4UFMA

Mouse galactocerebrosidase complexed with 1-deoxy-galacto-nojirimycin dgj
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
644
structure length
640
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 207
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ufmA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ufmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ufmA01
1W5MA 4Z1BA 1TIMA 4Z1CA 3M47A 3S5QA 3W2NA 4O50A 1M7OA 7A3HA 1TJRA 1LBLA 1NWUA 1V6VA 3R5EA 5HR6A 5FD0A 3OGVA 3MUIA 4MJ2A 2CLHA 1IXPA 3RNDA 4GIAA 1WDQA 1G4PA 2W5FA 3ZMRA 1FH8A 4W5UA 3VIPA 1JCJA 1CXKA 2G3NA 2IXVA 1V3KA 2NWSA 3K30A 1PX3A 3M43A 4XBSA 1MEHA 1KV5A 2W62A 1LOLA 3VX1A 1TB3A 4UQAA 4CD4A 4DUVA 1JQVA 3LCIA 3M1ZA 2QAFA 2W63A 3WNNA 5A95A 2X0HA 2VO5A 2DORA 2QCHA 4M6QA 2WSRA 5CZTA 1IXOA 2IXUA 4DBEA 4J3XA 3B04A 2D20A 2WAGA 3OZPA 3ARYA 1XL9A 1Q6CA 3WDRA 3UESA 3AZRA 4O1CA 5LSMA 4Z2KA 3BAKA 1W31A 4P8WA 2H6RA 1L9WA 1SR0A 2X2GA 1TTIA 3T09A 1LJYA 3NEVA 1UR8A 1V0KA 4LY8A 1H2JA 3AMLA 5JUVA 4DWSB 5K9CA 2B7NA 3R8RA 3WUEA 4RV8A 1KGXA 3VTRA 1FWRA 2CFFA 1QVBA 4N2YA 2J7HA 2DT0A 2DZSA 1KR0A 1UG6A 4N9BA 3KVLA 1HL9A 2ZUNA 4W7VA 1OK6A 1TE1A 4CU8A 3IJ8A 3LCHA 1GTEA 3QMTA 3WH9A 3UXAA 4CCDA 1IF2A 1GCYA 2ZA1A 3MMTA 4UQEA 4LYPA 2J25A 1L6YA 1LRTA 1KBJA 1E0WA 1I1WA 1WB0A 3CZLA 4F66A 4HPHA 1HN1A 1M03A 1GPWA 1M5WA 2GK1B 4O57A 3DC0A 3PSVA 1I2QA 1QMLA 2GVYA 4GJ1A 1C7SA 1R7AA 3GBDA 4JTSA 4OHQA 3N73A 4FMVA 5HPOA 3PBGA 3BAJA 3W1XA 1WDPA 3W76A 2D0GA 2A1YA 4PN2A 5D38A 1VQTA 2Y7GA 1WZKA 5FEWA 3ARSA 4ZFMA 1QW8A 1TPH1 3ABQA 4PMOA 3NO5A 3HPZA 3A3HA 3K4AA 4IOTA 3APGA 4DF2A 3NSNA 1ISWA 1LROA 1EO7A 1OCQA 4LUIA 3UG5A 4K8HA 5A2AA 3UEQA 3W75A 1W1YA 2VT0A 4AHOA 3DHDA 3W7HA 3VIIA 3B06A 1JD7A 4DO6A 3TA9A 4JFVA 4NJJA 3NZRA 3EDDA 3QMRA 3S1WA 4LVBA 3KWXA 1I2OA 3B0VC 1TMQA 4RE3A 4NRSA 5G2HA 2ZWYA 4LS1A 1TPEA 3DECA 3AIUA 4XZWA 3K8MA 3LB0A 2WM0A 1DVJA 3NQDA 4M6PA 1GHSA 5A2CA 3EWYA 1JG9A 2GQ9A 3U5UA 1JZ3A 1P0NA 3U14A 4Z1DA 1EA0A 4NUWA 3VOCA 3HG4A 2YCEA 3DFNA 3UYCA 4PCTA 4QNWA 1D9EA 3T2PA 2QQWA 4UQ9A 1F05A 4IMGA 3B8DA 4CQ9A 1KCLA 3GM8A 1OG0A 3GNRA 3Q2DA 3QR3A 1H1ZA 3UD6A 1UD6A 2WMIA 1Q3NA 3AIBA 1I2NA 4JTLA 2RDTA 1QNRA 2O7SA 3VE7A 4UTMA 2B7OA 3G3MA 4BQ2A 3CZKA 4PMZA 4UMAA 4TUFA 3PBWA 1TTQA 3LIHA 3QH2A 3LV6A 2ZBTA 3DI0A 5DT5A 3G6LA 1MW0A 2WK2A 3BCDA 2DH2A 1HIZA 1H51A 4JHOA 2JKEA 2X1SA 3DGRA 1UR0A 4EKJA 4KGLA 1GOXA 3PF3A 2WPBA 1AW2A 1X1OA 3U1XA 4RZ4A 3QOKA 3A4WA 3FY1A 3FJLA 2E8ZA 3PZIA 4AIUA 3IRDA 4O17A 4MY8A 2YL8A 4Z2HA 2W4XA 3CZJA 5GNYA 2Z6IA 1RP9A 1XBXA 4P2VA 3NIYA 4QCEA 4FXSA 4UTTA 1GOQA 4PMXA 2CZEA 3HIJA 5GPRA 5D2TA 1C8XA 1HL8A 4EIVA 3NQ7A 1E72M 4D6GA 4CQ8A 3CHDA 3STEA 3YPIA 1HL2A 1E6PA 2CETA 2E9BA 4PMDA 3W7CA 3WD1A 3OVRA 2ZE0A 5CQ1A 1SMDA 2VCCA 4ZE4A 2C6QA 4CU6A 3QF0A 3LGEA 1OBAA 5AFDA 2QV4A 2W0UA 3WJSA 2VI0A 2GPTA 2NXGA 3GNDA 3W74A 1VGAA 3VVGA 1C8VA 2DGAA 3VIHA 3WJYA 2GFTA 2XFYA 2A3EA 3IAQA 1Q6OA 5BOOA 4GBUA 1ISZA 5LKYA 4W89A 4AZCA 1EIBA 5FK8A 4ZL1A 3TQ0A 3AHTA 2GJNA 2V38A 1QBAA 1BG9A 3GH5A 2W79A 1GOMA 1X1NA 4WK9A 3ZR5A 5DBUA 3UG3A 1H1NA 2ZZ1A 1GJWA 1TV7A 1XM3A 1WNOA 4OGZA 1VFUA 3CHFA 4HA3A 4JAWA 4QFUA 4NQ1A 3EMZA 3C56A 5CPOA 1JF5A 1BFNA 1H5YA 3L66A 1SZEA 4ZQPA 1ZBVA 3L0KA 3F4WA 3WD3A 1WOBA 5H2ZA 2Z6JA 2QMKA 3GXMA 3W27A 3ALGA 4N0RA 3W2KA 4AIEA 1NEYA 1A50A 2ZUVA 3CB8A 4H8VA 1OYCA 5FKYA 1OABA 4W87A 4U31A 3WF4A 4GPNA 2PURA 4RK8A 4BQ5A 1TVNA 2O92A 2A3HA 4BI6A 3DI1A 3AS3A 4WZHA 2VEPA 4C1KA 4FNUA 2P1FA 1OFOA 5GNXA 3CWOX 3G1VA 3A24A 2WMIB 3L2MA 4MKNA 2CBUA 3L4ZA 1UD4A 4PMYA 4MADA 3GX9A 4GZEA 1W3KA 3FKRA 2DZXA 1ZY9A 5AYBA 5I77A 1JFXA 4U5KA 2QCDB 2VZTA 4BFAA 4MJZA 3VDAA 4Q33A 1JDAA 1MFVA 3UWVA 5BXTA 1F5ZA 2C14A 4HNVA 2ZXQA 1LF1A 1W2VA 1AW1A 2PE4A 3WNMA 1KM6A 1OX5A 3C2FA 2BVTA 3SCUA 1KWGA 1JCMP 3AMGA 4OV9A 3TCEA 4PSPA 2DSUA 1UH2A 2NWRA 5A8OA 4H8HA 3H3LA 4PL1A 3BC9A 1QWGA 5EFDA 4TX8A 1JZ2A 1E6XM 2BVYA 3AMKA 2G96A 3W3OA 1FCVA 1HX0A 3AZTA 4URIA 1UD3A 3AICA 4YN5A 4ZXOA 1XCFA 5D04C 2A85A 3PUOA 2FB3A 1B31A 2CHOA 3CZGA 2G95A 5AN7A 1UKTA 3NYZA 3SECA 5BXRA 1LLZA 5ANNA 1UR4A 4UNLA 4XV0A 5FOOA 1CGVA 2H90A 1WAUA 1OGBA 1UWQA 3TSBA 2HSAA 2QJIA 1UZ1A 1AQHA 1J4EA 3OIXA 1GZJA 5I3KA 2J27A 4DM1A 2RKXA 4JYEA 4KWWA 2D1ZA 4PTMA 1W9XA 5D37A 3NGJA 4P61A 4CGTA 1L2UA 3P7YA 3FHQA 3C2EA 3SCSA 1K7FA 1JAKA 5AYIA 3WEZA 3SCNA 2NUWA 1IGSA 4A21A 3AXHA 3W37A 3OG3A 2ZDRA 2H8ZA 1AMYA 3F4VA 3VE9A 4TTUA 5LYRA 1RVGA 3AHYA 3G1AA 3PM6A 3STFA 3U6WA 1M53A 3AS0A 1E15A 3HMCA 3MSDA 3WH5A 3TX9A 2F8QA 1QOPA 3W24A 5JBDA 5CZSA 4HNNA 3HPSA 2UY2A 3NL5A 4F9JA 1IXNA 3EWWA 3CTLA 3N2MA 3R12A 4AWUA 2WZEA 3VUPA 3WQ6A 3WUFA 1JZ4A 2OSXA 1VHNA 2QQVA 3TMLA 5KZDA 4CD7A 5CZ0A 4J3UA 4FIQA 1MXSA 1DWGM 4MFEA 2ATMA 3Q37A 2ESCA 3W70A 4Z0SA 2WCSA 4HPGA 4LYRA 4IUOA 2ZX9A 2TPSA 5A6BD 5DN1A 3S9YA 3ELFA 1EHNA 2B7PA 4O54A 1B4KA 3ZR6A 1U5JA 3P81A 4O12A 2CERA 3AXIA 2QCFA 4WLCA 2DT2A 4S2BA 4YMZA 3HBKA 5FMBA 3G0XA 1UKSA 4UR7A 4X3ZA 5CG0A 4IJBA 2D0FA 4J27A 1Q6GA 4NJHA 4UTUA 1GQKA 1KXTA 3CZEA 4AEFA 1O5KA 2Y61A 3VGGA 1MFUA 2DZUA 5FMCA 1D3CA 3W1AA 3C2RA 4QJ1A 2XFWA 1EB3A 2CYGA 4JFWA 4PTWA 5A8PA 2P10A 2NX9A 2W67A 3MSGA 2ZRXA 5JIPA 4MJMA 1QPQA 2E5DA 2PWFA 1M7XA 2J62A 2PRMA 4ADSA 1JI1A 4JFUA 1WDRA 3HF3A 1OK4A 5BXSA 1H50A 1EOKA 2D0HA 1UWUA 4MVAA 5F4SA 3P60A 4UCGA 3T55A 3EDFA 2GJRA 3BLPX 1EA9C 3DZ1A 3GZ3A 4M5PA 1GUVA 1Q6DA 2WSKA 3KFTA 5ABEA 2VOMA 2FJKA 2OLHA 2XN1A 3W7RA 1DJQA 4O15A 3J7HA 4D1IA 4L4LA 3GYEA 5AY7A 3JRKA 1J2WA 3GNNA 3VIMA 4QLLA 2YDQA 1A5SA 3M44A 1I2RA 3BARA 4E2DA 1UA3A 4M29A 3TC7A 3I3BA 3PZMA 4GI8A 4MNMA 1P5BA 2Y62A 3IAPA 1LWHA 3LBCA 1TSIA 5G2IA 3C0JA 3F4NA 2A5HA 4MFDA 5EA9A 1MYRA 3G8EA 5HWNA 3GXTA 4JKMA 4J28A 3R2GA 1KM0A 1FBAA 4AZHA 3RU6A 1EOMA 3O8AA 3HGJA 3OHIA 4A29A 2YIHA 5HBFA 1KBBA 2ZA3A 3I7SA 2OSYA 2JKPA 1B1YA 5CGMA 3S0CA 2NZLA 1E4IA 3P61A 4HPXA 3IGXA 2W61A 4MY9A 3SCTA 4EOUA 3OZOA 1XKYA 4OBSA 3TMQA 2ZFAA 4FIRA 4BI5A 4WKFA 3T0AA 1H11A 4EANA 3Q58A 5ECUA 2Y88A 4JTGA 3MI6A 1JAEA 1ZU8A 3WNOA 3RM9A 2R91A 3G6MA 5A6AA 1KLZA 1KXHA 4DWSC 1TPFA 2ZUTA 1PV8A 1RR2A 3CEUA 4X9SA 3W2MA 1OT2A 1V6WA 4HMDA 3RK8A 4HT3A 5CGQA 3STGA 4AD4A 4S3JA 2D23A 3CH9A 4UTFA 2AEZA 1YADA 2ZZ3A 4J9JA 2FIQA 3WD2A 1ODZA 3IGUA 3VNZA 2EPKX 5CSRA 4NNCA 1BKSA 1WO2A 4B9ZA 3FFSA 2FGZA 2DPEA 4LYQA 1FFRA 3LTSA 1N8FA 4PL2A 5C5YA 1E4MM 1WQ5A 4FK9A 1CGTA 1T99A 1ZL1A 2FHCA 3L4YA 4AWEA 1F6KA 3G1FA 3EEGA 3TQKA 5TQLA 4KFPA 1CNVA 2EPNA 2OWWA 1KQYA 5A2BA 5DEZA 3W7DA 4EK7A 2DDXA 3EB2A 3O15A 1QPKA 2ZUWA 2O9OA 2VCBA 2YDRA 3WDPP 1TPB1 4C1LA 3ZM8A 3WBAA 3WQ5A 1FCUA 3L5LA 5CSYA 3TU9A 5LA0A 2RFGA 3ZT6A 1UWIA 5I79A 1GHRA 3NSMA 1DEDA 4WKHA 3DFSA 5KZEA 1HJWA 1W2TA 4FNSA 1ISYA 4UCFA 5LGZA 3B9AA 1MEIA 3B8SA 3PZUA 1VYPX 1KTCA 2E5BA 4NT0A 4F79A 4JTHA 2DP3A 4O4WA 5K4XA 2QUVA 4ACZA 3GDTA 3ARXA 3VPLA 4I7WA 1OIFA 1GJPA 1JYWA 1J5TA 1J0YA 1BQCA 4Z08A 1LWJA 1SW3A 3NPVA 4FEZA 5LNUA 3N1AA 4PSRA 1JYNA 4PODA 3WMCA 3FYOA 3BLEA 4LTSA 2WOQA 2VFIA 2VCAA 1YLVA 4YL2A 3AROA 2VZUA 3RF9A 1WYIA 1W5PA 3W83A 4LVGA 3NL3A 3W1QA 3NDZA 3LXCA 5CPQA 1E4NA 2ZTJA 3MUZ1 4Y90A 2JK2A 1LM1A 3HOJA 1VR6A 4QIUA 4ZQOA 2GJXA 3BMVA 4QLJA 4CU7A 3GKAA 3QC3A 4GI6A 5FKBA 2QCCA 4AH7A 4IWWA 4NZFA 5EFFA 5JBFA 5LNRA 4LRTA 2WMFA 1KFKA 1LOSA 3G1SA 5AOUA 3T44A 5LHEA 4RZ6A 2XFFA 3D3AA 1XCXA 3L65A 4KRTA 6ALDA 4DM2A 4MNLA 4CVWA 1UYPA 4AZ7A 1JDCA 5DFAA 3KOFA 3OVQA 3W7JA 4CUCA 1VZWA 3E1F1 3EMQA 3QHNA 2J7FA 3B0PA 3EWZA 4FX8A 1H4PA 3SIMA 4JKKA 3EWUA 3MP5A 3WQ4A 4FX6M 3CGTA 3WH6A 5E0CA 1CENA 4XBKA 1FCBA 2BHUA 1ZJBA 2HVMA 1B3XA 1GOIA 4ICNA 2ABAA 2G41A 4NZJA 4IGHA 2VZSA 5FF0A 3P5ZA 4P7QA 2I9EA 4QM1A 3M5YA 2FHFA 5KSWA 3T2OA 1HF6A 1PVNA 2W6RA 3LTYA 3BGJA 1CXFA 2VEMA 2EJ1A 4UQBA 5G4WA 3U7BA 5DBTA 2YA0A 4AHQA 3GR7A 4D1JA 3VGEA 4A4AA 6A3HA 4IQLA 2R8WA 3GLCA 3B9DA 1G7VA 2F84A 4GQRA 4AD5A 3A5VA 5DXYA 5LA1A 3TNOA 1OVDA 5LNVA 4Q7NA 4TOQA 3HGOA 2CZDA 1XBZA 1ZAHA 2YZRA 3WFAA 3MUY1 1RP8A 2QAPA 2PWHA 4D2JA 3W1TA 3LPGA 5AC4A 4XUGA 2X09A 1GVRA 3DYOA 5I2UA 4R34A 5ABGA 2QQUA 3OEXA 4NSBA 4V2XA 1E3ZA 1G9HA 2RHGA 3ZSSA 3KRZA 5BRQA 2GVJA 4ACZB 4CN4A 1KA9F 1QNVA 1QHPA 3WMSA 2AAMA 2ZTKA 4ONVA 5AYZA 3M07A 2BTMA 1H5VA 4WSKA 4B16A 2X30A 4CVUA 3IGSA 3MO7A 1UB3A 1S46A 5D9MA 1VHCA 4AY1A 3TONA 1FDJA 1THFD 3KXQA 4A2SA 1V0LA 3AIQA 5D9PA 4PYSA 4O28A 4PFMA 3CWNA 4MZ1A 3F5JA 2CLEA 2BNJA 1TTJA 3KVMA 3RLVA 3LIGA 3MBDA 5EMUA 3FW6A 1G7UA 3P5YA 2B0MA 4IMDA 3IV3A 3DENA 4GUIA 2QCEA 4DF1A 4YHGA 2WCGA 3O9NA 1MQRA 4D6HA 5GQBA 1RD6A 1UWSA 2WPGA 1LOQA 3R89A 1B9BA 2GQAA 3PUDA 4WXYA 2QMJA 3M7SA 5CZKA 2BSLA 3BCFA 3RWKX 2XM2A 4KRUA 3N2XA 3LTPA 1GW1A 4MJ4A 3ANYA 4B5NA 1UD2A 3DYPA 3VGFA 4X22A 3GNOA 5D30A 4E0CA 1UASA 1WA3A 4QNEA 1GTHA 1G4EA 1XRVA 8CGTA 3PZGA 2OX1A 1CXIA 4UZSA 2PI6A 3PB2A 5G5IA 1E55A 1F4HA 3TP4A 3ATZA 3LHWA 1XBVA 3TAKA 3NPXA 3WBEA 3CLWA 1B30A 3TAOA 3TC6A 4U2YA 4UOJA 1KV8A 1H7PA 4K7VA 1E40A 1OM0A 1XH1A 2DH3A 3DU0A 3FYPA 3L4TA 3CUHA 1BTMA 2GVLA 1QFEA 3WJXA 4ZZ9A 5A6BA 1FX6A 5DCBA 3BW3A 4GUFA 5DF0A 2YGYA 4GFSA 1ME9A 3BAWA 4D6DA 1QBBA 3TW6A 2DZPA 2G5WA 5L9FA 5BRBA 4L4MA 4PTNA 3EWXA 1VENA 2OWXA 4OZOA 3WIJA 4IPIA 4O1AA 4DELA 2VRKA 1UKQA 2WHKA 3VGBA 2WVUA 1GQNA 1C8QA 1GORA 2J9ZA 2CKRA 5AYXA 1NOUA 1DKWA 2J4GA 3C6CA 1YXYA 1R85A 4KGJA 5KZMA 3RM8A 2GOUA 3QPZA 3B05A 1TCMA 2TRSA 4J7RA 4HA1A 4YWIA 1R46A 1UJPA 3AO0A 4ZQMA 2XJ7A 3OLDA 3W82A 3B9EA 4UUIA 1SSDA 1CEOA 2CWNA 3S5ZA 1J9YA 1R8LA 1G01A 1ZBKA 5A6MA 1Q4NX 1O6IA 4A2RA 2OZ0A 4IMCA 2VEKA 3CUGA 4I7UA 4JTKA 2OMAA 1E43A 3OG2A 2QCNA 4UFJA 2YKKA 4JY9A 1E6QM 2ZXBA 4MB5A 1BTCA 2MANA 1K02A 3L5MA 4QP0A 3NNTA 4FO4A 3LPPA 1NWTA 1AW5A 3NQ2A 2XM1A 2X16A 5DLCA 1VPXA 3FAWA 2VEIA 1LLWA 1JF6A 4B3LA 1YHTA 1VCVA 5F7UA 2ZOXA 2Z1SA 3KF3A 3EYPA 1BEUA 3WDJA 2CLFA 4ACYA 3MP4A 3L4UA 4V27A 1NM9A 4UNKA 2Z0IA 2Y8VA 3HN3A 2ZYFA 3QMSA 5CZJA 3LLFA 2VTFA 3CEPA 4WSJA 3UY7A 4M19A 2VOTA 3N34A 1ODUA 4EAMA 1Y9MA 5I3DA 1OF8A 4FFHA 3LI0A 3W7LA 2I14A 1E51A 4LS0A 1W0MA 2ABBA 3L5AA 3PS7A 1GQIA 3ALFA 4XTIA 3TE9A 1FDYA 5D32A 4JX6A 2RH9A 2QCLA 1M01A 1VEOA 1LBFA 2JKAA 5FI8A 1UCWA 1CI1A 2E68A 3N11A 2H8XA 1PJ9A 3F03K 1PHWA 3DAQA 1G1YA 1XD1A 4UZUA 1OFDA 3N9RA 4KKXA 4K6AA 1LL4A 1QNPA 4AC1X 4AZBA 3Q94A 3BMWA 2HS8A 1ME8A 1H61A 3MI2A 4HIBA 3V1PA 3CQ0A 1MW3A 1EGZA 1H0IA 3LI1A 2YA2A 3GAYA 3QM3A 4JR5A 2XWDA 4PTXA 3T0DA 1JXJA 2E6FA 2VFFA 3IIVA 2E09A 5SWUA 3GIYA 3KL0A 1FFQA 1XV8A 3NA8A 1JCLA 2G8ZA 1Y7VA 3MANA 3DH7A 3T7VA 1SUXA 3HG3A 1JD9A 3E0IA 2F7FA 3BG5A 3P74A 2PWDA 4M1RA 3W7EA 5C6MA 1J12A 5E09A 4AMCA 4Q22A 3TXVA 3PB0A 2PBOA 7TAAA 1W3NA 1JR1A 4O14A 3VNYA 1K03A 3TQVA 5FIXA 3AZSA 2Z2UA 3MUXA 3ARVA 2NLIA 4GZIA 4W7UA 5FEZA 5G1TA 4D6JA 1NVMA 1K9DA 1RQEA 2A4AA 1SYTA 3AIRA 1IT0A 3W81A 2UY3A 1PHQA 3LF7A 1KBKA 1CYGA 3N04A 3SCPA 4QQ3A 2C19A 3EX1A 3HG5A 1X1ZA 3OSDA 2BWGA 3G1HA 1WDSA 1W3LA 3ARUA 2WZIA 4BQ3A 1E56A 3P8IA 4P7NA 2QCDA 4WXZA 1BGAA 1A5AA 4QHZA 3TROA 1UR9A 2FGLA 5I3IA 2WMJA 1NF7A 3WF2A 1M04A 4ZVJA 1FWTA 4CQAA 4L4OA 3WKZA 4OU1A 3VD3A 3O1NA 2TAAA 3O6AA 1F2JA 2XHYA 2YJQA 3IMMA 1JNEA 2J75A 2VX4A 2DSKA 5D05A 1VEPA 3EDEA 5AHEA 1RPKA 1K8YA 2BX7A 2XSAA 3SSJA 1JYXA 1PIFA 4CCCA 2ZIDA 4D6CA 4AF0A 4MIMA 1TV8A 1N55A 3WF1A 1P1XA 1T96A 2WJZA 3PBYA 5EPDA 1HJXA 5CXPA 5AHIA 1SQ7A 2X1IA 2WNQA 5D2YA 4IX2A 5M17A 4AYSA 2Q8ZA 3BW2A 3T40A 3WENA 1H7RA 5E6ZA 4R33A 1GEQA 3PG9A 2X8RA 1ECEA 3CUFA 1U30A 2VKZG 1WE5A 2ZXAA 1ZBWA 2CBVA 1GT8A 2J8FA 3ZOAA 2BV9A 1FWWA 2Y89A 3P62A 3MMWA 4BF9A 1V6YA 3O07A 1BYBA 1RV8A 3PN8A 9CGTA 1FHLA 2VC6A 3GZAA 2C7FA 4E8DA 3RIKA 1QCWA 5K9DA 5C54A 1XGZA 2EPMX 1PZ3A 2F61A 4K36A 1GOKA 3OGRA 3ZJKA 2XGBA 4DPQA 4IPJA 4HP5A 1WDWA 3BVJA 2O9PA 2AAAA 3LRKA 3VM5A 3EX6A 5AHMA 4JHZA 1V5XA 4ZMGA 4QISA 5T26A 1Z41A 1CGUA 1F7BA 5BMWA 1W1ZA 1RZMA 3LOTA 3MMDA 1JZ8A 2RDWA 1GQJA 2XQRA 4GINA 4UMBA 5CLWA 2A7PA 1K8XA 1ZALA 3DKLA 4FNRA 1H41A 5M3WA 2ZZ7A 1P6WA 3CHCA 3ZWTA 3U7VA 2QR6A 4JTIA 4BWLA 4K38A 3NYDA 5A6JA 1SZNA 2BY1A 3BLFA 4N9CA 3IIOA 1OINA 4AAJA 4G1KA 4EF8A 1MQQA 1NWSA 3EDJA 4GC4A 2YW3A 4Y96A 1KB3A 3VNDA 5G4EA 1HP4A 1CECA 1G94A 2OYLA 1UZ4A 2OXBA 1QR7A 4AW7A 5A69A 3MV01 4PUDA 3VIGA 1W91A 5AC7A 2X0YA 3ZIZA 1US3A 1F76A 3EWBX 1E6SM 3LCGA 2CLMA 4N4PA 1BVNP 1W3HA 2J88A 2EPHA 1BYDA 4P7OA 3M6YA 4JYFA 2VL4A 1GZGA 2WQPA 3HGSA 1E4LA 1OIMA 1R87A 3UWUA 4Y8FA 3CIVA 2PRHA 2VC9A 5D33A 3AYSA 1I2PA 1FWNA 2DEPA 4ZQRA 1V6XA 1PE1A 5J5DA 2QDGA 4JYDA 4MB4A 4UQCA 3CUJA 4UFIA 4LUJA 5U7SA 4ATDA 3OGSA 1KXQA 4AZ6A 2ATSA 2VJXA 2ZZ6A 3F1QA 4GNJA 4AF0B 3S8HA 3RCNA 1A5BA 3DFQA 1GWJA 4Q4KA 5JBEA 4JTFA 3BK0A 4QAWA 1XH0A 2PCQA 2WNZA 4RKAA 5IBXA 1KBIA 3AMCA 1GOOA 3DKJA 4K7YA 2DT1A 1D3HA 3AXXA 6CGTA 3NR0A 2VMFA 3RLUA 2V5DA 4PH6A 3C3NA 1GVFA 2Q3RA 4CLMA 2EQDA 1TPUA 4CNPA 3IK2A 4JFTA 4EQVA 1DV7A 4GZJA 3BH4A 2I1OA 4W9TA 1N82A 2XG9A 1FP8A 1EP1A 5FESA 1EDQA 5C71A 4U3AA 1GVOA 1LRQA 1HT6A 3ZSTA 1JRBA 2E5CA 3SJ3A 1NH6A 3NPUA 1H60A 1HUVA 3KRSA 4UMCA 2WLZA 4PEEA 4W86A 2XVKA 3S2CA 3HQ1A 4JCMA 4ADTA 2BVDA 1KM3A 4QAIA 1FWSA 4CD5A 2OJPA 1TREA 1QPRA 3SUVA 3GDRA 4AD1A 4W8AA 4K8EA 3MBFA 2C1HA 2V2HA 3VD4A 1QOQA 3II1A 1R30A 1XSIA 1TUXA 4AD2A 3WL1A 1YYAA 3MW7A 4M81A 1ICPA 1KFWA 1OD8A 1W3IA 2BXVA 1KFJA 4AZZA 3SUWA 1CGWA 1D2KA 1KQZA 1YTEA 2VQUA 4W7WA 1YDVA 4AB4A 2WWDA 5BROA 3VDBA 4ZQNA 5HWMA 1QI4A 4B3KA 3STCA 3CPRA 3UY8A 2WC4A 1W8SA 4XB3A 3UPBA 1V0MA 4NI3A 1NAL1 4LT9A 4H04A 1BWKA 3WQVA 3PC0A 3GXDA 2YPIA 3ABRA 2XUCA 3CIWA 4K37A 1ZENA 2C15A 2ZRZA 1UOKA 2J74A 1PS9A 1Y4WA 4XWUA 3V75A 3BV4A 4BZYA 5KEZA 1W37A 3EDKA 2VXNA 3SCWA 3UR8A 1PIGA 3QSRA 2XVPA 4JIQA 1GVIA 2YFOA 4JL1A 2ZX6A 3TK7A 3W87A 2EAWA 3MWAA 3IJ9A 1KCKA 2CBIA 3U5YA 3I65A 2A6LA 1XUUA 3EX3A 4O0ZA 5AC8A 1HJQA 4PUEA 3RM4A 4H41A 2CLIA 3M7WA 4QITA 1C8YA 3F5KA 5GVJA 1NARA 2PC4A 3SCVA 4FNPA 3G1DA 1WZLA 3POCA 5D09A 5C8BB 1MVYA 2YDAA 4Z2LA 3EBVA 5F2LA 3A5FA 1LQ0A 3TSDA 1EEPA 1DQWA 2Q8LA 1HVXA 3NQMA 1KWKA 1UH4A 2YL9A 3S5NA 4MTVA 1EX5A 4U28A 1NSJA 2Z1BA 1TPDA 3VILA 3TIMA 5FL1A 1G69A 3TTOA 3P8JA 5FF4A 1JFHA 4YLWA 3CZ8A 1TA3B 4UTJA 2ZZ2A 2QHAA 1W1TA 3CMGA 1Y0EA 5A1AA 5EL1A 3TW7A 1KXVA 2V5LA 1ZFJA 2VRQA 4H3DA 3AOFA 1T8XA 1ESWA 3VINA 1J18A 1HP5A 1NOFA 1TRDA 3L2IA 5F2IA 3IIZA 2BXZA 3WNKA 4WOQA 5FF7A 4V28A 3MHGA 1Z42A 3VGDA 2WVTA 4WX2A 3L67A 1W1PA 2AGKA 2QPSA 5C70A 3ABSA 4WY0B 1V02A 4O8RA 2TYSA 2BFGA 5D8WA 2J7GA 5HXMA 3W22A 1PCWA 3W7MA 4WJXA 3MUAA 1O60A 1JDDA 3L4XA 2ZWZA 3OA5A 1OJXA 3FXYA 4W88A 1QDSA 4NNBA 3PWAA 3NQCA 1OFPA 3BW4A 5K2ZA 1SU5A 4RLIA 1JYVA 3TUUA 4GO9A 1FDZA 1YTDA 3L2LA 3CT7A 1WAWA 5E1QA 3LPFA 2DQXA 4MOZA 1JQXA 2XIIA 1TO3A 1TQJA 2YR1A 3P84A 3PBUA 4WD0A 4WUIA 5IHRA 2CESA 5LA2A 4IXXA 3K4DA 2QJHA 2Y6ZA 3PR2A 1CZ1A 2DIJA 3FN9A 4R5EA 4JTEA 3QHOA 1Z48A 5U4NA 5EB8A 1XC4A 3SCOA 2GSJA 3N13A 4O4VA 5BNKA 5DCDA 1CGYA 2GDVA 3KL5A 3RMJA 3VM7A 2V3EA 1V6UA 4NNAA 4LC6A 4MLRA 5DXXA 3U2OA 1HKIA 1ZHAA 4JGDA 4AWTA 1E6NA 4MUZA 3ZO9A 1TPC1 4AD0A 5I6SA 1VC4A 5KMYA 1W5QA 5HR7A 2YW4A 1XCWA 3C2OA 4ALDA 1KFBA 2VENA 3W7IA 3DFTA 1GJUA 3W73A 3UWZA 3W71A 3GH4A 2EHHA 1QPNA 4O52A 2V82A 2WKJA 1DWAM 4LWWA 1UQZA 2OWCA 5EBUA 1WKYA 1J01A 4B1LA 3G1YA 4N9EA 1OFQA 4LW7A 4DPPA 1HKKA 2ZICA 3DHPA 3WN6A 3A6OA 5EMYA 3L68A 1BPLB 1MZHA 5TBOA 4FFIA 3H54A 4J3SA 4IMEA 2Y8KA 3WK0A 3PG8A 4GXPA 4ATWA 1V3MA 3WEMA 2Q8XA 1PPIA 3W72A 5DCEA 1OGGA 1ZAJA 1JL8A 2Y7EA 1LDCA 5ABTA 1JNDA 3AIEA 2YBTA 2ISSA 2OT0A 4I9AA 3OB8A 3I68A 1KM2A 3GNPA 2DIEA 4BS0A 1PL9A 3WK3A 3WQWA 4LVAA 5M03A 2O9RA 1M7PA 1ZAIA 1Q6FA 2UV8G 2PC8A 4OIFA 3FNDA 4KWUA 4KFNA 1HJSA 1BHGA 3SCRA 4UR9A 3NL6A 2A7RA 1LL6A 1ME7A 1I4NA 3C52A 1NF0A 2CXGA 3LRLA 3USBA 4Y6GA 3CMJA 4BF7A 4D6EA 3A22A 4WQ6A 2BHZA 3QEZA 8TIMA 2CZFA 3UERA 2HISA 3W6MA 4JDBA 3TR2A 4BR1A 4W5ZA 1Q45A 1FXQA 3F5LA 4PMUA 2YOCA 4S3KA 2QUTA 1K7XA 4Q32A 5BXPA 5CPMA 3OLIA 3MV11 4M8UA 3LHYA 2DZWA 5HWJA 1TR1A 1V03A 1QAPA 1KGUA 2GVGA 2A3BA 4TMBA 3AIWA 3WF3A 3FIGA 4ZXLA 1DWJM 2JFEX 2UY5A 3FAXA 4QSHA 3UZ5A 1C3FA 4U5IA 4BI7A 3SC7X 2IQTA 2E9MA 4U2ZA 4U33A 1ML1A 4AISA 2HTMA 1UUQA 1KFCA 4RZ5A 3SY5A 1WV2A 3GDMA 4GQQA 1Q6EA 3G8RA 3NQEA 4LV9A 1SO4A 1UWRA 3W53A 1E1EA 4MAVA 3LDVA 3P82A 3B03A 2E9LA 1VCGA 1A5CA 1MO0A 3W6YA 1W9BM 5ABFA 2DU2A 3PAJA 3GR8A 2GJLA 1KLYA 4DQWA 3QFEA 4UTHA 2W66A 5D9OA 2J8GA 3POHA 1V3JA 2NUXA 1XH2A 1XD0A 4PMNA 3VU2A 1W54A 1CXEA 2WHMA 1T0OA 3NQFA 7CGTA 5FMDA 3NJ3A 4FXRA 1QHOA 5IDIA 1FUYA 1H7XA 2QLYA 4OUEA 2ALDA 4O10A 5KZ6A 4YPJA 4TX9A 2J7BA 1VRDA 4WY0F 4UOQA 4HOXA 1RH9A 4HNTA 2J7EA 1JJKA 1F73A 3MYPA 1FH9A 3LMYA 2GJPA 4AXNA 4PMQA 3PY2A 4I7VA 1CX9A 2ZX5A 4OKDA 3HJZA 3SW6A 3BPWA 1CGXA 1X6LA 5D4YA 3NMBA 4CNOA 4D72A 2E1DA 3CHEA 3K8KA 5DT7A 2E6DA 4FFGA 1E73M 1EDTA 3NXFA 4OV4A 1B3ZA 3W26A 2FQIA 2P0OA 5EY5A 1W56A 1QHZA 2WBKA 3NG3A 4S1FA 2WHLA 3GK0A 3M5ZA 4JKLA 4O19A 4W85A 2WKGA 4TXEA 5A3HA 1E6ZA 1VIWA 3S6DA 3O63A 3NL2A 1C7TA 3MU7A 3FA5A 2ZUSA 4X9YA 3C61A 2DJLA 3QRHA 2NT1A 1SZFA 3LHUA 1DJNA 4JQTA 3UNDA 3W7OA 4OWGA 4WKAA 4FLRA 1H63A 1R86A 3N9SA 3W85A 4Y9AA 2V30A 2WCAA 4J3WA 5LHFA 1PBGA 4FFFA 2WMHA 5K3VA 3UGFA 5HPCA 1YQ2A 2QF8A 1AK5A 3DXIA 3O05A 1G4TA 3OVPA 1YXDA 3IIPA 3MHFA 3PSWA 1H7WA 3QJAA 5KITA 3NQAA 1PZ2A 2BY2A 2D24A 3ARTA 5JIWA 2ZUUA 1XSKA 3RO8A 1KFLA 2RGLA 2VX5A 5I3HA 1QPOA 3WF0A 1ALDA 4IX0A 3VI2A 1IV8A 7TIMA 1XI3A 1C92A 4JX4A 4JFSA 1JUBA 3M5XA 3W0KA 1TZ7A 3BSGA 3RILA 3NM3A 3W1MA 2JEQA 4WJEA 1E70M 4OBTA 2QCMA 1UD8A 4JD4A 2CCRA 3W6LA 1QNOA 3PIJA 4BK9A 1EUNA 5C2XA 1FOBA 5L6UA 1S5WA 4R7JA 5DY3A 3AJXA 2YX0A 2YBUA 3IVUA 1HG3A 3ECQA 1HO4A 1IZJA 1XYZA 4Z2IA 4HMCA 5M5DA 3K1DA 4ORMA 5ABFB 3DFPA 3WELA 2YYTA 4OE7A 3ZJ7A 1US2A 3C2VA 1K3UA 3LERA 3NQ8A 4O1BA 3NPWA 1NP2A 2GQ8A 3W7GA 2TMDA 1CPUA 4CCEA 3AS1A 2A21A 3BAYA 3LHVA 5IFPA 2D22A 1EO5A 2NV2A 5A8QA 4JTUA 4GUHA 3CIXA 3WJWA 1OD0A 5A8NA 4UTTC 2H3BA 1A53A 1EPXA 1FQ0A 5A94A 3UWYA 1OGSA 5HINA 1H62A 1TTPA 3WY1A 5AC5A 3ARWA 3ARPA 2AOSA 4MYXA 4FHAA 2WWCA 3CBWA 3HGRA 1FA2A 1F74A 5D02A 2AQWA 2VFDA 3BG3A 3S1VA 2G3MA 2JIEA 3G0UA 1J10A 1GONA 1VFOA 6TIMA 2WMKA 2ZUMA 3OLEA 4MAZA 4RE2A 2VR4A 5I3FA 1OFRA 4F8XA 4CKQA 4NRRA 1MSSA 2ZRUA 4UTWA 2PBGA 5CSUA 2H3DA 1KM4A 4C7DA 2WXDM 4CN6A 4F9DA 4EF9A 1C9DA 3OBAA 2CLKA 1FCQA 2DZVA 3AHXA 2E8YA 2JGYA 4JIPA 1G5AA 3KL3A 1RPXA 3FS2A 3MJYA 3MYOA 2UWFA 2VZOA 4L4PA 5E0KA 3WL0A 3PZOA 1O95A 4IXHA 1RQBA 3WFLA 1PIIA 3A4AA 3RPMA 2FLIA 3G18A 3G3DA 4E38A 2X1UA 6TAAA 1SFSA 3LDRA 4AVFA 2A3AA 5E6YA 3DHFA 5BYWA 4GUGA 4XTDA 2G4FA 3ZJ6A 3M6DA 3BLKA 5AHFA 5FCZA 3PTMA 2Y7DA 2YYUA 1JGIA 2LLEA 4M24A 3QW4B 2E6AA 4JICA 1YDOA 1FXPA 1B3VA 1IZKA 3GDKA 4C7GA 4NU7A 4BWLC 1L0PA 2YLAA 3KEHA 3WSUA 1PEZA 1WBHA 1UR2A 2ZRWA 4TIMA 3EXRA 3WUGA 4UR8A 3G0SA 2W91A 1W9VA 2E0PA 3UQNA 5FL0A 4HKPA 1LP6A 1E5NA 3LLDA 3N14A 1DTUA 1J0KA 4IISA 2B7QA 3P67A 2CW6A 1XXXA 1VYSX 2ZX7A 3B0UX 4NXKA 1JCYA 4K39A 5LNWA 1CWYA 3BSHA 2FH6A 4AZIA 3HJEA 3EX2A 1ZCOA 4PEKA 2J9XA 5CPNA 4AWSA 1GOWA 4H8UA 2ZRYA 3IVTA 1WX0A 3SR7A 3KAOA 4YCPA 5C55A 3S42A 3KVJA 3M9YA 4M7TA 1XSJA 1BF2A 4LRSA 1W9DM 2E40A 2XN0A 1W1VA 2WLYA 3AHZA 3O2LA 3EX4A 5FKCA 4AHPA 4O16A 4E4PA 2WVVB 2J24A 1V7YA 4MYAA 1EDGA 4MB1A 3GXNA 1J0ZA 3W84A 3WUBA 4NVTA 4ZEPA 4RXGA 3PUEA 1JIBA 4AZ5A 2WV8A 5I78A 4B1MA 1CLXA 5IBXC 2CPUA 1BWLA 3TFXA 3NDOA 2UY4A 3N12A 4ZENA 2JEPA 1PCKA 4DUWA 3AFBA 2WANA 4D71A 5HDRA 2C13A 2E6YA 1NOWA 5LZLA 1HJVA 2PRLA 1AQ0A 4OQVA 2A7NA 2Y63A 1TYGA 4A3UA 1QI2A 1P0KA 4S2CA 4HOZA 3W7QA 5FF2A 2C8NA 3W4RA 1SW0A 2XN2A 3ABOA 1QO2A 1B57A 2D3NA 3PTQA 4HTYA 4LXFA 2F2HA 1VB9A 3QGVA 4UTLA 3U75A 2A2IA 3GB6A 4NJKA 1CTNA 4PCFA 3PTKA 2VFHA 2KZHA 2CIPA 5F4XA 1OSEA 1ZBCA 1F4AA 1JUEA 4JNMA 1V08A 3LCLA 1S5TA 1ICSA 3W1RA 1QI3A 1DP0A 2WZHA 2WB5A 2ZXDA 4NZCA 4UQDA 1ONRA 3DBPA 1W5OA 2B4GA 4UFHA 1OX4A 2FB2A 1JZ5A 2CLOA 5FEPA 1OFAA 1KM5A 3AISA 3KZSA 4JDYA 3GDLA 3M5VA 1I8JA 3S5YA 1KM1A 3DFOA 1U33A 4FLOA 4HU0A 3CM4A 2Y2WA 4DO4A 2ISVA 3PBVA 1G6CA 2QJGA 4JN6A 3T78A 3C4UA 5EYWA 2DT3A 3WMBA 5D2WA 2VFEA 1GVYA 2RGMA 4AXKA 3W2JA 1NP0A 5K4ZA 1QI0A 3CO4A 3CTTA 3OA3A 3PZVA 3WNPA 2GDUA 3FEMA 1LG2A 3W1UA 1SSGA 3ARRA 1X7FA 1QW9A 4LGXA 2ZX8A 3SUTA 4J3VA 4LPCA 3BGGA 3FOKA 1RQHA 4P8UA 4BA0A 3N15A 1UHVA 1QI5A 1HTIA 5E9AA 3NUKA 3BGAA 2BZNA 3W29A 4UFKA 1VLWA 1ZJIA 1E5JA 3NQ6A 1UR1A 2A3CA 3UETA 4NX0A 1VAHA 2OYKA 3SEPA 2CITA 3TH6A 3QZEA 2VUYA 2XTKA 3E02A 5CG7A 3O6DA 2V8ZA 1W5NA 2A6NA 4A22A 3LXAA 3B4UA 1OFEA 1G67A 2ISWA 3GKFA 3PZTA 3H55A 2YFNA 3N18A 3BG9A 5I0DA 3UCQA 3HBLA 3GTNA 4A3HA 5J5RA 2D2OA 3EKLA 4DXVA 3HG2A 4OBRA 4GKLA 2Y85A 4DBDA 2XFRA 2VRJA 3A23A 3SI9A 1L6WA 1OYAA 1PAMA 8A3HA 3BAXA 1ISVA 1E0VA 3T4CA 1F6PA 1MW1A 2BHYA 2V81A 4NJGA 4P7RA 3TXZA 5TD4A 2EGZA 1K9EA 1XUZA 2AEYA 1ZS2A 4LV4A 3AHVA 1VS1A 5D2XA 4O1DA 2C0HA 1AL8A 4ORIA 3M16A 2FHBA 3BLIA 1DWIM 2XSBA 3GH7A 1XBYA 5HNNA 1TPWA 2C18A 1MEWA 3E96A 5BCAA 1QOXA 3WH7A 3W1LA 4RJEA 3W7KA 5K7JA 3SUUA 3MP3A 4UTIA 1NQ6A 1R7OA 1UKOA 4KWVA 3NAVA 5F2MA 1VCFA 3TKFA 1MW2A 1WZMA 3G22A 3SUSA 3PIGA 2GUUA 3VKKA 3ZT5A 1OX4B 3ATYA 1TJPA 3SZ8A 2OYMA 4FF5A 3LCWA 2QUUA 4WIWA 2J6XA 1XC6A 2J77A 3THDA 3TOPA 1CXHA 2G3JA 1JCXA 3N17A 1FY6A 4PC8A 1AQMA 3ZR4A 1ITXA 3N9KA 3KRUA 4IM4A 4LVFA 4RE4A 1L8NA 1EIXA 4OT7A 3M46A 1SZGA 3LBMA 4GRSA 2HMCA 5H91A 5E70A 5A8GA 5AYYA 4IPLA 4B9YA 2WVSA 4W93A 3HO8A 1E1FA 4MB3A 2NXHA 4YHEA 5AHLA 4P8VA 2JE8A 3LPOA 1JULA 1WOAA 1BSIA 2V3FA 5KINA 2XVNA 2YL6A 5CGTA 2XYLA 2Y5EA 4LC8A 2WC3A 3PVFA 2QF7A 4X2RA 4PRWA 5BW6A 4AEEA 2EO7A 4U3CA 2CBJA 1EWDA 1K8ZA 1X6UA 4RXFA 3EXSA 2R14A 2NX1A 3LM7A 1W32A 1ZJAA 1C90A 1V3LA 4CD8A 1X8FA 4ML9A 2JALA 1DOSA 2WNWA 3L9CA 3TA6A 4W84A 4PCSA 2YA1A 3HU7A 2EKCA 3OIHA 5MHBA 1GVQA 1V3HA 5CPSA 1DWFM 2PF0A 3VDHA 1TA3A 4O11A 3ARZA 4FNQA 1VF8A 3MHUA 3GBEA 1B3YA 1VH7A 1Q6QA 1D3GA 1EH9A 1Y9GA 3W1PA 3VMOA 3WD4A 1W2PA 1B4EA 3UWWA 3IVSA 5A8MA 1CW2A 1FH7A 1LG1A 4OOUA 4X0VA 2QKFA 1O94A 5F2GA 4E2OA 1J0JA 3ZQ9A 3MKKA 2Z1KA 3VIFA 3NM1A 3W38A 1HKMA 2CHNA 3T0BA 4DWSD 2V5CA 2D73A 2VZVA 4WY0A 1WPCA 3THQA 3CUIA 1R2RA 1I45A 1GG1A 4YCOA 4FLQA 3LDKA 2AC1A 3SFKA 2JIWA 3ZFHA 1JRCA 3LX9A 4N02A 1VFFA 4KH2A 3SIZA 4AZCB 4EE9A 2FFCA 5HJLA 3QQ1A 3TJXA 1KTBA 3O6YX 5HMSA 1O7AA 3O16A 2C0AA 1SO6A 2CZ5A 2D3LA 2XVLA 3NSXA 3JS3A 4ML4A 1B0IA 4ATLA 4FF7A 1Q6LA 4RR4A 3ZT7A 2X1RA 5G2WA 1LCOA 2ADEA 2VVSA 4DO5A 1H7NA 3W25A 2EPLX 2VNCA 1C91A 3RDKA 1ADOA 2V2CA 2BXYA 4O18A 1H1YA 1DQXA 4GXMA 5A5WA 1MQPA 2XIBA 2YDSA 3NDYA 2CNCA 3I7QA 3IANA 3PZ9A 3U57A 1DBTA 4TO8A 1QNQA 2C16A 4HA4A 4RX0A 4UFLA 4OOZA 3K8LA 3UR7A 4FLSA 5BWFA 4HPJA 4FNTA 3T08A 3L0NA 3UWQA 2VELA 1JUKA 1BYCA 1VBRA 4AD3A 2YSWA 5I23A 2WSPA 3PZQA 3E9AA 3TFCA 4MPQA 1W3JA 2FH8A 2CU0A 4JZ5A 2OSWA 4UTKA 5HNRA 3U8GA 1U83A 4NX5A 2NV1A 2XPKA 4H6KA 1H49A 1TPVA 4E8CA 3SCQA 4CNNA 4IUGA 4FB7A 1VLIA 1C93A 1K6AA 3DYMA 3RJXA 1YPIA 4GE8A 4HXCA 3KHJA 1U2YA 3LHTA 3VIOA 1EP3A 1B90A 2O7QA 2WSYA 3TJLA 4MPKA 1IIGA 1N7KA 3FHAA 1KTNA 2VX7A 1G4SA 2WYSA 2OT1A 1TVPA 4E2BA 4C7FA 1B2YA 5CJ5A 1LORA 1HFBA 3AS2A 4PTVA 3TTYA 4R27A 1JVNA 3IIXA 1VJIA 2NT0A 1FP9A 5KTLA 1H3GA 5F1VA 1ZNNA 3CC1A 4W8BA 1SFJA 1OB0A 1SW7A 4NF7A 1UUOA 1R2SA 2QEZA 1AG1O 2R94A 3TTQA 4TR9A 2VVNA 2ZCGA 1GYLA 4AMAA 4DUXA 2JGQA 2V9DA 1XHGA 2ADDA 2O9TA 1X6NA 3FLUA 5DO8A 5BMXA 2WHJA 3SGUA 3IEBA 3KVKA 5AHNA 3W2UA 1OHLA 2VFGA 3NQVA 4KFOA 2PWGA 2XWEA 5A6SA 2PWEA 4XUYA 5I3JA 1K7EA 3VIJA 4LNYA 4FX7A 3L0GA 1GG0A 1ST8A 1AVAA 3EKZA 3WH8A 3W9ZA 5EBAA 1JZ6A 1HJUA 2W92A 1W3TA 4XQ6A 4AIOA 2G3IA 4JTJA 5HULA 3M0ZA 3GVGA 3VD5A 3MI3A 1WCGA 4M56A 4W8LA 3N3MA 1H7OA 3CPUA 4RL3A 2DSZA 1EUAA 1WXJA 3MS8A 1KW1A 3JR2A 4UIOA 1BVZA 4HSNA 4Y7EA 1LYXA 3QQ0A 3QSTA 1BLIA 2Y70A 4WF7A 5HOSA 3VIKA 4HU8A 1Z44A 5AC6A 1EP2A 4Z2JA 1DHKA 1ITCA 2X05A 3BAIA 4TMCA 3FKKA 2CLLA 2EXOA 4LU0A 1XFBA 4UXDA 2ZQ0A 5TIMA 3HMJG 1CDGA 1E3XA 2E3ZA 3JUGA 4N42A 1FHDA 2FDMA 3A47A 3FJ6A 2V3GA 4X0NA 1Q6RA 5LNSA 4P8XA 4B15A 4JTTA 1JZ7A 1A47A 3O6CA 2VURA 1EQPA 2J79A 3CLMA 4R53A 3VMPA 2Y4SA 4XZBA 3TSMA 1WBJA 3R13A 4NXSA 2NUYA 1I75A 1E9LA 5I24A 3GAKA 4WOZA 2V5BA 3OLGA 4K68A 1UA7A 4RCXA 1J0HA 5D2VA 3PULA 4KMQA 2X2YA 4HZ7A 1HO1A 2EEXA 1AL7A 4D6FA 4CN1A 5AB3A 3VGHA 1JI2A 5F1UA 3AYRA 3KX6A 3SGZA 3TTSA 3UG4A 5HUPA 3W86A 2DZTA 3M41A 4IMFA 5EKYA 1IIHA 2OCZA 4MDOA 3W2LA 3LHZA 1TMHA 3LV5A 1TFVA 3LFIA 1UWTA 2WMGA 1S3HA 1B9ZA 2G97A 3GXIA 3S6TA 4A3YA 2BY0A 3LCFA 2NX3A 1LRNA 1SMAA 4UC5A 2V2DA 1GPFA 4M6VA 3MO4A 5FIPA 3QOMA 2ZRVA 2V3DA 5ABHA 4MNKA 2FPTA 1W9PA 1E6RA 4U4MA 4JS3A 4MZ8A 2NW0A 4MZYA 4N4QA 3OBKA 1JXKA 4N6EA 1HNYA 2QCGA 3TV8A 1EHAA 1H0GA 3D0CA 4LOCA 3HB9A 3H53A 1UH3A 5I5RA 1BGGA 4UOZA 3GDBA 1VEMA 2VQTA 4JX5A 2DSVA 1E0XA 2WW5A 4H2CA 3QW3A 3LCXA 1VJZA 2X1TA 1OT1A 3I3DA 2J9YA 4HSOA 1YTKA 1CLVA 1ICQA 4UTWC 1XDLA 1MXDA 4DEFA 3A4XA 4J3TA 1WZAA 4Z1AA 3S1UA 2JF6A 4QDMA 3HPXA 3EMCA 1WP6A 1D7FA 1V3IA 2QPUA 2VR5A 5FEXA 3W7PA 3K46A 2NXIA 5IHSA 1KR1A 4HOWA 1OF6A 4HMEA 3S1XA 3VDCA 3W7NA 3WEOA 3NZ1A 1ZB5A 3E12A 4LVDA 1UKPA 2A0NA 5CPLA 2JF7A 1PX8A 2XGIA 1IXQA 1MXGA 1TG7A 1TQXA 2Y24A 4LS2A 3AJ7A 1V02E 4XZ9A 4QCFA 3RJYA 1G0CA 3CHVA 3GXFA 3W23A 3A21A 1HKJA 2AMGA 4HZ6A 1EWEA 3VD9A 2Y7FA 3L21A 3SURA 3PHAA 4ZQCA 3RFAA 4HZ8A 4Z0JA 1J0IA 3I6RA 4PBGA 1C29A 3W07A 3IJ7A 2J7DA 1I1XA 3UZJA 1NWRA 2HS6A 4PA8A 2J78A 1K9TA 1EXPA 5E93A 5A6KA 3NVTA 4EVZA 3NOEA 5F4WA 3QYQA 4GUJA 1W9UA 2XVGA 1RD5A 1SPQA 4P7LA 3VMNA 2ZZ4A 1SO3A 1BAGA 4AZGA 1VRXA 3I7RA 3LRMA 1KGWA 3GYCA 4MDPA 1M6JA 3WDIA 3L4VA 2E4TA 1EQCA 5FF3A 1TCDA 3KE0A 4XKYA 4LQ1A 5FK7A 1XDMA 5IFTA 1P4CA 3W28A 1GVSA 1SFLA 4N9DA 5IXEA 4JL2A 5DMYA 1UYQA 5G1YA 5CLTA 3VCRA 1TRIA 1XYFA 3T2QA 5HQEA 2ZZ5A 1UUMA 1LL7A 1B3WA 3WFZA 3D5HA 5D8ZA 2Q3OA 3UGHA 2VX6A 2FPYA 3BXWA 1LBMA 4AEOA 3P80A 1BYAA 1LTDA 1TV5A 1J11A 2J47A 3QPYA 5GNZA 3THCA 1O5XA 4TX6A 2WSQA 4EWND 2RDUA 4TVDA 4TTGA 2GUYA 1KFEA 1HXJA 1ISXA 1V0NA 3WQ8A 2B31A 2PB1A 4D6IA 1OFBA 5CKSA 4TU1A 1SO5A 5D9NA 4MNJA 3QHMA 3ARQA 1YXCA 4M80A 3WDQA 4POCA 3W1NA 4PMRA 4O0KA 3INPA 5D03A 3PZNA 3TDFA 3THAA 2YL5A 2WBGA 1UQYA 1LLOA 2YLLA 5CSSA 4QLKA 4XX6A 4OJYA 1UBSA 2WKLA 2CKSA 3L4WA 1OYBA 1VYRA 3UXDA 1GYNA 1NFBA 2WO5A 2NSXA 5CPTA 2DJXA 1S5VA 4Z2GA 3NCOA 4HHPA 3WDHA 1BG4A 2V0TA 3MMUA 1A3HA 2BS9A 1CIUA 3UPWA 1DORA 2C3ZA 3WK2A 4JY8A 2DSWA 4H4IA 4IPNB 3CU2A 5LGXA 2FPVA 4UFMA 3LEMA 1LZOA 1OX6A 2YXGA 1DWHM 2FTPA 1UD5A 3VFLA 4HNUA 1VJSA 3N19B 2J7CA 2WC7A 3VKJA 1MWOA 3VX0A 4MLJA 4ADUA 3VD7A 2BY3A 4N6FA 1QO5A 5I3GA 1R2TA 1DHPA 4PMVA 4UNIA 3WNLA 5HUOA 4ZE5A 3BO9A 4M7SA 4GO8A 1CXLA 4H7VA 3LXBA 3UGGA 1Z32X 4DWSA 4O53A 3I3EA 3WD0A 3O06A 2BLEA 5K9XA 3ZWSA 3EXTA 3AMDA 3VO0A 3G1XA 4GWEA 1AMKA 2JBMA 4NJIA 1O4UA 2EPOA 1HVQA 4M82A 5A6LA 2GJXB 4JIEA 4TVCA 3S5OA 5DELA 4YXGA 2FDSA 1K9FA 2QDHA 1OWQA 5IM51 2WVVA 4BCEA 4TVUA 2IUZA 4GI9A 5DY2A 1JCNA 3NQGA 1L6SA 2GK1A 3A9IA 1E71M 1B3OA 3KF5A 4CD6A 3C8FA 2E77A 4LX4A 1SR9A 3GXPA 4XKYB 4JXCA 1GNXA 1VFMA 3WK1A 2TSYA 4DF0A 1GQLA 1VBUA 3E49A 2CEQA 3ZS4A 4JEQA 5BRPA 2ZA2A 1CBGA 1DL3A 4JCLA 1YPFA 4HN4A 1PX4A 3ZJ8A 4BQ4A 3W88A 2EF9A 5E0FA 3G24A 3AQUA 4O13A 1QNSA 1YDNA 3AIVA 2WNNA 3AI0A 2EBNA 3RMEA 1H09A 4MY1A 3WJZA 1R47A 3DHUA
chains in the Genus database with same CATH superfamily
3K2OA 4A44A 5IK7A 4RNHA 3RYKA 3VBFA 2YBPA 3W2NA 4O50A 1M7OA 5DN2A 2Z00A 1V6VA 3BOXA 1Z89A 5HR6A 3F95A 3OGVA 4MJ2A 3UGVA 2CLHA 3RNDA 1FATA 4HL0A 2GOKA 5HV4A 2WRAA 1FH8A 2G3NA 4C6MA 1J3QA 2QDRA 1EGMA 4B92A 4NUBA 4S2FA 4DUVA 1TB3A 2F6UA 1JQVA 3WNNA 5FR3A 2QAFA 1R082 4KETA 4OYUA 1J2BA 5LBBA 2QCHA 4DBEA 3B04A 3OZPA 1W8OA 3ARYA 5FZ0A 3ZDSA 2V68A 3WDRA 3UESA 1IKQA 4FP2A 4Z2KA 5FJKA 2YCKX 4P8WA 3ITVA 1QQP3 1VBD2 1UY2A 2WWJA 1UR8A 3VHPA 3KHDA 2V73A 3GTHA 3WUEA 4RV8A 1ZSXA 2CFFA 1QVBA 4N9BA 2OPWA 3U11A 1OK6A 1BD0A 1GTEA 2QS8A 2VGBA 3LQLA 3MMTA 4FOUA 1LRTA 1OLRA 4HPHA 4DS0A 3H2OA 4O57A 1AYN1 1QMLA 4BQYA 2GVYA 3MDWA 4GJ1A 3GBDA 4JTSA 2PN5A 4FMVA 4YW3A 4KCWA 3ME2A 4NHKA 1NFGA 3EKGA 1OC1A 4QX8A 4HSHA 2X5IA 2P17A 3D0SA 4EXQA 2Y7GA 4F7ZA 1WZKA 3ARSA 3TYUA 4ZFMA 5FEWA 1CWPA 4DY1A 1RALA 3LZ3A 4L11A 1FOD1 2A6XA 1W1YA 2VT0A 3DHDA 3W7HA 2GGJA 3TA9A 4NJJA 1UY0A 1F8MA 3NZRA 3QMRA 1GOGA 2TBVA 1TMF2 1PGW1 5G2HA 4MHRA 3VUSA 2WM0A 3LB0A 2OGJA 1GHSA 4IIGA 4Q4OA 1JG9A 5A2CA 2FZNA 3E74A 3VOFA 4WGXA 1B35C 3U14A 3TZFA 1U5VA 3T2PA 3DFNA 3UYCA 3PLQA 2QQWA 4HNCA 1UPIA 4IMGA 1KCLA 1NA1B 4AFCA 3H4GA 2FCTA 2RE9A 5EV7A 2O7SA 4EZ4A 2B7OA 5LATA 1PO13 4A45A 3VKFC 3QH2A 4ASTA 3H21A 1DGRA 4FQ4A 1MS0A 2QQMA 2DH2A 4HK9A 4JHOA 4EKJA 1QOOA 1RUC2 3PF3A 2ORZA 3ANUA 3QOKA 4WCJA 2VMEA 1DJHA 2E8ZA 3PZIA 4Y9MA 4AIUA 3OYWB 2NLRA 3LD8A 4MY8A 4O17A 1U22A 2W4XA 3CZJA 3AP9A 1BLZA 4OHZA 2Y60A 4KG8A 2W52A 4C1WA 3HIJA 2XLAA 1UZHA 3MW4A 3AJYA 4E4HA 1E72M 1HL8A 3KTCA 4CQ8A 2VQAA 3STEA 1E6PA 3TEYA 1IHIA 2CETA 3WD1A 3OVRA 4R4ZA 2ODOA 3H4XA 4ZXKA 1D7PM 4CU6A 2QV4A 1GU3A 2VUNA 2AR6A 2PMWB 3WJSA 5JOZA 1VGAA 3VVGA 3VIHA 2DGAA 5F5CA 4N9IA 5KHKA 2XFYA 3RZZA 2JD9A 1Q6OA 1JW6A 1EIBA 2ZVIA 3MTWA 2HWC2 2BZDA 2YC2A 1CIWA 3UG3A 1OCJA 1ONWA 5JSRA 4JAWA 1TV7A 4QFUA 4OGZA 4AYUA 1VFUA 3EMZA 4NQ1A 4Q6JA 4HK7A 1BFNA 1SZEA 2FHRA 3OBTA 5FZFA 4GY1A 3F4WA 2CWXA 3PP7A 4KCTA 4K7JA 1N47A 4IV3B 3W27A 3ALGA 4OVEA 3NO8A 3O7UA 5ISLA 2FZBA 3WF4A 2BNOA 4BQ5A 2O92A 4I9MA 2BGPA 4FNUA 2QDNA 2RDXA 5GNXA 1HN0A 1ULGA 3CWOX 3G1VA 3POGA 2DCYA 2QNKA 4MKNA 2Z42A 5DUUA 5IAXA 3GX9A 3QR1A 1IOAA 4GH1A 1RUH2 1ZY9A 5I77A 1NCQA 1F3TA 2VNVA 4ZU4A 3BICA 4META 4AQTA 3BN6A 4GGHA 3UWVA 5BXTA 1ZLPA 2ZXQA 2VM8A 1W2VA 2PE4A 2NQLA 4AR2A 3UGRA 2A5ZA 1R9XA 1JCMP 4GNVA 3GWQA 1ULOA 3WINE 3BUCA 1UH2A 1GEHA 2QKDA 4Q0SA 2DV0A 3NWKA 4S3GA 3BC9A 4F48A 4TX8A 4CXWA 3K5XA 3AZTA 1UXZA 3AICA 5D04C 3T1MA 2JDKA 1MI3A 2EALA 4WVWA 5HXVA 2G95A 2WFPA 1UKTA 5AN7A 3SECA 3NVCA 3C2UA 3U0ZA 5FP9A 1UWQA 1WAUA 2HSAA 2QJIA 1UZ1A 2PP0A 1ZUAX 2J27A 4GH4B 3EB3A 3C3UA 5DDJ3 4JYEA 1DYPA 4DM1A 2D1ZA 4C6NA 1W9XA 4CGTA 3FHQA 1EPZA 3C2EA 3CAWA 4Q8NA 1K7FA 3I2DA 2NUWA 2ZDRA 4NHYA 3TNPB 2H8ZA 5LYRA 5EXOA 1YQ5A 4OUSA 1YX1A 2R1NA 3D5OA 3G1AA 1M53A 3HMCA 2D98A 3WH5A 3TX9A 1J6OA 1PMJX 1QOPA 5JBDA 3EOSA 5KWRA 4DO7A 2WZEA 3CTLA 1XIFA 4CD7A 5CZ0A 4FIQA 3WCSA 1TJ1A 3W70A 3GJAA 4B8EA 2AQVA 4FPYA 4IZGA 4JAAA 5A6BD 5A7PA 3S9YA 2VH9A 2CERA 3AXIA 4O12A 2QULA 2DT2A 3HPFA 4P5HA 3G0XA 3JQXA 3CL6A 4KEUA 4L1WA 4X3ZA 1OSGA 4UTUA 3CZEA 3WQCA 4YU1A 1O5KA 4Q4W2 1Q8PA 1CAVA 4I5XA 4JFWA 3Q8CA 2WJEA 3CNAA 3GE7A 2FQPA 2E5DA 2J62A 5T5OA 1Y5WA 3TN4A 1XFCA 4JFUA 5H9SA 5MKGB 3HF3A 5H9RA 2E53A 1OK4A 5FP3A 2BBFA 5BXSA 3U37A 1GBGA 4URTA 1W9YA 1UWUA 4MVAA 5FPAA 5F4SA 1M06G 4IQJA 3T55A 1YQ6A 3V7PA 1NZIA 1GUVA 3DZ1A 3GZ3A 4QDWA 1AUYA 4KEVA 3CLPA 4GWMA 1FWGC 2FJKA 1YIFA 4BHYA 3SM0A 2XN1A 3W7RA 1XXNA 3ZYJB 4O15A 3J7HA 1OBNA 2W0XA 2I5GA 2E51A 1Z0HA 1J2WA 3GNNA 3VIMA 3CT2A 3ZXGA 1A5SA 4E2DA 4IEOA 4IE0A 3GVWA 2O8OA 4M29A 3I3BA 1D8WA 4ZOBA 2X7VA 5HBAA 1TSIA 2A5HA 2CV6A 4I9TA 5EA9A 3UJSA 3VYLA 3GXTA 2BWAA 4J28A 1W6MB 1FBAA 5CEHA 2CYFA 1KM0A 2XWBB 3MSYA 5FPZA 1RHI2 3OHIA 4Z82A 4A29A 5HBFA 1OQDA 1AH0A 1KBBA 1QJX2 2AACA 2WR9A 1UY3A 4GI4A 2IKHA 3VKLA 4MWAB 4R9CA 1E4IA 3P61A 4HPXA 3IGXA 3SCTA 4LAUA 4OBSA 2ZFAA 1PGL2 4WKFA 3KRBA 4BJ0A 3DEMA 3V56A 1M3UA 1ZU8A 4ZBCA 3RM9A 2XZ7A 2R91A 2BDRA 1KLZA 3FZ3A 3M3EA 4ZTYA 3H70A 4ZFCA 1PV8A 2BV4A 5ERLA 1OT2A 3W2MA 2C1FA 3RK8A 3STGA 1COV2 1CN1A 4XFBA 3UJQA 2XKOA 4LOTA 2Q0AA 2D23A 2XG3A 3M64A 2FIQA 3WD2A 1UNBA 1ODZA 3LA2A 4NNCA 4WJ8A 1WO2A 4B9ZA 3S7IA 1N8FA 3LTSA 5C5YA 1E4MM 4FK9A 1VBA1 4R52A 1RL3A 1F6KA 4AWEA 4HA0A 3WV6A 2GAUA 5CFCC 3MF6A 4F2TA 3B40A 5DEZA 1UP2A 2DDXA 1VMFA 3O15A 1EV12 1QPKA 2VCBA 5CSYA 3TU9A 2DFCA 2VG9A 3ZT6A 2D6PA 3AU6A 2X41A 5A3TA 3TN91 4LE4A 1H1IA 3LN3A 4ATFA 4UCFA 3NSTA 4Y9OA 3FYYA 5LGZA 4OI1A 2X8KA 3B8SA 5HANA 1KTCA 1A8MA 2DP3A 4O4WA 1CESA 3VPLA 3IJ6A 5JDBA 1LWJA 1SW3A 4FEZA 3N1AA 4PSRA 5REQA 1STMA 4PODA 2LM3A 2Q1MA 3FYOA 1TELA 1YLVA 4M3CE 4JVAA 1W6PB 2WZTA 4LVGA 4JGZC 5XINA 2IUWA 1PYFA 3DFYA 3AFGA 5CPQA 3LXCA 3W1QA 1E4NA 4XACA 4HKWA 4K1WA 3IBMA 1A0CA 2JK2A 5J04A 4ZQOA 4CU7A 2W1UA 4GI6A 5FXXA 4LUTB 3ACIA 3I59A 1IWPA 5EFFA 2WMFA 4H6EA 1XIMA 1XOYA 4DYJA 4G56A 3VBRC 4KRTA 6ALDA 1KFXL 4HVOA 4GLEA 5BNQA 1M68A 1WCKA 3W7JA 1VZWA 2GP5A 5FP8A 2J7FA 1H4PA 5BNOA 4JKKA 1WW4A 4FX6M 3WH6A 4P02B 4XBKA 4FOKA 4OFGA 4IV1A 2G41A 2ABAA 4ICNA 4QPIB 4LK6A 4IGHA 4NASA 4QM1A 1HRI1 1CVNA 2FHFA 4X2PA 3B0XA 3T2OA 2HWB3 4RHV3 2EJ1A 4HCHA 4NIHA 4ERGA 4B5XA 5FY5A 2DUPA 4D1JA 3VGEA 4IQLA 4ZSTA 4DJFA 3GLCA 1G7VA 4GQRA 4AD5A 3L9JT 4TOQA 1YJKA 3BTXA 3AC0A 1RXGA 4Y5TA 5LEJA 1U12A 4SBVA 2QAPA 2PWHA 4D2JA 3DYOA 3V0BB 1FT9A 4A6OA 3JUUA 5I2UA 5LBEA 1PO22 3KCYA 4R34A 2FMOA 1E3ZA 2PTWA 5FACA 4W50A 3KRZA 1S0CA 2CY6A 4UWMA 4GACA 1NU5A 2B42B 5JOYA 1Q13A 1R3TA 4ONVA 4DLMA 4WSKA 1H5VA 2BTMA 2PHXA 2UURA 3IGSA 4A2SA 1EJTC 1JN2P 2X53S 2BNJA 5FY0A 2QQPA 3RLVA 5DZGA 1MACA 3UF9A 3FW6A 2ZGKA 4AEDC 3IV3A 2D5FA 4IMDA 2OLSA 4DF1A 4D6HA 1QXRA 3KWSA 1NXD1 4AIBA 1NYWA 4H7CA 3VNKA 1FV3A 2RS12 1MQTC 3M7SA 4KRUA 3DPRB 3N2XA 4MJ4A 3ANYA 3FL7A 2O0OA 4CQCA 2HNHA 1WA3A 1XRVA 4XXAA 2YC0A 4LNCA 4UZSA 4E4SA 2PI6A 3TP4A 4I01A 5F3GA 3EJKA 4MO3M 3TAOA 1KV8A 3DCPA 3RR1A 1H7PA 1OM0A 1XH1A 4K7VA 3DU0A 3B94A 3CUHA 5CC7A 2JG8B 2GVLA 4ZZ9A 5DCBA 1R083 3UVAA 4NPMA 4D6DA 2R042 4K1YA 1QBBA 3RZMA 3WIJA 4PTNA 2OWXA 5DXDA 1AD4A 4IPIA 2WHKA 3HIFA 2WVUA 1C8QA 1VBD3 5LRRA 2XH7A 3RM8A 4KGJA 5KZMA 2GOUA 3GU2A 1SACA 3Q9OA 2FDGA 2ZEWA 1UJPA 5JMUA 3W82A 1T6BX 4UUIA 1J9YA 4MGYE 2XJRA 3K48A 2CSGA 1G01A 4C6LA 3CUGA 4I7UA 4UFJA 3GNEA 1TIWA 3VFCA 3SY8A 4D9PA 3LPPA 3ZXLA 1SBDA 2XM1A 1LAJA 1RVF2 3WXPA 1RLCL 3H2MA 3EYPA 5A6ZA 1EF2A 1CB7B 1BEUA 3WDJA 2CLFA 4AI9A 3L4UA 4XKMA 3HN3A 3QMSA 4WSJA 1BVWA 1N1VA 3IJLA 2VOTA 1Y9MA 4AFDA 3WQ7A 3R4DB 3W7LA 3HT1A 4XF1A 1WUFA 5D32A 2QCLA 2R071 1TMF3 2JKAA 1Q5OA 1CI1A 2E68A 5DAVA 4QBXA 1XIBA 3ILFA 1FMD1 2UYAA 4AC1X 2CWSA 3U4SA 2QVNA 3FV9A 3OTRA 3Q94A 4YG0A 1JMUB 3MI2A 1QU4A 3H26A 2NQ5A 2YA2A 3QM3A 4J40A 4PTXA 3EB7A 3V5CA 3HN1A 3WLTA 2QIIA 1FFQA 1XV8A 3PURA 2G8ZA 1UO9A 3FDGA 5TSWA 1VIZA 3ITOA 4XVHA 1YNQA 1NE6A 3WX5A 2PWDA 2F7FA 3BG5A 1JU4A 4Q4MA 3W7EA 2ZS6B 5IVCA 4Q22A 1KO0A 2OO6A 3AZSA 4R8HA 4GBDA 2Z2UA 1KJLA 3ARVA 3MUXA 4GHRA 3ETQA 1RUC3 5JXGA 5G1TA 4D6JA 1NVMA 3RYRA 1OY0A 1RQEA 1VMHA 3AIRA 1IT0A 2GWNA 4KWSA 1PHQA 2PDYA 4NAFA 4QQ3A 3EX1A 2BWGA 3IPWA 4A3ZA 2UZ9A 3ARUA 1Z7S1 4WM7B 4W6YA 4WXZA 3I2HA 1NF7A 1GV9A 4L4OA 1XYLA 4PUMA 1RK6A 3WKZA 2TAAA 1SMVA 3BLDA 3ATGA 2YJQA 3IMMA 5JVVA 2J75A 1J3PA 4E2SA 4F3JA 5JR7B 4H2HA 5AHEA 5JMOA 1K8YA 1OCBA 1RPKA 3IJIA 4U2AA 4CP9A 5D8AA 1GYKA 4CCCA 4D6CA 2D6NA 4MIMA 3P5BA 1TV8A 3R0UA 4QKBA 1AR63 1P1XA 5FQ0A 2R1PA 2B45X 1SQ7A 2X1IA 4QG8A 4D0QA 4I5RA 4IX2A 4BY3A 4QPGC 1H7RA 2Q1FA 5E6ZA 4LBUA 4I2OA 3CUFA 4JBRA 3DEQA 2VOKA 3MPPG 1YI9A 4YG3A 4RNFA 4YLZA 3BJTA 1A5MC 3ZOAA 1FWWA 2RS33 5CFDC 2NQ9A 1YYNA 1BYBA 4QQ2A 3PN8A 2VC6A 4E8DA 1XGZA 2EPMX 2J22A 1ND3B 3OGRA 1XLAA 4DPQA 4IPJA 3WX7A 1LNSA 1RUH3 4DBWA 3KM8A 3B9CA 3EX6A 5AHMA 4ZMGA 1Z41A 4W65A 1JTZX 3KV5A 4I8YA 4GINA 2PDWA 2UU8A 1PKNA 5EJ1B 1D2QA 1XG3A 1YNYA 3U7VA 2ZA9A 4LBNA 4BWLA 3NYDA 2EF6A 1NTHA 5FY9A 3BLFA 1SFNA 4EF8A 4G1KA 5T54A 1A5KC 5L7OC 1UZ4A 3EB4A 1UOGA 3WDXA 4Q4V3 2OQ6A 5GZDA 2ZGLA 1EKOA 4PBOA 5E6HA 2EPHA 4IMAA 1BYDA 4XEZA 4GAZA 3J7NA 1GZGA 5A3UA 3RX2A 3TYDA 3A9BA 2RM23 1I2PA 4S2HA 3CAVA 1PE1A 2Z25A 5J5DA 2QDGA 4MB4A 4UQCA 3IRSA 3LGGA 4UFIA 4AZ6A 2CL2A 1KXQA 4CP0A 2ZZ6A 3F1QA 1ZA4A 1SEFA 3RCNA 1A5BA 4AF0B 5FV3A 1N3PA 2D40A 3BK0A 3ZVHA 1XH0A 2WNZA 4Q7BA 4DRSA 1ULEA 2MHFA 3P93A 4H9TA 3DKJA 1FWBC 1F8VA 3RLUA 2V5DA 3O1MA 1FPN2 2Q3RA 2B4KA 2BP6A 3CPGA 4CNPA 2MEV3 3NGFA 4N53C 3OBEA 4GZJA 1N82A 2XG9A 4W9TA 5FESA 1DJXA 1CX1A 1HT6A 3I6TA 2XDFA 5GLWA 1UMHA 1H60A 2WLZA 4UMCA 4F2BA 3FWEA 1SHWB 4W86A 2JDZA 4NN0A 3SH5A 4Z07A 2BVDA 1KM3A 4QAIA 3SFWA 1TVLA 4KCUA 5DQPA 1RUI1 3ZYGA 4JGYB 4CCZA 3SUVA 4OTKA 3VD4A 4BMBA 5C9AA 2HEYF 1POKA 1QOQA 4MOAA 1VRH1 1OQFA 1YYAA 2Q8CA 4XXPA 1ICPA 2R063 2BXVA 4AZZA 1KQZA 4JDOA 3KCOA 1O59A 2VYOA 3QACA 4ZQNA 3LWCA 1QI4A 5HWMA 3CPRA 2W9MA 4L1GA 2WC4A 3UY8A 1REFA 3UPBA 1Z78A 1W2NA 3UW6A 4QWNA 3CIWA 4K37A 1ZENA 1PS9A 3V75A 5B7ZA 2PHLA 2ERFA 1W37A 1S2KA 4J6GA 1PIGA 3QSRA 4JIQA 3W87A 2EAWA 1XSRA 3U5YA 2PWVA 1OFSA 1W28A 1P7TB 2WSVA 3M7WA 4IEZA 3RN6A 3O1PA 4C1NA 1QMJA 3G1DA 4E8GA 3POCA 4Y9NA 2DVTA 1EEPA 2Q8LA 1KWKA 2XMLA 3KT4A 1UH4A 2YL9A 2XHKA 3TLLA 3CQOA 5FL1A 1TZ9A 3P8JA 5FF4A 1W6QB 4PUWA 3HZ3A 1JFHA 1WMEA 3WY6A 4YLWA 1QJX3 3PHMA 5A1AA 5EL1A 4Y1YA 3AOFA 3PU3A 1ESWA 4LAZA 1J18A 2PAJA 2HDJA 2ZGUA 3KSCA 2A71A 3WNKA 1A0EA 4WOQA 2BPA2 2VMCA 3VGDA 2Z79A 3HAGA 1W1PA 2AGKA 5C70A 1VPHA 1V02A 2PLV1 4NP7A 2WS93 4Y22A 2TYSA 1COV3 2Z1WA 1BXNA 4CUBA 3OA5A 3FXYA 4J25A 4NNBA 1GFF2 5DG1A 2R9RA 2DUQA 3NQCA 4QX4A 2NVDA 3R0KA 3TUUA 4GO9A 1OT5A 1IR1A 5BOFA 4NRPA 4V2VA 4PCNA 4PCPA 5FZ3A 1TMLA 1TQJA 4WUIA 3EA1A 5E16A 4IXXA 2QJHA 2BODX 1OKQA 1GZCA 4XW3A 2GSJA 3P0XA 1EV13 4O4VA 4REQB 2GDVA 4H9UA 3SN4A 1C8M3 2WFF2 3LENA 5DXXA 3U2OA 4E2VA 4JGDA 4AWTA 3ZO9A 3RZKA 2VMIA 1TPC1 4IG2A 2E7AA 3EXUA 5HR7A 2YW4A 3QH7A 5C9UA 5C6CA 4Y1VA 3GH4A 3W73A 1F61A 4L64A 1KDMA 1OH4A 1AH4A 4GA9A 1J01A 1HKKA 3VHNA 3A6OA 5T5JA 5HA7A 1MZHA 5TBOA 4FFIA 3H54A 2BERA 3TCSA 3IPVB 1YRZA 3B93A 5DCEA 3REQA 4I3GA 3PUGA 1P8JA 1PUDA 3ZIWA 4YTUA 3VBHB 2ISSA 1KM2A 4QPYA 2H6BA 3V3WA 4EACA 3RLGA 2QZ2A 1H2NA 4KFNA 1HJSA 3H2FA 2PAKA 1LL6A 1I4NA 4D6EA 1NF0A 3USBA 2J42A 4WQ6A 3KS6A 2CZFA 1S0GA 4BR1A 4W5ZA 4LO5B 4F0MA 3F5LA 1MDRA 4H7LA 3B0YA 2YOCA 4S3KA 2QUTA 2XL7A 4FSJA 2Y26A 3AIWA 2GVGA 2Z28A 2VBDA 1H6XA 5LK5A 2JFEX 3FIGA 3FAXA 2QUNA 5T9BG 1C3FA 2ZC1A 1W1A1 4BI7A 3SC7X 3VBSB 4AISA 3CEWA 1W8GA 2Q5TA 1ZM1A 3DG3A 4RZ5A 1WV2A 3GDMA 4GQQA 3NQEA 4LV9A 1SO4A 1E1EA 4MAVA 3P82A 4IDZA 3NNMA 2WO7A 4E4ZA 2D93A 1VP5A 2R49A 1V3JA 2NUXA 1XD0A 2F2KA 2XLGA 4AHYA 2Y0IA 3NQFA 3KTXA 4HTBA 4J2MA 5IDIA 3KP0A 2QLYA 2J7BA 2FDFA 4WY0F 2INEA 1F35A 3HVDA 3LMYA 2Y33A 1JJKA 1F9CA 1O68A 3BV7A 1RVKA 3FLPA 3ZFGB 4V1XA 1CGXA 3BPWA 5EMKA 3SW6A 3V0AB 4PGLA 1ENQA 3BDKA 4D72A 1KDKA 2ZJCA 2E1DA 5DT7A 3U3HA 4FFGA 4M4PA 1BBT2 4C1XA 1B3ZA 3TEWA 3W26A 3PL0A 4I30A 4C6JA 1QHZA 4LIVA 4NYUA 3ILNA 3VBUB 5A3HA 4LBSA 1E6ZA 2DW6A 3O63A 2EXKA 4LBQA 4OQ9A 2NT1A 1DJNA 4Y20A 4JQTA 2H9AA 3POWA 2FZMA 1EAH1 1IHMA 1EUUA 3N9QA 1UMZA 4YGDA 1TJ2A 2RS13 4CEWB 4IV3C 4FFFA 4HYVA 4B4FA 1EYBA 4JRAA 2QF8A 2PA7A 3DXIA 2DCZA 3FJ4A 3LOBA 3IIPA 2AYHA 5KITA 2HWD1 2DTWA 1XSKA 2NMNA 2RS52 3CKHA 3RO8A 2C0ZA 2HWB1 3WF0A 1ALDA 1WMDA 4RHV1 1FWFC 4IX0A 2RJ2A 1IV8A 2BGQA 1IWBA 1ZP4A 4JX4A 2WIIB 1YFYA 1JUBA 3M70A 4RDZA 4CU9A 1GZ1A 4WJEA 1UD8A 2QCMA 3ZPOA 2CCRA 3CQJA 1UW8A 3PIJA 4WV8A 4AX7A 5DRIA 4KGGA 3PNAA 1W8HA 2YBUA 1XYCA 3ECQA 3CJIB 1HG3A 2JB8A 1XISA 4F2UA 3CMFA 4ORMA 2QV5A 2ZUMA 3NQ8A 4O1BA 3NPWA 4LSBA 2XQXA 1QT1A 1AR91 2A21A 3LHVA 1EO5A 2NV2A 1J58A 1JPMA 1OD0A 5A8NA 1A53A 3M4HA 1FQ0A 2PLJA 1TTPA 2JQXA 1CIYA 2OPKA 2WWCA 2HPMA 2G3MA 2JIEA 1GONA 3U9IA 2WMKA 3NV4A 5A7OA 2Z1XA 3GC5A 3S7EA 5G4HC 1NLRA 2VAUA 2ZRUA 4UTWA 2AKMA 4L9XA 4XD3A 3NOYA 1AD1A 4C7DA 2WXDM 5A33B 1C9DA 2V69A 1OCNA 2JGYA 1OURA 5EMLA 3FS2A 4MGZE 4CEUC 3GQYA 1Q7ZA 2XZ9A 4B29A 3WL0A 3A4AA 3RPMA 2DU1A 3G3DA 1JYCA 1QDCA 5D1IA 3LZ5A 5E6YA 4XTDA 3TAYA 4DY5A 1XIDA 4G6CA 5FXZA 2Y7DA 2YYUA 1HQWA 1ZBE3 3QW4B 3GDKA 3DKWA 3GIPA 5GJNA 4LBKA 1R081 4KRZA 4C7GA 4S2DA 2IPJA 3ES8A 1XE7A 4LCRA 4ZOEA 2E0PA 3ITCA 3UQNA 4GZ9A 4GXLA 3N14A 1VBD1 2B7QA 3ALQA 4BK5A 1XXXA 3UV9A 2ZX7A 2XH2A 2XJSA 1CWYA 1R9YA 3BSHA 2FH6A 3HJEA 4PEKA 3ETPA 1JPDX 3BVCA 3JBG2 3KAOA 2D7FA 4COUA 2AL1A 3M9YA 3B00A 3S42A 5C55A 2WABA 5FY7A 4LRSA 1W1VA 4WBBA 3EX4A 5FKCA 4O16A 4E4PA 3JB4C 4AC7C 1J0ZA 3AXDA 1KGYA 3B01A 3WUBA 1JUIA 1P0DA 2A6WA 4AZ5A 5FZGA 3SRDA 5IBXC 2OA2A 1M9HA 4FOYA 4NO4A 4Q1RA 2EICA 1PCKA 1TV4A 4L9YA 3N4AA 3RI9A 2C13A 2DBNA 4RQPA 2V6AA 2E32A 4S2CA 5I7GA 3W4RA 2PTMA 1B57A 4HTYA 5T91A 1VB9A 4NJKA 3V5OA 4PCFA 2CIPA 1H2MA 3ZMNA 3CS2A 3G1RA 3URFA 4AQSA 1TMF1 4MGTA 2I2SA 4RGGA 3DBPA 3I2IA 1YBQA 4UFHA 1JZ5A 2GWGA 5FYHA 4XCAA 1ZA7A 4Q8MA 1V9U2 3GDLA 4FR1A 1I8JA 1KM1A 4YWSA 4MWAC 4HU0A 4ES8A 4DO4A 3RZJA 2ISVA 2DT3A 1G6CA 3PBVA 3C4UA 1LOFA 3JXSA 1GVYA 5D2WA 2ZE3A 1NP0A 1QI0A 3CTTA 1CZSA 3OA3A 3WNPA 5FJHA 3WSOA 2XGXA 2J66A 3ARRA 1V93A 4MX3A 4LGXA 2ZX8A 3SUTA 4P8UA 5BXXA 1AQFA 1UHVA 3EGJA 1RUG2 3TYJA 3BGAA 2BZNA 3W29A 1E5JA 1ZJIA 1FAYA 3E6EA 2VZQA 1UR1A 1RUC1 3UETA 5C7HA 3EOOA 3GCWA 3O6DA 4F0LA 1POV0 4A22A 3LXAA 4AGVA 3AAMA 3RQ0A 3N18A 3GTNA 3RO6A 3EKLA 4GKLA 2VRJA 2OEJA 1U5HA 1OYAA 1PAMA 8A3HA 4WHBA 1E0VA 3LGDA 2GMPA 3H2AA 1ITQA 5TD4A 1K9EA 4B4RA 1ZS2A 1WGPA 4LV4A 4IIDA 5IVBA 3M16A 2XSBA 3GH7A 1XBYA 3T4HB 2PTDA 5DUVA 1H9PA 1MEWA 1H4GA 3AVRA 3NZGA 1QOXA 3WH7A 3W1LA 4RJEA 2V67A 4A7KA 2OZ6A 5F2MA 2GSYA 3ZT5A 1XF0A 3SUSA 3BURA 3E2VA 4LEQA 3ATYA 1MS1A 4WIWA 2P6HA 5I0SA 1XC6A 1ENRA 1VFSA 3THDA 2J77A 3TOPA 1FY6A 3QBUA 4PC8A 3N9KA 2ZAAA 3KRUA 4IM4A 4W4QA 4RE4A 1VAKA 5A3OA 3LA4A 3LBMA 2HMCA 1C1LA 1E1FA 3VHOA 2XOMA 1XNDA 2XB6C 3LPOA 5CGTA 5KINA 2Y5EA 4PRRA 1RUH1 3DN7A 1FXZA 2HVNA 3TNBA 4NIGA 5BW6A 2CBJA 2K9ZA 4D3WA 5I00A 3KBWA 1W2UA 3HPNA 4QPIC 4HU3A 3HQRA 1R9ZA 2JALA 3QH6A 4ML9A 1DOSA 1DZQA 4PCSA