4UFMA

Mouse galactocerebrosidase complexed with 1-deoxy-galacto-nojirimycin dgj
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
644
structure length
640
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
publication title Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
pubmed doi rcsb
source organism Mus musculus
total genus 207
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ufmA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ufmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ufmA01
1VBUA 2VR5A 1SW0A 1J0HA 2VZTA 3B8DA 2ZUVA 1SSGA 5J5DA 2QCGA 2ZZ5A 3DYPA 4AD1A 1JZ6A 1QO5A 4K39A 1CECA 1QFEA 4J28A 3WIJA 2CHNA 2C1HA 3I3EA 4LC6A 3SCVA 4W93A 1D3HA 4UQEA 4XUGA 1X6UA 2NWRA 1OK4A 3MP4A 2RDWA 2PWDA 5HDRA 4EAMA 1VHNA 1EDGA 4MPKA 1H7XA 1E4MM 3C4UA 2Y85A 2XSBA 1SZFA 3NQ6A 2VMFA 3FW6A 2Q3RA 3T7VA 3QOMA 1VF8A 1UR9A 2B4GA 4HHPA 5CPMA 3TC7A 3O05A 2J7CA 1KGWA 3ARVA 3OLGA 1OYBA 2D2OA 1W5MA 1JZ4A 3HG5A 3LTPA 4TMCA 4RE4A 4Y9AA 5CZKA 2FQIA 5I77A 1UOKA 3TKFA 1JDCA 3W37A 1WX0A 2XIBA 5D9NA 3GTNA 2OSYA 2C16A 1UR8A 4YXGA 3SUSA 2IXUA 2WCGA 3IJ7A 2C19A 5AOUA 5LHEA 4UTWA 3A5FA 3NDYA 3OB8A 2QPUA 1JZ7A 3AQUA 5F4XA 1JXKA 3MBDA 1A47A 2E8YA 5DELA 3SSJA 3VMOA 2I1OA 2QDGA 3A5VA 1CXHA 3L0NA 1TZ7A 3UQNA 2G4FA 5BXRA 2NLIA 1V0LA 2CKRA 2E9LA 1QNVA 1ZBKA 4HPHA 1SMDA 1SFJA 5EMYA 4FX6M 1UG6A 4DWSA 1EX5A 4O0ZA 1MW1A 5CGTA 2WC7A 3MV11 4IX0A 2ZXBA 4OE7A 5I3HA 3W7GA 1EP2A 2CBIA 3M5VA 4QCEA 3WY1A 6CGTA 2AOSA 5CLWA 3TQKA 2H8ZA 3W1AA 4LGXA 1M7XA 2X8RA 1H51A 1HP4A 1JZ5A 1UQZA 1BGGA 3OIHA 2VXNA 2CESA 4GFSA 3QJAA 1V02A 1B0IA 3F1QA 2VI0A 1JZ2A 1OB0A 2CITA 1OFDA 4P7RA 4EOUA 1UH3A 4FIRA 8A3HA 1XD0A 1ISVA 4O4WA 5D30A 3UWVA 3APGA 4JKKA 4A2RA 3ZS4A 1C91A 1Y4WA 1NWSA 2Q3OA 3S5NA 4X0NA 1D9EA 4AZCA 4ORMA 3BCDA 5HPOA 2A85A 4PTNA 2DZSA 5A6LA 1MFUA 1OD8A 2VNCA 1D3GA 5HUPA 1TTIA 1UR1A 3UWYA 4OJYA 4H8VA 2NV2A 3T2PA 1EDTA 2X16A 3DH7A 3R89A 4ZEPA 4UR9A 1E70M 3EDKA 3PZUA 3N3MA 3EWWA 4PEKA 4D2JA 3UWWA 1J0JA 2QMKA 1DORA 2XVPA 4MNKA 3VX0A 3WDPP 3CPUA 3DENA 4HPJA 2WLZA 3EWYA 4FX8A 5FKCA 5DXXA 4S3JA 1RQBA 1XYFA 1ZCOA 3U57A 4JTHA 2GDUA 5LNVA 2ZRYA 1R86A 4Z2HA 4H8UA 1F05A 3VINA 1CGVA 2GVGA 2CXGA 4P61A 1GOWA 1M04A 3WEOA 1CW2A 2XHYA 1TIMA 2VTFA 4XWUA 2RGLA 2VEMA 4JYDA 1GG0A 1VBRA 2X1TA 2WCAA 2OYKA 1ONRA 3UERA 3HG3A 4CKQA 3LPOA 1E71M 1K8ZA 2R94A 3IIZA 3QRHA 3ARWA 2GOUA 4M6PA 3T55A 2O9OA 3I7SA 2WVVB 3PZIA 2WO5A 1WP6A 4H04A 3SUTA 4B3LA 1BSIA 3WUFA 5A6AA 3WBEA 2BHYA 2CLOA 5BWFA 1P6WA 1ML1A 1EP3A 1N7KA 3M7WA 3KZSA 3VIFA 3VTRA 4Z2IA 4K6AA 3UETA 3I68A 3PVFA 1CPUA 5G2WA 1YADA 3NQ7A 1JDAA 3G1HA 1WAUA 5BRBA 2C3ZA 1TA3A 4IM4A 4UR8A 3MU7A 4CUCA 4K8HA 2YLAA 1ZAHA 1OX4B 1CZ1A 1M53A 4WKHA 4XX6A 2DIEA 1A5SA 2TSYA 5TIMA 1MQRA 4AZ6A 3IMMA 1B4EA 2ZX7A 3OZPA 4U28A 1HG3A 5D2XA 3UD6A 5FL0A 1AVAA 1B3OA 2XM2A 3CIWA 5KZEA 3BPWA 3EB2A 2QHAA 5D04C 3UR8A 2GJXB 3G6MA 4DUWA 5IFPA 1RH9A 4TVUA 5E9AA 1EIXA 3CEUA 2QUVA 5DY3A 3W76A 1VHCA 3CHFA 1GTEA 5CSYA 1FH9A 3UPWA 3IVUA 3AIUA 5G1TA 1JNEA 3LPGA 3HIJA 3FAXA 4F8XA 4GBUA 2G95A 4Z2JA 8TIMA 3IEBA 1UASA 1BTMA 3LF7A 3BG5A 1A5BA 2ZTJA 3DXIA 4MKNA 4AZ5A 5LGZA 4CQ9A 2DT1A 3AIWA 4MB1A 2D20A 2VCAA 3G3MA 1L6WA 3FJLA 3QHMA 1GUVA 4GI6A 4YN5A 1E6RA 2Q8XA 2P1FA 1BKSA 3B05A 5F2LA 1JUBA 4W9TA 3GK0A 1D7FA 3TSMA 1G6CA 1SMAA 1V0MA 4HP5A 3TXVA 4YLWA 2ZZ7A 3CC1A 3RJYA 1S5WA 1HFBA 3ZWSA 1E6SM 5DMYA 1YPFA 3T0BA 1DWAM 3LHUA 4IWWA 2XFFA 3WEMA 3AXIA 5ABHA 2FDSA 2B7PA 1ZJBA 4W8BA 3ALGA 3W22A 1FXQA 3O8AA 3HOJA 3QW4B 5MHBA 2EPLX 4JFVA 3S1WA 1M01A 7CGTA 2PB1A 3LIGA 1FUYA 4D6EA 3EX4A 4YL2A 3BGGA 5E09A 5BCAA 1GEQA 3B9AA 1PV8A 3NQDA 2WANA 5CPTA 1E51A 5I3IA 3PG8A 3CU2A 4ADSA 5CQ1A 1UBSA 1XH2A 4BWLA 3WELA 5FK8A 2YL6A 1YQ2A 2GVLA 3AISA 4M81A 5IHSA 1W9UA 4XTIA 5HWMA 2GFTA 4CNPA 5BYWA 4EWND 3PBUA 5FEWA 4CNNA 3CZLA 2NX1A 5DFAA 3LB0A 3ARRA 3C2VA 4LQ1A 3A21A 3C56A 2IQTA 1ME8A 1VCGA 3DAQA 3IRDA 4ONVA 1Q4NX 1EGZA 3CO4A 1KM2A 2QCNA 4OV4A 4Y90A 1UD2A 3NYDA 4KGLA 5BXTA 1J11A 4ACZB 1QNQA 2CFFA 1TRIA 1WKYA 4JL1A 3AIQA 2DGAA 1WBJA 2JGQA 4GWEA 1E6PA 2BY2A 1NM9A 2DH2A 1QAPA 2XJ7A 3P5YA 1FWNA 1V08A 3UWQA 1VRDA 1E6QM 1KTBA 4TX6A 5G5IA 4JKLA 3L66A 3JS3A 4FB7A 5KZ6A 4DBDA 2FH6A 1RD6A 4IQLA 3CUGA 3WQ8A 4AZBA 5BMXA 3NYZA 1E0WA 4E0CA 1K9FA 2QLYA 2V3EA 2V3FA 1ZBVA 2J7EA 4R27A 3II1A 5G2HA 4JTTA 3UYCA 2QCFA 5GVJA 2DJXA 3TE9A 4P2VA 4HZ7A 3WD4A 2QCEA 3AMLA 1ZU8A 3LIHA 3U1XA 4GE8A 3MO7A 2ZUSA 1NAL1 4Y6GA 1XCXA 5DT5A 4MADA 1KCLA 1SW7A 5AC4A 1TTQA 1K03A 4MB3A 4B5NA 4OU1A 1L9WA 1Z41A 1P1XA 1XBYA 3PZ9A 3PTKA 4GINA 3WD3A 5LKYA 1VEOA 2VRKA 3HJEA 2XVGA 2Q8ZA 3F4NA 3BK0A 2QMJA 3UXDA 2ZRVA 5KITA 1ITXA 4QAWA 4B15A 5DCBA 4EQVA 1IIGA 3EDDA 4WXZA 4Z1DA 3R8RA 2V30A 2BS9A 4J3XA 3RLUA 3S1XA 1ST8A 2BSLA 1XCWA 4HNTA 3GBDA 1OABA 4QFUA 1XBZA 3POHA 3GXMA 3FYPA 2PC4A 2XVNA 1ZB5A 1WCGA 2BVDA 3GDLA 3IIPA 3NNTA 4X0VA 3CUHA 1CDGA 3NJ3A 1F7BA 1E0XA 2QCLA 3GLCA 1LRNA 3MMDA 1WQ5A 3VILA 4FEZA 4L4LA 4NNBA 5F1VA 5M03A 5IDIA 2HS8A 1QO2A 5TD4A 2ZA3A 4X9YA 2BY1A 3EX1A 3VMNA 2VRQA 4ADUA 3O6YX 2B31A 4U3CA 4TIMA 2VR4A 4L4MA 5F7UA 1XBXA 2TYSA 1EO5A 4NI3A 4ZENA 5A8NA 5I6SA 3S9YA 1UCWA 2XTKA 1I4NA 3A23A 5DN1A 2A3HA 3O07A 2WNQA 2BVYA 5EMUA 4B3KA 1BWLA 1TJRA 3BAYA 1W1PA 1E5JA 3L67A 1LLOA 3PC0A 4IMCA 4CN4A 4U31A 3C2RA 2WNNA 4TMBA 5CLTA 3HMCA 4UNLA 5FEZA 5AFDA 2VQTA 1HJVA 5D9OA 4MAVA 5IBXC 1B90A 1ME7A 1HJXA 2OT1A 3KVJA 2J4GA 4F66A 1TCMA 5HOSA 5CZTA 3RMEA 3NQGA 1TPB1 1RZMA 2RH9A 1PZ2A 4IMEA 3WJZA 3NR0A 2J7HA 1GOXA 3GAKA 3GM8A 1I2PA 3WQ6A 1GPWA 4O18A 1NWRA 3W7DA 2E09A 3FY1A 1DQXA 1TREA 3QMSA 4M6VA 5LYRA 5D09A 1H50A 3W7IA 4L4OA 2DP3A 4MZ8A 3O6DA 1I2NA 5DBUA 2EO7A 4E8DA 4KFNA 1TMHA 4OOUA 4HPXA 3LLFA 2ZZ3A 1DBTA 4IXXA 1NP0A 2W67A 1TPWA 4PBGA 5BOOA 2XVKA 4QLKA 3UGFA 1A3HA 5AYXA 5M17A 4JHOA 2YCEA 3LRKA 5HBFA 3U8GA 1OFBA 1EA0A 1QI2A 3UCQA 4C1LA 3Q94A 4ZQCA 3W28A 3W1TA 3W6MA 5A8MA 1KQYA 1JF6A 4BQ4A 1PE1A 4JTSA 1UB3A 5KINA 1R2SA 1CIUA 2QF8A 3AYRA 3EYPA 3F5LA 3OVPA 4AWTA 3CHEA 1H1YA 2ZX5A 2E6DA 2VFIA 3PZMA 2CWNA 1VEMA 1QI5A 2EGZA 2VT0A 1DHKA 2WXDM 4FLQA 4O1DA 1JVNA 2VOMA 3PBWA 4JX6A 2GUYA 5D8ZA 4YMZA 3F4WA 1X6LA 3WDHA 2XWDA 2J77A 3LCGA 1GQIA 1B3VA 1CEOA 4UTKA 3BAXA 3W87A 1E43A 3KL0A 4D6DA 3LHVA 4R34A 3P82A 5CKSA 4C1KA 1LG2A 4BR1A 3W07A 1RPKA 1HO4A 3NM1A 4JAWA 5A3HA 4A3HA 2QQVA 3UZ5A 1JJKA 3W82A 4OV9A 1OX6A 2CLIA 4S3KA 3OA5A 5DCEA 4HNUA 1VEPA 2WJZA 2VJXA 5FEPA 1DTUA 9CGTA 1VH7A 3W2JA 1BAGA 4UTWC 1EUAA 2VX6A 2ZX9A 4BQ3A 1PIIA 3P81A 3MS8A 4W85A 5A6KA 2VFGA 3UY7A 4DF0A 2CBJA 4P8VA 4U2ZA 3WNNA 5DBTA 1LG1A 3GNPA 1FHDA 3C3NA 2XSAA 4NJKA 2Y6ZA 4HZ6A 2RHGA 4Z08A 2NXGA 1UD6A 4QP0A 5C70A 5EFDA 1NSJA 4TX9A 3W9ZA 2DH3A 3W7RA 1KFCA 2ISSA 3M47A 1K9DA 3G18A 4DWSC 4IOTA 4HXCA 3L21A 1KXQA 2AMGA 4P7OA 3TONA 3WH9A 3GKFA 1HX0A 1KM1A 3MI6A 3BSHA 5GPRA 4CQAA 1QI0A 1DQWA 2VL4A 1Q6RA 1ZAJA 2KZHA 2YYUA 2RDUA 3WQVA 3O63A 3MUAA 3LXBA 3HPSA 2GVJA 2PI6A 5ANNA 3LCHA 3AS3A 4HKPA 3WSUA 1JI2A 1I2OA 5LNSA 2CERA 5A2BA 4LT9A 3UWZA 2C7FA 5BRPA 5JUVA 3QPZA 3HG4A 4RV8A 3W83A 2W6RA 4UNKA 3CUIA 3T0AA 1HIZA 1YPIA 3SZ8A 3NQMA 1AMYA 1X7FA 4M19A 4RK8A 3KFTA 3M5ZA 3LDVA 5AHEA 1L6SA 2NW0A 5IHRA 3LRMA 2E0PA 5EYWA 5LA0A 4K38A 1GVIA 1D2KA 2ZWYA 3RIKA 1EDQA 2W5FA 5EY5A 3GXDA 4N9EA 2VEIA 3FIGA 4BI7A 1BQCA 3WFAA 5M5DA 1C8VA 4K7YA 2E8ZA 4WIWA 4N9BA 2DU2A 1HJSA 2XG9A 3LRLA 4QITA 5AHFA 1W1YA 3N12A 3CT7A 4HSNA 4V27A 3U14A 1V3KA 4DUVA 3TCEA 4AB4A 1FWTA 2AEZA 2CCRA 2OSWA 1CTNA 2QAFA 4PTXA 4WKFA 1FQ0A 3BVJA 3SCNA 5HWJA 4HMDA 3W7JA 1OFRA 1LTDA 4M5PA 2DZUA 3DHDA 3LTSA 3SGZA 3W7CA 3BAIA 2WPBA 5DF0A 1N55A 5AYZA 4BF7A 2NX9A 5HINA 4AYSA 1KFBA 1H61A 1XCFA 3LEMA 4MFEA 1JL8A 4R5EA 3VGGA 3MP5A 4W84A 1R7AA 4NZCA 3W1QA 2X1IA 2OWWA 1FWSA 3P8JA 3GH5A 5A69A 1LLWA 3O16A 1IZKA 3CBWA 1V6YA 3CQ0A 4UCGA 4GNJA 1UHVA 1BHGA 5HR7A 3WF2A 2PWEA 3NL6A 3OG3A 3VD5A 1H7OA 4XQ6A 3B0UX 1SR9A 4DUXA 4PMOA 4TX8A 4DM1A 4S2CA 1YTKA 1VR6A 3HF3A 3P60A 4WXYA 3AXHA 3IAPA 4IUGA 1XDMA 3QMTA 2OLHA 1G69A 2CU0A 1C8XA 1J0ZA 2OWCA 1KM5A 3S42A 5FEXA 1L2UA 5LNWA 1EB3A 1TQJA 1QNSA 1E40A 3WNOA 2VEKA 2EXOA 3N04A 1OYCA 4M7SA 3LHWA 1V6XA 4KWUA 3PR2A 4U3AA 2QF7A 1FDJA 5ABGA 4D72A 3BAWA 1B31A 1K6AA 2E6FA 2F8QA 1VQTA 5I3JA 2Z1SA 3EWXA 1O5KA 3M07A 1NEYA 2C8NA 3KE0A 4JY8A 1YTEA 1P5BA 4GKLA 1BYBA 4LW7A 2CIPA 2YGYA 4GUFA 4MYAA 4QISA 4W5UA 2OXBA 2JKAA 5T26A 4OT7A 4ZMGA 3G8RA 1HT6A 1KXHA 2XVLA 1T99A 4PCTA 3SECA 3U5YA 5I79A 5IFTA 1GTHA 1JCYA 2V2CA 3ZJ7A 2VENA 4MB5A 4FFIA 3W29A 3INPA 1KBKA 1UKQA 2DJLA 3DECA 1DV7A 2B7QA 4WK9A 2Y7EA 1L0PA 4JTUA 1V6UA 3SCSA 4R7JA 5E93A 3HGOA 2WMIA 3Q2DA 1JRBA 2QCDA 4EF9A 1GHRA 3SFKA 3L5LA 2VFHA 4AEOA 4CVUA 1TV7A 2HTMA 2DIJA 3C0JA 3P67A 5CZ0A 4ZVJA 5DY2A 3EEGA 4W88A 4K7VA 5LNRA 4AF0B 2DT2A 3UWUA 1C29A 4OZOA 3EKLA 2ZFAA 1C93A 5M3WA 5G2IA 3TMQA 5FIXA 3TFCA 4MY1A 3AIBA 5CPLA 4P8WA 4LS0A 1KFEA 3CTLA 3GKAA 4ZZ9A 1KR0A 2WMHA 2WPGA 2YFNA 3LHYA 4Q32A 3E1F1 2GJNA 3WK3A 2J8GA 2XGIA 2VZVA 1HVXA 4QLLA 2WZHA 3EMQA 1E15A 1PCKA 3UEQA 2NSXA 4NRRA 4LUJA 4BWLC 2W4XA 1H62A 1J18A 4MAZA 3ARYA 2YDRA 2C0AA 3PUEA 2E6YA 1RPXA 1TPUA 5LA2A 4IMGA 2WMGA 3A4AA 1OF8A 4AZGA 3UG4A 3PAJA 1B9ZA 4F9DA 1JYNA 3LHZA 3DKJA 4MJ2A 2E1DA 1KBIA 2DZPA 1Q6OA 1SR0A 2D23A 1DVJA 3TH6A 2E9BA 1W91A 4CU8A 2OCZA 3RF9A 5CSUA 2UY5A 1GPFA 3OGVA 3PBYA 4IMFA 2Q8LA 3B8SA 4PSPA 3VNDA 3ZMRA 1FCBA 5EA9A 1XH0A 3LV5A 1BLIA 4ZQRA 5KZDA 1B3ZA 1XD1A 4AZHA 3AJ7A 3TROA 1HKMA 4A2SA 3NSNA 1UWIA 3PTMA 3DU0A 1QR7A 2ZUUA 3VGEA 3BGAA 3HJZA 2VRJA 1TPC1 3BC9A 3MO4A 1DP0A 2C15A 1SFSA 2PWHA 3N13A 2DZVA 4PRWA 5A6MA 2WV8A 5U7SA 3W0KA 1EO7A 3DBPA 4Y96A 2FPTA 2X1UA 3UG5A 2AGKA 4Z0SA 2ZRUA 4UMCA 2WKJA 3TFXA 3PHAA 1OFPA 1TV5A 1CBGA 2QV4A 5G4EA 1VFOA 3W53A 2JBMA 4FLSA 4PUEA 3VKJA 2W62A 3BO9A 1XKYA 4J9JA 4A21A 2OJPA 1CGUA 1XL9A 1YTDA 1ZAIA 3ZJ6A 1PX4A 4YHGA 2J7GA 1XC4A 1SO6A 3WJWA 4U2YA 3N9SA 3P5ZA 5D9MA 3L5MA 4O11A 1CXEA 2J74A 1IXNA 3BLIA 1W3LA 3RCNA 1YXYA 1L8NA 2GDVA 1S5TA 2G3MA 3HPZA 5FKBA 1M7OA 4AZ7A 1Y9GA 4AD4A 2ZZ2A 1JDDA 2J88A 1TTPA 1JCMP 2WMFA 2ATMA 3L4VA 4YHEA 2A3EA 1JAEA 3CUFA 5K2ZA 3MKKA 4JEQA 1FOBA 1V02E 1WO2A 5E0KA 1O4UA 2CZ5A 3KX6A 2ABBA 3TX9A 4MNMA 3E9AA 1Q6FA 1DWHM 4JCMA 4XUYA 3PY2A 3CEPA 5FI8A 1GYNA 1E4NA 4D1IA 2YXGA 1MQPA 3TTQA 2QQWA 4ZQOA 4BK9A 2TMDA 1WAWA 4QQ3A 1CWYA 6TAAA 4WOQA 1BVNP 1I1XA 3PBGA 4PMRA 1PHWA 3P61A 1VGAA 5DO8A 2WHMA 4A3YA 4AW7A 2H6RA 4D6CA 1BG4A 2PRHA 3BLPX 1GJPA 3IAQA 4EE9A 3W70A 3WBAA 3P80A 1H5YA 5F4SA 5CXPA 4U5IA 3S5ZA 1W2PA 2DZTA 5I0DA 4UFJA 5K4XA 2QR6A 1B30A 2WWDA 3B9DA 2E68A 4GI8A 2ZWZA 3ZQ9A 2BXVA 3LBCA 3BW3A 4N9DA 6TIMA 2ZXAA 4N0RA 1W3IA 1PPIA 4E2DA 4WLCA 3VDHA 2QCHA 4X9SA 2YBUA 2C14A 4I7VA 3W2LA 4FNTA 4LYPA 4R53A 2XGBA 2PURA 1GOOA 3G1AA 2NX3A 1C8YA 3MJYA 5J5RA 4HIBA 4NZJA 3C8FA 2X0HA 3ZR4A 1OF6A 3O9NA 1GT8A 1EA9C 3CHDA 3CWOX 4PFMA 1IV8A 2DSZA 2YW3A 3G1VA 2OT0A 4AH7A 2ZX6A 2C6QA 3ARZA 4EVZA 3QGVA 4TVCA 3ZFHA 4IPJA 1MW3A 2O9TA 3PWAA 3FKRA 2J24A 3G1DA 4DO6A 3ZO9A 4AEFA 1WYIA 2GPTA 1GVQA 4FX7A 4Q4KA 4P7NA 3FJ6A 3HB9A 4ZQNA 1OGBA 4DO5A 4HMEA 2Y63A 2J25A 3G3DA 4ZXOA 3SW6A 2NT0A 1IT0A 4AISA 5KSWA 2B0MA 1DEDA 1EWEA 3B06A 4IX2A 4CU7A 2HISA 1LOLA 1AW2A 2E5CA 3AO0A 1KTCA 3MP3A 5FF4A 1PX3A 3SJ3A 3LPPA 1YDOA 4E38A 5F2GA 1LQ0A 1QI3A 3CZGA 5EBUA 3LMYA 1W9BM 3N34A 1ZBCA 1G1YA 3U75A 1LRQA 3PS7A 1TPVA 1Y0EA 1QHZA 3ATZA 4PTVA 3WMBA 4AEEA 5HPCA 1G4TA 3NQCA 1LZOA 3G1SA 4NVTA 7TIMA 3WKZA 1MXGA 6A3HA 3M43A 5HMSA 3OLDA 2RKXA 3WD1A 1JYWA 1B3YA 1W5PA 3E96A 3TC6A 2R91A 5A2AA 1JG9A 3THAA 1JXJA 4UFIA 3OBKA 1ZL1A 2NUYA 4MIMA 2Y4SA 1UR4A 3UXAA 1VJIA 2FB3A 3KAOA 4O1BA 4RZ6A 1I2RA 2VC9A 3CIXA 2YW4A 4JICA 4HOXA 4ADTA 3P62A 3AHYA 3MI2A 2XFYA 1MZHA 5K9XA 1Q6LA 1U33A 4RCXA 2E77A 4FFFA 5C55A 3KL3A 4XV0A 3P7YA 5D38A 4J3VA 2V82A 1EWDA 1CXFA 3W2KA 2FIQA 1W5OA 1DWFM 1B9BA 3T40A 3AHZA 3MMWA 1H7PA 1QPNA 5BXSA 1OVDA 5HR6A 2JKEA 5E6ZA 3VIOA 4WKAA 1KXTA 2BXZA 4O28A 1LCOA 3VIGA 1XXXA 1E1FA 3LFIA 1KA9F 2B7OA 4KRUA 3OEXA 2J9ZA 1W9XA 1AG1O 2DPEA 3BMWA 3D3AA 3AIRA 3L2LA 3IVTA 2D0GA 2WAGA 2C0HA 5E6YA 1W9PA 3WNLA 5I3DA 1W5NA 2GJPA 4Q7NA 2CZDA 2O92A 3TTSA 3LPFA 5E1QA 4D6HA 3B4UA 3ARSA 3L2IA 1I1WA 3G8EA 1QOQA 4AWSA 1GVYA 4JQTA 1TVNA 3ZWTA 4NNAA 5F2MA 3S6DA 4JN6A 1W2VA 3L4XA 3K4DA 5C2XA 4KMQA 1OT2A 1OFAA 1WZMA 4GZIA 5CSRA 1ISZA 1UH2A 1WDSA 1M6JA 1ZHAA 1QNOA 5ABFB 1J12A 2UV8G 4AHQA 1OK6A 3U5UA 2CEQA 1LM1A 4PMYA 1PX8A 4Z2GA 1O94A 1W3HA 3HU7A 3WN6A 1QW8A 3RPMA 4CCCA 4ZE5A 2XN2A 4WD0A 3T09A 4O1AA 4JTIA 3ARQA 2YA1A 3L4WA 4PTWA 3IK2A 4O13A 3CZKA 4BS0A 1SO3A 5D2WA 4LXFA 3LM7A 3TP4A 4AZZA 3GVGA 2CBVA 2VCBA 1JZ8A 4RXFA 2AEYA 2CNCA 3DFTA 3VIHA 5I23A 4TR9A 3ZSTA 3LX9A 1JYXA 1ZENA 4LVFA 4AVFA 1QPOA 3G1XA 4JTKA 2Z6JA 4LWWA 4NNCA 2JE8A 1W8SA 3NG3A 1YXCA 2ZYFA 4G1KA 3RFAA 3BLKA 3FN9A 1K02A 2GUUA 3TIMA 2WLYA 4QM1A 3CLWA 4IPLA 3VGFA 2WMJA 4UFMA 3PIJA 3S8HA 2ZZ1A 3V1PA 1NF0A 4DQWA 2JIWA 4GPNA 4MOZA 2WVVA 3AIEA 4P7QA 3B04A 4U4MA 3C2OA 5EPDA 1W54A 3DKLA 4NJJA 1B4KA 2J7BA 2FGZA 4EKJA 2BHZA 3MANA 5E0FA 3RK8A 3NQFA 1MW0A 2WC4A 3S1UA 1H7WA 2XFWA 1F74A 3E49A 3VFLA 3O1NA 2J79A 4HMCA 3WUGA 1TUXA 3CLMA 4MDOA 4R33A 2BTMA 1XC6A 2D24A 1KFKA 4POCA 1E3XA 2JF6A 4HZ8A 5AC5A 1TVPA 1K9EA 3KOFA 3WD0A 1IXPA 1RQEA 4OBTA 5KZMA 3YPIA 4UQCA 1OX4A 3NO5A 1E56A 2YYTA 4LC8A 2EEXA 3GXPA 4PL2A 2J75A 2VUYA 1OWQA 2GQAA 4XBKA 4D6IA 5ECUA 1V6VA 2E40A 4FF5A 3OLIA 3QR3A 5AYBA 3AIVA 1F6PA 2VVNA 3W1NA 2G8ZA 1E1EA 3GH4A 3L9CA 3TAOA 3F4VA 2GJXA 2V3DA 2F7FA 4MZ1A 3W7PA 3W6LA 4IGHA 1J2WA 1IF2A 2PRMA 1K7EA 3K46A 3NPWA 2R8WA 4QIUA 1PBGA 4CN6A 1H63A 1NOWA 2XUCA 3IIVA 3ABSA 2VZOA 3ZT6A 1CGTA 3SY5A 1W9VA 3N17A 4J3SA 4YCPA 3P84A 1QHOA 1J9YA 1JQVA 4JD4A 3KF5A 1TPDA 3TK7A 1JCXA 3VD7A 3DI1A 1O5XA 3WFZA 5AHLA 5D33A 1DWIM 4O1CA 3VMPA 1SSDA 1PS9A 2CLKA 3GDMA 4CVWA 4HNNA 5K7JA 1C7SA 2HS6A 1UD3A 3EWZA 5A6BA 1SPQA 1K9TA 3IJ8A 1QBAA 1OCQA 4W8AA 3TTOA 1UYPA 1JIBA 1PAMA 3AS1A 1F5ZA 2BFGA 1LBMA 3WUEA 1QVBA 3MUXA 1W1TA 3QPYA 1G01A 3ELFA 2W0UA 3W7NA 3NSXA 5FF7A 3USBA 1E72M 4N2YA 1E55A 1JQXA 2WHKA 5A94A 5A8OA 3AXXA 5D4YA 2F2HA 3CB8A 1VLIA 2WVTA 3KVMA 2ZOXA 5I3KA 4AMCA 3OVQA 1NH6A 4HOWA 4AMAA 1RV8A 3IV3A 4Z0JA 2G5WA 3Q58A 1ICPA 3IGXA 1GQKA 5HNRA 5I3GA 4S2BA 1ESWA 2QEZA 3M6YA 4UQ9A 2V0TA 3W7MA 2AQWA 1KM3A 2YZRA 2G3NA 4AD0A 1HTIA 4J3UA 3HGRA 3KWXA 1I75A 1P0NA 3N9KA 4PCFA 3HBLA 3BAJA 3UGHA 4UTTA 4ZQPA 3PB0A 1NARA 4C7FA 3F5KA 3UESA 5FMCA 2BHUA 3AS2A 3EMCA 3VM5A 1KV5A 2QJIA 3W27A 1DJQA 2NZLA 1A5AA 4JTFA 1PHQA 1BG9A 3W25A 3WMSA 4D71A 3AHVA 4JTLA 1VENA 4ML4A 5DEZA 4FNQA 2QJGA 3WQWA 5D32A 2RGMA 1C7TA 5HXMA 2A6NA 3MMTA 3R5EA 4RE3A 3RDKA 4MJZA 2ZXDA 3WJXA 3WQ4A 3NPVA 2VO5A 5ABTA 4MLJA 5BW6A 3GDBA 3S2CA 1E6ZA 1V0NA 2OYLA 1JYVA 4MNJA 4N6EA 3PB2A 5A5WA 2W61A 4Q22A 4O53A 1R7OA 3KHJA 5GNYA 4ATWA 4UC5A 2EKCA 1KW1A 5CGQA 1QWGA 1UZ4A 2E4TA 4ACZA 4JFSA 3A24A 5D02A 1ISWA 4Z1AA 3WDRA 1EXPA 1ZJAA 4XZ9A 3DFPA 3CZJA 1NWUA 4NXKA 3WNPA 4DF2A 5I5RA 3C61A 1HL9A 3M5XA 4KH2A 2FTPA 4K36A 4DM2A 1DJNA 3AICA 1HXJA 3ABOA 1V3LA 1R2TA 4OGZA 2JIEA 1W3JA 4JTGA 1LL7A 4KRTA 5GQBA 1B3WA 3P8IA 2WW5A 3SR7A 1O6IA 4LVGA 1MQQA 1HF6A 2J7DA 5DCDA 3TW7A 3W1PA 1LORA 2W92A 3STEA 5LSMA 2FHFA 3CMGA 1FFRA 1XYZA 4GO9A 4MJ4A 1OSEA 1KGXA 1V3IA 1Y9MA 1AMKA 1AQMA 3K1DA 5HQEA 3IJ9A 2A6LA 3WH5A 3LERA 4WY0B 3KF3A 1QCWA 4EF8A 1VS1A 4Q33A 1PIGA 2WHJA 1V7YA 1W31A 2DZXA 1HJUA 3U6WA 1BYDA 4DWSD 2VFFA 3M9YA 2E9MA 3QW3A 1MWOA 4QLJA 4O8RA 3MI3A 1KFJA 2WNZA 1K8XA 1FCVA 1NFBA 2NUXA 3ZJKA 3T08A 7TAAA 1QNRA 3G0UA 4RKAA 1H0IA 3BLEA 4X2RA 2UY2A 1ZNNA 2NXHA 4N4QA 2PWGA 2Y7GA 3GXTA 4ZL1A 3AMDA 3STFA 3RM8A 4LTSA 5CG0A 2WYSA 1J4EA 2J8FA 1ZY9A 5K9DA 2Z2UA 1B2YA 1BYCA 1GOIA 3RLVA 1G0CA 1GQJA 1WZLA 4E4PA 2ISWA 2CZEA 4NJHA 1XUUA 5AN7A 2IUZA 4JY9A 4HA4A 1X8FA 2BWGA 5K3VA 1HJWA 2WVSA 1R87A 2JALA 4L4PA 1OBAA 5E0CA 2Y24A 2O7QA 3LCIA 1E4IA 5CG7A 1BF2A 1RVGA 2EPHA 4UTMA 5FF0A 3AS0A 4UOQA 3DGRA 2UWFA 3NXFA 3FKKA 4JCLA 3VKKA 2CLMA 3KRZA 4PMQA 4LS2A 1XH1A 4O50A 2QQUA 5BROA 2O7SA 4FFHA 1CX9A 4FMVA 4PMNA 3FHQA 3UR7A 4H41A 1R2RA 3S5OA 2GJRA 1H2JA 2J78A 3T2QA 1O60A 3FEMA 1CGWA 3POCA 3U7BA 1VFUA 1Q3NA 4BZYA 1TQXA 5GNXA 1K7FA 2XQRA 1QPQA 4OWGA 3WK2A 1OGGA 1DKWA 4DF1A 2A3CA 3R13A 2Y89A 4XKYB 1U5JA 3GDKA 4JFWA 3AROA 4QDMA 1LLZA 1GONA 1W3KA 2FGLA 3AMKA 2ZUTA 4WJEA 2O9RA 2GK1B 1LYXA 1W1VA 4TO8A 3LCWA 4O54A 2DSKA 4NQ1A 1QHPA 3NM3A 1H09A 3STCA 1AW5A 1UA7A 2DQXA 3RNDA 3NPXA 4NJIA 4LV4A 1E0VA 3VD3A 3UGGA 2F84A 3SC7X 1W2TA 1V6WA 3HN3A 1HP5A 3JRKA 4XZBA 4RZ4A 4TU1A 3T2OA 2TAAA 4MTVA 3VIPA 1XRVA 5U4NA 3AZSA 5DXYA 4MDPA 2D3LA 4W7WA 2ZIDA 4FK9A 4BQ2A 2A7PA 3ZT5A 3AHTA 4CNOA 3LCXA 4PMDA 1S5VA 3WJSA 1UZ1A 4ORIA 3MSDA 4B1LA 1VPXA 2JF7A 5AYIA 4CCEA 4GUHA 4D6JA 2AC1A 2FH8A 3A4WA 3AHXA 1FWWA 1KQZA 1WPCA 2BLEA 3GNOA 3L2MA 1TSIA 5C8BB 2RDTA 1U30A 1T8XA 2H8XA 1VAHA 3ARUA 4PMUA 4UQAA 3ANYA 1FDYA 4JTJA 3TXZA 1YDVA 3CIVA 3V75A 3MBFA 2ISVA 1OIFA 2V5LA 3TU9A 1TV8A 2FFCA 2Z6IA 1V5XA 4O57A 4UTHA 3A3HA 2CLEA 4I9AA 2XN1A 3LXAA 2YA0A 1PCWA 5D37A 2J62A 1KFLA 4DBEA 4PMZA 2C18A 3NGJA 2YL8A 4JFTA 3L4TA 1YHTA 1JNDA 1GVFA 3CPRA 4LPCA 1MO0A 3W23A 4AHPA 1GJWA 3A6OA 4AXKA 4QJ1A 3SCQA 3LI0A 2ZA1A 3C2EA 4GIAA 3EWUA 4JHZA 3B0VC 2CBUA 4AXNA 2R14A 2BZNA 2VFDA 4JIQA 1LL6A 3BMVA 4BI5A 3EX3A 1NQ6A 2WQPA 3MMUA 4CD6A 1G7VA 5BRQA 4AD2A 3TNOA 3CTTA 1WXJA 1JUKA 1OINA 1QNPA 2Z1BA 1EH9A 1GZJA 4FF7A 4O16A 4IJBA 1TPH1 6ALDA 4N42A 3W38A 4JR5A 3NL3A 4PCSA 3W7LA 3RILA 3N18A 4B9YA 1I8JA 4UXDA 4OBSA 5AYYA 3WEZA 4LNYA 4JX5A 1VJZA 1Z32X 5HWNA 2YPIA 2J27A 3CM4A 2CPUA 3W88A 1ZBWA 3I65A 3LTYA 1W0MA 1MYRA 2PRLA 1SO4A 2NV1A 1V03A 4UOJA 4DWSB 1FBAA 2UY3A 4OUEA 1E5NA 2PBGA 5CSSA 1GQNA 4M56A 4U5KA 4UOZA 5G1YA 3VM7A 2WSYA 3OHIA 5F1UA 3VUPA 1TRDA 1ISYA 2FHBA 4GO8A 2BX7A 2ZZ4A 4O10A 3W1LA 3M0ZA 1G4PA 2DT3A 4GZEA 2BVTA 3FLUA 1AL8A 2UY4A 2WM0A 4CD5A 3HQ1A 2YSWA 5TBOA 4U33A 5A2CA 3BG3A 3LOTA 3GYCA 1O7AA 1WDRA 2FDMA 1R46A 2RFGA 1XSKA 2V5CA 3AZTA 1HL8A 4ZE4A 3H53A 1JCJA 3N14A 2YA2A 2FJKA 3VNYA 2Y8KA 2DZWA 2Z0IA 4M24A 1HO1A 2J6XA 1MFVA 1UWSA 2G97A 3WH8A 4O15A 4HSOA 1J0YA 3I3DA 3NQ8A 1O95A 4MJMA 2J9XA 2A21A 1GOMA 3KL5A 2WZEA 3GYEA 3TTYA 1IIHA 3PSWA 1KWGA 2PCQA 2Y7FA 2H3BA 4X22A 4D1JA 3I7QA 3NL2A 3FOKA 5FF3A 3OGSA 4ATDA 3W7KA 2YBTA 3EXSA 1GORA 2H3DA 1C90A 2QDHA 3ZSSA 2ZXQA 2WC3A 4FO4A 3WL1A 2CLFA 3HO8A 4JXCA 3MHUA 1C9DA 1N8FA 1GWJA 3G1YA 4QAIA 1XUZA 3GR7A 1OGSA 2XIIA 3WH7A 4JX4A 2ATSA 1YXDA 1GQLA 1BFNA 4UZUA 3DFNA 4B16A 1UKOA 5D9PA 3TUUA 4Z1CA 1ZS2A 3PUOA 2ZICA 3PZQA 4W87A 3WL0A 5I24A 3NQVA 3W24A 5AHIA 3S1VA 2NWSA 3W3OA 3NPUA 4I7UA 5CGMA 3TDFA 3CHVA 1U2YA 2YJQA 2QUTA 1I45A 5JBDA 3AJXA 4GC4A 2YKKA 3G22A 2D1ZA 3A4XA 2W79A 1RP8A 4RLIA 5TQLA 5CZJA 1CXIA 1NP2A 1QBBA 4NT0A 1FHLA 1FCQA 3W84A 1EUNA 3WK1A 2QUUA 1LDCA 2B7NA 4UFKA 4IPIA 2V5DA 5CPSA 1F76A 4ICNA 3TMLA 1HNYA 2YFOA 1JFHA 3DYOA 1EEPA 4ZXLA 2A1YA 3KRSA 4QNEA 1XV8A 3T0DA 2X30A 2ZX8A 1KCKA 4Y8FA 5KEZA 3W4RA 3DFSA 5A8GA 1TA3B 1UQYA 2EQDA 2XPKA 4DELA 3FNDA 3VD4A 3MV01 3W72A 4H8HA 3EDFA 4H6KA 4MYXA 2VX7A 4LRTA 5EKYA 3TV8A 1G9HA 4NU7A 1XHGA 5D2VA 3A22A 2PE4A 5A6BD 1X1OA 1E6NA 1N82A 3WDIA 1C8QA 3CH9A 3M46A 3PZNA 1GOKA 2ZTKA 1QI4A 3DC0A 1F6KA 4O0KA 8CGTA 2GQ9A 4PL1A 4PMXA 3N2XA 1JULA 3M5YA 1C92A 5ABEA 4WY0F 4A22A 3R12A 4JDBA 5JIPA 1ZJIA 3SCPA 1V3JA 1B57A 3ZOAA 4EK7A 1K3UA 2QJHA 2QCCA 2OMAA 3IGSA 1MEHA 1OG0A 2CW6A 3NDOA 3TJLA 1VFMA 4M1RA 1Q6CA 3W2NA 3HG2A 1J01A 1FA2A 3G0SA 1CI1A 2WSRA 4W86A 2GVYA 1DOSA 1XI3A 3VOCA 1XGZA 3IGUA 2AAAA 3L0KA 2V2HA 4OHQA 3CZEA 3RMJA 2NXIA 3OGRA 1KLZA 4H4IA 3BXWA 5LZLA 3AMCA 2DT0A 4AC1X 1JI1A 4W7VA 1WA3A 3CUJA 4AF0A 2WBKA 1TMQA 4PUDA 3ZIZA 3VI2A 5D2YA 1G67A 1XSJA 3AYSA 3W81A 1XBVA 4MZYA 1LBFA 3LI1A 4W5ZA 5FOOA 4GXPA 2D73A 2ZDRA 3BW2A 3QSTA 4IMDA 3QQ1A 1LF1A 3VIMA 3OBAA 2JGYA 3ABQA 3M16A 3KXQA 2Y7DA 1RD5A 4Z2KA 4BA0A 2V2DA 3SCWA 3ZR6A 1X6NA 3EX6A 2F61A 4LVDA 3L4ZA 1R47A 1A50A 4UTTC 3VU2A 3N73A 4MUZA 1KXVA 4KFPA 1Q45A 3B9EA 2YL9A 3IIXA 4XBSA 1AW1A 3U2OA 1TFVA 2WMKA 3L4YA 3PIGA 4ML9A 5AC6A 1LRTA 3NZRA 5A8QA 2J7FA 4W8LA 5JBEA 5AB3A 2FLIA 1NF7A 5D05A 5KTLA 4PSRA 3D0CA 3CZ8A 3FHAA 2H90A 1UH4A 1GCYA 2NUWA 4EANA 1OIMA 3M41A 1FXPA 2DSUA 1HUVA 4I7WA 1KFWA 2Y2WA 3MUZ1 4LYRA 4PYSA 1WDQA 3FYOA 5C5YA 3AI0A 3NCOA 4BI6A 1XM3A 1L6YA 5FL1A 3EXTA 2W63A 5A1AA 1UUOA 3GR8A 2Z1KA 2D22A 4YWIA 3S6TA 4TVDA 3NQ2A 4UTIA 3RM9A 3WFLA 4PA8A 4HN4A 4PN2A 3ZT7A 3H55A 4H3DA 2A7NA 3BV4A 3LV6A 2TPSA 1SQ7A 1ICSA 3PULA 1JD9A 3WQ5A 4UMBA 1CXKA 1H7RA 2QKFA 5L6UA 2VZUA 5DLCA 5CZSA 1Q6EA 3U7VA 1FWRA 3W75A 2EAWA 4J27A 2OX1A 2ZUWA 4OOZA 5FCZA 3L0GA 2BY3A 1CGXA 4ALDA 1HKKA 2Y61A 3L5AA 1LP6A 4N02A 2G41A 2QPSA 2DSWA 4FIQA 5A8PA 2JKPA 3GBEA 4D6GA 3WF4A 1XFBA 3F03K 2FB2A 3PG9A 4GI9A 3UZJA 1G94A 1WNOA 4DPQA 2ZBTA 2MANA 2VZSA 5SWUA 3PZOA 1H4PA 1WZKA 1AQHA 1SW3A 2ALDA 2VOTA 3W74A 4UFHA 1VLWA 3MWAA 3UY8A 3TSBA 3CHCA 3H54A 1QPKA 4WX2A 3B03A 1Q6GA 4LV9A 1NWTA 3KVLA 1FP9A 1VJSA 5LNUA 5GNZA 4ACYA 3LGEA 4JFUA 3WUBA 4O17A 4AZIA 3KVKA 3R2GA 3TQVA 3C6CA 1CENA 4TUFA 2DORA 1KBJA 1VIWA 1ALDA 1JCNA 1EQPA 4RR4A 4HPGA 4LYQA 1HKIA 1UUQA 4F9JA 4N4PA 1GVOA 4O19A 4PTMA 3W73A 1FFQA 3K30A 3NAVA 3RM4A 1R30A 4BQ5A 4WSKA 5JBFA 4MFDA 1NOFA 5CPOA 3VDBA 3ATYA 4JYEA 4DO4A 1JUEA 1OFQA 1PZ3A 4KWWA 2Y62A 3JUGA 4AIEA 2IXVA 2X2YA 3SUVA 3W7HA 3EX2A 3VDCA 4JTEA 2OWXA 1PL9A 3NQEA 1KBBA 5JIWA 5H2ZA 1SO5A 1HVQA 2ESCA 3NUKA 3WDJA 3TJXA 4A3UA 4OBRA 1WB0A 3GH7A 1UD8A 4CD7A 1LWJA 1ODZA 2VX5A 3NDZA 1F4AA 3PBVA 2V8ZA 3TOPA 1W9DM 3G6LA 2ZE0A 2FPYA 4MPQA 1OYAA 4M29A 5FMDA 3WK0A 3VE9A 5FIPA 3W86A 3QC3A 4AHOA 3GIYA 2E6AA 1G7UA 3DZ1A 3GZ3A 5F2IA 4BCEA 4K37A 3W26A 4NJGA 1GNXA 3BAKA 3SI9A 3TQ0A 5D8WA 2A3BA 1KTNA 4FXRA 3TSDA 4MNLA 4QCFA 1SU5A 1BGAA 1KR1A 2X05A 5CJ5A 5HNNA 3BGJA 4DEFA 1GYLA 1OHLA 3D5HA 2PBOA 3FXYA 4X3ZA 1VCFA 3GXNA 3GZAA 2V9DA 1WOAA 5K9CA 1E6XM 4JIPA 1OT1A 1PEZA 2CYGA 1DHPA 1KM6A 1G4SA 1S3HA 2ZCGA 3OVRA 3TA6A 1J10A 4LU0A 2YDAA 1TR1A 3EWBX 4HT3A 3VE7A 1XSIA 1H11A 3SURA 1T0OA 2A4AA 3VDAA 3W7OA 3BCFA 1FCUA 1H60A 1JD7A 3LHTA 1JFXA 1Y7VA 2YR1A 5D03A 3RWKX 4WZHA 4A4AA 4K68A 1K8YA 3GX9A 1Z44A 4CN1A 4MB4A 2EBNA 3W2MA 3LDKA 2YDSA 4FNSA 1EP1A 1DWGM 2EJ1A 1UD4A 1XDLA 3QF0A 1C3FA 4E8CA 1CLVA 2WBGA 4BF9A 1GG1A 1KM4A 1OX5A 1E4LA 4DPPA 4QSHA 1TTJA 3PUDA 1QDSA 4ATLA 1G4EA 1WV2A 4WSJA 5FD0A 4P8UA 4XB3A 3VPLA 3MHFA 2G96A 4MVAA 4WQ6A 1EOKA 2VC6A 3LCLA 3QHOA 1BYAA 2DEPA 4GQRA 5H91A 4LVAA 3PM6A 1UWUA 3RO8A 3MW7A 4P7LA 3HGSA 3B0PA 3SGUA 4CD4A 4JYFA 5IM51 2O9PA 3W7EA 1HL2A 2BY0A 5EBAA 1H1ZA 1GOQA 3AZRA 3LDRA 4AY1A 3Q37A 2EPOA 2YOCA 1MEIA 1JF5A 4IUOA 2VKZG 5G4WA 4LRSA 2YDQA 2C13A 1R85A 1W1ZA 3PF3A 3PZGA 1W37A 2A0NA 1J0IA 4M7TA 1ECEA 3A47A 4RXGA 5AY7A 1TPEA 2TRSA 3HGJA 3QM3A 1QOPA 1OD0A 4GRSA 1FDZA 5F4WA 1SUXA 3E0IA 4NRSA 3EBVA 5ABFA 3M1ZA 4LY8A 3I6RA 2V5BA 5EL1A 2J47A 1UUMA 3N2MA 3QQ0A 3SIZA 3KRUA 1J0KA 2WNWA 1EHAA 3MUIA 1MEWA 3W85A 1E3ZA 4KGJA 4MY9A 1VZWA 4PODA 1VYPX 2PWFA 3GB6A 3K4AA 3WNKA 3I7RA 5D2TA 2D0FA 3T44A 2NT1A 3ARTA 3K8KA 1FP8A 3BARA 3BLFA 1P0KA 4XZWA 2WSQA 2OZ0A 1ZALA 4JDYA 3UPBA 2VEPA 3SUWA 3OLEA 1US2A 3EDEA 1YYAA 3NL5A 5A95A 3S5YA 1V3HA 4NXSA 4HOZA 1M5WA 1H5VA 2ZZ6A 3M7SA 3W1UA 2Y5EA 4FXSA 2OSXA 1TG7A 3WF1A 1VCVA 1OFOA 1JRCA 3L68A 3N19B 4OIFA 1KGUA 2VX4A 1QMLA 3UNDA 3DFQA 4FHAA 3EMZA 4GQQA 3ZJ8A 4CCDA 5EB8A 1FX6A 1US3A 1THFD 1GJUA 5FMBA 4Y7EA 3UG3A 1CLXA 1GHSA 2CETA 1H0GA 4F79A 4WF7A 1W3NA 2ZUNA 2DDXA 3VGDA 5I78A 2XN0A 1LROA 3QZEA 1NOUA 3K8LA 5FESA 3QOKA 3ALFA 4JL2A 3LLDA 3W1RA 5I3FA 3PZTA 3WF0A 3TR2A 3WF3A 3M6DA 1GZGA 3NVTA 1KM0A 3FS2A 4HNVA 1VFFA 3SCOA 1W56A 3WMCA 4CGTA 2ZRWA 1Q6QA 1YDNA 2WWCA 2XFRA 4HTYA 4M82A 2PC8A 3ECQA 3CWNA 4W89A 5LGXA 2I14A 1A5CA 4LX4A 3QFEA 1H7NA 1I2QA 2ADDA 2ZQ0A 5FK7A 1UKSA 2A3AA 3ZR5A 3T78A 3GNRA 4GUGA 4P8XA 4AIOA 2WCSA 3O2LA 1G5AA 2CHOA 2XM1A 3J7HA 1ODUA 3BW4A 4CD8A 3G0XA 4JIEA 4JS3A 1QOXA 3WJYA 4J3WA 2VURA 4YPJA 1JAKA 2CLHA 2P0OA 1QPRA 1TCDA 1UKTA 3LXCA 3DI0A 3OG2A 4PEEA 2FPVA 4C7DA 2X1RA 2WSKA 4UZSA 4GUJA 3KEHA 3FA5A 2EPMX 3M44A 1JGIA 1UKPA 3QYQA 1VB9A 4WUIA 1ADOA 3SCRA 4IXHA 4UTLA 3W2UA 1R8LA 1LBLA 3SUUA 4JKMA 3NZ1A 1RP9A 3AMGA 3CMJA 1QW9A 1IZJA 4IPNB 4M80A 5AHMA 2BV9A 1TJPA 1CGYA 2ZA2A 4RJEA 2PF0A 3WH6A 1J5TA 5K4ZA 1H49A 3PZVA 4UMAA 5AHNA 4M8UA 3DFOA 4RL3A 4UQBA 5A6SA 3VIIA 7A3HA 1AL7A 2CZFA 3VIJA 2EHHA 1WZAA 3VX1A 2CLLA 3MYPA 3WENA 1IXOA 2W91A 2YL5A 1F2JA 4M6QA 2EF9A 1WE5A 1B1YA 1UWRA 2WVUA 4UNIA 4E2BA 1SZNA 3VGHA 2WMIB 1SZGA 4NF7A 1AQ0A 4UCFA 3GXFA 2QCDB 3NA8A 5CPNA 4UUIA 1CNVA 1UR2A 2V38A 2WOQA 3VCRA 3IVSA 1WDWA 1UWQA 4B9ZA 1OFEA 3N15A 1HN1A 3G24A 1S46A 3THDA 3HBKA 2JK2A 3OA3A 3FFSA 3QEZA 4FLOA 4NX0A 2ZUMA 3RU6A 2X2GA 4JGDA 5LA1A 3AFBA 1JCLA 4TTUA 1KLYA 2VCCA 4NUWA 4LUIA 3CGTA 2ABAA 4WOZA 2AAMA 1GVSA 2WB5A 1WBHA 1PVNA 2VELA 2VFEA 2GQ8A 2JEQA 1T96A 4URIA 2WKLA 4QNWA 3MYOA 1B3XA 1LL4A 2DSVA 3H3LA 3GAYA 4B1MA 3TAKA 2I9EA 1H1NA 2EPNA 2EPKX 3S0CA 3G1FA 4LOCA 4N6FA 3HMJG 3VVGA 3GNDA 2WKGA 3F5JA 1P4CA 3WDQA 1H41A 1ZFJA 3TW6A 2J9YA 3NQAA 1D3CA 4RZ5A 2VVSA 3L4UA 4YCOA 2BNJA 1RQHA 4JNMA 1EHNA 1AK5A 1IGSA 1FH7A 1UWTA 2A7RA 3QHNA 4TXEA 3LCFA 3MHGA 5FKYA 5L9FA 3O6AA 1OM0A 4ZQMA 3E12A 2BXYA 3A9IA 1HKJA 5AC8A 2X0YA 1BWKA 2A5HA 3N1AA 3N11A 1TE1A 3BH4A 3ZM8A 3NIYA 3EDJA 1LJYA 4Z1BA 1CYGA 2CKSA 4WJXA 3T4CA 5LHFA 4S1FA 4KKXA 4BFAA 3PTQA 3DHUA 1BTCA 1IXQA 2HMCA 1UR0A 3DHPA 1X1ZA 1W3TA 4C7GA 4UIOA 3THCA 1EIBA 1W32A 1TB3A 4TOQA 1A53A 2P10A 4FNRA 3GDRA 1E9LA 2YIHA 3ARPA 4AD3A 4FLRA 4PC8A 2E3ZA 4K8EA 3AOFA 5AC7A 1WDPA 1NVMA 1Z42A 1HJQA 1UYQA 2Y8VA 3MSGA 1M03A 5A6JA 1E73M 4MLRA 3VNZA 5BNKA 4WY0A 1MXDA 5I2UA 3GDTA 4AIUA 1MSSA 4CLMA 3C52A 4EIVA 3WD2A 1ME9A 4UFLA 1UJPA 3W1MA 2GJLA 2D0HA 2YX0A 2ZRXA 2D3NA 3TA9A 3P74A 1TO3A 4NX5A 1JZ3A 2JFEX 5C71A 3LBMA 2WHLA 4CU6A 1GVRA 3S5QA 2YLLA 4NSBA 5BMWA 2HSAA 5EFFA 5DT7A 2QCMA 1DL3A 4O12A 1K7XA 1M7PA 3THQA 3ABRA 5CPQA 4HU8A 1EOMA 4UTFA 4HA3A 4Z2LA 3OIXA 2ZRZA 3DYMA 3DHFA 5KMYA 3PSVA 1BPLB 4GUIA 3NSMA 3E02A 3W1XA 1KB3A 4AAJA 1W5QA 5C6MA 1TYGA 3L65A 2JEPA 2Y88A 4V28A 1H3GA 3SCUA 4AWEA 1TPFA 4A29A 3MUY1 4NZFA 1U83A 3W6YA 3HPXA 4DXVA 4GXMA 1VYRA 4N9CA 3EXRA 5HUOA 4JZ5A 4FNPA 1MXSA 1ICQA 3NOEA 2WK2A 4OKDA 4H7VA 3SEPA 2A2IA 4FFGA 1VC4A 2QAPA 3GNNA 3N9RA 4GJ1A 4HA1A 4UQDA 4PMVA 1ISXA 2LLEA 1LOSA 2WZIA 3EKZA 5C54A 2VQUA 4KWVA 4RX0A 4V2XA 4O4VA 1CXLA 4RE2A 3OSDA 2HVMA 3O06A 1Z48A 3BSGA 3VIKA 3STGA 1Q6DA 3BG9A 4PH6A 1PJ9A 1YLVA 3W71A 1WOBA 3JR2A 4UTJA 4UR7A 3RJXA 1F73A 3PN8A 4AD5A 1ITCA 3IIOA 1BVZA 1MW2A 3IANA 5IXEA 1OJXA 1BEUA 3WNMA 3C2FA 2FHCA 3GXIA 4D6FA 4GZJA 5IBXA 4AZCB 3ARXA 4XKYA 3O15A 3SIMA 2G3IA 4LS1A 3I3BA 3VGBA 2OYMA 5BXPA 3SCTA 3O6CA 2GK1A 1KV8A 5FF2A 2XYLA 3FAWA 5HJLA 4QHZA 4TTGA 1SFLA 2GSJA 2E5DA 4O14A 2X09A 1JR1A 3K8MA 2XWEA 1UD5A 4W7UA 5E70A 1V0KA 3W7QA 4E2OA 1MVYA 4OQVA 3NMBA 4UTUA 5HULA 4CQ8A 1V3MA 4KFOA 4IISA 1FY6A 3NEVA 1F4HA 4XTDA 1FH8A 2V81A 3QH2A 2W66A 1EQCA 2V3GA 2ADEA 1RR2A 1KWKA 1DWJM 3OZOA 3VO0A 4LVBA 1VRXA 1UA3A 4ZFMA 2G3JA 3VD9A 4H2CA 4AWUA 1SYTA 1X1NA 1PIFA 2WSPA 3QSRA 3QMRA 1LWHA 4J3TA 2X1SA 1GW1A 1LOQA 4MY8A 4J7RA 2E5BA 4FNUA 2Y70A 4O52A 1VYSX 1EPXA 4HU0A 1SZEA
chains in the Genus database with same CATH superfamily
3RPDA 1MQTA 1SSGA 5J5DA 1UY0A 3IV8A 3L2HA 1CECA 1QFEA 2PTWA 4J28A 3J4UH 3WP6A 3I3EA 4TZDA 4XUGA 2NWRA 3MP4A 5AC92 2RDWA 2VGDA 1VHNA 3KTXA 4YJ5A 2E7FA 2XSBA 3NQ6A 2VMFA 3PUAA 4YVWA 1VBE1 2PP3A 2IXHA 2B4GA 2J7CA 1X33A 3ARVA 3M1HA 1JS9A 1KGWA 4I9JA 1ZZ6A 2PGEA 2BGPA 5EIYB 5LATA 4Y9AA 5CZKA 3CWHA 5I77A 1UOKA 4JGYA 3W37A 2XIBA 1AA1B 3O1SA 2C16A 4AI1A 3LSCA 4ZB2A 3IJ7A 2WCGA 3E3HA 3AL6A 5FYUA 1SPPB 2ZZQA 2C19A 4UTWA 4Z1YA 3DCQA 3PJQA 5FYZA 1E0TA 1A47A 2HH9A 3JU9A 3B9NA 2RDNA 2ORXA 3VUOA 3VMOA 3T1GA 7PTDA 2NLIA 4F0HA 5JXQA 1QNVA 1YHFA 1BF6A 3R4DB 1MW1A 3MQTA 5KHKA 2WC7A 3GHUA 3MV11 4IX0A 4BIOA 4DRRA 4OE7A 2DU0A 5LWBA 3WY1A 5C3OA 2AOSA 2QVNA 1ZZ9A 4LGXA 4HGXA 1M7XA 3WUDA 5IVVA 1H51A 3EEZA 1BGGA 4HU4A 1UZHA 2CESA 4GFSA 5JIUA 1V02A 4RNFA 1B0IA 3I59A 4P7RA 1OFDA 1N8WA 3MTWA 5EXOA 1QATA 1XD0A 5CFDC 1ISVA 4YGEA 2IVIB 2CU5A 4A2RA 1C91A 3QH6A 3ILRA 4X0NA 1D9EA 3BCDA 4PTNA 1IEQA 1D3GA 1O5RA 4IEWA 3B0XA 4H8VA 1EDTA 3EAUA 3R89A 2XBO2 3KV4A 3N3MA 4D2JA 4MNKA 3CPUA 1PGW2 3SKVA 1DDLA 2EXKA 4FX8A 3VBHA 5FKCA 5JWPA 2WLPA 2GDUA 1V93A 2ZRYA 4DY3A 5BNNB 1R86A 4AQSA 3V0BA 3I4KA 3VINA 1PKLA 2EIDA 2CXGA 1GOWA 1RK5A 3WEOA 1CW2A 4HN1A 2A6ZA 1VBRA 1QJU1 2X1TA 4LUMA 4PR4A 1ONRA 2OYKA 3UERA 3HG3A 1OC1A 2PQQA 1E71M 2GOUA 2O9OA 4QJ5B 3S1GA 3I7SA 1F3TA 3QFWA 3OEBA 3OYWA 4MXVA 1VFLA 3LKJA 3GVRA 3KTCA 3WBEA 3SO7A 2BHYA 3S2MA 3RHGA 5BWFA 3KZSA 2CGOA 3I68A 1CPUA 5G2WA 1JDAA 1TA3A 3A3XA 3G1HA 2C3ZA 3VZLA 1J96A 2YLAA 5REQA 3TJIA 2XB6C 2DIEA 2YC0A 3IMMA 2GGIA 2WZ8A 5FY5A 5D2XA 1AVAA 2NQ9A 2XM2A 1RL3A 3NL1A 4YARA 5FZ1A 3IARA 5A6ZA 3D82A 4I8YA 3EB2A 2GJXB 3G6MA 3AP9A 3UFYA 4TVUA 5E9AA 1RXGA 3WBWA 1Q7ZA 5CSYA 4O9GA 3IVUA 3FAXA 2D40A 4GBUA 3CAKA 4XURA 3MYXA 1BTMA 2PTZA 4N53A 2ZTJA 2ZTNA 4CQ9A 2FZ8A 2FCUA 2VCAA 3B7MA 1LUCB 3FJLA 4GI6A 5DRCA 4ZCWA 2P1FA 5FZDA 5F2LA 3B05A 1D7FA 4HP5A 4W9TA 3TYEA 1G6CA 1V0MA 4YLWA 1OLRA 3RJYA 1ZA4A 1HFBA 4KU7A 3ZWSA 1RBLA 2Y6LA 5DMYA 4A44A 3VDDB 3LHUA 2XFFA 4SLIA 5ABHA 3S5AA 4W8BA 3KBSA 3POSA 1FXQA 3W22A 3HOJA 4Z92B 3QW4B 5MHBA 1R9YA 3LIGA 1FUYA 4ZB0A 3BGGA 3OOXA 1ASJ1 1Y7BA 3BB6A 3FC0A 1E51A 5I3IA 3UGVA 3PPHA 2Z2BA 4QDSA 3WELA 1I6NA 4BWLA 3ALQA 1JHJA 5BNPC 2ZGQA 1QUMA 1SFYA 2GFTA 4CNPA 2FJUB 4CNNA 5DFAA 1IOAA 3WV6A 1ZP4A 4ZY9A 2PHDA 4C1WA 4YW2A 2J13A 2IQTA 1ME8A 3IRDA 4ONVA 3SGGA 3H8RA 3RSJA 3TB0A 3ZXLA 2GOKA 5J8LA 4ACZB 5BXTA 3LSBA 3AIQA 2ARAA 3T81A 2BY2A 2XJ7A 3C7EA 1NM9A 1QAPA 1QW7A 3P5YA 4Q4PA 2A79A 3UWQA 1VRDA 2H9AA 2X42A 4TX6A 3E74A 3L66A 4FB7A 5KZ6A 2QDRA 3CUGA 1T6GC 4AZBA 1E0WA 2V3EA 2RJGA 2OKTA 5DMMA 1PVC1 1XLMA 2A1XA 3AL5A 3UYCA 2DJXA 4HZ7A 3TE9A 1DJYA 4G4FA 3LIHA 4J4KA 1NAL1 1N8IA 2YZ5A 1ZP3A 2OELA 1TTQA 1K03A 4KBXA 1KD7A 1Z41A 1XBYA 2OG9A 2V6AA 1LB2A 1XRSA 1NX9A 3BZJA 2Q8ZA 4OVXA 2QMJA 1ZZ7A 4FOQA 3UXDA 3WLOA 1ITXA 4IE0A 4B15A 4LUTB 3FBYA 1XCWA 2CHRA 5B4NA 1D0GA 1AX2A 1XBZA 4QFUA 2HEWF 3JBG2 1IGOA 3RRAA 1DTNA 3GHRA 1XYMA 3GDLA 4X0VA 4A8LA 3CUHA 1CDGA 4B5SA 3AK0A 2GP5A 4NIDA 4DAFA 3MMDA 4FEZA 4NNBA 5F1VA 5M03A 4X9YA 3S2NA 4JTOA 5IVYA 4NRMA 2BY1A 3W02A 2XIQA 2HLEA 4TIMA 5CH9A 4G9PA 5FZ4A 4NI3A 5A8NA 5ACA2 1UO9A 3S9YA 1UCWA 5T91A 1V6KA 3KB5A 1I4NA 5DN1A 2A3HA 5FZ0A 4NAEB 1TJRA 1YW1A 3BAYA 1I0DA 1PVC3 2QGHA 5BPXA 4LIVA 3C2RA 4U31A 4CN4A 1GZ1A 5CLTA 1V6TA 3KWSA 1W6NB 1B90A 2BVVA 4P9LA 1J5SA 1R1A1 4A42A 1HJXA 3U4FA 3KVJA 4OQ8A 1TCMA 4JNYA 3O12A 3NR0A 3T42A 2UURA 1I2PA 3WQ6A 5HXVA 4D94A 1QJWA 1TREA 5LYRA 3KP1A 1V77A 3W7IA 4DJDC 3O6DA 2QJMA 2P1BA 3QKEA 4HPXA 3LLFA 2XLAA 2ZZ3A 4IXXA 1O4TA 4LAZA 2W67A 3H2NA 2LALA 1TPWA 5BOOA 3UGFA 5AYXA 4Q8PA 4JHOA 3LRKA 2AL2A 3UCQA 4ZQCA 2ZS6B 5A8MA 2ONEA 1XGEA 3WLJA 1JF6A 4JTSA 1AR93 1R2SA 2QF8A 4DJEC 4AWTA 3CHEA 1TV4A 3PZMA 2CWNA 4ARXA 3J8F1 4OFCA 3H23A 4O1DA 2JDZA 4JX6A 5D8ZA 4W65A 3R10A 3F4WA 3ZLGA 2WFF2 5HV4A 3LCGA 4UTKA 1E43A 1LG2A 5CKSA 4HL0A 2HWF1 4HSLA 4XMAA 1WBLA 3PBMA 3SB0A 1HO4A 3OW1A 2BNNA 4A3HA 2QQVA 3VLBB 4HOOA 2KR2A 1MRQA 3P6BA 1VEPA 3C8NA 2WJZA 2VJXA 1R1A3 5FEPA 9CGTA 1BAGA 4KQNA 2ZX9A 4BQ3A 4W85A 3P81A 3UY7A 5DBTA 5F3CA 2CDOA 2QVSB 2XSAA 3C3NA 3K4WA 4NJKA 4ZO8A 2NXGA 4TX9A 3W7RA 3RZGA 1KC7A 2ISSA 4NKCA 1H4GA 4DWSC 3GIQA 1KXQA 3ZSJA 3KLLA 4CDWA 3MI6A 4AEDA 1DQWA 3KBVA 5FO7B 4IESA 1VBC1 3QXBA 3LXBA 2OUHA 2B9UA 5HQLA 3VZMA 1I2OA 4AVTA 3NQHA 3UWZA 2C7FA 1EP0A 3BJTA 3J8F3 3WO8A 4LKFA 1VAKA 3I2JA 4UNKA 4LHKA 3NQMA 1DXIA 4AY8A 4RK8A 1L6SA 3M5ZA 4PQ9A 5IHRA 3LRMA 4FVVA 5EYWA 4K38A 1KITA 2ZWYA 3EZ4A 1LOCA 3B8VA 3APBA 5EY5A 3THTA 3WW4A 2VEIA 2OZ6A 5M5DA 2E8ZA 4WIWA 2XG9A 5IDZA 5EQUA 4NHXA 5FPZA 5AHFA 2HCVA 4EV0A 1QJX2 2NSOA 3VL8A 3SH4A 2PTYA 3I2OA 2D69A 1CTNA 3D8CA 4PTXA 4WKFA 4QE5A 2W87A 1YEWA 3BVJA 3SCNA 1F3EA 4CDUA 3BAIA 3DHDA 3LTSA 2VZQA 1K5MA 2F6UA 5DF0A 1N55A 4QEHA 4MFEA 2ZX1A 1AF9A 3VGGA 4CCZA 3MP5A 2WA3A 1UBPC 1A4MA 1MDRA 1LLWA 3CBWA 4UCGA 1BHGA 1TVLA 5HR7A 3WF2A 3NL6A 2G4JA 1H7OA 4XQ6A 3B0UX 1SR9A 3X29B 2C6SA 3OD0A 4MSSA 1VBC3 2WO3A 1YTKA 4FOKA 4WXYA 3IAPA 2BODX 1XDMA 3ELNA 1J0ZA 3IK4A 3NO3A 1KM5A 2FMYA 3OPZA 5FEXA 2OWCA 4MGIE 2QNEA 3AMQA 1PVXA 1C9WA 4YFZA 4KWUA 1FDJA 3U2CA 2PDQA 3O0XA 4B3LA 5CAZA 3O1TA 1NEYA 3U37A 4PRRA 1UMLA 1YTEA 1MEC2 4HA0A 4LW7A 1A34A 4L11A 4MYAA 5EZWA 2BEOA 2XVLA 2HVOA 2C24A 4IFRA 1GTHA 1JCYA 5EMLA 4AI9A 4GXWA 5DDJ1 4DS0A 4FFIA 2REQA 2B7QA 1L0PA 4JTUA 1V6UA 3SCSA 4R7JA 2QCDA 4EF9A 1GHRA 2ZHNA 2VFHA 2UBPC 3S0MA 2HTMA 3MIDA 4PUWA 5GLVA 1VR3A 5DY2A 4TN7A 3S2JA 3WG2A 2ZKMX 4K1WA 3Q45A 3MJMA 4OZOA 5J3UA 2ZA9A 1KKRA 2WSUA 1R082 5FJUA 4ZZ9A 1KR0A 2PLMA 3GKAA 2YFNA 2GJNA 5C5UA 2YMZA 2VZVA 2WZHA 5FZOB 2ADAA 2RS13 3P5BA 1PCKA 1H62A 3ZMOA 3INAA 2PEVA 3PUEA 1RPXA 4HKLA 1TPUA 4IMGA 3A4AA 3D0JA 3KT4A 1B9ZA 4F9DA 2G50A 1JYNA 1K45A 4K9SA 1KBIA 1W06A 1O6UA 5TF0A 5IT6A 2PZ0A 2A75A 2UY5A 3T8LA 4IMFA 1YNAA 4PSPA 3VNDA 3WMLA 4Z2AA 3FE5A 4LR4A 3LV5A 4Y9PA 4ZQRA 1B3ZA 4AZHA 3TROA 3O7UA 1PO12 2DUOA 5C9UA 4GK8A 2PHRA 3VGEA 2C9KA 3BGAA 2QQLA 2G37A 4NZ1A 4MWAD 3POEA 4PRWA 5A6MA 4IETA 3DBPA 3UG5A 2WT1A 2AGKA 3ITQA 3KCCA 5FUPA 1TV5A 1CBGA 1R3YA 2QV4A 5G4EA 1W99A 1VFOA 4FLSA 2ZVIA 4PUEA 3GC5A 1P43A 4DZ5A 1XL9A 1YTDA 3ZJ6A 4YHGA 1E9IA 4EXQA 3BKZA 4ZZ8A 1EF3A 2RJLA 1POV1 2HKXA 5JLVA 3P5ZA 4IIGA 1CXEA 1IXNA 4CEWB 1W3LA 1Q8QA 4PB4A 1ZBE2 4D7SA 1CGPA 1L8NA 3V56A 3HPZA 3HQUA 2EIGA 4C6CA 2IKHA 4GMP1 3OYZA 1FOBA 4JEQA 3S57A 2XH6A 3IIAA 1Z3NA 3KX6A 3TX9A 1Q6FA 4LF1A 2GN7A 4IDZA 1GYNA 2VUAA 1JW6A 2YXGA 3H0OA 1XIDA 1MQPA 4HYWA 4H00A 2TMDA 6TAAA 4QQ3A 3ES4A 4UW5A 3P61A 2WHMA 1F5JA 1JDFA 4D6CA 3WW3A 4E2VA 3WBAA 4DXKA 5F4SA 2HWC1 4U5IA 3S5ZA 6REQA 5A6YA 4UFJA 2QR6A 3B9DA 1AYM3 2BXVA 4N9DA 4E2DA 3FVMA 5T5JA 1ZLPA 3CV6A 3T1LA 4JV4A 2YBUA 4I7VA 2QFEA 3W2LA 4NAFB 1A5LC 1F15A 2XGBA 1GOOA 2CWXA 3G1AA 1C8YA 2NX3A 4HIBA 1M4WA 3C8FA 2ZHMA 2JG9C 1OH3A 4PFMA 1T41A 3ETQA 2YW3A 2IVJA 2ZX6A 4EVZA 4KI5M 4DEQA 2J24A 3ZO9A 1POV3 1FMD1 4C6BA 4ASLA 1WYIA 5AZ1A 3FJ6A 3QC0A 3HB9A 4ZQNA 1OGBA 4DO5A 1GW9A 2J25A 3G3DA 4GMP3 4AISA 3B06A 4CU7A 3WZ1A 2QUMA 5FF4A 2R32A 3GWQA 1RMU1 4KT2A 3B01A 1UYXA 4C90A 1XG3A 3CZGA 4XF0A 4QX4A 5F2GA 3LMYA 1YUDA 1UYZA 2E53A 3M70A 1LRQA 4MGYE 3PS7A 4O8AA 1Y0EA 1W6QA 3NURA 4PTVA 1W8OA 4AEEA 1QGLA 1WA6X 3G1SA 1K4HA 1V6OA 3M43A 1C5IA 2RKXA 5KXBA 1W5PA 3LQLA 3LENA 2BRTA 1ZL1A 3THAA 2NUYA 4MIMA 2Y4SA 2E6VA 3T8QA 4RZ6A 4O1BA 2YGLA 3GC2A 3CIXA 2YW4A 1R0MA 4K8RB 4IJRA 2JDUA 3AHYA 1IEWA 1U33A 1WLTA 2E77A 3DC8A 5D38A 1QJY2 1CXFA 2DU1A 1EWDA 3H7VA 1B9BA 1V00A 3AHZA 5BXSA 3OODA 5E6ZA 3VIOA 2DY3A 1KXTA 4HVRA 7REQA 3H2EA 3S6OA 1LCOA 1E1FA 3LFIA 2VHLA 2B7OA 5CVRA 3BMWA 3F2DA 3AIRA 2D0GA 1FMD3 3FUQA 4XJ9A 2E25A 3AZVA 5I3DA 1TX2A 4Q7NA 3R8GA 2CZDA 3LPFA 3E2QA 3MIBA 3L2IA 4AWSA 4OHVA 3PVBB 3MY9A 3ZWTA 3IM0A 4JN6A 4R7OA 2FDJA 3CO2A 1OT2A 1ENQA 1RMU3 2J7MA 4NHMA 1WDSA 4GZIA 3SFWA 2RM21 4OMDA 5CSRA 3LEIA 1QNOA 2CAVA 4LJ3A 4QX8A 1GLHA 2JWPA 3PK7A 4PMYA 5PTDA 4HN8A 1PX8A 2CGNA 1O94A 4LAOA 5HATA 3RPMA 4ZE5A 2XN2A 3ROUA 2FDKA 5HV0A 3ARQA 4B4PA 2VG9A 3L4WA 2BB0A 4PTWA 3IK2A 3CZKA 1BJQA 5T9CE 1SO3A 1XPGA 3TP4A 2W94A 4TV6A 2AL1A 4RXFA 3RJ2X 3DESA 4JX0A 4TR9A 2AKMA 1JYXA 4L1GA 1NDVA 1I9RA 1QPOA 3G1XA 2BGSA 2ZYFA 5F5CA 1XLLA 3FLRA 2WLYA 4QM1A 2R072 3AFKA 1RUH2 3PIJA 5CC6A 3GALA 1NF0A 4DQWA 4MOZA 5LIYX 2WVVA 4YTUA 4NJJA 1B35C 3WQDA 3QYSA 2FGZA 4EKJA 4G3YC 3RK8A 3NQFA 2WC4A 3JQXA 1R3TA 4HMCA 2J79A 3DN5A 3WUGA 4MDOA 1XC6A 1FOD1 5AC5A 3SQMA 1HQLA 4AR2A 2ODOA 3CB3A 4B5VA 1IXPA 2OQYA 3NO5A 1E56A 3K51A 1UZVA 2EEXA 4LC8A 2ZGPA 1Y5WA 2VXJA 1O3QA 2Z1VA 4TWTA 2PP0A 4JPGA 3ZN6A 1F6PA 2VVNA 1Q2SA 5FYYA 3GH4A 3L9CA 3GHMA 2PRMA 4IGHA 1WMFA 3DFHA 2R8WA 4CN6A 4GGHA 1NOWA 2C5DA 2VTXJ 2VZOA 4J3SA 1PB0A 3TR9A 1BXHA 3TK7A 1JCXA 1JEZA 1O66A 4XVEA 3WP5A 1W8GA 1SSDA 3RI8A 3GDMA 2X0SA 4CVWA 3HQPA 1UD3A 5FYHA 4RDWA 1SPQA 1QBAA 2K46A 1UYPA 1PAMA 3AS1A 2VBPA 3VBRC 1QVBA 3MUXA 1W1TA 3M3OA 1AQFA 3MT1A 1E55A 3VK5A 3U0HA 2VUNA 3AXXA 2OKOA 3RI9A 2F2HA 3I6EA 3CB8A 1VLIA 4LBKA 4WHBA 4AMAA 5A3UA 3WR0A 4I02A 1ICPA 4NWWA 1H1MA 2WL1A 1ESWA 4S2BA 3W7MA 1XNTA 2G3NA 1ND3A 3HGRA 1NDWA 1YNQA 2BBAA 2BQPA 2EALA 1NARA 1Y3TA 3F5KA 2ZKNA 5FMCA 4RL7A 1KV5A 4D71A 1PHQA 4NWVA 2Z1XA 3RRDA 3N3TA 1OA4A 4GA9A 3NZGA 3ITXA 5FXZA 2VDIA 3M0VA 3WQ4A 3NWKA 5ABTA 5BW6A 3GDBA 1EGVA 4GD0A 4Q0UA 2LM3A 5IOBA 2FMDA 4MNJA 3PB2A 3E6DA 1R7OA 1RUF2 3S3GA 3FV9A 3QCWA 1ULCA 4Z1AA 1S4CA 4XBNA 1EXPA 2Z2SB 1WBFA 3DFPA 4NXKA 1UD1A 5I5RA 1HL9A 4KH2A 3AICA 2JD9A 1V3LA 3TOYA 3SBFA 4KRTA 4KGQA 1B3WA 3RQ0A 4LVGA 3TYCA 4FS9A 1TMF2 4Y9NA 2J1AA 3IZOA 2BGCA 2XGZA 1W0PA 1IT7A 3RLHA 4AK3A 2FHFA 4Y5SA 1FFRA 1OSEA 1AMKA 2IXIA 3PPGA 5C8CA 3GRIA 3LERA 1PIGA 4Q33A 1V7YA 4DY1A 2DZXA 1XIHA 5FBJA 3AKPA 1YCIA 3QW3A 5FQ0B 3MI3A 1APNA 1K8XA 5H9RA 1Q8AA 2VZPA 4PDWB 3TN3A 4S2GA 1QNRA 1XPYA 4QQUA 4PGLA 1ZNNA 3M3IA 2NXHA 3TLQA 1POKA 3AMDA 4ZL1A 3STFA 4LTSA 1OKQA 4Y22B 1B2YA 1GOIA 4EPKA 5K9DA 1UOBA 1KD0A 4EZHA 4GH4B 4NJHA 3KS5A 4JY9A 4HA4A 1V8EA 1EPVA 4GB32 3JB8A 4L1XA 2WVSA 2Y24A 3C7HA 4GYFA 2BOEX 3THPA 1O5QA 3GW3A 2JIJA 3NXFA 3ZFGB 2CLMA 3OPTA 1XH1A 4O50A 2QQUA 4FFHA 3FHQA 3ZXGA 1VBB2 3AX4A 1R2RA 4BQXA 1ZREA 1H2JA 3U7BA 3FEMA 1Q3NA 4JTNA 2YB7A 1DZTA 5GNXA 2DYCA 1OGGA 4DF1A 1J8VA 4Q4W1 2IKGA 4QDMA 3ME2A 4XKYB 4H3WA 3CUXA 1LLZA 4EN9B 1RLDA 2ZUTA 2POTA 1W1VA 1QHPA 5CKQA 4LB3A 3NPXA 1E0VA 4NJIA 3TZNA 3VD3A 4AGRA 3SC7X 3WNKA 3HN3A 4OZXA 2W9XA 4HFSA 4S2DA 3VIPA 5L7OB 4MDPA 1K5JA 4BQ2A 1HRI2 4ROPA 3PHMA 2XINA 3GTHA 1C1FA 1S5VA 1UZ1A 3LCXA 2DCTA 3WJSA 4ORIA 3MSDA 1VPXA 2JF7A 4FR6A 2AC1A 4EN0A 2K9ZA 2C4XA 3GNOA 1XLJA 1U30A 2RDTA 3HVDA 2YXSA 3QPEA 4AVBA 4UQAA 3BDKA 1MQTB 5FYIA 3TXZA 2MUCA 3V75A 1WLCA 2OW4A 5IYYA 2V5LA 5H1WA 2Z6IA 2IC1A 3FJ4A 4S3EA 4QG8A 2XN1A 2YA0A 1KFLA 4NIAA 2F2KA 2HWD2 3L4TA 4LB4A 1F31A 1PZ1A 3SQLA 5IK8A 4YVWB 2R043 1YC61 1W1A1 3SCQA 3EWUA 3OBZA 2QULA 4AXNA 1TZZA 4QE4A 4BI5A 3GW0A 1V79A 3GZTB 2A3LA 4CD6A 4Q4W3 4JGYB 1KS4A 3VBRA 1LU1A 3D3FA 4LH8A 4CXWA 3VOIA 3W38A 3RLGA 3W7LA 2XLGA 4OBSA 3AVRA 1LT7A 3WEZA 5LXEA 2ZHKA 3HIFA 2B7YA 2ZVRA 1ZNPA 3W88A 3DV8A 3U10A 1OQDA 1ZBWA 3I65A 3LTYA 1MYRA 1SO4A 1PSCA 4OUEA 3S83A 1E5NA 3GFXA 3IDEA 5T5PA 5CSSA 4S38A 4UOZA 2WN3A 2E9QA 3B3DA 5G1YA 5F1UA 1ISYA 4J2PA 1XLKA 2FHBA 4GO8A 4O10A 3WHUA 2BVTA 4R3UA 5LA9A 2WM0A 4CD5A 1AL22 1Q4WA 5A2CA 3BG3A 4D7YA 2O14A 1R46A 2RFGA 1HL8A 2HBVA 3H3UA 4IFKA 3QN3A 3M4FA 2HQAA 2YA2A 3VNYA 5E88A 5H9PA 4R4ZA 4MUPA 3TEYA 4UW4A 1XQKA 1HO1A 2G97A 4PCNA 3KL5A 2FZBA 4ZTXA 1LHUA 2JDPA 4DZGA 2PLV2 2Y7FA 4ICMA 3ORWA 3OGSA 4LKDA 1QJFA 3W7KA 2Y34A 1A49A 4KWLA 4FO4A 2P4EA 1JMUB 4JXCA 2Q4SA 1C9DA 2XIIA 1GWJA 4CEYA 4L92A 3G1YA 3JW7A 2NM1A 3LEPA 4JX4A 1STMA 3VBHB 4XXPA 4UZUA 5FO8B 3DFNA 1FWHC 2EA7A 3MKVA 5I24A 3V0BB 4GYPC 4WVXA 1NCQC 1Q3EA 4OCTA 4CCKA 3A4UA 5CGMA 3TDFA 1PNGA 2HEJA 2YJQA 4GC4A 3G22A 2D1ZA 3CEWA 4B5WA 1RP8A 4RLIA 2RAGA 1QBBA 4Y1XA 4XMIA 4UFKA 1LU2A 1UZZA 4ICNA 4QJ3B 4QNEA 4XE9A 2G9ZA 2DUPA 3HEIA 3ZYZA 3ABZA 1TA3B 1LQ2A 1U22A 1UQYA 5A8GA 3PNAA 1LOBA 3MV01 5REQB 4L2NA 1LOEA 3EDFA 3MPBA 1D4M2 4H6KA 2VX7A 8RUCA 2RJKA 1XHGA 4M01A 2GH8A 1LGCA 3A22A 4H55A 3NNGA 3PUGA 4B7EA 2FDFA 2DIKA 3PZNA 5CEHA 2PS2A 3TEZA 4O0KA 3TEVA 4PL1A 5ABEA 3M0HA 1GNYA 4ATEA 5LXXA 2QCCA 1EPWA 1MEHA 1VFMA 3NDOA 2XMLA 1EJRC 4N53B 2A73B 1J01A 2GGEA 4W86A 2WSRA 1XI3A 3VOCA 1GP5A 4M0XA 1PGL2 2C91A 4GKTA 4L8QA 4M1BA 2IPJA 3BXWA 3AMCA 2DT0A 1P8JA 3CUJA 5FRAA 5J09A 4O1FA 2D6OX 3V7PA 5T9BG 3W81A 1LBFA 3LI1A 5FOOA 2Z4GA 1OVSA 1WXYA 3S9IA 4MX3A 3OBAA 1KXGA 3ABQA 3M16A 2PQSA 2ACSA 4UF0A 2Y7DA 4Z2KA 2V2DA 1OFNA 1X6NA 1XJBA 2F61A 4LVDA 4GBDA 3E5UA 3EPMA 3SAZA 4EJRA 4Q8TA 1AVBA 1AW1A 3L4YA 4ML9A 1EV11 2PLKA 2WR9A 4KCWA 4PSRA 3MFAA 1C3HA 3FHAA 4N9IA 4DIAA 1GCYA 1OIMA 3M41A 4CDXC 4W8JA 2DSUA 3T30A 1Q5OA 1KFWA 1P6BA 1AXZA 1BEV2 3PDQA 5C3RA 2I9UA 2WNUC 2J8TA 3F7JA 1OPMA 4RD7A 4AI0A 3AI0A 2VMIA 5JSPA 2W63A 4J1WA 2D22A 3NQ2A 4UTIA 4GIYA 5EJ1B 4PN2A 3ZT7A 4AVCA 3RUBL 1OA2A 3BV4A 1GKRA 1VPYA 2VP8A 1SQ7A 1JD9A 3VN4A 2H9AB 3CK5A 3PULA 5JH2A 3DUGA 2QKFA 3G6JB 5DLCA 4QX3A 1ZPTA 1W2OA 1FWRA 1VE0A 1QK2A 3NVCA 1JN2P 4D8ZA 4YM3A 2FGBA 1RVF2 4OOZA 1OC5A 3L0GA 2BY3A 1RAKA 3LZ3A 1ZRCA 4N02A 3MCNA 3TVAA 1X9TA 3GBEA 1L6FA 1XFBA 3CYVA 3UZJA 5IJRA 1G94A 1WNOA 1IPJA 4S2HA 4FPFA 3PZOA 1EF2A 5A3PA 2V4VA 3GUGA 5DQPA 3UY8A 3CHCA 1S5NA 3NNFA 3KHBA 4WX2A 3S2LA 1Q6GA 1NWTA 2ZACA 4BEUA 4ACYA 5LNUA 4AZIA 1EV13 3J7LA 4TUFA 1JOPA 1LEDA 3KCLA 2DORA 3NJXA 3PU8A 1UUQA 4F9JA 5AFBA 5C9WA 1H8TC 4O19A 3E6BA 2FHRA 1O7FA 4X6QB 1A5NC 1ZRRA 3ATYA 4JYEA 4HMZA 1UKRA 4KWWA 3BU7A 5AVAA 2A71A 3GC4A 1D8CA 2R1MA 2B46X 3VDCA 1UPPA 4JTEA 3NQEA 1KBBA 4TYSA 2ESCA 1RUD2 3TJXA 4M3CF 4A3UA 4WJ8A 1WB0A 1ZZMA 4IIEA 2JENA 3K75B 1P7TA 5CEWA 4CD7A 1ODZA 5CCZA 3TOPA 4EWDA 2B81A 3W5MA 2ZE0A 4GYPA 3NAPC 1Z7AA 3GTFA 1YQ8A 3AP7A 3EB3A 3GIYA 3DEMA 3OZMA 2VOXA 4LEJA 2E6AA 1HKDA 3WBYA 3C86A 4NJGA 1GNXA 5D8WA 1Z7S2 2MNRA 2Q0AA 2X05A 1LAJA 1SU5A 3ABXA 3B97A 1GYLA 2NVAA 1RJPA 2OEJA 4H6EA 1TZ9A 1UJQA 1WOAA