5GZCA

Crystal structure of galectin-8 n-crd with part of linker
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
152
structure length
152
Chain Sequence
NLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8
publication title Crystallization of Galectin-8 Linker Reveals Intricate Relationship between the N-terminal Tail and the Linker
doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 32
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5gzcA00
2A3WA 3WG1A 3DGTA 5H9QA 4YZ2A 2E7QA 4XJ8A 3ZSLA 3SH5A 4XIKA 4BM8A 5F5QA 2WT2A 1FV3A 1N3PA 2ZACA 1UZZA 1GKBA 1AVBA 2ZMNA 3PMEA 2V73A 4ZKTB 4GWMA 3POSA 3B00A 2A6VA 1A78A 4W65A 5T5JA 5CAZA 4DRRA 2WJSA 1BYHA 4YG6A 1W6MA 2A6YA 1BJQA 1G9CA 2NMNA 5FRAA 2GNBA 1UL9A 1W6OA 1AXZA 1DBNA 1FV2A 3M2MA 1IS6A 2DU0A 5CBLA 5DUXA 3IMNA 3WUDA 2AYHA 2ZZJA 3WHUA 1IS3A 2JDZA 2CYFA 4JRAA 1G8WA 2E6VA 2A75A 1QOTA 3WDUA 5SV8A 1W0OA 1WLWA 3ASIA 4R9BA 2DUPA 5IK7A 3SITA 3H0OA 5GZDA 3ENRA 1JHNA 1IKPA 1NXD1 3A4UA 1S0GA 3B3QE 1QU0A 4ZXKA 3ZSMA 5JOWA 2D3RA 2P37A 3AXDA 1FNYA 5DUVA 5JOXA 3D6EA 4H55A 1KDKA 1W6PB 5GZFA 3ZXEA 1KITA 1HDKA 1UKGA 4AVSA 1ULFA 5DG1A 1VLNA 1GZCA 3AZXA 3N7JA 2E53A 2W52A 1AXYA 1GYKA 2DWRA 4YZ1A 5DZEA 1V6MA 2ERFA 4IQPA 3ZSKA 2GNMA 3OY8A 2NMOA 4Y24A 3RS6A 1MZ5A 1C4RA 2VW2A 3MW2A 2WQZC 3AZZA 5FREA 4YZ5A 4AGRA 1ZA4A 4Y26A 4K1ZA 2ZA9A 2UWCA 2VW1A 4JCKA 4M3CA 4XIOA 1B09A 1R1ZA 2ZGSA 1SLIA 3IPVB 5KXDA 1DYPA 2DTYA 1EPWA 4K1YA 1Y7BA 1WD3A 2OUJA 4Y22B 2D6KA 5GZCA 1FATA 1LOFC 1XQNA 4XMAA 4Q2FA 3PVOA 1G7YA 4FP2A 1U0AA 3POYA 4XBQA 3HN1A 1JYCA 3OJBA 4LBJA 4C1XA 1ULDA 1LECA 4FPKA 2R0HA 4C1WA 1QKQA 3VUOA 2CWSA 2ZKNA 5AVAA 2R0FA 3NV2A 5EYXA 5CA6A 2ZMLA 4FPOB 3GNEA 4LBKA 1CONA 2VXRA 4XYXA 1DQ1A 1DZQA 1MVQA 1GLHA 1N47A 1ULCA 2EALA 2JD4A 2VY0A 4RL7A 1Z0HA 1ENQA 3A0KA 4ITCA 3TAYA 2ZGOA 2BQPA 2D6MA 2WT1A 3SH3A 3UJOA 1DLLA 3NV1A 2ENRA 1W6QB 5GLTA 4WV8A 1GBGA 2Q5TA 1IS5A 3VKMA 1WW6A 1QF3A 3LSEA 2XB6C 3ILRA 4M3CE 3RMXA 4P9YA 3WDYA 2ZABA 5T55A 3KM5A 3VV1A 1GSLA 4YG0A 1LHVA 1N1VA 4GKYA 1FYUA 2WNEA 3POWA 1QDOA 1VIWB 3UK9A 5BYNA 1GZWA 2R1DA 2WT0A 4FPFA 4XJAA 3JU9A 3V65A 5F9TA 5JLVA 1JYIA 1F9KA 4M01A 4RA0A 2PHWA 4L8QA 2UU8A 1S0DA 4YW3A 4BPZA 4BMEA 1SLTA 2EXHA 4U36A 3RSJA 1GNZA 1N3OA 3KQRA 1JXNA 1A3KA 1AXKA 1S0EA 4YM1A 3WNXA 3V0BB 1G86A 4PCRA 2GN3A 3FLRA 2DVGA 4MYEA 1APNA 3WLUA 1CR7A 1LOCA 4NO4A 5LK5A 1LU2A 2W39A 3PVEA 4M3CF 1GV9A 1BKZA 2P3IA 2C9AA 2VH9A 3V0AA 1LODA 1SCRA 4Y1YA 1Q8QA 3NWKA 1YI7A 1JW6A 1MR5A 5CNAA 2A7AA 3BOPA 1AX2A 2EXIA 5IUQA 3N3HA 4XHXA 4K20A 3T2TA 4CTEA 2TEPA 3N7KA 3OBTA 1LHWA 4GKXA 4JC1A 1PZ7A 3UL2A 1QNYA 3B9CA 1W6NB 4DRVA 2VW0A 5H9RA 4DPNA 1AX0A 1LGNA 1S1AA 1LESA 1MS8A 3ZXFA 3GALA 1LULA 3D5OA 2EIGA 1AJOA 1N1YA 1WW7A 2NYYA 1S0BA 4LBQA 1UZYA 3B01A 1KQRA 2WLQA 4NOTA 2DTWA 4Z8BA 2YXSA 3HR9A 2A3XA 4XXAA 5JDBA 1Q8PA 2NN8A 1AJKA 1F5FA 1BZWA 4YGEA 5HCFA 4LBLA 3WVJA 4FOWA 3M3QA 1LJ7A 3ZVXA 2FHRA 3WDXA 1N1TA 3I8TA 2A6XA 1ENRA 2D6LX 5E8AA 4LBMA 1LOBA 1ZM1A 2D3PA 2B7YA 5DG2A 2WSVA 1MACA 5CB7A 1N3QA 4Q8KA 2FMDA 1LHUA 1ONAA 3INAA 3OYWB 3ZXKA 4BOWA 3M3OA 3OBRA 2A71A 1SLLA 4WVWA 1LEDA 4XTPA 1O4YA 1CQ9A 2WKKA 5GZEA 5HCAA 2JKBA 2KM2A 4YG3A 2P34A 1H30A 2VU9A 5E88A 4YW1A 2ZHKA 2OW4A 4Y20B 4WVVA 1GNHA 1CESA 4OZXA 1H9PA 2DYCA 5DUUA 1S0IA 3AYAA 1V6OA 2PHUA 4Y1XA 1N1SA 1UX6A 3CNAA 2PELA 1V00A 4YM2A 1DQ0A 2CL2A 2GMPA 3ZYRA 4GWNA 3AXEA 4CRQA 1DQ4A 2R49A 4YZ4A 1DGLA 4UW6A 4FPCA 1MZ6A 1JUIA 4DQAA 3R4SA 2D6PA 4ISRA 1WBLA 1J1TA 3RMYA 1LU1A 3AX4A 4FP3A 4BQ1A 4ATFA 4YW5A 2ARBA 1SLAA 1MS5A 1V6IA 1C1FA 2GN7A 1URXA 2LTNA 2ZHMA 1C57A 1W6PA 1Q8VA 2AR6A 1JN2P 1Q8OA 3AZYA 3OPZA 2NP0A 1DYKA 2JECA 2EAKA 3RQ0A 5T54A 2D6NA 3AP9A 5KXCA 2ZGPA 1PZ9A 2A70A 1YO8A 4AVVA 2I2SA 2GNDA 3AZWA 3ZPYA 4XOGA 3MW4A 4AWDA 1LOEA 2AUYA 1QOSA 2ZGNA 4GA9A 4K21A 1KRIA 1QOOA 2ZGLA 3O0WA 2EXKA 4LBOA 3A0NA 4SLIA 1H9WA 1WD4A 4XXPA 4XTMA 1HLCA 1LGCA 1PZ8A 3IPVA 5DZFA 2ZAAA 4XDQA 5JMCA 4XJUA 4FQ4A 3USUB 4AGVA 4YM3A 2D6OX 3AK0A 5T50A 2JE9A 4Y22A 1HQLA 2DVBA 2LALA 3QCWA 1W0PA 1LHOA 1MS4A 5GALA 3SH4A 1D0HA 1MS0A 3ZSJA 2AH2A 2GNTA 1GICA 1LOAA 3W59A 3IM0A 3AZVA 5T5LA 1LGBA 3AYDA 4Q1PA 4DFSA 2YROA 2AGSA 4XJ9A 2YY1A 3FUOA 3N7MA 1DQ2A 1SBEA 3QLQA 5H9SA 3MPPG 3LCPA 2NM1A 3WCRA 1G9DA 2WSUA 2YZ4A 4FQZA 3M1HA 2D3SA 5GJ6A 2CTVA 4LBNA 4XILA 4F83A 1OKQA 2NZ9A 3ILNA 2R1BA 4KBBA 1W6MB 1DFQA 2PHXA 1W6OB 4YGCA 1KDMA 3VKFC 1I3HA 1DQ5A 3MW3A 4YZ3A 3RRDA 4R9AA 1MS3A 3APBA 1RIRA 1W6QA 2UURA 3Q9OA 4Q27A 4Y1VA 5DZGA 3M3CA 4XBNA 3NV3A 1LOGA 1SFYA 2RHPA 4FPGA 1BXHA 1G9FA 2E7TA 4P9WA 2CWMA 4GALA 4Q8LA 4XBLA 5GLVA 2A6WA 4FOQA 3IN9A 2ZGMA 2VUAA 2UWBA 3AP6A 2PHRA 3N7LA 4FOVA 1CJPA 1S0FA 4FPJA 4FPHA 3O0XA 2R16A 3VKOA 1ULGA 4UW5A 4PQ9A 5IK4A 1IKQA 1KJLA 1QNWA 4XMIA 1JOJA 1TEIA 1GZ9A 4XE9A 3I4IA 3NV4A 3ZXLA 5JOYA 1FNZA 3FLPA 3FFZA 2AREA 3AP7A 3D4KA 3V0BA 2DVFA 2ZGUA 1HKDA 4WZFA 1NLSA 2ZGQA 1DIWA 3OY8B 1VALA 3ATGA 4R9DA 1LTEA 4AGGA 3U4XA 2AENA 1QDCA 4AVTA 4M3CB 4DS0A 2DUOA 2OUHA 2DVDA 2DURA 2GMMA 5DUWA 3WUCA 1OFSA 3VKNA 3AYCA 1G9BA 1VAMA 2DV9A 1F31A 3WDTA 3FUQA 3AFKA 1Q8SA 4I30A 4BLIA 4YGBA 3HMYA 1W6NA 2P3KA 3MEPA 4Q1RA 1LENA 4LBQD 3T1LA 4BLJA 1LCLA 1HQWA 1SACA 2ZGRA 1SCSA 4YLZA 1OQ1A 2C5DA 2GALA 3RG0A 1WUVA 1WW4A 1Z78A 4HANA 1YXWA 3ILFA 3O0VA 4YW4A 3ZYPA 3OGGA 1V6LA 3SLIA 1MS1A 4ASMB 3BIWE 2JE7A 3N35A 5GM0A 3PVNA 1JBCA 1CPMA 5GLZA 4FPYA 4PBPA 1UMZA 1ENSA 2PHFA 3WHTA 4R9CA 3AJZA 2GDFA 1DHKB 2DVAA 3AP4A 3C2UA 3IKWA 4XJZA 4YW2A 5IK8A 4YFZA 5IK5A 3WDVA 1CIWA 2E51A 3BTAA 3PJQA 3T1MA 1V6KA 2G4IA 3DUIA 1I1EA 3SNMA 2A6ZA 5H9PA 5JVVA 3UJQA 3OYWA 1GANA 2CNAA 3SISA 5KXEA 1WBFA 1IOAA 4FPLA 3AP5A 2D43A 2Z42A 1WCSA 4XZPA 4CZSA 1UAIA 2SBAA 4AYUA 4Y20A 4PF5A 1LOFA 4YFWA 2D44A 2A5ZA 1D2SA 2YMZA 1GZWB 2ES3A 3AYEA 1FX5A 1YYNA 2PHTA 1UPSA 2SLIA 4ISQA 2GMEA 4FVVA 2A3YA 2DU1A 4HL0A 3M3EA 1WLCA 4FPEA 2JJ6A 4U2AA 4D69A 2HYKA 1LEMA 1LHNA 2OVUA 1S0CA 3VKLA 4BMBA 2CY6A 4Y1ZA 2XG3A 4XHBA 2P3JA 3ZXJA 1AZDA 3AJYA 2DUQA 1AF9A 3JUUA 1MS9A 2ZBJA 3N36A 3WZ1A 1SBDA 3WCSA 2V5YA 5T5OA 1AX1A 4YM0A 2ZGTA 3V0AB 2W68A 4UW3A 5EYYA 5EWSA 1WW5A 2UWAA 3WDWA 5L73A 4Q26A 4P9XA 2P2KA 1DQ6A 1SLBA 3TB0A 4XJWA 3WV6A 1RITA 1A8DA 3L2YA 3O5SA 4P14A 1V6NA 5EXOA 5GLUA 1CPNA 1Q56A 1KJRA 2ARXA 1YIFA 3B69A 5T52A 1QMJA 2YV8A 4FOYA 1WLDA 2H0BA 3FBYA 5E89A 3LSDA 3WG2A 1V6JA 1O4ZA 5JOZA 2W08A 3BODA 1RINA 5T5PA 2D7FA 5IT6A 1G9AA 3WG4A 2ZMKA 5HCBA 4LBQB 1YRZA 2ZHNA 5DXDA 4M00A 3R4UA 4UW4A 1BQPA 3WOGA 3USUA 1C1LA 3FLTA 3W58A 4TYSA 4PBOA 1SBFA 4ATEA 1IS4A 1QGLA 1SLCA 3O12A 1UN1A 1FAYA 5KXBA 4GXLA 1MVEA 3WG3A 1VAVA 2EF6A 1ULEA 2ZHLA 2ZGKA 4Y1UA 1S0JA 3V64A 5GZGA 1CN1A 1CVNA 5GLWA 4YGDA 1X50A 2EXJA 4TZDA 3R05A
chains in the Genus database with same CATH superfamily
1BMV1 1PVC2 1BEV1 2A3WA 3DGTA 1J3QA 2E7QA 4NPLA 5FZ7A 3ZSLA 2JG8B 1B35A 4XIKA 2FCUA 3CMGA 5FY7A 1OBNA 2MHFA 5C5TA 5KR7A 4CDXC 2ZACA 1GKBA 4IW3A 2BVBA 2X53S 4QWNA 3AFGA 4GWMA 2YU1A 3POSA 3B00A 4P02B 5FYTA 3MFCA 4W65A 5T5JA 1HRI1 5FJHA 4YG6A 3ZKYA 2WAAA 1W6MA 4DRRA 1BJQA 1F4HA 1EV11 2NMNA 4QHZA 1WGPA 1UL9A 2GNBA 4HVQA 2E32A 2DU0A 4Q0PA 4GQ7A 2VQUA 4HXCA 2JDZA 4AI3A 1X8MA 1SMVA 2EICA 1W9TA 2VOTA 4H7LA 4JHZA 3WNLA 3ASIA 1BBT2 1V9U1 2YUEA 1REEA 4LITA 5GZDA 4COYA 2X5IA 5EZWA 1DG6A 1NXD1 2BTVC 3MLKA 1S0GA 4ZXKA 2HBUA 5FFOC 3T08A 2D3RA 2P37A 1FNYA 2OZJA 4PJYA 5DUVA 3D6EA 3SCHA 4I2OA 3ZXEA 4OUEA 4UYBA 4JX0A 1YIPA 2W52A 3V56A 1YFWA 2PLV2 2ZEYA 4OULA 1O59A 3MF9A 4DZGA 3ZN6A 5J48A 2RS32 4N9HA 3JB8A 4JTNA 4IQPA 5C33A 2B42B 3OY8A 4Y24A 2ET7A 1XOYA 3E5UA 4XAEA 5F37A 3I3MA 5FREA 4AGRA 2XJUA 1CIYA 4JGYA 4NRPA 4WVZA 4K1ZA 2D40A 4NHLA 4Y26A 5FUPA 2VZRA 3J9SA 3H1WA 3U75A 1B09A 2XWJB 4A4AA 1PVC3 5ABJA 2R072 4QPGC 5KXDA 2C9KA 1DYPA 2DTYA 1UU4A 5LA0A 3OG2A 3EMRA 5LW9A 1J59A 1K5MB 2I45A 2J1SA 2OUJA 5FYVA 3ZDSA 1HRV3 3G7DA 3O14A 1C8M3 4DXRA 1LOFC 5GZCA 1J3RA 2G9FA 2FDJA 2UY8A 3DYOA 1QQP1 2WDBA 2HEYF 2JDUA 2OA2A 4EN9B 3WF2A 4UFJA 2MNGA 3PUAA 4QQLA 4N43A 3PJYA 4W6XA 4W6YA 1UYYA 5DAXA 1ZZ6A 1HV1A 4UFLA 5IVCA 5BNNB 5FZ9A 4UT5A 2FZ1A 1GP5A 3VUOA 4G4FA 4AE2A 1HB1A 1ND3C 4CXWA 1O3QA 4R4XA 5EFUA 3NSTA 4INDA 3ZDVA 4W6WA 4YRDA 3IT8A 4LBKA 5C6CA 4DUXA 1XXNA 2E33A 4K8RB 1D4M1 4RHV1 2QNKA 3W5MA 4RL7A 1Z0HA 4OZOA 4YYOA 5EJ1B 2BQPA 1NY72 4EN8B 2IWGB 4I02A 1K42A 2ZEZA 3KWVA 2ILMA 4XZUG 1W6QB 3I2HA 2WL1A 1OHFA 4LHNA 3VKMA 1R64A 2RJ2A 4MSVA 2LUWA 3HAGA 1DLCA 1TMF1 4NROA 3BIEA 3TBDA 1L7LA 4YG0A 4A42A 1GOHA 2OS2A 2YHJA 3POWA 3I2FA 3VBUA 1S2EA 5BYNA 1RVF2 4KH9A 5CFCB 5KC5A 4UFHA 2Y38A 3J7LA 1VBB1 3V65A 5F9TA 2Q1FA 1K3IA 4Q4V1 5LEJA 4BPZA 4K7JA 4CDUA 4GWJA 4BMEA 1RUNA 1FT9A 3I54A 3KQRA 1A3KA 1GP6A 1S0EA 2G1MA 4I0BA 4LOTA 2K9ZA 2AACA 1CZVA 1G86A 4XFAA 4JZRA 2ZAHA 1APNA 2R6QA 2Y60A 1CR7A 5HBAA 2VQTA 3D3AA 3GJAA 1RL3A 5FZOB 3ZFEC 3AL6A 2K2SA 1SCRA 3OB8A 5E16A 3A7QA 1W3VA 2OYZA 5HI0A 5GKAC 3WP3A 5IUQA 4M0HA 4XHXA 4CTEA 3WR0A 1BVVA 1W8TA 5LBBA 1QJZA 3VGIA 2VZVA 3KV9A 3GJBA 2VCAA 3UL2A 1W6NB 3WW3A 5C8CC 5F3CA 2VW0A 4AG4A 4DPNA 1MQTA 4FAHA 5A6YA 1S1AA 1LESA 4WZCA 5A3LA 4Z1VA 1HXS3 1PHMA 5D21A 3VBRC 1XE8A 1S0BA 1CAWA 2JICA 3SHRA 4NOTA 1U12A 2FDIA 2YXSA 2AZ5A 5K0UA 4LNVA 2DFBA 4B8EA 1NOVA 1JZ4A 3JQWA 4HZFA 1BZWA 4YGEA 3VZNA 1XE0A 1JU4A 2IVIB 3NJVA 4FOWA 3M3IA 3WP5A 2WINB 2HWC3 3I8TA 2YC2A 4N53B 4W50A 3NAPA 4UOJA 3KGLA 1NLQA 3PURA 5E8AA 4CP2A 1NUKA 1YHFA 2QQLA 2K0GA 1LOBA 4XFHA 3WW1A 1O3TA 5CB7A 1ONAA 2VBDA 4QHBA 2RDSA 1ZX5A 4GWIA 5HCAA 5TSWA 5J09A 3TEWA 3PVBB 1TNFA 1OURA 4YG3A 2HWE2 2VU9A 3DYMA 1AL22 2P5BA 3DV8A 1H9PA 5CIRA 2CGPA 4NN0A 5DUUA 3K3NA 3OD0A 2BVVA 2FCVA 1UX6A 3CNAA 3T0BA 1UYZA 1ZBE2 3WW2A 3PL0A 2BNNA 4YM2A 3ZYRA 5ISLA 3E5XA 4J25A 2XH6A 4GWNA 4D7SA 3B7MA 1DQ4A 5FZDA 4NHMA 1RUG1 2B4KA 2VXJA 3Q8AA 2D6PA 5SV5A 5FZ3A 1WBLA 4IUGA 3WF0A 4XF0A 3RMYA 4BQ1A 2B45X 4ATFA 4GB31 4XUNA 4I0AA 2BFUL 4YPJA 2GN7A 1SLAA 2CAUA 1V6IA 1UX7A 1URXA 4EQVA 1H0BA 5CADA 2AR6A 1XNDA 4L92A 3CDZB 2JECA 5T54A 3AP9A 4CP0A 5KXCA 1U5YA 2PMWB 1YI9A 3IWZA 2XL9A 3SMHA 4JTOA 1CAUB 3H42B 4QPGA 5FWEA 1K12A 4CCNA 3GGLA 1X82A 3M4FA 2MEV1 2E26A 2XQXA 5LA1A 5FKBA 3JBG1 1QOSA 2VVDA 5E6HA 1KRIA 1ND2C 2JDPA 4LBOA 1NA1C 1W2OA 2BOJA 1QJY1 3GBWA 1ALYA 4IV1C 5BNOA 2X29A 4XXPA 3MO4A 1LGCA 1BK0A 2P6HA 1NCQA 3IPVA 4XDQA 1BVP1 1FPN2 2VNGA 5CG8A 2RMU1 3VZOA 1XJAA 3M8LA 4YM3A 5F2SA 1X33A 5C3SA 1J3PA 3ZFFC 5ANNA 1HQLA 1UY4A 5EJZB 1BHGA 3VZKA 5GALA 5JIAA 2E31A 1A6CA 3U14A 4NIGA 3ZSJA 2VQAA 2HWF2 4DY5A 5JZGB 2HWE3 1D2QA 1AL23 4K9SA 5A6XA 4XFIA 4MVTA 1E5HA 4DFSA 2AGSA 3UNPA 2WO1A 4X8PA 1DQ2A 3HJRA 3HVDA 5H9SA 4HKLA 2WSUA 4FQZA 3KB5A 4MZUA 3MZHA 1NQJA 1WCUA 4Q0SA 4LBNA 1RUD3 1OKQA 5LY1A 5AC91 2JE8A 3JB4C 2R1BA 2DCZA 4Z2AA 3K4AA 4YARA 1W6OB 1U5ZA 1KDMA 4MLOA 3MW3A 4GH4A 3I2KA 1RIRA 2BRTA 3Q9OA 1XU1A 5DZGA 3OEBA 1VBD1 1UKRA 4K6BA 1UY0A 3JD73 4XDOA 3LPGA 3ZXGA 2C4XA 4CEWA 1O91A 4FPGA 3MFAA 4QKDA 1JYTA 2CWMA 3QOPA 2ZGMA 1H4HA 3AP6A 3N7LA 2GU9A 4FOVA 1CJPA 2R16A 1FMD2 2YU2A 1PM7A 1ULGA 3MPBA 3GXUA 4BIFA 5C3OA 1VMFA 4IEPA 1IKQA 2ET1A 1JOJA 1BCXA 2ZX4A 5EPAA 3BUCA 3K4ZA 1ZZBA 4XE9A 2WR9A 4AI1A 1PNGA 3S7IA 3ZXLA 4AXOA 1BEV2 3LPFA 1BMV2 3FFZA 4YW7A 3DPRB 1SPPB 3ACGA 3D4KA 3OGSA 1VBA1 3Q8FA 4HK8A 4UWDA 2B46X 2QQWA 4GJZA 1QJX3 1W05A 1DIWA 4R9DA 5FMOL 1YNAA 2JG8C 2R061 2AENA 4AHZA 3U4XA 2L9LA 3W5NA 2FD8A 3HT2A 3K75B 4OI4A 5CISA 4LA2A 2HEVF 5A6QA 4M3CB 5C8CA 1EYBA 1HRI2 2OUHA 1EAH2 2PXJA 1EV12 1XB9A 4X6RB 3HQUA 4XUTA 3U4SA 1G9BA 1IG3A 1K45A 5HPOA 3FUQA 5D8AA 3JXSA 1QEXA 4COZA 4D6SA 5CA6A 4V2VA 1RYYA 4Q1RA 5A33B 4MG2A 4V2WA 1OA2A 3VHOA 2VO5A 2VULA 5FPLA 2R041 1WUVA 1V9U2 1W9WA 5C4WB 1WW4A 1IPKA 1AR73 2V09A 4XUQA 1OXCA 4META 4QPIC 3HEIA 3R0RA 4JGZB 4LHKA 4I09A 1V6LA 4B29A 2YGLA 1H8TA 1OF3A 3NL1A 1IZ3A 1MS1A 4QKBA 5DDJ1 1QJU1 2CGNA 3MICA 4E9KA 4E8CA 4LTAA 1O7FA 1L3JA 3AJZA 4D94A 2BV4A 4ZXEA 3UGFA 2QQOA 4OMCA 3O1SA 2PHLA 2E51A 3PJQA 1H1AA 1SFPA 4H14A 5FPBA 1V6KA 1XNTA 2JG9B 4RS5A 3DECA 1UIJA 3SNMA 4RGAA 5H9PA 1DP0A 1PIV1 5FZAA 3DF0A 4QQ2A 3UJQA 1WWYA 2RM21 4MV2A 1YQ8A 3MIGA 5FZKA 5KXEA 3I2JA 3HN3A 2XJRA 2Z69A 2W95A 1BEV3 1RHI3 2EA7A 4XZPA 4CZSA 3AB0A 5APAA 1OSGA 5JIUA 2KD7A 2WRAA 4AYUA 4P08A 3ZIWA 1ACCA 2Q30A 1WA6X 1XYNA 3AL5A 4PF5A 3I2GA 4XUPA 3FJSA 5KHIA 3J8F1 2IXCA 3RZKA 1FX5A 1YYNA 2QCSB 5DAQA 1K5MC 5FZ0A 4P5HA 5FP4A 2DU1A 4P9IA 4HL0A 4IE4A 4AAPA 4P9LA 1HRI3 1XNAA 1VRH2 1MPXA 2JJ6A 2KR2A 4U2AA 5FDBA 4LHLA 4RGKA 2VZ3A 2ZPXA 4QU2A 3L9JT 1W9YA 4BMBA 3LB9A 4UBHA 3P1IA 2KXLA 3WQ0A 2XONA 4QXBA 4TLFA 3UKNA 2P3JA 1AZDA 2N7GA 3AJYA 4BOWA 5BNNC 1AF9A 5I8SA 1JHJA 1MS9A 3N36A 1SBDA 1W39A 3POFA 5T5OA 3WCSA 3WW4A 4YWAA 5A7WB 4A2UA 5JUVA 1W99A 5A3PA 3V0AB 5EWSA 4A3XA 5CFDB 4JHTA 2FDKA 2WO2A 4NAOA 4RHV2 4P9XA 3C7OA 1DQ6A 4S2GA 5C9AB 1UF2C 3SC7X 4GD4A 1V6NA 1H2KA 3W21A 4DEVA 4I3GA 3AMQA 4PF1A 3AMNA 1WLDA 2W1UA 5E89A 3ZFFA 2GH2A 1O4ZA 4HPKB 1W2AX 2EVXA 2R7EB 1TMF2 3BODA 1XYOA 5LA9A 2D5FA 2D7FA 3RYKA 4CDWC 1G9AA 4LBQB 2DCKA 4YVSA 3PDQA 4M00A 2P4EA 5I0TA 3ES4A 3WOGA 1GQPA 2WNOA 2YBSA 2VBPA 3W58A 4A45A 4TYSA 5BNPB 2PAKA 1MZFA 1SBFA 3SXWA 4XFFA 1VBE2 2BFUS 5A7NA 4PI0A 5J96B 5KXBA 2Q8CA 2J42A 1ST8A 1VAVA 2EF6A 4UF0A 1S0JA 4MGYE 1PGW2 5GLWA 1CVNA 2IFRA 4PLOA 2X09A 4QQPA 1AR63 4Y33A 5JSOA 1G6NA 4EROA 4XJ8A 3OTFA 1OUSA 2WT2A 1FV3A 1N3PA 4QM8A 1QQP3 1AVBA 3PMEA 3B9IA 4ZKTB 4IEYA 4O9EA 1UY2A 2VZ1A 3BB6A 2Q8DA 1LB2A 3AMHA 4HKWA 2WJSA 1BYHA 4PT6A 2A6YA 4WM7B 1G9CA 4HN0A 4AHYA 1W8FA 4MGIE 1XNCA 1POV3 1OPOA 3WUDA 2ZOEB 3WHUA 4AVCA 1IS3A 4HSLA 2VMHA 3VBFC 4OI1A 5KC6A 3C7EA 2E6VA 3AKTA 2VZSA 1ZREA 1QOTA 3J7HA 3WDUA 5JXIA 3HOBA 2WWSA 1D4M3 3AM2A 4RHV3 5SV8A 4BH9A 3WP4A 2DUPA 5IK7A 1COV1 3BN6A 5JSPA 3ENRA 1IKPA 2WO3A 3B3QE 1QU0A 1NKGA 1Z7S2 2WUHA 3S6PA 3TRSB 5JOWA 2CSGA 3LIHA 5JOXA 4H55A 4Q4Y1 1RUD1 5F7UA 5IVBA 4E4DX 1TMF3 4HVOA 2W1SA 3VL9A 4RQPA 4B7KA 2E53A 4TWTA 5F6KA 2WYSA 4DY3A 1UXZA 3NNJA 5DZEA 4KQ7A 5IVYA 1W90A 2C24A 1OLQA 3ZSKA 2XHNA 2W92A 4N53C 3MLLA 2WNUA 3RS6A 1VRBA 1BLZA 1MZ5A 1C4RA 1VBB3 4IEWA 5B2GB 2Y6LA 3ZYJB 4NHYA 2XUMA 1DGWA 2ARAA 4Q4V3 5HV0A 4MGSA 5LBEA 2UWCA 4JCKA 4IE5A 1R1ZA 2WFF1 5C3QA 1SLIA 3WY6A 3LDRA 1IPJA 4XDPA 3T2QA 1NLRA 1A34A 2WQ4A 2UY9A 4KWJA 4QPIA 2VMIA 4MXWB 4A7KA 2E7AA 2O1QA 5FY9A 5JR7B 4N8MA 2WWJA 4CPBA 1XQNA 3RDIA 2JDKA 2UYBA 4LR4A 4AFMA 4CP9B 3VBHA 1G7YA 1JOPA 1HN1A 2GC1A 2TUNA 4RFRB 5A32B 3RI9A 1CZTA 1U0AA 4HOOA 4XBQA 5L7OA 1QJX1 2OT7A 1JYCA 4LO7A 1XE7A 3OJBA 1GWMA 3UT0A 1CX4A 4IV3A 1ULDA 1LECA 2R0HA 2XOMA 5B4NA 4GB32 1QHDA 2QDRA 1GP4A 1C28A 1VR3A 2R0FA 3NV2A 4P9JA 5EYXA 1OFNA 3N9OA 2ORXA 3GNEA 2CAVA 3D0JA 1XNKA 4K3UA 3B93A 2WN3A 4XYXA 4EWAA 4JQRA 5EP9A 5J98B 1DZQA 1MVQA 1PX4A 2EALA 2VY0A 4X6QB 5A80A 4GAZA 5DQ0A 4BZ4A 5FYUA 3H1YA 3TAYA 1MEC1 3UJOA 3NV1A 1M06G 2MEV2 2ENRA 4NE9A 3JBG2 2Z4FA 4WV8A 2PHDA 1PO21 1YJKA 1IS5A 1W8HA 2ZX2A 1P8JA 1QJY2 2XB6C 5FAXA 4CEYB 4CUCA 5FQ0A 2WNVA 3TWIA 4L2NA 4IL7A 4JVAA 3RZHA 3WDYA 3MBWA 3KM5A 5A3UA 1NYWA 2RMU2 3N9LA 4QX0A 1FYUA 1ODMA 2WNEA 3OUJA 3P3PA 4TN7A 1OQEA 1IPSA 4CE8A 2C6SA 1GZWA 2Y6HA 2VECA 3SCFA 4LKSA 3OUHA 3VL8A 3NJXA 1M4WA 1XBFA 1F9KA 4M01A 3WQ7A 4D7YA 3A21A 2UU8A 4L8QA 1Y9GA 2EXHA 3M70A 1GNZA 4CCLA 4YM1A 3WNXA 2BNOA 3V0BB 5KHHA 2RS51 3CHXA 5JZGC 4OCTA 2GN3A 4MYEA 1LOCA 4AOCA 1J58A 2W39A 1VB2A 3FL7A 3NNLA 1RHI1 1YJLA 4CU7A 5JSRA 1GV9A 2XLAA 4YVWA 2IXJA 5A7OA 1LODA 3UV9A 5LCWL 1Q8QA 1PMHX 4Y5Z0 1RUG3 1T6BX 2ZZQA 4CDWA 4GMP1 5I0SA 1HRV2 2E63A 3N3HA 1C8M2 4KMQA 4Q4W3 1JODA 3N7KA 4UFMA 4GB33 4CA9A 1LHWA 4GKXA 4KNCA 4MUVA 5K7PA 3IDAA 4HG6B 4BXFA 4IEVA 1AR81 4QQHA 5HV4A 1OUXA 1AX0A 4UXAA 3ZXFA 1Q5OA 2EIGA 1AJOA 1NCRA 2NYYA 4KG8A 1UZYA 3OD4A 4PDWC 3B01A 3AKPA 3ZSEA 5EIYB 3I59A 2MEV3 2A73B 3JBG3 2OQ6A 3CJIC 4Q0UA 4XXAA 5FXXA 2NN8A 1REFA 2K46A 1PGSA 1W2TA 1QJY3 2P1BA 2HWB1 1HN0A 1OH4A 2JEMA 3WVJA 1DZTA 2Y0OA 4LJHA 3ZVXA 2RDRA 2OZ6A 2RMU3 4COWA 1N1TA 2YB7A 1VBA2 1OKOA 2A6XA 2J1TA 1AL0G 4IGOA 3LD8A 4NWVA 4XF9A 4BQ2A 1KEXA 2O0OA 3DPRC 1ZM1A 4AZZA 5AFBA 2B7YA 3ZFGB 3NJZA 3KQ4B 1WMFA 4Q8KA 5C3PA 3POJA 1SHWB 5CKMA 4ZHNA 5IFPA 2ZS6B 3H3ZA 2ADDA 3KHBA 5J37A 1WCKA 3VBFA 2PQQA 3K46A 4UAPA 4CDQB 1O4YA 4H7MA 4AR2A 1UD1A 5E88A 2KM2A 3VDDA 3SQOA 3VBSB 2QQMA 1ZZ9A 2QFEA 2O8QA 4FO9A 4QX8A 4WVVA 4Y20B 4AI0A 1CESA 2CGOA 3JZVA 4EN6B 1RXGA 1GQHA 2DYCA 3HD8B 3E1F1 4RD7A 1UU6A 4Y1XA 3LGRA 3KV5A 4AFAA 2JXAA 2ZEWA 1AR61 1QY4A 4FTBA 2R042 3AXEA 5AC93 4Q29A 4BQYA 1HIXA 4C90A 5C4WC 1J1TA 1JMUB 2XKPA 4FP3A 4LHSA 3UESA 3O1OA 3N4MA 3QBQA 1OOPB 3DXUA 4JGZC 1VBD3 3HWJA 1QJU2 2LTNA 2QDNA 5DDJ2 4OHZA 3T4HB 2BBVA 1W6PA 4AQTA 3OPZA 1GQGA 1DYKA 2XLFA 3RQ0A 1C3HA 4CU6A 4RR3A 1SZBA 2JB4A 1POV1 2A70A 4LKEA 4AVVA 2I2SA 1GU3A 3OGJA 5BXXA 5FXZA 2TNFA 4MOAA 2GC2A 4WVMA 3U10A 3WNNA 4COVA 1PIV2 1LOEA 1UPIA 1HXS2 4GA9A 4K21A 2JG9C 1QOOA 4QGMA 3ZX7A 4LE3A 3T4VA 4CUAA 5ACA1 4XW3A 2O8OA 3K3OA 2VMFA 4BK4A 4M4RA 1JUHA 1ZVFA 3H8RA 4XTMA 1OF4A 1HLCA 1PZ8A 2ATFA 1VBA3 2Y0IA 4M0NA 2YPDA 4FQ4A 3USUB 1YEWA 3E6CC 5DAPA 2YFUA 4XCBA 2G9GA 2R063 5FUNA 5FYMA 4Y22A 3HQXA 2LALA 5FK8A 1HV0A 1TZOA 5F5CA 5FOBB 1LHOA 4QDQA 1TME1 2HWC2 3H3UA 2BP6A 3OCPA 2IVJA 1R093 2FCTA 3LWCA 3IMMA 1MS0A 4GMP0 5FZFA 5AFEA 3CU7A 1JYWA 2PAEA 3ZLIA 1F15A 5L9RA 3KCXA 5FYCA 3W59A 3IIIA 1B35B 3AYDA 4QX1A 5CKNA 2C26A 2P3YA 3NO8A 2JIGA 4NIAA 3FUOA 4IEZA 2YBPA 4LO8A 3S30A 3VD5A 1SBEA 4DXZA 3LCPA 1VP6A 1SDDB 2W9XA 1W9FA 3U37A 2D3SA 1ZZ7A 2R043 4A7ZA 4S2FA 5GJ6A 2CTVA 4FTEA 4F83A 4FFIA 1PMIA 4KBBA 1W6MB 2Y6FA 2PHXA 4QXHA 1YQ6A 3CEWA 3DN7A 4G3YC 4CCEA 4YZ3A 5F39A 3RI8A 5C9AC 4R9AA 5KHKA 1WMXA 2PTMA 5DDJ3 1QJU3 4Y1VA 3H9AA 3VBOA 3N9PA 3NV3A 2QQJA 2W5FA 1SFYA 1NE4A 1BXHA 2W46A 2E7TA 4GALA 4ZY9A 5FPVA 1JOBA 2X5IB 1I5ZA 3U11A 1S0FA 3B5LB 4MGKE 2F4LA 1PIV3 3USSA 4UW5A 5BNPC 4AEDC 4Z92B 2HLEA 2RM23 2FBEA 4R52A 2EIDA 1C5HA 3KMHA 1GZ9A 3FBMA 2Q4SA 4HBNA 1X8EA 1DU3D 2YFZA 3I4IA 1KD7A 2LW8A 3FN9A 1FNZA 3FLPA 3AP7A 4LPLA 2QE3A 4OQ9A 2DVFA 3ZN6B 3AKQA 1HKDA 4CDXA 1JYXA 3VD9A 2ZGQA 3J8F3 1CWPA 4HKOA 1RUH1 3OY8B 3ATGA 4O65A 3C3VA 4XC9A 5ANQA 4JGYB 5FO8B 1DGWX 3VD3A 5ABJB 5IWFA 2DUOA 3OPWA 2ADEA 2DVDA 2DURA 2B8MA 1OFSA 4PDWA 3F2ZA 4WM7C 4IGPA 2DV9A 2IXKA 3WF4A 2DBNA 2DF7A 4XQ4A 3LEMA 1OD5A 2RV9A 1H2NA 3HMYA 3MEPA 4YGBA 5FJKA 4LBQD 4M4PA 5FMCA 4LMFA 3CJIA 1UZWA 1HQWA 3NVCA 4OHVA 1VMHA 2Z79A 1OQ1A 1POV0 2C5DA 2WYFA 3AVSA 3H7YA 4IERA 1OC1A 4CCDA 3I3QA 4QB1A 4N43B 1COV2 2Z2SB 4E2QA 4HANA 1PK6C 4SBVA 3O0VA 3G6JB 5FP9A 3ZYPA 4MO3M 1D7PM 1UMIA 4UFIA 4MXVA 1H4GA 4BQ3A 5CU1A 1RUD2 3THCA 3ALQA 4PIYA 2JE7A 3PVNA 1CPMA 3K77A 1OD3A 4Q4W1 1LNSA 2H6CA 2IZWA 4WM8C 4PBPA 3WHTA 1OVPA 2DVAA 3K51A 4KBZA 4HK9A 4D6RA 4YW2A 5IK8A 2RR11 5LBCA 2QBXA 1ZYBA 3JD72 3VHRA 3BTZA 2G4IA 4DINB 3O7OA 2A6ZA 2Y8KA 4XETA 3CIHA 3OYWA 4NIHA 4ZZ8A 3KCCA 3SISA 2QZ3A 1WBFA 2XBO1 4FPLA 2WFF2 1UW8A 1GWKA 4GIQA 4GULA 1IGOA 1PVXA 2JX9A 1EUTA 1W3XA 3FZ3A 1UAIA 1VJ2A 2SBAA 3ST7A 4LLOA 4IE7A 1LOFA 2BJSA 4KG0A 3UETA 3VBUB 3UKVA 2B5HA 4JRLA 1O8SA 2W1QA 3WNOA 5FIXA 2XUEA 1VMJA 2PHTA 2SLIA 4ISQA 2GMEA 2BZDA 3OBZA 3RZZA 4ZZ5A 1U5IA 2V72A 3LFIA 4CDUB 1QJX2 1F2NA 5F3GA 1LHNA 2OVUA 1ND3A 2CY6A 1D4VB 2PQSA 2XG3A 4LUMA 1QXJA 2W94A 3JUUA 2WAOA 1FXZA 4LOSA 1AX1A 4UFKA 2ZGTA 2BEOA 5A70A 3MV01 1WW5A 2LRPA 1COV3 4QKFA 2QJVA 4QMAA 4AAXA 4QX5A 2YG0A 2JDHA 1H2LA 3RGBA 1MEC2 4P14A 3ON7A 5DAWA 1CPNA 5GLUA 3GZUC 1OLME 1ZBA1 3KV6A 4ZPIA 2ARXA 4Q4Y3 4B4PA 5T52A 2ZKLA 3FBYA 1AR72 3LSDA 4BIOA 1NX9A 1V6JA 1MQTB 2O14A 2W08A 1RINA 4OI2A 1AYN1 3WNKA 3WQ1A 2ZXQA 1XPWA 2ZMKA 4XFBA 5HCBA 5DXDA 2ZHNA 4FXGB 4L99A 4CEYC 1CAWB 3TN91 1OI6A 4CCMA 3LAGA 5I0UA 4ATEA 5FZCA 3RPQA 1QGLA 1SLCA 5K0UB 2ZJCA 1MVEA 1CD3G 1W8OA 2XVGA 5LY2A 4AHWA 2EAAA 4NJ4A 4HFSA 2VZOA 2WFF3 1RC6A 5J3UA 2EXKA 5CBLA 2BPA2 3LEGA 3MLJA 3IDEA 4YZ2A 1U5XA 4LEJA 3NAPB 3BU7A 4YNIA 2HBTA 2RS52 4A44A 4AFDA 1J84A 3ACHA 3GZAA 3J7MA 1UQXA 5FZHA 3ZYGA 2VC9A 4XQDA 5JXHA 3ZFEA 4Z82A 4BM8A 3N9NA 5F5QA 1RHI2 3BTXA 1CAVA 5J36A 2ZMNA 1EUUA 5L9VA 1GOGA 1WZXA 2V73A 4LULA 3N9QA 3LZZA 4OHXA 5JXGA 1XRUA 4HMZA 4KI5M 1FV2A 1DBNA 3J26N 4BE3A 2P17A 2GSYA 1R091 5DUXA 1E57A 2ZZJA 4Y5TA 1BBT1 2WZR1 1AR82 2CYFA 2Q1MA 5LBFA 1PO11 4AI8A 3VBRA 4C91A 3AKSA 3WNPA 4AEDA 3QD6A 3TEXA 4LUKA 1O3RA 3H7JA 1W0NA 4R9BA 5FK7A 4W4ZA 3E97A 4KWUA 1RUI1 3KCYA 3CO2A 1MEC3 3H0OA 1W9SA 2VCMA 3I2DA 3SITA 1JHNA 3A4UA 3PUHA 3ZSMA 3NKTA 3BCWA 4BDVB 1PO23 2VUDA 1UMHA 2Y34A 3THDA 1W8UA 4DNYA 2PLV1 4CVUA 1KITA 1HDKA 3I7DA 4MH0E 2DCYA 4AVSA 2YC0A 2WS93 1GR3A 5IHRA 1NZCA 1GZCA 3AZXA 3N7JA 5FZEA 1GYKA 3TOJA 5LRSA 3TYJA 3VLBB 4YZ1A 3S0MA 3WSOA 4QPGB 2BOIA 4CU8A 4E2SA 1V6MA 2FQPA 2D93A 2VW2A 3MW2A 2R071 3WXPA 2WQZC 3AZZA 3ZN5A 2QQUA 1ZA4A 3ES1A 3ZFGC 1ZRIA 5FZ6A 3LOBA 2VW1A 4XIOA 4MGTA 4B4QA 5BNOB 3LA3A 3EBRA 1DCSA 1QIQA 5FY5A 5C8WA 3IPVB 1NCQB 4CDQC 1AR91 2RS53 2FDHA 4NMIA 5KHGA 1Y7BA 1PK6A 3VBSC 1YUDA 3EYPA 3Q8EA 1FATA 5FV3A 1RTVA 1TQ5A 5CVRA 3ROUA 1AR62 2VVFA 1F5JA 2RG4A 3DEMA 3PVOA 5JCTA 3B02A 3WEZA 4FP2A 5IJRA 3PU8A 4GMP3 5BNQA 3POYA 4CCKA 3HN1A 4WM8A 2BDRA 3HIFA 3S5QA 2JKXA 3I97A 1QQP2 1Q3EA 2HWD1 1KGYA 4NWWA 2CWSA 2ZKNA 5K4LA 1XC6A 2JD9A 5AVAA 5I93A 3PU3A 1AR83 1D0GA 1YC61 2XWBB 1JZ3A 2ZMLA 1CJDA 4FPOB 1JTZX 3ZYIB 1CX1A 1OOPC 2V4AA 4XURA 4XVHA 3SEPA 3WF3A 1NY71 4XCAA 1CONA 3W20A 1DQ1A 3LIGA 2YDEA 5LRRA 2ZGOA 2YC4A 3NJYA 3FX3A 2WT1A 4GH4B 1ND2A 3WD5A 1V70A 1D4M2 1NA1A 2VOVA 1DGRA 5FYYA 5GLTA 1HB3A 2ID4A 1GBGA 5F32A 2LM3A 2HWB3 4IV1A 3WNMA 4QDRA 1WW6A 1YWKA 3A23A 1QF3A 2PYTA 3P5BA 4CEWB 3ILRA 4M3CE 3MIHA 3PNAA 1GMMA 3T3YA 2BWAA 4N7IA 4RN5A 2ZABA 4LLFA 5T55A 4BK5A 1RUF1 2QQPA 3VV1A 1CAXA 1GSLA 1QWRA 4FAGA 1LHVA 2W87A 1UOGA 2BERA 3H8UA 1ASJ1 4XACA 3UK9A 1OA4A 2R1DA 1AUYA 1TME2 2ZEXA 4LKDA 1KFUL 1REDA 3E6DA 4XJAA 3ZMOA 1JYIA 2VMCA 2PHWA 4QAWA 3DL3A 2G19A 1S0DA 4YW3A 4B1LA 3Q8BA 3K48A 3RJRA 5DMYA 1NZIA 1VBB2 2NQYA 3N9MA 3NQHA 1JZ2A 2JB8A 4N7UA 4PCRA 2DVGA 4Q4V2 5CFCC 2W47A 2DCTA 5FKCA 5G05L 3VN4A 3RYPA 1LU2A 3PVEA 4PI2A 2XPJA 2NLRA 4CYDA 2P3IA 4OFGA 1JH5A 1Y3TA 4Y1YA 3SKJE 5C8CB 1H1IA 1QH6A 1JW6A 1MR5A 4L97A 2A7AA 2VZQA 5CNAA 3FHAA 4AEJA 5JR2A 2TEPA 2WA3A 5DABA 4ARXA 2VVEA 2XQRA 2YBKA 3OBTA 3OGRA 4C8DA 3O1TA 5D8AB 3LQCA 5KHJA 3IDCB 4PLNA 4JC1A 1PZ7A 1QNYA 4DRVA 4A3ZA 2DCJA 2XMLA 4EE2A 5H9RA 4MGZE 1OLRA 4FTSA 1MS8A 3HNYM 3D5OA 2RDQA 5FXVA 3IBMA 5FY8A 3T09A 4MX3A 3ZYBA 3BOWA 1PM4A 2WLQA 4Z8BA 3RJ2X 5FYHA 1H8TB 2WQ8A 5CKQA 3IDBB 4LA3A 2A3XA 2X5IC 3EXUA 1Q8PA 2RS11 4NAMA 4BWOA 5D1IA 1AJKA 1OH3A 5ACA3 4AEMA 1NG0A 4LBLA 4OUMA 3M3QA 4NIIA 1LJ7A 4B4RA 4HLTA 3ZM8A 2JG8A 3RFRA 3PHMA 1I5PA 4RS5B 5DG2A 1KFXL 1MACA 1PGL1 1TME3 2ZTNA 5DN2A 2J1EA 1LR5A 4A7YA 3U78A 3M3OA 2Y6GA 3AVRA 1SLLA 4IXLA 2BGOA 4QT6A 4WVWA 4EZ4A 2WKKA 3KVBA 1VBC1 4JGYC 5T3NA 4BJ0A 2P34A 1H30A 4EZHA 2PA7A 2VZUA 4FXKB 3NNFA 2ZHKA 2OW4A 4IEQA 5F5IA 1ZZ8A 1WCQA 4FFGA 2Q1ZB 5ABJC 1XNBA 4OZXA 5F6LB 1PMJX 2YYOA 4KWLA 5FP3A 1AHSA 3AYAA 1V6OA 1UOFA 2PHUA 4PIZA 3BPZA 2WZPP 2VCBA 3ZO0B 2JDAA 2PELA 1V00A 1DQ0A 2GMPA 1GOFA 3R4DB 3IB3A 2VMGA 1YCIA 2R49A 4YZ4A 1MZ6A 4DQAA 3R4SA 4ISRA 4DOUA 4FT8A 3H8XA 4I01A 2XJSA 3TNPB 4GZ9A 2OQ7A 3U1XA 4N43C 1LU1A 2RJKA 1TE1B 4YW5A 1NXMA 1NT0A 1C1FA 1RUG2 5JMOA 5FBJA 2ZHMA 3VD4A 1C57A 1DGRN 1Q8VA 4BQ4A 3AZYA 1Q8OA 3GF6A 4Q4W2 2NP0A 3CZJA 5CG9A 1FI2A 4OVEA 1O5LA 1UYPA 2RR12 4HVRA 4QGLA 4A41A 4KGQA 3QACA 5FR3A 3RVHA 2GNDA 4QB6A 3T2PA 1LKNA 4XOGA 4AWDA 1J83A 1YQ5A 2VGDA 5F5AA 5JAXA 3DKWA 4CUBA 2ZGNA 1UWWA 1FPN1 3ZFFB 2ZGLA 3O0WA 5FZIA 3POEA 2XBO2 5I8YA 4SLIA 1WD4A 5E1RA 3EB7A 4YVSB 2ZAAA 1W06A 5JMCA 5IATA 4MADA 4BYYA 4AGVA 3ZMNA 1RUH3 1S2BA 2D6OX 2QQKA 1K5MA 1W8WA 2WFPA 2HWF1 2HH9A 2JE9A 2WS91 5T50A 4IETA 5A7SA 2JDNA 3VZMA 5KWRA 1RUC1 4UF0B 1R1A3 3SH4A 2QUOA 1CZSA 4OMDA 4J1XA 2B39A 4DXTA 3MF6A 2GNTA 5LB6A 4JKLA 3LOIA 1GICA 1XYPA 2BBAA 1LOAA 1ENXA 5J7MA 1MZEA 5T5LA 2JIJA 1LGBA 2VMEA 2H0VA 4CDUC 5BNNA 3LE0A 3ZN4A 5FPUA 3UYJA 2YROA 4XJ9A 3MUY1 4Q4X3 2YY1A 5F2WA 4E4HA 3N7MA 3LDBA 2KA3A 5ERLA 2NM1A 4BQWA 4LQRA 2YZ4A 5A6ZA 3X29B 3M1HA 3T1LA 1PNFA 3OOXA 3KD4A 2WN2A 1HQNA 2VPVA 1FOD1 2X10A 1XSQA 4QQOA 3S7EA 1W28A 4A6OA 1WMDA 5A3NA 3RRDA 1YQCA 4XEZA 2YGMA 1ZBA2 4Y4YA 4YW6A 3EO6A 1Q43A 5IAVA 5AC92 3APBA 5FPXA 4AI2A 1W6QA 2UURA 2Q0AA 2VTXJ 1W2NA 4JKKA 1R083 1RUE3 2F4PA 2PAMA 2VG9A 4QU1A 2RDNA 4RSUA 4XBNA 1LOGA 5K8SA 4JV4A 2RHPA 2VCCA 3VHPA 1G9FA 3POIA 2OXBA 1FMD1 1RMU3 2RR13 4Q8LA 4XBLA 2A6WA 1H1MA 3VHNA 1WA4A 4JQTA 4FOQA 1VBD2 4ES8A 2VUAA 2CHHA 2UWBA 2PHRA 4FPJA 4N9IA 4N90A 3O0XA 5FPAA 2C0ZA 5CFCA 3I2IA 4PQ9A 4IESA 4QGNA 5IK4A 1KJLA 1QNWA 3KVAA 4JDNA 3LFMA 1TEIA 4XMIA 3FWEA 5K0UC 2XBO3 3ZYFA 5I8TA 4RQPB 4AL9A 3NV4A 1YQ2A 2B9UA 3H50A 5JOYA 3RZLA 1SQ4A 1TVGA 1XU2A 4WZFA 1NLSA 2GAUA 3QH7A 2X8KA 1T6GC 3NAPC 1VALA 2WNUB 1EAH1 5EJ3A 1JZ8A 5FZOA 4AVTA 1UY1A 4P9GA 2P6CA 5A7QA 4DS0A 4LO4B 1SG3A 4ET7A 2R062 2W1WA 4AFBA 1LRHA 1Y43B 3CQOA 4KWKA 2GMMA 5DUWA 4XABA 1S2KA 4O7XA 3AYCA 1R092 4QPIB 1ZNPA 1F31A 3AFKA 2WZR2 3PUIA 4BLJA 1W6NA 2P3KA 4V1PA 1PO12 1X9TA 3HT1A 1LCLA 3VBHB 3Q8CA 5LWBA 1SEFA 1T2XA 5L7OB 3RWNA 2GALA 3L2HA 4KU7A 3WF1A 4Y3OA 3KF3A 2WABA 1RUI2 5A7PA 5KBFA 1DF0A 3ILFA 4IV3B 4I3PA 1UOBA 5FP7A 5FPZA 1ZBA3 3BPSA 2VUJA 3O1MA 3ETQA 3SLIA 4ASMB 3BIWE 4CSWA 2HJIA 3N35A 4Q5OA 2VMDA 1AYN3 4ZS2A 3RZJA 5DAVA 1UMZA 4NVPA 3OF1A 1DHKB 3AP4A 3IKWA 4XJZA 3TN93 5FCCA 4MGQA 4YFZA 5IK5A 3I3BA 4N53A 3T1MA 1YLLA 3DUIA 1I1EA 3HBZA 1OLMA 4JKMA 3LEKA 2B9VA 2VM9A 2J7MA 4QB2A 1H2MA 1US3A 4O61A 1GANA 2XJPA 3IIAA 2W0XA 4B1MA 5FQ0B 1E5SA 4FFHA 2WNVB 4PHZA 2W91A 4ASLA 2Z42A 1WCSA 2FZ2A 3P6BA 1AR92 5FY1A 2D98A 2RM22 5BNOC 4AFCA 4YFWA 1NCQC 2D44A 2YMZA 1D2SA 1GZWB 1XSRA 1VRH1 3RZMA 4AHXA 4FVVA 5JPMB 1UY3A 3MGUA 3NNMA 4AVAA 5C7GA 4IEUA 4B3NA 3J8F2 4E8DA 2A1XA 2VNRA 4XFCA 4D69A 4LIUA 2HWD2 3VKLA 3EQEA 4Y1ZA 2ZX1A 3FFQA 2BNMA 3GBGA 3LF7A 4ZONA 3ITQA 1BBT3 2WZR3 3ORJA 3ZXJA 5A1AA 3WZ1A 1PO13 2ZBJA 4LK6A 5M0TA 1I9RA 2IXHA 3S57A 3NKGA 3ME2A 1S55A 4YVWB 4D7TA 1CGPA 4BQXA 2UWAA 3AKRA 2P2KA 4CDWB 5IVFA 1RUI3 2XJTA 3CL1A 1SLBA 4UBGA 3BYWA 5FY4A 3TB0A 5L36A 4UI9L 3ABZA 5FP8A 4FI9A 1CAUA 3L2YA 3O5SA 4BHPA 2ZX0A 1Q56A 1KJRA 2Y33A 1YIFA 2PLV3 4TSVA 1OVSA 1QMJA 2YV8A 3DKQA 2AEYA 3A22A 3EJKA 4FOYA 3WG2A 4GH4C 2WZ8A 2RS33 3C7FA 5CFDC 5JOZA 2J1VA 1VPHA 5T5PA 5FMBA 2G9ZA 3CZUA 1VBE1 5IT6A 3WG4A 1NCRB 1RUF2 1YRZA 2R30A 4XFGA 2JDYA 2QQVA 4CEWC 1C1LA 3FLTA 4CCJA 1KS4A 1ASJ2 3I59B 1PGW1 1JZ7A 1QJEA 1A8MA 3LKJA 1IS4A 2R073 1UN1A 4QM9A 5FTTC 1OMIA 1NQDA 2XJQA 1ULEA 4Y1UA 4FCAA 2LROA 3ZPOA 2J22A 1DZRA 3O1RA 3V64A 1CN1A 4URTA 4YGDA 1X50A 1AYM1 2EXJA 4TZDA 5FBZA 4RGGA 5LASA 5JZGA 3OGVA 1AR93 3GZEA 4NRMA 5H9QA 5A3OA 3WG1A 2PN5A 4F3JA 2WBKA 3SH5A 1X36A 4R4ZA 3KLSA 4HSJA 4LE4A 4OYUA 1QXPA 3J4UH 4QDSA 4TXWA 1UU5A 1UZZA 3DYPA 5CYYA 2R32A 1HX6A 5FZ1A 3VBFB 3CJXA 3AMMA 4CUGA 3KF5A 2A6VA 1HW5A 2Y64A 5DPNA 1A78A 5FZBA 2BW8A 5CAZA 2XHKA 3VDDB 4P5YA 2HWD3 5FRAA 2IXLA 1W6OA 1AXZA 2LS6A 3M2MA 1IS6A 2NPIA 2J1RA 3LDKA 1R1A1 4BU2A 3IMNA 2AYHA 5F1RA 4ZU7A 1JI6A 4EYUA 4JRAA 1G8WA 3MDPA 4BCUA 5D8AC 2A75A 5IYYA 3AMPA 1Z7S1 2C1FA 5HXVA 1W0OA 1SDWA 1WLWA 3THPA 2ZCWA 4Q4X1 5C70A 5FZ4A 1POQA 2WC2A 4G9SB 4K40A 4Y5SA 4D6QA 1RUJ1 3AXDA 1UZ0A 4QX3A 1F35A 2RS12 4Z2WA 1KDKA 1OQDA 1W6PB 5GZFA 1H8TC 5FZLA 4ES9A 4J6GA 1UKGA 4AQ2A 1ULFA 5DG1A 3E5QA 1RVF3 1VLNA 3POBA 5HCHA 1RUF3 1UCXA 4RR3B 3MIFA 3ZOIA 3HNBM 1AXYA 4Q4Y2 2DWRA 4ARYA 4KL1A 1Y4WA 3DPRA 1SPPA 4AF9A 4EV0A 1ASJ3 4ZS3A 1HB4A 1R081 1RUE1 2FMYA 4BA6A 2ERFA 2GNMA 4KGGA 2NMOA 4WVMB 3BU0A 5HXMA 2UYAA 4XF4A 1RMU1 4RS5C 4YZ5A 1C5IA 4Q0QA 3M7AA 2QVSB 2ZA9A 5FZMA 4M3CA 5IW0A 1VBC2 2J1AA 2ZGSA 1Y9MA 3OEAA 1EPWA 5FYIA 4K1YA 3ZR5A 2VTFA 3OSDA 1WD3A 1RUOA 1RJ8A 3OPTA 4Y22B 2GP5A 2D6KA 4P00B 5A33A 4QD2A 4XMAA 4Q2FA 1O8PA 4E4SA 5C4WA 4HT1T 4LBJA 5FYSA 4C1XA 4FPKA 4JGZA 3S5AA 4QHOA 4C1WA 1QKQA 4XAAA 3IAPA 4I0WB 5LA2A 1VAKA 2JWPA 3K4DA 5F3IA 3I2OA 3I49A 3FHIB 4LT5A 1ODNA 5G04L 1JYNA 2VXRA 2VTXA 1N47A 1ULCA 1GLHA 2JD4A 3TEZA 3LEIA 2XGXA 2CU5A 3EHKA 2Z5WA 1ENQA 3A0KA 4D8MA 4ITCA 2D6MA 4LIVA 3SH3A 1C8NA 2JG9A 1DLLA 4COUA 3KT4A 2RS13 3T0DA 2I74A 2Q5TA 3VBOB 5BY5A 5LK7B 3C7HA 3MYXA 1E5IA 3LSEA 4DO0A 3RMXA 4P9YA 1VB4A 4AQ6A 4BQ5A 4NR1A 2VE1A 1PO22 4CCCA 3PLQA 1E5RA 3ZR6A 4BISA 1RB8G 3UGGA 1N1VA 2VQ0A 4GKYA 3WQBA 2VBBA 1QDOA 1VIWB 4RFT0 2WS92 4YVSC 5J1XA 4NIDA 2WT0A 3SEEA 4E27A 4FPFA 4HETA 1RUC2 2V4VA 3JU9A 2E9QA 3GBFA 4RA0A 1VBC3 1IHMA 1SLTA 2EIBA 4U36A 3RSJA 1N3OA 3O1PA 1ZRRA 1JXNA 1PVC1 1AXKA 1ZBE3 3ZXAC 1HJGA 3W9AA 2Y26A 2WLPA 3I3DA 4CDXB 3FLRA 3WLUA 2X05A 5FYBA 4IE0A 4NO4A 5LK5A 5JPNB 3ECQA 3VDBA 3NMBA 1HRV1 3H3LA 4M3CF 1C8M1 1RGSA 2CV6A 1BKZA 4XPVA 5A7WA 2C9AA 2VH9A 4EN7B 2BGCA 2VNOA 5A3TA 3MIBA 3V0AA 1FOD2 5CFDA 3NWKA 1YI7A 3K2OA 4JDMA 1IQAA 1W03A 3J7NA 3BOPA 5C9AA 1F4AA 1AX2A 2EXIA 3T2TA 5JLVA 5K9YA 4K20A 1JZ5A 3WT3A 1EY2A 2WWUA 4PDWB 4C0HA 4PQQA 4H3WA 4XQWA 4ASKA 5LZ6A 2XJVA 4QXKA 1GNYA 3B9CA 5D2AA 2WO7A 3CJIB 4HPKA 1LGNA 1J1LA 1BK1A 1LULA 3GALA 4NHXA 4OHYA 3FMGA 3QH6A 4O9GA 3P3NA 3PIGA 1N1YA 1WW7A 3HQRA 4LBQA 3URFA 3PUQA 4AI9A 4QKNA 1KQRA 5BNPA 1H6XA 2DTWA 1PX3A 5A1FA 3HR9A 2VOXA 3D8CA 5I0DA 3MHZA 1HB2A 3GCXA 3GHNA 1FPN3 1YFYA 3SKVA 4WBBA 5IFTA 5JDBA 5EQUA 1F5FA 1F8VA 1W04A 2XL7A 4L11A 5FMDA 5HCFA 2FDGA 4QPWA 4L0PA 2FHRA 3WDXA 4CXYA 4RQPC 1ENRA 2D6LX 2QKDA 2HWB2 2HWF3 1ZRDA 4LBMA 2RS31 2D3PA 2WSVA 1EP0A 3E6BA 3IZOA 4XUOA 1N3QA 1RUC3 1QJFA 2FMDA 5A3WA 1LHUA 3INAA 3U07A 3OYWB 3ZXKA 1VE0A 2IUWA 2WNUC 3IAQA 2I07B 3OBRA 5EHDA 1GUIA 2A71A 4XTPA 1LEDA 2OX0A 5FLJA 4EWEA 1CQ9A 1HJFA 5GZEA 4E2GA 3DXTA 2F6BA 2JKBA 4WM7A 4YW1A 3F95A 4URAA 1GNHA 4TTGA 4DUVA 1DYOA 4NUBA 1GWLA 1S0IA 4H2AA 4LO5B 5C5UA 1N1SA 2GH8A 5FWJA 3GHMA 2CL2A 3VD7A 1FOD3 2BUKA 2JENA 2HKXA 3HNMA 3KV4A 4DEQA 4CRQA 4YSFA 3BALA 1JYVA 1UIKA 2VOKA 3VBHC 4CXXA 1DGLA 1JZ6A 4FPCA 1JUIA 1US2A 2ORZA 3WINE 5L7OC 1ND3B 4MHRA 4OUSA 3AX4A 3GCWA 4IV3C 4B7EA 3JQXA 2ARBA 4NPRA 1MS5A 4E4ZA 3AC0A 1STMA 1JN2P 3B94A 4AW7A 1FMD3 3D0SA 2EAKA 2W3JA 3ACFA 2D6NA 4FBFA 2ZGPA 2HYXA 1PZ9A 1X7NA 3RNSA 1ZA7A 5A3MA 1HXS1 1YO8A 2D97A 1ULPA 2BGPA 3KS7A 4LO6B 5IVJA 4JDOA 5FY0A 3AZWA 3ZPYA 2Q8EA 1ZZCA 3MW4A 1O4TA 4ORFA 3H1MA 2AUYA 2BWCA 2J1UA 1JS9A 3MIEA 4X8NA 3T30A 4DUWA 1PGL2 4OHWA 3A0NA 1H9WA 5DZFA 4S2DA 5BV6A 1Y9QA 2WNVC 4XJUA 3VZJA 2HWC1 4CPBD 5ACA2 4QX2A 4DB5A 3AK0A 4GJYA 4MXWA 2HEWF 1EAH3 2BU9A 1EV13 2DVBA 3THTA 1RVF1 4F7ZA 3QCWA 1W0PA 2FDFA 1MS4A 4CP9A 3O1UA 1D0HA 5A32A 4KU8A 4D0QA 2AH2A 4D3WA 2Y6KA 3HPNA 3NNGA 3IM0A 3AZVA 4LKFA 4L9BA 4Q1PA 4RYDA 5FO9B 1V9U3 3ZFEB 5FLIA 1UNBA 2VZPA 3QLQA 3MPPG 5F3EA 5L9BA 1CAVB 3WCRA 3I3EA 5B4XA 2WIIB 2YPJA 4IE6A 4EWDA 1G9DA 1QH7A 4S2HA 2ARCA 4IEOA 1H6YA 1GFF2 4XILA 4PIXA 1YFXA 1S4CA 2NZ9A 3BVCA 3ILNA 1IG0A 3CKHA 1B35C 4YVWC 3UGHA 5BUVA 1DFQA 1W2UA 1UYXA 4YGCA 3NRUA 3VKFC 1I3HA 1DQ5A 5FZGA 2D5HA 1KXGA 4FFFA 1MS3A 3KHCA 2QTWB 4Q27A 2QQIA 3M3CA 1JU3A 5LATA 3VBRB 3ZXDA 4AEDB 1RJ7A 2VJXA 4ONUA 4CEYA 2VZTA 4F8AA 4TLGA 2PFWA 2AEZA 4P9WA 5GLVA 3KZ4C 4OQ8A 3D82A 3IN9A 3PMSA 5FUIA 4EN0A 2ZX3A 2WZEA 1NCRC 5CZKA 5FXWA 3VKOA 4FPHA 3VDAA 5C71A 4W8JA 2XR4A 3RZGA 4NHKA 4MHUA 1DDLA 2VL4A 1AYM2 1UOJA 2Q8OA 5FOJB 3U0ZA 5JI9A 2AREA 3V0BA 2VNVA 2TBVA 2ZGUA 5FO7B 1VRH3 2DDUA 3JCIA 3PTYA 2RE9A 3CF6E 4IEXA 5BPXA 4AGGA 1K5JA 1LTEA 1UZVA 4LORA 2F17A 4BB3A 4XF1A 3BKZA 1QDCA 3WX5A 2DBIA 5I91A 1RUH2 4QXCA 4C0BA 1QXRA 3MI8A 3CLPA 2CDOA 2HWE1 3WUCA 4R8HA 1AL21 3ELNA 3VKNA 1PK6B 1R1A2 3VDDC 3GM8A 1VAMA 1WCDJ 3WDTA 5FZ8A 1Q8SA 4I30A 4BLIA 1LENA 3LA2A 1SACA 1ZBE1 1SCSA 2ZGRA 4YLZA 3ZYHA 5IVVA 1EPZA 5LEKA 4CU9A 3PIJA 3RG0A 4AEKA 1V0AA 4Q4X2 4WM8B 4DIQA 1L7RA 1Z78A 3H8OA 1YXWA 4YW4A 1O6UA 3OGGA 3BI3A 2XKOA 1RUJ2 4DXSA 2RJLA 3VZLA 3WP6A 2XVKA 5FLHA 2ETEA 5GM0A 4EJRA 2BYVE 1JBCA 3POGA 5GLZA 1VBE3 3JD71 4FPYA 2IC1A 2Y6JA 2PHFA 1ENSA 1W8NA 3PUSA 3FE5A 4R9CA 4OI0A 4LK7A 2GDFA 5IAXA 3C2UA 2WA4A 4PLMA 5A1LA 1R082 1RUE2 2VOWA 1CIWA 1I6XA 2VUCA 3BTAA 4RR3C 4QPYA 3WDVA 1ND2B 1LAJA 1NA1B 3ZFGA 2W2IA 1RMU2 5JVVA 4FSJA 5JI7A 4IV1B 2OKXA 1AYM3 2CNAA 1OPMA 1YFUA 5IVEA 4CDQA 1IOAA 1TG7A 3AP5A 3DCQA 2D43A 4CP1A 1WLTA 3KT1A 2XDVA 3RYRA 3LA7A 3VBSA 1CAXB 5AVPA 3T2OA 5F8PA 4J1WA 2GZWA 4Y20A 1X9PA 3C8XA 3KT7A 4OLLA 2A5ZA 2ES3A 3AYEA 4IGQA 3ZKUA 4CCOA 2OPKA 2VR4A 2CDPA 3RWKX 1UPSA 4HONA 4LXLA 3NW4A 1OT5A 2QZ2A 4Z07A 2A3YA 2DFCA 3MUZ1 2QQNA 3M3EA 1WLCA 4FPEA 5FMOS 5JXJA 2V5DA 1ZRCA 5FYZA 3BGAA 1W8ZA 2GC3A 2HYKA 2JDMA 3PTRB 3TNQA 1LEMA 3MV11 3VBUC 1S0CA 3FHQA 1GZTA 1ULOA 4XHBA 3GYDA 1OOPA 4HN1A 3ACLA 1TNRA 2DUQA 3HBKA 1NAEA 4Y4RA 5C3RA 3O1VA 4BXSV 2OIIA 2V5YA 5EV7A 3UKTA 4YM0A 4NRQA 2H6BA 1Z7S3 2IFWA 2W68A 2MPFA 4UW3A 5EYYA 4ZU5A 3WDWA 2XXZA 5L73A 4Q26A 4K8FA 1WKYA 1UO9A 1ZRFA 1H8VA 3ACIA 2XLGA 1SFNA 3FC0A 4XJWA 3VDCA 1AR71 4QX7A 3WV6A 1RITA 3GDBA 2RVAA 1A8DA 1RUJ3 3OBAA 4AQSA 5JWPA 5EXOA 1O3SA 2EIEA 5I0RA 3C7GA 1O5UA 3CBNA 3ZIXA 3B69A 2H0BA 1L7QA 2GP3A 4ZU4A 3VB9A 1NE6A 4AK3A 4NPMA 4IDZA 3VBOC 5L19A 3TEYA 4AVBA 2XVLA 1IQDC 4JAAA 5CEHA 3GZTB 2VD7A 2AC1A 3KSCA 3R4UA 4UW4A 1BQPA 1UXXX 2VAUA 3R6SA 3USUA 3BTYA 3OUIA 3ETPA 1AYN2 1WMEA 4PBOA 4Q0VA 3KGZA 3SCGA 3MIDA 3O12A 2OPWA 2IXIA 1FAYA 4GXLA 1MQTC 4XF3A 3TN92 4A6SA 4DMIA 3WG3A 1KS5A 1OA3A 2ZHLA 2ZGKA 1RXFA 5GZGA 4UW6A 2GC0A 3R05A 3T0AA
chains in the Genus database with same CATH topology
1BMV1 1PVC2 1BEV1 2A3WA 3DGTA 1J3QA 2E7QA 3ZSLA 2JG8B 1B35A 4XIKA 2MHFA 4CDXC 2ZACA 1GKBA 2BVBA 2X53S 3AFGA 4GWMA 3POSA 3B00A 3MFCA 4W65A 5T5JA 1HRI1 4DRRA 4YG6A 1W6MA 1BJQA 1EV11 2NMNA 1WGPA 1UL9A 2GNBA 4HVQA 2DU0A 4Q0PA 4GQ7A 2JDZA 4AI3A 1X8MA 1SMVA 4H7LA 3ASIA 1BBT2 1V9U1 2YUEA 1REEA 5GZDA 4COYA 2X5IA 5EZWA 1DG6A 1NXD1 2BTVC 3MLKA 1S0GA 4ZXKA 5FFOC 2D3RA 2P37A 1FNYA 2OZJA 4PJYA 5DUVA 3D6EA 3SCHA 4I2OA 3ZXEA 1YIPA 2W52A 3V56A 1YFWA 2PLV2 4OULA 4DZGA 3MF9A 3ZN6A 5J48A 2RS32 4N9HA 3JB8A 4JTNA 4IQPA 5C33A 2B42B 3OY8A 4Y24A 2ET7A 3E5UA 5FREA 4AGRA 2XJUA 4JGYA 4WVZA 4K1ZA 2D40A 4NHLA 4Y26A 3J9SA 3H1WA 1B09A 2XWJB 1PVC3 5ABJA 2R072 4QPGC 5KXDA 1DYPA 2DTYA 1UU4A 1J59A 1K5MB 2I45A 2OUJA 3ZDSA 1HRV3 3G7DA 3O14A 1C8M3 5GZCA 1LOFC 1J3RA 2G9FA 2UY8A 1QQP1 2HEYF 4EN9B 2OA2A 2MNGA 4QQLA 4N43A 3PJYA 4W6XA 4W6YA 1ZZ6A 1HV1A 5BNNB 2FZ1A 3VUOA 4G4FA 4AE2A 1ND3C 1O3QA 4R4XA 5EFUA 3NSTA 4INDA 4W6WA 4YRDA 3IT8A 4LBKA 5C6CA 1XXNA 4RHV1 1D4M1 2QNKA 4RL7A 1Z0HA 4YYOA 2BQPA 1NY72 4EN8B 2IWGB 4I02A 2ILMA 1W6QB 2WL1A 1OHFA 4LHNA 3VKMA 4MSVA 2LUWA 3HAGA 1TMF1 3TBDA 4YG0A 2YHJA 3POWA 3VBUA 5BYNA 1RVF2 4KH9A 5CFCB 5KC5A 2Y38A 1VBB1 3V65A 5F9TA 4Q4V1 5LEJA 4BPZA 4K7JA 4CDUA 4BMEA 1RUNA 1FT9A 3I54A 3KQRA 1A3KA 4I0BA 1S0EA 2K9ZA 1G86A 4XFAA 2ZAHA 1APNA 2R6QA 1CR7A 5HBAA 1RL3A 3ZFEC 2K2SA 1SCRA 5E16A 2OYZA 5HI0A 5GKAC 3WP3A 5IUQA 4M0HA 4XHXA 4CTEA 3WR0A 1BVVA 1QJZA 3VGIA 3UL2A 1W6NB 3WW3A 5C8CC 2VW0A 4AG4A 4DPNA 1MQTA 4FAHA 1S1AA 1LESA 4WZCA 5A3LA 4Z1VA 1HXS3 1PHMA 3VBRC 1XE8A 1S0BA 1CAWA 2JICA 3SHRA 4NOTA 1U12A 2YXSA 2AZ5A 5K0UA 4LNVA 2DFBA 4B8EA 1NOVA 3JQWA 4HZFA 1BZWA 4YGEA 3VZNA 4FOWA 3M3IA 3WP5A 2WINB 2HWC3 3I8TA 4N53B 3NAPA 4CP2A 3KGLA 5E8AA 1YHFA 2K0GA 1LOBA 4XFHA 3WW1A 1O3TA 5CB7A 1ONAA 4QHBA 1ZX5A 5HCAA 5TSWA 5J09A 3PVBB 1TNFA 4YG3A 2HWE2 2VU9A 1AL22 3DV8A 1H9PA 5CIRA 2CGPA 4NN0A 5DUUA 3OD0A 2BVVA 1UX6A 3CNAA 1ZBE2 3WW2A 2BNNA 4YM2A 3ZYRA 3E5XA 2XH6A 4GWNA 4D7SA 3B7MA 1DQ4A 4NHMA 1RUG1 2D6PA 5SV5A 1WBLA 4XF0A 3RMYA 4BQ1A 2B45X 4ATFA 4GB31 4I0AA 2BFUL 2GN7A 1SLAA 1V6IA 2CAUA 1URXA 1H0BA 5CADA 2AR6A 1XNDA 4L92A 2JECA 5T54A 3AP9A 4CP0A 5KXCA 1U5YA 3IWZA 1YI9A 3SMHA 2XL9A 4JTOA 1CAUB 4QPGA 1X82A 3M4FA 2MEV1 3JBG1 1QOSA 2VVDA 1KRIA 1ND2C 4LBOA 1NA1C 1QJY1 3GBWA 1ALYA 4IV1C 5BNOA 2X29A 4XXPA 1LGCA 3IPVA 5CG8A 1NCQA 4XDQA 1BVP1 1FPN2 2VNGA 2RMU1 3VZOA 3M8LA 4YM3A 1X33A 1J3PA 3ZFFC 1HQLA 3VZKA 5GALA 5JIAA 1A6CA 3ZSJA 2VQAA 2HWF2 4DY5A 5JZGB 2HWE3 1D2QA 1AL23 4K9SA 4XFIA 4MVTA 4DFSA 2AGSA 4X8PA 1DQ2A 5H9SA 4HKLA 2WSUA 4FQZA 3KB5A 4MZUA 3MZHA 1NQJA 4Q0SA 4LBNA 1RUD3 1OKQA 5AC91 3JB4C 2R1BA 2DCZA 4YARA 1W6OB 1U5ZA 1KDMA 4MLOA 3MW3A 4GH4A 1RIRA 5DZGA 3Q9OA 1XU1A 4K6BA 1VBD1 1UKRA 3JD73 3ZXGA 4CEWA 1O91A 4FPGA 3MFAA 2CWMA 3QOPA 2ZGMA 1H4HA 3AP6A 3N7LA 2GU9A 4FOVA 1CJPA 2R16A 1FMD2 3MPBA 1PM7A 1ULGA 4BIFA 4IEPA 1IKQA 2ET1A 1JOJA 1BCXA 2ZX4A 1ZZBA 4XE9A 4AI1A 1PNGA 3S7IA 3ZXLA 4AXOA 1BEV2 1BMV2 3FFZA 3DPRB 3D4KA 4HK8A 1VBA1 2B46X 1QJX3 1DIWA 4R9DA 5FMOL 1YNAA 2JG8C 2R061 2AENA 4AHZA 3U4XA 3HT2A 4OI4A 4LA2A 2HEVF 4M3CB 5C8CA 1EYBA 1HRI2 2OUHA 1EAH2 1EV12 4X6RB 1G9BA 3FUQA 5D8AA 4COZA 5CA6A 5A33B 4Q1RA 1OA2A 3VHOA 2VULA 2R041 1WUVA 1V9U2 5C4WB 1WW4A 1IPKA 1AR73 2V09A 4META 4QPIC 3R0RA 4JGZB 4LHKA 4I09A 1V6LA 4B29A 2YGLA 1H8TA 3NL1A 1IZ3A 1MS1A 5DDJ1 1QJU1 2CGNA 3MICA 4E9KA 4LTAA 1O7FA 1L3JA 3AJZA 4D94A 2PHLA 2E51A 3PJQA 1H1AA 4H14A 1V6KA 2JG9B 4RS5A 3SNMA 1UIJA 4RGAA 5H9PA 1PIV1 3UJQA 3DF0A 4QQ2A 2RM21 4MV2A 3MIGA 5KXEA 2XJRA 2Z69A 1BEV3 1RHI3 2EA7A 4XZPA 4CZSA 3AB0A 5JIUA 1OSGA 4AYUA 3ZIWA 2Q30A 4PF5A 1XYNA 3FJSA 5KHIA 3J8F1 2IXCA 1FX5A 1YYNA 2QCSB 1K5MC 4P5HA 2DU1A 4P9IA 4HL0A 4P9LA 1HRI3 5FDBA 1VRH2 2JJ6A 4U2AA 4LHLA 2ZPXA 4QU2A 3L9JT 4BMBA 3LB9A 4UBHA 2KXLA 3WQ0A 4TLFA 3UKNA 2P3JA 1AZDA 2N7GA 3AJYA 5BNNC 1AF9A 5I8SA 1MS9A 3N36A 1SBDA 1W39A 5T5OA 3WCSA 3WW4A 4A2UA 3V0AB 5EWSA 4A3XA 5CFDB 4RHV2 4P9XA 1DQ6A 4S2GA 5C9AB 1UF2C 1V6NA 1H2KA 4I3GA 3AMQA 3AMNA 1WLDA 5E89A 3ZFFA 2GH2A 1O4ZA 4HPKB 2EVXA 3BODA 1TMF2 4CDWC 1XYOA 3RYKA 2D5FA 2D7FA 1G9AA 4LBQB 2DCKA 4YVSA 4M00A 5I0TA 3ES4A 3WOGA 3W58A 5BNPB 4TYSA 2PAKA 1MZFA 1SBFA 3SXWA 4XFFA 1VBE2 2BFUS 5J96B 5KXBA 1VAVA 2EF6A 1S0JA 4MGYE 1PGW2 5GLWA 1CVNA 2IFRA 4PLOA 4QQPA 1AR63 1G6NA 4EROA 4XJ8A 3OTFA 2WT2A 1FV3A 1N3PA 4QM8A 1QQP3 1AVBA 3PMEA 3B9IA 4ZKTB 4IEYA 4O9EA 3BB6A 1LB2A 3AMHA 4HKWA 2WJSA 1BYHA 4WM7B 2A6YA 1G9CA 4HN0A 4AHYA 4MGIE 1XNCA 1POV3 1OPOA 3WUDA 2ZOEB 3WHUA 4AVCA 1IS3A 4HSLA 2VMHA 3VBFC 4OI1A 5KC6A 2E6VA 3AKTA 1ZREA 1QOTA 3WDUA 2WWSA 1D4M3 3AM2A 4RHV3 5SV8A 4BH9A 3WP4A 2DUPA 5IK7A 1COV1 5JSPA 3ENRA 1IKPA 3B3QE 1QU0A 1Z7S2 3S6PA 3TRSB 5JOWA 5JOXA 4H55A 4Q4Y1 1RUD1 4E4DX 1TMF3 4HVOA 3VL9A 4RQPA 4B7KA 2E53A 4TWTA 5F6KA 4DY3A 5DZEA 4KQ7A 3ZSKA 1OLQA 5JAXA 4N53C 3ZX7A 3MLLA 2WNUA 3RS6A 1MZ5A 1C4RA 1VBB3 4IEWA 5B2GB 3ZYJB 2XUMA 1DGWA 4Q4V3 2UWCA 4JCKA 1R1ZA 2WFF1 1SLIA 1IPJA 1NLRA 2WQ4A 2UY9A 4KWJA 4QPIA 2VMIA 4MXWB 4A7KA 2E7AA 2O1QA 5JR7B 1XQNA 3RDIA 2UYBA 4LR4A 4AFMA 3VBHA 1G7YA 2GC1A 2TUNA 5A32B 3RI9A 5BNQA 5L7OA 1U0AA 4XBQA 1QJX1 1JYCA 4LO7A 1XE7A 3OJBA 1CX4A 4IV3A 1ULDA 1LECA 2R0HA 4GB32 1QHDA 2QDRA 1C28A 1VR3A 2R0FA 3NV2A 4P9JA 5EYXA 1OFNA 3GNEA 2CAVA 3D0JA 1XNKA 4K3UA 3B93A 4EWAA 4XYXA 4JQRA 5J98B 1DZQA 1MVQA 4X6QB 2EALA 2VY0A 4BZ4A 3H1YA 3TAYA 1MEC1 3UJOA 3NV1A 1M06G 2MEV2 2ENRA 3JBG2 4WV8A 2PHDA 1PO21 1YJKA 1IS5A 2ZX2A 1QJY2 2XB6C 5FAXA 4CEYB 5FQ0A 2WNVA 3TWIA 4L2NA 4IL7A 4JVAA 3WDYA 3KM5A 1NYWA 2RMU2 1FYUA 2WNEA 3P3PA 1OQEA 1GZWA 2VECA 3SCFA 3VL8A 1M4WA 1F9KA 4M01A 3WQ7A 4D7YA 4L8QA 2UU8A 2EXHA 3M70A 1GNZA 4YM1A 3WNXA 2BNOA 3V0BB 5KHHA 2RS51 5JZGC 2GN3A 4MYEA 1LOCA 1J58A 2W39A 1VB2A 1RHI1 1YJLA 5JSRA 1GV9A 2XLAA 4YVWA 2IXJA 3UV9A 1LODA 1Q8QA 4Y5Z0 1RUG3 2ZZQA 4CDWA 4GMP1 5I0SA 1HRV2 2E63A 3N3HA 1C8M2 4Q4W3 3N7KA 4GB33 1LHWA 4GKXA 4KNCA 4MUVA 5K7PA 4IEVA 1AR81 4QQHA 1AX0A 4UXAA 3ZXFA 1Q5OA 2EIGA 1AJOA 1NCRA 2NYYA 4KG8A 1UZYA 3OD4A 4PDWC 3B01A 3AKPA 3ZSEA 3I59A 2MEV3 2A73B 3JBG3 3CJIC 4XXAA 4Q0UA 2NN8A 1REFA 1PGSA 1QJY3 2HWB1 2JEMA 3WVJA 1DZTA 2Y0OA 3ZVXA 2OZ6A 2RMU3 4COWA 1N1TA 1VBA2 4NWVA 2A6XA 4XF9A 1AL0G 2O0OA 3DPRC 1ZM1A 5AFBA 2B7YA 3ZFGB 3NJZA 1WMFA 4Q8KA 2ZS6B 3H3ZA 5J37A 1WCKA 3VBFA 2PQQA 4CDQB 1O4YA 4H7MA 1UD1A 5E88A 2KM2A 3VDDA 3VBSB 1ZZ9A 2QFEA 2O8QA 4FO9A 4WVVA 4Y20B 4AI0A 1CESA 2CGOA 3JZVA 4EN6B 1GQHA 2DYCA 3HD8B 4RD7A 1UU6A 4Y1XA 3LGRA 4AFAA 2JXAA 1AR61 1QY4A 4FTBA 2R042 3AXEA 5AC93 4Q29A 1HIXA 4C90A 5C4WC 1J1TA 2XKPA 4FP3A 3N4MA 3QBQA 1OOPB 4JGZC 4OHZA 1VBD3 3HWJA 2QDNA 2LTNA 1QJU2 5DDJ2 2BBVA 1W6PA 4AQTA 3OPZA 1GQGA 1DYKA 2XLFA 3RQ0A 1C3HA 4RR3A 1POV1 2A70A 4AVVA 2I2SA 3OGJA 5BXXA 2TNFA 2GC2A 4WVMA 3U10A 4COVA 1PIV2 1LOEA 1UPIA 1HXS2 4GA9A 4K21A 2JG9C 1QOOA 4QGMA 4LE3A 5ACA1 4XW3A 2O8OA 1JUHA 1ZVFA 4XTMA 1HLCA 1PZ8A 2ATFA 1VBA3 2Y0IA 4M0NA 4FQ4A 3USUB 3E6CC 2G9GA 2R063 4Y22A 3HQXA 2LALA 1HV0A 5FOBB 1LHOA 1TME1 2HWC2 3H3UA 3OCPA 1R093 4GMP0 3LWCA 5AFEA 1MS0A 3CU7A 2PAEA 3KCXA 3W59A 1B35B 3AYDA 3NO8A 3S30A 3FUOA 4IEZA 4LO8A 1SBEA 4DXZA 3LCPA 1VP6A 2D3SA 1ZZ7A 2R043 4A7ZA 4S2FA 5GJ6A 2CTVA 4FTEA 4F83A 1PMIA 4KBBA 1W6MB 2PHXA 3CEWA 3DN7A 4G3YC 4YZ3A 3RI8A 5C9AC 4R9AA 5KHKA 2PTMA 5DDJ3 1QJU3 4Y1VA 3H9AA 3VBOA 3NV3A 1SFYA 1NE4A 1BXHA 2E7TA 4GALA 2X5IB 1I5ZA 3U11A 1S0FA 3B5LB 4MGKE 1PIV3 3USSA 4UW5A 5BNPC 4AEDC 4Z92B 2RM23 2FBEA 4R52A 1C5HA 3KMHA 1GZ9A 3FBMA 2Q4SA 4HBNA 1X8EA 1DU3D 3I4IA 1KD7A 1FNZA 3FLPA 3AP7A 2QE3A 2DVFA 3ZN6B 3AKQA 1HKDA 4CDXA 2ZGQA 3J8F3 4HKOA 1RUH1 3OY8B 3ATGA 3C3VA 4JGYB 5FO8B 1DGWX 5ABJB 2DUOA 2DVDA 2DURA 2B8MA 1OFSA 4PDWA 4WM7C 2DV9A 2IXKA 2DF7A 4XQ4A 1OD5A 4YGBA 1H2NA 3HMYA 3MEPA 3T1LA 4LBQD 3CJIA 3NVCA 1HQWA 4OHVA 4FBFA 2Z79A 5J36A 1OQ1A