2J1VA

Structure of a streptococcus pneumoniae fucose binding module in complex with the blood group h-trisaccharide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Carbohydrate-binding protein
molecule keywords FUCOLECTIN-RELATED PROTEIN
total genus 39
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1vA00
3LPFA 3WF4A 2C4XA 3MV11 3HJRA 3NJXA 4AG4A 3U37A 3LEKA 3VD3A 2X10A 1W9TA 1K3IA 2JE8A 3HNMA 4W8JA 2J1TA 4QX2A 3F2ZA 3I3BA 3EB7A 5HPOA 3CZJA 3THCA 3MV01 4UAPA 4CUAA 1K45A 1CZVA 2W5FA 4XUPA 5JXHA 3WSOA 1OH4A 2VJXA 3T0DA 2VCBA 1DYOA 5JXGA 1L7QA 1JYVA 2ZEYA 4LPLA 3ACIA 1O8SA 3HEIA 3IB3A 2DCJA 1JU4A 2EICA 3WF3A 4KMQA 2YC2A 5C71A 2WZEA 3K4DA 4CU7A 5EJ1B 1L7RA 2Y6LA 3K75B 2RJ2A 2R7EB 4CUCA 1XPWA 2C9KA 2YB7A 3HN3A 3UETA 1UY1A 4PT6A 1JZ2A 4A6OA 4TXWA 4MGQA 4QX0A 1J83A 1CZSA 5B4NA 2J1SA 3LPGA 2DDUA 3I2GA 2QQKA 2Y6HA 1W99A 2VZTA 2QQOA 1UY4A 4JKLA 4DXRA 3GDBA 2OKXA 1JYNA 4XURA 2WUHA 2W91A 4KI5M 2B9VA 3VDBA 1GOGA 4OYUA 4DUVA 3VD5A 4AAXA 1YQ2A 4OMDA 3MUY1 3CZUA 2V5DA 3A22A 5J1XA 3FL7A 4YPJA 3T0AA 3C7EA 2WO1A 1O59A 2V4VA 1MPXA 3OGVA 5DMYA 3OGRA 2VZVA 2ZEWA 4BDVB 3W5MA 4QX1A 4ZZ5A 4P5YA 5IFTA 4RN5A 4MGSA 4HG6B 4TTGA 1UYXA 1W9SA 2W1SA 3C7HA 2J1RA 2VL4A 3C7GA 3I97A 3I3EA 3SEEA 4ZZ8A 4BK4A 3WNNA 2WBKA 1KGYA 3FHAA 3CDZB 2EIEA 5LA0A 2VQTA 3I2HA 3SKVA 5C70A 4CU9A 2VZQA 3W5NA 2W95A 1JZ8A 3BGAA 1PX4A 2VMDA 2XHNA 3D3AA 3DYPA 3LEIA 2E31A 4IUGA 5DQ0A 3WNPA 5CZKA 4LHSA 2W1WA 1TVGA 3FN9A 2W46A 1UXZA 3UESA 1PMJX 2J1VA 3WNKA 2VZPA 3VD4A 2Z4FA 3ECQA 1JYWA 2VCAA 2ZEZA 1JI6A 4M4PA 3WQBA 3VDCA 1IQDC 1JHJA 3EYPA 2VMFA 5JMOA 2BGOA 2W87A 1OT5A 3T2OA 5LCWL 4QDQA 1CX1A 2VZRA 2B4KA 4JKKA 4DXSA 3ACGA 2QQNA 2C26A 5LA1A 2BZDA 1PMHX 2E32A 3WF1A 3NQHA 2VZOA 3I2JA 4UI9L 3GM8A 2W9XA 1NKGA 4LKSA 2J22A 2HYXA 3NNGA 1UXXX 3PUIA 4XZUG 2WAAA 4CU6A 1KEXA 2KD7A 2LW8A 4P08A 4CUBA 5JUVA 5JXJA 2Y6KA 3I2IA 1ULOA 4CVUA 1P8JA 1WCQA 4QX3A 4XUQA 3T08A 4D8MA 2HLEA 2WN3A 3OEBA 3OB8A 4QAWA 4DXTA 2L9LA 3WEZA 3A21A 1DP0A 5A1AA 3T0BA 1DLCA 2YFZA 1LNSA 1O8PA 4W50A 4E8CA 1GUIA 2VCCA 2WABA 5HXMA 1OF3A 3T2PA 1NUKA 2VM9A 1JZ3A 3C8XA 4OMCA 3K4ZA 3CIHA 3MBWA 3MO4A 3NJVA 2WZ8A 4PQQA 3LEGA 2ORZA 2W94A 3HNBM 4JX0A 2ZXQA 1US2A 4Z2AA 2ID4A 5CYYA 1HN1A 2Y6JA 2ZEXA 4QDSA 5C7GA 3ETPA 1R64A 4XUNA 1K12A 1UYZA 2VQUA 5JXIA 3NRUA 4RYDA 2YG0A 1US3A 3MUZ1 3SKJE 1W8OA 2VTFA 2DCKA 2QQLA 1K42A 2RV9A 5IYYA 3DYMA 2XQXA 1W9WA 4JHZA 1JZ4A 4L0PA 2QQIA 4QPWA 3IDAA 2PQSA 2XONA 1EUUA 3ACFA 4MO3M 1D7PM 1T2XA 3LQCA 1OD3A 2J1UA 2Y8KA 1XNAA 2VOTA 2W92A 3T09A 2WDBA 3WF2A 3CKHA 1WKYA 4GWIA 4QB6A 3VD7A 4A42A 3C7FA 1XC6A 2VR4A 3E1F1 3BN6A 4FI9A 1JU3A 4M4RA 4A44A 3IIIA 1UX7A 2WAOA 3GXUA 4ET7A 3T2QA 3IAQA 2Y64A 2CDOA 4JKMA 1EUTA 2V72A 5B4XA 1ULPA 4A3ZA 2E26A 1GNYA 5JR2A 3WF0A 3DECA 4ARXA 3OBAA 3WNLA 1H6YA 4A4AA 1F4AA 4D0QA 2BGPA 1GOHA 3IAPA 2J7MA 3A7QA 1I5PA 3DYOA 3HNYM 2CDPA 4A45A 5G04L 4OZOA 4DEVA 3LE0A 4MADA 3P1IA 3WNOA 2VZUA 2VZSA 1JZ5A 4A41A 2EIDA 4ZY9A 3K77A 4KWUA 1CZTA 2BBAA 4E8DA 4PF1A 1JYXA 2WO3A 4ARYA 2VZ1A 3OG2A 1OF4A 2J1AA 5DN2A 4QDRA 3ABZA 2VO5A 2LS6A 1UZ0A 1CIYA 3I2FA 5EIYB 3PUHA 3P6BA 5FUIA 3THDA 2RVAA 4ZXEA 4GWJA 4UOJA 3A23A 1UMIA 4QB1A 2Y6GA 3VDAA 1W8NA 1SHWB 2XOMA 3K46A 3I3DA 3AC0A 1UY3A 1RYYA 4CU8A 4QB2A 3WNMA 2QQJA 5IHRA 5EJZB 1UY2A 3ACHA 4DEQA 2QQMA 2JDAA 4OUEA 2YFUA 1GU3A 2VMCA 1JZ7A 3J7HA 2W1QA 2ORXA 2E33A 2WN2A 2JKXA 3CMGA 5DPNA 3HOBA 1BHGA 2X09A 2YC4A 3JXSA 1GMMA 2VC9A 4BXSV 2WQ8A 1JZ6A 1XNTA 5I0DA 1GQPA 3OEAA 3C7OA 1UWWA 5LA2A 1TG7A 5IJRA 3VD9A 3K4AA 3HPNA 4DUWA 1GOFA 1W0NA 1J84A 2VMEA 2X05A 4P00B 1H6XA 4XUOA 1UYYA 3OGSA 2EIBA 1UMHA 1NX9A 1SDDB 2W47A 3FHQA 2W3JA 5F7UA 2QBXA 1SG3A 3GGLA 3I2KA 2WO2A 1F4HA 2WYSA 3ZM8A 4XUTA 2W1UA 2BERA 4LQRA 4GZ9A 2J1EA 4MOAA 1UY0A 3UNPA 1PX3A 2JD9A 4W4ZA 1NAEA 4P02B 2VZ3A 4DUXA 3SEPA 4XVHA 4BJ0A 4BK5A 5IFPA 3CQOA 5G05L
chains in the Genus database with same CATH superfamily
4AFBA 1VPHA 3CU7A 3AFKA 3HJRA 2ZGKA 4CCMA 3NAPC 3LEKA 2D6KA 2X10A 1JYTA 2D6OX 1EV13 4S2GA 3I2DA 4HL0A 3TB0A 3UKNA 2V73A 5K0UB 1QQP1 5L7OB 3T1MA 3NSTA 2J1TA 4C1XA 1AL21 1MZ6A 2WKKA 3AP7A 3F2ZA 4UFMA 4QXKA 5HPOA 3FLTA 4FOYA 3ALQA 3CL1A 4JQTA 4A7ZA 1SCSA 1HKDA 2V09A 4KWLA 3O1UA 4LBNA 1Y9MA 2E63A 4UAPA 4YGEA 1GP4A 1RUD3 5HCFA 3Q8FA 4B29A 4MGYE 2H0VA 2VJXA 2VNGA 2BW8A 4X8PA 4Z82A 2Q0AA 3KF5A 4ZU5A 4BA6A 2ZS6B 4DY3A 2OW4A 5J3UA 4UFHA 4IV3A 1VBE1 3KWVA 4NRMA 2ZEYA 4QHOA 5FR3A 5FZIA 4EN7B 3PDQA 2VVEA 3WQ1A 2DCJA 3WF3A 4NO4A 1C8NA 2ZMKA 1KITA 3ZFFA 3OTFA 4YYOA 3OPZA 5FZLA 4AVSA 4LKEA 4V1PA 1WW7A 2HWC3 4I30A 3GJAA 3K4DA 4FFFA 1HLCA 2VECA 2VW2A 2ZHMA 3MLJA 4Y4RA 3RZZA 2JG9B 3RZMA 4CUCA 4XILA 3WZ1A 1AR62 2KR2A 3HN3A 2KA3A 5C3SA 1AUYA 4KBBA 1NLSA 1UOBA 4NMIA 1L3JA 2BU9A 1UZYA 4YW6A 4GJYA 3MHZA 3UT0A 5A3LA 3LCPA 1JZ2A 4CDQA 2PHFA 1QJFA 1J83A 1KQRA 1OH3A 1AR63 3AMMA 3PIJA 5EYYA 4AQ2A 3PJQA 1WBFA 2QQVA 2VUCA 2DDUA 2E53A 3L2YA 3OY8B 3RWNA 4BPZA 4Z2WA 1OOPC 2XL7A 4IEWA 5CFDA 5A6ZA 1WGPA 2QQOA 3I8TA 4ATEA 4JKLA 1QHDA 1LEMA 5FK8A 1WLWA 4YZ2A 4XURA 1LECA 2RDRA 1QQP3 5LZ6A 2WUHA 5FP3A 1W6MA 2HEVF 1W2AX 5F3IA 1LB2A 2HWD1 2WL1A 3POYA 5DUWA 1C8M1 5ANNA 3HVDA 2OQ7A 3NV4A 1EPWA 4PBPA 1RHI1 5E6HA 4QGMA 1GOGA 5SV8A 4XBNA 3FJSA 4MZUA 4XACA 3JB4C 4AAXA 2CYFA 3J7NA 2WSVA 4XW3A 3B01A 2A1XA 3PVBB 2GSYA 2YZ4A 3KV9A 5GLVA 1UCXA 4RFRB 3WQ7A 1OQDA 3R4SA 4YRDA 5GZEA 3T0AA 4CDWA 2PN5A 1G6NA 2AEZA 4AK3A 4EN8B 1Z0HA 4Y1UA 3ZFEB 4Q4V3 4HT1T 1UW8A 1Q8VA 3AZWA 4EROA 2RMU2 4BDVB 3LA3A 4GJZA 4DB5A 5F2WA 2YUEA 4ZZ5A 2YBSA 1VBE2 3NWKA 2YYOA 4PJYA 2RS32 4I02A 1R082 3SHRA 5GLTA 3ILFA 1W04A 2QZ2A 2HWE1 2J1RA 5FYUA 2BJSA 1C8M3 2R16A 3GALA 3QD6A 5D1IA 2N7GA 3HMYA 2Q8EA 3ST7A 1DIWA 2NP0A 5IK7A 2WBKA 4G9SB 4WM7A 3FHAA 3CDZB 2XJRA 4BQWA 5LA0A 3S30A 5LRSA 5FMBA 1RHI2 2GP3A 3DL3A 1GLHA 2CWMA 4YVWC 1SCRA 2A75A 2XJSA 3PVOA 2HWD2 3H8UA 5M0TA 4IEPA 1ENSA 1C8M2 2W2IA 3N9LA 2ZGNA 5A7NA 3ZN5A 1JZ8A 2FDGA 4WM8A 2XHNA 4IUGA 3N4MA 1UQXA 2ADEA 3ZXLA 3E97A 4NUBA 3VHOA 3TNPB 2WQ4A 3I59A 1RHI3 1FV2A 5CISA 3UESA 1PMJX 2J1VA 5BNPB 2HWB1 4QD2A 1FOD3 2VGDA 1FNZA 2BNNA 4K40A 1HQWA 2XKOA 2Z4FA 3MDPA 3U11A 2O0OA 3PUAA 2CSGA 2ZOEB 4ZXKA 5FZBA 1IQDC 1ZBE1 2D98A 3KCXA 1PO22 1IS4A 3LOBA 4K8RB 5JPNB 2IFRA 3VUOA 3ES1A 3HT1A 1C4RA 1STMA 2R0FA 2NMOA 5HCAA 3NL1A 1S4CA 3VKMA 1G9AA 1MS9A 5JSOA 5F32A 5CEHA 1LHUA 1TMF1 1CX1A 1A34A 4PCRA 4BMEA 1UU6A 2H6BA 4OHZA 2XJVA 3RZJA 4NIHA 4DXSA 3OUIA 2R071 1E5SA 2BTVC 1PO23 3AM2A 4ASKA 4CEWB 2QJVA 4TWTA 5F3GA 2BZDA 2RS12 4O9EA 3ITQA 2D93A 1PMHX 3NQHA 2VZOA 5DUUA 2PHTA 2LALA 4LKSA 1ND2C 3POFA 1UXXX 1LTEA 2ADDA 4M0HA 5FXXA 4IEUA 4EJRA 1ZRDA 4NHMA 1Z78A 2WAAA 3O7OA 4RQPA 4CU6A 1S0DA 2R072 2RS13 3M3OA 1ULCA 3MW3A 5BV6A 2OIIA 1OHFA 1ZZ7A 3I2IA 4FFHA 2WLPA 3T3YA 2P1BA 3O1SA 3IBMA 4FQZA 3B9CA 5FZ9A 1W3VA 1S0BA 2PYTA 3N9OA 1P8JA 3VB9A 3OYWB 5KXDA 3V56A 2XBO3 4NRQA 4XUQA 4QPGB 2Z42A 2FZ1A 4HSJA 2C5DA 2BOJA 1W6OA 3OB8A 1X9PA 2DVFA 4HVRA 3H1WA 3WEZA 5A1AA 1DCSA 2Q8DA 2Z69A 2DF7A 5FAXA 3IN9A 2WWUA 1WMDA 3USUB 1NQDA 1LOCA 4YG3A 3M3EA 1W6MB 4H55A 4MGTA 3KVAA 5BNQA 4W50A 4Y5TA 1PO11 4B7EA 2FDHA 4LOSA 4LUKA 4YM2A 5K9YA 1WD3A 1QNWA 2RDQA 4BCUA 5LASA 3LSEA 3FLRA 4AVTA 5BNOA 1B35A 1C28A 2VM9A 3N7JA 4RS5A 4LK6A 3AJYA 4FP3A 3M2MA 4DRRA 1VBA1 2IVIB 2VNRA 1YFYA 3K4ZA 3MO4A 2WO7A 4O9GA 2WZ8A 2PMWB 1SLTA 5EJ3A 1GBGA 1AR92 3HNBM 1BVVA 1HXS3 4JX0A 2ZXQA 1US2A 4Z1VA 4Z2AA 4L97A 4Q4V1 4ATFA 3Q8EA 5A6XA 3ZYIB 3Q8CA 1FATA 2ZEXA 4QKBA 4IEQA 3TN92 2B5HA 1YIFA 4GQ7A 3OSDA 3ETPA 4AVCA 3J8F1 3VKLA 3WHTA 2RHPA 4G4FA 5GZFA 1CPNA 4KU7A 2WRAA 5JXIA 1RUF3 5JVVA 3GJBA 3WV6A 2GH8A 3H42B 2YG0A 4RS5C 5J09A 1RUI2 1W8OA 1PMIA 2DCKA 3VBFA 5ABJC 3HN1A 3CJIB 1MS3A 4CDXA 1RUC2 4PLMA 4YM1A 1QJU2 3AYDA 5IK8A 1AR83 4QPWA 3A0NA 5C4WA 2PQSA 3TRSB 4RHV1 3ACFA 5F5CA 1AR73 1T2XA 4L2NA 2A70A 3AP5A 3LQCA 4M3CE 5JOWA 1W3XA 1D0HA 4LA2A 1AL23 3VZKA 1D4VB 4W65A 1VRH2 1XNAA 4HN0A 2W92A 4D3WA 1B35B 3AZVA 3GZEA 2VG9A 4Q4X3 1PM4A 5EYXA 3T09A 2CTVA 4C0HA 4MHRA 1CD3G 3WF2A 3THTA 3NV1A 2DWRA 3BTXA 4GWIA 2FBEA 3G6JB 3WR0A 1UX6A 3IM0A 4W6WA 3FWEA 4AHXA 4IV1C 5C4WC 4PIZA 4Q4X2 1SQ4A 1XU1A 1XC6A 3P3PA 3QACA 4EWAA 4CDQC 4JGYC 2TBVA 4M4RA 1TQ5A 4HKWA 3CO2A 5CVRA 3SNMA 5F37A 3OCPA 4PQ9A 2IXLA 2BWCA 2D43A 3T2QA 3WP6A 2RDSA 2Y64A 4IQPA 4FTBA 1PGL1 2CDOA 4JKMA 1PVC1 5JR2A 1ULPA 5I0UA 1GNYA 1PK6B 2ZHNA 4Q4W3 1O4YA 3WLUA 2E7QA 1HB2A 5FPVA 2D7FA 1D4M3 2VMHA 2Y0IA 3DCQA 3RJRA 5IK5A 2HWB3 5FPLA 4ARXA 5J96B 4M01A 3KV4A 2YBKA 1TME1 1DHKB 1MACA 4BLIA 5C9AA 4RQPC 1GOHA 3IAPA 1DBNA 4Q4Y2 1W8WA 4A7YA 3HNYM 3NNLA 4P9IA 5LBFA 2GH2A 2VXRA 4A45A 5G04L 2B9UA 1G86A 2RS31 1OSGA 1VMHA 5GJ6A 3THPA 4AI2A 5FUPA 2LM3A 1IZ3A 5GZDA 4DPNA 1GR3A 3CJIC 1FT9A 4RQPB 4TLFA 5JSPA 4AGGA 3BPSA 3ZMOA 2P37A 5IT6A 4I09A 1FAYA 5KHHA 3O1TA 2GP5A 4ORFA 3FHIB 4O65A 3WW3A 3UL2A 5A3TA 5FIXA 4ARYA 2H6CA 5IWFA 3QOPA 1DQ1A 1ZBA3 2J1AA 4Y24A 4K8FA 2ILMA 4QDRA 3N3HA 4YGDA 5KXCA 5BNOC 4WZFA 4KU8A 4KWKA 2EXJA 1H1MA 4KNCA 3AYAA 1W0PA 4Y22A 4C90A 1H8TC 5EIYB 1J58A 3B9IA 3LF7A 2JECA 3WG3A 2F6BA 3ZYRA 5AC93 4IV1B 4COUA 3O0WA 3BTZA 3AMHA 3S0MA 3FC0A 2X5IB 1LOFA 3R4DB 3GHMA 4MGZE 3U75A 5K7PA 2VOWA 1HRI3 4KGGA 2V4AA 1DZTA 2C6SA 2CAUA 4XQDA 4UOJA 1WLTA 2C0ZA 4NROA 4QB1A 4AEMA 1ZBA1 1NCQA 4B4PA 5JZGC 4P9YA 1V6MA 2FCTA 1UF2C 3VV1A 3URFA 1KS4A 2IFWA 4SLIA 2WYFA 2W39A 2ZHKA 1SPPB 2X29A 3FFZA 1RYYA 1SLLA 5T3NA 4DIQA 5ACA2 4GKXA 4LJHA 2ET1A 4QB2A 4ISRA 5AVPA 2GN7A 5E88A 1VBD1 5IHRA 2YU2A 3H50A 1UY2A 4DY5A 2QQMA 4AQ6A 2JDAA 3OPTA 4XJZA 3WP5A 4Z92B 4HK8A 1I1EA 2W1QA 2GZWA 3S5AA 1EPZA 4HMZA 3VBSC 3TBDA 3VKOA 1W6PB 1ASJ3 4NIDA 1NZCA 4FPCA 2R1DA 2XLGA 4WM8B 4ZS2A 2XJUA 4Q29A 4QXHA 2NN8A 3UGHA 1D4M1 1SMVA 2PELA 3JBG2 4XIOA 1HRV2 1LKNA 1U5YA 2YDEA 1GMMA 3J7LA 4LO7A 4IGPA 1FPN2 3DPRC 3JQWA 1XNTA 3ACLA 2WFF1 4COYA 1H4GA 5ERLA 3WINE 5B4NA 3PTYA 4LHNA 3WW4A 3ON7A 1BBT3 2CL2A 3KGLA 3KT4A 1IKQA 4YVSB 2RDNA 1R081 1HRV3 1YQ5A 2DCZA 4RA0A 5JAXA 2FCVA 4XFGA 3ZYPA 2D6PA 5EZWA 1SPPA 4XDOA 2UY8A 4XFIA 5DDJ1 2ZGSA 5H9RA 3MFAA 1W0NA 2JDUA 5LY2A 1FNYA 4HETA 4YG6A 3D8CA 4LE4A 2WQZC 3D4KA 5C8CB 1QNYA 1YI7A 3GBGA 1C5HA 2EIBA 4LBKA 1PK6C 3S6PA 2GC0A 4XJ8A 2W47A 5IAVA 3JD73 4RGKA 2ZX3A 2K2SA 1J1LA 1GZTA 5F7UA 4B1MA 1Q8OA 2X8KA 5LK5A 3ZM8A 5GZCA 5TSWA 1DF0A 1HJGA 2K46A 4IE5A 3KGZA 2CGPA 4NPMA 1IPSA 1GZCA 1FPN1 5L19A 3NJYA 4AW7A 4PF5A 4P02B 2IWGB 2VZ3A 1OXCA 1XYOA 4AQSA 4DUXA 4WBBA 4LORA 1QH7A 1VBA2 2WFF3 5FZKA 2ZGMA 2AEYA 1CAWA 2RR13 2XVLA 3K3OA 4J6GA 3RGBA 1JUHA 3LPFA 3HIFA 4Q27A 4QQOA 1MVEA 2BDRA 1XNDA 2WNUC 4D7SA 1ZX5A 4GB33 1DQ6A 2OYZA 3KV5A 1SFNA 1K3IA 2ZX2A 1PHMA 1W03A 3VN4A 1YFXA 4XOGA 3ZFEC 1RC6A 2PAMA 4QX2A 2HBTA 3VBUA 3EB7A 4FTSA 2DTWA 5A6QA 5FZMA 4LULA 5FXVA 1QJY3 3MV01 4R8HA 3O1PA 4Y1XA 4XYXA 2YBPA 4NVPA 4YG0A 3T30A 1NA1B 3MIGA 3RS6A 1KFUL 2VBBA 4N7IA 3N7MA 2HKXA 2W5FA 3IPVB 3JU9A 1GQHA 2P6HA 1KXGA 2JDNA 1OH4A 2OT7A 2WFPA 4BQ5A 4LKDA 1DYOA 1WUVA 3B3QE 1QJY2 1L7QA 4XF0A 2ARBA 3H9AA 1ZREA 1ZA7A 1O8SA 4MGIE 3H8RA 2XBO1 2JG8C 2EICA 2WNVA 2WINB 1COV3 5FYBA 4S2FA 5HBAA 1GYKA 4GH4A 5C3QA 4D7TA 4FPFA 5T54A 4BIFA 3M3QA 3GCWA 1K5MB 3NV2A 3VL9A 3MIFA 1GZWA 4CU7A 1CONA 1F15A 2A6VA 1QOOA 2Y6LA 4HVOA 2GAUA 2YU1A 2R7EB 4XZPA 1V0AA 3AFGA 5BNNB 1MS5A 2BPA2 2C9KA 5FZOB 3A0KA 3RDIA 3UETA 4F7ZA 1KFXL 1COV2 2CHHA 4UWDA 5DAXA 4Q8KA 2WIIB 3SXWA 1O3SA 3VBRA 5FXWA 1H2MA 3B94A 3V65A 3G7DA 5FPBA 4EZHA 1YIPA 4NR1A 4OI0A 3M1HA 2VOKA 1ODMA 3ZXFA 1PO21 3PUSA 4MGQA 4QX0A 1N3PA 1SFPA 3M3IA 2BFUS 5FOBB 1CWPA 2J1SA 4ITCA 3PUQA 4UW5A 5J98B 4K9SA 1RMU1 4JHTA 1O7FA 3VDDC 3ES4A 3IPVA 3VZOA 5JLVA 1MR5A 2VZTA 2RJLA 1WCUA 3GDBA 4JZRA 4QPIB 1QY4A 2AUYA 4MXWB 3ZN6A 2FDKA 1UKGA 4ZKTB 4I01A 5FUNA 2VUJA 3AVRA 3N9PA 3OYWA 4Y5Z0 3IMMA 4CUGA 4L92A 2B9VA 5KXBA 5FYCA 3O12A 2A3YA 4OHXA 2I2SA 4Q0VA 5FP8A 4C0BA 5L36A 1RUE1 1W6OB 4LO5B 4JCKA 2BGCA 1QOSA 5I0TA 2EVXA 3BU0A 4YVSA 1RUNA 3V0AA 3VD5A 1LHWA 1ST8A 2R32A 4GIQA 2G9GA 3NJZA 3MUY1 4OMDA 4YVWB 2Y0OA 3ZPYA 4EWDA 4DNYA 5A80A 2V5DA 1X8EA 1RVF3 4LMFA 2PXJA 3FL7A 4UBGA 3RPQA 3DGTA 4QPGC 4YPJA 3ZXAC 4D6SA 3OJBA 1MS8A 2VOXA 3WDXA 1MZFA 2XJTA 2V4VA 1CAUB 3OGVA 5A6YA 3NNMA 4ISQA 2GU9A 1R1A3 1NXD1 4XF9A 4DQAA 1AVBA 4P14A 1JOPA 5KBFA 2FDFA 3VKFC 3M4FA 4P5YA 3DKWA 3K3NA 1PVXA 2WS92 1CAXA 4OUSA 4RN5A 2F17A 5KC5A 3J4UH 3VBOC 3AP4A 4HG6B 5BNNC 1LOFC 1OUSA 1R1A2 3C7GA 1PVC3 3MEPA 1W2OA 4MXWA 2ZGTA 5FMOL 3ZN6B 5IAXA 4RL7A 4ZZ8A 2P3KA 2HJIA 4N90A 4FVVA 1GWKA 2WS93 1XB9A 1QJEA 2EIEA 3JBG1 3W59A 4ZONA 4AYUA 4X6RB 1X33A 2RE9A 5FO9B 1PVC2 4EV0A 5JCTA 5FZCA 2PA7A 3VBHA 1GZ9A 2BUKA 3BGAA 5FBJA 1PX4A 1RINA 2VMDA 3D3AA 3DYPA 4UFLA 3WNPA 3EO6A 3IZOA 5CZKA 2DYCA 3AZXA 2CV6A 2W46A 1RUH2 4FQ4A 4I3GA 2VZPA 2DFBA 4HANA 4NHXA 2DUPA 3LFIA 4XJUA 3HQXA 1RMU2 1NT0A 4Z07A 5FZ1A 3TEWA 4HXCA 3WNXA 2UWAA 4M4PA 4OI2A 5E8AA 1JHJA 1WW5A 4Y26A 1SLAA 3EYPA 1R092 5GM0A 5JMOA 4YW5A 2JE7A 4FPJA 5FFOC 3EQEA 4XQ4A 2BGOA 2W87A 1J3QA 1ENXA 1OT5A 3BOWA 4MHUA 4Q4V2 3T2OA 5LCWL 2NMNA 4GMP3 3KHBA 3ATGA 2C26A 4AVVA 1B35C 4QGNA 4CRQA 1VALA 1FV3A 4JC1A 4UF0A 3FBMA 2B42B 2QUOA 4RGGA 4B8EA 4QX8A 2DTYA 1LHVA 3MIHA 5AC91 3WF1A 5GLZA 2JIGA 5FYSA 4AI9A 2A3WA 1RUOA 5IVBA 4E2GA 4E4DX 2RMU1 1MEC3 2JWPA 4UI9L 3KSCA 2W9XA 1NKGA 2XGXA 5FZ6A 5BPXA 5L73A 2VQ0A 1PGSA 1W6QA 1OKOA 4XZUG 1FX5A 1Z7S2 1WZXA 3ZYBA 4G3YC 4R4XA 2G9FA 1YRZA 3VBRB 2KD7A 1LAJA 5DDJ2 4AFCA 2R063 4N9HA 5APAA 2Y6KA 4B7KA 3GBFA 2UYAA 3NAPA 4R4ZA 1Y9GA 4D94A 1MEC2 1WCQA 1ALYA 5DAVA 1CAVB 1QOTA 2WZR2 4CCEA 2VY0A 1MS1A 3JB8A 3RRDA 3QLQA 1ULDA 1LOAA 1MS0A 2F4LA 4GA9A 2HLEA 4D8MA 3T2TA 1FOD2 4H7LA 2L9LA 5CG8A 4OHWA 2C1FA 4QPIA 1A6CA 2LROA 1WMEA 1DLCA 2VNOA 2WWSA 2YFZA 4LKFA 4LO8A 3HBKA 2YROA 3CEWA 1J3RA 1SBFA 4JTNA 5JZGA 5CU1A 4QT6A 4BOWA 4BLJA 1AXKA 2JD4A 1RUG3 5LW9A 2VCCA 3POGA 4FT8A 1TE1B 4R9DA 3MIBA 4YZ3A 1W8ZA 1U0AA 5HXMA 1NZIA 4CP1A 1Y9QA 2XL9A 2DVAA 3C8XA 4QPYA 5B2GB 1TZOA 1BMV1 3CIHA 3JCIA 3NJVA 3BTAA 4PQQA 3W21A 5H9QA 1ENRA 2ORZA 3LEGA 5BXXA 5C3PA 2H0BA 3CF6E 2ID4A 1HB3A 2CY6A 1NY72 4WM8C 1HN1A 4AVBA 4LBQB 2VCMA 4QDSA 1HX6A 1H30A 1IGOA 4CPBA 1OA4A 1VBB2 3POJA 5A7WA 1CPMA 2AACA 2G9ZA 2NM1A 1APNA 3W20A 1W28A 3B5LB 4JGYB 4XUNA 3POIA 4OQ8A 4Q0SA 1D4M2 5FZFA 2VQUA 4AFAA 2DV9A 2QQUA 3NRUA 1XYPA 1JYCA 2R073 1NCQB 4JGZC 4AI1A 3M8LA 3LOIA 1US3A 3SKJE 1GV9A 4AWDA 1E57A 3LSDA 3O1VA 1K42A 1QEXA 5IYYA 2XQXA 4LHLA 3RI8A 1WWYA 1OVSA 1XE8A 2YGMA 3FLPA 1HXS1 2ZACA 4V2WA 5EPAA 4B4RA 1JZ4A 3VBOB 4L0PA 1J1TA 4FO9A 1FOD1 3IDAA 2XONA 1QWRA 2Z2SB 1OOPA 1AHSA 1EUUA 4Q2FA 1YFUA 5K4LA 2DBIA 3EXUA 1YC61 2HH9A 4E4SA 1I5ZA 2J1UA 3IMNA 3JD71 4CCJA 2WLQA 2Y8KA 2A6YA 4Q1RA 1DFQA 4N43C 2HWE2 4P9JA 2VD7A 2D3RA 3VBHB 5FTTC 1YFWA 2WDBA 3MW2A 4JRLA 3ZXGA 3SH3A 3CJXA 1WKYA 3CKHA 5JOYA 1S0FA 2VVDA 4F3JA 4UW3A 2BVBA 3H0OA 2HWE3 1POV3 1BCXA 3AMPA 1GANA 3BN6A 4Y20B 3UGFA 3O14A 1DZQA 3B02A 4XHBA 1UPSA 4JQRA 3TN93 2AENA 4A3ZA 1OLRA 4YARA 2E26A 2VH9A 3AKQA 1O3TA 3DECA 1JBCA 2BFUL 1H1IA 1K5MA 1XOYA 3FFQA 2MHFA 1HRI2 1IPJA 2I74A 1ZVFA 2D40A 3OBAA 3VLBB 5D8AC 3WNLA 3LZZA 4KL1A 4PIXA 3ZPOA 4A4AA 2IZWA 5FZ0A 2XH6A 4D0QA 1XJAA 2PHDA 2J7MA 1DG6A 1R1A1 2QZ3A 1W06A 3DYOA 1V6LA 1KJLA 2CDPA 1BVP1 2XG3A 4OZOA 1ZNPA 3LE0A 3I49A 4MADA 1XQNA 1AR72 1PGW2 3MGUA 5KC6A 1V6IA 3KS7A 1W6NB 3N9MA 2B7YA 4IXLA 3U1XA 5AFEA 4UFJA 4J25A 1OC1A 4NRPA 4NN0A 1ZA4A 1ND3C 4CP9B 5J7MA 4WM7B 1NCRB 1JMUB 1ULGA 1AR81 4CCDA 3KQ4B 4XEZA 3WQ0A 1EAH3 3OG2A 2VULA 1GSLA 1M4WA 4X8NA 4EN0A 2P3YA 1O91A 1CX4A 1URXA 3VDDA 1GWMA 1UZ0A 2KM2A 2PHXA 5FV3A 3VHNA 3V0AB 2SBAA 5DUVA 1UL9A 5I0RA 1UKRA 5LK7B 2KXLA 4NHYA 1UPIA 3AZYA 3PUHA 1OQ1A 3P6BA 4P9LA 4Y3OA 5FZDA 5FO7B 1JOJA 1FYUA 1FI2A 4AAPA 2JG9C 1H2LA 1PZ9A 1CR7A 1BEV3 2RVAA 1OLQA 2ZPXA 1BBT2 2A5ZA 2CGOA 2O1QA 2P34A 2XR4A 3R4UA 2P6CA 4J1WA 4GWJA 5FJKA 3LD8A 3C2UA 2DURA 2XMLA 2Z5WA 4HSLA 3ZFFB 2OPKA 2R042 4Y1ZA 2VXJA 1O5UA 1SHWB 4MV2A 4LNVA 3CBNA 4XDPA 3VBFB 3K46A 4AL9A 4QPIC 3RMXA 3UV9A 3I3DA 4GKYA 5A7WB 3ASIA 1VIWB 1UY3A 1PZ7A 5FMDA 2GNMA 1TMF2 1ZBE2 4CEWA 1DYKA 4CU8A 1G9DA 1COV1 1QXRA 1OFNA 1ZZBA 2WNVB 4P9WA 4XFFA 2VAUA 1Q8PA 4LUMA 3KD4A 2VOVA 1LOBA 1XE7A 3ACHA 3NNJA 4Y1YA 4BZ4A 2VMGA 4COZA 4CXWA 1E5IA 1DGLA 2YFUA 4KGQA 3VGIA 2JDZA 2BVVA 1WD4A 2Q4SA 3J7HA 2ORXA 3RQ0A 4NHLA 3HBZA 5FDBA 4XCBA 3K2OA 3VZNA 2WN2A 2DFCA 5T52A 3S57A 3BU7A 3ILNA 1XNBA 5DPNA 5T50A 5CFDB 1U12A 1WCSA 2X09A 4CSWA 2OUJA 2YC4A 1NCRC 4CP2A 1OPMA 3HD8B 2PHUA 3KZ4C 4IEXA 4BXSV 4OHYA 3RVHA 2XDVA 5IVCA 4CP0A 4GB32 2XUEA 5E89A 5I0DA 1MS4A 2JDMA 1EV11 4M3CB 3OEAA 3S7IA 1N1VA 4HPKB 4YGCA 1LHNA 4AEJA 2O8OA 3VBSB 3RZHA 4XC9A 4QQHA 4XJ9A 2JB4A 4LK7A 4YW3A 3RNSA 1ND2A 2WS91 2F4PA 4FXKB 3U78A 4BXFA 3OUHA 4JDMA 4L11A 5IJRA 2VBPA 3VD9A 3HPNA 2DVDA 5DXDA 1A78A 2CNAA 1W90A 2UYBA 4E2SA 4DUWA 1YHFA 5F1RA 4FTEA 3LDRA 1G9CA 4WVWA 1WA6X 2VMEA 3QCWA 3H1YA 1VR3A 1C3HA 4RS5B 5DZGA 3WCRA 5ISLA 3MLLA 4Q4X1 2WA3A 1QMJA 1H8VA 4N43A 3OGSA 3VZMA 2CGNA 1I3HA 1NLRA 1SBDA 1NX9A 2QKDA 1VAVA 2CWSA 4K6BA 1IQAA 5D8AB 5FRAA 2VW1A 1SG3A 1IG0A 3GGLA 2WO2A 1F4HA 3I2KA 4OLLA 3DXUA 4XUTA 2Q8CA 2VVFA 2W1UA 2BERA 2UY9A 5LEKA 4LBJA 3IKWA 3KB5A 5IVVA 2E9QA 1KJRA 3UYJA 5KHJA 5I93A 1S2BA 2W0XA 1AR91 1NAEA 1G9FA 4XDQA 1U5ZA 1M06G 1JYIA 3FBYA 4N53B 1VE0A 4XVHA 5DAQA 1D0GA 5LBBA 2D5FA 1TNFA 2RM21 5E1RA 4HPKA 3JBG3 5IFPA 4CCKA 3H1MA 3WF4A 4XAEA 2C4XA 5FYVA 5C4WB 3NJXA 2JDYA 3VD3A 2LRPA 1W9TA 1RUD2 1UZVA 1UD1A 2Q1MA 3AKTA 4AR2A 4WM7C 3IDBB 2QDNA 2QVSB 4MVTA 4CDQB 5BNPA 3CZJA 2UWCA 3OBZA 4YM3A 1RITA 4MG2A 3OOXA 2BBVA 4GWNA 3N9NA 2V5YA 1POQA 5FKCA 1K45A 1CZVA 1PZ8A 3OY8A 5A1LA 4XUPA 3WSOA 1PO13 3T0DA 2VCBA 5LATA 3K51A 5A7QA 4DFSA 3B93A 5IW0A 5JXGA 3WUDA 2ZZQA 1RL3A 3R05A 4YLZA 4LPLA 3SCFA 1Q56A 1LENA 2XB6C 5FY7A 3IB3A 4EYUA 3APBA 2ATFA 4BYYA 3PMSA 1UOJA 4FPKA 2AREA 3VZJA 1ULFA 2IUWA 1PO12 1RVF2 2YC2A 1V6KA 2UWBA 3D0SA 3ZIXA 5C33A 5CKNA 5IVEA 5JMCA 1BKZA 2HWF2 2C9AA 1DGRA 1OI6A 4JDNA 4K3UA 3ZSLA 4MLOA 3LA2A 5DZEA 2RJ2A 3E5XA 4MSVA 2OPWA 3X29B 1AF9A 2YB7A 3J9SA 4AHYA 3E6DA 4BISA 1UY1A 2JDKA 1LULA 3FUOA 2A73B 1OA2A 1PNGA 3OGJA 1NE4A 4PT6A 4AF9A 3BKZA 1J3PA 4KG0A 1N1TA 3MF6A 5FZ3A 1YEWA 4D69A 4TXWA 1R091 4HKLA 3VL8A 1V70A 2ZGLA 1BK1A 2GNDA 1VLNA 3MIEA 3PU3A 1W2UA 3GZUC 1K5MC 2D3PA 3LPGA 4HBNA 4MGKE 4W6XA 3I2GA 5I8TA 3WCSA 4DO0A 4EN6B 2QQKA 5FPUA 1W99A 2IXCA 5JDBA 2DBNA 3D82A 4IEYA 3WT3A 1UY4A 4DXRA 1JYNA 1RJ8A 2OKXA 5F3CA 4BM8A 3ZVXA 3TEYA 1RUJ1 4OZXA 3USUA 4AEDB 4CDWC 2P2KA 5EQUA 4LO4B 2Q1FA 2ZZJA 4Q8LA 4KI5M 2GMMA 3VDBA 2FMDA 3WDUA 3AL6A 3VBSA 1N3OA 2Y6FA 4QHZA 2R30A 1OA3A 3PNAA 2BQPA 1RUH3 1Y3TA 4OYUA 4DUVA 1QH6A 2ARCA 3UKTA 2GMEA 5JZGB 5LWBA 2YXSA 3VHRA 4BMBA 1IS5A 2RMU3 4PDWB 3PU8A 3A22A 3FUQA 2D6NA 5FWJA 1VBE3 1YO8A 3AP9A 3O0XA 4XPVA 3C7EA 3ZXDA 4P5HA 2GC1A 2RS33 4DZGA 4URAA 1MPXA 3N36A 3H8XA 1AYN2 4N43B 5GLUA 4IEZA 1DQ2A 4XXPA 1UYPA 2ZEWA 3L9JT 1VMFA 2BRTA 3ZFGC 4DOUA 3W5MA 1UZZA 1IOAA 3U10A 4QX1A 4XJWA 5D8AA 2QDRA 4I0WB 1Q8SA 1QF3A 1QJY1 2D6MA 3I3QA 3WDVA 1H4HA 2PQQA 1W6NA 5EP9A 2XXZA 1F9KA 2IXIA 2AC1A 4TTGA 1UYXA 1W9SA 3A4UA 2G1MA 3C7HA 3MPPG 3I97A 3I3EA 2YMZA 4JGYA 5A3UA 2EAKA 4LEJA 4Q0QA 3AMNA 2WZR1 4Q5OA 1YXWA 1UO9A 3BODA 1KGYA 1HIXA 4JAAA 3E5QA 2JG8A 4N53A 1HRV1 1R083 1Z7S3 2VMIA 5A7SA 3I2HA 4HLTA 5A3MA 3KLSA 3FMGA 4FPGA 3SKVA 5K8SA 5C70A 1LGCA 1RUJ3 3ZOIA 2VZQA 4CU9A 3O1OA 1TEIA 3PL0A 4HONA 4NOTA 1UN1A 2MNGA 5FP9A 1SFYA 1BK0A 1R1ZA 4CCLA 3LA7A 4CEYA 2GNBA 1KDKA 1H9PA 2P17A 5DQ0A 1OOPB 2DCTA 3LWCA 4AGVA 2W1WA 4E9KA 4BIOA 3QBQA 3ZSMA 4HOOA 4CCOA 4AEDC 4LHKA 4CDWB 3VD4A 1UOFA 2VPVA 5F5QA 1YCIA 5BY5A 2W68A 3ECQA 3ZO0B 1JYWA 2VCAA 2OZJA 1JI6A 4C91A 2WWJA 1JOBA 2XPJA 3VDCA 1W05A 2XKPA 1V9U1 1REDA 2PLV2 5ABJB 5A1FA 1OVPA 1XSQA 1E5RA 4CTEA 1PK6A 1GZWB 5BUVA 4QDQA 3BTYA 4W6YA 4FCAA 1BMV2 3JQXA 1T6GC 4KG8A 5CG9A 1S2EA 4Y20A 5BNNA 1O4TA 2B4KA 4YFWA 5CADA 3ACGA 4FPYA 3B69A 1GNZA 4QM8A 4XCAA 5LA1A 5C9AB 1NYWA 4CA9A 3L2HA 4FAGA 1PIV2 2IC1A 1LGBA 2ZAHA 3GHNA 2SLIA 3OGGA 3JUUA 4YZ1A 5FYMA 5E16A 3I2JA 3WG4A 2EAAA 4FPOB 1BQPA 2FDIA 2HYXA 2XBO2 2EXHA 3PUIA 4RSUA 5FYIA 5FZHA 1BYHA 1DYPA 3OD4A 3PJYA 4Z8BA 3R0RA 1KEXA 5FQ0B 4O61A 4OI1A 1ZRCA 4P08A 5T5OA 5C8WA 4B1LA 5JXJA 1LODA 1AXZA 4MXVA 4XFCA 2P5BA 1AYM1 4RR3B 3SITA 4CVUA 5A32A 1DLLA 2NQYA 4V2VA 5FMOS 4AE2A 1YJKA 3USSA 1N3QA 2NLRA 4K1YA 1S0IA 3AP6A 2LTNA 5FY4A 5FP4A 3T08A 2VTXA 1CVNA 2OVUA 4QQLA 4LT5A 2WN3A 4DXTA 5HCHA 2C24A 3LB9A 2D3SA 1XE0A 2A71A 1Y7BA 1DP0A 3A21A 3RZGA 1RMU3 4WVMA 1VB2A 4QKFA 1U5XA 5I0SA 3VBRC 3DKQA 3MYXA 4NPRA 1IS6A 1RUI1 1O8PA 4LXLA 3CNAA 2G4IA 4E8CA 5FJHA 3HWJA 1GUIA 3EMRA 5K0UC 5L7OC 3LAGA 2GC2A 3MFCA 4OMCA 1OF3A 2WT0A 1CAUA 4DMIA 2YY1A 1UIKA 3DV8A 5FK7A 5CNAA 1AJKA 3MBWA 1H8TA 1CESA 2E7TA 4BWOA 3POWA 1CGPA 4NWVA 3VBHC 4HK9A 1RUG1 4COVA 5LBEA 2GN3A 5CYYA 3W9AA 4F8AA 5C5UA 5CFDC 2ZX0A 3BCWA 2Y6JA 1DZRA 4EQVA 3POEA 1X36A 5FY0A 5C7GA 1CQ9A 4ES8A 4EE2A 1R64A 1RUC3 3KVBA 3TOJA 3WP3A 4CYDA 5C5TA 5CA6A 1K12A 1C5IA 1AR93 1DDLA 5FWEA 4IESA 3SQOA 2K0GA 2RJKA 4S2HA 5CFCA 4IE0A 3MUZ1 4PLOA 2R062 2VTFA 5F8PA 4QXBA 2JIJA 3WOGA 1SLCA 4AI3A 5L9RA 3ZDSA 1W9WA 2OQ6A 4C1WA 3VHPA 1AYM3 4JHZA 2WZR3 1IPKA 2NPIA 3WHUA 3OPWA 1MQTB 4IV3C 2JB8A 4L9BA 5CKQA 5T5JA 2O14A 4NPLA 4QQPA 4MO3M 2BWAA 2ZGRA 2ZMLA 4EWEA 1VBC1 3J26N 2ZKNA 4F83A 3SCGA 1Q8QA 2WC2A 3ZFFC 4QQ2A 3PHMA 2XLAA 1UU4A 4AFMA 2VOTA 5CIRA 4XXAA 1QJU3 5FPXA 1AR82 4M0NA 2Y60A 2JX9A 4Y4YA 2A6XA 4XTMA 1D2SA 1YQCA 1Q43A 1S1AA 2MEV3 1UU5A 1WMXA 1Q3EA 2OZ6A 4BQ2A 5I8SA 1EAH2 1ZRFA 4META 1JODA 1VRBA 4A42A 5IVFA 4GMP1 3ZYHA 4H2AA 4FI9A 3DXTA 4NAMA 1JU3A 1W9YA 2FZ2A 4UFIA 3IIIA 2WAOA 3GXUA 4CCNA 5LEJA 1OBNA 1OPOA 3K48A 3KT7A 3VKNA 3IAQA 4QX5A 5B4XA 5IUQA 1S0GA 1ZZ6A 4YVWA 3GYDA 1BEV2 5FZEA 1O5LA 4K1ZA 3RYPA 3CJIA 1OKQA 1RJ7A 4LE3A 1VAKA 4ASMB 3ZR5A 1NLQA 4FAHA 4YZ4A 1H6YA 3KM5A 2JG9A 2I07B 4QU2A 4XF1A 4C8DA 1RUE2 2B45X 3ZX7A 2BGPA 4ZHNA 1XXNA 1O3RA 5DAWA 3SLIA 1S2KA 1KD7A 4AI0A 3GF6A 1EP0A 1HRI1 4XE9A 4QKNA 5F5IA 4BHPA 1SBEA 2UURA 2HWB2 5F2SA 4DEVA 2WZPP 3P1IA 1KRIA 1SACA 1VB4A 4JV4A 5JOZA 1XNCA 5DG2A 1W39A 1TMF3 3T4HB 1CJPA 2QQPA 4AEKA 5J37A 1JZ5A 4A41A 1D2QA 1OMIA 2EIDA 2YC0A 1YYNA 3GCXA 1I9RA 3K77A 4KWUA 1YNAA 2JE9A 5A3WA 2BBAA 3I54A 1GNHA 1HW5A 2XLFA 4CEWC 4K21A 4LR4A 2ZX1A 2R49A 2E6VA 3AL5A 4PF1A 3P5BA 5FZGA 4RR3C 4QPGA 2WO3A 4LIVA 4A2UA 5JI9A 2VZ1A 1Y43B 5HV4A 3PTRB 1OF4A 5DN2A 3J7MA 3NO8A 2WA4A 3ABZA 2VO5A 4LO6B 4WVMB 1POV1 4Y33A 1H2NA 4UT5A 2QNKA 1WLDA 2DVBA 3BOPA 3U07A 5FY5A 3N9QA 1JN2P 1WW6A 3Q8AA 5J48A 4LBLA 4XIKA 1HV1A 3ENRA 2B39A 2Q30A 5FUIA 4Q1PA 1LESA 5KR7A 4ZS3A 1KDMA 1O4ZA 3EBRA 3LDBA 4E2QA 5A33A 1XBFA 3LIHA 5FMCA 2RM22 1S55A 5AC92 4ES9A 3PMEA 2XQRA 2JKBA 5FLJA 1W8NA 2P3JA 3ZIWA 2XOMA 3IDCB 5ABJA 3LFMA 3MW4A 4B4QA 4ZPIA 3AC0A 2A6WA 3AKRA 4JVAA 1X82A 3D0JA 1ND3A 1S0CA 4QHBA 5FZOA 4LOTA 5JI7A 4UF0B 1TNRA 5EXOA 1W9FA 2QQJA 3WNMA 3MLKA 4UBHA 1OLMA 3RG0A 4DEQA 1PM7A 3ZSKA 4LBMA 1REEA 3ME2A 1V6OA 1O3QA 1UZWA 5FY8A 3UKVA 3U0ZA 3MICA 2ZABA 3NKTA 1FPN3 4IW3A 3IT8A 4O7XA 3TEXA 4RD7A 3CMGA 4XETA 3EJKA 3HOBA 3H7YA 5GKAC 1J59A 3SC7X 3WX5A 2RS52 5DAPA 3JXSA 1DU3D 1UIJA 5FZ8A 3UGGA 1C57A 1JZ6A 2WQ8A 1RB8G 2QCSB 4QKDA 5FYTA 4YW1A 3S5QA 3UJOA 1YLLA 4DS0A 1CAWB 1GQPA 1EV12 1OUXA 5FXZA 1X50A 2RS53 4RGAA 1UWWA 2WT2A 5HI0A 4AOCA 2EA7A 3H3UA 5LA2A 1F31A 2YPJA 3OBRA 1JXNA 1KS5A 3K4AA 1DGWX 1SLIA 4I3PA 5C3OA 4NIAA 1QJU1 2R043 4S2DA 4X6QB 3VBUB 4NIGA 5J36A 4XTPA 5BYNA 1J84A 2X05A 1WA4A 4JGZB 4L99A 1MZ5A 2FDJA 1IKPA 3WP4A 4P00B 1W8FA 4XUOA 4H14A 5A3NA 2DU0A 1UMHA 1ZBE3 3HR9A 1UNBA 1SDDB 4AXOA 2QTWB 2W3JA 5F39A 2JJ6A 1HQLA 5KWRA 2HEYF 1ASJ1 2QBXA 1LOEA 4XBQA 4BE3A 2EXIA 5KHKA 2OX0A 2YHJA 2WFF2 3U4XA 3H8OA 4GZ9A 2J1EA 2HWF3 4IEOA 3ZFEA 4IERA 4DINB 1GKBA 3UNPA 1PX3A 2JD9A 1NCRA 2B46X 3JD72 4PLNA 2ZJCA 4RR3A 5A3PA 1A8DA 2ERFA 2R041 2ARAA 3SEPA 3ZN4A 4BK5A 1XYNA 2VUAA 3RFRA 3VDDB 1AX2A 1JTZX 1FMD2 3VBOA 1ZZ9A 4AHZA 2ZGOA 4YGBA 1VP6A 2BP6A 2ZCWA 3MV11 1ZRIA 5EFUA 4AI8A 4XBLA 4AG4A 4UW6A 2ZGQA 3U37A 2FQPA 1H2KA 2DVGA 3AKSA 2JE8A 2ENRA 3U14A 1XSRA 3HNMA 3ELNA 3MI8A 1JH5A 2ZHLA 3BYWA 4W8JA 2DU1A 3I3BA 4YWAA 3DN7A 4YW4A 4LLFA 4EN9B 3THCA 5IVJA 3WW2A 3BUCA 4Y22B 2HBUA 4CUAA 1YJLA 2ZGPA 4CEYB 3DF0A 4FPLA 1LU2A 4FOQA 3INAA 1NCQC 5JXHA 3QH6A 4M00A 2PLV1 4OULA 1BEV1 3PVEA 1MEC1 1REFA 3I7DA 2W08A 1JYVA 4YNIA 1DQ0A 1CIWA 3ACIA 2E7AA 1NOVA 3HEIA 4IETA 1JU4A 1UAIA 3FZ3A 4YFZA 5CAZA 2LUWA 4KMQA 3SH4A 5C8CC 4UW4A 1ACCA 5C71A 1QIQA 5CFCB 5FYZA 1H0BA 2WZEA 5CBLA 3T4VA 3JZVA 5EJ1B 1EAH1 4KBZA 1L7RA 1CN1A 1GP5A 1O6UA 3K75B 1AYN3 4CDXB 3VZLA 4PDWC 5FBZA 1XPWA 3GZAA 2B8MA 3O5SA 3UJQA 5AVAA 5JOXA 1VMJA 2PHRA 2RG4A 1NY71 3ZR6A 1JUIA 5CFCC 1NXMA 1W8TA 4A6OA 3ZYGA 1RTVA 1X8MA 1LEDA 4RFT0 2FD8A 1CZSA 3RZKA 4FXGB 1T6BX 4NJ4A 1OD5A 1FXZA 4FFGA 5EWSA 4YSFA 4R9BA 4TYSA 2FHRA 1V00A 2Y6HA 3OBTA 2ZMNA 4TSVA 1G9BA 2PAKA 5FQ0A 4CP9A 1GICA 2ZTNA 1U5IA 2G19A 5HXVA 3ZKUA 4AGRA 2XHKA 1RUJ2 1SEFA 1QKQA 5JPMB 4H7MA 1PIV1 3GZTB 1W2TA 2W91A 2XUMA 2VW0A 4IE4A 1FMD1 5FYHA 3O1RA 3WDWA 2P4EA 5FY9A 1AXYA 3D6EA 4LBQD 5EHDA 2VBDA 3BIWE 3H3ZA 5JIUA 4FOWA 5CKMA 4XFBA 5DG1A 5C3RA 4KQ7A 1NA1C 1YQ2A 1A8MA 5FP7A 1N47A 3CZUA 3SISA 1BZWA 3NMBA 5J1XA 5C6CA 3LIGA 1C1LA 3EHKA 4GAZA 1ONAA 5T5PA 1Q5OA 1H1AA 1WCDJ 3ZMNA 5AFBA 4OCTA 2HWC2 2IXKA 2WO1A 1RXGA 1O59A 3FX3A 1CJDA 4CDUB 3SH5A 5BNOB 2D6LX 4QWNA 1LHOA 5DMYA 2D5HA 3OGRA 2VZVA 3AZZA 1W8UA 2WT1A 4MYEA 4A6SA 3OF1A 1H8TB 1LOGA 2XJPA 4OFGA 5JWPA 2NZ9A 4YVSC 5DUXA 2WJSA 1RVF1 2MPFA 3DEMA 2FMYA 3PURA 5FCCA 2VNVA 5IFTA 2X5IC 1POV0 2XJQA 4BH9A 1PIV3 4HN1A 4MGSA 1F2NA 3AYCA 1QDCA 2W1SA 1IG3A 3Q9OA 5FZ7A 2VL4A 4YZ5A 3SEEA 5F9TA 1WBLA 4FOVA 2TNFA 4BK4A 2YPDA 4NAOA 5K0UA 2ETEA 3WNNA 5L7OA 4CE8A 3I3MA 5FO8B 1DQ5A 1VBC2 2OS2A 4TZDA 3N7KA 3HQRA 2VQTA 4XHXA 2MEV1 1ULEA 1IHMA 5A70A 1QQP2 3POBA 5L9BA 4CPBD 1HB1A 3WVJA 2J42A 2W95A 3DUIA 3W5NA 1W6QB 1MVQA 1PGL2 5KHIA 1MQTA 2W52A 2GNTA 1BJQA 4FBFA 3LEIA 3J8F3 3NNFA 1QJX1 2E31A 4N8MA 4ZU4A 3ZDVA 1VBC3 5FZAA 4LHSA 2JDHA 1TVGA 3FN9A 5LBCA 3WDTA 5FPAA 1UXZA 3OD0A 3O0VA 1PNFA 2JDPA 3WNKA 3PVNA 1X9TA 1QJZA 2NYYA 1CAVA 1LCLA 4U2AA 1AJOA 3P3NA 4E27A 2ZEZA 2HWC1 5A33B 3O1MA 3J8F2 3WQBA 3ZSEA 5ACA1 4HKOA 1SZBA 2AR6A 2VMFA 3VBFC 3E5UA 2VE1A 3UK9A 3IWZA 4GH4C 5I91A 1ND2B 3AMQA 3PLQA 3KT1A 1CAXB 2JICA 3N7LA 4FSJA 5GLWA 1V9U2 2VZRA 1HV0A 3D5OA 5ANQA 3TEZA 2R1BA 4JKKA 3TWIA 1R093 2QQNA 4FPEA 1ND3B 4JDOA 4WZCA 4MUVA 1A3KA 1JW6A 3WXPA 5L9VA 4GMP0 1XNKA 2OXBA 4N53C 2E32A 2IXJA 2WSUA 3R6SA 1JHNA 1V9U3 3I4IA 4N9IA 3GM8A 4GXLA 2J22A 2JEMA 3NNGA 4J1XA 3ZXEA 4DRVA 4AVAA 1XU2A 3RI9A 4BQ3A 3MPBA 5A7OA 4LBQA 4A3XA 1ZM1A 2K9ZA 3MF9A 3PIGA 2VQAA 2LW8A 4QXCA 2AYHA 4CUBA 1RUI3 5JUVA 2R0HA 2QFEA 1YWKA 2HWD3 1LR5A 1Y4WA 1ULOA 2GC3A 1ENQA 2WR9A 2BEOA 3KF3A 4URTA 4NIIA 3NVCA 4LITA 3RYRA 4I2OA 1AYM2 3WG2A 3AXEA 3ZYFA 4AEDA 3V0BA 4LIUA 4QX3A 4WVZA 1SDWA 3WDYA 1W2NA 5IATA 2Y38A 3HT2A 3C3VA 4QAWA 3OEBA 4YM0A 5DDJ3 1WLCA 3T1LA 1N1YA 1QXJA 4R9AA 4B3NA 2FCUA 1AL22 1LJ7A 1VRH3 1LNSA 5T5LA 1B09A 4HFSA 4PDWA 3CHXA 4XJAA 2PLV3 2EXKA 3ZSJA 3BPZA 1GWLA 2WABA 1YQ8A 1SLBA 1YI9A 1ZZ8A 2ES3A 5JIAA 3T2PA 4PI2A 5FLHA 1NUKA 2DUOA 4JGZA 1JZ3A 4Q0PA 1OFSA 4COWA 1DQ4A 2D97A 2EIGA 4JRAA 2YGLA 1AL0G 3IIAA 4ZU7A 2W94A 4XFHA 1RUG2 2TEPA 5LRRA 4A7KA 4IV1A 5T55A 1RXFA 5GALA 3TN91 2WNOA 1GFF2 2X5IA 4JTOA 5LB6A 2TUNA 5IK4A 5FLIA 1ZRRA 4Q4W2 3WY6A 2R6QA 4QMAA 4CDUC 3B7MA 4CXYA 2RS51 1ZZCA 1QU0A 1UYZA 4IE7A 3V0BB 4RYDA 5FYYA 1V6NA 4FFIA 2JG8B 2A6ZA 4XF4A 4XMIA 2EF6A 2PAEA 2UU8A 1QDOA 2QQLA 2RV9A 3DPRA 4QX7A 1VBB3 3DYMA 2ZX4A 4U36A 3RSJA 1OLME 1BBT1 3T0BA 1LRHA 3OUJA 3NKGA 2QQIA 4LBOA 4AHWA 4OUMA 1JS9A 3M7AA 1QGLA 3W58A 3V64A 1D7PM 1X7NA 3I59B 1K5JA 3AVSA 3SMHA 3ZXJA 1OD3A 1WW4A 3Q8BA 5JR7B 1WCKA 3WD5A 4D6QA 1AX0A 2I45A 1RIRA 5I8YA 3E6BA 3N35A 3TNQA 4OI4A 2OA2A 3KHCA 1NG0A 3CLPA 2A7AA 3KCCA 2ARXA 3WUCA 4WVVA 4AQTA 4ASLA 1W6PA 4EZ4A 3BI3A 4QB6A 1ZBA2 4E4HA 3VD7A 1H9WA 2WNUB 1F5JA 4LLOA 3C7FA 4UXAA 2VR4A 5CB7A 1F5FA 3E1F1 1AR71 5F6KA 1HXS2 1NE6A 4A44A 3U4SA 1UX7A 5FKBA 4ET7A 2HYKA 4GD4A 4GULA 4PIYA 1F35A 5D21A 3ZFGB 1EUTA 2V72A 2ET7A 5FY1A 4GH4B 3WF0A 1E5HA 4TLGA 4BU2A 4LA3A 1RUF2 2XWBB 4N7UA 5GZGA 2Y26A 2BV4A 3H3LA 4NHKA 1F4AA 4WV8A 4PHZA 1G7YA 4XABA 2A3XA 2D44A 2GDFA 2WNVC 3KV6A 2XVGA 3A7QA 1AR61 1I5PA 5H9PA 5BNPC 3I2OA 4D6RA 5C8CA 1VJ2A 3GNEA 3RJ2X 4FPHA 5JSRA 3POSA 4Y1VA 3IDEA 1GP6A 4TN7A 3WNOA 4H3WA 4XFAA 2VTXJ 2VZUA 1BLZA 3LEMA 4ONUA 2VZSA 1HQNA 4IE6A 3ORJA 4ZY9A 4Y5SA 3BIEA 2JXAA 3B00A 1AYN1 1CZTA 1L7LA 1W0OA 2DUQA 4KH9A 3AJZA 3AKPA 3NAPB 5D2AA 4QGLA 3TYJA 4CCCA 4E8DA 4E4ZA 1HN0A 1QJX2 5KHGA 2MEV2 4I0BA 5HCBA 4XMAA 1JYXA 4P9XA 3S7EA 5IVYA 4IGOA 2GALA 1AZDA 2QE3A 3HQUA 3LGRA 1VRH1 2EALA 4L8QA 4MH0E 3RWKX 1LGNA 5LA9A 2O8QA 4INDA 3WW1A 2AGSA 2XVKA 1OURA 2LS6A 4UFKA 1CIYA 3ZFGA 5KXEA 1QJX3 1AX1A 1VAMA 2ZAAA 4HZFA 1IS3A 2QQWA 3AK0A 3I2FA 1UMZA 2ZKLA 5FREA 3KCYA 5HV0A 1RUC1 2PFWA 4PI0A 3KQRA 5F6LB 2GMPA 3THDA 1RUD1 1F8VA 1HDKA 3LDKA 4PBOA 1Z7S1 5C9AC 1OQEA 3WG1A 1VBD3 2PHLA 3GBWA 3ILRA 4I0AA 2BYVE 1S0EA 4NE9A 3BVCA 3AYEA 4ZXEA 4CDUA 2IVJA 1PGW1 3H7JA 4QM9A 3ZYJB 1NA1A 2PTMA 1ODNA 3LKJA 3A23A 1RUE3 1TME3 3AXDA 1UMIA 3HAGA 3MIDA 4M3CA 2E51A 4AZZA 4XAAA 3E6CC 2JENA 4Q4Y3 2VUDA 2Y6GA 3VDAA 2AH2A 4R9CA 1S0JA 1YUDA 4OVEA 1VBD2 5DZFA 4Q4Y1 4K7JA 4CXXA 2Z79A 1GQGA 3BALA 1EYBA 1TME2 3ZKYA 4GB31 1W8HA 4IGQA 2VU9A 5FOJB 1I6XA 3VBUC 2BNMA 2BOIA 1YQ6A 5EJZB 1RUF1 1ZYBA 2RR11 4SBVA 3DPRB 4Q0UA 2ZGUA 3RYKA 3KMHA 4OUEA 1GU3A 2HWF1 2VMCA 4CZSA 1JZ7A 3ZLIA 2Q8OA 4IL7A 2E33A 4GWMA 4R52A 2JKXA 1MZEA 2WNEA 4MX3A 2Y34A 1RUH1 3BB6A 5F5AA 4BQ4A 4HVQA 1VBA3 1BHGA 5A32B 5LY1A 2RR12 1FMD3 2Q1ZB 2VC9A 4QU1A 2DCYA 1VBB1 3F95A 1HJFA 1XRUA 4CDXC 2ZA9A 1DGRN 2IXHA 2X53S 3ROUA 3M3CA 2WNUA 4Q26A 3C7OA 4XQWA 2OUHA 4LTAA 1TG7A 3ZXKA 2RM23 4RHV2 1V6JA 2BNOA 5SV5A 1N1SA 3MZHA 4BQXA 1GOFA 4P9GA 4YW7A 4BB3A 1QXPA 5DABA 4FP2A 3QH7A 5A3OA 1LU1A 4GALA 2PHWA 5H9SA 5A7PA 1H6XA 1UYYA 2Y33A 4RHV3 4DXZA 5ACA3 2R061 1BXHA 3NV3A 2RS11 1RGSA 3FHQA 4CEYC 1C1FA 4NWWA 5FPZA 4Q4W1 3ETQA 4OQ9A 4BQ1A 2CU5A 1NQJA 2WYSA 3AB0A 4IEVA 4M3CF 1MQTC 4IV3B 3SCHA 4AFDA 3TAYA 4LQRA 1EY2A 1DGWA 1WMFA 4D7YA 4IDZA 2ZBJA 4MOAA 1UY0A 2XWJB 5EV7A 4KWJA 4OHVA 2P3IA 1ASJ2 2AZ5A 2YV8A 3NW4A 4W4ZA 2CAVA 4XF3A 5F3EA 4YW2A 2Q5TA 3AX4A 3RMYA 4BQYA 3RZLA 1G8WA 5FZ4A 4BJ0A 3FE5A 1UOGA 1HB4A 2HEWF 4UYBA 3M70A 3CQOA 4K20A 5G05L
chains in the Genus database with same CATH topology
3LPFA 3WF4A 2C4XA 3MV11 3HJRA 3NJXA 4AG4A 3U37A 3LEKA 3VD3A 2X10A 1W9TA 1K3IA 2JE8A 3HNMA 4W8JA 2J1TA 4QX2A 3F2ZA 3I3BA 3EB7A 5HPOA 3CZJA 3THCA 3MV01 4UAPA 4CUAA 1K45A 1CZVA 2W5FA 4XUPA 5JXHA 3WSOA 1OH4A 2VJXA 3T0DA 2VCBA 1DYOA 5JXGA 1L7QA 1JYVA 2ZEYA 4LPLA 3ACIA 1O8SA 3HEIA 3IB3A 2DCJA 1JU4A 2EICA 3WF3A 4KMQA 2YC2A 5C71A 2WZEA 3K4DA 4CU7A 5EJ1B 1L7RA 2Y6LA 3K75B 2RJ2A 2R7EB 4CUCA 1XPWA 2C9KA 2YB7A 3HN3A 3UETA 1UY1A 4PT6A 1JZ2A 4A6OA 4TXWA 4MGQA 4QX0A 1J83A 1CZSA 5B4NA 2J1SA 3LPGA 2DDUA 3I2GA 2QQKA 2Y6HA 1W99A 2VZTA 2QQOA 1UY4A 4JKLA 4DXRA 3GDBA 2OKXA 1JYNA 4XURA 2WUHA 2W91A 4KI5M 2B9VA 3VDBA 1GOGA 4OYUA 4DUVA 3VD5A 4AAXA 1YQ2A 4OMDA 3MUY1 3CZUA 2V5DA 3A22A 5J1XA 3FL7A 4YPJA 3T0AA 3C7EA 2WO1A 1O59A 2V4VA 1MPXA 3OGVA 5DMYA 3OGRA 2VZVA 2ZEWA 4BDVB 3W5MA 4QX1A 4ZZ5A 4P5YA 5IFTA 4RN5A 4MGSA 4HG6B 4TTGA 1UYXA 1W9SA 2W1SA 3C7HA 2J1RA 2VL4A 3C7GA 3I97A 3I3EA 3SEEA 4ZZ8A 4BK4A 3WNNA 2WBKA 1KGYA 3FHAA 3CDZB 2EIEA 5LA0A 2VQTA 3I2HA 3SKVA 5C70A 4CU9A 2VZQA 3W5NA 2W95A 1JZ8A 3BGAA 1PX4A 2VMDA 2XHNA 3D3AA 3DYPA 3LEIA 2E31A 4IUGA 5DQ0A 3WNPA 5CZKA 4LHSA 2W1WA 1TVGA 3FN9A 2W46A 1UXZA 3UESA 1PMJX 2J1VA 3WNKA 2VZPA 3VD4A 2Z4FA 3ECQA 1JYWA 2VCAA 2ZEZA 1JI6A 4M4PA 3WQBA 3VDCA 1IQDC 1JHJA 3EYPA 2VMFA 5JMOA 2BGOA 2W87A 1OT5A 3T2OA 5LCWL 4QDQA 1CX1A 2VZRA 2B4KA 4JKKA 4DXSA 3ACGA 2QQNA 2C26A 5LA1A 2BZDA 1PMHX 2E32A 3WF1A 3NQHA 2VZOA 3I2JA 4UI9L 3GM8A 2W9XA 1NKGA 4LKSA 2J22A 2HYXA 3NNGA 1UXXX 3PUIA 4XZUG 2WAAA 4CU6A 1KEXA 2KD7A 2LW8A 4P08A 4CUBA 5JUVA 5JXJA 2Y6KA 3I2IA 1ULOA 4CVUA 1P8JA 1WCQA 4QX3A 4XUQA 3T08A 4D8MA 2HLEA 2WN3A 3OEBA 3OB8A 4QAWA 4DXTA 2L9LA 3WEZA 3A21A 1DP0A 5A1AA 3T0BA 1DLCA 2YFZA 1LNSA 1O8PA 4W50A 4E8CA 1GUIA 2VCCA 2WABA 5HXMA 1OF3A 3T2PA 1NUKA 2VM9A 1JZ3A 3C8XA 4OMCA 3K4ZA 3CIHA 3MBWA 3MO4A 3NJVA 2WZ8A 4PQQA 3LEGA 2ORZA 2W94A 3HNBM 4JX0A 2ZXQA 1US2A 4Z2AA 2ID4A 5CYYA 1HN1A 2Y6JA 2ZEXA 4QDSA 5C7GA 3ETPA 1R64A 4XUNA 1K12A 1UYZA 2VQUA 5JXIA 3NRUA 4RYDA 2YG0A 1US3A 3MUZ1 3SKJE 1W8OA 2VTFA 2DCKA 2QQLA 1K42A 2RV9A 5IYYA 3DYMA 2XQXA 1W9WA 4JHZA 1JZ4A 4L0PA 2QQIA 4QPWA 3IDAA 2PQSA 2XONA 1EUUA 3ACFA 4MO3M 1D7PM 1T2XA 3LQCA 1OD3A 2J1UA 2Y8KA 1XNAA 2VOTA 2W92A 3T09A 2WDBA 3WF2A 3CKHA 1WKYA 4GWIA 4QB6A 3VD7A 4A42A 3C7FA 1XC6A 2VR4A 3E1F1 3BN6A 4FI9A 1JU3A 4M4RA 4A44A 3IIIA 1UX7A 2WAOA 3GXUA 4ET7A 3T2QA 3IAQA 2Y64A 2CDOA 4JKMA 1EUTA 2V72A 5B4XA 1ULPA 4A3ZA 2E26A 1GNYA 5JR2A 3WF0A 3DECA 4ARXA 3OBAA 3WNLA 1H6YA 4A4AA 1F4AA 4D0QA 2BGPA 1GOHA 3IAPA 2J7MA 3A7QA 1I5PA 3DYOA 3HNYM 2CDPA 4A45A 5G04L 4OZOA 4DEVA 3LE0A 4MADA 3P1IA 3WNOA 2VZUA 2VZSA 1JZ5A 4A41A 2EIDA 4ZY9A 3K77A 4KWUA 1CZTA 2BBAA 4E8DA 4PF1A 1JYXA 2WO3A 4ARYA 2VZ1A 3OG2A 1OF4A 2J1AA 5DN2A 4QDRA 3ABZA 2VO5A 2LS6A 1UZ0A 1CIYA 3I2FA 5EIYB 3PUHA 3P6BA 5FUIA 3THDA 2RVAA 4ZXEA 4GWJA 4UOJA 3A23A 1UMIA 4QB1A 2Y6GA 3VDAA 1W8NA 1SHWB 2XOMA 3K46A 3I3DA 3AC0A 1UY3A 1RYYA 4CU8A 4QB2A 3WNMA 2QQJA 5IHRA 5EJZB 1UY2A 3ACHA 4DEQA 2QQMA 2JDAA 4OUEA 2YFUA 1GU3A 2VMCA 1JZ7A 3J7HA 2W1QA 2ORXA 2E33A 2WN2A 2JKXA 3CMGA 5DPNA 3HOBA 1BHGA 2X09A 2YC4A 3JXSA 1GMMA 2VC9A 4BXSV 2WQ8A 1JZ6A 1XNTA 5I0DA 1GQPA 3OEAA 3C7OA 1UWWA 5LA2A 1TG7A 5IJRA 3VD9A 3K4AA 3HPNA 4DUWA 1GOFA 1W0NA 1J84A 2VMEA 2X05A 4P00B 1H6XA 4XUOA 1UYYA 3OGSA 2EIBA 1UMHA 1NX9A 1SDDB 2W47A 3FHQA 2W3JA 5F7UA 2QBXA 1SG3A 3GGLA 3I2KA 2WO2A 1F4HA 2WYSA 3ZM8A 4XUTA 2W1UA 2BERA 4LQRA 4GZ9A 2J1EA 4MOAA 1UY0A 3UNPA 1PX3A 2JD9A 4W4ZA 1NAEA 4P02B 2VZ3A 4DUXA 3SEPA 4XVHA 4BJ0A 4BK5A 5IFPA 3CQOA 5G05L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LPF A;  3WF4 A;  2C4X A;  3MV1 1;  3HJR A;  3NJX A;  4AG4 A;  3U37 A;  3LEK A;  3VD3 A;  2X10 A;  1W9T A;  1K3I A;  2JE8 A;  3HNM A;  4W8J A;  2J1T A;  4QX2 A;  3F2Z A;  3I3B A;  3EB7 A;  5HPO A;  3CZJ A;  3THC A;  3MV0 1;  4UAP A;  4CUA A;  1K45 A;  1CZV A;  2W5F A;  4XUP A;  5JXH A;  3WSO A;  1OH4 A;  2VJX A;  3T0D A;  2VCB A;  1DYO A;  5JXG A;  1L7Q A;  1JYV A;  2ZEY A;  4LPL A;  3ACI A;  1O8S A;  3HEI A;  3IB3 A;  2DCJ A;  1JU4 A;  2EIC A;  3WF3 A;  4KMQ A;  2YC2 A;  5C71 A;  2WZE A;  3K4D A;  4CU7 A;  5EJ1 B;  1L7R A;  2Y6L A;  3K75 B;  2RJ2 A;  2R7E B;  4CUC A;  1XPW A;  2C9K A;  2YB7 A;  3HN3 A;  3UET A;  1UY1 A;  4PT6 A;  1JZ2 A;  4A6O A;  4TXW A;  4MGQ A;  4QX0 A;  1J83 A;  1CZS A;  5B4N A;  2J1S A;  3LPG A;  2DDU A;  3I2G A;  2QQK A;  2Y6H A;  1W99 A;  2VZT A;  2QQO A;  1UY4 A;  4JKL A;  4DXR A;  3GDB A;  2OKX A;  1JYN A;  4XUR A;  2WUH A;  2W91 A;  4KI5 M;  2B9V A;  3VDB A;  1GOG A;  4OYU A;  4DUV A;  3VD5 A;  4AAX A;  1YQ2 A;  4OMD A;  3MUY 1;  3CZU A;  2V5D A;  3A22 A;  5J1X A;  3FL7 A;  4YPJ A;  3T0A A;  3C7E A;  2WO1 A;  1O59 A;  2V4V A;  1MPX A;  3OGV A;  5DMY A;  3OGR A;  2VZV A;  2ZEW A;  4BDV B;  3W5M A;  4QX1 A;  4ZZ5 A;  4P5Y A;  5IFT A;  4RN5 A;  4MGS A;  4HG6 B;  4TTG A;  1UYX A;  1W9S A;  2W1S A;  3C7H A;  2J1R A;  2VL4 A;  3C7G A;  3I97 A;  3I3E A;  3SEE A;  4ZZ8 A;  4BK4 A;  3WNN A;  2WBK A;  1KGY A;  3FHA A;  3CDZ B;  2EIE A;  5LA0 A;  2VQT A;  3I2H A;  3SKV A;  5C70 A;  4CU9 A;  2VZQ A;  3W5N A;  2W95 A;  1JZ8 A;  3BGA A;  1PX4 A;  2VMD A;  2XHN A;  3D3A A;  3DYP A;  3LEI A;  2E31 A;  4IUG A;  5DQ0 A;  3WNP A;  5CZK A;  4LHS A;  2W1W A;  1TVG A;  3FN9 A;  2W46 A;  1UXZ A;  3UES A;  1PMJ X;  2J1V A;  3WNK A;  2VZP A;  3VD4 A;  2Z4F A;  3ECQ A;  1JYW A;  2VCA A;  2ZEZ A;  1JI6 A;  4M4P A;  3WQB A;  3VDC A;  1IQD C;  1JHJ A;  3EYP A;  2VMF A;  5JMO A;  2BGO A;  2W87 A;  1OT5 A;  3T2O A;  5LCW L;  4QDQ A;  1CX1 A;  2VZR A;  2B4K A;  4JKK A;  4DXS A;  3ACG A;  2QQN A;  2C26 A;  5LA1 A;  2BZD A;  1PMH X;  2E32 A;  3WF1 A;  3NQH A;  2VZO A;  3I2J A;  4UI9 L;  3GM8 A;  2W9X A;  1NKG A;  4LKS A;  2J22 A;  2HYX A;  3NNG A;  1UXX X;  3PUI A;  4XZU G;  2WAA A;  4CU6 A;  1KEX A;  2KD7 A;  2LW8 A;  4P08 A;  4CUB A;  5JUV A;  5JXJ A;  2Y6K A;  3I2I A;  1ULO A;  4CVU A;  1P8J A;  1WCQ A;  4QX3 A;  4XUQ A;  3T08 A;  4D8M A;  2HLE A;  2WN3 A;  3OEB A;  3OB8 A;  4QAW A;  4DXT A;  2L9L A;  3WEZ A;  3A21 A;  1DP0 A;  5A1A A;  3T0B A;  1DLC A;  2YFZ A;  1LNS A;  1O8P A;  4W50 A;  4E8C A;  1GUI A;  2VCC A;  2WAB A;  5HXM A;  1OF3 A;  3T2P A;  1NUK A;  2VM9 A;  1JZ3 A;  3C8X A;  4OMC A;  3K4Z A;  3CIH A;  3MBW A;  3MO4 A;  3NJV A;  2WZ8 A;  4PQQ A;  3LEG A;  2ORZ A;  2W94 A;  3HNB M;  4JX0 A;  2ZXQ A;  1US2 A;  4Z2A A;  2ID4 A;  5CYY A;  1HN1 A;  2Y6J A;  2ZEX A;  4QDS A;  5C7G A;  3ETP A;  1R64 A;  4XUN A;  1K12 A;  1UYZ A;  2VQU A;  5JXI A;  3NRU A;  4RYD A;  2YG0 A;  1US3 A;  3MUZ 1;  3SKJ E;  1W8O A;  2VTF A;  2DCK A;  2QQL A;  1K42 A;  2RV9 A;  5IYY A;  3DYM A;  2XQX A;  1W9W A;  4JHZ A;  1JZ4 A;  4L0P A;  2QQI A;  4QPW A;  3IDA A;  2PQS A;  2XON A;  1EUU A;  3ACF A;  4MO3 M;  1D7P M;  1T2X A;  3LQC A;  1OD3 A;  2J1U A;  2Y8K A;  1XNA A;  2VOT A;  2W92 A;  3T09 A;  2WDB A;  3WF2 A;  3CKH A;  1WKY A;  4GWI A;  4QB6 A;  3VD7 A;  4A42 A;  3C7F A;  1XC6 A;  2VR4 A;  3E1F 1;  3BN6 A;  4FI9 A;  1JU3 A;  4M4R A;  4A44 A;  3III A;  1UX7 A;  2WAO A;  3GXU A;  4ET7 A;  3T2Q A;  3IAQ A;  2Y64 A;  2CDO A;  4JKM A;  1EUT A;  2V72 A;  5B4X A;  1ULP A;  4A3Z A;  2E26 A;  1GNY A;  5JR2 A;  3WF0 A;  3DEC A;  4ARX A;  3OBA A;  3WNL A;  1H6Y A;  4A4A A;  1F4A A;  4D0Q A;  2BGP A;  1GOH A;  3IAP A;  2J7M A;  3A7Q A;  1I5P A;  3DYO A;  3HNY M;  2CDP A;  4A45 A;  5G04 L;  4OZO A;  4DEV A;  3LE0 A;  4MAD A;  3P1I A;  3WNO A;  2VZU A;  2VZS A;  1JZ5 A;  4A41 A;  2EID A;  4ZY9 A;  3K77 A;  4KWU A;  1CZT A;  2BBA A;  4E8D A;  4PF1 A;  1JYX A;  2WO3 A;  4ARY A;  2VZ1 A;  3OG2 A;  1OF4 A;  2J1A A;  5DN2 A;  4QDR A;  3ABZ A;  2VO5 A;  2LS6 A;  1UZ0 A;  1CIY A;  3I2F A;  5EIY B;  3PUH A;  3P6B A;  5FUI A;  3THD A;  2RVA A;  4ZXE A;  4GWJ A;  4UOJ A;  3A23 A;  1UMI A;  4QB1 A;  2Y6G A;  3VDA A;  1W8N A;  1SHW B;  2XOM A;  3K46 A;  3I3D A;  3AC0 A;  1UY3 A;  1RYY A;  4CU8 A;  4QB2 A;  3WNM A;  2QQJ A;  5IHR A;  5EJZ B;  1UY2 A;  3ACH A;  4DEQ A;  2QQM A;  2JDA A;  4OUE A;  2YFU A;  1GU3 A;  2VMC A;  1JZ7 A;  3J7H A;  2W1Q A;  2ORX A;  2E33 A;  2WN2 A;  2JKX A;  3CMG A;  5DPN A;  3HOB A;  1BHG A;  2X09 A;  2YC4 A;  3JXS A;  1GMM A;  2VC9 A;  4BXS V;  2WQ8 A;  1JZ6 A;  1XNT A;  5I0D A;  1GQP A;  3OEA A;  3C7O A;  1UWW A;  5LA2 A;  1TG7 A;  5IJR A;  3VD9 A;  3K4A A;  3HPN A;  4DUW A;  1GOF A;  1W0N A;  1J84 A;  2VME A;  2X05 A;  4P00 B;  1H6X A;  4XUO A;  1UYY A;  3OGS A;  2EIB A;  1UMH A;  1NX9 A;  1SDD B;  2W47 A;  3FHQ A;  2W3J A;  5F7U A;  2QBX A;  1SG3 A;  3GGL A;  3I2K A;  2WO2 A;  1F4H A;  2WYS A;  3ZM8 A;  4XUT A;  2W1U A;  2BER A;  4LQR A;  4GZ9 A;  2J1E A;  4MOA A;  1UY0 A;  3UNP A;  1PX3 A;  2JD9 A;  4W4Z A;  1NAE A;  4P02 B;  2VZ3 A;  4DUX A;  3SEP A;  4XVH A;  4BJ0 A;  4BK5 A;  5IFP A;  3CQO A;  5G05 L; 
#chains in the Genus database with same CATH topology
 4AFB A;  1VPH A;  3CU7 A;  3AFK A;  3HJR A;  2ZGK A;  4CCM A;  3NAP C;  3LEK A;  2D6K A;  2X10 A;  1JYT A;  2D6O X;  1EV1 3;  4S2G A;  3I2D A;  4HL0 A;  3TB0 A;  3UKN A;  2V73 A;  5K0U B;  1QQP 1;  5L7O B;  3T1M A;  3NST A;  2J1T A;  4C1X A;  1AL2 1;  1MZ6 A;  2WKK A;  3AP7 A;  3F2Z A;  4UFM A;  4QXK A;  5HPO A;  3FLT A;  4FOY A;  3ALQ A;  3CL1 A;  4JQT A;  4A7Z A;  1SCS A;  1HKD A;  2V09 A;  4KWL A;  3O1U A;  4LBN A;  1Y9M A;  2E63 A;  4UAP A;  4YGE A;  1GP4 A;  1RUD 3;  5HCF A;  3Q8F A;  4B29 A;  4MGY E;  2H0V A;  2VJX A;  2VNG A;  2BW8 A;  4X8P A;  4Z82 A;  2Q0A A;  3KF5 A;  4ZU5 A;  4BA6 A;  2ZS6 B;  4DY3 A;  2OW4 A;  5J3U A;  4UFH A;  4IV3 A;  1VBE 1;  3KWV A;  4NRM A;  2ZEY A;  4QHO A;  5FR3 A;  5FZI A;  4EN7 B;  3PDQ A;  2VVE A;  3WQ1 A;  2DCJ A;  3WF3 A;  4NO4 A;  1C8N A;  2ZMK A;  1KIT A;  3ZFF A;  3OTF A;  4YYO A;  3OPZ A;  5FZL A;  4AVS A;  4LKE A;  4V1P A;  1WW7 A;  2HWC 3;  4I30 A;  3GJA A;  3K4D A;  4FFF A;  1HLC A;  2VEC A;  2VW2 A;  2ZHM A;  3MLJ A;  4Y4R A;  3RZZ A;  2JG9 B;  3RZM A;  4CUC A;  4XIL A;  3WZ1 A;  1AR6 2;  2KR2 A;  3HN3 A;  2KA3 A;  5C3S A;  1AUY A;  4KBB A;  1NLS A;  1UOB A;  4NMI A;  1L3J A;  2BU9 A;  1UZY A;  4YW6 A;  4GJY A;  3MHZ A;  3UT0 A;  5A3L A;  3LCP A;  1JZ2 A;  4CDQ A;  2PHF A;  1QJF A;  1J83 A;  1KQR A;  1OH3 A;  1AR6 3;  3AMM A;  3PIJ A;  5EYY A;  4AQ2 A;  3PJQ A;  1WBF A;  2QQV A;  2VUC A;  2DDU A;  2E53 A;  3L2Y A;  3OY8 B;  3RWN A;  4BPZ A;  4Z2W A;  1OOP C;  2XL7 A;  4IEW A;  5CFD A;  5A6Z A;  1WGP A;  2QQO A;  3I8T A;  4ATE A;  4JKL A;  1QHD A;  1LEM A;  5FK8 A;  1WLW A;  4YZ2 A;  4XUR A;  1LEC A;  2RDR A;  1QQP 3;  5LZ6 A;  2WUH A;  5FP3 A;  1W6M A;  2HEV F;  1W2A X;  5F3I A;  1LB2 A;  2HWD 1;  2WL1 A;  3POY A;  5DUW A;  1C8M 1;  5ANN A;  3HVD A;  2OQ7 A;  3NV4 A;  1EPW A;  4PBP A;  1RHI 1;  5E6H A;  4QGM A;  1GOG A;  5SV8 A;  4XBN A;  3FJS A;  4MZU A;  4XAC A;  3JB4 C;  4AAX A;  2CYF A;  3J7N A;  2WSV A;  4XW3 A;  3B01 A;  2A1X A;  3PVB B;  2GSY A;  2YZ4 A;  3KV9 A;  5GLV A;  1UCX A;  4RFR B;  3WQ7 A;  1OQD A;  3R4S A;  4YRD A;  5GZE A;  3T0A A;  4CDW A;  2PN5 A;  1G6N A;  2AEZ A;  4AK3 A;  4EN8 B;  1Z0H A;  4Y1U A;  3ZFE B;  4Q4V 3;  4HT1 T;  1UW8 A;  1Q8V A;  3AZW A;  4ERO A;  2RMU 2;  4BDV B;  3LA3 A;  4GJZ A;  4DB5 A;  5F2W A;  2YUE A;  4ZZ5 A;  2YBS A;  1VBE 2;  3NWK A;  2YYO A;  4PJY A;  2RS3 2;  4I02 A;  1R08 2;  3SHR A;  5GLT A;  3ILF A;  1W04 A;  2QZ2 A;  2HWE 1;  2J1R A;  5FYU A;  2BJS A;  1C8M 3;  2R16 A;  3GAL A;  3QD6 A;  5D1I A;  2N7G A;  3HMY A;  2Q8E A;  3ST7 A;  1DIW A;  2NP0 A;  5IK7 A;  2WBK A;  4G9S B;  4WM7 A;  3FHA A;  3CDZ B;  2XJR A;  4BQW A;  5LA0 A;  3S30 A;  5LRS A;  5FMB A;  1RHI 2;  2GP3 A;  3DL3 A;  1GLH A;  2CWM A;  4YVW C;  1SCR A;  2A75 A;  2XJS A;  3PVO A;  2HWD 2;  3H8U A;  5M0T A;  4IEP A;  1ENS A;  1C8M 2;  2W2I A;  3N9L A;  2ZGN A;  5A7N A;  3ZN5 A;  1JZ8 A;  2FDG A;  4WM8 A;  2XHN A;  4IUG A;  3N4M A;  1UQX A;  2ADE A;  3ZXL A;  3E97 A;  4NUB A;  3VHO A;  3TNP B;  2WQ4 A;  3I59 A;  1RHI 3;  1FV2 A;  5CIS A;  3UES A;  1PMJ X;  2J1V A;  5BNP B;  2HWB 1;  4QD2 A;  1FOD 3;  2VGD A;  1FNZ A;  2BNN A;  4K40 A;  1HQW A;  2XKO A;  2Z4F A;  3MDP A;  3U11 A;  2O0O A;  3PUA A;  2CSG A;  2ZOE B;  4ZXK A;  5FZB A;  1IQD C;  1ZBE 1;  2D98 A;  3KCX A;  1PO2 2;  1IS4 A;  3LOB A;  4K8R B;  5JPN B;  2IFR A;  3VUO A;  3ES1 A;  3HT1 A;  1C4R A;  1STM A;  2R0F A;  2NMO A;  5HCA A;  3NL1 A;  1S4C A;  3VKM A;  1G9A A;  1MS9 A;  5JSO A;  5F32 A;  5CEH A;  1LHU A;  1TMF 1;  1CX1 A;  1A34 A;  4PCR A;  4BME A;  1UU6 A;  2H6B A;  4OHZ A;  2XJV A;  3RZJ A;  4NIH A;  4DXS A;  3OUI A;  2R07 1;  1E5S A;  2BTV C;  1PO2 3;  3AM2 A;  4ASK A;  4CEW B;  2QJV A;  4TWT A;  5F3G A;  2BZD A;  2RS1 2;  4O9E A;  3ITQ A;  2D93 A;  1PMH X;  3NQH A;  2VZO A;  5DUU A;  2PHT A;  2LAL A;  4LKS A;  1ND2 C;  3POF A;  1UXX X;  1LTE A;  2ADD A;  4M0H A;  5FXX A;  4IEU A;  4EJR A;  1ZRD A;  4NHM A;  1Z78 A;  2WAA A;  3O7O A;  4RQP A;  4CU6 A;  1S0D A;  2R07 2;  2RS1 3;  3M3O A;  1ULC A;  3MW3 A;  5BV6 A;  2OII A;  1OHF A;  1ZZ7 A;  3I2I A;  4FFH A;  2WLP A;  3T3Y A;  2P1B A;  3O1S A;  3IBM A;  4FQZ A;  3B9C A;  5FZ9 A;  1W3V A;  1S0B A;  2PYT A;  3N9O A;  1P8J A;  3VB9 A;  3OYW B;  5KXD A;  3V56 A;  2XBO 3;  4NRQ A;  4XUQ A;  4QPG B;  2Z42 A;  2FZ1 A;  4HSJ A;  2C5D A;  2BOJ A;  1W6O A;  3OB8 A;  1X9P A;  2DVF A;  4HVR A;  3H1W A;  3WEZ A;  5A1A A;  1DCS A;  2Q8D A;  2Z69 A;  2DF7 A;  5FAX A;  3IN9 A;  2WWU A;  1WMD A;  3USU B;  1NQD A;  1LOC A;  4YG3 A;  3M3E A;  1W6M B;  4H55 A;  4MGT A;  3KVA A;  5BNQ A;  4W50 A;  4Y5T A;  1PO1 1;  4B7E A;  2FDH A;  4LOS A;  4LUK A;  4YM2 A;  5K9Y A;  1WD3 A;  1QNW A;  2RDQ A;  4BCU A;  5LAS A;  3LSE A;  3FLR A;  4AVT A;  5BNO A;  1B35 A;  1C28 A;  2VM9 A;  3N7J A;  4RS5 A;  4LK6 A;  3AJY A;  4FP3 A;  3M2M A;  4DRR A;  1VBA 1;  2IVI B;  2VNR A;  1YFY A;  3K4Z A;  3MO4 A;  2WO7 A;  4O9G A;  2WZ8 A;  2PMW B;  1SLT A;  5EJ3 A;  1GBG A;  1AR9 2;  3HNB M;  1BVV A;  1HXS 3;  4JX0 A;  2ZXQ A;  1US2 A;  4Z1V A;  4Z2A A;  4L97 A;  4Q4V 1;  4ATF A;  3Q8E A;  5A6X A;  3ZYI B;  3Q8C A;  1FAT A;  2ZEX A;  4QKB A;  4IEQ A;  3TN9 2;  2B5H A;  1YIF A;  4GQ7 A;  3OSD A;  3ETP A;  4AVC A;  3J8F 1;  3VKL A;  3WHT A;  2RHP A;  4G4F A;  5GZF A;  1CPN A;  4KU7 A;  2WRA A;  5JXI A;  1RUF 3;  5JVV A;  3GJB A;  3WV6 A;  2GH8 A;  3H42 B;  2YG0 A;  4RS5 C;  5J09 A;  1RUI 2;  1W8O A;  1PMI A;  2DCK A;  3VBF A;  5ABJ C;  3HN1 A;  3CJI B;  1MS3 A;  4CDX A;  1RUC 2;  4PLM A;  4YM1 A;  1QJU 2;  3AYD A;  5IK8 A;  1AR8 3;  4QPW A;  3A0N A;  5C4W A;  2PQS A;  3TRS B;  4RHV 1;  3ACF A;  5F5C A;  1AR7 3;  1T2X A;  4L2N A;  2A70 A;  3AP5 A;  3LQC A;  4M3C E;  5JOW A;  1W3X A;  1D0H A;  4LA2 A;  1AL2 3;  3VZK A;  1D4V B;  4W65 A;  1VRH 2;  1XNA A;  4HN0 A;  2W92 A;  4D3W A;  1B35 B;  3AZV A;  3GZE A;  2VG9 A;  4Q4X 3;  1PM4 A;  5EYX A;  3T09 A;  2CTV A;  4C0H A;  4MHR A;  1CD3 G;  3WF2 A;  3THT A;  3NV1 A;  2DWR A;  3BTX A;  4GWI A;  2FBE A;  3G6J B;  3WR0 A;  1UX6 A;  3IM0 A;  4W6W A;  3FWE A;  4AHX A;  4IV1 C;  5C4W C;  4PIZ A;  4Q4X 2;  1SQ4 A;  1XU1 A;  1XC6 A;  3P3P A;  3QAC A;  4EWA A;  4CDQ C;  4JGY C;  2TBV A;  4M4R A;  1TQ5 A;  4HKW A;  3CO2 A;  5CVR A;  3SNM A;  5F37 A;  3OCP A;  4PQ9 A;  2IXL A;  2BWC A;  2D43 A;  3T2Q A;  3WP6 A;  2RDS A;  2Y64 A;  4IQP A;  4FTB A;  1PGL 1;  2CDO A;  4JKM A;  1PVC 1;  5JR2 A;  1ULP A;  5I0U A;  1GNY A;  1PK6 B;  2ZHN A;  4Q4W 3;  1O4Y A;  3WLU A;  2E7Q A;  1HB2 A;  5FPV A;  2D7F A;  1D4M 3;  2VMH A;  2Y0I A;  3DCQ A;  3RJR A;  5IK5 A;  2HWB 3;  5FPL A;  4ARX A;  5J96 B;  4M01 A;  3KV4 A;  2YBK A;  1TME 1;  1DHK B;  1MAC A;  4BLI A;  5C9A A;  4RQP C;  1GOH A;  3IAP A;  1DBN A;  4Q4Y 2;  1W8W A;  4A7Y A;  3HNY M;  3NNL A;  4P9I A;  5LBF A;  2GH2 A;  2VXR A;  4A45 A;  5G04 L;  2B9U A;  1G86 A;  2RS3 1;  1OSG A;  1VMH A;  5GJ6 A;  3THP A;  4AI2 A;  5FUP A;  2LM3 A;  1IZ3 A;  5GZD A;  4DPN A;  1GR3 A;  3CJI C;  1FT9 A;  4RQP B;  4TLF A;  5JSP A;  4AGG A;  3BPS A;  3ZMO A;  2P37 A;  5IT6 A;  4I09 A;  1FAY A;  5KHH A;  3O1T A;  2GP5 A;  4ORF A;  3FHI B;  4O65 A;  3WW3 A;  3UL2 A;  5A3T A;  5FIX A;  4ARY A;  2H6C A;  5IWF A;  3QOP A;  1DQ1 A;  1ZBA 3;  2J1A A;  4Y24 A;  4K8F A;  2ILM A;  4QDR A;  3N3H A;  4YGD A;  5KXC A;  5BNO C;  4WZF A;  4KU8 A;  4KWK A;  2EXJ A;  1H1M A;  4KNC A;  3AYA A;  1W0P A;  4Y22 A;  4C90 A;  1H8T C;  5EIY B;  1J58 A;  3B9I A;  3LF7 A;  2JEC A;  3WG3 A;  2F6B A;  3ZYR A;  5AC9 3;  4IV1 B;  4COU A;  3O0W A;  3BTZ A;  3AMH A;  3S0M A;  3FC0 A;  2X5I B;  1LOF A;  3R4D B;  3GHM A;  4MGZ E;  3U75 A;  5K7P A;  2VOW A;  1HRI 3;  4KGG A;  2V4A A;  1DZT A;  2C6S A;  2CAU A;  4XQD A;  4UOJ A;  1WLT A;  2C0Z A;  4NRO A;  4QB1 A;  4AEM A;  1ZBA 1;  1NCQ A;  4B4P A;  5JZG C;  4P9Y A;  1V6M A;  2FCT A;  1UF2 C;  3VV1 A;  3URF A;  1KS4 A;  2IFW A;  4SLI A;  2WYF A;  2W39 A;  2ZHK A;  1SPP B;  2X29 A;  3FFZ A;  1RYY A;  1SLL A;  5T3N A;  4DIQ A;  5ACA 2;  4GKX A;  4LJH A;  2ET1 A;  4QB2 A;  4ISR A;  5AVP A;  2GN7 A;  5E88 A;  1VBD 1;  5IHR A;  2YU2 A;  3H50 A;  1UY2 A;  4DY5 A;  2QQM A;  4AQ6 A;  2JDA A;  3OPT A;  4XJZ A;  3WP5 A;  4Z92 B;  4HK8 A;  1I1E A;  2W1Q A;  2GZW A;  3S5A A;  1EPZ A;  4HMZ A;  3VBS C;  3TBD A;  3VKO A;  1W6P B;  1ASJ 3;  4NID A;  1NZC A;  4FPC A;  2R1D A;  2XLG A;  4WM8 B;  4ZS2 A;  2XJU A;  4Q29 A;  4QXH A;  2NN8 A;  3UGH A;  1D4M 1;  1SMV A;  2PEL A;  3JBG 2;  4XIO A;  1HRV 2;  1LKN A;  1U5Y A;  2YDE A;  1GMM A;  3J7L A;  4LO7 A;  4IGP A;  1FPN 2;  3DPR C;  3JQW A;  1XNT A;  3ACL A;  2WFF 1;  4COY A;  1H4G A;  5ERL A;  3WIN E;  5B4N A;  3PTY A;  4LHN A;  3WW4 A;  3ON7 A;  1BBT 3;  2CL2 A;  3KGL A;  3KT4 A;  1IKQ A;  4YVS B;  2RDN A;  1R08 1;  1HRV 3;  1YQ5 A;  2DCZ A;  4RA0 A;  5JAX A;  2FCV A;  4XFG A;  3ZYP A;  2D6P A;  5EZW A;  1SPP A;  4XDO A;  2UY8 A;  4XFI A;  5DDJ 1;  2ZGS A;  5H9R A;  3MFA A;  1W0N A;  2JDU A;  5LY2 A;  1FNY A;  4HET A;  4YG6 A;  3D8C A;  4LE4 A;  2WQZ C;  3D4K A;  5C8C B;  1QNY A;  1YI7 A;  3GBG A;  1C5H A;  2EIB A;  4LBK A;  1PK6 C;  3S6P A;  2GC0 A;  4XJ8 A;  2W47 A;  5IAV A;  3JD7 3;  4RGK A;  2ZX3 A;  2K2S A;  1J1L A;  1GZT A;  5F7U A;  4B1M A;  1Q8O A;  2X8K A;  5LK5 A;  3ZM8 A;  5GZC A;  5TSW A;  1DF0 A;  1HJG A;  2K46 A;  4IE5 A;  3KGZ A;  2CGP A;  4NPM A;  1IPS A;  1GZC A;  1FPN 1;  5L19 A;  3NJY A;  4AW7 A;  4PF5 A;  4P02 B;  2IWG B;  2VZ3 A;  1OXC A;  1XYO A;  4AQS A;  4DUX A;  4WBB A;  4LOR A;  1QH7 A;  1VBA 2;  2WFF 3;  5FZK A;  2ZGM A;  2AEY A;  1CAW A;  2RR1 3;  2XVL A;  3K3O A;  4J6G A;  3RGB A;  1JUH A;  3LPF A;  3HIF A;  4Q27 A;  4QQO A;  1MVE A;  2BDR A;  1XND A;  2WNU C;  4D7S A;  1ZX5 A;  4GB3 3;  1DQ6 A;  2OYZ A;  3KV5 A;  1SFN A;  1K3I A;  2ZX2 A;  1PHM A;  1W03 A;  3VN4 A;  1YFX A;  4XOG A;  3ZFE C;  1RC6 A;  2PAM A;  4QX2 A;  2HBT A;  3VBU A;  3EB7 A;  4FTS A;  2DTW A;  5A6Q A;  5FZM A;  4LUL A;  5FXV A;  1QJY 3;  3MV0 1;  4R8H A;  3O1P A;  4Y1X A;  4XYX A;  2YBP A;  4NVP A;  4YG0 A;  3T30 A;  1NA1 B;  3MIG A;  3RS6 A;  1KFU L;  2VBB A;  4N7I A;  3N7M A;  2HKX A;  2W5F A;  3IPV B;  3JU9 A;  1GQH A;  2P6H A;  1KXG A;  2JDN A;  1OH4 A;  2OT7 A;  2WFP A;  4BQ5 A;  4LKD A;  1DYO A;  1WUV A;  3B3Q E;  1QJY 2;  1L7Q A;  4XF0 A;  2ARB A;  3H9A A;  1ZRE A;  1ZA7 A;  1O8S A;  4MGI E;  3H8R A;  2XBO 1;  2JG8 C;  2EIC A;  2WNV A;  2WIN B;  1COV 3;  5FYB A;  4S2F A;  5HBA A;  1GYK A;  4GH4 A;  5C3Q A;  4D7T A;  4FPF A;  5T54 A;  4BIF A;  3M3Q A;  3GCW A;  1K5M B;  3NV2 A;  3VL9 A;  3MIF A;  1GZW A;  4CU7 A;  1CON A;  1F15 A;  2A6V A;  1QOO A;  2Y6L A;  4HVO A;  2GAU A;  2YU1 A;  2R7E B;  4XZP A;  1V0A A;  3AFG A;  5BNN B;  1MS5 A;  2BPA 2;  2C9K A;  5FZO B;  3A0K A;  3RDI A;  3UET A;  4F7Z A;  1KFX L;  1COV 2;  2CHH A;  4UWD A;  5DAX A;  4Q8K A;  2WII B;  3SXW A;  1O3S A;  3VBR A;  5FXW A;  1H2M A;  3B94 A;  3V65 A;  3G7D A;  5FPB A;  4EZH A;  1YIP A;  4NR1 A;  4OI0 A;  3M1H A;  2VOK A;  1ODM A;  3ZXF A;  1PO2 1;  3PUS A;  4MGQ A;  4QX0 A;  1N3P A;  1SFP A;  3M3I A;  2BFU S;  5FOB B;  1CWP A;  2J1S A;  4ITC A;  3PUQ A;  4UW5 A;  5J98 B;  4K9S A;  1RMU 1;  4JHT A;  1O7F A;  3VDD C;  3ES4 A;  3IPV A;  3VZO A;  5JLV A;  1MR5 A;  2VZT A;  2RJL A;  1WCU A;  3GDB A;  4JZR A;  4QPI B;  1QY4 A;  2AUY A;  4MXW B;  3ZN6 A;  2FDK A;  1UKG A;  4ZKT B;  4I01 A;  5FUN A;  2VUJ A;  3AVR A;  3N9P A;  3OYW A;  4Y5Z 0;  3IMM A;  4CUG A;  4L92 A;  2B9V A;  5KXB A;  5FYC A;  3O12 A;  2A3Y A;  4OHX A;  2I2S A;  4Q0V A;  5FP8 A;  4C0B A;  5L36 A;  1RUE 1;  1W6O B;  4LO5 B;  4JCK A;  2BGC A;  1QOS A;  5I0T A;  2EVX A;  3BU0 A;  4YVS A;  1RUN A;  3V0A A;  3VD5 A;  1LHW A;  1ST8 A;  2R32 A;  4GIQ A;  2G9G A;  3NJZ A;  3MUY 1;  4OMD A;  4YVW B;  2Y0O A;  3ZPY A;  4EWD A;  4DNY A;  5A80 A;  2V5D A;  1X8E A;  1RVF 3;  4LMF A;  2PXJ A;  3FL7 A;  4UBG A;  3RPQ A;  3DGT A;  4QPG C;  4YPJ A;  3ZXA C;  4D6S A;  3OJB A;  1MS8 A;  2VOX A;  3WDX A;  1MZF A;  2XJT A;  2V4V A;  1CAU B;  3OGV A;  5A6Y A;  3NNM A;  4ISQ A;  2GU9 A;  1R1A 3;  1NXD 1;  4XF9 A;  4DQA A;  1AVB A;  4P14 A;  1JOP A;  5KBF A;  2FDF A;  3VKF C;  3M4F A;  4P5Y A;  3DKW A;  3K3N A;  1PVX A;  2WS9 2;  1CAX A;  4OUS A;  4RN5 A;  2F17 A;  5KC5 A;  3J4U H;  3VBO C;  3AP4 A;  4HG6 B;  5BNN C;  1LOF C;  1OUS A;  1R1A 2;  3C7G A;  1PVC 3;  3MEP A;  1W2O A;  4MXW A;  2ZGT A;  5FMO L;  3ZN6 B;  5IAX A;  4RL7 A;  4ZZ8 A;  2P3K A;  2HJI A;  4N90 A;  4FVV A;  1GWK A;  2WS9 3;  1XB9 A;  1QJE A;  2EIE A;  3JBG 1;  3W59 A;  4ZON A;  4AYU A;  4X6R B;  1X33 A;  2RE9 A;  5FO9 B;  1PVC 2;  4EV0 A;  5JCT A;  5FZC A;  2PA7 A;  3VBH A;  1GZ9 A;  2BUK A;  3BGA A;  5FBJ A;  1PX4 A;  1RIN A;  2VMD A;  3D3A A;  3DYP A;  4UFL A;  3WNP A;  3EO6 A;  3IZO A;  5CZK A;  2DYC A;  3AZX A;  2CV6 A;  2W46 A;  1RUH 2;  4FQ4 A;  4I3G A;  2VZP A;  2DFB A;  4HAN A;  4NHX A;  2DUP A;  3LFI A;  4XJU A;  3HQX A;  1RMU 2;  1NT0 A;  4Z07 A;  5FZ1 A;  3TEW A;  4HXC A;  3WNX A;  2UWA A;  4M4P A;  4OI2 A;  5E8A A;  1JHJ A;  1WW5 A;  4Y26 A;  1SLA A;  3EYP A;  1R09 2;  5GM0 A;  5JMO A;  4YW5 A;  2JE7 A;  4FPJ A;  5FFO C;  3EQE A;  4XQ4 A;  2BGO A;  2W87 A;  1J3Q A;  1ENX A;  1OT5 A;  3BOW A;  4MHU A;  4Q4V 2;  3T2O A;  5LCW L;  2NMN A;  4GMP 3;  3KHB A;  3ATG A;  2C26 A;  4AVV A;  1B35 C;  4QGN A;  4CRQ A;  1VAL A;  1FV3 A;  4JC1 A;  4UF0 A;  3FBM A;  2B42 B;  2QUO A;  4RGG A;  4B8E A;  4QX8 A;  2DTY A;  1LHV A;  3MIH A;  5AC9 1;  3WF1 A;  5GLZ A;  2JIG A;  5FYS A;  4AI9 A;  2A3W A;  1RUO A;  5IVB A;  4E2G A;  4E4D X;  2RMU 1;  1MEC 3;  2JWP A;  4UI9 L;  3KSC A;  2W9X A;  1NKG A;  2XGX A;  5FZ6 A;  5BPX A;  5L73 A;  2VQ0 A;  1PGS A;  1W6Q A;  1OKO A;  4XZU G;  1FX5 A;  1Z7S 2;  1WZX A;  3ZYB A;  4G3Y C;  4R4X A;  2G9F A;  1YRZ A;  3VBR B;  2KD7 A;  1LAJ A;  5DDJ 2;  4AFC A;  2R06 3;  4N9H A;  5APA A;  2Y6K A;  4B7K A;  3GBF A;  2UYA A;  3NAP A;  4R4Z A;  1Y9G A;  4D94 A;  1MEC 2;  1WCQ A;  1ALY A;  5DAV A;  1CAV B;  1QOT A;  2WZR 2;  4CCE A;  2VY0 A;  1MS1 A;  3JB8 A;  3RRD A;  3QLQ A;  1ULD A;  1LOA A;  1MS0 A;  2F4L A;  4GA9 A;  2HLE A;  4D8M A;  3T2T A;  1FOD 2;  4H7L A;  2L9L A;  5CG8 A;  4OHW A;  2C1F A;  4QPI A;  1A6C A;  2LRO A;  1WME A;  1DLC A;  2VNO A;  2WWS A;  2YFZ A;  4LKF A;  4LO8 A;  3HBK A;  2YRO A;  3CEW A;  1J3R A;  1SBF A;  4JTN A;  5JZG A;  5CU1 A;  4QT6 A;  4BOW A;  4BLJ A;  1AXK A;  2JD4 A;  1RUG 3;  5LW9 A;  2VCC A;  3POG A;  4FT8 A;  1TE1 B;  4R9D A;  3MIB A;  4YZ3 A;  1W8Z A;  1U0A A;  5HXM A;  1NZI A;  4CP1 A;  1Y9Q A;  2XL9 A;  2DVA A;  3C8X A;  4QPY A;  5B2G B;  1TZO A;  1BMV 1;  3CIH A;  3JCI A;  3NJV A;  3BTA A;  4PQQ A;  3W21 A;  5H9Q A;  1ENR A;  2ORZ A;  3LEG A;  5BXX A;  5C3P A;  2H0B A;  3CF6 E;  2ID4 A;  1HB3 A;  2CY6 A;  1NY7 2;  4WM8 C;  1HN1 A;  4AVB A;  4LBQ B;  2VCM A;  4QDS A;  1HX6 A;  1H30 A;  1IGO A;  4CPB A;  1OA4 A;  1VBB 2;  3POJ A;  5A7W A;  1CPM A;  2AAC A;  2G9Z A;  2NM1 A;  1APN A;  3W20 A;  1W28 A;  3B5L B;  4JGY B;  4XUN A;  3POI A;  4OQ8 A;  4Q0S A;  1D4M 2;  5FZF A;  2VQU A;  4AFA A;  2DV9 A;  2QQU A;  3NRU A;  1XYP A;  1JYC A;  2R07 3;  1NCQ B;  4JGZ C;  4AI1 A;  3M8L A;  3LOI A;  1US3 A;  3SKJ E;  1GV9 A;  4AWD A;  1E57 A;  3LSD A;  3O1V A;  1K42 A;  1QEX A;  5IYY A;  2XQX A;  4LHL A;  3RI8 A;  1WWY A;  1OVS A;  1XE8 A;  2YGM A;  3FLP A;  1HXS 1;  2ZAC A;  4V2W A;  5EPA A;  4B4R A;  1JZ4 A;  3VBO B;  4L0P A;  1J1T A;  4FO9 A;  1FOD 1;  3IDA A;  2XON A;  1QWR A;  2Z2S B;  1OOP A;  1AHS A;  1EUU A;  4Q2F A;  1YFU A;  5K4L A;  2DBI A;  3EXU A;  1YC6 1;  2HH9 A;  4E4S A;  1I5Z A;  2J1U A;  3IMN A;  3JD7 1;  4CCJ A;  2WLQ A;  2Y8K A;  2A6Y A;  4Q1R A;  1DFQ A;  4N43 C;  2HWE 2;  4P9J A;  2VD7 A;  2D3R A;  3VBH B;  5FTT C;  1YFW A;  2WDB A;  3MW2 A;  4JRL A;  3ZXG A;  3SH3 A;  3CJX A;  1WKY A;  3CKH A;  5JOY A;  1S0F A;  2VVD A;  4F3J A;  4UW3 A;  2BVB A;  3H0O A;  2HWE 3;  1POV 3;  1BCX A;  3AMP A;  1GAN A;  3BN6 A;  4Y20 B;  3UGF A;  3O14 A;  1DZQ A;  3B02 A;  4XHB A;  1UPS A;  4JQR A;  3TN9 3;  2AEN A;  4A3Z A;  1OLR A;  4YAR A;  2E26 A;  2VH9 A;  3AKQ A;  1O3T A;  3DEC A;  1JBC A;  2BFU L;  1H1I A;  1K5M A;  1XOY A;  3FFQ A;  2MHF A;  1HRI 2;  1IPJ A;  2I74 A;  1ZVF A;  2D40 A;  3OBA A;  3VLB B;  5D8A C;  3WNL A;  3LZZ A;  4KL1 A;  4PIX A;  3ZPO A;  4A4A A;  2IZW A;  5FZ0 A;  2XH6 A;  4D0Q A;  1XJA A;  2PHD A;  2J7M A;  1DG6 A;  1R1A 1;  2QZ3 A;  1W06 A;  3DYO A;  1V6L A;  1KJL A;  2CDP A;  1BVP 1;  2XG3 A;  4OZO A;  1ZNP A;  3LE0 A;  3I49 A;  4MAD A;  1XQN A;  1AR7 2;  1PGW 2;  3MGU A;  5KC6 A;  1V6I A;  3KS7 A;  1W6N B;  3N9M A;  2B7Y A;  4IXL A;  3U1X A;  5AFE A;  4UFJ A;  4J25 A;  1OC1 A;  4NRP A;  4NN0 A;  1ZA4 A;  1ND3 C;  4CP9 B;  5J7M A;  4WM7 B;  1NCR B;  1JMU B;  1ULG A;  1AR8 1;  4CCD A;  3KQ4 B;  4XEZ A;  3WQ0 A;  1EAH 3;  3OG2 A;  2VUL A;  1GSL A;  1M4W A;  4X8N A;  4EN0 A;  2P3Y A;  1O91 A;  1CX4 A;  1URX A;  3VDD A;  1GWM A;  1UZ0 A;  2KM2 A;  2PHX A;  5FV3 A;  3VHN A;  3V0A B;  2SBA A;  5DUV A;  1UL9 A;  5I0R A;  1UKR A;  5LK7 B;  2KXL A;  4NHY A;  1UPI A;  3AZY A;  3PUH A;  1OQ1 A;  3P6B A;  4P9L A;  4Y3O A;  5FZD A;  5FO7 B;  1JOJ A;  1FYU A;  1FI2 A;  4AAP A;  2JG9 C;  1H2L A;  1PZ9 A;  1CR7 A;  1BEV 3;  2RVA A;  1OLQ A;  2ZPX A;  1BBT 2;  2A5Z A;  2CGO A;  2O1Q A;  2P34 A;  2XR4 A;  3R4U A;  2P6C A;  4J1W A;  4GWJ A;  5FJK A;  3LD8 A;  3C2U A;  2DUR A;  2XML A;  2Z5W A;  4HSL A;  3ZFF B;  2OPK A;  2R04 2;  4Y1Z A;  2VXJ A;  1O5U A;  1SHW B;  4MV2 A;  4LNV A;  3CBN A;  4XDP A;  3VBF B;  3K46 A;  4AL9 A;  4QPI C;  3RMX A;  3UV9 A;  3I3D A;  4GKY A;  5A7W B;  3ASI A;  1VIW B;  1UY3 A;  1PZ7 A;  5FMD A;  2GNM A;  1TMF 2;  1ZBE 2;  4CEW A;  1DYK A;  4CU8 A;  1G9D A;  1COV 1;  1QXR A;  1OFN A;  1ZZB A;  2WNV B;  4P9W A;  4XFF A;  2VAU A;  1Q8P A;  4LUM A;  3KD4 A;  2VOV A;  1LOB A;  1XE7 A;  3ACH A;  3NNJ A;  4Y1Y A;  4BZ4 A;  2VMG A;  4COZ A;  4CXW A;  1E5I A;  1DGL A;  2YFU A;  4KGQ A;  3VGI A;  2JDZ A;  2BVV A;  1WD4 A;  2Q4S A;  3J7H A;  2ORX A;  3RQ0 A;  4NHL A;  3HBZ A;  5FDB A;  4XCB A;  3K2O A;  3VZN A;  2WN2 A;  2DFC A;  5T52 A;  3S57 A;  3BU7 A;  3ILN A;  1XNB A;  5DPN A;  5T50 A;  5CFD B;  1U12 A;  1WCS A;  2X09 A;  4CSW A;  2OUJ A;  2YC4 A;  1NCR C;  4CP2 A;  1OPM A;  3HD8 B;  2PHU A;  3KZ4 C;  4IEX A;  4BXS V;  4OHY A;  3RVH A;  2XDV A;  5IVC A;  4CP0 A;  4GB3 2;  2XUE A;  5E89 A;  5I0D A;  1MS4 A;  2JDM A;  1EV1 1;  4M3C B;  3OEA A;  3S7I A;  1N1V A;  4HPK B;  4YGC A;  1LHN A;  4AEJ A;  2O8O A;  3VBS B;  3RZH A;  4XC9 A;  4QQH A;  4XJ9 A;  2JB4 A;  4LK7 A;  4YW3 A;  3RNS A;  1ND2 A;  2WS9 1;  2F4P A;  4FXK B;  3U78 A;  4BXF A;  3OUH A;  4JDM A;  4L11 A;  5IJR A;  2VBP A;  3VD9 A;  3HPN A;  2DVD A;  5DXD A;  1A78 A;  2CNA A;  1W90 A;  2UYB A;  4E2S A;  4DUW A;  1YHF A;  5F1R A;  4FTE A;  3LDR A;  1G9C A;  4WVW A;  1WA6 X;  2VME A;  3QCW A;  3H1Y A;  1VR3 A;  1C3H A;  4RS5 B;  5DZG A;  3WCR A;  5ISL A;  3MLL A;  4Q4X 1;  2WA3 A;  1QMJ A;  1H8V A;  4N43 A;  3OGS A;  3VZM A;  2CGN A;  1I3H A;  1NLR A;  1SBD A;  1NX9 A;  2QKD A;  1VAV A;  2CWS A;  4K6B A;  1IQA A;  5D8A B;  5FRA A;  2VW1 A;  1SG3 A;  1IG0 A;  3GGL A;  2WO2 A;  1F4H A;  3I2K A;  4OLL A;  3DXU A;  4XUT A;  2Q8C A;  2VVF A;  2W1U A;  2BER A;  2UY9 A;  5LEK A;  4LBJ A;  3IKW A;  3KB5 A;  5IVV A;  2E9Q A;  1KJR A;  3UYJ A;  5KHJ A;  5I93 A;  1S2B A;  2W0X A;  1AR9 1;  1NAE A;  1G9F A;  4XDQ A;  1U5Z A;  1M06 G;  1JYI A;  3FBY A;  4N53 B;  1VE0 A;  4XVH A;  5DAQ A;  1D0G A;  5LBB A;  2D5F A;  1TNF A;  2RM2 1;  5E1R A;  4HPK A;  3JBG 3;  5IFP A;  4CCK A;  3H1M A;  3WF4 A;  4XAE A;  2C4X A;  5FYV A;  5C4W B;  3NJX A;  2JDY A;  3VD3 A;  2LRP A;  1W9T A;  1RUD 2;  1UZV A;  1UD1 A;  2Q1M A;  3AKT A;  4AR2 A;  4WM7 C;  3IDB B;  2QDN A;  2QVS B;  4MVT A;  4CDQ B;  5BNP A;  3CZJ A;  2UWC A;  3OBZ A;  4YM3 A;  1RIT A;  4MG2 A;  3OOX A;  2BBV A;  4GWN A;  3N9N A;  2V5Y A;  1POQ A;  5FKC A;  1K45 A;  1CZV A;  1PZ8 A;  3OY8 A;  5A1L A;  4XUP A;  3WSO A;  1PO1 3;  3T0D A;  2VCB A;  5LAT A;  3K51 A;  5A7Q A;  4DFS A;  3B93 A;  5IW0 A;  5JXG A;  3WUD A;  2ZZQ A;  1RL3 A;  3R05 A;  4YLZ A;  4LPL A;  3SCF A;  1Q56 A;  1LEN A;  2XB6 C;  5FY7 A;  3IB3 A;  4EYU A;  3APB A;  2ATF A;  4BYY A;  3PMS A;  1UOJ A;  4FPK A;  2ARE A;  3VZJ A;  1ULF A;  2IUW A;  1PO1 2;  1RVF 2;  2YC2 A;  1V6K A;  2UWB A;  3D0S A;  3ZIX A;  5C33 A;  5CKN A;  5IVE A;  5JMC A;  1BKZ A;  2HWF 2;  2C9A A;  1DGR A;  1OI6 A;  4JDN A;  4K3U A;  3ZSL A;  4MLO A;  3LA2 A;  5DZE A;  2RJ2 A;  3E5X A;  4MSV A;  2OPW A;  3X29 B;  1AF9 A;  2YB7 A;  3J9S A;  4AHY A;  3E6D A;  4BIS A;  1UY1 A;  2JDK A;  1LUL A;  3FUO A;  2A73 B;  1OA2 A;  1PNG A;  3OGJ A;  1NE4 A;  4PT6 A;  4AF9 A;  3BKZ A;  1J3P A;  4KG0 A;  1N1T A;  3MF6 A;  5FZ3 A;  1YEW A;  4D69 A;  4TXW A;  1R09 1;  4HKL A;  3VL8 A;  1V70 A;  2ZGL A;  1BK1 A;  2GND A;  1VLN A;  3MIE A;  3PU3 A;  1W2U A;  3GZU C;  1K5M C;  2D3P A;  3LPG A;  4HBN A;  4MGK E;  4W6X A;  3I2G A;  5I8T A;  3WCS A;  4DO0 A;  4EN6 B;  2QQK A;  5FPU A;  1W99 A;  2IXC A;  5JDB A;  2DBN A;  3D82 A;  4IEY A;  3WT3 A;  1UY4 A;  4DXR A;  1JYN A;  1RJ8 A;  2OKX A;  5F3C A;  4BM8 A;  3ZVX A;  3TEY A;  1RUJ 1;  4OZX A;  3USU A;  4AED B;  4CDW C;  2P2K A;  5EQU A;  4LO4 B;  2Q1F A;  2ZZJ A;  4Q8L A;  4KI5 M;  2GMM A;  3VDB A;  2FMD A;  3WDU A;  3AL6 A;  3VBS A;  1N3O A;  2Y6F A;  4QHZ A;  2R30 A;  1OA3 A;  3PNA A;  2BQP A;  1RUH 3;  1Y3T A;  4OYU A;  4DUV A;  1QH6 A;  2ARC A;  3UKT A;  2GME A;  5JZG B;  5LWB A;  2YXS A;  3VHR A;  4BMB A;  1IS5 A;  2RMU 3;  4PDW B;  3PU8 A;  3A22 A;  3FUQ A;  2D6N A;  5FWJ A;  1VBE 3;  1YO8 A;  3AP9 A;  3O0X A;  4XPV A;  3C7E A;  3ZXD A;  4P5H A;  2GC1 A;  2RS3 3;  4DZG A;  4URA A;  1MPX A;  3N36 A;  3H8X A;  1AYN 2;  4N43 B;  5GLU A;  4IEZ A;  1DQ2 A;  4XXP A;  1UYP A;  2ZEW A;  3L9J T;  1VMF A;  2BRT A;  3ZFG C;  4DOU A;  3W5M A;  1UZZ A;  1IOA A;  3U10 A;  4QX1 A;  4XJW A;  5D8A A;  2QDR A;  4I0W B;  1Q8S A;  1QF3 A;  1QJY 1;  2D6M A;  3I3Q A;  3WDV A;  1H4H A;  2PQQ A;  1W6N A;  5EP9 A;  2XXZ A;  1F9K A;  2IXI A;  2AC1 A;  4TTG A;  1UYX A;  1W9S A;  3A4U A;  2G1M A;  3C7H A;  3MPP G;  3I97 A;  3I3E A;  2YMZ A;  4JGY A;  5A3U A;  2EAK A;  4LEJ A;  4Q0Q A;  3AMN A;  2WZR 1;  4Q5O A;  1YXW A;  1UO9 A;  3BOD A;  1KGY A;  1HIX A;  4JAA A;  3E5Q A;  2JG8 A;  4N53 A;  1HRV 1;  1R08 3;  1Z7S 3;  2VMI A;  5A7S A;  3I2H A;  4HLT A;  5A3M A;  3KLS A;  3FMG A;  4FPG A;  3SKV A;  5K8S A;  5C70 A;  1LGC A;  1RUJ 3;  3ZOI A;  2VZQ A;  4CU9 A;  3O1O A;  1TEI A;  3PL0 A;  4HON A;  4NOT A;  1UN1 A;  2MNG A;  5FP9 A;  1SFY A;  1BK0 A;  1R1Z A;  4CCL A;  3LA7 A;  4CEY A;  2GNB A;  1KDK A;  1H9P A;  2P17 A;  5DQ0 A;  1OOP B;  2DCT A;  3LWC A;  4AGV A;  2W1W A;  4E9K A;  4BIO A;  3QBQ A;  3ZSM A;  4HOO A;  4CCO A;  4AED C;  4LHK A;  4CDW B;  3VD4 A;  1UOF A;  2VPV A;  5F5Q A;  1YCI A;  5BY5 A;  2W68 A;  3ECQ A;  3ZO0 B;  1JYW A;  2VCA A;  2OZJ A;  1JI6 A;  4C91 A;  2WWJ A;  1JOB A;  2XPJ A;  3VDC A;  1W05 A;  2XKP A;  1V9U 1;  1RED A;  2PLV 2;  5ABJ B;  5A1F A;  1OVP A;  1XSQ A;  1E5R A;  4CTE A;  1PK6 A;  1GZW B;  5BUV A;  4QDQ A;  3BTY A;  4W6Y A;  4FCA A;  1BMV 2;  3JQX A;  1T6G C;  4KG8 A;  5CG9 A;  1S2E A;  4Y20 A;  5BNN A;  1O4T A;  2B4K A;  4YFW A;  5CAD A;  3ACG A;  4FPY A;  3B69 A;  1GNZ A;  4QM8 A;  4XCA A;  5LA1 A;  5C9A B;  1NYW A;  4CA9 A;  3L2H A;  4FAG A;  1PIV 2;  2IC1 A;  1LGB A;  2ZAH A;  3GHN A;  2SLI A;  3OGG A;  3JUU A;  4YZ1 A;  5FYM A;  5E16 A;  3I2J A;  3WG4 A;  2EAA A;  4FPO B;  1BQP A;  2FDI A;  2HYX A;  2XBO 2;  2EXH A;  3PUI A;  4RSU A;  5FYI A;  5FZH A;  1BYH A;  1DYP A;  3OD4 A;  3PJY A;  4Z8B A;  3R0R A;  1KEX A;  5FQ0 B;  4O61 A;  4OI1 A;  1ZRC A;  4P08 A;  5T5O A;  5C8W A;  4B1L A;  5JXJ A;  1LOD A;  1AXZ A;  4MXV A;  4XFC A;  2P5B A;  1AYM 1;  4RR3 B;  3SIT A;  4CVU A;  5A32 A;  1DLL A;  2NQY A;  4V2V A;  5FMO S;  4AE2 A;  1YJK A;  3USS A;  1N3Q A;  2NLR A;  4K1Y A;  1S0I A;  3AP6 A;  2LTN A;  5FY4 A;  5FP4 A;  3T08 A;  2VTX A;  1CVN A;  2OVU A;  4QQL A;  4LT5 A;  2WN3 A;  4DXT A;  5HCH A;  2C24 A;  3LB9 A;  2D3S A;  1XE0 A;  2A71 A;  1Y7B A;  1DP0 A;  3A21 A;  3RZG A;  1RMU 3;  4WVM A;  1VB2 A;  4QKF A;  1U5X A;  5I0S A;  3VBR C;  3DKQ A;  3MYX A;  4NPR A;  1IS6 A;  1RUI 1;  1O8P A;  4LXL A;  3CNA A;  2G4I A;  4E8C A;  5FJH A;  3HWJ A;  1GUI A;  3EMR A;  5K0U C;  5L7O C;  3LAG A;  2GC2 A;  3MFC A;  4OMC A;  1OF3 A;  2WT0 A;  1CAU A;  4DMI A;  2YY1 A;  1UIK A;  3DV8 A;  5FK7 A;  5CNA A;  1AJK A;  3MBW A;  1H8T A;  1CES A;  2E7T A;  4BWO A;  3POW A;  1CGP A;  4NWV A;  3VBH C;  4HK9 A;  1RUG 1;  4COV A;  5LBE A;  2GN3 A;  5CYY A;  3W9A A;  4F8A A;  5C5U A;  5CFD C;  2ZX0 A;  3BCW A;  2Y6J A;  1DZR A;  4EQV A;  3POE A;  1X36 A;  5FY0 A;  5C7G A;  1CQ9 A;  4ES8 A;  4EE2 A;  1R64 A;  1RUC 3;  3KVB A;  3TOJ A;  3WP3 A;  4CYD A;  5C5T A;  5CA6 A;  1K12 A;  1C5I A;  1AR9 3;  1DDL A;  5FWE A;  4IES A;  3SQO A;  2K0G A;  2RJK A;  4S2H A;  5CFC A;  4IE0 A;  3MUZ 1;  4PLO A;  2R06 2;  2VTF A;  5F8P A;  4QXB A;  2JIJ A;  3WOG A;  1SLC A;  4AI3 A;  5L9R A;  3ZDS A;  1W9W A;  2OQ6 A;  4C1W A;  3VHP A;  1AYM 3;  4JHZ A;  2WZR 3;  1IPK A;  2NPI A;  3WHU A;  3OPW A;  1MQT B;  4IV3 C;  2JB8 A;  4L9B A;  5CKQ A;  5T5J A;  2O14 A;  4NPL A;  4QQP A;  4MO3 M;  2BWA A;  2ZGR A;  2ZML A;  4EWE A;  1VBC 1;  3J26 N;  2ZKN A;  4F83 A;  3SCG A;  1Q8Q A;  2WC2 A;  3ZFF C;  4QQ2 A;  3PHM A;  2XLA A;  1UU4 A;  4AFM A;  2VOT A;  5CIR A;  4XXA A;  1QJU 3;  5FPX A;  1AR8 2;  4M0N A;  2Y60 A;  2JX9 A;  4Y4Y A;  2A6X A;  4XTM A;  1D2S A;  1YQC A;  1Q43 A;  1S1A A;  2MEV 3;  1UU5 A;  1WMX A;  1Q3E A;  2OZ6 A;  4BQ2 A;  5I8S A;  1EAH 2;  1ZRF A;  4MET A;  1JOD A;  1VRB A;  4A42 A;  5IVF A;  4GMP 1;  3ZYH A;  4H2A A;  4FI9 A;  3DXT A;  4NAM A;  1JU3 A;  1W9Y A;  2FZ2 A;  4UFI A;  3III A;  2WAO A;  3GXU A;  4CCN A;  5LEJ A;  1OBN A;  1OPO A;  3K48 A;  3KT7 A;  3VKN A;  3IAQ A;  4QX5 A;  5B4X A;  5IUQ A;  1S0G A;  1ZZ6 A;  4YVW A;  3GYD A;  1BEV 2;  5FZE A;  1O5L A;  4K1Z A;  3RYP A;  3CJI A;  1OKQ A;  1RJ7 A;  4LE3 A;  1VAK A;  4ASM B;  3ZR5 A;  1NLQ A;  4FAH A;  4YZ4 A;  1H6Y A;  3KM5 A;  2JG9 A;  2I07 B;  4QU2 A;  4XF1 A;  4C8D A;  1RUE 2;  2B45 X;  3ZX7 A;  2BGP A;  4ZHN A;  1XXN A;  1O3R A;  5DAW A;  3SLI A;  1S2K A;  1KD7 A;  4AI0 A;  3GF6 A;  1EP0 A;  1HRI 1;  4XE9 A;  4QKN A;  5F5I A;  4BHP A;  1SBE A;  2UUR A;  2HWB 2;  5F2S A;  4DEV A;  2WZP P;  3P1I A;  1KRI A;  1SAC A;  1VB4 A;  4JV4 A;  5JOZ A;  1XNC A;  5DG2 A;  1W39 A;  1TMF 3;  3T4H B;  1CJP A;  2QQP A;  4AEK A;  5J37 A;  1JZ5 A;  4A41 A;  1D2Q A;  1OMI A;  2EID A;  2YC0 A;  1YYN A;  3GCX A;  1I9R A;  3K77 A;  4KWU A;  1YNA A;  2JE9 A;  5A3W A;  2BBA A;  3I54 A;  1GNH A;  1HW5 A;  2XLF A;  4CEW C;  4K21 A;  4LR4 A;  2ZX1 A;  2R49 A;  2E6V A;  3AL5 A;  4PF1 A;  3P5B A;  5FZG A;  4RR3 C;  4QPG A;  2WO3 A;  4LIV A;  4A2U A;  5JI9 A;  2VZ1 A;  1Y43 B;  5HV4 A;  3PTR B;  1OF4 A;  5DN2 A;  3J7M A;  3NO8 A;  2WA4 A;  3ABZ A;  2VO5 A;  4LO6 B;  4WVM B;  1POV 1;  4Y33 A;  1H2N A;  4UT5 A;  2QNK A;  1WLD A;  2DVB A;  3BOP A;  3U07 A;  5FY5 A;  3N9Q A;  1JN2 P;  1WW6 A;  3Q8A A;  5J48 A;  4LBL A;  4XIK A;  1HV1 A;  3ENR A;  2B39 A;  2Q30 A;  5FUI A;  4Q1P A;  1LES A;  5KR7 A;  4ZS3 A;  1KDM A;  1O4Z A;  3EBR A;  3LDB A;  4E2Q A;  5A33 A;  1XBF A;  3LIH A;  5FMC A;  2RM2 2;  1S55 A;  5AC9 2;  4ES9 A;  3PME A;  2XQR A;  2JKB A;  5FLJ A;  1W8N A;  2P3J A;  3ZIW A;  2XOM A;  3IDC B;  5ABJ A;  3LFM A;  3MW4 A;  4B4Q A;  4ZPI A;  3AC0 A;  2A6W A;  3AKR A;  4JVA A;  1X82 A;  3D0J A;  1ND3 A;  1S0C A;  4QHB A;  5FZO A;  4LOT A;  5JI7 A;  4UF0 B;  1TNR A;  5EXO A;  1W9F A;  2QQJ A;  3WNM A;  3MLK A;  4UBH A;  1OLM A;  3RG0 A;  4DEQ A;  1PM7 A;  3ZSK A;  4LBM A;  1REE A;  3ME2 A;  1V6O A;  1O3Q A;  1UZW A;  5FY8 A;  3UKV A;  3U0Z A;  3MIC A;  2ZAB A;  3NKT A;  1FPN 3;  4IW3 A;  3IT8 A;  4O7X A;  3TEX A;  4RD7 A;  3CMG A;  4XET A;  3EJK A;  3HOB A;  3H7Y A;  5GKA C;  1J59 A;  3SC7 X;  3WX5 A;  2RS5 2;  5DAP A;  3JXS A;  1DU3 D;  1UIJ A;  5FZ8 A;  3UGG A;  1C57 A;  1JZ6 A;  2WQ8 A;  1RB8 G;  2QCS B;  4QKD A;  5FYT A;  4YW1 A;  3S5Q A;  3UJO A;  1YLL A;  4DS0 A;  1CAW B;  1GQP A;  1EV1 2;  1OUX A;  5FXZ A;  1X50 A;  2RS5 3;  4RGA A;  1UWW A;  2WT2 A;  5HI0 A;  4AOC A;  2EA7 A;  3H3U A;  5LA2 A;  1F31 A;  2YPJ A;  3OBR A;  1JXN A;  1KS5 A;  3K4A A;  1DGW X;  1SLI A;  4I3P A;  5C3O A;  4NIA A;  1QJU 1;  2R04 3;  4S2D A;  4X6Q B;  3VBU B;  4NIG A;  5J36 A;  4XTP A;  5BYN A;  1J84 A;  2X05 A;  1WA4 A;  4JGZ B;  4L99 A;  1MZ5 A;  2FDJ A;  1IKP A;  3WP4 A;  4P00 B;  1W8F A;  4XUO A;  4H14 A;  5A3N A;  2DU0 A;  1UMH A;  1ZBE 3;  3HR9 A;  1UNB A;  1SDD B;  4AXO A;  2QTW B;  2W3J A;  5F39 A;  2JJ6 A;  1HQL A;  5KWR A;  2HEY F;  1ASJ 1;  2QBX A;  1LOE A;  4XBQ A;  4BE3 A;  2EXI A;  5KHK A;  2OX0 A;  2YHJ A;  2WFF 2;  3U4X A;  3H8O A;  4GZ9 A;  2J1E A;  2HWF 3;  4IEO A;  3ZFE A;  4IER A;  4DIN B;  1GKB A;  3UNP A;  1PX3 A;  2JD9 A;  1NCR A;  2B46 X;  3JD7 2;  4PLN A;  2ZJC A;  4RR3 A;  5A3P A;  1A8D A;  2ERF A;  2R04 1;  2ARA A;  3SEP A;  3ZN4 A;  4BK5 A;  1XYN A;  2VUA A;  3RFR A;  3VDD B;  1AX2 A;  1JTZ X;  1FMD 2;  3VBO A;  1ZZ9 A;  4AHZ A;  2ZGO A;  4YGB A;  1VP6 A;  2BP6 A;  2ZCW A;  3MV1 1;  1ZRI A;  5EFU A;  4AI8 A;  4XBL A;  4AG4 A;  4UW6 A;  2ZGQ A;  3U37 A;  2FQP A;  1H2K A;  2DVG A;  3AKS A;  2JE8 A;  2ENR A;  3U14 A;  1XSR A;  3HNM A;  3ELN A;  3MI8 A;  1JH5 A;  2ZHL A;  3BYW A;  4W8J A;  2DU1 A;  3I3B A;  4YWA A;  3DN7 A;  4YW4 A;  4LLF A;  4EN9 B;  3THC A;  5IVJ A;  3WW2 A;  3BUC A;  4Y22 B;  2HBU A;  4CUA A;  1YJL A;  2ZGP A;  4CEY B;  3DF0 A;  4FPL A;  1LU2 A;  4FOQ A;  3INA A;  1NCQ C;  5JXH A;  3QH6 A;  4M00 A;  2PLV 1;  4OUL A;  1BEV 1;  3PVE A;  1MEC 1;  1REF A;  3I7D A;  2W08 A;  1JYV A;  4YNI A;  1DQ0 A;  1CIW A;  3ACI A;  2E7A A;  1NOV A;  3HEI A;  4IET A;  1JU4 A;  1UAI A;  3FZ3 A;  4YFZ A;  5CAZ A;  2LUW A;  4KMQ A;  3SH4 A;  5C8C C;  4UW4 A;  1ACC A;  5C71 A;  1QIQ A;  5CFC B;  5FYZ A;  1H0B A;  2WZE A;  5CBL A;  3T4V A;  3JZV A;  5EJ1 B;  1EAH 1;  4KBZ A;  1L7R A;  1CN1 A;  1GP5 A;  1O6U A;  3K75 B;  1AYN 3;  4CDX B;  3VZL A;  4PDW C;  5FBZ A;  1XPW A;  3GZA A;  2B8M A;  3O5S A;  3UJQ A;  5AVA A;  5JOX A;  1VMJ A;  2PHR A;  2RG4 A;  1NY7 1;  3ZR6 A;  1JUI A;  5CFC C;  1NXM A;  1W8T A;  4A6O A;  3ZYG A;  1RTV A;  1X8M A;  1LED A;  4RFT 0;  2FD8 A;  1CZS A;  3RZK A;  4FXG B;  1T6B X;  4NJ4 A;  1OD5 A;  1FXZ A;  4FFG A;  5EWS A;  4YSF A;  4R9B A;  4TYS A;  2FHR A;  1V00 A;  2Y6H A;  3OBT A;  2ZMN A;  4TSV A;  1G9B A;  2PAK A;  5FQ0 A;  4CP9 A;  1GIC A;  2ZTN A;  1U5I A;  2G19 A;  5HXV A;  3ZKU A;  4AGR A;  2XHK A;  1RUJ 2;  1SEF A;  1QKQ A;  5JPM B;  4H7M A;  1PIV 1;  3GZT B;  1W2T A;  2W91 A;  2XUM A;  2VW0 A;  4IE4 A;  1FMD 1;  5FYH A;  3O1R A;  3WDW A;  2P4E A;  5FY9 A;  1AXY A;  3D6E A;  4LBQ D;  5EHD A;  2VBD A;  3BIW E;  3H3Z A;  5JIU A;  4FOW A;  5CKM A;  4XFB A;  5DG1 A;  5C3R A;  4KQ7 A;  1NA1 C;  1YQ2 A;  1A8M A;  5FP7 A;  1N47 A;  3CZU A;  3SIS A;  1BZW A;  3NMB A;  5J1X A;  5C6C A;  3LIG A;  1C1L A;  3EHK A;  4GAZ A;  1ONA A;  5T5P A;  1Q5O A;  1H1A A;  1WCD J;  3ZMN A;  5AFB A;  4OCT A;  2HWC 2;  2IXK A;  2WO1 A;  1RXG A;  1O59 A;  3FX3 A;  1CJD A;  4CDU B;  3SH5 A;  5BNO B;  2D6L X;  4QWN A;  1LHO A;  5DMY A;  2D5H A;  3OGR A;  2VZV A;  3AZZ A;  1W8U A;  2WT1 A;  4MYE A;  4A6S A;  3OF1 A;  1H8T B;  1LOG A;  2XJP A;  4OFG A;  5JWP A;  2NZ9 A;  4YVS C;  5DUX A;  2WJS A;  1RVF 1;  2MPF A;  3DEM A;  2FMY A;  3PUR A;  5FCC A;  2VNV A;  5IFT A;  2X5I C;  1POV 0;  2XJQ A;  4BH9 A;  1PIV 3;  4HN1 A;  4MGS A;  1F2N A;  3AYC A;  1QDC A;  2W1S A;  1IG3 A;  3Q9O A;  5FZ7 A;  2VL4 A;  4YZ5 A;  3SEE A;  5F9T A;  1WBL A;  4FOV A;  2TNF A;  4BK4 A;  2YPD A;  4NAO A;  5K0U A;  2ETE A;  3WNN A;  5L7O A;  4CE8 A;  3I3M A;  5FO8 B;  1DQ5 A;  1VBC 2;  2OS2 A;  4TZD A;  3N7K A;  3HQR A;  2VQT A;  4XHX A;  2MEV 1;  1ULE A;  1IHM A;  5A70 A;  1QQP 2;  3POB A;  5L9B A;  4CPB D;  1HB1 A;  3WVJ A;  2J42 A;  2W95 A;  3DUI A;  3W5N A;  1W6Q B;  1MVQ A;  1PGL 2;  5KHI A;  1MQT A;  2W52 A;  2GNT A;  1BJQ A;  4FBF A;  3LEI A;  3J8F 3;  3NNF A;  1QJX 1;  2E31 A;  4N8M A;  4ZU4 A;  3ZDV A;  1VBC 3;  5FZA A;  4LHS A;  2JDH A;  1TVG A;  3FN9 A;  5LBC A;  3WDT A;  5FPA A;  1UXZ A;  3OD0 A;  3O0V A;  1PNF A;  2JDP A;  3WNK A;  3PVN A;  1X9T A;  1QJZ A;  2NYY A;  1CAV A;  1LCL A;  4U2A A;  1AJO A;  3P3N A;  4E27 A;  2ZEZ A;  2HWC 1;  5A33 B;  3O1M A;  3J8F 2;  3WQB A;  3ZSE A;  5ACA 1;  4HKO A;  1SZB A;  2AR6 A;  2VMF A;  3VBF C;  3E5U A;  2VE1 A;  3UK9 A;  3IWZ A;  4GH4 C;  5I91 A;  1ND2 B;  3AMQ A;  3PLQ A;  3KT1 A;  1CAX B;  2JIC A;  3N7L A;  4FSJ A;  5GLW A;  1V9U 2;  2VZR A;  1HV0 A;  3D5O A;  5ANQ A;  3TEZ A;  2R1B A;  4JKK A;  3TWI A;  1R09 3;  2QQN A;  4FPE A;  1ND3 B;  4JDO A;  4WZC A;  4MUV A;  1A3K A;  1JW6 A;  3WXP A;  5L9V A;  4GMP 0;  1XNK A;  2OXB A;  4N53 C;  2E32 A;  2IXJ A;  2WSU A;  3R6S A;  1JHN A;  1V9U 3;  3I4I A;  4N9I A;  3GM8 A;  4GXL A;  2J22 A;  2JEM A;  3NNG A;  4J1X A;  3ZXE A;  4DRV A;  4AVA A;  1XU2 A;  3RI9 A;  4BQ3 A;  3MPB A;  5A7O A;  4LBQ A;  4A3X A;  1ZM1 A;  2K9Z A;  3MF9 A;  3PIG A;  2VQA A;  2LW8 A;  4QXC A;  2AYH A;  4CUB A;  1RUI 3;  5JUV A;  2R0H A;  2QFE A;  1YWK A;  2HWD 3;  1LR5 A;  1Y4W A;  1ULO A;  2GC3 A;  1ENQ A;  2WR9 A;  2BEO A;  3KF3 A;  4URT A;  4NII A;  3NVC A;  4LIT A;  3RYR A;  4I2O A;  1AYM 2;  3WG2 A;  3AXE A;  3ZYF A;  4AED A;  3V0B A;  4LIU A;  4QX3 A;  4WVZ A;  1SDW A;  3WDY A;  1W2N A;  5IAT A;  2Y38 A;  3HT2 A;  3C3V A;  4QAW A;  3OEB A;  4YM0 A;  5DDJ 3;  1WLC A;  3T1L A;  1N1Y A;  1QXJ A;  4R9A A;  4B3N A;  2FCU A;  1AL2 2;  1LJ7 A;  1VRH 3;  1LNS A;  5T5L A;  1B09 A;  4HFS A;  4PDW A;  3CHX A;  4XJA A;  2PLV 3;  2EXK A;  3ZSJ A;  3BPZ A;  1GWL A;  2WAB A;  1YQ8 A;  1SLB A;  1YI9 A;  1ZZ8 A;  2ES3 A;  5JIA A;  3T2P A;  4PI2 A;  5FLH A;  1NUK A;  2DUO A;  4JGZ A;  1JZ3 A;  4Q0P A;  1OFS A;  4COW A;  1DQ4 A;  2D97 A;  2EIG A;  4JRA A;  2YGL A;  1AL0 G;  3IIA A;  4ZU7 A;  2W94 A;  4XFH A;  1RUG 2;  2TEP A;  5LRR A;  4A7K A;  4IV1 A;  5T55 A;  1RXF A;  5GAL A;  3TN9 1;  2WNO A;  1GFF 2;  2X5I A;  4JTO A;  5LB6 A;  2TUN A;  5IK4 A;  5FLI A;  1ZRR A;  4Q4W 2;  3WY6 A;  2R6Q A;  4QMA A;  4CDU C;  3B7M A;  4CXY A;  2RS5 1;  1ZZC A;  1QU0 A;  1UYZ A;  4IE7 A;  3V0B B;  4RYD A;  5FYY A;  1V6N A;  4FFI A;  2JG8 B;  2A6Z A;  4XF4 A;  4XMI A;  2EF6 A;  2PAE A;  2UU8 A;  1QDO A;  2QQL A;  2RV9 A;  3DPR A;  4QX7 A;  1VBB 3;  3DYM A;  2ZX4 A;  4U36 A;  3RSJ A;  1OLM E;  1BBT 1;  3T0B A;  1LRH A;  3OUJ A;  3NKG A;  2QQI A;  4LBO A;  4AHW A;  4OUM A;  1JS9 A;  3M7A A;  1QGL A;  3W58 A;  3V64 A;  1D7P M;  1X7N A;  3I59 B;  1K5J A;  3AVS A;  3SMH A;  3ZXJ A;  1OD3 A;  1WW4 A;  3Q8B A;  5JR7 B;  1WCK A;  3WD5 A;  4D6Q A;  1AX0 A;  2I45 A;  1RIR A;  5I8Y A;  3E6B A;  3N35 A;  3TNQ A;  4OI4 A;  2OA2 A;  3KHC A;  1NG0 A;  3CLP A;  2A7A A;  3KCC A;  2ARX A;  3WUC A;  4WVV A;  4AQT A;  4ASL A;  1W6P A;  4EZ4 A;  3BI3 A;  4QB6 A;  1ZBA 2;  4E4H A;  3VD7 A;  1H9W A;  2WNU B;  1F5J A;  4LLO A;  3C7F A;  4UXA A;  2VR4 A;  5CB7 A;  1F5F A;  3E1F 1;  1AR7 1;  5F6K A;  1HXS 2;  1NE6 A;  4A44 A;  3U4S A;  1UX7 A;  5FKB A;  4ET7 A;  2HYK A;  4GD4 A;  4GUL A;  4PIY A;  1F35 A;  5D21 A;  3ZFG B;  1EUT A;  2V72 A;  2ET7 A;  5FY1 A;  4GH4 B;  3WF0 A;  1E5H A;  4TLG A;  4BU2 A;  4LA3 A;  1RUF 2;  2XWB B;  4N7U A;  5GZG A;  2Y26 A;  2BV4 A;  3H3L A;  4NHK A;  1F4A A;  4WV8 A;  4PHZ A;  1G7Y A;  4XAB A;  2A3X A;  2D44 A;  2GDF A;  2WNV C;  3KV6 A;  2XVG A;  3A7Q A;  1AR6 1;  1I5P A;  5H9P A;  5BNP C;  3I2O A;  4D6R A;  5C8C A;  1VJ2 A;  3GNE A;  3RJ2 X;  4FPH A;  5JSR A;  3POS A;  4Y1V A;  3IDE A;  1GP6 A;  4TN7 A;  3WNO A;  4H3W A;  4XFA A;  2VTX J;  2VZU A;  1BLZ A;  3LEM A;  4ONU A;  2VZS A;  1HQN A;  4IE6 A;  3ORJ A;  4ZY9 A;  4Y5S A;  3BIE A;  2JXA A;  3B00 A;  1AYN 1;  1CZT A;  1L7L A;  1W0O A;  2DUQ A;  4KH9 A;  3AJZ A;  3AKP A;  3NAP B;  5D2A A;  4QGL A;  3TYJ A;  4CCC A;  4E8D A;  4E4Z A;  1HN0 A;  1QJX 2;  5KHG A;  2MEV 2;  4I0B A;  5HCB A;  4XMA A;  1JYX A;  4P9X A;  3S7E A;  5IVY A;  4IGO A;  2GAL A;  1AZD A;  2QE3 A;  3HQU A;  3LGR A;  1VRH 1;  2EAL A;  4L8Q A;  4MH0 E;  3RWK X;  1LGN A;  5LA9 A;  2O8Q A;  4IND A;  3WW1 A;  2AGS A;  2XVK A;  1OUR A;  2LS6 A;  4UFK A;  1CIY A;  3ZFG A;  5KXE A;  1QJX 3;  1AX1 A;  1VAM A;  2ZAA A;  4HZF A;  1IS3 A;  2QQW A;  3AK0 A;  3I2F A;  1UMZ A;  2ZKL A;  5FRE A;  3KCY A;  5HV0 A;  1RUC 1;  2PFW A;  4PI0 A;  3KQR A;  5F6L B;  2GMP A;  3THD A;  1RUD 1;  1F8V A;  1HDK A;  3LDK A;  4PBO A;  1Z7S 1;  5C9A C;  1OQE A;  3WG1 A;  1VBD 3;  2PHL A;  3GBW A;  3ILR A;  4I0A A;  2BYV E;  1S0E A;  4NE9 A;  3BVC A;  3AYE A;  4ZXE A;  4CDU A;  2IVJ A;  1PGW 1;  3H7J A;  4QM9 A;  3ZYJ B;  1NA1 A;  2PTM A;  1ODN A;  3LKJ A;  3A23 A;  1RUE 3;  1TME 3;  3AXD A;  1UMI A;  3HAG A;  3MID A;  4M3C A;  2E51 A;  4AZZ A;  4XAA A;  3E6C C;  2JEN A;  4Q4Y 3;  2VUD A;  2Y6G A;  3VDA A;  2AH2 A;  4R9C A;  1S0J A;  1YUD A;  4OVE A;  1VBD 2;  5DZF A;  4Q4Y 1;  4K7J A;  4CXX A;  2Z79 A;  1GQG A;  3BAL A;  1EYB A;  1TME 2;  3ZKY A;  4GB3 1;  1W8H A;  4IGQ A;  2VU9 A;  5FOJ B;  1I6X A;  3VBU C;  2BNM A;  2BOI A;  1YQ6 A;  5EJZ B;  1RUF 1;  1ZYB A;  2RR1 1;  4SBV A;  3DPR B;  4Q0U A;  2ZGU A;  3RYK A;  3KMH A;  4OUE A;  1GU3 A;  2HWF 1;  2VMC A;  4CZS A;  1JZ7 A;  3ZLI A;  2Q8O A;  4IL7 A;  2E33 A;  4GWM A;  4R52 A;  2JKX A;  1MZE A;  2WNE A;  4MX3 A;  2Y34 A;  1RUH 1;  3BB6 A;  5F5A A;  4BQ4 A;  4HVQ A;  1VBA 3;  1BHG A;  5A32 B;  5LY1 A;  2RR1 2;  1FMD 3;  2Q1Z B;  2VC9 A;  4QU1 A;  2DCY A;  1VBB 1;  3F95 A;  1HJF A;  1XRU A;  4CDX C;  2ZA9 A;  1DGR N;  2IXH A;  2X53 S;  3ROU A;  3M3C A;  2WNU A;  4Q26 A;  3C7O A;  4XQW A;  2OUH A;  4LTA A;  1TG7 A;  3ZXK A;  2RM2 3;  4RHV 2;  1V6J A;  2BNO A;  5SV5 A;  1N1S A;  3MZH A;  4BQX A;  1GOF A;  4P9G A;  4YW7 A;  4BB3 A;  1QXP A;  5DAB A;  4FP2 A;  3QH7 A;  5A3O A;  1LU1 A;  4GAL A;  2PHW A;  5H9S A;  5A7P A;  1H6X A;  1UYY A;  2Y33 A;  4RHV 3;  4DXZ A;  5ACA 3;  2R06 1;  1BXH A;  3NV3 A;  2RS1 1;  1RGS A;  3FHQ A;  4CEY C;  1C1F A;  4NWW A;  5FPZ A;  4Q4W 1;  3ETQ A;  4OQ9 A;  4BQ1 A;  2CU5 A;  1NQJ A;  2WYS A;  3AB0 A;  4IEV A;  4M3C F;  1MQT C;  4IV3 B;  3SCH A;  4AFD A;  3TAY A;  4LQR A;  1EY2 A;  1DGW A;  1WMF A;  4D7Y A;  4IDZ A;  2ZBJ A;  4MOA A;  1UY0 A;  2XWJ B;  5EV7 A;  4KWJ A;  4OHV A;  2P3I A;  1ASJ 2;  2AZ5 A;  2YV8 A;  3NW4 A;  4W4Z A;  2CAV A;  4XF3 A;  5F3E A;  4YW2 A;  2Q5T A;  3AX4 A;  3RMY A;  4BQY A;  3RZL A;  1G8W A;  5FZ4 A;  4BJ0 A;  3FE5 A;  1UOG A;  1HB4 A;  2HEW F;  4UYB A;  3M70 A;  3CQO A;  4K20 A;  5G05 L; 
#chains in the Genus database with same CATH homology
 3LPF A;  3WF4 A;  2C4X A;  3MV1 1;  3HJR A;  3NJX A;  4AG4 A;  3U37 A;  3LEK A;  3VD3 A;  2X10 A;  1W9T A;  1K3I A;  2JE8 A;  3HNM A;  4W8J A;  2J1T A;  4QX2 A;  3F2Z A;  3I3B A;  3EB7 A;  5HPO A;  3CZJ A;  3THC A;  3MV0 1;  4UAP A;  4CUA A;  1K45 A;  1CZV A;  2W5F A;  4XUP A;  5JXH A;  3WSO A;  1OH4 A;  2VJX A;  3T0D A;  2VCB A;  1DYO A;  5JXG A;  1L7Q A;  1JYV A;  2ZEY A;  4LPL A;  3ACI A;  1O8S A;  3HEI A;  3IB3 A;  2DCJ A;  1JU4 A;  2EIC A;  3WF3 A;  4KMQ A;  2YC2 A;  5C71 A;  2WZE A;  3K4D A;  4CU7 A;  5EJ1 B;  1L7R A;  2Y6L A;  3K75 B;  2RJ2 A;  2R7E B;  4CUC A;  1XPW A;  2C9K A;  2YB7 A;  3HN3 A;  3UET A;  1UY1 A;  4PT6 A;  1JZ2 A;  4A6O A;  4TXW A;  4MGQ A;  4QX0 A;  1J83 A;  1CZS A;  5B4N A;  2J1S A;  3LPG A;  2DDU A;  3I2G A;  2QQK A;  2Y6H A;  1W99 A;  2VZT A;  2QQO A;  1UY4 A;  4JKL A;  4DXR A;  3GDB A;  2OKX A;  1JYN A;  4XUR A;  2WUH A;  2W91 A;  4KI5 M;  2B9V A;  3VDB A;  1GOG A;  4OYU A;  4DUV A;  3VD5 A;  4AAX A;  1YQ2 A;  4OMD A;  3MUY 1;  3CZU A;  2V5D A;  3A22 A;  5J1X A;  3FL7 A;  4YPJ A;  3T0A A;  3C7E A;  2WO1 A;  1O59 A;  2V4V A;  1MPX A;  3OGV A;  5DMY A;  3OGR A;  2VZV A;  2ZEW A;  4BDV B;  3W5M A;  4QX1 A;  4ZZ5 A;  4P5Y A;  5IFT A;  4RN5 A;  4MGS A;  4HG6 B;  4TTG A;  1UYX A;  1W9S A;  2W1S A;  3C7H A;  2J1R A;  2VL4 A;  3C7G A;  3I97 A;  3I3E A;  3SEE A;  4ZZ8 A;  4BK4 A;  3WNN A;  2WBK A;  1KGY A;  3FHA A;  3CDZ B;  2EIE A;  5LA0 A;  2VQT A;  3I2H A;  3SKV A;  5C70 A;  4CU9 A;  2VZQ A;  3W5N A;  2W95 A;  1JZ8 A;  3BGA A;  1PX4 A;  2VMD A;  2XHN A;  3D3A A;  3DYP A;  3LEI A;  2E31 A;  4IUG A;  5DQ0 A;  3WNP A;  5CZK A;  4LHS A;  2W1W A;  1TVG A;  3FN9 A;  2W46 A;  1UXZ A;  3UES A;  1PMJ X;  2J1V A;  3WNK A;  2VZP A;  3VD4 A;  2Z4F A;  3ECQ A;  1JYW A;  2VCA A;  2ZEZ A;  1JI6 A;  4M4P A;  3WQB A;  3VDC A;  1IQD C;  1JHJ A;  3EYP A;  2VMF A;  5JMO A;  2BGO A;  2W87 A;  1OT5 A;  3T2O A;  5LCW L;  4QDQ A;  1CX1 A;  2VZR A;  2B4K A;  4JKK A;  4DXS A;  3ACG A;  2QQN A;  2C26 A;  5LA1 A;  2BZD A;  1PMH X;  2E32 A;  3WF1 A;  3NQH A;  2VZO A;  3I2J A;  4UI9 L;  3GM8 A;  2W9X A;  1NKG A;  4LKS A;  2J22 A;  2HYX A;  3NNG A;  1UXX X;  3PUI A;  4XZU G;  2WAA A;  4CU6 A;  1KEX A;  2KD7 A;  2LW8 A;  4P08 A;  4CUB A;  5JUV A;  5JXJ A;  2Y6K A;  3I2I A;  1ULO A;  4CVU A;  1P8J A;  1WCQ A;  4QX3 A;  4XUQ A;  3T08 A;  4D8M A;  2HLE A;  2WN3 A;  3OEB A;  3OB8 A;  4QAW A;  4DXT A;  2L9L A;  3WEZ A;  3A21 A;  1DP0 A;  5A1A A;  3T0B A;  1DLC A;  2YFZ A;  1LNS A;  1O8P A;  4W50 A;  4E8C A;  1GUI A;  2VCC A;  2WAB A;  5HXM A;  1OF3 A;  3T2P A;  1NUK A;  2VM9 A;  1JZ3 A;  3C8X A;  4OMC A;  3K4Z A;  3CIH A;  3MBW A;  3MO4 A;  3NJV A;  2WZ8 A;  4PQQ A;  3LEG A;  2ORZ A;  2W94 A;  3HNB M;  4JX0 A;  2ZXQ A;  1US2 A;  4Z2A A;  2ID4 A;  5CYY A;  1HN1 A;  2Y6J A;  2ZEX A;  4QDS A;  5C7G A;  3ETP A;  1R64 A;  4XUN A;  1K12 A;  1UYZ A;  2VQU A;  5JXI A;  3NRU A;  4RYD A;  2YG0 A;  1US3 A;  3MUZ 1;  3SKJ E;  1W8O A;  2VTF A;  2DCK A;  2QQL A;  1K42 A;  2RV9 A;  5IYY A;  3DYM A;  2XQX A;  1W9W A;  4JHZ A;  1JZ4 A;  4L0P A;  2QQI A;  4QPW A;  3IDA A;  2PQS A;  2XON A;  1EUU A;  3ACF A;  4MO3 M;  1D7P M;  1T2X A;  3LQC A;  1OD3 A;  2J1U A;  2Y8K A;  1XNA A;  2VOT A;  2W92 A;  3T09 A;  2WDB A;  3WF2 A;  3CKH A;  1WKY A;  4GWI A;  4QB6 A;  3VD7 A;  4A42 A;  3C7F A;  1XC6 A;  2VR4 A;  3E1F 1;  3BN6 A;  4FI9 A;  1JU3 A;  4M4R A;  4A44 A;  3III A;  1UX7 A;  2WAO A;  3GXU A;  4ET7 A;  3T2Q A;  3IAQ A;  2Y64 A;  2CDO A;  4JKM A;  1EUT A;  2V72 A;  5B4X A;  1ULP A;  4A3Z A;  2E26 A;  1GNY A;  5JR2 A;  3WF0 A;  3DEC A;  4ARX A;  3OBA A;  3WNL A;  1H6Y A;  4A4A A;  1F4A A;  4D0Q A;  2BGP A;  1GOH A;  3IAP A;  2J7M A;  3A7Q A;  1I5P A;  3DYO A;  3HNY M;  2CDP A;  4A45 A;  5G04 L;  4OZO A;  4DEV A;  3LE0 A;  4MAD A;  3P1I A;  3WNO A;  2VZU A;  2VZS A;  1JZ5 A;  4A41 A;  2EID A;  4ZY9 A;  3K77 A;  4KWU A;  1CZT A;  2BBA A;  4E8D A;  4PF1 A;  1JYX A;  2WO3 A;  4ARY A;  2VZ1 A;  3OG2 A;  1OF4 A;  2J1A A;  5DN2 A;  4QDR A;  3ABZ A;  2VO5 A;  2LS6 A;  1UZ0 A;  1CIY A;  3I2F A;  5EIY B;  3PUH A;  3P6B A;  5FUI A;  3THD A;  2RVA A;  4ZXE A;  4GWJ A;  4UOJ A;  3A23 A;  1UMI A;  4QB1 A;  2Y6G A;  3VDA A;  1W8N A;  1SHW B;  2XOM A;  3K46 A;  3I3D A;  3AC0 A;  1UY3 A;  1RYY A;  4CU8 A;  4QB2 A;  3WNM A;  2QQJ A;  5IHR A;  5EJZ B;  1UY2 A;  3ACH A;  4DEQ A;  2QQM A;  2JDA A;  4OUE A;  2YFU A;  1GU3 A;  2VMC A;  1JZ7 A;  3J7H A;  2W1Q A;  2ORX A;  2E33 A;  2WN2 A;  2JKX A;  3CMG A;  5DPN A;  3HOB A;  1BHG A;  2X09 A;  2YC4 A;  3JXS A;  1GMM A;  2VC9 A;  4BXS V;  2WQ8 A;  1JZ6 A;  1XNT A;  5I0D A;  1GQP A;  3OEA A;  3C7O A;  1UWW A;  5LA2 A;  1TG7 A;  5IJR A;  3VD9 A;  3K4A A;  3HPN A;  4DUW A;  1GOF A;  1W0N A;  1J84 A;  2VME A;  2X05 A;  4P00 B;  1H6X A;  4XUO A;  1UYY A;  3OGS A;  2EIB A;  1UMH A;  1NX9 A;  1SDD B;  2W47 A;  3FHQ A;  2W3J A;  5F7U A;  2QBX A;  1SG3 A;  3GGL A;  3I2K A;  2WO2 A;  1F4H A;  2WYS A;  3ZM8 A;  4XUT A;  2W1U A;  2BER A;  4LQR A;  4GZ9 A;  2J1E A;  4MOA A;  1UY0 A;  3UNP A;  1PX3 A;  2JD9 A;  4W4Z A;  1NAE A;  4P02 B;  2VZ3 A;  4DUX A;  3SEP A;  4XVH A;  4BJ0 A;  4BK5 A;  5IFP A;  3CQO A;  5G05 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...