4CCDA

Structure of mouse galactocerebrosidase with d-galactal: enzyme- intermediate complex
Total Genus 220
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
220
sequence length
644
structure length
640
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
publication title Structural Snapshots Illustrate the Catalytic Cycle of Beta-Galactocerebrosidase, the Defective Enzyme in Krabbe Disease
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 220
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ccdA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ccdA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ccdA01
3CIXA 3LLFA 3W76A 3W6MA 1GOQA 4EANA 5BMWA 3S5NA 3TDFA 2EQDA 4W8BA 3VM5A 3VM7A 3PB2A 3W0KA 4FNRA 5AYXA 4MYAA 3AHYA 1J2WA 3Q58A 3L65A 4K36A 2ZZ3A 2YR1A 1B90A 1WZKA 2V9DA 1VS1A 1VCVA 4PUEA 3W1MA 2X16A 4GZJA 2JKEA 2YL9A 3WDJA 5JIPA 4B1LA 4LVFA 1EB3A 1R8LA 3CUIA 4PTVA 1OF8A 2DPEA 4BI7A 2C0HA 3M7SA 1IIHA 3VIMA 1ZNNA 4F79A 4I7UA 4IUOA 1DL3A 5CPMA 3BXWA 3W7LA 1JCLA 1P6WA 1VR6A 3EWZA 5HNRA 2J8FA 3VE7A 3AZSA 4B16A 1JUKA 4Z08A 3WD4A 1HNYA 3CMJA 3HOJA 3SUUA 1SO3A 2E77A 2JIWA 1V3KA 3UG5A 3EB2A 3MW7A 1ZAJA 4PODA 1E0XA 3L2LA 3W22A 1GQKA 2WOQA 4JYEA 3WJSA 4TIMA 3QQ1A 1OM0A 4O17A 2EJ1A 2WPGA 3L68A 4UTTC 4QHZA 5I24A 2FPTA 1QW8A 5BNKA 1DWAM 3IJ9A 3SFKA 4B9YA 2WMIB 4BFAA 4OE7A 2WMKA 3G3DA 1FCVA 2FPVA 1LLZA 1U83A 5E09A 4O11A 3L21A 3IIXA 4JFTA 1VAHA 2ZX7A 3BVJA 4FF7A 3SUSA 3UXAA 3B8SA 3GDBA 1IZKA 3PN8A 3PBWA 1UWIA 1XL9A 1WZMA 1XDLA 2VENA 3QJAA 4PTWA 4U31A 3IMMA 1LZOA 1HKJA 3O16A 2NX9A 3PWAA 1B1YA 3WD2A 4HA1A 4Z0SA 5I78A 4UNLA 5CSYA 3N2XA 4NT0A 3M7WA 3E12A 1HVXA 4CD7A 3CHDA 2QF7A 3LLDA 4K37A 1MW3A 3BLPX 2VTFA 1PV8A 4JTUA 2ZUSA 2WSPA 4XB3A 3SUVA 1WE5A 3PSWA 3UD6A 1AQHA 3WH6A 4PEKA 5KSWA 3N1AA 2IXVA 3MV01 3ZJKA 4R53A 1OHLA 4AC1X 4UTIA 4EVZA 4AIOA 5D2TA 5HWJA 4OUEA 3F4WA 3NL2A 4MZ8A 3QOMA 5CLTA 4NX5A 1CIUA 3U5UA 4PL2A 3W2KA 1QMLA 2WLYA 4W85A 1EEPA 4QP0A 3L0NA 4O13A 3ZSSA 2WYSA 3C2EA 1X8FA 2V2CA 2BHZA 1V08A 1H61A 4AD0A 1K9FA 5CGQA 1KA9F 1NF0A 4JX6A 3FYOA 1NQ6A 2J74A 1B3ZA 4P61A 4IPLA 3WQ8A 2G5WA 1V6YA 4DF2A 5G4WA 2VNCA 2YOCA 3GXMA 1XC6A 4TUFA 4JTEA 1JNDA 3TUUA 1W5OA 1PCWA 3NR0A 1TMHA 1XBXA 1MXSA 3YPIA 4RZ6A 5EKYA 1DHPA 1O5KA 4H8VA 4D6CA 4DO6A 1V3JA 1BQCA 4FLQA 1Z41A 2XN2A 2Y89A 4M6VA 1OFEA 4JL2A 1AL8A 3EWBX 3LX9A 4NXKA 4YL2A 4X3ZA 3UWUA 4MAVA 3BLIA 3LGEA 3KAOA 1YPFA 1BSIA 4TXEA 5I23A 3NG3A 2E3ZA 3CZLA 4AZGA 3LIHA 1E51A 3KRZA 3N19B 4LNYA 2WKLA 3LXAA 3OVQA 4NF7A 2C13A 3INPA 1SZEA 4KKXA 3SCWA 1EO7A 3C61A 1Y4WA 2DJXA 4FEZA 1KFJA 1SO5A 3B0PA 3IEBA 2V0TA 3KRUA 4IMGA 1BFNA 4E8CA 5AB3A 3IRDA 1E9LA 3BMVA 2VFDA 5C8BB 3V1PA 3IGUA 3HB9A 3I68A 2J9ZA 3QFEA 1TCDA 4M24A 3WFZA 2EF9A 3O9NA 1MZHA 5CSRA 3C4UA 1NARA 1EUNA 3W87A 1HKKA 2DSUA 4GUHA 1I1WA 1QPNA 1XHGA 2BV9A 3ZMRA 4LRSA 3O1NA 1XI3A 4O54A 2Y7FA 2UY2A 3G0XA 1H7WA 2OYKA 2E9LA 2B7QA 2Y5EA 1KV5A 4N6EA 2QCDB 3ABSA 1CXFA 3AIVA 3E1F1 2D23A 3ZR6A 1HKIA 6CGTA 2YL6A 3CGTA 3L9CA 4FHAA 3KVKA 4MAZA 1QI5A 2WSQA 1V6WA 1LOQA 1J11A 1MEIA 2VFEA 1KXVA 5A6KA 1KBBA 1M7XA 2R94A 5HULA 5D38A 5LNUA 1H7PA 5AYZA 2J7HA 3BGGA 5AHMA 1RQHA 3VDCA 2ZWZA 4K7VA 3AS2A 4W87A 4JD4A 3R8RA 3CEUA 4AMAA 1B9BA 3QR3A 3SCSA 1JYNA 3W38A 2WMIA 3PBGA 3Q2DA 3S6DA 1R7OA 2ZUVA 3L2IA 1LRQA 3TXZA 3UWQA 3BAXA 4P8UA 1A47A 2EO7A 4IQLA 3W75A 4UR9A 1J5TA 2Y7GA 3CM4A 3FKRA 1G5AA 2XYLA 2HS8A 3STCA 2OT1A 5K9XA 1C93A 2YKKA 4ZZ9A 2YLLA 1Z44A 4JTJA 3S1WA 5DT7A 5FKCA 1UR0A 4UFJA 3EX6A 1GNXA 3DBPA 5CPTA 2ZRWA 2Z1SA 1XXXA 3VGDA 5EMYA 2A3AA 4LVAA 5BMXA 3WUFA 4JY8A 2UY4A 3A21A 4PC8A 2V5LA 1OX5A 4GC4A 3HBKA 5EA9A 3II1A 3RM4A 4MPQA 3DFNA 1GOOA 3GLCA 1OSEA 1R30A 1OFQA 3T08A 2RDTA 3DC0A 3MANA 1H41A 3W84A 4YHGA 3VNZA 1BGAA 1FHLA 4GUIA 5FK7A 5BWFA 1I4NA 1LOLA 1R47A 4MIMA 3G1YA 3DAQA 1RD5A 4U28A 2WNNA 2D2OA 4UQCA 1WDSA 3RMJA 2VELA 4DELA 1JZ6A 1VC4A 2D20A 3WMCA 2WSYA 3CHVA 1W1YA 4HNNA 1AW5A 2WCGA 2E5DA 4HOZA 1X6LA 4AB4A 2DGAA 1H49A 3IVSA 5D32A 1BYCA 3NM3A 1V02A 1TMQA 2NT1A 3TAKA 1QO5A 5F2GA 3CQ0A 3MBFA 4FNTA 2BTMA 4DPPA 1ZBVA 4UCFA 4CQ8A 3EEGA 1D7FA 3ALGA 3GDMA 5I3JA 3U14A 5ABTA 5FI8A 2DSKA 2E8ZA 1KBIA 1W2VA 4AZCB 3TSDA 3S8HA 1SPQA 4YXGA 2YDSA 4EQVA 3A23A 3EWXA 4LYRA 3T0DA 1J10A 2I14A 4O53A 3G1FA 1TRIA 1VLIA 2DH2A 3SCOA 2RDWA 3LCLA 3G24A 3PBVA 4FNSA 2Y2WA 2WBKA 3P62A 1E5JA 4IOTA 3GDLA 1NFBA 4MB1A 5AC8A 4WKFA 3VO0A 3BV4A 5H91A 1BEUA 4AZ6A 1ECEA 4ZE5A 4ORMA 2CLHA 2W79A 4Q32A 1H4PA 1TPC1 1GVSA 2ZX6A 2ZX5A 3F5LA 1Q6QA 2GQ8A 5LNWA 2D22A 5E0CA 2Y61A 2BXZA 1US2A 2CLFA 1IIGA 3GXPA 2O7QA 4YHEA 3GH4A 5BXRA 4YCOA 4CGTA 2WNZA 2B7PA 4HZ8A 3NL3A 2QEZA 5G4EA 1KW1A 1P1XA 1ME9A 3M47A 4ZQCA 5ABFB 3WBEA 4TMBA 2XVKA 3FAXA 3NZ1A 4RK8A 4J3VA 1H1NA 2ESCA 3LEMA 3A4XA 1UKPA 4CVWA 3P80A 3RF9A 1GJPA 4R27A 3PZQA 3ZIZA 3CTTA 1GW1A 3B05A 5DCDA 3MI2A 3N18A 4CLMA 2VZUA 2BX7A 1H2JA 2CZDA 2Y85A 2GJXB 4CQAA 3AMLA 3TXVA 1TB3A 5KZEA 1VH7A 3AS0A 3BH4A 4D6EA 1UKQA 2XM2A 3LPPA 3NQ6A 4A22A 5HNNA 1W3TA 3TU9A 4OJYA 1BYBA 1G4EA 5FESA 3HPZA 2QKFA 1HIZA 5K4XA 1E1EA 3NIYA 1OD0A 2V81A 1GPWA 3W07A 1KFCA 3RM9A 3P5YA 4O1AA 1J0YA 4KGJA 4OBTA 2Q8ZA 2W6RA 2QJGA 3W88A 5GQBA 3NDYA 1JDDA 1H1YA 3MHGA 1L6SA 2QJIA 1HJWA 3EWUA 1BTCA 2BHUA 1H62A 2Z2UA 1MFUA 1VEMA 3AICA 1VJZA 2DZUA 3CMGA 3TFCA 3PUEA 4JTKA 1QNVA 2OSYA 1A5BA 1LP6A 3WSUA 1JZ2A 1KWGA 4DF0A 3C6CA 3W86A 4BWLC 3WF0A 3TOPA 2OWWA 3UG4A 4EE9A 1OYBA 3AOFA 1W3IA 3KL0A 1IGSA 3A24A 1LQ0A 4UTTA 2DZPA 3BG3A 2FH8A 4U5IA 3SECA 3PY2A 1O6IA 3HMJG 3PIJA 1TPVA 5CZJA 3OG3A 3RU6A 3WQVA 1E4IA 4BQ5A 4OHQA 4X9SA 2EPKX 3VKJA 2JALA 2E68A 1HL9A 1HF6A 2ZA3A 5BRQA 1UH3A 3IIOA 2YSWA 3UGHA 1OD8A 4PUDA 1XD1A 1TZ7A 1F2JA 1GTHA 1ZENA 4JTHA 3W7GA 1EDTA 3HGSA 1TCMA 4HU8A 1I2PA 4AZHA 3DU0A 1OK6A 2O9RA 4IMDA 1IXQA 3KXQA 4GQRA 5FEPA 3P67A 1QBBA 1UASA 1UJPA 4AIUA 4F9JA 1B9ZA 2B31A 4D6FA 2W67A 4HP5A 5I3GA 3TC6A 3EWYA 4Q4KA 1SUXA 1LDCA 1UOKA 2XWEA 1B31A 2FIQA 4MJ2A 3HIJA 1HVQA 5I79A 3MHFA 2X30A 4AIEA 4GJ1A 1RD6A 3UWVA 4JX4A 2F84A 4UXDA 2ZBTA 3W7PA 2QV4A 4HPHA 4J27A 2A1YA 2G3IA 2V5DA 2VI0A 4MDOA 2NV1A 3LF7A 1GWJA 1ZAHA 5D30A 4Z2GA 1JRBA 5A6MA 1IXPA 3ARXA 5BRBA 2J9XA 3GKFA 1ISWA 2WMFA 4AZCA 4FX8A 1NWUA 3C2OA 4RZ5A 2GVJA 5I0DA 2ZZ1A 1H7XA 2A3HA 2VRJA 1HG3A 4MY9A 3W7EA 3FLUA 1Q6DA 2JEQA 3DHPA 1TIMA 3S0CA 3I6RA 3S5ZA 2AEZA 4FNPA 5AOUA 4AD5A 5HINA 1JNEA 1DOSA 3NQVA 4MOZA 4UIOA 3LM7A 5HR7A 1FHDA 1BYAA 3TTSA 5E93A 4CD5A 2TMDA 5LHFA 4P7OA 4WKHA 3M5XA 1YXDA 1V0MA 1UUOA 3PAJA 3QMSA 3GDKA 4RCXA 1FFRA 3GB6A 1B3XA 2XVNA 3I3BA 2CBVA 1CEOA 3BLEA 2Y4SA 4NU7A 2QCFA 1XKYA 4OV9A 1XYZA 2Z0IA 4XZWA 2FTPA 3QHMA 2QR6A 4LVGA 5AC6A 3CWNA 1R2SA 1OIMA 1GEQA 4NVTA 4URIA 3PZNA 1XCXA 5JBFA 1BAGA 4FFHA 2XSBA 1W9XA 1Q6GA 5J5RA 1TPFA 5FOOA 2OWXA 1CW2A 2ALDA 2VEKA 3F5JA 3SURA 3TONA 1JF6A 2VEIA 2VZVA 1YHTA 1CXHA 2GDUA 1S5VA 3THAA 2RFGA 1WPCA 4UOJA 1E15A 5G1TA 2WAGA 2Q3OA 2V2DA 1ICPA 1SFSA 2WKGA 3WN6A 4DPQA 4S3KA 3WUEA 2VQUA 2WCSA 3BC9A 5A8PA 4PTNA 1V3IA 3DENA 1ISYA 5KEZA 3R12A 1NAL1 4M7TA 3RO8A 3G8RA 4TX9A 2VFFA 5LHEA 4X2RA 3IIZA 1UD3A 2GJPA 4CUCA 2DZSA 2E5BA 4AZZA 1V3HA 4UFKA 4UMBA 5C2XA 2JE8A 4WXYA 4TOQA 3W2NA 4HOWA 3USBA 4ADSA 1E73M 1HT6A 1F74A 5AC4A 1OABA 4HIBA 4JHOA 1Y0EA 3UCQA 3CT7A 1M53A 3WQWA 4PCTA 4NNBA 4PMRA 2DU2A 3UR8A 1KGXA 4L4OA 2AOSA 1R46A 3PVFA 4MY1A 1ITCA 5HOSA 3NPVA 1SYTA 3S5QA 1GVOA 4MFDA 2JFEX 3WL0A 2Y63A 3TCEA 1I8JA 3TE9A 2E9MA 1R2TA 4MB3A 1F76A 1K02A 3RLVA 1E4MM 3LFIA 1ESWA 1KXQA 4CQ9A 4N9CA 1RPKA 5LNRA 3WBAA 2W63A 4LUJA 1TYGA 2WVTA 4TR9A 1R7AA 1IXNA 4TMCA 2X8RA 4B3LA 2ZA2A 1MYRA 2UV8G 2A3BA 2XM1A 2YL8A 4IMEA 1D2KA 3M9YA 2OT0A 3HBLA 4AZBA 3ARRA 2PCQA 5HWNA 4PSPA 2VX7A 4MB4A 2JGQA 3U7VA 5A6BA 5D02A 2AC1A 2YYTA 1CPUA 5F1VA 1GOMA 3QHOA 4M8UA 1E6NA 3ZJ6A 3KF3A 4XUGA 5D2YA 3VINA 3RJYA 3W25A 1SZNA 2Y7DA 3P81A 2GPTA 4PH6A 1WZAA 2BY0A 3DXIA 4FFFA 3NQMA 5I3DA 4UR7A 4E38A 4GIAA 3TTOA 4K38A 2Q8LA 1R2RA 5GNZA 1H50A 2VC6A 3BG9A 1FCBA 3HQ1A 3VIHA 2TYSA 3OVPA 2WBGA 2VUYA 2QUUA 4A2SA 1EUAA 3SUWA 5AN7A 1G7VA 4D1IA 4U3AA 1FCUA 3K4DA 3ECQA 3N13A 3AZRA 3C3NA 3HPSA 2WMHA 4UTMA 3LCGA 1PIGA 1WX0A 4P7LA 5A6LA 5AHLA 1PCKA 2V3EA 3W6YA 3PZOA 1TREA 1QNSA 3ZT7A 5ABEA 1JZ3A 1F05A 1E3ZA 1AW2A 4ZQNA 2CESA 3ZJ8A 3N9KA 2G3JA 1H60A 2JKPA 2J79A 2ZXBA 3L4WA 1KFKA 2XTKA 4DQWA 1Y9MA 1B3OA 2WANA 4EWND 2OXBA 4N02A 5A2CA 1VENA 4M29A 1VHCA 3MHUA 4AISA 2V5BA 5HUPA 3NQEA 1PIIA 5I3HA 1CGXA 4Z1DA 3W2UA 1EQCA 3B0UX 3K8LA 3WQ4A 3ABQA 1JI2A 2J78A 3L4XA 1DQWA 5FL1A 2FJKA 3GDRA 1S5WA 5D9MA 3W9ZA 5D9OA 1G67A 2DZWA 1V03A 3QQ0A 3A6OA 4JS3A 4IXXA 2G8ZA 3NQFA 3BARA 2FHFA 4IWWA 5TIMA 1ML1A 4OBRA 4W88A 1UD5A 4W8AA 3CLMA 2QAFA 2GQ9A 4UNIA 3WEMA 5FF0A 2EPMX 3GVGA 5F1UA 4M19A 1OFDA 4IPJA 1O94A 3WQ5A 1BPLB 3VFLA 2NLIA 1JIBA 1US3A 2V38A 4ZEPA 2P1FA 5ECUA 1QHPA 3RJXA 3M44A 1CGWA 1E6SM 4AEEA 4CCDA 5FK8A 2QJHA 4CU6A 4FF5A 2E6FA 2ABAA 1X7FA 2WVUA 3TQKA 1OB0A 1OT2A 1WDQA 4N42A 3WD3A 3G22A 1AMYA 3TFXA 2PWGA 3WKZA 3VU2A 5LNVA 2DZXA 3VDHA 1CNVA 1W5MA 4HNVA 3AYSA 4NJIA 4ORIA 1NWRA 1EWDA 3KVLA 2V3DA 3GH7A 4GE8A 1YQ2A 4QLJA 3G3MA 3H54A 2GK1B 4Y90A 4EKJA 2OMAA 4B1MA 1TTJA 4Y6GA 5IHRA 1MWOA 1W3NA 4I7VA 2V5CA 4ZVJA 4H4IA 1HJVA 3WH7A 1G94A 4GBUA 5F4SA 2XFFA 3KFTA 3MSGA 4B5NA 4AH7A 3CZKA 3QC3A 2QMKA 1V3MA 1L0PA 5IXEA 1K6AA 3VIJA 1J18A 1BTMA 4JTTA 1LROA 1XBVA 2A7RA 1Q3NA 5FF4A 1MQPA 2WC7A 3T2OA 3W4RA 2D3LA 4JQTA 3ZWSA 4X0NA 2JK2A 4FNUA 1AW1A 5BYWA 1EP2A 2PRLA 3VGFA 2JKAA 3B06A 1UYPA 1KCKA 1O95A 3QH2A 4AZIA 1ZJIA 3ZFHA 4RE3A 1DWGM 2YBUA 3PC0A 4GINA 1JL8A 1QOQA 3BO9A 2PC4A 4PMDA 1T99A 1X6UA 5A69A 4W7VA 3B9EA 5D37A 2WLZA 1BG9A 3JS3A 3G1SA 1WOAA 2BWGA 4O8RA 3T78A 3WFAA 1RV8A 2XUCA 2NXGA 2J27A 4N6FA 1AL7A 2PB1A 4X0VA 2BFGA 2NT0A 4NRSA 4JKKA 4J7RA 5IBXC 3WNNA 2QMJA 1QWGA 2A3CA 3VIFA 1XH1A 2A4AA 3EDKA 5SWUA 1SU5A 4WSJA 3NSNA 4HU0A 1B57A 5LKYA 1ZJBA 5AY7A 5FIPA 1TO3A 1MXDA 3QM3A 3AIUA 1OJXA 4F66A 3GNNA 4E4PA 2ZUMA 2OWCA 3ZR5A 3UESA 3E9AA 4GO9A 4E2BA 3FW6A 1EIBA 1PS9A 4Z0JA 3GXNA 2J77A 3AMKA 4Y9AA 4ML9A 2QCCA 2W62A 4KRTA 4RJEA 1EDQA 1W3LA 1C29A 1Q45A 3EKLA 5A5WA 4LU0A 1KCLA 2V2HA 4FXSA 3SW6A 1UH2A 1TQXA 3MUZ1 1KBKA 2VX4A 3ABRA 1KR0A 3GBEA 1TPB1 2QQWA 3LRMA 5DCEA 3GAKA 3QPYA 3N11A 3HU7A 5AYYA 2VURA 4LVDA 1KM4A 3W7CA 5IHSA 4XQ6A 4QSHA 5K4ZA 3EDEA 4J3WA 1DTUA 2WHJA 3UWYA 4BQ4A 1H0IA 1PE1A 1RPXA 2V8ZA 3QF0A 4JXCA 4AF0B 1R86A 3K4AA 3SIMA 3WDHA 1ICSA 4AEOA 2B4GA 1G6CA 4WX2A 1CGUA 1C91A 2AGKA 4UTJA 1UKSA 3SSJA 1DWIM 1MW1A 1K7FA 1GJUA 2NW0A 2C7FA 3ARPA 1E55A 3DFPA 3AJXA 4JIEA 4AWUA 1BWKA 4YWIA 3NUKA 3DHUA 3M6YA 3S2CA 1ZB5A 1LWHA 4O18A 3FEMA 5JUVA 3RIKA 2VFGA 4RX0A 3FOKA 2WW5A 5A6SA 2QDHA 3GXIA 2CLMA 3O2LA 2P0OA 3BW2A 1FA2A 3VDAA 4I9AA 3EKZA 1DBTA 1OBAA 5FMBA 1OGGA 1NWSA 2J47A 4JTGA 1SMAA 4HMDA 3PZTA 2GFTA 5KZMA 3NQ7A 5AC7A 1H7RA 1C8QA 2CERA 4ML4A 1J0HA 2NSXA 4AEFA 2DORA 4ICNA 4A4AA 4ADUA 4O15A 4LUIA 3H3LA 1LWJA 3NCOA 1KM3A 3NDOA 4KWUA 2VRKA 1W9DM 3NM1A 5DCBA 1ZAIA 1N8FA 1F6KA 3W7KA 1C7TA 1E3XA 4UOZA 2CZFA 2GK1A 1YADA 2PF0A 1J0ZA 3ABOA 1PHWA 3SZ8A 2J7DA 3QGVA 2Y62A 3MP4A 2GUUA 2W4XA 4O50A 4JZ5A 3W27A 3C52A 3HN3A 4Q22A 4PFMA 5KINA 4P7RA 3APGA 4S3JA 1TRDA 2QCLA 1JI1A 1A3HA 4QJ1A 3JR2A 1OWQA 2WNWA 1BG4A 1GZGA 5DXXA 4O19A 1RVGA 4AD3A 1DJQA 2GJLA 3NVTA 3DYMA 1TPH1 2J25A 3POCA 3GYEA 4M6QA 3S1VA 4IX2A 5DY2A 1RP8A 3U2OA 1UH4A 3M1ZA 2VZTA 1OX4B 2FB3A 2NUXA 5GNXA 4U2ZA 5DO8A 4KFOA 4Z2KA 5CKSA 4LW7A 2X1TA 2CNCA 2TRSA 5I6SA 5D9PA 4IUGA 1XCFA 1AQ0A 2WK2A 3D5HA 4MNKA 4XBKA 2D73A 3VGHA 2WM0A 1Q6OA 4KMQA 1FY6A 4N9EA 1CXIA 7A3HA 3UXDA 1GVIA 3OB8A 1EA9C 3B04A 4MY8A 4H6KA 4OQVA 4XKYB 2ZZ5A 4HSNA 4BF9A 1XCWA 1N7KA 4QM1A 4DWSC 1BGGA 1HJXA 3RM8A 4CNPA 3W7HA 1HN1A 4YLWA 1OT1A 1Z32X 4AW7A 2B7NA 2W0UA 1KXHA 2FDSA 5KMYA 3KL5A 1DEDA 2ATSA 4GZIA 4WIWA 1TTIA 5AHIA 1TTQA 1B0IA 5A2AA 3U7BA 3N9SA 3C8FA 4M56A 3QHNA 2AMGA 4EF8A 1IF2A 4CD8A 1NP0A 1WYIA 4MDPA 3W1XA 2XN1A 1CGYA 1HKMA 1H7OA 2PBGA 4U33A 3U57A 4DXVA 2AEYA 2DT3A 2F7FA 5CZ0A 3R89A 1M01A 3W1AA 4O14A 1G7UA 4QAIA 1G0CA 1GJWA 5HQEA 1CXKA 1HO4A 3L5MA 3WJZA 4PMYA 1DWFM 5EFFA 1BLIA 2WSRA 1XM3A 2WWCA 5EBAA 4MB5A 1SW3A 1VBUA 1JCMP 1I2RA 5CSSA 1KM6A 3E96A 4Z1AA 3NQ2A 1K9DA 5TD4A 3LPFA 1FUYA 3ARWA 2A3EA 3V75A 3W85A 3TP4A 2WHMA 5CG7A 3AIEA 1A50A 3LHVA 3THDA 3VILA 1O7AA 7CGTA 1VGAA 2HSAA 3L66A 3MI3A 3TNOA 2EBNA 3F4NA 3AI0A 2XVGA 3L4VA 3NDZA 4CVUA 4WOQA 1BWLA 1ZJAA 4JKMA 4FB7A 4AF0A 2DT2A 3G1VA 3AO0A 3R5EA 4D2JA 4ZE4A 3PZMA 5FIXA 4TX8A 2O92A 4IX0A 3GNRA 1K7EA 3PBYA 3DHDA 1W3HA 1V6XA 4MJZA 4NXSA 3W7QA 1GVYA 1V6VA 2W92A 1FDYA 1W8SA 1S3HA 5EPDA 4OIFA 4O4VA 2OYMA 3W1UA 3QYQA 4C1KA 3S1UA 3UNDA 3POHA 1GG1A 3PUOA 2I9EA 3BMWA 4LC8A 4UTWC 2G96A 4NJJA 2A5HA 2IXUA 4KWVA 3NQGA 1K3UA 2ABBA 3DYPA 1MFVA 5HPCA 1HP4A 3WK3A 1UWSA 3GXFA 3VIIA 4YMZA 1NM9A 1PPIA 2VC9A 2I1OA 4CKQA 2G3NA 2C18A 1CTNA 3W7RA 1MVYA 3CUFA 4U5KA 1G9HA 1JCJA 1JF5A 5KZDA 4PBGA 1S46A 4AHQA 3DHFA 4BI6A 3IJ8A 3SGUA 1K7XA 2X1UA 1TPDA 4L4PA 1I45A 3PF3A 4LY8A 3W23A 3DH7A 3W7JA 1RH9A 1GQJA 3ARYA 3IIVA 4W93A 3T55A 3ATZA 3GZAA 3WDPP 1RQEA 1C3FA 4XUYA 4TO8A 4HPJA 1FQ0A 1F4HA 1B30A 2R91A 3TW6A 1UZ1A 2O9PA 4J3SA 3ZQ9A 1ZHAA 3PR2A 2H3DA 3SCNA 1NF7A 2ZOXA 4FX7A 3ZS4A 1EQPA 3O6AA 4PMZA 3WF3A 4DUVA 1ME8A 3VIPA 4TVDA 1LORA 1NEYA 1HP5A 1XH0A 4AZ7A 3P5ZA 3LTSA 4IPIA 1JQVA 2G97A 3O07A 3IVTA 2ADEA 1G4TA 4N4QA 5DXYA 2Y70A 1W3KA 1BF2A 4PCFA 1OX4A 5E1QA 5BW6A 2EKCA 2OX1A 3MUAA 5DT5A 2ATMA 4UMAA 1ZBKA 3RLUA 3AQUA 1SSDA 2ZUNA 4E2OA 4A3HA 1JYXA 2X2YA 4X9YA 2C19A 2YYUA 2XWDA 4MYXA 1NVMA 3T09A 3QRHA 2NV2A 2WZEA 3VGEA 2GVLA 5DELA 1JVNA 1JZ5A 3LXCA 1MQQA 5FMCA 2NXHA 1E71M 2CBIA 1JUEA 2J75A 3CU2A 1GTEA 2CLIA 4TVUA 4XKYA 1W3JA 2E0PA 3NQDA 3NSMA 1UKOA 2QCDA 1S5TA 4LOCA 4N4PA 1U33A 2R14A 4YN5A 2PRMA 4S1FA 1HXJA 1Q4NX 4FX6M 4C7FA 4JGDA 3MMDA 1V6UA 2FHBA 3BSHA 1ODZA 1YPIA 4H8UA 3LERA 2YX0A 4W5UA 4ZXOA 2WMGA 4JICA 3KHJA 4WZHA 4HSOA 4ONVA 4BK9A 1QI0A 1K8ZA 1TPWA 5FF2A 3L4ZA 4DWSB 1WQ5A 1FDZA 4RR4A 2V3GA 5F2MA 5IBXA 3EMQA 4HPGA 1GQNA 1ZBCA 1QNOA 2E6DA 3WNKA 3CUHA 4PTMA 2BVYA 3T4CA 1YXYA 4Z2HA 1KB3A 1QR7A 3PS7A 1VIWA 4LYPA 3FJ6A 3SI9A 1EHNA 2XPKA 4WOZA 4FFIA 4UNKA 5D33A 4UR8A 1TJPA 1M6JA 3IK2A 2DIJA 1JR1A 1GVRA 4CCCA 2ZCGA 1SW0A 3PZIA 2R8WA 4G1KA 1E6QM 5CZTA 2FH6A 4H3DA 2GDVA 1E6RA 3VPLA 3W26A 5CG0A 3FXYA 4OKDA 2QPSA 4QLLA 5DMYA 1WB0A 3BW3A 1JXJA 4J28A 3FJLA 3TK7A 3TSMA 1PX4A 3QW3A 4R7JA 1XFBA 3H55A 1XD0A 2VJXA 4O0KA 2G4FA 2Y7EA 3E02A 4FNQA 4CN1A 3VD9A 1JXKA 2B0MA 4LV9A 3AZTA 2Z1KA 4QIUA 3RK8A 1YLVA 3LI1A 3G6MA 3OA3A 3TR2A 5D9NA 3JRKA 1SMDA 5E6ZA 1V0NA 4CNNA 3SCQA 3CWOX 3NJ3A 4UZUA 3VNYA 3CHCA 4D6JA 3STEA 5CSUA 5D04C 1GONA 2Z1BA 2WKJA 1NOWA 5FMDA 2C8NA 3WDIA 2QLYA 3D0CA 4EOUA 2D0FA 1JYWA 1QBAA 3M5VA 1GOKA 4ZXLA 3HPXA 2G41A 5G2IA 4JN6A 1Q6LA 3CUJA 3K8KA 1MEHA 4H41A 1DORA 1PVNA 1XUUA 2QCNA 3B8DA 3LBCA 4NX0A 5AFDA 1W1VA 4DO5A 1D9EA 3M07A 4ZQRA 5A1AA 3ZM8A 2J62A 1H7NA 3IGSA 1JUBA 4HMEA 2NX1A 1FWTA 1ZU8A 3ARTA 1E72M 2TPSA 4MZYA 3W3OA 1LL6A 1EPXA 5DN1A 1GUVA 3ARSA 2XFYA 1KTNA 1OFRA 4CCEA 3W72A 4BI5A 3OZOA 1W54A 5D03A 3CBWA 3MV11 4DUXA 2PWHA 2DP3A 5CLWA 4JIQA 1I75A 4Y7EA 3G6LA 4S2BA 5DFAA 3CHEA 2FGLA 3NOEA 4GNJA 4K7YA 4AXNA 4EIVA 5M3WA 4NI3A 1JCXA 3NQCA 5U4NA 2CCRA 4JYDA 1TVNA 2FDMA 2QQUA 1IZJA 4XZBA 4LT9A 1SFLA 3GH5A 5HWMA 2ZX9A 1SR0A 1WXJA 5LSMA 2BY1A 3LHZA 4U4MA 4FLRA 1OGSA 4QDMA 1I2OA 5CPLA 3WNLA 3MSDA 1IV8A 5A8MA 3WH5A 5I3IA 1L2UA 1FWWA 1TTPA 3WD1A 2BY2A 3MUY1 1P0KA 2WNQA 3WENA 4GRSA 1UWQA 3AROA 3T2QA 4GI8A 3DFOA 1LJYA 1I2NA 3ZSTA 4JDYA 2EPOA 2J8GA 1PAMA 1W1PA 5ABFA 1K9EA 4PMUA 3N34A 3DI0A 1UBSA 1VHNA 3P8JA 3S1XA 2ZUUA 1X1OA 1DVJA 2GJRA 3STGA 1GT8A 1QOXA 3O6CA 2J7BA 4UOQA 2YDQA 4LS0A 4AD2A 4DM1A 1W32A 4O1DA 2YW3A 2ISSA 3A3HA 3OLDA 4EK7A 3ZWTA 2EGZA 1E4LA 3L0GA 5ABGA 1CGTA 1ST8A 1L6WA 5G1YA 2CBJA 5F7UA 2ZQ0A 4HT3A 2GJXA 2ZXAA 3GYCA 2ZUTA 3SUTA 3VOCA 3WELA 4ADTA 4CU7A 1KM5A 1BKSA 4JFSA 1ICQA 3D3AA 2OYLA 1W5QA 3TJLA 1QI3A 3UEQA 2A6NA 1TJRA 4JNMA 1C90A 4Z1BA 2QPUA 3LIGA 1NSJA 4GZEA 3UG3A 4NQ1A 4PRWA 1J0IA 1WV2A 5M5DA 4XWUA 2CLLA 3SR7A 6ALDA 5U7SA 1TPEA 3QMRA 2VVSA 4FLOA 3PB0A 5LA1A 1EH9A 4DWSA 4GUFA 3S5YA 1WZLA 4L4LA 3NYDA 2XIBA 5IFTA 3ARZA 4B15A 1VZWA 1O5XA 2PE4A 2YA2A 3AXXA 2VT0A 3L2MA 3VIKA 4W8LA 3I7QA 3G0SA 4Z2IA 1GYLA 3NAVA 2ISWA 2AAAA 3GK0A 3H53A 3Q94A 1T0OA 2ZZ2A 1LL7A 5HPOA 1V0KA 3BGAA 1OK4A 1KTCA 3WF2A 1E40A 1KLZA 2E4TA 3VUPA 1V0LA 3K8MA 2VFIA 1UKTA 3VD5A 4AY1A 2ADDA 2YPIA 2QUTA 3VMOA 4J3XA 1MSSA 3AISA 1TSIA 1W37A 5DLCA 1QPOA 1R87A 2Y8KA 3K1DA 4PCSA 3CZGA 5EB8A 3RMEA 1H0GA 3WK1A 1RZMA 3UWZA 3N15A 1TUXA 1P0NA 1TG7A 2RKXA 4N9BA 3T40A 2PWFA 1GVFA 4E8DA 1VYSX 1FFQA 1HL2A 4A29A 5D4YA 3WEOA 2O9TA 1W1TA 5KTLA 5EY5A 1KLYA 1MW0A 3B0VC 2FFCA 1L6YA 4R33A 3BAYA 3LCHA 3BPWA 3UPBA 1LG2A 3CO4A 4H8HA 4KRUA 5I2UA 1SO4A 2CEQA 5HDRA 1OGBA 5ANNA 1TA3B 1HFBA 4GPNA 4O16A 4WLCA 1O4UA 3IIPA 8A3HA 3WK0A 3C0JA 3W53A 1GORA 2A7PA 5A94A 2YZRA 3CUGA 5AYBA 3OA5A 1IXOA 2DSVA 2X1SA 3EMCA 2VL4A 2WWDA 1CXEA 4W84A 4D6DA 4NJKA 1B3WA 2ZFAA 1PIFA 5DY3A 4UZSA 3WUGA 3W2LA 3NXFA 1W2TA 3FS2A 4M82A 4UTWA 4JFWA 3QSTA 1GPFA 3MP3A 4H2CA 3C2VA 3WNOA 2FLIA 3A5VA 1XSIA 2CLEA 5TQLA 1PJ9A 1UQZA 1W1ZA 1YYAA 4A3YA 3FA5A 1F4AA 3ATYA 5E70A 1DP0A 5D2VA 3AHXA 1LOSA 1JDAA 4WSKA 2C3ZA 4O1BA 3W7OA 4BQ2A 3P82A 1FWNA 3F4VA 3SC7X 1OIFA 3THQA 3MO4A 3VMNA 4BS0A 3KZSA 4RV8A 1K9TA 3OZPA 5C6MA 4I7WA 4RE4A 4HXCA 3C56A 4ALDA 3A22A 2DQXA 1V7YA 2E1DA 2C6QA 4KH2A 4QAWA 3EX4A 3EWWA 1HJQA 4E0CA 3EDJA 4LTSA 1UR4A 4J3UA 3P74A 5FD0A 2O7SA 2J7FA 4QLKA 4CN6A 1PBGA 3WIJA 4FMVA 2YW4A 3LTPA 4J9JA 3STFA 5D2WA 3OG2A 2EPHA 1HUVA 2CKSA 4KFPA 1KWKA 3TMLA 2XVPA 2XVLA 3JUGA 3AIBA 1EGZA 4HA3A 4LYQA 3UPWA 2C1HA 1JYVA 3SCTA 1YDVA 2DZTA 2YA0A 1P4CA 3TMQA 4WY0B 1TFVA 1TV8A 5A6BD 3OGRA 3K46A 1LCOA 5CPSA 4LGXA 2VXNA 1HL8A 3HF3A 1UD2A 3EDFA 1UYQA 4AHOA 1VCGA 4MFEA 3MYPA 3VCRA 3CC1A 3KX6A 3HG2A 1JFXA 1F5ZA 4Z2LA 2PC8A 3LV6A 4GO8A 4RE2A 3W70A 1JZ8A 2WB5A 1NOFA 3ANYA 1WAUA 3THCA 1WOBA 4M7SA 5HUOA 6TAAA 3SY5A 5CGMA 2OJPA 4OGZA 1CBGA 1OCQA 1SFJA 3MMTA 1OX6A 2FQIA 3W2MA 4GI9A 1H63A 3GXTA 1SQ7A 5BXSA 3NZRA 5M17A 3IGXA 1QFEA 2AQWA 3LCFA 2F2HA 2YA1A 1HJSA 5AYIA 3PZUA 3NSXA 2QCHA 2CETA 3LDVA 3PTMA 2YBTA 3EMZA 1UG6A 2QCGA 3B4UA 4A21A 3AYRA 2ZYFA 2H6RA 3G8EA 3AS1A 5L6UA 2X2GA 3RNDA 2W61A 5F2LA 3FNDA 2CZEA 2D0GA 1AK5A 1QO2A 2E5CA 3LRKA 1LRNA 3O15A 3U6WA 3A4AA 3CHFA 1ME7A 3RFAA 1JULA 4BWLA 4IISA 1NOUA 2NX3A 3EX2A 3QW4B 5A8NA 4ZL1A 3C2RA 4D6GA 4D72A 3N12A 2CIPA 3PUDA 2VRQA 5IM51 1ADOA 4ZMGA 1E0WA 3BAKA 3A47A 5A6AA 3KVJA 4UTKA 4LX4A 3CPRA 3FYPA 3NGJA 1WBHA 2KZHA 5K3VA 3AXHA 2PBOA 5LGXA 4P8VA 4P8WA 4C7GA 1N55A 3AS3A 4XX6A 1XC4A 1GOIA 3WD0A 4B3KA 5LNSA 1NWTA 2WVSA 4UTHA 4LC6A 4V2XA 5DBTA 3BW4A 3HGOA 2B7OA 4XTIA 1TE1A 1SSGA 2BSLA 1ZS2A 4DUWA 5JBDA 4D6HA 3UETA 1PX3A 1XDMA 1VRXA 4JKLA 5LZLA 2WXDM 1FXPA 1E6XM 2XSAA 4MADA 3MKKA 3O06A 1F73A 1LYXA 5IDIA 2QQVA 4DM2A 3NL6A 1KXTA 1KM2A 5HMSA 1GQLA 2QDGA 4ZQPA 1TA3A 4MJ4A 3AHTA 3OGVA 3TIMA 2C14A 4Z2JA 1JFHA 1VEPA 1WP6A 1I2QA 2NXIA 3GXDA 1FX6A 1GQIA 1T96A 1FH7A 3WEZA 3T44A 2W5FA 3UY7A 1VFOA 1KV8A 1LM1A 2ZRXA 3HJZA 3O8AA 4IXHA 4QCFA 1K8XA 2WPBA 4LRTA 4UCGA 3TH6A 1L8NA 4CNOA 2O9OA 1YDOA 2UY5A 1ZBWA 3L4YA 3LMYA 3MMUA 4CU8A 4M81A 4NZCA 3VKKA 1NH6A 1DKWA 2F8QA 3P7YA 1CECA 3VTRA 3UZJA 1WO2A 4QISA 2VEMA 3L5AA 2X1RA 2EEXA 4GFSA 3M16A 2IUZA 1TR1A 3TJXA 3TQVA 4ZQMA 1OINA 4AMCA 4U2YA 4FIQA 4D6IA 3VNDA 1W9BM 5E6YA 4DEFA 2J88A 2JIEA 5CZKA 2BXYA 1KBJA 3HG5A 1W91A 2DSWA 3PSVA 4FLSA 3TTQA 1RQBA 2ZDRA 2JF7A 4MTVA 3TV8A 1FWRA 3MMWA 4FIRA 2UWFA 1EXPA 3SCRA 4HZ6A 5CPNA 3TQ0A 5K2ZA 2CXGA 3CZJA 3LHUA 4JR5A 1KFWA 1PX8A 4JFVA 3DFSA 3M5YA 3SGZA 1BYDA 3RWKX 4WY0A 4MZ1A 1RP9A 4OZOA 5GVJA 3L4TA 1CDGA 1G01A 4IM4A 4GUGA 3LHTA 1JG9A 3TA6A 1QI2A 4RLIA 3L5LA 4AWTA 3BCDA 1JZ4A 2DJLA 5D2XA 1DJNA 1M7OA 3OBKA 4PMVA 5I77A 2VQTA 1HX0A 1QCWA 2ZZ4A 1N82A 3HJEA 4O28A 2WZHA 4N0RA 5BOOA 2FPYA 3W81A 1CENA 2ZIDA 4XV0A 1GYNA 1GHRA 4MVAA 1TQJA 1XBYA 3HO8A 5FEZA 1DHKA 3MUIA 4H04A 1AQMA 3W1LA 2CU0A 4IMCA 2HVMA 2CWNA 3FN9A 4TTGA 3UY8A 1MXGA 1YDNA 2GVGA 3LBMA 4RZ4A 3WNPA 1UD4A 4D71A 4NNAA 4JDBA 3W1PA 2VVNA 1QAPA 1PEZA 4O0ZA 1UR8A 4PMXA 3Q37A 2BXVA 1YTKA 4LXFA 2CLOA 1MO0A 3DKLA 3EXSA 1KFBA 5D8ZA 2PRHA 2YXGA 2V3FA 1OYAA 3N14A 1WAWA 3N2MA 3KE0A 1NP2A 2QCEA 1PZ2A 2DT1A 3CZ8A 3GNOA 3PZGA 5A8OA 4ATLA 2ZXQA 1EP3A 1Q6FA 1ZALA 3U8GA 3UQNA 1PHQA 3WF1A 3WJXA 4IMFA 1BVNP 3PBUA 3G0UA 4W7UA 1QNQA 4F8XA 2WO5A 5C70A 3UZ5A 1E43A 4O10A 1E56A 2EHHA 4M1RA 2A85A 2VR5A 3VX1A 4C7DA 4Y96A 1J4EA 3AXIA 1XSKA 4DBEA 3GM8A 3GZ3A 4S2CA 1Z42A 1SR9A 5F4XA 3G1DA 3A5FA 2YIHA 4DO4A 3GNPA 3CEPA 4AZ5A 1D3GA 5KZ6A 3NNTA 4K8EA 2BZNA 4TU1A 3AJ7A 4PTXA 2ZTJA 4ZQOA 3MP5A 5E9AA 4ATDA 2YCEA 1HTIA 3VD7A 3IJ7A 3DKJA 3TA9A 3G1HA 3BAJA 4MNJA 4WF7A 3NPXA 3GDTA 2WJZA 2EPLX 5FL0A 3DFTA 1W9UA 2QCMA 1G4SA 1UD8A 4PMOA 3U1XA 5EBUA 4ATWA 2A2IA 4PMQA 1BHGA 4NRRA 1H51A 3RILA 1ALDA 3ARUA 5CGTA 1HJUA 5T26A 4LPCA 6A3HA 4RL3A 5A8QA 1L9WA 2WV8A 2YDAA 3LTYA 3B9AA 1H11A 4R34A 4WKAA 2XFRA 2Y6ZA 5EMUA 2VCAA 3QOKA 4GKLA 1GZJA 1JZ7A 1Z48A 4UQAA 3W7IA 3SCUA 4JTLA 5LA2A 2VX5A 1JAEA 4PN2A 3TTYA 2ZICA 4HZ7A 3IAPA 4E2DA 6TIMA 3PTKA 2VOMA 2C0AA 3P84A 4MKNA 5TBOA 3ZO9A 3O63A 2XGIA 3SEPA 1A5AA 4JTFA 2YJQA 3M41A 3WMSA 3DGRA 1JGIA 3O05A 1ISXA 3IANA 4QCEA 5DEZA 1E70M 3RCNA 5IFPA 3DFQA 4GWEA 3B9DA 4U3CA 3GKAA 4CD4A 4MNMA 1XGZA 4KGLA 1A5SA 2GSJA 2X0HA 1QPKA 1VEOA 2PI6A 2WHLA 2C15A 2FB2A 4KFNA 1UR2A 1E6PA 3PM6A 5DF0A 3ZT6A 2ZZ7A 1WKYA 2W91A 3F5KA 5AHEA 1WCGA 4NSBA 1EO5A 3SJ3A 4D1JA 3OLGA 3LB0A 4XTDA 4TVCA 2G95A 1SO6A 4OV4A 4W86A 3CH9A 4CN4A 3BG5A 4AXKA 1MW2A 4TTUA 4L4MA 1X1NA 5FKYA 4FXRA 3WQ6A 3I65A 2CZ5A 4UFMA 4O1CA 4O57A 1B2YA 3EYPA 1WDWA 3LPOA 1VYRA 2WQPA 5I5RA 1MQRA 3HG3A 4K68A 3HGRA 1FCQA 2BHYA 1JD9A 3FAWA 3VDBA 2J9YA 1J12A 2EPNA 4WJXA 1H5YA 3WMBA 2PWDA 2BVTA 4KWWA 3TAOA 4OU1A 3P60A 3W73A 4BZYA 2DSZA 1QHZA 1QVBA 1J0JA 1ISVA 1UCWA 4Q33A 1H3GA 2TAAA 3L0KA 3OLIA 2FHCA 1FH9A 4F9DA 4UFLA 2VEPA 5HXMA 3ARQA 3NA8A 1OFOA 4HTYA 4HNTA 4AWEA 2WC4A 1XBZA 5LGZA 4V27A 3QSRA 4QFUA 3K30A 3WDRA 4FFGA 5FEWA 3T0AA 3N73A 4NJGA 3U5YA 3MO7A 1G1YA 4POCA 5BXTA 3M0ZA 1GG0A 1Q6RA 4GUJA 2PURA 5EL1A 2OLHA 1W9PA 1E6ZA 1YXCA 4JAWA 3S6TA 4RXFA 5AC5A 3B03A 1VFMA 2CKRA 4O12A 1FOBA 2PWEA 4H7VA 4ZENA 4DBDA 3N3MA 4A3UA 3O6DA 4WY0F 4LQ1A 4ACYA 2P10A 3GTNA 2TSYA 3A9IA 1UQYA 1ZCOA 1JCNA 3OIXA 3S5OA 1V02E 1X6NA 1LTDA 4LS2A 2A7NA 1D3CA 1KGUA 3BLKA 3EDDA 4JTIA 3FIGA 4NZJA 1XSJA 1VLWA 2DDXA 3AIWA 3VD4A 5HR6A 2H8ZA 3UGFA 3F1QA 2CLKA 3N04A 1UWUA 4AD1A 1RR2A 2H3BA 1EA0A 5AHNA 3J7HA 4OWGA 3W71A 1AMKA 1C8XA 2XN0A 3MBDA 3NO5A 4K8HA 3M6DA 2ZRUA 1ZFJA 4HMCA 3W37A 2OSWA 1Y7VA 3I7SA 3TC7A 3I7RA 1OFAA 1QDSA 2BY3A 2H8XA 3QPZA 4JL1A 3WF4A 1JDCA 2GVYA 3WFLA 1X1ZA 2E09A 2VCBA 3NEVA 1Q6CA 3MYOA 2VR4A 3P8IA 2AAMA 3QMTA 4OT7A 1UZ4A 1TV7A 1F6PA 2EAWA 3TKFA 2D24A 4JY9A 2ZRZA 3VE9A 4PL1A 1SZGA 1VPXA 1QOPA 2CFFA 1SW7A 2E6AA 3R2GA 1GHSA 2ZTKA 3P61A 2A6LA 2UY3A 2J7CA 2XHYA 1OFBA 4QITA 2QUVA 2ZRVA 3PTQA 2FGZA 5F2IA 1LLOA 2CITA 2ZWYA 3S42A 2VZOA 2X1IA 1U5JA 5D05A 3VIOA 5G2HA 4W7WA 1W5PA 5BXPA 1LBMA 1U30A 4CD6A 2ZX8A 3KEHA 4YPJA 1OYCA 2A0NA 1B3VA 4OOZA 4HKPA 3ALFA 2LLEA 3LHWA 5FCZA 2BS9A 3BGJA 3OHIA 3W82A 3PULA 3NQ8A 1F7BA 4HHPA 4LS1A 3VGBA 1ODUA 2WC3A 4WXZA 1IT0A 1SZFA 4IJBA 4UTLA 2YGYA 3A4WA 3NPUA 1VF8A 3RPMA 3BCFA 4GI6A 1LBLA 1QPRA 1HO1A 5C5YA 3OEXA 4K6AA 3M43A 2RGLA 1D3HA 2CHOA 3T0BA 3CIWA 3ZR4A 2VO5A 5CQ1A 3SCVA 4PEEA 3FKKA 4JFUA 4K39A 3MWAA 1ISZA 1V5XA 2Z6IA 4QNWA 3KVMA 4LWWA 4JIPA 4P8XA 5L9FA 2HMCA 2NZLA 4AAJA 3S9YA 1KFEA 4OOUA 4W9TA 4TX6A 5FKBA 3FHQA 4IPNB 1WDRA 3AFBA 1TPUA 1EWEA 1EX5A 5F4WA 3LXBA 5A8GA 3DZ1A 2X0YA 3PZVA 7TAAA 3NQAA 3I3EA 3OVRA 4LV4A 4BCEA 4EF9A 1BVZA 2ZRYA 3N17A 1ITXA 2ZE0A 3CLWA 2E9BA 1ONRA 1KR1A 2H90A 3LV5A 1CX9A 1VB9A 4M80A 3UERA 5K9DA 1UR9A 3CTLA 1FH8A 2W66A 2WHKA 4FK9A 1C92A 2WVVB 3MU7A 1OFPA 3PG8A 1JQXA 1XV8A 3VIGA 2X05A 5CXPA 1M5WA 2Y24A 1E4NA 2JF6A 1THFD 4QNEA 1FP9A 2CHNA 2NWRA 4HPXA 1KM1A 2DIEA 1W9VA 1XUZA 1O60A 1Q6EA 3QZEA 1DWHM 1KTBA 3WL1A 1VFUA 2E40A 1VCFA 3W24A 1LRTA 1A53A 3DI1A 3MI6A 3EX3A 5E0KA 5H2ZA 1H5VA 1KQZA 1Y9GA 4R5EA 3BAWA 5LA0A 4ACZB 2GOUA 3AMCA 5K9CA 1VQTA 2C16A 3ARVA 3WY1A 1QI4A 1UR1A 1ZL1A 3G1XA 4NNCA 4UFHA 1OG0A 1EP1A 4J3TA 1VJSA 4C1LA 2JBMA 1E0VA 4O52A 3EXTA 2V30A 1QW9A 2OZ0A 2OSXA 3AMGA 3LDRA 1J01A 4WJEA 1AG1O 3UR7A 3ZJ7A 3O6YX 5GPRA 2BNJA 3L67A 1LL4A 3ZT5A 3MJYA 2J7EA 3GNDA 3W7NA 2BVDA 2ZZ6A 4BR1A 3W6LA 3OSDA 2MANA 4GQQA 4O4WA 4UTUA 1FWSA 1UWRA 4AHPA 2J4GA 2E6YA 4NJHA 3T2PA 1GCYA 5AHFA 3LOTA 1KM0A 5KITA 1EIXA 1UB3A 2CW6A 3IVUA 5HJLA 1QNRA 3LCXA 4WUIA 5G2WA 5G5IA 2DEPA 3PHAA 1K8YA 5E0FA 1H1ZA 3OBAA 3WNMA 3QEZA 2OCZA 3LPGA 1EHAA 2XFWA 1VRDA 8CGTA 3TX9A 3FY1A 4P7NA 2VKZG 3IAQA 1GOXA 1XH2A 5LYRA 5A2BA 4UQEA 1FP8A 4UFIA 2CYGA 2D3NA 2VZSA 1C8YA 5M03A 3WJYA 3AHZA 3DYOA 3W28A 1AVAA 3SIZA 2JEPA 5MHBA 4Q7NA 4WD0A 2YLAA 1DQXA 1UWTA 3W83A 1KGWA 4MLJA 4UQ9A 3W1QA 2D1ZA 4GXMA 2YFNA 4LVBA 4MLRA 3IV3A 1GOWA 3GR7A 5CPOA 3W1TA 3RDKA 3GAYA 4MNLA 4HOXA 1OF6A 1DV7A 1VYPX 2XGBA 1CZ1A 2F61A 2VX6A 2XIIA 4UQDA 3WUBA 1JAKA 3EX1A 5CJ5A 3N9RA 1M04A 1UHVA 1CLVA 3FFSA 3SCPA 3OLEA 2JGYA 3E49A 1UUMA 2Y8VA 5A95A 3TROA 3UWWA 4NUWA 5D8WA 4MUZA 3BLFA 2XG9A 1VBRA 2VMFA 3W7MA 1WBJA 3OGSA 1LBFA 3CB8A 3LCWA 4AWSA 4HA4A 4UTFA 3BAIA 4JX5A 4JCLA 1JRCA 3M5ZA 2J6XA 3UYCA 3AHVA 1UA7A 3LI0A 1V3LA 3CPUA 5A3HA 7TIMA 5CPQA 1H09A 3LHYA 3GIYA 1G4PA 3I3DA 3G18A 3KL3A 1JCYA 2GJNA 5GNYA 3FHAA 1B3YA 5C71A 2YL5A 1E5NA 4Z1CA 1VJIA 2A21A 5EYWA 3W7DA 1PZ3A 1ZY9A 2V82A 1TVPA 2DH3A 2J7GA 1CYGA 2QHAA 4FO4A 3KF5A 2CPUA 3T7VA 2Y88A 1W56A 3VGGA 1KFLA 4EAMA 1K03A 4RKAA 4RXGA 1JD7A 2Q8XA 3LDKA 4B9ZA 4AYSA 2HS6A 2RH9A 1WDPA 2RHGA 2IQTA 3M46A 3W29A 3UGGA 2GUYA 3R13A 5JBEA 1C7SA 4Y8FA 4MJMA 4UUIA 3LRLA 2ISVA 4JEQA 2D0HA 2XJ7A 4DWSD 2RDUA 3WH9A 3NYZA 4N2YA 3AIQA 4DF1A 1W2PA 1MEWA 4PSRA 3WH8A 3VD3A 2VOTA 2WVVA 1QNPA 1CLXA 1WNOA 2WSKA 3F03K 3MUXA 1U2YA 5I3FA 2NWSA 4UQBA 2DZVA 3NMBA 1CI1A 4WK9A 3VMPA 5C54A 2QAPA 3WJWA 5J5DA 3GR8A 1KQYA 1J9YA 1VFFA 5JIWA 2XQRA 3HG4A 1T8XA 1CXLA 3W2JA 3C2FA 3VX0A 4JYFA 1W5NA 1CWYA 1UUQA 2DT0A 3TW7A 3GBDA 4JTSA 4PYSA 4AD4A 3U75A 1EOKA 3DECA 1FXQA 4XBSA 4BA0A 4M6PA 1C8VA 5ABHA 2J24A 3CZEA 5C55A 2YDRA 3W74A 4P2VA 1XRVA 4OBSA 4ACZA 1R85A 4IGHA 1UA3A 4XZ9A 3KRSA 3L4UA 4PMNA 4JCMA 4BF7A 2G3MA 1CGVA 3KWXA 2Z6JA 2WZIA 1W31A 2GQAA 4JHZA 4HNUA 1W0MA 1FBAA 2VFHA 4UC5A 1YTDA 4NZFA 2CBUA 2X09A 4ZFMA 3NPWA 4WQ6A 3WDQA 3BK0A 4UMCA 3EXRA 1LF1A 1A5CA 4M5PA 3TSBA 1C9DA 3VI2A 8TIMA 4HN4A 1LLWA 2VCCA 5EFDA 3OIHA 1LG1A 3PG9A 2E8YA 5HBFA 3EBVA 1M7PA 3PIGA 2HISA 1FDJA 3VVGA 1B4KA 9CGTA 1EDGA 2ZA1A 3KOFA 1EOMA 2EXOA 1YTEA 3AMDA 1PL9A 2BLEA 5K7JA 3W1RA 3WK2A 4PA8A 5BROA 1B4EA 1DWJM 2NUYA 4YCPA 4A2RA 2YFOA 1UD6A 2ZUWA 5A6JA 3E0IA 5FF3A 3HGJA 4X22A 1QPQA 5I3KA 1M03A 4QQ3A 5CZSA 1I1XA 2WCAA 2WMJA 3W1NA 2QF8A 3AIRA 3BSGA 3MS8A 2ZXDA 3NL5A 1J0KA 1OVDA 1GVQA 3HMCA 4MPKA 2Q3RA 3LCIA 1TV5A 3GX9A 4W89A 1QHOA 4AVFA 3PZ9A 1XYFA 1JJKA 3ZOAA 1E1FA 4P7QA 3ELFA 3G1AA 5FF7A 2NUWA 4V28A 5D09A 4BQ3A 5FEXA 3CIVA 5BRPA 5DBUA 2RGMA 1G69A 4GXPA 4W5ZA 5BCAA 2HTMA 1P5BA 4N9DA 1WA3A
chains in the Genus database with same CATH superfamily
2VBBA 4A8IA 3L12A 1Y5VA 5BMWA 5A33B 3VM7A 4FNRA 2SFPA 2DW6A 5AYXA 4G8TA 2QUNA 1RBOB 4QE1A 2YXXA 2YR1A 4PUEA 2V9DA 1VS1A 4GOAA 1A80A 3UVAA 3W1MA 5LW9A 2YL9A 1UOFA 4B1LA 3MZNA 3N4EA 1T5AA 1Q66A 1YKWA 1XR2A 4PTVA 4HN1A 3ZSKA 3ZOIA 1UNBA 1IIHA 4S3DA 3VIMA 1JN2P 4BI7A 3BXWA 5DUUA 1JCLA 3AXMA 2IXJA 2P5NA 4CCNA 3OOQA 4Z08A 3M0YA 4WDWA 2VMDA 3SUUA 4HL0A 3O0VA 5G04L 4BU2A 4MWAD 5IJRA 1ZAJA 1D4M1 2OPWA 1OQ1A 2XKPA 5AFEA 4TIMA 3WJSA 3UL2A 5FYCA 2O0OA 2RMU3 4UF0B 1DWAM 3IJ9A 4KQNA 4BFAA 3MWCA 1LLZA 1U83A 1FWFC 4AF9A 2ZX7A 1VIZA 4HHMA 3SUSA 5FPUA 2FDIA 3AZXA 3B8SA 3PN8A 3GVVA 1VR3A 2YFUA 2W1UA 3QJAA 4PTWA 1LZOA 2NX9A 5E8AA 2VEGA 3S7IA 1Q8JA 2PODA 3TZFA 4CD7A 1HVXA 2BB0A 4E4ZA 1PMIA 1M9HA 1OA3A 4CP0A 4HKWA 2VD7A 3BLPX 2XH2A 1X82A 3EPOA 2B81A 2ZUSA 3SUVA 3UD6A 3WH6A 3WDYA 5KSWA 1C28A 1SGJA 3MV01 1S0BA 2IXIA 3TYUA 3SKVA 5C5UA 4AIOA 3NL2A 4MZ8A 4PI0A 5AVHA 4LXLA 3S3GA 2DCJA 2WQ4A 4O61A 1XLCA 5J8LA 1W2NA 3ZXAC 4ZBCA 2W3JA 1TQ5A 1A5UA 4MGSA 1NF0A 2ZX0A 3TN93 3FYOA 4JX6A 1NY72 4LB3A 1B3ZA 5JPNB 4NI8A 1LOEA 4YM3A 5C8WA 1YBQB 5C9UA 3AX4A 5G4WA 1CQ9A 2B4KA 3NOYA 5DXDA 1Y8BA 2GSHA 3HWJA 4WBBA 1MXSA 2JDKA 1X97A 5EKYA 1OBNA 4V2WA 1AJOA 3KCXA 4JL2A 1X36A 4M6VA 1OFEA 2ASHA 1AL8A 2PZ0A 4X3ZA 3GD6A 3UWUA 1KDMA 1OQFA 4TXEA 2ZGRA 4KIEA 4PCRA 2A79A 3INPA 3CNYA 3SCWA 5FJTA 4GJYA 2GU9A 3B0PA 5FZ9A 4IMGA 4GH4C 5C8BB 4B4PA 1I6XA 3T4WA 3F2CA 3ILFA 4M24A 2EF9A 5CSRA 3J9SA 3C4UA 1EUNA 3W87A 4XJWA 1HRI2 3IPWA 1PKYA 3ZMRA 4I0BA 2WT1A 3P14A 4JGZC 3G0XA 3E1F1 4N6EA 4B2DD 3WDXA 3L9CA 4FHAA 3KVKA 1A5LC 1V6WA 2WSQA 4DRVA 4XETA 3ALQA 2R94A 3VDGA 1H7PA 5LNUA 1EEXA 3H1WA 3BCJA 1AZ1A 4K7VA 3R8RA 1DJHA 1KCXA 1N3OA 3R0KA 4LR4A 3RYPA 3UR2A 3PBGA 2JKXA 3L2IA 3BAXA 5LY1A 4XVEA 4Q7BA 2EO7A 3GTFA 2OO6A 2VTXA 3M4FA 1G5AA 1K70A 3M7AA 1C93A 5T54A 1NQKA 3MC5A 1Z44A 4INFA 5JMCA 1J5SA 2OQHA 1OOPA 2X5IC 2PU0A 1VJ2A 2C1FA 1ZJHA 2A3AA 3VBSC 3KBSA 1Q85A 3HBKA 3L2HA 1W28A 1NAEA 2DF7A 2C9KA 2HWF2 2OO0A 1BGAA 1WCQA 3OYWA 4E2GA 4MIMA 3VB9A 3DAQA 4PUUA 2D2OA 4UQCA 4B5UA 2WDBA 3IIIA 1F2NA 3CEWA 2E7QA 1JZ6A 3JBG3 1VC4A 4HOZA 2E31A 1CWPA 1X6LA 4XFCA 2Z24A 1IYXA 3M2MA 3IACA 3TAKA 1QO5A 4Y9PA 2VCMA 5F2GA 3MBFA 4FNTA 3WD2A 4DPPA 1D7FA 4L1GA 4COYA 5ABTA 5FI8A 3W59A 2DSKA 1KBIA 4AZCB 1OZMA 4EQVA 2PDYA 3EWXA 2P8CA 1J10A 4RNJA 3R0UA 2RHPA 1FPN2 3G24A 4FNSA 3U11A 1E5JA 4IOTA 3QY6A 5AC8A 3BV4A 3EOSA 1DXFA 1IWBA 1LGCA 4Q32A 1NA1A 4XK2A 2AL2A 3W9AA 4N9IA 3F5LA 5JOZA 2GQ8A 5LNWA 2D22A 1XLFA 2BXZA 1MEC2 5I02A 1US2A 3POIA 2O7QA 2ZA9A 1OPOA 1B54A 4R88A 3DPRA 2WNZA 4I02A 2B7PA 4HZ8A 1H1AA 2AGTA 4QQOA 4GVFA 4P08A 3WBEA 2Z1XA 4YVVA 3PURA 1GJPA 4KI5M 2BDRA 1VBA2 1GW1A 3V0UA 1RK5A 5A7PA 2VZUA 4NZ4A 1XLBA 4CQAA 1H2MA 3TXVA 2LTNA 1TB3A 5KZEA 2XLGA 3AS0A 4F8AA 4IZGA 1LULA 4N43C 4QS6A 1PDZA 4L6HA 5HNNA 1BYBA 4G9SB 2QKFA 1HIZA 3RM9A 1GPWA 3PPGA 4O1AA 4KGJA 5DAVA 1WLTA 4DO0A 1JDDA 1TELA 4JIIX 1L6SA 3EBRA 3WLTA 3LMZA 3GVRA 2BHUA 1W8TA 3APTA 1H62A 3AICA 3HQXA 2VBDA 1V4YA 3TFCA 3KS5A 3PUEA 1H4HA 4L9XA 1WA4A 3IWZA 2OWWA 4JNYA 3UG4A 1BRLB 2FH8A 3BG3A 4UTTA 2OEMA 1MQTB 1O6IA 3M64A 1TPVA 5CZJA 1GWKA 2HWC2 1N3PA 1QQP1 4IEZA 4BQ5A 2JALA 4GYPC 2ZA3A 1UH3A 3IIOA 1OD8A 3UKVA 5LCWL 4D0QA 1F9CA 4ERAA 1NDZA 3FVDA 2P50A 3HQNA 2XBO2 4HNOA 5FSDC 2VYOA 2Y34A 4WCJA 1UASA 3WVJA 4AIUA 2ENRA 2B31A 4D6FA 2W67A 1ND3A 5I3GA 5LA9A 1GKPA 3TC6A 2XWEA 4DMIA 4Q4OA 5FFOC 2P4EA 2X30A 2CC0A 4GJ1A 1ENUA 4XC9A 4EPKA 2A1YA 2DU0A 4FOJA 4MDOA 1EJRC 1GWJA 3M0HA 1JRBA 2Y26A 1RVF3 2YBVA 1RUC2 2XMLA 2V63A 3HQUA 4EYUA 4LSBA 4RZ5A 4DRRA 4AXOA 1NZIA 2A3HA 5ISLA 2JEQA 3FLUA 5IVYA 2WZPP 1O1HA 5C9AC 3S5ZA 2AEZA 1GKQA 2D6LX 5AOUA 2O4MA 3SCHA 5HINA 4I3GA 2J6VA 4LHKA 3NQVA 3KS7A 1FHDA 5D8AA 3HIFA 2OQ6A 2NLYA 3RRDA 5CA6A 2ATFA 5EU9A 4P7OA 1YXDA 1LUCA 3LEPA 2WJFA 2ZC8A 3BLEA 1YNPA 1OFSA 1SLLA 2FTPA 5AC6A 1OIMA 3AVRA 1IEVA 3D0SA 5JBFA 1BAGA 4FFHA 3SN0A 1PGW2 1N1YA 4L2NA 3FFZA 5J5RA 2RVAA 2OWXA 1WMEA 4Q8VA 4GC3A 1BLZA 1YHTA 1QJY2 1S5VA 2HVOA 2PTDA 4GNKB 3I59A 1XSRA 4FXKB 2Q3OA 3EB4A 1SFSA 2DYCA 5HV4A 2GN7A 2I5GA 2VMIA 4LKEA 4DPQA 3VZZA 2VQUA 4CEUC 5A8PA 1V3IA 2CSGA 2R49A 1NAL1 1CAUB 3DKWA 4R9XA 4XVDA 5LHEA 1E57A 4CUCA 2E5BA 1LOGA 4B5TA 2JE8A 5C2XA 4B5VA 4GABA 3QFWA 3L2YA 1VAMA 1E73M 1XLIA 5GJNA 4ADSA 2ETEA 4HOWA 4FZIA 2D6NA 2W94A 1OABA 3VXGA 1M53A 1CAXB 4PMRA 1J1LA 3UR8A 4FSAA 1R46A 3PVFA 1ITCA 5HOSA 4QDWA 3CQIA 2JDMA 1SYTA 4AY7A 3S5QA 4MFDA 1XG3A 1GBGA 4KETA 1R2TA 1ND2A 1F76A 1K02A 3FHIB 3RLVA 4V1PA 3UCDA 4N9CA 3H7YA 2GYIA 2WVTA 3TEXA 4B3LA 4LF2A 1D2KA 5E6HA 3PUIA 1UY3A 3ARRA 2PCQA 5BNPA 1K5MC 5DDJ2 2YYTA 4W50A 4M8UA 3WLUA 4Q4SA 5FY9A 3RJYA 2Y7DA 1WZAA 3DXIA 1XF0A 4FFFA 1PWMA 5I3DA 2WFF1 4UR7A 4E38A 1ULGA 1W6TA 2FVKA 3VN4A 5M1TA 2A71A 2WBGA 5H9QA 4NKCA 4NAFA 4IIEA 3SUWA 1G7VA 4B5SA 2E26A 3K4DA 4Q8TA 3N13A 2FZBA 3C3NA 4UTMA 3LCGA 4P7LA 1QJEA 1G8WA 2V3EA 3W6YA 4E2VA 2GP5A 3R4SA 1E3ZA 4R7WA 3QPEA 3DCQA 3N9KA 4GKYA 2WZR1 2IVIB 1KFKA 4X61A 1RUH1 3OBRA 3CASA 1KDKA 1X8MA 3ZZ1A 4W4ZA 1HW6A 4OFGA 3MHUA 1TWDA 3WOGA 4Z1DA 4CNTA 3ABQA 2OZJA 1DQWA 1NFPA 2FJKA 3GDRA 3WLNA 3W9ZA 1PXGA 1JUHA 2H9AB 4IXXA 3M70A 3NQFA 5TIMA 3CLMA 3ZLHA 2V69A 5FF0A 2EPMX 3GVGA 5F1UA 4M19A 2Q5TA 1O94A 3VFLA 4LOTA 4OVEA 5CAZA 2NLIA 2QW5A 4I0AA 1YQ5A 4H00A 5C33A 2P1FA 3WQOA 4AEEA 5FK8A 2QJHA 4CU6A 1ENSA 2ABAA 2WVUA 1GNHA 4UW4A 4XAYA 3G22A 3TFXA 2BYVE 3WKZA 2DZXA 4HK8A 3CB3A 3AYSA 1S2VA 4K40A 4ORIA 2V3DA 3WY6A 2Z26A 3G3MA 2P17A 3QQWA 1EBGA 3H54A 4XKMA 1ZBE1 3HQOA 3U48A 5H6HA 3AKPA 4I7VA 2TEPA 4GQBA 3KCYA 4H4IA 4GBUA 5F4SA 4AU0A 2CAVA 4DBSA 4JTOA 2E32A 3H7UA 3AFKA 5CFDA 3W4RA 4JZRA 1IS5A 2D3LA 3ZWSA 3VK5A 3WHUA 2VXJA 4CE8A 3BLOA 4FNUA 2Z4FA 4XFAA 2D6OX 1W6OB 1O95A 3LNPA 2WS92 1V6LA 1UJQA 3FJ4A 4E27A 4IIDA 4BEQA 2Y1HA 3PC0A 3FBMA 2OS2A 2PC4A 3WNXA 1S2UA 2I9UA 4K1WA 5LB6A 1T99A 2WNUC 4AC7C 5B80A 3VKCA 3JS3A 1WOAA 3RZKA 5FUNA 1RV8A 2J27A 5DRCA 4YARA 2VMEA 4MGTA 1K77A 1CIYA 4J7RA 5IBXC 3BOPA 2X53S 3WNNA 1QWGA 2G3FA 3IARA 2RUSA 4WSJA 2QJNA 4DYJA 1SBFA 1MXDA 3AIUA 3QM3A 5FIPA 5REQB 5LIKX 3ZR5A 4AFAA 5A3NA 4E2BA 1RHI3 1PS9A 4Z0JA 1CZTA 2J77A 3P0XA 3EWCA 3AMKA 2J7MA 1U5IA 1AR62 1RCXB 1HXS2 3IB3A 5JOWA 1DQ0A 4H83A 5HMFA 1KCLA 4LU0A 3C0SA 4F3HA 1O7FA 3BTAA 3MUZ1 4YM1A 3LM3A 3GAKA 3QPYA 4AHWA 4LVDA 1V6JA 4QSHA 5K4ZA 1TV4A 3UWYA 4QHBA 2E25A 1H0IA 4WR3A 2L9LA 3SH5A 2V8ZA 4JXCA 1GKBA 1ICSA 2ZGOA 2B4GA 4AEOA 1PB0A 1G6CA 4WX2A 1C91A 1UYXA 1MW1A 5DMLA 2NW0A 3CLPA 4IEYA 1E55A 2VHLA 1LT8A 3MPBA 1S0DA 3WG3A 4XD4A 4YWIA 4K6BA 2HE8A 3S2CA 3B0YA 1ZB5A 1KS5A 2AKZA 5IVCA 1V9U2 3PNZA 3FEMA 3RIKA 3P2VA 4GFIA 4AQLA 1EYWA 1RUJ2 2QDHA 4BXFA 3VDAA 2X42A 3BW2A 3EPMA 1OGGA 1OBAA 2JG9A 3PLQA 5CKNA 4ML4A 4NZ1A 4S38A 2DORA 3WG4A 6XIAA 1VRH3 4ADUA 4O15A 1LWJA 3H3LA 4KWUA 3NDOA 3S0MA 5BNQA 7ODCA 4P9LA 1ELSA 1MS0A 3DX5A 4ZS2A 2J7DA 3QGVA 4NRMA 1R3WA 4O50A 3AB0A 2W2IA 3APGA 3POYA 1BKZA 2R1BA 2E33A 4UBHA 5IK7A 3QLDA 5DXXA 1RVGA 3WQ7A 1AL21 1TVLA 5FZHA 5CBIA 4QPWA 1XRFA 2VP8A 1UH4A 5DY2A 3U2OA 3M1ZA 1OX4B 3HURA 4Z2KA 1BMV2 5CKSA 7REQB 5D9PA 3HFYA 4C6EA 4FP1A 3C8XA 4XBKA 1P6CA 5FLJA 4D8MA 1CXIA 3LWCA 3OB8A 3EEZA 4H6KA 1N7KA 2GH8A 1EAH1 4QM1A 3RZLA 3RM8A 1RA0A 4CNPA 1Z32X 4AW7A 4YLWA 2CY6A 3W7HA 2G4JA 2ZHMA 2B7NA 3LBOA 1KXHA 2FDSA 4WIWA 3WLRA 1YFXA 5CFCA 1TTQA 3H1MA 5A2AA 4M56A 5FYIA 2AMGA 4EF8A 4I01A 1S0JA 1UXZA 4C90A 1ZZBA 2OXNA 1I5ZA 1HKMA 2PBGA 3U57A 1PZ9A 2DT3A 5CZ0A 5HNUA 2NQLA 3W1AA 4QAIA 1Q2RA 1FPN3 1H30A 5F39A 1HO4A 2YC2A 2WM1A 1CPMA 4XUOA 1OHFA 4MB5A 2IMRA 1JCMP 5CSSA 3E96A 3ITLA 1JPIA 3TP4A 3LPFA 1FUYA 2A3EA 4ZPIA 5CG7A 3AIEA 4C91A 1MEC3 4BLIA 3CL6A 3EB7A 2OQLA 3MI3A 4DJDC 2YPDA 1UQXA 3F4NA 3ES8A 5I93A 4LPLA 3ETPA 3NDZA 2WZ8A 4CVUA 2XGXA 4JDNA 2VOWA 4D3WA 4ZOEA 1ZJAA 3UWEA 1TVGA 4IE7A 1J84A 1ZA7A 2YCLA 1OUSA 3CL1A 3WLIA 3GNRA 3WR0A 2GDFA 2NQ9A 2ZMNA 4MJZA 4NXSA 1FDYA 5EPDA 3NAPA 2QZ2A 3QYQA 2RDRA 1QF3A 3B4YA 2ZEWA 1FWDC 1ZP3A 2G96A 2IXUA 5TNVA 4KWVA 2PHRA 5IK5A 4GVIA 3THUA 4H9ZA 4LUTB 5HPCA 1UWSA 3VIIA 2VC9A 4CKQA 1POKA 4UYBA 2A3LA 2C18A 1MVYA 4YGCA 1JCJA 1V77A 3DHFA 2X1UA 3BODA 3GTHA 4L4PA 4GIQA 4LY8A 1QJX2 1LEMA 1QY4A 3ZSLA 5DN2A 1SCRA 1EUTA 3WP5A 5ABJA 1FQ0A 1ASJ2 2E7AA 3AKQA 2ZOXA 1EQPA 4PMZA 3K2OA 4DUVA 5EMLA 1ME8A 4GYKA 3V3WA 1LORA 4XDQA 4H6QA 1UZYA 1J2BA 4U10A 4NZ3A 4ZY9A 1A4MA 4QPYA 5T5OA 2E7FA 1IEWA 1ZBKA 3AU2A 3GVQA 2IPGA 1PYMA 3PMEA 1JYXA 3PVEA 2A6XA 2XWDA 1E0UA 2WZEA 3BIWE 1FMD2 5FBJA 2GVLA 1JVNA 5FMCA 1JUEA 3B9CA 3I8TA 2WN2A 1W3JA 4XKYA 4QQ2A 1UKOA 4C6NA 4FR6A 3AALA 4PDWB 1YPIA 3AVSA 3ORJA 3LERA 4WRHA 2XPJA 4ZXOA 1V0AA 3ZFFB 4HSOA 4ONVA 4DWSB 5F2MA 1GQNA 1ZBCA 1K1DA 2WO3A 1RUC3 2DVDA 4COVA 4XZHA 2B9UA 2GN3A 3O7OA 4AVSA 3O7UA 1I0DA 3VNMA 3JXSA 4FFIA 1F07A 4UR8A 1HJFA 3CO8A 4Y9NA 2QBXA 3RQ0A 2DIJA 4IG2A 4S2HA 2FH6A 1TWZA 5CG0A 3W26A 3G1RA 4PZVA 1CCWB 3MLKA 1YQ6A 3AXDA 4QLLA 3APBA 1WB0A 2P3KA 1DGWX 1PX4A 2VJXA 3TSMA 3CK5A 3QW3A 1QXPA 3CKHA 3KQ4B 4ASMB 3XIMA 2D6MA 1NOVA 4XQWA 3E2QA 3AZTA 4QIUA 3RK8A 3ZYIB 3OA3A 3TR2A 3UA3A 1H2KA 5I8TA 1O8SA 3CWOX 4UZUA 3HN1A 2KM2A 3IPVB 1I60A 3PJWA 2RM23 5D04C 5F5CA 4AQ6A 2WKJA 1QJY3 2GGHA 2I45A 1JYWA 3SAZA 3GU1A 1S39A 1GOKA 4JN6A 1MEHA 3I2IA 3IJDA 1W1VA 2BZDA 4B3NA 4DO5A 1D9EA 4ZQRA 3DG7A 2J62A 1J96A 4JGYB 3IGSA 1JUBA 3S6PA 5JU6A 3ZYHA 1FWTA 1ZU8A 1E72M 4DN1A 6REQB 1LL6A 1GUVA 5DN1A 3SH3A 3ARSA 2C6SA 2XFYA 3QZ6A 3SXWA 1V6OA 3ZPOA 4ZTYA 1YYNA 2GDQA 3UFYA 4Y7EA 4BQ1A 4FTEA 2EG6A 2FGLA 2PP1A 1POQA 4S2DA 5M3WA 5FACA 1BBT1 3GH5A 4R7OA 4LHSA 1WXJA 4PB4A 2XLAA 5FJKA 3URFA 4QXIA 5CPLA 2Q8EA 3WH5A 1XGDA 1M7JA 4OI4A 4L64A 4XUNA 1UWQA 4H3WA 1XIEA 3R8HA 4CRQA 3PL0A 4B92A 2PQQA 3MDPA 4ERGA 1I2NA 3EOEA 4JDYA 5FYMA 1YC61 4R9CA 1K9EA 4EAYA 4D8ZA 1DVJA 5DDJ3 1QOXA 5FO8B 2J7BA 1CGPA 3A3HA 4GY1A 3V0BB 4EK7A 4KNCA 3ZWTA 1XICA 4MWAB 4R52A 3J8F1 5LATA 4GMP1 4QM8A 4HT3A 3WELA 3VOCA 5M0TA 4CU7A 3SADA 2DTYA 2W46A 1W5QA 1QI3A 3UEQA 3WDUA 3LIGA 3DG3A 4JGZA 1OLME 3SR7A 1S1AA 4XABA 3PB0A 4EN7B 4NRQA 3S5YA 1VMJA 3ARZA 3DG6A 1W03A 1O5XA 2PE4A 1QW7A 2A3WA 4I5XA 3NAVA 1VRBA 3GK0A 3Q94A 1RUF3 2ZADA 5HPOA 1V0KA 2W27A 4NZ5A 1BZWA 1XNTA 2PDBA 3LS9A 3VUPA 2GZWA 4OVXA 1V0LA 2YXSA 2ADDA 2YPIA 3TAYA 4CDUC 4LAKA 4J3XA 1MSSA 5DLCA 1W37A 2Y8KA 1R87A 4RGKA 2DU1A 4RSUA 3MZ2A 3GQYA 1I1EA 2A7AA 1PKMA 4J5NA 1UC5A 2WL1A 5HMEA 1GVFA 5LIWX 2O9TA 4G4FA 3GTIA 5D21A 1L6YA 1RUG3 3NSTA 1ZRCA 1VBC1 1UL9A 3BAYA 4LCQA 3CO4A 2ICSA 1LG2A 3UPBA 5I2UA 2A6ZA 2CEQA 1B5TA 4O16A 5FDBA 3POBA 3IIPA 1WCDJ 8A3HA 3C0JA 1GORA 2A7PA 2ACUA 4P9JA 2YZRA 5AYBA 3OA5A 1LAJA 1ULFA 4BB3A 2X1SA 3EMCA 3JZVA 2QDEA 3UYIA 4CEXC 2Y6LA 4W84A 1B3WA 2ZFAA 4DVOA 2C9AA 4RS5C 1VFLA 1RBLA 1R1A2 3WUGA 4KEVA 4A6SA 4H2CA 3V65A 3WNOA 3C2VA 4K21A 4YW1A 2UWAA 4QB2A 1UQZA 1YYAA 3FA5A 1F4AA 1DP0A 2WNVB 3AHXA 2JD9A 1JDAA 2C3ZA 3SC7X 4FOQA 3MO4A 1IE7C 4BS0A 3VZJA 5HCFA 1K8CA 1S55A 4I7WA 5F3GA 3TBDA 1FWHC 4CCLA 3C56A 4ALDA 4H01A 3EWWA 4P5YA 3O5SA 4DZHA 2FGBA 3P74A 2O7SA 3LTPA 4ZXKA 4QE5A 3OTFA 1W17A 1HUVA 4LO6B 4KFPA 2XVPA 1RMU2 3AIBA 4HA3A 2PQSA 5A6BD 3VKDA 4WY0B 2ZC1A 3K46A 4LLFA 1LCOA 1W6NB 3FJNA 3IM0A 2VXNA 1HL8A 2HWB2 1VCGA 3CC1A 5FZCA 3HG2A 5CC5A 2PC8A 4GO8A 1JDFA 3ANYA 1JBCA 4EN8B 1AR63 5HUOA 1HXS3 3QD6A 3S9ZA 2NP0A 4L9YA 1UW8A 1OCQA 1KJLA 1OX6A 2QZRA 1VBHA 4Y22B 1RA5A 4PFHA 4Z17A 1QFEA 1PK6B 3LCFA 1HJSA 1Q13A 3NSXA 2PF8A 3LDVA 4LUMA 2YBTA 4QS5A 1UG6A 4QX1A 4RQPA 4INDA 4L6DA 2W61A 5F2LA 3ZXKA 4HCDA 1AK5A 3A4AA 3PUQA 3LRKA 3O15A 4HK7A 3U6WA 3N9OA 3RFAA 1YXWA 4IISA 1MZEA 3QW4B 3N12A 2VRQA 4WVVA 5A6AA 1AH3A 4LX4A 1H9PA 2HWE2 2R1MA 1GZTA 1WBHA 4XF0A 2KZHA 5LGXA 1V9U3 4C7GA 2EXJA 3R79A 4XX6A 5A7NA 4B3KA 1NWTA 2ET7A 1GANA 2WVSA 1S0FA 4P5HA 4XTIA 1TE1A 4DUWA 5ACA3 4D6HA 3VBUC 2FVMA 1TME3 1PX3A 3VBFA 4TSVA 5IVBA 1FXPA 2WXDM 4QRNA 5LZLA 4HJFA 2XSAA 2PLMA 1F61A 5IDIA 4QX0A 5HMSA 1GQLA 4MGQA 5L73A 4ZQPA 1NY71 4Q4V2 3SGGA 3D46A 3WZ0E 4QB1A 3GXDA 1FX6A 1ULDA 1KV8A 2J1EA 3KBVA 4IXHA 1L8NA 2FCTA 2WKKA 4HKLA 2UY5A 5KC5A 2YU1A 1DQ4A 1KRMA 4NL1A 3MMUA 3B7MA 4CU8A 2FZMA 4M81A 1NH6A 4KU8A 1YEYA 3T1MA 2F8QA 4Q8PA 2HJPA 5A6YA 3UZJA 1UY2A 3FX4A 1YIPA 3L5AA 2YYOA 3U0HA 1OOPB 2OVUA 4KIRA 1C3HA 4U2YA 1U0AA 4D6IA 3VNJA 2EICA 2LALA 1W8UA 1CB2A 1W91A 2DSWA 4XSMA 3TTQA 1RQBA 3GG1A 2JDZA 4HN0A 2UWFA 2GGJA 1EXPA 5C2GA 1ZLPA 3IKWA 2CXGA 4US5A 4Z2WA 1HRI1 4DXSA 4QKFA 3PNAA 1BYDA 4MZ1A 3CYJA 3V36A 5K9YA 4GUGA 2KA3A 3VBHB 4DQAA 2OZ6A 1JZ4A 1JG9A 1E9YB 4RLIA 3TA6A 3QYSA 5D2XA 1XJBA 4RNHA 5I77A 4LKSA 1QCWA 2PTZA 3W81A 1CENA 2J66A 2ZIDA 2FDKA 1GYNA 4C6IA 1GHRA 5FEZA 3HO8A 1XBYA 3WO8A 5XIAA 3W1LA 2HVMA 4XHXA 4IMCA 2CWNA 3BV7A 4TTGA 1YDNA 3WNPA 2GGEA 4D71A 1OA4A 4JDBA 3W1PA 1QAPA 1W9YA 2AL2B 1UAIA 2BXVA 2CU5A 3I49A 1MO0A 3EXSA 1H8TB 1H1MA 4HTBA 1MPXA 1OYAA 3N14A 3KE0A 1NP2A 3D4KA 2BPA2 2QCEA 1AJZA 2FZDA 2INEA 3B0XA 2D69A 1KFXL 4B90A 2CWSA 3TWBA 3HNYM 1PHQA 3UJFA 2D2JA 2YXOA 4XD5A 5C70A 3UZ5A 4AEKA 1M1BA 1NIUA 2PHFA 2DVFA 2NVCA 2EHHA 3VNLA 3VX1A 1J4EA 2QQKA 1L3JA 3O0XA 3GZ3A 1HQWA 2BOIA 2WWUA 1T6MA 1Z42A 1SR9A 5K8SA 4BM8A 1B35A 4RR3C 5KZ6A 2FDHA 3NNTA 2BZNA 4PTXA 4IL2A 5E9AA 2YCEA 3KHDA 4ZODA 3RJRA 4R9DA 4Z8BA 1QATA 2NYYA 4XACA 1OA2A 1SM9A 6PTDA 5FZ8A 3DFTA 3ACGA 2QCMA 3NJZA 2WUHA 1UD8A 2BODX 1CIWA 4FVVA 2P3JA 2Y6GA 4AI1A 1JEZA 4YM0A 5T26A 1PIV1 4LPCA 4RL3A 1IEIA 2PHTA 3T30A 5A1FA 1GZJA 3UGVA 5LA2A 4I30A 5JMOA 4AVCA 4PN2A 3TTYA 2FJUB 3T07A 2ZGQA 3P84A 5DUXA 3H3UA 2YC4A 3O63A 3WCRA 3BICA 4QCEA 3O05A 1FMD3 3RCNA 4EE2A 1S1RA 1E70M 2VW1A 1XGZA 4NOTA 5A7OA 4EXBA 4GJZA 2C15A 3WUCA 1VBA1 5JR7B 1EJ7L 5AC92 3A3WA 4N7QA 5AHEA 4QXKA 2J1AA 2HLEA 4OLLA 4DB7A 1AJ2A 3SJ3A 4CSWA 1AUYA 3OLGA 4D1JA 2FDFA 4OV4A 2DZAA 3OD4A 1MW2A 2Z69A 4C5YA 1X1NA 3OQ8A 1OFNA 4FP3A 1B2YA 4FOUA 4O1CA 1V51A 2CDOA 4ZO8A 1FCQA 4WJXA 1H5YA 3HV8A 1PHMA 4Y5SA 2BVTA 3BJTA 3TAOA 3P60A 4BZYA 2DSZA 1QVBA 3MKCA 4Q33A 1RLDA 1H3GA 3Q67A 3C3UA 1JS9A 3OLIA 3WLQA 2FHCA 3NA8A 1NFGA 4FFGA 5D8AB 5EJZB 2UYBA 2XOMA 4AVTA 1KRIA