4NIDA

Crystal structure of alkb protein with cofactors bound to dsdna containing m6a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
203
structure length
203
Chain Sequence
QEPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Switching Demethylation Activities between AlkB Family RNA/DNA Demethylases through Exchange of Active-Site Residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/dna
total genus 48
structure length 203
sequence length 203
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2013-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4nidA00
4ZS2A 3T3YA 3BU0A 3H8RA 4QHOA 4IE5A 3BTYA 4QKFA 3BKZA 3T4VA 3RZKA 4NRMA 4NIGA 3I3MA 3I49A 4MG2A 3BTXA 4CXYA 4RFRB 4MGTA 4ZHNA 2FDKA 2FDHA 4IE0A 4NRPA 3I3QA 3H8XA 2FDJA 3RZLA 3O1RA 2FDIA 4NIHA 4NRQA 4IDZA 3BTZA 5F8PA 3S5AA 3KHBA 3O1SA 2IUWA 3RZGA 3S57A 3H8OA 3RZHA 2FDGA 4QKDA 4CXWA 4IE7A 3BIEA 3T4HB 3O1PA 3O1VA 4NPLA 4O61A 3O1MA 3O1OA 3BUCA 4NIDA 2FDFA 2FD8A 4NIIA 4NPMA 4OCTA 3RZJA 4IE6A 3RZMA 3KHCA 4JHTA 4CXXA 5DABA 3BI3A 4O7XA 3O1TA 3O1UA 4IE4A 3LFMA 3I2OA 4NJ4A 4ZS3A 4QKNA 4QKBA 4NROA
chains in the Genus database with same CATH superfamily
2ZGLA 1HKDA 2TBVA 4EZHA 2P37A 3VDCA 1GOHA 4Q1PA 5C9AC 3DPRB 3ATGA 1R092 4N7UA 4LBQB 3N7MA 4B8EA 3MLKA 4HONA 3TNQA 1ZZ6A 2WNUC 1U5IA 4YVSC 3IT8A 2VC9A 4EWAA 1NAEA 2WNVC 1KS4A 2VVFA 1JOPA 4YZ3A 1FPN2 3DCQA 4O9EA 1RJ8A 3AYDA 1ZRDA 3URFA 3P3NA 2R071 4I09A 2XLGA 5IYYA 1YWKA 4Y1ZA 4YZ2A 1I3HA 2ZGSA 4IEYA 2OYZA 2V09A 3DEMA 2B9UA 2QQLA 4YM0A 2FHRA 2D43A 1OFSA 1KS5A 4CP9B 5DG2A 5GJ6A 1DBNA 4ZHNA 4OI2A 1T6GC 1DGRA 5FZ9A 2XUEA 4DRRA 3IN9A 4LEJA 4NUBA 1J1TA 1UY1A 3R0RA 4ISQA 4JGZA 3NNJA 5FYHA 1W3VA 4HVQA 4L97A 5FZOB 2B46X 2ZHMA 1A8MA 3C3VA 1PIV3 4HN0A 4XJWA 5FP8A 3KCYA 4V1PA 2A5ZA 4CE8A 5FPAA 4QD2A 4BQ1A 1QNWA 4QX5A 3CJIA 2VD7A 1G9DA 4Q4X2 1PVXA 3IKWA 2TUNA 4YW5A 4OUSA 1NA1B 1LHVA 4LXLA 3LEKA 1PGL2 3IIIA 4W6WA 3D5OA 3PTRB 4QWNA 3ZFGB 1HQNA 2PHDA 1MS1A 1WZXA 4AWDA 3SEPA 3ZYBA 4COYA 1TMF3 3VZLA 5FP4A 1LB2A 1GNZA 2HWF2 5CFCA 2DVFA 4RGAA 1I5ZA 5HCHA 1XSRA 3N3HA 2BNNA 2QQIA 2W1UA 4IV3C 1JTZX 1MQTB 2AREA 3POGA 1TNRA 3ZYJB 4BPZA 3UKVA 4F7ZA 2Q4SA 4GMP1 3TOJA 2YY1A 3AP5A 1W6OA 1SCSA 2JB4A 1UMHA 4Q0UA 5T5JA 3KV5A 1XNTA 3UL2A 5H9QA 2WLQA 2W1SA 4YPJA 2YU1A 3OD4A 2Y6JA 1O3QA 1WW6A 2OS2A 4NIIA 3POIA 5E88A 3VD7A 2GU9A 2AC1A 1ASJ2 2RS13 4LUKA 3WVJA 2HYKA 2V4VA 2ETEA 3NNMA 1BCXA 2D6NA 5LA9A 2ZEWA 5A3MA 3B3QE 2EXJA 1KDMA 2A6VA 4FP2A 3GBWA 4CDWB 3PUSA 4FSJA 2HWD3 2JE8A 2PELA 1POV0 1SMVA 2ZMNA 1G86A 3DPRC 5FKCA 2ZGRA 1CX1A 2IZWA 3AVRA 4K20A 1QMJA 1WCSA 4LOTA 4Q2FA 4WM8B 4INDA 3VUOA 1UY3A 5FZIA 2VCMA 1OLMA 2DCJA 3UK9A 3OGGA 1C8M3 4XJ9A 2RVAA 3IMNA 3PU8A 3ILNA 1VBC3 5J98B 3RVHA 3LEGA 1WA6X 2YBKA 2YGLA 3EMRA 3S7EA 4BISA 1NCQB 3DYOA 4RYDA 1VB2A 2XVGA 5JI9A 3C2UA 5F3CA 1ENRA 3LDRA 1OOPA 4E4DX 4K8FA 1BHGA 3T3YA 1M06G 1HRV2 4CP2A 3N9NA 4XUOA 3RG0A 2B7YA 2WWJA 4XJ8A 4CA9A 4IE5A 2Z2SB 2HEWF 1QF3A 3QACA 2RM21 3ZSJA 1W0PA 1LOFA 2ZGQA 3UGFA 1AL23 4LHLA 4Q4V2 1SQ4A 1XYOA 2D6MA 2J22A 5A7WA 2BWCA 2JDPA 5F2SA 3JBG2 5CFDB 4I2OA 2C1FA 4F83A 1HRI1 1NQJA 1UX7A 3RZKA 4B29A 1HV0A 5DAPA 5A7QA 4EN0A 2Y34A 4NAMA 1RUE3 5IK8A 1OLME 4K1YA 4XHBA 1O4YA 1NXD1 4HZFA 4C1XA 4BJ0A 2WZR1 3DV8A 3A0KA 3GGLA 3LEIA 5CB7A 5IK7A 2VOKA 1NA1C 2XG3A 5BXXA 3T1LA 2TNFA 2ZXQA 4X8NA 5A7OA 1C1LA 5DUVA 1OXCA 2WDBA 3ZFGC 3CDZB 2WKKA 4GJZA 2VZVA 4PDWA 5IVEA 2R063 4I02A 2WT1A 1AR82 3JUUA 2X29A 4UFKA 1W90A 5FO7B 4CDQC 4E8CA 1X82A 3H8XA 1G9FA 5GLTA 1W2NA 5AC92 2D93A 4L11A 1AXKA 2WT2A 4LR4A 4WV8A 1MQTC 2QVSB 2R16A 4J1XA 1F2NA 1K5JA 3IMMA 4N43B 3S5QA 3ZYIB 4IGOA 3N9LA 2ILMA 4OULA 5A3PA 5DMYA 1QOSA 3ACIA 3RZZA 4CU9A 1QWRA 3KHBA 4Q0SA 2EVXA 1HLCA 1PO12 3J4UH 1WLWA 4LO7A 5FY0A 1YUDA 3D8CA 1D4M1 1V6KA 5DZEA 3WW4A 3RZHA 2J1VA 2GDFA 1MS0A 3OPWA 5FOBB 1RUOA 4OHVA 3PIGA 2LTNA 3J7NA 1WW7A 2GN7A 3P1IA 3LIGA 1H1IA 1POV3 5EWSA 5LATA 3RFRA 2XJQA 4H2AA 4CDWC 3WF2A 3BIEA 1YNAA 3WDTA 4XJZA 4AW7A 3ROUA 2E31A 4P02B 2GNDA 3IZOA 2Y38A 4I0BA 4XFBA 4WM8C 3VL8A 3RYKA 1W9TA 4DY5A 4ET7A 1JS9A 2ZEYA 1R091 2E9QA 2YU2A 4HPKA 5CKMA 1WBLA 2PLV3 2XJSA 4XUNA 4Q26A 1H9PA 3FUOA 4AI1A 1E5IA 4CCDA 5HXMA 3ZFEB 4GKYA 3FFZA 2E32A 2DVAA 1PVC1 1OPMA 5F5AA 5FP9A 5M0TA 2R30A 4O7XA 5FP3A 3EYPA 1BEV2 4XOGA 4OQ9A 5I93A 1PNFA 2HH9A 2OQ6A 3R4UA 1KFXL 3ILRA 2GNMA 3QOPA 1OD3A 3O1UA 3IIAA 2HBUA 1Q56A 4IE4A 1K5MA 5LRSA 4QGLA 4C0HA 2NMOA 1UWWA 5FQ0B 1SFYA 4D7YA 4CVUA 5CFDC 3ETQA 2IXCA 3NRUA 4QX2A 1VBD3 3ZXAC 1WMXA 5J96B 5KHJA 2K0GA 4Y5TA 1S2EA 1SBDA 2RS52 3M70A 1OKOA 5ANNA 2IXKA 4AG4A 3NAPB 1QJX2 4HANA 5FDBA 1WCKA 1VBB1 4DUVA 3VBRB 3WV6A 3S7IA 2ZACA 4Q4X1 5BV6A 3OJBA 4HSJA 3AX4A 5HI0A 4K3UA 4I0AA 1DQ6A 4QHOA 1K3IA 3BCWA 5ISLA 5C71A 1PGL1 4YWAA 4QX7A 1GMMA 2IXIA 2DU1A 3ZYRA 2XGXA 1DZQA 1OC1A 1FOD3 5CVRA 5FYSA 2JDHA 2HWE3 3VBUA 1G9CA 1SEFA 3M1HA 4Q5OA 5EYYA 3O5SA 1OH4A 5AVAA 3RSJA 3HJRA 2HWF1 2JD9A 3UETA 1W3XA 3N7KA 1XNKA 4H55A 4KNCA 4XQWA 4A2UA 4HKLA 4XEZA 4NIGA 4N43C 4OHYA 3NVCA 3AKQA 1NZCA 4MG2A 2IC1A 3B01A 2QZ3A 4XFHA 2Y64A 5DUWA 4AHYA 2ADEA 1SPPA 3UKNA 3HIFA 2EXHA 3FN9A 4KWUA 4CU7A 1Y3TA 2SLIA 5TSWA 2AEYA 4NIAA 5IATA 2IXHA 1RUG2 4LK6A 1X33A 4ITCA 5A3LA 4AVCA 3MO4A 2CDPA 3OG2A 4MGZE 1PO23 4CEWA 1UZVA 1VP6A 2H6CA 1ASJ1 2P34A 3BTAA 1I1EA 1W8WA 1DGWA 3ZXFA 1RMU2 2EF6A 3U14A 1AVBA 5E1RA 1KDKA 2ZGPA 4M3CB 1KD7A 5JZGB 4DINB 3WQ1A 5JWPA 2R0FA 4UW4A 5IVJA 5FKBA 3MEPA 5AFBA 1D0HA 1VRBA 4AVBA 3AKPA 2VCBA 4D3WA 2RJLA 3PVNA 4DY3A 1Z7S3 3M3CA 4KBZA 2ERFA 1QJU2 3POYA 2O1QA 4WVWA 4F3JA 3EJKA 4CDXB 4OHWA 4IE7A 1F8VA 5IVBA 3ZFEC 3CJIB 1ENXA 4JRAA 4QX3A 1FPN3 4NHXA 5JIAA 4RR3B 1KEXA 4YSFA 3BB6A 4PIYA 1JZ2A 1PZ9A 3AP4A 4LITA 4UFJA 4CU6A 4D7SA 3OYWA 1RYYA 5CISA 2QQOA 3GZAA 1TEIA 1XU1A 2HJIA 1NLRA 3Q9OA 4P5YA 3WHUA 1IS4A 2ZKNA 3LA2A 1J58A 1RUI2 1GYKA 4DXSA 5EV7A 4FFFA 4LA3A 4BQ2A 4IE6A 3KHCA 1QU0A 4Q4V1 3HBKA 5C4WB 3E6DA 4JDOA 5CYYA 4KWKA 3JBG1 4BQ5A 4HKOA 2XVLA 3MW4A 1IS3A 2QQVA 2VTFA 4I3GA 2XL9A 5FY8A 5LY2A 3NAPC 1GKBA 1UZYA 2CAUA 1V6OA 5K7PA 4Q1RA 3ETPA 3VBRC 5CNAA 2PAEA 1IGOA 1WWYA 1C5HA 1UD1A 1H4HA 2XHNA 2V4AA 4UFMA 3DECA 5FY1A 3CF6E 3R05A 3T2OA 4Z07A 4AHWA 4N9IA 1YQ2A 2ZTNA 4HMZA 5FZGA 5JSPA 2DBNA 1JZ5A 5B4XA 1ZZ7A 2VQ0A 4QM8A 1Y4WA 3G6JB 4BIOA 4EZ4A 1QNYA 2NP0A 1AR81 4ASKA 1QJY2 5I8SA 2XL7A 2J1EA 3AZXA 3U75A 5AC91 2JE9A 2RG4A 3UGHA 1NE4A 4IW3A 3VBOB 1UQXA 1RHI3 2WRAA 2VPVA 1UO9A 2C0ZA 5FLHA 3AXEA 3AK0A 1ACCA 1FAYA 2JG9A 4XFCA 3VBSC 4UFIA 5A33A 5CEHA 4XIOA 1PO11 3H42B 1AJOA 1MEC1 1KJRA 5FZCA 3THTA 3THCA 4D8MA 1BJQA 2PAKA 3AZYA 4MUVA 2FMDA 1FMD2 3ZSLA 4M4PA 3N7LA 3AL5A 1VMHA 5FPVA 3PVBB 5CKQA 3VBHA 3MIGA 3AKSA 1NOVA 2MPFA 3D82A 1H0BA 3I54A 1U12A 1RUF3 3A7QA 2ZEXA 4H7MA 2Q1FA 2Y6HA 5JZGC 2VJXA 1MS4A 2GSYA 3W9AA 1PIV2 3BPSA 3OPZA 1X7NA 1UAIA 1CAXA 4FOYA 4CXYA 3K4DA 3JZVA 1TVGA 1AYM3 4RFRB 3WG1A 3J7LA 1GUIA 5FY4A 4CPBA 3KS7A 4QQ2A 3NKTA 4GH4B 1DIWA 3I3QA 4NRPA 4CDXC 4PBPA 3GM8A 2YBPA 4LNVA 4U2AA 3CJIC 2W87A 2AH2A 3TB0A 2P4EA 5FWJA 4OQ8A 3VHNA 2ZCWA 1YXWA 3ZN6A 1RVF3 4K8RB 4RR3C 1TMF2 3BTZA 1ZX5A 4PIZA 4UBHA 3WQ7A 3LA7A 2WJSA 1BEV1 4NVPA 1VJ2A 2W0XA 1OLRA 1HRV3 2D5FA 5JOYA 3WNOA 3WINE 3HWJA 1O91A 2YC2A 5EPAA 3I8TA 1DLCA 2GP5A 1IS6A 1KGYA 2NZ9A 3VZMA 4Y1YA 2O8QA 3H1YA 1CGPA 1NLSA 1JHNA 1AR93 1C1FA 2AR6A 2VQTA 5C4WC 1H8VA 5A3NA 2F4LA 2P5BA 4XF4A 3ZKYA 4FQZA 3B7MA 5F3IA 3C7OA 3NW4A 5BNPA 2LS6A 5IJRA 3QLQA 5KC6A 3INAA 3WT3A 2VXRA 2WZEA 2LROA 4E2SA 1LHNA 1G8WA 5JPNB 2BFUS 1QJX1 4UFLA 3J9SA 4DXZA 2UY8A 3AXDA 4CEYA 2WO1A 4FFGA 5GLWA 1OA3A 2GC0A 1ZZBA 5BNNB 3LIHA 2R49A 4YW2A 3U37A 1H1MA 1XQNA 3BUCA 3B94A 3O14A 2YC0A 3AKTA 3TN91 1Y7BA 1CAVA 3ORJA 1UX6A 1UXZA 4HK8A 1LRHA 1H2LA 2PAMA 4ZU5A 3Q8FA 1QQP1 4LBNA 4QM9A 1YQCA 3SHRA 1PMHX 3L2HA 4QDQA 2VZ3A 3HQUA 5EYXA 3VBOC 3Q8AA 1ZZ8A 1C8M2 4UW5A 1QJZA 1YFUA 3MBWA 3SEEA 4Y22A 1VBC2 3GJAA 3CZJA 3T2TA 3ZYFA 2OT7A 1H6XA 2VOVA 2UWAA 4HPKB 3OCPA 1QJFA 1E57A 4FPCA 1V9U3 4AZZA 3H7JA 1S0CA 4BQ3A 4JCKA 4H3WA 2UY9A 5FXWA 5JXJA 1VRH3 2ZOEB 3AYCA 5IFPA 4ZZ5A 1SBEA 4K9SA 4EN9B 5LBEA 1WCDJ 2DVBA 2HBTA 3T08A 1DYOA 1TG7A 3VBFB 3BVCA 3SKVA 3WF0A 1IZ3A 4BZ4A 1URXA 2B4KA 2QCSB 2YV8A 3ZXJA 1AR62 2JIJA 2VBDA 3OSDA 1RMU1 1DYKA 2CWMA 4RQPA 3KM5A 5T5OA 3EXUA 4DNYA 4CUBA 2B45X 2DCYA 1RUE2 2ZHKA 3WNLA 4LHKA 2DVDA 2VMEA 3OEAA 4P9JA 1LOBA 4GH4C 4JKKA 3WDXA 4B7EA 2VZTA 3BODA 5JIUA 4NWVA 3I3BA 1SCRA 4BWOA 2N7GA 3RJRA 5FZHA 3ZMNA 1CIYA 3WNNA 1IHMA 4FO9A 2V72A 2WFF2 5J09A 2GC3A 2KA3A 4RD7A 4DXTA 4AI2A 1L7LA 2OVUA 3MIEA 1L7RA 3GCXA 3ILFA 4YYOA 3NNFA 5FRAA 1DP0A 5A1AA 2NM1A 1CAUA 1UU4A 3J8F2 3JQXA 3K51A 3BOWA 2A3XA 3POBA 4FPFA 1Q8SA 3KV9A 4R4XA 2ORZA 4CCLA 1B35B 2FDIA 1BLZA 3VD4A 3UKTA 3GHMA 4NIHA 2VUJA 3VDDA 1CJDA 2RS53 5HCFA 2XMLA 1UPSA 5EQUA 5BNNC 4CDUA 4EYUA 1OURA 1KITA 3LE0A 1R083 2ZGKA 3KLSA 4K7JA 3IAQA 3KQRA 3RGBA 1YQ5A 1W99A 5FMBA 5KHKA 2DFCA 4QPIA 3A4UA 2JIGA 4N90A 4IGQA 5F37A 1EUUA 4URTA 1REEA 2BV4A 3KF5A 3K4AA 4HL0A 3D0JA 4Z2WA 3NNGA 5FZ4A 3WDYA 3W21A 3VZOA 1J83A 5GZEA 4KWLA 3THDA 5C7GA 3H3LA 4XBNA 1ZBE3 3JXSA 4O65A 1PK6B 5T5PA 3WF4A 1ZZ9A 3OB8A 1V6MA 2VMCA 3MI8A 1VMJA 4PJYA 4XQ4A 4AOCA 4XBLA 4DOUA 5C8CB 3SLIA 2ZAAA 4FXGB 2VCCA 1QGLA 2VULA 4XZUG 3VKNA 2DCTA 2X5IA 3PMSA 1RUG3 2ZMLA 1OT5A 1W8NA 2A73B 3VBFC 4AFCA 1OVSA 2BYVE 1WW5A 2EA7A 2LALA 3GBFA 3VDBA 2DFBA 1O4TA 2X8KA 5DABA 5FPZA 5IVYA 2E6VA 1CPNA 3V0BB 1G7YA 3C7FA 1EYBA 1W8TA 3ES4A 3LDBA 2BERA 1ND3C 4IGPA 3VL9A 4XAAA 5ABJA 4LKSA 2JDAA 4W50A 2E53A 4WVVA 1PIV1 3KT7A 2K2SA 4RHV2 1LR5A 3A0NA 4XC9A 3WW1A 1JXNA 1W0OA 1P8JA 3CU7A 3RWNA 4CCCA 2EXKA 1YC61 2IFRA 4Q29A 5FXXA 3UV9A 1LGNA 5IK4A 3SCGA 1QJU3 1PM4A 5LEJA 2TEPA 4UF0A 5KC5A 1GZ9A 1HJFA 3E6BA 1FI2A 3GBGA 3V0AB 1S2BA 4HK9A 2BGCA 1AYN2 5LK5A 1TMF1 1LKNA 1QKQA 4YVWB 4EN7B 1OQDA 4ZXKA 1G6NA 4ZZ8A 1SLCA 3TYJA 1EUTA 5KHHA 1VLNA 1R1A3 2P2KA 4WM7A 3SCHA 5HPOA 1R1ZA 3WG2A 3H7YA 4QDSA 4M00A 1RUI3 4XFAA 2IVJA 4W4ZA 4B4RA 1EPWA 2A6XA 2GAUA 1B35C 2QQWA 5L7OA 2J1RA 5I8TA 2YC4A 1TME2 1CAWA 2D7FA 5CU1A 4CP1A 2JG9B 1PGW1 1XC6A 4XTPA 1PO22 2RV9A 3AMHA 2Y6LA 3RI8A 2RS11 4K40A 5LY1A 3OBAA 3ST7A 3AM2A 1RUH3 3FHIB 5CIRA 4C90A 2O8OA 4PI2A 3VHRA 4RS5B 2Y0IA 4Z2AA 2FDKA 4ATFA 4AFMA 1VBA2 2HWD1 2JX9A 4FPEA 4LULA 1V0AA 4UFHA 3N9OA 2FDHA 1XE0A 2QE3A 3GNEA 2DBIA 2ZMKA 1BMV2 4XCBA 2BBVA 2HWB3 1QJY3 3OOXA 4GWIA 4N53A 1Z7S2 2H0VA 5J3UA 2VM9A 2YUEA 1UF2C 2XJRA 1C8M1 2BJSA 2WQ8A 3C7GA 4HN1A 4HT1T 5FYVA 4EWDA 5JXGA 1PK6C 1VBC1 4GXLA 2ZAHA 2YZ4A 3WHTA 5EFUA 3SH3A 1W6MB 5C8CC 3KVBA 2WABA 3I59A 3U10A 2X09A 4XJAA 3WW2A 3LD8A 1TZOA 2FCUA 3W5MA 3IDEA 4Y20A 1FMD3 3CNAA 5FJHA 4M3CF 2ZX3A 2BWAA 5FZ1A 1W8FA 2VZSA 3DL3A 3G7DA 1QHDA 4TTGA 4AEJA 5CAZA 1SBFA 4QQHA 3HNMA 2WAOA 3SXWA 3F95A 4BXSV 1AL21 2G19A 4QAWA 3CHXA 5I0RA 1O5LA 4L9BA 4TYSA 3O1PA 3ENRA 1XSQA 1Y9QA 4WBBA 3U4XA 3N36A 2W91A 1RUE1 3WNXA 1D2QA 2W2IA 3QBQA 4E4SA 4XF1A 4NIDA 2I74A 4IV1A 1PHMA 1W6QA 2RHPA 2BVVA 1BVVA 2RJ2A 5DZFA 3FHAA 5GLZA 4Z82A 3MF9A 5AVPA 5C3PA 3HT1A 4EE2A 3ZSKA 3BOPA 2R061 1UU5A 2P1BA 4M4RA 4YVWC 2VR4A 3AP7A 3AYEA 1T6BX 3MUZ1 4Z8BA 1GBGA 1OA4A 1X9PA 3OPTA 1CAVB 1RHI2 1W9SA 3OGSA 5C3QA 1GP4A 4HSLA 4OLLA 4ZU7A 5F7UA 1HN1A 4P9XA 4AVVA 1SDWA 2VMIA 4MGQA 5KHGA 3BALA 2B5HA 4Q0PA 2VZ1A 3WQBA 1A78A 2JG9C 2RS32 4COUA 2Z42A 5FTTC 5IVCA 4WZFA 4JX0A 4S2GA 2IXLA 2CTVA 3R4DB 3V64A 3ZXEA 1RUF2 4RS5C 1POV1 2RDQA 3GHNA 1W9YA 1WMEA 5CA6A 1QXRA 3P3PA 5DXDA 2Y6KA 4UBGA 5D8AB 5DDJ3 2CNAA 1O3SA 1W39A 4HKWA 1N3PA 2JG8A 1FV2A 4LBOA 1AYM2 1XNBA 2WT0A 3VKFC 3QH6A 5HBAA 2UWCA 1ND2A 4D6RA 4XDQA 3W5NA 4P9IA 2FMYA 3POSA 2PLV1 4AQSA 1JW6A 3Q8CA 4Y26A 1IKQA 3GZTB 1RUJ3 1RVF2 1ULGA 1JUHA 3OUHA 1YFWA 4JZRA 1JN2P 4MGTA 3HVDA 1U5XA 2Z5WA 4LPLA 4B4QA 3UYJA 4MXWA 4XQDA 2RMU2 1COV2 4K1ZA 2WNEA 4IE0A 4O9GA 2XLAA 3FZ3A 4R9CA 2YMZA 2IFWA 2WS93 3AZZA 3RPQA 1DG6A 5J36A 4XMIA 1F31A 2WFPA 1AR92 1LTEA 1NCRA 1AR63 4BHPA 1ULOA 4YNIA 1VBD1 1FATA 1H8TA 1WD4A 4AEKA 4QT6A 4AYUA 3VN4A 1EAH3 3O1SA 2KXLA 4Q0QA 2XONA 3DXTA 2VOXA 1X8EA 4DPNA 3HMYA 4LLOA 2Y6GA 3HEIA 3VDDB 2G1MA 2Q8CA 4AQ2A 1VPHA 4QQLA 3TBDA 2JXAA 3UNPA 4W6XA 2YBSA 4CPBD 3OGVA 4NHYA 4AEDA 4XUPA 3J7HA 3AP6A 4HBNA 2WFF3 3MF6A 2HKXA 4E2GA 1FOD1 3HN3A 3IDAA 2ARCA 2HWE1 3I7DA 5A7NA 4DXRA 1JZ7A 4X6RB 1PX4A 3NV2A 4XF0A 4XPVA 5FOJB 2EALA 4XXPA 2VBPA 2UYBA 1JYNA 4UAPA 4IESA 1DGRN 3ZLIA 3J8F3 4A42A 4OI0A 4AI8A 3VV1A 2UU8A 5JAXA 3D6EA 1GU3A 1V9U2 2KM2A 4TZDA 1MZ5A 2QQNA 4GA9A 4QX1A 1APNA 3ZXGA 1TNFA 3A22A 4QQPA 1VRH2 3IM0A 1CR7A 2JD4A 2PFWA 3ZKUA 3E6CC 3ZFFB 5T52A 2A70A 3SITA 1PO21 2MEV2 3WCRA 2EXIA 1LHOA 3FX3A 3WR0A 2XB6C 4FOQA 4QX8A 3MLLA 5A70A 1UXXX 2OPKA 1PGSA 1GQPA 5EJ1B 4YW1A 1RINA 2CYFA 1AJKA 4LOSA 5D8AC 3JCIA 1WD3A 2WSVA 4LKDA 4Y1UA 2BW8A 2JENA 3LFMA 1A34A 2XR4A 1PZ7A 1GSLA 3WF3A 1BMV1 5ABJB 1UYXA 4LJHA 2P3KA 4BMEA 2CV6A 2Q8OA 2F6BA 3UT0A 1CX4A 1Z7S1 2PHWA 3R4SA 5BNOB 4MH0E 5KR7A 4XFGA 4MHUA 4NROA 1UKRA 1NCQC 1C8NA 4ZS2A 1FPN1 4M0HA 2DCZA 3WG4A 3FBMA 3MIBA 1EV13 3WLUA 4LE4A 2P3IA 4COWA 4GWMA 4DS0A 5FUPA 4P5HA 4UF0B 3CEWA 5K0UA 2WN2A 3W58A 1J59A 2LW8A 3I2KA 1Q8VA 4LTAA 4QKFA 4EN8B 4JGYB 2IXJA 1N3OA 1W9FA 1BK0A 4E27A 3PTYA 1TQ5A 1DFQA 1KQRA 2WBKA 5HCAA 3ACLA 3JB8A 1W8HA 4V2WA 5FZ0A 2XQRA 1W2UA 2XVKA 4Q4W2 4IQPA 3B02A 5F6LB 2R0HA 3T0AA 4RHV3 3KGLA 1Y9MA 3B5LB 3HR9A 5HCBA 1MZEA 5L7OB 2B9VA 3N35A 3AP9A 4ARXA 1JZ3A 2B8MA 1WMDA 4YM2A 4XACA 3DKQA 1GZCA 1R082 1JH5A 1W6PA 3LOIA 3WZ1A 2PHXA 2J1TA 3KB5A 4QPGA 1OD5A 3GALA 2VO5A 3JD72 3HQRA 4GD4A 3TEWA 1DU3D 5JUVA 4EROA 1ZREA 1A8DA 4KGGA 1AYN3 1Q8QA 5LEKA 4BK5A 3OY8A 1FV3A 4FPJA 3KV4A 2ZABA 4K6BA 2VZRA 3PIJA 4TSVA 4UI9L 4OYUA 4MGYE 2GALA 1QOTA 4XJUA 2OXBA 4QX0A 1RHI1 3WG3A 1ZBE2 1IPJA 1OQEA 2OZ6A 1NKGA 4CUCA 2PXJA 2DUQA 1F35A 5C5TA 2WYSA 1V6NA 2GMEA 4L8QA 3H8OA 4QKDA 5HV0A 4FAGA 2ZGTA 2EIDA 3AZWA 2UURA 4IXLA 5FZAA 4RGKA 4CXWA 4LHNA 2OUHA 5I8YA 5HV4A 1TME3 1ZBA3 2VXJA 3ZFFC 3MIDA 1N1VA 4IEZA 5L19A 1SLLA 4RN5A 1YIFA 2BTVC 1ULEA 3ELNA 4J1WA 2WIIB 2DUOA 1Y9GA 1QXPA 4GWNA 4ARYA 5T54A 4M01A 1RUF1 4KGQA 3KF3A 3O1MA 4SBVA 1W04A 4I01A 4RSUA 4JHZA 1AX2A 1VBA3 3HD8B 3GJBA 4RL7A 3ZDSA 3FLRA 3LDKA 4C8DA 2JECA 3MZHA 3RZMA 3KT4A 3LGRA 4JGZB 1AYM1 1S4CA 1S55A 3FHQA 5FMCA 3ZSMA 4OMCA 4CXXA 5ABJC 3DYMA 2BOIA 1O8PA 3E5XA 4UWDA 2ZBJA 4W8JA 5A7SA 4BQYA 5BNOC 4Y4RA 2A3YA 2XJUA 3H50A 4CUGA 1EPZA 2ZA9A 5FO9B 2YPDA 3ZPYA 3LOBA 1ZRRA 4NO4A 5BNQA 1C4RA 1GP6A 1RVF1 1BBT2 3ASIA 4DIQA 4ES9A 5J48A 4FXKB 4IV1B 2BRTA 4XBQA 4AVSA 1JYXA 2ES3A 2JWPA 1U5YA 1MVEA 2K46A 3HBZA 4OUMA 1MR5A 4BK4A 1WLDA 1AF9A 2G9GA 4FQ4A 4FT8A 2P3JA 1HJGA 5E8AA 2OW4A 1RUD2 4IUGA 1HB2A 1HRV1 2WNUA 4JGYC 1DCSA 1GZWA 1R1A2 4YVSA 3EO6A 3MPPG 2R042 2WNVA 5F3GA 1S1AA 4A7ZA 5FUIA 3IPVA 5CFCB 4C1WA 1VR3A 1JI6A 2QNKA 2J1AA 5BUVA 4UYBA 1HX6A 2GZWA 4P14A 3U1XA 1VBE2 4QKNA 3WUDA 2DURA 1AR91 3LWCA 3N9QA 4FI9A 3WP4A 3B9CA 1XNDA 2JDNA 1ODMA 3PUHA 1W6OB 1W8OA 2XQXA 2ZX4A 2ARAA 4BQXA 4FOVA 1RJ7A 1HQWA 1RUH2 1V6IA 2ZX1A 5F32A 1W6NA 4BMBA 1AX1A 1LECA 1E5RA 1YI7A 4TXWA 2Q30A 2RDRA 1UYPA 2RR13 3NJVA 4P9LA 3S30A 3BKZA 3T4VA 1LU1A 3AJZA 1JYTA 4NRMA 1FNZA 2HWB2 2HWC2 3ZPOA 2J1SA 4HVRA 1Q8OA 4XE9A 2W95A 2ZS6B 3BTXA 4IEOA 3M3EA 2Y33A 1BK1A 3ABZA 2EICA 2W08A 1OMIA 3AVSA 4Y4YA 3ZYHA 1KFUL 2DTYA 3CMGA 4H7LA 4LBJA 3RDIA 1MPXA 1FX5A 1YCIA 3K75B 4DQAA 4BLJA 1V9U1 2C5DA 1F4AA 2CY6A 3RZLA 2JKBA 3HNBM 1O6UA 2WN3A 2FBEA 3WX5A 2RS33 2GP3A 4IL7A 1VRH1 4IDZA 4ES8A 3CIHA 4AK3A 4IV3A 3U0ZA 3HAGA 4AAPA 5CG8A 1OOPB 1AXYA 1DLLA 2BGPA 4MXWB 3HNYM 3VZKA 4I3PA 4WVMA 2ARXA 3KV6A 3BGAA 3WCSA 3T09A 1ENSA 4ZY9A 1S0IA 1YEWA 2Y6FA 2WUHA 3IBMA 2WZPP 4B1MA 1BVP1 4JGZC 5A6QA 4IETA 1V00A 2FDGA 4LBKA 4CSWA 1H9WA 1N1TA 5A7WB 3U07A 4AEMA 3KCXA 5H9PA 2EAAA 2WA4A 1LEMA 4NPRA 2QFEA 5L73A 1QEXA 1UCXA 5FLIA 3A21A 1C3HA 1ZA7A 1JU3A 2J7MA 5GZDA 1WGPA 2YG0A 2W94A 4YZ5A 5J37A 2AYHA 4IV1C 2H6BA 1GV9A 3SH4A 3ZYGA 4A6SA 4MHRA 5FXVA 1OKQA 1HB3A 5KXCA 4AEDB 4QPWA 2RMU3 3AMPA 1COV3 3PJQA 4PDWB 2ZGOA 2VNRA 4IEVA 5AFEA 3SH5A 4XURA 1GLHA 1KJLA 2JDUA 5CFCC 4PCRA 2ID4A 4A6OA 5T5LA 1YO8A 2CGOA 2AENA 4HETA 5ANQA 4AI3A 2WINB 4UW6A 2YYOA 1B09A 5FBJA 2DU0A 4QDRA 5FIXA 5FUNA 3K77A 4QXBA 3CO2A 4JRLA 4MZUA 4FPHA 1KRIA 1UOBA 1SLIA 3PUQA 2CSGA 1F5FA 2RS51 3ME2A 2W3JA 3VLBB 4AQ6A 2PHFA 4XHXA 4LHSA 2F17A 5JOZA 1WW4A 4QHZA 1XNCA 2YGMA 4XIKA 3M8LA 1PMIA 1SZBA 3AFGA 5FZOA 1S0DA 4NN0A 1R081 4PLOA 1HQLA 1HXS3 2A6YA 5DAXA 5DDJ2 2VMDA 2JE7A 2D98A 1UZZA 4Q4Y2 2VBBA 1OUXA 2ZJCA 4OFGA 3OUJA 1IPSA 1J3PA 1CZSA 3WP6A 4AFDA 3WNPA 4TLFA 2Q5TA 2R6QA 1LULA 3AC0A 4YW3A 3KGZA 3K48A 1ODNA 2VAUA 3AMQA 1WKYA 1GNHA 1O3TA 1N1YA 1NA1A 5DAWA 1RUJ2 2O0OA 5L36A 4A7KA 1ZBE1 4I0WB 2VMFA 3MUY1 3ZFGA 4ZXEA 2FCVA 4XILA 4LIVA 4LO6B 4Y5Z0 4EJRA 1DZRA 4CDQA 5FZ6A 1ZNPA 4JKMA 2F4PA 4FPOB 4AGRA 1BYHA 1RUG1 1XE8A 2Z69A 5IW0A 4FFIA 1H2KA 1MQTA 2WS92 4Z92B 3UGGA 1H4GA 2W1QA 3HN1A 1OOPC 1X9TA 2QBXA 1O59A 2MEV3 4OHXA 4QU1A 5EXOA 2BNOA 1RITA 4NOTA 3ACGA 5K0UB 2GH2A 1MS3A 1CZTA 2RE9A 3KQ4B 3USSA 2WNOA 3POEA 2WQZC 4Y5SA 4YW4A 1FXZA 1EAH2 1K5MB 4Q8KA 1LOFC 2R072 2RDNA 1GFF2 4ZPIA 5DAQA 5FJKA 2WAAA 3CJXA 1C5IA 2D3SA 4PF1A 4P00B 2EAKA 2CAVA 2DDUA 4L2NA 1WBFA 4CZSA 4H14A 1QJU1 4GWJA 4NE9A 4CDWA 3C7EA 5APAA 2AEZA 1UOGA 3K3NA 3S5AA 3RYPA 4BCUA 1RXFA 1VIWB 5D1IA 2DF7A 4WM8A 5C70A 1DQ4A 2XHKA 3C8XA 5L9BA 1GWLA 4IEUA 4BOWA 5BYNA 2JDYA 1V70A 1EP0A 4PDWC 1WLTA 1YJKA 5LRRA 1R1A1 2VY0A 4XXAA 3VBUB 3M2MA 3VKLA 4F8AA 1REDA 3PVOA 3NJZA 1RUI1 3LSEA 1FT9A 5CZKA 2PQSA 3MW3A 2XBO3 1SFPA 5KXEA 1DDLA 4IEPA 4XVHA 1US2A 3O1VA 4Q4W3 1O8SA 5I0SA 4KBBA 4YRDA 1OHFA 1SPPB 2HEYF 2ZGNA 1XJAA 3EBRA 5K9YA 1J84A 3HQXA 4A3XA 2ZZQA 3KWVA 3ZMOA 1IKPA 2QDNA 2FDFA 1RUH1 5LB6A 2R32A 5T50A 4JHTA 5JSOA 2OPWA 2QQUA 4CEWB 2ET7A 2J1UA 3NL1A 1VMFA 4YGDA 2ZHLA 3JD73 4YZ4A 4ZKTB 2HWB1 4FCAA 1QY4A 2GMPA 3I2JA 1AUYA 1Q43A 1QJY1 2E7AA 3WP3A 2VE1A 3PURA 3V56A 3LSDA 4BB3A 5K8SA 4MADA 4GQ7A 2HEVF 2WO3A 3LPFA 1EV12 1CN1A 2NPIA 3BIWE 5A3TA 1YFXA 1PMJX 3MW2A 4YLZA 3TWIA 4LBMA 2YXSA 4KU8A 2V5DA 1PNGA 3UESA 2NN8A 1FMD1 4D6SA 1H30A 3QCWA 3WNKA 1DGWX 1QJEA 4N43A 1UN1A 3I97A 2VUCA 5DAVA 3B93A 5K0UC 4HOOA 3NV3A 3OYWB 3T2PA 4CTEA 4N9HA 1MS8A 1PM7A 2XWBB 3MPBA 1CQ9A 1AR73 2QDRA 2WNUB 4YVSB 5L9VA 1ULFA 3WEZA 1ULDA 5JI7A 1K5MC 1O3RA 1IOAA 3IPVB 5DQ0A 4BA6A 4DEVA 2XLFA 4PBOA 1QH7A 2D3PA 1E5SA 3NMBA 3E5QA 4L99A 3T0DA 1NLQA 4A3ZA 4FTEA 5FYMA 2IWGB 2A7AA 2EIGA 4E4ZA 1I6XA 4LK7A 4AGVA 3I49A 1VAVA 4NWWA 3WNMA 1ZRFA 1CVNA 3FLPA 3VBHB 1GZTA 4JQRA 5FK7A 1BBT3 1GQHA 5DG1A 1YHFA 4XF3A 5LK7B 4M0NA 3VKMA 3KMHA 4GJYA 4MGIE 3LPGA 1G9BA 3L9JT 5EHDA 1RUD3 3KZ4C 4BE3A 3VBUC 1IPKA 1RL3A 2R043 4DRVA 3M4FA 1JYVA 1YIPA 1H2NA 1BQPA 2PHLA 2WZR2 1LOEA 1OQ1A 2C24A 2HYXA 3OTFA 2OKXA 3WP5A 1V6JA 1VBE3 3LCPA 4UT5A 4BQWA 2GC1A 1ONAA 1HIXA 3SISA 1O4ZA 2XUMA 1ZBA2 1YJLA 3R6SA 4AR2A 2FZ1A 1XNAA 1PZ8A 5A33B 3ZR6A 2QZ2A 3PMEA 2H0BA 5JXIA 1GICA 5FQ0A 3ON7A 3ACHA 4CEWC 2Y60A 2VQUA 5DDJ1 3BYWA 4JVAA 3RRDA 1DQ0A 2BUKA 5ERLA 1S0JA 1VE0A 1W2AX 2E7TA 2HWC3 3NAPA 3T4HB 1X8MA 4Q27A 3ZVXA 3RYRA 5JVVA 1D4M2 2BZDA 1OH3A 3LA3A 1CAXB 1JBCA 1ZVFA 1ZZCA 3OF1A 1FYUA 3AKRA 3VD9A 1RUJ1 1RUC3 3FE5A 3O0VA 3B00A 1LHUA 4X6QB 1QDCA 4OZXA 2E33A 4MO3M 1CONA 3I2IA 3ZN6B 2D6LX 5DUXA 1ULCA 4KMQA 3N4MA 2PQQA 2W39A 2WS91 5FMOL 3T2QA 2ZX0A 4GB33 1XYPA 3V65A 3M3IA 3O7OA 3P6BA 5LBBA 2VTXJ 3KSCA 3OD0A 5ACA3 1OUSA 5C3SA 3VBSA 2Q1MA 4QGMA 4B1LA 1AR61 2P3YA 1LNSA 1EAH1 1VAMA 1WUVA 3VD5A 2QUOA 1PVC2 4ASLA 1NQDA 3T1MA 4MX3A 3TEYA 1GWMA 2PN5A 1OSGA 5IK5A 3WDWA 4P08A 3NJXA 1UKGA 5JMOA 5BNPB 4JTOA 1W8UA 4K21A 2RR12 2BPA2 1JOBA 5CG9A 1UMZA 1HB1A 4M3CA 4XW3A 3VBHC 5JZGA 4E9KA 4CEYB 2WFF1 1AXZA 5CADA 4RGGA 1J3RA 1N3QA 1JYWA 1OVPA 2Q1ZB 4IEXA 2MNGA 4CDXA 4QB2A 5FPBA 2W68A 2A6ZA 3J8F1 1QIQA 1VBB2 3D4KA 3PUAA 2XJPA 4JQTA 4QB6A 1AL0G 2R7EB 4FVVA 5IFTA 1QH6A 4RR3A 4XDPA 3UJQA 1H6YA 3B9IA 3ITQA 3JQWA 3PHMA 4Y22B 1JMUB 5T55A 3DXUA 4AAXA 1ALYA 2JJ6A 2ZHNA 5FWEA 4FPGA 2P6HA 4JAAA 1QDOA 2GC2A 2VNVA 5KBFA 3LQCA 2G9FA 3VKOA 2CGPA 4JC1A 4CDQB 4C91A 1IG0A 2YHJA 1HV1A 4NHMA 5FYTA 4DUWA 5J1XA 2QQKA 5A3WA 4M3CE 1XU2A 2G4IA 4CP0A 2GH8A 3WUCA 5I91A 3PU3A 5FPXA 5C4WA 1O5UA 1JYCA 2VZPA 3O1RA 2DWRA 4FPLA 1W03A 4QQOA 5FZBA 1K42A 2ZGMA 2ZEZA 1HB4A 4J25A 4NRQA 4Q4Y3 5DZGA 3BPZA 1UIKA 5FO8B 5LW9A 3FL7A 1NYWA 4RQPB 2QJVA 4GMP0 2OX0A 1F9KA 1JYIA 5FZ7A 1LGCA 3CBNA 4R52A 5GALA 3TAYA 1JOJA 2Y0OA 4BU2A 2JDZA 4G3YC 3MIFA 2D97A 3GZUC 1OPOA 3NJYA 5C5UA 1RB8G 4QXKA 1EV11 1R64A 2D6OX 5FYUA 3WSOA 4KH9A 1RUNA 2JEMA 1O7FA 2W52A 1E5HA 5I0TA 4FPKA 3VBOA 3NSTA 2ZX2A 2XPJA 1D2SA 1D4VB 4FTSA 5DPNA 5GLUA 1KXGA 3E97A 4FTBA 1OF3A 4LKFA 1UNBA 2AGSA 3USUA 2XWJB 1CAUB 3AMNA 5B2GB 1WCUA 4RHV1 2R073 4LIUA 3TEXA 4GALA 3K2OA 1XYNA 5DUUA 3LAGA 5FREA 4XF9A 3ZOIA 3WQ0A 5BNPC 1S0GA 4P9GA 1K45A 3TNPB 4ORFA 1HXS2 4XTMA 4EWEA 2ET1A 2LUWA 1HW5A 4G4FA 3NV1A 4COVA 3ZSEA 2B42B 2QTWB 3IB3A 5EJZB 4CEYC 3LFIA 1DQ2A 3RJ2X 4CDUB 5IAXA 1NY72 4JV4A 2XKPA 1AYN1 3DYPA 4HFSA 3FUQA 2CWSA 4ZU4A 1U5ZA 1S0FA 3HT2A 2ARBA 3HPNA 4GH4A 4LORA 4PHZA 4D7TA 4QMAA 3MFCA 2SBAA 2XJTA 4QPIB 4LBQD 2XKOA 1F15A 1AZDA 2VCAA 3APBA 4YG6A 4JDNA 2Q8DA 3CZUA 2VUDA 2WC2A 4QKBA 1D0GA 4QXCA 4GIQA 4XUQA 3KT1A 2Q8EA 1Z0HA 3SQOA 1TME1 1ZBA1 4P9WA 3K4ZA 1DGLA 1VAKA 4PQ9A 4CYDA 3VDAA 3TEZA 1NXMA 5SV5A 1I5PA 3BTYA 4TWTA 2X5IB 3TRSB 2VL4A 2X53S 1UOFA 2P6CA 2V5YA 3O0WA 2YROA 3OUIA 4G9SB 4R4ZA 4AF9A 1NE6A 2CU5A 3K3OA 4GMP3 4PLMA 1VBA1 3NNLA 2C9AA 3AJYA 3M3OA 4XUTA 4BQ4A 3I3MA 1RTVA 1MEC2 4OZOA 4RQPC 1I9RA 2QQJA 3VGIA 1US3A 4XMAA 1NX9A 3NV4A 2X05A 5BNNA 5F39A 2WSUA 4S2HA 5K4LA 2W46A 1SACA 1CESA 3PJYA 4JKLA 4LO4B 3VHOA 3T0BA 2HLEA 4EN6B 1JHJA 5LBCA 4CCNA 3F2ZA 5F1RA 1BXHA 2VZOA 1WLCA 3DN7A 1X50A 3OBRA 1EY2A 3MGUA 4D69A 2C6SA 1YRZA 2W1WA 3ES1A 5D2AA 3OGJA 5JLVA 3POWA 1RC6A 1OLQA 1LAJA 2ZZJA 3SKJE 3POJA 5F8PA 3J7MA 2RDSA 1ZM1A 3ACFA 4PT6A 1SG3A 2XBO2 2YDEA 5C6CA 4DFSA 5FXZA 4AQTA 4WM7B 4YARA 1T2XA 1IG3A 2FZ2A 3A23A 4OMDA 1AX0A 3MDPA 4CCOA 2QQMA 2WQ4A 3VBFA 4DUXA 3KD4A 4FPYA 3BI3A 1UU6A 1M4WA 4GAZA 1HDKA 1CAWB 5H9SA 4FOWA 4YW6A 3VDDC 1SLTA 3IAPA 1FNYA 2X10A 2D3RA 3ZXDA 2RR11 2W9XA 1ND3A 1LESA 2WWSA 1UIJA 3ZN4A 4CDUC 4BXFA 2RM23 4GKXA 5JSRA 2YFZA 3D3AA 5IAVA 3O1OA 2VNOA 3SC7X 2ZGUA 2JDKA 4WZCA 2UYAA 4HG6B 4KWJA 5FYBA 3U78A 5GZGA 1HRI3 2FD8A 3MV01 2A71A 4QPIC 2EIEA 4A7YA 4XFFA 5E89A 5FYZA 4YM1A 5F6KA 4EV0A 4N53B 4NHLA 5IWFA 5A7PA 3N7JA 2WZR3 2GN3A 1SLAA 3MLJA 2NYYA 3D0SA 1F5JA 1GR3A 2PA7A 3AMMA 1F4HA 2AUYA 2GNTA 3O1TA 2BU9A 3DKWA 2XH6A 4ONUA 2VNGA 5FZ8A 2RS31 3TN92 1YYNA 5A3UA 5A80A 4BYYA 4ASMB 1QQP2 3I59B 1MVQA 4MVTA 3VB9A 2DYCA 2X5IC 4AVAA 4UW3A 2QQPA 4Y20B 2Q0AA 1AR72 3I2OA 4P9YA 4JTNA 3SNMA 4FP3A 5F5IA 4IEQA 4N8MA 1B35A 1UZ0A 4ZS3A 3ZM8A 1Q5OA 2VGDA 5A3OA 1STMA 5LBFA 3VBSB 2Y26A 4HXCA 3LF7A 1JZ8A 4AGGA 4KQ7A 1GWKA 1TE1B 3I2DA 3THPA 1GNYA 5A6YA 1D4M3 4NAOA 1NT0A 2WLPA 4ISRA 4RA0A 5G05L 5SV8A 1K12A 1U0AA 3AZVA 4TN7A 1JU4A 3FWEA 4J6GA 2GNBA 3AYAA 3FBYA 5JDBA 3M3QA 5F9TA 5IVVA 1N47A 1W6QB 3B69A 4AXOA 2A3WA 2K9ZA 2WA3A 3P5BA 1CWPA 3CL1A 2D6KA 4META 4XDOA 2RMU1 1COV1 5KXDA 4PIXA 1XBFA 2VQAA 5JOXA 4R8HA 3NO8A 1W28A 3KCCA 4KL1A 3UJOA 1R093 5FYIA 5F3EA 1PK6A 4L0PA 1CZVA 3WY6A 1DZTA 2KR2A 4RFT0 3RMYA 5C8CA 4WM7C 2LM3A 4FBFA 4LT5A 1HN0A 4EQVA 4PI0A 3W20A 4HLTA 4E8DA 1Q3EA 4X8PA 1NZIA 1DF0A 5L7OC 2VOTA 1PVC3 2FDJA 5LCWL 4KG0A 2FQPA 3Q8BA 4LA2A 3T30A 3PL0A 2V73A 4W65A 1C28A 2D6PA 3V0BA 2VZUA 1UW8A 2VMGA 5F5QA 4I30A 4OVEA 4DEQA 1HXS1 4YZ1A 4DB5A 1CJPA 3RNSA 3DF0A 3NKGA 1CIWA 3ZX7A 1OBNA 2IUWA 1NY71 1UY0A 1H2MA 2BEOA 2J42A 5GKAC 3S57A 2PTMA 1IQDC 4PLNA 4BH9A 1UYZA 2ENRA 5EP9A 3WDVA 2JG8B 2P17A 2XDVA 4CRQA 2JDMA 3WW3A 2AACA 1RUC2 4N53C 2I2SA 5BPXA 1ND2B 2BBAA 3EQEA 4LE3A 1VBB3 1QOOA 4R9BA 4AE2A 5EZWA 3V0AA 4Q4X3 2A1XA 4Q0VA 1L7QA 4N7IA 3FC0A 4YVWA 4AVTA 3L2YA 4S2FA 5C3RA 4QHBA 4AI9A 4XFIA 2MHFA 4YGBA 4A4AA 2RJKA 3CQOA 3MHZA 2VW2A 1GP5A 4ZONA 3CLPA 3AB0A 1GOGA 2ORXA 5EIYB 3Q8EA 3WXPA 1CPMA 2BGOA 3GDBA 1LENA 3GXUA 4GB32 2DCKA 2VUAA 4MGSA 5BY5A 2BNMA 2MEV1 4W6YA 1C57A 2HWF3 3MFAA 3PUIA 5ACA2 5H9RA 3O0XA 1SLBA 1UYYA 1XPWA 5LWBA 2A6WA 1S0EA 2WR9A 1V6LA 3GF6A 1A6CA 5A32A 3H8UA 5A6ZA 3QH7A 1ZRIA 3EB7A 1BZWA 2KD7A 3IDBB 2PHTA 3ALQA 2NMNA 3IDCB 1NCRB 1MS9A 3USUB 3SCFA 4A45A 1H8TB 3PLQA 3ZXLA 4Z1VA 1Y43B 4HVOA 4RS5A 3IWZA 3C7HA 4PQQA 5JXHA 2CHHA 5A1FA 3ZR5A 3J26N 4S2DA 5JR2A 1ASJ3 1Z78A 1OA2A 1REFA 3PNAA 3AL6A 3SMHA 3DPRA 1ZRCA 4LBQA 1LOGA 4DMIA 2E7QA 2PHRA 1WA4A 2XXZA 1SFNA 2OQ7A 4D6QA 1S0BA 4SLIA 5FK8A 4BIFA 3U4SA 4C0BA 5JMCA 5JPMB 4CU8A 4URAA 5GZFA 1XXNA 3I2FA 2W92A 2CGNA 5E6HA 5FZKA 1XRUA 1W6MA 2VVEA 3W59A 2XBO1 4XABA 5KWRA 3BU0A 2Y8KA 3BN6A 2C4XA 1UY4A 2PHUA 4R9DA 1CD3G 4Q4W1 3M7AA 4CP9A 4L92A 4LO8A 4CCMA 2C9KA 5C33A 4IERA 1ULPA 3I2GA 1LOAA 4MOAA 5GM0A 2BQPA 3N9MA 4R9AA 2DV9A 2QKDA 1W06A 4GULA 5FY5A 5C3OA 2E51A 2XOMA 3JD71 3GCWA 4Q4V3 5DN2A 4QGNA 4Y1XA 4NMIA 3JBG3 5T3NA 2JG8C 1PGW2 2W5FA 5LZ6A 5J7MA 4CUAA 4YG3A 3NQHA 2BDRA 4QU2A 4OI1A 4Y24A 3VZNA 2BVBA 1J1LA 1ND2C 2RS12 3MICA 1NG0A 4UXAA 5FZDA 4B3NA 5A1LA 3I3EA 1W05A 2E63A 4MSVA 3H9AA 5FV3A 5D21A 1H1AA 2HWD2 3I2HA 5FFOC 4MYEA 1DYPA 5KXBA 2UWBA 4YM3A 2VZQA 2O14A 2ATFA 1LOCA 1AR83 4BLIA 1UL9A 5CKNA 1ENQA 3RI9A 2DVGA 3LB9A 5AC93 4MLOA 1LGBA 1AR71 4COZA 5EJ3A 4B4PA 4FFHA 1W2OA 2VTXA 5FY9A 2L9LA 2YB7A 4JDMA 5IT6A 2WO7A 4YGEA 1NCRC 3X29B 3ZIXA 1A3KA 1BKZA 1WCQA 1PO13 2JICA 1H8TC 1MEC3 1YQ8A 2VECA 5FLJA 4KI5M 5IUQA 3POFA 5FMOS 4MV2A 5FY7A 1OI6A 3I3DA 4E4HA 1UZWA 2B39A 2PYTA 4LKEA 4CCJA 2GMMA 2JB8A 2BP6A 5D8AA 4TLGA 2VVDA 1BBT1 4OCTA 1AL22 1GANA 2OZJA 1YLLA 2VU9A 3LEMA 1W6PB 1ZYBA 4XCAA 4AEDC 1VB4A 1POQA 1ND3B 4QPGB 3VZJA 3N9PA 2G9ZA 1JODA 5LA1A 1RUD1 5FZLA 4XZPA 2YFUA 2PMWB 1LEDA 1Q8PA 1N1SA 1W8ZA 2R041 4E2QA 3OY8B 5E16A 4YW7A 3EHKA 3ECQA 1NCQA 5I0UA 1MS5A 3K46A 2WZ8A 1VBE1 3ZIWA 3WDUA 2D40A 2XJVA 5FYCA 1XOYA 5F5CA 3S6PA 4AL9A 1DHKB 3MYXA 1W0NA 2R062 3DGTA 3H3UA 4KU7A 4V2VA 1L3JA 2BOJA 4AHXA 2VMHA 3FLTA 1BEV3 1OFNA 1J3QA 2WL1A 3LKJA 1DQ1A 5CFDA 3O12A 3ZN5A 1GOFA 1NUKA 1X36A 3H8RA 2HWC1 4QXHA 3FJSA 4YFZA 5GZCA 2CL2A 4OUEA 1DQ5A 2LRPA 2DUPA 4LLFA 4Y3OA 4A44A 2W47A 5I0DA 5FYYA 4XAEA 1JZ6A 2OA2A 2ZPXA 4PF5A 3VHPA 4AFAA 1RUC1 3H1WA 1QJX3 1XB9A 3BU7A 3ZYPA 5FPLA 4LO5B 4A41A 1LCLA 4BM8A 2JKXA 4LMFA 3E1F1 2NQYA 2Z79A 2NLRA 3WD5A 2FCTA 4KG8A 4NHKA 3TN93 4ATEA 3H0OA 1SHWB 4CCKA 5C9AB 1QQP3 1QXJA 4GB31 4FAHA 1YQ6A 4MGKE 5LA0A 4YGCA 2YPJA 5IHRA 1JUIA 1XE7A 2Z4FA 3ZO0B 1S2KA 2PLV2 3WF1A 5ACA1 1GZWB 1WMFA 5FZMA 4OHZA 3RMXA 4DO0A 2WNVB 3AFKA 4LQRA 4QB1A 2A75A 1ST8A 4BDVB 3S0MA 4LBLA 5FZ3A 3U11A 3ZFFA 4DZGA 1RXGA 2AZ5A 4NR1A 4YFWA 5GLVA 5LASA 4LUMA 4Y1VA 3I4IA 3ZDVA 2OIIA 5FP7A 3RS6A 4WVZA 2I07B 2WO2A 4UOJA 1MZ6A 4D0QA 2C26A 1YFYA 2R1BA 1G9AA 3RZGA 3HOBA 1MZFA 2R1DA 2RM22 2VW0A 1UPIA 5JOWA 5HXVA 1RGSA 1W6NB 4AI0A 2D5HA 1RIRA 3E5UA 1RMU3 1VBD2 1ZA4A 2IVIB 3JU9A 4Q8LA 4QPGC 1HRI2 2OUJA 5FPUA 5JCTA 5LA2A 4MXVA 5FBZA 2VH9A 1UMIA 2E26A 5A6XA 5BNOA 3MV11 5FZFA 3JB4C 3H1MA 4Y33A 1LU2A 3OBZA 5F2WA 3ZFEA 5C8WA 1SDDB 4NPLA 3WOGA 3ZXKA 4IEWA 4O61A 4XYXA 1IS5A 5JR7B 4B7KA 2DTWA 3MIHA 4CCEA 3DUIA 2ADDA 1GQGA 5FCCA 2CDOA 4YG0A 4NPMA 5G04L 3H3ZA 5L9RA 3RZJA 1AHSA 1FOD2 5KHIA 1LJ7A 1LODA 2HWE2 4JGYA 2WYFA 3GZEA 3OGRA 2D44A 3GYDA 1UY2A 1W9WA 3OBTA 2BFUL 3FMGA 1MACA 4IV3B 5FR3A 2I45A 2WWUA 3RWKX 1LHWA 5IVFA 5B4NA 4D94A 2ZKLA 5FAXA 4Q4Y1 1PX3A 2VOWA 5FZEA 4WVMB 5FMDA 4QPYA 4AHZA 3VBRA 5A32B 3VD3A 1OF4A 1UOJA 3KVAA 3PDQA 4OI4A 5CBLA 1D7PM 4U36A 4NJ4A 4GZ9A 1W2TA 3CKHA 3OEBA 2EIBA 1JZ4A 3QD6A 3RQ0A 3FFQA 1VALA 4AFBA 3PVEA 1IQAA 4XETA 3LZZA 2VG9A 5C9AA 2VW1A 1YI9A 3NWKA
chains in the Genus database with same CATH topology
4ZS2A 3T3YA 3BU0A 3H8RA 4QHOA 4IE5A 3BTYA 4QKFA 3BKZA 3T4VA 3RZKA 4NRMA 4NIGA 3I3MA 3I49A 4MG2A 3BTXA 4CXYA 4RFRB 4MGTA 4ZHNA 2FDKA 2FDHA 4IE0A 4NRPA 3I3QA 3H8XA 2FDJA 3RZLA 3O1RA 2FDIA 4NIHA 4NRQA 4IDZA 3BTZA 5F8PA 3S5AA 3KHBA 3O1SA 2IUWA 3RZGA 3S57A 3H8OA 3RZHA 2FDGA 4QKDA 4CXWA 4IE7A 3BIEA 3T4HB 3O1PA 3O1VA 4NPLA 4O61A 3O1MA 3O1OA 3BUCA 4NIDA 2FDFA 2FD8A 4NIIA 4NPMA 4OCTA 3RZJA 4IE6A 3RZMA 3KHCA 4JHTA 4CXXA 5DABA 3BI3A 4O7XA 3O1TA 3O1UA 4IE4A 3LFMA 3I2OA 4NJ4A 4ZS3A 4QKNA 4QKBA 4NROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZS2 A;  3T3Y A;  3BU0 A;  3H8R A;  4QHO A;  4IE5 A;  3BTY A;  4QKF A;  3BKZ A;  3T4V A;  3RZK A;  4NRM A;  4NIG A;  3I3M A;  3I49 A;  4MG2 A;  3BTX A;  4CXY A;  4RFR B;  4MGT A;  4ZHN A;  2FDK A;  2FDH A;  4IE0 A;  4NRP A;  3I3Q A;  3H8X A;  2FDJ A;  3RZL A;  3O1R A;  2FDI A;  4NIH A;  4NRQ A;  4IDZ A;  3BTZ A;  5F8P A;  3S5A A;  3KHB A;  3O1S A;  2IUW A;  3RZG A;  3S57 A;  3H8O A;  3RZH A;  2FDG A;  4QKD A;  4CXW A;  4IE7 A;  3BIE A;  3T4H B;  3O1P A;  3O1V A;  4NPL A;  4O61 A;  3O1M A;  3O1O A;  3BUC A;  4NID A;  2FDF A;  2FD8 A;  4NII A;  4NPM A;  4OCT A;  3RZJ A;  4IE6 A;  3RZM A;  3KHC A;  4JHT A;  4CXX A;  5DAB A;  3BI3 A;  4O7X A;  3O1T A;  3O1U A;  4IE4 A;  3LFM A;  3I2O A;  4NJ4 A;  4ZS3 A;  4QKN A;  4QKB A;  4NRO A; 
#chains in the Genus database with same CATH topology
 2ZGL A;  1HKD A;  2TBV A;  4EZH A;  2P37 A;  3VDC A;  1GOH A;  4Q1P A;  5C9A C;  3DPR B;  3ATG A;  1R09 2;  4N7U A;  4LBQ B;  3N7M A;  4B8E A;  3MLK A;  4HON A;  3TNQ A;  1ZZ6 A;  2WNU C;  1U5I A;  4YVS C;  3IT8 A;  2VC9 A;  4EWA A;  1NAE A;  2WNV C;  1KS4 A;  2VVF A;  1JOP A;  4YZ3 A;  1FPN 2;  3DCQ A;  4O9E A;  1RJ8 A;  3AYD A;  1ZRD A;  3URF A;  3P3N A;  2R07 1;  4I09 A;  2XLG A;  5IYY A;  1YWK A;  4Y1Z A;  4YZ2 A;  1I3H A;  2ZGS A;  4IEY A;  2OYZ A;  2V09 A;  3DEM A;  2B9U A;  2QQL A;  4YM0 A;  2FHR A;  2D43 A;  1OFS A;  1KS5 A;  4CP9 B;  5DG2 A;  5GJ6 A;  1DBN A;  4ZHN A;  4OI2 A;  1T6G C;  1DGR A;  5FZ9 A;  2XUE A;  4DRR A;  3IN9 A;  4LEJ A;  4NUB A;  1J1T A;  1UY1 A;  3R0R A;  4ISQ A;  4JGZ A;  3NNJ A;  5FYH A;  1W3V A;  4HVQ A;  4L97 A;  5FZO B;  2B46 X;  2ZHM A;  1A8M A;  3C3V A;  1PIV 3;  4HN0 A;  4XJW A;  5FP8 A;  3KCY A;  4V1P A;  2A5Z A;  4CE8 A;  5FPA A;  4QD2 A;  4BQ1 A;  1QNW A;  4QX5 A;  3CJI A;  2VD7 A;  1G9D A;  4Q4X 2;  1PVX A;  3IKW A;  2TUN A;  4YW5 A;  4OUS A;  1NA1 B;  1LHV A;  4LXL A;  3LEK A;  1PGL 2;  3III A;  4W6W A;  3D5O A;  3PTR B;  4QWN A;  3ZFG B;  1HQN A;  2PHD A;  1MS1 A;  1WZX A;  4AWD A;  3SEP A;  3ZYB A;  4COY A;  1TMF 3;  3VZL A;  5FP4 A;  1LB2 A;  1GNZ A;  2HWF 2;  5CFC A;  2DVF A;  4RGA A;  1I5Z A;  5HCH A;  1XSR A;  3N3H A;  2BNN A;  2QQI A;  2W1U A;  4IV3 C;  1JTZ X;  1MQT B;  2ARE A;  3POG A;  1TNR A;  3ZYJ B;  4BPZ A;  3UKV A;  4F7Z A;  2Q4S A;  4GMP 1;  3TOJ A;  2YY1 A;  3AP5 A;  1W6O A;  1SCS A;  2JB4 A;  1UMH A;  4Q0U A;  5T5J A;  3KV5 A;  1XNT A;  3UL2 A;  5H9Q A;  2WLQ A;  2W1S A;  4YPJ A;  2YU1 A;  3OD4 A;  2Y6J A;  1O3Q A;  1WW6 A;  2OS2 A;  4NII A;  3POI A;  5E88 A;  3VD7 A;  2GU9 A;  2AC1 A;  1ASJ 2;  2RS1 3;  4LUK A;  3WVJ A;  2HYK A;  2V4V A;  2ETE A;  3NNM A;  1BCX A;  2D6N A;  5LA9 A;  2ZEW A;  5A3M A;  3B3Q E;  2EXJ A;  1KDM A;  2A6V A;  4FP2 A;  3GBW A;  4CDW B;  3PUS A;  4FSJ A;  2HWD 3;  2JE8 A;  2PEL A;  1POV 0;  1SMV A;  2ZMN A;  1G86 A;  3DPR C;  5FKC A;  2ZGR A;  1CX1 A;  2IZW A;  3AVR A;  4K20 A;  1QMJ A;  1WCS A;  4LOT A;  4Q2F A;  4WM8 B;  4IND A;  3VUO A;  1UY3 A;  5FZI A;  2VCM A;  1OLM A;  2DCJ A;  3UK9 A;  3OGG A;  1C8M 3;  4XJ9 A;  2RVA A;  3IMN A;  3PU8 A;  3ILN A;  1VBC 3;  5J98 B;  3RVH A;  3LEG A;  1WA6 X;  2YBK A;  2YGL A;  3EMR A;  3S7E A;  4BIS A;  1NCQ B;  3DYO A;  4RYD A;  1VB2 A;  2XVG A;  5JI9 A;  3C2U A;  5F3C A;  1ENR A;  3LDR A;  1OOP A;  4E4D X;  4K8F A;  1BHG A;  3T3Y A;  1M06 G;  1HRV 2;  4CP2 A;  3N9N A;  4XUO A;  3RG0 A;  2B7Y A;  2WWJ A;  4XJ8 A;  4CA9 A;  4IE5 A;  2Z2S B;  2HEW F;  1QF3 A;  3QAC A;  2RM2 1;  3ZSJ A;  1W0P A;  1LOF A;  2ZGQ A;  3UGF A;  1AL2 3;  4LHL A;  4Q4V 2;  1SQ4 A;  1XYO A;  2D6M A;  2J22 A;  5A7W A;  2BWC A;  2JDP A;  5F2S A;  3JBG 2;  5CFD B;  4I2O A;  2C1F A;  4F83 A;  1HRI 1;  1NQJ A;  1UX7 A;  3RZK A;  4B29 A;  1HV0 A;  5DAP A;  5A7Q A;  4EN0 A;  2Y34 A;  4NAM A;  1RUE 3;  5IK8 A;  1OLM E;  4K1Y A;  4XHB A;  1O4Y A;  1NXD 1;  4HZF A;  4C1X A;  4BJ0 A;  2WZR 1;  3DV8 A;  3A0K A;  3GGL A;  3LEI A;  5CB7 A;  5IK7 A;  2VOK A;  1NA1 C;  2XG3 A;  5BXX A;  3T1L A;  2TNF A;  2ZXQ A;  4X8N A;  5A7O A;  1C1L A;  5DUV A;  1OXC A;  2WDB A;  3ZFG C;  3CDZ B;  2WKK A;  4GJZ A;  2VZV A;  4PDW A;  5IVE A;  2R06 3;  4I02 A;  2WT1 A;  1AR8 2;  3JUU A;  2X29 A;  4UFK A;  1W90 A;  5FO7 B;  4CDQ C;  4E8C A;  1X82 A;  3H8X A;  1G9F A;  5GLT A;  1W2N A;  5AC9 2;  2D93 A;  4L11 A;  1AXK A;  2WT2 A;  4LR4 A;  4WV8 A;  1MQT C;  2QVS B;  2R16 A;  4J1X A;  1F2N A;  1K5J A;  3IMM A;  4N43 B;  3S5Q A;  3ZYI B;  4IGO A;  3N9L A;  2ILM A;  4OUL A;  5A3P A;  5DMY A;  1QOS A;  3ACI A;  3RZZ A;  4CU9 A;  1QWR A;  3KHB A;  4Q0S A;  2EVX A;  1HLC A;  1PO1 2;  3J4U H;  1WLW A;  4LO7 A;  5FY0 A;  1YUD A;  3D8C A;  1D4M 1;  1V6K A;  5DZE A;  3WW4 A;  3RZH A;  2J1V A;  2GDF A;  1MS0 A;  3OPW A;  5FOB B;  1RUO A;  4OHV A;  3PIG A;  2LTN A;  3J7N A;  1WW7 A;  2GN7 A;  3P1I A;  3LIG A;  1H1I A;  1POV 3;  5EWS A;  5LAT A;  3RFR A;  2XJQ A;  4H2A A;  4CDW C;  3WF2 A;  3BIE A;  1YNA A;  3WDT A;  4XJZ A;  4AW7 A;  3ROU A;  2E31 A;  4P02 B;  2GND A;  3IZO A;  2Y38 A;  4I0B A;  4XFB A;  4WM8 C;  3VL8 A;  3RYK A;  1W9T A;  4DY5 A;  4ET7 A;  1JS9 A;  2ZEY A;  1R09 1;  2E9Q A;  2YU2 A;  4HPK A;  5CKM A;  1WBL A;  2PLV 3;  2XJS A;  4XUN A;  4Q26 A;  1H9P A;  3FUO A;  4AI1 A;  1E5I A;  4CCD A;  5HXM A;  3ZFE B;  4GKY A;  3FFZ A;  2E32 A;  2DVA A;  1PVC 1;  1OPM A;  5F5A A;  5FP9 A;  5M0T A;  2R30 A;  4O7X A;  5FP3 A;  3EYP A;  1BEV 2;  4XOG A;  4OQ9 A;  5I93 A;  1PNF A;  2HH9 A;  2OQ6 A;  3R4U A;  1KFX L;  3ILR A;  2GNM A;  3QOP A;  1OD3 A;  3O1U A;  3IIA A;  2HBU A;  1Q56 A;  4IE4 A;  1K5M A;  5LRS A;  4QGL A;  4C0H A;  2NMO A;  1UWW A;  5FQ0 B;  1SFY A;  4D7Y A;  4CVU A;  5CFD C;  3ETQ A;  2IXC A;  3NRU A;  4QX2 A;  1VBD 3;  3ZXA C;  1WMX A;  5J96 B;  5KHJ A;  2K0G A;  4Y5T A;  1S2E A;  1SBD A;  2RS5 2;  3M70 A;  1OKO A;  5ANN A;  2IXK A;  4AG4 A;  3NAP B;  1QJX 2;  4HAN A;  5FDB A;  1WCK A;  1VBB 1;  4DUV A;  3VBR B;  3WV6 A;  3S7I A;  2ZAC A;  4Q4X 1;  5BV6 A;  3OJB A;  4HSJ A;  3AX4 A;  5HI0 A;  4K3U A;  4I0A A;  1DQ6 A;  4QHO A;  1K3I A;  3BCW A;  5ISL A;  5C71 A;  1PGL 1;  4YWA A;  4QX7 A;  1GMM A;  2IXI A;  2DU1 A;  3ZYR A;  2XGX A;  1DZQ A;  1OC1 A;  1FOD 3;  5CVR A;  5FYS A;  2JDH A;  2HWE 3;  3VBU A;  1G9C A;  1SEF A;  3M1H A;  4Q5O A;  5EYY A;  3O5S A;  1OH4 A;  5AVA A;  3RSJ A;  3HJR A;  2HWF 1;  2JD9 A;  3UET A;  1W3X A;  3N7K A;  1XNK A;  4H55 A;  4KNC A;  4XQW A;  4A2U A;  4HKL A;  4XEZ A;  4NIG A;  4N43 C;  4OHY A;  3NVC A;  3AKQ A;  1NZC A;  4MG2 A;  2IC1 A;  3B01 A;  2QZ3 A;  4XFH A;  2Y64 A;  5DUW A;  4AHY A;  2ADE A;  1SPP A;  3UKN A;  3HIF A;  2EXH A;  3FN9 A;  4KWU A;  4CU7 A;  1Y3T A;  2SLI A;  5TSW A;  2AEY A;  4NIA A;  5IAT A;  2IXH A;  1RUG 2;  4LK6 A;  1X33 A;  4ITC A;  5A3L A;  4AVC A;  3MO4 A;  2CDP A;  3OG2 A;  4MGZ E;  1PO2 3;  4CEW A;  1UZV A;  1VP6 A;  2H6C A;  1ASJ 1;  2P34 A;  3BTA A;  1I1E A;  1W8W A;  1DGW A;  3ZXF A;  1RMU 2;  2EF6 A;  3U14 A;  1AVB A;  5E1R A;  1KDK A;  2ZGP A;  4M3C B;  1KD7 A;  5JZG B;  4DIN B;  3WQ1 A;  5JWP A;  2R0F A;  4UW4 A;  5IVJ A;  5FKB A;  3MEP A;  5AFB A;  1D0H A;  1VRB A;  4AVB A;  3AKP A;  2VCB A;  4D3W A;  2RJL A;  3PVN A;  4DY3 A;  1Z7S 3;  3M3C A;  4KBZ A;  2ERF A;  1QJU 2;  3POY A;  2O1Q A;  4WVW A;  4F3J A;  3EJK A;  4CDX B;  4OHW A;  4IE7 A;  1F8V A;  5IVB A;  3ZFE C;  3CJI B;  1ENX A;  4JRA A;  4QX3 A;  1FPN 3;  4NHX A;  5JIA A;  4RR3 B;  1KEX A;  4YSF A;  3BB6 A;  4PIY A;  1JZ2 A;  1PZ9 A;  3AP4 A;  4LIT A;  4UFJ A;  4CU6 A;  4D7S A;  3OYW A;  1RYY A;  5CIS A;  2QQO A;  3GZA A;  1TEI A;  1XU1 A;  2HJI A;  1NLR A;  3Q9O A;  4P5Y A;  3WHU A;  1IS4 A;  2ZKN A;  3LA2 A;  1J58 A;  1RUI 2;  1GYK A;  4DXS A;  5EV7 A;  4FFF A;  4LA3 A;  4BQ2 A;  4IE6 A;  3KHC A;  1QU0 A;  4Q4V 1;  3HBK A;  5C4W B;  3E6D A;  4JDO A;  5CYY A;  4KWK A;  3JBG 1;  4BQ5 A;  4HKO A;  2XVL A;  3MW4 A;  1IS3 A;  2QQV A;  2VTF A;  4I3G A;  2XL9 A;  5FY8 A;  5LY2 A;  3NAP C;  1GKB A;  1UZY A;  2CAU A;  1V6O A;  5K7P A;  4Q1R A;  3ETP A;  3VBR C;  5CNA A;  2PAE A;  1IGO A;  1WWY A;  1C5H A;  1UD1 A;  1H4H A;  2XHN A;  2V4A A;  4UFM A;  3DEC A;  5FY1 A;  3CF6 E;  3R05 A;  3T2O A;  4Z07 A;  4AHW A;  4N9I A;  1YQ2 A;  2ZTN A;  4HMZ A;  5FZG A;  5JSP A;  2DBN A;  1JZ5 A;  5B4X A;  1ZZ7 A;  2VQ0 A;  4QM8 A;  1Y4W A;  3G6J B;  4BIO A;  4EZ4 A;  1QNY A;  2NP0 A;  1AR8 1;  4ASK A;  1QJY 2;  5I8S A;  2XL7 A;  2J1E A;  3AZX A;  3U75 A;  5AC9 1;  2JE9 A;  2RG4 A;  3UGH A;  1NE4 A;  4IW3 A;  3VBO B;  1UQX A;  1RHI 3;  2WRA A;  2VPV A;  1UO9 A;  2C0Z A;  5FLH A;  3AXE A;  3AK0 A;  1ACC A;  1FAY A;  2JG9 A;  4XFC A;  3VBS C;  4UFI A;  5A33 A;  5CEH A;  4XIO A;  1PO1 1;  3H42 B;  1AJO A;  1MEC 1;  1KJR A;  5FZC A;  3THT A;  3THC A;  4D8M A;  1BJQ A;  2PAK A;  3AZY A;  4MUV A;  2FMD A;  1FMD 2;  3ZSL A;  4M4P A;  3N7L A;  3AL5 A;  1VMH A;  5FPV A;  3PVB B;  5CKQ A;  3VBH A;  3MIG A;  3AKS A;  1NOV A;  2MPF A;  3D82 A;  1H0B A;  3I54 A;  1U12 A;  1RUF 3;  3A7Q A;  2ZEX A;  4H7M A;  2Q1F A;  2Y6H A;  5JZG C;  2VJX A;  1MS4 A;  2GSY A;  3W9A A;  1PIV 2;  3BPS A;  3OPZ A;  1X7N A;  1UAI A;  1CAX A;  4FOY A;  4CXY A;  3K4D A;  3JZV A;  1TVG A;  1AYM 3;  4RFR B;  3WG1 A;  3J7L A;  1GUI A;  5FY4 A;  4CPB A;  3KS7 A;  4QQ2 A;  3NKT A;  4GH4 B;  1DIW A;  3I3Q A;  4NRP A;  4CDX C;  4PBP A;  3GM8 A;  2YBP A;  4LNV A;  4U2A A;  3CJI C;  2W87 A;  2AH2 A;  3TB0 A;  2P4E A;  5FWJ A;  4OQ8 A;  3VHN A;  2ZCW A;  1YXW A;  3ZN6 A;  1RVF 3;  4K8R B;  4RR3 C;  1TMF 2;  3BTZ A;  1ZX5 A;  4PIZ A;  4UBH A;  3WQ7 A;  3LA7 A;  2WJS A;  1BEV 1;  4NVP A;  1VJ2 A;  2W0X A;  1OLR A;  1HRV 3;  2D5F A;  5JOY A;  3WNO A;  3WIN E;  3HWJ A;  1O91 A;  2YC2 A;  5EPA A;  3I8T A;  1DLC A;  2GP5 A;  1IS6 A;  1KGY A;  2NZ9 A;  3VZM A;  4Y1Y A;  2O8Q A;  3H1Y A;  1CGP A;  1NLS A;  1JHN A;  1AR9 3;  1C1F A;  2AR6 A;  2VQT A;  5C4W C;  1H8V A;  5A3N A;  2F4L A;  2P5B A;  4XF4 A;  3ZKY A;  4FQZ A;  3B7M A;  5F3I A;  3C7O A;  3NW4 A;  5BNP A;  2LS6 A;  5IJR A;  3QLQ A;  5KC6 A;  3INA A;  3WT3 A;  2VXR A;  2WZE A;  2LRO A;  4E2S A;  1LHN A;  1G8W A;  5JPN B;  2BFU S;  1QJX 1;  4UFL A;  3J9S A;  4DXZ A;  2UY8 A;  3AXD A;  4CEY A;  2WO1 A;  4FFG A;  5GLW A;  1OA3 A;  2GC0 A;  1ZZB A;  5BNN B;  3LIH A;  2R49 A;  4YW2 A;  3U37 A;  1H1M A;  1XQN A;  3BUC A;  3B94 A;  3O14 A;  2YC0 A;  3AKT A;  3TN9 1;  1Y7B A;  1CAV A;  3ORJ A;  1UX6 A;  1UXZ A;  4HK8 A;  1LRH A;  1H2L A;  2PAM A;  4ZU5 A;  3Q8F A;  1QQP 1;  4LBN A;  4QM9 A;  1YQC A;  3SHR A;  1PMH X;  3L2H A;  4QDQ A;  2VZ3 A;  3HQU A;  5EYX A;  3VBO C;  3Q8A A;  1ZZ8 A;  1C8M 2;  4UW5 A;  1QJZ A;  1YFU A;  3MBW A;  3SEE A;  4Y22 A;  1VBC 2;  3GJA A;  3CZJ A;  3T2T A;  3ZYF A;  2OT7 A;  1H6X A;  2VOV A;  2UWA A;  4HPK B;  3OCP A;  1QJF A;  1E57 A;  4FPC A;  1V9U 3;  4AZZ A;  3H7J A;  1S0C A;  4BQ3 A;  4JCK A;  4H3W A;  2UY9 A;  5FXW A;  5JXJ A;  1VRH 3;  2ZOE B;  3AYC A;  5IFP A;  4ZZ5 A;  1SBE A;  4K9S A;  4EN9 B;  5LBE A;  1WCD J;  2DVB A;  2HBT A;  3T08 A;  1DYO A;  1TG7 A;  3VBF B;  3BVC A;  3SKV A;  3WF0 A;  1IZ3 A;  4BZ4 A;  1URX A;  2B4K A;  2QCS B;  2YV8 A;  3ZXJ A;  1AR6 2;  2JIJ A;  2VBD A;  3OSD A;  1RMU 1;  1DYK A;  2CWM A;  4RQP A;  3KM5 A;  5T5O A;  3EXU A;  4DNY A;  4CUB A;  2B45 X;  2DCY A;  1RUE 2;  2ZHK A;  3WNL A;  4LHK A;  2DVD A;  2VME A;  3OEA A;  4P9J A;  1LOB A;  4GH4 C;  4JKK A;  3WDX A;  4B7E A;  2VZT A;  3BOD A;  5JIU A;  4NWV A;  3I3B A;  1SCR A;  4BWO A;  2N7G A;  3RJR A;  5FZH A;  3ZMN A;  1CIY A;  3WNN A;  1IHM A;  4FO9 A;  2V72 A;  2WFF 2;  5J09 A;  2GC3 A;  2KA3 A;  4RD7 A;  4DXT A;  4AI2 A;  1L7L A;  2OVU A;  3MIE A;  1L7R A;  3GCX A;  3ILF A;  4YYO A;  3NNF A;  5FRA A;  1DP0 A;  5A1A A;  2NM1 A;  1CAU A;  1UU4 A;  3J8F 2;  3JQX A;  3K51 A;  3BOW A;  2A3X A;  3POB A;  4FPF A;  1Q8S A;  3KV9 A;  4R4X A;  2ORZ A;  4CCL A;  1B35 B;  2FDI A;  1BLZ A;  3VD4 A;  3UKT A;  3GHM A;  4NIH A;  2VUJ A;  3VDD A;  1CJD A;  2RS5 3;  5HCF A;  2XML A;  1UPS A;  5EQU A;  5BNN C;  4CDU A;  4EYU A;  1OUR A;  1KIT A;  3LE0 A;  1R08 3;  2ZGK A;  3KLS A;  4K7J A;  3IAQ A;  3KQR A;  3RGB A;  1YQ5 A;  1W99 A;  5FMB A;  5KHK A;  2DFC A;  4QPI A;  3A4U A;  2JIG A;  4N90 A;  4IGQ A;  5F37 A;  1EUU A;  4URT A;  1REE A;  2BV4 A;  3KF5 A;  3K4A A;  4HL0 A;  3D0J A;  4Z2W A;  3NNG A;  5FZ4 A;  3WDY A;  3W21 A;  3VZO A;  1J83 A;  5GZE A;  4KWL A;  3THD A;  5C7G A;  3H3L A;  4XBN A;  1ZBE 3;  3JXS A;  4O65 A;  1PK6 B;  5T5P A;  3WF4 A;  1ZZ9 A;  3OB8 A;  1V6M A;  2VMC A;  3MI8 A;  1VMJ A;  4PJY A;  4XQ4 A;  4AOC A;  4XBL A;  4DOU A;  5C8C B;  3SLI A;  2ZAA A;  4FXG B;  2VCC A;  1QGL A;  2VUL A;  4XZU G;  3VKN A;  2DCT A;  2X5I A;  3PMS A;  1RUG 3;  2ZML A;  1OT5 A;  1W8N A;  2A73 B;  3VBF C;  4AFC A;  1OVS A;  2BYV E;  1WW5 A;  2EA7 A;  2LAL A;  3GBF A;  3VDB A;  2DFB A;  1O4T A;  2X8K A;  5DAB A;  5FPZ A;  5IVY A;  2E6V A;  1CPN A;  3V0B B;  1G7Y A;  3C7F A;  1EYB A;  1W8T A;  3ES4 A;  3LDB A;  2BER A;  1ND3 C;  4IGP A;  3VL9 A;  4XAA A;  5ABJ A;  4LKS A;  2JDA A;  4W50 A;  2E53 A;  4WVV A;  1PIV 1;  3KT7 A;  2K2S A;  4RHV 2;  1LR5 A;  3A0N A;  4XC9 A;  3WW1 A;  1JXN A;  1W0O A;  1P8J A;  3CU7 A;  3RWN A;  4CCC A;  2EXK A;  1YC6 1;  2IFR A;  4Q29 A;  5FXX A;  3UV9 A;  1LGN A;  5IK4 A;  3SCG A;  1QJU 3;  1PM4 A;  5LEJ A;  2TEP A;  4UF0 A;  5KC5 A;  1GZ9 A;  1HJF A;  3E6B A;  1FI2 A;  3GBG A;  3V0A B;  1S2B A;  4HK9 A;  2BGC A;  1AYN 2;  5LK5 A;  1TMF 1;  1LKN A;  1QKQ A;  4YVW B;  4EN7 B;  1OQD A;  4ZXK A;  1G6N A;  4ZZ8 A;  1SLC A;  3TYJ A;  1EUT A;  5KHH A;  1VLN A;  1R1A 3;  2P2K A;  4WM7 A;  3SCH A;  5HPO A;  1R1Z A;  3WG2 A;  3H7Y A;  4QDS A;  4M00 A;  1RUI 3;  4XFA A;  2IVJ A;  4W4Z A;  4B4R A;  1EPW A;  2A6X A;  2GAU A;  1B35 C;  2QQW A;  5L7O A;  2J1R A;  5I8T A;  2YC4 A;  1TME 2;  1CAW A;  2D7F A;  5CU1 A;  4CP1 A;  2JG9 B;  1PGW 1;  1XC6 A;  4XTP A;  1PO2 2;  2RV9 A;  3AMH A;  2Y6L A;  3RI8 A;  2RS1 1;  4K40 A;  5LY1 A;  3OBA A;  3ST7 A;  3AM2 A;  1RUH 3;  3FHI B;  5CIR A;  4C90 A;  2O8O A;  4PI2 A;  3VHR A;  4RS5 B;  2Y0I A;  4Z2A A;  2FDK A;  4ATF A;  4AFM A;  1VBA 2;  2HWD 1;  2JX9 A;  4FPE A;  4LUL A;  1V0A A;  4UFH A;  3N9O A;  2FDH A;  1XE0 A;  2QE3 A;  3GNE A;  2DBI A;  2ZMK A;  1BMV 2;  4XCB A;  2BBV A;  2HWB 3;  1QJY 3;  3OOX A;  4GWI A;  4N53 A;  1Z7S 2;  2H0V A;  5J3U A;  2VM9 A;  2YUE A;  1UF2 C;  2XJR A;  1C8M 1;  2BJS A;  2WQ8 A;  3C7G A;  4HN1 A;  4HT1 T;  5FYV A;  4EWD A;  5JXG A;  1PK6 C;  1VBC 1;  4GXL A;  2ZAH A;  2YZ4 A;  3WHT A;  5EFU A;  3SH3 A;  1W6M B;  5C8C C;  3KVB A;  2WAB A;  3I59 A;  3U10 A;  2X09 A;  4XJA A;  3WW2 A;  3LD8 A;  1TZO A;  2FCU A;  3W5M A;  3IDE A;  4Y20 A;  1FMD 3;  3CNA A;  5FJH A;  4M3C F;  2ZX3 A;  2BWA A;  5FZ1 A;  1W8F A;  2VZS A;  3DL3 A;  3G7D A;  1QHD A;  4TTG A;  4AEJ A;  5CAZ A;  1SBF A;  4QQH A;  3HNM A;  2WAO A;  3SXW A;  3F95 A;  4BXS V;  1AL2 1;  2G19 A;  4QAW A;  3CHX A;  5I0R A;  1O5L A;  4L9B A;  4TYS A;  3O1P A;  3ENR A;  1XSQ A;  1Y9Q A;  4WBB A;  3U4X A;  3N36 A;  2W91 A;  1RUE 1;  3WNX A;  1D2Q A;  2W2I A;  3QBQ A;  4E4S A;  4XF1 A;  4NID A;  2I74 A;  4IV1 A;  1PHM A;  1W6Q A;  2RHP A;  2BVV A;  1BVV A;  2RJ2 A;  5DZF A;  3FHA A;  5GLZ A;  4Z82 A;  3MF9 A;  5AVP A;  5C3P A;  3HT1 A;  4EE2 A;  3ZSK A;  3BOP A;  2R06 1;  1UU5 A;  2P1B A;  4M4R A;  4YVW C;  2VR4 A;  3AP7 A;  3AYE A;  1T6B X;  3MUZ 1;  4Z8B A;  1GBG A;  1OA4 A;  1X9P A;  3OPT A;  1CAV B;  1RHI 2;  1W9S A;  3OGS A;  5C3Q A;  1GP4 A;  4HSL A;  4OLL A;  4ZU7 A;  5F7U A;  1HN1 A;  4P9X A;  4AVV A;  1SDW A;  2VMI A;  4MGQ A;  5KHG A;  3BAL A;  2B5H A;  4Q0P A;  2VZ1 A;  3WQB A;  1A78 A;  2JG9 C;  2RS3 2;  4COU A;  2Z42 A;  5FTT C;  5IVC A;  4WZF A;  4JX0 A;  4S2G A;  2IXL A;  2CTV A;  3R4D B;  3V64 A;  3ZXE A;  1RUF 2;  4RS5 C;  1POV 1;  2RDQ A;  3GHN A;  1W9Y A;  1WME A;  5CA6 A;  1QXR A;  3P3P A;  5DXD A;  2Y6K A;  4UBG A;  5D8A B;  5DDJ 3;  2CNA A;  1O3S A;  1W39 A;  4HKW A;  1N3P A;  2JG8 A;  1FV2 A;  4LBO A;  1AYM 2;  1XNB A;  2WT0 A;  3VKF C;  3QH6 A;  5HBA A;  2UWC A;  1ND2 A;  4D6R A;  4XDQ A;  3W5N A;  4P9I A;  2FMY A;  3POS A;  2PLV 1;  4AQS A;  1JW6 A;  3Q8C A;  4Y26 A;  1IKQ A;  3GZT B;  1RUJ 3;  1RVF 2;  1ULG A;  1JUH A;  3OUH A;  1YFW A;  4JZR A;  1JN2 P;  4MGT A;  3HVD A;  1U5X A;  2Z5W A;  4LPL A;  4B4Q A;  3UYJ A;  4MXW A;  4XQD A;  2RMU 2;  1COV 2;  4K1Z A;  2WNE A;  4IE0 A;  4O9G A;  2XLA A;  3FZ3 A;  4R9C A;  2YMZ A;  2IFW A;  2WS9 3;  3AZZ A;  3RPQ A;  1DG6 A;  5J36 A;  4XMI A;  1F31 A;  2WFP A;  1AR9 2;  1LTE A;  1NCR A;  1AR6 3;  4BHP A;  1ULO A;  4YNI A;  1VBD 1;  1FAT A;  1H8T A;  1WD4 A;  4AEK A;  4QT6 A;  4AYU A;  3VN4 A;  1EAH 3;  3O1S A;  2KXL A;  4Q0Q A;  2XON A;  3DXT A;  2VOX A;  1X8E A;  4DPN A;  3HMY A;  4LLO A;  2Y6G A;  3HEI A;  3VDD B;  2G1M A;  2Q8C A;  4AQ2 A;  1VPH A;  4QQL A;  3TBD A;  2JXA A;  3UNP A;  4W6X A;  2YBS A;  4CPB D;  3OGV A;  4NHY A;  4AED A;  4XUP A;  3J7H A;  3AP6 A;  4HBN A;  2WFF 3;  3MF6 A;  2HKX A;  4E2G A;  1FOD 1;  3HN3 A;  3IDA A;  2ARC A;  2HWE 1;  3I7D A;  5A7N A;  4DXR A;  1JZ7 A;  4X6R B;  1PX4 A;  3NV2 A;  4XF0 A;  4XPV A;  5FOJ B;  2EAL A;  4XXP A;  2VBP A;  2UYB A;  1JYN A;  4UAP A;  4IES A;  1DGR N;  3ZLI A;  3J8F 3;  4A42 A;  4OI0 A;  4AI8 A;  3VV1 A;  2UU8 A;  5JAX A;  3D6E A;  1GU3 A;  1V9U 2;  2KM2 A;  4TZD A;  1MZ5 A;  2QQN A;  4GA9 A;  4QX1 A;  1APN A;  3ZXG A;  1TNF A;  3A22 A;  4QQP A;  1VRH 2;  3IM0 A;  1CR7 A;  2JD4 A;  2PFW A;  3ZKU A;  3E6C C;  3ZFF B;  5T52 A;  2A70 A;  3SIT A;  1PO2 1;  2MEV 2;  3WCR A;  2EXI A;  1LHO A;  3FX3 A;  3WR0 A;  2XB6 C;  4FOQ A;  4QX8 A;  3MLL A;  5A70 A;  1UXX X;  2OPK A;  1PGS A;  1GQP A;  5EJ1 B;  4YW1 A;  1RIN A;  2CYF A;  1AJK A;  4LOS A;  5D8A C;  3JCI A;  1WD3 A;  2WSV A;  4LKD A;  4Y1U A;  2BW8 A;  2JEN A;  3LFM A;  1A34 A;  2XR4 A;  1PZ7 A;  1GSL A;  3WF3 A;  1BMV 1;  5ABJ B;  1UYX A;  4LJH A;  2P3K A;  4BME A;  2CV6 A;  2Q8O A;  2F6B A;  3UT0 A;  1CX4 A;  1Z7S 1;  2PHW A;  3R4S A;  5BNO B;  4MH0 E;  5KR7 A;  4XFG A;  4MHU A;  4NRO A;  1UKR A;  1NCQ C;  1C8N A;  4ZS2 A;  1FPN 1;  4M0H A;  2DCZ A;  3WG4 A;  3FBM A;  3MIB A;  1EV1 3;  3WLU A;  4LE4 A;  2P3I A;  4COW A;  4GWM A;  4DS0 A;  5FUP A;  4P5H A;  4UF0 B;  3CEW A;  5K0U A;  2WN2 A;  3W58 A;  1J59 A;  2LW8 A;  3I2K A;  1Q8V A;  4LTA A;  4QKF A;  4EN8 B;  4JGY B;  2IXJ A;  1N3O A;  1W9F A;  1BK0 A;  4E27 A;  3PTY A;  1TQ5 A;  1DFQ A;  1KQR A;  2WBK A;  5HCA A;  3ACL A;  3JB8 A;  1W8H A;  4V2W A;  5FZ0 A;  2XQR A;  1W2U A;  2XVK A;  4Q4W 2;  4IQP A;  3B02 A;  5F6L B;  2R0H A;  3T0A A;  4RHV 3;  3KGL A;  1Y9M A;  3B5L B;  3HR9 A;  5HCB A;  1MZE A;  5L7O B;  2B9V A;  3N35 A;  3AP9 A;  4ARX A;  1JZ3 A;  2B8M A;  1WMD A;  4YM2 A;  4XAC A;  3DKQ A;  1GZC A;  1R08 2;  1JH5 A;  1W6P A;  3LOI A;  3WZ1 A;  2PHX A;  2J1T A;  3KB5 A;  4QPG A;  1OD5 A;  3GAL A;  2VO5 A;  3JD7 2;  3HQR A;  4GD4 A;  3TEW A;  1DU3 D;  5JUV A;  4ERO A;  1ZRE A;  1A8D A;  4KGG A;  1AYN 3;  1Q8Q A;  5LEK A;  4BK5 A;  3OY8 A;  1FV3 A;  4FPJ A;  3KV4 A;  2ZAB A;  4K6B A;  2VZR A;  3PIJ A;  4TSV A;  4UI9 L;  4OYU A;  4MGY E;  2GAL A;  1QOT A;  4XJU A;  2OXB A;  4QX0 A;  1RHI 1;  3WG3 A;  1ZBE 2;  1IPJ A;  1OQE A;  2OZ6 A;  1NKG A;  4CUC A;  2PXJ A;  2DUQ A;  1F35 A;  5C5T A;  2WYS A;  1V6N A;  2GME A;  4L8Q A;  3H8O A;  4QKD A;  5HV0 A;  4FAG A;  2ZGT A;  2EID A;  3AZW A;  2UUR A;  4IXL A;  5FZA A;  4RGK A;  4CXW A;  4LHN A;  2OUH A;  5I8Y A;  5HV4 A;  1TME 3;  1ZBA 3;  2VXJ A;  3ZFF C;  3MID A;  1N1V A;  4IEZ A;  5L19 A;  1SLL A;  4RN5 A;  1YIF A;  2BTV C;  1ULE A;  3ELN A;  4J1W A;  2WII B;  2DUO A;  1Y9G A;  1QXP A;  4GWN A;  4ARY A;  5T54 A;  4M01 A;  1RUF 1;  4KGQ A;  3KF3 A;  3O1M A;  4SBV A;  1W04 A;  4I01 A;  4RSU A;  4JHZ A;  1AX2 A;  1VBA 3;  3HD8 B;  3GJB A;  4RL7 A;  3ZDS A;  3FLR A;  3LDK A;  4C8D A;  2JEC A;  3MZH A;  3RZM A;  3KT4 A;  3LGR A;  4JGZ B;  1AYM 1;  1S4C A;  1S55 A;  3FHQ A;  5FMC A;  3ZSM A;  4OMC A;  4CXX A;  5ABJ C;  3DYM A;  2BOI A;  1O8P A;  3E5X A;  4UWD A;  2ZBJ A;  4W8J A;  5A7S A;  4BQY A;  5BNO C;  4Y4R A;  2A3Y A;  2XJU A;  3H50 A;  4CUG A;  1EPZ A;  2ZA9 A;  5FO9 B;  2YPD A;  3ZPY A;  3LOB A;  1ZRR A;  4NO4 A;  5BNQ A;  1C4R A;  1GP6 A;  1RVF 1;  1BBT 2;  3ASI A;  4DIQ A;  4ES9 A;  5J48 A;  4FXK B;  4IV1 B;  2BRT A;  4XBQ A;  4AVS A;  1JYX A;  2ES3 A;  2JWP A;  1U5Y A;  1MVE A;  2K46 A;  3HBZ A;  4OUM A;  1MR5 A;  4BK4 A;  1WLD A;  1AF9 A;  2G9G A;  4FQ4 A;  4FT8 A;  2P3J A;  1HJG A;  5E8A A;  2OW4 A;  1RUD 2;  4IUG A;  1HB2 A;  1HRV 1;  2WNU A;  4JGY C;  1DCS A;  1GZW A;  1R1A 2;  4YVS A;  3EO6 A;  3MPP G;  2R04 2;  2WNV A;  5F3G A;  1S1A A;  4A7Z A;  5FUI A;  3IPV A;  5CFC B;  4C1W A;  1VR3 A;  1JI6 A;  2QNK A;  2J1A A;  5BUV A;  4UYB A;  1HX6 A;  2GZW A;  4P14 A;  3U1X A;  1VBE 2;  4QKN A;  3WUD A;  2DUR A;  1AR9 1;  3LWC A;  3N9Q A;  4FI9 A;  3WP4 A;  3B9C A;  1XND A;  2JDN A;  1ODM A;  3PUH A;  1W6O B;  1W8O A;  2XQX A;  2ZX4 A;  2ARA A;  4BQX A;  4FOV A;  1RJ7 A;  1HQW A;  1RUH 2;  1V6I A;  2ZX1 A;  5F32 A;  1W6N A;  4BMB A;  1AX1 A;  1LEC A;  1E5R A;  1YI7 A;  4TXW A;  2Q30 A;  2RDR A;  1UYP A;  2RR1 3;  3NJV A;  4P9L A;  3S30 A;  3BKZ A;  3T4V A;  1LU1 A;  3AJZ A;  1JYT A;  4NRM A;  1FNZ A;  2HWB 2;  2HWC 2;  3ZPO A;  2J1S A;  4HVR A;  1Q8O A;  4XE9 A;  2W95 A;  2ZS6 B;  3BTX A;  4IEO A;  3M3E A;  2Y33 A;  1BK1 A;  3ABZ A;  2EIC A;  2W08 A;  1OMI A;  3AVS A;  4Y4Y A;  3ZYH A;  1KFU L;  2DTY A;  3CMG A;  4H7L A;  4LBJ A;  3RDI A;  1MPX A;  1FX5 A;  1YCI A;  3K75 B;  4DQA A;  4BLJ A;  1V9U 1;  2C5D A;  1F4A A;  2CY6 A;  3RZL A;  2JKB A;  3HNB M;  1O6U A;  2WN3 A;  2FBE A;  3WX5 A;  2RS3 3;  2GP3 A;  4IL7 A;  1VRH 1;  4IDZ A;  4ES8 A;  3CIH A;  4AK3 A;  4IV3 A;  3U0Z A;  3HAG A;  4AAP A;  5CG8 A;  1OOP B;  1AXY A;  1DLL A;  2BGP A;  4MXW B;  3HNY M;  3VZK A;  4I3P A;  4WVM A;  2ARX A;  3KV6 A;  3BGA A;  3WCS A;  3T09 A;  1ENS A;  4ZY9 A;  1S0I A;  1YEW A;  2Y6F A;  2WUH A;  3IBM A;  2WZP P;  4B1M A;  1BVP 1;  4JGZ C;  5A6Q A;  4IET A;  1V00 A;  2FDG A;  4LBK A;  4CSW A;  1H9W A;  1N1T A;  5A7W B;  3U07 A;  4AEM A;  3KCX A;  5H9P A;  2EAA A;  2WA4 A;  1LEM A;  4NPR A;  2QFE A;  5L73 A;  1QEX A;  1UCX A;  5FLI A;  3A21 A;  1C3H A;  1ZA7 A;  1JU3 A;  2J7M A;  5GZD A;  1WGP A;  2YG0 A;  2W94 A;  4YZ5 A;  5J37 A;  2AYH A;  4IV1 C;  2H6B A;  1GV9 A;  3SH4 A;  3ZYG A;  4A6S A;  4MHR A;  5FXV A;  1OKQ A;  1HB3 A;  5KXC A;  4AED B;  4QPW A;  2RMU 3;  3AMP A;  1COV 3;  3PJQ A;  4PDW B;  2ZGO A;  2VNR A;  4IEV A;  5AFE A;  3SH5 A;  4XUR A;  1GLH A;  1KJL A;  2JDU A;  5CFC C;  4PCR A;  2ID4 A;  4A6O A;  5T5L A;  1YO8 A;  2CGO A;  2AEN A;  4HET A;  5ANQ A;  4AI3 A;  2WIN B;  4UW6 A;  2YYO A;  1B09 A;  5FBJ A;  2DU0 A;  4QDR A;  5FIX A;  5FUN A;  3K77 A;  4QXB A;  3CO2 A;  4JRL A;  4MZU A;  4FPH A;  1KRI A;  1UOB A;  1SLI A;  3PUQ A;  2CSG A;  1F5F A;  2RS5 1;  3ME2 A;  2W3J A;  3VLB B;  4AQ6 A;  2PHF A;  4XHX A;  4LHS A;  2F17 A;  5JOZ A;  1WW4 A;  4QHZ A;  1XNC A;  2YGM A;  4XIK A;  3M8L A;  1PMI A;  1SZB A;  3AFG A;  5FZO A;  1S0D A;  4NN0 A;  1R08 1;  4PLO A;  1HQL A;  1HXS 3;  2A6Y A;  5DAX A;  5DDJ 2;  2VMD A;  2JE7 A;  2D98 A;  1UZZ A;  4Q4Y 2;  2VBB A;  1OUX A;  2ZJC A;  4OFG A;  3OUJ A;  1IPS A;  1J3P A;  1CZS A;  3WP6 A;  4AFD A;  3WNP A;  4TLF A;  2Q5T A;  2R6Q A;  1LUL A;  3AC0 A;  4YW3 A;  3KGZ A;  3K48 A;  1ODN A;  2VAU A;  3AMQ A;  1WKY A;  1GNH A;  1O3T A;  1N1Y A;  1NA1 A;  5DAW A;  1RUJ 2;  2O0O A;  5L36 A;  4A7K A;  1ZBE 1;  4I0W B;  2VMF A;  3MUY 1;  3ZFG A;  4ZXE A;  2FCV A;  4XIL A;  4LIV A;  4LO6 B;  4Y5Z 0;  4EJR A;  1DZR A;  4CDQ A;  5FZ6 A;  1ZNP A;  4JKM A;  2F4P A;  4FPO B;  4AGR A;  1BYH A;  1RUG 1;  1XE8 A;  2Z69 A;  5IW0 A;  4FFI A;  1H2K A;  1MQT A;  2WS9 2;  4Z92 B;  3UGG A;  1H4G A;  2W1Q A;  3HN1 A;  1OOP C;  1X9T A;  2QBX A;  1O59 A;  2MEV 3;  4OHX A;  4QU1 A;  5EXO A;  2BNO A;  1RIT A;  4NOT A;  3ACG A;  5K0U B;  2GH2 A;  1MS3 A;  1CZT A;  2RE9 A;  3KQ4 B;  3USS A;  2WNO A;  3POE A;  2WQZ C;  4Y5S A;  4YW4 A;  1FXZ A;  1EAH 2;  1K5M B;  4Q8K A;  1LOF C;  2R07 2;  2RDN A;  1GFF 2;  4ZPI A;  5DAQ A;  5FJK A;  2WAA A;  3CJX A;  1C5I A;  2D3S A;  4PF1 A;  4P00 B;  2EAK A;  2CAV A;  2DDU A;  4L2N A;  1WBF A;  4CZS A;  4H14 A;  1QJU 1;  4GWJ A;  4NE9 A;  4CDW A;  3C7E A;  5APA A;  2AEZ A;  1UOG A;  3K3N A;  3S5A A;  3RYP A;  4BCU A;  1RXF A;  1VIW B;  5D1I A;  2DF7 A;  4WM8 A;  5C70 A;  1DQ4 A;  2XHK A;  3C8X A;  5L9B A;  1GWL A;  4IEU A;  4BOW A;  5BYN A;  2JDY A;  1V70 A;  1EP0 A;  4PDW C;  1WLT A;  1YJK A;  5LRR A;  1R1A 1;  2VY0 A;  4XXA A;  3VBU B;  3M2M A;  3VKL A;  4F8A A;  1RED A;  3PVO A;  3NJZ A;  1RUI 1;  3LSE A;  1FT9 A;  5CZK A;  2PQS A;  3MW3 A;  2XBO 3;  1SFP A;  5KXE A;  1DDL A;  4IEP A;  4XVH A;  1US2 A;  3O1V A;  4Q4W 3;  1O8S A;  5I0S A;  4KBB A;  4YRD A;  1OHF A;  1SPP B;  2HEY F;  2ZGN A;  1XJA A;  3EBR A;  5K9Y A;  1J84 A;  3HQX A;  4A3X A;  2ZZQ A;  3KWV A;  3ZMO A;  1IKP A;  2QDN A;  2FDF A;  1RUH 1;  5LB6 A;  2R32 A;  5T50 A;  4JHT A;  5JSO A;  2OPW A;  2QQU A;  4CEW B;  2ET7 A;  2J1U A;  3NL1 A;  1VMF A;  4YGD A;  2ZHL A;  3JD7 3;  4YZ4 A;  4ZKT B;  2HWB 1;  4FCA A;  1QY4 A;  2GMP A;  3I2J A;  1AUY A;  1Q43 A;  1QJY 1;  2E7A A;  3WP3 A;  2VE1 A;  3PUR A;  3V56 A;  3LSD A;  4BB3 A;  5K8S A;  4MAD A;  4GQ7 A;  2HEV F;  2WO3 A;  3LPF A;  1EV1 2;  1CN1 A;  2NPI A;  3BIW E;  5A3T A;  1YFX A;  1PMJ X;  3MW2 A;  4YLZ A;  3TWI A;  4LBM A;  2YXS A;  4KU8 A;  2V5D A;  1PNG A;  3UES A;  2NN8 A;  1FMD 1;  4D6S A;  1H30 A;  3QCW A;  3WNK A;  1DGW X;  1QJE A;  4N43 A;  1UN1 A;  3I97 A;  2VUC A;  5DAV A;  3B93 A;  5K0U C;  4HOO A;  3NV3 A;  3OYW B;  3T2P A;  4CTE A;  4N9H A;  1MS8 A;  1PM7 A;  2XWB B;  3MPB A;  1CQ9 A;  1AR7 3;  2QDR A;  2WNU B;  4YVS B;  5L9V A;  1ULF A;  3WEZ A;  1ULD A;  5JI7 A;  1K5M C;  1O3R A;  1IOA A;  3IPV B;  5DQ0 A;  4BA6 A;  4DEV A;  2XLF A;  4PBO A;  1QH7 A;  2D3P A;  1E5S A;  3NMB A;  3E5Q A;  4L99 A;  3T0D A;  1NLQ A;  4A3Z A;  4FTE A;  5FYM A;  2IWG B;  2A7A A;  2EIG A;  4E4Z A;  1I6X A;  4LK7 A;  4AGV A;  3I49 A;  1VAV A;  4NWW A;  3WNM A;  1ZRF A;  1CVN A;  3FLP A;  3VBH B;  1GZT A;  4JQR A;  5FK7 A;  1BBT 3;  1GQH A;  5DG1 A;  1YHF A;  4XF3 A;  5LK7 B;  4M0N A;  3VKM A;  3KMH A;  4GJY A;  4MGI E;  3LPG A;  1G9B A;  3L9J T;  5EHD A;  1RUD 3;  3KZ4 C;  4BE3 A;  3VBU C;  1IPK A;  1RL3 A;  2R04 3;  4DRV A;  3M4F A;  1JYV A;  1YIP A;  1H2N A;  1BQP A;  2PHL A;  2WZR 2;  1LOE A;  1OQ1 A;  2C24 A;  2HYX A;  3OTF A;  2OKX A;  3WP5 A;  1V6J A;  1VBE 3;  3LCP A;  4UT5 A;  4BQW A;  2GC1 A;  1ONA A;  1HIX A;  3SIS A;  1O4Z A;  2XUM A;  1ZBA 2;  1YJL A;  3R6S A;  4AR2 A;  2FZ1 A;  1XNA A;  1PZ8 A;  5A33 B;  3ZR6 A;  2QZ2 A;  3PME A;  2H0B A;  5JXI A;  1GIC A;  5FQ0 A;  3ON7 A;  3ACH A;  4CEW C;  2Y60 A;  2VQU A;  5DDJ 1;  3BYW A;  4JVA A;  3RRD A;  1DQ0 A;  2BUK A;  5ERL A;  1S0J A;  1VE0 A;  1W2A X;  2E7T A;  2HWC 3;  3NAP A;  3T4H B;  1X8M A;  4Q27 A;  3ZVX A;  3RYR A;  5JVV A;  1D4M 2;  2BZD A;  1OH3 A;  3LA3 A;  1CAX B;  1JBC A;  1ZVF A;  1ZZC A;  3OF1 A;  1FYU A;  3AKR A;  3VD9 A;  1RUJ 1;  1RUC 3;  3FE5 A;  3O0V A;  3B00 A;  1LHU A;  4X6Q B;  1QDC A;  4OZX A;  2E33 A;  4MO3 M;  1CON A;  3I2I A;  3ZN6 B;  2D6L X;  5DUX A;  1ULC A;  4KMQ A;  3N4M A;  2PQQ A;  2W39 A;  2WS9 1;  5FMO L;  3T2Q A;  2ZX0 A;  4GB3 3;  1XYP A;  3V65 A;  3M3I A;  3O7O A;  3P6B A;  5LBB A;  2VTX J;  3KSC A;  3OD0 A;  5ACA 3;  1OUS A;  5C3S A;  3VBS A;  2Q1M A;  4QGM A;  4B1L A;  1AR6 1;  2P3Y A;  1LNS A;  1EAH 1;  1VAM A;  1WUV A;  3VD5 A;  2QUO A;  1PVC 2;  4ASL A;  1NQD A;  3T1M A;  4MX3 A;  3TEY A;  1GWM A;  2PN5 A;  1OSG A;  5IK5 A;  3WDW A;  4P08 A;  3NJX A;  1UKG A;  5JMO A;  5BNP B;  4JTO A;  1W8U A;  4K21 A;  2RR1 2;  2BPA 2;  1JOB A;  5CG9 A;  1UMZ A;  1HB1 A;  4M3C A;  4XW3 A;  3VBH C;  5JZG A;  4E9K A;  4CEY B;  2WFF 1;  1AXZ A;  5CAD A;  4RGG A;  1J3R A;  1N3Q A;  1JYW A;  1OVP A;  2Q1Z B;  4IEX A;  2MNG A;  4CDX A;  4QB2 A;  5FPB A;  2W68 A;  2A6Z A;  3J8F 1;  1QIQ A;  1VBB 2;  3D4K A;  3PUA A;  2XJP A;  4JQT A;  4QB6 A;  1AL0 G;  2R7E B;  4FVV A;  5IFT A;  1QH6 A;  4RR3 A;  4XDP A;  3UJQ A;  1H6Y A;  3B9I A;  3ITQ A;  3JQW A;  3PHM A;  4Y22 B;  1JMU B;  5T55 A;  3DXU A;  4AAX A;  1ALY A;  2JJ6 A;  2ZHN A;  5FWE A;  4FPG A;  2P6H A;  4JAA A;  1QDO A;  2GC2 A;  2VNV A;  5KBF A;  3LQC A;  2G9F A;  3VKO A;  2CGP A;  4JC1 A;  4CDQ B;  4C91 A;  1IG0 A;  2YHJ A;  1HV1 A;  4NHM A;  5FYT A;  4DUW A;  5J1X A;  2QQK A;  5A3W A;  4M3C E;  1XU2 A;  2G4I A;  4CP0 A;  2GH8 A;  3WUC A;  5I91 A;  3PU3 A;  5FPX A;  5C4W A;  1O5U A;  1JYC A;  2VZP A;  3O1R A;  2DWR A;  4FPL A;  1W03 A;  4QQO A;  5FZB A;  1K42 A;  2ZGM A;  2ZEZ A;  1HB4 A;  4J25 A;  4NRQ A;  4Q4Y 3;  5DZG A;  3BPZ A;  1UIK A;  5FO8 B;  5LW9 A;  3FL7 A;  1NYW A;  4RQP B;  2QJV A;  4GMP 0;  2OX0 A;  1F9K A;  1JYI A;  5FZ7 A;  1LGC A;  3CBN A;  4R52 A;  5GAL A;  3TAY A;  1JOJ A;  2Y0O A;  4BU2 A;  2JDZ A;  4G3Y C;  3MIF A;  2D97 A;  3GZU C;  1OPO A;  3NJY A;  5C5U A;  1RB8 G;  4QXK A;  1EV1 1;  1R64 A;  2D6O X;  5FYU A;  3WSO A;  4KH9 A;  1RUN A;  2JEM A;  1O7F A;  2W52 A;  1E5H A;  5I0T A;  4FPK A;  3VBO A;  3NST A;  2ZX2 A;  2XPJ A;  1D2S A;  1D4V B;  4FTS A;  5DPN A;  5GLU A;  1KXG A;  3E97 A;  4FTB A;  1OF3 A;  4LKF A;  1UNB A;  2AGS A;  3USU A;  2XWJ B;  1CAU B;  3AMN A;  5B2G B;  1WCU A;  4RHV 1;  2R07 3;  4LIU A;  3TEX A;  4GAL A;  3K2O A;  1XYN A;  5DUU A;  3LAG A;  5FRE A;  4XF9 A;  3ZOI A;  3WQ0 A;  5BNP C;  1S0G A;  4P9G A;  1K45 A;  3TNP B;  4ORF A;  1HXS 2;  4XTM A;  4EWE A;  2ET1 A;  2LUW A;  1HW5 A;  4G4F A;  3NV1 A;  4COV A;  3ZSE A;  2B42 B;  2QTW B;  3IB3 A;  5EJZ B;  4CEY C;  3LFI A;  1DQ2 A;  3RJ2 X;  4CDU B;  5IAX A;  1NY7 2;  4JV4 A;  2XKP A;  1AYN 1;  3DYP A;  4HFS A;  3FUQ A;  2CWS A;  4ZU4 A;  1U5Z A;  1S0F A;  3HT2 A;  2ARB A;  3HPN A;  4GH4 A;  4LOR A;  4PHZ A;  4D7T A;  4QMA A;  3MFC A;  2SBA A;  2XJT A;  4QPI B;  4LBQ D;  2XKO A;  1F15 A;  1AZD A;  2VCA A;  3APB A;  4YG6 A;  4JDN A;  2Q8D A;  3CZU A;  2VUD A;  2WC2 A;  4QKB A;  1D0G A;  4QXC A;  4GIQ A;  4XUQ A;  3KT1 A;  2Q8E A;  1Z0H A;  3SQO A;  1TME 1;  1ZBA 1;  4P9W A;  3K4Z A;  1DGL A;  1VAK A;  4PQ9 A;  4CYD A;  3VDA A;  3TEZ A;  1NXM A;  5SV5 A;  1I5P A;  3BTY A;  4TWT A;  2X5I B;  3TRS B;  2VL4 A;  2X53 S;  1UOF A;  2P6C A;  2V5Y A;  3O0W A;  2YRO A;  3OUI A;  4G9S B;  4R4Z A;  4AF9 A;  1NE6 A;  2CU5 A;  3K3O A;  4GMP 3;  4PLM A;  1VBA 1;  3NNL A;  2C9A A;  3AJY A;  3M3O A;  4XUT A;  4BQ4 A;  3I3M A;  1RTV A;  1MEC 2;  4OZO A;  4RQP C;  1I9R A;  2QQJ A;  3VGI A;  1US3 A;  4XMA A;  1NX9 A;  3NV4 A;  2X05 A;  5BNN A;  5F39 A;  2WSU A;  4S2H A;  5K4L A;  2W46 A;  1SAC A;  1CES A;  3PJY A;  4JKL A;  4LO4 B;  3VHO A;  3T0B A;  2HLE A;  4EN6 B;  1JHJ A;  5LBC A;  4CCN A;  3F2Z A;  5F1R A;  1BXH A;  2VZO A;  1WLC A;  3DN7 A;  1X50 A;  3OBR A;  1EY2 A;  3MGU A;  4D69 A;  2C6S A;  1YRZ A;  2W1W A;  3ES1 A;  5D2A A;  3OGJ A;  5JLV A;  3POW A;  1RC6 A;  1OLQ A;  1LAJ A;  2ZZJ A;  3SKJ E;  3POJ A;  5F8P A;  3J7M A;  2RDS A;  1ZM1 A;  3ACF A;  4PT6 A;  1SG3 A;  2XBO 2;  2YDE A;  5C6C A;  4DFS A;  5FXZ A;  4AQT A;  4WM7 B;  4YAR A;  1T2X A;  1IG3 A;  2FZ2 A;  3A23 A;  4OMD A;  1AX0 A;  3MDP A;  4CCO A;  2QQM A;  2WQ4 A;  3VBF A;  4DUX A;  3KD4 A;  4FPY A;  3BI3 A;  1UU6 A;  1M4W A;  4GAZ A;  1HDK A;  1CAW B;  5H9S A;  4FOW A;  4YW6 A;  3VDD C;  1SLT A;  3IAP A;  1FNY A;  2X10 A;  2D3R A;  3ZXD A;  2RR1 1;  2W9X A;  1ND3 A;  1LES A;  2WWS A;  1UIJ A;  3ZN4 A;  4CDU C;  4BXF A;  2RM2 3;  4GKX A;  5JSR A;  2YFZ A;  3D3A A;  5IAV A;  3O1O A;  2VNO A;  3SC7 X;  2ZGU A;  2JDK A;  4WZC A;  2UYA A;  4HG6 B;  4KWJ A;  5FYB A;  3U78 A;  5GZG A;  1HRI 3;  2FD8 A;  3MV0 1;  2A71 A;  4QPI C;  2EIE A;  4A7Y A;  4XFF A;  5E89 A;  5FYZ A;  4YM1 A;  5F6K A;  4EV0 A;  4N53 B;  4NHL A;  5IWF A;  5A7P A;  3N7J A;  2WZR 3;  2GN3 A;  1SLA A;  3MLJ A;  2NYY A;  3D0S A;  1F5J A;  1GR3 A;  2PA7 A;  3AMM A;  1F4H A;  2AUY A;  2GNT A;  3O1T A;  2BU9 A;  3DKW A;  2XH6 A;  4ONU A;  2VNG A;  5FZ8 A;  2RS3 1;  3TN9 2;  1YYN A;  5A3U A;  5A80 A;  4BYY A;  4ASM B;  1QQP 2;  3I59 B;  1MVQ A;  4MVT A;  3VB9 A;  2DYC A;  2X5I C;  4AVA A;  4UW3 A;  2QQP A;  4Y20 B;  2Q0A A;  1AR7 2;  3I2O A;  4P9Y A;  4JTN A;  3SNM A;  4FP3 A;  5F5I A;  4IEQ A;  4N8M A;  1B35 A;  1UZ0 A;  4ZS3 A;  3ZM8 A;  1Q5O A;  2VGD A;  5A3O A;  1STM A;  5LBF A;  3VBS B;  2Y26 A;  4HXC A;  3LF7 A;  1JZ8 A;  4AGG A;  4KQ7 A;  1GWK A;  1TE1 B;  3I2D A;  3THP A;  1GNY A;  5A6Y A;  1D4M 3;  4NAO A;  1NT0 A;  2WLP A;  4ISR A;  4RA0 A;  5G05 L;  5SV8 A;  1K12 A;  1U0A A;  3AZV A;  4TN7 A;  1JU4 A;  3FWE A;  4J6G A;  2GNB A;  3AYA A;  3FBY A;  5JDB A;  3M3Q A;  5F9T A;  5IVV A;  1N47 A;  1W6Q B;  3B69 A;  4AXO A;  2A3W A;  2K9Z A;  2WA3 A;  3P5B A;  1CWP A;  3CL1 A;  2D6K A;  4MET A;  4XDO A;  2RMU 1;  1COV 1;  5KXD A;  4PIX A;  1XBF A;  2VQA A;  5JOX A;  4R8H A;  3NO8 A;  1W28 A;  3KCC A;  4KL1 A;  3UJO A;  1R09 3;  5FYI A;  5F3E A;  1PK6 A;  4L0P A;  1CZV A;  3WY6 A;  1DZT A;  2KR2 A;  4RFT 0;  3RMY A;  5C8C A;  4WM7 C;  2LM3 A;  4FBF A;  4LT5 A;  1HN0 A;  4EQV A;  4PI0 A;  3W20 A;  4HLT A;  4E8D A;  1Q3E A;  4X8P A;  1NZI A;  1DF0 A;  5L7O C;  2VOT A;  1PVC 3;  2FDJ A;  5LCW L;  4KG0 A;  2FQP A;  3Q8B A;  4LA2 A;  3T30 A;  3PL0 A;  2V73 A;  4W65 A;  1C28 A;  2D6P A;  3V0B A;  2VZU A;  1UW8 A;  2VMG A;  5F5Q A;  4I30 A;  4OVE A;  4DEQ A;  1HXS 1;  4YZ1 A;  4DB5 A;  1CJP A;  3RNS A;  3DF0 A;  3NKG A;  1CIW A;  3ZX7 A;  1OBN A;  2IUW A;  1NY7 1;  1UY0 A;  1H2M A;  2BEO A;  2J42 A;  5GKA C;  3S57 A;  2PTM A;  1IQD C;  4PLN A;  4BH9 A;  1UYZ A;  2ENR A;  5EP9 A;  3WDV A;  2JG8 B;  2P17 A;  2XDV A;  4CRQ A;  2JDM A;  3WW3 A;  2AAC A;  1RUC 2;  4N53 C;  2I2S A;  5BPX A;  1ND2 B;  2BBA A;  3EQE A;  4LE3 A;  1VBB 3;  1QOO A;  4R9B A;  4AE2 A;  5EZW A;  3V0A A;  4Q4X 3;  2A1X A;  4Q0V A;  1L7Q A;  4N7I A;  3FC0 A;  4YVW A;  4AVT A;  3L2Y A;  4S2F A;  5C3R A;  4QHB A;  4AI9 A;  4XFI A;  2MHF A;  4YGB A;  4A4A A;  2RJK A;  3CQO A;  3MHZ A;  2VW2 A;  1GP5 A;  4ZON A;  3CLP A;  3AB0 A;  1GOG A;  2ORX A;  5EIY B;  3Q8E A;  3WXP A;  1CPM A;  2BGO A;  3GDB A;  1LEN A;  3GXU A;  4GB3 2;  2DCK A;  2VUA A;  4MGS A;  5BY5 A;  2BNM A;  2MEV 1;  4W6Y A;  1C57 A;  2HWF 3;  3MFA A;  3PUI A;  5ACA 2;  5H9R A;  3O0X A;  1SLB A;  1UYY A;  1XPW A;  5LWB A;  2A6W A;  1S0E A;  2WR9 A;  1V6L A;  3GF6 A;  1A6C A;  5A32 A;  3H8U A;  5A6Z A;  3QH7 A;  1ZRI A;  3EB7 A;  1BZW A;  2KD7 A;  3IDB B;  2PHT A;  3ALQ A;  2NMN A;  3IDC B;  1NCR B;  1MS9 A;  3USU B;  3SCF A;  4A45 A;  1H8T B;  3PLQ A;  3ZXL A;  4Z1V A;  1Y43 B;  4HVO A;  4RS5 A;  3IWZ A;  3C7H A;  4PQQ A;  5JXH A;  2CHH A;  5A1F A;  3ZR5 A;  3J26 N;  4S2D A;  5JR2 A;  1ASJ 3;  1Z78 A;  1OA2 A;  1REF A;  3PNA A;  3AL6 A;  3SMH A;  3DPR A;  1ZRC A;  4LBQ A;  1LOG A;  4DMI A;  2E7Q A;  2PHR A;  1WA4 A;  2XXZ A;  1SFN A;  2OQ7 A;  4D6Q A;  1S0B A;  4SLI A;  5FK8 A;  4BIF A;  3U4S A;  4C0B A;  5JMC A;  5JPM B;  4CU8 A;  4URA A;  5GZF A;  1XXN A;  3I2F A;  2W92 A;  2CGN A;  5E6H A;  5FZK A;  1XRU A;  1W6M A;  2VVE A;  3W59 A;  2XBO 1;  4XAB A;  5KWR A;  3BU0 A;  2Y8K A;  3BN6 A;  2C4X A;  1UY4 A;  2PHU A;  4R9D A;  1CD3 G;  4Q4W 1;  3M7A A;  4CP9 A;  4L92 A;  4LO8 A;  4CCM A;  2C9K A;  5C33 A;  4IER A;  1ULP A;  3I2G A;  1LOA A;  4MOA A;  5GM0 A;  2BQP A;  3N9M A;  4R9A A;  2DV9 A;  2QKD A;  1W06 A;  4GUL A;  5FY5 A;  5C3O A;  2E51 A;  2XOM A;  3JD7 1;  3GCW A;  4Q4V 3;  5DN2 A;  4QGN A;  4Y1X A;  4NMI A;  3JBG 3;  5T3N A;  2JG8 C;  1PGW 2;  2W5F A;  5LZ6 A;  5J7M A;  4CUA A;  4YG3 A;  3NQH A;  2BDR A;  4QU2 A;  4OI1 A;  4Y24 A;  3VZN A;  2BVB A;  1J1L A;  1ND2 C;  2RS1 2;  3MIC A;  1NG0 A;  4UXA A;  5FZD A;  4B3N A;  5A1L A;  3I3E A;  1W05 A;  2E63 A;  4MSV A;  3H9A A;  5FV3 A;  5D21 A;  1H1A A;  2HWD 2;  3I2H A;  5FFO C;  4MYE A;  1DYP A;  5KXB A;  2UWB A;  4YM3 A;  2VZQ A;  2O14 A;  2ATF A;  1LOC A;  1AR8 3;  4BLI A;  1UL9 A;  5CKN A;  1ENQ A;  3RI9 A;  2DVG A;  3LB9 A;  5AC9 3;  4MLO A;  1LGB A;  1AR7 1;  4COZ A;  5EJ3 A;  4B4P A;  4FFH A;  1W2O A;  2VTX A;  5FY9 A;  2L9L A;  2YB7 A;  4JDM A;  5IT6 A;  2WO7 A;  4YGE A;  1NCR C;  3X29 B;  3ZIX A;  1A3K A;  1BKZ A;  1WCQ A;  1PO1 3;  2JIC A;  1H8T C;  1MEC 3;  1YQ8 A;  2VEC A;  5FLJ A;  4KI5 M;  5IUQ A;  3POF A;  5FMO S;  4MV2 A;  5FY7 A;  1OI6 A;  3I3D A;  4E4H A;  1UZW A;  2B39 A;  2PYT A;  4LKE A;  4CCJ A;  2GMM A;  2JB8 A;  2BP6 A;  5D8A A;  4TLG A;  2VVD A;  1BBT 1;  4OCT A;  1AL2 2;  1GAN A;  2OZJ A;  1YLL A;  2VU9 A;  3LEM A;  1W6P B;  1ZYB A;  4XCA A;  4AED C;  1VB4 A;  1POQ A;  1ND3 B;  4QPG B;  3VZJ A;  3N9P A;  2G9Z A;  1JOD A;  5LA1 A;  1RUD 1;  5FZL A;  4XZP A;  2YFU A;  2PMW B;  1LED A;  1Q8P A;  1N1S A;  1W8Z A;  2R04 1;  4E2Q A;  3OY8 B;  5E16 A;  4YW7 A;  3EHK A;  3ECQ A;  1NCQ A;  5I0U A;  1MS5 A;  3K46 A;  2WZ8 A;  1VBE 1;  3ZIW A;  3WDU A;  2D40 A;  2XJV A;  5FYC A;  1XOY A;  5F5C A;  3S6P A;  4AL9 A;  1DHK B;  3MYX A;  1W0N A;  2R06 2;  3DGT A;  3H3U A;  4KU7 A;  4V2V A;  1L3J A;  2BOJ A;  4AHX A;  2VMH A;  3FLT A;  1BEV 3;  1OFN A;  1J3Q A;  2WL1 A;  3LKJ A;  1DQ1 A;  5CFD A;  3O12 A;  3ZN5 A;  1GOF A;  1NUK A;  1X36 A;  3H8R A;  2HWC 1;  4QXH A;  3FJS A;  4YFZ A;  5GZC A;  2CL2 A;  4OUE A;  1DQ5 A;  2LRP A;  2DUP A;  4LLF A;  4Y3O A;  4A44 A;  2W47 A;  5I0D A;  5FYY A;  4XAE A;  1JZ6 A;  2OA2 A;  2ZPX A;  4PF5 A;  3VHP A;  4AFA A;  1RUC 1;  3H1W A;  1QJX 3;  1XB9 A;  3BU7 A;  3ZYP A;  5FPL A;  4LO5 B;  4A41 A;  1LCL A;  4BM8 A;  2JKX A;  4LMF A;  3E1F 1;  2NQY A;  2Z79 A;  2NLR A;  3WD5 A;  2FCT A;  4KG8 A;  4NHK A;  3TN9 3;  4ATE A;  3H0O A;  1SHW B;  4CCK A;  5C9A B;  1QQP 3;  1QXJ A;  4GB3 1;  4FAH A;  1YQ6 A;  4MGK E;  5LA0 A;  4YGC A;  2YPJ A;  5IHR A;  1JUI A;  1XE7 A;  2Z4F A;  3ZO0 B;  1S2K A;  2PLV 2;  3WF1 A;  5ACA 1;  1GZW B;  1WMF A;  5FZM A;  4OHZ A;  3RMX A;  4DO0 A;  2WNV B;  3AFK A;  4LQR A;  4QB1 A;  2A75 A;  1ST8 A;  4BDV B;  3S0M A;  4LBL A;  5FZ3 A;  3U11 A;  3ZFF A;  4DZG A;  1RXG A;  2AZ5 A;  4NR1 A;  4YFW A;  5GLV A;  5LAS A;  4LUM A;  4Y1V A;  3I4I A;  3ZDV A;  2OII A;  5FP7 A;  3RS6 A;  4WVZ A;  2I07 B;  2WO2 A;  4UOJ A;  1MZ6 A;  4D0Q A;  2C26 A;  1YFY A;  2R1B A;  1G9A A;  3RZG A;  3HOB A;  1MZF A;  2R1D A;  2RM2 2;  2VW0 A;  1UPI A;  5JOW A;  5HXV A;  1RGS A;  1W6N B;  4AI0 A;  2D5H A;  1RIR A;  3E5U A;  1RMU 3;  1VBD 2;  1ZA4 A;  2IVI B;  3JU9 A;  4Q8L A;  4QPG C;  1HRI 2;  2OUJ A;  5FPU A;  5JCT A;  5LA2 A;  4MXV A;  5FBZ A;  2VH9 A;  1UMI A;  2E26 A;  5A6X A;  5BNO A;  3MV1 1;  5FZF A;  3JB4 C;  3H1M A;  4Y33 A;  1LU2 A;  3OBZ A;  5F2W A;  3ZFE A;  5C8W A;  1SDD B;  4NPL A;  3WOG A;  3ZXK A;  4IEW A;  4O61 A;  4XYX A;  1IS5 A;  5JR7 B;  4B7K A;  2DTW A;  3MIH A;  4CCE A;  3DUI A;  2ADD A;  1GQG A;  5FCC A;  2CDO A;  4YG0 A;  4NPM A;  5G04 L;  3H3Z A;  5L9R A;  3RZJ A;  1AHS A;  1FOD 2;  5KHI A;  1LJ7 A;  1LOD A;  2HWE 2;  4JGY A;  2WYF A;  3GZE A;  3OGR A;  2D44 A;  3GYD A;  1UY2 A;  1W9W A;  3OBT A;  2BFU L;  3FMG A;  1MAC A;  4IV3 B;  5FR3 A;  2I45 A;  2WWU A;  3RWK X;  1LHW A;  5IVF A;  5B4N A;  4D94 A;  2ZKL A;  5FAX A;  4Q4Y 1;  1PX3 A;  2VOW A;  5FZE A;  4WVM B;  5FMD A;  4QPY A;  4AHZ A;  3VBR A;  5A32 B;  3VD3 A;  1OF4 A;  1UOJ A;  3KVA A;  3PDQ A;  4OI4 A;  5CBL A;  1D7P M;  4U36 A;  4NJ4 A;  4GZ9 A;  1W2T A;  3CKH A;  3OEB A;  2EIB A;  1JZ4 A;  3QD6 A;  3RQ0 A;  3FFQ A;  1VAL A;  4AFB A;  3PVE A;  1IQA A;  4XET A;  3LZZ A;  2VG9 A;  5C9A A;  2VW1 A;  1YI9 A;  3NWK A; 
#chains in the Genus database with same CATH homology
 4ZS2 A;  3T3Y A;  3BU0 A;  3H8R A;  4QHO A;  4IE5 A;  3BTY A;  4QKF A;  3BKZ A;  3T4V A;  3RZK A;  4NRM A;  4NIG A;  3I3M A;  3I49 A;  4MG2 A;  3BTX A;  4CXY A;  4RFR B;  4MGT A;  4ZHN A;  2FDK A;  2FDH A;  4IE0 A;  4NRP A;  3I3Q A;  3H8X A;  2FDJ A;  3RZL A;  3O1R A;  2FDI A;  4NIH A;  4NRQ A;  4IDZ A;  3BTZ A;  5F8P A;  3S5A A;  3KHB A;  3O1S A;  2IUW A;  3RZG A;  3S57 A;  3H8O A;  3RZH A;  2FDG A;  4QKD A;  4CXW A;  4IE7 A;  3BIE A;  3T4H B;  3O1P A;  3O1V A;  4NPL A;  4O61 A;  3O1M A;  3O1O A;  3BUC A;  4NID A;  2FDF A;  2FD8 A;  4NII A;  4NPM A;  4OCT A;  3RZJ A;  4IE6 A;  3RZM A;  3KHC A;  4JHT A;  4CXX A;  5DAB A;  3BI3 A;  4O7X A;  3O1T A;  3O1U A;  4IE4 A;  3LFM A;  3I2O A;  4NJ4 A;  4ZS3 A;  4QKN A;  4QKB A;  4NRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...