4NIDA

Crystal structure of alkb protein with cofactors bound to dsdna containing m6a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
203
structure length
203
Chain Sequence
QEPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/dna
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Switching Demethylation Activities between AlkB Family RNA/DNA Demethylases through Exchange of Active-Site Residues.
pubmed doi rcsb
source organism Escherichia coli
total genus 48
structure length 203
sequence length 203
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2013-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4nidA00
4NIGA 4JHTA 3S5AA 4O7XA 4IE0A 3H8RA 3O1OA 2FDKA 4MG2A 2FDJA 3LFMA 3BI3A 3I3QA 3RZHA 3RZMA 3RZKA 3RZJA 4NROA 3T4HB 4IE6A 4IE5A 4CXWA 3O1VA 3T4VA 5F8PA 5DABA 3O1SA 4ZHNA 4NPLA 3RZGA 4CXYA 4RFRB 4QKDA 3I3MA 3BTZA 4ZS2A 2FDIA 3RZLA 4CXXA 2IUWA 4NRPA 3BKZA 4OCTA 3KHCA 3H8OA 4O61A 4IDZA 3I2OA 4MGTA 2FDHA 3O1MA 4ZS3A 4IE4A 3BTYA 3T3YA 4NIIA 4NJ4A 4QHOA 4QKBA 4QKNA 4NPMA 2FD8A 4NRMA 3BIEA 3BTXA 3I49A 3BUCA 3O1PA 3O1RA 4NIHA 3BU0A 2FDGA 3O1UA 3KHBA 2FDFA 4IE7A 3S57A 4NIDA 3O1TA 4NRQA 4QKFA 3H8XA
chains in the Genus database with same CATH superfamily
3AKRA 4XACA 3VGIA 5FCCA 5LWBA 2WSVA 2HWD1 4ATEA 3H8RA 2XVKA 3PVEA 4W4ZA 2HWF1 1JZ5A 1PNGA 2WSUA 4NHMA 3AP5A 4KH9A 3JB8A 1O3RA 4S2GA 1YJLA 1Z7S2 1W8ZA 2Q1ZB 3BI3A 3T09A 1HN0A 1S0IA 3RVHA 3HT1A 3USUA 2BOIA 3AXEA 2OS2A 4GA9A 4MGZE 2DURA 3N7LA 3USSA 1PX4A 2Y6GA 3VBRC 4BE3A 3OBZA 4XILA 3UYJA 3VBOB 1P8JA 4L2NA 2AEYA 3OGJA 1QJY3 1ODMA 5F6KA 2WNOA 1RUF1 4O9EA 5C4WC 1TZOA 2A7AA 2GN3A 2V73A 2RMU1 4C0BA 1U12A 3UNPA 2DCYA 3VKNA 3U37A 5JR2A 1DQ0A 5CG8A 4BH9A 5A6ZA 1ND2A 1OI6A 1VR3A 1YC61 3ATGA 1VBE2 4TXWA 5LA1A 2R063 4KBBA 5LK5A 4FCAA 1APNA 1QY4A 2YB7A 2P17A 1CAWA 4OLLA 1YQCA 4MHRA 1PK6B 1BMV2 1G9CA 4M00A 1KFXL 2DBNA 4XC9A 4YW2A 3KQ4B 3JQXA 2E26A 1E5IA 2Y60A 5A6XA 2IXIA 2WO1A 1DQ1A 5F5IA 5JSOA 3I3EA 4M3CE 5DDJ1 3OPTA 5DUUA 2HWC1 2A3WA 2VAUA 4MX3A 1NZCA 2ET7A 2UYAA 2WABA 1B09A 3T0BA 3SKJE 3W9AA 2JDKA 1VAKA 1DP0A 1VLNA 1LODA 3AFKA 1VP6A 3ACGA 3TEYA 4YW6A 3TOJA 2RM23 5JXIA 1LRHA 1H4GA 4YFWA 1Y9QA 1PO12 3K4ZA 1RUE2 2ZHMA 1HB2A 2G9FA 2JICA 3EB7A 3SQOA 3TN93 4QKBA 3WNMA 1AR92 1W8FA 4CEYB 2HBTA 2WJSA 3F2ZA 1EP0A 1X33A 4Q4V1 5LRRA 3UKTA 4AF9A 1D0HA 5F3EA 3FBMA 4EYUA 1K45A 2R0HA 3VBOA 3OF1A 1AF9A 2VW2A 1PZ7A 4GB33 4YVWB 5FBZA 2XBO2 4BISA 3SH4A 2XLAA 4LOSA 4EQVA 3ZYFA 1ZZCA 3HR9A 4Q8LA 3CZJA 1ND2C 5J1XA 4JGYB 1SCSA 1PM7A 4OUEA 1W3VA 3MHZA 4ZY9A 2XR4A 4EWDA 5KR7A 2Y8KA 2K0GA 2VY0A 1VALA 4XQ4A 2EIDA 1JH5A 1UYYA 5FZGA 3MI8A 4A7ZA 5C5UA 4EJRA 3HNYM 1NCRA 3IAPA 5D2AA 4BIFA 1URXA 4AEMA 1RIRA 2XUEA 4X6QB 4DRVA 1LGNA 4CDWA 5HPOA 1SBFA 3UGHA 1YNAA 4DZGA 2PHXA 3MV11 1YHFA 3ZOIA 3VHPA 4LK6A 2XKOA 4MXWA 1C8M2 4IEWA 1AXKA 2DCTA 2VZVA 3POBA 1ZRIA 3B7MA 1V00A 5LCWL 1RHI1 2ZGOA 4A3XA 1O8PA 4SBVA 4AQ6A 4XJ9A 2IXCA 2OW4A 3GBGA 3N9NA 3PVBB 3RZHA 2WUHA 5ACA2 1D4M2 2OZ6A 4Y26A 3WQ1A 2EXJA 5JDBA 1JTZX 1LOFA 3D0JA 4PLNA 1LB2A 1AZDA 3IM0A 5C8CB 2BBAA 2Y38A 2CL2A 4FXGB 2K9ZA 4E2QA 4D69A 3SXWA 1Q5OA 4M01A 2D6KA 2VOTA 1UKGA 2DTYA 5AC91 3VBOC 3OSDA 1IOAA 3KZ4C 1W6OA 3H3LA 3M1HA 5FYMA 2DTWA 1HRV3 4LKFA 1MR5A 3P3NA 4YW7A 1F5FA 4YVWA 1GZWB 3ZYRA 3A22A 1WCKA 1RVF2 3W59A 2IVIB 1YJKA 3C2UA 2PFWA 3U07A 3UETA 2FDIA 4GWNA 1RUJ3 1F2NA 4RQPA 1NCRC 1MEC1 1TMF1 3ZVXA 3R4SA 4CCOA 1R1A2 2JD4A 3BPSA 5D21A 1IZ3A 4COWA 2Q5TA 3WP6A 2VNOA 3E97A 3NNMA 4N90A 4LNVA 1V6JA 2D3PA 4JTOA 4I3GA 4CDWC 2YFUA 3NNGA 4NVPA 2EIBA 1SDWA 1KDKA 4MYEA 1V0AA 3SEEA 1RGSA 2DWRA 5FJKA 1YQ6A 2ZAHA 5A3UA 1VRH2 1VBA1 4W6YA 3ZMOA 1W03A 2LW8A 1JXNA 4LOTA 4ES9A 2YBKA 3SCHA 2R0FA 4CYDA 1O59A 1YI9A 1ZZ9A 5FRAA 4F7ZA 3B94A 1BKZA 1DYOA 4E4ZA 5I91A 2D3SA 4PQ9A 4NN0A 1LOFC 4MV2A 3ASIA 3LIHA 3NV3A 1SBEA 4PI2A 4GJZA 5KXCA 2WFF2 1GNYA 5A1FA 4TTGA 1V70A 1GZ9A 1NT0A 1HJFA 1PGW2 4LLFA 1NYWA 2WQ4A 5C8CA 4CP9A 5F3IA 4QDSA 1J83A 4E4SA 2G9ZA 3GBFA 4H2AA 4BPZA 1DG6A 2HWE3 1M4WA 1ENSA 3JBG3 1UU5A 3IPVB 2ZHNA 2VQ0A 4YVWC 1FOD2 4GWIA 4URAA 2CTVA 3BTXA 5FQ0B 3ZXGA 4CP1A 3WINE 3WVJA 4HANA 1ONAA 3A7QA 2YC0A 5I0TA 3Q8FA 4LEJA 3VDDA 3SCFA 4RQPC 5JSPA 1EV13 2ET1A 1GZWA 4NOTA 1JOPA 5LK7B 2R49A 3BN6A 3CHXA 4AWDA 1C8NA 2PLV1 1W8UA 2ZEZA 5CADA 4CUAA 1MPXA 5FYTA 3C7OA 4P9YA 2BZDA 2UYBA 4XJ8A 1EAH2 1QXRA 1WA6X 2ZGNA 2JDYA 3NVCA 4IEYA 3W58A 4C1WA 3V0BB 4Q1RA 4JKKA 1OQDA 1QJU2 2RJKA 3CDZB 3WOGA 2FDKA 4GJYA 1Q3EA 5CFCB 5LEKA 4E9KA 3AMNA 4QQLA 3H42B 1LOCA 4IGQA 4P9LA 4Q8KA 1COV1 5BUVA 3WDXA 4F3JA 1AYN3 1BK1A 3H7YA 4KWJA 3KF3A 2X5IB 5FXWA 1ZBA3 3WSOA 4FAGA 1GKBA 1IG0A 3AFGA 2BQPA 1HV1A 4A42A 2WQZC 2WYSA 2ZABA 3TEZA 1HV0A 2ES3A 3U0ZA 3DEMA 4MLOA 5C8CC 3M3IA 4MSVA 4YVSA 3HQXA 5LA2A 2VH9A 4HK9A 4Q5OA 1TE1B 1W6NB 2D98A 2EXHA 4HKWA 2AUYA 4FFGA 1XRUA 3ACHA 4MH0E 2E9QA 1QH7A 2VNVA 1LULA 2X10A 3IN9A 4ZU7A 1HRI2 2UY9A 1W9FA 3IPVA 1IKQA 3LZZA 4QHBA 2KD7A 3HAGA 3MF6A 5FZFA 2Q8EA 3VDDC 4D6QA 4E2SA 4UAPA 2B46X 1AL22 2CAVA 5F39A 2EAAA 2VGDA 3BTZA 2PQQA 2R071 2C0ZA 1GP6A 3Q8BA 2W94A 1XB9A 3OY8B 1NA1B 3THCA 1QQP3 1JYCA 4YZ5A 3GM8A 5BNNB 1N1SA 2MEV3 2ZA9A 2XQXA 2V5YA 3VBSA 1MS5A 2J1VA 2JJ6A 2QBXA 2XG3A 4FPKA 1IS6A 3DGTA 3I4IA 3ROUA 2AC1A 2YU2A 2CYFA 4YM3A 5GZFA 3SITA 1XSRA 2FMYA 2Q4SA 3AP9A 4RHV1 4DEVA 5JR7B 2XJTA 2VCMA 4XUQA 5DMYA 4GULA 4XXAA 2Q8OA 1F8VA 1R081 3V0BA 3MYXA 5FY7A 1S0EA 1DQ5A 3EMRA 5IATA 3ZFGA 2JX9A 1Z0HA 4UBHA 3VZMA 1PGL1 2XHKA 1FATA 2ZX4A 4CUGA 5CFCA 4M3CA 5CFDA 1OA4A 4XQWA 3EHKA 1QJX1 2RDQA 4Q29A 1GZTA 1YYNA 5IFTA 4H55A 4YVSC 3I2DA 1DLCA 3ST7A 1EPZA 4DXZA 1QOOA 2C9KA 4I2OA 2GNDA 5C9AA 4UW4A 2ERFA 3B3QE 4N43A 1DCSA 1OLQA 5FY5A 5IT6A 4XF4A 5EWSA 3ZXEA 4AHZA 1VRBA 2WZ8A 2XMLA 4LBOA 2VQTA 3POGA 2VTXA 4S2DA 1AR72 1BLZA 2KA3A 2WS93 4JAAA 5FR3A 3FC0A 3MW2A 1WLDA 1F4HA 1BEV3 4XEZA 5L9BA 1RUD2 1WA4A 1ZVFA 1UY1A 2WT2A 1CPNA 3R0RA 3IBMA 5CVRA 5BNOA 3KT1A 3FE5A 3BU0A 4K1YA 3O1UA 2DVFA 3WW2A 1HQWA 1XYNA 1JUIA 1VBE3 2K2SA 4O65A 1V9U3 2PN5A 3IAQA 2AENA 2WBKA 1REEA 3W21A 4UFKA 2OQ7A 2P2KA 1J3PA 1TME1 2B9UA 1AJKA 2RE9A 3H7JA 4I0WB 2VMGA 2KM2A 2V4VA 4QKFA 4D94A 5BNNA 3H8XA 1JYTA 1G9DA 2VMEA 3ZFFB 5JI9A 4JHTA 3S5AA 1LOBA 1SPPB 5FZ6A 3CMGA 4K1ZA 1UYPA 3GJBA 1Q8PA 5LW9A 4TWTA 4RS5B 4G9SB 3ZFGC 1DGRN 4DMIA 3CJXA 3FZ3A 1O5LA 1PO22 4LHNA 5G05L 5CFCC 2JB4A 5CFDC 2QQVA 3IIIA 2VBPA 4BQXA 5B2GB 4G4FA 4QDRA 2DVBA 5KHHA 1ULPA 3VKFC 4YZ1A 5DUXA 3VLBB 1DBNA 4GAZA 3LB9A 2JIJA 2TNFA 1PO13 1VBC3 2DF7A 1RUE3 3RZJA 2B42B 4HONA 5KC5A 4UFLA 1ND3A 4FPFA 1UNBA 1I6XA 1QJFA 4FPLA 2QQUA 5FIXA 5C9AC 3FHAA 4N43C 5IVVA 1HXS1 2AGSA 2Y6FA 3TNQA 4JQTA 4GMP3 5FLIA 1O91A 5JPNB 5I0DA 4UBGA 1WD3A 2DU1A 3PNAA 3S5QA 3WY6A 1OUXA 4EN7B 5FLJA 1W9TA 4BIOA 2ILMA 5FZMA 1X9TA 5C3RA 2W0XA 2DBIA 1UW8A 4XMAA 5BNOC 4XF0A 4J25A 2ZX2A 1VB4A 4ZS2A 5LBEA 3G6JB 3RZLA 3FWEA 4OHZA 1NOVA 5FZCA 1PVC2 2Y0OA 2XB6C 3LEGA 1U5XA 1NA1C 1DU3D 1FPN2 3AL6A 5BNNC 4R9AA 1UZWA 3BB6A 2NLRA 1OHFA 4GD4A 1XNDA 2IWGB 3KHCA 1C3HA 3R05A 3WF4A 1Q8VA 1RITA 2YC2A 3B9CA 3QH6A 4GXLA 4QB6A 1QJZA 5FKCA 1GR3A 4B4PA 3BGAA 1AR61 1R092 2ZEYA 3ZFFA 1KJRA 4FI9A 3VBFB 1C8M3 2RVAA 1F4AA 2ARBA 2CNAA 3PVNA 5CEHA 3W5NA 2EF6A 3KT4A 2VMDA 1FV2A 4DO0A 4AGRA 1H2KA 1I3HA 4NHYA 2VXRA 2YBPA 1BYHA 1ND3C 3ZX7A 5HCAA 1NG0A 1D4M3 2HWD2 4QKNA 2WZR1 2HWF2 3JZVA 3NW4A 2H0BA 3PL0A 4L99A 3O0VA 5HXVA 4XCBA 4IV3A 5B4XA 4LIUA 1O3SA 4A6SA 5J37A 3H3ZA 4N53A 5APAA 1BK0A 1FYUA 4LBKA 5EPAA 4A44A 1U5IA 2Q30A 4AFDA 4DB5A 3WP3A 4XDQA 3ZKUA 1W9YA 1XBFA 1C1LA 4ES8A 2W3JA 1BBT1 1C57A 1RMU1 5CKMA 4OI1A 2BTVC 5EP9A 2F4PA 1DGLA 1DZQA 1RVF3 1Y4WA 3WG2A 3PTRB 5EIYB 1RUF2 2P3KA 3D6EA 3NV4A 5J98B 3AMMA 2RMU2 2HWB1 2XLFA 5E8AA 4NIDA 1VBD1 4BK5A 1R1A3 3ENRA 1YWKA 4LBLA 1C5HA 1SACA 1OF4A 3ALQA 5A33A 3P3PA 1IHMA 4UF0A 4CA9A 3ZFEB 3FLRA 4UFMA 3ZFFC 2WFPA 4AQTA 4ZKTB 1F15A 2Q1MA 1K3IA 2RR11 3WNNA 3VHRA 5IVBA 2EAKA 1VRH3 2BGCA 2YV8A 3I97A 3WCRA 1PMJX 4Q4W3 3SLIA 4PBPA 5A3NA 3VDBA 1NCQA 1UCXA 2P3YA 2OUJA 3KMHA 5DUVA 1NQDA 3JUUA 4AEJA 2PHDA 5JXHA 2VR4A 5DDJ2 3K4DA 3PURA 2OZJA 2HWC2 4R9DA 1J1TA 4ZU4A 1QU0A 2WFF3 4HN1A 4AEDB 3KS7A 1DGWA 3P1IA 1IG3A 3PUHA 4KU7A 4LQRA 2C5DA 4I0AA 4CTEA 4IV3C 1Y43B 3WG4A 5AFEA 2VMFA 4P5HA 3ZM8A 3T2OA 2QCSB 4N53C 4OYUA 2CAUA 5T52A 3O5SA 1OSGA 3WD5A 4XZUG 5FUIA 3AKPA 1FOD3 1J3RA 2AR6A 3GJAA 1POV1 3OPZA 2AZ5A 4Q4V2 2D44A 3ZN6B 3E5XA 3H9AA 5KHGA 3VDCA 5BXXA 1NZIA 1Y3TA 1RXGA 3CJIB 4XFAA 3WZ1A 3PMEA 2WN2A 3SH3A 3ZYHA 2EICA 1GFF2 1W0OA 2FZ1A 2XGXA 2ZKNA 4IL7A 4L9BA 4NPRA 5JMOA 1LESA 5DN2A 3K2OA 3ZXAC 2ZMLA 3IWZA 1OQ1A 1W2TA 3AMQA 2OYZA 4BQYA 2JDAA 4J1XA 1EY2A 4GKXA 5IK4A 3WW3A 4RL7A 3ZPOA 5A3TA 1EAH3 5FLHA 2PA7A 4C8DA 2D7FA 2XONA 1WCSA 5F5AA 4CRQA 4QQHA 1ZBE3 2MPFA 4EWEA 3RMYA 1MVEA 4D3WA 1OMIA 1D0GA 2QVSB 4XE9A 4W65A 1NCQC 2WLQA 3U4XA 3HWJA 1BJQA 1AYM2 5FZHA 5A32B 3IDCB 2W39A 3EO6A 4IXLA 2K46A 1ZRDA 2VXJA 5BPXA 2JG9A 3PUSA 4LXLA 5J09A 2ZMKA 3C7HA 2I07B 1RHI2 1IS3A 4QX0A 4NRMA 4RN5A 4AI2A 1RYYA 5CB7A 5J7MA 5JZGB 2VVEA 2WZEA 4NE9A 1CQ9A 3DECA 2W1SA 5EYYA 4XCAA 1WMXA 1YXWA 1CAVB 2R043 1JZ3A 3P5BA 2H0VA 1XXNA 2YDEA 4B3NA 4P5YA 5AC92 4LULA 1AL0G 1CVNA 2I45A 1AL23 2QFEA 3GZEA 3LF7A 3WP5A 4OHWA 4N9HA 2XPJA 3OD4A 1S0GA 2IFRA 4K40A 1W05A 4CSWA 4WM8B 4YM0A 4M4RA 4MVTA 1Y9MA 5DAXA 1UMHA 3OOXA 1JOBA 3WF3A 4P9IA 4X6RB 2C6SA 3WT3A 2DCJA 2P37A 3QD6A 5C4WA 3FFQA 3V65A 2BFUS 3O1OA 1MEC2 1TMF2 5JMCA 3ILNA 4XW3A 4YGBA 5FZEA 2GNTA 3RPQA 1O8SA 2VBBA 2YY1A 3HN3A 1ASJ1 3T08A 4Z82A 1WW7A 4IEVA 3PMSA 3KB5A 5A7WA 2Q1FA 5FKBA 2O8OA 5KBFA 1BVVA 1R091 1TVGA 2RM21 1XPWA 4Q0SA 4Y22B 5FPZA 1JZ7A 3DYOA 2ZHLA 4AFCA 1W6QB 1EYBA 4IEQA 1VBA2 3TN91 4BK4A 2E53A 3MIHA 2XWBB 3ELNA 3ZXLA 3RYRA 1HIXA 1UIKA 3MIBA 4ZHNA 2VUCA 2VZTA 2VZ1A 4S2HA 4GB31 1BZWA 4ASMB 2VUAA 4QKDA 5EV7A 1RJ7A 3ZSLA 4B4RA 1VIWB 1MS1A 3C7GA 3MUY1 3C3VA 4NAOA 4LO7A 3RRDA 1WLTA 1QJEA 1OPMA 2C9AA 2R1DA 4QMAA 3QOPA 2EIGA 1GBGA 2EALA 4LORA 1NQJA 2IFWA 1CAVA 3T2PA 3GDBA 3I2GA 4Z92B 5IVCA 3AXDA 5F32A 5T5OA 4XFFA 3SNMA 2RS11 2PHWA 1SMVA 2ARAA 3NMBA 2P4EA 2VU9A 3U78A 5C71A 4P9XA 2DVDA 3HQUA 4MO3M 3DKQA 4WBBA 2FCUA 4KBZA 3SISA 1QDCA 4DNYA 3DPRB 2BWAA 5EYXA 2TUNA 4CCMA 5HBAA 1PMIA 4PDWB 4KG0A 1W8OA 2IXLA 4FVVA 4NWVA 4XFGA 5A7QA 3BOPA 1OURA 2VW0A 4U36A 1UAIA 4HSJA 4TLFA 1XNAA 3W5MA 4B7EA 3O1MA 1SFPA 4BLIA 2PLV2 3LGRA 4QB2A 1W04A 4Y20B 3I2KA 3PJYA 1CR7A 4JVAA 1NE6A 1PO23 2CWMA 4YGDA 1NAEA 1S1AA 4JGZB 5H9QA 2OKXA 1UF2C 2A6XA 5FMBA 1CIYA 1AX0A 4IESA 1ULDA 3PU8A 2WT0A 4P00B 3J8F3 1EPWA 1UU4A 1YEWA 2WLPA 2WO2A 2WINB 4QQ2A 2V5DA 1BMV1 3LSEA 3INAA 4YW1A 2QKDA 1COV2 1V6NA 4CCNA 2JDZA 3AP6A 2ZGMA 5GZCA 1GSLA 2ZGTA 3FHIB 3SMHA 3BCWA 2IZWA 1WCQA 4BU2A 5FPLA 3RMXA 2BFUL 5FZ8A 4ATFA 1FI2A 2PMWB 4Z07A 4AHWA 1UY4A 2AACA 1A34A 3BTAA 1ZZ6A 1NLRA 4JDNA 4MGIE 5GLWA 2A6VA 1F5JA 4CCLA 5DZFA 2GNMA 3TRSB 1V6MA 4TLGA 3SHRA 3PIGA 3KHBA 4XMIA 4EN9B 2DUQA 4KG8A 1MS8A 4IGOA 3MZHA 1PM4A 1POQA 4WM8C 3WNLA 2J1EA 1KJLA 2IXJA 2ZAAA 4JV4A 2VULA 1GU3A 4PF1A 2UWAA 5L7OB 1CONA 5ISLA 4OMDA 2R072 4AK3A 1LJ7A 5FY1A 3H0OA 1G9BA 1XYPA 2PXJA 3ETPA 4K8FA 4LKEA 3TEXA 3LQCA 4AI1A 4MG2A 3MLJA 1HJGA 1HQNA 4ONUA 2NP0A 2A6YA 4Y5Z0 3HQRA 3VZJA 2ZGUA 1UZVA 2QQMA 3E5QA 1I1EA 1OC1A 1JYNA 1YQ2A 5FP9A 3AZXA 4Y5TA 1VBB3 3UGGA 4IEXA 4DINB 3ZIXA 1O4YA 2JWPA 3J7NA 3NRUA 1Q56A 3CU7A 2OPWA 3IMMA 4RHV2 2WNUB 2DCKA 1WMFA 2VZOA 3AC0A 4CCKA 2DU0A 1R082 2W91A 1PK6A 2Z5WA 1DQ6A 2HWF3 3EYPA 4ZXEA 1AYM1 4FFHA 1PGL2 1XNKA 1X50A 3GF6A 3KCYA 4IW3A 3OGVA 1ENXA 1QJX2 3ZYPA 1YLLA 2NM1A 4C1XA 3MBWA 4Y1UA 2EXIA 2RS53 3CL1A 5LY2A 1UOJA 2VOKA 4H7MA 5FO7B 2XHNA 3AB0A 3AYEA 5FYIA 4XIOA 4MOAA 1TG7A 1HLCA 4XBLA 4XFBA 4YW3A 3H8UA 1EV11 5FZBA 5FYUA 1RUF3 4AI9A 4AVAA 3HOBA 2VVDA 3A0KA 4LO6B 4R9CA 3L9JT 2Q8DA 2W9XA 3JD73 4P9JA 2QZ3A 2VUJA 1UZZA 4DRRA 4QPYA 1KITA 4EZHA 5JIAA 1QHDA 4CEYA 2B39A 3OGSA 5JAXA 2WNVB 3RWNA 4LHLA 1SLCA 1QOTA 3HD8B 1OKQA 4L11A 3S6PA 5A3MA 2SBAA 2VOWA 2QQOA 1PVXA 3AJYA 4ZS3A 4XJUA 2PELA 1Q8SA 3M70A 2PHLA 4PT6A 4JQRA 2GALA 2GZWA 1TME2 2VCAA 2WN3A 1SLAA 1CWPA 2W52A 1JYWA 4JGYA 5HCHA 4KQ7A 4D7YA 1X36A 4JGZC 1XNTA 3ORJA 4GALA 1H6YA 1ZBA1 1ZA7A 2WR9A 4FPEA 1PK6C 2DV9A 2ADEA 1RUC3 2VM9A 4AQSA 2R30A 2W68A 1HN1A 4B4QA 3R4UA 4U2AA 1KD7A 3DXUA 1RC6A 3VHOA 4AI3A 3MF9A 1V6LA 4XF1A 1S4CA 2O1QA 3PUQA 3OBAA 1OLMA 1W28A 4L92A 5EZWA 3NNJA 1DQ2A 2JKXA 2WIIB 2JKBA 4LTAA 1S2BA 3VL8A 3ABZA 1GWMA 1VMFA 2IC1A 1G9FA 1KS5A 1SFNA 3NO8A 1HXS2 3CIHA 3ES1A 3J9SA 1LU1A 2VW1A 2XJVA 4PI0A 4GMP0 4LUKA 1KXGA 1RJ8A 1QQP1 2LTNA 4XTPA 3UV9A 3ZR6A 1SLTA 2QQKA 4NRQA 5IK5A 1TNRA 4GKYA 1AJOA 4FQZA 4BXFA 1OA3A 3MLLA 1MZ6A 4CP0A 4CEYC 2VCCA 3LD8A 3A4UA 4LBQB 1W9SA 2B45X 5FFOC 2B4KA 3VZNA 4YFZA 4LBJA 5GZGA 5IVJA 3VD4A 4HKLA 4LT5A 1OFSA 2W47A 3KT7A 4KWKA 1CJDA 5L7OC 4UW5A 3MV01 3KWVA 1JHJA 1YO8A 1DQ4A 3OTFA 4FP2A 2YBSA 5A70A 3I3QA 1OH4A 4JGYC 1LAJA 2VQUA 5FZLA 1BQPA 1UMIA 3I2HA 5DXDA 5T3NA 2JENA 2XJSA 3POWA 3GBWA 3SEPA 1H2NA 1UY2A 1XNCA 3NJXA 3ACIA 4XUNA 1T6BX 1GOHA 4IE6A 1AR62 2QNKA 1RL3A 2A71A 1AXYA 1F9KA 1OPOA 3O1VA 3POIA 2ZZQA 3D0SA 2OT7A 1HQLA 3MW3A 5FP3A 3VD5A 4CZSA 3MICA 2RS31 2QQPA 5FY0A 3ZR5A 3GNEA 3AKQA 3RS6A 1N1YA 1SLLA 4QT6A 4AVVA 4XURA 1UY0A 1DF0A 2E6VA 2VE1A 2WS91 4NHKA 4W6WA 4A41A 1NX9A 1CAUB 2WZR2 5A7SA 5K4LA 1LU2A 4YM1A 4L97A 4CXXA 2IUWA 3TYJA 1O3TA 1LEMA 4NRPA 4CDQB 4K8RB 1ZYBA 5FUNA 3AZYA 1V9U1 1FMD3 2WDBA 2A3YA 1UKRA 2QQIA 3PUIA 4YARA 4HBNA 4QM8A 2P6HA 1JZ8A 1BBT2 1DIWA 1LGCA 3OBTA 4XFHA 3ZKYA 2P1BA 1RMU2 2D5HA 1JMUB 4B1LA 3C8XA 1K42A 1UZYA 1YIFA 4FPGA 3VZOA 2Y6KA 1G8WA 3E6DA 2HWB2 3BYWA 3HEIA 4FTBA 1TMF3 5CAZA 5FMOS 1VBD2 3M4FA 2XVGA 5FREA 1DZTA 1GNZA 3F95A 2YYOA 5FQ0A 4HOOA 5IK8A 1XJAA 4M0NA 4MXVA 4ARXA 3O7OA 5KXEA 2YPJA 3WHUA 2JDMA 2R16A 3K48A 1VBC1 3AJZA 1J3QA 1OD5A 1OVSA 5JXJA 2L9LA 3KLSA 2RR12 1YFUA 2ZBJA 3AP4A 3ZN4A 1VBA3 3AKSA 3E6BA 2B7YA 5G04L 2KXLA 4XFCA 4ITCA 2J1UA 4CCEA 4AGGA 3M3QA 5FTTC 1K5MB 1UYXA 2TEPA 2ZPXA 5BNPB 2ID4A 2YUEA 2WAAA 1S0BA 2N7GA 1RUNA 2R7EB 3WG3A 1Z7S3 1KQRA 4DY3A 3LDRA 4FOYA 3I3DA 5J3UA 4UW6A 1CAUA 4CEWB 4CPBA 1IQDC 1SDDB 1ULFA 3RJRA 1VJ2A 1WGPA 2I74A 3WUCA 3ZSMA 3QACA 5DZGA 2X5IA 4XAEA 4LO8A 4V2VA 2D6PA 1LOGA 4HL0A 4JCKA 1GOFA 2Z4FA 3OUHA 4IE0A 4DUXA 5I0SA 4I30A 4I3PA 1HB4A 5FZAA 1JZ4A 1W6NA 2B9VA 1WKYA 4QX1A 5CNAA 2ZMNA 3UJQA 1GYKA 4FQ4A 3Q8AA 5DAVA 5KWRA 2PLV3 1WW5A 3CQOA 4QQOA 5FYSA 1E57A 3MIDA 4IV1B 2WQ8A 1PIV2 3LCPA 3WF1A 1RINA 4D7SA 1OKOA 4FSJA 4OVEA 2NMOA 3GGLA 3OY8A 1NA1A 2WWUA 3RZZA 2VC9A 4WV8A 5FZOB 3D82A 1PX3A 4AAPA 3HBZA 3WDUA 5H9PA 2GNBA 5FO9B 5IVEA 5HV4A 1MACA 3WF0A 1LGBA 1CZTA 1KDMA 2VMHA 3THPA 1OOPB 3NSTA 1V6OA 4QGNA 5D8AB 3WEZA 4ISRA 4NHXA 1QWRA 2XVLA 3AVRA 5F5CA 5FYVA 3AVSA 2D43A 4PHZA 5AVAA 2LM3A 2VOVA 3D3AA 4CP2A 1K5MA 2QTWB 3GYDA 1RUH1 3WCSA 4FP3A 3GZUC 3MLKA 4LBNA 2ZACA 3BVCA 5BNPA 4UFHA 5FZ7A 3VBUB 2BGPA 4D0QA 2X5IC 3FFZA 4RFT0 3ILFA 4OCTA 4OMCA 4K6BA 4UI9L 3U1XA 4BHPA 1CAXB 4YZ3A 3WW4A 4N7UA 1AR93 1PNFA 3K3NA 3I54A 2ZHKA 5J36A 4IGPA 4K3UA 2HJIA 1W3XA 2VG9A 1US2A 2QDNA 3J7MA 4Q26A 1FNZA 2XBO3 4UYBA 3X29B 4E8DA 2D3RA 5GLTA 1YI7A 2Z69A 4Q4Y1 4XYXA 3T2QA 2VZPA 3LA2A 3OBRA 3WW1A 1IPJA 3C7FA 2GDFA 3Q9OA 1S0JA 4BLJA 1MZEA 1S2KA 2RDNA 4LKSA 3VBHB 3ZSJA 3OCPA 2GAUA 3ZYJB 1NE4A 5FZ3A 2JXAA 4IV1A 3GHNA 2JEMA 4A2UA 5IK7A 2Y6HA 5CYYA 1QNYA 1QMJA 2BNOA 3AL5A 2QQJA 2GP5A 2FZ2A 1ASJ2 4HZFA 2VZSA 5C3QA 2VJXA 3OYWB 3NJVA 1LR5A 1GNHA 1RTVA 1YUDA 5FP8A 1UX6A 2P6CA 4Y33A 3V56A 4R4ZA 2RM22 1PZ8A 5JI7A 2XKPA 5FP4A 2PHTA 3RJ2X 2LS6A 1QJX3 4WZFA 1SPPA 4AFAA 3M3OA 3N9OA 3R6SA 2ZCWA 1K5MC 1ENQA 3IDAA 4XJWA 5KHIA 3TN92 5BNPC 4RS5A 3MFCA 4IERA 4XUOA 1CGPA 3PUAA 4KWUA 5F6LB 3NKGA 2X09A 1NXMA 1X8EA 3ETQA 1IPKA 5ACA3 3MIGA 4QX7A 1UN1A 4GB32 1GWLA 4MADA 5F3GA 5J96B 4HVQA 4J6GA 4CCDA 4NIGA 1UXZA 2ZJCA 2LUWA 3PVOA 4MGYE 4I0BA 3K77A 2ZGLA 3MPBA 4INDA 4WM7B 1JYIA 2PYTA 5HV0A 3POYA 2RS12 3RSJA 1ZBE1 1OT5A 2TBVA 2OUHA 4KL1A 2YPDA 3U4SA 3VKMA 5FWJA 3G7DA 4CU6A 2G19A 3AYDA 3DV8A 3FHQA 3GCXA 4WVMB 1STMA 1TME3 2OA2A 2X53S 3JU9A 3LFIA 2GH2A 1AR81 3OEBA 4IV1C 1OLRA 4J1WA 1W8NA 2GSYA 3T4HB 5C7GA 3PDQA 1ZNPA 4HMZA 5C70A 2W08A 1ACCA 3JCIA 1K12A 1JZ6A 1UO9A 4LO5B 5A6YA 3OGGA 3ITQA 4NPLA 1SBDA 2P34A 4RR3B 4QPGB 4EWAA 3OEAA 4RFRB 5KXBA 5DPNA 4Q4X1 3TEWA 3N9MA 1ULOA 1AVBA 3VZKA 3LEIA 4DUVA 3KVAA 4A7KA 2DUPA 5EQUA 4RS5C 1S55A 5FZ9A 4CDXB 1SQ4A 2O0OA 4Y4RA 4CU7A 4QXBA 4RYDA 4Q2FA 2R041 3VBFA 4H3WA 5K9YA 4QXKA 4QGMA 1A6CA 1GP5A 4Y5SA 2A75A 2EXKA 1UPIA 1HXS3 5A3OA 1I9RA 5CZKA 2WA3A 1OD3A 3N3HA 3ZN5A 2R1BA 3LE0A 3WR0A 4ET7A 1XYOA 4M3CF 4FPOB 4OZOA 4RSUA 3B5LB 3NAPB 4Q0QA 1GANA 3V0AB 3H8OA 1H30A 1Y9GA 3CKHA 4H14A 4P02B 2GMMA 1NKGA 2UU8A 5FZ4A 1JYXA 4QX2A 2RJ2A 1LEDA 1BXHA 1GV9A 2VNRA 3DL3A 3U75A 2VTFA 4EV0A 3PIJA 2RDSA 2QZ2A 1QKQA 4FFIA 4HKOA 2RDRA 4O9GA 4QAWA 2GU9A 1O6UA 4JKLA 3LPFA 5ANNA 4CU9A 1X7NA 1JS9A 3BTYA 2Z42A 3S7EA 1W39A 5A1AA 2FHRA 3WNXA 1DDLA 1IPSA 4LIVA 3B9IA 2PAMA 5IVYA 3RYKA 1Q8QA 2G9GA 2W1WA 1RUI1 2VMCA 5F5QA 2WYFA 4BQ2A 1LCLA 2BGOA 3ZPYA 3THDA 2WRAA 4NHLA 1AR63 1RUG1 4UOJA 4Y24A 5C3OA 1C5IA 2GH8A 3O14A 1PIV1 2JE9A 5FXZA 1LOEA 2Q0AA 4Z2WA 1VMJA 2DFBA 2E31A 4XHBA 4ASLA 4C91A 1ODNA 5FYCA 3O1PA 1WBLA 4CUBA 1R1ZA 3LOBA 1QJU3 5E6HA 4C90A 5IW0A 3ZFEA 1DGRA 2VNGA 5C3SA 3EJKA 5FAXA 3VBFC 1LNSA 4B29A 3O1RA 3VBRB 2FDGA 1ZZ8A 4QX5A 5I0RA 1L7LA 4IUGA 3POFA 2J1AA 5FPAA 4QU2A 4LHSA 1HX6A 3KV6A 5CKQA 4CCJA 3T0AA 3S57A 2YU1A 3FBYA 2E33A 3MFAA 1U5ZA 2MNGA 3CNAA 1OLME 1K5JA 2CGNA 4GZ9A 1N3PA 4Y4YA 2DYCA 3BIWE 4LUMA 5F3CA 3VB9A 3ON7A 4FPCA 1W6PB 1IQAA 4Y1ZA 4AEDA 1QJY1 1ZZ7A 4DXSA 1BBT3 1US3A 5EJZB 5H9RA 1RMU3 3UGFA 3KV5A 4W6XA 1W6MB 1J59A 1CX1A 2VMIA 1S2EA 1LECA 1EV12 1XSQA 3EQEA 3GXUA 3HNBM 4YPJA 4DXTA 4Q0UA 3I59B 3A21A 3LIGA 5T5JA 3T2TA 4BJ0A 1CJPA 1HRI3 3HJRA 2PTMA 1VBD3 1VE0A 1HW5A 3RI8A 2VOXA 4AVBA 2DDUA 5DZEA 2QJVA 4G3YC 2BU9A 4A45A 2R061 2CU5A 3AKTA 3ZN6A 5B4NA 4LHKA 4HN0A 3CJIA 4IE5A 3IZOA 3KM5A 2ZGQA 4PIYA 2DFCA 3J4UH 4N8MA 2LALA 3T0DA 5FPBA 3ZXDA 2D6OX 5DABA 5T54A 5KC6A 3J8F1 2UY8A 2Y6JA 4FPHA 4PCRA 4YM2A 5T5PA 2WZPP 3UJOA 3AYCA 1I5ZA 1Q43A 2J42A 5DAWA 4GQ7A 4OQ8A 2A73B 1ZREA 3ZFEC 1ZBA2 3DF0A 3K3OA 3J7LA 4D7TA 1YQ5A 3APBA 2ORXA 2WO7A 3NKTA 4CDXC 1SG3A 1XU2A 3ZXJA 1WCDJ 4E27A 3ZDVA 4WVVA 2XOMA 4BQ4A 3DUIA 3CF6E 3TB0A 3I8TA 4CCCA 1C1FA 5A32A 4TN7A 2A5ZA 4COVA 1UOBA 4AEDC 3HBKA 3CO2A 3HNMA 1POV3 5F1RA 4IEZA 4JDMA 5GZDA 4XF9A 4YG6A 1YCIA 2RG4A 1AR73 1OQEA 5F9TA 3VKOA 4Q1PA 4E4DX 2X8KA 1E5RA 1QQP2 4ASKA 5JZGA 1UZ0A 4OZXA 2ATFA 4WVWA 2ZXQA 1RUD3 4NJ4A 2MEV2 4FXKB 1HDKA 3AMPA 4QHOA 1EUTA 4P14A 3H3UA 4YG0A 2GP3A 1H6XA 3CJIC 4EN6B 5DUWA 1OH3A 1ZA4A 4XXPA 4BQ5A 1UPSA 5F2SA 2ZGKA 4XBQA 1CPMA 2CGPA 5SV5A 4WM8A 2RHPA 5CIRA 3BIEA 3D4KA 3RDIA 4FPYA 4KGGA 4OULA 4LE3A 4MGKE 1O5UA 1HB3A 5FZKA 3TNPB 1DZRA 5EJ3A 4GIQA 4UW3A 2PAKA 5IYYA 4Z2AA 1W99A 2RS51 2OPKA 4A3ZA 4F8AA 4XVHA 5GLZA 4PBOA 1TEIA 4FOQA 2XWJB 2ZOEB 4L0PA 4ZPIA 3WQ7A 2CGOA 2RS32 4K21A 1OFNA 4HK8A 4COUA 4IE7A 5JOYA 4XHXA 2E51A 3D8CA 1AXZA 3M7AA 3VKLA 1ZX5A 4PIXA 4Y22A 1GP4A 5ABJB 3LKJA 5FJHA 2X29A 3K4AA 1OF3A 2EVXA 1QOSA 2JIGA 2D40A 2BVVA 2WS92 3K51A 4NO4A 3VZLA 3JD71 5L19A 1W6QA 1BEV2 2J1RA 3IMNA 3J7HA 5FY4A 1N3QA 4LPLA 1X9PA 4NIAA 1ZRFA 2GC1A 1GWKA 5FPVA 2NPIA 2FDJA 4UT5A 5FUPA 4Z1VA 2WT1A 4HVOA 3OG2A 4EE2A 5JZGC 1HRV1 1NCRB 3FLTA 1V9U2 2JDHA 2JB8A 3OB8A 3O12A 4PIZA 4HG6B 5CISA 2YC4A 2QQNA 2ZKLA 4QXHA 4KWLA 1E5SA 5GJ6A 1G86A 2E32A 4Y3OA 1VAMA 2ZEWA 5LRSA 1JU4A 2YGLA 4ZZ5A 1QDOA 4CDWB 3WDWA 2ETEA 4YNIA 2YROA 1RUJ1 3UT0A 3T1LA 1PVC3 5C3PA 2IVJA 1NLQA 1ULGA 4MXWB 3UL2A 4FTEA 3FLPA 1WMEA 3H1WA 1AX1A 3IDEA 5GLUA 4ARYA 1FPN3 4CUCA 4UWDA 1RUC1 3B01A 1WZXA 2F6BA 5C33A 3RZGA 3V64A 1ASJ3 1B35B 2ZGSA 3LEMA 3I3MA 5DG1A 4K9SA 3DPRA 3OGRA 3ZYBA 1V6KA 4E2GA 1AX2A 4KNCA 2VD7A 4KU8A 4PDWA 1R093 3URFA 1H4HA 2C1FA 3KCXA 2J1TA 3MO4A 1VBC2 5FP7A 5FK8A 3U14A 4COYA 4Z8BA 2LROA 2BP6A 1CN1A 3PU3A 5L36A 1MS9A 2W46A 3GALA 1CX4A 2QQWA 5LEJA 1H2MA 2JE8A 4Y20A 4YGEA 1UY3A 1UOFA 1W6OB 3ZMNA 2D93A 4JGZA 5T50A 5FOBB 5T5LA 3EBRA 1YFYA 3BOWA 3S0MA 4X8NA 1O4ZA 2HWD3 1IS5A 1A78A 4O61A 4JDOA 2ZX0A 2SLIA 4IDZA 4MZUA 3I2OA 4MGTA 4ZXKA 5ABJA 3NV2A 4BQ1A 4C0HA 1PMHX 2HWE1 4S2FA 4RQPB 3JBG1 1FX5A 1XOYA 3AX4A 4IEUA 2UWCA 1T2XA 3POSA 4LBMA 2UURA 3LDKA 2P5BA 4D6RA 2RS13 3GHMA 3CEWA 2XL7A 3OUJA 1N47A 1QGLA 1UMZA 3P6BA 3TBDA 1H8TB 1O4TA 2PHFA 4LR4A 4QB1A 2MHFA 2Y33A 1U0AA 1SLIA 3WNKA 2R6QA 2HBUA 1JYVA 4AE2A 5A3LA 2CDPA 4NR1A 2RMU3 3JB4C 3ZO0B 5JUVA 2VZRA 1MS0A 4BCUA 1SLBA 2XDVA 3M3EA 5IUQA 3HPNA 4QQPA 4TZDA 3N4MA 3DPRC 4AOCA 1WWYA 1X8MA 1W2OA 1ENRA 3I2FA 1W8TA 4PDWC 1LTEA 4QX3A 1JODA 2P3JA 5L7OA 1KFUL 5DAQA 1B35A 3B00A 2YFZA 5E88A 3TWIA 2XH6A 1EUUA 4ISQA 1CESA 2WKKA 3FX3A 3FN9A 4QD2A 4BMEA 4CP9B 1NXD1 1AYN1 1W8HA 3L2HA 5JIUA 2ORZA 5I8TA 3LWCA 4WVZA 5DDJ3 2ZX3A 5GZEA 4FTSA 1DHKB 2HWC3 2HLEA 5JXGA 4LBQD 1WBFA 1UWWA 1XQNA 1FMD1 2JG8B 4I09A 4D6SA 4XJZA 5HCBA 5ABJC 4O7XA 4R8HA 2WNUA 3T1MA 3VDDB 1OXCA 1RUH2 1DFQA 4I02A 5A7PA 4HFSA 3PLQA 2FCTA 5EJ1B 5J48A 3LAGA 3LFMA 3N9QA 4RGKA 3FUOA 2NMNA 3N35A 4WZCA 2G1MA 4H7LA 1QXPA 5AFBA 2XUMA 3IIAA 3RZMA 5FZDA 4Q4V3 2VZ3A 2D6LX 1MVQA 5FOJB 1XE0A 2BEOA 4ORFA 1H1MA 5FDBA 4LO4B 4FT8A 1UL9A 1GZCA 1ST8A 1VMHA 1OA2A 1H8TA 5DG2A 2YZ4A 4FOVA 1NY71 5GALA 3T4VA 2VUDA 3UESA 4FFFA 1NLSA 2MEV1 2NQYA 1S0CA 4Q4Y2 4DPNA 5LA0A 3D5OA 4LJHA 3KQRA 3N7KA 3RQ0A 4AVTA 3LPGA 4Q4W2 2JDPA 3HT2A 4CPBD 1B35C 1SZBA 2WNVA 3NL1A 1S0FA 4XDOA 1IGOA 2V4AA 1KRIA 1MZ5A 4YVSB 1Z78A 4OHXA 2D97A 4LLOA 4OI2A 4R52A 4KMQA 5L9VA 1Z7S1 3OPWA 1AYM3 5C6CA 1N1VA 2FCVA 1WUVA 2VECA 3RYPA 4FOWA 5C8WA 2DVAA 5GM0A 4HXCA 2WNUC 2JDNA 3M2MA 2YG0A 4TYSA 4YGCA 4BQ3A 2BJSA 2DVGA 2V72A 4PLMA 4XIKA 2JDUA 2GC0A 2JG8A 1M06G 1RHI3 5CA6A 2W95A 4YSFA 4IE4A 3KV9A 5LBFA 5A1LA 1H1AA 3JQWA 3K46A 4KGQA 5E89A 3KGZA 5I8SA 4GH4B 4AI0A 3T3YA 1BEV1 3O0XA 4NIIA 3WQBA 4QX8A 2J22A 1SEFA 2ADDA 2D5FA 2P3IA 4LKDA 3VBSB 5I93A 1QNWA 1JBCA 1XU1A 5FY8A 5AC93 3A23A 3FMGA 1ZM1A 4LITA 2CY6A 1VBE1 5EFUA 4NAMA 5ANQA 3GZAA 1H8TC 5FMCA 1S0DA 2DUOA 2FD8A 1G9AA 1W2UA 5HXMA 2E7TA 4HSLA 4BMBA 1ZBE2 1QF3A 4QDQA 5JOZA 4XZPA 3ZFGB 1A8MA 2CDOA 5A3PA 4YRDA 1R64A 2XXZA 4N9IA 4XAAA 4M3CB 1DLLA 5CFDB 3NV1A 4R4XA 5F7UA 2WNVC 5BV6A 1AR82 4LBQA 2BWCA 1ULEA 1MEC3 2A6WA 4NUBA 3ZYIB 1D2SA 5BYNA 1NUKA 4JC1A 3ME2A 4Y1YA 2GC3A 1BVP1 4JZRA 4CU8A 5FMDA 5C9AB 3ACFA 5BY5A 4AR2A 1YFXA 5ERLA 2CWSA 4N43B 4BOWA 2WAOA 1L3JA 4AG4A 2PHRA 2HYXA 1PO11 4HLTA 4Q4X2 1RUE1 5JOXA 1L7QA 1GMMA 3E1F1 4QXCA 5SV8A 2WA4A 4X8PA 4AYUA 2JG8C 3LA7A 1AR91 3NQHA 4LMFA 2VZUA 2R042 3KV4A 3S30A 3WQ0A 5BNOB 4GMP1 2YXSA 5L9RA 2W5FA 1H0BA 5D1IA 2D6MA 4B8EA 2BOJA 1LHUA 1JHNA 2PHUA 5A7NA 2XBO1 2YHJA 3IT8A 4LA2A 2Z2SB 2I2SA 2LRPA 1D4VB 5IFPA 2GC2A 1JW6A 3K75B 1GQPA 1OUSA 4N7IA 4NMIA 2YMZA 4GH4A 5DAPA 3WP4A 4NROA 4META 4XABA 1H9PA 4CVUA 4TSVA 3AMHA 1I5PA 4CXWA 2VL4A 5IJRA 4AZZA 1QXJA 4CDQA 3ACLA 4LA3A 4UFIA 5A7OA 5IWFA 2XQRA 1CZVA 1UU6A 3MPPG 5LA9A 5L73A 3ZXFA 5KHJA 3LA3A 2Y26A 1SFYA 3VHNA 3DYMA 4Y1VA 1UIJA 1RUI2 2XLGA 1FXZA 3KSCA 1ND3B 1W0NA 2AYHA 4IETA 5I8YA 1C8M1 3W20A 2A1XA 4QU1A 1RUG2 3BU7A 3RNSA 3VDAA 1LHNA 3VD7A 5IAXA 3POJA 3ZSEA 4OUSA 4OHYA 1GICA 3WX5A 1REDA 3N7JA 4L8QA 2AH2A 1CZSA 2RS33 2V09A 4UFJA 2NZ9A 5ACA1 1D4M1 3A0NA 4XQDA 5HCFA 2WNEA 2BYVE 5LBCA 3U11A 4FO9A 4YWAA 1W8WA 2W92A 4QHZA 5F2WA 3MDPA 4QPWA 1ZRRA 1COV3 1LENA 3E5UA 3KGLA 1N3OA 5FXVA 3B93A 4RA0A 4D8MA 3B69A 4KI5M 2XJUA 2C4XA 4W50A 2XJQA 1N1TA 3C7EA 1PZ9A 1C4RA 3AM2A 3LDBA 5T55A 4YLZA 1W06A 2F4LA 4V2WA 4GH4C 2WWJA 4B7KA 1WCUA 3ZDSA 5K8SA 5K7PA 5FMOL 1WMDA 1XNBA 2KR2A 3VBSC 4XUTA 3CBNA 1IS4A 1QJY2 1RVF1 5FY9A 5IAVA 3RI9A 4HVRA 3HVDA 1UXXX 3WDTA 4CDQC 1JU3A 2OIIA 4CEWA 3CLPA 3WUDA 2BBVA 1R1A1 4AFMA 4RD7A 2QDRA 3MEPA 2VPVA 4XJAA 3MW4A 4EROA 5FO8B 4BWOA 4FPJA 4DQAA 5TSWA 1H2LA 2R062 3GZTB 3N9LA 2R073 3WHTA 4DEQA 5FYBA 1QH6A 3BPZA 4IQPA 1MS3A 3Q8EA 2ENRA 4JX0A 3Q8CA 4Q0PA 4NIHA 3PJQA 3AZVA 1AHSA 2AREA 3QBQA 3H1MA 1J58A 1VRH1 5JVVA 3AK0A 3AP7A 1WD4A 5AVPA 4Q4W1 1JI6A 3J8F2 1KS4A 2Z79A 4IEOA 1A8DA 5FXXA 4XTMA 1E5HA 4IV3B 3O1TA 1W9WA 5KHKA 2BRTA 4N53B 4Q27A 1X82A 2NN8A 4MGSA 3ZIWA 4YZ2A 4RHV3 5CBLA 3JXSA 1CIWA 2BNNA 1H9WA 2WFF1 1JOJA 4NWWA 4BB3A 4EZ4A 5JOWA 3FL7A 1R083 3QCWA 3HMYA 3RGBA 4OUMA 1PGW1 3VD3A 5IVFA 1XE8A 5FZOA 3WF2A 1F35A 4MHUA 2AEZA 3PHMA 2Y64A 4ZONA 2XJRA 4GWJA 5FYZA 1OBNA 1LHVA 1FOD1 1OOPA 4DIQA 4COZA 4XPVA 3WG1A 3RZKA 5D8AA 1MS4A 3MIFA 1LKNA 2ZEXA 2BUKA 3N36A 4P08A 4URTA 5E16A 5F37A 1ZRCA 5FBJA 1JN2P 2B8MA 2ZS6B 5A33B 3THTA 4E4HA 1T6GC 1W2NA 4UF0B 4CEWC 3KD4A 1POV0 4K20A 5BNQA 4QWNA 5LZ6A 3S7IA 3VBUA 4SLIA 2PQSA 4RGAA 2FBEA 4ZU5A 3O1SA 2VQAA 3BODA 3MIEA 3UK9A 1CAXA 3WXPA 3O0WA 2W2IA 4AXOA 1DYPA 2JE7A 5FYYA 1PGSA 1NCQB 2NYYA 3UKNA 1J84A 1EAH1 5LBBA 2Y6LA 2J7MA 1GOGA 2BV4A 1HKDA 3DYPA 1VBB2 2VBDA 3AYAA 4K7JA 4PF5A 4F83A 1QJU1 3U10A 5KXDA 3H50A 2OQ6A 4XETA 2C26A 2PAEA 1HB1A 3AZWA 3BKZA 2H6CA 1XC6A 3NWKA 5JCTA 2W1UA 1FNYA 1MQTB 1IKPA 1KGYA 2HEYF 2JD9A 3VBHA 2ZX1A 1G7YA 1O7FA 3ZSKA 5A6QA 4BZ4A 3DN7A 1YIPA 3BALA 2OXBA 2RS52 2ZGRA 2BDRA 4M4PA 4BYYA 5JPMB 4AI8A 2VO5A 2F17A 3IDBB 2W1QA 3SC7X 3M8LA 4MUVA 4OQ9A 1RUH3 2CV6A 4JHZA 3OYWA 2Y34A 1VPHA 3I2IA 4ZZ8A 3IKWA 4BXSV 1OOPC 2R32A 4QPIB 1KEXA 1U5YA 5D8AC 4BQWA 1JZ2A 2HH9A 2XJPA 3GCWA 1QEXA 1HRI1 2HYKA 2CSGA 3JD72 1YRZA 2BVBA 5K0UB 4OI0A 4HETA 1G6NA 4NPMA 1AL21 2G4IA 1DYKA 4M0HA 4AGVA 4AEKA 3B02A 3VBUC 1UD1A 5FZ0A 3VL9A 2E7AA 4HT1T 2HEVF 4LE4A 1HRV2 4AVCA 4AW7A 1AUYA 3KF5A 5I0UA 5C5TA 3N7MA 4CDUB 4DFSA 2BW8A 4Q4Y3 1O3QA 3TAYA 3I49A 3BUCA 5GLVA 2FMDA 4OHVA 3WLUA 4BDVB 3T30A 4AQ2A 4XUPA 1RUJ2 1UX7A 3N9PA 1C28A 4EN0A 3FJSA 3VN4A 1W2AX 5DQ0A 2A70A 1BCXA 4WM7A 2HEWF 1ULCA 2JG9B 4BA6A 5LB6A 2X05A 5EHDA 2IXKA 3RFRA 1RUC2 2WL1A 1REFA 3SKVA 4JRLA 1GUIA 4WVMA 5FPXA 3VBHC 2RV9A 2E63A 2FQPA 1FAYA 2O14A 3KVBA 3H1YA 1MQTA 2H6BA 1F31A 4DOUA 4Q0VA 3SCGA 4CE8A 3MUZ1 5E1RA 5A3WA 5GKAC 1VAVA 1YFWA 1W0PA 2E7QA 1GLHA 3FUQA 4RR3A 4QPGA 5LY1A 2O8QA 2GMEA 1AR71 1RXFA 2DCZA 2GN7A 2WZR3 4PLOA 1UYZA 4GWMA 2D6NA 4QPIA 1RUD1 4CDXA 3RWKX 2JECA 4BM8A 3OJBA 2ARCA 3ZYGA 3CZUA 1L7RA 1SHWB 1Y7BA 2CHHA 2ZTNA 3HN1A 3PTYA 4OI4A 4E8CA 1BHGA 2A6ZA 5C4WB 2HWE2 1H1IA 2A3XA 3JBG2 4JKMA 5K0UA 1VB2A 5F8PA 5JWPA 4PQQA 5HI0A 3HIFA 5H9SA 3UKVA 1JUHA 4R9BA 4DXRA 3SH5A 5A7WB 1FT9A 4CXYA 3LEKA 3NAPA 3V0AA 4HPKB 1TQ5A 2WO3A 1GQGA 2Y0IA 3DXTA 5FZ1A 3I2JA 2W87A 3ILRA 1RB8G 2QE3A 4AHXA 5IHRA 5A80A 4CDUA 1LHWA 4DUWA 4WM7C 1AR83 2Q8CA 2B5HA 1TNFA 2HWB3 1CD3G 4Y1XA 3IB3A 4I01A 5LASA 4XDPA 5LATA 1D2QA 3VUOA 4AHYA 4EN8B 3QH7A 1PO21 3E6CC 2VTXJ 3J26N 3OD0A 1SCRA 5EXOA 3WNPA 4A4AA 5FYHA 4YZ4A 1DGWX 4A6OA 4FBFA 4MGQA 1MQTC 3L2YA 3I7DA 4Q4X3 5JLVA 2IXHA 2RR13 3ZXKA 1H8VA 4DY5A 1Q8OA 2GMPA 1LHOA 2FDHA 4UXAA 4XFIA 4YW5A 5FWEA 1OVPA 3USUB 4RR3C 4QPGC 1AYN2 4FAHA 1A3KA 2VZQA 5CKNA 1ZZBA 2J1SA 1V6IA 4XF3A 5FV3A 4W8JA 4A7YA 3KCCA 5CU1A 2BERA 3LSDA 1D7PM 4AFBA 1WW4A 3MGUA 3WDVA 2VVFA 2XL9A 4QM9A 3WDYA 1FMD2 4JRAA 4QPIC 5FZIA 3QLQA 3RG0A 3WV6A 3ZLIA 1FV3A 1GQHA 1PHMA 1WW6A 4XOGA 4AVSA 3VBRA 5FPUA 5M0TA 5K0UC 2OVUA 3WNOA 2BNMA 1PVC1 1ALYA 3NAPC 3R4DB 1WLCA 3ECQA 1ND2B 2ARXA 4LK7A 1FPN1 1YQ8A 5JSRA 4IEPA 4AL9A 2VCBA 4DS0A 3DCQA 2HKXA 1W90A 4P9GA 4B1MA 4CDUC 5CG9A 1W6PA 1J1LA 1CAWB 2EIEA 4YG3A 4HPKA 2EA7A 4P9WA 2C24A 2ZZJA 4XBNA 2YGMA 2QQLA 3EXUA 1W6MA 1RUI3 2WWSA 3NJZA 4JTNA 4PJYA 2ZGPA 1RUOA 1NY72 3LOIA 2RJLA 4V1PA 3M3CA 1MZFA 1UQXA 1WLWA 3ES4A 3POEA 3I59A 3NNLA 3OUIA 1RUG3 2JG9C 2FDFA 2BPA2 3I3BA 3NJYA 2QUOA 4AAXA 4YW4A 1LOAA 1XE7A 4QGLA 2UWBA 3AZZA 4RGGA 1PIV3 1VBB1 4YYOA 3VV1A 3VD9A 1QIQA 2OX0A 5FK7A 4OFGA 3NNFA 3DKWA 1UOGA 2WC2A
chains in the Genus database with same CATH topology
4NIGA 4JHTA 3S5AA 4O7XA 4IE0A 3H8RA 3O1OA 2FDKA 4MG2A 2FDJA 3LFMA 3BI3A 3I3QA 3RZHA 3RZMA 3RZKA 3RZJA 4NROA 3T4HB 4IE6A 4IE5A 4CXWA 3O1VA 3T4VA 5F8PA 5DABA 3O1SA 4ZHNA 4NPLA 3RZGA 4CXYA 4RFRB 4QKDA 3I3MA 3BTZA 4ZS2A 2FDIA 3RZLA 4CXXA 2IUWA 4NRPA 3BKZA 4OCTA 3KHCA 3H8OA 4O61A 4IDZA 3I2OA 4MGTA 2FDHA 3O1MA 4ZS3A 4IE4A 3BTYA 3T3YA 4NIIA 4NJ4A 4QHOA 4QKBA 4QKNA 4NPMA 2FD8A 4NRMA 3BIEA 3BTXA 3I49A 3BUCA 3O1PA 3O1RA 4NIHA 3BU0A 2FDGA 3O1UA 3KHBA 2FDFA 4IE7A 3S57A 4NIDA 3O1TA 4NRQA 4QKFA 3H8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NIG A;  4JHT A;  3S5A A;  4O7X A;  4IE0 A;  3H8R A;  3O1O A;  2FDK A;  4MG2 A;  2FDJ A;  3LFM A;  3BI3 A;  3I3Q A;  3RZH A;  3RZM A;  3RZK A;  3RZJ A;  4NRO A;  3T4H B;  4IE6 A;  4IE5 A;  4CXW A;  3O1V A;  3T4V A;  5F8P A;  5DAB A;  3O1S A;  4ZHN A;  4NPL A;  3RZG A;  4CXY A;  4RFR B;  4QKD A;  3I3M A;  3BTZ A;  4ZS2 A;  2FDI A;  3RZL A;  4CXX A;  2IUW A;  4NRP A;  3BKZ A;  4OCT A;  3KHC A;  3H8O A;  4O61 A;  4IDZ A;  3I2O A;  4MGT A;  2FDH A;  3O1M A;  4ZS3 A;  4IE4 A;  3BTY A;  3T3Y A;  4NII A;  4NJ4 A;  4QHO A;  4QKB A;  4QKN A;  4NPM A;  2FD8 A;  4NRM A;  3BIE A;  3BTX A;  3I49 A;  3BUC A;  3O1P A;  3O1R A;  4NIH A;  3BU0 A;  2FDG A;  3O1U A;  3KHB A;  2FDF A;  4IE7 A;  3S57 A;  4NID A;  3O1T A;  4NRQ A;  4QKF A;  3H8X A; 
#chains in the Genus database with same CATH topology
 3AKR A;  4XAC A;  3VGI A;  5FCC A;  5LWB A;  2WSV A;  2HWD 1;  4ATE A;  3H8R A;  2XVK A;  3PVE A;  4W4Z A;  2HWF 1;  1JZ5 A;  1PNG A;  2WSU A;  4NHM A;  3AP5 A;  4KH9 A;  3JB8 A;  1O3R A;  4S2G A;  1YJL A;  1Z7S 2;  1W8Z A;  2Q1Z B;  3BI3 A;  3T09 A;  1HN0 A;  1S0I A;  3RVH A;  3HT1 A;  3USU A;  2BOI A;  3AXE A;  2OS2 A;  4GA9 A;  4MGZ E;  2DUR A;  3N7L A;  3USS A;  1PX4 A;  2Y6G A;  3VBR C;  4BE3 A;  3OBZ A;  4XIL A;  3UYJ A;  3VBO B;  1P8J A;  4L2N A;  2AEY A;  3OGJ A;  1QJY 3;  1ODM A;  5F6K A;  2WNO A;  1RUF 1;  4O9E A;  5C4W C;  1TZO A;  2A7A A;  2GN3 A;  2V73 A;  2RMU 1;  4C0B A;  1U12 A;  3UNP A;  2DCY A;  3VKN A;  3U37 A;  5JR2 A;  1DQ0 A;  5CG8 A;  4BH9 A;  5A6Z A;  1ND2 A;  1OI6 A;  1VR3 A;  1YC6 1;  3ATG A;  1VBE 2;  4TXW A;  5LA1 A;  2R06 3;  4KBB A;  5LK5 A;  4FCA A;  1APN A;  1QY4 A;  2YB7 A;  2P17 A;  1CAW A;  4OLL A;  1YQC A;  4MHR A;  1PK6 B;  1BMV 2;  1G9C A;  4M00 A;  1KFX L;  2DBN A;  4XC9 A;  4YW2 A;  3KQ4 B;  3JQX A;  2E26 A;  1E5I A;  2Y60 A;  5A6X A;  2IXI A;  2WO1 A;  1DQ1 A;  5F5I A;  5JSO A;  3I3E A;  4M3C E;  5DDJ 1;  3OPT A;  5DUU A;  2HWC 1;  2A3W A;  2VAU A;  4MX3 A;  1NZC A;  2ET7 A;  2UYA A;  2WAB A;  1B09 A;  3T0B A;  3SKJ E;  3W9A A;  2JDK A;  1VAK A;  1DP0 A;  1VLN A;  1LOD A;  3AFK A;  1VP6 A;  3ACG A;  3TEY A;  4YW6 A;  3TOJ A;  2RM2 3;  5JXI A;  1LRH A;  1H4G A;  4YFW A;  1Y9Q A;  1PO1 2;  3K4Z A;  1RUE 2;  2ZHM A;  1HB2 A;  2G9F A;  2JIC A;  3EB7 A;  3SQO A;  3TN9 3;  4QKB A;  3WNM A;  1AR9 2;  1W8F A;  4CEY B;  2HBT A;  2WJS A;  3F2Z A;  1EP0 A;  1X33 A;  4Q4V 1;  5LRR A;  3UKT A;  4AF9 A;  1D0H A;  5F3E A;  3FBM A;  4EYU A;  1K45 A;  2R0H A;  3VBO A;  3OF1 A;  1AF9 A;  2VW2 A;  1PZ7 A;  4GB3 3;  4YVW B;  5FBZ A;  2XBO 2;  4BIS A;  3SH4 A;  2XLA A;  4LOS A;  4EQV A;  3ZYF A;  1ZZC A;  3HR9 A;  4Q8L A;  3CZJ A;  1ND2 C;  5J1X A;  4JGY B;  1SCS A;  1PM7 A;  4OUE A;  1W3V A;  3MHZ A;  4ZY9 A;  2XR4 A;  4EWD A;  5KR7 A;  2Y8K A;  2K0G A;  2VY0 A;  1VAL A;  4XQ4 A;  2EID A;  1JH5 A;  1UYY A;  5FZG A;  3MI8 A;  4A7Z A;  5C5U A;  4EJR A;  3HNY M;  1NCR A;  3IAP A;  5D2A A;  4BIF A;  1URX A;  4AEM A;  1RIR A;  2XUE A;  4X6Q B;  4DRV A;  1LGN A;  4CDW A;  5HPO A;  1SBF A;  3UGH A;  1YNA A;  4DZG A;  2PHX A;  3MV1 1;  1YHF A;  3ZOI A;  3VHP A;  4LK6 A;  2XKO A;  4MXW A;  1C8M 2;  4IEW A;  1AXK A;  2DCT A;  2VZV A;  3POB A;  1ZRI A;  3B7M A;  1V00 A;  5LCW L;  1RHI 1;  2ZGO A;  4A3X A;  1O8P A;  4SBV A;  4AQ6 A;  4XJ9 A;  2IXC A;  2OW4 A;  3GBG A;  3N9N A;  3PVB B;  3RZH A;  2WUH A;  5ACA 2;  1D4M 2;  2OZ6 A;  4Y26 A;  3WQ1 A;  2EXJ A;  5JDB A;  1JTZ X;  1LOF A;  3D0J A;  4PLN A;  1LB2 A;  1AZD A;  3IM0 A;  5C8C B;  2BBA A;  2Y38 A;  2CL2 A;  4FXG B;  2K9Z A;  4E2Q A;  4D69 A;  3SXW A;  1Q5O A;  4M01 A;  2D6K A;  2VOT A;  1UKG A;  2DTY A;  5AC9 1;  3VBO C;  3OSD A;  1IOA A;  3KZ4 C;  1W6O A;  3H3L A;  3M1H A;  5FYM A;  2DTW A;  1HRV 3;  4LKF A;  1MR5 A;  3P3N A;  4YW7 A;  1F5F A;  4YVW A;  1GZW B;  3ZYR A;  3A22 A;  1WCK A;  1RVF 2;  3W59 A;  2IVI B;  1YJK A;  3C2U A;  2PFW A;  3U07 A;  3UET A;  2FDI A;  4GWN A;  1RUJ 3;  1F2N A;  4RQP A;  1NCR C;  1MEC 1;  1TMF 1;  3ZVX A;  3R4S A;  4CCO A;  1R1A 2;  2JD4 A;  3BPS A;  5D21 A;  1IZ3 A;  4COW A;  2Q5T A;  3WP6 A;  2VNO A;  3E97 A;  3NNM A;  4N90 A;  4LNV A;  1V6J A;  2D3P A;  4JTO A;  4I3G A;  4CDW C;  2YFU A;  3NNG A;  4NVP A;  2EIB A;  1SDW A;  1KDK A;  4MYE A;  1V0A A;  3SEE A;  1RGS A;  2DWR A;  5FJK A;  1YQ6 A;  2ZAH A;  5A3U A;  1VRH 2;  1VBA 1;  4W6Y A;  3ZMO A;  1W03 A;  2LW8 A;  1JXN A;  4LOT A;  4ES9 A;  2YBK A;  3SCH A;  2R0F A;  4CYD A;  1O59 A;  1YI9 A;  1ZZ9 A;  5FRA A;  4F7Z A;  3B94 A;  1BKZ A;  1DYO A;  4E4Z A;  5I91 A;  2D3S A;  4PQ9 A;  4NN0 A;  1LOF C;  4MV2 A;  3ASI A;  3LIH A;  3NV3 A;  1SBE A;  4PI2 A;  4GJZ A;  5KXC A;  2WFF 2;  1GNY A;  5A1F A;  4TTG A;  1V70 A;  1GZ9 A;  1NT0 A;  1HJF A;  1PGW 2;  4LLF A;  1NYW A;  2WQ4 A;  5C8C A;  4CP9 A;  5F3I A;  4QDS A;  1J83 A;  4E4S A;  2G9Z A;  3GBF A;  4H2A A;  4BPZ A;  1DG6 A;  2HWE 3;  1M4W A;  1ENS A;  3JBG 3;  1UU5 A;  3IPV B;  2ZHN A;  2VQ0 A;  4YVW C;  1FOD 2;  4GWI A;  4URA A;  2CTV A;  3BTX A;  5FQ0 B;  3ZXG A;  4CP1 A;  3WIN E;  3WVJ A;  4HAN A;  1ONA A;  3A7Q A;  2YC0 A;  5I0T A;  3Q8F A;  4LEJ A;  3VDD A;  3SCF A;  4RQP C;  5JSP A;  1EV1 3;  2ET1 A;  1GZW A;  4NOT A;  1JOP A;  5LK7 B;  2R49 A;  3BN6 A;  3CHX A;  4AWD A;  1C8N A;  2PLV 1;  1W8U A;  2ZEZ A;  5CAD A;  4CUA A;  1MPX A;  5FYT A;  3C7O A;  4P9Y A;  2BZD A;  2UYB A;  4XJ8 A;  1EAH 2;  1QXR A;  1WA6 X;  2ZGN A;  2JDY A;  3NVC A;  4IEY A;  3W58 A;  4C1W A;  3V0B B;  4Q1R A;  4JKK A;  1OQD A;  1QJU 2;  2RJK A;  3CDZ B;  3WOG A;  2FDK A;  4GJY A;  1Q3E A;  5CFC B;  5LEK A;  4E9K A;  3AMN A;  4QQL A;  3H42 B;  1LOC A;  4IGQ A;  4P9L A;  4Q8K A;  1COV 1;  5BUV A;  3WDX A;  4F3J A;  1AYN 3;  1BK1 A;  3H7Y A;  4KWJ A;  3KF3 A;  2X5I B;  5FXW A;  1ZBA 3;  3WSO A;  4FAG A;  1GKB A;  1IG0 A;  3AFG A;  2BQP A;  1HV1 A;  4A42 A;  2WQZ C;  2WYS A;  2ZAB A;  3TEZ A;  1HV0 A;  2ES3 A;  3U0Z A;  3DEM A;  4MLO A;  5C8C C;  3M3I A;  4MSV A;  4YVS A;  3HQX A;  5LA2 A;  2VH9 A;  4HK9 A;  4Q5O A;  1TE1 B;  1W6N B;  2D98 A;  2EXH A;  4HKW A;  2AUY A;  4FFG A;  1XRU A;  3ACH A;  4MH0 E;  2E9Q A;  1QH7 A;  2VNV A;  1LUL A;  2X10 A;  3IN9 A;  4ZU7 A;  1HRI 2;  2UY9 A;  1W9F A;  3IPV A;  1IKQ A;  3LZZ A;  4QHB A;  2KD7 A;  3HAG A;  3MF6 A;  5FZF A;  2Q8E A;  3VDD C;  4D6Q A;  4E2S A;  4UAP A;  2B46 X;  1AL2 2;  2CAV A;  5F39 A;  2EAA A;  2VGD A;  3BTZ A;  2PQQ A;  2R07 1;  2C0Z A;  1GP6 A;  3Q8B A;  2W94 A;  1XB9 A;  3OY8 B;  1NA1 B;  3THC A;  1QQP 3;  1JYC A;  4YZ5 A;  3GM8 A;  5BNN B;  1N1S A;  2MEV 3;  2ZA9 A;  2XQX A;  2V5Y A;  3VBS A;  1MS5 A;  2J1V A;  2JJ6 A;  2QBX A;  2XG3 A;  4FPK A;  1IS6 A;  3DGT A;  3I4I A;  3ROU A;  2AC1 A;  2YU2 A;  2CYF A;  4YM3 A;  5GZF A;  3SIT A;  1XSR A;  2FMY A;  2Q4S A;  3AP9 A;  4RHV 1;  4DEV A;  5JR7 B;  2XJT A;  2VCM A;  4XUQ A;  5DMY A;  4GUL A;  4XXA A;  2Q8O A;  1F8V A;  1R08 1;  3V0B A;  3MYX A;  5FY7 A;  1S0E A;  1DQ5 A;  3EMR A;  5IAT A;  3ZFG A;  2JX9 A;  1Z0H A;  4UBH A;  3VZM A;  1PGL 1;  2XHK A;  1FAT A;  2ZX4 A;  4CUG A;  5CFC A;  4M3C A;  5CFD A;  1OA4 A;  4XQW A;  3EHK A;  1QJX 1;  2RDQ A;  4Q29 A;  1GZT A;  1YYN A;  5IFT A;  4H55 A;  4YVS C;  3I2D A;  1DLC A;  3ST7 A;  1EPZ A;  4DXZ A;  1QOO A;  2C9K A;  4I2O A;  2GND A;  5C9A A;  4UW4 A;  2ERF A;  3B3Q E;  4N43 A;  1DCS A;  1OLQ A;  5FY5 A;  5IT6 A;  4XF4 A;  5EWS A;  3ZXE A;  4AHZ A;  1VRB A;  2WZ8 A;  2XML A;  4LBO A;  2VQT A;  3POG A;  2VTX A;  4S2D A;  1AR7 2;  1BLZ A;  2KA3 A;  2WS9 3;  4JAA A;  5FR3 A;  3FC0 A;  3MW2 A;  1WLD A;  1F4H A;  1BEV 3;  4XEZ A;  5L9B A;  1RUD 2;  1WA4 A;  1ZVF A;  1UY1 A;  2WT2 A;  1CPN A;  3R0R A;  3IBM A;  5CVR A;  5BNO A;  3KT1 A;  3FE5 A;  3BU0 A;  4K1Y A;  3O1U A;  2DVF A;  3WW2 A;  1HQW A;  1XYN A;  1JUI A;  1VBE 3;  2K2S A;  4O65 A;  1V9U 3;  2PN5 A;  3IAQ A;  2AEN A;  2WBK A;  1REE A;  3W21 A;  4UFK A;  2OQ7 A;  2P2K A;  1J3P A;  1TME 1;  2B9U A;  1AJK A;  2RE9 A;  3H7J A;  4I0W B;  2VMG A;  2KM2 A;  2V4V A;  4QKF A;  4D94 A;  5BNN A;  3H8X A;  1JYT A;  1G9D A;  2VME A;  3ZFF B;  5JI9 A;  4JHT A;  3S5A A;  1LOB A;  1SPP B;  5FZ6 A;  3CMG A;  4K1Z A;  1UYP A;  3GJB A;  1Q8P A;  5LW9 A;  4TWT A;  4RS5 B;  4G9S B;  3ZFG C;  1DGR N;  4DMI A;  3CJX A;  3FZ3 A;  1O5L A;  1PO2 2;  4LHN A;  5G05 L;  5CFC C;  2JB4 A;  5CFD C;  2QQV A;  3III A;  2VBP A;  4BQX A;  5B2G B;  4G4F A;  4QDR A;  2DVB A;  5KHH A;  1ULP A;  3VKF C;  4YZ1 A;  5DUX A;  3VLB B;  1DBN A;  4GAZ A;  3LB9 A;  2JIJ A;  2TNF A;  1PO1 3;  1VBC 3;  2DF7 A;  1RUE 3;  3RZJ A;  2B42 B;  4HON A;  5KC5 A;  4UFL A;  1ND3 A;  4FPF A;  1UNB A;  1I6X A;  1QJF A;  4FPL A;  2QQU A;  5FIX A;  5C9A C;  3FHA A;  4N43 C;  5IVV A;  1HXS 1;  2AGS A;  2Y6F A;  3TNQ A;  4JQT A;  4GMP 3;  5FLI A;  1O91 A;  5JPN B;  5I0D A;  4UBG A;  1WD3 A;  2DU1 A;  3PNA A;  3S5Q A;  3WY6 A;  1OUX A;  4EN7 B;  5FLJ A;  1W9T A;  4BIO A;  2ILM A;  5FZM A;  1X9T A;  5C3R A;  2W0X A;  2DBI A;  1UW8 A;  4XMA A;  5BNO C;  4XF0 A;  4J25 A;  2ZX2 A;  1VB4 A;  4ZS2 A;  5LBE A;  3G6J B;  3RZL A;  3FWE A;  4OHZ A;  1NOV A;  5FZC A;  1PVC 2;  2Y0O A;  2XB6 C;  3LEG A;  1U5X A;  1NA1 C;  1DU3 D;  1FPN 2;  3AL6 A;  5BNN C;  4R9A A;  1UZW A;  3BB6 A;  2NLR A;  1OHF A;  4GD4 A;  1XND A;  2IWG B;  3KHC A;  1C3H A;  3R05 A;  3WF4 A;  1Q8V A;  1RIT A;  2YC2 A;  3B9C A;  3QH6 A;  4GXL A;  4QB6 A;  1QJZ A;  5FKC A;  1GR3 A;  4B4P A;  3BGA A;  1AR6 1;  1R09 2;  2ZEY A;  3ZFF A;  1KJR A;  4FI9 A;  3VBF B;  1C8M 3;  2RVA A;  1F4A A;  2ARB A;  2CNA A;  3PVN A;  5CEH A;  3W5N A;  2EF6 A;  3KT4 A;  2VMD A;  1FV2 A;  4DO0 A;  4AGR A;  1H2K A;  1I3H A;  4NHY A;  2VXR A;  2YBP A;  1BYH A;  1ND3 C;  3ZX7 A;  5HCA A;  1NG0 A;  1D4M 3;  2HWD 2;  4QKN A;  2WZR 1;  2HWF 2;  3JZV A;  3NW4 A;  2H0B A;  3PL0 A;  4L99 A;  3O0V A;  5HXV A;  4XCB A;  4IV3 A;  5B4X A;  4LIU A;  1O3S A;  4A6S A;  5J37 A;  3H3Z A;  4N53 A;  5APA A;  1BK0 A;  1FYU A;  4LBK A;  5EPA A;  4A44 A;  1U5I A;  2Q30 A;  4AFD A;  4DB5 A;  3WP3 A;  4XDQ A;  3ZKU A;  1W9Y A;  1XBF A;  1C1L A;  4ES8 A;  2W3J A;  1BBT 1;  1C57 A;  1RMU 1;  5CKM A;  4OI1 A;  2BTV C;  5EP9 A;  2F4P A;  1DGL A;  1DZQ A;  1RVF 3;  1Y4W A;  3WG2 A;  3PTR B;  5EIY B;  1RUF 2;  2P3K A;  3D6E A;  3NV4 A;  5J98 B;  3AMM A;  2RMU 2;  2HWB 1;  2XLF A;  5E8A A;  4NID A;  1VBD 1;  4BK5 A;  1R1A 3;  3ENR A;  1YWK A;  4LBL A;  1C5H A;  1SAC A;  1OF4 A;  3ALQ A;  5A33 A;  3P3P A;  1IHM A;  4UF0 A;  4CA9 A;  3ZFE B;  3FLR A;  4UFM A;  3ZFF C;  2WFP A;  4AQT A;  4ZKT B;  1F15 A;  2Q1M A;  1K3I A;  2RR1 1;  3WNN A;  3VHR A;  5IVB A;  2EAK A;  1VRH 3;  2BGC A;  2YV8 A;  3I97 A;  3WCR A;  1PMJ X;  4Q4W 3;  3SLI A;  4PBP A;  5A3N A;  3VDB A;  1NCQ A;  1UCX A;  2P3Y A;  2OUJ A;  3KMH A;  5DUV A;  1NQD A;  3JUU A;  4AEJ A;  2PHD A;  5JXH A;  2VR4 A;  5DDJ 2;  3K4D A;  3PUR A;  2OZJ A;  2HWC 2;  4R9D A;  1J1T A;  4ZU4 A;  1QU0 A;  2WFF 3;  4HN1 A;  4AED B;  3KS7 A;  1DGW A;  3P1I A;  1IG3 A;  3PUH A;  4KU7 A;  4LQR A;  2C5D A;  4I0A A;  4CTE A;  4IV3 C;  1Y43 B;  3WG4 A;  5AFE A;  2VMF A;  4P5H A;  3ZM8 A;  3T2O A;  2QCS B;  4N53 C;  4OYU A;  2CAU A;  5T52 A;  3O5S A;  1OSG A;  3WD5 A;  4XZU G;  5FUI A;  3AKP A;  1FOD 3;  1J3R A;  2AR6 A;  3GJA A;  1POV 1;  3OPZ A;  2AZ5 A;  4Q4V 2;  2D44 A;  3ZN6 B;  3E5X A;  3H9A A;  5KHG A;  3VDC A;  5BXX A;  1NZI A;  1Y3T A;  1RXG A;  3CJI B;  4XFA A;  3WZ1 A;  3PME A;  2WN2 A;  3SH3 A;  3ZYH A;  2EIC A;  1GFF 2;  1W0O A;  2FZ1 A;  2XGX A;  2ZKN A;  4IL7 A;  4L9B A;  4NPR A;  5JMO A;  1LES A;  5DN2 A;  3K2O A;  3ZXA C;  2ZML A;  3IWZ A;  1OQ1 A;  1W2T A;  3AMQ A;  2OYZ A;  4BQY A;  2JDA A;  4J1X A;  1EY2 A;  4GKX A;  5IK4 A;  3WW3 A;  4RL7 A;  3ZPO A;  5A3T A;  1EAH 3;  5FLH A;  2PA7 A;  4C8D A;  2D7F A;  2XON A;  1WCS A;  5F5A A;  4CRQ A;  4QQH A;  1ZBE 3;  2MPF A;  4EWE A;  3RMY A;  1MVE A;  4D3W A;  1OMI A;  1D0G A;  2QVS B;  4XE9 A;  4W65 A;  1NCQ C;  2WLQ A;  3U4X A;  3HWJ A;  1BJQ A;  1AYM 2;  5FZH A;  5A32 B;  3IDC B;  2W39 A;  3EO6 A;  4IXL A;  2K46 A;  1ZRD A;  2VXJ A;  5BPX A;  2JG9 A;  3PUS A;  4LXL A;  5J09 A;  2ZMK A;  3C7H A;  2I07 B;  1RHI 2;  1IS3 A;  4QX0 A;  4NRM A;  4RN5 A;  4AI2 A;  1RYY A;  5CB7 A;  5J7M A;  5JZG B;  2VVE A;  2WZE A;  4NE9 A;  1CQ9 A;  3DEC A;  2W1S A;  5EYY A;  4XCA A;  1WMX A;  1YXW A;  1CAV B;  2R04 3;  1JZ3 A;  3P5B A;  2H0V A;  1XXN A;  2YDE A;  4B3N A;  4P5Y A;  5AC9 2;  4LUL A;  1AL0 G;  1CVN A;  2I45 A;  1AL2 3;  2QFE A;  3GZE A;  3LF7 A;  3WP5 A;  4OHW A;  4N9H A;  2XPJ A;  3OD4 A;  1S0G A;  2IFR A;  4K40 A;  1W05 A;  4CSW A;  4WM8 B;  4YM0 A;  4M4R A;  4MVT A;  1Y9M A;  5DAX A;  1UMH A;  3OOX A;  1JOB A;  3WF3 A;  4P9I A;  4X6R B;  2C6S A;  3WT3 A;  2DCJ A;  2P37 A;  3QD6 A;  5C4W A;  3FFQ A;  3V65 A;  2BFU S;  3O1O A;  1MEC 2;  1TMF 2;  5JMC A;  3ILN A;  4XW3 A;  4YGB A;  5FZE A;  2GNT A;  3RPQ A;  1O8S A;  2VBB A;  2YY1 A;  3HN3 A;  1ASJ 1;  3T08 A;  4Z82 A;  1WW7 A;  4IEV A;  3PMS A;  3KB5 A;  5A7W A;  2Q1F A;  5FKB A;  2O8O A;  5KBF A;  1BVV A;  1R09 1;  1TVG A;  2RM2 1;  1XPW A;  4Q0S A;  4Y22 B;  5FPZ A;  1JZ7 A;  3DYO A;  2ZHL A;  4AFC A;  1W6Q B;  1EYB A;  4IEQ A;  1VBA 2;  3TN9 1;  4BK4 A;  2E53 A;  3MIH A;  2XWB B;  3ELN A;  3ZXL A;  3RYR A;  1HIX A;  1UIK A;  3MIB A;  4ZHN A;  2VUC A;  2VZT A;  2VZ1 A;  4S2H A;  4GB3 1;  1BZW A;  4ASM B;  2VUA A;  4QKD A;  5EV7 A;  1RJ7 A;  3ZSL A;  4B4R A;  1VIW B;  1MS1 A;  3C7G A;  3MUY 1;  3C3V A;  4NAO A;  4LO7 A;  3RRD A;  1WLT A;  1QJE A;  1OPM A;  2C9A A;  2R1D A;  4QMA A;  3QOP A;  2EIG A;  1GBG A;  2EAL A;  4LOR A;  1NQJ A;  2IFW A;  1CAV A;  3T2P A;  3GDB A;  3I2G A;  4Z92 B;  5IVC A;  3AXD A;  5F32 A;  5T5O A;  4XFF A;  3SNM A;  2RS1 1;  2PHW A;  1SMV A;  2ARA A;  3NMB A;  2P4E A;  2VU9 A;  3U78 A;  5C71 A;  4P9X A;  2DVD A;  3HQU A;  4MO3 M;  3DKQ A;  4WBB A;  2FCU A;  4KBZ A;  3SIS A;  1QDC A;  4DNY A;  3DPR B;  2BWA A;  5EYX A;  2TUN A;  4CCM A;  5HBA A;  1PMI A;  4PDW B;  4KG0 A;  1W8O A;  2IXL A;  4FVV A;  4NWV A;  4XFG A;  5A7Q A;  3BOP A;  1OUR A;  2VW0 A;  4U36 A;  1UAI A;  4HSJ A;  4TLF A;  1XNA A;  3W5M A;  4B7E A;  3O1M A;  1SFP A;  4BLI A;  2PLV 2;  3LGR A;  4QB2 A;  1W04 A;  4Y20 B;  3I2K A;  3PJY A;  1CR7 A;  4JVA A;  1NE6 A;  1PO2 3;  2CWM A;  4YGD A;  1NAE A;  1S1A A;  4JGZ B;  5H9Q A;  2OKX A;  1UF2 C;  2A6X A;  5FMB A;  1CIY A;  1AX0 A;  4IES A;  1ULD A;  3PU8 A;  2WT0 A;  4P00 B;  3J8F 3;  1EPW A;  1UU4 A;  1YEW A;  2WLP A;  2WO2 A;  2WIN B;  4QQ2 A;  2V5D A;  1BMV 1;  3LSE A;  3INA A;  4YW1 A;  2QKD A;  1COV 2;  1V6N A;  4CCN A;  2JDZ A;  3AP6 A;  2ZGM A;  5GZC A;  1GSL A;  2ZGT A;  3FHI B;  3SMH A;  3BCW A;  2IZW A;  1WCQ A;  4BU2 A;  5FPL A;  3RMX A;  2BFU L;  5FZ8 A;  4ATF A;  1FI2 A;  2PMW B;  4Z07 A;  4AHW A;  1UY4 A;  2AAC A;  1A34 A;  3BTA A;  1ZZ6 A;  1NLR A;  4JDN A;  4MGI E;  5GLW A;  2A6V A;  1F5J A;  4CCL A;  5DZF A;  2GNM A;  3TRS B;  1V6M A;  4TLG A;  3SHR A;  3PIG A;  3KHB A;  4XMI A;  4EN9 B;  2DUQ A;  4KG8 A;  1MS8 A;  4IGO A;  3MZH A;  1PM4 A;  1POQ A;  4WM8 C;  3WNL A;  2J1E A;  1KJL A;  2IXJ A;  2ZAA A;  4JV4 A;  2VUL A;  1GU3 A;  4PF1 A;  2UWA A;  5L7O B;  1CON A;  5ISL A;  4OMD A;  2R07 2;  4AK3 A;  1LJ7 A;  5FY1 A;  3H0O A;  1G9B A;  1XYP A;  2PXJ A;  3ETP A;  4K8F A;  4LKE A;  3TEX A;  3LQC A;  4AI1 A;  4MG2 A;  3MLJ A;  1HJG A;  1HQN A;  4ONU A;  2NP0 A;  2A6Y A;  4Y5Z 0;  3HQR A;  3VZJ A;  2ZGU A;  1UZV A;  2QQM A;  3E5Q A;  1I1E A;  1OC1 A;  1JYN A;  1YQ2 A;  5FP9 A;  3AZX A;  4Y5T A;  1VBB 3;  3UGG A;  4IEX A;  4DIN B;  3ZIX A;  1O4Y A;  2JWP A;  3J7N A;  3NRU A;  1Q56 A;  3CU7 A;  2OPW A;  3IMM A;  4RHV 2;  2WNU B;  2DCK A;  1WMF A;  2VZO A;  3AC0 A;  4CCK A;  2DU0 A;  1R08 2;  2W91 A;  1PK6 A;  2Z5W A;  1DQ6 A;  2HWF 3;  3EYP A;  4ZXE A;  1AYM 1;  4FFH A;  1PGL 2;  1XNK A;  1X50 A;  3GF6 A;  3KCY A;  4IW3 A;  3OGV A;  1ENX A;  1QJX 2;  3ZYP A;  1YLL A;  2NM1 A;  4C1X A;  3MBW A;  4Y1U A;  2EXI A;  2RS5 3;  3CL1 A;  5LY2 A;  1UOJ A;  2VOK A;  4H7M A;  5FO7 B;  2XHN A;  3AB0 A;  3AYE A;  5FYI A;  4XIO A;  4MOA A;  1TG7 A;  1HLC A;  4XBL A;  4XFB A;  4YW3 A;  3H8U A;  1EV1 1;  5FZB A;  5FYU A;  1RUF 3;  4AI9 A;  4AVA A;  3HOB A;  2VVD A;  3A0K A;  4LO6 B;  4R9C A;  3L9J T;  2Q8D A;  2W9X A;  3JD7 3;  4P9J A;  2QZ3 A;  2VUJ A;  1UZZ A;  4DRR A;  4QPY A;  1KIT A;  4EZH A;  5JIA A;  1QHD A;  4CEY A;  2B39 A;  3OGS A;  5JAX A;  2WNV B;  3RWN A;  4LHL A;  1SLC A;  1QOT A;  3HD8 B;  1OKQ A;  4L11 A;  3S6P A;  5A3M A;  2SBA A;  2VOW A;  2QQO A;  1PVX A;  3AJY A;  4ZS3 A;  4XJU A;  2PEL A;  1Q8S A;  3M70 A;  2PHL A;  4PT6 A;  4JQR A;  2GAL A;  2GZW A;  1TME 2;  2VCA A;  2WN3 A;  1SLA A;  1CWP A;  2W52 A;  1JYW A;  4JGY A;  5HCH A;  4KQ7 A;  4D7Y A;  1X36 A;  4JGZ C;  1XNT A;  3ORJ A;  4GAL A;  1H6Y A;  1ZBA 1;  1ZA7 A;  2WR9 A;  4FPE A;  1PK6 C;  2DV9 A;  2ADE A;  1RUC 3;  2VM9 A;  4AQS A;  2R30 A;  2W68 A;  1HN1 A;  4B4Q A;  3R4U A;  4U2A A;  1KD7 A;  3DXU A;  1RC6 A;  3VHO A;  4AI3 A;  3MF9 A;  1V6L A;  4XF1 A;  1S4C A;  2O1Q A;  3PUQ A;  3OBA A;  1OLM A;  1W28 A;  4L92 A;  5EZW A;  3NNJ A;  1DQ2 A;  2JKX A;  2WII B;  2JKB A;  4LTA A;  1S2B A;  3VL8 A;  3ABZ A;  1GWM A;  1VMF A;  2IC1 A;  1G9F A;  1KS5 A;  1SFN A;  3NO8 A;  1HXS 2;  3CIH A;  3ES1 A;  3J9S A;  1LU1 A;  2VW1 A;  2XJV A;  4PI0 A;  4GMP 0;  4LUK A;  1KXG A;  1RJ8 A;  1QQP 1;  2LTN A;  4XTP A;  3UV9 A;  3ZR6 A;  1SLT A;  2QQK A;  4NRQ A;  5IK5 A;  1TNR A;  4GKY A;  1AJO A;  4FQZ A;  4BXF A;  1OA3 A;  3MLL A;  1MZ6 A;  4CP0 A;  4CEY C;  2VCC A;  3LD8 A;  3A4U A;  4LBQ B;  1W9S A;  2B45 X;  5FFO C;  2B4K A;  3VZN A;  4YFZ A;  4LBJ A;  5GZG A;  5IVJ A;  3VD4 A;  4HKL A;  4LT5 A;  1OFS A;  2W47 A;  3KT7 A;  4KWK A;  1CJD A;  5L7O C;  4UW5 A;  3MV0 1;  3KWV A;  1JHJ A;  1YO8 A;  1DQ4 A;  3OTF A;  4FP2 A;  2YBS A;  5A70 A;  3I3Q A;  1OH4 A;  4JGY C;  1LAJ A;  2VQU A;  5FZL A;  1BQP A;  1UMI A;  3I2H A;  5DXD A;  5T3N A;  2JEN A;  2XJS A;  3POW A;  3GBW A;  3SEP A;  1H2N A;  1UY2 A;  1XNC A;  3NJX A;  3ACI A;  4XUN A;  1T6B X;  1GOH A;  4IE6 A;  1AR6 2;  2QNK A;  1RL3 A;  2A71 A;  1AXY A;  1F9K A;  1OPO A;  3O1V A;  3POI A;  2ZZQ A;  3D0S A;  2OT7 A;  1HQL A;  3MW3 A;  5FP3 A;  3VD5 A;  4CZS A;  3MIC A;  2RS3 1;  2QQP A;  5FY0 A;  3ZR5 A;  3GNE A;  3AKQ A;  3RS6 A;  1N1Y A;  1SLL A;  4QT6 A;  4AVV A;  4XUR A;  1UY0 A;  1DF0 A;  2E6V A;  2VE1 A;  2WS9 1;  4NHK A;  4W6W A;  4A41 A;  1NX9 A;  1CAU B;  2WZR 2;  5A7S A;  5K4L A;  1LU2 A;  4YM1 A;  4L97 A;  4CXX A;  2IUW A;  3TYJ A;  1O3T A;  1LEM A;  4NRP A;  4CDQ B;  4K8R B;  1ZYB A;  5FUN A;  3AZY A;  1V9U 1;  1FMD 3;  2WDB A;  2A3Y A;  1UKR A;  2QQI A;  3PUI A;  4YAR A;  4HBN A;  4QM8 A;  2P6H A;  1JZ8 A;  1BBT 2;  1DIW A;  1LGC A;  3OBT A;  4XFH A;  3ZKY A;  2P1B A;  1RMU 2;  2D5H A;  1JMU B;  4B1L A;  3C8X A;  1K42 A;  1UZY A;  1YIF A;  4FPG A;  3VZO A;  2Y6K A;  1G8W A;  3E6D A;  2HWB 2;  3BYW A;  3HEI A;  4FTB A;  1TMF 3;  5CAZ A;  5FMO S;  1VBD 2;  3M4F A;  2XVG A;  5FRE A;  1DZT A;  1GNZ A;  3F95 A;  2YYO A;  5FQ0 A;  4HOO A;  5IK8 A;  1XJA A;  4M0N A;  4MXV A;  4ARX A;  3O7O A;  5KXE A;  2YPJ A;  3WHU A;  2JDM A;  2R16 A;  3K48 A;  1VBC 1;  3AJZ A;  1J3Q A;  1OD5 A;  1OVS A;  5JXJ A;  2L9L A;  3KLS A;  2RR1 2;  1YFU A;  2ZBJ A;  3AP4 A;  3ZN4 A;  1VBA 3;  3AKS A;  3E6B A;  2B7Y A;  5G04 L;  2KXL A;  4XFC A;  4ITC A;  2J1U A;  4CCE A;  4AGG A;  3M3Q A;  5FTT C;  1K5M B;  1UYX A;  2TEP A;  2ZPX A;  5BNP B;  2ID4 A;  2YUE A;  2WAA A;  1S0B A;  2N7G A;  1RUN A;  2R7E B;  3WG3 A;  1Z7S 3;  1KQR A;  4DY3 A;  3LDR A;  4FOY A;  3I3D A;  5J3U A;  4UW6 A;  1CAU A;  4CEW B;  4CPB A;  1IQD C;  1SDD B;  1ULF A;  3RJR A;  1VJ2 A;  1WGP A;  2I74 A;  3WUC A;  3ZSM A;  3QAC A;  5DZG A;  2X5I A;  4XAE A;  4LO8 A;  4V2V A;  2D6P A;  1LOG A;  4HL0 A;  4JCK A;  1GOF A;  2Z4F A;  3OUH A;  4IE0 A;  4DUX A;  5I0S A;  4I30 A;  4I3P A;  1HB4 A;  5FZA A;  1JZ4 A;  1W6N A;  2B9V A;  1WKY A;  4QX1 A;  5CNA A;  2ZMN A;  3UJQ A;  1GYK A;  4FQ4 A;  3Q8A A;  5DAV A;  5KWR A;  2PLV 3;  1WW5 A;  3CQO A;  4QQO A;  5FYS A;  1E57 A;  3MID A;  4IV1 B;  2WQ8 A;  1PIV 2;  3LCP A;  3WF1 A;  1RIN A;  4D7S A;  1OKO A;  4FSJ A;  4OVE A;  2NMO A;  3GGL A;  3OY8 A;  1NA1 A;  2WWU A;  3RZZ A;  2VC9 A;  4WV8 A;  5FZO B;  3D82 A;  1PX3 A;  4AAP A;  3HBZ A;  3WDU A;  5H9P A;  2GNB A;  5FO9 B;  5IVE A;  5HV4 A;  1MAC A;  3WF0 A;  1LGB A;  1CZT A;  1KDM A;  2VMH A;  3THP A;  1OOP B;  3NST A;  1V6O A;  4QGN A;  5D8A B;  3WEZ A;  4ISR A;  4NHX A;  1QWR A;  2XVL A;  3AVR A;  5F5C A;  5FYV A;  3AVS A;  2D43 A;  4PHZ A;  5AVA A;  2LM3 A;  2VOV A;  3D3A A;  4CP2 A;  1K5M A;  2QTW B;  3GYD A;  1RUH 1;  3WCS A;  4FP3 A;  3GZU C;  3MLK A;  4LBN A;  2ZAC A;  3BVC A;  5BNP A;  4UFH A;  5FZ7 A;  3VBU B;  2BGP A;  4D0Q A;  2X5I C;  3FFZ A;  4RFT 0;  3ILF A;  4OCT A;  4OMC A;  4K6B A;  4UI9 L;  3U1X A;  4BHP A;  1CAX B;  4YZ3 A;  3WW4 A;  4N7U A;  1AR9 3;  1PNF A;  3K3N A;  3I54 A;  2ZHK A;  5J36 A;  4IGP A;  4K3U A;  2HJI A;  1W3X A;  2VG9 A;  1US2 A;  2QDN A;  3J7M A;  4Q26 A;  1FNZ A;  2XBO 3;  4UYB A;  3X29 B;  4E8D A;  2D3R A;  5GLT A;  1YI7 A;  2Z69 A;  4Q4Y 1;  4XYX A;  3T2Q A;  2VZP A;  3LA2 A;  3OBR A;  3WW1 A;  1IPJ A;  3C7F A;  2GDF A;  3Q9O A;  1S0J A;  4BLJ A;  1MZE A;  1S2K A;  2RDN A;  4LKS A;  3VBH B;  3ZSJ A;  3OCP A;  2GAU A;  3ZYJ B;  1NE4 A;  5FZ3 A;  2JXA A;  4IV1 A;  3GHN A;  2JEM A;  4A2U A;  5IK7 A;  2Y6H A;  5CYY A;  1QNY A;  1QMJ A;  2BNO A;  3AL5 A;  2QQJ A;  2GP5 A;  2FZ2 A;  1ASJ 2;  4HZF A;  2VZS A;  5C3Q A;  2VJX A;  3OYW B;  3NJV A;  1LR5 A;  1GNH A;  1RTV A;  1YUD A;  5FP8 A;  1UX6 A;  2P6C A;  4Y33 A;  3V56 A;  4R4Z A;  2RM2 2;  1PZ8 A;  5JI7 A;  2XKP A;  5FP4 A;  2PHT A;  3RJ2 X;  2LS6 A;  1QJX 3;  4WZF A;  1SPP A;  4AFA A;  3M3O A;  3N9O A;  3R6S A;  2ZCW A;  1K5M C;  1ENQ A;  3IDA A;  4XJW A;  5KHI A;  3TN9 2;  5BNP C;  4RS5 A;  3MFC A;  4IER A;  4XUO A;  1CGP A;  3PUA A;  4KWU A;  5F6L B;  3NKG A;  2X09 A;  1NXM A;  1X8E A;  3ETQ A;  1IPK A;  5ACA 3;  3MIG A;  4QX7 A;  1UN1 A;  4GB3 2;  1GWL A;  4MAD A;  5F3G A;  5J96 B;  4HVQ A;  4J6G A;  4CCD A;  4NIG A;  1UXZ A;  2ZJC A;  2LUW A;  3PVO A;  4MGY E;  4I0B A;  3K77 A;  2ZGL A;  3MPB A;  4IND A;  4WM7 B;  1JYI A;  2PYT A;  5HV0 A;  3POY A;  2RS1 2;  3RSJ A;  1ZBE 1;  1OT5 A;  2TBV A;  2OUH A;  4KL1 A;  2YPD A;  3U4S A;  3VKM A;  5FWJ A;  3G7D A;  4CU6 A;  2G19 A;  3AYD A;  3DV8 A;  3FHQ A;  3GCX A;  4WVM B;  1STM A;  1TME 3;  2OA2 A;  2X53 S;  3JU9 A;  3LFI A;  2GH2 A;  1AR8 1;  3OEB A;  4IV1 C;  1OLR A;  4J1W A;  1W8N A;  2GSY A;  3T4H B;  5C7G A;  3PDQ A;  1ZNP A;  4HMZ A;  5C70 A;  2W08 A;  1ACC A;  3JCI A;  1K12 A;  1JZ6 A;  1UO9 A;  4LO5 B;  5A6Y A;  3OGG A;  3ITQ A;  4NPL A;  1SBD A;  2P34 A;  4RR3 B;  4QPG B;  4EWA A;  3OEA A;  4RFR B;  5KXB A;  5DPN A;  4Q4X 1;  3TEW A;  3N9M A;  1ULO A;  1AVB A;  3VZK A;  3LEI A;  4DUV A;  3KVA A;  4A7K A;  2DUP A;  5EQU A;  4RS5 C;  1S55 A;  5FZ9 A;  4CDX B;  1SQ4 A;  2O0O A;  4Y4R A;  4CU7 A;  4QXB A;  4RYD A;  4Q2F A;  2R04 1;  3VBF A;  4H3W A;  5K9Y A;  4QXK A;  4QGM A;  1A6C A;  1GP5 A;  4Y5S A;  2A75 A;  2EXK A;  1UPI A;  1HXS 3;  5A3O A;  1I9R A;  5CZK A;  2WA3 A;  1OD3 A;  3N3H A;  3ZN5 A;  2R1B A;  3LE0 A;  3WR0 A;  4ET7 A;  1XYO A;  4M3C F;  4FPO B;  4OZO A;  4RSU A;  3B5L B;  3NAP B;  4Q0Q A;  1GAN A;  3V0A B;  3H8O A;  1H30 A;  1Y9G A;  3CKH A;  4H14 A;  4P02 B;  2GMM A;  1NKG A;  2UU8 A;  5FZ4 A;  1JYX A;  4QX2 A;  2RJ2 A;  1LED A;  1BXH A;  1GV9 A;  2VNR A;  3DL3 A;  3U75 A;  2VTF A;  4EV0 A;  3PIJ A;  2RDS A;  2QZ2 A;  1QKQ A;  4FFI A;  4HKO A;  2RDR A;  4O9G A;  4QAW A;  2GU9 A;  1O6U A;  4JKL A;  3LPF A;  5ANN A;  4CU9 A;  1X7N A;  1JS9 A;  3BTY A;  2Z42 A;  3S7E A;  1W39 A;  5A1A A;  2FHR A;  3WNX A;  1DDL A;  1IPS A;  4LIV A;  3B9I A;  2PAM A;  5IVY A;  3RYK A;  1Q8Q A;  2G9G A;  2W1W A;  1RUI 1;  2VMC A;  5F5Q A;  2WYF A;  4BQ2 A;  1LCL A;  2BGO A;  3ZPY A;  3THD A;  2WRA A;  4NHL A;  1AR6 3;  1RUG 1;  4UOJ A;  4Y24 A;  5C3O A;  1C5I A;  2GH8 A;  3O14 A;  1PIV 1;  2JE9 A;  5FXZ A;  1LOE A;  2Q0A A;  4Z2W A;  1VMJ A;  2DFB A;  2E31 A;  4XHB A;  4ASL A;  4C91 A;  1ODN A;  5FYC A;  3O1P A;  1WBL A;  4CUB A;  1R1Z A;  3LOB A;  1QJU 3;  5E6H A;  4C90 A;  5IW0 A;  3ZFE A;  1DGR A;  2VNG A;  5C3S A;  3EJK A;  5FAX A;  3VBF C;  1LNS A;  4B29 A;  3O1R A;  3VBR B;  2FDG A;  1ZZ8 A;  4QX5 A;  5I0R A;  1L7L A;  4IUG A;  3POF A;  2J1A A;  5FPA A;  4QU2 A;  4LHS A;  1HX6 A;  3KV6 A;  5CKQ A;  4CCJ A;  3T0A A;  3S57 A;  2YU1 A;  3FBY A;  2E33 A;  3MFA A;  1U5Z A;  2MNG A;  3CNA A;  1OLM E;  1K5J A;  2CGN A;  4GZ9 A;  1N3P A;  4Y4Y A;  2DYC A;  3BIW E;  4LUM A;  5F3C A;  3VB9 A;  3ON7 A;  4FPC A;  1W6P B;  1IQA A;  4Y1Z A;  4AED A;  1QJY 1;  1ZZ7 A;  4DXS A;  1BBT 3;  1US3 A;  5EJZ B;  5H9R A;  1RMU 3;  3UGF A;  3KV5 A;  4W6X A;  1W6M B;  1J59 A;  1CX1 A;  2VMI A;  1S2E A;  1LEC A;  1EV1 2;  1XSQ A;  3EQE A;  3GXU A;  3HNB M;  4YPJ A;  4DXT A;  4Q0U A;  3I59 B;  3A21 A;  3LIG A;  5T5J A;  3T2T A;  4BJ0 A;  1CJP A;  1HRI 3;  3HJR A;  2PTM A;  1VBD 3;  1VE0 A;  1HW5 A;  3RI8 A;  2VOX A;  4AVB A;  2DDU A;  5DZE A;  2QJV A;  4G3Y C;  2BU9 A;  4A45 A;  2R06 1;  2CU5 A;  3AKT A;  3ZN6 A;  5B4N A;  4LHK A;  4HN0 A;  3CJI A;  4IE5 A;  3IZO A;  3KM5 A;  2ZGQ A;  4PIY A;  2DFC A;  3J4U H;  4N8M A;  2LAL A;  3T0D A;  5FPB A;  3ZXD A;  2D6O X;  5DAB A;  5T54 A;  5KC6 A;  3J8F 1;  2UY8 A;  2Y6J A;  4FPH A;  4PCR A;  4YM2 A;  5T5P A;  2WZP P;  3UJO A;  3AYC A;  1I5Z A;  1Q43 A;  2J42 A;  5DAW A;  4GQ7 A;  4OQ8 A;  2A73 B;  1ZRE A;  3ZFE C;  1ZBA 2;  3DF0 A;  3K3O A;  3J7L A;  4D7T A;  1YQ5 A;  3APB A;  2ORX A;  2WO7 A;  3NKT A;  4CDX C;  1SG3 A;  1XU2 A;  3ZXJ A;  1WCD J;  4E27 A;  3ZDV A;  4WVV A;  2XOM A;  4BQ4 A;  3DUI A;  3CF6 E;  3TB0 A;  3I8T A;  4CCC A;  1C1F A;  5A32 A;  4TN7 A;  2A5Z A;  4COV A;  1UOB A;  4AED C;  3HBK A;  3CO2 A;  3HNM A;  1POV 3;  5F1R A;  4IEZ A;  4JDM A;  5GZD A;  4XF9 A;  4YG6 A;  1YCI A;  2RG4 A;  1AR7 3;  1OQE A;  5F9T A;  3VKO A;  4Q1P A;  4E4D X;  2X8K A;  1E5R A;  1QQP 2;  4ASK A;  5JZG A;  1UZ0 A;  4OZX A;  2ATF A;  4WVW A;  2ZXQ A;  1RUD 3;  4NJ4 A;  2MEV 2;  4FXK B;  1HDK A;  3AMP A;  4QHO A;  1EUT A;  4P14 A;  3H3U A;  4YG0 A;  2GP3 A;  1H6X A;  3CJI C;  4EN6 B;  5DUW A;  1OH3 A;  1ZA4 A;  4XXP A;  4BQ5 A;  1UPS A;  5F2S A;  2ZGK A;  4XBQ A;  1CPM A;  2CGP A;  5SV5 A;  4WM8 A;  2RHP A;  5CIR A;  3BIE A;  3D4K A;  3RDI A;  4FPY A;  4KGG A;  4OUL A;  4LE3 A;  4MGK E;  1O5U A;  1HB3 A;  5FZK A;  3TNP B;  1DZR A;  5EJ3 A;  4GIQ A;  4UW3 A;  2PAK A;  5IYY A;  4Z2A A;  1W99 A;  2RS5 1;  2OPK A;  4A3Z A;  4F8A A;  4XVH A;  5GLZ A;  4PBO A;  1TEI A;  4FOQ A;  2XWJ B;  2ZOE B;  4L0P A;  4ZPI A;  3WQ7 A;  2CGO A;  2RS3 2;  4K21 A;  1OFN A;  4HK8 A;  4COU A;  4IE7 A;  5JOY A;  4XHX A;  2E51 A;  3D8C A;  1AXZ A;  3M7A A;  3VKL A;  1ZX5 A;  4PIX A;  4Y22 A;  1GP4 A;  5ABJ B;  3LKJ A;  5FJH A;  2X29 A;  3K4A A;  1OF3 A;  2EVX A;  1QOS A;  2JIG A;  2D40 A;  2BVV A;  2WS9 2;  3K51 A;  4NO4 A;  3VZL A;  3JD7 1;  5L19 A;  1W6Q A;  1BEV 2;  2J1R A;  3IMN A;  3J7H A;  5FY4 A;  1N3Q A;  4LPL A;  1X9P A;  4NIA A;  1ZRF A;  2GC1 A;  1GWK A;  5FPV A;  2NPI A;  2FDJ A;  4UT5 A;  5FUP A;  4Z1V A;  2WT1 A;  4HVO A;  3OG2 A;  4EE2 A;  5JZG C;  1HRV 1;  1NCR B;  3FLT A;  1V9U 2;  2JDH A;  2JB8 A;  3OB8 A;  3O12 A;  4PIZ A;  4HG6 B;  5CIS A;  2YC4 A;  2QQN A;  2ZKL A;  4QXH A;  4KWL A;  1E5S A;  5GJ6 A;  1G86 A;  2E32 A;  4Y3O A;  1VAM A;  2ZEW A;  5LRS A;  1JU4 A;  2YGL A;  4ZZ5 A;  1QDO A;  4CDW B;  3WDW A;  2ETE A;  4YNI A;  2YRO A;  1RUJ 1;  3UT0 A;  3T1L A;  1PVC 3;  5C3P A;  2IVJ A;  1NLQ A;  1ULG A;  4MXW B;  3UL2 A;  4FTE A;  3FLP A;  1WME A;  3H1W A;  1AX1 A;  3IDE A;  5GLU A;  4ARY A;  1FPN 3;  4CUC A;  4UWD A;  1RUC 1;  3B01 A;  1WZX A;  2F6B A;  5C33 A;  3RZG A;  3V64 A;  1ASJ 3;  1B35 B;  2ZGS A;  3LEM A;  3I3M A;  5DG1 A;  4K9S A;  3DPR A;  3OGR A;  3ZYB A;  1V6K A;  4E2G A;  1AX2 A;  4KNC A;  2VD7 A;  4KU8 A;  4PDW A;  1R09 3;  3URF A;  1H4H A;  2C1F A;  3KCX A;  2J1T A;  3MO4 A;  1VBC 2;  5FP7 A;  5FK8 A;  3U14 A;  4COY A;  4Z8B A;  2LRO A;  2BP6 A;  1CN1 A;  3PU3 A;  5L36 A;  1MS9 A;  2W46 A;  3GAL A;  1CX4 A;  2QQW A;  5LEJ A;  1H2M A;  2JE8 A;  4Y20 A;  4YGE A;  1UY3 A;  1UOF A;  1W6O B;  3ZMN A;  2D93 A;  4JGZ A;  5T50 A;  5FOB B;  5T5L A;  3EBR A;  1YFY A;  3BOW A;  3S0M A;  4X8N A;  1O4Z A;  2HWD 3;  1IS5 A;  1A78 A;  4O61 A;  4JDO A;  2ZX0 A;  2SLI A;  4IDZ A;  4MZU A;  3I2O A;  4MGT A;  4ZXK A;  5ABJ A;  3NV2 A;  4BQ1 A;  4C0H A;  1PMH X;  2HWE 1;  4S2F A;  4RQP B;  3JBG 1;  1FX5 A;  1XOY A;  3AX4 A;  4IEU A;  2UWC A;  1T2X A;  3POS A;  4LBM A;  2UUR A;  3LDK A;  2P5B A;  4D6R A;  2RS1 3;  3GHM A;  3CEW A;  2XL7 A;  3OUJ A;  1N47 A;  1QGL A;  1UMZ A;  3P6B A;  3TBD A;  1H8T B;  1O4T A;  2PHF A;  4LR4 A;  4QB1 A;  2MHF A;  2Y33 A;  1U0A A;  1SLI A;  3WNK A;  2R6Q A;  2HBU A;  1JYV A;  4AE2 A;  5A3L A;  2CDP A;  4NR1 A;  2RMU 3;  3JB4 C;  3ZO0 B;  5JUV A;  2VZR A;  1MS0 A;  4BCU A;  1SLB A;  2XDV A;  3M3E A;  5IUQ A;  3HPN A;  4QQP A;  4TZD A;  3N4M A;  3DPR C;  4AOC A;  1WWY A;  1X8M A;  1W2O A;  1ENR A;  3I2F A;  1W8T A;  4PDW C;  1LTE A;  4QX3 A;  1JOD A;  2P3J A;  5L7O A;  1KFU L;  5DAQ A;  1B35 A;  3B00 A;  2YFZ A;  5E88 A;  3TWI A;  2XH6 A;  1EUU A;  4ISQ A;  1CES A;  2WKK A;  3FX3 A;  3FN9 A;  4QD2 A;  4BME A;  4CP9 B;  1NXD 1;  1AYN 1;  1W8H A;  3L2H A;  5JIU A;  2ORZ A;  5I8T A;  3LWC A;  4WVZ A;  5DDJ 3;  2ZX3 A;  5GZE A;  4FTS A;  1DHK B;  2HWC 3;  2HLE A;  5JXG A;  4LBQ D;  1WBF A;  1UWW A;  1XQN A;  1FMD 1;  2JG8 B;  4I09 A;  4D6S A;  4XJZ A;  5HCB A;  5ABJ C;  4O7X A;  4R8H A;  2WNU A;  3T1M A;  3VDD B;  1OXC A;  1RUH 2;  1DFQ A;  4I02 A;  5A7P A;  4HFS A;  3PLQ A;  2FCT A;  5EJ1 B;  5J48 A;  3LAG A;  3LFM A;  3N9Q A;  4RGK A;  3FUO A;  2NMN A;  3N35 A;  4WZC A;  2G1M A;  4H7L A;  1QXP A;  5AFB A;  2XUM A;  3IIA A;  3RZM A;  5FZD A;  4Q4V 3;  2VZ3 A;  2D6L X;  1MVQ A;  5FOJ B;  1XE0 A;  2BEO A;  4ORF A;  1H1M A;  5FDB A;  4LO4 B;  4FT8 A;  1UL9 A;  1GZC A;  1ST8 A;  1VMH A;  1OA2 A;  1H8T A;  5DG2 A;  2YZ4 A;  4FOV A;  1NY7 1;  5GAL A;  3T4V A;  2VUD A;  3UES A;  4FFF A;  1NLS A;  2MEV 1;  2NQY A;  1S0C A;  4Q4Y 2;  4DPN A;  5LA0 A;  3D5O A;  4LJH A;  3KQR A;  3N7K A;  3RQ0 A;  4AVT A;  3LPG A;  4Q4W 2;  2JDP A;  3HT2 A;  4CPB D;  1B35 C;  1SZB A;  2WNV A;  3NL1 A;  1S0F A;  4XDO A;  1IGO A;  2V4A A;  1KRI A;  1MZ5 A;  4YVS B;  1Z78 A;  4OHX A;  2D97 A;  4LLO A;  4OI2 A;  4R52 A;  4KMQ A;  5L9V A;  1Z7S 1;  3OPW A;  1AYM 3;  5C6C A;  1N1V A;  2FCV A;  1WUV A;  2VEC A;  3RYP A;  4FOW A;  5C8W A;  2DVA A;  5GM0 A;  4HXC A;  2WNU C;  2JDN A;  3M2M A;  2YG0 A;  4TYS A;  4YGC A;  4BQ3 A;  2BJS A;  2DVG A;  2V72 A;  4PLM A;  4XIK A;  2JDU A;  2GC0 A;  2JG8 A;  1M06 G;  1RHI 3;  5CA6 A;  2W95 A;  4YSF A;  4IE4 A;  3KV9 A;  5LBF A;  5A1L A;  1H1A A;  3JQW A;  3K46 A;  4KGQ A;  5E89 A;  3KGZ A;  5I8S A;  4GH4 B;  4AI0 A;  3T3Y A;  1BEV 1;  3O0X A;  4NII A;  3WQB A;  4QX8 A;  2J22 A;  1SEF A;  2ADD A;  2D5F A;  2P3I A;  4LKD A;  3VBS B;  5I93 A;  1QNW A;  1JBC A;  1XU1 A;  5FY8 A;  5AC9 3;  3A23 A;  3FMG A;  1ZM1 A;  4LIT A;  2CY6 A;  1VBE 1;  5EFU A;  4NAM A;  5ANQ A;  3GZA A;  1H8T C;  5FMC A;  1S0D A;  2DUO A;  2FD8 A;  1G9A A;  1W2U A;  5HXM A;  2E7T A;  4HSL A;  4BMB A;  1ZBE 2;  1QF3 A;  4QDQ A;  5JOZ A;  4XZP A;  3ZFG B;  1A8M A;  2CDO A;  5A3P A;  4YRD A;  1R64 A;  2XXZ A;  4N9I A;  4XAA A;  4M3C B;  1DLL A;  5CFD B;  3NV1 A;  4R4X A;  5F7U A;  2WNV C;  5BV6 A;  1AR8 2;  4LBQ A;  2BWC A;  1ULE A;  1MEC 3;  2A6W A;  4NUB A;  3ZYI B;  1D2S A;  5BYN A;  1NUK A;  4JC1 A;  3ME2 A;  4Y1Y A;  2GC3 A;  1BVP 1;  4JZR A;  4CU8 A;  5FMD A;  5C9A B;  3ACF A;  5BY5 A;  4AR2 A;  1YFX A;  5ERL A;  2CWS A;  4N43 B;  4BOW A;  2WAO A;  1L3J A;  4AG4 A;  2PHR A;  2HYX A;  1PO1 1;  4HLT A;  4Q4X 2;  1RUE 1;  5JOX A;  1L7Q A;  1GMM A;  3E1F 1;  4QXC A;  5SV8 A;  2WA4 A;  4X8P A;  4AYU A;  2JG8 C;  3LA7 A;  1AR9 1;  3NQH A;  4LMF A;  2VZU A;  2R04 2;  3KV4 A;  3S30 A;  3WQ0 A;  5BNO B;  4GMP 1;  2YXS A;  5L9R A;  2W5F A;  1H0B A;  5D1I A;  2D6M A;  4B8E A;  2BOJ A;  1LHU A;  1JHN A;  2PHU A;  5A7N A;  2XBO 1;  2YHJ A;  3IT8 A;  4LA2 A;  2Z2S B;  2I2S A;  2LRP A;  1D4V B;  5IFP A;  2GC2 A;  1JW6 A;  3K75 B;  1GQP A;  1OUS A;  4N7I A;  4NMI A;  2YMZ A;  4GH4 A;  5DAP A;  3WP4 A;  4NRO A;  4MET A;  4XAB A;  1H9P A;  4CVU A;  4TSV A;  3AMH A;  1I5P A;  4CXW A;  2VL4 A;  5IJR A;  4AZZ A;  1QXJ A;  4CDQ A;  3ACL A;  4LA3 A;  4UFI A;  5A7O A;  5IWF A;  2XQR A;  1CZV A;  1UU6 A;  3MPP G;  5LA9 A;  5L73 A;  3ZXF A;  5KHJ A;  3LA3 A;  2Y26 A;  1SFY A;  3VHN A;  3DYM A;  4Y1V A;  1UIJ A;  1RUI 2;  2XLG A;  1FXZ A;  3KSC A;  1ND3 B;  1W0N A;  2AYH A;  4IET A;  5I8Y A;  1C8M 1;  3W20 A;  2A1X A;  4QU1 A;  1RUG 2;  3BU7 A;  3RNS A;  3VDA A;  1LHN A;  3VD7 A;  5IAX A;  3POJ A;  3ZSE A;  4OUS A;  4OHY A;  1GIC A;  3WX5 A;  1RED A;  3N7J A;  4L8Q A;  2AH2 A;  1CZS A;  2RS3 3;  2V09 A;  4UFJ A;  2NZ9 A;  5ACA 1;  1D4M 1;  3A0N A;  4XQD A;  5HCF A;  2WNE A;  2BYV E;  5LBC A;  3U11 A;  4FO9 A;  4YWA A;  1W8W A;  2W92 A;  4QHZ A;  5F2W A;  3MDP A;  4QPW A;  1ZRR A;  1COV 3;  1LEN A;  3E5U A;  3KGL A;  1N3O A;  5FXV A;  3B93 A;  4RA0 A;  4D8M A;  3B69 A;  4KI5 M;  2XJU A;  2C4X A;  4W50 A;  2XJQ A;  1N1T A;  3C7E A;  1PZ9 A;  1C4R A;  3AM2 A;  3LDB A;  5T55 A;  4YLZ A;  1W06 A;  2F4L A;  4V2W A;  4GH4 C;  2WWJ A;  4B7K A;  1WCU A;  3ZDS A;  5K8S A;  5K7P A;  5FMO L;  1WMD A;  1XNB A;  2KR2 A;  3VBS C;  4XUT A;  3CBN A;  1IS4 A;  1QJY 2;  1RVF 1;  5FY9 A;  5IAV A;  3RI9 A;  4HVR A;  3HVD A;  1UXX X;  3WDT A;  4CDQ C;  1JU3 A;  2OII A;  4CEW A;  3CLP A;  3WUD A;  2BBV A;  1R1A 1;  4AFM A;  4RD7 A;  2QDR A;  3MEP A;  2VPV A;  4XJA A;  3MW4 A;  4ERO A;  5FO8 B;  4BWO A;  4FPJ A;  4DQA A;  5TSW A;  1H2L A;  2R06 2;  3GZT B;  3N9L A;  2R07 3;  3WHT A;  4DEQ A;  5FYB A;  1QH6 A;  3BPZ A;  4IQP A;  1MS3 A;  3Q8E A;  2ENR A;  4JX0 A;  3Q8C A;  4Q0P A;  4NIH A;  3PJQ A;  3AZV A;  1AHS A;  2ARE A;  3QBQ A;  3H1M A;  1J58 A;  1VRH 1;  5JVV A;  3AK0 A;  3AP7 A;  1WD4 A;  5AVP A;  4Q4W 1;  1JI6 A;  3J8F 2;  1KS4 A;  2Z79 A;  4IEO A;  1A8D A;  5FXX A;  4XTM A;  1E5H A;  4IV3 B;  3O1T A;  1W9W A;  5KHK A;  2BRT A;  4N53 B;  4Q27 A;  1X82 A;  2NN8 A;  4MGS A;  3ZIW A;  4YZ2 A;  4RHV 3;  5CBL A;  3JXS A;  1CIW A;  2BNN A;  1H9W A;  2WFF 1;  1JOJ A;  4NWW A;  4BB3 A;  4EZ4 A;  5JOW A;  3FL7 A;  1R08 3;  3QCW A;  3HMY A;  3RGB A;  4OUM A;  1PGW 1;  3VD3 A;  5IVF A;  1XE8 A;  5FZO A;  3WF2 A;  1F35 A;  4MHU A;  2AEZ A;  3PHM A;  2Y64 A;  4ZON A;  2XJR A;  4GWJ A;  5FYZ A;  1OBN A;  1LHV A;  1FOD 1;  1OOP A;  4DIQ A;  4COZ A;  4XPV A;  3WG1 A;  3RZK A;  5D8A A;  1MS4 A;  3MIF A;  1LKN A;  2ZEX A;  2BUK A;  3N36 A;  4P08 A;  4URT A;  5E16 A;  5F37 A;  1ZRC A;  5FBJ A;  1JN2 P;  2B8M A;  2ZS6 B;  5A33 B;  3THT A;  4E4H A;  1T6G C;  1W2N A;  4UF0 B;  4CEW C;  3KD4 A;  1POV 0;  4K20 A;  5BNQ A;  4QWN A;  5LZ6 A;  3S7I A;  3VBU A;  4SLI A;  2PQS A;  4RGA A;  2FBE A;  4ZU5 A;  3O1S A;  2VQA A;  3BOD A;  3MIE A;  3UK9 A;  1CAX A;  3WXP A;  3O0W A;  2W2I A;  4AXO A;  1DYP A;  2JE7 A;  5FYY A;  1PGS A;  1NCQ B;  2NYY A;  3UKN A;  1J84 A;  1EAH 1;  5LBB A;  2Y6L A;  2J7M A;  1GOG A;  2BV4 A;  1HKD A;  3DYP A;  1VBB 2;  2VBD A;  3AYA A;  4K7J A;  4PF5 A;  4F83 A;  1QJU 1;  3U10 A;  5KXD A;  3H50 A;  2OQ6 A;  4XET A;  2C26 A;  2PAE A;  1HB1 A;  3AZW A;  3BKZ A;  2H6C A;  1XC6 A;  3NWK A;  5JCT A;  2W1U A;  1FNY A;  1MQT B;  1IKP A;  1KGY A;  2HEY F;  2JD9 A;  3VBH A;  2ZX1 A;  1G7Y A;  1O7F A;  3ZSK A;  5A6Q A;  4BZ4 A;  3DN7 A;  1YIP A;  3BAL A;  2OXB A;  2RS5 2;  2ZGR A;  2BDR A;  4M4P A;  4BYY A;  5JPM B;  4AI8 A;  2VO5 A;  2F17 A;  3IDB B;  2W1Q A;  3SC7 X;  3M8L A;  4MUV A;  4OQ9 A;  1RUH 3;  2CV6 A;  4JHZ A;  3OYW A;  2Y34 A;  1VPH A;  3I2I A;  4ZZ8 A;  3IKW A;  4BXS V;  1OOP C;  2R32 A;  4QPI B;  1KEX A;  1U5Y A;  5D8A C;  4BQW A;  1JZ2 A;  2HH9 A;  2XJP A;  3GCW A;  1QEX A;  1HRI 1;  2HYK A;  2CSG A;  3JD7 2;  1YRZ A;  2BVB A;  5K0U B;  4OI0 A;  4HET A;  1G6N A;  4NPM A;  1AL2 1;  2G4I A;  1DYK A;  4M0H A;  4AGV A;  4AEK A;  3B02 A;  3VBU C;  1UD1 A;  5FZ0 A;  3VL9 A;  2E7A A;  4HT1 T;  2HEV F;  4LE4 A;  1HRV 2;  4AVC A;  4AW7 A;  1AUY A;  3KF5 A;  5I0U A;  5C5T A;  3N7M A;  4CDU B;  4DFS A;  2BW8 A;  4Q4Y 3;  1O3Q A;  3TAY A;  3I49 A;  3BUC A;  5GLV A;  2FMD A;  4OHV A;  3WLU A;  4BDV B;  3T30 A;  4AQ2 A;  4XUP A;  1RUJ 2;  1UX7 A;  3N9P A;  1C28 A;  4EN0 A;  3FJS A;  3VN4 A;  1W2A X;  5DQ0 A;  2A70 A;  1BCX A;  4WM7 A;  2HEW F;  1ULC A;  2JG9 B;  4BA6 A;  5LB6 A;  2X05 A;  5EHD A;  2IXK A;  3RFR A;  1RUC 2;  2WL1 A;  1REF A;  3SKV A;  4JRL A;  1GUI A;  4WVM A;  5FPX A;  3VBH C;  2RV9 A;  2E63 A;  2FQP A;  1FAY A;  2O14 A;  3KVB A;  3H1Y A;  1MQT A;  2H6B A;  1F31 A;  4DOU A;  4Q0V A;  3SCG A;  4CE8 A;  3MUZ 1;  5E1R A;  5A3W A;  5GKA C;  1VAV A;  1YFW A;  1W0P A;  2E7Q A;  1GLH A;  3FUQ A;  4RR3 A;  4QPG A;  5LY1 A;  2O8Q A;  2GME A;  1AR7 1;  1RXF A;  2DCZ A;  2GN7 A;  2WZR 3;  4PLO A;  1UYZ A;  4GWM A;  2D6N A;  4QPI A;  1RUD 1;  4CDX A;  3RWK X;  2JEC A;  4BM8 A;  3OJB A;  2ARC A;  3ZYG A;  3CZU A;  1L7R A;  1SHW B;  1Y7B A;  2CHH A;  2ZTN A;  3HN1 A;  3PTY A;  4OI4 A;  4E8C A;  1BHG A;  2A6Z A;  5C4W B;  2HWE 2;  1H1I A;  2A3X A;  3JBG 2;  4JKM A;  5K0U A;  1VB2 A;  5F8P A;  5JWP A;  4PQQ A;  5HI0 A;  3HIF A;  5H9S A;  3UKV A;  1JUH A;  4R9B A;  4DXR A;  3SH5 A;  5A7W B;  1FT9 A;  4CXY A;  3LEK A;  3NAP A;  3V0A A;  4HPK B;  1TQ5 A;  2WO3 A;  1GQG A;  2Y0I A;  3DXT A;  5FZ1 A;  3I2J A;  2W87 A;  3ILR A;  1RB8 G;  2QE3 A;  4AHX A;  5IHR A;  5A80 A;  4CDU A;  1LHW A;  4DUW A;  4WM7 C;  1AR8 3;  2Q8C A;  2B5H A;  1TNF A;  2HWB 3;  1CD3 G;  4Y1X A;  3IB3 A;  4I01 A;  5LAS A;  4XDP A;  5LAT A;  1D2Q A;  3VUO A;  4AHY A;  4EN8 B;  3QH7 A;  1PO2 1;  3E6C C;  2VTX J;  3J26 N;  3OD0 A;  1SCR A;  5EXO A;  3WNP A;  4A4A A;  5FYH A;  4YZ4 A;  1DGW X;  4A6O A;  4FBF A;  4MGQ A;  1MQT C;  3L2Y A;  3I7D A;  4Q4X 3;  5JLV A;  2IXH A;  2RR1 3;  3ZXK A;  1H8V A;  4DY5 A;  1Q8O A;  2GMP A;  1LHO A;  2FDH A;  4UXA A;  4XFI A;  4YW5 A;  5FWE A;  1OVP A;  3USU B;  4RR3 C;  4QPG C;  1AYN 2;  4FAH A;  1A3K A;  2VZQ A;  5CKN A;  1ZZB A;  2J1S A;  1V6I A;  4XF3 A;  5FV3 A;  4W8J A;  4A7Y A;  3KCC A;  5CU1 A;  2BER A;  3LSD A;  1D7P M;  4AFB A;  1WW4 A;  3MGU A;  3WDV A;  2VVF A;  2XL9 A;  4QM9 A;  3WDY A;  1FMD 2;  4JRA A;  4QPI C;  5FZI A;  3QLQ A;  3RG0 A;  3WV6 A;  3ZLI A;  1FV3 A;  1GQH A;  1PHM A;  1WW6 A;  4XOG A;  4AVS A;  3VBR A;  5FPU A;  5M0T A;  5K0U C;  2OVU A;  3WNO A;  2BNM A;  1PVC 1;  1ALY A;  3NAP C;  3R4D B;  1WLC A;  3ECQ A;  1ND2 B;  2ARX A;  4LK7 A;  1FPN 1;  1YQ8 A;  5JSR A;  4IEP A;  4AL9 A;  2VCB A;  4DS0 A;  3DCQ A;  2HKX A;  1W90 A;  4P9G A;  4B1M A;  4CDU C;  5CG9 A;  1W6P A;  1J1L A;  1CAW B;  2EIE A;  4YG3 A;  4HPK A;  2EA7 A;  4P9W A;  2C24 A;  2ZZJ A;  4XBN A;  2YGM A;  2QQL A;  3EXU A;  1W6M A;  1RUI 3;  2WWS A;  3NJZ A;  4JTN A;  4PJY A;  2ZGP A;  1RUO A;  1NY7 2;  3LOI A;  2RJL A;  4V1P A;  3M3C A;  1MZF A;  1UQX A;  1WLW A;  3ES4 A;  3POE A;  3I59 A;  3NNL A;  3OUI A;  1RUG 3;  2JG9 C;  2FDF A;  2BPA 2;  3I3B A;  3NJY A;  2QUO A;  4AAX A;  4YW4 A;  1LOA A;  1XE7 A;  4QGL A;  2UWB A;  3AZZ A;  4RGG A;  1PIV 3;  1VBB 1;  4YYO A;  3VV1 A;  3VD9 A;  1QIQ A;  2OX0 A;  5FK7 A;  4OFG A;  3NNF A;  3DKW A;  1UOG A;  2WC2 A; 
#chains in the Genus database with same CATH homology
 4NIG A;  4JHT A;  3S5A A;  4O7X A;  4IE0 A;  3H8R A;  3O1O A;  2FDK A;  4MG2 A;  2FDJ A;  3LFM A;  3BI3 A;  3I3Q A;  3RZH A;  3RZM A;  3RZK A;  3RZJ A;  4NRO A;  3T4H B;  4IE6 A;  4IE5 A;  4CXW A;  3O1V A;  3T4V A;  5F8P A;  5DAB A;  3O1S A;  4ZHN A;  4NPL A;  3RZG A;  4CXY A;  4RFR B;  4QKD A;  3I3M A;  3BTZ A;  4ZS2 A;  2FDI A;  3RZL A;  4CXX A;  2IUW A;  4NRP A;  3BKZ A;  4OCT A;  3KHC A;  3H8O A;  4O61 A;  4IDZ A;  3I2O A;  4MGT A;  2FDH A;  3O1M A;  4ZS3 A;  4IE4 A;  3BTY A;  3T3Y A;  4NII A;  4NJ4 A;  4QHO A;  4QKB A;  4QKN A;  4NPM A;  2FD8 A;  4NRM A;  3BIE A;  3BTX A;  3I49 A;  3BUC A;  3O1P A;  3O1R A;  4NIH A;  3BU0 A;  2FDG A;  3O1U A;  3KHB A;  2FDF A;  4IE7 A;  3S57 A;  4NID A;  3O1T A;  4NRQ A;  4QKF A;  3H8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...