5GZCA

Crystal structure of galectin-8 n-crd with part of linker
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
152
structure length
152
Chain Sequence
NLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-8
publication title Crystallization of Galectin-8 Linker Reveals Intricate Relationship between the N-terminal Tail and the Linker
doi rcsb
source organism Homo sapiens
total genus 32
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5gzcA00
1MVEA 1WW4A 4AVTA 3NV3A 3UK9A 3LSDA 4YM3A 1DFQA 3PMEA 1CQ9A 4YW2A 1C4RA 5EXOA 3UJOA 1UZYA 1XQNA 1SFYA 3M3EA 2A3WA 1W6OA 2ZHKA 1KITA 4YGBA 5GLTA 4BMEA 3HR9A 3Q9OA 1CESA 1LESA 1VAMA 3MW2A 5JOWA 1AJOA 1ZA4A 2ZMNA 1WUVA 4TYSA 2OUHA 3OYWA 1G9CA 4GXLA 4XE9A 3DUIA 1CIWA 4AGRA 3ZSLA 1MZ5A 1KJLA 1LHVA 1LOAA 1YO8A 2PHUA 4IQPA 4XHXA 3R4SA 2DVBA 2P3IA 3VKMA 2R1BA 3KQRA 1ULEA 4CRQA 2NN8A 1DIWA 2P2KA 3ZXJA 4XBLA 4DPNA 1Z0HA 3MW4A 5DG2A 3A0KA 4Q8LA 2D44A 4FVVA 3UJQA 1GNZA 1GYKA 3WOGA 1MVQA 2WT0A 1OFSA 3AJZA 4HL0A 4WZFA 4YZ4A 3AP9A 2W39A 3AFKA 3ENRA 1CPMA 1DQ4A 1QF3A 1QKQA 3PVOA 3OPZA 1R1ZA 3MEPA 2A5ZA 2E51A 4FOYA 4R9AA 5DZEA 3VKOA 1FATA 3SLIA 5CAZA 4ISQA 2ZZJA 1WLCA 4YZ5A 2AENA 3VKNA 4PBOA 4FPHA 4L8QA 4WV8A 1IS6A 1ONAA 2D6LX 1QOSA 1AF9A 4WVWA 4Y24A 3M3QA 4MYEA 4FPEA 2CWSA 4P9YA 4Q1PA 2G4IA 1V6JA 2Q5TA 1F5FA 2DUQA 1MS9A 5AVAA 3ZXFA 5IK4A 4YG6A 1JW6A 2A6ZA 2ZGMA 4FOVA 2LALA 4M3CA 5KXDA 1W6NA 1RITA 1FAYA 3L2YA 3WCRA 2R0FA 5GLWA 3M3OA 1YIFA 1QOOA 4LBMA 1FYUA 5KXCA 1UKGA 2UU8A 3WDUA 3VKFC 2ARXA 4FPGA 1W6MA 3JU9A 3SISA 2AYHA 1VIWB 3OBRA 5IT6A 1ENQA 1IS5A 2RHPA 3AJYA 3A0NA 1LEMA 2D43A 3PJQA 2D3RA 5EWSA 2GMMA 3MW3A 3IM0A 4FPCA 3B01A 2FHRA 4UW3A 3D4KA 2NYYA 1S0IA 3IPVB 5T5LA 1CPNA 3B69A 1Q56A 1SLIA 4FP3A 1KDMA 2VUAA 2GNDA 1DZQA 1N3OA 1DYPA 1WLDA 4PCRA 4YFWA 1LGBA 2I2SA 3W59A 1JHNA 5T5OA 2ZKNA 4KBBA 3N7MA 1DQ6A 2EIGA 4Z8BA 1C57A 3N7LA 5H9QA 2WQZC 1CVNA 3MPPG 2ERFA 5T50A 4BOWA 3WUDA 2NZ9A 3SH5A 4GKXA 1JN2P 4YW1A 2ZHLA 4D69A 1WW6A 3ATGA 2E6VA 1BZWA 1H9WA 3M3CA 4FPJA 1WBFA 3WG1A 3ASIA 3KM5A 1ULDA 4GWMA 5GLZA 1MS5A 1S0CA 1LOBA 1MS0A 4Y1UA 3WHTA 1GNHA 3AYAA 5T55A 1DQ0A 1WW5A 2DTYA 1OQ1A 1QDCA 3NV1A 2NP0A 3HN1A 3N7JA 4YW3A 2WKKA 1RIRA 3N36A 1ULGA 3AK0A 3IPVA 1W6QA 1LTEA 3AZZA 1N1TA 1A8DA 1LENA 2ZGKA 3N7KA 3FUOA 1BKZA 2VXRA 2YROA 4XDQA 4Y1ZA 1PZ9A 3PVNA 5JOYA 4XBNA 1C1LA 1HKDA 1IKPA 5EYXA 3WG3A 4ATFA 5IK8A 1UL9A 4YZ3A 2R16A 1FNZA 4BLJA 1IS4A 1S0BA 4XIOA 3IMNA 1FX5A 4W65A 4R9DA 4FPKA 4ASMB 1GZWB 1V6LA 1JYCA 1S1AA 5GZEA 2WSVA 3D6EA 1UZZA 4Q2FA 3W58A 2ZGTA 3DGTA 3WHUA 4XHBA 3OJBA 1LOGA 1KQRA 1H30A 1LGNA 2W68A 4GALA 3R4UA 2W52A 2OUJA 1SBFA 2A6XA 3POWA 3IKWA 4ITCA 2ZMKA 2AR6A 1KJRA 1DGLA 3OBTA 5HCBA 2BQPA 1AX1A 3C2UA 1LULA 5JLVA 4GA9A 1HQLA 5T54A 1O4YA 1UAIA 2EXHA 3N3HA 5GZCA 2PHWA 5H9SA 2JECA 3FLTA 1AX2A 3B9CA 1WW7A 1SLLA 2GALA 2YMZA 1ULFA 1BYHA 3FLPA 4GKYA 2KM2A 1O4ZA 3A4UA 4Y22B 4BM8A 1DHKB 1VALA 2DVGA 2ZGRA 4YGDA 2NM1A 1Q8VA 1ENRA 3USUA 1LHOA 3SNMA 4XMIA 4I30A 4UW5A 4XJUA 2E53A 3WZ1A 1MS8A 1MACA 3SH3A 3BTAA 1GZWA 2ENRA 4Q1RA 3O12A 3WCSA 3V0BB 2DTWA 2DVFA 2ZGLA 4XILA 5DZFA 3WDXA 3AYCA 2ZHNA 2GDFA 3RMXA 4XJ9A 2ZAAA 4K21A 3ILNA 3T2TA 4LBQD 4NOTA 1S0JA 5GLVA 3QCWA 1QDOA 2C9AA 2D6KA 4AGGA 2W08A 1S0EA 4CTEA 1CONA 3WG4A 4YW4A 4UW6A 2VW2A 3HMYA 4FP2A 5H9RA 1G9AA 1YXWA 1V6MA 2EALA 4AYUA 2V73A 2A6YA 1Y7BA 2YZ4A 1AXKA 4Y1VA 4F83A 2GNMA 4DQAA 2ZGOA 3V65A 2CWMA 1DQ2A 5JOZA 4M01A 4Y22A 2DVDA 4XJZA 1V6IA 4M3CE 2JE7A 5GZDA 1URXA 1UX6A 2CTVA 2D6MA 1A3KA 3POSA 1N1SA 1DBNA 4YGEA 1GZCA 3IN9A 4U36A 4XMAA 1GBGA 3O5SA 3SITA 2ZGQA 3V0BA 3WDWA 3AX4A 1DYKA 1QNYA 2DV9A 1QNWA 5GLUA 4XJ8A 4DFSA 5SV8A 3AZWA 4FPFA 4BQ1A 1QGLA 4UW4A 2AREA 3O0VA 1LOEA 1LU2A 5IK5A 1X50A 2ES3A 1NXD1 5L73A 5T5PA 2E7TA 2A3YA 1KDKA 1GZ9A 2NMNA 1N1VA 1EPWA 2A6VA 4XIKA 3LSEA 1N1YA 1W0PA 3N35A 3T1MA 2WJSA 3NV4A 3R05A 1CJPA 1LODA 2WSUA 3AXEA 3GALA 3CNAA 1YYNA 2UWCA 1BJQA 3ZXEA 3ZSKA 3PVEA 1ZM1A 3AP5A 3WV6A 2EAKA 1QOTA 2UWBA 4YGCA 4ZKTB 5GALA 1G86A 2D7FA 2DVAA 1WCSA 2WT2A 4FPOB 4XJWA 3WG2A 3ZXKA 1I1EA 1KRIA 1GICA 1IKQA 3V0AB 1GSLA 5BYNA 3M1HA 1WLWA 2A6WA 2JJ6A 3OGGA 5T5JA 4AWDA 2A70A 4LBNA 1LHUA 2DU0A 4ISRA 4K20A 4XTMA 3I4IA 1DQ1A 2CNAA 2D3SA 5T52A 2EXIA 1SACA 2A3XA 4YM2A 1FV3A 1C1FA 1G8WA 1LGCA 4R9BA 4OZXA 4M00A 3VUOA 2PHRA 1UPSA 4YFZA 2ZGNA 1S0GA 1WD4A 4XXPA 1MS1A 1Q8SA 1SCSA 1CN1A 4FQZA 5IUQA 5CB7A 3ILRA 5F5QA 1Q8QA 1MR5A 1N3PA 3BIWE 2VW1A 5H9PA 1GKBA 1LECA 5DG1A 1V6NA 1V00A 3H0OA 5E88A 1PZ7A 3ILFA 2JD4A 1MZ6A 4SLIA 5E89A 3V0AA 3FFZA 4JCKA 4YLZA 1YI7A 2SLIA 4FPLA 4P9WA 2ZABA 2TEPA 2ZACA 4AVVA 2PHXA 1OKQA 1W0OA 1AXZA 1NLSA 2D6OX 1N47A 3V64A 1G9FA 4YW5A 1AX0A 3O0WA 3SH4A 5CA6A 2CL2A 4BLIA 1UN1A 3AP7A 1LOCA 1SCRA 3ZSJA 2B7YA 2CY6A 2D6NA 2AUYA 4LBLA 3AYDA 1HLCA 1U0AA 4YZ2A 3WUCA 4K1YA 2AGSA 4K1ZA 2VH9A 2ZMLA 5F9TA 1WD3A 4XYXA 4RA0A 2XB6C 3B00A 3OY8B 4PF5A 1QMJA 1APNA 3QLQA 1PZ8A 1Q8OA 1FNYA 2NMOA 4Y20B 1ULCA 4ATEA 1TEIA 2LTNA 3T1LA 4C1XA 2GN7A 1WBLA 4FOQA 2V5YA 3RRDA 1V6KA 2YXSA 3ZVXA 1LCLA 1V6OA 1SLTA 3M2MA 5KXEA 2D6PA 5JOXA 4PQ9A 4R9CA 1VLNA 3AZYA 4FPYA 2DURA 3FLRA 3LCPA 3POYA 4M3CB 3RQ0A 2R0HA 3BODA 2A75A 1W6NB 1AJKA 2JKBA 1A78A 1BQPA 2VW0A 2ZGUA 4PBPA 4Y26A 3RSJA 2VY0A 3INAA 2A7AA 4RL7A 3AXDA 4FOWA 3D5OA 4JC1A 2R49A 4LBKA 2AH2A 2JDZA 1ENSA 3RS6A 5IK7A 1SLCA 1W6MB 1FV2A 3ZYPA 5FRAA 2GNBA 2ZA9A 2GMPA 2UURA 1SLBA 2FMDA 1AZDA 2XG3A 1LHWA 3AP6A 4XZPA 4YG3A 2E7QA 3OY8A 1D2SA 1SBEA 3O0XA 2YY1A 5DZGA 2ZGPA 1SLAA 4H55A 3ZPYA 2A71A 2VU9A 1LHNA 4GWNA 3RMYA 1Z78A 3WDVA 5KXBA 1G9DA 4HANA 2DWRA 5JVVA 2D3PA 4Y20A 2ZHMA 3VV1A 1YRZA 2H0BA 1LOFC 3FUQA 1B09A 1GANA 2GN3A 3AP4A 4M3CF 5HCFA 5GZFA 4YG0A 5LK5A 5JDBA 2P3JA 4ZXKA 5HCAA 2HYKA 4CZSA 1CR7A 3FBYA 5DXDA 2OVUA 4XTPA 5FREA 2WLQA 4BPZA 1LOFA 1S0DA 2EF6A 3TAYA 1UMZA 2C5DA 2P34A 1VAVA 1GV9A 1MS3A 2JE9A 1Q8PA 4Q27A 1RINA 3RG0A 4BMBA 5DUVA 5CBLA 4WVVA 1IOAA 5JMCA 1G9BA 1HQWA 2P37A 4Q26A 3WVJA 2YV8A 5E8AA 4AGVA 5DUXA 1JYIA 3WDYA 3AZXA 3WDTA 1W6QB 2DUOA 2WT1A 2Z42A 2WNEA 1LU1A 4Q8KA 4YM1A 1H9PA 2DYCA 3I8TA 3TB0A 3NV2A 4LBQB 2GMEA 1BXHA 1JUIA 2GNTA 1QU0A 4XBQA 5GM0A 4XOGA 2R1DA 1HDKA 5DUWA 2P3KA 4AVSA 1W6PB 3GNEA 4LBOA 3NWKA 4LBJA 4YM0A 1LJ7A 2DU1A 3AYEA 2DUPA 3JUUA 1SBDA 1N3QA 5GZGA 2ARBA 3WLUA 5GJ6A 2UWAA 1J1TA 1F9KA 1W6OB 2EXKA 4P9XA 3WNXA 1S0FA 2PHFA 4XXAA 1D0HA 1F31A 4JRAA 4TZDA 1DQ5A 2OW4A 3UL2A 3VKLA 1GLHA 3OYWB 3ZXLA 1AVBA 4NO4A 1JBCA 4Y1XA 3APBA 3B3QE 4XJAA 3ZSMA 1LEDA 4P14A 3ZYRA 1I3HA 4U2AA 1MS4A 5CNAA 1JOJA 4C1WA 2SBAA 3BOPA 3AZVA 4DRVA 3U4XA 2ZBJA 4LBQA 1AXYA 1DLLA 1JXNA 4DRRA 5DUUA 2CYFA 4FQ4A 2PELA 2PHTA 3USUB 2ZGSA 4Y1YA 2EXJA 1W6PA 5EYYA 1G7YA 4YZ1A 4DS0A 1IS3A
chains in the Genus database with same CATH superfamily
1MVEA 1WW4A 4AVTA 1B35C 1WA4A 3NV3A 5FZ6A 1I6XA 3UK9A 1DFQA 3HJRA 1CQ9A 2BP6A 1C4RA 3PMEA 5EXOA 1BHGA 3Q8FA 3RFRA 1UQXA 1UZYA 4IE7A 1LKNA 3M3EA 3UJOA 1TNRA 2ZX2A 5HV4A 5FWEA 3CJIC 4CEYB 3TN91 4J6GA 3AL5A 5JOWA 1ZA4A 4EWEA 1RUI2 4NPRA 1UY4A 2ZX0A 2QNKA 3LA7A 2VNVA 1G9CA 1UYYA 3GZEA 4N53B 1B35A 5LASA 4AGRA 3KV9A 1NKGA 1MZ5A 4QPYA 1PIV3 5FK7A 3LIGA 3T0BA 1O91A 5C3OA 3T4HB 3CJIA 5DDJ3 3VHPA 3ZX7A 5C7GA 5HBAA 2NN8A 4CP2A 1U5YA 2P2KA 5FPXA 1JODA 2R043 4NE9A 1SHWB 4KGGA 4YW7A 2D44A 3UJQA 2FDGA 1MVQA 5ANQA 4XETA 1COV2 2VZOA 3O7OA 3OBAA 5CU1A 3ENRA 1STMA 5EJZB 1CPMA 1DQ4A 4XC9A 2ADDA 1R1ZA 3MEPA 4KL1A 1YQ2A 1OXCA 4NAMA 3VKOA 2VMCA 2R7EB 1FATA 3BOWA 4YRDA 1C3HA 4OQ9A 3BTZA 1S55A 2PLV2 5BNOB 2O0OA 1J59A 3E6CC 1UPIA 3J7LA 4I01A 3UV9A 2HWE1 1IS6A 1CGPA 2W2IA 3UESA 5C5UA 3M3QA 4S2GA 4MYEA 4FPEA 5A7QA 4LOTA 2VO5A 4P9YA 5JCTA 1XYPA 3RZHA 3B9IA 4KU7A 3ZXFA 1PM4A 4KWLA 2A6ZA 4FOVA 4CEWB 4M3CA 1F4AA 1UYPA 2EIBA 4MZUA 1J58A 1HB1A 2R0FA 5GLWA 5C9AB 1AR72 2FCVA 2NLRA 4NHLA 5FR3A 5FY1A 2HWB2 3P6BA 4COWA 1VBC3 4XZUG 2PAMA 3BKZA 1UY2A 2VNGA 3I7DA 2RVAA 2WDBA 5F8PA 4AHZA 3BPSA 1O7FA 3AJYA 2BEOA 1LEMA 3RPQA 1YI9A 5CFDC 1BK1A 2GMMA 2GSYA 2LW8A 2QFEA 2VNOA 2Y60A 3MW3A 2FHRA 2OPWA 4QQOA 4UW3A 2NYYA 1RUD2 1VBD3 3FN9A 3HIFA 1W8TA 2VULA 3B69A 3EHKA 3DV8A 4X8NA 1KDMA 4YFWA 2J1VA 4Q4W1 5FYIA 4QQ2A 2WO7A 3W59A 3MUZ1 4AXOA 1J84A 3AMNA 4QMAA 5CFDA 3MI8A 4QX8A 1ZRCA 4OQ8A 2NZ9A 3DKQA 1UZWA 3WNOA 4R4ZA 4DXRA 2VTFA 5FQ0B 3ATGA 2BGCA 4QX7A 1BZWA 1H9WA 4FFFA 3MV01 2PMWB 2DF7A 1UIJA 2QDNA 2XBO2 2ZX1A 5J37A 3KM5A 1ULDA 4GWMA 4COVA 1RB8G 1TMF3 3ZN5A 5L36A 3LB9A 3GHNA 4Y5SA 3WT3A 1NQDA 2WNVA 1OQ1A 5FPBA 4BQ2A 3HN1A 2CV6A 3TNPB 3N36A 2ORXA 4D6RA 4N9IA 5J98B 3NNMA 3A23A 3AK0A 4LKFA 3RI9A 1Q43A 5FYUA 1VB2A 1W6QA 3AZZA 1OHFA 1NX9A 4N43C 1BKZA 1PZ9A 1UU4A 4JGYB 1C1LA 5FMDA 1GP4A 3ZIWA 3IB3A 5A7PA 2ZJCA 4BLJA 4QDSA 5I0UA 4XIOA 4BWOA 3THCA 4W65A 1ACCA 4IE6A 3WNLA 4W8JA 1T6GC 1UOFA 5BV6A 4KBZA 1TME1 3VBHC 4S2FA 2YG0A 3JD72 4N43A 2WR9A 1MQTC 1RC6A 2DCJA 4FCAA 4JVAA 1LOGA 1PHMA 2OZ6A 4E2SA 2ARCA 2W68A 5C4WC 3S5AA 4GQ7A 3I3QA 2BNMA 5C3PA 2A6XA 3POWA 2VM9A 3S0MA 4ZS2A 1OVPA 3IKWA 3Q8CA 2ZMKA 5LWBA 2BU9A 5C3QA 1KJRA 1DGLA 2IWGB 2VQ0A 4B1MA 4PLMA 5F1RA 1LULA 3VBHA 1QIQA 2EXHA 5HXVA 5GZCA 4LT5A 1MQTA 5H9SA 1R1A3 4Q4V2 5F5AA 4CDUC 3FLTA 5C4WA 3PU3A 1SLLA 1UU5A 3TWIA 3ZLIA 1ULFA 3FLPA 3T2QA 2XKOA 3SKJE 5BNQA 5BNPA 1YQ5A 5FMOS 2J7MA 2FDHA 1VALA 4ZXEA 1O3RA 2JENA 2NM1A 4XACA 1Q8VA 2VMIA 1H6YA 4Y3OA 1AR61 4RS5B 5KHIA 4L2NA 3FHQA 4MGYE 4GAZA 3O12A 3WP3A 3WCSA 4CDUA 2JE8A 3ACHA 5LY1A 1KS4A 3AYCA 4IV3C 2RS32 1PVC2 4RHV2 2ZAAA 4LBQD 4GJYA 1YFWA 1H8TC 4IETA 5C33A 2VOWA 1NE6A 4KNCA 4AGGA 3VZMA 2W08A 2K0GA 4CTEA 1TVGA 4PDWC 4LA2A 1WGPA 2W3JA 4YW4A 2VW2A 2YFUA 5H9RA 1G9AA 4Z07A 4ASKA 3CJXA 3MLKA 1RUG2 5C71A 2V73A 1HRV2 2PA7A 4Y1VA 3GZAA 1H8TA 1R091 2ZGOA 3ZKYA 5JOZA 1UW8A 3U1XA 4AG4A 4XJZA 4JGZB 4CXYA 2O8OA 4PDWA 5FZ7A 4A7KA 1A3KA 2X8KA 3GDBA 3POSA 4PIZA 1N1SA 4QPIC 1DBNA 1YQ8A 1WA6X 3IN9A 3PUQA 1RUE1 1RXFA 4YGEA 3HVDA 4LQRA 4QGNA 1YQCA 4QHOA 4AR2A 2VD7A 5L7OC 1RYYA 1W8HA 2DV9A 4JDNA 2P4EA 4XJ8A 4UOJA 4OI4A 2YPDA 5J09A 1C5HA 3BVCA 2XKPA 1VBA3 4XUPA 2RS53 1O4TA 1LOEA 4XCAA 3WW3A 2LM3A 5AVPA 4FXKB 4QPIA 1NXD1 3GGLA 1HRI3 3IDCB 5L73A 5T5PA 2XMLA 3LE0A 1GWKA 2Q0AA 4MVTA 1K5MB 1NCQC 1N1YA 1W0PA 2MEV2 3NAPC 4Z2WA 4Q0UA 5L7OA 2TNFA 1LODA 2W47A 1KFUL 2WSUA 2I74A 2XWJB 3TEXA 3ZSKA 1IPJA 4H14A 4QQLA 5IVBA 3CZUA 3WV6A 1T6BX 1FMD2 1QOTA 2WS92 4ZKTB 5GALA 1G86A 2DVAA 2WT2A 4XJWA 3VHRA 1ENXA 1VMHA 3J7MA 4D0QA 1ZX5A 3ELNA 4XAAA 3V0AB 2BTVC 3KF5A 1NCQA 4NRQA 3RVHA 2EA7A 2A6WA 3NAPA 4LO4B 4XUQA 2D97A 4G3YC 5A1FA 2HLEA 3LZZA 1Y9QA 1XE7A 2DU0A 4ISRA 4EN8B 4K20A 4XURA 4YNIA 1BEV1 1C28A 4CDQC 2R061 1H2KA 1Y9MA 1H4HA 5FLJA 1X82A 1W2AX 3K3OA 2EXIA 2ZS6B 1J83A 4HOOA 3VUOA 3SEPA 1COV3 5AC93 1QXPA 3ACLA 4TTGA 1DF0A 1UPSA 3SC7X 1VBB1 4Q4X2 3WQ1A 2PQSA 2BBAA 4CDQA 5A1LA 4GJZA 5IUQA 4DEQA 4HPKA 1Q8QA 4WVMB 2VZ1A 3BIWE 1R64A 1GKBA 1ZA7A 1V00A 3LEGA 3WF0A 2BPA2 1ZVFA 1QQP1 4NIHA 1DLCA 2Q8OA 3ILFA 1SG3A 1RHI1 1ZBA1 1HX6A 4IEYA 4JCKA 1W03A 5EP9A 1RUJ3 4FPLA 4D7YA 3IBMA 1EYBA 2JWPA 3DXUA 3CJIB 1DGRA 1KEXA 2B9VA 1NLSA 1BMV1 4OZOA 1NUKA 2GZWA 5CFCC 4UBHA 3V64A 3VBFB 4A44A 3HD8B 3O0WA 5J1XA 4BK5A 4BLIA 3AP7A 2RDNA 3WW2A 3ZSJA 2B7YA 4XUNA 2D6NA 2FZ2A 5FXVA 5F3GA 3AYDA 4LKSA 1U0AA 4YZ2A 4JAAA 2HWB3 2VBBA 3B5LB 5FXXA 2K2SA 5EQUA 5A80A 5CFCA 3WP6A 4PF5A 3I2GA 1WWYA 3O1UA 1QMJA 3PJYA 3AKSA 3VN4A 1PZ8A 1OC1A 4LA3A 1RJ8A 1PGW1 4A6OA 5K8SA 4NIGA 1Q8OA 2DDUA 1XE8A 2HWD1 2NMOA 4BK4A 3VBOA 4ATEA 1FPN2 4C8DA 1RUD3 4BQ4A 3ZVXA 2YXSA 2XVLA 1V6OA 1NZCA 3DPRC 3M2MA 1K12A 3DYMA 3MPBA 1OPMA 4EN9B 1UYXA 2V4VA 2Q8CA 4D7SA 5JOXA 2G19A 2Y38A 4M3CB 3RQ0A 2A75A 5FUIA 4QKDA 3WW4A 2JKBA 4DUXA 4D3WA 2XPJA 2VC9A 3KQ4B 5J7MA 1UMHA 2VCCA 3LF7A 3RSJA 3TEYA 2VTXJ 1RUF2 3IMMA 3VZNA 1DU3D 1GOHA 2CGOA 2E9QA 4JC1A 5ACA1 4Q4Y1 3DPRA 1ENSA 4XPVA 1R083 2XBO3 1UOBA 2Q30A 1U5XA 2GMPA 1VRH2 4QKBA 3AP6A 1F5JA 3VBUC 4COUA 1CZVA 1Y43B 1ZBE1 1SBEA 2E7QA 3BCWA 3O0XA 2J1SA 2YY1A 3OY8A 4CP9B 4H55A 2GC2A 3RMYA 5LA2A 2EIEA 2E32A 3PUIA 5FYMA 2H6CA 3PNAA 4IERA 4UF0A 4DY5A 3I3DA 2HWF1 4Y20A 4ONUA 4LXLA 5FBZA 1IQDC 1H4GA 5FY5A 2YBKA 4X6RB 4XFAA 4ASLA 3FUQA 4BXSV 3VBUA 1GANA 2GN3A 4M3CF 1W8FA 3V56A 4CA9A 3C8XA 2VZVA 5BNNC 5A6ZA 5LK5A 2ORZA 1NZIA 1JU3A 2W1QA 4CU9A 2Y64A 4D94A 5HCAA 1CJDA 2HYKA 1PIV2 1OLME 2HH9A 2YC4A 4CXWA 4XTPA 2PXJA 5FREA 5DDJ2 3JD73 1HJFA 1AR81 4LJHA 4BPZA 2EF6A 4EN7B 2P34A 2R042 3HT1A 4Q27A 1MS3A 4XF0A 2WFF3 2WNVB 5BNNA 3MIFA 3I59A 5CBLA 4WVVA 4NAOA 2P37A 2YV8A 4IEPA 4AGVA 5DUXA 4A4AA 1DG6A 4HN0A 3WDTA 1W6QB 3CDZB 3UKTA 4EV0A 4TSVA 3N4MA 4AZZA 1PO13 1Z7S1 2BV4A 4HSLA 4L92A 4QAWA 4AQSA 5A33B 5FK8A 1YFUA 1AYM3 1IG3A 3CIHA 5TSWA 1HIXA 2RS11 4X6QB 1EY2A 1O5LA 3TB0A 2IXHA 4Q4V3 4LBQB 1X7NA 2YPJA 3HNBM 4HZFA 5F5CA 4DNYA 1BXHA 1BBT2 1W9SA 5JI9A 1F4HA 4XBQA 2WA3A 4L99A 2XJQA 2YBPA 1JYXA 1POV3 1W6PB 4LBOA 3PTYA 3NWKA 4LBJA 4YM0A 1LJ7A 4YVWC 5IVFA 2DUPA 1W3XA 3JUUA 3ZOIA 5DMYA 3A21A 2C0ZA 4MH0E 2BFUS 1XSRA 4QPGC 1AYN3 1CAWA 2J1RA 4ZZ5A 1H6XA 1W6OB 4P9XA 2ID4A 2PFWA 1S0FA 1FT9A 1Y4WA 4XXAA 1D0HA 1PVC3 4JRAA 5IVVA 1GQPA 1DQ5A 4N90A 1DGWX 1ASJ3 3G7DA 3RNSA 3OYWB 4NO4A 4YVWA 1JBCA 4P9GA 4FI9A 3HOBA 5E6HA 4Y1XA 5D2AA 3B3QE 1VBC2 1W9TA 3ZSMA 1ZRDA 1LEDA 2W1SA 3ZYRA 1MQTB 3WF2A 3D3AA 2LROA 4QPGA 3E5XA 4U2AA 4JQTA 5FYYA 4RD7A 3AMPA 2SBAA 4DUVA 1SPPA 2JDUA 1RUG3 3J8F2 2XUMA 3NNLA 1AL23 3J26N 3U10A 1VBD2 1AXYA 2V4AA 4YVSA 4AFBA 1IHMA 3CO2A 4DRRA 2CYFA 3CZJA 4MXWB 1MEC1 3ZN4A 3RWKX 1G7YA 4YZ1A 2IXJA 5E16A 2VMGA 1QJU2 3MICA 1RUC1 4CDUB 5JSOA 5EFUA 2QQLA 4LTAA 5A32B 4FBFA 4YW2A 1HN0A 4IUGA 4PI2A 4DXTA 5GLTA 4YGBA 1LR5A 4BMEA 2WO2A 3HR9A 4LR4A 4QM9A 1QJZA 1LESA 3FZ3A 1AJOA 4UFMA 3M7AA 2OUHA 4P5HA 3WSOA 4XE9A 1TMF2 3DUIA 3H9AA 1CIWA 4WM8C 3VLBB 1NA1C 2WNUC 3PIJA 2FMYA 1YO8A 4IQPA 1AR91 4AEDB 3R4SA 5JXHA 3LQCA 2DVBA 1FOD1 4O7XA 2R1BA 2D98A 3KQRA 5A3NA 1ULEA 4CRQA 3OD0A 3EBRA 4HONA 1JU4A 3R4DB 1DIWA 1H0BA 2DCTA 2IUWA 2VBDA 1Z0HA 4NHXA 3ZYFA 4GULA 4Q8LA 1C5IA 1ND3C 4FVVA 4XQDA 5A7SA 2NQYA 2WS93 2XLGA 5FXZA 4Q29A 1QJX1 5HV0A 4NN0A 4WM8A 3AJZA 1NA1A 3OEAA 2WNUA 4WZFA 3NO8A 1JMUB 4KG0A 2ET1A 2IFRA 4GD4A 1JYWA 4RR3C 3OBZA 1QH7A 5FZMA 4AF9A 2FDKA 5A7WA 3BI3A 1EV11 5G04L 1OPOA 4UYBA 2ZZJA 1ND3A 2VVEA 1VB4A 3MFCA 2AENA 4NRPA 4QPIB 2VVFA 4QU2A 1IG0A 4XDOA 5F6LB 3WP5A 2PHLA 2D6LX 4WVWA 1L7QA 5L7OB 4RR3A 1O8PA 2PTMA 4PT6A 1V6JA 5FXWA 4CDXC 1F5FA 2DUQA 2JG8C 2Q8DA 1CAUA 2BNOA 2VG9A 4Q4X3 2QJVA 2XWBB 5I0TA 2PYTA 4KWJA 4MO3M 1W6NA 1RITA 5K0UC 1FAYA 3L2YA 3WCRA 3I2KA 3BGAA 3ZXAC 1R1A2 2VCBA 4E2GA 1XSQA 1NCQB 5F2SA 1YIFA 1WZXA 3JXSA 1TG7A 1V70A 2ZXQA 3NAPB 1IPSA 4L9BA 4OUMA 4XUTA 2XGXA 5KXCA 4CDXA 3B02A 3TYJA 2VOTA 3BYWA 2BYVE 2JG8A 5EZWA 3VBRC 1WCKA 5D1IA 1VIWB 2GC3A 1ENQA 1ZZ8A 1VMJA 5FPVA 3A0NA 2D43A 1C8NA 2D3RA 5K0UA 1NCRC 4FPCA 4CYDA 3DF0A 3B01A 1F15A 5JIUA 3K46A 3AKQA 4MUVA 4PIYA 1SLIA 2RMU3 4FP3A 5FPAA 1NOVA 5EHDA 2VNRA 1LGBA 3VBRA 5FAXA 3IZOA 3N7MA 4MADA 5JR2A 4QKFA 1PNGA 2EIGA 4CDQB 1D4M1 3N7LA 4CCEA 4ZHNA 3ZXGA 3MPPG 1NCRA 2VR4A 4LLOA 2PQQA 1L7RA 4IEXA 3SH5A 4ET7A 3ROUA 1JN2P 2W1WA 4UBGA 2WA4A 3I2FA 1SEFA 2FDJA 2XLAA 1OOPC 3PHMA 2WUHA 4NWVA 2BVVA 5C5TA 3ASIA 1FPN3 4RGAA 1RMU3 1SZBA 3SQOA 1LOBA 1UOGA 5FMCA 3WHTA 3FBMA 4AEKA 1GOFA 2VZQA 1W05A 2DTYA 1O6UA 3T2PA 1VBE3 3OGVA 4NMIA 1GFF2 3N7JA 3LKJA 5HCHA 2WKKA 1RIRA 3E5QA 4D6SA 1ULGA 2F4PA 2LRPA 1OOPA 3LWCA 4B4QA 5FP7A 3IPVA 2G1MA 1LTEA 3N7KA 2VQTA 2ZGKA 1JZ7A 3TEWA 3KCXA 2YROA 5JOYA 4XBNA 1XNBA 1RUOA 4IGPA 5EYXA 1IKPA 4LE3A 3RGBA 2RS52 4ATFA 5IK8A 5DAVA 1IS4A 2QQKA 2RJLA 1QJEA 4HT1T 4IL7A 1VRH3 3E6BA 4XUOA 2H0VA 5J36A 1UKRA 4ASMB 1XU1A 3ES4A 3VBOB 1JYCA 1S1AA 3N9LA 2CDPA 3D6EA 1OI6A 3D0SA 3THTA 3WD5A 4Q2FA 3DGTA 3L9JT 1D4VB 3M4FA 4HETA 1KQRA 1W8WA 1H30A 3UKVA 2VTXA 3K3NA 2OUJA 4O65A 1WCUA 2RM23 4JDMA 3C7FA 1SMVA 1WMFA 2ZKLA 3TOJA 1YJLA 3VZOA 4ITCA 4MGSA 4XW3A 2W95A 3X29B 5DAQA 1TNFA 1F2NA 2BQPA 4IDZA 5L9RA 3KCYA 1QJY1 4RQPB 1CZSA 1PMIA 4HKOA 2BDRA 4CU7A 1W2NA 1AX2A 2WO1A 3B9CA 4OUEA 4OHYA 2GALA 3GBWA 4AFCA 4ZZ8A 1BYHA 3KGZA 3R6SA 4AOCA 1O4ZA 2QQJA 3A4UA 3THDA 4AHWA 1IGOA 3FWEA 5BNPC 5FY9A 5C8CC 4NIDA 4FFIA 1DHKB 3EB7A 4EWDA 3MBWA 4C0BA 3N9QA 3DYOA 1ENRA 1LHOA 2VCMA 3UGGA 5AC92 5LW9A 2VMFA 3K48A 3WZ1A 3ZIXA 1MACA 4BB3A 1GZWA 3RDIA 2VZSA 4AQ2A 2P3YA 2DVFA 2ZGLA 3VB9A 4MGZE 5LBEA 3SEEA 3I2DA 4M4PA 2ZHNA 2GDFA 3T4VA 2XJPA 4JV4A 1UU6A 2D5FA 2W1UA 4GMP1 4QB2A 3T2TA 5C8CA 5KHKA 4PHZA 4BCUA 2F17A 1BBT3 1W04A 2QZ2A 4QPWA 1OBNA 1RUJ2 2Q4SA 4QHBA 3QBQA 1CONA 4NHKA 2GAUA 4OI1A 3WG4A 4UW6A 4BXFA 5F6KA 4SBVA 1PO21 1K3IA 1YXWA 2EALA 4AYUA 4BYYA 3RZLA 2BVBA 1Y7BA 4MV2A 4CP0A 3AVSA 2CAVA 2GNMA 3ZFGC 3ME2A 2BJSA 3C7GA 2BRTA 5B4XA 1DQ2A 5FY7A 4RN5A 4EROA 3NKGA 3VBSC 4Y22A 4IEVA 1W9FA 3LDBA 3O1OA 1PGSA 2RJ2A 4IXLA 1CAXB 2JE7A 5GZDA 4ES8A 5IFTA 1EP0A 3VZJA 4CU6A 1EAH1 4XMAA 3SITA 2ZGQA 3V0BA 1HB3A 3ZFGA 4XF1A 3CU7A 5FJHA 4MSVA 4DFSA 1W28A 4AI2A 4GZ9A 5SV8A 3VBSA 4EJRA 2GC1A 3J8F3 5D8AC 3WR0A 4CCLA 4DB5A 4QB1A 3RYPA 1OLMA 3MF6A 1LU2A 5KC6A 2ZAHA 2ES3A 2RR11 2JIJA 1GQHA 3LGRA 1GZ9A 2NMNA 3VZKA 1N1VA 1EPWA 3ZFEC 3LSEA 2VZRA 3FX3A 1ZZ6A 4JX0A 4Z92B 1J3PA 3DCQA 4OCTA 3T1MA 1QJU3 5A3LA 3NV4A 1NLQA 1CJPA 5LEJA 3I2IA 3PTRB 4CVUA 5D8AA 3C7EA 2EAKA 2ZOEB 4IGQA 3OUJA 2D7FA 3F2ZA 4K6BA 1WCSA 4XVHA 3WG2A 2AC1A 2YUEA 5FZGA 3ZXKA 1I1EA 3H50A 3O1PA 3ZFEA 1GICA 4LIVA 1IKQA 4CUCA 5BYNA 1R082 2CAUA 4B7EA 2WIIB 2JJ6A 5FYVA 2UY9A 1PK6B 1LHUA 4A3XA 4QX3A 1GUIA 4HFSA 4KG8A 5FZ0A 3PL0A 2VZUA 1WCQA 4YVSB 4AI0A 5GKAC 2Y0IA 4QDRA 1PGL1 4ZPIA 1YEWA 1D2QA 4EZHA 1G8WA 3KS7A 1XOYA 4M0NA 5FCCA 1LGCA 1AHSA 2EAAA 5FZ3A 2WC2A 3U11A 4B8EA 4M00A 2WZPP 2PHRA 3J4UH 4WVZA 2Z2SB 2OA2A 4XXPA 2BGOA 1MS1A 1Q8SA 1SCSA 4FQZA 5CB7A 3WXPA 5A3UA 5IYYA 4FTSA 1WMDA 4IEUA 5F5QA 5FZFA 3PVBB 5DN2A 5KHGA 2XOMA 4WM7C 3DYPA 5DG1A 1V6NA 3H0OA 1PZ7A 5B2GB 5E89A 4JRLA 4SLIA 4YW6A 5JIAA 2WQ8A 3PURA 3SCHA 2SLIA 2WFF2 4P9WA 5JXIA 1OD3A 1GZTA 2PHXA 5FJKA 3O1MA 1V9U1 2Y6HA 3HQUA 4XDPA 2FCUA 3NJXA 4MHRA 4URTA 2P6HA 4YW5A 3SH4A 4WM7A 1UZ0A 1PO12 1LOCA 5FMBA 1SCRA 1Y9GA 4WM8B 4K7JA 4XF4A 2A1XA 1AYM2 3K4AA 4QB6A 2WNUB 3N9MA 2N7GA 3OD4A 4YWAA 2VOVA 4K1YA 3WUCA 1ULPA 2C1FA 4K1ZA 4KMQA 5F9TA 1WD3A 5ABJB 4RYDA 5T3NA 4ORFA 4XYXA 1HJGA 4R4XA 4EE2A 3MIHA 3B00A 4P9JA 1ND3B 2W46A 4XFBA 1ND2B 3A7QA 4JHTA 2JICA 3I3BA 1RGSA 4XCBA 3O1TA 1AYN2 2ZTNA 1ULCA 4GH4C 5LEKA 2LTNA 3BIEA 3D82A 2P6CA 2VQAA 3B94A 3FE5A 4JTNA 3AKTA 3RRDA 1V6KA 4RR3B 5KXEA 2D6PA 3L2HA 3IIIA 1CAUB 2XJTA 2FD8A 5HXMA 1ASJ2 1VLNA 4LPLA 2OXBA 3AZYA 1RJ7A 4OHZA 1BLZA 5LY2A 3BODA 2ETEA 3C7OA 1W6NB 2X10A 1AJKA 4AHYA 2VW0A 2ZGUA 3H7JA 3FHAA 3PUHA 4PBPA 4Y26A 3WNMA 4GH4A 2YU1A 4NRMA 4FTEA 4FTBA 1RUH2 3AB0A 1WCDJ 2RJKA 3VD9A 2A7AA 1HXS1 2QBXA 3D5OA 3GXUA 4LBKA 2X29A 3OB8A 1ST8A 4IV3A 2JDZA 4P00B 2VE1A 1AL22 4K8RB 1FV2A 3ZYPA 1KFXL 1X8EA 1CAVA 4H2AA 3H3UA 4Q0SA 3U37A 1AZDA 3RZMA 1LHWA 1OH3A 1UY3A 5A1AA 1YHFA 5DZGA 2ZGPA 2ADEA 1SLAA 3ZPYA 1VBA1 5A3WA 1W2TA 5FPLA 3WDVA 1SFPA 5FO9B 1NXMA 2DWRA 4UAPA 2D3PA 1RVF1 1HRI1 2XHKA 3MHZA 4BH9A 1BK0A 4GWIA 4BU2A 1OMIA 2Z5WA 1QHDA 5DAWA 3VBRB 2Y26A 4M0HA 1YRZA 2H0BA 4PJYA 1OLQA 3AP4A 5HCFA 5GZFA 1K45A 1NCRB 2MPFA 2Q8EA 4JKKA 4JDOA 5JXJA 4ZXKA 3NQHA 2VBPA 4CDWA 1RUI1 1UCXA 4AEJA 2JG9C 4GIQA 4LORA 1S0DA 3I2OA 1UMZA 2C5DA 2DCZA 1GV9A 1R093 2JE9A 1Q8PA 2XH6A 5A6XA 3RG0A 5FWJA 5DUVA 4MGTA 2VOXA 3R0RA 2HWC2 2JB4A 5JMCA 1G9BA 2XONA 2E26A 4Q26A 4FAGA 2CU5A 2VAUA 1RUC2 3DL3A 4Q0VA 1JZ5A 1LB2A 3WDYA 1JOPA 1XNKA 3AZXA 3HAGA 5EIYB 3T0DA 1RUE3 2Z42A 1KXGA 2JG9A 3GCXA 3ZN6A 4Q8KA 2GU9A 1ZYBA 3T30A 1COV1 1GNYA 5FUNA 3ZMOA 3HQXA 5I91A 4IW3A 2D40A 4IV1B 4XOGA 5JPNB 1C8M2 1Q3EA 1LNSA 3N9PA 4TN7A 3GNEA 4LO6B 2QTWB 1GOGA 2DU1A 3WW1A 2XL7A 3NKTA 3E6DA 1NT0A 1SBDA 1N3QA 5GZGA 5K7PA 2ARBA 4PLOA 3WLUA 2PLV1 5GJ6A 2UWAA 5SV5A 1VAKA 3S7IA 4HSJA 5A3TA 1KD7A 4Z2AA 3VDDC 3UGFA 1IZ3A 4A7ZA 4J25A 4TZDA 2OW4A 1NY72 3UL2A 1PVXA 1AVBA 2WN3A 1B35B 2BGPA 2HEVF 2WWSA 3WX5A 3UYJA 3NMBA 2B9UA 4P14A 3U75A 3IT8A 3JBG2 2QQUA 2X5IC 3M70A 1MS4A 4META 3KV4A 1JOJA 2Q1ZB 3HNYM 1JS9A 3KT7A 5CIRA 3POFA 1AR71 4K8FA 3AZVA 3TBDA 1BEV3 3VDDA 3WF1A 2R063 4DRVA 3U4XA 2VUCA 2HWB1 3H1YA 2WBKA 2RMU2 4FQ4A 1ZNPA 2PELA 4AAPA 2ZGSA 4RSUA 2ZEYA 4Y1YA 2X53S 4LKDA 5EYYA 5J3UA 2E33A 2A73B 4DIQA 2HBTA 1IS3A 3BU7A 4PIXA 3ST7A 4B3NA 2X5IA 3POIA 1DP0A 5CEHA 4BA6A 1RUD1 1OH4A 3LSDA 4YM3A 2WZR2 5FZHA 1XQNA 4XFFA 2ET7A 2ZHKA 1KITA 3W5MA 2J22A 3Q9OA 1REFA 5EV7A 1CESA 3MW2A 5FPUA 4URAA 4S2DA 5FZ8A 3CLPA 1QQP3 4TYSA 1RMU2 4GXLA 3K4ZA 1ZBA3 1KJLA 1LHVA 1LOAA 3RJ2X 2VZPA 1ZREA 1VBE2 1REEA 2XBO1 4ZU4A 3MF9A 4W4ZA 4A6SA 3A0KA 3LDKA 4P02B 2XQXA 4CEYC 1UZVA 3OPWA 1W9WA 2QQVA 4XEZA 4HL0A 4OUSA 4KU8A 4M4RA 5FY4A 2QE3A 4W50A 4CCNA 4E4HA 1QF3A 4N53C 1JOBA 1VP6A 4FOYA 5DZEA 1Q5OA 2G9GA 2KXLA 3SLIA 2FQPA 2AEZA 2BOIA 4E27A 4TWTA 4ISQA 1VE0A 1US2A 3BUCA 5CKQA 4CEYA 1KS5A 4UFKA 3CBNA 3VKNA 2HWD3 4PBOA 4AVCA 4FPHA 3ES1A 4YPJA 4L8QA 4Y24A 1AF9A 4N53A 3AMHA 2RM22 4BZ4A 4BQXA 4Q1PA 2G4IA 5E1RA 2Q5TA 4V2VA 4IEWA 3JD71 1MS9A 1V0AA 5CFDB 4YG6A 2ZGMA 2LALA 2Q1FA 4QX5A 1W90A 2J1EA 4UFJA 3RYKA 2QQNA 3AMQA 3C3VA 1AL0G 3KF3A 5F3IA 4OHWA 4DXZA 3WEZA 2YFZA 2VMDA 1SQ4A 3ITQA 4LBMA 5ACA3 4CCKA 4Q4Y3 4C1WA 1FYUA 2C26A 4AVAA 1UKGA 3WDUA 4Q5OA 2CGNA 1W0NA 4CUBA 2VZ3A 3QACA 4GB32 3JU9A 3SISA 1S2KA 5DQ0A 4AFAA 1OD5A 3OBRA 4XABA 4LNVA 1IS5A 4A2UA 2RHPA 4Q4V1 1ZBE3 4TLGA 3BTXA 3ZYHA 1J3RA 4UFLA 3MDPA 4OHVA 4LK7A 5T5LA 2J42A 5CVRA 4JZRA 2HWF3 1HQNA 4AL9A 5FYZA 4EN0A 2VUAA 1F35A 1N3OA 1DYPA 2LS6A 1GQGA 4PCRA 4MGIE 3TN92 5C9AC 5LCWL 1JHNA 5T5OA 2ZKNA 2WN2A 4QU1A 2ARAA 3CEWA 1C57A 1JTZX 5H9QA 3ZMNA 4Z8BA 1CVNA 1O8SA 4INDA 2JDAA 2RE9A 4HMZA 1E5SA 5T50A 3H8UA 4I0BA 2RS31 3WUDA 4BOWA 1WMEA 1QXRA 5FZLA 5FP9A 1PVC1 4GKXA 4RHV1 1XE0A 2DCKA 4YW1A 2C6SA 4D69A 1E5RA 2E6VA 4N43B 5BY5A 2WO3A 3M3CA 4FPJA 3SCGA 4D7TA 4RGGA 4JKLA 1XXNA 3AFGA 5C9AA 1AR83 3AL6A 4QT6A 1MS5A 3PDQA 4NROA 5GLZA 1MS0A 4Y1UA 4CCMA 4ES9A 1DGWA 1GNHA 2G9FA 2HEYF 5CYYA 4C0HA 1DQ0A 2W92A 4UXAA 5J96B 1RUG1 2J1AA 1HRV1 4N9HA 3VBHB 3T3YA 2OPKA 5IVCA 3JQXA 4QD2A 2V72A 1N1TA 1A8DA 3ACFA 1RUH3 3U4SA 3FUOA 5C4WB 1XNTA 2VXRA 2RS13 3PVNA 4FSJA 2C4XA 3M8LA 1EPZA 1HKDA 1X9TA 1UL9A 4YZ3A 1FNZA 1OT5A 3QH7A 1S0BA 2JB8A 2HWE2 4V2WA 5FZCA 1UIKA 5CG9A 3S7EA 1VRBA 5HI0A 4R9DA 1S2BA 4FPKA 1RUNA 4J1WA 4FFGA 1I9RA 5GZEA 1D7PM 2WSVA 1NYWA 3ZYBA 5FQ0A 1DZRA 5KR7A 3NJVA 4QX2A 3W58A 1UY0A 2IFWA 4GALA 4JQRA 4MX3A 2W52A 2MEV1 1SBFA 2K9ZA 2WYFA 4JGYC 1E5HA 1GWLA 2JDNA 4NIAA 2W5FA 1YJKA 5HCBA 5FZEA 3C2UA 5JLVA 4GA9A 5T54A 3MV11 1O4YA 4HVQA 5LZ6A 1FMD1 3N3HA 3UT0A 2WS91 2DBNA 4IESA 4BHPA 4IV3B 3G6JB 2JECA 4H7LA 5B4NA 3MUY1 2YMZA 1VPHA 1H8TB 4GKYA 1T2XA 4Y33A 2R071 4JGYA 4W6YA 3SCFA 3S5QA 1HW5A 4BM8A 2PAEA 5BUVA 3ZYJB 2ZGRA 4YGDA 2OQ7A 4PDWB 2HWC3 4P9IA 4Q4W2 5LK7B 1CZTA 4BIOA 4LMFA 3SNMA 4Q0PA 3ZO0B 4CPBA 5JAXA 1MS8A 1RUC3 3VD7A 3EJKA 4LE4A 2DTWA 4WBBA 4KGQA 3WF4A 4LKEA 2JXAA 1YLLA 3MIEA 4OULA 4K21A 3ILNA 3AKPA 4XJ9A 4LHKA 4NOTA 2CDOA 4Q4X1 1QXJA 5KWRA 2WLPA 1QDOA 2C9AA 2D6KA 5BPXA 2UYAA 1C8M3 5K4LA 2UY8A 2XVKA 1XNDA 3HEIA 2Y34A 3HT2A 3LIHA 4RS5C 4EWAA 2WZ8A 5FIXA 4CP1A 1FOD3 2A6YA 4A3ZA 5IW0A 1AXKA 4I3PA 1PX4A 4CP9A 4DQAA 3V65A 3VZLA 2VGDA 5FYTA 2DVDA 1V6IA 4L97A 1QJX3 4C90A 5JZGC 4AHXA 2D6MA 2CTVA 5CG8A 5IHRA 4RS5A 2GP3A 3LA2A 4U36A 3ZN6B 3O5SA 2Y6FA 3JBG3 3LDRA 3LPFA 3WDWA 2B46X 3OPTA 5FZKA 4HXCA 5GLUA 5CISA 3LA3A 3HNMA 1I5ZA 1TME2 2JDPA 4AQTA 3H8XA 1QGLA 4UW4A 2HKXA 1H8VA 4K3UA 3E97A 4B4RA 4MGKE 2XL9A 5JZGA 3I49A 4DUWA 1OF4A 3PU8A 2X05A 2XJVA 2A3YA 3EXUA 3Q8AA 4JGZC 4Y5Z0 2A6VA 3I3EA 5I93A 3FL7A 3N35A 1OUSA 3AKRA 2Y33A 4QQHA 3WP4A 3N9NA 3R05A 4HK8A 4BISA 3ZXEA 1FPN1 3RI8A 3CNAA 1YYNA 4HPKB 3PVEA 2WZR3 1YCIA 3AP5A 1W9YA 2F6BA 5LATA 4YYOA 1GR3A 3RZJA 4P5YA 5FP3A 4FPOB 2XUEA 4JGZA 1GSLA 4Z1VA 3LFIA 1UMIA 2JKXA 1WLWA 3VD3A 1XYNA 4IEOA 4LBNA 1K5MC 5LA0A 1RUF1 5I8TA 3ZR6A 2HJIA 3KLSA 1AR62 4F7ZA 4HKLA 4HN1A 2D3SA 4CCCA 3LEIA 1SACA 4YM2A 1PMJX 4NIIA 1VRH1 1MZEA 1C1FA 2W87A 4LO5B 2JEMA 4BQ5A 3I2JA 2B39A 4R9BA 4OZXA 4XAEA 1ZZCA 2JIGA 2RDRA 1K5MA 3OEBA 1GP5A 4YFZA 5CFCB 2ZGNA 1S0GA 3DKWA 5FOBB 2YC0A 1ZRRA 5FUPA 4BQYA 1OF3A 1UO9A 4NHYA 3ILRA 2CGPA 1MR5A 3P1IA 5I0SA 1XPWA 2VW1A 3C7HA 4CU8A 4DY3A 1ZZ7A 2JD4A 3LD8A 3V0AA 3FFZA 1R092 1YI7A 2IXIA 1PIV1 2W94A 1W8UA 4UI9L 2TEPA 2ZACA 4NJ4A 1WLTA 4AVVA 1P8JA 1XYOA 5JSPA 4HVRA 1OKQA 5A70A 1OUXA 1W0OA 1XJAA 1AXZA 2B4KA 3OCPA 5DDJ1 1XNCA 2JDMA 1XRUA 2XQRA 3LOIA 1DZTA 2R041 1RUE2 3H1MA 1UN1A 3WQBA 4AEMA 2L9LA 2ZEWA 3GHMA 1NAEA 3FMGA 4E2QA 3N9OA 4LUKA 3KWVA 3DPRB 1X36A 1O59A 2AUYA 4LBLA 4QM8A 1MPXA 1HLCA 4BDVB 3CKHA 4XFGA 3ZPOA 2AGSA 2ZMLA 4RGKA 3UGHA 3D8CA 1NG0A 3ZDVA 4RA0A 3KD4A 4GB33 3OY8B 1FXZA 2WRAA 3U07A 2IVIB 3RZKA 4RFRB 3W20A 5FYSA 5KHHA 2IXCA 3IAPA 4WVMA 3J7NA 5EPAA 2P1BA 3PMSA 3H3LA 3F95A 1BBT1 1FNYA 2OIIA 4UF0B 4Y20B 3VBFC 1UF2C 3TEZA 5FDBA 3QH6A 2GN7A 4FOQA 5EJ1B 1LCLA 2ZX4A 1SLTA 3VBUB 4DO0A 3NRUA 1X8MA 1YWKA 3DXTA 4KQ7A 3TN93 4R9CA 3DECA 2GP5A 5FZ9A 5LA1A 2DURA 1A8MA 2IVJA 4LOSA 3SMHA 1A78A 1SFNA 1BCXA 3VBFA 5JMOA 1XBFA 2OQ6A 1QJY3 4A42A 4QGLA 5FO8B 1ZZ9A 3INAA 3AXDA 4FOWA 1YFXA 2WYSA 5L19A 1BEV2 2R49A 4JHZA 2AH2A 2R062 2VL4A 4LO8A 3WNPA 5FTTC 1SLCA 1VBC1 2XHNA 3Q8BA 2WWJA 3I59B 5BNNB 5HPOA 2GNBA 4QHZA 3NSTA 3EO6A 4I0WB 2FMDA 4OLLA 3W5NA 3FC0A 3MIBA 4AW7A 1H2NA 1EUUA 3J8F1 5CZKA 2A71A 3M3IA 5A7NA 3S57A 4GWNA 5KXBA 1DCSA 1VBD1 1YFYA 1VBB2 4HANA 4Y5TA 1UXZA 5FYCA 5JVVA 5IATA 2Z79A 1U12A 2CHHA 2ZHMA 3VV1A 4QX1A 3KB5A 4XQWA 5A3PA 1G6NA 2MHFA 3P3NA 1XC6A 2AEYA 3JB8A 1H2LA 1QJU1 3MGUA 4GMP3 1OVSA 2ZPXA 4B1LA 1QQP2 4YG0A 4COZA 4D6QA 4Y4YA 5JDBA 1RHI2 1ZBA2 1LRHA 4CZSA 4B29A 2HWE3 1CR7A 1KGYA 3H1WA 4MHUA 1H1AA 2P5BA 3ZR5A 3ZFFC 2D93A 1OA4A 5I0DA 3RWNA 1PO23 1CAWB 2OVUA 4TLFA 3HBZA 1BMV2 3MFAA 4ARYA 5F39A 1TMF1 3OSDA 3AVRA 3K75B 1RINA 2Z69A 1XB9A 1OA3A 4W6WA 4YVWB 2UYBA 3WVJA 5E8AA 5CKMA 3POJA 3ZFFA 5JPMB 4QPGB 2DUOA 2WT1A 3MLLA 4O61A 3POBA 1EAH3 2WNEA 4YM1A 5LBFA 2DYCA 1SPPB 1HN1A 3NV2A 3MIGA 2X09A 2BNNA 3VDBA 2GMEA 2XJRA 4QX0A 4FAHA 1PGW2 2HWD2 5GM0A 5IAVA 2R1DA 4ARXA 5DUWA 4AVSA 2WNVC 4XFCA 3KHCA 2RR13 1J1LA 4GWJA 3KSCA 4PI0A 1S4CA 2FBEA 3VHOA 5KBFA 2RV9A 4Q4W3 3CL1A 1DGRN 3GYDA 2BWAA 5LA9A 4K9SA 1J1TA 2QDRA 4I3GA 1W99A 4LITA 4UT5A 5LRSA 2HEWF 3WNXA 4XFHA 1LAJA 2PHFA 1GP6A 1NLRA 1F31A 2YGLA 3HBKA 1IQAA 3CQOA 3BU0A 2ZZQA 5C8WA 3VKLA 2VCAA 1GLHA 5ERLA 5ACA2 4Q4Y2 5LRRA 3MLJA 2JDHA 2EVXA 3APBA 4IGOA 4XJAA 4J1XA 3ALQA 3H3ZA 5C6CA 3EMRA 3OGRA 1R1A1 1ZBE2 1CX1A 5A33A 3IDEA 5FLIA 2VMEA 4QGMA 5F37A 4LLFA 2ZBJA 4QXCA 4LBQA 3B7MA 1DLLA 3DN7A 2HWF2 5DUUA 2QQIA 1OA2A 3CMGA 1NA1B 2EXJA 1W6PA 3K51A 2BBVA 4M01A 1MZFA 1YC61 5FZOA 3WY6A 5F2WA 4CUAA 4ZONA 3H8RA 5A7WB 3VDAA 5A7OA 2ATFA 5FLHA 4E4ZA 1OQDA 1SFYA 2A3WA 1W6OA 4CCDA 2E31A 5IAXA 3FHIB 3W21A 1VAMA 4LHLA 2ZMNA 3IDAA 4Q0QA 3I54A 1TME3 1WUVA 4CCOA 1AR82 3PUAA 3OYWA 4KWKA 4I2OA 2VUDA 3ZSLA 2IXKA 3WQ7A 4XHXA 2PHUA 3ZYIB 3PIGA 2P3IA 3VKMA 1V9U3 3OGJA 2Z4FA 1O3SA 4NR1A 3ZXJA 4HBNA 4XBLA 4DPNA 3MW4A 4I09A 4QXBA 5DG2A 4XF9A 3VD5A 1Z7S2 1GNZA 1GYKA 2PAKA 3CF6E 3WOGA 3ZXDA 4CDWC 2RS12 2WT0A 5DPNA 4MXWA 1OFSA 5FZ1A 4OI2A 4YZ4A 3AP9A 3GJAA 4CDXB 4DXSA 2W39A 2JG8B 3AFKA 1QKQA 3PVOA 2VVDA 3OPZA 2KD7A 3Q8EA 2A5ZA 4BE3A 5A32A 1F8VA 2E51A 4R9AA 4QXHA 4AEDC 4CUGA 4QQPA 5K0UB 5FMOL 5CAZA 1JYVA 1XU2A 4UFHA 4IEZA 1XNAA 1WLCA 5IWFA 1K5JA 1AR63 3ZSEA 5JZGB 4YZ5A 2RS51 3AM2A 1DDLA 3P3PA 3EYPA 3OUHA 4OMCA 1M06G 2BOJA 4WV8A 1ONAA 4HK9A 1QOSA 3VL9A 1UWWA 4JKMA 2GH8A 2XR4A 2CWSA 2O1QA 1CWPA 4AEDA 4AFMA 5AVAA 3KV6A 3VDCA 3GF6A 4NUBA 5IK4A 2YC2A 4RFT0 1JW6A 1POV0 4F8AA 3NNJA 1POQA 5KXDA 5JWPA 4NPLA 3OF1A 5FZAA 1HXS3 3M3OA 1JUHA 4XF3A 1QOOA 4AE2A 1VR3A 3NNFA 2YB7A 2VOKA 2TUNA 2UU8A 2E7AA 2WINB 3VKFC 2RG4A 2ARXA 3NL1A 1W6MA 4FPGA 2AYHA 1RTVA 3WINE 4NWWA 3O1VA 5IT6A 2QVSB 1MEC2 2ZX3A 2O8QA 1CD3G 3PJQA 5EWSA 3IM0A 1OOPB 4G4FA 1JI6A 3D4KA 3IPVB 1S0IA 2J1TA 4ZU7A 1OQEA 3ZYGA 1CPNA 1RVF3 1Q56A 1K42A 3IDBB 1JZ6A 2WAOA 2GNDA 1DZQA 1WLDA 2I45A 3W9AA 2I2SA 2BUKA 4DMIA 2VZTA 5AC91 4KBBA 1DQ6A 5I8YA 3JQWA 5JI7A 4XFIA 1GU3A 2WQZC 4Y4RA 1J3QA 2ERFA 3ECQA 3GCWA 1A34A 5AFEA 4UWDA 2QQWA 5F3CA 1AR92 1W8OA 1WW6A 2ZHLA 4NVPA 5DAXA 3PLQA 3RZZA 1FOD2 1RUI3 3KT1A 2W0XA 1WBFA 3WG1A 3ETQA 5FZIA 2R072 1QJFA 1S0CA 1RUJ1 1IPKA 2GC0A 3AYAA 5T55A 4E9KA 1JZ3A 1WW5A 1QJX2 1RXGA 4P9LA 1QDCA 3NV1A 1YNAA 2NP0A 4YW3A 4LK6A 3ON7A 2QQPA 1UOJA 5FP8A 5CADA 4P08A 3O14A 4KI5M 3ABZA 1YIPA 1LENA 1W3VA 2R32A 1O3TA 1EV12 4XDQA 4Y1ZA 1A6CA 3JB4C 3I3MA 3WG3A 2R16A 5F32A 5FBJA 4AVBA 5C3RA 1OLRA 2DBIA 3QD6A 4E4SA 3IMNA 1FX5A 2V09A 2YU2A 3SKVA 4R8HA 1GZWB 1V6LA 2RDQA 4KWUA 4QWNA 3LPGA 2PLV3 1UZZA 3KV5A 1VBB3 2ZGTA 3A22A 5A3MA 3WHUA 4XHBA 3OJBA 1WKYA 5BNPB 1LGNA 3J9SA 5M0TA 5C8CB 3R4UA 2WNOA 4H7MA 3ZDSA 2AR6A 2DCYA 3OBTA 4ZU5A 5FP4A 3ZKUA 1AX1A 3OOXA 4IE0A 2BW8A 1HQLA 5J48A 1RHI3 3NJYA 1UAIA 1W2UA 3AC0A 4BJ0A 4AI9A 4HVOA 4PF1A 3J7HA 4L11A 5DABA 5FY8A 4CXXA 2PHWA 3VBOC 2KR2A 1HB4A 1AR73 1WW7A 2WWUA 4QKNA 5D21A 4OI0A 1R081 3T08A 4DINB 2KM2A 3LEMA 2E63A 4Y22B 2B5HA 2DVGA 3I2HA 1NQJA 3GBFA 3RZGA 3LEKA 4PLNA 5I8SA 1QY4A 5F3EA 5LBCA 3USUA 4XMIA 1TQ5A 4I30A 4UW5A 4XJUA 2E53A 2LUWA 4N8MA 3UNPA 3SH3A 3AMMA 2ENRA 2Q1MA 1D4M2 3BTAA 4Q1RA 3GJBA 3V0BB 5KHJA 3KVBA 4RQPC 4OFGA 4XILA 5DZFA 5APAA 3WDXA 2AZ5A 3ZFGB 1JZ8A 5IVEA 5IFPA 4EYUA 3VBSB 3RMXA 2VXJA 3VGIA 4F3JA 1S0JA 1TE1B 5GLVA 1W8ZA 3K2OA 3QCWA 3GZUC 1HV0A 1UNBA 2I07B 2W9XA 5L9BA 1L3JA 1S0EA 2PN5A 4IE4A 3WF3A 2JX9A 3CHXA 1VMFA 1REDA 2FZ1A 2O14A 4AFDA 3HMYA 1JZ4A 4FP2A 4RQPA 1EUTA 1V6MA 4KH9A 3GBGA 2F4LA 2YZ4A 1H1MA 4YARA 1UY1A 2OX0A 4QDQA 4F83A 5D8AB 2WFF1 4AI8A 2CWMA 1L7LA 2QUOA 5FZ4A 3P5BA 3ZFEB 1SDWA 3QOPA 4M3CE 1ODMA 2P17A 1TZOA 4N7IA 4PQQA 3ZFFB 2DFBA 1URXA 3POGA 1UX6A 3PUSA 4NHMA 5BNOC 4BIFA 4MOAA 4MG2A 1GZCA 3HQRA 3NNGA 4XQ4A 2YDEA 1PO11 1W39A 1GBGA 2VECA 5LB6A 1AYM1 1CIYA 2VJXA 3AX4A 1DYKA 1QNYA 1QNWA 4FO9A 1S2EA 2IC1A 4UFIA 2W91A 1JHJA 2R6QA 3GM8A 5JR7B 3AZWA 4FPFA 4BQ1A 4I02A 3OGSA 4O9EA 2AREA 2Y6LA 1H2MA 1OURA 1ALYA 2WAAA 3O0VA 4X8PA 3TNQA 1POV1 2ZEXA 5BNOA 4CEWC 5IK5A 1X50A 2E7TA 4O9GA 1X33A 1KDKA 1JYNA 3GZTB 4XIKA 3I97A 5FV3A 3FFQA 2WJSA 4CSWA 1AYN1 3WQ0A 5A6YA 3AXEA 3GALA 1E57A 2UWCA 1BJQA 4LULA 4FFHA 1ZM1A 2AACA 1HV1A 3U14A 3U0ZA 1QJY2 2UWBA 4CEWA 4YGCA 1AUYA 4WZCA 1ASJ1 1KRIA 2VMHA 5FO7B 3KGLA 3USSA 3SXWA 5K9YA 3RYRA 3MO4A 2XXZA 5FOJB 1CAXA 2IZWA 3M1HA 5BXXA 3OGGA 2Y6GA 3ZM8A 5T5JA 4AWDA 5ANNA 2A70A 2B8MA 3FJSA 3NVCA 2J1UA 2YYOA 4D8MA 1RUH1 4DOUA 1ZRIA 3MYXA 2XJSA 3S30A 4AK3A 2QZ3A 4XTMA 2QQOA 2VUJA 3I4IA 1DQ1A 1AL21 1E5IA 1U5ZA 2CNAA 4WM7B 5IVYA 4JTOA 2C24A 5T52A 2A3XA 1FV3A 1SDDB 2RDSA 3BB6A 1Z7S3 1U5IA 4NPMA 5FPZA 5FYBA 5FZOB 4EQVA 1X9PA 3LFMA 5JUVA 4L0PA 3UKNA 4R52A 2MNGA 2EICA 1WD4A 4V1PA 2Y6KA 4OHXA 4AI1A 1CN1A 1PK6C 3IAQA 2RS33 5FZBA 1N3PA 5H9PA 4RHV3 1PO22 4YVSC 1LECA 5E88A 3THPA 1MZ6A 5CKNA 1HB2A 2WL1A 4YLZA 2BFUL 5JXGA 2ZABA 5AFBA 4BQ3A 2YBSA 2D5HA 1OFNA 3O1SA 3KZ4C 3S6PA 1PK6A 2OS2A 5KC5A 2D6OX 1HRV3 1N47A 1G9FA 1AX0A 4GH4B 1QWRA 5CA6A 2CL2A 1EAH2 1UD1A 5C70A 4EZ4A 1PNFA 2B42B 2HWC1 4COYA 2CY6A 3HWJA 2HYXA 1CAVB 1ULOA 3VHNA 3K4DA 5L9VA 3E1F1 2VH9A 2B45X 4DEVA 5IVJA 5C3SA 5I0RA 2XB6C 5FKBA 3UETA 2RR12 2FCTA 4HKWA 2YGMA 4LHNA 4W6XA 5LBBA 2OYZA 1APNA 3QLQA 1MEC3 1BVVA 2XLFA 2KA3A 3IWZA 5F5IA 1TEIA 3T1LA 1C8M1 4C1XA 2ZCWA 1WBLA 3H7YA 1O5UA 2OKXA 2V5YA 4E4DX 1ODNA 3OUIA 4MLOA 3SHRA 1DYOA 1YUDA 4PQ9A 4GMP0 2MEV3 2C9KA 3NW4A 4FPYA 3FLRA 3LCPA 4A45A 3POYA 5ABJC 2R0HA 2VPVA 2NPIA 3HPNA 4LO7A 1RL3A 3ETPA 1BQPA 3K77A 5A6QA 3U78A 1FMD3 3BN6A 4CDWB 2BZDA 2VY0A 1ND2C 4BQWA 1AR93 3JZVA 4RL7A 1NY71 4DZGA 1Y3TA 3H8OA 4LHSA 3RS6A 2GH2A 5IK7A 1W6MB 4B4PA 1UXXX 4CCJA 4EN6B 4IEQA 2R073 4K40A 5FRAA 3KVAA 1PGL2 3BALA 2ZA9A 3JBG1 5ABJA 2UURA 1SLBA 2XG3A 3JCIA 4XZPA 1FI2A 1D0GA 4YG3A 4A41A 3ACGA 4TXWA 1D2SA 1OKOA 2WQ4A 1ZRFA 1W2OA 2QKDA 2VQUA 3VL8A 2VU9A 1LHNA 4HG6B 1ND2A 1YQ6A 1Z78A 3E5UA 1G9DA 2JG9B 3O1RA 3ORJA 2DFCA 1CX4A 5FYHA 2RMU1 2Y6JA 3OG2A 3B93A 3POEA 4Z82A 2G9ZA 1VJ2A 1PM7A 2FDIA 2WFPA 1LOFC 3DEMA 1B09A 1EV13 2XVGA 4MXVA 3H42B 4ZS3A 5FY0A 2CSGA 5DAPA 3URFA 4A7YA 1WMXA 2PHDA 3EQEA 2ILMA 2WZR1 5G05L 2R30A 2EIDA 2P3JA 2H6BA 3KT4A 3KMHA 2V5DA 4IE5A 5FZDA 3FBYA 5DXDA 1QEXA 2JDKA 4CPBD 3ACIA 4FT8A 1V9U2 4N7UA 4C91A 2Y0OA 2YHJA 1I5PA 1NE4A 4LUMA 2WLQA 1LOFA 1RMU1 4AAXA 1GWMA 3TAYA 3WNNA 4LIUA 1VAVA 3NJZA 4BMBA 3D0JA 2WABA 1OSGA 3WNKA 4I0AA 1W06A 1IOAA 1QH6A 1HQWA 2BWCA 3T0AA 1VBE1 4B7KA 2XDVA 1M4WA 1JYIA 4MGQA 2OT7A 4YSFA 4G9SB 3VD4A 4AI3A 4HLTA 1LU1A 1US3A 1H9PA 3I8TA 5A3OA 3VDDB 3TRSB 3OTFA 3KCCA 2FDFA 1JUIA 1GMMA 2GNTA 1QU0A 3HN3A 1HDKA 3RJRA 2P3KA 4H3WA 4OYUA 5EJ3A 2JDYA 3AYEA 2X5IB 4QXKA 2ZEZA 3T09A 3MZHA 3LAGA 4S2HA 1F9KA 1D4M3 4OMDA 1O3QA 2EXKA 2WZEA 1PMHX 1BVP1 5F7UA 4FXGB 2RM21 3IIAA 5JSRA 2K46A 1HXS2 1PX3A 2QCSB 2XJUA 1H1IA 3ZXLA 3BTYA 4IV1C 2TBVA 3LOBA 1JH5A 4AQ6A 2BERA 1UYZA 1I3HA 1ZZBA 3KHBA 4ZY9A 3T2OA 2IXLA 2HBUA 4OVEA 4E8CA 5CNAA 5FKCA 4E8DA 2JD9A 3BOPA 1RUF3 1W8NA 3MIDA 3BPZA 1VBA2 5FFOC 1JXNA 4GB31 1RVF2 1UX7A 4LEJA 1HRI2 4IV1A 2PHTA 2OZJA 3USUB 4CE8A 2QQMA 5IJRA 1JZ2A 1JYTA 5ISLA 2Y8KA 4DS0A
chains in the Genus database with same CATH topology
1MVEA 1WW4A 4AVTA 1B35C 1WA4A 3NV3A 1I6XA 3UK9A 1DFQA 3PMEA 1CQ9A 1C4RA 5EXOA 3UJOA 1UZYA 1LKNA 3M3EA 1TNRA 2ZX2A 3CJIC 4CEYB 3TN91 4J6GA 5JOWA 1ZA4A 4EWEA 1RUI2 4NPRA 2ZX0A 2QNKA 3LA7A 1G9CA 4N53B 1B35A 4AGRA 1MZ5A 4QPYA 1PIV3 1O91A 3CJIA 5DDJ3 3VHPA 3ZX7A 5HBAA 2NN8A 4CP2A 1U5YA 2P2KA 5FPXA 2R043 4KGGA 2D44A 3UJQA 1MVQA 4XETA 1COV2 3O7OA 5CU1A 3ENRA 1CPMA 1DQ4A 1R1ZA 3MEPA 4KL1A 3VKOA 1FATA 3BOWA 4YRDA 1C3HA 1S55A 2PLV2 5BNOB 2O0OA 1J59A 3E6CC 1UPIA 4I01A 3UV9A 2HWE1 1IS6A 1CGPA 3M3QA 4S2GA 4MYEA 4FPEA 4P9YA 5JCTA 1XYPA 3B9IA 4KU7A 3ZXFA 4KWLA 2A6ZA 4FOVA 4CEWB 4M3CA 4MZUA 1J58A 2R0FA 5GLWA 5C9AB 1AR72 2NLRA 4NHLA 2HWB2 4COWA 1VBC3 2PAMA 2VNGA 3I7DA 4AHZA 1O7FA 3AJYA 2BEOA 1LEMA 3RPQA 1YI9A 5CFDC 1BK1A 2GMMA 2GSYA 3MW3A 2QFEA 2VNOA 4QQOA 2FHRA 4UW3A 2NYYA 1RUD2 1VBD3 3HIFA 2VULA 3B69A 3EHKA 3DV8A 4X8NA 1KDMA 4YFWA 4Q4W1 3W59A 4QQ2A 4AXOA 3AMNA 4QMAA 5CFDA 3MI8A 1ZRCA 2NZ9A 4R4ZA 5FQ0B 3ATGA 2BGCA 1BZWA 1H9WA 2DF7A 1UIJA 2QDNA 2XBO2 2ZX1A 5J37A 3KM5A 1ULDA 4GWMA 4COVA 1RB8G 1TMF3 3ZN5A 5L36A 3LB9A 3GHNA 3WT3A 1NQDA 2WNVA 1OQ1A 3HN1A 2CV6A 3TNPB 3N36A 4N9IA 5J98B 3AK0A 3RI9A 1Q43A 1VB2A 1W6QA 3AZZA 1OHFA 4N43C 1BKZA 1PZ9A 1UU4A 4JGYB 1C1LA 3ZIWA 2ZJCA 4BLJA 5I0UA 4XIOA 4BWOA 4W65A 1T6GC 5BV6A 1TME1 3VBHC 4S2FA 3JD72 4N43A 1MQTC 1RC6A 2DCJA 4FCAA 4JVAA 1LOGA 1PHMA 2OZ6A 4E2SA 2W68A 5C4WC 4GQ7A 2BNMA 2A6XA 3POWA 3S0MA 3IKWA 2ZMKA 1KJRA 1DGLA 2IWGB 2VQ0A 5F1RA 4PLMA 1LULA 3VBHA 2EXHA 5HXVA 5GZCA 4LT5A 1MQTA 5H9SA 1R1A3 4Q4V2 4CDUC 3FLTA 5C4WA 1SLLA 1UU5A 3TWIA 1ULFA 3FLPA 2XKOA 5BNQA 5FMOS 1VALA 1O3RA 2JENA 2NM1A 1Q8VA 2VMIA 1AR61 4RS5B 5KHIA 4L2NA 4MGYE 3O12A 3WP3A 3WCSA 4CDUA 1KS4A 3AYCA 4IV3C 2RS32 1PVC2 4RHV2 2ZAAA 4LBQD 1YFWA 1H8TC 4IETA 5C33A 2VOWA 1NE6A 4KNCA 4AGGA 3VZMA 2W08A 2K0GA 4CTEA 4PDWC 4LA2A 1WGPA 4YW4A 2VW2A 5H9RA 1G9AA 4Z07A 3CJXA 3MLKA 1RUG2 2V73A 1HRV2 2PA7A 4Y1VA 3GZAA 1H8TA 1R091 2ZGOA 5JOZA 1UW8A 4AG4A 4XJZA 4JGZB 2O8OA 4PDWA 4A7KA 1A3KA 2X8KA 3POSA 4PIZA 4QPIC 1N1SA 1DBNA 4YGEA 3IN9A 1RUE1 4QGNA 5L7OC 2DV9A 4JDNA 4XJ8A 4OI4A 5J09A 1C5HA 2XKPA 1VBA3 2RS53 1O4TA 1LOEA 3WW3A 2LM3A 5AVPA 4FXKB 4QPIA 1NXD1 5L73A 1HRI3 3IDCB 5T5PA 2Q0AA 4MVTA 1K5MB 1NCQC 1N1YA 1W0PA 2MEV2 3NAPC 4Q0UA 5L7OA 2TNFA 1LODA 2WSUA 1KFUL 2I74A 2XWJB 3ZSKA 1IPJA 4H14A 4QQLA 3WV6A 1FMD2 1QOTA 2WS92 4ZKTB 5GALA 1G86A 2DVAA 2WT2A 4XJWA 3VHRA 1ENXA 1ZX5A 3ELNA 3V0AB 2BTVC 1NCQA 2EA7A 2A6WA 3NAPA 4LO4B 2D97A 4G3YC 3LZZA 1Y9QA 1XE7A 2DU0A 4ISRA 4EN8B 4K20A 4YNIA 1BEV1 1C28A 4CDQC 2R061 1H2KA 1H4HA 5FLJA 1X82A 2EXIA 2ZS6B 3VUOA 1COV3 5AC93 1QXPA 3ACLA 1DF0A 1UPSA 1VBB1 4Q4X2 3WQ1A 4CDQA 5IUQA 4HPKA 1Q8QA 4WVMB 3BIWE 1GKBA 1V00A 2BPA2 1ZVFA 1QQP1 2Q8OA 3ILFA 4IEYA 1RHI1 1ZBA1 1HX6A 4JCKA 1RUJ3 4FPLA 4D7YA 3IBMA 1EYBA 3CJIB 1DGRA 1NLSA 1BMV1 2GZWA 5CFCC 4UBHA 3V64A 3VBFB 3HD8B 3O0WA 4BLIA 3AP7A 3WW2A 3ZSJA 2B7YA 2D6NA 2FZ2A 3AYDA 4YZ2A 1U0AA 4JAAA 2HWB3 3B5LB 2K2SA 5CFCA 3WP6A 4PF5A 1QMJA 3PJYA 3AKSA 3VN4A 1PZ8A 4LA3A 5K8SA 1RJ8A 1PGW1 1Q8OA 1XE8A 2NMOA 2HWD1 3VBOA 4ATEA 1FPN2 1RUD3 3ZVXA 2YXSA 2XVLA 1V6OA 1NZCA 3DPRC 3M2MA 3MPBA 1OPMA 4EN9B 5JOXA 4D7SA 2Y38A 4M3CB 3RQ0A 2A75A 3WW4A 2JKBA 4D3WA 2XPJA 5J7MA 3RSJA 1RUF2 3VZNA 1DU3D 4JC1A 2CGOA 2E9QA 5ACA1 4Q4Y1 3DPRA 1ENSA 4XPVA 1R083 2XBO3 2Q30A 1U5XA 2GMPA 1VRH2 3VBUC 3AP6A 1F5JA 4COUA 1Y43B 1ZBE1 1SBEA 2E7QA 3BCWA 3O0XA 2YY1A 3OY8A 4H55A 2GC2A 3RMYA 2H6CA 3PNAA 4IERA 4DY5A 2HWF1 4Y20A 4ONUA 5FBZA 1H4GA 4ASLA 4X6RB 4XFAA 3FUQA 3VBUA 1GANA 2GN3A 4M3CF 3V56A 5BNNC 5LK5A 4D94A 5HCAA 1CJDA 2HYKA 1PIV2 4XTPA 5FREA 5DDJ2 3JD73 4BPZA 1AR81 2EF6A 4EN7B 2P34A 2R042 3HT1A 4Q27A 1MS3A 4XF0A 2WFF3 2WNVB 5BNNA 3MIFA 3I59A 5CBLA 4WVVA 2P37A 2YV8A 4IEPA 4AGVA 5DUXA 1DG6A 4HN0A 3WDTA 1W6QB 3UKTA 4EV0A 4TSVA 3N4MA 1PO13 1Z7S1 4AQSA 4HSLA 4L92A 5A33B 4EROA 1YFUA 1AYM3 5TSWA 1HIXA 2RS11 4X6QB 1EY2A 1O5LA 3TB0A 2IXHA 4Q4V3 4LBQB 1X7NA 2YPJA 4HZFA 4DNYA 1BXHA 1BBT2 5JI9A 4XBQA 2WA3A 4L99A 2XJQA 1POV3 1W6PB 4LBOA 3PTYA 3NWKA 4LBJA 4YM0A 1LJ7A 4YVWC 2DUPA 3JUUA 2C0ZA 4MH0E 2BFUS 4QPGC 1AYN3 1CAWA 1W6OB 4P9XA 2PFWA 1S0FA 1FT9A 4XXAA 1D0HA 1PVC3 4JRAA 1DQ5A 4N90A 1DGWX 1ASJ3 3G7DA 3RNSA 3OYWB 4NO4A 4YVWA 1JBCA 4P9GA 4Y1XA 3B3QE 1VBC2 1ZRDA 3ZSMA 1LEDA 3ZYRA 1MQTB 4QPGA 4U2AA 3E5XA 4RD7A 3AMPA 2SBAA 1RUG3 3J8F2 2XUMA 1AL23 3J26N 3U10A 1VBD2 1AXYA 4YVSA 4AFBA 1IHMA 3CO2A 4DRRA 2CYFA 4MXWB 1MEC1 3ZN4A 1G7YA 4YZ1A 2IXJA 5E16A 2VMGA 1QJU2 3MICA 1RUC1 4CDUB 5JSOA 5EFUA 4LTAA 5A32B 4FBFA 4YW2A 5GLTA 4YGBA 1LR5A 4BMEA 3HR9A 4LR4A 4QM9A 1QJZA 1LESA 3FZ3A 1AJOA 3M7AA 2OUHA 4P5HA 4XE9A 1TMF2 3DUIA 3H9AA 1CIWA 4WM8C 3VLBB 1NA1C 2WNUC 2FMYA 1YO8A 4IQPA 1AR91 4AEDB 3R4SA 2DVBA 1FOD1 2R1BA 2D98A 3KQRA 1ULEA 4CRQA 3OD0A 3EBRA 3R4DB 1DIWA 1H0BA 2DCTA 1Z0HA 4GULA 4Q8LA 1C5IA 1ND3C 4FVVA 4XQDA 2NQYA 2WS93 2XLGA 4Q29A 1QJX1 4NN0A 4WM8A 3AJZA 1NA1A 2WNUA 4WZFA 3NO8A 4KG0A 2ET1A 2IFRA 4RR3C 4AF9A 1QH7A 1EV11 1OPOA 2ZZJA 1ND3A 2VVEA 1VB4A 3MFCA 2AENA 4QPIB 2VVFA 4QU2A 5F6LB 3WP5A 2PHLA 2D6LX 4WVWA 5L7OB 4RR3A 2PTMA 4CDXC 1V6JA 1F5FA 2DUQA 2JG8C 1CAUA 2BNOA 2VG9A 4Q4X3 2QJVA 2XWBB 5I0TA 2PYTA 4KWJA 1W6NA 1RITA 5K0UC 1FAYA 3L2YA 3WCRA 3ZXAC 1R1A2 4E2GA 1NCQB 1YIFA 3NAPB 4L9BA 1V70A 4OUMA 2XGXA 5KXCA 4CDXA 3B02A 3TYJA 5EZWA 2BYVE 2JG8A 3VBRC 1WCKA 5D1IA 1VIWB 2GC3A 1ENQA 1ZZ8A 3A0NA 2D43A 1C8NA 2D3RA 5K0UA 1NCRC 4FPCA 4CYDA 3DF0A 3B01A 5JIUA 3AKQA 4MUVA 4PIYA 1SLIA 2RMU3 4FP3A 1NOVA 2VNRA 1LGBA 3VBRA 5FAXA 3N7MA 1PNGA 2EIGA 4CDQB 1D4M1 3N7LA 3ZXGA 3MPPG 1NCRA 4LLOA 2PQQA 4IEXA 3SH5A 3ROUA 1JN2P 4UBGA 2WA4A 1SEFA 2XLAA 1OOPC 3PHMA 4NWVA 2BVVA 3ASIA 1FPN3 4RGAA 1RMU3 1LOBA 3WHTA 3FBMA 4AEKA 2DTYA 1VBE3 1GFF2 3N7JA 3LKJA 2WKKA 1RIRA 3E5QA 1ULGA 2F4PA 1OOPA 3LWCA 4B4QA 3IPVA 1LTEA 3N7KA 2ZGKA 3KCXA 2YROA 5JOYA 4XBNA 1XNBA 1RUOA 5EYXA 1IKPA 4LE3A 4ATFA 2RS52 5IK8A 1IS4A 2RJLA 4HT1T 4IL7A 1VRH3 3E6BA 5J36A 2H0VA 1UKRA 4ASMB 1XU1A 3ES4A 3VBOB 1JYCA 1S1AA 3VL9A 3D6EA 3THTA 1OI6A 3D0SA 3WD5A 4Q2FA 3DGTA 3L9JT 1D4VB 3M4FA 4HETA 1KQRA 1H30A 3UKVA 2OUJA 2RM23 4JDMA 1SMVA 1WMFA 2ZKLA 3TOJA 1YJLA 3VZOA 4ITCA 4XW3A 3X29B 1TNFA 1F2NA 2BQPA 3KCYA 1QJY1 4RQPB 4HKOA 1PMIA 1AX2A 3B9CA 4OHYA 2GALA 3GBWA 4AFCA 1BYHA 3KGZA 3R6SA 1O4ZA 3A4UA 4AHWA 1IGOA 3FWEA 5BNPC 5C8CC 1DHKB 4EWDA 4C0BA 1ENRA 1LHOA 5AC92 3K48A 3WZ1A 3ZIXA 1MACA 1GZWA 3RDIA 4AQ2A 2DVFA 2ZGLA 4MGZE 3I2DA 2ZHNA 2GDFA 5BNPA 2XJPA 4JV4A 1UU6A 2D5FA 4GMP1 3T2TA 5C8CA 5KHKA 4BCUA 1BBT3 2QZ2A 1RUJ2 2Q4SA 4QHBA 3QBQA 1CONA 4NHKA 2GAUA 4OI1A 3WG4A 4UW6A 5F6KA 4SBVA 1PO21 1YXWA 2EALA 4AYUA 4BYYA 2BVBA 1Y7BA 4MV2A 4CP0A 2CAVA 2GNMA 3ZFGC 3ME2A 1DQ2A 3NKGA 3VBSC 4Y22A 4IEVA 1PGSA 4IXLA 1CAXB 2JE7A 5GZDA 4ES8A 1EP0A 3VZJA 1EAH1 4XMAA 3SITA 2ZGQA 3V0BA 3ZFGA 4XF1A 3CU7A 4MSVA 4DFSA 4AI2A 5SV8A 3VBSA 4EJRA 2GC1A 3J8F3 5D8AC 3WR0A 4DB5A 3RYPA 3MF6A 5KC6A 1LU2A 2ZAHA 2ES3A 2RR11 1GQHA 3LGRA 1GZ9A 2NMNA 3VZKA 1N1VA 1EPWA 3ZFEC 3LSEA 3FX3A 1ZZ6A 4Z92B 1J3PA 3T1MA 1QJU3 5A3LA 3NV4A 1CJPA 5LEJA 5D8AA 2EAKA 2ZOEB 2D7FA 3WG2A 4K6BA 1WCSA 2YUEA 3ZXKA 1I1EA 3H50A 3ZFEA 1GICA 1IKQA 5BYNA 1R082 2CAUA 4B7EA 2WIIB 2JJ6A 2UY9A 1PK6B 1LHUA 4A3XA 4HFSA 4KG8A 4YVSB 4AI0A 5GKAC 2Y0IA 1PGL1 1D2QA 1G8WA 3KS7A 4M0NA 5FCCA 1LGCA 1AHSA 2EAAA 3U11A 2WC2A 4B8EA 4M00A 2WZPP 2PHRA 3J4UH 4WVZA 2Z2SB 2OA2A 4XXPA 1MS1A 1Q8SA 1SCSA 4FQZA 5CB7A 3WXPA 4FTSA 1WMDA 4IEUA 5F5QA 3PVBB 5KHGA 4WM7C 5DG1A 1V6NA 3H0OA 1PZ7A 5B2GB 5E89A 4JRLA 4SLIA 5JIAA 3SCHA 2SLIA 2WFF2 4P9WA 2PHXA 1V9U1 4URTA 4YW5A 3SH4A 4WM7A 1PO12 1LOCA 1SCRA 4WM8B 4K7JA 4XF4A 1AYM2 2WNUB 2N7GA 3OD4A 3WUCA 2VOVA 4K1YA 4K1ZA 2C1FA 5F9TA 1WD3A 5ABJB 5T3NA 4ORFA 4XYXA 4R4XA 3MIHA 3B00A 4P9JA 1ND3B 4XFBA 1ND2B 2JICA 1RGSA 1AYN2 2ZTNA 1ULCA 4GH4C 5LEKA 2LTN