2J1VA

Structure of a streptococcus pneumoniae fucose binding module in complex with the blood group h-trisaccharide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Carbohydrate-binding protein
total genus 39
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1vA00
1LNSA 2J1UA 1XPWA 2X05A 1UY4A 3SEEA 2VO5A 1UXZA 4W8JA 3HEIA 2EIEA 3OEBA 4BXSV 2WABA 5EJ1B 4QDRA 2B4KA 4A6OA 1XC6A 2VMDA 3WNKA 4ZZ8A 1OH4A 4JKMA 4M4RA 3HPNA 5C70A 2WAOA 2VZOA 4Z2AA 2VZTA 2EIDA 3P1IA 5B4XA 3VD4A 3NQHA 1CZSA 3T2PA 2W87A 1KEXA 2W46A 3A7QA 4GWJA 4GWIA 1ULOA 4GZ9A 4RN5A 2HLEA 1UY2A 4W4ZA 1JYXA 1H6YA 4JKKA 1OD3A 1JYNA 4OZOA 4PQQA 2WZEA 1F4AA 1L7RA 4PF1A 3I3BA 4A41A 4ZY9A 3UNPA 4OMCA 2DCJA 2W1WA 4QDQA 3BGAA 1GQPA 4RYDA 5JMOA 1W9SA 2X09A 3VDAA 5A1AA 5HPOA 2VQUA 4D0QA 3THCA 3NJVA 1W9WA 3EYPA 2V72A 2ZEYA 3GGLA 1PMJX 2W1UA 3GM8A 4XUQA 2CDPA 1CZTA 2ZXQA 4JX0A 3IB3A 1MPXA 3DYMA 2VZPA 2VCCA 1OF4A 5CYYA 4OUEA 3W5NA 1GU3A 1K45A 1T2XA 1NKGA 1XNAA 3ABZA 3NRUA 3I2JA 2KD7A 2E31A 3FHQA 4CUAA 4QAWA 2JKXA 3LPGA 1L7QA 1DYOA 2YG0A 4P02B 4A45A 1SDDB 2QQMA 4MO3M 2VM9A 2E33A 2ZEWA 5G05L 4P00B 2YFUA 5LA0A 4MGQA 3T08A 1W0NA 2BZDA 1SG3A 3VD9A 3C7EA 2VZ3A 3CZUA 3SKVA 3CZJA 2Y8KA 3WF3A 2VOTA 3THDA 4DUXA 3CKHA 3ETPA 3HNYM 1TVGA 4KWUA 3T2QA 3I3DA 1SHWB 2LS6A 2C4XA 3GDBA 3LE0A 4IUGA 4XUNA 4LKSA 1NAEA 3MUZ1 2W1SA 4XUOA 4BK4A 3CIHA 4UOJA 2JD9A 1CZVA 4ZXEA 4TTGA 2E32A 4MADA 2XHNA 5F7UA 3OB8A 2BERA 1EUUA 3BN6A 1UZ0A 1JYWA 1K12A 2WN2A 3D3AA 1UYYA 4M4PA 3WQBA 1K3IA 2VMEA 1UY3A 3WF0A 3K77A 3SKJE 4ARYA 3OBAA 3I2GA 1UMHA 1UY1A 4UAPA 2XOMA 3HNMA 2J1RA 3WF4A 3OEAA 2W91A 5C7GA 1D7PM 4YPJA 3LEKA 3IAPA 3DECA 3VDCA 3ACFA 2W47A 4DXTA 2DCKA 4W50A 4QB2A 2ZEXA 3CMGA 2VMCA 4CUBA 5JXIA 5FUIA 3LQCA 2QQKA 4UI9L 2QQOA 3VD3A 1XNTA 3SEPA 2W95A 4XUPA 1O8PA 4A4AA 2BGOA 3ECQA 3J7HA 2YFZA 4TXWA 1P8JA 3MO4A 3WF1A 1JZ7A 4A44A 1US2A 2WDBA 3C7OA 3AC0A 3HOBA 3T0BA 5JUVA 4LQRA 4ARXA 4DUWA 5IYYA 2C26A 2VZRA 1I5PA 3E1F1 3WEZA 1YQ2A 1JZ3A 5CZKA 1R64A 5JR2A 3U37A 3OGVA 1JZ4A 2Y64A 3WNLA 4P08A 4DEQA 3K75B 5LCWL 3CQOA 1JZ5A 2VL4A 3I97A 3EB7A 2EIBA 2J1AA 2WUHA 4QX2A 2WYSA 2VJXA 5G04L 4BJ0A 1JZ8A 1F4HA 1BHGA 3F2ZA 3K4AA 5IFTA 2WZ8A 2RVAA 1TG7A 3ACHA 3OGSA 5JXHA 3LEIA 3W5MA 2DDUA 2J1EA 3K46A 5EJZB 4XUTA 1O59A 2QQLA 4A42A 2XQXA 3IIIA 2WO3A 5IJRA 4CU7A 2BBAA 2OKXA 4QB1A 4AAXA 4OMDA 3WF2A 3IDAA 1PMHX 2J1TA 2W5FA 5IHRA 1ULPA 5B4NA 3ACGA 4A3ZA 3T09A 5IFPA 3IAQA 4BK5A 2VR4A 3VD7A 5HXMA 4CU6A 1UYZA 5DPNA 3A23A 4QB6A 1UXXX 4DEVA 2VQTA 3PUIA 2C9KA 4OYUA 1W9TA 4DXSA 3GXUA 3C7FA 4XVHA 3DYPA 4XURA 2ZEZA 2J1SA 2EICA 2V4VA 2J22A 4CU8A 1O8SA 4ET7A 3ZM8A 2RJ2A 1H6XA 1KGYA 5J1XA 2J7MA 3UETA 3FN9A 1CIYA 1UMIA 2X10A 3MUY1 2QQNA 3DYOA 1JYVA 3I2FA 3MV11 4DUVA 2YB7A 3UESA 2WO1A 1PX3A 1JU3A 1GMMA 5JXJA 3HNBM 1JI6A 3I2HA 2JE8A 2Y6JA 4D8MA 1PX4A 2WQ8A 5I0DA 3WNPA 5JXGA 1EUTA 1JU4A 2R7EB 4QX0A 2VZSA 4MOAA 4QPWA 1W99A 2B9VA 2RV9A 2VTFA 4LHSA 3FL7A 2Y6GA 2W9XA 3C8XA 3C7HA 2VCBA 1GOHA 4MGSA 3JXSA 4QX1A 2JDAA 1IQDC 2VC9A 2BGPA 4FI9A 1JZ6A 3K4DA 2VZVA 2XONA 1GNYA 4QDSA 1NX9A 2Y6HA 2L9LA 3NNGA 3PUHA 5DQ0A 1OT5A 1WKYA 4KMQA 1J84A 2W1QA 4JHZA 3NJXA 3ACIA 4L0PA 2QQJA 3I2KA 3A22A 2V5DA 2WO2A 3I2IA 3MBWA 1K42A 3T0AA 1UWWA 2QBXA 1GOGA 2CDOA 3VD5A 3WNOA 4E8DA 2WAAA 2LW8A 1GOFA 4ZZ5A 4KI5M 5LA1A 3FHAA 2QQIA 1WCQA 3WNNA 1US3A 1JHJA 4XZUG 2Z4FA 1NUKA 4CVUA 3A21A 1W8NA 2W92A 2W3JA 3WSOA 1CX1A 1J83A 4JKLA 5LA2A 1W8OA 3C7GA 3OG2A 3HN3A 2WN3A 1UY0A 2Y6KA 3LPFA 5C71A 2HYXA 2VCAA 3CDZB 3OGRA 4LPLA 1UYXA 3T0DA 1OF3A 4HG6B 5DN2A 4CU9A 3K4ZA 2WBKA 4P5YA 2VZQA 5DMYA 2W94A 1UX7A 1HN1A 4CUCA 2PQSA 3LEGA 2ORXA 4AG4A 1DP0A 4QX3A 1GUIA 4E8CA 2VMFA 1RYYA 3T2OA 5EIYB 1DLCA 2ORZA 3HJRA 2Y6LA 2VZUA 4BDVB 2YC4A 3VDBA 4DXRA 1JZ2A 2YC2A 2ID4A 3P6BA 2VZ1A 2E26A 4PT6A 2J1VA 3WNMA 3I3EA 3MV01
chains in the Genus database with same CATH superfamily
2D43A 2R0FA 3K2OA 3ENRA 1LNSA 1SDWA 1UZYA 5EJ3A 5FJKA 1ULDA 2WJSA 1W0OA 4CEYA 2O8QA 3LDBA 1W39A 2VVFA 3R4SA 4N9IA 1PO11 4O7XA 1KS5A 3VV1A 5FO9B 2OUHA 1UW8A 4BXSV 2YU2A 3WNXA 5A33B 4Q4W1 4ZS3A 1NE6A 1SBDA 2LALA 2WABA 2IXCA 3KB5A 4GMP1 4A7YA 4OQ8A 1W8TA 4HETA 3J8F3 2D3RA 2Y6FA 2UYAA 4HSJA 1ZBE1 3QH6A 5FOJB 5KHIA 5HI0A 3HN1A 1STMA 3AZXA 1RUH3 4QPGA 5IUQA 3WNKA 1EAH2 1PK6B 2OT7A 4JKMA 2WNVA 4M4RA 3HPNA 2WAOA 3LF7A 1AYM2 3WP6A 4Z2AA 5CU1A 1VBA1 2AC1A 2D6LX 2EIDA 5FYCA 1H9PA 4UF0A 4AVVA 2ZHLA 3DXUA 3WP5A 3NQHA 4BZ4A 4AGRA 4R9DA 1B35A 3H50A 3T2PA 3NJYA 4S2HA 1ULOA 2OQ7A 3UJQA 5D8AC 1EV13 2O14A 4DZGA 5A3MA 5EWSA 1GP4A 1Q8PA 1XYPA 4JVAA 3GZUC 3DF0A 3KQRA 4A7KA 1JYNA 2G9FA 4CE8A 3I3BA 4S2DA 3F95A 4Y1XA 1UQXA 1VRH2 3SMHA 4IXLA 5E6HA 1H8TB 4V2VA 1OA2A 2XQRA 3JBG3 2IXIA 1GQPA 1QDOA 1DIWA 5A1AA 4HANA 3KF5A 1C8M3 2OX0A 5AFBA 5HPOA 5GM0A 2VQUA 2ZA9A 4LA2A 4B1MA 1BQPA 3KSCA 4Y20A 1JYCA 1GV9A 1W9WA 1S0JA 2X5IC 4BPZA 3LDRA 4DIQA 1OD5A 2D6MA 1AL22 5SV8A 1Z7S3 3ZYGA 1MQTA 3GNEA 1UMZA 1WW4A 1I1EA 1OVPA 1IS4A 2HWD3 4NHXA 2ZACA 3DV8A 1RUF1 2YBPA 3HIFA 4JX0A 2ZAHA 3NWKA 1MVQA 3NVCA 2AEYA 1U5YA 1J59A 1BKZA 4H3WA 2VBPA 4GQ7A 5C3PA 2FD8A 1OC1A 1W90A 1NG0A 1X9TA 4ZPIA 5CEHA 1K45A 1NKGA 2WNEA 1VPHA 1XU2A 5GLTA 5IVEA 2RM23 1QU0A 2E31A 1AXZA 4KG0A 1OQDA 1QIQA 4CUAA 1FOD2 1XNBA 2JKXA 2X53S 4AGVA 3LPGA 5A6XA 1DYOA 1YQCA 1T6BX 4QPIB 1JMUB 4XFFA 3VBRC 5EFUA 4QQPA 2FMDA 3RMYA 4BIOA 2XJQA 1XE8A 5E1RA 4KG8A 1QH7A 5FZIA 4MGZE 2YGLA 1ND3C 4DINB 4CEYC 1J3RA 1WLDA 4KNCA 1NE4A 2YFUA 4DO0A 3AYDA 2A6WA 5LA0A 4OHWA 2D6KA 1LULA 5A33A 1XRUA 3FJSA 4OVEA 3WZ1A 2H6CA 4P9GA 1W2NA 1REDA 3J8F1 4NOTA 5A6QA 1UF2C 3JD72 2OZ6A 1BJQA 5EXOA 2DUOA 2VPVA 2ET1A 1ASJ3 4XFGA 4QPGC 2PAEA 2YY1A 1RUG3 1RUH1 1SZBA 2XJVA 1GSLA 5FXWA 1G9FA 4LOTA 2ENRA 2QFEA 4YGBA 1EY2A 5CFCC 3NV2A 2EALA 2RS32 2ZAAA 3RZKA 4GB33 3HNYM 1TVGA 4KWUA 3PMSA 1COV2 3LE0A 3MI8A 5ANQA 3ZOIA 1PVC3 3NSTA 4XPVA 2W1SA 4QPYA 4XUOA 3VKOA 3CIHA 4LUMA 4XFHA 1EV11 1R1A3 3BI3A 1CZVA 2QVSB 4LBMA 4AEDB 2HWF3 4ISRA 5F6KA 3U4SA 1HRI2 3VBUB 1W2UA 1WUVA 5BNOB 1S4CA 2BNOA 2E32A 3OGJA 5F7UA 4RGGA 4AHXA 2GALA 4PLMA 4XMIA 1ZRRA 1EUUA 2BERA 2QE3A 3KD4A 2G1MA 1H8TA 3PIGA 2EVXA 4FFGA 4JV4A 5K0UB 3D3AA 1MVEA 3FX3A 3JBG1 1K3IA 3JQXA 3POFA 4CP9B 1C8M1 5DZFA 2ZGKA 2OYZA 1UY3A 1POV0 4ARYA 4LE3A 1W0PA 2VTXJ 1PZ7A 2IXKA 4OHVA 4AHYA 4DRVA 3E5QA 2XVKA 2IXJA 5CVRA 4I30A 2G19A 3HQRA 4CA9A 1PO22 2XOMA 4F3JA 4X6RB 5HV0A 1Z7S1 4JDMA 2XJPA 2OIIA 2W91A 4QXKA 1UPIA 2D44A 2HWD1 3VDDC 4LE4A 4YPJA 4FSJA 4XDOA 1ZBA2 2JICA 3LB9A 5FY5A 4LO7A 3ALQA 4HBNA 1QKQA 5F3GA 1DQ4A 1GZ9A 1UKRA 5ANNA 1DGRA 4MXVA 2GC2A 2UY9A 3UKTA 3N9MA 1I9RA 4QB2A 3SNMA 4LBQD 2RM21 3WG3A 4IEXA 1Y9QA 1HJFA 4L11A 4FPGA 1O4ZA 1KXGA 3QD6A 2I45A 4UI9L 2QQOA 2R042 1N1VA 2QNKA 1J58A 5FZMA 4LK6A 2YDEA 4Q4Y2 3SITA 1XNTA 4XUPA 1UOJA 3I7DA 2DVBA 1PGW1 1ULGA 1S0IA 1PIV3 4JGZC 3ECQA 1FV2A 2SLIA 2VTXA 2YMZA 3CBNA 1HX6A 1XNCA 3VGIA 4TXWA 3MO4A 4HVOA 4JDNA 5I8SA 3WF1A 4META 2Y0OA 3C7OA 5A3TA 3LGRA 1JH5A 4HKLA 5JR7B 1DGRN 1A8MA 4I0BA 1Q8OA 3CEWA 5KXEA 3E1F1 1I5PA 1UN1A 3OBTA 2ZHNA 4UWDA 1ASJ1 1PK6C 5CZKA 4BCUA 4BHPA 1RUG1 4P14A 5FAXA 3VKLA 2P3JA 3FMGA 4CEWB 1VAMA 1JZ4A 1B09A 1LHWA 2Y64A 5FZ4A 3WNLA 2IUWA 4AK3A 4GB31 1LECA 3RQ0A 3EO6A 3L9JT 1DCSA 1RVF2 3VBHC 2PHXA 4V2WA 2Y26A 1QHDA 1RJ8A 4NHLA 3LOIA 1H9WA 3LSDA 1PVC1 3GCWA 3QBQA 5JMCA 1WLWA 1X7NA 1A78A 1WZXA 2WUHA 3AZZA 5T3NA 5G04L 4PDWC 4AEDA 3R4DB 3NW4A 4BJ0A 1R1A1 3VBUA 2IXHA 2HWF1 1N1SA 1BHGA 1QQP2 3F2ZA 3K4AA 1DGLA 5BNOA 1FX5A 2HWE3 1BK1A 3MW3A 3D0SA 4NRMA 1QOOA 4Q5OA 3ZYFA 1CESA 1MZ6A 1LHUA 3FZ3A 4KU7A 2HJIA 3LEIA 4IW3A 1WGPA 1ZYBA 3MIFA 5K0UA 1HDKA 2J1EA 1ZZBA 3GBGA 4P9XA 4PJYA 3AX4A 1BEV2 2PHWA 1V00A 3ZYIB 1E5RA 4R52A 5EJZB 3J4UH 4Q8LA 2RS12 4MHRA 1H4GA 2XQXA 2DBNA 3NNLA 2PHRA 1RB8G 4CU7A 2BBAA 5L7OA 3FLTA 4UFJA 1HQNA 2R073 5F2WA 1PVXA 4Y24A 4C1XA 5C4WC 1FNZA 4AAXA 3O0XA 5H9SA 1HQWA 1TEIA 1OPOA 2A6XA 1D0HA 4FCAA 5T54A 1RINA 4FPKA 4LBKA 5B4NA 3NNMA 2TEPA 4NHKA 4HLTA 2Q4SA 3AP7A 4BK5A 5KHJA 1AX2A 5FMDA 4PIZA 2ZGRA 3B69A 4QB6A 3AMPA 4YYOA 4QPIC 2VQTA 1OFSA 3LA7A 5AC93 1SFYA 4NUBA 1OLQA 2QUOA 2BTVC 4YW3A 3ZSKA 5FYZA 3HMYA 5FXVA 2RDRA 4I01A 3C2UA 1FPN2 1NA1C 1PIV1 2DTYA 2XKPA 3D4KA 1O8SA 2IWGB 3N7LA 4K21A 5KHKA 4MX3A 4AWDA 3PHMA 4IERA 4NPRA 3ELNA 3RNSA 1VBE3 3UETA 3OSDA 1CIYA 1RGSA 1KDKA 3ILRA 3AJZA 5FQ0A 4QXBA 3RYKA 3ZR6A 5E88A 4EN0A 4NIIA 3MUY1 2QQNA 1ND2B 1S55A 3I59B 1IPJA 2D5HA 4LORA 2JB8A 2RDSA 4CEWA 5CNAA 4DUVA 5C8WA 3UESA 1Q56A 2FDIA 4D7YA 1O3QA 4H55A 4W6XA 5EZWA 3MIHA 4RR3B 3MPBA 4Z8BA 5L9VA 1LEDA 1QJU3 1JU3A 1ZZ8A 1GMMA 2OUJA 2CAUA 1ZRFA 1RUD3 5FUPA 3I4IA 3AXDA 3PUAA 3HNBM 3I2HA 2JE8A 4AEDC 2JX9A 1PX4A 2WQ8A 5DZEA 3WNPA 3MHZA 4PI2A 4RFRB 2DU1A 2DVGA 2Z2SB 4R9BA 2R7EB 4HL0A 2YYOA 3SHRA 4INDA 2HWE1 2K2SA 1ACCA 1LGNA 4QPWA 4UFLA 2RV9A 2QJVA 4G3YC 4LHSA 3GZAA 5T55A 4MHUA 1MZEA 2Y6GA 4IL7A 1H2LA 1S0BA 5F5AA 3SCGA 1CJPA 1YUDA 3RMXA 1CD3G 5CBLA 5J36A 1AX0A 4HXCA 2A6VA 2AEZA 2A5ZA 1RMU3 3JXSA 1ULFA 2OQ6A 3N9PA 5DDJ2 1ZREA 4CDUB 2VC9A 4K6BA 4COWA 3WX5A 4GMP0 4L99A 4FP2A 5BNPB 4U2AA 4S2GA 1QJZA 2VZVA 2LM3A 2R071 5FPVA 5A7NA 3WQ1A 2L9LA 4FPOB 1RITA 3O1MA 4Q1RA 5DUUA 3HQXA 1WKYA 3Q8FA 5FYTA 4FXGB 1BMV1 2W1QA 3NJXA 1VLNA 4AVTA 3ACIA 1DU3D 2ADDA 5B2GB 5CISA 3A22A 5IVCA 4YM3A 2V5DA 4R9CA 1MEC2 4C90A 1MS5A 1S0DA 1Y43B 4HVQA 1Y9MA 4QWNA 1J1LA 1GOGA 4UFKA 2CDOA 4OHXA 3AL5A 1V6OA 2GN3A 2Q8OA 5LY2A 3NAPB 3AMQA 3WNOA 4DQAA 2A3YA 4PLNA 3BPZA 4XEZA 2WAAA 2LW8A 1GP5A 1GOFA 4QQHA 3WP3A 3ZIXA 4DFSA 1FATA 2P4EA 5AC91 2QQIA 1QJX2 3PNAA 4FQZA 4TWTA 1CONA 3ST7A 3VKFC 3RYPA 3G7DA 4CVUA 4ZU7A 3VBOC 4LIVA 5KC5A 2W92A 3GJBA 1SCSA 1VBE1 1W6PB 4R8HA 2Q1MA 1VBC3 1UAIA 3PVNA 3NL1A 3S7EA 3V64A 2NMNA 3MZHA 1ND2A 3ZYRA 3I59A 4KBBA 4HVRA 5ISLA 4UYBA 2H0VA 4AGGA 1JBCA 1QJY3 3VZKA 4CEWC 1WCSA 5E16A 2VCAA 4LPLA 1VRH3 3HWJA 3AMNA 2GAUA 1OF3A 3AVRA 1AR63 5DN2A 1ONAA 4K1ZA 2XMLA 2FBEA 3EJKA 4RR3A 3T4VA 3ZFGA 2VOVA 1UOFA 2WBKA 5F32A 4P5YA 1QJU1 5DMYA 2EF6A 2A6ZA 1S2BA 4GH4B 4LXLA 4Q0SA 1RUD1 4B4QA 4AQSA 1W3XA 4P9IA 4AFDA 4CUGA 2X8KA 1DP0A 4QX3A 2Q8DA 2G9GA 2DCZA 2A1XA 5A70A 1IG3A 4YFZA 5IVYA 3THTA 4NWWA 1WBFA 3DKWA 2WS93 2XVGA 3WDVA 4CP1A 1CAUB 2VBDA 4O9GA 3HBZA 3W9AA 3VLBB 4ASMB 2E63A 1DLCA 2EXJA 2UU8A 5FZ0A 2ZKLA 3TNQA 2IFWA 4QKFA 3K48A 2WR9A 5FP7A 5IWFA 2XVLA 4A6SA 4P9WA 5D2AA 3EMRA 1MZ5A 2E26A 2JD4A 2KXLA 1OMIA 2J1VA 1QF3A 3M3IA 4PT6A 1VB2A 4YW7A 3WDYA 3H1WA 4D6SA 4D94A 5C8CB 4Y26A 3V0AA 3AK0A 3FUOA 1SLIA 2J1UA 1T6GC 1GWLA 1XPWA 1AVBA 2UWCA 1RMU1 2C0ZA 1CAXB 4CDUA 3I3MA 2QTWB 4WZCA 4CCOA 2X05A 1FOD3 4IEOA 1UXZA 5BNPA 1NY72 4W8JA 1KRIA 2VNRA 2VY0A 2W08A 3MIDA 5A3WA 1SPPB 5EJ1B 4EJRA 4QDRA 2B4KA 4M00A 5EYXA 5ACA3 3ES4A 1IS5A 3AM2A 4HONA 5L36A 5FCCA 3NNFA 2FZ2A 4C0BA 1OH4A 4QQ2A 4H7LA 3UGGA 3POJA 2C9AA 2QQUA 3IPVB 3Q8CA 4O65A 3AKQA 2JG9A 3ITQA 4CCDA 1TME3 5A6ZA 2G4IA 4Q4X3 3BPSA 2WA4A 3NAPA 3WW4A 5ABJA 2OA2A 3WDXA 4JHTA 3ZN4A 4ONUA 2W46A 4LLFA 4QHZA 5FYIA 3U1XA 4RN5A 4BMBA 1NXMA 1UX6A 3M70A 4HKWA 4I0AA 5DAQA 4N53C 1SLAA 1O6UA 1UY2A 2ZCWA 4W4ZA 1G9DA 3E6CC 1JYXA 4WM8C 3H0OA 4LBQB 1OD3A 4QT6A 3VBRB 1COV3 4D7TA 4ES8A 4PF1A 5FTTC 4OUSA 3J7NA 3TAYA 4AFMA 4ZY9A 3THPA 1YXWA 3KT1A 2HH9A 4LOSA 4XBQA 1F9KA 1ND3B 1W6PA 4ASLA 2OZJA 2W1WA 4QDQA 3M2MA 1VBC1 2QCSB 3ZDVA 2LROA 4RYDA 4CCMA 1OI6A 2X09A 5LWBA 3VDAA 1ND2C 4C0HA 1CJDA 5A7WA 5LW9A 5FK8A 3AKPA 4C8DA 4D0QA 3ZSJA 1QJY1 1PGSA 1NOVA 1VRH1 3MFCA 1UU4A 2ZEYA 3TNPB 1AR61 2VUJA 2CTVA 2A75A 2QDRA 5IK4A 5CFCB 4GH4A 3ROUA 1JOBA 1MPXA 1W3VA 3CO2A 4MZUA 4YW1A 1CAUA 2WS91 5DUVA 2WWJA 5F2SA 1GU3A 2RG4A 2DVFA 3AP9A 5JZGB 1OUSA 3NRUA 5T5OA 1NCQC 2FCTA 2VOKA 1R093 4IEQA 2NPIA 4XIKA 1POQA 1ENQA 5FREA 1VBD3 4COVA 2DFBA 4MO3M 2VM9A 3GHNA 4XF0A 1CAVB 4K9SA 4E2SA 1HRV3 1V9U2 2OPWA 4XHBA 2AZ5A 2VUCA 5AVAA 5LBBA 3ZKYA 1CAXA 1WMEA 2R062 1TNFA 4LNVA 4YZ4A 3OPWA 1YFWA 1FOD1 2WRAA 3PU8A 1OQ1A 1RUJ2 2XLGA 1SPPA 3POEA 4MGQA 2PHUA 4XF9A 1W0NA 3MW2A 1RXFA 4LHNA 5IW0A 1DQ2A 5ACA1 5EV7A 2QQPA 3UV9A 3WW2A 1BCXA 4Y1YA 1AR72 1AR93 1SG3A 3TOJA 3H3UA 3RG0A 4DNYA 3CZUA 3VDDB 4SLIA 3RWNA 3SKVA 3WF3A 2DUQA 2VOTA 2CSGA 5H9QA 1RUE2 3SH3A 3VHPA 3CHXA 3IPVA 4YZ3A 3T4HB 1YFYA 3CKHA 4QQLA 4CXWA 1Q8VA 4FO9A 1TME1 1SHWB 3AMMA 4XUNA 3NAPC 4Q4X1 1QJEA 3FFZA 4QGLA 3OJBA 4AHWA 3MUZ1 1AYN3 3R0RA 4L97A 5LRSA 4Z07A 5A6YA 4P5HA 4XYXA 4UOJA 4E2GA 4FFFA 2MHFA 2JDUA 2Y60A 3MF9A 1SLBA 4LBQA 3VBRA 2PHDA 2HKXA 3WW3A 2GH8A 2ZZJA 1RHI3 1IKQA 1RVF3 1COV1 2UURA 4N7UA 2PFWA 2ZHKA 4AQ2A 4CYDA 3BTXA 1VMFA 2JG8C 2PLV2 2XHNA 3LA3A 3OB8A 4I02A 4JGZB 5FY9A 1ND3A 4I0WB 4B7KA 2ARCA 4R4XA 2WN2A 4RGKA 3X29B 4X6QB 4HN0A 1QQP3 1VIWB 1ZNPA 3IZOA 5GZDA 2K0GA 4QXHA 4Q26A 3ON7A 3WF0A 4FAHA 3I2OA 3HT2A 4A2UA 2YROA 3ZMOA 2F4LA 4IETA 3LSEA 3SQOA 2HWC2 5IVJA 1UMHA 3N7KA 2R16A 4UAPA 4IE5A 1NXD1 3PVOA 1OQEA 1VBB3 1OFNA 2DFCA 2XBO3 3HNMA 4YW5A 3WF4A 5CFCA 4DXZA 1UYPA 1U5XA 4GH4C 2CGNA 1U5ZA 2RHPA 4O9EA 1IHMA 1NLSA 1D7PM 2PTMA 1QXRA 5F39A 3VBHB 3S5QA 3DKQA 3KZ4C 2R30A 5FMBA 3VDCA 4CDXB 1V6KA 4BM8A 4P9LA 1YLLA 2DF7A 5JZGA 4ZHNA 4PDWB 5KHGA 1XOYA 3PU3A 2ZEXA 3RZHA 3LEMA 4YVWC 2I2SA 4CUBA 4QX5A 1R091 3A4UA 2QQKA 1N1TA 1VBD1 1O5LA 3CU7A 5C8CC 1CAVA 2DU0A 5FZ7A 1HRV1 2XG3A 2CGOA 1VR3A 4Y1UA 3KV5A 1W9FA 4MGIE 4EN8B 4GALA 1JZ7A 3FUQA 1US2A 1VALA 4JQTA 5DUXA 3AC0A 3USSA 4KGGA 4FBFA 3TN93 4BH9A 1Q43A 1LEMA 4ARXA 1XSRA 3ZLIA 5IYYA 1F35A 2C26A 3U14A 3QACA 5FWEA 3ASIA 1QGLA 2QZ2A 3H9AA 5FZLA 5A3NA 3BIEA 1AR91 5C4WB 1VP6A 3KV9A 3VDDA 3TEWA 4OLLA 3VKNA 4N43C 3NMBA 5AVPA 3U37A 4LULA 3OGVA 5KR7A 3MGUA 2FMYA 4EWAA 2ZTNA 2VOWA 3ACLA 2XL9A 3INAA 3C3VA 2VW1A 1OLRA 3TWIA 3DUIA 2ARAA 1DZQA 2P3KA 1JOPA 1HB4A 1AYN1 2J1AA 3I54A 4RHV2 3ORJA 5KBFA 1N47A 5F6LB 5FK7A 1JZ8A 2D3PA 1F4HA 1W6OA 1N3OA 2VAUA 4Y22B 1FMD2 1RHI1 1RVF1 2YUEA 2Z69A 4F7ZA 2UYBA 1V6JA 2VQ0A 4JGZA 4BQ1A 1TG7A 3ACHA 3B02A 1NA1B 3OGSA 3I3QA 1S0EA 3SH4A 2B39A 2VE1A 4JRLA 2MNGA 5FZBA 2FDGA 4QD2A 1BXHA 2DDUA 4LUKA 3DGTA 4GWMA 4XQDA 5BXXA 3SXWA 2WKKA 3K46A 5C3RA 1QQP1 3WOGA 4AZZA 1K5JA 4LO6B 1HXS3 2QQLA 4AOCA 3WT3A 1BYHA 4QKDA 2WO3A 2BDRA 4K8RB 3U75A 1ZA4A 2SBAA 5GLVA 2Y34A 1UOBA 2D6NA 1PK6A 4YZ2A 3KGLA 1L3JA 3V56A 1PHMA 2OXBA 4LBJA 4Q4V2 1VBB1 4TSVA 3BUCA 2XBO1 2UWAA 2R1BA 3LKJA 5J48A 4QB1A 4O61A 4FTBA 2JECA 3WF2A 1MS4A 1UZWA 3VBHA 3ZXDA 4N8MA 3WCSA 2W5FA 5IHRA 1IS6A 4RQPC 3FWEA 5E89A 1SLCA 2RR13 3O12A 1DYPA 4YNIA 3V0BB 2Q5TA 2DCYA 2K9ZA 2YGMA 3UL2A 4HK9A 5CA6A 2VGDA 4PDWA 5JZGC 5HXMA 4CU6A 4Y4RA 2WA3A 3A23A 2HWB3 1R083 2D6OX 2Q1FA 3OUJA 3PDQA 3RZJA 5SV5A 3MLKA 4LEJA 2XHKA 3WDWA 4PIYA 3N7JA 5DAPA 4XABA 4FOYA 5KXDA 1WCKA 3AVSA 1V0AA 2ZEZA 1VAKA 2J1SA 2V4VA 2VVEA 2Z42A 4IEYA 4K8FA 2E51A 1X36A 5C3OA 2C6SA 4M3CF 1PO12 2CNAA 1CWPA 4DB5A 4FPJA 4KQ7A 5J1XA 2J7MA 1BBT3 3FN9A 4Q4W2 3TN91 3AL6A 1UMIA 2ETEA 1PGL1 2XJRA 4PCRA 4QU2A 2NQYA 4AVCA 1ZBE2 1QXJA 4R9AA 2WFF3 3LFIA 5C4WA 2JB4A 2XGXA 1QWRA 2WNOA 4FP3A 4BQ3A 3W21A 4DY3A 3N4MA 3I2FA 2ZX1A 3MV11 4QKBA 5BNNC 1Y4WA 1NZIA 2YB7A 4FOQA 4MXWB 2ZGOA 4AHZA 4IV3B 1VBA2 2AACA 4DPNA 3WV6A 3H8RA 1O7FA 4BISA 1F5FA 3CJXA 2ATFA 2BYVE 3VL9A 1IPKA 4YZ5A 2IVIB 3IM0A 4IEWA 3LIHA 4CDWB 4MVTA 5CG8A 1LODA 3KMHA 1JI6A 2XKOA 1RUI3 2XXZA 3POIA 4M3CE 2VXJA 4YW4A 2Y6JA 4QPIA 3WQ7A 2WWSA 3DEMA 3WVJA 1LR5A 5DUWA 1D2SA 1JU4A 2BNNA 4I09A 4Y22A 1XU1A 4XFIA 3LA2A 4XXAA 2R1DA 1YO8A 2ARXA 2BNMA 1DFQA 1NA1A 4QX0A 5LBFA 1W99A 4Q0VA 4COUA 3LZZA 4CRQA 4PQ9A 3S5AA 1LGCA 4NMIA 1DZRA 1LB2A 5KC6A 2W9XA 4CP2A 2Y33A 5HCBA 3VBOB 2VCBA 1WCUA 3OD0A 1I5ZA 1TMF2 4YG0A 1BVP1 4E4ZA 1X33A 3M3QA 1D4M2 4TLFA 4MGSA 3OUIA 1HXS1 5LEJA 1WD3A 1IQDC 1W2TA 4YRDA 3AKRA 4QU1A 1L7LA 4EQVA 2CGPA 2GC1A 1N3PA 4FI9A 1JZ6A 5F37A 5J3UA 5HCFA 2GP5A 3ZXLA 3K4DA 4RGAA 2HEYF 3J7MA 4XJ8A 2CAVA 3GALA 4OI4A 5FZOB 1NX9A 2ARBA 1KITA 1RUF2 1GBGA 3PUHA 3ZXAC 2GNMA 5H9PA 1OT5A 3IT8A 1W05A 4GD4A 2GNBA 4XCBA 5FPZA 1MS3A 5GLZA 4CDXC 2RR11 4HPKB 3V0BA 4R4ZA 1AUYA 1FYUA 5JIAA 4L0PA 4XZPA 2QQJA 1NLQA 2Y0IA 4LJHA 3N9NA 2VW0A 3I2IA 1K42A 3VBSB 5T52A 1W6MB 2HWB1 1R081 1UPSA 2GZWA 2ZOEB 5HCAA 4JGYB 2LUWA 3ZPOA 2WWUA 1W8FA 2BFUS 4FFIA 1W9YA 1UD1A 2KM2A 3IKWA 3RZMA 5FKCA 2WT2A 1E5IA 1RIRA 4ZZ5A 5LA1A 3FHAA 1WCQA 5FRAA 3ZN6B 2GMEA 4CP9A 1S0GA 5F9TA 4LO5B 5FLJA 1XE0A 3HAGA 5C9AB 1RXGA 2DCTA 1REFA 5IAVA 5IK7A 1X9PA 4IV1C 1NUKA 5CAZA 1H2KA 3OF1A 3A21A 4LR4A 4XAEA 1IOAA 1S0CA 3P3NA 4WVZA 1W8NA 1UZVA 2O8OA 1BBT1 2VG9A 3WSOA 3FC0A 3KLSA 1SMVA 4JKLA 5C3SA 5K7PA 5LA2A 3O1OA 2PYTA 3OG2A 4Q0PA 1CIWA 1AF9A 1PZ8A 2IFRA 5T5JA 4G4FA 1UY0A 2WFF1 4Y1ZA 3WG4A 2RMU3 3LPFA 1G6NA 4TYSA 3WCRA 1PZ9A 3IMMA 3OGRA 5HXVA 4MXWA 1UYXA 3ZSMA 3UYJA 5A3LA 3OY8B 1LOCA 3KF3A 4C1WA 5FYUA 1PM7A 4B4PA 3A0NA 4JC1A 4LIUA 1YRZA 4M01A 1QXPA 1X8MA 1F31A 4OCTA 2W94A 4CUCA 2PQSA 3LEGA 4AG4A 4LBNA 1RUI1 4XQWA 4E8CA 1EV12 1XB9A 1Z0HA 2VMFA 1RUC3 4K20A 3POYA 4WM7C 5FYBA 2FDKA 5LRRA 3D5OA 3T2OA 1KFXL 3MIGA 4N53B 2P2KA 3WDUA 2ADEA 3QCWA 2Y6LA 1X50A 4WM8B 4BDVB 2GSYA 5A7PA 3RI9A 3B3QE 4DXRA 1WWYA 2GC0A 3RJ2X 4GAZA 2A73B 2B8MA 2ID4A 2V09A 1LOAA 2ZABA 3VBOA 1F8VA 3JBG2 4CSWA 2VZ1A 3H7JA 3VBFB 1EPWA 3IDCB 3I3EA 3ZYPA 4OULA 1C8M2 1Y9GA 1OXCA 1KJRA 4SBVA 4AFAA 4OI0A 4HFSA 4ZKTB 3KM5A 1UY4A 4IEPA 3SEEA 2VO5A 3TB0A 1K5MB 3HEIA 4JRAA 2EIEA 3JB4C 5BY5A 4TN7A 5FR3A 2J42A 3MIEA 2WZR3 2AYHA 2HWD2 4NRQA 4A6OA 1XC6A 4AE2A 1CR7A 2GMMA 3ZR5A 2WIIB 1WA4A 4IDZA 2XR4A 2QZ3A 4HPKA 2VMDA 1POV3 4YM0A 1RUJ3 4MV2A 5FXXA 4BQXA 4YLZA 4GIQA 4LK7A 4YGCA 4COZA 2VZOA 1X8EA 4L9BA 2NLRA 2XUMA 3VBSA 3P1IA 4WVMB 1W6MA 5B4XA 3KVAA 2RM22 5LA9A 1DQ1A 4JGYA 3VD4A 3H3ZA 4PF5A 2AGSA 1H0BA 4JDOA 2W87A 1KEXA 1NCQB 3M4FA 4GZ9A 4GWIA 4PBOA 4PHZA 4Q0UA 4BQYA 2DV9A 1AR83 5FYVA 3ZN6A 4JAAA 4XACA 1PGW2 3FLRA 4KU8A 4J25A 1M06G 5C9AA 1E57A 4C91A 3ZYJB 4PQQA 4EV0A 3GF6A 1V6IA 4EWEA 3M3EA 2WZEA 1F4AA 1WMDA 1WMFA 4A41A 3UNPA 1R1ZA 5H9RA 5IVVA 2DCJA 1D4VB 3HVDA 4I2OA 3MLLA 3BGAA 3L2HA 4HK8A 2RJKA 1OHFA 1ASJ2 2RMU1 1G9BA 4D6RA 1RUG2 3J7LA 3NJVA 3OY8A 4IV3C 4WZFA 1HW5A 3RGBA 2AR6A 4QM8A 4GB32 2CWSA 4IGPA 3GBFA 1IKPA 2FDHA 1W2AX 5A3UA 3ZFEC 5JOZA 5GZEA 4NIAA 1RTVA 2JDPA 3BKZA 4CDWC 1VB4A 1DG6A 1QDCA 2CDPA 2D93A 1RJ7A 1AJOA 1PVC2 5A3OA 2ZXQA 3AKSA 5C5UA 2XPJA 3IB3A 2WO7A 2CHHA 3DYMA 3VHNA 1EAH3 1YI7A 2EIGA 2VCCA 1R1A2 1RUC1 3TRSB 2D6PA 5GKAC 2NP0A 5CYYA 1GYKA 1AYM3 2JJ6A 4OUEA 4N53A 4IGQA 1CGPA 4MLOA 3AZYA 4NE9A 1IGOA 4WM8A 2PQQA 4UFIA 4RD7A 1UOGA 3I2JA 2HYKA 3FHQA 4UXAA 1H2MA 1KD7A 2VUAA 4L8QA 2RDQA 3RJRA 4JZRA 2RS52 4B3NA 4HSLA 1HB1A 1HIXA 1SBFA 2JG8B 2VNVA 3AYEA 2HBUA 1V6NA 2QQMA 5FZGA 4A45A 1C5IA 3B94A 4LITA 5A7SA 2ZEWA 5G05L 4ITCA 4BYYA 1G9CA 2XJUA 2WNUB 1M4WA 4NHMA 4EN9B 4AF9A 3IMNA 1K5MA 1LOFC 1U0AA 5HCHA 3ZXKA 5FDBA 5LEKA 4FQ4A 4OZXA 3BTYA 2WZR1 2FHRA 4RL7A 4YGEA 1W03A 4ORFA 1CVNA 2HEVF 1SQ4A 3CZJA 1RUJ1 2Y8KA 2BWCA 4XETA 4NAMA 3N9LA 5FZ3A 1J3PA 2Q8CA 3THDA 3U78A 3VBSC 4WVMA 1AL23 3T2QA 4DRRA 3I3DA 2LS6A 4JGYC 1QNWA 2C4XA 5FYHA 1LGBA 1Q8SA 4AFCA 2XL7A 4LKSA 4BQ4A 1NCQA 5DXDA 4XIOA 4YVWB 2JD9A 1AR81 2D97A 5A32B 3CL1A 3GZEA 5M0TA 1EP0A 4W6YA 2BOIA 3TEZA 4ZXEA 1PGL2 1PM4A 2Q1ZB 5LBCA 4BOWA 3D8CA 5KHHA 3TYJA 4TTGA 4MADA 5EPAA 2ZS6B 2XLAA 4K40A 3KVBA 4QKNA 5FYYA 5FP3A 1UZ0A 2Z79A 4JCKA 3PVBB 1K12A 4LLOA 2LRPA 5A80A 1UYYA 4M4PA 3WQBA 4WBBA 2WSVA 5LZ6A 2C5DA 4M3CB 1IQAA 3B9IA 1YQ8A 1W8ZA 5FP8A 4NIHA 1C4RA 3K77A 3SKJE 1H1IA 4YZ1A 1E5HA 3H1YA 3OBAA 3ZX7A 4BE3A 2VECA 3I2GA 1ZM1A 2JKBA 1NCRB 3VL8A 1OA4A 2VD7A 4CCNA 5DAXA 4N43B 3K3NA 2OPKA 3OEAA 4LTAA 4P9YA 4EN6B 4FFHA 3JD73 3EXUA 2EXHA 4NPLA 3T1MA 3LEKA 1JS9A 3LDKA 2F4PA 3IAPA 3WW1A 2B9UA 1EAH1 4FPYA 4IE6A 4RA0A 1DGWA 3LIGA 2B45X 2W47A 3WD5A 2UWBA 1AYM1 5E8AA 1ENRA 2AENA 2RS33 5F1RA 3RVHA 4Z1VA 1XNKA 2HWE2 3DL3A 5FYMA 3JUUA 2DCKA 4W50A 4NVPA 3CMGA 4AR2A 2ZMNA 1LKNA 1C5HA 3B93A 1Q3EA 4FOVA 2JG8A 5FUIA 3LQCA 5F5CA 3VBFC 4EROA 3E97A 2JIGA 3I8TA 3RFRA 2WYFA 3OPZA 3FFQA 3SEPA 2W95A 2WNUA 1KS4A 2XWBB 1SLLA 2WT1A 1DLLA 4XCAA 5BPXA 1HRI3 5EYYA 2YFZA 1K5MC 2H0BA 2E7AA 3R05A 1P8JA 1WLTA 2WDBA 1XQNA 5FY8A 2KR2A 2V5YA 2PAKA 4LHKA 4H7MA 4XDPA 3HOBA 5C6CA 4URAA 3N3HA 4LA3A 4DUWA 5FPXA 4XMAA 1LTEA 1MZFA 1S1AA 1LOBA 2D5FA 3MFAA 2HBTA 1JZ3A 3BVCA 1BMV2 3RZGA 5JR2A 3UK9A 2BUKA 4AQ6A 4FPLA 2Q8EA 3J9SA 1O3SA 4QGNA 4P08A 3JCIA 4RQPB 2YV8A 1PO23 1AL21 1JN2P 1OKOA 3AXEA 3N35A 3UKVA 4DEQA 1Q8QA 4UT5A 3CQOA 1YIFA 3I97A 3NJZA 1TNRA 3ETQA 5FOBB 4N7IA 3EB7A 4HOOA 3MW4A 1ZBA3 4BMEA 4YVWA 3OPTA 4QX2A 4MSVA 2BP6A 2WYSA 3ZXGA 5A32A 5AC92 2VJXA 3RRDA 5JOXA 2ILMA 2D7FA 2OVUA 1GQGA 3I2DA 5C8CA 5IFTA 2JDYA 2P17A 1HKDA 4U36A 2NN8A 1D2QA 3DCQA 4YM1A 2VMIA 1OPMA 2IZWA 1DGWX 1XSQA 4S2FA 5JXHA 3QH7A 1VBE2 2ZX0A 3DPRC 3WG2A 3AP4A 1G7YA 1YHFA 2NZ9A 3AZWA 3W5MA 2R043 4M3CA 5GLWA 1I3HA 4Q4Y3 1YWKA 2TNFA 3BIWE 4JQRA 4XUTA 3VZLA 4L92A 1O59A 3KT7A 4XFCA 5CG9A 4OHYA 1JODA 1QEXA 4URTA 2B42B 5DAVA 3ZFFB 1UO9A 4N43A 1TMF3 4MUVA 4Z82A 5BNNB 3OCPA 4X8NA 1D4M3 3M3CA 4GKXA 1QJU2 4Y5Z0 2OKXA 3WUCA 2ERFA 3MIBA 1AXYA 2ZGQA 1O3RA 3JD71 1KDMA 2J1TA 3K3OA 3W20A 5I91A 1ENXA 1ODMA 1FAYA 1LHNA 4MGYE 5F3IA 3SCFA 3RZZA 5FWJA 1ULPA 4EN7B 1C57A 5C9AC 2LTNA 2YU1A 1U5IA 5IFPA 3IAQA 2E6VA 2VR4A 1KJLA 2P6HA 2RS31 1MQTB 1UIKA 1UYZA 2Y38A 2BWAA 1BK0A 1QJFA 3RDIA 4B8EA 3LWCA 4B7EA 3I49A 4J1XA 2C9KA 2YBKA 4DXSA 4Y4YA 4CDQC 3GXUA 3C7FA 4XVHA 3A0KA 2WNUC 4IESA 3DYPA 4XURA 3G6JB 4XE9A 5CIRA 4MG2A 4CU8A 2J22A 5LK5A 1HRI1 1RMU2 2P1BA 1GFF2 1HJGA 5CADA 5CKNA 3ZM8A 4YM2A 2RJ2A 1QOSA 2WLQA 3EHKA 3VHRA 4J1WA 4FXKB 4EE2A 5F3CA 1KGYA 3ATGA 4LO4B 3BODA 2R6QA 3IIAA 1BEV3 4GKYA 3KCCA 1AX1A 5FZDA 5FO8B 1GNHA 3DYOA 3ZN5A 2RS13 3TEXA 1YJLA 1F2NA 3OBRA 3U07A 2ET7A 2JDKA 1DDLA 4RQPA 4H14A 4CXXA 1HB2A 2FZ1A 3RYRA 3H8OA 3BTAA 2VVDA 1ZRIA 1PO21 3DXTA 1ZZ7A 3E5UA 2A71A 1PX3A 2WO1A 4AFBA 4YARA 3PJYA 1DF0A 2CY6A 4F8AA 4QX7A 5JXJA 4QMAA 2VBBA 2W52A 1A8DA 1ZBA1 1GNZA 2OW4A 5JDBA 2QQWA 3ES1A 5FY1A 1NQJA 5FMOS 2JDMA 2TUNA 1JW6A 4XTPA 1I6XA 5LB6A 4QX8A 5JSOA 1W2OA 5FZFA 3TEYA 4MOAA 1LAJA 2B9VA 2VTFA 1GANA 3VZOA 3W59A 4X8PA 5JSRA 1GZCA 2XLFA 3QOPA 4IV1B 3C8XA 1VBC2 5K9YA 2YC0A 2R041 2O0OA 1HB3A 1W8WA 1C3HA 4Q4Y1 3PTRB 2WZPP 1GOHA 1FPN3 2EXIA 3WLUA 2R0HA 4IEVA 1QJY2 4QX1A 1SCRA 2GMPA 1Z78A 2C24A 1LU2A 1NCRC 5FJHA 4E9KA 5F8PA 3PVEA 3ZFFA 4AAPA 2FCUA 3VZNA 1AR62 4OFGA 1XE7A 5BNNA 3PMEA 4AI9A 5J7MA 3BTZA 1TMF1 5FPBA 4LHLA 4BQ5A 4JTNA 1D4M1 3SLIA 4NN0A 1JOJA 4QDSA 1OOPB 2VUDA 3VKMA 1C8NA 5DQ0A 5BYNA 5JI7A 2KA3A 2WT0A 2ZMLA 1CPMA 1DQ5A 4KMQA 1J84A 3D0JA 1RUNA 5CFDB 2BVBA 2WINB 1WBLA 2WS92 3O14A 3UT0A 2P5BA 4NJ4A 4LKFA 3FBMA 4LO8A 1YEWA 3MBWA 2XH6A 3B00A 4WM7B 4CCJA 3T0AA 1UWWA 1OKQA 4KGQA 5C33A 1GQHA 3HD8B 3VD5A 5I93A 1QMJA 1OSGA 5FZ6A 3FE5A 4PBPA 3GBWA 5DZGA 5FZ9A 4FT8A 1ALYA 3ZYHA 1US3A 2D98A 2WQZC 1H4HA 2PELA 3N36A 5T5LA 3PL0A 4RS5C 1BZWA 3IN9A 5TSWA 5JCTA 2E7TA 5FLHA 3Q8BA 1DQ0A 2MPFA 5T50A 1AXKA 4DY5A 1J83A 3FHIB 4EWDA 4IE0A 5GLUA 2V4AA 3C7GA 2MEV2 3O5SA 5ACA2 1BEV1 1FXZA 3HBKA 5IVFA 1MR5A 2A6YA 2Y6KA 3PIJA 2CYFA 3IDEA 2RS11 4GXLA 2P6CA 2A7AA 4P9JA 3M8LA 3QLQA 5DDJ3 2HYXA 4E4SA 3CDZB 5C71A 4FTSA 4GWNA 3U0ZA 4NO4A 4CDXA 2FDFA 1HV0A 1TZOA 1V70A 2QKDA 4KH9A 3WG1A 4CU9A 1EPZA 3K4ZA 5IK8A 2VCMA 1TME2 2EAKA 3AMHA 4Q4X2 1UX7A 4M0HA 2PAMA 2BFUL 4XF1A 3WP4A 2WNVC 2NMOA 2ORXA 2V73A 3AFKA 1OLME 4ZXKA 5JAXA 5EHDA 5C5TA 1V6LA 3MDPA 1BVVA 5DAWA 5L9RA 4YSFA 5EQUA 5IATA 2ZGPA 5FBZA 4DS0A 3O1PA 1MEC3 5EIYB 1XYOA 3O1UA 2ORZA 3R4UA 2VZUA 1B35C 2ZPXA 4AI3A 3O0VA 4IV1A 4MYEA 2AREA 3P6BA 4WVWA 4YWAA 3T2TA 1AJKA 1KFUL 4MH0E 4Q29A 4K3UA 4XILA 1GZWB 1SBEA 1QJX3 3KCXA 3HQUA 3MV01 4LQRA 4RFT0 1BLZA 3AYAA 2PHLA 4YG3A 1FPN1 1UNBA 1YI9A 2DYCA 4G9SB 1VMJA 1RC6A 2RS53 2JIJA 3ZFFC 4CPBA 5L9BA 4XJZA 5K4LA 2ZMKA 1C1LA 1QY4A 1V6MA 2F17A 3OEBA 2W68A 1SEFA 4M0NA 4Y3OA 1OOPA 5FZCA 4A7ZA 1WW5A 3UGHA 3ZFEB 3WR0A 4I3GA 3WHTA 3AB0A 4ATEA 5KXBA 2Q0AA 2ZGMA 1XBFA 2ZKNA 3DN7A 5CFDA 4ZZ8A 5KXCA 3GYDA 4GJYA 5L7OB 4XDQA 5C70A 4J6GA 4NAOA 1MQTC 3OD4A 4QXCA 2VZTA 2NYYA 1F15A 4WM7A 5FY0A 5K8SA 4K7JA 4NHYA 4W6WA 5FBJA 2G9ZA 3ZXEA 2WLPA 1CZSA 5JWPA 1R092 3LCPA 3ZKUA 3BB6A 2JWPA 1ST8A 2EA7A 1VBD2 3A7QA 4GWJA 4Y1VA 3B5LB 5DG2A 1H30A 4AL9A 4E4DX 4UBHA 2HLEA 2VW2A 4XAAA 1LJ7A 1HRV2 3P3PA 3POGA 3EBRA 5FZAA 1YQ5A 2GNTA 1H6YA 4AVAA 4ZU4A 3O1RA 4JKKA 3ILNA 4OZOA 3BOWA 1XYNA 3NV3A 5JVVA 3S0MA 4Q8KA 1L7RA 4OMCA 4XJUA 1E5SA 2E53A 1W06A 3POSA 1RL3A 2R49A 3WY6A 1UU5A 5JMOA 2PXJA 3J26N 1W9SA 4B4RA 1UCXA 1JUIA 1AR92 1C28A 1XJAA 3E6DA 3NNJA 3VUOA 1WLCA 2XJTA 4D3WA 1DZTA 3THCA 2A3XA 5DDJ1 2NM1A 4FPCA 3H8UA 1U12A 2PN5A 5EP9A 3EYPA 2V72A 4LKEA 2N7GA 3T30A 3GGLA 1PMJX 2W1UA 4E4HA 3B01A 5FQ0B 5GALA 5FZEA 4CCLA 2W2IA 2B7YA 5D21A 3GM8A 4NWVA 4GA9A 2O1QA 4XUQA 5I0TA 3KHBA 3S30A 1AYN2 1CZTA 1IZ3A 3KCYA 4XJ9A 3O1VA 1UU6A 4ZS2A 3FBYA 3PURA 2VZPA 4Y5TA 2DVDA 5FP4A 1OF4A 4XJAA 3S7IA 1W8UA 4PIXA 1RHI2 3Q9OA 3W5NA 1T2XA 4B1LA 1XNAA 1MEC1 3KS7A 3CNAA 1CAWB 1UL9A 3ABZA 2KD7A 2VNGA 5FPLA 4YW2A 4QAWA 2GP3A 4TLGA 2BPA2 1L7QA 2E9QA 2YG0A 4P02B 1ZVFA 2VOXA 1SDDB 5J09A 3ZMNA 1GZWA 5LBEA 2E33A 1UZZA 2ZGUA 2B5HA 3D6EA 5FLIA 1QJX1 4DMIA 2AUYA 3J8F2 4OI2A 1ZRDA 4NIDA 1REEA 3KV4A 4P00B 4YVSB 2XUEA 2VNOA 1H8TC 4IEUA 4UW4A 5LATA 5C3QA 1RUH2 2RS51 5A7OA 4BXFA 4RSUA 5D1IA 1OBNA 1VBB2 2D3SA 3MEPA 2XBO2 4I3PA 4IV3A 4AI0A 1DBNA 2IC1A 1OA3A 3T08A 4BQ2A 5A1FA 2BZDA 1OOPC 1UKGA 5JI9A 3PTYA 5IVBA 1NT0A 3NV1A 3ZFEA 4L2NA 4CDWA 3VD9A 1H2NA 3M1HA 3C7EA 5FXZA 2YPDA 2BQPA 2BRTA 2VZ3A 5GZFA 3PLQA 5CFDC 1G8WA 4F83A 1FI2A 1S2KA 4HKOA 1N1YA 4N9HA 3B7MA 4DUXA 3KGZA 1GP6A 3ETPA 1W28A 2ZZQA 5DG1A 3M3OA 3GDBA 1GZTA 4IUGA 2CV6A 3CJIB 1NAEA 3PUQA 4IGOA 4Q27A 4BK4A 3SH5A 3ZXJA 4LBLA 1KQRA 1ZX5A 1ULEA 3OYWB 2ZGLA 4ZU5A 3BU0A 2EAAA 4HN1A 1OVSA 4JTOA 4Y33A 3UJOA 1GWMA 3WDTA 4CXYA 5J96B 1W6NB 1N3QA 4HMZA 5IT6A 3ZSEA 5A7QA 4OI1A 3BN6A 3UGFA 4BWOA 3AYCA 5LY1A 1JYWA 3BOPA 1LOFA 1YIPA 3TN92 4CCCA 4Q2FA 1GKBA 1X82A 3AP5A 2JEMA 1Z7S2 2VMEA 2FQPA 2PHFA 4HZFA 3LFMA 1V9U3 5FZOA 1ODNA 1PMIA 4UW5A 1YNAA 3WINE 1WA6X 2R063 1O5UA 3ZXFA 1YJKA 1JTZX 3E5XA 4KWKA 1H1AA 3O7OA 1F5JA 3CLPA 2JXAA 2YXSA 3V65A 1UY1A 2ZJCA 1NY71 2XJSA 4QHOA 1S2EA 3H3LA 4MGTA 1O91A 2BV4A 2J1RA 3T1LA 2BW8A 3CF6E 3NKTA 3H7YA 5FZHA 1ZZ9A 5C7GA 2BEOA 2GN7A 1SFNA 1ENSA 4UFMA 3VZJA 1AR73 1SFPA 1SLTA 2CU5A 1HQLA 3OGGA 1CQ9A 3IBMA 2BOJA 3DECA 4HT1T 2OS2A 4XF4A 3WUDA 4AEJA 3AP6A 1LCLA 3O1SA 1RUE3 3ACFA 1CX4A 3ZFGB 4DOUA 2ZX4A 4XF3A 3VB9A 2ZX2A 1DYKA 5FP9A 4DXTA 1CAWA 3H8XA 3ZYBA 2IVJA 1OURA 2VMCA 4FOWA 3PUSA 3N7MA 5FKBA 5FO7B 1A34A 1Q5OA 4AXOA 2B46X 3O1TA 5FYSA 5JXIA 1GICA 4FPFA 3MLJA 2P37A 2ZX3A 3GJAA 2HEWF 5FUNA 3TBDA 3VBUC 4PLOA 1ULCA 5BNOC 3DPRB 3MICA 3VD3A 2DTWA 4XOGA 4CPBD 2D40A 4OQ9A 1HXS2 1O8PA 2BGOA 4YFWA 3J7HA 4YVSA 1PNGA 4BU2A 4A4AA 2I74A 1G86A 2PLV3 2JDZA 5K0UC 5FY7A 4A44A 1OH3A 1MS1A 3ZPYA 3AZVA 4AQTA 3OOXA 3D82A 1LOGA 3T0BA 4BIFA 4CTEA 4FAGA 5JUVA 3V0AB 2AH2A 4NRPA 2VZRA 1FNYA 3POBA 3WEZA 3ZIWA 1LESA 4YGDA 5L73A 5GZGA 5L7OC 1YQ2A 2GDFA 1R64A 1NQDA 2RR12 1UIJA 4QGMA 3MF6A 5FMCA 3AFGA 2HWC3 5JLVA 4AYUA 4WV8A 1J1TA 1CN1A 1VMHA 3GCXA 1XXNA 2HWF2 3LAGA 3ZDSA 2A70A 2F6BA 3K75B 4BA6A 2K46A 3JU9A 4KL1A 2HWB2 1R082 2XWJB 1VE0A 4UW6A 2VL4A 3URFA 5LCWL 1JZ5A 3CJIA 3ZSLA 4EYUA 2BGCA 4KWLA 2EIBA 2QQVA 4XBLA 3HT1A 1H1MA 4ZONA 3OYWA 4XTMA 2BBVA 3VBFA 1O3TA 1GR3A 4XW3A 1W8HA 3MPPG 2JG9B 4CDQB 5I8TA 1W6NA 2WZ8A 3ZVXA 2RVAA 4ATFA 2Z5WA 4KBZA 5LASA 4UW3A 5ABJB 3RWKX 1LHOA 1BBT2 3OBZA 1YCIA 4D69A 5JIUA 4AI8A 2VU9A 4Q1PA 4XFBA 5BV6A 3N9QA 3RI8A 2PHTA 5FPUA 5HV4A 3IDBB 5AFEA 3VHOA 1V9U1 2WFF2 3HR9A 3B9CA 5JPNB 4XHXA 4E27A 4A42A 3KT4A 2RJLA 3IIIA 2R061 4AW7A 3JQWA 1G9AA 1RUOA 1S0FA 5IJRA 3S57A 1W6QB 4NIGA 3BCWA 3LOBA 4ASKA 5CB7A 1POV1 1YFUA 3POWA 2TBVA 2VXRA 2VMHA 3BYWA 4QHBA 5FZ1A 5FFOC 2YZ4A 4OMDA 5A7WB 5I0RA 3IDAA 1PMHX 3EQEA 1AR71 2A3WA 1RUI2 2DBIA 2XB6C 3ACGA 3Q8EA 3R6SA 4A3ZA 4COYA 3T09A 1RUE1 3U11A 2IXLA 1GLHA 1DHKB 3VD7A 3Q8AA 1D0GA 5KWRA 1ZA7A 1PIV2 5DPNA 4EZ4A 1NZCA 1UXXX 1TQ5A 2RDNA 3E6BA 4DEVA 1NLRA 3NV4A 4RHV3 1FV3A 3PUIA 4OYUA 1W9TA 3DPRA 3GHMA 1CPNA 3SCHA 2BU9A 5D8AB 2EICA 2P3YA 3W58A 4YVSC 5A3PA 3M7AA 5IK5A 1FMD3 1ZZCA 4ET7A 1Y7BA 2DVAA 2DUPA 2W39A 2PLV1 3SC7X 5FY4A 1H6XA 3JZVA 3AKTA 4LKDA 4XC9A 2JDHA 5CKQA 3WQ0A 4BLIA 1IPSA 5F5QA 2GH2A 2X10A 2FDJA 2P34A 1AL0G 1QNYA 4YG6A 4CCKA 1JYVA 2DWRA 1HLCA 2YBSA 1QOTA 2VMGA 5J98B 2EXKA 3T3YA 1MS0A 1AHSA 2P3IA 1NYWA 3ILFA 3IWZA 1WW6A 2HWC1 2X5IB 5ERLA 1JYIA 3APBA 4Q4V3 2FCVA 2MEV3 4H2AA 3U10A 3BU7A 2WL1A 3CJIC 4Q0QA 3UKNA 1A6CA 3USUB 3SISA 4NR1A 5GJ6A 3RS6A 3RSJA 2JE7A 1IS3A 3OTFA 1VRBA 4D8MA 5I0DA 2WSUA 5JOWA 5JXGA 1YFXA 1EUTA 4OHZA 4GJZA 4CDQA 1PNFA 3ZO0B 4CP0A 5F3EA 2GU9A 4N90A 2VZSA 4V1PA 4IQPA 3GZTB 2W0XA 5BNQA 4RS5B 3FL7A 2WQ4A 2JDNA 1XNDA 3C7HA 5FV3A 1OLMA 1YC61 2R072 4FPEA 2VH9A 2Q30A 2ZGNA 1LHVA 2QDNA 1QH6A 2C1FA 1LOEA 1GWKA 2RMU2 2ES3A 2JDAA 3ME2A 4AI2A 1J3QA 1A3KA 1HN0A 1MS9A 2BGPA 1W6QA 4QM9A 1LENA 4UBGA 4CEYB 1PO13 1AZDA 2GNDA 2GC3A 4LMFA 4Q4W3 2ZGSA 4Y5SA 3RZLA 4GMP3 2XONA 4MGKE 1GNYA 1HV1A 4K1YA 1ZBE3 2Y6HA 3NNGA 2R32A 2YPJA 1WW7A 4GULA 1IG0A 2PMWB 2CWMA 3BALA 1VAVA 3NO8A 2BVVA 4FVVA 4QPGB 1RUC2 4Z2WA 2CL2A 4JHZA 1OUXA 4RR3C 1WD4A 2WNVB 3RPQA 3ZFGC 5FZKA 3I2KA 3K51A 1VJ2A 5FMOL 1TE1B 1VBA3 1MACA 1Y3TA 2WO2A 5DABA 2VQAA 3S6PA 2QBXA 4UF0B 4UFHA 4EZHA 4IE7A 5IAXA 5T5PA 2UY8A 5I8YA 5BUVA 4E8DA 2YHJA 4Z92B 4YW6A 5I0SA 4IE4A 1B35B 3H1MA 4RHV1 3KWVA 4QQOA 2XDVA 1WCDJ 1H8VA 4KI5M 3FLPA 5D8AA 5L19A 3OUHA 3WNNA 1JHJA 4CZSA 4WVVA 3WHUA 4AEMA 4D7SA 3KHCA 1JYTA 4XZUG 5F5IA 2Z4FA 1FMD1 2E7QA 2ZGTA 4PI0A 2VULA 4XXPA 3WXPA 3MYXA 2DURA 3AJYA 1JUHA 4W65A 3PJQA 4FPHA 1NCRA 1SACA 2W3JA 1MS8A 1CX1A 1W04A 2ZHMA 4CCEA 5GZCA 5FPAA 1W8OA 2H6BA 2WFPA 2WZR2 4XJWA 3HN3A 5HBAA 5JPMB 1APNA 3VZMA 4CDUC 2WN3A 3KQ4B 4NPMA 4BQWA 3KV6A 1LRHA 5J37A 1RUD2 3NKGA 4XFAA 1C1FA 2X29A 4OUMA 5BNPC 5CKMA 4Y20B 4AVBA 3O0WA 4ISQA 2X5IA 3T0DA 4D6QA 5FIXA 4TZDA 1YQ6A 4HG6B 5A1LA 4Q4V1 2MEV1 3H42B 4FTEA 2VZQA 4XQ4A 4A3XA 2ZBJA 3JB8A 4IEZA 3L2YA 1HN1A 1RUF3 3USUA 5JOYA 4AVSA 4BLJA 4B29A 2RE9A 2I07B 3P5BA 1ZRCA 4LT5A 1DQ6A 2BJSA 1GUIA 1O4TA 4AI1A 1AR82 4BB3A 2JG9C 4ES9A 1EYBA 1RYYA 2JENA 1O4YA 5I0UA 1WMXA 3N9OA 1URXA 1YYNA 1JXNA 5FZ8A 4AEKA 3U4XA 4KWJA 5ABJC 3HJRA 4NROA 5LK7B 2YC4A 5APAA 3VDBA 4LBOA 2PA7A 4E2QA 4RS5A 3VN4A 1JZ2A 1LU1A 2JE9A 2YC2A 3LD8A 1JHNA 4XBNA 5JSPA 1FT9A 3WNMA 1ZZ6A 1W6OB 2WC2A
chains in the Genus database with same CATH topology
1LNSA 2J1UA 1XPWA 2X05A 1UY4A 3SEEA 2VO5A 1UXZA 4W8JA 3HEIA 2EIEA 3OEBA 4BXSV 2WABA 5EJ1B 4QDRA 2B4KA 4A6OA 1XC6A 2VMDA 3WNKA 4ZZ8A 1OH4A 4JKMA 4M4RA 3HPNA 5C70A 2WAOA 2VZOA 4Z2AA 2VZTA 2EIDA 3P1IA 5B4XA 3VD4A 3NQHA 1CZSA 3T2PA 2W87A 1KEXA 2W46A 3A7QA 4GWJA 4GWIA 1ULOA 4GZ9A 4RN5A 2HLEA 1UY2A 4W4ZA 1JYXA 1H6YA 4JKKA 1OD3A 1JYNA 4OZOA 4PQQA 2WZEA 1F4AA 1L7RA 4PF1A 3I3BA 4A41A 4ZY9A 3UNPA 4OMCA 2DCJA 2W1WA 4QDQA 3BGAA 1GQPA 4RYDA 5JMOA 1W9SA 2X09A 3VDAA 5A1AA 5HPOA 2VQUA 4D0QA 3THCA 3NJVA 1W9WA 3EYPA 2V72A 2ZEYA 3GGLA 1PMJX 2W1UA 3GM8A 4XUQA 2CDPA 1CZTA 2ZXQA 4JX0A 3IB3A 1MPXA 3DYMA 2VZPA 2VCCA 1OF4A 5CYYA 4OUEA 3W5NA 1GU3A 1K45A 1T2XA 1NKGA 1XNAA 3ABZA 3NRUA 3I2JA 2KD7A 2E31A 3FHQA 4CUAA 4QAWA 2JKXA 3LPGA 1L7QA 1DYOA 2YG0A 4P02B 4A45A 1SDDB 2QQMA 4MO3M 2VM9A 2E33A 2ZEWA 5G05L 4P00B 2YFUA 5LA0A 4MGQA 3T08A 1W0NA 2BZDA 1SG3A 3VD9A 3C7EA 2VZ3A 3CZUA 3SKVA 3CZJA 2Y8KA 3WF3A 2VOTA 3THDA 4DUXA 3CKHA 3ETPA 3HNYM 1TVGA 4KWUA 3T2QA 3I3DA 1SHWB 2LS6A 2C4XA 3GDBA 3LE0A 4IUGA 4XUNA 4LKSA 1NAEA 3MUZ1 2W1SA 4XUOA 4BK4A 3CIHA 4UOJA 2JD9A 1CZVA 4ZXEA 4TTGA 2E32A 4MADA 2XHNA 5F7UA 3OB8A 2BERA 1EUUA 3BN6A 1UZ0A 1JYWA 1K12A 2WN2A 3D3AA 1UYYA 4M4PA 3WQBA 1K3IA 2VMEA 1UY3A 3WF0A 3K77A 3SKJE 4ARYA 3OBAA 3I2GA 1UMHA 1UY1A 4UAPA 2XOMA 3HNMA 2J1RA 3WF4A 3OEAA 2W91A 5C7GA 1D7PM 4YPJA 3LEKA 3IAPA 3DECA 3VDCA 3ACFA 2W47A 4DXTA 2DCKA 4W50A 4QB2A 2ZEXA 3CMGA 2VMCA 4CUBA 5JXIA 5FUIA 3LQCA 2QQKA 4UI9L 2QQOA 3VD3A 1XNTA 3SEPA 2W95A 4XUPA 1O8PA 4A4AA 2BGOA 3ECQA 3J7HA 2YFZA 4TXWA 1P8JA 3MO4A 3WF1A 1JZ7A 4A44A 1US2A 2WDBA 3C7OA 3AC0A 3HOBA 3T0BA 5JUVA 4LQRA 4ARXA 4DUWA 5IYYA 2C26A 2VZRA 1I5PA 3E1F1 3WEZA 1YQ2A 1JZ3A 5CZKA 1R64A 5JR2A 3U37A 3OGVA 1JZ4A 2Y64A 3WNLA 4P08A 4DEQA 3K75B 5LCWL 3CQOA 1JZ5A 2VL4A 3I97A 3EB7A 2EIBA 2J1AA 2WUHA 4QX2A 2WYSA 2VJXA 5G04L 4BJ0A 1JZ8A 1F4HA 1BHGA 3F2ZA 3K4AA 5IFTA 2WZ8A 2RVAA 1TG7A 3ACHA 3OGSA 5JXHA 3LEIA 3W5MA 2DDUA 2J1EA 3K46A 5EJZB 4XUTA 1O59A 2QQLA 4A42A 2XQXA 3IIIA 2WO3A 5IJRA 4CU7A 2BBAA 2OKXA 4QB1A 4AAXA 4OMDA 3WF2A 3IDAA 1PMHX 2J1TA 2W5FA 5IHRA 1ULPA 5B4NA 3ACGA 4A3ZA 3T09A 5IFPA 3IAQA 4BK5A 2VR4A 3VD7A 5HXMA 4CU6A 1UYZA 5DPNA 3A23A 4QB6A 1UXXX 4DEVA 2VQTA 3PUIA 2C9KA 4OYUA 1W9TA 4DXSA 3GXUA 3C7FA 4XVHA 3DYPA 4XURA 2ZEZA 2J1SA 2EICA 2V4VA 2J22A 4CU8A 1O8SA 4ET7A 3ZM8A 2RJ2A 1H6XA 1KGYA 5J1XA 2J7MA 3UETA 3FN9A 1CIYA 1UMIA 2X10A 3MUY1 2QQNA 3DYOA 1JYVA 3I2FA 3MV11 4DUVA 2YB7A 3UESA 2WO1A 1PX3A 1JU3A 1GMMA 5JXJA 3HNBM 1JI6A 3I2HA 2JE8A 2Y6JA 4D8MA 1PX4A 2WQ8A 5I0DA 3WNPA 5JXGA 1EUTA 1JU4A 2R7EB 4QX0A 2VZSA 4MOAA 4QPWA 1W99A 2B9VA 2RV9A 2VTFA 4LHSA 3FL7A 2Y6GA 2W9XA 3C8XA 3C7HA 2VCBA 1GOHA 4MGSA 3JXSA 4QX1A 2JDAA 1IQDC 2VC9A 2BGPA 4FI9A 1JZ6A 3K4DA 2VZVA 2XONA 1GNYA 4QDSA 1NX9A 2Y6HA 2L9LA 3NNGA 3PUHA 5DQ0A 1OT5A 1WKYA 4KMQA 1J84A 2W1QA 4JHZA 3NJXA 3ACIA 4L0PA 2QQJA 3I2KA 3A22A 2V5DA 2WO2A 3I2IA 3MBWA 1K42A 3T0AA 1UWWA 2QBXA 1GOGA 2CDOA 3VD5A 3WNOA 4E8DA 2WAAA 2LW8A 1GOFA 4ZZ5A 4KI5M 5LA1A 3FHAA 2QQIA 1WCQA 3WNNA 1US3A 1JHJA 4XZUG 2Z4FA 1NUKA 4CVUA 3A21A 1W8NA 2W92A 2W3JA 3WSOA 1CX1A 1J83A 4JKLA 5LA2A 1W8OA 3C7GA 3OG2A 3HN3A 2WN3A 1UY0A 2Y6KA 3LPFA 5C71A 2HYXA 2VCAA 3CDZB 3OGRA 4LPLA 1UYXA 3T0DA 1OF3A 4HG6B 5DN2A 4CU9A 3K4ZA 2WBKA 4P5YA 2VZQA 5DMYA 2W94A 1UX7A 1HN1A 4CUCA 2PQSA 3LEGA 2ORXA 4AG4A 1DP0A 4QX3A 1GUIA 4E8CA 2VMFA 1RYYA 3T2OA 5EIYB 1DLCA 2ORZA 3HJRA 2Y6LA 2VZUA 4BDVB 2YC4A 3VDBA 4DXRA 1JZ2A 2YC2A 2ID4A 3P6BA 2VZ1A 2E26A 4PT6A 2J1VA 3WNMA 3I3EA 3MV01
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LNS A;  2J1U A;  1XPW A;  2X05 A;  1UY4 A;  3SEE A;  2VO5 A;  1UXZ A;  4W8J A;  3HEI A;  2EIE A;  3OEB A;  4BXS V;  2WAB A;  5EJ1 B;  4QDR A;  2B4K A;  4A6O A;  1XC6 A;  2VMD A;  3WNK A;  4ZZ8 A;  1OH4 A;  4JKM A;  4M4R A;  3HPN A;  5C70 A;  2WAO A;  2VZO A;  4Z2A A;  2VZT A;  2EID A;  3P1I A;  5B4X A;  3VD4 A;  3NQH A;  1CZS A;  3T2P A;  2W87 A;  1KEX A;  2W46 A;  3A7Q A;  4GWJ A;  4GWI A;  1ULO A;  4GZ9 A;  4RN5 A;  2HLE A;  1UY2 A;  4W4Z A;  1JYX A;  1H6Y A;  4JKK A;  1OD3 A;  1JYN A;  4OZO A;  4PQQ A;  2WZE A;  1F4A A;  1L7R A;  4PF1 A;  3I3B A;  4A41 A;  4ZY9 A;  3UNP A;  4OMC A;  2DCJ A;  2W1W A;  4QDQ A;  3BGA A;  1GQP A;  4RYD A;  5JMO A;  1W9S A;  2X09 A;  3VDA A;  5A1A A;  5HPO A;  2VQU A;  4D0Q A;  3THC A;  3NJV A;  1W9W A;  3EYP A;  2V72 A;  2ZEY A;  3GGL A;  1PMJ X;  2W1U A;  3GM8 A;  4XUQ A;  2CDP A;  1CZT A;  2ZXQ A;  4JX0 A;  3IB3 A;  1MPX A;  3DYM A;  2VZP A;  2VCC A;  1OF4 A;  5CYY A;  4OUE A;  3W5N A;  1GU3 A;  1K45 A;  1T2X A;  1NKG A;  1XNA A;  3ABZ A;  3NRU A;  3I2J A;  2KD7 A;  2E31 A;  3FHQ A;  4CUA A;  4QAW A;  2JKX A;  3LPG A;  1L7Q A;  1DYO A;  2YG0 A;  4P02 B;  4A45 A;  1SDD B;  2QQM A;  4MO3 M;  2VM9 A;  2E33 A;  2ZEW A;  5G05 L;  4P00 B;  2YFU A;  5LA0 A;  4MGQ A;  3T08 A;  1W0N A;  2BZD A;  1SG3 A;  3VD9 A;  3C7E A;  2VZ3 A;  3CZU A;  3SKV A;  3CZJ A;  2Y8K A;  3WF3 A;  2VOT A;  3THD A;  4DUX A;  3CKH A;  3ETP A;  3HNY M;  1TVG A;  4KWU A;  3T2Q A;  3I3D A;  1SHW B;  2LS6 A;  2C4X A;  3GDB A;  3LE0 A;  4IUG A;  4XUN A;  4LKS A;  1NAE A;  3MUZ 1;  2W1S A;  4XUO A;  4BK4 A;  3CIH A;  4UOJ A;  2JD9 A;  1CZV A;  4ZXE A;  4TTG A;  2E32 A;  4MAD A;  2XHN A;  5F7U A;  3OB8 A;  2BER A;  1EUU A;  3BN6 A;  1UZ0 A;  1JYW A;  1K12 A;  2WN2 A;  3D3A A;  1UYY A;  4M4P A;  3WQB A;  1K3I A;  2VME A;  1UY3 A;  3WF0 A;  3K77 A;  3SKJ E;  4ARY A;  3OBA A;  3I2G A;  1UMH A;  1UY1 A;  4UAP A;  2XOM A;  3HNM A;  2J1R A;  3WF4 A;  3OEA A;  2W91 A;  5C7G A;  1D7P M;  4YPJ A;  3LEK A;  3IAP A;  3DEC A;  3VDC A;  3ACF A;  2W47 A;  4DXT A;  2DCK A;  4W50 A;  4QB2 A;  2ZEX A;  3CMG A;  2VMC A;  4CUB A;  5JXI A;  5FUI A;  3LQC A;  2QQK A;  4UI9 L;  2QQO A;  3VD3 A;  1XNT A;  3SEP A;  2W95 A;  4XUP A;  1O8P A;  4A4A A;  2BGO A;  3ECQ A;  3J7H A;  2YFZ A;  4TXW A;  1P8J A;  3MO4 A;  3WF1 A;  1JZ7 A;  4A44 A;  1US2 A;  2WDB A;  3C7O A;  3AC0 A;  3HOB A;  3T0B A;  5JUV A;  4LQR A;  4ARX A;  4DUW A;  5IYY A;  2C26 A;  2VZR A;  1I5P A;  3E1F 1;  3WEZ A;  1YQ2 A;  1JZ3 A;  5CZK A;  1R64 A;  5JR2 A;  3U37 A;  3OGV A;  1JZ4 A;  2Y64 A;  3WNL A;  4P08 A;  4DEQ A;  3K75 B;  5LCW L;  3CQO A;  1JZ5 A;  2VL4 A;  3I97 A;  3EB7 A;  2EIB A;  2J1A A;  2WUH A;  4QX2 A;  2WYS A;  2VJX A;  5G04 L;  4BJ0 A;  1JZ8 A;  1F4H A;  1BHG A;  3F2Z A;  3K4A A;  5IFT A;  2WZ8 A;  2RVA A;  1TG7 A;  3ACH A;  3OGS A;  5JXH A;  3LEI A;  3W5M A;  2DDU A;  2J1E A;  3K46 A;  5EJZ B;  4XUT A;  1O59 A;  2QQL A;  4A42 A;  2XQX A;  3III A;  2WO3 A;  5IJR A;  4CU7 A;  2BBA A;  2OKX A;  4QB1 A;  4AAX A;  4OMD A;  3WF2 A;  3IDA A;  1PMH X;  2J1T A;  2W5F A;  5IHR A;  1ULP A;  5B4N A;  3ACG A;  4A3Z A;  3T09 A;  5IFP A;  3IAQ A;  4BK5 A;  2VR4 A;  3VD7 A;  5HXM A;  4CU6 A;  1UYZ A;  5DPN A;  3A23 A;  4QB6 A;  1UXX X;  4DEV A;  2VQT A;  3PUI A;  2C9K A;  4OYU A;  1W9T A;  4DXS A;  3GXU A;  3C7F A;  4XVH A;  3DYP A;  4XUR A;  2ZEZ A;  2J1S A;  2EIC A;  2V4V A;  2J22 A;  4CU8 A;  1O8S A;  4ET7 A;  3ZM8 A;  2RJ2 A;  1H6X A;  1KGY A;  5J1X A;  2J7M A;  3UET A;  3FN9 A;  1CIY A;  1UMI A;  2X10 A;  3MUY 1;  2QQN A;  3DYO A;  1JYV A;  3I2F A;  3MV1 1;  4DUV A;  2YB7 A;  3UES A;  2WO1 A;  1PX3 A;  1JU3 A;  1GMM A;  5JXJ A;  3HNB M;  1JI6 A;  3I2H A;  2JE8 A;  2Y6J A;  4D8M A;  1PX4 A;  2WQ8 A;  5I0D A;  3WNP A;  5JXG A;  1EUT A;  1JU4 A;  2R7E B;  4QX0 A;  2VZS A;  4MOA A;  4QPW A;  1W99 A;  2B9V A;  2RV9 A;  2VTF A;  4LHS A;  3FL7 A;  2Y6G A;  2W9X A;  3C8X A;  3C7H A;  2VCB A;  1GOH A;  4MGS A;  3JXS A;  4QX1 A;  2JDA A;  1IQD C;  2VC9 A;  2BGP A;  4FI9 A;  1JZ6 A;  3K4D A;  2VZV A;  2XON A;  1GNY A;  4QDS A;  1NX9 A;  2Y6H A;  2L9L A;  3NNG A;  3PUH A;  5DQ0 A;  1OT5 A;  1WKY A;  4KMQ A;  1J84 A;  2W1Q A;  4JHZ A;  3NJX A;  3ACI A;  4L0P A;  2QQJ A;  3I2K A;  3A22 A;  2V5D A;  2WO2 A;  3I2I A;  3MBW A;  1K42 A;  3T0A A;  1UWW A;  2QBX A;  1GOG A;  2CDO A;  3VD5 A;  3WNO A;  4E8D A;  2WAA A;  2LW8 A;  1GOF A;  4ZZ5 A;  4KI5 M;  5LA1 A;  3FHA A;  2QQI A;  1WCQ A;  3WNN A;  1US3 A;  1JHJ A;  4XZU G;  2Z4F A;  1NUK A;  4CVU A;  3A21 A;  1W8N A;  2W92 A;  2W3J A;  3WSO A;  1CX1 A;  1J83 A;  4JKL A;  5LA2 A;  1W8O A;  3C7G A;  3OG2 A;  3HN3 A;  2WN3 A;  1UY0 A;  2Y6K A;  3LPF A;  5C71 A;  2HYX A;  2VCA A;  3CDZ B;  3OGR A;  4LPL A;  1UYX A;  3T0D A;  1OF3 A;  4HG6 B;  5DN2 A;  4CU9 A;  3K4Z A;  2WBK A;  4P5Y A;  2VZQ A;  5DMY A;  2W94 A;  1UX7 A;  1HN1 A;  4CUC A;  2PQS A;  3LEG A;  2ORX A;  4AG4 A;  1DP0 A;  4QX3 A;  1GUI A;  4E8C A;  2VMF A;  1RYY A;  3T2O A;  5EIY B;  1DLC A;  2ORZ A;  3HJR A;  2Y6L A;  2VZU A;  4BDV B;  2YC4 A;  3VDB A;  4DXR A;  1JZ2 A;  2YC2 A;  2ID4 A;  3P6B A;  2VZ1 A;  2E26 A;  4PT6 A;  2J1V A;  3WNM A;  3I3E A;  3MV0 1; 
#chains in the Genus database with same CATH topology
 2D43 A;  2R0F A;  3K2O A;  3ENR A;  1LNS A;  1SDW A;  1UZY A;  5EJ3 A;  5FJK A;  1ULD A;  2WJS A;  1W0O A;  4CEY A;  2O8Q A;  3LDB A;  1W39 A;  2VVF A;  3R4S A;  4N9I A;  1PO1 1;  4O7X A;  1KS5 A;  3VV1 A;  5FO9 B;  2OUH A;  1UW8 A;  4BXS V;  2YU2 A;  3WNX A;  5A33 B;  4Q4W 1;  4ZS3 A;  1NE6 A;  1SBD A;  2LAL A;  2WAB A;  2IXC A;  3KB5 A;  4GMP 1;  4A7Y A;  4OQ8 A;  1W8T A;  4HET A;  3J8F 3;  2D3R A;  2Y6F A;  2UYA A;  4HSJ A;  1ZBE 1;  3QH6 A;  5FOJ B;  5KHI A;  5HI0 A;  3HN1 A;  1STM A;  3AZX A;  1RUH 3;  4QPG A;  5IUQ A;  3WNK A;  1EAH 2;  1PK6 B;  2OT7 A;  4JKM A;  2WNV A;  4M4R A;  3HPN A;  2WAO A;  3LF7 A;  1AYM 2;  3WP6 A;  4Z2A A;  5CU1 A;  1VBA 1;  2AC1 A;  2D6L X;  2EID A;  5FYC A;  1H9P A;  4UF0 A;  4AVV A;  2ZHL A;  3DXU A;  3WP5 A;  3NQH A;  4BZ4 A;  4AGR A;  4R9D A;  1B35 A;  3H50 A;  3T2P A;  3NJY A;  4S2H A;  1ULO A;  2OQ7 A;  3UJQ A;  5D8A C;  1EV1 3;  2O14 A;  4DZG A;  5A3M A;  5EWS A;  1GP4 A;  1Q8P A;  1XYP A;  4JVA A;  3GZU C;  3DF0 A;  3KQR A;  4A7K A;  1JYN A;  2G9F A;  4CE8 A;  3I3B A;  4S2D A;  3F95 A;  4Y1X A;  1UQX A;  1VRH 2;  3SMH A;  4IXL A;  5E6H A;  1H8T B;  4V2V A;  1OA2 A;  2XQR A;  3JBG 3;  2IXI A;  1GQP A;  1QDO A;  1DIW A;  5A1A A;  4HAN A;  3KF5 A;  1C8M 3;  2OX0 A;  5AFB A;  5HPO A;  5GM0 A;  2VQU A;  2ZA9 A;  4LA2 A;  4B1M A;  1BQP A;  3KSC A;  4Y20 A;  1JYC A;  1GV9 A;  1W9W A;  1S0J A;  2X5I C;  4BPZ A;  3LDR A;  4DIQ A;  1OD5 A;  2D6M A;  1AL2 2;  5SV8 A;  1Z7S 3;  3ZYG A;  1MQT A;  3GNE A;  1UMZ A;  1WW4 A;  1I1E A;  1OVP A;  1IS4 A;  2HWD 3;  4NHX A;  2ZAC A;  3DV8 A;  1RUF 1;  2YBP A;  3HIF A;  4JX0 A;  2ZAH A;  3NWK A;  1MVQ A;  3NVC A;  2AEY A;  1U5Y A;  1J59 A;  1BKZ A;  4H3W A;  2VBP A;  4GQ7 A;  5C3P A;  2FD8 A;  1OC1 A;  1W90 A;  1NG0 A;  1X9T A;  4ZPI A;  5CEH A;  1K45 A;  1NKG A;  2WNE A;  1VPH A;  1XU2 A;  5GLT A;  5IVE A;  2RM2 3;  1QU0 A;  2E31 A;  1AXZ A;  4KG0 A;  1OQD A;  1QIQ A;  4CUA A;  1FOD 2;  1XNB A;  2JKX A;  2X53 S;  4AGV A;  3LPG A;  5A6X A;  1DYO A;  1YQC A;  1T6B X;  4QPI B;  1JMU B;  4XFF A;  3VBR C;  5EFU A;  4QQP A;  2FMD A;  3RMY A;  4BIO A;  2XJQ A;  1XE8 A;  5E1R A;  4KG8 A;  1QH7 A;  5FZI A;  4MGZ E;  2YGL A;  1ND3 C;  4DIN B;  4CEY C;  1J3R A;  1WLD A;  4KNC A;  1NE4 A;  2YFU A;  4DO0 A;  3AYD A;  2A6W A;  5LA0 A;  4OHW A;  2D6K A;  1LUL A;  5A33 A;  1XRU A;  3FJS A;  4OVE A;  3WZ1 A;  2H6C A;  4P9G A;  1W2N A;  1RED A;  3J8F 1;  4NOT A;  5A6Q A;  1UF2 C;  3JD7 2;  2OZ6 A;  1BJQ A;  5EXO A;  2DUO A;  2VPV A;  2ET1 A;  1ASJ 3;  4XFG A;  4QPG C;  2PAE A;  2YY1 A;  1RUG 3;  1RUH 1;  1SZB A;  2XJV A;  1GSL A;  5FXW A;  1G9F A;  4LOT A;  2ENR A;  2QFE A;  4YGB A;  1EY2 A;  5CFC C;  3NV2 A;  2EAL A;  2RS3 2;  2ZAA A;  3RZK A;  4GB3 3;  3HNY M;  1TVG A;  4KWU A;  3PMS A;  1COV 2;  3LE0 A;  3MI8 A;  5ANQ A;  3ZOI A;  1PVC 3;  3NST A;  4XPV A;  2W1S A;  4QPY A;  4XUO A;  3VKO A;  3CIH A;  4LUM A;  4XFH A;  1EV1 1;  1R1A 3;  3BI3 A;  1CZV A;  2QVS B;  4LBM A;  4AED B;  2HWF 3;  4ISR A;  5F6K A;  3U4S A;  1HRI 2;  3VBU B;  1W2U A;  1WUV A;  5BNO B;  1S4C A;  2BNO A;  2E32 A;  3OGJ A;  5F7U A;  4RGG A;  4AHX A;  2GAL A;  4PLM A;  4XMI A;  1ZRR A;  1EUU A;  2BER A;  2QE3 A;  3KD4 A;  2G1M A;  1H8T A;  3PIG A;  2EVX A;  4FFG A;  4JV4 A;  5K0U B;  3D3A A;  1MVE A;  3FX3 A;  3JBG 1;  1K3I A;  3JQX A;  3POF A;  4CP9 B;  1C8M 1;  5DZF A;  2ZGK A;  2OYZ A;  1UY3 A;  1POV 0;  4ARY A;  4LE3 A;  1W0P A;  2VTX J;  1PZ7 A;  2IXK A;  4OHV A;  4AHY A;  4DRV A;  3E5Q A;  2XVK A;  2IXJ A;  5CVR A;  4I30 A;  2G19 A;  3HQR A;  4CA9 A;  1PO2 2;  2XOM A;  4F3J A;  4X6R B;  5HV0 A;  1Z7S 1;  4JDM A;  2XJP A;  2OII A;  2W91 A;  4QXK A;  1UPI A;  2D44 A;  2HWD 1;  3VDD C;  4LE4 A;  4YPJ A;  4FSJ A;  4XDO A;  1ZBA 2;  2JIC A;  3LB9 A;  5FY5 A;  4LO7 A;  3ALQ A;  4HBN A;  1QKQ A;  5F3G A;  1DQ4 A;  1GZ9 A;  1UKR A;  5ANN A;  1DGR A;  4MXV A;  2GC2 A;  2UY9 A;  3UKT A;  3N9M A;  1I9R A;  4QB2 A;  3SNM A;  4LBQ D;  2RM2 1;  3WG3 A;  4IEX A;  1Y9Q A;  1HJF A;  4L11 A;  4FPG A;  1O4Z A;  1KXG A;  3QD6 A;  2I45 A;  4UI9 L;  2QQO A;  2R04 2;  1N1V A;  2QNK A;  1J58 A;  5FZM A;  4LK6 A;  2YDE A;  4Q4Y 2;  3SIT A;  1XNT A;  4XUP A;  1UOJ A;  3I7D A;  2DVB A;  1PGW 1;  1ULG A;  1S0I A;  1PIV 3;  4JGZ C;  3ECQ A;  1FV2 A;  2SLI A;  2VTX A;  2YMZ A;  3CBN A;  1HX6 A;  1XNC A;  3VGI A;  4TXW A;  3MO4 A;  4HVO A;  4JDN A;  5I8S A;  3WF1 A;  4MET A;  2Y0O A;  3C7O A;  5A3T A;  3LGR A;  1JH5 A;  4HKL A;  5JR7 B;  1DGR N;  1A8M A;  4I0B A;  1Q8O A;  3CEW A;  5KXE A;  3E1F 1;  1I5P A;  1UN1 A;  3OBT A;  2ZHN A;  4UWD A;  1ASJ 1;  1PK6 C;  5CZK A;  4BCU A;  4BHP A;  1RUG 1;  4P14 A;  5FAX A;  3VKL A;  2P3J A;  3FMG A;  4CEW B;  1VAM A;  1JZ4 A;  1B09 A;  1LHW A;  2Y64 A;  5FZ4 A;  3WNL A;  2IUW A;  4AK3 A;  4GB3 1;  1LEC A;  3RQ0 A;  3EO6 A;  3L9J T;  1DCS A;  1RVF 2;  3VBH C;  2PHX A;  4V2W A;  2Y26 A;  1QHD A;  1RJ8 A;  4NHL A;  3LOI A;  1H9W A;  3LSD A;  1PVC 1;  3GCW A;  3QBQ A;  5JMC A;  1WLW A;  1X7N A;  1A78 A;  1WZX A;  2WUH A;  3AZZ A;  5T3N A;  5G04 L;  4PDW C;  4AED A;  3R4D B;  3NW4 A;  4BJ0 A;  1R1A 1;  3VBU A;  2IXH A;  2HWF 1;  1N1S A;  1BHG A;  1QQP 2;  3F2Z A;  3K4A A;  1DGL A;  5BNO A;  1FX5 A;  2HWE 3;  1BK1 A;  3MW3 A;  3D0S A;  4NRM A;  1QOO A;  4Q5O A;  3ZYF A;  1CES A;  1MZ6 A;  1LHU A;  3FZ3 A;  4KU7 A;  2HJI A;  3LEI A;  4IW3 A;  1WGP A;  1ZYB A;  3MIF A;  5K0U A;  1HDK A;  2J1E A;  1ZZB A;  3GBG A;  4P9X A;  4PJY A;  3AX4 A;  1BEV 2;  2PHW A;  1V00 A;  3ZYI B;  1E5R A;  4R52 A;  5EJZ B;  3J4U H;  4Q8L A;  2RS1 2;  4MHR A;  1H4G A;  2XQX A;  2DBN A;  3NNL A;  2PHR A;  1RB8 G;  4CU7 A;  2BBA A;  5L7O A;  3FLT A;  4UFJ A;  1HQN A;  2R07 3;  5F2W A;  1PVX A;  4Y24 A;  4C1X A;  5C4W C;  1FNZ A;  4AAX A;  3O0X A;  5H9S A;  1HQW A;  1TEI A;  1OPO A;  2A6X A;  1D0H A;  4FCA A;  5T54 A;  1RIN A;  4FPK A;  4LBK A;  5B4N A;  3NNM A;  2TEP A;  4NHK A;  4HLT A;  2Q4S A;  3AP7 A;  4BK5 A;  5KHJ A;  1AX2 A;  5FMD A;  4PIZ A;  2ZGR A;  3B69 A;  4QB6 A;  3AMP A;  4YYO A;  4QPI C;  2VQT A;  1OFS A;  3LA7 A;  5AC9 3;  1SFY A;  4NUB A;  1OLQ A;  2QUO A;  2BTV C;  4YW3 A;  3ZSK A;  5FYZ A;  3HMY A;  5FXV A;  2RDR A;  4I01 A;  3C2U A;  1FPN 2;  1NA1 C;  1PIV 1;  2DTY A;  2XKP A;  3D4K A;  1O8S A;  2IWG B;  3N7L A;  4K21 A;  5KHK A;  4MX3 A;  4AWD A;  3PHM A;  4IER A;  4NPR A;  3ELN A;  3RNS A;  1VBE 3;  3UET A;  3OSD A;  1CIY A;  1RGS A;  1KDK A;  3ILR A;  3AJZ A;  5FQ0 A;  4QXB A;  3RYK A;  3ZR6 A;  5E88 A;  4EN0 A;  4NII A;  3MUY 1;  2QQN A;  1ND2 B;  1S55 A;  3I59 B;  1IPJ A;  2D5H A;  4LOR A;  2JB8 A;  2RDS A;  4CEW A;  5CNA A;  4DUV A;  5C8W A;  3UES A;  1Q56 A;  2FDI A;  4D7Y A;  1O3Q A;  4H55 A;  4W6X A;  5EZW A;  3MIH A;  4RR3 B;  3MPB A;  4Z8B A;  5L9V A;  1LED A;  1QJU 3;  1JU3 A;  1ZZ8 A;  1GMM A;  2OUJ A;  2CAU A;  1ZRF A;  1RUD 3;  5FUP A;  3I4I A;  3AXD A;  3PUA A;  3HNB M;  3I2H A;  2JE8 A;  4AED C;  2JX9 A;  1PX4 A;  2WQ8 A;  5DZE A;  3WNP A;  3MHZ A;  4PI2 A;  4RFR B;  2DU1 A;  2DVG A;  2Z2S B;  4R9B A;  2R7E B;  4HL0 A;  2YYO A;  3SHR A;  4IND A;  2HWE 1;  2K2S A;  1ACC A;  1LGN A;  4QPW A;  4UFL A;  2RV9 A;  2QJV A;  4G3Y C;  4LHS A;  3GZA A;  5T55 A;  4MHU A;  1MZE A;  2Y6G A;  4IL7 A;  1H2L A;  1S0B A;  5F5A A;  3SCG A;  1CJP A;  1YUD A;  3RMX A;  1CD3 G;  5CBL A;  5J36 A;  1AX0 A;  4HXC A;  2A6V A;  2AEZ A;  2A5Z A;  1RMU 3;  3JXS A;  1ULF A;  2OQ6 A;  3N9P A;  5DDJ 2;  1ZRE A;  4CDU B;  2VC9 A;  4K6B A;  4COW A;  3WX5 A;  4GMP 0;  4L99 A;  4FP2 A;  5BNP B;  4U2A A;  4S2G A;  1QJZ A;  2VZV A;  2LM3 A;  2R07 1;  5FPV A;  5A7N A;  3WQ1 A;  2L9L A;  4FPO B;  1RIT A;  3O1M A;  4Q1R A;  5DUU A;  3HQX A;  1WKY A;  3Q8F A;  5FYT A;  4FXG B;  1BMV 1;  2W1Q A;  3NJX A;  1VLN A;  4AVT A;  3ACI A;  1DU3 D;  2ADD A;  5B2G B;  5CIS A;  3A22 A;  5IVC A;  4YM3 A;  2V5D A;  4R9C A;  1MEC 2;  4C90 A;  1MS5 A;  1S0D A;  1Y43 B;  4HVQ A;  1Y9M A;  4QWN A;  1J1L A;  1GOG A;  4UFK A;  2CDO A;  4OHX A;  3AL5 A;  1V6O A;  2GN3 A;  2Q8O A;  5LY2 A;  3NAP B;  3AMQ A;  3WNO A;  4DQA A;  2A3Y A;  4PLN A;  3BPZ A;  4XEZ A;  2WAA A;  2LW8 A;  1GP5 A;  1GOF A;  4QQH A;  3WP3 A;  3ZIX A;  4DFS A;  1FAT A;  2P4E A;  5AC9 1;  2QQI A;  1QJX 2;  3PNA A;  4FQZ A;  4TWT A;  1CON A;  3ST7 A;  3VKF C;  3RYP A;  3G7D A;  4CVU A;  4ZU7 A;  3VBO C;  4LIV A;  5KC5 A;  2W92 A;  3GJB A;  1SCS A;  1VBE 1;  1W6P B;  4R8H A;  2Q1M A;  1VBC 3;  1UAI A;  3PVN A;  3NL1 A;  3S7E A;  3V64 A;  2NMN A;  3MZH A;  1ND2 A;  3ZYR A;  3I59 A;  4KBB A;  4HVR A;  5ISL A;  4UYB A;  2H0V A;  4AGG A;  1JBC A;  1QJY 3;  3VZK A;  4CEW C;  1WCS A;  5E16 A;  2VCA A;  4LPL A;  1VRH 3;  3HWJ A;  3AMN A;  2GAU A;  1OF3 A;  3AVR A;  1AR6 3;  5DN2 A;  1ONA A;  4K1Z A;  2XML A;  2FBE A;  3EJK A;  4RR3 A;  3T4V A;  3ZFG A;  2VOV A;  1UOF A;  2WBK A;  5F32 A;  4P5Y A;  1QJU 1;  5DMY A;  2EF6 A;  2A6Z A;  1S2B A;  4GH4 B;  4LXL A;  4Q0S A;  1RUD 1;  4B4Q A;  4AQS A;  1W3X A;  4P9I A;  4AFD A;  4CUG A;  2X8K A;  1DP0 A;  4QX3 A;  2Q8D A;  2G9G A;  2DCZ A;  2A1X A;  5A70 A;  1IG3 A;  4YFZ A;  5IVY A;  3THT A;  4NWW A;  1WBF A;  3DKW A;  2WS9 3;  2XVG A;  3WDV A;  4CP1 A;  1CAU B;  2VBD A;  4O9G A;  3HBZ A;  3W9A A;  3VLB B;  4ASM B;  2E63 A;  1DLC A;  2EXJ A;  2UU8 A;  5FZ0 A;  2ZKL A;  3TNQ A;  2IFW A;  4QKF A;  3K48 A;  2WR9 A;  5FP7 A;  5IWF A;  2XVL A;  4A6S A;  4P9W A;  5D2A A;  3EMR A;  1MZ5 A;  2E26 A;  2JD4 A;  2KXL A;  1OMI A;  2J1V A;  1QF3 A;  3M3I A;  4PT6 A;  1VB2 A;  4YW7 A;  3WDY A;  3H1W A;  4D6S A;  4D94 A;  5C8C B;  4Y26 A;  3V0A A;  3AK0 A;  3FUO A;  1SLI A;  2J1U A;  1T6G C;  1GWL A;  1XPW A;  1AVB A;  2UWC A;  1RMU 1;  2C0Z A;  1CAX B;  4CDU A;  3I3M A;  2QTW B;  4WZC A;  4CCO A;  2X05 A;  1FOD 3;  4IEO A;  1UXZ A;  5BNP A;  1NY7 2;  4W8J A;  1KRI A;  2VNR A;  2VY0 A;  2W08 A;  3MID A;  5A3W A;  1SPP B;  5EJ1 B;  4EJR A;  4QDR A;  2B4K A;  4M00 A;  5EYX A;  5ACA 3;  3ES4 A;  1IS5 A;  3AM2 A;  4HON A;  5L36 A;  5FCC A;  3NNF A;  2FZ2 A;  4C0B A;  1OH4 A;  4QQ2 A;  4H7L A;  3UGG A;  3POJ A;  2C9A A;  2QQU A;  3IPV B;  3Q8C A;  4O65 A;  3AKQ A;  2JG9 A;  3ITQ A;  4CCD A;  1TME 3;  5A6Z A;  2G4I A;  4Q4X 3;  3BPS A;  2WA4 A;  3NAP A;  3WW4 A;  5ABJ A;  2OA2 A;  3WDX A;  4JHT A;  3ZN4 A;  4ONU A;  2W46 A;  4LLF A;  4QHZ A;  5FYI A;  3U1X A;  4RN5 A;  4BMB A;  1NXM A;  1UX6 A;  3M70 A;  4HKW A;  4I0A A;  5DAQ A;  4N53 C;  1SLA A;  1O6U A;  1UY2 A;  2ZCW A;  4W4Z A;  1G9D A;  3E6C C;  1JYX A;  4WM8 C;  3H0O A;  4LBQ B;  1OD3 A;  4QT6 A;  3VBR B;  1COV 3;  4D7T A;  4ES8 A;  4PF1 A;  5FTT C;  4OUS A;  3J7N A;  3TAY A;  4AFM A;  4ZY9 A;  3THP A;  1YXW A;  3KT1 A;  2HH9 A;  4LOS A;  4XBQ A;  1F9K A;  1ND3 B;  1W6P A;  4ASL A;  2OZJ A;  2W1W A;  4QDQ A;  3M2M A;  1VBC 1;  2QCS B;  3ZDV A;  2LRO A;  4RYD A;  4CCM A;  1OI6 A;  2X09 A;  5LWB A;  3VDA A;  1ND2 C;  4C0H A;  1CJD A;  5A7W A;  5LW9 A;  5FK8 A;  3AKP A;  4C8D A;  4D0Q A;  3ZSJ A;  1QJY 1;  1PGS A;  1NOV A;  1VRH 1;  3MFC A;  1UU4 A;  2ZEY A;  3TNP B;  1AR6 1;  2VUJ A;  2CTV A;  2A75 A;  2QDR A;  5IK4 A;  5CFC B;  4GH4 A;  3ROU A;  1JOB A;  1MPX A;  1W3V A;  3CO2 A;  4MZU A;  4YW1 A;  1CAU A;  2WS9 1;  5DUV A;  2WWJ A;  5F2S A;  1GU3 A;  2RG4 A;  2DVF A;  3AP9 A;  5JZG B;  1OUS A;  3NRU A;  5T5O A;  1NCQ C;  2FCT A;  2VOK A;  1R09 3;  4IEQ A;  2NPI A;  4XIK A;  1POQ A;  1ENQ A;  5FRE A;  1VBD 3;  4COV A;  2DFB A;  4MO3 M;  2VM9 A;  3GHN A;  4XF0 A;  1CAV B;  4K9S A;  4E2S A;  1HRV 3;  1V9U 2;  2OPW A;  4XHB A;  2AZ5 A;  2VUC A;  5AVA A;  5LBB A;  3ZKY A;  1CAX A;  1WME A;  2R06 2;  1TNF A;  4LNV A;  4YZ4 A;  3OPW A;  1YFW A;  1FOD 1;  2WRA A;  3PU8 A;  1OQ1 A;  1RUJ 2;  2XLG A;  1SPP A;  3POE A;  4MGQ A;  2PHU A;  4XF9 A;  1W0N A;  3MW2 A;  1RXF A;  4LHN A;  5IW0 A;  1DQ2 A;  5ACA 1;  5EV7 A;  2QQP A;  3UV9 A;  3WW2 A;  1BCX A;  4Y1Y A;  1AR7 2;  1AR9 3;  1SG3 A;  3TOJ A;  3H3U A;  3RG0 A;  4DNY A;  3CZU A;  3VDD B;  4SLI A;  3RWN A;  3SKV A;  3WF3 A;  2DUQ A;  2VOT A;  2CSG A;  5H9Q A;  1RUE 2;  3SH3 A;  3VHP A;  3CHX A;  3IPV A;  4YZ3 A;  3T4H B;  1YFY A;  3CKH A;  4QQL A;  4CXW A;  1Q8V A;  4FO9 A;  1TME 1;  1SHW B;  3AMM A;  4XUN A;  3NAP C;  4Q4X 1;  1QJE A;  3FFZ A;  4QGL A;  3OJB A;  4AHW A;  3MUZ 1;  1AYN 3;  3R0R A;  4L97 A;  5LRS A;  4Z07 A;  5A6Y A;  4P5H A;  4XYX A;  4UOJ A;  4E2G A;  4FFF A;  2MHF A;  2JDU A;  2Y60 A;  3MF9 A;  1SLB A;  4LBQ A;  3VBR A;  2PHD A;  2HKX A;  3WW3 A;  2GH8 A;  2ZZJ A;  1RHI 3;  1IKQ A;  1RVF 3;  1COV 1;  2UUR A;  4N7U A;  2PFW A;  2ZHK A;  4AQ2 A;  4CYD A;  3BTX A;  1VMF A;  2JG8 C;  2PLV 2;  2XHN A;  3LA3 A;  3OB8 A;  4I02 A;  4JGZ B;  5FY9 A;  1ND3 A;  4I0W B;  4B7K A;  2ARC A;  4R4X A;  2WN2 A;  4RGK A;  3X29 B;  4X6Q B;  4HN0 A;  1QQP 3;  1VIW B;  1ZNP A;  3IZO A;  5GZD A;  2K0G A;  4QXH A;  4Q26 A;  3ON7 A;  3WF0 A;  4FAH A;  3I2O A;  3HT2 A;  4A2U A;  2YRO A;  3ZMO A;  2F4L A;  4IET A;  3LSE A;  3SQO A;  2HWC 2;  5IVJ A;  1UMH A;  3N7K A;  2R16 A;  4UAP A;  4IE5 A;  1NXD 1;  3PVO A;  1OQE A;  1VBB 3;  1OFN A;  2DFC A;  2XBO 3;  3HNM A;  4YW5 A;  3WF4 A;  5CFC A;  4DXZ A;  1UYP A;  1U5X A;  4GH4 C;  2CGN A;  1U5Z A;  2RHP A;  4O9E A;  1IHM A;  1NLS A;  1D7P M;  2PTM A;  1QXR A;  5F39 A;  3VBH B;  3S5Q A;  3DKQ A;  3KZ4 C;  2R30 A;  5FMB A;  3VDC A;  4CDX B;  1V6K A;  4BM8 A;  4P9L A;  1YLL A;  2DF7 A;  5JZG A;  4ZHN A;  4PDW B;  5KHG A;  1XOY A;  3PU3 A;  2ZEX A;  3RZH A;  3LEM A;  4YVW C;  2I2S A;  4CUB A;  4QX5 A;  1R09 1;  3A4U A;  2QQK A;  1N1T A;  1VBD 1;  1O5L A;  3CU7 A;  5C8C C;  1CAV A;  2DU0 A;  5FZ7 A;  1HRV 1;  2XG3 A;  2CGO A;  1VR3 A;  4Y1U A;  3KV5 A;  1W9F A;  4MGI E;  4EN8 B;  4GAL A;  1JZ7 A;  3FUQ A;  1US2 A;  1VAL A;  4JQT A;  5DUX A;  3AC0 A;  3USS A;  4KGG A;  4FBF A;  3TN9 3;  4BH9 A;  1Q43 A;  1LEM A;  4ARX A;  1XSR A;  3ZLI A;  5IYY A;  1F35 A;  2C26 A;  3U14 A;  3QAC A;  5FWE A;  3ASI A;  1QGL A;  2QZ2 A;  3H9A A;  5FZL A;  5A3N A;  3BIE A;  1AR9 1;  5C4W B;  1VP6 A;  3KV9 A;  3VDD A;  3TEW A;  4OLL A;  3VKN A;  4N43 C;  3NMB A;  5AVP A;  3U37 A;  4LUL A;  3OGV A;  5KR7 A;  3MGU A;  2FMY A;  4EWA A;  2ZTN A;  2VOW A;  3ACL A;  2XL9 A;  3INA A;  3C3V A;  2VW1 A;  1OLR A;  3TWI A;  3DUI A;  2ARA A;  1DZQ A;  2P3K A;  1JOP A;  1HB4 A;  1AYN 1;  2J1A A;  3I54 A;  4RHV 2;  3ORJ A;  5KBF A;  1N47 A;  5F6L B;  5FK7 A;  1JZ8 A;  2D3P A;  1F4H A;  1W6O A;  1N3O A;  2VAU A;  4Y22 B;  1FMD 2;  1RHI 1;  1RVF 1;  2YUE A;  2Z69 A;  4F7Z A;  2UYB A;  1V6J A;  2VQ0 A;  4JGZ A;  4BQ1 A;  1TG7 A;  3ACH A;  3B02 A;  1NA1 B;  3OGS A;  3I3Q A;  1S0E A;  3SH4 A;  2B39 A;  2VE1 A;  4JRL A;  2MNG A;  5FZB A;  2FDG A;  4QD2 A;  1BXH A;  2DDU A;  4LUK A;  3DGT A;  4GWM A;  4XQD A;  5BXX A;  3SXW A;  2WKK A;  3K46 A;  5C3R A;  1QQP 1;  3WOG A;  4AZZ A;  1K5J A;  4LO6 B;  1HXS 3;  2QQL A;  4AOC A;  3WT3 A;  1BYH A;  4QKD A;  2WO3 A;  2BDR A;  4K8R B;  3U75 A;  1ZA4 A;  2SBA A;  5GLV A;  2Y34 A;  1UOB A;  2D6N A;  1PK6 A;  4YZ2 A;  3KGL A;  1L3J A;  3V56 A;  1PHM A;  2OXB A;  4LBJ A;  4Q4V 2;  1VBB 1;  4TSV A;  3BUC A;  2XBO 1;  2UWA A;  2R1B A;  3LKJ A;  5J48 A;  4QB1 A;  4O61 A;  4FTB A;  2JEC A;  3WF2 A;  1MS4 A;  1UZW A;  3VBH A;  3ZXD A;  4N8M A;  3WCS A;  2W5F A;  5IHR A;  1IS6 A;  4RQP C;  3FWE A;  5E89 A;  1SLC A;  2RR1 3;  3O12 A;  1DYP A;  4YNI A;  3V0B B;  2Q5T A;  2DCY A;  2K9Z A;  2YGM A;  3UL2 A;  4HK9 A;  5CA6 A;  2VGD A;  4PDW A;  5JZG C;  5HXM A;  4CU6 A;  4Y4R A;  2WA3 A;  3A23 A;  2HWB 3;  1R08 3;  2D6O X;  2Q1F A;  3OUJ A;  3PDQ A;  3RZJ A;  5SV5 A;  3MLK A;  4LEJ A;  2XHK A;  3WDW A;  4PIY A;  3N7J A;  5DAP A;  4XAB A;  4FOY A;  5KXD A;  1WCK A;  3AVS A;  1V0A A;  2ZEZ A;  1VAK A;  2J1S A;  2V4V A;  2VVE A;  2Z42 A;  4IEY A;  4K8F A;  2E51 A;  1X36 A;  5C3O A;  2C6S A;  4M3C F;  1PO1 2;  2CNA A;  1CWP A;  4DB5 A;  4FPJ A;  4KQ7 A;  5J1X A;  2J7M A;  1BBT 3;  3FN9 A;  4Q4W 2;  3TN9 1;  3AL6 A;  1UMI A;  2ETE A;  1PGL 1;  2XJR A;  4PCR A;  4QU2 A;  2NQY A;  4AVC A;  1ZBE 2;  1QXJ A;  4R9A A;  2WFF 3;  3LFI A;  5C4W A;  2JB4 A;  2XGX A;  1QWR A;  2WNO A;  4FP3 A;  4BQ3 A;  3W21 A;  4DY3 A;  3N4M A;  3I2F A;  2ZX1 A;  3MV1 1;  4QKB A;  5BNN C;  1Y4W A;  1NZI A;  2YB7 A;  4FOQ A;  4MXW B;  2ZGO A;  4AHZ A;  4IV3 B;  1VBA 2;  2AAC A;  4DPN A;  3WV6 A;  3H8R A;  1O7F A;  4BIS A;  1F5F A;  3CJX A;  2ATF A;  2BYV E;  3VL9 A;  1IPK A;  4YZ5 A;  2IVI B;  3IM0 A;  4IEW A;  3LIH A;  4CDW B;  4MVT A;  5CG8 A;  1LOD A;  3KMH A;  1JI6 A;  2XKO A;  1RUI 3;  2XXZ A;  3POI A;  4M3C E;  2VXJ A;  4YW4 A;  2Y6J A;  4QPI A;  3WQ7 A;  2WWS A;  3DEM A;  3WVJ A;  1LR5 A;  5DUW A;  1D2S A;  1JU4 A;  2BNN A;  4I09 A;  4Y22 A;  1XU1 A;  4XFI A;  3LA2 A;  4XXA A;  2R1D A;  1YO8 A;  2ARX A;  2BNM A;  1DFQ A;  1NA1 A;  4QX0 A;  5LBF A;  1W99 A;  4Q0V A;  4COU A;  3LZZ A;  4CRQ A;  4PQ9 A;  3S5A A;  1LGC A;  4NMI A;  1DZR A;  1LB2 A;  5KC6 A;  2W9X A;  4CP2 A;  2Y33 A;  5HCB A;  3VBO B;  2VCB A;  1WCU A;  3OD0 A;  1I5Z A;  1TMF 2;  4YG0 A;  1BVP 1;  4E4Z A;  1X33 A;  3M3Q A;  1D4M 2;  4TLF A;  4MGS A;  3OUI A;  1HXS 1;  5LEJ A;  1WD3 A;  1IQD C;  1W2T A;  4YRD A;  3AKR A;  4QU1 A;  1L7L A;  4EQV A;  2CGP A;  2GC1 A;  1N3P A;  4FI9 A;  1JZ6 A;  5F37 A;  5J3U A;  5HCF A;  2GP5 A;  3ZXL A;  3K4D A;  4RGA A;  2HEY F;  3J7M A;  4XJ8 A;  2CAV A;  3GAL A;  4OI4 A;  5FZO B;  1NX9 A;  2ARB A;  1KIT A;  1RUF 2;  1GBG A;  3PUH A;  3ZXA C;  2GNM A;  5H9P A;  1OT5 A;  3IT8 A;  1W05 A;  4GD4 A;  2GNB A;  4XCB A;  5FPZ A;  1MS3 A;  5GLZ A;  4CDX C;  2RR1 1;  4HPK B;  3V0B A;  4R4Z A;  1AUY A;  1FYU A;  5JIA A;  4L0P A;  4XZP A;  2QQJ A;  1NLQ A;  2Y0I A;  4LJH A;  3N9N A;  2VW0 A;  3I2I A;  1K42 A;  3VBS B;  5T52 A;  1W6M B;  2HWB 1;  1R08 1;  1UPS A;  2GZW A;  2ZOE B;  5HCA A;  4JGY B;  2LUW A;  3ZPO A;  2WWU A;  1W8F A;  2BFU S;  4FFI A;  1W9Y A;  1UD1 A;  2KM2 A;  3IKW A;  3RZM A;  5FKC A;  2WT2 A;  1E5I A;  1RIR A;  4ZZ5 A;  5LA1 A;  3FHA A;  1WCQ A;  5FRA A;  3ZN6 B;  2GME A;  4CP9 A;  1S0G A;  5F9T A;  4LO5 B;  5FLJ A;  1XE0 A;  3HAG A;  5C9A B;  1RXG A;  2DCT A;  1REF A;  5IAV A;  5IK7 A;  1X9P A;  4IV1 C;  1NUK A;  5CAZ A;  1H2K A;  3OF1 A;  3A21 A;  4LR4 A;  4XAE A;  1IOA A;  1S0C A;  3P3N A;  4WVZ A;  1W8N A;  1UZV A;  2O8O A;  1BBT 1;  2VG9 A;  3WSO A;  3FC0 A;  3KLS A;  1SMV A;  4JKL A;  5C3S A;  5K7P A;  5LA2 A;  3O1O A;  2PYT A;  3OG2 A;  4Q0P A;  1CIW A;  1AF9 A;  1PZ8 A;  2IFR A;  5T5J A;  4G4F A;  1UY0 A;  2WFF 1;  4Y1Z A;  3WG4 A;  2RMU 3;  3LPF A;  1G6N A;  4TYS A;  3WCR A;  1PZ9 A;  3IMM A;  3OGR A;  5HXV A;  4MXW A;  1UYX A;  3ZSM A;  3UYJ A;  5A3L A;  3OY8 B;  1LOC A;  3KF3 A;  4C1W A;  5FYU A;  1PM7 A;  4B4P A;  3A0N A;  4JC1 A;  4LIU A;  1YRZ A;  4M01 A;  1QXP A;  1X8M A;  1F31 A;  4OCT A;  2W94 A;  4CUC A;  2PQS A;  3LEG A;  4AG4 A;  4LBN A;  1RUI 1;  4XQW A;  4E8C A;  1EV1 2;  1XB9 A;  1Z0H A;  2VMF A;  1RUC 3;  4K20 A;  3POY A;  4WM7 C;  5FYB A;  2FDK A;  5LRR A;  3D5O A;  3T2O A;  1KFX L;  3MIG A;  4N53 B;  2P2K A;  3WDU A;  2ADE A;  3QCW A;  2Y6L A;  1X50 A;  4WM8 B;  4BDV B;  2GSY A;  5A7P A;  3RI9 A;  3B3Q E;  4DXR A;  1WWY A;  2GC0 A;  3RJ2 X;  4GAZ A;  2A73 B;  2B8M A;  2ID4 A;  2V09 A;  1LOA A;  2ZAB A;  3VBO A;  1F8V A;  3JBG 2;  4CSW A;  2VZ1 A;  3H7J A;  3VBF B;  1EPW A;  3IDC B;  3I3E A;  3ZYP A;  4OUL A;  1C8M 2;  1Y9G A;  1OXC A;  1KJR A;  4SBV A;  4AFA A;  4OI0 A;  4HFS A;  4ZKT B;  3KM5 A;  1UY4 A;  4IEP A;  3SEE A;  2VO5 A;  3TB0 A;  1K5M B;  3HEI A;  4JRA A;  2EIE A;  3JB4 C;  5BY5 A;  4TN7 A;  5FR3 A;  2J42 A;  3MIE A;  2WZR 3;  2AYH A;  2HWD 2;  4NRQ A;  4A6O A;  1XC6 A;  4AE2 A;  1CR7 A;  2GMM A;  3ZR5 A;  2WII B;  1WA4 A;  4IDZ A;  2XR4 A;  2QZ3 A;  4HPK A;  2VMD A;  1POV 3;  4YM0 A;  1RUJ 3;  4MV2 A;  5FXX A;  4BQX A;  4YLZ A;  4GIQ A;  4LK7 A;  4YGC A;  4COZ A;  2VZO A;  1X8E A;  4L9B A;  2NLR A;  2XUM A;  3VBS A;  3P1I A;  4WVM B;  1W6M A;  5B4X A;  3KVA A;  2RM2 2;  5LA9 A;  1DQ1 A;  4JGY A;  3VD4 A;  3H3Z A;  4PF5 A;  2AGS A;  1H0B A;  4JDO A;  2W87 A;  1KEX A;  1NCQ B;  3M4F A;  4GZ9 A;  4GWI A;  4PBO A;  4PHZ A;  4Q0U A;  4BQY A;  2DV9 A;  1AR8 3;  5FYV A;  3ZN6 A;  4JAA A;  4XAC A;  1PGW 2;  3FLR A;  4KU8 A;  4J25 A;  1M06 G;  5C9A A;  1E57 A;  4C91 A;  3ZYJ B;  4PQQ A;  4EV0 A;  3GF6 A;  1V6I A;  4EWE A;  3M3E A;  2WZE A;  1F4A A;  1WMD A;  1WMF A;  4A41 A;  3UNP A;  1R1Z A;  5H9R A;  5IVV A;  2DCJ A;  1D4V B;  3HVD A;  4I2O A;  3MLL A;  3BGA A;  3L2H A;  4HK8 A;  2RJK A;  1OHF A;  1ASJ 2;  2RMU 1;  1G9B A;  4D6R A;  1RUG 2;  3J7L A;  3NJV A;  3OY8 A;  4IV3 C;  4WZF A;  1HW5 A;  3RGB A;  2AR6 A;  4QM8 A;  4GB3 2;  2CWS A;  4IGP A;  3GBF A;  1IKP A;  2FDH A;  1W2A X;  5A3U A;  3ZFE C;  5JOZ A;  5GZE A;  4NIA A;  1RTV A;  2JDP A;  3BKZ A;  4CDW C;  1VB4 A;  1DG6 A;  1QDC A;  2CDP A;  2D93 A;  1RJ7 A;  1AJO A;  1PVC 2;  5A3O A;  2ZXQ A;  3AKS A;  5C5U A;  2XPJ A;  3IB3 A;  2WO7 A;  2CHH A;  3DYM A;  3VHN A;  1EAH 3;  1YI7 A;  2EIG A;  2VCC A;  1R1A 2;  1RUC 1;  3TRS B;  2D6P A;  5GKA C;  2NP0 A;  5CYY A;  1GYK A;  1AYM 3;  2JJ6 A;  4OUE A;  4N53 A;  4IGQ A;  1CGP A;  4MLO A;  3AZY A;  4NE9 A;  1IGO A;  4WM8 A;  2PQQ A;  4UFI A;  4RD7 A;  1UOG A;  3I2J A;  2HYK A;  3FHQ A;  4UXA A;  1H2M A;  1KD7 A;  2VUA A;  4L8Q A;  2RDQ A;  3RJR A;  4JZR A;  2RS5 2;  4B3N A;  4HSL A;  1HB1 A;  1HIX A;  1SBF A;  2JG8 B;  2VNV A;  3AYE A;  2HBU A;  1V6N A;  2QQM A;  5FZG A;  4A45 A;  1C5I A;  3B94 A;  4LIT A;  5A7S A;  2ZEW A;  5G05 L;  4ITC A;  4BYY A;  1G9C A;  2XJU A;  2WNU B;  1M4W A;  4NHM A;  4EN9 B;  4AF9 A;  3IMN A;  1K5M A;  1LOF C;  1U0A A;  5HCH A;  3ZXK A;  5FDB A;  5LEK A;  4FQ4 A;  4OZX A;  3BTY A;  2WZR 1;  2FHR A;  4RL7 A;  4YGE A;  1W03 A;  4ORF A;  1CVN A;  2HEV F;  1SQ4 A;  3CZJ A;  1RUJ 1;  2Y8K A;  2BWC A;  4XET A;  4NAM A;  3N9L A;  5FZ3 A;  1J3P A;  2Q8C A;  3THD A;  3U78 A;  3VBS C;  4WVM A;  1AL2 3;  3T2Q A;  4DRR A;  3I3D A;  2LS6 A;  4JGY C;  1QNW A;  2C4X A;  5FYH A;  1LGB A;  1Q8S A;  4AFC A;  2XL7 A;  4LKS A;  4BQ4 A;  1NCQ A;  5DXD A;  4XIO A;  4YVW B;  2JD9 A;  1AR8 1;  2D97 A;  5A32 B;  3CL1 A;  3GZE A;  5M0T A;  1EP0 A;  4W6Y A;  2BOI A;  3TEZ A;  4ZXE A;  1PGL 2;  1PM4 A;  2Q1Z B;  5LBC A;  4BOW A;  3D8C A;  5KHH A;  3TYJ A;  4TTG A;  4MAD A;  5EPA A;  2ZS6 B;  2XLA A;  4K40 A;  3KVB A;  4QKN A;  5FYY A;  5FP3 A;  1UZ0 A;  2Z79 A;  4JCK A;  3PVB B;  1K12 A;  4LLO A;  2LRP A;  5A80 A;  1UYY A;  4M4P A;  3WQB A;  4WBB A;  2WSV A;  5LZ6 A;  2C5D A;  4M3C B;  1IQA A;  3B9I A;  1YQ8 A;  1W8Z A;  5FP8 A;  4NIH A;  1C4R A;  3K77 A;  3SKJ E;  1H1I A;  4YZ1 A;  1E5H A;  3H1Y A;  3OBA A;  3ZX7 A;  4BE3 A;  2VEC A;  3I2G A;  1ZM1 A;  2JKB A;  1NCR B;  3VL8 A;  1OA4 A;  2VD7 A;  4CCN A;  5DAX A;  4N43 B;  3K3N A;  2OPK A;  3OEA A;  4LTA A;  4P9Y A;  4EN6 B;  4FFH A;  3JD7 3;  3EXU A;  2EXH A;  4NPL A;  3T1M A;  3LEK A;  1JS9 A;  3LDK A;  2F4P A;  3IAP A;  3WW1 A;  2B9U A;  1EAH 1;  4FPY A;  4IE6 A;  4RA0 A;  1DGW A;  3LIG A;  2B45 X;  2W47 A;  3WD5 A;  2UWB A;  1AYM 1;  5E8A A;  1ENR A;  2AEN A;  2RS3 3;  5F1R A;  3RVH A;  4Z1V A;  1XNK A;  2HWE 2;  3DL3 A;  5FYM A;  3JUU A;  2DCK A;  4W50 A;  4NVP A;  3CMG A;  4AR2 A;  2ZMN A;  1LKN A;  1C5H A;  3B93 A;  1Q3E A;  4FOV A;  2JG8 A;  5FUI A;  3LQC A;  5F5C A;  3VBF C;  4ERO A;  3E97 A;  2JIG A;  3I8T A;  3RFR A;  2WYF A;  3OPZ A;  3FFQ A;  3SEP A;  2W95 A;  2WNU A;  1KS4 A;  2XWB B;  1SLL A;  2WT1 A;  1DLL A;  4XCA A;  5BPX A;  1HRI 3;  5EYY A;  2YFZ A;  1K5M C;  2H0B A;  2E7A A;  3R05 A;  1P8J A;  1WLT A;  2WDB A;  1XQN A;  5FY8 A;  2KR2 A;  2V5Y A;  2PAK A;  4LHK A;  4H7M A;  4XDP A;  3HOB A;  5C6C A;  4URA A;  3N3H A;  4LA3 A;  4DUW A;  5FPX A;  4XMA A;  1LTE A;  1MZF A;  1S1A A;  1LOB A;  2D5F A;  3MFA A;  2HBT A;  1JZ3 A;  3BVC A;  1BMV 2;  3RZG A;  5JR2 A;  3UK9 A;  2BUK A;  4AQ6 A;  4FPL A;  2Q8E A;  3J9S A;  1O3S A;  4QGN A;  4P08 A;  3JCI A;  4RQP B;  2YV8 A;  1PO2 3;  1AL2 1;  1JN2 P;  1OKO A;  3AXE A;  3N35 A;  3UKV A;  4DEQ A;  1Q8Q A;  4UT5 A;  3CQO A;  1YIF A;  3I97 A;  3NJZ A;  1TNR A;  3ETQ A;  5FOB B;  4N7I A;  3EB7 A;  4HOO A;  3MW4 A;  1ZBA 3;  4BME A;  4YVW A;  3OPT A;  4QX2 A;  4MSV A;  2BP6 A;  2WYS A;  3ZXG A;  5A32 A;  5AC9 2;  2VJX A;  3RRD A;  5JOX A;  2ILM A;  2D7F A;  2OVU A;  1GQG A;  3I2D A;  5C8C A;  5IFT A;  2JDY A;  2P17 A;  1HKD A;  4U36 A;  2NN8 A;  1D2Q A;  3DCQ A;  4YM1 A;  2VMI A;  1OPM A;  2IZW A;  1DGW X;  1XSQ A;  4S2F A;  5JXH A;  3QH7 A;  1VBE 2;  2ZX0 A;  3DPR C;  3WG2 A;  3AP4 A;  1G7Y A;  1YHF A;  2NZ9 A;  3AZW A;  3W5M A;  2R04 3;  4M3C A;  5GLW A;  1I3H A;  4Q4Y 3;  1YWK A;  2TNF A;  3BIW E;  4JQR A;  4XUT A;  3VZL A;  4L92 A;  1O59 A;  3KT7 A;  4XFC A;  5CG9 A;  4OHY A;  1JOD A;  1QEX A;  4URT A;  2B42 B;  5DAV A;  3ZFF B;  1UO9 A;  4N43 A;  1TMF 3;  4MUV A;  4Z82 A;  5BNN B;  3OCP A;  4X8N A;  1D4M 3;  3M3C A;  4GKX A;  1QJU 2;  4Y5Z 0;  2OKX A;  3WUC A;  2ERF A;  3MIB A;  1AXY A;  2ZGQ A;  1O3R A;  3JD7 1;  1KDM A;  2J1T A;  3K3O A;  3W20 A;  5I91 A;  1ENX A;  1ODM A;  1FAY A;  1LHN A;  4MGY E;  5F3I A;  3SCF A;  3RZZ A;  5FWJ A;  1ULP A;  4EN7 B;  1C57 A;  5C9A C;  2LTN A;  2YU1 A;  1U5I A;  5IFP A;  3IAQ A;  2E6V A;  2VR4 A;  1KJL A;  2P6H A;  2RS3 1;  1MQT B;  1UIK A;  1UYZ A;  2Y38 A;  2BWA A;  1BK0 A;  1QJF A;  3RDI A;  4B8E A;  3LWC A;  4B7E A;  3I49 A;  4J1X A;  2C9K A;  2YBK A;  4DXS A;  4Y4Y A;  4CDQ C;  3GXU A;  3C7F A;  4XVH A;  3A0K A;  2WNU C;  4IES A;  3DYP A;  4XUR A;  3G6J B;  4XE9 A;  5CIR A;  4MG2 A;  4CU8 A;  2J22 A;  5LK5 A;  1HRI 1;  1RMU 2;  2P1B A;  1GFF 2;  1HJG A;  5CAD A;  5CKN A;  3ZM8 A;  4YM2 A;  2RJ2 A;  1QOS A;  2WLQ A;  3EHK A;  3VHR A;  4J1W A;  4FXK B;  4EE2 A;  5F3C A;  1KGY A;  3ATG A;  4LO4 B;  3BOD A;  2R6Q A;  3IIA A;  1BEV 3;  4GKY A;  3KCC A;  1AX1 A;  5FZD A;  5FO8 B;  1GNH A;  3DYO A;  3ZN5 A;  2RS1 3;  3TEX A;  1YJL A;  1F2N A;  3OBR A;  3U07 A;  2ET7 A;  2JDK A;  1DDL A;  4RQP A;  4H14 A;  4CXX A;  1HB2 A;  2FZ1 A;  3RYR A;  3H8O A;  3BTA A;  2VVD A;  1ZRI A;  1PO2 1;  3DXT A;  1ZZ7 A;  3E5U A;  2A71 A;  1PX3 A;  2WO1 A;  4AFB A;  4YAR A;  3PJY A;  1DF0 A;  2CY6 A;  4F8A A;  4QX7 A;  5JXJ A;  4QMA A;  2VBB A;  2W52 A;  1A8D A;  1ZBA 1;  1GNZ A;  2OW4 A;  5JDB A;  2QQW A;  3ES1 A;  5FY1 A;  1NQJ A;  5FMO S;  2JDM A;  2TUN A;  1JW6 A;  4XTP A;  1I6X A;  5LB6 A;  4QX8 A;  5JSO A;  1W2O A;  5FZF A;  3TEY A;  4MOA A;  1LAJ A;  2B9V A;  2VTF A;  1GAN A;  3VZO A;  3W59 A;  4X8P A;  5JSR A;  1GZC A;  2XLF A;  3QOP A;  4IV1 B;  3C8X A;  1VBC 2;  5K9Y A;  2YC0 A;  2R04 1;  2O0O A;  1HB3 A;  1W8W A;  1C3H A;  4Q4Y 1;  3PTR B;  2WZP P;  1GOH A;  1FPN 3;  2EXI A;  3WLU A;  2R0H A;  4IEV A;  1QJY 2;  4QX1 A;  1SCR A;  2GMP A;  1Z78 A;  2C24 A;  1LU2 A;  1NCR C;  5FJH A;  4E9K A;  5F8P A;  3PVE A;  3ZFF A;  4AAP A;  2FCU A;  3VZN A;  1AR6 2;  4OFG A;  1XE7 A;  5BNN A;  3PME A;  4AI9 A;  5J7M A;  3BTZ A;  1TMF 1;  5FPB A;  4LHL A;  4BQ5 A;  4JTN A;  1D4M 1;  3SLI A;  4NN0 A;  1JOJ A;  4QDS A;  1OOP B;  2VUD A;  3VKM A;  1C8N A;  5DQ0 A;  5BYN A;  5JI7 A;  2KA3 A;  2WT0 A;  2ZML A;  1CPM A;  1DQ5 A;  4KMQ A;  1J84 A;  3D0J A;  1RUN A;  5CFD B;  2BVB A;  2WIN B;  1WBL A;  2WS9 2;  3O14 A;  3UT0 A;  2P5B A;  4NJ4 A;  4LKF A;  3FBM A;  4LO8 A;  1YEW A;  3MBW A;  2XH6 A;  3B00 A;  4WM7 B;  4CCJ A;  3T0A A;  1UWW A;  1OKQ A;  4KGQ A;  5C33 A;  1GQH A;  3HD8 B;  3VD5 A;  5I93 A;  1QMJ A;  1OSG A;  5FZ6 A;  3FE5 A;  4PBP A;  3GBW A;  5DZG A;  5FZ9 A;  4FT8 A;  1ALY A;  3ZYH A;  1US3 A;  2D98 A;  2WQZ C;  1H4H A;  2PEL A;  3N36 A;  5T5L A;  3PL0 A;  4RS5 C;  1BZW A;  3IN9 A;  5TSW A;  5JCT A;  2E7T A;  5FLH A;  3Q8B A;  1DQ0 A;  2MPF A;  5T50 A;  1AXK A;  4DY5 A;  1J83 A;  3FHI B;  4EWD A;  4IE0 A;  5GLU A;  2V4A A;  3C7G A;  2MEV 2;  3O5S A;  5ACA 2;  1BEV 1;  1FXZ A;  3HBK A;  5IVF A;  1MR5 A;  2A6Y A;  2Y6K A;  3PIJ A;  2CYF A;  3IDE A;  2RS1 1;  4GXL A;  2P6C A;  2A7A A;  4P9J A;  3M8L A;  3QLQ A;  5DDJ 3;  2HYX A;  4E4S A;  3CDZ B;  5C71 A;  4FTS A;  4GWN A;  3U0Z A;  4NO4 A;  4CDX A;  2FDF A;  1HV0 A;  1TZO A;  1V70 A;  2QKD A;  4KH9 A;  3WG1 A;  4CU9 A;  1EPZ A;  3K4Z A;  5IK8 A;  2VCM A;  1TME 2;  2EAK A;  3AMH A;  4Q4X 2;  1UX7 A;  4M0H A;  2PAM A;  2BFU L;  4XF1 A;  3WP4 A;  2WNV C;  2NMO A;  2ORX A;  2V73 A;  3AFK A;  1OLM E;  4ZXK A;  5JAX A;  5EHD A;  5C5T A;  1V6L A;  3MDP A;  1BVV A;  5DAW A;  5L9R A;  4YSF A;  5EQU A;  5IAT A;  2ZGP A;  5FBZ A;  4DS0 A;  3O1P A;  1MEC 3;  5EIY B;  1XYO A;  3O1U A;  2ORZ A;  3R4U A;  2VZU A;  1B35 C;  2ZPX A;  4AI3 A;  3O0V A;  4IV1 A;  4MYE A;  2ARE A;  3P6B A;  4WVW A;  4YWA A;  3T2T A;  1AJK A;  1KFU L;  4MH0 E;  4Q29 A;  4K3U A;  4XIL A;  1GZW B;  1SBE A;  1QJX 3;  3KCX A;  3HQU A;  3MV0 1;  4LQR A;  4RFT 0;  1BLZ A;  3AYA A;  2PHL A;  4YG3 A;  1FPN 1;  1UNB A;  1YI9 A;  2DYC A;  4G9S B;  1VMJ A;  1RC6 A;  2RS5 3;  2JIJ A;  3ZFF C;  4CPB A;  5L9B A;  4XJZ A;  5K4L A;  2ZMK A;  1C1L A;  1QY4 A;  1V6M A;  2F17 A;  3OEB A;  2W68 A;  1SEF A;  4M0N A;  4Y3O A;  1OOP A;  5FZC A;  4A7Z A;  1WW5 A;  3UGH A;  3ZFE B;  3WR0 A;  4I3G A;  3WHT A;  3AB0 A;  4ATE A;  5KXB A;  2Q0A A;  2ZGM A;  1XBF A;  2ZKN A;  3DN7 A;  5CFD A;  4ZZ8 A;  5KXC A;  3GYD A;  4GJY A;  5L7O B;  4XDQ A;  5C70 A;  4J6G A;  4NAO A;  1MQT C;  3OD4 A;  4QXC A;  2VZT A;  2NYY A;  1F15 A;  4WM7 A;  5FY0 A;  5K8S A;  4K7J A;  4NHY A;  4W6W A;  5FBJ A;  2G9Z A;  3ZXE A;  2WLP A;  1CZS A;  5JWP A;  1R09 2;  3LCP A;  3ZKU A;  3BB6 A;  2JWP A;  1ST8 A;  2EA7 A;  1VBD 2;  3A7Q A;  4GWJ A;  4Y1V A;  3B5L B;  5DG2 A;  1H30 A;  4AL9 A;  4E4D X;  4UBH A;  2HLE A;  2VW2 A;  4XAA A;  1LJ7 A;  1HRV 2;  3P3P A;  3POG A;  3EBR A;  5FZA A;  1YQ5 A;  2GNT A;  1H6Y A;  4AVA A;  4ZU4 A;  3O1R A;  4JKK A;  3ILN A;  4OZO A;  3BOW A;  1XYN A;  3NV3 A;  5JVV A;  3S0M A;  4Q8K A;  1L7R A;  4OMC A;  4XJU A;  1E5S A;  2E53 A;  1W06 A;  3POS A;  1RL3 A;  2R49 A;  3WY6 A;  1UU5 A;  5JMO A;  2PXJ A;  3J26 N;  1W9S A;  4B4R A;  1UCX A;  1JUI A;  1AR9 2;  1C28 A;  1XJA A;  3E6D A;  3NNJ A;  3VUO A;  1WLC A;  2XJT A;  4D3W A;  1DZT A;  3THC A;  2A3X A;  5DDJ 1;  2NM1 A;  4FPC A;  3H8U A;  1U12 A;  2PN5 A;  5EP9 A;  3EYP A;  2V72 A;  4LKE A;  2N7G A;  3T30 A;  3GGL A;  1PMJ X;  2W1U A;  4E4H A;  3B01 A;  5FQ0 B;  5GAL A;  5FZE A;  4CCL A;  2W2I A;  2B7Y A;  5D21 A;  3GM8 A;  4NWV A;  4GA9 A;  2O1Q A;  4XUQ A;  5I0T A;  3KHB A;  3S30 A;  1AYN 2;  1CZT A;  1IZ3 A;  3KCY A;  4XJ9 A;  3O1V A;  1UU6 A;  4ZS2 A;  3FBY A;  3PUR A;  2VZP A;  4Y5T A;  2DVD A;  5FP4 A;  1OF4 A;  4XJA A;  3S7I A;  1W8U A;  4PIX A;  1RHI 2;  3Q9O A;  3W5N A;  1T2X A;  4B1L A;  1XNA A;  1MEC 1;  3KS7 A;  3CNA A;  1CAW B;  1UL9 A;  3ABZ A;  2KD7 A;  2VNG A;  5FPL A;  4YW2 A;  4QAW A;  2GP3 A;  4TLG A;  2BPA 2;  1L7Q A;  2E9Q A;  2YG0 A;  4P02 B;  1ZVF A;  2VOX A;  1SDD B;  5J09 A;  3ZMN A;  1GZW A;  5LBE A;  2E33 A;  1UZZ A;  2ZGU A;  2B5H A;  3D6E A;  5FLI A;  1QJX 1;  4DMI A;  2AUY A;  3J8F 2;  4OI2 A;  1ZRD A;  4NID A;  1REE A;  3KV4 A;  4P00 B;  4YVS B;  2XUE A;  2VNO A;  1H8T C;  4IEU A;  4UW4 A;  5LAT A;  5C3Q A;  1RUH 2;  2RS5 1;  5A7O A;  4BXF A;  4RSU A;  5D1I A;  1OBN A;  1VBB 2;  2D3S A;  3MEP A;  2XBO 2;  4I3P A;  4IV3 A;  4AI0 A;  1DBN A;  2IC1 A;  1OA3 A;  3T08 A;  4BQ2 A;  5A1F A;  2BZD A;  1OOP C;  1UKG A;  5JI9 A;  3PTY A;  5IVB A;  1NT0 A;  3NV1 A;  3ZFE A;  4L2N A;  4CDW A;  3VD9 A;  1H2N A;  3M1H A;  3C7E A;  5FXZ A;  2YPD A;  2BQP A;  2BRT A;  2VZ3 A;  5GZF A;  3PLQ A;  5CFD C;  1G8W A;  4F83 A;  1FI2 A;  1S2K A;  4HKO A;  1N1Y A;  4N9H A;  3B7M A;  4DUX A;  3KGZ A;  1GP6 A;  3ETP A;  1W28 A;  2ZZQ A;  5DG1 A;  3M3O A;  3GDB A;  1GZT A;  4IUG A;  2CV6 A;  3CJI B;  1NAE A;  3PUQ A;  4IGO A;  4Q27 A;  4BK4 A;  3SH5 A;  3ZXJ A;  4LBL A;  1KQR A;  1ZX5 A;  1ULE A;  3OYW B;  2ZGL A;  4ZU5 A;  3BU0 A;  2EAA A;  4HN1 A;  1OVS A;  4JTO A;  4Y33 A;  3UJO A;  1GWM A;  3WDT A;  4CXY A;  5J96 B;  1W6N B;  1N3Q A;  4HMZ A;  5IT6 A;  3ZSE A;  5A7Q A;  4OI1 A;  3BN6 A;  3UGF A;  4BWO A;  3AYC A;  5LY1 A;  1JYW A;  3BOP A;  1LOF A;  1YIP A;  3TN9 2;  4CCC A;  4Q2F A;  1GKB A;  1X82 A;  3AP5 A;  2JEM A;  1Z7S 2;  2VME A;  2FQP A;  2PHF A;  4HZF A;  3LFM A;  1V9U 3;  5FZO A;  1ODN A;  1PMI A;  4UW5 A;  1YNA A;  3WIN E;  1WA6 X;  2R06 3;  1O5U A;  3ZXF A;  1YJK A;  1JTZ X;  3E5X A;  4KWK A;  1H1A A;  3O7O A;  1F5J A;  3CLP A;  2JXA A;  2YXS A;  3V65 A;  1UY1 A;  2ZJC A;  1NY7 1;  2XJS A;  4QHO A;  1S2E A;  3H3L A;  4MGT A;  1O91 A;  2BV4 A;  2J1R A;  3T1L A;  2BW8 A;  3CF6 E;  3NKT A;  3H7Y A;  5FZH A;  1ZZ9 A;  5C7G A;  2BEO A;  2GN7 A;  1SFN A;  1ENS A;  4UFM A;  3VZJ A;  1AR7 3;  1SFP A;  1SLT A;  2CU5 A;  1HQL A;  3OGG A;  1CQ9 A;  3IBM A;  2BOJ A;  3DEC A;  4HT1 T;  2OS2 A;  4XF4 A;  3WUD A;  4AEJ A;  3AP6 A;  1LCL A;  3O1S A;  1RUE 3;  3ACF A;  1CX4 A;  3ZFG B;  4DOU A;  2ZX4 A;  4XF3 A;  3VB9 A;  2ZX2 A;  1DYK A;  5FP9 A;  4DXT A;  1CAW A;  3H8X A;  3ZYB A;  2IVJ A;  1OUR A;  2VMC A;  4FOW A;  3PUS A;  3N7M A;  5FKB A;  5FO7 B;  1A34 A;  1Q5O A;  4AXO A;  2B46 X;  3O1T A;  5FYS A;  5JXI A;  1GIC A;  4FPF A;  3MLJ A;  2P37 A;  2ZX3 A;  3GJA A;  2HEW F;  5FUN A;  3TBD A;  3VBU C;  4PLO A;  1ULC A;  5BNO C;  3DPR B;  3MIC A;  3VD3 A;  2DTW A;  4XOG A;  4CPB D;  2D40 A;  4OQ9 A;  1HXS 2;  1O8P A;  2BGO A;  4YFW A;  3J7H A;  4YVS A;  1PNG A;  4BU2 A;  4A4A A;  2I74 A;  1G86 A;  2PLV 3;  2JDZ A;  5K0U C;  5FY7 A;  4A44 A;  1OH3 A;  1MS1 A;  3ZPY A;  3AZV A;  4AQT A;  3OOX A;  3D82 A;  1LOG A;  3T0B A;  4BIF A;  4CTE A;  4FAG A;  5JUV A;  3V0A B;  2AH2 A;  4NRP A;  2VZR A;  1FNY A;  3POB A;  3WEZ A;  3ZIW A;  1LES A;  4YGD A;  5L73 A;  5GZG A;  5L7O C;  1YQ2 A;  2GDF A;  1R64 A;  1NQD A;  2RR1 2;  1UIJ A;  4QGM A;  3MF6 A;  5FMC A;  3AFG A;  2HWC 3;  5JLV A;  4AYU A;  4WV8 A;  1J1T A;  1CN1 A;  1VMH A;  3GCX A;  1XXN A;  2HWF 2;  3LAG A;  3ZDS A;  2A70 A;  2F6B A;  3K75 B;  4BA6 A;  2K46 A;  3JU9 A;  4KL1 A;  2HWB 2;  1R08 2;  2XWJ B;  1VE0 A;  4UW6 A;  2VL4 A;  3URF A;  5LCW L;  1JZ5 A;  3CJI A;  3ZSL A;  4EYU A;  2BGC A;  4KWL A;  2EIB A;  2QQV A;  4XBL A;  3HT1 A;  1H1M A;  4ZON A;  3OYW A;  4XTM A;  2BBV A;  3VBF A;  1O3T A;  1GR3 A;  4XW3 A;  1W8H A;  3MPP G;  2JG9 B;  4CDQ B;  5I8T A;  1W6N A;  2WZ8 A;  3ZVX A;  2RVA A;  4ATF A;  2Z5W A;  4KBZ A;  5LAS A;  4UW3 A;  5ABJ B;  3RWK X;  1LHO A;  1BBT 2;  3OBZ A;  1YCI A;  4D69 A;  5JIU A;  4AI8 A;  2VU9 A;  4Q1P A;  4XFB A;  5BV6 A;  3N9Q A;  3RI8 A;  2PHT A;  5FPU A;  5HV4 A;  3IDB B;  5AFE A;  3VHO A;  1V9U 1;  2WFF 2;  3HR9 A;  3B9C A;  5JPN B;  4XHX A;  4E27 A;  4A42 A;  3KT4 A;  2RJL A;  3III A;  2R06 1;  4AW7 A;  3JQW A;  1G9A A;  1RUO A;  1S0F A;  5IJR A;  3S57 A;  1W6Q B;  4NIG A;  3BCW A;  3LOB A;  4ASK A;  5CB7 A;  1POV 1;  1YFU A;  3POW A;  2TBV A;  2VXR A;  2VMH A;  3BYW A;  4QHB A;  5FZ1 A;  5FFO C;  2YZ4 A;  4OMD A;  5A7W B;  5I0R A;  3IDA A;  1PMH X;  3EQE A;  1AR7 1;  2A3W A;  1RUI 2;  2DBI A;  2XB6 C;  3ACG A;  3Q8E A;  3R6S A;  4A3Z A;  4COY A;  3T09 A;  1RUE 1;  3U11 A;  2IXL A;  1GLH A;  1DHK B;  3VD7 A;  3Q8A A;  1D0G A;  5KWR A;  1ZA7 A;  1PIV 2;  5DPN A;  4EZ4 A;  1NZC A;  1UXX X;  1TQ5 A;  2RDN A;  3E6B A;  4DEV A;  1NLR A;  3NV4 A;  4RHV 3;  1FV3 A;  3PUI A;  4OYU A;  1W9T A;  3DPR A;  3GHM A;  1CPN A;  3SCH A;  2BU9 A;  5D8A B;  2EIC A;  2P3Y A;  3W58 A;  4YVS C;  5A3P A;  3M7A A;  5IK5 A;  1FMD 3;  1ZZC A;  4ET7 A;  1Y7B A;  2DVA A;  2DUP A;  2W39 A;  2PLV 1;  3SC7 X;  5FY4 A;  1H6X A;  3JZV A;  3AKT A;  4LKD A;  4XC9 A;  2JDH A;  5CKQ A;  3WQ0 A;  4BLI A;  1IPS A;  5F5Q A;  2GH2 A;  2X10 A;  2FDJ A;  2P34 A;  1AL0 G;  1QNY A;  4YG6 A;  4CCK A;  1JYV A;  2DWR A;  1HLC A;  2YBS A;  1QOT A;  2VMG A;  5J98 B;  2EXK A;  3T3Y A;  1MS0 A;  1AHS A;  2P3I A;  1NYW A;  3ILF A;  3IWZ A;  1WW6 A;  2HWC 1;  2X5I B;  5ERL A;  1JYI A;  3APB A;  4Q4V 3;  2FCV A;  2MEV 3;  4H2A A;  3U10 A;  3BU7 A;  2WL1 A;  3CJI C;  4Q0Q A;  3UKN A;  1A6C A;  3USU B;  3SIS A;  4NR1 A;  5GJ6 A;  3RS6 A;  3RSJ A;  2JE7 A;  1IS3 A;  3OTF A;  1VRB A;  4D8M A;  5I0D A;  2WSU A;  5JOW A;  5JXG A;  1YFX A;  1EUT A;  4OHZ A;  4GJZ A;  4CDQ A;  1PNF A;  3ZO0 B;  4CP0 A;  5F3E A;  2GU9 A;  4N90 A;  2VZS A;  4V1P A;  4IQP A;  3GZT B;  2W0X A;  5BNQ A;  4RS5 B;  3FL7 A;  2WQ4 A;  2JDN A;  1XND A;  3C7H A;  5FV3 A;  1OLM A;  1YC6 1;  2R07 2;  4FPE A;  2VH9 A;  2Q30 A;  2ZGN A;  1LHV A;  2QDN A;  1QH6 A;  2C1F A;  1LOE A;  1GWK A;  2RMU 2;  2ES3 A;  2JDA A;  3ME2 A;  4AI2 A;  1J3Q A;  1A3K A;  1HN0 A;  1MS9 A;  2BGP A;  1W6Q A;  4QM9 A;  1LEN A;  4UBG A;  4CEY B;  1PO1 3;  1AZD A;  2GND A;  2GC3 A;  4LMF A;  4Q4W 3;  2ZGS A;  4Y5S A;  3RZL A;  4GMP 3;  2XON A;  4MGK E;  1GNY A;  1HV1 A;  4K1Y A;  1ZBE 3;  2Y6H A;  3NNG A;  2R32 A;  2YPJ A;  1WW7 A;  4GUL A;  1IG0 A;  2PMW B;  2CWM A;  3BAL A;  1VAV A;  3NO8 A;  2BVV A;  4FVV A;  4QPG B;  1RUC 2;  4Z2W A;  2CL2 A;  4JHZ A;  1OUX A;  4RR3 C;  1WD4 A;  2WNV B;  3RPQ A;  3ZFG C;  5FZK A;  3I2K A;  3K51 A;  1VJ2 A;  5FMO L;  1TE1 B;  1VBA 3;  1MAC A;  1Y3T A;  2WO2 A;  5DAB A;  2VQA A;  3S6P A;  2QBX A;  4UF0 B;  4UFH A;  4EZH A;  4IE7 A;  5IAX A;  5T5P A;  2UY8 A;  5I8Y A;  5BUV A;  4E8D A;  2YHJ A;  4Z92 B;  4YW6 A;  5I0S A;  4IE4 A;  1B35 B;  3H1M A;  4RHV 1;  3KWV A;  4QQO A;  2XDV A;  1WCD J;  1H8V A;  4KI5 M;  3FLP A;  5D8A A;  5L19 A;  3OUH A;  3WNN A;  1JHJ A;  4CZS A;  4WVV A;  3WHU A;  4AEM A;  4D7S A;  3KHC A;  1JYT A;  4XZU G;  5F5I A;  2Z4F A;  1FMD 1;  2E7Q A;  2ZGT A;  4PI0 A;  2VUL A;  4XXP A;  3WXP A;  3MYX A;  2DUR A;  3AJY A;  1JUH A;  4W65 A;  3PJQ A;  4FPH A;  1NCR A;  1SAC A;  2W3J A;  1MS8 A;  1CX1 A;  1W04 A;  2ZHM A;  4CCE A;  5GZC A;  5FPA A;  1W8O A;  2H6B A;  2WFP A;  2WZR 2;  4XJW A;  3HN3 A;  5HBA A;  5JPM B;  1APN A;  3VZM A;  4CDU C;  2WN3 A;  3KQ4 B;  4NPM A;  4BQW A;  3KV6 A;  1LRH A;  5J37 A;  1RUD 2;  3NKG A;  4XFA A;  1C1F A;  2X29 A;  4OUM A;  5BNP C;  5CKM A;  4Y20 B;  4AVB A;  3O0W A;  4ISQ A;  2X5I A;  3T0D A;  4D6Q A;  5FIX A;  4TZD A;  1YQ6 A;  4HG6 B;  5A1L A;  4Q4V 1;  2MEV 1;  3H42 B;  4FTE A;  2VZQ A;  4XQ4 A;  4A3X A;  2ZBJ A;  3JB8 A;  4IEZ A;  3L2Y A;  1HN1 A;  1RUF 3;  3USU A;  5JOY A;  4AVS A;  4BLJ A;  4B29 A;  2RE9 A;  2I07 B;  3P5B A;  1ZRC A;  4LT5 A;  1DQ6 A;  2BJS A;  1GUI A;  1O4T A;  4AI1 A;  1AR8 2;  4BB3 A;  2JG9 C;  4ES9 A;  1EYB A;  1RYY A;  2JEN A;  1O4Y A;  5I0U A;  1WMX A;  3N9O A;  1URX A;  1YYN A;  1JXN A;  5FZ8 A;  4AEK A;  3U4X A;  4KWJ A;  5ABJ C;  3HJR A;  4NRO A;  5LK7 B;  2YC4 A;  5APA A;  3VDB A;  4LBO A;  2PA7 A;  4E2Q A;  4RS5 A;  3VN4 A;  1JZ2 A;  1LU1 A;  2JE9 A;  2YC2 A;  3LD8 A;  1JHN A;  4XBN A;  5JSP A;  1FT9 A;  3WNM A;  1ZZ6 A;  1W6O B;  2WC2 A; 
#chains in the Genus database with same CATH homology
 1LNS A;  2J1U A;  1XPW A;  2X05 A;  1UY4 A;  3SEE A;  2VO5 A;  1UXZ A;  4W8J A;  3HEI A;  2EIE A;  3OEB A;  4BXS V;  2WAB A;  5EJ1 B;  4QDR A;  2B4K A;  4A6O A;  1XC6 A;  2VMD A;  3WNK A;  4ZZ8 A;  1OH4 A;  4JKM A;  4M4R A;  3HPN A;  5C70 A;  2WAO A;  2VZO A;  4Z2A A;  2VZT A;  2EID A;  3P1I A;  5B4X A;  3VD4 A;  3NQH A;  1CZS A;  3T2P A;  2W87 A;  1KEX A;  2W46 A;  3A7Q A;  4GWJ A;  4GWI A;  1ULO A;  4GZ9 A;  4RN5 A;  2HLE A;  1UY2 A;  4W4Z A;  1JYX A;  1H6Y A;  4JKK A;  1OD3 A;  1JYN A;  4OZO A;  4PQQ A;  2WZE A;  1F4A A;  1L7R A;  4PF1 A;  3I3B A;  4A41 A;  4ZY9 A;  3UNP A;  4OMC A;  2DCJ A;  2W1W A;  4QDQ A;  3BGA A;  1GQP A;  4RYD A;  5JMO A;  1W9S A;  2X09 A;  3VDA A;  5A1A A;  5HPO A;  2VQU A;  4D0Q A;  3THC A;  3NJV A;  1W9W A;  3EYP A;  2V72 A;  2ZEY A;  3GGL A;  1PMJ X;  2W1U A;  3GM8 A;  4XUQ A;  2CDP A;  1CZT A;  2ZXQ A;  4JX0 A;  3IB3 A;  1MPX A;  3DYM A;  2VZP A;  2VCC A;  1OF4 A;  5CYY A;  4OUE A;  3W5N A;  1GU3 A;  1K45 A;  1T2X A;  1NKG A;  1XNA A;  3ABZ A;  3NRU A;  3I2J A;  2KD7 A;  2E31 A;  3FHQ A;  4CUA A;  4QAW A;  2JKX A;  3LPG A;  1L7Q A;  1DYO A;  2YG0 A;  4P02 B;  4A45 A;  1SDD B;  2QQM A;  4MO3 M;  2VM9 A;  2E33 A;  2ZEW A;  5G05 L;  4P00 B;  2YFU A;  5LA0 A;  4MGQ A;  3T08 A;  1W0N A;  2BZD A;  1SG3 A;  3VD9 A;  3C7E A;  2VZ3 A;  3CZU A;  3SKV A;  3CZJ A;  2Y8K A;  3WF3 A;  2VOT A;  3THD A;  4DUX A;  3CKH A;  3ETP A;  3HNY M;  1TVG A;  4KWU A;  3T2Q A;  3I3D A;  1SHW B;  2LS6 A;  2C4X A;  3GDB A;  3LE0 A;  4IUG A;  4XUN A;  4LKS A;  1NAE A;  3MUZ 1;  2W1S A;  4XUO A;  4BK4 A;  3CIH A;  4UOJ A;  2JD9 A;  1CZV A;  4ZXE A;  4TTG A;  2E32 A;  4MAD A;  2XHN A;  5F7U A;  3OB8 A;  2BER A;  1EUU A;  3BN6 A;  1UZ0 A;  1JYW A;  1K12 A;  2WN2 A;  3D3A A;  1UYY A;  4M4P A;  3WQB A;  1K3I A;  2VME A;  1UY3 A;  3WF0 A;  3K77 A;  3SKJ E;  4ARY A;  3OBA A;  3I2G A;  1UMH A;  1UY1 A;  4UAP A;  2XOM A;  3HNM A;  2J1R A;  3WF4 A;  3OEA A;  2W91 A;  5C7G A;  1D7P M;  4YPJ A;  3LEK A;  3IAP A;  3DEC A;  3VDC A;  3ACF A;  2W47 A;  4DXT A;  2DCK A;  4W50 A;  4QB2 A;  2ZEX A;  3CMG A;  2VMC A;  4CUB A;  5JXI A;  5FUI A;  3LQC A;  2QQK A;  4UI9 L;  2QQO A;  3VD3 A;  1XNT A;  3SEP A;  2W95 A;  4XUP A;  1O8P A;  4A4A A;  2BGO A;  3ECQ A;  3J7H A;  2YFZ A;  4TXW A;  1P8J A;  3MO4 A;  3WF1 A;  1JZ7 A;  4A44 A;  1US2 A;  2WDB A;  3C7O A;  3AC0 A;  3HOB A;  3T0B A;  5JUV A;  4LQR A;  4ARX A;  4DUW A;  5IYY A;  2C26 A;  2VZR A;  1I5P A;  3E1F 1;  3WEZ A;  1YQ2 A;  1JZ3 A;  5CZK A;  1R64 A;  5JR2 A;  3U37 A;  3OGV A;  1JZ4 A;  2Y64 A;  3WNL A;  4P08 A;  4DEQ A;  3K75 B;  5LCW L;  3CQO A;  1JZ5 A;  2VL4 A;  3I97 A;  3EB7 A;  2EIB A;  2J1A A;  2WUH A;  4QX2 A;  2WYS A;  2VJX A;  5G04 L;  4BJ0 A;  1JZ8 A;  1F4H A;  1BHG A;  3F2Z A;  3K4A A;  5IFT A;  2WZ8 A;  2RVA A;  1TG7 A;  3ACH A;  3OGS A;  5JXH A;  3LEI A;  3W5M A;  2DDU A;  2J1E A;  3K46 A;  5EJZ B;  4XUT A;  1O59 A;  2QQL A;  4A42 A;  2XQX A;  3III A;  2WO3 A;  5IJR A;  4CU7 A;  2BBA A;  2OKX A;  4QB1 A;  4AAX A;  4OMD A;  3WF2 A;  3IDA A;  1PMH X;  2J1T A;  2W5F A;  5IHR A;  1ULP A;  5B4N A;  3ACG A;  4A3Z A;  3T09 A;  5IFP A;  3IAQ A;  4BK5 A;  2VR4 A;  3VD7 A;  5HXM A;  4CU6 A;  1UYZ A;  5DPN A;  3A23 A;  4QB6 A;  1UXX X;  4DEV A;  2VQT A;  3PUI A;  2C9K A;  4OYU A;  1W9T A;  4DXS A;  3GXU A;  3C7F A;  4XVH A;  3DYP A;  4XUR A;  2ZEZ A;  2J1S A;  2EIC A;  2V4V A;  2J22 A;  4CU8 A;  1O8S A;  4ET7 A;  3ZM8 A;  2RJ2 A;  1H6X A;  1KGY A;  5J1X A;  2J7M A;  3UET A;  3FN9 A;  1CIY A;  1UMI A;  2X10 A;  3MUY 1;  2QQN A;  3DYO A;  1JYV A;  3I2F A;  3MV1 1;  4DUV A;  2YB7 A;  3UES A;  2WO1 A;  1PX3 A;  1JU3 A;  1GMM A;  5JXJ A;  3HNB M;  1JI6 A;  3I2H A;  2JE8 A;  2Y6J A;  4D8M A;  1PX4 A;  2WQ8 A;  5I0D A;  3WNP A;  5JXG A;  1EUT A;  1JU4 A;  2R7E B;  4QX0 A;  2VZS A;  4MOA A;  4QPW A;  1W99 A;  2B9V A;  2RV9 A;  2VTF A;  4LHS A;  3FL7 A;  2Y6G A;  2W9X A;  3C8X A;  3C7H A;  2VCB A;  1GOH A;  4MGS A;  3JXS A;  4QX1 A;  2JDA A;  1IQD C;  2VC9 A;  2BGP A;  4FI9 A;  1JZ6 A;  3K4D A;  2VZV A;  2XON A;  1GNY A;  4QDS A;  1NX9 A;  2Y6H A;  2L9L A;  3NNG A;  3PUH A;  5DQ0 A;  1OT5 A;  1WKY A;  4KMQ A;  1J84 A;  2W1Q A;  4JHZ A;  3NJX A;  3ACI A;  4L0P A;  2QQJ A;  3I2K A;  3A22 A;  2V5D A;  2WO2 A;  3I2I A;  3MBW A;  1K42 A;  3T0A A;  1UWW A;  2QBX A;  1GOG A;  2CDO A;  3VD5 A;  3WNO A;  4E8D A;  2WAA A;  2LW8 A;  1GOF A;  4ZZ5 A;  4KI5 M;  5LA1 A;  3FHA A;  2QQI A;  1WCQ A;  3WNN A;  1US3 A;  1JHJ A;  4XZU G;  2Z4F A;  1NUK A;  4CVU A;  3A21 A;  1W8N A;  2W92 A;  2W3J A;  3WSO A;  1CX1 A;  1J83 A;  4JKL A;  5LA2 A;  1W8O A;  3C7G A;  3OG2 A;  3HN3 A;  2WN3 A;  1UY0 A;  2Y6K A;  3LPF A;  5C71 A;  2HYX A;  2VCA A;  3CDZ B;  3OGR A;  4LPL A;  1UYX A;  3T0D A;  1OF3 A;  4HG6 B;  5DN2 A;  4CU9 A;  3K4Z A;  2WBK A;  4P5Y A;  2VZQ A;  5DMY A;  2W94 A;  1UX7 A;  1HN1 A;  4CUC A;  2PQS A;  3LEG A;  2ORX A;  4AG4 A;  1DP0 A;  4QX3 A;  1GUI A;  4E8C A;  2VMF A;  1RYY A;  3T2O A;  5EIY B;  1DLC A;  2ORZ A;  3HJR A;  2Y6L A;  2VZU A;  4BDV B;  2YC4 A;  3VDB A;  4DXR A;  1JZ2 A;  2YC2 A;  2ID4 A;  3P6B A;  2VZ1 A;  2E26 A;  4PT6 A;  2J1V A;  3WNM A;  3I3E A;  3MV0 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...