2J1VA

Structure of a streptococcus pneumoniae fucose binding module in complex with the blood group h-trisaccharide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
b'KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Carbohydrate-binding protein
total genus 39
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1vA00
1CZSA 1UY4A 3CIHA 1R64A 4UOJA 1XNAA 2VZQA 3AC0A 2XHNA 3UETA 2BZDA 3I2GA 1P8JA 2EIDA 1YQ2A 2VZOA 2VZSA 4E8CA 2VJXA 3C7FA 3WSOA 3GDBA 4QX3A 3MV01 2Y6JA 3THCA 3LQCA 4W4ZA 4RN5A 1OH4A 3PUIA 4OUEA 3FHAA 4ARXA 2QQJA 4XUOA 1L7RA 1J84A 4GWIA 2XOMA 3DYPA 4A3ZA 4D8MA 1JZ6A 3VD3A 4DUVA 4HG6B 2BERA 2VCBA 3K4AA 3SEPA 3VD9A 4P02B 3ACHA 1UWWA 1KGYA 1UXZA 1ULPA 4RYDA 3OGRA 1XNTA 2VMCA 1PX4A 1UYXA 3NJXA 5IYYA 5F7UA 2W92A 4MO3M 4A42A 2JE8A 1K42A 4CVUA 4D0QA 3CZJA 4OYUA 5J1XA 1W8NA 2B9VA 2W95A 2YFUA 3HNBM 2VZ1A 3C7EA 3MBWA 3SEEA 1CX1A 1CZVA 1BHGA 3FHQA 4PF1A 3OEAA 2J1EA 1NKGA 5LCWL 1JYWA 2W9XA 4BDVB 2LW8A 1W9SA 5IFTA 1H6XA 2QQIA 2W91A 5HXMA 2BGPA 3NRUA 5DPNA 3NNGA 3CKHA 2R7EB 1O8SA 4L0PA 5DQ0A 5LA1A 4TXWA 1CZTA 5JR2A 4A4AA 1TVGA 2J1TA 4DXTA 2ZEWA 2VCCA 1GMMA 4QDQA 3I2KA 4UAPA 1K45A 3LPGA 5JXIA 2J1RA 4GWJA 5LA0A 4XUTA 4OZOA 3T09A 3MUY1 5G04L 1GNYA 4LKSA 1JU4A 1K3IA 4W50A 4DUWA 3K4ZA 4DEQA 2WN2A 2VM9A 2WO3A 1GUIA 3SKJE 4BJ0A 4DUXA 1GOFA 2KD7A 2VL4A 1GU3A 2W46A 2VQTA 3A22A 3D3AA 4QDSA 1UY1A 3K46A 3WNKA 4XUNA 4A44A 4ZXEA 2DCJA 3NJVA 4LHSA 4A6OA 3LEIA 1JYXA 2WABA 2J1VA 3IDAA 4P08A 1UY3A 2EICA 3T2PA 5JXGA 3WF1A 3OG2A 3ACIA 4BK5A 2X05A 4PT6A 4JKKA 2CDPA 2WO2A 3U37A 2WAOA 1O59A 2E33A 4QDRA 2YG0A 4CU6A 2YB7A 2X10A 3VDCA 3GGLA 3HJRA 3MO4A 2ORXA 3T08A 3OGVA 3THDA 2JKXA 4KWUA 2QQKA 5IJRA 3J7HA 2W87A 5FUIA 3IAQA 1EUUA 1NAEA 2QQLA 1XPWA 2J1AA 2Y6HA 4DXRA 4QB6A 2VC9A 2VZTA 1F4HA 2VO5A 2W47A 1J83A 3C8XA 3C7GA 1K12A 1PMJX 4LPLA 4FI9A 5G05L 2J22A 4ZZ5A 5CYYA 5EJZB 2XQXA 3I2FA 4QX2A 1JZ5A 3VD7A 4BK4A 4JX0A 1UYYA 5B4NA 5I0DA 3HEIA 3WNNA 3WNPA 3UNPA 4QAWA 2WUHA 2Y8KA 3WF3A 5JUVA 1GQPA 1CIYA 4CUCA 1T2XA 3I3DA 2DDUA 1W8OA 4MGQA 1W9WA 3ECQA 2RVAA 3OBAA 2VMEA 1SG3A 1L7QA 3VD5A 4CU9A 4M4RA 3DYOA 2ID4A 3BGAA 1DYOA 2C4XA 1DP0A 4AG4A 4AAXA 1O8PA 3HNMA 5C7GA 2RV9A 4W8JA 2W94A 1PX3A 1NUKA 4A41A 1HN1A 2Y64A 2W1WA 4OMDA 3HNYM 3VDBA 1GOGA 3VD4A 4OMCA 3ACFA 2PQSA 3I3BA 2W1QA 2EIBA 4IUGA 2ZEXA 2L9LA 2WO1A 3MV11 2HYXA 3WF0A 2OKXA 3CDZB 3A21A 4XURA 2YC4A 3MUZ1 4CU8A 3GXUA 3WF4A 3I2HA 3WNMA 2B4KA 4QB2A 3WF2A 3ZM8A 4ZY9A 2QQMA 5DN2A 2EIEA 5C71A 3LEKA 2E31A 2WBKA 1JZ7A 3HPNA 2HLEA 1UX7A 1OF4A 3C7HA 2VCAA 3CZUA 4PQQA 2C26A 2BBAA 2XONA 3WEZA 2W3JA 1OF3A 2ZXQA 3I2IA 4XZUG 1LNSA 4GZ9A 3HOBA 2J1UA 1NX9A 1EUTA 4UI9L 1JYNA 1PMHX 1IQDC 4DEVA 2V5DA 3K75B 3LE0A 1UZ0A 2X09A 3IIIA 4A45A 2ZEZA 3OEBA 2VTFA 4QX0A 1JZ2A 1GOHA 1D7PM 3ETPA 2QQNA 4XVHA 1W99A 3DECA 1US2A 2V4VA 3BN6A 3P1IA 1JI6A 4BXSV 3EYPA 3T0AA 1JZ8A 5JXHA 3W5NA 2Z4FA 1JHJA 3K77A 3GM8A 1I5PA 1W0NA 4P00B 3EB7A 3T2QA 3ACGA 1KEXA 3P6BA 1WKYA 2W5FA 3K4DA 1UMHA 2WDBA 3PUHA 2WZEA 3C7OA 2J7MA 4P5YA 4Z2AA 5C70A 4QX1A 2E26A 2VMFA 3A7QA 3FN9A 4CUAA 1TG7A 1OT5A 3T2OA 2ZEYA 1W9TA 4LQRA 2BGOA 4MOAA 4QPWA 3W5MA 4XUPA 2VZVA 2QBXA 2VZPA 3A23A 2WQ8A 3JXSA 4CU7A 2CDOA 4JKLA 4MGSA 3SKVA 1F4AA 1UYZA 2WAAA 4XUQA 4CUBA 2WN3A 4KI5M 4KMQA 3WNOA 2J1SA 1JU3A 4QB1A 5IHRA 1SHWB 2DCKA 5JMOA 3T0DA 3FL7A 3HN3A 4MADA 2YFZA 1UXXX 2VZUA 3OGSA 1UMIA 2VOTA 2VQUA 3UESA 1US3A 3OB8A 2LS6A 2YC2A 5LA2A 5JXJA 3VDAA 1UY2A 5HPOA 3E1F1 2VR4A 1DLCA 3NQHA 1JZ4A 3DYMA 1MPXA 4ARYA 4DXSA 2C9KA 4E8DA 2Y6KA 2V72A 1WCQA 2Y6GA 2WZ8A 3LPFA 1H6YA 3F2ZA 4ET7A 4ZZ8A 5A1AA 3I3EA 1JYVA 2JDAA 5EIYB 4JKMA 4M4PA 3WQBA 3IAPA 5CZKA 5EJ1B 2VZRA 4TTGA 2WYSA 2W1UA 1ULOA 1RYYA 1UY0A 3WNLA 2VMDA 3CQOA 2VZ3A 3I97A 1OD3A 5B4XA 3ABZA 2E32A 3T0BA 2RJ2A 5IFPA 1JZ3A 4YPJA 2QQOA 3CMGA 4JHZA 2ORZA 3IB3A 2W1SA 2Y6LA 1XC6A 3I2JA 1SDDB 2JD9A 3LEGA 5DMYA
chains in the Genus database with same CATH superfamily
1CZSA 1K5MB 4R9CA 3CIHA 1R64A 4HOOA 5GKAC 1NCRC 1REEA 2BWAA 4FP3A 5D8AA 3UETA 2BZDA 3DXUA 1P8JA 3BTAA 4S2FA 5LBCA 4MUVA 2XLGA 4YW3A 2HYKA 2D40A 3BI3A 4E2GA 3C7FA 4LJHA 5H9PA 5JVVA 3WSOA 5A32A 5CKNA 3WV6A 4LBKA 4FTEA 3NV3A 2Y6JA 5I8YA 3ZIWA 4W4ZA 1DZRA 2QCSB 3WDTA 3VB9A 5KC5A 4RN5A 1QJY1 4M3CE 2BNOA 3ZDSA 2EAKA 4V2VA 1CAXA 4XMIA 3FHAA 5K0UA 4LO7A 1GYKA 4I30A 3VZLA 1LTEA 3J8F2 4K7JA 5FZLA 3H3UA 1YC61 5T5PA 1SLAA 4Q1PA 1EV11 2JECA 2AREA 2GSYA 2VGDA 3POBA 1J84A 4AEMA 4GWIA 3SQOA 2SLIA 3K51A 4A3ZA 2WNVB 1PO12 3HBZA 2CSGA 3MW4A 5C3QA 5HCFA 1VBC1 1HW5A 1J3PA 2R062 4HG6B 4HK8A 4KU7A 5I0UA 3VD9A 2VCBA 2W39A 1QGLA 3BOPA 4QPYA 3ACHA 1UWWA 1KGYA 1UXZA 1ULPA 2WYFA 1HB3A 2DFCA 3OGRA 3U07A 3AZWA 5K4LA 4DRRA 1W2UA 1FMD3 4S2DA 3NJXA 3ZKYA 3I4IA 1FNZA 4A42A 1YXWA 2P3JA 3NMBA 5F7UA 3O12A 2RS13 2PA7A 4M0HA 1OUSA 1F35A 3VBUC 3SHRA 4YZ1A 5FP4A 3HD8B 1BJQA 3M7AA 4D0QA 1VAMA 1OQEA 1G86A 2FCTA 4XPVA 3WQ7A 1QJU1 1POQA 4K9SA 4IGPA 1PGL1 5A7PA 3MIFA 3HWJA 1FV2A 5JLVA 2I74A 1QJY3 5AC91 2NPIA 2UY8A 4IV1A 3W58A 5FYIA 1LOEA 4XBQA 2TUNA 2IXLA 3WUCA 1SMVA 3MIDA 5A7NA 4QM9A 1DDLA 1CZVA 1QQP1 4LLFA 1WA6X 4PF1A 3KQRA 1OI6A 4FPHA 5ABJA 1NKGA 2UY9A 2A6XA 4WZFA 5LCWL 4Q4Y2 2W9XA 4Y5Z0 2LW8A 1H6XA 2WZR1 3CL1A 1C1FA 2IXKA 4JGZB 5FMOS 5LK5A 3KT7A 1O6UA 5FIXA 2BGPA 5ERLA 1LOFA 3OPWA 1V6OA 1W2NA 5FPZA 5DQ0A 5LA1A 4AXOA 1QHDA 5FV3A 1RUI2 1FYUA 4NOTA 5BXXA 4DXTA 5T5JA 5FY5A 4TLFA 3PURA 2AC1A 3AM2A 4XJ9A 4EZ4A 1CONA 1GNZA 3WP5A 1LGNA 1ST8A 1YQ8A 1GMMA 3WVJA 4ZKTB 5FRAA 1GWLA 1QXPA 2OPWA 2WNEA 4EN6B 3LPGA 1MQTC 3A0NA 5FR3A 2DUOA 4KBZA 5DUUA 2J1RA 1QU0A 3GBFA 3RYKA 2I45A 5LA0A 5FP3A 2WA3A 5BNPB 3LIHA 1FX5A 2WO7A 3HIFA 4UW6A 3GYDA 4GULA 1GLHA 4PLNA 3MUY1 2C1FA 1CESA 3MIHA 3MF6A 3PL0A 3ME2A 4K20A 1VBD1 3AXEA 1GWMA 5FREA 1YCIA 4PBPA 4XIKA 1RUH3 1FPN2 4OULA 1RUG1 5FLHA 3WDXA 1K3IA 3OGJA 1BBT1 1QF3A 2DVGA 4ISRA 4NO4A 4C91A 2DV9A 1SBFA 2WN2A 2VM9A 2WO3A 3WW3A 1WUVA 4NJ4A 1W6PA 3G6JB 1NQJA 4BJ0A 1QDOA 5TSWA 1CN1A 2VQTA 5C9AC 4DOUA 3ZYGA 1EV12 4EN7B 3A22A 4QDSA 3FE5A 2CTVA 1TQ5A 2BTVC 3K46A 1VP6A 4AW7A 1VBC2 5CISA 2BW8A 4ZXEA 3UKVA 1DLLA 4LHSA 2ADDA 1VBA1 2WWJA 3WP6A 4A6OA 5FXXA 1OQDA 4H2AA 1Z7S3 1X8MA 2G9ZA 2NLRA 1DYKA 4E4ZA 2ZHMA 4LMFA 5C8CC 3KV6A 4Q2FA 1U5ZA 3ACIA 1FXZA 4UT5A 4QHBA 4BMBA 2X05A 4JGZA 5L9BA 2CDPA 3U37A 2WAOA 4B4PA 2E33A 3PUSA 1C8NA 4CU6A 4KH9A 4COYA 2YB7A 4MGZE 2GU9A 1QJU2 2X10A 3WZ1A 2P37A 3POEA 3MO4A 4KWKA 5T5LA 3KHCA 5AC92 3ZIXA 3WHTA 3U14A 3OGVA 3VUOA 1LOGA 1UOGA 1CIWA 2QQKA 3FLRA 2A71A 4GIQA 3RZGA 2W87A 1QQP2 3LEMA 4DINB 5A6QA 5FUIA 1YUDA 3RZLA 2YUEA 3NO8A 4WVZA 2QQLA 4JGYB 4C0HA 1Y43B 4XFHA 1UU5A 2WZR2 3PMSA 2IFWA 2HWF1 4DXRA 4FOQA 5DDJ3 3CJIA 2BVVA 2NZ9A 2PHLA 3DN7A 4FP2A 3M3OA 2RR11 1RITA 4NHLA 4FOVA 4MG2A 1GNHA 3C7GA 3HN1A 1H8TC 4FI9A 1LGBA 3I3MA 5KHKA 1NCRA 1WCKA 5CYYA 2JIJA 4R9AA 4XBLA 2RJLA 3RZKA 3PJYA 1OOPC 1XQNA 1AYN1 2WWSA 3WW2A 4BWOA 2P17A 1AL21 3ZMOA 4BK4A 3EQEA 2D3RA 4JX0A 4NAMA 1B09A 2QVSB 2WFF1 3AKQA 5FZ0A 5B4NA 2CU5A 5I0DA 1ZX5A 1O4TA 4KG0A 1PK6C 3WNNA 2XMLA 1W6QA 3WNPA 3B7MA 1HQNA 3UNPA 1WLWA 2GDFA 3ZYPA 4QAWA 3MPPG 3RS6A 2AH2A 5AVAA 3EMRA 3WF3A 3KV4A 3ZFEB 2ZKLA 1T2XA 3I3DA 3N9QA 2DDUA 5A7QA 1UMZA 4Z82A 1UOFA 1VBD2 3AX4A 2RVAA 2WZPP 4XDQA 3AVRA 1RUG2 3ZFGC 1S55A 1BBT2 1RUE3 1DGWX 2NM1A 1REFA 1NZCA 1PGW1 2HWF3 4AFAA 3BGAA 3JQWA 1Q43A 4GALA 1COV1 2P1BA 4AI0A 4LK7A 1APNA 2YGMA 2DUPA 1LAJA 3S7IA 4PBOA 2X53S 3ZOIA 1NUKA 2B5HA 5JIAA 2ZHNA 2ZHKA 3FLPA 3MPBA 5JWPA 3RG0A 1GOGA 1EPWA 1W8TA 4OMCA 4F83A 1VBA2 1PO21 3WQ1A 1AYN3 4FFGA 4IUGA 4RFRB 3VBUA 2WLQA 1DIWA 3Q8BA 1OVPA 4NPMA 4YW4A 2WJSA 2XGXA 2IVJA 2L9LA 5I0RA 3UKTA 2GMEA 4BISA 1VAVA 4JGYA 4CDXB 2HYXA 4MXVA 5F2SA 5A6YA 5HV0A 1SLIA 2JG8C 1GZTA 3DV8A 3JB8A 5A70A 5LZ6A 5HBAA 1XE0A 4NE9A 4Q0VA 2YC4A 3L2HA 4EV0A 4FPEA 2Z2SB 4IEQA 4CU8A 2VOVA 3NNJA 4QXBA 4IV3B 4RS5C 3LSDA 4QB2A 4HANA 5BYNA 1I9RA 1RGSA 1OFNA 4PI0A 3ZN6A 5BNOB 5F8PA 4AGVA 3J7LA 5FXZA 5F3IA 3VBRC 3LEKA 4WM7C 1PHMA 1N47A 3INAA 3PTYA 1QNWA 2ZGRA 3J7MA 3O0VA 4XCBA 2GP5A 2HLEA 2LUWA 2PLV3 4BZ4A 3SH4A 3BTZA 4D6SA 4XFCA 3KF5A 4PQQA 3VBFB 2C26A 2R1DA 3WG1A 2ENRA 4E27A 2HWE1 1AUYA 1XYNA 2XL7A 4HETA 4XQ4A 4HVQA 4L99A 3ITQA 1ZZBA 3ZFEA 3HQUA 3KSCA 1OKQA 3U75A 1PM4A 2VULA 1BVP1 4WM8C 1BZWA 1OF3A 2RR12 2WSVA 5FZ6A 2ZXQA 1YYNA 1ZRRA 3I2IA 3I8TA 2R041 3KCXA 4IEXA 4GZ9A 5FXVA 1CAVA 1NX9A 4H7MA 4KBBA 3B94A 5DUXA 1WLDA 4UI9L 2GC3A 4I3PA 5A7SA 1PMHX 3TRSB 1JYNA 1RUD3 3F95A 3POJA 4HXCA 4LORA 2XVKA 3K75B 3BPZA 1LU2A 1AL22 4Y5TA 5JMCA 2WFF2 2QTWB 4AVVA 1UU4A 4QX0A 2O8OA 3KB5A 2VUAA 2EXKA 3ETPA 1G6NA 4HK9A 5IVBA 5C3RA 2Y26A 4XVHA 3S5AA 4LITA 3TEWA 4K8RB 2B9UA 4NWWA 3VHRA 2A6VA 2IXJA 1JUHA 1YFUA 1ZVFA 4FCAA 3ZDVA 5GM0A 4BXSV 5IVCA 4DO0A 4DPNA 2GNBA 4UF0A 3TEXA 4LO4B 2Y6FA 4KL1A 1JZ8A 4RHV1 3RYRA 1A34A 4RGGA 1QWRA 1ULCA 4KWJA 1PGW2 4QWNA 2A6WA 1QMJA 3UT0A 3FUQA 4Q4X3 1COV2 3GM8A 2LM3A 3LSEA 4MVTA 1I5PA 2PAEA 3T3YA 5C8WA 4N8MA 1W0NA 5E89A 4AQ2A 4K40A 3T2QA 1ZA4A 2C24A 1AXZA 4FPLA 3H8XA 3BVCA 3K4DA 5L7OB 1UMHA 3OBRA 5C8CA 2YXSA 2WDBA 1R1ZA 2ZGNA 3DKWA 3N36A 3PUHA 4LE4A 3C7OA 4HKWA 5CADA 2HH9A 5BNOA 2FDJA 2V4AA 4P5YA 3V0AA 1PO22 1ULGA 1XJAA 1XU1A 1OA4A 4JDOA 5HCBA 2ARXA 4QKNA 2E26A 4QX1A 2ILMA 3O7OA 1IZ3A 5K7PA 1YJKA 1OT5A 3WP3A 1N3QA 4YM0A 1W9TA 3W59A 3BB6A 5F37A 2AUYA 1SLTA 4BYYA 2VOKA 1M4WA 2WFPA 5LRRA 3VBFA 2QDRA 2TEPA 4FQZA 4XUPA 1KRIA 4COWA 5IAVA 3ZR5A 2WS93 1UZVA 1C4RA 1S0CA 4ZS2A 2D6KA 2FDGA 3ASIA 1VJ2A 4MXWB 2WAAA 3HT2A 1OPOA 3QD6A 4XUQA 1FAYA 2WN3A 3RVHA 2IXCA 2RMU1 2VTXA 3ZR6A 1JHNA 5DG1A 2O0OA 3N9OA 1SHWB 3AJYA 2HEWF 2W52A 5JMOA 4FTSA 4Z8BA 2EXIA 3FL7A 1UKRA 1JODA 3RZHA 3VV1A 5F32A 1WD4A 1ZM1A 1UIKA 1ND3B 4F8AA 1US3A 1LJ7A 3OBTA 4BM8A 2HWE2 3WLUA 5J96B 3GF6A 1TMF1 5LA2A 1ACCA 1JYIA 2DCYA 3VDAA 3WR0A 1UY2A 2G4IA 4LBOA 4C1WA 1VMFA 2D5FA 5GZGA 1IG0A 5JOYA 2VBBA 4KWLA 4LHKA 1YIFA 1KJLA 2R042 2ZA9A 1WCDJ 4LO5B 2A1XA 4UFLA 2P3YA 4AEDB 1C5HA 4FAGA 4Z2WA 1XBFA 1PK6A 1JZ4A 3AMQA 1GP5A 3DYMA 4Q4W3 5FZGA 5FZ3A 2BBVA 2C9KA 2JE7A 2GZWA 4HVOA 4N7IA 2V5YA 2Y6KA 2A73B 4Q0SA 2Z5WA 2BOJA 1Z78A 4XJUA 3U1XA 1DZQA 2WZ8A 3AYAA 4M01A 4JC1A 2ZHLA 5IVFA 4HBNA 3F2ZA 3ROUA 4ET7A 3ZFGA 1JYVA 2IXIA 1RUF1 1D4M1 4JKMA 2D3PA 4M4PA 2IC1A 2XJPA 4UFKA 5EJ1B 1E57A 5K0UC 1DGLA 2CGOA 3NKTA 3ZX7A 3CHXA 3RMXA 3WNLA 4HT1T 5I0TA 3IM0A 4HPKB 3CQOA 5CEHA 4RHV2 2ZAAA 2W08A 4GMP0 5E1RA 5FK8A 1AR62 3VBHC 4J1WA 4O65A 5B4XA 3O1OA 4B4RA 4QQOA 5FZKA 4EWAA 3VDDB 2ZGSA 2FBEA 5C3SA 1A8DA 2VUDA 2CWSA 3H0OA 4MHUA 5FLIA 1TE1B 2YY1A 4JHZA 2ORZA 4MH0E 2XBO2 2XJTA 2XJRA 2A70A 5FKCA 1XC6A 2JD4A 4N53B 3SH3A 1O3RA 1AF9A 4MXWA 3AP7A 2KM2A 1W03A 4A7ZA 3GBWA 4TLGA 4NIAA 3GBGA 3IMMA 4D7SA 1AYM1 2PMWB 3IMNA 1UY4A 4R8HA 1F8VA 4CCOA 3R6SA 3DPRB 1X9TA 3H1WA 1YQ2A 2VZSA 3PIGA 2DVFA 4RS5A 5FK7A 2VJXA 1KDKA 3IZOA 4QPGC 3RI8A 2MHFA 4CXXA 2P34A 3H50A 5FY4A 4JHTA 1YFWA 2D5HA 4AAPA 5IVYA 4AI9A 1U5XA 1NA1C 3LQCA 1XB9A 2JG9C 1HV1A 3VBRA 2VQAA 4LO6B 3S6PA 3PUIA 3CU7A 5HV4A 5FFOC 3E6CC 1W2OA 4B3NA 2RM21 2PXJA 4I0BA 1RINA 2X29A 4AEDA 1K5MC 2RMU2 2PN5A 4AHZA 4XUOA 1O7FA 3FHIB 4AI8A 1L7RA 1MR5A 1W8FA 5FZAA 5DZGA 1MS1A 5FP8A 1WW6A 1QOSA 1JZ6A 4BIFA 2XUEA 3ES4A 2XWBB 2BERA 2ZX4A 1XE7A 4P02B 2RS33 1R083 2ZZQA 1EAH3 5CKQA 4EN0A 3ZSMA 4D69A 4IE0A 3AFGA 1V9U1 4XJZA 5FYCA 1PX4A 4P9XA 4BE3A 4Y24A 1UYXA 5IYYA 2W92A 4MO3M 2EF6A 2JE8A 4D3WA 1IS5A 2VOXA 5D1IA 3J7NA 2KR2A 2VW1A 4UW4A 1OHFA 1UYPA 1ZBA1 4GKXA 5FZMA 4GMP3 3VLBB 2YC0A 2ZX1A 3CZJA 2V09A 2WNVC 2DCZA 4I3GA 2Y0IA 3NSTA 4LA2A 4Y26A 5FMBA 5FY8A 3RI9A 3VDDA 4AQSA 1C1LA 1Q8SA 2R073 4IESA 2B9VA 1BKZA 1W6OA 2I07B 3KM5A 4TYSA 2OZJA 2RS53 2YFUA 3HNBM 2VZ1A 2ZCWA 5FJKA 3MBWA 3VZKA 3ZXDA 3PVNA 4P9WA 1RUF2 1D4M2 1ENXA 5KWRA 4B7KA 1TME3 1IS6A 4XETA 3ZXLA 3FHQA 2GP3A 5T3NA 3PHMA 2R061 5GZFA 4BDVB 3LIGA 1SPPA 3NV2A 1W9SA 2MPFA 4QQ2A 4BQXA 2QQIA 4F3JA 4GB33 1ND2B 4K8FA 5J09A 5HXMA 4LTAA 3R4UA 3OF1A 3ZXFA 2CGPA 4NPRA 1WCSA 2DTYA 3CKHA 1PIV2 1A3KA 4EYUA 4MSVA 3SITA 4PIXA 4CXYA 4R9DA 4IXLA 1TVGA 3N7MA 4NAOA 2YBPA 2VXRA 2J1TA 5FQ0B 1SLBA 2ZEWA 3OSDA 4I09A 5GLUA 4B29A 3I3QA 4E9KA 1LOAA 1O3QA 1AYM2 3AXDA 2B39A 4QQLA 2OX0A 4UAPA 4JGZC 4NN0A 4XAAA 1IQAA 5BPXA 4CDWB 2H6CA 3OY8B 4FPGA 5JXIA 3WDVA 3J8F3 4B1MA 1SEFA 5H9QA 5J3UA 1W9YA 4GWJA 3HT1A 4XUTA 5FWEA 3IIAA 4OUMA 5DAVA 3HVDA 2A3XA 3FJSA 4RQPB 1PO13 4NMIA 3ZXKA 1N1SA 3AKRA 4PDWB 4LKSA 5EZWA 1JU4A 3HQXA 2R063 5F39A 1S0FA 5JAXA 1VB4A 4XIOA 4HMZA 1GUIA 4UXAA 2RM22 5KXEA 2JDZA 1VBE2 2KD7A 1GU3A 4BQWA 2LROA 1D2SA 1A8MA 1F2NA 4IW3A 2RJKA 3LA3A 4WVWA 4XMAA 4OHXA 4GQ7A 4GH4B 3WT3A 1IGOA 1AX2A 4XUNA 3B93A 3BPSA 5BNPC 2JENA 5LW9A 1RC6A 4RGKA 3H8RA 4MGKE 3LEIA 3N7JA 3VKOA 1U12A 1XOYA 2JXAA 4D7TA 1TEIA 3OUIA 4YRDA 3WHUA 1U5IA 3IDAA 1DQ0A 1B35B 1UY3A 1V9U2 3USUB 3M4FA 4M3CB 5JXGA 4Q4V3 3TAYA 4XE9A 4W6WA 1GSLA 2H6BA 1UAIA 4BK5A 1MEC1 4JKKA 2WO2A 2GALA 4FPJA 5FYVA 5T52A 1O59A 1ZBA2 4ASMB 5LEJA 1ND2A 4QDRA 1Q8QA 3POWA 3NAPB 1FPN1 5IUQA 5FY0A 5F3CA 4Q4Y3 3I54A 4U2AA 5FLJA 1N3PA 1X36A 4LKDA 1OVSA 1I3HA 1WLTA 3PU8A 1HKDA 4H14A 4XC9A 1V0AA 2PAKA 5FCCA 3I49A 4U36A 1DG6A 1RXGA 4O9GA 1W06A 3BODA 5EQUA 4OQ9A 1JOJA 3VBHA 5FQ0A 1WMFA 1QY4A 1C5IA 1EY2A 1QEXA 3VKFC 3ZLIA 1RUI3 2RHPA 4AI1A 2GH8A 2Y6HA 1UZZA 5FMDA 4QB6A 2VC9A 2VZTA 4P9IA 1ONAA 3KMHA 4H55A 1POV1 2BQPA 2ZGPA 5EP9A 2JKBA 1UD1A 3SNMA 4AF9A 2XB6C 3OOXA 2VU9A 4RQPA 1K12A 3I59B 4LPLA 3W20A 5A6XA 3O0XA 1IS4A 1FOD1 2ZMKA 4PDWA 3IT8A 2JDMA 4JVAA 1LGCA 3NWKA 2XQXA 3CEWA 1S1AA 1HRV1 3WDWA 1EPZA 1W3VA 4QPGA 4CCJA 1WW7A 4CXWA 4JGYC 5E88A 1MZEA 4UYBA 2UURA 1HLCA 1GP6A 1NA1A 2D43A 2JG9A 5GLVA 3JB4C 3AP9A 4Y1ZA 1S0EA 5JSOA 1AR72 3EHKA 2CHHA 1DQ5A 4LKEA 3WG3A 5JUVA 1EV13 3DGTA 4AI2A 1K5MA 2JDNA 5FDBA 2BNMA 2ZX0A 4IDZA 3OBAA 3R05A 1VBC3 4Y20B 4AZZA 5JCTA 4IEYA 2E9QA 1SG3A 1R091 4CEYB 1O4YA 2B8MA 4PLOA 4CU9A 1SLCA 1UPSA 1ENSA 3D5OA 1XRUA 3E5UA 1W90A 3USSA 3IDEA 3E97A 5HXVA 3OGGA 5LA9A 4AG4A 3Q8EA 1YRZA 3AZZA 3HNMA 3O5SA 4AHYA 4DXZA 2WLPA 4F7ZA 5C7GA 1LHWA 1UW8A 2ZZJA 2PQQA 4BQ3A 2FDHA 2WKKA 2QDNA 1HN1A 4YGCA 1WMDA 2XXZA 2WNUB 3ZFEC 3VDBA 4MGIE 1YI7A 3VD4A 3KT1A 2W1QA 4CDUB 1QJU3 4CRQA 3MW3A 2WNVA 4BQYA 2P6CA 5F5QA 4A2UA 1HJGA 2ZGOA 4Q8LA 5AC93 1RVF1 3OYWB 2BFUL 1ZZ8A 5FZ4A 1XNCA 1O4ZA 2DUQA 3DF0A 3H7YA 1LKNA 3I7DA 4LOTA 1LEMA 1OH3A 2ATFA 1MEC2 3ACLA 1S2EA 1QQP3 4XURA 1UL9A 1LEDA 3MUZ1 2PFWA 3GXUA 4K21A 4XYXA 3WF4A 3WNMA 2B4KA 2DU1A 2WZR3 3AFKA 5JPNB 4ZY9A 3V0BB 5DN2A 1FMD2 4IE4A 1CJPA 1JOBA 2C6SA 4LE3A 2D7FA 5A3MA 4HVRA 1HQLA 2RS12 2E31A 3TB0A 1JZ7A 1HX6A 3N9PA 2HJIA 1W3XA 4CP1A 4P5HA 5A33B 4CDXC 3N35A 1UX7A 1MZ5A 1OF4A 2VCAA 5FUPA 3UYJA 4DY3A 1HQWA 4HKOA 5DUVA 3VKMA 2NP0A 2QQUA 2EALA 3T1MA 2BBAA 2YROA 3ZXAC 1KITA 5L36A 3WEZA 5CFDB 1LCLA 2VMIA 5E6HA 3MFAA 5KHIA 4IV3C 2VW0A 5FZ1A 2FDKA 4Y1VA 2DVBA 5FZFA 1XNBA 2VNRA 1NCQB 1V6MA 4XZUG 5FYYA 1LNSA 3VBSB 5BNOC 2P6HA 3HOBA 4PI2A 1FOD2 3IBMA 2QUOA 4IEOA 4Q29A 3ZVXA 2WRAA 4CEYA 1RUOA 1W6NB 3O1SA 1Q5OA 2OIIA 4CA9A 2X5IB 4DB5A 2BEOA 5DUWA 1HRV2 1UZ0A 3LFIA 3ZYJB 1VBD3 3T2TA 2X09A 4Q26A 3TN91 3FBYA 4P14A 4QX5A 3BU7A 5ISLA 1RUG3 3VBFC 1BBT3 1UNBA 1GOHA 3U11A 5FZEA 4TN7A 1AL0G 3DECA 1QJFA 1VB2A 2V4VA 5HCHA 4GD4A 5BNQA 2ET7A 3JU9A 2ZS6B 3EYPA 2HWD1 2PHUA 5JIUA 2A5ZA 2QJVA 4NRQA 2JDPA 2RDNA 5FYUA 1R092 3W5NA 4Q5OA 1VBA3 2Z4FA 1YO8A 2CL2A 1S0JA 5BNPA 4CYDA 2ES3A 5AFBA 1DGRN 3ZXGA 4P00B 1LHNA 1R1A1 2O8QA 3UJOA 2FDFA 5GZEA 2QQVA 3ACGA 1KEXA 2LRPA 3P6BA 4E2SA 5FZBA 2RE9A 2EIGA 2W5FA 5FBJA 5IW0A 1ALYA 2DURA 1SDWA 1LR5A 1CQ9A 5CFCB 4BQ4A 2WZEA 5FO9B 3V0BA 3UV9A 3OD4A 4JRAA 1YQCA 4XFBA 4ZHNA 5C70A 1F31A 4CUAA 4ES9A 4CCEA 1TG7A 1BVVA 3T2OA 5A33A 1MS3A 1RVF2 1SACA 1W04A 2XLAA 3M3IA 1QH6A 4LQRA 5FY7A 5FPUA 5DAQA 1GZCA 5IVJA 2Y33A 1G9DA 5L73A 3W5MA 1NZIA 2BOIA 3VZNA 4OHYA 3SCHA 3RFRA 2GN3A 2QBXA 5K9YA 4XCAA 2VZPA 2C0ZA 2VCMA 3O1TA 1KS4A 5A3TA 5L7OC 2XJUA 4JCKA 4JKLA 2WQ4A 3SKVA 1YEWA 1PZ7A 2YDEA 2QNKA 4XQDA 2VMGA 4QPIB 5C3PA 3ZSLA 2GC0A 3DL3A 4JDMA 4CUBA 5BNNB 5IVVA 4S2GA 4KI5M 4KMQA 2Q0AA 4UFMA 4M0NA 4FOYA 5LRSA 4IGOA 2QQPA 4QB1A 5IHRA 1IG3A 2ZAHA 4N9IA 2RR13 1ZREA 4AVBA 4OI4A 1Y3TA 5FPXA 3QOPA 4QKDA 3FFQA 2A7AA 1UXXX 2VZUA 3OGSA 3WOGA 3JBG1 2JB8A 4WVMB 2AEZA 1OLRA 1DQ4A 4DS0A 3OB8A 3ORJA 4AR2A 2XL9A 5C4WB 1AZDA 1AL23 2YC2A 5JXJA 1AR91 2WFF3 1VRH1 3VGIA 3E1F1 3KVAA 3H1YA 2Q30A 4K1YA 3URFA 1O91A 3IPVB 3NQHA 3N9NA 3OTFA 4N43B 4ARYA 4FTBA 1GANA 3FC0A 4YW6A 4COUA 2K2SA 3AYCA 4DFSA 4E8DA 4BIOA 3UJQA 1CVNA 3ZN4A 3TN92 3LKJA 1ND3C 1I6XA 1CD3G 3KCYA 2MEV1 1FV3A 5C9AB 2FMYA 3PVOA 2PTMA 3LPFA 1VBB1 3APBA 3KS7A 3GCXA 4ZZ8A 5JI9A 1TNFA 1W39A 4NVPA 2JDAA 1COV3 5EIYB 5I8TA 4ISQA 3AB0A 3WQBA 4NRMA 2OA2A 1OLME 1W8WA 3IAPA 1S2KA 5CZKA 3MLLA 4TTGA 3KD4A 1E5RA 2HWD2 3B9IA 4FT8A 1RYYA 1UY0A 3T4HB 1NT0A 4AEDC 5AVPA 4B8EA 1JXNA 2VZ3A 2D44A 2YBKA 2FZ1A 2OW4A 3I97A 1OD3A 3CJXA 4XOGA 3WG4A 1PO23 3B3QE 1W0OA 1V6JA 1UQXA 4QMAA 3W21A 5IFPA 1JZ3A 1PVXA 2R0HA 3SC7X 2QQOA 4HZFA 5L19A 2VG9A 4AHWA 4IGQA 1R1A2 4GWNA 2R6QA 4QM8A 4OHZA 3ZPOA 1OA2A 2Y6LA 1YQ5A 4YW7A 4BA6A 2UU8A 1SDDB 1W05A 4BQ5A 1YLLA 4QPIA 4FSJA 2XJVA 1PMIA 2BNNA 1M06G 1JH5A 2C5DA 1AR81 3IN9A 5DZFA 3LEGA 2Q8DA 4NIDA 5FP9A 3WCSA 5DMYA 3IWZA 4NIGA 2GMMA 1VR3A 2RDQA 4UOJA 1GP4A 3P5BA 1XNAA 2VZQA 3AC0A 1IPJA 4JTNA 2EIDA 4QGLA 3MICA 1OKOA 3AMPA 3VDDC 4O9EA 2Q1MA 1KS5A 2W0XA 1VLNA 4YARA 1HXS2 3NV4A 5EWSA 4AL9A 3B9CA 3GDBA 1ZA7A 1O5UA 4B4QA 4QX3A 1C28A 5L9RA 3THCA 2FZ2A 1UPIA 5LATA 3MLKA 4K6BA 4N53C 1ENRA 1AR61 1OH4A 3N4MA 4CEWB 3U4XA 4QD2A 2ARBA 5GLZA 2BYVE 1G9CA 3L2YA 2HWE3 2PHFA 4ARXA 4CDXA 1DFQA 1PZ8A 3H1MA 3IPVA 1ULEA 2AEYA 3X29B 3DPRC 5FY9A 2XBO1 4LBLA 4IE6A 2AACA 2R043 3WNXA 1HB1A 3VBOB 4IV3A 3VD3A 3BYWA 2PHRA 3CO2A 4META 4CE8A 1C8M1 3JBG2 4DUVA 5I91A 3U10A 3MZHA 3PUAA 1DZTA 2ZOEB 3ZO0B 5JZGB 2JE9A 5DXDA 5DABA 1ASJ1 4GKYA 4LXLA 4A3XA 3M2MA 1AR92 1XNTA 3N9MA 1J1TA 1VRH2 3KT4A 4YM3A 3SMHA 4LBQB 1L3JA 3C2UA 3G7DA 3ETQA 4P9YA 1K42A 5F3GA 4C90A 2WT2A 1C57A 3A0KA 3AYEA 3CF6E 2EA7A 2HWB1 3PUQA 5J1XA 3Q8CA 3RZZA 1J1LA 3H42B 1W8NA 2EVXA 2Q1ZB 2XR4A 2VBPA 4RHV3 3VZJA 1O5LA 2MEV2 4CZSA 4O61A 2W95A 3JZVA 3T1LA 1VBB2 1O3TA 4CDQB 2BPA2 3C7EA 4AEJA 2ERFA 4ZPIA 4LOSA 2Q8CA 1SFNA 3BIEA 1HDKA 1BHGA 1RUD2 5T54A 4GXLA 2J1EA 2LALA 2XBO3 4W65A 3K3NA 2DTWA 2E7QA 4RFT0 2B46X 3POSA 3UKNA 4FO9A 1W9FA 4NHMA 4XHBA 4Q0PA 2HKXA 4BMEA 5CB7A 4P9JA 4JDNA 1GICA 2GNMA 4OUSA 4C1XA 2PHTA 3UL2A 1WZXA 1X33A 3RWKX 5CBLA 1I5ZA 2HWC1 1H2LA 2TBVA 4RR3B 1AJOA 5CNAA 5DPNA 3TBDA 2JG8B 2R7EB 1REDA 3LD8A 4J25A 4MGTA 1O8SA 2WT1A 4A7KA 2AENA 1H1IA 1CZTA 3UGFA 4CEWA 5JR2A 1BCXA 3PLQA 1NE4A 4YM1A 2VVDA 1HIXA 3QLQA 4QKBA 1AR82 3TWIA 4ES8A 5ACA1 4DNYA 3MDPA 4HKLA 4XFFA 1OUXA 4IERA 5LEKA 3MIBA 4QDQA 2XG3A 3MIGA 1WW4A 5FBZA 5IT6A 3ZYFA 4ONUA 2V73A 2E7TA 1ND2C 4V2WA 5L7OA 2PYTA 4EN8B 3Q8FA 2RMU3 3H9AA 3BIWE 1QJX1 2Q4SA 5JZGA 2WSUA 5DAWA 1XE8A 2HBTA 3H3LA 4X6QB 5FP7A 2GH2A 1GNYA 1IHMA 1PVC1 4PIYA 1T6BX 5J98B 2BDRA 4AFCA 3VZMA 1GQHA 3SKJE 1AX1A 2D6MA 2DBNA 3BOWA 4DUXA 4QU2A 5C3OA 1TMF3 3FLTA 1H2KA 3GJAA 5LY1A 1SCSA 1DU3D 5EJ3A 1PIV1 2ZTNA 4CDWC 3D3AA 2OVUA 2IWGB 1EP0A 2XKOA 1LESA 4XW3A 2RG4A 5GZDA 5E8AA 3ZPYA 4BLIA 5FTTC 4ORFA 1C8M2 2WS92 2DCJA 2HBUA 4LULA 1H9PA 3FFZA 4RQPC 5G04L 3TEZA 2XPJA 4CCCA 1DGWA 2E53A 4PDWC 2Y34A 5FYMA 1ASJ2 2E63A 1LENA 2PHXA 4Y1YA 2J1VA 4I0AA 2GC1A 2EICA 3KWVA 1OA3A 3S5QA 1PM7A 1HRI2 3NNFA 3WW1A 2FCUA 1RIRA 3DXTA 4LIUA 1ND3A 1J59A 4FFFA 1D4VB 1LHVA 1D4M3 1RUF3 1Z0HA 1RMU1 4LKFA 4PT6A 3O1RA 2JWPA 4FVVA 4OHVA 3S57A 4GH4C 1XNDA 2HWB2 1GZ9A 1WW5A 2YG0A 4UW5A 4XF3A 3SCGA 5FO8B 5LY2A 1GBGA 4RR3A 3GGLA 3VDCA 3HJRA 2EAAA 3OPZA 2ORXA 1VBE1 2XQRA 4PQ9A 2D97A 3D82A 4QHZA 4IEWA 2H0VA 4BQ2A 1NLRA 1RHI1 2JKXA 5CU1A 2BFUS 3FUOA 4LBNA 1B35C 5IJRA 3J7HA 3OBZA 4Y4YA 4NUBA 1VIWB 4Z07A 2YV8A 1EUUA 2VMHA 2A6ZA 4AHXA 1JYCA 5KR7A 1YWKA 2DFBA 3KCCA 3VKNA 4X8PA 5EYYA 2GNDA 1HV0A 4OZXA 5EHDA 3JD71 4OHWA 3NAPC 4YLZA 1XYOA 1AYM3 2VO5A 3SCFA 4E2QA 1OQ1A 2HWC2 2W47A 4SLIA 4XFAA 3GHNA 2YU1A 4QT6A 4XTPA 4BB3A 5FOBB 1DF0A 2WIIB 3RNSA 3O1VA 4LLOA 3AKTA 4HPKA 4YW2A 5G05L 1AXYA 3V56A 5KC6A 4X8NA 4J6GA 4ZZ5A 1X82A 1BEV1 3E5QA 4KGQA 1Q56A 1S0BA 4N7UA 4QX2A 2QZ3A 4ITCA 5ACA2 1JZ5A 1MVEA 2VH9A 1S0GA 1ZRIA 2UWCA 5F6KA 1CR7A 2G9FA 4BXFA 4LBJA 1OC1A 1Y7BA 4K1ZA 4L97A 4P9GA 1OSGA 2RM23 4N53A 4YGBA 1JOPA 2ZJCA 2C9AA 2OT7A 2CAVA 2KXLA 5C33A 1QJX2 1XNKA 1MZ6A 2Y8KA 5JOXA 1GQPA 1CIYA 3TOJA 1WBFA 1ZBE1 1ZZCA 1PVC2 4MGQA 2NN8A 1W9WA 1NOVA 1RUC1 3ECQA 1NE6A 3DPRA 2VMEA 2A3YA 1MS4A 3MYXA 4QGMA 5FJHA 3Q9OA 1L7QA 4LBMA 3FWEA 2OPKA 1BMV1 1Q8PA 4M4RA 4AEKA 1NLQA 1DYOA 1OLQA 1WWYA 2C4XA 2VNVA 3RMYA 1DP0A 1QKQA 1O8PA 3KGLA 1BLZA 1V9U3 4LHLA 3O1PA 2NMNA 4LBQD 1GFF2 2RV9A 2AGSA 1PX3A 5D8AB 2BP6A 4A41A 1D0HA 3NJYA 3HNYM 1XSRA 1F5JA 3ZN5A 3C3VA 3RZJA 1ZBA3 3PJQA 4FFHA 1RUJ1 4LK6A 2PQSA 5A32B 4R9BA 3ES1A 2EIBA 3P3PA 5CIRA 4YG6A 1X9PA 2ZEXA 1W0PA 1STMA 3NVCA 3OUHA 4CEYC 1LODA 4YNIA 2W2IA 2HEVF 3MIEA 4YVSB 2VBDA 5FAXA 4NHYA 1AR71 1XXNA 3D6EA 1CAXB 1DBNA 1S4CA 2QFEA 1WCUA 1W8HA 2OUHA 4X6RB 4YVWB 5JI7A 2WQZC 2ZKNA 3WF0A 2OKXA 2XDVA 1RMU2 3CDZB 5FPVA 3A21A 2FD8A 2P4EA 5KBFA 2YZ4A 4IEZA 5IK4A 2RS32 2WNUC 4CTEA 3AL6A 1W8UA 2WC2A 3I2HA 1RUNA 3OD0A 4XTMA 3TEYA 1JTZX 2D93A 2OQ7A 2PAMA 1K5JA 4XF0A 4CDUC 2R0FA 3ENRA 2EIEA 4H3WA 2WL1A 4AVSA 1RHI2 2BUKA 4FXKB 5I8SA 5C71A 1Y9MA 2WBKA 5FZOB 4BOWA 3HPNA 5JPMB 4L2NA 2GAUA 1G9AA 3VZOA 5KXBA 3BTYA 3C7HA 3CZUA 1RL3A 4JAAA 4W6XA 5SV5A 5J36A 1W2TA 4I2OA 1KFUL 2XONA 3JD72 4CP9B 2JX9A 2DVDA 3LZZA 4Y5SA 2FQPA 2W3JA 3O14A 4UBHA 1HB4A 1UN1A 2YBSA 3FZ3A 4XDPA 3ZXEA 3GALA 1BK0A 4FPKA 5I0SA 4FBFA 1QH7A 3AKPA 3JUUA 3LB9A 4PJYA 1TME2 3WCRA 3OCPA 1POV0 4OFGA 2CWMA 4IV1B 2R30A 1SQ4A 5CG8A 5JSPA 1H4GA 1IQDC 1BEV2 4DEVA 4E4HA 2V5DA 2Q1FA 4Q0UA 3LE0A 1NXMA 1NXD1 1ZNPA 4XF9A 4ZXKA 4KNCA 5H9RA 4YGEA 5ABJB 1YHFA 2VTFA 4QQHA 5LB6A 1JZ2A 4AFBA 4MZUA 3ZFFB 1FMD1 1W8ZA 1D7PM 3T30A 4D6QA 5CFDC 2ZGTA 5GZCA 1QJZA 1OXCA 3RDIA 2QQNA 3N3HA 3SH5A 3BKZA 2RS11 1W99A 3BN6A 1LOBA 3P1IA 3J26N 3AMHA 4NROA 1JI6A 3M3QA 4LO8A 4CCKA 3BU0A 1NCQC 1CAUB 3VBSC 4G4FA 3D4KA 4LHNA 4CCNA 4KG8A 1ZBE2 1RUC2 2VY0A 3T0AA 4CDWA 3ILRA 1YNAA 3OY8A 1F15A 2X5IC 4JTOA 4YVSA 5JXHA 5CA6A 1ZRFA 1BMV2 5FOJB 1SFYA 2VNGA 1E5SA 4YVWA 4AGGA 5HCAA 2O1QA 1CX4A 5GLWA 4XF4A 4HSJA 3LDKA 4XF1A 2BU9A 4FPYA 1J3RA 1H4HA 3EB7A 3HAGA 1UZYA 2WT0A 1WKYA 3ZYRA 4HSLA 1MS5A 2FHRA 3LA7A 1MEC3 2D6OX 1ZZ9A 5D2AA 5A6ZA 1RUJ2 4AGRA 4Z2AA 1FPN3 1VAKA 3N9LA 3HQRA 1UX6A 5FZOA 1O3SA 4GH4A 1H1AA 1JUIA 1WD3A 3GCWA 5F5CA 1GWKA 2JEMA 4YG3A 2BGOA 4AVTA 3T4VA 1YJLA 1W6PB 3R0RA 4QPWA 1RTVA 1QIQA 5KXDA 2EXHA 4CP9A 4EZHA 1N1YA 3A23A 2K0GA 4CU7A 1LB2A 1B35A 1WMXA 2K46A 4L11A 1DQ2A 5FUNA 2CDOA 1V00A 4M3CA 4MGSA 3USUA 4G9SB 5CFCC 1DHKB 2JJ6A 4XJWA 4PCRA 4ATEA 2Z69A 3OUJA 1JN2P 2J1SA 1JU3A 3PU3A 2XVGA 3MLJA 1ZYBA 2TNFA 4Q4V2 3A4UA 1POV3 3THTA 3ZSJA 4LEJA 3T0DA 3NAPA 4XFIA 3QBQA 3TYJA 3LDBA 3HN3A 4I01A 3B69A 4XABA 5FYBA 1FOD3 1PZ9A 5T50A 3O1MA 2YFZA 4YM2A 1RUH1 1UMIA 2CGNA 5A1LA 5IATA 2VOTA 2VQUA 3P3NA 3UESA 3ZFFA 3ZYIB 1S0IA 2LS6A 1HRV3 4NIIA 4CPBD 1LRHA 3VKLA 3IKWA 4INDA 3I2DA 2A3WA 5FZ9A 1H8VA 3KZ4C 4QPIC 3K3OA 1CAUA 5BNNC 3B01A 4L8QA 5CG9A 2XUMA 3GZUC 1DLCA 3AKSA 5FZCA 3WX5A 1LECA 3POGA 3VHNA 2NQYA 1ZZ6A 2VE1A 3MI8A 4HFSA 2JDHA 3O0WA 1RJ7A 2VVFA 1Z7S1 3I59A 2G1MA 4B7EA 1WCQA 1R093 1GKBA 3VHPA 1G8WA 3KQ4B 1H6YA 5AFEA 5C4WC 3IDBB 2AR6A 3I3EA 3CJIB 4I02A 4TWTA 5JOZA 4JRLA 4UBGA 4W6YA 3RSJA 4GA9A 1AVBA 1NYWA 3BTXA 2WYSA 2W1UA 2PHWA 4LIVA 1ULOA 3R4DB 4Q0QA 2VMDA 1W28A 2ZPXA 2RDRA 2IZWA 4N43C 4OI2A 4S2HA 1NCRB 4CP2A 5IAXA 1QJY2 1UU6A 4Y3OA 5A3UA 1G7YA 1KDMA 2UYAA 1IPKA 2E32A 3D0SA 3T0BA 4AFMA 3MF9A 2ZGUA 4CUGA 2RJ2A 1ZRCA 2D6NA 4YW5A 5D21A 2H0BA 3ZYHA 5JDBA 4CCMA 1QXJA 5KHHA 1CPMA 1RVF3 4UFJA 4Y20A 3LOBA 1S0DA 4L92A 4AI3A 2YPDA 1HN0A 1NLSA 4JQRA 1W6QB 3NNLA 1LOCA 4C8DA 3I2JA 1UF2C 2JD9A 5M0TA 3CBNA 3TNQA 1U5YA 4MYEA 1V6KA 3LFMA 5DDJ1 2ZX2A 4IE5A 3N7KA 4Y22B 2K9ZA 4GWMA 2X8KA 3H7JA 3HR9A 3VL8A 3WG2A 5HI0A 2BWCA 2XHNA 3W9AA 3I2GA 2PHDA 2WNUA 1CPNA 2VZOA 3WY6A 4E8CA 5BV6A 2ZACA 3E5XA 1BXHA 1SCRA 2ET1A 3AVSA 4IEUA 4MLOA 4CDUA 3MV01 1HJFA 1QJEA 3EXUA 4PHZA 2B7YA 4AK3A 2ADEA 4YWAA 1KXGA 1X50A 5E16A 4K3UA 2JIGA 3FBMA 2IVIB 3OYWA 5A80A 4TZDA 1PGL2 4OUEA 4ATFA 2QQJA 4YFWA 3L9JT 2P3KA 1AJKA 4UWDA 4OQ8A 4LA3A 2AZ5A 4BQ1A 5BUVA 5FWJA 5L9VA 4BHPA 4Y33A 3VBUB 3I2OA 2I2SA 2XOMA 1VRBA 3DYPA 1E5HA 3KVBA 4D8MA 3H8UA 5EV7A 1RUH2 2ZBJA 5F5IA 2YPJA 2FCVA 2VTXJ 3B02A 4PIZA 1RUE1 1JBCA 3SEPA 3K4AA 4D94A 4WZCA 2ZGQA 1FNYA 3ST7A 1JS9A 2DYCA 4LNVA 3PVBB 4RYDA 3TN93 2VQ0A 3SISA 5A1FA 4CEWC 1WMEA 3LAGA 2VMCA 5FKBA 3WP4A 1SBDA 1RXFA 2VPVA 4ASKA 4KU8A 1HXS1 5J37A 4NWVA 4EWDA 5DAXA 4CVUA 3ZN6B 1KJRA 2XVLA 4ZU4A 5CFDA 3RGBA 1MVQA 5EFUA 4OYUA 2HWD3 3U78A 1KFXL 1MZFA 2JDYA 3VBOC 4EE2A 5JSRA 1AXKA 1VMHA 1Z7S2 2ZGLA 5JZGC 1YI9A 1BYHA 1NCQA 3LA2A 4NPLA 2LTNA 2VECA 3VBSA 1AX0A 1ULDA 3AJZA 1YIPA 5FXWA 5B2GB 1W6NA 1Q8OA 4FOWA 4YW1A 2F17A 2X5IA 3SEEA 4LR4A 1C3HA 3RPQA 1MS8A 4NHKA 4MV2A 1Q3EA 1CX1A 1R1A3 1ZZ7A 4QXKA 3OEAA 4Y22A 1N3OA 3D0JA 1JYWA 5K8SA 1CAVB 3OPTA 5IFTA 3E6DA 2F4LA 3M1HA 4QQPA 4Y1UA 1MQTB 2W91A 4YZ3A 4H7LA 3DKQA 2ZABA 1OMIA 4BPZA 2B45X 5DZEA 1PNFA 3NRUA 4XXAA 3NNGA 5FYSA 2P3IA 4XBNA 1IPSA 1UOBA 4CDQC 4L0PA 2IFRA 4TXWA 2PLV1 5FZIA 5LWBA 1HXS3 4IQPA 4A4AA 3PMEA 4EJRA 1SFPA 4YG0A 2VCCA 5F2WA 3DEMA 5DDJ2 1A78A 3HMYA 1ZRDA 2GN7A 3I2KA 1DGRA 5IWFA 4V1PA 4SBVA 4UF0B 3NJZA 4DMIA 1K45A 3B5LB 2WWUA 5A3WA 4D6RA 2FDIA 5BY5A 2A6YA 3VHOA 5CFCA 5FYTA 3MFCA 4IL7A 4GJZA 4RR3C 5ANQA 4NIHA 4OZOA 1RUD1 2F6BA 5FZ8A 4QX7A 4E4DX 2ZGKA 3T09A 4M00A 1QXRA 4C0BA 1G9BA 2XHKA 3GZEA 4AOCA 3EJKA 2IXHA 3JBG3 4OLLA 4W50A 4DUWA 2R32A 3EO6A 3ZKUA 1H2MA 2J42A 3K4ZA 2OYZA 5C8CB 1GV9A 3LDRA 4YSFA 2XH6A 1N1TA 1GOFA 2BVBA 4RL7A 2VL4A 5F6LB 2W46A 1AR93 1JW6A 3M3EA 3V0AB 5APAA 4FPOB 5JR7B 1VRH3 5FZHA 2MNGA 2QE3A 4I0WB 4AWDA 2GNTA 2HEYF 4ZONA 1UY1A 5A7OA 1OPMA 1LU1A 2R16A 3WNKA 1DYPA 5BNNA 4YZ5A 4A44A 5EPAA 3RQ0A 3NJVA 1RUE2 3WDUA 1VALA 4HN1A 4RD7A 2HWF2 1JYXA 2VAUA 2XLFA 2WABA 3WXPA 4Q4X1 3E6BA 2CV6A 3QH6A 4P08A 1V70A 4RSUA 2MEV3 2YMZA 3T2PA 2BJSA 4DZGA 2Z79A 2VUCA 4ZS3A 3RYPA 1MACA 3WF1A 1VBB3 3OG2A 3K2OA 4HLTA 5FO7B 4QHOA 1GQGA 3WINE 4WVMA 1FI2A 1UIJA 1U0AA 1VPHA 4R4XA 1WBLA 3R4SA 4BCUA 2WA4A 4XJAA 1EYBA 5C4WA 1MQTA 5KHJA 1E5IA 3U4SA 3VL9A 3J9SA 1D0GA 2GC2A 1AYN2 3LWCA 4JV4A 5FMOL 2OS2A 2WR9A 4BLJA 5LBEA 2JDKA 1H8TB 4PLMA 4Q1RA 3T08A 2JB4A 4N43A 3THDA 3CNAA 4KWUA 1UOJA 4RGAA 1N1VA 2P2KA 3ON7A 1OURA 4XJ8A 3M70A 2D98A 1OLMA 4LUMA 4DEQA 3ALQA 1OOPB 4GAZA 2NYYA 1NAEA 2N7GA 3IAQA 2WS91 2R49A 4XZPA 1H30A 1V6LA 4BU2A 4Y1XA 3UGHA 4CCLA 1XPWA 2J1AA 4HN0A 5C9AA 3PTRB 4AQ6A 4COZA 1AR83 1PK6B 4WV8A 1URXA 2VD7A 1F4HA 4ASLA 4FXGB 3BUCA 4EQVA 2VXJA 1J83A 2UWAA 5GJ6A 1DQ6A 3MEPA 1HRI1 3C8XA 4FPCA 4QX8A 5IK5A 1PMJX 4WVVA 5FPLA 2J22A 2PLV2 1DCSA 3GZTB 5EJZB 5DAPA 3ZFGB 2GMPA 3WW4A 3I2FA 1W2AX 1S2BA 3VD7A 4AVAA 3GJBA 1UYYA 1W6MB 1AR63 3NL1A 1UO9A 4KGGA 3POIA 3ELNA 3HEIA 2ARCA 2D3SA 2O14A 4WBBA 5C5TA 3RWNA 5A3NA 1IKPA 2WUHA 3MGUA 2IUWA 3JQXA 2WINB 4Q4W1 4R52A 4CUCA 1CAWB 2ETEA 4JZRA 3LCPA 1W8OA 2CY6A 4QXCA 4XXPA 4URTA 2Y0OA 3NW4A 4YFZA 2YHJA 1C8M3 2DWRA 4RA0A 3S0MA 3VD5A 4YZ2A 3QH7A 3DYOA 4M3CF 2D6LX 2JICA 2ID4A 1ASJ3 5ANNA 5FZ7A 3CLPA 1XSQA 4IEVA 4AAXA 1X8EA 1YQ6A 1UCXA 3K48A 4YYOA 5A3LA 2VVEA 2OZ6A 4IEPA 4W8JA 1HRI3 2W94A 2AYHA 4PF5A 2Y64A 2W1WA 4OMDA 3RJ2X 4YGDA 1MS0A 1MS9A 1J58A 4RS5B 1G9FA 4Y4RA 2A75A 1H8TA 3ACFA 2HWB3 3I3BA 3LOIA 1JYTA 1ODNA 5EXOA 4Q4X2 1NQDA 1QOTA 4JQTA 2Y38A 2QQWA 3FMGA 2P5BA 3JCIA 4WM7B 3VBRB 3VBOA 3H8OA 1L7LA 1OOPA 2VUJA 1CGPA 2UWBA 3ZSEA 2WO1A 2ZGMA 1IKQA 1UKGA 3MV11 1BQPA 1A6CA 1F5FA 1YFYA 5LASA 1ULFA 3IDCB 4FQ4A 3THPA 3PVEA 4GJYA 1OBNA 1TZOA 5FPAA 1Y4WA 1QNYA 5D8AC 1H1MA 5FYZA 5F1RA 5LBBA 1H2NA 3ILFA 1IS3A 2OQ6A 4LBQA 5EYXA 3ZXJA 4D7YA 3DCQA 4WM8B 3ZM8A 4TSVA 1VMJA 4XILA 2Q8EA 3WF2A 2QQMA 4HL0A 3QACA 3V65A 5FMCA 3S7EA 4CP0A 2DCTA 1ODMA 2HWC3 1CWPA 3UK9A 1Y9GA 3GHMA 3N7LA 4YVSC 3POYA 2UYBA 5C5UA 5SV8A 4FFIA 3POFA 4KQ7A 4N90A 5A3OA 1W6MA 1OD5A 4YVWC 2B42B 4QKFA 4XFGA 4ZU5A 2WNOA 3H3ZA 4XHXA 5FY1A 2VOWA 4CDQA 1PNGA 3SLIA 5IVEA 4COVA 4ZU7A 2VNOA 2JDUA 3D8CA 1YFXA 5ACA3 3OJBA 3ZMNA 4EN9B 5CVRA 1CAWA 4XDOA 3WUDA 3RJRA 1W6OB 4XQWA 1NY71 2J1UA 3MHZA 1EUTA 1QJX3 1TNRA 2DF7A 1WLCA 4URAA 5J48A 3PNAA 1VE0A 2EXJA 2YU2A 3AZXA 2RS31 1R081 3WDYA 5JOWA 4OI1A 1EAH1 4E4SA 1PVC3 4B1LA 3IIIA 4A45A 2ZEZA 3OEBA 4DQAA 2JG8A 1T6GC 3O1UA 4J1XA 2QZ2A 1I1EA 1SPPB 2F4PA 2Y60A 2YYOA 4MX3A 3AZYA 1US2A 2XJSA 4Q8KA 5FZDA 5DG2A 4Q4W2 5A3PA 1Q8VA 1PIV3 3KF3A 4GMP1 5CKMA 2W68A 2E7AA 4IV1C 2R071 2E6VA 4WM7A 3KGZA 3M8LA 3BALA 2ZMNA 2RS51 1JHJA 5CAZA 3NNMA 4R4ZA 2ARAA 2Z42A 4OVEA 1GR3A 2XJQA 3BCWA 3K77A 5ABJC 3AMMA 4Q27A 3B00A 3U0ZA 3ZFFC 2CYFA 1TME1 3RRDA 4IE7A 4IETA 1ENQA 4DY5A 1Y9QA 3NKGA 4WM8A 1RMU3 1WGPA 2NMOA 2VW2A 4CCDA 1QDCA 2J7MA 1DQ1A 1KD7A 4GB31 4NR1A 5F9TA 2CNAA 1OFSA 5LK7B 1LOFC 4OI0A 1F9KA 1WA4A 3M3CA 1TMF2 2VMFA 3A7QA 2CAUA 3AYDA 3FN9A 5FYHA 3V64A 1GZWB 4UFHA 1HB2A 2KA3A 1VBE3 3AP4A 2ZEYA 3NV1A 3PIJA 4A6SA 4QGNA 1RJ8A 2SBAA 4YZ4A 4MOAA 1RHI3 3DUIA 1X7NA 4N9HA 4AQTA 2Q5TA 1H9WA 4MHRA 2VZVA 4AYUA 3Q8AA 1V6NA 3JXSA 2WQ8A 2YGLA 3KLSA 5A7WB 1SBEA 4FAHA 3J4UH 5GLTA 1F4AA 1PGSA 1NG0A 1UYZA 3KHBA 1V6IA 3HBKA 3J8F1 3JD73 3WNOA 5C6CA 2R1BA 3AP6A 1LULA 4NRPA 3AL5A 3WQ0A 2D6PA 2DCKA 3ILNA 4DIQA 4UFIA 1JMUB 2BV4A 5H9SA 1D2QA 3S30A 5T5OA 4MADA 1PO11 4XEZA 3MW2A 1IOAA 2BRTA 3UGGA 3ZYBA 3VN4A 1BEV3 3KV5A 4O7XA 1LHUA 3AMNA 2XKPA 5T55A 2ZMLA 3KV9A 4LUKA 4OCTA 1AHSA 4XACA 5HPOA 2OUJA 4HONA 2ZX3A 5K0UB 2VR4A 1NY72 4AE2A 5GALA 5LBFA 1LHOA 1MPXA 4NHXA 4QXHA 4DXSA 5F3EA 2QKDA 3VBHB 2V72A 1R082 4UW3A 1EAH2 1ZBE3 4EWEA 1XYPA 1SLLA 1RUC3 5KXCA 4XAEA 1J3QA 1FATA 3QCWA 2FMDA 2Y6GA 1CJDA 2G9GA 3WD5A 1RB8G 4Q4V1 4EROA 1QOOA 3TNPB 3AK0A 5A1AA 5IK8A 1UZWA 3EBRA 4FPFA 4LT5A 3AZVA 2RDSA 2PELA 4DRVA 4Z92B 4CPBA 5IK7A 2VZRA 4CSWA 5FPBA 1H0BA 2BGCA 4Q4Y1 2E51A 3LGRA 3SXWA 2OXBA 3GZAA 4MGYE 2Q8OA 2R072 1BK1A 2DVAA 4L9BA 1GZWA 2XWJB 4P9LA 1RUJ3 1XU2A 4AFDA 2RS52 3ATGA 3ABZA 3FX3A 3GNEA 1FT9A 1SZBA 3AP5A 4AVCA 3PDQA 2DU0A 2G19A 4QPGB 2DBIA 3CMGA 4YPJA 5I93A 3IB3A 4BH9A 4Z1VA 1AR73 5A7WA 2W1SA 4QU1A 1NA1B 2JG9B 1KQRA 1RUI1 3CJIC 3RZMA 5J7MA 5KHGA 5F5AA 4A7YA 3ZSKA 3LF7A 4GB32 4G3YC
chains in the Genus database with same CATH topology
1CZSA 1UY4A 3CIHA 1R64A 4UOJA 1XNAA 2VZQA 3AC0A 2XHNA 3UETA 2BZDA 3I2GA 1P8JA 2EIDA 1YQ2A 2VZOA 2VZSA 4E8CA 2VJXA 3C7FA 3WSOA 3GDBA 4QX3A 3MV01 2Y6JA 3THCA 3LQCA 4W4ZA 4RN5A 1OH4A 3PUIA 4OUEA 3FHAA 4ARXA 2QQJA 4XUOA 1L7RA 1J84A 4GWIA 2XOMA 3DYPA 4A3ZA 4D8MA 1JZ6A 3VD3A 4DUVA 4HG6B 2BERA 2VCBA 3K4AA 3SEPA 3VD9A 4P02B 3ACHA 1UWWA 1KGYA 1UXZA 1ULPA 4RYDA 3OGRA 1XNTA 2VMCA 1PX4A 1UYXA 3NJXA 5IYYA 5F7UA 2W92A 4MO3M 4A42A 2JE8A 1K42A 4CVUA 4D0QA 3CZJA 4OYUA 5J1XA 1W8NA 2B9VA 2W95A 2YFUA 3HNBM 2VZ1A 3C7EA 3MBWA 3SEEA 1CX1A 1CZVA 1BHGA 3FHQA 4PF1A 3OEAA 2J1EA 1NKGA 5LCWL 1JYWA 2W9XA 4BDVB 2LW8A 1W9SA 5IFTA 1H6XA 2QQIA 2W91A 5HXMA 2BGPA 3NRUA 5DPNA 3NNGA 3CKHA 2R7EB 1O8SA 4L0PA 5DQ0A 5LA1A 4TXWA 1CZTA 5JR2A 4A4AA 1TVGA 2J1TA 4DXTA 2ZEWA 2VCCA 1GMMA 4QDQA 3I2KA 4UAPA 1K45A 3LPGA 5JXIA 2J1RA 4GWJA 5LA0A 4XUTA 4OZOA 3T09A 3MUY1 5G04L 1GNYA 4LKSA 1JU4A 1K3IA 4W50A 4DUWA 3K4ZA 4DEQA 2WN2A 2VM9A 2WO3A 1GUIA 3SKJE 4BJ0A 4DUXA 1GOFA 2KD7A 2VL4A 1GU3A 2W46A 2VQTA 3A22A 3D3AA 4QDSA 1UY1A 3K46A 3WNKA 4XUNA 4A44A 4ZXEA 2DCJA 3NJVA 4LHSA 4A6OA 3LEIA 1JYXA 2WABA 2J1VA 3IDAA 4P08A 1UY3A 2EICA 3T2PA 5JXGA 3WF1A 3OG2A 3ACIA 4BK5A 2X05A 4PT6A 4JKKA 2CDPA 2WO2A 3U37A 2WAOA 1O59A 2E33A 4QDRA 2YG0A 4CU6A 2YB7A 2X10A 3VDCA 3GGLA 3HJRA 3MO4A 2ORXA 3T08A 3OGVA 3THDA 2JKXA 4KWUA 2QQKA 5IJRA 3J7HA 2W87A 5FUIA 3IAQA 1EUUA 1NAEA 2QQLA 1XPWA 2J1AA 2Y6HA 4DXRA 4QB6A 2VC9A 2VZTA 1F4HA 2VO5A 2W47A 1J83A 3C8XA 3C7GA 1K12A 1PMJX 4LPLA 4FI9A 5G05L 2J22A 4ZZ5A 5CYYA 5EJZB 2XQXA 3I2FA 4QX2A 1JZ5A 3VD7A 4BK4A 4JX0A 1UYYA 5B4NA 5I0DA 3HEIA 3WNNA 3WNPA 3UNPA 4QAWA 2WUHA 2Y8KA 3WF3A 5JUVA 1GQPA 1CIYA 4CUCA 1T2XA 3I3DA 2DDUA 1W8OA 4MGQA 1W9WA 3ECQA 2RVAA 3OBAA 2VMEA 1SG3A 1L7QA 3VD5A 4CU9A 4M4RA 3DYOA 2ID4A 3BGAA 1DYOA 2C4XA 1DP0A 4AG4A 4AAXA 1O8PA 3HNMA 5C7GA 2RV9A 4W8JA 2W94A 1PX3A 1NUKA 4A41A 1HN1A 2Y64A 2W1WA 4OMDA 3HNYM 3VDBA 1GOGA 3VD4A 4OMCA 3ACFA 2PQSA 3I3BA 2W1QA 2EIBA 4IUGA 2ZEXA 2L9LA 2WO1A 3MV11 2HYXA 3WF0A 2OKXA 3CDZB 3A21A 4XURA 2YC4A 3MUZ1 4CU8A 3GXUA 3WF4A 3I2HA 3WNMA 2B4KA 4QB2A 3WF2A 3ZM8A 4ZY9A 2QQMA 5DN2A 2EIEA 5C71A 3LEKA 2E31A 2WBKA 1JZ7A 3HPNA 2HLEA 1UX7A 1OF4A 3C7HA 2VCAA 3CZUA 4PQQA 2C26A 2BBAA 2XONA 3WEZA 2W3JA 1OF3A 2ZXQA 3I2IA 4XZUG 1LNSA 4GZ9A 3HOBA 2J1UA 1NX9A 1EUTA 4UI9L 1JYNA 1PMHX 1IQDC 4DEVA 2V5DA 3K75B 3LE0A 1UZ0A 2X09A 3IIIA 4A45A 2ZEZA 3OEBA 2VTFA 4QX0A 1JZ2A 1GOHA 1D7PM 3ETPA 2QQNA 4XVHA 1W99A 3DECA 1US2A 2V4VA 3BN6A 3P1IA 1JI6A 4BXSV 3EYPA 3T0AA 1JZ8A 5JXHA 3W5NA 2Z4FA 1JHJA 3K77A 3GM8A 1I5PA 1W0NA 4P00B 3EB7A 3T2QA 3ACGA 1KEXA 3P6BA 1WKYA 2W5FA 3K4DA 1UMHA 2WDBA 3PUHA 2WZEA 3C7OA 2J7MA 4P5YA 4Z2AA 5C70A 4QX1A 2E26A 2VMFA 3A7QA 3FN9A 4CUAA 1TG7A 1OT5A 3T2OA 2ZEYA 1W9TA 4LQRA 2BGOA 4MOAA 4QPWA 3W5MA 4XUPA 2VZVA 2QBXA 2VZPA 3A23A 2WQ8A 3JXSA 4CU7A 2CDOA 4JKLA 4MGSA 3SKVA 1F4AA 1UYZA 2WAAA 4XUQA 4CUBA 2WN3A 4KI5M 4KMQA 3WNOA 2J1SA 1JU3A 4QB1A 5IHRA 1SHWB 2DCKA 5JMOA 3T0DA 3FL7A 3HN3A 4MADA 2YFZA 1UXXX 2VZUA 3OGSA 1UMIA 2VOTA 2VQUA 3UESA 1US3A 3OB8A 2LS6A 2YC2A 5LA2A 5JXJA 3VDAA 1UY2A 5HPOA 3E1F1 2VR4A 1DLCA 3NQHA 1JZ4A 3DYMA 1MPXA 4ARYA 4DXSA 2C9KA 4E8DA 2Y6KA 2V72A 1WCQA 2Y6GA 2WZ8A 3LPFA 1H6YA 3F2ZA 4ET7A 4ZZ8A 5A1AA 3I3EA 1JYVA 2JDAA 5EIYB 4JKMA 4M4PA 3WQBA 3IAPA 5CZKA 5EJ1B 2VZRA 4TTGA 2WYSA 2W1UA 1ULOA 1RYYA 1UY0A 3WNLA 2VMDA 3CQOA 2VZ3A 3I97A 1OD3A 5B4XA 3ABZA 2E32A 3T0BA 2RJ2A 5IFPA 1JZ3A 4YPJA 2QQOA 3CMGA 4JHZA 2ORZA 3IB3A 2W1SA 2Y6LA 1XC6A 3I2JA 1SDDB 2JD9A 3LEGA 5DMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZS A;  1UY4 A;  3CIH A;  1R64 A;  4UOJ A;  1XNA A;  2VZQ A;  3AC0 A;  2XHN A;  3UET A;  2BZD A;  3I2G A;  1P8J A;  2EID A;  1YQ2 A;  2VZO A;  2VZS A;  4E8C A;  2VJX A;  3C7F A;  3WSO A;  3GDB A;  4QX3 A;  3MV0 1;  2Y6J A;  3THC A;  3LQC A;  4W4Z A;  4RN5 A;  1OH4 A;  3PUI A;  4OUE A;  3FHA A;  4ARX A;  2QQJ A;  4XUO A;  1L7R A;  1J84 A;  4GWI A;  2XOM A;  3DYP A;  4A3Z A;  4D8M A;  1JZ6 A;  3VD3 A;  4DUV A;  4HG6 B;  2BER A;  2VCB A;  3K4A A;  3SEP A;  3VD9 A;  4P02 B;  3ACH A;  1UWW A;  1KGY A;  1UXZ A;  1ULP A;  4RYD A;  3OGR A;  1XNT A;  2VMC A;  1PX4 A;  1UYX A;  3NJX A;  5IYY A;  5F7U A;  2W92 A;  4MO3 M;  4A42 A;  2JE8 A;  1K42 A;  4CVU A;  4D0Q A;  3CZJ A;  4OYU A;  5J1X A;  1W8N A;  2B9V A;  2W95 A;  2YFU A;  3HNB M;  2VZ1 A;  3C7E A;  3MBW A;  3SEE A;  1CX1 A;  1CZV A;  1BHG A;  3FHQ A;  4PF1 A;  3OEA A;  2J1E A;  1NKG A;  5LCW L;  1JYW A;  2W9X A;  4BDV B;  2LW8 A;  1W9S A;  5IFT A;  1H6X A;  2QQI A;  2W91 A;  5HXM A;  2BGP A;  3NRU A;  5DPN A;  3NNG A;  3CKH A;  2R7E B;  1O8S A;  4L0P A;  5DQ0 A;  5LA1 A;  4TXW A;  1CZT A;  5JR2 A;  4A4A A;  1TVG A;  2J1T A;  4DXT A;  2ZEW A;  2VCC A;  1GMM A;  4QDQ A;  3I2K A;  4UAP A;  1K45 A;  3LPG A;  5JXI A;  2J1R A;  4GWJ A;  5LA0 A;  4XUT A;  4OZO A;  3T09 A;  3MUY 1;  5G04 L;  1GNY A;  4LKS A;  1JU4 A;  1K3I A;  4W50 A;  4DUW A;  3K4Z A;  4DEQ A;  2WN2 A;  2VM9 A;  2WO3 A;  1GUI A;  3SKJ E;  4BJ0 A;  4DUX A;  1GOF A;  2KD7 A;  2VL4 A;  1GU3 A;  2W46 A;  2VQT A;  3A22 A;  3D3A A;  4QDS A;  1UY1 A;  3K46 A;  3WNK A;  4XUN A;  4A44 A;  4ZXE A;  2DCJ A;  3NJV A;  4LHS A;  4A6O A;  3LEI A;  1JYX A;  2WAB A;  2J1V A;  3IDA A;  4P08 A;  1UY3 A;  2EIC A;  3T2P A;  5JXG A;  3WF1 A;  3OG2 A;  3ACI A;  4BK5 A;  2X05 A;  4PT6 A;  4JKK A;  2CDP A;  2WO2 A;  3U37 A;  2WAO A;  1O59 A;  2E33 A;  4QDR A;  2YG0 A;  4CU6 A;  2YB7 A;  2X10 A;  3VDC A;  3GGL A;  3HJR A;  3MO4 A;  2ORX A;  3T08 A;  3OGV A;  3THD A;  2JKX A;  4KWU A;  2QQK A;  5IJR A;  3J7H A;  2W87 A;  5FUI A;  3IAQ A;  1EUU A;  1NAE A;  2QQL A;  1XPW A;  2J1A A;  2Y6H A;  4DXR A;  4QB6 A;  2VC9 A;  2VZT A;  1F4H A;  2VO5 A;  2W47 A;  1J83 A;  3C8X A;  3C7G A;  1K12 A;  1PMJ X;  4LPL A;  4FI9 A;  5G05 L;  2J22 A;  4ZZ5 A;  5CYY A;  5EJZ B;  2XQX A;  3I2F A;  4QX2 A;  1JZ5 A;  3VD7 A;  4BK4 A;  4JX0 A;  1UYY A;  5B4N A;  5I0D A;  3HEI A;  3WNN A;  3WNP A;  3UNP A;  4QAW A;  2WUH A;  2Y8K A;  3WF3 A;  5JUV A;  1GQP A;  1CIY A;  4CUC A;  1T2X A;  3I3D A;  2DDU A;  1W8O A;  4MGQ A;  1W9W A;  3ECQ A;  2RVA A;  3OBA A;  2VME A;  1SG3 A;  1L7Q A;  3VD5 A;  4CU9 A;  4M4R A;  3DYO A;  2ID4 A;  3BGA A;  1DYO A;  2C4X A;  1DP0 A;  4AG4 A;  4AAX A;  1O8P A;  3HNM A;  5C7G A;  2RV9 A;  4W8J A;  2W94 A;  1PX3 A;  1NUK A;  4A41 A;  1HN1 A;  2Y64 A;  2W1W A;  4OMD A;  3HNY M;  3VDB A;  1GOG A;  3VD4 A;  4OMC A;  3ACF A;  2PQS A;  3I3B A;  2W1Q A;  2EIB A;  4IUG A;  2ZEX A;  2L9L A;  2WO1 A;  3MV1 1;  2HYX A;  3WF0 A;  2OKX A;  3CDZ B;  3A21 A;  4XUR A;  2YC4 A;  3MUZ 1;  4CU8 A;  3GXU A;  3WF4 A;  3I2H A;  3WNM A;  2B4K A;  4QB2 A;  3WF2 A;  3ZM8 A;  4ZY9 A;  2QQM A;  5DN2 A;  2EIE A;  5C71 A;  3LEK A;  2E31 A;  2WBK A;  1JZ7 A;  3HPN A;  2HLE A;  1UX7 A;  1OF4 A;  3C7H A;  2VCA A;  3CZU A;  4PQQ A;  2C26 A;  2BBA A;  2XON A;  3WEZ A;  2W3J A;  1OF3 A;  2ZXQ A;  3I2I A;  4XZU G;  1LNS A;  4GZ9 A;  3HOB A;  2J1U A;  1NX9 A;  1EUT A;  4UI9 L;  1JYN A;  1PMH X;  1IQD C;  4DEV A;  2V5D A;  3K75 B;  3LE0 A;  1UZ0 A;  2X09 A;  3III A;  4A45 A;  2ZEZ A;  3OEB A;  2VTF A;  4QX0 A;  1JZ2 A;  1GOH A;  1D7P M;  3ETP A;  2QQN A;  4XVH A;  1W99 A;  3DEC A;  1US2 A;  2V4V A;  3BN6 A;  3P1I A;  1JI6 A;  4BXS V;  3EYP A;  3T0A A;  1JZ8 A;  5JXH A;  3W5N A;  2Z4F A;  1JHJ A;  3K77 A;  3GM8 A;  1I5P A;  1W0N A;  4P00 B;  3EB7 A;  3T2Q A;  3ACG A;  1KEX A;  3P6B A;  1WKY A;  2W5F A;  3K4D A;  1UMH A;  2WDB A;  3PUH A;  2WZE A;  3C7O A;  2J7M A;  4P5Y A;  4Z2A A;  5C70 A;  4QX1 A;  2E26 A;  2VMF A;  3A7Q A;  3FN9 A;  4CUA A;  1TG7 A;  1OT5 A;  3T2O A;  2ZEY A;  1W9T A;  4LQR A;  2BGO A;  4MOA A;  4QPW A;  3W5M A;  4XUP A;  2VZV A;  2QBX A;  2VZP A;  3A23 A;  2WQ8 A;  3JXS A;  4CU7 A;  2CDO A;  4JKL A;  4MGS A;  3SKV A;  1F4A A;  1UYZ A;  2WAA A;  4XUQ A;  4CUB A;  2WN3 A;  4KI5 M;  4KMQ A;  3WNO A;  2J1S A;  1JU3 A;  4QB1 A;  5IHR A;  1SHW B;  2DCK A;  5JMO A;  3T0D A;  3FL7 A;  3HN3 A;  4MAD A;  2YFZ A;  1UXX X;  2VZU A;  3OGS A;  1UMI A;  2VOT A;  2VQU A;  3UES A;  1US3 A;  3OB8 A;  2LS6 A;  2YC2 A;  5LA2 A;  5JXJ A;  3VDA A;  1UY2 A;  5HPO A;  3E1F 1;  2VR4 A;  1DLC A;  3NQH A;  1JZ4 A;  3DYM A;  1MPX A;  4ARY A;  4DXS A;  2C9K A;  4E8D A;  2Y6K A;  2V72 A;  1WCQ A;  2Y6G A;  2WZ8 A;  3LPF A;  1H6Y A;  3F2Z A;  4ET7 A;  4ZZ8 A;  5A1A A;  3I3E A;  1JYV A;  2JDA A;  5EIY B;  4JKM A;  4M4P A;  3WQB A;  3IAP A;  5CZK A;  5EJ1 B;  2VZR A;  4TTG A;  2WYS A;  2W1U A;  1ULO A;  1RYY A;  1UY0 A;  3WNL A;  2VMD A;  3CQO A;  2VZ3 A;  3I97 A;  1OD3 A;  5B4X A;  3ABZ A;  2E32 A;  3T0B A;  2RJ2 A;  5IFP A;  1JZ3 A;  4YPJ A;  2QQO A;  3CMG A;  4JHZ A;  2ORZ A;  3IB3 A;  2W1S A;  2Y6L A;  1XC6 A;  3I2J A;  1SDD B;  2JD9 A;  3LEG A;  5DMY A; 
#chains in the Genus database with same CATH topology
 1CZS A;  1K5M B;  4R9C A;  3CIH A;  1R64 A;  4HOO A;  5GKA C;  1NCR C;  1REE A;  2BWA A;  4FP3 A;  5D8A A;  3UET A;  2BZD A;  3DXU A;  1P8J A;  3BTA A;  4S2F A;  5LBC A;  4MUV A;  2XLG A;  4YW3 A;  2HYK A;  2D40 A;  3BI3 A;  4E2G A;  3C7F A;  4LJH A;  5H9P A;  5JVV A;  3WSO A;  5A32 A;  5CKN A;  3WV6 A;  4LBK A;  4FTE A;  3NV3 A;  2Y6J A;  5I8Y A;  3ZIW A;  4W4Z A;  1DZR A;  2QCS B;  3WDT A;  3VB9 A;  5KC5 A;  4RN5 A;  1QJY 1;  4M3C E;  2BNO A;  3ZDS A;  2EAK A;  4V2V A;  1CAX A;  4XMI A;  3FHA A;  5K0U A;  4LO7 A;  1GYK A;  4I30 A;  3VZL A;  1LTE A;  3J8F 2;  4K7J A;  5FZL A;  3H3U A;  1YC6 1;  5T5P A;  1SLA A;  4Q1P A;  1EV1 1;  2JEC A;  2ARE A;  2GSY A;  2VGD A;  3POB A;  1J84 A;  4AEM A;  4GWI A;  3SQO A;  2SLI A;  3K51 A;  4A3Z A;  2WNV B;  1PO1 2;  3HBZ A;  2CSG A;  3MW4 A;  5C3Q A;  5HCF A;  1VBC 1;  1HW5 A;  1J3P A;  2R06 2;  4HG6 B;  4HK8 A;  4KU7 A;  5I0U A;  3VD9 A;  2VCB A;  2W39 A;  1QGL A;  3BOP A;  4QPY A;  3ACH A;  1UWW A;  1KGY A;  1UXZ A;  1ULP A;  2WYF A;  1HB3 A;  2DFC A;  3OGR A;  3U07 A;  3AZW A;  5K4L A;  4DRR A;  1W2U A;  1FMD 3;  4S2D A;  3NJX A;  3ZKY A;  3I4I A;  1FNZ A;  4A42 A;  1YXW A;  2P3J A;  3NMB A;  5F7U A;  3O12 A;  2RS1 3;  2PA7 A;  4M0H A;  1OUS A;  1F35 A;  3VBU C;  3SHR A;  4YZ1 A;  5FP4 A;  3HD8 B;  1BJQ A;  3M7A A;  4D0Q A;  1VAM A;  1OQE A;  1G86 A;  2FCT A;  4XPV A;  3WQ7 A;  1QJU 1;  1POQ A;  4K9S A;  4IGP A;  1PGL 1;  5A7P A;  3MIF A;  3HWJ A;  1FV2 A;  5JLV A;  2I74 A;  1QJY 3;  5AC9 1;  2NPI A;  2UY8 A;  4IV1 A;  3W58 A;  5FYI A;  1LOE A;  4XBQ A;  2TUN A;  2IXL A;  3WUC A;  1SMV A;  3MID A;  5A7N A;  4QM9 A;  1DDL A;  1CZV A;  1QQP 1;  4LLF A;  1WA6 X;  4PF1 A;  3KQR A;  1OI6 A;  4FPH A;  5ABJ A;  1NKG A;  2UY9 A;  2A6X A;  4WZF A;  5LCW L;  4Q4Y 2;  2W9X A;  4Y5Z 0;  2LW8 A;  1H6X A;  2WZR 1;  3CL1 A;  1C1F A;  2IXK A;  4JGZ B;  5FMO S;  5LK5 A;  3KT7 A;  1O6U A;  5FIX A;  2BGP A;  5ERL A;  1LOF A;  3OPW A;  1V6O A;  1W2N A;  5FPZ A;  5DQ0 A;  5LA1 A;  4AXO A;  1QHD A;  5FV3 A;  1RUI 2;  1FYU A;  4NOT A;  5BXX A;  4DXT A;  5T5J A;  5FY5 A;  4TLF A;  3PUR A;  2AC1 A;  3AM2 A;  4XJ9 A;  4EZ4 A;  1CON A;  1GNZ A;  3WP5 A;  1LGN A;  1ST8 A;  1YQ8 A;  1GMM A;  3WVJ A;  4ZKT B;  5FRA A;  1GWL A;  1QXP A;  2OPW A;  2WNE A;  4EN6 B;  3LPG A;  1MQT C;  3A0N A;  5FR3 A;  2DUO A;  4KBZ A;  5DUU A;  2J1R A;  1QU0 A;  3GBF A;  3RYK A;  2I45 A;  5LA0 A;  5FP3 A;  2WA3 A;  5BNP B;  3LIH A;  1FX5 A;  2WO7 A;  3HIF A;  4UW6 A;  3GYD A;  4GUL A;  1GLH A;  4PLN A;  3MUY 1;  2C1F A;  1CES A;  3MIH A;  3MF6 A;  3PL0 A;  3ME2 A;  4K20 A;  1VBD 1;  3AXE A;  1GWM A;  5FRE A;  1YCI A;  4PBP A;  4XIK A;  1RUH 3;  1FPN 2;  4OUL A;  1RUG 1;  5FLH A;  3WDX A;  1K3I A;  3OGJ A;  1BBT 1;  1QF3 A;  2DVG A;  4ISR A;  4NO4 A;  4C91 A;  2DV9 A;  1SBF A;  2WN2 A;  2VM9 A;  2WO3 A;  3WW3 A;  1WUV A;  4NJ4 A;  1W6P A;  3G6J B;  1NQJ A;  4BJ0 A;  1QDO A;  5TSW A;  1CN1 A;  2VQT A;  5C9A C;  4DOU A;  3ZYG A;  1EV1 2;  4EN7 B;  3A22 A;  4QDS A;  3FE5 A;  2CTV A;  1TQ5 A;  2BTV C;  3K46 A;  1VP6 A;  4AW7 A;  1VBC 2;  5CIS A;  2BW8 A;  4ZXE A;  3UKV A;  1DLL A;  4LHS A;  2ADD A;  1VBA 1;  2WWJ A;  3WP6 A;  4A6O A;  5FXX A;  1OQD A;  4H2A A;  1Z7S 3;  1X8M A;  2G9Z A;  2NLR A;  1DYK A;  4E4Z A;  2ZHM A;  4LMF A;  5C8C C;  3KV6 A;  4Q2F A;  1U5Z A;  3ACI A;  1FXZ A;  4UT5 A;  4QHB A;  4BMB A;  2X05 A;  4JGZ A;  5L9B A;  2CDP A;  3U37 A;  2WAO A;  4B4P A;  2E33 A;  3PUS A;  1C8N A;  4CU6 A;  4KH9 A;  4COY A;  2YB7 A;  4MGZ E;  2GU9 A;  1QJU 2;  2X10 A;  3WZ1 A;  2P37 A;  3POE A;  3MO4 A;  4KWK A;  5T5L A;  3KHC A;  5AC9 2;  3ZIX A;  3WHT A;  3U14 A;  3OGV A;  3VUO A;  1LOG A;  1UOG A;  1CIW A;  2QQK A;  3FLR A;  2A71 A;  4GIQ A;  3RZG A;  2W87 A;  1QQP 2;  3LEM A;  4DIN B;  5A6Q A;  5FUI A;  1YUD A;  3RZL A;  2YUE A;  3NO8 A;  4WVZ A;  2QQL A;  4JGY B;  4C0H A;  1Y43 B;  4XFH A;  1UU5 A;  2WZR 2;  3PMS A;  2IFW A;  2HWF 1;  4DXR A;  4FOQ A;  5DDJ 3;  3CJI A;  2BVV A;  2NZ9 A;  2PHL A;  3DN7 A;  4FP2 A;  3M3O A;  2RR1 1;  1RIT A;  4NHL A;  4FOV A;  4MG2 A;  1GNH A;  3C7G A;  3HN1 A;  1H8T C;  4FI9 A;  1LGB A;  3I3M A;  5KHK A;  1NCR A;  1WCK A;  5CYY A;  2JIJ A;  4R9A A;  4XBL A;  2RJL A;  3RZK A;  3PJY A;  1OOP C;  1XQN A;  1AYN 1;  2WWS A;  3WW2 A;  4BWO A;  2P17 A;  1AL2 1;  3ZMO A;  4BK4 A;  3EQE A;  2D3R A;  4JX0 A;  4NAM A;  1B09 A;  2QVS B;  2WFF 1;  3AKQ A;  5FZ0 A;  5B4N A;  2CU5 A;  5I0D A;  1ZX5 A;  1O4T A;  4KG0 A;  1PK6 C;  3WNN A;  2XML A;  1W6Q A;  3WNP A;  3B7M A;  1HQN A;  3UNP A;  1WLW A;  2GDF A;  3ZYP A;  4QAW A;  3MPP G;  3RS6 A;  2AH2 A;  5AVA A;  3EMR A;  3WF3 A;  3KV4 A;  3ZFE B;  2ZKL A;  1T2X A;  3I3D A;  3N9Q A;  2DDU A;  5A7Q A;  1UMZ A;  4Z82 A;  1UOF A;  1VBD 2;  3AX4 A;  2RVA A;  2WZP P;  4XDQ A;  3AVR A;  1RUG 2;  3ZFG C;  1S55 A;  1BBT 2;  1RUE 3;  1DGW X;  2NM1 A;  1REF A;  1NZC A;  1PGW 1;  2HWF 3;  4AFA A;  3BGA A;  3JQW A;  1Q43 A;  4GAL A;  1COV 1;  2P1B A;  4AI0 A;  4LK7 A;  1APN A;  2YGM A;  2DUP A;  1LAJ A;  3S7I A;  4PBO A;  2X53 S;  3ZOI A;  1NUK A;  2B5H A;  5JIA A;  2ZHN A;  2ZHK A;  3FLP A;  3MPB A;  5JWP A;  3RG0 A;  1GOG A;  1EPW A;  1W8T A;  4OMC A;  4F83 A;  1VBA 2;  1PO2 1;  3WQ1 A;  1AYN 3;  4FFG A;  4IUG A;  4RFR B;  3VBU A;  2WLQ A;  1DIW A;  3Q8B A;  1OVP A;  4NPM A;  4YW4 A;  2WJS A;  2XGX A;  2IVJ A;  2L9L A;  5I0R A;  3UKT A;  2GME A;  4BIS A;  1VAV A;  4JGY A;  4CDX B;  2HYX A;  4MXV A;  5F2S A;  5A6Y A;  5HV0 A;  1SLI A;  2JG8 C;  1GZT A;  3DV8 A;  3JB8 A;  5A70 A;  5LZ6 A;  5HBA A;  1XE0 A;  4NE9 A;  4Q0V A;  2YC4 A;  3L2H A;  4EV0 A;  4FPE A;  2Z2S B;  4IEQ A;  4CU8 A;  2VOV A;  3NNJ A;  4QXB A;  4IV3 B;  4RS5 C;  3LSD A;  4QB2 A;  4HAN A;  5BYN A;  1I9R A;  1RGS A;  1OFN A;  4PI0 A;  3ZN6 A;  5BNO B;  5F8P A;  4AGV A;  3J7L A;  5FXZ A;  5F3I A;  3VBR C;  3LEK A;  4WM7 C;  1PHM A;  1N47 A;  3INA A;  3PTY A;  1QNW A;  2ZGR A;  3J7M A;  3O0V A;  4XCB A;  2GP5 A;  2HLE A;  2LUW A;  2PLV 3;  4BZ4 A;  3SH4 A;  3BTZ A;  4D6S A;  4XFC A;  3KF5 A;  4PQQ A;  3VBF B;  2C26 A;  2R1D A;  3WG1 A;  2ENR A;  4E27 A;  2HWE 1;  1AUY A;  1XYN A;  2XL7 A;  4HET A;  4XQ4 A;  4HVQ A;  4L99 A;  3ITQ A;  1ZZB A;  3ZFE A;  3HQU A;  3KSC A;  1OKQ A;  3U75 A;  1PM4 A;  2VUL A;  1BVP 1;  4WM8 C;  1BZW A;  1OF3 A;  2RR1 2;  2WSV A;  5FZ6 A;  2ZXQ A;  1YYN A;  1ZRR A;  3I2I A;  3I8T A;  2R04 1;  3KCX A;  4IEX A;  4GZ9 A;  5FXV A;  1CAV A;  1NX9 A;  4H7M A;  4KBB A;  3B94 A;  5DUX A;  1WLD A;  4UI9 L;  2GC3 A;  4I3P A;  5A7S A;  1PMH X;  3TRS B;  1JYN A;  1RUD 3;  3F95 A;  3POJ A;  4HXC A;  4LOR A;  2XVK A;  3K75 B;  3BPZ A;  1LU2 A;  1AL2 2;  4Y5T A;  5JMC A;  2WFF 2;  2QTW B;  4AVV A;  1UU4 A;  4QX0 A;  2O8O A;  3KB5 A;  2VUA A;  2EXK A;  3ETP A;  1G6N A;  4HK9 A;  5IVB A;  5C3R A;  2Y26 A;  4XVH A;  3S5A A;  4LIT A;  3TEW A;  4K8R B;  2B9U A;  4NWW A;  3VHR A;  2A6V A;  2IXJ A;  1JUH A;  1YFU A;  1ZVF A;  4FCA A;  3ZDV A;  5GM0 A;  4BXS V;  5IVC A;  4DO0 A;  4DPN A;  2GNB A;  4UF0 A;  3TEX A;  4LO4 B;  2Y6F A;  4KL1 A;  1JZ8 A;  4RHV 1;  3RYR A;  1A34 A;  4RGG A;  1QWR A;  1ULC A;  4KWJ A;  1PGW 2;  4QWN A;  2A6W A;  1QMJ A;  3UT0 A;  3FUQ A;  4Q4X 3;  1COV 2;  3GM8 A;  2LM3 A;  3LSE A;  4MVT A;  1I5P A;  2PAE A;  3T3Y A;  5C8W A;  4N8M A;  1W0N A;  5E89 A;  4AQ2 A;  4K40 A;  3T2Q A;  1ZA4 A;  2C24 A;  1AXZ A;  4FPL A;  3H8X A;  3BVC A;  3K4D A;  5L7O B;  1UMH A;  3OBR A;  5C8C A;  2YXS A;  2WDB A;  1R1Z A;  2ZGN A;  3DKW A;  3N36 A;  3PUH A;  4LE4 A;  3C7O A;  4HKW A;  5CAD A;  2HH9 A;  5BNO A;  2FDJ A;  2V4A A;  4P5Y A;  3V0A A;  1PO2 2;  1ULG A;  1XJA A;  1XU1 A;  1OA4 A;  4JDO A;  5HCB A;  2ARX A;  4QKN A;  2E26 A;  4QX1 A;  2ILM A;  3O7O A;  1IZ3 A;  5K7P A;  1YJK A;  1OT5 A;  3WP3 A;  1N3Q A;  4YM0 A;  1W9T A;  3W59 A;  3BB6 A;  5F37 A;  2AUY A;  1SLT A;  4BYY A;  2VOK A;  1M4W A;  2WFP A;  5LRR A;  3VBF A;  2QDR A;  2TEP A;  4FQZ A;  4XUP A;  1KRI A;  4COW A;  5IAV A;  3ZR5 A;  2WS9 3;  1UZV A;  1C4R A;  1S0C A;  4ZS2 A;  2D6K A;  2FDG A;  3ASI A;  1VJ2 A;  4MXW B;  2WAA A;  3HT2 A;  1OPO A;  3QD6 A;  4XUQ A;  1FAY A;  2WN3 A;  3RVH A;  2IXC A;  2RMU 1;  2VTX A;  3ZR6 A;  1JHN A;  5DG1 A;  2O0O A;  3N9O A;  1SHW B;  3AJY A;  2HEW F;  2W52 A;  5JMO A;  4FTS A;  4Z8B A;  2EXI A;  3FL7 A;  1UKR A;  1JOD A;  3RZH A;  3VV1 A;  5F32 A;  1WD4 A;  1ZM1 A;  1UIK A;  1ND3 B;  4F8A A;  1US3 A;  1LJ7 A;  3OBT A;  4BM8 A;  2HWE 2;  3WLU A;  5J96 B;  3GF6 A;  1TMF 1;  5LA2 A;  1ACC A;  1JYI A;  2DCY A;  3VDA A;  3WR0 A;  1UY2 A;  2G4I A;  4LBO A;  4C1W A;  1VMF A;  2D5F A;  5GZG A;  1IG0 A;  5JOY A;  2VBB A;  4KWL A;  4LHK A;  1YIF A;  1KJL A;  2R04 2;  2ZA9 A;  1WCD J;  4LO5 B;  2A1X A;  4UFL A;  2P3Y A;  4AED B;  1C5H A;  4FAG A;  4Z2W A;  1XBF A;  1PK6 A;  1JZ4 A;  3AMQ A;  1GP5 A;  3DYM A;  4Q4W 3;  5FZG A;  5FZ3 A;  2BBV A;  2C9K A;  2JE7 A;  2GZW A;  4HVO A;  4N7I A;  2V5Y A;  2Y6K A;  2A73 B;  4Q0S A;  2Z5W A;  2BOJ A;  1Z78 A;  4XJU A;  3U1X A;  1DZQ A;  2WZ8 A;  3AYA A;  4M01 A;  4JC1 A;  2ZHL A;  5IVF A;  4HBN A;  3F2Z A;  3ROU A;  4ET7 A;  3ZFG A;  1JYV A;  2IXI A;  1RUF 1;  1D4M 1;  4JKM A;  2D3P A;  4M4P A;  2IC1 A;  2XJP A;  4UFK A;  5EJ1 B;  1E57 A;  5K0U C;  1DGL A;  2CGO A;  3NKT A;  3ZX7 A;  3CHX A;  3RMX A;  3WNL A;  4HT1 T;  5I0T A;  3IM0 A;  4HPK B;  3CQO A;  5CEH A;  4RHV 2;  2ZAA A;  2W08 A;  4GMP 0;  5E1R A;  5FK8 A;  1AR6 2;  3VBH C;  4J1W A;  4O65 A;  5B4X A;  3O1O A;  4B4R A;  4QQO A;  5FZK A;  4EWA A;  3VDD B;  2ZGS A;  2FBE A;  5C3S A;  1A8D A;  2VUD A;  2CWS A;  3H0O A;  4MHU A;  5FLI A;  1TE1 B;  2YY1 A;  4JHZ A;  2ORZ A;  4MH0 E;  2XBO 2;  2XJT A;  2XJR A;  2A70 A;  5FKC A;  1XC6 A;  2JD4 A;  4N53 B;  3SH3 A;  1O3R A;  1AF9 A;  4MXW A;  3AP7 A;  2KM2 A;  1W03 A;  4A7Z A;  3GBW A;  4TLG A;  4NIA A;  3GBG A;  3IMM A;  4D7S A;  1AYM 1;  2PMW B;  3IMN A;  1UY4 A;  4R8H A;  1F8V A;  4CCO A;  3R6S A;  3DPR B;  1X9T A;  3H1W A;  1YQ2 A;  2VZS A;  3PIG A;  2DVF A;  4RS5 A;  5FK7 A;  2VJX A;  1KDK A;  3IZO A;  4QPG C;  3RI8 A;  2MHF A;  4CXX A;  2P34 A;  3H50 A;  5FY4 A;  4JHT A;  1YFW A;  2D5H A;  4AAP A;  5IVY A;  4AI9 A;  1U5X A;  1NA1 C;  3LQC A;  1XB9 A;  2JG9 C;  1HV1 A;  3VBR A;  2VQA A;  4LO6 B;  3S6P A;  3PUI A;  3CU7 A;  5HV4 A;  5FFO C;  3E6C C;  1W2O A;  4B3N A;  2RM2 1;  2PXJ A;  4I0B A;  1RIN A;  2X29 A;  4AED A;  1K5M C;  2RMU 2;  2PN5 A;  4AHZ A;  4XUO A;  1O7F A;  3FHI B;  4AI8 A;  1L7R A;  1MR5 A;  1W8F A;  5FZA A;  5DZG A;  1MS1 A;  5FP8 A;  1WW6 A;  1QOS A;  1JZ6 A;  4BIF A;  2XUE A;  3ES4 A;  2XWB B;  2BER A;  2ZX4 A;  1XE7 A;  4P02 B;  2RS3 3;  1R08 3;  2ZZQ A;  1EAH 3;  5CKQ A;  4EN0 A;  3ZSM A;  4D69 A;  4IE0 A;  3AFG A;  1V9U 1;  4XJZ A;  5FYC A;  1PX4 A;  4P9X A;  4BE3 A;  4Y24 A;  1UYX A;  5IYY A;  2W92 A;  4MO3 M;  2EF6 A;  2JE8 A;  4D3W A;  1IS5 A;  2VOX A;  5D1I A;  3J7N A;  2KR2 A;  2VW1 A;  4UW4 A;  1OHF A;  1UYP A;  1ZBA 1;  4GKX A;  5FZM A;  4GMP 3;  3VLB B;  2YC0 A;  2ZX1 A;  3CZJ A;  2V09 A;  2WNV C;  2DCZ A;  4I3G A;  2Y0I A;  3NST A;  4LA2 A;  4Y26 A;  5FMB A;  5FY8 A;  3RI9 A;  3VDD A;  4AQS A;  1C1L A;  1Q8S A;  2R07 3;  4IES A;  2B9V A;  1BKZ A;  1W6O A;  2I07 B;  3KM5 A;  4TYS A;  2OZJ A;  2RS5 3;  2YFU A;  3HNB M;  2VZ1 A;  2ZCW A;  5FJK A;  3MBW A;  3VZK A;  3ZXD A;  3PVN A;  4P9W A;  1RUF 2;  1D4M 2;  1ENX A;  5KWR A;  4B7K A;  1TME 3;  1IS6 A;  4XET A;  3ZXL A;  3FHQ A;  2GP3 A;  5T3N A;  3PHM A;  2R06 1;  5GZF A;  4BDV B;  3LIG A;  1SPP A;  3NV2 A;  1W9S A;  2MPF A;  4QQ2 A;  4BQX A;  2QQI A;  4F3J A;  4GB3 3;  1ND2 B;  4K8F A;  5J09 A;  5HXM A;  4LTA A;  3R4U A;  3OF1 A;  3ZXF A;  2CGP A;  4NPR A;  1WCS A;  2DTY A;  3CKH A;  1PIV 2;  1A3K A;  4EYU A;  4MSV A;  3SIT A;  4PIX A;  4CXY A;  4R9D A;  4IXL A;  1TVG A;  3N7M A;  4NAO A;  2YBP A;  2VXR A;  2J1T A;  5FQ0 B;  1SLB A;  2ZEW A;  3OSD A;  4I09 A;  5GLU A;  4B29 A;  3I3Q A;  4E9K A;  1LOA A;  1O3Q A;  1AYM 2;  3AXD A;  2B39 A;  4QQL A;  2OX0 A;  4UAP A;  4JGZ C;  4NN0 A;  4XAA A;  1IQA A;  5BPX A;  4CDW B;  2H6C A;  3OY8 B;  4FPG A;  5JXI A;  3WDV A;  3J8F 3;  4B1M A;  1SEF A;  5H9Q A;  5J3U A;  1W9Y A;  4GWJ A;  3HT1 A;  4XUT A;  5FWE A;  3IIA A;  4OUM A;  5DAV A;  3HVD A;  2A3X A;  3FJS A;  4RQP B;  1PO1 3;  4NMI A;  3ZXK A;  1N1S A;  3AKR A;  4PDW B;  4LKS A;  5EZW A;  1JU4 A;  3HQX A;  2R06 3;  5F39 A;  1S0F A;  5JAX A;  1VB4 A;  4XIO A;  4HMZ A;  1GUI A;  4UXA A;  2RM2 2;  5KXE A;  2JDZ A;  1VBE 2;  2KD7 A;  1GU3 A;  4BQW A;  2LRO A;  1D2S A;  1A8M A;  1F2N A;  4IW3 A;  2RJK A;  3LA3 A;  4WVW A;  4XMA A;  4OHX A;  4GQ7 A;  4GH4 B;  3WT3 A;  1IGO A;  1AX2 A;  4XUN A;  3B93 A;  3BPS A;  5BNP C;  2JEN A;  5LW9 A;  1RC6 A;  4RGK A;  3H8R A;  4MGK E;  3LEI A;  3N7J A;  3VKO A;  1U12 A;  1XOY A;  2JXA A;  4D7T A;  1TEI A;  3OUI A;  4YRD A;  3WHU A;  1U5I A;  3IDA A;  1DQ0 A;  1B35 B;  1UY3 A;  1V9U 2;  3USU B;  3M4F A;  4M3C B;  5JXG A;  4Q4V 3;  3TAY A;  4XE9 A;  4W6W A;  1GSL A;  2H6B A;  1UAI A;  4BK5 A;  1MEC 1;  4JKK A;  2WO2 A;  2GAL A;  4FPJ A;  5FYV A;  5T52 A;  1O59 A;  1ZBA 2;  4ASM B;  5LEJ A;  1ND2 A;  4QDR A;  1Q8Q A;  3POW A;  3NAP B;  1FPN 1;  5IUQ A;  5FY0 A;  5F3C A;  4Q4Y 3;  3I54 A;  4U2A A;  5FLJ A;  1N3P A;  1X36 A;  4LKD A;  1OVS A;  1I3H A;  1WLT A;  3PU8 A;  1HKD A;  4H14 A;  4XC9 A;  1V0A A;  2PAK A;  5FCC A;  3I49 A;  4U36 A;  1DG6 A;  1RXG A;  4O9G A;  1W06 A;  3BOD A;  5EQU A;  4OQ9 A;  1JOJ A;  3VBH A;  5FQ0 A;  1WMF A;  1QY4 A;  1C5I A;  1EY2 A;  1QEX A;  3VKF C;  3ZLI A;  1RUI 3;  2RHP A;  4AI1 A;  2GH8 A;  2Y6H A;  1UZZ A;  5FMD A;  4QB6 A;  2VC9 A;  2VZT A;  4P9I A;  1ONA A;  3KMH A;  4H55 A;  1POV 1;  2BQP A;  2ZGP A;  5EP9 A;  2JKB A;  1UD1 A;  3SNM A;  4AF9 A;  2XB6 C;  3OOX A;  2VU9 A;  4RQP A;  1K12 A;  3I59 B;  4LPL A;  3W20 A;  5A6X A;  3O0X A;  1IS4 A;  1FOD 1;  2ZMK A;  4PDW A;  3IT8 A;  2JDM A;  4JVA A;  1LGC A;  3NWK A;  2XQX A;  3CEW A;  1S1A A;  1HRV 1;  3WDW A;  1EPZ A;  1W3V A;  4QPG A;  4CCJ A;  1WW7 A;  4CXW A;  4JGY C;  5E88 A;  1MZE A;  4UYB A;  2UUR A;  1HLC A;  1GP6 A;  1NA1 A;  2D43 A;  2JG9 A;  5GLV A;  3JB4 C;  3AP9 A;  4Y1Z A;  1S0E A;  5JSO A;  1AR7 2;  3EHK A;  2CHH A;  1DQ5 A;  4LKE A;  3WG3 A;  5JUV A;  1EV1 3;  3DGT A;  4AI2 A;  1K5M A;  2JDN A;  5FDB A;  2BNM A;  2ZX0 A;  4IDZ A;  3OBA A;  3R05 A;  1VBC 3;  4Y20 B;  4AZZ A;  5JCT A;  4IEY A;  2E9Q A;  1SG3 A;  1R09 1;  4CEY B;  1O4Y A;  2B8M A;  4PLO A;  4CU9 A;  1SLC A;  1UPS A;  1ENS A;  3D5O A;  1XRU A;  3E5U A;  1W90 A;  3USS A;  3IDE A;  3E97 A;  5HXV A;  3OGG A;  5LA9 A;  4AG4 A;  3Q8E A;  1YRZ A;  3AZZ A;  3HNM A;  3O5S A;  4AHY A;  4DXZ A;  2WLP A;  4F7Z A;  5C7G A;  1LHW A;  1UW8 A;  2ZZJ A;  2PQQ A;  4BQ3 A;  2FDH A;  2WKK A;  2QDN A;  1HN1 A;  4YGC A;  1WMD A;  2XXZ A;  2WNU B;  3ZFE C;  3VDB A;  4MGI E;  1YI7 A;  3VD4 A;  3KT1 A;  2W1Q A;  4CDU B;  1QJU 3;  4CRQ A;  3MW3 A;  2WNV A;  4BQY A;  2P6C A;  5F5Q A;  4A2U A;  1HJG A;  2ZGO A;  4Q8L A;  5AC9 3;  1RVF 1;  3OYW B;  2BFU L;  1ZZ8 A;  5FZ4 A;  1XNC A;  1O4Z A;  2DUQ A;  3DF0 A;  3H7Y A;  1LKN A;  3I7D A;  4LOT A;  1LEM A;  1OH3 A;  2ATF A;  1MEC 2;  3ACL A;  1S2E A;  1QQP 3;  4XUR A;  1UL9 A;  1LED A;  3MUZ 1;  2PFW A;  3GXU A;  4K21 A;  4XYX A;  3WF4 A;  3WNM A;  2B4K A;  2DU1 A;  2WZR 3;  3AFK A;  5JPN B;  4ZY9 A;  3V0B B;  5DN2 A;  1FMD 2;  4IE4 A;  1CJP A;  1JOB A;  2C6S A;  4LE3 A;  2D7F A;  5A3M A;  4HVR A;  1HQL A;  2RS1 2;  2E31 A;  3TB0 A;  1JZ7 A;  1HX6 A;  3N9P A;  2HJI A;  1W3X A;  4CP1 A;  4P5H A;  5A33 B;  4CDX C;  3N35 A;  1UX7 A;  1MZ5 A;  1OF4 A;  2VCA A;  5FUP A;  3UYJ A;  4DY3 A;  1HQW A;  4HKO A;  5DUV A;  3VKM A;  2NP0 A;  2QQU A;  2EAL A;  3T1M A;  2BBA A;  2YRO A;  3ZXA C;  1KIT A;  5L36 A;  3WEZ A;  5CFD B;  1LCL A;  2VMI A;  5E6H A;  3MFA A;  5KHI A;  4IV3 C;  2VW0 A;  5FZ1 A;  2FDK A;  4Y1V A;  2DVB A;  5FZF A;  1XNB A;  2VNR A;  1NCQ B;  1V6M A;  4XZU G;  5FYY A;  1LNS A;  3VBS B;  5BNO C;  2P6H A;  3HOB A;  4PI2 A;  1FOD 2;  3IBM A;  2QUO A;  4IEO A;  4Q29 A;  3ZVX A;  2WRA A;  4CEY A;  1RUO A;  1W6N B;  3O1S A;  1Q5O A;  2OII A;  4CA9 A;  2X5I B;  4DB5 A;  2BEO A;  5DUW A;  1HRV 2;  1UZ0 A;  3LFI A;  3ZYJ B;  1VBD 3;  3T2T A;  2X09 A;  4Q26 A;  3TN9 1;  3FBY A;  4P14 A;  4QX5 A;  3BU7 A;  5ISL A;  1RUG 3;  3VBF C;  1BBT 3;  1UNB A;  1GOH A;  3U11 A;  5FZE A;  4TN7 A;  1AL0 G;  3DEC A;  1QJF A;  1VB2 A;  2V4V A;  5HCH A;  4GD4 A;  5BNQ A;  2ET7 A;  3JU9 A;  2ZS6 B;  3EYP A;  2HWD 1;  2PHU A;  5JIU A;  2A5Z A;  2QJV A;  4NRQ A;  2JDP A;  2RDN A;  5FYU A;  1R09 2;  3W5N A;  4Q5O A;  1VBA 3;  2Z4F A;  1YO8 A;  2CL2 A;  1S0J A;  5BNP A;  4CYD A;  2ES3 A;  5AFB A;  1DGR N;  3ZXG A;  4P00 B;  1LHN A;  1R1A 1;  2O8Q A;  3UJO A;  2FDF A;  5GZE A;  2QQV A;  3ACG A;  1KEX A;  2LRP A;  3P6B A;  4E2S A;  5FZB A;  2RE9 A;  2EIG A;  2W5F A;  5FBJ A;  5IW0 A;  1ALY A;  2DUR A;  1SDW A;  1LR5 A;  1CQ9 A;  5CFC B;  4BQ4 A;  2WZE A;  5FO9 B;  3V0B A;  3UV9 A;  3OD4 A;  4JRA A;  1YQC A;  4XFB A;  4ZHN A;  5C70 A;  1F31 A;  4CUA A;  4ES9 A;  4CCE A;  1TG7 A;  1BVV A;  3T2O A;  5A33 A;  1MS3 A;  1RVF 2;  1SAC A;  1W04 A;  2XLA A;  3M3I A;  1QH6 A;  4LQR A;  5FY7 A;  5FPU A;  5DAQ A;  1GZC A;  5IVJ A;  2Y33 A;  1G9D A;  5L73 A;  3W5M A;  1NZI A;  2BOI A;  3VZN A;  4OHY A;  3SCH A;  3RFR A;  2GN3 A;  2QBX A;  5K9Y A;  4XCA A;  2VZP A;  2C0Z A;  2VCM A;  3O1T A;  1KS4 A;  5A3T A;  5L7O C;  2XJU A;  4JCK A;  4JKL A;  2WQ4 A;  3SKV A;  1YEW A;  1PZ7 A;  2YDE A;  2QNK A;  4XQD A;  2VMG A;  4QPI B;  5C3P A;  3ZSL A;  2GC0 A;  3DL3 A;  4JDM A;  4CUB A;  5BNN B;  5IVV A;  4S2G A;  4KI5 M;  4KMQ A;  2Q0A A;  4UFM A;  4M0N A;  4FOY A;  5LRS A;  4IGO A;  2QQP A;  4QB1 A;  5IHR A;  1IG3 A;  2ZAH A;  4N9I A;  2RR1 3;  1ZRE A;  4AVB A;  4OI4 A;  1Y3T A;  5FPX A;  3QOP A;  4QKD A;  3FFQ A;  2A7A A;  1UXX X;  2VZU A;  3OGS A;  3WOG A;  3JBG 1;  2JB8 A;  4WVM B;  2AEZ A;  1OLR A;  1DQ4 A;  4DS0 A;  3OB8 A;  3ORJ A;  4AR2 A;  2XL9 A;  5C4W B;  1AZD A;  1AL2 3;  2YC2 A;  5JXJ A;  1AR9 1;  2WFF 3;  1VRH 1;  3VGI A;  3E1F 1;  3KVA A;  3H1Y A;  2Q30 A;  4K1Y A;  3URF A;  1O91 A;  3IPV B;  3NQH A;  3N9N A;  3OTF A;  4N43 B;  4ARY A;  4FTB A;  1GAN A;  3FC0 A;  4YW6 A;  4COU A;  2K2S A;  3AYC A;  4DFS A;  4E8D A;  4BIO A;  3UJQ A;  1CVN A;  3ZN4 A;  3TN9 2;  3LKJ A;  1ND3 C;  1I6X A;  1CD3 G;  3KCY A;  2MEV 1;  1FV3 A;  5C9A B;  2FMY A;  3PVO A;  2PTM A;  3LPF A;  1VBB 1;  3APB A;  3KS7 A;  3GCX A;  4ZZ8 A;  5JI9 A;  1TNF A;  1W39 A;  4NVP A;  2JDA A;  1COV 3;  5EIY B;  5I8T A;  4ISQ A;  3AB0 A;  3WQB A;  4NRM A;  2OA2 A;  1OLM E;  1W8W A;  3IAP A;  1S2K A;  5CZK A;  3MLL A;  4TTG A;  3KD4 A;  1E5R A;  2HWD 2;  3B9I A;  4FT8 A;  1RYY A;  1UY0 A;  3T4H B;  1NT0 A;  4AED C;  5AVP A;  4B8E A;  1JXN A;  2VZ3 A;  2D44 A;  2YBK A;  2FZ1 A;  2OW4 A;  3I97 A;  1OD3 A;  3CJX A;  4XOG A;  3WG4 A;  1PO2 3;  3B3Q E;  1W0O A;  1V6J A;  1UQX A;  4QMA A;  3W21 A;  5IFP A;  1JZ3 A;  1PVX A;  2R0H A;  3SC7 X;  2QQO A;  4HZF A;  5L19 A;  2VG9 A;  4AHW A;  4IGQ A;  1R1A 2;  4GWN A;  2R6Q A;  4QM8 A;  4OHZ A;  3ZPO A;  1OA2 A;  2Y6L A;  1YQ5 A;  4YW7 A;  4BA6 A;  2UU8 A;  1SDD B;  1W05 A;  4BQ5 A;  1YLL A;  4QPI A;  4FSJ A;  2XJV A;  1PMI A;  2BNN A;  1M06 G;  1JH5 A;  2C5D A;  1AR8 1;  3IN9 A;  5DZF A;  3LEG A;  2Q8D A;  4NID A;  5FP9 A;  3WCS A;  5DMY A;  3IWZ A;  4NIG A;  2GMM A;  1VR3 A;  2RDQ A;  4UOJ A;  1GP4 A;  3P5B A;  1XNA A;  2VZQ A;  3AC0 A;  1IPJ A;  4JTN A;  2EID A;  4QGL A;  3MIC A;  1OKO A;  3AMP A;  3VDD C;  4O9E A;  2Q1M A;  1KS5 A;  2W0X A;  1VLN A;  4YAR A;  1HXS 2;  3NV4 A;  5EWS A;  4AL9 A;  3B9C A;  3GDB A;  1ZA7 A;  1O5U A;  4B4Q A;  4QX3 A;  1C28 A;  5L9R A;  3THC A;  2FZ2 A;  1UPI A;  5LAT A;  3MLK A;  4K6B A;  4N53 C;  1ENR A;  1AR6 1;  1OH4 A;  3N4M A;  4CEW B;  3U4X A;  4QD2 A;  2ARB A;  5GLZ A;  2BYV E;  1G9C A;  3L2Y A;  2HWE 3;  2PHF A;  4ARX A;  4CDX A;  1DFQ A;  1PZ8 A;  3H1M A;  3IPV A;  1ULE A;  2AEY A;  3X29 B;  3DPR C;  5FY9 A;  2XBO 1;  4LBL A;  4IE6 A;  2AAC A;  2R04 3;  3WNX A;  1HB1 A;  3VBO B;  4IV3 A;  3VD3 A;  3BYW A;  2PHR A;  3CO2 A;  4MET A;  4CE8 A;  1C8M 1;  3JBG 2;  4DUV A;  5I91 A;  3U10 A;  3MZH A;  3PUA A;  1DZT A;  2ZOE B;  3ZO0 B;  5JZG B;  2JE9 A;  5DXD A;  5DAB A;  1ASJ 1;  4GKY A;  4LXL A;  4A3X A;  3M2M A;  1AR9 2;  1XNT A;  3N9M A;  1J1T A;  1VRH 2;  3KT4 A;  4YM3 A;  3SMH A;  4LBQ B;  1L3J A;  3C2U A;  3G7D A;  3ETQ A;  4P9Y A;  1K42 A;  5F3G A;  4C90 A;  2WT2 A;  1C57 A;  3A0K A;  3AYE A;  3CF6 E;  2EA7 A;  2HWB 1;  3PUQ A;  5J1X A;  3Q8C A;  3RZZ A;  1J1L A;  3H42 B;  1W8N A;  2EVX A;  2Q1Z B;  2XR4 A;  2VBP A;  4RHV 3;  3VZJ A;  1O5L A;  2MEV 2;  4CZS A;  4O61 A;  2W95 A;  3JZV A;  3T1L A;  1VBB 2;  1O3T A;  4CDQ B;  2BPA 2;  3C7E A;  4AEJ A;  2ERF A;  4ZPI A;  4LOS A;  2Q8C A;  1SFN A;  3BIE A;  1HDK A;  1BHG A;  1RUD 2;  5T54 A;  4GXL A;  2J1E A;  2LAL A;  2XBO 3;  4W65 A;  3K3N A;  2DTW A;  2E7Q A;  4RFT 0;  2B46 X;  3POS A;  3UKN A;  4FO9 A;  1W9F A;  4NHM A;  4XHB A;  4Q0P A;  2HKX A;  4BME A;  5CB7 A;  4P9J A;  4JDN A;  1GIC A;  2GNM A;  4OUS A;  4C1X A;  2PHT A;  3UL2 A;  1WZX A;  1X33 A;  3RWK X;  5CBL A;  1I5Z A;  2HWC 1;  1H2L A;  2TBV A;  4RR3 B;  1AJO A;  5CNA A;  5DPN A;  3TBD A;  2JG8 B;  2R7E B;  1RED A;  3LD8 A;  4J25 A;  4MGT A;  1O8S A;  2WT1 A;  4A7K A;  2AEN A;  1H1I A;  1CZT A;  3UGF A;  4CEW A;  5JR2 A;  1BCX A;  3PLQ A;  1NE4 A;  4YM1 A;  2VVD A;  1HIX A;  3QLQ A;  4QKB A;  1AR8 2;  3TWI A;  4ES8 A;  5ACA 1;  4DNY A;  3MDP A;  4HKL A;  4XFF A;  1OUX A;  4IER A;  5LEK A;  3MIB A;  4QDQ A;  2XG3 A;  3MIG A;  1WW4 A;  5FBZ A;  5IT6 A;  3ZYF A;  4ONU A;  2V73 A;  2E7T A;  1ND2 C;  4V2W A;  5L7O A;  2PYT A;  4EN8 B;  3Q8F A;  2RMU 3;  3H9A A;  3BIW E;  1QJX 1;  2Q4S A;  5JZG A;  2WSU A;  5DAW A;  1XE8 A;  2HBT A;  3H3L A;  4X6Q B;  5FP7 A;  2GH2 A;  1GNY A;  1IHM A;  1PVC 1;  4PIY A;  1T6B X;  5J98 B;  2BDR A;  4AFC A;  3VZM A;  1GQH A;  3SKJ E;  1AX1 A;  2D6M A;  2DBN A;  3BOW A;  4DUX A;  4QU2 A;  5C3O A;  1TMF 3;  3FLT A;  1H2K A;  3GJA A;  5LY1 A;  1SCS A;  1DU3 D;  5EJ3 A;  1PIV 1;  2ZTN A;  4CDW C;  3D3A A;  2OVU A;  2IWG B;  1EP0 A;  2XKO A;  1LES A;  4XW3 A;  2RG4 A;  5GZD A;  5E8A A;  3ZPY A;  4BLI A;  5FTT C;  4ORF A;  1C8M 2;  2WS9 2;  2DCJ A;  2HBU A;  4LUL A;  1H9P A;  3FFZ A;  4RQP C;  5G04 L;  3TEZ A;  2XPJ A;  4CCC A;  1DGW A;  2E53 A;  4PDW C;  2Y34 A;  5FYM A;  1ASJ 2;  2E63 A;  1LEN A;  2PHX A;  4Y1Y A;  2J1V A;  4I0A A;  2GC1 A;  2EIC A;  3KWV A;  1OA3 A;  3S5Q A;  1PM7 A;  1HRI 2;  3NNF A;  3WW1 A;  2FCU A;  1RIR A;  3DXT A;  4LIU A;  1ND3 A;  1J59 A;  4FFF A;  1D4V B;  1LHV A;  1D4M 3;  1RUF 3;  1Z0H A;  1RMU 1;  4LKF A;  4PT6 A;  3O1R A;  2JWP A;  4FVV A;  4OHV A;  3S57 A;  4GH4 C;  1XND A;  2HWB 2;  1GZ9 A;  1WW5 A;  2YG0 A;  4UW5 A;  4XF3 A;  3SCG A;  5FO8 B;  5LY2 A;  1GBG A;  4RR3 A;  3GGL A;  3VDC A;  3HJR A;  2EAA A;  3OPZ A;  2ORX A;  1VBE 1;  2XQR A;  4PQ9 A;  2D97 A;  3D82 A;  4QHZ A;  4IEW A;  2H0V A;  4BQ2 A;  1NLR A;  1RHI 1;  2JKX A;  5CU1 A;  2BFU S;  3FUO A;  4LBN A;  1B35 C;  5IJR A;  3J7H A;  3OBZ A;  4Y4Y A;  4NUB A;  1VIW B;  4Z07 A;  2YV8 A;  1EUU A;  2VMH A;  2A6Z A;  4AHX A;  1JYC A;  5KR7 A;  1YWK A;  2DFB A;  3KCC A;  3VKN A;  4X8P A;  5EYY A;  2GND A;  1HV0 A;  4OZX A;  5EHD A;  3JD7 1;  4OHW A;  3NAP C;  4YLZ A;  1XYO A;  1AYM 3;  2VO5 A;  3SCF A;  4E2Q A;  1OQ1 A;  2HWC 2;  2W47 A;  4SLI A;  4XFA A;  3GHN A;  2YU1 A;  4QT6 A;  4XTP A;  4BB3 A;  5FOB B;  1DF0 A;  2WII B;  3RNS A;  3O1V A;  4LLO A;  3AKT A;  4HPK A;  4YW2 A;  5G05 L;  1AXY A;  3V56 A;  5KC6 A;  4X8N A;  4J6G A;  4ZZ5 A;  1X82 A;  1BEV 1;  3E5Q A;  4KGQ A;  1Q56 A;  1S0B A;  4N7U A;  4QX2 A;  2QZ3 A;  4ITC A;  5ACA 2;  1JZ5 A;  1MVE A;  2VH9 A;  1S0G A;  1ZRI A;  2UWC A;  5F6K A;  1CR7 A;  2G9F A;  4BXF A;  4LBJ A;  1OC1 A;  1Y7B A;  4K1Z A;  4L97 A;  4P9G A;  1OSG A;  2RM2 3;  4N53 A;  4YGB A;  1JOP A;  2ZJC A;  2C9A A;  2OT7 A;  2CAV A;  2KXL A;  5C33 A;  1QJX 2;  1XNK A;  1MZ6 A;  2Y8K A;  5JOX A;  1GQP A;  1CIY A;  3TOJ A;  1WBF A;  1ZBE 1;  1ZZC A;  1PVC 2;  4MGQ A;  2NN8 A;  1W9W A;  1NOV A;  1RUC 1;  3ECQ A;  1NE6 A;  3DPR A;  2VME A;  2A3Y A;  1MS4 A;  3MYX A;  4QGM A;  5FJH A;  3Q9O A;  1L7Q A;  4LBM A;  3FWE A;  2OPK A;  1BMV 1;  1Q8P A;  4M4R A;  4AEK A;  1NLQ A;  1DYO A;  1OLQ A;  1WWY A;  2C4X A;  2VNV A;  3RMY A;  1DP0 A;  1QKQ A;  1O8P A;  3KGL A;  1BLZ A;  1V9U 3;  4LHL A;  3O1P A;  2NMN A;  4LBQ D;  1GFF 2;  2RV9 A;  2AGS A;  1PX3 A;  5D8A B;  2BP6 A;  4A41 A;  1D0H A;  3NJY A;  3HNY M;  1XSR A;  1F5J A;  3ZN5 A;  3C3V A;  3RZJ A;  1ZBA 3;  3PJQ A;  4FFH A;  1RUJ 1;  4LK6 A;  2PQS A;  5A32 B;  4R9B A;  3ES1 A;  2EIB A;  3P3P A;  5CIR A;  4YG6 A;  1X9P A;  2ZEX A;  1W0P A;  1STM A;  3NVC A;  3OUH A;  4CEY C;  1LOD A;  4YNI A;  2W2I A;  2HEV F;  3MIE A;  4YVS B;  2VBD A;  5FAX A;  4NHY A;  1AR7 1;  1XXN A;  3D6E A;  1CAX B;  1DBN A;  1S4C A;  2QFE A;  1WCU A;  1W8H A;  2OUH A;  4X6R B;  4YVW B;  5JI7 A;  2WQZ C;  2ZKN A;  3WF0 A;  2OKX A;  2XDV A;  1RMU 2;  3CDZ B;  5FPV A;  3A21 A;  2FD8 A;  2P4E A;  5KBF A;  2YZ4 A;  4IEZ A;  5IK4 A;  2RS3 2;  2WNU C;  4CTE A;  3AL6 A;  1W8U A;  2WC2 A;  3I2H A;  1RUN A;  3OD0 A;  4XTM A;  3TEY A;  1JTZ X;  2D93 A;  2OQ7 A;  2PAM A;  1K5J A;  4XF0 A;  4CDU C;  2R0F A;  3ENR A;  2EIE A;  4H3W A;  2WL1 A;  4AVS A;  1RHI 2;  2BUK A;  4FXK B;  5I8S A;  5C71 A;  1Y9M A;  2WBK A;  5FZO B;  4BOW A;  3HPN A;  5JPM B;  4L2N A;  2GAU A;  1G9A A;  3VZO A;  5KXB A;  3BTY A;  3C7H A;  3CZU A;  1RL3 A;  4JAA A;  4W6X A;  5SV5 A;  5J36 A;  1W2T A;  4I2O A;  1KFU L;  2XON A;  3JD7 2;  4CP9 B;  2JX9 A;  2DVD A;  3LZZ A;  4Y5S A;  2FQP A;  2W3J A;  3O14 A;  4UBH A;  1HB4 A;  1UN1 A;  2YBS A;  3FZ3 A;  4XDP A;  3ZXE A;  3GAL A;  1BK0 A;  4FPK A;  5I0S A;  4FBF A;  1QH7 A;  3AKP A;  3JUU A;  3LB9 A;  4PJY A;  1TME 2;  3WCR A;  3OCP A;  1POV 0;  4OFG A;  2CWM A;  4IV1 B;  2R30 A;  1SQ4 A;  5CG8 A;  5JSP A;  1H4G A;  1IQD C;  1BEV 2;  4DEV A;  4E4H A;  2V5D A;  2Q1F A;  4Q0U A;  3LE0 A;  1NXM A;  1NXD 1;  1ZNP A;  4XF9 A;  4ZXK A;  4KNC A;  5H9R A;  4YGE A;  5ABJ B;  1YHF A;  2VTF A;  4QQH A;  5LB6 A;  1JZ2 A;  4AFB A;  4MZU A;  3ZFF B;  1FMD 1;  1W8Z A;  1D7P M;  3T30 A;  4D6Q A;  5CFD C;  2ZGT A;  5GZC A;  1QJZ A;  1OXC A;  3RDI A;  2QQN A;  3N3H A;  3SH5 A;  3BKZ A;  2RS1 1;  1W99 A;  3BN6 A;  1LOB A;  3P1I A;  3J26 N;  3AMH A;  4NRO A;  1JI6 A;  3M3Q A;  4LO8 A;  4CCK A;  3BU0 A;  1NCQ C;  1CAU B;  3VBS C;  4G4F A;  3D4K A;  4LHN A;  4CCN A;  4KG8 A;  1ZBE 2;  1RUC 2;  2VY0 A;  3T0A A;  4CDW A;  3ILR A;  1YNA A;  3OY8 A;  1F15 A;  2X5I C;  4JTO A;  4YVS A;  5JXH A;  5CA6 A;  1ZRF A;  1BMV 2;  5FOJ B;  1SFY A;  2VNG A;  1E5S A;  4YVW A;  4AGG A;  5HCA A;  2O1Q A;  1CX4 A;  5GLW A;  4XF4 A;  4HSJ A;  3LDK A;  4XF1 A;  2BU9 A;  4FPY A;  1J3R A;  1H4H A;  3EB7 A;  3HAG A;  1UZY A;  2WT0 A;  1WKY A;  3ZYR A;  4HSL A;  1MS5 A;  2FHR A;  3LA7 A;  1MEC 3;  2D6O X;  1ZZ9 A;  5D2A A;  5A6Z A;  1RUJ 2;  4AGR A;  4Z2A A;  1FPN 3;  1VAK A;  3N9L A;  3HQR A;  1UX6 A;  5FZO A;  1O3S A;  4GH4 A;  1H1A A;  1JUI A;  1WD3 A;  3GCW A;  5F5C A;  1GWK A;  2JEM A;  4YG3 A;  2BGO A;  4AVT A;  3T4V A;  1YJL A;  1W6P B;  3R0R A;  4QPW A;  1RTV A;  1QIQ A;  5KXD A;  2EXH A;  4CP9 A;  4EZH A;  1N1Y A;  3A23 A;  2K0G A;  4CU7 A;  1LB2 A;  1B35 A;  1WMX A;  2K46 A;  4L11 A;  1DQ2 A;  5FUN A;  2CDO A;  1V00 A;  4M3C A;  4MGS A;  3USU A;  4G9S B;  5CFC C;  1DHK B;  2JJ6 A;  4XJW A;  4PCR A;  4ATE A;  2Z69 A;  3OUJ A;  1JN2 P;  2J1S A;  1JU3 A;  3PU3 A;  2XVG A;  3MLJ A;  1ZYB A;  2TNF A;  4Q4V 2;  3A4U A;  1POV 3;  3THT A;  3ZSJ A;  4LEJ A;  3T0D A;  3NAP A;  4XFI A;  3QBQ A;  3TYJ A;  3LDB A;  3HN3 A;  4I01 A;  3B69 A;  4XAB A;  5FYB A;  1FOD 3;  1PZ9 A;  5T50 A;  3O1M A;  2YFZ A;  4YM2 A;  1RUH 1;  1UMI A;  2CGN A;  5A1L A;  5IAT A;  2VOT A;  2VQU A;  3P3N A;  3UES A;  3ZFF A;  3ZYI B;  1S0I A;  2LS6 A;  1HRV 3;  4NII A;  4CPB D;  1LRH A;  3VKL A;  3IKW A;  4IND A;  3I2D A;  2A3W A;  5FZ9 A;  1H8V A;  3KZ4 C;  4QPI C;  3K3O A;  1CAU A;  5BNN C;  3B01 A;  4L8Q A;  5CG9 A;  2XUM A;  3GZU C;  1DLC A;  3AKS A;  5FZC A;  3WX5 A;  1LEC A;  3POG A;  3VHN A;  2NQY A;  1ZZ6 A;  2VE1 A;  3MI8 A;  4HFS A;  2JDH A;  3O0W A;  1RJ7 A;  2VVF A;  1Z7S 1;  3I59 A;  2G1M A;  4B7E A;  1WCQ A;  1R09 3;  1GKB A;  3VHP A;  1G8W A;  3KQ4 B;  1H6Y A;  5AFE A;  5C4W C;  3IDB B;  2AR6 A;  3I3E A;  3CJI B;  4I02 A;  4TWT A;  5JOZ A;  4JRL A;  4UBG A;  4W6Y A;  3RSJ A;  4GA9 A;  1AVB A;  1NYW A;  3BTX A;  2WYS A;  2W1U A;  2PHW A;  4LIV A;  1ULO A;  3R4D B;  4Q0Q A;  2VMD A;  1W28 A;  2ZPX A;  2RDR A;  2IZW A;  4N43 C;  4OI2 A;  4S2H A;  1NCR B;  4CP2 A;  5IAX A;  1QJY 2;  1UU6 A;  4Y3O A;  5A3U A;  1G7Y A;  1KDM A;  2UYA A;  1IPK A;  2E32 A;  3D0S A;  3T0B A;  4AFM A;  3MF9 A;  2ZGU A;  4CUG A;  2RJ2 A;  1ZRC A;  2D6N A;  4YW5 A;  5D21 A;  2H0B A;  3ZYH A;  5JDB A;  4CCM A;  1QXJ A;  5KHH A;  1CPM A;  1RVF 3;  4UFJ A;  4Y20 A;  3LOB A;  1S0D A;  4L92 A;  4AI3 A;  2YPD A;  1HN0 A;  1NLS A;  4JQR A;  1W6Q B;  3NNL A;  1LOC A;  4C8D A;  3I2J A;  1UF2 C;  2JD9 A;  5M0T A;  3CBN A;  3TNQ A;  1U5Y A;  4MYE A;  1V6K A;  3LFM A;  5DDJ 1;  2ZX2 A;  4IE5 A;  3N7K A;  4Y22 B;  2K9Z A;  4GWM A;  2X8K A;  3H7J A;  3HR9 A;  3VL8 A;  3WG2 A;  5HI0 A;  2BWC A;  2XHN A;  3W9A A;  3I2G A;  2PHD A;  2WNU A;  1CPN A;  2VZO A;  3WY6 A;  4E8C A;  5BV6 A;  2ZAC A;  3E5X A;  1BXH A;  1SCR A;  2ET1 A;  3AVS A;  4IEU A;  4MLO A;  4CDU A;  3MV0 1;  1HJF A;  1QJE A;  3EXU A;  4PHZ A;  2B7Y A;  4AK3 A;  2ADE A;  4YWA A;  1KXG A;  1X50 A;  5E16 A;  4K3U A;  2JIG A;  3FBM A;  2IVI B;  3OYW A;  5A80 A;  4TZD A;  1PGL 2;  4OUE A;  4ATF A;  2QQJ A;  4YFW A;  3L9J T;  2P3K A;  1AJK A;  4UWD A;  4OQ8 A;  4LA3 A;  2AZ5 A;  4BQ1 A;  5BUV A;  5FWJ A;  5L9V A;  4BHP A;  4Y33 A;  3VBU B;  3I2O A;  2I2S A;  2XOM A;  1VRB A;  3DYP A;  1E5H A;  3KVB A;  4D8M A;  3H8U A;  5EV7 A;  1RUH 2;  2ZBJ A;  5F5I A;  2YPJ A;  2FCV A;  2VTX J;  3B02 A;  4PIZ A;  1RUE 1;  1JBC A;  3SEP A;  3K4A A;  4D94 A;  4WZC A;  2ZGQ A;  1FNY A;  3ST7 A;  1JS9 A;  2DYC A;  4LNV A;  3PVB B;  4RYD A;  3TN9 3;  2VQ0 A;  3SIS A;  5A1F A;  4CEW C;  1WME A;  3LAG A;  2VMC A;  5FKB A;  3WP4 A;  1SBD A;  1RXF A;  2VPV A;  4ASK A;  4KU8 A;  1HXS 1;  5J37 A;  4NWV A;  4EWD A;  5DAX A;  4CVU A;  3ZN6 B;  1KJR A;  2XVL A;  4ZU4 A;  5CFD A;  3RGB A;  1MVQ A;  5EFU A;  4OYU A;  2HWD 3;  3U78 A;  1KFX L;  1MZF A;  2JDY A;  3VBO C;  4EE2 A;  5JSR A;  1AXK A;  1VMH A;  1Z7S 2;  2ZGL A;  5JZG C;  1YI9 A;  1BYH A;  1NCQ A;  3LA2 A;  4NPL A;  2LTN A;  2VEC A;  3VBS A;  1AX0 A;  1ULD A;  3AJZ A;  1YIP A;  5FXW A;  5B2G B;  1W6N A;  1Q8O A;  4FOW A;  4YW1 A;  2F17 A;  2X5I A;  3SEE A;  4LR4 A;  1C3H A;  3RPQ A;  1MS8 A;  4NHK A;  4MV2 A;  1Q3E A;  1CX1 A;  1R1A 3;  1ZZ7 A;  4QXK A;  3OEA A;  4Y22 A;  1N3O A;  3D0J A;  1JYW A;  5K8S A;  1CAV B;  3OPT A;  5IFT A;  3E6D A;  2F4L A;  3M1H A;  4QQP A;  4Y1U A;  1MQT B;  2W91 A;  4YZ3 A;  4H7L A;  3DKQ A;  2ZAB A;  1OMI A;  4BPZ A;  2B45 X;  5DZE A;  1PNF A;  3NRU A;  4XXA A;  3NNG A;  5FYS A;  2P3I A;  4XBN A;  1IPS A;  1UOB A;  4CDQ C;  4L0P A;  2IFR A;  4TXW A;  2PLV 1;  5FZI A;  5LWB A;  1HXS 3;  4IQP A;  4A4A A;  3PME A;  4EJR A;  1SFP A;  4YG0 A;  2VCC A;  5F2W A;  3DEM A;  5DDJ 2;  1A78 A;  3HMY A;  1ZRD A;  2GN7 A;  3I2K A;  1DGR A;  5IWF A;  4V1P A;  4SBV A;  4UF0 B;  3NJZ A;  4DMI A;  1K45 A;  3B5L B;  2WWU A;  5A3W A;  4D6R A;  2FDI A;  5BY5 A;  2A6Y A;  3VHO A;  5CFC A;  5FYT A;  3MFC A;  4IL7 A;  4GJZ A;  4RR3 C;  5ANQ A;  4NIH A;  4OZO A;  1RUD 1;  2F6B A;  5FZ8 A;  4QX7 A;  4E4D X;  2ZGK A;  3T09 A;  4M00 A;  1QXR A;  4C0B A;  1G9B A;  2XHK A;  3GZE A;  4AOC A;  3EJK A;  2IXH A;  3JBG 3;  4OLL A;  4W50 A;  4DUW A;  2R32 A;  3EO6 A;  3ZKU A;  1H2M A;  2J42 A;  3K4Z A;  2OYZ A;  5C8C B;  1GV9 A;  3LDR A;  4YSF A;  2XH6 A;  1N1T A;  1GOF A;  2BVB A;  4RL7 A;  2VL4 A;  5F6L B;  2W46 A;  1AR9 3;  1JW6 A;  3M3E A;  3V0A B;  5APA A;  4FPO B;  5JR7 B;  1VRH 3;  5FZH A;  2MNG A;  2QE3 A;  4I0W B;  4AWD A;  2GNT A;  2HEY F;  4ZON A;  1UY1 A;  5A7O A;  1OPM A;  1LU1 A;  2R16 A;  3WNK A;  1DYP A;  5BNN A;  4YZ5 A;  4A44 A;  5EPA A;  3RQ0 A;  3NJV A;  1RUE 2;  3WDU A;  1VAL A;  4HN1 A;  4RD7 A;  2HWF 2;  1JYX A;  2VAU A;  2XLF A;  2WAB A;  3WXP A;  4Q4X 1;  3E6B A;  2CV6 A;  3QH6 A;  4P08 A;  1V70 A;  4RSU A;  2MEV 3;  2YMZ A;  3T2P A;  2BJS A;  4DZG A;  2Z79 A;  2VUC A;  4ZS3 A;  3RYP A;  1MAC A;  3WF1 A;  1VBB 3;  3OG2 A;  3K2O A;  4HLT A;  5FO7 B;  4QHO A;  1GQG A;  3WIN E;  4WVM A;  1FI2 A;  1UIJ A;  1U0A A;  1VPH A;  4R4X A;  1WBL A;  3R4S A;  4BCU A;  2WA4 A;  4XJA A;  1EYB A;  5C4W A;  1MQT A;  5KHJ A;  1E5I A;  3U4S A;  3VL9 A;  3J9S A;  1D0G A;  2GC2 A;  1AYN 2;  3LWC A;  4JV4 A;  5FMO L;  2OS2 A;  2WR9 A;  4BLJ A;  5LBE A;  2JDK A;  1H8T B;  4PLM A;  4Q1R A;  3T08 A;  2JB4 A;  4N43 A;  3THD A;  3CNA A;  4KWU A;  1UOJ A;  4RGA A;  1N1V A;  2P2K A;  3ON7 A;  1OUR A;  4XJ8 A;  3M70 A;  2D98 A;  1OLM A;  4LUM A;  4DEQ A;  3ALQ A;  1OOP B;  4GAZ A;  2NYY A;  1NAE A;  2N7G A;  3IAQ A;  2WS9 1;  2R49 A;  4XZP A;  1H30 A;  1V6L A;  4BU2 A;  4Y1X A;  3UGH A;  4CCL A;  1XPW A;  2J1A A;  4HN0 A;  5C9A A;  3PTR B;  4AQ6 A;  4COZ A;  1AR8 3;  1PK6 B;  4WV8 A;  1URX A;  2VD7 A;  1F4H A;  4ASL A;  4FXG B;  3BUC A;  4EQV A;  2VXJ A;  1J83 A;  2UWA A;  5GJ6 A;  1DQ6 A;  3MEP A;  1HRI 1;  3C8X A;  4FPC A;  4QX8 A;  5IK5 A;  1PMJ X;  4WVV A;  5FPL A;  2J22 A;  2PLV 2;  1DCS A;  3GZT B;  5EJZ B;  5DAP A;  3ZFG B;  2GMP A;  3WW4 A;  3I2F A;  1W2A X;  1S2B A;  3VD7 A;  4AVA A;  3GJB A;  1UYY A;  1W6M B;  1AR6 3;  3NL1 A;  1UO9 A;  4KGG A;  3POI A;  3ELN A;  3HEI A;  2ARC A;  2D3S A;  2O14 A;  4WBB A;  5C5T A;  3RWN A;  5A3N A;  1IKP A;  2WUH A;  3MGU A;  2IUW A;  3JQX A;  2WIN B;  4Q4W 1;  4R52 A;  4CUC A;  1CAW B;  2ETE A;  4JZR A;  3LCP A;  1W8O A;  2CY6 A;  4QXC A;  4XXP A;  4URT A;  2Y0O A;  3NW4 A;  4YFZ A;  2YHJ A;  1C8M 3;  2DWR A;  4RA0 A;  3S0M A;  3VD5 A;  4YZ2 A;  3QH7 A;  3DYO A;  4M3C F;  2D6L X;  2JIC A;  2ID4 A;  1ASJ 3;  5ANN A;  5FZ7 A;  3CLP A;  1XSQ A;  4IEV A;  4AAX A;  1X8E A;  1YQ6 A;  1UCX A;  3K48 A;  4YYO A;  5A3L A;  2VVE A;  2OZ6 A;  4IEP A;  4W8J A;  1HRI 3;  2W94 A;  2AYH A;  4PF5 A;  2Y64 A;  2W1W A;  4OMD A;  3RJ2 X;  4YGD A;  1MS0 A;  1MS9 A;  1J58 A;  4RS5 B;  1G9F A;  4Y4R A;  2A75 A;  1H8T A;  3ACF A;  2HWB 3;  3I3B A;  3LOI A;  1JYT A;  1ODN A;  5EXO A;  4Q4X 2;  1NQD A;  1QOT A;  4JQT A;  2Y38 A;  2QQW A;  3FMG A;  2P5B A;  3JCI A;  4WM7 B;  3VBR B;  3VBO A;  3H8O A;  1L7L A;  1OOP A;  2VUJ A;  1CGP A;  2UWB A;  3ZSE A;  2WO1 A;  2ZGM A;  1IKQ A;  1UKG A;  3MV1 1;  1BQP A;  1A6C A;  1F5F A;  1YFY A;  5LAS A;  1ULF A;  3IDC B;  4FQ4 A;  3THP A;  3PVE A;  4GJY A;  1OBN A;  1TZO A;  5FPA A;  1Y4W A;  1QNY A;  5D8A C;  1H1M A;  5FYZ A;  5F1R A;  5LBB A;  1H2N A;  3ILF A;  1IS3 A;  2OQ6 A;  4LBQ A;  5EYX A;  3ZXJ A;  4D7Y A;  3DCQ A;  4WM8 B;  3ZM8 A;  4TSV A;  1VMJ A;  4XIL A;  2Q8E A;  3WF2 A;  2QQM A;  4HL0 A;  3QAC A;  3V65 A;  5FMC A;  3S7E A;  4CP0 A;  2DCT A;  1ODM A;  2HWC 3;  1CWP A;  3UK9 A;  1Y9G A;  3GHM A;  3N7L A;  4YVS C;  3POY A;  2UYB A;  5C5U A;  5SV8 A;  4FFI A;  3POF A;  4KQ7 A;  4N90 A;  5A3O A;  1W6M A;  1OD5 A;  4YVW C;  2B42 B;  4QKF A;  4XFG A;  4ZU5 A;  2WNO A;  3H3Z A;  4XHX A;  5FY1 A;  2VOW A;  4CDQ A;  1PNG A;  3SLI A;  5IVE A;  4COV A;  4ZU7 A;  2VNO A;  2JDU A;  3D8C A;  1YFX A;  5ACA 3;  3OJB A;  3ZMN A;  4EN9 B;  5CVR A;  1CAW A;  4XDO A;  3WUD A;  3RJR A;  1W6O B;  4XQW A;  1NY7 1;  2J1U A;  3MHZ A;  1EUT A;  1QJX 3;  1TNR A;  2DF7 A;  1WLC A;  4URA A;  5J48 A;  3PNA A;  1VE0 A;  2EXJ A;  2YU2 A;  3AZX A;  2RS3 1;  1R08 1;  3WDY A;  5JOW A;  4OI1 A;  1EAH 1;  4E4S A;  1PVC 3;  4B1L A;  3III A;  4A45 A;  2ZEZ A;  3OEB A;  4DQA A;  2JG8 A;  1T6G C;  3O1U A;  4J1X A;  2QZ2 A;  1I1E A;  1SPP B;  2F4P A;  2Y60 A;  2YYO A;  4MX3 A;  3AZY A;  1US2 A;  2XJS A;  4Q8K A;  5FZD A;  5DG2 A;  4Q4W 2;  5A3P A;  1Q8V A;  1PIV 3;  3KF3 A;  4GMP 1;  5CKM A;  2W68 A;  2E7A A;  4IV1 C;  2R07 1;  2E6V A;  4WM7 A;  3KGZ A;  3M8L A;  3BAL A;  2ZMN A;  2RS5 1;  1JHJ A;  5CAZ A;  3NNM A;  4R4Z A;  2ARA A;  2Z42 A;  4OVE A;  1GR3 A;  2XJQ A;  3BCW A;  3K77 A;  5ABJ C;  3AMM A;  4Q27 A;  3B00 A;  3U0Z A;  3ZFF C;  2CYF A;  1TME 1;  3RRD A;  4IE7 A;  4IET A;  1ENQ A;  4DY5 A;  1Y9Q A;  3NKG A;  4WM8 A;  1RMU 3;  1WGP A;  2NMO A;  2VW2 A;  4CCD A;  1QDC A;  2J7M A;  1DQ1 A;  1KD7 A;  4GB3 1;  4NR1 A;  5F9T A;  2CNA A;  1OFS A;  5LK7 B;  1LOF C;  4OI0 A;  1F9K A;  1WA4 A;  3M3C A;  1TMF 2;  2VMF A;  3A7Q A;  2CAU A;  3AYD A;  3FN9 A;  5FYH A;  3V64 A;  1GZW B;  4UFH A;  1HB2 A;  2KA3 A;  1VBE 3;  3AP4 A;  2ZEY A;  3NV1 A;  3PIJ A;  4A6S A;  4QGN A;  1RJ8 A;  2SBA A;  4YZ4 A;  4MOA A;  1RHI 3;  3DUI A;  1X7N A;  4N9H A;  4AQT A;  2Q5T A;  1H9W A;  4MHR A;  2VZV A;  4AYU A;  3Q8A A;  1V6N A;  3JXS A;  2WQ8 A;  2YGL A;  3KLS A;  5A7W B;  1SBE A;  4FAH A;  3J4U H;  5GLT A;  1F4A A;  1PGS A;  1NG0 A;  1UYZ A;  3KHB A;  1V6I A;  3HBK A;  3J8F 1;  3JD7 3;  3WNO A;  5C6C A;  2R1B A;  3AP6 A;  1LUL A;  4NRP A;  3AL5 A;  3WQ0 A;  2D6P A;  2DCK A;  3ILN A;  4DIQ A;  4UFI A;  1JMU B;  2BV4 A;  5H9S A;  1D2Q A;  3S30 A;  5T5O A;  4MAD A;  1PO1 1;  4XEZ A;  3MW2 A;  1IOA A;  2BRT A;  3UGG A;  3ZYB A;  3VN4 A;  1BEV 3;  3KV5 A;  4O7X A;  1LHU A;  3AMN A;  2XKP A;  5T55 A;  2ZML A;  3KV9 A;  4LUK A;  4OCT A;  1AHS A;  4XAC A;  5HPO A;  2OUJ A;  4HON A;  2ZX3 A;  5K0U B;  2VR4 A;  1NY7 2;  4AE2 A;  5GAL A;  5LBF A;  1LHO A;  1MPX A;  4NHX A;  4QXH A;  4DXS A;  5F3E A;  2QKD A;  3VBH B;  2V72 A;  1R08 2;  4UW3 A;  1EAH 2;  1ZBE 3;  4EWE A;  1XYP A;  1SLL A;  1RUC 3;  5KXC A;  4XAE A;  1J3Q A;  1FAT A;  3QCW A;  2FMD A;  2Y6G A;  1CJD A;  2G9G A;  3WD5 A;  1RB8 G;  4Q4V 1;  4ERO A;  1QOO A;  3TNP B;  3AK0 A;  5A1A A;  5IK8 A;  1UZW A;  3EBR A;  4FPF A;  4LT5 A;  3AZV A;  2RDS A;  2PEL A;  4DRV A;  4Z92 B;  4CPB A;  5IK7 A;  2VZR A;  4CSW A;  5FPB A;  1H0B A;  2BGC A;  4Q4Y 1;  2E51 A;  3LGR A;  3SXW A;  2OXB A;  3GZA A;  4MGY E;  2Q8O A;  2R07 2;  1BK1 A;  2DVA A;  4L9B A;  1GZW A;  2XWJ B;  4P9L A;  1RUJ 3;  1XU2 A;  4AFD A;  2RS5 2;  3ATG A;  3ABZ A;  3FX3 A;  3GNE A;  1FT9 A;  1SZB A;  3AP5 A;  4AVC A;  3PDQ A;  2DU0 A;  2G19 A;  4QPG B;  2DBI A;  3CMG A;  4YPJ A;  5I93 A;  3IB3 A;  4BH9 A;  4Z1V A;  1AR7 3;  5A7W A;  2W1S A;  4QU1 A;  1NA1 B;  2JG9 B;  1KQR A;  1RUI 1;  3CJI C;  3RZM A;  5J7M A;  5KHG A;  5F5A A;  4A7Y A;  3ZSK A;  3LF7 A;  4GB3 2;  4G3Y C; 
#chains in the Genus database with same CATH homology
 1CZS A;  1UY4 A;  3CIH A;  1R64 A;  4UOJ A;  1XNA A;  2VZQ A;  3AC0 A;  2XHN A;  3UET A;  2BZD A;  3I2G A;  1P8J A;  2EID A;  1YQ2 A;  2VZO A;  2VZS A;  4E8C A;  2VJX A;  3C7F A;  3WSO A;  3GDB A;  4QX3 A;  3MV0 1;  2Y6J A;  3THC A;  3LQC A;  4W4Z A;  4RN5 A;  1OH4 A;  3PUI A;  4OUE A;  3FHA A;  4ARX A;  2QQJ A;  4XUO A;  1L7R A;  1J84 A;  4GWI A;  2XOM A;  3DYP A;  4A3Z A;  4D8M A;  1JZ6 A;  3VD3 A;  4DUV A;  4HG6 B;  2BER A;  2VCB A;  3K4A A;  3SEP A;  3VD9 A;  4P02 B;  3ACH A;  1UWW A;  1KGY A;  1UXZ A;  1ULP A;  4RYD A;  3OGR A;  1XNT A;  2VMC A;  1PX4 A;  1UYX A;  3NJX A;  5IYY A;  5F7U A;  2W92 A;  4MO3 M;  4A42 A;  2JE8 A;  1K42 A;  4CVU A;  4D0Q A;  3CZJ A;  4OYU A;  5J1X A;  1W8N A;  2B9V A;  2W95 A;  2YFU A;  3HNB M;  2VZ1 A;  3C7E A;  3MBW A;  3SEE A;  1CX1 A;  1CZV A;  1BHG A;  3FHQ A;  4PF1 A;  3OEA A;  2J1E A;  1NKG A;  5LCW L;  1JYW A;  2W9X A;  4BDV B;  2LW8 A;  1W9S A;  5IFT A;  1H6X A;  2QQI A;  2W91 A;  5HXM A;  2BGP A;  3NRU A;  5DPN A;  3NNG A;  3CKH A;  2R7E B;  1O8S A;  4L0P A;  5DQ0 A;  5LA1 A;  4TXW A;  1CZT A;  5JR2 A;  4A4A A;  1TVG A;  2J1T A;  4DXT A;  2ZEW A;  2VCC A;  1GMM A;  4QDQ A;  3I2K A;  4UAP A;  1K45 A;  3LPG A;  5JXI A;  2J1R A;  4GWJ A;  5LA0 A;  4XUT A;  4OZO A;  3T09 A;  3MUY 1;  5G04 L;  1GNY A;  4LKS A;  1JU4 A;  1K3I A;  4W50 A;  4DUW A;  3K4Z A;  4DEQ A;  2WN2 A;  2VM9 A;  2WO3 A;  1GUI A;  3SKJ E;  4BJ0 A;  4DUX A;  1GOF A;  2KD7 A;  2VL4 A;  1GU3 A;  2W46 A;  2VQT A;  3A22 A;  3D3A A;  4QDS A;  1UY1 A;  3K46 A;  3WNK A;  4XUN A;  4A44 A;  4ZXE A;  2DCJ A;  3NJV A;  4LHS A;  4A6O A;  3LEI A;  1JYX A;  2WAB A;  2J1V A;  3IDA A;  4P08 A;  1UY3 A;  2EIC A;  3T2P A;  5JXG A;  3WF1 A;  3OG2 A;  3ACI A;  4BK5 A;  2X05 A;  4PT6 A;  4JKK A;  2CDP A;  2WO2 A;  3U37 A;  2WAO A;  1O59 A;  2E33 A;  4QDR A;  2YG0 A;  4CU6 A;  2YB7 A;  2X10 A;  3VDC A;  3GGL A;  3HJR A;  3MO4 A;  2ORX A;  3T08 A;  3OGV A;  3THD A;  2JKX A;  4KWU A;  2QQK A;  5IJR A;  3J7H A;  2W87 A;  5FUI A;  3IAQ A;  1EUU A;  1NAE A;  2QQL A;  1XPW A;  2J1A A;  2Y6H A;  4DXR A;  4QB6 A;  2VC9 A;  2VZT A;  1F4H A;  2VO5 A;  2W47 A;  1J83 A;  3C8X A;  3C7G A;  1K12 A;  1PMJ X;  4LPL A;  4FI9 A;  5G05 L;  2J22 A;  4ZZ5 A;  5CYY A;  5EJZ B;  2XQX A;  3I2F A;  4QX2 A;  1JZ5 A;  3VD7 A;  4BK4 A;  4JX0 A;  1UYY A;  5B4N A;  5I0D A;  3HEI A;  3WNN A;  3WNP A;  3UNP A;  4QAW A;  2WUH A;  2Y8K A;  3WF3 A;  5JUV A;  1GQP A;  1CIY A;  4CUC A;  1T2X A;  3I3D A;  2DDU A;  1W8O A;  4MGQ A;  1W9W A;  3ECQ A;  2RVA A;  3OBA A;  2VME A;  1SG3 A;  1L7Q A;  3VD5 A;  4CU9 A;  4M4R A;  3DYO A;  2ID4 A;  3BGA A;  1DYO A;  2C4X A;  1DP0 A;  4AG4 A;  4AAX A;  1O8P A;  3HNM A;  5C7G A;  2RV9 A;  4W8J A;  2W94 A;  1PX3 A;  1NUK A;  4A41 A;  1HN1 A;  2Y64 A;  2W1W A;  4OMD A;  3HNY M;  3VDB A;  1GOG A;  3VD4 A;  4OMC A;  3ACF A;  2PQS A;  3I3B A;  2W1Q A;  2EIB A;  4IUG A;  2ZEX A;  2L9L A;  2WO1 A;  3MV1 1;  2HYX A;  3WF0 A;  2OKX A;  3CDZ B;  3A21 A;  4XUR A;  2YC4 A;  3MUZ 1;  4CU8 A;  3GXU A;  3WF4 A;  3I2H A;  3WNM A;  2B4K A;  4QB2 A;  3WF2 A;  3ZM8 A;  4ZY9 A;  2QQM A;  5DN2 A;  2EIE A;  5C71 A;  3LEK A;  2E31 A;  2WBK A;  1JZ7 A;  3HPN A;  2HLE A;  1UX7 A;  1OF4 A;  3C7H A;  2VCA A;  3CZU A;  4PQQ A;  2C26 A;  2BBA A;  2XON A;  3WEZ A;  2W3J A;  1OF3 A;  2ZXQ A;  3I2I A;  4XZU G;  1LNS A;  4GZ9 A;  3HOB A;  2J1U A;  1NX9 A;  1EUT A;  4UI9 L;  1JYN A;  1PMH X;  1IQD C;  4DEV A;  2V5D A;  3K75 B;  3LE0 A;  1UZ0 A;  2X09 A;  3III A;  4A45 A;  2ZEZ A;  3OEB A;  2VTF A;  4QX0 A;  1JZ2 A;  1GOH A;  1D7P M;  3ETP A;  2QQN A;  4XVH A;  1W99 A;  3DEC A;  1US2 A;  2V4V A;  3BN6 A;  3P1I A;  1JI6 A;  4BXS V;  3EYP A;  3T0A A;  1JZ8 A;  5JXH A;  3W5N A;  2Z4F A;  1JHJ A;  3K77 A;  3GM8 A;  1I5P A;  1W0N A;  4P00 B;  3EB7 A;  3T2Q A;  3ACG A;  1KEX A;  3P6B A;  1WKY A;  2W5F A;  3K4D A;  1UMH A;  2WDB A;  3PUH A;  2WZE A;  3C7O A;  2J7M A;  4P5Y A;  4Z2A A;  5C70 A;  4QX1 A;  2E26 A;  2VMF A;  3A7Q A;  3FN9 A;  4CUA A;  1TG7 A;  1OT5 A;  3T2O A;  2ZEY A;  1W9T A;  4LQR A;  2BGO A;  4MOA A;  4QPW A;  3W5M A;  4XUP A;  2VZV A;  2QBX A;  2VZP A;  3A23 A;  2WQ8 A;  3JXS A;  4CU7 A;  2CDO A;  4JKL A;  4MGS A;  3SKV A;  1F4A A;  1UYZ A;  2WAA A;  4XUQ A;  4CUB A;  2WN3 A;  4KI5 M;  4KMQ A;  3WNO A;  2J1S A;  1JU3 A;  4QB1 A;  5IHR A;  1SHW B;  2DCK A;  5JMO A;  3T0D A;  3FL7 A;  3HN3 A;  4MAD A;  2YFZ A;  1UXX X;  2VZU A;  3OGS A;  1UMI A;  2VOT A;  2VQU A;  3UES A;  1US3 A;  3OB8 A;  2LS6 A;  2YC2 A;  5LA2 A;  5JXJ A;  3VDA A;  1UY2 A;  5HPO A;  3E1F 1;  2VR4 A;  1DLC A;  3NQH A;  1JZ4 A;  3DYM A;  1MPX A;  4ARY A;  4DXS A;  2C9K A;  4E8D A;  2Y6K A;  2V72 A;  1WCQ A;  2Y6G A;  2WZ8 A;  3LPF A;  1H6Y A;  3F2Z A;  4ET7 A;  4ZZ8 A;  5A1A A;  3I3E A;  1JYV A;  2JDA A;  5EIY B;  4JKM A;  4M4P A;  3WQB A;  3IAP A;  5CZK A;  5EJ1 B;  2VZR A;  4TTG A;  2WYS A;  2W1U A;  1ULO A;  1RYY A;  1UY0 A;  3WNL A;  2VMD A;  3CQO A;  2VZ3 A;  3I97 A;  1OD3 A;  5B4X A;  3ABZ A;  2E32 A;  3T0B A;  2RJ2 A;  5IFP A;  1JZ3 A;  4YPJ A;  2QQO A;  3CMG A;  4JHZ A;  2ORZ A;  3IB3 A;  2W1S A;  2Y6L A;  1XC6 A;  3I2J A;  1SDD B;  2JD9 A;  3LEG A;  5DMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...