2IXHA

Rmlc p aeruginosa with dtdp-rhamnose
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
184
structure length
184
Chain Sequence
b'SMAMKATRLAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSARGVLRGLHYQIRQAQGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGFVVLSEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQDAPLLSEKDRQGKAFADADCFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DTDP-4-DEHYDRORHAMNOSE 3,5-EPIMERASE
publication title RmlC, a C3' and C5' carbohydrate epimerase, appears to operate via an intermediate with an unusual twist boat conformation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Isomerase
total genus 49
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2006-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ixhA00
4LA2A 2PQQA 4Z82A 1Y9QA 4IETA 1RUOA 4META 5I8YA 4IEZA 1PMIA 2XLAA 1YWKA 4WBBA 2IXKA 4MX3A 2PFWA 4ZU4A 4B29A 4R52A 4I3PA 4EWDA 1XE7A 1OI6A 4I2OA 4QGLA 2Q4SA 2ET7A 4GULA 5EFUA 1UIJA 4YRDA 2UYAA 3VHRA 5LRSA 1QY4A 1ZZ6A 2H0VA 1YUDA 3E6BA 3ES4A 1CAXB 1WGPA 3FFQA 2VPVA 3CLPA 1ZRRA 3PLQA 1LKNA 3IDCB 1UPIA 4OFGA 2XKPA 4EWEA 1V70A 1GQHA 3EO6A 3E6CC 2BNMA 3CO2A 3DKWA 3NL1A 3IIAA 2EA7A 1Q43A 4KU7A 4KWLA 1NYWA 5LEKA 1QXRA 3FX3A 1SFNA 3B02A 3LAGA 1LB2A 5C6CA 5BPXA 2MNGA 4EROA 4IEPA 3KMHA 1J1LA 3SHRA 2MPFA 4MGKE 3N4MA 3DV8A 2UY8A 3QOPA 3H8UA 4MGZE 1XRUA 2PAMA 3E5UA 1VP6A 1VJ2A 2OA2A 2Q30A 4YNIA 1ZX5A 4QGNA 4ZU5A 3ES1A 5BY5A 4MUVA 4UBGA 1EYBA 4EV0A 1X82A 5JSRA 3HT2A 4JTNA 1NZCA 1I6XA 3LWCA 5KHHA 4JVAA 3ST7A 1ZNPA 1ZZ9A 4YSFA 3IDBB 3WW4A 4KWJA 1RUNA 2B5HA 3C3VA 5I0RA 5KHKA 2XLFA 3SCHA 1WA4A 1EY2A 2H6BA 5I0TA 3KGZA 1YLLA 1RL3A 4LTAA 4KU8A 5FLJA 4XFHA 3BPZA 3BB6A 1YHFA 4I01A 3H50A 4KWKA 2HKXA 3H3ZA 2D5FA 2QNKA 4XF0A 4FAHA 2P17A 3CF6E 2ATFA 3FWEA 4FAGA 4YYOA 1ZRCA 4XF4A 1OMIA 3I59B 1UIKA 4Q0QA 3HIFA 1J3PA 1DGWA 3U0ZA 1I5ZA 2GZWA 3HQXA 4D7SA 5HI0A 2FMYA 2XKOA 4HVRA 5FPXA 2V09A 4HMZA 4QM8A 2B8MA 4AVAA 5E16A 4PIXA 4HBNA 1X8EA 1FI2A 2IXHA 3E6DA 2UY9A 1ZZ8A 3LZZA 1J59A 4QMAA 2GAUA 1ZZ7A 2BEOA 4HLTA 4IEQA 4TLFA 3RYRA 4FBFA 4Z07A 3ZDSA 4N9HA 3FZ3A 3CJXA 3I7DA 2Z2SB 3NVCA 3S0MA 3H3UA 3L2HA 4K8FA 3U11A 5FPZA 3WW3A 2XGXA 3M3IA 3PNAA 3SCGA 4CYDA 2Z69A 3WW1A 2ZCWA 3BALA 3DL3A 3KSCA 5K8SA 3H7YA 3BCWA 1PM7A 2KXLA 2C0ZA 4JTOA 1UCXA 3OCPA 4HVQA 4IERA 1CAUA 4JV4A 3RDIA 4I0AA 1O5UA 1Q5OA 2GU9A 1O7FA 2XL9A 5E1RA 4XFFA 4MGYE 4NVPA 3LA3A 3OD0A 4IEXA 5C8WA 3G7DA 3UKNA 5KHJA 4BH9A 5FLIA 2OYZA 4KL1A 1CAWB 4E2SA 2ZKLA 2XLGA 1ZREA 1O3QA 2PA7A 2K9ZA 1RTVA 4J1WA 4Q0PA 1CAWA 1QXJA 1G6NA 4HZFA 1O3TA 1ZRFA 5I91A 1LRHA 2Q0AA 1ZVFA 5I8SA 1O3RA 1OFNA 5LRRA 2IC1A 3IBMA 4IEVA 1IPKA 3ETQA 3U10A 3E5QA 3PVBB 3JZVA 4F8AA 3MZHA 3H1MA 1DZTA 3LA2A 4YARA 3WW2A 3MPBA 4PIYA 2BNOA 3S7EA 5LEJA 4PIZA 3GBFA 3USSA 4PJYA 4Q29A 4ZU7A 1DGRA 1NE6A 2PAKA 3OTFA 3KCCA 2GH2A 2DCTA 5F1RA 4QM9A 5BXXA 4XF1A 4AXOA 4LA3A 1NE4A 1SQ4A 1CAVB 3FHIB 2D40A 4WZCA 2UYBA 4IEWA 2I45A 4MZUA 5T3NA 3H9AA 5CU1A 1GQGA 2F4PA 4HVOA 1FT9A 1J3RA 1H1MA 4MH0E 4XFCA 4O9EA 3BU7A 4R8HA 1CAVA 4X6RB 1UD1A 1O4TA 1ZZCA 4XFGA 3CEWA 5KHGA 3LOIA 1FXZA 1CX4A 2CGPA 4LEJA 3EJKA 2XL7A 3H1WA 1O5LA 5FLHA 1WLTA 4HSJA 3NKTA 1RC6A 4XEZA 4LLOA 3OF1A 2PYTA 2D5HA 4DINB 3NW4A 4Q0UA 2Y0OA 1QWRA 1XE8A 5CADA 1ZRDA 1HW5A 5I8TA 4MGIE 5CVRA 3EBRA 4XF3A 3TNQA 1Y3TA 2OPKA 3UKVA 5FDBA 4XFIA 1TQ5A 2WC2A 4L11A 1LR5A 1NXMA 2GC1A 4LULA 3CL1A 4P9GA 5JSPA 3D0SA 1CAUB 2CV6A 3NJZA 4LUMA 4HN0A 4IEUA 5FQ0B 3RYKA 1J58A 1OD5A 4OLLA 5J7MA 2CAVA 2GC2A 4HSLA 1L3JA 5J3UA 1X8MA 1H1IA 4XFAA 4BYYA 4AVBA 2QCSB 2PAEA 2VECA 4UXAA 3RNSA 2QDRA 5FQ0A 2ETEA 1YFXA 1O3SA 5JR7B 1RGSA 2IXLA 4AVCA 4I09A 3RPQA 2HJIA 4X6QB 2BGCA 4IEYA 3IWZA 3GYDA 1Q3EA 5AVPA 4Q0SA 1CAXA 2IXJA 3MYXA 3LA7A 3HT1A 2GC0A 1UW8A 4L2NA 2K0GA 1SEFA 2IXCA 4XETA 3ELNA 2D93A 3KGLA 3SXWA 1EP0A 3ACLA 2OZ6A 2EAAA 3O14A 3M70A 1J3QA 2H6CA 3S7IA 2QVSB 2CAUA 2PHLA 2O8QA 3FJSA 4WVZA 5J48A 2Q1ZB 3UKTA 2B9UA 3EHKA 3RYPA 4LUKA 3ROUA 5BV6A 3NSTA 4EWAA 4AQ2A 4IESA 3FE5A 4N9IA 1X7NA 1ZZBA 1EPZA 4H7LA 2E9QA 2IXIA 2VQAA 1JUHA 4I0BA 5I93A 2OZJA 2XHKA 5JSOA 4IEOA 4BHPA 3EQEA 4I02A 2PTMA 3DN7A 1DZRA 1YFUA 4XF9A 4QGMA 4Q0VA 4MV2A 2PHDA 4O9GA 4FT8A 4XFBA 2FQPA 4F7ZA 4RD7A 5EZWA 3MDPA 3E5XA 5D1IA 5FCCA 2MHFA 4A2UA 4ORFA 4J1XA 5KBFA 3I54A 2BNNA 3QACA 3TNPB 3SCFA 5I0UA 4AQ6A 5JAXA 4QXKA 4UBHA 1U12A 1VR3A 5KHIA 3R6SA 3OGJA 3D82A 2O1QA 2N7GA 3SMHA 4E2QA 3H7JA 4QX5A 3RZZA 4D7TA 2ET1A 4BIFA 2EVXA 5JCTA 4ONUA 3I59A 4HN1A 2BYVE 1IPJA 2GC3A 5BUVA 3E97A 2QJVA 4E2GA 1CGPA 5I0SA 1YFWA 3D0JA 3H1YA 2WFPA 1YFYA
chains in the Genus database with same CATH superfamily
4MOAA 4CUCA 3NAPA 3VDDA 3VLBB 5LATA 3POSA 2BWAA 4META 5ABJC 4IEZA 1LHUA 2JXAA 4QDSA 4FCAA 2XLAA 3POJA 4GKXA 3HNYM 4OULA 2VZQA 2IXKA 2VH9A 5FP7A 5IW0A 1GKBA 4D6QA 3W5MA 1ZRIA 1TVGA 5DUXA 2HWC2 5T5OA 4B29A 1W8WA 4I3PA 1XE7A 3U78A 4AVSA 5K0UA 1POV1 3VZNA 2Q8OA 1R1A1 1QF3A 5F9TA 4G9SB 4FFHA 5JOXA 3Q8BA 4GULA 1J84A 4YRDA 3CJIC 1W0PA 1ZZ6A 3BIWE 2JDKA 3AX4A 1WLWA 5A33A 5ABJA 4FPCA 1IOAA 3CLPA 5HBAA 3J7LA 3SKJE 1QJX2 1ZRRA 3BPSA 1LKNA 1W2AX 1H8TB 1OPMA 1UL9A 4R4ZA 1PO12 2DWRA 1AR61 1V70A 1GQHA 2Z4FA 3JB4C 1LGNA 2BVVA 4K40A 3A22A 4RR3A 3MLLA 3K51A 5FJKA 2BNMA 5FZ3A 1R081 1UYZA 3VBHC 1PK6C 2ZZQA 1AX0A 5T55A 4BJ0A 3ZXDA 1JYNA 1AR63 1VMFA 4JQRA 1OBNA 3ORJA 1NYWA 4YZ4A 5LEKA 1RYYA 2VOVA 1HQLA 2ZMNA 3B9IA 3MO4A 1UXXX 2YY1A 3BODA 4QHZA 1VRH2 1BEV3 4NMIA 1W2TA 3PU3A 1W99A 1DCSA 2D6PA 2ZA9A 3LD8A 4Q4W3 4LNVA 1QJU3 1LESA 1Q8QA 4RS5B 3SHRA 4S2HA 3TEYA 5JZGB 3N4MA 3BTAA 2UY8A 3DV8A 4GB32 1Z7S1 5D8AC 1HV0A 1QQP3 1SACA 2QE3A 1PK6A 2WNEA 4Y1ZA 3PIJA 3VBHA 4JGZC 4CZSA 2QUOA 4S2FA 2JG9C 4ITCA 1AYM2 1WCDJ 2Q30A 4LIUA 4P5HA 2CNAA 3ES1A 4ZU5A 4UBGA 5A3OA 1NA1A 1AHSA 3MIGA 5C7GA 4UFJA 5IFPA 1BBT2 5J1XA 1V9U1 3AB0A 5A3NA 1VBB1 4DNYA 1SMVA 2Y34A 2ZKNA 2D3SA 2R0HA 1HRV2 5LK7B 1PGL1 1NZCA 1I6XA 2HEYF 3DCQA 3OEBA 3Q8EA 3LWCA 4MHRA 4Z1VA 3ZOIA 3VKLA 1ZZ9A 5LK5A 1IG3A 1W6OB 5FY7A 2QQLA 4KWJA 2JG9A 1MEC1 2A5ZA 4P9XA 4M3CA 4LKSA 3MIBA 5KHKA 4OZOA 4LKFA 3VD5A 4CDXC 2OQ6A 2AYHA 4JKLA 3KD4A 4FFIA 4BCUA 3HEIA 4TSVA 1RL3A 4PQQA 5FLJA 3ZMNA 4OUSA 5A6XA 3IMNA 4TYSA 5BNQA 5HV4A 1YHFA 1MZ6A 2ZPXA 4MG2A 3PVNA 4PBOA 3THCA 1JYWA 3H3ZA 2D5FA 1GWKA 3POWA 1ZBA1 1MS8A 2VZTA 1POQA 1RIRA 2DUQA 4M00A 3T2QA 4FAHA 4CXYA 4AVVA 5HV0A 1JZ4A 3ZFEA 4CDXA 2VTXA 2WNVB 2DBIA 4UFKA 4V1PA 4PI2A 5F5CA 4XF4A 3A7QA 4HKLA 4CEYB 1W8ZA 3I59B 4D8MA 1UIKA 1OURA 4IL7A 3UYJA 3ZPYA 4LBJA 3PUQA 2XVGA 1J83A 3U0ZA 1I5ZA 1UO9A 5EYXA 2DTWA 4NROA 3T30A 1GR3A 1AL0G 5FZMA 1RUF1 1S0GA 4QXHA 1KRIA 1HRI1 1W6MA 4FPJA 4MLOA 4QM8A 5A7OA 4Y24A 5E16A 3URFA 2MEV3 5CFDB 4OHVA 4HBNA 1X8EA 1B35B 1U5YA 5FZOA 2IXHA 3HN1A 2DYCA 3NWKA 3NAPB 2R072 3KM5A 2EIGA 5IFTA 2A6VA 2WN3A 3KF3A 2PHTA 3K4DA 4OHXA 1O8PA 2BEOA 4NRPA 4W65A 4HLTA 4TLFA 3ZYPA 2VGDA 3RYRA 4AE2A 2P6CA 2PHXA 4P08A 2PHWA 4Z07A 2D3PA 4FBFA 5K0UB 2AENA 1QXPA 2DURA 3KF5A 3FZ3A 4HOOA 4N9HA 5M0TA 4FPYA 1W9FA 2XOMA 5GZFA 4AGVA 3I7DA 4A42A 2WWSA 3C7FA 3RS6A 1GZCA 4CCMA 1EAH2 2D7FA 2FZ2A 5A33B 4NE9A 1K5JA 3R4UA 1CZVA 4B3NA 2G19A 1P8JA 4EN7B 4QPWA 3U11A 4K9SA 1FPN3 4DOUA 5FPZA 1Q8SA 2XGXA 3ABZA 4CCCA 4HXCA 5FYBA 1UY0A 4XMIA 3SC7X 2ZCWA 3AYEA 3BALA 1FOD2 1H2KA 1PO21 3ZXEA 4RR3B 1RUJ1 3KSCA 2Y33A 3WOGA 2A73B 4H7MA 3W21A 4LO8A 2WS91 2KA3A 4AFCA 3RFRA 2C0ZA 3BTXA 1C5IA 1NZIA 4NHKA 3OCPA 4HVQA 1RUJ3 1VBA1 5HCAA 3D4KA 4B1LA 3N9MA 4A7YA 3JXSA 3HN3A 5E1RA 1A8DA 2R7EB 4RHV3 3AKSA 5KXBA 5LASA 3PTYA 3GGLA 5FAXA 1ZA7A 2ZEXA 1LJ7A 3UKNA 2VM9A 5KHJA 4BH9A 3PMEA 4WVVA 1CIYA 1HX6A 4XACA 3WF3A 5KXEA 3O5SA 4E2SA 1OHFA 2JICA 2DVFA 2ZKLA 1W3VA 1RUC3 1ZREA 1O3QA 1ASJ1 1NA1B 1OA4A 2HWD3 2K9ZA 5IHRA 5A32A 4Q0PA 2XDVA 1CWPA 4FI9A 3AP4A 1GNHA 1BKZA 1O3TA 3I49A 2IFWA 3LDBA 1DBNA 2AH2A 2PLV1 4WZFA 3TEWA 3DPRC 4M3CB 1WD3A 4FO9A 3J8F1 4Y20A 4LO7A 2XH6A 5LRRA 5AC91 4N7IA 4C0BA 3IBMA 2PELA 2E63A 2BQPA 3AC0A 1XYOA 3EB7A 4AFMA 5L19A 3MBWA 4F8AA 4XUTA 3TWIA 3MF9A 2O14A 5FZKA 1NKGA 3K48A 2QFEA 4RA0A 2GNMA 3H1MA 1JOPA 1O59A 4GQ7A 3VZJA 2FCUA 1NCRB 3WW2A 1KS5A 2BNOA 2J1EA 3KCXA 3S7EA 3NV1A 1JN2P 4L92A 3DPRA 3AVSA 3RZHA 4ZU7A 1NE6A 2WZ8A 2KD7A 3OTFA 2R061 4GWMA 3ZFEB 3VN4A 2JE9A 1MS5A 4UFLA 2C4XA 2ZMKA 2J7MA 1CJPA 4IGPA 4A44A 4QM9A 2Q1MA 4XZPA 1QJY1 2JD9A 2ZHNA 4YZ2A 1AYN2 4XYXA 1FX5A 5BXXA 4PI0A 5LA1A 1OQEA 4LA3A 3NQHA 2R063 3UJQA 5LCWL 4AEKA 1UYYA 3FHIB 4ZXEA 3OPTA 4TXWA 2SLIA 1NXD1 2ZBJA 1OA3A 1OQDA 2WUHA 3DYMA 4IEWA 5DUVA 3BUCA 5T3NA 4AG4A 4DY5A 1QJY3 4C1XA 4WV8A 1APNA 4HVOA 5I0DA 4Q4X2 1H1MA 2RM22 4XFCA 1L7RA 2Y6FA 4LO4B 4AQSA 3BU7A 3FLTA 1CAVA 2PMWB 2W9XA 3LSEA 5G04L 5FZOB 5A6ZA 2KM2A 1MS0A 2WZR1 3KQ4B 3SISA 1UD1A 4NN0A 1CN1A 1MPXA 3NV2A 4PCRA 3LOIA 2VOKA 1FXZA 2NLRA 4LORA 1I1EA 1TG7A 3T2OA 4B7KA 5IK5A 2CGPA 3F2ZA 2VZPA 1JMUB 1DP0A 4BE3A 3ACGA 5IUQA 5C4WC 4CCJA 4ZHNA 2QQPA 1GWMA 4LITA 1E5SA 2ARCA 2C9AA 2A71A 2CHHA 4JAAA 3ILFA 3OSDA 2OKXA 1TMF1 4ARXA 3DF0A 1GP5A 5KR7A 4C1WA 2VZ3A 2VCCA 3BGAA 4DB5A 2ZX4A 2PYTA 1TEIA 1VRBA 2XVKA 1DYPA 3MV01 4JDNA 5C8CB 3NW4A 2Y0OA 1FV2A 1TMF3 1XE8A 4H14A 5C4WA 5FXZA 4AFDA 4TZDA 4JKMA 3PUAA 3WZ1A 5I8TA 1PX4A 5FOJB 3EBRA 3N7JA 1MQTC 3UKVA 1X33A 2YC0A 1RUD2 4QPYA 4XFIA 1TQ5A 2WC2A 5GZDA 5CKQA 5CB7A 3D8CA 4HKOA 1NXMA 4LULA 4XCBA 2CU5A 3U4XA 1BVVA 4Q4Y2 2CV6A 3PJYA 1GZ9A 2VUJA 5GALA 3U4SA 5FQ0B 1PIV2 4QX2A 3SH5A 5FO7B 5JXIA 1RUH2 2CAVA 5J3UA 4XTPA 1H1IA 1SBEA 4LBQD 4WVWA 2RS53 4JDMA 4BYYA 2D6MA 4NWVA 5B2GB 2KR2A 3T2TA 3I2KA 5CBLA 2HWC1 3ZX7A 2ZGUA 1KQRA 2QDRA 3WHUA 2G4IA 1LODA 1S0DA 1TME2 5EIYB 1GQPA 2DVBA 1PX3A 3ZSJA 4WVMA 2BOJA 1D2QA 4JGYC 4B1MA 1G8WA 3ZFGC 3J7HA 5FREA 2YU1A 1DF0A 2JDMA 3IWZA 1QJX1 3GYDA 4INDA 1Q56A 1YQ5A 2UWBA 1WLDA 1W9TA 1PO11 3O1MA 4XXPA 1UW8A 4XJAA 2XUEA 1O4YA 3S30A 4GMP3 4LE3A 3KT7A 1SEFA 2W2IA 5JPMB 4QB6A 2IXCA 1W8TA 4A3XA 4R9DA 2AREA 2A3XA 2JG8C 4E4DX 3KGLA 1F4HA 2RS13 3ZFGA 1NQDA 2HWB2 3GM8A 1SHWB 4BA6A 2W1UA 4YGDA 1PO13 2EAAA 3PMSA 4FP2A 5FZBA 4AEJA 1B09A 3KT1A 3KLSA 2Y64A 4D69A 2VZSA 2CSGA 3IKWA 4AW7A 2O8QA 2WR9A 2G9FA 1VRH1 2XBO1 3A21A 2HBTA 3IMMA 1MS9A 4LE4A 4LUKA 1JZ8A 3WINE 1GOFA 3WV6A 3KV5A 4NIHA 2XJUA 4IESA 1W06A 4QPIA 3IT8A 1GSLA 2C9KA 4QQLA 5L73A 3T0AA 5FY8A 3THDA 3WP5A 3O0WA 4P14A 2E9QA 5C33A 4KBBA 2XBO3 1YQCA 5I93A 1AYM1 3IM0A 3U07A 2YU2A 2BWCA 5FO9B 3JBG3 5A7QA 1EV13 1BBT1 3T4VA 1LHWA 4RQPB 5L9RA 1MR5A 1W9WA 4MXWA 1HRV1 5BNOC 1FNYA 3ZSEA 1OVSA 4MHUA 5JOYA 3FBMA 3GJBA 4PBPA 1G9AA 3IPVA 4UFMA 5CKMA 1VMHA 5LBBA 4DXSA 2VU9A 4CXWA 4O9GA 4FT8A 4LBKA 3TEXA 1VBE3 1GOHA 3E5XA 5FCCA 3FHQA 4NHMA 1BK0A 2A70A 2WO7A 5DPNA 1D0HA 3UGGA 3VKFC 5EXOA 4AAXA 3C7HA 3OEAA 4YM2A 4E8DA 2V5YA 5LA0A 3ZYJB 3DXTA 3I2OA 3NV3A 3TNPB 2YPJA 4XJ9A 3UETA 4CCLA 2OW4A 5J37A 4RGGA 3WP6A 5A3MA 2FBEA 2BOIA 2VL4A 4GA9A 2HEVF 5FPVA 4EE2A 5JAXA 5DZFA 3DECA 4L97A 1VR3A 1D4M2 5IVEA 5F3GA 1F2NA 1LU2A 4YW3A 4YLZA 2NPIA 3D82A 3WDUA 1RUG2 2WA4A 2N7GA 3O0XA 4A6SA 2XHNA 5E8AA 4D3WA 4D7TA 5FZ7A 3VBSC 1NCQB 1N1TA 2ET1A 5JVVA 3RZLA 1ENQA 2CL2A 4LR4A 1YC61 1DLCA 1ULPA 4NOTA 2W0XA 1KDMA 2ZMLA 1ZBE3 5FPLA 5FYIA 4DMIA 3O1VA 1QMJA 3AJYA 5A7WA 3FMGA 3VZOA 2QQIA 1JXNA 1HQWA 3B7MA 1A8MA 1AUYA 1U5ZA 3UGHA 5FZDA 3T1LA 3ZYFA 2X5IA 1YFWA 2WNUB 5DN2A 4PF1A 5FYYA 3VBSA 3J9SA 2R071 4Q1RA 5FUNA 1S0CA 4URTA 1OFSA 1PM4A 3TEZA 1UU6A 1YFYA 5FUIA 4DFSA 1BMV2 1WCQA 4CU8A 2PQQA 2BU9A 4XQWA 3USUA 2FCVA 3U37A 5I8YA 3PTRB 4YVWA 2WQ4A 1YWKA 5JR2A 4QAWA 4RGKA 2R073 4FVVA 4MX3A 3WDWA 3BVCA 1OLRA 3GHMA 4FFFA 1MZ5A 1XQNA 4ASLA 2BERA 4R52A 1H30A 3O1PA 1WMDA 1A34A 1G7YA 4HK9A 1EAH1 2JIJA 1TNFA 4QGLA 4Z92B 2LROA 2ET7A 4JRAA 3N9QA 5LRSA 1QY4A 1R092 2GN7A 2ZGOA 1AR92 1H8TC 2QQVA 1MZEA 4OZXA 1YQ8A 2D98A 3KS7A 5FFOC 1QNYA 3WSOA 2GP5A 2IWGB 1WLCA 1FOD1 3PLQA 4BOWA 1HXS2 2BRTA 5C70A 4Y1VA 4OFGA 2XKPA 5FZ8A 3J7NA 1LGBA 3E6CC 3RWNA 2V4VA 1ULFA 2QTWB 5HXMA 2JEMA 2GNBA 1Y4WA 3KT4A 1SCRA 1W3XA 1LTEA 1KS4A 3AP7A 4QU1A 1H8TA 1SFYA 5AVAA 2EA7A 1Q43A 2BFUL 1M06G 5FZ6A 2XPJA 2DDUA 4RS5C 3ZKUA 3FX3A 4LHKA 5JZGC 3LAGA 2WN2A 4M3CE 1YRZA 4YZ3A 3K77A 3HQUA 2MNGA 4QPIB 3GCWA 4LO5B 5ACA3 1RUE3 4P9LA 4K1YA 2B45X 4E4SA 5LY2A 3GHNA 3OGRA 4MGKE 1L7QA 3QOPA 3UESA 3H8UA 4YGEA 4MADA 2WT1A 4FTSA 5FXWA 4B4QA 3RZJA 1W6NA 4K20A 3S5QA 3AJZA 3VDBA 1LAJA 2OA2A 4RS5A 5IVBA 4X8PA 5ANNA 3WQBA 1ST8A 5BYNA 1X82A 4JTNA 2D6LX 1UZYA 1RJ8A 1OQ1A 2HBUA 2BPA2 3ST7A 3INAA 1RB8G 4DRVA 2W08A 1F4AA 3IDBB 4QT6A 1RUI2 3VHNA 1AL22 4MGSA 3MHZA 3C3VA 5HXVA 2BTVC 3TOJA 1RXFA 3GXUA 3LF7A 3MFAA 1W0NA 2OS2A 4Z8BA 2E6VA 1XSQA 5F7UA 2Z42A 1JYCA 2JJ6A 2ZAAA 2XJVA 3AKQA 2XJTA 3UT0A 3KHCA 3BIEA 1RXGA 2W1WA 4LKDA 1CJDA 1XB9A 2R1BA 3WNOA 5F37A 4I3GA 1UWWA 2WNVC 2HKXA 2UWCA 4IUGA 4KWKA 2BVBA 2IVIB 4OI2A 1JYIA 3GZUC 5LBEA 4CEYC 2WSUA 1QHDA 4XF0A 2P17A 2YBSA 4LHSA 3CF6E 3FWEA 2R1DA 2W87A 3A0KA 1N3PA 3NO8A 1IKPA 1AYN1 2NN8A 4LKEA 1NY72 3MUY1 1ZRCA 1PHMA 2ZGTA 3DKQA 3KHBA 1OLQA 5GLVA 3HVDA 3AYDA 1LOFC 1MVQA 4FSJA 1OPOA 4NPLA 4Q0QA 5EWSA 5A7WB 1J3PA 2WNVA 1F9KA 3DEMA 4LLFA 4DUWA 2VMFA 4W6XA 5BNPA 5KWRA 3MW4A 4Q4X1 2RM21 5FP3A 5FYUA 3I2GA 5CFDC 2X5IB 1B35C 4HVRA 3TN93 2W91A 5GLWA 2RMU2 5FPXA 3FLPA 1US2A 2YYOA 3EMRA 3NAPC 4HMZA 5FZ0A 2LS6A 1QDOA 2PXJA 4GWJA 3VD4A 1I5PA 1TE1B 4Y5SA 3R0RA 5K9YA 1ONAA 3VD7A 3GF6A 3KV9A 1CVNA 4ISRA 5FY1A 3TAYA 1OXCA 1UYXA 4AEMA 1ZZ8A 3JQXA 4TN7A 5EV7A 1QIQA 2XWJB 3TYJA 3AZZA 5K0UC 1DGWX 2GAUA 2ZGKA 4YVWB 5FV3A 2TUNA 4IEQA 5FZCA 4XAAA 5CFDA 1B35A 3LPGA 5EYYA 1LGCA 2Y26A 3BTZA 1XYPA 2ADEA 1W9SA 1BZWA 3ALQA 5CG9A 1X50A 2GSYA 3JD72 2ZGLA 5LB6A 3BTYA 2Z2SB 2J42A 2GDFA 2WZEA 3CZJA 4NJ4A 3POFA 2X05A 3H3UA 1W05A 4XTMA 4RL7A 4K8FA 4KNCA 2FDJA 3M7AA 4RR3C 5L9VA 2UWAA 3VBUB 4XBNA 4UW6A 4CCKA 2W39A 3ZKYA 1RUD1 3Q9OA 1YIFA 3FUQA 1QJZA 1GICA 3HQRA 1SDWA 5K8SA 1POV3 2R16A 1R1A3 1ND3B 3NNMA 4CP2A 5EJ1B 3BCWA 3MW3A 3ZXJA 3B93A 5E88A 3WNMA 1QOSA 4PLMA 1MS1A 1SBFA 4BQ5A 4XMAA 3OBRA 2VZUA 1PIV1 4A4AA 1UCXA 1RUH1 2AR6A 3JQWA 5FY0A 1N3OA 3AMPA 4FPOB 3MEPA 3HPNA 2ZABA 1O5UA 1Q5OA 3FLRA 5T5JA 1CQ9A 2J22A 4XFFA 3M8LA 2E32A 3VBRB 4AI1A 3LA3A 3OD0A 3LEIA 4BPZA 1WCUA 3D5OA 4W6YA 4AF9A 2VNOA 1TME1 4GALA 1RUH3 1NA1C 1IS3A 3GZAA 3O12A 5FLIA 1R083 3M2MA 5E89A 1W6NB 1AJKA 2ZX1A 1HB3A 4EZ4A 2G9ZA 2VC9A 2RJLA 1JZ3A 1Q8VA 1KJLA 4COVA 2EAKA 4TTGA 2ARBA 3BU0A 1NQJA 1G6NA 1G9DA 1PVC2 1QH7A 2RDSA 1LRHA 4XXAA 1ODMA 4ZS3A 1ULOA 1UX7A 2Q0AA 1PGW2 4K7JA 2Y6JA 1ZVFA 1Z7S3 5I8SA 1BHGA 4MYEA 1OFNA 2HWB1 2QZ2A 2O0OA 1Z0HA 5FO8B 2RS32 3A0NA 1NCRC 2DTYA 3ETQA 3N9PA 3PVBB 2DVGA 3JZVA 1DLLA 5DDJ2 1V9U3 4P9JA 1VBB3 1XC6A 2OT7A 4LBOA 2HWB3 4NHLA 3ZFEC 2BV4A 3AMQA 3MPBA 4PIYA 4PIZA 3UGFA 5T5LA 3RMYA 3USSA 1VBD2 4PJYA 3WQ1A 5CZKA 4Q29A 2YG0A 3MFCA 4XPVA 5F3CA 2ORZA 3KCCA 1MEC3 4YZ5A 3I97A 1JZ2A 3T0BA 2GH2A 2R042 4GD4A 5FMOS 1NCRA 4HKWA 4FTBA 4XILA 1QEXA 3W5NA 2EIBA 5DAQA 1N1SA 5T50A 4FPFA 1YCIA 1DZQA 4P9YA 3GNEA 5BNPB 4H3WA 1KFUL 5BNNA 3SKVA 4MZUA 4E4HA 1ZBA3 2TNFA 3H9AA 4BU2A 3NNJA 1A6CA 2YBPA 1U0AA 1W90A 3L2YA 1V0AA 4I0WB 4MH0E 5FYSA 2LALA 4LHNA 4O9EA 5GKAC 3M3CA 4D6SA 4R8HA 5F5AA 1HN0A 1XU2A 2LUWA 2D6KA 2Y6LA 4ZONA 3OUIA 4X6RB 1YIPA 4YG0A 4QXBA 4F3JA 2R32A 1IGOA 3CEWA 5KHGA 2GMMA 1C4RA 2DV9A 2VW0A 1QOOA 5FIXA 4PF5A 3H1WA 4A45A 1O5LA 1H1AA 2VBPA 2P37A 3IAQA 2A7AA 1RUF3 3QBQA 1FATA 2W94A 1FMD2 1D4M1 4LK7A 1HRI3 1YJKA 4V2VA 3OY8A 5C8CC 4N90A 5CG8A 2CYFA 1COV2 3HBKA 3I2IA 4BMEA 2VAUA 4NIDA 1EUTA 3ZFFB 4XEZA 4JC1A 4LLOA 1W0OA 3OF1A 2VQTA 2ZAHA 3X29B 5FP9A 4XZUG 3VDAA 5CYYA 4K21A 2DU1A 4ES9A 3FFZA 3AZVA 1QWRA 2OIIA 1XE0A 5F2WA 1LOCA 4GWNA 1XJAA 1GMMA 4AHXA 4DUVA 1HW5A 4BQ1A 1GU3A 4COWA 2DVAA 5D2AA 1DGRN 1ULCA 1HV1A 3ZLIA 5C8CA 1Y3TA 2HWE2 5FDBA 3DYPA 3VHOA 1GP6A 2RDNA 1C8M2 4AVTA 2ORXA 1LNSA 2GC1A 3I8TA 3ZYIB 1S0BA 3OBAA 4LBNA 5CNAA 5JSPA 3APBA 5IK4A 3NJZA 3MICA 2WFF2 1V6JA 3IN9A 4UF0B 2YUEA 5H9QA 5JOWA 3RYKA 1ENSA 4KG8A 5A3TA 3OPZA 4RGAA 1VB2A 4Q8KA 1DG6A 1L3JA 3M3EA 1X8MA 4HSLA 4XFAA 4XJZA 1AR72 3HOBA 1PO23 1CONA 2ZTNA 2BUKA 3GZTB 4Q27A 2GNTA 4AVBA 5A3UA 1I9RA 4KGQA 4UXAA 4QQ2A 3CIHA 1ZM1A 1IS5A 2EICA 2TEPA 3D3AA 2WS93 5FQ0A 1YFXA 2P3JA 2P5BA 3P1IA 3TRSB 1BXHA 4BXFA 2WWUA 3GALA 1R091 4NWWA 3SEPA 4ES8A 4UWDA 1AR91 1VBA3 4CEWA 1YJLA 4I09A 4X6QB 3HNMA 1H2LA 3I2HA 4HK8A 4NIAA 3POEA 4EN9B 1HXS1 2NZ9A 5AVPA 1CAXA 3N7LA 4U36A 3LA7A 5FWEA 1C57A 4XQ4A 4Y33A 3ZXGA 3TBDA 3ZSKA 4AYUA 2XVLA 5FZEA 2XQRA 2D43A 4XETA 1REFA 4LO6B 2D93A 2JDYA 3F95A 3N3HA 1OA2A 3ME2A 2VUCA 1ASJ3 2F4LA 2VVFA 4W50A 3SXWA 1EP0A 4XHXA 1JOJA 3VL8A 1BCXA 4DXRA 3M70A 3S57A 1J3QA 3CHXA 2QVSB 3O0VA 4WM8A 3PUIA 2VCBA 2YZ4A 1JHNA 2DUOA 2Y60A 3EHKA 4Q4V2 3FHAA 2PLV3 2W68A 3WP4A 4LK6A 4PLOA 3CDZB 2H0BA 4LQRA 3J8F3 1LECA 2Q5TA 3FE5A 1AR82 1ZZBA 3Q8FA 4NR1A 4H7LA 3WVJA 3ZPOA 2RR12 5AC93 2WDBA 1JYVA 1W6QB 4RQPC 1JUHA 1VBC2 4YZ1A 5ERLA 4OQ8A 5F3IA 4CU9A 2JDPA 3ZR5A 3AKTA 3K2OA 2XHKA 4UT5A 5FXXA 4GH4A 3T0DA 3SH3A 1RHI2 5BNNB 2A1XA 2D6NA 2VD7A 5DZEA 3DN7A 1WKYA 1YI7A 3ZN6A 1SDDB 1MZFA 4XIOA 4CP1A 5IJRA 1H2NA 5A3LA 3ZDVA 3IZOA 4QGMA 1S0FA 1S0JA 1GZTA 2OQ7A 1RUI1 4RQPA 4MO3M 5JMOA 3NJVA 1O91A 1AL21 1UAIA 2FQPA 4TWTA 4F7ZA 4RD7A 2YFZA 4UFIA 3MDPA 2VTXJ 5D1IA 5FP8A 2DVDA 4IDZA 4NIIA 4XBLA 5C5TA 2AC1A 2VTFA 2W1QA 5KBFA 3POGA 3CBNA 3I54A 1RVF2 4Y26A 4LHLA 4AI8A 2GNDA 2BBAA 2I07B 2BGOA 3ACIA 4FFGA 3OY8B 1AX1A 5I0UA 4AQ6A 4ZXKA 3ASIA 3HWJA 1U12A 1GYKA 2P3KA 4UBHA 1JH5A 2WZR3 3R6SA 4DS0A 1NCQC 4M4PA 1OF3A 2Q8CA 4E2QA 4P5YA 3H7JA 1T2XA 1HB2A 2HYKA 3KCYA 3LDKA 4Y5TA 4JKKA 3V0BA 2EVXA 1F15A 1S2KA 4ONUA 4HONA 5DXDA 2P1BA 3AL5A 5H9PA 4AEDC 1A3KA 5C5UA 2E7QA 1GANA 4HN1A 1URXA 1YYNA 2WNUC 5FJHA 3UV9A 3MUZ1 4CUGA 2RMU1 2GC3A 2WLPA 4AHZA 1NCQA 2WIIB 4BQ2A 4EN6B 5IAXA 1CGPA 5FMCA 3H8OA 2JDZA 3ZN4A 5J96B 2ZGRA 3RI8A 3UNPA 2VULA 3D0JA 5E6HA 3V56A 2R6QA 3WNLA 3DYOA 3K75B 4SLIA 2RMU3 2WFPA 4AEDA 2ZS6B 4AGGA 4LA2A 1VMJA 2FHRA 3BYWA 1Y9QA 4Y22B 2WNUA 1MS3A 4IETA 4Z82A 2JD4A 1GOGA 1QKQA 5JPNB 4YVSB 1IQAA 1PMIA 1IZ3A 1AXYA 1OLME 1UY2A 5FMBA 2PFWA 3JD71 1UU4A 1X36A 4TLGA 4ZU4A 4D94A 4EWDA 1OI6A 5C9AB 4COZA 4I2OA 4CEWB 4UW5A 2Q4SA 5EFUA 1UIJA 2GH8A 2D97A 4FOWA 4N53B 4U2AA 4YFWA 5HCFA 3VHRA 3W59A 3WG2A 3WNXA 4C0HA 2H0VA 1YUDA 2ENRA 3E6BA 3ES4A 1CAXB 3GZEA 2DF7A 1WGPA 3KVBA 4QD2A 1KGYA 1WZXA 3FFQA 4OUEA 3VBOB 3NJYA 2QQNA 5FPAA 2OUJA 2HWC3 1UMZA 2VO5A 3IDCB 4UYBA 1UPIA 3MGUA 1DYOA 3H42B 5JXHA 4CP0A 3N9NA 4ET7A 3EO6A 3OOXA 1BEV2 4Q4W2 2YDEA 1QJU2 2ZHKA 5CIRA 4CA9A 1IPSA 3P3NA 3I3MA 4QX8A 1UNBA 3DKWA 3NL1A 4WM8B 4GJYA 1QQP2 4QPIC 1QJX3 4GKYA 5CEHA 5IAVA 1V6LA 2C1FA 3GJAA 1N1YA 5G05L 5FZGA 1IS4A 5DAPA 5EJ3A 5CKNA 3HMYA 1BJQA 1QXRA 3B02A 3AM2A 4UOJA 1TZOA 1LB2A 2XJRA 5C6CA 1V6IA 2QQMA 5BPXA 4EROA 1TNRA 3ILNA 4ZY9A 4YGCA 3KWVA 1J1LA 4RFRB 5SV8A 2J1VA 5CFCA 2MPFA 2YBKA 4O7XA 5EPAA 2JWPA 1VAVA 3WF1A 4C91A 2VBBA 1Z78A 4MGZE 4GH4B 4GB31 4OMCA 4J25A 1H8VA 2RV9A 3LCPA 3SITA 3WX5A 4N7UA 5BY5A 2YGLA 4YNIA 5KC5A 1ND2A 1ZX5A 2DFCA 3FC0A 3IDAA 1VRH3 3NNGA 2JX9A 4MUVA 4XJWA 3ZN6B 1CX1A 5JOZA 3HJRA 4K8RB 2WO3A 4OI1A 4EV0A 4Y3OA 3HT2A 5JSRA 4GWIA 2VQUA 4WM7B 3I4IA 1PGW1 1OH3A 2VMIA 2VMDA 4GB33 5FP4A 2A75A 2OUHA 1K45A 5KHHA 4JVAA 1OKQA 2VCMA 3GDBA 4YSFA 2QQKA 2GMPA 2VCAA 1W04A 1AYM3 3WW4A 1ALYA 2RS31 4IQPA 1UOFA 1EPWA 2B5HA 1BBT3 1JS9A 5DDJ1 2WRAA 2XLFA 4YM0A 3ZXFA 4B8EA 4QDQA 1W2UA 1WA4A 4QX1A 3RZGA 1HRV3 1EY2A 5I0TA 1PZ9A 1QJFA 3GBGA 1EUUA 1CZTA 3BPZA 1LOGA 2L9LA 4I01A 2VBDA 2P6HA 3QLQA 4LBMA 2R041 4CDQA 2JB4A 4A41A 2QNKA 2O8OA 2WSVA 1UU5A 3ZYRA 4FAGA 3BOWA 4CDWB 1ZA4A 2DU0A 3B3QE 3WF0A 3V0BB 1OMIA 5DZGA 3R05A 3OJBA 1CR7A 2MEV2 3V65A 1S2BA 5A1FA 3BOPA 2X5IC 3HIFA 4CSWA 1DGWA 1C1FA 2GZWA 3IDEA 1KDKA 3OGSA 4XJ8A 5HI0A 2FMYA 1XYNA 1PMHX 1WCKA 3LDRA 1F31A 3ECQA 2NMNA 3ITQA 2A6YA 2V09A 4R9CA 3VKNA 1S2EA 2X8KA 3WNNA 3PL0A 5LBFA 4PIXA 1JBCA 4AEDB 4YVWC 3WCSA 3FN9A 2UU8A 3E6DA 4BK5A 2QQOA 2UY9A 2AEYA 1JYTA 3LZZA 4QMAA 5J98B 4IGQA 5HCBA 3U14A 2LTNA 4ASMB 1ZZ7A 5AFEA 1DQ4A 1FMD1 1OH4A 2VXRA 2VZVA 3B5LB 4IE4A 1OKOA 2ZGQA 3HNBM 1FPN2 3ZDSA 2XMLA 3KZ4C 1G9BA 1F8VA 1PGSA 1COV1 5J36A 4KWUA 5FPBA 2BW8A 5A3WA 3O1SA 3O1RA 2AZ5A 4FQ4A 1DQ0A 3NVCA 1RINA 3VBUC 5JWPA 2VZOA 2WZPP 3AZYA 4AI0A 2FDGA 5J09A 4XDPA 4P00B 5F39A 1NT0A 3O7OA 3WW3A 3L9JT 3WDVA 1ND3C 1SFPA 3K46A 3PNAA 3SCGA 4CYDA 5L36A 1RUJ2 1WUVA 1LHOA 3NNFA 2HWE1 1PVXA 5A7NA 3DL3A 1AJOA 2R49A 2JENA 1C8M1 4RHV2 2C26A 2VOTA 1EAH3 3MIHA 3H7YA 4QWNA 4ISQA 1WA6X 1X9PA 2E26A 3ACFA 4HETA 5FXVA 1BQPA 3VBUA 5A6YA 1PM7A 1UXZA 2WFF1 4KI5M 1SPPB 3AKRA 1W2NA 3I3EA 4GJZA 2VMHA 3VBRC 4LPLA 4OUMA 3AP6A 2WQ8A 3AMHA 1ND3A 5B4NA 1AR71 1FOD3 1RUC2 1AX2A 2HH9A 2WAAA 3AK0A 2GU9A 1KFXL 2VQ0A 1O7FA 2XL9A 4YPJA 2WINB 2HWD2 3RVHA 4BQXA 1OLMA 1A78A 2EALA 2CDOA 4NVPA 5CFCB 5JIAA 5K7PA 3G7DA 3P6BA 1OD3A 5A70A 2XWBB 2BGPA 2VXJA 4QKDA 5B4XA 1UYPA 2OYZA 1CAWB 2RHPA 3HD8B 3NKGA 3THPA 1T6GC 4AZZA 3SNMA 3K3OA 2DCYA 1UMIA 2ZOEB 1ND2B 3VBRA 3ZYGA 2XLGA 5JI9A 2I74A 3LEMA 4P9IA 2PA7A 3MPPG 4E27A 1G86A 1BVP1 3I3BA 1RTVA 3IB3A 4GXLA 4J1WA 5LA2A 4EQVA 1E57A 3RSJA 4E8CA 4NHXA 4YGBA 3RDIA 4AI3A 1REEA 1ZRFA 3JU9A 2WO1A 1NX9A 1W6PB 2FDIA 3LOBA 4CDUA 4RFT0 4HPKA 3K4ZA 5FRAA 2SBAA 2NQYA 4HANA 4O61A 4LT5A 4AHWA 4YG3A 4LBLA 4IE5A 1BLZA 5FK8A 4OHWA 2IC1A 2GP3A 4UAPA 1PNFA 2E51A 3OYWB 3I3QA 3S5AA 3U10A 5FYZA 4B4RA 2JDNA 5A7SA 1OUSA 4DEQA 5FPUA 3MZHA 4YG6A 4Q4V1 1V6KA 2W95A 3LA2A 5EHDA 2VZRA 3VBFB 5LEJA 4QPGB 5FY5A 1ZYBA 2R062 4QX3A 4CDQB 1AR81 4CU6A 2RR11 1HDKA 2V73A 2PAKA 4KBZA 4ZPIA 4BK4A 4DPNA 4L8QA 5SV5A 1VBC1 2BJSA 1OOPB 1IHMA 1QJY2 2DCTA 1CPNA 3AFGA 4IV1B 5GLTA 2WKKA 3RG0A 5BNPC 1S0IA 4A6OA 1O4ZA 5DAWA 1F5JA 2P2KA 2ZHMA 1RHI1 2Y8KA 1GV9A 3CNAA 5CISA 1UKRA 4AXOA 3PJQA 1PZ8A 1XOYA 2QZ3A 5H9RA 3H8RA 3WG4A 3VV1A 4EN8B 1OT5A 2D40A 2EIEA 3A4UA 3LEKA 4WZCA 1SLTA 2UYBA 2NMOA 4QX0A 2CDPA 4R9BA 2F4PA 5CU1A 1RHI3 1J3RA 1LOAA 2ZEZA 2QQUA 4FXKB 1AYN3 5IK8A 1IS6A 4OVEA 4P9WA 2FCTA 1O4TA 2W5FA 1XNBA 4XFGA 4N43B 3WNPA 1RVF1 4XBQA 4PLNA 1UZZA 3SLIA 3ZVXA 1BYHA 4G4FA 3OPWA 3WT3A 5FK7A 1UOJA 2WAOA 5F3EA 5GZGA 3LIHA 2JDUA 2XL7A 4Q4X3 2RM23 4X8NA 3B00A 4JZRA 2A3YA 5FLHA 2F6BA 2JE8A 1H4HA 1HB1A 1WMEA 1XNAA 3ZFFC 1U5IA 3ZN5A 4E4ZA 2B4KA 4W8JA 4D6RA 1Y43B 3VZMA 2G9GA 4QX7A 3NKTA 2CGNA 1C28A 1V6NA 4COUA 1H0BA 1C5HA 3QD6A 4FXGB 3CZUA 4UFHA 1V00A 2TBVA 3D6EA 2VE1A 4DINB 4D7YA 2K46A 1M4WA 5C3PA 5CADA 1OF4A 1DHKB 1ZRDA 4MGTA 1JZ6A 3RI9A 3ZFFA 1NLRA 3I2DA 3IIIA 5CVRA 2WT2A 3ATGA 5FYTA 3TNQA 2P3YA 1H6XA 3RZKA 4UI9L 2OPKA 1GFF2 2RS52 2Z5WA 3WEZA 1YQ6A 3ETPA 4L11A 1LR5A 1SBDA 4JDOA 5FMDA 4Q26A 1DQ6A 4QHBA 3WHTA 2RDRA 3D0SA 1OUXA 1JOBA 5C3QA 1PZ7A 2E31A 4LUMA 1H6YA 4HN0A 2EXKA 3E1F1 1C3HA 4M0HA 2XJQA 5IYYA 4IEUA 4LBQB 1ACCA 4Q4Y1 4OLLA 2WLQA 4IV3B 3ZXLA 1GNYA 1RUD3 2CWMA 4V2WA 1HJFA 1K5MA 3MW2A 2W3JA 2XB6C 2VOWA 3WNKA 2IFRA 2VECA 5CA6A 3RNSA 4UF0A 5IVCA 2B42B 1QGLA 4IE7A 4Q8LA 4DEVA 4Q4Y3 5TSWA 1O3SA 2DCKA 4Y1YA 2ZEWA 5DMYA 1PIV3 2IXLA 1VIWB 3ZXKA 3B94A 2ARAA 2YFUA 3BN6A 3UJOA 1LEMA 2HJIA 2RS12 2BGCA 4P02B 1MACA 2X09A 3AYCA 1RITA 3OD4A 4CDUB 1FV3A 2XJSA 4AR2A 2IXJA 3AP9A 1UOGA 1XSRA 4HPKB 4QKBA 3HT1A 1TME3 2GC0A 3CJIA 3WR0A 4JX0A 1BEV1 4CCOA 4Q4W1 2D6OX 3NRUA 1QJU1 2HWF2 2YB7A 1S1AA 2ERFA 4MVTA 4CUAA 1DDLA 1D2SA 2G1MA 3EYPA 1QQP1 3DUIA 2OZ6A 4AK3A 2H6CA 3S7IA 4Y4YA 2XBO2 3ZO0B 4XDOA 2CAUA 3FJSA 4XAEA 4WVZA 4BXSV 5J48A 3C8XA 2B7YA 2Q1ZB 2ZGNA 4JHZA 3JBG2 4YW5A 1EV12 2B9UA 5BV6A 3VD3A 5FMOL 1DU3D 3JB8A 3NSTA 4GZ9A 4Y4RA 4EN0A 2A3WA 3WDYA 4Q5OA 4N9IA 4GIQA 1LENA 3LB9A 2CGOA 2VVEA 2R0FA 2LW8A 1JU3A 4S2DA 5BNNC 5LY1A 4QDRA 3T08A 1OVPA 5JSOA 1VBE2 3CMGA 4IEOA 3QH7A 2Y6HA 3EQEA 3LE0A 1UMHA 5FWJA 5D8AA 5L7OB 1W6QA 2PTMA 2ZGMA 2VY0A 5FZ4A 4JGZA 5A1LA 1DZRA 3JCIA 4XF9A 4A7ZA 4MV2A 2OPWA 3Q8CA 3W20A 3O1UA 2PHDA 4KH9A 4Z2WA 1WMFA 3KB5A 4IE0A 4XFBA 4FPKA 4RSUA 3V0AB 4NO4A 4EZHA 4BQ3A 5EZWA 4CRQA 4XQDA 4LMFA 2MHFA 2JDHA 2HEWF 3H3LA 1XXNA 1YI9A 2PHUA 5F5IA 2BNNA 3QACA 4OMDA 2ZHLA 2F17A 1NLQA 2WBKA 3PU8A 1QNWA 3WLUA 4HFSA 3SCFA 3LIGA 4HG6B 5IVJA 5LBCA 5IVYA 1CPMA 1VAKA 2J1SA 1ZBE2 1IG0A 5KHIA 2PHFA 3N9OA 4JCKA 4A3ZA 3OGJA 4AOCA 5IATA 2FDHA 1QOTA 3WF4A 2B39A 3VD9A 1PMJX 4NPMA 4PDWB 3T09A 1RMU2 2MEV1 1CD3G 2V4AA 3R4DB 4QX5A 4XUPA 1RUG1 3RZZA 5DQ0A 2PN5A 5LA9A 2Y6KA 2X53S 5KXCA 2HLEA 4XCAA 4AFBA 5F6KA 1DIWA 1D4M3 2ZX3A 1HQNA 4BLJA 1IPJA 2Q1FA 2WYFA 4BB3A 4BIOA 1RUG3 3E97A 4CPBA 3OBZA 1S4CA 1W9YA 2QJVA 4Y1UA 5BUVA 1J1TA 3VDDB 2A6WA 1S55A 2V5DA 3AKPA 1LEDA 3VZKA 4IW3A 2A6XA 3C2UA 2IUWA 4XUOA 4YVSC 1UPSA 1HKDA 5FZLA 3NV4A 1K5MB 1C1LA 4BZ4A 1RUOA 1ULGA 2VZ1A 4MSVA 1FPN1 4FPLA 3WXPA 5C9AC 1BMV1 4PQ9A 1HN1A 1PNGA 2NYYA 2W52A 2JECA 3UL2A 4CEWC 1LCLA 1VE0A 1E5HA 4WBBA 3VL9A 4XURA 2ZACA 4N53C 4QU2A 4C8DA 4L0PA 1AVBA 3CQOA 5ABJB 4QKNA 5F5QA 4Y22A 3SQOA 3VBOC 1UOBA 2J1TA 4YVSA 3WUDA 2WL1A 2UYAA 4NHYA 2ARXA 3P3PA 5DAVA 2VW2A 5GLZA 3PURA 1SLLA 2JDAA 2VNGA 5C9AA 2AACA 2VPVA 4YW2A 4GMP0 5FY9A 3CJIB 4AQTA 3PUHA 2FDKA 4N53A 2DFBA 4RHV1 4EWEA 4L99A 2WA3A 1WMXA 2ZX0A 3OBTA 4WM8C 1CZSA 3VBOA 4FTEA 1WW5A 1R093 1RUE2 1YNAA 5ACA2 1AR93 2RG4A 1H4GA 3CO2A 3O1TA 3KV6A 5FZ1A 4AL9A 3MIFA 2D3RA 2QKDA 3FL7A 5GLUA 3IIAA 4IE6A 4QHOA 5F32A 5FUPA 1RUC1 2XXZA 1HXS3 1AXKA 3AP5A 2ZZJA 2JE7A 4KU7A 4KWLA 2HWD1 3PVEA 4DXTA 5C3SA 2FD8A 3VBHB 5FZIA 4MGQA 1PK6B 1SFNA 5A80A 4NPRA 5L9BA 2Q8DA 5FKBA 3WG1A 3S6PA 4IEPA 3KMHA 1LOBA 4KGGA 4GH4C 4BM8A 5C71A 5T54A 3DXUA 2YHJA 4OHYA 2FZ1A 3PHMA 1GWLA 3VZLA 3RZMA 3WQ0A 1HB4A 4Q2FA 4LIVA 4SBVA 1XRUA 1AXZA 2EXHA 1VPHA 2PAMA 3E5UA 1YEWA 4QB1A 1I3HA 4WM7C 1VP6A 1VJ2A 3WDTA 5D8AB 4DUXA 4QGNA 4XIKA 2ES3A 3WY6A 4AFAA 4CVUA 1EYBA 4XHBA 4JGZB 4XC9A 1ULDA 2ID4A 2JG9B 3M4FA 4LJHA 3TB0A 2D44A 1H2MA 4YW7A 4CCDA 3FBYA 4JQTA 1W8HA 3RWKX 1QH6A 1KEXA 2YC4A 4DIQA 1DYKA 1WCSA 3J26N 3RQ0A 1ZNPA 1XNDA 2AEZA 3LSDA 2WT0A 1WW6A 4KG0A 1YXWA 4YM3A 3LGRA 4WM7A 4H55A 4QXCA 1RUNA 4Q1PA 5FOBB 3ZXAC 5I0RA 1FYUA 3LPFA 2RDQA 3SCHA 4DRRA 2ADDA 1W28A 4CP9A 2H6BA 3KGZA 5KXDA 1YLLA 3C7EA 4LTAA 4KU8A 4XFHA 4KMQA 1K12A 1US3A 3BB6A 2GALA 3ZYHA 4CDXB 5C3OA 1W2OA 3N7KA 3H50A 5IK7A 1RUI3 3OGVA 1VAMA 4HL0A 4AGRA 4CDWC 5A6QA 1SLAA 1AL23 1SCSA 1F35A 5D21A 3G6JB 2JIGA 4K1ZA 2ATFA 1N3QA 1W8NA 4FPHA 1UY4A 3QH6A 4YYOA 3TN92 5JXGA 1WW4A 5DG2A 3VGIA 1IQDC 1NY71 2J1UA 4IGOA 3B01A 3KV4A 3N36A 4NIGA 2I2SA 1W6MB 1WW7A 2K2SA 3RJ2X 3WCRA 5GZCA 4CDWA 1GZWA 2ZEYA 4N8MA 3OB8A 3HQXA 4D7SA 1JTZX 1GP4A 1DQ2A 1AF9A 2XKOA 3WG3A 4DO0A 2ZX2A 4LOSA 4Y1XA 2VOXA 4AVAA 2B8MA 2WYSA 3OG2A 5FZHA 1N1VA 1W8FA 2WABA 4BWOA 1FI2A 2Y6GA 2GMEA 1O6UA 2YPDA 1LHNA 1J59A 3V64A 2OXBA 1SLCA 1STMA 3VHPA 3LFMA 2WNOA 3CU7A 2XR4A 1JZ5A 1UY3A 4ZS2A 2W46A 2B9VA 3ZSMA 3N9LA 3WUCA 2ZXQA 1YQ2A 3CJXA 4OCTA 2Z79A 3ACHA 2P4EA 3QCWA 4PHZA 4JHTA 1R1A2 2VNRA 3S0MA 3L2HA 4W6WA 4I30A 3EXUA 1LULA 5T5PA 4C90A 5JUVA 3M3IA 3RJRA 4E9KA 3ON7A 2Z69A 5FBJA 1KD7A 1KITA 4O65A 5EP9A 3WW1A 5C3RA 4JRLA 4EJRA 2RS51 3JD73 2CTVA 4BQYA 4QKFA 2VVDA 1LHVA 3I2JA 2DCZA 1H9WA 1AR62 2AUYA 3C7GA 5JIUA 2W47A 2YROA 4LXLA 3ZM8A 1Q8PA 2KXLA 4AI9A 4JTOA 2R30A 1R082 5JMCA 4B4PA 5CFCC 4BMBA 1MQTA 4FOVA 4IERA 1CAUA 4JV4A 1JUIA 3PDQA 2X10A 4I0AA 3MLJA 4ATFA 3SH4A 4ZZ5A 4K3UA 4MGYE 1K42A 1SPPA 3T3YA 3K3NA 4IEXA 1UN1A 1NOVA 1DGLA 5C8WA 1ND2C 1E5RA 1UF2C 2IVJA 3WD5A 5A32B 3N7MA 5LWBA 4KL1A 1JI6A 5FYHA 3W9AA 4GMP1 2Q8EA 1D4VB 1UX6A 1Z7S2 3SEEA 3POYA 2RS11 4CXXA 3AMNA 1UZVA 1E5IA 2YC2A 1FNZA 1CAWA 1QXJA 4ASKA 1W8UA 3MV11 4Y20B 4COYA 4CCEA 1DQ5A 4HZFA 1GUIA 3ZIXA 3OUJA 1Y7BA 5I91A 1V9U2 3MI8A 1VBB2 1PVC1 4HT1T 5F6LB 4JGYA 4LOTA 1W39A 3AXDA 3RGBA 3VKMA 2HWF1 1O3RA 5H9SA 1PGL2 3O1OA 1SZBA 5FKCA 4UW3A 4K6BA 3ENRA 2A6ZA 5DUWA 1CESA 1UQXA 1W6PA 4IEVA 4OI0A 5IT6A 1IPKA 4CP9B 1MEC2 4XOGA 2B46X 2EXIA 1PVC3 1QJEA 3E5QA 3DPRB 3VBFC 3PIGA 4QPGC 2HWF3 4CDQC 3GBWA 2E7AA 4F83A 1VALA 3JBG1 1EV11 3BI3A 1DZTA 2J1RA 1W03A 2JG8A 5DG1A 5A7PA 4YARA 1T6BX 3J7MA 1XNCA 4AHYA 3OYWA 3WDXA 1OOPC 4IV1C 3GBFA 1ENXA 5GJ6A 1W8OA 1DGRA 4AAPA 2RS33 3M1HA 2ZGPA 1FAYA 4YW6A 1VBD1 3AVRA 2WO2A 1ZBA2 5DDJ3 5F1RA 1HIXA 2EIDA 3VBFA 1GLHA 4QPGA 2CY6A 1VBE1 5FY4A 1ENRA 1JODA 5APAA 2XQXA 4XF1A 4FOQA 4XUQA 4Z2AA 1G9FA 3Q8AA 1LU1A 1C8NA 1GZWB 1NE4A 4BQ4A 1VBD3 1OOPA 1CAVB 1SQ4A 4G3YC 4IV1A 3H8XA 3A23A 1WD4A 2RE9A 2DBNA 2I45A 2DCJA 2JKBA 2R043 3AL6A 2V72A 1GQGA 1HJGA 2VR4A 1JZ7A 4YM1A 1FT9A 4N43C 1Y9GA 2VJXA 1R64A 1RUF2 3OUHA 2ZGSA 4YW4A 5BNOA 2UURA 4L9BA 2VMCA 2XG3A 1HRI2 4RYDA 2AGSA 2C5DA 1WBFA 5FYVA 1ZZCA 2X29A 3AFKA 3N35A 1CX4A 2P34A 4J6GA 3AZWA 4LEJA 3RMXA 4ATEA 1JHJA 1BK1A 4BQWA 5IWFA 4XJUA 3FUOA 4KQ7A 4RN5A 3EJKA 3KVAA 5ANQA 3T1MA 2E53A 3T2PA 5DUUA 3U1XA 1WLTA 1Y9MA 4XE9A 4FPEA 4N43A 1WBLA 4QQOA 4ZKTB 1ZBE1 2RJ2A 5DABA 5EQUA 4HSJA 5C4WB 5DAXA 1NLSA 3B9CA 5EJZB 5A3PA 1V6OA 2OVUA 3IAPA 4OI4A 1CIWA 5F8PA 2E33A 1RC6A 2EXJA 2VMGA 1RMU1 4QQHA 3WQ7A 4M4RA 4R4XA 4GAZA 3ZIWA 2VG9A 5JI7A 2HYXA 1D0GA 2D5HA 5IVFA 1KXGA 4Q0UA 1VB4A 3BKZA 1JW6A 1FMD3 3MIEA 3AZXA 3UK9A 1POV0 4MGIE 1RMU3 3ZMOA 4YFZA 3J4UH 5GZEA 2WJSA 4XF3A 1COV3 2LM3A 3U75A 1G9CA 2W92A 1PO22 4M3CF 3CKHA 3LQCA 2NP0A 3AXEA 4P9GA 3CL1A 4IV3C 4ARYA 2WS92 1MQTB 2BBVA 1CAUB 2E7TA 5AFBA 1UZ0A 3I2FA 3ILRA 2W1SA 1H9PA 1J58A 1OD5A 4UW4A 5J7MA 2DUPA 2GC2A 3K4AA 1VBA2 2JKXA 2HWE3 4WVMB 3JUUA 2CWSA 2QCSB 2JB8A 2PAEA 1C8M3 3NJXA 5JLVA 5LZ6A 1XU1A 4XDQA 5FYCA 3VB9A 1R1ZA 4LBQA 4FPGA 2ETEA 1XNKA 3OGGA 2EF6A 4FOYA 4IV3A 2WFF3 3ZSLA 4XVHA 5JR7B 1RGSA 1JU4A 1LOEA 2YGMA 3HBZA 4CDUC 5JXJA 3H0OA 2PHRA 4AVCA 1IKQA 3T4HB 2YV8A 1AR73 1GBGA 2XJPA 2YMZA 1YO8A 1ASJ2 3RPQA 1UY1A 4IEYA 1F5FA 2QQJA 1X9TA 4QB2A 1Q3EA 3THTA 2GN3A 3PVOA 4Q0SA 3MYXA 4JGYB 1KJRA 1L7LA 3ZFGB 5HCHA 4BISA 4IXLA 4L2NA 4FQZA 3PUSA 4NRMA 2K0GA 2J1AA 5ACA1 1RUE1 4CCNA 3W58A 2WQZC 2PLV2 1OSGA 3ELNA 4H2AA 4S2GA 3LKJA 4OYUA 1GNZA 2XUMA 3J8F2 3ACLA 3MLKA 4CTEA 5IVVA 4YW1A 5AC92 4W4ZA 5FZ9A 3O14A 4ZZ8A 4XUNA 4AWDA 2JG8B 3DGTA 2BP6A 3MF6A 1QU0A 2PHLA 1NG0A 1U5XA 1ULEA 2C6SA 1NUKA 3HR9A 3NNLA 3VDCA 4AI2A 3UKTA 3RYPA 3ROUA 1MVEA 4NRQA 2BFUS 4EWAA 1NAEA 4M01A 2QBXA 3LEGA 4AQ2A 3KQRA 4DY3A 3NMBA 1X7NA 2FDFA 1EPZA 4MXWB 2IXIA 2VQAA 5FZFA 2ZJCA 2VMEA 3ZYBA 5JZGA 5ISLA 4I0BA 5L7OC 2BZDA 2XONA 4OHZA 1SLBA 3IPVB 3P5BA 2OZJA 2C24A 5FBZA 3WP3A 4A7KA 5KC6A 4Q4V3 4BHPA 4DZGA 4YWAA 3M3OA 4I02A 5GM0A 1HLCA 1AR83 3GCXA 1YFUA 2RVAA 5A1AA 2RR13 1VBC3 1RJ7A 4MXVA 4Q0VA 5BNOB 3POIA 2VW1A 1UKGA 2WWJA 4BDVB 5L7OA 2QDNA 2P3IA 1W6OA 5FYMA 1OC1A 2LRPA 4EYUA 1XPWA 2WZR2 3VKOA 4A2UA 4CE8A 1D7PM 1DQ1A 4ORFA 4J1XA 4CU7A 4Y5Z0 5K4LA 4BLIA 2VUDA 3WF2A 3V0AA 1AZDA 5LW9A 2PQSA 1UZWA 1S0EA 4QQPA 5FTTC 2VNVA 4NAMA 1SLIA 5JDBA 4PDWC 2QQWA 4QXKA 1WWYA 4OQ9A 2IZWA 5T52A 1TMF2 2VUAA 3TN91 4DQAA 4URAA 1DFQA 3AMMA 3R4SA 5CAZA 3VUOA 2FMDA 2RJKA 1RVF3 3MIDA 1VLNA 2O1QA 2NM1A 1ODNA 3SMHA 1K3IA 2OX0A 2Y38A 4B7EA 4BIFA 4CEYA 5JCTA 3I59A 2ILMA 2BDRA 1SG3A 3POBA 4CPBD 3ZR6A 1JYXA 1N47A 1MS4A 1Q8OA 1V6MA 4NUBA 4PDWA 3VDDC 3VBSB 1REDA 2Y0IA 2BYVE 3I3DA 1XNTA 4XABA 4XW3A 3B69A 4FP3A 5FR3A 1QDCA 1LOFA 4CUBA 1XBFA 5HPOA 4E2GA 4M0NA 5I0SA 3USUB 3C7OA 3AYAA 1K5MC 4DXZA 4PT6A 4R9AA 5FZAA 3RRDA 4D0QA 3M3QA 4NAOA 2YXSA 3H1YA 3HAGA 5F2SA 1O8SA 3LFIA
chains in the Genus database with same CATH topology
3NAPA 3VDDA 3VLBB 5ABJC 3POSA 2BWAA 4META 4IEZA 1LHUA 2JXAA 4FCAA 2XLAA 4GKXA 4OULA 2IXKA 2VH9A 1GKBA 5DUXA 2HWC2 5T5OA 4B29A 4I3PA 1XE7A 4AVSA 5K0UA 1POV1 3VZNA 2Q8OA 1R1A1 1QF3A 5F9TA 4G9SB 5JOXA 4GULA 4YRDA 3CJIC 1W0PA 1ZZ6A 3BIWE 3AX4A 1WLWA 5A33A 5ABJA 4FPCA 1IOAA 3CLPA 5HBAA 1QJX2 1ZRRA 1LKNA 1H8TB 1OPMA 1UL9A 4R4ZA 1PO12 2DWRA 1AR61 1V70A 1GQHA 3JB4C 1LGNA 2BVVA 4K40A 4RR3A 3MLLA 3K51A 2BNMA 1R081 3VBHC 1PK6C 2ZZQA 1AX0A 5T55A 3ZXDA 1AR63 4JQRA 1NYWA 4YZ4A 5LEKA 3B9IA 2VOVA 1HQLA 2ZMNA 2YY1A 3BODA 1VRH2 1BEV3 2D6PA 4Q4W3 4LNVA 2ZA9A 3SHRA 1QJU3 1LESA 1Q8QA 4RS5B 4S2HA 5JZGB 3N4MA 3BTAA 2UY8A 3DV8A 4GB32 1Z7S1 5D8AC 1HV0A 1QQP3 1SACA 2QE3A 1PK6A 2WNEA 4Y1ZA 3VBHA 4CZSA 4JGZC 2QUOA 4S2FA 2JG9C 4ITCA 1AYM2 1WCDJ 2Q30A 4P5HA 2CNAA 3ES1A 4ZU5A 4UBGA 1NA1A 1AHSA 3MIGA 1BBT2 1V9U1 3AB0A 1VBB1 1SMVA 2ZKNA 2D3SA 2R0HA 1HRV2 5LK7B 1PGL1 1NZCA 1I6XA 2HEYF 4Z1VA 3LWCA 3VKLA 1ZZ9A 5LK5A 1W6OB 4KWJA 2JG9A 1MEC1 2A5ZA 4P9XA 4M3CA 3MIBA 5KHKA 4CDXC 2AYHA 3KD4A 4BCUA 4TSVA 3ZMNA 1RL3A 5FLJA 4OUSA 3IMNA 4TYSA 5BNQA 1YHFA 1MZ6A 2ZPXA 3PVNA 4PBOA 3H3ZA 2D5FA 3POWA 1ZBA1 1MS8A 1RIRA 2DUQA 4M00A 4FAHA 4AVVA 3ZFEA 4CDXA 2WNVB 4V1PA 4XF4A 4HKLA 4CEYB 3I59B 1UIKA 4IL7A 3ZPYA 4LBJA 2XVGA 3U0ZA 1I5ZA 5EYXA 2DTWA 1GR3A 1AL0G 1RUF1 1S0GA 1KRIA 1HRI1 1W6MA 4FPJA 4MLOA 4QM8A 4Y24A 5E16A 3URFA 2MEV3 5CFDB 4OHVA 4HBNA 1X8EA 1B35B 1U5YA 2IXHA 3HN1A 2DYCA 3NWKA 3NAPB 2R072 3KM5A 2EIGA 2A6VA 2PHTA 4OHXA 2BEOA 4W65A 4AE2A 4HLTA 4TLFA 3ZYPA 2VGDA 3RYRA 2PHXA 4Z07A 2PHWA 4FBFA 2D3PA 5K0UB 2AENA 1QXPA 2DURA 4N9HA 3FZ3A 4FPYA 4AGVA 5GZFA 3I7DA 2WWSA 3RS6A 1GZCA 1EAH2 2D7FA 2FZ2A 5A33B 3R4UA 4B3NA 4EN7B 3U11A 4K9SA 1FPN3 4DOUA 5FPZA 1Q8SA 2XGXA 4XMIA 2ZCWA 3AYEA 3BALA 1FOD2 1H2KA 1PO21 3ZXEA 4RR3B 1RUJ1 3KSCA 3WOGA 2A73B 4H7MA 4LO8A 2WS91 2KA3A 4AFCA 2C0ZA 1C5IA 4NHKA 3OCPA 4HVQA 1RUJ3 1VBA1 5HCAA 3D4KA 4A7YA 5E1RA 1A8DA 4RHV3 3AKSA 5KXBA 3PTYA 5FAXA 1LJ7A 3UKNA 5KHJA 4BH9A 3PMEA 4WVVA 1HX6A 5KXEA 3O5SA 4E2SA 1OHFA 2JICA 2DVFA 2ZKLA 1RUC3 1ZREA 1O3QA 1ASJ1 1NA1B 1OA4A 2HWD3 2K9ZA 5A32A 4Q0PA 3AP4A 1GNHA 1BKZA 1O3TA 2IFWA 1DBNA 2AH2A 2PLV1 4WZFA 3DPRC 4M3CB 1WD3A 4FO9A 3J8F1 4Y20A 4LO7A 2XH6A 5LRRA 5AC91 4N7IA 4C0BA 3IBMA 2PELA 2E63A 2BQPA 1XYOA 4AFMA 5L19A 4F8AA 3MF9A 3K48A 2QFEA 4RA0A 2GNMA 3H1MA 4GQ7A 3VZJA 1NCRB 3WW2A 1KS5A 2BNOA 3S7EA 3KCXA 3NV1A 1JN2P 4L92A 3DPRA 4ZU7A 1NE6A 3OTFA 4GWMA 2R061 3ZFEB 3VN4A 2JE9A 1MS5A 2ZMKA 1CJPA 4QM9A 2Q1MA 4XZPA 1QJY1 2ZHNA 4YZ2A 1AYN2 4XYXA 1FX5A 5BXXA 1OQEA 4LA3A 2R063 3UJQA 4AEKA 3FHIB 2SLIA 1NXD1 2ZBJA 1OA3A 1OQDA 4IEWA 5DUVA 5T3NA 4AG4A 4DY5A 1QJY3 4C1XA 4WV8A 1APNA 4HVOA 4Q4X2 1H1MA 2RM22 4XFCA 4AQSA 4LO4B 3BU7A 3FLTA 1CAVA 3LSEA 2KM2A 1MS0A 2WZR1 3SISA 1UD1A 4NN0A 1CN1A 4PCRA 3NV2A 3LOIA 2VOKA 1FXZA 2NLRA 1I1EA 5IK5A 4B7KA 2CGPA 4BE3A 5IUQA 5C4WC 2QQPA 2C9AA 2A71A 4JAAA 3ILFA 1TMF1 3DF0A 4C1WA 4DB5A 2ZX4A 2PYTA 1TEIA 2XVKA 1DYPA 4JDNA 5C8CB 3NW4A 2Y0OA 1FV2A 1TMF3 1XE8A 4H14A 5C4WA 4AFDA 4TZDA 3WZ1A 5I8TA 5FOJB 3EBRA 3N7JA 1MQTC 3UKVA 1X33A 2YC0A 1RUD2 4QPYA 4XFIA 1TQ5A 2WC2A 5GZDA 5CB7A 3D8CA 4HKOA 1NXMA 4LULA 3U4XA 1BVVA 4Q4Y2 2CV6A 3PJYA 1GZ9A 2VUJA 5GALA 5FQ0B 1PIV2 3SH5A 5FO7B 1RUH2 2CAVA 5J3UA 4XTPA 1H1IA 1SBEA 4LBQD 4WVWA 2RS53 4JDMA 4BYYA 2D6MA 4NWVA 5B2GB 3T2TA 5CBLA 2HWC1 3ZX7A 2ZGUA 1KQRA 2QDRA 3WHUA 2G4IA 1LODA 1S0DA 1TME2 2DVBA 3ZSJA 4WVMA 1D2QA 4JGYC 1G8WA 3ZFGC 5FREA 1DF0A 3IWZA 1QJX1 3GYDA 4INDA 1Q56A 2UWBA 1WLDA 1PO11 4XXPA 1UW8A 4XJAA 1O4YA 3S30A 4GMP3 4LE3A 3KT7A 1SEFA 5JPMB 2IXCA 4A3XA 4R9DA 2AREA 2A3XA 2JG8C 4E4DX 3KGLA 2RS13 3ZFGA 1NQDA 2HWB2 4BA6A 4YGDA 1PO13 2EAAA 3PMSA 4FP2A 4AEJA 1B09A 3KT1A 3KLSA 4D69A 3IKWA 4AW7A 2O8QA 2G9FA 1VRH1 2XBO1 4LUKA 1MS9A 4LE4A 3WINE 3WV6A 2XJUA 4IESA 4QPIA 4QQLA 3IT8A 1GSLA 5L73A 3WP5A 3O0WA 4P14A 2E9QA 5C33A 4KBBA 2XBO3 5I93A 1AYM1 3IM0A 3U07A 5FO9B 2BWCA 3JBG3 1EV13 1BBT1 1LHWA 4RQPB 1MR5A 4MXWA 1HRV1 5BNOC 1FNYA 3ZSEA 5JOYA 3FBMA 4PBPA 1G9AA 3IPVA 2VU9A 4O9GA 4FT8A 4LBKA 1VBE3 3E5XA 5FCCA 4NHMA 2A70A 1D0HA 3VKFC 5EXOA 4YM2A 2V5YA 3ZYJB 3NV3A 3TNPB 2YPJA 4XJ9A 2OW4A 5J37A 4RGGA 3WP6A 5A3MA 2FBEA 4GA9A 5JAXA 2HEVF 5DZFA 4L97A 1VR3A 1D4M2 1F2NA 1LU2A 4YW3A 4YLZA 2NPIA 3D82A 3WDUA 1RUG2 2WA4A 2N7GA 3O0XA 5E8AA 4D3WA 4D7TA 3VBSC 1NCQB 1N1TA 2ET1A 5JVVA 1ENQA 2CL2A 4LR4A 4NOTA 2W0XA 1KDMA 2ZMLA 1ZBE3 4DMIA 1QMJA 3AJYA 3FMGA 3VZOA 1JXNA 1HQWA 3B7MA 1A8MA 1AUYA 1U5ZA 3T1LA 2X5IA 1YFWA 2WNUB 3VBSA 3J9SA 2R071 4Q1RA 1S0CA 4URTA 1OFSA 1UU6A 1YFYA 4DFSA 1BMV2 2PQQA 4XQWA 3USUA 5I8YA 4YVWA 2WQ4A 1YWKA 2R073 4FVVA 4MX3A 3WDWA 1OLRA 3GHMA 1MZ5A 1XQNA 4ASLA 4R52A 1H30A 1WMDA 1G7YA 4HK9A 1EAH1 4QGLA 1TNFA 4Z92B 2ET7A 4JRAA 5LRSA 1QY4A 1R092 2GN7A 2ZGOA 1AR92 1H8TC 1MZEA 4OZXA 2D98A 3KS7A 5FFOC 1QNYA 2IWGB 1WLCA 1FOD1 3PLQA 4BOWA 1HXS2 4Y1VA 4OFGA 2XKPA 1LGBA 3E6CC 3RWNA 1ULFA 2JEMA 2GNBA 3KT4A 1SCRA 1LTEA 1KS4A 3AP7A 1H8TA 1SFYA 5AVAA 2EA7A 1Q43A 2BFUL 1M06G 2XPJA 4RS5C 3FX3A 4LHKA 5JZGC 3LAGA 4M3CE 4YZ3A 1YRZA 2MNGA 4QPIB 4LO5B 5ACA3 1RUE3 4P9LA 4K1YA 2B45X 4E4SA 3GHNA 4MGKE 3QOPA 3H8UA 4YGEA 4FTSA 2WT1A 4B4QA 1W6NA 4K20A 3AJZA 2OA2A 4RS5A 4X8PA 5BYNA 1X82A 4JTNA 2D6LX 1UZYA 1RJ8A 1OQ1A 2BPA2 3ST7A 3INAA 1RB8G 4DRVA 2W08A 3IDBB 4QT6A 1RUI2 3VHNA 1AL22 3C3VA 5HXVA 2BTVC 3TOJA 3MFAA 4Z8BA 2E6VA 2Z42A 1JYCA 2JJ6A 2ZAAA 2XJVA 3AKQA 2XJTA 1CJDA 2R1BA 4I3GA 2WNVC 4KWKA 2HKXA 2UWCA 1JYIA 4OI2A 2BVBA 3GZUC 4CEYC 2WSUA 1QHDA 4XF0A 2P17A 3CF6E 3FWEA 2R1DA 3A0KA 1N3PA 3NO8A 1IKPA 1AYN1 2NN8A 1ZRCA 1NY72 1PHMA 2ZGTA 1OLQA 5GLVA 3AYDA 1LOFC 1MVQA 4FSJA 1OPOA 4Q0QA 5EWSA 1J3PA 2WNVA 1F9KA 5BNPA 4LLFA 5KWRA 4W6XA 3MW4A 4Q4X1 2RM21 5CFDC 2X5IB 1B35C 4HVRA 3TN93 5GLWA 2RMU2 5FPXA 3FLPA 2YYOA 3NAPC 4HMZA 1QDOA 1TE1B 3R0RA 5K9YA 1ONAA 3GF6A 3TAYA 1CVNA 4ISRA 4AEMA 1ZZ8A 3JQXA 5EV7A 2XWJB 3TYJA 3AZZA 5K0UC 1DGWX 2GAUA 2ZGKA 4YVWB 2TUNA 4IEQA 5CFDA 1B35A 5EYYA 1LGCA 2Y26A 1XYPA 3ALQA 1BZWA 5CG9A 1X50A 2GSYA 3JD72 2ZGLA 2Z2SB 2GDFA 3H3UA 4XTMA 4RL7A 4K8FA 4KNCA 3M7AA 4RR3C 2UWAA 3VBUB 4XBNA 4UW6A 2W39A 1RUD1 3Q9OA 1YIFA 3FUQA 1QJZA 1GICA 1SDWA 5K8SA 1POV3 2R16A 1R1A3 1ND3B 4CP2A 3BCWA 3MW3A 3ZXJA 3B93A 5E88A 1QOSA 4PLMA 1MS1A 1SBFA 4XMAA 3OBRA 1PIV1 1UCXA 1RUH1 2AR6A 3JQWA 1N3OA 3AMPA 4FPOB 3MEPA 2ZABA 1O5UA 1Q5OA 3FLRA 5T5JA 1CQ9A 4XFFA 3M8LA 3VBRB 4AI1A 3LA3A 3OD0A 4BPZA 3D5OA 4W6YA 4AF9A 2VNOA 1TME1 4GALA 1RUH3 1NA1C 1IS3A 3GZAA 3O12A 5FLIA 1R083 3M2MA 5E89A 1W6NB 1AJKA 2ZX1A 2RJLA 1Q8VA 1KJLA 4COVA 2EAKA 2ARBA 1NQJA 1G6NA 1G9DA 1PVC2 1QH7A 1LRHA 4XXAA 2Q0AA 1PGW2 4K7JA 1ZVFA 1Z7S3 5I8SA 4MYEA 1OFNA 2HWB1 2QZ2A 2O0OA 1Z0HA 5FO8B 2RS32 3A0NA 1NCRC 2DTYA 3ETQA 3PVBB 2DVGA 3JZVA 1DLLA 5DDJ2 1V9U3 4P9JA 1VBB3 4LBOA 2HWB3 4NHLA 3ZFEC 3AMQA 3MPBA 4PIYA 4PIZA 5T5LA 3RMYA 3USSA 1VBD2 4PJYA 3WQ1A 4Q29A 3MFCA 4XPVA 3KCCA 1MEC3 4YZ5A 2GH2A 2R042 5FMOS 1NCRA 4HKWA 4FTBA 4XILA 1N1SA 5T50A 4FPFA 1YCIA 1DZQA 4P9YA 3GNEA 5BNPB 4H3WA 1KFUL 5BNNA 4MZUA 1ZBA3 2TNFA 3H9AA 1A6CA 1U0AA 3L2YA 4I0WB 4MH0E 5GKAC 2LALA 4LHNA 4O9EA 3M3CA 4R8HA 1XU2A 2LUWA 2D6KA 4X6RB 1YIPA 4YG0A 4F3JA 2R32A 1IGOA 3CEWA 5KHGA 2GMMA 1C4RA 2DV9A 2VW0A 1QOOA 4PF5A 3H1WA 1O5LA 1H1AA 2P37A 2A7AA 1RUF3 3QBQA 1FATA 1FMD2 1D4M1 1HRI3 1YJKA 5C8CC 3OY8A 4N90A 5CG8A 1COV2 2CYFA 4BMEA 3ZFFB 4XEZA 4JC1A 4LLOA 1W0OA 3OF1A 3X29B 2ZAHA 4ES9A 4K21A 2DU1A 3FFZA 3AZVA 1QWRA 2OIIA 1LOCA 4GWNA 4AHXA 1HW5A 4BQ1A 4COWA 2DVAA 1DGRN 1ULCA 1HV1A 5C8CA 1Y3TA 2HWE2 5FDBA 3VHOA 1C8M2 4AVTA 2GC1A 3I8TA 3ZYIB 1S0BA 4LBNA 5CNAA 5JSPA 3APBA 5IK4A 3NJZA 3MICA 2WFF2 1V6JA 3IN9A 2YUEA 5H9QA 5JOWA 3RYKA 1ENSA 4KG8A 3OPZA 4RGAA 1VB2A 4Q8KA 1DG6A 1L3JA 3M3EA 1X8MA 4HSLA 4XFAA 4XJZA 1AR72 1PO23 1CONA 2ZTNA 2BUKA 3GZTB 4Q27A 2GNTA 4AVBA 1I9RA 4KGQA 4UXAA 4QQ2A 1ZM1A 1IS5A 2TEPA 2WS93 5FQ0A 1YFXA 2P3JA 3TRSB 1BXHA 3GALA 1R091 4NWWA 4ES8A 1AR91 1VBA3 4CEWA 1YJLA 4I09A 4X6QB 1H2LA 4HK8A 4EN9B 1HXS1 2NZ9A 5AVPA 1CAXA 3N7LA 4U36A 3LA7A 1C57A 4XQ4A 3ZXGA 3TBDA 3ZSKA 4AYUA 2XVLA 2D43A 4XETA 1REFA 4LO6B 2D93A 3N3HA 3SXWA 1OA2A 3ME2A 1ASJ3 2VVFA 1EP0A 4XHXA 1JOJA 3VL8A 1BCXA 3M70A 1J3QA 2QVSB 3O0VA 4WM8A 2YZ4A 1JHNA 2DUOA 3EHKA 4Q4V2 2PLV3 2W68A 3WP4A 4PLOA 2H0BA 3J8F3 1LECA 2Q5TA 3FE5A 1AR82 1ZZBA 4NR1A 4CTEA 4H7LA 3WVJA 5AC93 2RR12 1W6QB 4RQPC 1JUHA 1VBC2 4YZ1A 3AKTA 2XHKA 4GH4A 3SH3A 1RHI2 5BNNB 2D6NA 5DZEA 3DN7A 1YI7A 3ZN6A 4XIOA 1MZFA 4CP1A 1H2NA 5A3LA 4QGMA 1S0FA 1S0JA 1RUI1 4RQPA 1O91A 1AL21 1UAIA 2FQPA 4TWTA 4F7ZA 4RD7A 3MDPA 5D1IA 2DVDA 4XBLA 5KBFA 3I54A 1RVF2 4Y26A 4LHLA 4AI8A 2GNDA 2I07B 5I0UA 4AQ6A 3OY8B 1AX1A 4ZXKA 3ASIA 3HWJA 1U12A 1GYKA 2P3KA 4UBHA 1JH5A 2WZR3 3R6SA 4DS0A 1NCQC 4E2QA 3H7JA 2HYKA 3KCYA 3V0BA 2EVXA 1S2KA 4ONUA 5DXDA 4AEDC 5H9PA 1A3KA 2E7QA 1GANA 4HN1A 1URXA 1YYNA 2WNUC 3UV9A 2RMU1 2GC3A 2WLPA 4AHZA 1NCQA 2WIIB 4EN6B 1CGPA 2JDZA 3ZN4A 5J96B 2ZGRA 3RI8A 2VULA 3D0JA 3V56A 2R6QA 4SLIA 2RMU3 2WFPA 4AEDA 2ZS6B 4AGGA 4LA2A 2FHRA 4Z82A 1Y9QA 4Y22B 2WNUA 1MS3A 4IETA 2JD4A 1QKQA 5JPNB 4YVSB 1IQAA 1PMIA 1IZ3A 1AXYA 2PFWA 3JD71 1UU4A 1X36A 4ZU4A 4D94A 4EWDA 1OI6A 5C9AB 4COZA 4I2OA 4CEWB 4UW5A 2Q4SA 5EFUA 1UIJA 2GH8A 2D97A 4FOWA 4N53B 4U2AA 4YFWA 5HCFA 3VHRA 3W59A 3WG2A 3WNXA 4C0HA 2H0VA 1YUDA 2ENRA 3E6BA 3ES4A 1CAXB 2DF7A 1WGPA 4QD2A 3FFQA 3VBOB 2OUJA 2HWC3 1UMZA 3IDCB 1UPIA 3MGUA 4CP0A 3EO6A 1BEV2 4Q4W2 2YDEA 1QJU2 2ZHKA 5CIRA 3P3NA 3DKWA 3NL1A 4WM8B 1QQP2 4QPIC 1QJX3 4GKYA 1V6LA 2C1FA 1N1YA 1IS4A 5EJ3A 3HMYA 1BJQA 1QXRA 3B02A 3AM2A 1LB2A 2XJRA 5C6CA 1V6IA 5BPXA 4EROA 1TNRA 3ILNA 4YGCA 1J1LA 5SV8A 5CFCA 2MPFA 1VAVA 4C91A 1Z78A 4MGZE 4GH4B 4GB31 1H8VA 3LCPA 3SITA 3WX5A 4N7UA 5BY5A 2YGLA 4YNIA 5KC5A 1ND2A 1ZX5A 2DFCA 3FC0A 4XJWA 1VRH3 4MUVA 2JX9A 3ZN6B 4DNYA 5JOZA 4OI1A 4EV0A 5JSRA 3HT2A 4WM7B 3I4IA 1PGW1 2VMIA 4GB33 2A75A 2OUHA 5KHHA 4JVAA 1OKQA 4YSFA 2GMPA 1AYM3 3WW4A 1ALYA 2RS31 4IQPA 1EPWA 2B5HA 1BBT3 5DDJ1 2XLFA 3ZXFA 4YM0A 4B8EA 1W2UA 1WA4A 1EY2A 1HRV3 5I0TA 1PZ9A 3GBGA 3BPZA 1LOGA 4I01A 3QLQA 4LBMA 2R041 4CDQA 2QNKA 2O8OA 2WSVA 1UU5A 3ZYRA 4FAGA 3BOWA 4CDWB 1ZA4A 2DU0A 3B3QE 3V0BB 1OMIA 5DZGA 3R05A 3OJBA 1CR7A 2MEV2 3V65A