4CCDA

Structure of mouse galactocerebrosidase with d-galactal: enzyme- intermediate complex
Total Genus 220
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
220
sequence length
644
structure length
640
Chain Sequence
b'GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
publication title Structural Snapshots Illustrate the Catalytic Cycle of Beta-Galactocerebrosidase, the Defective Enzyme in Krabbe Disease
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 220
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ccdA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ccdA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ccdA01
4GBUA 1WDWA 4AF0A 5FF0A 4DWSB 2VEPA 3WNNA 1KTBA 1SQ7A 1W56A 2J88A 3EBVA 2DP3A 2YW3A 1K9FA 3RDKA 1OYAA 4AD5A 3W87A 3CMGA 1EPXA 2ZA3A 1JFHA 3E96A 4IM4A 5AHMA 1L2UA 1SO4A 3P82A 2C19A 3CEPA 3U8GA 2ZXDA 3NEVA 3KL0A 3U14A 1EOMA 3U2OA 4K8HA 5BWFA 3VD4A 3W24A 4I7VA 1VJZA 4W93A 1C7SA 2DT3A 1ME9A 3I68A 3EXRA 1IXNA 1UKOA 3PB2A 1H7XA 2QCCA 1TJPA 4MJMA 4AAJA 1BYDA 2J77A 1F4AA 1XHGA 3M7SA 4V27A 3AHVA 1V0KA 4JTLA 3OLGA 3N17A 3NJ3A 4V2XA 3IGXA 3M5YA 1FH8A 1ZAJA 1SU5A 3L0KA 2PWGA 4HMEA 4GINA 1WZMA 3VIGA 3BVJA 4JX4A 3M9YA 4MB5A 1UD2A 3AHZA 3VNZA 1PPIA 5DCBA 2VKZG 2VFEA 2IXUA 3O07A 3W7DA 4DEFA 4CCDA 5LGXA 3AJ7A 4OIFA 4GUIA 2VQTA 4RJEA 1GJWA 4OBSA 3SY5A 1WPCA 1OFPA 3W73A 4TVDA 1XC4A 1A5AA 5AB3A 4O28A 3WH7A 3SCVA 3HO8A 4JTUA 3W7CA 1QW8A 1N55A 3GNNA 4Z1DA 1BVZA 2QV4A 3S6DA 4DM2A 2V3DA 4CU7A 2R14A 3NL6A 4MLJA 4HN4A 2XIBA 1QPNA 4DF2A 1H50A 4PCSA 2XN0A 2ZZ6A 3NQVA 2QJHA 4WSJA 4D6DA 3GDBA 2GJXB 4BFAA 3WEOA 4XZBA 1CXHA 3S5NA 1P5BA 4WX2A 1GJPA 2WSKA 3WUFA 2XVGA 2YX0A 1QBAA 3FS2A 4ONVA 4FIQA 4HTYA 4W7VA 1NWTA 2YA2A 2W79A 4XUGA 4ATWA 3VGDA 3N19B 5LNVA 4PEEA 1Q45A 3S42A 3DYMA 1XM3A 2A6NA 3U5YA 1UWQA 3AHXA 1KBKA 1SFJA 4H41A 1ODUA 1H5YA 2QQUA 2DSZA 4GI6A 3ZT7A 1I2NA 1IT0A 1E6PA 3VFLA 1TTJA 1J0HA 3P61A 1PIFA 5ABGA 1X8FA 2OX1A 3W2KA 1EDQA 1U83A 1HKKA 1NH6A 3CPUA 3WDJA 4JTIA 2NT1A 2VRKA 4ZE4A 3RNDA 5HUOA 4EQVA 1HJSA 7TAAA 4PYSA 3BLFA 3E0IA 3JR2A 1B3XA 2O9RA 3TW7A 2ZUMA 2WWCA 3QQ1A 4Z1BA 3W1XA 4IMCA 4HA1A 5LNUA 3QOKA 1V02A 3W4RA 5FEPA 4BWLA 2CBVA 2CHNA 1KGWA 4RZ6A 2VFIA 1KFKA 4IPJA 1UR4A 1XYZA 3CHEA 2XWDA 4OHQA 5HR7A 1VCVA 1GOQA 4QJ1A 3AIRA 3BV4A 2W67A 2ZOXA 4KH2A 4AZBA 3TR2A 1Q6QA 1F6KA 5H2ZA 2MANA 4CNOA 4RZ5A 4UTJA 5DLCA 3WQWA 4AZGA 1HX0A 1KFWA 5LNRA 1QI4A 3WF0A 2I9EA 4HIBA 5LGZA 2DZPA 1OSEA 3V75A 3DYOA 1E0VA 3AHTA 4XKYB 1I8JA 4CVUA 2WSPA 1K9EA 3SW6A 2V3EA 4Y7EA 2VCAA 5KINA 4WF7A 1YQ2A 1UA7A 2YDAA 2G3MA 4UC5A 5AHNA 5K4XA 3W82A 4JX6A 3STCA 5CSYA 1UJPA 3G18A 4AZZA 4DO5A 3OVQA 3G6MA 3NQGA 3QYQA 4IX0A 1JIBA 3EWBX 3MI3A 2XN2A 4PC8A 2ZICA 3KRZA 1LBLA 1ZCOA 4DQWA 2A3EA 5FCZA 1VYPX 3ZJ7A 4HOWA 2X1UA 3EX2A 1AG1O 3GXTA 4QFUA 1JXJA 4MY1A 4N9CA 1TZ7A 3EDKA 2P0OA 3BCFA 3S5QA 4XB3A 4TTGA 2XFWA 3OVRA 3RCNA 4CN4A 1B3WA 3UZ5A 3PG8A 4H6KA 5U7SA 5I24A 2BVDA 1UUQA 1VS1A 3HPSA 3FW6A 4B3LA 1S5TA 1KFLA 2QCFA 3CU2A 4GO9A 3RILA 1VENA 2OYMA 1EWDA 1OYBA 3CUFA 1TYGA 3W1TA 3WQ8A 5F1UA 1XCWA 2PB1A 4Z2IA 1UKTA 3A4AA 3FAWA 2C8NA 2BY1A 2ZX5A 1UBSA 1YXCA 4Z0JA 1W1PA 2D3NA 2E0PA 3AHYA 3AMGA 2NX9A 2YDRA 1Y9GA 4O19A 1BWKA 4UQ9A 2C1HA 2ZBTA 1TMHA 3NVTA 2WZEA 2CLMA 5DELA 4LV4A 5FKCA 1FDYA 1R7AA 1V3IA 2XSAA 4PMXA 1G94A 1WZKA 5A2CA 2ZUUA 1ZBCA 1TTPA 1G69A 2GOUA 2J24A 1KFBA 1W5PA 3NSXA 2OT1A 3VMOA 3DU0A 4QIUA 1ZL1A 3AZRA 3GXDA 3QHOA 1BEUA 2HSAA 3PSWA 4IMFA 1H61A 3PUDA 2R8WA 3F4WA 2VC9A 3HU7A 4AZCA 2YZRA 3WUBA 2A3BA 3W2JA 2PBGA 2QMJA 1CW2A 3C8FA 4EKJA 2J7GA 3BLIA 3GDTA 1Q6RA 3PZGA 3MS8A 1CX9A 3N9KA 4A2RA 2Y89A 2H90A 1JZ7A 1LOLA 2VFHA 1JUEA 1TV8A 3FJ6A 1MXSA 3VCRA 3CM4A 2DIEA 5I5RA 5J5RA 3PM6A 3B0UX 2QCDA 1GT8A 4PA8A 4MNKA 4URIA 2DU2A 1W31A 4WQ6A 1W32A 2WK2A 3A21A 3WMBA 1PX3A 4PTWA 1LRNA 3DFOA 1V3KA 1ZBWA 1H7OA 4D6HA 1NOWA 2Y7EA 3TIMA 4L4LA 3EXSA 4AB4A 2CETA 3LXAA 4PTNA 4JHZA 2GPTA 2C15A 3I6RA 4K39A 2X2YA 1K3UA 1L8NA 1S46A 1FBAA 1SPQA 1NSJA 1WOAA 2VEKA 3KVLA 3FA5A 4JX5A 1F4HA 3TC6A 3L67A 3LCHA 2YA1A 5GNZA 4QAWA 1C9DA 1UR0A 4KRTA 4FF7A 1CNVA 3MP5A 5F4SA 2ZIDA 4D6GA 3NA8A 1NOFA 5JBDA 5DMYA 3MMWA 4R34A 3KVJA 3TK7A 1Y7VA 1UUMA 2W66A 1XBZA 2QUTA 5DN1A 1W9VA 4UFIA 1DHPA 2OZ0A 5KZMA 1UH4A 3IIOA 4WY0A 1C90A 2XFRA 1RD5A 1K6AA 3AIQA 4MAZA 4AC1X 1KBJA 4DM1A 1F6PA 1TPH1 2RDUA 3G0SA 1H51A 4PTXA 1ISVA 1HIZA 1OFOA 4FNPA 4QLLA 2EF9A 3FJLA 5FMBA 3IVUA 4UTIA 4YL2A 4O17A 3EX3A 5TIMA 4NRRA 4MZ8A 3ARUA 4QCFA 4FNTA 3I7QA 4LUIA 5BXRA 1W9PA 3AZSA 2WVVA 2DORA 2VXNA 3G22A 4ML4A 1XD1A 2WXDM 3ARYA 2Z6IA 3NQMA 5G4WA 1UWTA 3N12A 4XV0A 3SUSA 1J9YA 4PSRA 2JEPA 2ZRZA 1SO6A 2ZRWA 1EGZA 4PMQA 1ECEA 3I7RA 2JE8A 1UWSA 4MJ4A 3JS3A 3LTPA 4LVAA 4LWWA 3RU6A 3L4ZA 4CN1A 3NPXA 4J3UA 2X0YA 5CLTA 3CC1A 3FHQA 1VFMA 3O15A 4MYXA 1E56A 4WJXA 4P7QA 3THCA 1JVNA 4GXPA 1K7EA 4OGZA 2DSWA 1HJUA 1YADA 3CUJA 1E71M 5M3WA 1FX6A 3TTYA 4AZ7A 4UQCA 5C55A 1Q3NA 5HWJA 2JK2A 1US3A 2TSYA 3DENA 3MKKA 5JBFA 3VUPA 5D2TA 2GVJA 1G0CA 1P1XA 3OLDA 4ACZA 4DPPA 4LVGA 2OSXA 4DO4A 4FFGA 4FX8A 2GK1B 5LHFA 4DUWA 3TSDA 1QI5A 1VCGA 2BV9A 3T4CA 4GQRA 1X6UA 1WX0A 3T08A 3B9EA 1DQWA 4GNJA 3W7RA 3ZFHA 4FNRA 4UQEA 5FK7A 2ZXAA 4AD0A 4CKQA 3MANA 5EMYA 4JKKA 4AZ6A 3TJXA 3CTTA 5CZKA 3TFXA 4CQAA 3T2PA 2Y8KA 1FHLA 1HVQA 1GQLA 4OBTA 1E15A 1TA3A 1MW1A 1PEZA 4NU7A 1MXGA 2W0UA 4JICA 3VNDA 1H41A 2RGMA 5DY2A 3TKFA 3QQ0A 3UCQA 4JTTA 2V8ZA 1JAKA 1M03A 5CZTA 1JYVA 1ZFJA 2ZUSA 3EDEA 3LHTA 2CIPA 4D6JA 2Y70A 3CLMA 2WMFA 1EP2A 4K68A 2JF7A 1R2TA 1CBGA 2H3BA 4D72A 5LZLA 4AIOA 3RM4A 3O05A 4BA0A 2J62A 2XIIA 3N34A 1F2JA 1OFEA 4BI5A 3L4XA 3VIKA 2UY4A 4KFNA 3ARSA 4U28A 1SW7A 3PIGA 1Q6DA 1F05A 2WNNA 3HGJA 4UMBA 2WPGA 4PCTA 3AIEA 2B7QA 3C6CA 1K02A 3WF4A 3MW7A 2WMIA 1RQBA 4K36A 1OD0A 1SZGA 2FPYA 1TQXA 1WDRA 2W92A 3VO0A 3B0VC 1GZJA 1YLVA 1G4TA 2V3GA 5GNXA 1UD3A 1Z42A 1HL9A 4C7GA 1FXPA 2V81A 3VE9A 1OFQA 2DZWA 3OZOA 2E09A 1QBBA 5J5DA 1EIBA 4CU6A 5D8WA 2GDUA 3BPWA 2DSUA 3WN6A 1S3HA 3TCEA 1R8LA 1G7VA 4LS0A 1WZLA 2ZZ1A 3MSDA 3PWAA 2WHMA 3EKLA 5E9AA 1I2PA 4UNLA 1GPFA 4UTHA 3EYPA 3NMBA 1A3HA 2J74A 3QC3A 5CZJA 4CD4A 1QI3A 5HPCA 3VGGA 2Q8XA 2HMCA 3LBCA 4JTEA 5I3DA 4OQVA 3WD2A 1GG0A 1ITCA 1XBXA 4LRTA 3AIVA 4Y96A 4E0CA 3TUUA 1OWQA 3B8SA 4J27A 5I77A 1QCWA 1PX4A 4LNYA 1D7FA 3DGRA 3M5VA 5A6BD 2R94A 3H3LA 1AL8A 1OT1A 6TAAA 2YPIA 3BC9A 4NJKA 4HHPA 4N6EA 3SUVA 4IMGA 1TSIA 4POCA 4JEQA 2PRHA 2IXVA 3FYOA 1B3VA 2UV8G 4CU8A 4LYQA 4UOZA 4ADSA 4AWUA 2HS8A 2FDMA 3BW3A 3OGRA 1OINA 4X0VA 3NQEA 1MYRA 1VQTA 2X16A 2VX4A 5F2IA 3I3EA 4LGXA 4OOZA 4UOJA 2EPHA 4C7DA 2CLEA 3WIJA 1RD6A 4AXNA 3WDHA 1ODZA 5CQ1A 4H8VA 3WEMA 2QCNA 4AZIA 1ICSA 2XUCA 1W3TA 1G01A 2VVNA 4W87A 2QUUA 4UMCA 5F2MA 2WKJA 4M1RA 3LRMA 4EOUA 1XCFA 3ZS4A 3LDKA 1KCLA 4B15A 2CLLA 3QMTA 1H2JA 5G2IA 1KBIA 1GG1A 3POCA 3AIWA 1XL9A 1NARA 2HISA 3BO9A 3BMWA 2VNCA 1AMYA 4GQQA 2EBNA 3GDKA 3DFQA 3L5AA 1KW1A 4IWWA 3M47A 5KTLA 3L9CA 3W7LA 3N11A 3HBKA 3KF3A 1CXIA 5E6YA 1FDJA 3HG3A 1B2YA 1DWAM 4W84A 4CD6A 1PZ3A 1UQZA 3EB2A 3N9RA 3GNOA 2Y5EA 4A3UA 3PZVA 1FHDA 1TVNA 1KM3A 1LRQA 3HF3A 5AN7A 3TC7A 1MEHA 4I7UA 3VD9A 3IK2A 1US2A 5BRPA 3VMPA 2YJQA 4EIVA 1GVOA 5AYZA 2VEIA 1IXPA 2CWNA 1MEWA 2X1SA 4O18A 1AW5A 1H7RA 4H4IA 4LVBA 4YXGA 2XSBA 5A6KA 4IX2A 3A5FA 1QAPA 3F03K 3RFAA 1SFSA 1QO2A 5AOUA 2PC8A 3AJXA 1K8YA 1WKYA 3L4VA 1W3LA 1W8SA 3SGZA 3WNMA 4ZE5A 1E3XA 5BW6A 2D20A 3CTLA 4FIRA 4JL2A 4K37A 4UCFA 3GNRA 1JCLA 3R2GA 2OWWA 1SW3A 3PIJA 2QCMA 1CENA 1GHSA 2E5BA 1G5AA 2CW6A 1H09A 1VLIA 2WPBA 2DH2A 3GXFA 3NIYA 1YTKA 1ZJBA 3BAWA 3W26A 1F7BA 2OT0A 5HUPA 5A2AA 3TMLA 3O06A 3ZO9A 1JNDA 3AXHA 2J9ZA 5A8MA 3DFSA 4Q32A 3U75A 1KM5A 4FFIA 1HFBA 1SW0A 3B04A 3GZ3A 1ZJAA 3LPPA 4BQ3A 2YL9A 3VIHA 2ADEA 4F66A 1V5XA 4Y6GA 2Y2WA 1TCMA 1LQ0A 3SIMA 4F9DA 3MHGA 1VHCA 4UFHA 2ZFAA 4B1MA 3GB6A 4NNCA 5I3FA 1X6LA 1PCWA 3UNDA 1TE1A 1UKPA 3HJEA 3TAKA 4TX9A 4OUEA 2OJPA 3HMJG 1VFUA 1B31A 1W5OA 3VI2A 3N3MA 1W3JA 1R46A 4X9SA 2OXBA 4KWVA 3M46A 1A50A 2WV8A 5AYIA 2DEPA 4CNNA 4AEEA 2VX7A 1DVJA 4Z2GA 2Y62A 4Z08A 1FCVA 3ZR5A 1FDZA 5DY3A 1KGUA 3NQFA 4AEFA 2GUYA 3B06A 5CG0A 1CI1A 1WQ5A 1MXDA 5M5DA 2HS6A 2CLKA 5D8ZA 1Y9MA 3UPBA 3VD5A 4L4OA 2QAFA 4ZQRA 1RPKA 3AMDA 1QOQA 3IJ8A 4B5NA 1JGIA 2J6XA 2TRSA 4RX0A 4ZQNA 3W70A 3CZGA 2HVMA 3NL5A 1BG4A 2GDVA 3WL0A 3TE9A 2V0TA 3O63A 1U2YA 4DUVA 5D9MA 4FNUA 3M1ZA 1EXPA 2VR4A 4FFFA 1NAL1 5BXPA 4AISA 5ECUA 3VVGA 4HOZA 2VZUA 1QI0A 3CIVA 1D3GA 1LDCA 5G2HA 4QLJA 3LI1A 3LIHA 4M7SA 3GH5A 4W85A 1JCJA 1LCOA 4H2CA 4ACYA 1NVMA 1E51A 1JRCA 1QNQA 5D2XA 2VC6A 1J5TA 2Y85A 2CITA 3KL3A 1JZ4A 1N82A 4EE9A 5CJ5A 2ADDA 1EDTA 3L4UA 3K46A 2YXGA 3W1RA 2CZDA 1GONA 1BTCA 3CIXA 2WOQA 1H7WA 5IFTA 3PN8A 3NR0A 2O7QA 3QEZA 3KVMA 3NPVA 4O4WA 1SR0A 2QCGA 4AF0B 2PI6A 4N9EA 1BAGA 4LS2A 3LX9A 1TPDA 3S2CA 1EP3A 1H1YA 4O14A 4M80A 5K3VA 2XFFA 3WK3A 2E6FA 1O7AA 1FOBA 2VO5A 4H04A 2V5DA 4W88A 1TREA 3P8JA 3ZR4A 2WMKA 2NUYA 4AHPA 3GTNA 3VIIA 3QM3A 1G4SA 3R8RA 1LF1A 2GUUA 3CGTA 3EX6A 1H1ZA 3L66A 2VEMA 2Q8LA 3GH7A 1BYCA 1WXJA 1NQ6A 1DQXA 1G6CA 1HL2A 2YYUA 4DBEA 1WAWA 1ML1A 1UR8A 4NZFA 1M7XA 3DHUA 1H11A 5FL0A 3F4NA 1W5NA 3ZWTA 1DWFM 1AQ0A 2V5LA 4XZ9A 1I75A 1JG9A 3GM8A 3T55A 5D38A 1V6VA 3QHMA 1O5XA 4FXSA 3W85A 1V3JA 4M6PA 1NF7A 1HL8A 1C92A 1E0XA 4ADTA 2QMKA 1JD9A 2G96A 4JDBA 3LPFA 4IGHA 4GWEA 5K7JA 2AAAA 2WNQA 1ZU8A 3CUHA 2G4FA 1ICQA 1VLWA 4XTDA 3PZNA 5IXEA 1BPLB 4AMAA 1QOXA 1AQMA 3L2LA 1Q6LA 4Z2LA 3AI0A 5FKYA 2YOCA 1GVRA 5FEXA 1XH0A 1WNOA 4KMQA 4AD4A 1DBTA 3AS3A 3M41A 1ISWA 3GDRA 3QH2A 1ISZA 2QDGA 3OB8A 2ZRXA 1GOXA 1JRBA 5I79A 3T0AA 2C3ZA 2NZLA 4W86A 1YDOA 1C29A 1VC4A 2D22A 2C16A 3N14A 3BG3A 1V03A 1J0JA 3MUAA 3HG2A 4W5UA 3HMCA 4QLKA 2ZTKA 1DORA 4W7WA 1XUUA 2YBTA 3W1PA 4UFLA 5FIXA 1OX4B 1SO5A 2Z6JA 1CXKA 3CUIA 1MQPA 3W1QA 3DHDA 3FKKA 4MFEA 2VR5A 4PMNA 3D0CA 4JTKA 4WK9A 1VFOA 2VZVA 2GQ8A 4L4PA 2ZZ4A 1EO7A 2GJPA 3AISA 4JFSA 3TTOA 3TNOA 4RK8A 3QFEA 3U1XA 2ALDA 2YR1A 3M7WA 4UTTC 3TH6A 1CLXA 3ZJ8A 1VJSA 3BAKA 8A3HA 1YYAA 4DBDA 1MWOA 2R91A 3CWOX 3U7BA 5LA1A 2A4AA 5KMYA 1E3ZA 1MW2A 2PBOA 1UD5A 1ZNNA 1J2WA 3TDFA 2Y7DA 4HZ8A 3M6DA 1CPUA 4CUCA 5A8QA 2WSRA 3UZJA 3W7PA 1EA0A 4IJBA 3NZRA 5CPNA 2E5DA 3NGJA 1DWJM 1C7TA 3LIGA 1W2PA 4MY8A 3WF2A 1UKSA 2DQXA 3M5ZA 1FH7A 1VFFA 1G9HA 4U33A 4GE8A 1DEDA 4P8VA 2BY0A 3EEGA 3MV11 4IISA 3MI2A 4JD4A 4C1LA 1CZ1A 3KEHA 4GI9A 5HOSA 4UTFA 1TG7A 3LRKA 3HGOA 4JCLA 1JF6A 4X0NA 4Z0SA 4I9AA 2O92A 3W7NA 3AQUA 4YMZA 4AWEA 1LM1A 2EHHA 2P1FA 3UWZA 1U30A 3PBGA 5BRQA 4IMEA 5A6BA 4BWLC 3WNKA 4FNSA 1QWGA 3AMKA 3MBFA 4FX7A 4LS1A 2WSYA 2WW5A 4H3DA 5HNNA 5I3JA 1J01A 3WELA 5G1YA 3DFPA 4IQLA 1QVBA 3W25A 1RPXA 4CD8A 1XCXA 1RV8A 1VF8A 1Q6FA 1UB3A 2ISVA 5FI8A 2G3NA 2W91A 1UYPA 1NM9A 3HQ1A 5AY7A 3OIXA 4DPQA 4NVTA 4PTVA 2OMAA 3WF1A 4TVUA 4O1BA 3QR3A 3WMSA 3TP4A 3PF3A 2YFOA 4UTTA 1X7FA 4GUFA 5A94A 3EWUA 4QP0A 3W6LA 2EPLX 1YXDA 1BGAA 1E4MM 4PCFA 3GBEA 1EP1A 1JZ2A 2VOMA 1QO5A 2VENA 3H54A 1J4EA 1W5QA 3WQ5A 1Q4NX 4KGLA 3I3BA 1HJVA 4PMDA 1TV5A 3UERA 3D3AA 4LXFA 4WOQA 3PBVA 4GUGA 2A6LA 3LCIA 5E1QA 4DF1A 3ARTA 3GIYA 3M43A 2QUVA 1PX8A 1MO0A 2BNJA 3CHCA 5BRBA 1GZGA 3WJZA 5LNSA 3CHDA 3DI0A 4EWND 4TVCA 1C8XA 1XYFA 3SUWA 3PS7A 5C70A 4UMAA 2Z1SA 3TXVA 1ICPA 4D71A 4JYEA 5BNKA 3IIXA 3IAQA 1VEOA 1V3HA 2BXZA 3VKJA 2C0HA 3BSHA 3W7JA 2VQUA 3MUXA 4JNMA 1XFBA 2JEQA 3BAYA 5SWUA 5DBTA 4ZENA 2C18A 2FTPA 5FEZA 4TIMA 4ML9A 2J79A 3SJ3A 1OFRA 2UY3A 4NXSA 5EYWA 1K9DA 5EB8A 3WBAA 3CO4A 1HNYA 1WDPA 1KM4A 4MNLA 1A47A 2A7NA 3S6TA 3ZT5A 1UOKA 4O52A 4BQ4A 3MP3A 3EMCA 3VDAA 4PUDA 3IEBA 3V1PA 4M19A 1E1FA 3UYCA 4YWIA 4WY0F 4DO6A 1MQRA 4E2OA 2BSLA 3M0ZA 5CGQA 1E9LA 4QNWA 3ARVA 1P0KA 4FEZA 5HNRA 4HA3A 4AZCB 3O6CA 4O1AA 2V3FA 3W86A 7A3HA 2BFGA 2ATSA 4J3VA 1LTDA 5ABFA 1KTNA 4NSBA 2UY5A 4MNJA 1E4NA 4F8XA 1K7XA 4AVFA 4IXHA 4WXZA 4D1JA 3UGGA 2I1OA 2QCLA 3UQNA 2GJRA 2GJXA 2X1IA 3RPMA 4RZ4A 3IV3A 1B90A 4IUGA 3STGA 5KZEA 3LEMA 5FESA 2BVYA 1LBMA 3G1YA 3L68A 3BAIA 4GRSA 1EEPA 4N42A 2BHYA 2OSWA 2BWGA 1C8QA 1QNRA 4FLQA 3VINA 3WKZA 3MJYA 3KWXA 7CGTA 5D2YA 3LHVA 4D1IA 4ZQCA 3RLUA 3LB0A 1BKSA 3LHWA 7TIMA 3EDDA 1W91A 3CLWA 1V6XA 3MI6A 4XUYA 4AHQA 3RM8A 3WL1A 5CGTA 2XFYA 2XGBA 1FWNA 3GR7A 3MUY1 4E4PA 1JYWA 3LDVA 4M6QA 3N04A 4WJEA 4N9BA 1EHNA 2BS9A 3G1DA 3CQ0A 3UGHA 2BTMA 1HJWA 2WKLA 2WKGA 4HA4A 4M8UA 4NJJA 1ISYA 3W76A 1MFUA 3W0KA 3BAJA 5L6UA 5CLWA 4LRSA 3VGBA 3LGEA 2FGLA 3BLPX 3WH9A 3T7VA 4UCGA 1HN1A 1H62A 1L9WA 1CXEA 3GH4A 3GYCA 3M5XA 5C6MA 1THFD 1O6IA 4B3KA 1O5KA 2D24A 4O11A 4E38A 5D33A 1GOOA 4QDMA 2V2CA 1JDCA 3VDHA 3W3OA 1KFEA 1BHGA 3C56A 4L4MA 4OV9A 2WVVB 3S9YA 3G3MA 3SI9A 4NQ1A 2XGIA 3AXXA 1GOMA 4FXRA 5HDRA 4QHZA 2C14A 3P60A 4I7WA 1MFVA 3NQ7A 1EQCA 2GFTA 4Q22A 1J11A 4JFWA 3BAXA 2DSKA 2NUXA 3LTYA 3T40A 3G1XA 4HPXA 4A3HA 1CGWA 2G5WA 3MHUA 1KGXA 1LG2A 3O6YX 2E8YA 4O12A 5F2LA 3R89A 1QHOA 2G95A 3UWYA 1LLZA 8TIMA 3W2NA 2DPEA 1G4PA 4V28A 3PZQA 3ZOAA 3UEQA 5D9OA 4QM1A 4YPJA 3WNOA 1VCFA 2VT0A 2ZRUA 1H3GA 2E40A 2DZTA 4LTSA 2ZRVA 4UR8A 1C93A 1SR9A 5FOOA 2A3HA 3QOMA 4H7VA 1QI2A 1V6UA 5D02A 3SUUA 3T2OA 5IBXA 5IDIA 3PTQA 3NL3A 4OJYA 2A2IA 4N4PA 4MKNA 1FP8A 4UZSA 1TUXA 2NX3A 1TPFA 4K7YA 3N2MA 1Y4WA 4BS0A 2GVLA 4HNTA 2EEXA 3GAKA 3L0GA 3PVFA 1UWUA 4BF7A 3WMCA 2WHJA 4KRUA 2RDWA 3G1HA 3VILA 3WUEA 3STFA 3F5LA 3KFTA 5CZSA 2EXOA 3WENA 1H4PA 4NNBA 2ZXBA 2TAAA 3NYDA 3OLEA 5BROA 2YA0A 3PZIA 5E0KA 1DL3A 4BI7A 2WWDA 3BG9A 4MY9A 2WC7A 3RM9A 5A95A 4MDOA 1H0IA 3ZMRA 3W2MA 1OX5A 3A24A 5E09A 3S5OA 3N9SA 1TCDA 4CCCA 1VIWA 2EPNA 3IIZA 4EK7A 4U31A 4Y90A 3VDBA 1JUKA 4NJGA 3O2LA 1DJNA 2ZDRA 4AZ5A 4MZYA 3KL5A 1V08A 3WD1A 5D03A 4MDPA 1A5SA 2WMIB 1OF8A 4JIPA 3WQ4A 1G4EA 1GVSA 3TSMA 2DT0A 1FWSA 1KQZA 2VUYA 3LMYA 1HKIA 3CZJA 5K2ZA 1YPIA 3SCOA 3ARPA 1D2KA 1OIMA 1PHWA 4LYRA 6CGTA 1GOWA 1A5CA 5AC4A 3KE0A 4HPGA 3PTKA 4JTGA 3H55A 5A1AA 5D30A 5D09A 1C8YA 4WSKA 5I0DA 4O57A 4MB3A 5I3HA 1W54A 5I23A 3W2UA 4WIWA 3U6WA 3G24A 3PSVA 4UNKA 3DHPA 1W3IA 4LU0A 1B4KA 5K9XA 2J7CA 2EGZA 1TPVA 2Y24A 1WAUA 5A6AA 3VE7A 2Y63A 3JUGA 4AYSA 4XBKA 1TVPA 4OT7A 5CSSA 3AMLA 4B1LA 3TJLA 2O9PA 3QW3A 3CUGA 4OZOA 2XN1A 1JAEA 2O9TA 3STEA 3ABRA 2YDQA 3PZTA 3QZEA 1SFLA 3QMRA 1UA3A 4JTJA 3I7SA 4EF9A 3CZKA 3BCDA 1B0IA 1DTUA 2E68A 3A47A 1LZOA 1W9DM 4KFPA 2D23A 3WBEA 2GVGA 3OBKA 5A8NA 3LFIA 4MAVA 3ABOA 4YHEA 4JTSA 3W84A 1UUOA 2WBKA 4MTVA 1W9BM 2VX5A 4RCXA 4PMVA 1TRDA 1FCUA 3W9ZA 2A7RA 4HKPA 4S3KA 4KWWA 4U5IA 5JIPA 1S5VA 2Q8ZA 3O16A 1W1YA 3NL2A 2AC1A 1BYAA 1F73A 1W37A 1IV8A 3CPRA 1J12A 4NZCA 3CZEA 2H6RA 1HF6A 1OFDA 4R33A 1S5WA 5A2BA 5IHRA 1PVNA 5FKBA 2AOSA 2B31A 1SO3A 3B9AA 3W83A 1UZ1A 2ZCGA 1E6NA 1P4CA 4CNPA 4MLRA 1FP9A 1F74A 1EO5A 5DXYA 1OG0A 4NNAA 3SCNA 3LCLA 3OA3A 2ZTJA 4IPNB 2YLAA 3A4XA 3II1A 1OFBA 3G3DA 1F5ZA 4ATLA 3SC7X 1PJ9A 2CLHA 3QF0A 4TR9A 1BGGA 1KM2A 3LBMA 1OT2A 1V6WA 4MADA 3VDCA 1EUAA 3W1AA 4N2YA 3SCRA 1E5NA 4YLWA 2JIWA 3K4DA 4MZ1A 2YL5A 1K03A 1XI3A 1GORA 1AVAA 1AQHA 4CCEA 2PC4A 3ABQA 4XZWA 3GVGA 2X09A 4HZ6A 2A0NA 3C52A 4O10A 1GQKA 4QNEA 4WKAA 2F7FA 4AW7A 3DH7A 2CU0A 1UCWA 3WDIA 2YFNA 1LWJA 2XPKA 1M7OA 1WZAA 2YW4A 2QR6A 2ZX9A 4IPLA 1P6WA 3W7KA 2GK1A 2CNCA 2ZA2A 3OG2A 4O0ZA 1PE1A 3MYPA 5LA0A 3FIGA 3WH8A 2FB2A 2YBUA 3GDLA 5EL1A 2WBGA 1WV2A 4OU1A 4PODA 1W5MA 2CLFA 3CB8A 3ARZA 4U3CA 3IVSA 4LYPA 3WH5A 1L6YA 1KA9F 2CHOA 2EJ1A 3BK0A 4BQ2A 4WXYA 2ATMA 1QFEA 1QR7A 1NP0A 2DIJA 3W37A 3MU7A 4JFVA 4J28A 1XD0A 1KM0A 5C54A 2P10A 4P8XA 3GZAA 3C4UA 3S1UA 4JXCA 1JNEA 2J78A 4DWSD 4AWSA 5E93A 1JDAA 2ZX7A 2WZIA 5AC5A 4YHGA 4NUWA 4KWUA 4JGDA 2V2HA 4LPCA 2ESCA 3KF5A 1Q6CA 3EMZA 4CD7A 2XJ7A 3CZ8A 3S5YA 1TPUA 2AGKA 3THQA 4E2BA 3HOJA 2PWHA 1K8XA 5LSMA 2BVTA 3KVKA 1KR0A 4MFDA 3Q94A 1E73M 5BMXA 3W7GA 1MZHA 4ORIA 4GUJA 3L21A 3AYSA 2VFDA 1U5JA 1TMQA 1F76A 3LRLA 4FMVA 3U7VA 1AMKA 3VD3A 4A2SA 5C5YA 2QPUA 5CXPA 2CZ5A 4LT9A 4P8UA 4CN6A 3LXBA 1JCMP 3A22A 4FX6M 4W8AA 3VKKA 3WUGA 1KWGA 1DOSA 2O9OA 2EO7A 4D6EA 3NDOA 5CPSA 3AIUA 1VGAA 3GXNA 1I2QA 1B4EA 2W6RA 1JUBA 1WYIA 3OHIA 2GQ9A 5AC8A 3ZM8A 3S1XA 1T0OA 3F5JA 2A3CA 3QRHA 3G8RA 5G2WA 1OM0A 5AYBA 3WK2A 5T26A 3WK1A 2A85A 3PBUA 4DELA 1W3KA 5G5IA 2NWSA 1UQYA 1OFAA 3IGSA 3RIKA 1GWJA 3WDQA 3VD7A 2JIEA 3WFLA 5A6LA 3E9AA 4O4VA 3MP4A 3W1UA 2Q3OA 2NW0A 4UTWA 4IXXA 3LLFA 1V3LA 4JHOA 4PRWA 4UR9A 4U5KA 1GOIA 1E6SM 4UQDA 1QNSA 3GYEA 3AROA 5F7UA 3LPGA 3OGSA 1E40A 4OV4A 2DZXA 2RGLA 1NOUA 5BMWA 4UIOA 4N4QA 4MVAA 2GJNA 4R53A 2VFGA 3WF3A 3THAA 4MJZA 2KZHA 2NWRA 2J9YA 1LLOA 2VCBA 1TO3A 2AQWA 5K9DA 2E9MA 4PSPA 4YCPA 1B1YA 1UH3A 2ZXQA 3WD4A 9CGTA 3IRDA 1JD7A 1GQNA 3GAYA 3T44A 1IZKA 3GXMA 3QHNA 5F4WA 4K8EA 1XBYA 2B7OA 1JF5A 2J47A 2BLEA 3K8LA 3K8KA 2AEZA 3QW4B 3TTSA 3S1VA 2CFFA 3P81A 3HGRA 4HNVA 2Y8VA 1ME7A 3QJAA 1SMDA 2QDHA 4HZ7A 2XM1A 1XH1A 3BSGA 1V3MA 2IQTA 4NI3A 1IGSA 4RE3A 3RJYA 2Z1BA 4N9DA 3IANA 4AIUA 1N8FA 1GVYA 3ZSSA 1JZ6A 5CPQA 1WB0A 3FEMA 4Y9AA 2WCSA 1ME8A 5AYXA 4FB7A 1NWSA 2BY3A 3FN9A 2ZUTA 1E6ZA 3VIJA 3LHYA 2ZYFA 1IZJA 2WZHA 4A29A 3MWAA 1GEQA 1RQHA 4JKLA 2J7HA 1HO1A 3MUZ1 3LLDA 2D0FA 1XXXA 1GJUA 3KXQA 2WC3A 1VZWA 2D73A 2CPUA 3PULA 2WHKA 3EDJA 3RMEA 2X2GA 1VH7A 4GUHA 4GFSA 3T0DA 4CD5A 4ATDA 1UD4A 3AFBA 4LOCA 2J8GA 3BGJA 3T2QA 3W81A 1JCNA 1JR1A 4GC4A 4X2RA 1JZ3A 1L6WA 4FLOA 4CLMA 2JFEX 3C2RA 3MSGA 4ZQPA 4CQ9A 3NZ1A 1R87A 4KFOA 1EH9A 4F79A 2G3JA 3WY1A 1VPXA 3R12A 3YPIA 4J9JA 3AS0A 1G1YA 2RH9A 4WZHA 4P8WA 3EWXA 2Z0IA 1TB3A 1CXLA 3FFSA 3WH6A 3MBDA 1TR1A 1LORA 1XKYA 1NF0A 4HPJA 4P7LA 2VRQA 3OBAA 3FOKA 2QCHA 3UGFA 2BHZA 3HB9A 3EX4A 3MO4A 1QHZA 3AZTA 2OWXA 1N7KA 1Z44A 1H1NA 3TX9A 3NQCA 1ZAIA 2CLIA 3ATZA 3WK0A 1V6YA 1W2VA 5AC7A 3WSUA 5CGMA 3PB0A 3WFZA 3RO8A 1JI1A 2VTFA 2D0HA 2ZZ5A 5DXXA 3SECA 1H5VA 4UTLA 1UWRA 1YTDA 3U5UA 3FLUA 1UR2A 3AIBA 3AOFA 1K9TA 4KGJA 3U57A 2TPSA 1GNXA 2LLEA 3PBWA 4UTMA 1FCQA 3B4UA 3K30A 1I2OA 1CEOA 2A5HA 1J18A 2WVUA 2Y7FA 1GTEA 4ZQMA 1LL6A 1FCBA 3CIWA 1OVDA 1J0YA 1JYNA 3CBWA 3NCOA 4W8LA 2G3IA 3GBDA 4PBGA 1B3ZA 2E6YA 2E3ZA 2CKRA 3NSNA 1QPKA 3HJZA 2XWEA 4AD2A 2XTKA 1KM6A 4HP5A 1KLZA 3T09A 1TPWA 4RKAA 3UPWA 1ST8A 2V30A 4LW7A 3UY7A 1VR6A 5HWMA 4AEOA 1E72M 1CIUA 3MUIA 4BZYA 5HBFA 5DCDA 2V38A 2DSVA 3AMCA 3EWZA 3PZ9A 5A3HA 1WOBA 4O16A 3DECA 2NUWA 4RV8A 3KOFA 1DWIM 2FLIA 1O60A 4IPIA 2WANA 4O54A 4JYFA 3UWUA 4ZVJA 3W7MA 3IJ9A 4H8UA 2NV2A 1UD8A 3UETA 4ICNA 4CVWA 1D3HA 4K6AA 4LC6A 4RE2A 1ISXA 3QSRA 2FIQA 3GNDA 4JCMA 2DZVA 3ZIZA 3N1AA 1YXYA 2E9BA 3NQAA 1ZBKA 4AHOA 3NYZA 4WD0A 4X3ZA 1XSKA 2QQVA 4FO4A 4E2DA 5KITA 2ZUWA 1ADOA 3CHFA 4OKDA 1TRIA 2V5BA 1A5BA 2OCZA 2QF7A 4O13A 2YIHA 1OJXA 5JIWA 2QKFA 1HJQA 3W1LA 2PWFA 1KXVA 4WOZA 3RMJA 1Q6OA 4BI6A 3JRKA 3M16A 3USBA 2XVPA 4LVFA 1M01A 2FPVA 3DYPA 4HSNA 3LV6A 3GLCA 3L5MA 3WJSA 4U2YA 3FY1A 1E0WA 3TOPA 2V5CA 3WQ6A 4DWSC 3QGVA 1JFXA 5A6SA 4HU0A 3SCQA 3LHZA 4BQ5A 1GTHA 1B9BA 1HG3A 1YPFA 2FQIA 3SEPA 2VL4A 2RHGA 3AXIA 3AS1A 3W29A 3PAJA 4P2VA 5D9NA 1J0KA 4IOTA 3OSDA 5A8GA 1WA3A 3TROA 4ZEPA 3ANYA 1ONRA 3G8EA 1AW1A 4PMUA 3BARA 3G1FA 5AHIA 2BZNA 1T96A 4ZQOA 4GI8A 1R7OA 3NDYA 2WMJA 1VHNA 2ZUVA 3PG9A 1OIFA 2EAWA 3IIVA 4EF8A 3N2XA 4J3XA 2V9DA 5M03A 1CTNA 5KEZA 4H8HA 4W5ZA 2ZX6A 1WBHA 1JI2A 1FFQA 4U3AA 3P8IA 5TQLA 5ABHA 2X05A 3HGSA 5EBAA 2B4GA 1HP5A 4UFMA 3UR7A 1W2TA 5EBUA 5KZDA 4E8CA 4DUXA 5HXMA 4WKFA 1H60A 1TTQA 1KB3A 1GVQA 3RJXA 4JQTA 3W7QA 5FEWA 2WSQA 4M29A 4YN5A 1W3NA 1LBFA 3S8HA 1VRXA 2FH6A 1X1OA 4P7RA 5ABFB 5F1VA 3EX1A 3R13A 3OG3A 4HMDA 4NXKA 3DAQA 4PFMA 1Z48A 3DHFA 3BGAA 1HO4A 4ORMA 1VYSX 1K8ZA 3EDFA 3GXIA 1LRTA 1MEIA 3VX0A 1I45A 4HU8A 5FL1A 2JGYA 1MSSA 1GUVA 4DWSA 4F9JA 2O7SA 3Q58A 4M7TA 3W7EA 1JDDA 2WCGA 2XVKA 3ZJ6A 5A69A 1H7NA 4ZXLA 1FWRA 2WCAA 4XQ6A 1JXKA 5D05A 4PTMA 3WD3A 1OX4A 1BSIA 1I1XA 3A4WA 1EB3A 3DZ1A 3W53A 1ZS2A 3SIZA 1FA2A 2E6AA 5DT7A 2A21A 3A9IA 3VIFA 3LV5A 5CPMA 3CH9A 3L2MA 4NRSA 5E0CA 4CQ8A 3BH4A 2YKKA 1M53A 5EPDA 1RR2A 4LVDA 4N0RA 1QPQA 2VX6A 1G7UA 4K38A 2F2HA 4JAWA 4GZIA 5F4XA 3TMQA 2GJLA 3CHVA 1OD8A 4QCEA 1X6NA 4OOUA 2Y61A 4UOQA 3NQDA 4D6CA 3W7IA 1HKMA 1M7PA 1JJKA 2E4TA 2WLYA 3AICA 2CBIA 3W27A 3TFCA 4UUIA 2JKEA 1TQJA 2H3DA 3N13A 1XV8A 3D5HA 3ARQA 3LPOA 1RP8A 4JL1A 5D2VA 3NQ8A 1SZNA 3OLIA 1J0ZA 1SUXA 3WNLA 4JKMA 2PCQA 2E6DA 1KTCA 3L2IA 5AYYA 2VRJA 5BCAA 4S1FA 5I2UA 3LCWA 3S1WA 2CKSA 4HT3A 3A6OA 5E70A 2EPMX 1ZENA 1KCKA 5D37A 2FH8A 5HWNA 2NXIA 4GZJA 1E5JA 3E12A 3W28A 4JDYA 2ZX8A 3W1NA 1D3CA 1OB0A 3L5LA 4Q33A 3BXWA 5FF7A 4MIMA 4QISA 2J7FA 5DO8A 5DCEA 2QCDB 3P67A 3W2LA 2OYLA 4K7VA 5I78A 2C7FA 5LNWA 2RFGA 3IJ7A 1HT6A 3PHAA 4GO8A 1W3HA 2F8QA 2VCCA 1HUVA 5K4ZA 4AD3A 3MMUA 4R7JA 2BY2A 6A3HA 1B3YA 1CDGA 3HG5A 3FAXA 5IHSA 2H8XA 4D6FA 3SCTA 3TQKA 3OA5A 4MJ2A 4DF0A 2RKXA 1V0MA 2J9XA 3BGGA 4QAIA 4PMOA 2WYSA 2CLOA 3EKZA 1UZ4A 3QPZA 1KQYA 4A3YA 2WO5A 1JL8A 1LJYA 2G41A 3T0BA 3E49A 2VVSA 3WFAA 5IBXC 1T99A 1XBVA 4WY0B 3ATYA 3K1DA 1W9XA 4JS3A 3L4YA 4E8DA 1H63A 1E70M 2CZEA 4TMCA 1UG6A 2JKAA 2WC4A 3WNPA 3NAVA 2Y6ZA 3TV8A 5GVJA 1WO2A 3P7YA 3MMDA 1DWHM 4RE4A 4IUOA 5U4NA 3KZSA 1TV7A 3I3DA 4RLIA 1LLWA 1UKQA 4PUEA 3TXZA 4TXEA 5HJLA 3NPUA 2W62A 3SGUA 1H0GA 3W6MA 4NX0A 3LM7A 3NG3A 2A7PA 3DC0A 1IXQA 1SZEA 1JCYA 3G1VA 1KXHA 4FF5A 4TTUA 2YL6A 1FWTA 5E6ZA 4PEKA 3NM1A 1OF6A 1KFJA 2ZQ0A 3LXCA 4MUZA 1BYBA 3UESA 3S0CA 5GNYA 1VBUA 5A8PA 3UD6A 5LHEA 3BLKA 1Z41A 2E5CA 3TQ0A 3THDA 2FB3A 2ISWA 3WD0A 2V82A 4XKYA 2BXVA 1QPOA 3ABSA 4C1KA 1ITXA 1NP2A 1RZMA 3W88A 4HOXA 3W1MA 5A8OA 4A21A 1TPEA 2OLHA 1PHQA 1CGXA 1ZHAA 3W74A 5ANNA 1TJRA 1ZBVA 2EPOA 1W0MA 3PUEA 3VGFA 1E55A 4UR7A 3VMNA 4ACZB 2B7NA 1CWYA 2Y7GA 3IGUA 4Y8FA 1E4LA 4OWGA 3ALFA 3WQVA 3AYRA 1WP6A 2JF6A 1UASA 4NX5A 2A3AA 5CSRA 2YSWA 1R85A 3K8MA 2EPKX 4RXGA 3HPZA 1EQPA 1L0PA 1YDVA 3B0PA 3EMQA 4WUIA 4R27A 1TIMA 1B3OA 5G1TA 1OHLA 4O53A 4XWUA 3P80A 2OSYA 4TUFA 2DJLA 3C2FA 1TA3B 4GPNA 1QHPA 1SMAA 5ABTA 1WE5A 2CXGA 3DI1A 2VZSA 5BYWA 3VX1A 1UH2A 2ISSA 3M6YA 3C61A 4TX6A 4NJIA 2NXGA 3W23A 1GW1A 3ALGA 1KV5A 1UHVA 4Q4KA 1HVXA 3P74A 1DKWA 3WJYA 5IM51 1SSGA 2FFCA 3S5ZA 1LL4A 2D3LA 2XVNA 1AW2A 4P7OA 3TSBA 3UG5A 1GVIA 3PR2A 4LX4A 2QQWA 3LCGA 4UTUA 5L9FA 2CEQA 1KFCA 4JN6A 3VGEA 3NNTA 1EIXA 2WNZA 3MYOA 5FF2A 3K4AA 1VBRA 3TA9A 3DBPA 4LUJA 4D6IA 5HPOA 2G8ZA 4UTKA 1E43A 2J7DA 1P0NA 3TQVA 1G67A 2PURA 1AL7A 3VOCA 2E1DA 3PBYA 2Z2UA 4MB4A 3L0NA 2VZTA 4BCEA 4W9TA 3BLEA 1X1ZA 1Y0EA 3L4WA 3TONA 4MPQA 5HQEA 3VPLA 1GVFA 1VEPA 3WEZA 1M6JA 3NQ6A 3DFNA 2D0GA 2YL8A 3M44A 1E6QM 2B7PA 2WHLA 2NX1A 1W1ZA 1PAMA 5CPTA 1DV7A 1DHKA 1M04A 3P84A 2PE4A 3B03A 4JYDA 5D04C 5LKYA 2VURA 3PZOA 4FFHA 1QOPA 4FHAA 4AXKA 4NJHA 2F61A 4W8BA 1W1VA 2VMFA 1KXTA 4AY1A 2CBJA 2FHBA 1R2RA 3RWKX 3LHUA 3PTMA 1XH2A 2C6QA 4XTIA 3HN3A 3O1NA 1TTIA 3A3HA 4M81A 1M5WA 1CXFA 1QDSA 2CCRA 1LROA 4P7NA 4EAMA 1IIHA 1E4IA 3B9DA 3VIPA 1X1NA 2J75A 3QPYA 4FK9A 1QMLA 5EY5A 5I3KA 1GOKA 4GKLA 1KR1A 4MB1A 5FD0A 4PL1A 2F84A 3O8AA 3FNDA 3N15A 2JKPA 1B9ZA 4PN2A 2DH3A 1QPRA 2DZUA 2QLYA 3NO5A 1LYXA 4UFKA 3B05A 4JY9A 5H91A 4AZHA 1K7FA 4P61A 5HR6A 4B9YA 1L6SA 4O15A 4HXCA 3ARRA 2E8ZA 4UQAA 1NWRA 2CZFA 3SR7A 2FHCA 1Z32X 3VGHA 1SZFA 1JCXA 2DJXA 4BK9A 2NSXA 4DXVA 4TO8A 4ZZ9A 4JFUA 2QPSA 4O8RA 3RF9A 2NV1A 5FF3A 5CKSA 1DJQA 1E6RA 4PMZA 2OYKA 3W6YA 2BX7A 5I3IA 1JULA 3NDZA 1QW9A 1T8XA 2FDSA 1C3FA 3O6AA 5EFFA 3TTQA 2CBUA 5BXTA 3CEUA 4C7FA 4BR1A 4M82A 4YCOA 3ZT6A 1XDLA 1JQVA 3BG5A 1V02E 3E1F1 2TYSA 1ZALA 2ZE0A 5ABEA 1Q6GA 3NM3A 3PY2A 2H8ZA 1WCGA 3EWYA 3G1SA 5FF4A 1HXJA 5C8BB 1EUNA 1BQCA 2VI0A 3BW4A 2ZWYA 3F5KA 2GQAA 4U4MA 2DT1A 1XSIA 2Y4SA 2JALA 3DFTA 3GK0A 2X1TA 1OYCA 2UWFA 3BMVA 4Z2HA 2QJIA 5D9PA 2ZA1A 4OE7A 1BG9A 4JZ5A 4ZFMA 2QEZA 1XDMA 3GDMA 3ARXA 4M6VA 2I14A 2YLLA 1UR9A 1JQXA 3KAOA 3W75A 3FYPA 2DDXA 3N73A 4M56A 4O50A 3OZPA 4JY8A 3GXPA 3L65A 2XG9A 5KSWA 3VTRA 3W38A 2WLZA 1FQ0A 4XBSA 5I3GA 4W7UA 2CERA 1D9EA 2BHUA 4W89A 3MV01 3EWWA 5FIPA 4G1KA 2G97A 3LI0A 3PZMA 4S3JA 5MHBA 4HMCA 1O94A 3C2VA 2DGAA 1VB9A 3KRSA 2GVYA 2WVSA 4GZEA 3UR8A 2A1YA 1NFBA 5FMCA 5CZ0A 1IXOA 1CGVA 1AK5A 5HINA 4J3WA 3C0JA 4PH6A 1PS9A 3LCXA 2C13A 4PMRA 2UY2A 2JGQA 4PL2A 4QSHA 1CGYA 1V0LA 2ABAA 2VJXA 3P62A 5TD4A 4FLSA 4Z2JA 4O0KA 2YCEA 3C2EA 4UTWC 1OGSA 2E77A 1PZ2A 3A5VA 1EOKA 4WKHA 4Z2KA 2J4GA 4LV9A 3UWQA 1EDGA 5DT5A 1O95A 5D32A 5A6MA 1XUZA 1HTIA 5FMDA 3W22A 3ARWA 3PC0A 4Z1CA 3IMMA 1GPWA 4GXMA 1BLIA 1MVYA 3N18A 3W7OA 1C91A 3SCUA 3P5ZA 2XYLA 1QNVA 1QNOA 4CGTA 1WBJA 3SCSA 4NZJA 1LP6A 3GR8A 4GJ1A 2QCEA 5BOOA 3GKAA 1ALDA 1GYNA 4Z1AA 5G4EA 5D4YA 5DBUA 1MQQA 1LG1A 2HTMA 3G0UA 2ABBA 1FXQA 1DP0A 2DT2A 5LA2A 3BW2A 1BF2A 5F2GA 1J10A 1XRVA 2E9LA 1GHRA 3CMJA 1LOSA 3W7HA 1KV8A 3H53A 5JUVA 1GYLA 1IIGA 3WJWA 4QQ3A 3ZR6A 3LCFA 4D2JA 1YDNA 2EQDA 5KZ6A 1SSDA 3NSMA 2VOTA 3NOEA 3OGVA 3PZUA 4Q7NA 1NEYA 5LYRA 4M24A 3VNYA 1FY6A 1PCKA 3FKRA 3C2OA 1GQIA 4UZUA 1V7YA 1VEMA 1PL9A 1VYRA 2V2DA 2WM0A 1KLYA 3CWNA 1HKJA 4RL3A 2IUZA 4GIAA 3ZJKA 1KWKA 4AIEA 3HPXA 3SZ8A 4ALDA 4O1CA 4B9ZA 2X0HA 3SSJA 3OIHA 3EXTA 2XQRA 1KXQA 2TMDA 3B8DA 1W1TA 4M5PA 3SCPA 1HJXA 2QF8A 2RDTA 1B57A 1J0IA 4IMDA 2YGYA 4R5EA 4QITA 2W61A 1I2RA 2D2OA 5AHFA 4FLRA 1CLVA 5DF0A 3KX6A 1UD6A 4EVZA 3Q37A 2J7BA 3ZSTA 3NXFA 3W71A 5BXSA 1UYQA 3ECQA 1EX5A 3W72A 5EMUA 1R86A 3VU2A 2WMGA 3FXYA 2ZZ2A 3ZWSA 5AC6A 2OWCA 3UG4A 1XGZA 1EA9C 3VIMA 1OGGA 3UY8A 1BWLA 3VM5A 2GSJA 3IAPA 1ZJIA 4ZL1A 4J3TA 4J7RA 3KHJA 5HULA 1W9UA 4OBRA 1KBBA 4TOQA 3Q2DA 3SUTA 4JIQA 1PV8A 1OK6A 3T78A 3UG3A 5GPRA 4ZXOA 3WDPP 1PBGA 1VAHA 1BFNA 2FHFA 3TA6A 3MO7A 1OCQA 3VM7A 3O6DA 3ELFA 2WVTA 3DKJA 3AO0A 2X30A 3SFKA 1XC6A 2EKCA 5GQBA 2X8RA 5AHLA 2XHYA 4AD1A 3DKLA 3HG4A 5K9CA 1E1EA 1YTEA 3P5YA 1CYGA 4FNQA 4LQ1A 1JYXA 2QJGA 1OBAA 2NLIA 3TAOA 2AEYA 1H49A 1PIIA 4EANA 2XM2A 1R47A 3LOTA 1CECA 1OK4A 5TBOA 3G1AA 1TPC1 1A53A 1FWWA 1O4UA 5FK8A 5A6JA 3RK8A 3NPWA 4NT0A 4A4AA 1CGUA 3KRUA 2XVLA 2FJKA 3CZLA 4JTFA 2B0MA 4N02A 1PIGA 2PWDA 4LY8A 2VZOA 2DZSA 4B16A 3INPA 2WAGA 2J7EA 1FH9A 8CGTA 3WJXA 2VELA 2D1ZA 2BXYA 3OEXA 2J27A 2WMHA 5AFDA 4J3SA 4HPHA 2NT0A 3F1QA 4MOZA 5D2WA 4AWTA 1MW3A 4TX8A 3VIOA 2FGZA 4RR4A 1BTMA 2J8FA 3W07A 5EA9A 1V0NA 4JTHA 3DXIA 5CG7A 3APGA 1RQEA 3RLVA 4X22A 1WDSA 5HMSA 1IF2A 1H7PA 2NXHA 3GX9A 4U2ZA 6ALDA 5C71A 3IIPA 3GKFA 4A22A 5EFDA 1LWHA 2PRMA 3M07A 5EKYA 1UWIA 2Y88A 1RH9A 3TU9A 3TW6A 3CT7A 5DEZA 5M17A 3HBLA 5CPLA 1GCYA 3GNPA 1E6XM 2PF0A 2ZWZA 3LTSA 1WDQA 1ZAHA 1EHAA 4JFTA 3R5EA 1JZ8A 2W4XA 3MHFA 3SCWA 2WNWA 1I1WA 2AAMA 3POHA 3I65A 2W5FA 3FHAA 1EWEA 4PMYA 2PWEA 3IVTA 1CGTA 3QSTA 4HNUA 4UNIA 1BVNP 4O1DA 4LC8A 5DFAA 3UWVA 5IFPA 3UXAA 2W63A 4MYAA 1RVGA 2QAPA 2WJZA 4UQBA 4MNMA 2QHAA 3PUOA 2CESA 5CSUA 3ZQ9A 1FFRA 2FPTA 5I6SA 4HNNA 2ZUNA 3AS2A 2Q3RA 3LDRA 4JIEA 3WDRA 4N6FA 4AH7A 4MPKA 1LL7A 1TPB1 4JR5A 1YHTA 3SURA 1LOQA 2VFFA 1GQJA 2WB5A 3G0XA 1KM1A 2PRLA 1Q6EA 1SYTA 3LERA 1R2SA 1OABA 1ZY9A 3NUKA 4KKXA 5JBEA 1U33A 6TIMA 3J7HA 3L4TA 1XSJA 2J25A 1R30A 1ZB5A 1NWUA 4NF7A 1C8VA 3MMTA 3UXDA 4X9YA 2WQPA 1I4NA 1FUYA 4UFJA 4S2BA 4HSOA 4BF9A 2ZRYA 1OGBA 2X1RA 4XX6A 2AMGA 3NQ2A 2ZZ7A 1TFVA 4WLCA 3HIJA 2ZZ3A 4ADUA 3A23A 1B30A 3F4VA 1VJIA 4TU1A 4UXDA 1QNPA 4RXFA 2JBMA 1HP4A 3G6LA 4S2CA 2C0AA 5AHEA 2YYTA 1MW0A 3OVPA 2Z1KA 1OX6A 4ZMGA 3E02A 5CPOA 3QMSA 4TMBA 3C3NA 1JZ5A 2YDSA 2CYGA 5E0FA 4AMCA 1RP9A 5C2XA 1ESWA 5A5WA 1UR1A 3O9NA 1DWGM 3LF7A 3UWWA 1VRDA
chains in the Genus database with same CATH superfamily
2VD7A 3P5BA 2RS11 1W9YA 4DWSB 4AFDA 1ASJ3 1KTBA 1SQ7A 3KS7A 2DP3A 4L61A 2SBAA 2YW3A 3CAWA 3KZ4C 4ZGYA 3UGVA 1C3HA 4OI1A 4CDUA 3RUBL 3ZVHB 3VFCA 1NCRB 3KOWA 2ARBA 4TZDA 3C0QA 3RQ0A 1OF4A 1IXNA 1UKOA 1H7XA 2QCCA 1MUCA 1TJPA 4AAJA 5IJRA 3B8WA 1XHGA 1JYCA 4A6OA 3OZYA 3UR5A 3EOEA 2PWGA 3L0KA 4HMEA 3BVJA 4JX4A 4P9XA 3M9YA 3VNZA 4MWAE 2PDIA 4DEFA 3W7DA 4CNUA 2IKHA 4RJEA 5J98B 1WPCA 4EE2A 3GR4A 2OUHA 3CQIA 4JRLA 1VFSA 4JTUA 3CYJA 4DY1A 4HSJA 5CADA 4Z1DA 4NIHA 5A3MA 3CQHA 2XBO3 4HN4A 2XIBA 4DF2A 3M3OA 3AP6A 4J35A 4JTRA 5I07A 2ZZ6A 4PUMA 1NY1A 4D6DA 3ZYGA 3GDBA 4XZBA 4LUYA 4F0LA 4ZO9A 1CXHA 4QE4A 4YTTA 3UFYA 3FS2A 1Q66A 4FIQA 3D6NA 4GQBA 4IP4A 5LNVA 4PEEA 2GC0A 2Q8DA 2DZAA 4X6RB 1XNDA 2WFF3 4H41A 4Q4W3 2G3FA 2QQUA 3ZT7A 2DVXA 2WQ8A 1IT0A 1E6PA 5ABGA 1S4CA 4JIIX 1EDQA 3FDKA 3T4VA 2VRKA 4XFHA 5HUOA 4LUTB 4A7ZA 4EQVA 3QH7A 3BLFA 2JJ6A 3QN3A 4INDA 3JR2A 2OX0A 4JNYA 1CAXA 3LSDA 1UOZA 1W0NA 1V02A 5BNOC 2RG4A 2XIJA 4L6OA 1KFKA 3SAZA 1UR4A 6PTDA 3CHEA 2IKIA 5HR7A 5GLUA 1YIPA 3URAA 2DYCA 1IZCA 2GGJA 5H2ZA 4RZ5A 4AZGA 4B5TA 1RAKA 4DXXA 2KR2A 1KFWA 1UY1A 2XLFA 3FL7A 4H00A 4Q8WA 1M68A 1I8JA 4XKYB 2WSPA 3MIBA 5CFCA 1DIOA 2G9ZA 2OZ6A 3MW3A 5K0UC 4DWDA 4GH3A 2DU1A 5DDJ1 3W82A 1HRI3 3WX5A 1UJPA 3G18A 4W50A 1VP6A 3G6MA 3EWBX 4PC8A 1LBLA 4DQWA 1MZEA 1VYPX 3ZJ7A 4XMAA 3TOJA 1AG1O 4B92A 2R042 1TZ7A 4N9CA 1RJQA 2RS33 3BCFA 3MC5A 3OVRA 4ZFCA 4ZU5A 4BKNA 3NRUA 1S5TA 3CU2A 2ACSA 2A6YA 1AJKA 5L7OC 4N9IA 1UBSA 2D3NA 1W1PA 4GMP3 1U5VA 3I49A 4LPLA 2C1HA 2WZEA 1TV3A 1R7AA 3OY8A 3K75B 4K3UA 4PMXA 1G94A 4XZUG 3MY9A 1W5PA 2JECA 3NSXA 3H2EA 3AZRA 1Z3NA 1F9CA 3F4WA 2RV9A 1TZZA 2YZRA 3I10A 2XISA 7ENLA 3AM2A 5LXXA 2ZEZA 3C8FA 3BLIA 3WQBA 1WA6X 3UA4A 3HURA 1YQ5A 3N9KA 5LY1A 2RE9A 3M4FA 4MG2A 3BL3A 2DIEA 5J5RA 3WW1A 2OQ7A 1H8TC 1GT8A 2QCDA 3QH6A 4XVDA 3LEIA 4ZR8A 1V3KA 5H9SA 4LBLA 1L7RA 4NPLA 2HKXA 1NOWA 2Y7EA 4AB4A 3SH5A 2E25A 2GPTA 3I6RA 3C7FA 3NL1A 1S46A 4DAIA 1NSJA 3TC6A 4GX9A 2YA1A 1S39A 3LCHA 2PTXA 5L73A 4D6GA 1Q4WA 5F4SA 1GQGA 3MMWA 1EYBA 3DG7A 3PWGA 4WY0A 4N43A 4QG8A 2JDUA 4KCWA 4Y20A 1ULGA 1UZVA 3WX7A 4RS5C 4YL2A 3D47A 5BXRA 1Q5MA 1W9PA 4AFYA 2WVVA 2VXNA 2BBVA 2Z6IA 5G4WA 1UWTA 3GUWA 2ZRWA 5FUNA 1UWSA 3V0AA 4LVAA 4LWWA 3NPXA 3UCDA 5A33B 4RPPA 4C5ZA 3FHQA 2IWGB 4YVWB 4CEYC 3EB7A 4WJXA 4P7QA 2QUOA 4GXPA 1HJUA 3A9BA 1QJU2 1R3WA 1YADA 3C7HA 1XRSA 3UG8A 5DPNA 3VLBB 4AZ7A 4HMNA 5C55A 1Q3NA 4G7FA 2XJQA 1IKPA 3ITCA 3VUPA 3TYJA 3PJQA 4LVGA 4FFGA 4FX8A 2GK1B 5KXCA 2BV9A 1I0DA 4UQEA 5FK7A 2ZXAA 4C6IA 2P5NA 4AZ6A 5CZKA 3TFXA 3CL6A 1HVQA 5MKGB 3IDCB 1MW1A 4M51A 3LYEA 4XO6A 4JICA 5FZGA 4IL0A 3TKFA 3QQ0A 1XNKA 3UCQA 1M41A 5CZTA 3LHTA 2CIPA 4D6JA 3IUHA 3POWA 3VZJA 4ATEA 1REQB 1BK0A 1D4M1 1UOFA 4YZ2A 2E63A 1OFEA 3VIKA 1VBA2 4ZB5A 4FP2A 4U28A 1Q6DA 3G5EA 2YB7A 5FZBA 1VE0A 3KT4A 1K02A 3WF4A 2CWMA 1OD0A 4O65A 2FPYA 4LBNA 3VO0A 1J58A 4GK8A 5GNXA 1ZLPA 5I0SA 3KV4A 1Z42A 4C7GA 1FXPA 3VE9A 1OFQA 2E09A 4CU6A 4GD0A 4X63A 1G7VA 2C1FA 3MSDA 4H01A 3BQ5A 2WNOA 4UNLA 5FUPA 1GVEA 1A3HA 4CD4A 5CZJA 2QTWB 4FP1A 1T40A 5ABJB 4CZSA 3TUUA 4DZAA 1PX4A 1QCWA 4LNYA 1D7FA 5LZ6A 4CPBD 4GMP0 3M5VA 5FPZA 1AL8A 1JPKA 2YPIA 5C9RA 3SUVA 1LEDA 2PRHA 4AWUA 3TLLA 2FDMA 5A6ZA 4XD5A 3H2AA 2PLMA 1VQTA 3U0HA 3USSA 3WR0A 3I3EA 5FZ4A 5DUWA 4IFRA 1H0BA 5CQ1A 2HWF2 3GW0A 5LCWL 3WEMA 2VNVA 4B3NA 1IHIA 2QCNA 1EUTA 2INZA 2HWE3 2ZEWA 5I91A 5BOEA 2WKJA 2ZADA 3LRMA 1FWBC 1XCFA 3ZS4A 3LDKA 4EOUA 2CLLA 4L6DA 4HCLA 4M3CA 2P3IA 4IHCA 1X50A 2VNCA 1AMYA 1C8M3 3L5AA 4I9JA 4LO4B 2OPJA 2GYIA 3EA3A 4IWWA 3M47A 3CV6A 4WDUA 3HBKA 1AJ0A 3KF3A 4CD6A 5J96B 1B2YA 4JAAA 1HX6A 1PGL1 4A3UA 3BWWA 1N3OA 2LW8A 4XZIA 1KM3A 1LRQA 3TC7A 4RYDA 1QNWA 2J1EA 3VD9A 1US2A 3D82A 4DXRA 2AMXA 4EIVA 2V5JA 2UU8A 2CWNA 4LUMA 2X1SA 4LK7A 2XSBA 5AOUA 4BYYA 3SRFA 4I09A 1N1TA 3SGZA 4XIMA 4UCFA 3OU8A 1JCLA 2OWWA 2E5BA 4MB5A 2WPBA 1ZJBA 2OT0A 5A2AA 5HUPA 1V9U3 3TMLA 2CL2A 3ZO9A 2O0OA 2J9ZA 5A8MA 4RGKA 1SW0A 3AP4A 1P1MA 3IV8A 1K3IA 3LPPA 3S6OA 1QU0A 3KP0A 2ADEA 1V5XA 4Y6GA 4A7YA 3O1OA 4CQBA 4B1MA 4UWDA 3GB6A 4NNCA 1AF9A 2YV8A 1X6LA 1PCWA 3UNDA 2FZDA 3TAKA 2PEVA 2BBAA 2OJPA 1CPMA 3Q8AA 3HMJG 3R4SA 4HQVA 1KKRA 3PL0A 4RL7A 1OOPC 4QS6A 1OA4A 4KWVA 2XJSA 2PSNA 2ZGNA 1DJZA 1DVJA 4Z2GA 4Z08A 1FCVA 1KGUA 1FDZA 4QX3A 2GUYA 3UXKA 5CG0A 2FDHA 3WY6A 1WQ5A 5M5DA 2HS6A 5D8ZA 1DJHA 2Z2AA 3VD5A 4QGLA 4M4PA 2HROA 4L4OA 1LECA 4B5NA 2VC7A 3M0KA 3W70A 3NL5A 4HANA 3S30A 1TIWA 1X8CA 1S1RA 3O63A 3HQUA 1NAL1 2OELA 4AISA 5BXPA 5ECUA 4R52A 5ACA1 1LDCA 4QLJA 4M7SA 3GH5A 1QNQA 1JZ4A 1NY72 1RUE2 2I16A 4EE9A 1ECQA 1HXS2 3KUMA 3K46A 3CIXA 1S55A 3SISA 1UOBA 1H7WA 1N2VA 4H19A 3GZEA 3PVNA 2EXHA 3GFZA 3NR0A 2ADAA 3WLJA 1BAGA 1XLFA 1TWSA 1XRFA 4W6WA 3CQJA 3S2CA 4BEUA 3HPFA 4A45A 1VFTA 3WK3A 2E6FA 2BERA 2V5DA 3UYIA 4JTCA 2JDKA 2WMKA 5A7WB 3EX6A 1DCSA 2VEMA 1BYCA 4IIGA 1DQXA 4DBEA 1X39A 3FDGA 4S3CA 3E6EA 4NAFB 2NMOA 4QQHA 1H11A 1DWFM 1EX1A 1X96A 3BV7A 1K8CA 4A3XA 3RYKA 1O5XA 4LJHA 3PJXA 1NF7A 4IG2A 3KS6A 2DW7A 3LPFA 3OGRA 2QMKA 4JDBA 4ADTA 4GWEA 2WNQA 3PZNA 1ICQA 4XTDA 4GOAA 1GNHA 1Y5VA 5IXEA 4AMAA 1Q6LA 4Z2LA 1GVRA 3DOPA 1WNOA 3C7EA 4AD4A 3VZKA 3AS3A 3M41A 2YGMA 2WNUC 3T07A 2POTA 1C29A 1VC4A 2HWB1 2XKOA 1LQAA 3BG3A 3N14A 3I6TA 3HMCA 4QLKA 1DORA 1XUUA 4PLNA 1XYLA 1OX4B 1CXKA 3DHDA 2BMBA 4MFEA 2EALA 5LB6A 3PPFA 4PMNA 1C1FA 1VFOA 3IGHX 1XR2A 1EO7A 2GJPA 2FHRA 1LENA 2XU2A 4UTTC 8A3HA 1YYAA 5LA1A 3UT0A 1MWOA 2R91A 4QROA 1MW2A 1E3ZA 1UD5A 1ZNNA 1J2WA 2O4QA 3TDFA 1VB2A 1TJ0A 3VABA 3RMYA 3TB0A 2WSRA 5A8QA 2D2GA 3AZWA 1W6NA 3NZRA 3NGJA 4MY8A 1UKSA 4F0RA 4XUQA 3THPA 3AMQA 3MI2A 3M3CA 1CZ1A 5A1LA 4UTFA 2Q09A 1POQA 4JCLA 3O0WA 1AXZA 2O92A 3W7NA 3IARA 4W4QA 1LM1A 3PBGA 1VMHA 4CPBA 5BRQA 3AP5A 4BWLC 8RUCA 3ZYIB 1S2TA 3EB4A 4H3DA 2WAOA 3V5OA 2J66A 4EYUA 2KD7A 4GYPC 4IQLA 7ODCA 3W25A 1EGVA 4I30A 3DGTA 2W91A 1AJZA 2G3NA 1X97A 2EAAA 2P76A 3HJRA 2PA6A 1W6PA 3EWUA 4QP0A 3W6LA 1PZ0A 3O1MA 4YM1A 4AHYA 1EP1A 1RUF1 3E6DA 1R082 1NZCA 1ZUAX 1Q4NX 1W8FA 3UERA 4IP5A 2RM21 4WOQA 3KCOA 3ARTA 3K3NA 1MO0A 2BNJA 3CHCA 3QKEA 5FQ0A 1GZGA 1GNZA 1C8XA 1XYFA 3SUWA 3ZVHA 1NCRA 5BNOB 4QXBA 5FR3A 3U2CA 2OZJA 3N29A 3NV2A 5BNKA 2IXJA 3TYAA 1W6MB 1VEOA 1DGWA 2I2SA 1JXNA 2VQUA 4AX7A 2E33A 4JNMA 3BAYA 4XZPA 2C18A 1FTXA 4TIMA 4ML9A 5EB8A 1OFRA 4G8TA 3CO4A 4V1PA 1KM4A 3WNXA 1WDPA 4GVGA 1KRAC 2A7NA 3FBYA 4BQ4A 4O52A 3EMCA 1TNRA 3IEBA 4M19A 3ANUA 5K0UB 3M0ZA 1FWJC 4IEWA 1EZWA 1P0KA 3MEPA 4AZCB 3OYXA 3ZO0B 3LZ5A 3BJFA 1SBFA 1ULOA 3IPVB 3CWHA 4H83A 5ABFA 2WJFA 2BBFA 1KBLA 3ABZA 2UY5A 1E4NA 4CDWB 1R5YA 1K7XA 2OVLA 1RUH1 4D1JA 3JQWA 2QCLA 1DJXA 1B90A 3UKNA 4J2PA 1EEPA 2BHYA 2BWGA 1EZ2A 1C8QA 1QNRA 2WJEA 4FLQA 3F2BA 3VDDC 3LHVA 5L7OB 4ZQCA 3RLUA 3ZSJA 7TIMA 4LAUA 4GG9A 1V6XA 2QJNA 4FR6A 3WL1A 1UWWA 1FWNA 5GZFA 3RJ2X 1EHNA 3CO8A 3E5XA 4E8GA 4R85A 1DJWA 1UPPA 2WKGA 3LBOA 3QY8A 1UCXA 4M8UA 1MFUA 1XYCA 4LCSA 4Y4RA 4IV1C 5CLWA 4Y9OA 3VGBA 4LUTA 3TTEA 3USZA 4E4DX 2HWB3 3M5XA 1THFD 1O6IA 3BE7A 1UR3M 4E38A 5D33A 4QDMA 1M06G 2HBVA 3FX4A 5LWBA 3G3MA 1Y5XA 4NQ1A 4FXRA 3OP2A 4QHZA 1PKNA 2ISFA 2GFTA 2OX4A 1H8TB 1J11A 3LTYA 3G1XA 5A6XA 2PDWA 1YJKA 4HPXA 2Q1FA 2OPKA 4B4HA 1MS3A 3G2GA 1EEXA 3W2NA 1G4PA 1IT8A 4WV8A 1PMHX 3CEWA 5FZ7A 2ZRUA 3VKOA 2DZTA 4LTSA 2ZRVA 1C93A 2G9FA 1SR9A 5FOOA 2A3HA 1TMLA 3NWKA 4H7VA 7REQB 1V6UA 1QJZA 4RDVA 4PCRA 3HN1A 4PIXA 5IDIA 2WZR1 1FP8A 4MKNA 4C1NB 2X5IB 1R9XA 3N2MA 4HNTA 3ZIXA 4L65A 4ISRA 4PR4A 3AAMA 3L0GA 3WMCA 2RDWA 1PHMA 5T52A 3STFA 1AR62 1CLKA 4JQ4A 1H4PA 4CXXA 4ZB2A 4Q3MA 5BROA 5C3PA 2WC7A 3BG9A 4CCJA 4MDOA 1S2BA 1OX5A 3W2MA 5E09A 1RBOB 3DC8A 1TCDA 4CEYB 3IIZA 1LQ2A 3ITXA 4NJGA 3DN7A 4AFMA 3O2LA 4AZ5A 3J9SA 5LA9A 3KL5A 4LCRA 5D03A 3WQ4A 3TSMA 1KQZA 2VUYA 3NZGA 4IQJA 1K4HA 3CZJA 3KLKA 5K2ZA 3ARPA 3LDBA 2FDFA 4A2UA 1GOWA 5A3PA 4HPGA 3BI3A 1UMYA 3IDBB 3LENA 1HQLA 4WSKA 4A05A 4MB3A 1W54A 5I23A 1TME1 2V63A 1Z89A 3PSVA 4BPZA 4W65A 2EGZA 4KPLA 1TPVA 4LR4A 4NRMA 4Y9MA 4NL1A 3CUGA 2XN1A 1RCQA 3STEA 2YDQA 3QMRA 3CZKA 4R9OA 1XYPA 3B00A 1LZOA 1D7PM 1PNFA 1O6UA 5KR7A 4C6KA 4GULA 4Z82A 4G3YC 3W84A 4P9WA 4GLEA 4GH1A 4QHBA 7PTDA 4PMVA 1FCUA 4S3KA 2PQSA 1ZYBA 4I2OA 3NL2A 3LM3A 1IV8A 3EHKA 3GBFA 1J12A 2Y0FA 4Z1YA 1HF6A 2E31A 3O1SA 3KCXA 1U12A 2QQLA 2AOSA 3MLKA 1UZ1A 2J1UA 3GSMA 3KV5A 1E6NA 1FP9A 2ZCGA 2HBXA 1EO5A 4KCTA 1N8IA 4PE8A 4IPNB 3E0FA 1ITQA 1F5ZA 3WLMA 3HR9A 1PJ9A 3QF0A 4TR9A 3LBMA 2BZDA 4MADA 2QJMA 5A33A 4ITCA 1EUAA 3W1AA 4N2YA 3SCRA 2JIWA 4YLWA 1LOAA 2YMZA 4MZ1A 2JD4A 1GORA 5L9BA 3C52A 1CCWB 2XHKA 2F7FA 1W8OA 3WUCA 1V79A 3B3DA 4AW7A 3DH7A 2CU0A 1LWJA 3ZXKA 1CX1A 3FGCB 1PVC3 2YW4A 3K51A 2QR6A 1VR3A 3W7KA 2GK1A 1GLHA 2CNCA 3OG2A 5LA0A 5IVEA 4QQLA 5EL1A 3MPBA 2WBGA 4OU1A 3I4EA 3POIA 2BGSA 2CLFA 3ARZA 1DQ0A 1FX5A 3KV6A 4W8JA 1B5TA 4LYPA 4U3CA 4WDXA 2EJ1A 4BQ2A 2AKMA 1QR7A 3OEAA 1QXJA 3KBJA 3W37A 4JFVA 1KM0A 4P8XA 3S4TA 5L9RA 4MXWB 3OODA 3UP8A 4AWSA 1JDAA 2GLKA 3DCPA 3NAPA 4NUWA 4YHGA 5AC5A 1R3SA 4JGDA 1REQA 2OEKA 2ESCA 1LEMA 3KF5A 2ZGOA 3ZLHA 4CD7A 2EIBA 4LCQA 3S5YA 1TPUA 3ZFGC 3P3PA 3MSYA 2WLPA 2PWHA 5LSMA 1N3PA 1KR0A 5LW9A 4MFDA 5BMXA 1Q3EA 4WR3A 3L21A 4LA3A 3QV7A 1TMQA 1U5JA 4QX4A 5EJZB 3U7VA 2Z1XA 3T3YA 3QD6A 4CN6A 3VKKA 5SV8A 1WLCA 2XKPA 2DUAA 2O9OA 4D6EA 3NDOA 1I2QA 2PDNA 2GQ9A 3S1GA 4NPRA 2ZGUA 5FY1A 3QRHA 3G8RA 2P4EA 1PDYA 5AYBA 3WK1A 1JYTA 2A85A 3PBUA 5G5IA 2HK0A 4C6NA 3VD7A 4MGYE 3ZIWA 1O3SA 4XD3A 4UTWA 1QJU1 4PRWA 4H9VA 3WQCA 5F7UA 3LPGA 4LNVA 2RGLA 4HJWA 5BMWA 1S2KA 5JI9A 1GEHA 4MVAA 1XB9A 2GJNA 4DYEA 3SY8A 4C60A 2XIQA 1BQGA 1LLOA 3RXZA 1R3TA 3COTA 2XLAA 4IQDA 5FJIA 2E9MA 4MF4A 4G56A 1JD7A 3GXMA 1CONA 2OODA 3QHNA 2PAKA 1P0DA 3SCGA 1DQ2A 3KSCA 4K8EA 1JF5A 1JI6A 3A4UA 5FJKA 2O8OA 1YXWA 3HGRA 2HWD2 3T0CA 1RUD1 3QJAA 2QDHA 1XS2A 4L1WA 2IQTA 1IGSA 4AIUA 2Z1BA 2D2JA 3JU2A 5FLJA 2VTXJ 4C1WA 2FMYA 1VBA1 3V16A 3KGZA 2PDJA 3FN9A 1RITA 3NV1A 3WYZA 2HXTA 5HV0A 2XINA 3LHYA 3VIJA 1IZJA 1D0HA 1IZ3A 2D5FA 2WZHA 1GEQA 1RQHA 2IXHA 3MUZ1 3LLDA 1XXXA 1O5LA 2R043 1GJUA 1FV2A 1YFXA 2CAUA 2CPUA 1KXGA 2W39A 4OULA 3EDJA 4PF5A 1VH7A 3VB9A 1UD4A 3SSZA 3BGJA 1OQDA 1JR1A 1JZ3A 4X2RA 4P5UA 2Z2BA 3BKZA 2JFEX 3C2RA 4BQXA 2HJPA 3GG1A 4QX7A 3WY1A 4MGGA 3R12A 3YPIA 2Q01A 3EKGA 4AQLA 1CXLA 3WH6A 3MBDA 5CC5A 2PDYA 1LORA 5LEKA 3PNUA 4HPJA 2VRQA 3FOKA 2YBPA 4YGCA 3U37A 3UGFA 3UVAA 3ITLA 3EX4A 3MO4A 1N7KA 3V64A 2UWBA 3INAA 1XLHA 1ZAIA 3ATZA 4M0NA 2LUWA 2VMIA 2DURA 3GG7A 2ZZ5A 1UWRA 2PUZA 3FLUA 2YCJA 4PB3A 5I02A 2IUWA 5HV4A 4KGJA 3U57A 3BN6A 1W8TA 4UTMA 1FCQA 3ZDVA 2BODX 3MLLA 4L11A 2Y5JA 3MA8A 1L6FA 4CEWC 6XIAA 1B3ZA 1RALA 2HNEA 2E3ZA 1QDCA 4MMWA 4Y5Z0 1KLZA 2J1VA 4CDQA 2WNUB 3UPWA 1OEPA 2PHDA 1ST8A 4LW7A 3UY7A 1E72M 3MUIA 5HBFA 1OC6A 5DCDA 3EWZA 4ZZ8A 5A3HA 1EC8A 4C6CA 2NUWA 4ZZ5A 2YPDA 1O60A 1CJPA 4JYFA 2JDYA 5AC93 3W7MA 2FVLA 1OCJA 1UD8A 1ULPA 3LUTA 5GM0A 1AJOA 1ISXA 3QSRA 3GNDA 4FAGA 2DZVA 3N1AA 1YXYA 1ZBKA 3LSBA 1XSKA 4HNLA 4FO4A 2ZUWA 4Q6JA 1TRIA 4O13A 3HQNA 3C3VA 2QKFA 1XXNA 4ZO6A 2BUKA 4XCAA 2PWFA 3GRIA 4I8YA 2V68A 1Q6OA 3RDIA 1M01A 2FPVA 3GLCA 3FY1A 4DZGA 2JE7A 5FYIA 3IRSA 3QGVA 1DIDA 4QPIC 2YBKA 5FP9A 3LHZA 1GTHA 1K42A 3SEPA 3W5NA 4LAOA 3AXIA 4LJ3A 5A70A 5A7WA 1NU5A 5D9NA 5DUXA 1QJU3 2WZ8A 2Z5WA 5A3LA 2F6XA 3G8EA 1Y7BA 4NAFA 3IJQA 3LN3A 1GMMA 4PMUA 5AHIA 5IK7A 2BZNA 4AG0A 2IC1A 1VHNA 2EAWA 4J3XA 3WT3A 1EJUC 3H7YA 4HT1T 3BOXA 1OUXA 2R1MA 2R1PA 3CH0A 5D8AC 5EBAA 3UR7A 5EBUA 3H6OA 5KZDA 3F2DA 2VGIA 3BQ6A 1TTQA 4QEHA 4AVCA 4M1BA 3KP1A 1GVQA 2PS2A 3RZMA 2WSQA 3S8HA 3WP5A 4XIOA 2AKZA 3DAQA 3U2ZA 2VPVA 1F5FA 1VYSX 2PDFA 3GXIA 3NXLA 4FA3A 2JGYA 5FYMA 1DU3D 3PTYA 4XTMA 4EACA 1KRMA 4F9JA 3W7EA 3SQLA 5EIYB 2WT1A 4ZXLA 1VBA3 3TLQA 2WCAA 5J37A 3GVQA 4WVZA 5FYYA 1JXKA 5D05A 4JTOA 1I1XA 1OX4A 1RUE1 2GNMA 1HXS1 1CWPA 2BASA 4XETA 3DCQA 5T54A 3QYSA 1ENXA 1P7TA 4NRSA 3L2MA 4TQTA 3ACGA 2I45A 2YKKA 1VALA 1RR2A 3A7QA 4COYA 2VX6A 5CAHA 1FI2A 1XPYA 3TMQA 1BRLB 1OD8A 1AX2A 3P6LA 3T0TA 2Y61A 2C71A 4D6CA 1HKMA 5DABA 1EPZA 3W27A 1OC5A 2JKEA 1TQJA 4JVAA 3VKFC 4Q8VA 4Z8BA 2QQ6A 3LPOA 5D2VA 3B8UA 5HK4A 3OLIA 1J0ZA 1JMUB 4FXGB 3WNLA 1SUXA 2W9XA 5BCAA 1QUMA 3KTSA 3LCWA 5XINA 2W27A 4AZHA 2EPMX 3OVGA 4X61A 1Y5WA 3A3WA 4A3QA 3ZOIA 2ZX8A 3W1NA 4Q33A 3VV1A 3BTZA 5FJUA 4QISA 2ZAAA 5DO8A 3WLPA 1SMVA 5I78A 1WMEA 3UJ2A 5JQ9A 1VBGA 2OQYA 2HWF3 4R7JA 3H22A 1B3YA 3U10A 3KW3A 1DE5A 3AMHA 2X41A 3TQKA 1PIV1 1VAMA 4DF0A 1A5KC 1HV1A 3ITGA 4FPSA 2QUNA 3BGGA 1RYYA 2WYSA 4Y24A 3EKZA 3LNPA 5TNVA 1KQYA 4A3YA 4IV1B 3VBOB 3M1HA 3E49A 1RJ7A 1NQJA 3VUOA 4MGQA 1W9XA 2VZ1A 3L4YA 4JS3A 3WNPA 5K7PA 2WC4A 5C33A 1LU1A 3MJMA 5BNOA 4NG3A 3J8F1 5GVJA 5F39A 1L8PA 2PTMA 2KAUC 3ILRA 2GWNA 3TC3A 1W6MA 3I3DA 1WD4A 1TV4A 3ZSLA 4TXEA 2Q6ZA 2OGJA 1AYN2 2OYZA 5CC3A 3LM7A 4IGQA 3NG3A 4ICCX 1IXQA 2HBTA 4E4ZA 2OVUA 1SZEA 4FF5A 1VIWB 5FO9B 5GZEA 3MDUA 2MEV2 1OY0A 4PEKA 3POSA 1BYBA 4DNYA 4MUZA 4IH3A 1Z7S1 5A8PA 3OQEA 2GVEA 5K0UA 3HTWA 2ZGRA 2A5ZA 1PMIA 2ZMLA 2V82A 2BXVA 3WD0A 3ABSA 2D93A 2NZ9A 1Q8VA 4QKBA 1NDYA 3W88A 3W1MA 2CDPA 4A21A 5AVAA 2YUEA 1M9HA 2Z4GA 4ATFA 1ZBVA 3VGFA 5ANNA 2ES3A 2FCVA 5F32A 4ARYA 4E4FA 1GK8A 1QXLA 1JN2P 2Y7GA 3IGUA 4Y8FA 4PB4A 3NTYA 3WLQA 1AL0G 3PFMA 2HVNA 2DCTA 4FXFA 4GVHA 2XOMA 2XWBB 3VZLA 3T1MA 3EMQA 1B3OA 4Y9NA 1NLRA 2OSYA 4GPNA 5L7OA 5BYWA 1V0AA 1UH2A 2JIJA 4IV3C 4DO0A 1LOCA 2NXGA 5ECVA 3ALGA 4K2SA 2GMPA 4Q4KA 3CMFA 4D6SA 1DKWA 1X38A 1FPN2 5FO7B 1LL4A 4DINB 3TSBA 4FPCA 4LX4A 2QQWA 1UXXX 3FSTA 4XZHA 2TBVA 4LO7A 2CEQA 1KFCA 2VMEA 1MUWA 1BEV1 4DYKA 3TA9A 3XIMA 4AGRA 3R11A 4IE6A 4YGBA 2PDGA 1E43A 4UTKA 3SADA 3TQVA 2Q0AA 4XJUA 4KIRA 2HLEA 3PBYA 1CR7A 3L0NA 4BCEA 3AWNA 3KQRA 3BLEA 3WEZA 1Y0EA 3D0SA 3L4WA 4MPQA 1GVFA 2PWVA 4HA0A 1YEYA 4PDWB 3N6QA 1RUE3 3VC5A 1PAMA 5CPTA 1DHKA 4JYDA 1HXS3 2PE4A 5D04C 1H8TA 5AECA 1A3KA 3CU7A 1F3WA 3PZOA 3VKNA 2CSGA 4FFHA 1R3RA 1AL22 3RI8A 3S2MA 4BE3A 4AY1A 1XLMA 5HNUA 3A3HA 2Z29A 4H6EA 1M5WA 2ONEA 1LROA 2RUSA 4P7NA