O9GA 1F2NA 1YJLA 4UFHA 3ZN6B 1WCQA 1PZ9A 4BQYA 3ZFEC 1YNAA 4PT6A 2RDRA 2W46A 5T3NA 2E9QA 2DU1A 1XC6A 3WG1A 3AP5A 1VBE2 1KGYA 4AI0A 2DURA 4B7EA 2BJSA 1JZ2A 3DYMA 5CADA 2JJ6A 1PNFA 2GMPA 4TLGA 1PO11 2A6XA 3C7FA 5HCBA 1H8TA 1OMIA 4Q4V2 2UYAA 3WR0A 3NAPB 3VKLA 2PHXA 4N43C 1NLRA 5JOZA 3AP7A 3OEAA 5ANNA 3WF1A 1CX1A 3DECA 2D6PA 3K77A 2IZWA 3C2UA 4Y1YA 2UWCA 2OYZA 1W9TA 2IVIB 4QDSA 2W1QA 3ES4A 1UZZA 2WFF1 5CBLA 4RR3C 1D7PM 3PUQA 5A32A 3POYA 5FXWA 1RUD2 3GYDA 1X9PA 1W8UA 2HWF1 3F2ZA 3EB7A 1NYWA 3IKWA 1LHNA 5FV3A 5L7OA 2VTFA 3ILFA 1HRV2 2VUJA 4AVVA 5IVBA 2DYCA 2Z79A 2W3JA 2EIGA 3K4DA 3VD7A 4CDXC 4OCTA 1RUI1 4COUA 4YZ4A 4JKKA 4OI0A 2VOKA 4KH9A 1YQ5A 3RYKA 2JDZA 3WQ1A 3LEGA 4Y26A 1OPMA 3EJKA 3VHNA 1V0AA 1DGRN 1NA1A 4UFLA 1JXNA 4XJAA 4XUQA 1GNZA 3LDKA 2RS33 3LKJA 1R081 1VBC1 4FOQA 5FP3A 4EYUA 3VD4A 2W5FA 2O0OA 2E7TA 4QGNA 4I2OA 2Q8CA 4Q4Y2 4XF4A 2B9UA 3OPTA 3IAQA 4XMIA 5APAA 2P6CA 1UOBA 2DV9A 1JYVA 1JYCA 5A7SA 2XG3A 4HLTA 4XFIA 1QXRA 1SLBA 3NNJA 4GMP0 2JDAA 5KBFA 1QF3A 5KR7A 3WNPA 2ORZA 4LK7A 1IKPA 5DDJ2 1G9AA 4AI9A 4DRVA 3F95A 1DYPA 1RJ8A 3KM5A 1DGRA 3MV11 5FXXA 1V6OA 3M3OA 3NAPC 1PNGA 1Y7BA 3VBFA 4UBHA 4YVSB 4ZS2A 4AEJA 3ES1A 2Y8KA 1N3PA 2ZKLA 2B9VA 2QNKA 4L92A 4LEJA 4K1YA 2A6YA 4Y4YA 2J7MA 1L7QA 4P9XA 3I8TA 5EJZB 1AR62 4DS0A 3GALA 2DVDA 1ZRFA 1VB4A 2E63A 1WZXA 1LR5A 2VQAA 3I2FA 1AL0G 4NHLA 1GP5A 4RGKA 3J7MA 4LBOA 4XVHA 3TNPB 3BYWA 4JQTA 3GZTB 4P5YA 5A3LA 1X50A 3BTYA 1ST8A 3H7YA 4RA0A 3K4ZA 1BEV2 3RWKX 3TEYA 1O91A 5JPNB 1CAVA 1LHVA 2EIBA 3Q8EA 5FOBB 2VCBA 2VULA 5K4LA 4BB3A 3VBUA 1F9KA 3ZYIB 1LB2A 3GBFA 2H6CA 1TME1 2D3SA 1UY2A 1CAWA 4IE7A 1PMHX 4K6BA 2V72A 3QBQA 1UU6A 2B4KA 2W1WA 2VW2A 3OUJA 4N8MA 4QQLA 3WNKA 3ZM8A 1DBNA 3VHOA 1AYM1 2WWUA 4ASKA 4NIHA 2ZGRA 2C9KA 1AR92 3OUHA 1W28A 4JTNA 5FREA 2R0HA 3DV8A 2OW4A 1HX6A 3JQXA 1OF4A 2R041 1V6NA 4H3WA 4OYUA 2JD4A 3D3AA 5C3SA 5FZDA 3RZMA 1W99A 3AP6A 1V9U1 2JIGA 3S7EA 2C9AA 3CJIB 5JR7B 3U78A 1XPWA 2XBO3 2W47A 3USSA 1LTEA 4YVSC 3MW3A 2PMWB 4ATFA 4XUOA 2LUWA 4AQSA 4IL7A 3UGFA 1N1VA 2JKXA 1CGPA 2PHFA 5EYYA 4NVPA 5GZEA 4CUCA 1JBCA 2F4PA 3HBKA 5C8CB 3CQOA 4KWUA 3TN92 3H1WA 4HPKA 4ORFA 2DCKA 4COZA 1RXFA 3LD8A 4DQAA 5JZGB 1G6NA 4RHV1 3DYOA 3N7LA 5H9RA 2MHFA 4MHUA 4GH4A 5DN2A 1GNYA 1WLWA 5JSPA 5CA6A 3SCGA 1W6NA 1BQPA 2WDBA 1J58A 5BXXA 4NROA 3KHCA 5JLVA 3BALA 1UU5A 2ZGPA 5H9SA 4TWTA 2VCCA 4U36A 1ZZBA 4HSLA 2YB7A 2BYVE 5DABA 2RDQA 5FLJA 2GH8A 1RUF1 5KXCA 1D4M2 1LGBA 1OXCA 3FFQA 1FAYA 1AL22 3N9OA 3OYWB 5KXBA 3J4UH 4O7XA 2WZPP 3AXEA 3ZR6A 2AACA 3WF0A 3B5LB 1MS5A 1RUD3 5DG2A 2JDPA 5KC6A 2YMZA 5BYNA 2CDPA 3IIAA 1YFWA 4A6SA 1HRV3 2G4IA 3MIBA 1UYXA 2JX9A 4HVRA 4QHZA 3HJRA 3QCWA 1POV0 3HNYM 3KF3A 4FCAA 4Y1UA 3T1LA 2X5IA 2DFBA 3TWIA 1BK0A 4EN7B 3B00A 2P2KA 5A7WB 3MGUA 3CJIC 3LGRA 4WZCA 1O3SA 1AR83 1W6PA 4H7MA 1BMV1 2Q1ZB 4XHXA 3A22A 3R4UA 3PDQA 1UL9A 3BI3A 4KQ7A 2V73A 4ES9A 1EV13 1MS8A 4AFMA 4URAA 2FMDA 2Y6HA 1F35A 4PIXA 4AQ6A 2ZGUA 1WCKA 2PQQA 1JU3A 2R0FA 4NIAA 2Y0OA 2WNUB 3AC0A 4IV1A 3CMGA 4IEXA 4GJZA 1Y3TA 1ZM1A 4JQRA 5A80A 3TNQA 5JZGC 2A6WA 1D2QA 4ISRA 4JGZA 1WKYA 3K75B 3RPQA 2EA7A 1J59A 5DDJ3 1X7NA 3G6JB 1UX6A 4BYYA 1GV9A 1SPPA 1CAUA 1E5HA 3ACLA 4E2QA 2QDNA 4HETA 1U5IA 4JX0A 1JMUB 1VRBA 4UW6A 4CDQB 5A6YA 3IMNA 5C7GA 2WAOA 1C28A 1ZRIA 2O8QA 2FCTA 5FK7A 3JD72 4LKFA 5GLTA 5DAWA 1K45A 2EXIA 3HPNA 3KQRA 4LE4A 3MI8A 1DYOA 1YCIA 3MPBA 1OKQA 3ZSMA 4JHTA 1RVF2 2QUOA 4M3CA 5FZMA 4FAGA 1OOPB 1RUC1 1CZTA 4AR2A 1HXS3 1PVC2 1V6IA 1S0GA 1R1A2 5I91A 3LFIA 2QDRA 4Z82A 1DP0A 2B45X 1NCRB 3FLPA 3X29B 4F83A 3ZVXA 4QWNA 4EWEA 3SKJE 4GKYA 3ORJA 1LAJA 3PIJA 1W0PA 4LBLA 3VZOA 3WOGA 5IVEA 1ENRA 1UOJA 1WW7A 4C90A 2D6MA 4XDOA 3NV2A 4TXWA 3RQ0A 1FT9A 3EYPA 3OBZA 4Y5SA 3I49A 1VE0A 1VRH2 3MICA 4XFAA 3VDBA 2BNOA 3ZXDA 3TBDA 2WNUC 4YGCA 4LXLA 2JG8A 1Q43A 1GZWB 2RE9A 3CHXA 4YG6A 3S6PA 4CDWA 2OKXA 3J7NA 2O1QA 2WFPA 4YPJA 1PGW1 5IK8A 3B9CA 3FX3A 1W6OA 3P1IA 4H2AA 5F1RA 2EXJA 1OLRA 4QT6A 4GWNA 1GSLA 3ZMNA 2DBIA 3GCXA 1CJPA 4I0AA 4I3PA 2PTMA 2SBAA 5CNAA 1W2AX 4CDQC 5A3PA 1K12A 1HQNA 5KHKA 5K8SA 3MYXA 3BU7A 2H0BA 2WT2A 3AB0A 4M4RA 1ENQA 5L9RA 4QX5A 1BKZA 3PVNA 1OLQA 3I4IA 1OC1A 1BHGA 1ND3A 2QQWA 3VBOA 3S0MA 4JGYA 5E88A 5F2SA 2A3WA 2GZWA 5AC93 3WG2A 5JPMB 3VD9A 5BUVA 2GNBA 3PHMA 2NYYA 3WF3A 1ULCA 4G4FA 2F17A 1OOPC 4P9GA 4UYBA 2P3IA 3I2IA 1GZ9A 5E16A 5J1XA 4L2NA 2VQTA 2HWB3 5JOXA 1N1SA 2PHTA 2XH6A 2ZJCA 3U4XA 1MS1A 1NCRC 1IPSA 2BU9A 1PMIA 1WW6A 3UGHA 5FPVA 4CCDA 2LRPA 2P4EA 2VECA 2WZ8A 1QJY1 5ABJB 1IQDC 2XJQA 2IFRA 4BQWA 5T50A 2QQMA 4K7JA 2ZX1A 4YFZA 1COV2 2Y33A 5CKMA 1D4M3 4AGGA 3I7DA 3MIFA 1X36A 3GCWA 4UW5A 1QJX1 1DQ1A 2W39A 2BGCA 3WW4A 3FMGA 3I2JA 5A70A 3A7QA 3OBAA 1XB9A 5FZ0A 5E1RA 3P6BA 3AJZA 3WDTA 1GKBA 4Q4X2 1QJFA 1EAH1 2C24A 5F37A 3O0VA 2JB4A 2WO7A 5FYSA 2B7YA 2V5DA 1BLZA 4PDWB 5C9AB 5CISA 1OHFA 3LIGA 3KLSA 2AREA 3LPFA 4Y22B 1ENSA 3MLJA 5I8SA 1HQLA 1L7LA 4YM3A 1CONA 4XABA 3A0NA 1PO22 5DXDA 2WQZC 1HB4A 1LU1A 2WO1A 3P3NA 1FYUA 3SMHA 4BXSV 3W5MA 5B4NA 2RS52 4OHZA 3D4KA 1U5ZA 2FHRA 3L2HA 3C7HA 3PJYA 5FZHA 1V6LA 2X29A 3NJXA 1T6GC 4YW2A 1GFF2 4XCAA 3OGVA 1PGSA 1E5IA 1ULFA 1X33A 1C8NA 1QOTA 1Q3EA 3ZX7A 2QKDA 2VM9A 4X6QB 5CZKA 4B4QA 4Q0UA 4R9BA 1SEFA 3HT1A 3HBZA 4Y1XA 2A3XA 2CY6A 2ADDA 3AKQA 3N9NA 4L9BA 1NY71 1WD3A 3WD5A 2BERA 2VPVA 4AEKA 5HPOA 1VBB2 4L99A 5ABJC 3ZSLA 2E31A 4YZ3A 4OMCA 2JDKA 2D5HA 1ZREA 2X05A 4YG0A 4AFAA 2HWD1 2ZGSA 2GNTA 3JD73 1I6XA 1GICA 3N7MA 4QPYA 2ZX0A 3IBMA 1RHI1 5JOYA 1SHWB 2EIEA 2OZ6A 4JTOA 4WZFA 2VUCA 3BOWA 4ZU7A 3I54A 1R1A3 5A1FA 5A1LA 1QH6A 2WNEA 2R063 2RM21 4LHSA 4DRRA 3WCSA 4PDWC 5FMOS 3VKOA 1RUH2 2E53A 5C9AC 2BNMA 1JYIA 3IDBB 2VQ0A 3U75A 3WY6A 2FDHA 3NNFA 1HW5A 1REEA 4NIGA 4GH4B 4KU8A 4L8QA 3KVBA 4Z8BA 5JIAA 2J1VA 1LOFC 2VXRA 4DEQA 1OQDA 3POIA 1BBT3 1TZOA 4NHXA 4LTAA 3RFRA 3SEEA 3PU3A 2KR2A 3IM0A 4MHRA 1RUG2 1PK6B 2JIJA 4LO4B 2Q30A 5C6CA 2F4LA 4MGTA 3WZ1A 2PFWA 3MFAA 5J7MA 2D3PA 1CPNA 2W9XA 3J7HA 3OGGA 3V0AB 4IEZA 2OPKA 2QVSB 2DTYA 4LKDA 2VZRA 3ETPA 4QX0A 2HYXA 4XAEA 1KRIA 1CAXA 5IVVA 5A7OA 3K4AA 1W6MA 1XSQA 2RVAA 3FBMA 4QPIB 5FZOA 4DOUA 3EMRA 3I97A 2GC3A 2Y6KA 2ID4A 1X8MA 2DVGA 1HKDA 5BY5A 3FLRA 4PLOA 5B4XA 1RC6A 2R1DA 2ZOEB 2NZ9A 4HOOA 3GDBA 4AGVA 2EVXA 3OBRA 3TAYA 4BMBA 2OA2A 4BDVB 3BB6A 1Z0HA 1YQ8A 5IVYA 1C8M1 3A21A 1TNFA 1SG3A 4XFGA 2PAMA 5BNPA 3WW1A 4TSVA 5JWPA 1LECA 3ZXLA 3M2MA 1W9FA 3M3CA 1Z78A 1AR71 2BOJA 4F7ZA 4CEWB 5K0UB 3JBG2 1XU2A 2A71A 2MEV2 3HEIA 1ZNPA 3MLKA 1UW8A 3LIHA 1Q8PA 1Z7S2 1F5FA 4BOWA 3B93A 2XKPA 2W1UA 5IW0A 1OLMA 3LWCA 3QLQA 2YPJA 2PAKA 5LBEA 1PK6C 4GA9A 5EZWA 5LA1A 4K20A 5LY2A 1GR3A 4GD4A 1QJEA 4OULA 3V65A 5C4WA 4Q4X3 4ZXEA 2ZGLA 4NIIA 3CKHA 3ILRA 4FPOB 3B7MA 1WUVA 2C4XA 2VOTA 1QQP1 3HN1A 1YFUA 1O8PA 2PHRA 2D44A 4QQOA 1UOGA 5IHRA 1PGL1 1WW4A 3VV1A 1QXJA 1F8VA 1VAMA 2X10A 4Q26A 1GWMA 4QPIC 1ODNA 1TMF1 1UIJA 2CGOA 3MV01 2WSVA 1C1FA 4UBGA 3AMPA 4UOJA 1PO23 4NHKA 1JW6A 1MS4A 4AVBA 4CCCA 4G3YC 3O1VA 1DFQA 3T0AA 3ZOIA 2VZPA 4UWDA 2D6NA 4YZ1A 4F3JA 4UT5A 3J8F1 4HG6B 4XJZA 2DCTA 2PHDA 2JE9A 4FPEA 4HKLA 4D7SA 4TTGA 1XE7A 4CCJA 4Y1ZA 1GOFA 1G9FA 2E51A 1XU1A 4MGQA 5FDBA 2YHJA 4Y20A 3O1TA 2Y6FA 2J1TA 2IUWA 3RJRA 4IEVA 3MF6A 2Y6JA 2DDUA 4KL1A 4YZ2A 4CEWC 1VBB3 5JAXA 5K0UC 5JMCA 5G04L 4QX7A 1D0GA 3WP5A 2YU1A 4MO3M 1BXHA 5JVVA 1QJU1 2JDYA 3DKQA 1QMJA 2VMDA 2RS11 5EFUA 1V6KA 3FBYA 2BW8A 1UIKA 1UZWA 3ZIXA 1OA2A 4CCLA 1KFUL 1AHSA 1YRZA 1ASJ1 1OBNA 2RS32 4OZOA 5DAVA 4DXTA 2RMU1 2JE8A 3ZFFA 2X09A 5FQ0A 1AYN3 2K46A 5F3GA 5KXDA 2ATFA 3VBRA 4JVAA 1NLQA 1U12A 1ULDA 2DVBA 3URFA 5KHGA 1HV0A 2VMFA 3B02A 3LEMA 5DMYA 1O4ZA 4L97A 1FPN2 3IT8A 2XGXA 3MW2A 2QCSB 2VVDA 2CWSA 1JYXA 1I3HA 2R073 1JOPA 3KT1A 4HBNA 5D8AA 3T30A 2E32A 4V2WA 5CFDB 1G7YA 5AFEA 3UKVA 3KCYA 3N9LA 4QX8A 4Q27A 3CNAA 2BOIA 3OGSA 1H9PA 2D40A 3WNNA 4DB5A 1UZYA 5JUVA 3VHPA 1RMU2 2XVLA 2XXZA 5A3TA 3Q8FA 2YBKA 2WINB 4GMP3 1FOD3 3NW4A 4RYDA 3O1SA 4M01A 4P9JA 2PHWA 3HAGA 1VBE1 3ECQA 3ELNA 2XDVA 1K5MA 3NJVA 3N9PA 1FV2A 1I5PA 1ONAA 4MXVA 1NE4A 4A45A 1KXGA 5BV6A 2PHUA 2BBAA 1NUKA 4Q4V1 1AXYA 1NCQA 4HL0A 5FLIA 3V56A 1LGNA 1NQJA 2ARCA 2UURA 4RQPA 4V2VA 5J36A 5LWBA 2D6LX 3LQCA 5FMOL 2XL7A 4XE9A 1SFPA 3GJBA 2VMHA 1VMJA 1SCSA 2C5DA 4JC1A 5T5PA 3MDPA 4IESA 3GXUA 5GLVA 4HVQA 1XRUA 2GH2A 1RUD1 4LK6A 1FMD3 3JBG3 4Q29A 3LSDA 1E57A 5FZ7A 1VAKA 3WV6A 5BNOA 4X8PA 3USUA 1UKRA 2G19A 1UN1A 2QQJA 3WNLA 5FJKA 4WVMA 4UFMA 3THCA 1OFSA 3DCQA 1S4CA 1VBD3 3ATGA 4MUVA 4NUBA 1FI2A 2ERFA 5CFDC 3KF5A 3RMYA 2R49A 4YGBA 2VVEA 2XBO2 4CXXA 1C3HA 4QPGA 2GP3A 3D0JA 2JG9A 4Q4Y1 5GLWA 4XTMA 5K9YA 4XZPA 3KWVA 1FATA 1UYZA 2PLV1 4HONA 4YW5A 4B4PA 1H2LA 1NZCA 3SLIA 1UX7A 3KT7A 4E8DA 5C3OA 1QIQA 4CU8A 3T2TA 4ARXA 2O8OA 4MLOA 2VMIA 4OLLA 5C3QA 5FIXA 2P5BA 5AVAA 2VZOA 3VBSA 1FNYA 1KITA 4CDUB 1H6XA 2V4VA 5I8YA 2BPA2 2VJXA 1BJQA 4R4ZA 5D1IA 5JSRA 1OVSA 3TYJA 3W58A 1ZZ7A 2DUOA 2ZGKA 4Y24A 5DUUA 3OEBA 5T52A 1RIRA 1LOGA 5ACA2 2VZSA 1UY4A 4DNYA 3SCFA 1JN2P 2RR12 1W0NA 2VL4A 4P02B 1IS5A 1AR61 3OPWA 3N35A 2I45A 2WO2A 2WUHA 1MVEA 1VMHA 2D7FA 3OGRA 4XDQA 2JDNA 1BVVA 2BEOA 2SLIA 1KDKA 5A33B 5IWFA 5A3MA 1ZRCA 2XJPA 4QDRA 5B2GB 3RZJA 3CZJA 1O5UA 4YVWB 3RG0A 2XB6C 1UAIA 1UYPA 1CESA 4XMAA 1BEV1 4DPNA 3NJYA 3AFKA 4GB32 5L9BA 3O1PA 1JTZX 3SXWA 3WUCA 3HVDA 2HWC1 5F5CA 3ZDVA 1XNAA 3HOBA 4YFWA 1RXGA 2QQLA 2YV8A 4CP1A 3VDDB 4YYOA 1AR82 4PQQA 3E1F1 2VNGA 4E4HA 3S5AA 1UCXA 4CTEA 1DU3D 2IXJA 5LZ6A 5DZFA 5CFCB 1KS5A 4DY5A 3R0RA 1CR7A 1H8VA 1YEWA 2QTWB 2VNRA 1CZVA 1EV12 3AMNA 4ITCA 4YRDA 5SV5A 3ROUA 5I93A 1AR91 3HMYA 3AXDA 5FPZA 1O5LA 3U4SA 3FLTA 2VCMA 4RS5A 3VZNA 3EBRA 5JXJA 1GMMA 1DDLA 2VTXA 4CEYA 2IXIA 1GZTA 4C91A 1POV3 1WMEA 4EJRA 1GUIA 1QDCA 1W2NA 4IW3A 1FPN3 4OMDA 4CDUC 5FO9B 5LA9A 3NKTA 4WVVA 3KT4A 3IPVA 4IXLA 3POWA 3OSDA 4QKNA 4AI8A 2WS93 1JH5A 4D94A 5A7PA 5FUIA 4Y3OA 3NQHA 5GZDA 4LMFA 3EO6A 3ZXEA 1UMHA 4HFSA 2WZR3 1RMU3 3K2OA 3TN91 1IS3A 4FTBA 2VMCA 3LDRA 4NRPA 2A6ZA 3GHMA 5KWRA 3CU7A 1ZBA1 4XHBA 2XHKA 4IV3A 2JDMA 1N47A 4P5HA 1OSGA 4LBNA 4YVWC 3ZPOA 5LCWL 1MZFA 1HXS2 3ZIWA 3O0WA 1PO12 4YW6A 4AG4A 4JKLA 2IVJA 2W0XA 4LBQD 3V64A 3FZ3A 2BVBA 4AFBA 4KGQA 4OQ8A 1HJGA 4KU7A 3NRUA 4XIKA 3BTAA 3I2OA 1H6YA 4MADA 3VDDC 1R092 1B35B 4Q8LA 1OLME 4PIZA 4BPZA 2VC9A 1AL21 1Q8OA 5FWEA 3UKTA 3VN4A 4RFT0 1UD1A 5CFCC 5JI7A 2HEWF 1A8MA 2R1BA 2J1AA 2R30A 5CAZA 2A1XA 1UKGA 1YIFA 4CXYA 2HWF2 4UF0B 4CE8A 3WHUA 4D0QA 3BIEA 2XUMA 4XQDA 1G9DA 1JS9A 2Q8DA 1RUI2 5KHIA 1OURA 2QQUA 4AVTA 1VBA3 1LOBA 1LNSA 4K3UA 5I0TA 2GN7A 3VL9A 3H8OA 4BWOA 1JOJA 2XJUA 3HN3A 1S0FA 1YI9A 3KGZA 1I9RA 4PF5A 2UWAA 2H6BA 4AZZA 4IERA 4OHXA 5FWJA 5C5TA 2WABA 3FHAA 3LA2A 4XC9A 5AC92 4EZ4A 2HBUA 2VZ3A 5KC5A 1RUE1 1DQ2A 4LLFA 3WP3A 1OH3A 5FLHA 4LPLA 5ERLA 4B3NA 5C3RA 2YBSA 5KHHA 2ZGNA 4X8NA 1G9CA 3WDWA 1WMXA 4K8RB 2DTWA 3ZO0B 4OI2A 2HWB2 2YFZA 1UPSA 2IXLA 2VD7A 1GYKA 4CP9B 4QGMA 5ACA3 2EXHA 2RR13 4BZ4A 5A7QA 4L0PA 2WNVB 4QU1A 3O1RA 1B35C 1O59A 1X8EA 2LS6A 3VKFC 5GZGA 2C6SA 3OY8B 1UXXX 3CO2A 5IAXA 2WBKA 2VNOA 1RVF1 1U0AA 2D5FA 4Q0SA 3KQ4B 1W6QA 2ZX3A 4DEVA 2FD8A 2EF6A 1VALA 2ZABA 1PVC1 2KXLA 1OD3A 1RUJ3 4IGPA 3BN6A 1ZRRA 1XE8A 1ALYA 1GOHA 2QQIA 4LUKA 3BTZA 1ULPA 4GB33 4LIUA 1ODMA 3WT3A 2PAEA 3ZSKA 2JEMA 1O8SA 3GZUC 3WW3A 4NJ4A 2NM1A 1HV1A 4LORA 2P6HA 5BNNB 1JOBA 1TME2 3C7EA 4SLIA 4NPRA 5FYTA 4W6YA 2BWAA 3RJ2X 1EYBA 2FBEA 2HWE3 4KBBA 5IT6A 3BU0A 1VRH1 2AENA 5FO8B 1AYM2 2CTVA 1LOCA 1T2XA 5IK4A 4YWAA 1S0EA 1MQTB 2UWBA 3VDCA 5C8CC 2Q1MA 4W6XA 1H1AA 2OX0A 1DLCA 1SDDB 4CVUA 2PA7A 1WBLA 3I59A 2BP6A 3JUUA 4C1WA 1G8WA 1SCRA 4OQ9A 2JD9A 3WSOA 2VGDA 5DQ0A 1IG3A 1SACA 1OH4A 3POFA 3S5QA 1V9U2 4MYEA 5CG8A 3C3VA 4ASLA 2W95A 2KM2A 1WLCA 2NMNA 1UXZA 3PJQA 1AZDA 5FZ6A 4QX3A 4UXAA 4KBZA 4HANA 1IQAA 1VPHA 2CU5A 3WEZA 2WNVC 4JCKA 1W9SA 3INAA 3W5NA 2VG9A 3N7KA 1J83A 1BVP1 1HLCA 3RNSA 1US3A 4LBQA 3OGJA 3FFZA 4XFBA 3ZYPA 2YC2A 2ZX4A 3WNMA 2J1UA 4RHV2 2ZGMA 3IZOA 2XLAA 2ZS6B 1PIV1 3QH7A 5SV8A 1X82A 2Y0IA 4XBQA 2I74A 1KQRA 1PO13 4MSVA 2R062 5FP8A 4AEDA 3IIIA 2UY9A 4P9LA 1RINA 4CU7A 3ZN5A 2W68A 4ARYA 3AX4A 4Q8KA 1WD4A 3P5BA 2WIIB 1ZBE1 3KCCA 4N9HA 1R093 5BNNC 1COV1 5LA2A 1YHFA 4AI3A 4PBOA 3H1MA 3U11A 1RUF2 5EJ1B 4DUXA 1VJ2A 2VQUA 1BBT2 2WFF3 5D2AA 1H8TB 4R9CA 1EP0A 3PVBB 2IC1A 1N3OA 4YW3A 2TBVA 1MQTC 4IGQA 5FY8A 2HWF3 3IMMA 1H1IA 3LDBA 2YXSA 5FZGA 3TEZA 2GP5A 1RUI3 4KG8A 1WCDJ 5EIYB 2V4AA 1HDKA 4D8MA 1YWKA 3PURA 5A32B 3UESA 4GIQA 4WVZA 3UJQA 3MUY1 4ZZ8A 4LUMA 3SH3A 2XWJB 4JDOA 3PNAA 2HJIA 5FZEA 5FZIA 4JDMA 5L7OB 4Z92B 1R083 1VBC3 4LKSA 4Q0VA 3ON7A 1QOOA 2RS51 4I09A 1PX4A 3AM2A 2JENA 2RG4A 3WDVA 1GU3A 4E27A 4Z2AA 1KJRA 2ZMLA 4BQ3A 1NA1B 1O6UA 3FN9A 1NZIA 4NE9A 2G9ZA 3LA3A 4FFIA 3H3LA 4ATEA 2WKKA 2YGMA 2CAUA 5GZFA 2WA4A 1C57A 1NLSA 2ZX2A 1ND2A 5F6LB 2ARBA 4DUWA 2WQ4A 4E4SA 1QGLA 4WM8A 4CUBA 3AMHA 3DN7A 4FPGA 2IWGB 1N3QA 2Q1FA 3POEA 4FFGA 2DUPA 5CU1A 3SITA 4WM7A 3D5OA 1GOGA 1OKOA 3POJA 3AYDA 3IN9A 1RL3A 1VB2A 3LB9A 4HK8A 5KHJA 2ET1A 5CG9A 2HEVF 4AQ2A 5GLUA 3WDXA 4JV4A 5DZEA 5EXOA 2WAAA 1H8TC 4D7TA 5FFOC 2OIIA 3VBFB 3H7JA 4XW3A 3HR9A 3ZFGA 4CCNA 1W06A 2P1BA 1RUC2 4AK3A 1WW5A 1DQ6A 2IFWA 1O7FA 1XJAA 4MX3A 4PLMA 1GQHA 1RUH1 2QZ2A 3POSA 3PUSA 1QDOA 3VBHA 1ZZ6A 1LU2A 1MPXA 1A34A 3AK0A 3T0BA 3U07A 5FZ1A 4N53A 3DPRA 3KGLA 3NMBA 1LHOA 5F2WA 1HB1A 4LLOA 1TME3 4KG0A 5LBCA 5L7OC 1S0CA 1ZRDA 3V0BA 2YDEA 2AC1A 4FPCA 1RUG1 2D6OX 3OBTA 4IE0A 4Q4W1 3O0XA 2P37A 5E8AA 3THPA 3ZFEA 1V70A 3ZKYA 4A4AA 5KXEA 4V1PA 1AYM3 4C8DA 1CAVB 2FMYA 3BTXA 3FL7A 4KNCA 3I3EA 3ME2A 4XXAA 1X9TA 2LTNA 3VBUB 4MGKE 4K9SA 4O9EA 1T6BX 1NA1C 2BQPA 1NKGA 4BLIA 3Q8CA 1CAWB 3RVHA 2R043 3DGTA 3EHKA 4N43A 3T2PA 4YGDA 4DXZA 1QNYA 4BM8A 1ZZ9A 1V9U3 1U5YA 2KD7A 3W9AA 1F31A 3DXUA 4RFRB 3TEWA 2RDNA 1GWLA 2D3RA 1IS4A 4LBMA 3DEMA 3LOIA 1WGPA 1AX2A 4RR3A 3AVSA 5IFPA 4OVEA 2PQSA 4C1XA 4XQWA 2A70A 3DF0A 3TRSB 3CIHA 1JHJA 3DKWA 3MFCA 3PIGA 1IG0A 5A6ZA 4CDXA 4RHV3 2BUKA 2XONA 3VBFC 3IDEA 5FP4A 3AMMA 4GJYA 5FY7A 1SLAA 3U37A 1AYN2 2FCVA 3AKRA 1SLIA 4HT1T 4D6QA 1XBFA 2VR4A 4QKFA 4Y4RA 1HRI1 2OXBA 1UO9A 2QFEA 1LRHA 2MEV1 4HPKB 3BODA 2WLQA 1MEC1 2JDUA 2PXJA 1A6CA 5CKQA 1QJY2 1Z7S1 1XNDA 1LEMA 4Y1VA 3ZN6A 4QHOA 1RUF3 3AL6A 1ZA4A 2BGOA 1VAVA 1W6NB 3FE5A 1UYYA 2R072 3Q9OA 1ZA7A 4TYSA 3RI8A 5JXIA 1NT0A 1W3XA 3E6DA 3OD0A 5F3EA 5A3WA 2GMMA 4B1MA 4D3WA 3PMEA 4LT5A 4AL9A 3VBUC 1EY2A 2GC1A 3UV9A 4ISQA 3CJXA 2DCJA 1UF2C 1EAH2 1MS0A 4XBLA 3VKMA 4QXKA 3VZLA 3PUHA 1OQ1A 3NAPA 4XURA 3W21A 1S1AA 3WF2A 3AKSA 5FYVA 1FOD2 2VTXJ 3MPPG 5FZKA 1UZVA 1G9BA 4M4PA 3I3DA 5I0SA 1SLLA 1OVPA 5LK7B 1DIWA 3T2OA 3B3QE 2X5IB 2ARAA 4EWAA 5DUVA 3RZZA 4Z2WA 3PTRB 4PF1A 1S2BA 2Z42A
chains in the Genus database with same CATH topology
1L3JA 2ZHMA 3SISA 1W6PB 3M3QA 4S2FA 3WG4A 1DQ5A 2B42B 2XLGA 4URTA 4NOTA 4META 4XYXA 1O3TA 1YJKA 2DCYA 1FMD2 3CEWA 4IV1B 3LA7A 4AYUA 4FT8A 1YFXA 4HK9A 4GH4C 4JGZB 2JXAA 3AFGA 4XTPA 2HWD2 4OI1A 1CAUB 1DZRA 1VBD2 4Q1PA 1OA4A 2VW0A 3ETQA 4OZXA 4XF1A 2CV6A 4XEZA 2RS31 3HWJA 1RUC3 2P3JA 4S2GA 2ZGOA 5LEKA 3M3IA 1ULGA 2A6VA 5IK7A 2CGPA 4YVSA 4IEQA 1DG6A 2Q8OA 3I2DA 4M3CB 2ZGQA 1IS6A 2ZHKA 3NL1A 3WNXA 2KA3A 4YZ5A 4FO9A 3UJOA 4AEDB 1OPOA 1C4RA 4QQHA 3L9JT 2X5IC 2BWCA 1QJZA 2FZ2A 2UY8A 1OI6A 4IEPA 4LBJA 2H0VA 1RMU1 1XNCA 3LZZA 3RWNA 4BE3A 1AX0A 4MGIE 1BK1A 1O3RA 1QY4A 4MGYE 5C8WA 1UPIA 1A78A 4YGEA 3BOPA 1FXZA 1W2UA 4LHNA 4RSUA 3MF9A 4C0HA 5HCAA 4IV1C 1H1MA 2JG8B 3NV1A 4N7IA 4CDWB 3FC0A 4FTSA 4JGZC 1SLCA 2ZZJA 5IUQA 1W6OB 4Q0PA 3AKTA 4IETA 2GC2A 2G9GA 4ONUA 4B4RA 4Q0QA 3R6SA 2ZAHA 3EQEA 1C1LA 2CAVA 1AF9A 4R52A 1RTVA 1GZCA 2GU9A 4FPLA 4K21A 1OD5A 3DUIA 1ND3B 3VBOB 3B94A 3CJIA 4JGYB 5GZCA 2BTVC 4YW4A 1AR72 2JICA 1I5ZA 2CGNA 1TNRA 1LODA 1QJY3 3AZXA 4WVWA 5FPXA 1IKQA 4XF3A 4AFDA 4INDA 3B9IA 1AJOA 3MW4A 2AUYA 2ZAAA 4XJUA 4YW1A 1QJX3 3U0ZA 3BIWE 1DQ0A 3LCPA 2OUJA 4AEDC 5JZGA 4FTEA 2WSUA 5BPXA 2XBO1 2WS92 2DVAA 1ULEA 2PHLA 2XVGA 1EAH3 4FOVA 4A2UA 2WZR2 4AVAA 4JAAA 1PGL2 2GAUA 4CYDA 5HCFA 3NWKA 3A0KA 4QM9A 3WUDA 4TZDA 1TMF2 4XFHA 3BPZA 4YLZA 3VUOA 2JG8C 4R4XA 2ES3A 4CDWC 3E5XA 3OYWA 4LNVA 1Q56A 2GNDA 3NVCA 4M00A 3VL8A 3J8F2 4GQ7A 5DG1A 1PZ8A 2G9FA 4S2HA 4XBNA 2GN3A 3M70A 2E6VA 4H55A 3VKNA 4EV0A 1C5IA 3N3HA 1ND3C 1Q8SA 3VBOC 4JGYC 1A3KA 1HRV1 1FNZA 1Y43B 4GALA 4P9YA 3NV4A 4PQ9A 2HWD3 2VMGA 1QJU2 2WNUA 3MIEA 4AEMA 2RS12 1AR81 1RHI3 1VBA2 4OHWA 4FPYA 2GSYA 2XJTA 1EV11 4H14A 2WL1A 4CP0A 4BIFA 1BYHA 2ETEA 4XFCA 1Q8VA 5BNQA 3D82A 4CDQA 4QMAA 2JECA 4FP3A 4NN0A 5DDJ1 1ZZCA 2LM3A 2EAAA 2CYFA 5CB7A 1DGLA 2ZA9A 5L19A 4E9KA 2CL2A 1YIPA 3ZSEA 1CN1A 3M7AA 1OOPA 3ZYJB 4AI1A 1YYNA 3H3ZA 2Z2SB 3ASIA 3QD6A 1NCRA 1S0BA 1LULA 2B5HA 1JUHA 2BNNA 1YLLA 2VUAA 4WBBA 3IDCB 2HKXA 3O14A 5HXVA 2X53S 1HXS1 1W39A 5T5JA 1RUJ2 4GKXA 3WQ0A 5K7PA 2EXKA 1RUNA 1CAXB 1LCLA 4XIOA 3QH6A 1W6MB 3J9SA 1GZWA 1R091 1SQ4A 4AWDA 3D8CA 4JDNA 3GHNA 1PZ7A 1XYPA 4KWLA 1C8M3 3JB4C 1BCXA 5EYXA 2HWE2 2VY0A 4YM0A 2A73B 1AR73 4W6WA 3ENRA 4MV2A 4LE3A 4XPVA 1OFNA 5H9QA 2BFUS 3ALQA 2ZZQA 5T5OA 1GANA 4WV8A 5BNPB 2NQYA 3RI9A 3RDIA 1V6JA 1FV3A 3ZXFA 3AZVA 1GLHA 2GNMA 4E2SA 5FOJB 4OFGA 5TSWA 4AI2A 5GLZA 2PYTA 4LHKA 2YY1A 3WVJA 4S2DA 2VW1A 1QQP3 2PLV2 5AC91 4NWWA 2TUNA 5ABJA 3HD8B 4HSJA 1TMF3 4AF9A 3D0SA 3RRDA 4ZXKA 5C4WB 3OD4A 5J48A 1I1EA 3VHRA 2HWB1 4M0HA 2W08A 1IOAA 2MNGA 2WC2A 3NSTA 3J8F3 4L11A 3ZXKA 5DZGA 3E6CC 4ZU4A 5CVRA 1U5XA 2QE3A 1GQGA 1D4M1 3QACA 4PDWA 5FCCA 2GDFA 5C9AA 2LALA 2WFF2 2WA3A 4Y22A 2E7AA 3WG3A 4AW7A 2K9ZA 2XJRA 4IEWA 4OUSA 2MPFA 1H2NA 3ZXJA 1LOFA 4XILA 4B8EA 3FUQA 2W52A 4IEOA 3PMSA 1R1ZA 5CIRA 1MZ6A 4XQ4A 3JCIA 3PTYA 5BNPC 1QJU3 4Y20B 1MVQA 2HWC2 2RS13 3APBA 3VZJA 2VH9A 3M3EA 4RGAA 3E97A 2A5ZA 4J1XA 4Q2FA 1ASJ3 2EALA 1R082 1VBC2 2RMU3 2Q5TA 3UL2A 3LOBA 3KCXA 3ILNA 1KS4A 2BVVA 5J09A 1S55A 4F8AA 2B46X 3ZMOA 4QU2A 1URXA 2Q4SA 1SMVA 3P3PA 5C4WC 4FQZA 3ZFFB 4G9SB 4MXWA 5FQ0B 1MZ5A 3T1MA 4LBKA 1F5JA 5FRAA 3VBRB 5LRSA 2GC0A 5T5LA 2V5YA 4YARA 1H9WA 2ILMA 2WT1A 3LSEA 1WLTA 2CWMA 2ZHLA 3JD71 2K2SA 3JB8A 3WLUA 5JSOA 4MVTA 4N9IA 1EPWA 5D8AB 3UKNA 2XVKA 1AXZA 4I02A 1ZBA2 1N1YA 1VBE3 4IEUA 4KWJA 4BLJA 1V6MA 2AH2A 1R1A1 3NO8A 4I0BA 4COYA 2R061 1PK6A 1C5HA 4Q4V3 2ZACA 4GXLA 3SCHA 1YO8A 4I30A 3V0AA 2ZKNA 1REFA 3LAGA 4PBPA 5EJ3A 3ZDSA 4BIOA 3O7OA 1K5MB 3AYEA 4XJWA 1BBT1 2YC0A 1O4TA 4QM8A 2F6BA 3PVEA 5AFBA 2B8MA 1NCQB 1PHMA 2D98A 5I0RA 4FQ4A 4QPIA 3D6EA 4RQPB 4YG3A 2ENRA 5IK5A 2E7QA 3E6BA 1ENXA 1LOEA 2R042 4LO7A 2HEYF 3ZFFC 1AX1A 4OI4A 1VR3A 1APNA 2ZCWA 3VBRC 5C33A 5L36A 4AHYA 2ZHNA 5BNOB 3AZYA 5GALA 2DU0A 4NO4A 3USUB 4Q4Y3 3OCPA 3VZKA 4WVMB 2A7AA 2PLV3 2K0GA 2P34A 4CEWA 2RJKA 5D8AC 5K0UA 1DHKB 3EXUA 1M06G 1SFNA 3M4FA 1LKNA 1NXD1 2Z69A 1RUE2 1SLTA 4N90A 1H4HA 4QPGB 4XF0A 4COWA 3UK9A 2JG9B 4LO5B 5T55A 2VU9A 3ZYGA 2NPIA 3KMHA 4FPHA 4U2AA 5JDBA 5GKAC 3WP6A 1MZEA 1H2MA 4HZFA 3VLBB 1RITA 3WDYA 1W0OA 1AR63 3VBSB 1K5MC 1PVXA 4A7ZA 2BFUL 3AMQA 1DGWA 1D4VB 1NCQC 4QD2A 1HIXA 1CIWA 4FP2A 1LOAA 4RQPC 1CVNA 2VOXA 2D6KA 2DF7A 1DF0A 4Q4X1 2P3KA 1BEV3 1KD7A 4RL7A 4BA6A 1J1LA 2HWC3 4C0BA 3TB0A 4Z1VA 2N7GA 1RJ7A 3AZZA 4E2GA 2FQPA 3IWZA 1PO21 3RYPA 1H2KA 1BMV2 4BQ1A 5BNOC 1CQ9A 1GBGA 4M3CF 4DFSA 1B09A 4OHYA 3MEPA 1AR93 5E89A 3U10A 1CD3G 3O5SA 3JQWA 3E5QA 3E5UA 2XL9A 1TQ5A 4HVOA 3ZXAC 4QPGC 3ZN4A 2JG9C 4AQTA 1QNWA 4HN1A 4HKOA 1YFYA 1VBB1 1YI7A 4RS5B 3GBGA 1J3PA 5I0UA 3L2YA 2AR6A 2QZ3A 4CEYB 3BCWA 3WP4A 3QOPA 2YZ4A 2A75A 4EWDA 3WX5A 3VBSC 1RUOA 2I07B 3TN93 2B39A 2NN8A 4KGGA 5F9TA 1WA4A 1IPKA 3IPVB 4AE2A 2XWBB 1ZBA3 1AXKA 3FHIB 4GULA 5KC6A 2IXHA 1KJLA 2V09A 4AFCA 1PIV2 2ET7A 5I8TA 2TEPA 1AYN1 1J3QA 1REDA 4FOWA 4LO8A 5CFDA 2Z5WA 4E4DX 3CL1A 1ZVFA 2WWSA 1BZWA 4NWVA 3ZSJA 4AHZA 4IV3B 1QHDA 5F5QA 1ZBE2 5J96B 2A3YA 4HN0A 1DLLA 3M8LA 1AL23 4P9IA 2JE7A 2R071 2YROA 2NMOA 1NQDA 1ZYBA 4AVCA 3KS7A 4YM2A 4E4ZA 4UW3A 4JRLA 3MIHA 2IXCA 4ASMB 3OTFA 2DCZA 1XNKA 4LA3A 1PGW2 5J37A 4GMP1 1FOD1 2TNFA 2VOWA 5JIUA 4XETA 1LHWA 1AVBA 1SDWA 2WJSA 4RS5C 4BCUA 4CEYC 4LULA 4FPFA 1DZQA 2PN5A 1AUYA 4B29A 1V00A 4QHBA 4YM1A 3W59A 1RUE3 3MZHA 3SH5A 3G7DA 4AHWA 1CJDA 1FMD1 4I3GA 3WXPA 4J6GA 3M1HA 3JBG1 3AZWA 2DWRA 1WMFA 4IV3C 1VLNA 2ZMKA 4LO6B 1J1TA 4LR4A 5L73A 2ZBJA 4A3XA 4MXWB 3CF6E 1VBD1 4IQPA 2GALA 4XFFA 1QJX2 1RVF3 4AGRA 3VZMA 1XQNA 3MLLA 2C1FA 4AHXA 1PVC3 4CDUA 4XF9A 1NE6A 1ZX5A 2R32A 4XJ9A 1QH7A 3N36A 4D7YA 3MIDA 4R9AA 4FBFA 3RMXA 3HIFA 1W6QB 5LRRA 3R4SA 2PELA 4Z07A 2AGSA 4SBVA 4BMEA 4Q4W2 3J26N 4ES8A 1VRH3 3NJZA 5A33A 1O3QA 3FUOA 3OF1A 4YVWA 1KDMA 1M4WA 3KD4A 2YUEA 2DVFA 3NV3A 5FTTC 4CZSA 4XJ8A 4FPJA 5J3UA 4NHMA 4D69A 4PLNA 1FX5A 1LESA 1MACA 3OPZA 5HBAA 3VDDA 4FXGB 4A7YA 1NY72 2OVUA 3GZAA 3H1YA 3K48A 2I2SA 4H7LA 3ZXGA 5CFCA 3MIGA 5LEJA 5DUWA 3I59B 3FJSA 1SBEA 1S0DA 4K8FA 4M0NA 5FAXA 3AP9A 1KFXL 1NG0A 1JUIA 3NKGA 3DL3A 1Y9QA 4UW4A 4YNIA 1QOSA 1RHI2 2HYKA 1HQWA 1PIV3 1YUDA 1TEIA 2XKOA 3S7IA 3N4MA 2ZMNA 2NLRA 4PJYA 3AJYA 1IZ3A 2RM22 3WHTA 1DGWX 1DQ4A 1HRI2 2CNAA 4P14A 3VGIA 4LBQB 1Q8QA 2FZ1A 4W65A 1MEC2 4RD7A 1IGOA 1POV1 1ZBE3 3H9AA 4QGLA 1D2SA 1COV3 5JOWA 4P9WA 1FPN1 3AYCA 1WBFA 1QU0A 2XJVA 1AJKA 3B69A 2X8KA 1G86A 2WS91 4RGGA 4X6RB 4R8HA 4B7KA 3HQXA 3N7JA 1LHUA 3A4UA 2XJSA 5HI0A 3AKPA 2WZR1 4K1ZA 3WINE 4HMZA 2D97A 4EROA 1A8DA 1S0JA 4DINB 3H50A 1QKQA 3H3UA 1SFYA 1LJ7A 4K40A 4GWMA 1MR5A 1XYNA 1S2KA 4HKWA 1B35A 1XYOA 2JKBA 3WQ7A 2VOVA 4XXPA 2GMEA 2RJLA 2RS53 1JHNA 2R16A 3GF6A 4EN8B 3WW2A 2OUHA 4NR1A 4A7KA 2UYBA 3RYRA 3KSCA 4CP2A 1C8M2 1D0HA 4M3CE 3H8UA 1CPMA 2EAKA 1S0IA 2R6QA 2P17A 3GBWA 1SBDA 4ZU5A 4BHPA 2BBVA 3R05A 5H9PA 2DFCA 4OUMA 1LGCA 4I0WB 1WMDA 2Q0AA 5EWSA 4QQPA 4J1WA 2QJVA 5FO7B 2AYHA 4LA2A 4FOYA 1OA3A 5C8CA 2VVFA 1LEDA 1PM7A 2ZPXA 1ND2B 1WLDA 1VBA1 2YGLA 3JU9A 3ZPYA 1OQEA 4R9DA 4WM8B 5F6KA 4MGZE 4COVA 2ARXA 3AP4A 4FXKB 3ZYRA 4WM7B 1RGSA 2DUQA 4QQ2A 1RUH3 3PLQA 1QQP2 1QWRA 4N7UA 4BH9A 2D43A 4OHVA 4Y5Z0 1NOVA 4TLFA 2WNVA 3K51A 2YYOA 3JZVA 4DY3A 3ZFGB 1WCSA 3OY8A 4LHLA 4Q4W3 1RUG3 4DMIA 1EPZA 1IHMA 2XPJA 1Q5OA 4XOGA 3VBHB 2QQPA 4FVVA 5ACA1 4IEYA 4AVSA 2RHPA 2WT0A 4N53B 4DZGA 2RR11 3DPRB 3R4DB 1N1TA 2C0ZA 4MH0E 5LK5A 1VIWB 3V0BB 4EN6B 3SNMA 3ZFEB 5JI9A 2Y38A 4FPKA 3TOJA 2ZGTA 5DUXA 5BNNA 5FBZA 1QXPA 3O12A 1CX4A 5GM0A 1RUJ1 3WDUA 4AXOA 1UU4A 1H0BA 2UU8A 3AYAA 5AVPA 4EN9B 3KB5A 4GB31 3ST7A 1YXWA 1DYKA 1XNBA 1GNHA 4N43B 1MQTA 1MS9A 1RB8G 4CRQA 3THTA 1DZTA 1ND2C 3RS6A 3S30A 2IXKA 5J98B 1UMZA 1NXMA 5EV7A 4WM8C 3HT2A 2D93A 2HWE1 1ZZ8A 4KWKA 1ASJ2 3SH4A 4YSFA 4RR3B 1VP6A 1IPJA 1MS3A