2J1VA

Structure of a streptococcus pneumoniae fucose binding module in complex with the blood group h-trisaccharide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Carbohydrate-binding protein
molecule keywords FUCOLECTIN-RELATED PROTEIN
total genus 39
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1vA00
1UX7A 2VC9A 2Y8KA 3VD4A 4XUTA 2VZTA 4QAWA 1XNTA 3LEIA 4MO3M 1GOFA 3CZJA 4QB6A 4D0QA 3CKHA 1IQDC 3ETPA 2VL4A 1UXXX 3BGAA 5IFTA 1BHGA 2WABA 1K12A 1OT5A 1PX4A 1W99A 1F4AA 1UMIA 1XPWA 3WNOA 4CU8A 1L7QA 2DDUA 3GDBA 2V5DA 4QX1A 2YFUA 4RN5A 3I3EA 4IUGA 3MV01 3K46A 4A3ZA 1H6YA 2VQUA 2W1UA 3WF0A 1PX3A 3WQBA 1K42A 3MBWA 3I3BA 2WZEA 2W94A 1JYWA 2VQTA 3CDZB 1ULPA 4KWUA 1UY1A 1JU3A 4UOJA 3ZM8A 2WO3A 3HN3A 3GXUA 4QDSA 4ZZ5A 5IFPA 3WF4A 3F2ZA 3MV11 3OG2A 3K4DA 3HNBM 4QX2A 2DCJA 2JKXA 4ARYA 2EICA 3HEIA 3OBAA 3EYPA 4QDRA 3VDCA 2WYSA 3T09A 1UYYA 1PMJX 1L7RA 1YQ2A 3I3DA 2JD9A 3OGSA 2W1WA 3I2IA 2W91A 4LPLA 3U37A 5LA1A 3ACGA 2C4XA 2BZDA 1JZ7A 3NJVA 4DEQA 2X10A 3I2FA 3K75B 1UZ0A 1US2A 2ZEYA 5LA0A 3MO4A 2L9LA 3C8XA 4UAPA 1JZ4A 2QQKA 3P1IA 3NRUA 2VCAA 2YC4A 2W1QA 1OD3A 4CU6A 5EJ1B 5JUVA 1F4HA 2X05A 4MGSA 1I5PA 3JXSA 5IHRA 4XVHA 1J84A 3SKJE 3GM8A 4A6OA 3OGVA 1KGYA 1UXZA 2B9VA 2Y6KA 1SDDB 2W95A 4XUQA 2VMDA 1H6XA 3FL7A 4P00B 3T0AA 3VD5A 4XUNA 1W9WA 3WF2A 3CMGA 5HXMA 2QQJA 3AC0A 1NX9A 1XNAA 1W0NA 2E31A 4ZY9A 2J1UA 2VJXA 2VM9A 4GWIA 4M4PA 3DYPA 3IDAA 2W46A 1CZVA 3OEAA 3NQHA 2ZEZA 4P08A 2JE8A 3LE0A 1PMHX 5F7UA 2ZEXA 3I2HA 1OF4A 4BJ0A 3A7QA 4HG6B 3WNMA 4QB2A 3D3AA 4XZUG 2V72A 2W47A 2XQXA 2VOTA 4DXSA 2WUHA 2XONA 3T08A 2ZXQA 3CIHA 3NJXA 3VD9A 3IB3A 5B4NA 2VZ1A 1JYVA 4BK5A 3DYMA 4DXTA 5EIYB 4CUBA 2W87A 2VZSA 4PF1A 4TTGA 3PUHA 4LQRA 2XOMA 1JZ5A 2VTFA 4PT6A 5C71A 1JZ3A 4MADA 4JKMA 2QQOA 2WO2A 4OMCA 2B4KA 3T0BA 4JKLA 4CVUA 4TXWA 2YB7A 3CZUA 2BGOA 4KMQA 3C7OA 3T2QA 1GQPA 3K4ZA 2HLEA 3HNMA 3VD3A 2X09A 4CUAA 3E1F1 2WAAA 2Y6JA 4RYDA 2ORZA 3I2KA 4ZXEA 5DQ0A 5FUIA 1O8SA 1JU4A 3WF1A 3OB8A 1HN1A 2J1TA 2EIDA 2W5FA 5JXJA 2LW8A 2BGPA 1UYZA 2KD7A 1TVGA 4W8JA 2WN2A 3C7GA 5CZKA 2BERA 2XHNA 3UNPA 3THCA 1JHJA 3J7HA 1W9TA 1J83A 1JYXA 4A42A 4BK4A 4QX3A 5IYYA 1US3A 3A23A 2ID4A 4P02B 4JHZA 4MGQA 4DUWA 3FHQA 1R64A 2VR4A 4QB1A 2R7EB 4BDVB 4DUVA 1CZTA 3I2JA 3W5NA 1O59A 1K3IA 3ACIA 3C7EA 4CU7A 2C26A 1DP0A 3A21A 4BXSV 1GU3A 1SHWB 2CDPA 2J7MA 2ORXA 4DEVA 2Z4FA 4W4ZA 4MOAA 1O8PA 4OUEA 2PQSA 5EJZB 1OF3A 4A4AA 1W9SA 3LEGA 2YFZA 1WKYA 1W8NA 5DMYA 2W3JA 1ULOA 2VZUA 2WO1A 3I97A 4E8DA 3WF3A 3ACHA 5I0DA 2J22A 5A1AA 3LPGA 2EIBA 1CIYA 3LEKA 3DECA 5CYYA 3WNNA 2RJ2A 4L0PA 4A41A 5JR2A 2QQNA 2VCCA 5JXHA 4P5YA 3A22A 3VD7A 2RV9A 1WCQA 3EB7A 1GOGA 1XC6A 2J1EA 1UWWA 4CUCA 3SKVA 2VMCA 2VZVA 2Y64A 4AAXA 4DUXA 3WNPA 1D7PM 2V4VA 3T0DA 2VMEA 1EUTA 3THDA 3T2PA 1JZ8A 4QPWA 4YPJA 2W1SA 3GGLA 1GMMA 3ABZA 4KI5M 2Y6HA 1JZ2A 4AG4A 4D8MA 5LCWL 1GUIA 2J1SA 1UMHA 3CQOA 2Y6LA 5IJRA 4ZZ8A 3P6BA 1NKGA 3C7FA 1NUKA 2VMFA 3UESA 2E32A 4ARXA 3SEPA 2YC2A 2WAOA 2HYXA 1GNYA 4JKKA 2E26A 3MUZ1 3ACFA 4FI9A 3WSOA 5JMOA 2LS6A 3T2OA 1KEXA 1UY4A 4ET7A 3IAPA 4DXRA 2YG0A 2CDOA 5G05L 4E8CA 4QX0A 4M4RA 2EIEA 3I2GA 4LKSA 3HJRA 4CU9A 4OMDA 1JZ6A 3LPFA 2VZ3A 5LA2A 1LNSA 2VO5A 2RVAA 2VZOA 1JI6A 3PUIA 2OKXA 2WDBA 2QQMA 2WBKA 2W9XA 4GWJA 3HNYM 1MPXA 3VDAA 4GZ9A 3C7HA 5JXGA 2JDAA 4A45A 4LHSA 3LQCA 5JXIA 4W50A 3FHAA 4XURA 3ECQA 2QQIA 4UI9L 1K45A 4JX0A 3VDBA 2J1AA 5B4XA 1RYYA 1SG3A 2QQLA 1TG7A 3BN6A 1EUUA 3IAQA 1DYOA 3FN9A 4XUPA 2WN3A 5C70A 3OEBA 3HOBA 1CX1A 2Y6GA 2J1RA 2VZRA 1P8JA 1UYXA 1W8OA 3K77A 1UY2A 3OGRA 5DN2A 4PQQA 1CZSA 3K4AA 5G04L 5C7GA 1NAEA 2VCBA 5HPOA 3WNKA 1UY3A 2DCKA 2C9KA 3W5MA 2QBXA 1GOHA 1UY0A 2VZPA 2BBAA 2VZQA 4Z2AA 4OZOA 4OYUA 3IIIA 3SEEA 2W92A 3MUY1 3WNLA 4A44A 1JYNA 4XUOA 3WEZA 1OH4A 2E33A 2WZ8A 2J1VA 2ZEWA 1T2XA 1DLCA 3UETA 5J1XA 3HPNA 3NNGA 5DPNA 3DYOA 4QDQA 2WQ8A
chains in the Genus database with same CATH superfamily
2VC9A 3VD4A 1AR81 4QAWA 2D6MA 1UPIA 2C0ZA 2QFEA 1OH3A 2VULA 4BISA 4XABA 3MGUA 5J48A 3DEMA 2WZPP 4Y20A 3CZJA 4DIQA 4IV1C 4K1YA 2W2IA 4D0QA 4ZPIA 5GLUA 1RUG1 1J59A 3ETPA 1R1ZA 1KJRA 3VDDC 3BGAA 3MPBA 1AR61 1W06A 5IFTA 4LBLA 1IGOA 2PLV3 5H9PA 5HCHA 1HQWA 4LHLA 1Q8PA 4J1WA 2GH8A 2YXSA 3UKTA 3RZGA 1MS5A 2JDPA 2R6QA 1OHFA 1GZ9A 1PVC2 1FOD3 3OOXA 4LO8A 5E6HA 1XPWA 2D43A 1MQTC 4ES8A 5FYZA 1L7QA 2QUOA 2V5DA 2IC1A 4XC9A 2BTVC 2YU1A 2YFUA 5KHKA 1W8TA 2A6WA 3GBFA 3OYWA 3I3EA 1OA2A 2WSUA 4E2GA 4CE8A 4L11A 5ANQA 1KS4A 2VVDA 1UCXA 3KV6A 4A3ZA 1H6YA 4HLTA 2UU8A 4JDOA 4MHRA 4XMIA 2W1UA 1DGRA 4HXCA 1NLRA 2AUYA 1VIWB 1K42A 5FXXA 4D3WA 2QZ2A 5A32B 3N7JA 1YJLA 1B35A 2RM21 4FO9A 4BMBA 3PMEA 1UIKA 2CWMA 1YXWA 5FZAA 1V9U2 1UQXA 4Q4W1 1GBGA 2DTYA 1RVF3 2D7FA 5FZ0A 1X33A 1ZREA 5I93A 3WXPA 4B29A 1JU3A 1MS0A 4YWAA 1V00A 3GXUA 1XNBA 4COZA 3HT2A 4LA3A 1ZX5A 4FFIA 2BWAA 2WLQA 4S2GA 4DQAA 5IFPA 3VKFC 1LESA 5D8AC 1CJDA 2XJPA 1QWRA 4HK8A 3HNBM 1MACA 1JN2P 2A6YA 4ARYA 2D6NA 2D5FA 4XFGA 2EICA 3KZ4C 2EXJA 3JB4C 3OBAA 5JZGA 3BTXA 1LEMA 3U75A 4R9DA 3UGHA 2A6VA 4FPLA 2DUOA 2WZR2 2Z42A 4QXHA 3PJYA 1PO13 1GFF2 4A7KA 1QH7A 4HETA 1PMJX 3WP3A 3V0AB 1H4GA 1L7RA 2D97A 5FY4A 3ZMNA 2RG4A 4LA2A 2Y0OA 5L73A 3ZFGB 1WD3A 2R072 4NHLA 3ZYPA 1WCSA 4IEUA 4Q4Y1 1QXRA 2D5HA 3P5BA 3KQRA 3ON7A 4Y4RA 5D2AA 1EYBA 1GP5A 3MI8A 2D3SA 4CDQB 4LK6A 1EAH3 1VBD1 4M00A 1YWKA 1GYKA 2RR12 1VBC2 2WFF3 4IW3A 1GZTA 1RVF2 2EAKA 3JBG3 2NLRA 4CDWA 4DEQA 4XJWA 4IXLA 3WX5A 3NMBA 2A70A 3I2FA 4Y20B 2R073 1SMVA 2ZMNA 3B93A 3T3YA 1AYM3 2ZEYA 4MXVA 4WZFA 4RGAA 4AEDB 5B2GB 5LA0A 2WS91 3EMRA 2L9LA 5FYUA 1V6IA 5I0SA 1OLMA 1JZ4A 1YRZA 2WQ4A 4OCTA 2WA4A 2LTNA 1Y9QA 5GLZA 4DPNA 2ZAHA 4M3CA 4NIHA 2GNBA 1FYUA 1OD3A 5F3EA 3W59A 2ZHNA 4MGIE 5ACA3 3WR0A 2JD4A 4LLOA 4PI2A 1E5SA 1F4HA 1I5PA 3S7EA 3U4XA 3IBMA 1MZ6A 2DVAA 3JXSA 4UW5A 5BNNA 1CWPA 3C2UA 4ZU4A 2D6KA 2CNAA 4C0HA 1A8MA 1G9DA 2Y60A 2YGLA 1CVNA 1BYHA 4BXFA 1ULCA 4AEDA 3O5SA 1ST8A 1XU1A 1VBD2 1NCRC 3LWCA 4Q5OA 2VBBA 1OFNA 4P5HA 3FL7A 1RITA 2E7QA 1DG6A 1JUHA 5GLWA 2X29A 3CJIA 3DUIA 3RS6A 1COV1 3V64A 4WM8A 2AENA 1I1EA 1XBFA 3CMGA 1LGBA 4AQ6A 3KS7A 3DXTA 1LEDA 4P9XA 2QQJA 3LSDA 3KHCA 4FPGA 4CDQA 1BK1A 2PAMA 5DXDA 4FQ4A 4Q4X1 3BKZA 3RGBA 2GP3A 3H1WA 2DCTA 4FXGB 3AYDA 1AYM2 3VBUC 4ZY9A 1REEA 3NW4A 1NCQB 3AKTA 5FZEA 1OLRA 1YYNA 2XWJB 2OIIA 3KD4A 4OFGA 4NPLA 3TOJA 4BLJA 2CGNA 5GZCA 1PGL2 4GWNA 1DZQA 1LULA 3ASIA 2ZEZA 3MHZA 3T1LA 2JE8A 2W08A 5LATA 4FOQA 2ZX0A 3LE0A 3VBOB 2DV9A 1OF4A 4L97A 1UO9A 1L3JA 1J1TA 3U10A 4BJ0A 4NPRA 4PQ9A 2VPVA 1AR63 1GQGA 3WNMA 3VBRA 2G19A 1AR93 3D3AA 4XZUG 5FPBA 1W9FA 1W8ZA 2WNUC 4NWWA 5DABA 1NXD1 5H9RA 4CP9B 3EHKA 1ZRFA 1NOVA 1UNBA 2DBNA 3VBFC 4B8EA 3Q8BA 2XGXA 3FLPA 5A3UA 1QGLA 4H14A 3WCRA 3T1MA 1IOAA 1AL23 3KT1A 3VBFA 4JQRA 3PUSA 5EIYB 1HV0A 1JW6A 4NHMA 4TTGA 2VZSA 1I3HA 1QHDA 1DZRA 1Q8VA 3KF5A 1ODMA 4YM2A 3IDCB 1OUXA 2OVUA 1HXS1 3KCCA 4LQRA 4UW3A 4XBNA 4YW7A 1QXJA 1QU0A 4GD4A 3OPWA 3NV4A 1KD7A 5CIRA 5IVFA 1R1A2 2VTFA 4Q4V1 1POV0 1ZA7A 3LFIA 2SBAA 1H0BA 1WLCA 5ERLA 4E27A 4UFMA 2QQOA 1UPSA 4MLOA 5CKNA 4OMCA 1X7NA 4YGCA 3AP6A 4JKLA 1FV3A 2BOJA 4FFFA 1A34A 1VBE1 3CZUA 1O4ZA 4QX8A 5L9BA 2C24A 4AVCA 5LW9A 2K2SA 2OT7A 2XHKA 4RR3C 1W8UA 5FYCA 3VLBB 4LK7A 2JB8A 2RHPA 5F8PA 4LITA 2GSYA 2XLGA 4NPMA 3RSJA 1IPKA 3K4ZA 5D21A 1NA1A 2IXIA 2FDKA 4MGTA 4G3YC 2NM1A 4K9SA 4JTNA 2O1QA 4ZXEA 1PO21 4GB32 5LWBA 1JU4A 3CNAA 2O14A 3WF1A 5BNQA 3OB8A 3OSDA 4XJZA 3B69A 4CCLA 1DYKA 5EFUA 5LASA 1HXS2 5FXZA 2XLFA 1W6NA 4PBPA 4XW3A 4Z92B 1YI7A 2E6VA 2KD7A 2O8OA 4XFCA 1ZBE3 5DAPA 1WW5A 5EP9A 4FOYA 4IE4A 4LMFA 3E6CC 4N9HA 1S0CA 3FC0A 1IG3A 5HCAA 1J83A 2ZKNA 1YI9A 1OURA 2VBPA 1CAUA 1W8HA 2R1BA 1ND2C 3KHBA 3D6EA 4IV3C 1AVBA 3KCXA 4L2NA 1DQ4A 3PIJA 1W0PA 1I6XA 4JHZA 4F7ZA 1OKOA 3KV5A 3VBSA 4DUWA 4DUVA 3AM2A 4B1MA 4BDVB 3M3CA 3PURA 5FYVA 1EPWA 2CTVA 1UD1A 1F15A 4RD7A 2Q8DA 2IXLA 3HN1A 2G4IA 2VECA 4YW1A 1MS9A 2VBDA 4OULA 3C7EA 1ACCA 1D0HA 1GANA 2C26A 3IN9A 4HT1T 3A21A 4CU7A 3BI3A 3RZKA 2FMYA 2J7MA 2EIGA 2ZGSA 2Z4FA 1MZEA 2ENRA 1CAWA 3ZPYA 1ND3B 3WHTA 2AC1A 4GXLA 1W9SA 4YNIA 1UKGA 3AXEA 4ITCA 1TMF3 1WKYA 2RS33 2D40A 3JCIA 1QXPA 2CSGA 5DMYA 1CAXA 1GZCA 2VMHA 3UL2A 1U5YA 1N1VA 1QDCA 4E8DA 3ACHA 3WNXA 1UL9A 2MHFA 3RZJA 5FAXA 2WZR3 4Q4X3 4LBNA 3LPGA 3N9LA 3DXUA 3KVBA 3USSA 1NLSA 2IVJA 3DECA 5CYYA 2R49A 4LHKA 3URFA 1RUD2 4L0PA 1WMXA 4IGQA 5FP3A 1LODA 3A0KA 4OI2A 4P5YA 3M3EA 3EO6A 5JOYA 1K5MC 3RMXA 1RUH3 1RUH2 4F8AA 4LO7A 5FWEA 3IMMA 2EVXA 2J1EA 1UWWA 3UGGA 3ZSJA 3SKVA 5L19A 1XNDA 1ND3C 4JDNA 1RUF2 3M3IA 1REFA 4CEYA 1KITA 2Y64A 4AAXA 5FZ1A 3K3OA 2FMDA 2AH2A 4XAAA 3I3QA 5DUUA 3MIHA 2ZPXA 1OLME 3CEWA 3G7DA 3MICA 1POV3 3VZJA 4DMIA 2JIGA 3THDA 1FX5A 3VGIA 5ACA1 1R091 2HBTA 3QOPA 4E2SA 1KS5A 4YPJA 4CXXA 4NRQA 4XQWA 3BYWA 2LUWA 3ZR5A 4CEWA 1AZDA 1GMMA 1J3RA 3ABZA 4KI5M 5BNPB 1VBB1 1O3TA 1MZFA 2QCSB 1LHNA 2WJSA 2WLPA 3H50A 2E9QA 4GMP3 4P9LA 1W9YA 4PIYA 4RQPC 2YC0A 3RDIA 1GUIA 1HRV1 5FYMA 3VZKA 4AQSA 4DFSA 3MIDA 1UU5A 2PHWA 4AVAA 4QHZA 3POIA 1JXNA 3MW3A 2ZZJA 3C7FA 5FLIA 1G6NA 5FZ4A 4AI8A 1YQ8A 1B35B 1EV12 2EF6A 2WFF1 1RUH1 2YBSA 3RJRA 4BZ4A 5A32A 5L7OB 4LXLA 3H8XA 2BU9A 4WVVA 3ES4A 1NCRA 3SH5A 1EAH1 1VBD3 2W39A 4YZ4A 1BVVA 1HKDA 5GZEA 3W58A 3MUZ1 3VBHC 2AACA 4FFHA 1FPN2 3T2OA 1C28A 1RUNA 1UY4A 3T4HB 4IV3B 3UJOA 1R082 1ZBA1 4DXRA 4XFIA 2CDOA 4TLFA 3ZFFB 1W8FA 2XJSA 4E8CA 3BIWE 4NHXA 1QOOA 1RMU3 1UKRA 3H8UA 5DUXA 3POEA 5FJKA 2PTMA 3PUQA 4IESA 3H9AA 1N1YA 2FBEA 3CHXA 4NMIA 4NUBA 5FY5A 5J3UA 2UY9A 1RUJ3 2GN3A 3KCYA 4MHUA 1RB8G 1G9CA 2W68A 1QJY1 3RPQA 2N7GA 5LA2A 4IV1A 1LNSA 3TN92 3LAGA 4A2UA 5IK5A 3RFRA 1BEV3 3O14A 4Q26A 2WWUA 2ES3A 2Y6FA 5CFCC 5JMCA 3IDEA 4MV2A 4GKXA 3AZZA 3SMHA 1G9AA 2WDBA 1O3SA 3MDPA 5BNNB 3WVJA 4L92A 1H30A 4AVSA 4XTPA 1YCIA 4BQYA 1RUJ2 1AR82 3B01A 3QBQA 1VB4A 2RM23 3NV3A 1BBT1 3AYEA 4AE2A 4ASKA 3ETQA 3O1TA 1G8WA 2ARCA 3TWIA 5JXGA 3A4UA 4COWA 3UKVA 3H8RA 4YM1A 1IKPA 5FZ9A 5JXIA 3CL1A 4FBFA 1LOFC 3ZN5A 1DCSA 3TEZA 2QQIA 5GLTA 1T6GC 3TEWA 4P9GA 4CDXB 1Z7S1 1QNWA 5A7PA 1SLBA 4ONUA 4GB33 4QPYA 3RZZA 5JSRA 4JGYB 2VNGA 4JGZA 1V6KA 2MPFA 2PMWB 3TN91 3O1VA 4JRAA 2B5HA 2B45X 1OVPA 5JI9A 3F95A 3ZX7A 4GWMA 2CGOA 2VZRA 4K6BA 4Q8LA 2OPWA 5F32A 3OY8B 4LEJA 3KV9A 1ASJ3 1UY2A 5CFDB 1VBE3 3CO2A 4TSVA 2NP0A 3ZKUA 1QQP1 3WW3A 3POBA 4UFJA 2BDRA 3LEMA 1K5MA 1AR92 1CZSA 5G04L 2P5BA 5FZOA 4EWEA 2VCBA 2EAAA 3FMGA 3DN7A 1MS3A 4HSJA 1GR3A 4N90A 1UY3A 1BK0A 1FATA 1WMFA 3LOIA 3U14A 1XE7A 1G9FA 4YVWC 1ZVFA 4LJHA 1UY0A 1O3QA 3AKSA 2JJ6A 3WDTA 3L9JT 3O1OA 2BBAA 2VZQA 4QXKA 1VP6A 3UYJA 5IT6A 3IIIA 1QDOA 2DUPA 1AXKA 2W92A 3VN4A 4XXPA 2HEYF 4AOCA 4MSVA 4G9SB 1OH4A 4CCNA 4CUGA 3GNEA 4UFLA 5A3TA 5FZLA 1DLCA 2Z5WA 3TAYA 3I4IA 4CXYA 5FKBA 1BKZA 2PLV2 1W6QB 3EBRA 4QDQA 4UF0B 4BIFA 1W2TA 4XUTA 5AVAA 3R4SA 2HWD2 3G6JB 1XNTA 1GNZA 1RUD3 5A3WA 1WBFA 1SLLA 1X8EA 3LEIA 4MO3M 3POGA 1H2LA 4IV3A 4XE9A 1GOFA 3ZYBA 3FFZA 4IEOA 1IQDC 2OZJA 4QHOA 3WZ1A 4XFBA 4ZU7A 1BHGA 3D5OA 3H1MA 2QJVA 1NCRB 1HRI1 2JDKA 5KXDA 3TBDA 1YFXA 2AYHA 3S6PA 3V0BB 4AFAA 1W99A 5I0TA 1F4AA 4QPIB 4WVMA 2Z69A 5BNNC 4IE5A 3EXUA 3IZOA 4OHYA 2KR2A 4HOOA 3Q8AA 4IE7A 4LKFA 4Y5SA 5IVCA 4FOVA 5I91A 4QX1A 2GMPA 4LORA 1KFXL 4RN5A 2PA7A 3I8TA 4TYSA 4H7MA 1LRHA 4D6QA 3MV01 4QM8A 4QD2A 2EA7A 2XWBB 2VQUA 3SISA 3AP5A 4Q0QA 3JQXA 4YGEA 3WQBA 5KHGA 1S2EA 1SLAA 4ZXKA 1BBT3 4K40A 1AL0G 1DQ6A 2W94A 1JYWA 3ZYHA 1W03A 4QU2A 1ULPA 1COV3 2G1MA 5KXEA 2ZAAA 4L99A 5IVYA 3VBOC 4WM7C 1SDWA 4LR4A 1WA6X 1ZZCA 2G9GA 4BOWA 1F5JA 5CVRA 2JG8A 2WO3A 5A1LA 3K51A 2VE1A 2D6OX 4WM7B 1YQ5A 2LALA 3ZLIA 2JIJA 3WF4A 4NHKA 5BUVA 3DGTA 4CDXC 2IXKA 2MEV1 4G4FA 4O7XA 4W6YA 2DCJA 4AGVA 1RUI2 5JR2A 2RDNA 2WNVC 4QX7A 3EYPA 5C5UA 4KGQA 4QDRA 4UYBA 3J26N 5I8YA 4JGYA 4IEWA 1LOFA 4OHWA 4D7TA 5DAXA 1CONA 1H4HA 4RS5A 3K48A 2BFUS 2KXLA 2CL2A 2F4PA 2XKOA 4HL0A 3WUDA 3OUIA 4CP2A 1UU6A 3OGSA 1JMUB 5BNOB 5A6XA 3I2IA 4EYUA 3NKTA 1LENA 1C1LA 5IVJA 5LA1A 2VD7A 2WYFA 5FP4A 5FPUA 1AXYA 3ACGA 4C1XA 1EPZA 1M4WA 1YO8A 1CX4A 3T30A 1SLIA 4I2OA 5DZGA 2ZBJA 4JC1A 2XJUA 4ZHNA 1UZZA 1JYCA 3J8F2 1HJGA 4EV0A 1UZ0A 3ALQA 1WCDJ 3AVRA 2C6SA 2BOIA 4YRDA 4HONA 3MO4A 1VBB3 4HSLA 3C8XA 5SV5A 2YGMA 3ZXDA 4UAPA 4NE9A 3IMNA 1GP4A 4PLNA 4LT5A 2ARXA 3NRUA 3ILFA 4IV1B 2VCAA 5A6QA 2TUNA 4IQPA 3O1RA 2W1QA 4QU1A 3WOGA 3AVSA 3U11A 4JQTA 1POV1 2WO7A 2XG3A 4HN0A 2X05A 5IAVA 4MGSA 5L36A 3B02A 4FVVA 1AHSA 2VUCA 2ZX1A 4PI0A 5L7OA 5IHRA 4LULA 2E63A 3SKJE 1Q5OA 2CGPA 1CPNA 1D4M3 3OGVA 3PNAA 1PIV1 3FJSA 3MEPA 2Y6KA 1O6UA 2BFUL 4XUQA 2AEZA 2ZHMA 2VY0A 3K3NA 2R062 3T0AA 3D4KA 3KV4A 4XUNA 4FPEA 1W9WA 4RQPB 4MXWA 1W28A 1OKQA 5K0UB 3A0NA 1VRH2 3SH4A 4IEPA 1NX9A 3I59A 4INDA 1PHMA 4L9BA 4Q4X2 1X82A 2RDQA 4UFHA 3IWZA 1XNAA 2BWCA 3GHNA 5C3QA 4TLGA 5A6YA 1W0NA 1D0GA 2VUJA 1VJ2A 4BHPA 1B35C 2J1UA 3OD4A 2NYYA 2HWB2 3U1XA 2VJXA 4CEYB 2V73A 4D6RA 3H42B 3J8F3 3N35A 2B9UA 3WQ0A 4M4PA 4AEMA 3DYPA 2W46A 3B5LB 3OEAA 3S7IA 4CEWB 1YHFA 2FDIA 1RJ8A 3WDXA 3I49A 4XHBA 2RR13 4QHBA 2ZEXA 4LOTA 5EWSA 5GM0A 2FDJA 1YIFA 5CU1A 3POJA 5FPAA 1VB2A 4QB2A 3BB6A 4NAOA 4GIQA 4B1LA 2WQZC 3VKNA 1HX6A 2XQXA 2PHXA 3PTYA 2GMEA 5T5LA 2FQPA 2XONA 2C5DA 2R061 3SC7X 2FCTA 3CIHA 3GHMA 3RI9A 5E16A 4RHV1 1S0BA 4WV8A 1QY4A 3HBZA 2UWBA 3VBOA 3NJXA 2HWD3 3MW2A 3IB3A 3B3QE 4OUSA 4Z1VA 3VD9A 3BUCA 2R0HA 1NQJA 2NN8A 2VZ1A 2X53S 2VUAA 5EHDA 5LB6A 3ENRA 2YROA 4KQ7A 2Y26A 3H7JA 1ND3A 2HEVF 1ZBE1 4A7YA 1WCKA 4MYEA 4IEXA 4C8DA 4AW7A 3ZN4A 1OOPA 3AKQA 1J58A 2W87A 4PF1A 1DGLA 4Q29A 1ZRIA 2A6XA 2VQAA 4BWOA 2ADEA 2ETEA 3RG0A 4XACA 1FV2A 1NZIA 3WW4A 5C3RA 2XOMA 3M8LA 3PTRB 1JZ5A 5DUVA 4YG6A 3KT7A 3VBSB 2VQ0A 5ABJC 1XSQA 4LE4A 1LHOA 5K4LA 1NCQA 4QGNA 2RDSA 5FO9B 3T0BA 2XBO1 2JDUA 4CYDA 4LBQA 1URXA 4CVUA 4TXWA 5ANNA 2YB7A 3E5XA 4GA9A 4KH9A 1XU2A 4DINB 4R9BA 1TQ5A 4YFZA 2H0BA 1SFYA 1W6NB 5KBFA 3E97A 5FZIA 4KMQA 2ZGLA 4Y22B 4GH4B 3C7OA 3T2QA 1GQPA 1WMEA 1UOJA 2JG9C 2ZMKA 3HNMA 2X09A 1W6PB 2E51A 3TN93 1Q8SA 5BNPC 2WAAA 4Z07A 1JUIA 2ORZA 1BVP1 5FUIA 1H2NA 1YLLA 4GB31 1SBDA 1C1FA 2WNUB 3NNLA 2J1TA 3HD8B 1AR73 5A7OA 2LW8A 4DRRA 2RS52 4QXCA 5BYNA 2BGPA 2JG9A 5D1IA 2GP5A 1EY2A 4RFRB 4R8HA 4R4XA 1R083 1FT9A 3C7GA 5CZKA 4GALA 1QMJA 1WA4A 3PVOA 3ELNA 3LOBA 1AL21 2XL9A 1JHJA 4OI4A 1AYN1 5HCBA 3CJXA 4QQPA 5T5OA 2XBO2 4BK4A 3R0RA 2YYOA 1JYXA 1L7LA 4FP3A 4XAEA 1I5ZA 2ID4A 3BVCA 2ZS6B 4FXKB 3N9MA 3FHQA 1LOGA 1ENQA 4AR2A 4XDOA 1BZWA 1PNGA 1VAKA 3MIFA 5A3OA 3ZSEA 5DDJ2 2VTXA 2PHRA 4BE3A 1BEV1 5AFEA 3WLUA 1CZTA 5A6ZA 5AVPA 5JVVA 1O59A 3W5NA 4D6SA 1GNHA 1K3IA 2A3YA 4XMAA 4NIIA 1V0AA 4U2AA 1H1MA 3LA3A 1S0DA 3LGRA 4F3JA 1XE0A 5A7NA 4MOAA 1JOPA 1HB3A 3JD73 4DOUA 3LDBA 5EJZB 2YFZA 4A6SA 4LBJA 1BMV1 3KM5A 1VBA1 2WNVA 4S2HA 1ULOA 1FMD2 1DQ1A 1V6NA 2OXBA 3I97A 4N7UA 5KHHA 3LDKA 2Q30A 2J22A 3PVBB 4NJ4A 5A1AA 5FPVA 1ASJ2 4CCDA 5FUPA 1O5LA 1VALA 2VVFA 3LEKA 4Q8KA 4CA9A 3LF7A 1QJU1 1DYPA 2ZOEB 2E7TA 3PU3A 4FAHA 5FOJB 4AAPA 3AMQA 5JI7A 3AZYA 4UF0A 2VXJA 1GOGA 2JE7A 2YU2A 2ZGOA 1IG0A 3D82A 3M2MA 1VBC1 3B9CA 1PVC1 1SPPA 1XC6A 4FPFA 1S55A 5FMDA 1OI6A 3WG3A 4BA6A 4NOTA 3ZO0B 2P3IA 1D4M2 4YZ5A 4KWJA 2P6CA 3RWKX 3QCWA 3O12A 1WW7A 1C4RA 2BEOA 2ZX4A 3TEXA 4DUXA 3WNPA 5J36A 2XPJA 4XF4A 4PCRA 1WMDA 3BU7A 3POSA 3FBMA 3T0DA 2WFPA 2VH9A 4JV4A 4KNCA 1XSRA 3ST7A 3Q8CA 5K9YA 4FFGA 1D2SA 2DU1A 2I07B 5F5IA 3GJBA 2W1SA 3UKNA 2RM22 3RRDA 3AP4A 1X36A 3KVAA 1XJAA 2O8QA 1FMD1 2JX9A 2RDRA 1V70A 3CJIB 3ZN6A 5I8SA 2C9AA 1H8VA 1FNYA 4X6QB 5CFDA 3AP9A 1CD3G 3ZMOA 1UMHA 3VZMA 4Q0SA 4FTBA 3NJYA 5IJRA 2K46A 4ZZ8A 3P6BA 4RA0A 4PBOA 1WUVA 1YC61 4EE2A 1HIXA 3PIGA 1PVC3 4N8MA 1VBC3 1EV11 1N3OA 2WFF2 4YVWA 1OPMA 5FFOC 4OHZA 1JS9A 2ZACA 4AI1A 1PGW2 3ZSKA 2YC2A 1ZNPA 2PFWA 2IUWA 2HYXA 2RMU2 1GICA 2ZMLA 4P9JA 4XJ9A 5FZOB 2QDNA 3POYA 4FI9A 5D8AB 2J42A 4P14A 1RXGA 2A5ZA 1PZ7A 4ET7A 3APBA 3IAPA 2YG0A 2WSVA 4AZZA 3IIAA 4QX0A 1ZRCA 1PO11 3I2GA 2Q8EA 3ZKYA 1W39A 2JECA 3HJRA 4LKSA 1PK6C 4OMDA 5FZBA 3WP5A 2ET7A 4AEDC 2ZGNA 1MZ5A 4CCMA 5DAQA 1NY72 1C8M3 3BOPA 4AVBA 1LU1A 3QLQA 3LPFA 2OYZA 2MEV3 4M3CB 5DG1A 3WDUA 1PNFA 4QGLA 4PLOA 4WM8C 3RZLA 2LM3A 4XJ8A 4ATEA 2VGDA 2VZOA 2X5IC 4B4RA 1UIJA 4YLZA 2BNOA 5H9QA 2OKXA 4FPHA 3HT1A 4C1WA 1QEXA 1W2UA 2QQMA 3BCWA 4NN0A 2WBKA 3FZ3A 2W9XA 2C1FA 5FMCA 5JSPA 4H2AA 1RVF1 2DCYA 4H55A 5FWJA 5EJ3A 1C8M2 4GH4A 4K1ZA 1BBT2 5A7QA 2XR4A 2VNRA 3LKJA 4GZ9A 5FK8A 5DAVA 3USUB 3AYCA 2VW2A 4Q0PA 3C7HA 3MIGA 1O91A 2IFWA 1F2NA 3KF3A 3OCPA 3UV9A 1CQ9A 4LHSA 4LBQB 2BNNA 4ZS3A 4CPBA 4P9IA 4V2WA 4W50A 4XURA 3RNSA 3FUQA 4UI9L 3VL8A 5C4WC 1SQ4A 2BP6A 3ACLA 3B94A 1K45A 3BOWA 1Z0HA 5FZCA 4CCOA 4EWDA 1UX6A 2CAVA 3V0AA 2R16A 1RYYA 3PU8A 1SG3A 1FOD1 2QQLA 2JXAA 1EUUA 2ZABA 3IAQA 4FP2A 1DYOA 1KXGA 3FN9A 5J7MA 5C70A 1CX1A 3GZTB 3HOBA 3N9OA 2ZHKA 5BY5A 1W90A 4B7KA 3THPA 1P8JA 1N47A 2YBPA 2JDNA 1WLTA 4R4ZA 1QQP2 4CCKA 1RJ7A 4ASLA 4UFKA 5DN2A 3MF6A 3K4AA 5A7SA 4Y24A 5CB7A 5JWPA 3TNPB 2RMU3 4U36A 5HCFA 5A80A 3LB9A 1Q8QA 4LHNA 3QD6A 3ZSMA 1CESA 2BUKA 4RGGA 1D4VB 2HWE1 4RS5C 3MZHA 3W5MA 4YW5A 1GOHA 1VMHA 4Q4V3 5FZFA 1NLQA 2DVGA 4Y33A 1DU3D 4OYUA 2A1XA 4KGGA 4XEZA 4COUA 4HKLA 1JOBA 5FY9A 5K8SA 3WEZA 3EJKA 2DFCA 1UN1A 1WLWA 1PGL1 2EALA 2V4AA 5BNPA 2RS11 3P3PA 1T2XA 5J37A 3OTFA 1RUI1 5KHIA 5FZ3A 3NNGA 2MNGA 3WG1A 5DPNA 2A3XA 4Y1YA 4E4HA 3B00A 2WQ8A 1XOYA 1AXZA 1UX7A 1ULGA 4YGBA 2HWD1 2Q4SA 2PN5A 1O7FA 2B8MA 2WIIB 4XOGA 2GN7A 4B4QA 1F8VA 2V09A 4RR3A 4C91A 1SBFA 2VOWA 1B09A 4QPGB 4ZKTB 3WT3A 3NSTA 5T52A 4XPVA 4I30A 1O4YA 1C8NA 1UZWA 2R32A 4XBQA 1Y9GA 2VL4A 1UXXX 4S2DA 3ZR6A 1DLLA 4MGZE 3RQ0A 5CFCA 2RS32 5H9SA 1K12A 2P6HA 4D7YA 5L7OC 2JICA 2JKBA 4BQ4A 1WW6A 2VNOA 3WNOA 5KC6A 2VVEA 3GDBA 4IGPA 3ES1A 3HQXA 3BU0A 2XJTA 5A70A 4KBBA 2HWB3 3AKPA 4XJUA 4IUGA 3NWKA 4XFAA 4HVQA 4Z2WA 1MEC3 4YW4A 1FI2A 4Q4V2 5DZEA 3VBRC 1PX3A 3HMYA 3ZXFA 3NKGA 2OZ6A 5FZMA 3MBWA 1ND2A 4FPOB 2XMLA 4D69A 1KDKA 2JDYA 4MGKE 3PUAA 3IKWA 1PGSA 5F6LB 4KU8A 2Q8CA 4V1PA 3W9AA 3O1PA 3ZIWA 3RYKA 4AYUA 1GWKA 1TE1B 3ZM8A 5CBLA 4QKFA 1QJFA 1PIV3 4ZZ5A 4RS5B 2VAUA 5AC91 4Y1ZA 1DHKB 3MV11 4H7LA 2ILMA 4DS0A 1OOPB 4CTEA 3GCWA 2A75A 3B9IA 1CPMA 5FZ6A 5FYYA 3UJQA 1CAVB 1DQ2A 1H8TC 4Y4YA 3SCFA 1UYPA 2X8KA 3HEIA 1SBEA 4FQZA 2IWGB 1H8TA 4LO4B 3WW1A 3OUJA 1J3QA 1BXHA 4AK3A 4ISRA 2YV8A 1TME2 1YQ2A 5FZ8A 4SLIA 1RIRA 2JD9A 3VKMA 2V5YA 2Q1ZB 3FHIB 2W91A 3ZFEC 5FOBB 2BPA2 5IATA 3JD72 1H1IA 4YSFA 4XIKA 2BVBA 2VW1A 5E89A 1RUOA 2FDHA 1OD5A 3ZFEA 4FPKA 1YQ6A 3BTZA 1RUC3 1YFUA 4MH0E 2BZDA 1OA4A 3WQ7A 4ZS2A 5CG8A 5A3LA 4HMZA 4EZHA 5CFDC 1ENXA 4HPKA 4W6XA 4PLMA 5HV0A 2X10A 4XJAA 4Q4Y3 4YARA 1GSLA 3VUOA 1CN1A 2XVKA 2GC1A 3WG4A 2JDMA 4YFWA 5C33A 1SFPA 1NXMA 4GMP1 1QOSA 3BTYA 4AGGA 1APNA 2B46X 4PDWB 5J96B 2OW4A 2QQKA 3MYXA 3FBYA 3P1IA 5FYBA 3WDVA 3WV6A 1LGCA 1FNZA 1C3HA 1R093 1QJEA 3LIGA 5EJ1B 5C8CC 5LZ6A 3H7YA 4S2FA 1A8DA 5FYHA 1E5RA 4IE6A 1LB2A 4CDUC 2A3WA 1DGWA 4NO4A 4PJYA 4PDWA 4BQWA 1STMA 4HVRA 4A7ZA 2A6ZA 2GU9A 5IK8A 1KGYA 2WT2A 1UXZA 3GZUC 5DDJ1 2CU5A 2W95A 4YM3A 1AR62 3I59B 1LOBA 1BCXA 1JODA 5LA9A 3VD5A 1W3XA 5JOXA 4Q4W3 1WBLA 2H6CA 1U5IA 3W20A 1LTEA 3WF2A 1S0JA 5C4WB 5HXMA 4LE3A 4R9AA 4C90A 1W2AX 1QJU3 3CJIC 1MQTB 4PF5A 1RUF1 4JDMA 4QQ2A 2DWRA 5F39A 5A1FA 4GQ7A 4HVOA 4EN0A 1EP0A 4XQ4A 5GLVA 2E31A 3VHRA 4J1XA 4OHVA 4QXBA 1JHNA 1VR3A 4B7EA 4AQ2A 1E57A 1HB4A 2HWB1 4BPZA 4BU2A 1C57A 4LO6B 3ROUA 3SH3A 2VM9A 3H8OA 3D0SA 4Q1PA 4OI1A 3S0MA 2DCZA 1X8MA 1CZVA 4A3XA 4XDQA 2P34A 3LA7A 1PMHX 5BV6A 5LEKA 2PAEA 3BALA 3ITQA 4TWTA 2Y38A 4XCAA 5AFBA 5LEJA 1IPJA 3A7QA 1UAIA 3IPVB 1RUG3 3VL9A 4AHWA 2V72A 1JOJA 1X9PA 1FPN1 1MS4A 2W47A 5BNOA 4DXSA 1H1AA 2AR6A 2WUHA 2TNFA 2ET1A 4X6RB 1IHMA 3T08A 2RE9A 3ZYIB 1RUD1 1PVXA 5HXVA 4R9CA 5FUNA 4QKBA 4EROA 3PVEA 1S1AA 4FPYA 4WM8B 1JYVA 4AFBA 2P3KA 3DYMA 3MLLA 3T2TA 1R081 2WL1A 3ZYRA 2ZJCA 4LUKA 1ZZ8A 4XF9A 1RTVA 4CUBA 1RUG2 3AL5A 1WZXA 2XKPA 3CF6E 4TN7A 1N3PA 5CKMA 2BGCA 5FY1A 1RUE3 1Q3EA 2DTWA 3JZVA 3U4SA 5C5TA 3JB8A 5BPXA 3TB0A 3M3QA 5LRSA 5ACA2 3M1HA 5FZGA 1OFSA 1R092 4YYOA 4AVVA 5A3PA 3AMNA 4EN6B 1JZ3A 2CV6A 2DVFA 3ZYJB 2ZCWA 4BQ5A 2RMU1 4JHTA 1VBB2 3MLJA 3VBUB 5F5CA 5F2WA 3IPVA 2BGOA 1QJX3 1QJX2 2A73B 1ASJ1 2WA3A 3SNMA 4TZDA 1HDKA 1MS1A 1SCSA 4HBNA 3DPRB 4BLIA 2VTXJ 4AL9A 5IW0A 4RSUA 3ZYFA 1ZYBA 5FDBA 1V9U1 4I01A 4MUVA 4AHZA 1W6MB 3ZFFC 3VD3A 4COVA 5JZGB 2XVGA 2H0VA 2Y6JA 2QQUA 4E4ZA 2OUJA 1G86A 3OGGA 1O8SA 2TEPA 5DAWA 1RUE1 2CY6A 1HXS3 5JAXA 2W5FA 4NIGA 1OBNA 4K21A 5EV7A 1O4TA 2PQQA 3ZFGA 2RS51 4FSJA 5HV4A 4IE0A 4LNVA 1NA1C 1UYZA 3AMPA 3OD0A 4W8JA 1VPHA 4DNYA 1QH6A 2GAUA 1TNRA 1V6LA 5GKAC 3WD5A 1SPPB 3LSEA 5C3OA 5C8CA 5IWFA 3X29B 3FWEA 2CAUA 1LOEA 4X8NA 3UNPA 1AL22 3I2OA 3R4DB 3THCA 5F37A 1IS3A 3J7HA 3M70A 4IETA 4N53A 2HH9A 2ZA9A 2ZGPA 4WVMB 3SQOA 1QJY2 2EXIA 4AI2A 5JDBA 3AP7A 1UZYA 4QX3A 5IYYA 1YFWA 4AXOA 2QTWB 4Q0UA 5FYIA 1WCUA 1XE8A 4HFSA 3IT8A 2VR4A 4Q27A 4QB1A 5T5PA 4MZUA 2BV4A 5LBBA 1AR91 1ZA4A 5ABJB 4JAAA 1DDLA 1DQ5A 5E8AA 1OVSA 3WDWA 1XNCA 3H3UA 4SBVA 4AF9A 3I2JA 2P17A 3VZNA 3J7NA 2RR11 2VW0A 3VZLA 1DP0A 1XYNA 4MX3A 2WS92 1GU3A 4BXSV 5K7PA 3POFA 1K5JA 1RUJ1 4DEVA 5IK4A 1O8PA 3WP4A 1KQRA 1OF3A 2BNMA 5L9RA 4A4AA 3KSCA 1A78A 1DGWX 5M0TA 4JGZC 1DFQA 3TRSB 1W8NA 2JEMA 2GMMA 2W3JA 2VZUA 2XJRA 4F83A 1FAYA 3O1MA 2GZWA 3THTA 3AMMA 3WF3A 4HPKB 5I0DA 3LCPA 4NVPA 3OYWB 2EIBA 1CIYA 2ZGRA 3AK0A 3WY6A 2RJ2A 2P3YA 5CNAA 1ZM1A 3DCQA 2YPJA 2P2KA 3Q9OA 2QQNA 2Y34A 4A41A 1NY71 5CADA 5C9AA 3PL0A 4UXAA 5JXHA 5F3IA 3AFGA 2RV9A 2JG8C 1LECA 3EB7A 5GJ6A 1U5ZA 4AFDA 5C9AC 3N9PA 1EV13 4MGYE 4Q0VA 4CCCA 4N43C 5FO7B 2VOVA 2D98A 4CUCA 5ISLA 1HB2A 1Y43B 2VMCA 3HQRA 1OMIA 2VZVA 3ATGA 4Y1VA 3RVHA 5IVVA 4NROA 3KQ4B 4CEWC 4QGMA 4IEZA 1HRV3 2RJKA 1D7PM 2VU9A 3AZXA 4IERA 4K3UA 2VMEA 3NV2A 4GJZA 5CKQA 4DRVA 2VCMA 4QKDA 4AI0A 3S5QA 2GC3A 1TMF2 4QPWA 3AB0A 3VBHB 4XFHA 1GP6A 2JDHA 2OQ7A 4CEYC 3AZWA 4M0HA 2JG9B 2WS93 1JH5A 3M4FA 1JZ2A 4D8MA 1F31A 1AYM1 5LCWL 5EZWA 1DGRN 5C3SA 2R071 4BIOA 4LO5B 2ZGKA 1VRH3 1RL3A 1HV1A 4BB3A 1O5UA 4J25A 1CAUB 3OUHA 4YW3A 1VE0A 3ZSLA 3BIEA 2VMFA 3JBG1 5A33A 2GDFA 3NAPC 3ZDSA 4ARXA 1RUC1 3HBKA 3SEPA 3D0JA 1GLHA 4OVEA 2P4EA 1GNYA 1YNAA 4V2VA 5JSOA 4BMEA 1W2NA 3AXDA 1YEWA 5FZKA 2QE3A 5FK7A 5JMOA 2LS6A 2LROA 2QQPA 1KEXA 4LBKA 3KWVA 4H3WA 1RMU2 4QPGC 5T5JA 2WR9A 5G05L 2D44A 3HWJA 5J98B 1VBA3 3SLIA 1OQ1A 1HRI2 3WUCA 1TMF1 5DUWA 4QX5A 1AR72 4BM8A 3DKQA 1RXFA 3ZYGA 5FYTA 4CPBD 1MQTA 2B42B 4E9KA 1LU2A 2VOKA 4I0WB 4LKEA 4UWDA 4NAMA 1V6MA 2Q1MA 2VNVA 1VAMA 4MVTA 2XB6C 3UGFA 3WHUA 3ZFGC 2FHRA 1NE4A 5F6KA 4DO0A 2RVAA 3L2HA 2WNOA 4E4DX 1W0OA 4NIAA 5AC93 1JI6A 2FDFA 2HWC3 1UW8A 1LOCA 3PUIA 2OPKA 3O1UA 4XDPA 3LDRA 1Y7BA 1RUC2 1N1TA 5LRRA 5CA6A 1COV2 2PAKA 4QKNA 4EN7B 4GWJA 1TZOA 5E1RA 1U12A 2OQ6A 5EYXA 3RI8A 5FO8B 3PLQA 3HNYM 4KG0A 1MPXA 2DVDA 3OBZA 3N36A 2WWSA 3ZVXA 3VDAA 2PHTA 2YUEA 2KM2A 4FT8A 1XB9A 5DZFA 3UK9A 3HQUA 2FCVA 3U78A 1BJQA 1MR5A 4Y5Z0 5JZGC 3SCHA 2R0FA 4A45A 2HWC2 2R042 5APAA 5GZFA 2RS53 2Z2SB 3LQCA 5A7WA 3BPZA 3FHAA 5E88A 2ZGQA 5A3NA 1AR71 4XF1A 2EXKA 4JX0A 4O9GA 5K0UA 3VDBA 2J1AA 1MVEA 2WNVB 3R4UA 4MXWB 2UWAA 4QMAA 1FOD2 4OHXA 2ZX2A 1TG7A 1Y4WA 2JDZA 5K0UC 2XXZA 4XUPA 2XUEA 5LK5A 1PZ9A 2QDRA 3BODA 3OPZA 1HRI3 1SLCA 2GALA 5T55A 3OEBA 5J09A 4HZFA 2J1RA 3FLRA 1ULFA 3NVCA 4KBZA 5CG9A 2QZ3A 2IVIB 3KMHA 3NNFA 4LLFA 4YW2A 1UYXA 3J7LA 3FX3A 2D3RA 2XJQA 1CGPA 3J7MA 3WCSA 4N9IA 2PYTA 4HKWA 3OGRA 1SZBA 4IEYA 2Q0AA 5C7GA 5HPOA 3WNKA 4Z82A 4YG0A 3ME2A 3AMHA 2DVBA 1F5FA 2Y33A 2C9KA 2UYAA 4CP9A 1KJLA 3WDYA 2RS13 1IKQA 4DY5A 1IPSA 2ERFA 1KFUL 3GYDA 3MPPG 4YZ3A 2VZPA 5FP9A 2HEWF 4I09A 5FP8A 1NCQC 4LUMA 5CISA 2QQWA 4URAA 1JYNA 2DUQA 1JTZX 1BQPA 4XUOA 1OQEA 1UOGA 4BQ3A 1LHUA 2WZ8A 2J1VA 5FY0A 2ATFA 3OJBA 4XTMA 4DXZA 3UETA 4QPIC 5J1XA 1ULDA 2HWE3 4WVZA 3DYOA 3O1SA 1ZRRA 1AYN2 2Y8KA 3ZXEA 4FOWA 2BJSA 4Y26A 2VZTA 4RHV3 1W6PA 1QQP3 3AFKA 2XLAA 4RL7A 2R063 4YVSB 1VBE2 2DBIA 2W0XA 2P3JA 3ZOIA 4LBMA 1FPN3 2WINB 4QB6A 3CKHA 2WT0A 5FPZA 4YVSC 1G9BA 4ES9A 1KDMA 3N4MA 2WABA 5FIXA 4YVSA 3VBHA 1OT5A 1VRBA 1PX4A 2WRAA 1CIWA 4OQ9A 1UMIA 4UFIA 2WKKA 3ZXJA 1Z7S3 2GH2A 2DDUA 2HWF2 4CU8A 1WGPA 3NNMA 5CFCB 5KXCA 1XRUA 1ZZBA 4WM7A 5FMOS 2K9ZA 4YZ2A 1QNYA 3K46A 3U07A 4YZ1A 1HQLA 3MLKA 3IDBB 5FCCA 5KWRA 3R05A 3N9QA 4FTSA 3WF0A 3CU7A 4RFT0 4B4PA 1ZZ9A 3I3BA 1C5IA 2WZEA 3P3NA 4XZPA 4IGOA 4KL1A 1H2KA 2NQYA 4N7IA 2VQTA 3CDZB 3O0XA 4KWUA 4XHXA 5FBZA 3GJAA 4NRMA 4UW4A 1OSGA 1UY1A 3WQ1A 4UOJA 3RJ2X 5DG2A 2FCUA 1AJOA 1EAH2 1IS4A 5DDJ3 4QDSA 3HN3A 3ZXLA 2XQRA 4Q1RA 2BRTA 1XQNA 5C6CA 2VUDA 2UYBA 1D4M1 1HLCA 4BQ2A 1JYTA 2JENA 5JIAA 3RWNA 3F2ZA 3OG2A 4MG2A 4LIVA 4NWVA 2D6PA 3K4DA 1QJY3 2GNDA 4QX2A 3CLPA 2I2SA 2JKXA 5C8WA 3RZHA 4JGYC 5EXOA 2HWF1 4PHZA 3LZZA 4AEKA 1T6BX 3VB9A 4AFCA 3OBRA 3VDCA 4AEJA 1MVQA 1SCRA 2YZ4A 1IZ3A 5GZGA 1YJKA 2Y0IA 4L8QA 2WYSA 1Q8OA 2D6LX 4Y3OA 3T09A 1UYYA 1JYIA 2JB4A 3TNQA 2I74A 5F3GA 1AUYA 3QH7A 3N3HA 3R6SA 2FD8A 1LOAA 3WP6A 2IZWA 1RHI3 3GZEA 3I3DA 4C0BA 3V56A 2W1WA 5KC5A 3WINE 1UF2C 4QQOA 4LPLA 1X9TA 1RINA 4Z8BA 1AX2A 3VBRB 3U37A 3GBGA 4I0BA 5FLHA 1W6QA 2NZ9A 2C4XA 1A6CA 1LAJA 4O61A 2W52A 2XJVA 4RQPA 5C8CB 3ZXGA 2QVSB 1JZ7A 3NJVA 4P9WA 3NAPA 5F5AA 1R1A3 2AZ5A 2UY8A 3MIBA 1PM4A 1Q56A 3OGJA 1BEV2 1U5XA 3K75B 4YM0A 2G9ZA 1PM7A 3VKOA 1S0GA 1G7YA 4N43B 1US2A 4RGKA 1XNKA 1VAVA 2FZ1A 1O3RA 3ZPOA 2BVVA 3TYJA 1HW5A 3LA2A 2NPIA 1N3QA 1OQDA 2BYVE 2YC4A 3KGLA 5FY7A 4FTEA 2EXHA 1BMV2 1Z7S2 2HWF3 3UESA 4CU6A 5JUVA 2F4LA 3LIHA 4KG8A 4Q4W2 1OA3A 4JTOA 1HRV2 4I3PA 3NNJA 1S0FA 4IL7A 1J84A 2WWJA 3MIEA 4XVHA 5FJHA 3T4VA 3OY8A 3J9SA 3SXWA 3GM8A 4BYYA 4K20A 4A6OA 5LBCA 3WW2A 4ORFA 2B9VA 1SDDB 2JWPA 2NMOA 4JRLA 4N53C 1JBCA 2CWSA 2VMDA 1H6XA 2UURA 5FZDA 4OLLA 4P00B 5LK7B 1ULEA 1W6MA 2X5IB 1J1LA 4UBGA 5FQ0A 5JPNB 1TEIA 4CP0A 1M06G 4B3NA 3AJZA 3BPSA 3Q8FA 5EQUA 1ENRA 5IK7A 3ILNA 3MFCA 3AC0A 5A33B 5FZ7A 1LHWA 1ZBA2 1GKBA 4NRPA 4ASMB 2WZR1 1W6OA 1GWMA 5EPAA 1ZZ7A 1UMZA 3OF1A 2LRPA 3I54A 4COYA 2VOXA 3Q8EA 2CHHA 4GWIA 2D3PA 3IDAA 1WLDA 3KB5A 4Q4Y2 2GNMA 5FLJA 4WBBA 1NQDA 5D8AA 3S5AA 4JVAA 3NQHA 4P08A 2PHFA 1W05A 1FXZA 2GC2A 2X5IA 2Q8OA 3VBSC 4XCBA 5F7UA 1WD4A 1HB1A 3I2HA 1PGW1 4GJYA 4CSWA 2PLV1 5I0RA 1DIWA 4HG6B 1AJKA 3HAGA 5A3MA 2DYCA 5C9AB 5IVBA 2DF7A 3ILRA 4M3CF 3HR9A 5FBJA 2IXCA 3PHMA 4AGRA 1POQA 3IM0A 2ZX3A 3H1YA 4XYXA 5I0UA 3ZDVA 2VOTA 2F6BA 4UT5A 4NHYA 3TEYA 5F1RA 2ZXQA 1UU4A 2VXRA 1YFYA 3ZXKA 2JG8B 4GULA 4I02A 4CDWB 1PO12 1AYN3 5FQ0B 5B4NA 3AX4A 4META 4AWDA 4BCUA 4BK5A 4J6GA 1DF0A 5FP7A 4CCEA 4YVWB 1RUI3 2CYFA 3K2OA 2WNEA 3M7AA 4DXTA 5CEHA 4R52A 2XH6A 4AVTA 4N43A 1DZTA 5FPLA 2ZGMA 2ADDA 3PUHA 3NV1A 4XF0A 4W6WA 2B39A 1QOTA 4CP1A 3ZN6B 5LBFA 3S30A 1REDA 1SACA 3W21A 5IAXA 2PHLA 4OZXA 2XVLA 4PT6A 5JCTA 2BW8A 2RJLA 3AKRA 5TSWA 1QIQA 5C71A 5FV3A 3SHRA 2ZZQA 4MADA 2YHJA 2D93A 2IXJA 4JKMA 1HJFA 2WO2A 4EN8B 1OUSA 4KWKA 1V9U3 2B4KA 2TBVA 3JUUA 4QPIA 3I3MA 3HIFA 1LCLA 4EZ4A 1IS6A 4DY3A 4KWLA 1RGSA 1SLTA 3M3OA 1MS8A 3AL6A 4JZRA 1LGNA 5ABJA 5LY2A 2HBUA 4IEVA 2XBO3 3NAPB 5FKCA 4DZGA 2YY1A 4E4SA 3O0WA 2HLEA 2FZ2A 4CUAA 1N1SA 3E1F1 3DV8A 5KHJA 2MEV2 4RYDA 4NIDA 4GMP0 3I2KA 4I0AA 4O9EA 1ONAA 4O65A 5DQ0A 4N53B 1PO22 2G9FA 3KGZA 3C3VA 1PZ8A 5FMOL 4XIOA 3INAA 3WG2A 1HN1A 2EIDA 3VV1A 3GBWA 2OS2A 4WVWA 4EN9B 5JXJA 1XXNA 2VMIA 3JQWA 4CDUA 4P9YA 3FE5A 2R043 1TVGA 2YPDA 2DURA 2WN2A 1S0EA 1PK6B 2BERA 2XHNA 4ISQA 1KRIA 1XYPA 3MF9A 3GCXA 4YW6A 3RZMA 3S57A 2QQVA 1W9TA 2E7AA 1Z78A 3HVDA 1TNFA 4A42A 2P1BA 3NJZA 5IUQA 4XILA 4ZU5A 4I3GA 1US3A 1DQ0A 1AX0A 3A23A 4FPCA 2HWE2 2XUMA 3MW4A 4P02B 4YGDA 4FAGA 3DPRC 4MGQA 5GALA 1R64A 2R7EB 1J3PA 1AX1A 3SITA 2HWC1 5FR3A 1GZWA 3DPRA 1CAXB 1S0IA 3QACA 5AC92 4FPJA 2K0GA 4BQXA 1E5IA 5JR7B 4E2QA 5FPXA 1E5HA 3ACIA 3JU9A 5F9TA 3VBUA 3AJYA 1YQCA 1SHWB 2CDPA 1F9KA 1C8M1 1WW4A 2ORXA 3N9NA 1H2MA 2RS12 2NMNA 4W4ZA 5LY1A 4OUEA 1LJ7A 2PQSA 3H3ZA 5T50A 4CXWA 1W8WA 2SLIA 3J8F1 3LEGA 4XETA 4Y1XA 3RYRA 2O0OA 2PXJA 4OUMA 2YDEA 4HN1A 4X8PA 1I9RA 4GAZA 4Y22A 5BNOC 4LIUA 1RMU1 5CAZA 2WO1A 2OUHA 4CZSA 4K8RB 4AQTA 3PVNA 2ZGTA 4CDXA 3GZAA 2YBKA 1Q43A 1TME1 3KT4A 1ZBA3 4XFFA 5FXWA 5JLVA 3WNNA 2ZHLA 1RUF3 2ARAA 2WNUA 3NL1A 1CAWB 2VCCA 4BQ1A 1LR5A 3A22A 4HK9A 3VD7A 5L9VA 3DKWA 1IS5A 1ND2B 1WCQA 3EQEA 1S2BA 4K8FA 4AHXA 2OX0A 5LBEA 3H3LA 2WT1A 1PIV2 3O0VA 3N7MA 5GZDA 1F35A 1VRH1 1S4CA 1IQAA 1YIPA 2ZKLA 4GKYA 4Y1UA 3LD8A 2XL7A 4AI9A 2V4VA 3E6BA 4QT6A 3E6DA 1HN0A 1EUTA 1FMD3 1OC1A 1ALYA 2AGSA 4XXAA 4AI3A 3T2PA 1JZ8A 2HKXA 1RC6A 1NA1B 2Q5TA 1UZVA 3GGLA 1OLQA 5C4WA 4URTA 3UT0A 5IVEA 2Y6HA 3PMSA 5KXBA 2H6BA 4LTAA 4AG4A 2QNKA 4LBOA 4ATFA 4ZONA 2GC0A 3VHPA 2J1SA 4CDWC 3NO8A 4CDUB 3AZVA 1NZCA 4RR3B 4PIZA 3CQOA 1LKNA 2PHUA 2Y6LA 3ZFFA 1R1A1 3PJQA 1NKGA 2GNTA 5F2SA 1S2KA 3JBG2 1NUKA 3GF6A 2E32A 3KLSA 3VDDA 5JIUA 2BBVA 2WAOA 4D94A 5BXXA 2DU0A 4JKKA 5FTTC 2QKDA 2E26A 2VMGA 3V65A 3ACFA 3ZXAC 2DFBA 1GZWB 3WSOA 2FDGA 4XF3A 4UBHA 4EJRA 3CBNA 1ZBE2 1Y9MA 1RHI1 2UWCA 4WZCA 3VHNA 1TME3 4Q2FA 2F17A 5HBAA 5KR7A 5A7WB 4RHV2 2PELA 4Y5TA 1WWYA 1ZRDA 4IDZA 4M4RA 2EIEA 1VLNA 1ZZ6A 2IXHA 4W65A 2RS31 1ENSA 2Q1FA 4CU9A 4XQDA 3V0BA 2A71A 4LOSA 2R1DA 3VHOA 3JD71 3BTAA 1PK6A 4M3CE 1JZ6A 2Z79A 2JE9A 3E5QA 4PDWC 3E5UA 4AFMA 4PIXA 2VZ3A 1LHVA 4LKDA 5F5QA 3ORJA 4K7JA 4GH4C 2HJIA 2VO5A 4QQHA 4CRQA 3I2DA 1PMIA 2P37A 2E53A 2B7YA 4QM9A 1OPOA 3FFQA 5T54A 1W04A 4CDQC 4OQ8A 1W3VA 1UOFA 4HKOA 3J4UH 4EQVA 3VBFB 4D7SA 2YMZA 5FMBA 5FY8A 2OA2A 5JOWA 3FLTA 1NG0A 1BLZA 2WC2A 1GQHA 3DF0A 3H0OA 1NE6A 4HANA 3VDDB 4LBQD 5FRAA 1OXCA 1HQNA 3ZFEB 1CAVA 1RHI2 4YG3A 1GV9A 3N7LA 2R30A 5F3CA 1VBA2 2JDAA 2R041 1MEC1 1UOBA 5EYYA 5T3NA 1SEFA 3VZOA 2A7AA 2VG9A 4M0NA 1QF3A 3ECQA 1H9PA 1OOPC 1QKQA 2IFRA 1H9WA 1NYWA 1VMJA 4QWNA 3RYPA 3USUA 1AF9A 3O7OA 2BQPA 3ZIXA 2ARBA 5B4XA 1PO23 2ZGUA 1H8TB 1QJZA 3BN6A 4JCKA 5FXVA 3MFAA 1K5MB 1CR7A 1CJPA 3B7MA 1V6OA 1C5HA 3GALA 2WN3A 5C3PA 5JPMB 3OBTA 4DB5A 2Y6GA 1VMFA 3VKLA 3OPTA 2KA3A 1GWLA 1SFNA 4OI0A 1W8OA 1XYOA 3K77A 5FZHA 3I7DA 3N7KA 1QJX1 1YUDA 2ZTNA 5I8TA 1ODNA 1NT0A 1AR83 2XDVA 4PQQA 1DBNA 4FCAA 1X50A 1D2QA 4JGZB 3RMYA 1NAEA 3D8CA 4KU7A 4IEQA 3L2YA 4UW6A 2I45A 2DCKA 3PDQA 5FYSA 2QBXA 1W2OA 1Y3TA 3FUOA 3DL3A 4NR1A 4EWAA 1MEC2 4AHYA 4Z2AA 2AEYA 4OZOA 1RUE2 1W6OB 1A3KA 3SEEA 3MUY1 1U0AA 4M01A 3WNLA 4A44A 4BH9A 5HI0A 3U0ZA 3AYAA 5SV8A 1V6JA 3LFMA 2E33A 2PHDA 2ZEWA 4XBLA 4CCJA 5JOZA 3POWA 3SCGA 4QPGA 3HPNA 5FREA 4QQLA 2AREA 2HYKA 1QJU2 3QH6A
chains in the Genus database with same CATH topology
1UX7A 2VC9A 2Y8KA 3VD4A 4XUTA 2VZTA 4QAWA 1XNTA 3LEIA 4MO3M 1GOFA 3CZJA 4QB6A 4D0QA 3CKHA 1IQDC 3ETPA 2VL4A 1UXXX 3BGAA 5IFTA 1BHGA 2WABA 1K12A 1OT5A 1PX4A 1W99A 1F4AA 1UMIA 1XPWA 3WNOA 4CU8A 1L7QA 2DDUA 3GDBA 2V5DA 4QX1A 2YFUA 4RN5A 3I3EA 4IUGA 3MV01 3K46A 4A3ZA 1H6YA 2VQUA 2W1UA 3WF0A 1PX3A 3WQBA 1K42A 3MBWA 3I3BA 2WZEA 2W94A 1JYWA 2VQTA 3CDZB 1ULPA 4KWUA 1UY1A 1JU3A 4UOJA 3ZM8A 2WO3A 3HN3A 3GXUA 4QDSA 4ZZ5A 5IFPA 3WF4A 3F2ZA 3MV11 3OG2A 3K4DA 3HNBM 4QX2A 2DCJA 2JKXA 4ARYA 2EICA 3HEIA 3OBAA 3EYPA 4QDRA 3VDCA 2WYSA 3T09A 1UYYA 1PMJX 1L7RA 1YQ2A 3I3DA 2JD9A 3OGSA 2W1WA 3I2IA 2W91A 4LPLA 3U37A 5LA1A 3ACGA 2C4XA 2BZDA 1JZ7A 3NJVA 4DEQA 2X10A 3I2FA 3K75B 1UZ0A 1US2A 2ZEYA 5LA0A 3MO4A 2L9LA 3C8XA 4UAPA 1JZ4A 2QQKA 3P1IA 3NRUA 2VCAA 2YC4A 2W1QA 1OD3A 4CU6A 5EJ1B 5JUVA 1F4HA 2X05A 4MGSA 1I5PA 3JXSA 5IHRA 4XVHA 1J84A 3SKJE 3GM8A 4A6OA 3OGVA 1KGYA 1UXZA 2B9VA 2Y6KA 1SDDB 2W95A 4XUQA 2VMDA 1H6XA 3FL7A 4P00B 3T0AA 3VD5A 4XUNA 1W9WA 3WF2A 3CMGA 5HXMA 2QQJA 3AC0A 1NX9A 1XNAA 1W0NA 2E31A 4ZY9A 2J1UA 2VJXA 2VM9A 4GWIA 4M4PA 3DYPA 3IDAA 2W46A 1CZVA 3OEAA 3NQHA 2ZEZA 4P08A 2JE8A 3LE0A 1PMHX 5F7UA 2ZEXA 3I2HA 1OF4A 4BJ0A 3A7QA 4HG6B 3WNMA 4QB2A 3D3AA 4XZUG 2V72A 2W47A 2XQXA 2VOTA 4DXSA 2WUHA 2XONA 3T08A 2ZXQA 3CIHA 3NJXA 3VD9A 3IB3A 5B4NA 2VZ1A 1JYVA 4BK5A 3DYMA 4DXTA 5EIYB 4CUBA 2W87A 2VZSA 4PF1A 4TTGA 3PUHA 4LQRA 2XOMA 1JZ5A 2VTFA 4PT6A 5C71A 1JZ3A 4MADA 4JKMA 2QQOA 2WO2A 4OMCA 2B4KA 3T0BA 4JKLA 4CVUA 4TXWA 2YB7A 3CZUA 2BGOA 4KMQA 3C7OA 3T2QA 1GQPA 3K4ZA 2HLEA 3HNMA 3VD3A 2X09A 4CUAA 3E1F1 2WAAA 2Y6JA 4RYDA 2ORZA 3I2KA 4ZXEA 5DQ0A 5FUIA 1O8SA 1JU4A 3WF1A 3OB8A 1HN1A 2J1TA 2EIDA 2W5FA 5JXJA 2LW8A 2BGPA 1UYZA 2KD7A 1TVGA 4W8JA 2WN2A 3C7GA 5CZKA 2BERA 2XHNA 3UNPA 3THCA 1JHJA 3J7HA 1W9TA 1J83A 1JYXA 4A42A 4BK4A 4QX3A 5IYYA 1US3A 3A23A 2ID4A 4P02B 4JHZA 4MGQA 4DUWA 3FHQA 1R64A 2VR4A 4QB1A 2R7EB 4BDVB 4DUVA 1CZTA 3I2JA 3W5NA 1O59A 1K3IA 3ACIA 3C7EA 4CU7A 2C26A 1DP0A 3A21A 4BXSV 1GU3A 1SHWB 2CDPA 2J7MA 2ORXA 4DEVA 2Z4FA 4W4ZA 4MOAA 1O8PA 4OUEA 2PQSA 5EJZB 1OF3A 4A4AA 1W9SA 3LEGA 2YFZA 1WKYA 1W8NA 5DMYA 2W3JA 1ULOA 2VZUA 2WO1A 3I97A 4E8DA 3WF3A 3ACHA 5I0DA 2J22A 5A1AA 3LPGA 2EIBA 1CIYA 3LEKA 3DECA 5CYYA 3WNNA 2RJ2A 4L0PA 4A41A 5JR2A 2QQNA 2VCCA 5JXHA 4P5YA 3A22A 3VD7A 2RV9A 1WCQA 3EB7A 1GOGA 1XC6A 2J1EA 1UWWA 4CUCA 3SKVA 2VMCA 2VZVA 2Y64A 4AAXA 4DUXA 3WNPA 1D7PM 2V4VA 3T0DA 2VMEA 1EUTA 3THDA 3T2PA 1JZ8A 4QPWA 4YPJA 2W1SA 3GGLA 1GMMA 3ABZA 4KI5M 2Y6HA 1JZ2A 4AG4A 4D8MA 5LCWL 1GUIA 2J1SA 1UMHA 3CQOA 2Y6LA 5IJRA 4ZZ8A 3P6BA 1NKGA 3C7FA 1NUKA 2VMFA 3UESA 2E32A 4ARXA 3SEPA 2YC2A 2WAOA 2HYXA 1GNYA 4JKKA 2E26A 3MUZ1 3ACFA 4FI9A 3WSOA 5JMOA 2LS6A 3T2OA 1KEXA 1UY4A 4ET7A 3IAPA 4DXRA 2YG0A 2CDOA 5G05L 4E8CA 4QX0A 4M4RA 2EIEA 3I2GA 4LKSA 3HJRA 4CU9A 4OMDA 1JZ6A 3LPFA 2VZ3A 5LA2A 1LNSA 2VO5A 2RVAA 2VZOA 1JI6A 3PUIA 2OKXA 2WDBA 2QQMA 2WBKA 2W9XA 4GWJA 3HNYM 1MPXA 3VDAA 4GZ9A 3C7HA 5JXGA 2JDAA 4A45A 4LHSA 3LQCA 5JXIA 4W50A 3FHAA 4XURA 3ECQA 2QQIA 4UI9L 1K45A 4JX0A 3VDBA 2J1AA 5B4XA 1RYYA 1SG3A 2QQLA 1TG7A 3BN6A 1EUUA 3IAQA 1DYOA 3FN9A 4XUPA 2WN3A 5C70A 3OEBA 3HOBA 1CX1A 2Y6GA 2J1RA 2VZRA 1P8JA 1UYXA 1W8OA 3K77A 1UY2A 3OGRA 5DN2A 4PQQA 1CZSA 3K4AA 5G04L 5C7GA 1NAEA 2VCBA 5HPOA 3WNKA 1UY3A 2DCKA 2C9KA 3W5MA 2QBXA 1GOHA 1UY0A 2VZPA 2BBAA 2VZQA 4Z2AA 4OZOA 4OYUA 3IIIA 3SEEA 2W92A 3MUY1 3WNLA 4A44A 1JYNA 4XUOA 3WEZA 1OH4A 2E33A 2WZ8A 2J1VA 2ZEWA 1T2XA 1DLCA 3UETA 5J1XA 3HPNA 3NNGA 5DPNA 3DYOA 4QDQA 2WQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UX7 A;  2VC9 A;  2Y8K A;  3VD4 A;  4XUT A;  2VZT A;  4QAW A;  1XNT A;  3LEI A;  4MO3 M;  1GOF A;  3CZJ A;  4QB6 A;  4D0Q A;  3CKH A;  1IQD C;  3ETP A;  2VL4 A;  1UXX X;  3BGA A;  5IFT A;  1BHG A;  2WAB A;  1K12 A;  1OT5 A;  1PX4 A;  1W99 A;  1F4A A;  1UMI A;  1XPW A;  3WNO A;  4CU8 A;  1L7Q A;  2DDU A;  3GDB A;  2V5D A;  4QX1 A;  2YFU A;  4RN5 A;  3I3E A;  4IUG A;  3MV0 1;  3K46 A;  4A3Z A;  1H6Y A;  2VQU A;  2W1U A;  3WF0 A;  1PX3 A;  3WQB A;  1K42 A;  3MBW A;  3I3B A;  2WZE A;  2W94 A;  1JYW A;  2VQT A;  3CDZ B;  1ULP A;  4KWU A;  1UY1 A;  1JU3 A;  4UOJ A;  3ZM8 A;  2WO3 A;  3HN3 A;  3GXU A;  4QDS A;  4ZZ5 A;  5IFP A;  3WF4 A;  3F2Z A;  3MV1 1;  3OG2 A;  3K4D A;  3HNB M;  4QX2 A;  2DCJ A;  2JKX A;  4ARY A;  2EIC A;  3HEI A;  3OBA A;  3EYP A;  4QDR A;  3VDC A;  2WYS A;  3T09 A;  1UYY A;  1PMJ X;  1L7R A;  1YQ2 A;  3I3D A;  2JD9 A;  3OGS A;  2W1W A;  3I2I A;  2W91 A;  4LPL A;  3U37 A;  5LA1 A;  3ACG A;  2C4X A;  2BZD A;  1JZ7 A;  3NJV A;  4DEQ A;  2X10 A;  3I2F A;  3K75 B;  1UZ0 A;  1US2 A;  2ZEY A;  5LA0 A;  3MO4 A;  2L9L A;  3C8X A;  4UAP A;  1JZ4 A;  2QQK A;  3P1I A;  3NRU A;  2VCA A;  2YC4 A;  2W1Q A;  1OD3 A;  4CU6 A;  5EJ1 B;  5JUV A;  1F4H A;  2X05 A;  4MGS A;  1I5P A;  3JXS A;  5IHR A;  4XVH A;  1J84 A;  3SKJ E;  3GM8 A;  4A6O A;  3OGV A;  1KGY A;  1UXZ A;  2B9V A;  2Y6K A;  1SDD B;  2W95 A;  4XUQ A;  2VMD A;  1H6X A;  3FL7 A;  4P00 B;  3T0A A;  3VD5 A;  4XUN A;  1W9W A;  3WF2 A;  3CMG A;  5HXM A;  2QQJ A;  3AC0 A;  1NX9 A;  1XNA A;  1W0N A;  2E31 A;  4ZY9 A;  2J1U A;  2VJX A;  2VM9 A;  4GWI A;  4M4P A;  3DYP A;  3IDA A;  2W46 A;  1CZV A;  3OEA A;  3NQH A;  2ZEZ A;  4P08 A;  2JE8 A;  3LE0 A;  1PMH X;  5F7U A;  2ZEX A;  3I2H A;  1OF4 A;  4BJ0 A;  3A7Q A;  4HG6 B;  3WNM A;  4QB2 A;  3D3A A;  4XZU G;  2V72 A;  2W47 A;  2XQX A;  2VOT A;  4DXS A;  2WUH A;  2XON A;  3T08 A;  2ZXQ A;  3CIH A;  3NJX A;  3VD9 A;  3IB3 A;  5B4N A;  2VZ1 A;  1JYV A;  4BK5 A;  3DYM A;  4DXT A;  5EIY B;  4CUB A;  2W87 A;  2VZS A;  4PF1 A;  4TTG A;  3PUH A;  4LQR A;  2XOM A;  1JZ5 A;  2VTF A;  4PT6 A;  5C71 A;  1JZ3 A;  4MAD A;  4JKM A;  2QQO A;  2WO2 A;  4OMC A;  2B4K A;  3T0B A;  4JKL A;  4CVU A;  4TXW A;  2YB7 A;  3CZU A;  2BGO A;  4KMQ A;  3C7O A;  3T2Q A;  1GQP A;  3K4Z A;  2HLE A;  3HNM A;  3VD3 A;  2X09 A;  4CUA A;  3E1F 1;  2WAA A;  2Y6J A;  4RYD A;  2ORZ A;  3I2K A;  4ZXE A;  5DQ0 A;  5FUI A;  1O8S A;  1JU4 A;  3WF1 A;  3OB8 A;  1HN1 A;  2J1T A;  2EID A;  2W5F A;  5JXJ A;  2LW8 A;  2BGP A;  1UYZ A;  2KD7 A;  1TVG A;  4W8J A;  2WN2 A;  3C7G A;  5CZK A;  2BER A;  2XHN A;  3UNP A;  3THC A;  1JHJ A;  3J7H A;  1W9T A;  1J83 A;  1JYX A;  4A42 A;  4BK4 A;  4QX3 A;  5IYY A;  1US3 A;  3A23 A;  2ID4 A;  4P02 B;  4JHZ A;  4MGQ A;  4DUW A;  3FHQ A;  1R64 A;  2VR4 A;  4QB1 A;  2R7E B;  4BDV B;  4DUV A;  1CZT A;  3I2J A;  3W5N A;  1O59 A;  1K3I A;  3ACI A;  3C7E A;  4CU7 A;  2C26 A;  1DP0 A;  3A21 A;  4BXS V;  1GU3 A;  1SHW B;  2CDP A;  2J7M A;  2ORX A;  4DEV A;  2Z4F A;  4W4Z A;  4MOA A;  1O8P A;  4OUE A;  2PQS A;  5EJZ B;  1OF3 A;  4A4A A;  1W9S A;  3LEG A;  2YFZ A;  1WKY A;  1W8N A;  5DMY A;  2W3J A;  1ULO A;  2VZU A;  2WO1 A;  3I97 A;  4E8D A;  3WF3 A;  3ACH A;  5I0D A;  2J22 A;  5A1A A;  3LPG A;  2EIB A;  1CIY A;  3LEK A;  3DEC A;  5CYY A;  3WNN A;  2RJ2 A;  4L0P A;  4A41 A;  5JR2 A;  2QQN A;  2VCC A;  5JXH A;  4P5Y A;  3A22 A;  3VD7 A;  2RV9 A;  1WCQ A;  3EB7 A;  1GOG A;  1XC6 A;  2J1E A;  1UWW A;  4CUC A;  3SKV A;  2VMC A;  2VZV A;  2Y64 A;  4AAX A;  4DUX A;  3WNP A;  1D7P M;  2V4V A;  3T0D A;  2VME A;  1EUT A;  3THD A;  3T2P A;  1JZ8 A;  4QPW A;  4YPJ A;  2W1S A;  3GGL A;  1GMM A;  3ABZ A;  4KI5 M;  2Y6H A;  1JZ2 A;  4AG4 A;  4D8M A;  5LCW L;  1GUI A;  2J1S A;  1UMH A;  3CQO A;  2Y6L A;  5IJR A;  4ZZ8 A;  3P6B A;  1NKG A;  3C7F A;  1NUK A;  2VMF A;  3UES A;  2E32 A;  4ARX A;  3SEP A;  2YC2 A;  2WAO A;  2HYX A;  1GNY A;  4JKK A;  2E26 A;  3MUZ 1;  3ACF A;  4FI9 A;  3WSO A;  5JMO A;  2LS6 A;  3T2O A;  1KEX A;  1UY4 A;  4ET7 A;  3IAP A;  4DXR A;  2YG0 A;  2CDO A;  5G05 L;  4E8C A;  4QX0 A;  4M4R A;  2EIE A;  3I2G A;  4LKS A;  3HJR A;  4CU9 A;  4OMD A;  1JZ6 A;  3LPF A;  2VZ3 A;  5LA2 A;  1LNS A;  2VO5 A;  2RVA A;  2VZO A;  1JI6 A;  3PUI A;  2OKX A;  2WDB A;  2QQM A;  2WBK A;  2W9X A;  4GWJ A;  3HNY M;  1MPX A;  3VDA A;  4GZ9 A;  3C7H A;  5JXG A;  2JDA A;  4A45 A;  4LHS A;  3LQC A;  5JXI A;  4W50 A;  3FHA A;  4XUR A;  3ECQ A;  2QQI A;  4UI9 L;  1K45 A;  4JX0 A;  3VDB A;  2J1A A;  5B4X A;  1RYY A;  1SG3 A;  2QQL A;  1TG7 A;  3BN6 A;  1EUU A;  3IAQ A;  1DYO A;  3FN9 A;  4XUP A;  2WN3 A;  5C70 A;  3OEB A;  3HOB A;  1CX1 A;  2Y6G A;  2J1R A;  2VZR A;  1P8J A;  1UYX A;  1W8O A;  3K77 A;  1UY2 A;  3OGR A;  5DN2 A;  4PQQ A;  1CZS A;  3K4A A;  5G04 L;  5C7G A;  1NAE A;  2VCB A;  5HPO A;  3WNK A;  1UY3 A;  2DCK A;  2C9K A;  3W5M A;  2QBX A;  1GOH A;  1UY0 A;  2VZP A;  2BBA A;  2VZQ A;  4Z2A A;  4OZO A;  4OYU A;  3III A;  3SEE A;  2W92 A;  3MUY 1;  3WNL A;  4A44 A;  1JYN A;  4XUO A;  3WEZ A;  1OH4 A;  2E33 A;  2WZ8 A;  2J1V A;  2ZEW A;  1T2X A;  1DLC A;  3UET A;  5J1X A;  3HPN A;  3NNG A;  5DPN A;  3DYO A;  4QDQ A;  2WQ8 A; 
#chains in the Genus database with same CATH topology
 2VC9 A;  3VD4 A;  1AR8 1;  4QAW A;  2D6M A;  1UPI A;  2C0Z A;  2QFE A;  1OH3 A;  2VUL A;  4BIS A;  4XAB A;  3MGU A;  5J48 A;  3DEM A;  2WZP P;  4Y20 A;  3CZJ A;  4DIQ A;  4IV1 C;  4K1Y A;  2W2I A;  4D0Q A;  4ZPI A;  5GLU A;  1RUG 1;  1J59 A;  3ETP A;  1R1Z A;  1KJR A;  3VDD C;  3BGA A;  3MPB A;  1AR6 1;  1W06 A;  5IFT A;  4LBL A;  1IGO A;  2PLV 3;  5H9P A;  5HCH A;  1HQW A;  4LHL A;  1Q8P A;  4J1W A;  2GH8 A;  2YXS A;  3UKT A;  3RZG A;  1MS5 A;  2JDP A;  2R6Q A;  1OHF A;  1GZ9 A;  1PVC 2;  1FOD 3;  3OOX A;  4LO8 A;  5E6H A;  1XPW A;  2D43 A;  1MQT C;  4ES8 A;  5FYZ A;  1L7Q A;  2QUO A;  2V5D A;  2IC1 A;  4XC9 A;  2BTV C;  2YU1 A;  2YFU A;  5KHK A;  1W8T A;  2A6W A;  3GBF A;  3OYW A;  3I3E A;  1OA2 A;  2WSU A;  4E2G A;  4CE8 A;  4L11 A;  5ANQ A;  1KS4 A;  2VVD A;  1UCX A;  3KV6 A;  4A3Z A;  1H6Y A;  4HLT A;  2UU8 A;  4JDO A;  4MHR A;  4XMI A;  2W1U A;  1DGR A;  4HXC A;  1NLR A;  2AUY A;  1VIW B;  1K42 A;  5FXX A;  4D3W A;  2QZ2 A;  5A32 B;  3N7J A;  1YJL A;  1B35 A;  2RM2 1;  4FO9 A;  4BMB A;  3PME A;  1UIK A;  2CWM A;  1YXW A;  5FZA A;  1V9U 2;  1UQX A;  4Q4W 1;  1GBG A;  2DTY A;  1RVF 3;  2D7F A;  5FZ0 A;  1X33 A;  1ZRE A;  5I93 A;  3WXP A;  4B29 A;  1JU3 A;  1MS0 A;  4YWA A;  1V00 A;  3GXU A;  1XNB A;  4COZ A;  3HT2 A;  4LA3 A;  1ZX5 A;  4FFI A;  2BWA A;  2WLQ A;  4S2G A;  4DQA A;  5IFP A;  3VKF C;  1LES A;  5D8A C;  1CJD A;  2XJP A;  1QWR A;  4HK8 A;  3HNB M;  1MAC A;  1JN2 P;  2A6Y A;  4ARY A;  2D6N A;  2D5F A;  4XFG A;  2EIC A;  3KZ4 C;  2EXJ A;  3JB4 C;  3OBA A;  5JZG A;  3BTX A;  1LEM A;  3U75 A;  4R9D A;  3UGH A;  2A6V A;  4FPL A;  2DUO A;  2WZR 2;  2Z42 A;  4QXH A;  3PJY A;  1PO1 3;  1GFF 2;  4A7K A;  1QH7 A;  4HET A;  1PMJ X;  3WP3 A;  3V0A B;  1H4G A;  1L7R A;  2D97 A;  5FY4 A;  3ZMN A;  2RG4 A;  4LA2 A;  2Y0O A;  5L73 A;  3ZFG B;  1WD3 A;  2R07 2;  4NHL A;  3ZYP A;  1WCS A;  4IEU A;  4Q4Y 1;  1QXR A;  2D5H A;  3P5B A;  3KQR A;  3ON7 A;  4Y4R A;  5D2A A;  1EYB A;  1GP5 A;  3MI8 A;  2D3S A;  4CDQ B;  4LK6 A;  1EAH 3;  1VBD 1;  4M00 A;  1YWK A;  1GYK A;  2RR1 2;  1VBC 2;  2WFF 3;  4IW3 A;  1GZT A;  1RVF 2;  2EAK A;  3JBG 3;  2NLR A;  4CDW A;  4DEQ A;  4XJW A;  4IXL A;  3WX5 A;  3NMB A;  2A70 A;  3I2F A;  4Y20 B;  2R07 3;  1SMV A;  2ZMN A;  3B93 A;  3T3Y A;  1AYM 3;  2ZEY A;  4MXV A;  4WZF A;  4RGA A;  4AED B;  5B2G B;  5LA0 A;  2WS9 1;  3EMR A;  2L9L A;  5FYU A;  1V6I A;  5I0S A;  1OLM A;  1JZ4 A;  1YRZ A;  2WQ4 A;  4OCT A;  2WA4 A;  2LTN A;  1Y9Q A;  5GLZ A;  4DPN A;  2ZAH A;  4M3C A;  4NIH A;  2GNB A;  1FYU A;  1OD3 A;  5F3E A;  3W59 A;  2ZHN A;  4MGI E;  5ACA 3;  3WR0 A;  2JD4 A;  4LLO A;  4PI2 A;  1E5S A;  1F4H A;  1I5P A;  3S7E A;  3U4X A;  3IBM A;  1MZ6 A;  2DVA A;  3JXS A;  4UW5 A;  5BNN A;  1CWP A;  3C2U A;  4ZU4 A;  2D6K A;  2CNA A;  4C0H A;  1A8M A;  1G9D A;  2Y60 A;  2YGL A;  1CVN A;  1BYH A;  4BXF A;  1ULC A;  4AED A;  3O5S A;  1ST8 A;  1XU1 A;  1VBD 2;  1NCR C;  3LWC A;  4Q5O A;  2VBB A;  1OFN A;  4P5H A;  3FL7 A;  1RIT A;  2E7Q A;  1DG6 A;  1JUH A;  5GLW A;  2X29 A;  3CJI A;  3DUI A;  3RS6 A;  1COV 1;  3V64 A;  4WM8 A;  2AEN A;  1I1E A;  1XBF A;  3CMG A;  1LGB A;  4AQ6 A;  3KS7 A;  3DXT A;  1LED A;  4P9X A;  2QQJ A;  3LSD A;  3KHC A;  4FPG A;  4CDQ A;  1BK1 A;  2PAM A;  5DXD A;  4FQ4 A;  4Q4X 1;  3BKZ A;  3RGB A;  2GP3 A;  3H1W A;  2DCT A;  4FXG B;  3AYD A;  1AYM 2;  3VBU C;  4ZY9 A;  1REE A;  3NW4 A;  1NCQ B;  3AKT A;  5FZE A;  1OLR A;  1YYN A;  2XWJ B;  2OII A;  3KD4 A;  4OFG A;  4NPL A;  3TOJ A;  4BLJ A;  2CGN A;  5GZC A;  1PGL 2;  4GWN A;  1DZQ A;  1LUL A;  3ASI A;  2ZEZ A;  3MHZ A;  3T1L A;  2JE8 A;  2W08 A;  5LAT A;  4FOQ A;  2ZX0 A;  3LE0 A;  3VBO B;  2DV9 A;  1OF4 A;  4L97 A;  1UO9 A;  1L3J A;  1J1T A;  3U10 A;  4BJ0 A;  4NPR A;  4PQ9 A;  2VPV A;  1AR6 3;  1GQG A;  3WNM A;  3VBR A;  2G19 A;  1AR9 3;  3D3A A;  4XZU G;  5FPB A;  1W9F A;  1W8Z A;  2WNU C;  4NWW A;  5DAB A;  1NXD 1;  5H9R A;  4CP9 B;  3EHK A;  1ZRF A;  1NOV A;  1UNB A;  2DBN A;  3VBF C;  4B8E A;  3Q8B A;  2XGX A;  3FLP A;  5A3U A;  1QGL A;  4H14 A;  3WCR A;  3T1M A;  1IOA A;  1AL2 3;  3KT1 A;  3VBF A;  4JQR A;  3PUS A;  5EIY B;  1HV0 A;  1JW6 A;  4NHM A;  4TTG A;  2VZS A;  1I3H A;  1QHD A;  1DZR A;  1Q8V A;  3KF5 A;  1ODM A;  4YM2 A;  3IDC B;  1OUX A;  2OVU A;  1HXS 1;  3KCC A;  4LQR A;  4UW3 A;  4XBN A;  4YW7 A;  1QXJ A;  1QU0 A;  4GD4 A;  3OPW A;  3NV4 A;  1KD7 A;  5CIR A;  5IVF A;  1R1A 2;  2VTF A;  4Q4V 1;  1POV 0;  1ZA7 A;  3LFI A;  2SBA A;  1H0B A;  1WLC A;  5ERL A;  4E27 A;  4UFM A;  2QQO A;  1UPS A;  4MLO A;  5CKN A;  4OMC A;  1X7N A;  4YGC A;  3AP6 A;  4JKL A;  1FV3 A;  2BOJ A;  4FFF A;  1A34 A;  1VBE 1;  3CZU A;  1O4Z A;  4QX8 A;  5L9B A;  2C24 A;  4AVC A;  5LW9 A;  2K2S A;  2OT7 A;  2XHK A;  4RR3 C;  1W8U A;  5FYC A;  3VLB B;  4LK7 A;  2JB8 A;  2RHP A;  5F8P A;  4LIT A;  2GSY A;  2XLG A;  4NPM A;  3RSJ A;  1IPK A;  3K4Z A;  5D21 A;  1NA1 A;  2IXI A;  2FDK A;  4MGT A;  4G3Y C;  2NM1 A;  4K9S A;  4JTN A;  2O1Q A;  4ZXE A;  1PO2 1;  4GB3 2;  5LWB A;  1JU4 A;  3CNA A;  2O14 A;  3WF1 A;  5BNQ A;  3OB8 A;  3OSD A;  4XJZ A;  3B69 A;  4CCL A;  1DYK A;  5EFU A;  5LAS A;  1HXS 2;  5FXZ A;  2XLF A;  1W6N A;  4PBP A;  4XW3 A;  4Z92 B;  1YI7 A;  2E6V A;  2KD7 A;  2O8O A;  4XFC A;  1ZBE 3;  5DAP A;  1WW5 A;  5EP9 A;  4FOY A;  4IE4 A;  4LMF A;  3E6C C;  4N9H A;  1S0C A;  3FC0 A;  1IG3 A;  5HCA A;  1J83 A;  2ZKN A;  1YI9 A;  1OUR A;  2VBP A;  1CAU A;  1W8H A;  2R1B A;  1ND2 C;  3KHB A;  3D6E A;  4IV3 C;  1AVB A;  3KCX A;  4L2N A;  1DQ4 A;  3PIJ A;  1W0P A;  1I6X A;  4JHZ A;  4F7Z A;  1OKO A;  3KV5 A;  3VBS A;  4DUW A;  4DUV A;  3AM2 A;  4B1M A;  4BDV B;  3M3C A;  3PUR A;  5FYV A;  1EPW A;  2CTV A;  1UD1 A;  1F15 A;  4RD7 A;  2Q8D A;  2IXL A;  3HN1 A;  2G4I A;  2VEC A;  4YW1 A;  1MS9 A;  2VBD A;  4OUL A;  3C7E A;  1ACC A;  1D0H A;  1GAN A;  2C26 A;  3IN9 A;  4HT1 T;  3A21 A;  4CU7 A;  3BI3 A;  3RZK A;  2FMY A;  2J7M A;  2EIG A;  2ZGS A;  2Z4F A;  1MZE A;  2ENR A;  1CAW A;  3ZPY A;  1ND3 B;  3WHT A;  2AC1 A;  4GXL A;  1W9S A;  4YNI A;  1UKG A;  3AXE A;  4ITC A;  1TMF 3;  1WKY A;  2RS3 3;  2D40 A;  3JCI A;  1QXP A;  2CSG A;  5DMY A;  1CAX A;  1GZC A;  2VMH A;  3UL2 A;  1U5Y A;  1N1V A;  1QDC A;  4E8D A;  3ACH A;  3WNX A;  1UL9 A;  2MHF A;  3RZJ A;  5FAX A;  2WZR 3;  4Q4X 3;  4LBN A;  3LPG A;  3N9L A;  3DXU A;  3KVB A;  3USS A;  1NLS A;  2IVJ A;  3DEC A;  5CYY A;  2R49 A;  4LHK A;  3URF A;  1RUD 2;  4L0P A;  1WMX A;  4IGQ A;  5FP3 A;  1LOD A;  3A0K A;  4OI2 A;  4P5Y A;  3M3E A;  3EO6 A;  5JOY A;  1K5M C;  3RMX A;  1RUH 3;  1RUH 2;  4F8A A;  4LO7 A;  5FWE A;  3IMM A;  2EVX A;  2J1E A;  1UWW A;  3UGG A;  3ZSJ A;  3SKV A;  5L19 A;  1XND A;  1ND3 C;  4JDN A;  1RUF 2;  3M3I A;  1REF A;  4CEY A;  1KIT A;  2Y64 A;  4AAX A;  5FZ1 A;  3K3O A;  2FMD A;  2AH2 A;  4XAA A;  3I3Q A;  5DUU A;  3MIH A;  2ZPX A;  1OLM E;  3CEW A;  3G7D A;  3MIC A;  1POV 3;  3VZJ A;  4DMI A;  2JIG A;  3THD A;  1FX5 A;  3VGI A;  5ACA 1;  1R09 1;  2HBT A;  3QOP A;  4E2S A;  1KS5 A;  4YPJ A;  4CXX A;  4NRQ A;  4XQW A;  3BYW A;  2LUW A;  3ZR5 A;  4CEW A;  1AZD A;  1GMM A;  1J3R A;  3ABZ A;  4KI5 M;  5BNP B;  1VBB 1;  1O3T A;  1MZF A;  2QCS B;  1LHN A;  2WJS A;  2WLP A;  3H50 A;  2E9Q A;  4GMP 3;  4P9L A;  1W9Y A;  4PIY A;  4RQP C;  2YC0 A;  3RDI A;  1GUI A;  1HRV 1;  5FYM A;  3VZK A;  4AQS A;  4DFS A;  3MID A;  1UU5 A;  2PHW A;  4AVA A;  4QHZ A;  3POI A;  1JXN A;  3MW3 A;  2ZZJ A;  3C7F A;  5FLI A;  1G6N A;  5FZ4 A;  4AI8 A;  1YQ8 A;  1B35 B;  1EV1 2;  2EF6 A;  2WFF 1;  1RUH 1;  2YBS A;  3RJR A;  4BZ4 A;  5A32 A;  5L7O B;  4LXL A;  3H8X A;  2BU9 A;  4WVV A;  3ES4 A;  1NCR A;  3SH5 A;  1EAH 1;  1VBD 3;  2W39 A;  4YZ4 A;  1BVV A;  1HKD A;  5GZE A;  3W58 A;  3MUZ 1;  3VBH C;  2AAC A;  4FFH A;  1FPN 2;  3T2O A;  1C28 A;  1RUN A;  1UY4 A;  3T4H B;  4IV3 B;  3UJO A;  1R08 2;  1ZBA 1;  4DXR A;  4XFI A;  2CDO A;  4TLF A;  3ZFF B;  1W8F A;  2XJS A;  4E8C A;  3BIW E;  4NHX A;  1QOO A;  1RMU 3;  1UKR A;  3H8U A;  5DUX A;  3POE A;  5FJK A;  2PTM A;  3PUQ A;  4IES A;  3H9A A;  1N1Y A;  2FBE A;  3CHX A;  4NMI A;  4NUB A;  5FY5 A;  5J3U A;  2UY9 A;  1RUJ 3;  2GN3 A;  3KCY A;  4MHU A;  1RB8 G;  1G9C A;  2W68 A;  1QJY 1;  3RPQ A;  2N7G A;  5LA2 A;  4IV1 A;  1LNS A;  3TN9 2;  3LAG A;  4A2U A;  5IK5 A;  3RFR A;  1BEV 3;  3O14 A;  4Q26 A;  2WWU A;  2ES3 A;  2Y6F A;  5CFC C;  5JMC A;  3IDE A;  4MV2 A;  4GKX A;  3AZZ A;  3SMH A;  1G9A A;  2WDB A;  1O3S A;  3MDP A;  5BNN B;  3WVJ A;  4L92 A;  1H30 A;  4AVS A;  4XTP A;  1YCI A;  4BQY A;  1RUJ 2;  1AR8 2;  3B01 A;  3QBQ A;  1VB4 A;  2RM2 3;  3NV3 A;  1BBT 1;  3AYE A;  4AE2 A;  4ASK A;  3ETQ A;  3O1T A;  1G8W A;  2ARC A;  3TWI A;  5JXG A;  3A4U A;  4COW A;  3UKV A;  3H8R A;  4YM1 A;  1IKP A;  5FZ9 A;  5JXI A;  3CL1 A;  4FBF A;  1LOF C;  3ZN5 A;  1DCS A;  3TEZ A;  2QQI A;  5GLT A;  1T6G C;  3TEW A;  4P9G A;  4CDX B;  1Z7S 1;  1QNW A;  5A7P A;  1SLB A;  4ONU A;  4GB3 3;  4QPY A;  3RZZ A;  5JSR A;  4JGY B;  2VNG A;  4JGZ A;  1V6K A;  2MPF A;  2PMW B;  3TN9 1;  3O1V A;  4JRA A;  2B5H A;  2B45 X;  1OVP A;  5JI9 A;  3F95 A;  3ZX7 A;  4GWM A;  2CGO A;  2VZR A;  4K6B A;  4Q8L A;  2OPW A;  5F32 A;  3OY8 B;  4LEJ A;  3KV9 A;  1ASJ 3;  1UY2 A;  5CFD B;  1VBE 3;  3CO2 A;  4TSV A;  2NP0 A;  3ZKU A;  1QQP 1;  3WW3 A;  3POB A;  4UFJ A;  2BDR A;  3LEM A;  1K5M A;  1AR9 2;  1CZS A;  5G04 L;  2P5B A;  5FZO A;  4EWE A;  2VCB A;  2EAA A;  3FMG A;  3DN7 A;  1MS3 A;  4HSJ A;  1GR3 A;  4N90 A;  1UY3 A;  1BK0 A;  1FAT A;  1WMF A;  3LOI A;  3U14 A;  1XE7 A;  1G9F A;  4YVW C;  1ZVF A;  4LJH A;  1UY0 A;  1O3Q A;  3AKS A;  2JJ6 A;  3WDT A;  3L9J T;  3O1O A;  2BBA A;  2VZQ A;  4QXK A;  1VP6 A;  3UYJ A;  5IT6 A;  3III A;  1QDO A;  2DUP A;  1AXK A;  2W92 A;  3VN4 A;  4XXP A;  2HEY F;  4AOC A;  4MSV A;  4G9S B;  1OH4 A;  4CCN A;  4CUG A;  3GNE A;  4UFL A;  5A3T A;  5FZL A;  1DLC A;  2Z5W A;  3TAY A;  3I4I A;  4CXY A;  5FKB A;  1BKZ A;  2PLV 2;  1W6Q B;  3EBR A;  4QDQ A;  4UF0 B;  4BIF A;  1W2T A;  4XUT A;  5AVA A;  3R4S A;  2HWD 2;  3G6J B;  1XNT A;  1GNZ A;  1RUD 3;  5A3W A;  1WBF A;  1SLL A;  1X8E A;  3LEI A;  4MO3 M;  3POG A;  1H2L A;  4IV3 A;  4XE9 A;  1GOF A;  3ZYB A;  3FFZ A;  4IEO A;  1IQD C;  2OZJ A;  4QHO A;  3WZ1 A;  4XFB A;  4ZU7 A;  1BHG A;  3D5O A;  3H1M A;  2QJV A;  1NCR B;  1HRI 1;  2JDK A;  5KXD A;  3TBD A;  1YFX A;  2AYH A;  3S6P A;  3V0B B;  4AFA A;  1W99 A;  5I0T A;  1F4A A;  4QPI B;  4WVM A;  2Z69 A;  5BNN C;  4IE5 A;  3EXU A;  3IZO A;  4OHY A;  2KR2 A;  4HOO A;  3Q8A A;  4IE7 A;  4LKF A;  4Y5S A;  5IVC A;  4FOV A;  5I91 A;  4QX1 A;  2GMP A;  4LOR A;  1KFX L;  4RN5 A;  2PA7 A;  3I8T A;  4TYS A;  4H7M A;  1LRH A;  4D6Q A;  3MV0 1;  4QM8 A;  4QD2 A;  2EA7 A;  2XWB B;  2VQU A;  3SIS A;  3AP5 A;  4Q0Q A;  3JQX A;  4YGE A;  3WQB A;  5KHG A;  1S2E A;  1SLA A;  4ZXK A;  1BBT 3;  4K40 A;  1AL0 G;  1DQ6 A;  2W94 A;  1JYW A;  3ZYH A;  1W03 A;  4QU2 A;  1ULP A;  1COV 3;  2G1M A;  5KXE A;  2ZAA A;  4L99 A;  5IVY A;  3VBO C;  4WM7 C;  1SDW A;  4LR4 A;  1WA6 X;  1ZZC A;  2G9G A;  4BOW A;  1F5J A;  5CVR A;  2JG8 A;  2WO3 A;  5A1L A;  3K51 A;  2VE1 A;  2D6O X;  4WM7 B;  1YQ5 A;  2LAL A;  3ZLI A;  2JIJ A;  3WF4 A;  4NHK A;  5BUV A;  3DGT A;  4CDX C;  2IXK A;  2MEV 1;  4G4F A;  4O7X A;  4W6Y A;  2DCJ A;  4AGV A;  1RUI 2;  5JR2 A;  2RDN A;  2WNV C;  4QX7 A;  3EYP A;  5C5U A;  4KGQ A;  4QDR A;  4UYB A;  3J26 N;  5I8Y A;  4JGY A;  4IEW A;  1LOF A;  4OHW A;  4D7T A;  5DAX A;  1CON A;  1H4H A;  4RS5 A;  3K48 A;  2BFU S;  2KXL A;  2CL2 A;  2F4P A;  2XKO A;  4HL0 A;  3WUD A;  3OUI A;  4CP2 A;  1UU6 A;  3OGS A;  1JMU B;  5BNO B;  5A6X A;  3I2I A;  4EYU A;  3NKT A;  1LEN A;  1C1L A;  5IVJ A;  5LA1 A;  2VD7 A;  2WYF A;  5FP4 A;  5FPU A;  1AXY A;  3ACG A;  4C1X A;  1EPZ A;  1M4W A;  1YO8 A;  1CX4 A;  3T30 A;  1SLI A;  4I2O A;  5DZG A;  2ZBJ A;  4JC1 A;  2XJU A;  4ZHN A;  1UZZ A;  1JYC A;  3J8F 2;  1HJG A;  4EV0 A;  1UZ0 A;  3ALQ A;  1WCD J;  3AVR A;  2C6S A;  2BOI A;  4YRD A;  4HON A;  3MO4 A;  1VBB 3;  4HSL A;  3C8X A;  5SV5 A;  2YGM A;  3ZXD A;  4UAP A;  4NE9 A;  3IMN A;  1GP4 A;  4PLN A;  4LT5 A;  2ARX A;  3NRU A;  3ILF A;  4IV1 B;  2VCA A;  5A6Q A;  2TUN A;  4IQP A;  3O1R A;  2W1Q A;  4QU1 A;  3WOG A;  3AVS A;  3U11 A;  4JQT A;  1POV 1;  2WO7 A;  2XG3 A;  4HN0 A;  2X05 A;  5IAV A;  4MGS A;  5L36 A;  3B02 A;  4FVV A;  1AHS A;  2VUC A;  2ZX1 A;  4PI0 A;  5L7O A;  5IHR A;  4LUL A;  2E63 A;  3SKJ E;  1Q5O A;  2CGP A;  1CPN A;  1D4M 3;  3OGV A;  3PNA A;  1PIV 1;  3FJS A;  3MEP A;  2Y6K A;  1O6U A;  2BFU L;  4XUQ A;  2AEZ A;  2ZHM A;  2VY0 A;  3K3N A;  2R06 2;  3T0A A;  3D4K A;  3KV4 A;  4XUN A;  4FPE A;  1W9W A;  4RQP B;  4MXW A;  1W28 A;  1OKQ A;  5K0U B;  3A0N A;  1VRH 2;  3SH4 A;  4IEP A;  1NX9 A;  3I59 A;  4IND A;  1PHM A;  4L9B A;  4Q4X 2;  1X82 A;  2RDQ A;  4UFH A;  3IWZ A;  1XNA A;  2BWC A;  3GHN A;  5C3Q A;  4TLG A;  5A6Y A;  1W0N A;  1D0G A;  2VUJ A;  1VJ2 A;  4BHP A;  1B35 C;  2J1U A;  3OD4 A;  2NYY A;  2HWB 2;  3U1X A;  2VJX A;  4CEY B;  2V73 A;  4D6R A;  3H42 B;  3J8F 3;  3N35 A;  2B9U A;  3WQ0 A;  4M4P A;  4AEM A;  3DYP A;  2W46 A;  3B5L B;  3OEA A;  3S7I A;  4CEW B;  1YHF A;  2FDI A;  1RJ8 A;  3WDX A;  3I49 A;  4XHB A;  2RR1 3;  4QHB A;  2ZEX A;  4LOT A;  5EWS A;  5GM0 A;  2FDJ A;  1YIF A;  5CU1 A;  3POJ A;  5FPA A;  1VB2 A;  4QB2 A;  3BB6 A;  4NAO A;  4GIQ A;  4B1L A;  2WQZ C;  3VKN A;  1HX6 A;  2XQX A;  2PHX A;  3PTY A;  2GME A;  5T5L A;  2FQP A;  2XON A;  2C5D A;  2R06 1;  3SC7 X;  2FCT A;  3CIH A;  3GHM A;  3RI9 A;  5E16 A;  4RHV 1;  1S0B A;  4WV8 A;  1QY4 A;  3HBZ A;  2UWB A;  3VBO A;  3NJX A;  2HWD 3;  3MW2 A;  3IB3 A;  3B3Q E;  4OUS A;  4Z1V A;  3VD9 A;  3BUC A;  2R0H A;  1NQJ A;  2NN8 A;  2VZ1 A;  2X53 S;  2VUA A;  5EHD A;  5LB6 A;  3ENR A;  2YRO A;  4KQ7 A;  2Y26 A;  3H7J A;  1ND3 A;  2HEV F;  1ZBE 1;  4A7Y A;  1WCK A;  4MYE A;  4IEX A;  4C8D A;  4AW7 A;  3ZN4 A;  1OOP A;  3AKQ A;  1J58 A;  2W87 A;  4PF1 A;  1DGL A;  4Q29 A;  1ZRI A;  2A6X A;  2VQA A;  4BWO A;  2ADE A;  2ETE A;  3RG0 A;  4XAC A;  1FV2 A;  1NZI A;  3WW4 A;  5C3R A;  2XOM A;  3M8L A;  3PTR B;  1JZ5 A;  5DUV A;  4YG6 A;  3KT7 A;  3VBS B;  2VQ0 A;  5ABJ C;  1XSQ A;  4LE4 A;  1LHO A;  5K4L A;  1NCQ A;  4QGN A;  2RDS A;  5FO9 B;  3T0B A;  2XBO 1;  2JDU A;  4CYD A;  4LBQ A;  1URX A;  4CVU A;  4TXW A;  5ANN A;  2YB7 A;  3E5X A;  4GA9 A;  4KH9 A;  1XU2 A;  4DIN B;  4R9B A;  1TQ5 A;  4YFZ A;  2H0B A;  1SFY A;  1W6N B;  5KBF A;  3E97 A;  5FZI A;  4KMQ A;  2ZGL A;  4Y22 B;  4GH4 B;  3C7O A;  3T2Q A;  1GQP A;  1WME A;  1UOJ A;  2JG9 C;  2ZMK A;  3HNM A;  2X09 A;  1W6P B;  2E51 A;  3TN9 3;  1Q8S A;  5BNP C;  2WAA A;  4Z07 A;  1JUI A;  2ORZ A;  1BVP 1;  5FUI A;  1H2N A;  1YLL A;  4GB3 1;  1SBD A;  1C1F A;  2WNU B;  3NNL A;  2J1T A;  3HD8 B;  1AR7 3;  5A7O A;  2LW8 A;  4DRR A;  2RS5 2;  4QXC A;  5BYN A;  2BGP A;  2JG9 A;  5D1I A;  2GP5 A;  1EY2 A;  4RFR B;  4R8H A;  4R4X A;  1R08 3;  1FT9 A;  3C7G A;  5CZK A;  4GAL A;  1QMJ A;  1WA4 A;  3PVO A;  3ELN A;  3LOB A;  1AL2 1;  2XL9 A;  1JHJ A;  4OI4 A;  1AYN 1;  5HCB A;  3CJX A;  4QQP A;  5T5O A;  2XBO 2;  4BK4 A;  3R0R A;  2YYO A;  1JYX A;  1L7L A;  4FP3 A;  4XAE A;  1I5Z A;  2ID4 A;  3BVC A;  2ZS6 B;  4FXK B;  3N9M A;  3FHQ A;  1LOG A;  1ENQ A;  4AR2 A;  4XDO A;  1BZW A;  1PNG A;  1VAK A;  3MIF A;  5A3O A;  3ZSE A;  5DDJ 2;  2VTX A;  2PHR A;  4BE3 A;  1BEV 1;  5AFE A;  3WLU A;  1CZT A;  5A6Z A;  5AVP A;  5JVV A;  1O59 A;  3W5N A;  4D6S A;  1GNH A;  1K3I A;  2A3Y A;  4XMA A;  4NII A;  1V0A A;  4U2A A;  1H1M A;  3LA3 A;  1S0D A;  3LGR A;  4F3J A;  1XE0 A;  5A7N A;  4MOA A;  1JOP A;  1HB3 A;  3JD7 3;  4DOU A;  3LDB A;  5EJZ B;  2YFZ A;  4A6S A;  4LBJ A;  1BMV 1;  3KM5 A;  1VBA 1;  2WNV A;  4S2H A;  1ULO A;  1FMD 2;  1DQ1 A;  1V6N A;  2OXB A;  3I97 A;  4N7U A;  5KHH A;  3LDK A;  2Q30 A;  2J22 A;  3PVB B;  4NJ4 A;  5A1A A;  5FPV A;  1ASJ 2;  4CCD A;  5FUP A;  1O5L A;  1VAL A;  2VVF A;  3LEK A;  4Q8K A;  4CA9 A;  3LF7 A;  1QJU 1;  1DYP A;  2ZOE B;  2E7T A;  3PU3 A;  4FAH A;  5FOJ B;  4AAP A;  3AMQ A;  5JI7 A;  3AZY A;  4UF0 A;  2VXJ A;  1GOG A;  2JE7 A;  2YU2 A;  2ZGO A;  1IG0 A;  3D82 A;  3M2M A;  1VBC 1;  3B9C A;  1PVC 1;  1SPP A;  1XC6 A;  4FPF A;  1S55 A;  5FMD A;  1OI6 A;  3WG3 A;  4BA6 A;  4NOT A;  3ZO0 B;  2P3I A;  1D4M 2;  4YZ5 A;  4KWJ A;  2P6C A;  3RWK X;  3QCW A;  3O12 A;  1WW7 A;  1C4R A;  2BEO A;  2ZX4 A;  3TEX A;  4DUX A;  3WNP A;  5J36 A;  2XPJ A;  4XF4 A;  4PCR A;  1WMD A;  3BU7 A;  3POS A;  3FBM A;  3T0D A;  2WFP A;  2VH9 A;  4JV4 A;  4KNC A;  1XSR A;  3ST7 A;  3Q8C A;  5K9Y A;  4FFG A;  1D2S A;  2DU1 A;  2I07 B;  5F5I A;  3GJB A;  2W1S A;  3UKN A;  2RM2 2;  3RRD A;  3AP4 A;  1X36 A;  3KVA A;  1XJA A;  2O8Q A;  1FMD 1;  2JX9 A;  2RDR A;  1V70 A;  3CJI B;  3ZN6 A;  5I8S A;  2C9A A;  1H8V A;  1FNY A;  4X6Q B;  5CFD A;  3AP9 A;  1CD3 G;  3ZMO A;  1UMH A;  3VZM A;  4Q0S A;  4FTB A;  3NJY A;  5IJR A;  2K46 A;  4ZZ8 A;  3P6B A;  4RA0 A;  4PBO A;  1WUV A;  1YC6 1;  4EE2 A;  1HIX A;  3PIG A;  1PVC 3;  4N8M A;  1VBC 3;  1EV1 1;  1N3O A;  2WFF 2;  4YVW A;  1OPM A;  5FFO C;  4OHZ A;  1JS9 A;  2ZAC A;  4AI1 A;  1PGW 2;  3ZSK A;  2YC2 A;  1ZNP A;  2PFW A;  2IUW A;  2HYX A;  2RMU 2;  1GIC A;  2ZML A;  4P9J A;  4XJ9 A;  5FZO B;  2QDN A;  3POY A;  4FI9 A;  5D8A B;  2J42 A;  4P14 A;  1RXG A;  2A5Z A;  1PZ7 A;  4ET7 A;  3APB A;  3IAP A;  2YG0 A;  2WSV A;  4AZZ A;  3IIA A;  4QX0 A;  1ZRC A;  1PO1 1;  3I2G A;  2Q8E A;  3ZKY A;  1W39 A;  2JEC A;  3HJR A;  4LKS A;  1PK6 C;  4OMD A;  5FZB A;  3WP5 A;  2ET7 A;  4AED C;  2ZGN A;  1MZ5 A;  4CCM A;  5DAQ A;  1NY7 2;  1C8M 3;  3BOP A;  4AVB A;  1LU1 A;  3QLQ A;  3LPF A;  2OYZ A;  2MEV 3;  4M3C B;  5DG1 A;  3WDU A;  1PNF A;  4QGL A;  4PLO A;  4WM8 C;  3RZL A;  2LM3 A;  4XJ8 A;  4ATE A;  2VGD A;  2VZO A;  2X5I C;  4B4R A;  1UIJ A;  4YLZ A;  2BNO A;  5H9Q A;  2OKX A;  4FPH A;  3HT1 A;  4C1W A;  1QEX A;  1W2U A;  2QQM A;  3BCW A;  4NN0 A;  2WBK A;  3FZ3 A;  2W9X A;  2C1F A;  5FMC A;  5JSP A;  4H2A A;  1RVF 1;  2DCY A;  4H55 A;  5FWJ A;  5EJ3 A;  1C8M 2;  4GH4 A;  4K1Z A;  1BBT 2;  5A7Q A;  2XR4 A;  2VNR A;  3LKJ A;  4GZ9 A;  5FK8 A;  5DAV A;  3USU B;  3AYC A;  2VW2 A;  4Q0P A;  3C7H A;  3MIG A;  1O91 A;  2IFW A;  1F2N A;  3KF3 A;  3OCP A;  3UV9 A;  1CQ9 A;  4LHS A;  4LBQ B;  2BNN A;  4ZS3 A;  4CPB A;  4P9I A;  4V2W A;  4W50 A;  4XUR A;  3RNS A;  3FUQ A;  4UI9 L;  3VL8 A;  5C4W C;  1SQ4 A;  2BP6 A;  3ACL A;  3B94 A;  1K45 A;  3BOW A;  1Z0H A;  5FZC A;  4CCO A;  4EWD A;  1UX6 A;  2CAV A;  3V0A A;  2R16 A;  1RYY A;  3PU8 A;  1SG3 A;  1FOD 1;  2QQL A;  2JXA A;  1EUU A;  2ZAB A;  3IAQ A;  4FP2 A;  1DYO A;  1KXG A;  3FN9 A;  5J7M A;  5C70 A;  1CX1 A;  3GZT B;  3HOB A;  3N9O A;  2ZHK A;  5BY5 A;  1W90 A;  4B7K A;  3THP A;  1P8J A;  1N47 A;  2YBP A;  2JDN A;  1WLT A;  4R4Z A;  1QQP 2;  4CCK A;  1RJ7 A;  4ASL A;  4UFK A;  5DN2 A;  3MF6 A;  3K4A A;  5A7S A;  4Y24 A;  5CB7 A;  5JWP A;  3TNP B;  2RMU 3;  4U36 A;  5HCF A;  5A80 A;  3LB9 A;  1Q8Q A;  4LHN A;  3QD6 A;  3ZSM A;  1CES A;  2BUK A;  4RGG A;  1D4V B;  2HWE 1;  4RS5 C;  3MZH A;  3W5M A;  4YW5 A;  1GOH A;  1VMH A;  4Q4V 3;  5FZF A;  1NLQ A;  2DVG A;  4Y33 A;  1DU3 D;  4OYU A;  2A1X A;  4KGG A;  4XEZ A;  4COU A;  4HKL A;  1JOB A;  5FY9 A;  5K8S A;  3WEZ A;  3EJK A;  2DFC A;  1UN1 A;  1WLW A;  1PGL 1;  2EAL A;  2V4A A;  5BNP A;  2RS1 1;  3P3P A;  1T2X A;  5J37 A;  3OTF A;  1RUI 1;  5KHI A;  5FZ3 A;  3NNG A;  2MNG A;  3WG1 A;  5DPN A;  2A3X A;  4Y1Y A;  4E4H A;  3B00 A;  2WQ8 A;  1XOY A;  1AXZ A;  1UX7 A;  1ULG A;  4YGB A;  2HWD 1;  2Q4S A;  2PN5 A;  1O7F A;  2B8M A;  2WII B;  4XOG A;  2GN7 A;  4B4Q A;  1F8V A;  2V09 A;  4RR3 A;  4C91 A;  1SBF A;  2VOW A;  1B09 A;  4QPG B;  4ZKT B;  3WT3 A;  3NST A;  5T52 A;  4XPV A;  4I30 A;  1O4Y A;  1C8N A;  1UZW A;  2R32 A;  4XBQ A;  1Y9G A;  2VL4 A;  1UXX X;  4S2D A;  3ZR6 A;  1DLL A;  4MGZ E;  3RQ0 A;  5CFC A;  2RS3 2;  5H9S A;  1K12 A;  2P6H A;  4D7Y A;  5L7O C;  2JIC A;  2JKB A;  4BQ4 A;  1WW6 A;  2VNO A;  3WNO A;  5KC6 A;  2VVE A;  3GDB A;  4IGP A;  3ES1 A;  3HQX A;  3BU0 A;  2XJT A;  5A70 A;  4KBB A;  2HWB 3;  3AKP A;  4XJU A;  4IUG A;  3NWK A;  4XFA A;  4HVQ A;  4Z2W A;  1MEC 3;  4YW4 A;  1FI2 A;  4Q4V 2;  5DZE A;  3VBR C;  1PX3 A;  3HMY A;  3ZXF A;  3NKG A;  2OZ6 A;  5FZM A;  3MBW A;  1ND2 A;  4FPO B;  2XML A;  4D69 A;  1KDK A;  2JDY A;  4MGK E;  3PUA A;  3IKW A;  1PGS A;  5F6L B;  4KU8 A;  2Q8C A;  4V1P A;  3W9A A;  3O1P A;  3ZIW A;  3RYK A;  4AYU A;  1GWK A;  1TE1 B;  3ZM8 A;  5CBL A;  4QKF A;  1QJF A;  1PIV 3;  4ZZ5 A;  4RS5 B;  2VAU A;  5AC9 1;  4Y1Z A;  1DHK B;  3MV1 1;  4H7L A;  2ILM A;  4DS0 A;  1OOP B;  4CTE A;  3GCW A;  2A75 A;  3B9I A;  1CPM A;  5FZ6 A;  5FYY A;  3UJQ A;  1CAV B;  1DQ2 A;  1H8T C;  4Y4Y A;  3SCF A;  1UYP A;  2X8K A;  3HEI A;  1SBE A;  4FQZ A;  2IWG B;  1H8T A;  4LO4 B;  3WW1 A;  3OUJ A;  1J3Q A;  1BXH A;  4AK3 A;  4ISR A;  2YV8 A;  1TME 2;  1YQ2 A;  5FZ8 A;  4SLI A;  1RIR A;  2JD9 A;  3VKM A;  2V5Y A;  2Q1Z B;  3FHI B;  2W91 A;  3ZFE C;  5FOB B;  2BPA 2;  5IAT A;  3JD7 2;  1H1I A;  4YSF A;  4XIK A;  2BVB A;  2VW1 A;  5E89 A;  1RUO A;  2FDH A;  1OD5 A;  3ZFE A;  4FPK A;  1YQ6 A;  3BTZ A;  1RUC 3;  1YFU A;  4MH0 E;  2BZD A;  1OA4 A;  3WQ7 A;  4ZS2 A;  5CG8 A;  5A3L A;  4HMZ A;  4EZH A;  5CFD C;  1ENX A;  4HPK A;  4W6X A;  4PLM A;  5HV0 A;  2X10 A;  4XJA A;  4Q4Y 3;  4YAR A;  1GSL A;  3VUO A;  1CN1 A;  2XVK A;  2GC1 A;  3WG4 A;  2JDM A;  4YFW A;  5C33 A;  1SFP A;  1NXM A;  4GMP 1;  1QOS A;  3BTY A;  4AGG A;  1APN A;  2B46 X;  4PDW B;  5J96 B;  2OW4 A;  2QQK A;  3MYX A;  3FBY A;  3P1I A;  5FYB A;  3WDV A;  3WV6 A;  1LGC A;  1FNZ A;  1C3H A;  1R09 3;  1QJE A;  3LIG A;  5EJ1 B;  5C8C C;  5LZ6 A;  3H7Y A;  4S2F A;  1A8D A;  5FYH A;  1E5R A;  4IE6 A;  1LB2 A;  4CDU C;  2A3W A;  1DGW A;  4NO4 A;  4PJY A;  4PDW A;  4BQW A;  1STM A;  4HVR A;  4A7Z A;  2A6Z A;  2GU9 A;  5IK8 A;  1KGY A;  2WT2 A;  1UXZ A;  3GZU C;  5DDJ 1;  2CU5 A;  2W95 A;  4YM3 A;  1AR6 2;  3I59 B;  1LOB A;  1BCX A;  1JOD A;  5LA9 A;  3VD5 A;  1W3X A;  5JOX A;  4Q4W 3;  1WBL A;  2H6C A;  1U5I A;  3W20 A;  1LTE A;  3WF2 A;  1S0J A;  5C4W B;  5HXM A;  4LE3 A;  4R9A A;  4C90 A;  1W2A X;  1QJU 3;  3CJI C;  1MQT B;  4PF5 A;  1RUF 1;  4JDM A;  4QQ2 A;  2DWR A;  5F39 A;  5A1F A;  4GQ7 A;  4HVO A;  4EN0 A;  1EP0 A;  4XQ4 A;  5GLV A;  2E31 A;  3VHR A;  4J1X A;  4OHV A;  4QXB A;  1JHN A;  1VR3 A;  4B7E A;  4AQ2 A;  1E57 A;  1HB4 A;  2HWB 1;  4BPZ A;  4BU2 A;  1C57 A;  4LO6 B;  3ROU A;  3SH3 A;  2VM9 A;  3H8O A;  3D0S A;  4Q1P A;  4OI1 A;  3S0M A;  2DCZ A;  1X8M A;  1CZV A;  4A3X A;  4XDQ A;  2P34 A;  3LA7 A;  1PMH X;  5BV6 A;  5LEK A;  2PAE A;  3BAL A;  3ITQ A;  4TWT A;  2Y38 A;  4XCA A;  5AFB A;  5LEJ A;  1IPJ A;  3A7Q A;  1UAI A;  3IPV B;  1RUG 3;  3VL9 A;  4AHW A;  2V72 A;  1JOJ A;  1X9P A;  1FPN 1;  1MS4 A;  2W47 A;  5BNO A;  4DXS A;  1H1A A;  2AR6 A;  2WUH A;  2TNF A;  2ET1 A;  4X6R B;  1IHM A;  3T08 A;  2RE9 A;  3ZYI B;  1RUD 1;  1PVX A;  5HXV A;  4R9C A;  5FUN A;  4QKB A;  4ERO A;  3PVE A;  1S1A A;  4FPY A;  4WM8 B;  1JYV A;  4AFB A;  2P3K A;  3DYM A;  3MLL A;  3T2T A;  1R08 1;  2WL1 A;  3ZYR A;  2ZJC A;  4LUK A;  1ZZ8 A;  4XF9 A;  1RTV A;  4CUB A;  1RUG 2;  3AL5 A;  1WZX A;  2XKP A;  3CF6 E;  4TN7 A;  1N3P A;  5CKM A;  2BGC A;  5FY1 A;  1RUE 3;  1Q3E A;  2DTW A;  3JZV A;  3U4S A;  5C5T A;  3JB8 A;  5BPX A;  3TB0 A;  3M3Q A;  5LRS A;  5ACA 2;  3M1H A;  5FZG A;  1OFS A;  1R09 2;  4YYO A;  4AVV A;  5A3P A;  3AMN A;  4EN6 B;  1JZ3 A;  2CV6 A;  2DVF A;  3ZYJ B;  2ZCW A;  4BQ5 A;  2RMU 1;  4JHT A;  1VBB 2;  3MLJ A;  3VBU B;  5F5C A;  5F2W A;  3IPV A;  2BGO A;  1QJX 3;  1QJX 2;  2A73 B;  1ASJ 1;  2WA3 A;  3SNM A;  4TZD A;  1HDK A;  1MS1 A;  1SCS A;  4HBN A;  3DPR B;  4BLI A;  2VTX J;  4AL9 A;  5IW0 A;  4RSU A;  3ZYF A;  1ZYB A;  5FDB A;  1V9U 1;  4I01 A;  4MUV A;  4AHZ A;  1W6M B;  3ZFF C;  3VD3 A;  4COV A;  5JZG B;  2XVG A;  2H0V A;  2Y6J A;  2QQU A;  4E4Z A;  2OUJ A;  1G86 A;  3OGG A;  1O8S A;  2TEP A;  5DAW A;  1RUE 1;  2CY6 A;  1HXS 3;  5JAX A;  2W5F A;  4NIG A;  1OBN A;  4K21 A;  5EV7 A;  1O4T A;  2PQQ A;  3ZFG A;  2RS5 1;  4FSJ A;  5HV4 A;  4IE0 A;  4LNV A;  1NA1 C;  1UYZ A;  3AMP A;  3OD0 A;  4W8J A;  1VPH A;  4DNY A;  1QH6 A;  2GAU A;  1TNR A;  1V6L A;  5GKA C;  3WD5 A;  1SPP B;  3LSE A;  5C3O A;  5C8C A;  5IWF A;  3X29 B;  3FWE A;  2CAU A;  1LOE A;  4X8N A;  3UNP A;  1AL2 2;  3I2O A;  3R4D B;  3THC A;  5F37 A;  1IS3 A;  3J7H A;  3M70 A;  4IET A;  4N53 A;  2HH9 A;  2ZA9 A;  2ZGP A;  4WVM B;  3SQO A;  1QJY 2;  2EXI A;  4AI2 A;  5JDB A;  3AP7 A;  1UZY A;  4QX3 A;  5IYY A;  1YFW A;  4AXO A;  2QTW B;  4Q0U A;  5FYI A;  1WCU A;  1XE8 A;  4HFS A;  3IT8 A;  2VR4 A;  4Q27 A;  4QB1 A;  5T5P A;  4MZU A;  2BV4 A;  5LBB A;  1AR9 1;  1ZA4 A;  5ABJ B;  4JAA A;  1DDL A;  1DQ5 A;  5E8A A;  1OVS A;  3WDW A;  1XNC A;  3H3U A;  4SBV A;  4AF9 A;  3I2J A;  2P17 A;  3VZN A;  3J7N A;  2RR1 1;  2VW0 A;  3VZL A;  1DP0 A;  1XYN A;  4MX3 A;  2WS9 2;  1GU3 A;  4BXS V;  5K7P A;  3POF A;  1K5J A;  1RUJ 1;  4DEV A;  5IK4 A;  1O8P A;  3WP4 A;  1KQR A;  1OF3 A;  2BNM A;  5L9R A;  4A4A A;  3KSC A;  1A78 A;  1DGW X;  5M0T A;  4JGZ C;  1DFQ A;  3TRS B;  1W8N A;  2JEM A;  2GMM A;  2W3J A;  2VZU A;  2XJR A;  4F83 A;  1FAY A;  3O1M A;  2GZW A;  3THT A;  3AMM A;  3WF3 A;  4HPK B;  5I0D A;  3LCP A;  4NVP A;  3OYW B;  2EIB A;  1CIY A;  2ZGR A;  3AK0 A;  3WY6 A;  2RJ2 A;  2P3Y A;  5CNA A;  1ZM1 A;  3DCQ A;  2YPJ A;  2P2K A;  3Q9O A;  2QQN A;  2Y34 A;  4A41 A;  1NY7 1;  5CAD A;  5C9A A;  3PL0 A;  4UXA A;  5JXH A;  5F3I A;  3AFG A;  2RV9 A;  2JG8 C;  1LEC A;  3EB7 A;  5GJ6 A;  1U5Z A;  4AFD A;  5C9A C;  3N9P A;  1EV1 3;  4MGY E;  4Q0V A;  4CCC A;  4N43 C;  5FO7 B;  2VOV A;  2D98 A;  4CUC A;  5ISL A;  1HB2 A;  1Y43 B;  2VMC A;  3HQR A;  1OMI A;  2VZV A;  3ATG A;  4Y1V A;  3RVH A;  5IVV A;  4NRO A;  3KQ4 B;  4CEW C;  4QGM A;  4IEZ A;  1HRV 3;  2RJK A;  1D7P M;  2VU9 A;  3AZX A;  4IER A;  4K3U A;  2VME A;  3NV2 A;  4GJZ A;  5CKQ A;  4DRV A;  2VCM A;  4QKD A;  4AI0 A;  3S5Q A;  2GC3 A;  1TMF 2;  4QPW A;  3AB0 A;  3VBH B;  4XFH A;  1GP6 A;  2JDH A;  2OQ7 A;  4CEY C;  3AZW A;  4M0H A;  2JG9 B;  2WS9 3;  1JH5 A;  3M4F A;  1JZ2 A;  4D8M A;  1F31 A;  1AYM 1;  5LCW L;  5EZW A;  1DGR N;  5C3S A;  2R07 1;  4BIO A;  4LO5 B;  2ZGK A;  1VRH 3;  1RL3 A;  1HV1 A;  4BB3 A;  1O5U A;  4J25 A;  1CAU B;  3OUH A;  4YW3 A;  1VE0 A;  3ZSL A;  3BIE A;  2VMF A;  3JBG 1;  5A33 A;  2GDF A;  3NAP C;  3ZDS A;  4ARX A;  1RUC 1;  3HBK A;  3SEP A;  3D0J A;  1GLH A;  4OVE A;  2P4E A;  1GNY A;  1YNA A;  4V2V A;  5JSO A;  4BME A;  1W2N A;  3AXD A;  1YEW A;  5FZK A;  2QE3 A;  5FK7 A;  5JMO A;  2LS6 A;  2LRO A;  2QQP A;  1KEX A;  4LBK A;  3KWV A;  4H3W A;  1RMU 2;  4QPG C;  5T5J A;  2WR9 A;  5G05 L;  2D44 A;  3HWJ A;  5J98 B;  1VBA 3;  3SLI A;  1OQ1 A;  1HRI 2;  3WUC A;  1TMF 1;  5DUW A;  4QX5 A;  1AR7 2;  4BM8 A;  3DKQ A;  1RXF A;  3ZYG A;  5FYT A;  4CPB D;  1MQT A;  2B42 B;  4E9K A;  1LU2 A;  2VOK A;  4I0W B;  4LKE A;  4UWD A;  4NAM A;  1V6M A;  2Q1M A;  2VNV A;  1VAM A;  4MVT A;  2XB6 C;  3UGF A;  3WHU A;  3ZFG C;  2FHR A;  1NE4 A;  5F6K A;  4DO0 A;  2RVA A;  3L2H A;  2WNO A;  4E4D X;  1W0O A;  4NIA A;  5AC9 3;  1JI6 A;  2FDF A;  2HWC 3;  1UW8 A;  1LOC A;  3PUI A;  2OPK A;  3O1U A;  4XDP A;  3LDR A;  1Y7B A;  1RUC 2;  1N1T A;  5LRR A;  5CA6 A;  1COV 2;  2PAK A;  4QKN A;  4EN7 B;  4GWJ A;  1TZO A;  5E1R A;  1U12 A;  2OQ6 A;  5EYX A;  3RI8 A;  5FO8 B;  3PLQ A;  3HNY M;  4KG0 A;  1MPX A;  2DVD A;  3OBZ A;  3N36 A;  2WWS A;  3ZVX A;  3VDA A;  2PHT A;  2YUE A;  2KM2 A;  4FT8 A;  1XB9 A;  5DZF A;  3UK9 A;  3HQU A;  2FCV A;  3U78 A;  1BJQ A;  1MR5 A;  4Y5Z 0;  5JZG C;  3SCH A;  2R0F A;  4A45 A;  2HWC 2;  2R04 2;  5APA A;  5GZF A;  2RS5 3;  2Z2S B;  3LQC A;  5A7W A;  3BPZ A;  3FHA A;  5E88 A;  2ZGQ A;  5A3N A;  1AR7 1;  4XF1 A;  2EXK A;  4JX0 A;  4O9G A;  5K0U A;  3VDB A;  2J1A A;  1MVE A;  2WNV B;  3R4U A;  4MXW B;  2UWA A;  4QMA A;  1FOD 2;  4OHX A;  2ZX2 A;  1TG7 A;  1Y4W A;  2JDZ A;  5K0U C;  2XXZ A;  4XUP A;  2XUE A;  5LK5 A;  1PZ9 A;  2QDR A;  3BOD A;  3OPZ A;  1HRI 3;  1SLC A;  2GAL A;  5T55 A;  3OEB A;  5J09 A;  4HZF A;  2J1R A;  3FLR A;  1ULF A;  3NVC A;  4KBZ A;  5CG9 A;  2QZ3 A;  2IVI B;  3KMH A;  3NNF A;  4LLF A;  4YW2 A;  1UYX A;  3J7L A;  3FX3 A;  2D3R A;  2XJQ A;  1CGP A;  3J7M A;  3WCS A;  4N9I A;  2PYT A;  4HKW A;  3OGR A;  1SZB A;  4IEY A;  2Q0A A;  5C7G A;  5HPO A;  3WNK A;  4Z82 A;  4YG0 A;  3ME2 A;  3AMH A;  2DVB A;  1F5F A;  2Y33 A;  2C9K A;  2UYA A;  4CP9 A;  1KJL A;  3WDY A;  2RS1 3;  1IKQ A;  4DY5 A;  1IPS A;  2ERF A;  1KFU L;  3GYD A;  3MPP G;  4YZ3 A;  2VZP A;  5FP9 A;  2HEW F;  4I09 A;  5FP8 A;  1NCQ C;  4LUM A;  5CIS A;  2QQW A;  4URA A;  1JYN A;  2DUQ A;  1JTZ X;  1BQP A;  4XUO A;  1OQE A;  1UOG A;  4BQ3 A;  1LHU A;  2WZ8 A;  2J1V A;  5FY0 A;  2ATF A;  3OJB A;  4XTM A;  4DXZ A;  3UET A;  4QPI C;  5J1X A;  1ULD A;  2HWE 3;  4WVZ A;  3DYO A;  3O1S A;  1ZRR A;  1AYN 2;  2Y8K A;  3ZXE A;  4FOW A;  2BJS A;  4Y26 A;  2VZT A;  4RHV 3;  1W6P A;  1QQP 3;  3AFK A;  2XLA A;  4RL7 A;  2R06 3;  4YVS B;  1VBE 2;  2DBI A;  2W0X A;  2P3J A;  3ZOI A;  4LBM A;  1FPN 3;  2WIN B;  4QB6 A;  3CKH A;  2WT0 A;  5FPZ A;  4YVS C;  1G9B A;  4ES9 A;  1KDM A;  3N4M A;  2WAB A;  5FIX A;  4YVS A;  3VBH A;  1OT5 A;  1VRB A;  1PX4 A;  2WRA A;  1CIW A;  4OQ9 A;  1UMI A;  4UFI A;  2WKK A;  3ZXJ A;  1Z7S 3;  2GH2 A;  2DDU A;  2HWF 2;  4CU8 A;  1WGP A;  3NNM A;  5CFC B;  5KXC A;  1XRU A;  1ZZB A;  4WM7 A;  5FMO S;  2K9Z A;  4YZ2 A;  1QNY A;  3K46 A;  3U07 A;  4YZ1 A;  1HQL A;  3MLK A;  3IDB B;  5FCC A;  5KWR A;  3R05 A;  3N9Q A;  4FTS A;  3WF0 A;  3CU7 A;  4RFT 0;  4B4P A;  1ZZ9 A;  3I3B A;  1C5I A;  2WZE A;  3P3N A;  4XZP A;  4IGO A;  4KL1 A;  1H2K A;  2NQY A;  4N7I A;  2VQT A;  3CDZ B;  3O0X A;  4KWU A;  4XHX A;  5FBZ A;  3GJA A;  4NRM A;  4UW4 A;  1OSG A;  1UY1 A;  3WQ1 A;  4UOJ A;  3RJ2 X;  5DG2 A;  2FCU A;  1AJO A;  1EAH 2;  1IS4 A;  5DDJ 3;  4QDS A;  3HN3 A;  3ZXL A;  2XQR A;  4Q1R A;  2BRT A;  1XQN A;  5C6C A;  2VUD A;  2UYB A;  1D4M 1;  1HLC A;  4BQ2 A;  1JYT A;  2JEN A;  5JIA A;  3RWN A;  3F2Z A;  3OG2 A;  4MG2 A;  4LIV A;  4NWV A;  2D6P A;  3K4D A;  1QJY 3;  2GND A;  4QX2 A;  3CLP A;  2I2S A;  2JKX A;  5C8W A;  3RZH A;  4JGY C;  5EXO A;  2HWF 1;  4PHZ A;  3LZZ A;  4AEK A;  1T6B X;  3VB9 A;  4AFC A;  3OBR A;  3VDC A;  4AEJ A;  1MVQ A;  1SCR A;  2YZ4 A;  1IZ3 A;  5GZG A;  1YJK A;  2Y0I A;  4L8Q A;  2WYS A;  1Q8O A;  2D6L X;  4Y3O A;  3T09 A;  1UYY A;  1JYI A;  2JB4 A;  3TNQ A;  2I74 A;  5F3G A;  1AUY A;  3QH7 A;  3N3H A;  3R6S A;  2FD8 A;  1LOA A;  3WP6 A;  2IZW A;  1RHI 3;  3GZE A;  3I3D A;  4C0B A;  3V56 A;  2W1W A;  5KC5 A;  3WIN E;  1UF2 C;  4QQO A;  4LPL A;  1X9T A;  1RIN A;  4Z8B A;  1AX2 A;  3VBR B;  3U37 A;  3GBG A;  4I0B A;  5FLH A;  1W6Q A;  2NZ9 A;  2C4X A;  1A6C A;  1LAJ A;  4O61 A;  2W52 A;  2XJV A;  4RQP A;  5C8C B;  3ZXG A;  2QVS B;  1JZ7 A;  3NJV A;  4P9W A;  3NAP A;  5F5A A;  1R1A 3;  2AZ5 A;  2UY8 A;  3MIB A;  1PM4 A;  1Q56 A;  3OGJ A;  1BEV 2;  1U5X A;  3K75 B;  4YM0 A;  2G9Z A;  1PM7 A;  3VKO A;  1S0G A;  1G7Y A;  4N43 B;  1US2 A;  4RGK A;  1XNK A;  1VAV A;  2FZ1 A;  1O3R A;  3ZPO A;  2BVV A;  3TYJ A;  1HW5 A;  3LA2 A;  2NPI A;  1N3Q A;  1OQD A;  2BYV E;  2YC4 A;  3KGL A;  5FY7 A;  4FTE A;  2EXH A;  1BMV 2;  1Z7S 2;  2HWF 3;  3UES A;  4CU6 A;  5JUV A;  2F4L A;  3LIH A;  4KG8 A;  4Q4W 2;  1OA3 A;  4JTO A;  1HRV 2;  4I3P A;  3NNJ A;  1S0F A;  4IL7 A;  1J84 A;  2WWJ A;  3MIE A;  4XVH A;  5FJH A;  3T4V A;  3OY8 A;  3J9S A;  3SXW A;  3GM8 A;  4BYY A;  4K20 A;  4A6O A;  5LBC A;  3WW2 A;  4ORF A;  2B9V A;  1SDD B;  2JWP A;  2NMO A;  4JRL A;  4N53 C;  1JBC A;  2CWS A;  2VMD A;  1H6X A;  2UUR A;  5FZD A;  4OLL A;  4P00 B;  5LK7 B;  1ULE A;  1W6M A;  2X5I B;  1J1L A;  4UBG A;  5FQ0 A;  5JPN B;  1TEI A;  4CP0 A;  1M06 G;  4B3N A;  3AJZ A;  3BPS A;  3Q8F A;  5EQU A;  1ENR A;  5IK7 A;  3ILN A;  3MFC A;  3AC0 A;  5A33 B;  5FZ7 A;  1LHW A;  1ZBA 2;  1GKB A;  4NRP A;  4ASM B;  2WZR 1;  1W6O A;  1GWM A;  5EPA A;  1ZZ7 A;  1UMZ A;  3OF1 A;  2LRP A;  3I54 A;  4COY A;  2VOX A;  3Q8E A;  2CHH A;  4GWI A;  2D3P A;  3IDA A;  1WLD A;  3KB5 A;  4Q4Y 2;  2GNM A;  5FLJ A;  4WBB A;  1NQD A;  5D8A A;  3S5A A;  4JVA A;  3NQH A;  4P08 A;  2PHF A;  1W05 A;  1FXZ A;  2GC2 A;  2X5I A;  2Q8O A;  3VBS C;  4XCB A;  5F7U A;  1WD4 A;  1HB1 A;  3I2H A;  1PGW 1;  4GJY A;  4CSW A;  2PLV 1;  5I0R A;  1DIW A;  4HG6 B;  1AJK A;  3HAG A;  5A3M A;  2DYC A;  5C9A B;  5IVB A;  2DF7 A;  3ILR A;  4M3C F;  3HR9 A;  5FBJ A;  2IXC A;  3PHM A;  4AGR A;  1POQ A;  3IM0 A;  2ZX3 A;  3H1Y A;  4XYX A;  5I0U A;  3ZDV A;  2VOT A;  2F6B A;  4UT5 A;  4NHY A;  3TEY A;  5F1R A;  2ZXQ A;  1UU4 A;  2VXR A;  1YFY A;  3ZXK A;  2JG8 B;  4GUL A;  4I02 A;  4CDW B;  1PO1 2;  1AYN 3;  5FQ0 B;  5B4N A;  3AX4 A;  4MET A;  4AWD A;  4BCU A;  4BK5 A;  4J6G A;  1DF0 A;  5FP7 A;  4CCE A;  4YVW B;  1RUI 3;  2CYF A;  3K2O A;  2WNE A;  3M7A A;  4DXT A;  5CEH A;  4R52 A;  2XH6 A;  4AVT A;  4N43 A;  1DZT A;  5FPL A;  2ZGM A;  2ADD A;  3PUH A;  3NV1 A;  4XF0 A;  4W6W A;  2B39 A;  1QOT A;  4CP1 A;  3ZN6 B;  5LBF A;  3S30 A;  1RED A;  1SAC A;  3W21 A;  5IAX A;  2PHL A;  4OZX A;  2XVL A;  4PT6 A;  5JCT A;  2BW8 A;  2RJL A;  3AKR A;  5TSW A;  1QIQ A;  5C71 A;  5FV3 A;  3SHR A;  2ZZQ A;  4MAD A;  2YHJ A;  2D93 A;  2IXJ A;  4JKM A;  1HJF A;  2WO2 A;  4EN8 B;  1OUS A;  4KWK A;  1V9U 3;  2B4K A;  2TBV A;  3JUU A;  4QPI A;  3I3M A;  3HIF A;  1LCL A;  4EZ4 A;  1IS6 A;  4DY3 A;  4KWL A;  1RGS A;  1SLT A;  3M3O A;  1MS8 A;  3AL6 A;  4JZR A;  1LGN A;  5ABJ A;  5LY2 A;  2HBU A;  4IEV A;  2XBO 3;  3NAP B;  5FKC A;  4DZG A;  2YY1 A;  4E4S A;  3O0W A;  2HLE A;  2FZ2 A;  4CUA A;  1N1S A;  3E1F 1;  3DV8 A;  5KHJ A;  2MEV 2;  4RYD A;  4NID A;  4GMP 0;  3I2K A;  4I0A A;  4O9E A;  1ONA A;  4O65 A;  5DQ0 A;  4N53 B;  1PO2 2;  2G9F A;  3KGZ A;  3C3V A;  1PZ8 A;  5FMO L;  4XIO A;  3INA A;  3WG2 A;  1HN1 A;  2EID A;  3VV1 A;  3GBW A;  2OS2 A;  4WVW A;  4EN9 B;  5JXJ A;  1XXN A;  2VMI A;  3JQW A;  4CDU A;  4P9Y A;  3FE5 A;  2R04 3;  1TVG A;  2YPD A;  2DUR A;  2WN2 A;  1S0E A;  1PK6 B;  2BER A;  2XHN A;  4ISQ A;  1KRI A;  1XYP A;  3MF9 A;  3GCX A;  4YW6 A;  3RZM A;  3S57 A;  2QQV A;  1W9T A;  2E7A A;  1Z78 A;  3HVD A;  1TNF A;  4A42 A;  2P1B A;  3NJZ A;  5IUQ A;  4XIL A;  4ZU5 A;  4I3G A;  1US3 A;  1DQ0 A;  1AX0 A;  3A23 A;  4FPC A;  2HWE 2;  2XUM A;  3MW4 A;  4P02 B;  4YGD A;  4FAG A;  3DPR C;  4MGQ A;  5GAL A;  1R64 A;  2R7E B;  1J3P A;  1AX1 A;  3SIT A;  2HWC 1;  5FR3 A;  1GZW A;  3DPR A;  1CAX B;  1S0I A;  3QAC A;  5AC9 2;  4FPJ A;  2K0G A;  4BQX A;  1E5I A;  5JR7 B;  4E2Q A;  5FPX A;  1E5H A;  3ACI A;  3JU9 A;  5F9T A;  3VBU A;  3AJY A;  1YQC A;  1SHW B;  2CDP A;  1F9K A;  1C8M 1;  1WW4 A;  2ORX A;  3N9N A;  1H2M A;  2RS1 2;  2NMN A;  4W4Z A;  5LY1 A;  4OUE A;  1LJ7 A;  2PQS A;  3H3Z A;  5T50 A;  4CXW A;  1W8W A;  2SLI A;  3J8F 1;  3LEG A;  4XET A;  4Y1X A;  3RYR A;  2O0O A;  2PXJ A;  4OUM A;  2YDE A;  4HN1 A;  4X8P A;  1I9R A;  4GAZ A;  4Y22 A;  5BNO C;  4LIU A;  1RMU 1;  5CAZ A;  2WO1 A;  2OUH A;  4CZS A;  4K8R B;  4AQT A;  3PVN A;  2ZGT A;  4CDX A;  3GZA A;  2YBK A;  1Q43 A;  1TME 1;  3KT4 A;  1ZBA 3;  4XFF A;  5FXW A;  5JLV A;  3WNN A;  2ZHL A;  1RUF 3;  2ARA A;  2WNU A;  3NL1 A;  1CAW B;  2VCC A;  4BQ1 A;  1LR5 A;  3A22 A;  4HK9 A;  3VD7 A;  5L9V A;  3DKW A;  1IS5 A;  1ND2 B;  1WCQ A;  3EQE A;  1S2B A;  4K8F A;  4AHX A;  2OX0 A;  5LBE A;  3H3L A;  2WT1 A;  1PIV 2;  3O0V A;  3N7M A;  5GZD A;  1F35 A;  1VRH 1;  1S4C A;  1IQA A;  1YIP A;  2ZKL A;  4GKY A;  4Y1U A;  3LD8 A;  2XL7 A;  4AI9 A;  2V4V A;  3E6B A;  4QT6 A;  3E6D A;  1HN0 A;  1EUT A;  1FMD 3;  1OC1 A;  1ALY A;  2AGS A;  4XXA A;  4AI3 A;  3T2P A;  1JZ8 A;  2HKX A;  1RC6 A;  1NA1 B;  2Q5T A;  1UZV A;  3GGL A;  1OLQ A;  5C4W A;  4URT A;  3UT0 A;  5IVE A;  2Y6H A;  3PMS A;  5KXB A;  2H6B A;  4LTA A;  4AG4 A;  2QNK A;  4LBO A;  4ATF A;  4ZON A;  2GC0 A;  3VHP A;  2J1S A;  4CDW C;  3NO8 A;  4CDU B;  3AZV A;  1NZC A;  4RR3 B;  4PIZ A;  3CQO A;  1LKN A;  2PHU A;  2Y6L A;  3ZFF A;  1R1A 1;  3PJQ A;  1NKG A;  2GNT A;  5F2S A;  1S2K A;  3JBG 2;  1NUK A;  3GF6 A;  2E32 A;  3KLS A;  3VDD A;  5JIU A;  2BBV A;  2WAO A;  4D94 A;  5BXX A;  2DU0 A;  4JKK A;  5FTT C;  2QKD A;  2E26 A;  2VMG A;  3V65 A;  3ACF A;  3ZXA C;  2DFB A;  1GZW B;  3WSO A;  2FDG A;  4XF3 A;  4UBH A;  4EJR A;  3CBN A;  1ZBE 2;  1Y9M A;  1RHI 1;  2UWC A;  4WZC A;  3VHN A;  1TME 3;  4Q2F A;  2F17 A;  5HBA A;  5KR7 A;  5A7W B;  4RHV 2;  2PEL A;  4Y5T A;  1WWY A;  1ZRD A;  4IDZ A;  4M4R A;  2EIE A;  1VLN A;  1ZZ6 A;  2IXH A;  4W65 A;  2RS3 1;  1ENS A;  2Q1F A;  4CU9 A;  4XQD A;  3V0B A;  2A71 A;  4LOS A;  2R1D A;  3VHO A;  3JD7 1;  3BTA A;  1PK6 A;  4M3C E;  1JZ6 A;  2Z79 A;  2JE9 A;  3E5Q A;  4PDW C;  3E5U A;  4AFM A;  4PIX A;  2VZ3 A;  1LHV A;  4LKD A;  5F5Q A;  3ORJ A;  4K7J A;  4GH4 C;  2HJI A;  2VO5 A;  4QQH A;  4CRQ A;  3I2D A;  1PMI A;  2P37 A;  2E53 A;  2B7Y A;  4QM9 A;  1OPO A;  3FFQ A;  5T54 A;  1W04 A;  4CDQ C;  4OQ8 A;  1W3V A;  1UOF A;  4HKO A;  3J4U H;  4EQV A;  3VBF B;  4D7S A;  2YMZ A;  5FMB A;  5FY8 A;  2OA2 A;  5JOW A;  3FLT A;  1NG0 A;  1BLZ A;  2WC2 A;  1GQH A;  3DF0 A;  3H0O A;  1NE6 A;  4HAN A;  3VDD B;  4LBQ D;  5FRA A;  1OXC A;  1HQN A;  3ZFE B;  1CAV A;  1RHI 2;  4YG3 A;  1GV9 A;  3N7L A;  2R30 A;  5F3C A;  1VBA 2;  2JDA A;  2R04 1;  1MEC 1;  1UOB A;  5EYY A;  5T3N A;  1SEF A;  3VZO A;  2A7A A;  2VG9 A;  4M0N A;  1QF3 A;  3ECQ A;  1H9P A;  1OOP C;  1QKQ A;  2IFR A;  1H9W A;  1NYW A;  1VMJ A;  4QWN A;  3RYP A;  3USU A;  1AF9 A;  3O7O A;  2BQP A;  3ZIX A;  2ARB A;  5B4X A;  1PO2 3;  2ZGU A;  1H8T B;  1QJZ A;  3BN6 A;  4JCK A;  5FXV A;  3MFA A;  1K5M B;  1CR7 A;  1CJP A;  3B7M A;  1V6O A;  1C5H A;  3GAL A;  2WN3 A;  5C3P A;  5JPM B;  3OBT A;  4DB5 A;  2Y6G A;  1VMF A;  3VKL A;  3OPT A;  2KA3 A;  1GWL A;  1SFN A;  4OI0 A;  1W8O A;  1XYO A;  3K77 A;  5FZH A;  3I7D A;  3N7K A;  1QJX 1;  1YUD A;  2ZTN A;  5I8T A;  1ODN A;  1NT0 A;  1AR8 3;  2XDV A;  4PQQ A;  1DBN A;  4FCA A;  1X50 A;  1D2Q A;  4JGZ B;  3RMY A;  1NAE A;  3D8C A;  4KU7 A;  4IEQ A;  3L2Y A;  4UW6 A;  2I45 A;  2DCK A;  3PDQ A;  5FYS A;  2QBX A;  1W2O A;  1Y3T A;  3FUO A;  3DL3 A;  4NR1 A;  4EWA A;  1MEC 2;  4AHY A;  4Z2A A;  2AEY A;  4OZO A;  1RUE 2;  1W6O B;  1A3K A;  3SEE A;  3MUY 1;  1U0A A;  4M01 A;  3WNL A;  4A44 A;  4BH9 A;  5HI0 A;  3U0Z A;  3AYA A;  5SV8 A;  1V6J A;  3LFM A;  2E33 A;  2PHD A;  2ZEW A;  4XBL A;  4CCJ A;  5JOZ A;  3POW A;  3SCG A;  4QPG A;  3HPN A;  5FRE A;  4QQL A;  2ARE A;  2HYK A;  1QJU 2;  3QH6 A; 
#chains in the Genus database with same CATH homology
 1UX7 A;  2VC9 A;  2Y8K A;  3VD4 A;  4XUT A;  2VZT A;  4QAW A;  1XNT A;  3LEI A;  4MO3 M;  1GOF A;  3CZJ A;  4QB6 A;  4D0Q A;  3CKH A;  1IQD C;  3ETP A;  2VL4 A;  1UXX X;  3BGA A;  5IFT A;  1BHG A;  2WAB A;  1K12 A;  1OT5 A;  1PX4 A;  1W99 A;  1F4A A;  1UMI A;  1XPW A;  3WNO A;  4CU8 A;  1L7Q A;  2DDU A;  3GDB A;  2V5D A;  4QX1 A;  2YFU A;  4RN5 A;  3I3E A;  4IUG A;  3MV0 1;  3K46 A;  4A3Z A;  1H6Y A;  2VQU A;  2W1U A;  3WF0 A;  1PX3 A;  3WQB A;  1K42 A;  3MBW A;  3I3B A;  2WZE A;  2W94 A;  1JYW A;  2VQT A;  3CDZ B;  1ULP A;  4KWU A;  1UY1 A;  1JU3 A;  4UOJ A;  3ZM8 A;  2WO3 A;  3HN3 A;  3GXU A;  4QDS A;  4ZZ5 A;  5IFP A;  3WF4 A;  3F2Z A;  3MV1 1;  3OG2 A;  3K4D A;  3HNB M;  4QX2 A;  2DCJ A;  2JKX A;  4ARY A;  2EIC A;  3HEI A;  3OBA A;  3EYP A;  4QDR A;  3VDC A;  2WYS A;  3T09 A;  1UYY A;  1PMJ X;  1L7R A;  1YQ2 A;  3I3D A;  2JD9 A;  3OGS A;  2W1W A;  3I2I A;  2W91 A;  4LPL A;  3U37 A;  5LA1 A;  3ACG A;  2C4X A;  2BZD A;  1JZ7 A;  3NJV A;  4DEQ A;  2X10 A;  3I2F A;  3K75 B;  1UZ0 A;  1US2 A;  2ZEY A;  5LA0 A;  3MO4 A;  2L9L A;  3C8X A;  4UAP A;  1JZ4 A;  2QQK A;  3P1I A;  3NRU A;  2VCA A;  2YC4 A;  2W1Q A;  1OD3 A;  4CU6 A;  5EJ1 B;  5JUV A;  1F4H A;  2X05 A;  4MGS A;  1I5P A;  3JXS A;  5IHR A;  4XVH A;  1J84 A;  3SKJ E;  3GM8 A;  4A6O A;  3OGV A;  1KGY A;  1UXZ A;  2B9V A;  2Y6K A;  1SDD B;  2W95 A;  4XUQ A;  2VMD A;  1H6X A;  3FL7 A;  4P00 B;  3T0A A;  3VD5 A;  4XUN A;  1W9W A;  3WF2 A;  3CMG A;  5HXM A;  2QQJ A;  3AC0 A;  1NX9 A;  1XNA A;  1W0N A;  2E31 A;  4ZY9 A;  2J1U A;  2VJX A;  2VM9 A;  4GWI A;  4M4P A;  3DYP A;  3IDA A;  2W46 A;  1CZV A;  3OEA A;  3NQH A;  2ZEZ A;  4P08 A;  2JE8 A;  3LE0 A;  1PMH X;  5F7U A;  2ZEX A;  3I2H A;  1OF4 A;  4BJ0 A;  3A7Q A;  4HG6 B;  3WNM A;  4QB2 A;  3D3A A;  4XZU G;  2V72 A;  2W47 A;  2XQX A;  2VOT A;  4DXS A;  2WUH A;  2XON A;  3T08 A;  2ZXQ A;  3CIH A;  3NJX A;  3VD9 A;  3IB3 A;  5B4N A;  2VZ1 A;  1JYV A;  4BK5 A;  3DYM A;  4DXT A;  5EIY B;  4CUB A;  2W87 A;  2VZS A;  4PF1 A;  4TTG A;  3PUH A;  4LQR A;  2XOM A;  1JZ5 A;  2VTF A;  4PT6 A;  5C71 A;  1JZ3 A;  4MAD A;  4JKM A;  2QQO A;  2WO2 A;  4OMC A;  2B4K A;  3T0B A;  4JKL A;  4CVU A;  4TXW A;  2YB7 A;  3CZU A;  2BGO A;  4KMQ A;  3C7O A;  3T2Q A;  1GQP A;  3K4Z A;  2HLE A;  3HNM A;  3VD3 A;  2X09 A;  4CUA A;  3E1F 1;  2WAA A;  2Y6J A;  4RYD A;  2ORZ A;  3I2K A;  4ZXE A;  5DQ0 A;  5FUI A;  1O8S A;  1JU4 A;  3WF1 A;  3OB8 A;  1HN1 A;  2J1T A;  2EID A;  2W5F A;  5JXJ A;  2LW8 A;  2BGP A;  1UYZ A;  2KD7 A;  1TVG A;  4W8J A;  2WN2 A;  3C7G A;  5CZK A;  2BER A;  2XHN A;  3UNP A;  3THC A;  1JHJ A;  3J7H A;  1W9T A;  1J83 A;  1JYX A;  4A42 A;  4BK4 A;  4QX3 A;  5IYY A;  1US3 A;  3A23 A;  2ID4 A;  4P02 B;  4JHZ A;  4MGQ A;  4DUW A;  3FHQ A;  1R64 A;  2VR4 A;  4QB1 A;  2R7E B;  4BDV B;  4DUV A;  1CZT A;  3I2J A;  3W5N A;  1O59 A;  1K3I A;  3ACI A;  3C7E A;  4CU7 A;  2C26 A;  1DP0 A;  3A21 A;  4BXS V;  1GU3 A;  1SHW B;  2CDP A;  2J7M A;  2ORX A;  4DEV A;  2Z4F A;  4W4Z A;  4MOA A;  1O8P A;  4OUE A;  2PQS A;  5EJZ B;  1OF3 A;  4A4A A;  1W9S A;  3LEG A;  2YFZ A;  1WKY A;  1W8N A;  5DMY A;  2W3J A;  1ULO A;  2VZU A;  2WO1 A;  3I97 A;  4E8D A;  3WF3 A;  3ACH A;  5I0D A;  2J22 A;  5A1A A;  3LPG A;  2EIB A;  1CIY A;  3LEK A;  3DEC A;  5CYY A;  3WNN A;  2RJ2 A;  4L0P A;  4A41 A;  5JR2 A;  2QQN A;  2VCC A;  5JXH A;  4P5Y A;  3A22 A;  3VD7 A;  2RV9 A;  1WCQ A;  3EB7 A;  1GOG A;  1XC6 A;  2J1E A;  1UWW A;  4CUC A;  3SKV A;  2VMC A;  2VZV A;  2Y64 A;  4AAX A;  4DUX A;  3WNP A;  1D7P M;  2V4V A;  3T0D A;  2VME A;  1EUT A;  3THD A;  3T2P A;  1JZ8 A;  4QPW A;  4YPJ A;  2W1S A;  3GGL A;  1GMM A;  3ABZ A;  4KI5 M;  2Y6H A;  1JZ2 A;  4AG4 A;  4D8M A;  5LCW L;  1GUI A;  2J1S A;  1UMH A;  3CQO A;  2Y6L A;  5IJR A;  4ZZ8 A;  3P6B A;  1NKG A;  3C7F A;  1NUK A;  2VMF A;  3UES A;  2E32 A;  4ARX A;  3SEP A;  2YC2 A;  2WAO A;  2HYX A;  1GNY A;  4JKK A;  2E26 A;  3MUZ 1;  3ACF A;  4FI9 A;  3WSO A;  5JMO A;  2LS6 A;  3T2O A;  1KEX A;  1UY4 A;  4ET7 A;  3IAP A;  4DXR A;  2YG0 A;  2CDO A;  5G05 L;  4E8C A;  4QX0 A;  4M4R A;  2EIE A;  3I2G A;  4LKS A;  3HJR A;  4CU9 A;  4OMD A;  1JZ6 A;  3LPF A;  2VZ3 A;  5LA2 A;  1LNS A;  2VO5 A;  2RVA A;  2VZO A;  1JI6 A;  3PUI A;  2OKX A;  2WDB A;  2QQM A;  2WBK A;  2W9X A;  4GWJ A;  3HNY M;  1MPX A;  3VDA A;  4GZ9 A;  3C7H A;  5JXG A;  2JDA A;  4A45 A;  4LHS A;  3LQC A;  5JXI A;  4W50 A;  3FHA A;  4XUR A;  3ECQ A;  2QQI A;  4UI9 L;  1K45 A;  4JX0 A;  3VDB A;  2J1A A;  5B4X A;  1RYY A;  1SG3 A;  2QQL A;  1TG7 A;  3BN6 A;  1EUU A;  3IAQ A;  1DYO A;  3FN9 A;  4XUP A;  2WN3 A;  5C70 A;  3OEB A;  3HOB A;  1CX1 A;  2Y6G A;  2J1R A;  2VZR A;  1P8J A;  1UYX A;  1W8O A;  3K77 A;  1UY2 A;  3OGR A;  5DN2 A;  4PQQ A;  1CZS A;  3K4A A;  5G04 L;  5C7G A;  1NAE A;  2VCB A;  5HPO A;  3WNK A;  1UY3 A;  2DCK A;  2C9K A;  3W5M A;  2QBX A;  1GOH A;  1UY0 A;  2VZP A;  2BBA A;  2VZQ A;  4Z2A A;  4OZO A;  4OYU A;  3III A;  3SEE A;  2W92 A;  3MUY 1;  3WNL A;  4A44 A;  1JYN A;  4XUO A;  3WEZ A;  1OH4 A;  2E33 A;  2WZ8 A;  2J1V A;  2ZEW A;  1T2X A;  1DLC A;  3UET A;  5J1X A;  3HPN A;  3NNG A;  5DPN A;  3DYO A;  4QDQ A;  2WQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...