4NIDA

Crystal structure of alkb protein with cofactors bound to dsdna containing m6a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
203
structure length
203
Chain Sequence
QEPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Switching Demethylation Activities between AlkB Family RNA/DNA Demethylases through Exchange of Active-Site Residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/dna
total genus 48
structure length 203
sequence length 203
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2013-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4nidA00
4NIDA 4NIGA 4ZS2A 4NPMA 3T3YA 4QKBA 3T4HB 3RZHA 3S5AA 3O1PA 4NJ4A 4OCTA 5F8PA 3O1MA 4IE0A 3O1TA 4CXYA 3LFMA 3O1VA 4NPLA 3O1RA 3RZKA 2FDKA 4IE5A 4IE6A 2FDGA 2FDFA 4O61A 3BIEA 3S57A 4JHTA 4IDZA 5DABA 4QKNA 3BKZA 4IE4A 4ZHNA 4O7XA 4QKFA 4NRMA 3BTZA 2FDIA 4MG2A 4NRPA 3T4VA 4NIIA 4NRQA 3BTYA 3O1UA 2FDJA 4RFRB 3I49A 4MGTA 3RZGA 3BI3A 2FD8A 3KHBA 3H8OA 3BTXA 2FDHA 4CXXA 4NROA 3H8RA 3RZJA 3RZMA 3I3QA 4QKDA 3BUCA 3BU0A 4CXWA 4NIHA 4QHOA 3H8XA 3RZLA 3O1OA 4ZS3A 4IE7A 3O1SA 3KHCA 2IUWA 3I2OA 3I3MA
chains in the Genus database with same CATH superfamily
5A33B 4RQPC 1UOGA 2ORZA 2JG8B 4META 3LWCA 3RZHA 5IJRA 3BALA 1PO11 3HEIA 1DP0A 4KNCA 1LR5A 3I2KA 3HNMA 4BISA 3M3IA 3FE5A 3USSA 3HJRA 5C9AB 1PHMA 3AX4A 4IV3A 4D7TA 3A23A 5FLIA 3FHAA 4QM9A 4JDNA 1RB8G 1K3IA 2OZJA 1JYNA 1Y9QA 1C8M1 4IEQA 4IW3A 3VBFC 1OPMA 4IV1A 3ZN4A 4NPLA 2ADEA 4I3PA 4NR1A 5JMOA 1MVEA 4O9GA 4XEZA 3ZSEA 5FYIA 1MS3A 1QJZA 4YSFA 5HPOA 4Q4V2 3U1XA 3PVBB 5IVCA 2WABA 3H50A 4XYXA 5C8CB 1W8ZA 3RMXA 3B01A 1FPN3 3MUZ1 1JS9A 3KT1A 5EZWA 3T1LA 2XB6C 4AL9A 3KQRA 2CSGA 1LHNA 4CDQB 5FZLA 5CAZA 3D6EA 5ANQA 2IZWA 3POFA 2D98A 3VBUA 1UO9A 1FMD1 2HKXA 5CFCC 4FO9A 1AHSA 1H2KA 4CSWA 1I1EA 1W6NA 2OZ6A 2PQQA 2C24A 1NCRC 3PTYA 5KHGA 3QD6A 2TBVA 4IETA 1WCDJ 1F8VA 3URFA 1B35C 5H9PA 2ZKNA 5FZ3A 5HCBA 3O1UA 3N7KA 4GMP3 3QH7A 2VZSA 2AUYA 2W87A 4YM2A 2F4LA 5JVVA 3H1WA 1OQEA 3T09A 1AR93 3ZFEB 4JGZA 2VZTA 4XDOA 1QQP1 4E4HA 1V70A 4RQPA 3TYJA 4NWVA 4AWDA 3LGRA 4C91A 4Q4W1 1US2A 1XYPA 1VBB2 3MIGA 5HXMA 1QOOA 1RUG2 4GH4C 1NXD1 2WS92 2K9ZA 4OQ9A 3AK0A 2LROA 4LKDA 3LDBA 4XETA 4DRRA 1FATA 1VBC2 2GZWA 4CYDA 4CVUA 2UURA 3CDZB 1O4TA 4BQ5A 1I5PA 1UOJA 1W6OA 5JXHA 3OUJA 1F15A 2EVXA 3J7HA 2JKXA 2QDRA 3BYWA 5JZGB 1ZBA3 3VKFC 1W0OA 4GWNA 1N1SA 3VDAA 3T0AA 2GP3A 1LGCA 1LTEA 2VOKA 1GUIA 1J84A 2CTVA 3ZYJB 4AAPA 4IEUA 5LY1A 4QHOA 3POJA 1YFXA 4IV3B 5LY2A 1N1TA 3U75A 5GZGA 4QX3A 2J1TA 4FCAA 5CFCA 1ULOA 3H1MA 3KV5A 4XUTA 1P8JA 4B3NA 4WM7C 4D69A 5LA0A 4IV1B 3AC0A 4ISRA 5LASA 1GWMA 2VNRA 4DXTA 4ASLA 5EP9A 1NCRA 1WBLA 1GQGA 3OSDA 4ES9A 5LEJA 4AE2A 4UF0A 3UKNA 2IUWA 3VD7A 3JD71 3ZSLA 3I2OA 2HEVF 1FOD2 5B2GB 4Z8BA 4S2GA 3KVBA 2DU1A 2Z69A 1L3JA 4H7MA 1BBT2 5L19A 4DUVA 3J26N 1K42A 5JMCA 3S30A 4CP1A 4QWNA 5IVYA 5BNPA 1AR82 4P9YA 5GZDA 2BNMA 4OCTA 1O8SA 4AFCA 2ID4A 3M8LA 4N53C 1U5IA 1EUTA 4DY5A 3VN4A 4HVQA 2A73B 4FAHA 2W1QA 4CDWA 2JECA 1XNKA 3FFZA 4HFSA 1BEV3 3OG2A 4HT1T 4AEDB 4OI0A 1UX7A 1R081 1FX5A 1IS3A 2W3JA 1JZ2A 3S0MA 2QVSB 3ITQA 2FCTA 1SBDA 3DPRC 4HXCA 2IFRA 4E8DA 5FK7A 3GALA 1DQ6A 1UXXX 1IG3A 1UZWA 3LIGA 4XFGA 3WDTA 1AL0G 2I74A 3KD4A 3PL0A 1OOPB 4XAAA 2E53A 1KJRA 4LE3A 4PLOA 3RSJA 3ZYRA 1DQ0A 2Z79A 2OS2A 1SEFA 5L9RA 1IS5A 2E7QA 2RDRA 2GN7A 4MG2A 1OA2A 1HV1A 2CHHA 2DCTA 2JB8A 5DAPA 3VZOA 4EV0A 4N9HA 5KXBA 2RMU2 3AJZA 1RINA 5K8SA 3ZXLA 5FZKA 1YC61 5DQ0A 3WG1A 2NMOA 3I3EA 2YGLA 3JUUA 4HKOA 5T3NA 3VBFB 1MZFA 1QJU1 1VBD1 3WHUA 1CPMA 4RFT0 3J7NA 1FMD2 1SDDB 3NNLA 5FXWA 4BMEA 3C2UA 4P5YA 1UY4A 4LTAA 4WVVA 1QJY3 1ASJ3 1ND3B 1DGRN 1PMJX 1DQ5A 3KQ4B 1ZZ7A 4JGYA 3UK9A 1LOBA 1R1A3 1YQ5A 3LB9A 4KG8A 2RS51 3USUA 1PO23 1RUF3 3GHMA 3AB0A 4XUOA 3KMHA 1D4M1 5A7OA 2P5BA 4UFIA 1W9TA 4QB1A 4N53A 4YLZA 4Y4YA 4YNIA 1H8VA 2WQ8A 2PHTA 2J1SA 3P6BA 3LOIA 3OD4A 4DINB 5FZGA 1QQP2 1HIXA 2ZMLA 4JVAA 2HEYF 2VMFA 3LD8A 4A45A 1QNWA 1FYUA 1XSRA 4Q4W2 1N47A 1NCRB 5C8WA 5F6LB 1W9YA 3FHIB 3H3LA 1UPIA 2XJPA 2ZGTA 3DPRA 3MPBA 4NIAA 4A6SA 3BOWA 4LBJA 4PF5A 1B35B 3POGA 4HPKB 2A6VA 1HRI2 4BQXA 1HB2A 1SFNA 4HONA 5F39A 5EJ1B 3D0JA 4KWKA 1PVC1 2W1WA 5I8SA 4P00B 4A6OA 3HN1A 2VCAA 3AZXA 4IEPA 3JXSA 3U37A 1Q43A 3CJIC 3VKLA 4K20A 1XNDA 5E8AA 1JYVA 4LUMA 3TEWA 4GH4B 5A6QA 3HOBA 1UN1A 3LA2A 3OUIA 4I09A 4ZY9A 1BK0A 4PCRA 3PDQA 3KHCA 3EXUA 4LT5A 4LKSA 5FV3A 1HDKA 4ARYA 4AXOA 2A6YA 1K5JA 2DCYA 2VULA 2W52A 1NKGA 2BGOA 5A1LA 1JZ8A 2LS6A 4FTSA 1H1IA 1QIQA 3A22A 1MS0A 1WW6A 4L11A 2ZGKA 2J1UA 4OHZA 4ET7A 2XLAA 4IE0A 4CA9A 2C9AA 5IYYA 2VQUA 4COUA 5FUIA 3JD72 4XIOA 4OQ8A 4QXCA 2VH9A 3O1VA 3IDBB 2CGOA 4PDWB 1DLCA 4YZ3A 4J25A 4Q4Y3 4AVVA 1KXGA 1O91A 3T08A 5K0UC 1H8TB 4NAOA 1GZ9A 2UY9A 2YV8A 5A33A 3JU9A 4NHXA 1C57A 4QX7A 2BYVE 1GP5A 2H6BA 2XL9A 3PNAA 5IK4A 4B7EA 4AVSA 1CAXB 4WM7B 1UIJA 4Y26A 3WQ7A 2HWB1 3PVOA 1CAWB 4Q4V3 1HJFA 1XE0A 1GNZA 2PN5A 2X5IC 3WNPA 5FZ6A 1MS4A 1SLBA 3OPTA 1M4WA 2WN3A 1R082 5JXGA 4LXLA 3AFGA 4XJ8A 1W9WA 1OFNA 1RTVA 2DCJA 2OVUA 2ZCWA 2OPWA 3NJVA 2NP0A 1SCSA 1QMJA 3BOPA 3M7AA 5BV6A 5EHDA 1HKDA 4EQVA 1W9SA 3UGGA 3X29B 2CGPA 3VLBB 3AMPA 4YG0A 4K1ZA 4AYUA 4LJHA 5GZFA 4E4DX 3RI9A 1ZRCA 1ZRRA 2YPDA 3AXDA 3CJIA 2UYBA 3ZYFA 2X09A 4Q0VA 3SQOA 3PUSA 1JH5A 1L7RA 4BU2A 3IN9A 2ZHNA 3LF7A 3WCRA 2WT2A 5FZ7A 5LEKA 3IDAA 2RM22 3WX5A 1POV3 3WQBA 4AGRA 3LE0A 2QDNA 2EXKA 4GMP0 1WUVA 4AEKA 1G9AA 1UPSA 1GNYA 2MPFA 4YW5A 2VUDA 1GQPA 1I5ZA 4M3CA 3WZ1A 5IVEA 3E5QA 5CVRA 4DIQA 2QZ3A 3BCWA 3VUOA 1CAUB 5K4LA 1X8MA 2VTXJ 2W46A 3LEIA 3NNFA 4LBMA 3GHNA 5EIYB 1VBD2 2I2SA 3CEWA 5GJ6A 3ST7A 3S5QA 1JW6A 1YUDA 1VBB3 4RL7A 3B3QE 3B9IA 4AEMA 5FP7A 1RUG3 2WNOA 3AMNA 1NY71 1AXKA 2ZGOA 1SZBA 2QQVA 4GWMA 1RGSA 2XWJB 3WW4A 5JSRA 4XFHA 4ASMB 4QKDA 1GWKA 2RS52 1KEXA 4JX0A 1MS9A 1VBC3 5A3MA 3BU0A 1AXYA 1D4M2 1ZVFA 2IVJA 3PTRB 3T30A 1Y9MA 4Y22A 2TEPA 5FO9B 1XJAA 2V09A 2WNUA 4BPZA 1O3QA 3AMMA 1S2EA 4MH0E 4UW3A 2VC9A 4P9GA 1BYHA 1WCUA 4IERA 5FP8A 4KU8A 2X5IA 1GBGA 3VZNA 1CZVA 5FLHA 4GKXA 1TMF3 3B02A 5CA6A 2G19A 1F35A 3PHMA 4EN9B 2B5HA 3BODA 4OYUA 4TZDA 4ZS3A 2WQ4A 2QQWA 1RUH2 5T55A 2DFBA 1Z0HA 4PBOA 4RHV3 1MQTC 2ZBJA 1LOCA 5T5JA 5K7PA 4IEZA 3I2GA 4LO6B 5A3UA 4C8DA 2AEYA 5C70A 4ZS2A 2A6WA 4F8AA 2JDKA 3QBQA 4QPGC 5FZBA 3T4HB 2ZAHA 4QX1A 1ENSA 1SBFA 1FOD3 2C4XA 2HWE1 5B4NA 1BBT3 1G7YA 2VNOA 3QCWA 3MW3A 4GJYA 1SACA 5A7SA 3ZYPA 4GB31 4BQWA 4I0BA 1HXS1 2YXSA 4N7UA 3QACA 2Y6FA 4I30A 4RR3A 2YYOA 2BWCA 2Q8CA 4RGKA 4LBOA 1AYM1 5FJHA 3ACFA 5FXVA 1QEXA 3C7GA 4JQRA 1A6CA 1UIKA 2ZACA 5F5AA 2VGDA 1V9U3 2WO7A 2ZGRA 4M0HA 3DYPA 5KHKA 2DU0A 3AKRA 3M3CA 1K45A 3HT2A 4UBGA 1C8NA 1NUKA 5DZEA 5FJKA 1PGL1 3THCA 1VRH1 2GH8A 2QQJA 2WFPA 1PO13 2W1UA 3AVSA 4OHXA 5F3EA 1RUD1 2D3SA 2FQPA 4JDOA 2BBAA 2WNVC 3ZYGA 1DYPA 5M0TA 1QOTA 3O14A 4KH9A 5BNOC 1GZWB 2D6NA 1WLDA 5FMOS 4Z2AA 2W68A 1C8M3 3MDPA 2K46A 2PHFA 2YMZA 3KV4A 1GLHA 3OGVA 3B94A 5KXCA 1OQ1A 3LSEA 2I45A 4UFLA 3RWNA 5AVAA 2D44A 5FP4A 1FNZA 4KI5M 2NQYA 3WLUA 3BPZA 3MFCA 4FTBA 1N1VA 4B29A 1REFA 1IKQA 3KF3A 4NHLA 5HV0A 1IPSA 1KFUL 1FPN2 5FY0A 1HB3A 2YUEA 1RHI1 3VDDC 1K5MC 4RFRB 2QQNA 3N9OA 2D3RA 3UGHA 5K0UB 2A70A 2DWRA 1LEDA 2A1XA 2JG9A 2VL4A 3NJYA 4K8RB 4MLOA 5F3GA 3NSTA 4YPJA 3SH5A 3T0DA 2V72A 5KHHA 4FBFA 1FMD3 4TTGA 3BI3A 4QPGA 1O4ZA 1IPKA 3KV9A 2P34A 2UYAA 3MLKA 4WVMB 2Y6LA 3OGSA 1ZZ6A 3O12A 3IWZA 4QX8A 4L0PA 4XW3A 4C1XA 1GZCA 3WNKA 4QPWA 2VQAA 3CIHA 1SBEA 4FXKB 3C3VA 4AAXA 2WKKA 3W58A 1JYWA 4MYEA 1GICA 1YFWA 1AR92 1QY4A 5J48A 1H0BA 1QQP3 2VPVA 4Q1PA 4YVWB 5FXXA 2XGXA 2Y0IA 3U11A 3PIGA 2KXLA 2ILMA 1QJX1 5IVJA 3WG2A 4Q4W3 4KGGA 3NKTA 3T2OA 2VZPA 1ZX5A 2PA7A 3HT1A 3R4DB 4P9XA 1DBNA 3N36A 4AFBA 1LHUA 1XNTA 4XF3A 3WNOA 4AQSA 4PLMA 1IG0A 3BVCA 5BNOA 5BYNA 3RS6A 2WZR1 3SCGA 3LEGA 1V6MA 3PJYA 4A41A 2QQMA 3O0WA 3KV6A 4HANA 2J1EA 2CY6A 2ZEYA 2RDQA 4XQDA 3MLLA 4DY3A 5L36A 4DEVA 3DL3A 3OY8B 1O4YA 5I0RA 3UT0A 2H0VA 5CISA 2XR4A 4BYYA 4JKKA 1J3RA 1SLTA 2V4AA 1KS4A 2D6OX 3RRDA 1XYNA 2H6CA 3AP4A 4ZZ8A 3I3MA 1PZ9A 4FQ4A 2J1AA 3T3YA 3FX3A 4BLJA 1WKYA 1PZ8A 2PTMA 2HWD1 3ZR6A 4IEYA 1SLLA 5J36A 3V0AA 3S5AA 4XMIA 4FOVA 1NA1B 1D0GA 5C3RA 1QH7A 2LUWA 2JDUA 1RUJ1 1WA6X 1XNBA 5DG2A 3MV11 4MXVA 2VUJA 2ZHMA 3HBKA 5H9QA 5FPXA 3I2DA 4XF9A 5J09A 2CAUA 4UI9L 2XHNA 5JSPA 4PIYA 1W6QB 3DF0A 2HLEA 4XQ4A 1BMV1 3UETA 4FPHA 3O1RA 4LLOA 4AF9A 1HQNA 4CCNA 4D6QA 5CADA 1LOFA 4LOSA 4N43C 2PHRA 3Q8FA 3OGJA 2FDGA 1V6LA 2ZTNA 5FYUA 2HWE2 4CP9A 1J3QA 2W5FA 3WW2A 3WDXA 2XLGA 4GB32 2XG3A 2ZXQA 1HXS2 4M0NA 1PMHX 4RS5B 4UFJA 3ZFFC 3CL1A 3VDCA 4Z1VA 5FZOA 5IAXA 1FNYA 2D43A 1MQTB 2VZ1A 4GWIA 2E32A 1XE8A 2R0FA 3FL7A 4EWDA 3MIHA 1Q8QA 3UYJA 3ZMNA 1BEV2 2PELA 2VOVA 3RYPA 1R083 5FMCA 1PGL2 1N3PA 1W8TA 3ETPA 4YW4A 1VRH2 2CU5A 2LW8A 3VD3A 4NHYA 2GNTA 1QWRA 2ADDA 2V4VA 3THTA 1AXZA 1RUD2 2OT7A 4EZ4A 2EALA 1XQNA 1IPJA 2VJXA 4G9SB 3WVJA 3OF1A 4LMFA 1UCXA 4BM8A 2Y26A 4UOJA 1NE4A 4QDSA 5EYXA 3WDWA 1WBFA 3QOPA 1PK6A 4XFCA 5D21A 4DXZA 5GZCA 2BBVA 2BP6A 3HD8B 1H9PA 5D8AC 2UU8A 3APBA 2RS31 5T50A 4FTEA 4MGTA 3ZN5A 4GULA 1UL9A 5IVFA 1POV0 4B1MA 1Y7BA 5FYZA 3M3OA 1IHMA 3PU3A 1TE1B 3WUDA 1HB4A 2WNVB 2RVAA 1RHI2 1QDOA 1ZZ9A 2BTVC 2PLV3 5FKBA 5FY7A 3ZSMA 5JAXA 3VL9A 1QJU3 1VBD3 2VMDA 1G9BA 3H8RA 3IZOA 3V64A 5DAWA 4FT8A 3AP5A 3MEPA 4GIQA 2PAEA 4N43A 5CKQA 1QJY2 2QCSB 3LA3A 2W95A 5DXDA 1URXA 4XFFA 3IDCB 4CXWA 4IESA 4CU6A 4XXPA 3PVNA 2WL1A 1L7LA 1LHVA 3AP7A 3LFIA 3TWIA 1D4M3 1W8WA 1K5MB 3VDDB 3V0AB 5CNAA 2YFZA 4URTA 1RUE1 2IXKA 4F7ZA 3RZLA 2NPIA 2ARCA 4CCDA 2PHWA 1W0NA 5FZ4A 1YFYA 5FYTA 3VBRC 4QQHA 1GMMA 1QJX2 4ZU4A 1PX3A 1S0FA 1CR7A 4LO8A 1EP0A 4PLNA 4NWWA 3LZZA 4JTNA 1Q5OA 2XXZA 3JZVA 5J7MA 2O8QA 3ACLA 5EFUA 2VNVA 2HWC1 2JEMA 2XQRA 1RL3A 2WZR2 1ONAA 4H2AA 2Y6JA 3WY6A 5F1RA 1GOFA 4QKBA 5LB6A 1PVC3 1W8FA 4ZPIA 1FI2A 3GZTB 2AACA 3J8F1 3VBUC 3MHZA 3SNMA 3GBGA 5D8AA 4QXHA 1VR3A 3IIAA 3NJXA 1X36A 3PUAA 3VZJA 1NQDA 5FMBA 3WOGA 2JE8A 1NCQA 1OLRA 3POIA 5JOWA 1OD3A 1KITA 3OEBA 3VDBA 4CCJA 1W2OA 4L9BA 3WNLA 2GMPA 2HBUA 1F5JA 2XWBB 4OULA 4FFHA 3WP4A 3UL2A 3OTFA 3TAYA 5F9TA 2OQ7A 1UZVA 2FDFA 5EJZB 4CU8A 4XE9A 1LODA 1RUJ2 5FYBA 3SXWA 3SEPA 4Q0QA 4V1PA 4KG0A 4JHTA 4JKMA 4ISQA 5DABA 1DGWA 4X8PA 1RXFA 1GR3A 2WAAA 2VE1A 3EB7A 3ECQA 3JB4C 1X9TA 4FOWA 1RMU1 3WT3A 1BMV2 4IE4A 1UAIA 4CUAA 4XZUG 3VBSA 2LM3A 4TWTA 2W91A 3FBYA 1T6BX 2D6KA 2NZ9A 4MGQA 2WUHA 2VUCA 1WD4A 1DGWX 4QXKA 3SITA 4Q4Y2 3IT8A 3PVEA 4DEQA 1UYPA 1UY1A 2R16A 4M4RA 1A34A 2CAVA 2ZGNA 4WM8B 1RUI1 4W4ZA 2ZX4A 1PNGA 5FZ1A 3JBG1 1AYN1 3DYMA 3HN3A 2R073 4V2WA 3VBRA 2JB4A 4P9LA 2HWB3 4AEJA 1C4RA 1X8EA 1GKBA 5A32A 1AZDA 3OBZA 3HVDA 3RVHA 5LWBA 3ROUA 3I97A 4YM1A 3TB0A 2YU2A 1U5XA 2XVKA 1GFF2 1DZQA 1WZXA 4JV4A 2PXJA 5GLWA 4CEYB 2UWAA 5BUVA 1LECA 2P6CA 3ZFFB 5LA9A 4AHWA 4LBQD 2JWPA 1E5SA 3AZZA 3LEKA 4JAAA 3TBDA 2FBEA 3ZYHA 4NROA 1OPOA 4XFIA 4LULA 2OUHA 2WIIB 2RS32 1ALYA 4M00A 4D6RA 3I3QA 5CG9A 2BFUS 2Q0AA 1W0PA 1O5UA 2JKBA 2JDNA 3CQOA 1Q8VA 1FXZA 2B8MA 3RG0A 3SCHA 5C5TA 1TME1 5KHIA 4MXWA 2AEZA 4BLIA 5BNPC 1UYXA 3U4SA 4HOOA 3G7DA 1GYKA 2L9LA 2ERFA 2VW2A 1OSGA 4JQTA 4LEJA 1CGPA 3LQCA 2QQLA 2P3KA 1TZOA 4FI9A 3MW4A 2EXIA 3KT4A 4KWUA 4CDWC 1V00A 1EAH1 3H42B 3AYEA 2JDAA 4FXGB 5D8AB 1SLIA 3H8UA 4BQ2A 5AFBA 3O1OA 5DUXA 4D6SA 4X6RB 2DBNA 3K77A 3QLQA 4NVPA 5JSOA 2VOXA 3H3UA 4A44A 4BMBA 5IT6A 1PGW2 1OD5A 1ENXA 2A71A 1CAVB 2EAAA 2N7GA 3N9MA 3OBTA 1POQA 2DUQA 2ES3A 3V0BB 5EPAA 4EE2A 2J7MA 3GF6A 1YIPA 4JKLA 3N9NA 5KXEA 1RUNA 5A3NA 1TMF2 1M06G 4OI2A 4Y3OA 2BU9A 2VNGA 4FOYA 1KDKA 2BV4A 4C0BA 3LFMA 3FN9A 2NMNA 4X8NA 4A7KA 3W59A 3ZIWA 2HWC2 3CO2A 1YQCA 4HVOA 2A7AA 3AZWA 4EN8B 5C7GA 4KWLA 1E5HA 4RHV2 4W6XA 4XUQA 4LBQA 5CYYA 1D2SA 3SKJE 2BDRA 3J8F2 3SEEA 3OPWA 1J3PA 3ILRA 1CJPA 1OF4A 5IK5A 4P9WA 4QB2A 3WDUA 3VKNA 4G3YC 4ZU7A 2R041 5JCTA 2HWE3 1F2NA 2J1RA 2VTFA 3MV01 4JGYC 1O3TA 3GM8A 2Y34A 1JZ5A 1I6XA 2XL7A 1HW5A 4GB33 5F5CA 5CB7A 2P2KA 2E31A 1B09A 1HXS3 3K48A 3CZUA 3K3OA 4S2HA 3FLRA 2IWGB 4HKLA 3SMHA 1QXJA 1XB9A 1AYM3 2BNOA 1NYWA 5JOYA 1UNBA 3EO6A 4HLTA 3I2FA 2XH6A 3VBUB 1V9U2 1H6YA 2WT0A 4D7SA 2A6XA 1MS1A 3NV2A 1HRV1 1W6NB 4OLLA 4QPIA 3FJSA 1VRH3 2ZHLA 1RMU2 3NL1A 4JTOA 5A3OA 1PO12 2XJRA 3K4ZA 3W20A 5A3TA 5JUVA 1RUD3 4BCUA 1UMIA 1JHJA 2G1MA 5EV7A 4E8CA 4EN0A 4JRAA 2XKOA 5LA1A 2HWF1 1KS5A 3DECA 2WDBA 2YG0A 2Z5WA 3B00A 1C8M2 1WLTA 2VAUA 5FYVA 2FZ2A 1NOVA 4ZXEA 1VMJA 2G4IA 2E7AA 1MEC3 4JGZB 3ZDSA 1RUI2 3MICA 3JBG2 1AYN2 3A0NA 4RQPB 1ZZCA 1CX4A 2P4EA 2VVDA 1OLMA 3M3EA 4Q0UA 2WJSA 3KCCA 4EYUA 2BUKA 3BTXA 4Q29A 4LUKA 3KZ4C 2HYXA 3MIEA 1RHI3 2MHFA 3NKGA 4GQ7A 2GH2A 3P5BA 5FP9A 3VBOC 4CCMA 2PLV1 1MZEA 1OFSA 3J7LA 1D4VB 1QU0A 3EQEA 1QH6A 4N8MA 4AFMA 1AJOA 2C26A 1UZYA 1V6KA 2XMLA 3UESA 5I91A 5KXDA 1CWPA 2X10A 4XUPA 1V0AA 5LBEA 1S0GA 1W6OB 2PMWB 2ZGPA 1AUYA 2B42B 2OX0A 3KT7A 4KGQA 5FCCA 5C5UA 1VBE3 2PHXA 3NJZA 1HV0A 1DGLA 3W5NA 4FVVA 4UW6A 1Q8PA 1SHWB 1XSQA 3N7JA 4Y33A 5C3QA 3H8XA 4E2GA 3HIFA 3N9LA 3UJQA 1VAVA 1JZ4A 4A7ZA 3NV4A 1TME2 4LHNA 1PZ7A 1AX2A 1W39A 5A7WA 3OYWA 5I0UA 3RI8A 3VD9A 5FKCA 4TLGA 5FPZA 2WAOA 4LBQB 1JUHA 1VB2A 4R9DA 4YW7A 3RZZA 5CFCB 1W2UA 2BPA2 1QJX3 2LALA 5T5LA 1HN0A 1EAH2 1XU1A 3VL8A 2SLIA 1W99A 3KB5A 4QDRA 4UF0B 5FZ0A 2Z2SB 4UYBA 2PAMA 5FY9A 4A2UA 4XACA 4HZFA 1MVQA 2WZR3 2V73A 2CV6A 4PIZA 2IXLA 2Q5TA 3OD0A 3CMGA 5C4WA 1E57A 3RFRA 5BNPB 4IEXA 1WA4A 4CEWC 4S2FA 1ST8A 3G6JB 1XRUA 3NNGA 5C3PA 5C3SA 2DVAA 1LJ7A 2F6BA 4CCCA 1Z78A 4GZ9A 4CDWB 4P08A 4Y1YA 2W47A 2XONA 4EWAA 4O61A 1WLCA 1JBCA 2HWD3 4I01A 1ODMA 3VBOA 3AFKA 3WNNA 1YRZA 2XKPA 1CD3G 3DN7A 4KWJA 3MUY1 4ONUA 1RUJ3 3VZKA 4UWDA 4LA2A 5TSWA 1W04A 1NX9A 1W2TA 3RGBA 4AVCA 4CE8A 1WWYA 2BEOA 2GNMA 5DAXA 5FY1A 1A8DA 3HAGA 3SC7X 3LPFA 4M4PA 2VMHA 1JUIA 2XQXA 4QKFA 1AJKA 5I8YA 1VAKA 1JYCA 3WP3A 2AR6A 2A3YA 1SMVA 4LOTA 1ZREA 1H1AA 1BCXA 3WF0A 4MHUA 5GLTA 2OPKA 1NZCA 2R30A 2ZS6B 3MBWA 3JQWA 1YLLA 3CU7A 5FXZA 4DUXA 1W6PA 2MEV1 3I7DA 1QF3A 3R4SA 1X33A 4LK7A 2WNUC 2R071 4CDXC 3I3DA 3POSA 1GZTA 5LK7B 4AHZA 2BVVA 4Z07A 2W92A 4XDPA 3RZGA 1HRV2 2FD8A 4Z2WA 2JICA 4Q0SA 5A6ZA 1UWWA 4F3JA 3WF1A 2XUMA 2DCKA 1D0HA 4IL7A 4JGYB 4JHZA 1UZ0A 5H9RA 5GALA 3USUB 3L9JT 1YO8A 3ZXKA 3AVRA 2JXAA 4FPEA 2XUEA 4CEWA 4OZXA 4N53B 1EUUA 3ZR5A 1GOHA 1OXCA 4YYOA 4K8FA 4TYSA 5FYCA 5JOXA 2RS33 4JDMA 2RV9A 4H3WA 5J1XA 5FQ0A 4IXLA 3ZFGC 4Q4X1 4YVSC 3V65A 4KL1A 1QGLA 5F6KA 1LCLA 4W6YA 1R091 2BGPA 2YC4A 5C71A 3DPRB 3SCFA 4LA3A 3ON7A 4NPRA 4AHYA 3Q9OA 2DF7A 4C0HA 4RR3C 4XVHA 4AK3A 2AYHA 2PLV2 4FPLA 5JPMB 1JU3A 1UOFA 2VQTA 4C90A 4LBKA 2YFUA 3VBHC 1ND2A 5IUQA 1QJU2 1LESA 2KA3A 2B4KA 4GALA 3J9SA 2IC1A 2WO3A 3FLTA 2IXHA 2JJ6A 3ATGA 1LOAA 2FMDA 2XJVA 1U5YA 1RJ8A 2DVGA 5E16A 3K46A 5H9SA 4QQ2A 5LBCA 3LA7A 4L8QA 4HSJA 2D6MA 4CDXA 1RUE3 3WF4A 1LKNA 1OUXA 4TXWA 4YARA 2MNGA 2C9KA 4COWA 1V6IA 3N3HA 4XXAA 4DZGA 1NLRA 1UKGA 3RMYA 1FV3A 3L2HA 3S7IA 3W21A 5LCWL 3O5SA 1LRHA 4Y5Z0 5GZEA 2XOMA 5L7OA 5DG1A 4IE5A 4IE6A 2HWC3 3FBMA 3ZXJA 4AQTA 1UX6A 4OVEA 5FZCA 2JG9C 5CFDA 5I0DA 3S57A 2UWCA 4Y1XA 3A4UA 1AX1A 2PYTA 1PVC2 2W2IA 1VLNA 2O8OA 3H7YA 1AL21 2VVFA 3J8F3 4PI2A 3WNMA 4DOUA 5EJ3A 1XNAA 1JZ3A 1XC6A 3E5XA 1TEIA 2Q8DA 3ZFGA 3ZO0B 4YW3A 4BIOA 4BXFA 2D5FA 3KGLA 4YVSA 4OI1A 5HCHA 4HMZA 1UMZA 1EYBA 4OMCA 5LBFA 3BU7A 1TNFA 2Y38A 5DZFA 4Y1VA 5C6CA 5HBAA 1DU3D 3M70A 5CIRA 4BK4A 3A21A 3F95A 3O1MA 4HK9A 2QQPA 3B7MA 4QXBA 1BXHA 2ZOEB 2EIGA 2O1QA 4NRPA 3D3AA 3VBHA 2ATFA 2E33A 1RIRA 2XJUA 4OHVA 1S2KA 5IWFA 3AJYA 4CEWB 3WDVA 4XFBA 1N1YA 3GNEA 3IB3A 4XZPA 2RS11 3CJIB 3WQ1A 1RMU3 3SH4A 3U78A 4DNYA 2ENRA 2SBAA 2EXJA 4ATEA 3TEYA 3TOJA 1DIWA 1DZRA 3PUQA 3TRSB 3MLJA 1UY2A 4A3ZA 3AL6A 4LIUA 3ZKYA 4DFSA 2JE9A 4BWOA 4M3CB 2TUNA 3SISA 3UV9A 3M2MA 1MEC1 1RUI3 3GYDA 2MEV2 1OI6A 2DVFA 1AYN3 3JBG3 5FPUA 2RE9A 2R072 2YC2A 4AHXA 2HWB2 2IFWA 1OURA 2AGSA 2YC0A 4Y1UA 5FUNA 3DYOA 4BQ1A 2VMGA 5DZGA 2G9GA 2QQOA 2WYFA 3POYA 1MZ5A 3CF6E 1W8UA 2TNFA 4XHBA 1ZA4A 4BQ3A 2BGCA 1VPHA 2NN8A 1W8OA 4XCAA 3TNPB 4INDA 4EROA 4PIXA 4YZ4A 1NLSA 3NAPA 4QGNA 4QQPA 1RJ7A 4Y22B 1FT9A 1REEA 2ZX0A 2WNUB 4LIVA 3ZIXA 3OOXA 2JDZA 1W28A 4XBNA 1VBE1 5ACA1 5JIAA 3I59A 1HX6A 1LAJA 2X5IB 3U14A 4NUBA 1LOFC 2JE7A 3TNQA 3VV1A 3I2HA 3NV1A 3GZEA 5L73A 4XJ9A 1R092 1GANA 4CU9A 4XF0A 5ABJC 1NT0A 1TME3 4BQYA 3AMHA 2WWJA 2WQZC 1WW4A 2R1BA 1X7NA 1VAMA 1OVSA 5FRAA 5JWPA 2D6PA 4FP3A 4NPMA 5AFEA 3LOBA 1Q8SA 4U36A 4I0AA 4AVAA 4MADA 1YNAA 1EAH3 3AP9A 3C7HA 1RUC3 3AYAA 4FPJA 1PIV1 1NY72 3NQHA 4LHKA 4YG3A 2VZ3A 2XJTA 3VKMA 4L2NA 2P3JA 4CXYA 4XBQA 5BNNC 1RYYA 1IZ3A 2VVEA 4TN7A 4LO5B 4C1WA 2XBO1 1UD1A 5FOBB 4RR3B 2IXJA 1PNFA 5BXXA 3CZJA 4LNVA 4J1WA 1PK6C 3ZN6A 4QGLA 2ZGQA 2BOJA 3I3BA 3O1TA 1SPPA 3PMSA 4XC9A 5A6XA 3WV6A 5FZ8A 2KM2A 3K51A 4HN0A 2WA3A 1JMUB 4RGAA 2ZEXA 3LIHA 4PT6A 5T5PA 4YW1A 4BIFA 2D7FA 3POWA 4CCKA 3MGUA 1VP6A 1JOBA 3DV8A 4LO7A 4B4RA 4MGZE 1WLWA 3HBZA 5A7PA 4QQOA 3BGAA 4IEWA 2R32A 4R4XA 5FO7B 1AL22 2EIDA 1U0AA 1YYNA 4N90A 1JZ7A 3LAGA 1JU4A 1VRBA 1LGBA 1OA3A 1UY0A 2R043 3WW1A 1GP6A 4YW2A 3KS7A 1OKQA 3VB9A 3PMEA 5C9AC 1CZTA 3WG3A 5ABJA 3GZAA 1Q3EA 3DKWA 5A80A 5AC93 1UOBA 4Y24A 5J37A 4FFFA 2JG9B 1AYM2 4DB5A 1APNA 1R1ZA 5AVPA 2E26A 3NRUA 1Q8OA 1TQ5A 2PHLA 1VBA1 2Z42A 1WMEA 2V5YA 3GGLA 3P3NA 2OYZA 4QPGB 1HRV3 2DDUA 1OF3A 2RS12 2WN2A 3N9QA 2VZVA 3LDKA 2D5HA 3IMMA 5C8CC 1XNCA 4FPYA 1W3VA 3OGRA 4CCOA 5BNNA 2XHKA 5FY4A 5GLUA 3GBFA 1UW8A 3MIBA 2ZMKA 2E63A 4R9AA 2HWF3 3RYRA 4MGYE 4CDQC 3VHNA 2E51A 1DFQA 1DDLA 2XVGA 1MEC2 4AQ2A 4FPOB 4IGOA 1N3OA 5J3UA 2QTWB 1OC1A 2VMIA 3DEMA 4W65A 5FR3A 1C28A 1BQPA 1NQJA 5IK8A 4K1YA 4ZONA 1NCQC 4Y5TA 1T6GC 1ZBE1 2HH9A 2BRTA 1ULDA 4M01A 1VALA 5D1IA 4CUGA 2JDHA 5CU1A 3KLSA 1EV11 2CL2A 1DYKA 1YJLA 4H55A 1OH4A 5BNOB 5F2WA 3P1IA 3AXEA 3LCPA 2GNBA 3JQXA 4MGSA 1WD3A 3ZFEC 3K75B 2P37A 2ORXA 4Y5SA 1G8WA 1Y43B 2YB7A 4QPYA 5FBZA 2JG8A 2Y8KA 4Q27A 5GM0A 5FZMA 3RDIA 4DQAA 5A1AA 4Y20A 1ULGA 1Y4WA 1VBE2 3JCIA 1ODNA 3VBSC 1XU2A 1UF2C 5C9AA 3HQRA 2DCZA 4IEOA 5KR7A 3HQUA 1S2BA 2PHUA 5HCAA 1NAEA 1WCKA 3AMQA 1LHWA 3O0XA 4DS0A 4XJZA 1JOPA 2EIBA 4I2OA 1JHNA 3WF2A 2XPJA 2NM1A 4W50A 4R52A 2DBIA 2EA7A 1R64A 4X6QB 4QX0A 1EY2A 4LO4B 4OHWA 1LB2A 2BERA 1D7PM 5C8CA 1J1LA 1MPXA 4DXSA 1IOAA 2VTXA 2WFF3 2WS91 3R05A 3OJBA 4JCKA 1PIV2 4M3CE 3GBWA 4IGPA 3SLIA 5DMYA 2J22A 3RJ2X 4CP9B 3ZXAC 2GN3A 4YG6A 4CDQA 4QU2A 2DVBA 1SCRA 1YQ2A 5FWJA 2XBO2 3R0RA 1NG0A 2GP5A 2Y0OA 3MIDA 4XQWA 5FZOB 3ZKUA 2QBXA 1O5LA 5BNQA 4ZXKA 3NW4A 4Z82A 5IAVA 2FDIA 4FQZA 3VZLA 3OUHA 4J1XA 2Y6GA 4QDQA 1ULFA 1PMIA 3AL5A 2JIGA 3ES1A 1VMFA 4Q8LA 3T0BA 4AOCA 2HWD2 1W90A 4FPKA 4NN0A 4DO0A 2E9QA 4P5HA 3ZFEA 2I07B 2IXCA 2A3XA 3I49A 2WZ8A 4I3GA 5FYSA 1WMDA 4LPLA 4MZUA 1PK6B 4YM3A 3BN6A 3SH3A 1LULA 1COV1 3DKQA 4YRDA 1GU3A 1F4AA 5IW0A 4CDUC 4XBLA 2EF6A 3J4UH 2GMEA 2EICA 2FCVA 3ACGA 2VU9A 2IVIB 1QKQA 4LKEA 1LOEA 4XUNA 3E1F1 5FOJB 5SV8A 2FDHA 5FP3A 5JIUA 1AR81 5DDJ1 3D82A 1AF9A 1UZZA 4MGKE 4OMDA 4YGDA 1UMHA 3WP6A 2MEV3 3UKVA 3RZJA 2VBPA 3B93A 1W6MA 4MVTA 1VIWB 4Z92B 1VBA2 5JZGA 5FYMA 5L9BA 3OCPA 5F5IA 2GU9A 3AKSA 1OOPC 3EBRA 3N4MA 3GZUC 3KM5A 2BNNA 2HJIA 4OFGA 1W05A 4N43B 5LRRA 4CP2A 4Y20B 5KC6A 5APAA 4PJYA 2B45X 4QM8A 2BZDA 2YBSA 1FV2A 4ORFA 1ACCA 2R063 3NWKA 1YFUA 3FUOA 2WT1A 3AP6A 2QJVA 1H4HA 2IXIA 3BTAA 1YIFA 4R4ZA 5FIXA 1ND3C 4Q4X3 1KJLA 3FHQA 4JZRA 4CRQA 2ETEA 1VMHA 1R093 1ZBE2 4BDVB 1JODA 3Q8CA 1CQ9A 4NIGA 2QQUA 1EV12 1VJ2A 2RMU1 2A3WA 2VMCA 1JYTA 1T2XA 3D4KA 3HMYA 2Z4FA 4L92A 2VR4A 4NJ4A 5KHJA 3E97A 4LBLA 2W94A 4P14A 1QJFA 5HV4A 4AEDA 1JOJA 1QJEA 1RUC1 4CDUA 1S0DA 4AI2A 1A3KA 4QPIC 3K2OA 1NCQB 4NO4A 1F9KA 3ZDVA 3M4FA 2QKDA 4LK6A 2WZPP 2R1DA 3DXUA 4FPFA 1H30A 4OI4A 4O9EA 4XTPA 4CP0A 3MFAA 3VD5A 4CTEA 5BY5A 3VHOA 4XFAA 4BH9A 1KD7A 2ZGUA 1YCIA 4XCBA 4IDZA 1D2QA 4AW7A 1RUE2 2AENA 1OOPA 2VM9A 3AKTA 3V56A 2GDFA 4BK5A 4D94A 4D8MA 2LRPA 2PHDA 1S0CA 3RNSA 1YEWA 3A0KA 1Y9GA 4AQ6A 4EN7B 2DUPA 1MACA 4N7IA 5FZDA 3VBSB 4BE3A 4AFAA 3T2PA 3T2QA 2DTYA 2BJSA 1HRI1 3VHPA 3IKWA 5B4XA 2F17A 3K4AA 4XF4A 3NV3A 4UFKA 2HYKA 4HETA 5GLZA 3UGFA 3N7MA 3VBFA 1SDWA 1YJKA 1Z7S3 4OUMA 1F5FA 1BJQA 2W39A 3HQXA 4CZSA 2OA2A 3P3PA 1AL23 1OHFA 4XJWA 5E89A 5E6HA 4GAZA 1OA4A 2VG9A 2QNKA 4EZHA 1W6MB 3VBRB 1ND3A 3EMRA 1IS6A 3T2TA 2GC2A 2RG4A 2ARXA 5A32B 1LEMA 2JD9A 2P3IA 4PBPA 5FY5A 1AR61 1UKRA 1J59A 3S6PA 4PDWC 3IIIA 1DHKB 4QX5A 3AZVA 1MZ6A 3OBRA 1AR71 4BJ0A 2CDPA 2Y6KA 2YBPA 1H8TC 2PAKA 5AC91 5FYYA 3AKQA 5FMDA 2Q8OA 5ABJB 1YQ8A 1BZWA 2Q30A 4AZZA 4YM0A 5FY8A 2ZABA 2YGMA 4IUGA 3KCYA 1ULCA 5F3CA 3W5MA 3PLQA 2KR2A 4NAMA 4DRVA 4AEDC 4GXLA 5JDBA 1ZM1A 2RS13 2VXRA 1J58A 2XVLA 3PU8A 3THPA 1COV2 5EYYA 4EJRA 5I0SA 2BVBA 3TEZA 2FMYA 2VBDA 5ANNA 1B35A 4J6GA 5I8TA 2VCCA 3I4IA 4HPKA 4NHMA 5IFPA 2EAKA 2GALA 3SKVA 1UYZA 4AVTA 3R6SA 2VZUA 5F3IA 4MXWB 2YBKA 3WNXA 5DDJ2 4CCLA 4BXSV 5C4WC 5IATA 4FPGA 2R0HA 1C3HA 1WGPA 4BHPA 4QB6A 4KQ7A 5I93A 1OT5A 3TN93 1G86A 1XYOA 2DYCA 2G9ZA 4BB3A 4XIKA 1E5IA 4GH4A 4XDQA 3E6BA 4CDUB 4K40A 1C1FA 2WINB 3ENRA 5GLVA 2A75A 4DMIA 3MIFA 2RR11 2VW0A 4MO3M 2B7YA 2PFWA 4NMIA 3WP5A 2OW4A 1QXPA 4XAEA 3EHKA 4HG6B 2YROA 5JI9A 3H1YA 1LENA 5FZHA 2OKXA 2AC1A 4RGGA 1G9DA 3WW3A 5ACA3 2RDNA 2RM21 2JENA 1ENRA 3MW2A 1WW5A 4PDWA 1JXNA 1ZA7A 2W9XA 3Q8BA 4AR2A 4PQ9A 4XTMA 5G04L 3GCXA 3POBA 1QNYA 1H8TA 1W9FA 4HSLA 2GC0A 3VGIA 2JDMA 3D0SA 1LGNA 3GDBA 1UQXA 5FDBA 5LRSA 1CAXA 4WM7A 4YWAA 2OQ6A 1Y3TA 2KD7A 5LK5A 1UYYA 4D3WA 5CKNA 1CAWA 3NNJA 1JYIA 5KBFA 5SV5A 3M1HA 2QQKA 3D5OA 3WUCA 2WYSA 4AG4A 4AI0A 2XDVA 2B46X 1RUC2 2WFF1 2F4PA 4JC1A 2ZGLA 1PIV3 4F83A 3BKZA 3FLPA 4QU1A 4Y1ZA 1U12A 3IM0A 1GOGA 3O0VA 2X53S 1RVF1 3GCWA 2ZX1A 5CG8A 2BW8A 5FZEA 4ATFA 2XBO3 4GA9A 1DCSA 1DYOA 3K4DA 2ZKLA 4BA6A 4UT5A 1RITA 2W0XA 4U2AA 3KVAA 1ZZ8A 3N7LA 2O0OA 4NIIA 3BTYA 2EXHA 3LEMA 2GNDA 4O65A 4LLFA 3S7EA 4QPIB 4CUCA 2ZAAA 2FDJA 4E4SA 2R6QA 3WINE 1HN1A 5FK8A 3PJQA 2GC3A 1RUH1 4WZCA 1JN2P 5F37A 5FREA 1CAUA 2JDYA 5LA2A 3NNMA 4HKWA 4NHKA 4E2QA 4LHSA 2UY8A 1ND2C 2C0ZA 2ET1A 4R9CA 3ZSKA 4I02A 2WNEA 3O7OA 1ULPA 1YI9A 5A70A 4KBZA 1WMFA 5IHRA 4CXXA 4BOWA 4H7LA 5JI7A 3ZPOA 4WBBA 2BWAA 2R042 1DGRA 1AR62 4UBHA 2R7EB 2WRAA 3RYKA 3ZXFA 5IVVA 2K0GA 5A3WA 3LDRA 1O3SA 1AR72 4SLIA 3ZMOA 4TLFA 2K2SA 5AC92 5C33A 1EPZA 4XHXA 4UFMA 3UNPA 5FZIA 4FFIA 2FHRA 1DQ1A 5FWEA 1VBA3 1JTZX 1YQ6A 1JZ6A 2OUJA 2ZGSA 3U07A 1LOGA 2ZMNA 4AFDA 4NIHA 4NE9A 4WV8A 3ELNA 4A7YA 1ENQA 1H2LA 2WR9A 2QFEA 3CHXA 5DAVA 2ARBA 5IK7A 2VUAA 2AREA 5L7OC 1TVGA 1PVXA 4YZ5A 2A5ZA 2VECA 2EIEA 2NYYA 2HWF2 1H2MA 4IE7A 5CFDC 3IPVA 1O6UA 4K21A 2RDSA 3AYDA 2R061 3I2JA 1PM4A 3OYWB 5A7WB 2VY0A 3MPPG 4YFWA 3WEZA 4MX3A 4GWJA 3C8XA 4L97A 4QHZA 4NIDA 4L99A 1ZRDA 2E7TA 1W03A 4SBVA 2X8KA 4YGEA 3J7MA 1UXZA 4QQLA 4ASKA 1ZBE3 4AGGA 2WC2A 1FPN1 1W8HA 1S1AA 4JRLA 4WVWA 1EV13 1SQ4A 3PURA 4XJAA 1WMXA 2RR12 1MS8A 3FMGA 5A1FA 2JX9A 1C5IA 3CJXA 4K7JA 2WO1A 5C4WB 3POEA 2D3PA 4YVWC 2ZZQA 3HNBM 3BPSA 3WCSA 1MR5A 2VMEA 1H2NA 3PIJA 1QOSA 4NOTA 4W6WA 4LR4A 2WZEA 1G9CA 5CZKA 4AVBA 1YWKA 2OXBA 4AI1A 3ZXDA 3R4UA 3NMBA 1GZWA 2WBKA 4GMP1 1V6JA 4QKNA 2JDPA 4XF1A 3VBOB 3UJOA 4S2DA 1AX0A 4AI9A 1AR91 2ARAA 2Q4SA 4ZHNA 4RD7A 5DUWA 4YZ2A 4D0QA 5FMOL 1KDMA 1LU2A 3D8CA 3PUIA 3N35A 1N3QA 1H1MA 2CYFA 2CWMA 3KGZA 5KC5A 2YY1A 4NRMA 3BTZA 1OKOA 1BK1A 3WXPA 2AZ5A 4UW5A 1F31A 2WS93 1IQAA 2WFF2 1HQWA 4YGCA 5FPBA 2OIIA 2C5DA 3ILNA 2Y6HA 3ACIA 5K0UA 1NA1C 3OBAA 3U10A 1RVF2 3B9CA 2WWUA 3H0OA 5LW9A 1Z7S1 3E6CC 3ZXEA 5CEHA 1E5RA 3HPNA 4RN5A 1W2NA 3DCQA 3NAPC 1W6PB 2GC1A 3RWKX 4YFZA 2VZRA 1CESA 2GSYA 3CBNA 2YZ4A 4WVMA 3WF3A 1IKPA 1F4HA 2V5DA 4K3UA 4AI8A 1LHOA 1ZBA1 2VOWA 3ACHA 4QT6A 4CPBD 1X9PA 3B5LB 4IQPA 4UAPA 5EQUA 4H14A 1RXGA 2WSUA 3OEAA 4MGIE 5FYHA 1IS4A 3GXUA 4GJZA 4FFGA 4AI3A 4RS5C 2CNAA 1J1TA 5LATA 4KBBA 1CJDA 1C5HA 2YPJA 2VBBA 4B1LA 5I0TA 4YVWA 1IGOA 1XE7A 3ETQA 3I2IA 5ISLA 3IPVB 4A4AA 1SLAA 1A78A 1XXNA 5FUPA 1W2AX 3C7FA 1OUSA 4QMAA 4E9KA 5DN2A 1COV3 4MOAA 1PM7A 2P3YA 3QH6A 4DXRA 5A3PA 1CIYA 2D93A 4K6BA 1DQ2A 3IDEA 5FQ0B 4OZOA 2CWSA 1DG6A 2FCUA 1OVPA 4UXAA 1DQ4A 5DUVA 2JIJA 1MS5A 1U5ZA 1AR83 2B9UA 2BOIA 3KSCA 5DDJ3 1S0BA 2J1VA 1K12A 3WR0A 3OY8A 5FPAA 1OQDA 5A7NA 1CPNA 1ND2B 3BIWE 5KWRA 1C1LA 3TN91 4FAGA 3GJAA 3ZOIA 3HNYM 2VZOA 1BEV1 4ARXA 4COYA 1S0IA 1NLQA 2Q1FA 1ZRIA 2HBTA 1UU4A 3ILFA 3ZVXA 4D7YA 1O3RA 1NA1A 2QQIA 1DF0A 4LBNA 1V6OA 3ZM8A 2G9FA 4BQ4A 3O1PA 1CZSA 2XLFA 1I9RA 4YW6A 5DUUA 5F8PA 3WG4A 5JLVA 3F2ZA 4Y4RA 1W6QA 1RC6A 4HK8A 5FAXA 1O59A 2W1SA 3H9AA 4E27A 2R062 4CDXB 3C7EA 5J98B 3SHRA 5FZAA 1BVP1 2PQSA 3C7OA 4B7KA 4CPBA 2A6ZA 3UKTA 4QX2A 4Q4X2 4E4ZA 1V6NA 1STMA 5FO8B 3RZKA 2WWSA 2FDKA 1L7QA 2WO2A 3H7JA 4WVZA 5FLJA 4COZA 2DUOA 4RS5A 2VXJA 2RMU3 5L7OB 2P17A 5D2AA 1MQTA 3ES4A 1OLME 4V2VA 1PGSA 5CFDB 1QDCA 2ZEZA 1GP4A 2ZEWA 3KF5A 4Q1RA 3OGGA 5F5QA 1US3A 1Q56A 1UY3A 5JR7B 4PQQA 1X82A 4XURA 3RQ0A 1H9WA 2JD4A 1QHDA 5E1RA 1QJY1 1ASJ1 3ZFGB 4O7XA 4LE4A 3VZMA 3RJRA 2VCMA 4YVSB 2CDOA 4Q5OA 4YGBA 3LPGA 3CLPA 1R1A1 2ZA9A 3NO8A 1PO21 1RUF1 1VB4A 4MV2A 1EPWA 4XMAA 3VHRA 5C3OA 5JR2A 3WQ0A 4P9JA 3T1MA 2HEWF 2WA4A 2QUOA 3IMNA 4NRQA 1RUOA 4LITA 3VBHB 1VE0A 4E2SA 3FUQA 1GV9A 1JYXA 3FFQA 3VKOA 5IFTA 5A3LA 5DPNA 2DURA 3JB8A 2YHJA 3ZPYA 5J96B 1O8PA 2WNVA 2ZGMA 4UW4A 2YDEA 3N9PA 1HRI3 5T52A 2Y33A 1ULEA 3KHBA 4G4FA 5A7QA 4CU7A 2CGNA 5HCFA 1Z7S2 3ZLIA 5E88A 5HXVA 5K9YA 5EWSA 4HL0A 1DZTA 2ZZJA 2JG8C 4ZKTB 2Y64A 3I8TA 3FZ3A 4PI0A 5DAQA 3RZMA 5GKAC 4HBNA 1SLCA 4GKYA 1CIWA 3U0ZA 1ZBA2 3BUCA 4YZ1A 4XPVA 4KMQA 1AR63 3HR9A 5BPXA 4OHYA 1AVBA 2GAUA 3VDDA 3KWVA 1AR73 1K5MA 2P6HA 4B8EA 3HWJA 2ZJCA 4IEVA 3MYXA 4PF1A 1S0JA 2Q1ZB 1CX1A 4QAWA 2RJLA 3INAA 1YHFA 1CONA 1DLLA 2GMMA 2D6LX 2WLPA 1W8NA 5JPNB 4WM8C 2BQPA 2VOTA 3I54A 3NAPB 1QXRA 4P02B 5A6YA 5T54A 2B9VA 1KGYA 2UWBA 4A42A 4QHBA 1KFXL 3L2YA 4W8JA 2VZQA 3JD73 2DVDA 3I59B 3GJBA 2ZHKA 1G9FA 1UU6A 3MO4A 4ITCA 4TSVA 1XOYA 5HI0A 5F32A 1NZIA 1A8MA 4EN6B 1O7FA 4Q4Y1 3CKHA 4HN1A 4RYDA 3W9AA 1CN1A 4CEYC 3B69A 1BKZA 2NLRA 2X29A 5JXJA 1G6NA 1KQRA 1S55A 3M3QA 4CUBA 4K9SA 1HLCA 3H3ZA 1NXMA 1OBNA 3ZYIB 5FBJA 5FPVA 3BB6A 3VD4A 2RJKA 4ES8A 4MUVA 1LNSA 4Q4V1 3OPZA 3TN92 3AM2A 4DUWA 2QE3A 2WLQA 2C6SA 2ZX2A 1BVVA 1W06A 3Q8EA 4CCEA 2Q8EA 4COVA 4R8HA 2Y60A 4OUEA 1UU5A 3WSOA 2WSVA 3RPQA 1I3HA 2RR13 3AYCA 3ZX7A 5JXIA 1REDA 3E5UA 4R9BA 3WDYA 2J42A 3ORJA 1SFYA 3MF9A 3WD5A 3A7QA 5F7UA 5LZ6A 3IAPA 2YU1A 3BIEA 3K3NA 5G05L 3DXTA 3ZSJA 4EWEA 4XABA 3ZN6B 1GWLA 2XJQA 5FZFA 4BZ4A 1KRIA 1TG7A 4Q8KA 1BHGA 1SPPB 3IAQA 5ACA2 3CNAA 2RM23 2B39A 1ZNPA 2VW1A 1FAYA 2ET7A 3MF6A 3MI8A 1POV1 3NVCA 4RA0A 2ZPXA 1ZRFA 1GQHA 5T5OA 4UFHA 1J83A 4Q2FA 3ASIA 3DGTA 4WZFA 3THDA 4KU7A 3LKJA 1H4GA 4Q26A 1HB1A 4B4QA 4WM8A 2E6VA 1OMIA 2R49A 2W08A 3AZYA 4FPCA 5FZ9A 4P9IA 3EYPA 3EJKA 3T4VA 4RSUA 2X05A 2LTNA 5CKMA 1VBB1 4ZU5A 2D40A 5JZGC 1SG3A 2C1FA 2RHPA 3FWEA 4FOQA 4XOGA 1RUG1 5FFOC 5FTTC 3WHTA 1GNHA 5LBBA 1ASJ2 2AH2A 2D97A 3ALQA 4PHZA 4AGVA 1XBFA 4CEYA 1R1A2 1RVF3 2RS53 4LHLA 2VQ0A 1PGW1 1PO22 1RUF2 2DV9A 3LSDA 1VBC1 1WW7A 3ME2A 4IV3C 3ZFFA 4URAA 2Q1MA 1ZZBA 1SFPA 4FP2A 2DFCA 1LU1A 1IQDC 4IV1C 3H8OA 3U4XA 4LKFA 5ERLA 5CBLA 4A3XA 3FC0A 4B4PA 4ZZ5A 3ZXGA 1TMF1 4FSJA 2O14A 1S0EA 2VD7A 5IVBA 2H0BA 1H6XA 1CVNA 3E6DA 5BNNB 1X50A 1RUH3 1YXWA 2BFUL 3AKPA 4N9IA 1OLQA 2RJ2A 3OB8A 4MHRA 2VO5A 4RHV1 5JOZA 2XJSA 4Q0PA 1JI6A 5L9VA 1W3XA 2QZ2A 4LORA 3ABZA 1OH3A 3TEXA 4HVRA 1WCSA 4M3CF 3Q8AA 3MZHA 1BLZA 1XPWA 1S4CA 2ZX3A 2DTWA 3PUHA 4GD4A 1HQLA 1WCQA 4IGQA 1PX4A 4MSVA 1FOD1 2VCBA 4QGMA 5FPLA 4QD2A 1GSLA 1HJGA 3KCXA 1BBT1 4OUSA 2P1BA 4XILA 1YI7A 4I0WB 4LQRA 3IBMA 5F2SA 3DUIA 1ZYBA 5EXOA 1NE6A 3ZYBA 4DPNA 1CAVA 3O1SA 4XJUA 2FZ1A 3V0BA 1V9U1 4JGZC 1TNRA
chains in the Genus database with same CATH topology
4NIDA 4NIGA 4ZS2A 4NPMA 3T3YA 4QKBA 3T4HB 3RZHA 3S5AA 3O1PA 4NJ4A 4OCTA 5F8PA 3O1MA 4IE0A 3O1TA 4CXYA 3LFMA 3O1VA 4NPLA 3O1RA 3RZKA 2FDKA 4IE5A 4IE6A 2FDGA 2FDFA 4O61A 3BIEA 3S57A 4JHTA 4IDZA 5DABA 4QKNA 3BKZA 4IE4A 4ZHNA 4O7XA 4QKFA 4NRMA 3BTZA 2FDIA 4MG2A 4NRPA 3T4VA 4NIIA 4NRQA 3BTYA 3O1UA 2FDJA 4RFRB 3I49A 4MGTA 3RZGA 3BI3A 2FD8A 3KHBA 3H8OA 3BTXA 2FDHA 4CXXA 4NROA 3H8RA 3RZJA 3RZMA 3I3QA 4QKDA 3BUCA 3BU0A 4CXWA 4NIHA 4QHOA 3H8XA 3RZLA 3O1OA 4ZS3A 4IE7A 3O1SA 3KHCA 2IUWA 3I2OA 3I3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NID A;  4NIG A;  4ZS2 A;  4NPM A;  3T3Y A;  4QKB A;  3T4H B;  3RZH A;  3S5A A;  3O1P A;  4NJ4 A;  4OCT A;  5F8P A;  3O1M A;  4IE0 A;  3O1T A;  4CXY A;  3LFM A;  3O1V A;  4NPL A;  3O1R A;  3RZK A;  2FDK A;  4IE5 A;  4IE6 A;  2FDG A;  2FDF A;  4O61 A;  3BIE A;  3S57 A;  4JHT A;  4IDZ A;  5DAB A;  4QKN A;  3BKZ A;  4IE4 A;  4ZHN A;  4O7X A;  4QKF A;  4NRM A;  3BTZ A;  2FDI A;  4MG2 A;  4NRP A;  3T4V A;  4NII A;  4NRQ A;  3BTY A;  3O1U A;  2FDJ A;  4RFR B;  3I49 A;  4MGT A;  3RZG A;  3BI3 A;  2FD8 A;  3KHB A;  3H8O A;  3BTX A;  2FDH A;  4CXX A;  4NRO A;  3H8R A;  3RZJ A;  3RZM A;  3I3Q A;  4QKD A;  3BUC A;  3BU0 A;  4CXW A;  4NIH A;  4QHO A;  3H8X A;  3RZL A;  3O1O A;  4ZS3 A;  4IE7 A;  3O1S A;  3KHC A;  2IUW A;  3I2O A;  3I3M A; 
#chains in the Genus database with same CATH topology
 5A33 B;  4RQP C;  1UOG A;  2ORZ A;  2JG8 B;  4MET A;  3LWC A;  3RZH A;  5IJR A;  3BAL A;  1PO1 1;  3HEI A;  1DP0 A;  4KNC A;  1LR5 A;  3I2K A;  3HNM A;  4BIS A;  3M3I A;  3FE5 A;  3USS A;  3HJR A;  5C9A B;  1PHM A;  3AX4 A;  4IV3 A;  4D7T A;  3A23 A;  5FLI A;  3FHA A;  4QM9 A;  4JDN A;  1RB8 G;  1K3I A;  2OZJ A;  1JYN A;  1Y9Q A;  1C8M 1;  4IEQ A;  4IW3 A;  3VBF C;  1OPM A;  4IV1 A;  3ZN4 A;  4NPL A;  2ADE A;  4I3P A;  4NR1 A;  5JMO A;  1MVE A;  4O9G A;  4XEZ A;  3ZSE A;  5FYI A;  1MS3 A;  1QJZ A;  4YSF A;  5HPO A;  4Q4V 2;  3U1X A;  3PVB B;  5IVC A;  2WAB A;  3H50 A;  4XYX A;  5C8C B;  1W8Z A;  3RMX A;  3B01 A;  1FPN 3;  3MUZ 1;  1JS9 A;  3KT1 A;  5EZW A;  3T1L A;  2XB6 C;  4AL9 A;  3KQR A;  2CSG A;  1LHN A;  4CDQ B;  5FZL A;  5CAZ A;  3D6E A;  5ANQ A;  2IZW A;  3POF A;  2D98 A;  3VBU A;  1UO9 A;  1FMD 1;  2HKX A;  5CFC C;  4FO9 A;  1AHS A;  1H2K A;  4CSW A;  1I1E A;  1W6N A;  2OZ6 A;  2PQQ A;  2C24 A;  1NCR C;  3PTY A;  5KHG A;  3QD6 A;  2TBV A;  4IET A;  1WCD J;  1F8V A;  3URF A;  1B35 C;  5H9P A;  2ZKN A;  5FZ3 A;  5HCB A;  3O1U A;  3N7K A;  4GMP 3;  3QH7 A;  2VZS A;  2AUY A;  2W87 A;  4YM2 A;  2F4L A;  5JVV A;  3H1W A;  1OQE A;  3T09 A;  1AR9 3;  3ZFE B;  4JGZ A;  2VZT A;  4XDO A;  1QQP 1;  4E4H A;  1V70 A;  4RQP A;  3TYJ A;  4NWV A;  4AWD A;  3LGR A;  4C91 A;  4Q4W 1;  1US2 A;  1XYP A;  1VBB 2;  3MIG A;  5HXM A;  1QOO A;  1RUG 2;  4GH4 C;  1NXD 1;  2WS9 2;  2K9Z A;  4OQ9 A;  3AK0 A;  2LRO A;  4LKD A;  3LDB A;  4XET A;  4DRR A;  1FAT A;  1VBC 2;  2GZW A;  4CYD A;  4CVU A;  2UUR A;  3CDZ B;  1O4T A;  4BQ5 A;  1I5P A;  1UOJ A;  1W6O A;  5JXH A;  3OUJ A;  1F15 A;  2EVX A;  3J7H A;  2JKX A;  2QDR A;  3BYW A;  5JZG B;  1ZBA 3;  3VKF C;  1W0O A;  4GWN A;  1N1S A;  3VDA A;  3T0A A;  2GP3 A;  1LGC A;  1LTE A;  2VOK A;  1GUI A;  1J84 A;  2CTV A;  3ZYJ B;  4AAP A;  4IEU A;  5LY1 A;  4QHO A;  3POJ A;  1YFX A;  4IV3 B;  5LY2 A;  1N1T A;  3U75 A;  5GZG A;  4QX3 A;  2J1T A;  4FCA A;  5CFC A;  1ULO A;  3H1M A;  3KV5 A;  4XUT A;  1P8J A;  4B3N A;  4WM7 C;  4D69 A;  5LA0 A;  4IV1 B;  3AC0 A;  4ISR A;  5LAS A;  1GWM A;  2VNR A;  4DXT A;  4ASL A;  5EP9 A;  1NCR A;  1WBL A;  1GQG A;  3OSD A;  4ES9 A;  5LEJ A;  4AE2 A;  4UF0 A;  3UKN A;  2IUW A;  3VD7 A;  3JD7 1;  3ZSL A;  3I2O A;  2HEV F;  1FOD 2;  5B2G B;  4Z8B A;  4S2G A;  3KVB A;  2DU1 A;  2Z69 A;  1L3J A;  4H7M A;  1BBT 2;  5L19 A;  4DUV A;  3J26 N;  1K42 A;  5JMC A;  3S30 A;  4CP1 A;  4QWN A;  5IVY A;  5BNP A;  1AR8 2;  4P9Y A;  5GZD A;  2BNM A;  4OCT A;  1O8S A;  4AFC A;  2ID4 A;  3M8L A;  4N53 C;  1U5I A;  1EUT A;  4DY5 A;  3VN4 A;  4HVQ A;  2A73 B;  4FAH A;  2W1Q A;  4CDW A;  2JEC A;  1XNK A;  3FFZ A;  4HFS A;  1BEV 3;  3OG2 A;  4HT1 T;  4AED B;  4OI0 A;  1UX7 A;  1R08 1;  1FX5 A;  1IS3 A;  2W3J A;  1JZ2 A;  3S0M A;  2QVS B;  3ITQ A;  2FCT A;  1SBD A;  3DPR C;  4HXC A;  2IFR A;  4E8D A;  5FK7 A;  3GAL A;  1DQ6 A;  1UXX X;  1IG3 A;  1UZW A;  3LIG A;  4XFG A;  3WDT A;  1AL0 G;  2I74 A;  3KD4 A;  3PL0 A;  1OOP B;  4XAA A;  2E53 A;  1KJR A;  4LE3 A;  4PLO A;  3RSJ A;  3ZYR A;  1DQ0 A;  2Z79 A;  2OS2 A;  1SEF A;  5L9R A;  1IS5 A;  2E7Q A;  2RDR A;  2GN7 A;  4MG2 A;  1OA2 A;  1HV1 A;  2CHH A;  2DCT A;  2JB8 A;  5DAP A;  3VZO A;  4EV0 A;  4N9H A;  5KXB A;  2RMU 2;  3AJZ A;  1RIN A;  5K8S A;  3ZXL A;  5FZK A;  1YC6 1;  5DQ0 A;  3WG1 A;  2NMO A;  3I3E A;  2YGL A;  3JUU A;  4HKO A;  5T3N A;  3VBF B;  1MZF A;  1QJU 1;  1VBD 1;  3WHU A;  1CPM A;  4RFT 0;  3J7N A;  1FMD 2;  1SDD B;  3NNL A;  5FXW A;  4BME A;  3C2U A;  4P5Y A;  1UY4 A;  4LTA A;  4WVV A;  1QJY 3;  1ASJ 3;  1ND3 B;  1DGR N;  1PMJ X;  1DQ5 A;  3KQ4 B;  1ZZ7 A;  4JGY A;  3UK9 A;  1LOB A;  1R1A 3;  1YQ5 A;  3LB9 A;  4KG8 A;  2RS5 1;  3USU A;  1PO2 3;  1RUF 3;  3GHM A;  3AB0 A;  4XUO A;  3KMH A;  1D4M 1;  5A7O A;  2P5B A;  4UFI A;  1W9T A;  4QB1 A;  4N53 A;  4YLZ A;  4Y4Y A;  4YNI A;  1H8V A;  2WQ8 A;  2PHT A;  2J1S A;  3P6B A;  3LOI A;  3OD4 A;  4DIN B;  5FZG A;  1QQP 2;  1HIX A;  2ZML A;  4JVA A;  2HEY F;  2VMF A;  3LD8 A;  4A45 A;  1QNW A;  1FYU A;  1XSR A;  4Q4W 2;  1N47 A;  1NCR B;  5C8W A;  5F6L B;  1W9Y A;  3FHI B;  3H3L A;  1UPI A;  2XJP A;  2ZGT A;  3DPR A;  3MPB A;  4NIA A;  4A6S A;  3BOW A;  4LBJ A;  4PF5 A;  1B35 B;  3POG A;  4HPK B;  2A6V A;  1HRI 2;  4BQX A;  1HB2 A;  1SFN A;  4HON A;  5F39 A;  5EJ1 B;  3D0J A;  4KWK A;  1PVC 1;  2W1W A;  5I8S A;  4P00 B;  4A6O A;  3HN1 A;  2VCA A;  3AZX A;  4IEP A;  3JXS A;  3U37 A;  1Q43 A;  3CJI C;  3VKL A;  4K20 A;  1XND A;  5E8A A;  1JYV A;  4LUM A;  3TEW A;  4GH4 B;  5A6Q A;  3HOB A;  1UN1 A;  3LA2 A;  3OUI A;  4I09 A;  4ZY9 A;  1BK0 A;  4PCR A;  3PDQ A;  3KHC A;  3EXU A;  4LT5 A;  4LKS A;  5FV3 A;  1HDK A;  4ARY A;  4AXO A;  2A6Y A;  1K5J A;  2DCY A;  2VUL A;  2W52 A;  1NKG A;  2BGO A;  5A1L A;  1JZ8 A;  2LS6 A;  4FTS A;  1H1I A;  1QIQ A;  3A22 A;  1MS0 A;  1WW6 A;  4L11 A;  2ZGK A;  2J1U A;  4OHZ A;  4ET7 A;  2XLA A;  4IE0 A;  4CA9 A;  2C9A A;  5IYY A;  2VQU A;  4COU A;  5FUI A;  3JD7 2;  4XIO A;  4OQ8 A;  4QXC A;  2VH9 A;  3O1V A;  3IDB B;  2CGO A;  4PDW B;  1DLC A;  4YZ3 A;  4J25 A;  4Q4Y 3;  4AVV A;  1KXG A;  1O91 A;  3T08 A;  5K0U C;  1H8T B;  4NAO A;  1GZ9 A;  2UY9 A;  2YV8 A;  5A33 A;  3JU9 A;  4NHX A;  1C57 A;  4QX7 A;  2BYV E;  1GP5 A;  2H6B A;  2XL9 A;  3PNA A;  5IK4 A;  4B7E A;  4AVS A;  1CAX B;  4WM7 B;  1UIJ A;  4Y26 A;  3WQ7 A;  2HWB 1;  3PVO A;  1CAW B;  4Q4V 3;  1HJF A;  1XE0 A;  1GNZ A;  2PN5 A;  2X5I C;  3WNP A;  5FZ6 A;  1MS4 A;  1SLB A;  3OPT A;  1M4W A;  2WN3 A;  1R08 2;  5JXG A;  4LXL A;  3AFG A;  4XJ8 A;  1W9W A;  1OFN A;  1RTV A;  2DCJ A;  2OVU A;  2ZCW A;  2OPW A;  3NJV A;  2NP0 A;  1SCS A;  1QMJ A;  3BOP A;  3M7A A;  5BV6 A;  5EHD A;  1HKD A;  4EQV A;  1W9S A;  3UGG A;  3X29 B;  2CGP A;  3VLB B;  3AMP A;  4YG0 A;  4K1Z A;  4AYU A;  4LJH A;  5GZF A;  4E4D X;  3RI9 A;  1ZRC A;  1ZRR A;  2YPD A;  3AXD A;  3CJI A;  2UYB A;  3ZYF A;  2X09 A;  4Q0V A;  3SQO A;  3PUS A;  1JH5 A;  1L7R A;  4BU2 A;  3IN9 A;  2ZHN A;  3LF7 A;  3WCR A;  2WT2 A;  5FZ7 A;  5LEK A;  3IDA A;  2RM2 2;  3WX5 A;  1POV 3;  3WQB A;  4AGR A;  3LE0 A;  2QDN A;  2EXK A;  4GMP 0;  1WUV A;  4AEK A;  1G9A A;  1UPS A;  1GNY A;  2MPF A;  4YW5 A;  2VUD A;  1GQP A;  1I5Z A;  4M3C A;  3WZ1 A;  5IVE A;  3E5Q A;  5CVR A;  4DIQ A;  2QZ3 A;  3BCW A;  3VUO A;  1CAU B;  5K4L A;  1X8M A;  2VTX J;  2W46 A;  3LEI A;  3NNF A;  4LBM A;  3GHN A;  5EIY B;  1VBD 2;  2I2S A;  3CEW A;  5GJ6 A;  3ST7 A;  3S5Q A;  1JW6 A;  1YUD A;  1VBB 3;  4RL7 A;  3B3Q E;  3B9I A;  4AEM A;  5FP7 A;  1RUG 3;  2WNO A;  3AMN A;  1NY7 1;  1AXK A;  2ZGO A;  1SZB A;  2QQV A;  4GWM A;  1RGS A;  2XWJ B;  3WW4 A;  5JSR A;  4XFH A;  4ASM B;  4QKD A;  1GWK A;  2RS5 2;  1KEX A;  4JX0 A;  1MS9 A;  1VBC 3;  5A3M A;  3BU0 A;  1AXY A;  1D4M 2;  1ZVF A;  2IVJ A;  3PTR B;  3T30 A;  1Y9M A;  4Y22 A;  2TEP A;  5FO9 B;  1XJA A;  2V09 A;  2WNU A;  4BPZ A;  1O3Q A;  3AMM A;  1S2E A;  4MH0 E;  4UW3 A;  2VC9 A;  4P9G A;  1BYH A;  1WCU A;  4IER A;  5FP8 A;  4KU8 A;  2X5I A;  1GBG A;  3VZN A;  1CZV A;  5FLH A;  4GKX A;  1TMF 3;  3B02 A;  5CA6 A;  2G19 A;  1F35 A;  3PHM A;  4EN9 B;  2B5H A;  3BOD A;  4OYU A;  4TZD A;  4ZS3 A;  2WQ4 A;  2QQW A;  1RUH 2;  5T55 A;  2DFB A;  1Z0H A;  4PBO A;  4RHV 3;  1MQT C;  2ZBJ A;  1LOC A;  5T5J A;  5K7P A;  4IEZ A;  3I2G A;  4LO6 B;  5A3U A;  4C8D A;  2AEY A;  5C70 A;  4ZS2 A;  2A6W A;  4F8A A;  2JDK A;  3QBQ A;  4QPG C;  5FZB A;  3T4H B;  2ZAH A;  4QX1 A;  1ENS A;  1SBF A;  1FOD 3;  2C4X A;  2HWE 1;  5B4N A;  1BBT 3;  1G7Y A;  2VNO A;  3QCW A;  3MW3 A;  4GJY A;  1SAC A;  5A7S A;  3ZYP A;  4GB3 1;  4BQW A;  4I0B A;  1HXS 1;  2YXS A;  4N7U A;  3QAC A;  2Y6F A;  4I30 A;  4RR3 A;  2YYO A;  2BWC A;  2Q8C A;  4RGK A;  4LBO A;  1AYM 1;  5FJH A;  3ACF A;  5FXV A;  1QEX A;  3C7G A;  4JQR A;  1A6C A;  1UIK A;  2ZAC A;  5F5A A;  2VGD A;  1V9U 3;  2WO7 A;  2ZGR A;  4M0H A;  3DYP A;  5KHK A;  2DU0 A;  3AKR A;  3M3C A;  1K45 A;  3HT2 A;  4UBG A;  1C8N A;  1NUK A;  5DZE A;  5FJK A;  1PGL 1;  3THC A;  1VRH 1;  2GH8 A;  2QQJ A;  2WFP A;  1PO1 3;  2W1U A;  3AVS A;  4OHX A;  5F3E A;  1RUD 1;  2D3S A;  2FQP A;  4JDO A;  2BBA A;  2WNV C;  3ZYG A;  1DYP A;  5M0T A;  1QOT A;  3O14 A;  4KH9 A;  5BNO C;  1GZW B;  2D6N A;  1WLD A;  5FMO S;  4Z2A A;  2W68 A;  1C8M 3;  3MDP A;  2K46 A;  2PHF A;  2YMZ A;  3KV4 A;  1GLH A;  3OGV A;  3B94 A;  5KXC A;  1OQ1 A;  3LSE A;  2I45 A;  4UFL A;  3RWN A;  5AVA A;  2D44 A;  5FP4 A;  1FNZ A;  4KI5 M;  2NQY A;  3WLU A;  3BPZ A;  3MFC A;  4FTB A;  1N1V A;  4B29 A;  1REF A;  1IKQ A;  3KF3 A;  4NHL A;  5HV0 A;  1IPS A;  1KFU L;  1FPN 2;  5FY0 A;  1HB3 A;  2YUE A;  1RHI 1;  3VDD C;  1K5M C;  4RFR B;  2QQN A;  3N9O A;  2D3R A;  3UGH A;  5K0U B;  2A70 A;  2DWR A;  1LED A;  2A1X A;  2JG9 A;  2VL4 A;  3NJY A;  4K8R B;  4MLO A;  5F3G A;  3NST A;  4YPJ A;  3SH5 A;  3T0D A;  2V72 A;  5KHH A;  4FBF A;  1FMD 3;  4TTG A;  3BI3 A;  4QPG A;  1O4Z A;  1IPK A;  3KV9 A;  2P34 A;  2UYA A;  3MLK A;  4WVM B;  2Y6L A;  3OGS A;  1ZZ6 A;  3O12 A;  3IWZ A;  4QX8 A;  4L0P A;  4XW3 A;  4C1X A;  1GZC A;  3WNK A;  4QPW A;  2VQA A;  3CIH A;  1SBE A;  4FXK B;  3C3V A;  4AAX A;  2WKK A;  3W58 A;  1JYW A;  4MYE A;  1GIC A;  1YFW A;  1AR9 2;  1QY4 A;  5J48 A;  1H0B A;  1QQP 3;  2VPV A;  4Q1P A;  4YVW B;  5FXX A;  2XGX A;  2Y0I A;  3U11 A;  3PIG A;  2KXL A;  2ILM A;  1QJX 1;  5IVJ A;  3WG2 A;  4Q4W 3;  4KGG A;  3NKT A;  3T2O A;  2VZP A;  1ZX5 A;  2PA7 A;  3HT1 A;  3R4D B;  4P9X A;  1DBN A;  3N36 A;  4AFB A;  1LHU A;  1XNT A;  4XF3 A;  3WNO A;  4AQS A;  4PLM A;  1IG0 A;  3BVC A;  5BNO A;  5BYN A;  3RS6 A;  2WZR 1;  3SCG A;  3LEG A;  1V6M A;  3PJY A;  4A41 A;  2QQM A;  3O0W A;  3KV6 A;  4HAN A;  2J1E A;  2CY6 A;  2ZEY A;  2RDQ A;  4XQD A;  3MLL A;  4DY3 A;  5L36 A;  4DEV A;  3DL3 A;  3OY8 B;  1O4Y A;  5I0R A;  3UT0 A;  2H0V A;  5CIS A;  2XR4 A;  4BYY A;  4JKK A;  1J3R A;  1SLT A;  2V4A A;  1KS4 A;  2D6O X;  3RRD A;  1XYN A;  2H6C A;  3AP4 A;  4ZZ8 A;  3I3M A;  1PZ9 A;  4FQ4 A;  2J1A A;  3T3Y A;  3FX3 A;  4BLJ A;  1WKY A;  1PZ8 A;  2PTM A;  2HWD 1;  3ZR6 A;  4IEY A;  1SLL A;  5J36 A;  3V0A A;  3S5A A;  4XMI A;  4FOV A;  1NA1 B;  1D0G A;  5C3R A;  1QH7 A;  2LUW A;  2JDU A;  1RUJ 1;  1WA6 X;  1XNB A;  5DG2 A;  3MV1 1;  4MXV A;  2VUJ A;  2ZHM A;  3HBK A;  5H9Q A;  5FPX A;  3I2D A;  4XF9 A;  5J09 A;  2CAU A;  4UI9 L;  2XHN A;  5JSP A;  4PIY A;  1W6Q B;  3DF0 A;  2HLE A;  4XQ4 A;  1BMV 1;  3UET A;  4FPH A;  3O1R A;  4LLO A;  4AF9 A;  1HQN A;  4CCN A;  4D6Q A;  5CAD A;  1LOF A;  4LOS A;  4N43 C;  2PHR A;  3Q8F A;  3OGJ A;  2FDG A;  1V6L A;  2ZTN A;  5FYU A;  2HWE 2;  4CP9 A;  1J3Q A;  2W5F A;  3WW2 A;  3WDX A;  2XLG A;  4GB3 2;  2XG3 A;  2ZXQ A;  1HXS 2;  4M0N A;  1PMH X;  4RS5 B;  4UFJ A;  3ZFF C;  3CL1 A;  3VDC A;  4Z1V A;  5FZO A;  5IAX A;  1FNY A;  2D43 A;  1MQT B;  2VZ1 A;  4GWI A;  2E32 A;  1XE8 A;  2R0F A;  3FL7 A;  4EWD A;  3MIH A;  1Q8Q A;  3UYJ A;  3ZMN A;  1BEV 2;  2PEL A;  2VOV A;  3RYP A;  1R08 3;  5FMC A;  1PGL 2;  1N3P A;  1W8T A;  3ETP A;  4YW4 A;  1VRH 2;  2CU5 A;  2LW8 A;  3VD3 A;  4NHY A;  2GNT A;  1QWR A;  2ADD A;  2V4V A;  3THT A;  1AXZ A;  1RUD 2;  2OT7 A;  4EZ4 A;  2EAL A;  1XQN A;  1IPJ A;  2VJX A;  4G9S B;  3WVJ A;  3OF1 A;  4LMF A;  1UCX A;  4BM8 A;  2Y26 A;  4UOJ A;  1NE4 A;  4QDS A;  5EYX A;  3WDW A;  1WBF A;  3QOP A;  1PK6 A;  4XFC A;  5D21 A;  4DXZ A;  5GZC A;  2BBV A;  2BP6 A;  3HD8 B;  1H9P A;  5D8A C;  2UU8 A;  3APB A;  2RS3 1;  5T50 A;  4FTE A;  4MGT A;  3ZN5 A;  4GUL A;  1UL9 A;  5IVF A;  1POV 0;  4B1M A;  1Y7B A;  5FYZ A;  3M3O A;  1IHM A;  3PU3 A;  1TE1 B;  3WUD A;  1HB4 A;  2WNV B;  2RVA A;  1RHI 2;  1QDO A;  1ZZ9 A;  2BTV C;  2PLV 3;  5FKB A;  5FY7 A;  3ZSM A;  5JAX A;  3VL9 A;  1QJU 3;  1VBD 3;  2VMD A;  1G9B A;  3H8R A;  3IZO A;  3V64 A;  5DAW A;  4FT8 A;  3AP5 A;  3MEP A;  4GIQ A;  2PAE A;  4N43 A;  5CKQ A;  1QJY 2;  2QCS B;  3LA3 A;  2W95 A;  5DXD A;  1URX A;  4XFF A;  3IDC B;  4CXW A;  4IES A;  4CU6 A;  4XXP A;  3PVN A;  2WL1 A;  1L7L A;  1LHV A;  3AP7 A;  3LFI A;  3TWI A;  1D4M 3;  1W8W A;  1K5M B;  3VDD B;  3V0A B;  5CNA A;  2YFZ A;  4URT A;  1RUE 1;  2IXK A;  4F7Z A;  3RZL A;  2NPI A;  2ARC A;  4CCD A;  2PHW A;  1W0N A;  5FZ4 A;  1YFY A;  5FYT A;  3VBR C;  4QQH A;  1GMM A;  1QJX 2;  4ZU4 A;  1PX3 A;  1S0F A;  1CR7 A;  4LO8 A;  1EP0 A;  4PLN A;  4NWW A;  3LZZ A;  4JTN A;  1Q5O A;  2XXZ A;  3JZV A;  5J7M A;  2O8Q A;  3ACL A;  5EFU A;  2VNV A;  2HWC 1;  2JEM A;  2XQR A;  1RL3 A;  2WZR 2;  1ONA A;  4H2A A;  2Y6J A;  3WY6 A;  5F1R A;  1GOF A;  4QKB A;  5LB6 A;  1PVC 3;  1W8F A;  4ZPI A;  1FI2 A;  3GZT B;  2AAC A;  3J8F 1;  3VBU C;  3MHZ A;  3SNM A;  3GBG A;  5D8A A;  4QXH A;  1VR3 A;  3IIA A;  3NJX A;  1X36 A;  3PUA A;  3VZJ A;  1NQD A;  5FMB A;  3WOG A;  2JE8 A;  1NCQ A;  1OLR A;  3POI A;  5JOW A;  1OD3 A;  1KIT A;  3OEB A;  3VDB A;  4CCJ A;  1W2O A;  4L9B A;  3WNL A;  2GMP A;  2HBU A;  1F5J A;  2XWB B;  4OUL A;  4FFH A;  3WP4 A;  3UL2 A;  3OTF A;  3TAY A;  5F9T A;  2OQ7 A;  1UZV A;  2FDF A;  5EJZ B;  4CU8 A;  4XE9 A;  1LOD A;  1RUJ 2;  5FYB A;  3SXW A;  3SEP A;  4Q0Q A;  4V1P A;  4KG0 A;  4JHT A;  4JKM A;  4ISQ A;  5DAB A;  1DGW A;  4X8P A;  1RXF A;  1GR3 A;  2WAA A;  2VE1 A;  3EB7 A;  3ECQ A;  3JB4 C;  1X9T A;  4FOW A;  1RMU 1;  3WT3 A;  1BMV 2;  4IE4 A;  1UAI A;  4CUA A;  4XZU G;  3VBS A;  2LM3 A;  4TWT A;  2W91 A;  3FBY A;  1T6B X;  2D6K A;  2NZ9 A;  4MGQ A;  2WUH A;  2VUC A;  1WD4 A;  1DGW X;  4QXK A;  3SIT A;  4Q4Y 2;  3IT8 A;  3PVE A;  4DEQ A;  1UYP A;  1UY1 A;  2R16 A;  4M4R A;  1A34 A;  2CAV A;  2ZGN A;  4WM8 B;  1RUI 1;  4W4Z A;  2ZX4 A;  1PNG A;  5FZ1 A;  3JBG 1;  1AYN 1;  3DYM A;  3HN3 A;  2R07 3;  4V2W A;  3VBR A;  2JB4 A;  4P9L A;  2HWB 3;  4AEJ A;  1C4R A;  1X8E A;  1GKB A;  5A32 A;  1AZD A;  3OBZ A;  3HVD A;  3RVH A;  5LWB A;  3ROU A;  3I97 A;  4YM1 A;  3TB0 A;  2YU2 A;  1U5X A;  2XVK A;  1GFF 2;  1DZQ A;  1WZX A;  4JV4 A;  2PXJ A;  5GLW A;  4CEY B;  2UWA A;  5BUV A;  1LEC A;  2P6C A;  3ZFF B;  5LA9 A;  4AHW A;  4LBQ D;  2JWP A;  1E5S A;  3AZZ A;  3LEK A;  4JAA A;  3TBD A;  2FBE A;  3ZYH A;  4NRO A;  1OPO A;  4XFI A;  4LUL A;  2OUH A;  2WII B;  2RS3 2;  1ALY A;  4M00 A;  4D6R A;  3I3Q A;  5CG9 A;  2BFU S;  2Q0A A;  1W0P A;  1O5U A;  2JKB A;  2JDN A;  3CQO A;  1Q8V A;  1FXZ A;  2B8M A;  3RG0 A;  3SCH A;  5C5T A;  1TME 1;  5KHI A;  4MXW A;  2AEZ A;  4BLI A;  5BNP C;  1UYX A;  3U4S A;  4HOO A;  3G7D A;  1GYK A;  2L9L A;  2ERF A;  2VW2 A;  1OSG A;  4JQT A;  4LEJ A;  1CGP A;  3LQC A;  2QQL A;  2P3K A;  1TZO A;  4FI9 A;  3MW4 A;  2EXI A;  3KT4 A;  4KWU A;  4CDW C;  1V00 A;  1EAH 1;  3H42 B;  3AYE A;  2JDA A;  4FXG B;  5D8A B;  1SLI A;  3H8U A;  4BQ2 A;  5AFB A;  3O1O A;  5DUX A;  4D6S A;  4X6R B;  2DBN A;  3K77 A;  3QLQ A;  4NVP A;  5JSO A;  2VOX A;  3H3U A;  4A44 A;  4BMB A;  5IT6 A;  1PGW 2;  1OD5 A;  1ENX A;  2A71 A;  1CAV B;  2EAA A;  2N7G A;  3N9M A;  3OBT A;  1POQ A;  2DUQ A;  2ES3 A;  3V0B B;  5EPA A;  4EE2 A;  2J7M A;  3GF6 A;  1YIP A;  4JKL A;  3N9N A;  5KXE A;  1RUN A;  5A3N A;  1TMF 2;  1M06 G;  4OI2 A;  4Y3O A;  2BU9 A;  2VNG A;  4FOY A;  1KDK A;  2BV4 A;  4C0B A;  3LFM A;  3FN9 A;  2NMN A;  4X8N A;  4A7K A;  3W59 A;  3ZIW A;  2HWC 2;  3CO2 A;  1YQC A;  4HVO A;  2A7A A;  3AZW A;  4EN8 B;  5C7G A;  4KWL A;  1E5H A;  4RHV 2;  4W6X A;  4XUQ A;  4LBQ A;  5CYY A;  1D2S A;  3SKJ E;  2BDR A;  3J8F 2;  3SEE A;  3OPW A;  1J3P A;  3ILR A;  1CJP A;  1OF4 A;  5IK5 A;  4P9W A;  4QB2 A;  3WDU A;  3VKN A;  4G3Y C;  4ZU7 A;  2R04 1;  5JCT A;  2HWE 3;  1F2N A;  2J1R A;  2VTF A;  3MV0 1;  4JGY C;  1O3T A;  3GM8 A;  2Y34 A;  1JZ5 A;  1I6X A;  2XL7 A;  1HW5 A;  4GB3 3;  5F5C A;  5CB7 A;  2P2K A;  2E31 A;  1B09 A;  1HXS 3;  3K48 A;  3CZU A;  3K3O A;  4S2H A;  3FLR A;  2IWG B;  4HKL A;  3SMH A;  1QXJ A;  1XB9 A;  1AYM 3;  2BNO A;  1NYW A;  5JOY A;  1UNB A;  3EO6 A;  4HLT A;  3I2F A;  2XH6 A;  3VBU B;  1V9U 2;  1H6Y A;  2WT0 A;  4D7S A;  2A6X A;  1MS1 A;  3NV2 A;  1HRV 1;  1W6N B;  4OLL A;  4QPI A;  3FJS A;  1VRH 3;  2ZHL A;  1RMU 2;  3NL1 A;  4JTO A;  5A3O A;  1PO1 2;  2XJR A;  3K4Z A;  3W20 A;  5A3T A;  5JUV A;  1RUD 3;  4BCU A;  1UMI A;  1JHJ A;  2G1M A;  5EV7 A;  4E8C A;  4EN0 A;  4JRA A;  2XKO A;  5LA1 A;  2HWF 1;  1KS5 A;  3DEC A;  2WDB A;  2YG0 A;  2Z5W A;  3B00 A;  1C8M 2;  1WLT A;  2VAU A;  5FYV A;  2FZ2 A;  1NOV A;  4ZXE A;  1VMJ A;  2G4I A;  2E7A A;  1MEC 3;  4JGZ B;  3ZDS A;  1RUI 2;  3MIC A;  3JBG 2;  1AYN 2;  3A0N A;  4RQP B;  1ZZC A;  1CX4 A;  2P4E A;  2VVD A;  1OLM A;  3M3E A;  4Q0U A;  2WJS A;  3KCC A;  4EYU A;  2BUK A;  3BTX A;  4Q29 A;  4LUK A;  3KZ4 C;  2HYX A;  3MIE A;  1RHI 3;  2MHF A;  3NKG A;  4GQ7 A;  2GH2 A;  3P5B A;  5FP9 A;  3VBO C;  4CCM A;  2PLV 1;  1MZE A;  1OFS A;  3J7L A;  1D4V B;  1QU0 A;  3EQE A;  1QH6 A;  4N8M A;  4AFM A;  1AJO A;  2C26 A;  1UZY A;  1V6K A;  2XML A;  3UES A;  5I91 A;  5KXD A;  1CWP A;  2X10 A;  4XUP A;  1V0A A;  5LBE A;  1S0G A;  1W6O B;  2PMW B;  2ZGP A;  1AUY A;  2B42 B;  2OX0 A;  3KT7 A;  4KGQ A;  5FCC A;  5C5U A;  1VBE 3;  2PHX A;  3NJZ A;  1HV0 A;  1DGL A;  3W5N A;  4FVV A;  4UW6 A;  1Q8P A;  1SHW B;  1XSQ A;  3N7J A;  4Y33 A;  5C3Q A;  3H8X A;  4E2G A;  3HIF A;  3N9L A;  3UJQ A;  1VAV A;  1JZ4 A;  4A7Z A;  3NV4 A;  1TME 2;  4LHN A;  1PZ7 A;  1AX2 A;  1W39 A;  5A7W A;  3OYW A;  5I0U A;  3RI8 A;  3VD9 A;  5FKC A;  4TLG A;  5FPZ A;  2WAO A;  4LBQ B;  1JUH A;  1VB2 A;  4R9D A;  4YW7 A;  3RZZ A;  5CFC B;  1W2U A;  2BPA 2;  1QJX 3;  2LAL A;  5T5L A;  1HN0 A;  1EAH 2;  1XU1 A;  3VL8 A;  2SLI A;  1W99 A;  3KB5 A;  4QDR A;  4UF0 B;  5FZ0 A;  2Z2S B;  4UYB A;  2PAM A;  5FY9 A;  4A2U A;  4XAC A;  4HZF A;  1MVQ A;  2WZR 3;  2V73 A;  2CV6 A;  4PIZ A;  2IXL A;  2Q5T A;  3OD0 A;  3CMG A;  5C4W A;  1E57 A;  3RFR A;  5BNP B;  4IEX A;  1WA4 A;  4CEW C;  4S2F A;  1ST8 A;  3G6J B;  1XRU A;  3NNG A;  5C3P A;  5C3S A;  2DVA A;  1LJ7 A;  2F6B A;  4CCC A;  1Z78 A;  4GZ9 A;  4CDW B;  4P08 A;  4Y1Y A;  2W47 A;  2XON A;  4EWA A;  4O61 A;  1WLC A;  1JBC A;  2HWD 3;  4I01 A;  1ODM A;  3VBO A;  3AFK A;  3WNN A;  1YRZ A;  2XKP A;  1CD3 G;  3DN7 A;  4KWJ A;  3MUY 1;  4ONU A;  1RUJ 3;  3VZK A;  4UWD A;  4LA2 A;  5TSW A;  1W04 A;  1NX9 A;  1W2T A;  3RGB A;  4AVC A;  4CE8 A;  1WWY A;  2BEO A;  2GNM A;  5DAX A;  5FY1 A;  1A8D A;  3HAG A;  3SC7 X;  3LPF A;  4M4P A;  2VMH A;  1JUI A;  2XQX A;  4QKF A;  1AJK A;  5I8Y A;  1VAK A;  1JYC A;  3WP3 A;  2AR6 A;  2A3Y A;  1SMV A;  4LOT A;  1ZRE A;  1H1A A;  1BCX A;  3WF0 A;  4MHU A;  5GLT A;  2OPK A;  1NZC A;  2R30 A;  2ZS6 B;  3MBW A;  3JQW A;  1YLL A;  3CU7 A;  5FXZ A;  4DUX A;  1W6P A;  2MEV 1;  3I7D A;  1QF3 A;  3R4S A;  1X33 A;  4LK7 A;  2WNU C;  2R07 1;  4CDX C;  3I3D A;  3POS A;  1GZT A;  5LK7 B;  4AHZ A;  2BVV A;  4Z07 A;  2W92 A;  4XDP A;  3RZG A;  1HRV 2;  2FD8 A;  4Z2W A;  2JIC A;  4Q0S A;  5A6Z A;  1UWW A;  4F3J A;  3WF1 A;  2XUM A;  2DCK A;  1D0H A;  4IL7 A;  4JGY B;  4JHZ A;  1UZ0 A;  5H9R A;  5GAL A;  3USU B;  3L9J T;  1YO8 A;  3ZXK A;  3AVR A;  2JXA A;  4FPE A;  2XUE A;  4CEW A;  4OZX A;  4N53 B;  1EUU A;  3ZR5 A;  1GOH A;  1OXC A;  4YYO A;  4K8F A;  4TYS A;  5FYC A;  5JOX A;  2RS3 3;  4JDM A;  2RV9 A;  4H3W A;  5J1X A;  5FQ0 A;  4IXL A;  3ZFG C;  4Q4X 1;  4YVS C;  3V65 A;  4KL1 A;  1QGL A;  5F6K A;  1LCL A;  4W6Y A;  1R09 1;  2BGP A;  2YC4 A;  5C71 A;  3DPR B;  3SCF A;  4LA3 A;  3ON7 A;  4NPR A;  4AHY A;  3Q9O A;  2DF7 A;  4C0H A;  4RR3 C;  4XVH A;  4AK3 A;  2AYH A;  2PLV 2;  4FPL A;  5JPM B;  1JU3 A;  1UOF A;  2VQT A;  4C90 A;  4LBK A;  2YFU A;  3VBH C;  1ND2 A;  5IUQ A;  1QJU 2;  1LES A;  2KA3 A;  2B4K A;  4GAL A;  3J9S A;  2IC1 A;  2WO3 A;  3FLT A;  2IXH A;  2JJ6 A;  3ATG A;  1LOA A;  2FMD A;  2XJV A;  1U5Y A;  1RJ8 A;  2DVG A;  5E16 A;  3K46 A;  5H9S A;  4QQ2 A;  5LBC A;  3LA7 A;  4L8Q A;  4HSJ A;  2D6M A;  4CDX A;  1RUE 3;  3WF4 A;  1LKN A;  1OUX A;  4TXW A;  4YAR A;  2MNG A;  2C9K A;  4COW A;  1V6I A;  3N3H A;  4XXA A;  4DZG A;  1NLR A;  1UKG A;  3RMY A;  1FV3 A;  3L2H A;  3S7I A;  3W21 A;  5LCW L;  3O5S A;  1LRH A;  4Y5Z 0;  5GZE A;  2XOM A;  5L7O A;  5DG1 A;  4IE5 A;  4IE6 A;  2HWC 3;  3FBM A;  3ZXJ A;  4AQT A;  1UX6 A;  4OVE A;  5FZC A;  2JG9 C;  5CFD A;  5I0D A;  3S57 A;  2UWC A;  4Y1X A;  3A4U A;  1AX1 A;  2PYT A;  1PVC 2;  2W2I A;  1VLN A;  2O8O A;  3H7Y A;  1AL2 1;  2VVF A;  3J8F 3;  4PI2 A;  3WNM A;  4DOU A;  5EJ3 A;  1XNA A;  1JZ3 A;  1XC6 A;  3E5X A;  1TEI A;  2Q8D A;  3ZFG A;  3ZO0 B;  4YW3 A;  4BIO A;  4BXF A;  2D5F A;  3KGL A;  4YVS A;  4OI1 A;  5HCH A;  4HMZ A;  1UMZ A;  1EYB A;  4OMC A;  5LBF A;  3BU7 A;  1TNF A;  2Y38 A;  5DZF A;  4Y1V A;  5C6C A;  5HBA A;  1DU3 D;  3M70 A;  5CIR A;  4BK4 A;  3A21 A;  3F95 A;  3O1M A;  4HK9 A;  2QQP A;  3B7M A;  4QXB A;  1BXH A;  2ZOE B;  2EIG A;  2O1Q A;  4NRP A;  3D3A A;  3VBH A;  2ATF A;  2E33 A;  1RIR A;  2XJU A;  4OHV A;  1S2K A;  5IWF A;  3AJY A;  4CEW B;  3WDV A;  4XFB A;  1N1Y A;  3GNE A;  3IB3 A;  4XZP A;  2RS1 1;  3CJI B;  3WQ1 A;  1RMU 3;  3SH4 A;  3U78 A;  4DNY A;  2ENR A;  2SBA A;  2EXJ A;  4ATE A;  3TEY A;  3TOJ A;  1DIW A;  1DZR A;  3PUQ A;  3TRS B;  3MLJ A;  1UY2 A;  4A3Z A;  3AL6 A;  4LIU A;  3ZKY A;  4DFS A;  2JE9 A;  4BWO A;  4M3C B;  2TUN A;  3SIS A;  3UV9 A;  3M2M A;  1MEC 1;  1RUI 3;  3GYD A;  2MEV 2;  1OI6 A;  2DVF A;  1AYN 3;  3JBG 3;  5FPU A;  2RE9 A;  2R07 2;  2YC2 A;  4AHX A;  2HWB 2;  2IFW A;  1OUR A;  2AGS A;  2YC0 A;  4Y1U A;  5FUN A;  3DYO A;  4BQ1 A;  2VMG A;  5DZG A;  2G9G A;  2QQO A;  2WYF A;  3POY A;  1MZ5 A;  3CF6 E;  1W8U A;  2TNF A;  4XHB A;  1ZA4 A;  4BQ3 A;  2BGC A;  1VPH A;  2NN8 A;  1W8O A;  4XCA A;  3TNP B;  4IND A;  4ERO A;  4PIX A;  4YZ4 A;  1NLS A;  3NAP A;  4QGN A;  4QQP A;  1RJ7 A;  4Y22 B;  1FT9 A;  1REE A;  2ZX0 A;  2WNU B;  4LIV A;  3ZIX A;  3OOX A;  2JDZ A;  1W28 A;  4XBN A;  1VBE 1;  5ACA 1;  5JIA A;  3I59 A;  1HX6 A;  1LAJ A;  2X5I B;  3U14 A;  4NUB A;  1LOF C;  2JE7 A;  3TNQ A;  3VV1 A;  3I2H A;  3NV1 A;  3GZE A;  5L73 A;  4XJ9 A;  1R09 2;  1GAN A;  4CU9 A;  4XF0 A;  5ABJ C;  1NT0 A;  1TME 3;  4BQY A;  3AMH A;  2WWJ A;  2WQZ C;  1WW4 A;  2R1B A;  1X7N A;  1VAM A;  1OVS A;  5FRA A;  5JWP A;  2D6P A;  4FP3 A;  4NPM A;  5AFE A;  3LOB A;  1Q8S A;  4U36 A;  4I0A A;  4AVA A;  4MAD A;  1YNA A;  1EAH 3;  3AP9 A;  3C7H A;  1RUC 3;  3AYA A;  4FPJ A;  1PIV 1;  1NY7 2;  3NQH A;  4LHK A;  4YG3 A;  2VZ3 A;  2XJT A;  3VKM A;  4L2N A;  2P3J A;  4CXY A;  4XBQ A;  5BNN C;  1RYY A;  1IZ3 A;  2VVE A;  4TN7 A;  4LO5 B;  4C1W A;  2XBO 1;  1UD1 A;  5FOB B;  4RR3 B;  2IXJ A;  1PNF A;  5BXX A;  3CZJ A;  4LNV A;  4J1W A;  1PK6 C;  3ZN6 A;  4QGL A;  2ZGQ A;  2BOJ A;  3I3B A;  3O1T A;  1SPP A;  3PMS A;  4XC9 A;  5A6X A;  3WV6 A;  5FZ8 A;  2KM2 A;  3K51 A;  4HN0 A;  2WA3 A;  1JMU B;  4RGA A;  2ZEX A;  3LIH A;  4PT6 A;  5T5P A;  4YW1 A;  4BIF A;  2D7F A;  3POW A;  4CCK A;  3MGU A;  1VP6 A;  1JOB A;  3DV8 A;  4LO7 A;  4B4R A;  4MGZ E;  1WLW A;  3HBZ A;  5A7P A;  4QQO A;  3BGA A;  4IEW A;  2R32 A;  4R4X A;  5FO7 B;  1AL2 2;  2EID A;  1U0A A;  1YYN A;  4N90 A;  1JZ7 A;  3LAG A;  1JU4 A;  1VRB A;  1LGB A;  1OA3 A;  1UY0 A;  2R04 3;  3WW1 A;  1GP6 A;  4YW2 A;  3KS7 A;  1OKQ A;  3VB9 A;  3PME A;  5C9A C;  1CZT A;  3WG3 A;  5ABJ A;  3GZA A;  1Q3E A;  3DKW A;  5A80 A;  5AC9 3;  1UOB A;  4Y24 A;  5J37 A;  4FFF A;  2JG9 B;  1AYM 2;  4DB5 A;  1APN A;  1R1Z A;  5AVP A;  2E26 A;  3NRU A;  1Q8O A;  1TQ5 A;  2PHL A;  1VBA 1;  2Z42 A;  1WME A;  2V5Y A;  3GGL A;  3P3N A;  2OYZ A;  4QPG B;  1HRV 3;  2DDU A;  1OF3 A;  2RS1 2;  2WN2 A;  3N9Q A;  2VZV A;  3LDK A;  2D5H A;  3IMM A;  5C8C C;  1XNC A;  4FPY A;  1W3V A;  3OGR A;  4CCO A;  5BNN A;  2XHK A;  5FY4 A;  5GLU A;  3GBF A;  1UW8 A;  3MIB A;  2ZMK A;  2E63 A;  4R9A A;  2HWF 3;  3RYR A;  4MGY E;  4CDQ C;  3VHN A;  2E51 A;  1DFQ A;  1DDL A;  2XVG A;  1MEC 2;  4AQ2 A;  4FPO B;  4IGO A;  1N3O A;  5J3U A;  2QTW B;  1OC1 A;  2VMI A;  3DEM A;  4W65 A;  5FR3 A;  1C28 A;  1BQP A;  1NQJ A;  5IK8 A;  4K1Y A;  4ZON A;  1NCQ C;  4Y5T A;  1T6G C;  1ZBE 1;  2HH9 A;  2BRT A;  1ULD A;  4M01 A;  1VAL A;  5D1I A;  4CUG A;  2JDH A;  5CU1 A;  3KLS A;  1EV1 1;  2CL2 A;  1DYK A;  1YJL A;  4H55 A;  1OH4 A;  5BNO B;  5F2W A;  3P1I A;  3AXE A;  3LCP A;  2GNB A;  3JQX A;  4MGS A;  1WD3 A;  3ZFE C;  3K75 B;  2P37 A;  2ORX A;  4Y5S A;  1G8W A;  1Y43 B;  2YB7 A;  4QPY A;  5FBZ A;  2JG8 A;  2Y8K A;  4Q27 A;  5GM0 A;  5FZM A;  3RDI A;  4DQA A;  5A1A A;  4Y20 A;  1ULG A;  1Y4W A;  1VBE 2;  3JCI A;  1ODN A;  3VBS C;  1XU2 A;  1UF2 C;  5C9A A;  3HQR A;  2DCZ A;  4IEO A;  5KR7 A;  3HQU A;  1S2B A;  2PHU A;  5HCA A;  1NAE A;  1WCK A;  3AMQ A;  1LHW A;  3O0X A;  4DS0 A;  4XJZ A;  1JOP A;  2EIB A;  4I2O A;  1JHN A;  3WF2 A;  2XPJ A;  2NM1 A;  4W50 A;  4R52 A;  2DBI A;  2EA7 A;  1R64 A;  4X6Q B;  4QX0 A;  1EY2 A;  4LO4 B;  4OHW A;  1LB2 A;  2BER A;  1D7P M;  5C8C A;  1J1L A;  1MPX A;  4DXS A;  1IOA A;  2VTX A;  2WFF 3;  2WS9 1;  3R05 A;  3OJB A;  4JCK A;  1PIV 2;  4M3C E;  3GBW A;  4IGP A;  3SLI A;  5DMY A;  2J22 A;  3RJ2 X;  4CP9 B;  3ZXA C;  2GN3 A;  4YG6 A;  4CDQ A;  4QU2 A;  2DVB A;  1SCR A;  1YQ2 A;  5FWJ A;  2XBO 2;  3R0R A;  1NG0 A;  2GP5 A;  2Y0O A;  3MID A;  4XQW A;  5FZO B;  3ZKU A;  2QBX A;  1O5L A;  5BNQ A;  4ZXK A;  3NW4 A;  4Z82 A;  5IAV A;  2FDI A;  4FQZ A;  3VZL A;  3OUH A;  4J1X A;  2Y6G A;  4QDQ A;  1ULF A;  1PMI A;  3AL5 A;  2JIG A;  3ES1 A;  1VMF A;  4Q8L A;  3T0B A;  4AOC A;  2HWD 2;  1W90 A;  4FPK A;  4NN0 A;  4DO0 A;  2E9Q A;  4P5H A;  3ZFE A;  2I07 B;  2IXC A;  2A3X A;  3I49 A;  2WZ8 A;  4I3G A;  5FYS A;  1WMD A;  4LPL A;  4MZU A;  1PK6 B;  4YM3 A;  3BN6 A;  3SH3 A;  1LUL A;  1COV 1;  3DKQ A;  4YRD A;  1GU3 A;  1F4A A;  5IW0 A;  4CDU C;  4XBL A;  2EF6 A;  3J4U H;  2GME A;  2EIC A;  2FCV A;  3ACG A;  2VU9 A;  2IVI B;  1QKQ A;  4LKE A;  1LOE A;  4XUN A;  3E1F 1;  5FOJ B;  5SV8 A;  2FDH A;  5FP3 A;  5JIU A;  1AR8 1;  5DDJ 1;  3D82 A;  1AF9 A;  1UZZ A;  4MGK E;  4OMD A;  4YGD A;  1UMH A;  3WP6 A;  2MEV 3;  3UKV A;  3RZJ A;  2VBP A;  3B93 A;  1W6M A;  4MVT A;  1VIW B;  4Z92 B;  1VBA 2;  5JZG A;  5FYM A;  5L9B A;  3OCP A;  5F5I A;  2GU9 A;  3AKS A;  1OOP C;  3EBR A;  3N4M A;  3GZU C;  3KM5 A;  2BNN A;  2HJI A;  4OFG A;  1W05 A;  4N43 B;  5LRR A;  4CP2 A;  4Y20 B;  5KC6 A;  5APA A;  4PJY A;  2B45 X;  4QM8 A;  2BZD A;  2YBS A;  1FV2 A;  4ORF A;  1ACC A;  2R06 3;  3NWK A;  1YFU A;  3FUO A;  2WT1 A;  3AP6 A;  2QJV A;  1H4H A;  2IXI A;  3BTA A;  1YIF A;  4R4Z A;  5FIX A;  1ND3 C;  4Q4X 3;  1KJL A;  3FHQ A;  4JZR A;  4CRQ A;  2ETE A;  1VMH A;  1R09 3;  1ZBE 2;  4BDV B;  1JOD A;  3Q8C A;  1CQ9 A;  4NIG A;  2QQU A;  1EV1 2;  1VJ2 A;  2RMU 1;  2A3W A;  2VMC A;  1JYT A;  1T2X A;  3D4K A;  3HMY A;  2Z4F A;  4L92 A;  2VR4 A;  4NJ4 A;  5KHJ A;  3E97 A;  4LBL A;  2W94 A;  4P14 A;  1QJF A;  5HV4 A;  4AED A;  1JOJ A;  1QJE A;  1RUC 1;  4CDU A;  1S0D A;  4AI2 A;  1A3K A;  4QPI C;  3K2O A;  1NCQ B;  4NO4 A;  1F9K A;  3ZDV A;  3M4F A;  2QKD A;  4LK6 A;  2WZP P;  2R1D A;  3DXU A;  4FPF A;  1H30 A;  4OI4 A;  4O9E A;  4XTP A;  4CP0 A;  3MFA A;  3VD5 A;  4CTE A;  5BY5 A;  3VHO A;  4XFA A;  4BH9 A;  1KD7 A;  2ZGU A;  1YCI A;  4XCB A;  4IDZ A;  1D2Q A;  4AW7 A;  1RUE 2;  2AEN A;  1OOP A;  2VM9 A;  3AKT A;  3V56 A;  2GDF A;  4BK5 A;  4D94 A;  4D8M A;  2LRP A;  2PHD A;  1S0C A;  3RNS A;  1YEW A;  3A0K A;  1Y9G A;  4AQ6 A;  4EN7 B;  2DUP A;  1MAC A;  4N7I A;  5FZD A;  3VBS B;  4BE3 A;  4AFA A;  3T2P A;  3T2Q A;  2DTY A;  2BJS A;  1HRI 1;  3VHP A;  3IKW A;  5B4X A;  2F17 A;  3K4A A;  4XF4 A;  3NV3 A;  4UFK A;  2HYK A;  4HET A;  5GLZ A;  3UGF A;  3N7M A;  3VBF A;  1SDW A;  1YJK A;  1Z7S 3;  4OUM A;  1F5F A;  1BJQ A;  2W39 A;  3HQX A;  4CZS A;  2OA2 A;  3P3P A;  1AL2 3;  1OHF A;  4XJW A;  5E89 A;  5E6H A;  4GAZ A;  1OA4 A;  2VG9 A;  2QNK A;  4EZH A;  1W6M B;  3VBR B;  1ND3 A;  3EMR A;  1IS6 A;  3T2T A;  2GC2 A;  2RG4 A;  2ARX A;  5A32 B;  1LEM A;  2JD9 A;  2P3I A;  4PBP A;  5FY5 A;  1AR6 1;  1UKR A;  1J59 A;  3S6P A;  4PDW C;  3III A;  1DHK B;  4QX5 A;  3AZV A;  1MZ6 A;  3OBR A;  1AR7 1;  4BJ0 A;  2CDP A;  2Y6K A;  2YBP A;  1H8T C;  2PAK A;  5AC9 1;  5FYY A;  3AKQ A;  5FMD A;  2Q8O A;  5ABJ B;  1YQ8 A;  1BZW A;  2Q30 A;  4AZZ A;  4YM0 A;  5FY8 A;  2ZAB A;  2YGM A;  4IUG A;  3KCY A;  1ULC A;  5F3C A;  3W5M A;  3PLQ A;  2KR2 A;  4NAM A;  4DRV A;  4AED C;  4GXL A;  5JDB A;  1ZM1 A;  2RS1 3;  2VXR A;  1J58 A;  2XVL A;  3PU8 A;  3THP A;  1COV 2;  5EYY A;  4EJR A;  5I0S A;  2BVB A;  3TEZ A;  2FMY A;  2VBD A;  5ANN A;  1B35 A;  4J6G A;  5I8T A;  2VCC A;  3I4I A;  4HPK A;  4NHM A;  5IFP A;  2EAK A;  2GAL A;  3SKV A;  1UYZ A;  4AVT A;  3R6S A;  2VZU A;  5F3I A;  4MXW B;  2YBK A;  3WNX A;  5DDJ 2;  4CCL A;  4BXS V;  5C4W C;  5IAT A;  4FPG A;  2R0H A;  1C3H A;  1WGP A;  4BHP A;  4QB6 A;  4KQ7 A;  5I93 A;  1OT5 A;  3TN9 3;  1G86 A;  1XYO A;  2DYC A;  2G9Z A;  4BB3 A;  4XIK A;  1E5I A;  4GH4 A;  4XDQ A;  3E6B A;  4CDU B;  4K40 A;  1C1F A;  2WIN B;  3ENR A;  5GLV A;  2A75 A;  4DMI A;  3MIF A;  2RR1 1;  2VW0 A;  4MO3 M;  2B7Y A;  2PFW A;  4NMI A;  3WP5 A;  2OW4 A;  1QXP A;  4XAE A;  3EHK A;  4HG6 B;  2YRO A;  5JI9 A;  3H1Y A;  1LEN A;  5FZH A;  2OKX A;  2AC1 A;  4RGG A;  1G9D A;  3WW3 A;  5ACA 3;  2RDN A;  2RM2 1;  2JEN A;  1ENR A;  3MW2 A;  1WW5 A;  4PDW A;  1JXN A;  1ZA7 A;  2W9X A;  3Q8B A;  4AR2 A;  4PQ9 A;  4XTM A;  5G04 L;  3GCX A;  3POB A;  1QNY A;  1H8T A;  1W9F A;  4HSL A;  2GC0 A;  3VGI A;  2JDM A;  3D0S A;  1LGN A;  3GDB A;  1UQX A;  5FDB A;  5LRS A;  1CAX A;  4WM7 A;  4YWA A;  2OQ6 A;  1Y3T A;  2KD7 A;  5LK5 A;  1UYY A;  4D3W A;  5CKN A;  1CAW A;  3NNJ A;  1JYI A;  5KBF A;  5SV5 A;  3M1H A;  2QQK A;  3D5O A;  3WUC A;  2WYS A;  4AG4 A;  4AI0 A;  2XDV A;  2B46 X;  1RUC 2;  2WFF 1;  2F4P A;  4JC1 A;  2ZGL A;  1PIV 3;  4F83 A;  3BKZ A;  3FLP A;  4QU1 A;  4Y1Z A;  1U12 A;  3IM0 A;  1GOG A;  3O0V A;  2X53 S;  1RVF 1;  3GCW A;  2ZX1 A;  5CG8 A;  2BW8 A;  5FZE A;  4ATF A;  2XBO 3;  4GA9 A;  1DCS A;  1DYO A;  3K4D A;  2ZKL A;  4BA6 A;  4UT5 A;  1RIT A;  2W0X A;  4U2A A;  3KVA A;  1ZZ8 A;  3N7L A;  2O0O A;  4NII A;  3BTY A;  2EXH A;  3LEM A;  2GND A;  4O65 A;  4LLF A;  3S7E A;  4QPI B;  4CUC A;  2ZAA A;  2FDJ A;  4E4S A;  2R6Q A;  3WIN E;  1HN1 A;  5FK8 A;  3PJQ A;  2GC3 A;  1RUH 1;  4WZC A;  1JN2 P;  5F37 A;  5FRE A;  1CAU A;  2JDY A;  5LA2 A;  3NNM A;  4HKW A;  4NHK A;  4E2Q A;  4LHS A;  2UY8 A;  1ND2 C;  2C0Z A;  2ET1 A;  4R9C A;  3ZSK A;  4I02 A;  2WNE A;  3O7O A;  1ULP A;  1YI9 A;  5A70 A;  4KBZ A;  1WMF A;  5IHR A;  4CXX A;  4BOW A;  4H7L A;  5JI7 A;  3ZPO A;  4WBB A;  2BWA A;  2R04 2;  1DGR A;  1AR6 2;  4UBH A;  2R7E B;  2WRA A;  3RYK A;  3ZXF A;  5IVV A;  2K0G A;  5A3W A;  3LDR A;  1O3S A;  1AR7 2;  4SLI A;  3ZMO A;  4TLF A;  2K2S A;  5AC9 2;  5C33 A;  1EPZ A;  4XHX A;  4UFM A;  3UNP A;  5FZI A;  4FFI A;  2FHR A;  1DQ1 A;  5FWE A;  1VBA 3;  1JTZ X;  1YQ6 A;  1JZ6 A;  2OUJ A;  2ZGS A;  3U07 A;  1LOG A;  2ZMN A;  4AFD A;  4NIH A;  4NE9 A;  4WV8 A;  3ELN A;  4A7Y A;  1ENQ A;  1H2L A;  2WR9 A;  2QFE A;  3CHX A;  5DAV A;  2ARB A;  5IK7 A;  2VUA A;  2ARE A;  5L7O C;  1TVG A;  1PVX A;  4YZ5 A;  2A5Z A;  2VEC A;  2EIE A;  2NYY A;  2HWF 2;  1H2M A;  4IE7 A;  5CFD C;  3IPV A;  1O6U A;  4K21 A;  2RDS A;  3AYD A;  2R06 1;  3I2J A;  1PM4 A;  3OYW B;  5A7W B;  2VY0 A;  3MPP G;  4YFW A;  3WEZ A;  4MX3 A;  4GWJ A;  3C8X A;  4L97 A;  4QHZ A;  4NID A;  4L99 A;  1ZRD A;  2E7T A;  1W03 A;  4SBV A;  2X8K A;  4YGE A;  3J7M A;  1UXZ A;  4QQL A;  4ASK A;  1ZBE 3;  4AGG A;  2WC2 A;  1FPN 1;  1W8H A;  1S1A A;  4JRL A;  4WVW A;  1EV1 3;  1SQ4 A;  3PUR A;  4XJA A;  1WMX A;  2RR1 2;  1MS8 A;  3FMG A;  5A1F A;  2JX9 A;  1C5I A;  3CJX A;  4K7J A;  2WO1 A;  5C4W B;  3POE A;  2D3P A;  4YVW C;  2ZZQ A;  3HNB M;  3BPS A;  3WCS A;  1MR5 A;  2VME A;  1H2N A;  3PIJ A;  1QOS A;  4NOT A;  4W6W A;  4LR4 A;  2WZE A;  1G9C A;  5CZK A;  4AVB A;  1YWK A;  2OXB A;  4AI1 A;  3ZXD A;  3R4U A;  3NMB A;  1GZW A;  2WBK A;  4GMP 1;  1V6J A;  4QKN A;  2JDP A;  4XF1 A;  3VBO B;  3UJO A;  4S2D A;  1AX0 A;  4AI9 A;  1AR9 1;  2ARA A;  2Q4S A;  4ZHN A;  4RD7 A;  5DUW A;  4YZ2 A;  4D0Q A;  5FMO L;  1KDM A;  1LU2 A;  3D8C A;  3PUI A;  3N35 A;  1N3Q A;  1H1M A;  2CYF A;  2CWM A;  3KGZ A;  5KC5 A;  2YY1 A;  4NRM A;  3BTZ A;  1OKO A;  1BK1 A;  3WXP A;  2AZ5 A;  4UW5 A;  1F31 A;  2WS9 3;  1IQA A;  2WFF 2;  1HQW A;  4YGC A;  5FPB A;  2OII A;  2C5D A;  3ILN A;  2Y6H A;  3ACI A;  5K0U A;  1NA1 C;  3OBA A;  3U10 A;  1RVF 2;  3B9C A;  2WWU A;  3H0O A;  5LW9 A;  1Z7S 1;  3E6C C;  3ZXE A;  5CEH A;  1E5R A;  3HPN A;  4RN5 A;  1W2N A;  3DCQ A;  3NAP C;  1W6P B;  2GC1 A;  3RWK X;  4YFZ A;  2VZR A;  1CES A;  2GSY A;  3CBN A;  2YZ4 A;  4WVM A;  3WF3 A;  1IKP A;  1F4H A;  2V5D A;  4K3U A;  4AI8 A;  1LHO A;  1ZBA 1;  2VOW A;  3ACH A;  4QT6 A;  4CPB D;  1X9P A;  3B5L B;  4IQP A;  4UAP A;  5EQU A;  4H14 A;  1RXG A;  2WSU A;  3OEA A;  4MGI E;  5FYH A;  1IS4 A;  3GXU A;  4GJZ A;  4FFG A;  4AI3 A;  4RS5 C;  2CNA A;  1J1T A;  5LAT A;  4KBB A;  1CJD A;  1C5H A;  2YPJ A;  2VBB A;  4B1L A;  5I0T A;  4YVW A;  1IGO A;  1XE7 A;  3ETQ A;  3I2I A;  5ISL A;  3IPV B;  4A4A A;  1SLA A;  1A78 A;  1XXN A;  5FUP A;  1W2A X;  3C7F A;  1OUS A;  4QMA A;  4E9K A;  5DN2 A;  1COV 3;  4MOA A;  1PM7 A;  2P3Y A;  3QH6 A;  4DXR A;  5A3P A;  1CIY A;  2D93 A;  4K6B A;  1DQ2 A;  3IDE A;  5FQ0 B;  4OZO A;  2CWS A;  1DG6 A;  2FCU A;  1OVP A;  4UXA A;  1DQ4 A;  5DUV A;  2JIJ A;  1MS5 A;  1U5Z A;  1AR8 3;  2B9U A;  2BOI A;  3KSC A;  5DDJ 3;  1S0B A;  2J1V A;  1K12 A;  3WR0 A;  3OY8 A;  5FPA A;  1OQD A;  5A7N A;  1CPN A;  1ND2 B;  3BIW E;  5KWR A;  1C1L A;  3TN9 1;  4FAG A;  3GJA A;  3ZOI A;  3HNY M;  2VZO A;  1BEV 1;  4ARX A;  4COY A;  1S0I A;  1NLQ A;  2Q1F A;  1ZRI A;  2HBT A;  1UU4 A;  3ILF A;  3ZVX A;  4D7Y A;  1O3R A;  1NA1 A;  2QQI A;  1DF0 A;  4LBN A;  1V6O A;  3ZM8 A;  2G9F A;  4BQ4 A;  3O1P A;  1CZS A;  2XLF A;  1I9R A;  4YW6 A;  5DUU A;  5F8P A;  3WG4 A;  5JLV A;  3F2Z A;  4Y4R A;  1W6Q A;  1RC6 A;  4HK8 A;  5FAX A;  1O59 A;  2W1S A;  3H9A A;  4E27 A;  2R06 2;  4CDX B;  3C7E A;  5J98 B;  3SHR A;  5FZA A;  1BVP 1;  2PQS A;  3C7O A;  4B7K A;  4CPB A;  2A6Z A;  3UKT A;  4QX2 A;  4Q4X 2;  4E4Z A;  1V6N A;  1STM A;  5FO8 B;  3RZK A;  2WWS A;  2FDK A;  1L7Q A;  2WO2 A;  3H7J A;  4WVZ A;  5FLJ A;  4COZ A;  2DUO A;  4RS5 A;  2VXJ A;  2RMU 3;  5L7O B;  2P17 A;  5D2A A;  1MQT A;  3ES4 A;  1OLM E;  4V2V A;  1PGS A;  5CFD B;  1QDC A;  2ZEZ A;  1GP4 A;  2ZEW A;  3KF5 A;  4Q1R A;  3OGG A;  5F5Q A;  1US3 A;  1Q56 A;  1UY3 A;  5JR7 B;  4PQQ A;  1X82 A;  4XUR A;  3RQ0 A;  1H9W A;  2JD4 A;  1QHD A;  5E1R A;  1QJY 1;  1ASJ 1;  3ZFG B;  4O7X A;  4LE4 A;  3VZM A;  3RJR A;  2VCM A;  4YVS B;  2CDO A;  4Q5O A;  4YGB A;  3LPG A;  3CLP A;  1R1A 1;  2ZA9 A;  3NO8 A;  1PO2 1;  1RUF 1;  1VB4 A;  4MV2 A;  1EPW A;  4XMA A;  3VHR A;  5C3O A;  5JR2 A;  3WQ0 A;  4P9J A;  3T1M A;  2HEW F;  2WA4 A;  2QUO A;  3IMN A;  4NRQ A;  1RUO A;  4LIT A;  3VBH B;  1VE0 A;  4E2S A;  3FUQ A;  1GV9 A;  1JYX A;  3FFQ A;  3VKO A;  5IFT A;  5A3L A;  5DPN A;  2DUR A;  3JB8 A;  2YHJ A;  3ZPY A;  5J96 B;  1O8P A;  2WNV A;  2ZGM A;  4UW4 A;  2YDE A;  3N9P A;  1HRI 3;  5T52 A;  2Y33 A;  1ULE A;  3KHB A;  4G4F A;  5A7Q A;  4CU7 A;  2CGN A;  5HCF A;  1Z7S 2;  3ZLI A;  5E88 A;  5HXV A;  5K9Y A;  5EWS A;  4HL0 A;  1DZT A;  2ZZJ A;  2JG8 C;  4ZKT B;  2Y64 A;  3I8T A;  3FZ3 A;  4PI0 A;  5DAQ A;  3RZM A;  5GKA C;  4HBN A;  1SLC A;  4GKY A;  1CIW A;  3U0Z A;  1ZBA 2;  3BUC A;  4YZ1 A;  4XPV A;  4KMQ A;  1AR6 3;  3HR9 A;  5BPX A;  4OHY A;  1AVB A;  2GAU A;  3VDD A;  3KWV A;  1AR7 3;  1K5M A;  2P6H A;  4B8E A;  3HWJ A;  2ZJC A;  4IEV A;  3MYX A;  4PF1 A;  1S0J A;  2Q1Z B;  1CX1 A;  4QAW A;  2RJL A;  3INA A;  1YHF A;  1CON A;  1DLL A;  2GMM A;  2D6L X;  2WLP A;  1W8N A;  5JPN B;  4WM8 C;  2BQP A;  2VOT A;  3I54 A;  3NAP B;  1QXR A;  4P02 B;  5A6Y A;  5T54 A;  2B9V A;  1KGY A;  2UWB A;  4A42 A;  4QHB A;  1KFX L;  3L2Y A;  4W8J A;  2VZQ A;  3JD7 3;  2DVD A;  3I59 B;  3GJB A;  2ZHK A;  1G9F A;  1UU6 A;  3MO4 A;  4ITC A;  4TSV A;  1XOY A;  5HI0 A;  5F32 A;  1NZI A;  1A8M A;  4EN6 B;  1O7F A;  4Q4Y 1;  3CKH A;  4HN1 A;  4RYD A;  3W9A A;  1CN1 A;  4CEY C;  3B69 A;  1BKZ A;  2NLR A;  2X29 A;  5JXJ A;  1G6N A;  1KQR A;  1S55 A;  3M3Q A;  4CUB A;  4K9S A;  1HLC A;  3H3Z A;  1NXM A;  1OBN A;  3ZYI B;  5FBJ A;  5FPV A;  3BB6 A;  3VD4 A;  2RJK A;  4ES8 A;  4MUV A;  1LNS A;  4Q4V 1;  3OPZ A;  3TN9 2;  3AM2 A;  4DUW A;  2QE3 A;  2WLQ A;  2C6S A;  2ZX2 A;  1BVV A;  1W06 A;  3Q8E A;  4CCE A;  2Q8E A;  4COV A;  4R8H A;  2Y60 A;  4OUE A;  1UU5 A;  3WSO A;  2WSV A;  3RPQ A;  1I3H A;  2RR1 3;  3AYC A;  3ZX7 A;  5JXI A;  1RED A;  3E5U A;  4R9B A;  3WDY A;  2J42 A;  3ORJ A;  1SFY A;  3MF9 A;  3WD5 A;  3A7Q A;  5F7U A;  5LZ6 A;  3IAP A;  2YU1 A;  3BIE A;  3K3N A;  5G05 L;  3DXT A;  3ZSJ A;  4EWE A;  4XAB A;  3ZN6 B;  1GWL A;  2XJQ A;  5FZF A;  4BZ4 A;  1KRI A;  1TG7 A;  4Q8K A;  1BHG A;  1SPP B;  3IAQ A;  5ACA 2;  3CNA A;  2RM2 3;  2B39 A;  1ZNP A;  2VW1 A;  1FAY A;  2ET7 A;  3MF6 A;  3MI8 A;  1POV 1;  3NVC A;  4RA0 A;  2ZPX A;  1ZRF A;  1GQH A;  5T5O A;  4UFH A;  1J83 A;  4Q2F A;  3ASI A;  3DGT A;  4WZF A;  3THD A;  4KU7 A;  3LKJ A;  1H4G A;  4Q26 A;  1HB1 A;  4B4Q A;  4WM8 A;  2E6V A;  1OMI A;  2R49 A;  2W08 A;  3AZY A;  4FPC A;  5FZ9 A;  4P9I A;  3EYP A;  3EJK A;  3T4V A;  4RSU A;  2X05 A;  2LTN A;  5CKM A;  1VBB 1;  4ZU5 A;  2D40 A;  5JZG C;  1SG3 A;  2C1F A;  2RHP A;  3FWE A;  4FOQ A;  4XOG A;  1RUG 1;  5FFO C;  5FTT C;  3WHT A;  1GNH A;  5LBB A;  1ASJ 2;  2AH2 A;  2D97 A;  3ALQ A;  4PHZ A;  4AGV A;  1XBF A;  4CEY A;  1R1A 2;  1RVF 3;  2RS5 3;  4LHL A;  2VQ0 A;  1PGW 1;  1PO2 2;  1RUF 2;  2DV9 A;  3LSD A;  1VBC 1;  1WW7 A;  3ME2 A;  4IV3 C;  3ZFF A;  4URA A;  2Q1M A;  1ZZB A;  1SFP A;  4FP2 A;  2DFC A;  1LU1 A;  1IQD C;  4IV1 C;  3H8O A;  3U4X A;  4LKF A;  5ERL A;  5CBL A;  4A3X A;  3FC0 A;  4B4P A;  4ZZ5 A;  3ZXG A;  1TMF 1;  4FSJ A;  2O14 A;  1S0E A;  2VD7 A;  5IVB A;  2H0B A;  1H6X A;  1CVN A;  3E6D A;  5BNN B;  1X50 A;  1RUH 3;  1YXW A;  2BFU L;  3AKP A;  4N9I A;  1OLQ A;  2RJ2 A;  3OB8 A;  4MHR A;  2VO5 A;  4RHV 1;  5JOZ A;  2XJS A;  4Q0P A;  1JI6 A;  5L9V A;  1W3X A;  2QZ2 A;  4LOR A;  3ABZ A;  1OH3 A;  3TEX A;  4HVR A;  1WCS A;  4M3C F;  3Q8A A;  3MZH A;  1BLZ A;  1XPW A;  1S4C A;  2ZX3 A;  2DTW A;  3PUH A;  4GD4 A;  1HQL A;  1WCQ A;  4IGQ A;  1PX4 A;  4MSV A;  1FOD 1;  2VCB A;  4QGM A;  5FPL A;  4QD2 A;  1GSL A;  1HJG A;  3KCX A;  1BBT 1;  4OUS A;  2P1B A;  4XIL A;  1YI7 A;  4I0W B;  4LQR A;  3IBM A;  5F2S A;  3DUI A;  1ZYB A;  5EXO A;  1NE6 A;  3ZYB A;  4DPN A;  1CAV A;  3O1S A;  4XJU A;  2FZ1 A;  3V0B A;  1V9U 1;  4JGZ C;  1TNR A; 
#chains in the Genus database with same CATH homology
 4NID A;  4NIG A;  4ZS2 A;  4NPM A;  3T3Y A;  4QKB A;  3T4H B;  3RZH A;  3S5A A;  3O1P A;  4NJ4 A;  4OCT A;  5F8P A;  3O1M A;  4IE0 A;  3O1T A;  4CXY A;  3LFM A;  3O1V A;  4NPL A;  3O1R A;  3RZK A;  2FDK A;  4IE5 A;  4IE6 A;  2FDG A;  2FDF A;  4O61 A;  3BIE A;  3S57 A;  4JHT A;  4IDZ A;  5DAB A;  4QKN A;  3BKZ A;  4IE4 A;  4ZHN A;  4O7X A;  4QKF A;  4NRM A;  3BTZ A;  2FDI A;  4MG2 A;  4NRP A;  3T4V A;  4NII A;  4NRQ A;  3BTY A;  3O1U A;  2FDJ A;  4RFR B;  3I49 A;  4MGT A;  3RZG A;  3BI3 A;  2FD8 A;  3KHB A;  3H8O A;  3BTX A;  2FDH A;  4CXX A;  4NRO A;  3H8R A;  3RZJ A;  3RZM A;  3I3Q A;  4QKD A;  3BUC A;  3BU0 A;  4CXW A;  4NIH A;  4QHO A;  3H8X A;  3RZL A;  3O1O A;  4ZS3 A;  4IE7 A;  3O1S A;  3KHC A;  2IUW A;  3I2O A;  3I3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...