5A3UA

Hif prolyl hydroxylase 2 (phd2/egln1) in complex with 6-(5-oxo-4-(1h- 1,2,3-triazol-1-yl)-2,5-dihydro-1h-pyrazol-1-yl)nicotinic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
236
structure length
215
Chain Sequence
b'QTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EGL NINE HOMOLOG 1
publication title Potent and Selective Triazole-Based Inhibitors of the Hypoxia-Inducible Factor Prolyl-Hydroxylases with Activity in the Murine Brain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 55
structure length 215
sequence length 236
chains with identical sequence B, C
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5a3uA00
4ZPIA 4NHXA 2OPWA 3GJAA 5C5TA 4UWDA 4NHYA 2RDSA 5EP9A 3OUHA 5C5UA 5DAPA 5DAWA 3HQRA 4XACA 3NNMA 5EQUA 5L9VA 5L9BA 2HBUA 5DAXA 2FCVA 5IAVA 5ERLA 5IATA 3ITQA 2HBTA 4KBZA 2G1MA 4BQXA 4IW3A 3BVCA 4J25A 3W20A 3OUJA 3HQUA 5HV4A 2FCUA 4NMIA 5A3UA 2RG4A 4NHMA 3NNJA 4Y5SA 4XCAA 5L9RA 5LB6A 5IAXA 2A1XA 5LBBA 2Y34A 3KT1A 5LBCA 4NHLA 4XCBA 3GZEA 3GJBA 5EPAA 5DAQA 4ZONA 2Y33A 2RDNA 5M0TA 3KT4A 2JIJA 4BQWA 2RDRA 3NNLA 3MGUA 3KT7A 4Q5OA 3W21A 2V4AA 5HV0A 5LBFA 4Y5TA 3OBZA 2FCTA 5DAVA 3OUIA 5LATA 3DKQA 4NAOA 4XABA 2RDQA 3EMRA 5LASA 4MHRA 4NHKA 4JZRA 5LA9A 4XC9A 5LBEA 3PL0A 4XAAA 3NNFA 2JIGA 4BQYA 4MHUA 2G19A
chains in the Genus database with same CATH superfamily
1Q8VA 2VZRA 3M2MA 1LOCA 4CDXB 4JX0A 1E5SA 2HWD2 4Q4X2 5JXHA 3CF6E 1DGWX 4GMP1 4A7YA 5EP9A 2Q8DA 2VGDA 3WG3A 5IVCA 1TG7A 4Q0PA 3O7OA 3MW2A 2OUHA 4D6RA 3EXUA 5F5IA 4CEWC 2WS92 2VMFA 5DDJ3 5A70A 3RZLA 1VRH1 3UESA 3AZVA 3I59B 5A6ZA 4R52A 2WWSA 4GWJA 5IATA 1EY2A 2O1QA 4KBZA 1W8ZA 2G1MA 1GQGA 5FY4A 4P9WA 4FPFA 1UD1A 4YZ4A 1OA3A 4FPHA 2WA4A 2HYKA 1GICA 2PHTA 4XPVA 2ZGKA 3WDXA 1BLZA 1APNA 3VDDC 2JDYA 4YW5A 1L7RA 4JGYC 5F2SA 4KNCA 4P9GA 3DGTA 2GMPA 3TEXA 3H1MA 1UO9A 2ZGUA 4FQ4A 5ACA3 5A3NA 1XYOA 4WVVA 1U5YA 4OFGA 1B09A 1D4VB 4XHBA 4EZHA 2DDUA 2RG4A 2W39A 3URFA 5BNPC 5FZKA 2KXLA 4M01A 1GU3A 2RR13 4CP0A 3TRSB 1DZQA 5IAXA 4XZPA 1SPPB 1UYXA 2MHFA 3AXEA 2QQIA 4PLMA 1DIWA 4RQPC 1GP5A 4YW2A 1W3XA 1XE8A 5CFDB 4MG2A 5FZIA 1N3QA 3RRDA 1ND3B 3K46A 3KWVA 1NQDA 3LGRA 4BYYA 5FP4A 1EV11 5E1RA 1IG0A 2AR6A 3A23A 4P02B 4Y1YA 4ZONA 1W39A 3FLRA 2VCMA 1LEMA 2GC0A 1FPN1 3CJIC 2QQOA 2FDGA 1C4RA 1TEIA 1DQ6A 3D5OA 5BYNA 3ZDVA 1MS3A 5CADA 3FLTA 1G9AA 4RR3A 4V2VA 1SLAA 2ZBJA 4JKLA 3GZTB 2PYTA 2GH2A 1JYCA 1VAKA 4UF0A 3VL9A 4BU2A 1CN1A 5F1RA 5CKNA 3KT7A 3W21A 2PHUA 1R082 2VVDA 1VPHA 2RJ2A 1ENQA 2RMU3 1AR71 5DABA 3E5XA 1REDA 3T0DA 2BEOA 2R6QA 2ZGTA 4I2OA 4FFIA 2ORZA 1CIWA 3LE0A 1WZXA 5FY1A 4QGNA 3R05A 2W1WA 1RUC1 1ST8A 1EAH2 2W9XA 5EHDA 4JGZB 4AFBA 3CMGA 4Y22A 2X5IC 2Y6KA 4URAA 1A8MA 2WFF2 1ND2C 4LO4B 5D8AC 4CEWA 2JG8C 1VBD1 3N9PA 1OPMA 3ILNA 4A4AA 5IT6A 2BU9A 2JIGA 2OZ6A 2P5BA 3FN9A 5A32B 2KM2A 3GCWA 1JZ8A 3AYDA 4FAHA 1COV2 4LA3A 1DZRA 2XBO2 4AXOA 4RGGA 1X82A 2BVBA 1ENRA 2WZR3 3NSTA 2GDFA 1DQ0A 4EROA 5EIYB 5FOBB 4DEQA 1H30A 3POYA 3MBWA 4UWDA 3EBRA 1F5FA 4L9BA 4M3CA 4MGKE 4MXWB 3NVCA 1MS5A 2FDIA 1ZZ9A 3HQRA 3PUQA 4ZU4A 5GLUA 3SKVA 1FMD1 2X53S 5EQUA 1D7PM 1RUH1 4NO4A 1H2KA 1HB1A 4NPRA 1HXS3 4P08A 5A7WB 4N43B 3ZOIA 1CAXB 3AK0A 2QBXA 4HFSA 5C3SA 5FO8B 2FCVA 2Q5TA 4O9EA 5SV5A 3FUOA 3H8UA 1M4WA 2D3SA 1PX4A 2ARCA 4META 3V65A 2BWAA 1W8WA 4Y1UA 4BH9A 2J7MA 3IPVB 4AI3A 2EAKA 2R072 2VQTA 5DDJ1 2DYCA 1WA4A 2ZZQA 4CEYA 4QMAA 3MW4A 5BNPA 2D3PA 4IEPA 1O3RA 1Z0HA 2A3XA 4QPGB 1RUG3 2QQPA 3NV1A 2YU2A 2DUQA 3UYJA 1MPXA 4HT1T 4CCKA 2E9QA 1TNRA 3BVCA 4YVSC 4RA0A 4XQ4A 4XBLA 2PLV1 5JSRA 2WYFA 4RQPA 2FCUA 2ZXQA 2WQZC 1DQ1A 5DUVA 3WNLA 3BU7A 5IVVA 4QPIB 5FMBA 4RN5A 2YG0A 2ZHLA 1KITA 1RVF3 3IBMA 3L9JT 3WW2A 1J1TA 4RHV2 4CRQA 4FPLA 3CJIA 4LBQA 4N53B 1PNFA 2PN5A 1H8TC 1IHMA 5A6QA 4B4PA 5ACA1 5FZ1A 1VBC2 4D8MA 2RS12 3UGHA 4BA6A 4N7IA 1B35C 5FZGA 3O1OA 3O1VA 3HN1A 3FHQA 1J3RA 3WOGA 3ACIA 1AXKA 2J1TA 2RR11 2WIIB 3PMEA 2RE9A 3PTRB 1CR7A 5D21A 4UFHA 1HB3A 2W68A 1M06G 3KLSA 4CDUA 1GR3A 1K3IA 2CL2A 2EXKA 1OA2A 3SCGA 1OUSA 1Q8PA 3WSOA 1J84A 2ZHMA 4OYUA 3SKJE 3F95A 4BQWA 4AHWA 1GOHA 2B46X 3LZZA 2X5IA 1F4AA 4LEJA 3OD0A 1W6PB 2IXLA 4K1YA 1ND2A 5D8AA 4DXZA 2F4PA 1HQNA 1OF4A 2ZMNA 5IFPA 1Q8SA 3IMNA 4HKLA 1NA1B 4EJRA 1RB8G 1BZWA 1NCRC 4COVA 4COZA 1O6UA 2K0GA 1ASJ2 2WSUA 5FY5A 5FR3A 4KH9A 1R1A1 1UY3A 3F2ZA 3AZZA 3AMNA 3NV2A 1S1AA 1W2TA 4L97A 3TB0A 5FZDA 5DUWA 2XLGA 3AB0A 1VJ2A 3B7MA 2RMU1 1Y7BA 1CIYA 2CSGA 1ZREA 2OQ6A 2VTFA 2VULA 4PHZA 3DN7A 5LA9A 3ZPOA 2DU0A 3GALA 1UOJA 1YFXA 3WP5A 4MHUA 2XLAA 1HN0A 1YLLA 3EO6A 3I2GA 4AFCA 4CDXC 2Y6JA 4NRMA 4CPBD 4NR1A 2E33A 2NN8A 5HI0A 3I3EA 4RYDA 3BKZA 1ZZCA 4QXCA 1AUYA 2BNOA 4ZPIA 1YI9A 3U11A 3I3BA 3BTYA 3AMMA 4H2AA 2ZCWA 3CQOA 2FDJA 4CZSA 1J58A 3WCSA 1YQ8A 4BHPA 2DVGA 4XACA 1AZDA 5FYYA 4QDQA 3B3QE 3R4SA 1AX2A 4QB1A 1RGSA 3WG2A 2W46A 3AKPA 4KU8A 4YVSA 3O1UA 3USUA 5EV7A 5DQ0A 5F6LB 4ZY9A 5IW0A 4D94A 2R062 3KQRA 2BV4A 1JI6A 1AR63 1GYKA 2QZ3A 1ULFA 3U07A 4Q4W3 1Y9MA 2XG3A 3CHXA 3ZKYA 1REEA 2UWAA 2ZHNA 3CNAA 2HWF3 2GNMA 5KXDA 1QQP3 1WUVA 2WJSA 3PVOA 4QQLA 4A3XA 3ZR5A 4COYA 2FDKA 4YZ2A 1QJY1 4UFKA 1W6NA 3E6DA 3FBYA 3PLQA 5FZAA 2B45X 1QJX3 3MICA 1XXNA 3WR0A 5JLVA 1JZ4A 3I49A 3OUJA 3PIJA 2ZEZA 1B35A 4JQTA 4RD7A 5CA6A 1KGYA 3TEZA 1W6QB 2Y6HA 4X8PA 3ZPYA 4QX3A 4QHBA 1G6NA 4QQPA 1RUG1 1UZ0A 1VAMA 3U75A 3CJXA 3EJKA 4QDSA 4N9HA 1UYYA 1JZ3A 2DV9A 4XAEA 4XF1A 3PUSA 2HWD1 4Q4X1 2J22A 1GWKA 3P5BA 4ZHNA 2GAUA 2R0HA 1RUF3 5FOJB 4C0BA 5CFDC 5GZEA 2XKOA 3AJYA 4CPBA 2PHWA 2WINB 1CAWA 3ZN6A 4BPZA 1ND3C 2WN3A 1MZ6A 2Z79A 1L3JA 3J26N 5LBBA 4YLZA 3V64A 2Y34A 3KT1A 1PNGA 2WS91 5E16A 3SMHA 1Z7S3 2LTNA 5BXXA 5A3OA 3RDIA 4UFIA 4GMP0 1GZTA 4XQDA 1XYPA 4I02A 4CCDA 3AYEA 5I8TA 1ZA7A 3CZUA 5IVJA 4I09A 3LEMA 1JYTA 3ZLIA 1ODMA 3SXWA 1VBE2 2TNFA 4NIGA 2D97A 2B7YA 4YW1A 4YGDA 2XJTA 3GBWA 4ZZ5A 2CV6A 4G9SB 5HXVA 1W8TA 4EYUA 3VKOA 3SC7X 2P3JA 1AL23 1WLTA 2V5YA 2VXRA 3FWEA 3OBZA 5LA2A 4CDXA 2H6CA 5LW9A 3PHMA 1D4M3 4L8QA 4XABA 3J7LA 4DINB 1A8DA 2RDQA 1GMMA 2HEVF 3JUUA 3LFIA 2IWGB 3AZXA 1W90A 1I5ZA 2O8QA 2QJVA 3I2KA 1YWKA 3GM8A 4JAAA 1QNWA 2WUHA 4HPKB 5FZ0A 1TZOA 5LASA 3BIEA 4F7ZA 3I59A 4ORFA 2JDPA 1ZA4A 2EXJA 3BPZA 2EICA 3EQEA 2QQJA 2BOIA 1H9WA 1VRH2 3VZNA 1Y4WA 3M3OA 2AH2A 1S0FA 5J7MA 1UXZA 5I8YA 5IK4A 2JD9A 1LESA 2KA3A 1MACA 4XHXA 3D0SA 4NIAA 2A6XA 4HETA 4AK3A 2OZJA 2G9ZA 2W1SA 4LT5A 1NLQA 5CAZA 4JRLA 2CGNA 4N43C 1X36A 1W2OA 3ZR6A 4J1WA 5KXBA 1VBB1 2E7AA 5BPXA 5FBJA 3HMYA 4R4ZA 4M0NA 5JOZA 4M4RA 2JDAA 3AC0A 5JR2A 5A1FA 1OKOA 3W58A 1ZZ6A 4DOUA 1LB2A 1J3QA 3QLQA 1NQJA 3M3IA 1UZYA 2VMIA 4RR3B 2AEYA 4XFAA 5F8PA 4FFGA 3E5UA 4FXGB 5F7UA 3SH5A 3JBG2 5JMCA 3NAPB 3IM0A 4QPGC 4OUMA 3ILRA 4RFT0 3LF7A 2K2SA 2QUOA 4P9YA 1OF3A 2XOMA 2PHXA 2BZDA 4KU7A 4DXRA 3RZMA 3O1PA 2NP0A 1SPPA 3BTXA 1EAH1 1MS4A 3NRUA 3ZSJA 2EXIA 2W47A 4EN0A 4R9DA 5CFDA 2YXSA 4OMCA 2P37A 5FREA 2JWPA 3NW4A 1ND3A 4MVTA 4NPLA 3VBFB 2VW2A 3I97A 4QPIC 2YYOA 2D6KA 2OKXA 1N1VA 1T6GC 4AVCA 1US2A 2ZX1A 2NLRA 2WRAA 2JE8A 1COV1 3NWKA 4LXLA 2WWJA 5AFBA 4N53C 2Y0OA 1EV12 2YMZA 4NHMA 2GC2A 1OH4A 2RM22 3D3AA 2KR2A 3FMGA 3P6BA 5AVAA 5KHHA 2D6PA 1FPN2 4XTPA 1XRUA 4OZXA 4IETA 1EPZA 4M3CB 1ODNA 3LDKA 4MGIE 4PJYA 2Z69A 4W6XA 3HEIA 1S4CA 2VNOA 4GJZA 4PDWB 2ZAHA 4A2UA 1AR72 5EYXA 1RUF1 3BU0A 5EPAA 3ELNA 3OGRA 4FPGA 1JZ6A 1YIPA 5GKAC 1SBFA 4JGZA 2QKDA 3K51A 1WMXA 4JVAA 3AP4A 4KL1A 3AMHA 4H14A 1RUC2 2ZZJA 3T0AA 2GC1A 2EIBA 5JI9A 1NA1C 5CFCC 3B93A 1LHOA 3I4IA 1LKNA 2JE9A 5A32A 2VY0A 5FY7A 1MR5A 4CEYB 1MEC3 5IYYA 1WCQA 1QHDA 2P4EA 1GBGA 4PT6A 4Y1ZA 2BOJA 3GCXA 4Y5TA 1UZWA 5C33A 3ZYPA 1W9YA 1D0GA 3ZSEA 1JYIA 1XPWA 5FUNA 4OLLA 4XDOA 5FAXA 3UKTA 1VB4A 2ZTNA 3AKRA 4JHZA 4Q8KA 3D0JA 2JEMA 3H50A 3USSA 1REFA 3WW3A 1V6IA 4YVWB 3HNBM 3KCYA 3B5LB 3M3QA 4IEZA 1YYNA 4OQ9A 3KGLA 4RHV1 1DYKA 2CWSA 1AL21 1CAXA 1S55A 2ZOEB 1NAEA 5DG2A 3VHPA 4B8EA 2BYVE 1FMD2 2WAAA 1D4M1 3MHZA 4Y20A 1RUH2 3PL0A 3U0ZA 2VNRA 1HKDA 2J1AA 2JX9A 5KHGA 5T5LA 1ZX5A 3VHRA 3IPVA 2WR9A 1BKZA 3U1XA 3OEAA 1W0NA 1QGLA 3AZWA 3HN3A 1W6OB 2VZ1A 2A75A 3AVSA 3I2IA 4QPGA 3K2OA 5DDJ2 1JUIA 2I74A 5FPZA 1IKPA 1W06A 2BJSA 3OYWB 4CDUB 2B9VA 1V00A 4DRVA 3T4HB 5IAVA 5ERLA 1O5UA 2GU9A 4HN0A 3VZOA 1GLHA 4MYEA 2QQUA 4QPIA 1IS6A 4XFHA 1RUI3 1IPSA 1Q8OA 3ZMNA 3ZVXA 1JXNA 1GKBA 1QKQA 3LIHA 4N53A 5CG8A 3NV3A 2VNGA 5IWFA 2PFWA 1SDDB 4AQTA 3SCFA 1IQAA 5EJ3A 1W8NA 1UPSA 3VBOB 4DRRA 5JXIA 2QTWB 3H3LA 1BBT3 2XVGA 4FOQA 5ACA2 2BUKA 1XQNA 2Z42A 3KCXA 3MEPA 4ZXKA 4BK5A 3VKLA 1EUTA 4CCLA 4CDWB 3RJ2X 2C9KA 4B29A 2VUCA 3PIGA 3WW4A 4TZDA 4M4PA 2V09A 1QJU3 2RR12 3ZFEC 3RZJA 2IXCA 1WA6X 2CDPA 5JSOA 2QQNA 4LK6A 4TLFA 2YV8A 1SQ4A 1JYVA 2MEV3 1O4TA 1CJPA 1W99A 1H9PA 4UW3A 4OUSA 1ZBA1 4AEMA 1SACA 3W5NA 1FAYA 4DUWA 3A7QA 3H0OA 2F4LA 1VE0A 4NIHA 4QM9A 1YEWA 5E6HA 4E4ZA 4M00A 3JQXA 3BTAA 1SDWA 3N7JA 3OBAA 3BUCA 1LCLA 5FZBA 4PBOA 3WY6A 1LGBA 1HW5A 3AJZA 1R1A2 3ZXAC 1W9TA 3KQ4B 2ZKLA 3ZYIB 5J48A 4R9AA 2PHLA 4AE2A 4LUKA 2WLPA 1AF9A 1R1ZA 2WDBA 2RMU2 4UFLA 1JS9A 5LEKA 3VD7A 3SISA 1YQ5A 2FDHA 4LQRA 4EQVA 2N7GA 5DAVA 3W59A 2FCTA 5I0RA 1LGNA 2D40A 2VZOA 4TSVA 4ASKA 4L2NA 4PF1A 1V6OA 5FYIA 5FZMA 1JYNA 2HWE3 2VMEA 2ET1A 2Y38A 5FK8A 1F31A 5FPLA 3KHBA 2VMHA 1CONA 1MEC1 4XW3A 5FCCA 1QDOA 1C8NA 5FMCA 1HJGA 2XQRA 2XJSA 4FFHA 4AWDA 1S2BA 3HIFA 2PELA 4XAAA 2X09A 3AKSA 2GNBA 1CPMA 2G19A 1VLNA 3ZN6B 5T54A 1NY71 2XJRA 3POIA 3AM2A 3AXDA 3KV4A 3ZN4A 4D7YA 3OPTA 4YG6A 2VW1A 5FJHA 2ZX2A 2WNVB 5FYMA 1JU3A 5DAWA 4YM3A 2PQSA 4D6QA 2D5FA 4LPLA 1CQ9A 4QPYA 1VALA 5FBZA 1VBE1 1POQA 1UNBA 1TQ5A 4RR3C 1DQ2A 4YG0A 3RFRA 1I5PA 1QJY2 1W6QA 5CNAA 3NAPC 5DAXA 4OMDA 4ES9A 1W2NA 1VBA1 2AZ5A 4ITCA 3GYDA 5A1AA 3BN6A 4IEYA 2OYZA 5IFTA 4S2HA 1BVP1 1WKYA 4RFRB 2W5FA 5JI7A 1X9PA 4CXXA 2FDFA 3V56A 3WNNA 1O4YA 3PUAA 4ATEA 1JZ5A 1XYNA 1RUG2 2HWC3 3A0KA 2A3WA 1OVPA 3LWCA 5EZWA 4XIOA 1WLDA 2H0BA 5F3GA 5BNQA 1SFPA 2R16A 2YGMA 1ENXA 3VBFC 5BNOB 2BGPA 1YQ2A 2CHHA 3GGLA 2P6CA 1JHJA 3OPZA 4OVEA 1RUI1 3MLKA 4K21A 4YW6A 4BZ4A 4CCNA 1YRZA 3SH4A 4BCUA 4BQ5A 4KWJA 1EYBA 4RSUA 1NXMA 4FP2A 2ZX4A 2RS33 2XHKA 3NNGA 5HV4A 2E26A 1YNAA 1JZ7A 4F3JA 5FXXA 2YC2A 4FPKA 2W1UA 2XJVA 3GHNA 3HBZA 2C0ZA 3ZIWA 1QOOA 5J36A 2C26A 3N9OA 3GHMA 1CVNA 4H7MA 5FP9A 3VBUA 1FOD3 3UT0A 1KDKA 4ASLA 1CAVB 4TN7A 3N7MA 3UJQA 3OB8A 4BIFA 4QGMA 3H8XA 2P2KA 1HRV3 2VZQA 2BDRA 4PDWC 1YIFA 2ERFA 3VD3A 2RV9A 3OSDA 5C8CB 2GC3A 5CVRA 3WNMA 1W9SA 4PCRA 4DXTA 3N4MA 4TXWA 3JBG1 1PHMA 4DEVA 2YC0A 3AKQA 4FQZA 4LJHA 3SH3A 5CBLA 4HPKA 3RI9A 2XVKA 2YBKA 3N7LA 4CEYC 2VECA 2IFRA 2Q8CA 3I2OA 3ZXKA 4LIUA 5T55A 1OC1A 5IK7A 5I0DA 2WAOA 2O0OA 1C5HA 3PUHA 5A80A 3CLPA 3CU7A 1YO8A 4IE0A 4Y5Z0 2BGCA 2NPIA 3OPWA 3UNPA 2AREA 2ZHKA 3PMSA 5BV6A 3TBDA 3VKFC 4AEDB 2W92A 5LATA 3BALA 4CCOA 4JCKA 4YVWC 3GZAA 3QCWA 4IUGA 5I93A 5FFOC 1AYM1 1POV1 3MV11 2HKXA 4QU2A 3NJZA 4HBNA 2RM21 1C1LA 2NMNA 4WZCA 2XWBB 2QZ2A 1QIQA 4XE9A 1VBB2 3T2OA 5BNNA 1JMUB 3ACFA 2VOTA 1K42A 2DFCA 2FZ1A 4HKWA 3AL6A 3MF9A 1JZ2A 4FPYA 2NZ9A 3G7DA 4YFWA 3NAPA 4ONUA 3I2FA 1LULA 2NM1A 4NHXA 3WQ7A 1MS0A 5IUQA 1Q5OA 1XSRA 1AJKA 3WQBA 5FZFA 5C9AB 4CDUC 2JB8A 3WF0A 4E4HA 2EXHA 3QACA 1H2NA 1WW5A 1ZZ7A 2HH9A 1G8WA 2TBVA 5LY2A 1OPOA 1F35A 3MUY1 4YPJA 5FKCA 3VBFA 4Q8LA 4COWA 3FJSA 1AXZA 4OHVA 3JQWA 3NV4A 3IN9A 4XUQA 5C8WA 1AR62 1NE6A 5F32A 3IMMA 4N9IA 1OQDA 4Q4W2 3TN93 3THTA 5A3WA 2IUWA 5A7NA 2E63A 1C57A 2R041 3S7EA 1H4GA 1LOEA 1PM4A 1AX1A 2HWF2 4YZ5A 5IVBA 1QQP2 2ZEXA 5BUVA 1VIWB 3JD71 1V70A 5H9PA 1UZVA 1K12A 4QT6A 3IDEA 1LENA 4QX1A 2O14A 1RJ7A 1S0DA 4BMBA 4CDWC 2WYSA 1GSLA 4CDQA 4UXAA 3D6EA 4GJYA 4LO8A 4Y1XA 2HWC1 3OGJA 3LPGA 4PDWA 3EB7A 2HWB3 5DG1A 1ZRCA 1UY4A 1NLSA 2X8KA 3VBSB 4AI1A 4ES8A 3ZXDA 2RJLA 1GFF2 3JZVA 1DQ4A 4Y20B 1JW6A 1DG6A 1RUF2 2XONA 4PI2A 3O1SA 5JUVA 4E2QA 4D3WA 1U5XA 2VQUA 1E5IA 1GUIA 1GNYA 2E7TA 2RS31 5FPVA 5KHKA 1LHNA 5LA0A 1TME3 4EWAA 2XB6C 1Z7S2 3ON7A 4CUGA 2OT7A 4HOOA 4XJ8A 4MGTA 3C7HA 3C2UA 2IXIA 2XL7A 4XILA 2EIEA 5FZ3A 3B9IA 1LHVA 5FP7A 2C4XA 5FMOL 2VW0A 4NHLA 3WVJA 4H55A 4WM7B 1C28A 1S0CA 1SLBA 3ZYJB 2W08A 5AC93 4QX0A 1XBFA 1WD3A 4YVWA 3RNSA 2ARBA 1RUD3 3I3MA 5CKMA 4I3PA 2GP5A 4TTGA 4W65A 4IEUA 4LBOA 1GZWB 3S5QA 2A5ZA 1SHWB 1AL22 2A73B 5FXVA 1U5ZA 3RPQA 4I0BA 3WG4A 5HV0A 1D4M2 2AC1A 4LLFA 4YFZA 5I0TA 1PMIA 2QQMA 3N3HA 5FYVA 2JDKA 5FZOB 4RGAA 1W6OA 2PHDA 1WW7A 4W6WA 3ZSKA 1ZYBA 1GZ9A 2D43A 1ZBE3 4JDNA 4ZU5A 3FC0A 1OVSA 1RXFA 1UQXA 1WMEA 2YUEA 5AFEA 1UOBA 1UY0A 2UYBA 3OYWA 2Y6FA 5FZ6A 1SEFA 3H8RA 1DCSA 2QDNA 4YWAA 5A3LA 1V9U3 3AFGA 5SV8A 4GULA 5GZFA 4Q4V3 5JWPA 3NL1A 2RHPA 4HVRA 4NWVA 5CU1A 4KWKA 4OI1A 2WN2A 1UX7A 2ID4A 4S2GA 1WW6A 5A6YA 1DLCA 1FV3A 1VR3A 2WNVC 1MS1A 2BNMA 1XNAA 1TE1B 1YJKA 2VCAA 3WF2A 5FQ0B 3M7AA 4UW4A 2A6WA 4GD4A 2VBBA 1GP4A 2VNVA 2Q8EA 2A7AA 3MI8A 3VBOA 3V0AB 4GH4B 4I30A 4LBKA 3P3NA 3OF1A 4AEJA 5L9VA 2D6MA 1XNDA 2B39A 2PAEA 4KGQA 4CDWA 4UFMA 3BYWA 3WHUA 1LGCA 5A3MA 4LR4A 1V6NA 2MPFA 1XNCA 1ULCA 2G9FA 1NXD1 2PHFA 4GB33 3IDCB 2D6NA 1U0AA 2QCSB 5A33B 5BNOC 1GWMA 3M8LA 1AHSA 1RUE3 1PK6A 2VE1A 1RYYA 3CEWA 1Z78A 4Q26A 2J1VA 5FLHA 5FLJA 1QXJA 3ZYFA 4YSFA 2E51A 3LA7A 4FPJA 4DO0A 1DP0A 3VD4A 4GWIA 4GXLA 3GF6A 4PQQA 3TEWA 2C9AA 2CGPA 1WBLA 2ZEYA 1PVC3 3VKMA 5JCTA 1ZBA2 4GWNA 3Q8AA 4UOJA 1IGOA 2WZR1 5C3RA 5KR7A 5T5JA 1NZCA 1V6KA 3O0XA 2XHNA 1OA4A 4A42A 5IVEA 1UKGA 1JOJA 4AEKA 2A6VA 3ILFA 4HSLA 5FYSA 2GMEA 1CD3G 4N7UA 3IDBB 1BJQA 1ACCA 1TNFA 2W1QA 4WVZA 5FIXA 1PZ8A 3WQ0A 1SLCA 3Q8CA 1HXS1 2A1XA 5GLTA 1L7LA 1R083 3O0WA 4GIQA 3ZIXA 4F83A 1E5HA 4I0WB 5LBCA 1IPJA 4EN7B 2ZAAA 3H42B 4KQ7A 4EWEA 4AR2A 1FX5A 1SMVA 1AXYA 1RXGA 1TMF3 2BW8A 3GJBA 1ZRFA 4A7ZA 2G9GA 3WX5A 1QOTA 1OLME 4QXKA 3N9NA 1W0PA 3TOJA 4QWNA 5FZ9A 3JB4C 3PJYA 5JIAA 2AYHA 3KF3A 5J09A 3POFA 3WF4A 1MEC2 3LOBA 1LODA 4CUBA 4CP2A 1AYN3 1RMU3 4PQ9A 3HJRA 4AEDC 2KD7A 4URTA 1URXA 5FWEA 1LTEA 1WGPA 5JPMB 3NJVA 1G9FA 4LKDA 2BPA2 1W05A 2ADEA 2XBO3 5LBFA 4XF0A 2JENA 3SEEA 3O5SA 5GZDA 1UMHA 1LHWA 1RVF1 1W6MB 5JZGA 2WNVA 3WNKA 5EFUA 3T09A 2FQPA 4LHNA 1NY72 4IEOA 3ZFFB 4KMQA 3EMRA 5FZ7A 2JJ6A 4GA9A 3KHCA 1WCDJ 2SBAA 4U2AA 1PGW1 2E31A 3VBHB 3MPPG 2ZABA 2DUPA 3NNFA 1QXRA 1QEXA 4BQYA 1O8SA 2ZGMA 2Y64A 5LRSA 1BQPA 2R30A 2VOKA 2WZEA 5B4XA 3VBUB 4Q4Y3 2OX0A 5C9AC 2AENA 4GKYA 1AJOA 1VBA2 2R073 4M3CF 3WLUA 1V9U1 2EVXA 3MV01 1RJ8A 4Q4V1 3LIGA 4QU1A 5BNOA 1NT0A 4ARYA 4JGZC 4PBPA 2QQLA 1CGPA 1VRBA 4AI0A 4BMEA 2JB4A 4YM0A 2R0FA 4B1MA 3DPRA 5F5AA 5E8AA 4MLOA 3K3OA 1XE7A 2OA2A 2VZVA 5J1XA 1W28A 2H6BA 1RUI2 1HB2A 3LDBA 1ULOA 3K75B 2AEZA 5GJ6A 2VOVA 4AI2A 2VMGA 4AQSA 2XKPA 5L19A 1S0EA 3C7OA 1YHFA 1I3HA 3GXUA 1HV1A 5FXZA 3R4DB 4I0AA 2UY9A 3Q9OA 2VZTA 2BQPA 2VVFA 1CAVA 2ZGSA 3MFCA 4B4RA 2RS13 4XTMA 5FY9A 5C8CA 3WDVA 3VBSC 5CZKA 1MQTB 2W95A 3KZ4C 1YCIA 4P5YA 3BCWA 3OG2A 3DYPA 1HV0A 5FYZA 4YYOA 1POV0 1IG3A 3I2DA 3POSA 1BEV3 1Q43A 3WP6A 1BCXA 1SLIA 5BNNB 2H0VA 3OD4A 1LOAA 3H1YA 3POJA 2MEV2 5FJKA 1QOSA 1RTVA 3NJYA 4R4XA 2EA7A 4XCAA 1PVC1 1PZ7A 2PAMA 2VM9A 4NIIA 3ME2A 2VUDA 4UI9L 4AW7A 1QJZA 5D2AA 3LOIA 4MUVA 5KXCA 1PO13 2RJKA 2JD4A 3UKVA 1O3TA 4WM7C 5G05L 4HXCA 1HQWA 3WW1A 4AEDA 1AR61 4R9CA 3VZJA 2WABA 4Q4W1 5LEJA 4QM8A 1HRI3 2Z5WA 4K8FA 5JVVA 2WO2A 1YUDA 3M4FA 2HWF1 2XLFA 2Y8KA 1QQP1 1OD3A 2XWJB 2YC4A 3PVEA 4L99A 5M0TA 3OBRA 1AYM2 2OPKA 4P00B 1AR93 1JTZX 2BERA 3WP4A 2CU5A 1LR5A 1QJX1 1S0BA 1TMF1 3IAQA 4AG4A 1UPIA 2C24A 4FP3A 1WMFA 4YARA 1LU2A 1OBNA 2QVSB 3WV6A 3AP7A 3DECA 2GZWA 2DVAA 1S0JA 2CGOA 1C8M3 2DTWA 3N35A 4L92A 3PTYA 3TYJA 1OKQA 1R093 5FPAA 5C9AA 4CDQB 2QQWA 5F9TA 2XR4A 3QOPA 2FMDA 1H4HA 4KBBA 4Q29A 1FI2A 3LSDA 2DVDA 1MVEA 4NHKA 1OH3A 2W0XA 2VTXA 3MUZ1 4XC9A 3ES1A 4QKDA 5HPOA 1DQ5A 5IK5A 3V0BA 1G86A 1Z7S1 4FAGA 4HMZA 3U14A 1UIKA 1HB4A 3BI3A 5F5QA 4A7KA 4LIVA 2DBIA 4FOWA 1QF3A 2R042 1H0BA 3A0NA 3MIBA 4GH4C 4NHYA 3LA3A 1P8JA 1RHI3 4QB6A 4Y4YA 5F3CA 1XU2A 4YM2A 5EJ1B 3MIEA 1MS8A 4GQ7A 2BTVC 1XNKA 5T5PA 1KS4A 2O8OA 5LK5A 3JD72 1S0IA 4JDMA 4Q4Y1 4UFJA 5FRAA 1EP0A 1ULGA 3QD6A 4EV0A 3LD8A 3FX3A 3H8OA 1YI7A 2OW4A 2XH6A 2ZACA 3VGIA 1Y9QA 4QXHA 5FZCA 4C1WA 3VBSA 2J1UA 2HWC2 5ANNA 2EALA 3ASIA 5F3EA 5C7GA 5IJRA 4CE8A 1OOPA 1F4HA 3AVRA 1W9FA 1XU1A 4Y24A 5FKBA 2R49A 5L7OB 3DCQA 5B2GB 2JKBA 1WLWA 4A41A 1CWPA 5K0UB 2VMCA 1H1MA 3ACLA 1Q56A 4AFDA 5FPBA 1YC61 3H7JA 1CZVA 2D93A 3RWKX 1KEXA 2W91A 3O14A 1J59A 2RS32 4LBLA 2XUMA 2ARAA 2B8MA 1FATA 1GQPA 4IERA 1DZTA 4LKEA 4UBHA 2CWMA 3MDPA 1KRIA 1QY4A 4WM7A 3HVDA 3LA2A 5GZGA 4JHTA 1FNZA 2TEPA 1PIV3 4IESA 4OHWA 5JOXA 5T3NA 2WT1A 1X50A 4WV8A 1CZTA 1FOD2 2DF7A 1NUKA 2ETEA 3ECQA 3R0RA 3H9AA 1F5JA 1GZWA 2OUJA 4M0HA 1AX0A 1QJEA 1SG3A 4GZ9A 5CIRA 4BIOA 5K7PA 2FZ2A 2JDMA 4ZS3A 5J37A 1BEV1 2E7QA 5EYYA 4YZ3A 3SHRA 3UGGA 1O3QA 3Q8FA 5FZOA 1AL0G 1W8HA 3E6BA 5BY5A 3TNPB 3GZEA 2WBKA 4IL7A 2I07B 4XJUA 3KV9A 4GAZA 3S5AA 2BVVA 2HYXA 3VKNA 4AI8A 4TWTA 4YGEA 1PO11 4NJ4A 4GMP3 4CU7A 2E6VA 1IPKA 3WF3A 4NROA 2EIGA 4P9XA 5I0SA 3KMHA 5FZ4A 2ORXA 2WQ8A 4K6BA 3PU8A 1HRI1 2R7EB 3MGUA 5FYBA 4Q1RA 4BLIA 3I7DA 3ETPA 2JE7A 1PK6B 2IVIB 1KQRA 2JDUA 3CZJA 4QX5A 5DUXA 1WLCA 1QJFA 1X9TA 2CDOA 3HAGA 2LW8A 3ZFFC 1CESA 5FQ0A 4ISQA 1AR91 4U36A 4QKNA 1OLRA 2DCJA 5E89A 3WNXA 2ENRA 1CPNA 4AVTA 4C0HA 3NMBA 3V0AA 1N3OA 4EZ4A 4GH4A 3T2QA 4IE7A 2VZ3A 2XPJA 1SCRA 2ZGRA 3O12A 3LQCA 2VD7A 3IIAA 3VBUC 1R091 5FLIA 5FYUA 3VZLA 4PLNA 4AVBA 4CXYA 4SLIA 1SBEA 4CTEA 3BIWE 5JXJA 2ZMKA 1RC6A 3D82A 4AI9A 4L0PA 2VZPA 3IZOA 4JTOA 1VP6A 5GALA 5A33A 1BMV1 1UYPA 2HLEA 3B9CA 3O1TA 5F2WA 5FYHA 1PGL1 1SZBA 1DHKB 2NMOA 2WNEA 3C7GA 2ES3A 5AVPA 3S57A 4FFFA 3U78A 1QH7A 4YW3A 2PQQA 3K77A 3P1IA 3IWZA 2XUEA 3TN92 4BXSV 1C5IA 4D7TA 3BOPA 4MGSA 3T1LA 1ULEA 4QQHA 4AZZA 2VBDA 3WNOA 1RHI1 2RS53 3RWNA 1NOVA 2BWCA 5J3UA 4BWOA 3ITQA 1OSGA 2LROA 4Z2WA 5L73A 4ZKTB 3NKTA 1UIJA 2WZR2 4L11A 4UAPA 3ROUA 2D6LX 3L2HA 4LE3A 5HCBA 3MO4A 3M3CA 2B9UA 1FPN3 5H9QA 4AGVA 3EHKA 3RSJA 1H8TB 2EAAA 5D1IA 4ZS2A 3RG0A 2D7FA 2MNGA 2AACA 1MQTC 5JZGB 3HNMA 1G7YA 1BXHA 4PIZA 4UYBA 1HXS2 3OOXA 4RGKA 3WCRA 4E2SA 3M70A 3LPFA 2BGOA 4R8HA 2Q30A 4Q1PA 5T5OA 5BNNC 5ABJB 1OLMA 3K4AA 1X8MA 1Y43B 4OQ8A 5F39A 3U37A 4LE4A 4DXSA 2X10A 2Y6GA 4JKKA 1K45A 4BE3A 5J96B 4QXBA 5A7OA 2JECA 3DV8A 1BVVA 1TME2 2VOWA 3DXTA 3OJBA 4HZFA 4ZXEA 4BQ2A 1VMFA 3RMXA 1LJ7A 1WMDA 1ZRDA 4A3ZA 5L9RA 3POWA 2B4KA 4CCMA 4QHOA 3HOBA 3WINE 1CAUB 2Z2SB 1N47A 1SFYA 3OCPA 4MXVA 3DL3A 1UU5A 4INDA 1VBD3 4BDVB 4YW4A 4CYDA 2ZA9A 4UW6A 5AC92 1NLRA 4FTSA 1W6MA 4EWDA 1WD4A 1LU1A 4AHYA 3NQHA 5DAQA 2WO1A 3DPRB 3ZFFA 4OULA 4YGCA 3WP3A 1QNYA 2FBEA 2WZ8A 1PO23 2YDEA 1LOFA 4Z8BA 1N3PA 2B42B 1RVF2 1GZCA 1KJLA 3LB9A 3ABZA 2YBPA 4IV1A 3VBHA 4MO3M 1IS5A 1N1TA 1EUUA 4HKOA 5JDBA 2C1FA 2PA7A 3BB6A 5FMDA 1FMD3 1RUJ3 1BBT1 1KFXL 1VAVA 1DBNA 1RUH3 3LKJA 4Q0VA 4RS5B 1ZNPA 3S7IA 1JHNA 1S0GA 3C3VA 1PGW2 4OHYA 4MOAA 3LEKA 4CDQC 2YPDA 1RUOA 4H7LA 3TWIA 1ZBE2 3KB5A 3VV1A 1QJU1 1GNZA 2JDZA 3RMYA 3ZFGB 1MZ5A 3AYCA 1NCQA 4MGQA 5JMOA 3ZDSA 5I8SA 3CO2A 3VBRB 1RUNA 2Q1MA 3A21A 5LK7B 4OI0A 1H6XA 2D44A 4QPWA 1V9U2 4CP9A 3MZHA 4Y26A 2YU1A 2VZSA 3MFAA 2MEV1 3T1MA 3AX4A 4IV3B 4LHLA 4Q27A 4Q4V2 1YQCA 3SNMA 2XXZA 3POBA 1DYPA 3FL7A 3G6JB 1GNHA 1O8PA 2VZUA 2ZGLA 3ACGA 3CL1A 3OTFA 2JG9A 4MH0E 4NOTA 5DUUA 4D7SA 1HN1A 4QDRA 3DUIA 5L36A 4BQ3A 3VD9A 1F8VA 4Y4RA 1A78A 1DGRA 1C1FA 1ALYA 2PLV3 2LALA 3AP5A 3HT1A 4FVVA 4I01A 4W4ZA 5ANQA 3RI8A 4QAWA 2SLIA 4W8JA 1V6MA 3U4SA 3L2YA 1UF2C 4IDZA 4Q0QA 2E32A 1L7QA 2DTYA 2YPJA 4LA2A 3C8XA 1W04A 5DN2A 4ISRA 4OHZA 2J1RA 3T2PA 4CUCA 5FZEA 2VUJA 3H3ZA 4BXFA 4FPEA 2C6SA 2YGLA 4AHXA 3J7NA 4I3GA 3J4UH 2W3JA 3MIGA 2OIIA 4YRDA 1FNYA 1MQTA 5APAA 1Y3TA 4GB32 2YFUA 3W5MA 1FV2A 2UWCA 3IKWA 4LKSA 4B3NA 3RZKA 3EYPA 1WBFA 2VR4A 3OEBA 3Q8EA 4O9GA 3PJQA 5L7OC 3VL8A 1RUE2 1H2MA 2WT0A 2BNNA 2FMYA 2HWE1 3ATGA 5K0UC 1SLLA 2P6HA 1UZZA 3KV5A 3D8CA 4V2WA 4CU8A 1QH6A 1W9WA 2RS51 3J8F3 3OGSA 5IVFA 4HVQA 1PVC2 2F6BA 4HN1A 4LO6B 2WWUA 1G9DA 4IGOA 4Q2FA 5HCHA 1GWLA 4LITA 5A7PA 2Y60A 4B7EA 1DGRN 1ENSA 4OI4A 2ZGOA 4QB2A 3VUOA 1D0HA 2VXJA 4DUXA 4RL7A 5A3UA 2JKXA 4PI0A 4E2GA 1CJDA 1LOBA 4CU9A 1R1A3 2QNKA 3V0BB 2ZGNA 1UOGA 1UX6A 3PURA 3X29B 2FD8A 1OUXA 4IEXA 2A71A 4LK7A 4OHXA 1O5LA 1XB9A 1UY1A 4WBBA 3VBOC 4ARXA 1PZ9A 4AQ2A 4DUVA 3IDAA 4XUNA 2V4VA 1QJX2 5EJZB 1TMF2 5F6KA 2GMMA 3GBGA 4XF9A 5KHJA 3T08A 3U10A 2WC2A 3RJRA 2LS6A 3THCA 4NPMA 2DCTA 1STMA 2Q8OA 4Y3OA 5C6CA 3VHOA 3N36A 4DPNA 3MIDA 2XMLA 3MW3A 2ZX0A 1SBDA 2NYYA 3SLIA 4CCEA 1V6JA 3KT4A 1AYN2 1RMU2 1MZFA 2Y6LA 4LBQD 4LHKA 3THDA 1PK6C 1OOPB 4HG6B 2DBNA 1ONAA 3WEZA 5K4LA 4WM8B 3W9AA 2ET7A 4BQ4A 4O65A 1PO21 4XIKA 1VMHA 3OBTA 4P9LA 3J7MA 4CU6A 3ETQA 4LOSA 3ZX7A 5FUIA 3GBFA 2WQ4A 2GSYA 4QKFA 1AR83 1RUJ1 2UU8A 5GM0A 4PIXA 5C4WB 4OUEA 4J6GA 1WCKA 1OLQA 4YGBA 3A22A 1FOD1 4FBFA 3VDDA 5IHRA 1CX4A 5GLZA 1KD7A 4JGYA 4XJZA 4JZRA 1HRV1 3VLBB 1QJY3 4IEQA 4Q4Y2 4CVUA 3T2TA 1RIRA 4UT5A 1IKQA 3NJXA 1BK0A 1XE0A 1DGLA 3C7FA 3E5QA 3FZ3A 2GN7A 4N90A 3FHIB 4YZ1A 5LA1A 4O61A 4JQRA 4QX8A 2W2IA 2VAUA 3GJAA 5L7OA 3INAA 3DF0A 1ZZ8A 2RDSA 5K0UA 1O91A 2UY8A 1HX6A 1J3PA 2CTVA 2DURA 3OUHA 4WVWA 5DAPA 3UKNA 4E27A 3O1MA 1X8EA 3N7KA 2HWD3 4Q4X3 5JOYA 3RQ0A 5KBFA 5FTTC 4XYXA 4HVOA 3LFMA 4XMAA 2ZJCA 3I3DA 3JCIA 5FY8A 2HBUA 1DGWA 3WQ1A 1LEDA 3WXPA 4MADA 1OD5A 1XNTA 2W52A 3IIIA 1RITA 1HIXA 2WS93 1OMIA 2OS2A 3VDCA 5FY0A 1W03A 3PVNA 4DNYA 4EN9B 1UN1A 2HBTA 4AYUA 2J1SA 3LCPA 5KWRA 4K9SA 2BP6A 1UW8A 3MIFA 4CUAA 4AFAA 1OQ1A 3IT8A 5H9SA 4ASMB 4P5HA 5JZGC 5JSPA 4QQOA 2BBAA 2ZS6B 3C7EA 2AUYA 3S0MA 1JN2P 3RGBA 4BB3A 2XL9A 5ABJC 3N9LA 1LAJA 2LM3A 1T2XA 2VQ0A 4O7XA 1UL9A 3T3YA 4NVPA 5LRRA 4G3YC 1BEV2 2HJIA 3M3EA 4NWWA 4GKXA 2WSVA 3BPSA 5FP3A 4QX2A 3J8F1 2QFEA 4JC1A 4A44A 3RZGA 4SBVA 4XXPA 2JDHA 1QU0A 2WNUB 2UYAA 1PO12 2JG8A 4MX3A 4EN8B 2ZEWA 5FMOS 2Z4FA 4EE2A 2I2SA 5CFCB 3CKHA 3RYKA 2DVBA 1ZZBA 4DY3A 1FT9A 4ZZ8A 2A3YA 3FHAA 3AZYA 4Z1VA 2Q4SA 3TN91 1HRI2 1W3VA 3DPRC 4K8RB 5DZFA 4XCBA 3NO8A 3ACHA 1US3A 2F17A 3WG1A 4A45A 2B5HA 2XQXA 4B1LA 5FYCA 2D3RA 3K48A 4DB5A 4C90A 1AR92 1DLLA 1MVQA 4BLJA 3FFQA 3RYRA 1V0AA 3H7YA 5T50A 1OI6A 4RS5C 2GNTA 1GP6A 2OQ7A 4F8AA 1VBB3 3PU3A 4D69A 3DKWA 5TSWA 1KDMA 3ZO0B 3ZYHA 1C8M2 2V4AA 4K1ZA 3ZFGC 3ZMOA 3E6CC 1R092 4BISA 2HWB1 2CAVA 1BYHA 2XJPA 3VBRC 1W8OA 2A6ZA 2DWRA 2GN3A 2Q1ZB 3CIHA 3HBKA 4IQPA 4KG0A 3T0BA 5C8CC 2BFUL 2E53A 5DZGA 1KJRA 3DKQA 2YROA 3LAGA 4XFCA 4LUMA 4IV3C 3WUDA 5JOWA 4AFMA 1BMV2 1J1LA 1OURA 2WO7A 4AOCA 3WZ1A 1OQEA 1PGL2 1TME1 4S2DA 1IQDC 5FYTA 2WL1A 4Z92B 1DDLA 1EAH3 1XSQA 3DYMA 4LO7A 1FXZA 3ZSLA 5LBEA 2YY1A 4YG3A 5F3IA 1AR81 5CEHA 2WFF3 3KD4A 2DCZA 1YXWA 5I91A 5JIUA 1IS4A 4YNIA 4LBMA 3CDZB 2DVFA 3AMQA 1N1YA 3IB3A 4LOTA 4WVMB 3KM5A 3ZXEA 4AGRA 1RHI2 2VH9A 2PTMA 5AC91 2AGSA 3AYAA 4X6RB 5HCFA 1Q8QA 5FO9B 5K8SA 1COV3 4FOYA 5CYYA 4W50A 1MZEA 4HANA 2J42A 2VL4A 3K4DA 1H8TA 1RUD1 4CA9A 1UKRA 1JH5A 4LNVA 1PVXA 1D2QA 2L9LA 4D0QA 4OCTA 5JAXA 4HONA 1GOGA 5FPUA 4N8MA 5FZ8A 4MGZE 1A3KA 2K9ZA 2X29A 2IVJA 4H3WA 3MLJA 4P9IA 4XETA 2VC9A 5ABJA 1G9BA 4R9BA 3VD5A 1F9KA 4IV1B 1YFYA 3I54A 5LCWL 3OGVA 4AAXA 2GALA 2V5DA 2J1EA 3KVBA 1K5MB 4XBNA 3ZFEB 4DY5A 1ZBE1 1HDKA 2P3YA 5A3PA 3H1WA 1XC6A 3P3PA 1J83A 4IXLA 5DPNA 1U12A 4XZUG 3QH7A 3AP6A 5A7QA 1OXCA 4HK8A 2VPVA 1JBCA 1CAUA 1DU3D 1OFSA 1X7NA 2W87A 3LEGA 1NCQB 2A6YA 4IGQA 3K3NA 4XURA 4E4SA 1NCRA 4XEZA 4XFIA 1PIV2 3D4KA 3E1F1 4BM8A 4LHSA 2LUWA 3HQUA 2ZX3A 4XUTA 4XMIA 4UBGA 4CP9B 5DZEA 3ZYBA 2D98A 1UMIA 3OY8A 4W6YA 1PX3A 5LY1A 3ZXJA 3DXUA 2JG9B 1WW4A 2IZWA 2K46A 2DU1A 1X33A 1SCSA 3NNJA 4J1XA 4K40A 2CY6A 3DEMA 2BFUS 5LWBA 4Y5SA 2PMWB 4KGGA 4KG8A 5JR7B 3RZZA 4LKFA 2P17A 5LB6A 4AQ6A 4RS5A 2PXJA 2DUOA 4B4QA 5E88A 5KXEA 4XF4A 4RHV3 4XJAA 4C8DA 3WHTA 4HK9A 1JODA 3ZXFA 1W2UA 1BBT2 2JDNA 4S2FA 4QKBA 4CP1A 1VBC3 4XDPA 4GB31 2WKKA 3WDTA 3ZFGA 3VBRA 2PAKA 3VZKA 3FUQA 4HLTA 5F37A 4FO9A 3UV9A 1I6XA 1PGSA 1LHUA 5A7SA 5EXOA 1QJU2 1U5IA 3ORJA 4XDQA 1RUE1 4XUPA 1QWRA 3KF5A 1OOPC 4CXWA 3SCHA 1T6BX 2XGXA 4IV3A 2DCYA 2CAUA 4WM8C 2DFBA 3PDQA 2RDRA 4NRQA 3B69A 3FBMA 2VQAA 3ZYRA 2JXAA 2WZPP 4MSVA 1F15A 3QBQA 5HCAA 1W8UA 3WDUA 1O7FA 1ZRIA 3PNAA 3AKTA 5FK7A 4PF5A 3ES4A 4Z07A 2ARXA 4C1XA 3UETA 4IEVA 5C4WC 3OUIA 1HQLA 1VB2A 4GALA 1BK1A 1E57A 1WCUA 2ADDA 3HD8B 4DS0A 5GZCA 1ASJ3 1WCSA 2VOXA 3MIHA 3U4XA 5C70A 2V72A 4IGPA 4G4FA 4Y1VA 5JPNB 4MHRA 3B01A 4EN6B 1R081 1PMHX 1XNBA 4QGLA 4Q0SA 4X8NA 1KS5A 5A1LA 2QQKA 4UF0B 2OVUA 3ZXGA 4XXAA 1W2AX 3APBA 3MF6A 2VJXA 1I9RA 1JYWA 1ZM1A 4HSJA 3N9QA 4YM1A 3HWJA 4OI2A 2FHRA 2WLQA 1UU6A 4A6OA 1SFNA 2C5DA 2OPWA 5C5TA 1NKGA 2HWE2 2JICA 2VTXJ 1LRHA 3MPBA 1SLTA 1YJLA 4AL9A 5FDBA 2WFF1 4CCJA 3NNMA 3J9SA 1UOFA 4XJWA 3ST7A 2VCBA 1GANA 2CYFA 4K7JA 4AVVA 2EIDA 5J98B 4Y22B 4AVAA 3KVAA 4IE4A 5C3QA 1AYN1 1RMU1 2RS52 2VMDA 4OZOA 5L9BA 2WFPA 4B7KA 4XOGA 3VDAA 4JDOA 4CEWB 1ZBA3 2XBO1 2XVLA 3VZMA 4IE6A 4FXKB 5KHIA 1NZIA 3S30A 3Q8BA 4XFGA 2WO3A 1ULPA 2IXKA 2YHJA 2VO5A 5JXGA 2ZGQA 3LSEA 3PVBB 3IAPA 4BQXA 3POGA 5ISLA 2R063 4LO5B 3SQOA 1H2LA 3HR9A 2IXHA 4XUOA 3WD5A 3ALQA 1W0OA 4KWUA 2XJUA 2YB7A 1WWYA 4M3CE 3TAYA 4DIQA 2P3KA 5G04L 4KI5M 1GV9A 4XFFA 3UK9A 2A70A 1ZVFA 2VUAA 4LBNA 2NQYA 3W20A 5KC6A 1TVGA 4LTAA 5LZ6A 3I3QA 4CSWA 2GP3A 4TLGA 5KC5A 3JXSA 3GZUC 3VDDB 2BRTA 3VN4A 2VCCA 3WF1A 4JGYB 4LBJA 2R071 3VHNA 1O4ZA 2WNUC 4QQ2A 3ZYGA 4FSJA 1A34A 1UMZA 2YBSA 2RVAA 3BOWA 3THPA 1N1SA 5DXDA 1NX9A 5I0UA 1F2NA 2Y26A 4NUBA 5BNPB 4K20A 1VBD2 3JU9A 4P14A 1VMJA 4JTNA 4WM8A 2QE3A 1IZ3A 2VG9A 5FUPA 1JYXA 1DYOA 4MXWA 3ZXLA 1JUHA 5CB7A 4DMIA 1YFUA 3ZM8A 1PO22 1YFWA 3AFKA 4FTEA 4RQPB 1DFQA 4X6QB 3ZN5A 3WDWA 1UCXA 4TYSA 5C4WA 5A7WA 4MV2A 4N43A 2Y33A 5FO7B 4C91A 2P34A 4QX7A 3KCCA 2V73A 1FYUA 1RUJ2 3SITA 1RINA 5FPXA 1VBC1 4FPCA 3UGFA 3POEA 1ZRRA 2RS11 4XJ9A 1OT5A 1OHFA 3HPNA 3CJIB 4LBQB 1XOYA 1W8FA 5H9RA 4AAPA 5GLVA 1I1EA 1VBE3 4HL0A 5GLWA 1HRV2 2R32A 2YFZA 3ENRA 4FI9A 1JOPA 1A6CA 3BODA 3VB9A 1UY2A 1VBA3 1PMJX 2CNAA 3KSCA 5T52A 4NAOA 1QMJA 2UURA 4D6SA 1O3SA 5HXMA 2IC1A 3HNYM 4E8DA 5A3TA 1C3HA 3WUCA 3MYXA 1GOFA 1S2KA 2XDVA 2ZGPA 4Q0UA 2BBVA 3T30A 2VU9A 4LMFA 3VDBA 3KV6A 3A4UA 4XVHA 2GH8A 1NYWA 1QXPA 1UAIA 4AHZA 3BGAA 2Q1FA 4LLOA 2PLV2 2QDRA 2R1DA 2X5IB 2EF6A 3RS6A 3ZSMA 5B4NA 1ASJ1 1DF0A 1ND2B 5D8AB 2I45A 4FCAA 4KWLA 2JG8B 4IE5A 1EPWA 3RYPA 4Z2AA 3R4UA 1VRH3 3LEIA 4FOVA 4AF9A 4LORA 4NAMA 1LOGA 4MZUA 1UU4A 2UWBA 3FLPA 5C5UA 5K9YA 4IEWA 3ZKUA 3SEPA 1JOBA 1LOFC 2DCKA 4NRPA 4ATFA 3HT2A 4K3UA 4IV1C 3VBHC 5A6XA 1PM7A 2VVEA 4CCCA 5C3PA 4ET7A 3T4VA 4XF3A 4JV4A 4JKMA 1K5MC 1MS9A 1LNSA 1H1IA 1YQ6A 2D6OX 1CX1A 1C8M1 4FPOB 3I8TA 3E97A 3J7HA 3RZHA 1CZSA 4XBQA 2P3IA 1W6PA 2G4IA 4IW3A 4JRAA 2WNUA 4LULA 4MGYE 2IXJA 3J8F2 1NCQC 5DMYA 3JBG3 3CBNA 1LECA 1NA1A 4BJ0A 2Y0IA 5FXWA 5CFCA 5IVYA 4UW5A 4XQWA 4PLOA 1H6YA 2OXBA 2PHRA 1UWWA 1HJFA 4QD2A 1K5JA 1O59A 4J25A 4E4DX 2ZMLA 2R061 1D2SA 4E8CA 3GDBA 3O1RA 4Z82A 2JG9C 1ULDA 4AGGA 1HLCA 4YVSB 4NMIA 3USUB 2WA3A 3AMPA 4BK4A 4ZU7A 1NE4A 3I2HA 3O0VA 2XJQA 3R6SA 4DQAA 3N9MA 3FFZA 1OFNA 2YZ4A 2X05A 1E5RA 3GNEA 3TNQA 1AYM3 1POV3 1R64A 2IFWA 3AP9A 1H8VA 1EV13 2ZKNA 4XFBA 1UXXX 2RM23 3M1HA 4NIDA 4FT8A 5CKQA 5FP8A 3HQXA 4WZFA 3S6PA 5FV3A 3KGZA 3WDYA 4BQ1A 1V6LA 1W6NB 5CISA 4NE9A 3B02A 3K4ZA 1B35B 2HWB2 3FE5A 2D5HA 1S2EA 3UJOA 3H3UA 4P9JA 3TEYA 1XJAA 1NG0A 4DZGA 4QHZA 4A6SA 1KFUL 2RDNA 1AR73 1AVBA 5C3OA 2P1BA 2HEWF 1KXGA 5FZHA 2JIJA 2WNOA 3QH6A 1IOAA 1Y9GA 1GQHA 1QDCA 3NNLA 1RL3A 4PIYA 4YW7A 5EWSA 3WT3A 5HBAA 1RUC3 2ILMA 1CAWB 4Q5OA 3UL2A 4AVSA 4DFSA 1G9CA 4E9KA 3AL5A 4WVMA 1JU4A 5C71A 1PIV1 1AR82 3JB8A 3BTZA 2VBPA 3I2JA 2ATFA 3LDRA 5F5CA 5CG9A 2R043 2QQVA 2ZPXA 3OGGA 5FZLA 3B00A 1NCRB 5FWJA 1BHGA 2WT2A 1Q3EA 3DYOA 2TUNA 4V1PA 1H1AA 1IS3A 2R1BA 3NKGA 1RUD2 3JD73 3OY8B 4FTBA 3B94A 2Q0AA 4GWMA 3PUIA 1UYZA 2W94A 4NN0A 2GNDA 4COUA 2LRPA 4Y33A 3WNPA 4BOWA 5IK8A 3RVHA 3KS7A 2HEYF 3MLLA 1K5MA 3ZFEA
chains in the Genus database with same CATH topology
4ZPIA 4NHXA 2OPWA 3GJAA 5C5TA 4UWDA 4NHYA 2RDSA 5EP9A 3OUHA 5C5UA 5DAPA 5DAWA 3HQRA 4XACA 3NNMA 5EQUA 5L9VA 5L9BA 2HBUA 5DAXA 2FCVA 5IAVA 5ERLA 5IATA 3ITQA 2HBTA 4KBZA 2G1MA 4BQXA 4IW3A 3BVCA 4J25A 3W20A 3OUJA 3HQUA 5HV4A 2FCUA 4NMIA 5A3UA 2RG4A 4NHMA 3NNJA 4Y5SA 4XCAA 5L9RA 5LB6A 5IAXA 2A1XA 5LBBA 2Y34A 3KT1A 5LBCA 4NHLA 4XCBA 3GZEA 3GJBA 5EPAA 5DAQA 4ZONA 2Y33A 2RDNA 5M0TA 3KT4A 2JIJA 4BQWA 2RDRA 3NNLA 3MGUA 3KT7A 4Q5OA 3W21A 2V4AA 5HV0A 5LBFA 4Y5TA 3OBZA 2FCTA 5DAVA 3OUIA 5LATA 3DKQA 4NAOA 4XABA 2RDQA 3EMRA 5LASA 4MHRA 4NHKA 4JZRA 5LA9A 4XC9A 5LBEA 3PL0A 4XAAA 3NNFA 2JIGA 4BQYA 4MHUA 2G19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZPI A;  4NHX A;  2OPW A;  3GJA A;  5C5T A;  4UWD A;  4NHY A;  2RDS A;  5EP9 A;  3OUH A;  5C5U A;  5DAP A;  5DAW A;  3HQR A;  4XAC A;  3NNM A;  5EQU A;  5L9V A;  5L9B A;  2HBU A;  5DAX A;  2FCV A;  5IAV A;  5ERL A;  5IAT A;  3ITQ A;  2HBT A;  4KBZ A;  2G1M A;  4BQX A;  4IW3 A;  3BVC A;  4J25 A;  3W20 A;  3OUJ A;  3HQU A;  5HV4 A;  2FCU A;  4NMI A;  5A3U A;  2RG4 A;  4NHM A;  3NNJ A;  4Y5S A;  4XCA A;  5L9R A;  5LB6 A;  5IAX A;  2A1X A;  5LBB A;  2Y34 A;  3KT1 A;  5LBC A;  4NHL A;  4XCB A;  3GZE A;  3GJB A;  5EPA A;  5DAQ A;  4ZON A;  2Y33 A;  2RDN A;  5M0T A;  3KT4 A;  2JIJ A;  4BQW A;  2RDR A;  3NNL A;  3MGU A;  3KT7 A;  4Q5O A;  3W21 A;  2V4A A;  5HV0 A;  5LBF A;  4Y5T A;  3OBZ A;  2FCT A;  5DAV A;  3OUI A;  5LAT A;  3DKQ A;  4NAO A;  4XAB A;  2RDQ A;  3EMR A;  5LAS A;  4MHR A;  4NHK A;  4JZR A;  5LA9 A;  4XC9 A;  5LBE A;  3PL0 A;  4XAA A;  3NNF A;  2JIG A;  4BQY A;  4MHU A;  2G19 A; 
#chains in the Genus database with same CATH topology
 1Q8V A;  2VZR A;  3M2M A;  1LOC A;  4CDX B;  4JX0 A;  1E5S A;  2HWD 2;  4Q4X 2;  5JXH A;  3CF6 E;  1DGW X;  4GMP 1;  4A7Y A;  5EP9 A;  2Q8D A;  2VGD A;  3WG3 A;  5IVC A;  1TG7 A;  4Q0P A;  3O7O A;  3MW2 A;  2OUH A;  4D6R A;  3EXU A;  5F5I A;  4CEW C;  2WS9 2;  2VMF A;  5DDJ 3;  5A70 A;  3RZL A;  1VRH 1;  3UES A;  3AZV A;  3I59 B;  5A6Z A;  4R52 A;  2WWS A;  4GWJ A;  5IAT A;  1EY2 A;  2O1Q A;  4KBZ A;  1W8Z A;  2G1M A;  1GQG A;  5FY4 A;  4P9W A;  4FPF A;  1UD1 A;  4YZ4 A;  1OA3 A;  4FPH A;  2WA4 A;  2HYK A;  1GIC A;  2PHT A;  4XPV A;  2ZGK A;  3WDX A;  1BLZ A;  1APN A;  3VDD C;  2JDY A;  4YW5 A;  1L7R A;  4JGY C;  5F2S A;  4KNC A;  4P9G A;  3DGT A;  2GMP A;  3TEX A;  3H1M A;  1UO9 A;  2ZGU A;  4FQ4 A;  5ACA 3;  5A3N A;  1XYO A;  4WVV A;  1U5Y A;  4OFG A;  1B09 A;  1D4V B;  4XHB A;  4EZH A;  2DDU A;  2RG4 A;  2W39 A;  3URF A;  5BNP C;  5FZK A;  2KXL A;  4M01 A;  1GU3 A;  2RR1 3;  4CP0 A;  3TRS B;  1DZQ A;  5IAX A;  4XZP A;  1SPP B;  1UYX A;  2MHF A;  3AXE A;  2QQI A;  4PLM A;  1DIW A;  4RQP C;  1GP5 A;  4YW2 A;  1W3X A;  1XE8 A;  5CFD B;  4MG2 A;  5FZI A;  1N3Q A;  3RRD A;  1ND3 B;  3K46 A;  3KWV A;  1NQD A;  3LGR A;  4BYY A;  5FP4 A;  1EV1 1;  5E1R A;  1IG0 A;  2AR6 A;  3A23 A;  4P02 B;  4Y1Y A;  4ZON A;  1W39 A;  3FLR A;  2VCM A;  1LEM A;  2GC0 A;  1FPN 1;  3CJI C;  2QQO A;  2FDG A;  1C4R A;  1TEI A;  1DQ6 A;  3D5O A;  5BYN A;  3ZDV A;  1MS3 A;  5CAD A;  3FLT A;  1G9A A;  4RR3 A;  4V2V A;  1SLA A;  2ZBJ A;  4JKL A;  3GZT B;  2PYT A;  2GH2 A;  1JYC A;  1VAK A;  4UF0 A;  3VL9 A;  4BU2 A;  1CN1 A;  5F1R A;  5CKN A;  3KT7 A;  3W21 A;  2PHU A;  1R08 2;  2VVD A;  1VPH A;  2RJ2 A;  1ENQ A;  2RMU 3;  1AR7 1;  5DAB A;  3E5X A;  1RED A;  3T0D A;  2BEO A;  2R6Q A;  2ZGT A;  4I2O A;  4FFI A;  2ORZ A;  1CIW A;  3LE0 A;  1WZX A;  5FY1 A;  4QGN A;  3R05 A;  2W1W A;  1RUC 1;  1ST8 A;  1EAH 2;  2W9X A;  5EHD A;  4JGZ B;  4AFB A;  3CMG A;  4Y22 A;  2X5I C;  2Y6K A;  4URA A;  1A8M A;  2WFF 2;  1ND2 C;  4LO4 B;  5D8A C;  4CEW A;  2JG8 C;  1VBD 1;  3N9P A;  1OPM A;  3ILN A;  4A4A A;  5IT6 A;  2BU9 A;  2JIG A;  2OZ6 A;  2P5B A;  3FN9 A;  5A32 B;  2KM2 A;  3GCW A;  1JZ8 A;  3AYD A;  4FAH A;  1COV 2;  4LA3 A;  1DZR A;  2XBO 2;  4AXO A;  4RGG A;  1X82 A;  2BVB A;  1ENR A;  2WZR 3;  3NST A;  2GDF A;  1DQ0 A;  4ERO A;  5EIY B;  5FOB B;  4DEQ A;  1H30 A;  3POY A;  3MBW A;  4UWD A;  3EBR A;  1F5F A;  4L9B A;  4M3C A;  4MGK E;  4MXW B;  3NVC A;  1MS5 A;  2FDI A;  1ZZ9 A;  3HQR A;  3PUQ A;  4ZU4 A;  5GLU A;  3SKV A;  1FMD 1;  2X53 S;  5EQU A;  1D7P M;  1RUH 1;  4NO4 A;  1H2K A;  1HB1 A;  4NPR A;  1HXS 3;  4P08 A;  5A7W B;  4N43 B;  3ZOI A;  1CAX B;  3AK0 A;  2QBX A;  4HFS A;  5C3S A;  5FO8 B;  2FCV A;  2Q5T A;  4O9E A;  5SV5 A;  3FUO A;  3H8U A;  1M4W A;  2D3S A;  1PX4 A;  2ARC A;  4MET A;  3V65 A;  2BWA A;  1W8W A;  4Y1U A;  4BH9 A;  2J7M A;  3IPV B;  4AI3 A;  2EAK A;  2R07 2;  2VQT A;  5DDJ 1;  2DYC A;  1WA4 A;  2ZZQ A;  4CEY A;  4QMA A;  3MW4 A;  5BNP A;  2D3P A;  4IEP A;  1O3R A;  1Z0H A;  2A3X A;  4QPG B;  1RUG 3;  2QQP A;  3NV1 A;  2YU2 A;  2DUQ A;  3UYJ A;  1MPX A;  4HT1 T;  4CCK A;  2E9Q A;  1TNR A;  3BVC A;  4YVS C;  4RA0 A;  4XQ4 A;  4XBL A;  2PLV 1;  5JSR A;  2WYF A;  4RQP A;  2FCU A;  2ZXQ A;  2WQZ C;  1DQ1 A;  5DUV A;  3WNL A;  3BU7 A;  5IVV A;  4QPI B;  5FMB A;  4RN5 A;  2YG0 A;  2ZHL A;  1KIT A;  1RVF 3;  3IBM A;  3L9J T;  3WW2 A;  1J1T A;  4RHV 2;  4CRQ A;  4FPL A;  3CJI A;  4LBQ A;  4N53 B;  1PNF A;  2PN5 A;  1H8T C;  1IHM A;  5A6Q A;  4B4P A;  5ACA 1;  5FZ1 A;  1VBC 2;  4D8M A;  2RS1 2;  3UGH A;  4BA6 A;  4N7I A;  1B35 C;  5FZG A;  3O1O A;  3O1V A;  3HN1 A;  3FHQ A;  1J3R A;  3WOG A;  3ACI A;  1AXK A;  2J1T A;  2RR1 1;  2WII B;  3PME A;  2RE9 A;  3PTR B;  1CR7 A;  5D21 A;  4UFH A;  1HB3 A;  2W68 A;  1M06 G;  3KLS A;  4CDU A;  1GR3 A;  1K3I A;  2CL2 A;  2EXK A;  1OA2 A;  3SCG A;  1OUS A;  1Q8P A;  3WSO A;  1J84 A;  2ZHM A;  4OYU A;  3SKJ E;  3F95 A;  4BQW A;  4AHW A;  1GOH A;  2B46 X;  3LZZ A;  2X5I A;  1F4A A;  4LEJ A;  3OD0 A;  1W6P B;  2IXL A;  4K1Y A;  1ND2 A;  5D8A A;  4DXZ A;  2F4P A;  1HQN A;  1OF4 A;  2ZMN A;  5IFP A;  1Q8S A;  3IMN A;  4HKL A;  1NA1 B;  4EJR A;  1RB8 G;  1BZW A;  1NCR C;  4COV A;  4COZ A;  1O6U A;  2K0G A;  1ASJ 2;  2WSU A;  5FY5 A;  5FR3 A;  4KH9 A;  1R1A 1;  1UY3 A;  3F2Z A;  3AZZ A;  3AMN A;  3NV2 A;  1S1A A;  1W2T A;  4L97 A;  3TB0 A;  5FZD A;  5DUW A;  2XLG A;  3AB0 A;  1VJ2 A;  3B7M A;  2RMU 1;  1Y7B A;  1CIY A;  2CSG A;  1ZRE A;  2OQ6 A;  2VTF A;  2VUL A;  4PHZ A;  3DN7 A;  5LA9 A;  3ZPO A;  2DU0 A;  3GAL A;  1UOJ A;  1YFX A;  3WP5 A;  4MHU A;  2XLA A;  1HN0 A;  1YLL A;  3EO6 A;  3I2G A;  4AFC A;  4CDX C;  2Y6J A;  4NRM A;  4CPB D;  4NR1 A;  2E33 A;  2NN8 A;  5HI0 A;  3I3E A;  4RYD A;  3BKZ A;  1ZZC A;  4QXC A;  1AUY A;  2BNO A;  4ZPI A;  1YI9 A;  3U11 A;  3I3B A;  3BTY A;  3AMM A;  4H2A A;  2ZCW A;  3CQO A;  2FDJ A;  4CZS A;  1J58 A;  3WCS A;  1YQ8 A;  4BHP A;  2DVG A;  4XAC A;  1AZD A;  5FYY A;  4QDQ A;  3B3Q E;  3R4S A;  1AX2 A;  4QB1 A;  1RGS A;  3WG2 A;  2W46 A;  3AKP A;  4KU8 A;  4YVS A;  3O1U A;  3USU A;  5EV7 A;  5DQ0 A;  5F6L B;  4ZY9 A;  5IW0 A;  4D94 A;  2R06 2;  3KQR A;  2BV4 A;  1JI6 A;  1AR6 3;  1GYK A;  2QZ3 A;  1ULF A;  3U07 A;  4Q4W 3;  1Y9M A;  2XG3 A;  3CHX A;  3ZKY A;  1REE A;  2UWA A;  2ZHN A;  3CNA A;  2HWF 3;  2GNM A;  5KXD A;  1QQP 3;  1WUV A;  2WJS A;  3PVO A;  4QQL A;  4A3X A;  3ZR5 A;  4COY A;  2FDK A;  4YZ2 A;  1QJY 1;  4UFK A;  1W6N A;  3E6D A;  3FBY A;  3PLQ A;  5FZA A;  2B45 X;  1QJX 3;  3MIC A;  1XXN A;  3WR0 A;  5JLV A;  1JZ4 A;  3I49 A;  3OUJ A;  3PIJ A;  2ZEZ A;  1B35 A;  4JQT A;  4RD7 A;  5CA6 A;  1KGY A;  3TEZ A;  1W6Q B;  2Y6H A;  4X8P A;  3ZPY A;  4QX3 A;  4QHB A;  1G6N A;  4QQP A;  1RUG 1;  1UZ0 A;  1VAM A;  3U75 A;  3CJX A;  3EJK A;  4QDS A;  4N9H A;  1UYY A;  1JZ3 A;  2DV9 A;  4XAE A;  4XF1 A;  3PUS A;  2HWD 1;  4Q4X 1;  2J22 A;  1GWK A;  3P5B A;  4ZHN A;  2GAU A;  2R0H A;  1RUF 3;  5FOJ B;  4C0B A;  5CFD C;  5GZE A;  2XKO A;  3AJY A;  4CPB A;  2PHW A;  2WIN B;  1CAW A;  3ZN6 A;  4BPZ A;  1ND3 C;  2WN3 A;  1MZ6 A;  2Z79 A;  1L3J A;  3J26 N;  5LBB A;  4YLZ A;  3V64 A;  2Y34 A;  3KT1 A;  1PNG A;  2WS9 1;  5E16 A;  3SMH A;  1Z7S 3;  2LTN A;  5BXX A;  5A3O A;  3RDI A;  4UFI A;  4GMP 0;  1GZT A;  4XQD A;  1XYP A;  4I02 A;  4CCD A;  3AYE A;  5I8T A;  1ZA7 A;  3CZU A;  5IVJ A;  4I09 A;  3LEM A;  1JYT A;  3ZLI A;  1ODM A;  3SXW A;  1VBE 2;  2TNF A;  4NIG A;  2D97 A;  2B7Y A;  4YW1 A;  4YGD A;  2XJT A;  3GBW A;  4ZZ5 A;  2CV6 A;  4G9S B;  5HXV A;  1W8T A;  4EYU A;  3VKO A;  3SC7 X;  2P3J A;  1AL2 3;  1WLT A;  2V5Y A;  2VXR A;  3FWE A;  3OBZ A;  5LA2 A;  4CDX A;  2H6C A;  5LW9 A;  3PHM A;  1D4M 3;  4L8Q A;  4XAB A;  3J7L A;  4DIN B;  1A8D A;  2RDQ A;  1GMM A;  2HEV F;  3JUU A;  3LFI A;  2IWG B;  3AZX A;  1W90 A;  1I5Z A;  2O8Q A;  2QJV A;  3I2K A;  1YWK A;  3GM8 A;  4JAA A;  1QNW A;  2WUH A;  4HPK B;  5FZ0 A;  1TZO A;  5LAS A;  3BIE A;  4F7Z A;  3I59 A;  4ORF A;  2JDP A;  1ZA4 A;  2EXJ A;  3BPZ A;  2EIC A;  3EQE A;  2QQJ A;  2BOI A;  1H9W A;  1VRH 2;  3VZN A;  1Y4W A;  3M3O A;  2AH2 A;  1S0F A;  5J7M A;  1UXZ A;  5I8Y A;  5IK4 A;  2JD9 A;  1LES A;  2KA3 A;  1MAC A;  4XHX A;  3D0S A;  4NIA A;  2A6X A;  4HET A;  4AK3 A;  2OZJ A;  2G9Z A;  2W1S A;  4LT5 A;  1NLQ A;  5CAZ A;  4JRL A;  2CGN A;  4N43 C;  1X36 A;  1W2O A;  3ZR6 A;  4J1W A;  5KXB A;  1VBB 1;  2E7A A;  5BPX A;  5FBJ A;  3HMY A;  4R4Z A;  4M0N A;  5JOZ A;  4M4R A;  2JDA A;  3AC0 A;  5JR2 A;  5A1F A;  1OKO A;  3W58 A;  1ZZ6 A;  4DOU A;  1LB2 A;  1J3Q A;  3QLQ A;  1NQJ A;  3M3I A;  1UZY A;  2VMI A;  4RR3 B;  2AEY A;  4XFA A;  5F8P A;  4FFG A;  3E5U A;  4FXG B;  5F7U A;  3SH5 A;  3JBG 2;  5JMC A;  3NAP B;  3IM0 A;  4QPG C;  4OUM A;  3ILR A;  4RFT 0;  3LF7 A;  2K2S A;  2QUO A;  4P9Y A;  1OF3 A;  2XOM A;  2PHX A;  2BZD A;  4KU7 A;  4DXR A;  3RZM A;  3O1P A;  2NP0 A;  1SPP A;  3BTX A;  1EAH 1;  1MS4 A;  3NRU A;  3ZSJ A;  2EXI A;  2W47 A;  4EN0 A;  4R9D A;  5CFD A;  2YXS A;  4OMC A;  2P37 A;  5FRE A;  2JWP A;  3NW4 A;  1ND3 A;  4MVT A;  4NPL A;  3VBF B;  2VW2 A;  3I97 A;  4QPI C;  2YYO A;  2D6K A;  2OKX A;  1N1V A;  1T6G C;  4AVC A;  1US2 A;  2ZX1 A;  2NLR A;  2WRA A;  2JE8 A;  1COV 1;  3NWK A;  4LXL A;  2WWJ A;  5AFB A;  4N53 C;  2Y0O A;  1EV1 2;  2YMZ A;  4NHM A;  2GC2 A;  1OH4 A;  2RM2 2;  3D3A A;  2KR2 A;  3FMG A;  3P6B A;  5AVA A;  5KHH A;  2D6P A;  1FPN 2;  4XTP A;  1XRU A;  4OZX A;  4IET A;  1EPZ A;  4M3C B;  1ODN A;  3LDK A;  4MGI E;  4PJY A;  2Z69 A;  4W6X A;  3HEI A;  1S4C A;  2VNO A;  4GJZ A;  4PDW B;  2ZAH A;  4A2U A;  1AR7 2;  5EYX A;  1RUF 1;  3BU0 A;  5EPA A;  3ELN A;  3OGR A;  4FPG A;  1JZ6 A;  1YIP A;  5GKA C;  1SBF A;  4JGZ A;  2QKD A;  3K51 A;  1WMX A;  4JVA A;  3AP4 A;  4KL1 A;  3AMH A;  4H14 A;  1RUC 2;  2ZZJ A;  3T0A A;  2GC1 A;  2EIB A;  5JI9 A;  1NA1 C;  5CFC C;  3B93 A;  1LHO A;  3I4I A;  1LKN A;  2JE9 A;  5A32 A;  2VY0 A;  5FY7 A;  1MR5 A;  4CEY B;  1MEC 3;  5IYY A;  1WCQ A;  1QHD A;  2P4E A;  1GBG A;  4PT6 A;  4Y1Z A;  2BOJ A;  3GCX A;  4Y5T A;  1UZW A;  5C33 A;  3ZYP A;  1W9Y A;  1D0G A;  3ZSE A;  1JYI A;  1XPW A;  5FUN A;  4OLL A;  4XDO A;  5FAX A;  3UKT A;  1VB4 A;  2ZTN A;  3AKR A;  4JHZ A;  4Q8K A;  3D0J A;  2JEM A;  3H50 A;  3USS A;  1REF A;  3WW3 A;  1V6I A;  4YVW B;  3HNB M;  3KCY A;  3B5L B;  3M3Q A;  4IEZ A;  1YYN A;  4OQ9 A;  3KGL A;  4RHV 1;  1DYK A;  2CWS A;  1AL2 1;  1CAX A;  1S55 A;  2ZOE B;  1NAE A;  5DG2 A;  3VHP A;  4B8E A;  2BYV E;  1FMD 2;  2WAA A;  1D4M 1;  3MHZ A;  4Y20 A;  1RUH 2;  3PL0 A;  3U0Z A;  2VNR A;  1HKD A;  2J1A A;  2JX9 A;  5KHG A;  5T5L A;  1ZX5 A;  3VHR A;  3IPV A;  2WR9 A;  1BKZ A;  3U1X A;  3OEA A;  1W0N A;  1QGL A;  3AZW A;  3HN3 A;  1W6O B;  2VZ1 A;  2A75 A;  3AVS A;  3I2I A;  4QPG A;  3K2O A;  5DDJ 2;  1JUI A;  2I74 A;  5FPZ A;  1IKP A;  1W06 A;  2BJS A;  3OYW B;  4CDU B;  2B9V A;  1V00 A;  4DRV A;  3T4H B;  5IAV A;  5ERL A;  1O5U A;  2GU9 A;  4HN0 A;  3VZO A;  1GLH A;  4MYE A;  2QQU A;  4QPI A;  1IS6 A;  4XFH A;  1RUI 3;  1IPS A;  1Q8O A;  3ZMN A;  3ZVX A;  1JXN A;  1GKB A;  1QKQ A;  3LIH A;  4N53 A;  5CG8 A;  3NV3 A;  2VNG A;  5IWF A;  2PFW A;  1SDD B;  4AQT A;  3SCF A;  1IQA A;  5EJ3 A;  1W8N A;  1UPS A;  3VBO B;  4DRR A;  5JXI A;  2QTW B;  3H3L A;  1BBT 3;  2XVG A;  4FOQ A;  5ACA 2;  2BUK A;  1XQN A;  2Z42 A;  3KCX A;  3MEP A;  4ZXK A;  4BK5 A;  3VKL A;  1EUT A;  4CCL A;  4CDW B;  3RJ2 X;  2C9K A;  4B29 A;  2VUC A;  3PIG A;  3WW4 A;  4TZD A;  4M4P A;  2V09 A;  1QJU 3;  2RR1 2;  3ZFE C;  3RZJ A;  2IXC A;  1WA6 X;  2CDP A;  5JSO A;  2QQN A;  4LK6 A;  4TLF A;  2YV8 A;  1SQ4 A;  1JYV A;  2MEV 3;  1O4T A;  1CJP A;  1W99 A;  1H9P A;  4UW3 A;  4OUS A;  1ZBA 1;  4AEM A;  1SAC A;  3W5N A;  1FAY A;  4DUW A;  3A7Q A;  3H0O A;  2F4L A;  1VE0 A;  4NIH A;  4QM9 A;  1YEW A;  5E6H A;  4E4Z A;  4M00 A;  3JQX A;  3BTA A;  1SDW A;  3N7J A;  3OBA A;  3BUC A;  1LCL A;  5FZB A;  4PBO A;  3WY6 A;  1LGB A;  1HW5 A;  3AJZ A;  1R1A 2;  3ZXA C;  1W9T A;  3KQ4 B;  2ZKL A;  3ZYI B;  5J48 A;  4R9A A;  2PHL A;  4AE2 A;  4LUK A;  2WLP A;  1AF9 A;  1R1Z A;  2WDB A;  2RMU 2;  4UFL A;  1JS9 A;  5LEK A;  3VD7 A;  3SIS A;  1YQ5 A;  2FDH A;  4LQR A;  4EQV A;  2N7G A;  5DAV A;  3W59 A;  2FCT A;  5I0R A;  1LGN A;  2D40 A;  2VZO A;  4TSV A;  4ASK A;  4L2N A;  4PF1 A;  1V6O A;  5FYI A;  5FZM A;  1JYN A;  2HWE 3;  2VME A;  2ET1 A;  2Y38 A;  5FK8 A;  1F31 A;  5FPL A;  3KHB A;  2VMH A;  1CON A;  1MEC 1;  4XW3 A;  5FCC A;  1QDO A;  1C8N A;  5FMC A;  1HJG A;  2XQR A;  2XJS A;  4FFH A;  4AWD A;  1S2B A;  3HIF A;  2PEL A;  4XAA A;  2X09 A;  3AKS A;  2GNB A;  1CPM A;  2G19 A;  1VLN A;  3ZN6 B;  5T54 A;  1NY7 1;  2XJR A;  3POI A;  3AM2 A;  3AXD A;  3KV4 A;  3ZN4 A;  4D7Y A;  3OPT A;  4YG6 A;  2VW1 A;  5FJH A;  2ZX2 A;  2WNV B;  5FYM A;  1JU3 A;  5DAW A;  4YM3 A;  2PQS A;  4D6Q A;  2D5F A;  4LPL A;  1CQ9 A;  4QPY A;  1VAL A;  5FBZ A;  1VBE 1;  1POQ A;  1UNB A;  1TQ5 A;  4RR3 C;  1DQ2 A;  4YG0 A;  3RFR A;  1I5P A;  1QJY 2;  1W6Q A;  5CNA A;  3NAP C;  5DAX A;  4OMD A;  4ES9 A;  1W2N A;  1VBA 1;  2AZ5 A;  4ITC A;  3GYD A;  5A1A A;  3BN6 A;  4IEY A;  2OYZ A;  5IFT A;  4S2H A;  1BVP 1;  1WKY A;  4RFR B;  2W5F A;  5JI7 A;  1X9P A;  4CXX A;  2FDF A;  3V56 A;  3WNN A;  1O4Y A;  3PUA A;  4ATE A;  1JZ5 A;  1XYN A;  1RUG 2;  2HWC 3;  3A0K A;  2A3W A;  1OVP A;  3LWC A;  5EZW A;  4XIO A;  1WLD A;  2H0B A;  5F3G A;  5BNQ A;  1SFP A;  2R16 A;  2YGM A;  1ENX A;  3VBF C;  5BNO B;  2BGP A;  1YQ2 A;  2CHH A;  3GGL A;  2P6C A;  1JHJ A;  3OPZ A;  4OVE A;  1RUI 1;  3MLK A;  4K21 A;  4YW6 A;  4BZ4 A;  4CCN A;  1YRZ A;  3SH4 A;  4BCU A;  4BQ5 A;  4KWJ A;  1EYB A;  4RSU A;  1NXM A;  4FP2 A;  2ZX4 A;  2RS3 3;  2XHK A;  3NNG A;  5HV4 A;  2E26 A;  1YNA A;  1JZ7 A;  4F3J A;  5FXX A;  2YC2 A;  4FPK A;  2W1U A;  2XJV A;  3GHN A;  3HBZ A;  2C0Z A;  3ZIW A;  1QOO A;  5J36 A;  2C26 A;  3N9O A;  3GHM A;  1CVN A;  4H7M A;  5FP9 A;  3VBU A;  1FOD 3;  3UT0 A;  1KDK A;  4ASL A;  1CAV B;  4TN7 A;  3N7M A;  3UJQ A;  3OB8 A;  4BIF A;  4QGM A;  3H8X A;  2P2K A;  1HRV 3;  2VZQ A;  2BDR A;  4PDW C;  1YIF A;  2ERF A;  3VD3 A;  2RV9 A;  3OSD A;  5C8C B;  2GC3 A;  5CVR A;  3WNM A;  1W9S A;  4PCR A;  4DXT A;  3N4M A;  4TXW A;  3JBG 1;  1PHM A;  4DEV A;  2YC0 A;  3AKQ A;  4FQZ A;  4LJH A;  3SH3 A;  5CBL A;  4HPK A;  3RI9 A;  2XVK A;  2YBK A;  3N7L A;  4CEY C;  2VEC A;  2IFR A;  2Q8C A;  3I2O A;  3ZXK A;  4LIU A;  5T55 A;  1OC1 A;  5IK7 A;  5I0D A;  2WAO A;  2O0O A;  1C5H A;  3PUH A;  5A80 A;  3CLP A;  3CU7 A;  1YO8 A;  4IE0 A;  4Y5Z 0;  2BGC A;  2NPI A;  3OPW A;  3UNP A;  2ARE A;  2ZHK A;  3PMS A;  5BV6 A;  3TBD A;  3VKF C;  4AED B;  2W92 A;  5LAT A;  3BAL A;  4CCO A;  4JCK A;  4YVW C;  3GZA A;  3QCW A;  4IUG A;  5I93 A;  5FFO C;  1AYM 1;  1POV 1;  3MV1 1;  2HKX A;  4QU2 A;  3NJZ A;  4HBN A;  2RM2 1;  1C1L A;  2NMN A;  4WZC A;  2XWB B;  2QZ2 A;  1QIQ A;  4XE9 A;  1VBB 2;  3T2O A;  5BNN A;  1JMU B;  3ACF A;  2VOT A;  1K42 A;  2DFC A;  2FZ1 A;  4HKW A;  3AL6 A;  3MF9 A;  1JZ2 A;  4FPY A;  2NZ9 A;  3G7D A;  4YFW A;  3NAP A;  4ONU A;  3I2F A;  1LUL A;  2NM1 A;  4NHX A;  3WQ7 A;  1MS0 A;  5IUQ A;  1Q5O A;  1XSR A;  1AJK A;  3WQB A;  5FZF A;  5C9A B;  4CDU C;  2JB8 A;  3WF0 A;  4E4H A;  2EXH A;  3QAC A;  1H2N A;  1WW5 A;  1ZZ7 A;  2HH9 A;  1G8W A;  2TBV A;  5LY2 A;  1OPO A;  1F35 A;  3MUY 1;  4YPJ A;  5FKC A;  3VBF A;  4Q8L A;  4COW A;  3FJS A;  1AXZ A;  4OHV A;  3JQW A;  3NV4 A;  3IN9 A;  4XUQ A;  5C8W A;  1AR6 2;  1NE6 A;  5F32 A;  3IMM A;  4N9I A;  1OQD A;  4Q4W 2;  3TN9 3;  3THT A;  5A3W A;  2IUW A;  5A7N A;  2E63 A;  1C57 A;  2R04 1;  3S7E A;  1H4G A;  1LOE A;  1PM4 A;  1AX1 A;  2HWF 2;  4YZ5 A;  5IVB A;  1QQP 2;  2ZEX A;  5BUV A;  1VIW B;  3JD7 1;  1V70 A;  5H9P A;  1UZV A;  1K12 A;  4QT6 A;  3IDE A;  1LEN A;  4QX1 A;  2O14 A;  1RJ7 A;  1S0D A;  4BMB A;  4CDW C;  2WYS A;  1GSL A;  4CDQ A;  4UXA A;  3D6E A;  4GJY A;  4LO8 A;  4Y1X A;  2HWC 1;  3OGJ A;  3LPG A;  4PDW A;  3EB7 A;  2HWB 3;  5DG1 A;  1ZRC A;  1UY4 A;  1NLS A;  2X8K A;  3VBS B;  4AI1 A;  4ES8 A;  3ZXD A;  2RJL A;  1GFF 2;  3JZV A;  1DQ4 A;  4Y20 B;  1JW6 A;  1DG6 A;  1RUF 2;  2XON A;  4PI2 A;  3O1S A;  5JUV A;  4E2Q A;  4D3W A;  1U5X A;  2VQU A;  1E5I A;  1GUI A;  1GNY A;  2E7T A;  2RS3 1;  5FPV A;  5KHK A;  1LHN A;  5LA0 A;  1TME 3;  4EWA A;  2XB6 C;  1Z7S 2;  3ON7 A;  4CUG A;  2OT7 A;  4HOO A;  4XJ8 A;  4MGT A;  3C7H A;  3C2U A;  2IXI A;  2XL7 A;  4XIL A;  2EIE A;  5FZ3 A;  3B9I A;  1LHV A;  5FP7 A;  2C4X A;  5FMO L;  2VW0 A;  4NHL A;  3WVJ A;  4H55 A;  4WM7 B;  1C28 A;  1S0C A;  1SLB A;  3ZYJ B;  2W08 A;  5AC9 3;  4QX0 A;  1XBF A;  1WD3 A;  4YVW A;  3RNS A;  2ARB A;  1RUD 3;  3I3M A;  5CKM A;  4I3P A;  2GP5 A;  4TTG A;  4W65 A;  4IEU A;  4LBO A;  1GZW B;  3S5Q A;  2A5Z A;  1SHW B;  1AL2 2;  2A73 B;  5FXV A;  1U5Z A;  3RPQ A;  4I0B A;  3WG4 A;  5HV0 A;  1D4M 2;  2AC1 A;  4LLF A;  4YFZ A;  5I0T A;  1PMI A;  2QQM A;  3N3H A;  5FYV A;  2JDK A;  5FZO B;  4RGA A;  1W6O A;  2PHD A;  1WW7 A;  4W6W A;  3ZSK A;  1ZYB A;  1GZ9 A;  2D43 A;  1ZBE 3;  4JDN A;  4ZU5 A;  3FC0 A;  1OVS A;  1RXF A;  1UQX A;  1WME A;  2YUE A;  5AFE A;  1UOB A;  1UY0 A;  2UYB A;  3OYW A;  2Y6F A;  5FZ6 A;  1SEF A;  3H8R A;  1DCS A;  2QDN A;  4YWA A;  5A3L A;  1V9U 3;  3AFG A;  5SV8 A;  4GUL A;  5GZF A;  4Q4V 3;  5JWP A;  3NL1 A;  2RHP A;  4HVR A;  4NWV A;  5CU1 A;  4KWK A;  4OI1 A;  2WN2 A;  1UX7 A;  2ID4 A;  4S2G A;  1WW6 A;  5A6Y A;  1DLC A;  1FV3 A;  1VR3 A;  2WNV C;  1MS1 A;  2BNM A;  1XNA A;  1TE1 B;  1YJK A;  2VCA A;  3WF2 A;  5FQ0 B;  3M7A A;  4UW4 A;  2A6W A;  4GD4 A;  2VBB A;  1GP4 A;  2VNV A;  2Q8E A;  2A7A A;  3MI8 A;  3VBO A;  3V0A B;  4GH4 B;  4I30 A;  4LBK A;  3P3N A;  3OF1 A;  4AEJ A;  5L9V A;  2D6M A;  1XND A;  2B39 A;  2PAE A;  4KGQ A;  4CDW A;  4UFM A;  3BYW A;  3WHU A;  1LGC A;  5A3M A;  4LR4 A;  1V6N A;  2MPF A;  1XNC A;  1ULC A;  2G9F A;  1NXD 1;  2PHF A;  4GB3 3;  3IDC B;  2D6N A;  1U0A A;  2QCS B;  5A33 B;  5BNO C;  1GWM A;  3M8L A;  1AHS A;  1RUE 3;  1PK6 A;  2VE1 A;  1RYY A;  3CEW A;  1Z78 A;  4Q26 A;  2J1V A;  5FLH A;  5FLJ A;  1QXJ A;  3ZYF A;  4YSF A;  2E51 A;  3LA7 A;  4FPJ A;  4DO0 A;  1DP0 A;  3VD4 A;  4GWI A;  4GXL A;  3GF6 A;  4PQQ A;  3TEW A;  2C9A A;  2CGP A;  1WBL A;  2ZEY A;  1PVC 3;  3VKM A;  5JCT A;  1ZBA 2;  4GWN A;  3Q8A A;  4UOJ A;  1IGO A;  2WZR 1;  5C3R A;  5KR7 A;  5T5J A;  1NZC A;  1V6K A;  3O0X A;  2XHN A;  1OA4 A;  4A42 A;  5IVE A;  1UKG A;  1JOJ A;  4AEK A;  2A6V A;  3ILF A;  4HSL A;  5FYS A;  2GME A;  1CD3 G;  4N7U A;  3IDB B;  1BJQ A;  1ACC A;  1TNF A;  2W1Q A;  4WVZ A;  5FIX A;  1PZ8 A;  3WQ0 A;  1SLC A;  3Q8C A;  1HXS 1;  2A1X A;  5GLT A;  1L7L A;  1R08 3;  3O0W A;  4GIQ A;  3ZIX A;  4F83 A;  1E5H A;  4I0W B;  5LBC A;  1IPJ A;  4EN7 B;  2ZAA A;  3H42 B;  4KQ7 A;  4EWE A;  4AR2 A;  1FX5 A;  1SMV A;  1AXY A;  1RXG A;  1TMF 3;  2BW8 A;  3GJB A;  1ZRF A;  4A7Z A;  2G9G A;  3WX5 A;  1QOT A;  1OLM E;  4QXK A;  3N9N A;  1W0P A;  3TOJ A;  4QWN A;  5FZ9 A;  3JB4 C;  3PJY A;  5JIA A;  2AYH A;  3KF3 A;  5J09 A;  3POF A;  3WF4 A;  1MEC 2;  3LOB A;  1LOD A;  4CUB A;  4CP2 A;  1AYN 3;  1RMU 3;  4PQ9 A;  3HJR A;  4AED C;  2KD7 A;  4URT A;  1URX A;  5FWE A;  1LTE A;  1WGP A;  5JPM B;  3NJV A;  1G9F A;  4LKD A;  2BPA 2;  1W05 A;  2ADE A;  2XBO 3;  5LBF A;  4XF0 A;  2JEN A;  3SEE A;  3O5S A;  5GZD A;  1UMH A;  1LHW A;  1RVF 1;  1W6M B;  5JZG A;  2WNV A;  3WNK A;  5EFU A;  3T09 A;  2FQP A;  4LHN A;  1NY7 2;  4IEO A;  3ZFF B;  4KMQ A;  3EMR A;  5FZ7 A;  2JJ6 A;  4GA9 A;  3KHC A;  1WCD J;  2SBA A;  4U2A A;  1PGW 1;  2E31 A;  3VBH B;  3MPP G;  2ZAB A;  2DUP A;  3NNF A;  1QXR A;  1QEX A;  4BQY A;  1O8S A;  2ZGM A;  2Y64 A;  5LRS A;  1BQP A;  2R30 A;  2VOK A;  2WZE A;  5B4X A;  3VBU B;  4Q4Y 3;  2OX0 A;  5C9A C;  2AEN A;  4GKY A;  1AJO A;  1VBA 2;  2R07 3;  4M3C F;  3WLU A;  1V9U 1;  2EVX A;  3MV0 1;  1RJ8 A;  4Q4V 1;  3LIG A;  4QU1 A;  5BNO A;  1NT0 A;  4ARY A;  4JGZ C;  4PBP A;  2QQL A;  1CGP A;  1VRB A;  4AI0 A;  4BME A;  2JB4 A;  4YM0 A;  2R0F A;  4B1M A;  3DPR A;  5F5A A;  5E8A A;  4MLO A;  3K3O A;  1XE7 A;  2OA2 A;  2VZV A;  5J1X A;  1W28 A;  2H6B A;  1RUI 2;  1HB2 A;  3LDB A;  1ULO A;  3K75 B;  2AEZ A;  5GJ6 A;  2VOV A;  4AI2 A;  2VMG A;  4AQS A;  2XKP A;  5L19 A;  1S0E A;  3C7O A;  1YHF A;  1I3H A;  3GXU A;  1HV1 A;  5FXZ A;  3R4D B;  4I0A A;  2UY9 A;  3Q9O A;  2VZT A;  2BQP A;  2VVF A;  1CAV A;  2ZGS A;  3MFC A;  4B4R A;  2RS1 3;  4XTM A;  5FY9 A;  5C8C A;  3WDV A;  3VBS C;  5CZK A;  1MQT B;  2W95 A;  3KZ4 C;  1YCI A;  4P5Y A;  3BCW A;  3OG2 A;  3DYP A;  1HV0 A;  5FYZ A;  4YYO A;  1POV 0;  1IG3 A;  3I2D A;  3POS A;  1BEV 3;  1Q43 A;  3WP6 A;  1BCX A;  1SLI A;  5BNN B;  2H0V A;  3OD4 A;  1LOA A;  3H1Y A;  3POJ A;  2MEV 2;  5FJK A;  1QOS A;  1RTV A;  3NJY A;  4R4X A;  2EA7 A;  4XCA A;  1PVC 1;  1PZ7 A;  2PAM A;  2VM9 A;  4NII A;  3ME2 A;  2VUD A;  4UI9 L;  4AW7 A;  1QJZ A;  5D2A A;  3LOI A;  4MUV A;  5KXC A;  1PO1 3;  2RJK A;  2JD4 A;  3UKV A;  1O3T A;  4WM7 C;  5G05 L;  4HXC A;  1HQW A;  3WW1 A;  4AED A;  1AR6 1;  4R9C A;  3VZJ A;  2WAB A;  4Q4W 1;  5LEJ A;  4QM8 A;  1HRI 3;  2Z5W A;  4K8F A;  5JVV A;  2WO2 A;  1YUD A;  3M4F A;  2HWF 1;  2XLF A;  2Y8K A;  1QQP 1;  1OD3 A;  2XWJ B;  2YC4 A;  3PVE A;  4L99 A;  5M0T A;  3OBR A;  1AYM 2;  2OPK A;  4P00 B;  1AR9 3;  1JTZ X;  2BER A;  3WP4 A;  2CU5 A;  1LR5 A;  1QJX 1;  1S0B A;  1TMF 1;  3IAQ A;  4AG4 A;  1UPI A;  2C24 A;  4FP3 A;  1WMF A;  4YAR A;  1LU2 A;  1OBN A;  2QVS B;  3WV6 A;  3AP7 A;  3DEC A;  2GZW A;  2DVA A;  1S0J A;  2CGO A;  1C8M 3;  2DTW A;  3N35 A;  4L92 A;  3PTY A;  3TYJ A;  1OKQ A;  1R09 3;  5FPA A;  5C9A A;  4CDQ B;  2QQW A;  5F9T A;  2XR4 A;  3QOP A;  2FMD A;  1H4H A;  4KBB A;  4Q29 A;  1FI2 A;  3LSD A;  2DVD A;  1MVE A;  4NHK A;  1OH3 A;  2W0X A;  2VTX A;  3MUZ 1;  4XC9 A;  3ES1 A;  4QKD A;  5HPO A;  1DQ5 A;  5IK5 A;  3V0B A;  1G86 A;  1Z7S 1;  4FAG A;  4HMZ A;  3U14 A;  1UIK A;  1HB4 A;  3BI3 A;  5F5Q A;  4A7K A;  4LIV A;  2DBI A;  4FOW A;  1QF3 A;  2R04 2;  1H0B A;  3A0N A;  3MIB A;  4GH4 C;  4NHY A;  3LA3 A;  1P8J A;  1RHI 3;  4QB6 A;  4Y4Y A;  5F3C A;  1XU2 A;  4YM2 A;  5EJ1 B;  3MIE A;  1MS8 A;  4GQ7 A;  2BTV C;  1XNK A;  5T5P A;  1KS4 A;  2O8O A;  5LK5 A;  3JD7 2;  1S0I A;  4JDM A;  4Q4Y 1;  4UFJ A;  5FRA A;  1EP0 A;  1ULG A;  3QD6 A;  4EV0 A;  3LD8 A;  3FX3 A;  3H8O A;  1YI7 A;  2OW4 A;  2XH6 A;  2ZAC A;  3VGI A;  1Y9Q A;  4QXH A;  5FZC A;  4C1W A;  3VBS A;  2J1U A;  2HWC 2;  5ANN A;  2EAL A;  3ASI A;  5F3E A;  5C7G A;  5IJR A;  4CE8 A;  1OOP A;  1F4H A;  3AVR A;  1W9F A;  1XU1 A;  4Y24 A;  5FKB A;  2R49 A;  5L7O B;  3DCQ A;  5B2G B;  2JKB A;  1WLW A;  4A41 A;  1CWP A;  5K0U B;  2VMC A;  1H1M A;  3ACL A;  1Q56 A;  4AFD A;  5FPB A;  1YC6 1;  3H7J A;  1CZV A;  2D93 A;  3RWK X;  1KEX A;  2W91 A;  3O14 A;  1J59 A;  2RS3 2;  4LBL A;  2XUM A;  2ARA A;  2B8M A;  1FAT A;  1GQP A;  4IER A;  1DZT A;  4LKE A;  4UBH A;  2CWM A;  3MDP A;  1KRI A;  1QY4 A;  4WM7 A;  3HVD A;  3LA2 A;  5GZG A;  4JHT A;  1FNZ A;  2TEP A;  1PIV 3;  4IES A;  4OHW A;  5JOX A;  5T3N A;  2WT1 A;  1X50 A;  4WV8 A;  1CZT A;  1FOD 2;  2DF7 A;  1NUK A;  2ETE A;  3ECQ A;  3R0R A;  3H9A A;  1F5J A;  1GZW A;  2OUJ A;  4M0H A;  1AX0 A;  1QJE A;  1SG3 A;  4GZ9 A;  5CIR A;  4BIO A;  5K7P A;  2FZ2 A;  2JDM A;  4ZS3 A;  5J37 A;  1BEV 1;  2E7Q A;  5EYY A;  4YZ3 A;  3SHR A;  3UGG A;  1O3Q A;  3Q8F A;  5FZO A;  1AL0 G;  1W8H A;  3E6B A;  5BY5 A;  3TNP B;  3GZE A;  2WBK A;  4IL7 A;  2I07 B;  4XJU A;  3KV9 A;  4GAZ A;  3S5A A;  2BVV A;  2HYX A;  3VKN A;  4AI8 A;  4TWT A;  4YGE A;  1PO1 1;  4NJ4 A;  4GMP 3;  4CU7 A;  2E6V A;  1IPK A;  3WF3 A;  4NRO A;  2EIG A;  4P9X A;  5I0S A;  3KMH A;  5FZ4 A;  2ORX A;  2WQ8 A;  4K6B A;  3PU8 A;  1HRI 1;  2R7E B;  3MGU A;  5FYB A;  4Q1R A;  4BLI A;  3I7D A;  3ETP A;  2JE7 A;  1PK6 B;  2IVI B;  1KQR A;  2JDU A;  3CZJ A;  4QX5 A;  5DUX A;  1WLC A;  1QJF A;  1X9T A;  2CDO A;  3HAG A;  2LW8 A;  3ZFF C;  1CES A;  5FQ0 A;  4ISQ A;  1AR9 1;  4U36 A;  4QKN A;  1OLR A;  2DCJ A;  5E89 A;  3WNX A;  2ENR A;  1CPN A;  4AVT A;  4C0H A;  3NMB A;  3V0A A;  1N3O A;  4EZ4 A;  4GH4 A;  3T2Q A;  4IE7 A;  2VZ3 A;  2XPJ A;  1SCR A;  2ZGR A;  3O12 A;  3LQC A;  2VD7 A;  3IIA A;  3VBU C;  1R09 1;  5FLI A;  5FYU A;  3VZL A;  4PLN A;  4AVB A;  4CXY A;  4SLI A;  1SBE A;  4CTE A;  3BIW E;  5JXJ A;  2ZMK A;  1RC6 A;  3D82 A;  4AI9 A;  4L0P A;  2VZP A;  3IZO A;  4JTO A;  1VP6 A;  5GAL A;  5A33 A;  1BMV 1;  1UYP A;  2HLE A;  3B9C A;  3O1T A;  5F2W A;  5FYH A;  1PGL 1;  1SZB A;  1DHK B;  2NMO A;  2WNE A;  3C7G A;  2ES3 A;  5AVP A;  3S57 A;  4FFF A;  3U78 A;  1QH7 A;  4YW3 A;  2PQQ A;  3K77 A;  3P1I A;  3IWZ A;  2XUE A;  3TN9 2;  4BXS V;  1C5I A;  4D7T A;  3BOP A;  4MGS A;  3T1L A;  1ULE A;  4QQH A;  4AZZ A;  2VBD A;  3WNO A;  1RHI 1;  2RS5 3;  3RWN A;  1NOV A;  2BWC A;  5J3U A;  4BWO A;  3ITQ A;  1OSG A;  2LRO A;  4Z2W A;  5L73 A;  4ZKT B;  3NKT A;  1UIJ A;  2WZR 2;  4L11 A;  4UAP A;  3ROU A;  2D6L X;  3L2H A;  4LE3 A;  5HCB A;  3MO4 A;  3M3C A;  2B9U A;  1FPN 3;  5H9Q A;  4AGV A;  3EHK A;  3RSJ A;  1H8T B;  2EAA A;  5D1I A;  4ZS2 A;  3RG0 A;  2D7F A;  2MNG A;  2AAC A;  1MQT C;  5JZG B;  3HNM A;  1G7Y A;  1BXH A;  4PIZ A;  4UYB A;  1HXS 2;  3OOX A;  4RGK A;  3WCR A;  4E2S A;  3M70 A;  3LPF A;  2BGO A;  4R8H A;  2Q30 A;  4Q1P A;  5T5O A;  5BNN C;  5ABJ B;  1OLM A;  3K4A A;  1X8M A;  1Y43 B;  4OQ8 A;  5F39 A;  3U37 A;  4LE4 A;  4DXS A;  2X10 A;  2Y6G A;  4JKK A;  1K45 A;  4BE3 A;  5J96 B;  4QXB A;  5A7O A;  2JEC A;  3DV8 A;  1BVV A;  1TME 2;  2VOW A;  3DXT A;  3OJB A;  4HZF A;  4ZXE A;  4BQ2 A;  1VMF A;  3RMX A;  1LJ7 A;  1WMD A;  1ZRD A;  4A3Z A;  5L9R A;  3POW A;  2B4K A;  4CCM A;  4QHO A;  3HOB A;  3WIN E;  1CAU B;  2Z2S B;  1N47 A;  1SFY A;  3OCP A;  4MXV A;  3DL3 A;  1UU5 A;  4IND A;  1VBD 3;  4BDV B;  4YW4 A;  4CYD A;  2ZA9 A;  4UW6 A;  5AC9 2;  1NLR A;  4FTS A;  1W6M A;  4EWD A;  1WD4 A;  1LU1 A;  4AHY A;  3NQH A;  5DAQ A;  2WO1 A;  3DPR B;  3ZFF A;  4OUL A;  4YGC A;  3WP3 A;  1QNY A;  2FBE A;  2WZ8 A;  1PO2 3;  2YDE A;  1LOF A;  4Z8B A;  1N3P A;  2B42 B;  1RVF 2;  1GZC A;  1KJL A;  3LB9 A;  3ABZ A;  2YBP A;  4IV1 A;  3VBH A;  4MO3 M;  1IS5 A;  1N1T A;  1EUU A;  4HKO A;  5JDB A;  2C1F A;  2PA7 A;  3BB6 A;  5FMD A;  1FMD 3;  1RUJ 3;  1BBT 1;  1KFX L;  1VAV A;  1DBN A;  1RUH 3;  3LKJ A;  4Q0V A;  4RS5 B;  1ZNP A;  3S7I A;  1JHN A;  1S0G A;  3C3V A;  1PGW 2;  4OHY A;  4MOA A;  3LEK A;  4CDQ C;  2YPD A;  1RUO A;  4H7L A;  3TWI A;  1ZBE 2;  3KB5 A;  3VV1 A;  1QJU 1;  1GNZ A;  2JDZ A;  3RMY A;  3ZFG B;  1MZ5 A;  3AYC A;  1NCQ A;  4MGQ A;  5JMO A;  3ZDS A;  5I8S A;  3CO2 A;  3VBR B;  1RUN A;  2Q1M A;  3A21 A;  5LK7 B;  4OI0 A;  1H6X A;  2D44 A;  4QPW A;  1V9U 2;  4CP9 A;  3MZH A;  4Y26 A;  2YU1 A;  2VZS A;  3MFA A;  2MEV 1;  3T1M A;  3AX4 A;  4IV3 B;  4LHL A;  4Q27 A;  4Q4V 2;  1YQC A;  3SNM A;  2XXZ A;  3POB A;  1DYP A;  3FL7 A;  3G6J B;  1GNH A;  1O8P A;  2VZU A;  2ZGL A;  3ACG A;  3CL1 A;  3OTF A;  2JG9 A;  4MH0 E;  4NOT A;  5DUU A;  4D7S A;  1HN1 A;  4QDR A;  3DUI A;  5L36 A;  4BQ3 A;  3VD9 A;  1F8V A;  4Y4R A;  1A78 A;  1DGR A;  1C1F A;  1ALY A;  2PLV 3;  2LAL A;  3AP5 A;  3HT1 A;  4FVV A;  4I01 A;  4W4Z A;  5ANQ A;  3RI8 A;  4QAW A;  2SLI A;  4W8J A;  1V6M A;  3U4S A;  3L2Y A;  1UF2 C;  4IDZ A;  4Q0Q A;  2E32 A;  1L7Q A;  2DTY A;  2YPJ A;  4LA2 A;  3C8X A;  1W04 A;  5DN2 A;  4ISR A;  4OHZ A;  2J1R A;  3T2P A;  4CUC A;  5FZE A;  2VUJ A;  3H3Z A;  4BXF A;  4FPE A;  2C6S A;  2YGL A;  4AHX A;  3J7N A;  4I3G A;  3J4U H;  2W3J A;  3MIG A;  2OII A;  4YRD A;  1FNY A;  1MQT A;  5APA A;  1Y3T A;  4GB3 2;  2YFU A;  3W5M A;  1FV2 A;  2UWC A;  3IKW A;  4LKS A;  4B3N A;  3RZK A;  3EYP A;  1WBF A;  2VR4 A;  3OEB A;  3Q8E A;  4O9G A;  3PJQ A;  5L7O C;  3VL8 A;  1RUE 2;  1H2M A;  2WT0 A;  2BNN A;  2FMY A;  2HWE 1;  3ATG A;  5K0U C;  1SLL A;  2P6H A;  1UZZ A;  3KV5 A;  3D8C A;  4V2W A;  4CU8 A;  1QH6 A;  1W9W A;  2RS5 1;  3J8F 3;  3OGS A;  5IVF A;  4HVQ A;  1PVC 2;  2F6B A;  4HN1 A;  4LO6 B;  2WWU A;  1G9D A;  4IGO A;  4Q2F A;  5HCH A;  1GWL A;  4LIT A;  5A7P A;  2Y60 A;  4B7E A;  1DGR N;  1ENS A;  4OI4 A;  2ZGO A;  4QB2 A;  3VUO A;  1D0H A;  2VXJ A;  4DUX A;  4RL7 A;  5A3U A;  2JKX A;  4PI0 A;  4E2G A;  1CJD A;  1LOB A;  4CU9 A;  1R1A 3;  2QNK A;  3V0B B;  2ZGN A;  1UOG A;  1UX6 A;  3PUR A;  3X29 B;  2FD8 A;  1OUX A;  4IEX A;  2A71 A;  4LK7 A;  4OHX A;  1O5L A;  1XB9 A;  1UY1 A;  4WBB A;  3VBO C;  4ARX A;  1PZ9 A;  4AQ2 A;  4DUV A;  3IDA A;  4XUN A;  2V4V A;  1QJX 2;  5EJZ B;  1TMF 2;  5F6K A;  2GMM A;  3GBG A;  4XF9 A;  5KHJ A;  3T08 A;  3U10 A;  2WC2 A;  3RJR A;  2LS6 A;  3THC A;  4NPM A;  2DCT A;  1STM A;  2Q8O A;  4Y3O A;  5C6C A;  3VHO A;  3N36 A;  4DPN A;  3MID A;  2XML A;  3MW3 A;  2ZX0 A;  1SBD A;  2NYY A;  3SLI A;  4CCE A;  1V6J A;  3KT4 A;  1AYN 2;  1RMU 2;  1MZF A;  2Y6L A;  4LBQ D;  4LHK A;  3THD A;  1PK6 C;  1OOP B;  4HG6 B;  2DBN A;  1ONA A;  3WEZ A;  5K4L A;  4WM8 B;  3W9A A;  2ET7 A;  4BQ4 A;  4O65 A;  1PO2 1;  4XIK A;  1VMH A;  3OBT A;  4P9L A;  3J7M A;  4CU6 A;  3ETQ A;  4LOS A;  3ZX7 A;  5FUI A;  3GBF A;  2WQ4 A;  2GSY A;  4QKF A;  1AR8 3;  1RUJ 1;  2UU8 A;  5GM0 A;  4PIX A;  5C4W B;  4OUE A;  4J6G A;  1WCK A;  1OLQ A;  4YGB A;  3A22 A;  1FOD 1;  4FBF A;  3VDD A;  5IHR A;  1CX4 A;  5GLZ A;  1KD7 A;  4JGY A;  4XJZ A;  4JZR A;  1HRV 1;  3VLB B;  1QJY 3;  4IEQ A;  4Q4Y 2;  4CVU A;  3T2T A;  1RIR A;  4UT5 A;  1IKQ A;  3NJX A;  1BK0 A;  1XE0 A;  1DGL A;  3C7F A;  3E5Q A;  3FZ3 A;  2GN7 A;  4N90 A;  3FHI B;  4YZ1 A;  5LA1 A;  4O61 A;  4JQR A;  4QX8 A;  2W2I A;  2VAU A;  3GJA A;  5L7O A;  3INA A;  3DF0 A;  1ZZ8 A;  2RDS A;  5K0U A;  1O91 A;  2UY8 A;  1HX6 A;  1J3P A;  2CTV A;  2DUR A;  3OUH A;  4WVW A;  5DAP A;  3UKN A;  4E27 A;  3O1M A;  1X8E A;  3N7K A;  2HWD 3;  4Q4X 3;  5JOY A;  3RQ0 A;  5KBF A;  5FTT C;  4XYX A;  4HVO A;  3LFM A;  4XMA A;  2ZJC A;  3I3D A;  3JCI A;  5FY8 A;  2HBU A;  1DGW A;  3WQ1 A;  1LED A;  3WXP A;  4MAD A;  1OD5 A;  1XNT A;  2W52 A;  3III A;  1RIT A;  1HIX A;  2WS9 3;  1OMI A;  2OS2 A;  3VDC A;  5FY0 A;  1W03 A;  3PVN A;  4DNY A;  4EN9 B;  1UN1 A;  2HBT A;  4AYU A;  2J1S A;  3LCP A;  5KWR A;  4K9S A;  2BP6 A;  1UW8 A;  3MIF A;  4CUA A;  4AFA A;  1OQ1 A;  3IT8 A;  5H9S A;  4ASM B;  4P5H A;  5JZG C;  5JSP A;  4QQO A;  2BBA A;  2ZS6 B;  3C7E A;  2AUY A;  3S0M A;  1JN2 P;  3RGB A;  4BB3 A;  2XL9 A;  5ABJ C;  3N9L A;  1LAJ A;  2LM3 A;  1T2X A;  2VQ0 A;  4O7X A;  1UL9 A;  3T3Y A;  4NVP A;  5LRR A;  4G3Y C;  1BEV 2;  2HJI A;  3M3E A;  4NWW A;  4GKX A;  2WSV A;  3BPS A;  5FP3 A;  4QX2 A;  3J8F 1;  2QFE A;  4JC1 A;  4A44 A;  3RZG A;  4SBV A;  4XXP A;  2JDH A;  1QU0 A;  2WNU B;  2UYA A;  1PO1 2;  2JG8 A;  4MX3 A;  4EN8 B;  2ZEW A;  5FMO S;  2Z4F A;  4EE2 A;  2I2S A;  5CFC B;  3CKH A;  3RYK A;  2DVB A;  1ZZB A;  4DY3 A;  1FT9 A;  4ZZ8 A;  2A3Y A;  3FHA A;  3AZY A;  4Z1V A;  2Q4S A;  3TN9 1;  1HRI 2;  1W3V A;  3DPR C;  4K8R B;  5DZF A;  4XCB A;  3NO8 A;  3ACH A;  1US3 A;  2F17 A;  3WG1 A;  4A45 A;  2B5H A;  2XQX A;  4B1L A;  5FYC A;  2D3R A;  3K48 A;  4DB5 A;  4C90 A;  1AR9 2;  1DLL A;  1MVQ A;  4BLJ A;  3FFQ A;  3RYR A;  1V0A A;  3H7Y A;  5T50 A;  1OI6 A;  4RS5 C;  2GNT A;  1GP6 A;  2OQ7 A;  4F8A A;  1VBB 3;  3PU3 A;  4D69 A;  3DKW A;  5TSW A;  1KDM A;  3ZO0 B;  3ZYH A;  1C8M 2;  2V4A A;  4K1Z A;  3ZFG C;  3ZMO A;  3E6C C;  1R09 2;  4BIS A;  2HWB 1;  2CAV A;  1BYH A;  2XJP A;  3VBR C;  1W8O A;  2A6Z A;  2DWR A;  2GN3 A;  2Q1Z B;  3CIH A;  3HBK A;  4IQP A;  4KG0 A;  3T0B A;  5C8C C;  2BFU L;  2E53 A;  5DZG A;  1KJR A;  3DKQ A;  2YRO A;  3LAG A;  4XFC A;  4LUM A;  4IV3 C;  3WUD A;  5JOW A;  4AFM A;  1BMV 2;  1J1L A;  1OUR A;  2WO7 A;  4AOC A;  3WZ1 A;  1OQE A;  1PGL 2;  1TME 1;  4S2D A;  1IQD C;  5FYT A;  2WL1 A;  4Z92 B;  1DDL A;  1EAH 3;  1XSQ A;  3DYM A;  4LO7 A;  1FXZ A;  3ZSL A;  5LBE A;  2YY1 A;  4YG3 A;  5F3I A;  1AR8 1;  5CEH A;  2WFF 3;  3KD4 A;  2DCZ A;  1YXW A;  5I91 A;  5JIU A;  1IS4 A;  4YNI A;  4LBM A;  3CDZ B;  2DVF A;  3AMQ A;  1N1Y A;  3IB3 A;  4LOT A;  4WVM B;  3KM5 A;  3ZXE A;  4AGR A;  1RHI 2;  2VH9 A;  2PTM A;  5AC9 1;  2AGS A;  3AYA A;  4X6R B;  5HCF A;  1Q8Q A;  5FO9 B;  5K8S A;  1COV 3;  4FOY A;  5CYY A;  4W50 A;  1MZE A;  4HAN A;  2J42 A;  2VL4 A;  3K4D A;  1H8T A;  1RUD 1;  4CA9 A;  1UKR A;  1JH5 A;  4LNV A;  1PVX A;  1D2Q A;  2L9L A;  4D0Q A;  4OCT A;  5JAX A;  4HON A;  1GOG A;  5FPU A;  4N8M A;  5FZ8 A;  4MGZ E;  1A3K A;  2K9Z A;  2X29 A;  2IVJ A;  4H3W A;  3MLJ A;  4P9I A;  4XET A;  2VC9 A;  5ABJ A;  1G9B A;  4R9B A;  3VD5 A;  1F9K A;  4IV1 B;  1YFY A;  3I54 A;  5LCW L;  3OGV A;  4AAX A;  2GAL A;  2V5D A;  2J1E A;  3KVB A;  1K5M B;  4XBN A;  3ZFE B;  4DY5 A;  1ZBE 1;  1HDK A;  2P3Y A;  5A3P A;  3H1W A;  1XC6 A;  3P3P A;  1J83 A;  4IXL A;  5DPN A;  1U12 A;  4XZU G;  3QH7 A;  3AP6 A;  5A7Q A;  1OXC A;  4HK8 A;  2VPV A;  1JBC A;  1CAU A;  1DU3 D;  1OFS A;  1X7N A;  2W87 A;  3LEG A;  1NCQ B;  2A6Y A;  4IGQ A;  3K3N A;  4XUR A;  4E4S A;  1NCR A;  4XEZ A;  4XFI A;  1PIV 2;  3D4K A;  3E1F 1;  4BM8 A;  4LHS A;  2LUW A;  3HQU A;  2ZX3 A;  4XUT A;  4XMI A;  4UBG A;  4CP9 B;  5DZE A;  3ZYB A;  2D98 A;  1UMI A;  3OY8 A;  4W6Y A;  1PX3 A;  5LY1 A;  3ZXJ A;  3DXU A;  2JG9 B;  1WW4 A;  2IZW A;  2K46 A;  2DU1 A;  1X33 A;  1SCS A;  3NNJ A;  4J1X A;  4K40 A;  2CY6 A;  3DEM A;  2BFU S;  5LWB A;  4Y5S A;  2PMW B;  4KGG A;  4KG8 A;  5JR7 B;  3RZZ A;  4LKF A;  2P17 A;  5LB6 A;  4AQ6 A;  4RS5 A;  2PXJ A;  2DUO A;  4B4Q A;  5E88 A;  5KXE A;  4XF4 A;  4RHV 3;  4XJA A;  4C8D A;  3WHT A;  4HK9 A;  1JOD A;  3ZXF A;  1W2U A;  1BBT 2;  2JDN A;  4S2F A;  4QKB A;  4CP1 A;  1VBC 3;  4XDP A;  4GB3 1;  2WKK A;  3WDT A;  3ZFG A;  3VBR A;  2PAK A;  3VZK A;  3FUQ A;  4HLT A;  5F37 A;  4FO9 A;  3UV9 A;  1I6X A;  1PGS A;  1LHU A;  5A7S A;  5EXO A;  1QJU 2;  1U5I A;  3ORJ A;  4XDQ A;  1RUE 1;  4XUP A;  1QWR A;  3KF5 A;  1OOP C;  4CXW A;  3SCH A;  1T6B X;  2XGX A;  4IV3 A;  2DCY A;  2CAU A;  4WM8 C;  2DFB A;  3PDQ A;  2RDR A;  4NRQ A;  3B69 A;  3FBM A;  2VQA A;  3ZYR A;  2JXA A;  2WZP P;  4MSV A;  1F15 A;  3QBQ A;  5HCA A;  1W8U A;  3WDU A;  1O7F A;  1ZRI A;  3PNA A;  3AKT A;  5FK7 A;  4PF5 A;  3ES4 A;  4Z07 A;  2ARX A;  4C1X A;  3UET A;  4IEV A;  5C4W C;  3OUI A;  1HQL A;  1VB2 A;  4GAL A;  1BK1 A;  1E57 A;  1WCU A;  2ADD A;  3HD8 B;  4DS0 A;  5GZC A;  1ASJ 3;  1WCS A;  2VOX A;  3MIH A;  3U4X A;  5C70 A;  2V72 A;  4IGP A;  4G4F A;  4Y1V A;  5JPN B;  4MHR A;  3B01 A;  4EN6 B;  1R08 1;  1PMH X;  1XNB A;  4QGL A;  4Q0S A;  4X8N A;  1KS5 A;  5A1L A;  2QQK A;  4UF0 B;  2OVU A;  3ZXG A;  4XXA A;  1W2A X;  3APB A;  3MF6 A;  2VJX A;  1I9R A;  1JYW A;  1ZM1 A;  4HSJ A;  3N9Q A;  4YM1 A;  3HWJ A;  4OI2 A;  2FHR A;  2WLQ A;  1UU6 A;  4A6O A;  1SFN A;  2C5D A;  2OPW A;  5C5T A;  1NKG A;  2HWE 2;  2JIC A;  2VTX J;  1LRH A;  3MPB A;  1SLT A;  1YJL A;  4AL9 A;  5FDB A;  2WFF 1;  4CCJ A;  3NNM A;  3J9S A;  1UOF A;  4XJW A;  3ST7 A;  2VCB A;  1GAN A;  2CYF A;  4K7J A;  4AVV A;  2EID A;  5J98 B;  4Y22 B;  4AVA A;  3KVA A;  4IE4 A;  5C3Q A;  1AYN 1;  1RMU 1;  2RS5 2;  2VMD A;  4OZO A;  5L9B A;  2WFP A;  4B7K A;  4XOG A;  3VDA A;  4JDO A;  4CEW B;  1ZBA 3;  2XBO 1;  2XVL A;  3VZM A;  4IE6 A;  4FXK B;  5KHI A;  1NZI A;  3S30 A;  3Q8B A;  4XFG A;  2WO3 A;  1ULP A;  2IXK A;  2YHJ A;  2VO5 A;  5JXG A;  2ZGQ A;  3LSE A;  3PVB B;  3IAP A;  4BQX A;  3POG A;  5ISL A;  2R06 3;  4LO5 B;  3SQO A;  1H2L A;  3HR9 A;  2IXH A;  4XUO A;  3WD5 A;  3ALQ A;  1W0O A;  4KWU A;  2XJU A;  2YB7 A;  1WWY A;  4M3C E;  3TAY A;  4DIQ A;  2P3K A;  5G04 L;  4KI5 M;  1GV9 A;  4XFF A;  3UK9 A;  2A70 A;  1ZVF A;  2VUA A;  4LBN A;  2NQY A;  3W20 A;  5KC6 A;  1TVG A;  4LTA A;  5LZ6 A;  3I3Q A;  4CSW A;  2GP3 A;  4TLG A;  5KC5 A;  3JXS A;  3GZU C;  3VDD B;  2BRT A;  3VN4 A;  2VCC A;  3WF1 A;  4JGY B;  4LBJ A;  2R07 1;  3VHN A;  1O4Z A;  2WNU C;  4QQ2 A;  3ZYG A;  4FSJ A;  1A34 A;  1UMZ A;  2YBS A;  2RVA A;  3BOW A;  3THP A;  1N1S A;  5DXD A;  1NX9 A;  5I0U A;  1F2N A;  2Y26 A;  4NUB A;  5BNP B;  4K20 A;  1VBD 2;  3JU9 A;  4P14 A;  1VMJ A;  4JTN A;  4WM8 A;  2QE3 A;  1IZ3 A;  2VG9 A;  5FUP A;  1JYX A;  1DYO A;  4MXW A;  3ZXL A;  1JUH A;  5CB7 A;  4DMI A;  1YFU A;  3ZM8 A;  1PO2 2;  1YFW A;  3AFK A;  4FTE A;  4RQP B;  1DFQ A;  4X6Q B;  3ZN5 A;  3WDW A;  1UCX A;  4TYS A;  5C4W A;  5A7W A;  4MV2 A;  4N43 A;  2Y33 A;  5FO7 B;  4C91 A;  2P34 A;  4QX7 A;  3KCC A;  2V73 A;  1FYU A;  1RUJ 2;  3SIT A;  1RIN A;  5FPX A;  1VBC 1;  4FPC A;  3UGF A;  3POE A;  1ZRR A;  2RS1 1;  4XJ9 A;  1OT5 A;  1OHF A;  3HPN A;  3CJI B;  4LBQ B;  1XOY A;  1W8F A;  5H9R A;  4AAP A;  5GLV A;  1I1E A;  1VBE 3;  4HL0 A;  5GLW A;  1HRV 2;  2R32 A;  2YFZ A;  3ENR A;  4FI9 A;  1JOP A;  1A6C A;  3BOD A;  3VB9 A;  1UY2 A;  1VBA 3;  1PMJ X;  2CNA A;  3KSC A;  5T52 A;  4NAO A;  1QMJ A;  2UUR A;  4D6S A;  1O3S A;  5HXM A;  2IC1 A;  3HNY M;  4E8D A;  5A3T A;  1C3H A;  3WUC A;  3MYX A;  1GOF A;  1S2K A;  2XDV A;  2ZGP A;  4Q0U A;  2BBV A;  3T30 A;  2VU9 A;  4LMF A;  3VDB A;  3KV6 A;  3A4U A;  4XVH A;  2GH8 A;  1NYW A;  1QXP A;  1UAI A;  4AHZ A;  3BGA A;  2Q1F A;  4LLO A;  2PLV 2;  2QDR A;  2R1D A;  2X5I B;  2EF6 A;  3RS6 A;  3ZSM A;  5B4N A;  1ASJ 1;  1DF0 A;  1ND2 B;  5D8A B;  2I45 A;  4FCA A;  4KWL A;  2JG8 B;  4IE5 A;  1EPW A;  3RYP A;  4Z2A A;  3R4U A;  1VRH 3;  3LEI A;  4FOV A;  4AF9 A;  4LOR A;  4NAM A;  1LOG A;  4MZU A;  1UU4 A;  2UWB A;  3FLP A;  5C5U A;  5K9Y A;  4IEW A;  3ZKU A;  3SEP A;  1JOB A;  1LOF C;  2DCK A;  4NRP A;  4ATF A;  3HT2 A;  4K3U A;  4IV1 C;  3VBH C;  5A6X A;  1PM7 A;  2VVE A;  4CCC A;  5C3P A;  4ET7 A;  3T4V A;  4XF3 A;  4JV4 A;  4JKM A;  1K5M C;  1MS9 A;  1LNS A;  1H1I A;  1YQ6 A;  2D6O X;  1CX1 A;  1C8M 1;  4FPO B;  3I8T A;  3E97 A;  3J7H A;  3RZH A;  1CZS A;  4XBQ A;  2P3I A;  1W6P A;  2G4I A;  4IW3 A;  4JRA A;  2WNU A;  4LUL A;  4MGY E;  2IXJ A;  3J8F 2;  1NCQ C;  5DMY A;  3JBG 3;  3CBN A;  1LEC A;  1NA1 A;  4BJ0 A;  2Y0I A;  5FXW A;  5CFC A;  5IVY A;  4UW5 A;  4XQW A;  4PLO A;  1H6Y A;  2OXB A;  2PHR A;  1UWW A;  1HJF A;  4QD2 A;  1K5J A;  1O59 A;  4J25 A;  4E4D X;  2ZML A;  2R06 1;  1D2S A;  4E8C A;  3GDB A;  3O1R A;  4Z82 A;  2JG9 C;  1ULD A;  4AGG A;  1HLC A;  4YVS B;  4NMI A;  3USU B;  2WA3 A;  3AMP A;  4BK4 A;  4ZU7 A;  1NE4 A;  3I2H A;  3O0V A;  2XJQ A;  3R6S A;  4DQA A;  3N9M A;  3FFZ A;  1OFN A;  2YZ4 A;  2X05 A;  1E5R A;  3GNE A;  3TNQ A;  1AYM 3;  1POV 3;  1R64 A;  2IFW A;  3AP9 A;  1H8V A;  1EV1 3;  2ZKN A;  4XFB A;  1UXX X;  2RM2 3;  3M1H A;  4NID A;  4FT8 A;  5CKQ A;  5FP8 A;  3HQX A;  4WZF A;  3S6P A;  5FV3 A;  3KGZ A;  3WDY A;  4BQ1 A;  1V6L A;  1W6N B;  5CIS A;  4NE9 A;  3B02 A;  3K4Z A;  1B35 B;  2HWB 2;  3FE5 A;  2D5H A;  1S2E A;  3UJO A;  3H3U A;  4P9J A;  3TEY A;  1XJA A;  1NG0 A;  4DZG A;  4QHZ A;  4A6S A;  1KFU L;  2RDN A;  1AR7 3;  1AVB A;  5C3O A;  2P1B A;  2HEW F;  1KXG A;  5FZH A;  2JIJ A;  2WNO A;  3QH6 A;  1IOA A;  1Y9G A;  1GQH A;  1QDC A;  3NNL A;  1RL3 A;  4PIY A;  4YW7 A;  5EWS A;  3WT3 A;  5HBA A;  1RUC 3;  2ILM A;  1CAW B;  4Q5O A;  3UL2 A;  4AVS A;  4DFS A;  1G9C A;  4E9K A;  3AL5 A;  4WVM A;  1JU4 A;  5C71 A;  1PIV 1;  1AR8 2;  3JB8 A;  3BTZ A;  2VBP A;  3I2J A;  2ATF A;  3LDR A;  5F5C A;  5CG9 A;  2R04 3;  2QQV A;  2ZPX A;  3OGG A;  5FZL A;  3B00 A;  1NCR B;  5FWJ A;  1BHG A;  2WT2 A;  1Q3E A;  3DYO A;  2TUN A;  4V1P A;  1H1A A;  1IS3 A;  2R1B A;  3NKG A;  1RUD 2;  3JD7 3;  3OY8 B;  4FTB A;  3B94 A;  2Q0A A;  4GWM A;  3PUI A;  1UYZ A;  2W94 A;  4NN0 A;  2GND A;  4COU A;  2LRP A;  4Y33 A;  3WNP A;  4BOW A;  5IK8 A;  3RVH A;  3KS7 A;  2HEY F;  3MLL A;  1K5M A;  3ZFE A; 
#chains in the Genus database with same CATH homology
 4ZPI A;  4NHX A;  2OPW A;  3GJA A;  5C5T A;  4UWD A;  4NHY A;  2RDS A;  5EP9 A;  3OUH A;  5C5U A;  5DAP A;  5DAW A;  3HQR A;  4XAC A;  3NNM A;  5EQU A;  5L9V A;  5L9B A;  2HBU A;  5DAX A;  2FCV A;  5IAV A;  5ERL A;  5IAT A;  3ITQ A;  2HBT A;  4KBZ A;  2G1M A;  4BQX A;  4IW3 A;  3BVC A;  4J25 A;  3W20 A;  3OUJ A;  3HQU A;  5HV4 A;  2FCU A;  4NMI A;  5A3U A;  2RG4 A;  4NHM A;  3NNJ A;  4Y5S A;  4XCA A;  5L9R A;  5LB6 A;  5IAX A;  2A1X A;  5LBB A;  2Y34 A;  3KT1 A;  5LBC A;  4NHL A;  4XCB A;  3GZE A;  3GJB A;  5EPA A;  5DAQ A;  4ZON A;  2Y33 A;  2RDN A;  5M0T A;  3KT4 A;  2JIJ A;  4BQW A;  2RDR A;  3NNL A;  3MGU A;  3KT7 A;  4Q5O A;  3W21 A;  2V4A A;  5HV0 A;  5LBF A;  4Y5T A;  3OBZ A;  2FCT A;  5DAV A;  3OUI A;  5LAT A;  3DKQ A;  4NAO A;  4XAB A;  2RDQ A;  3EMR A;  5LAS A;  4MHR A;  4NHK A;  4JZR A;  5LA9 A;  4XC9 A;  5LBE A;  3PL0 A;  4XAA A;  3NNF A;  2JIG A;  4BQY A;  4MHU A;  2G19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...