2J1VA

Structure of a streptococcus pneumoniae fucose binding module in complex with the blood group h-trisaccharide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate-binding protein
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 39
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1vA00
2WAOA 2WDBA 4W4ZA 2QQIA 4A45A 1NKGA 1K3IA 4QX3A 4LKSA 4MGQA 5DMYA 4W8JA 3AC0A 4ET7A 1W0NA 2VZSA 5IJRA 4E8DA 1UY3A 4KMQA 2QQOA 2V5DA 2J1TA 2ZEYA 3K4ZA 3UNPA 3HNBM 4M4PA 2E33A 4W50A 5EIYB 2PQSA 1OH4A 2VZRA 2CDPA 2WZ8A 5C71A 5LA1A 4DXSA 2VCCA 2LW8A 3WSOA 3THDA 1JZ6A 4BDVB 2W3JA 4RN5A 3DYMA 5C70A 2J1AA 4MOAA 3K4DA 2ZXQA 3I2GA 5JXIA 2VZUA 4OMDA 3EYPA 5J1XA 4ZY9A 1O8SA 3W5MA 4QX1A 1P8JA 3UETA 1GU3A 3P1IA 1W8NA 2VZOA 2QQMA 1K12A 3GDBA 2VM9A 3I2KA 1UY2A 1D7PM 2QQLA 4XUTA 4LPLA 5IHRA 4IUGA 3I2JA 4MGSA 4QDRA 2VC9A 2B9VA 1UY1A 2VOTA 5DN2A 3WF4A 2BBAA 3HJRA 2KD7A 4A4AA 4QB2A 2VZ3A 2V4VA 3C7EA 1TG7A 4MADA 4JHZA 2C26A 2EIBA 4ZXEA 4D8MA 3THCA 3VD7A 3IAQA 2J1SA 3BGAA 4ZZ5A 1JU4A 4M4RA 4XURA 3DECA 2JD9A 3T0BA 3PUIA 1OF3A 3VDBA 4KWUA 2W1SA 2QQKA 3HNMA 1CZSA 3T0AA 4DUWA 3IIIA 3T2OA 3LE0A 5JMOA 2J1UA 1YQ2A 2WABA 2VCAA 2DCJA 3CZUA 3JXSA 2JDAA 3PUHA 5B4NA 2W92A 2RV9A 3OG2A 1GOGA 3HNYM 2EIDA 3IDAA 3HOBA 2W5FA 4OMCA 3T08A 4DXTA 3OEAA 5HXMA 1T2XA 4QB1A 1R64A 4UOJA 3WEZA 3HEIA 3GM8A 1JI6A 2RVAA 1UXZA 4CUAA 3K75B 4QB6A 3SKJE 5JXJA 4CU7A 2W95A 2WO2A 1PX4A 5G05L 3LEGA 3HPNA 1NX9A 2WO1A 2ZEZA 4XUOA 4BXSV 3ACHA 3IB3A 5IFTA 5IYYA 5EJZB 2L9LA 3OB8A 2C4XA 3DYOA 4AAXA 1J83A 2XQXA 3ETPA 2V72A 3WNLA 2E32A 4HG6B 2ZEXA 1W99A 3A21A 1CZTA 2E31A 4XUPA 4P00B 1NUKA 4BJ0A 3T0DA 3C8XA 3SKVA 4TXWA 4ARXA 3ACIA 1ULPA 4JKMA 2BGPA 4MO3M 5JUVA 4Z2AA 1EUUA 4OUEA 4CVUA 1W9SA 4P5YA 1TVGA 1HN1A 2WO3A 4OZOA 1I5PA 2VQTA 3ACGA 2W47A 3VD9A 2JE8A 5F7UA 3A7QA 1US2A 1UZ0A 4ARYA 4RYDA 2QQJA 1O59A 2DCKA 3I3BA 2J22A 4PF1A 2WAAA 2VZVA 1W9WA 3T09A 3WNMA 2X10A 3LPGA 4JX0A 3CIHA 3SEPA 4A42A 1UWWA 4DEQA 5CZKA 4FI9A 2YFZA 4E8CA 1XC6A 2JKXA 2YG0A 1JHJA 3BN6A 3K46A 5JR2A 3CQOA 1GOHA 3NJVA 1UYZA 5CYYA 1XNTA 2YC2A 2XHNA 1JYWA 3WNOA 1PX3A 4DEVA 2VCBA 4CU6A 1GOFA 3EB7A 1W9TA 3T2QA 2VZ1A 3VDAA 3C7FA 5JXGA 3U37A 1GMMA 2W94A 3WNNA 3VD4A 5LCWL 2XOMA 1UXXX 4TTGA 2WN2A 1XNAA 3FL7A 4PQQA 1XPWA 1L7QA 3FN9A 5LA2A 3K77A 3A23A 3I3DA 4QDSA 4A6OA 1RYYA 2ID4A 2YFUA 3DYPA 5FUIA 5IFPA 2VO5A 5EJ1B 3CDZB 3SEEA 4P08A 3WNPA 2VZTA 2VQUA 1J84A 1K45A 1PMJX 2W9XA 3GGLA 4OYUA 2QBXA 2WN3A 4ZZ8A 4UAPA 1OT5A 3C7GA 4GWIA 1UYYA 2Y8KA 2Y6JA 2Y64A 3I3EA 3MUY1 3MV11 2W46A 1JZ4A 1JZ8A 1DLCA 3HN3A 1JZ5A 1W8OA 4GWJA 3I97A 1GUIA 2EICA 2VMCA 3ECQA 2XONA 5A1AA 1KEXA 1UY0A 4A3ZA 3A22A 5LA0A 4A41A 2ZEWA 3P6BA 3CZJA 3CKHA 1UYXA 2WQ8A 2CDOA 4QX2A 2WUHA 4QX0A 1JYVA 2VTFA 2X09A 2VMDA 1JZ2A 3NNGA 4DXRA 2QQNA 1SDDB 1OF4A 2RJ2A 2EIEA 3WF1A 3MO4A 3ABZA 4CUCA 4PT6A 3LPFA 1LNSA 3OGSA 3LEIA 5B4XA 1L7RA 2BGOA 3T2PA 1JZ7A 1GNYA 3FHAA 2W91A 2B4KA 3WF0A 3IAPA 1WCQA 1EUTA 2WYSA 4JKKA 3VDCA 3VD3A 4XUNA 1BHGA 5G04L 4L0PA 3F2ZA 5DQ0A 1F4AA 2HYXA 1F4HA 3ACFA 3LQCA 3NRUA 3OEBA 2Y6LA 1ULOA 1DP0A 1CIYA 4CUBA 2Y6GA 3ZM8A 3I2IA 1WKYA 2C9KA 2LS6A 3OGRA 3NQHA 1O8PA 5DPNA 1US3A 2VMFA 4XVHA 2Y6KA 3D3AA 3I2HA 1JYNA 3MBWA 3C7HA 3NJXA 3J7HA 3W5NA 4P02B 3WF2A 3WQBA 2J1VA 1MPXA 4QDQA 2YC4A 2W1UA 1K42A 1DYOA 3C7OA 2J7MA 1JU3A 1UY4A 4LQRA 2HLEA 1OD3A 3I2FA 1UMHA 4AG4A 2W87A 2J1RA 2W1QA 2WBKA 1H6XA 1PMHX 1SHWB 5HPOA 4BK4A 4CU9A 4D0QA 1IQDC 2BZDA 2WZEA 3WF3A 2ORZA 4UI9L 3LEKA 4A44A 3WNKA 2VL4A 4LHSA 1H6YA 4QAWA 1CZVA 2VJXA 4KI5M 2W1WA 2ORXA 4XZUG 2BERA 1JZ3A 3GXUA 2DDUA 4XUQA 1UX7A 2Z4FA 1GQPA 3FHQA 4GZ9A 4QPWA 5JXHA 5I0DA 1SG3A 4CU8A 2OKXA 2Y6HA 4YPJA 3MUZ1 5C7GA 1JYXA 4DUXA 3CMGA 1KGYA 2E26A 2VZQA 2X05A 1UMIA 2VMEA 4BK5A 1NAEA 4JKLA 3E1F1 3VD5A 2YB7A 3OGVA 3UESA 2R7EB 2VZPA 1CX1A 2J1EA 3K4AA 3OBAA 4DUVA 3MV01 2VR4A
chains in the Genus database with same CATH superfamily
1DBNA 4W4ZA 2VXRA 1GANA 2QQIA 5JSRA 3ILFA 4Q4Y3 1OA3A 2OUJA 3KV9A 2A6VA 5HV0A 5FPZA 5JSPA 3EJKA 4LKSA 3TRSB 5C5UA 5DMYA 4LIVA 5SV5A 1CAUA 4YVSA 3U78A 3FUQA 1N1TA 1FV2A 4E8DA 5IJRA 1QQP2 1UY3A 2B7YA 2J42A 3NKGA 5CFCC 2W52A 2J1TA 4HBNA 5FK8A 3QBQA 1JOJA 1W0PA 2K46A 1QXJA 2JDZA 5FYSA 1ONAA 2H6BA 2WT1A 3THPA 5EIYB 1BYHA 2D6LX 3UJOA 4HETA 4BLJA 3M70A 2R073 1S0BA 1SCRA 2RR13 5AC93 2O8OA 1GNHA 3ZYPA 3T1MA 1YIPA 1XSQA 2WNUA 4HMZA 1HX6A 3DYMA 3RI8A 4NE9A 5A3TA 4URAA 4EQVA 3WDVA 2XG3A 2XVLA 3I2GA 3OF1A 4D94A 2F4LA 2W39A 1YFUA 2FCTA 4XJZA 4Z82A 4PIZA 2DYCA 2GNMA 4CP9B 1OUXA 3M3OA 1O8SA 2YROA 2SBAA 4LBQB 3LA3A 2VQAA 4QX1A 5J37A 1ALYA 4MX3A 3UETA 3AP6A 2BVVA 1W8NA 1XSRA 4IETA 1HJGA 4XJAA 5I0SA 2TEPA 3PNAA 1K12A 2EALA 1RHI2 2VM9A 5IK4A 4I3PA 4RFRB 1UY2A 2IUWA 1D7PM 3N7MA 4LPLA 4Y3OA 2PHDA 4IUGA 2YBKA 3I2JA 4I0AA 3ZFGC 2XHKA 2P5BA 4M3CF 4KBZA 5JWPA 2GALA 1U5ZA 1SPPA 3LIHA 2BBAA 3HJRA 4JZRA 4S2FA 2PFWA 3FC0A 1DGLA 5C4WB 1AJOA 1J1LA 4P14A 3MIEA 1TG7A 2D43A 4MADA 3NAPB 2HWC2 2EIBA 3IMNA 4KH9A 1LHOA 1RB8G 4RHV2 3IAQA 4FFFA 5FYMA 1ND3B 2VNOA 2WZR1 1HIXA 4EROA 5FMCA 3S7IA 4AYUA 4ZKTB 3PVEA 2RHPA 1QY4A 1SBFA 1B35C 2OA2A 3DECA 5GZGA 5JZGC 2XJPA 2ZX4A 1G9BA 2Z42A 4AVCA 2HEVF 4KWUA 3GCXA 2W1SA 3FJSA 4A3XA 3RYKA 4RQPC 4YZ2A 4PF5A 4OUMA 5F2SA 4D7YA 4DUWA 2CSGA 3MICA 1S0FA 1YI9A 2OPWA 5FYBA 1KQRA 3T2OA 2EXJA 1OQDA 3B00A 3BTAA 3KF3A 2CGNA 3KMHA 1T6BX 1RUD3 5LY1A 3JD73 2DCJA 3CZUA 1S0DA 3PUHA 4XFFA 4OHZA 1JUIA 5DUUA 4FXGB 2UU8A 1C8M1 3ITQA 2W5FA 1PIV2 1TE1B 4CDQC 4KGQA 1EYBA 3PVOA 4KQ7A 3WEZA 5K7PA 3SITA 4AK3A 1BMV1 1NYWA 1DGRN 1Z7S2 2PAEA 4Y1VA 3ZFFA 2CL2A 3OD4A 3GM8A 2XJQA 1MEC3 4X8NA 4CCJA 3KF5A 4BQ2A 2VTXA 3RZMA 1PO13 1SDWA 1Q8PA 1R1A1 3AFKA 3CJIC 4L11A 1UF2C 4QB6A 1AR72 2VBDA 4M3CA 4CU7A 3B5LB 5CEHA 2WO2A 4XFCA 4IV3B 4QHOA 4WM8C 3DGTA 1WLCA 2HWE1 3AYCA 5G05L 3D5OA 1NXMA 4GJZA 4IEQA 2RDNA 3EO6A 5FZ9A 3SHRA 2UURA 4TLFA 4D7SA 2WC2A 3S5QA 3AZYA 1MQTC 2RMU3 5D8AB 2WS93 4PLNA 3WG2A 2L9LA 1ENXA 5GLZA 4FTBA 3AKRA 3FFZA 1A6CA 3O0WA 4LTAA 5IK8A 4AAXA 4Y1UA 3CU7A 5FPAA 3IDBB 5F32A 4YM3A 3ZSMA 1YQ5A 3AP9A 2VECA 2WNVA 5IT6A 4HK8A 3WNLA 1VAVA 2JEMA 5IVCA 5LRSA 4BOWA 2XJUA 1W2OA 2ZEXA 4FQ4A 5F37A 4NWVA 5KC6A 2A3YA 3W9AA 4MXWB 1W6QB 3DXUA 4B7EA 3C8XA 4GH4C 3TN92 2JIGA 4EN0A 5AC92 1W2UA 2D6OX 5EQUA 1W9FA 4OQ9A 3NWKA 1F15A 5LEKA 1EUUA 2R1BA 3N36A 5J48A 4CEYC 1W9SA 3FHIB 2WO3A 1HN1A 2UWBA 3N9MA 1SLAA 3TEXA 1UZYA 1YI7A 5CKMA 3WQ7A 1BK1A 4FPHA 3ACGA 3RMXA 1N1VA 3C3VA 4CDXA 2W47A 1RUE3 1VBB1 1US2A 2LUWA 4LBNA 1M4WA 2GMEA 1O91A 2E7QA 3MIBA 4RYDA 4JQRA 4XETA 5H9SA 3V64A 5FV3A 3NNLA 3DKWA 3WUCA 1H0BA 4GB33 2O14A 2AACA 2H6CA 5I93A 2YXSA 3LPGA 5A7PA 3BIWE 3QH6A 4JX0A 1CAUB 2V73A 3CIHA 4YVSB 3SEPA 3VBOA 2Y0IA 1RIRA 5LRRA 4A42A 1GZWA 1UWWA 3VBRA 3H9AA 4CEWA 2PELA 2BVBA 4W6YA 4DEQA 2B8MA 4AHZA 2AYHA 1MS5A 1ZBA2 2YFZA 2GC0A 4E8CA 4XE9A 4XQWA 2JDYA 2PQQA 2VNVA 2JKXA 4LLOA 1Q56A 1ZRIA 4INDA 1W28A 4JGZA 4XFHA 2LRPA 2OT7A 4FFIA 1UOGA 1GOHA 5HV4A 2RS11 2XPJA 4MUVA 4META 1UYZA 2WNUB 3FE5A 2XHNA 4WVVA 3JCIA 2JE9A 4BZ4A 4JRLA 4P9XA 2BP6A 4BLIA 3T30A 4L92A 5A3MA 2RDSA 5BXXA 1UNBA 4SBVA 4Q4V2 5KR7A 2OIIA 4C8DA 3M3CA 2VZ1A 3HIFA 2AREA 1K5JA 3POIA 4LK7A 4OHXA 3WG1A 1RMU3 4AW7A 2W94A 1IKQA 3H3LA 4QKBA 3WNNA 2C24A 4I02A 4YW5A 1W2TA 3WX5A 3B94A 4K1YA 1LOBA 4TTGA 5FYYA 5ACA1 3ZXEA 2I74A 1QJU2 2WN2A 4PQQA 5ANQA 5DZGA 1D0HA 2WINB 5LA2A 3RZLA 1FMD1 1VBC1 4P9IA 1S4CA 4PLMA 2Y0OA 2KR2A 2YFUA 5JMCA 1F9KA 1GWLA 3GCWA 5FUIA 3OJBA 2VO5A 4OCTA 3PL0A 4FPCA 1SFYA 4OFGA 1ASJ3 2CNAA 3IPVA 3PTYA 4LKEA 3HQRA 3D4KA 4LOTA 1J3PA 5FPXA 2ZX1A 4P08A 1I1EA 3E5UA 4FAHA 3I8TA 1SPPB 4L97A 4YARA 1XE0A 3TYJA 1W8HA 5TSWA 1AUYA 2IXLA 3ZKUA 5JAXA 1V6IA 2JB4A 1LODA 2YU2A 4AI1A 5BUVA 3GGLA 2QBXA 1QJZA 2JENA 2WN3A 4GKXA 5FYVA 1M06G 1FPN3 3GJAA 3T1LA 4XXAA 3DPRC 2V09A 5FPVA 5FMDA 1VBE2 3D82A 1QJY3 4UW6A 4E2SA 1GP4A 1QNYA 2Y64A 2Y6JA 1TME1 2B5HA 1ZM1A 3OTFA 5FXZA 2EVXA 3HAGA 1D4M2 2AH2A 1CPMA 3LIGA 2YHJA 4LOSA 5CKQA 1DCSA 1JZ8A 2JX9A 1GQGA 3AKSA 4UW3A 4XHBA 1RINA 1W3VA 4O61A 1O5UA 1PVC3 1DZTA 1QJFA 3I97A 3UGGA 2IXKA 1MS3A 5AFEA 1POV1 1YLLA 4XAEA 2K0GA 2VMCA 5K4LA 1UOBA 1LU2A 3R05A 1QXRA 4UFLA 1ST8A 2ZEWA 4GIQA 3P6BA 1H8TC 2JDNA 3CKHA 1RUF1 2FCUA 4G9SB 3R4SA 2WQ8A 1TNFA 4O7XA 4QX2A 2GSYA 3EHKA 1ZA4A 3NNMA 3OY8A 2VD7A 2RG4A 3ZFFB 3ROUA 4FTEA 3J8F2 3ETQA 3VBUA 3H3ZA 4DZGA 5CFCA 1Q8SA 3KHBA 4Q1RA 3QD6A 2QCSB 3NNGA 1AR83 5IWFA 4NIIA 2LM3A 1SDDB 1V6OA 4OLLA 5HBAA 3O1PA 2A70A 3BPSA 4H55A 4ONUA 5CADA 1OMIA 4JCKA 1GLHA 2HEWF 4M3CB 3LPFA 4JDNA 4XQ4A 3KB5A 3WV6A 4A7ZA 3PVBB 3O7OA 1R083 2WIIB 2D5HA 1FOD1 2F17A 2HKXA 2BGOA 5JDBA 4RGAA 3T2PA 1WCKA 3ELNA 1JZ7A 1W8ZA 3AYDA 3AMQA 4BMEA 1K5MC 1W8UA 3DF0A 5JOYA 1DIWA 3E6BA 5T5JA 4NAMA 1LECA 3LF7A 2WLQA 2WYSA 1RUH1 2SLIA 5CU1A 1OFSA 1YNAA 4K20A 4A7YA 1BHGA 3AVSA 5G04L 4AVTA 1WCUA 4EJRA 2WNVB 2VMIA 3ALQA 1FATA 1F4HA 4QKNA 3B9IA 1WA6X 4NMIA 4EN9B 4PBPA 5H9QA 1W90A 2CGPA 5FJHA 1DQ2A 4D3WA 1HQLA 1DP0A 4CUBA 5D2AA 2WFF3 5JXGA 1OPMA 4FPFA 2CHHA 3ZM8A 3NL1A 3CBNA 2A3XA 1NLRA 3AZVA 2ES3A 1PGL1 1UKGA 1HN0A 1AYN2 3A0NA 3WG3A 4E2GA 3OGRA 1X82A 1HRI3 4UBHA 4Y5TA 5FY9A 4LITA 4CDUA 5DPNA 1IS4A 3U0ZA 4I0BA 3PLQA 5FTTC 2X53S 3WT3A 5F5AA 2GN7A 1O3QA 2W68A 4CDXB 1AX2A 4LBOA 3N9QA 2QDNA 5FZ3A 3C7HA 2MPFA 1Q43A 3EBRA 1H4HA 4QQ2A 3J7HA 3AMMA 1RXGA 4AI3A 1OLRA 1ND2A 1RUG3 1CGPA 4XAAA 1BJQA 4QDQA 3BU0A 5JZGA 5AVPA 3ZXDA 1ZBE2 2F6BA 3VBOB 3N35A 4CXXA 1WD3A 4L99A 2R042 2XL7A 1K42A 1DYOA 1GZWB 1NCRA 5HCFA 3VBRB 1ODNA 4CEWB 2R49A 3PIJA 4MHUA 4D69A 5BNQA 1NE6A 3I2FA 1ZRFA 1R092 1N3OA 2VNGA 4XFAA 1XNDA 4Q4Y1 2WR9A 4URTA 5FXXA 1G7YA 2W1QA 2WBKA 2YBPA 1H6XA 5FY7A 4CPBD 1ACCA 4H7MA 4CP1A 4JGZB 4QHZA 2HEYF 5E16A 4BK4A 4QM9A 3H1MA 3KLSA 3DV8A 1IQDC 1L7LA 1YRZA 4CDQA 4UI9L 1IPSA 1NG0A 4AI9A 1DZQA 4C0HA 1A34A 5CB7A 5DDJ2 1IQAA 4YW2A 4NRMA 3FLTA 4WZCA 4BQWA 1RITA 2EAKA 4KWJA 2BFUS 1CZVA 1C1FA 2MEV3 1VR3A 1H30A 2BOJA 2R071 2V5YA 4QXKA 2RR11 2FDJA 3CJIA 1LENA 3GYDA 3A0KA 5F39A 3UKVA 1V70A 2YDEA 2OZJA 4M00A 4QQOA 4EZ4A 3GALA 2YZ4A 4AEDA 3D6EA 3IM0A 3LD8A 1DQ6A 3O0VA 4WM8A 4GZ9A 1X7NA 1VRH2 3QOPA 2NP0A 3VHOA 2K2SA 3NSTA 3KCCA 5I0DA 3OD0A 4NO4A 3B9CA 3POBA 3Q8EA 3QLQA 4OI1A 1MQTA 4D6SA 3MPBA 2WSVA 1YXWA 3OBRA 5F6LB 2PHRA 2QNKA 3IPVB 3JB4C 4HK9A 3K51A 5FZGA 4COZA 1RUJ2 1LKNA 1TEIA 2Y33A 1W2NA 4BK5A 2IVIB 3E1F1 1FNZA 2FCVA 2YPJA 1WLDA 3I2DA 1S0CA 5FAXA 2ZOEB 1XQNA 2E7AA 1KFUL 3J7LA 3OGVA 1B09A 4J1XA 3ZSEA 3ZYBA 3M4FA 1DGWA 3TEWA 3IKWA 4DO0A 4DB5A 3K4AA 3C2UA 5FMOL 3PJYA 1UZVA 2WDBA 4E4DX 3DKQA 3VBHC 1K3IA 2O1QA 4YSFA 4QX3A 1RUC3 2D7FA 2JECA 3WP3A 4CEYA 3WHTA 4AHXA 1BBT2 1S0IA 5A33A 2R32A 2ZCWA 4Q1PA 4IGOA 1DHKB 1YC61 2XBO3 4C1XA 2QQOA 2V5DA 1XE7A 3POWA 4NHYA 3TAYA 4S2GA 5F3GA 4Z8BA 4LEJA 1DYPA 2QQVA 2R30A 5JOXA 2RS33 3KQRA 4YVWC 5FWEA 4LBMA 3HQUA 2IXHA 4M4PA 1N1YA 2E33A 2ZJCA 2QQWA 2HWB3 3FUOA 4FP3A 4XJ9A 2Q8EA 3VDDC 2BPA2 2VVFA 1QJX3 1EAH2 4B8EA 1W6NA 1PVXA 2VCCA 1JW6A 4DXSA 5LA1A 3BIEA 3BOWA 2EXKA 1O5LA 3UKNA 3WSOA 3AMPA 2ZMLA 1LR5A 3OY8B 4RN5A 1RUD1 4AXOA 3JD71 4BQYA 1CWPA 3VBUB 1CESA 2OYZA 2PLV2 1QGLA 2XQRA 1BVP1 4QPIC 3RRDA 3WLUA 4DMIA 5CFCB 4TZDA 4FPGA 1LAJA 2WL1A 2JD4A 4ORFA 5CVRA 1UPIA 4AWDA 3MF9A 5T3NA 5JXIA 3PVNA 1WW5A 5KXEA 4RA0A 2P1BA 4JDOA 3RWKX 4ZY9A 5LASA 1DQ4A 3W5MA 1J3RA 1AF9A 2PTMA 2GNTA 4HKWA 2XR4A 1MEC1 1STMA 3P1IA 2NQYA 4QHBA 1OVSA 1PO11 2DCZA 2JXAA 3DUIA 2IXJA 4XABA 4AI2A 1H4GA 5AFBA 2GC3A 4WM7C 5DZEA 2QQLA 4XUTA 2Z69A 5IHRA 4LT5A 1QH7A 5LBFA 3HBZA 5A6XA 1YJLA 3D8CA 4YGDA 2B9VA 4Q4W2 3DN7A 4ZS2A 1ULCA 2VOTA 4LIUA 4HPKA 5H9PA 4RS5C 5FY8A 1RUI2 4XF3A 1OURA 1PO22 2BU9A 2DU1A 4JQTA 5DN2A 2P2KA 2KD7A 2RMU1 4CE8A 2JDHA 5FP7A 2WS91 4QB2A 4AQSA 4E4HA 3DXTA 4JHZA 4RSUA 3RYRA 4AVSA 4K21A 3HVDA 2R063 2Z2SB 2RM23 5LWBA 1OA4A 2HWF3 1O6UA 1XU2A 5AVAA 2NLRA 1BEV3 5SV8A 4ZZ5A 1V9U3 4CDUB 1GNZA 5KHHA 1QEXA 1UU6A 5JIUA 2CWMA 4YM1A 3CF6E 4FQZA 5FZMA 3VBFA 4AAPA 3VB9A 3TEYA 1CAXA 1S2KA 3WXPA 4NIDA 1OC1A 3HNMA 3MI8A 4XFGA 1CZSA 3BODA 1NCQC 1ZZCA 4O65A 1MZFA 4LXLA 4WVZA 4MGZE 1O4YA 3IDCB 5B4NA 1ND2B 1MS4A 3V0AA 3OOXA 2VMGA 3OG2A 4GAZA 3H8OA 4K40A 4NHMA 3ZMNA 1GOGA 4FPJA 5JZGB 1W03A 2WQ4A 2XJSA 3WCRA 2ZX3A 4YG6A 4FAGA 5HXMA 3SISA 1NCRB 1RUE1 1BQPA 3NV2A 3PUQA 1HV0A 5LY2A 3ENRA 4CYDA 2VVDA 2D3SA 2GNBA 5FREA 1O3TA 1REEA 2CU5A 3H50A 2Y60A 4AR2A 2ZGNA 4UFHA 3B7MA 2RVAA 4IV1A 1YEWA 4LHKA 4GB31 1J58A 3BTYA 5CG9A 1ZRCA 1UPSA 3JQWA 3VZJA 1LU1A 3OYWA 1AX0A 4MXVA 3NV1A 3ZN4A 1ULDA 1IGOA 4R9DA 4CDQB 4CCMA 3PURA 3LEGA 1H8TA 3NJYA 5IK5A 5A32A 2ZEZA 3O12A 3VHRA 3UYJA 3ACHA 1RVF3 1DYKA 1E5IA 3IB3A 3VZOA 4CXYA 1NOVA 1AXZA 3L9JT 1UZZA 5BY5A 3LSDA 3OB8A 3CJIB 4XACA 4XTMA 1OUSA 4N53A 4Z1VA 1D0GA 2PHUA 3IIAA 3PDQA 2XUMA 2XQXA 2ZACA 4S2HA 1HRV3 3ETPA 4RR3C 4AEDB 4P9GA 2VULA 1GZTA 1ENQA 2E32A 2OQ6A 4HG6B 4K7JA 4WM8B 3T4VA 1CZTA 2WZR2 4XUPA 3CHXA 1NUKA 3PU3A 5IVYA 4BJ0A 5C33A 1HJFA 1RMU1 1K5MA 1I9RA 4IW3A 1MQTB 3ZFEC 1LCLA 4IEPA 3ACIA 4ZONA 1O3SA 2VOKA 1TQ5A 4OUEA 5KHJA 4HZFA 2VGDA 4P5YA 5JOZA 5LZ6A 5F9TA 4BHPA 3Q8BA 5FRAA 3BYWA 2JDKA 1MZ6A 3AYAA 1VBA3 1GYKA 3U1XA 1U5YA 3NKTA 2VQTA 2ET1A 3VHPA 1V6LA 1BCXA 4X6RB 2YGMA 3BKZA 4AFAA 1ASJ1 1C8M2 1OPOA 3LZZA 3UV9A 3B3QE 4OI4A 2JIJA 2ZGRA 2DCKA 4BMBA 1BMV2 2J22A 1U12A 4DINB 4NAOA 1W9WA 4K1ZA 3WNMA 1J1TA 4CEYB 2A1XA 4LHLA 3WDWA 4B1MA 4Q8KA 4CDWC 4LBKA 1W8FA 5A33B 2ZA9A 5GLWA 1R1A2 3M7AA 3VLBB 5JLVA 3LGRA 1JTZX 1FPN1 1E57A 4KNCA 3BTZA 1QJY1 2BUKA 4BIFA 2HWE2 1QF3A 1G9AA 2KA3A 4OHYA 3RZJA 3BN6A 1I6XA 3K46A 5BPXA 4LLFA 3ZR6A 1W6NB 5K8SA 2ZGOA 3WD5A 1GZ9A 2VOXA 3CEWA 5CYYA 2YC2A 1PVC1 1UIJA 1H2MA 3AX4A 2C9AA 3VUOA 2ZGSA 3ZSLA 3GZEA 4BQ5A 5FUPA 2VCBA 4XDQA 4CU6A 4FVVA 1XYPA 4Y1YA 4Q4X3 2HWD3 2GU9A 5APAA 5T5PA 1PNGA 1VMJA 3W21A 5F5CA 3SH5A 3IDEA 1UZWA 2BWCA 1TMF3 1XNAA 3FL7A 2DFCA 1V6MA 1L7QA 4IEYA 3NW4A 5FWJA 1AR81 4FOWA 1RYYA 5A70A 2ID4A 1UO9A 4QPGC 4L9BA 5GJ6A 2ZBJA 4N7UA 2RE9A 4Q0UA 4NIHA 4QXCA 4K8RB 4I3GA 2FQPA 1KITA 1KJLA 2TNFA 3CDZB 5EJ1B 1R081 3U4SA 3WR0A 1TNRA 3SEEA 2A6WA 3POFA 4FP2A 4HPKB 5DZFA 1VMHA 3IWZA 4YFWA 2VZTA 1VBB2 3JB8A 5A3WA 1JYCA 3U4XA 5EP9A 2IC1A 1H2LA 1PMJX 3MGUA 1E5SA 2W9XA 4OYUA 4UAPA 2KM2A 5I0RA 1OOPA 1VAKA 5FZ6A 1U0AA 4HSLA 2CGOA 3AP5A 5ERLA 4GWIA 2BW8A 2JE7A 4IERA 2HBTA 2C5DA 2WLPA 2D6PA 4ES8A 4YWAA 1EY2A 1W6MA 4B4PA 3VBFB 3MUY1 5DG2A 2WFF1 2R6QA 2R1DA 1CAXB 1PZ9A 3RWNA 1DLCA 4R9CA 1PHMA 5KWRA 1JZ5A 3ZYRA 2A3WA 3IZOA 5DG1A 2RS12 4XPVA 1GUIA 3SXWA 2Q30A 1HRI1 4QM8A 5B2GB 3V0AB 4IEUA 2JICA 5KXBA 4IXLA 5DAQA 1VRBA 2DUOA 3R0RA 5A1AA 1VBD3 5E8AA 4A3ZA 3A22A 4R52A 4I30A 1W04A 1AYM3 3APBA 3WDTA 4YFZA 2GN3A 1GQHA 1RXFA 2DVFA 5EYYA 5IAXA 2I07B 2X5IC 1IPJA 1JZ2A 1JHNA 1RUG1 5EFUA 1OLME 4IV1B 4DXRA 5ACA2 1AR63 4YVWA 2VQ0A 5K9YA 1G6NA 3AXDA 1FMD2 3DL3A 1VBC2 3OYWB 4ES9A 3MO4A 3ABZA 3VDDA 4PT6A 1LNSA 1W05A 3OGSA 4CZSA 4E4ZA 3LEIA 4NRPA 5B4XA 4NOTA 1H8TB 4DPNA 1LULA 5A32B 4V2VA 4KU8A 4XDOA 1CQ9A 4QKFA 4XYXA 1VB2A 1VPHA 1XNKA 3RYPA 1KFXL 4D7TA 2W91A 1X9PA 4QPIA 1PMIA 1HXS3 1SQ4A 4N53B 2DCYA 1CJPA 3VD3A 3VDCA 2VBBA 1Z78A 3MDPA 3GNEA 4L0PA 4FPKA 4YZ3A 5C3PA 2ENRA 4QGNA 4UYBA 2RS53 4IEXA 4AVBA 2VY0A 4W6XA 2MEV1 4B4QA 4IL7A 3LDKA 5L73A 4XJ8A 1K5MB 1LHUA 1FNYA 2XJTA 1TME2 4LKFA 1WKYA 3E6DA 5C6CA 4E4SA 3CNAA 2EF6A 4YLZA 3TEZA 2C9KA 3JBG3 2VUCA 2LS6A 3RJ2X 3NQHA 5CFDC 1OI6A 4FCAA 3WVJA 1US3A 2R0FA 3I7DA 2NM1A 2D3RA 3HD8B 1IG3A 3INAA 4Y4RA 4QGMA 5C3OA 1QOTA 2BWAA 3D3AA 1V6JA 4W6WA 4D6RA 3I2HA 1SLTA 1JYNA 2GP5A 3BTXA 2BGCA 3J7NA 1PK6A 4UF0A 4PI0A 4XC9A 4XXPA 4BYYA 3W5NA 4ATFA 1RUF2 3WF2A 5D21A 3ZIXA 1AL22 4JTNA 5T52A 3I2OA 3AKTA 3BU7A 3KV4A 4JC1A 2PAMA 5ABJA 1Q8QA 2YC4A 2QVSB 3B69A 1DFQA 3NMBA 3MIFA 2JKBA 1CR7A 1Y9MA 1UY4A 5EWSA 4UWDA 5IVVA 3FBMA 4XMIA 3AXEA 5F2WA 5FQ0A 2DVAA 1UCXA 5I8SA 1WBFA 1RUC1 3WP4A 4R9BA 3OBAA 5FBZA 1WCDJ 1FOD2 4M0NA 2DUPA 1E5RA 1PMHX 1YCIA 3MFAA 4LKDA 2H0BA 4FT8A 2AEZA 3GZUC 4ISQA 2CV6A 4WZFA 5FZFA 4CU9A 1HQWA 5A7OA 3D0SA 4I0WB 1COV3 4F83A 4XFIA 5FZIA 2XBO1 3ZYHA 3RG0A 3H3UA 2QDRA 3AMNA 2R16A 3PIGA 3VKOA 3LDRA 3RZZA 5FXVA 2RS31 1RUH2 3H0OA 3MIHA 1QHDA 2CY6A 2YV8A 2DV9A 4LHSA 3ZXGA 5JVVA 3VZLA 5CAZA 1X50A 2HWB1 4QAWA 2VW2A 3UK9A 4KI5M 1QJX1 1N3PA 1E5HA 1UL9A 2DBNA 2PA7A 4GMP0 3VL9A 4WVWA 2ORXA 4XZUG 4QT6A 1C5HA 4I2OA 5FZ1A 2BERA 4XF1A 3GXUA 4YW6A 1PZ8A 2DDUA 4K3UA 2ZAAA 1AR93 4ISRA 4LUMA 5CA6A 1PGL2 4MSVA 5D1IA 2IVJA 4QPWA 5JXHA 2Q8CA 4COUA 4FFHA 2XWBB 1W8TA 5FLJA 5D8AC 1A78A 1GKBA 1GWKA 1EV13 4GALA 1S55A 1VE0A 4A7KA 4DUXA 3CMGA 1KGYA 1T6GC 2E26A 3QCWA 1OQ1A 1WLWA 3S7EA 2NMOA 3OBZA 4DRVA 4YM0A 2YB7A 3K3OA 1NT0A 2XKPA 5H9RA 2GDFA 2R0HA 3H42B 2PMWB 2R7EB 3N7JA 2ZMNA 2ZGMA 1CX1A 1OOPB 3OUHA 4AF9A 5GZDA 3ZFEA 4DUVA 1GICA 2WAOA 3H8XA 5FZAA 2GC1A 2JDPA 1VB4A 1NKGA 3PUSA 4IEVA 4JDMA 1IOAA 1NLSA 4XDPA 1W6MB 4A2UA 4XZPA 1Y3TA 1G9CA 4R4XA 5CISA 1QQP3 4Q4Y2 1W6PA 1C57A 5KBFA 4W8JA 3AC0A 5E6HA 4ET7A 5FOJB 2FMYA 1W0NA 2VZSA 4KMQA 1XXNA 2R061 1OHFA 4HVRA 1MZ5A 2RM21 4J1WA 2HWF1 1BEV1 1RGSA 1V9U1 4FPEA 3VZKA 4U36A 3MZHA 1SFPA 4PDWC 4MGKE 4EV0A 5F3IA 4W50A 5FZ7A 1QU0A 5T50A 3MIDA 3R4DB 2CDPA 5C71A 1GBGA 2B39A 2Y38A 1QXPA 5JI7A 3WW3A 3RZHA 2GMPA 1C3HA 4CDWA 4BDVB 2N7GA 5KHGA 2R072 3OCPA 1LHNA 2RR12 5C70A 4PLOA 4Q26A 4V2WA 5BNPC 1KXGA 2VNRA 2J1AA 4UT5A 1Y4WA 3ZDVA 4BPZA 1UOJA 3M3IA 4GXLA 3KT4A 2ZXQA 4C91A 3FFQA 4IEOA 4YVWB 3ZFGA 4FPOB 4BB3A 4OMDA 3VDDB 4CA9A 4Z07A 2BRTA 5IAVA 3ZR5A 3EYPA 1W3XA 4KG8A 3N9NA 2FHRA 4IDZA 2Q8OA 1W06A 1WW6A 4XW3A 3ZYJB 1RHI3 1SEFA 1ZNPA 5FLHA 2LTNA 1BZWA 1AHSA 2QQMA 3CJXA 1KDMA 3I2KA 4LE4A 4QPIB 2A6YA 1UOFA 1AVBA 5FO7B 5FY1A 3RGBA 1LEDA 3RZGA 4HT1T 2VCMA 2FMDA 2O8QA 3SH4A 1UY1A 4K6BA 2H0VA 5FPLA 1B35A 1WMFA 1QDOA 1RVF1 3N9PA 4HFSA 1RTVA 4J6GA 5L7OC 4Y26A 3KGLA 1OKQA 2HWC3 3TOJA 4HANA 1H8VA 4RQPA 2VZ3A 2P4EA 3C7EA 4RHV3 5I8TA 1A8MA 3GBWA 1O4TA 5A6YA 2FDKA 4QPGA 4ZXEA 3OPZA 4ASLA 1HRV1 4BQXA 3THCA 2VXJA 3VD7A 5BNNC 2VOVA 4LBQD 1AJKA 1WMEA 2GNDA 4E2QA 3BGAA 4HN0A 1JU4A 2BV4A 4XJUA 1UU4A 4YW3A 2JD9A 1GP6A 4FOVA 3LSEA 3PUIA 3ZXFA 4UFIA 3VDBA 1W9YA 5A7SA 2KXLA 5LK5A 3WINE 3ILRA 2A71A 3P3NA 2ZGTA 4G3YC 1NA1C 2P3JA 2D97A 2E6VA 5J98B 5C3SA 2Q4SA 4RGKA 3IIIA 5FLIA 1PK6B 1Q5OA 1SLLA 4UF0B 4JVAA 2J1UA 5JMOA 4NJ4A 1YQ2A 2WABA 3JXSA 2XJRA 5IVFA 4XFBA 2JDAA 4AGRA 1HB2A 2W92A 1XRUA 1LRHA 1PIV3 1RUD2 2X29A 3JD72 3HNYM 2QZ3A 2DURA 3IDAA 4CCOA 1VBA1 5ABJB 5IK7A 4DXTA 1YFWA 3TB0A 3T08A 3WHUA 4CP0A 1Z7S3 1T2XA 2BFUL 5T55A 1LOGA 4UOJA 4BWOA 3HEIA 3WNXA 3AZWA 2RDRA 1KD7A 1DLLA 2AZ5A 5FQ0B 3P5BA 5KHKA 1JI6A 1WA4A 3H7JA 1UXZA 4NIGA 1AR73 3RZKA 2QKDA 1MEC2 1H9WA 4NUBA 3NO8A 2Q8DA 1GFF2 1PO12 3WDXA 5GLVA 3SKJE 3AL5A 3N9LA 1V00A 2Q5TA 5JXJA 3K3NA 3CLPA 5J09A 2AC1A 1SLBA 3NNJA 4LA3A 5FCCA 5FPUA 3KWVA 4AQTA 2WO1A 4BXSV 2DCTA 3TBDA 3ZFFC 3LKJA 2X5IA 4NHLA 2RDQA 4QMAA 2DTYA 5EJZB 4GH4A 4MHRA 4BM8A 2PHTA 1MZEA 2P6CA 5FY5A 2RMU2 4RD7A 2VBPA 3VBSC 2WS92 4N43C 5FO8B 1XOYA 3S57A 3SNMA 3AZXA 2EIGA 4J25A 3A21A 1EP0A 3Q8CA 2P3IA 3BCWA 2E31A 1N47A 2JDUA 2HWD1 4LBJA 4P00B 1OFNA 4Q4X1 3TN93 4Y22A 1HW5A 4YGCA 1RJ7A 2VPVA 4CSWA 4DRRA 5FZ4A 3T0DA 3N7LA 4LO7A 3PHMA 3OUJA 1QJEA 4N7IA 4Q0QA 4UFKA 4TXWA 3SKVA 3WQ0A 4ARXA 1ULPA 4EN8B 4JKMA 4N8MA 1RUNA 1TMF1 2YC0A 3ILNA 4Z2AA 4CPBA 1A3KA 1ZX5A 4IGQA 1I5PA 5F8PA 2G4IA 5FKCA 3QH7A 3AP7A 4IESA 5IVBA 4QGLA 4CXWA 4ZXKA 4KGGA 2HYKA 2JE8A 4JGYC 4P5HA 2B9UA 5FY0A 5F7UA 4AGVA 3A7QA 2DFBA 2VMHA 3M3EA 3ZFEB 4M3CE 4KBBA 3O14A 4ARYA 1RUE2 4MVTA 2Q1FA 2QQJA 1Q8OA 4NPMA 4XF4A 1IKPA 2E9QA 4PF1A 2ZGQA 5JOWA 3T09A 1HDKA 4QWNA 5L9BA 2ADEA 4N9IA 5FZKA 1VIWB 5CFDA 1W6PB 4GULA 4GB32 2HBUA 3Q8FA 1ZBA3 5CZKA 4CDXC 1ENRA 4P9JA 4CCNA 3LFMA 1JOBA 1YQ8A 2NMNA 4XF9A 5K0UC 5F5IA 5HCBA 3BOPA 2YG0A 1IS3A 1JHJA 2WQZC 2VH9A 4F7ZA 5A3LA 5JR2A 2IFWA 4R8HA 3VZNA 4EN7B 3VBOC 1NZCA 3NJVA 4CDWB 2DWRA 1ZREA 2G9GA 3EXUA 4UFMA 1F2NA 2CYFA 3LWCA 5I0TA 1PX3A 2D6MA 3LAGA 4Q4V3 1JYIA 4DEVA 2D40A 1YWKA 3CL1A 4XCBA 1VBD1 5EZWA 1W9TA 3M2MA 1LGCA 3ZFGB 1X8EA 1AYM1 1SLCA 2DF7A 1CN1A 2ZGLA 3C7FA 1UIKA 3VDAA 1GMMA 2YU1A 3G7DA 4B4RA 1QJU3 4JGZC 5LCWL 1UXXX 3FWEA 1YYNA 1RMU2 3MYXA 4Y5SA 3V56A 3ZXAC 1XPWA 2DTWA 3ASIA 1BKZA 4W65A 2ILMA 3K77A 3A23A 3I3DA 5FYCA 4YW7A 1VMFA 2QTWB 1AR61 2OUHA 2OXBA 2WKKA 3BALA 1Q3EA 2D98A 5I0UA 5L19A 1CAWA 1V0AA 4QXHA 3DYPA 1R1ZA 1PM7A 5IFPA 2G9ZA 3R4UA 4Q8LA 4IEWA 1FX5A 1QOSA 3DPRA 4LULA 1JS9A 5GKAC 1D4VB 1ENSA 2ADDA 2WWUA 1B35B 3WNPA 3USUA 2Q0AA 3WW2A 1ASJ2 2IXCA 3EMRA 1DQ5A 1OBNA 4PBOA 1DF0A 5LBCA 2VQUA 2FBEA 4RQPB 5ANNA 1J84A 5L9RA 1K45A 3GHMA 1HXS1 3MFCA 4CP2A 1WBLA 3ES1A 3H1YA 1AX1A 1DZRA 1SFNA 3MEPA 3FLRA 4QPGB 1OT5A 1FYUA 2BQPA 1VBE3 2D44A 4AZZA 1UYYA 5FZOA 2BJSA 2Y8KA 4HKLA 4KL1A 5LK7B 1D4M3 1IS5A 2RS51 2XVGA 2QUOA 2VTXJ 1FPN2 1HB3A 4Q0PA 5M0TA 3I3EA 3OPWA 3VHNA 4EYUA 1QJY2 3IMMA 4UW4A 2PYTA 3ZO0B 3N3HA 2PHFA 1W8OA 4GWJA 5E88A 5C8CC 3JBG1 3URFA 2DUQA 4NR1A 3VKMA 1J59A 5FYUA 1DGRA 1PVC2 3KZ4C 3ECQA 5FP4A 3CO2A 2X8KA 4MGIE 1KEXA 1LOEA 1NE4A 1POV0 3H8RA 2NYYA 4ZHNA 3HT2A 1ULEA 4A41A 3PMSA 1OVPA 5A1FA 1UYXA 1JBCA 1CIWA 1N3QA 1PGW1 3J8F3 2CDOA 2PHXA 3PTRB 4QX0A 4ZU7A 1JODA 2JG9C 2VTFA 5FYTA 3JUUA 4BIOA 2VMDA 5BNOC 4U2AA 3ZYGA 4Z2WA 2VUAA 3UJQA 4Y5Z0 2QQNA 2WYFA 1H2KA 4TN7A 5JI9A 1OF4A 5EXOA 4XQDA 3SCHA 2RJ2A 3AB0A 2EIEA 4H14A 4PDWA 3UGHA 4G4FA 3WF1A 1V6NA 1AR82 3ZVXA 4CUCA 4Q27A 2GMMA 4EWAA 1QH6A 1ZRDA 5JCTA 2JG8C 2WT0A 2DU0A 4FOQA 2Z79A 1GNYA 2ZHNA 2UY8A 5FYHA 3AL6A 2ZHLA 1R082 1D2SA 1JXNA 2BNOA 2X5IB 4Y1XA 5DUXA 3VBUC 4EZHA 1NY71 3FHAA 3ST7A 4BQ1A 5BNPA 4GH4B 3E5XA 1WLTA 1COV1 3RVHA 1GZCA 4HOOA 5CNAA 4JKKA 2ARAA 3NNFA 4XUNA 4ASKA 2EXHA 2YUEA 2OS2A 4SLIA 4YRDA 1F4AA 4Q29A 5FKBA 4YGBA 1ZZ9A 3ACFA 3WOGA 3LQCA 4Q0SA 3O1SA 1QOOA 5KC5A 5FIXA 4XEZA 3BI3A 2JWPA 1LEMA 1LOFC 3B93A 4Y22B 1ULOA 4TYSA 2RJKA 2Y6GA 4KG0A 4XMAA 1FXZA 5FBJA 3I2IA 1AYN3 3S30A 1UKRA 3IN9A 2WFF2 4UXAA 1URXA 1L3JA 2WZPP 1AR91 2YBSA 5DABA 5FUNA 4AFBA 4Z92B 2JJ6A 1O8PA 2WJSA 3AVRA 1H1MA 4XVHA 2VW0A 1F31A 1HRI2 1RC6A 4YYOA 2Y6KA 1XJAA 4IE7A 5L7OA 1EV11 1DGWX 1G9FA 1POQA 4WBBA 3HBKA 4Y20A 3ZXJA 3O1RA 4FOYA 1BVVA 3KM5A 4Y1ZA 3NJXA 1ZZ7A 5LBBA 5A7NA 3AM2A 1NQDA 3WQBA 1ZBE3 1YQ6A 2J1VA 4DFSA 5BNNA 4LNVA 2WNOA 2FZ2A 3LOIA 2R043 5EHDA 3ZN5A 4CDUC 5CFDB 4YZ1A 2FDIA 1OQEA 2ZHMA 4LBLA 2DVDA 5LBEA 3ZMOA 1HKDA 1RUG2 1XE8A 2XGXA 3KGZA 1LGBA 3MW3A 2YYOA 4FSJA 1OLQA 2YPDA 4HVQA 5A3PA 1R093 5T5LA 1LHWA 1ZA7A 2J7MA 3KCXA 4S2DA 3KT7A 1NA1A 1S0JA 4HONA 5C9AC 4NN0A 1ULGA 1OD3A 1HQNA 1UMHA 4AG4A 2BBVA 3Q8AA 4OI2A 1OH3A 2W87A 3VL8A 1NZIA 1YIFA 3NJZA 3NVCA 4AI8A 1ND2C 3LCPA 1QQP1 5HPOA 1CX4A 1MS1A 1UX6A 4C1WA 1MVEA 4Y4YA 2BZDA 2WZEA 2E63A 3RSJA 5DDJ3 2E51A 3I49A 1NCRC 2VW1A 3LEKA 2WA3A 2ZTNA 2ZGKA 4ZPIA 3WNKA 3JU9A 1HB1A 3Q9OA 1H6YA 1REFA 4PIXA 3UGFA 4FFGA 2G19A 1YHFA 2VJXA 1AL0G 2W1WA 1H9PA 2MEV2 4FPYA 4YG0A 3K2OA 1W2AX 4OVEA 1JZ3A 1VRH3 1Z0HA 4XUQA 3ZSKA 1XYOA 1UW8A 3IBMA 1UX7A 3FHQA 1XB9A 4IE6A 4GKYA 4BXFA 4DS0A 4O9EA 2ARBA 1CAWB 1SG3A 4NRQA 1MS9A 2XXZA 4F3JA 1WMXA 2OKXA 4HVOA 1LGNA 1RUJ3 4KWKA 3MUZ1 4Q5OA 5C7GA 1SBEA 2VAUA 2YMZA 4PIYA 2BEOA 4XBQA 3HQXA 4XF0A 3T2TA 2PXJA 4BQ3A 3DPRB 2VZQA 2X05A 3LDBA 3VBSA 3VBHA 1NAEA 3JQXA 2AGSA 3OSDA 4JKLA 2C1FA 1RHI1 2BTVC 2YGLA 4LO8A 4N43A 3USUB 4A6SA 4AEDC 3A4UA 4HKOA 5JSOA 2FZ1A 1H2NA 5C8WA 2LALA 1TZOA 1XYNA 1CPNA 2BNMA 3UESA 3S0MA 4XTPA 2VZPA 2PHLA 2J1EA 4MZUA 4QX8A 1YQCA 4NPRA 4AEKA 4HSJA 4ZZ8A 2O0OA 3ZIWA 2VR4A 5HCHA 5FZOB 2LROA 3ZYIB 4IE5A 3N9OA 2P34A 4A45A 5F1RA 1BBT3 1ZZBA 2ZGUA 1W6OA 4LO4B 2HWC1 4MGQA 5FP9A 3E6CC 3VGIA 2TBVA 1ZYBA 3OGJA 4RHV1 5FZ0A 1RUC2 4XJWA 3POEA 3USSA 3ZXKA 3DEMA 5GLTA 4ATEA 3KVAA 1LOCA 3AFGA 3M1HA 5LATA 4COVA 4EWEA 4L2NA 4OQ8A 3HMYA 1U5XA 1O7FA 1S0GA 2CTVA 2ZEYA 3HNBM 2IXIA 3K4ZA 3UNPA 4JGYA 2XBO2 3MLJA 2UYBA 1G8WA 1EAH3 4GMP3 1JUHA 3WY6A 3J7MA 2GP3A 2RS32 1JOPA 2PQSA 3THTA 1VJ2A 1OH4A 2VZRA 2WZ8A 2ZX2A 1QKQA 3ZX7A 3AK0A 2BDRA 2LW8A 2HWB2 3THDA 1QJX2 4LMFA 1OSGA 1JZ6A 2PLV3 2W3JA 3U11A 5FZHA 2P3YA 4TLGA 1VAMA 5CIRA 4YGEA 4N9HA 4QQPA 3BB6A 2A73B 5I8YA 2A6XA 4MOAA 4B1LA 1PIV1 4RL7A 3K4DA 4WM7A 1WZXA 3RS6A 3SCGA 2XKOA 4B29A 1NXD1 5K0UA 4LK6A 4AHWA 2VZUA 1MACA 4PDWB 1Z7S1 2DBIA 4GJYA 5F3CA 5J1XA 4CTEA 3U10A 3OBTA 4RS5A 5GALA 3ACLA 1QDCA 3T3YA 3OUIA 1P8JA 1GU3A 2EAAA 3MW2A 5C4WC 4COYA 3T4HB 5F3EA 2OVUA 1AR71 2VZOA 5BNPB 3GDBA 3NAPC 1CONA 5F5QA 2IFRA 2WNEA 1SCSA 4Q4W3 2A5ZA 4MGSA 3RQ0A 1ND3C 4WVMA 1XNBA 4K8FA 4QDRA 1RUI3 2VC9A 3VN4A 1J3QA 1PO23 4YZ5A 3ZDSA 1PNFA 1BLZA 1UQXA 3O0XA 1BK0A 4BU2A 2B42B 2BYVE 2CWSA 3WF4A 1V6KA 1JMUB 4A4AA 4F8AA 2FDHA 3GBGA 2V4VA 5ISLA 4GWNA 4PCRA 3G6JB 1NCQA 2C26A 4X6QB 2FD8A 1KJRA 4AI0A 4BH9A 4D8MA 4FBFA 3J4UH 1IHMA 5DUWA 2J1SA 2PHWA 4I01A 4QXBA 3AP4A 3NV4A 5DUVA 1AXYA 1C1LA 2R062 4M4RA 4R4ZA 1YUDA 2RM22 4XURA 3T0BA 2HWF2 5FYZA 3TN91 5AC91 1OF3A 3VKFC 1BEV2 2RJLA 1V9U2 3L2YA 5DAWA 5FJKA 1QNWA 1C8NA 1S0EA 5L7OB 4L8QA 4KWLA 2VUDA 2QQKA 4Y20B 3T0AA 5LB6A 2E7TA 1CD3G 3LE0A 4E9KA 2CAVA 3KSCA 4QU1A 2VCAA 2B45X 5FZDA 5A3UA 1RUOA 4PHZA 5BNNB 2RV9A 2ET7A 1VALA 3BPZA 3O5SA 3I59A 2EIDA 2QQUA 5IUQA 3HOBA 3B02A 4OMCA 1DDLA 3VBFC 4IV3C 5GM0A 3OEAA 1CJDA 4N90A 4AFMA 4QB1A 2XL9A 1R64A 3GBFA 3VKLA 4YZ4A 4R9AA 2A6ZA 5FO9B 1NA1B 2ETEA 3GF6A 2A75A 1HB4A 1XU1A 2ZABA 3ORJA 4AFCA 5C8CA 3N4MA 2ATFA 5IVJA 3H1WA 3UKTA 3TNPB 1D2QA 2W0XA 2UWCA 2YY1A 1SBDA 3K75B 4LORA 5A7QA 4AQ2A 4CUGA 4C90A 2QJVA 4AEJA 5A6ZA 2Y26A 2P17A 1ZBA1 5HXVA 5KXDA 5A1LA 2W95A 4RR3A 1Q8VA 3W58A 4OUSA 5FY4A 1PX4A 5A7WA 4BISA 3HPNA 1NX9A 4XUOA 2AUYA 1G86A 5IFTA 3KHCA 1H1IA 1MS8A 2JG9A 2PN5A 4QX5A 3WZ1A 4AL9A 5BNOA 5IYYA 3J9SA 1WGPA 4IV1C 1RVF2 3JZVA 4ZU4A 2P37A 4MGYE 2C4XA 4Y33A 2HH9A 1QWRA 3DYOA 5FFOC 1J83A 2C6SA 2ZKLA 4PI2A 4H2AA 4EE2A 2V72A 1NQJA 2WO7A 2WZR3 3U14A 3ZOIA 4Q4V1 1HRV2 2JG8A 1W99A 4ZS3A 4EWDA 1WW4A 2XWJB 3U75A 1AL21 4XILA 5J7MA 5C3QA 1DQ1A 1LB2A 4FTSA 4ZU5A 2AENA 4NVPA 2JB8A 2ZMKA 4HLTA 3H8UA 3ZSJA 1QJU1 4JAAA 1EPWA 3POSA 4ITCA 4AEMA 5CG8A 2ZGPA 2BGPA 2F4PA 4MO3M 4N53C 4QX7A 3VBHB 3VBSB 5JUVA 2D5FA 4N43B 4CVUA 3GHNA 2PAKA 4MV2A 1WD4A 2A7AA 1GR3A 1TVGA 2I2SA 3AKQA 4YVSC 4OZOA 3WW1A 1KRIA 5FK7A 4OI0A 4XOGA 1C8M3 1WWYA 3SC7X 5HI0A 2QQPA 3FLPA 4B3NA 1IS6A 2W08A 2ZAHA 2VUJA 3POYA 4YW1A 4DIQA 5DXDA 4DNYA 1LOFA 3VD9A 2VOWA 1VBA2 2BNNA 2IZWA 2XH6A 3ON7A 2ZX0A 1XNCA 1UZ0A 1DU3D 3RFRA 4QQHA 3AZZA 4IQPA 5FZLA 1O59A 1Y9GA 4EN6B 3I3BA 1ZRRA 4M01A 1W6OB 2WAAA 2VZVA 4I09A 3KV6A 4YM2A 1R1A3 4XBLA 3VZMA 5J36A 2QE3A 3LA7A 1REDA 2X10A 1AZDA 2WNUC 2ZS6B 3KVBA 2VVEA 3TWIA 4WV8A 4E27A 1LHVA 2OX0A 5J96B 3SCFA 1OD5A 4UFJA 1VBE1 4P9YA 4QU2A 4QQLA 2HWE3 2HJIA 4JGYB 2IWGB 2Y34A 3HR9A 4FI9A 4H7LA 5FZCA 2AEYA 4NIAA 1D4M1 1XC6A 3F95A 2ZPXA 4JTOA 4MYEA 5FPBA 5EPAA 2AR6A 4GWMA 1YJKA 5JPMB 2V4AA 1YO8A 5FZBA 3ZN6A 5C3RA 1HLCA 5T5OA 2FDFA 3CQOA 4MGTA 1FV3A 4ASMB 1XNTA 4YW4A 3MF6A 1DG6A 1IPKA 2OZ6A 3KCYA 4PQ9A 1JYWA 2E53A 3WNOA 4HXCA 4XIKA 1OA2A 5C9AA 2EXIA 4WM7B 3R6SA 1X9TA 3WCSA 1NLQA 1GOFA 1W0OA 2C0ZA 3EB7A 4FO9A 5C5TA 5K0UB 3T2QA 4QD2A 2UYAA 1F35A 1LJ7A 2VE1A 1AXKA 3U37A 4AOCA 4AVAA 4Q4X2 2HWD2 2ZHKA 3I54A 3J8F1 5GZFA 1FT9A 1RJ8A 3VD4A 2XOMA 3GZTB 3WUDA 4RS5B 4YG3A 3V0BA 2EA7A 4HN1A 2Z5WA 3AKPA 4LO6B 3W59A 1PGSA 3FN9A 4UW5A 2D6NA 4IGPA 4JRAA 5EYXA 4QDSA 1Y7BA 4A6OA 1TMF2 1X33A 3H7YA 1SMVA 4WVMB 4TWTA 1CAVA 2ZZJA 4V1PA 5BV6A 2G9FA 1JH5A 1SLIA 1S1AA 1VBB3 1W39A 1OLMA 1ZZ8A 2DVBA 2XLAA 3OPTA 4HL0A 3TNQA 3BVCA 1U5IA 5FR3A 1VLNA 4XBNA 2XUEA 2DVGA 2TUNA 3ES4A 5DAPA 4OHVA 2XLGA 4AFDA 4DY3A 5L36A 2K9ZA 3KV5A 4H3WA 3SLIA 1NCQB 3PMEA 1UMZA 3UL2A 3FBYA 2ERFA 3M8LA 3E5QA 1W8WA 1WMDA 4LO5B 5FXWA 4LA2A 3K48A 3C7GA 5FP3A 3ZKYA 4GQ7A 2NPIA 4CRQA 3LOBA 2GH2A 1UN1A 1A8DA 4KU7A 3KT1A 4OULA 1MR5A 2WWSA 2I45A 3M3QA 3PUAA 3WDYA 3MV11 4M0HA 2W46A 1JZ4A 2NZ9A 3AJZA 2GAUA 2WT2A 3KS7A 5FMBA 3MW4A 3O1MA 3ME2A 1AYN1 2W2IA 2RS13 4OZXA 3HN3A 3RDIA 1ZVFA 1F8VA 3WW4A 3S6PA 5FOBB 3LA2A 1OOPC 4NWWA 2EICA 2QZ2A 4RFT0 3LB9A 4CCLA 4P9WA 5FP8A 2ARCA 2XONA 2XDVA 1H1AA 3ATGA 3I59B 5LA0A 1UY0A 4CCDA 2BOIA 2D93A 4IE0A 4LUKA 4AE2A 2VG9A 5GZCA 3O1OA 5FMOS 1VBD2 3CZJA 3LEMA 1QIQA 1UD1A 4MLOA 4COWA 5JR7B 1AYM2 2WUHA 3O1VA 1JYVA 3ZXLA 5ACA3 3I4IA 4RGGA 1C4RA 2X09A 3FMGA 5A3NA 1I5ZA 1S2EA 3HN1A 4CCKA 1ZBE1 5C8CB 4BE3A 1FMD3 3HWJA 1VBC3 3WQ1A 4OHWA 3P3PA 2R041 2ZZQA 3DCQA 5FZEA 3WG4A 3FX3A 4Y24A 4NHKA 5JIAA 3RNSA 5IATA 4D6QA 1GP5A 1UYPA 1AR62 3J26N 1R091 2WNVC 4RR3B 4CP9A 1C28A 1FI2A 2OQ7A 4LBQA 3WP6A 3B01A 1L7RA 5A7WB 3HT1A 2XVKA 4GD4A 2D3PA 1KS5A 4XCAA 2JG9B 5KHIA 1LOAA 5BNOB 1C5IA 1F5JA 4PJYA 3W20A 2B4KA 5J3UA 1FAYA 3WF0A 1IG0A 4Q0VA 3IT8A 3IAPA 4YNIA 1WCQA 1EUTA 1HV1A 5DDJ1 4CCCA 1HXS2 3POGA 2XJVA 4LJHA 1GV9A 1ULFA 3BUCA 3F2ZA 5DQ0A 2HYXA 2FDGA 5DAXA 1XBFA 2B46X 2JG8B 5LA9A 3GZAA 4FPLA 1WW7A 3I3MA 3ZYFA 3NRUA 3EQEA 3OEBA 5A6QA 1TME3 4X8PA 2Y6LA 5GZEA 5C4WA 1S2BA 5JPNB 1CIYA 3RI9A 2RS52 1F5FA 4O9GA 3NAPA 1RL3A 3VV1A 3SMHA 2NN8A 1VRH1 2D6KA 1ND3A 1APNA 5LEJA 4CCEA 1POV3 2G1MA 1VP6A 4FXKB 3JBG2 2GZWA 4LHNA 3RPQA 3MHZA 2VMFA 2GC2A 3VBRC 3O1UA 4CEWC 3AMHA 3MLLA 2Y6FA 4MH0E 1RUJ1 3UT0A 5FZ8A 4QPYA 1CVNA 3MBWA 4NROA 1RUF3 5KXCA 1AL23 5T54A 1DQ0A 4BQ4A 1BXHA 1X36A 1YFXA 3WDUA 4AGGA 2VU9A 1ZZ6A 3N7KA 3RJRA 4B7KA 4P02B 1PGW2 2UY9A 5E1RA 1MPXA 4NPLA 5IW0A 3PU8A 5BYNA 3L2HA 3KQ4B 2GH8A 4NHXA 5EV7A 4P9LA 3POJA 5E89A 2W1UA 4XHXA 2Q1MA 2WWJA 2XLFA 3GJBA 2WRAA 1EPZA 4LE3A 1N1SA 4CUAA 3C7OA 4IEZA 1JU3A 5A3OA 4LQRA 2JDMA 2HLEA 1FOD3 5FYIA 1KDKA 1PK6C 1BBT1 1IZ3A 2J1RA 1MVQA 2OW4A 4DY5A 1UU5A 5I91A 3RMYA 3SQOA 3U07A 5FDBA 1SHWB 2ARXA 3MLKA 3ZN6B 4BCUA 3ZPYA 1YFYA 4D0QA 1OKOA 1PZ7A 1NY72 4QKDA 4DOUA 5ABJC 2XB6C 4AQ6A 1RUH3 3I3QA 2WFPA 1OXCA 3D0JA 3ZPOA 4AVVA 4IV3A 2ORZA 3WF3A 1JN2P 1COV2 1Y43B 2P3KA 3FZ3A 5A80A 4A44A 3AYEA 4BA6A 3AJYA 3O1TA 2VL4A 1GSLA 2WSUA 1WCSA 1EAH1 4GMP1 3E97A 2OPKA 5C9AB 1PM4A 2MHFA 1QMJA 5D8AA 4JV4A 1G9DA 1SZBA 3LFIA 5L9VA 1I3HA 2PLV1 2ZKNA 3NV3A 3V0BB 2UWAA 5LW9A 2QFEA 4Q2FA 4TSVA 3KD4A 1MS0A 5EJ3A 1SACA 3X29B 1WUVA 4GA9A 2Z4FA 1GQPA 3ZLIA 1O3RA 4K9SA 4MXWA 1AR92 1Y9QA 2CAUA 5IVEA 4CU8A 3MIGA 1LESA 1W6QA 1UAIA 4C0BA 2Y6HA 1KS4A 4YPJA 5F6KA 5CBLA 1JYXA 2MNGA 2WA4A 1CAVB 4DXZA 3QACA 1UMIA 1LTEA 2VMEA 5DAVA 1EV12 2P6HA 3OGGA 4UBGA 4AHYA 3VD5A 1X8MA 5CKNA 3VKNA 1O4ZA 4XIOA 1GWMA 5GLUA 4MG2A 1ODMA 4Q4W1 3WP5A 4IE4A 3S5AA 3SH3A 3MPPG 4DQAA 4JHTA 2XMLA 1RUI1 4LR4A 3V65A 5HCAA 1JYTA 1PO21 2Q1ZB 3PJQA 3MV01
chains in the Genus database with same CATH topology
2WAOA 2WDBA 4W4ZA 2QQIA 4A45A 1NKGA 1K3IA 4QX3A 4LKSA 4MGQA 5DMYA 4W8JA 3AC0A 4ET7A 1W0NA 2VZSA 5IJRA 4E8DA 1UY3A 4KMQA 2QQOA 2V5DA 2J1TA 2ZEYA 3K4ZA 3UNPA 3HNBM 4M4PA 2E33A 4W50A 5EIYB 2PQSA 1OH4A 2VZRA 2CDPA 2WZ8A 5C71A 5LA1A 4DXSA 2VCCA 2LW8A 3WSOA 3THDA 1JZ6A 4BDVB 2W3JA 4RN5A 3DYMA 5C70A 2J1AA 4MOAA 3K4DA 2ZXQA 3I2GA 5JXIA 2VZUA 4OMDA 3EYPA 5J1XA 4ZY9A 1O8SA 3W5MA 4QX1A 1P8JA 3UETA 1GU3A 3P1IA 1W8NA 2VZOA 2QQMA 1K12A 3GDBA 2VM9A 3I2KA 1UY2A 1D7PM 2QQLA 4XUTA 4LPLA 5IHRA 4IUGA 3I2JA 4MGSA 4QDRA 2VC9A 2B9VA 1UY1A 2VOTA 5DN2A 3WF4A 2BBAA 3HJRA 2KD7A 4A4AA 4QB2A 2VZ3A 2V4VA 3C7EA 1TG7A 4MADA 4JHZA 2C26A 2EIBA 4ZXEA 4D8MA 3THCA 3VD7A 3IAQA 2J1SA 3BGAA 4ZZ5A 1JU4A 4M4RA 4XURA 3DECA 2JD9A 3T0BA 3PUIA 1OF3A 3VDBA 4KWUA 2W1SA 2QQKA 3HNMA 1CZSA 3T0AA 4DUWA 3IIIA 3T2OA 3LE0A 5JMOA 2J1UA 1YQ2A 2WABA 2VCAA 2DCJA 3CZUA 3JXSA 2JDAA 3PUHA 5B4NA 2W92A 2RV9A 3OG2A 1GOGA 3HNYM 2EIDA 3IDAA 3HOBA 2W5FA 4OMCA 3T08A 4DXTA 3OEAA 5HXMA 1T2XA 4QB1A 1R64A 4UOJA 3WEZA 3HEIA 3GM8A 1JI6A 2RVAA 1UXZA 4CUAA 3K75B 4QB6A 3SKJE 5JXJA 4CU7A 2W95A 2WO2A 1PX4A 5G05L 3LEGA 3HPNA 1NX9A 2WO1A 2ZEZA 4XUOA 4BXSV 3ACHA 3IB3A 5IFTA 5IYYA 5EJZB 2L9LA 3OB8A 2C4XA 3DYOA 4AAXA 1J83A 2XQXA 3ETPA 2V72A 3WNLA 2E32A 4HG6B 2ZEXA 1W99A 3A21A 1CZTA 2E31A 4XUPA 4P00B 1NUKA 4BJ0A 3T0DA 3C8XA 3SKVA 4TXWA 4ARXA 3ACIA 1ULPA 4JKMA 2BGPA 4MO3M 5JUVA 4Z2AA 1EUUA 4OUEA 4CVUA 1W9SA 4P5YA 1TVGA 1HN1A 2WO3A 4OZOA 1I5PA 2VQTA 3ACGA 2W47A 3VD9A 2JE8A 5F7UA 3A7QA 1US2A 1UZ0A 4ARYA 4RYDA 2QQJA 1O59A 2DCKA 3I3BA 2J22A 4PF1A 2WAAA 2VZVA 1W9WA 3T09A 3WNMA 2X10A 3LPGA 4JX0A 3CIHA 3SEPA 4A42A 1UWWA 4DEQA 5CZKA 4FI9A 2YFZA 4E8CA 1XC6A 2JKXA 2YG0A 1JHJA 3BN6A 3K46A 5JR2A 3CQOA 1GOHA 3NJVA 1UYZA 5CYYA 1XNTA 2YC2A 2XHNA 1JYWA 3WNOA 1PX3A 4DEVA 2VCBA 4CU6A 1GOFA 3EB7A 1W9TA 3T2QA 2VZ1A 3VDAA 3C7FA 5JXGA 3U37A 1GMMA 2W94A 3WNNA 3VD4A 5LCWL 2XOMA 1UXXX 4TTGA 2WN2A 1XNAA 3FL7A 4PQQA 1XPWA 1L7QA 3FN9A 5LA2A 3K77A 3A23A 3I3DA 4QDSA 4A6OA 1RYYA 2ID4A 2YFUA 3DYPA 5FUIA 5IFPA 2VO5A 5EJ1B 3CDZB 3SEEA 4P08A 3WNPA 2VZTA 2VQUA 1J84A 1K45A 1PMJX 2W9XA 3GGLA 4OYUA 2QBXA 2WN3A 4ZZ8A 4UAPA 1OT5A 3C7GA 4GWIA 1UYYA 2Y8KA 2Y6JA 2Y64A 3I3EA 3MUY1 3MV11 2W46A 1JZ4A 1JZ8A 1DLCA 3HN3A 1JZ5A 1W8OA 4GWJA 3I97A 1GUIA 2EICA 2VMCA 3ECQA 2XONA 5A1AA 1KEXA 1UY0A 4A3ZA 3A22A 5LA0A 4A41A 2ZEWA 3P6BA 3CZJA 3CKHA 1UYXA 2WQ8A 2CDOA 4QX2A 2WUHA 4QX0A 1JYVA 2VTFA 2X09A 2VMDA 1JZ2A 3NNGA 4DXRA 2QQNA 1SDDB 1OF4A 2RJ2A 2EIEA 3WF1A 3MO4A 3ABZA 4CUCA 4PT6A 3LPFA 1LNSA 3OGSA 3LEIA 5B4XA 1L7RA 2BGOA 3T2PA 1JZ7A 1GNYA 3FHAA 2W91A 2B4KA 3WF0A 3IAPA 1WCQA 1EUTA 2WYSA 4JKKA 3VDCA 3VD3A 4XUNA 1BHGA 5G04L 4L0PA 3F2ZA 5DQ0A 1F4AA 2HYXA 1F4HA 3ACFA 3LQCA 3NRUA 3OEBA 2Y6LA 1ULOA 1DP0A 1CIYA 4CUBA 2Y6GA 3ZM8A 3I2IA 1WKYA 2C9KA 2LS6A 3OGRA 3NQHA 1O8PA 5DPNA 1US3A 2VMFA 4XVHA 2Y6KA 3D3AA 3I2HA 1JYNA 3MBWA 3C7HA 3NJXA 3J7HA 3W5NA 4P02B 3WF2A 3WQBA 2J1VA 1MPXA 4QDQA 2YC4A 2W1UA 1K42A 1DYOA 3C7OA 2J7MA 1JU3A 1UY4A 4LQRA 2HLEA 1OD3A 3I2FA 1UMHA 4AG4A 2W87A 2J1RA 2W1QA 2WBKA 1H6XA 1PMHX 1SHWB 5HPOA 4BK4A 4CU9A 4D0QA 1IQDC 2BZDA 2WZEA 3WF3A 2ORZA 4UI9L 3LEKA 4A44A 3WNKA 2VL4A 4LHSA 1H6YA 4QAWA 1CZVA 2VJXA 4KI5M 2W1WA 2ORXA 4XZUG 2BERA 1JZ3A 3GXUA 2DDUA 4XUQA 1UX7A 2Z4FA 1GQPA 3FHQA 4GZ9A 4QPWA 5JXHA 5I0DA 1SG3A 4CU8A 2OKXA 2Y6HA 4YPJA 3MUZ1 5C7GA 1JYXA 4DUXA 3CMGA 1KGYA 2E26A 2VZQA 2X05A 1UMIA 2VMEA 4BK5A 1NAEA 4JKLA 3E1F1 3VD5A 2YB7A 3OGVA 3UESA 2R7EB 2VZPA 1CX1A 2J1EA 3K4AA 3OBAA 4DUVA 3MV01 2VR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAO A;  2WDB A;  4W4Z A;  2QQI A;  4A45 A;  1NKG A;  1K3I A;  4QX3 A;  4LKS A;  4MGQ A;  5DMY A;  4W8J A;  3AC0 A;  4ET7 A;  1W0N A;  2VZS A;  5IJR A;  4E8D A;  1UY3 A;  4KMQ A;  2QQO A;  2V5D A;  2J1T A;  2ZEY A;  3K4Z A;  3UNP A;  3HNB M;  4M4P A;  2E33 A;  4W50 A;  5EIY B;  2PQS A;  1OH4 A;  2VZR A;  2CDP A;  2WZ8 A;  5C71 A;  5LA1 A;  4DXS A;  2VCC A;  2LW8 A;  3WSO A;  3THD A;  1JZ6 A;  4BDV B;  2W3J A;  4RN5 A;  3DYM A;  5C70 A;  2J1A A;  4MOA A;  3K4D A;  2ZXQ A;  3I2G A;  5JXI A;  2VZU A;  4OMD A;  3EYP A;  5J1X A;  4ZY9 A;  1O8S A;  3W5M A;  4QX1 A;  1P8J A;  3UET A;  1GU3 A;  3P1I A;  1W8N A;  2VZO A;  2QQM A;  1K12 A;  3GDB A;  2VM9 A;  3I2K A;  1UY2 A;  1D7P M;  2QQL A;  4XUT A;  4LPL A;  5IHR A;  4IUG A;  3I2J A;  4MGS A;  4QDR A;  2VC9 A;  2B9V A;  1UY1 A;  2VOT A;  5DN2 A;  3WF4 A;  2BBA A;  3HJR A;  2KD7 A;  4A4A A;  4QB2 A;  2VZ3 A;  2V4V A;  3C7E A;  1TG7 A;  4MAD A;  4JHZ A;  2C26 A;  2EIB A;  4ZXE A;  4D8M A;  3THC A;  3VD7 A;  3IAQ A;  2J1S A;  3BGA A;  4ZZ5 A;  1JU4 A;  4M4R A;  4XUR A;  3DEC A;  2JD9 A;  3T0B A;  3PUI A;  1OF3 A;  3VDB A;  4KWU A;  2W1S A;  2QQK A;  3HNM A;  1CZS A;  3T0A A;  4DUW A;  3III A;  3T2O A;  3LE0 A;  5JMO A;  2J1U A;  1YQ2 A;  2WAB A;  2VCA A;  2DCJ A;  3CZU A;  3JXS A;  2JDA A;  3PUH A;  5B4N A;  2W92 A;  2RV9 A;  3OG2 A;  1GOG A;  3HNY M;  2EID A;  3IDA A;  3HOB A;  2W5F A;  4OMC A;  3T08 A;  4DXT A;  3OEA A;  5HXM A;  1T2X A;  4QB1 A;  1R64 A;  4UOJ A;  3WEZ A;  3HEI A;  3GM8 A;  1JI6 A;  2RVA A;  1UXZ A;  4CUA A;  3K75 B;  4QB6 A;  3SKJ E;  5JXJ A;  4CU7 A;  2W95 A;  2WO2 A;  1PX4 A;  5G05 L;  3LEG A;  3HPN A;  1NX9 A;  2WO1 A;  2ZEZ A;  4XUO A;  4BXS V;  3ACH A;  3IB3 A;  5IFT A;  5IYY A;  5EJZ B;  2L9L A;  3OB8 A;  2C4X A;  3DYO A;  4AAX A;  1J83 A;  2XQX A;  3ETP A;  2V72 A;  3WNL A;  2E32 A;  4HG6 B;  2ZEX A;  1W99 A;  3A21 A;  1CZT A;  2E31 A;  4XUP A;  4P00 B;  1NUK A;  4BJ0 A;  3T0D A;  3C8X A;  3SKV A;  4TXW A;  4ARX A;  3ACI A;  1ULP A;  4JKM A;  2BGP A;  4MO3 M;  5JUV A;  4Z2A A;  1EUU A;  4OUE A;  4CVU A;  1W9S A;  4P5Y A;  1TVG A;  1HN1 A;  2WO3 A;  4OZO A;  1I5P A;  2VQT A;  3ACG A;  2W47 A;  3VD9 A;  2JE8 A;  5F7U A;  3A7Q A;  1US2 A;  1UZ0 A;  4ARY A;  4RYD A;  2QQJ A;  1O59 A;  2DCK A;  3I3B A;  2J22 A;  4PF1 A;  2WAA A;  2VZV A;  1W9W A;  3T09 A;  3WNM A;  2X10 A;  3LPG A;  4JX0 A;  3CIH A;  3SEP A;  4A42 A;  1UWW A;  4DEQ A;  5CZK A;  4FI9 A;  2YFZ A;  4E8C A;  1XC6 A;  2JKX A;  2YG0 A;  1JHJ A;  3BN6 A;  3K46 A;  5JR2 A;  3CQO A;  1GOH A;  3NJV A;  1UYZ A;  5CYY A;  1XNT A;  2YC2 A;  2XHN A;  1JYW A;  3WNO A;  1PX3 A;  4DEV A;  2VCB A;  4CU6 A;  1GOF A;  3EB7 A;  1W9T A;  3T2Q A;  2VZ1 A;  3VDA A;  3C7F A;  5JXG A;  3U37 A;  1GMM A;  2W94 A;  3WNN A;  3VD4 A;  5LCW L;  2XOM A;  1UXX X;  4TTG A;  2WN2 A;  1XNA A;  3FL7 A;  4PQQ A;  1XPW A;  1L7Q A;  3FN9 A;  5LA2 A;  3K77 A;  3A23 A;  3I3D A;  4QDS A;  4A6O A;  1RYY A;  2ID4 A;  2YFU A;  3DYP A;  5FUI A;  5IFP A;  2VO5 A;  5EJ1 B;  3CDZ B;  3SEE A;  4P08 A;  3WNP A;  2VZT A;  2VQU A;  1J84 A;  1K45 A;  1PMJ X;  2W9X A;  3GGL A;  4OYU A;  2QBX A;  2WN3 A;  4ZZ8 A;  4UAP A;  1OT5 A;  3C7G A;  4GWI A;  1UYY A;  2Y8K A;  2Y6J A;  2Y64 A;  3I3E A;  3MUY 1;  3MV1 1;  2W46 A;  1JZ4 A;  1JZ8 A;  1DLC A;  3HN3 A;  1JZ5 A;  1W8O A;  4GWJ A;  3I97 A;  1GUI A;  2EIC A;  2VMC A;  3ECQ A;  2XON A;  5A1A A;  1KEX A;  1UY0 A;  4A3Z A;  3A22 A;  5LA0 A;  4A41 A;  2ZEW A;  3P6B A;  3CZJ A;  3CKH A;  1UYX A;  2WQ8 A;  2CDO A;  4QX2 A;  2WUH A;  4QX0 A;  1JYV A;  2VTF A;  2X09 A;  2VMD A;  1JZ2 A;  3NNG A;  4DXR A;  2QQN A;  1SDD B;  1OF4 A;  2RJ2 A;  2EIE A;  3WF1 A;  3MO4 A;  3ABZ A;  4CUC A;  4PT6 A;  3LPF A;  1LNS A;  3OGS A;  3LEI A;  5B4X A;  1L7R A;  2BGO A;  3T2P A;  1JZ7 A;  1GNY A;  3FHA A;  2W91 A;  2B4K A;  3WF0 A;  3IAP A;  1WCQ A;  1EUT A;  2WYS A;  4JKK A;  3VDC A;  3VD3 A;  4XUN A;  1BHG A;  5G04 L;  4L0P A;  3F2Z A;  5DQ0 A;  1F4A A;  2HYX A;  1F4H A;  3ACF A;  3LQC A;  3NRU A;  3OEB A;  2Y6L A;  1ULO A;  1DP0 A;  1CIY A;  4CUB A;  2Y6G A;  3ZM8 A;  3I2I A;  1WKY A;  2C9K A;  2LS6 A;  3OGR A;  3NQH A;  1O8P A;  5DPN A;  1US3 A;  2VMF A;  4XVH A;  2Y6K A;  3D3A A;  3I2H A;  1JYN A;  3MBW A;  3C7H A;  3NJX A;  3J7H A;  3W5N A;  4P02 B;  3WF2 A;  3WQB A;  2J1V A;  1MPX A;  4QDQ A;  2YC4 A;  2W1U A;  1K42 A;  1DYO A;  3C7O A;  2J7M A;  1JU3 A;  1UY4 A;  4LQR A;  2HLE A;  1OD3 A;  3I2F A;  1UMH A;  4AG4 A;  2W87 A;  2J1R A;  2W1Q A;  2WBK A;  1H6X A;  1PMH X;  1SHW B;  5HPO A;  4BK4 A;  4CU9 A;  4D0Q A;  1IQD C;  2BZD A;  2WZE A;  3WF3 A;  2ORZ A;  4UI9 L;  3LEK A;  4A44 A;  3WNK A;  2VL4 A;  4LHS A;  1H6Y A;  4QAW A;  1CZV A;  2VJX A;  4KI5 M;  2W1W A;  2ORX A;  4XZU G;  2BER A;  1JZ3 A;  3GXU A;  2DDU A;  4XUQ A;  1UX7 A;  2Z4F A;  1GQP A;  3FHQ A;  4GZ9 A;  4QPW A;  5JXH A;  5I0D A;  1SG3 A;  4CU8 A;  2OKX A;  2Y6H A;  4YPJ A;  3MUZ 1;  5C7G A;  1JYX A;  4DUX A;  3CMG A;  1KGY A;  2E26 A;  2VZQ A;  2X05 A;  1UMI A;  2VME A;  4BK5 A;  1NAE A;  4JKL A;  3E1F 1;  3VD5 A;  2YB7 A;  3OGV A;  3UES A;  2R7E B;  2VZP A;  1CX1 A;  2J1E A;  3K4A A;  3OBA A;  4DUV A;  3MV0 1;  2VR4 A; 
#chains in the Genus database with same CATH topology
 1DBN A;  4W4Z A;  2VXR A;  1GAN A;  2QQI A;  5JSR A;  3ILF A;  4Q4Y 3;  1OA3 A;  2OUJ A;  3KV9 A;  2A6V A;  5HV0 A;  5FPZ A;  5JSP A;  3EJK A;  4LKS A;  3TRS B;  5C5U A;  5DMY A;  4LIV A;  5SV5 A;  1CAU A;  4YVS A;  3U78 A;  3FUQ A;  1N1T A;  1FV2 A;  4E8D A;  5IJR A;  1QQP 2;  1UY3 A;  2B7Y A;  2J42 A;  3NKG A;  5CFC C;  2W52 A;  2J1T A;  4HBN A;  5FK8 A;  3QBQ A;  1JOJ A;  1W0P A;  2K46 A;  1QXJ A;  2JDZ A;  5FYS A;  1ONA A;  2H6B A;  2WT1 A;  3THP A;  5EIY B;  1BYH A;  2D6L X;  3UJO A;  4HET A;  4BLJ A;  3M70 A;  2R07 3;  1S0B A;  1SCR A;  2RR1 3;  5AC9 3;  2O8O A;  1GNH A;  3ZYP A;  3T1M A;  1YIP A;  1XSQ A;  2WNU A;  4HMZ A;  1HX6 A;  3DYM A;  3RI8 A;  4NE9 A;  5A3T A;  4URA A;  4EQV A;  3WDV A;  2XG3 A;  2XVL A;  3I2G A;  3OF1 A;  4D94 A;  2F4L A;  2W39 A;  1YFU A;  2FCT A;  4XJZ A;  4Z82 A;  4PIZ A;  2DYC A;  2GNM A;  4CP9 B;  1OUX A;  3M3O A;  1O8S A;  2YRO A;  2SBA A;  4LBQ B;  3LA3 A;  2VQA A;  4QX1 A;  5J37 A;  1ALY A;  4MX3 A;  3UET A;  3AP6 A;  2BVV A;  1W8N A;  1XSR A;  4IET A;  1HJG A;  4XJA A;  5I0S A;  2TEP A;  3PNA A;  1K12 A;  2EAL A;  1RHI 2;  2VM9 A;  5IK4 A;  4I3P A;  4RFR B;  1UY2 A;  2IUW A;  1D7P M;  3N7M A;  4LPL A;  4Y3O A;  2PHD A;  4IUG A;  2YBK A;  3I2J A;  4I0A A;  3ZFG C;  2XHK A;  2P5B A;  4M3C F;  4KBZ A;  5JWP A;  2GAL A;  1U5Z A;  1SPP A;  3LIH A;  2BBA A;  3HJR A;  4JZR A;  4S2F A;  2PFW A;  3FC0 A;  1DGL A;  5C4W B;  1AJO A;  1J1L A;  4P14 A;  3MIE A;  1TG7 A;  2D43 A;  4MAD A;  3NAP B;  2HWC 2;  2EIB A;  3IMN A;  4KH9 A;  1LHO A;  1RB8 G;  4RHV 2;  3IAQ A;  4FFF A;  5FYM A;  1ND3 B;  2VNO A;  2WZR 1;  1HIX A;  4ERO A;  5FMC A;  3S7I A;  4AYU A;  4ZKT B;  3PVE A;  2RHP A;  1QY4 A;  1SBF A;  1B35 C;  2OA2 A;  3DEC A;  5GZG A;  5JZG C;  2XJP A;  2ZX4 A;  1G9B A;  2Z42 A;  4AVC A;  2HEV F;  4KWU A;  3GCX A;  2W1S A;  3FJS A;  4A3X A;  3RYK A;  4RQP C;  4YZ2 A;  4PF5 A;  4OUM A;  5F2S A;  4D7Y A;  4DUW A;  2CSG A;  3MIC A;  1S0F A;  1YI9 A;  2OPW A;  5FYB A;  1KQR A;  3T2O A;  2EXJ A;  1OQD A;  3B00 A;  3BTA A;  3KF3 A;  2CGN A;  3KMH A;  1T6B X;  1RUD 3;  5LY1 A;  3JD7 3;  2DCJ A;  3CZU A;  1S0D A;  3PUH A;  4XFF A;  4OHZ A;  1JUI A;  5DUU A;  4FXG B;  2UU8 A;  1C8M 1;  3ITQ A;  2W5F A;  1PIV 2;  1TE1 B;  4CDQ C;  4KGQ A;  1EYB A;  3PVO A;  4KQ7 A;  3WEZ A;  5K7P A;  3SIT A;  4AK3 A;  1BMV 1;  1NYW A;  1DGR N;  1Z7S 2;  2PAE A;  4Y1V A;  3ZFF A;  2CL2 A;  3OD4 A;  3GM8 A;  2XJQ A;  1MEC 3;  4X8N A;  4CCJ A;  3KF5 A;  4BQ2 A;  2VTX A;  3RZM A;  1PO1 3;  1SDW A;  1Q8P A;  1R1A 1;  3AFK A;  3CJI C;  4L11 A;  1UF2 C;  4QB6 A;  1AR7 2;  2VBD A;  4M3C A;  4CU7 A;  3B5L B;  5CEH A;  2WO2 A;  4XFC A;  4IV3 B;  4QHO A;  4WM8 C;  3DGT A;  1WLC A;  2HWE 1;  3AYC A;  5G05 L;  3D5O A;  1NXM A;  4GJZ A;  4IEQ A;  2RDN A;  3EO6 A;  5FZ9 A;  3SHR A;  2UUR A;  4TLF A;  4D7S A;  2WC2 A;  3S5Q A;  3AZY A;  1MQT C;  2RMU 3;  5D8A B;  2WS9 3;  4PLN A;  3WG2 A;  2L9L A;  1ENX A;  5GLZ A;  4FTB A;  3AKR A;  3FFZ A;  1A6C A;  3O0W A;  4LTA A;  5IK8 A;  4AAX A;  4Y1U A;  3CU7 A;  5FPA A;  3IDB B;  5F32 A;  4YM3 A;  3ZSM A;  1YQ5 A;  3AP9 A;  2VEC A;  2WNV A;  5IT6 A;  4HK8 A;  3WNL A;  1VAV A;  2JEM A;  5IVC A;  5LRS A;  4BOW A;  2XJU A;  1W2O A;  2ZEX A;  4FQ4 A;  5F37 A;  4NWV A;  5KC6 A;  2A3Y A;  3W9A A;  4MXW B;  1W6Q B;  3DXU A;  4B7E A;  3C8X A;  4GH4 C;  3TN9 2;  2JIG A;  4EN0 A;  5AC9 2;  1W2U A;  2D6O X;  5EQU A;  1W9F A;  4OQ9 A;  3NWK A;  1F15 A;  5LEK A;  1EUU A;  2R1B A;  3N36 A;  5J48 A;  4CEY C;  1W9S A;  3FHI B;  2WO3 A;  1HN1 A;  2UWB A;  3N9M A;  1SLA A;  3TEX A;  1UZY A;  1YI7 A;  5CKM A;  3WQ7 A;  1BK1 A;  4FPH A;  3ACG A;  3RMX A;  1N1V A;  3C3V A;  4CDX A;  2W47 A;  1RUE 3;  1VBB 1;  1US2 A;  2LUW A;  4LBN A;  1M4W A;  2GME A;  1O91 A;  2E7Q A;  3MIB A;  4RYD A;  4JQR A;  4XET A;  5H9S A;  3V64 A;  5FV3 A;  3NNL A;  3DKW A;  3WUC A;  1H0B A;  4GB3 3;  2O14 A;  2AAC A;  2H6C A;  5I93 A;  2YXS A;  3LPG A;  5A7P A;  3BIW E;  3QH6 A;  4JX0 A;  1CAU B;  2V73 A;  3CIH A;  4YVS B;  3SEP A;  3VBO A;  2Y0I A;  1RIR A;  5LRR A;  4A42 A;  1GZW A;  1UWW A;  3VBR A;  3H9A A;  4CEW A;  2PEL A;  2BVB A;  4W6Y A;  4DEQ A;  2B8M A;  4AHZ A;  2AYH A;  1MS5 A;  1ZBA 2;  2YFZ A;  2GC0 A;  4E8C A;  4XE9 A;  4XQW A;  2JDY A;  2PQQ A;  2VNV A;  2JKX A;  4LLO A;  1Q56 A;  1ZRI A;  4IND A;  1W28 A;  4JGZ A;  4XFH A;  2LRP A;  2OT7 A;  4FFI A;  1UOG A;  1GOH A;  5HV4 A;  2RS1 1;  2XPJ A;  4MUV A;  4MET A;  1UYZ A;  2WNU B;  3FE5 A;  2XHN A;  4WVV A;  3JCI A;  2JE9 A;  4BZ4 A;  4JRL A;  4P9X A;  2BP6 A;  4BLI A;  3T30 A;  4L92 A;  5A3M A;  2RDS A;  5BXX A;  1UNB A;  4SBV A;  4Q4V 2;  5KR7 A;  2OII A;  4C8D A;  3M3C A;  2VZ1 A;  3HIF A;  2ARE A;  1K5J A;  3POI A;  4LK7 A;  4OHX A;  3WG1 A;  1RMU 3;  4AW7 A;  2W94 A;  1IKQ A;  3H3L A;  4QKB A;  3WNN A;  2C24 A;  4I02 A;  4YW5 A;  1W2T A;  3WX5 A;  3B94 A;  4K1Y A;  1LOB A;  4TTG A;  5FYY A;  5ACA 1;  3ZXE A;  2I74 A;  1QJU 2;  2WN2 A;  4PQQ A;  5ANQ A;  5DZG A;  1D0H A;  2WIN B;  5LA2 A;  3RZL A;  1FMD 1;  1VBC 1;  4P9I A;  1S4C A;  4PLM A;  2Y0O A;  2KR2 A;  2YFU A;  5JMC A;  1F9K A;  1GWL A;  3GCW A;  5FUI A;  3OJB A;  2VO5 A;  4OCT A;  3PL0 A;  4FPC A;  1SFY A;  4OFG A;  1ASJ 3;  2CNA A;  3IPV A;  3PTY A;  4LKE A;  3HQR A;  3D4K A;  4LOT A;  1J3P A;  5FPX A;  2ZX1 A;  4P08 A;  1I1E A;  3E5U A;  4FAH A;  3I8T A;  1SPP B;  4L97 A;  4YAR A;  1XE0 A;  3TYJ A;  1W8H A;  5TSW A;  1AUY A;  2IXL A;  3ZKU A;  5JAX A;  1V6I A;  2JB4 A;  1LOD A;  2YU2 A;  4AI1 A;  5BUV A;  3GGL A;  2QBX A;  1QJZ A;  2JEN A;  2WN3 A;  4GKX A;  5FYV A;  1M06 G;  1FPN 3;  3GJA A;  3T1L A;  4XXA A;  3DPR C;  2V09 A;  5FPV A;  5FMD A;  1VBE 2;  3D82 A;  1QJY 3;  4UW6 A;  4E2S A;  1GP4 A;  1QNY A;  2Y64 A;  2Y6J A;  1TME 1;  2B5H A;  1ZM1 A;  3OTF A;  5FXZ A;  2EVX A;  3HAG A;  1D4M 2;  2AH2 A;  1CPM A;  3LIG A;  2YHJ A;  4LOS A;  5CKQ A;  1DCS A;  1JZ8 A;  2JX9 A;  1GQG A;  3AKS A;  4UW3 A;  4XHB A;  1RIN A;  1W3V A;  4O61 A;  1O5U A;  1PVC 3;  1DZT A;  1QJF A;  3I97 A;  3UGG A;  2IXK A;  1MS3 A;  5AFE A;  1POV 1;  1YLL A;  4XAE A;  2K0G A;  2VMC A;  5K4L A;  1UOB A;  1LU2 A;  3R05 A;  1QXR A;  4UFL A;  1ST8 A;  2ZEW A;  4GIQ A;  3P6B A;  1H8T C;  2JDN A;  3CKH A;  1RUF 1;  2FCU A;  4G9S B;  3R4S A;  2WQ8 A;  1TNF A;  4O7X A;  4QX2 A;  2GSY A;  3EHK A;  1ZA4 A;  3NNM A;  3OY8 A;  2VD7 A;  2RG4 A;  3ZFF B;  3ROU A;  4FTE A;  3J8F 2;  3ETQ A;  3VBU A;  3H3Z A;  4DZG A;  5CFC A;  1Q8S A;  3KHB A;  4Q1R A;  3QD6 A;  2QCS B;  3NNG A;  1AR8 3;  5IWF A;  4NII A;  2LM3 A;  1SDD B;  1V6O A;  4OLL A;  5HBA A;  3O1P A;  2A70 A;  3BPS A;  4H55 A;  4ONU A;  5CAD A;  1OMI A;  4JCK A;  1GLH A;  2HEW F;  4M3C B;  3LPF A;  4JDN A;  4XQ4 A;  3KB5 A;  3WV6 A;  4A7Z A;  3PVB B;  3O7O A;  1R08 3;  2WII B;  2D5H A;  1FOD 1;  2F17 A;  2HKX A;  2BGO A;  5JDB A;  4RGA A;  3T2P A;  1WCK A;  3ELN A;  1JZ7 A;  1W8Z A;  3AYD A;  3AMQ A;  4BME A;  1K5M C;  1W8U A;  3DF0 A;  5JOY A;  1DIW A;  3E6B A;  5T5J A;  4NAM A;  1LEC A;  3LF7 A;  2WLQ A;  2WYS A;  1RUH 1;  2SLI A;  5CU1 A;  1OFS A;  1YNA A;  4K20 A;  4A7Y A;  1BHG A;  3AVS A;  5G04 L;  4AVT A;  1WCU A;  4EJR A;  2WNV B;  2VMI A;  3ALQ A;  1FAT A;  1F4H A;  4QKN A;  3B9I A;  1WA6 X;  4NMI A;  4EN9 B;  4PBP A;  5H9Q A;  1W90 A;  2CGP A;  5FJH A;  1DQ2 A;  4D3W A;  1HQL A;  1DP0 A;  4CUB A;  5D2A A;  2WFF 3;  5JXG A;  1OPM A;  4FPF A;  2CHH A;  3ZM8 A;  3NL1 A;  3CBN A;  2A3X A;  1NLR A;  3AZV A;  2ES3 A;  1PGL 1;  1UKG A;  1HN0 A;  1AYN 2;  3A0N A;  3WG3 A;  4E2G A;  3OGR A;  1X82 A;  1HRI 3;  4UBH A;  4Y5T A;  5FY9 A;  4LIT A;  4CDU A;  5DPN A;  1IS4 A;  3U0Z A;  4I0B A;  3PLQ A;  5FTT C;  2X53 S;  3WT3 A;  5F5A A;  2GN7 A;  1O3Q A;  2W68 A;  4CDX B;  1AX2 A;  4LBO A;  3N9Q A;  2QDN A;  5FZ3 A;  3C7H A;  2MPF A;  1Q43 A;  3EBR A;  1H4H A;  4QQ2 A;  3J7H A;  3AMM A;  1RXG A;  4AI3 A;  1OLR A;  1ND2 A;  1RUG 3;  1CGP A;  4XAA A;  1BJQ A;  4QDQ A;  3BU0 A;  5JZG A;  5AVP A;  3ZXD A;  1ZBE 2;  2F6B A;  3VBO B;  3N35 A;  4CXX A;  1WD3 A;  4L99 A;  2R04 2;  2XL7 A;  1K42 A;  1DYO A;  1GZW B;  1NCR A;  5HCF A;  3VBR B;  1ODN A;  4CEW B;  2R49 A;  3PIJ A;  4MHU A;  4D69 A;  5BNQ A;  1NE6 A;  3I2F A;  1ZRF A;  1R09 2;  1N3O A;  2VNG A;  4XFA A;  1XND A;  4Q4Y 1;  2WR9 A;  4URT A;  5FXX A;  1G7Y A;  2W1Q A;  2WBK A;  2YBP A;  1H6X A;  5FY7 A;  4CPB D;  1ACC A;  4H7M A;  4CP1 A;  4JGZ B;  4QHZ A;  2HEY F;  5E16 A;  4BK4 A;  4QM9 A;  3H1M A;  3KLS A;  3DV8 A;  1IQD C;  1L7L A;  1YRZ A;  4CDQ A;  4UI9 L;  1IPS A;  1NG0 A;  4AI9 A;  1DZQ A;  4C0H A;  1A34 A;  5CB7 A;  5DDJ 2;  1IQA A;  4YW2 A;  4NRM A;  3FLT A;  4WZC A;  4BQW A;  1RIT A;  2EAK A;  4KWJ A;  2BFU S;  1CZV A;  1C1F A;  2MEV 3;  1VR3 A;  1H30 A;  2BOJ A;  2R07 1;  2V5Y A;  4QXK A;  2RR1 1;  2FDJ A;  3CJI A;  1LEN A;  3GYD A;  3A0K A;  5F39 A;  3UKV A;  1V70 A;  2YDE A;  2OZJ A;  4M00 A;  4QQO A;  4EZ4 A;  3GAL A;  2YZ4 A;  4AED A;  3D6E A;  3IM0 A;  3LD8 A;  1DQ6 A;  3O0V A;  4WM8 A;  4GZ9 A;  1X7N A;  1VRH 2;  3QOP A;  2NP0 A;  3VHO A;  2K2S A;  3NST A;  3KCC A;  5I0D A;  3OD0 A;  4NO4 A;  3B9C A;  3POB A;  3Q8E A;  3QLQ A;  4OI1 A;  1MQT A;  4D6S A;  3MPB A;  2WSV A;  1YXW A;  3OBR A;  5F6L B;  2PHR A;  2QNK A;  3IPV B;  3JB4 C;  4HK9 A;  3K51 A;  5FZG A;  4COZ A;  1RUJ 2;  1LKN A;  1TEI A;  2Y33 A;  1W2N A;  4BK5 A;  2IVI B;  3E1F 1;  1FNZ A;  2FCV A;  2YPJ A;  1WLD A;  3I2D A;  1S0C A;  5FAX A;  2ZOE B;  1XQN A;  2E7A A;  1KFU L;  3J7L A;  3OGV A;  1B09 A;  4J1X A;  3ZSE A;  3ZYB A;  3M4F A;  1DGW A;  3TEW A;  3IKW A;  4DO0 A;  4DB5 A;  3K4A A;  3C2U A;  5FMO L;  3PJY A;  1UZV A;  2WDB A;  4E4D X;  3DKQ A;  3VBH C;  1K3I A;  2O1Q A;  4YSF A;  4QX3 A;  1RUC 3;  2D7F A;  2JEC A;  3WP3 A;  4CEY A;  3WHT A;  4AHX A;  1BBT 2;  1S0I A;  5A33 A;  2R32 A;  2ZCW A;  4Q1P A;  4IGO A;  1DHK B;  1YC6 1;  2XBO 3;  4C1X A;  2QQO A;  2V5D A;  1XE7 A;  3POW A;  4NHY A;  3TAY A;  4S2G A;  5F3G A;  4Z8B A;  4LEJ A;  1DYP A;  2QQV A;  2R30 A;  5JOX A;  2RS3 3;  3KQR A;  4YVW C;  5FWE A;  4LBM A;  3HQU A;  2IXH A;  4M4P A;  1N1Y A;  2E33 A;  2ZJC A;  2QQW A;  2HWB 3;  3FUO A;  4FP3 A;  4XJ9 A;  2Q8E A;  3VDD C;  2BPA 2;  2VVF A;  1QJX 3;  1EAH 2;  4B8E A;  1W6N A;  1PVX A;  2VCC A;  1JW6 A;  4DXS A;  5LA1 A;  3BIE A;  3BOW A;  2EXK A;  1O5L A;  3UKN A;  3WSO A;  3AMP A;  2ZML A;  1LR5 A;  3OY8 B;  4RN5 A;  1RUD 1;  4AXO A;  3JD7 1;  4BQY A;  1CWP A;  3VBU B;  1CES A;  2OYZ A;  2PLV 2;  1QGL A;  2XQR A;  1BVP 1;  4QPI C;  3RRD A;  3WLU A;  4DMI A;  5CFC B;  4TZD A;  4FPG A;  1LAJ A;  2WL1 A;  2JD4 A;  4ORF A;  5CVR A;  1UPI A;  4AWD A;  3MF9 A;  5T3N A;  5JXI A;  3PVN A;  1WW5 A;  5KXE A;  4RA0 A;  2P1B A;  4JDO A;  3RWK X;  4ZY9 A;  5LAS A;  1DQ4 A;  3W5M A;  1J3R A;  1AF9 A;  2PTM A;  2GNT A;  4HKW A;  2XR4 A;  1MEC 1;  1STM A;  3P1I A;  2NQY A;  4QHB A;  1OVS A;  1PO1 1;  2DCZ A;  2JXA A;  3DUI A;  2IXJ A;  4XAB A;  4AI2 A;  1H4G A;  5AFB A;  2GC3 A;  4WM7 C;  5DZE A;  2QQL A;  4XUT A;  2Z69 A;  5IHR A;  4LT5 A;  1QH7 A;  5LBF A;  3HBZ A;  5A6X A;  1YJL A;  3D8C A;  4YGD A;  2B9V A;  4Q4W 2;  3DN7 A;  4ZS2 A;  1ULC A;  2VOT A;  4LIU A;  4HPK A;  5H9P A;  4RS5 C;  5FY8 A;  1RUI 2;  4XF3 A;  1OUR A;  1PO2 2;  2BU9 A;  2DU1 A;  4JQT A;  5DN2 A;  2P2K A;  2KD7 A;  2RMU 1;  4CE8 A;  2JDH A;  5FP7 A;  2WS9 1;  4QB2 A;  4AQS A;  4E4H A;  3DXT A;  4JHZ A;  4RSU A;  3RYR A;  4AVS A;  4K21 A;  3HVD A;  2R06 3;  2Z2S B;  2RM2 3;  5LWB A;  1OA4 A;  2HWF 3;  1O6U A;  1XU2 A;  5AVA A;  2NLR A;  1BEV 3;  5SV8 A;  4ZZ5 A;  1V9U 3;  4CDU B;  1GNZ A;  5KHH A;  1QEX A;  1UU6 A;  5JIU A;  2CWM A;  4YM1 A;  3CF6 E;  4FQZ A;  5FZM A;  3VBF A;  4AAP A;  3VB9 A;  3TEY A;  1CAX A;  1S2K A;  3WXP A;  4NID A;  1OC1 A;  3HNM A;  3MI8 A;  4XFG A;  1CZS A;  3BOD A;  1NCQ C;  1ZZC A;  4O65 A;  1MZF A;  4LXL A;  4WVZ A;  4MGZ E;  1O4Y A;  3IDC B;  5B4N A;  1ND2 B;  1MS4 A;  3V0A A;  3OOX A;  2VMG A;  3OG2 A;  4GAZ A;  3H8O A;  4K40 A;  4NHM A;  3ZMN A;  1GOG A;  4FPJ A;  5JZG B;  1W03 A;  2WQ4 A;  2XJS A;  3WCR A;  2ZX3 A;  4YG6 A;  4FAG A;  5HXM A;  3SIS A;  1NCR B;  1RUE 1;  1BQP A;  3NV2 A;  3PUQ A;  1HV0 A;  5LY2 A;  3ENR A;  4CYD A;  2VVD A;  2D3S A;  2GNB A;  5FRE A;  1O3T A;  1REE A;  2CU5 A;  3H50 A;  2Y60 A;  4AR2 A;  2ZGN A;  4UFH A;  3B7M A;  2RVA A;  4IV1 A;  1YEW A;  4LHK A;  4GB3 1;  1J58 A;  3BTY A;  5CG9 A;  1ZRC A;  1UPS A;  3JQW A;  3VZJ A;  1LU1 A;  3OYW A;  1AX0 A;  4MXV A;  3NV1 A;  3ZN4 A;  1ULD A;  1IGO A;  4R9D A;  4CDQ B;  4CCM A;  3PUR A;  3LEG A;  1H8T A;  3NJY A;  5IK5 A;  5A32 A;  2ZEZ A;  3O12 A;  3VHR A;  3UYJ A;  3ACH A;  1RVF 3;  1DYK A;  1E5I A;  3IB3 A;  3VZO A;  4CXY A;  1NOV A;  1AXZ A;  3L9J T;  1UZZ A;  5BY5 A;  3LSD A;  3OB8 A;  3CJI B;  4XAC A;  4XTM A;  1OUS A;  4N53 A;  4Z1V A;  1D0G A;  2PHU A;  3IIA A;  3PDQ A;  2XUM A;  2XQX A;  2ZAC A;  4S2H A;  1HRV 3;  3ETP A;  4RR3 C;  4AED B;  4P9G A;  2VUL A;  1GZT A;  1ENQ A;  2E32 A;  2OQ6 A;  4HG6 B;  4K7J A;  4WM8 B;  3T4V A;  1CZT A;  2WZR 2;  4XUP A;  3CHX A;  1NUK A;  3PU3 A;  5IVY A;  4BJ0 A;  5C33 A;  1HJF A;  1RMU 1;  1K5M A;  1I9R A;  4IW3 A;  1MQT B;  3ZFE C;  1LCL A;  4IEP A;  3ACI A;  4ZON A;  1O3S A;  2VOK A;  1TQ5 A;  4OUE A;  5KHJ A;  4HZF A;  2VGD A;  4P5Y A;  5JOZ A;  5LZ6 A;  5F9T A;  4BHP A;  3Q8B A;  5FRA A;  3BYW A;  2JDK A;  1MZ6 A;  3AYA A;  1VBA 3;  1GYK A;  3U1X A;  1U5Y A;  3NKT A;  2VQT A;  2ET1 A;  3VHP A;  1V6L A;  1BCX A;  4X6R B;  2YGM A;  3BKZ A;  4AFA A;  1ASJ 1;  1C8M 2;  1OPO A;  3LZZ A;  3UV9 A;  3B3Q E;  4OI4 A;  2JIJ A;  2ZGR A;  2DCK A;  4BMB A;  1BMV 2;  2J22 A;  1U12 A;  4DIN B;  4NAO A;  1W9W A;  4K1Z A;  3WNM A;  1J1T A;  4CEY B;  2A1X A;  4LHL A;  3WDW A;  4B1M A;  4Q8K A;  4CDW C;  4LBK A;  1W8F A;  5A33 B;  2ZA9 A;  5GLW A;  1R1A 2;  3M7A A;  3VLB B;  5JLV A;  3LGR A;  1JTZ X;  1FPN 1;  1E57 A;  4KNC A;  3BTZ A;  1QJY 1;  2BUK A;  4BIF A;  2HWE 2;  1QF3 A;  1G9A A;  2KA3 A;  4OHY A;  3RZJ A;  3BN6 A;  1I6X A;  3K46 A;  5BPX A;  4LLF A;  3ZR6 A;  1W6N B;  5K8S A;  2ZGO A;  3WD5 A;  1GZ9 A;  2VOX A;  3CEW A;  5CYY A;  2YC2 A;  1PVC 1;  1UIJ A;  1H2M A;  3AX4 A;  2C9A A;  3VUO A;  2ZGS A;  3ZSL A;  3GZE A;  4BQ5 A;  5FUP A;  2VCB A;  4XDQ A;  4CU6 A;  4FVV A;  1XYP A;  4Y1Y A;  4Q4X 3;  2HWD 3;  2GU9 A;  5APA A;  5T5P A;  1PNG A;  1VMJ A;  3W21 A;  5F5C A;  3SH5 A;  3IDE A;  1UZW A;  2BWC A;  1TMF 3;  1XNA A;  3FL7 A;  2DFC A;  1V6M A;  1L7Q A;  4IEY A;  3NW4 A;  5FWJ A;  1AR8 1;  4FOW A;  1RYY A;  5A70 A;  2ID4 A;  1UO9 A;  4QPG C;  4L9B A;  5GJ6 A;  2ZBJ A;  4N7U A;  2RE9 A;  4Q0U A;  4NIH A;  4QXC A;  4K8R B;  4I3G A;  2FQP A;  1KIT A;  1KJL A;  2TNF A;  3CDZ B;  5EJ1 B;  1R08 1;  3U4S A;  3WR0 A;  1TNR A;  3SEE A;  2A6W A;  3POF A;  4FP2 A;  4HPK B;  5DZF A;  1VMH A;  3IWZ A;  4YFW A;  2VZT A;  1VBB 2;  3JB8 A;  5A3W A;  1JYC A;  3U4X A;  5EP9 A;  2IC1 A;  1H2L A;  1PMJ X;  3MGU A;  1E5S A;  2W9X A;  4OYU A;  4UAP A;  2KM2 A;  5I0R A;  1OOP A;  1VAK A;  5FZ6 A;  1U0A A;  4HSL A;  2CGO A;  3AP5 A;  5ERL A;  4GWI A;  2BW8 A;  2JE7 A;  4IER A;  2HBT A;  2C5D A;  2WLP A;  2D6P A;  4ES8 A;  4YWA A;  1EY2 A;  1W6M A;  4B4P A;  3VBF B;  3MUY 1;  5DG2 A;  2WFF 1;  2R6Q A;  2R1D A;  1CAX B;  1PZ9 A;  3RWN A;  1DLC A;  4R9C A;  1PHM A;  5KWR A;  1JZ5 A;  3ZYR A;  2A3W A;  3IZO A;  5DG1 A;  2RS1 2;  4XPV A;  1GUI A;  3SXW A;  2Q30 A;  1HRI 1;  4QM8 A;  5B2G B;  3V0A B;  4IEU A;  2JIC A;  5KXB A;  4IXL A;  5DAQ A;  1VRB A;  2DUO A;  3R0R A;  5A1A A;  1VBD 3;  5E8A A;  4A3Z A;  3A22 A;  4R52 A;  4I30 A;  1W04 A;  1AYM 3;  3APB A;  3WDT A;  4YFZ A;  2GN3 A;  1GQH A;  1RXF A;  2DVF A;  5EYY A;  5IAX A;  2I07 B;  2X5I C;  1IPJ A;  1JZ2 A;  1JHN A;  1RUG 1;  5EFU A;  1OLM E;  4IV1 B;  4DXR A;  5ACA 2;  1AR6 3;  4YVW A;  2VQ0 A;  5K9Y A;  1G6N A;  3AXD A;  1FMD 2;  3DL3 A;  1VBC 2;  3OYW B;  4ES9 A;  3MO4 A;  3ABZ A;  3VDD A;  4PT6 A;  1LNS A;  1W05 A;  3OGS A;  4CZS A;  4E4Z A;  3LEI A;  4NRP A;  5B4X A;  4NOT A;  1H8T B;  4DPN A;  1LUL A;  5A32 B;  4V2V A;  4KU8 A;  4XDO A;  1CQ9 A;  4QKF A;  4XYX A;  1VB2 A;  1VPH A;  1XNK A;  3RYP A;  1KFX L;  4D7T A;  2W91 A;  1X9P A;  4QPI A;  1PMI A;  1HXS 3;  1SQ4 A;  4N53 B;  2DCY A;  1CJP A;  3VD3 A;  3VDC A;  2VBB A;  1Z78 A;  3MDP A;  3GNE A;  4L0P A;  4FPK A;  4YZ3 A;  5C3P A;  2ENR A;  4QGN A;  4UYB A;  2RS5 3;  4IEX A;  4AVB A;  2VY0 A;  4W6X A;  2MEV 1;  4B4Q A;  4IL7 A;  3LDK A;  5L73 A;  4XJ8 A;  1K5M B;  1LHU A;  1FNY A;  2XJT A;  1TME 2;  4LKF A;  1WKY A;  3E6D A;  5C6C A;  4E4S A;  3CNA A;  2EF6 A;  4YLZ A;  3TEZ A;  2C9K A;  3JBG 3;  2VUC A;  2LS6 A;  3RJ2 X;  3NQH A;  5CFD C;  1OI6 A;  4FCA A;  3WVJ A;  1US3 A;  2R0F A;  3I7D A;  2NM1 A;  2D3R A;  3HD8 B;  1IG3 A;  3INA A;  4Y4R A;  4QGM A;  5C3O A;  1QOT A;  2BWA A;  3D3A A;  1V6J A;  4W6W A;  4D6R A;  3I2H A;  1SLT A;  1JYN A;  2GP5 A;  3BTX A;  2BGC A;  3J7N A;  1PK6 A;  4UF0 A;  4PI0 A;  4XC9 A;  4XXP A;  4BYY A;  3W5N A;  4ATF A;  1RUF 2;  3WF2 A;  5D21 A;  3ZIX A;  1AL2 2;  4JTN A;  5T52 A;  3I2O A;  3AKT A;  3BU7 A;  3KV4 A;  4JC1 A;  2PAM A;  5ABJ A;  1Q8Q A;  2YC4 A;  2QVS B;  3B69 A;  1DFQ A;  3NMB A;  3MIF A;  2JKB A;  1CR7 A;  1Y9M A;  1UY4 A;  5EWS A;  4UWD A;  5IVV A;  3FBM A;  4XMI A;  3AXE A;  5F2W A;  5FQ0 A;  2DVA A;  1UCX A;  5I8S A;  1WBF A;  1RUC 1;  3WP4 A;  4R9B A;  3OBA A;  5FBZ A;  1WCD J;  1FOD 2;  4M0N A;  2DUP A;  1E5R A;  1PMH X;  1YCI A;  3MFA A;  4LKD A;  2H0B A;  4FT8 A;  2AEZ A;  3GZU C;  4ISQ A;  2CV6 A;  4WZF A;  5FZF A;  4CU9 A;  1HQW A;  5A7O A;  3D0S A;  4I0W B;  1COV 3;  4F83 A;  4XFI A;  5FZI A;  2XBO 1;  3ZYH A;  3RG0 A;  3H3U A;  2QDR A;  3AMN A;  2R16 A;  3PIG A;  3VKO A;  3LDR A;  3RZZ A;  5FXV A;  2RS3 1;  1RUH 2;  3H0O A;  3MIH A;  1QHD A;  2CY6 A;  2YV8 A;  2DV9 A;  4LHS A;  3ZXG A;  5JVV A;  3VZL A;  5CAZ A;  1X50 A;  2HWB 1;  4QAW A;  2VW2 A;  3UK9 A;  4KI5 M;  1QJX 1;  1N3P A;  1E5H A;  1UL9 A;  2DBN A;  2PA7 A;  4GMP 0;  3VL9 A;  4WVW A;  2ORX A;  4XZU G;  4QT6 A;  1C5H A;  4I2O A;  5FZ1 A;  2BER A;  4XF1 A;  3GXU A;  4YW6 A;  1PZ8 A;  2DDU A;  4K3U A;  2ZAA A;  1AR9 3;  4ISR A;  4LUM A;  5CA6 A;  1PGL 2;  4MSV A;  5D1I A;  2IVJ A;  4QPW A;  5JXH A;  2Q8C A;  4COU A;  4FFH A;  2XWB B;  1W8T A;  5FLJ A;  5D8A C;  1A78 A;  1GKB A;  1GWK A;  1EV1 3;  4GAL A;  1S55 A;  1VE0 A;  4A7K A;  4DUX A;  3CMG A;  1KGY A;  1T6G C;  2E26 A;  3QCW A;  1OQ1 A;  1WLW A;  3S7E A;  2NMO A;  3OBZ A;  4DRV A;  4YM0 A;  2YB7 A;  3K3O A;  1NT0 A;  2XKP A;  5H9R A;  2GDF A;  2R0H A;  3H42 B;  2PMW B;  2R7E B;  3N7J A;  2ZMN A;  2ZGM A;  1CX1 A;  1OOP B;  3OUH A;  4AF9 A;  5GZD A;  3ZFE A;  4DUV A;  1GIC A;  2WAO A;  3H8X A;  5FZA A;  2GC1 A;  2JDP A;  1VB4 A;  1NKG A;  3PUS A;  4IEV A;  4JDM A;  1IOA A;  1NLS A;  4XDP A;  1W6M B;  4A2U A;  4XZP A;  1Y3T A;  1G9C A;  4R4X A;  5CIS A;  1QQP 3;  4Q4Y 2;  1W6P A;  1C57 A;  5KBF A;  4W8J A;  3AC0 A;  5E6H A;  4ET7 A;  5FOJ B;  2FMY A;  1W0N A;  2VZS A;  4KMQ A;  1XXN A;  2R06 1;  1OHF A;  4HVR A;  1MZ5 A;  2RM2 1;  4J1W A;  2HWF 1;  1BEV 1;  1RGS A;  1V9U 1;  4FPE A;  3VZK A;  4U36 A;  3MZH A;  1SFP A;  4PDW C;  4MGK E;  4EV0 A;  5F3I A;  4W50 A;  5FZ7 A;  1QU0 A;  5T50 A;  3MID A;  3R4D B;  2CDP A;  5C71 A;  1GBG A;  2B39 A;  2Y38 A;  1QXP A;  5JI7 A;  3WW3 A;  3RZH A;  2GMP A;  1C3H A;  4CDW A;  4BDV B;  2N7G A;  5KHG A;  2R07 2;  3OCP A;  1LHN A;  2RR1 2;  5C70 A;  4PLO A;  4Q26 A;  4V2W A;  5BNP C;  1KXG A;  2VNR A;  2J1A A;  4UT5 A;  1Y4W A;  3ZDV A;  4BPZ A;  1UOJ A;  3M3I A;  4GXL A;  3KT4 A;  2ZXQ A;  4C91 A;  3FFQ A;  4IEO A;  4YVW B;  3ZFG A;  4FPO B;  4BB3 A;  4OMD A;  3VDD B;  4CA9 A;  4Z07 A;  2BRT A;  5IAV A;  3ZR5 A;  3EYP A;  1W3X A;  4KG8 A;  3N9N A;  2FHR A;  4IDZ A;  2Q8O A;  1W06 A;  1WW6 A;  4XW3 A;  3ZYJ B;  1RHI 3;  1SEF A;  1ZNP A;  5FLH A;  2LTN A;  1BZW A;  1AHS A;  2QQM A;  3CJX A;  1KDM A;  3I2K A;  4LE4 A;  4QPI B;  2A6Y A;  1UOF A;  1AVB A;  5FO7 B;  5FY1 A;  3RGB A;  1LED A;  3RZG A;  4HT1 T;  2VCM A;  2FMD A;  2O8Q A;  3SH4 A;  1UY1 A;  4K6B A;  2H0V A;  5FPL A;  1B35 A;  1WMF A;  1QDO A;  1RVF 1;  3N9P A;  4HFS A;  1RTV A;  4J6G A;  5L7O C;  4Y26 A;  3KGL A;  1OKQ A;  2HWC 3;  3TOJ A;  4HAN A;  1H8V A;  4RQP A;  2VZ3 A;  2P4E A;  3C7E A;  4RHV 3;  5I8T A;  1A8M A;  3GBW A;  1O4T A;  5A6Y A;  2FDK A;  4QPG A;  4ZXE A;  3OPZ A;  4ASL A;  1HRV 1;  4BQX A;  3THC A;  2VXJ A;  3VD7 A;  5BNN C;  2VOV A;  4LBQ D;  1AJK A;  1WME A;  2GND A;  4E2Q A;  3BGA A;  4HN0 A;  1JU4 A;  2BV4 A;  4XJU A;  1UU4 A;  4YW3 A;  2JD9 A;  1GP6 A;  4FOV A;  3LSE A;  3PUI A;  3ZXF A;  4UFI A;  3VDB A;  1W9Y A;  5A7S A;  2KXL A;  5LK5 A;  3WIN E;  3ILR A;  2A71 A;  3P3N A;  2ZGT A;  4G3Y C;  1NA1 C;  2P3J A;  2D97 A;  2E6V A;  5J98 B;  5C3S A;  2Q4S A;  4RGK A;  3III A;  5FLI A;  1PK6 B;  1Q5O A;  1SLL A;  4UF0 B;  4JVA A;  2J1U A;  5JMO A;  4NJ4 A;  1YQ2 A;  2WAB A;  3JXS A;  2XJR A;  5IVF A;  4XFB A;  2JDA A;  4AGR A;  1HB2 A;  2W92 A;  1XRU A;  1LRH A;  1PIV 3;  1RUD 2;  2X29 A;  3JD7 2;  3HNY M;  2QZ3 A;  2DUR A;  3IDA A;  4CCO A;  1VBA 1;  5ABJ B;  5IK7 A;  4DXT A;  1YFW A;  3TB0 A;  3T08 A;  3WHU A;  4CP0 A;  1Z7S 3;  1T2X A;  2BFU L;  5T55 A;  1LOG A;  4UOJ A;  4BWO A;  3HEI A;  3WNX A;  3AZW A;  2RDR A;  1KD7 A;  1DLL A;  2AZ5 A;  5FQ0 B;  3P5B A;  5KHK A;  1JI6 A;  1WA4 A;  3H7J A;  1UXZ A;  4NIG A;  1AR7 3;  3RZK A;  2QKD A;  1MEC 2;  1H9W A;  4NUB A;  3NO8 A;  2Q8D A;  1GFF 2;  1PO1 2;  3WDX A;  5GLV A;  3SKJ E;  3AL5 A;  3N9L A;  1V00 A;  2Q5T A;  5JXJ A;  3K3N A;  3CLP A;  5J09 A;  2AC1 A;  1SLB A;  3NNJ A;  4LA3 A;  5FCC A;  5FPU A;  3KWV A;  4AQT A;  2WO1 A;  4BXS V;  2DCT A;  3TBD A;  3ZFF C;  3LKJ A;  2X5I A;  4NHL A;  2RDQ A;  4QMA A;  2DTY A;  5EJZ B;  4GH4 A;  4MHR A;  4BM8 A;  2PHT A;  1MZE A;  2P6C A;  5FY5 A;  2RMU 2;  4RD7 A;  2VBP A;  3VBS C;  2WS9 2;  4N43 C;  5FO8 B;  1XOY A;  3S57 A;  3SNM A;  3AZX A;  2EIG A;  4J25 A;  3A21 A;  1EP0 A;  3Q8C A;  2P3I A;  3BCW A;  2E31 A;  1N47 A;  2JDU A;  2HWD 1;  4LBJ A;  4P00 B;  1OFN A;  4Q4X 1;  3TN9 3;  4Y22 A;  1HW5 A;  4YGC A;  1RJ7 A;  2VPV A;  4CSW A;  4DRR A;  5FZ4 A;  3T0D A;  3N7L A;  4LO7 A;  3PHM A;  3OUJ A;  1QJE A;  4N7I A;  4Q0Q A;  4UFK A;  4TXW A;  3SKV A;  3WQ0 A;  4ARX A;  1ULP A;  4EN8 B;  4JKM A;  4N8M A;  1RUN A;  1TMF 1;  2YC0 A;  3ILN A;  4Z2A A;  4CPB A;  1A3K A;  1ZX5 A;  4IGQ A;  1I5P A;  5F8P A;  2G4I A;  5FKC A;  3QH7 A;  3AP7 A;  4IES A;  5IVB A;  4QGL A;  4CXW A;  4ZXK A;  4KGG A;  2HYK A;  2JE8 A;  4JGY C;  4P5H A;  2B9U A;  5FY0 A;  5F7U A;  4AGV A;  3A7Q A;  2DFB A;  2VMH A;  3M3E A;  3ZFE B;  4M3C E;  4KBB A;  3O14 A;  4ARY A;  1RUE 2;  4MVT A;  2Q1F A;  2QQJ A;  1Q8O A;  4NPM A;  4XF4 A;  1IKP A;  2E9Q A;  4PF1 A;  2ZGQ A;  5JOW A;  3T09 A;  1HDK A;  4QWN A;  5L9B A;  2ADE A;  4N9I A;  5FZK A;  1VIW B;  5CFD A;  1W6P B;  4GUL A;  4GB3 2;  2HBU A;  3Q8F A;  1ZBA 3;  5CZK A;  4CDX C;  1ENR A;  4P9J A;  4CCN A;  3LFM A;  1JOB A;  1YQ8 A;  2NMN A;  4XF9 A;  5K0U C;  5F5I A;  5HCB A;  3BOP A;  2YG0 A;  1IS3 A;  1JHJ A;  2WQZ C;  2VH9 A;  4F7Z A;  5A3L A;  5JR2 A;  2IFW A;  4R8H A;  3VZN A;  4EN7 B;  3VBO C;  1NZC A;  3NJV A;  4CDW B;  2DWR A;  1ZRE A;  2G9G A;  3EXU A;  4UFM A;  1F2N A;  2CYF A;  3LWC A;  5I0T A;  1PX3 A;  2D6M A;  3LAG A;  4Q4V 3;  1JYI A;  4DEV A;  2D40 A;  1YWK A;  3CL1 A;  4XCB A;  1VBD 1;  5EZW A;  1W9T A;  3M2M A;  1LGC A;  3ZFG B;  1X8E A;  1AYM 1;  1SLC A;  2DF7 A;  1CN1 A;  2ZGL A;  3C7F A;  1UIK A;  3VDA A;  1GMM A;  2YU1 A;  3G7D A;  4B4R A;  1QJU 3;  4JGZ C;  5LCW L;  1UXX X;  3FWE A;  1YYN A;  1RMU 2;  3MYX A;  4Y5S A;  3V56 A;  3ZXA C;  1XPW A;  2DTW A;  3ASI A;  1BKZ A;  4W65 A;  2ILM A;  3K77 A;  3A23 A;  3I3D A;  5FYC A;  4YW7 A;  1VMF A;  2QTW B;  1AR6 1;  2OUH A;  2OXB A;  2WKK A;  3BAL A;  1Q3E A;  2D98 A;  5I0U A;  5L19 A;  1CAW A;  1V0A A;  4QXH A;  3DYP A;  1R1Z A;  1PM7 A;  5IFP A;  2G9Z A;  3R4U A;  4Q8L A;  4IEW A;  1FX5 A;  1QOS A;  3DPR A;  4LUL A;  1JS9 A;  5GKA C;  1D4V B;  1ENS A;  2ADD A;  2WWU A;  1B35 B;  3WNP A;  3USU A;  2Q0A A;  3WW2 A;  1ASJ 2;  2IXC A;  3EMR A;  1DQ5 A;  1OBN A;  4PBO A;  1DF0 A;  5LBC A;  2VQU A;  2FBE A;  4RQP B;  5ANN A;  1J84 A;  5L9R A;  1K45 A;  3GHM A;  1HXS 1;  3MFC A;  4CP2 A;  1WBL A;  3ES1 A;  3H1Y A;  1AX1 A;  1DZR A;  1SFN A;  3MEP A;  3FLR A;  4QPG B;  1OT5 A;  1FYU A;  2BQP A;  1VBE 3;  2D44 A;  4AZZ A;  1UYY A;  5FZO A;  2BJS A;  2Y8K A;  4HKL A;  4KL1 A;  5LK7 B;  1D4M 3;  1IS5 A;  2RS5 1;  2XVG A;  2QUO A;  2VTX J;  1FPN 2;  1HB3 A;  4Q0P A;  5M0T A;  3I3E A;  3OPW A;  3VHN A;  4EYU A;  1QJY 2;  3IMM A;  4UW4 A;  2PYT A;  3ZO0 B;  3N3H A;  2PHF A;  1W8O A;  4GWJ A;  5E88 A;  5C8C C;  3JBG 1;  3URF A;  2DUQ A;  4NR1 A;  3VKM A;  1J59 A;  5FYU A;  1DGR A;  1PVC 2;  3KZ4 C;  3ECQ A;  5FP4 A;  3CO2 A;  2X8K A;  4MGI E;  1KEX A;  1LOE A;  1NE4 A;  1POV 0;  3H8R A;  2NYY A;  4ZHN A;  3HT2 A;  1ULE A;  4A41 A;  3PMS A;  1OVP A;  5A1F A;  1UYX A;  1JBC A;  1CIW A;  1N3Q A;  1PGW 1;  3J8F 3;  2CDO A;  2PHX A;  3PTR B;  4QX0 A;  4ZU7 A;  1JOD A;  2JG9 C;  2VTF A;  5FYT A;  3JUU A;  4BIO A;  2VMD A;  5BNO C;  4U2A A;  3ZYG A;  4Z2W A;  2VUA A;  3UJQ A;  4Y5Z 0;  2QQN A;  2WYF A;  1H2K A;  4TN7 A;  5JI9 A;  1OF4 A;  5EXO A;  4XQD A;  3SCH A;  2RJ2 A;  3AB0 A;  2EIE A;  4H14 A;  4PDW A;  3UGH A;  4G4F A;  3WF1 A;  1V6N A;  1AR8 2;  3ZVX A;  4CUC A;  4Q27 A;  2GMM A;  4EWA A;  1QH6 A;  1ZRD A;  5JCT A;  2JG8 C;  2WT0 A;  2DU0 A;  4FOQ A;  2Z79 A;  1GNY A;  2ZHN A;  2UY8 A;  5FYH A;  3AL6 A;  2ZHL A;  1R08 2;  1D2S A;  1JXN A;  2BNO A;  2X5I B;  4Y1X A;  5DUX A;  3VBU C;  4EZH A;  1NY7 1;  3FHA A;  3ST7 A;  4BQ1 A;  5BNP A;  4GH4 B;  3E5X A;  1WLT A;  1COV 1;  3RVH A;  1GZC A;  4HOO A;  5CNA A;  4JKK A;  2ARA A;  3NNF A;  4XUN A;  4ASK A;  2EXH A;  2YUE A;  2OS2 A;  4SLI A;  4YRD A;  1F4A A;  4Q29 A;  5FKB A;  4YGB A;  1ZZ9 A;  3ACF A;  3WOG A;  3LQC A;  4Q0S A;  3O1S A;  1QOO A;  5KC5 A;  5FIX A;  4XEZ A;  3BI3 A;  2JWP A;  1LEM A;  1LOF C;  3B93 A;  4Y22 B;  1ULO A;  4TYS A;  2RJK A;  2Y6G A;  4KG0 A;  4XMA A;  1FXZ A;  5FBJ A;  3I2I A;  1AYN 3;  3S30 A;  1UKR A;  3IN9 A;  2WFF 2;  4UXA A;  1URX A;  1L3J A;  2WZP P;  1AR9 1;  2YBS A;  5DAB A;  5FUN A;  4AFB A;  4Z92 B;  2JJ6 A;  1O8P A;  2WJS A;  3AVR A;  1H1M A;  4XVH A;  2VW0 A;  1F31 A;  1HRI 2;  1RC6 A;  4YYO A;  2Y6K A;  1XJA A;  4IE7 A;  5L7O A;  1EV1 1;  1DGW X;  1G9F A;  1POQ A;  4WBB A;  3HBK A;  4Y20 A;  3ZXJ A;  3O1R A;  4FOY A;  1BVV A;  3KM5 A;  4Y1Z A;  3NJX A;  1ZZ7 A;  5LBB A;  5A7N A;  3AM2 A;  1NQD A;  3WQB A;  1ZBE 3;  1YQ6 A;  2J1V A;  4DFS A;  5BNN A;  4LNV A;  2WNO A;  2FZ2 A;  3LOI A;  2R04 3;  5EHD A;  3ZN5 A;  4CDU C;  5CFD B;  4YZ1 A;  2FDI A;  1OQE A;  2ZHM A;  4LBL A;  2DVD A;  5LBE A;  3ZMO A;  1HKD A;  1RUG 2;  1XE8 A;  2XGX A;  3KGZ A;  1LGB A;  3MW3 A;  2YYO A;  4FSJ A;  1OLQ A;  2YPD A;  4HVQ A;  5A3P A;  1R09 3;  5T5L A;  1LHW A;  1ZA7 A;  2J7M A;  3KCX A;  4S2D A;  3KT7 A;  1NA1 A;  1S0J A;  4HON A;  5C9A C;  4NN0 A;  1ULG A;  1OD3 A;  1HQN A;  1UMH A;  4AG4 A;  2BBV A;  3Q8A A;  4OI2 A;  1OH3 A;  2W87 A;  3VL8 A;  1NZI A;  1YIF A;  3NJZ A;  3NVC A;  4AI8 A;  1ND2 C;  3LCP A;  1QQP 1;  5HPO A;  1CX4 A;  1MS1 A;  1UX6 A;  4C1W A;  1MVE A;  4Y4Y A;  2BZD A;  2WZE A;  2E63 A;  3RSJ A;  5DDJ 3;  2E51 A;  3I49 A;  1NCR C;  2VW1 A;  3LEK A;  2WA3 A;  2ZTN A;  2ZGK A;  4ZPI A;  3WNK A;  3JU9 A;  1HB1 A;  3Q9O A;  1H6Y A;  1REF A;  4PIX A;  3UGF A;  4FFG A;  2G19 A;  1YHF A;  2VJX A;  1AL0 G;  2W1W A;  1H9P A;  2MEV 2;  4FPY A;  4YG0 A;  3K2O A;  1W2A X;  4OVE A;  1JZ3 A;  1VRH 3;  1Z0H A;  4XUQ A;  3ZSK A;  1XYO A;  1UW8 A;  3IBM A;  1UX7 A;  3FHQ A;  1XB9 A;  4IE6 A;  4GKY A;  4BXF A;  4DS0 A;  4O9E A;  2ARB A;  1CAW B;  1SG3 A;  4NRQ A;  1MS9 A;  2XXZ A;  4F3J A;  1WMX A;  2OKX A;  4HVO A;  1LGN A;  1RUJ 3;  4KWK A;  3MUZ 1;  4Q5O A;  5C7G A;  1SBE A;  2VAU A;  2YMZ A;  4PIY A;  2BEO A;  4XBQ A;  3HQX A;  4XF0 A;  3T2T A;  2PXJ A;  4BQ3 A;  3DPR B;  2VZQ A;  2X05 A;  3LDB A;  3VBS A;  3VBH A;  1NAE A;  3JQX A;  2AGS A;  3OSD A;  4JKL A;  2C1F A;  1RHI 1;  2BTV C;  2YGL A;  4LO8 A;  4N43 A;  3USU B;  4A6S A;  4AED C;  3A4U A;  4HKO A;  5JSO A;  2FZ1 A;  1H2N A;  5C8W A;  2LAL A;  1TZO A;  1XYN A;  1CPN A;  2BNM A;  3UES A;  3S0M A;  4XTP A;  2VZP A;  2PHL A;  2J1E A;  4MZU A;  4QX8 A;  1YQC A;  4NPR A;  4AEK A;  4HSJ A;  4ZZ8 A;  2O0O A;  3ZIW A;  2VR4 A;  5HCH A;  5FZO B;  2LRO A;  3ZYI B;  4IE5 A;  3N9O A;  2P34 A;  4A45 A;  5F1R A;  1BBT 3;  1ZZB A;  2ZGU A;  1W6O A;  4LO4 B;  2HWC 1;  4MGQ A;  5FP9 A;  3E6C C;  3VGI A;  2TBV A;  1ZYB A;  3OGJ A;  4RHV 1;  5FZ0 A;  1RUC 2;  4XJW A;  3POE A;  3USS A;  3ZXK A;  3DEM A;  5GLT A;  4ATE A;  3KVA A;  1LOC A;  3AFG A;  3M1H A;  5LAT A;  4COV A;  4EWE A;  4L2N A;  4OQ8 A;  3HMY A;  1U5X A;  1O7F A;  1S0G A;  2CTV A;  2ZEY A;  3HNB M;  2IXI A;  3K4Z A;  3UNP A;  4JGY A;  2XBO 2;  3MLJ A;  2UYB A;  1G8W A;  1EAH 3;  4GMP 3;  1JUH A;  3WY6 A;  3J7M A;  2GP3 A;  2RS3 2;  1JOP A;  2PQS A;  3THT A;  1VJ2 A;  1OH4 A;  2VZR A;  2WZ8 A;  2ZX2 A;  1QKQ A;  3ZX7 A;  3AK0 A;  2BDR A;  2LW8 A;  2HWB 2;  3THD A;  1QJX 2;  4LMF A;  1OSG A;  1JZ6 A;  2PLV 3;  2W3J A;  3U11 A;  5FZH A;  2P3Y A;  4TLG A;  1VAM A;  5CIR A;  4YGE A;  4N9H A;  4QQP A;  3BB6 A;  2A73 B;  5I8Y A;  2A6X A;  4MOA A;  4B1L A;  1PIV 1;  4RL7 A;  3K4D A;  4WM7 A;  1WZX A;  3RS6 A;  3SCG A;  2XKO A;  4B29 A;  1NXD 1;  5K0U A;  4LK6 A;  4AHW A;  2VZU A;  1MAC A;  4PDW B;  1Z7S 1;  2DBI A;  4GJY A;  5F3C A;  5J1X A;  4CTE A;  3U10 A;  3OBT A;  4RS5 A;  5GAL A;  3ACL A;  1QDC A;  3T3Y A;  3OUI A;  1P8J A;  1GU3 A;  2EAA A;  3MW2 A;  5C4W C;  4COY A;  3T4H B;  5F3E A;  2OVU A;  1AR7 1;  2VZO A;  5BNP B;  3GDB A;  3NAP C;  1CON A;  5F5Q A;  2IFR A;  2WNE A;  1SCS A;  4Q4W 3;  2A5Z A;  4MGS A;  3RQ0 A;  1ND3 C;  4WVM A;  1XNB A;  4K8F A;  4QDR A;  1RUI 3;  2VC9 A;  3VN4 A;  1J3Q A;  1PO2 3;  4YZ5 A;  3ZDS A;  1PNF A;  1BLZ A;  1UQX A;  3O0X A;  1BK0 A;  4BU2 A;  2B42 B;  2BYV E;  2CWS A;  3WF4 A;  1V6K A;  1JMU B;  4A4A A;  4F8A A;  2FDH A;  3GBG A;  2V4V A;  5ISL A;  4GWN A;  4PCR A;  3G6J B;  1NCQ A;  2C26 A;  4X6Q B;  2FD8 A;  1KJR A;  4AI0 A;  4BH9 A;  4D8M A;  4FBF A;  3J4U H;  1IHM A;  5DUW A;  2J1S A;  2PHW A;  4I01 A;  4QXB A;  3AP4 A;  3NV4 A;  5DUV A;  1AXY A;  1C1L A;  2R06 2;  4M4R A;  4R4Z A;  1YUD A;  2RM2 2;  4XUR A;  3T0B A;  2HWF 2;  5FYZ A;  3TN9 1;  5AC9 1;  1OF3 A;  3VKF C;  1BEV 2;  2RJL A;  1V9U 2;  3L2Y A;  5DAW A;  5FJK A;  1QNW A;  1C8N A;  1S0E A;  5L7O B;  4L8Q A;  4KWL A;  2VUD A;  2QQK A;  4Y20 B;  3T0A A;  5LB6 A;  2E7T A;  1CD3 G;  3LE0 A;  4E9K A;  2CAV A;  3KSC A;  4QU1 A;  2VCA A;  2B45 X;  5FZD A;  5A3U A;  1RUO A;  4PHZ A;  5BNN B;  2RV9 A;  2ET7 A;  1VAL A;  3BPZ A;  3O5S A;  3I59 A;  2EID A;  2QQU A;  5IUQ A;  3HOB A;  3B02 A;  4OMC A;  1DDL A;  3VBF C;  4IV3 C;  5GM0 A;  3OEA A;  1CJD A;  4N90 A;  4AFM A;  4QB1 A;  2XL9 A;  1R64 A;  3GBF A;  3VKL A;  4YZ4 A;  4R9A A;  2A6Z A;  5FO9 B;  1NA1 B;  2ETE A;  3GF6 A;  2A75 A;  1HB4 A;  1XU1 A;  2ZAB A;  3ORJ A;  4AFC A;  5C8C A;  3N4M A;  2ATF A;  5IVJ A;  3H1W A;  3UKT A;  3TNP B;  1D2Q A;  2W0X A;  2UWC A;  2YY1 A;  1SBD A;  3K75 B;  4LOR A;  5A7Q A;  4AQ2 A;  4CUG A;  4C90 A;  2QJV A;  4AEJ A;  5A6Z A;  2Y26 A;  2P17 A;  1ZBA 1;  5HXV A;  5KXD A;  5A1L A;  2W95 A;  4RR3 A;  1Q8V A;  3W58 A;  4OUS A;  5FY4 A;  1PX4 A;  5A7W A;  4BIS A;  3HPN A;  1NX9 A;  4XUO A;  2AUY A;  1G86 A;  5IFT A;  3KHC A;  1H1I A;  1MS8 A;  2JG9 A;  2PN5 A;  4QX5 A;  3WZ1 A;  4AL9 A;  5BNO A;  5IYY A;  3J9S A;  1WGP A;  4IV1 C;  1RVF 2;  3JZV A;  4ZU4 A;  2P37 A;  4MGY E;  2C4X A;  4Y33 A;  2HH9 A;  1QWR A;  3DYO A;  5FFO C;  1J83 A;  2C6S A;  2ZKL A;  4PI2 A;  4H2A A;  4EE2 A;  2V72 A;  1NQJ A;  2WO7 A;  2WZR 3;  3U14 A;  3ZOI A;  4Q4V 1;  1HRV 2;  2JG8 A;  1W99 A;  4ZS3 A;  4EWD A;  1WW4 A;  2XWJ B;  3U75 A;  1AL2 1;  4XIL A;  5J7M A;  5C3Q A;  1DQ1 A;  1LB2 A;  4FTS A;  4ZU5 A;  2AEN A;  4NVP A;  2JB8 A;  2ZMK A;  4HLT A;  3H8U A;  3ZSJ A;  1QJU 1;  4JAA A;  1EPW A;  3POS A;  4ITC A;  4AEM A;  5CG8 A;  2ZGP A;  2BGP A;  2F4P A;  4MO3 M;  4N53 C;  4QX7 A;  3VBH B;  3VBS B;  5JUV A;  2D5F A;  4N43 B;  4CVU A;  3GHN A;  2PAK A;  4MV2 A;  1WD4 A;  2A7A A;  1GR3 A;  1TVG A;  2I2S A;  3AKQ A;  4YVS C;  4OZO A;  3WW1 A;  1KRI A;  5FK7 A;  4OI0 A;  4XOG A;  1C8M 3;  1WWY A;  3SC7 X;  5HI0 A;  2QQP A;  3FLP A;  4B3N A;  1IS6 A;  2W08 A;  2ZAH A;  2VUJ A;  3POY A;  4YW1 A;  4DIQ A;  5DXD A;  4DNY A;  1LOF A;  3VD9 A;  2VOW A;  1VBA 2;  2BNN A;  2IZW A;  2XH6 A;  3ON7 A;  2ZX0 A;  1XNC A;  1UZ0 A;  1DU3 D;  3RFR A;  4QQH A;  3AZZ A;  4IQP A;  5FZL A;  1O59 A;  1Y9G A;  4EN6 B;  3I3B A;  1ZRR A;  4M01 A;  1W6O B;  2WAA A;  2VZV A;  4I09 A;  3KV6 A;  4YM2 A;  1R1A 3;  4XBL A;  3VZM A;  5J36 A;  2QE3 A;  3LA7 A;  1RED A;  2X10 A;  1AZD A;  2WNU C;  2ZS6 B;  3KVB A;  2VVE A;  3TWI A;  4WV8 A;  4E27 A;  1LHV A;  2OX0 A;  5J96 B;  3SCF A;  1OD5 A;  4UFJ A;  1VBE 1;  4P9Y A;  4QU2 A;  4QQL A;  2HWE 3;  2HJI A;  4JGY B;  2IWG B;  2Y34 A;  3HR9 A;  4FI9 A;  4H7L A;  5FZC A;  2AEY A;  4NIA A;  1D4M 1;  1XC6 A;  3F95 A;  2ZPX A;  4JTO A;  4MYE A;  5FPB A;  5EPA A;  2AR6 A;  4GWM A;  1YJK A;  5JPM B;  2V4A A;  1YO8 A;  5FZB A;  3ZN6 A;  5C3R A;  1HLC A;  5T5O A;  2FDF A;  3CQO A;  4MGT A;  1FV3 A;  4ASM B;  1XNT A;  4YW4 A;  3MF6 A;  1DG6 A;  1IPK A;  2OZ6 A;  3KCY A;  4PQ9 A;  1JYW A;  2E53 A;  3WNO A;  4HXC A;  4XIK A;  1OA2 A;  5C9A A;  2EXI A;  4WM7 B;  3R6S A;  1X9T A;  3WCS A;  1NLQ A;  1GOF A;  1W0O A;  2C0Z A;  3EB7 A;  4FO9 A;  5C5T A;  5K0U B;  3T2Q A;  4QD2 A;  2UYA A;  1F35 A;  1LJ7 A;  2VE1 A;  1AXK A;  3U37 A;  4AOC A;  4AVA A;  4Q4X 2;  2HWD 2;  2ZHK A;  3I54 A;  3J8F 1;  5GZF A;  1FT9 A;  1RJ8 A;  3VD4 A;  2XOM A;  3GZT B;  3WUD A;  4RS5 B;  4YG3 A;  3V0B A;  2EA7 A;  4HN1 A;  2Z5W A;  3AKP A;  4LO6 B;  3W59 A;  1PGS A;  3FN9 A;  4UW5 A;  2D6N A;  4IGP A;  4JRA A;  5EYX A;  4QDS A;  1Y7B A;  4A6O A;  1TMF 2;  1X33 A;  3H7Y A;  1SMV A;  4WVM B;  4TWT A;  1CAV A;  2ZZJ A;  4V1P A;  5BV6 A;  2G9F A;  1JH5 A;  1SLI A;  1S1A A;  1VBB 3;  1W39 A;  1OLM A;  1ZZ8 A;  2DVB A;  2XLA A;  3OPT A;  4HL0 A;  3TNQ A;  3BVC A;  1U5I A;  5FR3 A;  1VLN A;  4XBN A;  2XUE A;  2DVG A;  2TUN A;  3ES4 A;  5DAP A;  4OHV A;  2XLG A;  4AFD A;  4DY3 A;  5L36 A;  2K9Z A;  3KV5 A;  4H3W A;  3SLI A;  1NCQ B;  3PME A;  1UMZ A;  3UL2 A;  3FBY A;  2ERF A;  3M8L A;  3E5Q A;  1W8W A;  1WMD A;  4LO5 B;  5FXW A;  4LA2 A;  3K48 A;  3C7G A;  5FP3 A;  3ZKY A;  4GQ7 A;  2NPI A;  4CRQ A;  3LOB A;  2GH2 A;  1UN1 A;  1A8D A;  4KU7 A;  3KT1 A;  4OUL A;  1MR5 A;  2WWS A;  2I45 A;  3M3Q A;  3PUA A;  3WDY A;  3MV1 1;  4M0H A;  2W46 A;  1JZ4 A;  2NZ9 A;  3AJZ A;  2GAU A;  2WT2 A;  3KS7 A;  5FMB A;  3MW4 A;  3O1M A;  3ME2 A;  1AYN 1;  2W2I A;  2RS1 3;  4OZX A;  3HN3 A;  3RDI A;  1ZVF A;  1F8V A;  3WW4 A;  3S6P A;  5FOB B;  3LA2 A;  1OOP C;  4NWW A;  2EIC A;  2QZ2 A;  4RFT 0;  3LB9 A;  4CCL A;  4P9W A;  5FP8 A;  2ARC A;  2XON A;  2XDV A;  1H1A A;  3ATG A;  3I59 B;  5LA0 A;  1UY0 A;  4CCD A;  2BOI A;  2D93 A;  4IE0 A;  4LUK A;  4AE2 A;  2VG9 A;  5GZC A;  3O1O A;  5FMO S;  1VBD 2;  3CZJ A;  3LEM A;  1QIQ A;  1UD1 A;  4MLO A;  4COW A;  5JR7 B;  1AYM 2;  2WUH A;  3O1V A;  1JYV A;  3ZXL A;  5ACA 3;  3I4I A;  4RGG A;  1C4R A;  2X09 A;  3FMG A;  5A3N A;  1I5Z A;  1S2E A;  3HN1 A;  4CCK A;  1ZBE 1;  5C8C B;  4BE3 A;  1FMD 3;  3HWJ A;  1VBC 3;  3WQ1 A;  4OHW A;  3P3P A;  2R04 1;  2ZZQ A;  3DCQ A;  5FZE A;  3WG4 A;  3FX3 A;  4Y24 A;  4NHK A;  5JIA A;  3RNS A;  5IAT A;  4D6Q A;  1GP5 A;  1UYP A;  1AR6 2;  3J26 N;  1R09 1;  2WNV C;  4RR3 B;  4CP9 A;  1C28 A;  1FI2 A;  2OQ7 A;  4LBQ A;  3WP6 A;  3B01 A;  1L7R A;  5A7W B;  3HT1 A;  2XVK A;  4GD4 A;  2D3P A;  1KS5 A;  4XCA A;  2JG9 B;  5KHI A;  1LOA A;  5BNO B;  1C5I A;  1F5J A;  4PJY A;  3W20 A;  2B4K A;  5J3U A;  1FAY A;  3WF0 A;  1IG0 A;  4Q0V A;  3IT8 A;  3IAP A;  4YNI A;  1WCQ A;  1EUT A;  1HV1 A;  5DDJ 1;  4CCC A;  1HXS 2;  3POG A;  2XJV A;  4LJH A;  1GV9 A;  1ULF A;  3BUC A;  3F2Z A;  5DQ0 A;  2HYX A;  2FDG A;  5DAX A;  1XBF A;  2B46 X;  2JG8 B;  5LA9 A;  3GZA A;  4FPL A;  1WW7 A;  3I3M A;  3ZYF A;  3NRU A;  3EQE A;  3OEB A;  5A6Q A;  1TME 3;  4X8P A;  2Y6L A;  5GZE A;  5C4W A;  1S2B A;  5JPN B;  1CIY A;  3RI9 A;  2RS5 2;  1F5F A;  4O9G A;  3NAP A;  1RL3 A;  3VV1 A;  3SMH A;  2NN8 A;  1VRH 1;  2D6K A;  1ND3 A;  1APN A;  5LEJ A;  4CCE A;  1POV 3;  2G1M A;  1VP6 A;  4FXK B;  3JBG 2;  2GZW A;  4LHN A;  3RPQ A;  3MHZ A;  2VMF A;  2GC2 A;  3VBR C;  3O1U A;  4CEW C;  3AMH A;  3MLL A;  2Y6F A;  4MH0 E;  1RUJ 1;  3UT0 A;  5FZ8 A;  4QPY A;  1CVN A;  3MBW A;  4NRO A;  1RUF 3;  5KXC A;  1AL2 3;  5T54 A;  1DQ0 A;  4BQ4 A;  1BXH A;  1X36 A;  1YFX A;  3WDU A;  4AGG A;  2VU9 A;  1ZZ6 A;  3N7K A;  3RJR A;  4B7K A;  4P02 B;  1PGW 2;  2UY9 A;  5E1R A;  1MPX A;  4NPL A;  5IW0 A;  3PU8 A;  5BYN A;  3L2H A;  3KQ4 B;  2GH8 A;  4NHX A;  5EV7 A;  4P9L A;  3POJ A;  5E89 A;  2W1U A;  4XHX A;  2Q1M A;  2WWJ A;  2XLF A;  3GJB A;  2WRA A;  1EPZ A;  4LE3 A;  1N1S A;  4CUA A;  3C7O A;  4IEZ A;  1JU3 A;  5A3O A;  4LQR A;  2JDM A;  2HLE A;  1FOD 3;  5FYI A;  1KDK A;  1PK6 C;  1BBT 1;  1IZ3 A;  2J1R A;  1MVQ A;  2OW4 A;  4DY5 A;  1UU5 A;  5I91 A;  3RMY A;  3SQO A;  3U07 A;  5FDB A;  1SHW B;  2ARX A;  3MLK A;  3ZN6 B;  4BCU A;  3ZPY A;  1YFY A;  4D0Q A;  1OKO A;  1PZ7 A;  1NY7 2;  4QKD A;  4DOU A;  5ABJ C;  2XB6 C;  4AQ6 A;  1RUH 3;  3I3Q A;  2WFP A;  1OXC A;  3D0J A;  3ZPO A;  4AVV A;  4IV3 A;  2ORZ A;  3WF3 A;  1JN2 P;  1COV 2;  1Y43 B;  2P3K A;  3FZ3 A;  5A80 A;  4A44 A;  3AYE A;  4BA6 A;  3AJY A;  3O1T A;  2VL4 A;  1GSL A;  2WSU A;  1WCS A;  1EAH 1;  4GMP 1;  3E97 A;  2OPK A;  5C9A B;  1PM4 A;  2MHF A;  1QMJ A;  5D8A A;  4JV4 A;  1G9D A;  1SZB A;  3LFI A;  5L9V A;  1I3H A;  2PLV 1;  2ZKN A;  3NV3 A;  3V0B B;  2UWA A;  5LW9 A;  2QFE A;  4Q2F A;  4TSV A;  3KD4 A;  1MS0 A;  5EJ3 A;  1SAC A;  3X29 B;  1WUV A;  4GA9 A;  2Z4F A;  1GQP A;  3ZLI A;  1O3R A;  4K9S A;  4MXW A;  1AR9 2;  1Y9Q A;  2CAU A;  5IVE A;  4CU8 A;  3MIG A;  1LES A;  1W6Q A;  1UAI A;  4C0B A;  2Y6H A;  1KS4 A;  4YPJ A;  5F6K A;  5CBL A;  1JYX A;  2MNG A;  2WA4 A;  1CAV B;  4DXZ A;  3QAC A;  1UMI A;  1LTE A;  2VME A;  5DAV A;  1EV1 2;  2P6H A;  3OGG A;  4UBG A;  4AHY A;  3VD5 A;  1X8M A;  5CKN A;  3VKN A;  1O4Z A;  4XIO A;  1GWM A;  5GLU A;  4MG2 A;  1ODM A;  4Q4W 1;  3WP5 A;  4IE4 A;  3S5A A;  3SH3 A;  3MPP G;  4DQA A;  4JHT A;  2XML A;  1RUI 1;  4LR4 A;  3V65 A;  5HCA A;  1JYT A;  1PO2 1;  2Q1Z B;  3PJQ A;  3MV0 1; 
#chains in the Genus database with same CATH homology
 2WAO A;  2WDB A;  4W4Z A;  2QQI A;  4A45 A;  1NKG A;  1K3I A;  4QX3 A;  4LKS A;  4MGQ A;  5DMY A;  4W8J A;  3AC0 A;  4ET7 A;  1W0N A;  2VZS A;  5IJR A;  4E8D A;  1UY3 A;  4KMQ A;  2QQO A;  2V5D A;  2J1T A;  2ZEY A;  3K4Z A;  3UNP A;  3HNB M;  4M4P A;  2E33 A;  4W50 A;  5EIY B;  2PQS A;  1OH4 A;  2VZR A;  2CDP A;  2WZ8 A;  5C71 A;  5LA1 A;  4DXS A;  2VCC A;  2LW8 A;  3WSO A;  3THD A;  1JZ6 A;  4BDV B;  2W3J A;  4RN5 A;  3DYM A;  5C70 A;  2J1A A;  4MOA A;  3K4D A;  2ZXQ A;  3I2G A;  5JXI A;  2VZU A;  4OMD A;  3EYP A;  5J1X A;  4ZY9 A;  1O8S A;  3W5M A;  4QX1 A;  1P8J A;  3UET A;  1GU3 A;  3P1I A;  1W8N A;  2VZO A;  2QQM A;  1K12 A;  3GDB A;  2VM9 A;  3I2K A;  1UY2 A;  1D7P M;  2QQL A;  4XUT A;  4LPL A;  5IHR A;  4IUG A;  3I2J A;  4MGS A;  4QDR A;  2VC9 A;  2B9V A;  1UY1 A;  2VOT A;  5DN2 A;  3WF4 A;  2BBA A;  3HJR A;  2KD7 A;  4A4A A;  4QB2 A;  2VZ3 A;  2V4V A;  3C7E A;  1TG7 A;  4MAD A;  4JHZ A;  2C26 A;  2EIB A;  4ZXE A;  4D8M A;  3THC A;  3VD7 A;  3IAQ A;  2J1S A;  3BGA A;  4ZZ5 A;  1JU4 A;  4M4R A;  4XUR A;  3DEC A;  2JD9 A;  3T0B A;  3PUI A;  1OF3 A;  3VDB A;  4KWU A;  2W1S A;  2QQK A;  3HNM A;  1CZS A;  3T0A A;  4DUW A;  3III A;  3T2O A;  3LE0 A;  5JMO A;  2J1U A;  1YQ2 A;  2WAB A;  2VCA A;  2DCJ A;  3CZU A;  3JXS A;  2JDA A;  3PUH A;  5B4N A;  2W92 A;  2RV9 A;  3OG2 A;  1GOG A;  3HNY M;  2EID A;  3IDA A;  3HOB A;  2W5F A;  4OMC A;  3T08 A;  4DXT A;  3OEA A;  5HXM A;  1T2X A;  4QB1 A;  1R64 A;  4UOJ A;  3WEZ A;  3HEI A;  3GM8 A;  1JI6 A;  2RVA A;  1UXZ A;  4CUA A;  3K75 B;  4QB6 A;  3SKJ E;  5JXJ A;  4CU7 A;  2W95 A;  2WO2 A;  1PX4 A;  5G05 L;  3LEG A;  3HPN A;  1NX9 A;  2WO1 A;  2ZEZ A;  4XUO A;  4BXS V;  3ACH A;  3IB3 A;  5IFT A;  5IYY A;  5EJZ B;  2L9L A;  3OB8 A;  2C4X A;  3DYO A;  4AAX A;  1J83 A;  2XQX A;  3ETP A;  2V72 A;  3WNL A;  2E32 A;  4HG6 B;  2ZEX A;  1W99 A;  3A21 A;  1CZT A;  2E31 A;  4XUP A;  4P00 B;  1NUK A;  4BJ0 A;  3T0D A;  3C8X A;  3SKV A;  4TXW A;  4ARX A;  3ACI A;  1ULP A;  4JKM A;  2BGP A;  4MO3 M;  5JUV A;  4Z2A A;  1EUU A;  4OUE A;  4CVU A;  1W9S A;  4P5Y A;  1TVG A;  1HN1 A;  2WO3 A;  4OZO A;  1I5P A;  2VQT A;  3ACG A;  2W47 A;  3VD9 A;  2JE8 A;  5F7U A;  3A7Q A;  1US2 A;  1UZ0 A;  4ARY A;  4RYD A;  2QQJ A;  1O59 A;  2DCK A;  3I3B A;  2J22 A;  4PF1 A;  2WAA A;  2VZV A;  1W9W A;  3T09 A;  3WNM A;  2X10 A;  3LPG A;  4JX0 A;  3CIH A;  3SEP A;  4A42 A;  1UWW A;  4DEQ A;  5CZK A;  4FI9 A;  2YFZ A;  4E8C A;  1XC6 A;  2JKX A;  2YG0 A;  1JHJ A;  3BN6 A;  3K46 A;  5JR2 A;  3CQO A;  1GOH A;  3NJV A;  1UYZ A;  5CYY A;  1XNT A;  2YC2 A;  2XHN A;  1JYW A;  3WNO A;  1PX3 A;  4DEV A;  2VCB A;  4CU6 A;  1GOF A;  3EB7 A;  1W9T A;  3T2Q A;  2VZ1 A;  3VDA A;  3C7F A;  5JXG A;  3U37 A;  1GMM A;  2W94 A;  3WNN A;  3VD4 A;  5LCW L;  2XOM A;  1UXX X;  4TTG A;  2WN2 A;  1XNA A;  3FL7 A;  4PQQ A;  1XPW A;  1L7Q A;  3FN9 A;  5LA2 A;  3K77 A;  3A23 A;  3I3D A;  4QDS A;  4A6O A;  1RYY A;  2ID4 A;  2YFU A;  3DYP A;  5FUI A;  5IFP A;  2VO5 A;  5EJ1 B;  3CDZ B;  3SEE A;  4P08 A;  3WNP A;  2VZT A;  2VQU A;  1J84 A;  1K45 A;  1PMJ X;  2W9X A;  3GGL A;  4OYU A;  2QBX A;  2WN3 A;  4ZZ8 A;  4UAP A;  1OT5 A;  3C7G A;  4GWI A;  1UYY A;  2Y8K A;  2Y6J A;  2Y64 A;  3I3E A;  3MUY 1;  3MV1 1;  2W46 A;  1JZ4 A;  1JZ8 A;  1DLC A;  3HN3 A;  1JZ5 A;  1W8O A;  4GWJ A;  3I97 A;  1GUI A;  2EIC A;  2VMC A;  3ECQ A;  2XON A;  5A1A A;  1KEX A;  1UY0 A;  4A3Z A;  3A22 A;  5LA0 A;  4A41 A;  2ZEW A;  3P6B A;  3CZJ A;  3CKH A;  1UYX A;  2WQ8 A;  2CDO A;  4QX2 A;  2WUH A;  4QX0 A;  1JYV A;  2VTF A;  2X09 A;  2VMD A;  1JZ2 A;  3NNG A;  4DXR A;  2QQN A;  1SDD B;  1OF4 A;  2RJ2 A;  2EIE A;  3WF1 A;  3MO4 A;  3ABZ A;  4CUC A;  4PT6 A;  3LPF A;  1LNS A;  3OGS A;  3LEI A;  5B4X A;  1L7R A;  2BGO A;  3T2P A;  1JZ7 A;  1GNY A;  3FHA A;  2W91 A;  2B4K A;  3WF0 A;  3IAP A;  1WCQ A;  1EUT A;  2WYS A;  4JKK A;  3VDC A;  3VD3 A;  4XUN A;  1BHG A;  5G04 L;  4L0P A;  3F2Z A;  5DQ0 A;  1F4A A;  2HYX A;  1F4H A;  3ACF A;  3LQC A;  3NRU A;  3OEB A;  2Y6L A;  1ULO A;  1DP0 A;  1CIY A;  4CUB A;  2Y6G A;  3ZM8 A;  3I2I A;  1WKY A;  2C9K A;  2LS6 A;  3OGR A;  3NQH A;  1O8P A;  5DPN A;  1US3 A;  2VMF A;  4XVH A;  2Y6K A;  3D3A A;  3I2H A;  1JYN A;  3MBW A;  3C7H A;  3NJX A;  3J7H A;  3W5N A;  4P02 B;  3WF2 A;  3WQB A;  2J1V A;  1MPX A;  4QDQ A;  2YC4 A;  2W1U A;  1K42 A;  1DYO A;  3C7O A;  2J7M A;  1JU3 A;  1UY4 A;  4LQR A;  2HLE A;  1OD3 A;  3I2F A;  1UMH A;  4AG4 A;  2W87 A;  2J1R A;  2W1Q A;  2WBK A;  1H6X A;  1PMH X;  1SHW B;  5HPO A;  4BK4 A;  4CU9 A;  4D0Q A;  1IQD C;  2BZD A;  2WZE A;  3WF3 A;  2ORZ A;  4UI9 L;  3LEK A;  4A44 A;  3WNK A;  2VL4 A;  4LHS A;  1H6Y A;  4QAW A;  1CZV A;  2VJX A;  4KI5 M;  2W1W A;  2ORX A;  4XZU G;  2BER A;  1JZ3 A;  3GXU A;  2DDU A;  4XUQ A;  1UX7 A;  2Z4F A;  1GQP A;  3FHQ A;  4GZ9 A;  4QPW A;  5JXH A;  5I0D A;  1SG3 A;  4CU8 A;  2OKX A;  2Y6H A;  4YPJ A;  3MUZ 1;  5C7G A;  1JYX A;  4DUX A;  3CMG A;  1KGY A;  2E26 A;  2VZQ A;  2X05 A;  1UMI A;  2VME A;  4BK5 A;  1NAE A;  4JKL A;  3E1F 1;  3VD5 A;  2YB7 A;  3OGV A;  3UES A;  2R7E B;  2VZP A;  1CX1 A;  2J1E A;  3K4A A;  3OBA A;  4DUV A;  3MV0 1;  2VR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...