4CCDA

Structure of mouse galactocerebrosidase with d-galactal: enzyme- intermediate complex
Total Genus 220
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
220
sequence length
644
structure length
640
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Snapshots Illustrate the Catalytic Cycle of Beta-Galactocerebrosidase, the Defective Enzyme in Krabbe Disease
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
total genus 220
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ccdA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ccdA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ccdA01
1LL4A 1BTMA 3TA6A 3VD3A 1VZWA 3LF7A 2ZFAA 4TU1A 1W3HA 3LTSA 3NDZA 1LP6A 4J3TA 1YPFA 3IVSA 4PC8A 4Y9AA 1XFBA 5D9NA 3TW7A 2IXUA 1FP8A 3ELFA 5JIWA 5G4WA 4CQ8A 2X30A 3HPZA 5BYWA 1L2UA 2NV2A 4QLJA 5E09A 3MI2A 1CXLA 4X0VA 4JKKA 4LWWA 3M7SA 2G4FA 2A3AA 4UTMA 1W5NA 5FL1A 4PTVA 1IXNA 4Z08A 1QNQA 3PSWA 1ADOA 2PCQA 1JNDA 1GQKA 1VFMA 3VD5A 3VU2A 1E4MM 3W1RA 3TJXA 3B04A 1C8YA 1US3A 3GXPA 1LROA 3FN9A 1M03A 1SO4A 3RU6A 1W0MA 2QAPA 3THQA 3GNPA 4AZ6A 1FWWA 4CCCA 1IXPA 3WJZA 1NM9A 1TPVA 2CLMA 3VDCA 1A5BA 4F9JA 2VJXA 1P0NA 5HWMA 4O12A 4FLOA 3WJSA 1UHVA 4L4PA 1E6QM 1VFFA 4W93A 6ALDA 3TOPA 2QCLA 2VVSA 4MDPA 5IFTA 3E02A 3LB0A 1ZBKA 1NFBA 3CWNA 4QIUA 1A5SA 3NYDA 4Z0SA 3GXTA 3WNLA 5KITA 4R53A 1QNSA 2FGLA 2QPUA 5D9PA 1LOLA 1TE1A 4JICA 1Z44A 4BI5A 4LTSA 4CNNA 1TVPA 1UD6A 1A53A 3CIVA 3LBMA 3UWUA 4DXVA 1W91A 2YCEA 1H7PA 4Z1BA 3PSVA 3RM9A 4H8UA 2FDSA 1C8XA 1FA2A 3MP4A 2Y63A 2Q8LA 1KFWA 2QKFA 1GOOA 2V5LA 1YDVA 2ZIDA 3ARWA 3NZ1A 2ZZ2A 2J7HA 1WPCA 2H8XA 2WV8A 4WF7A 2QCNA 3CM4A 3SC7X 3W86A 2C7FA 1GCYA 3F4VA 1PS9A 4I7WA 5D9MA 3WF2A 3W7MA 3OBKA 1VYPX 4UMBA 3QHOA 1QDSA 3R2GA 4GI9A 4GUIA 2EXOA 1PHQA 2ZRUA 1QI3A 1HJWA 1BAGA 5EPDA 3FHQA 3LOTA 1H63A 4P2VA 3LHWA 3GH7A 4JYEA 4Y96A 4JIEA 2W91A 1GVFA 5E0CA 4UTLA 3W23A 4FB7A 3KF5A 2QF7A 4O1CA 1UB3A 5DBTA 5DN1A 4M56A 1MXDA 3M5VA 2WMGA 5D2VA 1J10A 1DWHM 1C3FA 1FOBA 2E9LA 2FFCA 2VX5A 3SUWA 3DYMA 4WZHA 5I77A 2XQRA 2WMIB 4J3XA 3CLMA 4UCGA 1LM1A 1DOSA 3A22A 4H6KA 4WXYA 2TSYA 1BG4A 1JDCA 3KHJA 4E8CA 1LJYA 1HJSA 1XGZA 3PBGA 3EWUA 1WAWA 2D0HA 4C1KA 3E49A 1DKWA 1KFJA 1KLZA 4NNAA 2E9MA 3OG2A 1GEQA 1PIIA 3L0NA 3BV4A 2DT3A 3L4ZA 4RXGA 5ABEA 1R2TA 3W1PA 1C91A 5EFDA 2VRQA 3A9IA 4CQAA 2WNWA 4ZE5A 2GUUA 5A6KA 2J74A 4MY1A 3U2OA 1DP0A 5L9FA 3QM3A 1TUXA 5FF4A 4LQ1A 3P7YA 2DGAA 1MFVA 4DUWA 5CPNA 2EAWA 2R8WA 2V2CA 2QMJA 4AAJA 2YFNA 1V3IA 1VJZA 2ZOXA 2ISVA 4UZUA 4X9YA 4D6JA 3W1NA 1TO3A 1F6PA 3BG3A 4JS3A 3EWWA 2VZTA 1E15A 1ST8A 2VZVA 3PG8A 4WXZA 1D3HA 2D22A 2F61A 5DXXA 1SSGA 1E3XA 2JIEA 2QJIA 4TXEA 3OVRA 5CPSA 1B9ZA 2Y85A 2GJLA 2B7OA 3BC9A 4XZBA 4C7FA 4LS1A 1EQCA 2ZX8A 2J9ZA 2ZZ6A 3W6LA 3F4WA 1AW2A 3HF3A 3DH7A 4PMRA 1GVQA 2TRSA 1V08A 3K4AA 2NT0A 3HPSA 3SECA 1B31A 3SCOA 3ABOA 3LCXA 3AHXA 2YGYA 3G1HA 4OV9A 2VR4A 1JZ8A 3G6LA 1UWRA 4ZFMA 3ZMRA 4MNMA 1FH9A 2CWNA 1DWJM 2ZTJA 1YXYA 2OYLA 1QNRA 1NSJA 3W2JA 1WDSA 2O9TA 4HNUA 3QW3A 1XBYA 4NU7A 1J9YA 4HZ8A 1E6PA 5LHFA 1GW1A 5I3IA 5FOOA 2GVLA 3M1ZA 3NQMA 2DIJA 3ATYA 5DMYA 2BVYA 3PAJA 3TONA 3LI1A 2GVGA 4MOZA 4NT0A 2WB5A 3PZ9A 2YYTA 3QOKA 1XCWA 1WZMA 1FBAA 4W7UA 5DCEA 3LHZA 5FL0A 3HG5A 3B0VC 3CHFA 1PCWA 4JFWA 1VR6A 2BNJA 3HBLA 5BWFA 1KR1A 1QNPA 3NDYA 5BXTA 3DGRA 1HIZA 2BXZA 4J27A 2Y24A 1JDAA 1B3WA 5FKCA 1F6KA 2NLIA 4UQDA 5FEXA 4DM1A 3LRKA 4LVFA 3RFAA 1KGXA 2JEQA 3RILA 3PS7A 4HOWA 1JCMP 2E9BA 3IIZA 4GUFA 4RX0A 2OJPA 3C2VA 4GC4A 3WK3A 2CLFA 2CESA 2GFTA 3AMGA 5KSWA 1VEOA 3WH9A 4E4PA 2HVMA 3W53A 2UY3A 3ZJ6A 3CLWA 1G4SA 1ZJAA 3HO8A 4V27A 3GX9A 3W9ZA 1V0NA 3VINA 1S5VA 2WZHA 1H5VA 3WF4A 5KTLA 4X9SA 2X2GA 1T99A 3N2MA 5D30A 3WD2A 2WLYA 4GO9A 4J3UA 1AQ0A 4W8LA 1W5MA 4O10A 3GIYA 4ZQMA 4A3HA 1OG0A 2Y7DA 4BFAA 1RPKA 3IAQA 4C7GA 3LV6A 2XHYA 1TRDA 1E6ZA 2CLEA 3WEMA 1P1XA 2C8NA 2FPYA 3ECQA 1KB3A 1C29A 3EDJA 4KH2A 1SMDA 3MV11 1QO2A 3T2OA 1P5BA 3SCTA 1BGGA 1C93A 1HL8A 1OFEA 3MBDA 4QCEA 4UTHA 3KRZA 1MFUA 2F8QA 1MQPA 1LWJA 2HSAA 3ABQA 1PVNA 5LNUA 3CEUA 4ICNA 5LGXA 2ZZ7A 3NQAA 1CXKA 4AYSA 3UQNA 1Y4WA 3OGRA 1ME7A 4O50A 2J4GA 4JHOA 1H1YA 2ALDA 4FFHA 1UR1A 3CTTA 3MHGA 2VL4A 1SO5A 5CSRA 5LHEA 1A5AA 5A8OA 2ZYFA 4LY8A 3T4CA 1P6WA 4DF0A 3N15A 2Z2UA 1H7XA 4PA8A 4NZCA 1KGWA 4EOUA 4QQ3A 2BFGA 3P8JA 1I2RA 3W0KA 1IXQA 5ABHA 2KZHA 1G6CA 5FEZA 2QV4A 3MWAA 3WL1A 3C3NA 3MMTA 1WDPA 2W62A 2DIEA 3L4UA 1HFBA 3WFZA 3MKKA 2ZZ4A 4FNPA 1MW3A 3BAJA 3TDFA 5LNVA 1XUUA 1KFBA 4WJEA 5K2ZA 5H91A 1WV2A 1VIWA 3AZRA 3CUHA 3MS8A 4GUJA 3FOKA 4IJBA 3RLUA 2ZICA 1YYAA 1EO7A 5AY7A 1FHLA 2J47A 4HKPA 3W7JA 2WWDA 3OSDA 3CHCA 1GTHA 4LS2A 1PBGA 2DSUA 3S1UA 5I3DA 5D2XA 3TSMA 1OFAA 1HJUA 3VX1A 3TTQA 5C54A 1FUYA 3C0JA 3K46A 1IZJA 1E4LA 2Y88A 3WJWA 1JCLA 1VJIA 4UTWC 1I2OA 4W9TA 1SZNA 3WJYA 1UUMA 4UQBA 5G1YA 1O94A 5E0FA 2E6YA 1XH2A 1TV5A 1FWNA 4X2RA 3AHTA 1R2RA 3BLFA 1BVZA 4AZCB 1MW0A 3AMCA 3EB2A 2YL5A 3U5UA 4FXSA 3WJXA 2DH2A 1WZKA 1UR2A 3T40A 1D3CA 3IGSA 4L4OA 3WQVA 3B8SA 4PMVA 8TIMA 4Q32A 4X3ZA 3SY5A 4DO6A 3QR3A 1JZ5A 3W6YA 4IPIA 4WSKA 4FEZA 4XBSA 1SR0A 3ZWTA 3I3DA 3H3LA 4AD2A 1XYFA 4D6CA 4KGJA 3PIGA 2E8YA 5T26A 4O8RA 1F7BA 2ZBTA 3A5FA 1JIBA 1FH8A 1HP5A 4P7LA 2XJ7A 3VIHA 3GDTA 2AGKA 3G6MA 5ABFB 3K4DA 4AD0A 4U5KA 2A7NA 2Y7FA 3NQDA 1Y7VA 2ZCGA 1H7OA 1GQNA 4IX0A 4LU0A 2IUZA 3K1DA 3UR8A 2GQ8A 3TX9A 1LG1A 3WNMA 3AJ7A 5HNNA 1G67A 2BVDA 1WZLA 2E40A 1VRXA 4PRWA 4UTUA 4GXMA 2FB3A 1YTEA 1TTIA 2H3BA 3NGJA 4PYSA 3BAKA 1DQXA 7CGTA 3VPLA 1O95A 1WQ5A 1M7PA 4LYRA 2XM1A 3MUZ1 5BMWA 1SUXA 4W87A 1MSSA 4NVTA 3YPIA 2TYSA 5FEPA 1K03A 4XKYB 1VCFA 5U4NA 3VGGA 1QW9A 3F5KA 2YYUA 2NZLA 3NOEA 4AVFA 1OJXA 1QO5A 4CU6A 4W7VA 3SCUA 2RKXA 3AICA 3W7KA 3WD3A 3W4RA 2P10A 5FKYA 3NR0A 1YDNA 3NQCA 4KFOA 2DZVA 2R14A 2QDGA 2X1TA 5FK7A 4RKAA 1C92A 3GNRA 4OU1A 3UG3A 1TA3B 1I8JA 2FTPA 1TPB1 1GHRA 4FNTA 4QNWA 1JYNA 1OYCA 2WXDM 2ZRVA 1N82A 3NPUA 4DUVA 4AWSA 1LOSA 1WBHA 1QHPA 1L9WA 4CUCA 5K9CA 1U30A 4D6GA 1TJRA 4JX5A 1JZ4A 3C61A 3RPMA 1FX6A 2J7GA 4AZGA 3GAYA 1OM0A 3HQ1A 4MB3A 4GINA 2OMAA 1TPDA 2YJQA 1LTDA 1H0IA 1KR0A 3DHFA 1LOQA 1W1TA 1UBSA 3LV5A 1ISZA 2AAAA 2GK1A 3AHVA 4RE4A 4PEKA 5EL1A 1OIMA 1TPH1 3A47A 3NDOA 4K36A 3VIPA 4QAIA 1NWRA 3I7RA 4MNLA 3TAOA 1DHPA 1MXSA 2YXGA 4OZOA 4AY1A 4N9DA 1AVAA 1W9BM 2VCBA 2XWEA 3O1NA 1HN1A 2WKGA 4N9CA 3EWBX 1GVYA 1HKJA 3AS3A 1JCYA 1BQCA 1E51A 3K8MA 4K8HA 3I3BA 1J18A 5AYXA 4FNUA 3OEXA 3LXBA 4M7TA 4PH6A 2WBKA 2DH3A 1CEOA 2UY4A 2DEPA 3IK2A 1NOWA 2ZRXA 3I6RA 1PZ3A 3SEPA 1FQ0A 1KM4A 4TO8A 3CU2A 3NQEA 4YWIA 3KL5A 2J8GA 1H5YA 2QHAA 3P62A 4AMAA 2V2DA 2GVJA 1A47A 1JD9A 3GZAA 4HA3A 4UQ9A 3CTLA 4ORMA 2UY5A 4LVDA 4GI6A 4FO4A 5IFPA 5FF0A 2C15A 2WC3A 1G69A 2RDWA 1LLWA 3V1PA 4M80A 2QAFA 1TR1A 4Z0JA 2QR6A 3BLEA 3AS2A 4BQ2A 4UQEA 3C6CA 4CQ9A 3MMDA 1TCDA 1NF0A 2DJXA 1CZ1A 4F8XA 1UWTA 1W31A 2FGZA 5A3HA 1LWHA 2OWCA 4MLRA 2VI0A 1SW3A 1H0GA 3W82A 4PEEA 4K8EA 4U4MA 4YPJA 3WMSA 3BCFA 3FS2A 3LPFA 4OOZA 5FF3A 1GQIA 1G4PA 1LL7A 2DT2A 5E9AA 3GDMA 2P0OA 3O15A 1PL9A 4YL2A 1CGTA 4X22A 3WF3A 1E6RA 1NWSA 3S5YA 3DYOA 3UGGA 3T0DA 2DP3A 3MUXA 3M5ZA 5GNXA 1TTJA 3NXFA 1EH9A 1PAMA 2BY2A 1KCLA 2I14A 1NWUA 4R27A 3VIKA 1G01A 5IBXC 1CI1A 5FD0A 1QPOA 4MYXA 5KZEA 2B7QA 4O19A 4QISA 1J4EA 4ZL1A 4CNOA 1SSDA 1NP2A 2O9RA 4CU7A 1OVDA 5BXRA 3DBPA 3TXVA 1UKOA 3PZVA 3B03A 2VURA 1E4IA 5TIMA 3LDKA 2CNCA 3U6WA 1ZJBA 4A29A 5E93A 3EDKA 1BYCA 5CGQA 1UWSA 3S5QA 5CZ0A 3R13A 2WHLA 4LV9A 3BSGA 4MPKA 4NSBA 4AH7A 5CGTA 3VDAA 1GJWA 1HTIA 3W7IA 2BZNA 1QOPA 1QI4A 2A4AA 3VGFA 4UC5A 3WQ6A 4CD5A 5JBEA 1LRTA 5HPOA 3ALGA 5TQLA 2WSQA 2PF0A 3WDIA 1XH1A 5DO8A 4MB1A 1R30A 3VIGA 3IIPA 3L2IA 1CXEA 4J28A 4LV4A 3ANYA 3BVJA 1W9UA 3T7VA 5D04C 3W7HA 3CZGA 3ZR6A 3W1QA 3VFLA 4O54A 1VLIA 4JD4A 3N1AA 1CGYA 4AEEA 2ZQ0A 4B3KA 4CNPA 1W5PA 4JY8A 1JUKA 1ZALA 2QEZA 1S46A 4CN4A 1V6WA 4P8UA 3V75A 4JL2A 1WE5A 2EPLX 3OGSA 4CCEA 3M47A 1K7XA 2WPBA 5I24A 1OX4B 4EVZA 3E0IA 3G8RA 4M6PA 1JD7A 3T2PA 3EX1A 4NXKA 1U33A 4QCFA 4MADA 3W87A 5BRQA 6TAAA 1KBBA 5AC7A 2W92A 3PUEA 4H04A 1F2JA 1J12A 1W2VA 4R34A 2V3FA 4MAVA 4PUDA 3RDKA 3TTSA 1JYWA 4GQQA 5G2IA 3ARVA 1G4TA 4P7OA 2GOUA 4JTKA 4FF5A 2QQUA 5DXYA 3P60A 4G1KA 4UIOA 1M7OA 3W38A 1JJKA 3BPWA 3LBCA 3B06A 1VCVA 3R12A 4K7VA 1Q6FA 1YTDA 3LERA 4P7QA 3U7BA 3GR8A 5SWUA 2DT0A 4TMCA 3W7OA 3PZIA 1GT8A 3WFLA 5HUPA 2RHGA 1BKSA 2DZWA 2RH9A 2V82A 1KFLA 1Q45A 3W71A 1WZAA 4DEFA 3AROA 4H8VA 1CYGA 2XUCA 1TV7A 1ME9A 2V0TA 4Y6GA 4WIWA 1B3OA 5JIPA 1DV7A 2RGLA 3KE0A 2FHCA 2YL6A 1AL8A 1UD2A 4B5NA 5D33A 5BMXA 4EK7A 4M1RA 3CH9A 2DZPA 5DT7A 1GQLA 3TH6A 3L9CA 1L0PA 3H53A 3BG9A 4WY0A 1FFQA 1DJNA 2WJZA 3P5ZA 4PODA 1CXFA 5A8QA 3TXZA 4B3LA 4NNCA 1UH2A 1CX9A 3UYCA 2NXGA 2WM0A 3BO9A 2PE4A 5FI8A 3C56A 4P8VA 1UYPA 4UTKA 1RP9A 1QHZA 2XVGA 4BQ3A 2OT1A 5K9DA 3WY1A 1J0KA 3BMVA 4D71A 2EPNA 1EXPA 5CQ1A 3VX0A 3DYPA 2YL9A 3WH6A 1AQHA 4H41A 1WDQA 2ZUNA 3GBDA 3AS0A 1SQ7A 4O52A 3IANA 4J3SA 2ZXBA 2OXBA 5EMYA 1FH7A 2NX3A 3HPXA 1EUNA 3B0PA 1NOFA 2D1ZA 3LLDA 3WUGA 4AD4A 2YLLA 2PRHA 2ZWZA 3VD9A 4F9DA 2ZXDA 4IMDA 4JTGA 2JKEA 2CEQA 1UYQA 2BHUA 4F66A 1XD0A 4UUIA 3QC3A 1Z42A 4D6FA 3VKJA 4KFPA 4UOZA 1GG1A 3UWQA 2YFOA 5U7SA 4N4PA 3JRKA 3F4NA 1W1VA 3PZMA 3WQ8A 3WQ4A 1UWQA 1QPQA 3JUGA 3NUKA 4XX6A 1TPUA 3N12A 1EIBA 3TIMA 5BW6A 1JYVA 4OHQA 1O5KA 3AFBA 4B15A 4O1DA 2WMIA 1ZCOA 3G1AA 1P0KA 4WQ6A 3WD0A 3ZR4A 2VEIA 2XGIA 5HBFA 1YPIA 1VQTA 3Q94A 4D6EA 4PBGA 2WPGA 1B90A 4UR8A 3STEA 3W1UA 1RH9A 3FAWA 4LYPA 3W24A 4AD3A 1P4CA 1TV8A 1XM3A 2I1OA 3TFXA 1J0HA 2WCGA 4EF9A 4MFEA 2VVNA 2FHFA 4MPQA 4JL1A 2CERA 4L4LA 5LNWA 1RQBA 3IVUA 2WK2A 2Q8ZA 2D20A 4QHZA 4MZYA 3BXWA 1NWTA 1QAPA 2JF7A 2G8ZA 5AYZA 3GZ3A 1NH6A 3VM5A 4AD1A 3QSRA 2VX7A 3W2KA 1F4HA 1JYXA 5K4ZA 1F4AA 3G3DA 2GJNA 2Y5EA 1W1ZA 3N9KA 2H6RA 4LC8A 3RMJA 1A3HA 4YCPA 3FXYA 1X6UA 3W7LA 1VHCA 1W9VA 3T44A 3ZWSA 3BLPX 1W1YA 2WHJA 3BW2A 5F1VA 4WSJA 4NZFA 2DT1A 4UTWA 1JGIA 2J62A 2YDRA 3HB9A 1X1OA 4KRUA 1WX0A 1I1WA 1WA3A 1CPUA 1YTKA 5D2WA 1CTNA 3VNZA 4M81A 2QCMA 5FMCA 5IXEA 4MZ8A 4FHAA 3M9YA 4UQCA 1OFBA 2PRMA 1M7XA 1B4KA 5CSUA 4J9JA 3OLGA 1SU5A 2XFYA 1KM2A 4UTFA 4D6IA 2XYLA 3IEBA 5A94A 1FP9A 2TPSA 3QH2A 1OD0A 1V3HA 4FNQA 4A3UA 3KL3A 4HA1A 3KVMA 4MZ1A 1GOMA 2YW3A 1SW7A 4N9BA 2J7DA 4BI6A 3FY1A 4YMZA 1BYAA 5D9OA 3GXMA 1W3TA 4EWND 5D03A 1FDJA 1ZS2A 3WBAA 2YBUA 5C55A 4V2XA 1Z32X 3L5LA 5CPLA 3BAXA 3N04A 3HBKA 4HPJA 4GZJA 1W3NA 2DZUA 3W2MA 5AHNA 2ZE0A 5I0DA 5EA9A 4MIMA 2WBGA 2DJLA 4O18A 1OF6A 4BS0A 1UASA 2R94A 3CWOX 2GVYA 3O6AA 3WBEA 4Z2JA 1EOKA 4W89A 1KV5A 1XBVA 3NQ2A 4P8XA 4AW7A 4TR9A 1ZU8A 4LT9A 1ESWA 4RE2A 1CLVA 1LCOA 1B2YA 5IHRA 3VD4A 1HG3A 2NX1A 1BTCA 1VS1A 3MUY1 3WNNA 1Q6DA 3GH5A 3UETA 3BAWA 1H41A 1TRIA 3MW7A 4K39A 3UXDA 1JAKA 1LORA 1H2JA 1XI3A 3SGZA 3TQKA 2O9PA 4ALDA 1QOXA 4BCEA 5CPQA 3INPA 2ZXAA 4PCTA 5FIPA 1E55A 1UR4A 1H50A 4DWSB 3HGRA 5F7UA 3THAA 5D8ZA 3HOJA 1VBUA 2F2HA 1UA7A 3LTPA 4O0KA 2W66A 1BSIA 4O16A 3GDBA 4NUWA 3S5NA 2ZUUA 4UOJA 4W84A 5A2BA 3GVGA 3EWYA 4UQAA 3NMBA 1RD5A 2YX0A 1M6JA 3S2CA 2EPKX 5L6UA 5I3JA 4QLKA 4KWWA 4JKMA 3VDHA 5MHBA 3MSGA 3KRUA 2X1RA 3NG3A 3T08A 3G8EA 4O53A 2ESCA 1G7UA 2VFHA 2FH6A 3CPRA 1QVBA 2FHBA 4DQWA 4H8HA 1S5TA 2QCDA 1SFJA 4ML9A 1WKYA 3WEOA 4RZ6A 5HPCA 3C52A 2RFGA 4BR1A 2J7BA 2DU2A 1WDRA 3TU9A 1SZFA 1QW8A 4QAWA 2J24A 1OK6A 1W8SA 1W2TA 1LZOA 3SUSA 5K4XA 4UTJA 1MXGA 2VOMA 3W3OA 5LGZA 2CIPA 3QQ1A 3G1XA 2BTMA 3KVLA 4MY9A 3W2UA 4A21A 3CMJA 5DFAA 2Z0IA 3HG4A 4WKFA 1CGUA 1YLVA 4AD5A 5JBDA 4GBUA 2J79A 1H4PA 2XVPA 4JIQA 3S5ZA 3MV01 1JAEA 4LS0A 3O6YX 2Y62A 4UNKA 3UWZA 1GUVA 5M5DA 1T0OA 2WMKA 1LF1A 2E5BA 2ZUSA 3W76A 4DELA 5BOOA 2WHKA 1UKQA 5CSYA 3TQ0A 4RZ5A 1R8LA 4HHPA 1GYNA 3RWKX 4UXDA 4UTTC 1RR2A 1O6IA 4IXHA 3S6TA 3O6DA 1G5AA 3W25A 3DAQA 3STFA 4AC1X 4JY9A 2WMHA 1QPKA 5FF2A 4D2JA 4XWUA 5CPTA 1TTPA 3PZUA 3MMUA 2E09A 3O6CA 2OSYA 3TE9A 3SUUA 3GLCA 5I78A 2E5CA 4OUEA 2CBIA 2X2YA 3VIIA 3M07A 1G9HA 2E1DA 1GPFA 3SZ8A 2VFGA 2CLOA 3SIZA 5A5WA 1R7AA 4NJIA 3SCRA 1PEZA 4NJKA 3UD6A 2VFEA 1KTBA 3CHDA 3OZPA 1MWOA 4IXXA 3C2OA 1CIUA 2C1HA 5HNRA 1SZGA 4MB4A 3UERA 2B0MA 5LA2A 4NQ1A 5ABTA 2H90A 5G5IA 7TIMA 4MNJA 3W1MA 1TQJA 3UCQA 2EHHA 3R8RA 3FEMA 4WOZA 1R86A 3PUDA 3CT7A 5GNZA 4CN1A 1EWEA 5HULA 1ECEA 4HU0A 4LW7A 1W32A 3N3MA 2CLKA 2A7PA 3WK2A 2PC8A 4DF2A 2CZDA 2BX7A 1KBJA 2V8ZA 1E3ZA 1QOQA 1J5TA 2Q3RA 5M03A 5EB8A 2O92A 4BQ5A 2LLEA 2Y7EA 4ZQOA 3MBFA 2C0AA 1BWLA 1OABA 3O8AA 1GOIA 1V02E 2UY2A 4QFUA 1L6WA 2CLHA 2O7SA 3LHTA 4C1LA 3F5JA 3WFAA 5DEZA 4AZHA 4S3JA 2NV1A 5I3KA 3H54A 3UWWA 2D2OA 1KLYA 1GONA 3IVTA 2AC1A 4S2BA 3VI2A 2A7RA 4KGLA 3I65A 4M24A 2WVVA 3WDRA 4D1JA 3EX3A 1KBKA 1MEIA 1R7OA 2F84A 1EA0A 3KZSA 4JTFA 3TA9A 3L21A 3D3AA 1OB0A 1YDOA 2PWHA 4P8WA 4CD4A 3ZJ7A 4Z2GA 1KBIA 3G18A 1MZHA 5I79A 2CBJA 2W4XA 3PIJA 4HXCA 4NJGA 5A6AA 2VQUA 1XCXA 3EBVA 4AF0A 3F5LA 4XUGA 5G4EA 1H3GA 4AHPA 2FPVA 3MYOA 2NUYA 1C8VA 3VE9A 4B9YA 4H3DA 1J2WA 4OV4A 4JFVA 4CD8A 1K9DA 2I9EA 3CMGA 3GKFA 2X1SA 1ML1A 2J9YA 3M6DA 3POCA 2DDXA 1E5NA 1QI0A 3ZQ9A 2XFWA 3O2LA 3IJ8A 1QCWA 2DQXA 1VLWA 1F73A 4XTIA 3B4UA 3PUOA 2PURA 1ICQA 1KA9F 3IIOA 4CD6A 4IMFA 3BLKA 4AHOA 3PVFA 4GUHA 3CBWA 3PR2A 3ZO9A 1E1FA 5IHSA 4PL2A 1XSKA 1OGSA 2A6NA 3T09A 5I6SA 1VC4A 5JBFA 3F03K 4DO4A 1OIFA 1SZEA 2DZXA 3NQGA 1EOMA 7TAAA 4JNMA 3ARSA 3NA8A 4OJYA 4MLJA 1K3UA 5LSMA 1T96A 5EBUA 3W1XA 1LRQA 3SFKA 3AZTA 3MP3A 4AXKA 2OLHA 3E1F1 2WZEA 4CVWA 3MUIA 4PFMA 2PB1A 3NZRA 4ADSA 3BCDA 4FFGA 4MY8A 3M46A 4N6EA 4O13A 1GYLA 3TQVA 3HMJG 3N19B 5K3VA 4ATDA 3I7SA 3WQ5A 2PWEA 2Y2WA 2EGZA 2Y61A 5BCAA 3GTNA 2Y6ZA 1O4UA 1S5WA 3N18A 1QR7A 5FEWA 3ARPA 1C7TA 2CZ5A 3PF3A 3OLEA 1FWTA 1E4NA 1KQYA 3ARXA 4Y7EA 1EUAA 1PX8A 4FX8A 1JQVA 5F4XA 3S1VA 2J25A 4R5EA 5D4YA 2WKLA 4IUGA 5AN7A 5A95A 3LPOA 1KXVA 4JN6A 3LPGA 4UFLA 5A8NA 4O4WA 4MJ2A 1W54A 1OD8A 1HVQA 1TMQA 3LRLA 2W0UA 1RQHA 2WHMA 2Z1KA 3DXIA 3TSDA 2R91A 3C2RA 3N17A 5E6YA 6A3HA 2ZZ1A 4NJHA 4R33A 3QMTA 2QQVA 3L65A 5CZKA 1I75A 3RNDA 4AIOA 4MB5A 4AF0B 1ZAJA 3KOFA 4JTJA 1PIFA 2GJXA 4KKXA 4X0NA 5A6JA 3UGHA 5CPMA 3TAKA 1OWQA 4GE8A 1DEDA 1AG1O 3TSBA 2UWFA 2VFIA 1VCGA 3T78A 3NNTA 4JX4A 2G5WA 3ARUA 3BW3A 4Q33A 2V2HA 3QMRA 2Z6IA 2G3JA 2J88A 3W29A 3U7VA 3QF0A 1GWJA 5DCBA 1U83A 4QNEA 3S9YA 1UWUA 2ZX9A 1OBAA 1V6UA 3PBYA 5BROA 1Q4NX 3CB8A 3GDRA 3LCIA 3O05A 2E5DA 2XVNA 3B9DA 1I2QA 3AIRA 1TREA 2J7FA 3EYPA 4BA0A 2VT0A 4JTTA 4AIUA 4N42A 3RO8A 4DUXA 3IRDA 2ZZ5A 3SCNA 1QI2A 5A2CA 3UZ5A 3SUTA 4PTWA 1Q6QA 1QPRA 2FIQA 3I68A 2XIBA 4LGXA 5HWNA 4WKAA 4GI8A 4HN4A 2PI6A 2OSWA 2QLYA 3WUBA 5KZDA 4AZCA 3CC1A 3QJAA 2CITA 3TP4A 3KXQA 3BGGA 4F79A 1KXHA 1SYTA 1PJ9A 2GQAA 3W22A 1E43A 3MU7A 4WKHA 2H8ZA 3MYPA 4LOCA 1TQXA 5G2HA 1OYAA 3EEGA 2QUTA 3L67A 3W84A 1B1YA 2G41A 1THFD 1YXDA 4IMGA 1E70M 1UG6A 1RPXA 1CDGA 3PG9A 4N6FA 5D09A 2Y7GA 5CKSA 4ADTA 1E6XM 3PTQA 3DFNA 3FLUA 3FIGA 3NL5A 3QYQA 4MNKA 5D2TA 1SFSA 1JI1A 1FCVA 1KXQA 2WYSA 2VOTA 3AHYA 3PC0A 1H7RA 2VMFA 1QWGA 4JCMA 1B4EA 1EX5A 4MDOA 1C7SA 3LPPA 1X1ZA 4BF7A 2BLEA 2A3HA 1Z48A 4WJXA 4PUEA 5D37A 4W5ZA 1R85A 2PBOA 2JIWA 3G1SA 3WK0A 2V9DA 4NX5A 3NQ6A 4E8DA 5D05A 2ZZ3A 1J0IA 1VAHA 3N9RA 4W8AA 2X1IA 3QOMA 4CLMA 1V0MA 1TJPA 3EKLA 4Y90A 3TROA 1IV8A 5FESA 1Q6LA 3NAVA 6CGTA 2GJXB 3FFSA 4GRSA 1DWFM 2AQWA 1WCGA 1IIHA 3N34A 4UZSA 1BG9A 1JFHA 2CHOA 2OSXA 4ACZB 3D5HA 2O7QA 3UY8A 2JFEX 4BZYA 1OX5A 1OX4A 2W6RA 9CGTA 2G3NA 4P7RA 2A2IA 3UZJA 5IM51 4HIBA 4JYFA 2X09A 3B9AA 1W1PA 4EANA 2CYGA 5CG0A 2J8FA 4J3WA 1ZNNA 3UR7A 3IGUA 3PZNA 1JF6A 1R87A 3UPWA 3AISA 2C13A 3VVGA 1KM5A 5I2UA 3MANA 2DSKA 5KMYA 4JZ5A 4WY0F 4ZEPA 1V3JA 3H55A 3WF0A 1WXJA 1IGSA 2CU0A 2G96A 4D72A 4TVCA 1H7NA 4N0RA 4UCFA 2QDHA 4H4IA 1WOAA 3FJ6A 4RLIA 4KWUA 4RL3A 3L4XA 2ZDRA 5KZMA 3MI6A 1JZ2A 1Y9MA 1HT6A 4PTMA 3GR7A 3T0BA 3ZSSA 4MYAA 1ME8A 5LKYA 4XKYA 3QEZA 4M6QA 2AMGA 2XFFA 2FB2A 3GNOA 3AHZA 1EQPA 4YCOA 4IGHA 5ABGA 4HSOA 3UWVA 2XWDA 3TNOA 2VUYA 1VGAA 3BARA 1G0CA 4TTUA 3QRHA 5HOSA 1OYBA 1CXHA 1X1NA 2D73A 2J78A 1TPC1 5AHFA 1B3YA 1LLOA 4AWEA 5AYYA 3EXRA 2HS6A 4N4QA 3IJ7A 5AHEA 2C0HA 4I7UA 4AXNA 5D2YA 3WNKA 2VZSA 5ECUA 3G1YA 3GDKA 5AOUA 2HTMA 3TUUA 2E6AA 4M8UA 2QUVA 1KFEA 3P67A 4RJEA 4Y8FA 5DY2A 3IAPA 1DVJA 3L2MA 3BLIA 4FLQA 3WMBA 2J7CA 2ZX7A 3NSMA 2Y89A 4HT3A 3C8FA 2W61A 4XTDA 1CNVA 3LTYA 1QFEA 5KINA 1FXQA 1EB3A 2BV9A 2O9OA 2WC7A 3IGXA 3ABSA 5F2LA 3MUAA 2FPTA 2VX6A 2GDUA 3TK7A 2DZSA 3VMPA 2A6LA 2XIIA 4GIAA 4JAWA 4PTXA 4M6VA 1JZ7A 4U31A 2ISWA 8CGTA 1SPQA 2WSYA 1AMYA 1B30A 1JF5A 1J11A 2EO7A 3WF1A 1GJPA 4NXSA 1JCNA 1VYSX 5F2IA 2GPTA 4AZ5A 1TMHA 2BS9A 3B8DA 2YLAA 4WOQA 4EQVA 3DFSA 3LM7A 3CUJA 2CLLA 3FNDA 5C70A 4QLLA 1TA3A 3WD4A 2ZUMA 2VCAA 1EO5A 4MAZA 3U14A 3W7QA 3B0UX 1V6XA 1ONRA 4FXRA 1I2PA 5E1QA 2VEMA 5J5DA 2QCDB 1KWKA 4A2RA 1CWYA 4OQVA 3PTMA 3OB8A 2WSKA 1KM3A 1N8FA 2VFFA 4MUZA 5CJ5A 2CZFA 4ACYA 1A50A 3DFTA 4HP5A 4GO8A 3DI0A 1NF7A 3PB2A 4XZ9A 1CBGA 1XHGA 2GDVA 3ARYA 2CFFA 2MANA 3WN6A 8A3HA 4PMDA 4IQLA 2WANA 4ADUA 3P61A 1V3KA 1FWSA 3SUVA 4EF8A 2OT0A 2BY1A 1HKIA 4JFUA 5BXPA 1KGUA 4ZXOA 1V6VA 5GPRA 1HXJA 1E56A 2DORA 3LHUA 1GZJA 1ZJIA 2C3ZA 1EHAA 1UH3A 4DBDA 4GZIA 4OBRA 5AC6A 4PMYA 2B31A 3RM8A 3SJ3A 5C5YA 3VD7A 3PWAA 2FH8A 1E0WA 3A4AA 4PMXA 3WUEA 1FFRA 4ACZA 4ZXLA 4JFSA 5LNRA 4RZ4A 2PRLA 2ZA3A 1N7KA 2YBTA 4JGDA 2XVLA 3DENA 4QSHA 2DSVA 3L4TA 3RLVA 3BGAA 4U5IA 1T8XA 2AAMA 3VGHA 1KTCA 2ZX5A 5EFFA 3B05A 1TG7A 1TSIA 3CGTA 3DZ1A 3E12A 3G22A 4NNBA 3RF9A 1EDTA 3DKLA 4JDYA 4C7DA 3TJLA 3NM3A 1H1ZA 1H11A 1A5CA 1JR1A 4W5UA 1CW2A 3HG2A 2AEZA 1W2PA 3KL0A 3LMYA 1KM1A 4DO5A 2WMJA 2EKCA 4NI3A 5IDIA 5BXSA 3SURA 3L4YA 4EAMA 3AXIA 1ZENA 3WDQA 4UMAA 3PZGA 3LXCA 1WAUA 1HL9A 1WYIA 1TTQA 1K9EA 4J7RA 3THCA 4MJ4A 3GXFA 1I2NA 1K8XA 1E5JA 2VC6A 2JKPA 3SCPA 4JTEA 4NX0A 1ISXA 5AHLA 4W7WA 3BG5A 4CVUA 3HU7A 1VHNA 2A3CA 1I4NA 3HGSA 2B7NA 1R47A 3OGVA 4U3AA 2FJKA 4K6AA 1HP4A 2Z1SA 2HS8A 2WNNA 5CXPA 1AK5A 1OGBA 1LDCA 1GVSA 2ZA1A 3TFCA 1UZ1A 3VCRA 4PMOA 3SIMA 3DFPA 1M01A 3CZEA 4Q22A 2VRJA 4Q4KA 3N73A 2NXIA 3W7CA 4RR4A 4HNTA 1YHTA 3VOCA 1KCKA 3W85A 1BF2A 1XBXA 2AOSA 3QW4B 4P61A 5FF7A 1GOXA 1ICSA 3LXAA 1H09A 3W81A 1OCQA 1MEWA 3IV3A 1H1NA 2BSLA 2X0YA 3BH4A 1V3MA 4N2YA 1PX3A 1JCJA 3NM1A 1ODUA 2VR5A 3Q37A 1SW0A 2V3GA 4OKDA 3RM4A 3BAIA 3LI0A 2V5DA 1O60A 2FDMA 1E72M 3K8LA 3MJYA 3QSTA 5D38A 3WQWA 5D02A 4URIA 4PTNA 3WD1A 4B9ZA 3S42A 2WVVB 3ZOAA 3AOFA 1TFVA 2C18A 1R2SA 2RGMA 3A4WA 1UKSA 4MFDA 4IPNB 1EHNA 3AIWA 3RJYA 4Z2KA 3AIBA 1DHKA 3S1XA 2VRKA 4LRSA 4XV0A 2JGQA 5LNSA 3WEZA 2TAAA 4CCDA 1UR8A 1JI2A 3K30A 2PWGA 3OA3A 3IIXA 1OFRA 1DWAM 1YADA 3E9AA 2VX4A 3HIJA 3WDHA 1RP8A 3W7EA 4JTHA 3LCWA 3D0CA 4RCXA 1JL8A 4YHEA 4ZVJA 3TMQA 3W1AA 2J75A 4FNRA 3FKKA 3NPXA 4FLRA 4IOTA 3KVJA 1EIXA 4E38A 1H61A 5HXMA 2YR1A 3G24A 3UY7A 4R7JA 3GK0A 4UR9A 4IPJA 4AB4A 1HKMA 1WDWA 2BHYA 3NVTA 3PM6A 1XYZA 3II1A 4DPPA 5TD4A 4HMDA 3S5OA 4E2DA 3PZQA 1FDYA 1JUBA 1OT2A 2BVTA 4B16A 2ZX6A 5D32A 2GUYA 3MMWA 3ARRA 4ML4A 3SW6A 1GOKA 4ZENA 1V0LA 4HZ7A 3PBUA 1O5XA 3W72A 1CENA 1HJQA 1UR0A 2VXNA 3AXXA 1XKYA 2EF9A 4CGTA 3PN8A 1MEHA 3G0XA 5FCZA 3P80A 4HTYA 4LNYA 1VB9A 1XSJA 2Q8XA 3HJZA 5FK8A 1X7FA 2G95A 2GJPA 1IXOA 5I3FA 4DWSD 3W75A 4YHGA 2PC4A 4ZE4A 3G1VA 3W27A 4UFKA 3W1TA 3L2LA 3VGDA 2CXGA 3AYRA 4GQRA 1JULA 4JTSA 3TTOA 3DKJA 1VEMA 1OT1A 3ALFA 1GNXA 3AYSA 3PZOA 1DJQA 2RDTA 5EBAA 5KZ6A 1CECA 5CZTA 2EJ1A 1IT0A 1N55A 2X8RA 5D8WA 3ZSTA 2IXVA 3L0KA 5I23A 4TIMA 4U28A 1ITCA 5GNYA 1KWGA 3NEVA 5M3WA 1CXIA 5A6BA 5F4WA 2DZTA 1WP6A 3CIWA 3NQFA 2V5BA 3KVKA 3FW6A 3N13A 2XTKA 1W5OA 3CO4A 2WO5A 4EIVA 4PSRA 3VMOA 2TMDA 3A24A 4LRTA 4OT7A 3EMCA 3CZ8A 5DT5A 1EGZA 5CZSA 1GOQA 1EDQA 3T2QA 2A0NA 3A5VA 1I45A 1V02A 2CKRA 4AEFA 4JKLA 3MO7A 3NQ7A 4RXFA 1BVNP 1KXTA 3GXIA 3KEHA 4V28A 5A8PA 4PCFA 1IIGA 2J6XA 1K8ZA 1EA9C 3VNDA 5E6ZA 3VIJA 1OK4A 3FHAA 1HO1A 1DTUA 4FF7A 4AHQA 4AISA 2NUWA 2Y4SA 2QCGA 4S2CA 3VIOA 4NZJA 2NWRA 1AW1A 1B3XA 1GVRA 4O15A 2VZUA 3WIJA 2RDUA 3AMLA 4AZ7A 1J0JA 5CZJA 5A1AA 2QCCA 2Y70A 3ARZA 5A6SA 2DSZA 3S6DA 1Q6EA 5HWJA 5DBUA 1BYBA 4FNSA 3EDDA 1MVYA 1VH7A 3HGOA 5K7JA 2E0PA 2A3BA 2YSWA 1JFXA 2QCFA 5HUOA 4DWSC 1M5WA 3LGEA 4UFHA 3WELA 3M43A 3EX6A 4FLSA 4HPGA 5A6LA 3ZR5A 1RVGA 4A2SA 3UG5A 3KWXA 1RQEA 5KEZA 4QITA 1UWIA 4Z2LA 1VBRA 2VEPA 5A6MA 1FCBA 3NCOA 2OYMA 1W37A 1KM6A 3QZEA 1J0YA 1NARA 1ZBWA 5F4SA 2X05A 4HPXA 1XXXA 4IM4A 1M04A 3KF3A 1UKTA 1DORA 2XG9A 1GTEA 1AMKA 3DHPA 3KAOA 4Z1AA 3VM7A 1JZ6A 1GOWA 2ZWYA 3BW4A 4MJMA 3A4XA 4TX8A 3WSUA 1V0KA 3QGVA 1VFUA 3W6MA 1NQ6A 3CHEA 3W1LA 4IMCA 1TCMA 4CU8A 1VPXA 1K7FA 3O16A 1S3HA 2A21A 3ABRA 4PL1A 4HSNA 3NJ3A 3U75A 1VRDA 1BWKA 1NAL1 3W74A 2X1UA 2XSAA 5CLWA 3ZT6A 1FCUA 2WVTA 4MTVA 3WMCA 4BF9A 3S1WA 4Q7NA 1KFKA 3EDEA 4HMEA 4ATWA 2BY3A 1HX0A 3L66A 1C9DA 1KFCA 1JVNA 4OGZA 3NL6A 4FK9A 3W7RA 4JFTA 5FKBA 3T0AA 2D23A 3RJXA 4JX6A 5CPOA 3W7PA 5AC5A 1WBJA 2W79A 3QHNA 2E4TA 5HDRA 1K8YA 1ITXA 4TUFA 1RD6A 4BWLA 2V30A 3UESA 5EMUA 5CSSA 3OBAA 3NSXA 1HUVA 4QDMA 5A69A 3VDBA 4AZBA 1ISYA 2QF8A 4E2BA 3THDA 2JGYA 3GXDA 1QMLA 2ZTKA 3ZT7A 2JBMA 5AFDA 3MSDA 3PTKA 4AZIA 1NVMA 2WSPA 1BYDA 4IUOA 1ODZA 3QMSA 3P74A 1X6NA 1MQQA 4A4AA 1TVNA 1Q6CA 4KFNA 1UQZA 2YIHA 1MO0A 3LRMA 2CPUA 4D6DA 1E1EA 1NOUA 3GNDA 3GYCA 3QFEA 4HOXA 3LX9A 5HR6A 5HQEA 2WZIA 2NSXA 4OBTA 2VC9A 4H7VA 3AIVA 3OLIA 1KV8A 1NEYA 3VMNA 3LIGA 3CEPA 2WKJA 3RK8A 1E73M 2ADEA 3EMZA 1FXPA 2VEKA 5BRPA 4GUGA 3A3HA 3M6YA 4TVDA 2GJRA 1GQJA 5LA1A 4WD0A 3T55A 2VZOA 2V3DA 1UJPA 3TW6A 2WW5A 4LXFA 4PN2A 1UUOA 2J9XA 3FA5A 2WC4A 2YDQA 1IF2A 2BY0A 4TVUA 3SCVA 3L68A 1L8NA 3RIKA 4W88A 3VUPA 3VIMA 1F74A 2X0HA 1KTNA 1UOKA 4M29A 1US2A 3NIYA 3GXNA 4O17A 1HVXA 3TTYA 1UR9A 3LLFA 4JTIA 5EY5A 1EP2A 5GQBA 3C2EA 3DU0A 3FYOA 2YA0A 4NRSA 4QP0A 4U33A 4PCSA 2Y8KA 3Q58A 1AW5A 1DBTA 2QUUA 5DY3A 3NL2A 1BFNA 4JYDA 3WENA 2WCAA 3TC7A 1KM0A 1W3LA 3OLDA 1FWRA 4RV8A 3CQ0A 1JNEA 1ISWA 1TPWA 4UNLA 3TCEA 1ZL1A 4KMQA 3NQVA 2D24A 3PY2A 5C2XA 2HMCA 3KFTA 1HF6A 1EP3A 1XH0A 3DFOA 1V3LA 2W63A 3CZJA 2ABBA 2XSBA 4RE3A 4K38A 5AHMA 3IJ9A 1I1XA 1HJXA 4PSPA 1E0VA 2ZXQA 1VYRA 4BK9A 2BXVA 1Q3NA 1R46A 1LBLA 4UFIA 3ARTA 1ZAHA 1J0ZA 3CHVA 4FFIA 4O11A 3WNOA 1SR9A 1OINA 2J77A 4PMQA 4GWEA 1GHSA 3C2FA 4HZ6A 3VGEA 4LVBA 3HMCA 4MKNA 3M5XA 2EPOA 2GSJA 4DM2A 1BGAA 4B1LA 3OVPA 2JE8A 3S0CA 3M44A 5I3HA 1PZ2A 3UG4A 4A22A 1QBBA 4RK8A 4I9AA 4OOUA 4HOZA 1ZAIA 3SCWA 2XN0A 4TX6A 1J01A 1GZGA 3OA5A 1TYGA 5E0KA 4IMEA 3TMLA 1K6AA 2D0GA 1JXKA 4FMVA 4LYQA 2GK1B 3PHAA 3VKKA 1F05A 5AYIA 2D3LA 3OG3A 3GNNA 4M7SA 3RCNA 3W73A 1V6YA 3NO5A 1W9DM 3OHIA 3O63A 4O0ZA 1F76A 3WH8A 1UQYA 4ORIA 1JRCA 2OCZA 3OVQA 3U1XA 1K7EA 4MVAA 3U5YA 3GB6A 1QBAA 2YDSA 3I3EA 3EXSA 1TB3A 3QQ0A 1W3IA 4K68A 3W28A 3PZTA 5K9XA 3CZKA 1Z41A 3BGJA 1V5XA 2YOCA 3SCQA 3E96A 4D6HA 2ATSA 1VF8A 2WVSA 1YQ2A 2WLZA 3WH7A 4Z2HA 3LDVA 3AQUA 3P81A 3SGUA 2CBUA 2XFRA 2A3EA 3R5EA 1FHDA 1Q6GA 1G1YA 2ADDA 1W3JA 4GPNA 3F1QA 1LL6A 3A23A 3LHYA 2P1FA 3L4VA 1XBZA 2PWDA 4P7NA 4TOQA 3ZJ8A 3NYZA 4UTTA 3JS3A 1MW2A 1WO2A 4AWUA 3W2LA 2VELA 1GVIA 3HJEA 4CN6A 2V81A 3AO0A 1WB0A 4TX9A 1GVOA 1V03A 4DBEA 2UV8G 1Q6RA 5HR7A 1BPLB 2CLIA 4LC6A 2PWFA 1K9TA 3GM8A 1B3VA 1QI5A 3VE7A 2NUXA 1TZ7A 3IIVA 4UFJA 3BSHA 1OF8A 3W70A 2YL8A 1XD1A 1GPWA 4O28A 5LZLA 1H62A 3R89A 3W2NA 1OGGA 4BQ4A 1YXCA 3EKZA 2OX1A 1VJSA 2V5CA 1HL2A 3DHUA 1AL7A 4FIQA 1D7FA 1E9LA 3K8KA 4OBSA 4IPLA 2X16A 3AI0A 3CUFA 1F5ZA 4JTLA 1UD4A 4KWVA 2VKZG 4FFFA 1D9EA 3HN3A 3FKRA 1L6YA 2H3DA 2ZRWA 5BNKA 3L4WA 3N14A 1LYXA 3P84A 5F2MA 3VO0A 4LPCA 4OWGA 3M7WA 1TPFA 1ZHAA 5HMSA 4NJJA 4KRTA 3WUFA 4U3CA 3UEQA 2YW4A 2YA1A 3VIFA 5AC8A 1RV8A 1UD3A 1DWGM 4ZZ9A 4Z1CA 1CGXA 1FDZA 5A6BD 2QCEA 3ZJKA 3O06A 1UCWA 1Y0EA 2CBVA 4GXPA 2QPSA 2V3EA 4XBKA 4BWLC 5M17A 4NRRA 5C6MA 5I3GA 2WVUA 4UMCA 2DPEA 5AC4A 3CUIA 4J3VA 1JQXA 4W86A 1C90A 2OYKA 1K02A 3M0ZA 4HU8A 1JDDA 1C8QA 5BRBA 1JXJA 3A6OA 1ALDA 4XB3A 1XV8A 4ZQRA 3VGBA 3LCLA 4K37A 3N2XA 1TPEA 1EP1A 3O9NA 3ZM8A 4N02A 2E6FA 2JKAA 3C4UA 1E0XA 3UXAA 4AMCA 2G97A 3SCSA 1XL9A 4DWSA 1GG0A 3I7QA 1E40A 2BHZA 5DCDA 2WOQA 4JDBA 3ARQA 3G3MA 3W7NA 2FLIA 3WDJA 2XPKA 3EDFA 5ANNA 4W8BA 4ZMGA 4O14A 2ABAA 2OWXA 1JRBA 5H2ZA 3QHMA 2ZUWA 1CGWA 4CD7A 3LCFA 3P5YA 4M82A 3HGJA 4GZEA 4H2CA 1CGVA 3G1FA 1AQMA 2XN2A 3DI1A 1OX6A 2VTFA 5DF0A 3AIUA 3WL0A 1W56A 1XSIA 3CPUA 2WAGA 3AIQA 1PPIA 2C19A 1UA3A 2EQDA 2WSRA 3GAKA 4AEOA 3W26A 1V7YA 3PB0A 4JTUA 3N11A 5I5RA 3LDRA 1XC4A 4M5PA 4LVAA 1WOBA 2WNZA 3NPVA 4IX2A 2XN1A 5LYRA 2E68A 3P82A 5CG7A 4Z2IA 1UUQA 1VENA 4W85A 5FMDA 4JEQA 1Y9GA 1QNOA 2ISSA 3L5MA 4U2YA 1UD8A 1U2YA 3DECA 2XM2A 1H7WA 3BMWA 4TTGA 1B9BA 4FIRA 1GORA 1K9FA 2JF6A 2IQTA 3M16A 4O1BA 4A3YA 1B3ZA 3FAXA 4POCA 1UKPA 3MHFA 1LLZA 4YLWA 3PULA 4AWTA 2HISA 1LRNA 4IISA 3HG3A 1MW1A 3EWZA 3GYEA 1ZBCA 3VILA 4JXCA 3DFQA 3STGA 3FYPA 2WCSA 2YDAA 2QMKA 2OZ0A 1QHOA 2XGBA 4EE9A 3MO4A 2B4GA 1IZKA 1OFDA 1E6NA 1BLIA 3EX2A 5CLTA 2E3ZA 3FJLA 1HJVA 2PBGA 1EPXA 4O4VA 1LBMA 3W37A 2A85A 1W3KA 3WK1A 5CGMA 1CLXA 1D3GA 5FMBA 4U2ZA 5DELA 4LVGA 4XUYA 3OIXA 1OSEA 1UH4A 1ICPA 1JG9A 1L6SA 3WDPP 2C16A 3DHDA 1DWIM 3LHVA 4UTIA 4LX4A 2QJGA 1ISVA 1U5JA 1KQZA 1XRVA 2VCCA 3PBVA 1PX4A 4AIEA 2CZEA 2F7FA 3G0UA 5EYWA 5GVJA 5HINA 2VO5A 1O7AA 2YA2A 3NPWA 3SSJA 4PMUA 4GNJA 3MP5A 3LEMA 1OHLA 1XUZA 4ZQNA 1X6LA 2ZA2A 4HNNA 1PIGA 2J27A 5F2GA 1Q6OA 1PE1A 4MJZA 4UOQA 1G94A 1JUEA 1PCKA 4GJ1A 4O57A 4QM1A 4AZZA 3KX6A 3W07A 1W9XA 3APGA 1ZFJA 4JQTA 1HO4A 3TKFA 2Z1BA 2WWCA 4D1IA 1FCQA 3AS1A 3U57A 2VENA 2QJHA 3MI3A 2Q3OA 5J5RA 1UZ4A 2JEPA 4JCLA 5E70A 3AMKA 5F1UA 1G4EA 1OFQA 3ZT5A 4EKJA 2WQPA 6TIMA 1LBFA 2BXYA 2ZUTA 4DPQA 4JR5A 3NL3A 1FY6A 4FX6M 5TBOA 3TV8A 2DSWA 1H49A 4M19A 1XCFA 3KRSA 3QPZA 4UFMA 3PBWA 1HNYA 3WH5A 5C71A 3L5AA 4ONVA 2Z6JA 5A2AA 4OE7A 4WUIA 3TC6A 3ZFHA 3UGFA 2YPIA 1DL3A 3ATZA 3W7DA 1BHGA 1NP0A 3DC0A 2BWGA 4WK9A 2A5HA 3WNPA 4CKQA 5G1TA 4QJ1A 3L0GA 1SO3A 2VFDA 3N9SA 5HJLA 7A3HA 3W83A 1ZB5A 2QQWA 3UWYA 3G1DA 2WMFA 1XC6A 1LG2A 1G7VA 3CZLA 3S8HA 3GH4A 4N9EA 4K7YA 4XQ6A 2QCHA 3A21A 1MQRA 2CKSA 2YKKA 4NF7A 5LA0A 4ZQPA 3GKAA 4B1MA 5ABFA 3EMQA 3NSNA 3CUGA 3QPYA 3W7GA 1JCXA 4TMBA 2V38A 3WKZA 1B0IA 3LCHA 1OFPA 1WNOA 4JHZA 4UR7A 4UNIA 2C14A 1BEUA 3USBA 4YXGA 2FQIA 1VFOA 1XDLA 1LQ0A 2W5FA 1ZY9A 1ZBVA 2CW6A 2J7EA 3AIEA 5C8BB 5A8MA 4ZQCA 4OIFA 2E6DA 4S3KA 2A1YA 5A8GA 1D2KA 1PV8A 2YZRA 4L4MA 1MYRA 3OIHA 3EXTA 2CCRA 4YN5A 1QNVA 1SFLA 3LIHA 4IWWA 5IBXA 2W67A 3POHA 2G3MA 3BAYA 3EX4A 3LCGA 3NQ8A 4Z1DA 3SR7A 4GKLA 4I7VA 4LUIA 3AZSA 2ZRZA 2CHNA 3EWXA 4S1FA 1W5QA 2EPMX 2G3IA 2JALA 3J7HA 1UD5A 2EPHA 2NXHA 2ZRYA 4FX7A 1SMAA 2EBNA 3P8IA 4JIPA 2OWWA 2B7PA 3VTRA 3AXHA 3O07A 3ZIZA 3VNYA 4ATLA 3G0SA 1TIMA 5AYBA 2VNCA 1M53A 4XZWA 2D3NA 2CETA 5JUVA 5DLCA 1SO6A 3UPBA 4E2OA 2ATMA 1QPNA 4WY0B 5FIXA 2D0FA 4HPHA 5AB3A 3JR2A 3IMMA 3W88A 2EEXA 4E0CA 3M41A 1W9PA 4PMNA 1E71M 3BK0A 2WNQA 4BI7A 1EWDA 3B9EA 2NW0A 3OZOA 3SI9A 3RMEA 1PHWA 2NX9A 3CIXA 3U8GA 2E8ZA 3MHUA 1B57A 2JK2A 1X8FA 3AMDA 2Y8VA 1OFOA 5EKYA 3ZS4A 2E77A 4LUJA 1VEPA 2C6QA 3AJXA 2VQTA 4HA4A 4O1AA 3STCA 4WLCA 5G2WA 4HNVA 4GFSA 2GQ9A 4PMZA 1EEPA 3GDLA 1EDGA 3UNDA 2ZUVA 4HMCA 1HKKA 3TR2A 1RZMA 3GBEA 1XDMA 2AEYA 5AHIA 2NT1A 1KW1A 1H51A 1GJUA 1DQWA 4WX2A 2NWSA 1H60A 4DF1A 1E6SM 1JZ3A 3Q2DA 3M5YA 3LFIA 2XVKA
chains in the Genus database with same CATH superfamily
1LL4A 5C7VA 2D6OX 3VD3A 3ZXDA 2ZFAA 1O4TA 4OMCA 3NDZA 3F2DA 1LP6A 4CDQA 1H1AA 1FMD3 5EJZB 3WBWA 2R1NA 2OKTA 4FS9A 2ZZJA 2BFUL 1L2UA 3BI3A 2NV2A 4GIYA 1JPHA 1KDKA 3MF9A 1K4GA 3RQ0A 1VFLA 3MI2A 3CB3A 1SJBA 5CH9A 2LUWA 4H7MA 4UTMA 2EG7A 5FL1A 5CEHA 1UD1A 3RZLA 1KD7A 4F2TA 1OH4A 1ADOA 3VU2A 1GQKA 2A70A 3VD5A 1DCSA 4LT5A 3W1RA 3GXPA 1LROA 1M03A 2BWAA 3U4SA 3ES1A 2QAPA 4GG9A 3GNPA 2XIOA 3RU6A 4DMIA 1LHNA 2CLMA 3V4BA 1REFA 2QDDA 3SLIA 1P0NA 4NHLA 1A3KA 3WJSA 3B8IA 3O14A 4MLOA 4D9PA 1DU3D 4CU9A 3E02A 3LB0A 3MIEA 2PLV2 1QNSA 4R53A 1EJVC 2QPUA 3OU8A 1TE1A 5D9PA 3T0CA 4LITA 1T6BX 1FPN1 4I02A 2PDXA 3CIVA 1ULDA 1VMJA 3UWUA 1S0BA 1H7PA 5EGRA 4Z1BA 3RM9A 2FDSA 3RU8X 2Y63A 1KFWA 1YDVA 4IGMA 4ERGA 3ARWA 3U0ZA 3TVAA 2R071 3CM4A 2PGFA 4IFOA 3W86A 3WF2A 4DZHA 1PS9A 3GU1A 4PCPA 1QDSA 4GI9A 1GW9A 4GUIA 3ITCA 3MTWA 1BAGA 3FHQA 3GH7A 5EPDA 4M4RA 2OW4A 3PANA 4JYEA 1GVFA 1CIWA 3USUA 2WMGA 3OHMB 2VX5A 4GALA 3RDIA 1P1MA 1ONEA 1E5HA 4Y1VA 1YQ6A 5A3WA 3TCSA 1BQGA 1ADDA 3MLKA 3D0JA 4H6KA 4E8CA 3BOFA 4WXYA 4C6EA 1LJYA 1D4M2 1XGZA 4KWSA 3H21A 2VGGA 3OG2A 3L0NA 3OP2A 1C91A 3RZKA 3A9IA 4U2AA 3VCNA 5LZ6A 3H2NA 3IPVB 1DP0A 5FQ0B 1R091 4LQ1A 2F6KA 1V0AA 2DGAA 1ULPA 4QDSA 1QDCA 1MFVA 2HLEA 2R8WA 4BKNA 2V2CA 2QMJA 1V3IA 1VJZA 2YFNA 2ZOXA 4QX2A 3W1NA 1F6PA 4JS3A 2OQLA 1IE7C 4I2OA 4QJ5B 3U07A 1D3HA 4WXZA 1EGMA 1A3WA 4GVGA 3QTGA 3AYAA 4B2DA 1B9ZA 5IOBA 4RFT0 2B7OA 3RUBL 2ZX8A 4LS1A 4BK5A 3R43A 4Q4V2 1V6NA 1AW2A 3HF3A 4MWAD 5EMMA 4WVZA 1Q8AA 4PMRA 1EY2A 1DGRA 5DZGA 3CNAA 5PTDA 4WV8A 2KAUC 4IE7A 4ISQA 1NU5A 5FYIA 3G6LA 4MNMA 4HN1A 2UWAA 2ZTJA 1YXYA 4S2HA 2HWD2 2VNVA 3W2JA 5FZHA 3BOPA 5LHFA 5FOOA 3V0AB 2GVLA 2POTA 5DMYA 4AI3A 4DJEC 2OEKA 3O12A 2DCTA 4Y4RA 1VJ2A 3QCWA 5DG1A 5XIAA 4W7UA 1WZMA 5DCEA 3V36A 2YBKA 3E2VA 2BNJA 3DOPA 1A5MC 4GQGA 3ZYJB 1QNPA 2VUNA 1Z7S3 5T52A 1RA5A 2BXZA 4J27A 4YVXA 5BV6A 5FKCA 1B3WA 2NLIA 1IQ8A 4UQDA 4KU7A 3VOHA 4N9IA 4LVFA 1FOD3 2JEQA 3RFAA 3RILA 1O12A 1JCMP 2E9BA 5CBIA 2OJPA 1XJBA 2GFTA 2CLFA 4QPIA 1VEOA 3MVIA 4TV6A 1K70A 2UY3A 3CLWA 3HO8A 3W9ZA 1NKGA 1H5VA 3WF4A 5KTLA 1T99A 3WD2A 2WLYA 1W8HA 4J3UA 3AL6A 1IWAA 3H70A 4F83A 4ZQMA 2Y7DA 1RPKA 3PJWA 3LAGA 1LGCA 3LV6A 4MH0E 1ASJ1 1EAH3 2CLEA 1P1XA 4DHGA 4F0MA 4XFAA 1LRHA 1SFNA 2FPYA 3RSJA 3T2OA 5CKNA 4UTHA 1MFUA 1ZCCA 1LWJA 1MS5A 2HSAA 4GH1A 1I6NA 3CEUA 4QD2A 1FPN3 1ME7A 2FFIA 4JHOA 4O50A 2BU9A 4DOUA 3OQEA 4REQA 2Y6FA 2WNUC 4Y3OA 5LHEA 1A5AA 1FI2A 3E5XA 4C6BA 3ZXKA 3NKGA 2AL1A 3VBUA 4PHZA 1KGWA 1OQFA 4EOUA 5JSRA 2BFGA 5F5IA 1ZBA3 2KZHA 3MWAA 4LBQD 1VAMA 1WDPA 2VEFA 2W62A 3WFZA 4BY3A 1HFBA 3MKKA 1H6XA 1MW3A 3PURA 4QQHA 2HVNA 1OMIA 4DXZA 4WJEA 5KXEA 1AYM2 1J84A 4H01A 5H91A 2YUEA 1VIWA 4E4HA 3MS8A 2ZICA 3L23A 3WDVA 1YYAA 4J2MA 4HKPA 3OSDA 3D6EA 2J22A 2C91A 2Y6KA 1H9PA 1HJUA 5C54A 3U4AA 3K46A 3T9PA 1IZJA 4MGQA 1XIIA 3WJWA 4UTWC 3SCFA 5G1YA 1XIBA 2ANUA 1AZDA 1RC6A 4X2RA 4WZFA 3DN5A 1XYAA 1UIOA 1ND2B 3B8VA 5DMMA 4PI2A 3TC3A 5IVVA 3VOIA 5GLWA 1D3CA 1LHOA 2HEWF 3V0AA 2V5KA 4JHMA 4X3ZA 4YZ1A 4IPIA 1ECQA 1SR0A 4FALA 1YUDA 3X29B 3QBUA 4AD2A 4H9MA 4F3JA 1FH8A 4CNUA 4P7LA 3VIHA 3N4EA 2JIJA 1Y7VA 3UR8A 4IX0A 3M7AA 1K4HA 2W95A 5FY1A 3TX9A 3GFYA 1YI7A 1UOBA 1G67A 1R3YA 4C0BA 1XB9A 4PYSA 4Y22B 3PUGA 1BKHA 3FVMA 7CGTA 3GZEA 3VPLA 1O95A 1M7PA 5EHDA 1ZZ8A 1SUXA 2CLPA 1MSSA 4HYRA 3YPIA 1LOGA 3R4SA 4XKYB 4CNTA 4I8YA 3NAPC 3LOIA 5L7OB 4IGOA 3WLOA 2XLGA 4W7VA 1UO9A 1UXXX 3W7KA 3RG0A 4XAPA 2P10A 1LT7A 1O1ZA 4YZ2A 2R14A 5J8LA 1ZPTA 4XD6A 3FLRA 3OW1A 1GHRA 4P14A 2AL2A 4DUVA 1N82A 2D6NA 2E6VA 5JXQA 1TJRA 2JKBA 2Y8UA 2PP3A 4E8GA 2ETEA 3O0VA 5DAQA 4MB3A 2GP5A 3LDBA 1H0IA 3KVBA 1LTDA 3DHFA 3QV8A 1VB4A 2TBVA 2AAAA 4YTUA 3ZYFA 3ZPOA 3O3RA 4QAIA 2F2KA 1E57A 1DFQA 4MNLA 2OPKA 2YXGA 2XWEA 3AWOA 3O1NA 5F2WA 4EE2A 1E51A 4K8HA 3ZKYA 3LSBA 2WBKA 4XQ4A 4ZCWA 3BU7A 2DH3A 2ZRXA 4LPLA 3J7NA 3N3HA 4OI1A 3ACHA 3ZLFA 4H19A 3VXGA 1H5YA 4CRQA 1JD9A 4UQ9A 3CTLA 4FO4A 3IUIA 2RDXA 4FZIA 2Y64A 1YNAA 2WZR3 1G69A 3H2EA 1LLWA 4I30A 4ET7A 4MHBA 2QR6A 4JTOA 4BQ2A 3AS2A 4XZMX 4CQ9A 2DIKA 1NF0A 1Y7BA 2VUCA 4P9YA 1G9AA 2OWCA 1LECA 3CQHA 3WDUA 2NQLA 5A33A 4JQ3A 3CT2A 4K8EA 4YPJA 3BV7A 3VBRC 3WXPA 3P0WA 1IS3A 3AB0A 1CGTA 3POWA 3ZO0B 1XNKA 5GNXA 2PGWA 2EJAA 3NNGA 4KCUA 1NWUA 2I14A 4R27A 3LGDA 3SQLA 1CI1A 5AFBA 2CDPA 4O19A 5BXRA 2DV0A 3VZOA 4Y1ZA 2BGPA 1UKOA 3A3XA 5K0UB 3B03A 3O0FA 3VNIA 1SHWB 5TIMA 3LDKA 3S57A 2PDHA 3AXDA 4JHTA 3S5QA 3BSGA 5CGTA 3M0MA 4AH7A 5EFUA 4MV2A 4NZ5A 4BF5A 2XMLA 1ASJ3 4MGKE 3VGFA 4CD5A 3WQ6A 5HPOA 2OZ3A 3ZDVA 4M4PA 3WDIA 4JRAA 1CXEA 4J28A 4LAOA 4LV4A 4AHWA 2P34A 3NV4A 5FY0A 2HJPA 3W7HA 5G4HC 3ZR6A 4FAMA 4L2NA 3WLTA 3CQOA 4JD4A 4B3KA 2ZQ0A 3M3QA 1AZ1A 1S46A 2QEZA 4CN4A 1V6WA 2EPLX 3OGSA 3OPSA 3M47A 4MMWA 5AKQA 2ZC8A 2WPBA 2OIIA 4BQWA 4EVZA 1Q5MA 2V5YA 4NAFA 3EX1A 4NXKA 2ZGLA 3UJ2A 4U36A 4QCFA 3O5SA 3H2AA 2XUEA 1O1HA 5BRQA 1KBBA 4BXFA 3Q8BA 5C9ZA 1NUKA 2X53S 3TTSA 1JYWA 4MAVA 4R34A 5EMLA 3URNA 4AX7A 5JXJA 4GQQA 3ARVA 1G4TA 1QQP3 2GOUA 3D5OA 4CDUA 1VKFA 1W6OA 3GQYA 2RS32 2I5IA 1LOEA 4K7VA 3VKFC 1YTDA 2PDQA 2OZ8A 4DXSA 3AKPA 4TMCA 2FDKA 1GT8A 4OTKA 5HUPA 2RHGA 4LO4B 3I54A 2V82A 5D2AA 1Q45A 5JZGA 3AROA 3W71A 4D1JA 4H8VA 1CYGA 1TV7A 1W6QA 1NXD1 2RGLA 2FHCA 1UD2A 4JQ1A 4B5NA 4EK7A 4HKOA 4F8AA 2DZPA 3VGIA 5DT7A 2J42A 2G37A 3URFA 2PHWA 3CHXA 3H53A 4GXWA 1FFQA 3T8LA 3MF6A 2HE8A 4H9XA 4LB3A 4NNCA 3C0SA 3UYCA 2WWUA 4RS5A 1DQ0A 2PE4A 1IEWA 2O8OA 4UTKA 4BIOA 3S5SA 4FAHA 1J0KA 2EPNA 1EXPA 1C1FA 2GSYA 2UWCA 4CA9A 2YL9A 2OB3A 4HYVA 4ARYA 1PIV3 4XHBA 5JZGB 3HPXA 2YLLA 2PRHA 1Q13A 4IMDA 4JTGA 2YY1A 4F66A 4UUIA 2JG9B 1VPHA 1Z42A 2VZRA 2C1IA 3VKJA 3KBNA 5CADA 1B09A 1VBB1 1GG1A 2IZWA 2BGQA 1BXCA 3PZMA 3NUKA 3OYZA 3N12A 5G04L 2DVAA 3TIMA 4B15A 1WW4A 1ZCOA 1P0KA 2HXTA 4G6CA 1C5IA 2C79A 4AHYA 1Z7S2 2VEIA 1RUC2 4Y9OA 3O1UA 3W24A 1J0HA 2J13A 2OOGA 2FHFA 4JL1A 2PWVA 4G9PA 1X7NA 5FOJB 1L8PA 2CZVA 3IVUA 2WK2A 2D20A 4HD5A 4MZYA 3KTSA 5JR2A 3KM8A 1NWTA 2A6VA 3M3EA 4CDXB 3RZHA 4DX3A 2JF7A 1L6GA 1T2XA 2G8ZA 5AYZA 2UY9A 4AD1A 3QSRA 2WR9A 2H6RA 3FXYA 2JG8A 3IV8A 4NJ4A 5FXVA 3BW2A 4WSJA 5FXXA 2J62A 1JGIA 4UTWA 3HB9A 3U2ZA 1WX0A 1YQ8A 4IEWA 1I1WA 1ZQ5A 1CPMA 2QYGA 3LD8A 5FMCA 4MZ8A 4FHAA 1VBE1 2J1RA 4QG6A 5CC5A 5T5JA 2VMIA 1W17A 2PTDA 4J9JA 1SU5A 3RAOA 5FY5A 2XFYA 2J7MA 2ZGPA 5FAGA 1R1A1 3IEBA 5A94A 5AVNA 4C6CA 3QH2A 1J59A 1OD0A 2DTYA 3KL3A 4HA1A 2D93A 4MZ1A 1A5OC 2YW3A 4MWAC 3U3HA 1A3XA 1NT0A 3O7UA 2R1KA 5D9OA 1IG3A 2MPFA 4EWND 3DDMA 1OVSA 3WBAA 3N9NA 4LHLA 4HETA 5C55A 3R0DA 3L5LA 5CPLA 3HEIA 4HPJA 5KETA 3FLTA 2DZUA 3W2MA 3UPMA 3BICA 1FWJC 1IPKA 1ZA7A 3H3ZA 5EA9A 4MIMA 2DJLA 1AX1A 4ZFCA 3CWOX 2XBO2 3C3UA 4WM8B 4RE2A 5FJPA 1LCOA 3WP5A 1JDFA 3B69A 1BTCA 2I7GA 4KEVA 1QJY2 3P93A 3BAWA 1H41A 3UXDA 1LORA 1SPPB 3TQKA 2VVDA 1QOXA 4BCEA 1BEV3 2X5IB 3INPA 2WO2A 1E55A 3VBHA 1H50A 1UR4A 4DWSB 3THAA 1F8IA 1S2CA 1VBUA 3KZ4C 1UA7A 4DY5A 1JTZX 2GWGA 5A2BA 1RCXB 3GVGA 3S7EA 3BOWA 2PDLA 3EWYA 3SH5A 1RAKA 4JKMA 1YQ5A 3MSGA 2R0HA 3EB4A 3T08A 3GJBA 5A32B 4O53A 4C5YA 3PPFA 3VHPA 2OX0A 2D44A 2VFHA 4H8HA 2GN7A 1Z0HA 4NWWA 3WEOA 3AFKA 1ZP3A 1LU1A 3ACGA 2RFGA 2J7BA 3H1YA 4CEWC 1SZFA 1W2TA 3BTYA 3IB3A 4PI0A 4B5XA 3W3OA 4RQPC 3G1XA 2BTMA 4SLIA 5CFDA 4LS0A 3CPGA 3O6YX 1OD5A 5M5DA 1RUE2 3P3NA 5FZ1A 1GZTA 1R8LA 4PIZA 3RWKX 4UTTC 4LLFA 4GD0A 3O6DA 1BMV1 2HRWA 4IXHA 3STFA 2JG9C 2WMHA 1QPKA 5CPTA 4D2JA 3E5QA 3M0VA 1TTPA 2BZDA 2E09A 3TE9A 3SUUA 5I78A 4OUEA 1E9YB 3RLHA 2CBIA 2C1FA 5DQPA 1G9HA 3DV8A 3SZ8A 5A5WA 3EB7A 4NJIA 2Z25A 5FBZA 3I59B 1MI3A 1GP5A 3UD6A 3OZPA 4HNCA 2ET1A 2HEYF 2JB8A 4WVMA 2D6KA 3R4DB 1QJY3 2WT1A 4A8RA 1SZGA 3PWIA 2QUOA 2JJ6A 2B0MA 4XAFA 4YIWA 5ABTA 5G5IA 4CDWB 2W2IA 2EHHA 3FEMA 4WOZA 4CN1A 4KIRA 3P0XA 1ECEA 4HU0A 1W32A 3N3MA 5A6KA 1KBJA 3ALQA 3IS4A 4NZ1A 1G9DA 5EB8A 1RUG2 2VE1A 1I0BA 4QXHA 1CGPA 4ZQOA 4I9JA 4R9AA 2C0AA 1BWLA 1OABA 4Y5TA 2WNOA 2O7SA 5FCCA 3LHTA 3F5JA 2ACQA 1RUJ3 4S3JA 2REQB 2D2OA 5I3KA 4XFIA 2AC1A 4NRPA 1U5IA 3VABA 2A7RA 2BVWA 4XEZA 3I65A 3WDRA 2HBTA 1RJ7A 4A42A 1HRI3 1A0DA 3NO1A 3KZSA 4JTFA 3D3AA 4QBXA 1AJ0A 5C3QA 3ZJ7A 1MZHA 5I79A 3PIJA 4NJGA 4GH4B 3JZUA 1XCXA 4ZU4A 1LQAA 2C71A 4AHPA 4IEXA 2INEA 5EMKA 4MWAB 1RXGA 4B9YA 1EJXC 4OV4A 3J26N 1CD3G 4QPGA 3A9BA 2J9YA 4QX4A 1E5NA 3URBA 3ZQ9A 3O2LA 3IJ8A 3SGGA 2ONEA 2PURA 3PUOA 1UPIA 1ICQA 4XKMA 5IHSA 1E1FA 4PL2A 3T09A 2A6NA 3AYTA 2A6YA 1VC4A 5HANA 5I7GA 1XJAA 2IKHA 1EOMA 2PTMA 2FDFA 3ARSA 1YO8A 4Q4PA 1K3UA 3W1XA 4COZA 3MP3A 5E16A 1GWLA 4QU1A 3MUIA 4ROPA 3W02A 2CL2A 2Q1ZB 2PB1A 1LHWA 3KP0A 1KJLA 3EAUA 4Q0UA 3NZRA 4MKSA 1GYKA 5BWAA 3BCDA 1JBCA 3HMJG 4B5UA 4PDWA 6PTDA 1BEV1 2Y61A 5BCAA 4R85A 1OUSA 3E0VA 1O4UA 1QR7A 4Q4Y2 5F8PA 1AXKA 1E4NA 3N4MA 2HDJA 2WWJA 3ARXA 4Y7EA 1EUAA 1PX8A 3TZFA 1UMYA 2J25A 3KHCA 5D4YA 4FOJA 1R64A 1W06A 4WVWA 5I91A 4AOCA 2G19A 2W1WA 1AYN3 4IUGA 4XUPA 5AN7A 2G4IA 5A95A 2MNGA 4O4WA 4MJ2A 4EZHA 1TMQA 1E0UA 1P6BA 4PBFA 5IK4A 4J25A 4YG3A 5E6YA 1KITA 2QQIA 1O3TA 4NJHA 3FJNA 3L65A 5CZKA 1I75A 4YVSA 5IVJA 5A6JA 3AZXA 4LQRA 2X7WA 4X0NA 3VFCA 2CWXA 2F6UA 3E0FA 4L99A 4PR4A 2G3JA 2R24A 2Z6IA 3U7VA 1XNTA 3H2FA 1C5HA 1GWJA 3S9YA 5T5OA 1W6QB 1UWUA 3E0LA 4M01A 4YTRA 3ZFFC 3K2GA 3AP7A 5JDBA 3CB8A 3O05A 2SBAA 2EG6A 3AIRA 2J7FA 3UP8A 3FXGA 4BA0A 2VNGA 4JTTA 4UW3A 3K4WA 3IRDA 2ZZ5A 5A2CA 3PFMA 2FIQA 3B94A 3I68A 4X6RB 2FZ2A 4KCVA 5HWNA 4WKAA 3GVQA 4GI8A 4N7UA 4HN4A 2QLYA 4AZCA 5KZDA 3CC1A 5IATA 4GH4A 4LJ3A 1KXHA 1SYTA 3MU7A 3PNAA 1W6TA 1ONXA 1DXFA 2W47A 1X98A 3M64A 1RJ8A 4DI9A 4NRMA 1THFD 4G4FA 4QPYA 1U5XA 2PYTA 1TUFA 2FDGA 5T5PA 1HB2A 3CQJA 1E6XM 4J3WA 3FLUA 3FIGA 3MDUA 3NL5A 1VLNA 1KXQA 1FCVA 2VOTA 1SLAA 5FMOS 2VMFA 1QWGA 5IRPA 5C8CC 4B91A 4BF7A 4DZGA 5AC91 4WJXA 3IUHA 4PUEA 4F0KA 1R85A 1C1LA 3SH3A 3SISA 1WMFA 4E8DA 1ULOA 1NDYA 1VAHA 2C26A 4Q8MA 2X1IA 2WAAA 4YSFA 1TJPA 4C65A 3NAVA 2GJXB 4GRSA 4ARXA 3RX2A 1TMF1 3N34A 3OQ8A 4CEYA 2RUSA 3VNKA 3VCCA 2BNMA 5CG0A 1CJDA 3IGUA 4LBNA 4OQ8A 5FXZA 4OULA 3RPDA 4M3PA 5JR7B 4AY7A 3R0KA 3UR5A 3MANA 5FPVA 5KMYA 1QXPA 1V3JA 5KHHA 3M8LA 2CU0A 4D72A 4TVCA 3WLKX 4UCFA 2V4AA 4H4IA 4RL3A 1KXGA 4ATEA 4GISA 4PTMA 4OVXA 5T91A 2E7AA 3V56A 3CXOA 5FZMA 2AMGA 1FKWA 3AHZA 2BUKA 4YCOA 3TNBA 3UWVA 1OUXA 2WNVC 3REQB 1RUE3 3BARA 2WN3A 3DPRA 5LBCA 4LAKA 1BLZA 1D0HA 1HB3A 1TPC1 1B3YA 5FO8B 5AYYA 3NNJA 4WDUA 4YTSA 2P3JA 3CH0A 1CAWB 4RE0A 1LQ2A 1PVC3 5E5CA 4RV3A 1XQNA 4IIEA 2E6AA 1HX6A 3PUSA 2Y26A 3L2MA 1DVJA 4FLQA 3NL1A 3SQSA 4ASLA 2W61A 3C8FA 4GWIA 1CNVA 3RZZA 3LTYA 4PCRA 4FI9A 5KINA 1NE4A 1VAKA 3MUAA 4Z07A 2BASA 2FPTA 3Q65A 4DUOA 1VAVA 5HV0A 2DZSA 2BV4A 3NQBA 1YNQA 1XE7A 1JZ7A 4JAWA 2POZA 3RITA 1G9CA 4LUSA 3PUAA 3QKEA 5BNNB 3UBPC 1PGSA 4YM0A 1B30A 2WSYA 1KFUL 2AUYA 3RN6A 2MHFA 2HWF1 4WOQA 1RLCL 3FNDA 2CLLA 1HXS3 1IQDC 4YJ5A 5C2GA 1JEZA 4W6XA 4HSHA 1L2QA 2GQ3A 1RUD2 4XW3A 3ON7A 2VFFA 2CZFA 1A50A 4HP5A 4GO8A 1RLDA 1CBGA 1L7RA 3WN6A 4IQLA 2WANA 2GH2A 2WNEA 3RYSA 3DEQA 1KGUA 1HXJA 3GALA 1H9WA 1IS6A 3LHUA 5JAXA 1QDOA 4UYBA 1UH3A 4I0AA 4DBDA 3ZFEC 5FREA 4OBRA 5AC6A 4S23A 1N1VA 3SJ3A 3TWIA 1RXFA 4A7YA 3LFMA 3SDOA 2Q5TA 1UOFA 2PRLA 2ZA3A 1OCBA 4JGDA 3ORWA 5F3GA 1AR62 3L4TA 2DCJA 3BGAA 3RLVA 3B05A 1EDTA 3LQLA 4B5WA 3NM3A 2P0IA 1A5CA 4W5UA 1MDRA 4Q4QA 2VU9A 4O8AA 4S3EA 2Z27A 2JDZA 3T8QA 2WMJA 2EKCA 3IPVA 3OY8B 5BXSA 3L4YA 3AXIA 4IIFA 4UMAA 3PTRB 1K9EA 3THCA 4HMNA 2ZX3A 1PWMA 2JKPA 4NX0A 3ZSLA 3APBA 3BG5A 3D6NA 3TYDA 4Q0SA 3GG1A 4PGLA 1R47A 2FDJA 3CEWA 1HP4A 1KGYA 3KD4A 1XW8A 1UZ1A 3VCRA 2PDMA 3AVRA 1M01A 2MUCA 4XF1A 3N73A 4HNTA 3W7CA 2BOFX 3OJGA 3VOCA 3WLJA 3QW4B 4EZ4A 1GOXA 1H09A 3CQKA 3UZZA 3W81A 1MEWA 1H1NA 5L73A 4F4RA 1V3MA 1PX3A 2VR5A 4HSJA 3NM1A 3BAIA 1O60A 3E2QA 1E72M 1EV11 3K8LA 2BDQA 3WQWA 4B9ZA 3FK4A 2WVVB 3J9SA 3NQHA 2FCTA 1TFVA 2C18A 2RGMA 4Y1UA 3S83A 4P9LA 4N9HA 3OUIA 3F4CA 2WS91 3POIA 4XF9A 4LRSA 2JGQA 2TAAA 2PWGA 1R083 1RHI2 3OA3A 4PB3A 1YADA 4DQAA 2VX4A 3WDHA 4JTHA 3KWVA 1JL8A 3AYVA 1ZBE2 1O3RA 4S38A 1UP3A 3MDWA 3JBG2 3KVJA 4E38A 4LYKA 5HXMA 2H6CA 4LHSA 3GK0A 3BPZA 3SSZA 4KESA 5FYZA 1FATA 1MZ5A 1S0CA 4HMDA 1BXHA 3UJEA 3TQPA 1OT2A 3E5BA 4LBRA 1JU3A 4QS5A 1X50A 2GUYA 3ARRA 3MMWA 2ZEYA 1GOKA 1V0LA 4G2DA 1CENA 1O5XA 3W72A 1XKYA 2EF9A 2X40A 4GK8A 2N7GA 4EYUA 4Y4YA 4NN0A 5HBAA 5T50A 3FUQA 1W2NA 4P5UA 2OXNA 3H1WA 5I3FA 1EP0A 2I56A 3AYEA 5C9AB 5GZCA 5FOBB 2WZPP 5FDBA 3L2LA 2OGYA 4JTSA 3TTOA 3DKJA 1E5SA 1VEMA 3TYCA 3AYSA 4LOTA 3PZOA 4FQ4A 4F0SA 3IDAA 5EBAA 5KZ6A 1CECA 2OOFA 5D8WA 2GDFA 4JTAA 1JYCA 4K8GA 1TNRA 4TIMA 3VL9A 4U28A 2ZPXA 5M3WA 1CXIA 1EC8A 5A6BA 4CQCA 1XLMA 2V5BA 3NQFA 3N13A 3CO4A 2PAJA 4WHBA 3G6JB 4LRTA 3EMCA 1UMLA 3OBRA 1GOQA 3LY0A 2CKRA 4AEFA 4AR2A 2GUBA 1RVF3 1DDLA 3MO7A 4V28A 1NX9A 1W0PA 4W6YA 4CXXA 2HZGA 3QTPA 4AVAA 1IIGA 2J6XA 1EA9C 4XVDA 4JTNA 2JDHA 4AHQA 5FP7A 4QRNA 1B3XA 4YG0A 1GVRA 5CBBA 1J0JA 3W9AA 4C60A 3E97A 2Y70A 1MUMA 2VP8A 4US6A 5DBUA 5FZBA 3HGOA 2DF7A 2PLJA 3S30A 2QCFA 3WD5A 5HUOA 3GU9A 4IEYA 3LGEA 3C0LA 3H2OA 3UG5A 1LOFC 4A2SA 2EALA 3KWXA 4C6MA 4QITA 9XIAA 4QXIA 2WIIB 1WZXA 1W37A 5FZ3A 1Y5XA 2X05A 1XXXA 1UKTA 3NO3A 3R6IA 3CZUA 3TBDA 1AMKA 1JZ6A 4XBLA 1GOWA 4B4QA 3A4XA 3U4FA 4QKDA 1OVPA 3QGVA 4P9GA 1VBB3 3G5EA 4KL1A 1S3HA 3H1MA 3ABRA 2XJRA 4AFAA 4PL1A 4HSNA 5APAA 3M0YA 3ZT6A 4MTVA 2PXJA 4LR4A 3DX5A 4ATWA 3L66A 1UR3M 4BEQA 2REQA 4RW5A 4OGZA 4LULA 4JFTA 3W7RA 4KS0A 3T0AA 4META 2D23A 4PMJA 3RR1A 3T0TA 3THTA 1VBE3 1Y5WA 4QJ4B 3ZFGC 1K8YA 4TUFA 1IG0A 3UESA 2DYCA 5CSSA 3IBMA 1ISYA 3MIDA 1KRMA 1DE6A 1I0DA 3GXDA 3O7OA 3F4DA 2ZTKA 3GR4A 3ZN4A 1NVMA 4GX9A 3ATGA 3QMSA 3TN91 1X6NA 3R94A 3GS6A 1LHUA 3WX5A 2YIHA 4E9KA 2CPUA 3LRMA 5FO7B 4ZONA 1NOUA 3GYCA 2WZIA 4U10A 4NI8A 4OBTA 3T1GA 4H7VA 1NEYA 2XQXA 1DHKB 4C1NA 2P3YA 3EMZA 2VEKA 3A3HA 1PO11 2GJRA 3CV2A 1UJPA 1UUOA 3FA5A 3SCVA 5FJRA 5BNPB 4V1YA 2PU1A 4W88A 5CFCB 3VUPA 1F74A 1UOKA 1OXCA 4O17A 1R1A2 3JB8A 3SN4A 3T42A 3LLFA 5EY5A 2ZAAA 2B5HA 5KR7A 2YA0A 1R082 4QP0A 2Y8KA