4CCDA

Structure of mouse galactocerebrosidase with d-galactal: enzyme- intermediate complex
Total Genus 220
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
220
sequence length
644
structure length
640
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Snapshots Illustrate the Catalytic Cycle of Beta-Galactocerebrosidase, the Defective Enzyme in Krabbe Disease
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
total genus 220
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ccdA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ccdA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ccdA01
1FDYA 1E5NA 3ARYA 3CEPA 4DPQA 1JCJA 3MMWA 3UR8A 3W0KA 4GBUA 4IX2A 1MQPA 3G1SA 3AIVA 3EDFA 1UKTA 2A4AA 1BYBA 5AYZA 1TTPA 2G8ZA 4LYQA 4NF7A 3ZO9A 4O4WA 5I3KA 1DEDA 4HZ8A 1WBJA 1K7EA 4LXFA 1SZNA 5E93A 5D9NA 1K6AA 2CLOA 5A6KA 1UWSA 3NL6A 1OT1A 1CYGA 1C7TA 2DQXA 1SW0A 3QHOA 1OK4A 4Y90A 2BS9A 4R5EA 3B9DA 3S6DA 5LA1A 5E0FA 4D6EA 4ACZA 1W5MA 4UMAA 1JZ6A 3AYSA 5CPQA 3N73A 2ZCGA 1P1XA 5E0KA 1TUXA 1QWGA 4ATLA 4CNPA 1ISZA 5A6LA 3V75A 1LROA 2D20A 2Y6ZA 3PSWA 2UY5A 3HJEA 3OIHA 1X1ZA 4E2OA 4JICA 2J7EA 4H4IA 1GORA 3NCOA 4UTFA 4TX6A 3SUSA 1TPC1 3B0PA 3QM3A 2D2OA 5K9XA 4XV0A 1R30A 3A5VA 4LC8A 5IFTA 3UCQA 1ME8A 2CU0A 4QCEA 3WNPA 1ICSA 1A5SA 1RH9A 3W7NA 3LGEA 1MZHA 4J28A 2HISA 1LZOA 1OX6A 4QJ1A 4EF8A 3CLWA 1U33A 2GK1B 3B8SA 2V30A 1J0KA 4TOQA 2JGQA 4RR4A 2PB1A 4X0VA 1C3FA 1WAWA 1JZ2A 2XGIA 3K8KA 3WMCA 3DYOA 1GTHA 2FTPA 1MXGA 2EPOA 2V3FA 1VEOA 3BAIA 3HBKA 4FNSA 2VCCA 5A1AA 1OFPA 4UFKA 1TYGA 2V81A 4OGZA 3R8RA 3MV11 5C70A 5U4NA 1OFOA 2Q8ZA 2X1UA 4J9JA 4B1LA 4HNNA 6CGTA 1XDLA 2I1OA 1RQEA 4O19A 1BG9A 1KBBA 3FW6A 4EWND 3ARXA 4LX4A 3ZT5A 3NPVA 3NQEA 5LGZA 2BY0A 3N18A 3W25A 4HNTA 1GQKA 1B3VA 3WFLA 2P10A 1WA3A 1WX0A 4LW7A 4EIVA 1O95A 4NX0A 3PWAA 3FIGA 1B4KA 4E2DA 3NOEA 3HPSA 3DI0A 3DFQA 4MPKA 5HR7A 2FGZA 3GNOA 3NMBA 4EVZA 5BROA 1UKPA 1G9HA 2QCCA 1W1TA 1VLWA 4OUEA 3ZJ6A 1ML1A 5HXMA 3NPWA 1UUQA 2Y24A 3ATZA 4N9BA 1UUMA 3LDVA 5CPOA 3W7JA 4O18A 2FLIA 1TJRA 1EO5A 2GDVA 1XSJA 1H09A 1B0IA 2LLEA 2OT0A 3CUGA 1L9WA 3KF5A 4KFPA 4JHOA 3PZGA 1F6PA 2WSQA 4AZGA 1XCWA 2A3CA 2UY4A 1E6SM 2QJGA 1LM1A 3IIXA 3ZQ9A 3AHTA 1M6JA 3CZKA 3RCNA 3UR7A 2P1FA 1ALDA 2PC4A 2TSYA 2ISSA 2WNZA 2WCGA 3HF3A 2B0MA 1ECEA 1UYQA 3NUKA 3H54A 3FYOA 1FH8A 2CEQA 3Q58A 1B30A 3APGA 2ADDA 2RDTA 1FFRA 1OSEA 2RH9A 1EHNA 2ZX8A 4YN5A 1QNPA 4PBGA 2AQWA 1QFEA 2V2CA 1N55A 1BG4A 1Q4NX 4JS3A 3GXIA 1Z48A 2V5BA 4OE7A 3ABOA 4K37A 2WVVB 1QOXA 4AISA 5D05A 2CKSA 2VMFA 1XFBA 4MB4A 2AEZA 1UASA 2GPTA 3F1QA 5FF2A 1HP4A 3S1WA 4LWWA 3SGZA 5DT7A 1PCKA 4FNTA 3AMGA 1H60A 1R2SA 1LQ0A 1HG3A 1GVQA 3EWUA 4KMQA 1IF2A 3T44A 2Y4SA 1G4PA 3WH8A 2BWGA 3W70A 3HU7A 2GOUA 3LHWA 1KWKA 5LNRA 5BNKA 1UBSA 1E4NA 2J24A 4PC8A 3TROA 3AISA 3MI2A 4PTXA 4WKHA 1IXNA 4JTHA 2V5LA 3GVGA 4O57A 2RGMA 3MMDA 4WY0A 1TTIA 3OIXA 2NX1A 4RZ4A 1J0YA 4R27A 3SCOA 4TTUA 1HKIA 1NWSA 3EWZA 1HKJA 4CD6A 1TTQA 3N17A 3BLIA 2WVUA 4KKXA 4O13A 2Q8LA 3WQWA 4XZWA 3USBA 1ZB5A 2PBGA 2Y85A 3MMTA 4JTKA 3VU2A 5FKYA 2E5CA 2J9ZA 4CN1A 4ZXLA 1VC4A 2J79A 2A6LA 2WMKA 2RKXA 3CUJA 4C7FA 1AK5A 4CVUA 1ONRA 1MO0A 1FX6A 3LXAA 1KLYA 1UD4A 1DBTA 1NSJA 2ZWZA 2RHGA 3P84A 3WK0A 1VFOA 4O1BA 2G5WA 3TUUA 4NRRA 3DYPA 4MZ1A 3TXVA 2CZFA 2XM2A 3DYMA 5BXTA 1OT2A 1H49A 4W86A 1KTCA 3M5XA 1UH2A 4AEEA 2Z2UA 4MYAA 3TC7A 1R85A 2D24A 2WMGA 3THAA 2TMDA 4BZYA 3M6YA 1KQZA 3MU7A 2QJIA 4M6QA 4HPGA 4MDPA 3WNNA 1XHGA 3ARQA 3B06A 4IMDA 3NZRA 3SR7A 2NXHA 4AZHA 1CIUA 3VO0A 3VILA 4Z2LA 3GK0A 3FJLA 4D6DA 5EFFA 1PIGA 2W0UA 1C93A 4P7QA 4RCXA 4NNCA 5DY2A 2KZHA 1MXSA 3LEMA 2EGZA 1JD9A 1KM3A 5DCBA 1SO3A 5HDRA 1JDDA 2C13A 2FDSA 3GDTA 1YYAA 3IGSA 3L5LA 5F1VA 5AHNA 3W72A 4UZSA 1KCKA 1PJ9A 1VCFA 3B05A 3RLUA 2DSKA 3VTRA 3OLEA 1AQHA 5KSWA 4JCMA 2J7HA 4S3JA 3VDAA 3E49A 3LRMA 5DBTA 3F4VA 4CLMA 4Z0JA 4JIQA 5HWJA 4JZ5A 1GVSA 4GUGA 4XUGA 4KRUA 1KFBA 2YL5A 1EP2A 3NQ2A 4J3SA 4Q22A 3C2OA 8A3HA 4QQ3A 4KRTA 4WKAA 3VD7A 1H63A 4DM2A 3DECA 3NL3A 4WJXA 5FL1A 1QPOA 3IIVA 4M19A 1HT6A 1V0KA 4A4AA 2B31A 3PZMA 3O8AA 3L4VA 5I3JA 4QLJA 1SFJA 1G01A 4A3HA 3UZ5A 5LNVA 5F2LA 1SQ7A 1EIBA 1LL6A 1VJIA 1XUZA 2XN0A 2GUYA 3W81A 6A3HA 1KGUA 1UKSA 2ZA1A 2CITA 2NV1A 3S1UA 2DSWA 4GKLA 4H2CA 3UERA 3B8DA 1UB3A 1IV8A 1OFRA 3QW4B 3I7RA 3W1NA 3LV6A 3W7KA 2DIEA 4BI5A 2CXGA 3KVJA 3MI3A 4AHQA 3U7VA 3VGFA 1JR1A 3T78A 2BHYA 3WDHA 3LHUA 4FLSA 5H2ZA 4GE8A 2ZX9A 4LYRA 3KL0A 1Q6RA 5HMSA 1BEUA 1OFBA 2RDWA 3QH2A 3GIYA 4YXGA 1B31A 1E5JA 1CW2A 3T08A 2Y88A 3VOCA 1NFBA 2B7QA 3WUBA 3N9SA 5AC6A 1JNEA 1QPRA 4PTNA 3TP4A 1OFDA 4JFWA 2ZZ5A 4UTMA 3DKJA 1CEOA 3AFBA 4JTSA 2MANA 5GPRA 3P82A 1S5TA 4AD0A 2A5HA 3WNOA 5DELA 3G1FA 3LM7A 1KB3A 1HNYA 4WIWA 1ISYA 2QDHA 3QHNA 1JULA 1UR4A 4AH7A 4AD3A 1MFVA 2O9RA 2WHLA 3G0UA 3GXDA 1HTIA 1W5PA 3L66A 1KFJA 3VGDA 3I7SA 4XKYA 1GNXA 3L21A 4F9JA 3VIPA 1E6QM 6ALDA 1G69A 5G2HA 3SUUA 4H8HA 1PVNA 4KWWA 2J47A 2C7FA 3KAOA 1RZMA 1K8XA 3K30A 3PG8A 4KGLA 3WNMA 4JAWA 1AW5A 2W62A 3TTYA 3C52A 3BLFA 3PAJA 1HN1A 1GQNA 2VEMA 5E70A 2CFFA 4DBDA 3CHVA 4D6IA 3VKJA 3G1AA 2AAMA 3KVLA 3LPOA 1WDPA 4LRTA 3S5NA 4HIBA 3RFAA 5GVJA 1GQIA 1PE1A 5D4YA 1JF6A 4DO6A 5D9PA 4DUXA 5HPOA 1V6XA 1C8QA 3P60A 3GNNA 4MZ8A 3WELA 3W7EA 2YKKA 2QF8A 5LA0A 1V03A 2WZIA 4NJHA 1TQJA 4RKAA 5KZ6A 3TK7A 4PCSA 3W2LA 2OYKA 2CLMA 3WDJA 3EBVA 4U3CA 4G1KA 3W2KA 1UG6A 2PURA 1M04A 1B3ZA 5LNSA 2F7FA 5D37A 1GW1A 2VR5A 1XM3A 1AQMA 3UGHA 1JYWA 1K02A 3AIEA 3CU2A 1J0HA 5FOOA 4UUIA 5AN7A 4UFIA 3UWVA 3BSGA 2X05A 3RM8A 4UFJA 3S5ZA 2Q3OA 1H0GA 3POCA 1XXXA 4IMEA 3TMQA 2ISWA 4A2SA 1SMDA 3OGRA 1PIIA 1AL8A 2C14A 4JGDA 3O9NA 3VMPA 3QMSA 2GSJA 1FWWA 2C3ZA 3QMTA 3S1XA 4S2BA 2X16A 3FLUA 3IMMA 1T96A 1GHRA 4M7TA 3SUVA 3VIIA 4ADUA 3HMJG 1E3XA 1LBMA 5CPLA 4UNIA 2WOQA 3GXPA 5F4XA 2FHFA 5DT5A 5FKCA 3ZR4A 2TYSA 4GUIA 3DFTA 5LNUA 3WF4A 2V3EA 2XFFA 2G96A 2NXGA 4MFDA 3STEA 2NUXA 2Y61A 5EYWA 4K38A 5A6MA 3FA5A 3PF3A 3I7QA 2JF7A 1RP9A 5D04C 4M56A 1VHCA 3IJ8A 1H51A 3LIGA 4MIMA 3S0CA 2WKLA 3ZJ7A 4CD5A 3EX4A 4ACZB 5HUOA 1F7BA 3OVQA 3QRHA 1CECA 4RX0A 2ATSA 5LHFA 1OM0A 4AWEA 3WBEA 1M7OA 3G1YA 4MNLA 1VRDA 3AOFA 5D2YA 1I1WA 2YL8A 2EAWA 4JNMA 4CN6A 5GNYA 1WP6A 3VGEA 4HOXA 4CQAA 2VX6A 4YHGA 5A6BD 2EQDA 3CHFA 2A85A 3ATYA 4MY1A 3PHAA 1W3TA 3W7PA 1E0XA 1UD6A 1OF6A 2YL6A 4QDMA 4MB3A 1GPWA 1CGWA 1Q6OA 1IIHA 5FIPA 3UQNA 2TPSA 3L65A 3LLDA 3UPWA 2G3MA 4L4OA 3W22A 4GI8A 3E9AA 2QMKA 3OGSA 4U31A 4JX6A 5AC8A 1HVQA 1ZALA 3TKFA 2ZZ6A 4JY9A 1VEPA 1KBIA 2XWEA 3LCHA 3PTKA 1UD8A 1FP8A 1VHNA 4ADSA 3MMUA 1SSDA 4KFNA 1EGZA 2E9BA 3BLEA 4PTMA 4XUYA 1HL2A 2DZXA 2GUUA 4UTTC 3LDKA 4ADTA 3CGTA 4K39A 4AHPA 3AYRA 1LOQA 5EMUA 4YWIA 1E6RA 5DXXA 4CQ8A 1HVXA 1NWUA 3QPZA 4WY0F 1OX4B 2WBKA 4LS0A 2GQ9A 2Y7DA 3HJZA 2WCSA 4HMDA 3I3BA 3CBWA 4TVUA 4A21A 4ORIA 5EY5A 4AXNA 3UWWA 1H1NA 3SUTA 1EOMA 2XIBA 1SU5A 5M3WA 4PTWA 5SWUA 5BCAA 4NVTA 3N19B 1HIZA 3D5HA 3FYPA 3UYCA 2ZTJA 5KTLA 2DH2A 4Z2HA 5M03A 4PMUA 2NWSA 3TTQA 1K9TA 2ZUSA 4M80A 4RE3A 3L0GA 4AWSA 3T55A 3ZJ8A 4FO4A 4A29A 3ZT6A 2C0HA 3ZSTA 3VIOA 2D0HA 4YMZA 3TXZA 2WAGA 5TIMA 3SCSA 3UWQA 3UY8A 5I0DA 3VUPA 3G0SA 5TQLA 3LXCA 1UCWA 2RFGA 2ZRXA 1L2UA 1BVZA 3RM4A 1V3MA 1SZGA 3L5AA 2BY2A 4GO8A 1EEPA 5CZTA 3NQCA 3AXIA 3LPFA 4TVDA 3WBAA 1XH2A 4LUIA 5FL0A 5AHMA 1W91A 3L5MA 4JTEA 4B16A 3IK2A 1DQXA 3WQ4A 4KH2A 3MUIA 3TE9A 2Y8KA 4D71A 4UTJA 4HA1A 1KM1A 3LHYA 1K8ZA 2CZ5A 3WJZA 2FPYA 1GJPA 3SFKA 3PB2A 3B9AA 3WQ5A 4POCA 1K03A 1VCVA 1GG1A 5F4SA 1VF8A 1M5WA 5FD0A 3W1MA 2YDQA 1EX5A 3R89A 1CPUA 3LHZA 3G24A 4N9DA 2VI0A 4I7WA 1E6XM 4W7WA 1DWIM 1XD0A 2O9PA 1FHDA 2W91A 1GHSA 3PZTA 5I5RA 4UNLA 3THCA 1HJWA 5G4EA 1NOUA 3LCWA 3VD9A 3YPIA 3PIGA 5JBEA 1GJUA 4UR8A 1V6VA 2VZSA 5MHBA 3IV3A 5BMWA 4AZBA 1VFUA 3ARWA 4GXPA 4Z2KA 1C92A 2D3LA 1XYZA 2BV9A 2R91A 1EH9A 1PHWA 4Y96A 1RPXA 3IGUA 3QMRA 3HGSA 1L6SA 3W88A 2ZIDA 3TOPA 2HS6A 2CBUA 2VFGA 2VENA 4X0NA 2WC7A 3WK1A 4MOZA 3GDRA 4M82A 5CSUA 1YXDA 3T0AA 4RJEA 4MYXA 3TSMA 4JTLA 1H61A 3ARUA 3FHAA 1QPNA 5EBUA 1IZKA 1NWTA 2H3BA 3DI1A 2EJ1A 2VOTA 1SO6A 3S8HA 1HUVA 1J10A 2WLZA 1X6UA 1YDOA 1ODZA 4MJZA 5TBOA 4JX5A 1VRXA 2Z1SA 1B4EA 2BLEA 4D1JA 3W1TA 1X6NA 5G1YA 5HBFA 1V3HA 1KM4A 3GR7A 2XQRA 2NZLA 4LRSA 1UD5A 1UQZA 3E96A 1Z32X 2OLHA 3BGAA 3NDYA 2E1DA 4HMEA 3CUIA 4U5IA 3AJXA 2YPIA 2C0AA 2Y5EA 1GONA 4QAWA 2PI6A 2QQVA 3VFLA 2X30A 4GWEA 2WVSA 1CGUA 3LI1A 1TPH1 2DORA 3NG3A 4AWUA 2XWDA 3DFOA 3I65A 1QHOA 1E1EA 4LT9A 1KV5A 4XTDA 4NJJA 1JXJA 3RF9A 3HPXA 3TSBA 4JYDA 1B3XA 1YQ2A 4GI6A 4PMQA 4TUFA 2VX7A 4MDOA 1VAHA 2WC4A 4PEEA 5I77A 6TIMA 2QQUA 3D3AA 1VGAA 1GOOA 4UTLA 4OBRA 3VM7A 3R12A 4UQEA 1XI3A 4Y6GA 1AQ0A 3OVPA 3EDJA 1QDSA 3UD6A 3WF0A 3QSRA 5A2CA 1K9DA 1LWHA 2WWCA 1A5BA 3AMKA 5KEZA 2XSBA 4IPIA 2WHMA 1LRNA 2VEKA 2VL4A 1YPFA 3UY7A 1YHTA 2D0FA 3KE0A 3FEMA 4PYSA 4W89A 3JS3A 1L6WA 5LGXA 2YFNA 4HSNA 4H7VA 2OWCA 2DT0A 2B4GA 4LC6A 4WZHA 4CD8A 1GOIA 4F66A 2QCHA 2BFGA 2VFHA 4NQ1A 1ESWA 3FJ6A 3AHYA 1NAL1 4H8UA 4IGHA 3W1XA 2OZ0A 3GXFA 4WOQA 3CHEA 1E6NA 2D3NA 4AMCA 3GM8A 1VJZA 4UCFA 4FXSA 3W1QA 1CGXA 3WD1A 1MXDA 3BARA 4AD2A 3BGGA 1SW7A 3E12A 3HGRA 4E8CA 3T40A 1VS1A 1W5QA 1MSSA 3TV8A 1QNSA 3GBDA 2UWFA 2H90A 3MUZ1 3NA8A 3BMVA 4PMRA 4P8VA 3Q2DA 3W86A 1UD2A 4V2XA 2O7QA 2R8WA 4LOCA 2X0HA 2DJLA 4NZFA 4XB3A 4O0ZA 1ZJIA 3WF3A 3EXRA 3F4WA 5F4WA 3IEBA 2X1IA 3QGVA 3G8EA 4U3AA 2QMJA 2DZWA 2BY3A 3T2OA 4FF5A 1BYCA 3VMOA 4H3DA 3P8IA 2ZUTA 1LOSA 4TO8A 4WX2A 1JCLA 4JD4A 1JI2A 3GH7A 1LP6A 1SUXA 1RQBA 3SCNA 1FDJA 3SEPA 4K8EA 5HR6A 2HVMA 3LB0A 3MP3A 3P62A 4HNUA 3RJXA 1AMKA 2VVNA 4C1LA 2ZUUA 4A3YA 1FHLA 3O06A 3IAPA 1VIWA 5A6BA 4W5UA 1G7VA 3PY2A 4FEZA 1TG7A 2ZX6A 2NW0A 3AMLA 3L9CA 4ZZ9A 5D38A 3NQGA 4FFGA 5F2GA 1J0ZA 3A24A 3EX6A 4QP0A 3PZ9A 3AIUA 3W1LA 1A5AA 3GAYA 5AOUA 1Q3NA 3C8FA 1KBKA 1UHVA 1ZNNA 2QUUA 5FEXA 4E0CA 3O2LA 1OX4A 5I3HA 1UZ1A 3W26A 4A2RA 3NM3A 2CBJA 1EA9C 2WSRA 4QSHA 1E43A 3BC9A 3MUAA 4TX9A 1E72M 5A8QA 1G1YA 3WJYA 4QFUA 2CZDA 4FMVA 5E6YA 3CPRA 1VYSX 3EWBX 3M41A 1I2PA 3PIJA 3G3DA 1E73M 2E9MA 4UQAA 2ZOXA 4AIUA 3VIJA 1TPEA 1M7PA 4YLWA 2ISVA 4DQWA 4Y9AA 1FUYA 1OIMA 3OLIA 3M9YA 1OD0A 4W8BA 3OG2A 3U5UA 3VINA 2JIWA 2WHKA 1XDMA 2OT1A 3WFZA 2CLHA 4HPXA 3ARTA 4JCLA 3M7SA 5HOSA 3FS2A 4GJ1A 1EXPA 1MEHA 5I79A 5CLWA 2W79A 3C0JA 1GOQA 4ZQNA 2YYTA 4GO9A 3EWXA 1JFHA 3TTSA 1QI2A 3WMSA 5D09A 5FEZA 2XVLA 3GBEA 1H7WA 1D9EA 3RO8A 4MJMA 1K8YA 2IUZA 1HFBA 1TSIA 2OWWA 1I2OA 1DQWA 1E4LA 1MFUA 2PWGA 1H4PA 1PPIA 3AQUA 3VIHA 4V28A 1GZJA 4N4PA 3EB2A 3PBUA 3G1XA 1QNOA 4O15A 4E4PA 1EP1A 2CLEA 2GK1A 1KFLA 5I24A 5LYRA 4W8LA 2FGLA 3C2EA 2QCMA 5FI8A 4P7LA 3WF1A 2WANA 3LI0A 3I3EA 2G95A 3ZMRA 5C6MA 1SPQA 4ICNA 1TPB1 2ZYFA 4DPPA 4BR1A 1T8XA 4HU8A 4HXCA 3N9KA 3QC3A 3FKRA 1XUUA 3NQMA 1TFVA 4ZE4A 2J7BA 1ZU8A 4XBSA 1SO4A 3ZWSA 1XBYA 3W75A 2DPEA 3L2LA 3WUEA 1EQPA 1ODUA 3BLPX 3W2JA 3WQ6A 3GR8A 3NQ6A 1CNVA 1QHPA 2BXYA 1YADA 2DT2A 1T99A 2VZTA 3U1XA 2YCEA 2CKRA 2WZHA 1TMHA 2WLYA 4PUDA 3DH7A 4LPCA 2W92A 2JK2A 2WSKA 1NVMA 1EWDA 2J7CA 2YA2A 2G4FA 1RVGA 1QBBA 2VZVA 2QR6A 3LRLA 4HZ6A 2QUVA 1T0OA 3LF7A 3AROA 3HB9A 2PBOA 3INPA 3P74A 4XKYB 5AB3A 2YDAA 2ZZ3A 2ZX5A 2A21A 3KVMA 2O92A 2UY3A 5D9OA 4P7NA 4U4MA 3UG5A 4UNKA 1G94A 1FBAA 1PV8A 1Y7VA 2Y2WA 3MI6A 4DBEA 4PEKA 4UCGA 1F6KA 4HT3A 3W2NA 3UGGA 3HO8A 4UC5A 4IMFA 2W63A 1O5XA 1CGYA 4C7DA 3SIMA 5KZDA 1WDQA 4JEQA 1CI1A 4RK8A 2E4TA 1E51A 4W7VA 3QSTA 4D6JA 3W38A 3W87A 3MSGA 4GC4A 4N42A 2W4XA 3LXBA 4J3UA 3DU0A 3WUGA 1O6IA 3HN3A 1UR9A 2R14A 1E15A 2DZPA 2Y70A 3KWXA 1OD8A 1W3HA 2DGAA 3HPZA 3DFPA 3PBYA 2AGKA 3NXFA 5BOOA 4IM4A 2NWRA 4JTTA 3NSXA 4X9YA 5BRPA 1Z41A 1LRTA 4GXMA 1WKYA 3QJAA 3LFIA 1BTMA 2XGBA 3QEZA 1V3IA 3WDRA 4UOJA 4OOUA 1S5WA 2DZSA 2YJQA 1KWGA 5KINA 2WK2A 3ALFA 4MAZA 4LGXA 4O1CA 4Z2JA 3UWZA 5AHIA 1DJNA 3C56A 4O10A 1JVNA 2XVNA 5J5RA 2ZDRA 3RM9A 2C8NA 5BYWA 3PS7A 2ZX7A 4K36A 2DJXA 1J12A 1KFEA 2J4GA 2DZUA 1HO1A 2OJPA 3WJSA 1A3HA 2CHOA 2VJXA 1X6LA 3L4WA 4URIA 3WEZA 1GOXA 2YYUA 3O6DA 1OK6A 1W9PA 2V2DA 1UA7A 3KL5A 3PULA 2BSLA 3KFTA 1JCMP 3GYEA 2QKFA 1NQ6A 5KMYA 1C8YA 1YTDA 3NYZA 3NPUA 4UR7A 1E56A 1GOMA 4D6HA 4PSPA 2Y7GA 2QJHA 4FFFA 4IUOA 3MUY1 1HF6A 1MQRA 4IISA 3RU6A 3NR0A 4QCFA 4D6FA 3VDBA 2FB3A 1PHQA 2DU2A 3F4NA 1HJQA 2E8ZA 4AW7A 4M6VA 1P0NA 3KRUA 4XTIA 3P7YA 4MJ4A 2BTMA 1GQJA 3ECQA 3ZM8A 4DF2A 2QF7A 4AD4A 3CTTA 3A22A 4MLJA 2V5DA 1E70M 3U7BA 2PWEA 3W9ZA 1H7OA 1OWQA 2XFRA 2FHBA 5GNZA 5I23A 1AW1A 2GDUA 3NJ3A 3EDEA 4MADA 3PR2A 1D3CA 2G3IA 3NSNA 4U33A 5EKYA 3U5YA 5AYXA 2GJLA 1GYNA 2V3GA 3T2QA 4F79A 2WNQA 2JEPA 2E9LA 3EXSA 4NJIA 1ZBKA 2J6XA 1NH6A 4CVWA 3NZ1A 2PWFA 1BLIA 4PFMA 2GQAA 1QO2A 3EX1A 2J8GA 4Q33A 2UY2A 2XVKA 4HKPA 1CENA 3FNDA 1AVAA 3MHGA 2VZUA 1YXYA 4MB1A 1OGBA 3B0UX 1KXTA 2VEPA 4MPQA 1LDCA 1W31A 2NUYA 5DEZA 5A2BA 1UR0A 4Q4KA 1ZS2A 1TV8A 4BF7A 4ZL1A 4AIOA 3M16A 2YDSA 3MANA 4LVAA 3PUOA 1WDWA 3T7VA 4XX6A 1DWFM 1QI4A 3G3MA 3UWUA 2XN1A 4FNRA 2VRKA 2JF6A 1DWGM 4OOZA 4OIFA 2OMAA 4YPJA 4BK9A 3DHDA 3GXTA 1MEWA 1OGSA 1B1YA 5CZJA 1KXVA 1TPUA 5CLTA 2V8ZA 5CZSA 2CZEA 3C2RA 5FESA 5AYYA 4JQTA 4IXXA 1HJXA 4JTJA 1MW0A 3B9EA 4AXKA 3A4XA 4EKJA 1VFMA 5TD4A 1I4NA 2DSZA 4QLKA 4JDBA 3QZEA 4MZYA 1WOBA 1PEZA 2CBIA 1JI1A 3ELFA 2NT1A 3W27A 4QAIA 1G4SA 4AZ7A 4C7GA 4DWSA 3TQ0A 4NRSA 1I45A 5BWFA 2DEPA 3PZUA 1HXJA 2ZQ0A 4B3LA 3WD2A 2QCLA 5HWNA 1FA2A 3S2CA 3UESA 4ACYA 4Z0SA 3UG4A 4QHZA 1XCFA 2XVPA 1JZ8A 3C3NA 4JKLA 3ABQA 5FCZA 4HN4A 2VXNA 3WEMA 3DXIA 4M24A 4UQBA 4PCFA 3T4CA 1N7KA 1YDVA 3NNTA 1SZFA 3RK8A 3WL1A 4UZUA 3HMCA 1H7PA 8TIMA 1WYIA 3ZT7A 2J9YA 4PCTA 3HG5A 1E1FA 5A69A 1JQXA 3KRZA 1WAUA 5FF3A 5LNWA 2HTMA 4IUGA 4PMXA 3EX2A 5DCDA 1OJXA 1R8LA 1B3YA 3SECA 4OZOA 1DV7A 3VD4A 1OVDA 3N2MA 3TW7A 2ATMA 3GX9A 1J2WA 1H7RA 4J3WA 3NQVA 5JIWA 4WSKA 3WNKA 4PTVA 1SFSA 4WY0B 1JYVA 3OGVA 4N0RA 4PUEA 2OYLA 3OBKA 1ZL1A 1QI3A 3P8JA 2DSUA 1TJPA 2C15A 3GNRA 1E3ZA 3N13A 3P80A 1W5NA 2CPUA 1TR1A 2VQUA 4PMNA 4D72A 4CU6A 2H8ZA 1ICQA 3MW7A 3GKAA 1CZ1A 1UR2A 3WH5A 1CLVA 4HU0A 2RGLA 4B15A 4LQ1A 3W24A 2J88A 3QQ0A 3NO5A 4J3TA 4JN6A 5A8NA 3MYPA 2EPKX 2OWXA 3Q37A 3GNPA 4M81A 4NSBA 4QNEA 1W1PA 3W23A 2VX4A 2EHHA 1A5CA 3HGJA 4MY8A 1V5XA 1YDNA 3N34A 4UOZA 3U57A 2A2IA 1D2KA 1NWRA 4P2VA 1NARA 3PBVA 3WQVA 3BG9A 3G1HA 1V08A 1OG0A 1TIMA 5E6ZA 5AC4A 4TTGA 5CGQA 1KBJA 2V82A 3W7QA 2DT3A 4LU0A 4MKNA 2VEIA 3B0VC 3W1RA 4K8HA 1H11A 1NOWA 1TA3B 5I3GA 1KR0A 5HWMA 2ZFAA 4Z2IA 1VLIA 3FKKA 3HG4A 1E0WA 3OLDA 1GVYA 5T26A 2XTKA 2GJNA 1C7SA 3FN9A 1GQLA 4HSOA 1UWRA 1ZAJA 3PZOA 4KFOA 3L4YA 1R2TA 4GUJA 3N3MA 1VB9A 1BYAA 4FK9A 1QBAA 2QAPA 2JBMA 4I9AA 3LCLA 3MP4A 1B2YA 1SR0A 3QW3A 1ZENA 2X8RA 3SCUA 3OEXA 2FIQA 1SR9A 1GTEA 3THQA 3PZIA 2W6RA 1P4CA 2DT1A 5FK7A 1Z44A 3AICA 4AEFA 1QPQA 1WZAA 1JL8A 3BVJA 1I2NA 4HHPA 3ZWTA 5FF0A 3O07A 3O63A 3QOMA 1RD5A 4KWVA 3VPLA 1KCLA 3AZRA 1FCQA 2I14A 2WPBA 4DXVA 1QHZA 1WPCA 3LPPA 3NIYA 2D1ZA 2YFOA 1KM6A 3D0CA 3KVKA 3QYQA 2A3EA 5FF7A 2JKEA 4O1AA 4Z1CA 5K7JA 3W53A 2WCAA 1L0PA 1AG1O 3WH6A 3S42A 3NQ8A 4O16A 4ZQMA 4UFMA 3MKKA 1G67A 4EK7A 1VQTA 4WD0A 5KZEA 4GRSA 3RPMA 3EX3A 5AC7A 4PMYA 2NV2A 4EAMA 1VCGA 4ZXOA 3WJXA 3TU9A 2XYLA 3CHDA 3RMJA 2VT0A 1LJYA 5E0CA 1UKOA 1VBRA 1A47A 1KTNA 1DVJA 4IX0A 3TAOA 1F5ZA 5HULA 3F5KA 4W85A 5K4XA 1EO7A 3DHFA 2G3NA 1UQYA 3CQ0A 3GLCA 4NX5A 3WDPP 1GZGA 5U7SA 3U6WA 4HP5A 2V0TA 4A3UA 4XZBA 4FHAA 3STCA 5DFAA 2QCNA 1W0MA 9CGTA 3P61A 1Q6CA 4MNKA 1E71M 1PIFA 2GVYA 4UFHA 3HG3A 3VX0A 3IIOA 5JIPA 3TX9A 1HJSA 2E77A 4XZ9A 1NM9A 4CCCA 3M47A 4ZEPA 2JKAA 1J11A 1LCOA 1TV5A 4FF7A 4RLIA 4ALDA 2AAAA 2G3JA 4WOZA 3GAKA 4MB5A 4PL1A 1ME9A 5AC5A 2H8XA 1HO4A 1HJVA 1YPIA 4BI6A 2YA0A 1VYPX 3NYDA 4J27A 3TIMA 1QNQA 3N1AA 4DWSB 2I9EA 1NEYA 2CERA 2VZOA 2IQTA 3L0KA 3DZ1A 4XBKA 3CIWA 1SFLA 1KQYA 5K9CA 2Y89A 1H1YA 2FPTA 2VURA 4UTTA 3CLMA 2WB5A 2WPGA 4CUCA 1LYXA 2VC9A 3SY5A 2ZZ4A 3HQ1A 2NXIA 4QITA 4TIMA 1I2QA 3W6MA 2XUCA 4YCPA 3SC7X 3MV01 1FP9A 5CKSA 4CCEA 2ZZ1A 1G4EA 2QCDB 2ZRYA 3SW6A 3MWAA 5LKYA 2VTFA 4J7RA 4UTWA 2J25A 2ZXQA 4DO4A 4P7OA 5D03A 5FMBA 4B5NA 5EB8A 1OGGA 1W1ZA 1KFCA 4O17A 3G8RA 1YTEA 1LOLA 4NXSA 2WVTA 5DO8A 3WK2A 1TVNA 3MSDA 1O4UA 2E0PA 1GYLA 3II1A 1FH7A 4W8AA 2ZRWA 3WFAA 3AIRA 1K7FA 3CTLA 3W6LA 1JUBA 2XFYA 1WQ5A 3H3LA 1HL8A 1TVPA 2A6NA 2J77A 4OBSA 1IT0A 2Y7FA 2F61A 4Z2GA 1MW3A 1OFEA 3TH6A 4TU1A 3LX9A 1HJUA 2ZUMA 4HA4A 3G18A 3DGRA 3T0DA 5I78A 2J75A 2OYMA 3W84A 4E2BA 3G1VA 3W83A 5CSRA 2ZTKA 1IXOA 2BVYA 4JXCA 3S5YA 4LUJA 1IXQA 3TNOA 5I3DA 3TW6A 1ZJBA 3AIBA 3HIJA 3OZOA 2YBUA 4RZ5A 3B04A 3LCGA 1XYFA 4WKFA 3SCQA 1W9UA 2Y8VA 1OX5A 4AZZA 3N11A 2WMIB 3TQVA 1ZBCA 4K6AA 3PZQA 4L4PA 3U75A 4JHZA 4NZCA 3B03A 5J5DA 1PAMA 3LTYA 4B1MA 3CB8A 2VO5A 5EFDA 1VH7A 4JY8A 1ICPA 2ZE0A 5BXPA 2XJ7A 3UG3A 1JYNA 2VC6A 5K9DA 3AZTA 1Y9MA 1F76A 5JBFA 4JTFA 2ZZ7A 3CIVA 1OYAA 3M1ZA 1RPKA 1MW1A 1EP3A 1QO5A 5F2MA 4ZMGA 1JDAA 1JZ5A 4B3KA 5HUPA 5BRBA 4GFSA 3C2FA 3W29A 5CXPA 3O05A 3LRKA 4ZVJA 4DELA 3QQ1A 3KHJA 1QCWA 4UMBA 1XCXA 4XWUA 2QQWA 4EOUA 3BG5A 2ZICA 2XM1A 2NLIA 4UFLA 4K7YA 2J74A 3MO7A 3NAVA 4ZQPA 1MEIA 3CZLA 3UEQA 3LOTA 5M5DA 3B4UA 3G1DA 3BMWA 4W87A 3GDLA 1G4TA 5D32A 1L6YA 2QCEA 3WUFA 3WJWA 4MNMA 4WF7A 2CNCA 5D8WA 5A94A 2BX7A 1JQVA 4H04A 1XL9A 4E8DA 3QHMA 1TRDA 3SZ8A 4AEOA 4N6FA 1DWHM 4CD7A 2IXVA 2Z1KA 2A3BA 2ZUVA 1ISXA 2FFCA 4BWLC 4Z1BA 1KFWA 3NL2A 2XG9A 4OQVA 1KLZA 1QNRA 2YBTA 3VNZA 1E9LA 5FK8A 2YSWA 1I75A 4MJ2A 3ABRA 1RD6A 1WDSA 3IJ7A 3RMEA 2J7GA 2WSPA 4JKKA 3M46A 2QCFA 4O4VA 2ZXBA 3JUGA 3CT7A 2GVJA 4JDYA 5BRQA 3BCFA 2EBNA 2C18A 2QAFA 3TMLA 4UTWC 1TMQA 1BVNP 3W4RA 3IVUA 1DL3A 1U2YA 4S3KA 3AIWA 2V38A 2WXDM 2DZVA 3Q94A 1OINA 3NQ7A 2CETA 2BXVA 4AF0B 4P8XA 1JYXA 3CM4A 3CZEA 1F2JA 5A5WA 3VNDA 4FX6M 3L2MA 3LLFA 1C8VA 4HNVA 4H8VA 4F8XA 1BKSA 4E38A 1THFD 3WDIA 2VFFA 1JAKA 3N12A 4JIEA 4MY9A 4ZE5A 3VD5A 1HX0A 4OV4A 4O52A 3A3HA 1VYRA 3MBFA 3BAWA 3UETA 2GVGA 1G6CA 4D6CA 1JDCA 1UH3A 1UWTA 3GDBA 1Y0EA 2OSWA 3S9YA 4NJKA 2CIPA 2V5CA 1H2JA 3TA9A 3KRSA 1FDZA 1BGAA 2V2HA 4N2YA 4O8RA 3TC6A 4X3ZA 1K7XA 1DHPA 3ZR5A 4M1RA 1I8JA 5IHSA 5D33A 2EKCA 3W3OA 4GNJA 1Q6LA 1EUNA 2WO5A 2PC8A 4QIUA 5C5YA 3RWKX 3SI9A 4HOWA 2DSVA 4EQVA 5BXRA 3CHCA 1DKWA 2X2YA 5E1QA 2YLAA 4PL2A 1PS9A 5CG0A 1CGTA 3C61A 2J62A 1XV8A 3ZIZA 2Y7EA 3CZJA 1ZAIA 3SSJA 3WD3A 1MVYA 2D23A 2A7NA 2YLLA 3ABSA 4IOTA 1BAGA 1XH0A 1SW3A 4UXDA 3SGUA 1KXHA 5LZLA 1KGWA 4ONVA 1CGVA 1GG0A 1R2RA 1DWAM 2VUYA 3AHVA 3OZPA 3SCVA 3KEHA 2CLFA 2WMHA 5IBXA 3A4AA 3AI0A 3THDA 1JZ4A 3M5VA 1B57A 3LTPA 3AZSA 1OHLA 1UZ4A 2QPUA 4CCDA 4UTIA 1R7OA 2QCGA 2A0NA 1OIFA 2AMGA 1SSGA 2DDXA 2O9TA 3M7WA 4HZ7A 3O16A 1V6YA 2TAAA 1WXJA 2V9DA 3ANYA 3W7IA 4DWSD 3N15A 2OSYA 1JZ7A 4P7RA 2B7PA 1UH4A 2F84A 1ZHAA 4TMCA 1DJQA 1FWTA 4WLCA 3MO4A 5GQBA 4UQCA 4IXHA 4M6PA 2VQTA 3AS3A 4W84A 2W67A 3VGBA 3CO4A 1WE5A 2A3AA 4R7JA 4WXZA 4D6GA 4W7UA 1GEQA 4I7UA 3L4UA 4HA3A 3IVSA 3CZGA 4LY8A 2E40A 2BZNA 2ZZ2A 2FJKA 4GUHA 4WXYA 1W9VA 3K4AA 4AZCB 3IVTA 4ML9A 4O11A 5AHLA 4HPJA 4ZQOA 5C54A 4C1KA 4WK9A 2DIJA 1OFQA 1R46A 1W3NA 1P5BA 1O94A 2YOCA 1S3HA 1TPFA 1VPXA 4FNPA 5CPMA 5CSSA 4N02A 2EPHA 1OABA 2VFDA 4N9EA 2PF0A 4J3XA 4FFIA 1LL4A 4JTGA 5G2WA 1UKQA 2X2GA 1W54A 2PRHA 4GZIA 4BF9A 3GTNA 4LVDA 3NSMA 4AD1A 3L4XA 4JKMA 1PBGA 2NX3A 2YX0A 4RXGA 1TV7A 5HQEA 1Q6DA 5CGMA 3P5YA 2OXBA 3UNDA 5IBXC 5FEWA 2JEQA 2VRJA 1B3OA 1GVRA 3CEUA 3RDKA 5A8PA 2AC1A 3A21A 3CUFA 1R47A 4OT7A 1QW8A 1W2PA 3R2GA 5CPTA 4JYFA 2X09A 1ME7A 3HGOA 3O15A 4Q7NA 3LPGA 1UYPA 5D8ZA 1JD7A 2J7FA 2JE8A 2E09A 5EA9A 4ML4A 3TDFA 3OA5A 3LDRA 5EL1A 3STGA 1EA0A 1PX4A 4OWGA 2XSAA 3VIGA 1K9EA 3LBCA 1ZY9A 3EKLA 3PTMA 4RZ6A 5D2VA 2E5BA 2J78A 1VFFA 2QCDA 4PMVA 3H55A 4LV4A 1XC4A 1WV2A 5FKBA 1GCYA 1XBVA 3TSDA 1B9BA 1D3HA 3BG3A 3NEVA 4AWTA 2D22A 3VMNA 1F4AA 3V1PA 3MHUA 1JRBA 4LS1A 3BLKA 4JFUA 3MYOA 3LTSA 1TCMA 1S46A 1OBAA 4JFSA 4QM1A 1B3WA 4KWUA 1H3GA 3HG2A 1FXQA 5D30A 4BI7A 1VBUA 2ZA2A 3CC1A 4NJGA 1UJPA 3BK0A 3RJYA 1RV8A 2B7NA 3L68A 5A8GA 3WD0A 5AFDA 4GZJA 4NXKA 1V6WA 2RDUA 5LA2A 5A6JA 1L8NA 2EPMX 3PC0A 2A1YA 1J0JA 4BQ3A 3SURA 3UPBA 1Q6FA 3ZSSA 1DORA 1O60A 3TAKA 3W7OA 7TAAA 1JCYA 2VFEA 2WVVA 4JFVA 4IPNB 1ZAHA 2FH8A 4RXFA 2CW6A 4PH6A 3DC0A 4JTUA 1C90A 5K3VA 2XHYA 2YZRA 3O6AA 3VX1A 3O1NA 3W7CA 1O5KA 1TTJA 4O14A 4WJEA 1M03A 5EPDA 3W2UA 3T2PA 4FNUA 3WH9A 1WBHA 4AZ5A 2YW3A 1NP2A 2BHUA 2X0YA 1ZBVA 2AEYA 1A53A 1EDGA 2VKZG 1FFQA 2VVSA 3A4WA 3M0ZA 1BF2A 4EE9A 1UWQA 3BPWA 3U8GA 1VR6A 2C16A 1CXKA 3E0IA 1LTDA 3TQKA 3N04A 3BGJA 3FXYA 3CUHA 1FWRA 3TJLA 4DF1A 4HTYA 6TAAA 1EDTA 3PN8A 1BTCA 3S5OA 5DCEA 1H0IA 1I1XA 3NQDA 4P61A 1EQCA 4GQRA 2OX1A 2QPSA 1FCUA 4ATDA 1H50A 1ADOA 1H5YA 1H5VA 4P8WA 3QF0A 2WM0A 4MTVA 1XSKA 1MWOA 4AAJA 4CGTA 4GPNA 3GZAA 2UV8G 3W82A 2GQ8A 2F8QA 4PA8A 1XGZA 3GB6A 5AYBA 1CXFA 1TO3A 2BY1A 4Y7EA 5M17A 1QAPA 4O50A 3W7RA 1P0KA 3W1PA 3PVFA 4RE2A 3RIKA 4MNJA 5A95A 4BFAA 1LG2A 2X1SA 5D02A 2W66A 3IAQA 3I6RA 4B9ZA 1TQXA 3FOKA 1D7FA 3EKZA 2ZA3A 1QMLA 4TVCA 1G0CA 3AS2A 3WD4A 3MHFA 1K9FA 2Z6JA 1TB3A 4IQLA 5JBDA 1Q6QA 1JIBA 1CWYA 4ZENA 3EMZA 5H91A 1W2TA 4IWWA 2VX5A 1W5OA 4I7VA 4R33A 1JGIA 3IANA 4K68A 3IRDA 1OFAA 4P8UA 1E55A 5C55A 2JIEA 3G22A 3UWYA 1CXIA 5DF0A 4H41A 1OYBA 4XQ6A 3VNYA 1X7FA 3QR3A 1H1ZA 4PMOA 3W1AA 2J7DA 2HS8A 2R94A 4ZQCA 7TIMA 4DWSC 1LRQA 1ST8A 1FWNA 1BYDA 1IZJA 4PMDA 3GYCA 1KFKA 3U2OA 1QW9A 4FLQA 3TCEA 1IIGA 3R5EA 1I2RA 1R87A 3EDKA 4TX8A 3MBDA 1H7NA 1UOKA 4MVAA 1J18A 4AVFA 3TR2A 1JAEA 1X1OA 5C8BB 4IMCA 1ZCOA 5IFPA 1DP0A 4FNQA 4NU7A 4FIQA 3WIJA 1EWEA 2ZXDA 3EEGA 5G5IA 1V7YA 1EPXA 3I3DA 3WY1A 3TFXA 3W74A 2VRQA 1LLWA 2EO7A 3CWNA 1PX8A 4ZQRA 5CZKA 4YHEA 4W88A 3N2XA 1OB0A 2VFIA 3M5YA 3QFEA 2NUWA 2AOSA 3VIMA 1E40A 3E1F1 1KA9F 4JIPA 4OHQA 1XRVA 5G4WA 1V0LA 3GNDA 3WEOA 3E02A 2X1RA 1BHGA 3W7GA 2WYSA 1W9DM 3QOKA 1NP0A 4KGJA 4M5PA 3WH7A 3ZR6A 1F05A 3VE9A 1V6UA 3WNLA 5ABFB 1VZWA 3W76A 4NI3A 5D2WA 2FH6A 2VELA 2CYGA 2WHJA 1KR1A 1PZ3A 1IGSA 1PCWA 1S5VA 1PX3A 1XC6A 3NDOA 1FH9A 5DN1A 3ARZA 3BAKA 1H41A 1HKKA 3F5JA 1XH1A 4L4MA 3VVGA 1JG9A 2WBGA 1JCXA 4PN2A 2WW5A 2ALDA 4AZ6A 3GH5A 4TXEA 4BS0A 3FHQA 1D3GA 1NF7A 3NPXA 3LMYA 4ATWA 3EWWA 1ITCA 1ITXA 1IXPA 1TZ7A 3A47A 3T09A 3NM1A 3MJYA 5E9AA 2H6RA 5L9FA 3NVTA 1Q6EA 1LBLA 1E6PA 1GT8A 2V3DA 3K46A 4OU1A 4L4LA 3CMJA 4UR9A 1BQCA 2WV8A 3S1VA 3CZ8A 3BXWA 2XIIA 4BQ5A 4F9DA 3DFSA 5CJ5A 2E8YA 1C9DA 1GOWA 1HKMA 3P67A 4FB7A 1KGXA 4RE4A 5EMYA 3W37A 1BFNA 1JRCA 1LWJA 3AJ7A 5E09A 2EF9A 3O6CA 1W56A 2WNWA 1G5AA 4RL3A 2H3DA 1RP8A 3L2IA 1KXQA 3GXMA 5CQ1A 3M44A 3W7LA 2Q3RA 2YR1A 5IM51 1YLVA 1TA3A 1W9XA 1CTNA 2WMJA 4PODA 4AZCA 4QISA 1KM0A 3SCWA 3NQFA 1R7AA 3PTQA 5IDIA 2WKJA 1AW2A 4N6EA 4X2RA 3OBAA 2QV4A 3W7MA 2A3HA 4CKQA 5CPNA 4X9SA 1FQ0A 4AY1A 2ZRUA 3LIHA 3W71A 3PBGA 5F2IA 5FF4A 3KX6A 2VOMA 3O6YX 1EB3A 3ZS4A 4MAVA 4BQ4A 4A22A 4MLRA 1MW2A 5G2IA 1H62A 2QLYA 3H53A 3KZSA 1VENA 3MS8A 3OG3A 3LV5A 3LCFA 5DXYA 1LF1A 3SIZA 1QI5A 3PZNA 4MFEA 3N14A 1U83A 2ABAA 3F03K 3CWOX 4JR5A 1V0NA 2J27A 5I3IA 5A6AA 4AMAA 3GDMA 4UTUA 2BVDA 1NF0A 2NT0A 3GZ3A 1GOKA 3G6MA 3SCTA 2QEZA 4O12A 2GVLA 1QNVA 4JTIA 1GPFA 5G1TA 2ADEA 1F74A 2BXZA 4U2YA 1ISWA 5ABFA 1YXCA 4UQ9A 2PE4A 3PBWA 3CMGA 8CGTA 4FIRA 1RQHA 3C4UA 5LSMA 2C1HA 1UUOA 4CU8A 5ABEA 2G41A 1N8FA 4O53A 4WSJA 1J01A 1AMYA 3A6OA 1WZKA 4AC1X 2JGYA 3STFA 3BCDA 3DHUA 3SCPA 3BH4A 5ABHA 4U5KA 4AD5A 1PZ2A 4CN4A 5FIXA 2BHZA 1EIXA 1WCGA 2P0OA 3PUEA 4DF0A 3AHXA 3ARPA 3BAXA 3AIQA 3ZOAA 1W1VA 3WENA 1V02E 3W7HA 2EXOA 4QNWA 3EMCA 5KZMA 1US3A 3AMDA 1US2A 3GDKA 1C29A 4FX7A 4AYSA 5ECUA 4OJYA 4PSRA 5IXEA 5CGTA 3BW2A 1JFXA 3IIZA 4GIAA 1TRIA 5I3FA 4O54A 2JFEX 4YL2A 3P5ZA 2EPNA 2XVGA 4JL2A 2CCRA 5CZ0A 4NNBA 5I6SA 1SYTA 1JUEA 4U2ZA 5FEPA 1J5TA 3LERA 3EYPA 3SCRA 5A3HA 1U5JA 5HPCA 4M7SA 1E6ZA 2XPKA 2DP3A 3DENA 3QPYA 1EUAA 1O7AA 4AHOA 1LL7A 1Q6GA 3WN6A 3JR2A 5DY3A 3TONA 1GWJA 1W37A 4LV9A 5D2XA 1SZEA 3C2VA 3TA6A 3M43A 3I68A 4UIOA 3W2MA 4LS2A 3UXAA 3W7DA 1UR1A 3L67A 1VJSA 1YTKA 1QVBA 4M8UA 4JL1A 3AO0A 1JCNA 3A5FA 3A23A 1NOFA 3NGJA 5CG7A 3IJ9A 4J3VA 7CGTA 1Y4WA 4NT0A 1W32A 3JRKA 3PB0A 5LHEA 4DUVA 1C8XA 2HSAA 1F73A 2XN2A 2C19A 4PRWA 4GI9A 3FAXA 3GKFA 4ORMA 1XSIA 2VR4A 2Z1BA 2ZRZA 3VE7A 2W61A 1KM2A 3BO9A 1AL7A 1N82A 1W2VA 5IHRA 1UWIA 1U30A 5ANNA 3VIKA 2EPLX 1M7XA 1W9BM 1LBFA 2YGYA 1TCDA 2Z0IA 3OVRA 3G0XA 4FFHA 4WQ6A 4AZIA 1W1YA 2A7PA 5AYIA 4DO5A 2WNNA 1J0IA 1WNOA 1QOQA 4FXRA 3GXNA 3W1UA 2QUTA 1OCQA 1JZ3A 2J8FA 1CXHA 1UWUA 2Y62A 1FCVA 2WSYA 1M01A 3VDHA 3AXXA 3ARRA 2XFWA 1QI0A 4S1FA 1TPWA 2PWDA 5AHEA 1KW1A 2QDGA 3EMQA 3FFSA 1XD1A 4B9YA 1V3JA 3L4TA 1HP5A 1WO2A 3DFNA 1BGGA 2E6AA 2ESCA 1E0VA 3ZJKA 5CSYA 1GVIA 1F4HA 1ZFJA 2GFTA 4BWLA 1TE1A 2EEXA 1GJWA 2D73A 5HJLA 5D9MA 3T0BA 3LBMA 3LHTA 4ZFMA 3ALGA 2ABBA 2BVTA 2TRSA 5FMCA 2WJZA 4O0KA 1WOAA 2PRLA 4U28A 4D2JA 4Z1AA 3CH9A 4CNNA 5KITA 3FAWA 5ABGA 3P81A 2YDRA 1B90A 3AHZA 4N9CA 1CLXA 3POHA 5HNNA 3HOJA 3C6CA 1Y9GA 1VEMA 2QHAA 5A8OA 3BSHA 1WZMA 2VCAA 3AS1A 4EANA 1CXLA 3NL5A 2YA1A 1V02A 4LTSA 3TFCA 1J9YA 1A50A 3W6YA 2PWHA 1Q45A 4LNYA 4W9TA 2CBVA 4DM1A 1Z42A 1DWJM 1QPKA 4JFTA 2YW4A 2WMIA 2FB2A 1TPDA 3K8LA 1CXEA 3EDDA 3AMCA 1DHKA 3W07A 4UTHA 1HL9A 4HMCA 1CDGA 3BAJA 3L0NA 1SO5A 3F5LA 1KV8A 4GQQA 4IPLA 1ZBWA 2GJXB 2ZWYA 2YL9A 4S2CA 4NZJA 2E3ZA 4R53A 5AHFA 1JF5A 1WB0A 5F1UA 5C71A 3BW4A 4FLRA 4TR9A 2PCQA 2ZUNA 4K7VA 4LVBA 5A6SA 1WDRA 5F7UA 3IIPA 5CPSA 4GZEA 2BNJA 3OSDA 1GVOA 2ZBTA 1LLZA 2B7OA 1JXKA 5HINA 2HMCA 3KF3A 3VCRA 1BSIA 4HPHA 3EXTA 2OCZA 5BMXA 3K4DA 2NX9A 1XBZA 3MP5A 1E4MM 4W93A 3SUWA 1CX9A 2J9XA 2CESA 4UMCA 4BQ2A 2E6DA 3LCIA 3BV4A 4UTKA 1R86A 3VI2A 4BA0A 4NUWA 3WL0A 2FHCA 2YIHA 2Y63A 5K4ZA 3K1DA 3G6LA 3OLGA 2ZRVA 2O7SA 1BPLB 4BCEA 1XBXA 3PZVA 3VKKA 1JJKA 2WQPA 4Z08A 3ARVA 3UGFA 1UA3A 3UXDA 1DOSA 3VM5A 1M53A 4R34A 5FMDA 2CHNA 1FXPA 2CWNA 4CQ9A 2JALA 3WMBA 2WMFA 4NNAA 3VGGA 3VIFA 1JNDA 7A3HA 4O1DA 3LHVA 2PRMA 2WC3A 5A2AA 5I2UA 3A9IA 4MUZA 4FX8A 2JKPA 3ZFHA 1EHAA 2Q8XA 1V3KA 5DLCA 2GJRA 2WZEA 5JUVA 5BXSA 3N9RA 3VGHA 5DMYA 3W28A 1LG1A 2IXUA 1ZJAA 4WUIA 1X1NA 2GJPA 5A8MA 4OBTA 4Y8FA 3TJXA 3OB8A 4RV8A 3CIXA 1V0MA 3DHPA 2X1TA 1XKYA 4W5ZA 1W3JA 2CLIA 4Q32A 2OSXA 1FWSA 3TTOA 1B9ZA 3AXHA 4QLLA 1BWKA 3K8MA 3S6TA 3WKZA 2C6QA 4JX4A 3PG9A 4AIEA 5GNXA 3W85A 5HNRA 1H7XA 1WZLA 1C91A 2VCBA 3UZJA 3M07A 1DTUA 3BW3A 3NQAA 5ABTA 2FQIA 1PL9A 2CLLA 2FPVA 2YXGA 3CPUA 2VNCA 3M5ZA 1FY6A 4X22A 1CBGA 3MUXA 5DBUA 1OF8A 1MYRA 1EDQA 3W73A 3L4ZA 4H6KA 4IJBA 4AB4A 4N4QA 3KL3A 4UQDA 4GINA 3OHIA 4CU7A 3U14A 3DBPA 1QR7A 4DEFA 5L6UA 5EBAA 2E5DA 4IMGA 1GVFA 4TMBA 3SJ3A 4OV9A 1RR2A 4JYEA 1W3LA 4OKDA 1E4IA 1SMAA 1ISVA 3VDCA 1MQQA 1P6WA 3AS0A 2F2HA 3LCXA 2ZXAA 2NSXA 1J4EA 1TPVA 3EWYA 3OA3A 4Z1DA 1UD3A 4D1IA 1G7UA 5K2ZA 2W5FA 3RILA 1W3KA 1FOBA 1GUVA 4V27A 1KTBA 2E68A 3DAQA 4CNOA 1OYCA 4IPJA 1QOPA 4EF9A 1V3LA 2FDMA 3J7HA 3M6DA 4LYPA 3WSUA 3HBLA 3WDQA 1W3IA 1LORA 3R13A 4O28A 2G97A 5D2TA 3RLVA 5BW6A 2O9OA 4FLOA 2E6FA 3RNDA 4LVGA 3PM6A 4HOZA 3IGXA 1TREA 3PSVA 3KXQA 4AF0A 2D0GA 4LVFA 2CLKA 1W8SA 3KOFA 4PMZA 3WQ8A 3WF2A 2Z6IA 3GH4A 3DKLA 4YCOA 2WWDA 1X8FA 3ARSA 2WKGA 3VD3A 2ZUWA 1K3UA 1UR8A 4UOQA 3BAYA 1BWLA 1EOKA 2GJXA 4M29A 1JUKA 2E6YA 3FY1A 5AY7A 1FCBA 5C2XA 4DUWA 4GUFA 2DH3A 3WK3A 4CD4A 3NDZA 2A7RA 3S5QA 1KM5A 1LLOA 3PUDA 2DZTA
chains in the Genus database with same CATH superfamily
2PAJA 3ARYA 4DPQA 4YFWA 3B9CA 4XSMA 4P9GA 3VNJA 3LD5A 1MQPA 3E5BA 3G1SA 3EDFA 5AYZA 2UYAA 1OQFA 3LZ3A 4LYQA 3JBG3 5LATA 4O4WA 4DIAA 1J3QA 3WP5A 4HZ8A 4S3BA 2GSYA 1U12A 1SZNA 5E93A 1K6AA 2CLOA 2PELA 1CYGA 1SW0A 4Y90A 4YG0A 5LA1A 3UKNA 4D6EA 3ACFA 1JZ6A 3H26A 4AG0A 3N73A 2GYIA 2P17A 4PTDA 2Y6ZA 1Y43B 3HJEA 3VNIA 2HEVF 4JICA 3NCOA 2PP0A 4TX6A 3QM3A 1LHNA 2DBNA 4NAMA 5K9XA 4IXLA 4LC8A 3RI9A 2CU0A 2GGGA 1A5SA 1RH9A 3LGEA 2O4MA 4QJ1A 1OX6A 4F40A 1U33A 2GK1B 5C4WB 5E16A 1RJ7A 2QIIA 1QEXA 2QDNA 4W6XA 1BRLB 4AOCA 3ONCA 2UBPC 1VB4A 2XGIA 4OHWA 4GBDA 3K8KA 3D4KA 1MXGA 2QDRA 1VEOA 3DCPA 5C8CC 5A1AA 5T9BG 2JQXA 4B29A 3R8RA 2XLAA 3T8QA 1RBAA 4CZSA 1XDLA 2I1OA 1BG9A 3NPVA 5JQ9A 1XYAA 3N18A 3WFLA 1EC8A 4HNTA 2RS11 2BOIA 4NX0A 3T1GA 3PWAA 3U2CA 1GP6A 3KLSA 3WUCA 3DI0A 4MPKA 4R3UA 5HR7A 3ZFGC 5BROA 4EVZA 2W94A 1G9HA 2QCCA 5HXMA 3ZJ6A 3Q8CA 1A3WA 2Y24A 3ATZA 2ZZQA 1UUMA 3W7JA 4COYA 4JNYA 3GHSA 5B2GB 5I93A 1REQB 2GDVA 3WLTA 5H8UA 3LENA 4JHOA 2OT0A 1L9WA 2CWMA 2WSQA 4GVIA 2UY4A 4NOTA 1LM1A 3QLLA 1M6JA 2TSYA 5KBFA 2YCIX 3H54A 3FYOA 1FH8A 5FYZA 5AECA 2E31A 1W6NA 2AQWA 3BDKA 2V2CA 4S23A 3KLKA 2WVVB 1MS3A 2VMFA 5D05A 2AEZA 1UASA 2GPTA 1RXGA 2B5HA 3MGUA 3PANA 3SGZA 4Q4X1 2XBO3 5T5LA 3U10A 1R2SA 1KGYA 4QXIA 1GVQA 4KMQA 3EWUA 1G4PA 4YGCA 2NVDA 1IZ3A 3LHWA 3LN3A 5LNRA 5BNKA 4KCWA 1AX1A 1WCQA 4PC8A 4PTXA 1OA4A 1YQCA 2RGMA 1EYEA 2NX1A 4KETA 4R27A 3SCOA 4TTUA 1GV9A 4CD6A 4HL0A 1TTQA 4GVFA 2Q8LA 2GU9A 4XZWA 3USBA 2PBGA 4JTKA 4YGDA 1E5RA 1DQUA 5FZLA 2BOJA 4J1XA 2WMKA 2RKXA 1KQRA 3CUJA 4I9JA 1BRLA 1AK5A 4LHKA 2JDAA 1FX6A 3LXAA 4R9OA 3GU1A 1DBTA 3ZYRA 2RHGA 4P9YA 1VFOA 4O1BA 4MZ1A 1EPZA 3DYMA 4AI1A 3G77A 2DV0A 2DZAA 1RVKA 3D3FA 1KTCA 3M5XA 1QUMA 2P3JA 1R85A 2D24A 4S2FA 2VG9A 2PA7A 1XQLA 4MDPA 1W1B1 3EOOA 3SR7A 4XPVA 4OQ8A 3FZ3A 1CIUA 3VO0A 1DGRN 2Y1HA 5F1RA 2BZDA 5EFFA 4XJUA 4RCXA 2KZHA 5JXHA 3HFTA 1ZUAX 3MPGA 2W9MA 2GALA 4RDYA 5FP7A 3UJFA 3H1WA 3GDTA 3L5LA 3W72A 5AHNA 1KCKA 8RUCA 1VCFA 2DSKA 3EA2A 3WD5A 2EKGA 1AQHA 1EF2A 4S3JA 4ZPIA 3B93A 4XF0A 4CLMA 5JR7B 4JIQA 2XLFA 2XIJA 4JZ5A 3C2UA 1GVSA 4XUGA 3D0JA 4Q22A 3JZVA 4QQ3A 4KRTA 4DJDD 1H63A 1UN1A 4L56A 1CX1A 2BERA 2PHUA 4XF3A 3NL3A 4PULA 4MSVA 1QQP3 1QPOA 1B35B 1Z78A 1GEHA 5F2LA 3W81A 3AVSA 1OVPA 2BFUS 1VJIA 3O7UA 6A3HA 2G50A 1A3KA 3KV4A 4GKLA 5FPZA 2Z28A 3CAKA 3NEHA 3UERA 3B8DA 1IV8A 1UZHA 1ZSXA 2WNOA 4MVTA 3U7VA 3KVJA 4AEDA 3MI8A 3MI3A 3T78A 4AEKA 3I2JA 5JMUA 2IQ0A 1XNDA 2Q5TA 2UWCA 1W8GA 2OU4A 1DFQA 4FCAA 2RM23 1M68A 3T08A 2ONEA 4L80A 5FJIA 3T1LA 2B7QA 3WUBA 4QB1A 4XO7A 4PTNA 1ZBA1 3TP4A 3WDYA 3AFBA 2VNGA 4AD0A 5GPRA 3P82A 3WNOA 2BNNA 3G1FA 5JLVA 5REQB 1FMD1 1GP5A 3GXDA 3VGDA 5EFUA 1VPQA 3L21A 5JI7A 6ALDA 1G69A 5G2HA 1HJGA 4H8HA 2K46A 4QXKA 4D8MA 2ISDA 5LBCA 1K8XA 4KGLA 5F5IA 4Q8UA 1RXFA 1F61A 4R4ZA 1HN1A 3BLFA 4AEDC 2VEMA 3GVRA 3QOPA 4DBDA 4L9BA 4D6IA 3VKJA 3VBOA 3AP6A 2AAMA 5LB6A 5EYXA 3C0LA 5DAQA 2REQA 4TWTA 2VGIA 2R9RA 3AYCA 3OBRA 1C8QA 3GNNA 2NV9A 4QDRA 4CCNA 3DG6A 5LA0A 4KWLA 2JDPA 4YTUA 3LY0A 1SFYA 1COV1 5A33B 1J3RA 3ZYBA 5C5TA 3W2KA 1QXJA 4PB3A 1B3ZA 3JU2A 5D37A 2VC7A 3F2CA 5C3RA 1FYUA 3UGHA 3AIEA 5FOOA 3BSGA 4UUIA 4UFIA 5AN7A 4FPGA 3RSJA 5E8AA 1W9WA 1XXXA 4EWDA 1SMDA 4N43C 2ISWA 1PM7A 3OGRA 2BGQA 2R1LA 2GSJA 5FZIA 3I7DA 2ZHNA 2X16A 3LGDA 4Y24A 4H8NA 3OVGA 4NHLA 3O0FA 4EZ4A 3LMZA 1WW4A 1YNQA 2WOQA 1FI2A 5FKCA 3WF4A 2TYSA 5LNUA 4ZTYA 2G3FA 4XACA 4COZA 2NXGA 4MFDA 1R9XA 1E5IA 3MB9A 2Y61A 1FWFC 2V73A 5LBBA 4K6BA 1XRFA 1JHJA 1VFLA 4KU8A 3JB4C 3ZN6A 4M56A 1H51A 3LIGA 4MIMA 3S0CA 2PHDA 2WKLA 2VOWA 3OVQA 1V9U1 1OM0A 5LHFA 3S2NA 4AWEA 3WBEA 3ROUA 1COV3 1ULPA 4MNLA 3KMHA 3I2DA 4I9TA 2OKTA 1I1WA 3RZGA 2ZCWA 3WBXA 2J1AA 2EQDA 3CHFA 5BZAA 3DFHA 1E0XA 1RTVA 2QFEA 5FIPA 1IIHA 3LGRA 3L65A 3UPWA 2I16A 3E6DA 3WQFA 3E9AA 1HVQA 1VEPA 1W1A1 4JY9A 3LCHA 1DIWA 2PTDA 3LE0A 1XLKA 2E9BA 2OZTA 4PTMA 3CGTA 2YB1A 1XLGA 2LM3A 2WQDA 1FWBC 4CQ8A 1V6IA 1D8CA 3QPZA 1UIPA 2WBKA 3EWDA 4HPNA 1F15A 2QIWA 4HMDA 1W6OA 4QX1A 4D9PA 5EY5A 2VW2A 4FXFA 1ENXA 1H1NA 2XIBA 1SU5A 4Q4QA 5M3WA 4PTWA 2W9XA 4L2NA 1HIZA 4GD0A 2DH2A 1OQDA 2NWSA 3NKTA 3TTQA 4KWSA 2ZUSA 4M80A 4S38A 5BNNA 4FO4A 3N36A 5J04A 3ZLHA 3IJ6A 4IGPA 4I3PA 1FWEC 1L2QA 5FZAA 3MSRA 4GO8A 1EEPA 2Y0IA 1NCQB 3D6EA 4LUIA 4U36A 5AHMA 1W91A 4JTEA 4B16A 1DQXA 1Z0HA 4UF0B 4KH2A 2WS91 4HA1A 2CZ5A 3H6OA 1GJPA 4POCA 3ISIX 1VF8A 1WMDA 1M5WA 3W1MA 3DL3A 1CPUA 4ARXA 2PLV3 1BQGA 3PZTA 3THCA 2YBPA 3V35A 3VD9A 3AU6A 5BNOB 3YPIA 4AI0A 1OXCA 2PAEA 2VZSA 3IV3A 2QJMA 4NUBA 3VBOB 1EJTC 2D3LA 3ZN6B 1XYZA 2R91A 1MS1A 2YBSA 1V8EA 3TN5A 1L6SA 3HGSA 2ZIDA 3VC5A 4JGYC 4K8GA 2CBUA 1RMU1 2AQVA 2WC7A 4EXAA 1PNFA 4A7YA 1YXDA 4LH8A 4H3WA 4D7SA 3V0TA 3RX3A 2GMEA 2H3BA 3DI1A 1BMV1 1SO6A 3S8HA 2WLZA 2DVGA 1KD7A 1X6UA 4MJZA 1HX6A 4L5ZA 4D1JA 3W1TA 3U0ZA 5HBFA 3VZMA 1KM4A 4LRSA 3WQCA 3NDYA 3BOWA 3BIEA 4XHXA 3O1UA 5DUUA 4WV8A 4BXSV 4HMEA 1VBD2 2YPIA 3AJXA 4WSHA 1GONA 3VDDC 1VFSA 2QV5A 3BQ6A 3EA1A 3APTA 1ND2A 4GWEA 4GA8A 1LEMA 5IK5A 3LI1A 1TPH1 3DFOA 2PXJA 4LT9A 3G6JB 1B3XA 3HPXA 4JYDA 1HRV2 2ASHA 1JBCA 7REQB 3BPSA 4IEQA 4JQAA 1V6TA 1W03A 2HPMA 4W4ZA 1XI3A 4Y6GA 4PDWC 4O1FA 3WF0A 4BQXA 3EDJA 5A2CA 1LWHA 4KCVA 1A5BA 3UF9A 1ALYA 3TAYA 3R6IA 4IPIA 2PDLA 2NYYA 5FYBA 4PYSA 3QQWA 2D3SA 4HTBA 1OZQA 2B4GA 5FJUA 4P5YA 5JAXA 1EAH1 4NI8A 4LAKA 3VBRB 2WO3A 3FJ6A 3O1PA 3VBSB 1RY8A 1ZJHA 1XB9A 1EJVC 3LOIA 4WVWA 4UCFA 1TUFA 1RHI3 1UP3A 3BARA 1Z7S3 5DMNA 3DEQA 2YC0A 1NG0A 2QDEA 3TV8A 1FATA 1O3SA 4P8VA 4V2XA 1UD2A 1TME1 2R8WA 2X0HA 4C8DA 4FT8A 1ZJIA 4O0ZA 4DLMA 3F4WA 3IEBA 2EAAA 2BY3A 1V4YA 3PTYA 3NQHA 3TWAA 3TYUA 3VBUC 1JI2A 2VECA 1LP6A 1DQ0A 3WP3A 3E5QA 5DZEA 4CA9A 1RQBA 3SEPA 1MZ5A 3SN0A 3ZPYA 1DIOA 3P62A 3I2FA 1AMKA 1O1ZA 3VCCA 3UXKA 1FRBA 1VIWA 1G7VA 3PY2A 2R063 1S2KA 3DUIA 2YB4A 3N2TA 3X29B 4ZZ9A 1LAJA 2GC3A 4JTDA 4D8ZA 1FVPA 1XS2A 3PZ9A 1N1TA 3AIUA 4YGBA 3W1LA 2MPFA 2WJEA 3HZ3A 3VKAA 3M2MA 1KBKA 3C8FA 1SACA 4M3CE 3IS4A 5FEXA 1AUYA 2HH9A 4E0CA 1OX4A 1LECA 4JRAA 3OEBA 2WSRA 3BC9A 3MUAA 4M1BA 1E72M 2CZDA 3WBAA 1QWRA 1I2PA 5FPVA 1EUUA 2CU5A 3URNA 1GKPA 1TPEA 1M7PA 2PLKA 1PB0A 5FY5A 1LOFA 3M3IA 1EJRC 2AMXA 1FUYA 3A3XA 1OIMA 3OLIA 4W8BA 1OD0A 2VD9A 3OPSA 1AJZA 4AF9A 1W6OB 2CLHA 4MM1A 5HOSA 1EXPA 3FS2A 4V33A 1MEHA 4LITA 5HMFA 3C0JA 2YYTA 3P2VA 3TTSA 1G9CA 4XYXA 2XVLA 2NQZA 1I1EA 2SBAA 3NNFA 1TSIA 1X8EA 1PPIA 5MF5A 1GZJA 1LHUA 3AWOA 3M0YA 5FO7B 4E4PA 5I24A 1QNOA 2Q4SA 3FBMA 2FGLA 4W8LA 3BMXA 3C2EA 2GSEA 3I3EA 2G95A 3ZMRA 2D97A 5G4HC 5C6MA 3PMSA 5J96B 4DUOA 2ZYFA 1T8XA 4LF1A 4A6OA 5A3WA 3BE7A 3I3QA 1TFVA 3CASA 3BCWA 3W75A 3H4WA 3WUEA 1EQPA 5JDBA 3W2JA 3WQ6A 3GR8A 1CNVA 2P34A 2VZTA 1YADA 2DT2A 1J58A 3U1XA 2CKRA 4XMAA 3VZZA 2YA2A 3NVDA 1QBBA 4FI4A 4F83A 4LFYA 2QR6A 3K13A 4YG3A 1ZGDA 2MEV3 5FXVA 3HB9A 1XLFA 4MO3M 5AB3A 3ITGA 4W65A 2ZX5A 2ZZ3A 3P74A 2VZPA 2UY3A 3Q8AA 4HKOA 5BNNC 3KVMA 4P7NA 4UNKA 1Y7VA 2Y2WA 4A3ZA 1NUKA 2R30A 3UGGA 2D7FA 3CL1A 4UC5A 3R0RA 4C7DA 3BTYA 3SIMA 1TJ1A 5KZDA 4HK6A 4RK8A 4XJWA 5IOBA 1W99A 5ACA2 3W87A 4QGNA 4N53A 1E15A 4F7ZA 1MQTC 1NXMA 1JMUB 1OD8A 3MSYA 2E63A 1H2MA 3O12A 5FZEA 3VUOA 3BCJA 5BOOA 3E0FA 2DUQA 3NSXA 2I7GA 1LRTA 3TEXA 3TTEA 5K0UC 3QEZA 4EPKA 2AZ5A 3MIEA 9RUBA 3VBFA 1PKLA 2ZJCA 1UKGA 4ZS2A 4Z2JA 3WQGA 2LS6A 2XBO1 1JVNA 5J5RA 3IDAA 5C3OA 3QZ6A 3ZYPA 2J4GA 1QATA 5FPBA 4ZCWA 4Q8NA 5HK4A 4GQ0A 4NY2A 3R1ZA 3AC0A 2V2DA 1SPPB 1H1IA 5DAPA 4UXAA 4M01A 1QJY3 1EJWC 3EHKA 3IWPA 2W1UA 3ZMNA 4PSPA 2Y7GA 4FFFA 3MUY1 2Z2SB 1HF6A 4ZU7A 1HJQA 4M6VA 1P0NA 1M1BA 5DN2A 1U1JA 5JOXA 4LAZA 5FZ7A 4IJCA 3QR0A 2OELA 1GQJA 3ZM8A 4DF2A 5F5AA 3A22A 1XIGA 1YQ8A 2ILMA 4FPCA 3RR1A 4MLJA 4PCPA 4FOJA 3WMLA 2FHBA 4FPLA 1CB2A 4LSBA 1UY2A 3UWEA 2G3IA 3PR2A 3NWRA 2GJLA 3T2QA 2JEPA 1S1AA 1GNYA 2OO6A 1LGNA 3NZ1A 2EG7A 3EX1A 3VYLA 2J8GA 1DXFA 1A8DA 3WP4A 3MHGA 2VZUA 1YXYA 1OGBA 2WNVB 2VEPA 4MPQA 4CEXC 1LDCA 4P5UA 4EN7B 2NUYA 3LCPA 1UZVA 3R0DA 1AYN3 3AXMA 2N7GA 4BF7A 3V5CA 2YDSA 2X5IA 5CU1A 4XURA 5FYYA 3USUB 2XH4A 1WDWA 3T7VA 1POKA 4OUIA 1DWFM 1DIDA 5L19A 4CRQA 1DWGM 2OMAA 4BK9A 2WT0A 1IE7C 4A7ZA 1OGSA 4B2DD 3UZXA 5LXEA 4QROA 4M4PA 2CZEA 1JHNA 5FLHA 1Z7S2 4JQTA 1C8M2 1MW0A 4IXXA 4AXKA 3A4XA 4EKJA 1F2NA 2ICSA 2OS2A 3POSA 3ITTA 3QZEA 2EVXA 5FZ0A 1NU5A 1WOBA 2CBIA 2YU1A 1TV3A 1NJJA 4Y5Z0 4JTOA 3I54A 3ELFA 1HQLA 5CYYA 4MWAB 3W27A 4QAIA 1I45A 5BWFA 2ZQ0A 1S2TA 1POV0 2QCLA 5HWNA 5XIAA 4S3DA 4KCTA 3MPBA 3C3NA 5FCZA 4GLEA 4HN4A 2VXNA 4M24A 4MYEA 4PCFA 1VBE1 2JENA 1GNHA 1CIWA 3CXOA 4UZUA 3HMCA 1WYIA 1H1MA 2AENA 3HG5A 3VNKA 5A69A 3KRZA 1LWIA 5FF3A 2HBTA 5DCDA 1OJXA 3SECA 3TW7A 1ZZBA 3ZXLA 2XJSA 3KV5A 3KTSA 4WSKA 3UKTA 1ZA7A 3OGVA 4PUEA 3RO6A 3B4YA 2GZWA 5APAA 1ZL1A 5B80A 4UYBA 3P8JA 3WQ1A 2O8OA 1LHWA 3PNAA 3N13A 2VQUA 4CU6A 4XTPA 3PHMA 4O0QA 3MW7A 3GKAA 1CLVA 4HU0A 2RGLA 3QQ0A 3MLJA 1E1CA 2JKXA 3ZSLA 5A8NA 3GNPA 2G0WA 2YGMA 3V56A 2ARXA 4CEWC 1Q66A 3SQOA 4UOZA 3WCRA 2A2IA 3BB6A 4Q1PA 1PDZA 3VCNA 3PBVA 3WQVA 2WQ4A 1UNBA 1OOPA 1TIMA 5E6ZA 3TYAA 4P9IA 4LKDA 1HGWA 1YMYA 1PHMA 1H11A 4MKNA 2BEOA 3I2IA 2ETEA 5HWMA 2ZFAA 4XHBA 3HG4A 2XTKA 4GK8A 2GJNA 1OUXA 5T26A 3SCHA 1KD0A 1R2TA 3DCQA 3N3MA 2Q01A 2Z42A 3IT8A 2BODX 2QAPA 2X8RA 3AVRA 2V4VA 4JQ3A 3THQA 3PZIA 2W6RA 4L7ZA 2AREA 4AEFA 3W20A 2VQAA 1TELA 1WZAA 1QT1A 2JDMA 3BVJA 1I2NA 5FF0A 4M0NA 3O63A 4WZFA 4CTEA 3VPLA 2WPBA 2BWAA 4FOVA 2VUCA 3NL1A 3D0CA 2RJHA 5FF7A 3W53A 1L0PA 4IGSA 3EJKA 4ZQMA 3S42A 1JYTA 4GOAA 3FDGA 2RJLA 1ZBA2 5K0UA 2ZGKA 4YZ4A 5JPMB 2NV2A 3LD8A 3PUAA 5GALA 5KHKA 3RLGA 2XYLA 3CHDA 1CONA 3TYJA 4OYUA 1H8VA 2PN5A 5K9YA 3DDMA 5GJMA 3TAOA 1PVC3 3FGCB 2TNFA 3GLCA 5U7SA 4HP5A 3U6WA 1AA1B 4QPIA 5FBJA 2V0TA 2HE8A 2VVFA 1UU6A 1OT5A 2GVYA 4UFHA 1I0DA 1TWDA 5SV8A 2HWB1 3IIOA 3V3WA 2JG9A 1YPXA 1NM9A 3WX7A 4IV3A 4US5D 4RLIA 2B39A 4MHUA 4PBEA 4PL1A 4EWAA 4BI6A 2YA0A 1O3RA 1V51A 2DYCA 1EV11 2GSHA 4BOWA 2IPJA 2VZOA 2F9RA 4PUUA 2O56A 2GN7A 1VBB3 1SFLA 5K9CA 4Q2FA 3PJXA 3ZVHA 2E7AA 2OYZA 2WB5A 4L9YA 2A71A 4BMBA 4WM8A 3WNXA 2NXIA 3HQ1A 4TIMA 4WJ8A 4CNTA 2XUCA 1X38A 1COV2 1FP9A 4M3PA 4HCHA 2ZZ1A 4Y1YA 1STMA 4J7RA 1XXNA 3Q45A 4P7OA 1QW7A 5D03A 6REQA 2WZR2 5EB8A 4MGKE 1H9PA 1P7TB 2XOMA 1NLSA 3KS7A 1RUG2 1RBLA 1TVNA 1VE0A 3PFMA 1GYLA 4W8AA 1X9TA 4LO7A 3AIRA 1JUBA 1O91A 1HL8A 5J48A 3S57A 2A6NA 5FZOB 3G18A 3K3NA 3G1VA 3W83A 5CSRA 5DAVA 5T91A 2Y26A 1ZJBA 4RGKA 1T6GC 1XJAA 4LB3A 1ONAA 3F95A 2YBUA 3GC5A 3LCGA 4LBQB 3AZZA 4PT6A 1XYFA 4WKFA 1W9UA 4BMEA 1BVP1 3EOEA 3N11A 1ADSA 3TQVA 1ZBCA 1BBT3 4K6AA 3WLKX 3U75A 4JHZA 4PRTA 4YW5A 4XETA 5EFDA 3CB8A 2VO5A 2DFCA 2JDNA 1ICPA 5BXPA 4HJWA 1Y9MA 5FXZA 3I59A 4ZSTA 1W06A 3CIVA 1RPKA 2OZ8A 3GTFA 3M1ZA 2R1NA 5F2MA 4FOUA 1YRRA 5HUPA 2POZA 3QV6A 7ENLA 1J6PA 4DELA 1X7NA 2GNTA 1XCXA 2VD8A 4XWUA 3BG5A 2XM1A 1RCOB 4AVVA 3NAVA 4IIEA 5M5DA 1WMEA 3B4UA 4ZONA 3BMWA 5FYIA 2BGOA 4QKNA 2ZABA 3V0BA 2NP0A 3WUFA 3V7PA 4E8DA 4R9AA 3QHMA 1O8PA 4AEOA 4CD7A 1RYYA 2IXVA 4A8RA 2ZUVA 3WXPA 1KFWA 4IEUA 1JPHA 1KLZA 1FT9A 5FK8A 1I75A 3IJ7A 3RMEA 4HZFA 2WSPA 3NGFA 4K20A 1FNYA 5C9AB 4O4VA 2BBFA 3BCFA 1YHFA 3SNMA 1GK8A 1TMQA 3WY6A 3W4RA 3MLLA 1UY4A 1DL3A 2JKBA 2VM8A 1RUC2 2WXDM 1X9PA 3Q94A 2HEYF 3NQ7A 2BXVA 4P8XA 4AF0B 1JYXA 3CZEA 1C9WA 3V5OA 3VNDA 5A5WA 4FX6M 3L2MA 5JWPA 3LLFA 3SJNA 3WDIA 4C65A 4JIEA 4ZSUA 5FJPA 4MY9A 4OV4A 4LNVA 2I07B 3MBFA 3UETA 4DS0A 3SRFA 2QQLA 3GDBA 1Y0EA 1AR61 4Y9PA 4H83A 2CIPA 1H2JA 3HVDA 3KRSA 1BGAA 1QQP2 4RQPB 1K7XA 1DHPA 4GISA 2ZGLA 3SH3A 4U2AA 5G05L 5D33A 3ZFEC 3W3OA 1Q6LA 2WO5A 4QIUA 2WKKA 3SI9A 2X2YA 4QX3A 2YLAA 4U10A 3R4IA 2SLIA 3O1MA 3C61A 1XV8A 1JPKA 2Y7EA 1ZAIA 1H8TC 2VVDA 4N9IA 2A7NA 1PGW1 1F3WA 1XH0A 4PBFA 1SW3A 2TEPA 1KXHA 2P88A 5LZLA 3QKZA 1LTEA 1CGVA 2BDQA 1GG0A 1PGL1 1P48A 2VUYA 4L64A 4P9JA 4JTNA 3AI0A 3MPPG 3A4AA 3THDA 4Y9MA 5IBXA 3M5VA 1OHLA 1UZ4A 2ZGOA 3L7RA 1H0BA 2QPUA 4CCDA 4UTIA 4BKNA 1OIFA 1XX1A 2QCGA 3JUUA 1SSGA 3ZLFA 1UPIA 3T30A 3M7WA 2TAAA 1EC7A 3O16A 3ANYA 2EG8A 1MS9A 1OVSA 3ZXFA 4P7RA 3V5FA 3ACLA 4J35A 2BOEX 2VOKA 4C6IA 3MO4A 4W84A 4WZCA 3AS3A 4F0MA 4GULA 3UGVA 4LA2A 2CDPA 1WE5A 2A3AA 3Q8BA 4R7JA 2D6MA 4I7UA 3WOGA 2ZZ2A 4GUHA 2FJKA 3IVTA 4O11A 2LROA 5AHLA 4OCTA 3KT4A 4WK9A 3SISA 4NPRA 2NMNA 1S3HA 4Y1VA 5CPMA 5CSSA 4N02A 1XE8A 4XILA 2DDUA 1LL4A 1UKQA 5G2WA 5FZMA 1KDKA 4LBQD 4B4QA 4EN8B 3S47A 1IG3A 1UYXA 2D5FA 3BTXA 2VZQA 1IEXA 2NX3A 2YX0A 5CKNA 5I03A 4XZLX 1OC5A 2F38A 3IRSA 2OXBA 3UNDA 1OCJA 1X96A 1GVRA 5A8PA 1RJPA 4Q4V1 3VKDA 5D21A 3GGLA 1YYNA 1LJ7A 1QNYA 1JD7A 1X36A 2HWC2 2E09A 3OA5A 2QUNA 1EA0A 2YY1A 1POV3 1K9EA 3LBCA 4CNUA 4EAYA 5FKBA 2XGZA 3TSDA 1X39A 2O1QA 3NEVA 3VMNA 1Q8JA 3MHUA 1JRBA 4LEQA 1DBNA 1FMD2 4COVA 2ZA2A 4DXKA 2AGSA 5TF0A 3WD0A 3L68A 1V6WA 1DGWA 2RDUA 2WAOA 3ZPOA 5KETA 3EB3A 5XIMA 3H7VA 3CHXA 3CUZA 1Q6FA 3ZSSA 3I8TA 1J3PA 4PLMA 4QE1A 4IGNA 4JFVA 4MUVA 4H9YA 5JOWA 4RXFA 4PQ9A 1U5IA 4KERA 4I5RA 3O6AA 4YW6A 3O1NA 3PPGA 1TTJA 4O14A 2PLCA 5F3CA 1C28A 4MGTA 4Q4MA 2VTXJ 1M06G 2W1WA 1A53A 2VKZG 1CAXA 4EE9A 1Q8QA 3TN92 5HA7A 1R3TA 3BPWA 2FJUB 1XNBA 1CXKA 3E0IA 3TQKA 3U4SA 1BMV2 4R7OA 1XIHA 4E5TA 5I8YA 3SXWA 3KDOA 1UPMB 3K77A 1S2UA 1EQCA 2FVKA 5IVEA 3ALQA 1RA0A 3PVBB 1LT8A 1H50A 4IL2A 1AYM3 1Q2RA 2WM0A 2MNGA 4GPNA 3ZDVA 4Q4Y1 2FBEA 1IGOA 3GB6A 4J5NA 4XVEA 5AYBA 5FY9A 4Q4V3 4Y7EA 1T5AA 4O50A 1NDYA 3PVFA 4RE2A 2ARBA 1B09A 4C1NA 4WHBA 5D02A 4LXLA 4RS5A 3FOKA 1CLKA 1K9FA 3MHFA 2QQMA 4JOMA 3LYEA 4DZ5A 1TB3A 4IQLA 5JBDA 2R32A 1Q6QA 2VUAA 1SHWB 1JIBA 4LAOA 1CWYA 4ZENA 4I7VA 4P14A 4P8UA 5C55A 3UWYA 3PTRB 1CJPA 3R0UA 1CXIA 4XQ6A 1AYN1 1D7PM 3TCSA 2R072 3VNYA 4L1WA 4PMOA 2J7DA 3KW3A 4XQDA 4IFOA 2FQPA 3HNBM 2VZ3A 2HS8A 2R94A 2X8KA 7TIMA 1BYDA 1LRQA 1LR5A 4PMDA 2JB4A 3K2GA 2PF8A 1QW9A 2PHWA 3LOBA 1VBGA 1R87A 3R5EA 3CNAA 3AXEA 4X60A 3MBDA 2XH0A 1UY3A 1J18A 1JAEA 3TR2A 1X1OA 4DZHA 4IMCA 1ZCOA 1EWEA 5G5IA 1V7YA 1EPXA 5EGRA 3WY1A 4HVXA 4Q4X3 1LOEA 4W88A 3N2XA 4HNOA 3VIMA 2JECA 3OF1A 1O5QA 3E1F1 2VH9A 1MVEA