2IXHA

Rmlc p aeruginosa with dtdp-rhamnose
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
184
structure length
184
Chain Sequence
SMAMKATRLAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSARGVLRGLHYQIRQAQGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGFVVLSEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQDAPLLSEKDRQGKAFADADCFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DTDP-4-DEHYDRORHAMNOSE 3,5-EPIMERASE
publication title RmlC, a C3' and C5' carbohydrate epimerase, appears to operate via an intermediate with an unusual twist boat conformation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Isomerase
total genus 49
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2006-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ixhA00
4MGKE 2GC2A 1HW5A 3OTFA 2PTMA 2OYZA 1WLTA 1H1MA 3BCWA 1WA4A 4I02A 4HVOA 3KSCA 4JTNA 2D93A 1JUHA 3LZZA 3H1MA 4HZFA 1NE4A 4P9GA 4AVCA 2ZKLA 1OFNA 1J1LA 1CX4A 5KHHA 2BNOA 2IXIA 5I0TA 3HQXA 3LAGA 4A2UA 1YHFA 5I8SA 2EAAA 3N4MA 1U12A 1UCXA 1YFYA 2WFPA 3BALA 2XHKA 3ES1A 2IXHA 3KCCA 3CL1A 2XGXA 3NL1A 5LEJA 5I8YA 1SQ4A 4LUKA 4MUVA 5KHGA 5KHKA 1YUDA 1ZRFA 1CAXA 4R8HA 3S7IA 5KBFA 2Y0OA 4YYOA 2IXKA 3DL3A 3H1WA 1DZRA 1YFXA 3U11A 2Z69A 4IEWA 1YFUA 3H8UA 1OD5A 1I6XA 1YFWA 4YARA 2XL7A 4XFAA 3MDPA 3FJSA 1IPJA 5FLJA 4QGMA 1QWRA 2BEOA 2PHDA 3QOPA 3CJXA 5E16A 4XF0A 4META 4FAHA 3OCPA 4LUMA 4L11A 4LEJA 2GU9A 2VPVA 3RYKA 5C8WA 1DGRA 3E5QA 1LB2A 5JAXA 5I91A 4K8FA 4D7SA 4LA2A 3NW4A 4XF1A 3ZDSA 4XFFA 1XE8A 1RC6A 3MPBA 1X7NA 1I5ZA 3H3ZA 3E6CC 1O7FA 5J48A 5EFUA 5FPXA 4XF9A 4EWAA 4I01A 1TQ5A 4HVRA 1PMIA 4Q0PA 4IERA 4QGNA 4XEZA 3M70A 4IEQA 3E6DA 4JTOA 2D5FA 2WC2A 4BYYA 5J7MA 2GC3A 3ETQA 3CO2A 3ACLA 3DV8A 4KL1A 4HN0A 5I0SA 2GH2A 3O14A 3GYDA 3UKNA 5FDBA 1SFNA 3HIFA 4KU7A 3LWCA 2I45A 4XETA 3USSA 3I7DA 5JCTA 1ZX5A 4Q29A 4XFIA 5JSPA 1VJ2A 5FQ0B 3R6SA 5KHIA 1ZZ7A 1J59A 2B5HA 2N7GA 3WW4A 2UY9A 2XLAA 2Z2SB 3U0ZA 1QY4A 5BY5A 3DN7A 2ZCWA 1FXZA 5FCCA 5KHJA 4IEYA 4Q0VA 4JVAA 1OMIA 2B9UA 3UKTA 3OF1A 1NXMA 3BPZA 2PAKA 1GQGA 3RYPA 4RD7A 1ZRCA 2Q1ZB 4HSLA 2FMYA 1O5LA 1G6NA 1H1IA 4D7TA 1Y3TA 4ZU5A 2H6BA 4MX3A 2PFWA 3H7JA 3KGLA 3H9AA 4KWLA 3IBMA 1EY2A 2F4PA 4N9IA 1YLLA 4LTAA 4Z07A 1VP6A 3FX3A 4UXAA 3TNQA 1L3JA 1SEFA 5FLIA 5AVPA 1J3QA 3H50A 4KWKA 4E2GA 1YWKA 4UBGA 1O3QA 5HI0A 3VHRA 1V70A 2PYTA 1OI6A 1CAWB 1DGWA 2IC1A 4LA3A 3LOIA 4YNIA 5JSRA 3EBRA 3S0MA 2QDRA 4B29A 2XKPA 1QXRA 1O4TA 3D0SA 1O3RA 3MZHA 4IEPA 4JV4A 2IXLA 1ZZ8A 1DZTA 4NVPA 1RGSA 2VQAA 2XL9A 2CV6A 4MV2A 2Q30A 1LR5A 4BH9A 3E5UA 3FHIB 3L2HA 4IESA 3SHRA 4BHPA 1ZZ9A 3QACA 4KU8A 4WVZA 2PAMA 4EWEA 1NE6A 2D40A 4ZU4A 3IDCB 1J3PA 2CAUA 1CAUB 1QXJA 4MGIE 4ORFA 3TNPB 2IXJA 1VR3A 5FQ0A 1CAVB 5EZWA 4DINB 1Q3EA 5T3NA 4F8AA 4EV0A 4Z82A 3M3IA 4IEOA 2O8QA 4XFCA 4XFBA 2EA7A 4XF4A 4KWJA 4LULA 1UD1A 1GQHA 5D1IA 1RUOA 2GC1A 4HBNA 3U10A 5LRRA 2OZJA 3PLQA 1FI2A 4XFHA 1J58A 3BU7A 1X8MA 2FQPA 4FBFA 4HLTA 4IEVA 4Q0UA 3SCFA 1EP0A 2DCTA 2BNNA 3KMHA 2HJIA 3SMHA 1CGPA 3LA2A 4X6QB 1O5UA 4J1WA 2GC0A 2OPKA 3BB6A 1O3TA 3FFQA 2BYVE 3KGZA 4QM8A 2GAUA 1UW8A 1ZVFA 3PNAA 4I0AA 4H7LA 4R52A 3FZ3A 5CU1A 3CF6E 3EJKA 4IETA 5K8SA 2H6CA 4PIZA 2IXCA 1J3RA 2ET1A 2KXLA 4WZCA 3RNSA 3LA3A 1ZZ6A 5I93A 4MGZE 2UYBA 2UY8A 4E2QA 4IEUA 4MGYE 5BXXA 1RUNA 3RYRA 4WBBA 1LRHA 4I0BA 4IEXA 4YRDA 4EROA 2XLGA 4XF3A 2B8MA 2XLFA 3HT2A 2QJVA 2ATFA 1NYWA 2PA7A 4Q0SA 4PIXA 4X6RB 1RL3A 5LRSA 3WW2A 2K0GA 1PM7A 3WW1A 1EYBA 3E6BA 2HKXA 5FPZA 3FE5A 5LEKA 1CAUA 3RDIA 5JR7B 1ZRRA 2EVXA 1CAVA 4O9EA 1RTVA 3ELNA 1ZREA 4QGLA 2QNKA 4AVAA 4IEZA 2Q4SA 4MH0E 2CAVA 1Q5OA 2QVSB 2UYAA 5E1RA 3RZZA 5C6CA 3D0JA 3UKVA 5I0UA 2BNMA 5JSOA 5BUVA 3CLPA 3G7DA 3LA7A 4TLFA 4I09A 3FWEA 4QXKA 5F1RA 1ZNPA 3JZVA 3I59B 2OZ6A 4LLOA 1XE7A 1NZCA 3EQEA 3NJZA 4O9GA 4ONUA 2OA2A 1O3SA 5CADA 2PQQA 4AVBA 4AXOA 4GULA 2O1QA 3SCHA 3IIAA 3WW3A 1ZZBA 2XKOA 3H1YA 3NVCA 4OFGA 3NSTA 5I0RA 4QX5A 2CGPA 3SCGA 4HVQA 3E5XA 4L2NA 4QM9A 3PVBB 3EHKA 2E9QA 4MZUA 4XFGA 1IPKA 1ZRDA 3S7EA 1WGPA 1UIJA 2K9ZA 3H7YA 1UPIA 3I54A 4J1XA 4E2SA 3ES4A 3ROUA 2ET7A 4EWDA 4FAGA 2VECA 3E97A 3GBFA 2MHFA 5CVRA 1Q43A 2Q0AA 2BGCA 4I3PA 1X8EA 3D82A 4FT8A 4Q0QA 4CYDA 1CAXB 5FLHA 5J3UA 2GZWA 3IWZA 1UIKA 3EO6A 3NKTA 4BIFA 4QMAA 4YSFA 5BV6A 2V09A 1ZZCA 5BPXA 2MNGA 4OLLA 2ETEA 1X82A 4F7ZA 4PJYA 2QCSB 4HN1A 4ZU7A 2C0ZA 3OGJA 3RPQA 4AQ6A 2MPFA 1FT9A 1Y9QA 2H0VA 1CAWA 3SXWA 3C3VA 3CEWA 4N9HA 2D5HA 3MYXA 3HT1A 3H3UA 3DKWA 3ST7A 3OD0A 2P17A 4HSJA 5I8TA 3IDBB 4UBHA 4PIYA 3B02A 2PHLA 1EPZA 2PAEA 4HMZA 4AQ2A 4I2OA 1LKNA 3I59A 1XRUA
chains in the Genus database with same CATH superfamily
4H3WA 2GC2A 5C3OA 1AVBA 1GOHA 1HW5A 2PTMA 3J7LA 1UL9A 4QX2A 3DYOA 1DGLA 3VBFC 1G8WA 3D8CA 1JS9A 3VDAA 1WA4A 4I02A 2JG8A 5FZMA 2B46X 4N43A 3P3NA 3K46A 5FP4A 4COVA 4AI0A 5E8AA 5F3EA 4HZFA 1NE4A 4IXLA 4JRAA 4G3YC 4AVCA 4RHV1 4BLJA 1N1SA 4Z8BA 1US2A 3UGFA 4DQAA 1OFNA 3ZYFA 1CX4A 1JHNA 4QHZA 5LBCA 3LEGA 1UMIA 1YRZA 5JI9A 4B4QA 5HBAA 2LALA 2D43A 2R0FA 5I0TA 2D6MA 3JCIA 4KG0A 5I8SA 3UESA 3LIGA 1VB4A 2HWD2 3WQ7A 2NN8A 3GHNA 4D6SA 1VBB3 4CCDA 2EIDA 4NO4A 2EICA 1U12A 1O8SA 1W99A 2I2SA 2RMU1 3KCXA 1YFYA 4E4HA 2XHKA 1JTZX 4COWA 2ZJCA 3NL1A 1LJ7A 1MS8A 1PK6C 2MEV3 1RUE1 3RZHA 2NMOA 3FLTA 4DUVA 2XDVA 1QJZA 3ILFA 1UO9A 1UXXX 2IZWA 4FPCA 2R072 2ZX2A 1XOYA 5C4WB 5JLVA 1CAXA 4HONA 3F2ZA 3S7IA 1YQCA 4YVSA 1AR83 3AFGA 3H1WA 4QB2A 2XBO1 4CA9A 2Z69A 3VBHA 1RUF2 5JMOA 4H55A 3UK9A 3ZPYA 4QDQA 1PGL2 1UAIA 1YFWA 2CWSA 2UURA 4BU2A 3H8OA 4OMCA 3VBFA 4RR3A 1PNFA 1QWRA 1RUG3 2PHDA 1UPSA 3OUHA 3ZMNA 4OYUA 1FATA 2OIIA 4WV8A 5E16A 1VRH3 5LZ6A 5GM0A 1V6MA 2DCKA 2RS11 4YG0A 2FD8A 3BU0A 2YB7A 2IVJA 3ZYBA 2GU9A 3THTA 3NJXA 4XOGA 2WNVB 1GANA 1PVC2 1QJY2 5CKMA 1L7LA 5IATA 5FY4A 4XDQA 4CP9A 3EMRA 3AC0A 1DQ1A 5JAXA 4O61A 1Q8SA 1Q8QA 1FMD2 1GP5A 3JBG3 4D7SA 3B69A 3N36A 3KS7A 3M8LA 3CJIB 3C7GA 4P9XA 3HBZA 1COV2 2W3JA 1VIWB 2WQ4A 3L9JT 2DU0A 1PO23 4NUBA 3Q8CA 4BISA 1UZVA 3C7OA 1HXS2 4NN0A 3T3YA 4HFSA 4XABA 3AP6A 4NIHA 4JGZC 2JE9A 2EXKA 4SBVA 3KLSA 2VR4A 5DG1A 1ZBE2 2QKDA 1YI9A 5HXVA 4MO3M 4IERA 1RUH3 1PK6A 4QGNA 4XW3A 4Q4V2 3M4FA 4MG2A 2W91A 3JXSA 1APNA 4FPGA 4Y3OA 1KDKA 2YC2A 4Y1VA 4YFWA 5FJKA 4XMIA 5M0TA 3RS6A 4Q4X1 4IW3A 3BOWA 3WF1A 4CU6A 3HEIA 4R9BA 2YV8A 4HN0A 2HWE1 2GH2A 1XYOA 3GYDA 4WVVA 5FDBA 4KU7A 2GMEA 3NV3A 2YBKA 4AFMA 2XJPA 4FFFA 5A7QA 2I45A 1NOVA 2FDIA 1ZX5A 3WVJA 2RV9A 3ZSJA 1VRBA 4UFHA 2AACA 4AWDA 4BB3A 3MHZA 2FCVA 3CU7A 3KD4A 4PF1A 3SH4A 1G7YA 1ZZ7A 4QPGB 4OI1A 1J59A 5A3NA 4LT5A 2VZ3A 3R4DB 5LA2A 1BK1A 1OVPA 5H9QA 1N1TA 5GZGA 3H8XA 2JE8A 2ZOEB 5FYMA 3MIDA 2AC1A 2WO3A 2WFF1 4GMP1 3M3EA 1TME3 3U37A 1C1FA 3NV2A 2B7YA 4R9AA 5FCCA 5KHJA 4XE9A 2WNOA 4E9KA 1JH5A 3CIHA 1HB1A 1XB9A 3O1MA 1BZWA 4Y20B 3PJQA 3OF1A 3UKTA 2W1QA 2KR2A 3VKOA 5A7SA 1N3QA 3N7MA 1MZ6A 2W1UA 3G6JB 5CAZA 1ND2B 3SH3A 3MFCA 2Q1ZB 3DXTA 1ZRCA 3ZYJB 4QQHA 2FDJA 1O5LA 3V56A 2ZGKA 4AE2A 3AMQA 4LE3A 3ZMOA 2C6SA 5F5AA 2G19A 4JGZA 1W3XA 4CP1A 2D6LX 2R1DA 3BI3A 3ZSMA 4V2WA 4LKFA 2PFWA 2ENRA 5GLTA 2RJKA 1RUI3 3SISA 3I3QA 4BIOA 2F4PA 5JVVA 5IFPA 5IVCA 1K42A 2R49A 1CX1A 4QKNA 1Q56A 3FX3A 3USUB 3LF7A 3TNQA 4DEVA 1VBB1 1SEFA 2R062 1M4WA 5AVPA 5DUXA 2E63A 2W95A 1TZOA 3JD71 5DMYA 3WP4A 1FV3A 4L92A 5LASA 5HI0A 3GZEA 3Q8AA 4IDZA 2DFCA 5IVJA 1CQ9A 1DGWA 4YNIA 1BQPA 3VL8A 2VTXA 2MEV1 3POWA 2GSYA 4XCAA 4YVWC 1D0HA 2YC0A 2XKPA 1FMD3 4CPBA 4B3NA 2BRTA 4NWVA 4COUA 2DF7A 1TNFA 4JV4A 1T2XA 2WZEA 3F95A 3AP9A 4BXFA 3HQRA 3N9OA 3VD5A 4IL7A 1AR81 4PHZA 5FO7B 1HXS3 4C1WA 3T2TA 4K1YA 2ORXA 1S0JA 5C71A 5AFBA 3E5UA 1VBA3 3L2HA 1ZBE3 3SHRA 4Q8LA 4EN8B 2ZAAA 3MLKA 4KNCA 3VBSC 4Q4V3 1AHSA 4YM0A 1RUG1 1UOFA 2GMMA 2JG8B 5T52A 1AX2A 1GR3A 3NNMA 1VRH1 2D40A 1S55A 2VU9A 2XVKA 3OYWA 4ZU4A 4NROA 1PZ9A 3VUOA 3AJZA 4MGIE 1PZ8A 2WLPA 2IXJA 2ZX1A 3TNPB 3ZO0B 5FQ0A 2PHUA 5EZWA 3WOGA 4DINB 3TB0A 1QJX2 3UV9A 1QH6A 2VNRA 1SFPA 3OPWA 2EIGA 1TMF2 1W8WA 3RZMA 3JBG1 2EA7A 4M0HA 4KWJA 1V0AA 4LULA 2FBEA 2DTWA 2NM1A 2D6KA 2X10A 4FFIA 4JKLA 4XJAA 5T55A 5JXGA 2CTVA 3GM8A 3WNMA 5ISLA 1LNSA 1PO21 2R30A 3AZWA 4XUQA 2BWCA 5LRRA 1AL0G 1C8NA 1C5HA 1RJ8A 4LJHA 2YROA 4XFHA 1J58A 2VUJA 3DYMA 2FQPA 4XUPA 3WDXA 4FBFA 3CKHA 3HPNA 2W92A 3SCFA 1W6NB 2DCTA 1RUH1 1QDCA 2WWJA 4CCEA 4UW6A 1XU2A 1JU4A 4YVWA 4AEDB 4FTSA 1CGPA 3C7EA 3LA2A 3GGLA 4COZA 2JG9B 2OPKA 5CZKA 5CG8A 3W5MA 1FNZA 2CGNA 4IE7A 3WP5A 1UX7A 2BYVE 1SCRA 4UAPA 4LBLA 3WY6A 3AL6A 2WWUA 1UNBA 1UW8A 4AL9A 1FV2A 1G9DA 2WZPP 4XACA 4R52A 2HH9A 5CU1A 4YG3A 3EJKA 4RR3B 1W6QA 1JZ4A 4QWNA 3VBSA 2J1AA 4PIZA 4P5YA 2W68A 1MACA 2VQ0A 1J3RA 3B9IA 4JHTA 2ET1A 2JKXA 5GLWA 1ONAA 3IN9A 1ENQA 3NAPB 3LA3A 1R1ZA 4CCJA 1PX3A 3QLQA 1TME1 2DFBA 2R063 5A32B 4PLMA 1YO8A 2UY8A 1Q8OA 3AX4A 2LS6A 5A3UA 4IEUA 3I3MA 4MGYE 1XQNA 1QNWA 1GBGA 3LEKA 4ZS2A 3PIJA 4INDA 2YFZA 1YI7A 3JUUA 1AL22 4K21A 2YC4A 4AHXA 4FOQA 1ULGA 5F39A 1LHOA 4NIGA 2XLGA 1OPMA 5HV4A 4XF3A 2VNVA 4MXWA 3I3DA 4DS0A 3MUY1 3RQ0A 1JXNA 2XLFA 4S2HA 2B42B 4W4ZA 2XJSA 1GZCA 1NYWA 3CMGA 1AXKA 2WA4A 4FI9A 1IG0A 4XDPA 2WWSA 3NMBA 3ACIA 5FWEA 1LHVA 1RUI1 2HKXA 5FPZA 1RB8G 2GP5A 3FE5A 5LEKA 4XPVA 1PGL1 3M7AA 4RN5A 4PDWB 4WM8B 5JI7A 1CAVA 3RMYA 4Q2FA 4QXCA 2VCCA 4QGLA 2QNKA 1LGBA 1H4GA 4AVAA 5IK4A 2FCTA 1O4YA 2J42A 2BERA 4Q4W2 2ZAHA 1NA1B 1W2TA 2DTYA 4OUMA 4QAWA 3ZXFA 4BDVB 1IKPA 4NHKA 1QJY1 2JDPA 2UYAA 3WDTA 3K75B 1VPHA 4XURA 2VNOA 3UKVA 2JDMA 2P34A 1TMF3 2ZGNA 1FMD1 1CJDA 2BNMA 5GZEA 1W8NA 2C9AA 1JBCA 5A7PA 1LOAA 3K2OA 2EF6A 1P8JA 4L97A 3ZFEC 4AW7A 5C70A 4Y1XA 5IK8A 1COV1 1GNYA 1GUIA 1U0AA 3PUQA 2AREA 1X50A 1HXS1 2ID4A 2VC9A 2YPJA 2ZGMA 3A4UA 5CKQA 1W05A 5FYYA 3NJZA 3LQCA 4FQZA 1IS5A 4LK7A 1VB2A 1VBA1 3ZKYA 1N1VA 4EYUA 1ZBE1 4H7MA 3ZLIA 4NHLA 3VKNA 3GJBA 1NLRA 4M4RA 5ABJB 4AXOA 3SCHA 4GXLA 4Q4V1 3IIAA 4YW3A 3WW3A 4WVMB 3POJA 2XKOA 3H1YA 3K4ZA 3NKGA 4O65A 5FK8A 5J09A 2BBVA 2IWGB 2J1EA 5G05L 4AI3A 2RS32 4EN7B 2BTVC 4XBNA 2W39A 1JZ3A 1YJKA 3CHXA 4JGZB 4A42A 3E5XA 2G9FA 1H6XA 1YQ2A 5LBEA 4BQWA 1MR5A 4YZ2A 1LEDA 4F83A 4MXVA 4CEWB 1REFA 4ET7A 1IPKA 3LGRA 1ZRDA 3T2QA 2C5DA 4IV3B 4Y22A 3GZTB 3O5SA 5LCWL 1NCRC 1OOPB 2VMCA 3Q9OA 3ES4A 4GB32 5EJ3A 5FY7A 1DQ5A 4CP2A 4EWDA 5J1XA 5FZHA 2J1TA 1GKBA 3PMSA 3AM2A 4BCUA 1AYN2 3AYAA 1Q43A 5JIAA 2RDNA 5IVFA 1UU5A 2CGOA 2JDUA 2P3KA 3RWNA 1U5ZA 4OCTA 1JZ5A 1VBC2 5JXIA 1UY0A 4RL7A 4HETA 5FLHA 3BUCA 3LEIA 3IWZA 2BQPA 2P3JA 3EO6A 3PHMA 1AL23 1S1AA 5HV0A 1LOBA 3ZFEA 3A21A 4NPLA 1D2QA 1I5PA 2R16A 4ZZ5A 1MVQA 2XXZA 1HJFA 1ZZCA 5FP7A 1JOBA 3RVHA 3U1XA 2Y6GA 3T2OA 1H9PA 1QF3A 4P00B 2DV9A 2QCSB 2VZPA 4I3GA 3CDZB 4Y24A 1POV0 4FPFA 1UQXA 2C0ZA 2LRPA 3OGJA 4AQ6A 4E8CA 5FPUA 3I3BA 1WA6X 3OGVA 2RVAA 4FP3A 4HT1T 5FZBA 4CCLA 1S2EA 3ZYHA 4AGVA 1S0GA 1QOOA 2PQSA 2R32A 4DY3A 1NT0A 3OY8B 3I2DA 1IPSA 1A6CA 2E33A 3ZYPA 3WF4A 2YG0A 2D5HA 5L9VA 2CNAA 1LGNA 2K46A 2Q1FA 3MYXA 1NKGA 2OQ6A 1BJQA 1REDA 2R061 3POBA 2LTNA 4YGDA 2Y6JA 5LY1A 4OHVA 4UFLA 4Q4W3 1RINA 5LBFA 3O1OA 4XIKA 3B02A 3WLUA 4TXWA 4CDUC 1EPZA 2PAEA 4CDWC 3MLJA 4Z1VA 3FBYA 2AH2A 4Z07A 3UYJA 3PL0A 4O7XA 3VZMA 1D2SA 4UFIA 5FP9A 2OYZA 5A3MA 1NCRA 1W2AX 4DIQA 3ZFFC 3WG3A 5A1LA 1AJOA 3A7QA 1Y43B 3P3PA 4HVOA 3B9CA 3KSCA 4JTNA 3V65A 2ZX0A 1GLHA 4Z2WA 4P08A 3B3QE 3LD8A 5IWFA 3IDEA 1CJPA 3RZLA 4YM1A 2ZKLA 3RJRA 5FOJB 4K8RB 5IUQA 2AGSA 1D4M2 1BYHA 5KHHA 2BNOA 2IXIA 2JIJA 3UJOA 3WNLA 4LBKA 3HQXA 3LAGA 2ZXQA 5SV5A 5FYVA 1XNTA 1S4CA 4BM8A 2ADDA 1HKDA 5FYSA 2EAAA 1O4ZA 2JDAA 4PI0A 4OI0A 2ZHLA 5CFDB 4HOOA 4YGEA 2ZABA 5KXEA 4QX1A 3LSEA 4L8QA 4AYUA 1Q8PA 5IT6A 1WMEA 2P2KA 2TNFA 5FBZA 2NLRA 3ILNA 3KCCA 3T0BA 3THPA 3CL1A 1TMF1 5C33A 2NPIA 5LEJA 1UKGA 1W90A 3IPVB 5I8YA 5FOBB 1GWLA 1W06A 2FDGA 1SQ4A 2XWBB 4MUVA 5A7WA 2ARCA 4GB33 1EUUA 4YZ1A 1YUDA 1ZRFA 1E5SA 4R8HA 3MPPG 2Y0OA 1AR72 1NCQC 4YYOA 1AYN3 2IXKA 3I2OA 1LGCA 2W08A 2JDNA 4CDWA 4CDUA 3H8UA 3I2FA 3ITQA 5FZ4A 1I6XA 3ILRA 1JOJA 3R0RA 4QX7A 4FP2A 1BKZA 4XFAA 1ULPA 3MDPA 5GJ6A 2O0OA 3CZUA 4MXWB 1W04A 1F9KA 1SDWA 4QGMA 3ZFFA 4AGRA 2OUHA 1VAMA 3BPSA 3CJXA 3QOPA 2VG9A 3TAYA 5FY0A 3GZUC 3FN9A 2DBIA 2TUNA 3GCXA 3M3OA 4FAHA 3W5NA 4Q4Y2 5FMBA 4UFJA 1W6PA 5FJHA 2DUQA 3RYKA 3D3AA 1CN1A 2A73B 3ZKUA 2E31A 4LO4B 5A3PA 2FCUA 4LBMA 5DG2A 1ALYA 5JOWA 5I91A 5FZ9A 3AYEA 3O7OA 4K8FA 2VMGA 4LA2A 4W6XA 1MEC2 3T0AA 3D5OA 1PNGA 1JU3A 3RI8A 3NW4A 3GNEA 4G4FA 1JOPA 3WX5A 5F7UA 4MYEA 4XFFA 5FMDA 4C0HA 3ABZA 4C90A 1I5ZA 2QQOA 3WT3A 4AEMA 3E6CC 4HKWA 5J48A 3OOXA 3POSA 1VMFA 1W0PA 5F3IA 5EFUA 1A8DA 2YHJA 5T50A 2Q8CA 4XF9A 3T08A 5FPBA 2D7FA 1TQ5A 3RZKA 4KGGA 4AHYA 4XEZA 1JZ7A 1AL21 4IEQA 4ASLA 2ZA9A 4OI4A 1HB3A 5SV8A 1OLRA 2D5FA 2P5BA 3KV5A 4XMAA 5IJRA 1OSGA 2VTFA 2YGMA 2GC3A 2VBDA 3AZXA 1K5JA 3V0AA 2VZSA 2XUMA 3AXEA 5B4XA 3BIWE 4RQPB 1NCQA 1MQTB 1KDMA 3HIFA 2I07B 1GV9A 3LWCA 4Y1YA 1LHNA 1OH3A 4XETA 4D94A 3WNOA 4LBQA 2JICA 4D8MA 2GNTA 4HXCA 1JMUB 5JCTA 4LHSA 5FY8A 4XFIA 1UYXA 3KZ4C 1D4M3 3OSDA 2GMPA 4J25A 4Y5Z0 4DOUA 5KHIA 2WA3A 5A1AA 5J36A 2ZPXA 1VMJA 1URXA 2XB6C 2A6VA 5FYUA 5KC5A 1C8M2 2HWF3 3UL2A 2N7GA 2JDHA 4XCBA 3WW4A 4TZDA 1A3KA 4ZY9A 1XPWA 1B35C 4Q4W1 5FZEA 4CE8A 2CU5A 1YCIA 1OQ1A 1SCSA 4A45A 5L9BA 4JVAA 4XJZA 3SQOA 2ZZQA 3VHNA 4YW2A 4Z2AA 4B4PA 1GQPA 3BPZA 4CEYB 5FO9B 1YEWA 2V5DA 3RYPA 3VBRB 3VBUC 1H1IA 4AF9A 3HQUA 5F5CA 3T4VA 1W3VA 2JX9A 2WO2A 4D69A 1IS4A 1HQNA 3J7HA 5FZ8A 3RZJA 4TTGA 4XTPA 1Y3TA 1PMJX 3KVBA 4P9IA 2H6BA 3MI8A 2JB8A 4WM7C 2HYKA 4FOWA 3ZPOA 5JOXA 2ZZJA 4D3WA 2EXIA 4BK4A 3IBMA 5JZGC 1EY2A 1YLLA 1Y4WA 5D8AC 2QQVA 2RS31 2KD7A 3LDBA 3GZAA 1LOFC 2RE9A 1XNAA 4IGPA 1VP6A 2XMLA 3JD73 4Y33A 4IE0A 4XDOA 5FLIA 1W8FA 1FNYA 4QU2A 3WCSA 1K5MB 4KWKA 4C1XA 1YWKA 4Q4Y3 5A6YA 1HB2A 2PHXA 1O3QA 1V70A 5CFCC 4JQTA 5C9AC 5JXJA 1EUTA 2AYHA 2GH8A 2PHWA 2ERFA 2XH6A 4NPMA 2HLEA 1C3HA 4KG8A 1ACCA 3EBRA 2QDRA 4ARYA 3VKMA 4FOVA 1ULDA 3AVSA 4P9JA 2VY0A 4GB31 1MEC3 1O3RA 5A33B 2G9GA 2C24A 1RITA 3ETPA 3OEBA 1POV3 3WG1A 2KM2A 4OULA 3MW4A 1B35A 3MV01 3P1IA 4UYBA 1AYN1 4LMFA 1NY72 2VQAA 1C5IA 1E5IA 3HN3A 1YIPA 3ATGA 3K4AA 4CDQB 1VBC1 1X9PA 1F35A 1SLLA 5KXCA 4NHXA 4N7UA 2EXHA 4BHPA 2VTXJ 4EE2A 2AUYA 1S0IA 2GDFA 3A0NA 1BLZA 2WN3A 4CSWA 3QACA 4QPIC 2VD7A 4KU8A 2BW8A 1RUC2 4WVZA 3VBUA 2D98A 3OUJA 3BTYA 3QD6A 1F31A 2WABA 5FYIA 4EWEA 2WN2A 1J1TA 3HNYM 1KJRA 2QE3A 4TWTA 2ZGPA 2Q1MA 1QJU2 2XJRA 4A6SA 1VR3A 4R9CA 3OJBA 4WM7A 4JGYC 4F8AA 2Z42A 2XJQA 3ZR5A 4EV0A 3LE0A 2WNUC 2Y34A 1X9TA 2O8QA 3O0XA 4LO6B 5C3SA 5GZCA 4XFBA 3LCPA 4UW5A 1PIV2 1W6OA 5FKCA 5JZGA 2GP3A 3INAA 4XF4A 5D8AA 3MFAA 1GQHA 5LWBA 4I0WB 3A23A 3TN92 1LOFA 1REEA 4HBNA 1WCDJ 3U10A 1NQJA 4XUOA 5DABA 5FP3A 3O1UA 2E7TA 3BN6A 3PLQA 5JDBA 1FI2A 1O8PA 2LROA 3BU7A 2VXJA 5DDJ2 5CFCA 3D6EA 5C9AA 1YQ6A 4YG6A 2ZX3A 3AL5A 4A4AA 2BV4A 4GKXA 4IV1C 5JR2A 1OLQA 1AXZA 3LEMA 3WHTA 3HMYA 2HJIA 1UU6A 2EAKA 2RDRA 4N8MA 3C2UA 3BODA 1RMU2 1XE0A 1GU3A 5BNNB 3RMXA 5K0UC 4UF0B 1G9CA 3MIGA 3BB6A 1UZZA 4JCKA 1GZWA 4BXSV 3VDDC 1O3TA 3FFQA 2WKKA 4QT6A 4OMDA 3S6PA 3TRSB 2WSVA 2V73A 2GAUA 5CBLA 1XU1A 2VQTA 2RJLA 2RS52 4DRRA 1ZVFA 1HB4A 4QKFA 5BNOB 5IVVA 4H7LA 2ADEA 5FZLA 2O14A 3FZ3A 4Z92B 1D4M1 4IETA 1DGWX 2DU1A 4ITCA 1RHI2 1LHWA 1UYPA 1V6IA 2BWAA 4QPIA 5FZOB 2BZDA 2H6CA 4CZSA 5K8SA 4YW5A 2HWD3 3LFIA 5L36A 2JDZA 2HWF1 3OUIA 2W0XA 3RNSA 5LA9A 2W5FA 3B00A 1H8TB 3SITA 3P6BA 3S5QA 5I93A 3C7FA 2A6WA 2VMFA 1ND3B 3KB5A 4LIVA 4MGZE 3VD4A 4NRPA 3NRUA 2V4AA 2VNGA 2UWAA 4JGYA 3ZXKA 4E2QA 2DVFA 2WNUA 5JPMB 1MS1A 3RYRA 4EZHA 4JZRA 5A6QA 1FPN2 1WMFA 1QMJA 3J9SA 3MIHA 3N9PA 1LAJA 2R073 3FLPA 4FO9A 3POFA 4MADA 1D0GA 4FSJA 3OPZA 2A6ZA 4EROA 4Q1PA 5ANQA 4XUTA 2B8MA 3BTXA 1YYNA 3T0DA 4MGQA 1SBDA 2Q8EA 4JHZA 4OHXA 3CZJA 1RUF3 5FK7A 3VDCA 4BQXA 2PA7A 4Q0SA 4BK5A 2V4VA 3KQRA 4X6RB 1RL3A 5FZ3A 1IQAA 3UT0A 2QTWB 5LRSA 2K0GA 4IV1A 4LHLA 1SZBA 1UOJA 4LOSA 1CAUA 2X5IC 1CD3G 3FMGA 3PUIA 2WL1A 3DCQA 4RS5B 1PGW2 1S0EA 5K0UA 3QH7A 3V0AB 2W52A 1MVEA 1NG0A 3VDDA 5E6HA 2C9KA 4AG4A 1Q8VA 1ZREA 3T2PA 1PVC3 4OQ8A 1QJY3 4Q4Y1 3VD7A 3BTAA 2CAVA 1QJU3 5FZAA 1IHMA 2JB4A 2VL4A 2Y33A 3AZZA 2QVSB 4WVWA 5FY5A 5L9RA 3SH5A 5A6ZA 2YBSA 1BCXA 1HRV2 2O8OA 2OT7A 1COV3 2A70A 4W65A 1MEC1 1PIV3 4CRQA 4XTMA 1S0BA 3FWEA 1POV1 2JD4A 3LDKA 4QXKA 2JE7A 5F1RA 4BA6A 5B4NA 2RJ2A 2OZ6A 3I59B 1XE7A 1NLSA 2CHHA 4QQOA 5C8CC 1G86A 1PO12 3PVNA 5EIYB 3OGRA 3EQEA 4O9GA 2PMWB 2WQZC 4ONUA 1Z7S2 1UY3A 4IE6A 5EYXA 5CADA 3H8RA 1O3SA 2PQQA 1K3IA 5I0DA 5CNAA 1YQ8A 2WJSA 2Y64A 3O1PA 4N43B 1XNCA 2K2SA 5E88A 4UFMA 1VMHA 1AJKA 4E27A 4QB1A 2F4LA 5FPAA 1DBNA 2BU9A 3T1MA 1JZ6A 2EIEA 1X36A 3NSTA 1UKRA 1RMU3 2ZGLA 1LU1A 4XBLA 4CDXC 3SCGA 2BGPA 4GH4C 5FZ7A 2YY1A 3FBMA 4QM9A 4DXRA 1SPPA 2EXJA 4AR2A 1OHFA 4XVHA 4DY5A 2P37A 1GFF2 2RS53 4XFGA 3S7EA 1WGPA 3WV6A 4A7ZA 2X5IA 1CZVA 2XJVA 1RXGA 3I54A 2I74A 4GZ9A 5J98B 1A34A 4E2SA 4DXTA 3ROUA 5FXWA 4PBPA 1OQDA 5FUPA 1SG3A 3PTRB 2P3IA 2VECA 1DF0A 1W8UA 3POEA 3AB0A 1HN1A 3GBFA 2Q0AA 3LIHA 4FQ4A 2BGCA 1CZSA 1QEXA 4ISQA 4TYSA 5T5JA 2W47A 4M3CE 4EJRA 1X8EA 2EIBA 4Q0QA 5G04L 1F8VA 1XYNA 1ODMA 1CAXB 2DCJA 2ES3A 3AYCA 3FUQA 4DB5A 1OFSA 4OZOA 5J3UA 5FWJA 1W9WA 4YVSB 1RJ7A 3OPTA 3AMHA 3NKTA 2DVDA 1BVVA 1QGLA 5H9RA 4QMAA 4YSFA 3VBHB 4RFRB 2VM9A 4XQ4A 4YW6A 5FPLA 2A3YA 1H0BA 3UETA 2RR12 2V09A 4YW7A 4LLFA 4JDOA 3BVCA 4LXLA 3P5BA 1ENRA 2ETEA 2G1MA 5H9SA 1AR92 2RM22 4NRQA 4TSVA 4Y1UA 5DZFA 3VBFB 2FMDA 1DZQA 4ZU7A 1DU3D 3SKJE 5L19A 3SEPA 3GALA 3EYPA 4A6OA 4XQDA 4ATEA 3U78A 1OUSA 2DURA 3ZFGB 4BOWA 4KI5M 1YJLA 4MHUA 3ZM8A 1CAWA 3WR0A 4B1MA 3KV4A 1HV1A 2HWD1 2J1UA 3PJYA 2JXAA 2WRAA 5F3CA 3AP7A 5APAA 2ZMLA 4CP9B 4CDXA 4D6QA 4IQPA 3J7NA 4GH4A 2HEWF 4WM7B 1KEXA 3OD0A 5FZGA 2PHFA 4B1LA 5I8TA 3IDBB 1LOGA 3PVEA 2E6VA 1OA4A 2PN5A 3IM0A 2VZQA 3DGTA 2PHLA 5T5OA 2QQNA 5JZGB 4I2OA 1W39A 3SLIA 5D8AB 1XRUA 2R071 1CPNA 4MGKE 4QDRA 1HRV3 2VZUA 5FUNA 4AVVA 1RVF2 1ZRIA 1E5HA 4YZ3A 2J7MA 3RG0A 1BBT2 2W46A 1WCKA 2HWC2 4LNVA 4BE3A 4UFKA 1PK6B 1RUF1 5C9AB 2VE1A 2VCBA 1MZEA 3QBQA 1JUHA 3LZZA 1PO13 4YM3A 3KHCA 2DUOA 4FPLA 4CCOA 4JAAA 4P9GA 3VKFC 1PMHX 5FZ1A 1HQWA 1LECA 4W50A 2ZBJA 1ST8A 1NLQA 1NQDA 3AP5A 4PT6A 1W9FA 1RXFA 4CVUA 4LHKA 3WG4A 5IK7A 1UYZA 3POGA 1PVC1 3TWIA 3K77A 2BFUL 1OT5A 4XXPA 5CG9A 1QJX3 5DUWA 4BQYA 4C91A 1QJU1 5FZIA 2WNEA 3ENRA 5C8CA 4ARXA 2YU1A 2WFPA 2RDSA 3MICA 4NHMA 3ZSKA 5J96B 3BALA 2IXHA 2RDQA 2YZ4A 3MLLA 3NO8A 1AYM2 2JDKA 1TNRA 2XGXA 3N3HA 4QPIB 4PQ9A 2VVFA 1PIV1 4M3CA 2JJ6A 5FZ6A 5KC6A 2VUDA 1JYWA 4LUKA 4LR4A 3IMMA 5KHGA 1O91A 4S2GA 1VBD2 2XVLA 1ZYBA 1H2KA 1WW5A 5F32A 5KBFA 4KBBA 4NMIA 1RUJ2 2ARXA 2WNUB 5FV3A 3THDA 3ZR6A 5FYBA 1DZRA 3T4HB 1YFXA 3U11A 1QKQA 4IEWA 5FUIA 1W28A 4YARA 4YGBA 2XL7A 1EAH2 5EYYA 3WDWA 3SKVA 3FJSA 3GXUA 4XILA 1IOAA 1RMU1 3O12A 1H2LA 3ZXLA 3MEPA 2QQWA 2HWB2 1OH4A 4XF0A 3NV4A 2RR13 4E4DX 3OCPA 4KH9A 4BWOA 4LUMA 1RUD2 4L11A 4LEJA 1AR93 1US3A 2HBTA 2ZS6B 2RS51 4UOJA 5EXOA 3URFA 1AUYA 1DGRA 2PELA 3AP4A 3E5QA 3WQBA 1LTEA 1YIFA 3N9NA 1LB2A 1WMDA 4XHXA 3W58A 4DRVA 3WZ1A 1F4HA 3VBOC 2LM3A 3R05A 3ZDSA 2Y6HA 3AZVA 5LA1A 1G9FA 1XE8A 3VKLA 1KGYA 1ULFA 4QQPA 1X7NA 1H2NA 1QJFA 3NV1A 3H3ZA 4GWMA 4Y4RA 2GNMA 2CYFA 4CXYA 3JQXA 2G9ZA 3ZX7A 2DWRA 1S0DA 1W8HA 1JODA 1W0NA 1ODNA 1LOEA 4I01A 4R4XA 4W8JA 4EWAA 2VQUA 1W8TA 4AEJA 2BPA2 1PMIA 3GDBA 3M70A 1W2UA 5IFTA 3E6DA 4JTOA 3RRDA 5FZ0A 4AEKA 2EALA 1OBNA 4NIIA 4HK8A 2QZ3A 4BYYA 5HCHA 4LPLA 1VE0A 4QX3A 2WNVC 3DEMA 4S2FA 3CO2A 2OXBA 1BBT3 4ZONA 3DV8A 2HWC3 2GNDA 2VOVA 4CCKA 2RG4A 4UWDA 2A6YA 2BP6A 3UKNA 2YMZA 1SFNA 2VVEA 1ZM1A 2BJSA 2GN7A 2ZGOA 3OYWB 3T1LA 3USSA 2RS12 4P02B 4KBZA 3TEZA 2ZMNA 1O59A 3CJIC 3MW3A 1WW7A 4M00A 1OVSA 4OUSA 1H1AA 4Q29A 5JSPA 1VJ2A 3MIBA 4OZXA 3WQ1A 5FQ0B 2XQXA 3KM5A 3R6SA 1STMA 2NYYA 1PGW1 4N90A 2XONA 1IZ3A 4URTA 2UU8A 1N47A 4QQ2A 3AJYA 5FAXA 3X29B 2UY9A 3MV11 1GICA 1QIQA 1QY4A 3U0ZA 2NP0A 1TE1B 3PUSA 2ZCWA 1MS0A 1FXZA 1W6MA 2ZEXA 4IEYA 2X5IB 2XJTA 3POYA 4AHZA 2A7AA 3ZN6A 2B9UA 3PTYA 1HRV1 1BHGA 3GHMA 2A3XA 5AC92 1AYM3 1N3PA 5GLZA 1NXMA 3VBOA 4RSUA 4DXZA 1H30A 2PAKA 4RD7A 4HSLA 2Z79A 2FMYA 2ORZA 1SBEA 3H0OA 4YVWB 1VBD3 4AI2A 3NWKA 1OURA 1PHMA 1PO11 5F8PA 2CL2A 1ULEA 1T6BX 3ASIA 3KCYA 4K6BA 4D7TA 1RUJ3 1G9BA 4ZU5A 4MX3A 4QPGC 4QX8A 1F5JA 4X8NA 4EN9B 3IB3A 3KGLA 5FYCA 5KXBA 5CEHA 1VBE2 4QDSA 1YC61 2RS33 4KWLA 4JRLA 4LORA 3VZNA 4M4PA 2AR6A 3POIA 1EAH3 4LO8A 4LTAA 5KWRA 2WNVA 4P9YA 2QDNA 3I3EA 3N9QA 4UXAA 1IS6A 3RGBA 1L3JA 1QJX1 1W6QB 2HWB3 1J3QA 3PU8A 3VBSB 3PVOA 4S2DA 2R042 4CUCA 3VHRA 1RUD3 2ZMKA 4LOTA 2PYTA 2VO5A 3A0KA 3CJIA 1CAWB 1LESA 2UWBA 3PURA 4K9SA 4XXAA 2IC1A 2Z5WA 3RWKX 3T30A 5JSRA 3AVRA 5L7OC 1JYXA 1UWWA 1Y9MA 3S0MA 1JW6A 3ON7A 4B29A 3I2GA 5T54A 2ZACA 3D0SA 1JYCA 3MZHA 4CTEA 3PUHA 2IXLA 4ES8A 1DZTA 1VBC3 3CBNA 1RGSA 3I2HA 3PIGA 4LQRA 4UW4A 2E51A 2PLV2 5ERLA 2XL9A 2CV6A 5DZGA 2Q30A 5DUVA 4BH9A 1DLLA 2YXSA 1ENSA 4ATFA 5C5TA 4K20A 1FX5A 1ZZ9A 4QHBA 1JYVA 3CNAA 4Q5OA 3HWJA 3O0VA 4URAA 1EPWA 2CDPA 1JYIA 2PAMA 4Q1RA 2Q5TA 5EP9A 2QQMA 1NE6A 3OGSA 5B2GB 3IDCB 1BMV2 2RR11 4BQ4A 2CAUA 1W8OA 5LBBA 4CU9A 2CSGA 4MGTA 1WD4A 2XHNA 4ORFA 1SMVA 3HAGA 5LA0A 1AR91 5EWSA 3ZSLA 1UN1A 4LHNA 1CAVB 2A6XA 3B01A 1IKQA 5JUVA 4QPGA 2IFRA 4NHYA 1VBB2 5T3NA 1TEIA 1JYTA 4Z82A 3M3IA 2Q8DA 4FFHA 2R7EB 4XFCA 3IDAA 3FHQA 1UMHA 3OD4A 4I30A 5DAWA 1UD1A 1UY1A 1YNAA 5IVBA 3THCA 2WSUA 3AKRA 4OHZA 4A7YA 3WDUA 2DVBA 2FZ2A 5FYTA 2XPJA 5A7NA 2VZVA 4Y20A 1JZ8A 1CIWA 2OUJA 1AF9A 3WUCA 4N53C 4BPZA 2ZX4A 3L2YA 3BYWA 3APBA 4IEVA 1NX9A 1OA2A 4HKLA 1EP0A 4LITA 5L7OA 4YW1A 2E53A 2BNNA 2B9VA 4Y4YA 1UOGA 2AEZA 4E4SA 1XXNA 2BUKA 5AC93 2XG3A 2BOIA 3OBZA 4X6QB 4ASMB 4J1WA 3BTZA 3N7JA 4Q26A 1BBT1 3O1SA 2HWC1 5DZEA 2VZTA 3VD9A 4CXWA 3KGZA 3PU3A 3Q8BA 2QUOA 5FRAA 1GYKA 2E7QA 4HANA 3OGGA 2LW8A 4WZFA 2B39A 4NOTA 5FXVA 1SLBA 4YLZA 4FTBA 3PNAA 1GWKA 4I0AA 4EN0A 3VDBA 5TSWA 3BKZA 1B09A 3CF6E 3USUA 3VZLA 1DFQA 1VBE3 1SFYA 4HK9A 4FPYA 2QQJA 1TVGA 2IXCA 4BJ0A 4GQ7A 4FXGB 2KXLA 2ARAA 4GWNA 1QH7A 4Y22B 4JDMA 5FMOL 1ZZ6A 3RFRA 3KHBA 2OVUA 2UYBA 2V5YA 4AEDC 4KMQA 4FFGA 1PO22 2R043 3O1TA 4QKDA 1GNHA 2JG9C 5BXXA 2QQKA 2VCAA 3UGHA 1AYM1 4WBBA 3AKSA 2OKXA 1A8MA 1UU4A 4DMIA 3WINE 1OQEA 1DP0A 3WEZA 4YRDA 3TEXA 3WP6A 1AX1A 1AR73 3KV9A 1R092 1VBD1 2VUAA 1SACA 3HT2A 2Y26A 3HNMA 3I2KA 4GALA 4GWJA 2QJVA 4RR3C 4BQ2A 4N53A 1RUJ1 4U36A 3ZFEB 5C3QA 3IT8A 3RSJA 2R1BA 2PLV3 4MVTA 3WW1A 1WCUA 4F3JA 4PI2A 3E6BA 2ZHNA 3DPRC 2BOJA 4XJWA 3VV1A 3WNKA 3ZN4A 3NAPC 2X05A 4CUGA 1EAH1 3RDIA 4UI9L 5LB6A 5JR7B 1ZRRA 2EVXA 1CIYA 4P9LA 4O9EA 3O0WA 4YW4A 4FPJA 5GKAC 2JWPA 2HWB1 1U5IA 3BOPA 3DKQA 3VB9A 2WT2A 3AZYA 3ZVXA 1DDLA 4AVTA 2Q4SA 3VHPA 4A3XA 1RUD1 2XUEA 1BVP1 3JB4C 3VLBB 4YFZA 1V6NA 5E1RA 1GOGA 1QQP2 2LUWA 1OC1A 1ENXA 3LPGA 4KQ7A 5EPAA 3RZZA 1TME2 5KXDA 5GALA 2YBPA 1V9U2 5I0UA 1QOSA 1HRI2 2WS92 5BUVA 5JSOA 1DIWA 2R0HA 3CLPA 4TLFA 4I09A 4RGAA 1EV12 4V2VA 1JN2P 1C57A 3NQHA 1ZNPA 2XVGA 1W6NA 1U5XA 2VGDA 1C28A 1CESA 1W6MB 2P1BA 4QD2A 1TG7A 1NCRB 1NZCA 2C1FA 2VH9A 4XJ9A 4AEDA 2Y6FA 3ZN6B 4PDWC 4LBNA 2OA2A 4WM8C 1U5YA 2JG9A 1R082 3AFKA 4LBJA 4AVBA 2YPDA 3VBOB 2AZ5A 2WUHA 1UMZA 3AMMA 2O1QA 4FCAA 3WNPA 1ZZBA 1AR62 3NVCA 4OFGA 5FZCA 4KWUA 1NA1C 1WBLA 5I0RA 1HV0A 1RUI2 5IAVA 4QXHA 2CGPA 3WNNA 2NMNA 4NAOA 1POQA 3ME2A 4L2NA 4N7IA 1WZXA 4YGCA 3HNBM 3OG2A 1V6KA 3ZDVA 4LE4A 4K7JA 2Y0IA 5HCFA 4NJ4A 2TBVA 1CONA 4CCCA 3DPRA 4FXKB 3JQWA 3NAPA 2K9ZA 3U14A 1WLWA 5D2AA 2A71A 1C8M3 3IAPA 4J1XA 5A32A 2L9LA 3V0BA 3AKTA 3Q8EA 3KF3A 2YYOA 3LKJA 3WF0A 1ASJ2 1HN0A 3C7HA 4BMEA 4DZGA 1QOTA 3TEWA 3OBAA 1H9WA 1KXGA 4FAGA 5EV7A 1SLCA 1QHDA 5K4LA 5ABJC 5F6LB 1XNBA 2JKBA 3KT1A 5CVRA 5FY9A 3ZFGC 5A7WB 4Y5SA 2J1SA 4I3PA 3HVDA 2B4KA 1NZIA 4FT8A 4ZXEA 5BNPC 4JDNA 1D7PM 1JUIA 4YWAA 5A3TA 5AC91 3HD8B 4PLNA 2VMEA 2WLQA 4XQWA 1VBA2 1W9TA 1X33A 2J22A 2DBNA 3IAQA 3ORJA 4CDWB 1LOCA 4RYDA 1W8ZA 4CDUB 3FHAA 4CEWC 5DAQA 4XUNA 4P14A 5FZFA 5BPXA 2VW0A 2MNGA 4TN7A 1R093 4OLLA 3B5LB 1X82A 4IV3C 1HX6A 3ZFFB 4PDWA 2W2IA 4WM8A 5F5IA 4NE9A 3RPQA 1DG6A 2MPFA 1R64A 1OOPC 2VW1A 4EZ4A 1WUVA 1VBE1 3WD5A 4CP0A 3OBRA 1UY2A 1W6PB 1W9YA 3C3VA 1OLME 4YM2A 4DNYA 2WDBA 1NA1A 4FOYA 2VMHA 4GD4A 1DQ2A 3ZSEA 4ZS3A 1GZ9A 1KQRA 3KVAA 3VD3A 4XHBA 3H3UA 1WLCA 4M0NA 5GLUA 4QKBA 5FMCA 1H6YA 2WT0A 2VOKA 4P9WA 5FPXA 1S2KA 1QXPA 1HJGA 2R041 4HSJA 1DQ4A 3N7KA 1KRIA 2WQ8A 2E7AA 1W2NA 4K1ZA 3ZIWA 3DUIA 3MUZ1 4PIYA 2D3PA 3KT4A 2VULA 4HMZA 1QQP3 3J26N 5FZKA 1LKNA 1ZBA2 1UXZA 2YU2A 2BFUS 5CYYA 3OTFA 1V9U3 1XSRA 2GNBA 3GJAA 1HRI3 2WS93 1AR71 1WLTA 2BBAA 1H1MA 3TOJA 4QPWA 3BCWA 3MF6A 1EV13 3ZXGA 5ABJA 3VZKA 4A3ZA 2Y6KA 2D93A 3ZFGA 4GAZA 4NWWA 4WVMA 5L7OB 1IS3A 1HLCA 2PLV1 3RJ2X 4CPBD 5IHRA 3O1RA 3H1MA 1XC6A 5BNPA 4QQLA 4CUBA 4OUEA 2AENA 1R083 5LATA 3C8XA 1J1LA 1RUC3 2QQIA 1NCQB 2JDYA 4AOCA 2F6BA 1M06G 1AR63 4LBQB 4PQQA 4A2UA 2GN3A 1YHFA 4CEWA 4C0BA 4GJZA 2E26A 1BMV1 2CDOA 5IAXA 4IV3A 3NJYA 4JC1A 3H3LA 3N4MA 1UCXA 1HDKA 5A70A 3SNMA 1LEMA 1SBFA 3PDQA 3WF2A 1OOPA 3ES1A 4XAEA 2VZ1A 4JQRA 3VL9A 3TN93 1JYNA 1BEV2 5FTTC 3H42B 1KJLA 1SHWB 1V00A 5LK5A 1LCLA 4AFDA 2VBPA 3SEEA 1ASJ3 3ZIXA 2WR9A 2ZEWA 3I4IA 5KHKA 3AK0A 5FBJA 2RHPA 1SLTA 5DDJ3 4OHYA 1GSLA 2WBKA 4HG6B 1I1EA 2BVVA 1KS4A 3ZOIA 2FZ1A 2QZ2A 3DL3A 3TYJA 2DVAA 2ZGUA 1KD7A 1YFUA 4X8PA 2YDEA 4GJYA 3AMNA 4MSVA 2OW4A 5FFOC 1OD5A 2V72A 1YQ5A 1IPJA 1XSQA 1HIXA 5FLJA 5CFDC 4ZPIA 1PZ7A 2QQUA 5BYNA 4PCRA 4HKOA 2BEOA 4AI9A 1OA3A 3NNFA 4R9DA 3B7MA 4HL0A 4N53B 2ZHKA 4META 1OLMA 1NUKA 4CUAA 1J83A 3EB7A 1VLNA 3OY8A 3OEAA 4FPHA 2VPVA 2ARBA 4DXSA 4XZUG 1RHI3 5C8WA 2VMIA 2VUCA 5ACA2 5FIXA 1C8M1 3M3QA 5T5PA 1N3OA 5EJZB 1CWPA 2WO1A 1Y7BA 3EXUA 1CZTA 2A3WA 1LHUA 4XF1A 4PLOA 1WLDA 2PHTA 2ILMA 1RC6A 1XNDA 2YFUA 3MGUA 3WXPA 1XJAA 3I2IA 3WNXA 3MPBA 3I49A 3WDYA 1DQ6A 1PGSA 5KR7A 1SLIA 1O7FA 4ZXKA 5AFEA 3W9AA 5C7GA 3GBGA 4K3UA 1S0FA 1FPN3 3SC7X 5H9PA 1WKYA 4E8DA 1H4HA 4OHWA 4A44A 1UX6A 3E1F1 2WAOA 1WCQA 4AK3A 4HVRA 4Q0PA 1B35B 3WG2A 1FYUA 1CR7A 4LKDA 1ZBA3 2PXJA 2WINB 2JECA 2FDFA 5J37A 2WC2A 4CU7A 5J7MA 3J4UH 4JKMA 3ETQA 2XWJB 1DYPA 3WDVA 2ZGTA 3ACLA 1R091 4W6WA 4BMBA 4KL1A 3MBWA 2WYSA 3K3NA 5I0SA 1GP6A 1XYPA 3O14A 5F5QA 2W94A 3R4SA 4M01A 3VBUB 2AEYA 1MZ5A 2W1SA 1JI6A 5FR3A 5EQUA 1UZ0A 3I7DA 4AHWA 4C8DA 4K40A 2WZR2 2PHRA 3JB8A 4XAAA 4AI1A 3VN4A 1DLCA 5CFDA 1BK0A 1GMMA 4RGKA 4Y1ZA 3BGAA 4AI8A 3AXDA 4D6RA 2ZGRA 4QPYA 4TLGA 5IYYA 2VOXA 2B5HA 2OX0A 1MS4A 3VHOA 5JOYA 2BDRA 3R4UA 3K51A 1W6OB 2XLAA 5GZFA 1QU0A 1PX4A 2Z2SB 5K7PA 5BY5A 3NNGA 3DN7A 3IPVA 5JOZA 3DPRB 3KQ4B 2VW2A 1MZFA 2Z4FA 2ZEZA 2VZRA 1QQP1 1KITA 1F4AA 4Q0VA 2D3SA 1OMIA 2D6OX 3FC0A 5FYZA 2E32A 3V0BB 3WCRA 4AVSA 1UZWA 2P6CA 4BQ3A 1E5RA 1V9U1 4IE4A 5A7OA 5JPNB 4XJ8A 1BEV3 1HRI1 2WS91 4RQPC 5CFCB 1MQTC 3HN1A 4XYXA 4CCMA 4CCNA 1OUXA 2Y8KA 4YZ5A 1GQGA 1NY71 2C26A 4FVVA 1EV11 3QCWA 3M3CA 1FOD2 1G6NA 2DUPA 1NXD1 5A3OA 5LW9A 1Z7S3 1PM4A 2NZ9A 4Q27A 3S5AA 3JU9A 4NIDA 1R1A2 3ZXEA 1T6GC 3MIFA 3ZXJA 4U2AA 1GZWB 4MOAA 2SLIA 3KV6A 2C4XA 1R081 3K48A 4FPKA 4J6GA 1DQ0A 3IZOA 5FKBA 1RUC1 3H7JA 5CB7A 4AFAA 3H9AA 3WF3A 2NQYA 3B94A 2ZGSA 4N9IA 1JZ2A 4PF5A 1AR61 1F2NA 4XJUA 1L7QA 1OPOA 4DPNA 3PUAA 2D97A 3MW2A 2WAAA 1ULCA 5CISA 3VZOA 4L99A 3HBKA 1G9AA 3U4SA 3DF0A 3H50A 5CA6A 3WUDA 2Y38A 1DHKB 4E2GA 5LK7B 2JIGA 1F15A 1WMXA 1XBFA 5D21A 5DXDA 4UBGA 1KS5A 5EHDA 4CEYC 1RIRA 1OI6A 4LBOA 5A6XA 1QNYA 2YUEA 4OVEA 3LPFA 2B45X 2JD9A 5F6KA 3TN91 3VBRC 3J8F2 2W87A 3LOIA 3AKQA 4LA3A 4GIQA 2XJUA 5F2SA 5ACA3 3OBTA 5F2WA 1QXRA 4JGYB 1O4TA 4BQ5A 4JX0A 5DPNA 1ASJ1 1K12A 1IGOA 3V64A 1OD3A 4IEPA 2DCYA 1UY4A 5DDJ1 3LSDA 3T09A 4AQTA 1SDDB 1ZZ8A 4GWIA 3U07A 4HPKA 1AZDA 1V6JA 5FY1A 4NVPA 5A3LA 3U4XA 4D7YA 1GNZA 4DUXA 4MV2A 3K4DA 4RGGA 5FPVA 1LR5A 4RHV2 1QJEA 4GMP0 4XIOA 1UYYA 5FO8B 3FHIB 4IESA 3WSOA 2P6HA 2XR4A 3NNJA 2F17A 4UT5A 5FXZA 4RQPA 1K5MC 1MQTA 2ZKNA 2HYXA 3NNLA 5HCBA 2A1XA 5L73A 2WO7A 5FREA 5IVEA 3MO4A 3N9MA 4IV1B 2RM23 2VAUA 4B7EA 1J3PA 2SBAA 2IUWA 1CAUB 1C4RA 1QXJA 1WCSA 4AGGA 1NAEA 5IK5A 5BNPB 3K3OA 5C4WC 5K0UB 3ECQA 1RHI1 2RMU2 3VDDB 3ZYGA 2HEVF 1Q3EA 4NRMA 4JKKA 4IEOA 1MS9A 3LOBA 3KWVA 5K9YA 1ZA7A 2WZR3 5JMCA 3GBWA 1RUE2 5CKNA 3CQOA 1DYKA 5D1IA 5IW0A 1RUOA 1Y9GA 2GC1A 2R6QA 2UWCA 3WHUA 1L7RA 1I3HA 2D3RA 2OPWA 4CDQC 3ZXAC 2OS2A 2OZJA 3OB8A 2CWMA 5CIRA 3TEYA 4AFCA 1N1YA 1FPN1 1X8MA 4KGQA 4CEYA 2JENA 4HLTA 1VAVA 2XBO2 3B93A 3DYPA 4Q0UA 5A3WA 4BZ4A 3VBRA 1RVF3 2QFEA 4MHRA 5DAVA 3KMHA 1ZBA1 4LKEA 3SMHA 5FMOS 4EQVA 1KFUL 4NPRA 1O5UA 3N7LA 2GC0A 1S2BA 1OKOA 4XZPA 4AQSA 1WBFA 1FOD3 1PVXA 3I97A 4QM8A 1VALA 3GCWA 4XC9A 1R1A3 4FPOB 3VZJA 5A1FA 1J84A 1WD3A 2WYFA 3W21A 4E4ZA 2VXRA 1W0OA 3MIEA 3DXUA 3ZYIB 4Y26A 4P5HA 3HOBA 1SPPB 1GWMA 1K5MA 3FL7A 2IFWA 3FLRA 5LY2A 4YPJA 4BLIA 1UF2C 2DCZA 4L0PA 1SLAA 2X29A 4WZCA 4AAPA 3ACHA 4GA9A 4ZHNA 5C4WA 4BQ1A 1LU2A 1W03A 1V6LA 3LDRA 5BNNC 3Q8FA 5A33A 4GKYA 3HJRA 1RUNA 5HPOA 1AX0A 4COYA 1LRHA 1BEV1 1MPXA 2D44A 3AYDA 3J8F3 4ES9A 3U75A 3UNPA 2HEYF 4I0BA 4LO5B 1WW4A 4IEXA 1KFXL 4CXXA 2DYCA 3FFZA 4Q4X2 4QU1A 3FUOA 5A80A 2OQ7A 2VCMA 4CDQA 4B7KA 1Z7S1 3ALQA 5DQ0A 2CY6A 4IUGA 4MLOA 2HWE2 5BNOC 2P3YA 5F9TA 2XOMA 3GF6A 5DN2A 3UJQA 2ATFA 2A5ZA 2ZEYA 4AFBA 2BGOA 2X09A 4PIXA 1HQLA 1DGRN 3WW2A 1PM7A 1UOBA 3W20A 1EYBA 1OF4A 2D6PA 3PMEA 1LULA 4W6YA 4RHV3 3AMPA 2W1WA 5C8CB 1H8TC 3IMNA 2ZHMA 1ND3C 3VGIA 5T5LA 4EN6B 4A7KA 4LKSA 4B4RA 1MS3A 1DYOA 1RTVA 2Y6LA 2HBUA 4ZKTB 1ZA4A 1QDOA 2JEMA 2YGLA 3ELNA 5DAPA 1CVNA 2VBBA 1ND2C 4NR1A 4IEZA 3O1VA 2WFF2 4DEQA 2ZGQA 1LENA 4MH0E 2HWF2 3LB9A 4IGOA 5JWPA 1Q5OA 3AKPA 2X8KA 2J1RA 2RMU3 1H8VA 2VMDA 4CDXB 5C6CA 4QXBA 4GH4B 2G4IA 1YXWA 3D0JA 3WP3A 4LIUA 4ZZ8A 5ACA1 2DVGA 3DECA 2DDUA 1RUE3 3G7DA 3LA7A 4G9SB 1Z0HA 2H0BA 3LFMA 4DUWA 4FPEA 4MGSA 3JZVA 1E57A 4LLOA 1IG3A 4RA0A 3A22A 3MF9A 1DCSA 2VJXA 2D6NA 1W9SA 2W9XA 3I2JA 1F5FA 3M2MA 4DFSA 5C3RA 2FDHA 5BNNA 4RS5C 4UF0A 5FXXA 1MS5A 2X53S 4AZZA 5C5UA 2XBO3 1GZTA 5E89A 4CU8A 3M1HA 4SLIA 1IQDC 1WWYA 2XQRA 4R4ZA 4GULA 2QQLA 3IKWA 1AXYA 4QHOA 1JHJA 5JXHA 2RM21 4L9BA 3RI9A 4AAXA 3TBDA 4QX5A 1C1LA 5BNOA 2WIIB 2QQPA 4HVQA 1UZYA 2RS13 4M3CF 4QB6A 3PVBB 3JD72 5FZOA 4FTEA 3D4KA 3EHKA 1W2OA 2E9QA 4Y5TA 4MZUA 4B8EA 4UW3A 3BIEA 1UIJA 2WZR1 1H8TA 4ASKA 2MEV2 3H7YA 1UPIA 1OF3A 3HR9A 1ND3A 2J1VA 1K45A 1GOFA 2VVDA 4V1PA 4ISRA 5F3GA 3UGGA 5BNQA 2ET7A 4NAMA 1GP4A 5EJ1B 4LBQD 1FAYA 1O6UA 1OKQA 2JG8C 1ND2A 3N9LA 5C3PA 1AR82 3E97A 4M3CB 2MHFA 2A75A 4N43C 4OQ9A 3I8TA 4LO7A 3S57A 1BXHA 1RVF1 1VAKA 3D82A 5DUUA 4CYDA 3WQ0A 4YZ4A 1D4VB 3W59A 1CPMA 2Y60A 4NIAA 4D0QA 1XNKA 3ACFA 2GZWA 1UIKA 3ZYRA 4BIFA 2VOTA 1RUG2 1OXCA 3QH6A 5DAXA 4HPKB 4XBQA 2VZOA 1VRH2 3N35A 4Q4X3 2BVBA 2WZ8A 1FOD1 2ZTNA 5BV6A 5GZDA 4H2AA 2HWE3 1H2MA 4OI2A 4PJYA 1R1A1 4F7ZA 4HN1A 2P4EA 3ZXDA 4RS5A 3KF5A 5ANNA 4Q8KA 1ULOA 1FT9A 3S30A 4PBOA 4RFT0 1Y9QA 1S0CA 5HCAA 2H0VA 3JBG2 1Z78A 3RZGA 2IVIB 3SXWA 2WT1A 3CEWA 3NJVA 4N9HA 5F37A 1WW6A 4A41A 3ACGA 4IGQA 3ZN5A 4DO0A 5IVYA 3HT1A 3DKWA 3KT7A 4IE5A 3ST7A 2GALA 2Q8OA 2VOWA 5FYHA 5JIUA 1V6OA 3J7MA 2P17A 5FZDA 5HXMA 2FHRA 1A78A 4GMP3 2WFF3 4YVSC 4H14A 1I9RA 4UBHA 5FP8A 5GLVA 2QBXA 3VBHC 4LK6A 2FDKA 1LODA 1RUH2 4QX0A 3IIIA 4AQ2A 2TEPA 3J8F1 1RYYA 5AVAA 3I59A 2KA3A
chains in the Genus database with same CATH topology
4H3WA 2GC2A 1AVBA 1HW5A 2PTMA 1UL9A 1DGLA 3VBFC 1G8WA 3D8CA 1WA4A 4I02A 2JG8A 2B46X 4N43A 3P3NA 4COVA 4AI0A 5E8AA 4HZFA 1NE4A 4IXLA 4JRAA 4G3YC 4AVCA 4RHV1 4BLJA 1N1SA 4Z8BA 4DQAA 1OFNA 1CX4A 1JHNA 1YRZA 5JI9A 4B4QA 5HBAA 2LALA 2D43A 2R0FA 5I0TA 2D6MA 3JCIA 4KG0A 5I8SA 1VB4A 2HWD2 3WQ7A 2NN8A 3GHNA 1VBB3 4NO4A 1U12A 2I2SA 2RMU1 3KCXA 1YFYA 2XHKA 1JTZX 4COWA 2ZJCA 3NL1A 1LJ7A 1MS8A 1PK6C 2MEV3 1RUE1 2NMOA 3FLTA 1QJZA 3ILFA 2IZWA 4FPCA 2R072 2ZX2A 5C4WB 5JLVA 1CAXA 3S7IA 4YVSA 1AR83 3AFGA 3H1WA 2XBO1 2Z69A 3VBHA 1RUF2 4H55A 3UK9A 3ZPYA 1PGL2 1UAIA 1YFWA 2CWSA 2UURA 3VBFA 4RR3A 1PNFA 1QWRA 1RUG3 2PHDA 1UPSA 3ZMNA 1FATA 2OIIA 4WV8A 5E16A 1VRH3 5GM0A 1V6MA 2DCKA 2RS11 4YG0A 2GU9A 3THTA 4XOGA 2WNVB 1GANA 1PVC2 1QJY2 4XDQA 1DQ1A 5JAXA 1Q8SA 1Q8QA 1FMD2 3JBG3 4D7SA 3B69A 3N36A 3KS7A 3M8LA 3CJIB 4P9XA 3HBZA 1COV2 2WQ4A 1VIWB 3L9JT 2DU0A 1PO23 1HXS2 4NN0A 4HFSA 3AP6A 4JGZC 2JE9A 2EXKA 4SBVA 3KLSA 5DG1A 1ZBE2 2QKDA 1YI9A 5HXVA 4XW3A 4IERA 1RUH3 1PK6A 4QGNA 4Q4V2 3M4FA 1APNA 4FPGA 4YFWA 1KDKA 4Y1VA 4XMIA 3RS6A 4Q4X1 3BOWA 4R9BA 2YV8A 4HN0A 2HWE1 2GH2A 1XYOA 3GYDA 4WVVA 5FDBA 4KU7A 2GMEA 3NV3A 4AFMA 2XJPA 2I45A 1NOVA 1ZX5A 3WVJA 3ZSJA 4AWDA 3CU7A 3KD4A 3SH4A 1G7YA 1ZZ7A 4QPGB 4OI1A 1J59A 4LT5A 3R4DB 1BK1A 5H9QA 5GZGA 1N1TA 2ZOEB 3MIDA 4GMP1 2WFF1 3M3EA 1TME3 1C1FA 3NV2A 2B7YA 4R9AA 5FCCA 5KHJA 4XE9A 4E9KA 1JH5A 1BZWA 4Y20B 3PJQA 3OF1A 3UKTA 3VKOA 1N3QA 3N7MA 1MZ6A 3G6JB 5CAZA 1ND2B 3SH3A 3MFCA 2Q1ZB 1ZRCA 3ZYJB 4QQHA 1O5LA 3V56A 2ZGKA 4AE2A 3AMQA 4LE3A 3ZMOA 4JGZA 4CP1A 2D6LX 2R1DA 3ZSMA 2PFWA 2ENRA 5GLTA 2RJKA 1RUI3 3SISA 4BIOA 2F4PA 5JVVA 2R49A 1Q56A 3FX3A 3USUB 3TNQA 1VBB1 1SEFA 2R062 1M4WA 5AVPA 5DUXA 2E63A 3JD71 3WP4A 1FV3A 4L92A 5HI0A 2DFCA 1CQ9A 1DGWA 4YNIA 1BQPA 3VL8A 2MEV1 3POWA 2GSYA 4YVWC 1D0HA 2YC0A 2XKPA 1FMD3 4B3NA 4NWVA 4COUA 2DF7A 1TNFA 4JV4A 3AP9A 4IL7A 1AR81 5FO7B 1HXS3 4C1WA 3T2TA 4K1YA 1S0JA 5AFBA 3E5UA 1VBA3 3L2HA 1ZBE3 3SHRA 4Q8LA 4EN8B 2ZAAA 3MLKA 4KNCA 3VBSC 4Q4V3 1AHSA 4YM0A 1RUG1 2JG8B 2GMMA 5T52A 1AX2A 1GR3A 1VRH1 2D40A 1S55A 2VU9A 2XVKA 3OYWA 4ZU4A 1PZ9A 3VUOA 3AJZA 4MGIE 1PZ8A 2WLPA 2IXJA 2ZX1A 3TNPB 3ZO0B 5FQ0A 2PHUA 5EZWA 3WOGA 4DINB 3TB0A 1QJX2 3UV9A 1QH6A 2VNRA 2EIGA 1TMF2 3JBG1 2EA7A 4M0HA 4KWJA 4LULA 2FBEA 2DTWA 2NM1A 2D6KA 4XJAA 5T55A 2CTVA 1PO21 2R30A 3AZWA 2BWCA 5LRRA 1AL0G 1C8NA 1C5HA 1RJ8A 2YROA 4XFHA 1J58A 2VUJA 2FQPA 3WDXA 4FBFA 3SCFA 1W6NB 2DCTA 1RUH1 1QDCA 4UW6A 1XU2A 4YVWA 4AEDB 4FTSA 1CGPA 3LA2A 4COZA 2JG9B 2OPKA 5CG8A 1FNZA 2CGNA 3WP5A 2BYVE 1SCRA 4LBLA 3WY6A 1UW8A 1FV2A 1G9DA 2WZPP 4R52A 5CU1A 4YG3A 3EJKA 4RR3B 1W6QA 3VBSA 4PIZA 2W68A 1MACA 2VQ0A 1J3RA 3B9IA 2ET1A 5GLWA 1ONAA 3IN9A 1ENQA 3NAPB 3LA3A 1R1ZA 3QLQA 1TME1 2DFBA 2R063 5A32B 4PLMA 1YO8A 2UY8A 1Q8OA 3AX4A 4IEUA 4MGYE 1XQNA 1QNWA 1GBGA 4INDA 1YI7A 3JUUA 1AL22 4K21A 4AHXA 4FOQA 1ULGA 1LHOA 2XLGA 1OPMA 4XF3A 4MXWA 4DS0A 3RQ0A 1JXNA 2XLFA 4S2HA 2B42B 2XJSA 1GZCA 1NYWA 1AXKA 2WA4A 2WWSA 1LHVA 1RUI1 2HKXA 5FPZA 1RB8G 1PGL1 3FE5A 5LEKA 4XPVA 3M7AA 4PDWB 4WM8B 5JI7A 1CAVA 3RMYA 4Q2FA 4QGLA 2QNKA 1LGBA 1H4GA 4AVAA 5IK4A 1O4YA 4Q4W2 3ZXFA 5FO8B 2ZAHA 1NA1B 2DTYA 4OUMA 1IKPA 4NHKA 1QJY1 2UYAA 3WDTA 2VNOA 3UKVA 2ZGNA 2P34A 1TMF3 1FMD1 1CJDA 2BNMA 5GZEA 2C9AA 1JBCA 1LOAA 4L97A 2EF6A 3ZFEC 4AW7A 4Y1XA 1COV1 1U0AA 2AREA 1X50A 1HXS1 2ZGMA 2YPJA 3A4UA 3NJZA 4FQZA 1IS5A 1VB2A 1VBA1 1N1VA 1ZBE1 4H7MA 5ABJB 4NHLA 3VKNA 1NLRA 4AXOA 3SCHA 4GXLA 4Q4V1 3IIAA 4YW3A 3WW3A 4WVMB 3ZFGB 2XKOA 3H1YA 3NKGA 5J09A 2BBVA 2IWGB 4AI3A 2RS32 4EN7B 2BTVC 4XBNA 2W39A 1YJKA 4JGZB 3E5XA 2G9FA 1MR5A 4YZ2A 1LEDA 4F83A 4MXVA 4CEWB 1REFA 1IPKA 3LGRA 1ZRDA 2C5DA 4IV3B 4Y22A 3GZTB 3O5SA 1NCRC 1OOPB 3Q9OA 4GB32 3ES4A 5EJ3A 4CP2A 1DQ5A 4EWDA 1GKBA 3PMSA 3AM2A 4BCUA 1AYN2 3AYAA 1Q43A 5JIAA 1UU5A 2CGOA 2P3KA 3RWNA 1U5ZA 1VBC2 4RL7A 4HETA 5FLHA 3IWZA 2BQPA 2P3JA 3EO6A 3PHMA 1AL23 1S1AA 1LOBA 3ZFEA 1D2QA 2R16A 1MVQA 1ZZCA 1H9PA 1QF3A 2DV9A 2QCSB 4I3GA 4Y24A 1POV0 4FPFA 2C0ZA 3OGJA 4AQ6A 4HT1T 4FP3A 4AGVA 1S0GA 1QOOA 2R32A 4DY3A 3OY8B 3I2DA 1A6CA 3ZYPA 2D5HA 2CNAA 1LGNA 3MYXA 1BJQA 1REDA 2R061 2LTNA 4YGDA 4OHVA 4Q4W3 1RINA 4XIKA 3B02A 3WLUA 4CDUC 1EPZA 2PAEA 4CDWC 3MLJA 4Z1VA 3FBYA 2AH2A 4Z07A 3VZMA 1D2SA 5A3MA 2OYZA 1NCRA 3ZFFC 3WG3A 1AJOA 1Y43B 3P3PA 4HVOA 3B9CA 3KSCA 4JTNA 3V65A 2ZX0A 1GLHA 4Z2WA 3B3QE 3IDEA 1CJPA 4YM1A 2ZKLA 3RJRA 5FOJB 5IUQA 1D4M2 2AGSA 1BYHA 5KHHA 2BNOA 2IXIA 3UJOA 4LBKA 3HQXA 3LAGA 5SV5A 4BM8A 1HKDA 2EAAA 1O4ZA 4OI0A 2ZHLA 5CFDB 4YGEA 2ZABA 5KXEA 3LSEA 4L8QA 4AYUA 1Q8PA 5IT6A 1WMEA 2P2KA 2TNFA 5FBZA 2NLRA 3ILNA 3KCCA 3THPA 3CL1A 1TMF1 5C33A 2NPIA 5LEJA 1UKGA 3IPVB 5I8YA 5FOBB 1SQ4A 2XWBB 4MUVA 4GB33 4YZ1A 1YUDA 1ZRFA 4R8HA 3MPPG 2Y0OA 1AR72 1NCQC 4YYOA 1AYN3 2IXKA 1LGCA 2W08A 4CDWA 4CDUA 3H8UA 1I6XA 3ILRA 1JOJA 3R0RA 4FP2A 1BKZA 4XFAA 3MDPA 5GJ6A 2O0OA 4MXWB 1F9KA 1SDWA 4QGMA 3ZFFA 4AGRA 2OUHA 1VAMA 3QOPA 3CJXA 2VG9A 3TAYA 3GZUC 2TUNA 3M3OA 4FAHA 4Q4Y2 1W6PA 2DUQA 3RYKA 1CN1A 2A73B 4LO4B 4LBMA 5DG2A 1ALYA 5JOWA 5I91A 3AYEA 3O7OA 4K8FA 2VMGA 4LA2A 4W6XA 1MEC2 3D5OA 1PNGA 3RI8A 3NW4A 3GNEA 4G4FA 3WX5A 4MYEA 4XFFA 4C0HA 4C90A 1I5ZA 3WT3A 4AEMA 3E6CC 4HKWA 5J48A 3POSA 1W0PA 5EFUA 1A8DA 2YHJA 5T50A 4XF9A 2D7FA 1TQ5A 4KGGA 4AHYA 4XEZA 1AL21 4IEQA 4ASLA 2ZA9A 4OI4A 5SV8A 1OLRA 2D5FA 4XMAA 1OSGA 2YGMA 2GC3A 3AZXA 3V0AA 2XUMA 3AXEA 3BIWE 4RQPB 1NCQA 1MQTB 1KDMA 3HIFA 2I07B 1GV9A 3LWCA 4Y1YA 1LHNA 4XETA 4D94A 4LBQA 2JICA 2GNTA 5JCTA 4XFIA 3KZ4C 1D4M3 4Y5Z0 2GMPA 4DOUA 5KHIA 2WA3A 5J36A 2ZPXA 1URXA 2XB6C 2A6VA 5KC5A 1C8M2 2HWF3 3UL2A 2N7GA 3WW4A 4TZDA 1A3KA 4Q4W1 1B35C 1YCIA 1OQ1A 1SCSA 4JVAA 4XJZA 2ZZQA 3VHNA 4YW2A 4B4PA 3BPZA 4CEYB 5FO9B 3RYPA 3VBRB 3VBUC 1H1IA 4AF9A 4D69A 2JX9A 1IS4A 1HQNA 4XTPA 1Y3TA 4P9IA 2H6BA 3MI8A 4WM7C 2HYKA 4FOWA 5JOXA 2ZZJA 4D3WA 2EXIA 3IBMA 5JZGC 1EY2A 1YLLA 5D8AC 2RS31 3GZAA 1LOFC 2RE9A 1VP6A 3JD73 5FLIA 3WCSA 1FNYA 4QU2A 1K5MB 4KWKA 4C1XA 1YWKA 4Q4Y3 2PHXA 1O3QA 1V70A 5CFCC 5C9AC 2AYHA 2GH8A 2PHWA 2ERFA 2XH6A 1C3HA 4KG8A 3EBRA 2QDRA 3VKMA 4FOVA 1ULDA 4P9JA 2VY0A 4GB31 1MEC3 1O3RA 5A33B 2G9GA 1RITA 1POV3 3WG1A 2KM2A 4OULA 3MW4A 1B35A 1AYN1 1NY72 2VQAA 1C5IA 1YIPA 3ATGA 4CDQB 1VBC1 1SLLA 5KXCA 4N7UA 2EXHA 4BHPA 2AUYA 1S0IA 2GDFA 3A0NA 3QACA 4QPIC 4KU8A 2BW8A 1RUC2 4WVZA 3VBUA 2D98A 3QD6A 1F31A 4EWEA 1J1TA 1KJRA 2QE3A 4TWTA 2ZGPA 2Q1MA 1QJU2 2XJRA 1VR3A 4R9CA 3OJBA 4WM7A 4JGYC 4F8AA 2Z42A 2XJQA 4EV0A 2WNUC 2O8QA 3O0XA 4LO6B 5GZCA 4XFBA 3LCPA 4UW5A 1PIV2 1W6OA 5JZGA 3INAA 4XF4A 5D8AA 3MFAA 1GQHA 4I0WB 3TN92 1LOFA 1REEA 4HBNA 1WCDJ 3U10A 1NQJA 2E7TA 3PLQA 5JDBA 1FI2A 3BU7A 5DDJ2 5CFCA 3D6EA 5C9AA 4YG6A 2ZX3A 4GKXA 4IV1C 1OLQA 1AXZA 3WHTA 3HMYA 2HJIA 1UU6A 2EAKA 3C2UA 3BODA 1RMU2 5BNNB 3RMXA 5K0UC 1G9CA 3MIGA 3BB6A 1UZZA 4JCKA 1GZWA 3VDDC 1O3TA 3FFQA 2WKKA 4QT6A 3S6PA 3TRSB 2WSVA 2V73A 2GAUA 5CBLA 1XU1A 2RJLA 2RS52 4DRRA 1ZVFA 5BNOB 4H7LA 3FZ3A 4Z92B 1D4M1 4IETA 1DGWX 2DU1A 4ITCA 1RHI2 1LHWA 4CZSA 1V6IA 2BWAA 4QPIA 5K8SA 2H6CA 4YW5A 2HWD3 5L36A 2JDZA 2HWF1 2W0XA 3RNSA 3B00A 1H8TB 3SITA 5I93A 2A6WA 1ND3B 3KB5A 4MGZE 3ZXKA 2VNGA 4E2QA 2UWAA 4JGYA 2DVFA 2WNUA 5JPMB 1MS1A 3RYRA 1FPN2 1WMFA 1QMJA 3J9SA 3MIHA 2R073 3FLPA 4FO9A 1D0GA 4FSJA 3OPZA 2A6ZA 4EROA 4Q1PA 2B8MA 1YYNA 1SBDA 4OHXA 1RUF3 2PA7A 4Q0SA 3KQRA 4X6RB 1RL3A 1IQAA 5LRSA 2K0GA 4IV1A 4LHLA 1CAUA 2X5IC 1CD3G 3FMGA 2WL1A 4RS5B 1PGW2 1S0EA 5K0UA 3QH7A 3V0AB 2W52A 1MVEA 1NG0A 3VDDA 4AG4A 1Q8VA 1ZREA 1PVC3 1QJY3 4Q4Y1 3BTAA 2CAVA 1QJU3 1IHMA 3AZZA 3SH5A 2QVSB 4WVWA 1BCXA 1HRV2 2O8OA 1COV3 2A70A 4W65A 1MEC1 1PIV3 4CRQA 4XTMA 1S0BA 3FWEA 1POV1 2JD4A 4QXKA 2JE7A 5F1RA 4BA6A 3I59B 2OZ6A 1XE7A 1NLSA 4QQOA 5C8CC 1G86A 1PO12 3PVNA 3EQEA 4O9GA 2WQZC 4ONUA 1Z7S2 5EYXA 5CADA 1O3SA 2PQQA 5CNAA 2WJSA 4N43B 1XNCA 2K2SA 5E88A 1AJKA 4E27A 1DBNA 3T1MA 1X36A 3NSTA 1UKRA 1RMU3 2ZGLA 1LU1A 4XBLA 4CDXC 3SCGA 4GH4C 2YY1A 3FBMA 4QM9A 2EXJA 1OHFA 4DY5A 2P37A 1GFF2 2RS53 4XFGA 3S7EA 1WGPA 3WV6A 4A7ZA 2X5IA 2XJVA 5J98B 3I54A 2I74A 4E2SA 3ROUA 4PBPA 1OQDA 2P3IA 2VECA 1DF0A 3AB0A 3GBFA 2Q0AA 4FQ4A 4ISQA 2BGCA 5T5JA 4TYSA 4M3CE 4EJRA 1X8EA 4Q0QA 1F8VA 1XYNA 2DCJA 1CAXB 3FUQA 2ES3A 3AYCA 4DB5A 1OFSA 5J3UA 4YVSB 1RJ7A 5H9RA 3AMHA 3NKTA 2DVDA 1BVVA 1QGLA 4QMAA 4YSFA 3VBHB 4XQ4A 2A3YA 1H0BA 2RR12 2V09A 4LLFA 4JDOA 1ENRA 2ETEA 5H9SA 5C8CA 1AR92 2RM22 4Y1UA 4TSVA 5DZFA 3VBFB 4ZU7A 2FMDA 1DZQA 1DU3D 5L19A 3GALA 4XQDA 4ATEA 2DURA 4BOWA 1YJLA 1CAWA 3WR0A 1HV1A 2HWD1 3PJYA 2JXAA 3AP7A 2ZMLA 4CDXA 4IQPA 4GH4A 2HEWF 4WM7B 3OD0A 2PHFA 5I8TA 3IDBB 1LOGA 3PVEA 2E6VA 1OA4A 2PN5A 3IM0A 5T5OA 3DGTA 2PHLA 5JZGB 4I2OA 1W39A 3SLIA 5D8AB 2R071 1XRUA 1CPNA 4MGKE 4AVVA 1HRV3 1RVF2 4YZ3A 3RG0A 1BBT2 1WCKA 2HWC2 4LNVA 4BE3A 1PK6B 1RUF1 5C9AB 1MZEA 3QBQA 1JUHA 3LZZA 1PO13 4YM3A 2DUOA 4FPLA 4JAAA 4P9GA 3VKFC 1HQWA 1LECA 2ZBJA 1NQDA 3AP5A 4LHKA 3WG4A 5IK7A 1PVC1 3TWIA 2BFUL 4XXPA 5CG9A 1QJX3 5DUWA 4C91A 1QJU1 2WNEA 3ENRA 2WFPA 3MICA 4NHMA 3ZSKA 5J96B 3BALA 2IXHA 2YZ4A 3MLLA 3NO8A 4QPIB 1AYM2 2XGXA 1TNRA 3N3HA 4PQ9A 2VVFA 1PIV1 4M3CA 2JJ6A 5KC6A 4LUKA 4LR4A 5KHGA 1O91A 4S2GA 1VBD2 2XVLA 1ZYBA 1H2KA 1WW5A 5KBFA 4KBBA 1RUJ2 2ARXA 2WNUB 1DZRA 1YFXA 3U11A 1QKQA 4IEWA 4YARA 4YGBA 2XL7A 1EAH2 5EYYA 3WDWA 3FJSA 4XILA 1IOAA 1RMU1 3O12A 1H2LA 3ZXLA 3MEPA 2HWB2 4XF0A 3NV4A 2RR13 4E4DX 3OCPA 4KH9A 4BWOA 4LUMA 1RUD2 4L11A 4LEJA 1AR93 2ZS6B 2RS51 5EXOA 3URFA 1AUYA 1DGRA 2PELA 3AP4A 3E5QA 1LTEA 1YIFA 1LB2A 1WMDA 4XHXA 3W58A 4DRVA 3WZ1A 3VBOC 2LM3A 3R05A 3ZDSA 3AZVA 1G9FA 1XE8A 3VKLA 1ULFA 4QQPA 1X7NA 1H2NA 3NV1A 4GWMA 3H3ZA 2GNMA 2CYFA 3JQXA 3ZX7A 1S0DA 2DWRA 1LOEA 4I01A 4R4XA 4EWAA 2BPA2 4AEJA 1PMIA 3M70A 1W2UA 3E6DA 4JTOA 3RRDA 4AEKA 2EALA 4HK8A 2QZ3A 4BYYA 4S2FA 2WNVC 3CO2A 1BBT3 3DV8A 2HWC3 2GNDA 2VOVA 2A6YA 3UKNA 2YMZA 1SFNA 2VVEA 1ZM1A 2GN7A 2ZGOA 3OYWB 3T1LA 3USSA 2RS12 2ZMNA 3CJIC 3MW3A 1WW7A 4M00A 4OUSA 1H1AA 4Q29A 5JSPA 1VJ2A 3MIBA 4OZXA 3WQ1A 5FQ0B 3KM5A 3R6SA 2NYYA 1PGW1 4N90A 1IZ3A 4URTA 2UU8A 1N47A 4QQ2A 3AJYA 5FAXA 3X29B 2UY9A 1GICA 3U0ZA 1QY4A 2NP0A 1TE1B 2ZCWA 1MS0A 1FXZA 1W6MA 4IEYA 2X5IB 2XJTA 3POYA 4AHZA 2A7AA