4CCDA

Structure of mouse galactocerebrosidase with d-galactal: enzyme- intermediate complex
Total Genus 220
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
220
sequence length
644
structure length
640
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GALACTOCEREBROSIDASE
publication title Structural Snapshots Illustrate the Catalytic Cycle of Beta-Galactocerebrosidase, the Defective Enzyme in Krabbe Disease
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 220
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ccdA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ccdA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ccdA01
3PBUA 4O17A 4ZQCA 4IX2A 5HUOA 4LYPA 4H3DA 4H6KA 2YYUA 3UXDA 4O1DA 1WDRA 3KL5A 3TQVA 1VQTA 1ZJIA 5HJLA 1UKQA 4D72A 4NQ1A 4KFNA 1KFBA 3IGXA 2DSKA 1EIXA 1HJUA 1YXYA 1PHQA 2OX1A 4PFMA 2JKEA 1ZJBA 3ALGA 4W89A 3VO0A 5HULA 1GW1A 4H8VA 1TO3A 1PHWA 2B7NA 4GI6A 4HSOA 3W87A 3W7RA 1UUQA 3QW4B 4UR7A 3EMZA 3U5UA 2DSVA 4FF7A 2CNCA 3WD2A 5K3VA 2OCZA 2YA1A 3F4VA 4JL1A 4CUCA 3POHA 4POCA 1HXJA 2E3ZA 3CHDA 3CGTA 4PMZA 4AYSA 3NPWA 3Q94A 3W7NA 1UWRA 1JRCA 1TJPA 2Q3OA 1LG2A 5HDRA 3WH5A 4XZWA 3U75A 2VMFA 5BXTA 4UMAA 5KZEA 2ZXBA 1TPB1 4K39A 1B3ZA 3KX6A 3TA6A 4BZYA 4Z1CA 3IEBA 1QPNA 2P10A 5I6SA 1ODUA 3DZ1A 2PRHA 1GVIA 2VVNA 3WNOA 1ZAIA 2LLEA 3VMNA 3W53A 2DIEA 3CHFA 4PA8A 4IWWA 1V6XA 2YKKA 4V28A 1DJQA 2J6XA 4D6JA 3F4WA 2H6RA 3S5OA 4O1AA 2PI6A 2WPGA 2CZDA 4R5EA 3LHUA 3GIYA 2ZUSA 5CQ1A 3WL0A 5LA1A 2Y70A 3NQAA 3W7HA 2QQWA 2WHMA 2V5CA 3FIGA 3LLFA 3T7VA 4Z0SA 1GPWA 2J7GA 4P8VA 3VDCA 2CLFA 3N9RA 2OSWA 1OWQA 1MWOA 4AC1X 3PZIA 3WQVA 5DT5A 3BK0A 4KRTA 4JTSA 5CZJA 4ZQOA 3CU2A 3NPVA 3IJ8A 4ADUA 3RF9A 1WNOA 3HO8A 4BF7A 3SCSA 3CIXA 4MFEA 4JKLA 3DFSA 3EKZA 2WQPA 2BY0A 2XN1A 1O6IA 3LLDA 4XWUA 1YADA 5AOUA 3QGVA 3W72A 1H1YA 4N4PA 5D2TA 3T44A 1TR1A 3WMSA 5E6YA 5CSSA 5L6UA 3IJ9A 2C0HA 1OX5A 2V2DA 4FNTA 5D37A 1E1FA 2FQIA 3L4ZA 3CC1A 3ZO9A 5IM51 1OGGA 4QLKA 1GVFA 2ZUVA 3SCWA 3NQGA 1KTCA 4UZSA 3SUVA 3UY7A 1AL7A 2WKJA 3IRDA 3ZWTA 1J0HA 4N42A 2QF7A 3ARZA 4ML9A 5LNSA 4UIOA 3S42A 3NGJA 1W9VA 2A3BA 1R86A 2A7PA 1YYAA 3K1DA 4JFTA 3L5MA 1E0XA 3TUUA 1GORA 4CQAA 1ZB5A 4P8UA 2CEQA 2J75A 1EA9C 4QITA 3K8LA 4CD7A 4ORIA 2Z1SA 2V5LA 1V6YA 1H7XA 3VIKA 4DM1A 4E8DA 5D2YA 3PR2A 4UNKA 3PZUA 1JZ5A 4TU1A 3UPWA 3GH5A 1FCQA 1HO1A 1R2RA 2P0OA 5IHSA 4EF8A 2VENA 1UR2A 2ZBTA 2VUYA 4GPNA 4MTVA 1GQLA 1TYGA 1MYRA 3D5HA 4AISA 4YN5A 5CLWA 2XWEA 1MFUA 1LLWA 1L6YA 3NQVA 3WD3A 5DELA 1MZHA 3E02A 2GDVA 4X9YA 2AAMA 3C2OA 1HN1A 2RDWA 2YA0A 4GO8A 4IPJA 4ACZB 1NF0A 4H8UA 1DKWA 5DY2A 3UWVA 3WDRA 1ME7A 1V08A 1W3IA 3EBVA 1K9TA 1XC4A 4R33A 4H2CA 4ZFMA 1V7YA 3W1QA 3HGSA 4N02A 4MNJA 4URIA 1E0WA 1ZU8A 1TPEA 3W1RA 5FEWA 1ISZA 1JUEA 3VKKA 3GDTA 1QWGA 4J3XA 1QW8A 1DWGM 2DZSA 2XPKA 2YFNA 3MMWA 2GUYA 3AYSA 1N55A 3LIHA 1ZFJA 4F9DA 2W66A 2C3ZA 4UCGA 4AD2A 1QOQA 3EDKA 4RL3A 2XIIA 4NZCA 4K6AA 3HG5A 2VI0A 3PG9A 3LXBA 3W1LA 4AIUA 3QRHA 3L0GA 1UQZA 3PZQA 1QO2A 4H7VA 3TOPA 3ARRA 1KFWA 5BRPA 5JBFA 2WHLA 3NL6A 3O8AA 1JUKA 4MPQA 1CBGA 4FXSA 5C54A 4K7YA 1H5YA 4TR9A 1H11A 1VF8A 1WP6A 3SCTA 1ZALA 4UFMA 4C1KA 3B0UX 3EWBX 4AEFA 3M5VA 1XSJA 1HF6A 3G6MA 3GDLA 4B3LA 3BG9A 3R89A 1UWIA 2V3EA 1H4PA 5ABGA 1ICPA 1TPFA 3NSXA 1Q6FA 1ZNNA 1BAGA 1NOUA 3W0KA 2V8ZA 1FQ0A 3VNDA 5D8WA 5D33A 4EKJA 2QCGA 3R5EA 3PIGA 2EKCA 1JDCA 2CKRA 4N6FA 4OGZA 1ZHAA 2C8NA 3TJLA 4UZUA 3LRLA 2WZEA 5FMBA 1LCOA 1ZAHA 4HT3A 1NAL1 1E0VA 4N0RA 1OX4B 3W83A 2D24A 4C7DA 3CZEA 2ZRUA 4UTTC 4NT0A 4WY0A 5G2HA 1X6LA 5FEZA 3C2EA 1AL8A 1QDSA 1VLIA 1V3LA 2ATSA 2PWFA 2WYSA 3AQUA 2WJZA 1D2KA 1CXHA 1G7UA 2I9EA 3DECA 1H7WA 1SO5A 4FXRA 1V0LA 2ZCGA 1MW3A 1H7RA 2NX3A 1F74A 1WB0A 4TIMA 2GVYA 1O94A 4CD8A 5AHFA 4WY0F 1HO4A 4UNLA 1H61A 1XH0A 3QHOA 5FKYA 1H60A 1E6PA 1U33A 1VFFA 3K4DA 1UKSA 1JXJA 1HJSA 2WMKA 4LV4A 4O52A 1K9DA 3MSDA 3KVMA 4LC6A 4PMNA 3BG3A 1H62A 3W7PA 1KM3A 1YPIA 1UD4A 4MJ2A 4DUWA 4QQ3A 3S2CA 4UFIA 2ZFAA 3IIOA 2UV8G 3GXMA 3QQ1A 1XCWA 2NUWA 3G0UA 1OF8A 3W22A 3DH7A 5D05A 3VCRA 4DXVA 2CESA 3DC0A 1LLZA 4MOZA 3UZJA 3GXDA 4M80A 3CZKA 3MBFA 4ZQMA 1SZGA 3W6MA 1C8VA 4BQ5A 1SFSA 3MANA 3WF0A 2OWWA 2G4FA 3A3HA 2ADDA 3VM7A 3GNNA 6TIMA 1I1WA 1WAWA 1MEWA 1RVGA 4WXYA 3G0SA 1LM1A 3OGSA 3L68A 1W2PA 3BH4A 2AGKA 5F2GA 5HNRA 4AHQA 8TIMA 2JGYA 4YPJA 3W6YA 4JTEA 4O57A 1VFOA 1W3HA 3QMRA 5CGTA 1OJXA 4LVDA 3WMCA 5CPLA 2YZRA 3OIHA 1M01A 3EWXA 5FIPA 5FKCA 2V2CA 2QCDB 2JKAA 4OT7A 1VJSA 3MUY1 2VKZG 1RV8A 1J0YA 3VGDA 4FX7A 2WVVA 4UTFA 3FNDA 4AZ7A 5ANNA 3HGOA 3MYPA 3G18A 5F1UA 4IMGA 5U7SA 1TCMA 5I3JA 2ZX8A 2XUCA 3PN8A 3PZ9A 1NWUA 3ABRA 3CWNA 1ZL1A 4QDMA 2EJ1A 4M82A 1OIFA 3I3BA 5BXSA 1CTNA 3UEQA 4S3KA 3USBA 3G6LA 3SCOA 5A8QA 4GZJA 5AC7A 3KRZA 3LBMA 4RXGA 6TAAA 4LY8A 3RK8A 4HIBA 2XVKA 2X1SA 2PWEA 1SU5A 4PEKA 1R85A 4JY9A 2O9TA 4NF7A 1ZJAA 4A29A 3AS1A 4BA0A 2BXVA 3GAYA 3R8RA 4K8EA 1XCXA 4QCEA 5FD0A 3T08A 4Z2IA 4JDYA 4KGJA 3EMCA 5A2AA 4LQ1A 2VFFA 3GR8A 2QR6A 2ZXDA 3Q37A 2NLIA 3OLGA 3NQ7A 1E43A 1KBBA 2DSUA 1MO0A 2UY3A 1VRDA 1JZ3A 1ODZA 3B06A 1LRNA 4MLJA 2Y8KA 3MUAA 3PUEA 5ABEA 1EWDA 2QMKA 1LYXA 1G5AA 2O92A 3PTMA 3M6DA 1TV7A 1WAUA 3PM6A 3EX6A 1EDQA 5D32A 1CECA 2HMCA 1EWEA 1BWLA 3ABSA 3G1FA 4A21A 1QW9A 5M5DA 4ZQRA 1YXDA 4RV8A 1PIFA 3RPMA 2BVTA 3L4UA 4AD4A 2J24A 1BTMA 1OFAA 2DZWA 5DXYA 2AQWA 2Z6JA 1TVPA 3QF0A 1OFEA 1W1TA 1LOQA 1VGAA 4G1KA 3EX3A 2RDTA 4AZGA 1F76A 1VLWA 2G95A 1IV8A 3WBAA 2EPNA 2NX9A 1BYAA 2FHBA 1HUVA 3LMYA 3W2JA 4AHOA 3TU9A 1RP8A 1VCGA 4MY9A 1JAKA 2ZRWA 3AS0A 1OFDA 1FFRA 2J27A 4O54A 2G3JA 4X2RA 2F61A 5FK7A 1GQNA 4UMCA 4OKDA 2Y62A 1E4LA 3H53A 3MSGA 4MAZA 1JNDA 4UTMA 2OJPA 4YWIA 1CW2A 1JAEA 1W9BM 1DWAM 2EEXA 2VCCA 1CXIA 4M29A 4RE3A 5HNNA 3LRMA 4Q32A 3WH7A 1B90A 4DPPA 2JFEX 1M6JA 2G8ZA 2YIHA 4D2JA 1GONA 3NIYA 3NEVA 4HKPA 5ECUA 1B3XA 4W84A 3G1DA 3CZLA 1JZ6A 4CCDA 2ZZ5A 3KVLA 5AHLA 3SSJA 1N7KA 1GZJA 2YL6A 2GFTA 1GJPA 3PZNA 4HMEA 3U2OA 5FI8A 5K2ZA 3LHTA 2EO7A 3GBEA 5KSWA 1LROA 3PZMA 1JCNA 2ATMA 2VFHA 1UR8A 1CXFA 3W24A 2EXOA 3QHMA 2NXIA 4ATLA 1I75A 4CQ8A 3MP3A 3S1UA 4FX8A 3T4CA 3ZM8A 1IGSA 4W5ZA 4JTFA 1GOKA 4X0NA 2WSQA 4M1RA 5DMYA 1OF6A 1H3GA 1JIBA 2J7EA 4PTVA 2C18A 3VE7A 3QOMA 1HKMA 3HBLA 3UNDA 1MEIA 5E1QA 3ZJKA 2VX6A 2J7BA 1GHRA 1WA3A 1VFUA 5D4YA 3RJXA 3MP4A 1M7OA 1AMYA 2FJKA 3TQKA 3HOJA 4BFAA 3G3DA 4P8WA 2VZOA 1VHNA 2ESCA 2E77A 2QCFA 1IT0A 4PMVA 3NQ2A 1PE1A 3QMSA 3APGA 2J88A 3CEPA 4MYXA 3TR2A 2OLHA 4YLWA 1XD0A 2ZIDA 2DEPA 4UFLA 4GNJA 3L66A 4ZZ9A 5CZ0A 1OYAA 1M7XA 3BCDA 4PBGA 1GQKA 3INPA 4U2ZA 2W4XA 5L9FA 4P8XA 4N2YA 3OIXA 3TMQA 3UWWA 2E9MA 4PC8A 4UFJA 3CZJA 4FLRA 3LXCA 1A47A 5BRQA 2A2IA 2WK2A 2G5WA 1DP0A 1X6NA 4ZMGA 1CGYA 4A4AA 2CZEA 3P61A 4QISA 2GJRA 2FH6A 4Y8FA 5SWUA 1W8SA 2G3MA 1JF5A 3HPSA 3WFAA 4XX6A 2W0UA 4GFSA 3ZSTA 4AIOA 4GINA 1U30A 1OT2A 1G9HA 3HPZA 2YLAA 1XYZA 1L8NA 2V38A 2QCCA 3MW7A 3N34A 1OINA 1Z32X 4E8CA 4ZVJA 5DY3A 1VEMA 5DBTA 4AXNA 2B4GA 1Y9MA 1AG1O 4ADSA 4ONVA 3S1WA 2WHJA 3VIFA 1IIHA 3S0CA 5CPTA 4M7TA 4PCFA 1B3VA 1VB9A 1W3KA 1KR0A 3UETA 1C92A 1PAMA 1J0ZA 3AHZA 3AIEA 4WSKA 3QM3A 2DJLA 4Z0JA 3NR0A 5LHEA 3THQA 1LWJA 3AXIA 5IHRA 1KFJA 1UOKA 3GX9A 3O15A 2ZX7A 4JTGA 4UOQA 4PL1A 3T0AA 1W91A 5CPOA 4MVAA 2OWXA 2JIWA 1DQXA 3GNOA 4PTWA 1KM1A 5E09A 4PCSA 3BXWA 3K30A 1KQZA 2FLIA 2D0FA 3HGJA 4QIUA 4ZE5A 4XUYA 3ZFHA 4EQVA 3II1A 3WFZA 3GH4A 3QYQA 1ICQA 2A5HA 4OQVA 3HMCA 1ISWA 3NCOA 1XL9A 2CITA 1M7PA 1JULA 4I7WA 1K8XA 4GUHA 1PX4A 4GZEA 4HZ7A 4D6EA 1UHVA 1JI1A 2WZHA 1BGGA 1W56A 3RNDA 4JAWA 1TPH1 2ALDA 2DU2A 3M9YA 2Y63A 1SFJA 2ISSA 2YSWA 5CZSA 5F2LA 1I1XA 3BAJA 2E6YA 3VIPA 2YDSA 5I5RA 1OK6A 3M6YA 4UFKA 1F6PA 1US3A 2Y7FA 2ZWYA 1SPQA 3W1AA 4JR5A 1W5MA 4E2DA 4YL2A 4AVFA 3WK0A 2YXGA 4XQ6A 3ARXA 4CU7A 3BV4A 1XDLA 4PH6A 1GOMA 3WQ4A 3W9ZA 2G3IA 2WZIA 5A8PA 3ARVA 2C13A 5E9AA 5I0DA 3W23A 4O1BA 4MNLA 5IXEA 1G67A 1Y7VA 1QI5A 2O9PA 1VYPX 1XM3A 1ISVA 2WKGA 3BGGA 3NL5A 3WQ8A 4BQ4A 3W27A 4JTJA 3PG8A 1B9BA 3L0NA 4W87A 4DBDA 4NJGA 3N1AA 1ONRA 3POCA 1JYNA 4QNWA 1UA7A 4D1JA 1Z42A 2WXDM 1B4EA 1OK4A 2BFGA 3DHDA 3J7HA 1VR6A 1BSIA 4NJHA 3WH6A 3SEPA 2Q3RA 4Q7NA 3PHAA 3KOFA 2ZRVA 1JD9A 3N3MA 3WENA 2F7FA 3GNRA 1ZAJA 2WM0A 2CU0A 4ALDA 3GDMA 4E2BA 4XBSA 1AQ0A 3PF3A 4TVUA 1V3JA 1BKSA 3OBKA 3S5YA 2OZ0A 3MYOA 4AZZA 1CDGA 1CX9A 3STCA 1UD2A 5LHFA 3LIGA 4JYDA 4Y90A 2OYMA 1VEOA 4UQEA 1B4KA 1EA0A 2QCLA 5HR6A 4HNUA 1JCMP 1SYTA 4I7VA 1V03A 1A5BA 4QFUA 1VZWA 3U7VA 3C2FA 3AIQA 1GJUA 1W54A 4LUIA 1CWYA 4RKAA 2NSXA 3STGA 4JCMA 3WD1A 1UZ4A 4P7LA 3G22A 3N2XA 1H49A 1SO3A 1NEYA 3P82A 3BSGA 4JFUA 5CZKA 3VOCA 1UWSA 2VC9A 1FCUA 4NNBA 3AHVA 4BI7A 1L6SA 1HVXA 3SUTA 1AMKA 1TE1A 1A5CA 1G4SA 1OFOA 3P5ZA 5HPOA 3PB0A 2DZVA 5D03A 3W71A 5KTLA 1EUNA 3IIXA 1P6WA 1K8YA 1TTQA 3TROA 1E73M 3LDKA 4PSRA 5D9NA 3WSUA 4H8HA 3ZMRA 2GOUA 1THFD 3KWXA 4P7QA 3EKLA 4DF0A 4Q4KA 1HIZA 2X09A 5I23A 1UR0A 3W07A 1YTEA 3VILA 4WOZA 1GHSA 1WZAA 4UTUA 3GYEA 2EPHA 2QCDA 1W1PA 1DQWA 4K7VA 2RKXA 2CIPA 5HWNA 1WOAA 1W5OA 4LTSA 5DBUA 4S2CA 2CLOA 4S1FA 2JALA 3DKLA 2WMIA 1SW3A 4NJJA 5F1VA 4J27A 2DT1A 1WDWA 3EXTA 5IBXC 4YXGA 4P2VA 3PIJA 2CLMA 1FX6A 1NWTA 1R8LA 2DH3A 2WPBA 4UMBA 1ECEA 3MWAA 3YPIA 2DZTA 3MJYA 1W31A 3NQEA 5FF2A 4CNOA 4CCEA 3T78A 5FF0A 1OGBA 4WLCA 2JBMA 5A95A 4WX2A 3PUOA 4JGDA 1XC6A 3IIZA 2CLIA 5BW6A 5AHNA 4CKQA 4CVWA 2QEZA 5K9DA 2V5DA 3HGRA 1BG9A 1K3UA 2X16A 1LL7A 3ARQA 3MMTA 1AW1A 3W75A 4ZENA 4Z2HA 1SSDA 3ATYA 3PUDA 3UGFA 5G2WA 4U28A 1WZLA 1JG9A 4OBSA 1XI3A 3B04A 4Z2JA 2WVVB 5LNVA 2YW3A 3W82A 1N82A 4LXFA 3VD3A 3W73A 2CHNA 4OBTA 3LDRA 4IUOA 4MB3A 3H54A 3VD7A 4ZQNA 2ABAA 4AWEA 4UTKA 2D1ZA 3BVJA 3BW4A 2WMHA 1B30A 2WNQA 4AZIA 2DIJA 3G24A 1TPUA 4LRTA 4OHQA 3W7OA 1NARA 2A3CA 2CBIA 2VX7A 3CHCA 5I24A 1R7AA 2E8YA 4CNPA 2VQTA 1PCWA 3DXIA 1QHZA 3U5YA 3UR7A 7CGTA 3WDIA 2WO5A 4C1LA 1E4IA 5IFTA 1E6SM 1Q6RA 4IMDA 1Q45A 3FHQA 2XVPA 3NQ6A 4R7JA 2HS6A 3T0DA 3WF1A 4QHZA 1KXQA 1EP3A 1HP4A 3IK2A 2PURA 1KM5A 4F8XA 1JCJA 3BAIA 5A94A 2FH8A 2QAFA 4B1MA 3CM4A 1U2YA 2IUZA 3VIJA 4MUZA 5JIPA 3TC7A 3VM5A 1KBJA 2XM1A 2Z6IA 1MW2A 4OOUA 4PMYA 2VJXA 3L9CA 3TH6A 2XHYA 4JFSA 4E38A 1OFBA 4U2YA 1SZNA 3WQ6A 4M24A 2DDXA 1DHPA 1YTDA 3AZSA 2ZX6A 3CMGA 3N12A 1Q6CA 4MNMA 5C8BB 1X7FA 2B31A 1K7EA 4KWVA 2QJIA 1MW0A 3S5QA 3KVJA 4YCOA 1KGXA 2X1IA 3A4XA 2HS8A 2WWCA 2Y8VA 3THCA 4NNCA 4PUEA 3DYOA 6CGTA 2QKFA 1PS9A 1WYIA 3LHVA 5HMSA 2OT0A 5C5YA 2ZWZA 3SCUA 3VDBA 1MQRA 4M6QA 3UQNA 5M03A 3LCGA 3AHTA 4DM2A 3SCQA 2QQUA 1IXOA 2PC4A 3DI0A 3MHFA 3VE9A 4QLJA 4Z2KA 2QF8A 3IAPA 4O8RA 1ITXA 3WUFA 4AZ6A 3L21A 5FEPA 3R12A 3DHUA 1GWJA 1I2NA 1UH2A 5DT7A 4AB4A 3VIMA 3C0JA 2FDSA 3DHFA 3CH9A 4HMCA 4PEEA 2QDHA 4PSPA 3M47A 4W93A 3WQWA 1B3OA 4JHOA 2WSYA 3VIGA 3OSDA 1QVBA 4QLLA 1XUUA 3T2OA 2D20A 3HF3A 1CEOA 1UR9A 1WX0A 1VCFA 1ZENA 1XD1A 3S6DA 5F7UA 2BZNA 4MB5A 2BTMA 3EX2A 3S6TA 4FNUA 3WNMA 1DHKA 4AMAA 1G94A 3VKJA 2Y7DA 3A5FA 5G4EA 1MXSA 1R46A 1E9LA 2C14A 3CTLA 4RR4A 2X0YA 1YHTA 4BWLA 2AMGA 2A7NA 5C55A 1E3XA 3I3EA 2QCMA 4QSHA 4FFIA 2Z1KA 1JFHA 1DORA 3TXVA 2O7SA 3QZEA 2Q8ZA 1TMHA 1X1OA 4X22A 1C93A 3NJ3A 5C71A 1UD5A 5G2IA 3QR3A 2Y24A 2J7FA 1W2TA 2ZZ3A 3LCLA 4QNEA 1GUVA 5D8ZA 4W7VA 4O0ZA 1K03A 3E49A 2R8WA 4X3ZA 4O18A 4FFHA 4NX0A 2QMJA 1FXQA 3F5JA 1D9EA 3W1TA 3VI2A 4AZHA 1SUXA 3NL3A 1UWUA 2RHGA 4ACYA 1E5JA 5A69A 4AZCA 4AD5A 4O12A 1M53A 1ESWA 1QOXA 4GIAA 1D3HA 4E2OA 2C6QA 3VMPA 4O11A 5LYRA 4W9TA 2GK1A 4O1CA 1CLVA 3FN9A 4RX0A 4XV0A 1GVOA 3A21A 5JBEA 4CD5A 3WNNA 3GXPA 1W1ZA 3MHGA 3TK7A 1KFEA 4M6VA 1OX6A 2EQDA 3O63A 4N9DA 1H51A 1M03A 1A50A 5FF7A 3LPOA 3FFSA 1MVYA 2Z1BA 3SURA 1P5BA 7A3HA 5D04C 3LPFA 3CBWA 1W5PA 3PSWA 3GDRA 1QBBA 3KE0A 4IMFA 1J5TA 2BS9A 5DLCA 3RILA 3RM8A 3VGBA 2D23A 3GB6A 2H3DA 4EWND 3DFTA 5J5DA 3KF5A 4GXMA 4P61A 4TX9A 2Y7EA 4YMZA 1DWHM 2GVLA 5A6AA 2PE4A 2VEIA 3TQ0A 4GZIA 5JIWA 2CZ5A 2V82A 1PIGA 5DO8A 1JYVA 3PAJA 2VZTA 9CGTA 3EMQA 5AC4A 4DO6A 3NSNA 3P74A 3O6AA 1RQHA 1GOWA 4U33A 1WCGA 5AY7A 5CLTA 4QCFA 2WSRA 2DJXA 3W29A 1E56A 2GJPA 1BG4A 1Z41A 1Z44A 3UWUA 2AAAA 1C9DA 1FH8A 4JKKA 2EF9A 3MMDA 3NDZA 1KW1A 2VEKA 5K7JA 1GVSA 4TUFA 3DHPA 2ISWA 5AYXA 1E4MM 1ML1A 4GUGA 1WZMA 4NXSA 3AICA 4FLQA 1R30A 1KGUA 4AWUA 3MU7A 5GNZA 1O5KA 1QNVA 4EAMA 1KM0A 1MFVA 4DELA 4MY1A 1QI0A 3BGAA 3RMEA 4DF2A 2JIEA 4AIEA 3AROA 1UQYA 3E96A 3ARPA 4IPLA 1IXPA 1MW1A 4EE9A 4U5KA 2YDAA 4IMCA 2W79A 3C56A 5AHMA 3L4XA 2Y5EA 3CIVA 5A6LA 2WMJA 2XGBA 3KHJA 3NQFA 3W1UA 3GLCA 1JVNA 1TV5A 3VIIA 4Z08A 3CT7A 4XBKA 5BCAA 3QC3A 3W7MA 4JFVA 3KFTA 1OGSA 3RO8A 1SO6A 1DJNA 4N9EA 3PB2A 4JCLA 1LL6A 4R53A 2VTFA 1T99A 5KINA 1GYLA 4N6EA 4AY1A 1FWWA 4BI6A 5CG7A 4KFPA 3O16A 3HN3A 3NMBA 1NOWA 3TW6A 2NUYA 3ATZA 4BS0A 2CWNA 3RDKA 3UERA 3BAWA 1XSKA 1TTPA 3RLUA 2ZUWA 4F79A 4K8HA 1LTDA 1B3YA 5D9MA 3TE9A 4MDPA 3AHXA 5A2BA 3NZRA 1EDGA 1FY6A 1XH2A 1ZY9A 1GTEA 3WJYA 3WDPP 5I3KA 1K9EA 3S5ZA 3T0BA 3E9AA 1ALDA 1XDMA 4L4LA 3TSMA 4PN2A 4RK8A 2UY2A 3AIWA 5D02A 2WW5A 1TPVA 4HMDA 3UG5A 3W86A 4UTIA 2BY3A 2VQUA 4L4MA 1JNEA 1TZ7A 3KEHA 1CXKA 4M6PA 2H3BA 4PODA 1TIMA 3V1PA 4D6DA 1F7BA 3WD4A 2QUTA 4RE4A 1XBZA 2X8RA 2ZX5A 3VD9A 3W7JA 4ACZA 1EQPA 4M5PA 4MZYA 1DWIM 4OUEA 5AYYA 1NP2A 4PCTA 3P8IA 2J7CA 3MBDA 1GEQA 2XYLA 2PBOA 2V3GA 4FFFA 3NVTA 1I45A 1SW7A 1OCQA 1KFKA 5FL1A 4RZ4A 1QNOA 1RPXA 1TCDA 1EH9A 5E0KA 3LX9A 2D73A 3U57A 1WKYA 5KZ6A 3AFBA 4U4MA 2Y89A 3TAOA 4OOZA 3N13A 3GXNA 1V3KA 1XRVA 4J3TA 4H4IA 4U3AA 4PMOA 3O6CA 6A3HA 3WMBA 1UB3A 3M5XA 2O9RA 2ZRZA 3ZT5A 1OSEA 2CKSA 1QAPA 2WMIB 1IXNA 3UWQA 2ZOXA 3VGFA 1H2JA 2ZZ4A 1G4EA 1LG1A 2A6LA 1TRIA 1QNRA 1EOMA 1QNPA 4LVFA 4MLRA 3T55A 4OWGA 1UWTA 2VL4A 3M5YA 3A4AA 2E68A 4RZ5A 3O6DA 3W88A 1E71M 1XUZA 1HJQA 5GQBA 2CLHA 2WV8A 1GPFA 4JTHA 3AZTA 1WOBA 2X1RA 3TKFA 1H7NA 4WQ6A 3P8JA 3AXXA 4PYSA 4CN6A 1V3HA 3CLMA 3SECA 1LZOA 1D3CA 1OT1A 3CHEA 4GO9A 3W28A 4D71A 4B9ZA 5HXMA 4IISA 3VX1A 5AB3A 2GUUA 4LNYA 2BXYA 3PBVA 1LORA 5IDIA 2V30A 4IOTA 4JYEA 3GXIA 3W37A 2QLYA 4OV9A 4OBRA 1OABA 3B4UA 1B1YA 1J10A 2FHFA 3FHAA 3CIWA 3Q2DA 1UKPA 4J9JA 4LGXA 4LU0A 3I68A 3L4WA 3NYZA 4IGHA 3W2UA 1ITCA 2CHOA 3ZT7A 3FYPA 2CPUA 5A6KA 3WH9A 2VOMA 1J9YA 1J0JA 4D6HA 4P7OA 4JTLA 3ZR5A 4D6FA 5A5WA 1EP2A 1XHGA 2TPSA 3K8MA 5FL0A 1HL9A 4GE8A 3W7LA 3AMDA 3MUIA 3UESA 4JTIA 1ZBWA 3DYMA 4JL2A 3D0CA 2ZA3A 2OYLA 3P67A 1MQPA 4O4VA 1K9FA 4GUJA 4JTTA 2DQXA 2XGIA 5E6ZA 3IVTA 1CNVA 4BR1A 1WXJA 3C6CA 2GVJA 4RCXA 4CNNA 3U14A 1CXEA 1SR0A 1V5XA 4K37A 4UQ9A 2Y88A 1ZBVA 4ZEPA 3JR2A 2MANA 4FO4A 1VEPA 3U7BA 3ABOA 4FB7A 5FF4A 4WKHA 1VJIA 1X8FA 2XFRA 2DZXA 3KF3A 2AOSA 3AS3A 1LP6A 4HNVA 1G0CA 4CN4A 5G1YA 1RD5A 1GOXA 1W9XA 3BGJA 1I4NA 3AHYA 3R2GA 2CYGA 1KWKA 2YPIA 1OIMA 3B9AA 2RFGA 4X0VA 3IVSA 5AN7A 2YBTA 3TV8A 4CLMA 4EVZA 3SC7X 1Q6EA 1VPXA 1KV5A 3EYPA 2R91A 1H1NA 4L4OA 3LTPA 3GK0A 4RJEA 2FHCA 5CPMA 5HWJA 2EPKX 1KWGA 3N9SA 3CPUA 2XWDA 1PZ3A 3PBYA 3OGRA 4CU6A 1XBVA 5F4WA 1GVQA 4NVTA 3NQ8A 1VAHA 2D0HA 3B9EA 1ZBCA 2WBGA 3GKAA 1V0NA 1NP0A 2D0GA 2VO5A 1BEUA 4LPCA 1DOSA 1JCLA 3WF3A 1JD7A 1BGAA 3ZQ9A 2W6RA 1HG3A 1T8XA 2CZFA 2V2HA 2VFDA 1C90A 1EO7A 2EPMX 1LBMA 3QH2A 3HJZA 3AIBA 3U1XA 3VVGA 4JX6A 2NT1A 2VC6A 5A6BA 2VFEA 5MHBA 2V81A 4MPKA 3VDHA 3WNLA 4IUGA 2J7DA 4MYAA 4WIWA 2VRQA 3W7IA 3OVPA 1G7VA 1OFRA 5D09A 3P81A 4WXZA 1DWFM 2VR5A 3NYDA 5C6MA 5K9XA 5LNRA 1C8XA 2DZUA 1A3HA 3IANA 1QPRA 4FX6M 3SI9A 1TQJA 1KR1A 4PMDA 3CUJA 4ZXLA 1LQ0A 1AVAA 1VS1A 5BMWA 1AQMA 4B1LA 2X0HA 4UOJA 1FWRA 1HJWA 4A3YA 3STFA 2BWGA 3AMKA 3SUWA 4MB1A 2VFGA 1O60A 1H7PA 3C52A 4UTLA 2WSPA 4MZ8A 4LYQA 5GPRA 1O4UA 2Q8LA 2VRJA 3WD0A 4HPXA 3SFKA 4HHPA 4PTXA 3WF2A 4WK9A 4UQDA 1DTUA 3EXRA 3QJAA 3M07A 3TONA 3BLFA 1KTNA 2J9YA 1XKYA 3ZJ8A 2BHYA 3BPWA 3EDEA 2J74A 5AC8A 4MDOA 1U5JA 4UC5A 3C2VA 2GJLA 4KKXA 5CGQA 4AEOA 2QCEA 1S46A 4CN1A 4WF7A 1UKOA 2GK1B 1PX8A 1ZCOA 4QM1A 2E5DA 2F2HA 3LEMA 1VCVA 3SCVA 1P4CA 3LHYA 3WDQA 3O6YX 3OG2A 2E6DA 3C8FA 4J3SA 1YQ2A 1V3MA 3TXZA 3CMJA 5ABFA 4N9BA 5D2XA 1TQXA 1CPUA 2AEYA 3RLVA 4E4PA 4AD0A 3RFAA 3GZAA 5K4XA 3P84A 2Q8XA 1A5SA 1KA9F 5G4WA 5AFDA 5FEXA 3AYRA 3M1ZA 3N14A 1UCWA 5CPNA 1CGWA 4FHAA 1FDYA 2BLEA 4WKFA 1ST8A 4DWSA 3M7WA 4AEEA 2NV1A 3IGSA 1QI2A 3FW6A 3BMWA 5A6BD 3KL3A 2VVSA 2VXNA 5A8GA 1E4NA 1GCYA 5BXPA 1G4PA 4ML4A 2ZXAA 2GJXA 3I7RA 4PMUA 3ZT6A 3LERA 4O10A 1XH1A 2WMFA 3NO5A 2YCEA 2XSAA 3EDDA 1UJPA 3EWZA 5CKSA 1F5ZA 4HXCA 5HUPA 2O9OA 3RJYA 5A8NA 1GYNA 3PTQA 3W1XA 3L4TA 2XJ7A 5LA2A 2DSWA 1JF6A 4UTHA 1TA3A 3UG4A 4C7GA 3M7SA 1YDOA 3S5NA 3E0IA 1KQYA 3L4VA 4FNRA 3EDJA 1E6XM 3PZOA 3N04A 3H3LA 1TTJA 3W26A 2BX7A 3F03K 2QPSA 3SGZA 4NRRA 4JDBA 1J0IA 3MHUA 2YDRA 1FWSA 1H09A 4LC8A 1VENA 2WLZA 3UY8A 1BQCA 1UBSA 4FNSA 1GT8A 3NXFA 5AYBA 3SW6A 3W3OA 3OB8A 3OA3A 3WL1A 1VIWA 5CG0A 1H7OA 1XSIA 2JKPA 1JYWA 1S5WA 3W2NA 1C7TA 5TD4A 1JDDA 2W92A 4PTNA 1W37A 5CSRA 1NOFA 1W2VA 2PWHA 2WNZA 3A5VA 3ARSA 2CFFA 5FIXA 3ZR6A 1NFBA 1OB0A 1EEPA 4HP5A 4W8AA 3ZJ6A 5A8OA 4UTJA 5BXRA 2ZZ7A 1DEDA 3WH8A 3CLWA 1JUBA 5F2IA 1JJKA 2FB2A 3ZWSA 2ZUTA 4ATWA 5D2WA 5CXPA 3AJXA 2ZYFA 3MS8A 2WHKA 1EP1A 1ISXA 1TTIA 3L2MA 2QJHA 3AISA 3ARWA 4BQ2A 2FGZA 2G3NA 3WJXA 1U83A 4BF9A 4PTMA 2ZUMA 1SQ7A 3K8KA 2WC7A 1XV8A 3MV01 4B3KA 2YYTA 3EXSA 4HTYA 5DCBA 4UR9A 5J5RA 2VZVA 1E6NA 1FUYA 2WC3A 1E1EA 1KXHA 1AW5A 1GG1A 3LCIA 4CCCA 4JNMA 1CGUA 5DCDA 5CJ5A 1T0OA 1BYBA 4NSBA 1LOLA 3NNTA 1X1ZA 5TIMA 5DEZA 2TMDA 5F4SA 2BV9A 3FA5A 4NZFA 1EB3A 2NXGA 1WBHA 3GKFA 1OD8A 5FESA 1JXKA 3UGHA 4MJ4A 1XYFA 1ME8A 3DFQA 2GQ8A 2Y85A 4GJ1A 2DSZA 4OV4A 2EPLX 3CQ0A 2Z2UA 2E40A 3TTSA 2IXUA 4JIQA 1YPFA 1WDSA 4AXKA 5EL1A 4AHPA 1PEZA 2QJGA 1W3NA 4LW7A 2WC4A 4MZ1A 1PCKA 3G1AA 5I3GA 3OLDA 3CO4A 2PC8A 4IXXA 3ALFA 2QUVA 4J3VA 3NZ1A 3O06A 3DGRA 1KFLA 3DFPA 2TSYA 1E3ZA 4LUJA 2VZSA 3BG5A 2OSYA 1VHCA 4JX5A 2YDQA 2F84A 2J47A 1Y0EA 4PUDA 3GAKA 3O1NA 2YGYA 1BTCA 3NM3A 2ZICA 1WQ5A 2ZUUA 1RPKA 2OWCA 3ZS4A 3OLEA 1K7FA 5LGXA 3WEZA 1JYXA 4W8BA 3NQMA 2VELA 1BYCA 3M43A 2WCGA 1LBFA 1E15A 5C2XA 3OGVA 4O16A 3PZVA 3VU2A 2R14A 3MUXA 2IQTA 4KWUA 4FMVA 3LGEA 3S9YA 4UQAA 4MY8A 3DFOA 1HNYA 3AIUA 2ZE0A 3LRKA 3LHWA 1QNQA 1Y4WA 1CLXA 5TBOA 4FNPA 1EPXA 1V02E 4AD3A 2ZRXA 1XXXA 1ADOA 3JUGA 2W61A 1VYSX 1KBKA 3UGGA 1RR2A 4E0CA 2NV2A 1FBAA 3NL2A 4JZ5A 1LOSA 3PY2A 4RE2A 1IIGA 4PMRA 1RQEA 2BHUA 3QEZA 1CYGA 1C29A 3QSTA 2A0NA 4I9AA 3IJ7A 2WLYA 4XZ9A 3TTQA 5A6MA 3RIKA 3TDFA 2NX1A 2WVSA 2YR1A 4UTWA 1CGTA 2XN0A 2W63A 3B8SA 5ABHA 1Q6GA 2CXGA 5D9OA 4IQLA 3RWKX 1QO5A 4OE7A 3O07A 2VURA 2XQRA 3SCRA 3LHZA 3W2LA 2EPOA 2I14A 4IMEA 5BRBA 3CTTA 2C0AA 4IXHA 4IJBA 1NSJA 3W7QA 1FOBA 1O7AA 1P0KA 1WZKA 1JCXA 3QSRA 3CUHA 3NDYA 2KZHA 4JTKA 2Y7GA 3AO0A 4HZ8A 4AD1A 1AW2A 3KRSA 1NVMA 3DFNA 1UA3A 3LCHA 4JIEA 4V27A 4UCFA 3LCXA 3RM4A 5I3DA 3WFLA 1YDNA 2DZPA 4CGTA 4B15A 3PZGA 1JZ7A 2NWRA 2Y61A 3VDAA 3MI6A 3NQCA 1D3GA 2E6AA 1TVNA 2PF0A 1VRXA 3VINA 3T40A 4EF9A 4KH2A 2PB1A 3VX0A 3GZ3A 2DT0A 4TX8A 1UR4A 1R7OA 3SUSA 4D6CA 3AJ7A 2W62A 3LF7A 5I79A 1JZ2A 1IZKA 3O2LA 1OFPA 1W5QA 5DN1A 4AH7A 2VCBA 2HVMA 5EY5A 5D2VA 3QW3A 4JD4A 2J79A 1EIBA 2X1TA 3EDFA 4TTGA 2QCHA 5HINA 3FY1A 2JGQA 3NOEA 2VZUA 1Q3NA 3QPYA 3TC6A 3HMJG 2E4TA 4NJKA 3DKJA 1JQVA 2CBJA 3LTYA 4ZXOA 1KTBA 1UKTA 1P0NA 2HSAA 3AMGA 4WKAA 1NF7A 2ZA1A 4RZ6A 2CCRA 1R2SA 4ZE4A 4U3CA 5KITA 1IZJA 2VX4A 4IM4A 4JEQA 1GQJA 4GQRA 4O19A 4EOUA 1RP9A 3IV3A 5FK8A 3CHVA 3MI3A 3PZTA 3HB9A 2JK2A 5C70A 4W5UA 3ABQA 3W70A 4AF0B 1JZ8A 1HKKA 2VEMA 2X05A 2CBVA 1ISYA 2JF6A 3WJWA 3UR8A 1W9PA 4AWTA 3WBEA 4Y6GA 3WNKA 4Z1DA 4MADA 4U5IA 1PVNA 5LGZA 4GUIA 3I65A 4JFWA 4AZCB 1OHLA 2EAWA 1MSSA 1AK5A 3W1MA 1EHNA 1LBLA 3TFCA 4JYFA 2YA2A 1H41A 3EWUA 5BYWA 1XGZA 2E5BA 5HOSA 1GVRA 1V6VA 2OXBA 2E9BA 4HSNA 3NDOA 3TJXA 2Y4SA 1MXGA 3THAA 2E5CA 4ICNA 2E09A 3CUFA 3KL0A 2C19A 2G97A 2NXHA 4DWSC 1Y9GA 1GNXA 2AC1A 3WK3A 3VUPA 2A1YA 4PRWA 1NH6A 4Z2GA 1X6UA 2WOQA 5CSUA 3FOKA 4XTIA 1TRDA 3PWAA 3NQDA 4UTTA 1BHGA 3WDHA 1FHDA 1UYQA 3P7YA 3EWYA 4JQTA 4A22A 3NG3A 5GNXA 1FA2A 3T2QA 3HG3A 1QI4A 3FAWA 4JICA 2XN2A 3N18A 3E1F1 1FH7A 3N15A 2C1HA 1OVDA 4BI5A 4PMXA 4PL2A 1R2TA 3QQ0A 4CQ9A 4UTWC 2BY2A 5GNYA 3A22A 5HBFA 3GDKA 5A6SA 1TB3A 5GVJA 1VC4A 3TNOA 2ZTKA 1QNSA 4HA3A 3OZPA 1A5AA 3TW7A 4WSJA 3DBPA 1B0IA 1X1NA 5I78A 4AZ5A 1EDTA 3VNYA 3LDVA 1B3WA 2YJQA 1NM9A 3M16A 1V0KA 1SZFA 3UYCA 3PC0A 3WDJA 1M5WA 2J9XA 3I6RA 3WJZA 2GQAA 1MQQA 1UR1A 1E72M 1VH7A 4Q22A 3ZIZA 5F4XA 1QFEA 4HN4A 2W91A 3SZ8A 3WEOA 1LDCA 1KLZA 2GVGA 4DUVA 5ABFB 4ADTA 2B7PA 4Q33A 4X9SA 2VT0A 4D6IA 2ZA2A 3LPGA 3W25A 4B5NA 4OU1A 3VIHA 4FIQA 1JFXA 2H90A 3BMVA 3ZSSA 4DWSB 3Q58A 3DU0A 2FDMA 4W7WA 3MP5A 4MAVA 3AOFA 4L4PA 4JTUA 4YCPA 4PMQA 4FEZA 3S1XA 3VGEA 3FJ6A 1HX0A 3LV6A 2X2YA 4KMQA 1JR1A 3UPBA 3CWOX 4O0KA 2RH9A 1US2A 4EIVA 2YL9A 3TP4A 4C7FA 4HPJA 1Q6DA 2GJXB 3CUGA 1V6WA 1GZGA 3OLIA 3UCQA 1E6QM 1W5NA 2UY4A 2XFFA 1KXVA 4NUWA 1W1VA 2EBNA 3A47A 4BK9A 2E0PA 5E0FA 4HA4A 1UYPA 1JRBA 2WVUA 5BROA 1G4TA 4W7UA 3WN6A 3OEXA 3HG2A 4O50A 4BWLC 5LZLA 1LWHA 4K68A 3SUUA 3N2MA 4K36A 5EBAA 3WNPA 4NI3A 1ZS2A 8CGTA 2V0TA 2C7FA 3ANYA 1TA3B 1QR7A 4J3WA 4DUXA 4U31A 1XFBA 3IVUA 3WKZA 1Z48A 3BLIA 2NUXA 1EQCA 2F8QA 4TMCA 3G1VA 4DBEA 5BMXA 3TFXA 2VEPA 4WZHA 3MV11 1SSGA 4A3HA 3V75A 1TPDA 3AMLA 2QAPA 2ZDRA 3W7DA 1G01A 2GDUA 3D3AA 3TAKA 4FLSA 3KRUA 4IX0A 4DQWA 1NQ6A 3C4UA 3AXHA 1M04A 3C3NA 4FFGA 2BSLA 3QPZA 5EYWA 3W2KA 3TIMA 5LNUA 2D2OA 1J12A 2XTKA 4GQQA 3NM1A 1UUMA 1TG7A 4LV9A 1RH9A 2CETA 1TFVA 1PBGA 3WJSA 3DENA 3PULA 4GRSA 3LPPA 3ARTA 3HU7A 3G8RA 2ZX9A 3AZRA 4S3JA 7TAAA 1B31A 2VOTA 4GI9A 2AEZA 2ZUNA 1HL8A 4W88A 1KCKA 1E6ZA 1RQBA 5HQEA 3VFLA 1W32A 1WV2A 3CEUA 3TA9A 3IGUA 2ADEA 3W7EA 3HBKA 3GNDA 2FPTA 4B16A 4LS0A 1E40A 1S5VA 3M41A 1ICSA 3GTNA 4HU0A 1E51A 2TAAA 1I2QA 4LWWA 4TO8A 3UWZA 2NT0A 3KVKA 3G1SA 1TSIA 3GXFA 5LSMA 4J3UA 3ZOAA 1V3IA 3W7KA 5CSYA 2PRLA 5FMCA 1OFQA 3BO9A 1UZ1A 4GUFA 1EHAA 4HPGA 2B0MA 1RD6A 1K8ZA 1F05A 3M5ZA 1L0PA 4A2SA 1VFMA 5E0CA 3UZ5A 5DXXA 3VPLA 1L9WA 3DYPA 3FAXA 1LF1A 3GDBA 3BARA 1EGZA 1SR9A 2A6NA 3OVQA 4HNTA 1PZ2A 2W5FA 5EMYA 1Q6OA 4CU8A 4EANA 3VGHA 1PIIA 1WPCA 4HU8A 3QHNA 1J0KA 3UXAA 1EXPA 2XSBA 5A8MA 4TVCA 1NWSA 4F9JA 4MB4A 3VIOA 5CGMA 5EB8A 3B05A 1UH4A 4XKYA 1S3HA 1BF2A 3N73A 4QAWA 3SGUA 3W74A 4JHZA 4XTDA 3G3MA 2V3DA 3GR7A 5D9PA 3FLUA 3STEA 1GOOA 3IIVA 5HR7A 4LS1A 2J77A 1K7XA 2WCSA 4P7RA 5M3WA 4AWSA 4F66A 1DBTA 3W84A 3U8GA 4AMCA 3FKRA 1R87A 2WBKA 2OSXA 3JS3A 5AYIA 2WKLA 1TV8A 1OYBA 1EX5A 3WELA 3P5YA 5K9CA 1BPLB 1H0GA 4KWWA 2JEPA 2BVDA 3TSDA 2A3EA 1H50A 1B2YA 2BHZA 4O4WA 3OHIA 4B9YA 3A23A 2CLEA 5HPCA 3B0PA 4UR8A 3S1VA 2WSKA 5DF0A 3TX9A 1BVNP 2VR4A 1G6CA 3LM7A 4YHGA 2WNNA 3PBGA 4HZ6A 4NXKA 1LLOA 1VBUA 3LXAA 1MEHA 4HNNA 3FEMA 4N9CA 1W1YA 2CLKA 1WO2A 1JZ4A 5BWFA 4BQ3A 1UD3A 2VNCA 3PTKA 1B57A 1V02A 4LX4A 4HOWA 4FIRA 3BAKA 2G96A 4MNKA 2A21A 4MKNA 3SR7A 1PV8A 1UUOA 4NJIA 2E8ZA 3ARUA 3AI0A 3L2LA 3T09A 3N11A 2DT2A 4DPQA 4WJXA 2A3AA 2ZZ6A 4K38A 2GJNA 5KZDA 2WNWA 4ORMA 3SJ3A 4A3UA 3HJEA 3OA5A 2X30A 2OT1A 5CPSA 4NU7A 1W3TA 3CPRA 4J28A 4D6GA 2C16A 1W0MA 3K46A 1RZMA 4GWEA 2DT3A 2VRKA 3E12A 1I2RA 3MO4A 2PBGA 2Z0IA 1GTHA 1V6UA 2C15A 5FF3A 2Y6ZA 3ECQA 2ZRYA 1K6AA 2OMAA 5A6JA 1CGVA 3MKKA 3MO7A 4WUIA 4DF1A 1OYCA 4DO4A 3VNZA 1L2UA 2BNJA 3GNPA 1FWNA 3W7GA 1TPC1 2XM2A 3QMTA 1BVZA 3SCNA 8A3HA 2QDGA 1UH3A 2D22A 3BLKA 5LA0A 1CZ1A 2A3HA 4LVGA 1H5VA 3P62A 3SY5A 1QHOA 1VJZA 3RMJA 3BW2A 1HJVA 1W9UA 3AMCA 3C2RA 2VFIA 2XVNA 4QP0A 2YL5A 1QMLA 3GVGA 3MI2A 1D7FA 1E55A 4KFOA 1J01A 2DORA 1I2PA 4FLOA 3HPXA 4I7UA 1E70M 3P60A 1N8FA 2GPTA 1TPWA 2QQVA 3OVRA 4AF0A 3AIVA 1FCBA 2NZLA 5E93A 3B0VC 3L5LA 2XVGA 3RCNA 4JXCA 3A24A 2WANA 1KM6A 1P1XA 2HTMA 4N4QA 3TCEA 4W86A 1KBIA 4O13A 3A6OA 2E1DA 5D30A 5TQLA 4AAJA 4TVDA 3FYOA 3L5AA 1GQIA 5A3HA 4UXDA 1KB3A 2XIBA 4HOXA 1FCVA 3N9KA 2FTPA 5EKYA 5H2ZA 1WDQA 4O14A 1BLIA 3BAYA 2NW0A 1UD6A 1ZBKA 3I7SA 1VYRA 2J62A 1A53A 1F4AA 4O53A 3K4AA 4D1IA 4WJEA 5K4ZA 1TMQA 2PWDA 5KEZA 2H8ZA 2PRMA 4M7SA 1OM0A 4KRUA 4FNQA 5DFAA 1C91A 5CPQA 1FDZA 3LI1A 3UD6A 4J7RA 2ZZ1A 4UUIA 2J25A 3VD5A 5D38A 2Y2WA 4LYRA 1H63A 5BNKA 4ATDA 1WDPA 4WOQA 5AC5A 4M81A 1O95A 3A9IA 1HFBA 3FJLA 3JRKA 3PS7A 2WMGA 4O15A 2WCAA 1HT6A 1CI1A 2YOCA 2W67A 5JUVA 1S5TA 4ZL1A 1PPIA 3BCFA 2ZXQA 2XVLA 1W3JA 2UY5A 4GI8A 4CD6A 4V2XA 5AHEA 1SMAA 1YDVA 3S8HA 1HTIA 4Y9AA 5HWMA 1ME9A 2EHHA 2V3FA 4O28A 4QAIA 1HL2A 4GC4A 1WBJA 3N17A 2YLLA 3ZJ7A 1C8YA 5DCEA 3O9NA 4MIMA 1C8QA 3W2MA 2FB3A 1GG0A 2E6FA 2O7QA 1KCLA 1J11A 3G8EA 2V5BA 2GSJA 1G69A 1DVJA 1KXTA 1J2WA 3BC9A 1WE5A 3ZR4A 1OG0A 2YW4A 4M19A 3M0ZA 1UWQA 4JX4A 3UWYA 3OBAA 1TUXA 3QFEA 6ALDA 4HA1A 4S2BA 3NPXA 1UASA 2J7HA 2J78A 2XFYA 3NSMA 3EB2A 5H91A 4TXEA 3IAQA 3TTOA 1QPQA 3B8DA 4TTUA 4YHEA 1V0MA 1TREA 1EOKA 5EA9A 5EFFA 5KZMA 2RGMA 3LV5A 3ELFA 3LCFA 2IXVA 2XG9A 3CZ8A 2YX0A 5AYZA 3WQ5A 4AW7A 2PCQA 5FMDA 4FF5A 3BAXA 3WY1A 2JEQA 5IFPA 3GM8A 1F73A 1G1YA 4JY8A 3L65A 3WK2A 4DO5A 3SCPA 4W8LA 5IBXA 1PL9A 3EEGA 5LKYA 3CZGA 1PX3A 4CD4A 3HG4A 4XUGA 1OBAA 3I3DA 5FCZA 1F2JA 1R47A 3NPUA 5KMYA 4QJ1A 3R13A 4IPIA 1MXDA 4BCEA 1CGXA 1QOPA 1Q6QA 1K02A 2FFCA 3SIZA 3U6WA 3W85A 1CXLA 3VGGA 2CW6A 3EWWA 1C7SA 4M56A 4RLIA 1QPOA 3IMMA 1FH9A 5F2MA 1FXPA 5LNWA 5EBUA 2H8XA 4JN6A 3LOTA 4JIPA 3DAQA 3BW3A 2ABBA 3HIJA 2QHAA 2D3LA 3BSHA 3AIRA 3W38A 4DEFA 5AHIA 3FXYA 3F4NA 3W76A 2WAGA 1W3LA 2X1UA 5ABTA 3NUKA 1HKJA 1B9ZA 1JCYA 1SW0A 1CIUA 1NWRA 3WIJA 3C61A 3MUZ1 4HOZA 3HQ1A 3LCWA 3RM9A 1OX4A 2ZTJA 1W9DM 4LVBA 2ISVA 2DGAA 3KZSA 2BVYA 3EX4A 4KGLA 3PBWA 1FHLA 3GYCA 1KM4A 5E70A 2ZQ0A 1E5NA 3VMOA 3QOKA 2YFOA 3O05A 1XBYA 4TMBA 2HISA 2A7RA 1H1ZA 4LOCA 1E6RA 3WF4A 2D3NA 2B7QA 1Q6LA 2FPYA 3BLPX 3T2PA 2DP3A 1JI2A 3WUBA 4UQCA 1QBAA 4DWSD 1YXCA 2J8GA 2QUUA 5U4NA 3EX1A 5G5IA 3G1YA 2BY1A 1XCFA 4WD0A 4NRSA 3BLEA 1J18A 7TIMA 3OG3A 4OJYA 4Z1BA 3PVFA 1JL8A 4XZBA 3I7QA 2RGLA 3WK1A 1GJWA 4NNAA 1LJYA 1QI3A 4Z1AA 2A4AA 2UWFA 3L2IA 4H04A 2VCAA 3F5KA 2R94A 2P1FA 5I3HA 4MFDA 4H41A 3NAVA 4M8UA 4WY0B 4EK7A 4MJMA 3IIPA 4R27A 3NA8A 2PWGA 3M46A 1SO4A 1EUAA 5CZTA 1SZEA 4JS3A 1BWKA 5BOOA 1OD0A 1YTKA 3A4WA 1C3FA 4NZJA 1CENA 1QHPA 2QV4A 4A2RA 2V9DA 1BYDA 1FFQA 5A2CA 1I2OA 1IF2A 1SFLA 1KLYA 3KXQA 1F6KA 4MJZA 2JE8A 2YBUA 1GOQA 3H55A 3WUEA 3L67A 2QPUA 2NWSA 5EMUA 1JQXA 2J8FA 3L0KA 3L4YA 5T26A 3W7CA 2I1OA 1JDAA 2GQ9A 5I3IA 4FK9A 5G1TA 4GKLA 4LVAA 4HPHA 2RDUA 1QCWA 4TOQA 1AQHA 1JGIA 2CERA 5I2UA 1GVYA 3W81A 1KV8A 3KAOA 1DWJM 2YL8A 3UG3A 2JF7A 3DI1A 2G41A 1QPKA 2QCNA 1TJRA 1J4EA 4P7NA 3FS2A 3M44A 1L6WA 5FKBA 1HVQA 4W85A 3G1HA 3PSVA 2DH2A 1O5XA 3W1PA 4LS2A 1LRTA 1FP9A 3CUIA 1KGWA 4NX5A 5I77A 3TSBA 3GBDA 4XKYB 3OZOA 3CB8A 3GXTA 2WVTA 3W4RA 3VD4A 1XBXA 4Y96A 1LRQA 3FKKA 3LFIA 2EGZA 2WB5A 1FDJA 3P80A 2OYKA 3TTYA 4CVUA 4Z2LA 4ZQPA 3N19B 2VX5A 3B9DA 1T96A 5AC6A 4GBUA 4AZBA 1IXQA 3G1XA 1LL4A 2WWDA 3MMUA 1EO5A 3VTRA 1UG6A 1DV7A 5I3FA 1DL3A 2FIQA 2DPEA 2CLLA 2BXZA 2J4GA 3LBCA 1KFCA 5M17A 3W1NA 1GOIA 3F5LA 3SIMA 2TRSA 5EPDA 2ZZ2A 5EFDA 1HP5A 3B03A 3ARYA 4XB3A 3RU6A 3AS2A 4GXPA 1FP8A 4UQBA 1KM2A 2XFWA 4OZOA 3WUGA 1HJXA 2B7OA 3TMLA 3G0XA 1SMDA 4Y7EA 2J9ZA 2TYSA 2X2GA 1UD8A 4RXFA 1H0IA 1HKIA 1VBRA 4LT9A 1F4HA 1PJ9A 1Q4NX 4JKMA 3LB0A 2FGLA 4UNIA 3THDA 2CBUA 2E9LA 5A1AA 3F1QA 3GH7A 4IPNB 2FPVA 4UFHA 5FOOA 4LRSA 1FWTA 4R34A 1BFNA 1I8JA 4TX6A 4UOZA 3WEMA 4OIFA 3W6LA 1YLVA 3LI0A 5JBDA 2A85A 3LTSA
chains in the Genus database with same CATH superfamily
3PBUA 5KHIA 5HUOA 2YYUA 5KHJA 4NWVA 3AP9A 3KL5A 4R9DA 3TQVA 2R0FA 3WY6A 1ZJIA 5HJLA 1FOD1 4KFNA 1QQP1 2R7EB 1KFBA 3BOLA 3IGXA 1RCXB 1JN2P 1PHQA 4HMNA 2JKEA 4N7QA 4GB31 1TO3A 2B7NA 2P34A 2PDBA 3U5UA 3FBYA 2OCZA 3UYJA 2YA1A 1OI6A 1EJSC 2NQHA 4GWNA 3POHA 4PMZA 4Q7IA 4DHGA 2GSHA 1JH5A 3AWOA 4NIGA 4V15A 2Q3OA 4OQ8A 1LG2A 3E0LA 2VMFA 5IATA 2ZGRA 5BXTA 1AR71 3LSDA 2FGBA 1MR5A 1X9PA 1MDRA 1BXNA 1QJEA 4K39A 3TA6A 3ZXDA 4Z1CA 1ODUA 3DZ1A 2PRHA 3WNOA 2ENRA 2UWCA 3KM8A 2YXOA 2X42A 1W2AX 3B9CA 1KDMA 2VY0A 2I07B 1V6XA 4D6JA 4JTAA 3S5AA 1CT5A 2PI6A 5LA1A 3GIYA 2CWXA 1FYUA 3VBOB 2OQLA 3W7HA 1OVSA 2WHMA 4IE0A 3FIGA 3LLFA 2HEVF 4S2FA 3PZIA 2R1PA 3RGTA 4AX7A 4ZQOA 5FPUA 3NPVA 3SCSA 1UOGA 2YDEA 2XN1A 3LLDA 4LALA 3QGVA 3W72A 4LO6B 5A3MA 1H1YA 5D2TA 3T44A 1R3WA 5E6YA 1DJIA 2V2DA 3WQ0A 2FQIA 3POJA 2RDQA 1OGGA 4QLKA 1R6WA 4AXOA 5J36A 3SCWA 3UY7A 1CB7B 3ZWTA 1J0HA 3S42A 2A3BA 5FOBB 3K1DA 7REQB 1AR82 4MGKE 1RYYA 4LLFA 3SN4A 2J75A 1EA9C 4HCLA 1UYZA 2B39A 1TJ1A 3B9NA 4UNKA 1HO1A 2GMPA 1R2RA 4EF8A 4ASMB 2CAVA 3D5HA 4AISA 1ASJ1 2XWEA 1JXNA 2C5DA 5DELA 1DQ6A 4X9YA 3R4DB 1EY2A 2YA0A 1UD1A 5MF5A 1DKWA 1AYN1 3PANA 3UWVA 1W3IA 3M1HA 1AUYA 2PTZA 3NURA 4MNJA 1TPEA 2GALA 1ISZA 3SLIA 3V35A 2HWF1 1QW8A 1VAMA 2JECA 5DABA 3KOWA 1ZBA1 3VZKA 2J13A 1DGRN 1J83A 4LK7A 1NY1A 2XIIA 3QRHA 3TOPA 3ARRA 5JBFA 1H9WA 1U1HA 3NL6A 1H11A 1VF8A 1QK0A 1H5YA 4K7YA 1CQ9A 4XDOA 2A7AA 3BG9A 4FPOB 5I93A 3EO6A 1UWIA 1TPFA 4L9BA 1Q6FA 1XIIA 1ZNNA 3MJMA 1RITA 3NL1A 5DUVA 2QCGA 2EKCA 4XFCA 4MWAD 2X41A 4L92A 4UZUA 3RDIA 4AI1A 5FMBA 1VBA3 1Y3TA 3W83A 4WY0A 2QT3A 4B5UA 4PQQA 1QTWA 2PWFA 3VBHB 2XISA 1G7UA 4Q8KA 2I9EA 1UQXA 1BF6A 4M1BA 3UCCA 3B69A 3HQOA 1I9CB 1OQDA 1H7RA 1OOPA 4RNFA 2NX3A 3WCRA 4CD8A 1HO4A 1JZ2A 4UNLA 1XH0A 1U33A 1TMF1 1UKSA 2ZZJA 3H1MA 3I2GA 5BNNC 3MSDA 1QNYA 4LC6A 5B4NA 1H62A 4XMIA 1KM3A 4DUWA 4MJ2A 4UFIA 5T91A 3IIOA 1R1A2 4D69A 4AVBA 3GXDA 4MOZA 4ZU4A 2PDFA 3K2GA 4MHUA 3VM7A 6TIMA 2HWE2 2D5HA 5FJOA 3DKWA 3L68A 3BH4A 4GQBA 3N3TA 4ZKTB 4A05A 4AGGA 4QDPA 3EOLA 4QPGA 3LZ3A 4LVDA 2VD8A 3EOEA 1M01A 4M3CA 5FKCA 2Z4GA 2B81A 2FZNA 1FNZA 4WM8C 3I2FA 4AZ7A 4UW4A 3HGOA 4XBQA 3G18A 2J1VA 3AVRA 1TCMA 4XAYA 2XUCA 1ZL1A 1SBEA 4KWOA 1RXGA 1KJLA 4RHV2 3SCOA 4GZJA 1DF0A 3KRZA 5FBZA 2XVKA 4PEKA 1P6CA 5DUWA 1X7NA 4JY9A 4B29A 3MQTA 3GAYA 4JIIX 3T08A 1OC1A 3KHDA 5JAXA 5CAZA 4HSLA 1O68A 2JXAA 1MO0A 2PTXA 5BYNA 1VRDA 2PHRA 3T9PA 5ABEA 3PUEA 1YWKA 4LSBA 1WAUA 4YRDA 3H2NA 1CECA 2HMCA 3TLQA 1RL3A 1BWLA 4A45A 2W46A 1PIFA 4S2HA 1KC7A 1OFAA 5CBLA 3GNEA 2DZWA 2ZGTA 4AFYA 4CXYA 4YZ2A 1IR2A 1W1TA 1VGAA 2PDHA 3EX3A 1F76A 1VLWA 1SJDA 3MEPA 1IV8A 5XIMA 2EPNA 1PGW2 2FHBA 2NX9A 4BWOA 1VCGA 4MY9A 1JAKA 2AKZA 3BKZA 2FTYA 2J27A 4O54A 5LIWX 2OO6A 3NW4A 5FK7A 1E4LA 2Y62A 3PL0A 3MSGA 4MAZA 1HQLA 1JAEA 1Q13A 1U22A 1V6MA 1CW2A 2EEXA 2OJPA 5HNNA 2WIIB 3E5UA 4KU7A 2AACA 3NIYA 1QDCA 3NEVA 2IS7A 3ZXEA 3CZUA 3KVLA 2YL6A 5D21A 3ZIXA 4GYPA 2ZX1A 5CC5A 1RK5A 3S2JA 5FDBA 2R1LA 5TF0A 2JKBA 4K8GA 5FZFA 1CXFA 4LBJA 1GZWA 2NXIA 3A4UA 4FX8A 1AD4A 3WMLA 1HGYA 4JTFA 4X63A 1GWLA 2WSQA 1OLME 2ZJCA 3H23A 1SHWB 3VKDA 1UY1A 1H3GA 1LQAA 2PDJA 3VE7A 3QOMA 4JOMA 3UNDA 2BJSA 5D4YA 3VZOA 1F5JA 3HOJA 3ID7A 3R58A 3TQKA 5F6KA 2VZOA 2X29A 1VHNA 2ESCA 2QCFA 2Q1ZB 4L11A 1PO21 3APGA 3QMSA 3CEPA 1U1JA 2DEPA 4GNJA 3I8TA 5CZ0A 2HE5A 2WT2A 3HQNA 1S39A 4PBGA 3INPA 4IZGA 4YS1A 4F3HA 3CV7A 2X7WA 4YW4A 1VPQA 4P8XA 4DJDC 2W52A 3I4KA 4FI9A 2E9MA 4FLRA 7REQA 4Z92B 1J79A 2Y0IA 1TIWA 2WK2A 2G5WA 2VGDA 2V5YA 4KT2A 4ZMGA 4AYGA 3P61A 4URTA 4M0XA 2BQPA 4Y9MA 3U9IA 1W8SA 2Y33A 2WZR2 1SLAA 2W0UA 4CDWC 1OT2A 4YW5A 5FP8A 5CAHA 3B9OA 5C9ZA 1OINA 4E8CA 4ZVJA 4BOWA 3C0LA 5DBTA 4FSAA 4AXNA 4X61A 4ADSA 4ONVA 3S1WA 5IK4A 3KV6A 3AB0A 1IIHA 5CPTA 3S0CA 1VB9A 1XLGA 1J0ZA 2XL9A 5FXZA 3UYIA 5LHEA 3L7RA 5IHRA 1UOKA 2ZX7A 3GX9A 4UOQA 4JTGA 4PL1A 4ZB0A 4DBUA 4QQUA 1ZNPA 3OQ8A 2JIWA 3GG7A 1KM1A 3HNYM 1BZWA 4K3UA 2WL1A 3BXWA 3K30A 2FLIA 2QBXA 4ZE5A 3II1A 1C8NA 2YPDA 4Q4Y2 1ICQA 2A5HA 2CITA 1M7PA 1JULA 4I7WA 1NQKA 1UHVA 2QNKA 1NY71 5JXHA 1W56A 3I49A 4JAWA 3M9YA 2YSWA 3EB3A 1PMIA 3R6SA 5CZSA 5DMNA 4P9YA 3A64A 3LN3A 2QQOA 4UFKA 5LZ6A 3W1AA 5FMOL 3FLRA 3CV6A 5B80A 3WK0A 5FAXA 4Y26A 1UN1A 4XQ6A 3ARXA 3DXTA 1XDLA 5JCTA 2G3IA 4HNLA 5A8PA 1W9YA 4MNLA 1G67A 4RL7A 1QI5A 2WKGA 3IUIA 2E26A 4ERIA 2ZGLA 1K1DA 5EP9A 3POCA 1UOZA 2OPKA 1ND3C 4E2VA 1Z42A 1OK4A 3J7HA 3B5LB 4I3GA 4NJHA 1DLLA 3WH6A 3UNPA 2JDKA 4AI0A 4QEHA 2RDRA 4QHBA 1XRTA 4CDUC 2ZRVA 3PTYA 3N3MA 2F7FA 3GNRA 1QEXA 4XBSA 1AQ0A 1BEV1 3ELNA 3CJXA 4AZZA 2EG7A 1CDGA 5C8CC 5LHFA 3BTZA 2OVUA 2VDIA 4FS9A 2DVTA 3ETQA 4HNUA 5EZWA 1JCMP 1PO12 1XIMA 2Y6KA 3VOFA 3B8UA 4LUIA 4RKAA 2OG9A 4JCMA 3STGA 4KWKA 3G22A 1SO3A 5CZKA 3P82A 4GKXA 3BSGA 4FXFA 4JFUA 3AHVA 2QZ3A 1FCUA 4GQ7A 5HPOA 1A5CA 5M1TA 1R0MA 3AWNA 4YU1A 1P6WA 1K8YA 5FXXA 4ZB2A 2BBVA 2HDJA 3ZMRA 1V6JA 2JDNA 3KWXA 4P7QA 5D8AA 4Q4KA 3AVSA 3O1VA 4H9UA 1UR0A 3KLLA 1WZAA 3GYEA 1XS2A 2VD9A 1VMHA 3AXDA 3ISIX 5HWNA 2JALA 4QLLA 4S2CA 3DKLA 2WMIA 1SW3A 1XIEA 5F1VA 1YIFA 3AJZA 4AVCA 5IBXC 3UVAA 4HSJA 1NWTA 1PYFA 1W90A 4FOKA 4P2VA 2WPBA 5LASA 3SADA 2OVLA 3VHRA 3MJYA 4CNOA 1W31A 4IQEA 4CCEA 1K77A 5FCCA 1XLIA 3ZFEA 5FMOS 2YU1A 4EWEA 3PUOA 4WX2A 3IIZA 1RHI2 2VOVA 4PFHA 1JMUB 4LIUA 5K9DA 2ANUA 3BALA 2GOKA 4C5YA 3DC8A 1W04A 4IEOA 3KW3A 2EF6A 1WZLA 3MC5A 2VW1A 4OBSA 1XI3A 3ZO0B 3N25A 2YW3A 3W82A 3U2CA 3LDRA 4ZQNA 2ABAA 2JD9A 4UTKA 3THPA 3MA8A 4DN1A 1B30A 4EX4A 3VZJA 3W7OA 4KH9A 4GULA 2VX7A 1F35A 1MZEA 1R093 2WO2A 5I24A 2QDEA 1GZCA 7CGTA 1O5QA 1E4IA 4XUQA 1SLBA 1MS0A 1FWEC 1MQTB 1Q45A 1FNYA 2XVPA 4XIKA 4R7JA 4YWAA 4DRSA 5MKGA 3T0DA 4Q29A 2HS6A 4XZLX 4C0BA 1KXQA 1RJ8A 2POTA 4Y1VA 4I02A 3BAIA 2FH8A 3SCHA 3VIJA 2GC3A 4YZ3A 5JIPA 1GKPA 3VM5A 3ALQA 2DUOA 1KBJA 4OOUA 2VJXA 4IV3C 2O8OA 2BGQA 4E38A 2HROA 3KRBA 1ENRA 1TNRA 4P9GA 3N12A 4M24A 3ETPA 1SFPA 4RZBA 5C8BB 4MNMA 1X7FA 1K7EA 3VD3A 4KWVA 1ZRFA 2GGGA 2Y8VA 5C33A 2PA6A 1JYIA 1OZMA 2QKFA 1PS9A 1E5RA 3BN6A 1JOJA 1W6PB 5FQ0A 4M6QA 3SB0A 3J7NA 2JKXA 1IXOA 4Z2KA 1VALA 4GIYA 4AQSA 3R12A 4OUMA 3VIMA 3Q8EA 2FDSA 4WDTA 2P4EA 2QDHA 4PSPA 4W93A 2HYKA 2F4PA 5EU9A 1B3OA 3WQWA 2WSYA 4DJEA 1CESA 1YI9A 3NQBA 1VCFA 2HWD1 3S6DA 2BZNA 5FZ0A 2CDOA 4MB5A 4BM8A 5LIKX 2D2GA 2D3SA 2OPWA 3KMHA 4W8JA 4NHLA 1DHKA 2HE8A 4GG9A 4U2AA 1GNYA 3C7GA 3A5FA 3MYXA 1UC4A 2PDWA 3P2VA 3RLHA 4DAFA 1F31A 1YHTA 3FE5A 2BFUS 4PLNA 4CQCA 2YG0A 4XYXA 3BOFA 3KZ4C 1UPMB 1DORA 1IYXA 3TXVA 2Q1FA 1OLMA 5HCAA 3NJ3A 3VOHA 5G2IA 5GJMA 2Q8CA 2ZZ3A 3IS4A 3WLPA 2FMYA 1K3IA 3BTAA 2ZVIA 3MW2A 2QMJA 1RA0A 4DVOA 4ACYA 4Q8TA 3P1IA 2GP5A 4O12A 2CLPA 1ESWA 3RRAA 1CIYA 3SEEA 4NRPA 5C4WB 4NAMA 1TMLA 5LYRA 3IJQA 3A21A 1GVOA 1YDYA 2R1NA 1KFEA 4F0KA 9XIMA 2WQ8A 1OX6A 4N9DA 5JSRA 1A50A 1M03A 1C5HA 2R073 2HRWA 3HWJA 4KGQA 3GDRA 4IMFA 3RILA 3RM8A 5IK8A 1XW8A 5FZOB 4P61A 4EZ4A 1DWHM 4XJAA 5FRAA 2VEIA 4GZIA 2VZTA 2CXEA 5AC4A 4DO6A 3P74A 2DTWA 1RQHA 1GOWA 4U33A 2WSRA 1E56A 1IOAA 2GJPA 1Z41A 1Z44A 1C9DA 4B90A 2EF9A 3NDZA 4JGZC 2LRPA 4KS0A 4GUGA 4UWMA 5EJ3A 4LUSB 1R30A 1NTHA 3MU7A 4AWUA 1QU0A 1QNVA 2RUSA 5DDJ1 1KM0A 3O7UA 2G50A 3TYDA 1VAVA 1FKWA 1QI0A 3U07A 1JUIA 4B5XA 2OO0A 4DF2A 4CTEA 3AROA 2H9AA 4EE9A 4U5KA 1X36A 1XNDA 4LHNA 5E6HA 4YM0A 3MT1A 2VQAA 5A6LA 3KHJA 3W1UA 3ICJA 3ZSLA 4XBKA 2PDUA 4WR3A 5EGRA 3QC3A 4JFVA 3R79A 2CY6A 1SO6A 1MDLA 1LL6A 3GJBA 5A7NA 1T99A 1L6GA 5KINA 4N6EA 2PTYA 5CG7A 2XLAA 2INFA 1LKNA 3VV1A 4INDA 1ONWA 4P00B 1NOWA 1R38A 3WCZA 1OADA 3ATZA 3RXZA 3UWEA 3UERA 1UY3A 4HCDA 1XSKA 3PJQA 3RLUA 4YTQA 2ZUWA 3B01A 2RS31 1OFSA 4K8HA 5D9MA 3TE9A 4GWMA 4QG8A 1XH2A 4DOUA 1T40A 3WDPP 5I3KA 1K9EA 3S5ZA 2Q8DA 3E9AA 3RZGA 3UG5A 5FPVA 4UTIA 4XW3A 4Y3OA 2VQUA 1AL23 3ASIA 1WLDA 3V1PA 4D6DA 5CFCA 2RHPA 3MLLA 4Y5Z0 4L6OA 4HJWA 2BASA 1XBZA 3VD9A 1EL3A 1ZYBA 3W7JA 2EIEA 2IC1A 2HNEA 4NHXA 3Q8BA 4PCTA 1TE1B 4QPYA 3VBUB 1RMU1 3NVTA 1XNKA 1I3HA 1SJBA 1I45A 3ATGA 1RPXA 3SISA 3LX9A 3WXPA 3V0BA 1EXBA 1YIXA 5KZ6A 4EWJA 3WD5A 3E6EA 4OOZA 4XSLA 1XRFA 1XRVA 1NOVA 1UB3A 2JICA 3G1RA 3VGFA 2XHKA 1H2JA 1LG1A 1HKVA 1B5TA 1TRIA 1Y5VA 4QTGA 4YM1A 2NQ9A 3A4AA 3POFA 2RDSA 1HJQA 3W88A 3OTRA 2WFF1 3KOXA 3AZTA 1WOBA 4WQ6A 3K4ZA 2R1MA 2KA3A 5IUQA 4PYSA 3CLMA 3W28A 1FPN3 3HQPA 5BWAA 3TNQA 4IISA 1MQTA 3VX1A 2GUUA 4LNYA 4J25A 2VGBA 4OBRA 4OV9A 1IGWA 1ZZBA 4H2HA 4TZDA 2FHFA 1B1YA 1FWGC 3CIWA 2DFBA 2CPUA 3C7FA 4EYUA 3WH9A 2VOMA 5A6KA 5M0TA 1J9YA 2PDNA 2VH9A 3QH6A 1Q4WA 1RCQA 3W7LA 3AMDA 1F3XA 4H14A 1ZBWA 2YGLA 1V0AA 3P67A 3NNJA 5DUXA 1MQPA 5FJTA 5E6ZA 2CWSA 3IVTA 1W6PA 4RPQA 4K37A 2YV8A 4ZEPA 3JR2A 1VEPA 3U7BA 3ABOA 1H0BA 1D4M3 3UL2A 1SACA 4K8RB 1DFQA 1LAJA 1A4MA 3KF3A 3AS3A 4HNVA 3MIDA 4PBOA 1N8IA 1P6BA 4QGMA 1I4NA 2PUZA 4S38A 2UY8A 3GF6A 2YPIA 1Q8SA 1OIMA 1KWKA 1J1TA 3G2GA 3EA1A 2LM3A 2R91A 4IT1A 4EPKA 3CPUA 4B5WA 4NWWA 4GYKA 4XD3A 4PF1A 2XIQA 1GVQA 1OD3A 4G7FA 1W0PA 4YG3A 1BGAA 1HG3A 1T8XA 1C90A 1JOBA 1DQ2A 2ASHA 2IWGB 2NT1A 3PJTA 2VC6A 3R0KA 3WW4A 4IUGA 2J7DA 3WG6A 4MYAA 4WIWA 1OFRA 4PB5A 2XLGA 3RJ2X 4AI2A 3DKQA 5C6MA 4CEYC 1QPRA 3SI9A 1U5XA 4PMDA 1LQ0A 4HOOA 4HNOA 4GHRA 4HHMA 1VS1A 5BMWA 3UPMA 2GC0A 1RJQA 2X0HA 1I60A 4XZPA 3STFA 2BWGA 4J1WA 4HB7A 4MG4A 2VZRA 3ZYPA 1A6CA 2V4AA 1IWAA 2VFGA 4PCRA 3C52A 4MZ8A 4G4FA 2VRJA 4R9CA 4PBPA 1T8QA 4PZVA 1DTUA 2HQAA 3BLFA 2J9YA 1XKYA 4Q6XA 2BHYA 1POV0 2E33A 3BPWA 3EDEA 4MDOA 4XETA 2GJLA 3LBOA 4KKXA 1O66A 4CN1A 4WF7A 2GK1B 4DYJA 1PX8A 3B8VA 3LEMA 1P4CA 3LHYA 3WDQA 3O6YX 2VAUA 2HBXA 3CMJA 3TXZA 5D2XA 1TQXA 5GJ6A 1YHFA 2AEYA 4LHSA 3GZAA 4MKVA 3P84A 5G4WA 3AYRA 2WABA 4HG6B 4A3XA 3HTWA 4PI2A 2BLEA 1ST8A 4DWSA 3M7WA 3FW6A 3BMWA 3KL3A 4V2WA 4I6KA 1GCYA 1AR81 4UF0B 1AJZA 4WVZA 1G4PA 2ZXAA 4BIFA 3NO8A 2DVFA 2XBO3 2A6YA 4FPGA 4QQOA 1R3VA 1HXS3 3EDDA 2D2JA 2PDQA 3VOGA 4DX3A 4MH0E 5LY1A 5LEKA 3L4TA 5A7OA 4O1FA 3M7SA 3E0IA 4K6BA 3UKVA 1E6XM 3PZOA 3N04A 1U5VA 1TTJA 5H8PA 3SGZA 5HJXA 4LO5B 3MHUA 4LC8A 4QT6A 1BQCA 4CEWB 3UY8A 4FNSA 5AYBA 3W3OA 4RS5B 4IL2A 1N1VA 1JDDA 4QHRA 1NOFA 1ZVFA 5A8OA 1OB0A 3ZR6A 4UAPA 1DEDA 2LTNA 1QWKA 4LKDA 3TZFA 2QE3A 4G1NA 3ZMOA 3ZFFB 4BF5A 3ARWA 2Y1HA 4Q4W2 3WJXA 2WNUC 5I7GA 3M3CA 2ZUMA 1SQ7A 1O7FA 4B3KA 4HTYA 3RCMA 4UR9A 5I02A 2HEJA 1E6NA 2WC3A 1E1EA 1KXHA 1LB2A 4JNMA 1GG1A 1CGUA 4W6YA 1T0OA 2CGOA 3HNMA 1DIDA 1BYBA 3KT7A 3VBUA 3LU2A 2BODX 1K6WA 4H9YA 1YXWA 4NRQA 4QX7A 2H0VA 1WBHA 4TLFA 5HV4A 1V6NA 5EQUA 4MJ4A 1XYFA 1ME8A 4EPDC 2E7TA 5EIYB 2GQ8A 3AC0A 4GJ1A 2DSZA 4OV4A 2EPLX 2IXUA 1XWYA 1YPFA 4AHPA 1WMFA 2XUEA 1GEHA 3AYEA 4IGPA 3FHIB 2WC4A 2VOXA 3G1AA 3OLDA 4QEEA 1JS9A 5FP7A 2QUVA 4NYUA 4M51A 3O06A 1ZREA 3LK6A 3KCCA 1VHCA 3WQCA 2J47A 3B93A 3GAKA 1R1A1 1BTCA 2ZICA 2NYYA 5LGXA 3VBFA 1F5FA 4WVMA 5C7VA 3POYA 3RYSA 2WCGA 5IJRA 4FR6A 5FAJA 5F5QA 2OS2A 2HWE1 1AFSA 4O16A 4NO4A 2R14A 3B8IA 3WG1A 5BY5A 3IGHX 4UQAA 3MKCA 3DFOA 4CCLA 5J96B 1QNQA 1Y4WA 4MXWA 3TYCA 4AEDB 4LKFA 4LORA 3WQPA 5TBOA 3VGIA 2NN8A 4C65A 1EPXA 1KEXA 1V02E 1XXXA 1G9CA 4V2VA 1XLCA 1ACCA 4LBSA 5JMCA 3UGGA 1RR2A 4D9PA 2NV2A 4TLGA 2A1XA 2OZ8A 4RE2A 1EPWA 2BHUA 2P1BA 1A0EA 3QSTA 5K0UB 1OFNA 2W68A 2WVSA 2V4VA 4UTWA 1HQWA 1WLCA 3B8SA 4A6GA 5ABHA 1Q6GA 4NILA 5HBAA 4IQLA 3S6PA 1LHWA 5JOZA 1AH0A 1MRAA 1QO5A 1NXMA 4GC3A 4OE7A 1XE8A 4Y1YA 3CTTA 3GIQA 3W7QA 1P0KA 2NLRA 2VVDA 1YRRA 3QSRA 2KZHA 2R072 5KXCA 2Y7GA 4HZ8A 2Y6JA 4AD1A 3OBZA 1AW2A 1UA3A 3LCHA 4V27A 3LEKA 3KZPA 1XBFA 3PUIA 1WXZA 4PRRA 2JX9A 2NWRA 2Y61A 4QM9A 4C1WA 3NQCA 1VRXA 3H2AA 2PB1A 4E4UA 1UR4A 5IYYA 3AJ7A 2VGGA 3LF7A 1A5OC 3O2LA 3RPQA 1N3QA 4AH7A 2BW8A 2HVMA 4E3TA 5D2VA 2J79A 3EDFA 2QCHA 2VZUA 4PB4A 1PGW1 1H1MA 1W3XA 1K5MA 4OUIA 3B97A 4YWSA 4JGYA 5HCFA 3T42A 1UKTA 2HSAA 3AMGA 4WKAA 1TME3 3NTYA 3VKAA 1CLKA 2VX4A 4IM4A 1GQJA 1BYHA 5BNQA 4GGBA 4EOUA 3S9IA 1J2BA 2BVBA 4MGQA 3CHVA 3PZTA 2E63A 2C26A 3GHMA 3W70A 1JZ8A 1HKKA 3L9JT 2VEMA 1ISYA 3UR8A 3WJWA 2P76A 4AWTA 1IG3A 3GIPA 4Y6GA 3N9LA 3I2DA 1DTNA 4PUUA 4U5IA 1PVNA 5LGZA 3U4XA 1VBD2 1AK5A 4ZOBA 1EHNA 5BYWA 1H41A 3EWUA 3B7MA 4W50A 2E5BA 1V6VA 3NDOA 3TJXA 4P5HA 2GZXA 3KL0A 1H30A 2ZS6B 1PDZA 4CA9A 4JNYA 2GL5A 1O3RA 5IVYA 3USSA 4Z2GA 2UWAA 2WOQA 3FOKA 5JQ9A 3WDHA 1UYQA 3EWYA 2JE7A 4C6FA 1QI4A 4N9HA 4JICA 3APYA 4XAFA 4HFSA 3OVGA 5F8PA 3TTEA 1R2TA 4CQ9A 3A22A 2MUCA 4DJED 5HBFA 3GDKA 1TB3A 5GVJA 1AL22 1VC4A 3TW7A 5HQMA 3DBPA 3V3WA 1Q63A 1GYKA 4IEWA 3LLXA 5DAXA 2GSEA 1NLQA 3M3EA 1NM9A 3H3UA 4XAAA 4XJ8A 1OG6A 4D6RA 4UF0A 2ZHNA 3I6RA 3IJDA 1QFEA 4MMWA 2W91A 3M3OA 1LDCA 3OO2A 1CVNA 4DUVA 2WZR1 2VT0A 4X9SA 3KGZA 4LF2A 3LEGA 2VVFA 4OU1A 2ZX4A 1UO9A 3ZSSA 5AC93 1GV9A 2FZBA 4PMQA 1MZ5A 1JDEA 3C86A 5M2FX 4COVA 4EIVA 2NM1A 2NVAA 2GJXB 1OHFA 4QU1A 1V6WA 3NNLA 5DG2A 3UCQA 1E6QM 4CEWA 3T4HB 1KXVA 1ZRCA 2O8QA 3A47A 1IEXA 1UYPA 3OEXA 3D6EA 1LWHA 4IIHA 5F3CA 3WNPA 5EBAA 4NI3A 4Q4Y1 8CGTA 3ANYA 4J3WA 1FPN2 3DGTA 1NIUA 2ADAA 2PDYA 3BLIA 3QY6A 3G1VA 3WX5A 3RPDA 3AMLA 4JRAA 3URQA 4FTSA 3D3AA 1OKQA 3VB9A 2D3PA 4IX0A 2Q09A 4FFGA 2BSLA 5LNUA 3QLQA 4Q8WA 3TIMA 3NM1A 1UUMA 3H2OA 1TG7A 1EC9A 1RH9A 2CETA 4NIDA 2BMBA 3TEZA 3WJSA 5AVNA 2VNRA 3E97A 4YTRA 4GI9A 2GDQA 4W88A 5HQEA 4FOUA 1PO9A 4Z1YA 3HBKA 1D4M2 2PD5A 1IKQA 4XIOA 2TAAA 3VL8A 4XVEA 3GUGA 3U2ZA 2NT0A 1SJCA 2CYFA 1PZ0A 4X8PA 3D3FA 3GG1A 5LSMA 1GANA 5HANA 1ND2C 4B7KA 1WXYA 5HATA 1JYTA 1UU5A 1OT5A 2FZMA 3ME3A 1UZ1A 1PO11 2OX0A 4FT8A 1EHAA 1K8ZA 1F05A 4A2SA 4GACA 5DXXA 5FJUA 2X8KA 3UK9A 3ERPA 3PNUA 1A80A 3VUOA 3FAXA 5K7PA 1LF1A 2QQMA 3BARA 1N1TA 1SR9A 3WDXA 1Q6OA 2BGSA 3VGHA 2XSBA 3O0VA 4C6IA 5CGMA 3VIOA 2VUJA 1UH4A 3FJ4A 1UY0A 1B35C 3N73A 4QAWA 2V3DA 3LGGA 1GOOA 4J2PA 4LS1A 1K7XA 4XAGA 1OUXA 4AWSA 3M7AA 4TSVA 1HQTA 2OSXA 2QIIA 4HU3A 1OYBA 2FDKA 5GZGA 4FQZA 3WELA 2VMDA 2VM8A 4ZXEA 2HV5A 2KAUC 1H50A 1J3QA 4BEUA 2AMXA 1D7PM 4UR8A 1MS1A 4LQRA 2WLQA 1ULGA 1ITQA 4N90A 1YFXA 1RHI1 3RX3A 3LXAA 5DRIA 1MEHA 3PPCA 1WO2A 1JZ4A 1UD3A 3I3MA 4JBRA 2VNCA 4RQPC 1B57A 1V02A 1PIV3 4FIRA 3BAKA