4CCDA

Structure of mouse galactocerebrosidase with d-galactal: enzyme- intermediate complex
Total Genus 220
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
220
sequence length
644
structure length
640
Chain Sequence
GAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GALACTOCEREBROSIDASE
publication title Structural Snapshots Illustrate the Catalytic Cycle of Beta-Galactocerebrosidase, the Defective Enzyme in Krabbe Disease
pubmed doi rcsb
source organism Mus musculus
total genus 220
structure length 640
sequence length 644
ec nomenclature ec 3.2.1.46: Galactosylceramidase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59
A PF17387 Glyco_hydro_59M Glycosyl hydrolase family 59 central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ccdA03
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ccdA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ccdA01
3GNNA 1ZL1A 1J0YA 5DN1A 2Y2WA 4CU8A 2BZNA 2CHNA 3M5ZA 2EF9A 2O7QA 2TMDA 2ZRYA 5CG7A 1W9PA 2WWCA 3VPLA 3W74A 5BROA 3FXYA 3PY2A 3BH4A 1DWFM 4JYFA 5CLWA 3TMLA 2YR1A 2G41A 1DORA 1I45A 1X1ZA 4FHAA 1E3ZA 5SWUA 2GQ9A 1ZENA 2Y62A 5E0CA 2VQUA 3C2EA 1I75A 3TFXA 4HKPA 1W1TA 3PZIA 2VXNA 2J7GA 4HNUA 1UA7A 1SFSA 3CTLA 3W87A 3BLEA 3LRMA 2GUUA 4M19A 4Z0SA 4N9BA 3OLDA 3FEMA 4PBGA 2WMGA 4LT9A 1QOPA 3UD6A 2E1DA 2J7HA 1I8JA 4AXKA 4J3WA 1VCGA 4J7RA 2Y5EA 4NT0A 1TO3A 2B7PA 3N3MA 1H7NA 5IHSA 1G94A 2DIEA 3OB8A 1UYPA 2OSWA 3C2RA 2ZA1A 2Z0IA 3W73A 1TRDA 1LRQA 2XGIA 2Z1BA 3VIGA 4B9ZA 3WBEA 1GEQA 4UFHA 3S1UA 2EPKX 5CXPA 5C54A 1W3HA 3HOJA 3O6CA 4TO8A 2JF6A 3VIOA 1CW2A 3EWZA 1K7XA 4ZVJA 1KTBA 3FFSA 2J47A 1KM2A 1ZJIA 1KGUA 4NJJA 1JL8A 4FIRA 3PAJA 3A9IA 2VZUA 3W37A 2CETA 2Y85A 3A3HA 3P61A 1XYZA 2A7RA 5CPOA 5A6MA 3IK2A 3VKKA 3DKJA 4UTWA 4OT7A 2VFHA 4WOQA 5D2TA 1PEZA 2WLYA 3AHZA 1OK6A 2YDRA 3HJEA 3SCSA 3W2UA 1TPDA 3ZQ9A 4ZEPA 3AJ7A 1KXTA 2E77A 3CUHA 2ZUNA 2NXGA 2R8WA 4MADA 2X1RA 3WNKA 2JE8A 1U83A 5CPSA 4Z0JA 5D2WA 3NOEA 1KV5A 4GFSA 1XCXA 2PF0A 2YKKA 3B05A 1JUKA 3MSDA 2YLLA 1A53A 1YDVA 1QR7A 5HMSA 1R2SA 1GUVA 4LYRA 4Z2HA 3O16A 2V3GA 2ZE0A 3TH6A 1W5NA 2DZVA 3G1XA 5U4NA 2VO5A 2JKEA 1F4HA 3AXIA 2GJXA 1QI3A 4CVWA 4F66A 1U2YA 1TB3A 5AFDA 1ZY9A 2TYSA 1KA9F 5HR6A 5JIPA 2G8ZA 3G1YA 3A23A 1U33A 1MZHA 4O4VA 3W1TA 4J3TA 3LHVA 2VZTA 3OIXA 1WB0A 4A2RA 1B30A 1FH9A 3CHEA 3NIYA 4A3YA 4AZCA 1CYGA 4R53A 4NF7A 3SCOA 3EDKA 3BG5A 1G4PA 4W7WA 1W9DM 4H2CA 4UFIA 3AIQA 3IEBA 1SFLA 5I3KA 1MWOA 3ZMRA 4X9YA 3RJXA 4Q7NA 1P0NA 3S6TA 1WDPA 3PZQA 1VPXA 1VZWA 4ZENA 3BW4A 4LVBA 2W79A 1KFBA 3WH6A 5CZJA 4Z08A 2ZZ3A 1SZFA 3G8RA 4LTSA 4PMDA 3W6YA 5K9DA 5DCEA 1MXDA 3CBWA 5DF0A 4GZEA 3SCRA 3EDFA 1DP0A 3W6LA 1CDGA 5BNKA 1TPWA 1QHPA 3WD2A 2WKJA 5AC8A 1SQ7A 1EIXA 2EHHA 2H6RA 1M6JA 1HJUA 3OVRA 1JZ2A 2QCLA 4KKXA 3ARVA 2YA0A 1H7WA 1CXEA 2X8RA 3N9KA 2VJXA 4IMDA 1UH2A 4N4PA 3NMBA 1DV7A 3K1DA 3I7SA 2PWEA 3NL2A 5KZMA 5BWFA 2D1ZA 4TX9A 3GLCA 1E56A 3AMGA 8CGTA 1E4NA 2DZSA 3LXCA 2BFGA 5FEXA 1K7EA 2VX6A 1KM0A 2QQVA 1IXNA 4IMGA 4EOUA 3WDIA 1ZB5A 1AQ0A 1JYVA 1NOWA 2V2DA 1EO5A 3EMQA 3DFQA 1E55A 4PMVA 4IX0A 2G97A 2WK2A 1LOQA 3C3NA 3E1F1 3PZTA 4DXVA 3UWYA 1GNXA 3N2MA 4CNOA 2UY5A 3W82A 2DZXA 1G0CA 3LHYA 3TK7A 5BRPA 2OJPA 1H1YA 4U3AA 1C93A 4AD5A 3W26A 4OBTA 4JTLA 3WUFA 2J9ZA 3TQVA 1XXXA 2VOMA 2H3DA 1E0XA 1UD4A 4RL3A 3AIBA 5ANNA 1MW2A 3FHQA 4QLLA 2WMIA 4EIVA 4RV8A 1J10A 1GORA 3VM7A 4JXCA 5IXEA 1A5BA 4MTVA 3IGUA 2YJQA 2OLHA 3W85A 2TAAA 4MNLA 5EFFA 1VEMA 3P81A 2NXHA 5BYWA 5FEZA 4CNNA 4MDPA 2D20A 5C5YA 4KFNA 1F73A 1R46A 5HNRA 2B7OA 1CXFA 1WE5A 1OFPA 3IGXA 1UWRA 1EDGA 1BYCA 4OUEA 1EP2A 4MYXA 3W75A 4E0CA 1GOOA 1X1OA 3RK8A 1GOXA 1BTCA 5FF0A 3U5UA 4B1MA 1JCMP 2R14A 3VUPA 3U57A 5I3JA 4XX6A 2V5CA 5F4SA 2B4GA 1MXGA 1GZJA 1GOMA 2FHCA 4JS3A 4XZBA 3S5ZA 3MMTA 2H8XA 4AHOA 1GOKA 4FX6M 4OBRA 4GZJA 1MQPA 4JD4A 2WSKA 3FYPA 4PTWA 4W86A 1UB3A 2VKZG 3BMVA 2Z6IA 3UG4A 3DU0A 4CVUA 2C19A 1HKKA 3HG2A 5F2LA 3P74A 5CSSA 1F05A 4R34A 4ACZA 1SFJA 3AMKA 1OIFA 3S0CA 1B3XA 1G4SA 1UKOA 5AHEA 3PZNA 3P80A 1IIHA 5AHMA 4UFMA 3WJXA 3LFIA 1CLXA 1E6ZA 2ZZ1A 5BMWA 1OWQA 2OT0A 1C8YA 1GTHA 3PG9A 1US3A 3N12A 2CW6A 4JNMA 1WAWA 4DUWA 2XN1A 3VD4A 1UR2A 4JN6A 5FKBA 1OGSA 1C91A 1E4MM 3WQ4A 1V6XA 3VI2A 2V5BA 3UETA 5LHEA 5HBFA 1F74A 3DXIA 5C6MA 3G1HA 2GK1A 4O50A 3VDCA 3MW7A 5DY3A 1ZFJA 2JGYA 1M53A 5FMCA 4LRTA 4M6VA 1GOQA 2PC4A 2J77A 2KZHA 1GT8A 4MOZA 1MW3A 1W1PA 3KWXA 2DSVA 3U8GA 3EBVA 2DEPA 4TVCA 2VFIA 4RZ6A 4J9JA 2BHZA 5KZ6A 3F4WA 4AMCA 1N7KA 1SR9A 4MUZA 3LX9A 4V28A 1IZJA 1C90A 2WB5A 4POCA 4H8UA 4JIQA 4XWUA 2PCQA 1C8QA 5FMBA 3PTKA 4EF9A 1SZNA 2YFOA 4HU8A 4FFIA 2ZUTA 5A2BA 4LPCA 3HPXA 3P8IA 2BWGA 4G1KA 4HPJA 3B8DA 3IIXA 4IPJA 1QFEA 2HSAA 4O53A 6TIMA 3VD3A 3ZFHA 2X1TA 2C14A 4X9SA 3QPYA 3W1XA 2IQTA 2WVSA 1QAPA 3SUSA 5CKSA 2X16A 1H5YA 4ORMA 3PTQA 3WQ8A 2V3FA 3JR2A 1PJ9A 1E15A 3C61A 2EO7A 4J28A 1OBAA 3ZIZA 5D04C 3MUZ1 3S2CA 4PTXA 3GVGA 3LDRA 2A4AA 5DELA 1QNOA 4V2XA 5FL0A 1SW3A 3KF5A 1OK4A 2GJNA 1SZEA 4IUGA 1PIFA 2ZZ2A 1D3CA 3W38A 4N6FA 1B4EA 3KVJA 1JQVA 4ICNA 4M24A 1QHOA 4X0NA 3P7YA 2Y8KA 4KGJA 1WZKA 2G3JA 2ZXQA 5T26A 4HA3A 1KFJA 4XBKA 1H7PA 2HVMA 2VOTA 3AYRA 4JFVA 1YTKA 2DSUA 5LKYA 1JDCA 3B8SA 1AQHA 3W72A 4AW7A 3T0DA 3BAXA 4XQ6A 4QAIA 2YFNA 3ZO9A 3LXAA 3WDPP 1KCKA 3BGJA 4JX4A 2QCEA 1X6LA 1FDJA 1EHAA 1YLVA 2DH3A 2YBTA 3QR3A 1TVPA 4CKQA 4WZHA 3W24A 3UWZA 1YXCA 1JDDA 3VNZA 4W5UA 3WNNA 3FJLA 2ZTKA 3ARYA 3F1QA 4TVUA 4YCOA 1GQKA 1D3GA 4AWTA 3W7EA 2W92A 3GXDA 3L68A 3L67A 1FCUA 2CERA 4NX5A 4M81A 4Q22A 3U7VA 1QNRA 4Z2GA 5AYXA 1ZAHA 5E6ZA 2O9OA 1Y0EA 4I7WA 3B0PA 3GDLA 3L21A 4R7JA 1W3IA 1W3LA 1XYFA 1X7FA 1W3NA 2CZ5A 1B0IA 3M6DA 3NQGA 3L2IA 4A22A 1HT6A 2J7CA 3HMCA 3PBGA 3VMPA 4D6IA 1EUNA 1LYXA 2EPOA 4FX8A 1JI1A 5AYBA 1VHCA 1JFXA 1SPQA 1PAMA 3WMCA 2DJLA 1V02A 4WIWA 4JKKA 1VAHA 5C55A 2VNCA 1Q6GA 3N9RA 1EPXA 3UWUA 1GPFA 1XFBA 4Y6GA 3WY1A 3NPVA 2VZSA 4HU0A 2AOSA 4H04A 3HF3A 2V9DA 3G3DA 3FYOA 2DSZA 2ZZ7A 3K8KA 1HN1A 2CESA 3MS8A 3GDTA 4IMEA 1H09A 1SZGA 2PRHA 2XJ7A 1G4TA 3AIWA 3VU2A 1K9EA 3CHFA 3PZOA 3LI0A 2VEMA 3SFKA 3O2LA 3UZ5A 4LRSA 3WNLA 4FXSA 3F5KA 3CQ0A 1UA3A 1N8FA 4OQVA 4M6QA 3NQ7A 1JZ5A 3VGGA 4PMQA 4CU6A 2YL5A 5A5WA 2ZUSA 2W5FA 2XIIA 1XCFA 3F5LA 4J3XA 1RD5A 2FLIA 3GK0A 4MB3A 3NXFA 2QR6A 4ONVA 5G5IA 3L2MA 5FL1A 5G1TA 3BG9A 3VD9A 1KWKA 1UD2A 5EPDA 3UPWA 2JFEX 1FWWA 3GZAA 3HGJA 5CG0A 3CWOX 4BFAA 4PMZA 2NX1A 3ZS4A 2A0NA 1I1WA 2RDUA 3W88A 1WCGA 2GJRA 4N42A 1WDWA 1M03A 2ZX8A 1IF2A 1MXSA 4O54A 4UR8A 2XIBA 3K4AA 4PTNA 4R5EA 3TJXA 4UTWC 5H2ZA 1A47A 4UFKA 5EKYA 4E4PA 2XN2A 1OX5A 2Y7EA 3LTYA 5K9XA 3WQVA 3N19B 2DDXA 3WJWA 2NLIA 2WSQA 4UXDA 3NDYA 5AHNA 3F03K 3SC7X 1JNDA 4M8UA 3GNRA 5CGMA 2AAMA 1WXJA 2ALDA 2NV2A 3W7IA 3A22A 4WY0F 1OYCA 3G6MA 1RZMA 4E38A 5A8GA 1TCMA 4PTMA 3ZJKA 3TIMA 4GUJA 5HOSA 2CLIA 3THCA 4Z2JA 1DQXA 4JX6A 4DPPA 1E1FA 4B9YA 3ARRA 3WUBA 1OF6A 4RE2A 5A6BA 2V8ZA 4PSPA 1TUXA 3LV5A 2A6LA 3GX9A 2E5CA 1E1EA 1HVXA 3ALFA 3C8FA 3C4UA 3H55A 2DGAA 2WC3A 3TV8A 3QW4B 4ZQNA 2WZHA 5K4ZA 2X0YA 3GYCA 1GVQA 3KX6A 3GIYA 4IWWA 4BQ4A 5A6BD 4QSHA 1UJPA 3KXQA 4LXFA 2XVKA 4AEEA 3MHGA 5ABHA 1SSDA 3W7CA 3TJLA 1QHZA 5KTLA 4MB1A 3BG3A 1W32A 3DECA 3AZSA 2BVYA 4MY1A 3VDBA 1XDLA 1TVNA 3SCPA 2QEZA 2FPVA 1V3LA 3W27A 3TSBA 5F1VA 2A7PA 1D2KA 2VEKA 1TCDA 2CBVA 4JTEA 4GINA 3AS1A 4W7UA 4YHGA 2ISWA 5EBUA 3TQ0A 5D9MA 3OSDA 3LPOA 1JZ6A 1WQ5A 2P0OA 3GBDA 2D23A 4QJ1A 1BVNP 1MW1A 1D9EA 4JDYA 3O15A 1H0IA 1R7AA 4BCEA 3C2OA 1JCYA 2WCAA 3W2LA 1P5BA 2YL6A 5A6SA 2OYMA 3WEOA 4KWVA 3VIJA 4CD8A 3ARSA 5F2MA 5FESA 1ICSA 2W4XA 1X6UA 4CD7A 1PZ2A 5ABFB 1H60A 3NNTA 4UQ9A 5D05A 4J3VA 1RQBA 4Q32A 5IBXA 1W5QA 4N02A 3BV4A 3IAQA 3GZ3A 4JQTA 1JF6A 3M16A 4KFPA 1F5ZA 2GVLA 4X22A 3QPZA 1BFNA 4O18A 5D9PA 2XGBA 3WF3A 1KQYA 3APGA 1ZNNA 3C2FA 5M03A 3PVFA 3U14A 3RDKA 4LUJA 3THDA 5AC6A 5HUOA 3SGUA 4FFFA 1CGYA 2CZEA 4HTYA 4WJXA 2VFDA 4ZXOA 5FOOA 2TRSA 1LBFA 3BAYA 1VFMA 2R94A 5LNWA 4JICA 1KM1A 3TCEA 3O6DA 2WVUA 4Y8FA 4D6DA 1TMQA 1E5JA 4HN4A 1W2TA 3CO4A 4W7VA 1TG7A 1SSGA 3EEGA 4MNJA 4JTKA 2QJHA 1AW1A 4O13A 3ZR5A 3EXTA 2XQRA 5AC7A 3S1WA 1OSEA 2VC9A 3J7HA 4M5PA 2XVPA 1HVQA 2CHOA 3LRLA 1ST8A 3TTSA 1T99A 5FIXA 1XUUA 1ZAIA 4EVZA 1LWJA 4AHQA 1V0MA 1LL6A 3AIRA 3MP4A 3L4VA 4QAWA 5DFAA 3WSUA 1QOXA 1C9DA 1WX0A 2WMFA 2ZOXA 4JHOA 4UTHA 1PZ3A 3IIVA 4Z2LA 2VURA 1YXYA 3VIIA 2NT0A 3E96A 3D3AA 4GJ1A 1CLVA 1UHVA 1XDMA 4AAJA 3USBA 1W56A 1H50A 2BXVA 2WKLA 1XBYA 1KLZA 3THQA 2D3NA 3AMDA 3L4TA 3E12A 4ML9A 1FWTA 4NJKA 4UNKA 3H3LA 4HP5A 5CZKA 5I77A 1BAGA 2HISA 1W3JA 3W7OA 1PVNA 1UWIA 3M6YA 4L4LA 1F2JA 2IXUA 3N17A 3HG4A 3WENA 3W2JA 2AEYA 2E68A 3OGSA 4PCFA 4OV9A 5D02A 1KBBA 3U75A 3ARUA 1R30A 2ZRUA 4W8AA 2Y4SA 5D9OA 5GNZA 1ME8A 1DKWA 3L4WA 2CLEA 1BHGA 1VYPX 3G1AA 1V3KA 4FNPA 4OZOA 1NWSA 2WVTA 3I6RA 1TREA 1ESWA 5D33A 1LOSA 4XUGA 3NQ6A 3AJXA 3MMWA 1MYRA 2P1FA 1NWTA 1E4IA 1JUBA 1VH7A 1QI4A 4ML4A 2EPHA 3VOCA 3GR7A 3MYPA 2V81A 3IRDA 3Q37A 1NWUA 1IXPA 3PBWA 1BF2A 2ZUVA 4UOQA 3WDJA 3TC6A 3RMEA 4ADTA 2B7QA 2PE4A 5CPTA 3C56A 2QCGA 3OEXA 1FQ0A 4BI7A 5LYRA 4W89A 3EKZA 4JCLA 4PYSA 4WF7A 4PMRA 1TRIA 4JYEA 3F5JA 4JIPA 1QO2A 1XSIA 2BTMA 3L9CA 5DBTA 5BW6A 4AD4A 3HQ1A 3WF4A 3PC0A 5LA1A 1YADA 3WD4A 4I7VA 4MAVA 1OCQA 4M29A 3TROA 1XBVA 4WD0A 3LGEA 2CNCA 3T09A 3B06A 2DT2A 2E3ZA 3ALGA 3VGHA 4EKJA 4XTIA 1C92A 2V2HA 3CHVA 3LTSA 1Q4NX 3UWQA 1ODZA 1EH9A 2FH6A 1TTQA 4TUFA 2ZA3A 4LW7A 1IT0A 4FLSA 1F7BA 4JY9A 1OGBA 3BAIA 4O19A 4IJBA 2WV8A 2ZX5A 1LBLA 5DLCA 1VIWA 4AWEA 5E70A 3SURA 1VQTA 4MLRA 4W8BA 3W7NA 3O05A 4JTJA 3WH8A 3BSHA 4QHZA 3SCUA 2QCMA 3ATZA 4P8WA 5K2ZA 4PH6A 4EANA 1JRCA 1WA3A 3CEPA 3WH9A 1JYXA 1E43A 3BLPX 5FEWA 4U28A 2J8FA 3NCOA 4WKFA 2W6RA 4Y7EA 1LLOA 2WMHA 2WW5A 4U2YA 3M5VA 3H53A 5D9NA 3T78A 2CPUA 5J5DA 3W4RA 1OF8A 3M5YA 1KR0A 3BGGA 2Z1KA 2ESCA 1Y9MA 4WXZA 2Y8VA 4AZ6A 3QOKA 2VFEA 3VDAA 1J0HA 1EQCA 3AZRA 1KFKA 3G0UA 4O52A 5A94A 1CX9A 4QNWA 3JUGA 3ELFA 4LOCA 2PC8A 1VJSA 1CIUA 1OFBA 5A2AA 4BR1A 1NOUA 1K8XA 2D24A 3ARZA 4JTTA 1MW0A 4AD3A 3WNPA 2A2IA 4RK8A 4FB7A 1YQ2A 3EX6A 4XB3A 4D6JA 1XV8A 3P84A 1XC4A 1H51A 1G6CA 1MQRA 3NR0A 1B3YA 4GC4A 2XM2A 1O94A 3FOKA 2YSWA 1G7UA 3MSGA 1S5WA 1HP4A 1K9TA 3SUTA 4CD6A 1JIBA 4AMAA 3HMJG 1ML1A 1B90A 1GQJA 1KGXA 1TA3B 4YWIA 1VYSX 3R89A 2WBGA 4QQ3A 2E8ZA 1UZ1A 3CUGA 4U3CA 3RLVA 5D4YA 1FDZA 4AB4A 2FPYA 3AO0A 1V0KA 4QCFA 1UH3A 4HNNA 2NX9A 2YPIA 2X09A 4D6FA 3NDZA 4PUEA 3DYMA 1LF1A 2CU0A 4F9JA 4A4AA 1C8VA 3UXDA 2PWHA 1KM6A 3QQ1A 3DFOA 2EJ1A 4GKLA 1UUMA 4GUHA 3PULA 3S5YA 2AC1A 1H7RA 1LQ0A 2WC4A 5ABEA 4LVGA 4H6KA 2NW0A 5LGZA 1RV8A 5AYYA 4P7OA 1ZALA 3W71A 3AQUA 3UR7A 4AEFA 3LXBA 3CT7A 2E6DA 1O6IA 3A4WA 4P61A 3QOMA 5C70A 1CECA 4GNJA 1MQQA 5G4WA 3AIUA 4TOQA 5I23A 1BQCA 3L4XA 1XBXA 1TYGA 2ZIDA 6TAAA 3OG3A 2IXVA 4E2BA 4S2BA 4GIAA 1H5VA 4K7VA 3QC3A 3HJZA 4NZJA 3TXVA 1O7AA 4PCSA 4QDMA 3KVKA 4MJZA 7TAAA 2E8YA 2PWDA 2Y70A 5D30A 2GPTA 4YHEA 3CLWA 1LCOA 1JZ8A 3VNDA 3M46A 2VZVA 1S5TA 3W07A 4CLMA 4LGXA 1H1ZA 2RFGA 3NQVA 4O11A 4N4QA 3GNOA 1UUQA 3AMLA 3W81A 1V02E 1FWSA 1LTDA 1QPOA 1VYRA 2F7FA 3NVTA 2OWXA 3ZT7A 4O1AA 1UR8A 3H54A 4HSOA 1HP5A 3BCDA 4F8XA 2WHMA 3HIJA 3A4AA 3AROA 3STGA 3KL5A 1Y4WA 3WEMA 5L9FA 4D72A 3LMYA 4Y9AA 1E6NA 1Y7VA 2DT1A 1LL7A 1HUVA 8TIMA 1GG1A 1LDCA 4WOZA 2A3CA 2X1SA 3AHYA 3ARXA 4JKLA 5IM51 4XUYA 3WUEA 3EWXA 2G3NA 3SCQA 4BI5A 5DBUA 1J2WA 3EMCA 5D2XA 3MP3A 1BG4A 4D1IA 3ARTA 1CGUA 2X2YA 1GYNA 2R91A 2QMKA 4AD2A 3L4YA 3VKJA 2C8NA 1W8SA 3TXZA 3BPWA 2NWSA 2W91A 3IIOA 4B5NA 3KAOA 5CZ0A 3BCFA 3R5EA 3PR2A 5D38A 3UQNA 3KZSA 4UTLA 3TW6A 1W37A 3W3OA 3TE9A 2VEPA 3INPA 3G0XA 1D7FA 1VBUA 4P7RA 2DJXA 1OB0A 2WNWA 1P0KA 4WSJA 5HXMA 1CGTA 2A3BA 1MFVA 4GUFA 4WX2A 3SW6A 1JNEA 1ZBKA 3M7SA 3LPPA 3GXNA 1VFUA 4NJGA 2FGZA 4K68A 2YIHA 4JTIA 1L6YA 4DBDA 2JIEA 5LNRA 1UWUA 4WQ6A 4FLQA 3PSVA 3TU9A 2B7NA 3HBLA 1ISYA 4D71A 2VCAA 2FH8A 1VJIA 3PWAA 4UMBA 4NQ1A 1R8LA 5FD0A 2VVNA 2OX1A 4TU1A 2QCHA 2JALA 4M82A 3ZWSA 4EAMA 2QJIA 4NZCA 3DBPA 3G24A 1OT1A 1VEPA 3ABRA 4P7NA 3HPSA 1OX6A 4UTUA 3UGGA 1OFOA 5AC5A 2B0MA 1WDQA 4FLRA 1OIMA 4DM1A 1WAUA 3VGFA 1UYQA 4E8DA 3NQDA 1EOKA 1I2QA 2VX7A 3T2QA 2Y24A 3DAQA 2PRLA 1B2YA 1W3KA 1WBHA 2JK2A 4AD0A 3LCWA 3TTQA 2BSLA 3WH7A 4PEEA 4FNQA 4CN6A 2JKPA 5ABGA 5A8NA 3NYDA 4HXCA 2E9BA 3K8LA 2JEQA 1EP1A 1LM1A 3VIFA 1W91A 3N1AA 2EBNA 4OU1A 3MHUA 2E9LA 3AIVA 1FFQA 4GI6A 1OFAA 3LLDA 4EWND 5HPOA 5BXTA 1X8FA 1UR1A 3KVMA 3GKAA 2A7NA 4I9AA 1QOQA 2JEPA 4PCTA 3QGVA 2WOQA 3IJ9A 3U2OA 3NO5A 4JDBA 3PIJA 4Q33A 2NUYA 2C7FA 3O07A 2F84A 2J4GA 3LHZA 3GM8A 3LPGA 3ZSSA 1TPFA 1RP9A 1UD6A 4ATLA 2Q3RA 1OD0A 1KTNA 4UNLA 3N11A 3W7KA 3W22A 2VL4A 2E5DA 3ARPA 4IM4A 1UWQA 4C7FA 3RLUA 1LROA 1W9UA 3WK2A 1NSJA 2XPKA 4WKAA 3CB8A 4AF0B 2DU2A 3EX4A 2NX3A 4S1FA 2CXGA 3NM1A 1YYAA 2YGYA 1OG0A 2VT0A 1W5MA 2XN0A 3K4DA 4AWUA 1LLZA 4GI9A 5A6KA 4BWLA 4IGHA 4NXKA 2C0HA 1FDYA 4ATDA 2XSAA 3OA5A 1QW8A 2OCZA 3A5FA 2ZXBA 4FXRA 4RXGA 1L6SA 4GXPA 3RNDA 1NOFA 1TJPA 1FCQA 2C15A 3DFNA 1UQYA 4O12A 1S3HA 2V5DA 5LA2A 3TOPA 3UY7A 1FP9A 4UTFA 3ZWTA 3BLKA 3ZT6A 3NJ3A 1TTJA 4IX2A 2UY4A 1V6WA 4FFGA 3TSDA 2W62A 3DC0A 3TP4A 4TX8A 3W1NA 2OZ0A 4LS2A 1IZKA 1Y9GA 2XVNA 1Z42A 3G6LA 4FK9A 5ECUA 1H4PA 1VBRA 1J5TA 2NUXA 5EYWA 4X3ZA 3POHA 4LYPA 3BAJA 3S42A 4N0RA 4W87A 4FNTA 4UNIA 3VIPA 1FXQA 1HL8A 3FKKA 3RM8A 3VFLA 1E6PA 4MYAA 2X05A 1UWTA 3RMJA 5GQBA 4OOZA 2DZUA 4D6CA 5FF4A 5F2IA 2A3AA 3VE9A 3N34A 4C1KA 4LWWA 3GXMA 4C7DA 2VX4A 4DQWA 3IANA 2PWGA 3EXSA 3T2OA 4FX7A 2BS9A 1KW1A 4PRWA 3T4CA 1UASA 5FF7A 1I2NA 3VE7A 2WAGA 2EAWA 1HJXA 4B16A 1VRDA 2YYTA 1HKIA 1OGGA 2AMGA 4M80A 1QNSA 4J3SA 1FHLA 3SZ8A 1VF8A 4W85A 4NX0A 1WZAA 4XBSA 3KFTA 1XD0A 1HF6A 2VR5A 3G8EA 4CCEA 1BTMA 1NARA 3W7GA 3O6YX 2EPNA 5DO8A 2O9TA 1LG2A 2WMJA 3WNMA 2O92A 4Y96A 3G1VA 2EQDA 3G0SA 2WSRA 5TBOA 5IHRA 1JZ7A 1PIIA 3MANA 4CNPA 1RVGA 4HNVA 1DWGM 2XWEA 2VI0A 3VGEA 2E4TA 3PZMA 3VCRA 4AC1X 4RZ5A 4WSKA 2V30A 4DBEA 3UGHA 2DSKA 2E09A 3HGRA 3DHUA 4LUIA 5LZLA 4BQ2A 2VUYA 2CBJA 4TTGA 4MIMA 2A85A 1JJKA 3TUUA 3CHCA 2C13A 3LHWA 4HNTA 1GJWA 3CTTA 1JCXA 4UQBA 3IIZA 1UKPA 2BLEA 2FTPA 1K8ZA 4IXHA 4NJHA 4WJEA 1R7OA 3W29A 3GDKA 1Q6FA 3T2PA 3W53A 2Y63A 2QF7A 3WMBA 4QITA 1EDQA 2E9MA 3SGZA 1Q6EA 3QF0A 2J74A 4O1BA 2RKXA 1K3UA 1P4CA 1CPUA 1QBAA 2W61A 3WFZA 2ZICA 1LG1A 5BOOA 1JCJA 3L65A 1XSJA 1NH6A 5FEPA 3U5YA 3W1PA 2FB2A 5L6UA 2O9RA 3SUVA 1GJUA 5HWNA 4JFWA 5D32A 4MZYA 1FP8A 1ODUA 1FUYA 2WKGA 4IPLA 4E2DA 3VMNA 2WPBA 1Z41A 3HO8A 3NPUA 1JGIA 1GQNA 4W93A 4CGTA 3CZLA 3WDRA 5EA9A 4MAZA 2RH9A 1KQZA 2UV8G 2XFWA 4O10A 3V75A 4MZ8A 3LIHA 3A24A 1KR1A 3GDRA 3IV3A 4CN4A 3DHDA 1PX3A 1GPWA 4QCEA 5I0DA 1TV8A 1UBSA 4NZFA 3AS2A 2HMCA 2ISSA 3E9AA 5E1QA 1TFVA 2ABAA 2VTFA 4OJYA 2CZDA 3N9SA 5HWJA 2A5HA 3Q94A 4O28A 1H0GA 1JXJA 2DSWA 4F9DA 4YL2A 3WK0A 3S8HA 3FN9A 4PMUA 1TV5A 2FIQA 4WK9A 5AHIA 1MSSA 3WF2A 4O1CA 1MEWA 1VB9A 1OFRA 2E6YA 5G2WA 4UOJA 3W7RA 2RDTA 3I3EA 4DUVA 1XC6A 5DT7A 4U5KA 5LSMA 2BHYA 2QKFA 1KTCA 5ABFA 1M04A 3GYEA 3W7HA 1Z44A 3DI1A 3PZ9A 1QPRA 1OABA 1C8XA 2V38A 2A1YA 4TMCA 2DT3A 5BCAA 4ORIA 1G9HA 1ITXA 1E51A 1K9FA 3LBCA 3QSTA 4M7SA 3C2VA 5HJLA 3NQ8A 2WMKA 5CZSA 4UQCA 4Z1CA 4WY0A 3QJAA 2G4FA 3MKKA 5AYIA 4GO9A 3QMTA 1JF5A 2XUCA 3NPXA 3VX0A 1L6WA 2DP3A 5ABTA 3LEMA 2IUZA 3CUIA 3FY1A 3VMOA 1AG1O 1GVYA 4NJIA 5KINA 2J25A 4O4WA 1DJQA 1LOLA 5U7SA 2WWDA 3CMJA 4FLOA 4D6GA 4Z2IA 4IMCA 5G2HA 3SECA 2E40A 3CWNA 4OIFA 1FOBA 1TSIA 2GVGA 1HL2A 4KWWA 3PF3A 4D2JA 4UQAA 1HNYA 3PM6A 2NSXA 4IUOA 1NP2A 3QHNA 3W1LA 1ZU8A 2VRQA 1TTIA 3F4VA 1DOSA 4PTVA 1SW7A 1G5AA 2C1HA 4ADSA 4PN2A 1E72M 2BY2A 1HXJA 3RM9A 3B4UA 3WMSA 3P62A 4IMFA 1FCBA 1EHNA 3UESA 3WDQA 1A5CA 1VS1A 3R2GA 2C6QA 1UD8A 4B3LA 5AYZA 1GYLA 3NL5A 3DYOA 2GFTA 2ZFAA 3IVTA 1KM4A 1K02A 4ZQOA 5LNVA 4K36A 5DCDA 3WQ5A 4NXSA 4ZFMA 4CQ9A 3MO7A 4M56A 4U4MA 2J79A 1G7VA 5DXYA 3NYZA 3SUWA 2GQ8A 3ABSA 5D03A 2OSXA 5C2XA 4BQ5A 5K9CA 1WOBA 4GQRA 3VINA 3TONA 1B31A 1O5XA 3FA5A 2YDSA 1EX5A 1US2A 3OBAA 1H11A 1Q6DA 3V1PA 1B3WA 1RP8A 2XWDA 4HZ7A 1AL8A 4HPHA 3VD5A 2BX7A 5DXXA 3GTNA 2NZLA 2GDVA 4AYSA 4PA8A 3B9EA 1TIMA 1MO0A 3I68A 4H4IA 5JBFA 1TQJA 2VC6A 3UXAA 1KFWA 1FY6A 1NF0A 2HTMA 3LOTA 3W2KA 3A47A 4PUDA 4WKHA 1X6NA 3G1SA 3MUIA 1E0WA 3N14A 2GJLA 3O1NA 3HN3A 3RU6A 3W7QA 3GH7A 4DO6A 1XHGA 4S2CA 1AW2A 5KEZA 2ZQ0A 3MP5A 1BLIA 4OGZA 3NQAA 1VEOA 3QQ0A 3WNOA 2ZRZA 5BXRA 4HA4A 5I3FA 2GQAA 2P10A 3BARA 3NQMA 4ZQMA 2YOCA 1TPVA 4H41A 1ZBWA 3BLIA 2J7FA 4MKNA 4KGLA 4O0KA 4NI3A 4JTGA 3E02A 2QMJA 4MPKA 1W2VA 4PC8A 2ATMA 4OOUA 1W31A 2CZFA 2QAFA 1L0PA 4JTHA 3T40A 4FNRA 5F2GA 3DFTA 4P7QA 4WY0B 4UZSA 1KBJA 3W7JA 1MEHA 1UD5A 2PI6A 3CMGA 3CZJA 4AZ5A 3KRSA 3L66A 4JX5A 4AIEA 5CSRA 1OHLA 5CGQA 1E70M 1Q45A 2E6FA 1RH9A 3KL3A 4ZXLA 8A3HA 4HMDA 2G95A 1QVBA 5EBAA 2CCRA 1FH8A 4Z1BA 1GWJA 2CLOA 3L0KA 3QFEA 1DWIM 1B9ZA 2YDQA 4EF8A 2CLMA 3NSNA 4UTKA 2FHFA 3NL6A 4H7VA 3I65A 2F61A 4QLJA 1UR4A 2DT0A 3CGTA 5CPQA 3G1DA 1GQIA 5G1YA 1GOIA 3W7PA 1WZMA 5CJ5A 1VC4A 2CFFA 3LIGA 3O6AA 2MANA 2QCNA 4CQ8A 3POCA 1E6RA 1V0LA 4PEKA 1WKYA 1K7FA 1BG9A 1R86A 2GOUA 5D2YA 3C0JA 3OVPA 2AAAA 1O5KA 3NSMA 2E0PA 3QH2A 1CWYA 1WP6A 4LVAA 3EXRA 5D2VA 2YZRA 4RKAA 3D0CA 4CCCA 2FDSA 1G1YA 1BPLB 1XH2A 1CENA 4LY8A 1EA9C 3UGFA 1CI1A 3NZ1A 3KRZA 1H3GA 3AS0A 1UOKA 1ME9A 4QM1A 3TA6A 1E73M 1GHRA 1PS9A 2CLLA 4FO4A 4IXXA 1XBZA 4JYDA 1QNVA 2FB3A 4BWLC 3PZUA 3WK1A 1F6KA 4O0ZA 3W1MA 1M7XA 1ZS2A 4H8HA 3CH9A 3BLFA 2GJPA 3FAXA 3IIPA 3FS2A 1TA3A 5D8WA 4PFMA 2QJGA 4K8HA 5H91A 3VIHA 3NUKA 4HOZA 3A5VA 4AEOA 1VRXA 1SR0A 2QLYA 3PUEA 3NL3A 4UTTA 3T0BA 1VFOA 3GDBA 4HHPA 2TSYA 5HNNA 3OGVA 1SU5A 1W9VA 4UZUA 1U5JA 4UMAA 3Q58A 3LCLA 1J18A 5C8BB 4K7YA 2EGZA 4BA0A 3LCGA 4GQQA 2X2GA 1PCWA 1B3ZA 4PMNA 4A3HA 5DMYA 2FFCA 4PL2A 2J8GA 3VO0A 4LU0A 4A29A 3DH7A 2WNZA 5KITA 3GDMA 1TR1A 3PBYA 3PG8A 1E9LA 1TJRA 1GW1A 1HJVA 2WPGA 4J3UA 1S5VA 5MHBA 1EGZA 2BY3A 2VCBA 2YBUA 1EQPA 3QMSA 3AXHA 3UWWA 1GCYA 4W9TA 2YW3A 2ZRXA 3Q2DA 4AZIA 3FJ6A 1UKTA 4PMOA 4XV0A 4V27A 4X2RA 2YL8A 2UY2A 4MB4A 4UR7A 4CCDA 5CLTA 1Q6CA 4B1LA 2EPLX 3IVSA 2HS8A 1J0ZA 3WJZA 3LHTA 5FKCA 1BKSA 2CWNA 2E6AA 3W2NA 1J0IA 1TMHA 1FA2A 2GUYA 2FQIA 3IJ7A 2WBKA 1G67A 3O8AA 1MFUA 4NRRA 2ATSA 5CSUA 6CGTA 1CGXA 4NNBA 1TTPA 2G5WA 5DY2A 4XZ9A 5FI8A 1UZ4A 3P5YA 2XSBA 3HGSA 4NU7A 3UR8A 5A8QA 4ZQPA 3JS3A 2ZDRA 1OT2A 5JBEA 4EE9A 3W23A 1ZBCA 5D37A 1LWHA 5LNSA 2V3DA 1W1VA 4DEFA 3AI0A 4D6HA 1FWNA 2J7DA 1SW0A 2BXYA 2TPSA 2PWFA 1GVSA 3UG3A 3KOFA 3CC1A 3ANYA 3LV6A 4WXYA 4LQ1A 3K46A 4LC6A 4JGDA 2DIJA 4OHQA 3UPBA 2UWFA 1KXQA 2J6XA 4O1DA 3VGBA 4UTIA 4JCMA 1JI2A 4UTJA 4QFUA 1LL4A 2WZIA 1EO7A 4P8XA 3AOFA 1H49A 1FFRA 3B03A 3M41A 5EY5A 3W86A 4ALDA 1C29A 1XD1A 2Z1SA 4QP0A 4AZZA 3TC7A 3UYCA 3MMDA 4XKYA 5A6AA 1OVDA 2NV1A 3NA8A 1NWRA 4M1RA 1B1YA 1MEIA 4U2ZA 2ZXAA 3L2LA 4KH2A 1PE1A 3FHAA 1WO2A 3PTMA 2ZXDA 5HUPA 1K6AA 3GB6A 3GXFA 3PS7A 3ZM8A 1H7OA 3GAYA 2OWWA 2AGKA 2VFGA 3RPMA 4K37A 1JDAA 3SR7A 3BGAA 2DZTA 2XFYA 3VIMA 3U1XA 3NQ2A 3WDHA 1SMDA 1GG0A 1BVZA 3TMQA 1OM0A 7CGTA 1WZLA 4JTUA 3LCXA 1CEOA 1K03A 3WJYA 4YPJA 5FMDA 2WYSA 2H90A 4W88A 4HT3A 1PV8A 1I2PA 3MBDA 1R47A 1OFEA 2HS6A 5KZDA 1ALDA 1H61A 3WK3A 3MO4A 3A21A 1QW9A 3BXWA 1JRBA 2WVVB 3WD1A 4AZ7A 3LHUA 5AHLA 2C18A 4GUIA 1BYDA 3GNPA 3B0VC 1CXIA 4W8LA 1OFDA 4NVTA 4UOZA 5BMXA 3STCA 2D73A 4P2VA 3M43A 5J5RA 1J12A 1IIGA 1QDSA 2QHAA 4B3KA 1W2PA 1XH1A 4FMVA 4UR9A 4XZWA 1FWRA 1DJNA 1AVAA 3LDKA 5E0KA 4IPIA 5FCZA 5AOUA 3UY8A 1UH4A 3IAPA 4F79A 4C1LA 4TIMA 1ISWA 4DELA 1NM9A 4S3JA 5F4WA 4DWSA 4HZ8A 1O4UA 1Z32X 1DHKA 1WV2A 2J62A 1M01A 3SIMA 4DM2A 3FNDA 3VIKA 2WO5A 4MFDA 3WKZA 4R27A 3SY5A 1KB3A 2EKCA 1JZ3A 5TD4A 1M7PA 1UD3A 3CM4A 1LORA 2D0HA 4DWSD 3LM7A 5BRBA 1P6WA 4RR4A 3S5NA 3WN6A 2VRJA 2VZOA 1V3JA 4W5ZA 2ZTJA 2RGLA 2NUWA 3ABQA 4X0VA 4AHPA 2QPSA 1EDTA 4RX0A 3LBMA 1HO1A 2GVYA 5JUVA 4OBSA 2CKRA 1HJQA 1PPIA 2ADDA 4A21A 3FAWA 4IPNB 5LA0A 2J24A 4ZQRA 4K8EA 3S6DA 4AF0A 2Y61A 3BK0A 3MJYA 2VELA 1DWHM 1I4NA 4P7LA 2PRMA 1XM3A 3M07A 3L5AA 3M9YA 3AHVA 2CBIA 4TTUA 1A3HA 5AN7A 4FFHA 4UCGA 4FF7A 5TIMA 5TQLA 2GSJA 2OYKA 1RD6A 1OYAA 1PL9A 3MBFA 4Z1AA 1WPCA 1G69A 4RE4A 1OYBA 4HSNA 3M44A 1B4KA 3SJ3A 1PCKA 3BW2A 1NF7A 1QWGA 2G3IA 1R2RA 2XHYA 1V3HA 3STFA 1W54A 1RQEA 3WJSA 3GNDA 4Z1DA 1OD8A 1E6QM 2DZWA 4XKYB 3TDFA 1KFCA 2ZBTA 1E4LA 1EUAA 1IXOA 3MYOA 2W66A 1DTUA 3CZKA 4LS1A 3N18A 5CSYA 2VX5A 3TSMA 3W1RA 3MMUA 3PUOA 1C7TA 5A3HA 1PIGA 1TPC1 1KWGA 4MJ2A 3ZJ7A 2JIWA 1OFQA 1S46A 3I7QA 3M7WA 1W0MA 5LHFA 2J9XA 3ZR4A 4N2YA 3MI6A 1HKJA 3MV11 2Y7FA 4N9DA 2D3LA 3AICA 3E49A 4K6AA 3KF3A 2QCCA 4MVAA 4H8VA 4GPNA 1QPNA 1DHPA 3UWVA 4WUIA 4GRSA 3S9YA 2J78A 1SO6A 1JULA 3AZTA 1EWEA 4TMBA 1T0OA 2J75A 4HPGA 3ABOA 3S1XA 5LNUA 1TV7A 4N9CA 4O8RA 3PZGA 2BV9A 1E40A 5DT5A 5HWMA 4RXFA 1UR0A 2NXIA 3LPFA 3BW3A 5DEZA 3T08A 2QF8A 4DPQA 3RFAA 3W84A 4O15A 2XFRA 3RF9A 5A69A 3BC9A 2J7BA 3OLGA 2X0HA 1IGSA 5K4XA 1ISZA 1OINA 2FPTA 3TAOA 1C7SA 3DYPA 3WL0A 2ZUWA 4KRUA 4ZE5A 1DWJM 1KBIA 4DWSB 2Q8XA 1V0NA 2FGLA 4Y90A 3P82A 4YCPA 2E5BA 1LJYA 4LVDA 1AMYA 1UKQA 1V3MA 3CPUA 3KE0A 1FXPA 3QRHA 2X1UA 5EB8A 2X1IA 4DF2A 1XSKA 4KMQA 5A8MA 1B9BA 4K38A 4N6EA 2UY3A 2YA1A 4BK9A 5IBXC 2J9YA 4U5IA 3EYPA 3MU7A 1VLWA 3CHDA 3B0UX 1GTEA 1V5XA 5CPMA 2VVSA 3EDEA 1O60A 1GVFA 2JKAA 2Q3OA 1TQXA 3I3BA 5A95A 3WQ6A 3OLEA 1PHQA 4XTDA 1J11A 1W5PA 4Z2KA 1VHNA 3LCFA 3S5OA 4GXMA 1JCNA 1VENA 1JVNA 2FJKA 3YPIA 3B04A 3SCNA 3SCWA 5M5DA 3AHXA 2WZEA 2Q8LA 7A3HA 3NM3A 1WDRA 2WANA 4MJMA 2VEIA 3A6OA 3W28A 3CIXA 3PSWA 4AD1A 4E2OA 5I3IA 1A50A 2WNNA 1UWSA 5AY7A 1CXKA 5IFPA 3PZVA 3VILA 1JD9A 4PSRA 2V5LA 2QQUA 4GE8A 7TIMA 1ADOA 2ZRVA 2AEZA 3AISA 3LDVA 3CLMA 1HFBA 2QCDA 3N2XA 2ZCGA 3MUXA 4ZZ9A 4UQEA 2ZZ4A 1L8NA 3RILA 3U7BA 1AW5A 4JFUA 4MPQA 2OWCA 1IXQA 4RJEA 1XUZA 3KL0A 5GNYA 1A5AA 2NWRA 3A4XA 2QPUA 4NRSA 4CD5A 1EWDA 4LC8A 1R87A 2GJXB 1LP6A 4R33A 1CBGA 6A3HA 1A5SA 3AHTA 5BRQA 2WHLA 1B3VA 1EOMA 2AQWA 4FIQA 3EDJA 1W5OA 3EDDA 3PBUA 3RM4A 3W70A 2WQPA 5CGTA 1BSIA 4FEZA 2V0TA 1UR9A 2Y89A 1Q3NA 3HG3A 3N04A 2V2CA 1ECEA 2DZPA 4KFOA 2ZZ6A 5DCBA 4AZCB 1JG9A 2OSYA 3OA3A 5GPRA 4RCXA 4ACYA 6ALDA 2WJZA 5A8OA 3OZOA 1NFBA 5HR7A 2ADEA 3EX3A 2VCCA 4KWUA 4RE3A 1V3IA 2RHGA 2PB1A 5HQEA 3RO8A 4HPXA 2QAPA 1I1XA 1E6XM 2A3EA 3TNOA 3M0ZA 5F4XA 3WD3A 4LVFA 4UTTC 1WOAA 5G2IA 1THFD 2QDGA 1JYNA 1EB3A 1J9YA 4UUIA 3EWBX 1ME7A 2OYLA 3E0IA 4TVDA 2I1OA 3WQWA 3QYQA 3VNYA 4GBUA 1SYTA 1QI5A 1ZCOA 3L0NA 5HINA 1TZ7A 4A3UA 1GVOA 4K39A 5CPLA 3CPRA 4AY1A 2H8ZA 3RCNA 4C7GA 3OVQA 2XYLA 1X1NA 1DEDA 3UNDA 2ZX7A 2Y7DA 3B9DA 3GR8A 4TX6A 5C71A 2WSPA 2CEQA 3MWAA 1CTNA 4BZYA 5JIWA 3WBAA 1H7XA 3M5XA 3P5ZA 1HJWA 3OG2A 2ISVA 2OMAA 5FKYA 3IGSA 3BSGA 3C6CA 1T96A 3HB9A 2QCFA 2O9PA 3NSXA 4AVFA 4JY8A 1OX4A 3CUFA 3ZJ8A 1XGZA 1QCWA 1E3XA 1FCVA 1FX6A 1E71M 1UUOA 3BVJA 4JZ5A 3T0AA 3FW6A 4PODA 5BXPA 3GXTA 4N9EA 5A8PA 1G4EA 1JQXA 2WNQA 5KMYA 2XVLA 4UFLA 5A6LA 1R85A 3QZEA 2WM0A 3NG3A 4D1JA 3R12A 5G4EA 5FK8A 2A3HA 2B31A 1Z48A 2C16A 4AZBA 1QBBA 3QHOA 3UEQA 3CU2A 4U33A 1VLIA 2WC7A 1E5NA 4CUCA 5I24A 3WFLA 3ARWA 1KFLA 3JRKA 1TPUA 2WMIB 4QLKA 4IQLA 4O57A 5I78A 4E8CA 3S5QA 2QCDB 1QPKA 1MVYA 1YTDA 4BF7A 1GONA 4DO4A 3OHIA 5KSWA 3BAKA 3OIHA 2EPMX 1V08A 3SUUA 1ZBVA 5I3GA 2BXZA 2QDHA 3II1A 5A2CA 1HJSA 3W7MA 4AH7A 3UZJA 1HO4A 1KLYA 3MV01 4ZE4A 3GH4A 3VGDA 2Z2UA 4LV4A 5F1UA 4LS0A 1J0JA 1K9DA 2WSYA 2ZZ5A 4B15A 2YL9A 2CLFA 2QUUA 3EX2A 4OWGA 3THAA 4U31A 4A2SA 2Z6JA 2VENA 3MI3A 5EL1A 3FKRA 4AIUA 3PN8A 2W67A 3WFAA 1VCVA 2YA2A 1H63A 1M5WA 3VDHA 4MJ4A 3IVUA 1ICQA 3W76A 3NAVA 1VJZA 2V82A 2BVDA 2DH2A 4H3DA 1EXPA 1YDOA 4AXNA 2ZWZA 3PUDA 2EEXA 3EWYA 4YXGA 1IV8A 2YYUA 1KXVA 3EB2A 3D5HA 1ZAJA 4OKDA 4BS0A 3RIKA 2YLAA 3R13A 2PURA 2F2HA 5KZEA 3W7LA 4ACZB 5D09A 3EWWA 1HIZA 1V7YA 5HPCA 4AISA 1B57A 2OXBA 4BI6A 1YXDA 1JFHA 2D0FA 1J4EA 1VCFA 1Q6QA 2WCGA 2I14A 1BYAA 3OLIA 3EX1A 2J88A 1CGVA 3AFBA 1JUEA 5AHFA 4JAWA 4PL1A 1W1YA 1HL9A 4MLJA 2W63A 5CQ1A 4YN5A 4FNUA 4LV9A 3NPWA 3GAKA 3IJ8A 1QMLA 3EWUA 3CIWA 3G1FA 4MDOA 4ATWA 1I2RA 1D3HA 1WBJA 2YX0A 1M7OA 3DFPA 2GK1B 1Q6LA 1T8XA 2WLZA 3CEUA 2XTKA 2XVGA 1JAKA 1HTIA 3NQCA 4L4MA 2ZWYA 4DWSC 4MFEA 3PB0A 1XH0A 1B3OA 2A6NA 3GBEA 2FHBA 1YPFA 2CBUA 1L2UA 2NT1A 1HG3A 3LERA 3M1ZA 1OX4B 5HDRA 4UCFA 3TA9A 1XKYA 1NVMA 5I6SA 3TQKA 5LGXA 3ZJ6A 5IDIA 2XG9A 4JHZA 5I5RA 2VRKA 1BGAA 3PIGA 1KXHA 4YMZA 3CIVA 1JZ4A 4M7TA 3W1QA 1H1NA 1OJXA 4MNKA 3F4NA 5I3DA 3KEHA 3GXIA 5A6JA 1TPEA 3NGJA 2BVTA 2BY1A 2JF7A 3VVGA 2ZX6A 4JL1A 3W9ZA 3L5MA 3WD0A 3CZ8A 3WIJA 3WF1A 5GNXA 4W84A 4I7UA 3RWKX 3W1UA 1CXHA 3LCIA 3T7VA 1GHSA 3P67A 3LF7A 5EMUA 4JFSA 1FBAA 4AWSA 2QV4A 1WYIA 5FF3A 1LLWA 1ZHAA 4LNYA 3NEVA 1ZJAA 2D0GA 2F8QA 4HA1A 3T55A 1JAEA 3NDOA 3SEPA 2VMFA 3BO9A 3HU7A 4HOWA 3NQFA 2O7SA 2XM1A 1V03A 3ARQA 2DPEA 2CLKA 3CUJA 4DF1A 4IOTA 5I2UA 3VM5A 3STEA 3QSRA 1YHTA 4JTSA 1ISVA 2LLEA 3HG5A 4JEQA 2Y6ZA 1VFFA 1VGAA 1GVRA 2J7EA 2ZUUA 3G18A 1N82A 1GQLA 4PMYA 3O63A 1WDSA 3RJYA 1KV8A 5F7UA 3DHFA 4QNEA 3ECQA 4M6PA 3I7RA 5A1AA 1EIBA 1BWKA 1GOWA 4UTMA 2G3MA 4UMCA 2ABBA 1EEPA 2H3BA 4O16A 3WUGA 3N13A 3W1AA 5AB3A 3TX9A 3SI9A 1J01A 3KHJA 1SMAA 1XL9A 2RGMA 3ZT5A 2WHJA 1YTEA 4NUWA 3LTPA 4JTFA 2QQWA 3ZR6A 3NZRA 1YDNA 4GZIA 4AZGA 3AYSA 1Q6OA 4ZMGA 1DL3A 3PHAA 4OE7A 1CNVA 1NAL1 4LYQA 4CU7A 1W1ZA 1AK5A 2X30A 3TR2A 4MY9A 4MB5A 5E9AA 3WF0A 1GZGA 3C52A 3CZGA 3SSJA 5FF2A 1KFEA 1SO3A 4CQAA 1SO5A 3K8MA 3PBVA 4BQ3A 1F6PA 1GVIA 2YDAA 3N73A 4ZL1A 1QPQA 3UG5A 3W25A 3K30A 3MUY1 1W3TA 2C3ZA 4JR5A 2JGQA 1KGWA 3W83A 4ZQCA 1J0KA 3VTRA 4DUXA 2G96A 2CKSA 3AIEA 1EA0A 4L4OA 3W6MA 1Q6RA 2QUTA 1H62A 4IISA 4TXEA 2Y88A 1XI3A 1TPB1 1L9WA 1H2JA 4DO5A 3LCHA 3AXXA 4LX4A 1JCLA 1R2TA 2XFFA 3T44A 3PB2A 4EK7A 2RDWA 4O14A 1F4AA 2BY0A 2BNJA 1QNPA 1RPXA 2I9EA 3KRUA 1E6SM 4HOXA 2WXDM 4NNAA 1FH7A 1JR1A 1I2OA 5EMYA 3EKLA 3SIZA 1BWLA 4GWEA 1KM5A 3HGOA 2ZX9A 5I3HA 1CXLA 1NEYA 4BF9A 3DFSA 3DHPA 1PX8A 2J27A 5CPNA 1RR2A 3HPZA 3P8JA 4Q4KA 3QM3A 1XRVA 3UCQA 4GI8A 3BAWA 2JBMA 1E0VA 2YCEA 1W9XA 3TTOA 2GDUA 3DI0A 4JL2A 4AZHA 1TE1A 2QUVA 4GO8A 2PBOA 2C0AA 1W9BM 4MY8A 2VQTA 3ZSTA 1LBMA 3LLFA 3DZ1A 2CYGA 5K3VA 1PX4A 1UG6A 3OGRA 3WL1A 3DGRA 2DQXA 1G01A 4URIA 1JYWA 1KBKA 1GJPA 5E6YA 3HBKA 4NNCA 5JBDA 3G22A 4O17A 5HULA 4JKMA 3FLUA 5E0FA 2CLHA 2D2OA 2WVVA 3SCTA 4YLWA 3TW7A 4HZ6A 4DF0A 1LZOA 5FIPA 1JXKA 1YPIA 3L4ZA 4P8VA 3LI1A 1O95A 1ITCA 3GXPA 1V6YA 3SCVA 4UFJA 3O9NA 1AL7A 1K8YA 4J27A 3MUAA 5EFDA 1VR6A 4FNSA 3WEZA 4UC5A 3EMZA 1DQWA 1H41A 2PBGA 4TR9A 3MI2A 1BEUA 2YW4A 5GVJA 3G3MA 4UQDA 1P1XA 1RQHA 2D22A 4P8UA 5FK7A 1FHDA 5BXSA 1QNQA 1HKMA 3N15A 1SUXA 1BGGA 1UKSA 1WNOA 4WLCA 4NSBA 3AS3A 1KCLA 2EXOA 1CGWA 1LRTA 3TAKA 2ZUMA 3P60A 3L5LA 1JD7A 3QW3A 4CN1A 1QO5A 3MHFA 4D6EA 1UCWA 2DORA 2VFFA 4KRTA 4UIOA 2Y7GA 2YXGA 2ZA2A 3KVLA 3OBKA 1V6UA 2CIPA 3DKLA 1PHWA 5E93A 3IMMA 5K7JA 1DWAM 1NP0A 2FDMA 2ZYFA 5I79A 5IFTA 1RPKA 4MZ1A 3CZEA 1DBTA 3NQEA 4RLIA 1PBGA 3W0KA 1V6VA 1SO4A 3L4UA 2BHUA 4L4PA 1QI2A 4GUGA 2OT1A 1ONRA 3R8RA 3QHMA 3ZOAA 3LRKA 1DVJA 3TTYA 1QI0A 5M17A 2V3EA 1HX0A 2GVJA 2ZRWA 4S3KA 1AQMA 1AMKA 1KM3A 4QIUA 1XCWA 4MNMA 3TFCA 3OZPA 1N55A 1ICPA 3W7DA 4AIOA 4JFTA 3WELA 4OV4A 1UQZA 4CD4A 4HIBA 9CGTA 2Q8ZA 3LB0A 3DENA 4JIEA 3QMRA 1C3FA 3TKFA 2WCSA 2CITA 1F76A 5E09A 4HMEA 5D8ZA 3BMWA 1NQ6A 3VD7A 1LRNA 1ZJBA 4FF5A 3FIGA 2WHKA 3M47A 1EP3A 5AC4A 4QISA 1ISXA 4HMCA 3QEZA 1BYBA 1CZ1A 1U30A 3VX1A 5M3WA 2VR4A 3ATYA 3L0GA 4RZ4A 3WH5A 3GH5A 5CZTA 3I3DA 4PMXA 3UERA 3B9AA 1TPH1 2W0UA 3O06A 4ADUA 3U6WA 3W2MA 3GKFA 3S1VA 3AMCA 2A21A 4EQVA
chains in the Genus database with same CATH superfamily
3N3HA 1BEV3 1IQAA 3VBHC 5DN1A 5DDJ1 2CHNA 1BKZA 2TMDA 3M5ZA 2ZRYA 1W9PA 4OUMA 4CA9A 4JYFA 2OR2A 5C33A 3RYSA 2G41A 1DORA 4QQ2A 1X1ZA 4L64A 1E3ZA 1MRAA 4QKBA 4I6KA 1I75A 4HKPA 1W1TA 3CS2A 3PZIA 3MW2A 2J7GA 2VXNA 1SFSA 1Z7S1 1NCQB 1RBLA 4N9BA 4PBGA 4B5TA 4GMP1 4V1PA 4S3DA 5BNNC 4AXKA 3ZYIB 2NQ9A 1WLWA 1VCGA 4BIOA 1TO3A 4I5RA 1RJ8A 1G94A 5LIWX 2OSWA 3C2RA 1TJ0A 3W73A 1PVC2 5ABJB 1GEQA 3S1UA 2EPKX 3EB3A 1W3HA 3M0KA 3BOLA 4TO8A 2JF6A 5A70A 1CW2A 3EWZA 5EXOA 2YC2A 4ZVJA 5FYBA 4QX0A 4CCMA 1E1CA 3RMXA 2J47A 5DRCA 5K0UB 3V0TA 2BGOA 3H8OA 2Y85A 1N2VA 2A7RA 4IIEA 1R092 5CPOA 1S1RA 1UY1A 4R85A 3NAPA 2VFHA 5AFBA 4KWKA 3HJEA 1VLNA 3ZQ9A 5JVVA 3P14A 1PGL2 4S2DA 1I0BA 1KXTA 3A4JA 3U2CA 1LODA 2R8WA 3CO2A 3RX2A 2VAUA 2VTXJ 3MT1A 1YRRA 5CPSA 5D2WA 1D4VB 2YKKA 3B05A 3MSDA 2YLLA 2WUHA 3WW3A 1KQRA 1A6CA 2OGJA 3TH6A 4RFRB 1REQB 4JHMA 4CVWA 1QI3A 3U3HA 1FRBA 1ZY9A 3SQSA 1KA9F 5HR6A 2G8ZA 3A23A 1U33A 4C6NA 1MZHA 5HBAA 1QWKA 3OIXA 1NA1A 1B30A 5JI9A 1FH9A 3CHEA 3NIYA 4L61A 4G7EB 4R53A 3ZKYA 4JNYA 3EDKA 4DRVA 1G4PA 1BQGA 4H2CA 2PMQA 2RDXA 4AU0A 3NXLA 5I3KA 3OBRA 1TX0A 4NIAA 1P0NA 1CZTA 3S6TA 1B35A 3BW4A 4LVBA 1KFBA 5CZJA 4Z08A 5ISLA 1O1HA 2ZZ3A 4FI4A 4YTQA 3W5MA 5DCEA 3CBWA 2UY9A 4XAPA 3SCRA 3MUCA 3N6QA 1CDGA 4LUMA 4XCAA 2WKJA 5AC8A 3HV8A 2H6RA 1NELA 4LHNA 4KKXA 5A7SA 4XISA 1S39A 1BVWA 3N9KA 4IMDA 3KLKA 2HBVA 3K1DA 1US0A 4EPEC 1QASA 2E1WA 1O5QA 3RRDA 2D1ZA 4TX9A 2MEV1 1E57A 2BFGA 3LXCA 1K7EA 1R64A 2WSVA 4EOUA 4X61A 3WDIA 4NASA 1ZB5A 2GN7A 3MW4A 1NOWA 1FPN1 3AZVA 1E1CB 1EO5A 2AENA 3WX5A 3IPVA 4XAZA 1E55A 2G97A 4IE6A 1O3SA 1AL22 2ZGRA 3GNXA 4DXVA 1N8IA 3W82A 5BRPA 3NAPB 3OPTA 3I59A 1AH0A 3PBMA 3WUFA 1XXXA 1E0XA 3AIBA 1A78A 2D3SA 3FHQA 4QLLA 2WMIA 2GGEA 5FAJA 1GORA 1T40A 4MTVA 3W85A 2NXHA 4CNNA 4MDPA 2WNUA 2UY8A 4KFNA 5HNRA 3IGXA 2C71A 3CUZA 4OUEA 1EP2A 2WO2A 3IBMA 3RK8A 1WMFA 3U5UA 4B1MA 4GAZA 1A5NC 1W2AX 1T7LA 3ITGA 1IEWA 1U5VA 5F4SA 1MXGA 3S5ZA 3MMTA 2H8XA 1JUIA 3FYPA 4W86A 1UB3A 5FLHA 2Z6IA 4CVUA 3UG4A 3TW9A 4Y5Z0 4ZSTA 2YBVA 4D8AA 4MUPA 3M3EA 1YNYA 1EX1A 1G4SA 1YI9A 4QB2A 1IIHA 4HJWA 3WJXA 2JXAA 1KITA 5BMWA 5D21A 1GTHA 1LEMA 3FFQA 1WAWA 3VD4A 4OMCA 3H0OA 1Y43B 2ZEWA 5FKBA 3ZDVA 4JN6A 1V6XA 5CG8A 3BWWA 5HBFA 2W3JA 5C6MA 4L8QA 4O50A 1FMD3 4TZDA 2J1RA 1GOQA 1W1PA 1GT8A 2KZHA 4MOZA 3TJ4A 2DEPA 2VFIA 3CAVA 3J7MA 4ET7A 2RJKA 4V28A 3KWVA 4H8UA 2PCQA 1OHFA 3PTKA 4FP1A 5A2BA 2HKXA 4LPCA 2KX9A 4BQYA 3O1UA 3IPVB 1SDDB 3B8DA 3VD3A 4IPJA 2HSAA 4O53A 3CNAA 6TIMA 1GU3A 2WVSA 4OQ9A 3PTQA 4ORMA 3JR2A 3AU2A 3SN4A 5FJJA 4LE3A 3MUZ1 1HXS3 4NAFB 5A3TA 5BWAA 1Z7S3 5FL0A 3KF5A 4AEDA 1A0CA 1YCIA 3KS6A 2KD7A 4ICNA 4M24A 2YB1A 4KGJA 2G3JA 4BH9A 2D40A 2ZXQA 2WNUB 3VBRA 3NOYA 3KP0A 2VOTA 5IDZA 2ZADA 1PVXA 1LQAA 2ACQA 5LKYA 2J1AA 1AQHA 4AW7A 3T0DA 4XQ6A 2YFNA 3WDPP 5L19A 1WW7A 1PGSA 4AI2A 1R3TA 3MCOA 4I8DA 3UXIA 4CKQA 2DH3A 2YBTA 1PMHX 1TVPA 4D6SA 3W24A 3WNNA 3FJLA 2ZTKA 4TVUA 3T42A 5F1RA 2H0VA 3L68A 1FCUA 4K3ZA 4NX5A 4M81A 5DQPA 3N4FA 2HDJA 4DI9A 1UL9A 2O9OA 1Y0EA 1YPXA 4I7WA 1A3WA 1EGVA 1W3IA 1W3LA 1X7FA 4H83A 5LWBA 3NQGA 4A22A 5FYSA 3ZYRA 5AYBA 3WZ0E 1PAMA 1Z9AA 3WMCA 1H9WA 1JU4A 4JIHA 3CV2A 3UWUA 1VFSA 2D69A 3NPVA 2AOSA 5C7VA 1JUHA 1AYN3 3CL7A 5FPUA 5DANA 3MS8A 1XWYA 4S3AA 1K9EA 4YNGA 3OF1A 1VBHA 1X8CA 4JGYC 3N9LA 4QXBA 2HBTA 4LHSA 1CPNA 1VAMA 5C9UA 1MI3A 2YL5A 3S7IA 3ZXJA 3OTRA 4PULA 3L2YA 1XCFA 1RY8A 3GK0A 2W39A 1QXPA 1PWLA 1UXZA 2QR6A 4CDXB 3L2MA 3BG9A 3E2SA 5EPDA 3UPWA 2ZGOA 5GZDA 4BFAA 3OOXA 3QOPA 3AYEA 2ZX8A 1RUG3 2O55A 4V1XA 5H2ZA 4UFKA 5EKYA 1XIBA 1TKKA 3AMQA 4ZCWA 2Y7EA 3LTYA 2DDXA 3WJWA 2NLIA 2WSQA 5AHNA 3F03K 3OEBA 2PFWA 1JNDA 3GNRA 2BW8A 4OULA 2AAMA 2DY3A 3A22A 4WY0F 4AHXA 3HQXA 3VBRB 1TCMA 3ZJKA 3TIMA 3TN91 1DQXA 1XLFA 4DPPA 3UPMA 3ARRA 3WUBA 2MEV3 5JU6A 4KERA 4PB4A 1RJPA 2INEA 2E5CA 5T5OA 4F0HA 3C8FA 4M3CF 1DIKA 5C2CA 3QW4B 3PWIA 1N47A 3DG7A 4Z07A 4IEWA 3KX6A 2K46A 3WD5A 3GIYA 3WLRA 1AR81 2B5HA 2Q1ZB 4E6MA 1GR3A 3MHGA 4NPRA 4MB1A 5KTLA 3HVDA 2BVYA 1XDLA 1KBLA 2FPVA 3W27A 1RXGA 5F1VA 4YZ4A 1FT9A 3PLQA 3QCWA 1RCXB 4AVSA 1MS3A 4I5UA 1MW1A 2YYOA 4JDYA 4NY2A 4BCEA 3PFMA 4IV3C 4UF0A 1D4M3 3N25A 3V0SA 1WUFA 1YFXA 2FMDA 2PDJA 5FYTA 5FESA 1BQPA 2W4XA 1PZ2A 4URAA 4J3VA 1RQBA 4N02A 3BV4A 2UWAA 1V9U3 2BASA 2R1MA 4JTAA 3M16A 4E5TA 4KFPA 1F5ZA 2GVLA 1IHIA 3QPZA 4C6DA 4H9TA 4O18A 1IR1A 3GE7A 1RK5A 3HPNA 1KQYA 2YPJA 1H4GA 3APGA 2VMHA 4B5XA 3T30A 2KM2A 3MIFA 4RL7A 1J84A 4FFFA 1CGYA 3SGUA 5AC6A 4XF3A 1Y8BA 1P6BA 3O6DA 1FWCC 5B7YA 3W9AA 1SPPB 3CO4A 4W7VA 1ZNPA 1SSGA 1XYAA 2YCIX 4JTKA 3SN0A 1AW1A 4NRQA 3ZSKA 1FWFC 1OSEA 3GUWA 4TLGA 3TTSA 3LRLA 1LWJA 1ZAIA 1XUUA 3L4VA 3T4HB 1QW7A 5DFAA 3TWIA 3UP8A 4DNYA 4I01A 2ZOXA 4HK5A 1WD4A 4HCHA 2NT0A 4QTGA 4DY1A 3FBMA 2WKLA 2ZMKA 2D3NA 5CZKA 1IWAA 1FWTA 5FXVA 4KEMA 3VZJA 4V2VA 4UNKA 4KEVA 1YIPA 5F3IA 1W3JA 3BVCA 3M6YA 2IXUA 5TNVA 3ELNA 3KCXA 4PCFA 2X7WA 2GOKA 5H8MA 1SQ4A 5D9OA 1DTNA 1VYPX 5JCTA 2PZ0A 2ZGTA 2HWF2 4DJDA 1ESWA 5D33A 1QEXA 3NQ6A 3K4ZA 3F95A 2WN3A 1CGPA 3VOCA 1JN2P 4MXWB 5FUPA 1IXPA 4IV1A 4RPPA 3IIIA 2RJLA 2XIQA 3RMEA 2PE4A 7XIMA 1CAUA 4BI7A 5DMLA 1NQKA 4I3GA 4HN0A 5J7MA 4MMWA 5CU1A 3QV7A 3EHKA 4ERAA 5IW0A 3FCPA 3PUGA 4WD0A 4AY7A 4XTIA 1C92A 5A3UA 2ZA3A 4Y4YA 4LW7A 4O19A 4GWNA 1HZYA 4AGRA 5DLCA 3EPOA 4NI8A 2N7GA 1VIWA 4MLRA 3C8NA 3BOXA 2Q01A 3WH8A 2XKOA 3SCUA 3ATZA 1POKA 4PH6A 1GYKA 4BEQA 3WMLA 2D6LX 3VCCA 3WH9A 3ZSMA 5FO8B 3BLPX 1JYIA 4LEFA 3N9MA 4WKFA 1J3QA 2WT2A 3MLKA 1ZZ8A 2WMHA 2WW5A 3I2HA 5D9NA 2CPUA 2Q8CA 3O12A 3BGGA 2ESCA 1XYBA 4RS5A 2Y8VA 3VDAA 3IKWA 1J0HA 2VFEA 4HQVA 2J1EA 3AZRA 2F17A 2YBKA 5A94A 2XH2A 5F3GA 4ATFA 1NFPA 4YW6A 1BK1A 1AR61 3ARZA 3V5CA 4DMIA 5IT6A 3K51A 3M2MA 1YQ2A 3EX6A 4XACA 5CC3A 2ARAA 3FOKA 3MVIA 1G7UA 4GH1A 1DYPA 3N9OA 1ZYBA 1GQJA 2WS93 1TA3B 5IAVA 1VYSX 4YWIA 2E8ZA 1UZ1A 1FDZA 1MS0A 4YTSA 1EF2A 4QCFA 4WGXA 4TLFA 3NDZA 4NVPA 2CU0A 2WLPA 1C8VA 4TWTA 3M0HA 3R7MA 1KM6A 1BRLA 1WA4A 4DY5A 3CYVA 4CNSA 2E32A 5FLJA 1UUMA 4O0QA 5ACA1 2AC1A 4LLOA 2WC4A 1JHNA 4H6KA 2GNBA 4IV1B 4P7OA 3W59A 1C5HA 3H12A 4AEFA 1YDYA 2FZNA 3PPHA 2E6DA 2PHTA 2ZKMX 4GVGA 1O8SA 1E5IA 1CECA 1MQQA 3L4XA 1XBXA 3BU0A 2ZIDA 4QGCA 3M0VA 4E2BA 3ITQA 4GIAA 1FOD3 1O7AA 3HJZA 4NZJA 3V3WA 3H24A 3KVKA 5D30A 1MACA 2GPTA 2C91A 2VZVA 4QHBA 3W07A 4CLMA 4LGXA 4O11A 3UKTA 2BZDA 1K70A 3W81A 2YMZA 1FWSA 2OWXA 5IVYA 3H54A 4F8XA 4EN9B 2WHMA 3A4AA 3KL5A 3STGA 2PFHA 1Y4WA 4ZBCA 4U10A 5L9FA 4D72A 3LMYA 2X8KA 5EZWA 2DT1A 5BNOA 3VHRA 1LDCA 3AHYA 3ARXA 5JXGA 4JKLA 4XUYA 1F3WA 3LQLA 2G3NA 3U10A 3RPTA 1RUD2 3EMCA 1QHDA 3TRSB 4D1IA 1TEIA 3TYDA 2BGSA 3JW7A 2C8NA 1X33A 1XYLA 1S0JA 3IIOA 4B5NA 4INDA 3VBOC 2BU9A 4I2OA 3PR2A 3MIGA 1F6YA 1W37A 4AQSA 3W3OA 3TE9A 2P3YA 4RS5B 3EOSA 4K20A 1P1MA 2VEPA 2WJDA 4GY0A 4G3YC 4WSJA 1VBC1 4FOUA 2WWJA 4WX2A 1JPIA 3CUXA 3LMZA 2FGZA 4K68A 4NJGA 1PHMA 3T07A 3BTAA 4JTIA 1PSCA 5LNRA 1UWUA 1LAJA 3PU8A 2B7NA 4D71A 3BLOA 4UMBA 3PP7A 1EPWA 3RZLA 2BGQA 3OW1A 4B2DD 4TU1A 1VBD1 2JALA 4B4PA 1KNWA 2X29A 3T1LA 1OT1A 5IK8A 3AJZA 3DBPA 2PDFA 3PTDA 4P7NA 3HPSA 1OX6A 4A35A 4C65A 4FXKB 1WDQA 4DBSA 4N7QA 3ZXEA 4DM1A 3TN3A 1Z69A 1WAUA 2EAAA 5JXJA 4WRHA 4CEWA 1STMA 4H9VA 6REQB 1OH4A 1B2YA 4R88A 4YGDA 3TTQA 4FPFA 2R1LA 4PEEA 4CN6A 2NVDA 5A6YA 4HXCA 1EP1A 2AREA 4PUUA 4OU1A 5T3NA 1DHKB 3C2UA 2XR4A 2V4AA 3GHMA 5DUVA 3LLDA 2PHUA 3LEKA 1V6TA 5HPOA 5C4WC 4FVVA 3ZXKA 4LEQA 1AR71 1QOQA 2WOQA 1QJY1 2CXEA 2E28A 4PUJA 1RUJ2 3DGBA 1TPFA 3HFTA 2NVCA 5BNOB 4DIAA 2AGTA 2E5DA 4IM4A 3RLUA 1LROA 1W9UA 2QVSB 2GNDA 3EX4A 4IQDA 4C0HA 1OG0A 4G4FA 4IGHA 3V36A 2C0HA 1XU2A 5IWFA 4RXGA 3RNDA 3JXSA 1UQYA 3CLPA 3UY7A 1FP9A 3BLKA 1V6WA 4FFGA 5HATA 4XURA 3AZYA 1IZKA 2OZ0A 3G6LA 4Z2WA 1M06G 1J5TA 2FKPA 3BAJA 4B7EA 4N0RA 3NRUA 3VIPA 3E5XA 1UO9A 4RGKA 4Y5TA 3AXEA 3KOWA 2X05A 3I6TA 3OHMB 4M3PA 4YW7A 5FF4A 5C6CA 4NR1A 3P6BA 1R082 5CNAA 1J96A 3N34A 1F8MA 4C1KA 1NCQC 2PA7A 3IANA 4IGOA 3T2OA 2IUWA 4FX7A 1DFQA 1OKQA 4XE9A 4PRWA 3T4CA 1XIDA 3KTSA 3CIHA 2WAGA 2Z28A 1HJXA 1VRDA 3ITLA 4CEWB 1HKIA 1OGGA 2YYTA 5ABJC 4BU2A 1ZTVA 1VF8A 4W85A 4AGGA 1WZAA 2PAEA 4XBSA 2XHNA 1C9WA 1XD0A 1XYCA 3G8EA 1BTMA 1SJAA 5XIAA 1NARA 1S4CA 3O6YX 5LBBA 3R8HA 3TTEA 3ZLGA 2YB4A 4Y96A 5K0UC 2EQDA 2WSRA 3THPA 4AHZA 1OXCA 2YY1A 2E9QA 4J1XA 1DQ5A 1COV2 4LSBA 4PRRA 3ITOA 3VCRA 2HEVF 5FZGA 3N29A 1XLHA 1QDOA 2PLV1 5PTDA 3HGRA 3ZYHA 4LUIA 2P3JA 2VUYA 5FJIA 3CHCA 4HNTA 4UQBA 1O3RA 2PELA 5DAQA 1GZCA 4NJHA 3W53A 3T2PA 4HHLA 2OFJA 4JNZA 4EXBA 4DJEA 3SGZA 2G9GA 2J74A 1QNWA 2F6XA 2RKXA 1H2NA 1CPUA 3POYA 4MGKE 4K1YA 4WCJA 5A7PA 2AKMA 1BXBA 5FO7B 3L65A 5TAOA 3U5YA 2FB2A 2FDFA 3BODA 4JFWA 1FP8A 1FUYA 4J3ZA 2RR12 4NWVA 2DVFA 2YHJA 2OUJA 4W93A 4LIUA 3ES8A 3VZZA 1OEPA 3VOHA 2BP6A 4O10A 5FZLA 3U2ZA 4MZ8A 4PR4A 3LIHA 4OZXA 3ZFEB 3GDRA 3IV3A 1PX3A 3RWNA 4NZFA 4IFOA 3E9AA 1TFVA 2ABAA 4OJYA 1H0GA 2DSWA 4DQAA 3N9SA 5HWJA 4XMAA 4PMUA 3WK0A 1SGJA 3S8HA 2BDQA 3WF2A 4LH8A 5AHIA 4B4HA 1MEWA 2E6YA 4WR3A 3W7RA 3VB9A 4RDVA 2BHYA 1ENUA 2QKFA 2OZJA 3MA8A 5LSMA 2UU8A 2OZ6A 1KS4A 3LSEA 3HIFA 1QPRA 1OABA 1HGYA 2DT3A 1E51A 2XL9A 4AFCA 3C2VA 4M7SA 3NQ8A 4UQCA 2G4FA 5TSWA 3QJAA 5DN2A 5LATA 3WQPA 2IUZA 4UI9L 2J25A 2WWDA 2A5ZA 4PB5A 2E40A 2Z2BA 3R6IA 5GALA 1TSIA 1UY4A 1NIUA 4KWWA 5DAVA 1BEV2 4UQAA 4EWDA 2W9XA 3QHNA 3W1LA 3REQA 1SW7A 3TYCA 4ADSA 2XH6A 3WMSA 3P62A 3UESA 5C7HA 3WDQA 1VS1A 3R2GA 2P6HA 4GACA 2JWPA 3ZMOA 2ZFAA 5HV4A 1K02A 3LNPA 3WLNA 4K36A 1E9ZB 1R1A1 1A5MC 3TYZA 4CQ9A 4M56A 2J79A 4P00B 4Q29A 2J1UA 2JG9B 1UN1A 4YTUA 4GQRA 3BALA 3VINA 3TONA 1WBFA 4GH4A 1QJEA 3V1PA 3S0MA 1RP8A 4HZ7A 2E51A 3EQEA 1AL8A 2GDVA 1AR73 3B9EA 5B4XA 3KT4A 1TIMA 2O8OA 2FCVA 4DXXA 1QJY3 2FZMA 4DXZA 4H4IA 5JBFA 5FP4A 3AP4A 2EIBA 3A47A 2HTMA 4C5YA 3W2KA 1C4RA 3SQMA 2I07B 4L92A 3N14A 1PZ7A 4DO6A 4F40A 5ANQA 5KEZA 2ZQ0A 4OGZA 1RB8G 3NQAA 1DLLA 1F9KA 1A34A 4RGGA 2GQAA 5CVRA 2P10A 1EC8A 1TPVA 1ZBWA 3BLIA 4DBUA 1PO21 1KD0A 3GNEA 1EBGA 1R9XA 4GKXA 4MPKA 3BCWA 3MEPA 4PC8A 4PF5A 3KRSA 3PUAA 4JX5A 4FXGB 2WC2A 4AIEA 5CSRA 1Q45A 4EYUA 4ZXLA 2ARBA 2G95A 3TB0A 1XJAA 1FH8A 4JDNA 1GWJA 1UIPA 2GC2A 1WWYA 2OG9A 2CLMA 4QLJA 3CGTA 3T0TA 3M4FA 5CJ5A 1CZVA 4LBKA 4ICMA 1GQHA 1HRI3 5T5PA 2CFFA 3O6AA 5CBIA 2QCNA 4PEKA 4KQNA 1BG9A 2GOUA 1UYXA 4BCUA 1ONXA 1XR2A 2I45A 4XZIA 2NQYA 1O5KA 2E0PA 3QH2A 3CZUA 1WP6A 4GK8A 2HJIA 4OQ8A 4RKAA 1G9FA 2OZ8A 5AVAA 4LY8A 3UGFA 1A8DA 2RDQA 2R9RA 3KRZA 1PTAA 1GQGA 3RCMA 4G1NA 4RR3A 4RGAA 4ZO6A 3PZUA 1QNVA 5I7GA 5FP8A 2P0IA 3LGDA 4GZ7A 3D6EA 1F6KA 1M7XA 4GH4B 1J8VA 3W1MA 3BLFA 4HMZA 5D8WA 3GZEA 5H91A 4AC7C 4HOZA 1VMHA 4GJZA 1GK8A 4Q8WA 4AEOA 5FZHA 2VMIA 5A80A 4CZSA 3T0BA 4UTTA 4H9YA 1W6QB 4HHPA 1SU5A 1FAYA 3SRHA 2OKXA 4XDOA 4QPYA 5C8BB 2ZX4A 4GQQA 1PCWA 5FY9A 5DMYA 2FFCA 2PEVA 4JIIX 5DAPA 1TR1A 4L5ZA 3KBVA 3PBYA 2WPGA 1FWJC 4JQRA 3AXHA 1EQPA 3QMSA 4BHYA 3UWWA 1GCYA 4L9XA 2ACUA 2XJRA 4YTTA 4V27A 1UMHA 3M7AA 1XE8A 2FCUA 4YS1A 5AC91 1Q8SA 4PLMA 4B1LA 1Q6CA 2JDNA 3IVSA 3V7PA 3LHTA 1J0IA 3Q65A 4U2AA 2GNTA 2WBKA 1QJWA 1TTPA 5FI8A 2DFAA 3KM5A 4CDXC 3W23A 1LT8A 1Y5WA 1W1VA 1XG3A 1ACCA 2R1KA 2PWFA 5H8UA 3UG3A 3KOFA 1G9DA 4WXYA 3HNBM 2JB4A 1XLCA 1S2UA 4XJ9A 4DXKA 4CTEA 4OHQA 4CQCA 3VGBA 4NIIA 1KXQA 2DV0A 4RNIA 4UTIA 1JI2A 2Z26A 4QU2A 1H49A 4F3HA 4ALDA 5A6AA 2Y5JA 4XKYA 4G6CA 4BLJA 2WO7A 3DOPA 1NWRA 4B90A 1RUC1 1B1YA 4C6OA 3VBRC 3L2LA 2QV5A 4AQTA 2ZXDA 3GXFA 3PS7A 2RMU1 4YFWA 2BP1A 3RPMA 5CEHA 1FMD2 2DZTA 3U1XA 3NQ2A 2D6PA 3IZOA 1HRV1 1M1BA 3TMQA 1PTGA 1WZLA 4JTUA 5J04A 3APYA 2WYSA 4W88A 1X96A 1R47A 1OFEA 5KZDA 4GULA 4IIHA 2OO6A 2XWJB 4Z1YA 5F6LB 1JRBA 2WVVB 3WD1A 1V00A 4AZ7A 4K9SA 1BYDA 1GZWA 1NCRB 2I17A 4NZ3A 4GX9A 4NVTA 3R1ZA 5BMXA 3QH6A 3CQHA 3ACLA 2D73A 4P2VA 1QDSA 2QHAA 2W94A 1W2PA 4FMVA 2FZ8A 1KC7A 5FCZA 5E0KA 4YGBA 1HXS2 1HQLA 1WBLA 2J62A 1X7NA 1Z7S2 1R1A3 3Q4DA 4R27A 2X5IB 3SY5A 1Q3EA 2PDIA 5JSPA 1ONWA 4AHYA 2D0HA 1IGOA 4DWSD 2ZTJA 2RGLA 4X0VA 1H8TA 1SVDA 2QPSA 3PJUA 3LBMA 3EGJA 2OELA 4SLIA 4OBSA 3GJBA 1V7AA 2W0XA 2ADDA 5FZOB 2V63A 3FAWA 4IPNB 4KCVA 1WLCA 4AF0A 1W0NA 5KC5A 4Y33A 4R4XA 1XM3A 1YRZA 3L5AA 3M07A 2BFUL 3J7NA 5AFEA 3AHVA 3EPNA 3RHGA 1KFXL 3QY7A 4UCGA 4ENLA 4LY4A 3UZXA 1G69A 3W20A 1B4KA 5H9SA 2G37A 1QWGA 1R2RA 3WJSA 1CAWB 3E2VA 4US6A 1VB2A 3PTRB 2DZWA 4XKYB 5FYVA 4HONA 5FSEC 2TUNA 2ZBTA 3STPA 4DB7A 4LS1A 5BU9A 3CEWA 2Q1FA 2VX5A 3MMUA 1C7TA 3PUOA 3TN4A 1PIGA 1AYN2 5IVCA 4MJ2A 4S2HA 4XCBA 1FHUA 2JIWA 5LHFA 4NKCA 3MV11 1HKJA 1RUH3 2A6WA 3NJZA 3E49A 4I30A 1PZ0A 4MVAA 3CJXA 1QPNA 4F0LA 2PA6A 4GRSA 2QQKA 3S9YA 1GNYA 1SO6A 2VNRA 2J75A 1GOGA 2HRWA 3I4EA 3OTFA 3E38A 3RPQA 1TV7A 1GZWB 4IIFA 4O8RA 4DXTA 1E40A 3K3OA 4C0BA 5DT5A 5HWMA 1FWEC 2NXIA 3BW3A 3RGTA 4DPQA 5A3MA 3W84A 4MGYE 1UOBA 2XFRA 4Y3OA 4NP7A 1IGSA 1CR7A 1OINA 1RUG2 3TAOA 3CHXA 1V0NA 4WZCA 4JGZB 2Y0IA 2V68A 4LVDA 2IXJA 1V3MA 2VZQA 3AMNA 5EB8A 5A8MA 4DF2A 1XSKA 4N6EA 3DIPA 3EYPA 5F6KA 3WCZA 4AQLA 4OMDA 3EOLA 1O60A 3GG8A 4PB3A 2Q3OA 1TQXA 3OD4A 1OA4A 3GC2A 4XTDA 5FJOA 2MEV2 2ZGUA 1VHNA 4Q8KA 2ZGQA 1POV1 3YPIA 3SCNA 5JI7A 3ZLIA 3MCNA 2WL1A 7A3HA 2WANA 4MJMA 4AI8A 3A6OA 4AD1A 4Q4PA 4E2OA 2WNNA 2WZR3 5IFPA 3PZVA 4PSRA 3I3QA 4D8ZA 2QCDA 3N2XA 3MUXA 4ZZ9A 4E9KA 1JEZA 2IXKA 1L8NA 3WOGA 4XTMA 4BQWA 4MPQA 2BOIA 4RJEA 1CESA 1LUCB 1K3IA 1XUZA 1A5AA 4OI4A 4NRSA 1CBGA 1A5SA 3EBRA 1D4M2 3AHTA 4KEZA 5BRQA 5JVLA 1EOMA 3IS4A 3EDJA 2R063 3FUQA 1UR9A 2V0TA 2V2CA 1ECEA 4OHWA 3LZ5A 3MY9A 2OSYA 3BUCA 1L6GA 3C5QA 4ACYA 6ALDA 4MGIE 5A8OA 3OZOA 1V9U2 2ADEA 3EX3A 2ADAA 4RE3A 3JZUA 4HPXA 1E6XM 2A3EA 3VBUB 2WFPA 5F4XA 5CKNA 1Q8PA 2OO0A 1JYNA 1J9YA 4UUIA 1ME7A 4FOYA 1UWWA 3QYQA 1UP0A 2H0BA 3M0XA 4GBUA 4IV1C 3BZGA 4BK4A 1QI5A 2WR9A 5HINA 4CPBD 1TZ7A 3GW0A 1FVPA 4K39A 3BTNA 2QDRA 3RRXA 1RUC3 3ACGA 2XYLA 3KQRA 3WP5A 3B9DA 1VPQA 4TX6A 5C71A 2QZRA 2CEQA 1DQ4A 4J25A 4CUGA 2ISVA 2OMAA 2Z5WA 3BSGA 1T96A 3CUFA 4JY8A 3N7JA 1QCWA 1GMMA 1FX6A 4JZ5A 3FW6A 4PODA 1OC6A 5A8PA 5FP3A 2OEMA 2XVLA