4UFMA

Mouse galactocerebrosidase complexed with 1-deoxy-galacto-nojirimycin dgj
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
644
structure length
640
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
total genus 207
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ufmA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ufmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ufmA01
3FKKA 1T99A 2QCHA 2X30A 3AHTA 2DZWA 1TQXA 4UQ9A 1F5ZA 1DORA 4UOQA 4JDBA 2EJ1A 1VRDA 4DO6A 2RKXA 5LA0A 4QFUA 4HXCA 2ZTKA 4GFSA 2Y7FA 2YL6A 2J7FA 2ZXDA 5DO8A 5HXMA 4UCFA 3NPVA 1YXYA 4GXMA 1VPXA 3WK1A 3PTMA 3CUFA 4ZFMA 3ARVA 4PTXA 4O0ZA 1TYGA 2DPEA 2A0NA 2V9DA 4C7FA 1ISXA 4TIMA 1J4EA 2ZWYA 4UC5A 3GKFA 1ZNNA 3P82A 4WQ6A 3NL2A 4N02A 4JTGA 5C2XA 1W56A 4UTIA 5D9PA 3ARSA 3N2MA 1JULA 1JF6A 4RE3A 1ZJBA 3WD0A 3PSVA 1LF1A 2OMAA 2P0OA 3IJ9A 2X09A 4UQEA 1UYQA 1H7PA 2PRHA 2YGYA 1VBRA 3BARA 4N9BA 1C91A 1GEQA 3MKKA 3FA5A 2C15A 1TB3A 3NQ8A 4LS1A 1GYNA 1MYRA 4H6KA 1KTBA 1ZU8A 5CGQA 2C0HA 4Z1CA 5EFFA 4TVCA 4ACZA 2VELA 3KVJA 3PZVA 5A2BA 4LV4A 1QNVA 3O06A 3AISA 2AMGA 1SZEA 2GK1B 1QHZA 1WP6A 2J78A 4Z2GA 3A21A 3YPIA 3N12A 5MHBA 2FFCA 2FLIA 3GX9A 2YL8A 5CZTA 1GVQA 4JIPA 4Z2KA 3M0ZA 5E6ZA 1E6SM 4UOZA 4ZQCA 4C7GA 4J3SA 2GQ9A 2RFGA 3TH6A 2XQRA 3GNNA 3TV8A 3MW7A 4IXHA 4XUGA 5K9DA 1E1FA 4TVDA 2C13A 3PG8A 5A6BA 3M07A 1PHWA 5LHFA 4MTVA 4PMVA 3T09A 2EHHA 2OT1A 4MLJA 3QW3A 5F1VA 2G8ZA 3PZQA 4FNUA 3UCQA 2J27A 1U33A 4PTMA 4W8AA 5M03A 3W87A 1WPCA 1E4MM 2GFTA 1MVYA 3TSDA 3F4NA 3T55A 1FCUA 3QMTA 3W7LA 4OUEA 5FK8A 1VENA 3WD1A 4KRTA 5H2ZA 2BY1A 2BVTA 2NW0A 3PBWA 4GJ1A 5D2XA 3T7VA 4N9CA 2G3JA 3WELA 3UG3A 4PSPA 1IXQA 4S3KA 3D3AA 2WSRA 4MY1A 1MW1A 3KHJA 1KWKA 3NPXA 5K9XA 1TV5A 1XV8A 3RDKA 3LHZA 4FXSA 3DI0A 2RGMA 4J3WA 3S1VA 2ZRVA 1F05A 1KM5A 2Y62A 1HJVA 1B1YA 3WQ6A 2BWGA 1IXOA 3K30A 2E8YA 2WMIA 4O18A 4POCA 1VJZA 1J11A 4ZE5A 3GLCA 4FLSA 4M81A 4LGXA 1FFQA 4RXGA 2YKKA 1UWSA 2DSVA 2E0PA 1NOFA 1J2WA 4JR5A 1A3HA 3B06A 2BXZA 5FF2A 4GUGA 1N7KA 1R7AA 1P6WA 1DQXA 3BPWA 4HSNA 2WLZA 3BO9A 2YJQA 1CGTA 1KR1A 4CQ8A 3MHFA 1V3HA 3CO4A 2PE4A 3MUXA 2QEZA 3VNYA 1I2PA 4JXCA 3BAKA 3MHGA 3VGFA 3WNNA 4LYQA 3VTRA 1BAGA 2X05A 5A6LA 4WY0B 3LTPA 5FF4A 1GOXA 1H1NA 1SMDA 4HOZA 3FLUA 3RFAA 5I23A 1LQ0A 3OGVA 4U5IA 5CPSA 4XKYA 1KGWA 5D9NA 1AG1O 1Z42A 3VIKA 4K39A 1MW3A 2ZYFA 3PF3A 1H1ZA 4O28A 5FEPA 2C6QA 4DELA 3O6AA 4ZE4A 4L4MA 3M9YA 2O9PA 4ML4A 3GR8A 5I77A 3AXIA 1W9VA 4JY9A 4B9ZA 3MMTA 3WK3A 5HPCA 4QQ3A 2EPHA 1TPDA 4BF9A 2DZUA 4DWSC 1V02A 4RR4A 2WKGA 3MS8A 3WUBA 1X1ZA 3EX6A 4M7SA 5LA1A 2GJNA 3VVGA 3C3NA 1E0VA 2XVGA 3AS1A 1DBTA 5CG7A 2DSZA 3SIMA 4JIQA 2VOMA 3U14A 4UZUA 1NF7A 4AMAA 2JEPA 1JNEA 2J9ZA 3C2VA 4A3YA 4E8CA 3MSGA 4FEZA 1XC6A 4QHZA 1HN1A 4B5NA 5AN7A 5KZDA 2V5DA 1DWIM 3AMKA 3C2FA 2CXGA 3N9KA 3DHPA 5KSWA 1ZFJA 3I7RA 2P10A 2PURA 4PTNA 2WMJA 4HA4A 1Q4NX 2J4GA 5E70A 1VFMA 1KLYA 3Q94A 5A2AA 1CDGA 1JZ3A 1WBHA 3RM4A 3DZ1A 2C16A 4GPNA 2H8ZA 3EX4A 1EDGA 1F4AA 4N2YA 3GH4A 4GO8A 1IGSA 2GVGA 4PH6A 1HKKA 5DEZA 3UG4A 1TTQA 3U2OA 4QM1A 4AB4A 1WDPA 4BWLA 1BG9A 1PIGA 1C8VA 3CZLA 3LPOA 4W7UA 2Z1SA 4GQRA 1H51A 3NQ6A 2E5BA 4O4VA 1GQJA 3EKLA 1RPKA 2FTPA 3LIHA 1W3KA 3VD5A 4A3UA 4P7NA 3ARWA 4V2XA 3HJZA 2XYLA 5KZMA 2QMKA 3L4UA 1FH7A 3WK2A 2J7GA 3W7EA 1L9WA 3KRUA 3M41A 4R53A 1OFAA 4WZHA 3W76A 4NRRA 4B15A 3M1ZA 2ZZ6A 4IMCA 1SU5A 3TXZA 3DENA 5ABEA 3H54A 3LHTA 4MB5A 3L68A 4UTUA 1C7SA 2JK2A 3W29A 3LCFA 4AW7A 1EQPA 1LM1A 5A6SA 5DY3A 2Y85A 1ISVA 1GQNA 1NEYA 4JTSA 3WF3A 2JFEX 3RF9A 3MUIA 2CESA 4J3VA 4UTJA 4R27A 3LF7A 4QJ1A 2WCAA 3QGVA 3ABSA 1LLWA 4ZL1A 4FLRA 1IIHA 1RQEA 2UV8G 3ZJKA 4EIVA 1BSIA 3PSWA 4IOTA 1CGYA 1KFKA 1Q6LA 2C1HA 5T26A 1OFOA 1L6WA 1V6WA 2QMJA 1UKQA 1CTNA 2VRQA 1F76A 2HTMA 1Y0EA 3W7MA 1C8XA 1DTUA 1FP9A 1SFSA 2BHUA 2W92A 4O0KA 4MB4A 4QLLA 3VDHA 3W7RA 5CSUA 2H3BA 1WCGA 1MXDA 1NM9A 1QOPA 4A22A 1BVZA 1KXQA 1V6XA 1B31A 4U28A 3ALFA 2C3ZA 1L2UA 3VMNA 3WF2A 5IM51 4GI9A 3LCGA 4B1MA 3W2JA 2BS9A 4O50A 3EX2A 4I7VA 3HMCA 3MI6A 1Q6RA 2WM0A 3UNDA 4B16A 5AYYA 5CSSA 3F03K 3U57A 2YW3A 2PF0A 3FW6A 1CBGA 1OK6A 3LHWA 1OGBA 1JQVA 5FEZA 2WMKA 2FB3A 2VXNA 1US2A 4IUGA 3GBEA 3MANA 4UUIA 1FWNA 2R94A 1J0KA 2ZRUA 1Q6CA 2WC7A 2NUYA 4CQ9A 3LLDA 2WOQA 4LC8A 4UNKA 3AYRA 4TMCA 2BHYA 5BXRA 3G0XA 1E5JA 2E8ZA 8TIMA 1R85A 4MB1A 1MEWA 5BWFA 1LL6A 1VB9A 3TR2A 4PRWA 5C8BB 4LNYA 3STGA 5M17A 3UG5A 3VUPA 3IJ8A 1TTJA 4ML9A 4URIA 3A47A 3BAYA 4B3LA 1OFDA 2CW6A 1F7BA 1IF2A 3OVRA 1QDSA 5A69A 1XBVA 4LVDA 5LZLA 1JL8A 1OGGA 1ICSA 4YLWA 4P2VA 1O94A 1GOWA 1V08A 2DU2A 3N04A 5F4XA 2W61A 2H8XA 2C7FA 1HO1A 2Y88A 3VGDA 3A9IA 3QQ0A 1KQZA 4O1BA 5A8PA 3K46A 3F5JA 2GUUA 4PMDA 4M80A 4UFMA 5F1UA 3NPWA 3BW2A 5F4SA 3EMZA 1G69A 1KW1A 1W3HA 4P7RA 4Z08A 1YTKA 2CLKA 2JIEA 3ZMRA 3KRSA 1E70M 3FHAA 3STCA 3A22A 3CEPA 4HKPA 3S5NA 2VURA 4M7TA 1E43A 4GI8A 3PS7A 2QCDB 1HKJA 1GCYA 4M56A 2JF7A 3LFIA 1T0OA 1NAL1 2CIPA 1TPWA 3DFSA 1XD0A 3HIJA 1C93A 1PX3A 3W2LA 3WIJA 1JZ4A 1K3UA 3T4CA 1VZWA 3PWAA 1XSKA 1W1TA 2RGLA 4NRSA 3LXAA 2VVSA 3E49A 4D6DA 4JEQA 3NNTA 3SSJA 2DH2A 1GJPA 1GORA 1OYAA 2XN0A 3DFOA 3G3DA 3AOFA 2UY2A 2KZHA 3P81A 4JDYA 1C90A 2ZWZA 3O8AA 2ZZ7A 1TRIA 1YYAA 1GQLA 3EDEA 2QJGA 3LPFA 4WLCA 4UXDA 5CPTA 3WF4A 3ZQ9A 1ZBKA 2ABBA 1M7OA 1FDJA 1RP9A 1CW2A 3L2LA 1DL3A 4YL2A 1LRNA 1LYXA 3AICA 3PZUA 3M16A 3QHOA 1SSDA 5AHMA 4IPNB 3L2MA 5JIWA 1SZGA 3HPXA 1UD3A 2WB5A 2NLIA 3M6DA 3W7HA 5G2IA 3TJLA 3HO8A 1E0WA 2Y70A 1EOMA 5CGMA 1ICPA 3TDFA 1TCMA 1E51A 2ZE0A 1W54A 1OIMA 3ZR6A 3ANYA 1W5OA 3L66A 5LHEA 4P7OA 1LTDA 1NWRA 4W93A 1A50A 1KXVA 3TK7A 4A2RA 2W67A 4XZWA 1G9HA 5DT5A 1GPWA 3WH6A 4MZYA 1ML1A 5HWMA 1JDAA 5C55A 2YFOA 2BXVA 3EMCA 4W5UA 3L65A 1EWEA 2GQ8A 3SECA 4H8VA 1CLVA 2J24A 4WY0F 1GOIA 3MWAA 1VAHA 1ZBVA 2D3NA 1BG4A 3NQCA 4WKFA 1UZ1A 4H8HA 4Y7EA 2GQAA 3NQDA 3ZSTA 3WJZA 2UY5A 3DBPA 3G8RA 4O12A 4PCTA 2EEXA 4CCEA 5AYXA 1EUAA 3SCVA 4CGTA 3WDIA 2XM1A 3EWWA 2ZZ2A 1GOMA 1KXHA 2X0HA 4QLKA 4PEKA 2YDSA 5KZ6A 3FN9A 4FF5A 2QR6A 3BLPX 5LGXA 1TFVA 3NZRA 3W2NA 4YWIA 1SQ7A 3O15A 2X1UA 4LYPA 3TTQA 4Z0SA 1F74A 2Z6IA 1H2JA 3WDRA 2V5CA 1NF0A 1GZJA 4AH7A 1QPKA 3EWXA 4GKLA 3W53A 1GOQA 4S3JA 3MBDA 2QCLA 4AD4A 1QFEA 3ZJ7A 7A3HA 2B7OA 2QDGA 1JFHA 1HL8A 2W6RA 3U75A 2QCFA 1X6UA 3FAWA 1CI1A 3MUY1 4YCPA 5A8QA 1QNRA 3CQ0A 3WNOA 3DI1A 1QPQA 3WNPA 3L2IA 4WSKA 3LTSA 5KZEA 3U5UA 1W2PA 4ZEPA 1KWGA 2CLLA 4IGHA 4WKHA 1OHLA 3GIYA 4ZQOA 3E02A 1H11A 3VM7A 1GT8A 3IMMA 4M19A 2D1ZA 4AIUA 3W83A 1RVGA 3RJXA 4K8HA 4F8XA 1N82A 2F2HA 4UNLA 1TRDA 1JDDA 4HNTA 2EQDA 2J7DA 2WHKA 2J9XA 2ZRWA 1CX9A 3BVJA 1K02A 5DY2A 1XBZA 2E4TA 4TX8A 2NUXA 3ARPA 4LUIA 1JI2A 3NQ2A 2XIBA 3RCNA 2DJXA 3U8GA 3SIZA 1I75A 1TE1A 3S5ZA 2E9BA 4O1DA 1VC4A 3DFQA 1PCKA 3G0SA 4S1FA 1TCDA 3T2QA 3W7NA 3SUSA 3FYPA 4P8WA 2J75A 1SO5A 1FHLA 3OB8A 4HZ6A 4ALDA 2QJHA 3GNRA 1A5CA 5U7SA 1EP1A 1K9FA 3U5YA 3ZR4A 1L6SA 4XB3A 5BOOA 2IQTA 4JKKA 1E4LA 3ARXA 5L6UA 4D2JA 4WK9A 1AK5A 2VNCA 3UWQA 1BF2A 1UA7A 3S2CA 3W1XA 4FMVA 1W5QA 2ZBTA 3CHCA 4NZCA 3VPLA 4WXYA 3NUKA 2TSYA 3CIWA 4W9TA 2B31A 3RNDA 1E3ZA 5EKYA 4Z2JA 1CGVA 3V75A 5DT7A 4AISA 3LRLA 3GAKA 5KMYA 4MDPA 4OZOA 2DQXA 1UKTA 5D8ZA 1WKYA 2AEYA 4H4IA 1L8NA 3W1AA 2GJLA 2QUTA 1LBFA 3ABOA 3UPWA 3PBYA 3C0JA 3W7GA 3G6LA 4UFLA 4ZZ9A 4TXEA 2O92A 4MLRA 3EDFA 3CUHA 4AC1X 2CHOA 2VFIA 3GKAA 1C8YA 1TVPA 3KE0A 4P7QA 4ACZB 4D71A 1BPLB 3KAOA 4NT0A 1E72M 1AL8A 4TMBA 1QI0A 1WZMA 2WHMA 5GNYA 3TJXA 2TRSA 3ABRA 3B0PA 3NAVA 5DXYA 2FHCA 3TQ0A 5I3IA 2YL5A 3I3BA 3W28A 5DCDA 3THAA 1AQMA 1KFJA 3MSDA 4K38A 1SR0A 2ISWA 3L67A 3GK0A 1XDMA 4GC4A 4CKQA 4JFUA 3KZSA 1C9DA 1S5TA 4NQ1A 4DWSD 1B9ZA 1BYBA 3LTYA 4WF7A 1E73M 4V27A 3UZJA 4IM4A 3EX1A 1TQJA 2DDXA 5A8OA 3H3LA 4AZZA 1W91A 5DN1A 3VIFA 3BGAA 4RZ6A 4NX5A 3HGRA 3L5LA 4UTMA 3DKJA 3WNMA 1X7FA 2TPSA 3PBVA 1GVOA 1OD8A 2WHLA 1J0HA 4QCEA 1KV8A 4K68A 3DXIA 1JCMP 1NQ6A 3WD3A 4NJKA 3N2XA 3P80A 2J47A 5A6BD 1LWHA 4S2CA 1GQIA 5JIPA 2XHYA 1W3JA 3C2OA 1W1ZA 3POHA 2H3DA 1AW1A 1DWFM 2VC6A 4F79A 3NG3A 1W2VA 1G4EA 2CHNA 1JUEA 4WKAA 1OFQA 2IUZA 2QCGA 1RP8A 1D2KA 3CZ8A 1VCGA 4JTFA 3HPSA 1A5AA 1CXIA 2RDWA 5I2UA 3LI1A 3T44A 1QOXA 3PG9A 4BFAA 1EO5A 1D9EA 3OZPA 2VFDA 4PMNA 2F7FA 2FIQA 3W1PA 1KBKA 4EQVA 1LOSA 5D02A 1BKSA 2PC8A 4CU8A 1VYRA 1PIFA 5BRBA 3WDQA 4AHQA 1E4NA 3A3HA 3SCRA 4ATLA 2RDUA 1KFBA 3CU2A 1W1YA 2PWDA 1TZ7A 3GH7A 1FH8A 3CH9A 5EBAA 5FMBA 1SUXA 5D03A 1UCWA 1OFBA 1NWTA 3VE7A 2WKJA 4U33A 1MWOA 1NWUA 4PTWA 3VMOA 4JICA 4OOUA 3WENA 2A6NA 2QUVA 3LBMA 4Q32A 3VI2A 1MXGA 3QW4B 1H1YA 3DC0A 3O2LA 1TV7A 2OLHA 3F1QA 3SCNA 4ATWA 5BCAA 4DUXA 1GVSA 2YLLA 3LPPA 4W7VA 1LLZA 1OX4B 1WA3A 3E9AA 5M5DA 1A47A 2PC4A 1B3OA 2ATMA 3G1AA 3W6LA 4BQ4A 2QQWA 4Z1AA 2Q3OA 3G1SA 1HKMA 3ZR5A 3EWBX 1HVXA 3WJXA 4BI7A 2E40A 2WVTA 2Z2UA 3A23A 4ADUA 1EA9C 2WC3A 5ECUA 4ONVA 2XSBA 1NP0A 4KGLA 3LCXA 3LV5A 4OJYA 4IPLA 5FKBA 4XTIA 1G4SA 2CLEA 4GUFA 5G1YA 1XUZA 2DSUA 1MQPA 2DP3A 4JGDA 1O60A 5D09A 3W1LA 4TU1A 4DUVA 4UTTC 4PUEA 1HO4A 3HGJA 3W1MA 3TXVA 4J28A 5EA9A 1GQKA 2QQVA 3CPRA 4QAIA 1PPIA 4D6FA 3GNDA 3UR8A 1HKIA 5JBEA 3W1NA 2QV4A 3PTKA 3VCRA 3WNKA 1WB0A 4JYFA 4N9EA 3TW6A 3NM1A 4LQ1A 4JTJA 3S5YA 3N34A 2QCMA 2OCZA 4JTHA 3T2PA 3THDA 1HJWA 2ABAA 3BLKA 4UR8A 2WQPA 3W23A 3B0VC 1TA3A 3E12A 1H4PA 4HA1A 3L4WA 3CM4A 3AIUA 3GM8A 4IMDA 1SZFA 1W32A 1YXCA 3W4RA 3JUGA 4LRTA 1X1OA 2ZQ0A 3TMLA 3LCHA 5DXXA 2HISA 1VQTA 5KEZA 4D6GA 2QJIA 3I7QA 3G1HA 2QCEA 4HN4A 1WDRA 4AZCB 2GPTA 3FJ6A 2VCCA 4E4PA 1JZ8A 2QF7A 3FJLA 1ME8A 2VFGA 5K9CA 4AEEA 2GJRA 1K9EA 2D20A 5E0CA 5FKYA 1WQ5A 3ARYA 3CTLA 4PMZA 3PULA 6ALDA 1ODUA 2ZA1A 4A29A 1KFWA 2OJPA 1ITCA 4NJJA 3C6CA 8CGTA 4EF9A 2PI6A 4PEEA 1FXPA 3O6CA 3N73A 5CSRA 2CBUA 3VD4A 3VE9A 3S42A 4DBEA 2F8QA 3P62A 1JGIA 3QQ1A 3DHUA 4PCFA 3B9EA 1SO4A 8A3HA 2OYKA 4CD6A 1SPQA 3NQEA 4FNSA 3LIGA 4MZ8A 5EPDA 1QW8A 1I2OA 3FHQA 5IFTA 1HNYA 5LSMA 2JE8A 2J62A 1QO2A 3UPBA 3A4WA 4D6JA 4PMXA 3O9NA 1CXEA 5AYIA 1ZJAA 3WEMA 1XCFA 2OT0A 1YHTA 1V0KA 4JKLA 4FFHA 1FWWA 3TOPA 3K8LA 2VQTA 3BCFA 4JTIA 2VOTA 3EYPA 1HF6A 2C14A 1JNDA 1OM0A 3SURA 1MXSA 1FCQA 3UD6A 1HJXA 1M5WA 3GDKA 3VX1A 7CGTA 1MZHA 3MI2A 1DHPA 3EXTA 1I4NA 1HVQA 4HIBA 4A3HA 2JF6A 3KL3A 3NVTA 2VJXA 2XVLA 4DM1A 3CUGA 2A3BA 4H7VA 3VFLA 4YHGA 3VIIA 1GVIA 2A7NA 3SCPA 3MHUA 2V3DA 3OA5A 3UZ5A 3WEOA 4BS0A 1O5XA 1XRVA 4EF8A 2QPUA 2NWRA 1H7NA 3MMDA 2ATSA 4M6QA 3NQFA 2CNCA 2CPUA 4N4PA 3G6MA 4AD3A 4JZ5A 4HZ8A 5HOSA 3G1FA 4N6FA 5E6YA 3TE9A 3ZT5A 2V2CA 3BLEA 3O07A 4W87A 5A5WA 1MQRA 3S6TA 1E5NA 3GR7A 4YMZA 5AFDA 1OFRA 3NEVA 4H2CA 2QAPA 4LX4A 5L9FA 3NYDA 1ZJIA 4IJBA 4TUFA 1DWAM 1AMYA 3RILA 3GZAA 9CGTA 5K2ZA 2VZUA 4K36A 3TQVA 3I3EA 4YN5A 3CEUA 5HJLA 4TTGA 1PCWA 2ZA2A 1H62A 1OABA 4RKAA 1ODZA 2YSWA 3CUJA 4M82A 4LVAA 2VEIA 1JUKA 1KBJA 1ME9A 1BGGA 1QI2A 2YIHA 4PMRA 2XG9A 3R8RA 4BI5A 4OBTA 3RLVA 3NL6A 1SYTA 4PMQA 4FXRA 3A6OA 3AHVA 1JG9A 1R2TA 3W37A 4TOQA 3IIPA 3CPUA 3W7CA 4CD5A 1K9TA 3P67A 1AL7A 2X2GA 2YX0A 4S2BA 1FUYA 5C6MA 3PZ9A 4Z2LA 2OSWA 1O7AA 2YR1A 1W1VA 1YDVA 4PSRA 4RE2A 1IT0A 1NFBA 3M46A 3UEQA 3PUDA 3BSHA 3ZO9A 4AMCA 5A8GA 3KRZA 3G24A 4CNOA 3NSNA 3C52A 3IRDA 1E9LA 1PZ3A 3GXIA 1EX5A 3EMQA 3EWYA 5CXPA 3IVTA 3DHDA 4LW7A 3W2MA 3L0NA 3W81A 5FMDA 4FFGA 1H0IA 1NWSA 2VKZG 3IAQA 3L4ZA 4MYAA 2YXGA 4J3UA 4UTFA 2NX3A 3GXPA 2VX6A 1H50A 1L0PA 4E2OA 1OX4A 3EEGA 5BW6A 2YYUA 5IBXC 2YCEA 4H3DA 4HNUA 1R2SA 2AGKA 3Q2DA 3TAKA 4JQTA 4M6VA 5LGZA 1CGWA 1QNPA 4LYRA 3EX3A 1PS9A 5HUPA 2VVNA 4P7LA 4PUDA 2B7NA 3G18A 1ZB5A 5BRQA 1E4IA 1VH7A 1W3LA 3HPZA 1J01A 3FS2A 1XBYA 1H7RA 3AJ7A 3QPZA 1Q6GA 5C54A 3CBWA 3KEHA 5KTLA 3NDYA 2YOCA 1DJQA 1ISWA 2E6FA 2WVUA 3WF0A 4IUOA 3SUTA 2DSWA 2ALDA 3L4YA 4GI6A 1ZS2A 2ZICA 3FFSA 7TIMA 1TVNA 1VBUA 3WUEA 4MJ2A 3W7DA 3QPYA 1UD8A 3S6DA 2OSXA 4MJMA 3LDKA 3CB8A 4JNMA 1JAEA 1K7EA 1EA0A 1P0KA 2GVJA 3PZGA 1FCBA 3GVGA 4CD4A 4OV4A 3W71A 3MO4A 3IVUA 3NYZA 1CECA 3VOCA 4ORIA 3W1QA 3WL1A 2BHZA 2CBIA 1ONRA 1TPVA 2BFGA 4MPQA 3BAWA 1VFOA 5IDIA 4LVGA 3KL5A 3SR7A 4FLOA 3T08A 4IQLA 1FH9A 3GXNA 3HMJG 1GPFA 2J74A 2LLEA 2VEMA 2CLIA 3OVQA 2Q3RA 3AROA 3CHVA 4HTYA 3I65A 4NNBA 2TAAA 1R7OA 4AZBA 1UR8A 1C7TA 1OJXA 3BLFA 5D38A 2J7HA 2WMGA 2Y4SA 5CPNA 2J25A 3THQA 4QLJA 3C4UA 1V7YA 4I7WA 4M24A 3LX9A 3ZT6A 1K8ZA 2NV1A 4V28A 2G96A 1CZ1A 3NDZA 1VHNA 1KV5A 3MV11 4LVFA 1H60A 3N3MA 3W7PA 1PEZA 2A3EA 4HPXA 2BY3A 5F2IA 1UUQA 1YDOA 1UR9A 1LCOA 3TONA 4DXVA 2VZSA 5IHRA 5LNRA 4GUJA 1SW3A 5IBXA 4OV9A 4J9JA 2B4GA 2NX1A 3NL5A 4Y6GA 2ADDA 4LTSA 4RL3A 4Z1DA 1OCQA 2DT0A 2J7CA 1CENA 4UR7A 4AZCA 4W86A 1J18A 2V81A 5DBUA 3WJWA 4WD0A 4O14A 3D0CA 2X0YA 5GNZA 1EUNA 1OSEA 5I3FA 2CITA 3NR0A 4AXKA 1X1NA 3R89A 3QOKA 5F2GA 4M8UA 3UESA 3CGTA 2OWWA 3II1A 4JN6A 3RJYA 3SUWA 1VR6A 3WNLA 3NQAA 3AIWA 1CEOA 1MFUA 3CC1A 5DF0A 1FX6A 1WOBA 3SEPA 1V3LA 3W6MA 5HULA 1G4TA 3N9RA 4ICNA 5A1AA 2YBTA 1G01A 2VQUA 2ZZ1A 4Q4KA 4CU7A 1QR7A 4L4OA 4LRSA 3WQVA 3B4UA 2ZUWA 2W79A 5FIXA 2EF9A 3B04A 5ABTA 1UG6A 3E96A 1OT1A 3KXQA 1H5VA 1BTCA 3PZIA 4NF7A 5BXSA 1OINA 1FWTA 2XN1A 1R2RA 1XM3A 4R33A 1E6ZA 1BGAA 4U3CA 3WQ4A 2BZNA 1IZJA 4ACYA 1EB3A 3O1NA 3MMUA 3ARTA 3ATYA 1O4UA 1UH3A 1WNOA 3F5KA 2GJXB 5E09A 2J79A 3UQNA 4PCSA 5FF3A 3BG5A 3STFA 3NCOA 3AIBA 3S9YA 4MNKA 3A5VA 4MAZA 2CLOA 4AD5A 1KM6A 3MUAA 1KM2A 2V2DA 3TUUA 1UD4A 2BVDA 3DYOA 3AHXA 4JD4A 4CQAA 2FH6A 5A8MA 1EOKA 2C19A 5AC4A 1XDLA 2JBMA 3EXRA 2D0FA 4EOUA 1W37A 4NX0A 4K8EA 3BGJA 4PODA 1E6NA 1OB0A 3BLIA 1FY6A 4IISA 1GZGA 5TQLA 3S0CA 2XFRA 3IIOA 3CZKA 2D73A 3QJAA 1DHKA 4Y8FA 5FMCA 3NJ3A 4UR9A 1B3WA 5G2WA 1TPUA 1H63A 2C8NA 2V3EA 2E77A 3ARUA 2G97A 3WK0A 3AHZA 5D32A 2G3MA 2GDUA 1K8XA 1EIXA 4O1CA 2FH8A 4D1IA 1TREA 1E71M 4MADA 3OEXA 1WZKA 3ABQA 4MUZA 2CBJA 2ZUUA 5CLTA 3QYQA 1U5JA 4KKXA 3VINA 1QOQA 4UTHA 4R34A 1N8FA 2C0AA 1GWJA 3W27A 2X1IA 4FNTA 4DPQA 2EPLX 1W3TA 1SO6A 4KWVA 3AFBA 2XTKA 1OYCA 2V2HA 1DWGM 1UR4A 3GBDA 1AW5A 3VNZA 3NOEA 4XWUA 3L0GA 2GK1A 3WMSA 4JX6A 2VT0A 4GBUA 4CNNA 3TW7A 2RH9A 3HGOA 4Z2HA 1M01A 3TTSA 1LDCA 3AIEA 3K8MA 3T0DA 1Q6EA 4BA0A 4OOZA 2O7QA 2WK2A 3LGEA 1ZENA 1SR9A 4CN6A 1JAKA 4HP5A 5DBTA 3PBUA 3QFEA 1DKWA 1S46A 2YDQA 5U4NA 2QCDA 1ME7A 5CPLA 4IXXA 4O54A 4HPJA 2XVPA 3M5YA 3G0UA 3W7IA 2OSYA 2E68A 3BXWA 4ATDA 3EDDA 2BNJA 3M6YA 1KGXA 4AD1A 4Y9AA 2ZRXA 5HNNA 4IMGA 5H91A 1R46A 2NV2A 4WJEA 4FNQA 2FPYA 1CNVA 2G3NA 2QQUA 2VO5A 2EAWA 2NT0A 3CT7A 5I3KA 4N6EA 5A6MA 2PRMA 5FKCA 2VRJA 1Y9MA 1WX0A 4HSOA 4QNWA 4DUWA 5BNKA 2WLYA 5A8NA 2YZRA 1G6CA 1KTCA 3VD3A 3CWOX 5EFDA 7TAAA 2X2YA 2Z0IA 2XVNA 1OG0A 4NSBA 2FHBA 2PWHA 2E3ZA 2YA2A 1HXJA 1KB3A 1W0MA 3HQ1A 3VGGA 4DPPA 3N1AA 2XWEA 3AHYA 1B2YA 1B9BA 5FESA 1B90A 3TAOA 5I0DA 4AD0A 2CZEA 5GVJA 1CPUA 5K4XA 2C18A 3C2EA 2YL9A 3SCOA 2CKSA 4RXFA 4FK9A 3WSUA 1W31A 1KM3A 2BTMA 2I14A 1YXDA 3NZ1A 3IIXA 5E1QA 1H41A 3HN3A 3OGSA 2NXHA 4P8VA 2VEKA 3MYPA 4QCFA 1JUBA 4BR1A 5GNXA 1GHRA 2FQIA 1BYCA 1X6LA 4F9DA 1W9UA 3UGFA 5IXEA 3QHNA 1MEIA 1AW2A 1RV8A 5AC5A 1XXXA 4D6HA 3HU7A 1EGZA 4CCCA 3RMEA 1KM4A 3LDRA 2CZ5A 4RJEA 3F4WA 4N42A 2ZX5A 1HP4A 3W7JA 2Q8ZA 4MKNA 4E2BA 2VUYA 3GXFA 1EQCA 5HWJA 3NMBA 3W82A 3VDAA 1NOUA 3M5VA 3GTNA 2V5LA 3B9AA 2XPKA 3KVLA 1G4PA 4FHAA 2GJXA 4K37A 2VRKA 3CUIA 2GVLA 3MV01 5ABGA 2FJKA 1TO3A 1DP0A 1WV2A 2QKFA 1PAMA 1OVDA 1ICQA 2VI0A 1AVAA 2ZRYA 3B9DA 3DAQA 4ZQMA 5LA2A 3FOKA 4ZQPA 2IXVA 5GPRA 3WH8A 2G95A 3ZFHA 2YPIA 1SW0A 4WSJA 1YPFA 4LVBA 4UCGA 1VEMA 1OWQA 3TTOA 3BV4A 3KF3A 2Q8XA 5HNRA 1GG0A 1UKSA 2WC4A 2HMCA 2PBOA 1V0LA 4JHZA 5AHFA 1WE5A 2DZXA 3G1YA 3SW6A 4TVUA 1TPC1 2NT1A 5TIMA 2ZDRA 4MJZA 1PBGA 3MYOA 3ECQA 1AQHA 3TFXA 1BHGA 5DCEA 1DWHM 3P8IA 4AHPA 1VLWA 3GH5A 2WZEA 1Q6DA 1Q6FA 1B3YA 2VFEA 2V3GA 5FEXA 3L0KA 3HJEA 2JGYA 4RE4A 1JZ2A 2YLAA 2ZA3A 2CLMA 2VZTA 1OIFA 3PTQA 1KCKA 5G4EA 2VX4A 3L9CA 3U7VA 1UJPA 2QDHA 1JXJA 4JTTA 4H8UA 2PWEA 4W84A 2V82A 3AJXA 3W7QA 1E15A 3WDPP 2BY2A 3S8HA 3QM3A 1ADOA 4NVTA 4CVWA 1P4CA 4FNPA 5DCBA 3TMQA 1KTNA 1VEOA 2EPKX 3B0UX 1TV8A 1BFNA 1J0JA 1W9PA 2Y8KA 4AZGA 3MI3A 2WCGA 1ZAHA 4JYEA 1KQYA 4O15A 4AZHA 3LXCA 1JCNA 3HG5A 1LOLA 1JFXA 4DF1A 2YA0A 3MJYA 2JKPA 4AWSA 4J3XA 1Q6QA 5CZSA 1ZHAA 3NGJA 1NH6A 3G1VA 4PC8A 1OT2A 1QI4A 2H90A 1R87A 2O9TA 2WMHA 5HDRA 4DM2A 1JYNA 4HHPA 1C3FA 3EDKA 5SWUA 2YBUA 4J7RA 3WF1A 3G1XA 1OD0A 4HU8A 1G7UA 5CGTA 4WJXA 1RQHA 1TA3B 3NDOA 1CXFA 3A24A 1LG1A 2A3HA 4JS3A 5FL0A 5AY7A 5A2CA 3EWZA 5K3VA 4LS2A 4CN1A 4GO9A 4PTVA 4QP0A 2BVYA 2J88A 2Y7DA 1IIGA 5AB3A 2ZXQA 3DHFA 3W3OA 2A5HA 2HSAA 2CZFA 3NO5A 4JKMA 5D9MA 4K7YA 4AIOA 2FHFA 4AEFA 4MFDA 4LUJA 4PA8A 3HBLA 4I9AA 4R7JA 3BCDA 3WDHA 1P5BA 3W26A 1D3GA 3W73A 3QOMA 1HP5A 3HBKA 5I3GA 1W9DM 5CZKA 2DZVA 3SGUA 5AYBA 5HR6A 2E6YA 1C92A 4AEOA 1WDSA 5I3DA 2OX1A 2WSYA 3ZWTA 3R12A 3OIHA 3THCA 1IXNA 1R8LA 4RX0A 4UFJA 3APGA 1ZAIA 3VDCA 1V3MA 3GYEA 1OX6A 1JYVA 3FYOA 4L4PA 3CLMA 3WUGA 5BRPA 1A5SA 3BAXA 5EBUA 1Z48A 1W2TA 2E09A 3OSDA 4FO4A 5EYWA 3UWWA 4E2DA 2VTFA 2VMFA 2YYTA 2G41A 2AC1A 4M5PA 4OKDA 3MMWA 4C7DA 4XZ9A 2WZHA 2WBGA 3UWZA 3WJYA 1W8SA 3UWVA 1ECEA 3TROA 3T0AA 1CXLA 1NP2A 1ZY9A 3LLFA 2WXDM 4GUHA 4JFSA 3GZ3A 4ZQNA 1JJKA 1KM0A 3UERA 1T8XA 1VJSA 2Y2WA 1DEDA 1JCJA 2WPBA 2D2OA 2GOUA 5I24A 1V02E 4OE7A 5DELA 3BW3A 3IIVA 5AYZA 1ZL1A 4XBKA 1TG7A 2WAGA 5D9OA 1B4EA 4ZMGA 3C56A 3F5LA 3J7HA 1UA3A 5HPOA 3NIYA 1LORA 2VFFA 3QSTA 1LL4A 1TJPA 3DYPA 2DH3A 1GG1A 2YDRA 5FIPA 1W5NA 3T0BA 3L5AA 3GXMA 1RQBA 3RPMA 2AOSA 3AI0A 2BXYA 3AXXA 2WO5A 1J0YA 3O6YX 1LRTA 3WH9A 5ABHA 1JYXA 3W1RA 1EXPA 3PAJA 1UWIA 1A5BA 2Y5EA 2E1DA 1G7VA 2E5CA 4QNEA 5CPOA 2J7BA 1PV8A 4O8RA 3OGRA 1Y4WA 3UXDA 4D1JA 1UYPA 3P74A 1E56A 2CERA 1XI3A 4G1KA 4W8LA 5A95A 3TIMA 1W9BM 3WBEA 5BYWA 1GONA 3Q37A 1VJIA 2QF8A 5C70A 2Y6ZA 4OWGA 1UH4A 5FCZA 3A5FA 3SCUA 2WMFA 1B4KA 1NOWA 3W72A 1J9YA 3QC3A 3LV6A 2DORA 4N0RA 2TMDA 3QHMA 1QNSA 3QH2A 1TSIA 1F2JA 3N14A 4YCOA 1JCLA 3UYCA 3EKZA 1KR0A 4QISA 3VM5A 5AC7A 4MY9A 1FA2A 2XGBA 5AHLA 1UASA 3P84A 3CHEA 4O57A 1MQQA 2A2IA 1XKYA 3DH7A 3TQKA 4UTLA 2VX7A 1ISZA 2CLFA 1Z41A 5AHIA 5C5YA 3CWNA 2EO7A 3MU7A 3LXBA 1ISYA 1XC4A 1RD6A 1O6IA 4RZ5A 2JALA 1EDQA 3CMGA 1PE1A 1OK4A 4UQCA 3KF5A 2WANA 3AMLA 4BQ2A 3IJ7A 1W5MA 1RH9A 5HWNA 2VR4A 1HUVA 4X22A 1M03A 2A85A 3OVPA 1MW0A 3DGRA 4O4WA 1RZMA 3MBFA 4C1KA 3IAPA 4HMCA 2AEZA 3QZEA 4UNIA 3VD7A 3CZGA 4IX2A 4EVZA 5AHEA 1UR2A 3NQVA 1V6UA 3TC6A 2G5WA 3TFCA 5IFPA 4KRUA 5CG0A 1RR2A 4ADTA 1VFFA 2GUYA 3A4AA 3VGEA 2B0MA 1QBAA 4X3ZA 3AQUA 2QCCA 2V30A 1XH2A 3PZNA 2ZUMA 3UGGA 3KX6A 2WW5A 2VCAA 3IANA 4O16A 3WY1A 2DZTA 4A21A 1UWRA 3PC0A 3LPGA 3Q58A 1FXQA 2X1SA 5FF0A 3N17A 3P60A 2CCRA 5DMYA 3W07A 4Q33A 1LBMA 5D04C 1K9DA 1JCXA 1G67A 1WZAA 2CKRA 4PMOA 1EH9A 3CZEA 2Y63A 3TSBA 2CFFA 4RK8A 4JTLA 1FWSA 3WD2A 4GZIA 1JZ6A 1WXJA 1G5AA 1H49A 1HL9A 2XM2A 1WAUA 4FX8A 4HNNA 3TSMA 5K7JA 4DQWA 4GINA 5HR7A 2WWDA 2D22A 4ZENA 1KA9F 2DIEA 5CQ1A 1GNXA 4X9SA 1UR0A 3QMRA 3W24A 4FX6M 1F6PA 1SSGA 5CSYA 4WIWA 4PFMA 4WX2A 1JR1A 4NJGA 4ORMA 2VX5A 4W8BA 2XIIA 2EKCA 2JEQA 2DJLA 1W5PA 5D2WA 5LNVA 2DIJA 3MO7A 4OU1A 1B30A 2FB2A 3AO0A 2CETA 3HB9A 1Q45A 4NZJA 2W4XA 5AOUA 1TR1A 5LYRA 4FFFA 1VHCA 4LV9A 1UBSA 2DSKA 1LROA 4JL2A 1KM1A 1WO2A 3RIKA 4GXPA 2WZIA 1BYAA 1ZBCA 3I3DA 1SFLA 2WHJA 2WVSA 2GJPA 1PZ2A 3LERA 4U2ZA 5J5DA 1XL9A 5G4WA 2VEPA 3NSXA 4AZ7A 4HZ7A 2VC9A 3RWKX 1QPOA 4TX6A 3O05A 4CNPA 1U2YA 3TTYA 3ZSSA 2AQWA 1UUOA 4HPGA 1S5WA 3PB2A 3R5EA 1DOSA 4JCMA 5A6KA 3BMWA 1VYPX 2XSAA 3BGGA 2JKEA 3WMBA 2NXGA 3PUEA 2A1YA 4M6PA 1B3XA 2J8FA 3IK2A 1GOOA 1P0NA 1V3JA 3UY8A 2TYSA 2NXIA 1QW9A 3W88A 2OXBA 3AYSA 2BY0A 3VMPA 5DFAA 5BXPA 4TX9A 1OFPA 4AF0B 1BWKA 1CIUA 3W7OA 4LPCA 4EK7A 3W25A 5CLWA 2ZTJA 4NUWA 3TA9A 3GXDA 3JR2A 4A2SA 2BV9A 4KGJA 5AC6A 1TPH1 1F73A 3IV3A 2DZSA 3L5MA 4NXKA 2ZX7A 3U1XA 4MZ1A 4WOQA 1Q6OA 4MNJA 4O11A 4E8DA 4F9JA 3OBAA 4UMAA 5A6AA 1H61A 3RM8A 1HJQA 3VKJA 1TMHA 4KWUA 3QEZA 3WJSA 1OFEA 2ZUNA 3AZTA 3QSRA 4DO4A 3B8DA 2CWNA 4TO8A 2ZIDA 4KH2A 2VZVA 1J12A 3OZOA 1GYLA 5F2MA 1GHSA 1K03A 1G0CA 2DZPA 2D0GA 3EXSA 4CVUA 2ZX8A 3K4DA 3FIGA 1PIIA 5I3HA 3CTTA 4FB7A 4GQQA 3W0KA 3LCWA 4Y90A 1MSSA 4A4AA 3RK8A 3NPUA 4MNMA 1K7FA 4W88A 1JI1A 4LY8A 3VIPA 4KFNA 4WXZA 4Q7NA 5D8WA 5A6JA 1ST8A 1KFEA 1CGUA 1LJYA 2WSPA 2XFYA 5TD4A 2DT2A 5I78A 1EEPA 3P61A 1V3KA 5LNWA 4AWTA 4OBRA 2ZXAA 3FNDA 3IVSA 1UWTA 1FHDA 1GVYA 1QVBA 4GIAA 3OIXA 2ZZ4A 1FOBA 2ZUSA 3T2OA 3VILA 5LNUA 1CLXA 2YDAA 2QLYA 5CPMA 2Y24A 1V3IA 4MVAA 5AC8A 5DLCA 2ZOXA 1SW7A 3D5HA 1H0GA 4LT9A 2GDVA 2Z1KA 2HS8A 1LG2A 4EAMA 2A21A 1QPRA 1V6YA 3LMYA 1BEUA 4FF7A 1PX8A 3VIGA 3PBGA 2J77A 3GDRA 4BQ3A 1B57A 4KFOA 4UTKA 2FPTA 5J5RA 5KINA 4PN2A 4Z2IA 2UY4A 4DBDA 5ABFA 3IGXA 3CHDA 3M7SA 4MAVA 1LRQA 3LRMA 3FY1A 1LOQA 3N15A 5ABFB 4W5ZA 3GDTA 2PCQA 3TCEA 3PR2A 3U6WA 2A7PA 2NX9A 4JX4A 3H55A 4JL1A 2CYGA 1CXHA 1DJNA 4ZXLA 4UMCA 2PWGA 4I7UA 3QF0A 1QHOA 3KVMA 4AHOA 4UFKA 3ATZA 5HBFA 5I79A 4QSHA 2A7RA 4IMFA 2GVYA 3ALGA 5D33A 2E5DA 1H5YA 4IMEA 4LC6A 3SGZA 5LKYA 1LZOA 1TTIA 3OBKA 1MW2A 3ZS4A 1GUVA 3SCSA 1KFLA 1I2QA 2A3AA 2O9RA 1QPNA 3ELFA 3KOFA 1RPXA 2I1OA 4NXSA 1UB3A 2XVKA 1NARA 4HMDA 2EXOA 2I9EA 1KXTA 4GZEA 2E9MA 4MY8A 3DECA 3DFTA 3AXHA 1C8QA 1PL9A 2ZFAA 1V03A 1TPEA 1KFCA 1E55A 2DT3A 3LHVA 3CZJA 3USBA 2WYSA 3T78A 3WH5A 4XUYA 5EMUA 1D7FA 5IHSA 3AS3A 3OLIA 1E0XA 4QIUA 1HTIA 1EO7A 2CLHA 4OHQA 2YA1A 3QR3A 5HMSA 1FP8A 5FOOA 4PMUA 6TIMA 1SMAA 1XGZA 1OF6A 3WMCA 3NA8A 4QITA 1PJ9A 3FXYA 3ZT7A 1JQXA 4AAJA 2FDSA 3N18A 4BCEA 2G3IA 1XCXA 1FBAA 3GAYA 2XWDA 3CLWA 2GSJA 3LCIA 3W7KA 2WCSA 4GE8A 4NU7A 4HNVA 3PM6A 3L4TA 3LI0A 3AZSA 3RO8A 4MPKA 3MUZ1 2WWCA 3FEMA 3MP4A 2BSLA 1B0IA 1VLIA 3BAIA 1W3IA 2ZZ5A 2XFWA 5JUVA 5E0FA 3UWYA 1VF8A 1JF5A 4ADSA 3W75A 3W85A 5JBFA 3ZWSA 2QPSA 3PY2A 2QHAA 3WFZA 4RCXA 4LOCA 3SUVA 3PVFA 1UOKA 2FDMA 2OYMA 3JRKA 2Y89A 3WEZA 1M53A 3AMCA 4MB3A 1G1YA 1A53A 5D37A 2ZUTA 3MP5A 1QAPA 1TPB1 3IIZA 3W74A 2DGAA 1Z32X 4AVFA 1X6NA 1R86A 3INPA 1PVNA 3IGSA 3SCWA 4JYDA 3I7SA 1E6RA 1HJSA 3AIQA 2OWCA 1FDYA 2PRLA 3C8FA 3M7WA 3TX9A 1JVNA 2PWFA 3LDVA 1JD7A 2WBKA 2Y8VA 5GQBA 2WMIB 1QBBA 3B8SA 2JKAA 1XD1A 5I3JA 5E93A 4MFEA 2A3CA 4M29A 4MYXA 2E6AA 3RU6A 5BMWA 4CLMA 1I1XA 3TC7A 1HJUA 2AAAA 2QUUA 3DKLA 3LHUA 2D3LA 4JTKA 1MEHA 4MOZA 4W7WA 5LNSA 3G8EA 3RM9A 4FIRA 4O53A 4H41A 4EKJA 1WOAA 4Z1BA 4AWEA 2J6XA 4IWWA 4UQBA 4JIEA 4E38A 3W1UA 1FCVA 4PMYA 3PUOA 3LEMA 2R91A 2EPOA 3SUUA 3NQGA 3BG9A 1US3A 1E1EA 3OLDA 4GZJA 4JFTA 3BG3A 2WNQA 4X0NA 1F6KA 5I6SA 4Y96A 3VX0A 1EDTA 5G1TA 5D30A 5E0KA 1N55A 5CZ0A 1QO5A 1JXKA 1UD6A 1AMKA 1H7OA 2X1RA 4FX7A 3TKFA 4D72A 1M04A 1ZBWA 5I5RA 5A3HA 2V0TA 4PL2A 3TA6A 4N4QA 4OT7A 5CZJA 1AQ0A 4OGZA 4XX6A 2A4AA 3HGSA 4DO5A 3UXAA 2UWFA 1NSJA 4CCDA 1EWDA 3UWUA 3VGBA 4P8XA 3HG4A 4H04A 1P1XA 4AF0A 1QHPA 1XCWA 4PYSA 1XBXA 3AZRA 3E0IA 2X1TA 1GW1A 1UKPA 2IXUA 3W2UA 1U83A 2WVVA 1E40A 4N9DA 4DF0A 1W9XA 1JDCA 4UMBA 5M3WA 4QDMA 4JFWA 4D6CA 2B7QA 1TJRA 4HT3A 2WSKA 5C71A 2W62A 3ZIZA 3ZOAA 2MANA 1Y9GA 4AIEA 1KBIA 5G2HA 4NNCA 1KGUA 4Q22A 3W38A 3NSMA 1QWGA 4W85A 1E6XM 4JY8A 1WDWA 2EPNA 2RDTA 3CMJA 4UQDA 4XZBA 2J7EA 3ZM8A 3OG2A 4XTDA 2OYLA 1JYWA 1JRBA 1UD5A 3ARQA 3AS0A 3PIJA 1NVMA 5G5IA 5HQEA 3B03A 3CIXA 1G94A 1UQYA 2V38A 2XUCA 4HMEA 1BTMA 1ZCOA 4GUIA 4EANA 2NZLA 5A94A 4UTWA 4B1LA 1K8YA 1VS1A 1U30A 3G22A 1H3GA 3ZJ8A 2DEPA 3PZOA 2WNWA 1VRXA 2EBNA 4MDOA 1GOKA 1YQ2A 4RV8A 3SZ8A 3N11A 1BYDA 3BH4A 1UHVA 5F7UA 3NXFA 4Z0JA 4KMQA 5CJ5A 4CU6A 1TUXA 3UY7A 4JFVA 3NQ7A 3OLEA 3O16A 3W9ZA 1BWLA 1D3CA 1H09A 2W91A 4EE9A 4F66A 3C2RA 5FF7A 1B3VA 4PL1A 2VR5A 1M7XA 3GDBA 4YPJA 1SZNA 4UFHA 1M7PA 3WKZA 4U4MA 5E9AA 1UQZA 5K4ZA 4OQVA 4O10A 3DFPA 2WKLA 3V1PA 3GDMA 3DYMA 2J9YA 5D2YA 3W22A 1W3NA 5F4WA 1VFUA 1W1PA 2VZOA 4XQ6A 1WZLA 2ZRZA 3SJ3A 2YW4A 1SFJA 2ZX9A 4LXFA 4JHOA 1ZAJA 4XV0A 3C61A 1KLZA 2WJZA 5EB8A 3W84A 3AMDA 1HFBA 4GNJA 2VCBA 1TPFA 3AIRA 4FLQA 2YFNA 3E1F1 4FFIA 1VEPA 3KVKA 1DWJM 1JD9A 3SY5A 4IPJA 4UQAA 1CGXA 4X0VA 4O13A 4MNLA 4UTWC 4NNAA 4DEFA 3BK0A 4EWND 3FAXA 3OA3A 5D05A 2R14A 1Y7VA 3OLGA 1X8FA 3DU0A 3STEA 2CU0A 1R47A 1UD2A 3FKRA 1FDZA 5BMXA 3WQ5A 4NJIA 3MP3A 3BC9A 3R2GA 2ZX6A 1RD5A 4JTUA 1XUUA 2PBGA 3KL0A 4UIOA 3SFKA 2ESCA 1LP6A 3ARRA 4BF7A 1HT6A 3LHYA 5F2LA 4ZQRA 3M5ZA 3UETA 4B9YA 5BROA 2AAMA 2F84A 4XBSA 3AIVA 4AD2A 3LRKA 1TTPA 3WUFA 1I8JA 1QCWA 1DVJA 1EPXA 3AS2A 4R5EA 2E6DA 3GNOA 4AWUA 4J27A 4O17A 3L4XA 1HX0A 4OBSA 1I45A 4AY1A 2FGLA 2G4FA 2WNNA 3P5YA 4WOZA 5HINA 2FPVA 3S1UA 3LBCA 4E0CA 3VIJA 3LM7A 1VYSX 1QI3A 6TAAA 2B7PA 1FWRA 3PN8A 1S3HA 3RLUA 3TNOA 4HPHA 4O52A 3BW4A 4UFIA 4K7VA 4JCLA 1EIBA 4U3AA 3S1WA 4AYSA 1GJUA 3VGHA 4OIFA 3N13A 2W5FA 2WV8A 5FD0A 3WBAA 1J0ZA 2ZXBA 2JGQA 3BMVA 4DF2A 3O6DA 2H6RA 3P8JA 4UOJA 4JX5A 4O19A 3VIHA 1IXPA 1UH2A 2V3FA 2EGZA 3W86A 3PIGA 2V8ZA 3SI9A 5ANNA 1L6YA 4CD7A 2Y61A 3NL3A 5D2TA 1GTEA 2R8WA 2VL4A 4DWSA 3WN6A 5JBDA 2ISVA 3B05A 4X2RA 2W0UA 2A6LA 1LWJA 4X9YA 3BAJA 1VIWA 3POCA 3VIOA 1ZALA 3SCTA 1XH0A 3O63A 4J3TA 2UY3A 4JAWA 1M6JA 3LOTA 2F61A 5FL1A 1EP3A 2Q8LA 4LWWA 1EP2A 1VCVA 3VNDA 2D0HA 1JZ5A 1CWYA 3GNPA 4D6EA 5FEWA 1QNQA 2W66A 1V5XA 3S1XA 1BLIA 2WSQA 3U7BA 2D24A 3VKKA 1Z44A 5CKSA 3LCLA 5CPQA 4TR9A 1MFVA 4YHEA 3ZJ6A 3ARZA 3G1DA 1IV8A 1UZ4A 1LL7A 1OYBA 4AZ6A 4P8UA 1UWQA 1LBLA 3WFLA 1H7XA 2W63A 1I2RA 1T96A 1WYIA 3GXTA 1CYGA 1XYZA 1I1WA 4BQ5A 1THFD 1R30A 2OZ0A 4P61A 3EB2A 1OGSA 3UR7A 4HOWA 4WUIA 5D2VA 1K6AA 4U5KA 3NQMA 2HS6A 1B3ZA 4FNRA 3TU9A 4ZXOA 1HG3A 2EPMX 1DV7A 4BWLC 1QI5A 1XSJA 4QAWA 1JRCA 1J10A 2ADEA 2Y7EA 3IEBA 5D4YA 4PBGA 4LU0A 4BZYA 2CZDA 2X16A 1JZ7A 1UWUA 1YLVA 3M44A 1VGAA 5EMYA 4TTUA 4L4LA 3P5ZA 3WH7A 4C1LA 3L21A 3VO0A 3PZMA 1VCFA 3I68A 1HL2A 3RMJA 1SO3A 3WFAA 1J5TA 3CHFA 4AZIA 2RHGA 4NZFA 1JIBA 1UKOA 3EDJA 2X8RA 1EHNA 1S5VA 3VIMA 2V5BA 3F4VA 1V6VA 4CD8A 5BXTA 4KWWA 1JCYA 2J8GA 5FK7A 2Z6JA 4CN4A 3M5XA 5FI8A 4BI6A 1ALDA 5EY5A 4LS0A 3SC7X 2BX7A 4GRSA 2E9LA 4CUCA 3OG3A 3K8KA 1PHQA 4O1AA 1GTHA 4WY0A 3KFTA 3W1TA 2VENA 1E3XA 3N19B 2Z1BA 4UZSA 4MIMA 3I6RA 1YADA 1MO0A 1QNOA 1Q3NA 4MJ4A 3TP4A 4D6IA 3WQWA 3M47A 4GWEA 1PX4A 1XFBA 2WVVB 3A4XA 3IGUA 4IPIA 1CXKA 3HF3A 1C29A 1HIZA 2D23A 2ZUVA 3K4AA 1FQ0A 1GVRA 1O95A 5KITA 2P1FA 2ISSA 1GJWA 1TIMA 2O7SA 3P7YA 1OF8A 4RZ4A 3WD4A 1D3HA 3L4VA 3WQ8A 6A3HA 2WNZA 1TMQA 1LLOA 3H53A 6CGTA 1XHGA 2QAFA 3W2KA 2O9OA 3GYCA 4AXNA 5TBOA 3S5QA 3S5OA 1EHAA 1FFRA 1WAWA 1I2NA 1ESWA 2XGIA 3PZTA 2NSXA 3G3MA 1UUMA 1XYFA 1F4HA 5HUOA 1YDNA 1V0MA 4K6AA 3DFNA 4NI3A 3W6YA 4UTTA 3WL0A 3EWUA 3HG3A 3QMSA 3AMGA 1XH1A 3K1DA 1V0NA 3BSGA 4IX0A 4U2YA 4AZ5A 3PB0A 3T40A 1OBAA 2XN2A 5EL1A 1YTEA 3QRHA 2XFFA 1DQWA 4KFPA 2BLEA 4YXGA 2XJ7A 2ZCGA 1H7WA 3NM3A 2Y7GA 1BQCA 3KWXA 3WDJA 4HU0A 2CEQA 1WDQA 3CIVA 3SCQA 4JTEA 4FIQA 1O5KA 3JS3A 3UGHA 1UR1A 3VD9A 1GVFA 2DT1A 3PHAA 3N9SA 3M43A 4HA3A 3R13A 4HOXA 1OX5A 3HG2A 3HOJA 3GB6A 5AHNA 1KBBA 4NJHA 1E6PA 2JIWA 2VFHA 4B3KA 4U31A 1YPIA 1ITXA 2NWSA 1KCLA 1E6QM 4DWSB 1BVNP 1XSIA 2WPGA 1QMLA 3OHIA 2HVMA 1K7XA 3VDBA 2PB1A 2NUWA 1WBJA 4ZVJA 2QCNA 4RLIA 3LB0A 4XKYB 2ZZ3A 2CBVA 2FGZA 4M1RA 4W89A 3VU2A 4BK9A 1YTDA 2OWXA 1J0IA 3GDLA 3W70A 1IZKA 3EBVA
chains in the Genus database with same CATH superfamily
1OOPC 4HPKA 1PGW2 1POQA 3DPRC 1TQXA 2CC0A 3O1UA 4XXAA 1F5ZA 4JDBA 9XIAA 2Z2AA 3VNJA 2BW8A 3SHRA 5LA0A 3CS2A 5A3TA 1HN0A 4GFSA 4Y22B 1YXYA 3WK1A 4C5YA 4PZVA 2BTVC 2DPEA 2V9DA 2GC3A 4YVXA 3DBNA 1J4EA 1JYCA 4R9XA 1OQEA 4XFIA 2XBO1 1FV2A 3P82A 5C2XA 3HQXA 4H9VA 4YW1A 4DNHA 1ENUA 1JF6A 1ZJBA 5DMLA 5A6QA 3I6EA 4HT1T 2GOKA 3PFMA 1POJA 1FWHC 4JQ4A 4EWEA 2FZDA 3B0YA 3FA5A 2D6NA 5KXCA 3PP7A 4FPEA 3IUDA 4ACZA 4LV4A 2AMGA 3R4SA 5DRIA 2PGWA 1AF9A 2J78A 2XH6A 5I06A 2FLIA 4AEDA 3KOYA 2WJFA 5CZTA 4JIPA 2WFF1 4XAYA 3M0ZA 3M3EA 3BTXA 4ZQCA 4C7GA 1WBFA 2RFGA 3TH6A 4K3UA 2XQRA 3GNNA 5K9DA 5A6BA 2WO1A 2C13A 3FV9A 5DX7A 1PHWA 4C6BA 4MLJA 4PUMA 5C7VA 3V0AA 1K3IA 4XAGA 1W90A 3I3MA 3BUVA 2I5IA 3TSDA 1MPXA 5FK8A 1AUYA 1VENA 4PUNA 2BY1A 4AVAA 5H2ZA 1OZQA 2BVTA 4NUBA 2YU2A 1WUEA 5D2XA 2G3JA 5FZOB 3UG3A 4CRQA 3BOPA 3REQB 1XV8A 3RDKA 4UW6A 4FXSA 1DZRA 1NA1C 1CPMA 4RFT0 7REQA 1ND2A 1IXOA 1MNZA 5CC7A 4QXCA 3WG3A 3GLCA 3WLKX 4H01A 1SEFA 5FZ6A 1JMUB 1RUG2 3LB9A 2YKKA 1CT5A 2X5IC 3WLTA 3TYZA 2DTYA 1A5KC 1EP0A 3BPWA 4Q26A 3MHFA 5CAKA 3CUZA 4LYQA 1BAGA 4KERA 5HXVA 3LTPA 2XUEA 1SMDA 4JRLA 3FLUA 4HOZA 4XO7A 3RAOA 5C4WA 5CPSA 4CUAA 1K4GA 1KGWA 4F3HA 5I00A 1H1ZA 4QDSA 2ILMA 1PO23 2EIGA 1MR5A 3TB0A 1MS0A 1O4ZA 4GWMA 1VRBA 1W6NB 4C5ZA 2NN8A 1W9VA 4IEVA 2XSXA 2HH9A 5HPCA 4GD4A 4QQ3A 4DWSC 1GP6A 2BNMA 5LA1A 2GJNA 4RHV1 3AS1A 1DJHA 1JW6A 2DSZA 4JOMA 4JV4A 1S2VA 4SLIA 4LB3A 2NMOA 1HN1A 4B5NA 3AMKA 5KZDA 4IICA 3ES1A 4IGQA 1ZFJA 4LA2A 3I7RA 1Q4NX 3NAPC 3RM4A 4DN1A 4GPNA 1ZRDA 3EX4A 3GH4A 5ACA3 4MWAC 3I2FA 3U2OA 2F6XA 4A2UA 4AB4A 3NFUA 5B7ZA 3CZLA 1H51A 2GGIA 3EKLA 2BBAA 2FTPA 3CJXA 3VD5A 4A3UA 3H23A 4V2XA 5A3NA 3HJZA 3WLOA 4XZIA 3DV8A 3Q9OA 4M3PA 4Q8OA 2J7GA 1Q5MA 4WVWA 4WZHA 1BBT2 5C3RA 2ZZ6A 1F3WA 1BWVA 1I5ZA 4URTA 4GULA 3H54A 3LHTA 4MB5A 1C7SA 3OVGA 3DXTA 2F17A 5DY3A 3WF3A 3FA3A 4A8RA 2JFEX 1D7KA 3VHNA 5KWRA 3AK0A 1E0TA 3MUIA 4XIOA 3SQLA 4J3VA 3OBTA 3LF7A 1F15A 4BH9A 3QGVA 4FLRA 3U2ZA 1Q63A 3AXDA 3TWAA 3B9IA 3VNIA 4EIVA 1BSIA 3LEPA 1MACA 5EWSA 3ITVA 3PSWA 3VFCA 2OPKA 2C1HA 3NZPA 4LBMA 1UKQA 1VBA2 2VRQA 3W7MA 1DTUA 1C8XA 4MB4A 4QLLA 1P0BA 4BF5A 3VDHA 3JCIA 5CSUA 1AR61 2Q1FA 2VNGA 4D8MA 2ZADA 1MXDA 1NM9A 1XGEA 1HJGA 1HKVA 1VBB3 1QOPA 3PK7A 3VHPA 3O1PA 1BVZA 3ALFA 4A22A 2JKBA 3UBPC 5IM51 4M3CF 4GI9A 3W2JA 2BS9A 3U48A 2ZCWA 4O50A 3HMCA 4I7VA 1FTXA 3MI6A 3F03K 1QF3A 2PF0A 4GYKA 1CBGA 3UG8A 3CNAA 4QE4A 2O0TA 4NKCA 1B35A 1D7PM 1JQVA 4OQ9A 5FEZA 5DZGA 4IUGA 3TR9A 3MANA 1Q6CA 2WC7A 3AWNA 1IHIA 2ZRUA 4LHLA 4GY7A 5H9PA 2QNKA 2ZGRA 4X6QB 3D6NA 1N1TA 2B7YA 4PRWA 2R042 4CP9B 4LNYA 3BAYA 5A69A 4P9JA 1ICSA 4YLWA 2J1VA 3N04A 4QQHA 2W61A 2WZR3 1HO1A 1XLKA 3A9IA 5FY8A 1Q8SA 3NPWA 4QGCA 1RITA 2Y1HA 4ZS2A 1G69A 3T4VA 1E70M 3AX4A 3STCA 3S5NA 2TNFA 2VURA 2W1SA 4L5ZA 1D2QA 2JF7A 2RMU1 1X33A 1NAL1 1T0OA 1TPWA 3AJZA 2CZVA 1S2AA 2HK0A 3DFSA 3HIJA 1PX3A 1JZ4A 2HWD3 3SFWA 3PWAA 1XSKA 4RW3A 1W1TA 3KQRA 3AZVA 3LXAA 4JTQA 4D6DA 3VKLA 1RUE2 1OYAA 2XN0A 3G3DA 2FZ1A 2H0VA 1C90A 3P81A 4JDYA 3BPZA 1TRIA 3UT0A 4GHRA 3LCPA 1TVLA 2GWNA 3LPFA 3ZQ9A 4META 3WF4A 4XMIA 2ZX3A 4KWJA 5FY1A 1RP9A 4XZNX 1PIV2 1DL3A 1LYXA 1TWZA 4YL2A 4ERGA 5JH2A 4TN7A 4AFYA 1VBE1 4Q4OA 5D1IA 4RE0A 2DBNA 3M6DA 4GJZA 2FKPA 4XZLX 4ROQA 5G2IA 3HO8A 1MS4A 4I09A 1OPOA 1ICPA 3RZJA 4S3AA 3ZR6A 3XINA 2ZX0A 1W5OA 4I8YA 3MWCA 5DT5A 1G9HA 2OOGA 3VHOA 3RR1A 3H4XA 3JQWA 4W5UA 4IF2A 5L7OC 3SECA 5REQB 4V1PA 2D3NA 3MWAA 1PYMA 3NQCA 3E0FA 1UZ1A 4WKFA 2GQAA 4W6XA 1AXKA 3G8RA 3RFRA 2EEXA 4HZMA 4ZGYA 3BIEA 1JDEA 1EUAA 3SCVA 1YI9A 4QQUA 3NRUA 4AG4A 4GZ7A 1RUC1 4QLKA 4IV1B 4FF5A 3P6LA 1UOJA 4XABA 1QNYA 4ATEA 4LYPA 4Y9MA 3MICA 2PHXA 1F74A 3EHKA 4GH3A 5I09A 2IVJA 3MBDA 2A3LA 2NVCA 1JFHA 2BGPA 3FAWA 3CQ0A 1QPQA 2D5FA 3LZZA 3LTSA 5DAWA 3A0NA 4ZEPA 1OHLA 4UBGA 2OQ6A 2J7MA 1PVC1 1GT8A 1Z69A 3IMMA 3CF6E 4QX5A 1RVGA 3G77A 3SRHA 4S3DA 1N82A 3NNLA 3O5SA 2HWB3 4XOGA 3MBWA 1JDDA 4HNTA 2J9XA 3UW6A 5FP4A 1RHI3 3AVRA 1EC7A 5B4NA 4DYKA 4LUIA 2O0OA 3SIZA 3TYEA 3WCZA 4LLFA 2Q1MA 1JODA 2E9BA 4AYGA 1KXGA 3FDGA 2VOKA 2WT1A 2J75A 4P8WA 4HZ6A 3CWHA 2LRPA 1ND3A 5BYNA 1C57A 2IQTA 5BOOA 1TZZA 4D2JA 2ZGUA 1RUJ1 1W5QA 4QS5A 1NYWA 2ZGKA 2TSYA 2B31A 1ZZ6A 1E3ZA 1KQRA 1CGVA 1FHUA 2Y38A 1YX1A 3GAKA 3LRLA 4MDPA 3T05A 4LF2A 5L36A 4H4IA 3I54A 1JTZX 2XKPA 3EB7A 5A6ZA 3W1AA 1JXNA 3H8XA 3VPLA 3W7GA 4MLRA 4AC1X 1TVPA 1ND2C 1UY4A 2ANUA 3UJ2A 1EV13 2WFPA 2OZ8A 4NT0A 1E72M 1QI0A 4HETA 3K75B 3TJXA 4I0WB 1LCLA 2FHCA 3NAVA 2P4EA 2YL5A 3W28A 1UYZA 3THAA 1RJRA 4BEQA 1KFJA 3MSDA 1SR0A 4LANA 2ISWA 3RMYA 3KZSA 4J4KA 1S5TA 4GA8A 4NQ1A 4CNTA 1B9ZA 3AU6A 5AC93 1BYBA 4GX9A 3ZYFA 5T5JA 5GM0A 3EX1A 1EF3A 2DDXA 4HPNA 1J1TA 1WW7A 5A8OA 3ZPOA 1W91A 1G9FA 1YKWA 3BGAA 2EAKA 5PTDA 4RZ6A 3HGRA 3L5LA 3PBVA 3T1LA 1J0HA 1KV8A 3OZMA 5BOEA 1QW7A 2FDFA 2C71A 4NJKA 4NZ3A 2J47A 3U4FA 5C7HA 1GQIA 5JIPA 1W3JA 3C2OA 4FPHA 1W1ZA 4ZO7A 2VC6A 5IVJA 3VBFA 1JUEA 2WRAA 4Y4RA 1OFQA 2CHNA 4IIDA 2E1WA 2QCGA 5A3OA 4D8AA 5GZDA 1VCGA 4JTFA 1A5AA 1JPHA 5FLIA 4LUYA 5I2UA 3LI1A 3T44A 4RNIA 1D9EA 3G5EA 1KBKA 2FIQA 4EQVA 4RNFA 1NCRC 1O4TA 4DINB 4CU8A 2YBPA 1VYRA 3HPAA 1HIXA 4HB7A 5JZGA 2HZGA 2QZ3A 1S0JA 3CU2A 2PWDA 4CEYA 1RA5A 3S5AA 5FMBA 5D03A 1OFBA 1OZMA 4MGTA 4PTWA 1NWUA 3VMOA 1U5XA 3BVCA 4JICA 1XJAA 2IUWA 3LBMA 2QIWA 4EN0A 1MXGA 2X53S 3DC0A 3SCNA 3LPPA 1J3RA 1J84A 5GJNA 1CIWA 2Q8CA 1BKZA 3VNKA 1OX4B 2ZX2A 1A47A 1OPMA 2ATMA 3FJ4A 2OELA 2QQWA 4Z1AA 1ADDA 4AI2A 3EWBX 4BI7A 2BOIA 1PM7A 2CL2A 2Z2UA 3FVMA 4AAXA 2XSBA 2E25A 4KGLA 3LCXA 4QGLA 3LV5A 4ZSUA 4IPLA 4GUFA 2CLEA 5FJHA 3QKZA 5T5LA 1MQPA 5D09A 3W1LA 4W6WA 4UTTC 4A35A 5GLTA 5JMOA 3TN93 5EA9A 3CPRA 2Y5SA 1PPIA 4QAIA 2ZMNA 3ZIWA 5E6HA 4P08A 3PTKA 1IGWA 4JYFA 3S47A 3TW6A 2RUSA 3NM1A 2OLAA 3GG1A 2PDPA 2GSYA 1M1BA 5JCTA 2QCMA 1HJWA 4UR8A 1FHVA 4LBRA 3GNXA 4XF0A 2DUOA 3RG6A 3K5XA 3AIUA 3GM8A 1W32A 3RRAA 3JUGA 2ZQ0A 4MUPA 3LCHA 1DQ6A 4OHXA 4NZ5A 4FOKA 3MIDA 1AYM2 4HN4A 4E4PA 4HBKA 3FJ6A 3WQEA 3MIFA 5K9CA 1ME8A 4AEEA 1ZZ8A 2IWGB 2D20A 3E38A 5ENLA 4PMZA 5CADA 1NY1A 4AEDB 2IW0A 1KJLA 3KHCA 4NJJA 2PA7A 4IIEA 3O6CA 1PMHX 3N73A 5CSRA 3FBYA 3S42A 1ITQA 4M1BA 4L97A 3FFZA 1LENA 4DJEC 1XU2A 1F5JA 4KGGA 1SFPA 2D6LX 2PUZA 4WEVX 1SPQA 3NQEA 4MZ8A 1QW8A 1JH5A 1A5MC 5EPDA 1HNYA 5C9ZA 2JE8A 2QQIA 5JPMB 3JBG3 1Q3EA 4Q8NA 4GIRA 2R1KA 3O9NA 2A6XA 2PZNA 2H9AA 1U1JA 5FY9A 1D2SA 1R3QA 4CDQB 1R9YA 4IFKB 3TOPA 3BCFA 3EYPA 2JDUA 2ACSA 3OU8A 2GNTA 3UD6A 5CBLA 4PQQA 2WFF3 4IEPA 5FZFA 1I4NA 2FTYA 1GSLA 3E5PA 1SGJA 1IR1A 4DM1A 5DMMA 2WLQA 3SCPA 3MHUA 3MDPA 1DPMA 3OA5A 1C4RA 3WEOA 1PDYA 4BS0A 1O5XA 5A70A 2QPUA 4EF8A 3MMDA 2CNCA 2OEJA 4WVXA 5HOSA 5D8AB 4N6FA 2V2CA 5FSDC 4W87A 1MQRA 1E5NA 3GR7A 5L9BA 2QAPA 2E7TA 3NYDA 1QGLA 4IJBA 4AQ2A 4TUFA 3VBSC 3GZAA 4NIIA 4YN5A 3CEUA 1OA4A 4FR1A 1J58A 2YSWA 4LVAA 2VEIA 1KBJA 2YIHA 4PMRA 2HE8A 4ZODA 4AVCA 3R8RA 3VUOA 2W3JA 1R3TA 4OBTA 4PMQA 4GC3A 4Q8KA 5LXEA 3IIPA 5FZ1A 3CPUA 3O0XA 3SKVA 4O61A 2X2GA 3SRKA 3PZ9A 3RX3A 4RE2A 2YFUA 2ZMLA 4AMCA 2D5HA 1JI6A 2X5IA 3EXUA 1PZ3A 2OO0A 3GXIA 1EX5A 3EMQA 3EWYA 4CXWA 3L0NA 2VG9A 3WDWA 3W81A 3L4ZA 4MYAA 3GXPA 2VX6A 1L0PA 3N4AA 1OX4A 5IBXC 3G18A 5FREA 4RA0A 1W3LA 1TV3A 3AXKA 3ITQA 3AJ7A 5BNOB 3AC0A 1K5JA 5F5AA 3W5NA 1ISWA 3MIHA 1DJQA 2QJMA 4IUOA 1KITA 2JDNA 1GNHA 1JBCA 3QN3A 1KNWA 3FFSA 4C0BA 4KEMA 4Q8VA 1IR2A 4XHXA 3KCCA 1K7EA 4IEOA 3ACHA 4B3NA 3UNPA 1FCBA 4GLEA 2RJLA 4OV4A 1W3XA 3DXUA 1CECA 5JDBA 3WY6A 3W1QA 3KW3A 1BQGA 5IDIA 1TWSA 4XAEA 2DVAA 4KWKA 3KL5A 5CJMA 4IQLA 2VGFA 5FJIA 2D2JA 2VEMA 2CLIA 2Q3RA 1QWRA 4HTYA 1PM4A 4XFCA 3I10A 1OJXA 3BLFA 4PCNA 1M4WA 4KU8A 4Q1PA 4QLJA 3C4UA 1V7YA 4AX6A 3KLLA 3ZT6A 1K8ZA 1LHVA 2AQVA 4ZB5A 4NHKA 2MEV2 1H60A 5DABA 2CWMA 3N3MA 5FPLA 1PEZA 2HQAA 3W7PA 4HPXA 1XBFA 1VIZA 1V9U3 1CB7B 3WQPA 5IHRA 1U5ZA 4ASTA 1W3VA 2RVAA 3I2IA 5FR3A 2PAKA 2NX1A 3BWWA 5A7SA 4DZHA 5H9SA 3E2SA 1NE4A 2J7CA 1SQ4A 1CENA 4UR7A 4AZCA 3WJWA 3ALQA 4O14A 5FZGA 4MO3M 3NR0A 3J8F3 5CFDA 4LBLA 2NP0A 2BGOA 3S2JA 1F31A 4ZOAA 1XIFA 1MFUA 1BMV2 4BIOA 3N9RA 4CU7A 1CAVA 4GVHA 1QR7A 1QJY1 4LRSA 3RGTA 3B4UA 3WQVA 2WL1A 1XLMA 4IV3C 4ZXEA 6XIMA 2XZ7A 4FOQA 3KXQA 5BXSA 2WWUA 5L9RA 2XN1A 3JBG2 3PUGA 3WQ4A 2BZNA 4KT2A 1H8TB 3O1NA 3ARTA 4IQPA 3ATYA 2OKTA 2GJXB 1CAXB 3F4CA 5E9XA 3UQNA 4K20A 3SNMA 1EV11 5FF3A 1J83A 1EAH2 5FZ9A 2HE5A 3R8HA 3W21A 1KM2A 1O3SA 3BZGA 3H2CA 2V2DA 2ZAAA 3MZHA 1UD4A 5LBEA 3TUUA 3ACGA 2FH6A 3URNA 5A8MA 1EOKA 5KHJA 2JBMA 4AXOA 2I9UA 1KRIA 1W37A 5LBBA 5DMNA 1OB0A 3BGJA 1E6NA 3MJMA 3BLIA 1YMYA 1FY6A 1GZGA 5TQLA 5HJXA 1VBC2 2UYBA 4UR9A 2C8NA 3N3TA 1RUJ3 3PBMA 4OHYA 4QQOA 2FH8A 1K8XA 1EIXA 1P0EA 1E71M 3ABQA 3DKQA 2CBJA 3ZMNA 5CLTA 5TAOA 4DNMA 1CJPA 2VW2A 1JYTA 3BJTA 3V5OA 4NAMA 1NY71 1RUI2 4UTHA 2XB6C 3B40A 2C0AA 1RIRA 2A5ZA 2W68A 4BA6A 2EPLX 3GBDA 1NIUA 3WMSA 4CDWC 4CNNA 3HGOA 4GJJA 1LDCA 1MS3A 4KQNA 1D0GA 1FWCC 1HX6A 2QDEA 2O7QA 4PRTA 4ERIA 3LGEA 2W46A 1J8VA 1SR9A 4HP5A 1V93A 5DBTA 2J42A 3BJSA 4IIBA 1DKWA 2VW0A 3JB8A 5U4NA 4IXXA 1C5HA 3W7IA 2J8TA 3E5QA 2GNBA 3M6YA 4QX2A 3UP8A 4Y9AA 2G0WA 2DFBA 2VO5A 2BJSA 2NT0A 3CT7A 3DG7A 2WWJA 2C9AA 2PRMA 2R1LA 3VBUC 5LIXX 1WX0A 4NPLA 3SRDA 5A3PA 3N9PA 1G6CA 5HAOA 3VD3A 4DY3A 3GNEA 4Y5TA 2YG0A 1OG0A 3EWCA 1HXJA 1W0MA 4FAHA 3W59A 3B3DA 1LOAA 5KHGA 5I0DA 2Y34A 4A7YA 1CPUA 5K4XA 3KD4A 4BQYA 4FK9A 3SN0A 2PLJA 3WSUA 5G05L 1KM3A 2BTMA 3IJQA 3NZ1A 3IIXA 3WQFA 4P8VA 3ITXA 4C8DA 3IRSA 3Q45A 3C8XA 4BR1A 4GCXA 4F9DA 1BYCA 8XIAA 5A32B 3UGFA 2XPJA 5IXEA 4CPBD 3C0SA 3GVRA 1EYBA 5I8TA 4D6HA 3AMHA 4CCCA 3RMEA 1M65A 3LDRA 1Y9QA 2P53A 1TE1B 4A7KA 1HP4A 4OVEA 2VUYA 1EQCA 5HWJA 2PXJA 3VDAA 5K7PA 1NOUA 3MSYA 5FYSA 3B9AA 1G9DA 2XPKA 2OUHA 4OFCA 3CT2A 4K37A 1GZWB 4YNIA 3MV01 4B4HA 1DP0A 2FJKA 1YXWA 4IH3A 2E53A 1PAMA 2VI0A 1NAEA 1U1HA 3DAQA 4C65A 2G95A 1N3PA 2MNGA 4FXGB 2YPIA 1SW0A 4WSJA 1NZCA 1OWQA 2D98A 3CV7A 4ATFA 3BV4A 1Y65A 4MSSA 3S6PA 3LY0A 3GG8A 1NCRA 4IGMA 2DZXA 4Y2WA 1TPC1 3V0UA 1ZP3A 1ZZMA 2NLRA 3ECQA 2JB4A 1AQHA 1X82A 3KCOA 1BHGA 3S46A 4AHPA 3H3ZA 4UAPA 3B93A 3HJEA 4ICCX 2YLAA 3ACLA 2VZTA 1OIFA 3PTQA 1KCKA 5G4EA 1UJPA 1JN2P 2QDHA 2YB1A 5FZ7A 4CVWA 1S5NA 3TMQA 2VZRA 2H6CA 2Y8KA 3B0UX 1CX1A 1TV8A 1W9PA 3TN6A 2WCGA 1F6YA 4G7FA 3LXCA 2PTXA 1W8NA 2JKPA 4J3XA 5CZSA 1R87A 3NGJA 3G1VA 3HJRA 2WMHA 4KH9A 4CPBA 2YBUA 3WF1A 4J7RA 4H9XA 3G1XA 1KC7A 3H2MA 3T4WA 1RQHA 4EWJA 3NDOA 1LG1A 3A24A 1FOD3 5A2CA 1DQ2A 1VMFA 5K3VA 3U11A 1RB8G 4HSLA 3AJYA 3BODA 3W3OA 2V68A 3NO5A 4D7YA 5D9MA 2OU4A 4JQ2A 4PA8A 3WDHA 3BCDA 2YCLA 2BBVA 1IPJA 1W9FA 5C4WB 1D3GA 3W73A 4EPKA 3ROUA 3W20A 2DZVA 5AYBA 1H8VA 4AEOA 3ACFA 3MZNA 3ERPA 4RX0A 3VDCA 1OBNA 1WDDA 3DGBA 3CLMA 3WUGA 5BRPA 3F2DA 3LA3A 1RHCA 3BAXA 1CZSA 2E09A 3OSDA 4QR6A 1YIXA 3P0WA 3R43A 1C28A 3THPA 2QZRA 3ONCA 5CJNA 4AFCA 3ILFA 1XISA 2WBGA 3UWZA 3WJYA 4UW4A 1AR83 2JIJA 5HCFA 1MZ6A 1FNZA 5BNQA 1ZY9A 3BB6A 4GUHA 1AX0A 1JJKA 2WPBA 1ZL1A 3BW3A 5AYZA 3RJ2X 2C0ZA 4ZMGA 4ZHNA 1JHNA 1NDVA 5FY4A 3O1SA 1J6OA 3KM5A 4OI4A 1LORA 1GG1A 4S39A 1IS3A 3SKJE 3T0BA 3L5AA 4MGKE 3RPMA 3AI0A 3LMZA 2BXYA 1I60A 3MC5A 5CFCA 1PZ7A 1PMJX 3O6YX 5C2CA 4AHZA 4FTSA 1R082 3KT7A 3PJTA 2RR12 1A5BA 3IPVB 2E5CA 2JD4A 4QNEA 3OGRA 5CPOA 4DB5A 1AZDA 1GP4A 1EYEA 3P74A 2VBPA 2C91A 2VECA 4MWAA 3I4EA 1XYLA 2O8QA 1W9BM 2R32A 1DGLA 3CNYA 3Q37A 1K5MB 2Y6ZA 1UH4A 4XD4A 2GSEA 1LEDA 3UKTA 4ZSTA 1XIDA 1B4KA 5FPUA 1SBFA 1J9YA 4YTQA 1UZZA 1NZIA 3LV6A 1UY3A 3QHMA 1QNSA 3QH2A 5KXDA 3SITA 2Z7KA 5T52A 1DU3D 5KC6A 5AC7A 5HBAA 1XE8A 1MQQA 8XIMA 2A2IA 3TQKA 1UZYA 3PJYA 3EOLA 2CLFA 4NG3A 3CWNA 1PKLA 2INEA 3LXBA 3ZIXA 1RD6A 4OFGA 2JALA 3S0MA 4CP9A 2QGYA 3KF5A 4CA9A 4GD0A 3OVPA 3FFQA 5C4WC 4XPVA 3DGRA 2UYAA 3AWOA 2AEZA 3QZEA 4UNIA 3VD7A 3CZGA 4IX2A 3LAGA 2CGNA 5CG9A 1UR2A 5AHEA 1DIWA 3NQVA 2Y0OA 5F6KA 5FZ8A 4D7TA 4KRUA 4IHCA 1MUCA 2QCCA 2V30A 1OG6A 3PZNA 3UZWA 4ZB2A 3KX6A 5A7WA 4A8NA 4A21A 3LPGA 1JU4A 5FF0A 1CVNA 2CCRA 1LBMA 1BVP1 2ZGPA 1EH9A 3N2TA 1RINA 3EOUA 4RK8A 1JZ6A 3WD2A 1YJKA 2XM2A 1VB4A 3Q4DA 4GINA 1WCUA 3DEMA 2HWE2 5HR7A 5D21A 2D22A 2P88A 2DFAA 2JG9C 3QTGA 1GNXA 1UR0A 2PGEA 3QMRA 2V5JA 1SSGA 1TWDA 3NWRA 3CL7A 4H6QA 1CONA 5JU6A 1IG3A 4IXLA 2VC7A 4HMZA 4OU1A 4XYXA 2CETA 2VM9A 2RDQA 4DEVA 2W4XA 4NZJA 5CKMA 1XRUA 3WXPA 1LROA 1UBSA 4XURA 3EA2A 2WZIA 3SB0A 2YCLB 1GOHA 3RCMA 2V4VA 3U4AA 4LEJA 4ASKA 5FBZA 3IMNA 5FO9B 1QPOA 1OD3A 4GMEA 3TTYA 2VQAA 4CNPA 3ES4A 1N47A 4H9YA 3TCSA 2ZE3A 2GWGA 4JC1A 2NXGA 1HQNA 2RDSA 3IK2A 1GOOA 1P0NA 4JIHA 4GYJA 1UZ0A 1QW9A 1IEWA 3GIQA 3W88A 1XLGA 4TX9A 3W7OA 1BK1A 4IW3A 4LNCA 5CLWA 5F2SA 4WVMA 4IZGA 4NUWA 1NDZA 4TXWA 3GU9A 5AC6A 4U36A 2DZSA 3O0FA 4HCHA 3L5MA 4C6LA 3U1XA 5K9YA 4DXZA 4HYWA 1MZRA 4F9JA 3WJSA 2DVFA 1UCXA 3AZTA 4DO4A 4TO8A 5A7PA 1J12A 2LALA 1G0CA 2VGIA 4Q4V3 4V2VA 2D0GA 2DZPA 4YG0A 5FZEA 4S23A 1F9KA 1R3VA 4FB7A 1QXRA 4XBJA 3GU1A 4A4AA 4MNMA 4W88A 1K1DA 4WXZA 3I8TA 3A64A 2XFYA 5TD4A 4LUSA 2DT2A 4QDRA 1EGMA 4M0XA 5I78A 3ATGA 2QZ2A 4DQAA 2D2HA 4NPMA 5HMDA 2VMIA 4JHTA 1FHDA 1GVYA 3OIXA 3I4IA 1CLXA 3DESA 1V6OA 2Y24A 4MVAA 3D5HA 5DLCA 3MI8A 4FF7A 1G6NA 4RL7A 4EV0A 4LHKA 3W00A 4UTKA 5J5RA 5KINA 4PN2A 5IW0A 1U1UA 1XLIA 4RS5A 3J8F1 3MW3A 3UJFA 1S0IA 2PCQA 3TCEA 2REQB 3KP1A 2NZ9A 3CQJA 4JL1A 2CYGA 2WYFA 1DJNA 1XWYA 1YE4A 2NQLA 5DUVA 2Q71A 3NURA 4ZXLA 3VUSA 2PWGA 2PDYA 3KVMA 4O9GA 3W9AA 3KV9A 2A7RA 2VE1A 1GWKA 2R041 1YBQB 2OB3A 4TV6A 1K5MA 1MW2A 3OBKA 2Z69A 1UOGA 4GH1A 2XH7A 1O12A 1YQ6A 4AG0A 5BNPA 2EXOA 1KXTA 3SN1A 3AXHA 4YZ4A 3LHVA 2DCTA 3T78A 1UOZA 4AVOA 3HBZA 3BPSA 5EMUA 3LEIA 2EICA 1E0XA 4QIUA 5CKQA 2DBIA 1FKWA 2YA1A 1YJLA 3ZYBA 3QR3A 3T8LA 5HMSA 1UZHA 5FOOA 1SMAA 4YVVA 2PTYA 3P0XA 4HVRA 4TLGA 1PJ9A 3QBUA 4LYKA 2FDSA 1W17A 3CLWA 2OQHA 4WGXA 2WCSA 4GE8A 3W7KA 5FAXA 3PM6A 4MPKA 3MUZ1 5FOBB 2ACQA 4DY1A 4XFFA 3FEMA 3MP4A 5FYIA 4PRRA 1W3IA 1XPYA 3ZXFA 3UWYA 1JF5A 1COV3 4ADSA 2DUZA 3WFZA 4WM7C 4LOCA 3J7MA 1H2NA 3N7JA 4LKSA 3WEZA 1M53A 5J7MA 5D37A 3JD72 3OW1A 2ZUTA 4LULA