3WDVA

The complex structure of ptlic16a with cellotetraose
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
298
structure length
298
Chain Sequence
EFYHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGEIDIIEGVNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKFNAQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mutagenetic analyses of a 1,3-1,4-beta-glucanase from Paecilomyces thermophila
pubmed doi rcsb
source organism Paecilomyces
molecule tags Hydrolase
molecule keywords Beta-1,3-1,4-glucanase
total genus 73
structure length 298
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wdvA00
1ULCA 1LCLA 1APNA 1ENSA 1JXNA 2UURA 3N7JA 4GKYA 4K20A 4YGBA 5JVVA 1WLCA 1QOOA 3VKMA 3BOPA 1JYCA 4UW4A 3GALA 3NWKA 1UX6A 2AYHA 3VKLA 1UAIA 4PQ9A 4YM3A 1G86A 1X50A 2YV8A 1SLCA 3APBA 3N7MA 3WCRA 1MS8A 2ZGMA 2Z42A 2ZHMA 1FV3A 1LTEA 4YW1A 4BLJA 3AYCA 2D3SA 4C1WA 1LHVA 1W6OB 3USUB 4AVVA 4Q27A 4Y22A 1VALA 3WDVA 3ILFA 1AJKA 1DGLA 2A70A 5GLWA 3WDTA 3VUOA 4XTMA 3TB0A 5JOZA 1KDMA 4Y26A 3V64A 1ULEA 2EXKA 4ISQA 3AP4A 3T1LA 2A3WA 3WZ1A 4TZDA 2GMMA 4YZ4A 1ZA4A 4FPFA 2WKKA 2P3JA 3FUOA 3SH3A 5KXDA 2DURA 4GA9A 1G8WA 5E8AA 1N47A 2WLQA 2YMZA 5JDBA 4JRAA 1KDKA 2VH9A 4YW2A 1C1FA 5T52A 2YY1A 2Q5TA 1GKBA 5T5JA 2DU1A 1ZM1A 1JYIA 1A3KA 5HCBA 2TEPA 3A0NA 3M1HA 3WUDA 3D4KA 3FLTA 3WHTA 2CYFA 2PHUA 3B9CA 3A4UA 1FAYA 4Q1PA 1I3HA 1DLLA 1LHOA 1Q8QA 2R1BA 5JOWA 5KXBA 4P14A 2E51A 4YW5A 3V0AA 2A6VA 2VUAA 4XBNA 1B09A 2YROA 1PZ7A 3JUUA 2AH2A 3PJQA 4FOVA 2JKBA 4LBJA 2W39A 5IK7A 1ULFA 1S0DA 2VW0A 4HL0A 2A6XA 1BJQA 4R9CA 5GZFA 1G9CA 2B7YA 1SBFA 1S0IA 4GKXA 1UKGA 1MZ5A 1WW7A 1FX5A 2ZZJA 2P3KA 4DPNA 5IT6A 2VY0A 4F83A 1FNYA 4XDQA 4PF5A 1MVEA 3O5SA 2ZGKA 1GV9A 4FQZA 2D44A 3HMYA 4AVTA 1Q8VA 5CB7A 1C4RA 1DBNA 1S1AA 1VLNA 3FLPA 1D2SA 3FLRA 4XE9A 4Y1YA 1LOFC 4YGCA 3AZWA 1U0AA 1GYKA 1S0JA 2AUYA 3FFZA 1V6IA 4P9XA 4Q8LA 1F9KA 3IKWA 4Y20A 2D6OX 2XB6C 1JW6A 1Q8PA 3UK9A 1WD3A 1N1SA 2P34A 1G7YA 1LHWA 2A5ZA 2ZHKA 4WVWA 3I4IA 1LOCA 4YZ3A 5HCAA 4YM2A 1F31A 4D69A 2UWCA 1CIWA 4GWNA 5H9RA 1PZ8A 2D6NA 1CR7A 1LU2A 3ZVXA 1JHNA 2GMEA 2ERFA 3BTAA 2WT1A 2EF6A 1IOAA 1HQLA 1O4YA 1V6MA 1GLHA 2D6LX 2XG3A 1Z78A 3L2YA 4XJ8A 3H0OA 4Z8BA 1AX1A 2DTWA 3SH5A 4XJWA 4ATEA 3AK0A 3C2UA 2ZMNA 1YXWA 4JC1A 1W6QB 5SV8A 1W6QA 5DUUA 3V65A 1WW5A 2KM2A 2OW4A 2SLIA 1V6OA 1DQ5A 5FRAA 1O4ZA 2VW1A 3M3EA 4FVVA 1LU1A 3AXDA 2JD4A 2H0BA 2WT2A 4M3CE 4UW3A 2A6YA 1SBEA 1S0FA 2CWMA 1YO8A 1JN2P 3A0KA 4XJAA 2CTVA 3O0VA 1LEDA 2PHXA 1G9DA 1LECA 1S0CA 2BQPA 4K1YA 5DZEA 4LBQD 1W6PB 1CQ9A 1LENA 5GJ6A 1LULA 3MEPA 3IM0A 4GWMA 5DUWA 3T2TA 1MVQA 4U36A 1QKQA 5EYYA 1SLAA 3RS6A 4Y1ZA 2GNMA 5GALA 1N3PA 4H55A 1KRIA 1AXZA 2P3IA 3IN9A 2ZHNA 2WSUA 3OY8B 4YGDA 5CA6A 4FPHA 3BIWE 3ZXLA 4XJUA 2A3XA 2ZACA 5EXOA 1CN1A 2VU9A 3AJZA 2JECA 1HQWA 1H9PA 3MW2A 5T55A 2YZ4A 1LOGA 4HANA 5DZGA 1W6MB 1V6LA 1V6KA 2EALA 1GNZA 1YIFA 1BZWA 2EIGA 1AF9A 3POYA 4ISRA 1G9AA 1RIRA 4TYSA 2P37A 1QF3A 1SLBA 2D7FA 4DFSA 2CY6A 3AZYA 1UN1A 3N7KA 1RINA 1V00A 1JBCA 1HLCA 1GZ9A 1N3QA 5JMCA 3V0AB 2ZABA 1S0BA 4Q1RA 5CNAA 1W6OA 4AWDA 2E7TA 2FHRA 1Q8SA 5EYXA 4YW3A 5IUQA 3RMXA 1F5FA 1OKQA 3FUQA 2EXJA 4XIKA 4YZ2A 3BODA 3N7LA 4XJ9A 4M3CF 1DZQA 1DQ1A 1UPSA 2ZGQA 3PVNA 4Y1VA 3WLUA 4LBQA 4XJZA 3USUA 5T54A 2OUHA 3VKNA 3INAA 1R1ZA 1S0GA 2ZMLA 3POWA 4LBMA 3KQRA 4R9BA 2PHRA 3ZXEA 1IKQA 3M3CA 2DVDA 3ZYRA 3JU9A 4PCRA 1IKPA 2GNTA 3HN1A 1ONAA 2DV9A 4CZSA 3DUIA 4R9AA 4FPEA 1BKZA 3NV4A 3R05A 1V6NA 5HCFA 1DIWA 2AGSA 5GZCA 2ZGSA 4FOQA 2NN8A 3NV3A 5DG2A 3CNAA 3ZPYA 2JDZA 3FBYA 4YFWA 5L73A 2VW2A 3WCSA 1H30A 5DG1A 1FV2A 2SBAA 3AYEA 2JE9A 4R9DA 4NO4A 3IMNA 2GN7A 1SBDA 1LEMA 2ENRA 2NYYA 5GLTA 2D6PA 3M3QA 1DQ4A 4XYXA 3SITA 2DTYA 2ZA9A 4YLZA 4YM0A 4YZ5A 1WW4A 4FOYA 1W0PA 3ZSMA 1KJRA 3ZXFA 3ILRA 3WNXA 2E7QA 4XILA 3IPVA 4FPYA 4BLIA 4XTPA 1ENRA 2I2SA 2UU8A 3WUCA 1WBLA 2PHWA 2GNDA 5GLUA 1GZCA 2R49A 1WLWA 4DRRA 1HDKA 2OVUA 4Y1XA 4AGGA 2DUQA 5T50A 3MW4A 4CRQA 1VIWB 3ENRA 2R0FA 3ATGA 1AX0A 1W6NA 1CESA 2VXRA 4BOWA 3R4UA 4LBOA 1CJPA 2A75A 2GDFA 1LJ7A 2D6MA 2GALA 5CBLA 4XBQA 1LGNA 1MZ6A 1WD4A 2NZ9A 4BQ1A 1MS9A 3MPPG 2R16A 1Q8OA 3PMEA 2ARXA 2ZGNA 3OYWB 5GZGA 4XXAA 3LCPA 5T5OA 4FQ4A 4M3CA 1YRZA 3OPZA 1FNZA 2ZMKA 4ITCA 1UMZA 4WZFA 2PELA 2DUOA 5JOYA 2DVFA 4Q2FA 4FPKA 1H9WA 4YG3A 2WT0A 3N36A 1IS5A 2CWSA 1DQ0A 1WW6A 2E6VA 2EXHA 2W08A 4M00A 1LOBA 3WG2A 1G9BA 3B3QE 2WSVA 1A8DA 1DYPA 5LK5A 3RSJA 4FP3A 3B69A 1QDCA 2E53A 3WDYA 1OFSA 2WQZC 1CPNA 1QNYA 4XHBA 5IK4A 4DQAA 2EXIA 2R1DA 3AXEA 4FP2A 1D0HA 1WLDA 2A3YA 4WVVA 1AJOA 1SLLA 2YXSA 1QU0A 2ZGLA 1IS3A 1MR5A 2C9AA 4FPCA 4YG0A 1V6JA 4M3CB 3AJYA 1DQ6A 2AENA 2D6KA 3AP5A 1AVBA 2DUPA 4XHXA 1KJLA 4UW6A 4C1XA 2V73A 4Y22B 1YI7A 1AXYA 1N3OA 2UWBA 1EPWA 3OBTA 3RRDA 1KITA 2OUJA 3SISA 3VKFC 5JLVA 4MYEA 1SACA 3WDUA 1XQNA 2GNBA 4GALA 3NV1A 2NM1A 2FMDA 1MS0A 1FATA 2DYCA 5GZDA 2LALA 1SCRA 2G4IA 5E88A 1GNHA 3WG1A 5T5PA 3I8TA 1UZZA 4AGVA 5GLZA 1GZWA 4PBOA 5DUXA 1QNWA 3UL2A 1W0OA 2DVAA 3ZXKA 3DGTA 4M01A 3M2MA 4ZKTB 4AVSA 2ZHLA 4UW5A 3TAYA 1SFYA 2EAKA 1N1VA 2D3RA 2HYKA 1MS3A 3D5OA 1LESA 1MS5A 4Q8KA 1LHNA 3AYDA 4PBPA 1VAVA 2UWAA 2A7AA 2W52A 3OBRA 5H9QA 3T1MA 2WNEA 4AGRA 4Q26A 1W6MA 1CPMA 1W6NB 2D3PA 3OY8A 4DRVA 4Y24A 1AZDA 1CVNA 2JJ6A 3ZSJA 1CONA 4K21A 1IS4A 1SCSA 5IK8A 4P9YA 1YYNA 3AP7A 1G9FA 3ASIA 3AZXA 2WJSA 4FPLA 4XXPA 1LGBA 3M3OA 3ZSKA 3WG4A 1IS6A 1BXHA 5GLVA 3UJOA 1GICA 1GZWB 3AZVA 1DYKA 3O12A 3POSA 5DZFA 2PHFA 1WBFA 4Y20B 1W6PA 4XOGA 3OJBA 1NLSA 4ASMB 4Y1UA 2A6ZA 4L8QA 4I30A 3WHUA 3LSDA 3RMYA 3QLQA 1UL9A 3OYWA 5AVAA 5GM0A 5GZEA 4NOTA 4CTEA 2DU0A 2GMPA 2ZKNA 2W68A 1N1YA 4ATFA 2ZGTA 5IK5A 2RHPA 3AP9A 3NV2A 4ZXKA 1SLTA 1QGLA 1LOFA 2ZGOA 1NXD1 4YM1A 3V0BA 3R4SA 4RA0A 3N35A 5DUVA 3HR9A 3V0BB 1GBGA 4DS0A 1LOEA 4OZXA 3ZYPA 2ZBJA 2DWRA 2JE7A 2ES3A 1C1LA 4YGEA 1AX2A 2V5YA 1C57A 1UZYA 2NMOA 4FPGA 3VKOA 2PHTA 3ILNA 1I1EA 4BM8A 3U4XA 1DFQA 3PVOA 2GN3A 1JOJA 1JUIA 3AX4A 4YFZA 5E89A 5JOXA 1MS1A 4RL7A 5F9TA 1BYHA 3D6EA 3GNEA 1HKDA 1QMJA 1WUVA 4P9WA 2NMNA 1S0EA 2CNAA 4GXLA 5EWSA 2ZAAA 2A71A 4FOWA 1Q56A 1VAMA 1DHKB 3O0WA 1A78A 1QDOA 1Z0HA 2AREA 4XMAA 3SLIA 1GANA 4JCKA 4YZ1A 4K1ZA 2ARBA 1Y7BA 3Q9OA 3OGGA 4FPOB 1ENQA 3ZXJA 3PVEA 3WV6A 3KM5A 4LBQB 1MS4A 3N3HA 2NP0A 2P2KA 4FPJA 4LBLA 3WDXA 4LBNA 3IPVB 1SLIA 4LBKA 1LGCA 2DVGA 3WDWA 3VV1A 3AP6A 2AR6A 1J1TA 2D43A 4YG6A 3W59A 1N1TA 5H9PA 2C5DA 3B01A 3SNMA 1QOSA 4U2AA 1AXKA 5KXCA 1QOTA 1OQ1A 5H9SA 1FYUA 1DQ2A 1URXA 3WOGA 3ZSLA 4BPZA 3RG0A 1LOAA 3AZZA 1BQPA 4SLIA 3AFKA 1LHUA 4XZPA 3WG3A 5BYNA 1ULDA 2ZGRA 4BMBA 1KQRA 4AYUA 5T5LA 3LSEA 1ULGA 4W65A 4YW4A 4WV8A 4KBBA 3WVJA 2CL2A 2LTNA 2A6WA 5KXEA 4XIOA 1MACA 4XBLA 2ZGUA 4XMIA 1WCSA 3AYAA 3SH4A 1RITA 2R0HA 3O0XA 1GSLA 3W58A 4BMEA 1LODA 3RQ0A 3UJQA 5CAZA 2DVBA 4IQPA 5DXDA 3MW3A 3QCWA 3B00A 1TEIA 5F5QA 2ZGPA 5FREA 1PZ9A
chains in the Genus database with same CATH superfamily
4MOAA 3ZFFC 1LKNA 1W03A 4GKYA 1RJ7A 3TN92 3ZKYA 3VKMA 2HYXA 1QEXA 5C5UA 3BOPA 1JYCA 3LF7A 4FCAA 4UW4A 3T4HB 3ZFFB 3THDA 2PHLA 1UAIA 1CAXA 1G86A 4BH9A 1VRH1 3K4DA 3D0JA 3HBZA 2CDPA 2XH6A 1NUKA 3WCRA 2O14A 3ZOIA 2ZHMA 5A6ZA 1V9U1 1X36A 3H3LA 4AI3A 1FV3A 1LTEA 3D0SA 4YW1A 1PVC3 4C1WA 1JZ3A 1W6OB 1H6YA 4AVVA 3NKGA 2QKDA 4Q27A 3CJXA 4Y22A 3WDVA 2WNVB 4Q4X2 4RSUA 5I8TA 4HVRA 4QQLA 4CCMA 3TB0A 5JOZA 5EJZB 1ZRDA 2IXJA 4QXHA 1H1MA 4Y26A 2BBVA 2WQ4A 1ODMA 3V64A 1CWPA 3DPRA 2XJRA 2X09A 4NWWA 4ISQA 4LNVA 4MHUA 3VBHB 1HX6A 3VZOA 5I91A 2GMMA 2Z79A 1ZA4A 2R062 3KV5A 3H3UA 4HT1T 4IEPA 2ZEXA 2DURA 4H7MA 4AAXA 4COYA 2X53S 4GA9A 1G8WA 1XNAA 2ARCA 2WLQA 3MLJA 2YMZA 2ETEA 3PTYA 4B4PA 4CDXA 1A8MA 1KDKA 4YW2A 2PMWB 5IW0A 1NA1A 5T52A 5FP4A 2HJIA 5T5JA 1RHI2 3W21A 4ZHNA 5FY7A 3A0NA 3JD71 3M1HA 5J3UA 2Y64A 3WXPA 4YSFA 1TZOA 3ACFA 4RR3A 1GOFA 1FAYA 3LQCA 3MLLA 4QPIC 1XNCA 1I3HA 1DLLA 2CAVA 1UZ0A 5BNQA 5C9AA 3BKZA 2BGCA 2R1BA 5KXBA 4P14A 2E51A 3VHNA 1H8VA 1HRV1 1UCXA 1YFYA 4XBNA 5EFUA 3JUUA 3NQHA 2OT7A 4CEYA 1A34A 4FOVA 4LBJA 5IK7A 4MSVA 4HL0A 5FPUA 2TUNA 1XYPA 2A6XA 2W1WA 3GCWA 1VE0A 2GC0A 2HWC3 2B7YA 1NAEA 2C6SA 4GKXA 2PAMA 5FY0A 1UKGA 3I2GA 4F83A 1FNYA 2D93A 4A4AA 4CDWB 4PF5A 3THCA 1MVEA 2ZGKA 1GV9A 2D44A 5C8CC 1HJFA 3GJAA 3HT1A 3MIHA 1A6CA 1Q8VA 2PTMA 3N9PA 4XDPA 4B29A 4DXRA 1JZ6A 4ES9A 3KV9A 3UKVA 5B2GB 5C70A 2OXBA 2AUYA 1V6IA 2PQSA 1I5PA 3D3AA 1E5SA 1AR81 1QJY2 3UK9A 5A7QA 3T0AA 1N1SA 2A5ZA 1LHWA 1VR3A 4YZ3A 1BBT1 1LOCA 1RUG1 3U07A 1F31A 3IMMA 3ZN6B 3ZYJB 4YVWB 5H9RA 4D6RA 1PZ8A 2Z69A 4LK7A 2MEV1 1LU2A 3ZVXA 2GMEA 3X29B 1GFF2 1TNFA 4XUTA 4RGAA 2EF6A 1V6MA 2BTVC 4GAZA 5B4NA 2D6LX 5HCHA 1PIV1 2XG3A 5A3OA 5D8AB 4AOCA 4Z8BA 1BEV3 3FHQA 3UESA 5BNPC 2OX0A 2BEOA 2PA7A 1QJU3 4XJWA 5IHRA 3DEMA 1X33A 2BNNA 4LOTA 1WW5A 3CU7A 2JDHA 1O4ZA 4FVVA 4NAMA 5HXVA 1SZBA 1TVGA 3AXDA 2HWB3 3GDBA 5FMOS 3MLKA 1EV13 3TN91 2VGDA 1JZ7A 1JN2P 2VTXJ 3A0KA 5FY8A 4AEDB 2CTVA 2VPVA 1J58A 4S2GA 3THTA 1J3PA 2PHXA 3D82A 3HQUA 2JE8A 5DZEA 3CF6E 2RJLA 4HKOA 4H7LA 2QUOA 3WX5A 3HPNA 3T09A 4K3UA 1QKQA 3RS6A 4P9LA 5GALA 3TEXA 1RUJ3 2Y6HA 3IAQA 3LFMA 1D4M3 3HWJA 1KXGA 2WNOA 3FHAA 4I02A 3IN9A 2F4PA 2ZHNA 2JDAA 5LBBA 4BZ4A 5CA6A 3BIWE 3SKVA 3KT1A 1NT0A 2A3XA 1CN1A 5FKCA 1W3XA 1HQWA 2VAUA 2WZR1 4GMP1 1H4GA 2CGNA 4HANA 3EJKA 4XABA 4PJYA 1V6LA 3POYA 1YIFA 4R4ZA 1BZWA 2EIGA 4OUEA 1CJDA 1RIRA 4XAEA 3SCHA 3DF0A 4XUNA 2D7FA 2Y0OA 3T2PA 4W6YA 3PUIA 2WNUB 2JD9A 3VN4A 3VZMA 2VTXA 4E4SA 1V00A 1GZ9A 1COV3 1N3QA 1SPPA 2FCUA 1X82A 2X29A 2ZABA 3KCCA 3LKJA 5CFDA 5F37A 3ALQA 5ABJB 3VBRC 5CEHA 1YQ6A 4AWDA 4QX2A 1IPKA 4YVWC 2VBPA 1GUIA 2Q30A 3FUQA 3UYJA 2ZJCA 4IESA 2IXIA 3AL6A 5FXXA 1DQ1A 1UPSA 2WFF2 2ZGQA 4Q0UA 3POBA 1UO9A 4Y1VA 3WLUA 3PIGA 2BVBA 4LBQA 4XJZA 2O1QA 2X05A 3RJ2X 5FK8A 5FOBB 2OUHA 4RFT0 4N43A 1HXS3 5FPVA 5F39A 2R6QA 5A3LA 4K6BA 3KQRA 4LBMA 2PHRA 3M3CA 3OEBA 1TE1B 3JU9A 4LA2A 4LO6B 1GP5A 3NNJA 5C4WB 2DV9A 4N43C 2XBO2 4CUAA 1Y4WA 5JZGA 2Y38A 3VZNA 4AI9A 2VOXA 3R05A 1HN1A 5FZKA 3CJIB 5HCFA 2VOWA 2BYVE 2ZGSA 4FOQA 4GB33 4QD2A 4ZONA 2NN8A 3NV3A 4XW3A 2JDZA 1VBC2 2IXCA 3RVHA 3MYXA 3GZAA 5L73A 3I2JA 1FV2A 3GM8A 5DN2A 2JE9A 3M7AA 4R9DA 4A7ZA 1YFXA 2GN7A 1V0AA 1H2MA 4GQ7A 3M3QA 3PUAA 5IVYA 3VD7A 4EE2A 1XXNA 2Y6KA 4XYXA 2FBEA 3SITA 1F8VA 1GP6A 2ATFA 2BJSA 2HWF3 4FOYA 3HAGA 5FZ4A 1KJRA 2WABA 2WWSA 2HWE1 3KHBA 4HN0A 4NUBA 3K46A 3WNXA 4RN5A 4ZZ8A 2JDPA 2UU8A 4QX8A 1WBLA 2FMYA 2PHWA 4RQPC 2K9ZA 5J48A 5IJRA 1UYXA 1GOGA 4LPLA 3ZDVA 4Y4YA 4DRRA 1HDKA 4Y1XA 1SDDB 3K2OA 4IV3B 4IV3A 2Y60A 3KV6A 4YRDA 5D8AC 2VNRA 2ZEZA 2PHDA 1NX9A 2G19A 3J7MA 4BOWA 4LBOA 2A75A 1R64A 2V5DA 2GDFA 3I3DA 3ON7A 4LHKA 4IV1C 4INDA 1S55A 1LGNA 2B9UA 2VMGA 3OPTA 2G1MA 4KWUA 4Q4V3 1XSRA 3ZFEC 4LKDA 3PMEA 4LE3A 1PGL1 2WWUA 2ZGNA 5GZGA 2BP6A 3CO2A 4F3JA 4D94A 1YRZA 1NCQB 3C7OA 3JQXA 3Q8BA 4WZFA 4COUA 3BOWA 5JI9A 2JEMA 4R8HA 2XJVA 4OVEA 3ZR6A 1H9WA 5F7UA 1L7QA 4V2WA 3AMNA 3N36A 4CXYA 2E6VA 3O1RA 2EXHA 2JIJA 4A6OA 5KC6A 1UY0A 5LK5A 2Y0IA 4M4PA 1QDCA 3WDYA 4LORA 1W05A 2WQZC 3PLQA 2AACA 4XHBA 4RS5A 4IXLA 3WF3A 5I0TA 4I2OA 1D0HA 3F95A 1JYVA 1WLDA 4XCBA 4IGOA 2QDRA 4HLTA 1QU0A 4NIHA 1FPN3 1TMF3 2WYSA 3TEYA 2VQ0A 4WM8C 4A41A 4JDNA 4M3CB 2HWF2 3Q8EA 3S0MA 4UW6A 3KGZA 3AL5A 2V73A 4Y22B 4EYUA 1EPWA 4PI0A 3VKFC 1KITA 4BDVB 5FO9B 1AR93 4MYEA 3FN9A 2R061 3NNFA 3NV1A 3PUQA 1VRBA 3DCQA 5F8PA 2FMDA 1WCKA 5A32B 3NRUA 2BPA2 5GZDA 5K8SA 3GZEA 1SCRA 3ZN6A 1C8M2 1PK6B 1QJZA 2WYFA 4PDWC 2GP3A 4QX1A 4EN6B 5J36A 1GWKA 5LY1A 2PAEA 3ZXKA 3JD72 3K4AA 4M01A 1W9WA 5FBJA 5FWEA 4BQXA 4COWA 2RMU1 4MLOA 5F1RA 4OLLA 4NMIA 3TAYA 2D3RA 1JU3A 3D5OA 1H8TC 1US3A 2DCKA 4Z82A 4XF0A 3AYDA 4PBPA 1VAVA 4AGRA 1H1AA 4LO8A 1B35B 3ZYHA 1TME3 1B35A 1VB2A 4NHLA 1D2QA 3TRSB 5HI0A 2UYAA 2VVFA 2BBAA 3OY8A 2YGMA 4Y24A 1ND3A 2ZZQA 1ZRRA 2HBTA 3U4SA 3SMHA 3AP7A 2ZS6B 1G9FA 3VD9A 2WJSA 4AQSA 1PNGA 2W0XA 4CDWC 1VBC1 3UJOA 1Y3TA 4KI5M 1PIV2 5FZ6A 4D3WA 5CFCA 1DYKA 3KVAA 3POSA 2D98A 4MADA 2PHFA 4TSVA 4Y20B 3OJBA 1NLSA 3RI8A 4Y1UA 3WNKA 5CFCC 3QLQA 3GBWA 5GZEA 1VBB1 4IGQA 4FFFA 5AFEA 4HONA 4NOTA 1ZVFA 4G9SB 1PX3A 1XE8A 1OLRA 1PO23 1VPHA 2ZGTA 3M4FA 2RHPA 5F3EA 4GIQA 2B4KA 1BCXA 2RS52 1RUH1 3LEMA 4ZXKA 2O0OA 4V2VA 2VCAA 1CZTA 4QQHA 2CU5A 2H6CA 5FZAA 4JKKA 2BVVA 1ZZ8A 4PIXA 4AQ6A 1ZBA1 2VUCA 3I2HA 1GBGA 5IAVA 3W5NA 2XL9A 4HOOA 1RUD3 2W91A 1Y9QA 1K3IA 2ES3A 4Y33A 1C1LA 3CZJA 1EUTA 2V5YA 4A42A 1JU4A 1UZYA 3BI3A 5FCCA 4AHZA 2VZRA 2W1UA 3C7HA 4PLMA 4E4HA 1WZXA 3VZJA 2XXZA 3JZVA 2DFCA 1MS1A 3KCXA 2YHJA 3GNEA 2P6CA 1HKDA 2AZ5A 2CAUA 3LOIA 2CNAA 3MBWA 2N7GA 4LULA 4QQOA 2A71A 5EWSA 4FOWA 1RGSA 5FQ0A 1PGL2 3WNLA 4BIOA 1GU3A 3AKSA 5A32A 1OFNA 3BIEA 5F3GA 1R083 4N90A 5FLHA 3WW4A 2KD7A 4AVAA 4FAGA 1S4CA 3WV6A 1UYPA 3OUIA 1O3SA 1VBA2 2IFWA 3KT7A 4TWTA 3RZKA 4PF1A 2I07B 2NP0A 3HNYM 2YPDA 1RUI1 4LBLA 3WDXA 5A1AA 1XYOA 3MPBA 1SLIA 4HK8A 2VMFA 1CX1A 2I45A 4Z1VA 2XVGA 2DVGA 3VV1A 2WFPA 3HNBM 4DZGA 3KQ4B 4OZOA 3BPZA 5AC93 5H9PA 3DYPA 3B01A 3RWKX 1AXKA 2HWE2 4Q5OA 2JG8C 5FMOL 5H9SA 3P6BA 1DQ2A 1FYUA 5ERLA 1QQP2 1ND2C 4AEDA 3AZZA 3O1TA 2Q4SA 2O8QA 1LHUA 4GMP0 4QMAA 3HNMA 3LGRA 2B39A 4F7ZA 2QQIA 2WA3A 4BMBA 5FZ1A 5A7PA 2VO5A 4ZPIA 5FY5A 4JGZC 1ULGA 3I3BA 4LKFA 5DPNA 1MEC3 2EAAA 2XWBB 4O61A 5C5TA 1ZZ9A 2ZTNA 1OC1A 5KXEA 4XIOA 3IDEA 1MACA 4XBLA 2ZGUA 5FMBA 4LUKA 3R6SA 1QXRA 3RYKA 1RITA 1NG0A 5A6XA 3EQEA 5F3IA 4QB2A 4LR4A 4QQ2A 4D7TA 1MQTB 1OKOA 2WNUA 1VBD2 1RMU1 2Z4FA 4CDXC 4B8EA 3OGJA 3U0ZA 2ZGPA 2PFWA 1JMUB 2P4EA 1APNA 4DIQA 5KHJA 3N7JA 2C24A 4PT6A 2WN3A 5JVVA 4UYBA 1W39A 2JDUA 4BU2A 1W2NA 3NNMA 3POGA 4QKFA 3H50A 1ZBE3 3NWKA 1UX6A 2VBBA 5EV7A 3VKLA 4ZXEA 5FP7A 3N7MA 3APBA 1MS8A 4X6RB 3VBFC 5JR7B 3C8XA 4KL1A 2D3SA 3MICA 3LB9A 3QBQA 4HVQA 2ZX3A 3IB3A 4CDQC 2WR9A 4XTMA 4IEZA 3LAGA 3ZFEA 4KQ7A 3TWIA 5DAQA 5FZOB 1M06G 3BN6A 1ND3C 1J84A 1HB4A 3J7HA 4PQQA 3AP4A 4BCUA 4HG6B 2A3WA 3WZ1A 3WQBA 1JZ8A 1O5UA 4FPFA 3OOXA 3ES1A 4BE3A 2P3JA 2YUEA 3FUOA 1CAUA 4AFBA 5KXDA 2QQKA 1XE7A 1RL3A 3BCWA 5E8AA 1N47A 1VB4A 4AI2A 4JRAA 5K0UC 4WBBA 2QQUA 1UQXA 3O1MA 3GHMA 2YY1A 5LA9A 3B93A 1GKBA 4MH0E 4GZ9A 4ZU5A 1ZM1A 3ETQA 1A3KA 4Z92B 1JYIA 1AR71 4OHWA 2TEPA 4P5YA 3D4KA 5FZDA 2Q1MA 2CYFA 2Y8KA 1PVC2 1UU4A 3WEZA 2BGPA 2RM22 5JIUA 4QB1A 3RZGA 1AL23 1XSQA 4MGKE 3KF3A 4NVPA 4FFGA 5IVJA 4H2AA 1SPPB 4YW5A 5AC92 1ASJ3 2A6VA 2RS13 3HD8B 4XVHA 4XUOA 1AR61 4HSLA 2BWAA 2MPFA 5FZHA 2W39A 2E33A 1QJFA 1BVP1 1S0DA 3LA3A 4QXBA 2RG4A 4ZS3A 4NIIA 1XU1A 2VCBA 5GZFA 4TLFA 1SBFA 1O91A 1RXGA 1S0IA 3AB0A 1G9CA 3HN3A 2ZZJA 4DPNA 1WKYA 3KT4A 1Q3EA 3BVCA 3CJIC 5LRRA 1DYOA 1RMU2 1ZYBA 3NAPC 2WN2A 3PU8A 1R1A3 4LTAA 3ZFGA 1MEC2 1RUE1 4FQZA 4M4RA 1FOD2 1W8UA 1UOBA 1OT5A 1XPWA 4OHVA 5CB7A 1I6XA 4LLFA 4XE9A 1VLNA 3FLRA 4YGCA 1U5XA 5ACA2 4P02B 3AZWA 4NJ4A 5I0SA 2K2SA 3AKQA 3VBOA 4P9XA 4LHSA 4Q8LA 4KGGA 4QQPA 3VD4A 2XB6C 2Y6LA 1W90A 5J96B 1G7YA 2ZHKA 4A2UA 4WVWA 4BQWA 3I4IA 2BFUS 3VL8A 4YM2A 4D6SA 2UWCA 3T4VA 5BUVA 2QZ3A 1G6NA 4GWNA 1GQGA 4D7SA 1KS5A 3ZYFA 2XUMA 1JHNA 4DXTA 4CP0A 4EWDA 4O7XA 5FP9A 2RS53 1ZX5A 3LFIA 1OXCA 5C4WA 4OHZA 1Z78A 3H0OA 3PIJA 1AX1A 3WINE 1OD5A 1QWRA 5FAXA 1X7NA 4UFIA 3C2UA 2ZX1A 5FZLA 4NAOA 1CAUB 2XMLA 1W6QA 1ENXA 2RM23 3V65A 2RDNA 4YYOA 2SLIA 3ZMOA 5FUNA 4IW3A 3K77A 2JD4A 2WT2A 1SBEA 3S5AA 3OUHA 3KZ4C 2PYTA 2CWMA 2V72A 4WM8B 2VZQA 4MGYE 4XJAA 1VP6A 5BNPB 5E6HA 2OPKA 2WLPA 4B1LA 4IEOA 2RR12 5FZCA 3W20A 3H8OA 1YEWA 1LECA 4K7JA 3UGHA 3I59B 3WNNA 1KS4A 1LULA 4GWMA 4I3GA 2OA2A 4PIYA 4ASLA 1WA6X 4HZFA 1HN0A 5JSPA 2R32A 4JHZA 2NPIA 1RHI3 1YQ2A 1AXZA 1SFNA 2VR4A 5IVFA 1WA4A 4MGTA 1KRIA 2VULA 4Q4V2 5IVEA 3K51A 3PMSA 3H42B 4YGDA 2JIGA 2HEWF 1Y43B 2YFUA 4MHRA 4CPBA 3ZXLA 4XJUA 4W6WA 4HFSA 3H1YA 4EQVA 3AJZA 2JECA 1OUSA 2HWB2 3MW2A 4IEXA 2FDHA 2YZ4A 1LOGA 1NZIA 3H7JA 3FBMA 2F17A 2EALA 2VZSA 4LHNA 1H8TB 2B42B 4FT8A 4TYSA 1FMD3 2WO2A 1QF3A 2OPWA 1FXZA 2VUDA 4CCCA 5FY1A 2CY6A 3AZYA 4QX5A 1UN1A 4W6XA 1WWYA 1JBCA 1HLCA 2WDBA 1F35A 4A45A 5A6QA 5JMCA 1UOGA 1AL0G 3MIBA 3IZOA 3MUY1 3VBOB 3V0AB 1AYM1 2VL4A 1PVC1 4UBGA 4Q1RA 4CUBA 1W6OA 2E7TA 1BEV2 3MZHA 4RHV1 5EYXA 4QPYA 4JX0A 3O14A 1PO11 2VD7A 5I93A 3RMXA 1F5FA 2MHFA 3LIGA 4HETA 1PGSA 1O5LA 5FP3A 4YZ2A 3BODA 3N7LA 4J1WA 4XCAA 3TOJA 4XJ9A 1SG3A 1DZQA 3J8F1 3NNGA 4XC9A 3PVNA 4HPKA 5LA1A 2IFRA 3E1F1 1RVF3 4CU9A 3USUA 1VBE1 1S0GA 3N9NA 1W8HA 2G9GA 2ZMLA 4JGZA 5FZFA 4R9BA 2GSYA 1OMIA 1QJY3 1RJ8A 2DVDA 4PCRA 1IKPA 5A6YA 2GNTA 3HN1A 1ONAA 4JAAA 4CDUC 1K12A 3DUIA 2HLEA 2RR13 4LUMA 5FK7A 1R093 4CCLA 1FMD2 4F8AA 1K5MA 2E9QA 1BKZA 1NLQA 3NV4A 4AHXA 1V6NA 2WAAA 4JKLA 1HB1A 4NHYA 3EYPA 3ZPYA 3NAPB 3FBYA 4FI9A 4KU8A 2C9KA 3NAPA 3ZFGC 2IWGB 2Q8DA 1NQDA 1SQ4A 1UOJA 3N9MA 5A7OA 4XQDA 2ZX4A 3C3VA 3MI8A 2J1AA 2NYYA 1LEMA 2D6PA 4EN9B 4N9IA 4YLZA 5FY9A 4BA6A 1KEXA 1WW4A 1W0PA 4K8FA 3ZXFA 5JCTA 3VDDC 4COVA 2E7QA 4BLIA 4UI9L 4XTPA 5FXZA 4YVSB 5G05L 2BERA 2WIIB 1RXFA 1WLWA 4URAA 1XOYA 4IEWA 4AGGA 3MW4A 1R092 1MZEA 2XHNA 4QM8A 2W3JA 2FD8A 3S7EA 3VZLA 1DLCA 3ENRA 4BJ0A 4IGPA 3ATGA 1OF3A 3I3EA 2P17A 1AX0A 4CDWA 4CEYB 5JPNB 3UT0A 2R073 3R4UA 3VDAA 1O8SA 3O1OA 4RYDA 5CFCB 1JYWA 2D6MA 1W2AX 4XBQA 3BU7A 4UT5A 4NPLA 2YU1A 4XQWA 4BQ1A 4QU1A 3OGVA 4CEWA 2R16A 1Q8OA 2V09A 3LE0A 4UFMA 1XC6A 5LBCA 4XXAA 1AL22 2W5FA 3ABZA 4M3CA 4ITCA 1O3QA 1FNZA 2ZMKA 2W87A 1UMZA 2WBKA 2CGOA 4H3WA 5FYHA 3OCPA 1VMFA 2FQPA 1OH3A 2VNOA 4LE4A 1HB3A 2G9ZA 2MEV3 4Q4X3 3TEWA 5CFDC 1VBA1 2LM3A 2CWSA 2YDEA 2YYOA 1G9BA 1LOBA 1RC6A 1PIV3 3B3QE 5EZWA 5FYMA 4HPKB 3WG2A 2QQVA 3MDPA 2JICA 1OA3A 2VZTA 3RSJA 4FP3A 5G04L 4YVWA 1OFSA 2XL7A 1CPNA 1QNYA 2C0ZA 2OQ6A 3NW4A 4DUXA 4LO4B 1UXZA 4B4RA 1AR82 5FUPA 4L92A 4WVVA 5JXJA 1KGYA 4Q4Y3 2JG8B 1IS3A 1CX4A 2HWB1 2EVXA 5L19A 4YG0A 1V6JA 1EV11 2EA7A 4IE7A 1QQP1 2AENA 3AP5A 4L97A 5FQ0B 2ZPXA 4EN0A 1HJGA 1N3OA 3PJYA 1UU6A 2OUJA 4Q4W3 4V1PA 1W9FA 3RRDA 1HRI3 3SISA 1CIYA 5JLVA 5EJ3A 3WDUA 1XQNA 4UF0B 2GNBA 3WSOA 5A3TA 2R041 1CZVA 4QPGA 3B94A 2NM1A 3ZYIB 1D7PM 1X9PA 2G4IA 2YC2A 4CCNA 4CP1A 3AKPA 3EB7A 3J7NA 5C9AB 5FIXA 5DDJ1 1ZZ7A 4QPGC 5T5PA 4QT6A 2RS12 1PO12 4AGVA 3VBOC 1GZWA 1RUJ1 5DUXA 5FZOA 1QNWA 3Q8FA 1AYN1 1SMVA 4S2FA 2DVAA 3GGLA 4XAAA 5DQ0A 4WVMB 3N9OA 2YGLA 1RUI2 3C7EA 1HQNA 4B3NA 3T30A 4AVSA 2ZHLA 5JIAA 1SFYA 2HYKA 1O59A 2Y6FA 4Q8KA 4EN7B 1CD3G 1LHNA 3G6JB 5LY2A 2W52A 2HBUA 1YFWA 3LZZA 4I3PA 4CPBD 1W6MA 1R1A2 5EPAA 2D3PA 4AHYA 1PK6C 1CAVB 3D8CA 1IS4A 1L3JA 4D8MA 3KB5A 5IK8A 5F3CA 4XZUG 1JOBA 4FPLA 3ZSKA 3M3OA 3WG4A 1IPSA 1IS6A 1BXHA 5CU1A 4ZS2A 5FPZA 5GLVA 5IWFA 4AQ2A 4LIVA 3AZVA 3O12A 3KLSA 5IVVA 2VMCA 4MXWB 3PHMA 1PMHX 5IYYA 3NJVA 4L8QA 4OMCA 5CZKA 3HVDA 3RMYA 2LUWA 3OYWA 5AVAA 2GMPA 2DU0A 3VHRA 4FXKB 1YI9A 1R082 4L2NA 1W9TA 5ABJA 5KWRA 1SHWB 5IK5A 3RZLA 4CCJA 4I0WB 2PLV3 3GF6A 4YW6A 5LBEA 2X5IA 3HQRA 1LOFA 2ZGOA 2PXJA 3R4SA 3N35A 5DUVA 1F15A 3V0BB 1Q5OA 1Z7S3 2HEVF 2BOJA 3FHIB 4IE5A 4OZXA 3ZYPA 3AMMA 3JB8A 1HV0A 4A3XA 2W46A 4JGYA 5A1LA 4YGEA 1JI6A 4N53A 4Q29A 4GB31 3ILNA 5A7NA 4ZU4A 1YIPA 1DFQA 3PVOA 1XU2A 3U11A 1JZ2A 2HWD1 4Q0VA 2BV4A 3PVBB 5E89A 1C5IA 1BYHA 1NCRC 3DL3A 4P9WA 1QMJA 2NMNA 2QJVA 3QH7A 3JD73 1IGOA 1VBE2 2QBXA 4P00B 3IDCB 2VJXA 1QDOA 2AREA 2R30A 4XMAA 5BV6A 1ND2B 3B02A 3MIFA 3TNQA 1C8M1 1NCRB 4RS5B 4FPOB 1ENQA 3PVEA 4AVCA 3J7LA 2IZWA 5A3WA 4CU6A 3N3HA 4XETA 4XUPA 2P2KA 4FPJA 4HK9A 1I9RA 5I0DA 1OLMA 1LGCA 3CIHA 2XJUA 5FDBA 3KV4A 1N1TA 1POV3 2VMHA 4ONUA 3O1SA 1XBFA 2YG0A 1QOSA 5KXCA 4A3ZA 5C3SA 2VE1A 4UFKA 5LWBA 2FDKA 4Q4V1 3ZSLA 1F2NA 1XE0A 1S2KA 3DXUA 3LEIA 5FUIA 4DY5A 1JYXA 3RG0A 3BPSA 1BQPA 5FZMA 3T0DA 3AFKA 4XACA 3LOBA 3AKTA 4X8PA 2R7EB 3LDBA 3MIDA 1WMDA 4XZPA 5BYNA 5DMYA 1ULDA 5K7PA 2BOIA 1UY4A 2PQQA 4HVOA 1KQRA 4DNYA 2QQLA 1RUNA 1S2EA 2DF7A 3J26N 3LSEA 4UAPA 1VJ2A 5T5LA 3ZXDA 1U5IA 5IATA 4YW4A 3ES4A 4O65A 4KBBA 2RS31 2Y6JA 4QX3A 4WV8A 1W28A 3S5QA 3ETPA 3BTYA 3O7OA 2KR2A 2VG9A 2WFF3 1UZVA 2BW8A 4QX7A 1K42A 3KGLA 2DBIA 3MFCA 1X8EA 2WO7A 5FO7B 3JB4C 3OGSA 1LODA 2XLGA 5CAZA 1X8MA 1QJX1 2WS93 2BU9A 5L9BA 5BY5A 3MW3A 2LS6A 2BGOA 3E6DA 3M70A 2B9VA 2VOKA 5F5QA 1UY2A 3WY6A 4YWAA 3FMGA 5FREA 5KC5A 3R0RA 1ENSA 4AQTA 4K20A 3KS7A 1YJLA 3ZLIA 1OD3A 2XJQA 4PLOA 2VMDA 2UY8A 4KBZA 1AR91 3QH6A 2HH9A 2AYHA 1ZRIA 3JBG3 3ZFFA 1X50A 2YV8A 1SLCA 2OZ6A 1AUYA 4MX3A 4RGKA 1AHSA 4J25A 4AAPA 4AEDC 4YW7A 4P9JA 4CXXA 1NKGA 3AYCA 3B9IA 2UY9A 3DKWA 2WNVC 1LHVA 2P3YA 4RQPB 3USUB 1JS9A 3S30A 4NIDA 3ILFA 3PUHA 3H9AA 2CV6A 1UPIA 2IXHA 2QZ2A 1MQTA 4LKSA 5GLWA 5I0UA 3VUOA 5ACA3 4CEWC 4IETA 5CG8A 1NXMA 4MV2A 4A7KA 1ALYA 2YB7A 3A23A 4GH4A 3S7IA 4AVBA 3PTRB 2RMU3 2OIIA 3T1LA 1D4M1 1RUH2 2F6BA 3GHNA 3ZXAC 4X8NA 4KGQA 3ACGA 3SH3A 1NA1C 1DGWX 1ZZCA 2QQMA 5APAA 4CDXB 1Y9MA 4IV1B 4AW7A 5IFTA 3HBKA 5FYIA 5JDBA 2XPJA 1C1FA 2WZR3 3ACHA 5A33B 3GBFA 5I8SA 4LITA 3VDCA 3RZMA 1OI6A 3DYMA 3NJZA 3WUDA 3FLTA 3B9CA 2PHUA 3C7FA 3MFAA 3OUJA 2W92A 4NR1A 5BNOB 1COV1 1RUF1 1LHOA 1Q8QA 2P1BA 3VBFA 3M8LA 3QACA 1UY3A 4QPIB 5DABA 2VZ1A 4CDQA 3V0AA 2JKXA 2J1SA 3KD4A 1B09A 4YNIA 2YROA 1PZ7A 3AFGA 3MV01 4H14A 3TYJA 3DYOA 3PJQA 2JKBA 4DUWA 1W04A 5HBAA 1YUDA 2FZ2A 1T6BX 2VW0A 1ZBA3 5F6LB 4CP9B 2XQXA 1BJQA 1PGW1 1US2A 1KD7A 2QFEA 2K46A 4JV4A 4NRPA 5JWPA 1MZ5A 1DF0A 5IT6A 3H7YA 2VY0A 1EAH3 1VBD1 2XUEA 4UXAA 1C8NA 3WP4A 4E4ZA 3O5SA 1RUJ2 2A1XA 3VD3A 1XRUA 2GC3A 3HMYA 4AVTA 1EP0A 5DDJ2 2Y34A 1C4RA 1S1AA 3FLPA 4CCOA 1D2SA 1AYN2 3VGIA 4E2SA 1U0AA 3NMBA 3ZN5A 4P5HA 3PU3A 4QB6A 4PHZA 1HXS2 4E9KA 1F9KA 3IKWA 3K48A 2D6OX 3MUZ1 3WNPA 1JW6A 5J98B 1V9U2 5F2SA 2FDGA 4NROA 4AFAA 1JH5A 1DCSA 2J1TA 1RUOA 2ZAHA 4D69A 2JXAA 1ZRFA 5J1XA 3BTZA 4L9BA 1CR7A 4GB32 2ERFA 2YBKA 1ODNA 3DV8A 2ILMA 4LJHA 1IOAA 1HQLA 1O4YA 4ZY9A 1GLHA 5IAXA 4N43B 5D8AA 3L2YA 3MHZA 4XJ8A 3U75A 2R042 1D4M2 1REFA 3BB6A 1Z7S2 3BTXA 4AFMA 3AK0A 4JC1A 2ZMNA 1YXWA 3AMPA 2OW4A 2RJKA 4N53B 5F5CA 1DQ5A 3LEGA 2VW1A 3F2ZA 5FRAA 3ACLA 1LU1A 4GULA 4DEQA 4CA9A 1S0FA 4HN1A 3VDDB 4FAHA 1VRH3 1HV1A 1PMIA 3SKJE 5LEJA 3NO8A 2JENA 3G7DA 3O0VA 5LA2A 1D4VB 1UYZA 3B5LB 4K1YA 1W6PB 1COV2 1CQ9A 1LENA 5GJ6A 3FX3A 4NN0A 2OS2A 5JPMB 1UU5A 4TTGA 3KHCA 1ZREA 4P9IA 2JG9C 4XPVA 3GBGA 3T2OA 4Y1ZA 1QXPA 4BQ5A 4CUGA 2GNMA 5JUVA 4E27A 2VTFA 4H55A 4NRQA 3I3MA 1IG3A 1LRHA 2P3IA 3VL9A 3ACIA 4QX0A 1HW5A 2RV9A 1YWKA 3ZN4A 3VBHC 4META 5C3PA 1M4WA 2ZACA 5EXOA 2VU9A 1EYBA 5T55A 5CYYA 4Q0SA 5DZGA 1W6MB 2C1FA 2LROA 2O8OA 1G9AA 1GNZA 4K40A 4WZCA 3UNPA 1AF9A 3TEZA 3JCIA 4OQ8A 4RGGA 4Q0PA 2P37A 1SLBA 1ZBE1 4DFSA 4OFGA 3N7KA 5L9VA 4BISA 1ZBA2 4D7YA 1K5MB 2XKOA 4HMZA 1C3HA 5LBFA 1TG7A 4MVTA 3I2IA 1S0BA 1NYWA 2EICA 5CNAA 4DXSA 5A3NA 1WMXA 5E1RA 1E5IA 4I01A 5L7OC 1OQDA 2EXJA 3JXSA 5FXWA 5JXGA 2YFZA 4N7UA 4M3CF 1REEA 1W9SA 5TSWA 1IQDC 1H2NA 2NLRA 2HWC1 4BXFA 3INAA 3K4ZA 1R1ZA 3OF1A 3RZHA 2JG8A 3POWA 3ZXEA 5JXHA 1IKQA 2Y33A 5A70A 1OOPC 5BNNC 4MGIE 5CG9A 4RS5C 1UMIA 2VVDA 4CZSA 4BK5A 2XR4A 5EIYB 4O9GA 3N9LA 1DZTA 3HJRA 1PNFA 2AGSA 2DBNA 4WM7C 1NQJA 1AR73 2XQRA 4QXKA 3ZIWA 4AR2A 3WCSA 5EHDA 1POQA 3VB9A 5DG1A 2WINB 2J1VA 2VZ3A 3J9SA 4LO7A 1W2TA 4PDWB 1GZTA 1J83A 4NO4A 1IG0A 3AMHA 3I2KA 1SBDA 2DCYA 2ENRA 5A7WA 4LT5A 5D2AA 4Z2WA 3WF1A 4CU7A 1DQ4A 2VQTA 4YZ5A 5KHKA 4YM0A 4EWAA 3ZSMA 3P5BA 4CEWB 1D0GA 4OI4A 3WR0A 3POIA 2GH2A 2QQPA 3K3NA 2GH8A 3WQ0A 1ZRCA 2GNDA 3K75B 4OYUA 2V4AA 1E57A 3NL1A 1BK1A 4HBNA 4NRMA 4UBHA 1ACCA 1H2KA 1RUH3 2R49A 4I09A 3DN7A 1QJU1 3I2DA 2OVUA 2DUQA 3LIHA 3LDRA 2ZEYA 5C7GA 4Y4RA 4AG4A 3MF6A 5A3PA 1R1A1 1O7FA 2BDRA 4GH4C 4CUCA 1W6NA 2VXRA 1JHJA 1CGPA 5BNPA 2AC1A 2HKXA 4KU7A 2J1UA 5CIRA 2X10A 4QHZA 5FLIA 4GJZA 2WAOA 3TN93 4BYYA 3MIEA 2GALA 2QDNA 2VVEA 2D5HA 2NZ9A 3I59A 3L9JT 1NLRA 1RUC3 3OSDA 4JKMA 3OYWB 4JRLA 1IQAA 1QJX2 3IDBB 5BNOC 3LCPA 5CFDB 5T5OA 4FQ4A 3OPZA 1NCQA 1RUD2 3JQWA 3OBZA 2W1QA 3PDQA 3EHKA 4XFIA 2DVFA 5LRSA 3WW3A 4FPKA 1W2OA 1ASJ2 3E97A 2E32A 4YG3A 1H2LA 2XBO3 1FOD1 2PAKA 1IS5A 1H0BA 2W08A 4M00A 1YQ8A 2A73B 2CHHA 2JB8A 2XJTA 3WF4A 4DO0A 2AEZA 1ND2A 1PM7A 4GWJA 2WSVA 3VDBA 4KWLA 2W2IA 1W8OA 2EXIA 3AXEA 1RUI3 4Y5Z0 4AI0A 4W50A 2RM21 3GZTB 2ORXA 5FZIA 5FLJA 2A3YA 4LQRA 1HRV2 1AJOA 1U5ZA 5IVCA 2YXSA 4KNCA 2J7MA 1BBT2 1RUG2 3VBSB 4CEYC 2C9AA 3W5MA 1AR62 4B4QA 1KFXL 2Y26A 3LEKA 3AJYA 5AC91 1DQ6A 2D6KA 3UKNA 1AVBA 4XHXA 5FYZA 1KJLA 1WLTA 3LA2A 4L11A 4CP2A 1IZ3A 1AXYA 1YI7A 3OBTA 4WM8A 4CDUA 3LPFA 1SACA 4B7EA 3W9AA 4GALA 1F4AA 4PDWA 5M0TA 1OF4A 1V9U3 2EIBA 5F2WA 1FATA 1OQEA 5FR3A 3OGRA 5E88A 2QVSB 3BGAA 4KWKA 1UW8A 5JI7A 2GAUA 4JGZB 4AI8A 3EO6A 4XQ4A 5CKMA 4PBOA 1RUE2 1RHI1 1W0OA 4E2GA 4QKDA 4MXVA 1XNDA 1K45A 3J8F2 1HXS1 2WNUC 3MV11 4KWJA 1PX4A 3M2MA 4QPWA 4ZKTB 1OBNA 5T3NA 1NOVA 2B46X 2EAKA 3CLPA 4IERA 2XVLA 1MS5A 4QDSA 4JVAA 4P9GA 3UGGA 3T1MA 3OBRA 5K4LA 1BLZA 2Q8CA 5I8YA 2WNEA 2K0GA 5IVBA 2ZKLA 1CPMA 1W6NB 1H8TA 1OA2A 4QDQA 5FZ3A 1AZDA 3P1IA 3ZSJA 4ASKA 1ND3B 4DRVA 5L7OA 4K21A 1W8NA 4AE2A 4P9YA 2L9LA 3O1PA 5JZGC 4XXPA 5EQUA 3T08A 1LGBA 2VQAA 3E6BA 4QXCA 3KWVA 1GWMA 1XYNA 1GICA 2DCTA 1GZWB 4RR3B 1U12A 2DDUA 1JZ4A 1OPMA 3I54A 5DAVA 1W6PA 2WS92 3IBMA 2Q8OA 4ASMB 5FZ8A 3THPA 2A6ZA 1PO13 3VBFB 1JYNA 2HWE3 3LSDA 4LEJA 1UL9A 2IC1A 1ST8A 2JDMA 3FWEA 3I7DA 3VD5A 1QHDA 1HRV3 4MUVA 3J8F3 2W68A 1E5RA 1N1YA 4CCDA 2NQYA 1RVF1 1ULPA 3U78A 3AP9A 1OSGA 4K8RB 1SLTA 3R4DB 1W9YA 4WVZA 5HXMA 1QGLA 3JBG2 2XOMA 1NXD1 3AMQA 4CSWA 4SBVA 3HR9A 1SEFA 5GKAC 4AEKA 5FPXA 1GQHA 3URFA 3U14A 2OZJA 4NHXA 1W8ZA 2C4XA 5FYCA 2B8MA 1UMHA 2JE7A 2GZWA 1R091 2DWRA 3KF5A 3MIGA 4AK3A 2G9FA 3SEEA 1AX2A 2B45X 5FZ0A 3RZZA 2PHTA 4LMFA 3VLBB 4TXWA 1I1EA 3U4XA 2GN3A 1JOJA 4D0QA 3NVCA 5FZEA 3FFQA 5JOXA 2QQNA 4RL7A 4MO3M 1Y9GA 4RQPA 4XF9A 5F9TA 4G4FA 1MPXA 3ORJA 4GXLA 1MZFA 3USSA 4HKLA 4DUVA 1PVXA 1NA1B 1DHKB 1Q56A 1VAMA 2VNGA 4Z07A 3DPRC 1Z0HA 5JSOA 3MF9A 1AR83 1AL21 2GC1A 5A3MA 1BBT3 1RUG3 2VC9A 3VBRB 5C8WA 1JODA 4K1ZA 4QAWA 2ARBA 3BYWA 4AF9A 3OG2A 2BWCA 3Q9OA 1ASJ1 4PI2A 2FDJA 4LBQB 1SFPA 3B7MA 2WUHA 1PGW2 4CDQB 1F4HA 2IXKA 3A22A 5FJKA 5FMCA 3MGUA 5D21A 5D1IA 1BEV1 3IPVB 1AYM2 4UOJA 2XJPA 3WDWA 2YBPA 3AP6A 1J1TA 2D43A 4YG6A 4CP9A 4E8CA 5JAXA 5JR2A 3ECQA 4JGYC 3CDZB 3SNMA 1W99A 1RUE3 3K3OA 4X6QB 4XFAA 5F5AA 1AR72 2BFUL 2YBSA 3WOGA 2R063 2KA3A 2ZCWA 4KG8A 4Q0QA 4RFRB 4SLIA 1GQPA 3T0BA 1NCRA 2J1RA 5LB6A 3WG3A 3C7GA 4Y5TA 2ZGRA 4JDMA 1PM4A 2WZR2 2BZDA 4W65A 2ZX2A 4QGLA 4IL7A 2ZX0A 1OURA 5BXXA 3WVJA 1VBA3 2CL2A 2LTNA 5EJ1B 2XVKA 4K9SA 1JOPA 4COZA 1WCSA 3AYAA 1YHFA 2VZOA 2R0HA 3O0XA 3QD6A 2ADDA 2YC0A 5C8CA 4FFHA 2W47A 3W58A 4TLGA 1X9TA 4BIFA 1KFUL 4OMDA 1U5YA 3HT2A 4N9HA 4IQPA 4Q4Y1 3QCWA 3UV9A 1V70A 2E63A 1RTVA 1TEIA 1PZ9A 1ULCA 1LCLA 4GMP3 4GWIA 4A6SA 1JXNA 2UURA 3RGBA 3I2FA 1QQP3 4NWVA 4YGBA 1WCQA 1WLCA 4URTA 1QOOA 5DAPA 3SXWA 4BQ2A 3GALA 2HWC2 4IV3C 1WCDJ 1UNBA 2JB4A 3KSCA 4PQ9A 3WW1A 1XNBA 4YM3A 3H3ZA 2R043 1ZZBA 2ZGMA 2Z42A 3ELNA 2BNOA 3LA7A 4YVSC 3KCYA 3ZO0B 4NHKA 1QJU2 4BLJA 1CAWB 3FZ3A 5J37A 1E5HA 1VBB3 5LW9A 1VALA 1VMJA 2QCSB 1VMHA 1AJKA 1DGLA 1PO21 2A70A 1GMMA 2MEV2 2VCMA 4FFIA 4QGNA 5FMDA 3WDTA 3WNMA 1GOHA 1AYN3 1KDMA 3FC0A 2E31A 3WP6A 4CVUA 1JZ5A 1EV12 5BNOA 4OUSA 4WM7A 4QWNA 1XB9A 4L0PA 3VBUB 1ULEA 4IUGA 4XDOA 2EXKA 1NCQC 2JX9A 4ZZ5A 5L9RA 3GCXA 4TZDA 1POV0 4YZ4A 2FDFA 5FPLA 2E7AA 5IFPA 1RUD1 2WKKA 4HSJA 2J22A 4CCEA 4LXLA 3LDKA 3LD8A 5K0UB 3ZPOA 4DY3A 1UXXX 4AEMA 3SEPA 4MGZE 5FOJB 1NY72 2DFBA 3KVBA 5CVRA 4CE8A 1HIXA 2VH9A 2IVIB 5FWJA 4TN7A 1CZSA 1LR5A 1OOPB 5BNNB 2Y6GA 2Q5TA 1PHMA 4XURA 2DU1A 2RJ2A 3EMRA 3NNLA 1ZNPA 2HWD2 5HCBA 5EP9A 3U1XA 1GR3A 3WHTA 3A4UA 3SCFA 4NE9A 1QH7A 4Q1PA 2VOTA 4EJRA 4YARA 4IE4A 5FPBA 2VOVA 2GC2A 1AYM3 4XFHA 4KG0A 3DXTA 1HB2A 3IAPA 1PK6A 3NJXA 5JOWA 4RHV3 2HWF1 3ME2A 2VUAA 2Z5WA 2LRPA 1QH6A 3OPWA 3IIAA 3RDIA 1OVPA 1STMA 1YFUA 4LOSA 4BWOA 1H6XA 2AH2A 4C91A 5FYBA 4ES8A 3LPGA 4IV1A 3ZIXA 1DU3D 1ULFA 4D6QA 1O3TA 4R9CA 1K5MC 5C71A 2D97A 3FJSA 5A33A 2VUJA 2H6BA 1WW7A 1FX5A 2XJSA 2P3KA 3SQOA 2P6HA 5FV3A 1J3RA 4XDQA 5FO8B 1GP4A 4Q4Y2 4NIGA 2WQ8A 3RWNA 3T3YA 3I2OA 3VHOA 4W4ZA 2HWD3 3RZJA 3CBNA 2D40A 1DBNA 2X5IC 4Y1YA 1IHMA 1LOFC 4JQRA 5JXIA 3E6CC 4E8DA 4Q4W2 1AR92 1GYKA 1B35C 1S0JA 2WO1A 3FFZA 1ZZ6A 1VRH2 3RYPA 4Y20A 4UF0A 1Q8PA 2RMU2 3GJBA 1NE6A 1WD3A 2P34A 3HQXA 5HCAA 3TNPB 3ZYBA 1C8M3 5LCWL 2J42A 1CIWA 3VHPA 3CHXA 3KMHA 4LHLA 5FBZA 2D6NA 4FO9A 1UOFA 3BTAA 1DGRA 5FYUA 5C33A 1XNTA 2WT1A 4FBFA 4QGMA 4WM7B 2OKXA 3RI9A 3GZUC 2B5HA 3WF0A 3VBUA 4XF1A 1F5JA 4XFGA 3OTFA 4R4XA 4PIZA 5CISA 2DTWA 3SH5A 4GH4B 4ATEA 2IVJA 3SC7X 4AEJA 1W6QB 1BHGA 5SV8A 5DUUA 2OYZA 2VXJA 2GU9A 2KM2A 1UIJA 1POV1 1V6OA 3RFRA 3M3EA 1FPN1 1TMF1 4AL9A 1RVF2 4OCTA 2H0BA 3UKTA 2R071 3NSTA 4M3CE 4UW3A 2A6YA 4W8JA 2D5FA 2VZPA 3ZMNA 2X8KA 1NZCA 1YO8A 4OI0A 3VBSC 2W94A 3AC0A 4QHBA 2OQ7A 5FKBA 4JZRA 5FZ7A 5FYYA 1DZRA 1Q43A 1LEDA 1YQ5A 2RVAA 5ABJC 1RB8G 2TBVA 5FYTA 4LO5B 3VBHA 1G9DA 2BQPA 1S0CA 5LATA 1DDLA 4LBQD 4MXWA 4DB5A 3SHRA 4Z2AA 3MEPA 4JQTA 3IM0A 3OBAA 3DPRB 4JDOA 5DUWA 4BK4A 3T2TA 1MVQA 2VNVA 4U36A 5EYYA 1SLAA 4ARYA 3I49A 1EAH2 3FE5A 4Q4X1 1N3PA 1XNKA 1PO22 4RR3C 3WT3A 5SV5A 5A80A 5ISLA 3BALA 4QPIA 1RUC2 1UX7A 2QE3A 3U10A 2WSUA 2H0VA 2ID4A 1YLLA 3OY8B 4FPHA 3A7QA 2P5BA 2WS91 5LZ6A 1DP0A 2EIDA 4B1MA 4AHWA 4Y3OA 1H9PA 4AFCA 1TME1 5FYSA 5KBFA 1V6KA 4ISRA 4RD7A 4DOUA 3JBG1 1EY2A 1CAXB 4IEVA 1RINA 1WGPA 1W8FA 4C90A 4ORFA 2ZEWA 5A1FA 2UYBA 4J6GA 1VBC3 1HRI1 5ANQA 3S57A 5J7MA 2VCCA 4JHTA 4M0NA 2ADEA 1Q8SA 2FHRA 3P3PA 4IEYA 4YW3A 2RS11 1J59A 3WW2A 3EXUA 3CQOA 5IUQA 3RYRA 5JMOA 1AR63 1OKQA 2J1EA 4XIKA 5LA0A 5DDJ3 1O3RA 2WL1A 1UWWA 4EWEA 4E4DX 3IDAA 5T54A 4DINB 1NE4A 1RYYA 3VKNA 2W95A 4S2DA 1BMV2 2YC4A 1OPOA 5FTTC 3ZYRA 5FZGA 2VMEA 3BU0A 2QNKA 2ET1A 3L2HA 3CL1A 2PN5A 1UZWA 3Q8CA 3VZKA 4R9AA 3WD5A 1XJAA 3ROUA 4FPEA 4NHMA 1DIWA 4OI2A 5GZCA 2RS32 4C0BA 3CEWA 3NKTA 5DG2A 3CNAA 4YFWA 4R52A 1W06A 2VW2A 4A7YA 2WC2A 1H30A 2SBAA 2MNGA 2RE9A 3AYEA 4QPGB 4XFFA 3IMNA 3VDDA 1O6UA 1LAJA 5GLTA 1T6GC 3E5QA 2DTYA 2ZA9A 4QU2A 3IIIA 5FZBA 3UETA 4OQ9A 3ILRA 1R081 4E2QA 1NY71 4LKEA 2HEYF 4QM9A 4UWDA 2XKPA 1K5JA 2RS51 3IPVA 4XFBA 2XLAA 4FPYA 4XILA 3ZM8A 4YVSA 2YPJA 1ENRA 2I2SA 3OEAA 3WUCA 4EN8B 3N4MA 5JZGB 4HXCA 4YPJA 4CYDA 5GLUA 4OUMA 2JDKA 1GZCA 2PLV1 3EBRA 3ZDSA 2Q8EA 4N53C 5T50A 4OHXA 4CRQA 1VIWB 3AVSA 3N9QA 1LNSA 2JDNA 2WRAA 2R0FA 1VBD3 1Z7S1 5C3OA 1QY4A 1CESA 1CJPA 3PURA 4MZUA 5KR7A 2CSGA 3ZSEA 5FP8A 1LJ7A 5A7WB 1FPN2 1FT9A 1TMF2 1YC61 2EIEA 2WWJA 3CKHA 5FZ9A 1O4TA 4BQYA 1MZ6A 5C3RA 1WD4A 2DCJA 5CBLA 4BQ4A 1WMEA 1H1IA 2DCZA 1MS9A 2LW8A 3J4UH 3MPPG 4LK6A 2W9XA 4NPMA 2ARXA 4HKWA 5C3QA 5BPXA 3VBUC 2Z2SB 3MO4A 1UKRA 2WA4A 4CU8A 5HV0A 4I0AA 2CGPA 3I97A 1OHFA 2RDSA 2PELA 2DUOA 1OLQA 3GYDA 5JOYA 4M0HA 3O1VA 5FFOC 2XLFA 4IDZA 4Q2FA 3T2QA 4DXZA 1YJKA 3SCGA 5F32A 2BUKA 4NIAA 5LEKA 2IUWA 1MEC1 3POJA 2WT0A 2VZVA 2E26A 3HEIA 1YCIA 2WZEA 1DQ0A 1WW6A 4G3YC 5A7SA 4AFDA 2Q1ZB 3TBDA 5LASA 1A8DA 1DYPA 1UY1A 1C28A 2VMIA 5C8CB 3B69A 4DEVA 2E53A 5IK4A 3PNAA 2XONA 4DQAA 2R1DA 4IE0A 3RPQA 4FP2A 5FYVA 2ARAA 4JGYB 1SLLA 2WZPP 1RMU3 1ZA7A 2ZGLA 4XUQA 1MR5A 3OD0A 4FPCA 1FMD1 4UFJA 1VAKA 3H8XA 1OUXA 1CAWA 1JUHA 2DUPA 4C1XA 4ZU7A 3RNSA 5KHHA 2UWBA 1EUUA 4DMIA 5J09A 1IPJA 1UF2C 2BRTA 3CJIA 2QQOA 1QXJA 2QTWB 4IEUA 1I5ZA 1OLME 4XF4A 3WQ1A 1TNRA 3ST7A 2VZUA 5L7OB 1QJEA 1MS0A 2DYCA 3WF2A 2LALA 3H8UA 2FZ1A 1GNHA 3WP5A 3CZUA 4OI1A 3WG1A 2RDQA 3I8TA 4XFCA 1UZZA 2WO3A 2XWJB 5GLZA 2RS33 3UL2A 1EPZA 4AZZA 1S2BA 2QQJA 3WP3A 3H8RA 3DGTA 3HOBA 4QKNA 1VBE3 1YQCA 2WZ8A 2WFF1 4WVMA 5F5IA 4MG2A 3FL7A 1FI2A 4IE6A 4BXSV 1QJY1 4UW5A 2PLV2 2XDVA 1N1VA 2YU2A 5L36A 1MS3A 3QOPA 1LESA 4NPRA 2XHKA 1T2XA 2RR11 5K9YA 5FXVA 2UWAA 4I0BA 2A7AA 4CDUB 5H9QA 1QJX3 3WNOA 4BB3A 1L7LA 1MQTC 3OD4A 4CXWA 3IT8A 4Q26A 1OVSA 4EROA 5C4WC 1J1LA 1CVNA 4XF3A 2JJ6A 3OB8A 1CONA 1CAVA 1REDA 1SCSA 3NJYA 1W0NA 1YYNA 1WMFA 3ASIA 3AZXA 5AFBA 5I0RA 2RDRA 4KH9A 5A3UA 4B7KA 3HIFA 5DZFA 1OA4A 1WBFA 3PUSA 4XOGA 5E16A 2GP5A 4LIUA 1TQ5A 1C5HA 4I30A 3WHUA 5B4XA 4C0HA 5GM0A 4UFHA 1O8PA 4CTEA 2ZKNA 2FDIA 1OH4A 4ATFA 4P08A 5ACA1 2Q1FA 2AEYA 3AVRA 3NV2A 4OULA 3U37A 3ZFGB 1UIKA 1W3VA 1W8TA 2ZXQA 4YM1A 4EZ4A 3V0BA 3P3NA 4RA0A 1W2UA 3VBRA 4AI1A 1WCUA 4L99A 2F4LA 1GWLA 1LOEA 2KXLA 3PL0A 4A44A 4DS0A 4QKBA 2ZBJA 4Y5SA 1P8JA 1UD1A 5AVPA 4EV0A 3ZX7A 4GD4A 3POEA 3WQ7A 1C57A 2NMOA 4FPGA 4GJYA 3VKOA 4OHYA 4BM8A 4O9EA 1JUIA 2QQWA 3AX4A 1W8WA 3ZKUA 4JTOA 1H4HA 4YFZA 4FTEA 1DG6A 3D6EA 3ZYGA 4KMQA 1WUVA 5CADA 1S0EA 5KHIA 2ZAAA 3BUCA 5JSRA 1OOPA 5BNNA 1BMV1 3ZFEB 3O0WA 1A78A 4MGQA 2ZOEB 4J1XA 3SLIA 1GANA 2FCVA 1RUF3 1BK0A 2WNVA 4JCKA 4AXOA 4YZ1A 4FTSA 5ANNA 3POFA 3H1WA 4N7IA 1Y7BA 3ZXGA 1LB2A 1ZBE2 1TME2 5DAXA 3E5XA 3OGGA 5CKNA 3E5UA 3ZXJA 3KM5A 2FCTA 5LK7B 4S2HA 5K0UA 1UYYA 1MS4A 4UFLA 1HRI2 3V56A 1ULOA 2VECA 2I74A 3VBSA 4BQ3A 2TNFA 4LBNA 4LBKA 3GXUA 4FTBA 1JYTA 1GNYA 3A21A 4FXGB 4XEZA 2V4VA 2AR6A 2C26A 4RHV2 1EAH1 3S6PA 3W59A 5FY4A 2C5DA 2BNMA 3DKQA 2CDOA 4U2AA 1J3QA 1QOTA 1OQ1A 4Q4W1 4QDRA 1L7RA 1URXA 1RUC1 3I3QA 1PMJX 4LLOA 5FJHA 4BPZA 3DECA 1LOAA 4C8DA 4JTNA 2Q0AA 5DAWA 1RUF2 4EZHA 5KHGA 2JDYA 5FPAA 4AYUA 5C6CA 3IWZA 2VM9A 3AM2A 4ET7A 3AKRA 5C9AC 2XBO1 1FOD3 3ZR5A 1VBB2 4IEQA 1JTZX 2A6WA 4MGSA 4CCKA 5F6KA 2VQUA 2ET7A 2W1SA 3LWCA 1YNAA 4XMIA 4LA3A 3H1MA 4QHOA 3UGFA 3CMGA 3SH4A 1DGWA 4ARXA 3RJRA 1BVVA 2VBDA 1GSLA 2X5IB 1DGRN 4BHPA 4BMEA 4FSJA 3ITQA 2JWPA 1QIQA 4N8MA 3RQ0A 2XGXA 3UJQA 3O1UA 2DVBA 2ORZA 1SDWA 2IXLA 5DXDA 4PLNA 3Q8AA 5HV4A 3B00A 5CKQA 2JG9A 3M3IA 5HPOA 2JG9B 2R072
chains in the Genus database with same CATH topology
3ZFFC 1LKNA 4GKYA 1RJ7A 3TN92 3VKMA 3BOPA 1JYCA 4UW4A 4FCAA 3ZFFB 2PHLA 1UAIA 1CAXA 1G86A 4BH9A 1VRH1 3D0JA 3HBZA 3WCRA 2XH6A 2ZHMA 1V9U1 1X36A 4AI3A 1FV3A 1LTEA 3D0SA 4YW1A 1PVC3 4C1WA 1W6OB 4AVVA 3NKGA 2QKDA 4Q27A 3CJXA 4Y22A 3WDVA 2WNVB 4Q4X2 4RSUA 4HVRA 4QQLA 3TB0A 5JOZA 1ZRDA 2IXJA 1H1MA 4Y26A 2BBVA 2WQ4A 3V64A 3DPRA 2XJRA 4NWWA 4ISQA 4LNVA 3VBHB 1HX6A 3VZOA 5I91A 2GMMA 2Z79A 1ZA4A 2R062 3H3UA 4HT1T 4IEPA 2DURA 4H7MA 4COYA 2X53S 4GA9A 1G8WA 2WLQA 3MLJA 2YMZA 2ETEA 3PTYA 4B4PA 4CDXA 1A8MA 1KDKA 4YW2A 1NA1A 5T52A 2HJIA 5T5JA 1RHI2 3A0NA 3JD71 3M1HA 5J3UA 3WXPA 4YSFA 4RR3A 1FAYA 3MLLA 4QPIC 1XNCA 1I3HA 1DLLA 2CAVA 5BNQA 5C9AA 2BGCA 2R1BA 5KXBA 4P14A 2E51A 3VHNA 1H8VA 1HRV1 1UCXA 1YFYA 4XBNA 5EFUA 3JUUA 4CEYA 4FOVA 4LBJA 5IK7A 4MSVA 4HL0A 2TUNA 1XYPA 2A6XA 2GC0A 2HWC3 2B7YA 4GKXA 2PAMA 1UKGA 4F83A 1FNYA 2D93A 4CDWB 4PF5A 1MVEA 2ZGKA 1GV9A 2D44A 5C8CC 3HT1A 3MIHA 1A6CA 1Q8VA 2PTMA 4B29A 4ES9A 3UKVA 5B2GB 2AUYA 1V6IA 1QJY2 1AR81 3UK9A 1N1SA 2A5ZA 1LHWA 1VR3A 4YZ3A 1BBT1 1LOCA 1RUG1 3U07A 1F31A 3ZN6B 3ZYJB 4YVWB 5H9RA 1PZ8A 2Z69A 2MEV1 1LU2A 3ZVXA 2GMEA 3X29B 1GFF2 1TNFA 4RGAA 2EF6A 1V6MA 2BTVC 2D6LX 1PIV1 2XG3A 5D8AB 4Z8BA 1BEV3 5BNPC 2BEOA 2PA7A 1QJU3 4XJWA 1X33A 2BNNA 1WW5A 3CU7A 1O4ZA 4FVVA 5HXVA 3AXDA 2HWB3 5FMOS 3MLKA 1EV13 3TN91 2VGDA 1JN2P 3A0KA 4AEDB 2CTVA 2VPVA 1J58A 4S2GA 3THTA 1J3PA 2PHXA 3D82A 5DZEA 3CF6E 2RJLA 4HKOA 4H7LA 2QUOA 3WX5A 4K3UA 1QKQA 3RS6A 4P9LA 5GALA 1RUJ3 1D4M3 3HWJA 1KXGA 4I02A 3IN9A 2F4PA 2ZHNA 4BZ4A 5CA6A 3BIWE 3KT1A 2A3XA 1CN1A 1HQWA 2WZR1 4GMP1 1H4GA 2CGNA 4HANA 3EJKA 4PJYA 1V6LA 3POYA 1YIFA 4R4ZA 1BZWA 2EIGA 1CJDA 1RIRA 3SCHA 3DF0A 2D7FA 2Y0OA 4W6YA 2WNUB 3VZMA 4E4SA 1V00A 1GZ9A 1COV3 1N3QA 1X82A 2X29A 3LKJA 5CFDA 2ZABA 3KCCA 3ALQA 5ABJB 3VBRC 4AWDA 1IPKA 4YVWC 2Q30A 3FUQA 2ZJCA 4IESA 2IXIA 1DQ1A 1UPSA 2WFF2 2ZGQA 4Q0UA 4Y1VA 3WLUA 5FOBB 2BVBA 4LBQA 4XJZA 2O1QA 3RJ2X 2OUHA 4RFT0 4N43A 1HXS3 2R6QA 5A3LA 4K6BA 3KQRA 4LBMA 2PHRA 3M3CA 4LA2A 1TE1B 3JU9A 4LO6B 5C4WB 2DV9A 4N43C 2XBO2 5JZGA 2Y38A 3VZNA 2VOXA 3R05A 3CJIB 5HCFA 2VOWA 2BYVE 2ZGSA 4FOQA 4GB33 4QD2A 2NN8A 3NV3A 4XW3A 2JDZA 1VBC2 2IXCA 3MYXA 3GZAA 5L73A 1FV2A 2JE9A 3M7AA 4R9DA 4A7ZA 1YFXA 2GN7A 1H2MA 4GQ7A 3M3QA 1XXNA 3SITA 4XYXA 2FBEA 1F8VA 2ATFA 2HWF3 4FOYA 3HAGA 1KJRA 2WWSA 2HWE1 4HN0A 3WNXA 2UU8A 1WBLA 2FMYA 2PHWA 4RQPC 2K9ZA 5J48A 4Y4YA 4DRRA 1HDKA 4Y1XA 4IV3B 4IV3A 4YRDA 5D8AC 2VNRA 2PHDA 4BOWA 4LBOA 2A75A 2GDFA 4LHKA 4IV1C 4INDA 1S55A 1LGNA 2VMGA 2B9UA 4Q4V3 3ZFEC 3PMEA 4LE3A 1PGL1 2ZGNA 5GZGA 3CO2A 4F3JA 4D94A 1YRZA 1NCQB 5JI9A 3JQXA 4WZFA 4COUA 3BOWA 2JEMA 4R8HA 2XJVA 4OVEA 1H9WA 3AMNA 3N36A 2E6VA 2EXHA 5KC6A 5LK5A 2Y0IA 1QDCA 3WDYA 3PLQA 2WQZC 4XHBA 4RS5A 4IXLA 4I2OA 5I0TA 1D0HA 1WLDA 2QDRA 4HLTA 1QU0A 1FPN3 1TMF3 2VQ0A 4WM8C 4JDNA 4M3CB 2HWF2 3S0MA 4UW6A 3KGZA 2V73A 4Y22B 1EPWA 3VKFC 1KITA 5FO9B 1AR93 4MYEA 2R061 3NV1A 5A32B 2BPA2 2FMDA 1WCKA 5GZDA 5K8SA 1SCRA 3ZN6A 1C8M2 1PK6B 1QJZA 4PDWC 4EN6B 5J36A 2PAEA 3ZXKA 3JD72 4M01A 5F1RA 2RMU1 4MLOA 4OLLA 3TAYA 2D3RA 3D5OA 1H8TC 2DCKA 4Z82A 4XF0A 3AYDA 4PBPA 1VAVA 4AGRA 1H1AA 4LO8A 1B35B 1TME3 1B35A 1VB2A 4NHLA 1D2QA 3TRSB 5HI0A 2UYAA 2VVFA 3OY8A 2YGMA 4Y24A 1ND3A 2ZZQA 1ZRRA 3SMHA 3AP7A 2ZS6B 1G9FA 2WJSA 4AQSA 1PNGA 2W0XA 4CDWC 1VBC1 3UJOA 1Y3TA 5CFCA 1PIV2 4D3WA 1DYKA 3POSA 4TSVA 2D98A 2PHFA 4Y20B 3OJBA 1NLSA 3RI8A 4Y1UA 5CFCC 3QLQA 3GBWA 5GZEA 1VBB1 5AFEA 4NOTA 1ZVFA 4G9SB 1XE8A 1OLRA 1PO23 2ZGTA 3M4FA 2RHPA 4GIQA 2RS52 1BCXA 1RUH1 4ZXKA 2O0OA 4QQHA 2H6CA 2BVVA 1ZZ8A 4PIXA 4AQ6A 1ZBA1 1GBGA 2XL9A 1RUD3 1Y9QA 2ES3A 1C1LA 2V5YA 1UZYA 5FCCA 4AHZA 4PLMA 3VZJA 3JZVA 2DFCA 1MS1A 3KCXA 2YHJA 3GNEA 1HKDA 2AZ5A 2CAUA 4LULA 3LOIA 2CNAA 4QQOA 2N7GA 5EWSA 2A71A 4FOWA 1RGSA 5FQ0A 1PGL2 4BIOA 3AKSA 5A32A 1OFNA 1R083 4N90A 5FLHA 3WW4A 4AVAA 4FAGA 3WV6A 1O3SA 1VBA2 2IFWA 3KT7A 4TWTA 2I07B 2NP0A 1RUI1 4LBLA 3WDXA 1XYOA 3MPBA 1SLIA 4HK8A 2I45A 4Z1VA 2XVGA 2DVGA 3VV1A 2WFPA 4DZGA 3BPZA 5AC93 5H9PA 3B01A 1AXKA 2HWE2 5FMOL 2JG8C 5H9SA 1DQ2A 1FYUA 1QQP2 1ND2C 4AEDA 3AZZA 2Q4SA 2O8QA 1LHUA 4GMP0 4QMAA 3LGRA 2B39A 4F7ZA 2WA3A 4BMBA 4JGZC 1ULGA 1MEC3 2EAAA 2XWBB 1ZZ9A 2ZTNA 5KXEA 4XIOA 3IDEA 1MACA 4XBLA 2ZGUA 4LUKA 3R6SA 1QXRA 3RYKA 1RITA 1NG0A 3EQEA 4LR4A 4QQ2A 4D7TA 1MQTB 2WNUA 1VBD2 1RMU1 4CDXC 4B8EA 3OGJA 3U0ZA 2ZGPA 2PFWA 1APNA 5KHJA 3N7JA 5JVVA 1W39A 3H50A 1ZBE3 3NWKA 1UX6A 5EV7A 3VKLA 3N7MA 3APBA 1MS8A 4X6RB 3VBFC 5JR7B 4KL1A 2D3SA 3MICA 3LB9A 3QBQA 4HVQA 2ZX3A 4CDQC 4XTMA 4IEZA 3LAGA 3ZFEA 4KQ7A 3TWIA 1M06G 1ND3C 3AP4A 4BCUA 2A3WA 3WZ1A 1O5UA 4FPFA 3ES1A 4BE3A 2P3JA 2YUEA 3FUOA 1CAUA 4AFBA 5KXDA 1XE7A 1RL3A 3BCWA 5E8AA 1N47A 1VB4A 4AI2A 4JRAA 5K0UC 4WBBA 3GHMA 2YY1A 3B93A 1GKBA 4MH0E 4ZU5A 4Z92B 1ZM1A 3ETQA 1A3KA 1JYIA 1AR71 4OHWA 2TEPA 3D4KA 2Q1MA 2CYFA 1PVC2 1UU4A 2RM22 5JIUA 1AL23 4MGKE 4NVPA 4YW5A 5AC92 1ASJ3 2A6VA 2RS13 3HD8B 1AR61 4HSLA 2BWAA 2MPFA 2W39A 1S0DA 1BVP1 3LA3A 1XU1A 5GZFA 1G9CA 4TLFA 1SBFA 1O91A 1S0IA 3AB0A 2ZZJA 4DPNA 3KT4A 1Q3EA 3CJIC 5LRRA 1RMU2 1ZYBA 3NAPC 3ZFGA 1R1A3 4LTAA 1MEC2 1RUE1 4FQZA 1FOD2 4OHVA 5CB7A 1I6XA 4LLFA 4XE9A 1VLNA 3FLRA 4YGCA 1U5XA 5ACA2 3AZWA 5I0SA 2K2SA 3AKQA 3VBOA 4P9XA 4Q8LA 4KGGA 4QQPA 2XB6C 5J96B 1G7YA 2ZHKA 4A2UA 4WVWA 3I4IA 2BFUS 3VL8A 4YM2A 2UWCA 5BUVA 2QZ3A 1G6NA 4GWNA 1GQGA 4D7SA 1KS5A 2XUMA 1JHNA 4CP0A 4EWDA 2RS53 1ZX5A 5C4WA 4OHZA 1Z78A 3H0OA 1AX1A 3WINE 1OD5A 1QWRA 5FAXA 1X7NA 3C2UA 2ZX1A 1CAUB 1W6QA 1ENXA 2RM23 3V65A 4YYOA 2SLIA 3ZMOA 2JD4A 2WT2A 1SBEA 3KZ4C 2PYTA 2CWMA 4WM8B 4MGYE 4XJAA 1VP6A 5BNPB 2OPKA 2WLPA 4IEOA 2RR12 1LECA 4K7JA 3I59B 1KS4A 1LULA 4GWMA 4I3GA 2OA2A 4PIYA 4ASLA 4HZFA 5JSPA 2R32A 2NPIA 1RHI3 1KRIA 1AXZA 1SFNA 1WA4A 2VULA 4Q4V2 3K51A 3PMSA 4YGDA 2HEWF 1Y43B 3ZXLA 4XJUA 4W6WA 4HFSA 3H1YA 3AJZA 2JECA 2HWB2 3MW2A 4IEXA 2YZ4A 1LOGA 3H7JA 3FBMA 2EALA 4LHNA 1H8TB 2B42B 4FT8A 4TYSA 1FMD3 1QF3A 1FXZA 2CY6A 3AZYA 4QX5A 1UN1A 4W6XA 1JBCA 1HLCA 5JMCA 1AL0G 3MIBA 3VBOB 3V0AB 1AYM1 1PVC1 4UBGA 4Q1RA 1W6OA 2E7TA 1BEV2 3MZHA 4RHV1 5EYXA 4QPYA 3O14A 1PO11 5I93A 3RMXA 1F5FA 2MHFA 4HETA 1PGSA 1O5LA 4YZ2A 3BODA 3N7LA 4J1WA 3TOJA 4XJ9A 1DZQA 3J8F1 3PVNA 4HPKA 2IFRA 1RVF3 3USUA 1VBE1 1S0GA 4JGZA 2G9GA 2ZMLA 4R9BA 2GSYA 1OMIA 1QJY3 1RJ8A 2DVDA 4PCRA 1IKPA 2GNTA 3HN1A 1ONAA 4JAAA 4CDUC 3DUIA 2RR13 4LUMA 4F8AA 1R093 5I8TA 1FMD2 1K5MA 2E9QA 1BKZA 4AHXA 3NV4A 1V6NA 3ZPYA 3NAPB 3FBYA 4KU8A 3NAPA 3ZFGC 2IWGB 1NQDA 1SQ4A 4XQDA 2ZX4A 3C3VA 3MI8A 2NYYA 1LEMA 2D6PA 4EN9B 4N9IA 4YLZA 4BA6A 1WW4A 1W0PA 4K8FA 3ZXFA 5JCTA 3VDDC 4COVA 2E7QA 4BLIA 4XTPA 4YVSB 2WIIB 1WLWA 4IEWA 4AGGA 3MW4A 1R092 1MZEA 4QM8A 3S7EA 3VZLA 3ENRA 3ATGA 5JPNB 2P17A 1AX0A 4CDWA 4CEYB 2R073 3R4UA 5CFCB 2D6MA 4XBQA 3BU7A 4XQWA 4BQ1A 4CEWA 2R16A 1Q8OA 2V09A 4XXAA 1AL22 4M3CA 4ITCA 1O3QA 1FNZA 2ZMKA 4H3WA 1UMZA 2CGOA 3OCPA 2FQPA 2VNOA 4LE4A 4Q4X3 2MEV3 5CFDC 1VBA1 2YDEA 2CWSA 2LM3A 2YYOA 1G9BA 1LOBA 1RC6A 1PIV3 3B3QE 5EZWA 3WG2A 4HPKB 3MDPA 2JICA 1OA3A 3RSJA 4FP3A 4YVWA 1OFSA 2XL7A 1CPNA 1QNYA 2C0ZA 3NW4A 4LO4B 4B4RA 1AR82 4L92A 4WVVA 4Q4Y3 2JG8B 1IS3A 1CX4A 2HWB1 2EVXA 5L19A 4YG0A 1V6JA 1EV11 2EA7A 1QQP1 2AENA 3AP5A 4L97A 5FQ0B 2ZPXA 4EN0A 1N3OA 3PJYA 1UU6A 2OUJA 4Q4W3 4V1PA 3RRDA 3SISA 1HRI3 5JLVA 5EJ3A 3WDUA 1XQNA 2GNBA 2R041 4QPGA 3B94A 2NM1A 3ZYIB 4CP1A 2G4IA 3AKPA 5C9AB 5DDJ1 1ZZ7A 4QPGC 5T5PA 4QT6A 2RS12 1PO12 4AGVA 3VBOC 1GZWA 1RUJ1 5DUXA 3VN4A 1QNWA 4S2FA 1AYN1 1SMVA 2DVAA 4WVMB 2YGLA 1RUI2 1HQNA 4B3NA 4AVSA 2ZHLA 5JIAA 1SFYA 2HYKA 4Q8KA 4EN7B 1CD3G 1LHNA 3G6JB 2W52A 3LZZA 1YFWA 4I3PA 1W6MA 1R1A2 2D3PA 4AHYA 1PK6C 1CAVB 3D8CA 1IS4A 1L3JA 5IK8A 3KB5A 4FPLA 3ZSKA 3M3OA 3WG4A 5CU1A 1IS6A 1BXHA 5GLVA 5FPZA 4AQ2A