3WDVA

The complex structure of ptlic16a with cellotetraose
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
298
structure length
298
Chain Sequence
EFYHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGEIDIIEGVNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKFNAQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-1,3-1,4-glucanase
publication title Structural and mutagenetic analyses of a 1,3-1,4-beta-glucanase from Paecilomyces thermophila
pubmed doi rcsb
source organism Paecilomyces
total genus 73
structure length 298
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wdvA00
1JHNA 1WUVA 1YYNA 3AZXA 2ZGUA 1LODA 1QMJA 1GICA 3AYAA 1JW6A 1CN1A 3OYWB 3GALA 4P9WA 4Y1XA 5GJ6A 3AX4A 2E7TA 5DZFA 4FPHA 1MS4A 3VKNA 3BOPA 5H9RA 1W6QA 3W59A 2GNDA 4XILA 1SBEA 1SBDA 1FNYA 1LHOA 4K21A 1N3OA 3IKWA 2CY6A 1W6OB 5GALA 3WG1A 5L73A 5T54A 2W52A 4C1WA 1WD3A 2PHUA 2YY1A 2P37A 3QLQA 1DZQA 4YW1A 4H55A 1CPNA 3ASIA 5DG1A 1QU0A 1MACA 1W0PA 1S0JA 2R49A 3M2MA 2ES3A 2GNMA 2D3PA 2R0FA 2ZHLA 3ENRA 2GMMA 1QKQA 2WKKA 1V6OA 3IN9A 3RS6A 4AGRA 4YM0A 1KJRA 4GWNA 3SH3A 2YMZA 1FV3A 1RITA 3LSEA 1APNA 3GNEA 4AGVA 3FLPA 4BLJA 1CESA 3FUOA 3AFKA 1OKQA 5DUVA 4CZSA 3T2TA 3O12A 1U0AA 1MS9A 3ZYRA 5JOYA 1AVBA 2B7YA 1S0FA 2E51A 4LBQB 4WVVA 2VXRA 1FV2A 3ZXLA 1CQ9A 2P3JA 1S1AA 2ZGSA 5T5JA 4PQ9A 3D5OA 3FLTA 4M00A 4YW3A 2PHWA 2WT2A 2GALA 1VALA 1MS1A 4C1XA 1AXKA 2VY0A 1VIWB 1VLNA 1GZWA 5IT6A 3V65A 4YZ5A 1OQ1A 2DUPA 1SBFA 2D43A 4FPOB 5JOWA 1IOAA 1AX1A 1AJOA 1DQ0A 2W68A 5EWSA 3FLRA 1LULA 3VUOA 1MR5A 2Q5TA 3AXDA 3WNXA 2DYCA 4ASMB 4BMBA 2ZGPA 3RSJA 2EXKA 2ZAAA 4XHXA 1LHWA 4HANA 4JC1A 4XJ9A 1AZDA 4Y1UA 1HKDA 1Q8QA 3OJBA 2SLIA 5LK5A 1N1TA 1GZCA 2C9AA 1N1VA 3N3HA 4K20A 1BKZA 3TB0A 4DRVA 4WV8A 1S0BA 3WHTA 4XDQA 4ZXKA 3C2UA 1QGLA 1DHKB 3AP9A 4WVWA 3RG0A 4PBPA 4BQ1A 4Z8BA 1V00A 3VKMA 1V6LA 4Y20B 1G86A 2LTNA 3POSA 4AVVA 4M3CB 2WQZC 1LEMA 4LBOA 3I4IA 1YI7A 2VW2A 2OUHA 2BQPA 1AJKA 2A75A 1UPSA 3LCPA 4XE9A 3T1LA 3O0WA 3ZYPA 1Q8OA 3B00A 4K1ZA 5KXEA 3WG4A 1V6IA 1GYKA 1Q8SA 2YV8A 3R05A 1X50A 4ISQA 2VU9A 3IM0A 4P9YA 1G9FA 2UWCA 4GWMA 1F31A 2NMNA 3VKFC 4ZKTB 1W6QB 1SCSA 3FBYA 1DQ4A 1C4RA 5DZEA 2ZMNA 1JOJA 1LGBA 4Y1YA 3CNAA 1LU2A 1FYUA 2GNTA 3AXEA 3PJQA 4Q8LA 5EYYA 1VAVA 3WUDA 2NZ9A 3UK9A 4LBLA 3VV1A 2A3XA 2YZ4A 1WW5A 1Z78A 2A5ZA 1DYPA 1C57A 2AYHA 4XJAA 1GBGA 2R0HA 2ZABA 4FPCA 4FPYA 3ZXFA 3V0BA 4IQPA 3UJQA 4R9BA 1ENQA 4XBNA 1O4ZA 2A70A 3APBA 4U2AA 4XJ8A 2P34A 3VKOA 1IKPA 5H9PA 2EALA 2AENA 4XJUA 1N47A 3ILFA 3WCRA 5FRAA 4YM3A 1GSLA 4JRAA 2D44A 2ZGQA 4FPEA 4FQ4A 4Q8KA 1DBNA 1QOSA 3SNMA 1Q56A 1ULFA 2LALA 4XMIA 4YGBA 3OY8A 4FVVA 2DV9A 2R1BA 3B69A 3IMNA 1ENRA 1DQ1A 2E53A 2ZGOA 4NO4A 3VKLA 3M1HA 1YXWA 5DXDA 5CA6A 4YGDA 1GZWB 2JD4A 1DQ5A 5KXDA 4XTPA 5F5QA 3PMEA 4R9DA 2E6VA 2CNAA 4TZDA 3SH4A 2NP0A 3HR9A 1BXHA 1H30A 1ULDA 2JECA 5IUQA 2FHRA 5EYXA 4ATFA 4BLIA 1HQWA 3FUQA 1LOBA 3ILNA 5E88A 4CTEA 2ENRA 1FAYA 1LGCA 1WLDA 3O0XA 4UW5A 4MYEA 1G9AA 2FMDA 4XZPA 1SLCA 2XG3A 2VW0A 5DUWA 1QOTA 1F5FA 2ZMLA 4PCRA 4W65A 1KRIA 1AXZA 2A71A 2ARXA 1SLTA 4M3CE 2DU0A 3RMYA 2OW4A 4Q26A 1KQRA 1WBLA 5CAZA 1RIRA 2VUAA 4U36A 3BTAA 1OFSA 5HCFA 1XQNA 1IKQA 3MPPG 4XXPA 2WJSA 1GZ9A 3D4KA 4UW4A 2ZGTA 1UX6A 1CJPA 5AVAA 1Z0HA 3AJZA 2NN8A 2CYFA 4Y24A 2W08A 1QOOA 1S0EA 3R4UA 5IK4A 1Q8PA 1V6NA 4P9XA 3ZPYA 3JUUA 4YG3A 2GMPA 3RRDA 3Q9OA 4XIOA 1FX5A 4DS0A 3ZSMA 1CVNA 3DGTA 2WT0A 4YGEA 1Q8VA 4M3CF 4Y22A 3MW2A 1DIWA 2EF6A 2P3IA 2EXIA 4PBOA 3MEPA 3RMXA 2PELA 3NV2A 1A3KA 1PZ7A 2DUQA 4YG6A 4YZ2A 2DVAA 1A78A 1UZZA 1H9WA 2PHFA 4XOGA 1YO8A 2UU8A 4XBLA 1KDMA 1UMZA 3IPVB 1B09A 5HCBA 3M3EA 4YFWA 4NOTA 1R1ZA 3DUIA 5HCAA 1LOEA 4GA9A 1LEDA 3V0BB 3B9CA 3AZWA 4YGCA 5GZDA 3KQRA 4Y1VA 3N7LA 4YLZA 1ONAA 1V6JA 3WDYA 4BM8A 2A6YA 2NYYA 3A4UA 1DLLA 2GN7A 4RL7A 2AH2A 1D0HA 2DTYA 2DTWA 1LU1A 1NLSA 3KM5A 4YZ1A 4BMEA 5GLUA 2A6VA 3OY8B 5JLVA 4FOWA 2D3RA 2EXHA 3POWA 1S0GA 2ZACA 2R16A 4LBQD 4FPLA 3OBRA 1DFQA 2D6MA 3N7JA 3FFZA 1LOAA 3SLIA 5GZEA 1G9DA 2ZGMA 2XB6C 1JUIA 1KJLA 3AYDA 2JE7A 1AX2A 2WNEA 2AR6A 3INAA 4XTMA 2NM1A 1LGNA 4L8QA 2V73A 3PVOA 2V5YA 1G9CA 1V6MA 2RHPA 1LOGA 5SV8A 4YFZA 2NMOA 4LBKA 1WW7A 3IPVA 1A8DA 1BJQA 1N1YA 3AYCA 3D6EA 3WDUA 3WV6A 5F9TA 5T5PA 2ZGRA 4YW4A 3ZVXA 1AF9A 4XHBA 4YZ3A 1MVEA 3B01A 3WDVA 4FPGA 4BPZA 4AYUA 4PF5A 1C1LA 3L2YA 5GM0A 4KBBA 3PVEA 2DWRA 2CWSA 2ZKNA 4ATEA 3NV1A 1F9KA 3M3CA 1NXD1 1WCSA 2AREA 3LSDA 3AP7A 3MW3A 3SITA 1LECA 5BYNA 4XIKA 2UURA 2CWMA 2JKBA 2JE9A 2ZHKA 4LBJA 4XJZA 1URXA 1MZ5A 3HMYA 4XJWA 1LOCA 1AX0A 4Y26A 4YM1A 1JXNA 2A3YA 2HYKA 1Y7BA 2R1DA 3AYEA 3BODA 4M01A 5DG2A 2A6WA 4AVTA 4WZFA 1MS8A 1IS4A 2WLQA 3NV4A 2ARBA 3WCSA 4AGGA 3ZSJA 4Y22B 1DGLA 1W6MA 2ZZJA 3AP6A 5E89A 3WHUA 1LHVA 4LBMA 1SLLA 5JDBA 1QF3A 4GKXA 4FPFA 4UW3A 4LBNA 1JYIA 1CPMA 4GXLA 3NV3A 2DU1A 3OGGA 3AZVA 3WVJA 4DRRA 1G9BA 1IS3A 1JYCA 1SLBA 2E7QA 2WSVA 3T1MA 3ZXEA 1BYHA 2D6KA 5JOZA 1ULGA 1LJ7A 1AXYA 2Z42A 3W58A 1QNWA 1SLIA 4GKYA 5E8AA 4Q2FA 5H9QA 3SH5A 3OPZA 2D6LX 1CIWA 2DVGA 1CONA 1GANA 2GNBA 3PVNA 1UAIA 3WOGA 5IK7A 5CNAA 3WDTA 2JJ6A 1LENA 1N3QA 1UN1A 2TEPA 4YW5A 5JVVA 3V0AA 1S0CA 2VH9A 1WW4A 2ZBJA 2ZGNA 1YRZA 3USUA 3WDXA 1GLHA 3ZXJA 3POYA 4Q1RA 1JBCA 2A3WA 3I8TA 1H9PA 1BZWA 1MS3A 3N36A 4RA0A 4YG0A 5GLVA 1WW6A 3AJYA 1W6PB 1J1TA 2GN3A 3WG3A 1BQPA 4YW2A 1I1EA 2H0BA 2DVDA 4Q1PA 4XBQA 1W6NB 3V64A 3WG2A 1WBFA 1RINA 3A0KA 4SLIA 2KM2A 1IS5A 1I3HA 2PHTA 5EXOA 5GZCA 5IK5A 2ZHNA 3BIWE 4FQZA 3OYWA 3WLUA 3WZ1A 5GZGA 3ATGA 1G8WA 4AWDA 2SBAA 4R9AA 2D3SA 2WT1A 3O5SA 2CL2A 3AP5A 2P3KA 1UZYA 1HLCA 1WLCA 1SCRA 1QDOA 4ISRA 3R4SA 4YM2A 1W6OA 1SACA 3WUCA 4BOWA 1LCLA 2GMEA 5IK8A 3NWKA 4DFSA 1GNZA 3OBTA 5KXBA 1VAMA 3WDWA 2YXSA 1DQ6A 4HL0A 2UWAA 4ITCA 4Q27A 1PZ9A 2I2SA 1UKGA 2P2KA 4JCKA 3UL2A 1O4YA 1FNZA 3ZSLA 1GNHA 1GKBA 2OVUA 4P14A 1DYKA 3ZXKA 5T55A 1QDCA 4D69A 1PZ8A 1LTEA 1LHUA 4FOQA 1W6PA 5GLWA 3N7KA 1LHNA 2CTVA 2ZGLA 3O0VA 2D6OX 2UWBA 4F83A 5GLTA 1W6NA 4YZ4A 2A6ZA 4XYXA 1MZ6A 1ZA4A 4OZXA 1D2SA 3U4XA 1QNYA 1TEIA 1UL9A 4LBQA 1MS5A 1KDKA 4XMAA 4UW6A 5DUUA 1ULCA 1LOFC 3JU9A 1LESA 3ILRA 1GV9A 4Y1ZA 1V6KA 1EPWA 1W6MB 1WD4A 2YROA 5T52A 3H0OA 3TAYA 2D7FA 4R9CA 1ENSA 4FOYA 2PHXA 5GZFA 3MW4A 1SLAA 5T5OA 1C1FA 3AZZA 2DVBA 3M3QA 5JMCA 5DUXA 4AVSA 4I30A 3N35A 1G7YA 1S0DA 2ZHMA 5DZGA 1JN2P 2A7AA 1N1SA 2OUJA 3M3OA 1HQLA 4FP2A 4GALA 4K1YA 3RQ0A 1MS0A 2WSUA 2VW1A 5CBLA 3SISA 3ZSKA 2AGSA 5GLZA 3A0NA 2AUYA 5T50A 1ZM1A 3AK0A 2G4IA 2ZGKA 5CB7A 4DQAA 1ULEA 3B3QE 1FATA 2EAKA 3N7MA 3V0AB 1N3PA 2EIGA 1HDKA 1LOFA 3AZYA 4FPKA 5T5LA 1YIFA 2GDFA 2DUOA 4FPJA 3UJOA 2C5DA 2D6NA 1W0OA 1CR7A 1KITA 3USUB 2ERFA 1SFYA 2W39A 1DQ2A 2ZA9A 3HN1A 2PHRA 4FOVA 4Y20A 4CRQA 1S0IA 5JOXA 3AP4A 2DURA 1WLWA 4M3CA 2ZMKA 5H9SA 3QCWA 5FREA 5KXCA 2DVFA 2A6XA 1MVQA 2D6PA 4DPNA 4TYSA 2JDZA 4XXAA 2EXJA 1IS6A 4FP3A
chains in the Genus database with same CATH superfamily
3H8OA 1AYM2 3K77A 1LODA 1HIXA 1GICA 3AYAA 1YLLA 3U11A 1JW6A 1VBA2 4RHV3 5C70A 3GALA 4CDUB 5J96B 3POIA 2KD7A 4QAWA 1PNFA 1ZBA2 2ZPXA 2VCAA 4YVSC 5H9RA 2CGNA 3BTXA 5FZAA 4BQ4A 4ARXA 3ZKUA 3M7AA 1SBEA 3LIHA 4N8MA 4XUTA 1VBC2 2VMDA 3AMMA 5FPZA 2CY6A 3IIIA 5IAXA 4CU8A 5FYBA 2KXLA 3BALA 5L73A 4MLOA 2RS31 2XKOA 4C1WA 4DUWA 2YY1A 5FV3A 5FPXA 1PIV1 4NPMA 1H8TB 3L2HA 3HT2A 5G05L 4CA9A 1S0JA 2J1UA 1J3QA 2ES3A 2WZR3 4AEKA 2GC3A 2JE8A 4KGGA 1JU3A 2RDNA 3RS6A 1J84A 5FPUA 4V2VA 3MIGA 1MEC3 5K9YA 4GWNA 2VZUA 2WS93 4MZUA 3ACIA 2YU1A 3WP3A 4ASKA 2R072 1H2LA 1UXZA 3DKQA 3ST7A 3WF4A 3K48A 1BMV1 3AFKA 2OX0A 5FYZA 1PM4A 1LAJA 1QJY2 3B9IA 3HOBA 3RI8A 1AVBA 3VDCA 2B7YA 4LK6A 4WVVA 5FMOS 5FZ6A 2JX9A 4B29A 3D5OA 4YW3A 4Z2AA 4QPGC 1FOD2 4CCEA 5LA2A 2VY0A 3ZMOA 4A2UA 1RUNA 4FPOB 5F5IA 5JOWA 5CZKA 3URFA 1QIQA 2X5IA 4Q4Y3 3O1TA 5A1FA 2Q5TA 1AL21 3SHRA 1UYXA 2DYCA 2VZSA 4FFGA 3DYMA 4MVTA 3VDDC 1ST8A 4ASMB 3IDAA 4V1PA 2V09A 4K9SA 3S7IA 4JC1A 1R1A2 4IETA 4QPYA 4AFBA 4WVZA 5FPLA 2XVLA 3OBZA 1N1TA 1HB1A 2JENA 3P6BA 2C9AA 4A41A 3WF0A 2CAUA 2VMGA 5IHRA 3T08A 3WW1A 3N3HA 2JB8A 1XBFA 2JXAA 4L97A 1W9WA 4D94A 4WV8A 3TRSB 1QGLA 3E5QA 2RS12 4PBPA 4NHKA 1O8PA 4N43A 2XBO2 1JTZX 2XL7A 3I7DA 2LTNA 3B02A 2BRTA 2WQZC 4CCNA 1LEMA 1RUD1 3OUHA 3FFQA 3LDBA 4A3XA 2W0XA 2W5FA 4GB33 2BQPA 1PVC2 3MYXA 5T3NA 3LCPA 1R093 3PLQA 4K1ZA 4UF0A 3WG4A 4Z1VA 1V6IA 3GBGA 1Q8SA 4E4HA 3FHIB 1X50A 3I97A 4FSJA 1RUF2 1TME1 4GWMA 4QPIC 4JQRA 3HNBM 4ZKTB 1PO22 1W6QB 4F7ZA 1UZ0A 4J6GA 4PIYA 2QQOA 4QDRA 1FYUA 2W46A 4Q8LA 4HOOA 5A32A 2A73B 2E63A 4LT5A 2YZ4A 4FAHA 4P5YA 1WW5A 2BP6A 3OGJA 1DGRA 4LO5B 3VZOA 1XYNA 2W47A 1SDDB 1QQP3 1RUG3 2OT7A 1GBGA 2ZABA 4FPCA 1MQTA 2VGDA 1RXGA 4J1WA 1FPN1 1ENQA 3DYPA 2A70A 3N9QA 3APBA 4XBNA 5FLJA 4GH4C 1O6UA 2P34A 3VKOA 1IKPA 4XJUA 4XEZA 4YM3A 2D5FA 2P5BA 4Q4X3 3Q8FA 2ID4A 3MICA 4BJ0A 2Y6FA 4YVSB 1D4VB 1E5RA 4JGYA 5FY0A 4NHLA 2BVBA 3OY8A 4FVVA 4HKLA 2JIJA 3B69A 5DAQA 4A44A 3IMNA 3NW4A 2ZX2A 4AQTA 2E53A 4XUNA 2VOXA 3M1HA 1QJFA 5KXDA 4XTPA 1UZVA 2RS53 2OPKA 5F5QA 3VBFC 3HQRA 3K51A 3HR9A 3HNYM 1H30A 1ULDA 5IUQA 3FN9A 2FHRA 5EYXA 4URTA 1DU3D 1HN1A 3FX3A 4BLIA 5LWBA 4COVA 2CGOA 2BZDA 4CDXA 3PHMA 1EUTA 1WLDA 1OA4A 3O0XA 4UW5A 3RPQA 4OHYA 1G9AA 2VC9A 5IJRA 1NCRA 2YBPA 2XG3A 3LEMA 3M3IA 4UOJA 1NCQB 5DUWA 3KV5A 1QOTA 1F5FA 1QJX1 3N9LA 1H1IA 4GQ7A 4LA3A 4QX8A 4AHZA 2LW8A 4OMDA 1ZA7A 1AXZA 2XLGA 2A71A 1RUI1 5CKNA 2DCJA 2I45A 5K4LA 2NPIA 1GOHA 1C8M3 5F2SA 1OA2A 5JSRA 5FY9A 4K8RB 3N9NA 3I54A 4X8NA 3MPPG 4NN0A 3EMRA 1GZ9A 4WM7C 2KA3A 4OYUA 4GMP3 4UW4A 5FZLA 1DCSA 3AJZA 4BIOA 1V9U3 2IXHA 3HPNA 5LY2A 4Y24A 5KR7A 2VZPA 3DV8A 5A6YA 1QOOA 2D97A 1Q8PA 1REEA 3P5BA 4P9XA 2RS32 4Y5TA 4Y4YA 3JUUA 2VZRA 3VD3A 3VDDB 4IEOA 3ZFEA 1PIV2 1NXMA 1YIPA 1M4WA 5DN2A 4ZU4A 1JZ2A 1V70A 4MV2A 5LY1A 1CVNA 3IT8A 3DGTA 2ZEZA 4YGEA 3AKSA 1Q8VA 3VL9A 1DIWA 4AEDC 5A3LA 1NY71 4PBOA 1XE8A 4P02B 3RMXA 1VMHA 3I2OA 3OD4A 2PELA 4D8MA 4X6RB 4O65A 3NMBA 3LDRA 4HT1T 1PO11 1BMV2 2XWBB 3HBZA 4XZUG 2VZTA 2XOMA 2DVAA 2RMU3 1A78A 1S4CA 1UZZA 3JXSA 4NR1A 4RFRB 4XOGA 5F37A 1BLZA 1UMZA 4XVHA 3VHOA 1B09A 1JS9A 1OOPC 4IGOA 3M3EA 4LNVA 4DY3A 2ZEWA 2BWCA 1LEDA 3OPTA 3V0BB 2PLV1 5FQ0A 2ET1A 4WVMA 1SMVA 1VRBA 4Y1VA 4YLZA 3WDYA 1RJ7A 1NYWA 2A6YA 3UETA 5JXIA 4HKOA 4E4DX 2WZ8A 1RVF1 1YNAA 2AH2A 1JZ7A 3A21A 4QPIB 2DTYA 5L19A 1AL22 5AC93 4CP1A 1LU1A 3MFCA 5L36A 3ETQA 1Y3TA 4YZ1A 4BMEA 2QE3A 3PNAA 4FOWA 1PK6C 2VZVA 3POWA 4FPLA 1UW8A 5IYYA 1L3JA 3OF1A 3VD5A 1G9DA 3LB9A 4BQXA 2QQJA 2VUDA 3WW2A 5ABJC 2RV9A 1FMD3 4CU6A 1AX2A 2QQUA 2WNEA 3CIHA 3O1MA 1JH5A 4Z82A 1W2UA 1HXS1 2RJLA 2V73A 2V5YA 3KCCA 5HXVA 2JDKA 2GP3A 3CF6E 1LOGA 1VBE1 1NA1C 2OA2A 4GH4B 4YFZA 2ARAA 3IPVA 1BJQA 3AYCA 4JX0A 3WDUA 1B35A 3S5AA 2E7AA 1RUD2 2ZGRA 4YW4A 1OPOA 3ZYGA 1U5ZA 4YZ3A 2V5DA 1KEXA 1MVEA 4TN7A 4NIDA 3WDVA 5DMYA 1QJEA 2BYVE 1XNCA 1ZX5A 3FE5A 5GM0A 3PVEA 4MOAA 2DWRA 2CWSA 4IE6A 2ZKNA 3H1MA 4ATEA 3KV9A 4LKEA 3M3CA 1D4M3 1WCSA 1ND2A 3N9PA 3AP7A 1HRV3 4I01A 3SITA 3WNKA 3E1F1 1TME2 2DCKA 4BB3A 4FBFA 3VBFB 3W20A 5L7OC 3AKPA 4AI2A 2JG8C 5BNPC 5C9AA 3RZHA 3ZFGC 4EROA 2BW8A 5EQUA 3MO4A 5BNOA 1UY0A 4N7IA 4XIKA 2UURA 4QGNA 2JKBA 5LBBA 1W2OA 4AFMA 3KF5A 1YFWA 1RMU3 2CU5A 1GUIA 3HMYA 4EN6B 1ODNA 4XW3A 1VBD3 3BODA 5A33A 4QB2A 1UKRA 4AVTA 2HWE1 2AZ5A 4QWNA 3NV4A 5C8CA 2JDYA 2ZZJA 2Y0IA 1ZBE3 3U0ZA 3HAGA 3NKGA 1QF3A 1KS5A 3MHZA 5FZOB 4UW3A 1FPN2 3JQWA 1CPMA 1A8MA 1W2AX 1X82A 2W94A 3J8F3 3NV3A 4GXLA 4MHRA 4S2DA 5LBCA 1G9BA 3KF3A 1JYCA 1SLBA 4D7SA 3WW4A 4IV3A 2P3YA 3PUAA 1ULGA 3MZHA 2WFPA 3TEXA 1O3QA 1LJ7A 2Z42A 4XDOA 2JG9C 4YWAA 3W58A 3SH5A 4WM7B 4L92A 5LRSA 1REDA 1U5IA 4Q2FA 5H9QA 4B3NA 2D6LX 3T0DA 4ZU5A 4QU2A 1X9PA 3H8UA 4KWLA 2GNBA 5E6HA 2Q1MA 4OHXA 3VDBA 3JD71 3RJRA 5CNAA 5IK7A 3I2FA 1ZYBA 1N3QA 1UN1A 2PAKA 2EVXA 3HT1A 3DPRC 4RHV2 4DNYA 1S0CA 2Q30A 2VH9A 3I3MA 2PAMA 3HWJA 1WW4A 4QHOA 5LZ6A 1H4HA 1GWKA 1XNBA 2FQPA 1WCUA 2WFF1 4AEDB 5C5TA 1ASJ1 1XNDA 5D2AA 5D8AA 4DXTA 1IQDC 4E8DA 4Q1RA 2H6BA 1UIKA 1Z7S3 2PHLA 4BYYA 5FXWA 1GP4A 4AG4A 1UMHA 3UNPA 2D40A 1J1TA 2WNVC 1OF3A 1RUOA 3V64A 2PFWA 1DG6A 1QJX2 2VJXA 1WBFA 5BV6A 1JYXA 3A0KA 1PGL1 4QQOA 1K45A 1I3HA 5FUPA 4BWOA 4IV1C 1RUI2 1OOPB 2PHDA 5GZCA 1RUC1 4RSUA 1F15A 4FQZA 5IK5A 1ZZ7A 4CE8A 4CEWC 1T6GC 1WLTA 3WLUA 4CDUA 1NE6A 3FL7A 4AWDA 2IXCA 2SBAA 3O5SA 3MLLA 3ZKYA 5CKMA 1WLCA 3B5LB 3K4AA 3MPBA 1SCRA 1MZFA 4O9GA 4YM2A 4MUVA 4QX1A 2GMEA 1UOFA 1R083 3VBSA 4EZ4A 1H8TA 3WDWA 3C7HA 2IFWA 4EQVA 4HL0A 1PK6B 1GOFA 1NQJA 4ITCA 4LOTA 4Q0QA 3ZM8A 2LS6A 4UYBA 2P2KA 1COV3 2BTVC 3LEKA 3UL2A 5DQ0A 1NUKA 4EN0A 1NY72 4P14A 1DYKA 1UOBA 5T55A 1LR5A 1PZ8A 1W6PA 3TWIA 2ILMA 2FDIA 3GBWA 3POJA 1PO12 5GLTA 4KWJA 4MHUA 5C7GA 1OHFA 1NA1B 1UO9A 4PIZA 1QNYA 1UL9A 4QX5A 1MS5A 1CX1A 5DUUA 4IE4A 2D93A 4BU2A 2HWC3 2QVSB 2VQ0A 5DAVA 1LESA 1WGPA 1UX7A 5T52A 2YROA 3VZMA 4AVAA 3PUQA 2PQQA 1PX4A 5IAVA 4R9CA 2X8KA 2PHXA 2PLV2 2XXZA 3THCA 3M3QA 2DVBA 2W87A 2W3JA 3H1WA 4FTEA 5FO7B 2WINB 1IHMA 3C8XA 4GWIA 1RVF2 4GALA 4CDQC 5L7OB 4I3PA 2WSUA 1U12A 5BNPB 2ZS6B 1DP0A 2VW1A 3ZFGB 4GJZA 3T09A 3I2HA 3K46A 5IWFA 3TN93 1UNBA 5T50A 3ZN6B 5I91A 3BB6A 1GNYA 4XC9A 2K2SA 1BVP1 1AUYA 3FZ3A 4ORFA 4RGAA 1OFNA 3B3QE 3THPA 2QQMA 2EAKA 4INDA 1K5MC 1ACCA 3C7FA 3IAQA 2X09A 3POEA 1AR61 2DUOA 1HXS2 2D6NA 3C7GA 1CR7A 1LB2A 1BEV3 4P9GA 3HN1A 2ZTNA 2PHRA 5I93A 1VBE2 5LRRA 2XR4A 4LOSA 2BOJA 4PLOA 1DZTA 5H9SA 4AF9A 1JU4A 1OLME 2Z5WA 2DVFA 4DPNA 4FXKB 3S30A 2HWD1 3BPSA 2JG9B 1J1LA 1WUVA 4LHLA 3AZXA 3PVBB 4KBZA 4AE2A 4P9WA 3ELNA 3HQUA 3C3VA 5GJ6A 4DMIA 4YRDA 1HRI3 2C24A 4NPRA 2HWF1 4FPHA 1AR83 3DPRB 4D7TA 1U5XA 2BVVA 2BU9A 1W6QA 3RGBA 3W59A 4L9BA 4A45A 4XILA 1LHOA 3IKWA 4EN7B 2VOTA 1AYN1 4L99A 5FIXA 1C8NA 1WD3A 4FO9A 2RJ2A 3DEMA 1ZRRA 4IEXA 3OEBA 4IL7A 2Z2SB 3RVHA 3O1RA 4YW1A 3R0RA 2QJVA 3S0MA 5DG1A 3ZFFA 3D3AA 1MACA 3MBWA 1XYPA 2HWE2 3CMGA 2WNVB 2ZHLA 2GNMA 2D3PA 4NIIA 3ENRA 5FZDA 4AGRA 2Q1ZB 1FT9A 2PXJA 3SH3A 1FV3A 5AVPA 3R6SA 4NE9A 5C8WA 4IV1B 5IVCA 1IPKA 4R4XA 4BLJA 4Q5OA 4CEWB 1W8UA 4ZY9A 4EWAA 4MADA 4IEZA 1GOGA 3HQXA 3T2TA 1LNSA 3WF2A 1MS9A 1VB4A 4Y3OA 3LE0A 4EE2A 4YVSA 2YC0A 1EAH1 4LBQB 2VXRA 1SG3A 1AR93 3ZXLA 5FZBA 2LRPA 2P3JA 4LXLA 2XJTA 4BHPA 4BQYA 4DOUA 3AFGA 3VZNA 4P00B 3MDPA 3FLTA 3Q8AA 2PHWA 4BXSV 3WEZA 1MS1A 2RS11 3JD72 3FHAA 5FYTA 3LOBA 3VBHC 1JOBA 4V2WA 5I0UA 4YZ5A 1PGSA 4OMCA 1RHI3 3SCHA 1J3RA 4XF4A 1DQ0A 5EWSA 2WFF2 5CFDC 2VMHA 1ASJ2 5DAPA 1WMXA 3VDAA 5HV0A 3NNFA 5LA9A 3WNXA 4BMBA 5JI9A 3OTFA 3VD7A 3MV11 1RUJ3 4QGMA 2EXKA 2WBKA 4JV4A 4XETA 3ZO0B 1LHWA 4M4RA 3ABZA 4XDPA 4XJ9A 1AZDA 2VBBA 1NCQA 1Q8QA 5FY8A 4MX3A 1W2TA 3ACHA 1PO21 4X6QB 3ZN4A 1PGL2 1N1VA 2FDJA 1J58A 2JDPA 4K20A 5DPNA 1BKZA 1RUC2 3TB0A 4DRVA 5FZGA 3CBNA 4HK8A 4ZXKA 1DHKB 2WO3A 3AP9A 4L2NA 2FDGA 1BHGA 5FZ9A 2VG9A 3KGZA 1V6LA 2F17A 3LOIA 3H3UA 4HFSA 3GF6A 4LBOA 4HVOA 4W6YA 4ARYA 2G9FA 4CDQB 2OUHA 4KU8A 5BY5A 3VDDA 2WNOA 2A75A 3JCIA 5FDBA 1TQ5A 5CADA 1UY3A 5A6XA 3ZYPA 3B00A 3HVDA 4XF3A 3DECA 1GYKA 2YV8A 3R05A 3U4SA 4CCJA 4CDWB 2VU9A 3IM0A 4P9YA 3I2GA 5L9RA 1G9FA 4AHWA 1F31A 3VKFC 1A6CA 4RGKA 2W95A 3FBYA 4MGQA 3E97A 2ZMNA 2OKXA 1JODA 3GDBA 4Y1YA 2XJUA 3VBRC 1BK0A 1K12A 4AI1A 5JWPA 5A6ZA 3BTYA 4UT5A 1JZ5A 1JOPA 4HVQA 5I0RA 3UK9A 4LULA 2QQIA 2QQVA 3I3DA 3VV1A 3LA3A 5CG9A 2VL4A 4Y5SA 1OPMA 1Z78A 2JDUA 4AAXA 5B2GB 1KS4A 1SPPB 1GZTA 2Y0OA 2AYHA 4NWVA 3EO6A 4CP2A 2VO5A 3HIFA 3SKVA 3U1XA 3O1UA 2YYOA 3RNSA 1D0GA 4NVPA 1BBT1 4ET7A 3V0BA 3QOPA 4DUVA 4R9BA 2RR11 2BGOA 4U2AA 4DXRA 5FO8B 1W8TA 2AENA 1QWRA 1N47A 3ILFA 4LUMA 4XF1A 1YFUA 2WDBA 1QHDA 4JRAA 2D44A 2WNUC 4Q8KA 3PDQA 3SMHA 1QOSA 4QPIA 4COYA 3SNMA 4D6QA 3NRUA 3OGVA 2OZJA 2LALA 2LROA 2RM21 4XMIA 2XJPA 4UFIA 3BN6A 2R1BA 3OBAA 3AM2A 3GZEA 4Y33A 1H1AA 3O1SA 1QEXA 2ZGOA 3J9SA 1YXWA 4E2GA 1GZWB 3JZVA 4AFAA 5HXMA 3PMEA 1STMA 2E6VA 4FCAA 4HXCA 1BXHA 2JECA 1VBB3 2JD9A 1AR62 3WW3A 3HNMA 4JGZC 1PM7A 5CVRA 1H4GA 1XE0A 2G9GA 4O61A 5E88A 2ENRA 3KGLA 5A80A 1FAYA 1RUE1 4QHBA 4GH4A 2Y6LA 4HMZA 4KG0A 4FI9A 1F4AA 5FZFA 4XUPA 3RZMA 1QXJA 2ZMLA 4GMP0 4PCRA 2Q8CA 1KRIA 2HWD2 2WWJA 3ETPA 4CXWA 4QDSA 3L9JT 2ARXA 1SLTA 4M3CE 4EZHA 1O3TA 5SV5A 1EP0A 3KB5A 2WIIB 1ZZ6A 1KQRA 2ZXQA 2W1WA 5IVFA 3FHQA 4LLOA 3AMPA 3VBHB 2R063 3VD4A 5A1AA 2HWF2 3CU7A 1OFSA 3VBFA 4ZHNA 2QQNA 3EJKA 1HJFA 2WJSA 3D4KA 5AVAA 3RJ2X 1UX6A 1CJPA 1XNTA 1Z0HA 1CAXB 2NN8A 5FXXA 2CYFA 5I0SA 1GR3A 5JPNB 5EJ3A 5FZCA 1WWYA 1AYN2 3ZR6A 1ZNPA 2W08A 4UAPA 1V6NA 2BGPA 3ZPYA 1O3RA 1GWMA 4YG3A 2GMPA 4JKKA 1RJ8A 3O1PA 2VNGA 3H3LA 3ZSMA 2MEV3 3CEWA 1IZ3A 3MW2A 4UFHA 5FZ1A 4IDZA 2C4XA 2P3IA 2ORZA 1HB3A 2EXIA 3A22A 3J4UH 4IGPA 4IUGA 2VCBA 3OCPA 3KVAA 1KD7A 4URAA 1DLCA 1W8FA 1M06G 1A3KA 2H6CA 4I02A 2DUQA 4H7MA 2CV6A 3WQ7A 2DDUA 4YZ2A 5A70A 1O4TA 3POBA 4OI4A 2PHFA 1CAUB 4WM7A 1EAH2 4B8EA 1YO8A 2UU8A 4KQ7A 1KDMA 5JR2A 3TEWA 5FZEA 1POV1 5HCBA 5F32A 4NOTA 5BPXA 1OQEA 3DUIA 5HCAA 3GJBA 2VD7A 3JBG3 4QB1A 1QJU3 1UD1A 4YGCA 1VAKA 3VBUC 1ULPA 1UYPA 5I8YA 2XMLA 1Q5OA 5J98B 1F5JA 5ACA1 2W9XA 2NYYA 4Q4V1 1XC6A 3A4UA 2GN7A 4O9EA 4AEDA 4CCMA 1K3IA 1VR3A 2RE9A 2J22A 3K75B 1FI2A 2DTWA 4NRMA 1XPWA 2R043 3CL1A 3CQOA 4UBGA 3KM5A 1AR71 1E5SA 3VBRB 1S0GA 4LBQD 4QX2A 2VECA 1JYNA 3NNLA 1O7FA 4FT8A 4GJYA 5GZEA 3SEPA 2ZGMA 2VBDA 2XB6C 5BNNC 2DFCA 1RUH1 4XTMA 2JE7A 1SFNA 3ZXGA 2YHJA 1OOPA 3INAA 5FZMA 2FD8A 1JYWA 1RYYA 3NJYA 4L8QA 1I9RA 4BDVB 1G9CA 2VNOA 1GP6A 2RHPA 1A34A 1W03A 1HB2A 2NMOA 2VOWA 5F9TA 5CYYA 1VMFA 3D6EA 5ANQA 3SCFA 5T5PA 1H0BA 2BOIA 2WNUB 3NNJA 2XQRA 1JYTA 3LQCA 3B01A 4FPGA 4IE0A 4BPZA 2ZX1A 4NAMA 3RWKX 1VRH3 2B4KA 4AYUA 3L2YA 5K7PA 1PK6A 2OXBA 3JB4C 1WZXA 3NV1A 4HVRA 1F9KA 3CKHA 1DGRN 3LSDA 4PIXA 4CYDA 5J1XA 1DYOA 3M4FA 5KBFA 4LO8A 2YB7A 2WN2A 1ALYA 1GQHA 5D21A 3BKZA 4A7YA 2CWMA 1OH3A 4JGZB 1CZSA 1OD3A 4HK9A 4XJWA 2BWAA 1LOCA 5FZKA 1C5HA 1NA1A 1JXNA 2BNNA 4RHV1 4YM1A 4LITA 1Y7BA 4M01A 3J7NA 4HSJA 1MS8A 1BCXA 4YYOA 3ZR5A 2ARBA 4PF1A 1HN0A 2BFUL 1RGSA 5E89A 1YCIA 3NNGA 1V0AA 4QMAA 1BBT2 1LHVA 4LBMA 1CAWB 1WKYA 2TNFA 2VMCA 1RL3A 4GKXA 4XQWA 4DO0A 2RR12 2VR4A 1JYIA 1ZRFA 2DU1A 4I0AA 2Y34A 2ZKLA 5KHIA 2E7QA 2JDHA 5FYCA 2Z79A 5HBAA 3ZXEA 1BYHA 3DKWA 3E6BA 4UFMA 5L7OA 3CHXA 5BNPA 2WZR1 2FCVA 5E8AA 3ZFGA 3T2OA 4R4ZA 1UY2A 1XE7A 2RM22 2E9QA 3OPZA 1MEC1 2VQAA 4Q4W3 2WAOA 2QQLA 2VNVA 2B42B 2WS91 1CONA 3BU7A 2DFBA 3HBKA 1VE0A 3PVNA 4QPGB 3ZN6A 2P6CA 3NJZA 4YPJA 1UY1A 3KVBA 1BVVA 2TEPA 5JVVA 1YQ5A 4UFJA 1ND3C 2HBUA 2W2IA 3FBMA 3OUIA 1EPZA 3TYJA 3AVSA 4F8AA 3DL3A 2WQ4A 1W9TA 4JDMA 5FLHA 5TSWA 1AR82 2X5IC 3OEAA 5FY7A 3TOJA 1YRZA 2DCTA 4LO6B 1GLHA 1OVPA 1JBCA 2A3WA 4LKDA 3WT3A 1RUE2 1L7RA 3BIEA 1L7QA 4RQPC 4AZZA 2V72A 3LGRA 2HBTA 2BNOA 4YW2A 1I1EA 4MSVA 4Q1PA 3BUCA 3DF0A 3PU3A 1W6NB 2JG9A 4QHZA 1VPHA 4HN0A 1AHSA 4Q4Y1 1NLQA 1IS5A 2PHTA 1CZVA 2P6HA 3WP4A 2ZHNA 3BIWE 2WABA 5I8SA 1KXGA 2HWB3 3WZ1A 1HB4A 4R52A 3KMHA 4JTOA 3AKTA 3KS7A 4YVWC 1NG0A 1ULOA 2QDNA 2WT1A 3T0BA 3TBDA 3DPRA 4BQ2A 1UYZA 1HLCA 3BYWA 4ISRA 1QDOA 5C3RA 3N9MA 4Q0SA 4KNCA 4RR3C 1LCLA 2VTFA 1AR92 3NWKA 1I5ZA 2RDRA 4XAAA 3J7LA 1GNZA 4A3ZA 2Q8EA 1US3A 4P9IA 3I2JA 3PIGA 4DIQA 2UWAA 1VMJA 1UPIA 2WNVA 4DXZA 2VZOA 3ORJA 5CISA 1FNZA 3WF3A 3MUZ1 1QJZA 1PHMA 1F2NA 1GNHA 1GQGA 1YWKA 2A1XA 3CJIC 2MHFA 1QDCA 4IV1A 4D69A 1LTEA 4FOQA 1EV13 5EJZB 1H2MA 3GBFA 4GB31 4XXAA 2IFRA 4CEWA 2CTVA 3WP5A 5CKQA 4NPLA 1VB2A 2CHHA 1OQDA 2A6ZA 1R091 1ZRCA 4OZXA 5A3OA 2WUHA 4XAEA 3RZKA 1GMMA 1E5HA 4LBQA 2HJIA 3KT1A 5EJ1B 4W4ZA 1ULCA 1WCKA 1LOFC 3JU9A 3ILRA 4ES8A 1V6KA 1EPWA 1YJLA 2N7GA 3H0OA 4JTNA 1MQTC 3GYDA 4CP0A 3OOXA 1MZEA 5JMCA 3AZZA 4FXGB 2JB4A 5DDJ3 5DUXA 4AVSA 5CFCC 3J7MA 5ACA2 1L7LA 2XGXA 1S0DA 2ZHMA 4Q4V2 5JPMB 4JQTA 2A7AA 4LHKA 1TMF3 2OUJA 4FP2A 1HQLA 4QD2A 5FY4A 4GD4A 1QQP1 1RUG1 5FMDA 2B9UA 3SISA 4BXFA 1AR72 2AGSA 2Y38A 4JGYC 3NSTA 4B4RA 5GLZA 4OI1A 4AAPA 3A0NA 4LK7A 5L9VA 1NQDA 5A3NA 3D0JA 1GQPA 2VVFA 3LEIA 1ULEA 4DQAA 3WQ1A 3UKTA 1FATA 4Q0PA 3KSCA 2EIDA 1RUH2 3N7MA 4HPKB 5J3UA 4Q4X1 1NKGA 5KWRA 4FPKA 5T5LA 1OMIA 1AYM3 3I3QA 3UJOA 2IWGB 2C5DA 1W0OA 1JI6A 1YHFA 1VBA3 2VOVA 3GXUA 3Q8EA 2YC2A 1DQ2A 2ZA9A 3WQ0A 4CRQA 4YW6A 4CDXC 3MIFA 4NUBA 2XKPA 2DURA 3G7DA 1ZBA3 4M0NA 5A3MA 2ZMKA 4MGSA 5FREA 2RS51 5KXCA 1MVQA 4CDQA 1VBC3 4RYDA 2JIGA 3GZUC 5FMBA 1JHNA 4HETA 2VPVA 3AL5A 1EYBA 2KR2A 1XXNA 3ZIXA 2XQXA 1CN1A 3OYWB 1XU2A 4Y1XA 4I0WB 3PURA 4CDWA 2E7TA 3KT7A 4PDWC 5DZFA 4CUBA 1W05A 1XOYA 1W8WA 1ND3B 3BOPA 4NIAA 1OLQA 1N3OA 1OT5A 2QQKA 2X5IB 5GALA 5EV7A 2W1UA 3NNMA 2QBXA 3WG1A 2R32A 5T54A 2R073 2W52A 4AW7A 2PHUA 3ZN5A 3QLQA 1YUDA 1C8M1 3PJYA 4TLGA 1ZVFA 4RQPB 1QJY3 3IDBB 4IEUA 1CPNA 3ECQA 3O14A 5D1IA 1QU0A 1W0PA 3U14A 2R49A 2OQ6A 1SPPA 3M2MA 3MV01 2R0FA 2XVGA 4DEVA 1J59A 2GMMA 1V6OA 4YM0A 4GMP1 4HZFA 3LSEA 4TSVA 3W21A 1V9U1 5EZWA 1FOD3 5FMOL 3FLPA 2WAAA 2C1FA 4QPWA 2C26A 1OKQA 5DUVA 1OA3A 3O12A 4YVWB 2J7MA 1OD5A 1G6NA 3ROUA 1W06A 3WNOA 3ZYRA 3OGSA 2E51A 2WZR2 3UT0A 1FV2A 3WNNA 1CQ9A 4UWDA 5LASA 3EXUA 1MEC2 1DGWX 1XNAA 4RR3B 2W91A 1ZRIA 2J1RA 2WS92 3B94A 4M00A 2WT2A 3K3OA 2JKXA 1NZIA 2WO7A 4CVUA 5LEJA 1R1A3 1AXKA 3C7OA 5G04L 4IEYA 1VIWB 1VJ2A 1GZWA 2EICA 2ZOEB 4LLFA 3VZJA 1PX3A 3V65A 3AMHA 1OQ1A 4K6BA 5FLIA 1EY2A 2RMU1 4IESA 4Q0VA 2W68A 4W50A 3GM8A 2GH2A 2GSYA 3VUOA 4ZZ5A 3AXDA 3IDEA 2B8MA 2HH9A 3CJIB 3RSJA 5FPAA 3H42B 2ZAAA 5FJHA 2XPJA 4XHXA 5F6LB 4HANA 1W9SA 5J37A 2XBO3 2XWJB 4N9IA 4CP9B 1HKDA 3OJBA 2SLIA 5ABJB 1TNFA 1GZCA 3ACGA 3MFAA 4Q4Y2 4XFFA 2MPFA 3MUY1 4DINB 1W90A 2YPDA 4P08A 4SBVA 3D82A 1PVC3 5AC91 5FPVA 3WHTA 2O14A 3H3ZA 4XDQA 3C2UA 3RG0A 3VBHA 4BQ1A 3VBOC 1US2A 4Z8BA 4TLFA 3AKQA 4MGYE 4Y20B 4E27A 2JEMA 4QX0A 1RUF3 4CPBA 5CFCB 1XU1A 5FYSA 1CAXA 4M3CB 1ZRDA 1LKNA 3K2OA 3I4IA 1YI7A 1FMD1 1H6YA 1WCQA 1IQAA 2VW2A 4WM8C 4DY5A 1W2NA 1AJKA 1QY4A 2PN5A 1UPSA 2Q4SA 2OS2A 2O8QA 4DZGA 4XE9A 3NJXA 3T1LA 3LPFA 4P5HA 5FR3A 3LA2A 2HEYF 2ORXA 4C0BA 1NAEA 3NAPC 2FDFA 2JG8B 2UWCA 2NMNA 3Q8CA 5F3CA 4UI9L 2F4LA 3KQ4B 1SCSA 1TZOA 2WO2A 1DQ4A 4OI2A 5DZEA 3BCWA 3VZLA 4ES9A 4OUEA 4AHYA 3ES4A 1JOJA 4GB32 1UU6A 3CNAA 5HI0A 5EYYA 2J1VA 1VAVA 2VQUA 2NZ9A 1R092 4B1MA 4LBLA 5B4NA 4CXXA 1CAUA 3Q8BA 1D4M1 2A5ZA 4MGIE 1HRV1 1C57A 1X33A 3ZYJB 2HEWF 3GHNA 4XJAA 1CZTA 4YNIA 3UYJA 2R0HA 4FPYA 1IPJA 3ZSEA 3ZXFA 2PQSA 5IFPA 1UQXA 3GJAA 1TVGA 3UJQA 4NJ4A 3RYPA 5FZ0A 4YARA 1O4ZA 1WA6X 2K0GA 3JQXA 5F3EA 1RMU1 2PTMA 3KD4A 5KHHA 2EALA 4LHSA 3WCRA 3T4HB 4CEYC 2YC4A 5FRAA 2VZ1A 4NIGA 3KHBA 1VBD1 4FPEA 4FQ4A 4PDWB 2MNGA 1P8JA 1Q56A 3LF7A 3THTA 3IZOA 3AKRA 3WR0A 4KWKA 1SEFA 1YI9A 1WMDA 3NKTA 1QQP2 1RUG2 5FP3A 1ZBE1 2ZJCA 2WZEA 3KV4A 1I5PA 2UYAA 3MIEA 3J8F1 4XACA 3HEIA 2Q8OA 1CIYA 5DXDA 5JCTA 4Z2WA 4YGDA 2JD4A 1H1MA 2QDRA 2BV4A 4R9DA 3ZYIB 4Q4X2 5LBEA 4TZDA 2J1SA 1S2BA 1W39A 3PU8A 4N9HA 3DXTA 3H8RA 4ATFA 2NP0A 2PA7A 1HQWA 3ILNA 4PI2A 4CTEA 3IMMA 1SHWB 2XJSA 2TBVA 5FKBA 4JHTA 1JYVA 5J7MA 2IXKA 3CJXA 1SLCA 2WNUA 4RGGA 2RS52 4H14A 4M0HA 2NLRA 1O91A 1T2XA 4W8JA 1UOJA 2RS33 5A7NA 4Q26A 4A4AA 4MGZE 5A1LA 4LKFA 4AL9A 1PIV3 3RFRA 1Z7S1 4AFCA 5CAZA 2P1BA 2QKDA 4XCAA 4CDUC 4QB6A 1RIRA 2VUAA 4U36A 5JIAA 4EWEA 2CAVA 5C6CA 5K0UC 1XQNA 4JKLA 3S5QA 4B1LA 5F8PA 1OXCA 5F2WA 2QUOA 1CWPA 3I59B 3IAPA 3PL0A 4JGZA 1S0EA 3R4UA 4NHMA 4DUXA 5IVBA 2AEYA 4C90A 4Q0UA 3N4MA 2QQPA 3RRDA 5LK7B 1C8M2 4IXLA 2GC2A 4XIOA 3VBSC 2LUWA 4QXKA 1H8TC 2IXLA 2YG0A 4DS0A 1H2KA 1OH4A 1XYOA 3ZDSA 4M3CF 3I3BA 1C3HA 2VULA 1KGYA 5C5UA 4YSFA 3MEPA 1CAWA 1V9U2 4LE4A 3ME2A 1JZ6A 3NV2A 1R081 2CDPA 1NE4A 2K46A 4G9SB 3VBOB 1H9WA 3RI9A 4XBLA 1COV1 2DCZA 1X7NA 1HX6A 2E26A 1AL23 3IPVB 3UKNA 4AQ6A 3N9OA 2Z4FA 4QPGA 4WM8B 3RZZA 4AEMA 4AFDA 1LOEA 4GA9A 3ZLIA 5GZDA 2VTXJ 1ONAA 2RMU2 4LKSA 5APAA 4BM8A 2GP5A 2JDAA 4RL7A 1F8VA 3NAPB 3PIJA 5F6KA 3A7QA 4S2GA 4BZ4A 2HWC1 3MI8A 3RZLA 1NLSA 3NL1A 2WYSA 2TUNA 2A6VA 4MG2A 1E5IA 5FBJA 4EV0A 1YQ2A 2R16A 3IBMA 4HLTA 4QQ2A 5A3WA 3V56A 2D6MA 5F3IA 1LOAA 4LJHA 3SLIA 3CO2A 5LA1A 1RUD3 1JUIA 1K5MB 2GC1A 4KU7A 3ALQA 4QT6A 5A33B 2NM1A 3P3NA 3OG2A 5AC92 3VN4A 4LMFA 3TN91 3VBUA 2FZ2A 3PTRB 4GULA 1PVXA 1QH6A 3W9AA 1WW7A 4CEYB 1N1YA 1TME3 4LQRA 5KHKA 3POGA 2ZX0A 1JZ4A 3ZVXA 1FMD2 2JDMA 1W9FA 4XHBA 1KFXL 5FTTC 4CSWA 5EIYB 2FZ1A 4OQ9A 3GGLA 3NJVA 3VZKA 4C91A 4PF5A 4XFAA 1C1LA 2P17A 2Y8KA 3KV6A 3U10A 5IVEA 1BEV1 2WQ8A 4BQ3A 2AREA 3MW3A 1WMFA 1W8OA 4OUSA 1Y43B 3LPGA 1LECA 3RYKA 4XUQA 5FXVA 3OGRA 3SCGA 3K4DA 3OB8A 2VMIA 1FPN3 2HEVF 5BUVA 4RS5C 1C28A 2GZWA 4LBJA 4XJZA 5FJKA 1W04A 4IW3A 1JZ3A 4XFGA 1AX0A 4JVAA 4Y26A 2XVKA 1HQNA 2A3YA 2HYKA 5DG2A 5KHJA 5EFUA 3F95A 3LIGA 1D4M2 1HRI1 2A6WA 2K9ZA 3DYOA 1HRV2 1T6BX 4E2SA 3ZFFC 1AR81 1XRUA 2EAAA 2L9LA 2OPWA 2WLQA 3TNQA 3WCSA 4AGGA 4Z92B 4Y22B 3AP6A 3I2KA 3VLBB 3WHUA 4TXWA 1IGOA 2C6SA 4EWDA 5JDBA 4FPFA 3UESA 1UY4A 1R64A 4LIVA 1RMU2 2VM9A 2W1QA 3AZVA 4HG6B 4LPLA 4QKFA 3WINE 2WSVA 4I0BA 5IVJA 5K0UB 2RDSA 1VBD2 1QNWA 4GKYA 3BI3A 4QXHA 5LB6A 1CAVB 1GU3A 1ZBE2 2DVGA 4MGKE 5J09A 1GANA 1OI6A 1UAIA 3NQHA 3J8F2 3WXPA 2YBSA 1W0NA 3POFA 3VBSB 2DF7A 4NRPA 4HPKA 5LBFA 3T4VA 1QJX3 3WNMA 5CFDB 5K8SA 1RUI3 1AR91 3WDXA 2Y33A 3ZYBA 3WSOA 4NAOA 1H9PA 4CU7A 3N36A 4RA0A 4XF0A 5GLVA 3USSA 1W6PB 5F1RA 5JUVA 3H7YA 4JDNA 2DVDA 4KL1A 5FWJA 4XBQA 5LATA 5FOJB 3WY6A 2Y6JA 1ZZBA 4LO7A 1NCQC 1RHI1 4ZPIA 3WG2A 1TG7A 4SLIA 5FZOA 4DB5A 1S2EA 5BXXA 5C71A 2P4EA 1XNKA 5C4WC 4QQHA 2GH8A 1DGWA 1CX4A 3EHKA 4N53C 1O3SA 3GZAA 2DCYA 3I2DA 4OHWA 5FZHA 2XJQA 3OYWA 2J42A 4CCOA 5C3QA 1Z7S2 1RUJ1 1G8WA 1DF0A 2B46X 4R9AA 4I2OA 2CL2A 1ND3A 4AEJA 3QBQA 1UZYA 1WMEA 3KCXA 2RG4A 3WUCA 2VMEA 2WA4A 4AHXA 3A23A 2Y60A 3MF9A 3UGHA 4OVEA 5KXBA 1PO13 1VAMA 2GAUA 4RQPA 5CU1A 5LW9A 3RZGA 1DQ6A 3BVCA 5IATA 4JAAA 4FFFA 4Q27A 5EHDA 3PUHA 1UKGA 2VZQA 4OZOA 1YC61 4JCKA 2X29A 1GKBA 2OVUA 2XLFA 3MGUA 5F39A 3ON7A 1LHUA 4CXYA 4K40A 4FTSA 1ENXA 1R082 2PLV3 2VTXA 4F83A 3LD8A 4MXWB 1LRHA 4YVWA 1MZ6A 3U4XA 1D2SA 5FO9B 3F2ZA 4XMAA 1KDKA 4E4SA 1RVF3 5JZGC 1COV2 4RR3A 3AMNA 3I49A 5DABA 5JXHA 4H7LA 1W6MB 1WD4A 3VD9A 2VXJA 2Q8DA 5M0TA 1NX9A 1QXRA 2D7FA 3VL8A 1ENSA 3EQEA 2ATFA 3IDCB 4FOYA 1SLAA 5GZFA 4ASLA 2Y64A 3LEGA 4I30A 5FUNA 3N35A 5HPOA 1FXZA 1REFA 1JN2P 1UU5A 3RQ0A 1PGW1 3CJIA 2HWC2 5CBLA 1HXS3 1OUXA 3QACA 2ZZQA 4QKDA 1SQ4A 2AUYA 5FPBA 1OKOA 1ZM1A 1VBE3 4RS5B 4XQ4A 4MGTA 2RVAA 3AK0A 4CP9A 4CCCA 5ABJA 2VUCA 1IG0A 3V0AB 5KC6A 3SC7X 2EIGA 1W9YA 3ZFFB 1HDKA 1LOFA 1AL0G 1C5IA 1YIFA 1KITA 2QFEA 4ZS3A 3USUB 2ERFA 5FY1A 3TN92 4OFGA 4AI9A 2FDHA 1SFYA 2W39A 4GZ9A 4FOVA 4Y20A 4ZXEA 3M8LA 3S6PA 3AP4A 5JOXA 5CFCA 4FFIA 4M3CA 4UXAA 5FMCA 4Y4RA 5ANNA 2ADDA 3H1YA 2IZWA 4JDOA 2Y6GA 4IEVA 2A6XA 2VUJA 4QXBA 5L9BA 2B5HA 1IS6A 1WA4A 5FUIA 4QXCA 4X8PA 1YYNA 3W5MA 1VBB1 1PMIA 2ZGUA 1H2NA 1QMJA 3VB9A 4IEPA 1BEV2 3T0AA 5JMOA 4B4QA 2CDOA 4COZA 4LUKA 2HWE3 3AX4A 1VP6A 4K3UA 2JG8A 3KLSA 1MS4A 2ZAHA 3AB0A 2FCTA 2YPJA 4OULA 3VKNA 4IE7A 2GNDA 2ARCA 1SBDA 1FNYA 4K21A 1W6OB 2O1QA 1HV0A 1UCXA 2HLEA 4QKBA 5FZ8A 2P37A 2WWUA 5IT6A 1DZQA 4B4PA 4H55A 1CD3G 1NT0A 3ASIA 5DAXA 1NLRA 1HRI2 2R061 3TAYA 4D6RA 4UFKA 2B39A 1YFXA 3B7MA 1QKQA 2WKKA 3GCXA 3IN9A 4GAZA 4C8DA 1KJRA 1NZCA 2WN3A 2YMZA 1RITA 2D98A 2FMYA 1APNA 5C4WB 3ZYHA 4N53B 3JD73 3GNEA 4AGVA 4BH9A 4ZU7A 1CESA 3FUOA 4F3JA 3C7EA 5IFTA 4CZSA 2XJRA 1U0AA 4PDWA 5JOYA 2YFUA 2MEV1 1S0FA 1X8MA 2WFF3 2BEOA 1ASJ3 2FDKA 3ZMNA 4E8CA 1S1AA 2ZGSA 4LORA 3E6DA 2XDVA 4PQ9A 5T5JA 3GHMA 3H50A 2O8OA 3THDA 2GALA 1VALA 4ZS2A 5EP9A 4MH0E 4C1XA 3RDIA 1VLNA 5FKCA 2ZCWA 4N43C 4QX3A 2DUPA 1SBFA 2D43A 3EBRA 1IOAA 5ISLA 1AX1A 4OI0A 1AJOA 2VMFA 3FLRA 4J25A 4BE3A 1LULA 1MR5A 2JWPA 1BK1A 1RUC3 5IVYA 3TEZA 2UYBA 2ZGPA 4CCLA 1W8NA 4A6OA 2BJSA 4AOCA 3JBG1 1O5UA 5FZ3A 1QJU1 2VAUA 4MO3M 5FK7A 1RB8G 4AI0A 4Y1UA 2PAEA 5BNNB 2XUEA 4NHXA 5LK5A 1RHI2 1ZZ9A 2F4PA 5CG8A 3WD5A 3BGAA 5JZGB 3DN7A 3OD0A 3CZJA 2V4AA 2ETEA 3M70A 5A7WB 1H8VA 2R041 4E4ZA 4FTBA 1RXFA 1S0BA 3SEEA 1D7PM 4CPBD 1RUJ2 5JSOA 5JIUA 4WVWA 3U37A 4I09A 5LEKA 2ZEYA 1V00A 3VKMA 4COWA 1G86A 3E5XA 3POSA 3BOWA 4AVVA 3K3NA 5J36A 2VCCA 2ZEXA 2WWSA 2BBVA 3I59A 2VVEA 5C33A 2VZ3A 5A3PA 2YGMA 4LE3A 4CUAA 2WLPA 4D6SA 2HKXA 2XHKA 4EYUA 1Y4WA 3O0WA 1Q8OA 5A6QA 5KXEA 5FYMA 4COUA 5AFBA 1W3VA 4ISQA 4C0HA 1Q43A 4LA2A 3T30A 1YQ6A 5C3PA 5FYVA 5E1RA 2X10A 4XF9A 1C4RA 2LM3A 4B7KA 4XPVA 2CSGA 1UZWA 1LGBA 2I74A 3WP6A 3BU0A 1LU2A 2Z69A 2UY8A 2GNTA 3AXEA 2D5HA 3HJRA 1VRH1 3PJQA 5F3GA 3OUJA 3WUDA 3VBOA 3WQBA 1Y9QA 4GIQA 5FAXA 2A3XA 4W6WA 1OBNA 1SFPA 3ITQA 2QNKA 3LAGA 1HJGA 3LDKA 3VHNA 4CCDA 3T3YA 5FYUA 1DYPA 1K5JA 4WM8A 4WZCA 5F7UA 4ONUA 4EN9B 3H7JA 2VNRA 4HKWA 2VVDA 4IQPA 5A3UA 5A7QA 4KWUA 3VGIA 4XJ8A 3CZUA 5H9PA 4CUGA 5KC5A 1OURA 1JMUB 3J26N 3LA7A 5C3OA 1GSLA 1NCRC 1UF2C 2B9VA 2ZGQA 4RFT0 1ZREA 3NAPA 1DBNA 3DCQA 4PQQA 5ERLA 5FYYA 1ULFA 2Y6HA 3JB8A 2G1MA 3RWNA 1PGW2 1AR63 1XB9A 4QKNA 2BNMA 4YGBA 2DV9A 5FP4A 4RN5A 3ZXDA 2EA7A 1ENRA 1DQ1A 2ZX4A 3LKJA 3VKLA 4NO4A 3I3EA 3UGGA 5JXGA 1QXPA 5CA6A 3BTZA 1DQ5A 1H6XA 2WZPP 5I8TA 1K5MA 1XSRA 3HD8B 3R4DB 2HWD3 3ZYFA 5JR7B 2CNAA 5LA0A 3NO8A 4Y5Z0 3SH4A 3ZXAC 3U07A 4CU9A 1E57A 1OSGA 3QH6A 1RC6A 1W28A 3FUQA 4Q4W1 1LOBA 2FCUA 5A7SA 3H9AA 5JXJA 3ZFEC 1LGCA 4CEYA 1DZRA 2HWF3 4MYEA 3UV9A 5JSPA 2FMDA 1POQA 1U5YA 3HN3A 4XZPA 3ZDVA 2IVJA 3IIAA 4TTGA 2VW0A 4W65A 3SKJE 1YQCA 3AMQA 3PTYA 4W6XA 2UY9A 1AYN3 1VBB2 4BQWA 4NWWA 2DU0A 4QDQA 3RMYA 1KFUL 2OW4A 2XHNA 1WBLA 1YJKA 2Q0AA 4BA6A 1GP5A 1YEWA 2R6QA 5F5AA 1O8SA 2VOKA 4D3WA 1OUSA 3BTAA 5HCFA 4N43B 1IKQA 2YBKA 4XXPA 4XURA 4P9JA 2XLAA 2ZGTA 4LHNA 1OLRA 2VE1A 4GWJA 1CJDA 1S55A 2X53S 1JZ8A 2VCMA 3MIHA 4N7UA 4A42A 3FMGA 2JDNA 5IK4A 4JKMA 3Q9OA 2HWB1 1FX5A 3D8CA 3MIBA 3D0SA 3OPWA 3ZX7A 4LEJA 4AXOA 2R062 4UF0B 3RYRA 4AI8A 2WT0A 1IPSA 1EAH3 4EN8B 1XSQA 4KG8A 2JICA 4Y22A 5J48A 2EF6A 4LIUA 2XJVA 5FK8A 4D7YA 4OCTA 2RS13 2BERA 4IERA 4QM8A 3B93A 1PZ7A 5KHGA 4RD7A 2R30A 4D0QA 5A7OA 5K0UA 2QCSB 2WO1A 4YG6A 3TNPB 3LFIA 4QX7A 5A32B 1NOVA 1X36A 4UFLA 1D2QA 5E16A 2MEV2 3K4ZA 1GWLA 3KWVA 4K8FA 4A7ZA 5C3SA 2G19A 3RZJA 1POV0 4AQSA 1CAVA 4YFWA 4R8HA 1R1ZA 1UWWA 2Y26A 1K42A 2IXIA 1EV11 1MQTB 1UOGA 3B9CA 3AZWA 4N90A 5FP7A 1PNGA 3KQRA 3N7LA 1RTVA 1V6JA 4HSLA 1PO23 1B35C 2WA3A 5CFDA 2C0ZA 3WNLA 1DLLA 4XQDA 1D0HA 2IC1A 2ZX3A 3KZ4C 3EYPA 4OLLA 2QQWA 2VBPA 4JGYB 4BQ5A 2BUKA 5GLUA 1JUHA 3OY8B 4H3WA 5JLVA 2D3RA 2EXHA 3JBG2 4LO4B 2YGLA 1QJU2 2ZACA 5CIRA 4HN1A 2EIEA 1DFQA 3OBRA 3N7JA 3AVRA 1TE1B 3FFZA 5DDJ1 5FZ4A 1ND2C 1Y9MA 2OQ7A 2RDQA 2AC1A 1KJLA 1W99A 3AYDA 3S7EA 5C9AC 3TEYA 2AR6A 1CGPA 1TMF1 1SZBA 1TNRA 4LR4A 4G4FA 5FWEA 2O0OA 5BNOC 3T2QA 2OIIA 1LGNA 2R042 2YFZA 3PVOA 1SDWA 2OYZA 4OQ8A 1W8ZA 3ACLA 1V6MA 3U78A 5B4XA 4XFBA 2C9KA 4CDXB 1OC1A 5FYHA 5SV8A 2YDEA 1S2KA 4LBKA 1A8DA 2PYTA 3WV6A 5FCCA 4WBBA 2GU9A 1NCRB 4PJYA 4XUOA 2QZ3A 2EIBA 5C8CC 1AF9A 3J7HA 4K7JA 3FJSA 5FBZA 4XABA 1HV1A 5JAXA 1AYM1 4O7XA 4DEQA 2H0VA 2WC2A 2CGPA 2WYFA 4KBBA 4IGQA 1VBA1 4KI5M 4LTAA 4CUCA 1X9TA 2WL1A 4OUMA 1NXD1 4IV3C 5CEHA 1O5LA 1ZBA1 4CDWC 3AL6A 3KHCA 5BYNA 2DBIA 1BBT3 1MPXA 1OF4A 1VBC1 1X8EA 4XCBA 3VBRA 3E6CC 2QTWB 4AK3A 2RR13 2JE9A 2ZHKA 4MXWA 4AVBA 3X29B 1URXA 2E31A 1VRH2 1MZ5A 3ZFEB 3VHPA 4BCUA 5FXZA 2YUEA 3AYEA 2R1DA 4BIFA 4QQLA 5FP8A 2AEZA 2GC0A 3MF6A 3GCWA 1IS4A 4WZFA 1F4HA 2W1SA 3SXWA 5HCHA 2RM23 4MXVA 3ZSJA 1DGLA 1W6MA 5D8AC 1SLLA 1EUUA 5EPAA 3T2PA 1JHJA 4LBNA 3H8XA 3VBUB 2R071 3ZPOA 4AVCA 4ZONA 3OGGA 4IE5A 3WVJA 3VHRA 2AACA 4DRRA 3BPZA 1IS3A 2G9ZA 3T1MA 5FP9A 2BFUS 1IG3A 3P1IA 1PMHX 1QJY1 2D6KA 2IXJA 4NRQA 1W8HA 4S2HA 3U75A 4NHYA 5JOZA 1AXYA 3CDZB 5A3TA 1J83A 1SLIA 5IVVA 1UMIA 1CIWA 1Q3EA 1ODMA 4CCKA 4M4PA 4XFIA 1RUE3 4RS5A 3WOGA 1FOD1 1DDLA 2WR9A 4AI3A 3WDTA 2JJ6A 5I0DA 1LENA 4BISA 4YW5A 3WX5A 5FQ0B 3V0AA 4WVMB 5DAWA 2X05A 3W5NA 1W3XA 2ZBJA 2ZGNA 4JRLA 3ZIWA 2PMWB 3USUA 1GFF2 4Q4W2 3WF1A 3ZXJA 2Y6KA 3POYA 4E2QA 2XUMA 4ZZ8A 3I8TA 3LZZA 3OSDA 1ZZCA 1BZWA 1MS3A 4YG0A 4EJRA 2ADEA 1WW6A 3AJYA 1R1A1 4NMIA 2GN3A 3WG3A 1BQPA 4HBNA 2H0BA 4JZRA 5IW0A 3SQOA 4NROA 2V4VA 4Z07A 4PT6A 2NQYA 1RINA 4B7EA 1O59A 2KM2A 2F6BA 3FWEA 5EXOA 3EB7A 3O7OA 4JHZA 5GKAC 3GZTB 2FBEA 2Q1FA 5LCWL 2BDRA 4IEWA 4A6SA 1Y9GA 3CLPA 1F35A 1UU4A 3LWCA 4QM9A 3ATGA 5BNQA 5GZGA 3ACFA 4PHZA 4PI0A 2D3SA 1J3PA 2R7EB 3MLJA 2XBO1 2P3KA 3AP5A 1HW5A 2I07B 4FFHA 1B35B 3ZOIA 3R4SA 1W6OA 2E32A 1SACA 1YFYA 4BOWA 3PMSA 3UKVA 5IK8A 5HV4A 4DFSA 2YU2A 4AQ2A 5FOBB 5JI7A 3UGFA 3OBTA 1PVC1 2HWB2 2YXSA 5FZ7A 1PZ9A 4L11A 2I2SA 3WNPA 1I6XA 1ND2B 1O4YA 2XL9A 1POV3 1RUF1 3P3PA 4G3YC 3ZSLA 2IUWA 4A7KA 3FC0A 3IWZA 5C9AB 4TWTA 5C4WA 3ZXKA 4N53A 3KT4A 4DXSA 5GLWA 5BNOB 3N7KA 1LHNA 2B45X 2ZGLA 3O0VA 2D6OX 2UWBA 2HYXA 1W6NA 4YZ4A 4XYXA 3G6JB 5ACA3 1ZA4A 2J1TA 2RJKA 1TEIA 3I2IA 4Q4V3 5A7PA 3IB3A 4UW6A 4META 5F5CA 3MLKA 5FZIA 5C8CB 4PLMA 1GV9A 1XJAA 1AR73 1OLMA 2XH6A 4Y1ZA 3DXUA 4OHVA 3S57A 1EV12 3NVCA 4KGQA 4S2FA 5T5OA 4OHZA 4NIHA 3MW4A 4IEQA 1C1FA 2OZ6A 2VQTA 4PLNA 3KCYA 5AFEA 4P9LA 3O1VA 4QQPA 2ET7A 1G7YA 3LFMA 1RUH3 4IV3B 5DZGA 4E9KA 2XONA 1N1SA 3M3OA 4L0PA 4UBHA 1WCDJ 4K1YA 1MS0A 4AR2A 1ZZ8A 4XFHA 3ZSKA 1YQ8A 2BGCA 2QZ2A 4I3GA 2WRAA 2BBAA 5FFOC 5FY5A 4BK5A 2W92A 1QH7A 4Q29A 2G4IA 1OVSA 2ZGKA 5DDJ2 5CB7A 5BNNA 4YW7A 4KMQA 2BPA2 5JZGA 2DBNA 3ES1A 1N3PA 5I0TA 1TMF2 3AZYA 5A7WA 4QGLA 2GDFA 5FYIA 4FPJA 3E5UA 4BK4A 5D8AB 2J1EA 4J1XA 4FAGA 4H2AA 3AC0A 2E33A 3QD6A 1UXXX 1S0IA 3MIDA 2IVIB 2J1AA 1UIJA 1WLWA 3QCWA 1UYYA 3QH7A 4KH9A 4QU1A 3PUIA 4HONA 1PMJX 3O1OA 2D6PA 4TYSA 2JDZA 4XFCA 2EXJA 3PUSA 4FP3A
chains in the Genus database with same CATH topology
1AYM2 1LODA 1HIXA 1GICA 3AYAA 1YLLA 3U11A 1JW6A 1VBA2 4RHV3 3GALA 4CDUB 5J96B 1PNFA 1ZBA2 2ZPXA 4YVSC 5H9RA 2CGNA 3M7AA 1SBEA 1VBC2 3AMMA 5FPZA 2CY6A 5L73A 2KXLA 3BALA 4C1WA 4MLOA 2RS31 2XKOA 2YY1A 5FPXA 1PIV1 1H8TB 3L2HA 3HT2A 1S0JA 4AEKA 1J3QA 2ES3A 2WZR3 2GC3A 4KGGA 3RS6A 3MIGA 1MEC3 5K9YA 4GWNA 2WS93 4MZUA 3WP3A 2R072 1H2LA 3ST7A 3K48A 1BMV1 3AFKA 1QJY2 3B9IA 3RI8A 1AVBA 2B7YA 4WVVA 5FMOS 2JX9A 4B29A 3D5OA 4YW3A 4QPGC 1FOD2 2VY0A 3ZMOA 4A2UA 1RUNA 4FPOB 5JOWA 3URFA 2X5IA 4Q4Y3 2Q5TA 1AL21 3SHRA 2DYCA 4MVTA 4ASMB 3VDDC 4V1PA 2V09A 4K9SA 3S7IA 4JC1A 1R1A2 4IETA 4QPYA 4AFBA 4WVZA 2XVLA 1N1TA 2JENA 2C9AA 2CAUA 2VMGA 3WW1A 3N3HA 4L97A 2JXAA 4D94A 4WV8A 3TRSB 1QGLA 3E5QA 2RS12 4PBPA 4NHKA 4N43A 2XBO2 1JTZX 2XL7A 3I7DA 2LTNA 3B02A 2WQZC 1LEMA 1RUD1 3FFQA 4A3XA 2W0XA 4GB33 2BQPA 1PVC2 3MYXA 5T3NA 3LCPA 1R093 3PLQA 4K1ZA 3WG4A 4Z1VA 1V6IA 3GBGA 1Q8SA 3FHIB 1X50A 4FSJA 1RUF2 1TME1 4GWMA 4QPIC 4JQRA 4ZKTB 1PO22 1W6QB 4F7ZA 4J6GA 4PIYA 1FYUA 4Q8LA 5A32A 2A73B 2E63A 4LT5A 2YZ4A 4FAHA 1WW5A 3OGJA 4LO5B 1DGRA 3VZOA 1XYNA 1QQP3 1RUG3 1GBGA 2ZABA 4FPCA 1MQTA 2VGDA 4J1WA 1FPN1 1ENQA 4XBNA 2A70A 5FLJA 3APBA 4GH4C 2P34A 3VKOA 1IKPA 4XJUA 4XEZA 4YM3A 2D5FA 4Q4X3 3MICA 4YVSB 1D4VB 4JGYA 4NHLA 2BVBA 3OY8A 4FVVA 4HKLA 3B69A 3IMNA 3NW4A 2ZX2A 4AQTA 2E53A 2VOXA 3M1HA 5KXDA 4XTPA 5F5QA 2RS53 2OPKA 3VBFC 3K51A 3HR9A 1H30A 1ULDA 5IUQA 2FHRA 5EYXA 4URTA 1DU3D 4BLIA 3FX3A 4COVA 2CGOA 4CDXA 3PHMA 1WLDA 1OA4A 3O0XA 4UW5A 3RPQA 4OHYA 1G9AA 1NCRA 2XG3A 3M3IA 5DUWA 1NCQB 4AHZA 1QOTA 1F5FA 1QJX1 1H1IA 4GQ7A 4LA3A 1AXZA 2XLGA 2A71A 1RUI1 2DCJA 2I45A 2NPIA 1C8M3 5JSRA 1OA2A 3I54A 4X8NA 3MPPG 4NN0A 1GZ9A 4WM7C 2KA3A 4UW4A 4GMP3 4BIOA 3AJZA 1V9U3 2IXHA 4Y24A 3DV8A 1QOOA 2D97A 1Q8PA 1REEA 4P9XA 4Y4YA 2RS32 3JUUA 3VDDB 4IEOA 3ZFEA 1PIV2 1NXMA 1YIPA 1M4WA 4ZU4A 1V70A 4MV2A 1CVNA 3IT8A 3DGTA 4YGEA 3AKSA 1Q8VA 3VL9A 1DIWA 4AEDC 5A3LA 1NY71 4PBOA 1XE8A 3RMXA 3OD4A 2PELA 4X6RB 4HT1T 1BMV2 1PO11 2XWBB 3HBZA 2DVAA 2RMU3 1A78A 1UZZA 4NR1A 4XOGA 1UMZA 3VHOA 1B09A 1OOPC 3M3EA 4LNVA 4DY3A 2BWCA 1LEDA 3V0BB 2PLV1 5FQ0A 2ET1A 4WVMA 1SMVA 4Y1VA 4YLZA 3WDYA 1RJ7A 1NYWA 2A6YA 4HKOA 4E4DX 1RVF1 1YNAA 2AH2A 4QPIB 2DTYA 5L19A 1AL22 5AC93 4CP1A 1LU1A 3MFCA 5L36A 3ETQA 1Y3TA 4YZ1A 4BMEA 2QE3A 3PNAA 4FOWA 1PK6C 3POWA 4FPLA 1UW8A 1L3JA 3OF1A 1G9DA 3LB9A 3WW2A 5ABJC 1FMD3 1AX2A 2WNEA 1JH5A 4Z82A 1W2UA 1HXS1 2RJLA 2V73A 2V5YA 3KCCA 5HXVA 3CF6E 1LOGA 1VBE1 1NA1C 2OA2A 4GH4B 4YFZA 3IPVA 1BJQA 3AYCA 3WDUA 1B35A 2E7AA 1RUD2 2ZGRA 4YW4A 1OPOA 3ZYGA 1U5ZA 4YZ3A 1MVEA 3WDVA 2BYVE 1XNCA 1ZX5A 3FE5A 5GM0A 3PVEA 2DWRA 2CWSA 2ZKNA 3H1MA 4ATEA 2XPJA 3M3CA 1D4M3 1WCSA 1ND2A 3SITA 3AP7A 1HRV3 4I01A 4FBFA 5L7OC 1TME2 2DCKA 3VBFB 3AKPA 4AI2A 2JG8C 5BNPC 5C9AA 3ZFGC 4EROA 2BW8A 5BNOA 4XIKA 4N7IA 2UURA 4QGNA 2JKBA 4AFMA 1YFWA 1RMU3 3HMYA 4EN6B 4XW3A 1VBD3 3BODA 5A33A 4AVTA 1UKRA 2HWE1 2AZ5A 3NV4A 5C8CA 2ZZJA 2Y0IA 1ZBE3 3U0ZA 3HAGA 3NKGA 1QF3A 1KS5A 4UW3A 1FPN2 3JQWA 1CPMA 1A8MA 1X82A 3J8F3 3NV3A 4GXLA 4S2DA 1G9BA 1JYCA 1SLBA 4D7SA 3WW4A 4IV3A 1O3QA 1ULGA 3MZHA 2WFPA 1LJ7A 2Z42A 2JG9C 3W58A 3SH5A 4WM7B 4L92A 5LRSA 1REDA 1U5IA 4Q2FA 5H9QA 4B3NA 2D6LX 4ZU5A 4QU2A 3H8UA 4KWLA 2GNBA 2Q1MA 4OHXA 3JD71 3RJRA 5CNAA 5IK7A 1ZYBA 1N3QA 1UN1A 2PAKA 2EVXA 3HT1A 3DPRC 4RHV2 4DNYA 1S0CA 2Q30A 2VH9A 2PAMA 3HWJA 1WW4A 1H4HA 1XNBA 2FQPA 2WFF1 4AEDB 1ASJ1 1XNDA 5D8AA 4Q1RA 2H6BA 1UIKA 1Z7S3 2PHLA 4BYYA 4AG4A 2D40A 1J1TA 2WNVC 1RUOA 3V64A 2PFWA 1DG6A 1QJX2 1WBFA 5BV6A 3A0KA 1PGL1 4QQOA 1I3HA 4BWOA 4IV1C 1RUI2 1OOPB 2PHDA 5GZCA 1RUC1 4RSUA 4FQZA 5IK5A 1ZZ7A 4CEWC 1T6GC 1WLTA 3WLUA 4CDUA 1NE6A 4AWDA 2IXCA 2SBAA 3O5SA 3MLLA 1WLCA 3B5LB 3MPBA 1SCRA 1MZFA 4O9GA 4YM2A 4MUVA 2GMEA 1R083 3VBSA 1H8TA 3WDWA 2IFWA 4HL0A 1PK6B 1NQJA 4ITCA 4Q0QA 2P2KA 1COV3 2BTVC 3UL2A 4EN0A 1NY72 4P14A 1DYKA 5T55A 1LR5A 1PZ8A 1W6PA 3TWIA 2ILMA 3GBWA 1PO12 5GLTA 4KWJA 1OHFA 1NA1B 4PIZA 1QNYA 1UL9A 4QX5A 1MS5A 5DUUA 2D93A 2HWC3 2QVSB 2VQ0A 1LESA 1WGPA 5T52A 3VZMA 2YROA 4AVAA 2PQQA 4R9CA 2X8KA 2PHXA 2PLV2 3M3QA 2DVBA 3H1WA 4FTEA 5FO7B 2WINB 1IHMA 5L7OB 1RVF2 4GALA 4CDQC 4I3PA 2WSUA 1U12A 5BNPB 2ZS6B 3ZFGB 2VW1A 3TN93 5T50A 3ZN6B 5I91A 3BB6A 2K2SA 1BVP1 1AUYA 3FZ3A 4ORFA 4RGAA 1OFNA 3B3QE 3THPA 2EAKA 4INDA 1K5MC 1AR61 2DUOA 1HXS2 2D6NA 1LB2A 1CR7A 1BEV3 4P9GA 3HN1A 2ZTNA 2PHRA 5I93A 1VBE2 5LRRA 4PLOA 1DZTA 5H9SA 4AF9A 2Z5WA 2DVFA 4DPNA 4FXKB 3S30A 2HWD1 2JG9B 1J1LA 1WUVA 4LHLA 3AZXA 3PVBB 4AE2A 4P9WA 3ELNA 3C3VA 5GJ6A 4DMIA 4YRDA 1HRI3 4NPRA 2HWF1 4FPHA 1AR83 3DPRB 4D7TA 1U5XA 2BVVA 3W59A 1W6QA 4L9BA 4XILA 1LHOA 3IKWA 4EN7B 1AYN1 4L99A 1C8NA 1WD3A 4FO9A 4IL7A 4IEXA 1ZRRA 2Z2SB 4YW1A 3R0RA 2QJVA 3S0MA 5DG1A 3ZFFA 1MACA 1XYPA 2HWE2 2WNVB 2ZHLA 2GNMA 2D3PA 3ENRA 4AGRA 2Q1ZB 1FT9A 3SH3A 1FV3A 5AVPA 3R6SA 5C8WA 4IV1B 1IPKA 4R4XA 4BLJA 4CEWB 4EWAA 4IEZA 3HQXA 3T2TA 1MS9A 1VB4A 4YVSA 2YC0A 1EAH1 4LBQB 2VXRA 1AR93 3ZXLA 2P3JA 2XJTA 4BHPA 4DOUA 3AFGA 3VZNA 3MDPA 3FLTA 2PHWA 1MS1A 2RS11 3JD72 3LOBA 3VBHC 4YZ5A 1PGSA 1RHI3 3SCHA 1J3RA 4XF4A 1DQ0A 5EWSA 2WFF2 5CFDC 2VMHA 1ASJ2 3WNXA 5JI9A 4BMBA 3OTFA 1RUJ3 4QGMA 2EXKA 4XETA 4JV4A 3ZO0B 1LHWA 4XJ9A 1AZDA 1NCQA 1Q8QA 4MX3A 1PO21 4X6QB 3ZN4A 1PGL2 1N1VA 1J58A 4K20A 1BKZA 1RUC2 3TB0A 4DRVA 4HK8A 4ZXKA 1DHKB 3AP9A 4L2NA 2VG9A 3KGZA 1V6LA 3LOIA 3H3UA 4HFSA 3GF6A 4LBOA 4HVOA 4W6YA 2G9FA 4CDQB 2OUHA 4KU8A 5BY5A 3VDDA 2A75A 3JCIA 5FDBA 1TQ5A 5CADA 3ZYPA 3B00A 4XF3A 1GYKA 2YV8A 3R05A 4CDWB 2VU9A 3IM0A 4P9YA 1G9FA 4AHWA 1F31A 3VKFC 1A6CA 3FBYA 3E97A 2ZMNA 3VBRC 4Y1YA 5JWPA 2XJUA 4AI1A 5I0RA 4HVQA 3UK9A 4LULA 3VV1A 3LA3A 5CG9A 1OPMA 1Z78A 5B2GB 1KS4A 2Y0OA 2AYHA 4NWVA 3EO6A 4CP2A 3HIFA 2YYOA 3RNSA 1D0GA 4NVPA 1BBT1 3V0BA 3QOPA 4R9BA 2RR11 4U2AA 5FO8B 2AENA 1QWRA 1N47A 3ILFA 4LUMA 4XF1A 1YFUA 1QHDA 4JRAA 2D44A 2WNUC 4Q8KA 3SMHA 1QOSA 4QPIA 4COYA 3SNMA 2OZJA 2LALA 2RM21 4XMIA 2XJPA 2R1BA 3AM2A 1H1AA 2ZGOA 3J9SA 1YXWA 4E2GA 1GZWB 3JZVA 4AFAA 3PMEA 2E6VA 4FCAA 1BXHA 2JECA 1VBB3 1AR62 3WW3A 4JGZC 1PM7A 5CVRA 1H4GA 2G9GA 5E88A 2ENRA 3KGLA 1FAYA 1RUE1 4QHBA 4GH4A 4HMZA 4KG0A 1QXJA 2ZMLA 4GMP0 4PCRA 1KRIA 2HWD2 3L9JT 2ARXA 1SLTA 4M3CE 1O3TA 5SV5A 1EP0A 3KB5A 2WIIB 1ZZ6A 1KQRA 4LLOA 3AMPA 3VBHB 2R063 2HWF2 3CU7A 1OFSA 3VBFA 3EJKA 2WJSA 5AVAA 3D4KA 3RJ2X 5I0SA 1UX6A 1CJPA 5JPNB 1Z0HA 1CAXB 2NN8A 2CYFA 1GR3A 5EJ3A 1AYN2 1ZNPA 2W08A 1V6NA 3ZPYA 1O3RA 4YG3A 2GMPA 1RJ8A 2VNGA 3ZSMA 2MEV3 3CEWA 1IZ3A 3MW2A 2P3IA 3J4UH 2EXIA 3OCPA 1KD7A 1M06G 1A3KA 2H6CA 4I02A 2DUQA 4H7MA 2CV6A 3WQ7A 4YZ2A 1O4TA 4OI4A 2PHFA 1CAUB 4WM7A 1EAH2 4B8EA 1YO8A 2UU8A 4KQ7A 1KDMA 1POV1 5HCBA 4NOTA 5BPXA 1OQEA 3DUIA 5HCAA 3JBG3 1QJU3 1UD1A 4YGCA 1VAKA 3VBUC 5I8YA 1Q5OA 5J98B 1F5JA 5ACA1 2NYYA 4Q4V1 3A4UA 2GN7A 4O9EA 4AEDA 1VR3A 2RE9A 1FI2A 2DTWA 2R043 4UBGA 3CL1A 3KM5A 1AR71 3VBRB 1S0GA 4LBQD 2VECA 1O7FA 4FT8A 5GZEA 2ZGMA 2XB6C 5BNNC 2DFCA 1RUH1 4XTMA 2JE7A 1SFNA 3ZXGA 2YHJA 1OOPA 3INAA 4L8QA 1I9RA 1G9CA 2VNOA 2RHPA 2NMOA 2VOWA 5F9TA 3SCFA 3D6EA 5T5PA 1H0BA 2WNUB 3B01A 4FPGA 4BPZA 2ZX1A 1VRH3 4AYUA 5K7PA 3L2YA 1PK6A 3JB4C 4HVRA 3NV1A 1F9KA 1DGRN 3LSDA 4PIXA 4CYDA 3M4FA 5KBFA 4LO8A 1ALYA 1GQHA 4A7YA 2CWMA 4JGZB 4HK9A 4XJWA 2BWAA 1LOCA 1C5HA 1NA1A 1JXNA 2BNNA 4RHV1 4YM1A 1Y7BA 4M01A 4HSJA 1MS8A 1BCXA 4YYOA 2ARBA 2BFUL 1RGSA 5E89A 1YCIA 4QMAA 1BBT2 1LHVA 4LBMA 1CAWB 2TNFA 4GKXA 4XQWA 1RL3A 1JYIA 2RR12 1ZRFA 2DU1A 4I0AA 2ZKLA 5KHIA 2E7QA 5HBAA 2Z79A 3ZXEA 1BYHA 3DKWA 3E6BA 5L7OA 5BNPA 2WZR1 5E8AA 3ZFGA 4R4ZA 1XE7A 3OPZA 2RM22 2E9QA 1MEC1 2VQAA 4Q4W3 2B42B 2WS91 1CONA 3BU7A 2DFBA 3PVNA 4QPGB 3ZN6A 3NJZA 1BVVA 2TEPA 5JVVA 1ND3C 3FBMA 3TYJA 1EPZA 4F8AA 3DL3A 2WQ4A 4JDMA 5FLHA 5TSWA 1AR82 2X5IC 3TOJA