2IXHA

Rmlc p aeruginosa with dtdp-rhamnose
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
184
structure length
184
Chain Sequence
SMAMKATRLAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSARGVLRGLHYQIRQAQGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGFVVLSEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQDAPLLSEKDRQGKAFADADCFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords DTDP-4-DEHYDRORHAMNOSE 3,5-EPIMERASE
publication title RmlC, a C3' and C5' carbohydrate epimerase, appears to operate via an intermediate with an unusual twist boat conformation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 49
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2006-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ixhA00
3D82A 2EAAA 2GC0A 4MV2A 4UXAA 5LEJA 3CL1A 3H50A 3ETQA 3H8UA 4CYDA 3KGZA 3KSCA 2PHLA 2EA7A 1GQHA 4XFAA 4XF4A 5JR7B 5J7MA 3H1MA 1UCXA 2KXLA 1IPJA 3RYRA 3IDBB 3U11A 5KHIA 1V70A 5C8WA 3E6DA 4MH0E 4BIFA 4IEUA 4HSLA 2IXHA 3SXWA 1Q43A 1YFXA 3M70A 4LEJA 2N7GA 3E5XA 3NW4A 4IESA 4AQ2A 4QX5A 5KHGA 2PA7A 2Q4SA 1FI2A 2IXIA 5C6CA 2FMYA 4J1WA 4O9EA 3U10A 1FT9A 3CLPA 4X6RB 1OMIA 4MGYE 4IEZA 4P9GA 1OI6A 1ZRRA 4OFGA 4XEZA 3CJXA 3E5QA 5JSRA 3ELNA 5HI0A 2P17A 2D5FA 3OD0A 2ATFA 4R52A 1UPIA 4Q0UA 2Y0OA 4EWDA 3LA2A 5FLJA 1NZCA 1YFWA 4KWKA 3RYPA 1J59A 5FQ0A 3PNAA 2HJIA 3RDIA 1DGWA 1O7FA 4EV0A 2ZKLA 1LB2A 1Y3TA 1VR3A 3HIFA 1VP6A 5JAXA 3ZDSA 3G7DA 3N4MA 1ZRCA 3QACA 4I2OA 5E16A 3MPBA 1YLLA 3WW2A 1DGRA 3LA7A 4XETA 3SCGA 4YARA 2I45A 3ACLA 5KHHA 4BH9A 1NE6A 2WC2A 4KU7A 3KMHA 3O14A 3FHIB 1ZX5A 3E5UA 1NYWA 4A2UA 2C0ZA 4NVPA 2UY8A 3S7EA 1RL3A 2HKXA 5FQ0B 1HW5A 4LLOA 4I09A 5KHKA 3H3ZA 5LRRA 2MHFA 4AVAA 2PTMA 3IWZA 3NSTA 4H7LA 2D5HA 1YWKA 4B29A 3BPZA 1ZNPA 1YFYA 4IEWA 3PLQA 4E2GA 3UKTA 4YSFA 4Q29A 3CO2A 2EVXA 2WFPA 1UW8A 1VJ2A 1J1LA 3GYDA 1RUOA 5I93A 1J3RA 4MGKE 4I01A 3OTFA 4LTAA 4DINB 3OCPA 4O9GA 3QOPA 2CGPA 3B02A 2QJVA 4Q0VA 3BU7A 4I3PA 1I6XA 2XL7A 4QGNA 4KWLA 3EBRA 4IEQA 3DL3A 4XFHA 3FE5A 2PAEA 4META 2XLAA 2QVSB 3EO6A 4EWAA 3I7DA 5FLHA 3RNSA 1O3QA 4XFGA 2XKOA 2IXCA 1O5LA 4MZUA 1IPKA 4AVCA 4PIYA 3OGJA 4I02A 4WZCA 3R6SA 2D40A 2E9QA 1XE8A 4WVZA 3RZZA 1EY2A 2PFWA 1DZRA 4ORFA 2VECA 1ZZ7A 2Q0AA 3SHRA 2H0VA 3LOIA 1SQ4A 4HVQA 2OYZA 1OD5A 1O3TA 2VPVA 3S7IA 4FBFA 1L3JA 5FPXA 3NL1A 3H1WA 1CAWA 1EYBA 2QCSB 3DKWA 5AVPA 1O3RA 2MPFA 5JSPA 5JSOA 1UIJA 1FXZA 5I0SA 4XF3A 2PQQA 1YHFA 3FX3A 4AXOA 4HLTA 1ZZCA 4KWJA 4LA3A 2B8MA 3EHKA 4HZFA 1RUNA 4JV4A 4I0BA 2ETEA 4LA2A 5J48A 2CAVA 4YNIA 3D0SA 5E1RA 1ZREA 5I0UA 2OZJA 4QGMA 5EFUA 4TLFA 1QWRA 1YUDA 4Q0QA 4IEXA 1SFNA 4I0AA 1XRUA 3TNQA 4D7SA 4Z82A 4J1XA 2GU9A 4IERA 3LZZA 2BNOA 4IEYA 3SMHA 4JTNA 4EROA 4HN1A 2XLGA 2Z69A 4EWEA 5BXXA 1CAWB 3IIAA 3FFQA 2PYTA 2GC3A 4HSJA 5J3UA 3EJKA 2BNNA 2BGCA 3H9AA 1ZZ6A 1CX4A 4HVOA 3DV8A 4HVRA 1I5ZA 3UKNA 5KHJA 3WW3A 2Q30A 4L11A 3L2HA 1CAUA 3DN7A 5FPZA 3ROUA 2UYBA 2UY9A 2IXLA 1QY4A 4LUMA 1CAVA 4ONUA 4LULA 1J58A 4WBBA 4ZU4A 5I0RA 4UBHA 1LRHA 5CADA 2BYVE 4Q0PA 4KL1A 4ZU5A 5I0TA 3TNPB 4Z07A 1X7NA 4ZU7A 2Q1ZB 1X8EA 3U0ZA 2QNKA 1ZZBA 3EQEA 4R8HA 5EZWA 4AVBA 3RPQA 4FAGA 4IEOA 3HT1A 5BUVA 3WW4A 4N9HA 4K8FA 3RYKA 5CVRA 2B5HA 2OPKA 3FJSA 5FLIA 4PIZA 3S0MA 1JUHA 2O8QA 1H1IA 4BHPA 2BEOA 2GH2A 1QXJA 2IC1A 3BALA 4JVAA 4MX3A 5FDBA 5BPXA 3D0JA 3I54A 1WLTA 2MNGA 1X82A 3H7JA 4IETA 3SCFA 1CAUB 1YFUA 5D1IA 5BY5A 1DZTA 4BYYA 5I8TA 1CAVB 4MGIE 4PJYA 3H1YA 2F4PA 3FZ3A 3ES4A 1CGPA 1O3SA 4QGLA 2DCTA 1J3QA 1O5UA 3LAGA 3ES1A 4XF9A 3IBMA 4E2QA 5I8YA 1UD1A 4Q0SA 4YYOA 3KGLA 5JCTA 2XHKA 4JTOA 2Z2SB 3E6BA 2UYAA 3H3UA 2XGXA 2D93A 2IXJA 1RTVA 1U12A 2PAMA 3USSA 2XLFA 3OF1A 2BNMA 3LA3A 4XFIA 2ET1A 1WA4A 3HQXA 4GULA 1LKNA 4QMAA 4XF0A 1ZZ9A 2QDRA 1XE7A 3NVCA 1ZRDA 2ET7A 3MYXA 4MGZE 2PAKA 2K9ZA 2PHDA 1RC6A 3H7YA 3UKVA 3FWEA 3MDPA 1UIKA 4HBNA 3CEWA 4XFCA 2XKPA 2H6BA 4YRDA 4QM9A 2GAUA 1X8MA 1ZZ8A 3E6CC 4AQ6A 4D7TA 4LUKA 1G6NA 4L2NA 2OZ6A 1Y9QA 2IXKA 4IEPA 2GC1A 4FT8A 4QM8A 3GBFA 4PIXA 1O4TA 5K8SA 4HN0A 1ZVFA 4F8AA 1TQ5A 1GQGA 3C3VA 4N9IA 1RGSA 1WGPA 3I59A 3M3IA 2OA2A 2ZCWA 4X6QB 4XF1A 3JZVA 1CAXA 1PM7A 2CV6A 5LRSA 1SEFA 5KBFA 3IDCB 4FAHA 2V09A 5LEKA 4XFFA 2K0GA 4UBGA 1ZRFA 3BCWA 3CF6E 4KU8A 4XFBA 3PVBB 3NKTA 4MUVA 3KCCA 2FQPA 2B9UA 5BV6A 1J3PA 4RD7A 2VQAA 1H1MA 5I8SA 3ST7A 2CAUA 5F1RA 4HMZA 4QXKA 3WW1A 3SCHA 1LR5A 1QXRA 4F7ZA 1NXMA 1PMIA 2H6CA 3VHRA 3NJZA 5T3NA 3HT2A 5CU1A 2GZWA 2O1QA 5FCCA 2GC2A 1Q3EA 3MZHA 3I59B 4IEVA 5I91A 4E2SA 1OFNA 1NE4A 1Q5OA 1EPZA 1CAXB 3E97A 4OLLA 3BB6A 1EP0A 3LWCA 2XL9A
chains in the Genus database with same CATH superfamily
3MIFA 4QWNA 2VZ1A 3B93A 1K5MC 3CL1A 1ST8A 2HEWF 3H8UA 3R4UA 1POV3 1XE0A 2I07B 3PMEA 4QU2A 4JAAA 4XC9A 3KSCA 1FMD3 1YI7A 2WQ8A 2PHRA 3LDRA 2BUKA 3N36A 3LSEA 4IE7A 4QPWA 4AI9A 2FZ2A 5DQ0A 1V6IA 2P3IA 3I2JA 5CA6A 4TYSA 1LOAA 1ND3A 1H9WA 3IDBB 4CP0A 2BWAA 1ULPA 5FK8A 3T09A 1UU6A 2AUYA 2VQ0A 3E6DA 3NRUA 1RUH1 4K6BA 5KHIA 1N3QA 3U75A 1ENQA 4HSLA 2R32A 3JD71 4JRLA 1W04A 1W3XA 1XNBA 3NMBA 3OEBA 4LEJA 4Y1XA 4BISA 5IK7A 2ZACA 5CFDA 4RA0A 1NT0A 4FXGB 1FMD2 4FP2A 5GLUA 3AYEA 1FI2A 4BB3A 4XJZA 3TN91 5C6CA 1H2MA 5CFCB 4YM0A 2ZMKA 3GZEA 4BQXA 1QOTA 2FMYA 4J1WA 1WMXA 3FC0A 5JPMB 1FT9A 1VBB3 3DPRC 1R081 1CONA 1WLDA 4MGYE 2CU5A 3TEYA 2R072 1UMZA 5JZGA 1G9FA 3WNKA 5JSRA 3CJXA 5FKCA 1S0FA 5HI0A 2DV9A 2E63A 1GOHA 3VGIA 4LBQD 5L36A 1RUE1 2HBTA 2YG0A 2DF7A 4AQ2A 4LIVA 2YPDA 1CQ9A 4Q0UA 3WNOA 2Y0OA 4XHBA 5CYYA 1JOPA 2IFWA 3LA2A 3M4FA 5DZFA 1PVC1 3RMYA 4EWDA 1L7RA 1OBNA 3KM5A 4KWKA 4M4RA 4BLIA 1J59A 4AHWA 3R4DB 1CJPA 1HXS2 3ABZA 3MGUA 4LMFA 2EF6A 3LEGA 1AJOA 3RDIA 1DGWA 1O7FA 3PURA 3ZR5A 2WL1A 3HR9A 3MV01 5JAXA 1DHKB 1VBA1 4IV3C 5FP9A 5T54A 1RMU3 3MFCA 2FDIA 1UKRA 3MPBA 3WDWA 2Q5TA 4GWNA 1V00A 4MYEA 3VDBA 4QKNA 3SCGA 3FBMA 4A3ZA 2E6VA 1AJKA 2JE8A 1KQRA 4FTEA 4ZZ8A 5F6KA 5FO7B 2I45A 1WCQA 1O8PA 2EALA 5IVVA 3S57A 3UJOA 5KHHA 1RMU2 4OI0A 3FUQA 3R0RA 5C5UA 2EICA 3JB8A 3FLTA 5A7OA 3HN3A 3O7OA 1GICA 4CU9A 2NLRA 4FO9A 2VM9A 3KVAA 4FFGA 4Q4X1 2G19A 5JOZA 4Q4V1 3KMHA 1W3VA 1GNHA 3E5UA 4D6SA 5BYNA 1PGSA 1W9FA 3CJIC 4LOTA 3CDZB 5C70A 2RJLA 4NVPA 1YNAA 3ZFFC 4OMDA 3DECA 3ZDVA 4XDPA 1MVQA 2XXZA 3KT4A 1HW5A 4FFFA 3VKNA 1RVF1 2JIGA 4TXWA 3SITA 4BXFA 1RUG1 5FO9B 1HB2A 4AVAA 1IGOA 2PTMA 5GLWA 2HWD3 2VNVA 3NSTA 1H6XA 3FHAA 4H7LA 4R9CA 3B01A 1YWKA 4A3XA 5J09A 3LKJA 1RUC3 5ACA1 2P3YA 1QJX3 3HEIA 4WM7C 1WLCA 3WLUA 2W94A 2BVBA 2WNVC 2ZGTA 5FXVA 3SC7X 4C1XA 5IVBA 5I0DA 1PGL1 2YU2A 4LT5A 1RITA 2ZX1A 5KWRA 3T1LA 2EVXA 5E89A 2HLEA 4IGQA 3PMSA 3ZXKA 3ILNA 4RL7A 1J1LA 3GYDA 1UU4A 1YQ5A 2RV9A 1J3RA 2OS2A 3PTRB 3C7EA 4LR4A 4XQ4A 2ILMA 1PX4A 2WN2A 3CJIB 1QJU1 4I01A 5LY1A 1S0EA 1SLIA 3TAYA 4LTAA 1PO21 4CEWB 4DINB 5JIUA 2A73B 3OCPA 2RM23 1OOPA 2Z5WA 4N7IA 3OOXA 3ZSMA 4JKKA 3USUA 2CGPA 3AJYA 4E8DA 2P37A 4QHOA 1AR62 4Q0VA 1MS0A 3BU7A 3OBTA 4Z2WA 1HQNA 4I3PA 2J1VA 5FV3A 1KS5A 4WM7B 4MADA 2C1FA 5A1LA 5A1AA 3O1TA 4UAPA 4XJ9A 3KF3A 3EBRA 2WNVB 1W6MA 2WQZC 2QFEA 2QDNA 4KQ7A 3DL3A 4QPIB 1UX7A 1BBT3 1W99A 4XFHA 5FY1A 2JDPA 4URTA 3FE5A 5C3QA 4K9SA 2RDQA 4P9XA 3WP4A 3EO6A 2QVSB 4AQTA 1ULGA 3I3QA 4BXSV 1RHI3 2ZGOA 2TEPA 3DGTA 2DDUA 2X8KA 4XDOA 2XKOA 4XFGA 5DPNA 1O3QA 4MG2A 4LO7A 2JDHA 1S2KA 2J1SA 3B94A 4QX3A 1POV1 1REFA 4XJAA 5EHDA 4PIYA 5TSWA 3WY6A 1JYXA 3R6SA 1FMD1 4Y24A 2ZZQA 1QJZA 1G9BA 5FJKA 1BBT2 4JGYA 2UU8A 5FYVA 3IZOA 3HNBM 4BA6A 4LHNA 4AGVA 1LULA 1MVEA 3WDYA 1G86A 4F83A 1RHI2 3VDDA 5BNOA 5FPUA 3WG3A 1W8NA 3QCWA 2H0VA 5A3UA 3NO8A 1W6PB 2XR4A 2PHTA 1RUF3 5KXEA 2P4EA 1XSQA 1OD5A 1S0DA 2OYZA 3VBHA 1LOGA 3S7IA 1L3JA 3T2PA 2E31A 3H1WA 4I30A 2QCSB 1PO13 2BFUS 1DYKA 1STMA 4UFIA 5JSPA 4Z2AA 4Y1YA 5JSOA 1GOFA 1HXS1 3TWIA 4A44A 4JGZA 4GH4B 4K1YA 5I0SA 1OHFA 2X5IB 5FXZA 3THCA 3K4AA 1SMVA 2DFBA 4O65A 1ZZCA 2VZRA 5DAPA 2EAKA 1SG3A 5FY4A 4IE4A 4BDVB 2GSYA 1YJKA 1PO12 2P5BA 3FMGA 4LA2A 2OW4A 5LBCA 3D0SA 1ZREA 2P34A 3RZKA 2WZEA 5D2AA 2VTFA 5DXDA 5EQUA 4TLFA 4BE3A 2WT0A 1YUDA 4GIQA 2WDBA 4AI0A 4YW6A 1TZOA 4CEYA 4COYA 4D7SA 3RZGA 1CPNA 1RMU1 1GMMA 4J1XA 1QJY3 1AXZA 4UW4A 4NHLA 2J1UA 2Y34A 3SMHA 5FYUA 1UZZA 1ND2A 4HKOA 3AK0A 1FAYA 3MIHA 3ZPOA 4YGDA 3O1UA 4EROA 4NO4A 2ADEA 3T4VA 2Y33A 1ENRA 4HK8A 4EWEA 1CAWB 3GCWA 2YZ4A 4QX8A 1I9RA 4YW4A 4BQ1A 1HRV2 2YB7A 3ZXJA 3ZSEA 3RZMA 1NCRC 1BQPA 1S0CA 1D7PM 2GNTA 4DPNA 5J3UA 1QH7A 5LA2A 2E26A 2B4KA 4LJHA 1NG0A 1AUYA 1ZZ6A 2XJPA 3WX5A 3ZFEB 4HVOA 5F37A 3TEXA 5C8CC 5A33A 4UI9L 1Q8VA 4ZKTB 1MZFA 2Q1MA 5GJ6A 5A3LA 2VBDA 4RN5A 2Q30A 5GALA 3PUHA 3L2HA 3RSJA 1GWLA 2VMFA 4IV1A 4CCNA 2UYBA 4Q8KA 3VKFC 2G9FA 5FZ1A 2AENA 4AL9A 3MICA 5E6HA 2BGPA 1QY4A 2P3JA 1CAVA 4ONUA 5EYXA 2HYKA 4LULA 3VZOA 4RYDA 1NQDA 5A1FA 3KWVA 3FHQA 4I3GA 3ZIWA 4FPLA 4CUCA 3I97A 2PELA 3PDQA 4CDXA 1Q8PA 3VN4A 2JG9C 1UU5A 1BVP1 4KL1A 4EYUA 2PHFA 1JHNA 2JDAA 3AYAA 3TNPB 2VCCA 1X7NA 1LJ7A 4W6WA 3HWJA 2W1SA 2XJVA 1PGW2 2ZBJA 1GQPA 4Q26A 5EZWA 4AVBA 2A3XA 2JG8A 3HT1A 4IGOA 4S2FA 5BUVA 2WS93 4V1PA 3VKMA 1CVNA 1NOVA 5LB6A 4LITA 2B5HA 3N35A 2R49A 5CVRA 2NMNA 1C4RA 1O8SA 3KHBA 2W46A 3OYWA 4UOJA 4YGEA 1H1IA 3O1RA 1E5IA 3W59A 2E33A 1NY71 1ZBE2 4Q4W3 2RM21 3N9NA 4D0QA 3DCQA 5BPXA 1W9TA 3APBA 3M3EA 3I54A 3K2OA 3RQ0A 3JQXA 2WS92 1WLTA 4Q2FA 1JXNA 2JG9B 2MNGA 2WBKA 4COZA 4IETA 1F2NA 1CAUB 2OPWA 1C5IA 5FKBA 5GZCA 3BIEA 4KBZA 2EXHA 1U5YA 1UL9A 3C2UA 4BYYA 4EN6B 3AP6A 4IW3A 4YG6A 2VNOA 2O14A 4Z92B 1BBT1 3FZ3A 2WFF3 4K1ZA 4Q4W2 1O3SA 3O1VA 3R4SA 1PVXA 3VBSA 4BCUA 3RMXA 4HPKB 3GZAA 1RHI1 5GLVA 1H2KA 3IBMA 4Q0SA 1VRH2 2P3KA 1GOGA 2ZA9A 3POGA 5J1XA 5A3OA 5LA1A 5JCTA 3W21A 1ULOA 5FZHA 4CXWA 2XHKA 5BNNA 1HB3A 5FIXA 4AGRA 4ASMB 3UT0A 2DU0A 4RGKA 4DXTA 1QU0A 4P9YA 1ENSA 4ZY9A 5DAWA 3I49A 4NN0A 4XUQA 1JOBA 1ND3C 2VZOA 1GZWA 3VZMA 1R1A3 3OF1A 2ORZA 2D44A 1WW5A 4XUTA 2BU9A 4A42A 3M7AA 3QBQA 3HQXA 4B1LA 1TNRA 3AP9A 4ARXA 1BKZA 3CZUA 4DUXA 4NMIA 4LE4A 1LKNA 1RYYA 3NVCA 1PO11 4OHVA 4OQ9A 3LF7A 2WKKA 1ZA4A 1HB4A 3J7NA 4KH9A 4D6RA 3OD4A 4MGZE 5FYHA 5LBFA 1V6MA 3Q8BA 1PMHX 1W6OA 1XOYA 5K0UA 2PAKA 1PZ9A 3UYJA 4NHKA 3AKSA 3V65A 1JZ7A 4J6GA 3DEMA 3UKVA 3H7YA 5JZGC 1YIFA 3MIEA 3V0AB 1HJFA 1GV9A 4GXLA 3S30A 3PIGA 4EN8B 1XYPA 4AFCA 1NZIA 4HFSA 1W28A 4W6XA 1V6OA 5KXCA 1W9WA 3E6CC 3S5QA 3I2IA 4XVHA 3O1MA 1ND3B 3OJBA 3ZKUA 4KNCA 4L2NA 3I2HA 1VRBA 3IT8A 3K4ZA 4QX7A 3Q8EA 4LIUA 5GZEA 3BI3A 4QM8A 4XACA 4OI1A 1O4TA 2IZWA 2ZGPA 4RQPC 3RG0A 4DFSA 4H2AA 3OUHA 2GALA 1H0BA 1HRV1 1LHOA 1LAJA 1W8WA 3QD6A 4LHLA 1W9YA 3C3VA 2W47A 4N8MA 1DG6A 5LRSA 4FPGA 4R9DA 3MI8A 2A6XA 5IAVA 5KBFA 2VMDA 5FTTC 4UBGA 2PMWB 1GR3A 4EE2A 2P6HA 4FQ4A 5J37A 4Y4YA 4LQRA 3BCWA 4XFBA 1ZRFA 2NQYA 3W9AA 4BQ2A 1I5PA 1NA1A 4M3CE 2L9LA 3SEEA 2P1BA 2LRPA 3SLIA 5J36A 4JZRA 4MUVA 4U2AA 1RXFA 4L8QA 3LIHA 5FXWA 3SH5A 2B9UA 5BV6A 4YW1A 1QNWA 5A7NA 3AVRA 5F3CA 2EIBA 3ZX7A 2V5YA 3NJVA 4TZDA 2HBUA 1PK6A 2R1DA 3LE0A 4RQPB 5I8SA 3VBOC 1CESA 2NP0A 1FNZA 4JQTA 3ILRA 4JHTA 1C28A 2CAUA 5F5IA 3ITQA 4HMZA 3WNMA 4RS5A 4L92A 1PGW1 2HWB2 3UJQA 2DCYA 4M3CA 3V56A 1SFYA 3O1SA 3SCHA 3H8RA 2WO7A 3SKJE 4BLJA 1NXMA 1ZBA3 1F31A 3OPZA 2V73A 1NCQA 2OKXA 1WA6X 1AX2A 3N9PA 2RMU3 3BGAA 2VAUA 2ZGKA 1XSRA 4YM2A 5B4NA 3MIDA 3QLQA 1Z7S3 4QQOA 4E2SA 1K42A 1OFNA 2A6VA 2JD9A 3Q8FA 5KC5A 4DZGA 2FDFA 4ATEA 3BB6A 2WA4A 4JDMA 2YGLA 2WS91 3HNYM 5CB7A 1MS3A 1GYKA 1W03A 3LWCA 2DFCA 2XBO3 1ONAA 2KM2A 3D82A 4BQYA 4CVUA 2RMU2 5C9AA 4AEJA 5KC6A 3NV2A 5FBZA 3VBOB 5LK7B 1VIWB 3KS7A 1Z7S2 5FMOS 4CDWA 2VXRA 3NNGA 3KGZA 4CYDA 4LKDA 3FL7A 4Q4W1 4NROA 4YZ4A 3NQHA 4XUOA 5FPBA 2EA7A 4QDQA 4Q27A 3ZYJB 3UNPA 1W0OA 1VRH1 5FWEA 2XBO2 1H30A 4GKXA 4IE6A 2RS32 4XOGA 3M70A 1HRI3 1MS5A 2N7GA 2WT2A 3C7OA 4IESA 5F3GA 4QX5A 2VXJA 4RSUA 2Q4SA 5D8AA 4C0HA 4DQAA 3WG4A 5FYZA 3TN92 5CKQA 5F3IA 2DCZA 1Y43B 4PF1A 3U10A 2GNDA 3HAGA 3CLPA 4X6RB 3WR0A 3M8LA 1TME3 4AYUA 2QTWB 2OXBA 4PCRA 3UV9A 3L2YA 4OFGA 5F5AA 2F17A 2XOMA 3I3BA 1H2NA 3ELNA 4EN9B 4FTBA 2LS6A 2Q8OA 2GN3A 1UQXA 4Y20B 3H42B 2ES3A 4JGYC 3M2MA 4CE8A 3OD0A 4R52A 3V0BB 4PDWB 3PL0A 5F39A 3GCXA 1ZM1A 1NZCA 1D4M3 1TME2 1V6KA 2QQLA 5FQ0A 3B9IA 4OVEA 1RIRA 1NXD1 1XQNA 2HJIA 4K21A 4QT6A 5GZDA 4FOYA 4TN7A 4PBPA 2DVFA 1X9PA 4X8NA 4QAWA 5F9TA 2ZAAA 2J1RA 1QJFA 2PLV3 4K7JA 4S2HA 4Y5Z0 1VP6A 3ZN6B 2W1QA 3PUQA 3N4MA 1HDKA 3NV1A 2A5ZA 5IK4A 1UY2A 3PTYA 1D4M2 5E16A 1YLLA 1BJQA 3WW2A 4FPYA 3LA7A 3J7MA 4XYXA 2A70A 1JS9A 4EJRA 1RXGA 5C33A 3KHCA 1OLME 4P14A 1F4HA 3WF3A 2PLV2 2VUJA 1C57A 1SDWA 5FP7A 1DYOA 5FJHA 2JB8A 1NE6A 5FP8A 2WC2A 4GWMA 4KU7A 1QKQA 1W8UA 4HANA 1AYN3 1OF3A 3MBWA 4AEDC 4ES9A 3BTZA 2JWPA 4FTSA 1EAH3 3ZXGA 1DGWX 3OBZA 1G9DA 1G8WA 1UZVA 3OY8A 2A6YA 4CEYC 2RDSA 1OLMA 3BIWE 2VMCA 4QKFA 1YQ2A 1UXZA 2UY8A 3Q8AA 4KGQA 4AF9A 4BM8A 1U0AA 1ND2C 4LLOA 4XJ8A 5KHKA 3LGRA 5JR2A 1DIWA 2WNUA 1EAH2 3VDCA 1XU1A 2D5HA 2YXSA 4B29A 2W9XA 2XQXA 4QPGA 5FZ6A 1AL23 1OA2A 3VZNA 2YBSA 2HEVF 3CHXA 3IB3A 2D6LX 2HWB1 4PQ9A 2WYSA 3HNMA 4E2GA 3UKTA 4MOAA 2AH2A 4H55A 3BUCA 5T5JA 2BPA2 3CO2A 2KD7A 1OQEA 2Y60A 2ZTNA 4LBOA 4N43A 3WEZA 4ASLA 4AEDB 2IFRA 2Q8DA 5FZGA 3VBFA 2VNGA 2V4AA 2WA3A 4XUNA 3RGBA 1AL22 3ZYFA 5I93A 1NAEA 3RZLA 2E53A 3ZXDA 4AI1A 1OQ1A 3HBKA 4MGKE 4AGGA 4IDZA 1DZQA 5FZOA 1W6QA 1WMDA 3B7MA 2QE3A 1ZBA1 2BJSA 4XMAA 5LBBA 4O9GA 4NPMA 4CDXC 2J1AA 2D3PA 3VV1A 5APAA 3QOPA 4HT1T 4UF0A 2RMU1 4OUSA 5FY0A 2ERFA 4DRVA 5LA0A 4WM8A 4OZXA 1Z7S1 2JEMA 2XL7A 2LALA 1IS6A 4ZXKA 4XXPA 1ZYBA 3KT7A 1HQLA 1W6NB 4FOVA 3IDAA 2D3SA 2JG8C 2XJTA 4CRQA 2ZX0A 4E4HA 1MEC3 2PAEA 3AX4A 4META 1XNAA 1YRZA 2XBO1 1V6JA 4O61A 3DYMA 2ZMNA 4CPBA 3AMHA 3GJAA 2RS31 4MZUA 3UETA 5L9RA 2OUJA 5EJ3A 5BNPA 3OBAA 4AI8A 1A8MA 3WCRA 2D3RA 4XAAA 4CU7A 1XE8A 1AXYA 2AACA 2D6MA 3MUZ1 1EY2A 2QUOA 4ARYA 1MEC2 5IK5A 2FZ1A 3MF9A 3J7LA 2Q0AA 5GLZA 2ZHNA 2VZPA 3VBUA 1QF3A 3T0AA 2R0FA 4QXCA 4CU8A 1K5MB 2JENA 1HRI1 5HXMA 1JMUB 5IHRA 1WW7A 2QQMA 2VW1A 4ASKA 1O3TA 3WQBA 5L73A 5FPXA 4FBFA 3ZN5A 2DBNA 5GKAC 1JODA 2BOIA 1EYBA 1QOOA 2NYYA 3DKWA 4GD4A 4JX0A 1O3RA 1DQ6A 1VBB2 2VC9A 4LHSA 1TME1 3NKGA 4XZPA 2YU1A 1C8NA 1POQA 3ILFA 1IKPA 4CCEA 4DB5A 5IAXA 3FN9A 4XF3A 2LROA 2ZHLA 4DS0A 1JI6A 3OPTA 2V4VA 1PZ8A 2BGOA 3FX3A 5BNNC 4Y1ZA 1E5RA 4S2DA 3EHKA 4HZFA 3ZMNA 1SLBA 4FVVA 2EXKA 4YVWA 3INAA 2ZGNA 1OH4A 3AFKA 3T0BA 1D4M1 2CAVA 3DPRB 4AW7A 3O0VA 4LBMA 1RINA 1UYPA 3RI8A 1OKQA 2BRTA 3TOJA 1YQ6A 5FZ3A 4ZZ5A 1IS5A 3C7FA 1U5ZA 3AMMA 4AZZA 2R063 1LOCA 2SBAA 4IEXA 3CKHA 4I0AA 1JUIA 2PLV1 2W39A 4XJWA 3T4HB 5A3NA 3TNQA 3I2OA 3KLSA 2JDKA 1OVSA 1GUIA 3D4KA 3ZYRA 4IERA 2BNOA 4IEYA 4B8EA 2W5FA 4JTNA 3RVHA 2NMOA 4Y4RA 4CCOA 1TMF3 4N53A 3PVEA 2E51A 3ZFGA 1X50A 3POBA 3WUCA 3ACIA 2R062 1IPSA 1OSGA 1EUUA 1VMHA 3M3QA 5FP3A 3AKPA 3K48A 5CAZA 3WG2A 4HOOA 3IIAA 5A32A 2PYTA 5A3TA 2VCAA 4IV3B 3EJKA 2BNNA 3JB4C 1V6LA 2BGCA 2QBXA 1N1TA 4DRRA 1A8DA 3DV8A 1AYN1 1TMF2 1PHMA 1EAH1 1WWYA 5JMOA 3LDBA 2AYHA 1S55A 1WCSA 5KHJA 3WW3A 4RFRB 1IKQA 4CP9A 3WP5A 2A3WA 3TB0A 4PQQA 4LKFA 3ROUA 2UY9A 1JYWA 2C9AA 3ZN4A 3B00A 2DYCA 4R9AA 4KBBA 3RI9A 4KGGA 1HIXA 4IL7A 4LUMA 2X29A 1LGBA 4XCAA 1JYTA 4KWUA 1W0PA 4ZU4A 2NPIA 3N3HA 4W65A 5FMOL 2QQPA 2O0OA 1SPPB 2XPJA 2HWD2 4NIIA 1H8TA 5CADA 2BYVE 2CGNA 3AKTA 3ATGA 4A45A 1RUC2 3JCIA 3O1PA 3E1F1 1AL21 1QJX2 2OQ7A 2C4XA 2Q1ZB 1KFXL 3POYA 1NA1C 1X8EA 2VCBA 2ZAHA 3LDKA 4NPRA 5T55A 3U0ZA 2VMIA 3ZFFB 3HN1A 2FHRA 2EIGA 4B4QA 4BK4A 1GANA 5EP9A 2MEV3 1W39A 4IEOA 2VR4A 1R64A 3WW4A 4K8FA 1HQWA 2OPKA 1UMHA 2JDNA 3FJSA 5HCFA 1GP6A 5FZCA 5A7WB 4PIZA 4ES8A 1APNA 2LTNA 4WVMB 3S0MA 1NY72 4NJ4A 4JVAA 3BALA 2IC1A 5FREA 4MX3A 5FDBA 1KD7A 1Q8OA 2RM22 3P1IA 2V5DA 5DG1A 1QIQA 1NCQC 3CMGA 2ZEWA 3ACHA 3H8OA 1IZ3A 1YFUA 3ACFA 3N7JA 1DGLA 1UYXA 4OYUA 3VD9A 4CCKA 1COV3 1B35A 2CDOA 4EN0A 1KEXA 2VZSA 1MEC1 2P2KA 2PHUA 5EJZB 5DAVA 4UWDA 4XF9A 3ZKYA 5C9AC 3I3DA 1VALA 2A7AA 2KA3A 4QXHA 2ZKNA 4MXVA 4RR3A 2VZTA 1CZSA 4JQRA 5HV0A 1GNYA 3T2TA 1XNCA 5F8PA 1XU2A 3THDA 2FDHA 4MGQA 1PMJX 4MGTA 3LPGA 1MS4A 1BMV1 3LOBA 3NV4A 4H3WA 2VMEA 3VBRA 2IXJA 1VBB1 2VBBA 2PAMA 3VHOA 4FPEA 1CIYA 4XABA 2XLFA 1VAKA 4UFJA 3ON7A 3F95A 3IPVB 1BLZA 2J1EA 1RUF2 4XFIA 1WA4A 1XYNA 4JDOA 2Q8EA 4GULA 5D8AC 1ZZ9A 3DUIA 2ZPXA 4YLZA 2B45X 3A21A 4MXWA 1ZRIA 3THPA 5FZIA 2E7TA 4ZS3A 1CX1A 5A7PA 2A1XA 4K8RB 4MO3M 4N90A 4CCCA 4AR2A 5LWBA 2RG4A 3F2ZA 1SCRA 3CEWA 3PJQA 3B3QE 2XKPA 3WP3A 1DYPA 1EPWA 3VB9A 2OT7A 4IE0A 5JOWA 2GAUA 2VNRA 5FK7A 5JIAA 4BWOA 1W8HA 3GGLA 4ZHNA 5FZAA 4AQ6A 4LBQA 1AR73 4QX0A 1C3HA 1H6YA 2OZ6A 1DQ0A 1FOD3 4HKWA 3J8F3 4R4ZA 3ETPA 3RFRA 1MPXA 5A6QA 5FZMA 3JXSA 2R061 3KQ4B 3LFIA 5DAXA 4DXSA 2GDFA 2WZR3 3GBFA 4NWWA 1DQ4A 5FZ0A 5K8SA 4NIDA 1GZ9A 5F2WA 3DYPA 5ABJC 2VTXJ 4YM3A 2QQKA 2D98A 2XDVA 1QJY2 4YVSA 2RDNA 2GN7A 1BCXA 4V2VA 4XUPA 1JYNA 4X6QB 1TMF1 3A22A 1CIWA 2UWCA 5JLVA 3W20A 2PXJA 1OD3A 3AL5A 1D0HA 3VHPA 4DXZA 3ZYIB 2ARXA 2P6CA 4XFFA 1FV3A 1JTZX 2JX9A 3OGVA 4CDQA 2VOXA 2XONA 4XE9A 3AZVA 3AZYA 5JDBA 1N47A 4KU8A 4BQ3A 1DP0A 2WT1A 2RJKA 2VQTA 3C8XA 3P5BA 2RS53 2X10A 2XJSA 4G4FA 2QKDA 1IHMA 4L99A 2K46A 2JJ6A 5A6YA 2HWD1 3KCCA 1O4ZA 4COUA 5LA9A 3IIIA 4RFT0 1J3PA 1RUC1 1AYM3 3FLRA 2ZABA 1QJX1 3K75B 4RD7A 1QEXA 2VQAA 1H1MA 1W05A 1AVBA 1GKBA 1AR93 4AG4A 1MR5A 5ABJB 2FD8A 1OKOA 3ST7A 5KXBA 1W8OA 3CIHA 5SV8A 4ZONA 3V64A 1NCRB 5F1RA 4V2WA 4XQDA 4DUVA 4IQPA 1TNFA 2XH6A 1LR5A 1QXRA 5FYYA 4AHZA 4F7ZA 1N3PA 1A6CA 2GMPA 3VHRA 5C8CB 5C4WA 3SQOA 5C71A 5CFCA 1AYM2 5CU1A 3OUIA 2WNUC 2FDGA 1V6NA 3WF4A 1UAIA 2O8OA 1F15A 1QMJA 4QU1A 3RWNA 2GMEA 1M06G 5DMYA 2GC2A 5DZEA 1Q3EA 2AEYA 3AMPA 3I59B 4LE3A 1EPZA 1CAXB 4W50A 5HBAA 5FZBA 2VJXA 4QHBA 1REDA 3IMMA 3AKQA 2FCUA 1AR83 1ENXA 5C5TA 4N43C 1E57A 1YJLA 1OF4A 2XL9A 3VBFC 3WDUA 5C3PA 3AVSA 2XUMA 3UGGA 4E4DX 5JOXA 4UXAA 5LEJA 3ETQA 2I74A 3AP5A 3PU8A 1G9CA 1VAMA 5L7OC 4XF4A 4FPCA 5JR7B 5J7MA 1YXWA 5A80A 4FI9A 1UCXA 2KXLA 1IPJA 2J42A 3WQ0A 3O12A 4YFZA 4MH0E 3AXEA 4BIFA 4WM8C 4YZ5A 2DTYA 4IEUA 2VTXA 1FX5A 2WIIB 1US3A 2YHJA 3K77A 4UFMA 1Q43A 1COV1 1YFXA 2XWBB 1VMJA 3E5XA 1CN1A 3LEMA 2WFF2 3GBGA 5H9RA 1QNYA 4COWA 1D2SA 2WSUA 4XTPA 1HJGA 2WWSA 2YBKA 2DU1A 4GKYA 2IXIA 4NHYA 4LO4B 4YM1A 1UX6A 4D3WA 4HK9A 5IFPA 3VBFB 2XUEA 1CD3G 1RUF1 2D6KA 4IEZA 2VO5A 2VCMA 1UY4A 4P9GA 1ZRRA 4XEZA 3UGFA 5CFDC 5M0TA 1YC61 1SLAA 3MEPA 2WAAA 4CCJA 3D8CA 1VMFA 2SLIA 3K3NA 5FZ9A 4RHV3 5L7OB 2D5FA 1B09A 4CXXA 3TEZA 4GZ9A 1TG7A 1CJDA 1UPIA 4K20A 3RZHA 1R1A2 1WZXA 5FLJA 3VBUC 2VW0A 5A3MA 4GB33 5FAXA 2IWGB 2BBVA 2XQRA 2ZGSA 3PNAA 1X36A 1OH3A 4UT5A 2XVGA 4EV0A 1LCLA 2ZKLA 4QQHA 1C1FA 1DQ2A 4RHV2 1Y3TA 2JDZA 4FFHA 3HIFA 2WR9A 3ZDSA 2CNAA 3G7DA 5L9BA 5JXIA 3ZO0B 3BTXA 3PJYA 2HEYF 2ZGUA 3GM8A 4N7UA 1ZRCA 1GNZA 2JECA 4GB32 4DO0A 1JZ5A 1CWPA 1JZ3A 1O6UA 5A3PA 4XETA 5SV5A 5CFDB 1RUJ3 1K45A 4QX2A 4XMIA 1YCIA 1GWMA 1QJY1 4OI2A 2HYXA 2PN5A 4YVWC 1DQ1A 5A7SA 1AR71 5B4XA 3TYJA 3CJIA 3POIA 4CCMA 1FOD1 5AFBA 3J8F1 4EN7B 4W4ZA 2ZHMA 4CEWA 2FCTA 3B5LB 5JZGB 3ZSLA 4LO5B 4C0BA 1H1AA 3OGSA 4TSVA 1SFPA 3K46A 1RUJ2 2JE9A 4CDUA 4WZFA 4MLOA 3FHIB 1O59A 1ZX5A 2NZ9A 5HXVA 3BYWA 2D6NA 1G9AA 4CCLA 4WM7A 1DGRN 2VG9A 4YGCA 3U37A 3UK9A 4A6OA 4E27A 2QQVA 4B4PA 1TEIA 3VKLA 2HKXA 4UW5A 4QPIA 3WNLA 2HWF3 3AMQA 2QZ2A 1BK0A 2MHFA 4Y5SA 3IWZA 5T5LA 4XURA 4JKMA 4B7KA 4IE5A 1FV2A 1W2OA 1ZNPA 2TBVA 3BPZA 1YFYA 1T6BX 3GBWA 2W2IA 4IEWA 3PLQA 3HQUA 4LPLA 2CGOA 4M0HA 5IWFA 2W1WA 3U4SA 1R093 4YSFA 1OC1A 3NNMA 4P5HA 1IG0A 4Q29A 2WAOA 1AYM1 2HWF2 1ODMA 4AE2A 3D5OA 1AR91 2YY1A 1XPWA 1VJ2A 2PHXA 4XIOA 5IT6A 4ZXEA 3ACGA 1RUD3 1RUOA 1F5FA 1WW6A 1W6PA 4UYBA 1LHWA 1BZWA 2LUWA 3OTFA 1R092 2B9VA 3VZLA 1ZBA2 1JBCA 2OVUA 3BPSA 4K40A 2R30A 1MZ5A 1LGCA 4GJYA 3NAPA 4A7ZA 4A6SA 1WLWA 1WBFA 4AQSA 3ENRA 1RUD2 1I6XA 4GH4A 2X5IA 2VZQA 4OULA 4QGNA 4OCTA 1K3IA 2R043 2Y8KA 1JN2P 4KWLA 4ZS2A 4IEQA 4NOTA 4AAXA 1GZTA 4B7EA 3O1OA 1OOPC 2ARCA 1VB4A 5C3OA 3AMNA 4GMP0 2XLAA 1ALYA 1H8VA 3I7DA 3RNSA 1JOJA 4JRAA 2IXCA 4FP3A 2EIEA 4Y5TA 5IUQA 4Y26A 1IPKA 5T5PA 3NNFA 4AVCA 3IAPA 4CP2A 5K9YA 2BQPA 1LTEA 3OGJA 3RZJA 3T0DA 2WFF1 4I02A 4WZCA 2D40A 2R042 3EYPA 1SLTA 2E9QA 2AR6A 1QXPA 4WVZA 4DMIA 3RZZA 2VL4A 4CZSA 4YGBA 1CZTA 2PFWA 2RJ2A 2VECA 4LHKA 3D3AA 4C8DA 5FUPA 2CTVA 2X05A 3LOIA 4W6YA 1HRI2 3AZZA 1SQ4A 5EV7A 5AVAA 1R083 4EZHA 1MZ6A 4UFLA 1B35C 3LEIA 3OG2A 4QKBA 4OUEA 3NL1A 1X9TA 1Z78A 3TBDA 3MO4A 1SHWB 1CAWA 1WCKA 1OOPB 5AVPA 1R1A1 4C91A 3VDDC 5BNOC 3USUB 2E32A 1UIJA 5JXHA 1FXZA 4AWDA 3ZFEA 3RWKX 3WNPA 4RR3C 1PVC3 2BERA 2PQQA 1CPMA 5FBJA 4OHZA 3N9QA 3VBHC 4C1WA 1YHFA 3ZXFA 2ZGLA 4HLTA 2TNFA 1W6MB 2KR2A 3VD3A 4KWJA 2WN3A 2ZGMA 4RHV1 2B8MA 3HBZA 1RUNA 3OBRA 2J1TA 4JV4A 5F5CA 3ZYBA 2WWUA 4I0BA 4TTGA 2J22A 1VBE3 5LBEA 4XIKA 4Q4Y3 4CXYA 4JGZC 4GB31 1QDCA 1DCSA 3I2GA 3KQRA 1K12A 4LBLA 5E1RA 4A4AA 2VZ3A 5E8AA 4AVTA 1AX0A 2OZJA 4QGMA 5EFUA 2XHNA 5H9PA 5FRAA 2VE1A 2WLPA 3GZUC 2WINB 2VOVA 3LIGA 2WZPP 4Q0QA 1SFNA 1AL0G 1O91A 2IVJA 1BEV3 2YROA 1JYCA 4JGYB 4Z82A 2YYOA 1SBEA 5F32A 2GU9A 3MLJA 2BVVA 1VBE2 3J7HA 1W06A 4Q4Y2 2BOJA 2CWMA 4OHXA 3VDDB 1HX6A 1VE0A 2Y6JA 1J1TA 5BNOB 5LCWL 2AEZA 3TEWA 1NKGA 5GZGA 1UPSA 2YUEA 3CQOA 2VOWA 3GNEA 2D97A 5L19A 1RUJ1 3WZ1A 3VBHB 2WO1A 3ZPYA 3HPNA 3I2DA 4LOSA 1UOFA 2XLGA 5FUIA 2W92A 2CYFA 1BEV2 5HPOA 2EIDA 2GC3A 3RJRA 2XVKA 4G3YC 5AC93 3HMYA 3H9AA 3ZYHA 3IAQA 4JGZB 4AI2A 2VZUA 5F5QA 1H4GA 1OFSA 4FPKA 4HVRA 1AYN2 2Y64A 4JCKA 1I5ZA 2RHPA 3UKNA 5FY5A 1RUG3 1KGYA 2JG9A 1W90A 5KR7A 1CAUA 1TVGA 3DN7A 3FBYA 4XDQA 5FPZA 3ZYPA 4YVSC 1J83A 3KZ4C 1KFUL 4JHZA 4Q8LA 5AC92 3GHNA 3IM0A 4WBBA 5H9SA 2HWF1 3AZWA 5I0RA 4UBHA 4YZ2A 1LRHA 2X09A 3I2KA 1URXA 5FPAA 3KF5A 4Q0PA 4CP1A 5IK8A 4HPKA 4LK6A 4CDQC 4IV1C 4PT6A 1NQJA 3A0KA 3UGHA 3KB5A 1MQTA 4Z07A 4CEYB 4ZU7A 3Q8CA 4KG0A 4P02B 3ZXLA 1R091 4OZOA 3MW2A 4PHZA 1ZZBA 3EQEA 5DDJ3 4R8HA 2CWSA 1ND2B 4IGPA 1G7YA 1OUSA 1QJU3 2RDRA 1WCUA 4QX1A 4CTEA 1PO23 1JZ8A 3RYKA 4XBNA 3VHNA 1RUD1 2CY6A 3IDEA 4XCBA 1XC6A 2ADDA 3ZM8A 1JUHA 4DEQA 4BHPA 4OMCA 5DDJ2 5E88A 1QXJA 1AHSA 1NLSA 5C4WC 5A33B 2VMHA 5F6LB 3D0JA 5CFCC 1F35A 3BTYA 3N9OA 3DYOA 2YV8A 3GHMA 4QQ2A 2BW8A 3H7JA 3SCFA 3PUAA 4DXRA 4IV1B 5FZLA 4P08A 1JYIA 1OPMA 5FYTA 2ZEYA 1DZTA 1C8M3 2R041 1LENA 1OA3A 2ZS6B 1CAVB 4M00A 3V0AA 3U14A 2VGDA 4PJYA 1WMFA 5FUNA 3SNMA 2F4PA 3ZOIA 2TUNA 4E8CA 1KJLA 4QGLA 2DCTA 2WYFA 2ZX2A 4CDXB 4AEKA 1OURA 1O5UA 1ULFA 4RGAA 4BIOA 4QB1A 4OQ8A 3I2FA 5C3RA 1OA4A 4WVWA 4E2QA 4YYOA 3PVOA 1A78A 2BDRA 4OHWA 2DWRA 1C8M2 2R073 3IKWA 5FZFA 5FYBA 3H3UA 4BQ4A 3MHZA 1BMV2 3VBSC 2XGXA 1WKYA 2UURA 2JG8B 3VDAA 4BU2A 1U12A 4QD2A 5C4WB 3CNAA 4XTMA 4LXLA 1UZWA 1CZVA 1YO8A 3USSA 1N1YA 5T52A 3WV6A 5IVCA 3FUOA 1WD4A 2BNMA 5JXJA 1VPHA 1RJ8A 3OYWB 1HN1A 4FOQA 1HXS3 2RR13 5G05L 5CG8A 3W5MA 4P9LA 1O4YA 2W68A 2WO2A 4P5YA 3Q9OA 4XF0A 4NIGA 1T2XA 5ANNA 4UW3A 3ZYGA 3UESA 2JICA 4WVVA 4NUBA 1W8FA 3MYXA 1PNGA 1VBC3 1S2EA 2WZ8A 3WUDA 2K9ZA 1H4HA 1S2BA 3OPWA 3ZVXA 2IUWA 1E5HA 1Q8SA 2C6SA 3FWEA 1KITA 2BWCA 2JDMA 2RR12 1DLCA 1UIKA 2WO3A 3MDPA 3NJXA 1YQCA 4XFCA 3T2OA 3WVJA 4D69A 2FDKA 1BYHA 2IVIB 5FYMA 5A3WA 4RQPA 3LB9A 3VBSB 1VBE1 4Q4Y1 4KI5M 1GSLA 5K0UC 4AHXA 3VZKA 1VBC2 3MLKA 4D7TA 4LUKA 1G6NA 4OHYA 3WQ1A 1Y9QA 2YDEA 2VMGA 4S2GA 1YI9A 4IEPA 1UNBA 3POSA 4SBVA 4XILA 3T30A 3VL8A 3AP7A 4RGGA 5BNNB 2QQOA 1V9U3 2JXAA 4ITCA 3SH4A 1BEV1 3BN6A 1ZVFA 4F8AA 1TQ5A 3GZTB 1EUTA 3GXUA 4Z1VA 1RGSA 1WGPA 1GZWB 3M3IA 3O0WA 5B2GB 5A70A 2ZCWA 1REEA 1QDOA 1UY1A 1PM7A 2CV6A 4JKLA 1SEFA 3LPFA 1JYVA 1L7QA 3IDCB 1OPOA 1I3HA 1WD3A 2V09A 5LEKA 3T3YA 1V9U2 1FPN3 2ARAA 1ULDA 2K0GA 4P9WA 4XXAA 1WMEA 2AGSA 3T08A 4EQVA 4NAOA 4AK3A 2ENRA 1PZ7A 3CF6E 3D6EA 3NNJA 3VBOA 1WBLA 3PVBB 4AOCA 4LBJA 5AC91 1W6OB 4QQLA 5K0UB 1DQ5A 2BP6A 5F7UA 4CEWC 5HCHA 1WCDJ 2FQPA 2VVEA 3HVDA 4BMBA 1MACA 2DTWA 5GM0A 2RS13 3GJBA 4XW3A 3AFGA 4LKEA 4YG3A 1US2A 4CDUC 3SH3A 1FPN2 1LOFA 3PUSA 1LHUA 3B69A 4P9IA 4L97A 2ZX3A 1UY3A 4NAMA 2JKXA 2R1BA 4CSWA 4C90A 3MW3A 4QXKA 3WW1A 3VD4A 5JXGA 4HG6B 4QPIC 4GMP3 1PMIA 2EXIA 2H6CA 2WABA 4WV8A 5T3NA 1YEWA 4FFIA 2RS12 1PK6C 3ZSJA 4GA9A 1UOJA 4Y33A 5ISLA 1E5SA 2GZWA 1ULEA 1YQ8A 5FOBB 5FFOC 1AR63 2OX0A 3O0XA 1PIV3 4TLGA 3MZHA 4RS5C 5FXXA 1JZ2A 1HKDA 5GLTA 5FYSA 3POFA 5I91A 5DDJ1 1ULCA 1LEDA 2A71A 2V72A 2LW8A 2MEV2 3ZLIA 4OLLA 4Y20A 4XBLA 5ERLA 2C9KA 2W87A 4DY3A 1WW4A 2YBPA 3V0BA 4PDWA 2VULA 2VH9A 2XJQA 1AX1A 2Y6KA 4CDUB 3KCYA 2EAAA 2GC0A 1AZDA 2E7QA 4MV2A 1OT5A 1PIV2 3OEAA 4QKDA 3H50A 1NA1B 1H9PA 3PU3A 2BTVC 5FPLA 3N9MA 2XWJB 5FMBA 5K7PA 2YFUA 1F5JA 3MUY1 4UFKA 1VBD3 5G04L 2PHLA 5LZ6A 1N3OA 4AFBA 1GQHA 4XFAA 4GALA 1SBDA 4A41A 3H1MA 3VL9A 1BVVA 1LU2A 3ZN6A 3HOBA 1LOBA 1IQDC 4Y1UA 3RYRA 3NAPC 3U11A 4Z8BA 1PK6B 1UY0A 1V70A 5C8WA 4TWTA 3CU7A 4GAZA 4MHRA 4PLNA 4GH4C 4QHZA 4CDWC 1C8M1 3I8TA 2IXHA 2G9GA 2X5IC 3N9LA 4FQZA 3SXWA 4CUBA 2Y6LA 1COV2 3CBNA 4NRMA 2YMZA 1RUI3 3NW4A 4RS5B 4M3CB 3UL2A 3QH6A 1LHVA 1UF2C 4PLMA 4P00B 3U1XA 2WUHA 2PA7A 1VBD2 3C7GA 5KHGA 4Q5OA 4AEMA 3MPPG 3VD7A 5LW9A 2OUHA 5BNQA 1XB9A 4M4PA 4MHUA 2CDPA 3P3PA 1SCSA 1NCQB 4O9EA 1U5IA 1OMIA 1FYUA 1YIPA 3EB7A 2YC0A 2VU9A 2R071 1OI6A 4BZ4A 3E5QA 1AF9A 3ZR6A 1RUI2 3NNLA 1GWKA 3J26N 2W0XA 1L7LA 2P17A 4M0NA 5C7GA 3AZXA 3LD8A 3WD5A 3WINE 2ATFA 2ARBA 5HV4A 5CNAA 5JOYA 3WNNA 4ET7A 5C9AB 1YFWA 3NAPB 3K51A 3RYPA 3U78A 2RR11 5F3EA 1R1ZA 4CDWB 4UFHA 3VLBB 3AYDA 2FCVA 3KV5A 4A7YA 4HXCA 1OLQA 3WHUA 2QQIA 5EPAA 1LB2A 1UO9A 2GH8A 1VR3A 4Y3OA 1VBC1 1HLCA 5DG2A 5FPVA 2JD4A 5T5OA 3QACA 4I2OA 3ZFEC 1D2QA 3M3CA 3TRSB 1JH5A 3OUJA 1DGRA 2NM1A 3BOPA 4GJZA 4LNVA 1DF0A 1SDDB 1X33A 3QH7A 2Y6GA 4AEDA 5D8AB 5FMCA 3WF1A 3G6JB 3MV11 4BMEA 1EV13 5DZGA 2JB4A 4YARA 3N7MA 1KS4A 1W9SA 2C24A 5LY2A 1N1SA 2PHWA 5ANQA 1HRV3 3ACLA 2K2SA 1AR72 4BH9A 2ZGQA 2DUQA 1FOD2 2XMLA 3J8F2 1UN1A 1SBFA 1F8VA 4NIAA 2R6QA 4INDA 2ZMLA 1NX9A 1GBGA 4YFWA 2WZR2 4AVSA 1A34A 1V9U1 4LLFA 2VOTA 2WRAA 5J98B 1GZCA 1LU1A 1QHDA 2NN8A 1GFF2 3CZJA 3OGRA 3A23A 4XAEA 3O14A 3J4UH 1EV12 4SLIA 1NYWA 1Y9MA 2A6WA 2C0ZA 2VVFA 3JU9A 4FPFA 4NHMA 4A2UA 4COVA 1DFQA 5FY7A 3WSOA 1QOSA 3MFAA 1W0NA 3S7EA 1RL3A 3H3LA 2Y6HA 4YW3A 4NWVA 2DCKA 2YC4A 4GWIA 5FQ0B 4YPJA 1W6NA 4BPZA 3T1MA 3KV9A 4I09A 2VY0A 1JHJA 4Q1RA 3H3ZA 5LRRA 4AI3A 3VUOA 1FPN1 3BVCA 5FYCA 5FMDA 3PIJA 1UOGA 3P3NA 4LK7A 3AJZA 1XNDA 2WNOA 3N7KA 4YZ3A 2RS52 1S0GA 2AREA 1FNYA 3KT1A 5CG9A 2LM3A 4JDNA 3WOGA 3KD4A 2B46X 2RS11 2Z79A 2WFPA 3R05A 4OI4A 5EWSA 3ZIXA 5IFTA 1AXKA 2A75A 3T2QA 4QPGC 3WXPA 2GP3A 1AR92 1UW8A 1LHNA 1S0IA 3WNXA 2AC1A 1K5MA 2VVDA 2HWE3 1UMIA 2MEV1 2ZZJA 4QXBA 4YW5A 1P8JA 3W5NA 4GMP1 1ZBE3 1MS1A 2VUDA 4FPJA 2DUOA 5LASA 2CSGA 4LKSA 5FZ4A 3RJ2X 3B02A 2QJVA 1BHGA 1AR61 3OY8B 1W8TA 1PIV1 1MQTC 1KDMA 4D7YA 5GZFA 5EJ1B 3ZSKA 2HH9A 2B7YA 3H0OA 4Y22B 5FYIA 2HWE2 5FZ8A 1PNFA 4J25A 3ORJA 1MS8A 1NLQA 1RJ7A 3VZJA 3WF0A 1AR82 1Q8QA 2ZEXA 3ZXEA 2OQ6A 4UW6A 2DVDA 5C3SA 3JBG3 2WNUB 5CISA 1F9KA 2XJRA 3DXTA 5FLHA 4QPGB 3SISA 3DPRA 3EXUA 1O5LA 1VRH3 3W58A 5EIYB 2B42B 2CHHA 1LODA 1VBD1 4KG8A 2AZ5A 1HN0A 2WNEA 1V0AA 3A4UA 2FMDA 5JPNB 1K5JA 1ACCA 2XJUA 2I2SA 3JBG2 4N43B 1D4VB 1DZRA 2D43A 2WJSA 4ORFA 4QB6A 3EMRA 1ZZ7A 2ID4A 3HD8B 3SHRA 5FO8B 3FLPA 2ZOEB 5BNPC 1MQTB 1UKGA 1RUI1 3MF6A 4MSVA 4HVQA 1DDLA 2ZJCA 5FZOB 1W6QB 4EWAA 5LK5A 2VPVA 4NHXA 1OUXA 3J9SA 5KXDA 4QDSA 1POV0 1JZ6A 1QQP3 2QQJA 2ZHKA 1Z0HA 2MPFA 4UF0B 4IV3A 4OUMA 2RVAA 2W3JA 4GWJA 4WM8B 1ZA7A 3I3MA 2WQ4A 2W95A 3BKZA 3X29B 4HKLA 4QDRA 1KJRA 1WUVA 1LGNA 4AXOA 1JU4A 3U4XA 1KXGA 5DUXA 4LA3A 3HJRA 4AFAA 4AVVA 4DOUA 5DABA 5CIRA 4NRQA 1QQP2 5CEHA 5HCBA 2ETEA 3LQCA 3NJYA 5J48A 4YNIA 3MIGA 1W8ZA 1CR7A 4U36A 5I0UA 4G9SB 1HV0A 5JMCA 1ASJ3 1SPPA 1OLRA 2GP5A 3MIBA 4LBKA 5BNPB 1C1LA 1QWRA 1QH6A 4IXLA 2JDUA 5IJRA 2JKBA 3PUIA 1XRUA 2Q8CA 2R7EB 1GLHA 2HWC3 4W8JA 4YW2A 4DUWA 3BOWA 3AL6A 3LZZA 4FCAA 3VBUB 3ZFFA 1BXHA 2XVLA 3GF6A 2BZDA 2A3YA 1XNTA 2WZR1 2QQWA 5IVFA 1XJAA 1ASJ2 2J7MA 2Z42A 4HL0A 5DUVA 5T50A 1S0JA 4DY5A 3GALA 3URFA 4HN1A 1OXCA 1EV11 2ORXA 2Z69A 3POWA 1BK1A 3LEKA 5BXXA 1UYZA 3FFQA 3RRDA 1C5HA 3AP4A 5A7WA 4CA9A 5HCAA 1DLLA 4WVMA 2WSVA 2HWC2 4HSJA 1T6GC 5FY8A 1LNSA 2WNVA 5A7QA 2UWAA 1IG3A 2D6OX 1U5XA 3KCXA 1IS3A 1CX4A 3POEA 4N53C 5DAQA 3ZFGC 3H8XA 3I4IA 4A7KA 3WCSA 4QQPA 3MLLA 1S4CA 4HETA 4MVTA 4AAPA 1PM4A 3BODA 4L11A 1W2UA 2UWBA 3JQWA 4DNYA 2W91A 2RS51 4YVWB 2IXLA 3M1HA 3DF0A 3WHTA 1IOAA 1J58A 5CZKA 3JUUA 2HWB3 1GP5A 2QZ3A 4H14A 5FZDA 4EZ4A 2QQUA 5FY9A 4CUGA 4ZU5A 4DIQA 4XBQA 5I0TA 4E4ZA 5CKMA 1JZ4A 2C5DA 4YG0A 2BBAA 2VOKA 3P6BA 2VUCA 2DCJA 2QNKA 1NLRA 2X53S 1DBNA 2W1UA 3A7QA 4CPBD 4B3NA 1J84A 1NUKA 4N53B 1H8TC 1Y4WA 3VKOA 3ZFGB 3RPQA 3WDXA 4FAGA 4QPYA 1Y7BA 5H9QA 1UZ0A 1QJEA 5CKNA 5JI7A 1LESA 4FPOB 1LOFC 2JE7A 2YC2A 2XG3A 1MS9A 2WWJA 4L9BA 4N9HA 4R4XA 3VD5A 1S1AA 2JIJA 5FLIA 4YWAA 5A32B 5CBLA 2XB6C 3IPVA 1W2NA 4LO6B 2W52A 5FZEA 3WDVA 4BQ5A 2HWE1 5JVVA 2DUPA 2O8QA 3AXDA 3SEPA 4XPVA 4B1MA 2BEOA 1ZBE1 2GH2A 1AR81 1YYNA 1SLLA 5IVJA 2YFZA 3K3OA 1XBFA 3B9CA 4ISQA 4Y1VA 5EYYA 4CU6A 1VLNA 2ZGRA 3AKRA 4FPHA 5DUUA 1W2AX 1XYOA 2Q1FA 4JC1A 4CP9B 3OGGA 2FDJA 5D21A 1X82A 3LFMA 1UYYA 5D1IA 2E7AA 3WQ7A 5BY5A 1RUH3 2BFUL 1H2LA 2D6PA 4PI2A 5EXOA 1MZEA 3S6PA 3JD73 3WP6A 1GP4A 2RS33 3WT3A 4MGIE 2QQNA 5I8TA 2Y6FA 3H1YA 5IYYA 1TE1B 4NIHA 5AFEA 1JU3A 3ES4A 3WDTA 4KMQA 1CGPA 1S0BA 2D7FA 4E9KA 2PQSA 3JBG1 1H8TB 2VW2A 1J3QA 3LAGA 4PDWC 3TN93 3ES1A 4F3JA 5LATA 5A6ZA 1VB2A 3AYCA 3ECQA 4K3UA 3ZXAC 1UD1A 5I8YA 4HONA 4Y22A 4LBNA 4CCDA 3KGLA 2R16A 1RUH2 4BOWA 1D0GA 4PBOA 3THTA 2WLQA 4X8PA 5JI9A 1UXXX 2OIIA 4JTOA 3JD72 4PI0A 2Z2SB 4FXKB 3E6BA 1DU3D 2UYAA 2VQUA 5FOJB 3OSDA 4IUGA 2VBPA 1LEMA 5F2SA 4AFMA 2D93A 1RUE3 1RTVA 2RE9A 2JDYA 2F4LA 3C7HA 2C26A 2ZX4A 4MGSA 4PF5A 5FP4A 3ALQA 4BQWA 1RB8G 1QGLA 1OVPA 4O7XA 4ATFA 3LA3A 3L9JT 3RS6A 3AM2A 1R082 2ET1A 3NV3A 1A3KA 4NPLA 1VAVA 3WF2A 1SZBA 1W2TA 3BU0A 1PX3A 3ME2A 3VBRC 1UOBA 2Y26A 4QMAA 2DBIA 4YZ1A 1QQP1 2QDRA 1XE7A 3POJA 4XQWA 3WG1A 1ZRDA 3KV4A 2B39A 1RUE2 2ZXQA 2VD7A 4P9JA 2ET7A 3GDBA 1VBA3 4LO8A 2Z4FA 1HB1A 2PHDA 2GMMA 1PVC2 1XNKA 3PVNA 1RC6A 5FWJA 5L9VA 4HBNA 2W08A 1B35B 3K4DA 2H6BA 4YRDA 3HQRA 4QM9A 2R0HA 4BK5A 5ABJA 1X8MA 1ZZ8A 3NWKA 1NCRA 3IMNA 1VBA2 1FATA 1Q56A 3KVBA 3MW4A 1LECA 2CL2A 1ASJ1 4GQ7A 4RR3B 1Y9GA 2BV4A 2IXKA 1JW6A 2GC1A 1SACA 3LCPA 4FT8A 4M01A 5C8CA 4FSJA 3DXUA 4AHYA 1XXNA 4PIXA 2Y0IA 2G1MA 4Q4X3 2YPJA 4HN0A 4NE9A 5JWPA 4Q4V3 3VBRB 2HWC1 5IVEA 1GQGA 2G9ZA 4URAA 4N9IA 4D6QA 3I59A 4XZUG 4B4RA 4R9BA 3ASIA 4E4SA 2OA2A 4PLOA 1LOEA 3AB0A 3JZVA 4XF1A 1OQDA 1CAXA 3IN9A 1SLCA 3I3EA 3LSDA 1I1EA 1RVF3 2DVBA 2A6ZA 2G4IA 4ZPIA 2Y38A 4CUAA 4FAHA 2DVAA 2EXJA 4Q4X2 5IATA 4Q4V2 5ACA3 3AC0A 4QB2A 4MXWB 3ZMOA 2GNMA 1KDKA 3S5AA 4AFDA 1HV1A 5FZKA 3A0NA 3OB8A 4DEVA 3NKTA 2ZEZA 4NR1A 3M3OA 5DUWA 2H0BA 2DURA 5DN2A 4LORA 1RVF2 2FBEA 2GNBA 5K4LA 4NRPA 4BJ0A 1RUG2 1N1VA 5IVYA 2F6BA 2VZVA 4H7MA 3N7LA 5ACA2 1UZYA 3KV6A 4ISRA 4XHXA 3FFZA 4L0PA 4D94A 2YGMA 4FOWA 1M4WA 4LBQB 3PHMA 1PGL2 1UWWA 5IW0A 3NJZA 5JUVA 3HT2A 1GU3A 3SKVA 3U07A 4I0WB 2O1QA 5FCCA 5J96B 4D8MA 4YVSB 4IEVA 4Q1PA 4M3CF 3BTAA 1F4AA 1NE4A 1Q5OA 3E97A 1IQAA 5FZ7A 4XJUA 4YW7A 1QJU2 3DKQA 1EP0A 5L7OA 1KRIA 1PO22 5FR3A 1ODNA 5A6XA 1IS4A 3O5SA 4CDQB 2VUAA 2DVGA
chains in the Genus database with same CATH topology
3MIFA 3B93A 1K5MC 3CL1A 2HEWF 3H8UA 3R4UA 1POV3 4QU2A 2I07B 3PMEA 4JAAA 3KSCA 1FMD3 1YI7A 3N36A 2PHRA 2BUKA 2FZ2A 3LSEA 1V6IA 2P3IA 5CA6A 4TYSA 1LOAA 1ND3A 1H9WA 3IDBB 4CP0A 2BWAA 5KHIA 1UU6A 2AUYA 2VQ0A 3E6DA 1RUH1 4K6BA 1N3QA 1ENQA 4HSLA 2R32A 3JD71 4JRLA 1XNBA 4LEJA 4Y1XA 5IK7A 2ZACA 5CFDA 4RA0A 4FXGB 1FMD2 4FP2A 5GLUA 3AYEA 1FI2A 4XJZA 3TN91 5C6CA 1H2MA 5CFCB 4YM0A 2ZMKA 1QOTA 2FMYA 4J1WA 3FC0A 5JPMB 1FT9A 1VBB3 3DPRC 1R081 1CONA 1WLDA 4MGYE 2R072 1UMZA 5JZGA 1G9FA 5JSRA 3CJXA 1S0FA 5HI0A 2DV9A 2E63A 3VGIA 5L36A 4LBQD 1RUE1 2DF7A 1CQ9A 4Q0UA 2Y0OA 4XHBA 5DZFA 2IFWA 3LA2A 3RMYA 3M4FA 4EWDA 1PVC1 3KM5A 4KWKA 4BLIA 1J59A 4AHWA 3R4DB 1CJPA 1HXS2 3MGUA 2EF6A 1AJOA 3RDIA 1DGWA 1O7FA 2WL1A 3HR9A 5JAXA 1DHKB 1VBA1 4IV3C 5T54A 1RMU3 3MFCA 1UKRA 3MPBA 3WDWA 2Q5TA 4GWNA 1V00A 4MYEA 3SCGA 3FBMA 2E6VA 1AJKA 1KQRA 4FTEA 5F6KA 5FO7B 2I45A 2EALA 3UJOA 5KHHA 1RMU2 4OI0A 3FUQA 3R0RA 3JB8A 3FLTA 3O7OA 1GICA 2NLRA 4FO9A 4Q4X1 5JOZA 4Q4V1 3KMHA 1GNHA 3E5UA 5BYNA 1PGSA 3CJIC 2RJLA 4NVPA 1YNAA 3ZFFC 3VKNA 1MVQA 3KT4A 1HW5A 1RVF1 3SITA 1RUG1 5FO9B 4AVAA 1IGOA 2PTMA 5GLWA 2HWD3 3NSTA 4H7LA 4R9CA 5J09A 3B01A 1YWKA 4A3XA 3LKJA 1RUC3 5ACA1 1QJX3 4WM7C 1WLCA 3WLUA 2BVBA 2WNVC 2ZGTA 4C1XA 1PGL1 4LT5A 1RITA 2ZX1A 5KWRA 3T1LA 2EVXA 5E89A 3PMSA 3ZXKA 3ILNA 4RL7A 1J1LA 3GYDA 1UU4A 1J3RA 4LR4A 4XQ4A 2ILMA 3CJIB 4I01A 1QJU1 1S0EA 1SLIA 3TAYA 4LTAA 1PO21 4CEWB 4DINB 5JIUA 2A73B 3OCPA 2RM23 1OOPA 2Z5WA 4N7IA 3ZSMA 3USUA 2CGPA 3AJYA 2P37A 1AR62 4Q0VA 1MS0A 3BU7A 3OBTA 4Z2WA 1HQNA 4I3PA 1KS5A 4WM7B 2C1FA 4XJ9A 3EBRA 2WNVB 1W6MA 2WQZC 2QFEA 2QDNA 4KQ7A 3DL3A 4QPIB 1BBT3 4XFHA 4URTA 3FE5A 4K9SA 4P9XA 3WP4A 3EO6A 2QVSB 4AQTA 1ULGA 4EWAA 1DDLA 1RHI3 2ZGOA 2TEPA 3DGTA 1O3QA 2X8KA 4XFGA 2XKOA 4LO7A 1S2KA 3B94A 5TSWA 1POV1 1REFA 4XJAA 4PIYA 3WY6A 3R6SA 1FMD1 4Y24A 2ZZQA 1QJZA 1G9BA 1BBT2 4JGYA 2UU8A 4BA6A 4LHNA 4AGVA 1LULA 1MVEA 3WDYA 1G86A 4F83A 1RHI2 3VDDA 5BNOA 3WG3A 3QCWA 2H0VA 3NO8A 1W6PB 2PHTA 1RUF3 5KXEA 2OYZA 1OD5A 1S0DA 3VBHA 1LOGA 3S7IA 1L3JA 3H1WA 4I30A 2QCSB 1PO13 2BFUS 1DYKA 5JSPA 5JSOA 4Y1YA 1HXS1 3TWIA 4JGZA 4GH4B 4K1YA 5I0SA 1OHFA 2X5IB 1SMVA 2DFBA 1ZZCA 2EAKA 2GSYA 1YJKA 1PO12 3FMGA 4LA2A 2OW4A 3D0SA 1ZREA 2P34A 5DXDA 4TLFA 4BE3A 2WT0A 1YUDA 4GIQA 4AI0A 4CEYA 4COYA 4D7SA 1CPNA 1RMU1 4J1XA 1QJY3 1AXZA 4UW4A 4NHLA 3SMHA 1UZZA 1ND2A 4HKOA 3AK0A 1FAYA 3MIHA 4YGDA 4EROA 4NO4A 1ENRA 4HK8A 4EWEA 1CAWB 2YZ4A 1I9RA 4YW4A 4BQ1A 1HRV2 3ZXJA 3ZSEA 1NCRC 1BQPA 1S0CA 2GNTA 4DPNA 5J3UA 1QH7A 3ZFEB 1NG0A 1AUYA 1ZZ6A 2XJPA 3WX5A 4HVOA 5C8CC 5A33A 1Q8VA 4ZKTB 1MZFA 2Q1MA 5GJ6A 5A3LA 2Q30A 5GALA 3L2HA 3RSJA 4IV1A 2UYBA 4Q8KA 3VKFC 2G9FA 2AENA 3MICA 1QY4A 2P3JA 1CAVA 4ONUA 5EYXA 2HYKA 4LULA 3VZOA 1NQDA 4I3GA 3ZIWA 4FPLA 2PELA 4CDXA 1Q8PA 3VN4A 2JG9C 1UU5A 1BVP1 4KL1A 2PHFA 1JHNA 3AYAA 3TNPB 1X7NA 1LJ7A 4W6WA 3HWJA 2XJVA 1PGW2 2ZBJA 4Q26A 5EZWA 4AVBA 2A3XA 2JG8A 3HT1A 5BUVA 4S2FA 2WS93 4V1PA 3VKMA 1CVNA 1NOVA 5CVRA 2B5HA 3N35A 2R49A 2NMNA 1C4RA 3OYWA 4YGEA 1H1IA 3W59A 1NY71 1ZBE2 4Q4W3 2RM21 5BPXA 3APBA 3M3EA 3RQ0A 3I54A 3JQXA 2WS92 1WLTA 4Q2FA 1JXNA 2JG9B 2MNGA 4COZA 4IETA 1F2NA 1CAUB 1C5IA 5GZCA 1UL9A 1U5YA 2EXHA 3C2UA 4BYYA 4EN6B 3AP6A 4YG6A 2VNOA 4Z92B 1BBT1 3FZ3A 2WFF3 4K1ZA 4Q4W2 1O3SA 3R4SA 1PVXA 3VBSA 4BCUA 3RMXA 4HPKB 3GZAA 1RHI1 5GLVA 1H2KA 3IBMA 4Q0SA 1VRH2 2P3KA 2ZA9A 5JCTA 2XHKA 5BNNA 4AGRA 4ASMB 2DU0A 1QU0A 4P9YA 1ENSA 4NN0A 1ND3C 1GZWA 3VZMA 1R1A3 3OF1A 2D44A 1WW5A 3M7AA 3QBQA 3HQXA 1TNRA 3AP9A 1BKZA 4LE4A 1LKNA 3NVCA 1PO11 4OHVA 2WKKA 1ZA4A 4KH9A 3OD4A 4MGZE 1V6MA 1W6OA 5K0UA 2PAKA 1PZ9A 3V65A 4NHKA 3AKSA 4J6GA 3UKVA 3H7YA 5JZGC 1YIFA 3MIEA 3V0AB 1GV9A 4GXLA 3S30A 4EN8B 1XYPA 4AFCA 4HFSA 4W6XA 1V6OA 5KXCA 3E6CC 1ND3B 3OJBA 4KNCA 4L2NA 3IT8A 5GZEA 4QM8A 4OI1A 1O4TA 2IZWA 2ZGPA 4RQPC 3RG0A 4DFSA 2GALA 1H0BA 1HRV1 1LHOA 3QD6A 4LHLA 3C3VA 1DG6A 5LRSA 4FPGA 4R9DA 3MI8A 2A6XA 5KBFA 5FTTC 4UBGA 1GR3A 4FQ4A 5J37A 1ZRFA 4Y4YA 3BCWA 4XFBA 2NQYA 3W9AA 1NA1A 4M3CE 3SLIA 5J36A 4MUVA 4U2AA 4L8QA 3SH5A 2B9UA 5BV6A 4YW1A 1QNWA 3ZX7A 2V5YA 4TZDA 1PK6A 2R1DA 4RQPB 5I8SA 3VBOC 1CESA 2NP0A 1FNZA 3ILRA 1C28A 2CAUA 4HMZA 4RS5A 4L92A 1PGW1 2HWB2 3UJQA 2DCYA 4M3CA 3V56A 1SFYA 3SCHA 4BLJA 1NXMA 1ZBA3 1F31A 3OPZA 2V73A 1NCQA 1AX2A 2RMU3 2ZGKA 4YM2A 3MIDA 3QLQA 1Z7S3 4QQOA 4E2SA 1OFNA 2A6VA 5KC5A 4DZGA 4ATEA 3BB6A 2WA4A 4JDMA 2YGLA 2WS91 5CB7A 1MS3A 1GYKA 3LWCA 2DFCA 2XBO3 1ONAA 2KM2A 3D82A 5C9AA 5KC6A 2RMU2 4AEJA 3NV2A 5FBZA 3VBOB 5LK7B 1VIWB 3KS7A 1Z7S2 5FMOS 4CDWA 2VXRA 4CYDA 3KGZA 4Q4W1 4YZ4A 2EA7A 4Q27A 3ZYJB 1W0OA 1VRH1 2XBO2 1H30A 4GKXA 2RS32 4XOGA 3M70A 1HRI3 1MS5A 2N7GA 2WT2A 4IESA 4QX5A 4RSUA 2Q4SA 5D8AA 4C0HA 4DQAA 3WG4A 3TN92 2DCZA 1Y43B 3U10A 2GNDA 3HAGA 3CLPA 4X6RB 3WR0A 3M8LA 1TME3 4AYUA 4PCRA 3UV9A 3L2YA 4OFGA 1H2NA 3ELNA 4EN9B 4FTBA 2Q8OA 2GN3A 4Y20B 2ES3A 4JGYC 3M2MA 3OD0A 4R52A 3V0BB 4PDWB 1ZM1A 1NZCA 1D4M3 1TME2 1V6KA 5FQ0A 3B9IA 4OVEA 1RIRA 1NXD1 1XQNA 2HJIA 4K21A 4QT6A 5GZDA 4FOYA 4PBPA 2DVFA 5F9TA 4X8NA 2ZAAA 4K7JA 4Y5Z0 2PLV3 4S2HA 1VP6A 3ZN6B 3N4MA 1HDKA 3NV1A 2A5ZA 5IK4A 3PTYA 1D4M2 5E16A 1YLLA 1BJQA 3WW2A 4FPYA 3LA7A 4XYXA 2A70A 4EJRA 5C33A 4P14A 2PLV2 2VUJA 1C57A 1SDWA 1NE6A 2WC2A 4GWMA 4KU7A 1QKQA 4HANA 1AYN3 4AEDC 4ES9A 4FTSA 1EAH3 3ZXGA 1DGWX 1G9DA 1G8WA 3OY8A 2A6YA 4CEYC 3BIWE 2UY8A 4KGQA 4AF9A 4BM8A 1U0AA 1ND2C 4LLOA 4XJ8A 5KHKA 3LGRA 1DIWA 2WNUA 1EAH2 1XU1A 2D5HA 2YXSA 4B29A 4QPGA 1AL23 1OA2A 3VZNA 2HEVF 2D6LX 2HWB1 4PQ9A 4E2GA 3UKTA 2AH2A 4H55A 5T5JA 2BPA2 3CO2A 1OQEA 2ZTNA 4LBOA 4N43A 4ASLA 4AEDB 2IFRA 3VBFA 2VNGA 2WA3A 1AL22 5I93A 2E53A 3ZXDA 4AI1A 1OQ1A 4MGKE 4AGGA 1DZQA 1W6QA 1WMDA 3B7MA 2QE3A 1ZBA1 4XMAA 4O9GA 4CDXC 2D3PA 3VV1A 3QOPA 4HT1T 2RMU1 4OUSA 2ERFA 4DRVA 4WM8A 4OZXA 1Z7S1 2JEMA 2XL7A 2LALA 1IS6A 4ZXKA 4XXPA 1ZYBA 3KT7A 1HQLA 1W6NB 4FOVA 2D3SA 2JG8C 2XJTA 4CRQA 2ZX0A 1MEC3 2PAEA 3AX4A 4META 1YRZA 2XBO1 1V6JA 2ZMNA 3AMHA 2RS31 4MZUA 2OUJA 5EJ3A 5BNPA 4AI8A 1A8MA 3WCRA 2D3RA 1XE8A 1AXYA 2D6MA 1EY2A 2QUOA 1MEC2 5IK5A 2FZ1A 3MF9A 2Q0AA 5GLZA 2ZHNA 3VBUA 1QF3A 2R0FA 1K5MB 2JENA 1HRI1 1WW7A 2VW1A 1O3TA 5L73A 5FPXA 4FBFA 3ZN5A 5GKAC 1EYBA 1QOOA 2NYYA 3DKWA 1O3RA 1DQ6A 1VBB2 4XZPA 1TME1 3NKGA 1C8NA 3ILFA 1IKPA 4DB5A 4XF3A 2ZHLA 4DS0A 1PZ8A 3FX3A 5BNNC 4Y1ZA 4S2DA 3EHKA 4HZFA 3ZMNA 1SLBA 4FVVA 2EXKA 4YVWA 3INAA 2ZGNA 3AFKA 1D4M1 2CAVA 3DPRB 4AW7A 3O0VA 4LBMA 1RINA 3RI8A 1OKQA 3TOJA 1IS5A 1U5ZA 3AMMA 2R063 1LOCA 2SBAA 4IEXA 4I0AA 1JUIA 2PLV1 2W39A 4XJWA 3TNQA 3KLSA 3D4KA 3ZYRA 4IERA 2BNOA 4IEYA 4B8EA 4JTNA 2NMOA 1TMF3 4N53A 3PVEA 2E51A 3ZFGA 1X50A 3WUCA 2R062 1OSGA 3M3QA 3AKPA 3K48A 5CAZA 3WG2A 3IIAA 5A32A 2PYTA 4IV3B 3EJKA 2BNNA 3JB4C 1V6LA 2BGCA 1N1TA 4DRRA 1A8DA 3DV8A 1AYN1 1TMF2 1PHMA 1EAH1 2AYHA 1S55A 1WCSA 5KHJA 3WW3A 1IKQA 3WP5A 2A3WA 3TB0A 3ROUA 2UY9A 2C9AA 3ZN4A 3B00A 2DYCA 4R9AA 4KBBA 3RI9A 4KGGA 1HIXA 4IL7A 4LUMA 2X29A 1LGBA 1W0PA 4ZU4A 2NPIA 3N3HA 4W65A 5FMOL 2QQPA 2O0OA 2XPJA 2HWD2 1H8TA 5CADA 2BYVE 2CGNA 3AKTA 3ATGA 1RUC2 3JCIA 1AL21 1QJX2 2Q1ZB 1KFXL 3POYA 1NA1C 1X8EA 4NPRA 2ZAHA 5T55A 3U0ZA 2VMIA 3ZFFB 3HN1A 2FHRA 2EIGA 4B4QA 1GANA 2MEV3 1W39A 4IEOA 3WW4A 4K8FA 1HQWA 2OPKA 3FJSA 5HCFA 4PIZA 4ES8A 1APNA 2LTNA 4WVMB 3S0MA 1NY72 4JVAA 3BALA 2IC1A 5FREA 4MX3A 5FDBA 1KD7A 1Q8OA 2RM22 5DG1A 1NCQC 1IZ3A 1YFUA 3N7JA 1DGLA 1COV3 1B35A 4EN0A 1MEC1 2P2KA 2PHUA 4XF9A 5C9AC 1VALA 2A7AA 2KA3A 2ZKNA 4MXVA 4RR3A 4JQRA 3T2TA 1XNCA 1XU2A 1MS4A 1BMV1 3LOBA 3NV4A 4H3WA 3VBRA 2IXJA 1VBB1 2PAMA 3VHOA 4FPEA 2XLFA 1VAKA 3IPVB 1RUF2 4XFIA 1WA4A 1XYNA 4JDOA 4GULA 5D8AC 1ZZ9A 3DUIA 2ZPXA 4YLZA 2B45X 4MXWA 3THPA 2E7TA 4N90A 1SCRA 3CEWA 3PJQA 3B3QE 2XKPA 3WP3A 1DYPA 1EPWA 5JOWA 2GAUA 2VNRA 4BWOA 5JIAA 4AQ6A 4LBQA 1AR73 4Y22B 1C3HA 2OZ6A 4HKWA 1DQ0A 1FOD3 4R4ZA 3J8F3 2R061 2GDFA 2WZR3 3GBFA 4NWWA 1DQ4A 5K8SA 1GZ9A 5ABJC 4YM3A 2D98A 1QJY2 4YVSA 2GN7A 1BCXA 4X6QB 1TMF1 1CIWA 2UWCA 5JLVA 1D0HA 3VHPA 4DXZA 3ZYIB 2ARXA 4XFFA 1FV3A 1JTZX 2JX9A 4CDQA 2VOXA 4XE9A 3AZVA 3AZYA 1N47A 4KU8A 2WT1A 2RJKA 2RS53 2XJSA 4G4FA 2QKDA 1IHMA 4L99A 2JJ6A 2HWD1 3KCCA 1O4ZA 4COUA 4RFT0 1J3PA 1RUC1 1AYM3 3FLRA 2ZABA 1QJX1 4RD7A 2VQAA 1H1MA 4AG4A 1AVBA 1GKBA 1AR93 1MR5A 5ABJB 3ST7A 5KXBA 3V64A 5SV8A 1NCRB 5F1RA 4XQDA 4IQPA 1TNFA 2XH6A 1LR5A 1QXRA 4AHZA 4F7ZA 1N3PA 1A6CA 2GMPA 3VHRA 5C8CB 5C4WA 5CFCA 1AYM2 5CU1A 2WNUC 1V6NA 1UAIA 2O8OA 1QMJA 3RWNA 1M06G 2GMEA 2GC2A 5DZEA 1Q3EA 3AMPA 3I59B 4LE3A 1EPZA 1CAXB 5HBAA 4QHBA 1REDA 3AKQA 1AR83 1ENXA 4N43C 1E57A 1YJLA 2XL9A 3WDUA 3VBFC 2XUMA 4E4DX 5JOXA 4UXAA 5LEJA 3ETQA 2I74A 3AP5A 1G9CA 1VAMA 5L7OC 4XF4A 4FPCA 5JR7B 5J7MA 1YXWA 1UCXA 2KXLA 1IPJA 3WQ0A 3O12A 4YFZA 4MH0E 3AXEA 4BIFA 4WM8C 4YZ5A 2DTYA 4IEUA 1FX5A 2WIIB 2YHJA 1Q43A 1COV1 1YFXA 2XWBB 3E5XA 1CN1A 5H9RA 2WFF2 3GBGA 4COWA 1QNYA 1D2SA 2WSUA 4XTPA 2WWSA 2DU1A 4GKYA 2IXIA 4LO4B 4YM1A 1UX6A 4D3WA 4HK9A 3VBFB 1CD3G 1RUF1 2D6KA 4IEZA 4P9GA 1ZRRA 4XEZA 5CFDC 1SLAA 3MEPA 3D8CA 2SLIA 4RHV3 5L7OB 2D5FA 1B09A 1CJDA 1UPIA 4K20A 1R1A2 5FLJA 3VBUC 2VW0A 5A3MA 4GB33 5FAXA 2IWGB 2BBVA 2ZGSA 3PNAA 1X36A 2XVGA 4EV0A 1LCLA 2ZKLA 4QQHA 1C1FA 1DQ2A 4RHV2 1Y3TA 2JDZA 3HIFA 3ZDSA 2CNAA 3G7DA 3ZO0B 1ZRCA 3PJYA 2HEYF 2ZGUA 4N7UA 1GNZA 2JECA 4GB32 4XETA 5SV5A 5CFDB 1RUJ3 4XMIA 1YCIA 1QJY1 4OI2A 2PN5A 4YVWC 1DQ1A 1AR71 3TYJA 3CJIA 1FOD1 5AFBA 3J8F1 4EN7B 2ZHMA 4CEWA 3B5LB 5JZGB 3ZSLA 4LO5B 4C0BA 1H1AA 4TSVA 4CDUA 1RUJ2 2JE9A 4WZFA 4MLOA 3FHIB 2NZ9A 1ZX5A 5HXVA 2D6NA 1G9AA 4WM7A 1DGRN 2VG9A 4YGCA 4E27A 3UK9A 4B4PA 1TEIA 3VKLA 2HKXA 4UW5A 4QPIA 2HWF3 3AMQA 2QZ2A 2MHFA 3IWZA 5T5LA 4B7KA 1FV2A 2TBVA 1ZNPA 3BPZA 3GBWA 1YFYA 4IEWA 3PLQA 2CGOA 4M0HA 4YSFA 1R093 4P5HA 4Q29A 1AYM1 2HWF2 4AE2A 3D5OA 1AR91 2YY1A 4XIOA 1VJ2A 2PHXA 5IT6A 1RUD3 1RUOA 1F5FA 1WW6A 1W6PA 1LHWA 1BZWA 2LUWA 3OTFA 1R092 3VZLA 1ZBA2 1JBCA 2OVUA 4K40A 2R30A 1MZ5A 1LGCA 3NAPA 4A7ZA 1WLWA 1WBFA 4AQSA 3ENRA 1RUD2 1I6XA 4GH4A 2X5IA 4OULA 4QGNA 2R043 1JN2P 4KWLA 4IEQA 1OOPC 1VB4A 3AMNA 4GMP0 2XLAA 1ALYA 1H8VA 3I7DA 3RNSA 1JOJA 4JRAA 2IXCA 4FP3A 5IUQA 4Y26A 1IPKA 5T5PA 4AVCA 4CP2A 5K9YA 2BQPA 1LTEA 3OGJA 2WFF1 4I02A