4UFMA

Mouse galactocerebrosidase complexed with 1-deoxy-galacto-nojirimycin dgj
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
644
structure length
640
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 207
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ufmA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ufmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ufmA01
1OYAA 3U8GA 1PVNA 1TIMA 5TBOA 2YL5A 2VXNA 1NOUA 3O6AA 4TTUA 2E9LA 2Y85A 3L4YA 5CPTA 3TA6A 1IXQA 1FX6A 1V7YA 2V5BA 3BW3A 2ZWZA 2YXGA 5HR7A 1K8XA 3DZ1A 5CZKA 3VE9A 3AIBA 1I45A 3VDBA 1HKIA 4AIUA 2WSPA 3PTKA 5HNNA 4GXPA 3W70A 3STGA 1K3UA 5A2AA 4XX6A 1PE1A 1O5XA 3GIYA 3ZM8A 3GLCA 4IPLA 3ZO9A 4LUJA 2OZ0A 4LRSA 2X1SA 3L4UA 2WZHA 3SIMA 1PHQA 4O1AA 5BXSA 1HL8A 1VLWA 4JTGA 3ABQA 4AMAA 3M5ZA 1XC4A 3UGHA 3DFQA 3MI6A 2A3BA 1HTIA 3G1XA 3M5XA 1DBTA 3WBAA 5K9DA 2VQTA 2OSYA 4Z2JA 1GOXA 2CLOA 4JXCA 4HNUA 5A6JA 3F4NA 5I0DA 1X6UA 5KITA 4UIOA 1FBAA 3T2OA 2HTMA 5HJLA 2IUZA 5HULA 2C0AA 3ARXA 5AY7A 1R2TA 4RLIA 1B4KA 1S5WA 3EXRA 4AF0A 3L65A 2NUWA 4H4IA 5DBUA 4IMFA 1TYGA 1M7OA 3NM3A 2PRMA 5F2IA 1ISWA 1E6PA 1ZCOA 3LLDA 1G67A 4E8DA 3NQ6A 2WC7A 3MO7A 3HGSA 4GI6A 1VEMA 1U5JA 1W3HA 2OSWA 3ZT7A 5LNVA 2DT0A 3BVJA 1VB9A 3O05A 3TROA 4O10A 4W93A 3WELA 1OX4A 1XCXA 2CHOA 3B9AA 3WMBA 4K7YA 1KQYA 4A3YA 1F4AA 2PBOA 4IPJA 1PX4A 5G1TA 3FIGA 3RU6A 4AHOA 1QI0A 5FL1A 3PVFA 4AISA 1E72M 1HJWA 3MYPA 4ZQCA 3AYSA 5BRBA 2WNWA 4Z1CA 2CITA 3WIJA 4FFFA 1CXFA 3FJ6A 4JKMA 4O54A 3BMWA 3UCQA 4OUEA 3II1A 6TIMA 4ZQNA 1OM0A 3IVTA 4N4PA 1PEZA 3SCRA 2YCEA 3P81A 5FEXA 3TX9A 4GQQA 4M82A 1WBHA 4XZBA 2VFIA 2CLMA 2ZX6A 3QMRA 3UESA 1XXXA 5DF0A 1OCQA 3W7EA 4X9SA 1ZHAA 1R47A 4DPQA 3SCWA 4P8XA 1GOWA 4FXSA 4IX2A 4I7UA 1EOMA 5D32A 1LROA 3TFCA 2A7NA 1VFMA 2QMJA 1V0MA 4O17A 3ZR6A 2V0TA 2FDMA 7CGTA 2A21A 4K36A 4PEKA 1XKYA 3PZIA 1XI3A 8CGTA 1AMKA 4GBUA 2CU0A 1DWHM 3LMYA 4QP0A 4ZFMA 3W22A 2WBGA 3MV01 3HG2A 1LBLA 4JTKA 4WQ6A 4DWSD 2VEPA 3CHEA 4W7UA 1UD4A 3KVKA 1I1XA 3KAOA 5LA1A 1JQVA 3G3DA 4S2CA 3AHXA 1W37A 3W81A 2VZTA 3TTSA 4MFDA 2X0HA 4JTEA 1JGIA 4QHZA 2VUYA 1J11A 3YPIA 1VFFA 1ZJAA 5EBAA 4DO6A 4UTUA 3W25A 1CGTA 1W3IA 4I7WA 2A3CA 2QHAA 4FMVA 2UY2A 3AMGA 4TVDA 4ACYA 2EXOA 1SQ7A 5LYRA 2BY1A 2XFWA 3AI0A 5HPOA 2FQIA 3P62A 3SGUA 4E38A 4FLRA 4R5EA 1OX6A 4NQ1A 4EOUA 3PB0A 2DH3A 1K8YA 3BV4A 2QAPA 1C92A 1EH9A 3GXMA 1KFCA 3GZ3A 3CUIA 1TE1A 3W76A 5D8WA 2W61A 1LZOA 1UYPA 3LCGA 4LW7A 4R7JA 2WVVA 2J24A 3W1PA 2YFOA 2CLKA 1XH1A 3M6YA 3NR0A 3PUDA 3VM7A 3M43A 3NQAA 3CTTA 3WH5A 4K38A 3DENA 4MB1A 4Z2HA 5JBDA 1H3GA 3OIHA 3G8RA 5D4YA 3UEQA 3PF3A 4C7DA 2VC6A 1G4TA 1ODUA 4M24A 4AD5A 3RLUA 3GKAA 2A85A 4DO5A 1GVSA 2PWHA 3FY1A 3USBA 1OABA 1FUYA 3AHTA 1YXCA 2B0MA 1PIFA 4LV9A 3VGFA 3C4UA 2YFNA 2PWFA 5M5DA 1GTHA 3BLEA 1UD2A 4Q4KA 1RD5A 1ICPA 1HL9A 4L4MA 4X3ZA 2G4FA 5ANNA 2D20A 4MNMA 4CD7A 2V5CA 4ZL1A 1E0WA 4IGHA 3RM4A 2YW3A 2W62A 2B7QA 4TR9A 2O7QA 1I2RA 2WNNA 7TAAA 3W37A 2J88A 2V9DA 3OBKA 3IVSA 3M07A 1GQNA 1FHDA 4ACZB 5FKBA 2V5DA 2ATSA 2E77A 5FF2A 3OZOA 1ADOA 1LLZA 4Y7EA 3KVLA 1H7XA 4O53A 2J7EA 4CNOA 3BAIA 3CU2A 5HINA 1KWGA 9CGTA 1KFEA 2XM2A 4CU8A 2KZHA 3QHOA 3JR2A 4WOZA 4N9DA 1WP6A 2VX4A 3NYDA 1BG9A 3EDDA 1Y4WA 3RM8A 5D09A 1W9DM 2ZUSA 4ML9A 2B7OA 3L68A 1ODZA 1I1WA 2CIPA 5LKYA 5CGTA 3VGHA 4CQ9A 4NU7A 2JKAA 3W7HA 3G22A 1BVZA 5D9MA 1E6NA 2VEMA 2Z2UA 3CQ0A 4IMCA 4NJKA 3TKFA 2BNJA 5ABGA 1CENA 4UMBA 5A6BD 1WDSA 4LRTA 5FF7A 4MB3A 4ZEPA 4JFWA 3ZWTA 3V1PA 4NRSA 3BAYA 5CKSA 3NQEA 4AH7A 4JKLA 1WV2A 4NNBA 3NJ3A 4N42A 3OGVA 4N4QA 1DEDA 1AL7A 2J62A 2YJQA 2V8ZA 1ZBCA 4W7WA 1JJKA 3ARUA 1NARA 2RDUA 2YLLA 3W7RA 1M5WA 1XL9A 4UR9A 4JKKA 1NM9A 4MZ1A 1TPFA 2WWCA 3EX3A 3GKFA 1OIMA 3W6MA 2V3DA 3MHFA 3CZJA 3W7PA 4AZBA 1EPXA 3TIMA 3SUVA 5F1UA 3S5ZA 5EY5A 1B3XA 3GXIA 4W87A 1JCYA 1LP6A 4Y6GA 4EE9A 3WQ8A 2BVYA 3T78A 1UWTA 1HF6A 3OBAA 2Y7FA 5D38A 3OG2A 2QEZA 3GB6A 1VFOA 2W0UA 3GNRA 3SUWA 3N14A 2J78A 2J74A 3NSMA 1I2OA 4BK9A 4O18A 4AVFA 3S1UA 1J0HA 1ZBKA 5FI8A 3STEA 8TIMA 2VURA 4UQBA 3H53A 3W2UA 4IOTA 1R85A 2CBVA 3WN6A 2A6NA 2YDAA 3EEGA 3LHVA 4A3UA 3DKLA 1K6AA 4RE4A 1UB3A 1PX8A 3UR7A 3ZT6A 5CZTA 3TP4A 3IK2A 5A95A 3B0UX 4AZCA 2X1RA 3MMWA 3EXSA 1ZU8A 3W1UA 4KMQA 3MP3A 4Y9AA 1LOSA 2ZIDA 4PN2A 1H4PA 5C2XA 3EWZA 3HQ1A 3SI9A 4AIEA 2FPYA 4JX5A 4V2XA 3P80A 3T7VA 3M9YA 2WKGA 4WK9A 3W0KA 5CLTA 4UQEA 4UMAA 1H1YA 5FF0A 2UWFA 2OJPA 2WBKA 2OCZA 3W7CA 1VCFA 5E9AA 3TFXA 3MW7A 3HGJA 1H62A 1TRIA 4C7FA 5GVJA 1F2JA 5C6MA 1EDGA 1W3KA 1JZ6A 3W1RA 2G97A 3O1NA 1TFVA 3RM9A 1E5JA 1Q6LA 3U5YA 4KKXA 1JNDA 2BVDA 3IMMA 2Y6ZA 3L0GA 4LC8A 3RF9A 1R46A 5IHSA 1HJVA 1X1NA 3A6OA 2G3IA 4CD6A 3CWOX 3W3OA 3OLGA 1JZ2A 1H11A 3CLWA 1US2A 4H7VA 5E0FA 4AHPA 3IV3A 5C54A 4PMOA 3PBUA 4RV8A 3DI0A 1UKOA 5I3IA 3QR3A 2GDUA 1XM3A 1DQWA 3PB2A 4OHQA 2Y62A 1XSJA 5T26A 3T2PA 3AFBA 5LA2A 2P1FA 3ZOAA 2ZA1A 2VVNA 2X16A 2JIEA 4N2YA 1EWDA 2CWNA 3MMTA 3NEVA 4PTXA 4ATLA 2QQVA 2ZZ6A 3SUTA 3WUBA 2XGIA 4UTWC 4J3UA 1W1YA 2E9BA 2E6DA 1Y0EA 3P74A 2NX1A 3FAXA 2CFFA 3UWWA 1GOIA 1VENA 2EPKX 1ZAJA 1W5QA 2J4GA 3J7HA 2NV1A 4QQ3A 3OLIA 2WHMA 3WD4A 2CBIA 2WHJA 1UKTA 2WCAA 1XYFA 4NVTA 2BY2A 3E1F1 4GUHA 4UQDA 3BAJA 3L0KA 4HPXA 4ADTA 1XH0A 4JIQA 3BH4A 2W92A 1FCVA 5C71A 1BVNP 1UQZA 1DOSA 2EQDA 1QNOA 4KFOA 3WDIA 4LT9A 4Q7NA 4W86A 3PULA 4QNEA 1BHGA 1W1VA 2GK1A 1HIZA 3N04A 2QQWA 3ARWA 2ZA3A 3VKJA 3HBKA 1SSGA 1UKQA 4AC1X 1XGZA 2BFGA 3GZAA 3MKKA 2PE4A 2RH9A 2WLYA 2DQXA 2WSRA 2Z6JA 1EEPA 2VR4A 4E8CA 1QW8A 2QCHA 4O15A 4QISA 5DCDA 4ORIA 4JTJA 1CGYA 1XUUA 3APGA 4Q22A 3ZIZA 4UR7A 1E4MM 4F79A 2QJGA 2JE8A 3AMCA 4ATWA 2C3ZA 1CNVA 1FOBA 2RGLA 2E68A 1GOKA 1OK6A 1D3CA 1MYRA 2DSVA 4U33A 3VM5A 4NT0A 2HSAA 4RE3A 3QQ0A 5FEPA 3I3EA 5L9FA 1K9EA 5H2ZA 3WFZA 3O6CA 2ZWYA 4EK7A 1TQXA 3KF5A 4CCDA 3F5LA 3WJSA 2Y7EA 4AHQA 1LL6A 2UY3A 3WFAA 2ZICA 3K8MA 1TTIA 2BWGA 4P7NA 1H2JA 1Q6FA 1TPB1 3M1ZA 5F1VA 2ZZ5A 2WMGA 1FWWA 3EWBX 5BWFA 1GTEA 3KHJA 4UTWA 5F4XA 1HKMA 4PMVA 1HJSA 3M46A 1KQZA 3KOFA 3PTMA 1EDQA 2Y8VA 2VMFA 2HS6A 4UCFA 1AMYA 1R2SA 3NYZA 1K02A 2YYTA 1DWGM 2EKCA 3W7GA 5I3GA 1IF2A 1JDCA 2EJ1A 3G6LA 4LX4A 1SMDA 2JFEX 2YDSA 2V3FA 2ISVA 3QH2A 3S6TA 2NX3A 4B9YA 4O4VA 2DT3A 5BNKA 2QF8A 3Q58A 4MY1A 4YLWA 5CPMA 3EXTA 4WIWA 4DF1A 4MNJA 3WDHA 1NWSA 1BYDA 4HIBA 3WK3A 4MUZA 4MPQA 1RV8A 3DFPA 1KTCA 1DV7A 1QPRA 2YDRA 3KRZA 2XVGA 1WZKA 2E0PA 4ZQRA 5CSUA 1JG9A 4MOZA 2FH6A 1L8NA 3CHCA 1QI5A 4MLJA 4EWND 2CEQA 5JIWA 1KFBA 2CYGA 3ZR5A 1FH9A 5FOOA 3BCDA 2YGYA 5F2LA 2DEPA 1O4UA 3N3MA 1PCWA 3QW3A 4RZ4A 2NXHA 4MZYA 3PBVA 5CSSA 5DY3A 2XIBA 4DM2A 3S5NA 2WANA 3MWAA 5CXPA 3B03A 4CUCA 1OYCA 1QBBA 1GORA 2ADDA 2CETA 2G8ZA 4EVZA 5G4EA 3ARYA 2RDWA 1ZENA 4GNJA 4KWVA 1O6IA 1FQ0A 3NSNA 3GDMA 3PC0A 1L6WA 4XB3A 3VMNA 1V3HA 4EF9A 1FHLA 1AW2A 2WPBA 5CZSA 5CG7A 4MDOA 2IXUA 1W3LA 4JN6A 1IXNA 1GZJA 1UD5A 4HA3A 3QEZA 1XUZA 1HVQA 2JEQA 3PR2A 3T44A 3HF3A 1H50A 3PUEA 4DELA 3I7QA 2W66A 2VTFA 4X0VA 3TTQA 4IJBA 4H2CA 3C3NA 1BSIA 1VEPA 4FO4A 4HOXA 1E73M 3AXHA 3EYPA 4WXZA 4LQ1A 4CQ8A 2DSUA 2DZUA 2QKFA 4LVGA 1VIWA 3ARSA 5I77A 3UY7A 3THQA 4A22A 1QBAA 3VILA 1GWJA 1CX9A 4PMXA 1HP5A 2EBNA 4UCGA 5KZDA 1JIBA 1O60A 4GUFA 2YSWA 1MSSA 3K46A 2H3DA 3LDVA 5DCBA 1GOMA 4D2JA 3PUOA 1QOXA 4JTSA 3MSGA 4JCMA 2QCEA 4D6IA 4K68A 5DT7A 4TX6A 2QCLA 3TSDA 4HNVA 3MHUA 1YDVA 4XKYB 1E4LA 1GW1A 1C91A 3VIKA 2ZRUA 3MO4A 2EHHA 4D6EA 3QPZA 2WMJA 1LRTA 2XVPA 1GVFA 1NP2A 3WDQA 2PURA 1CBGA 4CN1A 3SUUA 3GDRA 1X6LA 1W9XA 1YTDA 3HMJG 1TSIA 2DSWA 5I3FA 4FIRA 1E6RA 1UHVA 1E4NA 5ABFB 1UR4A 2J77A 4P61A 3AS1A 3CPUA 2WPGA 1VHNA 3M16A 3Q94A 3T0AA 1A3HA 4XBKA 5AC8A 2Q3OA 1K9DA 2DSZA 5FIPA 1B31A 3NSXA 3LRMA 3Q2DA 3KL3A 1EUAA 5DLCA 1KXVA 2I1OA 4YCPA 1JCXA 1G1YA 2E3ZA 3BLPX 2XVKA 1VCGA 2ESCA 2XGBA 3QF0A 3ZJKA 1SW7A 5DCEA 3WNNA 1TRDA 3L9CA 1N55A 1OX5A 3W7IA 2ZZ7A 1F6PA 1FXQA 4PTMA 3TMQA 4J3SA 3AHZA 2VENA 3CZGA 4W89A 4JR5A 4CN6A 5EKYA 5FL0A 1JZ4A 3T0BA 4AXNA 1G7UA 3AZSA 3VOCA 1JXJA 3PM6A 3C2EA 3VGBA 5G1YA 3FYOA 2ZRVA 4GXMA 3JRKA 1KFJA 3L5AA 3W7KA 1Y9MA 4HZ7A 4O52A 5KZMA 4MJ4A 1YQ2A 3ZJ8A 5D2WA 3MUY1 1TPDA 4JICA 1X7FA 3W7OA 3PZNA 3JUGA 1EXPA 1JYNA 1CZ1A 1OGGA 1I2QA 4FX8A 3DFNA 2G3JA 4UFMA 3W6LA 4S1FA 1LL4A 2AMGA 1H09A 1OFEA 1BPLB 1KM4A 4BI7A 2WLZA 1O7AA 3A3HA 4Z1BA 1W9PA 3W7DA 4XUYA 3SCPA 2OYMA 3TOPA 3W7NA 3HPXA 3SUSA 4B3KA 5IXEA 3NPVA 3K30A 4JD4A 5FKYA 1EP2A 1EIXA 3LIGA 2PWEA 4M56A 5LA0A 3L21A 4FFHA 2WVUA 2EPNA 4MJ2A 1T99A 4QDMA 3TC7A 5A6KA 4U31A 2GJXB 4LGXA 3O07A 2VX7A 5A8GA 4FLSA 5BROA 1FDZA 4RK8A 4PODA 1J5TA 4KWUA 2IXVA 2CCRA 3LDKA 1IGSA 1TO3A 1E6QM 1V3IA 4MADA 4NI3A 1C8XA 1UG6A 2Y4SA 3FHQA 5IBXC 1A5CA 1I75A 5FEZA 3GK0A 1B3OA 3GBDA 4BF9A 1W2PA 4NXSA 3WK2A 2H8ZA 1J0ZA 3L0NA 4HU0A 1NH6A 2JKPA 4AWUA 5F2GA 4QLKA 1UJPA 1F5ZA 1WCGA 3CHFA 3SCQA 1NQ6A 3G1VA 4JTIA 2O9OA 4LXFA 3W4RA 4Z0SA 4NX0A 2V38A 4O4WA 4HPJA 3QZEA 4PTNA 3TTOA 1SZEA 4BQ3A 5FMDA 3MS8A 5GNZA 4JIEA 2I9EA 4CN4A 1PV8A 5BXTA 4UTJA 5FIXA 5HMSA 2E4TA 1SFLA 3O63A 4O50A 4PMZA 3PBWA 1ICQA 5IM51 4RCXA 4KFNA 4QCFA 5D9PA 4O0ZA 3WJXA 3GNNA 1ITXA 2WXDM 2RFGA 5AHLA 2JIWA 3TQKA 1W1TA 2C7FA 1Q6EA 1PX3A 3VD4A 2DZSA 3VDCA 3HJZA 4UFLA 3W07A 4IMGA 3W88A 3VO0A 3CGTA 4WD0A 4MB5A 3I65A 2A0NA 2CERA 3LERA 2TAAA 2DJLA 2PWGA 1OFQA 4KRUA 4XV0A 4B15A 2G95A 3LV5A 3VMOA 1KFKA 4WUIA 5D8ZA 1H7RA 3WF0A 1VEOA 4C1LA 1JD9A 1V3MA 2WSYA 1Z32X 1E6ZA 3B06A 2AEZA 1MEWA 1UYQA 3G1HA 3VCRA 3INPA 5A8PA 4CLMA 1BLIA 4AMCA 1H7OA 1P1XA 2C18A 3F03K 4NF7A 2R14A 3NQFA 3W9ZA 1KCLA 3E9AA 3S42A 2TYSA 5IBXA 1SUXA 3WK0A 3AIUA 1JQXA 4LVDA 3VX0A 3POCA 5CG0A 4UTTC 1G01A 4CKQA 2OMAA 3F5JA 1OFDA 3QHNA 2J9XA 3D0CA 3GM8A 3CT7A 4P7RA 5IFPA 1NF7A 4TTGA 1JYVA 4UNKA 2ZCGA 5FMCA 1UH4A 2VOMA 5I24A 2JGQA 4QLLA 1LWHA 5CPLA 1TA3A 3T0DA 3LTPA 3FNDA 4PL2A 2FLIA 4AF0B 2GDVA 1S5VA 3VGEA 3IAQA 3WQWA 5CGMA 1LF1A 4IXHA 4N6FA 1VF8A 3I7SA 2QR6A 4D1IA 2J9YA 2GPTA 4IX0A 1SSDA 5M03A 3R12A 3S9YA 1ZALA 2X0YA 1V6WA 5E0KA 1JL8A 4FLQA 4XUGA 5AYZA 1E40A 2Z1KA 4D6DA 4PYSA 1OX4B 1YDNA 4M6PA 2CPUA 3GVGA 5DXXA 3W1MA 3L4WA 5LGXA 4U2ZA 4LS0A 4WKHA 1J0JA 4DM1A 4R34A 3WDPP 1JNEA 4PSRA 2PF0A 2XSBA 3HO8A 3MP5A 3A23A 4HT3A 2DZPA 3NZ1A 4JTFA 5D05A 5I3HA 1D9EA 1B2YA 1OINA 2VCBA 3CIVA 4GPNA 3AJXA 1OSEA 1KBJA 1MXSA 2XN2A 3U1XA 1QWGA 3N34A 4A29A 1R7OA 1WO2A 1E5NA 1WAWA 2W67A 3PZGA 4UTLA 1EP3A 1JR1A 4FIQA 1ISZA 1EWEA 3GDLA 3F5KA 4P8UA 4EANA 3NMBA 3PG8A 4U3CA 4JY9A 4GO9A 1BYBA 2J8FA 1VAHA 2X05A 1QO2A 3W2JA 2DSKA 4JGDA 3TXVA 4GRSA 1E56A 3W6YA 1E1EA 2GVGA 1C9DA 2BHZA 4LS2A 4A21A 4UTTA 3EX1A 4DF0A 1XRVA 3RCNA 5E1QA 2D0GA 1UWIA 4N9CA 3NL2A 2Q3RA 2OSXA 3AMDA 3NGJA 4OOUA 4D6JA 3LI1A 2WZEA 3VIJA 3I7RA 4DUXA 1VBRA 2IQTA 3W7LA 3IEBA 3LM7A 1JDDA 2J7GA 1YYAA 1PCKA 1GQIA 3FOKA 3WJWA 3BW2A 3LOTA 3N2MA 2XWDA 4NRRA 3SCNA 2V2CA 1AK5A 1FP8A 4WY0F 4TX9A 5JBEA 1HKJA 3M6DA 5AC5A 3GR8A 1EO5A 3NDZA 1OT2A 3W24A 1LM1A 2WW5A 2J27A 4Z2IA 3CUFA 3PHAA 5FK7A 4QNWA 1OJXA 3AJ7A 3WH6A 4OU1A 1VRXA 2ZQ0A 3A4AA 4D72A 3LPOA 4JHOA 5AC4A 1XBVA 4AWSA 3PTQA 4UTHA 4Z1DA 3QJAA 4M80A 2FPTA 3LFIA 4CNPA 3TMLA 1P0KA 5FF3A 1N82A 5GQBA 1TPH1 4O16A 3BSGA 4S3JA 3KE0A 3FN9A 4JFUA 3RNDA 1V02E 1AQ0A 4H8HA 1PS9A 2Z1BA 4FF7A 3WF4A 4GI9A 4IPNB 5A6SA 3B4UA 1HFBA 1DL3A 1H1NA 1CLXA 1ISVA 1ME9A 4CCEA 1RVGA 1H7NA 1GZGA 1A5BA 2A6LA 4CU6A 2PBGA 3I3BA 2WC3A 5HDRA 2CZEA 1P6WA 1F7BA 1D3HA 5TQLA 2WVVB 4HOZA 5AC6A 1I8JA 5CPSA 4CVWA 3L2LA 3G1FA 1BFNA 2A3AA 1TR1A 5AFDA 3A24A 1KB3A 3GDBA 1J4EA 1XCWA 3G0UA 3VNDA 3BG3A 3I68A 4M1RA 4UMCA 1ST8A 3ABOA 3SCVA 4W7VA 3C61A 1BWLA 4UZUA 3OHIA 1SZGA 4HHPA 3AS0A 4P8VA 3WQ5A 1B30A 2DZVA 3GH7A 2AC1A 1QFEA 3W1AA 3W1NA 2VFHA 4AZ5A 1VYRA 3IVUA 3TTYA 2YBTA 2ZUTA 3WFLA 5D03A 1VHCA 2P10A 4JYDA 2J7HA 2VCCA 2PRHA 1UKSA 2OX1A 4ONVA 2BHUA 3ZSSA 1OF6A 4OE7A 5AHFA 1CTNA 3LPGA 4TXEA 1B3ZA 1KTBA 1ALDA 3WDJA 4LVFA 2O7SA 4HNNA 3LHWA 3C56A 3KEHA 1TV5A 2QF7A 4LYPA 5A6LA 1UA7A 4AWEA 4WX2A 3SZ8A 1E70M 3TE9A 2VVSA 4PEEA 3IIPA 4JL2A 2D3NA 4P8WA 4FX6M 1LORA 2C16A 4MFEA 4NJHA 4QAIA 1N8FA 1IZJA 2VCAA 2EF9A 2VFFA 3GH5A 4MAZA 1E3ZA 2NV2A 1QPNA 3WL0A 2EPHA 4UC5A 1AG1O 2VO5A 2WCGA 3WF1A 2P0OA 1B3VA 4F8XA 4MB4A 2VZUA 2GOUA 3SFKA 1YDOA 5G2WA 1FFRA 1TG7A 3PBGA 2QCFA 3LBMA 1CGUA 1MVYA 2AOSA 1V6VA 3MUAA 3VGGA 1VPXA 3C0JA 1C3FA 1JCNA 1W31A 4JYFA 3Q37A 2UY4A 1YPIA 1O95A 4NZFA 3LTYA 1K7FA 2FDSA 3SJ3A 5BRQA 3FEMA 8A3HA 2NXIA 2R8WA 2TRSA 3S1XA 4ZXOA 3L4ZA 4GC4A 2XYLA 5E09A 5E0CA 2XFFA 5I23A 1WDRA 5D2XA 1OYBA 2WNQA 4AB4A 3A47A 1CDGA 1H5YA 2WOQA 4JTHA 5LZLA 3O9NA 1YADA 4N9EA 3FLUA 3NPUA 1QR7A 4L4LA 1MFUA 2BXZA 3G24A 1JCJA 5DELA 2AAAA 2GJPA 3M0ZA 3HG5A 5U7SA 3N17A 4MYAA 2ZRWA 4I7VA 1ESWA 5I3DA 3ZWSA 2YL8A 3FAWA 3S5QA 2WSQA 3NQGA 2WO5A 2CKSA 2CKRA 2E9MA 2D1ZA 3GH4A 4U3AA 1WBJA 3PZ9A 2J9ZA 2QLYA 4LC6A 3NDYA 5A6AA 1XDLA 4ZXLA 4I9AA 2RHGA 1GVYA 1QHPA 5GPRA 3ZSTA 1DP0A 3SIZA 1EQPA 3MSDA 1IIGA 4GZIA 2A4AA 3FYPA 2OWXA 1GVQA 3UXDA 3UG4A 4OJYA 2E6YA 5K9CA 3WNKA 1VS1A 3TH6A 3WMSA 3VIMA 3PIGA 1H51A 1QNSA 2GUUA 1J01A 1EO7A 2QPUA 3NL5A 5CGQA 2ZRXA 3U2OA 2HS8A 4DWSC 1F05A 4PCSA 3QMTA 1NOFA 3N73A 1F74A 1GJUA 3K8LA 3DH7A 4QIUA 1W9VA 1ZBVA 3HJEA 1TB3A 4H8VA 3RJXA 1W5NA 3FFSA 4PCFA 4WXYA 1V3KA 1CGVA 3UY8A 2VZVA 4UOQA 3ATZA 4AZCB 5IHRA 4KRTA 3HBLA 2J7CA 1EQCA 5G2HA 3AXIA 3GXPA 2WB5A 5EMYA 4AZGA 1O5KA 4DO4A 2F61A 4IXXA 3AROA 2E1DA 2DZXA 1F76A 3OIXA 1C8YA 2WVSA 4O0KA 3TQ0A 1VH7A 2HISA 3GDKA 2OXBA 3N19B 3R13A 3VKKA 5A8QA 5HPCA 1V02A 5I3JA 3NQCA 3S6DA 1V3JA 3PZQA 1EHNA 3E12A 4LNYA 6CGTA 1H60A 1LYXA 5EBUA 4AZZA 1YLVA 3WK1A 1BQCA 2GQ8A 5EA9A 1TMQA 4MPKA 3W74A 1GHRA 3EMCA 3LRLA 4C1KA 1T96A 1DWFM 2WV8A 3W2NA 1HVXA 1JUKA 1M01A 2FHBA 2E09A 2W63A 4JDYA 3QYQA 4XTDA 2ZUMA 2QCCA 4DUWA 2AAMA 1UASA 1GYLA 1NWRA 2Z1SA 2NW0A 2CLIA 3B0VC 5JIPA 4WJEA 1OB0A 5HWJA 1TVPA 2BY3A 3VIOA 1VRDA 1NAL1 3E96A 1GG1A 1AVAA 1K9FA 3CHDA 1XV8A 5HXMA 3HG4A 4CQAA 1YTKA 1Z42A 3MYOA 2DIJA 3WD2A 3EX6A 3NM1A 2EPOA 1EUNA 1LWJA 3ARQA 4MY8A 4FXRA 2DIEA 1J2WA 4O14A 4UUIA 1K7XA 3NDOA 1QVBA 4RXFA 4FNSA 2O9RA 3KRUA 3FJLA 3SGZA 4N02A 1HN1A 1W5PA 3WH9A 3S1WA 2F84A 3G18A 3DYMA 1FCBA 4NJIA 4H8UA 4DWSA 1GQKA 3VDAA 1NVMA 5KZEA 4ATDA 5EPDA 1UWQA 1R2RA 3TCEA 2XFYA 2VZSA 2QCNA 1JVNA 1NP0A 1MFVA 3EX4A 2XPKA 3RMJA 3VD3A 3VVGA 3QHMA 1JF5A 4UOZA 4W88A 4PMNA 3O8AA 3A21A 4N6EA 4CNNA 1ISYA 1SFSA 1S3HA 3OZPA 2CLLA 4RR4A 2VELA 3EDJA 3B9DA 3M47A 1E6SM 1B9BA 4LWWA 4PCTA 5FCZA 3IGXA 2XJ7A 3BAXA 3GNPA 1G69A 5K2ZA 1I4NA 3N9SA 1W1ZA 4W8BA 4DWSB 2G41A 1QI2A 3P60A 4OKDA 1PIGA 1W1PA 2VRQA 2AQWA 2GK1B 2BXYA 2ZZ2A 1LCOA 1FCUA 1KWKA 4W85A 2OYLA 1WXJA 2QAFA 4O11A 1VJSA 2DT2A 2WMFA 1ZB5A 2JEPA 4M19A 4RZ5A 1KR1A 4Q32A 1H63A 1J0YA 3KZSA 2X1TA 1KFWA 3EX2A 3U14A 3E02A 5AOUA 3CUJA 5EL1A 1FH7A 1HX0A 4NX5A 1E15A 1SR9A 3AIVA 1QDSA 1W3JA 3RJYA 4RX0A 3FS2A 1RD6A 3QMSA 5DFAA 4HSOA 1KBBA 4IQLA 1LL7A 2PI6A 4WJXA 3ELFA 1KLYA 3WKZA 4ICNA 1DKWA 3W28A 5FK8A 1Q6RA 1GUVA 5A94A 1Q4NX 5IFTA 4O1CA 4IISA 2CESA 3LCHA 3FXYA 1O94A 2A3EA 5D2YA 1G7VA 2QV4A 3EWXA 4LY8A 1E71M 2FJKA 3IGSA 4PFMA 2ZX9A 3TDFA 4J3TA 1B4EA 3WY1A 1CI1A 1LDCA 4Z08A 4JTLA 4YN5A 5K3VA 1WB0A 3FKRA 2G5WA 3MBFA 3UERA 1IIHA 2VNCA 5CJ5A 4K6AA 4UQAA 1VBUA 4AEEA 1ZJIA 5TIMA 5FD0A 1FY6A 4GZEA 4GWEA 1E4IA 4C7GA 5HUPA 1MQPA 1QHZA 4XTIA 5AHIA 2VQUA 4LUIA 5BXPA 1GPWA 1SU5A 4PMUA 3P8IA 3W2LA 3G1DA 3WD3A 1CGWA 2G96A 4CU7A 1TCDA 1OFOA 3PSVA 5SWUA 2XIIA 5LGZA 2FGLA 3WNMA 3QRHA 3DYPA 4FF5A 3HG3A 2F8QA 4HOWA 1TUXA 4H04A 4O57A 1UH3A 4UTIA 1ZBWA 4ADUA 3ZS4A 2PCQA 2O9PA 3WD0A 1H49A 1JULA 1GT8A 2BVTA 1IXPA 1G4SA 2Y63A 3KVJA 4W5UA 2Y5EA 5A6BA 3QOMA 3R89A 1BTCA 2A7RA 4P2VA 1HXJA 4WKAA 3BGJA 3C6CA 3HB9A 4G1KA 4POCA 3SSJA 2YKKA 3G3MA 3ATYA 5EB8A 4JEQA 4PBGA 1KGUA 1HP4A 4DBEA 3VUPA 1BF2A 2J25A 4Y96A 2V2HA 5K9XA 3AS3A 1WOAA 2ABAA 2BX7A 4HP5A 5LHFA 1KTNA 5F2MA 1FXPA 2WSKA 3DFSA 1UOKA 3P82A 3LPPA 4OIFA 1XCFA 1V5XA 3RIKA 2ABBA 3KVMA 3WENA 4FB7A 4JZ5A 3RMEA 1K9TA 2JBMA 2X1IA 1FWSA 2CXGA 1X6NA 3O06A 2ZZ4A 3SECA 3CWNA 3SY5A 3ZR4A 1JRCA 3G0XA 2WM0A 2NT0A 4HXCA 3W87A 5DEZA 1AW1A 2XUCA 4W9TA 2EGZA 1PAMA 3ABSA 1T0OA 4YHGA 3VI2A 2R91A 1KXHA 2NXGA 1BGAA 4HMCA 3VIPA 1AW5A 4H41A 3WEOA 3H55A 1WZLA 2E5CA 4O12A 3MJYA 1M03A 1UWSA 2WMIA 4KH2A 4FNRA 4Y8FA 3QC3A 1R8LA 2E8ZA 3D5HA 4KGJA 3G1YA 1W3TA 3A5VA 4Y90A 3AZTA 1M6JA 4M5PA 3BG9A 1ZAIA 4WLCA 3BLFA 1WE5A 3H3LA 4YL2A 1VJZA 3F4VA 3RO8A 1JUBA 4BQ2A 5BXRA 3UXAA 3HGOA 3CB8A 1AL8A 2WJZA 2QPSA 3OLDA 4M8UA 1XBYA 4S3KA 2ZTKA 1JFHA 1W5MA 1PJ9A 1JI1A 4QJ1A 1OHLA 2Y2WA 3RPMA 2V3EA 3BXWA 4OBTA 1ICSA 2W91A 2CBJA 1JRBA 1JZ5A 2OT1A 1V0LA 1SYTA 2FFCA 1KGXA 5I6SA 3L2IA 4B16A 2YPIA 4K8EA 1QI3A 2QCGA 2J7DA 4TVCA 5I2UA 2VFGA 3O16A 4DUVA 3ABRA 2GJRA 3UD6A 3VE7A 2DP3A 5BMWA 4PMDA 3NNTA 3GYEA 2OWCA 4AD0A 3W7QA 4W8AA 4J3VA 1JZ8A 1W5OA 3W1QA 1HJXA 4K7VA 1GQJA 3UWUA 5HWNA 4BR1A 3L5LA 1SZFA 4TIMA 1JAKA 1H5VA 2YA0A 4MY9A 5G5IA 1S5TA 4RJEA 5KEZA 5C5YA 3GDTA 3DYOA 3NQVA 1TPC1 1LQ0A 1HO1A 3AHYA 1M53A 3EDEA 3C2RA 3CMJA 3IIXA 3NIYA 4QAWA 3TR2A 3N15A 3P5ZA 1GJWA 4FNQA 1BAGA 2V2DA 4DEFA 3QPYA 5D30A 4FNUA 1QPQA 3IJ7A 3R8RA 5K7JA 1K03A 1FWNA 2D23A 1A5SA 4S2BA 1DWAM 4HKPA 4BQ5A 3LEMA 5A2CA 4A2RA 3CHVA 3AISA 4AW7A 5L6UA 3TONA 1TV8A 3MMDA 4A2SA 1B3YA 2WNZA 3AICA 2QCDA 3RDKA 3WUFA 1WQ5A 3DFOA 1JXKA 1SO4A 3JS3A 5DBTA 1SMAA 1GYNA 2X1UA 3CZEA 4GIAA 4L4PA 1UWRA 1V6YA 3THCA 2ZXAA 2GQ9A 3LCLA 1OT1A 4FK9A 2XN0A 3ALFA 4D6HA 4U28A 5M3WA 1G9HA 2FGZA 3NG3A 1TQJA 3C2OA 2EPMX 3CH9A 3TA9A 5A8OA 1KBIA 3N2XA 2OLHA 4NZCA 3WEZA 1Q6CA 3TW7A 3LXAA 1KXTA 4NJJA 3N9KA 2NLIA 3W86A 3NL3A 2GJNA 1CEOA 4AZHA 1CWYA 3LX9A 1XH2A 3TNOA 3A9IA 2QCDB 1KM1A 1YPFA 3C2FA 5LNWA 3CPRA 3WF3A 4DQWA 1J0IA 3CUHA 7A3HA 3TJXA 3GAYA 5CZJA 1C90A 1BWKA 1LBFA 4LVBA 1E0XA 4LV4A 5DO8A 1F6KA 3T2QA 5CPNA 3THDA 5GNYA 1Q6DA 2FH8A 1E3XA 3VINA 3LLFA 1FH8A 3U7BA 3MMUA 1DQXA 2I14A 3EWYA 3OEXA 4UXDA 2A3HA 4LPCA 1K7EA 4YXGA 2XN1A 2VX5A 3PBYA 2VFDA 1YHTA 1DJQA 3HN3A 2NSXA 4JS3A 1CLVA 5BMXA 5DN1A 4WOQA 2R94A 4MJMA 4OBRA 4B9ZA 5ABTA 1JD7A 2LLEA 3BW4A 4U5KA 2ZUUA 2DGAA 1XD1A 4TO8A 4AZ7A 4GUJA 4JFSA 1ZL1A 2X8RA 3F4WA 4MLRA 3KL5A 1DWIM 5JUVA 2TPSA 2V30A 1GONA 3W84A 2PRLA 3HGRA 5F4SA 1EA0A 1J9YA 1ONRA 1HJQA 1QNRA 4UNIA 1TPUA 4CD5A 1WX0A 4WY0A 3W1LA 3I3DA 2VRKA 3TQVA 4Z1AA 2YL9A 1SW0A 1VJIA 3AMLA 3KFTA 2HVMA 2ZX5A 1LG1A 1MW2A 3AXXA 5D9NA 4AY1A 1LRNA 3NXFA 2WKJA 3UWZA 1U33A 4HZ6A 4PMQA 4O28A 3WQVA 1I2NA 2C6QA 3WNOA 2VL4A 2DZWA 2EAWA 2JK2A 4ADSA 2BY0A 4MKNA 4O13A 3PIJA 5HUOA 3ARVA 1JZ3A 1SR0A 1LLOA 3IIZA 5KMYA 4E0CA 4BA0A 1B90A 5K4ZA 1J0KA 2DPEA 2BTMA 2WYSA 2Y88A 5D37A 1E0VA 3TAOA 5E6YA 3W2KA 2YYUA 4WY0B 3U6WA 4AEOA 3DXIA 3O2LA 5E70A 5F7UA 2VZOA 1TTJA 5I79A 1VLIA 2FB2A 3IIOA 4X0NA 2VJXA 3UETA 2UV8G 4B3LA 2BZNA 1SO5A 4M29A 3FA5A 3H54A 2Q8LA 3WMCA 2RDTA 3DHUA 4M7TA 1Z44A 1RZMA 3WQ4A 1G4EA 3N13A 2E40A 4XZWA 3VD5A 3BC9A 4IUOA 3S1VA 3W53A 1GVIA 4UTFA 5AYXA 4O8RA 1V08A 4U2YA 2XG9A 1BKSA 5BCAA 3ARPA 5G2IA 3PS7A 4LYQA 5CZ0A 5TD4A 1UD3A 3OGSA 1OFAA 4E2DA 1EP1A 3NA8A 2YIHA 5A5WA 3W27A 3WQ6A 4DPPA 2TSYA 3HU7A 4AD3A 5CLWA 1J18A 1KV8A 2ZYFA 4ZENA 1RP9A 3B05A 1GHSA 1V6XA 2NX9A 2J47A 2C1HA 2VR5A 1K8ZA 2WK2A 1CW2A 1W54A 1E9LA 2YR1A 3W7MA 3TSMA 1UUQA 1P5BA 1T8XA 4J9JA 2DDXA 2WHLA 4MAVA 4AIOA 1TA3B 2XVLA 3STFA 4D1JA 2VC9A 1H61A 4JX6A 1PZ3A 3D3AA 2WWDA 5EFFA 1XYZA 3CZ8A 3QGVA 4WSJA 4JNMA 1TREA 1W2TA 2FIQA 2CLEA 3F1QA 2ZXBA 5D9OA 5DMYA 2W79A 3MHGA 5H91A 5HNRA 4GJ1A 3LCIA 3SCOA 1WDQA 3LXBA 3SCUA 3EKZA 4HMDA 4MJZA 3PWAA 1FP9A 1XD0A 2YBUA 1KM5A 2ZZ3A 2J7FA 4L4OA 3THAA 3IAPA 3VNYA 3QFEA 4JCLA 3U7VA 1L2UA 3QW4B 4PUEA 1VC4A 2JF7A 1QNPA 5AYBA 4PH6A 5FKCA 1QAPA 1YTEA 3N1AA 1BYCA 2D0FA 4UTKA 3UNDA 1KR0A 1VYPX 3AIQA 3MU7A 3PN8A 2CZFA 1TV7A 1G5AA 1OD0A 2V81A 1WPCA 2B4GA 5E93A 3T09A 2VI0A 2C19A 1TCMA 3L2MA 3EWWA 1MO0A 3M44A 2DJXA 3WD1A 1GOQA 1CXLA 1SZNA 1PHWA 3G1AA 1H7WA 4HZ8A 3WH7A 4OQVA 2WMKA 4B1LA 1M7PA 1W9BM 1X1OA 5AB3A 4IMEA 4OGZA 2XVNA 4BS0A 4AEFA 2EPLX 1MZHA 1HJUA 1UQYA 2YA2A 5LSMA 1Q6OA 1XDMA 3UZJA 3TV8A 3UWYA 1Q45A 2YL6A 1Q6GA 3NQ8A 2ADEA 3HPSA 3SR7A 1GCYA 1UH2A 4GKLA 4J27A 5D33A 3EKLA 1E51A 1FDJA 4R53A 4AYSA 4NUWA 3P67A 1DWJM 2JF6A 1D7FA 3A22A 3IRDA 3N11A 1J10A 2A5HA 1MXDA 1TVNA 5HOSA 3TJLA 1E43A 4GFSA 1DHPA 5ECUA 3VIFA 1WZMA 2QDHA 3NQ2A 1IV8A 5D2VA 2C13A 4J7RA 2XWEA 3BGAA 3IJ8A 4J28A 3BAWA 3P84A 1GG0A 1Z41A 4BWLC 2WAGA 2BS9A 4Q33A 2YOCA 2CBUA 5FMBA 2Q8ZA 3G8EA 1PPIA 1XSKA 4RXGA 4W5ZA 4Z2GA 1BEUA 3R2GA 3BO9A 2W5FA 3KL0A 1WKYA 2D0HA 3LF7A 4D6CA 2H3BA 1UKPA 4HSNA 3MUZ1 5A2BA 1AQMA 4W8LA 1QCWA 4ZE5A 2O92A 2PWDA 1LOQA 4M81A 4LVAA 3VD7A 1KM3A 3BARA 3UG3A 2WKLA 2J8GA 4ZQOA 3U5UA 2W6RA 4ACZA 4BQ4A 1ME7A 1GJPA 4QITA 1LTDA 3B0PA 3FKKA 3E0IA 1MW3A 1V03A 1C7SA 1XFBA 4CD4A 5FEWA 5KSWA 2YLAA 3IIVA 4MYXA 1A53A 4QSHA 4BCEA 1YXYA 4A3HA 4AD2A 4HMEA 4WF7A 2DORA 1XBZA 3QQ1A 3WJZA 1NFBA 4CD8A 3O6YX 3IANA 3ECQA 4QLJA 1KXQA 1PZ2A 1H7PA 1TPEA 2C0HA 2VFEA 2QDGA 1X1ZA 6A3HA 2A1YA 4XZ9A 2C15A 1TTQA 1W3NA 3E49A 4N9BA 4GQRA 4LS1A 3UPBA 1WOBA 2Y61A 1W32A 3W7JA 1JCLA 3AHVA 1F4HA 2GFTA 3M5YA 2YA1A 4YWIA 3VPLA 3W85A 2X30A 3MI2A 4E2OA 2QJIA 3EWUA 1EIBA 4GO8A 3VU2A 1HL2A 3NQMA 4TX8A 3RFAA 1TJPA 3LHZA 3TK7A 5CSYA 2QUUA 3VTRA 3LRKA 1NF0A 1ZFJA 2GVLA 3CEPA 3LTSA 4UFIA 3EBVA 4RKAA 1ISXA 1HO4A 3CTLA 3GYCA 3BCFA 4YMZA 4D6FA 4U4MA 3CM4A 4BWLA 3K4AA 1W8SA 1JZ7A 3CIWA 3GXFA 1V6UA 5IDIA 4KFPA 4Z2LA 1GQLA 3C2VA 2QQUA 3IJ9A 3M7SA 1WDPA 3W82A 5HR6A 4YHEA 1UZ1A 2ALDA 2VEKA 5EFDA 3LXCA 3ARRA 3GR7A 1FDYA 1ZJBA 5C55A 2ZX7A 4ORMA 2OYKA 5A6MA 1P0NA 3S5YA 4QCEA 2OWWA 3M41A 1W56A 5D2TA 3OB8A 1C8VA 3UWVA 4X2RA 1UUOA 3PY2A 5LNUA 1OGSA 1GPFA 1US3A 1ML1A 1CXKA 1VFUA 3DHPA 4DF2A 4ML4A 5LHEA 3UG5A 3BAKA 3MBDA 4M7SA 4O19A 3PAJA 3CZKA 4GI8A 3PZUA 4NSBA 3OVPA 3WNPA 5I78A 1P4CA 3W38A 3K8KA 4UQCA 3K1DA 3W71A 1LLWA 4JHZA 2H8XA 3CIXA 3C52A 4TU1A 1DHKA 1GVRA 3G1SA 4DXVA 1ITCA 3I6RA 1MQRA 3DU0A 5AC7A 2NZLA 2QMKA 1L0PA 3C8FA 2AEYA 1OG0A 2J7BA 2ZOXA 4TOQA 1MW0A 4KWWA 2WVTA 3N18A 1W9UA 3ZMRA 4K37A 1UD8A 2J79A 1UR9A 3NPWA 3B8SA 5AHEA 3DHDA 3HMCA 5CPOA 2RKXA 1IXOA 3NL6A 1UD6A 2GQAA 3WSUA 1CXIA 4N0RA 4BI5A 3UGFA 4TMCA 3BLKA 1W0MA 4JL1A 3LHUA 2E8YA 1LBMA 1VGAA 2G3NA 1TPWA 2NUYA 2VRJA 2Y8KA 2NWRA 2V5LA 1FA2A 5DT5A 3A5FA 2G3MA 2V82A 4BF7A 3ZQ9A 5D04C 2Y7DA 3VIHA 4H3DA 4IUGA 1CIUA 1R86A 1OFPA 5KINA 2F7FA 4PUDA 1WNOA 3MUIA 1BYAA 5K4XA 4EF8A 1JI2A 2WC4A 3BGGA 3OSDA 4ALDA 3V75A 1S46A 1RQBA 3TC6A 3KX6A 1Z48A 4GUGA 2VT0A 3UPWA 4IM4A 4P7LA 1JCMP 5A69A 4MZ8A 2ZRYA 4MIMA 4E2BA 4FHAA 3GXDA 1XHGA 4RZ6A 1UR1A 3BMVA 4GZJA 2HMCA 1EX5A 4UFKA 1WYIA 2BSLA 2E6FA 3BPWA 2YW4A 3CZLA 4PTWA 3T08A 2BXVA 4PSPA 3W73A 3CLMA 1C8QA 2V3GA 5J5DA 3WL1A 4JX4A 1TZ7A 3SURA 5AYYA 3WF2A 1NWUA 4D71A 3WH8A 5KTLA 4B1MA 4JY8A 4TMBA 1ECEA 5I3KA 1V0NA 3W23A 2UY5A 1CXHA 2ZUVA 1RQHA 1JDAA 1BGGA 3M5VA 4PRWA 2XSAA 5EMUA 1DJNA 4R33A 4PL1A 1Y7VA 2C14A 3SC7X 3GX9A 2D24A 1E6XM 1NEYA 1CYGA 1QNQA 2F2HA 1A5AA 3VMPA 2CLHA 3PZTA 2GJLA 4YCOA 5BRPA 4F66A 3AS2A 4AD4A 3OA3A 1C93A 3AIRA 2ZRZA 3WUGA 2CW6A 2EEXA 2WZIA 1V0KA 3ZJ6A 2ZXDA 3OG3A 1RPKA 3LI0A 1WZAA 4GE8A 3AOFA 3DC0A 2TMDA 1HG3A 3DFTA 1QOQA 3KXQA 4KGLA 1THFD 2ZBTA 1UBSA 5F4WA 4UZSA 3OVRA 1UR2A 3MV11 3T55A 4X22A 5CPQA 1VZWA 3IGUA 5AYIA 1E55A 1M04A 3UGGA 2WMHA 4JTTA 2YX0A 2D73A 3GAKA 5C8BB 4LYRA 2Y24A 4DBDA 1UZ4A 1KBKA 1MQQA 1J12A 4JYEA 4NJGA 1SPQA 3MANA 4FLOA 1NOWA 3UWQA 1U30A 4QM1A 2FHFA 1SO6A 4FFIA 1GEQA 2AGKA 1JYXA 3DKJA 2ZX8A 1IZKA 1FFQA 3S8HA 1G94A 6ALDA 2GVYA 3GTNA 3FHAA 4K39A 1A50A 1AQHA 3DI1A 3CMGA 1RPXA 3SEPA 1G0CA 2BHYA 1EOKA 3B9EA 4IWWA 3P5YA 2X2YA 2JGYA 5EYWA 3W1TA 3ZFHA 3WDRA 1LOLA 1ZY9A 3U75A 4AAJA 1CGXA 1XSIA 4MNLA 2H90A 4XQ6A 5G4WA 5A1AA 1CPUA 1QO5A 3BLIA 3LCWA 1VQTA 2WQPA 3P7YA 2PB1A 4J3XA 2D22A 4PC8A 3EMZA 1VCVA 2CZDA 4AWTA 3LPFA 4URIA 4JFTA 5HWMA 2W4XA 1JFXA 1TPVA 4BZYA 1KV5A 2ZE0A 3S2CA 1QOPA 3NOEA 3TUUA 4MVAA 4NXKA 1OWQA 4HPGA 4O1BA 3CUGA 3W29A 2BLEA 1QHOA 4OBSA 3VIGA 1KA9F 3PG9A 1I2PA 5BOOA 5FESA 1E1FA 3EB2A 4CVUA 4ZMGA 3QSTA 3UR8A 1ZAHA 5DXYA 3RLVA 5GNXA 1LJYA 2EO7A 4OZOA 4OT7A 1B9ZA 3K4DA 5MHBA 5D02A 4PMRA 3W2MA 3PZVA 3RILA 1PIIA 3G6MA 1Q3NA 3NQDA 2ZUNA 3EDKA 2ISSA 1DVJA 3VD9A 1YXDA 4Z0JA 4UFJA 4AXKA 3KWXA 1BTMA 4V27A 3BK0A 5DY2A 5A3HA 1OK4A 1QPKA 3VX1A 3SCTA 3SCSA 1Q6QA 5HQEA 6TAAA 5CSRA 5ABEA 1RP8A 4F9DA 2ATMA 3QM3A 1GNXA 3LHTA 4FX7A 1G6CA 3WUEA 1W2VA 1EGZA 3OGRA 5A8MA 3MP4A 1SW3A 1WDWA 3DBPA 3HPZA 2QUVA 1OFRA 1ME8A 1OFBA 2D3LA 3ARTA 1BG4A 2WHKA 4R27A 4O1DA 4F9JA 4IPIA 4BI6A 2FPVA 2Z6IA 2DH2A 4HA1A 1UUMA 1CXEA 1C7TA 3WNLA 1FWRA 4ZQMA 1N7KA 2A2IA 1V3LA 1H41A 1A47A 2GUYA 1D3GA 1H0GA 1QMLA 3AO0A 1HT6A 4E4PA 3OVQA 4NNAA 2A7PA 2XQRA 4P7OA 3LGEA 4LU0A 3A4WA 3W75A 1PBGA 2XM1A 1EDTA 2H6RA 4JIPA 4JTUA 4WZHA 1L6YA 3RK8A 4B5NA 1B0IA 1EHAA 2CNCA 5A8NA 5ABHA 3T40A 3CEUA 3AYRA 4WKFA 2DU2A 4JFVA 1H1ZA 4FNPA 1UR0A 2ZFAA 1QNVA 3N12A 4XKYA 3AQUA 1HNYA 4J3WA 1MW1A 2O9TA 5JBFA 2J6XA 3NUKA 4UQ9A 2DT1A 1B1YA 1KM2A 3T4CA 4PMYA 3SW6A 3L4TA 4XWUA 2QUTA 1TTPA 4OWGA 4FNTA 2FB3A 5FF4A 1LG2A 3U57A 3GXNA 3W83A 3M7WA 3EMQA 3NZRA 3B04A 1RQEA 4M6QA 1H0IA 1R87A 1JF6A 1UR8A 3ZT5A 3OLEA 5I5RA 3WBEA 4HPHA 1EA9C 3NQ7A 5ABFA 3A4XA 1MXGA 2FTPA 3L4XA 3LCXA 4P7QA 3LDRA 3L67A 4UOJA 1QI4A 3VDHA 1HUVA 2WMIB 2VOTA 1NSJA 3TW6A 4HTYA 4UNLA 5HBFA 3L5MA 3P8JA 4FEZA 3GXTA 4FFGA 2C8NA 4X9YA 3WEMA 3AIWA 1SFJA 2VKZG 3S5OA 1B57A 1HKKA 2NT1A 2XHYA 2FHCA 1WAUA 1B3WA 3OA5A 3NPXA 4BFAA 2WCSA 3KF3A 4PA8A 3PZMA 2ZA2A 2CHNA 3PZOA 3VIIA 3ARZA 3QOKA 3B8DA 4NNCA 3WJYA 1OVDA 4UR8A 3TXZA 1C29A 2ZUWA 2CZ5A 2X09A 1VYSX 1KLZA 3ANYA 4HN4A 4EAMA 2CLFA 2MANA 3AIEA 3TAKA 1EB3A 4OV4A 2QCMA 2E5BA 3TSBA 2YDQA 3LCFA 1WA3A 2PC8A 1SO3A 4UTMA 5KZ6A 3NCOA 2ISWA 1XC6A 5CQ1A 3NAVA 1VR6A 2Y70A 3PSWA 1DTUA 3GBEA 1KW1A 1TMHA 2ZDRA 3R5EA 1JAEA 2D2OA 1FWTA 3ALGA 4HU8A 2ZZ1A 1UWUA 1XBXA 3L66A 1R30A 4JAWA 2RGMA 1U83A 1KFLA 2E5DA 1G4PA 1L9WA 5BW6A 3FW6A 4MDPA 4ZE4A 5C70A 3O15A 4JQTA 2ZXQA 1L6SA 1GVOA 2OT0A 4ZVJA 4OOZA 3TU9A 2VX6A 4M6VA 7TIMA 3LV6A 1OD8A 3O6DA 3EDFA 4NZJA 1ZNNA 2QJHA 4IMDA 2XFRA 5AN7A 1QPOA 4U5IA 5M17A 3LB0A 2Z0IA 5LNSA 2X2GA 4GINA 4UFHA 3N9RA 1ZS2A 5E6ZA 1KM6A 3GNOA 4Z2KA 4AZIA 4WSKA 2B7PA 1JYWA 4TUFA 3LIHA 3LBCA 3MUXA 4PTVA 4OV9A 2Q8XA 3W72A 4XBSA 3GNDA 3UYCA 3STCA 5AHNA 3G0SA 2E6AA 2GSJA 2ZTJA 3P61A 2GJXA 2PC4A 2XTKA 4GUIA 1FCQA 2NWSA 3BSHA 3LHYA 3AMKA 5AHMA 3HOJA 3UQNA 2B7NA 4W84A 3NVTA 1OGBA 4K8HA 3BG5A 1MEIA 5BYWA 4EQVA 4EIVA 3POHA 1UCWA 4AZ6A 4YPJA 3UZ5A 1CECA 4CGTA 4D6GA 3L4VA 3CO4A 3QSRA 3DECA 2JALA 1KM0A 1OF8A 5LNRA 2BV9A 4A4AA 2VEIA 3CC1A 3KRSA 2Y89A 3DAQA 1OBAA 3VNZA 3S0CA 4LTSA 4RL3A 3VGDA 2JKEA 3NO5A 5J5RA 2J75A 1MWOA 1RH9A 2NUXA 1GOOA 3CBWA 4ZQPA 1PL9A 4HA4A 3HIJA 3AZRA 1DORA 1JUEA 4JDBA 1IT0A 2B31A 1W91A 4HNTA 1F73A 1U2YA 4AD1A 4EKJA 2GVJA 4LOCA 1M7XA 1Y9GA 3W1XA 1QW9A 1KCKA 4CCCA 1LRQA 2Y7GA 1UA3A 4TVUA 3ZJ7A 1NWTA 2YZRA 1D2KA 3RWKX 4MNKA 1R7AA 1TJRA 5U4NA 4MTVA 4QFUA 1X8FA 1KGWA 4V28A 4ZZ9A 3DHFA 4RE2A 2DZTA 3DGRA 4H6KA 3VFLA 1RR2A 1OIFA 3W26A 1MEHA 3MI3A
chains in the Genus database with same CATH superfamily
4B5XA 1CB7B 1TIMA 3LZ3A 2VVDA 4ENLA 5I8YA 3WUCA 4AI1A 1F3WA 2VXNA 2E9LA 3VBOC 1DIKA 3KV4A 1K8XA 5IK5A 5HR7A 3MEPA 1JUHA 5CAHA 5CNAA 3OCPA 3ZM8A 4LIUA 3GIYA 5C8CC 3NOYA 4HJWA 1JMUB 3L4UA 2HWF2 5JXQA 4AMAA 3UGHA 3DFQA 4L61A 1UXZA 4XZHA 3WG3A 4LHSA 1M3UA 1FT9A 3WBAA 3CQJA 2VQTA 2GLKA 2Z2SB 3R58A 2CLOA 4TWTA 5I0DA 1IKPA 4F0LA 1W6OB 5KITA 2VM8A 2HTMA 1QHDA 5HULA 1NTHA 3L65A 3NM3A 3JD71 4IE6A 1ZCOA 1G67A 1NG0A 1ZBE1 3P6BA 4MG2A 4GI6A 2DTWA 4JNZA 2OSWA 3POFA 3BVJA 3O05A 3V0AB 4IV1A 1XCXA 4XIAA 3IRSA 1X36A 1ULPA 4M0XA 1KQYA 4N43A 5T9CE 5G1TA 4NWWA 4WM8C 3RU6A 4AHOA 1QI0A 1BEV1 2WABA 4AISA 1QF3A 1ZP3A 5JVLA 5FJIA 1CXFA 1F8VA 3FJ6A 1C8M3 4O54A 3BMWA 2E31A 6TIMA 1OM0A 3VNKA 2PZ0A 4N4PA 1W1B1 3SCRA 1OCNA 2VFIA 2ZOEB 5DF0A 1YW1A 1GNZA 3MIEA 1R47A 4DPQA 1KGYA 4FXSA 1XLBA 3E2VA 5D32A 1LROA 3E5XA 4HGXA 5CFDC 4O17A 3ZR6A 2FDMA 2V0TA 3PZIA 1XI3A 4UI9L 4GBDA 8CGTA 2WBGA 5HXVA 2VEPA 4W7UA 4YFWA 1I1XA 1JQVA 3AHXA 3W81A 4LO7A 1MDLA 3TTSA 1JGIA 3O1UA 2A6XA 2XL7A 4DO6A 1OQEA 2ANUA 2QHAA 1YXWA 1BYHA 5TNVA 4TVDA 4BY3A 2V67A 1LOFC 2YFZA 2ZBJA 2BY1A 2A3LA 5LYRA 3P62A 4RN5A 4E38A 2YB1A 1UYXA 4NQ1A 4FOKA 4EOUA 1D8CA 5IOBA 1S3TC 4H01A 1C92A 4RUBA 1SACA 3N6JA 2W61A 1LZOA 4R7JA 1XH1A 3VM7A 3NQAA 1SLAA 1W8FA 3TN93 3DBNA 5GZEA 5JBDA 5DABA 3UEQA 3G8RA 5D4YA 1PIV1 1GNHA 3APBA 4K9SA 2X7VA 1QJZA 3HEIA 3GKAA 3GFZA 4KU8A 4QXBA 1TMF3 1FUYA 1PIFA 4LV9A 3VGFA 4IIGA 2PWFA 5F3IA 2D40A 3U4AA 1GTHA 1PUDA 2YXXA 3VA8A 5T5LA 1ICPA 1ENRA 4L4MA 2G4FA 5BNOA 2EIBA 2BNMA 2MPFA 5T5OA 3OY8B 2D20A 4ZL1A 4XABA 1XU2A 3T81A 3N9MA 2Y5JA 4TR9A 2WNNA 1AYM3 5T3NA 3MPPG 2XBO1 3OBKA 4HYRA 3KCLA 4Y7EA 2ATSA 3QLDA 1OVSA 1ADOA 1LLZA 3U2ZA 4NJ4A 3BDKA 1XLHA 5FZBA 4F3HA 1KWGA 9CGTA 1KFEA 4OMCA 3JR2A 4Y20A 1WP6A 2VX4A 3EDDA 3URAA 3VZZA 5D09A 2ZUSA 4PDWC 1ODZA 3RRAA 2CIPA 1FI2A 1TME2 3WLUA 5CGTA 5LKYA 1XRSA 2IC1A 3T07A 3W7HA 3G22A 2UYAA 2ZX3A 3GCXA 1VBA2 1E6NA 4CRQA 2VEMA 2WJDA 1CENA 4CDXA 5A6BD 4MB3A 4H3WA 3BAYA 1URXA 4AH7A 1CAXA 1PYMA 5A3UA 3A64A 1LOCA 2NQZA 1HRI3 3NJ3A 4N4QA 2MNGA 2RMU3 2YJQA 1JJKA 2BV4A 1NARA 2XKOA 3VBUC 2YLLA 5ACA2 1JBCA 3QV9A 2Z69A 4OZXA 5DZEA 1NM9A 2XB6C 1TPFA 2D3RA 1NU5A 2HYKA 1OIMA 4Q8NA 3C86A 1DZQA 3QXBA 1OOPA 2CHRA 4LA3A 1QXPA 4Y6GA 5KBFA 2BVYA 5A6ZA 1HF6A 1NFGA 4P08A 2Y7FA 5AC92 1XE8A 1UIJA 3TRSB 1VFOA 4LBJA 3GNRA 3SUWA 2D6NA 4O18A 2NQJA 4AVFA 1ZBKA 1RUF2 1DXEA 4QPWA 2OW4A 4JV4A 4XAZA 4KI5M 3FXGA 1K6AA 1UB3A 3LQLA 1W2NA 5REQA 3IK2A 5A95A 3EOLA 3JW7A 3MMWA 1ZU8A 4KMQA 1R3TA 5LIYX 3QGKC 3HQ1A 4DHGA 1AZDA 3DXUA 3SI9A 2FPYA 2ARAA 4V2XA 3T7VA 2WKGA 4V2VA 1E5SA 3M0VA 5CLTA 4UQEA 4UMAA 1STMA 4GIRA 4NRPA 1SCSA 1BRLB 4GVFA 4WV8A 2WBKA 3W7CA 4XW3A 3TFXA 3ORWA 4NMIA 5C6MA 1F2JA 4QX0A 2KM2A 3O1NA 1QMJA 4QX5A 5KWRA 1JNDA 3DGBA 3RF9A 2FVMA 5IHSA 1NX9A 1X1NA 1XP3A 5DUWA 2XWBB 4ZBCA 3BPZA 3CWOX 1JZ2A 3OLGA 1US2A 5E0FA 4W6YA 4ARXA 3OZYA 2VUAA 5C54A 4GD4A 1UKOA 1DIDA 4U36A 5I3IA 2OZ6A 1QWRA 7ENLA 1DQWA 1JYTA 2BB0A 4XD5A 2VVNA 4NYYA 5IK7A 2QQVA 2ZZ6A 3SUTA 1S2UA 4YTQA 3AFGA 1TVLA 1W1YA 2E9BA 1Y0EA 2CFFA 5FUPA 4NZ1A 1W5QA 3OLIA 2NV1A 2WHMA 2GAUA 1BXNA 1UKTA 3DESA 1TX2A 2BY2A 1NYWA 4GUHA 4UQDA 3BAJA 3VBFC 1YRRA 3B97A 3BH4A 4JGZB 5EYYA 1BVNP 4BXSV 1QNOA 5I09A 3JU9A 4LT9A 3UR2A 3PVBB 1HIZA 3N04A 2QQWA 1LESA 3ARWA 3RZLA 1SSGA 1UKQA 4QPGC 5LW9A 4IGPA 3IPVA 2DQXA 5JDBA 2ZGSA 1CGYA 2QCHA 3ZIZA 1FPN1 3D82A 1XUUA 4OHYA 4KETA 4ATWA 4FAHA 2C3ZA 1CNVA 1J83A 2E68A 3ABZA 1GOKA 1OK6A 5F37A 4KCWA 3QQ0A 1K9EA 5H2ZA 1LEMA 3UA3A 1XKJA 3O6CA 3KF5A 4C1WA 3S30A 3GUWA 1LL6A 4Q1RA 2UY3A 1RVKA 4Z1VA 4P7NA 1TPB1 5F1VA 4R85A 1DYPA 2I9UA 2PHRA 4JVAA 2XH7A 3LAGA 4M3CB 1KQZA 3KOFA 3HR9A 3E2SA 3VOJA 2EJ1A 5I3GA 3GJBA 3EZ4A 3TR9A 2V3FA 3C0LA 3QH2A 2NX3A 1OCBA 4XACA 4MY1A 3GHNA 1NWSA 3WK3A 2K9ZA 4MPQA 1WMEA 3KCJA 2E0PA 1JG9A 1NKGA 1VFSA 4A3RA 4MLJA 2CEQA 1KFBA 1DIWA 4BLIA 5FQ0B 3W58A 4MGGA 1O4UA 2PQSA 3N3MA 3UPMA 4RZ4A 2NXHA 5DY3A 2X5IC 4ZXEA 3MWAA 3WLRA 3B03A 1OYCA 1QBBA 3SY8A 3TLLA 4EROA 1GZTA 2JB8A 1K12A 2X53S 2RDWA 4GNJA 1FQ0A 3GDMA 3QY6A 1QIQA 1L6WA 4XB3A 5A7QA 3GHMA 2HRWA 4HZMA 1DGRA 2WPBA 5CG7A 4JN6A 2GC3A 1YPXA 2JEQA 1HVQA 1H50A 2W66A 6REQA 3MW4A 1BSIA 4ONUA 1K77A 3JD73 2QKFA 3ARSA 4Q4OA 1ZBE3 4FP2A 1LUCA 1XJAA 1SQ4A 3LNPA 1HP5A 4KG8A 2YSWA 3K13A 1QJFA 1B35C 3MFAA 4D2JA 4NRQA 2QCEA 1BEV3 5DT7A 3D3FA 3TSDA 2PDCA 1YDVA 1VBC1 2D97A 1XG4A 3MO4A 5C3OA 5MF5A 2PDFA 3CU7A 2A3XA 3GDRA 4HOOA 1UHVA 1E6RA 5ABFB 4GACA 5K0UA 1CIWA 4XIOA 1A3HA 5AC8A 2Y34A 1K9DA 3B0XA 1H6YA 1E1CB 1QJY1 1GZCA 1QKQA 2GC2A 1VCGA 4HU3A 3OGJA 3R0KA 2ESCA 1A0CA 3QF0A 3I2OA 1R5YA 1UF2C 5DZFA 4ASTA 1UZVA 1FXQA 2OEMA 4AX6A 2UY9A 4AU0A 3RX2A 5BV6A 3CZGA 3TWAA 4AVCA 5FL0A 1SEFA 3R4UA 3T0BA 2DUPA 4AXNA 1PO11 3PM6A 3FYOA 3JRKA 4OFGA 3L5AA 4JTRA 5DAWA 4YVWB 3BCWA 2ZX2A 3EPOA 3MUY1 1TPDA 1VBE2 3W7OA 2HWE1 1IEQA 4YWAA 1CZ1A 1OGGA 4FQZA 2O55A 4H1ZA 3RR1A 1H09A 1OFEA 3S2NA 3TYZA 1KM4A 1H0BA 1GGOA 5I0SA 3WQPA 4BI7A 4RFRB 3W7DA 2PDLA 4MHUA 4XUYA 3M3QA 3BN6A 1UNBA 4NILA 3SUSA 2OEKA 1ULOA 3BV7A 1PIV3 3LDBA 1DQ2A 3L21A 4FFHA 4QEHA 4MJ2A 1EC8A 4INFA 4CEWB 5A6KA 2GJXB 1TNFA 3O07A 2VX7A 5A8GA 1FNYA 4ERIA 4QGCA 3WV6A 2PLKA 1IGSA 4MADA 1UG6A 4GC3A 1GOGA 1I75A 3W01A 2R0FA 1B3OA 3GBDA 4XBNA 1MUWA 4LBQB 1J0ZA 3LN3A 1U5IA 1NH6A 1UJPA 3VKDA 1O3RA 1SG3A 4CP9B 3OOQA 4US5A 3CO8A 2XBO3 4NHVA 3CDZB 4GLEA 3MCNA 4QD2A 5FMDA 2FVLA 4NPMA 4CN4A 4P5YA 2MEV2 5FIXA 3GBGA 4O50A 1IOAA 4YGDA 1T6MA 4KFNA 5D9PA 4MWAA 3VBHB 1BK0A 4QB1A 4YM0A 2RFGA 3HT1A 2JIWA 2YCJA 3BWWA 1Q6EA 4DJEA 3VD4A 4CCOA 3VDCA 3AWNA 2ATFA 2FYMA 4IMGA 1ZREA 5FCCA 5I8TA 2A0NA 1SBFA 2TAAA 3WBXA 5FAJA 4QX1A 4KRUA 1EAH2 4QU2A 4XDOA 1W6QB 4IGNA 5FYYA 3N36A 4AVBA 3VMOA 2ENRA 1KFKA 4NZ5A 4ZTXA 1SLCA 4C1LA 1JD9A 1V3MA 1E6ZA 1MEWA 3VCCA 1VB4A 4EE2A 1RUH3 3VCRA 5A8PA 4XYXA 1P1XA 2C18A 3E9AA 3S42A 5FZOA 3VB9A 5IBXA 3AIUA 5TF0A 3N9LA 3EO6A 4NIAA 2Q09A 2WDBA 1OFDA 5EWSA 3QHNA 4P7RA 1Q43A 2VDHA 4XSLA 4UNKA 4Y9MA 5FMCA 4CSWA 1BVP1 2P88A 4DZIA 5XIAA 2BPA2 1S1RA 4PL2A 1PK6B 4D6SA 2FLIA 2F6XA 2GDVA 2YBKA 4DUOA 3R8HA 5LA9A 5CGMA 4IXHA 3I7SA 4HCHA 3ZXDA 1H2LA 3R12A 4GWJA 4TQTA 4D6DA 4FCAA 4XUGA 4M6PA 5ENLA 3WQ1A 4U2ZA 5LGXA 4R34A 3IJQA 3PJWA 1XXNA 1DGWA 4CXWA 4HT3A 5I3HA 1D9EA 1KBJA 2MHFA 1R7OA 1KRBC 1WAWA 1V6IA 2OVUA 5K4LA 3LA3A 1A5UA 1EP3A 4FIQA 4QGNA 1EWEA 3PG8A 3LYEA 4GO9A 5C8CB 2DU0A 2DSKA 3TEZA 1V6TA 2ZHMA 2OELA 1V9U1 1PWMA 4K3ZA 4Q26A 3VZOA 4A21A 3RCNA 1XRVA 3ZFFB 2DUXA 3UVIA 1ZRDA 3CZUA 3NL2A 5IVYA 3NGJA 2JDYA 3LI1A 3SCFA 3VIJA 3OYWB 3IEBA 1JDDA 2J7GA 1AHSA 1YYAA 1ZTVA 4NAEB 1AD4A 3WVJA 3RGBA 1ALYA 2ZHLA 3SCNA 2V2CA 4F40A 5JBEA 2WQ4A 2ZE3A 2OYZA 4YG3A 1U1HA 2K2SA 3AL5A 4BEUA 2BERA 2UURA 1QRQA 1ACCA 1S38A 2WW5A 4PTDA 4O7XA 1Q85A 3EA3A 3LA4A 3LPOA 4JHOA 1QNYA 3SY1A 1XBVA 3T1GA 3ETQA 5HMFA 4WGXA 3TMLA 4CNPA 2I5QA 3U4XA 5FF3A 1N82A 5GQBA 1UU4A 4QROA 1DQ4A 4Q4X3 3KMHA 4JHTA 2E53A 5CYYA 2I2SA 4H8HA 2NMNA 1QXLA 4IPNB 5A6SA 1HFBA 4CDWC 1ISVA 3IK4A 3RYPA 3UXKA 4CU6A 3I3BA 1PZ0A 1F7BA 4RPQA 3MW2A 2QQLA 4Q4W1 5AC6A 1X98A 5FJPA 4BDVB 4CVWA 3G1FA 3D0JA 3VV1A 3G0UA 3VNDA 3BG3A 3SCVA 4UMCA 2CNAA 4W7VA 4UZUA 1SZGA 4XD3A 2JX9A 1WUEA 4KESA 3M0JA 1RUJ1 5FZLA 1VYRA 1C8NA 3TTYA 3OVGA 1HB3A 1UKSA 3VN4A 4ONVA 5C4WC 5JPMB 1OF6A 4JGYB 4TXEA 3N9PA 1DF0A 1ALDA 3USZA 4LVFA 3KEHA 2QF7A 4V1XA 4AWEA 4WX2A 3SZ8A 3IIPA 4JL2A 4GNVA 4P8WA 4GH3A 4XAYA 1LORA 2Q1ZB 3ZYIB 2VCAA 3AYAA 3GH5A 3WL0A 2NV2A 1CR7A 1MDRA 1AG1O 3WF1A 2V4VA 2DVGA 4MB4A 3USUB 1GKBA 2GOUA 3UP8A 1TG7A 2DWRA 1CGUA 1MVYA 3C0JA 4ISQA 1W31A 1R1A1 1YPIA 1EL3A 4IICA 5HJYA 5F3GA 3SJ3A 5IVFA 1KITA 5BRQA 3FEMA 2J1SA 3MDWA 4ZXOA 5E09A 1W1A1 2WNQA 3O9NA 2RAGA 2WOQA 5LZLA 2J1EA 3ILFA 4YNGA 1MFUA 4L4LA 2Z24A 1UZ0A 2AAAA 3OBRA 1UIPA 2VMEA 3HG5A 3M0ZA 4J2PA 5I3DA 4RHV3 2YL8A 3FAWA 4OI1A 2D1ZA 1LOAA 4U3AA 1OQDA 1WBJA 2J9ZA 1KKOA 3ZSTA 3T1LA 3SIZA 1QJU2 1GVQA 3UG4A 3UXDA 3WNKA 4S2HA 3TH6A 1RTVA 3UZZA 2EG7A 1GICA 4PCSA 4A3ZA 3S9IA 1UY1A 2BOGX 3H8XA 3GC4A 4ISRA 1RUOA 4AQ6A 3GC2A 1S2EA 2WA3A 1GK8A 4AVTA 2HZGA 1UO9A 4GB31 2RE9A 4WXYA 4PDWB 2GDQA 1CGVA 3ATZA 4AZCB 1WD4A 5IHRA 5JIUA 1EQCA 3GXPA 2WB5A 4DO4A 2BGQA 1VBC3 1C8YA 2OGYA 4NHYA 2HNHA 3DFYA 1KS5A 2GC1A 3R13A 3VKKA 5A8QA 1V02A 1RGSA 5EBUA 4AZZA 4ATEA 1AJKA 1P0BA 2GQ8A 3QV8A 3ES8A 5C9RA 4C1KA 3VBUB 2FHBA 1LCLA 3JBG3 2ZUMA 4XHBA 4BZ4A 1GYLA 2AQOA 2ZGPA 3AZXA 1XNBA 1TVPA 2BY3A 4WJEA 5HWJA 2BP1A 1W03A 1H8TA 3HG4A 4CQAA 4LFYA 2DIJA 3I59A 3NM1A 2GP5A 3ME2A 1QJY3 4C6MA 1YBQB 5EXOA 3H8RA 1LWJA 3DN7A 4FXRA 2YB4A 1RHI2 4E8GA 4O14A 2FDIA 4N53B 3NDOA 2Q5TA 3J8F1 2J1AA 2O9RA 4N02A 1HN1A 1W5PA 3WH9A 5FP8A 2F84A 3GU9A 3DYMA 1SJCA 1FCBA 4X2PA 4DWSA 3RZMA 3I2JA 3VDAA 1NCQA 1UWQA 2VD9A 5DUXA 1JYIA 2VZSA 3WHTA 1PVC1 1L7QA 4GALA 3EX4A 3O8AA 4Q4V1 2K46A 3FJNA 2VELA 4YVSA 2HWE3 7REQA 1DYKA 3GG7A 3N9SA 5J36A 4NAOA 2G41A 1QI2A 3EOSA 4GCXA 1ITQA 5BNPA 2GK1B 1LCOA 2OYLA 1DDLA 1WBFA 1KFWA 5AOUA 4JX0A 1FH7A 4AC7C 1YQ6A 3QMSA 9RUBA 4HSOA 3ITYA 4IXLA 2PI6A 1EP0A 4J1WA 4AG4A 4WJXA 3EHKA 5H9RA 1F31A 3WKZA 4ICNA 3W28A 1GUVA 1Q6RA 4IG2A 5IFTA 3VDDB 3V0BA 2A3EA 1FWFC 4LY8A 1E71M 2GYIA 1B4EA 2ACSA 5K3VA 4FR6A 3UERA 1SLBA 1IIHA 2YCLA 3H2NA 4YS1A 2IFRA 2FQPA 5D8AA 4BE3A 1OT5A 1HV0A 1NCRA 3PPHA 4IP4A 4GZEA 1SHWB 3S0MA 4XTIA 1GPWA 1Z8AA 4DN1A 2JE7A 3VBFB 3QRHA 3HG3A 1TUXA 3T42A 1UH3A 4B90A 3POIA 1ZBWA 1GKQA 3ZFEC 3IPWA 1H49A 1ASJ1 5L36A 4W5UA 3M0XA 1LKNA 3HTWA 3R89A 2A7RA 3VBRA 1S5NA 1T6BX 1HXJA 5LIKX 3HB9A 4POCA 2A70A 3WCRA 2YKKA 3G3MA 4JEQA 4LKDA 1V79A 3VUPA 3AS3A 4K21A 4AX7A 4HP5A 2IW0A 4GGHA 5F2MA 1Z7S1 2WSKA 3LPPA 1DIOA 2ABBA 4QE5A 3WENA 1K9TA 3SY5A 3CWNA 3LQCA 3JVAA 4W9TA 2EGZA 1S2TA 4YHGA 3LNMA 2YB7A 1ZBA1 1Q8VA 2NXGA 4XG1A 5FJRA 1AW5A 3WEOA 1W8OA 1WZLA 3H55A 2E5CA 4AF9A 2WMIA 1OURA 2VOWA 3D5HA 4RR3A 1R8LA 2LTNA 2Y6GA 1M6JA 1VIWB 3WYZA 1ZAIA 3F4VA 4YL2A 4FTEA 1FWBC 3HGOA 3CB8A 4LEQA 1AL8A 2WJZA 2QPSA 3AAMA 4S3KA 4M8UA 1XBYA 1JFHA 5CCZA 2Y2WA 1R3WA 4OBTA 1ICSA 2CBJA 1XLAA 2OT1A 5F2SA 4DNYA 2FDGA 4B16A 3E6BA 3F2ZA 1BKZA 5AKQA 2PDQA 2DUQA 4DUVA 3O16A 4ZONA 3D6NA 4H9TA 4XJ8A 3GG0A 1ADDA 4GNKB 3KP1A 3UYIA 4AD0A 1V9U3 1JZ8A 3ZXLA 4K7VA 3OPTA 5EHDA 1SZFA 4D3WA 2EXJA 2X0SA 1D0HA 2JJ6A 2ET1A 4O1FA 2XKPA 2YPJA 2FVKA 3DYOA 1U5HA 1GV9A 5JPNB 1MS1A 1RUE1 4BYYA 4CP2A 1M53A 1S2VA 2JQXA 1Q5OA 4QAWA 2YXSA 2XG3A 4FNQA 1BAGA 5ABJB 6XIMA 1WKFA 1K03A 4COUA 4FXJA 1A5SA 4FPJA 4S2BA 1WLCA 3LEMA 3AISA 3CHVA 1TV8A 3H2CA 4KH9A 4HN0A 1IT8A 2ZEWA 2QCDA 3FLPA 3DFOA 1B35B 3WUFA 4KWOA 1SMAA 4PBPA 2V63A 1RUI2 1UWRA 3LCLA 4PLNA 3ALFA 4DPNA 1QWKA 4M01A 2CDPA 4QKNA 3TA9A 1KBIA 3N2XA 3WEZA 5JQ9A 1Q6CA 4NJJA 3GTXA 1A4LA 3W86A 5FZDA 4PGLA 1F9CA 4YSFA 3LX9A 4EN8B 1RUG2 1T8QA 4BQ1A 5FSDC 4Q4W3 3TJXA 1LBFA 1Q2RA 1E0XA 4LV4A 3T2QA 1F6KA 4LUKA 3THDA 5GNYA 1Q6DA 2FH8A 2BODX 1SBEA 5L7OC 3MMUA 1N3PA 2JG8A 3LU2A 4JQ4A 4YXGA 2XN1A 4M51A 3SRDA 2VMGA 1YHTA 4JS3A 3A0NA 4KWSA 4C6PA 2WZTA 3BW4A 2DGAA 4AZ7A 4TO8A 1ONAA 3F4CA 4MLRA 1DWIM 1OLRA 3LZ5A 2TPSA 4XILA 1GONA 3HGRA 1NE6A 4UNIA 3QVQA 4CD5A 1WX0A 1P7TA 4AY1A 2OT7A 4DY5A 2ZX5A 1WA4A 1LU1A 4GX9A 1U33A 1LOGA 5F6KA 3DF0A 3N3HA 2C6QA 3SN4A 2DZWA 2EAWA 4ADSA 5HUOA 5CJNA 1SR0A 1W1IE 1VAVA 4KS0A 3V18A 4L0PA 4DOUA 3IIZA 4IEWA 3OEBA 4ZO8A 3ZVHA 2DPEA 1QTWA 5K4ZA 1LAJA 4JDNA 1EJRC 2Y88A 5D37A 1E0VA 1D0GA 4YM1A 3LEKA 4B4PA 3E5UA 1IS6A 1R1A3 1RUH2 1Y65A 4FPHA 3DXIA 3O3RA 5F7UA 2XJPA 2CGPA 2OPWA 1KDKA 1XLIA 5I79A 3IIOA 4QG8A 3D6EA 4L1WA 3WMCA 4AQLA 1G4EA 3VD5A 2XH4A 3WLNA 4TN7A 3PUGA 5FP4A 3UJOA 4UTFA 4O8RA 2XG9A 4Y33A 5BCAA 5JR2A 3ARPA 5BXXA 3VZKA 5G1MA 4LYQA 3UZYA 5FY9A 3NVDA 1OFAA 1EP1A 2YIHA 4AD3A 4DPPA 2TSYA 5CLWA 1KV8A 1IQAA 4C5YA 3WMLA 3H50A 3H1MA 1CW2A 2V5JA 1E9LA 2YR1A 4LUMA 3TSMA 1UUQA 1HQWA 4MAVA 4AIOA 4DJFC 3STFA 3DN5A 1H61A 1AUSL 1PZ3A 3DKQA 3VBOA 4BM8A 4UT5A 4BHPA 3KGZA 2CLEA 3F1QA 5D9OA 5MKGB 4GB33 5FP3A 1M9HA 4IESA 2V72A 2UZ9A 1KM5A 4L4OA 1U0AA 3QFEA 4ZOBA 4ASLA 2PZNA 3SRHA 1QAPA 1YTEA 1BYCA 3O7UA 2D0FA 2FDKA 1G5AA 1WPCA 3T09A 1MS9A 2VI0A 4NRMA 1TCMA 4S3CA 4Y1XA 2DJXA 2D2GA 2DVUA 5DDJ1 1SZNA 4HZ8A 1H7WA 4FXFA 4OQVA 4B1LA 3DUIA 1YNQA 1X1OA 2F38A 5AB3A 5CU1A 2ZGTA 5FAXA 3M70A 1W3VA 5LSMA 2D43A 3UZJA 1Q6GA 3J8F3 3HPSA 1RXFA 3SR7A 4C1NB 3ABXA 4J27A 2W39A 4KCTA 5D33A 1FDJA 3MLLA 4NUWA 1DWJM 3IRDA 4DIAA 2ZS6B 5FDBA 4Y26A 1V00A 3VIFA 1PVC3 4Q4X2 4ASKA 4ZFCA 3LOIA 4Q8TA 3SLIA 4Q4V3 1CJDA 2XDVA 1Z41A 4IV3A 1V70A 4W5ZA 3GD6A 3JXSA 3BO9A 4WCJA 4C6KA 5ECVA 1WKYA 1ITUA 4AFDA 3MUZ1 2DZBA 1AQMA 4EZHA 4LSBA 2O92A 5FYUA 4LVAA 3U5UA 2J8GA 4N90A 4BQ4A 2W6RA 4ACZA 4C8DA 1ME7A 4LO8A 1C7SA 5FEWA 1UY4A 4QSHA 1YXYA 4A3HA 4HMEA 1MZFA 4YYCA 3IANA 3O6YX 1GP5A 1A4MA 2A71A 2BGCA 1YE6A 3H23A 3ZPYA 4OMDA 1HV1A 2QUNA 2C0HA 2WZPP 1X1ZA 4XZ9A 5FZ0A 3V56A 1R64A 2XINA 4GQRA 4NHKA 2FHRA 3RPTA 1UKGA 1D7PM 2GVEA 3MI2A 2INEA 4CEUC 1EJSC 4E2OA 4MX3A 1EIBA 5CC3A 4BJ0A 4SBVA 3LRKA 1G9CA 4PF1A 4RV3A 4RKAA 1ISXA 2RS12 1KC7A 1HO4A 3CTLA 2R1LA 1W2AX 5E16A 2WNOA 3CM4A 3BU7A 5FZ1A 5F32A 2XIQA 5GM0A 4E2SA 1V6UA 3GXFA 1GQLA 3IJ9A 3M7SA 2HH9A 3DG7A 4YHEA 1UZ1A 2PDMA 3ARRA 2VC7A 1FDYA 3KS5A 5C55A 4ORMA 3SGGA 4AI0A 3M41A 1NQDA 4CDWB 2V69A 4X2RA 4Q0PA 3SHRA 4KEMA 4DF2A 4H7LA 3UG5A 1R1ZA 1ASJ3 1H6XA 3H70A 3VYLA 4RHV2 4GI8A 3PZUA 5I78A 3OVPA 3WLQA 3W38A 4YW1A 4UQCA 2D98A 5EIYB 5F5AA 1AA1B 3C52A 1R9ZA 1DHKA 3UA4A 2G9GA 4OI0A 1GVRA 2FZBA 4DXVA 3I6RA 3C8FA 2P6HA 3UFYA 1SJBA 3ZVIA 3S9ZA 3ZYHA 1Z7S3 4K37A 4QJ5B 5C2CA 3URNA 3NPWA 3B8SA 5C4WB 5DZGA 2QDRA 5C3RA 3I7DA 5CPOA 2HBVA 1IXOA 3WSUA 1K1DA 2WZR2 1ZBA3 4JIHA 2DTYA 2Y8KA 3UKTA 3ZPOA 2G3MA 4MZUA 4WM7C 4RDZA 3N7LA 2RDNA 3GCWA 2OTDA 3B8VA 1UY2A 1OFPA 2F7FA 2BBAA 3BOPA 2WNVC 1WNOA 3A7QA 3VNLA 2G19A 3BGGA 4RS5B 4RW3A 1S46A 3KX6A 1Z48A 4GUGA 3OBTA 5A69A 4MZ8A 1WDDA 2ZRYA 1WW4A 3JBG2 4YM3A 1OLQA 4RZ6A 4QS6A 4NI8A 1EX5A 3P3PA 3T08A 1WYIA 2E6FA 1RSCA 2Q71A 3WL1A 4H9MA 1PB0A 4JX4A 4PQQA 5AYYA 1RLDA 1BK1A 5JR7B 3WH8A 1V0NA 2XSXA 1CXHA 5C9AA