3WDVA

The complex structure of ptlic16a with cellotetraose
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
298
structure length
298
Chain Sequence
b'EFYHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGEIDIIEGVNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKFNAQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-1,4-glucanase
publication title Structural and mutagenetic analyses of a 1,3-1,4-beta-glucanase from Paecilomyces thermophila
pubmed doi rcsb
source organism Paecilomyces
molecule tags Hydrolase
total genus 73
structure length 298
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wdvA00
4AGGA 2DWRA 4FPHA 1YI7A 3A0NA 5LK5A 5JOWA 1RIRA 3AZZA 4HANA 3ENRA 3NV3A 1GANA 1W6MA 2DVBA 1MS3A 4OZXA 2YMZA 3B69A 1MVQA 3MEPA 1QMJA 2ARBA 5IK8A 1LEDA 2D6OX 4Q1PA 5GLZA 1ULCA 4TYSA 2DURA 2ES3A 2H0BA 1N1TA 1GNHA 3PVEA 2LALA 4H55A 2G4IA 4LBQD 4JRAA 4Q26A 5T55A 3WOGA 1PZ8A 3O12A 1IS3A 1C57A 1YO8A 2VW1A 1N47A 1GV9A 5EWSA 2ZHNA 4NOTA 3VV1A 1CVNA 3Q9OA 5T52A 2UWAA 1MS8A 2JE7A 2NZ9A 2DUQA 2NP0A 4YZ3A 4LBNA 4M00A 1AXKA 4UW5A 1N1VA 5CA6A 2GMMA 1AX0A 1F5FA 4Y22A 5JOXA 1WCSA 5DG2A 2VXRA 3ZPYA 2DYCA 2PELA 1Q8SA 5H9QA 2ENRA 2AYHA 1V6OA 2OVUA 4YGDA 1DYPA 1GZWA 5CB7A 1HQLA 1CPMA 1LGNA 2ZHLA 2P37A 2CTVA 5AVAA 1DQ6A 3FLRA 2A3WA 1DGLA 2PHUA 3AP6A 3C2UA 4FPJA 2XB6C 2EXKA 5T54A 1IKQA 1GZ9A 2YXSA 4ZKTB 2R49A 1V6NA 2OW4A 2WSUA 4Y1YA 4Y22B 5GZFA 4DS0A 1LECA 4XYXA 3ZXLA 3AX4A 2E53A 2PHFA 4Q8KA 1LOAA 2AR6A 1N3PA 3RRDA 3V0BA 1DQ2A 5DG1A 4FQZA 2GNMA 2OUHA 2TEPA 5DUXA 4ISRA 4YFWA 3RSJA 4NO4A 5KXEA 1MVEA 4M3CA 4XXPA 1SBFA 5EXOA 2E7TA 2DUPA 2ZBJA 3ZYRA 2ZA9A 2EXJA 3AP4A 4DRVA 2C5DA 3MW3A 1TEIA 4YGEA 3POSA 2W39A 2CWMA 3ZSKA 3AFKA 3WDTA 3FUQA 3WNXA 1UL9A 3M1HA 2DUOA 5GZGA 3ZXJA 4P9WA 1WLDA 1MS1A 1KQRA 2R1BA 4GA9A 4LBKA 4XILA 2WJSA 4FOVA 1DQ1A 3OYWB 1AF9A 1H9PA 1MS9A 1O4YA 1S0CA 3M3CA 4DFSA 4CTEA 3ZSLA 2WSVA 4RA0A 2VUAA 2AENA 2AH2A 5CNAA 1B09A 3WV6A 3PMEA 4Y1ZA 3UK9A 1DFQA 1IS5A 5SV8A 2ZMKA 2KM2A 2ZGMA 1GICA 4PQ9A 1WD4A 3MPPG 1UMZA 5JOYA 1J1TA 3CNAA 5EYYA 3M3OA 4XJAA 3B00A 3V65A 1FYUA 3ILFA 1QNWA 1UPSA 3KM5A 1QOOA 2ZGTA 4XZPA 5IT6A 1PZ7A 3MW4A 4YW5A 5GZEA 3USUA 4XIOA 1GYKA 3INAA 1G8WA 1LEMA 1WW4A 5H9SA 4GALA 1G9FA 1EPWA 5T50A 2WNEA 3R4SA 2YY1A 1LTEA 1QOSA 2Q5TA 1QKQA 1W0PA 3LSDA 1MZ6A 5F9TA 2AUYA 1SCRA 3VKMA 2GNTA 1PZ9A 1VAVA 4ATFA 5IUQA 5HCAA 2ZGRA 4FPGA 4RL7A 4PF5A 1LU1A 3O0VA 4F83A 4MYEA 4K1YA 3B9CA 3OY8B 1FAYA 2DTWA 5T5OA 1V6JA 3O0WA 2NN8A 4CZSA 2PHWA 4ITCA 2A71A 2ZZJA 4YGCA 3POWA 3IN9A 5CBLA 5BYNA 5KXBA 1BKZA 1SACA 3AJZA 1JXNA 1S0EA 2WT0A 2D3RA 4DPNA 3D4KA 5EYXA 4XJ8A 3W59A 4AYUA 1GKBA 1SLCA 3AZXA 3ILNA 2Z42A 1KDMA 4Y24A 3WG2A 1ZM1A 1KDKA 4ATEA 1O4ZA 3KQRA 1KITA 3WG1A 1MS4A 4WVWA 2GNDA 1SLIA 2SBAA 3HR9A 2ZABA 2JD4A 4XOGA 2A6YA 4PBOA 1DYKA 1Z78A 2ZAAA 1LHVA 3HMYA 1LGBA 3QCWA 5GJ6A 2GALA 4BOWA 3U4XA 1Q8PA 4M3CE 1Y7BA 2EAKA 5F5QA 3APBA 1D2SA 1LHUA 1WLWA 1IOAA 3IKWA 4P9XA 1UN1A 1BZWA 1JN2P 3AP7A 1V6LA 4YLZA 3JUUA 4Y1UA 4W65A 5HCBA 2YROA 4FPLA 3LSEA 1FNZA 4AVTA 3AZYA 2GMEA 1FNYA 5GZCA 1QU0A 1HKDA 1RITA 2DTYA 1C1FA 2DU1A 1JBCA 5T5PA 3SH4A 4ZXKA 3ATGA 2EALA 2WLQA 4FQ4A 2R16A 2ZHMA 4WVVA 1LESA 1ZA4A 1LULA 2I2SA 5DUWA 5HCFA 5DXDA 2ZGUA 4SLIA 1A3KA 3LCPA 5GALA 4Y26A 1AJKA 3V0AB 3VKNA 3OJBA 4FOQA 1WW6A 1CIWA 3ZXFA 1I1EA 5GLVA 3R05A 4DRRA 1I3HA 3WDXA 4D69A 4K21A 3OYWA 1UX6A 3B3QE 4P14A 1V6KA 2B7YA 1LHWA 5GLUA 1UZYA 1JOJA 1KJRA 1LODA 2ARXA 2E7QA 2SLIA 2ZGPA 4YZ4A 5JMCA 1MACA 2R0FA 4GWMA 3AZVA 1DQ5A 1UZZA 1GBGA 4XBLA 1KJLA 2GMPA 2VU9A 3M3QA 2ZGOA 3WCRA 3NV1A 4BLJA 4LBLA 1BXHA 1DQ4A 1S0IA 5E89A 1GSLA 4FPKA 1JW6A 5IK4A 2D6LX 2D7FA 1YYNA 4FPFA 2NM1A 2WT2A 3SH3A 1FV2A 3WHUA 1FV3A 3M2MA 3WG3A 1NXD1 1ENRA 1N3QA 2WQZC 4LBMA 3VKOA 3WCSA 2AREA 3SH5A 3WDYA 4XIKA 4YFZA 4YZ1A 1SCSA 3D5OA 2RHPA 2ZMNA 3ZXKA 2A6VA 3AP9A 3WUCA 1DHKB 4XMIA 3AK0A 1UKGA 4XXAA 2P2KA 1W6PB 4FP2A 1Q8QA 1WUVA 5DZGA 4FOWA 2DVDA 1FATA 2DV9A 1ENSA 3AYCA 2P3JA 1V00A 3OPZA 4LBJA 4LBQB 4XJZA 2YV8A 3WDVA 2A3YA 1CPNA 4FPOB 1QDCA 1WW7A 5E8AA 5FREA 1QDOA 1S0GA 3ZXEA 5IK5A 3OY8A 4DQAA 2CL2A 2PHRA 1W6QB 3QLQA 1KRIA 3M3EA 1Z0HA 5DUVA 1G9CA 4R9DA 4AVVA 2VH9A 3IPVB 4YGBA 5IK7A 5JOZA 3UL2A 2UU8A 5H9PA 3WVJA 1AXYA 1F31A 4Y20B 5DZFA 3SITA 4BMBA 3N3HA 1QGLA 4Q1RA 3FUOA 1JYIA 1ULEA 2HYKA 3ASIA 1GZCA 1SLBA 2V73A 2FHRA 3RQ0A 4BLIA 3NWKA 5FRAA 1YXWA 2W08A 4KBBA 3AXDA 1Q56A 4YW2A 3VKLA 4AWDA 1IS6A 1IKPA 3OGGA 4AGVA 2JKBA 2D6PA 1W6OB 3NV2A 2R0HA 1LHOA 2D3PA 1VIWB 2R1DA 4UW4A 1ULDA 4YZ2A 3DGTA 1LHNA 1NLSA 1S1AA 1MZ5A 1LOFC 4M3CF 2ZACA 2ZHKA 1GLHA 1S0BA 1G86A 2ZGSA 4XJ9A 2GN7A 2A7AA 2A6ZA 3D6EA 4XJUA 1CJPA 3N7JA 4YM3A 3ZYPA 2D3SA 4C1XA 3T1LA 4YZ5A 4Y1VA 3N7LA 2JE9A 1HDKA 1W6NB 1S0DA 1LJ7A 1HLCA 4R9BA 1JUIA 3VKFC 1LGCA 1ULFA 3HN1A 2A70A 5JLVA 2ZMLA 3AYAA 4LBOA 2ZGQA 4XE9A 1SLAA 3AJYA 3H0OA 2UWBA 1SBEA 1CESA 2EF6A 4M01A 1APNA 1ONAA 1AJOA 1WBFA 2V5YA 3V0AA 3O5SA 2CY6A 2D43A 4YG0A 2UURA 2ZGNA 1C4RA 1OKQA 3IM0A 4P9YA 2VY0A 3DUIA 5JVVA 2WT1A 2ZGLA 1HQWA 2C9AA 2P3IA 4PCRA 4U2AA 2DVGA 3ZVXA 1X50A 3TB0A 4XHXA 4L8QA 1F9KA 3FBYA 2AGSA 2GN3A 3GALA 4I30A 4Q8LA 4XMAA 2D44A 1JYCA 3BOPA 3NV4A 1ENQA 3UJOA 3WHTA 2A6XA 3N35A 1W6MB 4XTMA 4YM1A 4K1ZA 4AGRA 3JU9A 1VAMA 4XTPA 4GWNA 2BQPA 4IQPA 1AX1A 1MS0A 2D6KA 2W52A 1GNZA 2LTNA 2DU0A 2A6WA 2CWSA 4UW3A 4BMEA 2WKKA 5H9RA 3AXEA 3FLTA 1G9AA 2VW0A 3N36A 2A75A 4FPYA 2FMDA 1A78A 4UW6A 4XHBA 3WZ1A 3FLPA 1OQ1A 1VALA 2GNBA 1VLNA 4ASMB 3L2YA 3MW2A 2NMNA 1AX2A 1SFYA 2PHTA 1V6MA 3POYA 1JHNA 1LU2A 1N3OA 4FP3A 4YW1A 3FFZA 1LCLA 1W6PA 3PVOA 4Q2FA 1LOGA 4HL0A 4LBQA 1GZWB 1MS5A 4U36A 1CR7A 1LOCA 3A4UA 3RMXA 1SLTA 1DQ0A 2CYFA 2NMOA 1C1LA 1SLLA 3PJQA 4WZFA 1G9DA 5DZEA 1YIFA 4R9AA 4GKXA 3UJQA 1Q8OA 3WUDA 2E6VA 1W6QA 4TZDA 1AZDA 1WD3A 2EXHA 1URXA 1G7YA 2W68A 5KXDA 3WG4A 3ZSMA 3WDUA 3RMYA 3IPVA 3V0BB 4JCKA 5E88A 5DUUA 1A8DA 1S0FA 3PVNA 4FOYA 1CQ9A 2ERFA 2D6MA 3O0XA 1DBNA 4M3CB 4Y20A 5GZDA 4ISQA 4CRQA 5KXCA 1CONA 3SISA 1BJQA 4BM8A 1LOBA 3OBTA 3IMNA 4FVVA 2A5ZA 1QOTA 2PHXA 3RG0A 3TAYA 3ZSJA 1WLCA 2EXIA 1WW5A 4Q27A 1N1YA 3AYDA 4K20A 4XJWA 1DIWA 3SLIA 1BYHA 1S0JA 1G9BA 3BODA 1W6OA 1IS4A 1LOFA 1R1ZA 4Z8BA 2P34A 1FX5A 3N7MA 4R9CA 1XQNA 5L73A 2GDFA 2D6NA 1H30A 3T1MA 3R4UA 5GLTA 2DVAA 2XG3A 4GKYA 4YG6A 2NYYA 1N1SA 2ZKNA 3N7KA 1CN1A 2YZ4A 1DLLA 1V6IA 3A0KA 3WLUA 5T5JA 1RINA 2CNAA 4BQ1A 5CAZA 4JC1A 2ZGKA 2E51A 1QF3A 1AVBA 1W6NA 3GNEA 1H9WA 4BPZA 3AP5A 1LOEA 2OUJA 4YG3A 4WV8A 3WDWA 4C1WA 4FPEA 3BIWE 1QNYA 4Y1XA 1D0HA 1SBDA 4YM2A 2UWCA 5T5LA 3RS6A 3AZWA 4FPCA 3B01A 4YW3A 5JDBA 4XBNA 3SNMA 3I8TA 4XDQA 1Q8VA 4GXLA 3USUB 3BTAA 2DVFA 5GLWA 1U0AA 1WBLA 1UAIA 2JECA 1BQPA 5GM0A 3I4IA 4PBPA 2EIGA 3V64A 1DZQA 1MR5A 3AYEA 3T2TA 1LENA 1YRZA 4AVSA 3VUOA 1AXZA 3OBRA 2JDZA 1W0OA 1ULGA 4YM0A 2VW2A 2P3KA 2JJ6A 4YW4A 3W58A 2A3XA 1OFSA 3ILRA 4XBQA
chains in the Genus database with same CATH superfamily
2BNNA 1AR62 2DWRA 1VBC1 2E31A 5A70A 1YHFA 5LK5A 2F17A 2VMFA 1GANA 1W6MA 2Z2SB 4QPYA 3UNPA 4IETA 3LB9A 2BOIA 1WMXA 2XPJA 4UF0A 4XF1A 1ZNPA 5KC5A 2J1UA 5CADA 2VZRA 5F3CA 2RM23 2ES3A 4A42A 4Q26A 3PVEA 2LALA 5T55A 3OUJA 5KHKA 4EQVA 4CDWC 1JYXA 1O3RA 3BIEA 1YO8A 2VW1A 5FY5A 1N47A 5CU1A 3WF4A 5EWSA 3CLPA 4HK9A 3ZOIA 4TTGA 1AR63 3Q9OA 1MS8A 2JE7A 4TXWA 2VE1A 4I0BA 4LBNA 5FY1A 4UW5A 3VL9A 5C7GA 2XKPA 1N1VA 1XXNA 1RC6A 3NRUA 2GMMA 4EN7B 5CA6A 1F5FA 3GZUC 5SV5A 3E1F1 1EP0A 5D2AA 1OOPC 3VBOA 1PO11 1RUG2 2VXRA 1AR71 2CV6A 3DKQA 3PTYA 4FFFA 4HXCA 1Q8SA 4PLNA 5JXHA 2ENRA 2AYHA 4YGDA 5FY4A 3ZFGA 1WZXA 1WA4A 5FPAA 4MGYE 2DCZA 2ZHLA 3VDDC 5FQ0B 5AVAA 3ALQA 1VMFA 1DGLA 4GD4A 4FPJA 5D8AB 2FQPA 3UKTA 3ZR6A 4EWAA 5J96B 5T54A 1QJY2 1S2BA 1W04A 3WW3A 5A32A 1HIXA 3LA2A 2VVEA 1JZ5A 1TNFA 4D6QA 5FZOA 3ZXLA 4CCJA 2E53A 2PHFA 2PA7A 4KU7A 1HXS1 1O5UA 3RRDA 3V0BA 1JZ8A 2ZX2A 3CBNA 5DG1A 2GNMA 2TEPA 5DUXA 3MHZA 2V09A 1VBE1 4GMP1 4NO4A 1MVEA 1C28A 1I1EA 5BNPB 2ET1A 2BZDA 2ZA9A 2EXJA 1DCSA 2WWJA 4UBGA 4H7MA 3K4ZA 2RS52 5DMYA 2RDSA 3O1TA 3POSA 1ZZCA 1HB1A 1UU4A 3WW4A 4QQLA 5HPOA 3KCXA 4RGAA 4R52A 1JI6A 5FYHA 3FUQA 4OUSA 1R092 3VBRA 5EPAA 2HWE2 3HN3A 2VNRA 5GZGA 4TLFA 5LEKA 5L7OC 2BGCA 2WIIB 1WLDA 3OBZA 1ASJ2 1KQRA 1NG0A 2WO3A 2RMU1 1AF9A 4I0AA 5FY7A 2RE9A 5F3EA 3ZSLA 2VUAA 2HEWF 1UXZA 2GH8A 2GZWA 4AEDA 2RS53 1B09A 5FPVA 2IUWA 1B35A 4B4QA 5L9VA 5CFCB 2KA3A 2XUEA 1DFQA 3CKHA 3EJKA 1R093 1IS5A 3QBQA 2HWE3 4QD2A 4YVSB 3BU7A 2ZPXA 2ZMKA 1YFUA 2O1QA 4D7SA 1YLLA 1GWLA 4PQ9A 1ASJ3 1WD4A 2XL7A 3HT1A 3IDAA 3BOWA 3CNAA 4LIVA 5EYYA 1PO23 3I3BA 4OUMA 4INDA 4H14A 3DPRA 5JPNB 1TMF1 5FZ7A 1RB8G 2WRAA 1JMUB 1PZ7A 3VZJA 1UD1A 4M4PA 4QM8A 5FP3A 1JZ3A 3I2DA 3INAA 5FKCA 2CGPA 2XJVA 3BTYA 1BEV1 1G8WA 1DGWX 2X5IB 3MV11 1PK6A 4Q4Y2 5IWFA 1QJFA 2YY1A 3PMSA 3IMMA 5D21A 3LSDA 1MZ6A 2XJUA 4JGZB 2XHKA 5TSWA 1PZ9A 1VAVA 1ZVFA 4LTAA 5IUQA 5FP8A 1H1IA 3WSOA 1LU1A 3O0VA 4CXXA 5DDJ2 5FMCA 1FAYA 1PMIA 1CAWB 4MZUA 3VZOA 3ZMOA 2NN8A 3HT2A 4ITCA 5FPLA 3POWA 1ALYA 1X82A 2CU5A 2DCYA 2KD7A 2QQWA 3D0JA 5KXBA 5LA0A 1BKZA 1WMEA 1SACA 3J7HA 5IVVA 3W59A 4AYUA 4XJ8A 2WZPP 3ILNA 2Z42A 4IV3C 3WG2A 2YFZA 1E5HA 4QDSA 3H7YA 1KITA 1AR83 5F2WA 5J98B 3ELNA 2J1SA 4FFIA 4CEYB 2J1EA 2GNDA 5DDJ3 1UY2A 2JD4A 1FOD3 4META 4EJRA 3J7MA 1LHVA 2X10A 3ZSEA 2GALA 1K5MA 3S6PA 3MIBA 2W91A 5A7WB 5LBEA 1CD3G 2Y33A 4KGQA 4LITA 4XDOA 3VHRA 3ITQA 2EAKA 1ND2C 1ZYBA 1D2SA 3GM8A 4EE2A 3IKWA 2VOXA 4YSFA 1W90A 5FQ0A 1UN1A 4FFHA 3JUUA 1OMIA 4Y1UA 1RUI2 5D8AA 5FKBA 4W65A 2YROA 3P6BA 3LSEA 4FPLA 4AVTA 2JDHA 4K8RB 2TNFA 1AL22 2DF7A 1UZVA 2GMEA 4IE7A 3BYWA 3VBFB 1QU0A 1QH6A 5IVCA 4HN1A 3VZNA 3ZDSA 3ATGA 4KWLA 4CDQB 5LA1A 3MFAA 1Y9QA 4UAPA 4WVVA 4ET7A 2J7MA 1UIJA 4KG8A 1LESA 4O9GA 1UQXA 3ZO0B 4EN0A 1ND3B 5BNPA 3B7MA 1MEC1 3D0SA 4JV4A 4B29A 1D4M3 1RUI3 4YW6A 5FMOS 4KWKA 1W8NA 5A3MA 5GALA 5JMOA 2ZX1A 1AL23 4LPLA 3T2QA 2HWD1 3B93A 4CP1A 3VHPA 3ME2A 1PGL2 3KLSA 3R05A 4DUWA 4XFCA 2AZ5A 4DRRA 4DY3A 1NX9A 2Y6JA 2QQVA 4XQDA 1H1MA 4H2AA 4K21A 4KQ7A 4IEPA 1ZZ9A 5G04L 4A3XA 1QJZA 1C8M2 1DP0A 3SHRA 3AKTA 1C8NA 5JMCA 1KJRA 2ZGPA 3OPWA 1W8OA 2R0FA 4IDZA 2YFUA 1GBGA 2HBTA 4BLJA 4UFMA 3M3QA 4QPIB 3NV1A 4Q4W1 4LBLA 2JG9C 5B2GB 1DQ4A 5E89A 4YVSA 2ID4A 4CEWC 1PHMA 1GFF2 1REDA 1STMA 3OGSA 4S2GA 3WW1A 1YYNA 4AXOA 4RFT0 4CCDA 2G9ZA 3WHUA 3S0MA 1WMFA 2B9UA 4GWJA 4AEJA 1C8M3 4QXKA 1ENRA 4Y5SA 2ATFA 4LBMA 2GSYA 1H2KA 5FFOC 4PDWB 3WCSA 4XIKA 4AVAA 2VTXJ 4YZ1A 3KV4A 3D5OA 2RHPA 3NKGA 5I0TA 2RR12 3VD5A 2HWF1 1H0BA 1UCXA 3AP9A 3THTA 3AK0A 3LD8A 4OQ8A 2R061 1Q43A 1W6PB 2AACA 2X5IA 4IEXA 5IJRA 1CAXB 5FZ0A 4JZRA 1WUVA 4GJZA 4D8MA 4FOWA 2DVDA 2DV9A 3DL3A 2P3JA 1V00A 5C8CB 2ORXA 4JGZA 4ZU4A 1NQJA 2C6SA 2OZJA 3O7OA 1AUYA 2FZ1A 3OUIA 3WDVA 1RUJ3 2VECA 5FREA 2C24A 1S0GA 3LA3A 4LKDA 4ZS3A 2XR4A 1ZX5A 4ES8A 2WDBA 5FK8A 5DQ0A 4JGYB 2X8KA 2W46A 4H3WA 5A7PA 2RR13 4R9DA 4O65A 3U4SA 4AVVA 4CYDA 3ZX7A 5JOZA 1HQNA 1AYM1 3I49A 1J59A 2RS12 3NNLA 5A7NA 3WVJA 4Y20B 5DZFA 4LHSA 4Q1RA 5FWJA 1OVSA 1EPZA 4CEYA 2V73A 1QXRA 4RSUA 4W6XA 4CU8A 2FHRA 3DKWA 4XCBA 1BLZA 2CDPA 2WO7A 2YG0A 3NSTA 4KBBA 4WVZA 3BGAA 3RJ2X 1ZREA 5C9AC 2CAUA 4YW2A 1RUE1 5JSOA 5A7WA 1NLQA 2P6CA 2VQAA 1HN0A 1VE0A 3ABZA 1K45A 2VC9A 4AGVA 1CZSA 1JUHA 2BFUS 2R041 3NV2A 2R0HA 2D3PA 3B9IA 3OBAA 2R1DA 3DCQA 1ULDA 4UW4A 5ANQA 4YZ2A 5JXIA 3MZHA 1HB4A 3MICA 2ZHKA 5FXVA 5IHRA 3CZUA 4OLLA 5DAWA 1SFNA 2JEMA 3T2OA 5FZ1A 1G86A 3VBFA 3N9QA 3RZKA 2A7AA 2QQLA 1CJPA 4WM8C 1W2AX 2VOWA 2D3SA 4CDQA 4YM3A 4YZ5A 5K0UB 4AHYA 4LO4B 4DXSA 2P4EA 5ERLA 1LJ7A 4R9BA 4RYDA 4Y33A 3K3OA 1LGCA 2WQ8A 2QQPA 4NAOA 3AYAA 3AMPA 4LBOA 2UYAA 5FYTA 1RUF1 2AC1A 2WUHA 4NVPA 1CESA 4M01A 5J3UA 5ISLA 4IEQA 2RS31 3H42B 4NPLA 3HD8B 1WBFA 4EN9B 3PLQA 4XUNA 3W9AA 1QWRA 2IWGB 2UURA 2C0ZA 1BK0A 2QFEA 1XPWA 2ZGNA 3MFCA 1J83A 2A1XA 2BWCA 2ZTNA 4AR2A 1HQWA 5FZIA 2P3IA 2XUMA 1HJFA 3DYMA 3TB0A 4L8QA 4AI1A 1JZ4A 1UPIA 1GQGA 3UJOA 1NE6A 2E33A 3K48A 2A6XA 3GJAA 5G05L 3AKQA 4J25A 4XTMA 4K1ZA 4YM1A 4AGRA 4MGIE 4QPIA 1DF0A 4OMDA 1WCKA 1AX1A 2WNVB 3J9SA 3A22A 2W52A 1GNZA 3I3QA 4IERA 4HONA 4LHLA 1MPXA 5ABJB 3IBMA 3GHNA 2E32A 2ZX4A 4GH4C 3N36A 3ORJA 4JTNA 4ASKA 5APAA 3SMHA 3WZ1A 4BK4A 1PVC1 2XXZA 3K4DA 1YC61 4DIQA 3L2YA 1VBD2 4IGOA 2B4KA 4HSLA 3RVHA 4AAPA 1XE7A 3CJXA 4D3WA 5F5AA 3B5LB 3POYA 4FP3A 1N3OA 4M0NA 3M4FA 2PHDA 3E5XA 1LB2A 1AR72 1LCLA 1W6PA 2Q8DA 2VL4A 4A4AA 4ZONA 1LOGA 5FJHA 2XBO1 4MADA 4KGGA 2P1BA 4UT5A 1XJAA 4OI2A 2PLV1 3OEAA 5C8CA 1YJLA 3RYRA 5DABA 1LOCA 1JYVA 2CYFA 2X05A 5A3LA 3RZLA 3PUIA 1GU3A 3CJIC 4LULA 5FXWA 5FOBB 2NLRA 2VUDA 2W1QA 1VBD3 4TZDA 2EXHA 3GBFA 3MYXA 4IE4A 2QQUA 3LOIA 4JGYA 4QU1A 3S5QA 1F8VA 2W68A 2A73B 4MH0E 4V1PA 1FPN2 1HXS2 5FO7B 2VZSA 1WCQA 1AR73 1AYN1 3RMYA 3WDUA 3G6JB 4JCKA 5E88A 4ZZ8A 5JZGB 1CGPA 2XQXA 4DUVA 1RUOA 1VBE2 1YFWA 3PVNA 4LMFA 1OQEA 4Y20A 1JOPA 1PGW1 1YFYA 2ZX3A 3NAPC 4G3YC 5CZKA 4PIYA 3ZFFB 4XW3A 4JQTA 3IMNA 3JB4C 1SHWB 4FVVA 3TAYA 3VBSC 1W99A 2PHXA 3M70A 4E8CA 2ZJCA 4RQPC 1WW5A 4AF9A 1TME2 3AYDA 2VMHA 3UKNA 3TEZA 2ILMA 4Q4X2 1FPN3 3KHBA 4YYOA 2VQTA 3BODA 1IS4A 1LOFA 1QQP3 5JIUA 3DV8A 5CKMA 2VOTA 1LR5A 1XQNA 5FBZA 4Q8KA 1H30A 2VZTA 3BUCA 2QQMA 4YG6A 4IL7A 4TSVA 2ZKNA 4UXAA 2YZ4A 1DLLA 3A0KA 4BQ1A 5T5JA 2CNAA 3MF6A 3PHMA 4P9JA 5BNNB 2IC1A 5K0UA 1TME3 1QIQA 4AQ2A 2BU9A 5BNOA 3UKVA 4Q4X3 1QF3A 2XHNA 3PUHA 3ZMNA 4BPZA 3VZKA 2ZEYA 1QNYA 1W05A 3BIWE 1D0HA 1SBDA 2BTVC 2OQ6A 1H4HA 1TMF2 4H7LA 4BIFA 3N9PA 1AR91 1ODMA 4FPCA 1JHJA 1YI9A 4F8AA 1Q8VA 4GXLA 4N9HA 2WAOA 1POV1 4LOTA 3SCFA 2DVFA 1RXFA 5K4LA 2JECA 2JDKA 3VLBB 3O1SA 3HPNA 5GM0A 1MR5A 3AYEA 4AI0A 4E9KA 3WHTA 3WEZA 3KWVA 1W0OA 4YM0A 3U14A 4XUQA 4BU2A 2A3XA 1OFSA 2VOVA 3ILRA 3JQWA 4QPGB 1W06A 4JAAA 4WZCA 4FPHA 5JOWA 3A0NA 4HANA 1R081 1DG6A 1TMF3 1R64A 1VBB2 2DVBA 3S57A 3MO4A 3E97A 5ACA1 4OZXA 4YNIA 5FYVA 1EUTA 5A7QA 3B69A 4P9IA 1K12A 5IK8A 1EV12 3H3LA 4C0HA 4Q1PA 2E9QA 2WNVA 4A7KA 4XABA 2DURA 4CDUC 2R071 2XVLA 4B4PA 2JWPA 1PZ8A 3O12A 1IS3A 5ABJA 2VZQA 3MI8A 4NIHA 2BBVA 2ZHNA 1COV1 5CKQA 2Y0OA 3POJA 3K46A 1YQ5A 1EY2A 1R1A1 2XJSA 5FZKA 1O8PA 4LNVA 5LA2A 1PNFA 1KEXA 1VBB3 4YZ3A 1AXKA 3ECQA 1OOPB 4EV0A 2WL1A 3BTXA 1OLME 3ROUA 4HVRA 4Y22A 4FI9A 1EV13 2VAUA 5HBAA 4YARA 4C8DA 2GP5A 2RJKA 2DYCA 3T4VA 2RJ2A 3FFQA 4LORA 4N53C 3R4DB 4CP9A 4D7YA 1TNRA 2OVUA 2YBPA 3VDDB 5J37A 1K42A 2JE8A 2VQUA 1H8TC 4J1WA 3E6DA 1HQLA 5HCHA 4ORFA 2P37A 2WR9A 4LIUA 2A3WA 4QKFA 5I0UA 3VHOA 1NA1C 2EIDA 2R6QA 3KV6A 5C3RA 2EXKA 5FZLA 4MHUA 2VBBA 4XVHA 5EFUA 4ZKTB 1V6NA 2WSUA 3P3PA 3HBKA 1LECA 4QB1A 3AX4A 1Z7S1 3VBHB 5DN2A 5A6XA 1HB2A 2JIGA 4JRLA 2DCTA 3QH6A 4CXWA 3HAGA 5FP4A 5JZGA 1RHI1 1I9RA 2JDMA 3RSJA 1QEXA 5KXEA 1SBFA 2E7TA 1MEC2 3ZFFA 4W6WA 2GU9A 3HJRA 5CEHA 5T3NA 4LO6B 1J3QA 1TEIA 2QUOA 3MW3A 3KCYA 4DO0A 5L19A 2W39A 1BHGA 5EHDA 5FTTC 2WWSA 2CWMA 3WDTA 1ODNA 1OH4A 5L7OB 5FZOB 4OFGA 3VD9A 1UL9A 1JU3A 5C3OA 3E6BA 4P9WA 4Y4YA 1MS1A 2R1BA 3C7OA 3TNQA 3VB9A 1H2NA 1NCQC 2Y8KA 5E6HA 5BY5A 3E5UA 3IIIA 4E4SA 1O4YA 4DFSA 4CTEA 4LE3A 1MEC3 1QXPA 2V4VA 3OB8A 2BBAA 1QJU1 2JDUA 4KI5M 4BQ4A 4CSWA 1K3IA 3H9AA 2WZR2 3OG2A 3KF3A 5LASA 4Q4W2 3JXSA 2B39A 2PYTA 5BNNA 3FX3A 5SV8A 3PVBB 4C0BA 3Q8AA 4BXSV 5FY0A 2FDHA 3HNYM 2KM2A 2ZGMA 3MIHA 1L3JA 1W39A 4FTEA 4AFCA 1J1TA 3L9JT 2AEZA 5F5CA 3M3OA 4XFIA 3U4XA 3V65A 2X09A 3ILFA 1NUKA 4XZPA 5IT6A 3D82A 3G7DA 4PQQA 4AFMA 5KBFA 4I2OA 2DDUA 3MW4A 1A34A 1PMHX 4QT6A 4Q29A 1WGPA 4XIOA 1W8HA 4IEOA 4PLOA 2WZR3 2AEYA 4QXBA 4Q4W3 2CGNA 2VMEA 3A23A 4NIDA 1ZRFA 4GALA 4IV1C 2Q1ZB 1HV0A 1VBA2 2Q5TA 1QKQA 1W0PA 3J7LA 1F15A 4NIAA 2AUYA 1SCRA 2HYXA 3VKMA 2GNTA 4I01A 3VN4A 4ATFA 1DDLA 3WNKA 2ZGRA 4CCLA 4KBZA 2IXKA 3N9NA 2VBDA 5IVEA 1ZRRA 1CZTA 3BKZA 3O0WA 1VRH1 3Q8BA 5IVBA 3FZ3A 3MIDA 5A7OA 1UY0A 1OUSA 2A71A 4CDWA 3JD72 4L2NA 4XURA 3KT1A 3AJZA 1GP5A 4IV3B 1S0EA 2VZUA 4DPNA 1W3XA 1XNCA 5EYXA 1VBA3 2Y6HA 3LF7A 1GKBA 3POBA 4P08A 4Y3OA 5BUVA 3NVCA 5EV7A 1WKYA 2J22A 4BIOA 5C70A 1KDKA 5FZ4A 4ATEA 2BVVA 2TUNA 4R4ZA 4AHWA 2QZ2A 3WQ0A 5KHJA 5FYCA 1QXJA 5K7PA 1OOPA 1ZA7A 2SBAA 4RS5C 3VGIA 1DYKA 4W4ZA 1OUXA 1ENXA 2ZAAA 1HRV2 3ZR5A 1LGBA 3QCWA 3J8F3 5LY2A 3JD73 1GQPA 3HOBA 3KGZA 1NE4A 2C9KA 2IXHA 3VDDA 5IFPA 2FDGA 5A1AA 1YQCA 3APBA 3A7QA 4HETA 4LKFA 2XKOA 3C7EA 2RJLA 4P9XA 1BZWA 3AP7A 3RYKA 4S2DA 4CDXC 4EWDA 4ZS2A 2OQ7A 2O0OA 1QJEA 3AZYA 4E2QA 4S2HA 1IG3A 2BP6A 5T5PA 2DTYA 1C1FA 3H3UA 3SH4A 4NWWA 3VBHA 1HRV3 1K5MB 3H8OA 2WYFA 3PUSA 4FQ4A 2BDRA 1O8SA 4AL9A 5LBFA 3LOBA 1W8ZA 4QU2A 5FLIA 1O59A 1Y43B 2I2SA 2XL9A 4XAAA 3AVSA 4AI2A 1OHFA 1UWWA 4Z2WA 4PIXA 1V0AA 5LCWL 2RS32 3LEKA 4OCTA 4IEWA 1IGOA 5L7OA 2JENA 3OJBA 4FOQA 1WW6A 1CIWA 5IW0A 3MV01 3RWKX 1RUG3 1UX7A 5F1RA 2VCAA 3LDRA 5GLVA 5JR7B 1I3HA 4D69A 4GB31 4LO7A 1UX6A 4B1LA 3B3QE 5IYYA 1V6KA 3RWNA 4L11A 2VMCA 1LHWA 3OCPA 1UZYA 4YVWC 1JOJA 2SLIA 4UOJA 1MACA 4GWMA 1KD7A 1QJY3 3WP4A 3TN91 5HXVA 4GZ9A 2RS33 4CEWB 3WCRA 2QVSB 2N7GA 2WN2A 2Y6GA 2ZGOA 3LKJA 4CCMA 4Z1VA 4K9SA 1IPSA 1S0IA 3ZYJB 3HWJA 4ES9A 4A44A 2V5DA 4XF4A 1QJX1 3FHAA 4JVAA 3ZXAC 2D7FA 3NO8A 1VR3A 4FPFA 5C3QA 5C3SA 3AB0A 4HFSA 3SH3A 4FBFA 1FV3A 3M2MA 1MQTC 3WG3A 4CXYA 5I8SA 1NXD1 1OVPA 1VPHA 2WQZC 4XUPA 1W8TA 3WDYA 4IE6A 3I2OA 4AQSA 4N8MA 2VXJA 2ZMNA 2DCJA 3IDEA 3ZXKA 2A6VA 5I0RA 2E26A 1DHKB 1US2A 3I2JA 3SC7X 4PHZA 1OXCA 5JXGA 3IIAA 4HLTA 5DZGA 2Y0IA 2PLV2 4XJZA 5BPXA 3AYCA 4IEUA 2ZAHA 2YV8A 3VZMA 2A3YA 4ASLA 4CCOA 3U78A 1QDOA 3ZXEA 5IK5A 4EZHA 2GH2A 3AMMA 5I8YA 4DQAA 2CL2A 4AZZA 1X36A 1YNAA 2FBEA 2WINB 1KRIA 1Z0HA 2Q1FA 5FWEA 1AYN2 1C3HA 3IPVB 4IV3A 3I2HA 1NZIA 3VBRC 1RUC1 1QHDA 3UL2A 5I93A 2PLV3 5AC91 5FY8A 1AXYA 1PGW2 2VM9A 3CEWA 1QGLA 4A6SA 1JYIA 2OPKA 1ULEA 2HYKA 2B42B 2XJTA 5C9AB 2WS92 3IDBB 3RQ0A 1JOBA 2TBVA 5DAQA 3ZIWA 4B8EA 2W1UA 5FYSA 1OBNA 4AEDC 4QHOA 4IEZA 3TYJA 2Q0AA 4HBNA 3OGGA 4Q4Y3 1AYN3 4QMAA 2WAAA 2G9GA 2HWB2 3SQOA 3TNPB 1VIWB 4OQ9A 1RUD1 3VDAA 1NLSA 1S1AA 1PIV1 2WFF1 4RR3C 1BBT1 5C8WA 3RNSA 1U5XA 3CZJA 3KGLA 4KG0A 4WM8B 2WS93 4Y5Z0 4RGGA 3DPRC 4GAZA 4AW7A 4DOUA 2FDFA 1DGRN 5F39A 2MEV2 3PUQA 4NN0A 1RGSA 3BCWA 3ZYPA 4C1XA 3FWEA 4ZZ5A 5A3NA 3N7LA 1F4AA 3HQXA 3OTFA 1HDKA 2HWB3 4Q0QA 4E2SA 1HLCA 1RVF1 2EICA 5KC6A 1J58A 2PAKA 3K4AA 1AR92 4YW7A 2EIBA 2ZMLA 3LQCA 3VL8A 3MGUA 1ST8A 2EA7A 2UWBA 3KS7A 4BZ4A 3W5MA 1ONAA 1SMVA 2V5YA 1UY4A 3KV5A 5CVRA 5JSRA 2BGPA 4Y4RA 2CY6A 2D43A 2RV9A 2MEV3 3ON7A 3HIFA 1C4RA 1OKQA 5A3UA 1UOFA 1QH7A 2VY0A 2W1SA 1XNDA 2WNOA 2ZGLA 2XH6A 2C9AA 4N43B 3E6CC 4U2AA 4XF9A 3ZVXA 2DVGA 1H1AA 2VMDA 1X50A 4UFJA 4Q8LA 3BOPA 1JYCA 4IESA 4UFLA 4XAEA 3AKSA 3JBG1 5ACA2 3VBUC 2YC2A 2JDYA 4UFIA 4CEWA 3JU9A 3AFGA 3B94A 4XTPA 4GWNA 5C3PA 5FZ6A 3WX5A 1VP6A 4IQPA 1FMD1 1MS0A 1X9TA 4GH4B 1UYYA 2LTNA 4HKWA 4OI4A 1YFXA 2R072 2A6WA 4UW3A 1A8MA 3ACIA 3FLTA 4Z92B 2VW0A 1A78A 3GZAA 3PJYA 4W8JA 1JYNA 4QX8A 1Y3TA 1VALA 2WA4A 2PAEA 3MW2A 3TWIA 2Y38A 1AX2A 5ACA3 5HXMA 4OZOA 3EXUA 2PHTA 4NHXA 3BTZA 2J1RA 1JHNA 2K2SA 4YW1A 5BV6A 2LM3A 3FFZA 2ZX0A 4Q0UA 3RI9A 2HH9A 4Q2FA 3FHQA 2D5HA 1DGWA 3GXUA 4FXGB 1D2QA 3CQOA 2R073 1U12A 1GZWB 1CR7A 3E5QA 1SLLA 2QQNA 4UFHA 4DNYA 3H1WA 1IZ3A 3ES4A 3UJQA 4GKXA 3WUDA 3UGFA 2Q30A 1AZDA 1ZRDA 1OLRA 2VULA 3FJSA 1JODA 3RZGA 1OH3A 2JDPA 3WG4A 2I45A 4JX0A 3IPVA 5F6KA 3MLKA 4PI2A 1PVXA 2DFBA 5J1XA 3NAPB 4FOYA 2QJVA 1CQ9A 5F2SA 1W9WA 3R0RA 4M3CB 5A6ZA 3CIHA 5L9RA 4CRQA 5KXCA 4JDNA 5ANNA 4BM8A 1LOBA 4RQPB 2BVBA 4UBHA 3DYOA 3H1YA 1X33A 3USSA 5C9AA 2A5ZA 1OPOA 1WLCA 4KWJA 4B7EA 2EXIA 5I91A 1O7FA 5BNQA 2GC0A 4AEKA 3UGHA 1N1YA 5LBBA 1YWKA 4OHZA 4XJWA 1J1LA 4IEYA 1O6UA 3KT4A 2ZCWA 4OYUA 2XLGA 4YRDA 1G9BA 1UMHA 2PQSA 4QXCA 1D4VB 5CFCC 5LWBA 1R1ZA 1S2KA 3SKVA 4XUTA 2D98A 1FX5A 3OD0A 2GDFA 2D6NA 4Q4V2 4EWEA 3R4UA 4B1MA 2RDQA 1OA4A 4XFGA 1ACCA 1N1SA 4WM8A 1CN1A 3S30A 4LA2A 3WLUA 4AAXA 3VD4A 4QGLA 5CAZA 4JC1A 2MHFA 1NAEA 3EHKA 2V72A 3QD6A 1I5ZA 4GIQA 4IE0A 4NHLA 4IGQA 5JWPA 1EUUA 1H9WA 3C7GA 1LOEA 2OUJA 2RS13 2VNVA 4YG3A 2C26A 2X5IC 4BQYA 3F2ZA 4COWA 5FXXA 1AR61 5AVPA 3TBDA 4YM2A 4Q4V3 2MPFA 2WABA 3PU8A 1L7QA 4XBNA 3I8TA 4XDQA 3P5BA 2HBUA 3BTAA 2XDVA 1U0AA 4JHTA 4MHRA 4A45A 1BQPA 4HZFA 3EO6A 5FO8B 4PBPA 3PU3A 5BNOB 1OSGA 1OURA 2YBKA 4JDOA 1LENA 2WNUC 4N43A 3OBRA 4AVSA 3CO2A 3FHIB 5M0TA 2VW2A 5JPMB 4AGGA 1HRI2 2FMYA 3GHMA 3KV9A 1YI7A 5KHGA 1UKRA 3AZZA 3ENRA 3CHXA 5EP9A 5JXJA 1ZZBA 1NOVA 4DEQA 1VRH2 1YEWA 1JZ7A 4XEZA 1MVQA 1QMJA 2UYBA 2ARBA 2D6OX 2QQJA 3V56A 1H8VA 2LROA 1ULCA 4LLOA 4GH4A 4LO5B 4TYSA 1OA3A 4HOOA 4DZGA 1GNHA 4H55A 3VUOA 2G4IA 4QB6A 3HNBM 3O1VA 2WZ8A 4OMCA 4O61A 1VBC2 1GV9A 3LFMA 4NOTA 3VV1A 3W5NA 1O5LA 1TE1B 3TEXA 5A3PA 1HRI3 3CDZB 5A33B 1I6XA 5FZAA 3KHCA 2RDRA 4XUOA 2W2IA 3AKRA 1VRH3 4EROA 1CX1A 4N53B 1WCSA 5JOXA 5FMBA 1AL0G 4BE3A 2LW8A 5DG2A 5C4WB 5A1FA 1H8TB 4MGSA 3VD3A 2PELA 3WXPA 4J1XA 4JKMA 1OKOA 2PXJA 4GWIA 1DYPA 1GZWA 3NJVA 5CB7A 4CDQC 3CJIA 4ARYA 1NA1B 3JQXA 1LGNA 1CPMA 1VBC3 4AI9A 2CTVA 1DQ6A 4UWDA 5KHHA 2PHUA 4XDPA 5LW9A 3ZFEC 1ND3C 2RS51 2VCBA 1NCRC 1XSRA 4Y22B 4Y1YA 1PO12 4DS0A 2WC2A 4XYXA 4MGKE 1R091 2V4AA 1UNBA 1LOAA 2HWE1 2AR6A 3ETQA 5FZ8A 3CMGA 1L7RA 4AQTA 1DQ2A 4CP9B 4MO3M 4FQZA 3NAPA 1ASJ1 4NR1A 3I7DA 4YFWA 1PO21 4M3CA 5EXOA 3ZYRA 3VBSA 3VDBA 2DUPA 3AP4A 1Y4WA 3F95A 4QKNA 4RQPA 4DRVA 2C5DA 1OI6A 3WY6A 4A2UA 1YCIA 1OQDA 2VNOA 3GJBA 3ZSKA 3AFKA 4KNCA 4GMP0 3WNXA 4HKLA 4AI8A 2W5FA 1PO13 1XB9A 3U07A 2W94A 4P00B 2QBXA 4QPIC 2JIJA 4GA9A 4XILA 4FOVA 4LQRA 3KZ4C 4EZ4A 2VOKA 1MS9A 3IAQA 3M3CA 2QTWB 5J48A 4K6BA 2BPA2 4RA0A 2DBNA 2AENA 5CNAA 1XE8A 3ZYHA 4HN0A 3IAPA 4X6QB 3FL7A 3PMEA 4Y1ZA 3RZHA 4PDWC 3TEYA 1HXS3 2IVIB 2WO1A 3MLLA 4WM7C 3T4HB 4N7UA 3IWZA 2RMU2 3MPPG 1VBE3 1UMZA 4GMP3 4ZHNA 5LRSA 2W92A 4JQRA 1SDWA 1UOBA 3B00A 3JZVA 3BB6A 3MPBA 4NRQA 4P9LA 4XJAA 1FYUA 1QNWA 3KM5A 3U10A 1QOOA 5A3TA 1AR81 3I3DA 5F37A 2BGOA 2CAVA 4DMIA 2BUKA 5GZEA 2BNMA 1FOD1 4M0HA 3ZYIB 1UOJA 1X8MA 1YJKA 2BWAA 1G9FA 1EPWA 5T50A 2WNEA 4QX7A 2VR4A 4N90A 4UYBA 2B45X 4QX2A 1QOSA 2K46A 4G9SB 2RMU3 1LKNA 3IZOA 2FDJA 3SCGA 4JHZA 3NJZA 4FPGA 4ZY9A 4A7ZA 5CFDC 4XF0A 3RZZA 4MYEA 4K1YA 3B9CA 1GUIA 1VRBA 4QHBA 2DTWA 1V6JA 2QCSB 1BEV2 2OZ6A 2PHWA 3CF6E 3UV9A 1YUDA 2O14A 1S4CA 2XGXA 3IN9A 3NNGA 1FXZA 3GBWA 5A3OA 5BYNA 4LT5A 3WD5A 2JICA 2WT0A 2QQOA 4AI3A 2BJSA 1KS4A 3U0ZA 1DYOA 1SLCA 3AZXA 3M8LA 3N9LA 2OT7A 1KDMA 4Y24A 1ZM1A 5JR2A 1GWKA 1O4ZA 5A33A 2WFPA 3P3NA 3AMQA 3W20A 5FZ3A 1D4M1 4WVWA 1RUI1 1UO9A 1SLIA 5HV0A 3HR9A 2XJPA 4AHXA 4DXTA 2A6YA 3ZIXA 1UU6A 4PBOA 2JG8C 1AL21 3K77A 4N53A 3HMYA 1BEV3 2XLAA 4RHV1 5C4WA 4CDWB 5IFTA 4KWUA 2J42A 4QGMA 1H8TA 5EJZB 5A1LA 5IATA 4K3UA 5KWRA 5K0UC 4MLOA 1SEFA 5F5QA 5AFEA 1NA1A 4P9GA 1WLWA 1LHUA 3ACGA 4CDXB 2WFF2 1BBT2 4LHKA 1L7LA 1V6LA 4CP2A 1H6XA 4CU9A 2OKXA 4QGNA 1YIPA 1FNZA 3THCA 5KHIA 1FNYA 1JYWA 5GZCA 1BMV1 3KF5A 1HKDA 4ZXKA 4NWVA 2YC4A 2YPDA 4NHYA 2ZHMA 5FUIA 1OD5A 1PGL1 4YWAA 3PIGA 4QDQA 1UF2C 1LULA 5A6QA 3WP3A 3QOPA 2WFF3 5DXDA 3POIA 1C8M1 2ZGUA 2FCUA 2YGMA 4FSJA 3FC0A 3MUZ1 4F7ZA 3DXTA 4A6OA 3UYJA 4Y26A 1AJKA 3ZYBA 5FCCA 3WR0A 3VKNA 2D40A 1XC6A 5FZCA 5FV3A 3AKPA 1W2NA 1WWYA 3WDXA 4BXFA 1XYOA 5FZHA 2PAMA 4L97A 3C8XA 5A7SA 3W21A 4P14A 1BVVA 4QAWA 1RUJ1 4WVMB 4BQ3A 2B7YA 5FIXA 5GLUA 2Q8CA 1LODA 3ACFA 4V2VA 5FOJB 3T30A 1DQ5A 2YBSA 4XBLA 1EAH1 2HWD2 4CCCA 1VMHA 2H0VA 4R8HA 1BXHA 4FPKA 5CG8A 1JW6A 3NNJA 1M4WA 5E16A 4QHZA 3SEPA 1OF4A 1H2LA 3GDBA 3HQUA 3AMNA 3H8RA 2NM1A 2WT2A 3RDIA 2J1TA 3I2FA 3PUAA 1N3QA 4QKBA 3VKOA 5JUVA 5F32A 3SH5A 1NYWA 4O9EA 4OUEA 5LRRA 3WNOA 4YFZA 4MG2A 4IV1A 1IHMA 3MIEA 3K75B 1VJ2A 1DZTA 2HWD3 2E7AA 4AK3A 4FP2A 5FLHA 1Q8QA 4QXHA 2O8OA 2HWC1 5FUPA 2Y34A 1ENSA 4LBJA 4AG4A 1XOYA 3EMRA 5JZGC 1CPNA 5E8AA 1QDCA 1BK1A 2MNGA 4JKKA 3L2HA 2DCKA 4CVUA 2Q8OA 1QY4A 4S2FA 2PHRA 1W6QB 3QLQA 4DXZA 3OOXA 4XZUG 2HWF2 2JKXA 1W2UA 2R062 5DUVA 4P5HA 4TN7A 3RI8A 2IXCA 4K8FA 4YGBA 5IK7A 3NQHA 1GWMA 1PM4A 2UU8A 4DEVA 1YQ6A 2WO2A 3DYPA 5FPBA 1F31A 3SITA 3N3HA 2Q1MA 1JZ6A 1KFXL 3PDQA 1GZCA 2WQ4A 1Q5OA 4L99A 4D94A 3NWKA 1YXWA 2W08A 2FDKA 3AXDA 4QDRA 2HWF3 3T08A 3T2PA 1Q56A 2D5FA 3VKLA 4CCEA 5B4NA 1ZRCA 2R063 1IKPA 4X6RB 3UGGA 2VO5A 1C5IA 2GC2A 4LKSA 4CUGA 1F2NA 1AYM2 1F4HA 4IEVA 4D6RA 2D6PA 4RR3B 2LRPA 5FBJA 4CDXA 1RUH1 3KQ4B 1ULOA 1RJ7A 2BRTA 1ULPA 4OVEA 2HEYF 1LRHA 3NL1A 1RTVA 4M3CF 5JI7A 2IFWA 2OYZA 4MV2A 3WF3A 1S0BA 2ZGSA 5FXZA 1RUE2 2A6ZA 3D6EA 3I59A 3S7EA 5FO9B 3N7JA 2WWUA 1ND2B 1W2OA 3NNFA 4Y1VA 2HKXA 2R042 2J1AA 5FR3A 1AYM3 1ZRIA 3I97A 4BJ0A 1UZ0A 3S5AA 5EZWA 2WN3A 5FYZA 5IVJA 3HN1A 2A70A 1W2TA 5JLVA 3RJRA 2ZGQA 4QPGC 4D7TA 3AJYA 3H0OA 2EF6A 5DAVA 1APNA 1AJOA 3RGBA 3ETPA 4HG6B 4X8PA 1RUE3 4YG0A 2G19A 3MBWA 3WQ7A 5FZEA 5JVVA 4P9YA 3J26N 3DUIA 1BCXA 2WT1A 4LK6A 5IVFA 2R043 2JDAA 4PCRA 4YVWA 2XQRA 5FMOL 2NPIA 4E4ZA 1NT0A 2W3JA 4WVMA 5FYYA 3VBUB 2AGSA 2GN3A 1OT5A 3GALA 4XMAA 3I3MA 2D97A 4I0WB 4LEJA 1RUF2 2VTFA 3N35A 1H2MA 5CYYA 1W8FA 1VBD1 5LK7B 2YYOA 4NE9A 2D6KA 5FZ9A 3DECA 4IW3A 2DU0A 4XETA 2CWSA 1XU2A 5LB6A 1UMIA 4XQWA 1MQTA 1DGRA 2EVXA 4NPRA 1G9AA 2WLPA 2Y26A 4BYYA 2CDOA 3JB8A 4XHBA 3GYDA 2GC3A 1OQ1A 2GNBA 1VLNA 4ASMB 4EN8B 1XSQA 1RUF3 3OPTA 2JG9B 2P3YA 4CUBA 5FZBA 3TRSB 3PNAA 1RL3A 5FZDA 3OGJA 1V6MA 3WQ1A 4IUGA 4C91A 3PVOA 5LA9A 2XWJB 1FPN1 2DBIA 4HL0A 3VBOC 5L36A 3VBHC 3R6SA 4Q0VA 1QQP1 4KH9A 5C6CA 1IPKA 1PVC2 1C1LA 3AL6A 1TG7A 3PJQA 3OEBA 4L0PA 4LXLA 4QQPA 2JDNA 4URTA 4Y5TA 5DZEA 3ZFGC 4DY5A 5HI0A 4GJYA 4R9AA 4OHYA 4OULA 1W6QA 4J6GA 1WD3A 3U37A 2VZ1A 1J3RA 3I2KA 2XVGA 1URXA 3K2OA 1G7YA 4YPJA 2ZEZA 1XYNA 3FMGA 4ZU5A 1TME1 3ZSMA 2XBO2 1MZFA 4Q4X1 1W9YA 1A8DA 4CU6A 5FDBA 1PX3A 1ZZ8A 5FK7A 3OD4A 4HSJA 1PO22 4QQ2A 2D6MA 4QPWA 4XACA 3O0XA 5B4XA 3ZN6A 1RMU1 4ISQA 5C5UA 1CONA 2ZEWA 1PVC3 3AL5A 4ZU7A 4LO8A 3TEWA 3OBTA 3FE5A 4PI0A 3OF1A 3TOJA 3RG0A 3ZSJA 4OI1A 1X7NA 4Q27A 4COUA 4QX3A 4K20A 4LUMA 3SLIA 1BYHA 1IPJA 3WNNA 2XBO3 3OSDA 4RR3A 4BK5A 1YQ8A 2CSGA 2ZOEB 5CG9A 1W3VA 2P34A 3N7MA 2W47A 4R9CA 5GKAC 3OUHA 3O1OA 3T1MA 3O1MA 5GLTA 1J84A 4GKYA 4MGZE 4MGTA 4QKDA 4AE2A 2EAAA 2Q4SA 5HV4A 1V6IA 3THDA 4FAHA 1RINA 2BFUL 2KR2A 4FFGA 5C33A 3UESA 3D8CA 4GQ7A 1ND2A 2BW8A 3I54A 1V70A 1B35C 3IDCB 4LHNA 2GC1A 4N7IA 4QQOA 5LATA 2YB7A 5DAPA 5E1RA 1AVBA 3GNEA 1E5SA 4IXLA 2YC0A 4QQHA 3WQBA 2VNGA 4Y1XA 5FPUA 2ZKLA 1PGSA 5T5LA 1AR82 4YW3A 3B01A 3UT0A 2GP3A 4HVOA 4I02A 4F3JA 2XONA 1VBB1 3OGVA 5I8TA 3USUB 1FOD2 5FZGA 4RN5A 5GLWA 2XVKA 1UAIA 2WNUB 1JYTA 5IAXA 4QM9A 1EV11 3I4IA 3V64A 4ZXEA 1DZQA 1WA6X 3T2TA 1T6BX 1TVGA 1YRZA 4HT1T 4CCKA 2FZ2A 1SG3A 1P8JA 2JDZA 3W58A 1ZBA1 1PK6C 4XBQA 4IE5A 3THPA 3FN9A 4BH9A 5A3WA 3VBUA 1POV0 5FYBA 3EQEA 3S7IA 2VBPA 2VZ3A 1RIRA 4AVBA 1O91A 3NV3A 1UOGA 1RXGA 2QDRA 4BA6A 4FO9A 4LUKA 1MS3A 2VGDA 1PNGA 2YMZA 3ZKYA 3MEPA 1LEDA 1PM7A 5GLZA 3O1RA 1JH5A 2LS6A 3O1UA 2F4PA 2H0BA 1N1TA 4LBQD 3T09A 3WOGA 4E4DX 4JRAA 1C57A 1UZWA 3ACHA 1JZ2A 4DINB 3HBZA 1RYYA 1CWPA 4BB3A 1YQ2A 3KVBA 1CVNA 1R082 4MVTA 5F3GA 2UWAA 1AR93 5T52A 2NZ9A 1D4M2 2DUQA 4QX0A 2NP0A 2JG9A 3N9OA 4M00A 2LUWA 3GGLA 3CL1A 4COZA 5LBCA 4CUCA 1HB3A 1POV3 2QZ3A 1AX0A 3LE0A 4LOSA 4RHV2 5I0SA 5FUNA 5CKNA 2PMWB 4PIZA 3ZPYA 1GOHA 4XQ4A 3WNPA 4CE8A 5H9QA 1V6OA 4XC9A 2BNOA 4URAA 1K5MC 1XNAA 1COV2 1WCUA 1Q3EA 3ZFEB 2X29A 1R1A2 2NQYA 1NZCA 2QDNA 3FLRA 1R083 1NCRB 3AP6A 3C2UA 4LR4A 3ZXGA 1GOGA 2XB6C 1IKQA 4KMQA 1GZ9A 2YXSA 2W9XA 3A21A 1BMV2 2PHLA 5FYMA 3HQRA 2R49A 5D8AC 2OW4A 5GZFA 5FP9A 4EYUA 4RHV3 3KVAA 4COVA 1N3PA 2VUJA 3RZJA 5IAVA 3HEIA 2OUHA 4BQ5A 4PJYA 2PQQA 4ISRA 3NW4A 3CJIB 5FZFA 4A7YA 3LGRA 5DPNA 5C5TA 4L9BA 1COV3 4XXPA 1REEA 2ZBJA 4XF3A 2VMIA 4HK8A 1R1A3 2JB4A 4MXWB 4CPBD 4IGPA 5DAXA 1NY71 2ET7A 5BNPC 4YGEA 3LA7A 4FTBA 4L92A 3J4UH 1OD3A 1Z7S2 2OS2A 1OFNA 2WZR1 3M1HA 5CFCA 2DUOA 3DN7A 1VB2A 2XMLA 3ZXJA 1E5IA 1RHI2 2F6BA 1XU1A 2VPVA 3O14A 4LBKA 1W03A 1GOFA 2WJSA 2C1FA 3CU7A 1DQ1A 3K3NA 5JIAA 3OYWB 3ZYFA 3ZYGA 1M06G 1H9PA 1S0CA 3KD4A 2VZVA 1RUJ2 3VBSB 5J09A 3J7NA 1ZBE1 3BN6A 2WSVA 3PURA 4AOCA 1GP4A 2AH2A 5CIRA 1EAH2 3WV6A 3UK9A 4WM7B 3LEMA 1GMMA 4QX1A 1Z7S3 4BQ2A 3ZKUA 2ZS6B 2G1MA 4K7JA 1D7PM 3SXWA 3DXUA 2OX0A 2OIIA 1RHI3 1GICA 5JOYA 4YVSC 1VBA1 1V9U1 5EJ3A 3ACLA 4UI9L 1MZEA 3N4MA 5I0DA 3BPZA 1UPSA 2KXLA 2ZGTA 3NKTA 1QJU2 3U1XA 3SCHA 3LFIA 2O8QA 4YW5A 2WYSA 3ES1A 2B5HA 1CAWA 3USUA 4BISA 2H6CA 1GYKA 1JTZX 2I07B 1X9PA 1EAH3 2WNUA 4LK7A 5H9SA 1LEMA 1WW4A 3J8F1 1J3PA 2RM21 3JD71 2VG9A 2HWC2 2YUEA 3R4SA 2QQKA 2QKDA 1LTEA 4ARXA 1E5RA 3VHNA 4AFBA 3SKJE 5L9BA 1UY1A 5CFDB 5F9TA 1W8WA 1W9FA 3C3VA 5HCAA 1POQA 1TZOA 4RL7A 4JGZC 4PF5A 3U11A 2VUCA 4F83A 1CIYA 1QJU3 3OY8B 3ZLIA 4XFHA 5T5OA 3T0DA 4FT8A 2K9ZA 4CZSA 1XRUA 2ZZJA 4YGCA 5K8SA 2FDIA 1CAVB 1HRV1 5CBLA 3EYPA 4W50A 1JXNA 1VAKA 2D3RA 2HWC3 3AVRA 3D4KA 1DZRA 4ZPIA 4LE4A 1OLQA 2ADDA 4JTOA 3RYPA 5EQUA 3RZMA 1W9SA 1UYPA 2EIEA 1UIKA 4Z07A 3KQRA 3WG1A 1MS4A 2JG8B 4D6SA 1ZZ6A 5FY9A 2ZABA 4CUAA 4CDUB 3POFA 4XOGA 4RD7A 1Z78A 4COYA 3GCWA 4CEYC 3LZZA 4HPKB 3SEEA 1US3A 5GJ6A 2X53S 1RUG1 1CJDA 4BOWA 4XCAA 1Q8PA 4M3CE 5FLJA 5FPZA 3DEMA 3Q8EA 3ZXDA 2PTMA 1Y7BA 3Q8FA 2Y6KA 5J36A 1PX4A 1RUH2 1HW5A 3D3AA 3ZFEA 1IOAA 3QACA 1ND3A 2VTXA 1JN2P 2FCTA 4YLZA 3NNMA 1NCRA 4O7XA 1GNYA 5HCBA 1QJY1 2P5BA 3AMHA 4BDVB 4Z2AA 2PFWA 2I74A 5A6YA 1RITA 1SQ4A 4XPVA 2DU1A 1JBCA 3KSCA 3OGRA 3VBFC 3WF1A 4I3GA 2EALA 2WLQA 1A6CA 3GZTB 2R16A 3H8UA 3P1IA 1Y9MA 3GBGA 3BALA 1ZA4A 1RUH3 5DUWA 1TQ5A 4N43C 5HCFA 4OI0A 2E63A 4PT6A 2ARAA 4MXWA 4SLIA 4JDMA 3EBRA 3LIGA 2BOJA 4TWTA 2CGOA 1A3KA 1E57A 2BERA 3LCPA 2VJXA 4NRPA 5F3IA 4DXRA 5JCTA 3V0AB 1NXMA 2Z4FA 3U75A 3X29B 4GULA 3BVCA 3ZXFA 3I2IA 1XNTA 2YDEA 2VZPA 1EYBA 3MIFA 3VZLA 4B7KA 4QWNA 5F5IA 3H7JA 1HV1A 1JU4A 1HJGA 1SPPB 3OYWA 1VB4A 1O3TA 5FZMA 3T0AA 1UU5A 2XJRA 2ARXA 3WP6A 3JCIA 2E7QA 2BYVE 3KB5A 4YZ4A 1AHSA 4PDWA 4W6YA 3AZVA 1UZZA 4LJHA 4NPMA 1KJLA 2GMPA 2VU9A 2QE3A 4WM7A 1DU3D 3ZPOA 3MLJA 3UETA 1XBFA 1NCQB 3H50A 1GSLA 1CAXA 2XLFA 5IK4A 2ZEXA 4GB32 1W8UA 2D6LX 1GZTA 3PIJA 4NMIA 1WLTA 3ZN5A 5JI9A 3EB7A 1FV2A 4LA3A 4QX5A 1XNKA 2QQIA 2WZEA 4OHXA 1JS9A 2AREA 4Q0SA 3TN92 4AQ6A 2P6HA 5K9YA 1OF3A 2JD9A 1UYXA 3I3EA 3IT8A 1SCSA 1NKGA 4N9IA 4B3NA 5LEJA 3WUCA 4XMIA 1UKGA 4XXAA 5FAXA 2P2KA 1W9TA 1IG0A 1QJX2 4Q4Y1 3NJXA 2IXJA 4NJ4A 1FATA 2YU1A 4NRMA 4GB33 1QQP2 3OPZA 2YPJA 4LBQB 4ONUA 5CFDA 4NIIA 4LKEA 3LEIA 4PLMA 4FPOB 1WW7A 2BEOA 2ADEA 5C8CC 1RUNA 3I2GA 3VD7A 3PTRB 3RFRA 3OY8A 2UY8A 5DDJ1 4IV1B 3TN93 2WS91 4X8NA 3M3EA 4A41A 3NJYA 1CAVA 5LY1A 1G9CA 3WF0A 4AFDA 1W28A 2CHHA 3QH7A 4JGYC 2VH9A 3BI3A 3Q8CA 1QJX3 2B46X 2HWB1 1S2EA 5FPXA 5H9PA 2XWBB 4MXVA 1RMU2 2HLEA 3AC0A 3POGA 3WINE 4BMBA 4RGKA 3FUOA 3ASIA 3T0BA 2UY9A 2JG8A 3LEGA 1HX6A 1SLBA 5FYIA 1Y9GA 4MUVA 3KMHA 5CISA 4BLIA 4P02B 1SDDB 4K40A 5FRAA 3DF0A 4CDUA 4QB2A 3PL0A 2VVFA 4HPKA 3M3IA 2MEV1 2Y6FA 4AWDA 5F7UA 1IS6A 4LLFA 5FYUA 1RUC2 2JKBA 3WF2A 1O3SA 5AC92 1W6OB 2ZXQA 2YHJA 3O1PA 4KL1A 2YGLA 1C5HA 1LHOA 5KR7A 1F5JA 2YU2A 3DGTA 1LHNA 4RS5B 2Q8EA 4XFAA 1RMU3 3WW2A 2FD8A 1CAUB 1MZ5A 1LOFC 1SZBA 2ZACA 5LZ6A 2C4XA 2VQ0A 1GP6A 1GLHA 2OA2A 1UXXX 3IB3A 4XJ9A 1I5PA 1CX4A 2GN7A 4C90A 5FMDA 4XJUA 5BXXA 1H4GA 4KU8A 5AFBA 3T1LA 4FTSA 4FCAA 4E8DA 2OPWA 1F35A 1KXGA 5F6LB 1ZZ7A 4V2WA 2W87A 1RUC3 1W6NB 2JE9A 1S0DA 1RUD2 5EIYB 5AC93 3LDBA 5JSPA 2WA3A 2WBKA 5BNOC 1PIV2 1JUIA 3VKFC 2G9FA 1BVP1 1ULFA 3GZEA 5C71A 2DFCA 2Z5WA 1LNSA 2R30A 2K0GA 2B9VA 4XE9A 1SLAA 3MDPA 1PMJX 1SBEA 3MIGA 2L9LA 3V0AA 3LPGA 4I3PA 3O5SA 3I59B 1XE0A 2ETEA 2J1VA 4BQWA 3VDCA 2H6BA 4R4XA 1WCDJ 2R7EB 3IM0A 1UYZA 2VCMA 1IQDC 3AM2A 2HJIA 1RVF2 2ARCA 1REFA 1ZBA2 1SPPA 2D93A 1H6YA 1RUD3 2RVAA 1OPMA 4HMZA 4NAMA 2XJQA 4XHXA 1LAJA 1F9KA 3FBYA 1PIV3 4I30A 1BBT3 2Y6LA 2D44A 2W95A 3NV4A 1ENQA 3ZDVA 2R32A 1W6MB 3POEA 1FI2A 2IXIA 4G4FA 1U5IA 1GQHA 1VAMA 2RG4A 2BQPA 3LPFA 3GF6A 4UF0B 1NCQA 3LWCA 3BPSA 3URFA 4FAGA 4E27A 2JXAA 4PF1A 4BMEA 2VZOA 2WKKA 2WNVC 4TLGA 5H9RA 4UFKA 4YVWB 3AXEA 3LIHA 5C4WC 2VMGA 1RVF3 4FPYA 1CZVA 1ZBA3 2A75A 2FMDA 4AEMA 1RJ8A 1UW8A 4UW6A 5ABJC 1S55A 4M4RA 3FLPA 3JBG2 1DLCA 4AFAA 3K51A 4Q5OA 1GR3A 2NMNA 2IXLA 2VD7A 4CA9A 1SFYA 5F8PA 4HVQA 1FMD2 1LU2A 1KS5A 2RR11 3H1MA 3VBOB 3WNLA 4BCUA 2IZWA 4BHPA 1K5JA 3WT3A 2W0XA 4D0QA 4EN6B 1O4TA 2W1WA 1MQTB 4MOAA 3ZFGB 4LBQA 1MS5A 4U36A 4MX3A 2GAUA 3A4UA 3RMXA 1SLTA 1DQ0A 3WNMA 1G6NA 2NMOA 2Y64A 4WZFA 4AHZA 1G9DA 5A80A 3BU0A 2Z69A 3JBG3 1YIFA 3KCCA 4NROA 1Q8OA 3T3YA 2E6VA 3B02A 5A32B 1KFUL 3GCXA 4BQXA 4B4RA 2VVDA 1FMD3 1U5YA 3LDKA 5KXDA 1OLMA 4NIGA 3V0BB 3FBMA 4Q0PA 2BV4A 5DUUA 4E4HA 3ZM8A 1XNBA 1S0FA 5FP7A 2ERFA 2RS11 2P17A 1DBNA 5EJ1B 5GZDA 2IVJA 3HNMA 3SISA 3WP5A 1KGYA 1BJQA 3C7FA 4Q4V1 2Y60A 1NY72 1QOTA 4NHMA 1OA2A 3N9MA 3ZFFC 4JKLA 4MGQA 2B8MA 1XYPA 4CU7A 4XFBA 5D1IA 3VBRB 4I09A 4OHVA 1DIWA 2ZZQA 1UY3A 3HVDA 3M7AA 1S0JA 4CCNA 1W6OA 5FJKA 3MF9A 4CP0A 2IFRA 4Z8BA 4HKOA 4E2GA 1OC1A 1HN1A 5L73A 3MUY1 1NLRA 3ZN6B 3NMBA 4RS5A 1CAUA 1ZBE2 4DUXA 2DVAA 1X8EA 3RPQA 2XG3A 2NYYA 4Z82A 4AVCA 3C7HA 4AEDB 4CPBA 2OXBA 3N7KA 1B35B 1NQDA 3LAGA 2ZGKA 4NUBA 1FT9A 1W0NA 3ZN4A 2E51A 4DB5A 1U5ZA 2Z79A 3ST7A 5BNNC 2HEVF 1W6NA 2QNKA 4P5YA 4BWOA 5J7MA 1V9U2 2F4LA 3AP5A 4SBVA 4WV8A 3WDWA 4C1WA 4QPGA 1D0GA 4FPEA 1WMDA 2ORZA 2PN5A 5JAXA 3DPRB 1HRI1 1VMJA 2UWCA 4XFFA 3AZWA 1ZBE3 5IVYA 2JB8A 4FXKB 2FCVA 3RS6A 5JDBA 3H8XA 4NHKA 4RFRB 3SNMA 3H3ZA 1IQAA 1WBLA 4MSVA 3J8F2 2RM22 1O3QA 2EIGA 4A3ZA 2VCCA 2JX9A 1PK6B 1SFPA 2RDNA 1AXZA 1ULGA 2P3KA 2JJ6A 4OHWA 4YW4A 1T6GC 3KT7A 2XOMA 4WBBA 1V9U3 1T2XA
chains in the Genus database with same CATH topology
2BNNA 1AR62 2DWRA 1VBC1 1YHFA 5LK5A 1GANA 1W6MA 2Z2SB 4QPYA 4IETA 3LB9A 2XPJA 4XF1A 1ZNPA 5KC5A 5CADA 2RM23 2ES3A 4Q26A 3PVEA 2LALA 5T55A 1O3RA 5KHKA 4CDWC 1YO8A 2VW1A 1N47A 5CU1A 5EWSA 3CLPA 4HK9A 1AR63 3Q9OA 1MS8A 2JE7A 4I0BA 4LBNA 3VL9A 4UW5A 2XKPA 1N1VA 1XXNA 1RC6A 4EN7B 2GMMA 5CA6A 1F5FA 3GZUC 5SV5A 1EP0A 1OOPC 3VBOA 1PO11 1RUG2 2VXRA 1AR71 2CV6A 3PTYA 4PLNA 1Q8SA 2ENRA 2AYHA 4YGDA 3ZFGA 1WA4A 4MGYE 2DCZA 2ZHLA 3VDDC 5FQ0B 5AVAA 3ALQA 1DGLA 4FPJA 5D8AB 2FQPA 3UKTA 4EWAA 5J96B 5T54A 1QJY2 1S2BA 3WW3A 5A32A 1HIXA 3LA2A 2VVEA 1TNFA 3ZXLA 2E53A 2PHFA 2PA7A 4KU7A 1HXS1 1O5UA 3RRDA 3V0BA 2ZX2A 5DG1A 2GNMA 2TEPA 5DUXA 2V09A 1VBE1 4GMP1 4NO4A 1MVEA 1C28A 1I1EA 5BNPB 2ET1A 2ZA9A 2EXJA 4UBGA 4H7MA 2RS52 3POSA 1ZZCA 1UU4A 3WW4A 4QQLA 3KCXA 4RGAA 4R52A 3FUQA 4OUSA 1R092 3VBRA 2HWE2 2VNRA 5GZGA 4TLFA 5LEKA 5L7OC 2BGCA 2WIIB 1WLDA 1ASJ2 1KQRA 1NG0A 2RMU1 1AF9A 4I0AA 2RE9A 3ZSLA 2VUAA 2HEWF 2GH8A 2GZWA 4AEDA 2RS53 1B09A 1B35A 4B4QA 5CFCB 2KA3A 1DFQA 3EJKA 1R093 1IS5A 3QBQA 2HWE3 4QD2A 4YVSB 3BU7A 2ZPXA 2ZMKA 1YFUA 2O1QA 4D7SA 1YLLA 4PQ9A 1ASJ3 1WD4A 2XL7A 3HT1A 3BOWA 3CNAA 5EYYA 1PO23 4OUMA 4INDA 4H14A 3DPRA 5JPNB 1TMF1 1RB8G 1PZ7A 3VZJA 1UD1A 4QM8A 3I2DA 3INAA 2CGPA 2XJVA 1BEV1 1G8WA 1DGWX 2X5IB 4Q4Y2 1PK6A 2YY1A 3PMSA 3LSDA 1MZ6A 2XJUA 4JGZB 2XHKA 5TSWA 1PZ9A 1VAVA 1ZVFA 4LTAA 5IUQA 1H1IA 1LU1A 3O0VA 5DDJ2 1FAYA 1PMIA 1CAWB 4MZUA 3VZOA 3ZMOA 2NN8A 3HT2A 4ITCA 3POWA 1ALYA 1X82A 2DCYA 3D0JA 5KXBA 1BKZA 1WMEA 1SACA 3W59A 4AYUA 4XJ8A 2WZPP 3ILNA 2Z42A 4IV3C 3WG2A 5J98B 3H7YA 1KITA 1AR83 3ELNA 4CEYB 2GNDA 5DDJ3 2JD4A 1FOD3 4META 4EJRA 1LHVA 3ZSEA 2GALA 1K5MA 3S6PA 3MIBA 1CD3G 4KGQA 3VHRA 2EAKA 1ND2C 1ZYBA 1D2SA 4YSFA 3IKWA 2VOXA 5FQ0A 1UN1A 3JUUA 1OMIA 4Y1UA 1RUI2 5D8AA 4W65A 2YROA 4FPLA 3LSEA 4AVTA 2TNFA 1AL22 2DF7A 2GMEA 3VBFB 1QU0A 1QH6A 4HN1A 3VZNA 3ZDSA 3ATGA 4KWLA 4CDQB 3MFAA 1Y9QA 4WVVA 1UIJA 4KG8A 1LESA 4O9GA 3ZO0B 4EN0A 1ND3B 5BNPA 3B7MA 1MEC1 3D0SA 4JV4A 4B29A 1D4M3 1RUI3 5FMOS 4KWKA 5A3MA 5GALA 2ZX1A 1AL23 2HWD1 3B93A 4CP1A 3VHPA 3ME2A 1PGL2 3KLSA 3R05A 4XFCA 2AZ5A 4DRRA 4DY3A 4XQDA 1H1MA 4K21A 4KQ7A 4IEPA 1ZZ9A 4A3XA 1QJZA 1C8M2 3SHRA 3AKTA 1C8NA 5JMCA 1KJRA 2ZGPA 2R0FA 1GBGA 4BLJA 3M3QA 4QPIB 3NV1A 4Q4W1 4LBLA 2JG9C 5B2GB 1DQ4A 5E89A 4YVSA 4CEWC 1PHMA 1GFF2 1REDA 4S2GA 3WW1A 1YYNA 4AXOA 4RFT0 3WHUA 3S0MA 1WMFA 2B9UA 4AEJA 1C8M3 4QXKA 1ENRA 3WCSA 2ATFA 4LBMA 2GSYA 1H2KA 5FFOC 4PDWB 4XIKA 4AVAA 4YZ1A 3D5OA 2RHPA 3NKGA 5I0TA 2RR12 2HWF1 1H0BA 1UCXA 3AP9A 3THTA 3AK0A 2R061 1Q43A 1W6PB 2X5IA 4IEXA 1CAXB 1WUVA 4FOWA 2DVDA 2DV9A 3DL3A 2P3JA 1V00A 5C8CB 4JGZA 4ZU4A 1NQJA 3O7OA 2OZJA 1AUYA 2FZ1A 3WDVA 1RUJ3 2VECA 5FREA 1S0GA 3LA3A 1ZX5A 4ES8A 4JGYB 2X8KA 4H3WA 2RR13 4R9DA 4AVVA 4CYDA 3ZX7A 5JOZA 1HQNA 1AYM1 1J59A 2RS12 3WVJA 4Y20B 5DZFA 4Q1RA 1EPZA 4CEYA 2V73A 1QXRA 4RSUA 4W6XA 2FHRA 3DKWA 3NSTA 4WVZA 4KBBA 3RJ2X 1ZREA 5C9AC 2CAUA 4YW2A 1RUE1 5JSOA 2VQAA 4AGVA 1JUHA 2BFUS 2R041 3NV2A 2R0HA 2D3PA 3B9IA 4UW4A 2R1DA 4YZ2A 1ULDA 3MZHA 3MICA 2ZHKA 4OLLA 1SFNA 2JEMA 1G86A 3VBFA 2A7AA 1CJPA 4WM8C 4YM3A 2VOWA 2D3SA 4CDQA 4YZ5A 5K0UB 4AHYA 4LO4B 1LJ7A 4R9BA 1LGCA 2QQPA 3AYAA 3AMPA 4LBOA 2UYAA 1RUF1 4NVPA 1CESA 4M01A 5J3UA 4IEQA 2RS31 4EN9B 3HD8B 1WBFA 3PLQA 3W9AA 1QWRA 2IWGB 2UURA 2C0ZA 2QFEA 2ZGNA 3MFCA 2BWCA 2ZTNA 1HQWA 2P3IA 2XUMA 3TB0A 4L8QA 4AI1A 1UPIA 1GQGA 3UJOA 1NE6A 3K48A 2A6XA 3AKQA 4XTMA 4YM1A 4K1ZA 4AGRA 4MGIE 4QPIA 1DF0A 1WCKA 1AX1A 2WNVB 3J9SA 2W52A 1GNZA 4IERA 4LHLA 5ABJB 3IBMA 3GHNA 2ZX4A 4GH4C 3N36A 4JTNA 3SMHA 3WZ1A 1PVC1 3L2YA 1VBD2 4HSLA 1XE7A 3CJXA 4D3WA 3B5LB 3POYA 4FP3A 1N3OA 4M0NA 3M4FA 2PHDA 3E5XA 1LB2A 1AR72 1LCLA 1W6PA 1LOGA 2XBO1 4KGGA 4OI2A 2PLV1 5C8CA 1YJLA 3RYRA 1LOCA 2CYFA 5A3LA 3CJIC 4LULA 5FOBB 2NLRA 1VBD3 4TZDA 2EXHA 3GBFA 3MYXA 4JGYA 3LOIA 1F8VA 2W68A 2A73B 4MH0E 4V1PA 1FPN2 1HXS2 5FO7B 3WDUA 1AR73 1AYN1 3RMYA 3G6JB 4JCKA 5E88A 5JZGB 1CGPA 1RUOA 1VBE2 1YFWA 3PVNA 1OQEA 4Y20A 1PGW1 1YFYA 2ZX3A 4G3YC 3NAPC 3ZFFB 4PIYA 4XW3A 3IMNA 3JB4C 4FVVA 3TAYA 3VBSC 2PHXA 3M70A 2ZJCA 4RQPC 1WW5A 4AF9A 1TME2 3AYDA 2VMHA 3UKNA 2ILMA 4Q4X2 1FPN3 4YYOA 3BODA 1IS4A 1LOFA 1QQP3 5JIUA 3DV8A 5FBZA 1LR5A 1XQNA 1H30A 4YG6A 4IL7A 4TSVA 2ZKNA 4UXAA 2YZ4A 1DLLA 3A0KA 4BQ1A 5T5JA 2CNAA 3MF6A 3PHMA 4P9JA 5BNNB 2IC1A 5K0UA 1TME3 4AQ2A 5BNOA 3UKVA 4Q4X3 1QF3A 3ZMNA 4BPZA 3VZKA 3BIWE 1QNYA 1D0HA 1SBDA 2BTVC 1H4HA 1TMF2 4H7LA 4BIFA 1AR91 4FPCA 1YI9A 4F8AA 1Q8VA 4GXLA 4N9HA 1POV1 3SCFA 3VLBB 2DVFA 2JECA 5GM0A 1MR5A 3AYEA 4AI0A 4E9KA 3WHTA 1W0OA 4YM0A 2A3XA 2VOVA 1OFSA 3ILRA 3JQWA 4QPGB 4JAAA 4WZCA 4FPHA 5JOWA 3A0NA 4HANA 1R081 1DG6A 1TMF3 1VBB2 2DVBA 3E97A 5ACA1 4OZXA 4YNIA 3B69A 4P9IA 5IK8A 1EV12 4C0HA 4Q1PA 2E9QA 2WNVA 4A7KA 2DURA 4CDUC 2R071 2XVLA 4B4PA 5ABJA 1PZ8A 3O12A 1IS3A 3MI8A 2BBVA 2ZHNA 1COV1 2Y0OA 1EY2A 1R1A1 2XJSA 4LNVA 1PNFA 4YZ3A 1VBB3 1AXKA 3ECQA 1OOPB 4EV0A 2WL1A 3ROUA 4HVRA 4Y22A 1EV13 5HBAA 4YARA 2RJKA 2DYCA 3FFQA 4D7YA 4N53C 3R4DB 1TNRA 2OVUA 3VDDB 5J37A 1H8TC 4J1WA 3E6DA 1HQLA 4ORFA 2P37A 2A3WA 5I0UA 3VHOA 1NA1C 2R6QA 2EXKA 5EFUA 4ZKTB 1V6NA 2WSUA 3P3PA 1LECA 3AX4A 1Z7S1 3VBHB 4JRLA 2DCTA 3QH6A 3HAGA 5JZGA 1RHI1 1I9RA 3RSJA 5KXEA 1SBFA 2E7TA 1MEC2 3ZFFA 4W6WA 2GU9A 5T3NA 4LO6B 1J3QA 1TEIA 2QUOA 3MW3A 3KCYA 5L19A 2W39A 5FTTC 2WWSA 2CWMA 3WDTA 5L7OB 4OFGA 1UL9A 3E6BA 4P9WA 4Y4YA 1MS1A 2R1BA 3TNQA 1H2NA 1NCQC 5BY5A 3E5UA 4E4SA 1O4YA 4DFSA 4CTEA 4LE3A 1MEC3 1QXPA 1QJU1 3H9AA 2WZR2 4Q4W2 2B39A 2PYTA 5BNNA 3FX3A 5SV8A 3PVBB 4C0BA 2KM2A 2ZGMA 3MIHA 1L3JA 1W39A 4FTEA 4AFCA 1J1TA 3L9JT 3M3OA 4XFIA 3V65A 3ILFA 4XZPA 5IT6A 3D82A 3G7DA 4AFMA 5KBFA 3MW4A 4QT6A 4Q29A 1WGPA 4XIOA 4IEOA 4PLOA 2WZR3 4Q4W3 2CGNA 1ZRFA 4GALA 4IV1C 2Q1ZB 1HV0A 1VBA2 2Q5TA 1QKQA 1W0PA 2AUYA 1SCRA 3VKMA 2GNTA 4I01A 3VN4A 4ATFA 1DDLA 2ZGRA 2IXKA 1ZRRA 3O0WA 1VRH1 3FZ3A 3MIDA 2A71A 4CDWA 3JD72 4L2NA 3KT1A 3AJZA 4IV3B 1S0EA 4DPNA 5EYXA 1XNCA 1VBA3 1GKBA 5BUVA 3NVCA 5EV7A 4BIOA 1KDKA 4ATEA 2BVVA 2TUNA 4R4ZA 4AHWA 2QZ2A 3WQ0A 5KHJA 1QXJA 5K7PA 1OOPA 2SBAA 4RS5C 3VGIA 1DYKA 1ENXA 2ZAAA 1HRV2 1LGBA 3QCWA 3J8F3 3JD73 3KGZA 1NE4A 2IXHA 3VDDA 3APBA 4HETA 2XKOA 2RJLA 4P9XA 1BZWA 3AP7A 3RYKA 4S2DA 4CDXC 4EWDA 2O0OA 3AZYA 4E2QA 4S2HA 5T5PA 2DTYA 1C1FA 3H3UA 3SH4A 4NWWA 3VBHA 1HRV3 1K5MB 4FQ4A 3LOBA 4QU2A 5FLIA 1Y43B 2I2SA 2XL9A 4AI2A 1OHFA 4Z2WA 4PIXA 2RS32 4IEWA 1IGOA 5L7OA 2JENA 3OJBA 4FOQA 1WW6A 1CIWA 1RUG3 5F1RA 5GLVA 5JR7B 1I3HA 4D69A 4GB31 4LO7A 1UX6A 3B3QE 1V6KA 3RWNA 4L11A 1LHWA 3OCPA 1UZYA 4YVWC 1JOJA 2SLIA 1MACA 4GWMA 1KD7A 1QJY3 3WP4A 3TN91 5HXVA 4CEWB 2RS33 3WCRA 2QVSB 2N7GA 3LKJA 2ZGOA 4Z1VA 4K9SA 3ZYJB 1S0IA 3HWJA 4ES9A 4XF4A 1QJX1 4JVAA 3ZXAC 2D7FA 3NO8A 1VR3A 4FPFA 3AB0A 4HFSA 3SH3A 4FBFA 1FV3A 3M2MA 1MQTC 3WG3A 5I8SA 1NXD1 2WQZC 3WDYA 4AQSA 2ZMNA 2DCJA 3IDEA 3ZXKA 2A6VA 5I0RA 1DHKB 3IIAA 4HLTA 5DZGA 2Y0IA 2PLV2 4XJZA 5BPXA 3AYCA 4IEUA 2ZAHA 2YV8A 3VZMA 2A3YA 4ASLA 1QDOA 3ZXEA 5IK5A 2GH2A 3AMMA 5I8YA 4DQAA 2CL2A 1X36A 1YNAA 2FBEA 2WINB 1KRIA 1Z0HA 1AYN2 1C3HA 3IPVB 4IV3A 3VBRC 1RUC1 1QHDA 3UL2A 5I93A 2PLV3 5AC91 1AXYA 1PGW2 3CEWA 1QGLA 1JYIA 2OPKA 1ULEA 2HYKA 2B42B 2XJTA 5C9AB 2WS92 3IDBB 3RQ0A 2TBVA 3ZIWA 4B8EA 4AEDC 4IEZA 3TYJA 2Q0AA 4HBNA 3OGGA 4Q4Y3 1AYN3 4QMAA 2G9GA 2HWB2 3TNPB 1VIWB 1RUD1 1NLSA 1S1AA 1PIV1 2WFF1 4RR3C 1BBT1 5C8WA 3RNSA 1U5XA 3KGLA 4KG0A 4WM8B 2WS93 4Y5Z0 4RGGA 3DPRC 4AW7A 4DOUA 1DGRN 2MEV2 4NN0A 1RGSA 3BCWA 3ZYPA 4C1XA 3FWEA 3N7LA 3HQXA 3OTFA 1HDKA 2HWB3 4Q0QA 4E2SA 1HLCA 1RVF1 5KC6A 1J58A 2PAKA 1AR92 2ZMLA 3VL8A 3MGUA 2EA7A 2UWBA 3KS7A 4BZ4A 1ONAA 1SMVA 2V5YA 5CVRA 5JSRA 2CY6A 2D43A 2MEV3 3HIFA 1C4RA 1OKQA 1QH7A 2VY0A 4N43B 1XNDA 3E6CC 2ZGLA 2XH6A 2C9AA 4U2A