4UFMA

Mouse galactocerebrosidase complexed with 1-deoxy-galacto-nojirimycin dgj
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
644
structure length
640
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
total genus 207
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ufmA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ufmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ufmA01
4LW7A 2WANA 5LSMA 3DKJA 3VCRA 1BKSA 1HKIA 2RDWA 2ESCA 3WFZA 2YCEA 1FY6A 1G4TA 2BNJA 2YA1A 2CLEA 3T44A 3L4WA 4TXEA 4BI5A 4GE8A 5EA9A 3KVKA 3CGTA 1O5KA 2ZZ3A 1Y9GA 3N14A 1RQHA 1A50A 1FDJA 2WC3A 4ZENA 2DZWA 3T40A 1P0NA 4FEZA 2E8YA 1AK5A 3L4ZA 2X1UA 1DWIM 3UY8A 3T7VA 1HN1A 1UD5A 3AHZA 4WKHA 3NAVA 3NL2A 3VU2A 5A8NA 4HPHA 3HO8A 4W8BA 2ZUSA 3TOPA 1CLXA 3OHIA 5CKSA 3NL5A 1UYQA 3NIYA 3I7RA 1RPKA 2Y24A 3AO0A 4ZZ9A 2YA2A 3CHVA 2V5CA 2YDSA 4P8XA 1FWTA 1ODZA 5BNKA 2XSAA 1KFJA 3NQ8A 3B0VC 2IUZA 2W63A 5DFAA 2BWGA 1AW1A 3LRKA 4P8VA 3SC7X 1KM6A 5IHSA 1XCWA 1DQWA 3TU9A 1JCJA 2V3GA 3ZOAA 3W0KA 1LBFA 1LRNA 1B31A 3DFOA 1LOSA 2DT0A 3SUUA 1I2QA 3A23A 2ZXAA 1SZNA 4GRSA 4D6GA 1RQEA 2BVTA 2VEMA 1GTHA 3ARYA 3POCA 3WDJA 1E0XA 5D2VA 5D9OA 2IXVA 2H8XA 3C2FA 3E96A 5ABEA 1KXHA 5DT7A 3TUUA 3B0PA 4JYEA 4WOZA 1H5VA 4NZJA 3INPA 5BXPA 3WJSA 3W53A 2NWRA 4UTFA 4AWUA 2GVYA 1A5AA 1EB3A 1QBAA 1UUQA 3EB2A 1JGIA 1TRDA 2YLAA 1KV5A 1XXXA 2G8ZA 2E09A 3VUPA 2YPIA 2D1ZA 8CGTA 4X9SA 4ADUA 1ISXA 1HF6A 3CM4A 1JRBA 2GUUA 2W0UA 2YR1A 2BS9A 3LDVA 3M6YA 1QOQA 3ABSA 1X6LA 3RLUA 3TSMA 3K4DA 3MANA 1GQNA 1NFBA 2VFFA 5E09A 3W1AA 1UZ1A 4W5ZA 1JL8A 1AG1O 2VKZG 1B4KA 1P0KA 2WNWA 5CSYA 3UETA 5D30A 4QIUA 3CTTA 2GUYA 1TCMA 3MYPA 1TPWA 4YPJA 1Q45A 3L65A 4NT0A 2XSBA 4W5UA 1JVNA 3PBWA 4WXYA 3GDBA 3CEPA 2PC8A 2D3LA 2D24A 2QJGA 4HSOA 2WKLA 2W79A 1I2RA 3NDYA 2V3DA 2HS6A 3FAXA 1GOQA 1RP9A 2VZSA 4PMQA 4OV9A 1TV7A 1KTBA 3CWNA 3NYZA 1BTMA 1PPIA 1XUUA 1UR8A 2WVVB 2I14A 4DO5A 5K4ZA 3BMVA 4N2YA 4K7YA 2YJQA 4P61A 3WBAA 2H90A 3SY5A 3VMPA 3TH6A 1QPRA 5KZMA 1P1XA 3HN3A 4HPGA 3RDKA 1SFJA 4HOXA 4O8RA 5I24A 4FXRA 3KOFA 1NWUA 7A3HA 3W87A 4LTSA 1M6JA 4DM2A 4CVUA 1ICQA 4TMCA 1SSGA 2X8RA 1L8NA 3NPVA 1U5JA 1NOWA 3NL3A 2AEYA 5AHNA 4AWSA 1FH9A 2XVLA 4NI3A 2O7SA 5A8GA 1TA3A 3L2MA 1J10A 3PZIA 3GXPA 2DZSA 2ZZ5A 1TSIA 6ALDA 3HPSA 4IISA 4Z2HA 4CD8A 4DUWA 1HJXA 4MNJA 3C0JA 1S46A 2NUYA 5K3VA 4IX2A 4GZEA 3UPBA 2VOMA 1T96A 3ARQA 3PZGA 1V0KA 1SMDA 2QPUA 4WF7A 1E55A 4JXCA 3FAWA 1S5WA 5A6BD 1OGGA 1SZEA 4KKXA 3EKZA 3UZ5A 5FF4A 4CN1A 3ZWSA 3LTYA 3BAKA 3LPOA 5A6MA 3O6CA 1JUBA 1GWJA 2ZWYA 3TK7A 4RR4A 1YPIA 4UNKA 2ISVA 5CZJA 5FF2A 2GJXA 1UHVA 5FEPA 3VIPA 1C93A 3TP4A 3WF2A 3ARXA 4CU8A 4JHOA 3T0AA 1PEZA 1OD8A 4FF5A 4DO6A 4Z2LA 2AMGA 1XBVA 4ICNA 4POCA 3VNZA 2ADDA 1WV2A 1B1YA 2WVUA 3A3HA 2VT0A 2HMCA 2MANA 2WCAA 1EA0A 3OGVA 4ZFMA 1QNSA 4O4VA 3SCQA 3BLIA 4GQRA 1TV5A 1FDYA 4E2BA 1E56A 3HPXA 3LOTA 4FX8A 3WFLA 3MO4A 3OG2A 1WE5A 3WDPP 1HL2A 4S3KA 4ORIA 2YFNA 3GDTA 1FHDA 1NVMA 1QOXA 2Y4SA 1ADOA 4X2RA 1NEYA 1D2KA 1RD6A 4JKMA 3FIGA 4L4PA 5IFTA 1X1OA 3AXHA 2PB1A 2YX0A 5SWUA 3TQ0A 1VRDA 2J8GA 2QCDB 5AYBA 4PSPA 3MI6A 3FYOA 5DLCA 3W75A 5A6LA 3UYCA 1J2WA 2Q8ZA 2Z6JA 1DL3A 2E1DA 3WUEA 1HL9A 4BA0A 2V2DA 3HPZA 4LGXA 3W29A 3LTPA 1QMLA 1P6WA 1KFBA 1UBSA 5AOUA 3WDRA 1FA2A 4O17A 3H3LA 3CLWA 1TB3A 4GPNA 4BFAA 5DF0A 1UJPA 4MJ2A 5CGQA 5BROA 3W85A 1G4EA 3UR7A 1XSIA 2YLLA 4PL2A 2OJPA 3EWYA 1CGTA 3KXQA 3QQ0A 3THCA 3QJAA 4J3TA 4Q4KA 3OZOA 4BF7A 5AHLA 4XBSA 1EEPA 1U83A 3KVLA 2Q3OA 4RJEA 1RH9A 4HZ8A 3NSXA 2FIQA 3AXXA 3VD5A 3LV6A 3W23A 2CLMA 1B3WA 1FP9A 4CD4A 5EMUA 5GNYA 1GJPA 2EF9A 4O52A 5HUPA 2V30A 1BYBA 2FPTA 3L5LA 2YA0A 2WSPA 1G4SA 2Y85A 4WY0A 3IAPA 3W24A 4WD0A 4Y8FA 1B4EA 3CTLA 1M04A 3B8SA 3NYDA 4QLKA 1V03A 5I6SA 5D2WA 1GVRA 3KRZA 4M1RA 5JBFA 1QPOA 3EXTA 5C6MA 2E40A 1IV8A 1HXJA 5D2YA 3VX1A 2E3ZA 5FF3A 1W2VA 2VTFA 2BXZA 3I68A 2FDMA 3AS3A 1EUAA 5K2ZA 4E8DA 4JTEA 3O63A 3OZPA 1C8XA 1FFRA 1OT1A 1G6CA 4WY0B 1L6SA 3PTKA 4H2CA 3SECA 2WKGA 2V2CA 4ATDA 2YW3A 1U30A 1UQZA 3ALGA 1RZMA 5LA1A 5D4YA 1IIGA 1TRIA 2LLEA 1JF6A 3WQ8A 2AAAA 3OGRA 4KFPA 3UWVA 2ZA3A 1BWKA 5A8PA 4RK8A 2CHNA 4P7OA 5D9MA 3PSVA 4UFJA 3R2GA 1DQXA 2OSXA 3GYCA 3AMLA 4ZMGA 1VQTA 4NNCA 4NSBA 4D6IA 2DDXA 1BWLA 3MBFA 1VFOA 1ZAJA 3BW2A 1BYCA 2D0FA 3WNKA 4ADTA 1GQIA 2XTKA 5GNXA 2AQWA 4YXGA 3W7EA 4LYPA 5EMYA 5A2CA 3P82A 3G1HA 3W7KA 3IVUA 3UWYA 1I1XA 3WNMA 2VVSA 1XRVA 3QHMA 2WW5A 2QCCA 1W9XA 1KWKA 3TC6A 4GINA 3VDCA 1Y9MA 1UUMA 2Y62A 3SCUA 4CNNA 3MWAA 3S6DA 1JZ5A 2BVYA 5LNRA 2CLHA 4GZJA 1HKJA 1EQPA 2FPYA 1J0JA 4GZIA 2QCLA 3ALFA 3G1SA 3G3MA 2OT0A 3QHOA 1V0LA 4QAWA 5A6JA 3M44A 2GDUA 3TX9A 4OUEA 2VFIA 5TBOA 1NSJA 3LCXA 4IPNB 1BPLB 4OQVA 1W5QA 4A3UA 4AD2A 1PS9A 3NQGA 1TFVA 3A24A 2PWGA 2CETA 4FLOA 3Q94A 2WKJA 2GJRA 2AGKA 1G94A 4PRWA 1MQQA 3VDAA 2XFFA 3N11A 3OSDA 1OFOA 3FKRA 4AC1X 4KFNA 1XH1A 4BWLC 3EMCA 1BG4A 4UTHA 3P80A 1TV8A 4JGDA 2X05A 4CU7A 4JTFA 4OOUA 5GQBA 4URIA 5C54A 4CUCA 4JFTA 3WBEA 3LV5A 3DFQA 2B4GA 3BLEA 5C5YA 1KR0A 2VMFA 2ZRZA 1H4PA 4XKYA 2Q8XA 3SUWA 1CZ1A 2A1YA 2EHHA 3EXSA 3A4AA 2VX5A 3S42A 3W83A 1UD4A 2G41A 1MZHA 3N19B 3OB8A 2TMDA 3NXFA 1E70M 5EFDA 3LCLA 5FMCA 1UWTA 1H7RA 4JDBA 1J0IA 1W9PA 1VYRA 4H7VA 1H7NA 3KAOA 1H61A 5BWFA 1LZOA 3A9IA 3W1XA 2NXGA 5HPCA 2A6LA 4IJBA 3SUVA 3BW4A 4JN6A 3B06A 1IGSA 3AJ7A 3A5VA 4J3VA 1FFQA 4AD1A 3OGSA 1XC6A 5D8WA 2ZUWA 1FUYA 1HNYA 3N17A 3WENA 2VQUA 2DORA 3CZ8A 1WX0A 2IXUA 1KV8A 5GNZA 1AVAA 3GIYA 5L9FA 2YSWA 1ZS2A 2G5WA 1VC4A 3AQUA 3VIJA 4CQAA 1Q6LA 5CPLA 1M7XA 2ZX9A 3BAJA 1H51A 1J0HA 3POHA 2Z1SA 2Y5EA 3BG3A 3WJYA 3T0DA 3DI1A 2D3NA 4NU7A 3QZEA 5CPNA 2NWSA 3GB6A 5C71A 3AS0A 1HTIA 4Z2IA 3GBEA 3KL5A 4PMNA 3NL6A 3SCOA 2WBKA 3SEPA 2BV9A 4HKPA 2VFEA 1LQ0A 3TJXA 2D0HA 4U5IA 1QWGA 1KQYA 1CECA 4MNMA 3TTOA 4AZCA 1UD8A 3WH5A 4W88A 2ZUTA 1ITCA 2FJKA 1C8QA 5E0FA 1QPKA 4MAZA 3P84A 5LZLA 4YLWA 4O11A 2ZDRA 5DCBA 4K8HA 3UEQA 4PSRA 3FEMA 4DUVA 4NXKA 1WZAA 4JTJA 4ATLA 2HISA 4MPKA 4W8LA 2J24A 1V3HA 3GXMA 1KFLA 4IX0A 4MDOA 3I3DA 1KR1A 3EWUA 1QHZA 4FNUA 1V3KA 4ZQOA 1B9BA 1Y4WA 3TR2A 4WLCA 3UG4A 1Q4NX 1RPXA 1MXGA 1G67A 1A3HA 4AF0B 5A94A 3OA5A 3C4UA 1PJ9A 1I8JA 3V1PA 5FL1A 3DYOA 4AEOA 4FB7A 2CBJA 3K1DA 2G3MA 3HMJG 1JXJA 3U2OA 1V6VA 3W1RA 2BHZA 3FN9A 3FXYA 3O2LA 4UQ9A 3QMSA 2ZUUA 2GDVA 1W1ZA 3AZRA 2NT0A 2Y8KA 3N13A 1QOPA 3NZRA 1TZ7A 4FFHA 1JUKA 2WLYA 3W81A 1TVNA 1DORA 1JG9A 5G2WA 5I23A 3ZR5A 3NMBA 2RH9A 3FA5A 5CZ0A 5CQ1A 1YTKA 4HZ7A 5LKYA 2XPKA 3WH8A 1FBAA 2J9YA 2ZWZA 3ZJKA 3G0UA 3P7YA 2WNQA 2O9RA 2ZA1A 1WA3A 4B5NA 3MU7A 1H60A 1EIBA 1XSJA 1ECEA 1FQ0A 4PH6A 1Q6RA 3DU0A 4O18A 1HKMA 4BR1A 3ZT6A 2NX3A 5AHEA 3A22A 1PV8A 1E51A 3FKKA 4QCFA 3ARPA 3EWXA 4RZ6A 3LMYA 2VEKA 1TUXA 1HP5A 5CXPA 1GVOA 2VFHA 3ZS4A 2X1IA 4MB4A 2QF8A 2NV1A 4NJGA 5DEZA 3G18A 2WMIA 1Q3NA 2XFYA 1AQHA 3WIJA 1XC4A 2B7QA 1ISYA 3T2PA 2VENA 4S3JA 4DELA 2Y61A 4O50A 1CGUA 4TOQA 1RR2A 3SIMA 1XBYA 1YXYA 5D02A 5I0DA 1I2NA 4CVWA 4IUOA 3WNLA 2OX1A 2O9TA 1D3GA 1VYPX 1ZBCA 5LNVA 3VMOA 1JYXA 1K7FA 1CXFA 1WDRA 3I65A 3H53A 2OYMA 3HG4A 4LVFA 3PAJA 3GNOA 2GJPA 1JZ3A 1EOKA 3W2KA 3DENA 2V0TA 4JTSA 1M7OA 4PA8A 2XHYA 1SW7A 3G6LA 3OIHA 4TX8A 3VM5A 3W4RA 3TSBA 4U4MA 1WOBA 2E6YA 1CXIA 1CW2A 1H0GA 5DMYA 5F2MA 4UFIA 1K8ZA 3U5YA 4W9TA 4X3ZA 2QCDA 3QRHA 3L0NA 3O07A 4N9CA 4NNAA 4LOCA 2ZFAA 4HPJA 4O4WA 1OWQA 5AC8A 4UOJA 2Y63A 2ZZ7A 2GQAA 2EXOA 3O8AA 4XWUA 1OFBA 5E9AA 4IMDA 4NXSA 2EPMX 3WQ6A 3ZIZA 1ICSA 3APGA 3E9AA 4PMUA 4NVTA 3E02A 5I3IA 1PX8A 3RM4A 1NAL1 4XV0A 3D5HA 3VIFA 2ADEA 3HJZA 3MW7A 3TMLA 3DBPA 3HG2A 1A47A 3DHPA 5FD0A 3WEZA 3CZGA 3GNNA 3C2RA 3DI0A 3RNDA 4ZQRA 1WO2A 2BHYA 4XB3A 4XZWA 4UTWA 1GHRA 2WAGA 3T2OA 3BC9A 4WX2A 1GNXA 5H91A 2FH6A 4ZXLA 2VX6A 1TCDA 1PHWA 1UB3A 2CZDA 3L2IA 3ZWTA 3B0UX 3VNDA 4QNEA 1J9YA 1KFWA 3LPGA 1WNOA 4E2OA 2TPSA 4U28A 1XFBA 2VCBA 1WOAA 4AZ6A 3UXAA 3C8FA 1W56A 1XBZA 4YCPA 1HKKA 1KB3A 4A22A 4BWLA 1VHNA 1J11A 2RHGA 3TW6A 2ZE0A 2JKPA 3MJYA 1HO1A 4MAVA 2IQTA 3BAWA 3ZJ8A 1H5YA 2W62A 3UGHA 3USBA 4W8AA 3EXRA 5F1UA 3QHNA 4HPXA 1NOUA 3MMDA 4IM4A 3WNPA 2PWEA 3TNOA 1K9DA 1XYZA 1VHCA 3SJ3A 5CG7A 3GZ3A 1OIFA 3WD0A 2QUTA 4MZYA 1GHSA 2WMGA 4JFUA 2BX7A 1US3A 1XGZA 2C0HA 3F5LA 3BARA 5CPSA 1EQCA 1IXNA 4UZSA 1KTNA 1VGAA 4F9JA 4AZHA 3SZ8A 3BV4A 5E6ZA 3WL1A 5D2XA 2PBOA 4AYSA 4XUGA 4EANA 1ZAHA 3KZSA 2OLHA 2NX1A 4UQBA 1J01A 5DO8A 1GG1A 3PM6A 3MUZ1 5KEZA 4ZQNA 1SYTA 1DWFM 3LX9A 1PAMA 3D0CA 4P8UA 1ISVA 4TO8A 2DPEA 3P8JA 1WKYA 1O6IA 4CD7A 3MI3A 5EKYA 3UESA 4HA3A 3T08A 1AMYA 1QW9A 2WMHA 1SQ7A 1F73A 1RQBA 4ZQCA 3EDFA 1OM0A 4PUDA 1NWRA 2CKSA 1SR0A 1C7TA 3KRSA 2CZFA 1ZBKA 1JQVA 3HF3A 4D6HA 1JZ8A 4JTIA 3VGFA 5A6SA 1V6YA 4HP5A 1V02A 5CZTA 5D05A 4NJKA 3GX9A 3E0IA 1UR4A 2GJNA 3DKLA 5AB3A 1TQJA 5T26A 1OX4B 4HMCA 1CX9A 4BK9A 4BQ5A 3G0XA 4F8XA 1YPFA 1Y7VA 1UCWA 3PF3A 1H7OA 1OF8A 5HQEA 3W07A 4B15A 2ZUMA 3CIWA 5HWMA 2TRSA 3FY1A 3TTYA 2FB2A 3QR3A 2CBIA 3W1QA 2ZRXA 1FWRA 3JRKA 3GZAA 3VVGA 1SZGA 3OG3A 5F4XA 1QPNA 1UA7A 1MYRA 2QCMA 1L6YA 2Y7GA 1E40A 3CHCA 3IV3A 3LXBA 4V28A 5C70A 1OX4A 1V3LA 1NM9A 4IMFA 3TFXA 2D23A 3TMQA 2VRKA 3PY2A 2ZX7A 2XIIA 4NJJA 3PZNA 2BFGA 3QW3A 1OFQA 2H3BA 2JEQA 4Z2GA 3ABRA 3QPZA 1G4PA 1XH0A 4YCOA 4TTUA 4JTGA 4LVGA 1G5AA 1H7XA 1UWQA 4U31A 5D2TA 1PIIA 1E73M 3GDLA 4M82A 1KXTA 4Q33A 1W9UA 4PBGA 5I3DA 3L0GA 1ISWA 1R8LA 2H8ZA 1R7AA 5I3KA 2W91A 3WF3A 3E1F1 1BHGA 3L4VA 3Q37A 1MW1A 4PUEA 3W2UA 2ZOXA 1E5JA 3NQMA 1RP8A 3CHDA 2XG9A 3IJ8A 2YOCA 4DO4A 4CD5A 3ARUA 2CWNA 3THAA 3W2LA 3BGGA 3W7QA 4AH7A 2Y8VA 4CKQA 2OXBA 5BRQA 3R5EA 4HZ6A 3EWWA 4I9AA 1KBBA 2TSYA 2F61A 4GWEA 2C14A 4HT3A 3TXVA 1H1ZA 2EQDA 4O1CA 3R13A 4HTYA 1BEUA 3GXFA 2RGLA 1V0MA 1VH7A 1VBUA 4JNMA 3W1PA 3CBWA 4TMBA 1ZJAA 4AHPA 4AHOA 3CWOX 3LCGA 3P62A 3AIRA 4GI9A 4LVAA 4JKKA 3WN6A 4CN6A 3EMQA 1ZAIA 3AIVA 2JKAA 2JGQA 2QUVA 2WSQA 2XVPA 1UWUA 5I5RA 4ORMA 4FIQA 1W5OA 4ZQMA 5DY3A 1UKPA 2AOSA 4QFUA 1PCWA 2BY0A 3W1TA 2J62A 3GR8A 3W1MA 1B3YA 3B05A 2OWXA 4TIMA 3LPFA 2UWFA 3FHAA 4R33A 1R2SA 3OIXA 1C90A 1E6RA 1F4AA 3G22A 3IVSA 1ZBVA 2JK2A 4O53A 3NM1A 1QNQA 3WH6A 4C7FA 4Z1DA 1DEDA 2J25A 5FI8A 5K9CA 2ISSA 3W6YA 1MVYA 1VJZA 2NXHA 2VC6A 4OBSA 2WCSA 1WBJA 2EPHA 4O19A 4DWSC 3QC3A 1E6XM 1E3ZA 2WPGA 4O28A 2XN0A 2V81A 5A8QA 2OCZA 4W93A 3OBKA 5DN1A 4UQAA 5H2ZA 1EHNA 2WV8A 2WSYA 5M17A 4AIEA 1FHLA 3CT7A 2J7GA 2ZCGA 4D6JA 4E8CA 3SSJA 4M80A 2B0MA 3A6OA 1Q6QA 1JULA 2OT1A 3WJXA 3GXDA 1TIMA 1VF8A 4PEKA 3ARZA 3MHUA 5F2LA 1IZKA 1TPDA 4KRUA 5EBUA 2WWDA 1KBIA 1LROA 4JTTA 3VOCA 4Z0SA 2PF0A 1FWSA 4ZQPA 3WUGA 2A5HA 3BLPX 5JIWA 1B3XA 3FNDA 1W54A 4U3CA 5D37A 2P1FA 3P60A 2WHJA 2OYLA 3N2MA 3BK0A 2NSXA 1UD2A 1DVJA 4V27A 5HJLA 3CUGA 1F7BA 1BLIA 4IQLA 1NWTA 3U75A 1FXPA 2V3FA 3WMCA 4H4IA 3SCWA 3TFCA 5CPMA 3CZEA 1EO7A 1OFAA 2A3CA 1TYGA 1ZY9A 4GUJA 5HWJA 1N7KA 4EOUA 2C6QA 4QAIA 1KW1A 3FOKA 2FB3A 3WD2A 2FLIA 1S3HA 3VFLA 1K7XA 3AIUA 2E5DA 3W22A 1ITXA 1KFCA 2UY3A 1JAKA 2YIHA 4J3UA 4EF9A 4ML4A 3CPRA 1JDAA 5LHEA 3K8MA 4LXFA 1JI2A 1PCKA 4N9DA 1B30A 2YFOA 2PWDA 3GKAA 1GCYA 1V0NA 2CYGA 2XVNA 2WMKA 1TMQA 3W28A 1JNDA 1TG7A 4C7GA 2YDAA 4OE7A 2ZX5A 3B9EA 1IT0A 4E38A 1THFD 4J27A 3VDHA 2QDGA 3F1QA 5AFDA 4AZGA 3AMKA 2CU0A 3N18A 1K02A 1MEIA 3PC0A 4LUJA 3G1XA 4UTKA 2DEPA 1O5XA 2E77A 5L6UA 3HJEA 3N9KA 4F79A 2ZRVA 5A6BA 3UPWA 5KINA 1DWJM 3DFNA 1HJWA 4N02A 2ALDA 3DECA 2RFGA 2PRLA 2VEIA 4RV8A 2WQPA 3L5MA 4JEQA 4LNYA 4MZ1A 1R30A 4OIFA 3LLFA 2DSVA 5IFPA 2CLLA 3B9DA 3PTMA 3U5UA 1XV8A 3BCDA 1PL9A 2RDUA 5KITA 3D3AA 3AFBA 1UOKA 1KBJA 3PIJA 3WK1A 3VIHA 5CLTA 4FF7A 3J7HA 4QHZA 2EKCA 2DSWA 2B7PA 2OSYA 5CSUA 2J7FA 1CGVA 2NUWA 3KX6A 1GQKA 3N04A 4M56A 4EE9A 5DCDA 4M6QA 2X2GA 4JTUA 1KA9F 5F2GA 1J4EA 1VPXA 3W73A 2J78A 3A4XA 4PC8A 4M6PA 2C13A 1KCLA 3RF9A 2XYLA 2ZXBA 4U33A 2P10A 2E8ZA 2NUXA 1E4NA 4P2VA 2VO5A 3AROA 4GJ1A 1F5ZA 1T8XA 4JS3A 4UTWC 1DHKA 3QOKA 3UERA 4GKLA 4ZE5A 3VGBA 3MUXA 4MY1A 1QR7A 1YTDA 4MOZA 3UNDA 1QBBA 4GO8A 4W87A 3UWZA 1ALDA 1FP8A 3MO7A 2J75A 3U7VA 2FHBA 1UD6A 2VRJA 2OSWA 2NT1A 3S6TA 1LL4A 5HOSA 4OBTA 4OV4A 1XCXA 4MNKA 2J7HA 2ZQ0A 3W7IA 3M5VA 1GOOA 1IF2A 3AMGA 5AYZA 1CGWA 5TIMA 4ACYA 2VUYA 2A7NA 4AMAA 1KM2A 1W9BM 4JICA 2A3HA 1W3IA 3AOFA 2DZPA 1R7OA 5F2IA 5IHRA 4YL2A 1KQZA 1UKQA 4IGHA 3VGHA 4MLRA 3MUIA 4K7VA 3GLCA 4WOQA 4PTWA 5FL0A 3TAOA 2ZICA 1I75A 4OWGA 4YMZA 1OFDA 3L0KA 5CZSA 8TIMA 1NF0A 2W5FA 5A2BA 1FCVA 4MFDA 3ARWA 5HDRA 1GQJA 3EWZA 4JTLA 3K8LA 1AL8A 1D7FA 2XN1A 2CBVA 4RL3A 3E12A 5EY5A 1A5SA 2WNZA 3PBUA 3IIPA 3EYPA 4MADA 5I77A 1BYAA 3UCQA 5I78A 3IMMA 4J9JA 1JRCA 1EWDA 2UY4A 4O57A 2QCGA 1VFFA 3L4UA 3W7OA 3ZR6A 3IVTA 2DZVA 3UD6A 2E6FA 4AF0A 2X0YA 4QNWA 4KMQA 4M24A 1CXEA 4MLJA 2DJXA 3LBMA 2XM2A 1U33A 4UFHA 3TC7A 5G4WA 3W7GA 4CQ9A 3G3DA 3MMTA 1K9EA 3WQ4A 4NZFA 3C2VA 5D38A 1LP6A 4AB4A 4D2JA 3VIMA 4LC6A 1JIBA 1Q6DA 4EIVA 1E5NA 3HG5A 4P7LA 5HNNA 3QMTA 3N3MA 3LPPA 3S5NA 5A3HA 4TX9A 4A21A 5DXYA 2JKEA 4RX0A 4JCLA 1O7AA 1QHPA 3DHFA 4PCFA 4EQVA 4IMEA 3DHUA 2XM1A 3VI2A 3E49A 4UQDA 3Q58A 2J47A 4UTTA 5HR6A 4XBKA 1UWSA 5AHMA 3TCEA 3UY7A 1Q6FA 1LLZA 1VJSA 3LIGA 3EWBX 5HUOA 4M7TA 1OF6A 2GK1A 4YN5A 2FTPA 4HOWA 1B57A 4LS0A 1HVXA 4HNVA 4JTKA 1OGSA 4R7JA 1W3NA 5KZ6A 1OABA 1TPC1 3EX2A 3G1YA 4FK9A 5FKBA 4NRRA 4UFKA 2C16A 1M7PA 3MP5A 2XWEA 3KFTA 2VZTA 1FCBA 4O10A 1EP3A 1A5BA 1QFEA 1K7EA 2E0PA 2B31A 3TTSA 4IPIA 3QEZA 5DY2A 3VD3A 1H0IA 3WL0A 1JFHA 3M6DA 3W7HA 1CI1A 3MP3A 3I6RA 3O05A 3A47A 4FLQA 4H04A 3AIQA 2VQTA 5D04C 5HULA 3L21A 1PX3A 3QQ1A 3PZVA 3RM9A 2HTMA 3ZO9A 5CGMA 1CPUA 3BCFA 3IJ9A 4MVAA 1H7PA 1GTEA 3B04A 1LLOA 3CH9A 3LB0A 4N9EA 3SCPA 4NJIA 2ZYFA 1QNRA 3CUFA 4IPLA 1MW3A 1CXLA 1IXQA 3S5OA 2PWFA 2C0AA 4ATWA 4UIOA 4QJ1A 1VEOA 1TMHA 1IXPA 3P61A 1BVZA 4WQ6A 3P5ZA 3MUY1 3GYEA 1DWGM 1GVFA 1YDOA 6CGTA 1OFPA 3W9ZA 1DV7A 1VR6A 2PBGA 1LCOA 4DF2A 2QCEA 2VURA 1B3ZA 1E4IA 3G6MA 4JFSA 2DU2A 4FLRA 1JCXA 3NQAA 4ZL1A 2VRQA 4XZBA 3CHFA 4QLJA 2G96A 1FCUA 2GK1B 1VBRA 3PB0A 5BYWA 3S5QA 2WMFA 3SIZA 6TAAA 1HIZA 2KZHA 1DBTA 1W37A 1ST8A 3KF3A 4WJXA 4D1JA 3MMUA 3KL3A 3IK2A 3U8GA 4QM1A 4O0KA 2FQIA 1TTIA 3LRLA 3AHYA 1XD0A 2J9XA 3VD7A 4FIRA 1JYWA 1ZFJA 1K8XA 3G1AA 2CHOA 5E70A 2JF7A 1I45A 3AS1A 3IANA 3II1A 6A3HA 1RV8A 4IUGA 4FLSA 3UWQA 2XWDA 3W84A 4M29A 3PIGA 4UTJA 2WB5A 4KWUA 2C3ZA 1PHQA 1WQ5A 4F66A 2VFDA 1OB0A 3AJXA 2CKRA 1M53A 3FYPA 5C8BB 2VEPA 3M16A 4PEEA 3K4AA 4N9BA 4O1AA 5ABFB 2ZIDA 3LHVA 4AIUA 3GBDA 4PMZA 5JIPA 2Y2WA 3ZT7A 4M5PA 4BQ2A 1G7UA 3BPWA 4HNTA 4QCEA 4DQWA 2CITA 2YW4A 1HO4A 2CESA 2YBUA 3CO4A 3DAQA 3HBKA 2X1RA 2Y88A 1LWHA 1F6KA 2CLOA 3HBLA 2Y6ZA 1C7SA 3M41A 4TR9A 4C7DA 1KM3A 4BS0A 5D8ZA 1C9DA 3STFA 3T78A 4A3YA 3B8DA 1LBLA 3RCNA 1JNEA 3VIOA 2XVGA 3DZ1A 1LG2A 1MXSA 1D3HA 2QQUA 5A69A 3G1FA 3NVTA 2WK2A 1PBGA 2WMJA 3MYOA 3LCHA 3MHFA 4ZVJA 4HSNA 1GUVA 2J77A 4J3XA 4WK9A 2UY5A 1D9EA 3N9RA 4AZCB 1G69A 2WMIB 3NQVA 3EDEA 4KGJA 3LHYA 3I7QA 2EBNA 2J88A 3LHZA 4HIBA 2RGMA 2XGIA 1ZENA 4BF9A 1NARA 3VKJA 3VGDA 1TVPA 1TE1A 5CSRA 2WBGA 4UTIA 5I79A 2ATSA 4CNOA 3MHGA 4AZZA 1N55A 3L4TA 4FFGA 4CQ8A 5G5IA 1QI5A 3PUOA 2PURA 4QITA 2QCNA 1F05A 1OGBA 1FX6A 3S9YA 1VCVA 3KRUA 3BAXA 4J3WA 1V6UA 2DIEA 2WNNA 4D71A 4X0NA 1HJSA 2VOTA 2VJXA 4OOZA 5LGZA 1UG6A 1PZ3A 4UQCA 1BAGA 3ZJ7A 1L9WA 4XTIA 4JQTA 5BRBA 4XX6A 1LORA 4W86A 3M1ZA 3CIXA 3UGFA 1E1EA 1H09A 4G1KA 4O15A 1X6NA 4R53A 2VZUA 3A21A 3PZOA 2WC4A 5A8OA 5EPDA 4JTHA 1OBAA 1VFUA 3PVFA 3AMCA 4H8UA 4D6FA 3GKFA 4UTUA 1GZJA 4LX4A 3GH7A 1W1VA 2D2OA 3W72A 3F5JA 4JYFA 2C8NA 3WF4A 3NOEA 4M7SA 3WDIA 2QF7A 2XJ7A 1GJUA 2WHKA 4UC5A 1J0KA 3SCRA 1UASA 1SFSA 4GUHA 2E5CA 1FH8A 4W7WA 2DZUA 4TU1A 3W1NA 3I3BA 2WSRA 1ML1A 4ZXOA 4QISA 4B9YA 3TQVA 2G95A 2E9BA 3STEA 2FHFA 3AHVA 4FNTA 4TVUA 4IOTA 4EVZA 1LLWA 2V9DA 3NA8A 1WPCA 2QQWA 1YDVA 2J27A 1JXKA 3WMSA 1VJIA 3IEBA 1BGGA 1TPH1 1GORA 1W3HA 1SO4A 1LBMA 4E0CA 5EL1A 1SR9A 4HXCA 3TQKA 3QF0A 3WJZA 4Z1AA 1CBGA 4JCMA 1DKWA 4HU8A 3L4YA 3A4WA 5FKYA 1A5CA 1JJKA 4UTMA 1GYNA 2C19A 4MPQA 1CXHA 4R34A 3SURA 2WVTA 2QCHA 3N15A 4DWSD 5D09A 4PMRA 1M01A 3FS2A 1GJWA 1CGYA 1QPQA 2CW6A 4PN2A 4PMXA 4XQ6A 4Z08A 2W66A 3N73A 4Y90A 4NZCA 3PB2A 1V3MA 2UV8G 2G3NA 3VDBA 2G3JA 4HA1A 4FNQA 4KFOA 3ARVA 3ARSA 2Z2UA 3RO8A 1WDQA 3R12A 4UTTC 4CLMA 4HA4A 1V02E 2PE4A 4P7QA 4X0VA 3QFEA 4JIPA 1JDCA 3R89A 1JCYA 3NEVA 1Z41A 1G0CA 1SUXA 3PZMA 3IRDA 5G2HA 4J3SA 1HUVA 3O1NA 1WXJA 3GDMA 5U4NA 1P4CA 3CEUA 2CFFA 4O14A 1VRXA 3W7CA 1OIMA 3EBVA 3HMCA 1VLIA 4M8UA 4L4MA 3EKLA 4MY8A 2RDTA 3UXDA 3DGRA 1OT2A 5D9PA 2YDQA 5LA0A 4JAWA 4U2ZA 3WDQA 2ZBTA 3EDJA 4O1DA 1M5WA 1O4UA 2VELA 3Q2DA 2BY2A 2EO7A 3AYSA 2E4TA 3PBYA 3ANYA 3NDOA 5IM51 1IZJA 3W71A 3W7PA 3LCWA 2A3AA 3M9YA 2DIJA 2B7NA 4KGLA 1FCQA 3MUAA 1VIWA 2GJXB 3GNPA 3O6AA 5CLWA 2DSZA 2OZ0A 3LI1A 6TIMA 3K46A 1ONRA 3W1UA 1C91A 1QO2A 3LM7A 4GNJA 3LI0A 1DOSA 3BSHA 3HIJA 3QMRA 1YHTA 7TIMA 4FFFA 3WD1A 4CU6A 3EDKA 3VIGA 4UUIA 3WD4A 5D32A 3UG3A 1ZBWA 1JZ6A 2X1TA 2J7CA 2W61A 3RILA 3W37A 2GFTA 1CYGA 1OYBA 1VLWA 2DZTA 1CNVA 4AY1A 4K68A 1LDCA 4MZ8A 1WDPA 1HL8A 2FPVA 4MYXA 3KF5A 2BY1A 1JYNA 1QNVA 3BVJA 3S1UA 4JDYA 4AW7A 1QHOA 4A3HA 3R8RA 4PODA 2QDHA 2Y89A 4N6EA 4RXFA 4QSHA 5G1TA 2ZUNA 4AXKA 3ZMRA 3LGEA 4BQ4A 1NH6A 1EPXA 3L68A 5U7SA 2DGAA 2CEQA 3AIBA 3I3EA 5TD4A 4GXMA 5BOOA 3O15A 4GQQA 1EDGA 4JHZA 3WJWA 3SI9A 1E6QM 4UFMA 2Y7EA 1SU5A 1OJXA 1PVNA 4OT7A 1EOMA 3ZM8A 4AZBA 1JCNA 1LTDA 2VXNA 1K9FA 4N4QA 5MHBA 5F4SA 2YL8A 3VKKA 3VX0A 1TPVA 3I7SA 4AXNA 5LYRA 1XKYA 3UWWA 1N82A 3OLGA 2I1OA 4IXHA 3RIKA 3TTQA 3HB9A 3KVMA 4FFIA 4DWSA 3NPUA 1ME7A 1X6UA 2QAPA 4HHPA 4GXPA 5A6KA 4PFMA 1F6PA 4LPCA 4KRTA 4UOQA 4DBEA 1HJQA 1UUOA 2G97A 1WB0A 4ALDA 3MSGA 1JR1A 5FK8A 4JD4A 1OK4A 5K4XA 2AC1A 1QNOA 3MV01 1ZNNA 1PIGA 3NUKA 4D72A 1EIXA 4H8HA 4JR5A 1F2JA 2EPOA 4D6EA 3M7SA 3CMJA 2G4FA 3NZ1A 2V38A 3DYMA 1X8FA 3WQWA 1W5PA 5CZKA 1I2PA 4GI6A 4N42A 4UOZA 1JZ2A 1SFLA 3HG3A 3S2CA 4BQ3A 3TA9A 2QR6A 1EUNA 3CIVA 3NG3A 4F9DA 2H3DA 3GVGA 2J6XA 3QM3A 1UR2A 3NSNA 4N0RA 3LXCA 3HGOA 2Z0IA 4GO9A 3G1DA 2ZZ1A 2E9LA 4BCEA 2VCAA 1EX5A 3BMWA 1I4NA 2ZRUA 4RLIA 3O06A 1OINA 1HX0A 1BFNA 5AN7A 3SGUA 1T0OA 2JIWA 4LS2A 1W5NA 3ELFA 2XFRA 5JBDA 5TQLA 2A4AA 1EWEA 1V08A 1CDGA 5K9DA 2CCRA 4Y6GA 2EJ1A 3F4VA 3L9CA 1DJQA 2GVJA 3JR2A 5ABGA 3NSMA 1HT6A 3DHDA 3WFAA 3NQDA 4DBDA 3W25A 2V8ZA 3M46A 1QAPA 3UGGA 2Y7FA 2FGZA 2WVVA 3QSRA 4IMGA 4ADSA 4MDPA 1AW2A 2R8WA 5ECUA 2AAMA 3UQNA 2FH8A 3LIHA 3NQ6A 1HG3A 4U3AA 3L5AA 4JY9A 3WK3A 1CLVA 3SGZA 1KM0A 4S1FA 3N1AA 4Q7NA 1SPQA 1BVNP 4W85A 1UR1A 3GNDA 2AEZA 1X1ZA 9CGTA 3FJ6A 4UMAA 2YKKA 1K3UA 3BGJA 4PCTA 2ZXDA 3SCNA 2J79A 3K30A 4IXXA 5J5RA 2ZX8A 4E2DA 4WSKA 1TPUA 1GVQA 1EDTA 1UYPA 1MO0A 1VCGA 4DEFA 5GPRA 1E6NA 2A2IA 2GJLA 3EEGA 3AISA 4PMYA 1OCQA 1Q6EA 3ZJ6A 3U1XA 1EP1A 3P81A 3WUFA 1SZFA 3KL0A 1W9DM 4D6CA 4NUWA 3WUBA 2WYSA 1ESWA 3SCSA 3PZ9A 3GXNA 1A53A 2TYSA 2QAFA 1W2TA 2W67A 1KM4A 1IXOA 4O0ZA 1LOQA 3RMJA 3NM3A 3ABOA 1LRTA 4PTMA 5M5DA 4UNLA 3UG5A 3LDKA 1GOXA 4HNUA 1IIHA 1XL9A 4PTNA 1G7VA 1EO5A 3VE7A 5FEZA 2GOUA 2A85A 4KWVA 1CENA 1R86A 5CGTA 1DTUA 3W7MA 3F4NA 4MJZA 3L4XA 1NWSA 3OLIA 4JL1A 4JZ5A 5E0CA 5IBXC 4AIOA 3GAYA 4S2BA 1KWGA 4Z1BA 1WBHA 5AY7A 2WC7A 3TDFA 3IJ7A 3W7RA 2Q3RA 1JAEA 2YGYA 4IMCA 4H8VA 1J18A 4XKYB 1E0WA 3PN8A 5DXXA 4R27A 4P7RA 4J28A 1KGXA 2B7OA 3W27A 3ZT5A 2BHUA 1K03A 2PWHA 2E68A 4O12A 2VFGA 3S1WA 3M43A 3W1LA 1JCLA 3UZJA 4R5EA 3MKKA 4FNRA 5CSSA 2W4XA 3CZKA 4HMEA 1T99A 4FXSA 4XUYA 1XD1A 4Y7EA 5M3WA 5BMXA 1ICPA 5BCAA 1O94A 4M19A 3ABQA 1BGAA 2D22A 1V3JA 3IIOA 3TIMA 1DWHM 3ZSTA 3WSUA 4CGTA 1OFEA 1V6XA 4DWSB 4H41A 1E6SM 3NQ7A 4LC8A 5A8MA 2NXIA 1N8FA 1F74A 3FJLA 2YDRA 4Q22A 5LNSA 1LL7A 1WAWA 2FHCA 3JUGA 2EGZA 2D73A 3WNNA 3NPWA 4RZ4A 2XUCA 1WZLA 2J7DA 3AHXA 3T2QA 3NQEA 1GVIA 1SW0A 1OX5A 2E6DA 3C2EA 1OX6A 4AD4A 2CLKA 1GONA 2Z1KA 5DBUA 5FF0A 3QOMA 1VCFA 3W3OA 4MB1A 5LNWA 4W7UA 3MP4A 3CHEA 4GUIA 5IDIA 5FK7A 1Z32X 3W2NA 2BVDA 3ECQA 4MUZA 1UR0A 2OWCA 4JYDA 3WH7A 4ZEPA 4RKAA 4Z0JA 3PR2A 1ME9A 2XFWA 3M5XA 2ZTJA 1XBXA 3RFAA 2D20A 1XI3A 4EF8A 1MSSA 1M03A 1KGUA 2DT3A 1UKOA 3TONA 4GUFA 2ZUVA 1EP2A 2WVSA 1MFUA 1KM1A 3YPIA 2PC4A 1R87A 3THQA 2P0OA 3NO5A 4RZ5A 1VEMA 4ZE4A 1LJYA 1V7YA 1L2UA 5FCZA 4OKDA 4LV9A 4WJEA 5BRPA 3U57A 5F4WA 3TXZA 1JFXA 3W7LA 4V2XA 1YXDA 3DXIA 1H2JA 1R46A 3VINA 2BXYA 3WQVA 5D03A 3GNRA 2CLFA 4AD3A 1MQRA 3QH2A 1S5TA 3W2JA 3GAKA 5KMYA 1EA9C 1KBKA 3AICA 2A21A 1R2TA 4ACZB 3W7JA 3LCFA 3W86A 5AC6A 4BZYA 3O6YX 2ZA2A 3TE9A 3NR0A 1HVQA 3LTSA 3O6DA 3GH4A 2X0HA 2WSKA 2BZNA 1DWAM 1MFVA 4HN4A 2ZZ6A 1E1FA 3O16A 1C3FA 3RJYA 2QCFA 1FWWA 2QQVA 5CJ5A 2ZXQA 4HOZA 3VILA 4LWWA 1KCKA 3FFSA 4JX4A 3FW6A 1HJUA 3BXWA 3IIXA 4NNBA 1YADA 3W7DA 1SO3A 3OVRA 3OBAA 3GDKA 3LF7A 1BF2A 4GC4A 4OGZA 4UMBA 5A95A 1W32A 1C92A 1XUZA 2EEXA 3T4CA 2V5DA 4PTXA 3L66A 4RE3A 5BXTA 4TVDA 3RLVA 2HSAA 5I3FA 3RWKX 3G1VA 5HINA 2O9PA 3ZQ9A 4LYRA 4AEFA 3BAYA 4MKNA 2BLEA 4QQ3A 5E93A 1TO3A 1VAHA 2JGYA 4LQ1A 2ISWA 3VE9A 3LHUA 2QHAA 3VPLA 3TJLA 3H55A 5I3GA 1QI3A 3IGUA 3VO0A 3MBDA 3PULA 1LWJA 4N6FA 4M81A 1SO5A 5AHFA 4HNNA 4LT9A 3QGVA 5E0KA 4TX6A 3RMEA 1R2RA 1J0ZA 2GQ9A 4A2SA 2BXVA 4CD6A 1OYAA 2V5LA 1E6PA 1AW5A 3S1XA 3GDRA 3RJXA 5EFFA 4NRSA 1BG9A 2OWWA 1MEHA 2V2HA 1WYIA 3C56A 3GM8A 5GVJA 4AWTA 2TAAA 3GTNA 3G8EA 2A3BA 3EDDA 1X7FA 1KXQA 1F76A 4AMCA 1K9TA 2X30A 4CN4A 2ZX6A 3P74A 8A3HA 5AYIA 3WMBA 5I2UA 1VEPA 1SW3A 4K37A 2VNCA 4LY8A 2QMJA 4HMDA 3NQFA 1UD3A 2XVKA 3LFIA 3BG9A 4ACZA 1W8SA 5FMDA 2R14A 3FHQA 3B9AA 3AHTA 3GK0A 1JI1A 4MJMA 4S2CA 3MS8A 1UWIA 3LEMA 2JE8A 5FKCA 1W31A 5FIXA 5CG0A 4WKAA 3UWUA 2J7BA 3S8HA 1K8YA 5HR7A 1Q6CA 2OYKA 2ATMA 4FX6M 3W38A 2G3IA 5JUVA 2XN2A 3EX6A 3VM7A 1QI0A 4L4LA 2DP3A 2CIPA 4H6KA 4AZ7A 2QMKA 4DPPA 2OMAA 1AQMA 4B1LA 1TJRA 1TPFA 1UQYA 1SSDA 5HWNA 4GI8A 2A3EA 2WPBA 2CLIA 3W7NA 1V5XA 3VD9A 4LS1A 5I3HA 1E4MM 1KM5A 5I3JA 3SW6A 5JBEA 4MFEA 1UZ4A 1H7WA 1EGZA 2NZLA 2FDSA 3VD4A 4FNSA 3JS3A 3NNTA 5IXEA 3HGJA 2A7RA 2A7PA 1OSEA 2J7EA 5KSWA 3CU2A 4X22A 5A5WA 1H50A 1EXPA 3PZQA 2ABBA 2V82A 3C6CA 4U2YA 4MY9A 3LHWA 3W76A 1VS1A 5HNRA 2VI0A 3SUSA 3TROA 1CEOA 5DELA 3P67A 1MW2A 2DH3A 3THDA 5AYXA 1QI4A 3WK2A 1LOLA 2A6NA 1V6WA 1JUEA 3CZLA 2CPUA 2I9EA 1B3OA 4PYSA 1JD9A 2YXGA 2WWCA 3W82A 5EB8A 3WKZA 1MXDA 2QJHA 2X2YA 4JIEA 1GG0A 2VZVA 2H6RA 1B90A 3G8RA 5BW6A 4L4OA 3U6WA 4YHGA 5E6YA 1K6AA 5CPOA 1W3TA 5FF7A 3BGAA 5ABFA 5HBFA 2WM0A 4C1KA 1WZMA 1CXKA 3AZSA 3OVQA 4LRSA 5EBAA 2GVGA 1XCFA 1BQCA 3MV11 5DBTA 3AS2A 3DFSA 3LRMA 4TUFA 3PS7A 4YHEA 3S5YA 4AEEA 2DH2A 2WOQA 2NW0A 3HGRA 2YYTA 5AYYA 5F7UA 2D0GA 1OK6A 4JKLA 1JDDA 4CNPA 1LG1A 1ZCOA 1WDSA 2C18A 1F4HA 1UA3A 1TQXA 1DP0A 4LV4A 3CC1A 5A6AA 4LYQA 2Y7DA 3S0CA 5CPTA 1C8YA 2WZIA 1H1YA 1KLZA 2NV2A 5LA2A 4O13A 2YL5A 2W92A 3VNYA 4AISA 2X1SA 2PCQA 1UR9A 4MTVA 4JFWA 4FNPA 1JCMP 3W2MA 3RPMA 3DC0A 2F8QA 4E4PA 1W0MA 1Y0EA 2EPKX 1FXQA 2DJLA 1E0VA 1GVSA 3PBGA 4FMVA 3TA6A 5IBXA 1OVDA 1L6WA 5ABTA 4FX7A 1EHAA 1VENA 1TTPA 1JQXA 5FIPA 2VX4A 3N2XA 1O60A 1KFEA 1Z44A 3PBVA 3LCIA 3KVJA 2DQXA 1WCGA 1MEWA 1US2A 2F2HA 1QO5A 4B9ZA 1GW1A 2EPLX 4W84A 4XTDA 5LGXA 1XH2A 2VR4A 2R91A 1UH4A 2FGLA 1H1NA 2CERA 3NCOA 3BLFA 3U7BA 2J4GA 4UMCA 1LL6A 4K6AA 4WY0F 1TPB1 2VX7A 3ATZA 4XZ9A 3STGA 1W9VA 1JYVA 1UWRA 3PG8A 5HPOA 4JL2A 3DFPA 5BXRA 1LF1A 5FESA 1LM1A 3ZSSA 2O9OA 3WDHA 1QVBA 1AQ0A 4WXZA 3UR8A 1UH3A 1OG0A 1EH9A 1WZKA 3M0ZA 1R85A 2C7FA 3BH4A 4WIWA 3N9SA 3C3NA 1ZJBA 1H62A 4WUIA 3IIZA 1OFRA 1W2PA 4UQEA 4CCEA 1FWNA 3M5YA 3A5FA 4N4PA 4UR8A 1CTNA 4GBUA 4A29A 1W3JA 2CBUA 2JF6A 3O9NA 1W5MA 3BG5A 3CMGA 1S5VA 4DPQA 1GYLA 1WDWA 4K8EA 3IIVA 4O54A 1GQLA 3QW4B 2BTMA 3CQ0A 4NX0A 1W1YA 3IAQA 1KFKA 3C52A 5F1VA 1FOBA 4EKJA 1Z48A 1ZJIA 2Z1BA 1G9HA 4DUXA 1UKSA 3G24A 4MB3A 4RE2A 1B2YA 2WCGA 3CUHA 4BI6A 4PMVA 1L0PA 3M7WA 4LRTA 5G4EA 2V3EA 4IPJA 3AXIA 3MSDA 3AMDA 2A0NA 4OZOA 1HFBA 3DH7A 1GZGA 3EX4A 4BI7A 1UKTA 5J5DA 1E4LA 1H41A 3NQ2A 4TTGA 1H3GA 3K8KA 1CGXA 1H49A 1ISZA 3SCVA 5FMBA 2ZTKA 3WEMA 3BSGA 3GR7A 3PTQA 1PE1A 4D6DA 3CB8A 3VIIA 1Z42A 4AD0A 1CIUA 1HJVA 3KEHA 3G0SA 3QSTA 3T55A 4PMDA 2GVLA 2PRHA 1QNPA 1GT8A 3WNOA 2E6AA 1TPEA 3CZJA 4K36A 2V5BA 5LNUA 3OVPA 1B0IA 4UR7A 4D1IA 2O7QA 3VMNA 1JF5A 4WKFA 1E9LA 3HU7A 4MJ4A 2YYUA 2C1HA 3DFTA 4K39A 3OLEA 5FOOA 4C1LA 4GFSA 3LLDA 1ZHAA 1CWYA 3BLKA 1YDNA 1KGWA 4UNIA 3NQCA 2R94A 5BXSA 2DT2A 3F5KA 3WK0A 2XGBA 5AC4A 3C2OA 2JBMA 1O95A 2YZRA 4UFLA 1FH7A 1J12A 3LDRA 2BY3A 3NGJA 4JY8A 4NQ1A 3AIWA 4W89A 1PZ2A 3W6LA 1E15A 2J74A 4PTVA 4UCGA 2DSKA 2VR5A 1ODUA 5G1YA 1E72M 4M6VA 2RKXA 1E6ZA 5HMSA 3RM8A 1RD5A 1VFMA 2CZ5A 2QUUA 1OHLA 1NQ6A 1XDMA 3OEXA 1H63A 3N34A 4J7RA 3CLMA 1NP0A 1W91A 3W74A 3CUIA 3F03K 2Z6IA 1YXCA 2EAWA 2QV4A 5C55A 5A2AA 1WAUA 2ZZ4A 4OU1A 2E5BA 4MB5A 1W1TA 1VYSX 4Z1CA 5G2IA 4UR9A 5D33A 4PL1A 1VB9A 3MMWA 3W88A 3WY1A 4YWIA 1C8VA 4JX6A 3N12A 4MYAA 4U5KA 1YLVA 4H3DA 3B4UA 3W70A 4ONVA 1D3CA 2WXDM 1UH2A 4OHQA 1NOFA 3WH9A 1VZWA 3KWXA 2E9MA 2Y70A 4UCFA 1RVGA 3SFKA 3T0BA 2F84A 3WEOA 3M07A 1YTEA 2HS8A 2NX9A 4NX5A 1R47A 1QI2A 3AYRA 3GH5A 3T09A 4RXGA 5DCEA 1GOWA 1X1NA 1ZALA 4CCDA 3U14A 2PI6A 3ARTA 1ZL1A 4EAMA 5K9XA 1SMAA 4P7NA 4ML9A 2W6RA 3RU6A 1E43A 3W26A 7CGTA 1ME8A 4RCXA 2Q8LA 1TTQA 3AIEA 4Y96A 2WZHA 2ZRWA 1W1PA 2YL6A 4HU0A 3STCA 1G1YA 1I2OA 3S5ZA 1OYCA 3NPXA 3RK8A 2ZRYA 3IGXA 3KHJA 4FO4A 2J9ZA 3TAKA 2WHMA 2VZOA 3PZTA 3P8IA 4OBRA 3PWAA 4JX5A 2WO5A 3IGSA 2VVNA 4K38A 3F4WA 1LYXA 1AL7A 2WHLA 3SR7A 3B03A 3M5ZA 4UXDA 2VL4A 1NP2A 3LERA 4WZHA 1GPFA 1MWOA 3PG9A 3VTRA 2PRMA 3LXAA 5FEWA 1OD0A 3WF0A 3PSWA 2BSLA 2GQ8A 2ZZ2A 2QEZA 2UY2A 4GIAA 4FHAA 2DT1A 4B16A 1P5BA 2CZEA 4P8WA 4JIQA 4DM1A 4AWEA 4A4AA 3ZR4A 1YQ2A 1DHPA 1G01A 3QYQA 3OLDA 5DT5A 5AHIA 2GPTA 5EYWA 3EMZA 1BSIA 2CNCA 2DZXA 1GVYA 4GUGA 1WP6A 4DF1A 3W6MA 1JZ4A 2ABAA 2C15A 2QJIA 1U2YA 1KLYA 1AMKA 3QPYA 4TVCA 1TA3B 1TJPA 3HGSA 3BO9A 4AZ5A 4B3KA 1H11A 3EX3A 2QKFA 4KWWA 7TAAA 2HVMA 2JALA 5AC7A 1GOKA 2WLZA 3L2LA 5E1QA 4NF7A 1JD7A 1ZU8A 1QCWA 3S1VA 4UZUA 4B3LA 3LBCA 1XM3A 3AI0A 2QLYA 3CPUA 1XDLA 4AAJA 3SCTA 3GXTA 4LUIA 4DF0A 4JFVA 5AC5A 3ARRA 1KTCA 1XYFA 3PZUA 2JEPA 2WZEA 1Q6OA 2WJZA 1TREA 3C61A 3FLUA 4MIMA 3EX1A 4I7WA 1I1WA 4IWWA 5BMWA 1XHGA 3BW3A 4WSJA 4Q32A 2GSJA 3VIKA 3WF1A 4A2RA 1W3KA 1QDSA 2DSUA 4PMOA 4Z2JA 1C29A 4OJYA 5HXMA 1BYDA 4QP0A 3HQ1A 3P5YA 1GOIA 1PIFA 4RE4A 3WELA 3L67A 4B1MA 5D9NA 3HOJA 4EK7A 5FEXA 4X9YA 4Z2KA 4AD5A 4AZIA 3OA3A 3V75A 3GXIA 3BAIA 4LU0A 3PHAA 3WD3A 1LRQA 3CUJA 3ZFHA 4DXVA 2FFCA 1NF7A 1GOMA 1KXVA 1MQPA 3DYPA 3M47A 3TSDA 2X16A 1MW0A 3H54A 5C2XA 3ATYA 1EDQA 3WQ5A 1J5TA 3LHTA 4KH2A 4AHQA 4EWND 4LVDA 1TR1A 3VGGA 5KZEA 1FDZA 5K7JA 5KTLA 3KE0A 1PX4A 4UTLA 4PCSA 3TW7A 2J8FA 2CXGA 1DJNA 1E3XA 1ZB5A 1TTJA 3VGEA 4LVBA 4O1BA 4W7VA 2YBTA 3TV8A 2XQRA 4I7VA 5KZDA 1GPWA 1BTCA 2YL9A 5LHFA 4QDMA 2O92A 2X09A 4O16A 4CCCA 1XSKA 2EPNA 4Y9AA 4MNLA 1Q6GA 3PUEA 2JFEX 1SO6A 4NJHA 5ANNA 1B9ZA 2JIEA 3TKFA 2QPSA 5ABHA 3MI2A 3PUDA 2NLIA 1HP4A 3NDZA 4QLLA 2F7FA 3NJ3A 2XIBA 3AZTA 3SUTA 1JZ7A 1E71M 1YYAA 2VCCA 5A1AA 2VC9A 1J0YA 1GEQA 4AVFA 4I7UA 1B3VA 1V3IA 1QW8A 5CPQA 1W3LA 5M03A
chains in the Genus database with same CATH superfamily
1W9SA 4HSLA 1DQ0A 3M0MA 3IWZA 1BKSA 4MOAA 4TXEA 3NKTA 5FZDA 3TEYA 3CGTA 1QK0A 2ZZ3A 2Z29A 3N14A 1CAUB 3CYVA 4GALA 2DZWA 3T40A 2E8YA 2WQDA 4IJRA 3ZXLA 2X1UA 3UY8A 2HYXA 1UD5A 3NL2A 5CA6A 1W3XA 2ZUSA 1YI9A 4H9UA 1W9WA 4D7TA 2MNGA 3IPVA 3NIYA 1RPKA 1RA0A 1RUJ2 2Y24A 3KBMA 2WR9A 4MWAC 3RYPA 2V5CA 4P8XA 4PULA 1N3QA 4C6IA 3J8F3 4Y1UA 3TR9A 3TU9A 3W0KA 3ZXDA 2DVXA 3ZLGA 3ARYA 1E0XA 1M41A 3C2FA 5ABEA 1NQKA 3BSMA 1IR2A 4JDOA 1N1SA 2XH4A 3WJSA 2NWRA 4CDXC 4I5XA 1DJZA 1BKZA 4C8DA 1A8DA 1KV5A 1RY8A 3AZVA 2G8ZA 2E09A 2NYYA 2D1ZA 5C0QA 4X9SA 4ADUA 2YGMA 2BS9A 1BEV3 1O7FA 4IF2A 3M6YA 4K6BA 1QOQA 3TYEA 3M0YA 1NFBA 2VFFA 2QPXA 5E09A 4W5ZA 1DYOA 3DPRC 3S0MA 1DJHA 5GLWA 2XUEA 1IEWA 4H6EA 1J6PA 5CSYA 2OGJA 4DNMA 3CTTA 2ZKNA 1TCMA 1TPWA 1OKQA 4NT0A 5D21A 4CP9A 1JVNA 3PBWA 3CEPA 4Y9MA 2DUQA 4HSOA 2WKLA 1TQ5A 1I2RA 4H00A 2WFF2 2HS6A 3FAXA 4Y4YA 4A6OA 1GOQA 2VZSA 1RP9A 2QYGA 3EGJA 1KTBA 1BTMA 1COV2 1MDLA 1UR8A 2VGGA 2A3YA 1ULEA 2I14A 4IEWA 4K7YA 2YJQA 4P61A 3SY5A 3VMPA 3TH6A 2B45X 1SFJA 5FUNA 2DVUA 1F5FA 7A3HA 1NWUA 1VLNA 2YU1A 4DM2A 1SSGA 2BP1A 4D7YA 4OVEA 1NOWA 3NL3A 4C6LA 1IWBA 4AWSA 4HKLA 1RUSA 1TA3A 3PZIA 1UWWA 3T07A 2DZSA 2ZZ5A 3HPSA 1TV2A 4CD8A 4HCLA 4MNJA 3ZVHB 4GZEA 2VOMA 2JG8C 3AFGA 1V0KA 1SMDA 2QPUA 3DFHA 4JXCA 5DRCA 5ECVA 1REEA 1OGGA 1SZEA 4CN1A 3EKZA 2CAVA 5FF4A 3ZWSA 3BAKA 3LTYA 4LCSA 1V6TA 3R0RA 1GWJA 3MZNA 3WINE 1UWAA 4RR4A 3SMHA 3MLJA 1VIWB 2ISVA 5T52A 4NR1A 5FEPA 2HWD3 3ARXA 3T0AA 4LE3A 4COWA 2YCLA 4B8EA 4POCA 4NAEA 5GM0A 2D44A 1WV2A 2HMCA 3R6SA 3H7VA 1EA0A 3E0VA 4O4VA 4HZMA 4AX6A 3LOTA 3WFLA 3PNAA 4KG8A 1QU0A 1MS4A 5K9YA 4AVNA 1J3PA 1NXMA 1QOXA 1FHDA 3R10A 4X2RA 4JKMA 3FIGA 1QJX2 1X39A 1QUMA 4H01A 2ZS6B 4NIDA 3VDDA 1AJ0A 1AR71 3FYOA 5DLCA 3W75A 1J2WA 2WJSA 3KS7A 2BB0A 4Z82A 2E1DA 2EIDA 1HL9A 2ZHKA 2V2DA 3W29A 4E5TA 5LY2A 4KBZA 1UX7A 5AOUA 5EMLA 4LT5A 3H3LA 4GPNA 5H6HA 3K5XA 4BFAA 4MJ2A 2CL2A 2Z2SB 3SHRA 5CGQA 3W85A 1G4EA 4M3CB 1RK6A 1CGTA 5JU6A 4PDWA 3KXQA 1X7IA 2VOKA 4PT6A 1PIV2 3OZOA 4XBSA 1EEPA 4XFCA 5DAVA 1SCSA 2FIQA 3EHKA 3LV6A 1XNCA 1B3WA 2CLMA 1TV4A 1GJPA 2FTWA 4O52A 2YA0A 2DDUA 3SKJE 1M04A 2GGJA 3CTLA 3T4VA 1V03A 5I6SA 2DFBA 1GVRA 3VA8A 3KRZA 4GGHA 2PHXA 2HRWA 5CIRA 3TC3A 3VX1A 4LO5B 2FDMA 2WT0A 2IKJA 2E28A 3OZPA 3ILNA 4HN8A 1G6CA 4WY0B 2ZC8A 3TB0A 1ONWA 4QEEA 3PTKA 1L6SA 2WKGA 4ATDA 2YW3A 1U30A 1DQ6A 3NW4A 2C79A 5D4YA 4MXWB 2PHDA 1MZ5A 1JF6A 3UWVA 4Y9PA 3M7AA 4P7OA 5D9MA 2OSXA 4DIAA 1H2MA 3GYCA 3AMLA 4NNCA 4IFRA 1KJLA 1BWLA 1VFOA 5J09A 3IS4A 4YXGA 5A2CA 3J9SA 2CYFA 3KP0A 2VMIA 3WNMA 3AWOA 1TJ2A 1W9XA 3BWWA 1Y9MA 1DQUA 3S6DA 4FAMA 1EQPA 4E2GA 4GZIA 2QCLA 1XB9A 3MKVA 4GKTA 4NUBA 3M44A 4EAYA 2WJFA 4US6A 2VFIA 1MS9A 1Y5VA 4OQVA 4AD2A 3V0AA 1NA1A 1EZ2A 3H7RA 4OUMA 2CETA 3OYWA 1Z89A 5XIMA 1YKWA 2HV5A 3FKRA 3V0BB 3WQEA 4AC1X 4BWLC 5EMKA 2BV4A 3EMCA 4LBQB 4IL7A 1BG4A 4HANA 3P80A 1TV8A 2FKPA 1NCQA 4AHZA 4OOUA 4CCKA 5JAXA 5C54A 4JFTA 1S3TC 2D6NA 3WBEA 5CFCB 1DJWA 2FDGA 3URBA 3DFQA 4IEZA 5C5YA 5K8SA 1KR0A 1AH4A 1H4PA 5IYYA 5K0UA 4XKYA 1CZ1A 4WSHA 4QDRA 3ACFA 3S42A 3PJTA 4GH4A 1UD4A 2REQA 4F7ZA 2WINB 3BUVA 1E70M 1FX5A 3U2ZA 1I5PA 5XIAA 1JI6A 1H7NA 2OG9A 3KAOA 1X9PA 1DPMA 3WZ1A 2A6LA 1HGWA 2PTXA 4IJBA 3SUVA 3LOIA 4IFKB 3E6EA 1ZA7A 4KWLA 4J3VA 3C7HA 1KRMA 1XIHA 3OGSA 1XC6A 2RDXA 3ZYZA 2EXHA 1FUYA 1HNYA 3CKHA 2QIWA 3H8AA 2X29A 1H1IA 1ZS2A 3V4BA 5XINA 3URAA 1AR62 4FSJA 4CQAA 1M7XA 3BAJA 5FBJA 1DIKA 3POHA 2XHNA 3T0DA 4NU7A 3QZEA 5CPNA 3GB6A 1HTIA 4L9BA 4US5A 4Z07A 4HKPA 2VFEA 1TEIA 3TJXA 4U5IA 1KQYA 4AZCA 4AFDA 3WH5A 2BW8A 1UY4A 4YYCA 4F2BA 4CDQA 3IZOA 1YQ5A 4Y20B 5L36A 4F8AA 4GQ0A 3UEQA 1J1TA 1IG0A 4GK8A 1FWGC 4PSRA 4BK5A 2H9AA 3PUSA 4DUVA 2LM3A 4LBRA 4JDNA 4W8LA 3O7UA 1V3HA 2RM22 4IQEA 4IX0A 4MDOA 3NAPB 1V3KA 1QT1A 2Z1WA 4FNUA 1CB7B 5FPUA 1BVWA 4WLCA 3TR2A 1Q4NX 1XPYA 1G67A 1GWMA 1FVPA 4C6BA 3TNQA 4XILA 2W27A 2VYOA 1ZBE1 5I0RA 3GUWA 1PJ9A 3V1PA 3TN6A 3DYOA 1C8M3 1PK6C 3PJUA 4BQ1A 2Z1VA 3AZXA 3CL8A 1QJZA 2UZ9A 5FZKA 1EF2A 3W1RA 3NNGA 2GDVA 2FZ9A 3N13A 1J96A 4YM1A 2FDIA 1LQAA 4RUBA 1DORA 1JG9A 3VC5A 5I23A 3BOWA 3NMBA 2RH9A 5LKYA 1FBAA 2J9YA 4XJZA 4NRPA 1KKRA 3N9NA 1IHMA 1H60A 3IK4A 4ZTYA 3CT2A 4BR1A 3TEZA 3ZT6A 3A22A 3MEPA 3OYWB 4JHMA 4QCFA 3ARPA 5CXPA 1HP5A 1GVOA 3ZS4A 2X1IA 4PJYA 4MB4A 3R7MA 4F83A 2GGGA 4GXLA 5GZGA 2VENA 4O50A 1CGUA 1O66A 2ICSA 2BVBA 4Q4Y3 5I0DA 5FY4A 3P0XA 2SLIA 1OQDA 1OQFA 4CVWA 3BKZA 1RAKA 1RHI1 2WA3A 2O9TA 1K12A 1O5RA 1VYPX 3TCSA 3I65A 1NJJA 1E5SA 2PTYA 4QB2A 3HG4A 2IS7A 4LVFA 2PAKA 1Z7S1 4YVSA 3TAYA 1GP5A 3OIHA 4PA8A 1MEC2 3H22A 4HPKA 1PM4A 2E6YA 5DMYA 2FJUB 3ON7A 2BQPA 3L0NA 4NNAA 2RVAA 2OZ3A 5LW9A 5BV6A 2GQAA 4LNCA 3LAGA 1OFBA 5IVCA 4H6RA 1DGRN 2EPMX 3WQ6A 3FX3A 3APGA 3KCXA 4PMUA 4NVTA 1PX8A 4GMP1 3JXSA 1NAL1 3D5HA 3W02A 3WEZA 2BOJA 3EEZA 5FD0A 3H4GA 4LBJA 1PYMA 3CZGA 4I5UA 1AJOA 4ZQRA 1EC8A 3WQBA 1U5HA 1WO2A 1XRSA 1ADSA 4UTWA 3WLJA 2Y33A 3T2OA 2DU1A 4DJDD 5H91A 2VX6A 1PHWA 3L2IA 1J9YA 3VNDA 4QNEA 3LPGA 1WNOA 3UNTA 4LK6A 3RCYA 5C8WA 4EPDC 4YNIA 2RR13 1UZ0A 1W56A 4N43A 1HKKA 1CAVA 1J11A 2PTMA 1W99A 3PU8A 1VHNA 3MJYA 4Y9NA 1HO1A 4MAVA 2B46X 3H8RA 3FZ3A 2O56A 4Y1YA 2MNRA 3EXRA 4GH1A 3USBA 3MF9A 1ZLPA 1YNAA 2NN8A 5FYYA 3MMDA 4H9ZA 4IM4A 4ZOEA 3DERA 4WJ8A 1VHCA 5HQMA 4BQXA 3V5OA 1OIFA 3WD0A 2WMGA 3NO1A 4JFUA 3FK4A 3S6PA 1US3A 3F5LA 4WV8A 5A32B 1EQCA 3SB0A 4KGGA 3BVCA 1WW5A 1KTNA 1VGAA 2I57A 4AZHA 5I02A 5E6ZA 3VBRC 2PBOA 4AIBA 1J01A 3FA3A 4YG3A 1ENQA 3QV7A 2DPEA 1WKYA 1O6IA 3MI3A 5EKYA 5TAOA 3VKBA 1VRBA 1O3QA 1AMYA 2WO1A 4PBPA 1SJBA 3UL2A 3N2BA 3KRSA 4IGSA 3QXBA 4HP5A 1V02A 5CZTA 3I10A 5C9UA 1ZP3A 4PLOA 3GTFA 3E0IA 3UJSA 2GJNA 3BL3A 2FDJA 5AB3A 1BBT3 4AHXA 4DZGA 5IW0A 3ITXA 1WLDA 2QQJA 3TTYA 3W5NA 3W1QA 2FMOA 1FWRA 1BLZA 4YYOA 5F4XA 4V28A 3N6QA 4A35A 4KQ7A 5C70A 3K75B 4IMFA 3PY2A 2XIIA 3QW3A 4LPLA 1OFQA 3ABRA 1XH0A 1W2NA 2EIGA 1FWAC 4O8AA 1UWQA 1H7XA 1JHNA 2ONEA 1PIIA 3GDLA 4C5ZA 1KXTA 4PBGA 3AZYA 3T6CA 1VBGA 2DV0A 2BGSA 3I97A 4Y22A 2ZVRA 1ZBA1 1GW9A 2HBXA 3L4VA 4PUEA 3W2UA 2OLSA 3ERPA 3N6JA 4CD5A 4DO4A 4HPKB 2UYBA 2CWNA 3ARUA 1OLRA 3NO3A 3THAA 1AL22 2C9AA 2EAAA 4BM8A 4HZ6A 4GCXA 3PVBB 3EWWA 1KBBA 3E5BA 1XLAA 3R6IA 4O1CA 5IUQA 2YG0A 2RGLA 1V0MA 5F3IA 3ZYBA 1EPVA 4JNMA 2YFZA 1A0DA 4KCWA 3AIRA 4H2AA 4JKKA 1LHNA 4LVAA 3EMQA 2JKAA 2QUVA 4WGHA 1EYEA 2VOVA 4Q8PA 3CBNA 1W5OA 3E97A 1S39A 4QFUA 3MZHA 1H1MA 1PCWA 4IQDA 3S46A 3VLBB 1B3YA 3W1MA 4NWWA 2OWXA 3R8HA 2UWFA 1ZBVA 3JB4C 1BEV1 3WH6A 4Z1DA 1DEDA 3POSA 5K9CA 1PTGA 2K2SA 3W6YA 4ZO8A 2WCSA 3P0WA 4O19A 4DWSC 3LY0A 3LA3A 2XN0A 2V81A 3E3HA 2OCZA 3UNPA 2RMU3 4WVXA 1Y5WA 5M17A 4AIEA 4LUMA 4LR4A 2J7GA 2ZCGA 2QJJA 2OT1A 3KZPA 3GXDA 4PEKA 3ARZA 2DW7A 1W28A 4ATEA 1TPDA 2AMXA 5EBUA 3IDBB 1LROA 3AMNA 4Z0SA 3VNJA 2YCIX 2PF0A 1FWSA 4ZQPA 1V8EA 3WUGA 3BLPX 5JIWA 4HJFA 1W9TA 1ND3A 2D3PA 1GK8A 3FNDA 4G7FA 4U3CA 3Q8BA 4MGQA 5D37A 1GZ9A 2QQOA 1RVF3 2PDHA 4V27A 4M1BA 4OTKA 1NWTA 3VAVA 1K5MA 4H4IA 5FZFA 3SCWA 5CPMA 3PVOA 1TYGA 4Y1ZA 4QE5A 1KW1A 1WCKA 3WD2A 2FLIA 1S3HA 3VFLA 2YC2A 1K7XA 3W22A 1PGW2 5I00A 1AFSA 4EF9A 1Q2SA 4DXXA 5LHEA 2XR4A 2OU4A 3OTRA 5FPBA 5CKNA 2DZAA 2PWDA 3HZ3A 2V69A 3QH6A 4EV0A 3VDHA 4E38A 2ZX1A 2Y0OA 4UTKA 1O5XA 4AC7C 5L6UA 3QQWA 3UPWA 1UOGA 3OJBA 1E0UA 2VULA 1YBQA 4L7ZA 3RLHA 3WDYA 1RC6A 4RV8A 3N29A 3WV6A 2JE9A 1BKHA 2LTNA 1I5ZA 1R30A 2QQKA 4AVBA 5IFPA 2DSVA 3B9DA 3PTMA 3BCDA 2VE1A 1RCXB 1XKJA 1KBJA 2RS33 1PDZA 1V6IA 1S38A 3I4KA 4FF7A 4YWSA 2OYZA 3CJXA 3OD0A 2K46A 4QHZA 1UOBA 3B69A 3PDQA 4Q4Y1 2OSYA 3ZXEA 1CGVA 4M56A 3EO6A 4EE9A 4NG3A 5DCDA 1Z3NA 4M6QA 2X2GA 2KA3A 1KA9F 1J4EA 3A4XA 3I6TA 3SJNA 4ZFCA 2XYLA 4U33A 2E8ZA 2P10A 1MS0A 2X42A 3WDXA 3LSCA 4AL9A 3UERA 4JS3A 1IPSA 3B00A 2NPIA 4P5YA 1AD1A 3VGBA 3MUXA 1TNFA 1YTDA 4MOZA 4COYA 1KNWA 2A6VA 4E27A 4W87A 3UWZA 5KC5A 3C8XA 1B35C 2NT1A 4G9PA 1K77A 4ZOAA 2XPJA 1XCXA 4NZ3A 2ZQ0A 3SH3A 3W7IA 5FBZA 1CGWA 2DW6A 2OS2A 3VKDA 3BURA 2CSGA 3AXMA 4M4PA 5IHRA 4YL2A 1KQZA 4QKFA 1ZZCA 5CBLA 4K7VA 3GLCA 1U22A 5FL0A 2ZICA 3PNUA 5C9AC 1OFDA 3OYXA 1REFA 5FWEA 5DDJ2 1SGJA 8TIMA 1NF0A 1G86A 3USZA 2O0TA 5A2BA 1FCVA 3HWJA 2QQPA 3RI8A 3J8F1 3ARWA 1GQJA 4WZFA 3RVHA 2R1PA 4EZHA 1UYZA 1AL8A 1XRUA 2CBVA 3EWZA 3DUGA 2Y6KA 2WNZA 1C8M1 4MADA 5I77A 1HXS2 5I78A 1EWDA 3V36A 3LGDA 2UY4A 3THPA 4RHV1 4RQPB 5KHKA 1TZ9A 4O57A 4X8PA 4YARA 1VFFA 1VB4A 2IWGB 3UD6A 3BIEA 2ZMKA 4MLJA 2ACQA 4OZXA 1A3WA 4UFHA 3TC7A 2D6MA 5G4WA 3HJRA 3WQ4A 3VIMA 3QKEA 1JIBA 1E5NA 4HVXA 5FJPA 3LPPA 3AYCA 5FV3A 5JXIA 1NX9A 2JDZA 5A3HA 1AZ1A 3HT1A 2OFJA 1QHPA 3DHFA 4WBBA 2XL9A 3DHUA 3GC5A 3VI2A 1JTZX 3NNMA 5G4HC 1Z69A 1YEWA 1E57A 1H2NA 1F6YA 4UTTA 1YHFA 3WW3A 3OVGA 5AHMA 5HUOA 2GK1A 1P8JA 4HOWA 1HVXA 4LS0A 3ES8A 3IUHA 4JTKA 1OGSA 1W3NA 4H9MA 3G1YA 1BQPA 2R49A 2XWEA 3MP5A 2VZTA 3ZZ1A 4XSLA 1K7EA 1W8OA 3TTSA 5DY2A 4L6HA 4IMAA 3CXOA 1M06G 1JFHA 1XLCA 4FLQA 4H04A 2P5BA 5D04C 3QV6A 3L21A 5HULA 2FD8A 2HTMA 2R16A 3BCFA 3RRAA 2PHUA 3GHMA 3WZ0E 4XBJA 1CXLA 4Q0SA 3U78A 3AU2A 1CAXB 2WM1A 2PWFA 5J36A 1WKDA 4AVCA 1TMHA 5CB7A 1XYBA 1BVZA 1RUI3 4QS6A 2Q8DA 2PYTA 2PBGA 2PWVA 1W9FA 2VURA 1E4IA 1HV0A 1JCXA 2QDDA 5REQA 3NNJA 5HJXA 1VBRA 3QKZA 4L65A 4Z92B 3SIZA 1W37A 2VWTA 4GVIA 3KF3A 3VOGA 5DZFA 3RRXA 4G7EB 4BIOA 4K40A 2FQIA 1TTIA 3P3NA 4GMP0 5FZ3A 2J9XA 4S23A 1K8XA 3NNLA 4KIEA 1RV8A 2YXSA 2XWDA 4QXIA 3UWQA 3PIGA 1UF2C 3FWEA 2RDQA 4QROA 4F66A 3AJXA 4FQ4A 4LIVA 2QS8A 4Q7IA 3FYPA 5C8BB 2R1MA 5FZ1A 5GJNA 2BBVA 3K4AA 4ATFA 4O1AA 3RZKA 1P0BA 1VBD3 2XISA 3JZEA 4P14A 4TV5A 4BQ2A 4CUGA 3GIQA 3I49A 3E2QA 3MVTA 3NZGA 4IEPA 3D4KA 2CESA 3CO4A 5CCZA 3THUA 3HBLA 2P34A 1KM3A 2HXTA 1BVP1 2WO7A 5D8ZA 3STFA 3T78A 1LBLA 1JNEA 2Y5SA 4AXOA 2XVGA 3DZ1A 1D3HA 4GI4A 2FGBA 3G1FA 2WMJA 1PBGA 3NVTA 2HQAA 3SQOA 1YIPA 3ZN6B 4E3VA 2LUWA 4ERAA 1G69A 3O1SA 4HLTA 2J22A 3I7QA 2QZ2A 2EBNA 4RPQA 3RITA 2XGIA 3LHZA 2IXLA 3O0XA 3UCDA 4BF9A 3ZFGB 1AVBA 1RJQA 5CSRA 3CUZA 4CNOA 5LATA 3H8OA 5G5IA 2PURA 4IXLA 2QCNA 4QITA 5FSEC 1VCVA 1O1HA 3BAXA 2WWSA 4CQBA 1IG3A 4M0NA 1AH3A 3WLRA 4OOZA 2GALA 1PZ3A 5CISA 1TJ0A 1QQP2 4C91A 4GB32 3M1ZA 4IQPA 5I8YA 4F0SA 4W6YA 3A21A 2RS32 1OBAA 1N8IA 4D6FA 5LWBA 1GZJA 1W1VA 2YZ5A 5F6KA 5EXOA 3WF4A 3NJYA 3VBUB 4KRZA 1FV2A 4C1XA 4LOSA 3F7JA 3WQ1A 1GJUA 3CU7A 1J0KA 1VRH1 4X60A 3UWEA 3SCRA 3C7GA 4GUHA 2E5CA 4P00B 4F48A 2E9BA 3AHVA 4IOTA 3OGJA 1LLWA 1SVDA 4EVZA 1WPCA 5BOFA 1YDVA 1UX6A 1BGGA 2E33A 4L1WA 2NQ5A 2HNHA 1GORA 1W3HA 3IWPA 5EL1A 5ACA3 3QF0A 2XGZA 4CEXC 3IPVB 4BXFA 2F6KA 3L4YA 3A4WA 2C19A 4W4QA 4R34A 3N15A 4O0QA 4J4KA 5FO7B 4M3CE 4OMDA 4DRRA 4BLIA 1O8PA 1M65A 2G3NA 4RGGA 3KV9A 4IIEA 1AR93 1XQNA 4KFOA 4IDZA 4F3JA 1PO12 4O9EA 3KWSA 4YNGA 1PVXA 4P7QA 1S1AA 1V02E 1LOBA 4XDOA 3QFEA 3S6OA 3WLIA 4JIPA 2XJUA 3NEVA 4DJFA 2X8KA 3PZMA 4GVHA 2RR11 2UWAA 1NFGA 1EJXC 3O1NA 4PIXA 1LU1A 1Q3EA 2YCKX 5U4NA 3CEUA 4FPGA 4O14A 3WX5A 3EBVA 3WLMA 4B4FA 3BYWA 2PHWA 2J1VA 3AYTA 3QBUA 4U2ZA 3WDQA 2PMWB 4XAYA 1ZSXA 3EWCA 3Q2DA 1WW7A 3PBYA 5IM51 3NDOA 1IZJA 4EE2A 2JECA 3UR2A 1PB0A 2GJXB 3O6AA 5CLWA 3G2GA 2OZ0A 3K46A 2DIKA 1QO2A 3LM7A 4GNJA 3JD71 1DOSA 3BSHA 2OB3A 7TIMA 3EDKA 2HBTA 2PN5A 4UUIA 4CXXA 1XPGA 1GZWB 3VBOB 3UG3A 2XGXA 2R6QA 3FDGA 2OR2A 2GFTA 3K2OA 5FYUA 3M0IA 1VLWA 1CNVA 4HGXA 4K68A 1CB2A 4GY7A 2FPVA 5JCTA 3S1UA 1QHOA 2ALRA 4FALA 4JIIX 4N6EA 5G1TA 1W6QA 3Q8EA 1QNWA 4QXKA 4C1WA 5U7SA 4GXMA 5C3SA 4FI9A 3WBWA 4GYJA 2DY3A 3ZLIA 3GC2A 4UFMA 4BPZA 1W6PA 3REQA 4OT7A 3ZM8A 2GZXA 3AAMA 2VXNA 4XIMA 4M01A 2YL8A 5MHBA 3VX0A 1TPVA 1N82A 1CPNA 2I1OA 1NFPA 2AR6A 4NPMA 3E6BA 4RGAA 4E8GA 1SLTA 2OZ8A 1AH0A 4X61A 1GWLA 4ALDA 5C4WA 4JD4A 3IJDA 1MQTC 4D72A 1X8CA 4JQAA 4Q8UA 3GGLA 9XIAA 3ETQA 3NZ1A 4LAZA 4GQBA 2OOGA 1NTHA 4C65A 3NSNA 3RPTA 3T9PA 3SH5A 4GO9A 4BCEA 1EX5A 3RDIA 1R5YA 2ZA9A 4LUYA 2VTXA 4LUSA 3B3QE 2CDPA 4COVA 4NIGA 1BFNA 4IHCA 1S5MA 3GG0A 1W5NA 1UOJA 5TQLA 1CDGA 1AR73 2GVJA 1DGWA 3NQDA 2V8ZA 2C9KA 4CYDA 2EKGA 1A0CA 2FHRA 1IS4A 3UQNA 4PQQA 4QE1A 2ZBJA 3LBOA 3RR1A 4JY9A 3RG6A 1UY2A 1OPMA 2TUNA 2AEZA 1X1ZA 9CGTA 4LBNA 2YKKA 2RS11 1K3UA 1UYYA 4WSKA 1S2TA 4E2DA 1MO0A 3HQUA 5GPRA 4DEFA 2A2IA 2O1QA 5A7OA 5FZLA 1OCQA 5I09A 2ZMNA 4ZS3A 4D6CA 4NUWA 5A6TC 1ASJ1 2WYSA 1ESWA 1A53A 1UIKA 4UW6A 3IRSA 1KM4A 4O0ZA 1Q8JA 3UG5A 2JG8B 1G7VA 3VE7A 1O91A 3GBWA 2GOUA 1R091 5CVRA 1CENA 5CGTA 1DTUA 1QASA 3W7MA 5E0CA 1KWGA 2WC7A 1W8TA 5IK7A 4R9BA 4PDWC 4QQ2A 4V1PA 4IMCA 5LZ6A 1VPQA 4RFT0 1E0WA 5DXXA 1KGXA 1PVC3 4QHOA 5KXBA 1I0DA 1SFTA 4ES9A 4OQ8A 4O12A 1TX2A 3S1WA 1JCLA 3DPRA 4ET7A 4YFZA 3RCMA 4A8IA 1QJU2 2W4XA 4XUYA 4Y7EA 3NRUA 2QDRA 2VH9A 4M19A 2QQIA 1BGAA 3ABQA 4D7SA 3ZSTA 3WSUA 4CGTA 1V6XA 4XUPA 3RO6A 1E6SM 3NQ7A 4LC8A 5A8MA 1F74A 4MHUA 4GACA 1OVSA 1LL7A 1H9PA 4ZO9A 3WNNA 3KMHA 1AZ2A 2D73A 3NPWA 2OX4A 4RZ4A 1WZLA 3AHXA 4FOVA 1GVIA 4LOTA 2E6DA 1RUD1 3UBPC 2Z1KA 5DBUA 5JXHA 4DZ5A 5FF0A 4Q0VA 5LNWA 1XIEA 3MP4A 1AXKA 3H21A 3R94A 1JYIA 4MUZA 4QJ4B 2HWE1 3VZMA 2QT3A 3PR2A 3M5XA 4IQJA 2WS91 4XMIA 1XBXA 2D20A 3LEPA 1FHUA 1M03A 1KGUA 3TONA 4JEJA 1K42A 5IWFA 4ZXEA 3ZXAC 1KM1A 3SEEA 1J79A 4IV3B 3THQA 2P0OA 4ZE4A 1LJYA 1V7YA 4WJEA 5BRPA 3U57A 3TXZA 1PM7A 2XINA 1YXDA 3WDUA 1H2JA 1ND2A 3CIHA 1R46A 4ISQA 2BXYA 4XFHA 3GNRA 2CLFA 4MUPA 3AICA 3GAKA 1EA9C 3W2JA 2K9ZA 5KMYA 1NYWA 2A21A 3NV3A 3LCFA 1ODNA 3W86A 5AC6A 1HVQA 3NR0A 4LUTB 2X0HA 1MFVA 4HN4A 2DQWA 2ZZ6A 1VBD1 4LJHA 3RJYA 2J1AA 4MGSA 2GSHA 1KCZA 3IIIA 3BLLA 3MKCA 1R1ZA 3GDKA 4OFGA 3LF7A 1BF2A 1V6LA 1W2OA 4E2SA 1C92A 1MDRA 5LIYX 4S3AA 3RLVA 2HSAA 3TOYA 1XICA 3RWKX 2VMGA 3G1VA 3SADA 2LW8A 3BAYA 2BLEA 3AVRA 1JDEA 2QHAA 3VE9A 2Z79A 3VPLA 1UOZA 3TJLA 5I3GA 4S3GA 1HGYA 1LWJA 1BZWA 2ENRA 4LT9A 3MB9A 4TX6A 5E0KA 3RMEA 4CD6A 3H8XA 1OYAA 2A6YA 3VZKA 3MW4A 1VBHA 5EFFA 1KBLA 5CBJA 2OWWA 4D8LA 3UR5A 3RSJA 4AWTA 3KBSA 1X7FA 2PDLA 3QYSA 2X30A 1LOAA 2ZX6A 3P74A 1EZWA 5I2UA 1VBE2 4K37A 4CNUA 3AL5A 5EV7A 2Q30A 1C1LA 4AI3A 1DCSA 3NQFA 2J8TA 3BG9A 4J40A 5FMDA 5AVPA 7ENLA 5CFDA