4UFMA

Mouse galactocerebrosidase complexed with 1-deoxy-galacto-nojirimycin dgj
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
644
structure length
640
Chain Sequence
b'GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
molecule tags Hydrolase
source organism Mus musculus
publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
total genus 207
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ufmA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ufmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ufmA01
2ZX7A 4D6IA 3DGRA 1MEHA 3NPUA 2VT0A 4J27A 2OT1A 5LA1A 2G41A 3DYPA 3RCNA 4P8XA 3AOFA 3DENA 1WZKA 1Y9GA 5HPOA 1L2UA 3KVMA 1TUXA 3QMRA 3O2LA 2WWCA 4JNMA 1MW1A 2DU2A 3P60A 2ZUUA 2HS6A 2WZIA 3CUJA 2QJGA 2WC7A 5K7JA 3NYZA 5TBOA 2H8XA 4GO9A 7TIMA 4HMDA 4LVGA 1QOPA 4ACYA 4CD8A 1JCLA 2AOSA 2YKKA 4CCCA 3VI2A 1R85A 2WSKA 4J3UA 3GH4A 4NNBA 2YR1A 2AGKA 4WY0B 4NNAA 4UTMA 1XCXA 1LOQA 1WBJA 5A6KA 4HKPA 4TOQA 4HNVA 4UMCA 4DM1A 1TO3A 4XUYA 3ALFA 1E6RA 1F05A 1UD3A 4MOZA 1Z41A 2G3NA 4NI3A 4RZ6A 5KITA 3U8GA 5K4XA 3VGFA 4LVBA 4QJ1A 3GXFA 3BPWA 1ISZA 4E2OA 4B3KA 4H8HA 3PZQA 2X1RA 6A3HA 4UOZA 4UNLA 5CKSA 5C6MA 1DWJM 3KWXA 1TVPA 3MSDA 3ARUA 3W27A 3T44A 1FOBA 3EB2A 3QYQA 5CGTA 5CGMA 4NJIA 3W7JA 1KV5A 4JY8A 4X2RA 4ZQRA 1JD9A 3QRHA 1WBHA 3W7EA 3KZSA 3PTKA 1OF8A 2W66A 3WDJA 4A3HA 2G95A 1XH1A 3QQ1A 1THFD 1TPVA 2V5BA 3LCFA 1XM3A 4MDPA 2VX6A 3ZJ7A 1C3FA 3FEMA 1TMHA 1D3GA 3D0CA 1YTKA 4PN2A 3SECA 3DFPA 4C7FA 1YADA 1C91A 2Y62A 4OQVA 3S5ZA 3C0JA 4IMDA 4RKAA 5KINA 4S3JA 2EPLX 2VC6A 1QNOA 3OLDA 2QCLA 2DZWA 2WHKA 4UNIA 3NZ1A 3QW4B 4NRRA 1V3MA 4H8UA 3TROA 1FFQA 4LGXA 3THDA 3UWWA 3EX3A 3W3OA 3W75A 1NWSA 2ZZ6A 1AW5A 2DGAA 1KQZA 3C2RA 3VIIA 2PF0A 1R87A 1UR2A 3M07A 1Q6CA 2NWRA 3R5EA 3MU7A 4ADUA 5CZ0A 1KB3A 2Z1BA 3O16A 1GVFA 1W2VA 3A4XA 2GJNA 1QDSA 4XB3A 3WKZA 4K68A 1DKWA 4A3YA 2DSZA 2X1TA 1WZLA 3B4UA 3POHA 3WQ8A 4PMNA 1W1PA 1HKKA 3I7QA 2UY5A 4U3CA 4JYDA 2CZEA 2J62A 4GPNA 4LPCA 4W7VA 2V3DA 1VEMA 4TTGA 1OD8A 4UTTA 5D8ZA 4GRSA 4W8AA 2ZTKA 1TPC1 1V0KA 1TV8A 3FY1A 1FH7A 1JDCA 3RFAA 4JAWA 3M1ZA 3EWUA 4YWIA 3CH9A 4DXVA 1YDOA 4QFUA 2ZBTA 3H55A 4Y96A 1OD0A 1UUOA 1O94A 1GOXA 4FLQA 3WK2A 2Y88A 1PPIA 2CCRA 4HMEA 1FXQA 4BQ3A 2A6NA 5A6BA 1HJVA 3BAYA 4GO8A 1FCVA 1GOKA 2YSWA 7A3HA 3OLGA 2QCEA 3F4WA 3A47A 1LQ0A 4UQAA 5CQ1A 1UH3A 4LOCA 4PTNA 1XD1A 2GDVA 4V27A 3W2UA 3PUOA 1GORA 3VD4A 1VZWA 1JIBA 3VIKA 3G24A 1W9BM 4BCEA 4MUZA 4JN6A 1R2RA 3H54A 1KXHA 3UGHA 3O9NA 2J6XA 3S8HA 4JTHA 3UEQA 3NYDA 4ZZ9A 3MO4A 2TSYA 3WNKA 1VGAA 4W86A 3TOPA 2BHUA 1TQXA 2V2DA 3HJEA 1CXHA 1JI1A 1CX9A 2D0GA 2V38A 2ABBA 2PWEA 1Q3NA 4Z2LA 1LL6A 1J0IA 1WDRA 4BR1A 1BGAA 2OJPA 3KAOA 1E3XA 4DQWA 1AQMA 5FKYA 2DJLA 1HKIA 3NSXA 5D9MA 1TR1A 3U5UA 4RK8A 5A8GA 4M24A 4W9TA 3CHDA 3A4AA 2ZRVA 3JRKA 5A5WA 4CNPA 1ME8A 1VQTA 1TPDA 1KGXA 2CWNA 3OBKA 1C7TA 2PWGA 3GDLA 3IIOA 4LUJA 3NA8A 3O6AA 4D71A 3MP3A 1GJPA 4JX6A 4UTIA 3TXVA 3UPBA 1KM5A 4JTJA 1B3WA 1E6QM 2XVNA 4AIOA 3W1XA 5CPOA 3NPXA 1GCYA 3W7QA 4UOJA 1W3KA 5D9NA 5KMYA 3WQ6A 2CZDA 5D8WA 2XVKA 3BMWA 3SCNA 2MANA 3KRZA 1T0OA 1XYFA 4GIAA 3MW7A 3DU0A 1TPB1 4Q32A 3ZJ8A 3WY1A 2NZLA 1XCFA 3O6DA 1H7OA 3GYCA 4MDOA 4QNWA 4JX5A 1UQZA 4IMEA 2CERA 4Q22A 1QI3A 4RR4A 1MYRA 3BLPX 3NAVA 3THCA 1GYNA 1CLXA 5ABFA 2WMHA 1SZFA 5FEXA 4LU0A 5HOSA 1F76A 5DBUA 5HUPA 3I7RA 5U7SA 2BY0A 2G4FA 4CVWA 2RGLA 4XUGA 1TMQA 2ZRYA 4E8CA 4D6GA 1KV8A 2CXGA 4HSNA 2JF6A 2WKJA 4LW7A 3CZEA 2A4AA 3NM3A 2B31A 4WXYA 1L0PA 3QPYA 1GHSA 3QHOA 2Y4SA 3W1PA 3TSDA 4U5IA 4PRWA 5JIPA 1SSGA 4MY9A 1B3XA 2JEPA 2CETA 5D9PA 1JFXA 1QPQA 3IVSA 4CD5A 1ADOA 2WHLA 4BQ5A 2Y24A 4WZHA 3STGA 3VX1A 3BLFA 3N15A 4J28A 1LF1A 1GZJA 1MQQA 1Y7VA 3CHFA 1TFVA 1TREA 1M03A 2D22A 1CXKA 4TUFA 4M19A 3WQ4A 3CUHA 2J24A 1CGWA 1TRIA 5A6MA 3FJ6A 3SUUA 3MO7A 2ALDA 4HPHA 1GG1A 1ZBVA 2CLOA 2VRQA 2BNJA 4I7VA 3ATYA 3K30A 1NOWA 3F4VA 1MW3A 2YDAA 3S5QA 1WX0A 3P80A 2GVLA 3LHZA 4D6HA 5D2TA 2C15A 3FIGA 3B8DA 2QKFA 1AL8A 2YXGA 1K3UA 3VCRA 2F8QA 1W56A 2RH9A 3W74A 2DPEA 2QCNA 3T2PA 3LLFA 4DWSA 5CSUA 7TAAA 2EF9A 2VOTA 5D9OA 4HXCA 3STEA 2WV8A 1SQ7A 4UMBA 2DH3A 3G18A 3C6CA 1K7FA 4FXSA 3W25A 1JQVA 1L9WA 4FF7A 4WD0A 3NSMA 1FA2A 3BMVA 4K38A 5F4SA 3NPVA 3RLVA 2W79A 3NVTA 3FKKA 3AQUA 2NV1A 1ZFJA 3LB0A 4RZ4A 3VNYA 2OZ0A 5LNWA 2YL8A 4C7DA 1UWSA 3TAOA 3N1AA 5TIMA 2FPYA 3ABRA 4JL1A 3LF7A 1ZY9A 3LLDA 3W71A 4BWLC 4BS0A 1OHLA 2ZUSA 3HG3A 4GI6A 1SUXA 3DHDA 1W3NA 3G1AA 4ATLA 1H7NA 2F61A 3PZNA 3LXCA 5AN7A 1UD6A 2E8ZA 3NQ7A 2WVSA 4ZENA 4P7OA 4QIUA 3WEZA 3IGUA 2VKZG 2H3BA 4XBSA 3UPWA 5I3FA 4M82A 1MW0A 3I68A 4JGDA 1JI2A 2D3NA 2ZX8A 2V2CA 4RE2A 1W5OA 3WL1A 4MAZA 1UWQA 3ZIZA 5ECUA 2B7NA 4DWSB 3RU6A 4WJEA 1W1VA 1OF6A 3WBAA 3LPFA 4XQ6A 3MMWA 4GXPA 1VR6A 4OZOA 3N9SA 3W87A 4D72A 4JTIA 1LL7A 3A9IA 3O15A 3OB8A 3L0NA 2JKPA 4PTWA 4LRTA 3VIGA 1ZS2A 4AHQA 3WEOA 3S9YA 1LBLA 2WVVB 1KQYA 1ZAIA 3GNDA 1I4NA 3VIOA 4D6CA 3BARA 1K8XA 3MSGA 4GUHA 1W9DM 2Q8XA 3NQDA 3OSDA 2X8RA 5AYYA 5C55A 2VJXA 3N12A 5LKYA 3TMQA 3PZMA 2Q8ZA 1PZ3A 3G6LA 3TTSA 2B7OA 1ISVA 4HOXA 2WCGA 1ISYA 1C8XA 1LJYA 1CI1A 3WD1A 1YPIA 5FL1A 2XGBA 3CHEA 6TIMA 1VIWA 4F66A 1XH2A 1VRDA 1H3GA 4ADSA 5KZ6A 4XZBA 3WIJA 1AMKA 3UR8A 1IIGA 3WH7A 3PSWA 1YDNA 1Q6FA 3W53A 5FMBA 3LM7A 5DFAA 1DWIM 1R47A 3LCLA 4S2BA 3L2IA 2ZFAA 3PR2A 5HMSA 2TMDA 3W7DA 3SIMA 3HMJG 5I24A 3K46A 3TTOA 4W89A 4JTKA 5CZSA 3MYPA 1E0VA 5E6YA 3LHUA 1J0KA 3KRUA 3MJYA 3T4CA 4AMAA 1QO5A 3GAKA 5D32A 2YYUA 3W88A 1UZ4A 4CQ8A 1QMLA 2CW6A 4N0RA 4Z1CA 4AD0A 1IV8A 4AWTA 4BWLA 3UD6A 2TAAA 1FWRA 4TVCA 5F2LA 1SO4A 2E5BA 1HNYA 1KWKA 3LDRA 1H7XA 3STCA 1JF6A 1YXDA 3SIZA 1VBUA 4RZ5A 2WMJA 1X8FA 4ACZA 1OFBA 5BMXA 1IF2A 3B9DA 4WKHA 2Y63A 1HF6A 5E70A 1LOLA 4ZXOA 2QCDA 1CNVA 4XTDA 1K9DA 4AC1X 3CT7A 2CHOA 3W6LA 3NO5A 3O63A 1EHNA 3BW2A 4AZBA 4AHPA 5FF7A 4QNEA 4S3KA 3PUEA 4MKNA 2X1IA 2ZE0A 3R2GA 2EPNA 2VX5A 1N55A 3AMGA 5CGQA 4BI5A 5JBEA 3W7PA 2H90A 5D2XA 2ZA3A 3G1DA 1JF5A 4UFJA 3MYOA 3W1MA 1F7BA 1MVYA 1UR4A 4UUIA 2NLIA 1X1OA 4F8XA 2YW3A 5FCZA 2WZEA 4IJBA 1JD7A 1HUVA 3W85A 5DCBA 1UHVA 4AEEA 4FK9A 3WBEA 3LDVA 1EHAA 2YBUA 3G22A 5JIWA 1E15A 3IGXA 1HJWA 3QOKA 5FEPA 3UWUA 3DFTA 3P82A 3BSGA 1QNPA 2CZ5A 1ZHAA 4AEFA 4FNSA 4NZCA 4Z08A 3T0DA 2EJ1A 3NQGA 4HPJA 3L4XA 1EWDA 2GFTA 5D4YA 3UGGA 1KBJA 2WJZA 5A8OA 3VNDA 3M7WA 2VFHA 2ZZ1A 2C14A 2RDTA 1E40A 3AS3A 8A3HA 3W7KA 3C56A 3LTPA 1VHCA 2E0PA 3UCQA 3DZ1A 3W9ZA 4MNJA 3VM7A 5CPMA 3W83A 3W26A 1FCUA 3GNOA 2YBTA 5FL0A 1Q6LA 3GH7A 4AZHA 3KL5A 3W7HA 4W87A 2XN1A 1JJKA 3POCA 3L5LA 3TA6A 2ZTJA 3PUDA 5A6AA 4G1KA 3W38A 1N8FA 1LLWA 1CGVA 1QNQA 3KF5A 3CEUA 4JY9A 2O9TA 5LHFA 1KM0A 1TV7A 4PTXA 1LBFA 4C7GA 3W7NA 3OGRA 1P5BA 3AIUA 3SCVA 2NWSA 5LNRA 4PTVA 2QUVA 3PIJA 4EVZA 4U28A 2C1HA 3Q94A 1OYAA 2DJXA 4N02A 3W28A 1O60A 1US3A 2CBUA 1KM2A 3AZTA 1KFKA 2ZZ3A 5I77A 3T78A 4IX2A 2BVTA 4W85A 4QHZA 1CLVA 2XJ7A 3HGJA 3TV8A 3BLKA 1OK6A 2WNNA 4AISA 3PG9A 2ZICA 3L4UA 5F2MA 5A69A 3WK3A 1ZB5A 3OVQA 3AZSA 2VX4A 1G0CA 3U14A 4AY1A 3ZSTA 3ZS4A 3GNNA 3OEXA 3PAJA 2QQUA 2NV2A 5ABTA 2J7EA 1NP0A 4CGTA 2WBKA 2XM2A 1Y0EA 2E5CA 1EEPA 2CLKA 4A21A 1VFFA 1G1YA 3WMCA 1K9FA 1W8SA 1YYAA 3ZM8A 3BC9A 4R7JA 2FB2A 1TTPA 1OX6A 4PL1A 4Y6GA 5EMUA 4IPNB 1HTIA 3TE9A 4O8RA 5D37A 5A6JA 5I23A 2GJRA 1AG1O 4UMAA 5BRPA 4MFEA 1H1NA 1BYCA 3LPGA 3AHZA 4Z2KA 2FLIA 4ICNA 3ZT7A 5AHFA 3U5YA 3BK0A 4UFKA 2XG9A 4CD6A 2E5DA 1QHZA 4UR8A 3SC7X 4FNTA 1C9DA 1V0LA 3UG4A 3S2CA 2W4XA 4GQQA 2Y6ZA 3GZ3A 1E1FA 2YL9A 2R94A 2BWGA 2WYSA 2JIWA 1E72M 2YOCA 5G2HA 2GVGA 2QV4A 1XCWA 2DT0A 4AF0A 5EFFA 3ABOA 3O1NA 4O1CA 4DF1A 3BW4A 3GB6A 1SU5A 1JUKA 4XBKA 3PM6A 5G2WA 1XH0A 3ZQ9A 2FB3A 1RD5A 4ACZB 3MANA 3IJ7A 3G1XA 2W67A 4AB4A 4UTWC 3UG3A 5C8BB 3VE9A 1EX5A 1I2OA 2BXYA 3GXIA 2XTKA 1W9UA 1G9HA 4LTSA 2WNWA 3ZT5A 4TO8A 2X16A 2QCGA 3EXRA 4PMQA 1GG0A 1TV5A 3PWAA 4P8VA 5DT5A 5DT7A 5EMYA 5LNSA 3OZPA 3CHCA 2YYTA 3ZR4A 1UBSA 2J9ZA 1HXJA 4GUFA 1QW8A 3EDJA 1SW3A 5AYIA 2V5CA 3VGHA 5AHNA 4CCEA 4PMRA 1SO5A 5E0FA 2YLLA 5AYBA 2CFFA 4M6QA 2H8ZA 2WANA 1ICQA 1CECA 3D3AA 4LUIA 4D2JA 5BW6A 1CPUA 4MJ2A 1LP6A 4JEQA 2W63A 3WJWA 5G5IA 2WSQA 5IHSA 3L0GA 1PIIA 1TYGA 1UOKA 1CYGA 3TDFA 3B8SA 2WSRA 3KHJA 3UY8A 1B9ZA 1SR9A 4U3AA 3AYSA 3VDBA 3OZOA 1US2A 1H49A 2VOMA 3PBWA 4X0NA 1JNDA 1WDPA 3C3NA 5A6LA 3MUZ1 2G97A 4FMVA 3PS7A 4H4IA 3OLIA 2CHNA 3RDKA 3WF3A 2W5FA 4NT0A 3CWOX 1WPCA 1PX8A 4L4OA 3GDKA 3STFA 2ADDA 2V82A 2X1SA 3OBAA 1ESWA 5HR7A 2GJLA 3AZRA 5FIPA 4X9SA 2QQWA 1HP4A 2O7SA 3MBFA 4GZIA 4ATDA 3USBA 3SFKA 1FXPA 3TSMA 3QW3A 4X22A 1N82A 2D24A 1XUZA 4FIQA 5EBAA 3NXFA 3W72A 1VYPX 1KA9F 2YCEA 1KCKA 4NJKA 2I1OA 3P8JA 3MMTA 3OIHA 3WD0A 3B06A 1EPXA 4JCMA 1SFJA 5FF4A 1PAMA 3GIYA 3SCWA 2YX0A 3HBLA 3THAA 4E0CA 1F5ZA 4AZCA 1QPKA 1NH6A 4AWUA 2OSXA 4FX7A 5G1YA 3WQWA 3WNNA 1XXXA 2ZRWA 5D03A 3ABQA 2YDQA 2EKCA 3FJLA 1JCJA 3NQ8A 1HJXA 3HGSA 2QF8A 3SGUA 3U7VA 2J8GA 3W81A 1JCXA 3DFQA 1UH2A 2J7DA 3AIBA 4PMUA 4O16A 4S2CA 8CGTA 1DJQA 4LYQA 1W3LA 3W1TA 1VEPA 3AI0A 3UR7A 3T2QA 4D1JA 3VIJA 1OJXA 4CN4A 1M7XA 3MMUA 4D6FA 3EWBX 4PMDA 4FB7A 1SPQA 2PB1A 3K8LA 3GBEA 1J11A 1WQ5A 2AAAA 5D2VA 3QHNA 3LXAA 5F7UA 1A5CA 3GM8A 4DWSD 1FCBA 3UERA 1UYPA 1T8XA 2D73A 3R12A 1BWKA 4P61A 4UTTC 5K9XA 1V3IA 1Z32X 3GTNA 2WVUA 4PTMA 1Q4NX 4O19A 4LS1A 1DV7A 2I9EA 3VOCA 4E2BA 4FF5A 2JGYA 3MBDA 1B3ZA 1UWIA 3CTTA 4JCLA 3A21A 1H7PA 2NXIA 3QSTA 3TMLA 4LC8A 3H3LA 1KLZA 1KTNA 3GDTA 1KR0A 5J5RA 4K7VA 4WIWA 2A3AA 4AW7A 4YHEA 3WK1A 4AH7A 2WC4A 1UD8A 4B16A 1LBMA 3G8RA 1TTQA 2ATSA 3AHXA 4PUDA 2V3GA 1H62A 1NEYA 3CM4A 2QMKA 4U31A 1PX3A 3DHUA 5D2WA 3EXSA 4CVUA 2YLAA 1VLWA 3CPUA 3RM9A 5A8PA 3GH5A 3NL6A 3IIXA 1FDYA 1W5QA 1X1ZA 1UR0A 3HMCA 1SMDA 3WN6A 1HVQA 2YDRA 1KW1A 2NT1A 3EXTA 5CZJA 1J0JA 3ATZA 4R33A 4FNPA 4CU8A 3S5OA 4KH2A 1UZ1A 1MXDA 4HA3A 1K9TA 1IT0A 3WMSA 1KM4A 4R53A 1KFCA 3QZEA 2A85A 2VZOA 2ZX9A 1GQKA 2XM1A 3HOJA 1S46A 1BG4A 2VMFA 1XL9A 1ST8A 2GPTA 3L66A 5FF0A 1AVAA 2YFNA 1WP6A 2WMIB 4KRTA 3AS1A 2GQAA 1YTEA 1GJWA 2VQUA 2XYLA 3ARPA 3WJXA 2XHYA 1GOWA 2WKLA 4R5EA 4AD3A 1JYWA 1VCGA 1KBIA 4U4MA 3AROA 4JFWA 4RE3A 3G0XA 3AHYA 2Y7DA 3VD5A 4JD4A 4E8DA 5E0KA 1VCVA 3L21A 4WY0A 1QVBA 1UJPA 3P74A 5D09A 3UNDA 2CIPA 2DSKA 5D2YA 4JFTA 1R30A 1HKJA 3HPXA 1S5VA 4JFSA 4OOUA 3QC3A 4XWUA 3PN8A 4U5KA 1Z48A 3C52A 1H60A 3M6DA 3WENA 1QNRA 4K37A 1JDAA 2DIEA 2FGLA 1E4LA 1UR9A 1NF0A 5CSRA 2BXVA 1MFVA 4HA1A 5FESA 2OXBA 3RILA 3SI9A 3QM3A 4FEZA 4N9DA 1ONRA 1EQCA 5LNVA 3KXQA 4OJYA 2D3LA 4H7VA 1QO2A 4FO4A 3NQMA 5I3DA 1YXCA 4LWWA 1KTBA 1BTMA 1GOQA 3WD4A 2ZWZA 1AQ0A 2VRKA 3PBUA 3PBYA 4LS2A 1TRDA 4IXHA 1N7KA 1LRTA 4M7SA 5D02A 4BZYA 2XVLA 2PRMA 3BGJA 2PWFA 4MY1A 1AK5A 3QSRA 1PX4A 5HULA 1D2KA 4A2RA 1UKPA 2ZXQA 5IHRA 4FXRA 1BWLA 3LTYA 3FNDA 4EOUA 1H41A 5CLWA 5K9DA 4MADA 3TTQA 1ISXA 1BVNP 4N4QA 4LT9A 1VYSX 4ONVA 4POCA 3NQ2A 4RXGA 3TKFA 3K1DA 3VNZA 3MUAA 1UASA 2E6FA 1G01A 2VUYA 1SO6A 2W0UA 3TNOA 4MAVA 4HIBA 4OUEA 1H2JA 1Z44A 4GKLA 1D3HA 2FJKA 2YA0A 2WWDA 4I7WA 4QQ3A 3L4ZA 1OX4B 2YL6A 1NOFA 1DWAM 4Y7EA 2FTPA 4HZ6A 5EYWA 5L9FA 4O4VA 1GJUA 2WZHA 4QLJA 5GNZA 4UQBA 4AYSA 5AC4A 1A50A 4ZXLA 5D30A 3W2JA 3EWXA 1OB0A 3WF0A 1GW1A 1GHRA 3E9AA 1UA3A 2WNQA 2HMCA 1JZ4A 2KZHA 2Y7EA 4TU1A 2G3JA 1WXJA 2DZXA 2BXZA 5BXRA 4W7WA 3UXAA 1R8LA 3GXTA 2UV8G 1G7UA 4IXXA 2Y85A 2XPKA 3A4WA 3CIVA 3VMPA 5LA0A 3SURA 3TX9A 2V3EA 1WDSA 3F5LA 1O95A 1VLIA 3O8AA 5G1TA 3NM1A 3T55A 3UZ5A 1Q6GA 1ZU8A 2XUCA 2Z1SA 3MUIA 4JHZA 4Y9AA 4X0VA 2Z0IA 5SWUA 4RV8A 4OV9A 2QCHA 3A6OA 1OG0A 3NOEA 1IGSA 2FDMA 4YN5A 4B9YA 2W91A 3M44A 4I7UA 4DPPA 1V5XA 2WLZA 3IRDA 3HG5A 4OGZA 1M01A 2VI0A 1CEOA 4XZ9A 5LHEA 2CU0A 2A3CA 3CLMA 1WE5A 2VR5A 2CPUA 4JYFA 5FIXA 4O1AA 5E0CA 3N13A 3W2NA 4WY0F 2X0HA 4O1DA 3W7OA 2JE8A 3LCIA 3CMGA 2HS8A 3HB9A 4AAJA 3FLUA 1YHTA 4FX6M 5ABGA 1PHQA 2V81A 2YA1A 5KEZA 3E0IA 4XX6A 3W7GA 4AHOA 3AMLA 3S0CA 3HF3A 3WH9A 5BYWA 3RMJA 4FX8A 3BO9A 3N2MA 5JBDA 4PC8A 3GXPA 4DO4A 2XSAA 1YTDA 1BYDA 3TR2A 3BCFA 1QWGA 1NQ6A 5T26A 3TIMA 4PEEA 1P0NA 3VD7A 1JZ7A 4PMXA 1S3HA 1V03A 3AJXA 1EP2A 4YXGA 4DUVA 3N73A 3E12A 3NDOA 3GDMA 2IXUA 2WC3A 4LXFA 2J9XA 5CSYA 3RMEA 2QQVA 2ZZ2A 3WUFA 2CBIA 1TG7A 3WUEA 2ZZ7A 1TSIA 1FH8A 1RP9A 3LRMA 3PC0A 1PHWA 5FK7A 1ZL1A 3BGAA 3P84A 1BGGA 4AWSA 1ITCA 3CQ0A 1E6PA 3II1A 4J3XA 3M5YA 3W82A 1ALDA 3PZIA 2ZZ4A 5GNYA 2OWXA 1B2YA 4UIOA 2ISSA 1LWJA 4LNYA 2R8WA 2Y70A 5A3HA 2FPTA 3SUSA 4GINA 2FPVA 1UKTA 4DWSC 5I3IA 1JCNA 3MI2A 4FLRA 1ZAJA 3W1RA 2ZYFA 4K36A 4ZQPA 2XVPA 5FMDA 4LRSA 3IANA 3P8IA 3LEMA 1DHKA 4UFMA 1E70M 3QEZA 1WDQA 5A2BA 5CG0A 3HG2A 5C2XA 1FHDA 4AEOA 3PB2A 1CENA 2D23A 4JR5A 1WV2A 3L9CA 3W22A 4W88A 1TVNA 2B0MA 2TYSA 3OGVA 6ALDA 4PCFA 1K9EA 1RR2A 3VGBA 4FNQA 4CCDA 4IQLA 5M3WA 4MZYA 3VO0A 4BI6A 3C4UA 2VO5A 1HO1A 4ALDA 3LV5A 1GQNA 2BZNA 4YMZA 1W32A 4W5UA 3WNMA 1E71M 1EOKA 1I2PA 2C16A 1K03A 1TIMA 2VEIA 4HZ7A 4KWVA 2JK2A 1ICPA 5DF0A 5A2AA 2B7QA 1R86A 1WDWA 3N17A 1K6AA 3VILA 3VUPA 1WA3A 5I0DA 3W76A 3WF1A 4L4PA 4JDYA 2WMIA 3J7HA 5C70A 3MV11 3QPZA 3SUWA 3C2FA 4PUEA 1CXLA 1QHOA 3WNLA 1GQIA 1G94A 4XKYA 1WYIA 4IMCA 4NJGA 3DFSA 4AZ7A 2Z6JA 1DORA 3ARZA 1SMAA 4WOQA 4LVFA 5BWFA 3F5JA 1XUUA 1OINA 1EIXA 2BY1A 3WUGA 2Y5EA 4AZCB 1FBAA 1OFAA 2QDHA 5LSMA 3SCQA 3MUXA 3C2EA 1LWHA 3KL3A 4LYRA 4JTTA 5LZLA 3QMSA 3SZ8A 1FP8A 3CWNA 1EP1A 1TE1A 5F2GA 3P81A 3AXHA 7CGTA 3MS8A 1RD6A 3F4NA 1C90A 1L6WA 1ME9A 1GNXA 1U2YA 3CZLA 4QCFA 3W1NA 4BI7A 1X6LA 3L4WA 1Z42A 1JGIA 1PCKA 4AIEA 4Z0JA 1IXQA 2R14A 3FYPA 5A8NA 3S1VA 4Z1BA 5CPQA 4K7YA 1OGBA 2AAMA 4IGHA 1C29A 1V7YA 2XFWA 4NZJA 3UWVA 5F1VA 3AIQA 2BS9A 4QDMA 3CC1A 2P0OA 4LY8A 5F2IA 1HN1A 4ZFMA 1XC4A 1H0IA 2EHHA 3LHVA 1JYVA 4RLIA 1FH9A 4BQ4A 1OT2A 3KVLA 2DT1A 3ELFA 2EEXA 3WF4A 1W0MA 5BRQA 2VEMA 4MPQA 4E4PA 2VNCA 3E49A 4PEKA 2PE4A 3W7RA 3G1VA 1HL2A 3FYOA 4YL2A 5DXXA 5A2CA 5HPCA 3M6YA 4UTWA 3MP5A 4A4AA 3BGGA 2G8ZA 3U1XA 5DXYA 1MQRA 4QAWA 4TVUA 2LLEA 3W07A 2VCAA 2A1YA 1QNVA 3KL0A 2WQPA 5KZEA 3P67A 1ICSA 1KWGA 4ML9A 4JYEA 2C13A 3A23A 3QFEA 4MLJA 3TJLA 2ZUWA 5I78A 3OHIA 4FNUA 1WZAA 2CLMA 5H91A 2A3BA 2WHMA 3CUFA 5GNXA 3B9EA 4GZJA 4OIFA 4N4PA 2D20A 1GVQA 3VGGA 3ZWTA 4F9DA 3O07A 1KR1A 5IFTA 2XQRA 1LOSA 3DI1A 1JFHA 3KX6A 1MXSA 2ISVA 2J25A 4CU6A 2WLYA 2D0FA 4MNLA 4JS3A 4PODA 1ISWA 1W3JA 2Y2WA 3EDKA 1VH7A 3RO8A 1A53A 2FHFA 3TC7A 4ZE4A 2Z1KA 3B0PA 3FKRA 3WNPA 4GE8A 5E93A 2ZRXA 3DKLA 4UZSA 1KM6A 3KFTA 3VX0A 2E6DA 3H53A 3PF3A 4IMGA 2RHGA 1HO4A 3ZJKA 4UCFA 3IIVA 1E55A 3FW6A 4GJ1A 1ZJAA 2VZUA 2WPBA 3VKJA 2DEPA 4ZQCA 3W24A 1HP5A 1OVDA 5AHMA 2DP3A 3T08A 1V3LA 5I3KA 1TPEA 1NOUA 5FKBA 1QR7A 1UA7A 3PIGA 3K4DA 3HO8A 4O52A 1BG9A 1VRXA 1E51A 1NARA 1WOBA 2OSWA 1GOIA 2GUYA 1CXFA 5IDIA 1O5KA 2XWDA 1EO5A 2NXHA 3VPLA 4AWEA 1PCWA 3W1UA 4ZL1A 1TB3A 1VCFA 2YW4A 4KFPA 3YPIA 4NU7A 3KVKA 1QHPA 2ADEA 1NF7A 5LGXA 1KXVA 1KFWA 2A2IA 4L4MA 2OWWA 4DEFA 4ATWA 4B9ZA 1BKSA 3U2OA 1LLOA 2WVTA 3FHQA 1WCGA 5I2UA 1K7XA 1DWGM 1VEOA 3M46A 1ML1A 2YL5A 1OSEA 4WK9A 3AYRA 1ME7A 5HNRA 5FMCA 4O0ZA 3NDYA 5DCEA 5FD0A 4FIRA 2XN2A 5G2IA 4HNNA 3GAYA 4EF9A 1G7VA 1X6NA 4JQTA 3EX4A 3R8RA 1U30A 2OSYA 3MUY1 2FH8A 4LYPA 3ARVA 2WMFA 2OMAA 2YJQA 1XDLA 1GOOA 2Y7FA 1BSIA 4DM2A 4GQRA 1H0GA 2NUYA 3QQ0A 4PH6A 4YCPA 4V28A 3ZWSA 4J7RA 2XFYA 2HVMA 3GZAA 3EDFA 3N9RA 1AW2A 3M5VA 3O05A 4IPIA 3W7LA 2YFOA 1VPXA 4W8LA 4DUXA 2VELA 3LIGA 2P10A 4H3DA 1OX4A 4A2SA 2X1UA 3NQ6A 4MB3A 4D6EA 4JICA 2AQWA 1W9XA 1E1EA 3JR2A 3HPZA 2Q3OA 4XZWA 4FFFA 5EB8A 5E09A 1OIMA 3CGTA 4F79A 6TAAA 1K8ZA 3NQAA 4QITA 1OFPA 1PS9A 2CLEA 4NUWA 1OBAA 2D1ZA 1OGSA 2Q3RA 3SW6A 1D3CA 3LERA 1TQJA 4FNRA 3V1PA 4CKQA 2J8FA 2ZQ0A 4GBUA 4LC6A 1FHLA 2VQTA 2H6RA 1V3JA 3TCEA 5EBUA 1GVRA 1KFBA 3L0KA 2QUUA 2C8NA 2WMKA 3I6RA 4HNUA 3G1YA 1T99A 1ZBCA 2E6YA 2BTMA 3G1SA 1ZAHA 3B0VC 3EMQA 4OBSA 3W7IA 3QH2A 1HFBA 2VFIA 3EKZA 2CESA 3WF2A 2H3DA 2V30A 3S5YA 1BEUA 1AMYA 2QHAA 1T96A 5G4EA 4IPLA 1JZ6A 4URIA 1V6VA 2EPKX 1JZ2A 2X30A 3FOKA 3S5NA 3LXBA 4CU7A 1EP3A 1WKYA 1KXQA 2GVYA 3LRKA 3CTLA 3WDRA 3WK0A 3PVFA 2UY2A 3LFIA 3GVGA 3PB0A 4O18A 2W92A 3EBVA 1VFOA 2V8ZA 1XSIA 1XSJA 3BAKA 1V3KA 1JQXA 1V02A 2WSPA 2X2YA 1FP9A 2WOQA 3KEHA 4JHOA 4O11A 1H4PA 4TMCA 3K8MA 1EUNA 2C6QA 2J79A 1E0WA 4MLRA 3NL3A 4FHAA 4MZ8A 3TQKA 1KFJA 4EIVA 1W9VA 2WCAA 1VJIA 1FWWA 4GI8A 1FWTA 2VZVA 1GVOA 2GJXA 2A7NA 3ANYA 3N14A 4MPKA 5DELA 3M47A 4M6VA 3W2KA 3AS0A 4DUWA 1PBGA 4Y8FA 1ZENA 1RQHA 3AIWA 3LCWA 2WXDM 1DVJA 1B90A 3CO4A 4ZVJA 4CN1A 3L67A 2QCCA 3N34A 3WQVA 3DC0A 1CZ1A 4NJHA 5ANNA 5CJ5A 3DI0A 3HIJA 5DEZA 4PMZA 1TJPA 1KXTA 2E68A 5K9CA 3WDIA 3BH4A 1G69A 3VIHA 5BMWA 4YCOA 3RK8A 1SW0A 4M56A 3W29A 5ABFB 3IIPA 4H8VA 1OYBA 1XKYA 4K39A 2PBGA 1IXNA 2NUWA 1GYLA 4WUIA 1HX0A 3SUVA 2E3ZA 1CDGA 1H11A 1LCOA 5AB3A 2RDWA 4TX6A 2QJHA 1W3IA 3WDQA 4PA8A 3DH7A 3M16A 2FIQA 3P5YA 2ZX5A 3VINA 3VDCA 3GXNA 1OK4A 1J4EA 3EX6A 4WQ6A 1RH9A 2J27A 1JAKA 1L6SA 3WFAA 2E4TA 3M5ZA 3HG4A 1OFDA 3MHFA 3E1F1 3W84A 3EDDA 1BLIA 2NXGA 4DO6A 3WH8A 4WF7A 1UUMA 3ZR6A 1UQYA 3G1FA 4XTIA 2BLEA 3S1XA 4H04A 1JYNA 2DIJA 3KRSA 4Q4KA 1B57A 4ZMGA 1HG3A 4P8WA 2QMJA 4HOWA 3A5FA 3BLEA 2XN0A 3F5KA 1B4KA 4PMYA 1C8QA 3A3HA 4PSRA 3EMZA 1XBZA 4MIMA 4OBTA 5CZTA 5AHLA 4CQ9A 1TA3B 2ZX6A 3HU7A 3B04A 4HU0A 2XFFA 4UR7A 1MWOA 4C1LA 1O5XA 4EWND 2IXVA 2YA2A 4PSPA 4W84A 4CN6A 5HXMA 1JZ8A 5GVJA 1ZCOA 4A3UA 5C54A 4MJZA 1W1TA 4OOZA 3ABSA 2J9YA 1KM1A 5EY5A 2BV9A 2ZXDA 4ZE5A 5E9AA 1OABA 2QCDB 3WUBA 2EPMX 4MB5A 4MB4A 4JTLA 2D0HA 2PBOA 3LBMA 2C3ZA 1QNSA 1F74A 1R7OA 1J10A 3S42A 3TW6A 1DWHM 3B0UX 1SW7A 1J18A 1IZJA 5AC7A 1SZNA 1W91A 4JIEA 4UTKA 4ORIA 1B9BA 3QJAA 3P62A 5E1QA 3RM8A 1UCWA 2QJIA 8TIMA 4M6PA 4MB1A 2V5LA 1R46A 3LHTA 1XGZA 3U7BA 3TH6A 3AS2A 1W3HA 5M03A 1GQLA 3WELA 3U57A 2RGMA 4NRSA 4CD4A 3G0UA 1F4HA 4LV4A 3PZGA 3QR3A 3GXDA 2G3IA 4NX5A 1LG2A 4UTHA 1A5BA 2RDUA 3VGEA 2O9PA 4N6EA 2ZWYA 1DWFM 2JBMA 1BPLB 4UTJA 2NSXA 3VVGA 5HWNA 1E56A 3G8EA 3PY2A 3QF0A 4DBEA 4QLKA 3T0BA 3WEMA 5TQLA 5GQBA 4WOZA 3S6DA 1SFLA 3UWYA 4CLMA 1JAEA 1QI0A 1OFOA 4CQAA 5D04C 3IK2A 4AZIA 1CTNA 2X09A 1H61A 1B0IA 4EE9A 3VDAA 3AMKA 2C7FA 1U83A 2ZUMA 1KGUA 5AFDA 2Z2UA 4QISA 1DL3A 4M1RA 4TTUA 2WO5A 4E38A 2O92A 1WAWA 3FAXA 3TQVA 4UTLA 1W2TA 3WDHA 3OG3A 3IJ8A 5D05A 5AHIA 4KGJA 3EMCA 3GKAA 3PZOA 4B3LA 2J78A 4ZQMA 4H6KA 1MZHA 4OWGA 2J75A 3EDEA 4PL2A 5CG7A 4GI9A 3WL0A 4IUGA 3UY7A 1LZOA 4O1BA 4O10A 1TPUA 1X1NA 4PMVA 5GPRA 3NSNA 2PWDA 4WJXA 2WW5A 3EX1A 1PIGA 1VB9A 3MHGA 2BFGA 3ARRA 3C61A 2Z6IA 1W5NA 1QFEA 4HPXA 1FY6A 5I3JA 3PTQA 3FXYA 4UZUA 3AMDA 3N04A 3W1QA 5A94A 3LTSA 1H7RA 4LV9A 3CZGA 4LVDA 1CIUA 3NQEA 1OT1A 2VVNA 4LX4A 4M81A 1XBXA 1ZBWA 3TK7A 3EKLA 2EQDA 4AZ6A 3DFNA 1I1XA 3ARTA 1C92A 1IXPA 4BA0A 4RE4A 3LX9A 1O6IA 3CPRA 2PC4A 3I3BA 1KLYA 1XC6A 1CXEA 5JBFA 4YPJA 3WFZA 1VJSA 4HT3A 1JYXA 3BLIA 1SR0A 3AIEA 4DPQA 1JULA 1A5AA 4ZQOA 5H2ZA 3LPPA 4YHGA 5I79A 1UG6A 3DFOA 1OX5A 2EPOA 2QR6A 4W5ZA 4M29A 4QCEA 3FAWA 4FFGA 1JRBA 2JALA 3AHTA 3LRLA 5F4WA 1AL7A 3NQVA 1G4TA 1OFRA 4IX0A 4MFDA 2GK1B 4HA4A 1HKMA 4JL2A 3NL2A 3K4AA 4UOQA 3SR7A 4ML4A 5C71A 1GTHA 3B9AA 2PWHA 5CLTA 4TVDA 2XIIA 3WH5A 1DQWA 1JCYA 4HU8A 4GUGA 1W5PA 3LDKA 3EX2A 3TC6A 4GZEA 5FF2A 2GJXB 3NDZA 5BROA 4P2VA 5EKYA 1FFRA 2QF7A 2VFEA 2ZXAA 3VU2A 4NVTA 3PULA 4AD4A 3LCHA 5FF3A 3AO0A 4GFSA 5EFDA 2V0TA 5A6SA 4RL3A 2NX3A 1WAUA 4NQ1A 1B3YA 4CD7A 3KVJA 2E6AA 1GEQA 1LDCA 3G3MA 1EO7A 3NZRA 2WVVA 4B15A 4BF7A 1V3HA 3VDHA 5MHBA 3W70A 2XSBA 4IMFA 4PCSA 3VMOA 5LGZA 2J74A 2DORA 3G0SA 2GOUA 4NXSA 2E1DA 1HJQA 4LVAA 2VTFA 2YZRA 4Q7NA 3R13A 5AC8A 5HBFA 1YQ2A 3CMJA 5BXSA 4NXKA 3GLCA 5G4WA 3IJ9A 2AEYA 4MZ1A 3L65A 3P7YA 4RXFA 1Q6EA 4BFAA 4N6FA 3I7SA 4TR9A 3WJSA 1ODZA 1P6WA 3OGSA 3MWAA 4AXNA 3ARQA 4O54A 4JTEA 2UY3A 3TTYA 5CXPA 3BAXA 2W61A 2IQTA 5C5YA 3TJXA 5HR6A 2PI6A 3PHAA 3HGOA 1M5WA 1SFSA 1JXJA 1UR8A 2A3HA 3VIFA 1XBVA 3UWZA 3E96A 5AYXA 2J47A 3WD2A 4Z2GA 1JNEA 1VYRA 2RKXA 1J2WA 2QUTA 1M53A 4PCTA 2DT3A 3DHFA 5ABEA 2QAFA 4QAIA 2NX1A 4M5PA 2BX7A 1TCMA 1OWQA 3CB8A 1DQXA 3UQNA 1VENA 3CBWA 1JRCA 4EKJA 1YDVA 3EWZA 3ZO9A 2WNZA 3RJYA 1I45A 2YPIA 2ZUTA 2V2HA 1X7FA 1VF8A 1JCMP 1DOSA 4X3ZA 3AFBA 5IM51 1SO3A 3OA3A 4JTFA 4YLWA 1MW2A 3CIXA 4P7NA 3TXZA 2EAWA 1DP0A 4PYSA 5L6UA 4DELA 3N11A 4FFHA 3HN3A 2VEKA 4B5NA 1EA9C 2VFFA 1NM9A 3AIRA 4FLSA 4B1LA 4U33A 1E4IA 3RWKX 4B1MA 3SGZA 3ZT6A 3UGFA 1E6ZA 4Z2JA 2OCZA 4GXMA 2DQXA 1I2QA 2O9RA 3WQ5A 3HJZA 4OU1A 1IZKA 5A6BD 1GVYA 2ESCA 4HTYA 2ZRZA 3O06A 2A3EA 4H2CA 5EL1A 3U75A 1G4EA 4OHQA 2WB5A 3VIMA 5I3HA 5DY2A 1C7SA 2A7RA 4OE7A 3JUGA 5KZMA 1B3VA 3QHMA 4Q33A 1TZ7A 5FK8A 3KE0A 5KSWA 4W8BA 1M7PA 1B3OA 2QEZA 3T40A 3NIYA 1ECEA 4NJJA 1EOMA 4JFVA 1GTEA 1HJSA 3IEBA 1YXYA 3CLWA 5CPSA 4EANA 1E5JA 1EGZA 1WZMA 3DHPA 4AD1A 4A29A 1OGGA 4HZ8A 2WAGA 3MHUA 1DTUA 1O4UA 4K8HA 4Z1DA 1JG9A 1H5VA 1UKSA 2ZIDA 1W31A 2FQIA 1J01A 2E9MA 1RZMA 4D1IA 1LM1A 2TRSA 4O53A 4FFIA 1K02A 2P1FA 2ZA1A 1KBBA 4UQEA 2QAPA 2XFRA 1LRNA 1V0MA 4WKFA 2IUZA 2ATMA 4LQ1A 4U2ZA 1J0YA 1RPKA 2ZXBA 3CZKA 1NWTA 4NF7A 3RJXA 1UYQA 3IAPA 4UQ9A 2W6RA 5DY3A 3W0KA 3ZOAA 1G4PA 2ABAA 1KM3A 1BF2A 3M41A 4EF8A 2E9LA 5HWMA 4HMCA 1IIHA 1I1WA 2F2HA 3L4TA 1ITXA 1NWRA 4UTFA 2W62A 1JVNA 4RX0A 2TPSA 1NFBA 3Q2DA 2QPSA 5DBTA 2YGYA 4WSKA 4Z0SA 1E0XA 3B05A 2EXOA 5HDRA 1TTIA 2VC9A 3AXIA 1XYZA 3ARXA 1RVGA 2OX1A 3U6WA 2C0AA 1LL4A 4DF0A 3IAQA 2CEQA 3W37A 2YDSA 2GK1A 9CGTA 1J12A 1G5AA 4UFLA 2Y61A 4CNNA 3S1WA 1HJUA 1MQPA 2BY2A 3SEPA 1NAL1 4AXKA 1MFUA 4HSOA 2O7QA 2AC1A 3EWYA 4AVFA 3TW7A 4UQDA 4X9YA 3T0AA 2DZVA 2DT2A 1DEDA 1H7WA 2DDXA 3N9KA 1QW9A 3CIWA 2DZTA 3VFLA 2VZTA 2F84A 2OT0A 3VKKA 3BAIA 5FKCA 3JS3A 2E77A 1I2RA 3TSBA 3UETA 3WJYA 2WCSA 3NUKA 1EDQA 3RPMA 1H51A 1XBYA 4JKKA 2A0NA 3I3DA 4BQ2A 1FQ0A 3W23A 1QBAA 3INPA 3TFCA 3M0ZA 1EIBA 2BVDA 3SUTA 4NNCA 2WHJA 1G6CA 4MNKA 4HP5A 2V9DA 4JIPA 4JKMA 5FEZA 3DKJA 3GKFA 1E9LA 4TX8A 3IV3A 2WPGA 4KFNA 1FWNA 1H1ZA 2Q8LA 1M6JA 2GSJA 5BNKA 1Y9MA 4EQVA 2E40A 3GBDA 1C8YA 3A5VA 1E43A 4HN4A 1D7FA 1V6XA 2UY4A 1TPFA 4ADTA 4JTSA 1LTDA 2VCBA 2X05A 1KFLA 3DXIA 3WDPP 1EA0A 2J7CA 3ALGA 3IVTA 2J4GA 2CLFA 2CNCA 4AZZA 4AZ5A 3FS2A 3TU9A 1CWYA 3NQCA 1D9EA 3G3DA 1UH4A 1OFEA 4J3TA 5TD4A 3C8FA 1PV8A 3NR0A 3LHYA 4OBRA 4O0KA 1S5WA 1QPOA 1JR1A 2VFGA 3LIHA 5FOOA 1W1YA 1HL9A 3W2MA 3OA5A 1VFUA 1EB3A 4JXCA 1K7EA 1E4MM 3PZVA 4AF0B 1H63A 4MVAA 3RM4A 5D33A 2VENA 2WK2A 4NSBA 2VR4A 1TA3A 3CZJA 5DO8A 2EGZA 4KFOA 3FA5A 3L2MA 3LPOA 3NJ3A 2ZA2A 3S6TA 1BYBA 3BAJA 3IVUA 5IBXA 1F73A 2PRHA 1MEWA 1JDDA 4P8UA 3CU2A 5M5DA 2Y7GA 4UXDA 4IUOA 4C1KA 2J7BA 3CUGA 3GNRA 3ZFHA 4P7QA 5K3VA 3SSJA 4DF2A 1JZ3A 2R91A 1MEIA 3QOMA 1I75A 1Q6QA 3AJ7A 4PFMA 4PBGA 1XFBA 2ZCGA 2AMGA 2DSUA 1MO0A 4MYXA 1GPWA 4IISA 5KZDA 4FLOA 1VAHA 1HL8A 4MTVA 1BQCA 3BV4A 3IGSA 5I5RA 1W2PA 5IFPA 4UCGA 1KFEA 4JIQA 2OYLA 3T09A 1XD0A 1TTJA 3OVRA 3RLUA 3PBVA 2ISWA 2CKSA 5CSSA 4ZQNA 3T7VA 1TPH1 3UWQA 4HNTA 3TAKA 4UFHA 1FUYA 1R2SA 2B7PA 4LS0A 3GXMA 4GWEA 3S1UA 2HTMA 1B30A 1UWUA 4JKLA 1LORA 3F03K 1PE1A 2C18A 3G1HA 5HJLA 2BHYA 3BSHA 2DZUA 3SJ3A 5A1AA 5AC5A 3W6YA 1GZGA 3N19B 1XI3A 3GYEA 2A6LA 2QCFA 1R2TA 4KWUA 1NVMA 2G96A 3R89A 4KRUA 4J3SA 4K6AA 4N42A 3SCRA 4WXZA 2GDUA 5KTLA 1JUBA 1MXGA 2GVJA 4O50A 1DHPA 2Y89A 1FDJA 2HISA 1S5TA 1CXIA 3VM5A 1ZALA 4K8EA 4JTUA 4QSHA 2I14A 4DBDA 1VC4A 3AMCA 5HWJA 5LA2A 1UUQA 4NZFA 4O12A 5DN1A 1UWTA 1ZJBA 4KMQA 5ABHA 3TA9A 2B4GA 3M43A 1P4CA 1JUEA 1B1YA 2VVSA 2XIBA 1U5JA 4RJEA 2V5DA 5A95A 2JFEX 1UKOA 3CHVA 3N18A 1KCLA 1V6YA 3W86A 1C93A 1NP2A 4WKAA 3PBGA 4F9JA 3EEGA 3BW3A 1L8NA 1WB0A 1CGTA 3P61A 2JIEA 1EDGA 2XGIA 3L4VA 4TXEA 1KBKA 3IIZA 1HVXA 1HT6A 4P7LA 4QM1A 1BHGA 2J88A 2RFGA 1J0HA 2BY3A 2VURA 1Q45A 4BF9A 1WO2A 1E6XM 3CUIA 4E2DA 1RP8A 1P1XA 3BXWA 1XV8A 2VCCA 3M7SA 4MJ4A 1O7AA 1NWUA 2EBNA 3LI1A 1QPRA 1CBGA 1UD2A 2CBJA 2EO7A 3SCOA 3W4RA 1QPNA 5HNNA 2E8YA 4N2YA 1F6PA 3CZ8A 3ARYA 4W7UA 4MJMA 3L5MA 3NL5A 2CLLA 4O17A 4V2XA 1EDTA 4XKYB 3ARWA 1ZBKA 1GVSA 3HGRA 1XHGA 3L4YA 4UFIA 3VD3A 1RPXA 1PVNA 3L5AA 2OYKA 2VX7A 5A8MA 2A5HA 1E5NA 1UB3A 3UXDA 1ODUA 5AY7A 1VJZA 4M8UA 3W73A 3MMDA 5FI8A 1B31A 1BVZA 2CKRA 2WSYA 5EA9A 3TP4A 1XDMA 4JDBA 5JUVA 2GJPA 3NCOA 3A24A 2VEPA 3DYOA 2ZZ5A 4N9BA 1JZ5A 1UR1A 4HHPA 3TUUA 2Y8KA 1TJRA 1VFMA 4Z1AA 3SCTA 3VTRA 3DYMA 2DZSA 3VE7A 3NMBA 2PCQA 2O9OA 4IPJA 2JEQA 4S1FA 1A47A 2XVGA 5IBXC 4JZ5A 3FN9A 1SZEA 3LOTA 1CW2A 4A22A 2J7FA 2DZPA 3OIXA 1XSKA 3A22A 2D2OA 5BOOA 3I65A 3DAQA 1G4SA 4O28A 1OIFA 2YIHA 3MV01 2VL4A 3WMBA 1VHNA 4CUCA 3M5XA 1LYXA 3UZJA 2EPHA 1ZNNA 1FX6A 2OLHA 3LMYA 4KKXA 1CGXA 1SYTA 2J7GA 1E3ZA 2UWFA 2QCMA 4RCXA 1BFNA 1QCWA 3PSVA 3Q37A 1V0NA 2NX9A 5AYZA 3HQ1A 3V75A 1GVIA 1FCQA 1KTCA 1W54A 3HPSA 4TMBA 4AZGA 2ZRUA 3W2LA 5AC6A 1AW1A 4OV4A 1GT8A 3LGEA 3IMMA 1KGWA 1GPFA 3GR8A 1SZGA 5F1UA 3RNDA 4GC4A 4UNKA 2ZOXA 2FDSA 1IXOA 4Z2IA 1OYCA 3AIVA 1XRVA 3WNOA 4WSJA 3SCSA 5CPNA 1R7AA 1V6WA 2CBVA 1Q6RA 3WH6A 4MNMA 4CNOA 3VGDA 4AMCA 4Z2HA 3ECQA 5LYRA 1Y4WA 4O4WA 2FH6A 3VIPA 4TIMA 3QMTA 1VBRA 4GNJA 2FGZA 2JF7A 2ZDRA 4PMOA 2NT0A 3PZTA 3O6CA 5CPLA 1F4AA 4EK7A 1RQBA 4R34A 3ZR5A 1LROA 1M04A 4O13A 4WLCA 1OCQA 4OKDA 1HIZA 4J9JA 4ZEPA 5HINA 4WX2A 3THQA 5K2ZA 1QAPA 3L2LA 1E6NA 2C19A 3UESA 1W3TA 4UR9A 5K4ZA 2E9BA 2VFDA 2JKEA 3WSUA 2DH2A 1DJNA 1FWSA 3BG9A 5DCDA 3PTMA 3G6MA 1H50A 2BHZA 3RF9A 1V6UA 1BAGA 3ZMRA 2A21A 2CLHA 2J77A 4U2YA 1P0KA 2PRLA 3KF3A 4IM4A 2DSVA 1W1ZA 4KGLA 1EXPA 1J9YA 3EWWA 3FHAA 3NGJA 4P7RA 4W93A 5DMYA 2WBGA 5A8QA 3K8KA 3MKKA 5BXTA 4KWWA 1V08A 1OFQA 3AHVA 1J0ZA 1UD4A 1Q6DA 3D5HA 1LLZA 4IWWA 3WJZA 1LRQA 3CEPA 3NG3A 2NW0A 3O6YX 2CITA 3UG5A 1I8JA 3W1LA 4MY8A 3GDBA 4H41A 3LHWA 3BG5A 3W6MA 3TFXA 1GONA 4DO5A 1CGUA 1MSSA 3W7MA 3M9YA 1QOQA 4MYAA 2BSLA 4HPGA 3BG3A 2Y8VA 1C8VA 3GK0A 1WNOA 1QI2A 1AQHA 1W9PA 3VD9A 3OG2A 4J3WA 1JXKA 1G67A 4NX0A 5M17A 2BVYA 3RIKA 3PZUA 2CYGA 3TONA 4QLLA 3LCGA 2QDGA 5HUOA 3LV6A 3NQFA 4ORMA 1QOXA 2HSAA 4I9AA 1PZ2A 1UKQA 1I2NA 1A3HA 2VRJA 3APGA 2CLIA 1BYAA 2VZSA 2X0YA 3ARSA 3DECA 3BVJA 3Q58A 3PZ9A 1JL8A 3MI6A 1J5TA 5DLCA 1OM0A 1UD5A 1RV8A 2FHCA 2XWEA 3NEVA 5AOUA 2OWCA 1RQEA 3BAWA 4EAMA 1SSDA 3PG8A 2G3MA 3C2VA 4OT7A 5U4NA 2DSWA 3HBKA 4J3VA 2WKGA 3ZSSA 3FFSA 1H09A 1PEZA 4UTUA 3SCUA 3NNTA 1TCDA 3AICA 1K8YA 1V02E 2NUXA 2V3FA 3W7CA 1EWEA 2J7HA 1TPWA 5I6SA 5IXEA 1GWJA 1YPFA 5FEWA 3N2XA 5BXPA 1WOAA 5F4XA 2E09A 4UQCA 1L6YA 4UC5A 1GQJA 2WM0A 4D6JA 4BK9A 2QLYA 3GX9A 4AD5A 3KOFA 4HOZA 1A5SA 3N3MA 4R27A 5J5DA 3MI3A 3ZJ6A 6CGTA 1H5YA 2G5WA 3OVPA 2AEZA 1Q6OA 3DBPA 4O15A 4O57A 4IOTA 1F2JA 3MP4A 4JTGA 3LBCA 5D38A 3UYCA 4QP0A 3TQ0A 2C0HA 2GQ8A 3BCDA 5HQEA 3L68A 3LCXA 1E6SM 3LI0A 1E73M 1QI5A 3AXXA 1PIFA 2FHBA 3QGVA 5EPDA 1M7OA 4M7TA 3GNPA 1VS1A 1UWRA 2ZUVA 1ZJIA 5CPTA 5BCAA 2VXNA 1W37A 3F1QA 4M80A 5AHEA 3WD3A 3EYPA 5I3GA 1QI4A 2ZUNA 1NSJA 2GUUA 1FDZA 4N9EA 1CGYA 4JFUA 4AIUA 2PC8A 1DBTA 4N9CA 2JKAA 3OLEA 3B03A 2GQ9A 2OYMA 3W1AA 4AD2A 1QBBA 1X6UA 1E4NA 3I3EA 4O14A 4L4LA 1B4EA 2WMGA 3T2OA 1YLVA 3P5ZA 3SY5A 3VMNA 4D6DA 4TX9A 3AISA 2PURA 1BTCA 3SCPA 2JGQA 4JX4A 5BRBA 1U33A 2F7FA 2FFCA 2CZFA 1EH9A 1GUVA 1GOMA 4GUIA 1F6KA 5CZKA 3WFLA 5LNUA 1H1YA 3C2OA 4GUJA 4Y90A 1EQPA 2QPUA 3GDRA 4XV0A 2A7PA 5E6ZA 1LG1A 2X2GA 3NPWA 1PJ9A 3E02A 1EUAA 1W5MA 3GR7A 1PL9A
chains in the Genus database with same CATH superfamily
2FJUB 2H0BA 1UYZA 3DGRA 4AG4A 2IMRA 4XTMA 4FQ4A 4J27A 3N4FA 3DYPA 4ZO7A 4NWVA 3AOFA 2I74A 2RM21 1Y9GA 5HPOA 1L2UA 3KVMA 3QMRA 1OFNA 3EB4A 1MW1A 4F2TA 5JXQA 1P7TA 3P60A 2WSVA 3CUJA 4AYUA 1O5RA 1Z7S2 4AE2A 4ACYA 2AOSA 2YKKA 5FZ7A 3QBQA 3BE7A 4J3UA 4QSFA 4UBGA 2B5HA 3IIAA 1QJU2 1OUSA 1U1JA 1WBJA 1XCXA 4PUKA 2X0SA 4HKPA 4MGTA 4TOQA 2HEWF 1UD3A 4MOZA 2Q6ZA 1VBD2 4NI3A 5K4XA 4SLIA 2RE9A 3T30A 1A5UA 4IEPA 1MI3A 1K5MC 1ISZA 4H6RA 4E2OA 4Q4RA 3V0AA 1Z89A 1A5KC 1CPNA 5CKSA 2WJDA 3WQ1A 1PZ8A 2J1RA 4COVA 1JYIA 1FRBA 4Q27A 4NJIA 3W7JA 1SLCA 1KV5A 4X2RA 5FBZA 4KCUA 1A4MA 3W7EA 3KZSA 4NY2A 2RS31 3WDJA 2G95A 4KBZA 1THFD 4EN0A 2VX6A 2RS52 4WCJA 2YY1A 2R24A 3D0CA 4PN2A 3H7UA 1PO12 1UMHA 1WMEA 4H55A 1YFXA 3OLDA 2VC6A 2QCLA 3UW6A 3QW4B 3FXGA 3UZXA 3FLRA 1RBLA 1MS5A 1NDYA 3CPGA 4LGXA 3AZYA 3EX3A 3GC4A 1JPHA 1NWSA 4GLEA 4I09A 1ND2C 5T9CE 4GBDA 4LCRA 2PF0A 3BKZA 3M07A 1ULDA 2NWRA 1MDRA 4ADUA 1KB3A 3A4XA 2GJNA 2KD7A 4W8JA 4HD5A 2X1TA 3B4UA 4PMNA 4XABA 2CZEA 4LPCA 1EAH3 4TTGA 1D7KA 3PTDA 1VBD1 2ONEA 7PTDA 3SRDA 1PDZA 3A3WA 3MLJA 3FY1A 4HB7A 1JDCA 3RFAA 4YWIA 1VFLA 4OI2A 4FOYA 4S2HA 2WN2A 1OD0A 3H55A 3BICA 1RXGA 1UUOA 5FO7B 4HA0A 2Q0AA 4FLQA 3POJA 4BQ3A 1C9WA 3CNYA 1HJVA 3BAYA 1FCVA 1GOKA 3OLGA 3F4WA 3A47A 4OHXA 5FZ0A 2D40A 4M00A 3W2UA 1QOOA 1GORA 2D6MA 2CDPA 3S47A 1W9BM 4BCEA 4MUZA 4JN6A 1R2RA 3O9NA 2J6XA 4JTHA 3OOQA 3NYDA 4CEWB 2YCKX 3WNKA 3TOPA 1GQGA 2V2DA 3HJEA 4J4KA 1J0IA 3R58A 2VR2A 4ZODA 3N3TA 1AQMA 2ZGKA 5D9MA 1TR1A 3U5UA 5A8GA 5I09A 1RUE1 4CNPA 3B40A 2RS12 2WZMA 2VZQA 1VQTA 2YXSA 1C7TA 3OBKA 2Y6HA 4D71A 3DUIA 4QHBA 1B3WA 1KM5A 5GLZA 3NPXA 1GCYA 4L6HA 3UF9A 1PZ1A 5D9NA 5KMYA 4YRDA 2XVKA 3BMWA 2ISFA 3SCNA 2J1UA 2UU8A 5L9BA 3U4SA 3KRZA 4GIAA 1HXS2 3ITOA 3VOHA 4Q32A 3ZJ8A 4GYFA 1XCFA 4Z1VA 3NJVA 2JG8A 3GYCA 4CPBD 4QNWA 1UQZA 1PVC3 4IMEA 4DZIA 1QJX1 5FUIA 5LZ6A 2VMDA 3VBSA 2CERA 3VKNA 1PIV2 4GACA 2NLRA 3IIIA 2E67A 5T5PA 3T4VA 3DF0A 3O1UA 1SZFA 5HOSA 1F76A 5HUPA 3I7RA 2EXHA 5U7SA 4DJDD 2RGLA 3RWNA 1TMQA 5I00A 2ZRYA 1YPXA 3IACA 2IVJA 5GZEA 2JF6A 5A3OA 3T2TA 4F3HA 2B31A 2BP1A 2NQ5A 1GHSA 1NZCA 2ZGRA 4U5IA 2CETA 4M3CB 1QPQA 1UOJA 2WHLA 2VE1A 4LJ3A 2GAUA 5JSOA 3LNMA 1RJ8A 3M0MA 3BLFA 1Y7VA 1W28A 1TFVA 1M03A 3KTCA 4Z2AA 1WZXA 4M19A 4NHVA 3HFTA 3WQ4A 1CWPA 1TRIA 2GZWA 1AR62 4CRQA 3SUUA 3MO7A 5T5JA 3O7OA 1MS8A 2VRQA 2HBVA 1IWAA 2R0HA 1BXNA 3ATYA 2VP8A 1WBFA 1QQP3 3F4VA 1WX0A 3VV1A 2GVLA 2QKFA 2JB8A 2F8QA 1X7NA 2RH9A 3W74A 3LLFA 7TAAA 1UYXA 3ZSJA 4KGQA 4HXCA 5REQA 1ZGDA 2WV8A 5FZ8A 3JBG1 4UMBA 1VALA 1GICA 1RLDA 1K7FA 4WSHA 3W25A 1LHNA 3LGRA 3BMVA 2LS6A 4K38A 2BGOA 5FTTC 3U37A 2NV1A 3Q67A 5LBCA 2WQ8A 1KJRA 1WW4A 2OZ0A 2CDOA 1UWSA 5DN2A 2FPYA 4JL1A 2GN3A 4BS0A 4B3NA 4N8MA 1HIXA 1H7NA 4Y20B 1RUJ2 4U2AA 5AN7A 3AWOA 3VOFA 1YQCA 2WVSA 4C5YA 5FZ1A 3ITQA 4XBSA 3TNPB 3N9OA 2PEVA 2V2CA 1VIZA 1UWQA 2CHRA 2ET1A 1AD1A 3RU6A 1XNBA 3HQUA 5CBJA 3LPFA 3AP9A 2QIWA 2BOGX 3VOGA 1LODA 3W87A 4D72A 3OB8A 4PTWA 3LGGA 4AG0A 3E2VA 3RMXA 4HOOA 4LF2A 2Q4SA 4PBFA 3VIOA 1I4NA 3BARA 1K8XA 2BYVE 3AU2A 4GD4A 1W9DM 2X8RA 3OSDA 2VJXA 1YC61 1NFPA 1LQAA 1KRAC 3WQFA 3UXLA 3KSCA 3TTSA 3G6LA 3KMHA 5T52A 4HOXA 2WCGA 3VFCA 1FHUA 3I2OA 1LJYA 1CI1A 3WD1A 1YPIA 1WMDA 1VIWA 3GHNA 4DAIA 4JQ1A 1UU5A 5G4HC 2W39A 1US0A 5AFEA 4BIFA 2A6ZA 2FCUA 3I7DA 1OCNA 3LCLA 2OLAA 3PR2A 5HMSA 4IV1C 3NV4A 4AK3A 3ITXA 1J0KA 1YI9A 4NHMA 4QDRA 3GAKA 5BNPB 4CQ8A 4TV5A 1V9U1 4ZO6A 4AWTA 2R49A 2HCVA 4LK6A 2SBAA 1FWRA 5F2LA 4K2SA 3IUDA 1HNYA 2GNMA 2WMJA 3SIZA 1X8FA 1RUF1 1OFBA 3ZVXA 4F0KA 2Y63A 5BNQA 1LOLA 4GH1A 1CNVA 4XTDA 3DGBA 1CB2A 2CHOA 4WDWA 5FF7A 3H6OA 4S3KA 3SJNA 1ULPA 2ZGQA 4MKNA 3UA3A 3UR5A 3ZXDA 2VX5A 3R2GA 1TR9A 2V73A 4IE7A 2ZA3A 3G1DA 4L1WA 4UFJA 1MVYA 1G9FA 3AKRA 4CCKA 1W8UA 2REQB 4UUIA 1X1OA 4X60A 3TN4A 3M0XA 3FHIB 2R6OA 3W85A 5DCBA 4AEEA 4RR3A 4FK9A 4B92A 4Q4X1 3LDVA 2YBUA 3BCWA 4DOUA 5JIWA 1XFCA 5LATA 3WMLA 2OUJA 3IGXA 1H8TC 4CNTA 3QOKA 5FEPA 3DFTA 3P82A 4NHXA 1QNPA 4AEFA 4KS0A 1RB8G 4NZCA 5A6ZA 1OC1A 2NM1A 1EWDA 2YFUA 3UGGA 5A8OA 2YU1A 2GC1A 2MPFA 4AEDC 2VDGA 3VNDA 3M7WA 2ZZ1A 3C56A 3UCQA 3W9ZA 2O4MA 1ONAA 4MNJA 3W83A 5HV0A 3NRUA 4W87A 1HB4A 2DVGA 2XN1A 3WW3A 2ZTJA 4YVPA 2PMWB 3WT3A 2INZA 5LNRA 3T42A 3OW1A 4U28A 4RS5B 2C1HA 3Q94A 1I0DA 2DJXA 4QS5A 1US3A 3M0KA 1XKJA 1QXRA 4IX2A 1CLVA 4GY0A 3BLKA 3HGJA 5JXGA 1OK6A 5EMLA 2ZICA 1F9CA 2R1DA 1O91A 3U14A 3CS2A 2VVEA 4AY1A 3ZS4A 3OEXA 2CU5A 3WQDA 5ABTA 3VBSB 2WNVB 5G04L 2WBKA 2XM2A 1NY71 1BXCA 3EGJA 4A21A 1K9FA 2FTWA 1HJFA 1YYAA 3J9SA 2FB2A 4JCKA 1OX6A 5CFCC 4NIHA 4PL1A 2VGFA 4XIAA 2EF6A 5FXVA 5EMUA 2WNEA 3VOIA 2PZ0A 1UXXX 4BM8A 4UMAA 4Q1RA 4DJFC 5BRPA 4ROPA 2I57A 2DVTA 2IXCA 4ICNA 1PO21 5AHFA 2QULA 1QHZA 4UR8A 1G9DA 1JU4A 1C9DA 1FNZA 3B8WA 1S0CA 4C1WA 2YL9A 5F37A 1JPKA 2WYSA 4Q6XA 1E72M 1VBB3 2GVGA 2RMU2 2DT0A 3AALA 2I5QA 2XZ9A 3QV9A 3ENRA 4O1CA 1M9HA 2V4VA 5HNUA 1SU5A 3TOJA 3PM6A 2PU0A 4H2HA 4ACZB 4BF5A 3IJ7A 2CSGA 1VBC1 4IMAA 2BV4A 4QU2A 4I2OA 5C8BB 2W3JA 5JCTA 1EX5A 1KCXA 1W9UA 2OS2A 3K3OA 1FOD3 5LIYX 4H00A 3AXEA 4TO8A 1XLMA 3PUSA 2BOFX 5DT5A 5EMYA 1ND2B 1R5YA 1PO23 3KV9A 3W20A 1IKPA 3WLKX 2A3YA 4GY7A 1XG4A 3KM5A 4Q26A 4LBQA 4CU9A 1TME1 2VBPA 5CFDA 1SEFA 1HXJA 2G9ZA 3V5CA 1SW3A 1CVNA 4CCEA 3GQYA 5E0FA 4CDWB 5AYBA 1ICQA 3H26A 4QPIC 4D2JA 5BW6A 2ZC1A 5IUQA 1DIEA 2WSRA 1SR9A 1S1PA 4H9YA 1EJRC 1US2A 1PDYA 5CEWA 3WP6A 1JNDA 3GBWA 3MUZ1 4TN7A 1P8JA 4FMVA 4NILA 2W2IA 3PS7A 4H4IA 4B5UA 5T50A 4NT0A 1WPCA 4LLFA 3OBAA 1ESWA 1LOEA 5HR7A 3P2VA 4DB5A 1XLHA 3AZRA 4BQYA 4GZIA 1DU3D 4ATDA 3SFKA 2D24A 4X22A 2PLV3 2UWCA 3POGA 1LTEA 4NJKA 1D0GA 3NNMA 3OIHA 3WD0A 1L6GA 2C4XA 4GMP0 2W1UA 4C6NA 3VBRC 2XISA 4E0CA 2IPJA 4HFSA 1QPKA 4FX7A 1WCSA 3WQWA 3WNNA 5FYUA 1V00A 2YDQA 2YBSA 2EKCA 3U7VA 1JCJA 5ACA3 4QMAA 4AVAA 4IIGA 1UH2A 3EZ4A 5DZFA 4O16A 4S2CA 1FAYA 1Q2RA 1LJ7A 2WQZC 3AMPA 3QKZA 4J6GA 3T2QA 3VIJA 1LU1A 2YG0A 3RPQA 4CN4A 2A5ZA 2WFF3 4DJFD 1GP4A 1COV2 1WCQA 1SPQA 3RX4A 1GKPA 2AAAA 2I07B 4LMFA 4GYPC 4DJEA 3CJPA 4DWSD 3M8LA 2D6PA 2WVUA 2QQMA 4RDVA 2XH2A 2P37A 6XIAA 4IE4A 1DXEA 2IC1A 4UW5A 1V6LA 2ZJCA 1KRMA 4FF5A 2HWE1 1UWIA 1SJBA 3CTTA 4JCLA 3A21A 5EXOA 5F3EA 1TKKA 1X8MA 3H3LA 3PTYA 1KLZA 5IVFA 3G8RA 4XHXA 1QU4A 2WFF2 2W52A 2ATSA 3CM4A 1PX3A 5IT6A 2VTXA 4CVUA 3RM9A 3GH5A 3IIXA 1FDYA 2YBPA 1X1ZA 4WDUA 3WN6A 1IEVA 1EJTC 5CCZA 3EXTA 4A3QA 3VBFC 4FNPA 1LQ2A 4KH2A 2OUHA 2WO2A 2PA7A 4Q8MA 4Y2WA 4F8AA 1PUDA 3QZEA 2AREA 2V67A 4UF0A 1GQKA 2DU0A 5B7YA 3RJ2X 2GPTA 1AVAA 1WP6A 4KRTA 1V6NA 2QQNA 2ZMNA 5IVEA 1NELA 1GJWA 4AD3A 1DQ0A 1GOWA 4NYUA 4GZ7A 3AROA 5I02A 3AHYA 3I59A 4DI8A 1UMYA 2HEVF 1QVBA 2DSKA 5D09A 2ZX2A 3SRKA 3HPXA 1S5VA 2PDBA 4OUSA 4XWUA 4YM3A 1ZTVA 4H14A 3MT1A 3RZHA 2KM2A 4NN0A 1FPN1 2HDJA 4K37A 5CSRA 4HA1A 5CIRA 4F2BA 3ME2A 3RILA 4N9DA 3VBHB 4OJYA 3NWRA 4IE5A 2D3LA 5LNVA 1KTBA 1AQ0A 1NXMA 2VRKA 1L3JA 5HMEA 3E74A 5FWJA 2XVLA 3BGJA 1PX4A 5IHRA 1YWKA 1AK5A 4MY1A 2ZXQA 1D2KA 4FXRA 3P6LA 1ISXA 1VYSX 3NQ2A 1AZ2A 1CAUA 3MUAA 2W0UA 2EICA 4RFRB 5CVRA 3KCOA 1D3HA 2WWDA 4I9JA 1Q8SA 3GY1A 2PQSA 1QRQA 3FUQA 2FTPA 2JDAA 4Q8NA 4QLJA 5EYWA 4ZS2A 5AC4A 1A50A 1GZ9A 2MNGA 3EWXA 4XJZA 3APBA 4LALA 1UA3A 1U5IA 4I6KA 2HMCA 1PZ0A 2G3JA 1WXJA 2DZXA 2HV5A 3OVGA 1R8LA 1J1LA 1WXZA 2Y85A 1JUHA 5AC93 3SURA 5DG1A 3F5LA 1O95A 3BB6A 5CBLA 2B9UA 2ZZJA 1ODMA 4IV3B 2Z0IA 3A6OA 1IGSA 2FDMA 4YN5A 3PBMA 1DFQA 2R30A 4K1GA 3KHDA 4HKOA 1CEOA 3HTWA 2CU0A 4YARA 2VR5A 2CPUA 4JYFA 5FIXA 4S3DA 2MEV2 5E0CA 5AVHA 3W2NA 4IJCA 1IQ8A 3AJYA 1QWRA 1XOYA 4GWJA 3W7OA 4FOJA 2V81A 4E27A 1HDKA 3AMLA 4AHOA 8XIAA 3HF3A 3S0CA 2RMU1 3N2MA 5JBDA 1ACCA 3B00A 4MVTA 3EOSA 3BTAA 3BCFA 4QPIB 3H7RA 5T26A 2WN3A 1A80A 2Z26A 2ZHMA 3BU7A 3FVMA 1EP2A 3N73A 2WC3A 1FPN3 1G8WA 3IM0A 3WUEA 1RP9A 1TSIA 3O1TA 3E0LA 3PC0A 1PHWA 4W4QA 1ITCA 4AFMA 5IATA 3II1A 3P84A 4J3XA 3EXUA 4AWSA 3SH4A 5BNNB 2FDHA 1Y5WA 2R1NA 2QQPA 4HVOA 4PQQA 1VMFA 2QJNA 2ZMKA 4DWSC 5H8MA 1A8DA 1JCNA 3MI2A 2P50A 4R7WA 3PPGA 1EC8A 5D8AC 3IANA 3D3FA 1QY4A 3LEMA 1DHKA 2YYOA 3KBMA 4L8QA 3PB2A 4AEOA 2D23A 4JR5A 1WV2A 1ZBE3 3KZPA 1ZVFA 4W88A 3OGVA 4PCFA 1RR2A 1W17A 4HPKB 4BI6A 1AL23 4K40A 1DG6A 4ALDA 4S3GA 2PGEA 3WNMA 1I2PA 1K03A 2VEIA 4Z82A 4HZ7A 5DF0A 4E4HA 3CIHA 4A44A 1R86A 2GMEA 5I0DA 1VKFA 4L4PA 4JDYA 4S23A 2WMIA 2FVKA 3J7HA 4DY3A 5C70A 3QPZA 3C2FA 3T3YA 4J25A 1S55A 1CXLA 1QHOA 4AZ7A 4R4ZA 1G94A 4DAFA 2GMPA 4G7EB 3IUHA 5BWFA 1SMAA 2XJVA 3P6BA 1OINA 1EIXA 2Y5EA 2QDHA 3V5OA 4MMWA 3MUXA 4JC1A 3QMSA 1W2UA 5F2GA 3P81A 1RD6A 5M1TA 2QTWB 3UKNA 2IVIB 3W1NA 3H4WA 4RYDA 4BB3A 1IXQA 2R14A 3QY8A 3ZIXA 1S2BA 4Z1BA 3NW4A 4IGHA 2XFWA 3UWVA 4LA3A 2BS9A 4F0SA 3CC1A 5FSEC 4XHBA 4XUOA 4N53B 1JYVA 2INFA 2VBDA 1OT2A 3ELFA 1ZLPA 1CIWA 2X8KA 3BU0A 3E49A 4PEKA 4AVTA 2PE4A 3UJOA 1HL2A 1XYNA 1RY8A 4Q8WA 4Z1YA 3BL3A 3M6YA 5HXVA 5B80A 1HKDA 1MEC1 3BGGA 2G8ZA 2XKPA 3PJUA 5DXYA 3G77A 3W07A 1NZIA 3A4JA 4C65A 1QNVA 3KL0A 2WQPA 1ICSA 4ML9A 3F4DA 3I4IA 3VDGA 1ZQ5A 4PDWA 4N4PA 3VGGA 3ZWTA 1GZWB 2UYBA 2XXZA 3TN92 2XQRA 4AL9A 3DI1A 4XBLA 1XSRA 1HGWA 3KX6A 2ISVA 2J25A 1DJHA 2YC4A 3QPEA 3C7FA 2FHFA 1HB1A 4ZE4A 3RGTA 2O8QA 2ZTNA 5JI9A 1JODA 4GE8A 2OXNA 3ZVHA 3VX0A 3QGKC 1W99A 1VBA3 1M3UA 1EJXC 4H9ZA 1ZJAA 3WDVA 2PDQA 4ZQCA 2UY9A 1BJQA 3T08A 1OVDA 5HATA 1LT7A 4DY1A 3S0MA 3HJRA 2RR11 3K4DA 3PIGA 2O0TA 1PKYA 3W00A 5E5CA 2WR9A 1NARA 3FUOA 1T40A 5HMFA 1WOBA 1GOIA 2XKOA 1XE7A 1CXFA 5IDIA 3G2GA 2XWDA 2NXHA 3VPLA 4N90A 1YNYA 1NDVA 4Q4MA 1AUSL 1TB3A 1VCFA 1IR1A 4NU7A 1V70A 4K6BA 2ADEA 5LGXA 1KXVA 4IL7A 3GHRA 3XISA 3FHQA 1XU1A 4R9DA 1K7XA 2Y5SA 1FOD1 1ME7A 3FJNA 1GUIA 3NDYA 5DCEA 2XN2A 1X6NA 3MUY1 5FZIA 4YTSA 1HX6A 1VRH2 2X5IA 3ARVA 4ZFCA 5I03A 1XDLA 1KJLA 4GQRA 1TX0A 1W0OA 3QQ0A 4PH6A 4V28A 1J6OA 4W6WA 3GZAA 3N9RA 7REQA 4D7YA 4IEQA 5EYXA 4W8LA 1KKOA 4AI3A 4H3DA 2FZ1A 4E2GA 4D6EA 4IV1A 1W05A 4HMZA 3D82A 2LRPA 4XZWA 5EB8A 3CGTA 4F79A 1PS9A 5FY0A 4YGCA 2NVDA 1TQJA 3V3WA 2UWAA 3W02A 2J8FA 2GALA 2VQTA 2QW5A 4GBUA 1GVRA 1KFBA 2C8NA 1XG3A 1I6XA 4V15A 1REEA 2VTXJ 1ZBCA 3C2UA 4XE9A 3TB0A 3G1SA 1Q65A 3EMQA 4OBSA 4EXBA 3MFCA 2CESA 1B35C 3N7JA 5J37A 1S2WA 3JVAA 5FUPA 1T96A 5G4EA 1PMIA 4WRHA 1KXGA 4B8EA 1AQFA 2EPKX 3I2FA 4ARYA 3LXBA 1KXQA 4R7OA 4IQPA 3ZSLA 5FZGA 3CNAA 1B09A 2QZRA 5CADA 1XB9A 2XOMA 5CJNA 1VFOA 3CASA 1V3KA 2X2YA 3LA7A 4JHOA 4GZ9A 4O11A 3DG3A 1XP3A 5FJOA 1EUNA 2C6QA 2J79A 3E5PA 3TQKA 1PTAA 4MZ8A 1W9VA 2YCIX 2WCAA 3GIPA 4CDUA 1FWTA 2VZVA 3N14A 3ZFFA 4AQSA 2Q8EA 4HNCA 1YBQA 3LCWA 1EAH2 2BWCA 1DVJA 2ZDSA 3CO4A 4Y5SA 3CAKA 3L67A 5D2AA 3WQVA 1CZ1A 3AVSA 5CJ5A 3PUQA 2YB1A 2PWVA 1A3KA 3H50A 1TJPA 2A3LA 1UY2A 4M56A 3RK8A 3W29A 4H8VA 3EMRA 1OKOA 1ULOA 1GYLA 4WUIA 1HX0A 1DJWA 2E3ZA 1CDGA 3SUVA 5F1RA 1F5FA 4AI8A 2PPGA 3HMYA 1W3IA 2HQAA 1QTWA 1KC7A 4GWNA 2HVOA 1DJGA 1T2XA 1AR63 3V16A 4ERAA 3WFAA 1RK6A 3M5ZA 3JW7A 3MHFA 3W84A 1BLIA 1UUMA 4EPEC 4XTIA 2RS32 4AVBA 4H04A 1JYNA 3KRSA 2POZA 4HOWA 2QDEA 3B5LB 3RNSA 3U0HA 1C8QA 1XBZA 4MIMA 4Y24A 4OBTA 2ZX6A 5BXXA 2GLKA 3B04A 4HU0A 2YA2A 4PSPA 1EZ2A 4LAKA 3N6JA 5FZOA 5C5TA 4B5WA 3PFMA 1BK1A 1LB2A 2ZXDA 5EY5A 3LD5A 3VBOB 1OABA 3V5FA 1ZZBA 4DBSA 1R7OA 1J10A 3B3QE 2OQLA 4LA2A 2I7GA 3CQIA 1J18A 2BERA 2HBTA 1IZJA 1SW7A 1SZNA 1QH7A 3GG7A 1W91A 3SISA 1ONWA 2OO6A 3OZMA 2O55A 2QJIA 4M6PA 3UR2A 2WQ4A 3ENLA 1YEWA 3M3QA 4L7ZA 5M03A 1AR93 1PKLA 4JRLA 4LYKA 4BQWA 5C7VA 2RDUA 1YKWA 1DWFM 3OQ8A 5FWEA 2DVXA 3DX5A 4DBEA 3PY2A 4QLKA 2TUNA 3WEMA 5GQBA 4WOZA 4QB6A 3IK2A 4CLMA 2ZMLA 3GFYA 1H61A 1QXLA 3ZFFB 2G4IA 1FKWA 3KTXA 3GD6A 1WAWA 3FAXA 4X61A 3T1MA 4NWWA 1SHWB 4FPKA 3IJ8A 5T91A 1R3RA 3GKAA 2J78A 1RJPA 4JX0A 2J75A 2WT1A 3BTNA 1BRLA 3WL0A 4IUGA 1OKQA 3H2MA 4O10A 1TPUA 3NSNA 1XIMA 3OP2A 3CB3A 4OMCA 2BFGA 3GIQA 3UXKA 2IKGA 5B7ZA 1NFGA 3W1QA 4RQPA 4I0BA 1D4VB 1UMIA 2EG8A 4M81A 2VVNA 1XBXA 3EKLA 4AZ6A 4YVSC 2WS92 5CB7A 3PWGA 1C92A 3VK5A 1D2SA 3HNYM 2ACSA 1XC6A 1KLYA 1CXEA 3LPPA 5H2ZA 2DU1A 3U4XA 4J1XA 3SMHA 2P3IA 4M29A 3FAWA 3GGLA 3K3NA 3INAA 2P3ZA 3LRLA 4IX0A 2BBVA 4HA4A 1AR73 1GR3A 3NL2A 4JL2A 2RM22 4AGVA 5C71A 5FR3A 5CLTA 4TVDA 2XIIA 1XX1A 3SADA 3Q8BA 1W5PA 3LDKA 3RCNA 1D0HA 2VFEA 1V79A 3PULA 1W6PA 3AO0A 2V0TA 5A6SA 2NX3A 3WR0A 1WAUA 4C6CA 4M3CF 4Q4X3 1EO7A 2FMOA 3NZRA 5XINA 4BF7A 3Q8FA 1GEHA 4IMFA 4PCSA 2J74A 4DYJA 2E1DA 2YZ4A 1HJQA 2VTFA 5K8SA 4LVAA 3R13A 4MOAA 4PUMA 3CMJA 1IT8A 5BXSA 5G4WA 2AEYA 2ZVRA 3FFQA 3RFRA 2Z4FA 3I7SA 3OGSA 3WUDA 1ODZA 3WJSA 3MWAA 4AXNA 4CCMA 5IK8A 4JTEA 1E5SA 1OQDA 1UZ0A 2PLMA 4KF1A 2IQTA 1GNZA 2XJTA 1SFSA 1M5WA 3PHAA 2A3HA 1XBVA 4DYEA 4Z2GA 3C3UA 1VYRA 4K3ZA 2QUTA 3DHFA 3H2FA 2ZC8A 4L56A 3DPRC 1VENA 4K8GA 1H4HA 3BURA 1W6MA 2WNZA 4HMNA 1I45A 3LEGA 2V68A 1AR82 2QQ6A 3VKBA 1I3HA 1Z7S3 3GW3A 4PE8A 3CIXA 3HFYA 4C1XA 1C28A 4DELA 3ILFA 2WRAA 2PP3A 2VEKA 4U33A 2P88A 2QE3A 3AIRA 1OA4A 1HB2A 1E4IA 3QGAC 3UGFA 1E6ZA 4CP0A 3VC5A 1I2QA 3WQ5A 5L9RA 5A6BD 1VBD3 4FPSA 2ZRZA 4MM1A 5EL1A 3U75A 4O9EA 4OE7A 3JUGA 4Y22A 1TZ7A 4P9IA 3KE0A 4W8BA 2XDVA 3T40A 1AZDA 4QQLA 2BFUS 1EOMA 4INDA 3IEBA 1YXYA 4LKEA 3CLWA 2QVHA 2OIIA 3GVQA 4EANA 4TXWA 1WZMA 1XICA 1ZZ9A 4FTBA 1OGGA 1O4UA 4S2DA 1F6YA 4Z1DA 3HNMA 2QBXA 1UKSA 4XYXA 2E9MA 4AY8A 3FSTA 5GLTA 3DXTA 2VUCA 3N9PA 5FXZA 4FFIA 3TN91 2Z7KA 5T8GA 1W3XA 1KBBA 2Y6GA 2RR13 2QAPA 2JG9A 1R3SA 4P9JA 2Z4GA 2ZXBA 3CZKA 1UYQA 5DY3A 3ZOAA 1JOJA 4K21A 5C4WA 1S0EA 2E9LA 3WVJA 2ZGLA 7ODCA 2W62A 4RX0A 2GSHA 3N36A 2QPSA 3MPGA 2YGYA 4WSKA 3M4FA 2EXOA 5HDRA 2BUKA 4NIAA 2PDMA 4QX8A 2C0AA 5FAGA 4Y20A 1BSLA 1HJUA 1GOHA 4BJ0A 2Y61A 3S1WA 4AXKA 3FLTA 3A13A 3P14A 3N9KA 2CLPA 2DZTA 2F84A 3R4SA 4L6OA 4Y1XA 1HQWA 2PLV1 5FKCA 1R9YA 4G9SB 3BAIA 3ZFGA 3NUKA 1EDQA 4MWAE 4LHNA 2A70A 5FPZA 2DBNA 4L92A 3I3DA 5CC6A 3W23A 3INPA 4DEQA 2WHJA 2PELA 3RZKA 3DFHA 4JIIX 1WWYA 2QJVA 4KFNA 1FWNA 1H1ZA 5F8PA 3TZFA 3TBDA 4BHPA 1M6JA 1XNTA 4EQVA 3GBDA 3BOPA 1TPFA 4ADTA 1LTDA 5C5UA 3N9NA 2J4GA 2ENRA 2CNCA 4AFCA 3TU9A 5BYNA 3VDDC 3GRIA 5HQLA 3N2CA 3LHYA 1UOGA