2J1VA

Structure of a streptococcus pneumoniae fucose binding module in complex with the blood group h-trisaccharide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
b'KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
molecule tags Carbohydrate-binding protein
source organism Streptococcus pneumoniae
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor
pubmed doi rcsb
total genus 39
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1vA00
5CYYA 3UNPA 3SKVA 3LQCA 4QAWA 2R7EB 3NNGA 2Y6JA 3NJVA 2W47A 3HOBA 3U37A 3A21A 4D8MA 3VD3A 2ID4A 5JXIA 4JKMA 3FHAA 5C70A 3T0DA 4MGSA 2X05A 2WO1A 1O8SA 4A42A 2BZDA 2J1EA 3LPFA 4BK5A 1UY4A 4KMQA 2E26A 4OMCA 2VJXA 2WABA 3CZUA 1JZ7A 1NAEA 1UZ0A 1W9SA 2HLEA 4KWUA 2VTFA 2VMEA 2YC4A 4W8JA 1H6XA 4CU8A 4MO3M 4JX0A 2PQSA 4A6OA 1OT5A 2C26A 4OUEA 1YQ2A 5CZKA 5HXMA 2X10A 3MBWA 3HEIA 2VQUA 5LA0A 2VCBA 5G04L 4XZUG 1L7RA 2VCCA 1JU3A 4P5YA 5DPNA 3BGAA 4RYDA 1KEXA 2WAOA 5B4XA 4LHSA 4UAPA 1H6YA 2Y6GA 5EJZB 3C8XA 3HN3A 4JHZA 1UYXA 1CZSA 1SG3A 2VZPA 3MUY1 1UXXX 3ACGA 4M4PA 2WZEA 2Y6HA 2QQLA 3IDAA 4JKLA 5LA2A 4AAXA 3LE0A 5JUVA 3C7GA 3WF2A 4QDQA 1J83A 4E8CA 3LEIA 3JXSA 4CUAA 5F7UA 3OG2A 2KD7A 4CU9A 2WBKA 4CUBA 3VD9A 3ACHA 1GUIA 1SHWB 2VZTA 2ORZA 1F4AA 1JZ6A 2WZ8A 3FL7A 3C7HA 1US2A 1HN1A 2B4KA 4QX3A 3NRUA 4QX0A 2W46A 1OF4A 3K4ZA 1UY2A 5LA1A 3T2PA 3I97A 3PUIA 1RYYA 2VZQA 2ZEXA 2V5DA 3CIHA 5EIYB 1K12A 1W99A 3CQOA 3IAQA 1O8PA 1JI6A 2J1VA 3WQBA 1UWWA 1CZTA 1XNAA 2XOMA 3MUZ1 2RV9A 3VD5A 4A45A 2W1SA 3WNNA 1OF3A 2VZ3A 2BGOA 4YPJA 4DUVA 4DEQA 4W50A 2VO5A 1JZ4A 3K77A 1GOGA 4ZZ8A 4CU7A 3CKHA 4ARYA 1F4HA 1US3A 2YFZA 3T0BA 4FI9A 2VZRA 1L7QA 2QBXA 5DMYA 3I3BA 2VL4A 1GOFA 2V72A 3P6BA 3FHQA 1GMMA 2VZVA 1UMIA 1UY0A 4E8DA 1EUUA 4DEVA 1JYWA 2VQTA 3T09A 4ZY9A 2WO2A 2XHNA 3MV01 2JE8A 2YG0A 2QQMA 4BJ0A 3I2GA 2JDAA 3IIIA 3UETA 3VDCA 4BXSV 2Y6KA 4QB6A 1D7PM 2J1TA 3MO4A 1R64A 2E32A 4BDVB 5JMOA 4QX1A 3SKJE 1UY1A 1UYZA 3WNPA 2WAAA 2J7MA 3OGSA 4CVUA 3OEBA 2QQIA 3BN6A 4GWIA 2ORXA 5IYYA 1DLCA 3MV11 1KGYA 2Y6LA 2YB7A 3K75B 3SEPA 1WKYA 2BGPA 2EIBA 3HNYM 4XUPA 1CZVA 3GM8A 4LPLA 2XQXA 4XUTA 4OMDA 3LPGA 1WCQA 3I2HA 3CDZB 4A41A 2QQNA 2LS6A 4BK4A 3CZJA 4XVHA 1XPWA 2VZUA 5JXHA 2W5FA 3WF4A 2ZEWA 3EB7A 2W1UA 2VCAA 1NUKA 4QB1A 4XURA 1GQPA 3I2IA 5IFPA 1I5PA 2J1UA 2ZEYA 5HPOA 2LW8A 4DXSA 5B4NA 3WF3A 4M4RA 3GGLA 3J7HA 3D3AA 1JYNA 2BBAA 5G05L 5JXJA 4L0PA 2W94A 4LKSA 3DYOA 3T08A 3OB8A 1JZ2A 3GXUA 3C7EA 1O59A 2VOTA 2HYXA 1PX3A 3DYPA 1GOHA 1JHJA 3GDBA 1LNSA 3WNOA 5DN2A 5IJRA 4RN5A 4ZXEA 3W5NA 4QPWA 1PMJX 3T0AA 2J1SA 5C7GA 2WN2A 3ECQA 1JU4A 4A4AA 3C7FA 4TXWA 3K4AA 3K46A 4MOAA 4DXRA 3E1F1 3WEZA 4ET7A 3A7QA 4XUOA 4DUWA 2W1QA 3WSOA 1K45A 1UY3A 3ABZA 2QQJA 3NJXA 2DCKA 4A44A 2VM9A 1JZ3A 4CU6A 4XUQA 3DYMA 2V4VA 5DQ0A 3IAPA 1W9WA 1TVGA 4DXTA 3I3EA 4MADA 2VZ1A 1NKGA 4GZ9A 2WUHA 4MGQA 3ACFA 3PUHA 1EUTA 1XNTA 1UMHA 2Y8KA 5EJ1B 3I3DA 1OH4A 1K42A 4A3ZA 1W8OA 3C7OA 4P00B 2W92A 1SDDB 2W95A 2WDBA 2J1RA 2QQOA 4GWJA 3LEGA 5IFTA 2W9XA 3OEAA 4OYUA 2Y64A 2B9VA 4KI5M 2EICA 1GNYA 2E33A 2VMCA 4AG4A 2Z4FA 3VDBA 4D0QA 3VDAA 2W87A 1JYXA 1UYYA 3WF1A 1ULPA 3HJRA 3I2JA 2QQKA 3I2KA 5J1XA 4DUXA 2CDOA 2XONA 3OGRA 3EYPA 1GU3A 4QDRA 2WO3A 3F2ZA 3OGVA 4OZOA 1J84A 2E31A 2X09A 5LCWL 2JKXA 1OD3A 2VR4A 5IHRA 4PQQA 3AC0A 4ARXA 1ULOA 4UI9L 3WF0A 3SEEA 4PT6A 1CX1A 2W91A 1UXZA 2RJ2A 3FN9A 3T2OA 4JKKA 5I0DA 2CDPA 4UOJA 3LEKA 3UESA 3THCA 1UX7A 4IUGA 1CIYA 3WNKA 3VD4A 2ZEZA 3NQHA 3K4DA 2OKXA 2JD9A 5A1AA 2WQ8A 4CUCA 4Z2AA 1IQDC 2VZSA 4PF1A 4QX2A 1DYOA 3A22A 2L9LA 1NX9A 1MPXA 1TG7A 2WN3A 2WYSA 5JR2A 2DDUA 3IB3A 4XUNA 3DECA 1T2XA 4HG6B 3P1IA 5FUIA 2J22A 2VC9A 1JYVA 1JZ5A 2W1WA 3VD7A 4QDSA 3OBAA 4W4ZA 2YFUA 1W9TA 2C4XA 3WNMA 2RVAA 2W3JA 2VMFA 4ZZ5A 3CMGA 4P02B 1W0NA 1BHGA 2VZOA 4TTGA 3A23A 3I2FA 3WNLA 1P8JA 1K3IA 2C9KA 3ACIA 3HPNA 1XC6A 3ZM8A 3ETPA 2BERA 3HNMA 1W8NA 2DCJA 2J1AA 4LQRA 1PX4A 5C71A 1JZ8A 1PMHX 2EIDA 4QB2A 2YC2A 5JXGA 3THDA 4P08A 2EIEA 2VMDA 3W5MA 1DP0A 3HNBM 2ZXQA 3T2QA
chains in the Genus database with same CATH superfamily
4LIVA 1MQTB 1O4ZA 1PGW2 4IEOA 4LKDA 5CFCB 5FOJB 3LQCA 4QM8A 3O7OA 2GMMA 2Y6JA 3NJVA 4LOSA 2FDJA 4PF5A 1X9PA 1QXPA 2W47A 2WRAA 1GQGA 4DFSA 3RQ0A 1AXYA 4AVSA 2DFCA 1S0FA 3A21A 5FP4A 2H0BA 2RM23 1AL0G 4BISA 4N53B 2CWSA 2BWAA 3HR9A 4I0WB 2QZ3A 3OY8A 4JGZA 4XIKA 1LOCA 5CKQA 1X8MA 5DDJ3 3OF1A 2MEV3 3T0DA 3K3NA 4MGSA 3RG0A 5LWBA 5B2GB 2X05A 4XFBA 5SV8A 1J1TA 2QTWB 3RJ2X 1GYKA 3VBUA 2WZR2 1PMIA 1QJU3 3VBUC 5C33A 3VUOA 3FJSA 4LBOA 4YW1A 3UJOA 4CEYA 3ZFEA 5F32A 5KHKA 1ULFA 1A3KA 4FBFA 3FWEA 3GJAA 4KMQA 5K0UA 1G9DA 5F2WA 2VJXA 2WABA 2TUNA 1QJY3 1ZBE1 1SQ4A 1U5YA 3ZVXA 4IESA 3BTYA 5H9QA 1ZZ6A 1W6NB 5C3QA 1JS9A 4V1PA 2VD7A 2O8QA 1RTVA 2F4LA 4CU8A 1FPN1 1QJU2 1BBT2 1W0PA 4A6OA 2YU1A 1JOBA 2RG4A 1JYCA 1XSRA 4LLFA 2VPVA 2DU1A 2OZJA 1SFNA 1RUF2 3SITA 3SCGA 3Q8AA 5FMCA 3VL8A 5DUXA 5LA0A 2VCBA 4IEVA 4PJYA 4KU8A 2WNEA 3HT2A 1AX2A 1AR72 1PO21 4XTMA 2R49A 1JN2P 5DPNA 1X82A 3BGAA 2VH9A 3KV5A 5B4XA 3Q8BA 4AHYA 1QJY1 4LHSA 1RUI3 2RR13 3IPVB 5CKNA 2PHLA 3VBOA 1T6BX 4UAPA 1OUSA 4NHLA 2Y6GA 2PHXA 3C8XA 5EJZB 4JHZA 1UYXA 4K9SA 1I5ZA 4Q4X2 1CZSA 1G9CA 4H55A 2B8MA 3MUY1 1WW4A 2GU9A 1QH6A 2XL9A 3BPZA 4OULA 4KBBA 2NPIA 3JBG3 1XE8A 5A6QA 3IDAA 5LA2A 1D4M3 3LE0A 3N7MA 4MLOA 3C7GA 4CEYC 3WDXA 3RZGA 3WF2A 4GH4C 1PVXA 4QDQA 5K9YA 3ZFFA 4YZ1A 3LEIA 4B29A 3JUUA 2ZMLA 2P4EA 2JIJA 4LBLA 2YU2A 4ZU5A 5AC93 5J3UA 2WSVA 2Y26A 3T3YA 3M3OA 4BA6A 3O14A 5C8CA 1PO22 3SCHA 1LGBA 4PHZA 3Q8CA 1AR62 3VKMA 4D7SA 2CHHA 5FREA 4DZGA 2I74A 2R0FA 4DNYA 4FP3A 1AYM1 2WZ8A 3P3NA 3NSTA 3QH7A 3AYDA 4QX3A 1JMUB 3HT1A 4WM7B 4QX0A 5JZGB 1HXS1 4LO7A 3LZZA 3K4ZA 1UY2A 5LA1A 5FYSA 3ZMOA 3I97A 1GZWB 1WBLA 4XFAA 5IVVA 5GLWA 3BUCA 4QXBA 4ZU7A 3CIHA 2P2KA 2CSGA 2BOIA 3AZZA 4K20A 1OVSA 2RJKA 1NE6A 2DTWA 1JI6A 3EXUA 3HWJA 3WQBA 5HCBA 4KU7A 4AFAA 4F3JA 1UWWA 4CTEA 1COV1 2JDKA 5CNAA 1WUVA 2VY0A 2GNTA 3JB4C 5KC6A 1MEC3 2ZX3A 4QX7A 4HXCA 5GKAC 1RMU2 3WNNA 4WM7A 3SXWA 3AYAA 3VZLA 3WP4A 4HN1A 2QQUA 1PIV1 1AYM3 1UIKA 3KLSA 3DN7A 4FOWA 1FMD2 4Q26A 2WIIB 4YVSA 1PGSA 3J8F2 3JB8A 3N9PA 1O7FA 2ATFA 4W50A 1RUH3 4UWDA 4YG3A 5T5PA 4MHUA 1UPIA 2VW1A 4ZZ8A 3HQXA 5JR7B 4PI2A 1F4HA 2PTMA 3AP7A 3T4HB 1W03A 2YFZA 2FQPA 1DQ4A 1F35A 4LA2A 1ZRDA 4IXLA 1DGWX 1AL22 4YW2A 5D8AA 4Y24A 3DPRC 2V72A 5T5JA 1GMMA 3H1MA 4CXYA 3H8XA 3R4UA 3O1MA 1H8TC 1EUUA 4OHWA 4DEVA 5FJHA 2XJUA 2QQPA 4QHZA 5F8PA 3T09A 5FZGA 4FPJA 4PQ9A 4DXZA 2EXKA 4GA9A 3LA3A 2JE8A 3LKJA 3VDDA 3ZMNA 3WDYA 5FYUA 3ZYRA 3I2GA 1WD4A 2JDAA 4NAOA 2F6BA 1YEWA 1WZXA 2E63A 1TNFA 2Y6KA 3CJIA 3N3HA 4NMIA 5F37A 2P5BA 3BKZA 2J1TA 1GNZA 2VE1A 3MO4A 2X8KA 1YYNA 2E32A 1H9WA 5JMOA 4QX1A 3AXEA 4K21A 4HKWA 2V09A 4JGYB 5LZ6A 1PK6A 4KBZA 4NHKA 1QNYA 2MEV2 1UYZA 3E5UA 1MACA 5F3IA 5ERLA 5KXCA 3OGSA 4LBNA 4NRQA 4DMIA 3POSA 1CVNA 3OEBA 5BNQA 2QQIA 4CUGA 1XU1A 1LENA 1YO8A 1IKPA 4GWIA 4ZS3A 1STMA 4B7EA 1OLQA 3MV11 3WDUA 1KGYA 1Z7S3 2YB7A 3H8UA 3ZYPA 5T5LA 3ZFEB 1WW6A 4N43A 4PBOA 2EIBA 3HNYM 4NAMA 1RGSA 1MS9A 2QDRA 5A7SA 3RWNA 1C1FA 4XUTA 1H8TB 2OPKA 1ZRCA 3LA7A 3GNEA 5FP7A 4Q0PA 2C24A 1MQTC 1YC61 1Z78A 4CEWB 3I2HA 1JYIA 2XKPA 1EV13 2RS32 3CZJA 4BK4A 3O1VA 1H4GA 1F31A 4LORA 5CKMA 2ZX0A 3K3OA 2X29A 1VBC3 3EB7A 2PLV3 4OVEA 1R1A1 2KM2A 3MLKA 4IE5A 3ZIWA 4K6BA 5FYYA 1H4HA 3F95A 4TLFA 5IK8A 1MR5A 3VBSB 4X6RB 2J1UA 1Y3TA 2ZEYA 1YJLA 4BQ4A 4QQOA 2B7YA 4AQTA 5KHGA 3KCYA 5IW0A 4LBMA 1TME1 3SQOA 3KF5A 3KV9A 3GBWA 2WO7A 1CPMA 1SACA 4A7YA 1JYNA 2Y33A 2D6MA 2OIIA 2JG8A 5G05L 3LEMA 2QUOA 3T08A 5FY4A 3PTRB 4UW6A 1SZBA 1RUD3 2HBUA 4WBBA 2PMWB 4NUBA 4TLGA 5I8TA 4MHRA 1G9BA 1OC1A 2HWC2 1PX3A 1MS1A 1BXHA 1RUNA 1GOHA 2DV9A 4H14A 4CCMA 4QM9A 4BQ1A 4NWWA 4XDQA 5FUNA 2NZ9A 3GDBA 1LHVA 4XF1A 3OBZA 4ZXEA 3VZKA 2XWJB 1PMJX 3T0AA 1WW7A 3FE5A 3EO6A 1OVPA 2JDYA 1W8TA 2GC0A 4FPFA 4XACA 4ZONA 2HWD2 3MEPA 5FYMA 1XNCA 4TXWA 3RMXA 4K1YA 1WGPA 3IIAA 4NRPA 1S0GA 4N7UA 1YUDA 5FZCA 3M3IA 1UZYA 4ET7A 1DQ2A 1KS4A 4CDQC 5A6XA 1GP6A 1Q3EA 1SBDA 1V00A 2W1QA 3X29B 1WBFA 2TBVA 2MHFA 4BU2A 2YYOA 5DABA 4NHXA 3HQUA 5FYBA 1JZ3A 3IAPA 4IGQA 2RMU2 5CFDA 5C4WB 2OQ7A 4E8DA 1SBFA 5AFBA 2CY6A 1ND2C 1AF9A 4U2AA 5D8AC 5FY8A 1RUI2 2RR12 3WZ1A 2VZ1A 5HV0A 5JOWA 4YFWA 1ZVFA 2FCUA 5FZMA 2D3PA 4W65A 1OOPB 1XNTA 1RUJ3 3NNLA 3ES4A 3TEXA 3BYWA 4URAA 2Y8KA 3GALA 3I8TA 2DBIA 5EJ1B 2X5IC 3APBA 3ZXLA 4BMEA 1G7YA 3BPSA 1RVF1 3I4IA 4BE3A 4E2SA 3C7OA 1Q8QA 4IE7A 4JGYA 5JOYA 5FYVA 1JXNA 2IXCA 2RDNA 2J1RA 4K3UA 4RR3B 1OKOA 2NQYA 3LEGA 1LOEA 2QJVA 3CJIB 1AXZA 2WS92 3OEAA 4OZXA 2B9VA 1GNYA 2VMCA 4AG4A 3GZTB 4DIQA 1RJ7A 2Z4FA 1SLLA 4RD7A 4D0QA 1Y9QA 4JQRA 3N9LA 1LOGA 4Y1XA 2GMEA 1F5FA 2ETEA 2HWF3 2EIGA 2EAKA 2PHTA 4AOCA 5BNOC 3ZYJB 4NPLA 3WF1A 3U4XA 1VMHA 1C5IA 4MH0E 1EV12 2RS33 3I2KA 4NIIA 1UOJA 1TMF2 2WT0A 4EV0A 2XONA 3IDEA 3OGRA 3WUDA 2GAUA 3CNAA 5FZ3A 3ENRA 1IKQA 5CBLA 4JAAA 1OA3A 4EJRA 4Y5SA 4I3GA 4XFCA 1K5MB 4N53A 4AEKA 5JOZA 3WW3A 3OGVA 1GP4A 2X09A 3H3UA 1CX4A 3POGA 1IG0A 5FMBA 1JBCA 2XG3A 3TEYA 4FTSA 1QDOA 1ONAA 3AJYA 3OPTA 1NQJA 3AC0A 4EQVA 3POJA 3FUOA 3KT4A 3USUB 4LEJA 5L7OA 4E4HA 3PUAA 2G1MA 4PT6A 1L7LA 3BI3A 1CX1A 2PLV1 2WFPA 1MZEA 2R041 4UXAA 3FN9A 4BIFA 4OHZA 1RMU3 4XCAA 4JKKA 4EN7B 2CYFA 1CONA 3FLPA 2VBPA 3WQ7A 3AJZA 5C3SA 2HWB1 3IWZA 1PZ9A 3N7JA 1H1IA 1RUH2 4S2FA 1ENQA 1VRH2 3V0BB 1BK1A 4COZA 4NIDA 4Y3OA 4JDOA 1OSGA 3NQHA 5A7WB 1PNGA 2W0XA 4IV1C 2AGSA 1FNYA 1GFF2 2JD9A 2UYBA 5GZEA 3KVBA 2VZSA 2ZMKA 1NQDA 4PF1A 4QHOA 4QX2A 5AC92 1YWKA 4QPGC 1CWPA 5A3OA 1HRI3 4NPRA 2EALA 2BNNA 2WNVB 3IB3A 4GULA 4K40A 1T2XA 2XWBB 4UT5A 3P1IA 2DVAA 4IERA 1E57A 2WS91 3O0WA 3PMSA 5FUIA 3NO8A 4BZ4A 2XGXA 4M3CB 5T54A 1RMU1 4NO4A 4D6SA 2Z79A 1KQRA 1LEDA 4QDSA 2CTVA 4HPKB 2A3WA 3WX5A 2C5DA 2KR2A 2D6NA 1G9AA 4QKBA 4UFKA 3IMNA 1HN0A 2A7AA 2OZ6A 2RDSA 4O9GA 4XZPA 2WFF2 5IUQA 1ZREA 2FDHA 4URTA 5GJ6A 1LU1A 3A23A 3I2FA 4YSFA 4QU2A 1GLHA 1FPN3 4Q4Y2 5M0TA 3DGTA 3UGGA 1UMZA 1KITA 3ZXFA 4M00A 3OJBA 5IAVA 5I0RA 3SHRA 4C1WA 3RPQA 3ETPA 3R6SA 1RUG3 5GALA 2YXSA 1S55A 3MHZA 3NAPB 4IE4A 4O65A 4XQDA 4YW7A 1QF3A 3VV1A 2JB8A 4EYUA 5LK7B 2J1AA 2Q0AA 1PX4A 3NV2A 1PMHX 3U11A 2Q8EA 3UGHA 3VBSC 4ZXKA 3OGJA 3P3PA 3TNPB 5JOXA 5FYHA 4B4QA 5FLIA 5FV3A 2YROA 3TYJA 3KZ4C 1YFWA 1W6MB 2V73A 3UKNA 1N3QA 3PL0A 4FFFA 1UZZA 1S0BA 1ZBE3 3B7MA 3IN9A 4P9GA 3GBGA 4R9CA 4HK9A 3TWIA 4YARA 2IFRA 4XF4A 3WHUA 5BNPB 2XXZA 3D0JA 2DCZA 4N43C 4XETA 5FZ0A 5CADA 1AVBA 1OPOA 2DWRA 4PBPA 5JPNB 3NNGA 2FDIA 1S4CA 3SLIA 1UU6A 4ZPIA 1CJDA 2WKKA 3AYCA 3U37A 5EPAA 3RZJA 1VPHA 3M3EA 4D6RA 3FFZA 1W6PA 3RZHA 1G9FA 1RUG1 4B3NA 1DYKA 1RHI1 2ID4A 2P37A 1IPSA 1WA6X 2WINB 2Y34A 3ILFA 4XXAA 4GAZA 4YRDA 2EVXA 5FAXA 3WLUA 4CPBD 2BP6A 5C70A 2LUWA 4ZS2A 5T55A 3RVHA 2QVSB 1MS0A 4LMFA 4RS5B 4LHNA 4B4RA 4BCUA 1SLAA 4A42A 2Y6FA 4LJHA 1VAVA 4AI9A 2HWF1 5L36A 1AJOA 1RC6A 1RUI1 1Y9GA 2RR11 3NKGA 4WVVA 5E1RA 4CCOA 5AFEA 4P9XA 4GJYA 4QPGA 4XAAA 4EN9B 2E26A 4OMCA 2JG8B 3CZUA 5JZGA 4MG2A 1TME2 5A3LA 4Q8LA 1W8UA 4IEQA 2DUPA 3OD0A 1W9SA 4BLJA 5A3PA 1NCRC 3TN91 2ZGMA 3UKVA 4KWUA 4FO9A 3V56A 4Z2WA 5KR7A 3E97A 4IEUA 4D69A 3H8RA 2IXJA 4JX0A 1VBB3 4QXCA 4CDQA 3FUQA 4WM7C 4OI0A 2FBEA 1YQ2A 3U75A 1AYN2 2ZA9A 4IETA 3MBWA 5CFCA 2ZGTA 1PZ7A 3I49A 5AC91 2Q8DA 2VQUA 4KGQA 2BWCA 2GP5A 1QJX2 5DDJ1 4ITCA 2AYHA 1DF0A 3ZX7A 4CEWA 2VCCA 3WG4A 5AVAA 1FV2A 1K5JA 1GZ9A 1SLTA 1JU3A 2YMZA 4P5YA 1F9KA 2XBO1 4RYDA 3CBNA 3L2YA 1KEXA 2PHFA 2WAOA 4YM1A 5DZGA 3WDVA 5JIAA 4F83A 4K7JA 3H0OA 5F3EA 5FWJA 1WCDJ 5A1FA 1GICA 4RFT0 1Q8SA 4FT8A 4RFRB 2EAAA 1A6CA 1DIWA 2BVBA 2RM22 3H42B 4DINB 4AR2A 1SG3A 4Q5OA 1LAJA 3UJQA 1N3PA 3LD8A 3BB6A 1UXXX 3V0BA 3ZYBA 2GP3A 1IOAA 4M4PA 4HOOA 1YIFA 2Y6HA 4AAXA 2VOVA 4JKLA 5FMOL 1PGW1 1VALA 2JG9C 5FOBB 5JUVA 2RM21 4UF0B 3J8F3 3LF7A 3AFKA 2YY1A 2GNDA 1EAH3 5FK7A 4E8CA 2Q30A 3OUHA 4BQ2A 1H1AA 1PO13 4CUAA 5F7UA 3OG2A 4CDWA 4Q4W3 1LKNA 4C0HA 4RA0A 5A70A 1XSQA 1D2SA 3R0RA 4JZRA 4Y4RA 5KHHA 3LOIA 2SBAA 4CUBA 5F3CA 1GUIA 3N7KA 4JVAA 3VD9A 1FOD1 2VZTA 2ZACA 1VRH3 2LRPA 1W2TA 4Z8BA 1OLRA 4L11A 5D21A 3S5AA 2Z69A 1JODA 1RUE1 4Y20B 2B4KA 2Y60A 3URFA 3AM2A 4Q0UA 4HKOA 3H1WA 4KG8A 3NRUA 3ZXDA 4AFMA 3B94A 1NCRA 2JD4A 1CAXB 3KCXA 4WZCA 1WD3A 3EHKA 2R061 2RHPA 4LHLA 4CEYB 3SISA 2WLPA 2D6LX 2VZQA 1WMDA 2ZEXA 2V5DA 4MGKE 4JDNA 3OPZA 4OQ9A 4FOVA 4V2VA 4OFGA 5IK7A 3IAQA 4GB31 5JIUA 3U14A 2D44A 4QPIB 1OH3A 1GWKA 1MZ6A 3K48A 4Q0SA 5C3OA 4E4SA 1SDWA 3VZMA 1DZQA 3AVRA 2XOMA 3NJYA 4EWDA 2P3JA 5DZEA 5ANNA 5HCAA 4AHWA 3SH3A 5T52A 2W1SA 1LCLA 5L9VA 4IV3C 2VZ3A 2BGOA 4XTPA 4YPJA 4BWOA 1PK6B 5FIXA 2WNUC 4DUVA 5LBCA 4D3WA 1W6QB 5FZ1A 4FQ4A 2VXJA 3KT7A 2MNGA 2XJTA 2VO5A 1JZ4A 3AMQA 4MXWA 4XW3A 2GH2A 3IT8A 1WMFA 3K77A 4AEDB 2VG9A 1OQDA 1RITA 2R063 1A8DA 2W2IA 1KS5A 4GKYA 4CU7A 4NIGA 1XRUA 3EMRA 4M3CA 3CKHA 4JC1A 4BQ3A 5KXEA 1H9PA 3IM0A 4C1XA 4AE2A 3NW4A 1US3A 2PLV2 5FLHA 3KHCA 1Q8OA 3ALQA 2G9FA 3T0BA 3KS7A 4FI9A 2ZHLA 1LODA 1X50A 1IHMA 1W2AX 1YFUA 2VAUA 3FHIB 4XF3A 1RL3A 1HV1A 1J3QA 4O61A 2BOJA 5LB6A 3VBHB 3ZFGB 1NYWA 2VL4A 1GOFA 4HONA 4CEWC 3P6BA 2NP0A 3FHQA 2PQQA 5FYZA 1U5ZA 4GJZA 2VNOA 1UN1A 1UY0A 4EROA 4I01A 5CISA 1GZWA 4FPYA 3ME2A 4IEZA 4AQSA 1UZWA 1VAKA 2ZAAA 3PNAA 5GZDA 4ZU4A 3ES1A 1G8WA 4YYOA 2QQMA 3ZXKA 4BJ0A 2XR4A 5IK5A 3UETA 4BM8A 2FCTA 1S0CA 1ULGA 2AC1A 2VNGA 5A80A 2JDNA 2VUAA 1N3OA 2IVIB 5T50A 4IV3A 1AR81 4RHV3 3KGZA 4GWMA 4CA9A 4COWA 2PA7A 2LM3A 3ZFFC 3ZKUA 4YM2A 2OVUA 2BTVC 2XKOA 1ODNA 3DPRB 4FSJA 1PK6C 1GR3A 1UY1A 4CCDA 3ELNA 3RDIA 2TNFA 4LBQD 1W6OB 5BYNA 2VW2A 4XF9A 2VTXJ 2FHRA 1PVC3 3IDCB 4XHBA 1K5MA 3Q9OA 1RUD2 4CVUA 4Q0VA 3PHMA 3U0ZA 3NV1A 1BBT1 3ORJA 2HH9A 2PN5A 4D6QA 3RFRA 1O91A 4BXFA 1DLCA 3VHPA 1YQ6A 4JTNA 4F8AA 2Y6LA 1RUC2 4CXWA 3K75B 2DTYA 2BGPA 4MUVA 2XJPA 2OS2A 2ZS6B 5FXZA 4C0BA 4CCLA 1XU2A 4CDUB 4HMZA 1AR92 2JIGA 1CZVA 5FPVA 5ISLA 4I2OA 4P14A 4N7IA 3E5XA 1J59A 4YG6A 5F1RA 3OYWA 3LPGA 4G4FA 3S7EA 5GLZA 5IVCA 3SH5A 3FX3A 4LO5B 2ZOEB 3CDZB 3PMEA 4PDWC 2LS6A 3CHXA 4FPGA 4QGLA 1PIV2 1RUE2 4COYA 3AP4A 4YGCA 1N1SA 4K1ZA 2BYVE 4Z07A 1R1ZA 5FYIA 2VCAA 2E7QA 2FMYA 3I2IA 1H8VA 4RQPB 1T6GC 2AREA 1I5PA 5DAPA 4OLLA 3IZOA 3VHOA 2BJSA 1AR91 2R042 5J36A 1W39A 5HPOA 1XE0A 2HEVF 2ZX1A 5B4NA 3RZLA 3GGLA 2FZ2A 3J7HA 1W6NA 5J96B 2RS51 2OUJA 4RS5C 3LOBA 4A7ZA 2ARCA 3FZ3A 1XYNA 5I8YA 1N1VA 2DVBA 3UYJA 5IAXA 2OQ6A 3DYOA 5K0UB 2Q5TA 3OB8A 5BUVA 5C8CC 2JE9A 4P9JA 4QQLA 1X8EA 4BQXA 4YZ3A 2ZCWA 3W20A 2UY8A 2OYZA 4DY3A 1H0BA 2VOTA 4R4XA 2BU9A 5IK4A 2ZGUA 1NCRB 2VNVA 4QPIC 3ZXAC 4QU1A 4YM3A 1JHJA 3ZYIB 1X7NA 4AF9A 3NL1A 1LNSA 4YVWC 4NE9A 2ZMNA 3WNOA 5FO8B 4Y1VA 4COVA 3DEMA 1GZCA 1MZ5A 4RN5A 1AX1A 2XBO2 3AP6A 1DZTA 1LHOA 2ZGSA 4PLOA 5L9BA 2WA3A 3W5NA 4CDXA 3VHRA 4YM0A 5F9TA 4L2NA 5AVPA 5C7GA 2OX0A 1DG6A 2O14A 1WCUA 1OFSA 3H7YA 1POV3 1C57A 4CPBA 3IDBB 5CU1A 1UPSA 5F6KA 3WR0A 4ATFA 2PXJA 1QDCA 2DCTA 5C6CA 1W0OA 3HD8B 4GH4B 2XJRA 4LHKA 3VBFB 1DLLA 3ABZA 1QOSA 3QBQA 4A44A 5FXWA 1HB3A 1RIRA 1LGNA 1HB2A 3W58A 3D8CA 3N9MA 4XUQA 1W28A 1TEIA 3MW3A 5DZFA 3ITQA 4YW6A 3MF9A 3WG3A 3GZUC 4A7KA 3UV9A 3I3EA 5FZ7A 3POEA 1GBGA 1JW6A 3KCCA 4IDZA 2R0HA 1ZM1A 5KWRA 5CAZA 1DU3D 2Y0OA 4GZ9A 2BNOA 4TZDA 1IS3A 2D93A 2WSUA 4XXPA 5D8AB 5JAXA 5FBJA 3S7IA 1EUTA 1ULDA 3KB5A 1AYN1 4GH4A 4I09A 2XLFA 3ZPOA 2D6OX 1MVQA 1YLLA 4OI1A 4OQ8A 1W6OA 3VBOC 5FQ0A 1QQP3 3I3DA 3AKTA 1OH4A 4OI2A 1FMD1 1FV3A 1W8OA 4GMP0 4A3ZA 4P00B 1LB2A 1JOJA 2JG8C 1I3HA 1YIPA 2SLIA 4S2GA 4E27A 4LKEA 1R082 4LTAA 4QKDA 3ZOIA 4J6GA 2QQOA 2QQWA 2XUMA 5DUVA 3USUA 2R1DA 4WV8A 4UFLA 2W9XA 4OYUA 1XQNA 5FZFA 4RR3C 3RMYA 4L99A 3I2DA 3ZN6A 5F5IA 2IUWA 1PO12 1RUF3 4EN0A 3VDBA 3D4KA 3GYDA 1UD1A 5J37A 1RXFA 4QPGB 1B35A 4LO6B 1OOPC 2OW4A 4BH9A 4FPEA 3WINE 3LSDA 1LESA 3HJRA 4ASLA 4FP2A 4MGZE 5H9PA 1RUH1 4MGTA 2JICA 2CDOA 2BV4A 2D7FA 2JDZA 5A7NA 5J09A 1PHMA 2EXJA 1C8M2 3HVDA 1TE1B 3POBA 2GDFA 4NIAA 2E9QA 3N9NA 3AVSA 2XLGA 2RS11 4Q0QA 3H3ZA 4PCRA 1J84A 1LULA 2XVKA 2ZGPA 1EY2A 5GZFA 4B7KA 4Y1UA 2I07B 2VVFA 1QJX3 1TQ5A 1NXMA 4R52A 2IWGB 1UOGA 2RS52 1C8NA 5FZHA 2OT7A 3BU0A 1VMFA 4LUMA 4YGDA 3SEEA 4AK3A 3OUIA 3MIDA 1ND2A 1ST8A 1W6QA 3G7DA 3RJRA 3T2OA 1E5SA 5HBAA 3M70A 1EPZA 1PO23 2A71A 3RS6A 5FMOS 3VGIA 3CLPA 3MPPG 4LO4B 4QGNA 2ZGQA 3B02A 1LRHA 3LEKA 4QPYA 5FK8A 1F5JA 2WT2A 2A75A 2RS31 1ZBA1 1ZRIA 2AEZA 2JDMA 4IUGA 3M7AA 3N35A 1CAVB 3L2HA 4FOQA 3WNKA 2ZEZA 3VDDC 4WVWA 2UU8A 5FCCA 2DBNA 3K4DA 4R9DA 5F2SA 4BYYA 1UU4A 2QKDA 1CAVA 1C3HA 2F4PA 1A34A 5A1AA 1CGPA 2WQ8A 4CUCA 1JUHA 2WFF1 1IQDC 1SCRA 1X36A 3LWCA 2VECA 2NLRA 4YZ2A 4F7ZA 1ND3B 1UCXA 1OFNA 1YHFA 3ZKYA 2FD8A 5HXVA 3ZYHA 5C5TA 1WA4A 2FZ1A 1CR7A 2VW0A 4XUNA 3T30A 4YW3A 4NIHA 1GANA 3DPRA 4C90A 4DRVA 1JZ5A 1W8HA 1FOD3 2GH8A 5HCFA 4L9BA 4OI4A 3ZXJA 1ND2B 3WW2A 4DQAA 3OBAA 4MGIE 1W9TA 4FCAA 2A6ZA 3AMPA 3AMMA 1JHNA 2VQAA 3ZSLA 1UX6A 3QH6A 5KHIA 4ZZ5A 4XABA 2ZX4A 1YNAA 1AXKA 3FC0A 4HFSA 1W0NA 1O4TA 3ZPYA 5CG8A 1F8VA 4R9BA 4I0AA 2K0GA 4UBHA 4FAGA 5JPMB 1ASJ1 1R083 1P8JA 2VMIA 5DXDA 1K3IA 2CU5A 3IMMA 5FY9A 1AR61 1Q43A 3KHBA 3PIGA 3FLTA 5A3TA 3MIEA 4XFIA 1Y43B 2D40A 3ILRA 1AR83 2D6KA 3GCWA 2VUDA 4HANA 1WCKA 2DCJA 1JZ8A 5A32A 1RINA 1YQ5A 2BVVA 3VZJA 4HLTA 2OUHA 1SPPA 2EIDA 1RUG2 1NY72 3WQ1A 4CP9B 2ADEA 2YC2A 3THDA 2EIEA 1HX6A 1VMJA 3W5MA 4XF0A 5EV7A 4Z92B 4XFHA 1V70A 5FBZA 5IVJA 3J7NA 5LBEA 2GC1A 2R16A 2XUEA 3HNBM 1UO9A 4ASMB 2H6BA 5DAXA 5L7OB 1XYPA 5CYYA 3I2OA 4MXWB 4Z1VA 5ACA2 3RYKA 4QAWA 1DQ5A 1XE7A 4KL1A 5FDBA 5C8CB 1QIQA 1VJ2A 4RQPC 2B46X 3HOBA 2WZR3 4PLMA 2ZGNA 1B35C 4N8MA 2XVGA 4META 3AYEA 1S2EA 4CDXB 1QOOA 4D8MA 1CQ9A 1W3VA 2G4IA 5FQ0B 4K8RB 1RXGA 3VD3A 2FDFA 4S2DA 1CD3G 2Z2SB 2WWUA 4JKMA 2LROA 1QJY2 2WWJA 4YVWB 5K0UC 3GHNA 5LY2A 3LFMA 1RUF1 5ANQA 1R1A3 1WLDA 3B9CA 4EN8B 4EZ4A 4UFIA 1O8SA 5FWEA 4CP9A 1QWRA 2J1EA 1LOBA 3ZDSA 4Y5TA 1JYTA 3LPFA 1SFPA 1NLQA 2VOKA 4Q4W2 3MIHA 1VBD2 1IZ3A 3MW4A 4EWAA 3IPVA 1HQNA 2RMU1 3M3QA 1QH7A 1UW8A 3E6DA 3NV4A 1S0IA 4HZFA 4FOYA 5E89A 4B8EA 2VTFA 2VMEA 4W8JA 2XLAA 5FPAA 1H6XA 3HMYA 2E51A 3O5SA 4MO3M 2YUEA 4HSLA 5C4WC 2A5ZA 1OT5A 2VMHA 1CAUA 4OUEA 1HRV2 1NZIA 5CZKA 5BY5A 2QE3A 3MLJA 1HJFA 1H2LA 4XJAA 5FR3A 2QFEA 4XAEA 1YXWA 4Q4W1 3SNMA 5EQUA 5BNPA 5GZGA 1CAWB 5FY1A 4RL7A 3HEIA 3O1OA 2YDEA 4J1XA 4Q8KA 1O3TA 4YNIA 3ZLIA 4JV4A 2R32A 2YBSA 1BJQA 3KQRA 3KVAA 4LA3A 2UURA 2VNRA 4WM8C 3INAA 5FZDA 5BNNA 4CYDA 1ACCA 4Y33A 1X33A 2PAMA 3PVOA 4XFGA 3HN3A 3NAPA 4FFIA 2VZPA 1U12A 2D98A 3POWA 1AR73 4OCTA 5E6HA 3ACGA 4P9IA 3MZHA 1VAMA 5FZOA 3I3MA 2QQLA 4AEDC 4CSWA 2ES3A 2YBPA 3R4DB 4FFGA 3WCSA 5LY1A 3JD72 4FPOB 1NT0A 3USSA 3JXSA 3V64A 4RGGA 3LAGA 1PM7A 5F5CA 3RSJA 4CU9A 1VBC1 1NA1A 1HQWA 4CRQA 3MGUA 4RQPA 3WVJA 4CZSA 1H1MA 1SHWB 1UL9A 2G9GA 4CDQB 1BEV1 1GNHA 3THPA 1LGCA 1VB2A 3C3VA 1DYPA 2BQPA 3ON7A 3KD4A 3H50A 3PU8A 3KSCA 4K8FA 5DUWA 3VKNA 1H30A 1W04A 2BBVA 1E5HA 3C7HA 1US2A 5C3PA 1WMEA 1NG0A 4CCEA 3DF0A 2Q1ZB 4DS0A 3KM5A 2WZPP 1AZDA 4JGYC 1ASJ3 2ARXA 2W46A 3I54A 1RB8G 2A70A 1VBE2 5BV6A 1SPPB 1XNKA 1JH5A 1I9RA 3WCRA 5A32B 4B1LA 1W99A 3VBRA 2I2SA 3CQOA 4YVSC 1XB9A 3HN1A 3JD73 1O8PA 2A1XA 2VU9A 4NJ4A 1AUYA 4XHXA 2XPJA 3POFA 1VBD1 1AL23 2VVEA 3RWKX 3LDKA 5A3MA 4MV2A 5KXDA 5C3RA 1VBE3 4A45A 2BW8A 2GSYA 3D82A 4Y1ZA 3PU3A 5JCTA 4HVQA 4NN0A 5C9AC 2UY9A 1YQCA 5IVBA 3ZSEA 2ARBA 4XEZA 1VRH1 1EAH2 1GOGA 5CG9A 1ZBA3 2HWB2 4PI0A 3S30A 3CEWA 2IC1A 2IZWA 5KHJA 4CCJA 3H8OA 1B09A 4AXOA 5EZWA 1FXZA 3N4MA 4QGMA 2QQVA 2GC2A 4NRMA 4ARYA 1H8TA 4KGGA 1KXGA 3RZZA 3ZFFB 4AHZA 3A0NA 3U1XA 4L8QA 4UBGA 1OA4A 1W8WA 1ODMA 3A0KA 4IE0A 2D5FA 2DVDA 3BOWA 4KWKA 3OPWA 5L19A 5EYYA 5DMYA 2WL1A 3MIGA 3P5BA 1NA1C 2VZVA 1UMIA 2FDGA 1SFYA 2I45A 3U78A 1XNBA 3MF6A 4IV1A 2A3XA 2B5HA 3BALA 1PIV3 3FBYA 3IBMA 3UT0A 1KD7A 1PZ8A 2IFWA 1NY71 3AKPA 2VQTA 1JYWA 4PDWA 1BYHA 3NMBA 3VBRC 2VBBA 1QXJA 2HWD1 2WT1A 2WO2A 2XHNA 2ZABA 4ZY9A 4LLOA 2P3IA 4CCNA 4CE8A 1I6XA 1VLNA 4Y26A 5DAWA 2RS12 3DCQA 4QKFA 3IIIA 4Q29A 4WVMA 5L73A 3NV3A 4BXSV 4YGEA 1D7PM 3GCXA 3RYPA 2R072 5CEHA 2CGNA 1QKQA 5EXOA 1YRZA 1V6IA 2DYCA 2LTNA 1LHWA 1UQXA 2PELA 2R6QA 2ZAHA 1IS6A 4IEYA 2Y38A 3SKJE 1F15A 5JZGC 3GHMA 3BTXA 4LT5A 5TSWA 5A7PA 2VULA 3KV4A 4QXKA 4Y22A 2BFUS 3MIFA 2WAAA 1W2OA 4CXXA 1C28A 1UF2C 2B9UA 1OOPA 4JQTA 1FT9A 1FYUA 1YJKA 1HB1A 2E6VA 3GJBA 5H9RA 4IW3A 2ORXA 1AJKA 4YW4A 2HEYF 5FJKA 5FP3A 5IYYA 3V65A 5BXXA 4AGRA 2A73B 1GP5A 4QX5A 3O1PA 1WKYA 5JLVA 4GB32 5CFDC 5LEJA 1VR3A 2RS13 1B35B 1V9U1 2A6WA 2ARAA 3GM8A 4LPLA 2JG9B 1R081 1BVVA 2R073 2DUQA 2XL7A 1AR63 1QJX1 1D4M1 2ET1A 2WWSA 2XHKA 3AKQA 2K46A 2BUKA 2ZHMA 3WG2A 4A41A 4P9LA 2QQNA 1N47A 4GIQA 1BKZA 1TMF3 1V6NA 5A7QA 3ZR5A 4B4PA 4XVHA 4D7TA 1BQPA 3T1MA 1HRV1 5JXHA 2NMNA 2ZEWA 1Z0HA 5LW9A 3BODA 4YVSB 5IFPA 4XURA 3QOPA 1LEMA 4BIOA 3TNQA 4BLIA 1MQTA 1EP0A 2LW8A 3PUQA 3WF3A 2HWB3 4NWVA 4M4RA 4I0BA 2IXHA 1URXA 3D3AA 4UF0A 4A6SA 2IXLA 3WP3A 4A2UA 2UYAA 1WLTA 3PDQA 4C91A 5ABJB 3TN93 1A78A 1V9U3 2BBAA 3BOPA 1KRIA 4L0PA 2W94A 2WNUB 3C2UA 1ZA4A 2XDVA 3T1LA 4CP0A 2ZHKA 2Y0IA 3VBHC 3ZFGC 3ZO0B 4TYSA 1POV0 1R092 4X8PA 3GXUA 1VBB2 3ZDVA 4AVAA 1O59A 4FAHA 3HQRA 2JDUA 1CPNA 3M3CA 3H1YA 5J7MA 4RS5A 2WNUA 4NOTA 5A33A 4BQYA 5FP8A 3BVCA 3H9AA 1U5XA 3PIJA 4TN7A 5BNPC 1M4WA 5LRRA 1MEC1 2BEOA 5DN2A 5IJRA 4I02A 2GZWA 3FFQA 1XBFA 3SH4A 2JXAA 4RR3A 5IVEA 4H7MA 2G9ZA 4WM8B 1AR93 1OHFA 4JRLA 1N1TA 5GZCA 1ASJ2 1JU4A 1HQLA 1HRI2 4W6YA 4A4AA 1J3RA 3ATGA 3C7FA 5CFCC 3K4AA 4R8HA 4Q4V1 3SCFA 4DXRA 4P9WA 4TWTA 3WEZA 4RSUA 3A7QA 5JDBA 2D3RA 3WSOA 4N90A 4XOGA 4OHXA 3ZYFA 2DCKA 4AGVA 3L9JT 1QJZA 4HKLA 2VM9A 5J48A 2X5IB 4YGBA 5DQ0A 5FRAA 1O3SA 4LE3A 2ZPXA 3DXTA 1DGLA 1MZFA 1W9WA 1TVGA 1KFUL 1Q8VA 4DXTA 1RUOA 2DFBA 1XYOA 4OUSA 2ZGOA 4MADA 4FPHA 4BPZA 5LRSA 2AENA 5CB7A 2WUHA 4MGQA 3VBHA 3ZFGA 4UFMA 5I8SA 1UZVA 2DF7A 2HWD3 2JWPA 1LECA 3UK9A 2YGLA 1DZRA 2W92A 4LNVA 3VKLA 1UKGA 1SDDB 2W95A 4YWAA 2FDKA 2GC3A 4FPLA 4LBQB 5LEKA 4DOUA 1Y9MA 4GWJA 1UOFA 1PVC2 3AZYA 3WNXA 4WVMB 1LOFA 3JQWA 1GWLA 4KI5M 4OUMA 5A6YA 2MEV1 2EICA 1DHKB 2E33A 3VDDB 3KQ4B 2HJIA 3G6JB 2VOXA 3RZKA 3QLQA 3OYWB 2WNVA 5FLJA 2NYYA 2VOWA 1LOAA 1JTZX 2GMPA 2EA7A 2FMDA 1ND3C 1VBD3 3FMGA 2ZHNA 3VDAA 4FPCA 3WDWA 1W3XA 1FNZA 4AI0A 4CDUA 1M06G 3ZR6A 1VBE1 2W87A 1JYXA 4LOTA 2Q8CA 1Q56A 3SMHA 1BEV3 1CESA 1HJGA 3VBUB 2C9AA 4YLZA 1NZCA 1Z7S1 2QQKA 4ONUA 2WA4A 4ZHNA 1RVF3 4DUXA 2CAUA 1C8M1 2R30A 4U36A 5EP9A 3ZSJA 3VHNA 2VUJA 5FPUA 1H2NA 1OQEA 4B1MA 4XBQA 2A6VA 1K5MC 1OURA 1HXS3 2YC0A 3I7DA 2WO3A 3LB9A 3D5OA 1BMV1 4NROA 4OZOA 2E31A 4IE6A 3DXUA 2HWE3 2JKXA 5DAQA 5LCWL 4ES9A 2VR4A 4J25A 1IS5A 4IQPA 3BTAA 5IHRA 5A1LA 1REFA 4FFHA 3WP5A 3JD71 3ZIXA 1ULOA 3ROUA 2WQZC 3WF0A 1GZTA 3O12A 3OSDA 4JGZC 3WQ0A 1QXRA 5FYTA 3TB0A 5JSRA 4UW4A 1UXZA 4UW5A 1REDA 4R9AA 3WY6A 3BIEA 3VB9A 2GN3A 4QX8A 5I0DA 2CDPA 1O3RA 1LTEA 1O4YA 2HBTA 4Q4X3 1U0AA 3CO2A 1O5LA 4MGYE 1DQ1A 2CV6A 2B39A 4AVVA 2IXIA 4E4DX 1FX5A 1QJFA 1CIYA 2DUOA 3H7JA 2P6HA 5E88A 4JRAA 1OUXA 1H2MA 1U5IA 2J42A 2OKXA 2H6CA 1GKBA 2OPWA 1EPWA 3B5LB 2B45X 3BIWE 4Z2AA 5C8WA 4MVTA 2YPJA 4HVOA 1DYOA 2L9LA 1EAH1 1TG7A 4AFDA 3J8F1 5JR2A 1YI7A 1DGWA 1NE4A 1RUC1 1VB4A 2DDUA 3DECA 3MICA 4FQZA 3TAYA 5C5UA 1PVC1 4EWEA 4RHV2 2XJVA 1O5UA 3UKTA 1QOTA 2VC9A 3I59B 5SV5A 1JYVA 1AX0A 2W68A 4Y5Z0 3PUSA 4LKFA 3DKWA 4QQPA 4W4ZA 3AL6A 1COV2 2BDRA 2YFUA 3LDBA 2H0VA 1SLCA 3TN92 4HK8A 2RVAA 1S1AA 2EXIA 2YHJA 4XE9A 2RDQA 4P02B 4GQ7A 4AEMA 4DY5A 3RYRA 1POV1 1YQ8A 4PLNA 4QWNA 3PURA 5LBFA 1BHGA 2VZOA 4TTGA 4LITA 1AR82 1ZZ9A 4QHBA 3WNLA 4PDWB 2AZ5A 3ACIA 3A4UA 3HPNA 4WVZA 3RI9A 1E5RA 1ULCA 3PJYA 4AGGA 1O3QA 2E7AA 3ZM8A 4LK7A 1RJ8A 2HEWF 2BERA 3HNMA 3OGGA 2O8OA 1DGRA 2CNAA 5EYXA 5D1IA 2AR6A 1EV11 5CFDB 2ZGRA 3CF6E 4GKXA 1I1EA 1REEA 3DUIA 1MS3A 4QB2A 1HRV3 5GLVA 4Q1PA 3AP5A 3FBMA 1BBT3 3O1SA 4BMBA 2VMDA 3B69A 3S6PA 4Y20A 3AP9A 2LALA 5GM0A 2PAKA 3T2QA 4AVTA 1TME3 2AH2A 3UNPA 5EHDA 3SKVA 4WZFA 4LBQA 1ZZ8A 2R7EB 4CP1A 4IL7A 3TBDA 1LR5A 3PLQA 4QT6A 1WMXA 2BRTA 3ACLA 3M8LA 5FPBA 5FY0A 1ENSA 5FY7A 3UGFA 4Y4YA 4CCKA 1C1LA 5ABJC 5JXIA 2P17A 3O1RA 3ZFEC 2VTXA 5KXBA 1W05A 4LUKA 1Z7S2 2JKBA 3FHAA 2BPA2 2O1QA 4XBLA 4UFJA 1TZOA 3ETQA 1OI6A 5FTTC 2D97A 4AAPA 2WO1A 4DB5A 4KH9A 4MZUA 4XQ4A 2BZDA 2ZZQA 5K4LA 1SCSA 2UWAA 4JCKA 4M3CE 1Y7BA 3AZVA 2NM1A 4C8DA 2PYTA 5FMDA 1Y4WA 4IEWA 4BK5A 1UY4A 1WW5A 3GF6A 2X5IA 1JZ7A 1NAEA 1UZ0A 2DVFA 4AEJA 1OD5A 4X8NA 2PHUA 2XB6C 5FKCA 2C1FA 2JJ6A 3ZSMA 2HLEA 2ZJCA 4XILA 2YC4A 1HV0A 3CJIC 4BB3A 4CDUC 3RI8A 5A6ZA 2PQSA 2WZR1 2PFWA 2C26A 3V0AA 5T5OA 3OBTA 3TRSB 5HXMA 3BU7A 1A8MA 2X10A 2CL2A 2P3YA 3Q8FA 5EWSA 3VKFC 3NVCA 2XJSA 5F5AA 3LCPA 3AKSA 3O1UA 5KC5A 1QEXA 3QACA 1O6UA 4KNCA 1RHI2 4XZUG 1L7RA 5G04L 2ADDA 4DO0A 1HKDA 1MS5A 1VE0A 3KT1A 1WWYA 5FO9B 1DQ6A 4I30A 3LIGA 2JG9A 3ST7A 1CJPA 2HWC3 5A33B 4LXLA 4AI3A 2JDPA 4FTBA 2K9ZA 3J7LA 3N36A 5ACA1 1QQP2 3MFAA 1H6YA 2Q1FA 4DPNA 3NJZA 1GQHA 1VBB1 3ZYGA 2A6XA 2CGOA 2WZEA 2X53S 3OBRA 3WW1A 1DBNA 1HRI1 1FAYA 1J83A 4QKNA 4AI2A 1V6LA 1CAWA 3NNJA 1W6PB 2D43A 3N9QA 2KD7A 4AQ2A 5E8AA 5FYCA 1IS4A 2P6CA 4QXHA 1RUJ2 3WW4A 2WBKA 1PGL2 3B9IA 4N9HA 1W9FA 1W2NA 4ISRA 2XMLA 4HL0A 3ACHA 5CIRA 5GLTA 5LASA 3VBFC 3W21A 4AEDA 1XJAA 4M0HA 4R4ZA 1R1A2 3OCPA 1W06A 2ORZA 1F4AA 1JZ6A 5FPXA 4XYXA 1HN1A 2ET7A 2RS53 4AHXA 3MFCA 1DDLA 4YZ4A 1APNA 1OF4A 4W6WA 4QD2A 3T2PA 5LK5A 3N9OA 2XH6A 3PUIA 2QZ2A 1RYYA 4ASKA 1POQA 2Q4SA 3M2MA 2GNMA 5EIYB 1K12A 3MYXA 4ORFA 3PVNA 5IT6A 1J58A 1SMVA 2J1VA 4I3PA 3O1TA 1CZTA 1IQAA 1NOVA 4YVWA 3K2OA 1UU5A 1XNAA 1UOBA 3MUZ1 2RV9A 4AWDA 1IGOA 1X9TA 1IPKA 3VD5A 1JUIA 1CAXA 2HWF2 4CP2A 5A3NA 3W59A 2OA2A 1OF3A 3JZVA 2R043 5JI7A 3B00A 3S5QA 5JVVA 4LE4A 3S0MA 1CIWA 3CJXA 4DEQA 1KDMA 5BPXA 1D4M2 1V6MA 4CCCA 1JOPA 1DCSA 4JTOA 4MXVA 5FP9A 4Q4Y3 2E53A 2R071 3JCIA 4XJZA 2WJSA 4CDWB 5HI0A 5DG1A 1OQ1A 3JBG1 3KF3A 3M4FA 4N9IA 4DRRA 3RGBA 2QNKA 2KA3A 1MVEA 1PGL1 1KJRA 4AQ6A 2ILMA 2BGCA 2RJLA 2VZRA 3PVEA 2YV8A 3QCWA 3TEZA 1L7QA 2QBXA 1W90A 2XQRA 2DVGA 3I3BA 1SLIA 4SBVA 1BVP1 2C6SA 4FPKA 4D94A 4QQ2A 3RRDA 3MDPA 3OOXA 4IGPA 5K7PA 5C4WA 2VBDA 4INDA 1W8ZA 1SLBA 3U10A 1AYN3 3B3QE 4M0NA 1S2BA 1DQ0A 2HYKA 2TEPA 3MV01 4PIZA 3TEWA 1QQP1 1S0JA 1PNFA 2ERFA 1IG3A 2YG0A 4XC9A 4LIUA 1BMV2 1EYBA 3VN4A 5APAA 5FUPA 1XOYA 3T2TA 3VDCA 4QB6A 2E7TA 3TOJA 4N53C 4XQWA 3VL9A 2CAVA 4IEPA 4PIYA 3LGRA 1R64A 3HIFA 1S0EA 5FZAA 3VLBB 2DCYA 4BDVB 4MYEA 1NA1B 1TMF1 4AFBA 4GWNA 4IGOA 4AFCA 2P3KA 2ZKNA 3V0AB 3D0SA 3WP6A 4QQHA 5FO7B 2F17A 3ZXGA 4AI8A 3WNPA 2WS93 5L7OC 2J7MA 5F3GA 3HBKA 4E2QA 5BNOA 1R093 1ZRFA 3BN6A 2A3YA 5LATA 1KFXL 2G19A 2YPDA 4XMAA 2RE9A 2B42B 5FZKA 5T3NA 1YCIA 1HW5A 1LU2A 5EJ3A 3K51A 5FZ8A 1SEFA 4JHTA 2D6PA 5FPLA 3R05A 3SEPA 4E4ZA 3JBG2 2V4AA 4XUPA 2HWE2 1W2UA 1OLME 1W9YA 4G9SB 4GMP3 4RGKA 2XQXA 2NN8A 3ILNA 5FPZA 4BHPA 4XIOA 1CN1A 4OMDA 4NR1A 5IWFA 3THTA 3VBFA 2VMGA 5FXXA 1WCQA 5JI9A 1PM4A 3UL2A 4OHYA 1RHI3 4YFZA 2YZ4A 2JEMA 5FZIA 4LBKA 1XPWA 2VZUA 3J4UH 3KMHA 2AACA 4XCBA 1VP6A 2W5FA 3VBSA 3WF4A 3ZN4A 4EZHA 2YBKA 2W1UA 1HB4A 1NUKA 3E6BA 5DG2A 1V6OA 4QB1A 1FPN2 1GQPA 1QJU1 1FOD2 4KWLA 2WC2A 5K8SA 4E9KA 4S2HA 4EN6B 4YZ5A 4LR4A 1VBC2 4NHYA 4MX3A 1RUJ1 3AK0A 3GZAA 1WLWA 4DXSA 1N1YA 3O0VA 1ZBE2 4Q1RA 2RMU3 1H2KA 1W6MA 1RUE3 1QGLA 2JENA 3HAGA 3JU9A 5LBBA 4QPIA 1ALYA 3PVBB 5JXJA 4RGAA 1OLMA 4LKSA 5C9AB 2P34A 2R062 5D2AA 3WG1A 1FATA 4E2GA 4G3YC 4YW5A 3W9AA 1JZ2A 5FZ4A 1C5HA 3AL5A 4N43B 5CVRA 3C7EA 4NHMA 3J7MA 4GALA 2MPFA 2W08A 3WOGA 1ZZ7A 2HYXA 1MEC2 3DYPA 2W39A 3RNSA 2A6YA 2C0ZA 5C9AA 1D2QA 3PTYA 3POYA 2WQ4A 3AMNA 3WT3A 4CDWC 3I3QA 3R4SA 2ZGLA 2ZX2A 1BEV2 1G86A 2BFUL 4HVRA 3AZWA 4XJWA 5A3UA 1QHDA 2GNBA 3WDTA 4P9YA 4FVVA 4QPWA 2QDNA 3BCWA 1UKRA 4HT1T 2J1SA 4Y22B 3DV8A 2W52A 2WN2A 1YI9A 3EQEA 1NLRA 3ECQA 2VGDA 4GXLA 1ZYBA 5HCHA 2HWC1 4WM8A 1J3PA 2Z42A 4AVCA 1CAUB 5BNNC 1ULEA 3K46A 4HPKA 3AB0A 4MOAA 5ACA3 3E1F1 1FMD3 1KDKA 4XMIA 2ENRA 3LIHA 1BCXA 1VBA3 4XJUA 3I59A 4Y1YA 4XUOA 5EFUA 5GLUA 4DUWA 5IVFA 5JWPA 1K45A 1UY3A 2ZGKA 3AX4A 2DU0A 1SBEA 2QQJA 3NJXA 4ES8A 4J1WA 2O0OA 1MS4A 2PAEA 4HBNA 4CU6A 2PHWA 1RVF2 3DYMA 4FXGB 2V4VA 1IPJA 5HV4A 3ASIA 4NPMA 2ZBJA 1NCQA 1NCQC 4KQ7A 1ZA7A 3O0XA 4GD4A 2GALA 5FZ9A 4AI1A 3E6CC 2JB4A 5FKBA 5KBFA 3POIA 1VBA2 3KV6A 2JECA 4XFFA 1NKGA 1OA2A 5DDJ2 3J9SA 5F6LB 1TNRA 5CA6A 1NLSA 3ACFA 1UYPA 2GN7A 2VUCA 3OY8B 3PUHA 3JQXA 4JGZB 4L97A 1UMHA 4LBJA 4AW7A 2DURA 1HIXA 1DFQA 1E5IA 1W8FA 5I93A 3Q8EA 2QCSB 1FI2A 3PJQA 5A7OA 1K42A 4XDOA 1UAIA 3H3LA 3DKQA 1GWMA 1Q8PA 3NAPC 1OKQA 1QNWA 2BNMA 2WDBA 2EF6A 4IV3B 2HWE1 1QJEA 1RUD1 5DAVA 3M1HA 3S57A 2UWCA 4RHV1 5IFTA 5IVYA 3ZXEA 3MPBA 3EBRA 4Q4V2 1BZWA 1F2NA 2Y64A 1RUC3 4YG0A 1COV3 5IATA 4A3XA 1UIJA 5I0UA 2XVLA 1ND3A 3NWKA 3VZOA 3CL1A 4O7XA 3VZNA 4EE2A 3E5QA 1UYYA 4W6XA 4ZKTB 1LOFC 2KXLA 2EXHA 1ULPA 1D4VB 2OXBA 3B01A 3I2JA 1QMJA 3ZN5A 1YFYA 1VIWB 1QY4A 5FXVA 5J1XA 1C4RA 3BTZA 4BQWA 2ZTNA 5FFOC 3EYPA 4LULA 3OD4A 4FXKB 5FY5A 1ENXA 2AEYA 1OMIA 1GU3A 1G6NA 2WLQA 4LK6A 4QDRA 4XPVA 4GMP1 3GBFA 3ZSKA 4COUA 3F2ZA 4UYBA 3CU7A 5I0SA 2CWMA 2WYFA 4Q4Y1 5E16A 4BQ5A 4FTEA 1OD3A 4TSVA 4XDPA 2JX9A 3LSEA 3N7LA 3B93A 5I91A 1V0AA 5A3WA 1OPMA 4PQQA 4NVPA 2ZZJA 3KGLA 3QD6A 1AL21 1ENRA 1OBNA 3NNFA 4KG0A 4X6QB 4ARXA 4UI9L 1WLCA 1ZRRA 5F39A 3U07A 5F5QA 1D0HA 4P5HA 3WHTA 3WXPA 1S2KA 2W91A 2D5HA 1KJLA 1ZZBA 2RJ2A 2XBO3 1D0GA 3T4VA 4HETA 4BOWA 5J98B 4UOJA 2V5YA 2Z5WA 2PHDA 2NMOA 2WNOA 3THCA 1OXCA 1UX7A 3LFIA 5LA9A 3UESA 3NNMA 1MS8A 4H3WA 3KWVA 5FZOB 1C8M3 2UWBA 3DL3A 3AXDA 2VCMA 3GZEA 4IV1B 3VD4A 3AMHA 3D6EA 1WCSA 2VXRA 4M3CF 1AR71 2FCVA 5FZEA 2P1BA 5JSOA 3RZMA 1ZZCA 3LDRA 1DGRN 1V9U2 4XJ9A 2N7GA 4O9EA 5BNOB 3VBOB 2D3SA 5BNNB 1PO11 3A22A 1NX9A 1MPXA 1GSLA 2WN3A 2WYSA 5H9SA 5I0TA 1NXD1 1L3JA 4AVBA 1LHUA 4HG6B 2K2SA 3U4SA 3VKOA 1VRBA 1GV9A 3IKWA 4LO8A 2J22A 2R1BA 3OTFA 3WV6A 2RDRA 2W1WA 3AFGA 3AZXA 3AKRA 3VD7A 3HBZA 4UW3A 3WUCA 1LHNA 1UNBA 1S0DA 4HN0A 4KWJA 2JDHA 1HLCA 5DUUA 2C4XA 4XJ8A 2JE7A 3FLRA 3WNMA 2Q1MA 1HXS2 1V6JA 2W3JA 2VMFA 3CMGA 4AL9A 2YGMA 3EJKA 1V6KA 4ISQA 4Q2FA 3MIBA 1AYM2 4HSJA 1QU0A 2WR9A 4Z82A 1YFXA 1ZX5A 4Q4V3 4ATEA 3SC7X 2C9KA 1BK0A 1VBA1 1BLZA 4UFHA 1XC6A 2WFF3 2VVDA 1J1LA 4GB33 1ZBA2 2Q8OA 1HDKA 4SLIA 2PHRA 3NKTA 1AHSA 5A7WA 2CGPA 2AUYA 1Q5OA 2ZKLA 2IXKA 3MI8A 3J26N 4H2AA 4M01A 1W8NA 4QMAA 2VQ0A 4V2WA 3VBRB 4IEXA 2WNVC 4L92A 1NCQB 1XNDA 4LQRA 1LJ7A 4XBNA 5FZ6A 5C71A 5FZLA 5JMCA 5FZBA 5L9RA 4MSVA 5JXGA 3OUJA 4P08A 4AZZA 4JDMA 4Q27A 1ZNPA 3LA2A 4CDXC 1XXNA 1R091 1DP0A 4D7YA 5JSPA 5ABJA 2XJQA 4PIXA 3MW2A 4H7LA 4OHVA 3MLLA 3WD5A 4Q4X1 3ZN6B 4AYUA 3FL7A 2ZXQA 2HKXA 2IVJA
chains in the Genus database with same CATH topology
5CYYA 3UNPA 3SKVA 3LQCA 4QAWA 2R7EB 3NNGA 2Y6JA 3NJVA 2W47A 3HOBA 3U37A 3A21A 4D8MA 3VD3A 2ID4A 5JXIA 4JKMA 3FHAA 5C70A 3T0DA 4MGSA 2X05A 2WO1A 1O8SA 4A42A 2BZDA 2J1EA 3LPFA 4BK5A 1UY4A 4KMQA 2E26A 4OMCA 2VJXA 2WABA 3CZUA 1JZ7A 1NAEA 1UZ0A 1W9SA 2HLEA 4KWUA 2VTFA 2VMEA 2YC4A 4W8JA 1H6XA 4CU8A 4MO3M 4JX0A 2PQSA 4A6OA 1OT5A 2C26A 4OUEA 1YQ2A 5CZKA 5HXMA 2X10A 3MBWA 3HEIA 2VQUA 5LA0A 2VCBA 5G04L 4XZUG 1L7RA 2VCCA 1JU3A 4P5YA 5DPNA 3BGAA 4RYDA 1KEXA 2WAOA 5B4XA 4LHSA 4UAPA 1H6YA 2Y6GA 5EJZB 3C8XA 3HN3A 4JHZA 1UYXA 1CZSA 1SG3A 2VZPA 3MUY1 1UXXX 3ACGA 4M4PA 2WZEA 2Y6HA 2QQLA 3IDAA 4JKLA 5LA2A 4AAXA 3LE0A 5JUVA 3C7GA 3WF2A 4QDQA 1J83A 4E8CA 3LEIA 3JXSA 4CUAA 5F7UA 3OG2A 2KD7A 4CU9A 2WBKA 4CUBA 3VD9A 3ACHA 1GUIA 1SHWB 2VZTA 2ORZA 1F4AA 1JZ6A 2WZ8A 3FL7A 3C7HA 1US2A 1HN1A 2B4KA 4QX3A 3NRUA 4QX0A 2W46A 1OF4A 3K4ZA 1UY2A 5LA1A 3T2PA 3I97A 3PUIA 1RYYA 2VZQA 2ZEXA 2V5DA 3CIHA 5EIYB 1K12A 1W99A 3CQOA 3IAQA 1O8PA 1JI6A 2J1VA 3WQBA 1UWWA 1CZTA 1XNAA 2XOMA 3MUZ1 2RV9A 3VD5A 4A45A 2W1SA 3WNNA 1OF3A 2VZ3A 2BGOA 4YPJA 4DUVA 4DEQA 4W50A 2VO5A 1JZ4A 3K77A 1GOGA 4ZZ8A 4CU7A 3CKHA 4ARYA 1F4HA 1US3A 2YFZA 3T0BA 4FI9A 2VZRA 1L7QA 2QBXA 5DMYA 3I3BA 2VL4A 1GOFA 2V72A 3P6BA 3FHQA 1GMMA 2VZVA 1UMIA 1UY0A 4E8DA 1EUUA 4DEVA 1JYWA 2VQTA 3T09A 4ZY9A 2WO2A 2XHNA 3MV01 2JE8A 2YG0A 2QQMA 4BJ0A 3I2GA 2JDAA 3IIIA 3UETA 3VDCA 4BXSV 2Y6KA 4QB6A 1D7PM 2J1TA 3MO4A 1R64A 2E32A 4BDVB 5JMOA 4QX1A 3SKJE 1UY1A 1UYZA 3WNPA 2WAAA 2J7MA 3OGSA 4CVUA 3OEBA 2QQIA 3BN6A 4GWIA 2ORXA 5IYYA 1DLCA 3MV11 1KGYA 2Y6LA 2YB7A 3K75B 3SEPA 1WKYA 2BGPA 2EIBA 3HNYM 4XUPA 1CZVA 3GM8A 4LPLA 2XQXA 4XUTA 4OMDA 3LPGA 1WCQA 3I2HA 3CDZB 4A41A 2QQNA 2LS6A 4BK4A 3CZJA 4XVHA 1XPWA 2VZUA 5JXHA 2W5FA 3WF4A 2ZEWA 3EB7A 2W1UA 2VCAA 1NUKA 4QB1A 4XURA 1GQPA 3I2IA 5IFPA 1I5PA 2J1UA 2ZEYA 5HPOA 2LW8A 4DXSA 5B4NA 3WF3A 4M4RA 3GGLA 3J7HA 3D3AA 1JYNA 2BBAA 5G05L 5JXJA 4L0PA 2W94A 4LKSA 3DYOA 3T08A 3OB8A 1JZ2A 3GXUA 3C7EA 1O59A 2VOTA 2HYXA 1PX3A 3DYPA 1GOHA 1JHJA 3GDBA 1LNSA 3WNOA 5DN2A 5IJRA 4RN5A 4ZXEA 3W5NA 4QPWA 1PMJX 3T0AA 2J1SA 5C7GA 2WN2A 3ECQA 1JU4A 4A4AA 3C7FA 4TXWA 3K4AA 3K46A 4MOAA 4DXRA 3E1F1 3WEZA 4ET7A 3A7QA 4XUOA 4DUWA 2W1QA 3WSOA 1K45A 1UY3A 3ABZA 2QQJA 3NJXA 2DCKA 4A44A 2VM9A 1JZ3A 4CU6A 4XUQA 3DYMA 2V4VA 5DQ0A 3IAPA 1W9WA 1TVGA 4DXTA 3I3EA 4MADA 2VZ1A 1NKGA 4GZ9A 2WUHA 4MGQA 3ACFA 3PUHA 1EUTA 1XNTA 1UMHA 2Y8KA 5EJ1B 3I3DA 1OH4A 1K42A 4A3ZA 1W8OA 3C7OA 4P00B 2W92A 1SDDB 2W95A 2WDBA 2J1RA 2QQOA 4GWJA 3LEGA 5IFTA 2W9XA 3OEAA 4OYUA 2Y64A 2B9VA 4KI5M 2EICA 1GNYA 2E33A 2VMCA 4AG4A 2Z4FA 3VDBA 4D0QA 3VDAA 2W87A 1JYXA 1UYYA 3WF1A 1ULPA 3HJRA 3I2JA 2QQKA 3I2KA 5J1XA 4DUXA 2CDOA 2XONA 3OGRA 3EYPA 1GU3A 4QDRA 2WO3A 3F2ZA 3OGVA 4OZOA 1J84A 2E31A 2X09A 5LCWL 2JKXA 1OD3A 2VR4A 5IHRA 4PQQA 3AC0A 4ARXA 1ULOA 4UI9L 3WF0A 3SEEA 4PT6A 1CX1A 2W91A 1UXZA 2RJ2A 3FN9A 3T2OA 4JKKA 5I0DA 2CDPA 4UOJA 3LEKA 3UESA 3THCA 1UX7A 4IUGA 1CIYA 3WNKA 3VD4A 2ZEZA 3NQHA 3K4DA 2OKXA 2JD9A 5A1AA 2WQ8A 4CUCA 4Z2AA 1IQDC 2VZSA 4PF1A 4QX2A 1DYOA 3A22A 2L9LA 1NX9A 1MPXA 1TG7A 2WN3A 2WYSA 5JR2A 2DDUA 3IB3A 4XUNA 3DECA 1T2XA 4HG6B 3P1IA 5FUIA 2J22A 2VC9A 1JYVA 1JZ5A 2W1WA 3VD7A 4QDSA 3OBAA 4W4ZA 2YFUA 1W9TA 2C4XA 3WNMA 2RVAA 2W3JA 2VMFA 4ZZ5A 3CMGA 4P02B 1W0NA 1BHGA 2VZOA 4TTGA 3A23A 3I2FA 3WNLA 1P8JA 1K3IA 2C9KA 3ACIA 3HPNA 1XC6A 3ZM8A 3ETPA 2BERA 3HNMA 1W8NA 2DCJA 2J1AA 4LQRA 1PX4A 5C71A 1JZ8A 1PMHX 2EIDA 4QB2A 2YC2A 5JXGA 3THDA 4P08A 2EIEA 2VMDA 3W5MA 1DP0A 3HNBM 2ZXQA 3T2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CYY A;  3UNP A;  3SKV A;  3LQC A;  4QAW A;  2R7E B;  3NNG A;  2Y6J A;  3NJV A;  2W47 A;  3HOB A;  3U37 A;  3A21 A;  4D8M A;  3VD3 A;  2ID4 A;  5JXI A;  4JKM A;  3FHA A;  5C70 A;  3T0D A;  4MGS A;  2X05 A;  2WO1 A;  1O8S A;  4A42 A;  2BZD A;  2J1E A;  3LPF A;  4BK5 A;  1UY4 A;  4KMQ A;  2E26 A;  4OMC A;  2VJX A;  2WAB A;  3CZU A;  1JZ7 A;  1NAE A;  1UZ0 A;  1W9S A;  2HLE A;  4KWU A;  2VTF A;  2VME A;  2YC4 A;  4W8J A;  1H6X A;  4CU8 A;  4MO3 M;  4JX0 A;  2PQS A;  4A6O A;  1OT5 A;  2C26 A;  4OUE A;  1YQ2 A;  5CZK A;  5HXM A;  2X10 A;  3MBW A;  3HEI A;  2VQU A;  5LA0 A;  2VCB A;  5G04 L;  4XZU G;  1L7R A;  2VCC A;  1JU3 A;  4P5Y A;  5DPN A;  3BGA A;  4RYD A;  1KEX A;  2WAO A;  5B4X A;  4LHS A;  4UAP A;  1H6Y A;  2Y6G A;  5EJZ B;  3C8X A;  3HN3 A;  4JHZ A;  1UYX A;  1CZS A;  1SG3 A;  2VZP A;  3MUY 1;  1UXX X;  3ACG A;  4M4P A;  2WZE A;  2Y6H A;  2QQL A;  3IDA A;  4JKL A;  5LA2 A;  4AAX A;  3LE0 A;  5JUV A;  3C7G A;  3WF2 A;  4QDQ A;  1J83 A;  4E8C A;  3LEI A;  3JXS A;  4CUA A;  5F7U A;  3OG2 A;  2KD7 A;  4CU9 A;  2WBK A;  4CUB A;  3VD9 A;  3ACH A;  1GUI A;  1SHW B;  2VZT A;  2ORZ A;  1F4A A;  1JZ6 A;  2WZ8 A;  3FL7 A;  3C7H A;  1US2 A;  1HN1 A;  2B4K A;  4QX3 A;  3NRU A;  4QX0 A;  2W46 A;  1OF4 A;  3K4Z A;  1UY2 A;  5LA1 A;  3T2P A;  3I97 A;  3PUI A;  1RYY A;  2VZQ A;  2ZEX A;  2V5D A;  3CIH A;  5EIY B;  1K12 A;  1W99 A;  3CQO A;  3IAQ A;  1O8P A;  1JI6 A;  2J1V A;  3WQB A;  1UWW A;  1CZT A;  1XNA A;  2XOM A;  3MUZ 1;  2RV9 A;  3VD5 A;  4A45 A;  2W1S A;  3WNN A;  1OF3 A;  2VZ3 A;  2BGO A;  4YPJ A;  4DUV A;  4DEQ A;  4W50 A;  2VO5 A;  1JZ4 A;  3K77 A;  1GOG A;  4ZZ8 A;  4CU7 A;  3CKH A;  4ARY A;  1F4H A;  1US3 A;  2YFZ A;  3T0B A;  4FI9 A;  2VZR A;  1L7Q A;  2QBX A;  5DMY A;  3I3B A;  2VL4 A;  1GOF A;  2V72 A;  3P6B A;  3FHQ A;  1GMM A;  2VZV A;  1UMI A;  1UY0 A;  4E8D A;  1EUU A;  4DEV A;  1JYW A;  2VQT A;  3T09 A;  4ZY9 A;  2WO2 A;  2XHN A;  3MV0 1;  2JE8 A;  2YG0 A;  2QQM A;  4BJ0 A;  3I2G A;  2JDA A;  3III A;  3UET A;  3VDC A;  4BXS V;  2Y6K A;  4QB6 A;  1D7P M;  2J1T A;  3MO4 A;  1R64 A;  2E32 A;  4BDV B;  5JMO A;  4QX1 A;  3SKJ E;  1UY1 A;  1UYZ A;  3WNP A;  2WAA A;  2J7M A;  3OGS A;  4CVU A;  3OEB A;  2QQI A;  3BN6 A;  4GWI A;  2ORX A;  5IYY A;  1DLC A;  3MV1 1;  1KGY A;  2Y6L A;  2YB7 A;  3K75 B;  3SEP A;  1WKY A;  2BGP A;  2EIB A;  3HNY M;  4XUP A;  1CZV A;  3GM8 A;  4LPL A;  2XQX A;  4XUT A;  4OMD A;  3LPG A;  1WCQ A;  3I2H A;  3CDZ B;  4A41 A;  2QQN A;  2LS6 A;  4BK4 A;  3CZJ A;  4XVH A;  1XPW A;  2VZU A;  5JXH A;  2W5F A;  3WF4 A;  2ZEW A;  3EB7 A;  2W1U A;  2VCA A;  1NUK A;  4QB1 A;  4XUR A;  1GQP A;  3I2I A;  5IFP A;  1I5P A;  2J1U A;  2ZEY A;  5HPO A;  2LW8 A;  4DXS A;  5B4N A;  3WF3 A;  4M4R A;  3GGL A;  3J7H A;  3D3A A;  1JYN A;  2BBA A;  5G05 L;  5JXJ A;  4L0P A;  2W94 A;  4LKS A;  3DYO A;  3T08 A;  3OB8 A;  1JZ2 A;  3GXU A;  3C7E A;  1O59 A;  2VOT A;  2HYX A;  1PX3 A;  3DYP A;  1GOH A;  1JHJ A;  3GDB A;  1LNS A;  3WNO A;  5DN2 A;  5IJR A;  4RN5 A;  4ZXE A;  3W5N A;  4QPW A;  1PMJ X;  3T0A A;  2J1S A;  5C7G A;  2WN2 A;  3ECQ A;  1JU4 A;  4A4A A;  3C7F A;  4TXW A;  3K4A A;  3K46 A;  4MOA A;  4DXR A;  3E1F 1;  3WEZ A;  4ET7 A;  3A7Q A;  4XUO A;  4DUW A;  2W1Q A;  3WSO A;  1K45 A;  1UY3 A;  3ABZ A;  2QQJ A;  3NJX A;  2DCK A;  4A44 A;  2VM9 A;  1JZ3 A;  4CU6 A;  4XUQ A;  3DYM A;  2V4V A;  5DQ0 A;  3IAP A;  1W9W A;  1TVG A;  4DXT A;  3I3E A;  4MAD A;  2VZ1 A;  1NKG A;  4GZ9 A;  2WUH A;  4MGQ A;  3ACF A;  3PUH A;  1EUT A;  1XNT A;  1UMH A;  2Y8K A;  5EJ1 B;  3I3D A;  1OH4 A;  1K42 A;  4A3Z A;  1W8O A;  3C7O A;  4P00 B;  2W92 A;  1SDD B;  2W95 A;  2WDB A;  2J1R A;  2QQO A;  4GWJ A;  3LEG A;  5IFT A;  2W9X A;  3OEA A;  4OYU A;  2Y64 A;  2B9V A;  4KI5 M;  2EIC A;  1GNY A;  2E33 A;  2VMC A;  4AG4 A;  2Z4F A;  3VDB A;  4D0Q A;  3VDA A;  2W87 A;  1JYX A;  1UYY A;  3WF1 A;  1ULP A;  3HJR A;  3I2J A;  2QQK A;  3I2K A;  5J1X A;  4DUX A;  2CDO A;  2XON A;  3OGR A;  3EYP A;  1GU3 A;  4QDR A;  2WO3 A;  3F2Z A;  3OGV A;  4OZO A;  1J84 A;  2E31 A;  2X09 A;  5LCW L;  2JKX A;  1OD3 A;  2VR4 A;  5IHR A;  4PQQ A;  3AC0 A;  4ARX A;  1ULO A;  4UI9 L;  3WF0 A;  3SEE A;  4PT6 A;  1CX1 A;  2W91 A;  1UXZ A;  2RJ2 A;  3FN9 A;  3T2O A;  4JKK A;  5I0D A;  2CDP A;  4UOJ A;  3LEK A;  3UES A;  3THC A;  1UX7 A;  4IUG A;  1CIY A;  3WNK A;  3VD4 A;  2ZEZ A;  3NQH A;  3K4D A;  2OKX A;  2JD9 A;  5A1A A;  2WQ8 A;  4CUC A;  4Z2A A;  1IQD C;  2VZS A;  4PF1 A;  4QX2 A;  1DYO A;  3A22 A;  2L9L A;  1NX9 A;  1MPX A;  1TG7 A;  2WN3 A;  2WYS A;  5JR2 A;  2DDU A;  3IB3 A;  4XUN A;  3DEC A;  1T2X A;  4HG6 B;  3P1I A;  5FUI A;  2J22 A;  2VC9 A;  1JYV A;  1JZ5 A;  2W1W A;  3VD7 A;  4QDS A;  3OBA A;  4W4Z A;  2YFU A;  1W9T A;  2C4X A;  3WNM A;  2RVA A;  2W3J A;  2VMF A;  4ZZ5 A;  3CMG A;  4P02 B;  1W0N A;  1BHG A;  2VZO A;  4TTG A;  3A23 A;  3I2F A;  3WNL A;  1P8J A;  1K3I A;  2C9K A;  3ACI A;  3HPN A;  1XC6 A;  3ZM8 A;  3ETP A;  2BER A;  3HNM A;  1W8N A;  2DCJ A;  2J1A A;  4LQR A;  1PX4 A;  5C71 A;  1JZ8 A;  1PMH X;  2EID A;  4QB2 A;  2YC2 A;  5JXG A;  3THD A;  4P08 A;  2EIE A;  2VMD A;  3W5M A;  1DP0 A;  3HNB M;  2ZXQ A;  3T2Q A; 
#chains in the Genus database with same CATH topology
 4LIV A;  1MQT B;  1O4Z A;  1PGW 2;  4IEO A;  4LKD A;  5CFC B;  5FOJ B;  3LQC A;  4QM8 A;  3O7O A;  2GMM A;  2Y6J A;  3NJV A;  4LOS A;  2FDJ A;  4PF5 A;  1X9P A;  1QXP A;  2W47 A;  2WRA A;  1GQG A;  4DFS A;  3RQ0 A;  1AXY A;  4AVS A;  2DFC A;  1S0F A;  3A21 A;  5FP4 A;  2H0B A;  2RM2 3;  1AL0 G;  4BIS A;  4N53 B;  2CWS A;  2BWA A;  3HR9 A;  4I0W B;  2QZ3 A;  3OY8 A;  4JGZ A;  4XIK A;  1LOC A;  5CKQ A;  1X8M A;  5DDJ 3;  3OF1 A;  2MEV 3;  3T0D A;  3K3N A;  4MGS A;  3RG0 A;  5LWB A;  5B2G B;  2X05 A;  4XFB A;  5SV8 A;  1J1T A;  2QTW B;  3RJ2 X;  1GYK A;  3VBU A;  2WZR 2;  1PMI A;  1QJU 3;  3VBU C;  5C33 A;  3VUO A;  3FJS A;  4LBO A;  4YW1 A;  3UJO A;  4CEY A;  3ZFE A;  5F32 A;  5KHK A;  1ULF A;  1A3K A;  4FBF A;  3FWE A;  3GJA A;  4KMQ A;  5K0U A;  1G9D A;  5F2W A;  2VJX A;  2WAB A;  2TUN A;  1QJY 3;  1ZBE 1;  1SQ4 A;  1U5Y A;  3ZVX A;  4IES A;  3BTY A;  5H9Q A;  1ZZ6 A;  1W6N B;  5C3Q A;  1JS9 A;  4V1P A;  2VD7 A;  2O8Q A;  1RTV A;  2F4L A;  4CU8 A;  1FPN 1;  1QJU 2;  1BBT 2;  1W0P A;  4A6O A;  2YU1 A;  1JOB A;  2RG4 A;  1JYC A;  1XSR A;  4LLF A;  2VPV A;  2DU1 A;  2OZJ A;  1SFN A;  1RUF 2;  3SIT A;  3SCG A;  3Q8A A;  5FMC A;  3VL8 A;  5DUX A;  5LA0 A;  2VCB A;  4IEV A;  4PJY A;  4KU8 A;  2WNE A;  3HT2 A;  1AX2 A;  1AR7 2;  1PO2 1;  4XTM A;  2R49 A;  1JN2 P;  5DPN A;  1X82 A;  3BGA A;  2VH9 A;  3KV5 A;  5B4X A;  3Q8B A;  4AHY A;  1QJY 1;  4LHS A;  1RUI 3;  2RR1 3;  3IPV B;  5CKN A;  2PHL A;  3VBO A;  1T6B X;  4UAP A;  1OUS A;  4NHL A;  2Y6G A;  2PHX A;  3C8X A;  5EJZ B;  4JHZ A;  1UYX A;  4K9S A;  1I5Z A;  4Q4X 2;  1CZS A;  1G9C A;  4H55 A;  2B8M A;  3MUY 1;  1WW4 A;  2GU9 A;  1QH6 A;  2XL9 A;  3BPZ A;  4OUL A;  4KBB A;  2NPI A;  3JBG 3;  1XE8 A;  5A6Q A;  3IDA A;  5LA2 A;  1D4M 3;  3LE0 A;  3N7M A;  4MLO A;  3C7G A;  4CEY C;  3WDX A;  3RZG A;  3WF2 A;  4GH4 C;  1PVX A;  4QDQ A;  5K9Y A;  3ZFF A;  4YZ1 A;  3LEI A;  4B29 A;  3JUU A;  2ZML A;  2P4E A;  2JIJ A;  4LBL A;  2YU2 A;  4ZU5 A;  5AC9 3;  5J3U A;  2WSV A;  2Y26 A;  3T3Y A;  3M3O A;  4BA6 A;  3O14 A;  5C8C A;  1PO2 2;  3SCH A;  1LGB A;  4PHZ A;  3Q8C A;  1AR6 2;  3VKM A;  4D7S A;  2CHH A;  5FRE A;  4DZG A;  2I74 A;  2R0F A;  4DNY A;  4FP3 A;  1AYM 1;  2WZ8 A;  3P3N A;  3NST A;  3QH7 A;  3AYD A;  4QX3 A;  1JMU B;  3HT1 A;  4WM7 B;  4QX0 A;  5JZG B;  1HXS 1;  4LO7 A;  3LZZ A;  3K4Z A;  1UY2 A;  5LA1 A;  5FYS A;  3ZMO A;  3I97 A;  1GZW B;  1WBL A;  4XFA A;  5IVV A;  5GLW A;  3BUC A;  4QXB A;  4ZU7 A;  3CIH A;  2P2K A;  2CSG A;  2BOI A;  3AZZ A;  4K20 A;  1OVS A;  2RJK A;  1NE6 A;  2DTW A;  1JI6 A;  3EXU A;  3HWJ A;  3WQB A;  5HCB A;  4KU7 A;  4AFA A;  4F3J A;  1UWW A;  4CTE A;  1COV 1;  2JDK A;  5CNA A;  1WUV A;  2VY0 A;  2GNT A;  3JB4 C;  5KC6 A;  1MEC 3;  2ZX3 A;  4QX7 A;  4HXC A;  5GKA C;  1RMU 2;  3WNN A;  4WM7 A;  3SXW A;  3AYA A;  3VZL A;  3WP4 A;  4HN1 A;  2QQU A;  1PIV 1;  1AYM 3;  1UIK A;  3KLS A;  3DN7 A;  4FOW A;  1FMD 2;  4Q26 A;  2WII B;  4YVS A;  1PGS A;  3J8F 2;  3JB8 A;  3N9P A;  1O7F A;  2ATF A;  4W50 A;  1RUH 3;  4UWD A;  4YG3 A;  5T5P A;  4MHU A;  1UPI A;  2VW1 A;  4ZZ8 A;  3HQX A;  5JR7 B;  4PI2 A;  1F4H A;  2PTM A;  3AP7 A;  3T4H B;  1W03 A;  2YFZ A;  2FQP A;  1DQ4 A;  1F35 A;  4LA2 A;  1ZRD A;  4IXL A;  1DGW X;  1AL2 2;  4YW2 A;  5D8A A;  4Y24 A;  3DPR C;  2V72 A;  5T5J A;  1GMM A;  3H1M A;  4CXY A;  3H8X A;  3R4U A;  3O1M A;  1H8T C;  1EUU A;  4OHW A;  4DEV A;  5FJH A;  2XJU A;  2QQP A;  4QHZ A;  5F8P A;  3T09 A;  5FZG A;  4FPJ A;  4PQ9 A;  4DXZ A;  2EXK A;  4GA9 A;  3LA3 A;  2JE8 A;  3LKJ A;  3VDD A;  3ZMN A;  3WDY A;  5FYU A;  3ZYR A;  3I2G A;  1WD4 A;  2JDA A;  4NAO A;  2F6B A;  1YEW A;  1WZX A;  2E63 A;  1TNF A;  2Y6K A;  3CJI A;  3N3H A;  4NMI A;  5F37 A;  2P5B A;  3BKZ A;  2J1T A;  1GNZ A;  2VE1 A;  3MO4 A;  2X8K A;  1YYN A;  2E32 A;  1H9W A;  5JMO A;  4QX1 A;  3AXE A;  4K21 A;  4HKW A;  2V09 A;  4JGY B;  5LZ6 A;  1PK6 A;  4KBZ A;  4NHK A;  1QNY A;  2MEV 2;  1UYZ A;  3E5U A;  1MAC A;  5F3I A;  5ERL A;  5KXC A;  3OGS A;  4LBN A;  4NRQ A;  4DMI A;  3POS A;  1CVN A;  3OEB A;  5BNQ A;  2QQI A;  4CUG A;  1XU1 A;  1LEN A;  1YO8 A;  1IKP A;  4GWI A;  4ZS3 A;  1STM A;  4B7E A;  1OLQ A;  3MV1 1;  3WDU A;  1KGY A;  1Z7S 3;  2YB7 A;  3H8U A;  3ZYP A;  5T5L A;  3ZFE B;  1WW6 A;  4N43 A;  4PBO A;  2EIB A;  3HNY M;  4NAM A;  1RGS A;  1MS9 A;  2QDR A;  5A7S A;  3RWN A;  1C1F A;  4XUT A;  1H8T B;  2OPK A;  1ZRC A;  3LA7 A;  3GNE A;  5FP7 A;  4Q0P A;  2C24 A;  1MQT C;  1YC6 1;  1Z78 A;  4CEW B;  3I2H A;  1JYI A;  2XKP A;  1EV1 3;  2RS3 2;  3CZJ A;  4BK4 A;  3O1V A;  1H4G A;  1F31 A;  4LOR A;  5CKM A;  2ZX0 A;  3K3O A;  2X29 A;  1VBC 3;  3EB7 A;  2PLV 3;  4OVE A;  1R1A 1;  2KM2 A;  3MLK A;  4IE5 A;  3ZIW A;  4K6B A;  5FYY A;  1H4H A;  3F95 A;  4TLF A;  5IK8 A;  1MR5 A;  3VBS B;  4X6R B;  2J1U A;  1Y3T A;  2ZEY A;  1YJL A;  4BQ4 A;  4QQO A;  2B7Y A;  4AQT A;  5KHG A;  3KCY A;  5IW0 A;  4LBM A;  1TME 1;  3SQO A;  3KF5 A;  3KV9 A;  3GBW A;  2WO7 A;  1CPM A;  1SAC A;  4A7Y A;  1JYN A;  2Y33 A;  2D6M A;  2OII A;  2JG8 A;  5G05 L;  3LEM A;  2QUO A;  3T08 A;  5FY4 A;  3PTR B;  4UW6 A;  1SZB A;  1RUD 3;  2HBU A;  4WBB A;  2PMW B;  4NUB A;  4TLG A;  5I8T A;  4MHR A;  1G9B A;  1OC1 A;  2HWC 2;  1PX3 A;  1MS1 A;  1BXH A;  1RUN A;  1GOH A;  2DV9 A;  4H14 A;  4CCM A;  4QM9 A;  4BQ1 A;  4NWW A;  4XDQ A;  5FUN A;  2NZ9 A;  3GDB A;  1LHV A;  4XF1 A;  3OBZ A;  4ZXE A;  3VZK A;  2XWJ B;  1PMJ X;  3T0A A;  1WW7 A;  3FE5 A;  3EO6 A;  1OVP A;  2JDY A;  1W8T A;  2GC0 A;  4FPF A;  4XAC A;  4ZON A;  2HWD 2;  3MEP A;  5FYM A;  1XNC A;  4TXW A;  3RMX A;  4K1Y A;  1WGP A;  3IIA A;  4NRP A;  1S0G A;  4N7U A;  1YUD A;  5FZC A;  3M3I A;  1UZY A;  4ET7 A;  1DQ2 A;  1KS4 A;  4CDQ C;  5A6X A;  1GP6 A;  1Q3E A;  1SBD A;  1V00 A;  2W1Q A;  3X29 B;  1WBF A;  2TBV A;  2MHF A;  4BU2 A;  2YYO A;  5DAB A;  4NHX A;  3HQU A;  5FYB A;  1JZ3 A;  3IAP A;  4IGQ A;  2RMU 2;  5CFD A;  5C4W B;  2OQ7 A;  4E8D A;  1SBF A;  5AFB A;  2CY6 A;  1ND2 C;  1AF9 A;  4U2A A;  5D8A C;  5FY8 A;  1RUI 2;  2RR1 2;  3WZ1 A;  2VZ1 A;  5HV0 A;  5JOW A;  4YFW A;  1ZVF A;  2FCU A;  5FZM A;  2D3P A;  4W65 A;  1OOP B;  1XNT A;  1RUJ 3;  3NNL A;  3ES4 A;  3TEX A;  3BYW A;  4URA A;  2Y8K A;  3GAL A;  3I8T A;  2DBI A;  5EJ1 B;  2X5I C;  3APB A;  3ZXL A;  4BME A;  1G7Y A;  3BPS A;  1RVF 1;  3I4I A;  4BE3 A;  4E2S A;  3C7O A;  1Q8Q A;  4IE7 A;  4JGY A;  5JOY A;  5FYV A;  1JXN A;  2IXC A;  2RDN A;  2J1R A;  4K3U A;  4RR3 B;  1OKO A;  2NQY A;  3LEG A;  1LOE A;  2QJV A;  3CJI B;  1AXZ A;  2WS9 2;  3OEA A;  4OZX A;  2B9V A;  1GNY A;  2VMC A;  4AG4 A;  3GZT B;  4DIQ A;  1RJ7 A;  2Z4F A;  1SLL A;  4RD7 A;  4D0Q A;  1Y9Q A;  4JQR A;  3N9L A;  1LOG A;  4Y1X A;  2GME A;  1F5F A;  2ETE A;  2HWF 3;  2EIG A;  2EAK A;  2PHT A;  4AOC A;  5BNO C;  3ZYJ B;  4NPL A;  3WF1 A;  3U4X A;  1VMH A;  1C5I A;  4MH0 E;  1EV1 2;  2RS3 3;  3I2K A;  4NII A;  1UOJ A;  1TMF 2;  2WT0 A;  4EV0 A;  2XON A;  3IDE A;  3OGR A;  3WUD A;  2GAU A;  3CNA A;  5FZ3 A;  3ENR A;  1IKQ A;  5CBL A;  4JAA A;  1OA3 A;  4EJR A;  4Y5S A;  4I3G A;  4XFC A;  1K5M B;  4N53 A;  4AEK A;  5JOZ A;  3WW3 A;  3OGV A;  1GP4 A;  2X09 A;  3H3U A;  1CX4 A;  3POG A;  1IG0 A;  5FMB A;  1JBC A;  2XG3 A;  3TEY A;  4FTS A;  1QDO A;  1ONA A;  3AJY A;  3OPT A;  1NQJ A;  3AC0 A;  4EQV A;  3POJ A;  3FUO A;  3KT4 A;  3USU B;  4LEJ A;  5L7O A;  4E4H A;  3PUA A;  2G1M A;  4PT6 A;  1L7L A;  3BI3 A;  1CX1 A;  2PLV 1;  2WFP A;  1MZE A;  2R04 1;  4UXA A;  3FN9 A;  4BIF A;  4OHZ A;  1RMU 3;  4XCA A;  4JKK A;  4EN7 B;  2CYF A;  1CON A;  3FLP A;  2VBP A;  3WQ7 A;  3AJZ A;  5C3S A;  2HWB 1;  3IWZ A;  1PZ9 A;  3N7J A;  1H1I A;  1RUH 2;  4S2F A;  1ENQ A;  1VRH 2;  3V0B B;  1BK1 A;  4COZ A;  4NID A;  4Y3O A;  4JDO A;  1OSG A;  3NQH A;  5A7W B;  1PNG A;  2W0X A;  4IV1 C;  2AGS A;  1FNY A;  1GFF 2;  2JD9 A;  2UYB A;  5GZE A;  3KVB A;  2VZS A;  2ZMK A;  1NQD A;  4PF1 A;  4QHO A;  4QX2 A;  5AC9 2;  1YWK A;  4QPG C;  1CWP A;  5A3O A;  1HRI 3;  4NPR A;  2EAL A;  2BNN A;  2WNV B;  3IB3 A;  4GUL A;  4K40 A;  1T2X A;  2XWB B;  4UT5 A;  3P1I A;  2DVA A;  4IER A;  1E57 A;  2WS9 1;  3O0W A;  3PMS A;  5FUI A;  3NO8 A;  4BZ4 A;  2XGX A;  4M3C B;  5T54 A;  1RMU 1;  4NO4 A;  4D6S A;  2Z79 A;  1KQR A;  1LED A;  4QDS A;  2CTV A;  4HPK B;  2A3W A;  3WX5 A;  2C5D A;  2KR2 A;  2D6N A;  1G9A A;  4QKB A;  4UFK A;  3IMN A;  1HN0 A;  2A7A A;  2OZ6 A;  2RDS A;  4O9G A;  4XZP A;  2WFF 2;  5IUQ A;  1ZRE A;  2FDH A;  4URT A;  5GJ6 A;  1LU1 A;  3A23 A;  3I2F A;  4YSF A;  4QU2 A;  1GLH A;  1FPN 3;  4Q4Y 2;  5M0T A;  3DGT A;  3UGG A;  1UMZ A;  1KIT A;  3ZXF A;  4M00 A;  3OJB A;  5IAV A;  5I0R A;  3SHR A;  4C1W A;  3RPQ A;  3ETP A;  3R6S A;  1RUG 3;  5GAL A;  2YXS A;  1S55 A;  3MHZ A;  3NAP B;  4IE4 A;  4O65 A;  4XQD A;  4YW7 A;  1QF3 A;  3VV1 A;  2JB8 A;  4EYU A;  5LK7 B;  2J1A A;  2Q0A A;  1PX4 A;  3NV2 A;  1PMH X;  3U11 A;  2Q8E A;  3UGH A;  3VBS C;  4ZXK A;  3OGJ A;  3P3P A;  3TNP B;  5JOX A;  5FYH A;  4B4Q A;  5FLI A;  5FV3 A;  2YRO A;  3TYJ A;  3KZ4 C;  1YFW A;  1W6M B;  2V73 A;  3UKN A;  1N3Q A;  3PL0 A;  4FFF A;  1UZZ A;  1S0B A;  1ZBE 3;  3B7M A;  3IN9 A;  4P9G A;  3GBG A;  4R9C A;  4HK9 A;  3TWI A;  4YAR A;  2IFR A;  4XF4 A;  3WHU A;  5BNP B;  2XXZ A;  3D0J A;  2DCZ A;  4N43 C;  4XET A;  5FZ0 A;  5CAD A;  1AVB A;  1OPO A;  2DWR A;  4PBP A;  5JPN B;  3NNG A;  2FDI A;  1S4C A;  3SLI A;  1UU6 A;  4ZPI A;  1CJD A;  2WKK A;  3AYC A;  3U37 A;  5EPA A;  3RZJ A;  1VPH A;  3M3E A;  4D6R A;  3FFZ A;  1W6P A;  3RZH A;  1G9F A;  1RUG 1;  4B3N A;  1DYK A;  1RHI 1;  2ID4 A;  2P37 A;  1IPS A;  1WA6 X;  2WIN B;  2Y34 A;  3ILF A;  4XXA A;  4GAZ A;  4YRD A;  2EVX A;  5FAX A;  3WLU A;  4CPB D;  2BP6 A;  5C70 A;  2LUW A;  4ZS2 A;  5T55 A;  3RVH A;  2QVS B;  1MS0 A;  4LMF A;  4RS5 B;  4LHN A;  4B4R A;  4BCU A;  1SLA A;  4A42 A;  2Y6F A;  4LJH A;  1VAV A;  4AI9 A;  2HWF 1;  5L36 A;  1AJO A;  1RC6 A;  1RUI 1;  1Y9G A;  2RR1 1;  3NKG A;  4WVV A;  5E1R A;  4CCO A;  5AFE A;  4P9X A;  4GJY A;  4QPG A;  4XAA A;  4EN9 B;  2E26 A;  4OMC A;  2JG8 B;  3CZU A;  5JZG A;  4MG2 A;  1TME 2;  5A3L A;  4Q8L A;  1W8U A;  4IEQ A;  2DUP A;  3OD0 A;  1W9S A;  4BLJ A;  5A3P A;  1NCR C;  3TN9 1;  2ZGM A;  3UKV A;  4KWU A;  4FO9 A;  3V56 A;  4Z2W A;  5KR7 A;  3E97 A;  4IEU A;  4D69 A;  3H8R A;  2IXJ A;  4JX0 A;  1VBB 3;  4QXC A;  4CDQ A;  3FUQ A;  4WM7 C;  4OI0 A;  2FBE A;  1YQ2 A;  3U75 A;  1AYN 2;  2ZA9 A;  4IET A;  3MBW A;  5CFC A;  2ZGT A;  1PZ7 A;  3I49 A;  5AC9 1;  2Q8D A;  2VQU A;  4KGQ A;  2BWC A;  2GP5 A;  1QJX 2;  5DDJ 1;  4ITC A;  2AYH A;  1DF0 A;  3ZX7 A;  4CEW A;  2VCC A;  3WG4 A;  5AVA A;  1FV2 A;  1K5J A;  1GZ9 A;  1SLT A;  1JU3 A;  2YMZ A;  4P5Y A;  1F9K A;  2XBO 1;  4RYD A;  3CBN A;  3L2Y A;  1KEX A;  2PHF A;  2WAO A;  4YM1 A;  5DZG A;  3WDV A;  5JIA A;  4F83 A;  4K7J A;  3H0O A;  5F3E A;  5FWJ A;  1WCD J;  5A1F A;  1GIC A;  4RFT 0;  1Q8S A;  4FT8 A;  4RFR B;  2EAA A;  1A6C A;  1DIW A;  2BVB A;  2RM2 2;  3H42 B;  4DIN B;  4AR2 A;  1SG3 A;  4Q5O A;  1LAJ A;  3UJQ A;  1N3P A;  3LD8 A;  3BB6 A;  1UXX X;  3V0B A;  3ZYB A;  2GP3 A;  1IOA A;  4M4P A;  4HOO A;  1YIF A;  2Y6H A;  4AAX A;  2VOV A;  4JKL A;  5FMO L;  1PGW 1;  1VAL A;  2JG9 C;  5FOB B;  5JUV A;  2RM2 1;  4UF0 B;  3J8F 3;  3LF7 A;  3AFK A;  2YY1 A;  2GND A;  1EAH 3;  5FK7 A;  4E8C A;  2Q30 A;  3OUH A;  4BQ2 A;  1H1A A;  1PO1 3;  4CUA A;  5F7U A;  3OG2 A;  4CDW A;  4Q4W 3;  1LKN A;  4C0H A;  4RA0 A;  5A70 A;  1XSQ A;  1D2S A;  3R0R A;  4JZR A;  4Y4R A;  5KHH A;  3LOI A;  2SBA A;  4CUB A;  5F3C A;  1GUI A;  3N7K A;  4JVA A;  3VD9 A;  1FOD 1;  2VZT A;  2ZAC A;  1VRH 3;  2LRP A;  1W2T A;  4Z8B A;  1OLR A;  4L11 A;  5D21 A;  3S5A A;  2Z69 A;  1JOD A;  1RUE 1;  4Y20 B;  2B4K A;  2Y60 A;  3URF A;  3AM2 A;  4Q0U A;  4HKO A;  3H1W A;  4KG8 A;  3NRU A;  3ZXD A;  4AFM A;  3B94 A;  1NCR A;  2JD4 A;  1CAX B;  3KCX A;  4WZC A;  1WD3 A;  3EHK A;  2R06 1;  2RHP A;  4LHL A;  4CEY B;  3SIS A;  2WLP A;  2D6L X;  2VZQ A;  1WMD A;  2ZEX A;  2V5D A;  4MGK E;  4JDN A;  3OPZ A;  4OQ9 A;  4FOV A;  4V2V A;  4OFG A;  5IK7 A;  3IAQ A;  4GB3 1;  5JIU A;  3U14 A;  2D44 A;  4QPI B;  1OH3 A;  1GWK A;  1MZ6 A;  3K48 A;  4Q0S A;  5C3O A;  4E4S A;  1SDW A;  3VZM A;  1DZQ A;  3AVR A;  2XOM A;  3NJY A;  4EWD A;  2P3J A;  5DZE A;  5ANN A;  5HCA A;  4AHW A;  3SH3 A;  5T52 A;  2W1S A;  1LCL A;  5L9V A;  4IV3 C;  2VZ3 A;  2BGO A;  4XTP A;  4YPJ A;  4BWO A;  1PK6 B;  5FIX A;  2WNU C;  4DUV A;  5LBC A;  4D3W A;  1W6Q B;  5FZ1 A;  4FQ4 A;  2VXJ A;  3KT7 A;  2MNG A;  2XJT A;  2VO5 A;  1JZ4 A;  3AMQ A;  4MXW A;  4XW3 A;  2GH2 A;  3IT8 A;  1WMF A;  3K77 A;  4AED B;  2VG9 A;  1OQD A;  1RIT A;  2R06 3;  1A8D A;  2W2I A;  1KS5 A;  4GKY A;  4CU7 A;  4NIG A;  1XRU A;  3EMR A;  4M3C A;  3CKH A;  4JC1 A;  4BQ3 A;  5KXE A;  1H9P A;  3IM0 A;  4C1X A;  4AE2 A;  3NW4 A;  1US3 A;  2PLV 2;  5FLH A;  3KHC A;  1Q8O A;  3ALQ A;  2G9F A;  3T0B A;  3KS7 A;  4FI9 A;  2ZHL A;  1LOD A;  1X50 A;  1IHM A;  1W2A X;  1YFU A;  2VAU A;  3FHI B;  4XF3 A;  1RL3 A;  1HV1 A;  1J3Q A;  4O61 A;  2BOJ A;  5LB6 A;  3VBH B;  3ZFG B;  1NYW A;  2VL4 A;  1GOF A;  4HON A;  4CEW C;  3P6B A;  2NP0 A;  3FHQ A;  2PQQ A;  5FYZ A;  1U5Z A;  4GJZ A;  2VNO A;  1UN1 A;  1UY0 A;  4ERO A;  4I01 A;  5CIS A;  1GZW A;  4FPY A;  3ME2 A;  4IEZ A;  4AQS A;  1UZW A;  1VAK A;  2ZAA A;  3PNA A;  5GZD A;  4ZU4 A;  3ES1 A;  1G8W A;  4YYO A;  2QQM A;  3ZXK A;  4BJ0 A;  2XR4 A;  5IK5 A;  3UET A;  4BM8 A;  2FCT A;  1S0C A;  1ULG A;  2AC1 A;  2VNG A;  5A80 A;  2JDN A;  2VUA A;  1N3O A;  2IVI B;  5T50 A;  4IV3 A;  1AR8 1;  4RHV 3;  3KGZ A;  4GWM A;  4CA9 A;  4COW A;  2PA7 A;  2LM3 A;  3ZFF C;  3ZKU A;  4YM2 A;  2OVU A;  2BTV C;  2XKO A;  1ODN A;  3DPR B;  4FSJ A;  1PK6 C;  1GR3 A;  1UY1 A;  4CCD A;  3ELN A;  3RDI A;  2TNF A;  4LBQ D;  1W6O B;  5BYN A;  2VW2 A;  4XF9 A;  2VTX J;  2FHR A;  1PVC 3;  3IDC B;  4XHB A;  1K5M A;  3Q9O A;  1RUD 2;  4CVU A;  4Q0V A;  3PHM A;  3U0Z A;  3NV1 A;  1BBT 1;  3ORJ A;  2HH9 A;  2PN5 A;  4D6Q A;  3RFR A;  1O91 A;  4BXF A;  1DLC A;  3VHP A;  1YQ6 A;  4JTN A;  4F8A A;  2Y6L A;  1RUC 2;  4CXW A;  3K75 B;  2DTY A;  2BGP A;  4MUV A;  2XJP A;  2OS2 A;  2ZS6 B;  5FXZ A;  4C0B A;  4CCL A;  1XU2 A;  4CDU B;  4HMZ A;  1AR9 2;  2JIG A;  1CZV A;  5FPV A;  5ISL A;  4I2O A;  4P14 A;  4N7I A;  3E5X A;  1J59 A;  4YG6 A;  5F1R A;  3OYW A;  3LPG A;  4G4F A;  3S7E A;  5GLZ A;  5IVC A;  3SH5 A;  3FX3 A;  4LO5 B;  2ZOE B;  3CDZ B;  3PME A;  4PDW C;  2LS6 A;  3CHX A;  4FPG A;  4QGL A;  1PIV 2;  1RUE 2;  4COY A;  3AP4 A;  4YGC A;  1N1S A;  4K1Z A;  2BYV E;  4Z07 A;  1R1Z A;  5FYI A;  2VCA A;  2E7Q A;  2FMY A;  3I2I A;  1H8V A;  4RQP B;  1T6G C;  2ARE A;  1I5P A;  5DAP A;  4OLL A;  3IZO A;  3VHO A;  2BJS A;  1AR9 1;  2R04 2;  5J36 A;  1W39 A;  5HPO A;  1XE0 A;  2HEV F;  2ZX1 A;  5B4N A;  3RZL A;  3GGL A;  2FZ2 A;  3J7H A;  1W6N A;  5J96 B;  2RS5 1;  2OUJ A;  4RS5 C;  3LOB A;  4A7Z A;  2ARC A;  3FZ3 A;  1XYN A;  5I8Y A;  1N1V A;  2DVB A;  3UYJ A;  5IAX A;  2OQ6 A;  3DYO A;  5K0U B;  2Q5T A;  3OB8 A;  5BUV A;  5C8C C;  2JE9 A;  4P9J A;  4QQL A;  1X8E A;  4BQX A;  4YZ3 A;  2ZCW A;  3W20 A;  2UY8 A;  2OYZ A;  4DY3 A;  1H0B A;  2VOT A;  4R4X A;  2BU9 A;  5IK4 A;  2ZGU A;  1NCR B;  2VNV A;  4QPI C;  3ZXA C;  4QU1 A;  4YM3 A;  1JHJ A;  3ZYI B;  1X7N A;  4AF9 A;  3NL1 A;  1LNS A;  4YVW C;  4NE9 A;  2ZMN A;  3WNO A;  5FO8 B;  4Y1V A;  4COV A;  3DEM A;  1GZC A;  1MZ5 A;  4RN5 A;  1AX1 A;  2XBO 2;  3AP6 A;  1DZT A;  1LHO A;  2ZGS A;  4PLO A;  5L9B A;  2WA3 A;  3W5N A;  4CDX A;  3VHR A;  4YM0 A;  5F9T A;  4L2N A;  5AVP A;  5C7G A;  2OX0 A;  1DG6 A;  2O14 A;  1WCU A;  1OFS A;  3H7Y A;  1POV 3;  1C57 A;  4CPB A;  3IDB B;  5CU1 A;  1UPS A;  5F6K A;  3WR0 A;  4ATF A;  2PXJ A;  1QDC A;  2DCT A;  5C6C A;  1W0O A;  3HD8 B;  4GH4 B;  2XJR A;  4LHK A;  3VBF B;  1DLL A;  3ABZ A;  1QOS A;  3QBQ A;  4A44 A;  5FXW A;  1HB3 A;  1RIR A;  1LGN A;  1HB2 A;  3W58 A;  3D8C A;  3N9M A;  4XUQ A;  1W28 A;  1TEI A;  3MW3 A;  5DZF A;  3ITQ A;  4YW6 A;  3MF9 A;  3WG3 A;  3GZU C;  4A7K A;  3UV9 A;  3I3E A;  5FZ7 A;  3POE A;  1GBG A;  1JW6 A;  3KCC A;  4IDZ A;  2R0H A;  1ZM1 A;  5KWR A;  5CAZ A;  1DU3 D;  2Y0O A;  4GZ9 A;  2BNO A;  4TZD A;  1IS3 A;  2D93 A;  2WSU A;  4XXP A;  5D8A B;  5JAX A;  5FBJ A;  3S7I A;  1EUT A;  1ULD A;  3KB5 A;  1AYN 1;  4GH4 A;  4I09 A;  2XLF A;  3ZPO A;  2D6O X;  1MVQ A;  1YLL A;  4OI1 A;  4OQ8 A;  1W6O A;  3VBO C;  5FQ0 A;  1QQP 3;  3I3D A;  3AKT A;  1OH4 A;  4OI2 A;  1FMD 1;  1FV3 A;  1W8O A;  4GMP 0;  4A3Z A;  4P00 B;  1LB2 A;  1JOJ A;  2JG8 C;  1I3H A;  1YIP A;  2SLI A;  4S2G A;  4E27 A;  4LKE A;  1R08 2;  4LTA A;  4QKD A;  3ZOI A;  4J6G A;  2QQO A;  2QQW A;  2XUM A;  5DUV A;  3USU A;  2R1D A;  4WV8 A;  4UFL A;  2W9X A;  4OYU A;  1XQN A;  5FZF A;  4RR3 C;  3RMY A;  4L99 A;  3I2D A;  3ZN6 A;  5F5I A;  2IUW A;  1PO1 2;  1RUF 3;  4EN0 A;  3VDB A;  3D4K A;  3GYD A;  1UD1 A;  5J37 A;  1RXF A;  4QPG B;  1B35 A;  4LO6 B;  1OOP C;  2OW4 A;  4BH9 A;  4FPE A;  3WIN E;  3LSD A;  1LES A;  3HJR A;  4ASL A;  4FP2 A;  4MGZ E;  5H9P A;  1RUH 1;  4MGT A;  2JIC A;  2CDO A;  2BV4 A;  2D7F A;  2JDZ A;  5A7N A;  5J09 A;  1PHM A;  2EXJ A;  1C8M 2;  3HVD A;  1TE1 B;  3POB A;  2GDF A;  4NIA A;  2E9Q A;  3N9N A;  3AVS A;  2XLG A;  2RS1 1;  4Q0Q A;  3H3Z A;  4PCR A;  1J84 A;  1LUL A;  2XVK A;  2ZGP A;  1EY2 A;  5GZF A;  4B7K A;  4Y1U A;  2I07 B;  2VVF A;  1QJX 3;  1TQ5 A;  1NXM A;  4R52 A;  2IWG B;  1UOG A;  2RS5 2;  1C8N A;  5FZH A;  2OT7 A;  3BU0 A;  1VMF A;  4LUM A;  4YGD A;  3SEE A;  4AK3 A;  3OUI A;  3MID A;  1ND2 A;  1ST8 A;  1W6Q A;  3G7D A;  3RJR A;  3T2O A;  1E5S A;  5HBA A;  3M70 A;  1EPZ A;  1PO2 3;  2A71 A;  3RS6 A;  5FMO S;  3VGI A;  3CLP A;  3MPP G;  4LO4 B;  4QGN A;  2ZGQ A;  3B02 A;  1LRH A;  3LEK A;  4QPY A;  5FK8 A;  1F5J A;  2WT2 A;  2A75 A;  2RS3 1;  1ZBA 1;  1ZRI A;  2AEZ A;  2JDM A;  4IUG A;  3M7A A;  3N35 A;  1CAV B;  3L2H A;  4FOQ A;  3WNK A;  2ZEZ A;  3VDD C;  4WVW A;  2UU8 A;  5FCC A;  2DBN A;  3K4D A;  4R9D A;  5F2S A;  4BYY A;  1UU4 A;  2QKD A;  1CAV A;  1C3H A;  2F4P A;  1A34 A;  5A1A A;  1CGP A;  2WQ8 A;  4CUC A;  1JUH A;  2WFF 1;  1IQD C;  1SCR A;  1X36 A;  3LWC A;  2VEC A;  2NLR A;  4YZ2 A;  4F7Z A;  1ND3 B;  1UCX A;  1OFN A;  1YHF A;  3ZKY A;  2FD8 A;  5HXV A;  3ZYH A;  5C5T A;  1WA4 A;  2FZ1 A;  1CR7 A;  2VW0 A;  4XUN A;  3T30 A;  4YW3 A;  4NIH A;  1GAN A;  3DPR A;  4C90 A;  4DRV A;  1JZ5 A;  1W8H A;  1FOD 3;  2GH8 A;  5HCF A;  4L9B A;  4OI4 A;  3ZXJ A;  1ND2 B;  3WW2 A;  4DQA A;  3OBA A;  4MGI E;  1W9T A;  4FCA A;  2A6Z A;  3AMP A;  3AMM A;  1JHN A;  2VQA A;  3ZSL A;  1UX6 A;  3QH6 A;  5KHI A;  4ZZ5 A;  4XAB A;  2ZX4 A;  1YNA A;  1AXK A;  3FC0 A;  4HFS A;  1W0N A;  1O4T A;  3ZPY A;  5CG8 A;  1F8V A;  4R9B A;  4I0A A;  2K0G A;  4UBH A;  4FAG A;  5JPM B;  1ASJ 1;  1R08 3;  1P8J A;  2VMI A;  5DXD A;  1K3I A;  2CU5 A;  3IMM A;  5FY9 A;  1AR6 1;  1Q43 A;  3KHB A;  3PIG A;  3FLT A;  5A3T A;  3MIE A;  4XFI A;  1Y43 B;  2D40 A;  3ILR A;  1AR8 3;  2D6K A;  3GCW A;  2VUD A;  4HAN A;  1WCK A;  2DCJ A;  1JZ8 A;  5A32 A;  1RIN A;  1YQ5 A;  2BVV A;  3VZJ A;  4HLT A;  2OUH A;  1SPP A;  2EID A;  1RUG 2;  1NY7 2;  3WQ1 A;  4CP9 B;  2ADE A;  2YC2 A;  3THD A;  2EIE A;  1HX6 A;  1VMJ A;  3W5M A;  4XF0 A;  5EV7 A;  4Z92 B;  4XFH A;  1V70 A;  5FBZ A;  5IVJ A;  3J7N A;  5LBE A;  2GC1 A;  2R16 A;  2XUE A;  3HNB M;  1UO9 A;  4ASM B;  2H6B A;  5DAX A;  5L7O B;  1XYP A;  5CYY A;  3I2O A;  4MXW B;  4Z1V A;  5ACA 2;  3RYK A;  4QAW A;  1DQ5 A;  1XE7 A;  4KL1 A;  5FDB A;  5C8C B;  1QIQ A;  1VJ2 A;  4RQP C;  2B46 X;  3HOB A;  2WZR 3;  4PLM A;  2ZGN A;  1B35 C;  4N8M A;  2XVG A;  4MET A;  3AYE A;  1S2E A;  4CDX B;  1QOO A;  4D8M A;  1CQ9 A;  1W3V A;  2G4I A;  5FQ0 B;  4K8R B;  1RXG A;  3VD3 A;  2FDF A;  4S2D A;  1CD3 G;  2Z2S B;  2WWU A;  4JKM A;  2LRO A;  1QJY 2;  2WWJ A;  4YVW B;  5K0U C;  3GHN A;  5LY2 A;  3LFM A;  1RUF 1;  5ANQ A;  1R1A 3;  1WLD A;  3B9C A;  4EN8 B;  4EZ4 A;  4UFI A;  1O8S A;  5FWE A;  4CP9 A;  1QWR A;  2J1E A;  1LOB A;  3ZDS A;  4Y5T A;  1JYT A;  3LPF A;  1SFP A;  1NLQ A;  2VOK A;  4Q4W 2;  3MIH A;  1VBD 2;  1IZ3 A;  3MW4 A;  4EWA A;  3IPV A;  1HQN A;  2RMU 1;  3M3Q A;  1QH7 A;  1UW8 A;  3E6D A;  3NV4 A;  1S0I A;  4HZF A;  4FOY A;  5E89 A;  4B8E A;  2VTF A;  2VME A;  4W8J A;  2XLA A;  5FPA A;  1H6X A;  3HMY A;  2E51 A;  3O5S A;  4MO3 M;  2YUE A;  4HSL A;  5C4W C;  2A5Z A;  1OT5 A;  2VMH A;  1CAU A;  4OUE A;  1HRV 2;  1NZI A;  5CZK A;  5BY5 A;  2QE3 A;  3MLJ A;  1HJF A;  1H2L A;  4XJA A;  5FR3 A;  2QFE A;  4XAE A;  1YXW A;  4Q4W 1;  3SNM A;  5EQU A;  5BNP A;  5GZG A;  1CAW B;  5FY1 A;  4RL7 A;  3HEI A;  3O1O A;  2YDE A;  4J1X A;  4Q8K A;  1O3T A;  4YNI A;  3ZLI A;  4JV4 A;  2R32 A;  2YBS A;  1BJQ A;  3KQR A;  3KVA A;  4LA3 A;  2UUR A;  2VNR A;  4WM8 C;  3INA A;  5FZD A;  5BNN A;  4CYD A;  1ACC A;  4Y33 A;  1X33 A;  2PAM A;  3PVO A;  4XFG A;  3HN3 A;  3NAP A;  4FFI A;  2VZP A;  1U12 A;  2D98 A;  3POW A;  1AR7 3;  4OCT A;  5E6H A;  3ACG A;  4P9I A;  3MZH A;  1VAM A;  5FZO A;  3I3M A;  2QQL A;  4AED C;  4CSW A;  2ES3 A;  2YBP A;  3R4D B;  4FFG A;  3WCS A;  5LY1 A;  3JD7 2;  4FPO B;  1NT0 A;  3USS A;  3JXS A;  3V64 A;  4RGG A;  3LAG A;  1PM7 A;  5F5C A;  3RSJ A;  4CU9 A;  1VBC 1;  1NA1 A;  1HQW A;  4CRQ A;  3MGU A;  4RQP A;  3WVJ A;  4CZS A;  1H1M A;  1SHW B;  1UL9 A;  2G9G A;  4CDQ B;  1BEV 1;  1GNH A;  3THP A;  1LGC A;  1VB2 A;  3C3V A;  1DYP A;  2BQP A;  3ON7 A;  3KD4 A;  3H50 A;  3PU8 A;  3KSC A;  4K8F A;  5DUW A;  3VKN A;  1H30 A;  1W04 A;  2BBV A;  1E5H A;  3C7H A;  1US2 A;  5C3P A;  1WME A;  1NG0 A;  4CCE A;  3DF0 A;  2Q1Z B;  4DS0 A;  3KM5 A;  2WZP P;  1AZD A;  4JGY C;  1ASJ 3;  2ARX A;  2W46 A;  3I54 A;  1RB8 G;  2A70 A;  1VBE 2;  5BV6 A;  1SPP B;  1XNK A;  1JH5 A;  1I9R A;  3WCR A;  5A32 B;  4B1L A;  1W99 A;  3VBR A;  2I2S A;  3CQO A;  4YVS C;  1XB9 A;  3HN1 A;  3JD7 3;  1O8P A;  2A1X A;  2VU9 A;  4NJ4 A;  1AUY A;  4XHX A;  2XPJ A;  3POF A;  1VBD 1;  1AL2 3;  2VVE A;  3RWK X;  3LDK A;  5A3M A;  4MV2 A;  5KXD A;  5C3R A;  1VBE 3;  4A45 A;  2BW8 A;  2GSY A;  3D82 A;  4Y1Z A;  3PU3 A;  5JCT A;  4HVQ A;  4NN0 A;  5C9A C;  2UY9 A;  1YQC A;  5IVB A;  3ZSE A;  2ARB A;  4XEZ A;  1VRH 1;  1EAH 2;  1GOG A;  5CG9 A;  1ZBA 3;  2HWB 2;  4PI0 A;  3S30 A;  3CEW A;  2IC1 A;  2IZW A;  5KHJ A;  4CCJ A;  3H8O A;  1B09 A;  4AXO A;  5EZW A;  1FXZ A;  3N4M A;  4QGM A;  2QQV A;  2GC2 A;  4NRM A;  4ARY A;  1H8T A;  4KGG A;  1KXG A;  3RZZ A;  3ZFF B;  4AHZ A;  3A0N A;  3U1X A;  4L8Q A;  4UBG A;  1OA4 A;  1W8W A;  1ODM A;  3A0K A;  4IE0 A;  2D5F A;  2DVD A;  3BOW A;  4KWK A;  3OPW A;  5L19 A;  5EYY A;  5DMY A;  2WL1 A;  3MIG A;  3P5B A;  1NA1 C;  2VZV A;  1UMI A;  2FDG A;  1SFY A;  2I45 A;  3U78 A;  1XNB A;  3MF6 A;  4IV1 A;  2A3X A;  2B5H A;  3BAL A;  1PIV 3;  3FBY A;  3IBM A;  3UT0 A;  1KD7 A;  1PZ8 A;  2IFW A;  1NY7 1;  3AKP A;  2VQT A;  1JYW A;  4PDW A;  1BYH A;  3NMB A;  3VBR C;  2VBB A;  1QXJ A;  2HWD 1;  2WT1 A;  2WO2 A;  2XHN A;  2ZAB A;  4ZY9 A;  4LLO A;  2P3I A;  4CCN A;  4CE8 A;  1I6X A;  1VLN A;  4Y26 A;  5DAW A;  2RS1 2;  3DCQ A;  4QKF A;  3III A;  4Q29 A;  4WVM A;  5L73 A;  3NV3 A;  4BXS V;  4YGE A;  1D7P M;  3GCX A;  3RYP A;  2R07 2;  5CEH A;  2CGN A;  1QKQ A;  5EXO A;  1YRZ A;  1V6I A;  2DYC A;  2LTN A;  1LHW A;  1UQX A;  2PEL A;  2R6Q A;  2ZAH A;  1IS6 A;  4IEY A;  2Y38 A;  3SKJ E;  1F15 A;  5JZG C;  3GHM A;  3BTX A;  4LT5 A;  5TSW A;  5A7P A;  2VUL A;  3KV4 A;  4QXK A;  4Y22 A;  2BFU S;  3MIF A;  2WAA A;  1W2O A;  4CXX A;  1C28 A;  1UF2 C;  2B9U A;  1OOP A;  4JQT A;  1FT9 A;  1FYU A;  1YJK A;  1HB1 A;  2E6V A;  3GJB A;  5H9R A;  4IW3 A;  2ORX A;  1AJK A;  4YW4 A;  2HEY F;  5FJK A;  5FP3 A;  5IYY A;  3V65 A;  5BXX A;  4AGR A;  2A73 B;  1GP5 A;  4QX5 A;  3O1P A;  1WKY A;  5JLV A;  4GB3 2;  5CFD C;  5LEJ A;  1VR3 A;  2RS1 3;  1B35 B;  1V9U 1;  2A6W A;  2ARA A;  3GM8 A;  4LPL A;  2JG9 B;  1R08 1;  1BVV A;  2R07 3;  2DUQ A;  2XL7 A;  1AR6 3;  1QJX 1;  1D4M 1;  2ET1 A;  2WWS A;  2XHK A;  3AKQ A;  2K46 A;  2BUK A;  2ZHM A;  3WG2 A;  4A41 A;  4P9L A;  2QQN A;  1N47 A;  4GIQ A;  1BKZ A;  1TMF 3;  1V6N A;  5A7Q A;  3ZR5 A;  4B4P A;  4XVH A;  4D7T A;  1BQP A;  3T1M A;  1HRV 1;  5JXH A;  2NMN A;  2ZEW A;  1Z0H A;  5LW9 A;  3BOD A;  4YVS B;  5IFP A;  4XUR A;  3QOP A;  1LEM A;  4BIO A;  3TNQ A;  4BLI A;  1MQT A;  1EP0 A;  2LW8 A;  3PUQ A;  3WF3 A;  2HWB 3;  4NWV A;  4M4R A;  4I0B A;  2IXH A;  1URX A;  3D3A A;  4UF0 A;  4A6S A;  2IXL A;  3WP3 A;  4A2U A;  2UYA A;  1WLT A;  3PDQ A;  4C91 A;  5ABJ B;  3TN9 3;  1A78 A;  1V9U 3;  2BBA A;  3BOP A;  1KRI A;  4L0P A;  2W94 A;  2WNU B;  3C2U A;  1ZA4 A;  2XDV A;  3T1L A;  4CP0 A;  2ZHK A;  2Y0I A;  3VBH C;  3ZFG C;  3ZO0 B;  4TYS A;  1POV 0;  1R09 2;  4X8P A;  3GXU A;  1VBB 2;  3ZDV A;  4AVA A;  1O59 A;  4FAH A;  3HQR A;  2JDU A;  1CPN A;  3M3C A;  3H1Y A;  5J7M A;  4RS5 A;  2WNU A;  4NOT A;  5A33 A;  4BQY A;  5FP8 A;  3BVC A;  3H9A A;  1U5X A;  3PIJ A;  4TN7 A;  5BNP C;  1M4W A;  5LRR A;  1MEC 1;  2BEO A;  5DN2 A;  5IJR A;  4I02 A;  2GZW A;  3FFQ A;  1XBF A;  3SH4 A;  2JXA A;  4RR3 A;  5IVE A;  4H7M A;  2G9Z A;  4WM8 B;  1AR9 3;  1OHF A;  4JRL A;  1N1T A;  5GZC A;  1ASJ 2;  1JU4 A;  1HQL A;  1HRI 2;  4W6Y A;  4A4A A;  1J3R A;  3ATG A;  3C7F A;  5CFC C;  3K4A A;  4R8H A;  4Q4V 1;  3SCF A;  4DXR A;  4P9W A;  4TWT A;  3WEZ A;  4RSU A;  3A7Q A;  5JDB A;  2D3R A;  3WSO A;  4N90 A;  4XOG A;  4OHX A;  3ZYF A;  2DCK A;  4AGV A;  3L9J T;  1QJZ A;  4HKL A;  2VM9 A;  5J48 A;  2X5I B;  4YGB A;  5DQ0 A;  5FRA A;  1O3S A;  4LE3 A;  2ZPX A;  3DXT A;  1DGL A;  1MZF A;  1W9W A;  1TVG A;  1KFU L;  1Q8V A;  4DXT A;  1RUO A;  2DFB A;  1XYO A;  4OUS A;  2ZGO A;  4MAD A;  4FPH A;  4BPZ A;  5LRS A;  2AEN A;  5CB7 A;  2WUH A;  4MGQ A;  3VBH A;  3ZFG A;  4UFM A;  5I8S A;  1UZV A;  2DF7 A;  2HWD 3;  2JWP A;  1LEC A;  3UK9 A;  2YGL A;  1DZR A;  2W92 A;  4LNV A;  3VKL A;  1UKG A;  1SDD B;  2W95 A;  4YWA A;  2FDK A;  2GC3 A;  4FPL A;  4LBQ B;  5LEK A;  4DOU A;  1Y9M A;  4GWJ A;  1UOF A;  1PVC 2;  3AZY A;  3WNX A;  4WVM B;  1LOF A;  3JQW A;  1GWL A;  4KI5 M;  4OUM A;  5A6Y A;  2MEV 1;  2EIC A;  1DHK B;  2E33 A;  3VDD B;  3KQ4 B;  2HJI A;  3G6J B;  2VOX A;  3RZK A;  3QLQ A;  3OYW B;  2WNV A;  5FLJ A;  2NYY A;  2VOW A;  1LOA A;  1JTZ X;  2GMP A;  2EA7 A;  2FMD A;  1ND3 C;  1VBD 3;  3FMG A;  2ZHN A;  3VDA A;  4FPC A;  3WDW A;  1W3X A;  1FNZ A;  4AI0 A;  4CDU A;  1M06 G;  3ZR6 A;  1VBE 1;  2W87 A;  1JYX A;  4LOT A;  2Q8C A;  1Q56 A;  3SMH A;  1BEV 3;  1CES A;  1HJG A;  3VBU B;  2C9A A;  4YLZ A;  1NZC A;  1Z7S 1;  2QQK A;  4ONU A;  2WA4 A;  4ZHN A;  1RVF 3;  4DUX A;  2CAU A;  1C8M 1;  2R30 A;  4U36 A;  5EP9 A;  3ZSJ A;  3VHN A;  2VUJ A;  5FPU A;  1H2N A;  1OQE A;  4B1M A;  4XBQ A;  2A6V A;  1K5M C;  1OUR A;  1HXS 3;  2YC0 A;  3I7D A;  2WO3 A;  3LB9 A;  3D5O A;  1BMV 1;  4NRO A;  4OZO A;  2E31 A;  4IE6 A;  3DXU A;  2HWE 3;  2JKX A;  5DAQ A;  5LCW L;  4ES9 A;  2VR4 A;  4J25 A;  1IS5 A;  4IQP A;  3BTA A;  5IHR A;  5A1L A;  1REF A;  4FFH A;  3WP5 A;  3JD7 1;  3ZIX A;  1ULO A;  3ROU A;  2WQZ C;  3WF0 A;  1GZT A;  3O12 A;  3OSD A;  4JGZ C;  3WQ0 A;  1QXR A;  5FYT A;  3TB0 A;  5JSR A;  4UW4 A;  1UXZ A;  4UW5 A;  1RED A;  4R9A A;  3WY6 A;  3BIE A;  3VB9 A;  2GN3 A;  4QX8 A;  5I0D A;  2CDP A;  1O3R A;  1LTE A;  1O4Y A;  2HBT A;  4Q4X 3;  1U0A A;  3CO2 A;  1O5L A;  4MGY E;  1DQ1 A;  2CV6 A;  2B39 A;  4AVV A;  2IXI A;  4E4D X;  1FX5 A;  1QJF A;  1CIY A;  2DUO A;  3H7J A;  2P6H A;  5E88 A;  4JRA A;  1OUX A;  1H2M A;  1U5I A;  2J42 A;  2OKX A;  2H6C A;  1GKB A;  2OPW A;  1EPW A;  3B5L B;  2B45 X;  3BIW E;  4Z2A A;  5C8W A;  4MVT A;  2YPJ A;  4HVO A;  1DYO A;  2L9L A;  1EAH 1;  1TG7 A;  4AFD A;  3J8F 1;  5JR2 A;  1YI7 A;  1DGW A;  1NE4 A;  1RUC 1;  1VB4 A;  2DDU A;  3DEC A;  3MIC A;  4FQZ A;  3TAY A;  5C5U A;  1PVC 1;  4EWE A;  4RHV 2;  2XJV A;  1O5U A;  3UKT A;  1QOT A;  2VC9 A;  3I59 B;  5SV5 A;  1JYV A;  1AX0 A;  2W68 A;  4Y5Z 0;  3PUS A;  4LKF A;  3DKW A;  4QQP A;  4W4Z A;  3AL6 A;  1COV 2;  2BDR A;  2YFU A;  3LDB A;  2H0V A;  1SLC A;  3TN9 2;  4HK8 A;  2RVA A;  1S1A A;  2EXI A;  2YHJ A;  4XE9 A;  2RDQ A;  4P02 B;  4GQ7 A;  4AEM A;  4DY5 A;  3RYR A;  1POV 1;  1YQ8 A;  4PLN A;  4QWN A;  3PUR A;  5LBF A;  1BHG A;  2VZO A;  4TTG A;  4LIT A;  1AR8 2;  1ZZ9 A;  4QHB A;  3WNL A;  4PDW B;  2AZ5 A;  3ACI A;  3A4U A;  3HPN A;  4WVZ A;  3RI9 A;  1E5R A;  1ULC A;  3PJY A;  4AGG A;  1O3Q A;  2E7A A;  3ZM8 A;  4LK7 A;  1RJ8 A;  2HEW F;  2BER A;  3HNM A;  3OGG A;  2O8O A;  1DGR A;  2CNA A;  5EYX A;  5D1I A;  2AR6 A;  1EV1 1;  5CFD B;  2ZGR A;  3CF6 E;  4GKX A;  1I1E A;  1REE A;  3DUI A;  1MS3 A;  4QB2 A;  1HRV 3;  5GLV A;  4Q1P A;  3AP5 A;  3FBM A;  1BBT 3;  3O1S A;  4BMB A;  2VMD A;  3B69 A;  3S6P A;  4Y20 A;  3AP9 A;  2LAL A;  5GM0 A;  2PAK A;  3T2Q A;  4AVT A;  1TME 3;  2AH2 A;  3UNP A;  5EHD A;  3SKV A;  4WZF A;  4LBQ A;  1ZZ8 A;  2R7E B;  4CP1 A;  4IL7 A;  3TBD A;  1LR5 A;  3PLQ A;  4QT6 A;  1WMX A;  2BRT A;  3ACL A;  3M8L A;  5FPB A;  5FY0 A;  1ENS A;  5FY7 A;  3UGF A;  4Y4Y A;  4CCK A;  1C1L A;  5ABJ C;  5JXI A;  2P17 A;  3O1R A;  3ZFE C;  2VTX A;  5KXB A;  1W05 A;  4LUK A;  1Z7S 2;  2JKB A;  3FHA A;  2BPA 2;  2O1Q A;  4XBL A;  4UFJ A;  1TZO A;  3ETQ A;  1OI6 A;  5FTT C;  2D97 A;  4AAP A;  2WO1 A;  4DB5 A;  4KH9 A;  4MZU A;  4XQ4 A;  2BZD A;  2ZZQ A;  5K4L A;  1SCS A;  2UWA A;  4JCK A;  4M3C E;  1Y7B A;  3AZV A;  2NM1 A;  4C8D A;  2PYT A;  5FMD A;  1Y4W A;  4IEW A;  4BK5 A;  1UY4 A;  1WW5 A;  3GF6 A;  2X5I A;  1JZ7 A;  1NAE A;  1UZ0 A;  2DVF A;  4AEJ A;  1OD5 A;  4X8N A;  2PHU A;  2XB6 C;  5FKC A;  2C1F A;  2JJ6 A;  3ZSM A;  2HLE A;  2ZJC A;  4XIL A;  2YC4 A;  1HV0 A;  3CJI C;  4BB3 A;  4CDU C;  3RI8 A;  5A6Z A;  2PQS A;  2WZR 1;  2PFW A;  2C26 A;  3V0A A;  5T5O A;  3OBT A;  3TRS B;  5HXM A;  3BU7 A;  1A8M A;  2X10 A;  2CL2 A;  2P3Y A;  3Q8F A;  5EWS A;  3VKF C;  3NVC A;  2XJS A;  5F5A A;  3LCP A;  3AKS A;  3O1U A;  5KC5 A;  1QEX A;  3QAC A;  1O6U A;  4KNC A;  1RHI 2;  4XZU G;  1L7R A;  5G04 L;  2ADD A;  4DO0 A;  1HKD A;  1MS5 A;  1VE0 A;  3KT1 A;  1WWY A;  5FO9 B;  1DQ6 A;  4I30 A;  3LIG A;  2JG9 A;  3ST7 A;  1CJP A;  2HWC 3;  5A33 B;  4LXL A;  4AI3 A;  2JDP A;  4FTB A;  2K9Z A;  3J7L A;  3N36 A;  5ACA 1;  1QQP 2;  3MFA A;  1H6Y A;  2Q1F A;  4DPN A;  3NJZ A;  1GQH A;  1VBB 1;  3ZYG A;  2A6X A;  2CGO A;  2WZE A;  2X53 S;  3OBR A;  3WW1 A;  1DBN A;  1HRI 1;  1FAY A;  1J83 A;  4QKN A;  4AI2 A;  1V6L A;  1CAW A;  3NNJ A;  1W6P B;  2D43 A;  3N9Q A;  2KD7 A;  4AQ2 A;  5E8A A;  5FYC A;  1IS4 A;  2P6C A;  4QXH A;  1RUJ 2;  3WW4 A;  2WBK A;  1PGL 2;  3B9I A;  4N9H A;  1W9F A;  1W2N A;  4ISR A;  2XML A;  4HL0 A;  3ACH A;  5CIR A;  5GLT A;  5LAS A;  3VBF C;  3W21 A;  4AED A;  1XJA A;  4M0H A;  4R4Z A;  1R1A 2;  3OCP A;  1W06 A;  2ORZ A;  1F4A A;  1JZ6 A;  5FPX A;  4XYX A;  1HN1 A;  2ET7 A;  2RS5 3;  4AHX A;  3MFC A;  1DDL A;  4YZ4 A;  1APN A;  1OF4 A;  4W6W A;  4QD2 A;  3T2P A;  5LK5 A;  3N9O A;  2XH6 A;  3PUI A;  2QZ2 A;  1RYY A;  4ASK A;  1POQ A;  2Q4S A;  3M2M A;  2GNM A;  5EIY B;  1K12 A;  3MYX A;  4ORF A;  3PVN A;  5IT6 A;  1J58 A;  1SMV A;  2J1V A;  4I3P A;  3O1T A;  1CZT A;  1IQA A;  1NOV A;  4YVW A;  3K2O A;  1UU5 A;  1XNA A;  1UOB A;  3MUZ 1;  2RV9 A;  4AWD A;  1IGO A;  1X9T A;  1IPK A;  3VD5 A;  1JUI A;  1CAX A;  2HWF 2;  4CP2 A;  5A3N A;  3W59 A;  2OA2 A;  1OF3 A;  3JZV A;  2R04 3;  5JI7 A;  3B00 A;  3S5Q A;  5JVV A;  4LE4 A;  3S0M A;  1CIW A;  3CJX A;  4DEQ A;  1KDM A;  5BPX A;  1D4M 2;  1V6M A;  4CCC A;  1JOP A;  1DCS A;  4JTO A;  4MXV A;  5FP9 A;  4Q4Y 3;  2E53 A;  2R07 1;  3JCI A;  4XJZ A;  2WJS A;  4CDW B;  5HI0 A;  5DG1 A;  1OQ1 A;  3JBG 1;  3KF3 A;  3M4F A;  4N9I A;  4DRR A;  3RGB A;  2QNK A;  2KA3 A;  1MVE A;  1PGL 1;  1KJR A;  4AQ6 A;  2ILM A;  2BGC A;  2RJL A;  2VZR A;  3PVE A;  2YV8 A;  3QCW A;  3TEZ A;  1L7Q A;  2QBX A;  1W90 A;  2XQR A;  2DVG A;  3I3B A;  1SLI A;  4SBV A;  1BVP 1;  2C6S A;  4FPK A;  4D94 A;  4QQ2 A;  3RRD A;  3MDP A;  3OOX A;  4IGP A;  5K7P A;  5C4W A;  2VBD A;  4IND A;  1W8Z A;  1SLB A;  3U10 A;  1AYN 3;  3B3Q E;  4M0N A;  1S2B A;  1DQ0 A;  2HYK A;  2TEP A;  3MV0 1;  4PIZ A;  3TEW A;  1QQP 1;  1S0J A;  1PNF A;  2ERF A;  1IG3 A;  2YG0 A;  4XC9 A;  4LIU A;  1BMV 2;  1EYB A;  3VN4 A;  5APA A;  5FUP A;  1XOY A;  3T2T A;  3VDC A;  4QB6 A;  2E7T A;  3TOJ A;  4N53 C;  4XQW A;  3VL9 A;  2CAV A;  4IEP A;  4PIY A;  3LGR A;  1R64 A;  3HIF A;  1S0E A;  5FZA A;  3VLB B;  2DCY A;  4BDV B;  4MYE A;  1NA1 B;  1TMF 1;  4AFB A;  4GWN A;  4IGO A;  4AFC A;  2P3K A;  2ZKN A;  3V0A B;  3D0S A;  3WP6 A;  4QQH A;  5FO7 B;  2F17 A;  3ZXG A;  4AI8 A;  3WNP A;  2WS9 3;  5L7O C;  2J7M A;  5F3G A;  3HBK A;  4E2Q A;  5BNO A;  1R09 3;  1ZRF A;  3BN6 A;  2A3Y A;  5LAT A;  1KFX L;  2G19 A;  2YPD A;  4XMA A;  2RE9 A;  2B42 B;  5FZK A;  5T3N A;  1YCI A;  1HW5 A;  1LU2 A;  5EJ3 A;  3K51 A;  5FZ8 A;  1SEF A;  4JHT A;  2D6P A;  5FPL A;  3R05 A;  3SEP A;  4E4Z A;  3JBG 2;  2V4A A;  4XUP A;  2HWE 2;  1W2U A;  1OLM E;  1W9Y A;  4G9S B;  4GMP 3;  4RGK A;  2XQX A;  2NN8 A;  3ILN A;  5FPZ A;  4BHP A;  4XIO A;  1CN1 A;  4OMD A;  4NR1 A;  5IWF A;  3THT A;  3VBF A;  2VMG A;  5FXX A;  1WCQ A;  5JI9 A;  1PM4 A;  3UL2 A;  4OHY A;  1RHI 3;  4YFZ A;  2YZ4 A;  2JEM A;  5FZI A;  4LBK A;  1XPW A;  2VZU A;  3J4U H;  3KMH A;  2AAC A;  4XCB A;  1VP6 A;  2W5F A;  3VBS A;  3WF4 A;  3ZN4 A;  4EZH A;  2YBK A;  2W1U A;  1HB4 A;  1NUK A;  3E6B A;  5DG2 A;  1V6O A;  4QB1 A;  1FPN 2;  1GQP A;  1QJU 1;  1FOD 2;  4KWL A;  2WC2 A;  5K8S A;  4E9K A;  4S2H A;  4EN6 B;  4YZ5 A;  4LR4 A;  1VBC 2;  4NHY A;  4MX3 A;  1RUJ 1;  3AK0 A;  3GZA A;  1WLW A;  4DXS A;  1N1Y A;  3O0V A;  1ZBE 2;  4Q1R A;  2RMU 3;  1H2K A;  1W6M A;  1RUE 3;  1QGL A;  2JEN A;  3HAG A;  3JU9 A;  5LBB A;  4QPI A;  1ALY A;  3PVB B;  5JXJ A;  4RGA A;  1OLM A;  4LKS A;  5C9A B;  2P34 A;  2R06 2;  5D2A A;  3WG1 A;  1FAT A;  4E2G A;  4G3Y C;  4YW5 A;  3W9A A;  1JZ2 A;  5FZ4 A;  1C5H A;  3AL5 A;  4N43 B;  5CVR A;  3C7E A;  4NHM A;  3J7M A;  4GAL A;  2MPF A;  2W08 A;  3WOG A;  1ZZ7 A;  2HYX A;  1MEC 2;  3DYP A;  2W39 A;  3RNS A;  2A6Y A;  2C0Z A;  5C9A A;  1D2Q A;  3PTY A;  3POY A;  2WQ4 A;  3AMN A;  3WT3 A;  4CDW C;  3I3Q A;  3R4S A;  2ZGL A;  2ZX2 A;  1BEV 2;  1G86 A;  2BFU L;  4HVR A;  3AZW A;  4XJW A;  5A3U A;  1QHD A;  2GNB A;  3WDT A;  4P9Y A;  4FVV A;  4QPW A;  2QDN A;  3BCW A;  1UKR A;  4HT1 T;  2J1S A;  4Y22 B;  3DV8 A;  2W52 A;  2WN2 A;  1YI9 A;  3EQE A;  1NLR A;  3ECQ A;  2VGD A;  4GXL A;  1ZYB A;  5HCH A;  2HWC 1;  4WM8 A;  1J3P A;  2Z42 A;  4AVC A;  1CAU B;  5BNN C;  1ULE A;  3K46 A;  4HPK A;  3AB0 A;  4MOA A;  5ACA 3;  3E1F 1;  1FMD 3;  1KDK A;  4XMI A;  2ENR A;  3LIH A;  1BCX A;  1VBA 3;  4XJU A;  3I59 A;  4Y1Y A;  4XUO A;  5EFU A;  5GLU A;  4DUW A;  5IVF A;  5JWP A;  1K45 A;  1UY3 A;  2ZGK A;  3AX4 A;  2DU0 A;  1SBE A;  2QQJ A;  3NJX A;  4ES8 A;  4J1W A;  2O0O A;  1MS4 A;  2PAE A;  4HBN A;  4CU6 A;  2PHW A;  1RVF 2;  3DYM A;  4FXG B;  2V4V A;  1IPJ A;  5HV4 A;  3ASI A;  4NPM A;  2ZBJ A;  1NCQ A;  1NCQ C;  4KQ7 A;  1ZA7 A;  3O0X A;  4GD4 A;  2GAL A;  5FZ9 A;  4AI1 A;  3E6C C;  2JB4 A;  5FKB A;  5KBF A;  3POI A;  1VBA 2;  3KV6 A;  2JEC A;  4XFF A;  1NKG A;  1OA2 A;  5DDJ 2;  3J9S A;  5F6L B;  1TNR A;  5CA6 A;  1NLS A;  3ACF A;  1UYP A;  2GN7 A;  2VUC A;  3OY8 B;  3PUH A;  3JQX A;  4JGZ B;  4L97 A;  1UMH A;  4LBJ A;  4AW7 A;  2DUR A;  1HIX A;  1DFQ A;  1E5I A;  1W8F A;  5I93 A;  3Q8E A;  2QCS B;  1FI2 A;  3PJQ A;  5A7O A;  1K42 A;  4XDO A;  1UAI A;  3H3L A;  3DKQ A;  1GWM A;  1Q8P A;  3NAP C;  1OKQ A;  1QNW A;  2BNM A;  2WDB A;  2EF6 A;  4IV3 B;  2HWE 1;  1QJE A;  1RUD 1;  5DAV A;  3M1H A;  3S57 A;  2UWC A;  4RHV 1;  5IFT A;  5IVY A;  3ZXE A;  3MPB A;  3EBR A;  4Q4V 2;  1BZW A;  1F2N A;  2Y64 A;  1RUC 3;  4YG0 A;  1COV 3;  5IAT A;  4A3X A;  1UIJ A;  5I0U A;  2XVL A;  1ND3 A;  3NWK A;  3VZO A;  3CL1 A;  4O7X A;  3VZN A;  4EE2 A;  3E5Q A;  1UYY A;  4W6X A;  4ZKT B;  1LOF C;  2KXL A;  2EXH A;  1ULP A;  1D4V B;  2OXB A;  3B01 A;  3I2J A;  1QMJ A;  3ZN5 A;  1YFY A;  1VIW B;  1QY4 A;  5FXV A;  5J1X A;  1C4R A;  3BTZ A;  4BQW A;  2ZTN A;  5FFO C;  3EYP A;  4LUL A;  3OD4 A;  4FXK B;  5FY5 A;  1ENX A;  2AEY A;  1OMI A;  1GU3 A;  1G6N A;  2WLQ A;  4LK6 A;  4QDR A;  4XPV A;  4GMP 1;  3GBF A;  3ZSK A;  4COU A;  3F2Z A;  4UYB A;  3CU7 A;  5I0S A;  2CWM A;  2WYF A;  4Q4Y 1;  5E16 A;  4BQ5 A;  4FTE A;  1OD3 A;  4TSV A;  4XDP A;  2JX9 A;  3LSE A;  3N7L A;  3B93 A;  5I91 A;  1V0A A;  5A3W A;  1OPM A;  4PQQ A;  4NVP A;  2ZZJ A;  3KGL A;  3QD6 A;  1AL2 1;  1ENR A;  1OBN A;  3NNF A;  4KG0 A;  4X6Q B;  4ARX A;  4UI9 L;  1WLC A;  1ZRR A;  5F39 A;  3U07 A;  5F5Q A;  1D0H A;  4P5H A;  3WHT A;  3WXP A;  1S2K A;  2W91 A;  2D5H A;  1KJL A;  1ZZB A;  2RJ2 A;  2XBO 3;  1D0G A;  3T4V A;  4HET A;  4BOW A;  5J98 B;  4UOJ A;  2V5Y A;  2Z5W A;  2PHD A;  2NMO A;  2WNO A;  3THC A;  1OXC A;  1UX7 A;  3LFI A;  5LA9 A;  3UES A;  3NNM A;  1MS8 A;  4H3W A;  3KWV A;  5FZO B;  1C8M 3;  2UWB A;  3DL3 A;  3AXD A;  2VCM A;  3GZE A;  4IV1 B;  3VD4 A;  3AMH A;  3D6E A;  1WCS A;  2VXR A;  4M3C F;  1AR7 1;  2FCV A;  5FZE A;  2P1B A;  5JSO A;  3RZM A;  1ZZC A;  3LDR A;  1DGR N;  1V9U 2;  4XJ9 A;  2N7G A;  4O9E A;  5BNO B;  3VBO B;  2D3S A;  5BNN B;  1PO1 1;  3A22 A;  1NX9 A;  1MPX A;  1GSL A;  2WN3 A;  2WYS A;  5H9S A;  5I0T A;  1NXD 1;  1L3J A;  4AVB A;  1LHU A;  4HG6 B;  2K2S A;  3U4S A;  3VKO A;  1VRB A;  1GV9 A;  3IKW A;  4LO8 A;  2J22 A;  2R1B A;  3OTF A;  3WV6 A;  2RDR A;  2W1W A;  3AFG A;  3AZX A;  3AKR A;  3VD7 A;  3HBZ A;  4UW3 A;  3WUC A;  1LHN A;  1UNB A;  1S0D A;  4HN0 A;  4KWJ A;  2JDH A;  1HLC A;  5DUU A;  2C4X A;  4XJ8 A;  2JE7 A;  3FLR A;  3WNM A;  2Q1M A;  1HXS 2;  1V6J A;  2W3J A;  2VMF A;  3CMG A;  4AL9 A;  2YGM A;  3EJK A;  1V6K A;  4ISQ A;  4Q2F A;  3MIB A;  1AYM 2;  4HSJ A;  1QU0 A;  2WR9 A;  4Z82 A;  1YFX A;  1ZX5 A;  4Q4V 3;  4ATE A;  3SC7 X;  2C9K A;  1BK0 A;  1VBA 1;  1BLZ A;  4UFH A;  1XC6 A;  2WFF 3;  2VVD A;  1J1L A;  4GB3 3;  1ZBA 2;  2Q8O A;  1HDK A;  4SLI A;  2PHR A;  3NKT A;  1AHS A;  5A7W A;  2CGP A;  2AUY A;  1Q5O A;  2ZKL A;  2IXK A;  3MI8 A;  3J26 N;  4H2A A;  4M01 A;  1W8N A;  4QMA A;  2VQ0 A;  4V2W A;  3VBR B;  4IEX A;  2WNV C;  4L92 A;  1NCQ B;  1XND A;  4LQR A;  1LJ7 A;  4XBN A;  5FZ6 A;  5C71 A;  5FZL A;  5JMC A;  5FZB A;  5L9R A;  4MSV A;  5JXG A;  3OUJ A;  4P08 A;  4AZZ A;  4JDM A;  4Q27 A;  1ZNP A;  3LA2 A;  4CDX C;  1XXN A;  1R09 1;  1DP0 A;  4D7Y A;  5JSP A;  5ABJ A;  2XJQ A;  4PIX A;  3MW2 A;  4H7L A;  4OHV A;  3MLL A;  3WD5 A;  4Q4X 1;  3ZN6 B;  4AYU A;  3FL7 A;  2ZXQ A;  2HKX A;  2IVJ A; 
#chains in the Genus database with same CATH homology
 5CYY A;  3UNP A;  3SKV A;  3LQC A;  4QAW A;  2R7E B;  3NNG A;  2Y6J A;  3NJV A;  2W47 A;  3HOB A;  3U37 A;  3A21 A;  4D8M A;  3VD3 A;  2ID4 A;  5JXI A;  4JKM A;  3FHA A;  5C70 A;  3T0D A;  4MGS A;  2X05 A;  2WO1 A;  1O8S A;  4A42 A;  2BZD A;  2J1E A;  3LPF A;  4BK5 A;  1UY4 A;  4KMQ A;  2E26 A;  4OMC A;  2VJX A;  2WAB A;  3CZU A;  1JZ7 A;  1NAE A;  1UZ0 A;  1W9S A;  2HLE A;  4KWU A;  2VTF A;  2VME A;  2YC4 A;  4W8J A;  1H6X A;  4CU8 A;  4MO3 M;  4JX0 A;  2PQS A;  4A6O A;  1OT5 A;  2C26 A;  4OUE A;  1YQ2 A;  5CZK A;  5HXM A;  2X10 A;  3MBW A;  3HEI A;  2VQU A;  5LA0 A;  2VCB A;  5G04 L;  4XZU G;  1L7R A;  2VCC A;  1JU3 A;  4P5Y A;  5DPN A;  3BGA A;  4RYD A;  1KEX A;  2WAO A;  5B4X A;  4LHS A;  4UAP A;  1H6Y A;  2Y6G A;  5EJZ B;  3C8X A;  3HN3 A;  4JHZ A;  1UYX A;  1CZS A;  1SG3 A;  2VZP A;  3MUY 1;  1UXX X;  3ACG A;  4M4P A;  2WZE A;  2Y6H A;  2QQL A;  3IDA A;  4JKL A;  5LA2 A;  4AAX A;  3LE0 A;  5JUV A;  3C7G A;  3WF2 A;  4QDQ A;  1J83 A;  4E8C A;  3LEI A;  3JXS A;  4CUA A;  5F7U A;  3OG2 A;  2KD7 A;  4CU9 A;  2WBK A;  4CUB A;  3VD9 A;  3ACH A;  1GUI A;  1SHW B;  2VZT A;  2ORZ A;  1F4A A;  1JZ6 A;  2WZ8 A;  3FL7 A;  3C7H A;  1US2 A;  1HN1 A;  2B4K A;  4QX3 A;  3NRU A;  4QX0 A;  2W46 A;  1OF4 A;  3K4Z A;  1UY2 A;  5LA1 A;  3T2P A;  3I97 A;  3PUI A;  1RYY A;  2VZQ A;  2ZEX A;  2V5D A;  3CIH A;  5EIY B;  1K12 A;  1W99 A;  3CQO A;  3IAQ A;  1O8P A;  1JI6 A;  2J1V A;  3WQB A;  1UWW A;  1CZT A;  1XNA A;  2XOM A;  3MUZ 1;  2RV9 A;  3VD5 A;  4A45 A;  2W1S A;  3WNN A;  1OF3 A;  2VZ3 A;  2BGO A;  4YPJ A;  4DUV A;  4DEQ A;  4W50 A;  2VO5 A;  1JZ4 A;  3K77 A;  1GOG A;  4ZZ8 A;  4CU7 A;  3CKH A;  4ARY A;  1F4H A;  1US3 A;  2YFZ A;  3T0B A;  4FI9 A;  2VZR A;  1L7Q A;  2QBX A;  5DMY A;  3I3B A;  2VL4 A;  1GOF A;  2V72 A;  3P6B A;  3FHQ A;  1GMM A;  2VZV A;  1UMI A;  1UY0 A;  4E8D A;  1EUU A;  4DEV A;  1JYW A;  2VQT A;  3T09 A;  4ZY9 A;  2WO2 A;  2XHN A;  3MV0 1;  2JE8 A;  2YG0 A;  2QQM A;  4BJ0 A;  3I2G A;  2JDA A;  3III A;  3UET A;  3VDC A;  4BXS V;  2Y6K A;  4QB6 A;  1D7P M;  2J1T A;  3MO4 A;  1R64 A;  2E32 A;  4BDV B;  5JMO A;  4QX1 A;  3SKJ E;  1UY1 A;  1UYZ A;  3WNP A;  2WAA A;  2J7M A;  3OGS A;  4CVU A;  3OEB A;  2QQI A;  3BN6 A;  4GWI A;  2ORX A;  5IYY A;  1DLC A;  3MV1 1;  1KGY A;  2Y6L A;  2YB7 A;  3K75 B;  3SEP A;  1WKY A;  2BGP A;  2EIB A;  3HNY M;  4XUP A;  1CZV A;  3GM8 A;  4LPL A;  2XQX A;  4XUT A;  4OMD A;  3LPG A;  1WCQ A;  3I2H A;  3CDZ B;  4A41 A;  2QQN A;  2LS6 A;  4BK4 A;  3CZJ A;  4XVH A;  1XPW A;  2VZU A;  5JXH A;  2W5F A;  3WF4 A;  2ZEW A;  3EB7 A;  2W1U A;  2VCA A;  1NUK A;  4QB1 A;  4XUR A;  1GQP A;  3I2I A;  5IFP A;  1I5P A;  2J1U A;  2ZEY A;  5HPO A;  2LW8 A;  4DXS A;  5B4N A;  3WF3 A;  4M4R A;  3GGL A;  3J7H A;  3D3A A;  1JYN A;  2BBA A;  5G05 L;  5JXJ A;  4L0P A;  2W94 A;  4LKS A;  3DYO A;  3T08 A;  3OB8 A;  1JZ2 A;  3GXU A;  3C7E A;  1O59 A;  2VOT A;  2HYX A;  1PX3 A;  3DYP A;  1GOH A;  1JHJ A;  3GDB A;  1LNS A;  3WNO A;  5DN2 A;  5IJR A;  4RN5 A;  4ZXE A;  3W5N A;  4QPW A;  1PMJ X;  3T0A A;  2J1S A;  5C7G A;  2WN2 A;  3ECQ A;  1JU4 A;  4A4A A;  3C7F A;  4TXW A;  3K4A A;  3K46 A;  4MOA A;  4DXR A;  3E1F 1;  3WEZ A;  4ET7 A;  3A7Q A;  4XUO A;  4DUW A;  2W1Q A;  3WSO A;  1K45 A;  1UY3 A;  3ABZ A;  2QQJ A;  3NJX A;  2DCK A;  4A44 A;  2VM9 A;  1JZ3 A;  4CU6 A;  4XUQ A;  3DYM A;  2V4V A;  5DQ0 A;  3IAP A;  1W9W A;  1TVG A;  4DXT A;  3I3E A;  4MAD A;  2VZ1 A;  1NKG A;  4GZ9 A;  2WUH A;  4MGQ A;  3ACF A;  3PUH A;  1EUT A;  1XNT A;  1UMH A;  2Y8K A;  5EJ1 B;  3I3D A;  1OH4 A;  1K42 A;  4A3Z A;  1W8O A;  3C7O A;  4P00 B;  2W92 A;  1SDD B;  2W95 A;  2WDB A;  2J1R A;  2QQO A;  4GWJ A;  3LEG A;  5IFT A;  2W9X A;  3OEA A;  4OYU A;  2Y64 A;  2B9V A;  4KI5 M;  2EIC A;  1GNY A;  2E33 A;  2VMC A;  4AG4 A;  2Z4F A;  3VDB A;  4D0Q A;  3VDA A;  2W87 A;  1JYX A;  1UYY A;  3WF1 A;  1ULP A;  3HJR A;  3I2J A;  2QQK A;  3I2K A;  5J1X A;  4DUX A;  2CDO A;  2XON A;  3OGR A;  3EYP A;  1GU3 A;  4QDR A;  2WO3 A;  3F2Z A;  3OGV A;  4OZO A;  1J84 A;  2E31 A;  2X09 A;  5LCW L;  2JKX A;  1OD3 A;  2VR4 A;  5IHR A;  4PQQ A;  3AC0 A;  4ARX A;  1ULO A;  4UI9 L;  3WF0 A;  3SEE A;  4PT6 A;  1CX1 A;  2W91 A;  1UXZ A;  2RJ2 A;  3FN9 A;  3T2O A;  4JKK A;  5I0D A;  2CDP A;  4UOJ A;  3LEK A;  3UES A;  3THC A;  1UX7 A;  4IUG A;  1CIY A;  3WNK A;  3VD4 A;  2ZEZ A;  3NQH A;  3K4D A;  2OKX A;  2JD9 A;  5A1A A;  2WQ8 A;  4CUC A;  4Z2A A;  1IQD C;  2VZS A;  4PF1 A;  4QX2 A;  1DYO A;  3A22 A;  2L9L A;  1NX9 A;  1MPX A;  1TG7 A;  2WN3 A;  2WYS A;  5JR2 A;  2DDU A;  3IB3 A;  4XUN A;  3DEC A;  1T2X A;  4HG6 B;  3P1I A;  5FUI A;  2J22 A;  2VC9 A;  1JYV A;  1JZ5 A;  2W1W A;  3VD7 A;  4QDS A;  3OBA A;  4W4Z A;  2YFU A;  1W9T A;  2C4X A;  3WNM A;  2RVA A;  2W3J A;  2VMF A;  4ZZ5 A;  3CMG A;  4P02 B;  1W0N A;  1BHG A;  2VZO A;  4TTG A;  3A23 A;  3I2F A;  3WNL A;  1P8J A;  1K3I A;  2C9K A;  3ACI A;  3HPN A;  1XC6 A;  3ZM8 A;  3ETP A;  2BER A;  3HNM A;  1W8N A;  2DCJ A;  2J1A A;  4LQR A;  1PX4 A;  5C71 A;  1JZ8 A;  1PMH X;  2EID A;  4QB2 A;  2YC2 A;  5JXG A;  3THD A;  4P08 A;  2EIE A;  2VMD A;  3W5M A;  1DP0 A;  3HNB M;  2ZXQ A;  3T2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...