5A3UA

Hif prolyl hydroxylase 2 (phd2/egln1) in complex with 6-(5-oxo-4-(1h- 1,2,3-triazol-1-yl)-2,5-dihydro-1h-pyrazol-1-yl)nicotinic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
236
structure length
215
Chain Sequence
QTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords EGL NINE HOMOLOG 1
publication title Potent and Selective Triazole-Based Inhibitors of the Hypoxia-Inducible Factor Prolyl-Hydroxylases with Activity in the Murine Brain.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 215
sequence length 236
chains with identical sequence B, C
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5a3uA00
3W21A 2RDNA 4JZRA 2RG4A 3MGUA 2Y33A 3DKQA 4NHLA 4Y5SA 4NHMA 5L9RA 4NHYA 5L9BA 4J25A 5LBFA 2HBUA 2OPWA 3PL0A 5LBCA 3ITQA 5LA9A 3GJAA 5C5TA 2FCTA 4ZPIA 5LBBA 5IAXA 3BVCA 3HQUA 4XCBA 5LASA 3OUHA 5DAXA 5EQUA 5DAPA 5A3UA 5IATA 2RDRA 2RDQA 3EMRA 4NHXA 5L9VA 4XCAA 2HBTA 4NMIA 3GZEA 4ZONA 2Y34A 3OUJA 4UWDA 3NNJA 3KT4A 5C5UA 4Y5TA 3W20A 4XABA 4XC9A 4BQWA 5M0TA 4IW3A 4BQXA 2JIJA 4MHUA 2V4AA 3HQRA 4NAOA 5LB6A 2A1XA 3NNLA 3NNMA 2G1MA 5LBEA 5ERLA 2JIGA 2G19A 4Q5OA 4XAAA 5HV4A 5EPAA 2RDSA 5EP9A 5HV0A 4XACA 3OBZA 3OUIA 5DAQA 4MHRA 3GJBA 5DAWA 2FCVA 4BQYA 5IAVA 2FCUA 4KBZA 5LATA 3KT1A 3NNFA 5DAVA 3KT7A 4NHKA
chains in the Genus database with same CATH superfamily
3MV11 3VBFC 5CG9A 3MO4A 5E16A 5HXMA 2VCMA 4DB5A 2JKBA 1S0EA 1RJ7A 1AYM3 2VG9A 2VBDA 1NLSA 3BB6A 4RGGA 4DXZA 1AF9A 5JDBA 1JODA 3V64A 4AE2A 5LA1A 1OH3A 3MYXA 4YVSC 4CCLA 1ZZ9A 5DN2A 4GALA 3ZXKA 5L9BA 3KV6A 3LDBA 4DFSA 2BGCA 3VBUC 4TTGA 1AR93 3WV6A 3N7KA 5GM0A 2TNFA 1W2UA 3VN4A 4CCOA 2H6BA 4IEOA 1W8NA 2QJVA 4QWNA 1RMU3 2OQ7A 3AZZA 4WM8B 4CU6A 1UZVA 1UNBA 1CIYA 1VAKA 2VQUA 4Y4YA 3E6CC 3T08A 2X05A 5C9AA 2L9LA 1UQXA 3WNKA 2Y6JA 2XKPA 4HZFA 5FPVA 1JUHA 4L0PA 1R1A3 2WL1A 2DURA 5LZ6A 3LA2A 4LHLA 3T2QA 1RUI3 3ES1A 2HEVF 1WA6X 4N53B 4X8PA 5EZWA 1DQ4A 4Y33A 2DWRA 3VBHA 3DEMA 2VMCA 4XW3A 2PMWB 2V73A 4IL7A 1HJFA 5JXIA 2P17A 4CEWA 3U14A 2Q8CA 2GNTA 1DQ2A 2J1UA 5DUVA 3ZYPA 4ES8A 1SG3A 5SV5A 2QDRA 2VGDA 2HWF3 2ZGUA 2EIDA 4AVSA 2DCYA 2RJLA 2XGXA 2B5HA 4LNVA 3C7EA 5G05L 1LJ7A 1BXHA 5H9RA 1N3QA 2WZR2 2YXSA 3J8F1 4PQ9A 4QPGC 4FPYA 2W95A 2OX0A 1AR81 5IJRA 3O12A 1DGRN 1PGW2 3B02A 1QJU2 3OGGA 2E7TA 5BUVA 1IPJA 1FV3A 1DLCA 3DPRC 3JXSA 4XPVA 2NP0A 3ZPOA 2JJ6A 4K7JA 2PHWA 4Q0PA 2G9GA 1J3PA 2ETEA 4P5YA 4B7EA 1KXGA 3Q8BA 4YG6A 4NIIA 1FT9A 1WKYA 1X82A 4I0AA 3WNPA 4YFWA 1A8MA 1ZZ8A 2V5DA 3OBTA 3RZGA 4FTSA 1R091 2CNAA 2QTWB 1BYHA 4YW6A 5JSOA 2A5ZA 4QQLA 1WMDA 4E4SA 3N7LA 5CKNA 2IVIB 3I4IA 1YFXA 1RUJ3 3WQ0A 2QQOA 4FFGA 1X50A 1CWPA 4IDZA 2BNOA 2BPA2 1XJAA 5EJ3A 1KFUL 3VDBA 1IS3A 2PQQA 3VZMA 4LBKA 3POBA 1OT5A 5J98B 4EWDA 2J1EA 5KR7A 5GZDA 4XXAA 4IEWA 3MF9A 3UKTA 1C8M2 1SLCA 1O4ZA 2WZPP 3PUSA 1AXKA 4CXYA 3B93A 2BOJA 5CFDC 3UNPA 4PLMA 5LATA 3ZFFA 5ISLA 3O5SA 2W91A 3DKWA 5I0SA 3CIHA 2W47A 1NCQB 4OHVA 5FZ8A 2WFF1 1LCLA 3AYEA 1UYZA 4CPBA 1VBC1 1JOBA 1XNKA 4ZZ5A 1W28A 3H3LA 4GH4C 4UT5A 4Z82A 4ZS2A 4B4PA 3RZJA 4XJZA 3H9AA 4XOGA 2RS31 5FMCA 4GWIA 1YYNA 3TEWA 4FCAA 4OI4A 3DKQA 1HB3A 3ZLIA 4PF1A 1I6XA 1RXFA 5FLIA 2D6NA 1H2KA 5FY9A 3JQWA 3F95A 3LPFA 1X8EA 4HG6B 3BCWA 1K42A 2OPWA 1MQTC 1RITA 1N47A 3IAQA 3LWCA 1VBE1 3O7OA 3SKVA 2JKXA 1M4WA 1QGLA 2R16A 3WVJA 2A3WA 4YGCA 2LUWA 3ACIA 2WLQA 1HB1A 2GC2A 3BVCA 2D93A 5H9QA 2GNBA 3AYAA 2ZA9A 4RS5B 1ND2B 2WWJA 3H3ZA 1I5PA 2WZR3 3FWEA 4IV1A 5KHJA 2AZ5A 3WCRA 2DFCA 5JZGB 2RS32 2OZJA 5JSRA 4QGLA 3T2TA 2ATFA 3O1MA 1QJU3 4MGSA 2J7MA 3R05A 4LLFA 4XUTA 5HXVA 1GOGA 2WQZC 2X8KA 3POIA 1RXGA 4I2OA 4HSLA 3LPGA 1VBE2 2FDFA 3LAGA 2Q1MA 2VMHA 3N36A 1W0OA 3OEAA 1DYOA 2ET7A 1FYUA 4LORA 4R4XA 1BMV1 3GF6A 1KQRA 1SACA 4Y5Z0 5E89A 1U0AA 2DCZA 3CLPA 2C4XA 1BEV2 3V0BA 3HN3A 3J8F3 1Q8VA 4DPNA 4META 1X36A 5FYYA 1PVC2 1YI9A 3I59A 4CEYB 4OZOA 3WF4A 1UIJA 1WCQA 2BERA 1DFQA 1CONA 3QH6A 5FZFA 3ZYIB 5EIYB 2XG3A 1UMHA 2EXJA 2W1WA 3CBNA 2VNGA 3NAPB 4Y22B 5T55A 2YFUA 3AZVA 2VXJA 5FP4A 3QACA 3USUB 5JR2A 3OPWA 1X9TA 1R1ZA 3MICA 3OY8A 5J7MA 3WDVA 2WO7A 5M0TA 2QQKA 1C8M3 1FPN1 1DG6A 5EFUA 4AYUA 4BQXA 4UW3A 5C3QA 2QQLA 4CCNA 2XJPA 1T2XA 4IGPA 1R093 3VDDB 1NKGA 4ZXEA 5JWPA 2XVLA 5F37A 2ET1A 2CYFA 1HRV2 4KNCA 1JU3A 2ZMKA 4QB2A 1RUG2 4CU8A 5LA0A 3WF0A 1ND3A 1PZ7A 4YGDA 1QJY2 1DZRA 4HLTA 1OOPA 1DU3D 3N7JA 2RR11 5FYCA 5A6XA 5FYTA 5A70A 4N43A 5LK5A 3ACGA 4M3CA 5DZGA 5F39A 5A1AA 4BQYA 4JAAA 1ENRA 2F4LA 2ERFA 2CHHA 3LIGA 4QPYA 4UFJA 2KXLA 4AFCA 1WBLA 3B9IA 2WRAA 3LA3A 3PIGA 1IQDC 3WG1A 1XYNA 1WMFA 2DVAA 1AL21 2JE7A 2EVXA 1HJGA 1GWLA 2RS51 4QB1A 1NY71 4XUQA 3B01A 4PJYA 2JD9A 1RUD1 1AYN2 1WCUA 1QXRA 3ZN5A 3CDZB 2RR12 5FDBA 3E5XA 2GH2A 5D2AA 2HKXA 2ZGTA 1KJRA 1MVQA 2RS33 3CJIC 1Y43B 3NO8A 1QXPA 1Q8SA 4OMCA 2XVGA 3RGBA 5AFEA 4BQ1A 1H8VA 1NCRB 5BNNC 2VQTA 4GWJA 4LBOA 4KU7A 3QD6A 5A7SA 2ZHMA 5JAXA 2XB6C 2VUAA 1AL22 3DYPA 3WQBA 2YBPA 1POV3 2HWB1 1VBE3 2RS52 5F5IA 3O1OA 4D7SA 1NY72 1DQ5A 1LHNA 1WLTA 4JKKA 4UYBA 2N7GA 1MEC2 2VOVA 4ATEA 2B42B 1OVPA 4Z1VA 3H3UA 1XC6A 5BPXA 1W6MA 1QH7A 1NXD1 2J42A 4CDXC 3KM5A 2JDPA 1BEV3 4XHBA 4JGYA 4LKDA 3PVBB 2C6SA 5IVBA 2HWE1 4B3NA 1CPMA 4HKLA 4PDWB 4S2HA 1FNYA 2JG9A 4HMZA 1CX4A 3VZOA 5GALA 1DDLA 3H0OA 4XZUG 5C3PA 5L73A 4ET7A 2RM21 4IEYA 1K5MA 2GH8A 5A3UA 4LLOA 4AEDC 4EZ4A 1N1SA 3POGA 2OW4A 2AYHA 3J7MA 3AP9A 1CAXA 1LESA 1VBD1 5I93A 3AZYA 3LOIA 2WNVC 5FZ7A 4YZ4A 2OUJA 4CXXA 1QQP1 1XNAA 3VBOA 1XU2A 2ZAAA 1ZX5A 4K20A 4F3JA 3O0VA 1YHFA 1YCIA 1A34A 3KS7A 1AXZA 1N1VA 3M3IA 3EO6A 1G9AA 1PGL1 3ZFGA 1HRV3 5LRRA 1RUG3 1E5SA 4M4PA 1YNAA 3GZAA 1QJY3 4RHV1 4ZU5A 4K21A 3GHMA 3R4SA 2RM22 4FTBA 1H30A 2KD7A 2DBNA 2FHRA 2HWD2 1TE1B 4P08A 3HPNA 1UL9A 1KITA 1OLME 1W3VA 5FWJA 5FCCA 1J1TA 2YHJA 1QQP2 3AJYA 5C8CC 2JIJA 1MS0A 3FMGA 4RQPB 4BXSV 1H2LA 1UY2A 2A6XA 2WN3A 4AI0A 5B2GB 1EAH1 4LT5A 3HQRA 5APAA 3SKJE 4IEXA 1PGL2 4XJUA 3RMYA 2UWCA 5L7OA 3WF2A 3OGRA 4M3CE 3M3OA 5EHDA 3HWJA 2ZHLA 5KBFA 1ULDA 4RHV2 3WF3A 3P1IA 4IEUA 3V65A 2RR13 1G7YA 4BXFA 4QX2A 2GN3A 4FP3A 4QPIA 4UBGA 1O3RA 3USSA 4DIQA 4Z2WA 3MFCA 1L7RA 4JC1A 2KM2A 5C70A 1YJLA 3VHNA 4KBZA 1VPHA 4NWWA 3VKMA 1OURA 5J09A 4PHZA 3AKSA 3I2DA 1AL23 1EAH2 3K75B 4IXLA 4N43B 1ZREA 2VZTA 2NQYA 2RS53 3WEZA 4A2UA 1FMD1 4Z8BA 4AK3A 3JUUA 4BJ0A 1DYPA 1JS9A 2AENA 1PO21 4JGZB 3W21A 1UOFA 1S2EA 5GZFA 5IVCA 2ZXQA 4FXGB 3TEXA 3S57A 3ZXEA 1LAJA 2WINB 2QDNA 1IGOA 1LHOA 1PIV1 2DU0A 4P9XA 2QQVA 5FYUA 5EJ1B 4CE8A 1M06G 1K3IA 1C1FA 4I09A 3EBRA 3QH7A 4OMDA 3NSTA 1H6YA 4NJ4A 1GR3A 1ULPA 3D6EA 3PL0A 4J1WA 1SLTA 1BZWA 5T5LA 4LBQB 2BRTA 1O8SA 1UXZA 1B35B 1YFYA 3PTRB 4BCUA 3I2OA 1FMD2 3VD3A 1CZTA 4LHNA 2EF6A 3LKJA 4AQSA 2BVVA 2R0FA 4LO4B 1OFSA 4ASKA 4NPLA 2NM1A 2PHFA 1PO22 1XQNA 5DXDA 1JZ7A 2WUHA 3PU8A 1COV1 1SLIA 2HYKA 2LROA 2ZX3A 3FHQA 5FZKA 4PIYA 2HWE3 4QGMA 1WMXA 2AUYA 5CFCC 1LGCA 1WW5A 3RPQA 4TLGA 1OC1A 2O8QA 5FZAA 2JDHA 4B4QA 2F4PA 5BNQA 4QHZA 5FO8B 5K0UB 4DO0A 2RM23 3WQ7A 1SBEA 3H1WA 3BODA 4BZ4A 3FLTA 4HANA 3E97A 4BIOA 5FUNA 4ARXA 3IPVB 1QQP3 3JD72 4X6RB 4XCAA 4ZU4A 2C5DA 4IERA 4LR4A 3WINE 3ZR6A 1W9YA 1PK6B 1FNZA 2CWMA 1HXS1 2XR4A 1COV2 1JYTA 2OYZA 4HL0A 3LOBA 4XF3A 4XIKA 3N3HA 1DGWX 2WO1A 4ES9A 5J3UA 2MEV1 5I8SA 4RHV3 1Q8OA 3OGVA 2RHPA 4AF9A 2ZGQA 4O9GA 1NQJA 4P9IA 1JMUB 2PAEA 5BNOB 3BI3A 2UY8A 3SMHA 2ZMLA 4XABA 4KMQA 4R52A 2P6CA 3M3EA 4CDWB 1H8TC 3Q8EA 5L19A 2D6PA 3B5LB 3VL9A 4GQ7A 3FFQA 2DF7A 4KWKA 2HLEA 1EAH3 2CGOA 1AR71 1HXS2 4K8FA 4HVOA 2EAKA 1OA2A 1OLQA 5BNPA 1RHI2 5KHKA 1JZ3A 2J1AA 3WW4A 1F35A 1CAWB 3VBRB 1PMHX 2MEV2 5C3OA 4AHYA 3E6DA 1SCSA 2VBPA 4RFRB 1ZZ6A 2R1DA 4ATFA 4Y1XA 1JW6A 2ZMNA 1Z7S1 3RYPA 3AZWA 4MHRA 3VD7A 5DQ0A 3S30A 4HT1T 1YJKA 3BPZA 4WM7B 5CKMA 5J36A 3SH3A 3N9LA 2Q1ZB 1BQPA 1ACCA 3C7GA 3DL3A 3U0ZA 1S2KA 4XEZA 2X5IC 3PURA 1T6GC 3MPPG 4W6WA 3RNSA 1LECA 3ME2A 3D0SA 2VOXA 3MF6A 4XYXA 4CPBD 2E53A 4OUEA 3KT7A 4B7KA 1AR72 2DVDA 1MACA 1TVGA 3SITA 2CTVA 4FO9A 4FXKB 4ASLA 3ZSMA 1FMD3 4WZCA 3UJQA 2WBKA 3BOWA 2NYYA 4IV3C 1PO23 2DTYA 2BFUS 4MVTA 3TWIA 3ZVXA 4NE9A 1NX9A 4JVAA 2DVFA 4QXCA 1Z7S2 1VP6A 2TBVA 1GZCA 3WW2A 5F7UA 1OI6A 1EY2A 2RJ2A 2YGLA 4FOYA 4YVWA 3AJZA 4A7YA 2VZVA 2VNRA 1OOPC 1VAMA 5DUUA 1CAVA 1UU6A 1EV12 1XU1A 3UKVA 1VALA 2OT7A 4XDQA 3ZFEA 3ES4A 4AFAA 5E8AA 2ZX0A 3IT8A 5FY5A 2RS11 2WNUB 2YFZA 4YGEA 5JOYA 4MX3A 1W06A 4P9JA 4CP9B 4LHSA 4COWA 5JXJA 2I45A 3T0BA 3DCQA 4A41A 3HQUA 1G9FA 2BFUL 3JBG2 3JD73 4MGTA 4BM8A 4GKYA 4C1XA 3H8RA 2P5BA 4CDQB 2P3KA 2C26A 3VBFB 3HEIA 3WG2A 4A6OA 1COV3 2MPFA 5LASA 5FAXA 1PM4A 3WNXA 4CCMA 4M0NA 3VZLA 3ORJA 2PHUA 2Z69A 4WM8A 1BCXA 4YVSB 2EALA 1O59A 2HH9A 4LIVA 5FV3A 3PVNA 5GZCA 1NE4A 1T6BX 2GN7A 5A6YA 3VBUB 1Y9GA 4ISRA 3M8LA 1E5HA 2RS12 5L36A 1MS8A 5JVVA 1DQ1A 2ADEA 4Z92B 2Q0AA 3JU9A 4TWTA 3OYWB 4PCRA 3NWKA 2X53S 1W9WA 2DCJA 2JG8B 3VKFC 3ZYJB 5A3TA 4N53A 4AZZA 2Y6LA 3KB5A 3GZEA 3LIHA 3I2IA 3FFZA 1BLZA 1REFA 2QQUA 2RMU1 2YV8A 4ZONA 5F2WA 4OULA 4RD7A 3T0AA 5FZIA 4D6SA 1HXS3 2QBXA 1QU0A 2VNVA 4ZS3A 1RHI3 1UIKA 2V09A 4DINB 2MEV3 1GOFA 3AKPA 1LOCA 1LKNA 1UU5A 1UY4A 3NV1A 3WQ1A 4SLIA 3D4KA 3PVOA 1ZVFA 4XC9A 3TOJA 2JG9C 4DXSA 4JDNA 1AHSA 5A7QA 3LEIA 3M3QA 3OBAA 1SPPB 3RYKA 3RG0A 4AGGA 3VLBB 1ULGA 1KS4A 3BYWA 1NZCA 1XNTA 3K4ZA 4F8AA 1J59A 2WA3A 4UBHA 1Y4WA 2QZ3A 4AVVA 1N1YA 1HQNA 2A1XA 1W9FA 2RMU2 3S5QA 4CUBA 2IXHA 1S55A 1Q56A 4R4ZA 2B39A 1AR73 3EQEA 4XBQA 4BDVB 2G19A 3GALA 3I2KA 1GYKA 5FZOB 2O8OA 3S5AA 1RYYA 2PHDA 4C90A 5IUQA 2QQIA 5CZKA 3AMNA 2J1VA 1ZBA1 3GZTB 3W5MA 2A71A 2VZ3A 1W0PA 5KXEA 4YZ2A 3J7HA 1UY3A 5ABJC 3DPRB 5E1RA 4ZY9A 2YUEA 3GJBA 1Z7S3 3WY6A 2E7QA 3OCPA 1U5ZA 1V9U2 4EQVA 5A7WB 2F17A 2NLRA 2BWAA 1U5IA 2XQRA 3KGLA 1EV13 4BMEA 3I3QA 2ZEWA 5A6QA 4FFFA 4DUVA 3MHZA 3J9SA 1XB9A 4XF9A 3K3NA 1V70A 5KXBA 3MEPA 2W1QA 4XQWA 4CYDA 2A75A 1AZDA 1MZEA 5A7PA 3OGSA 1LOEA 1JZ5A 1XRUA 3O14A 4AQ6A 4CU9A 3EXUA 3BOPA 3U10A 1RL3A 2VOTA 4AVBA 2RV9A 2JICA 4UFIA 3WOGA 1IKQA 3PHMA 5FZ1A 2PLV2 4QQPA 1L7QA 4DQAA 4UFMA 1NCQA 3OJBA 1WLCA 3ELNA 3LFMA 2E32A 4AHXA 2FZ1A 4GMP0 1ULOA 4I0BA 3POJA 5CFDB 3KVBA 5LA9A 4AEJA 1OPMA 2RS13 5F32A 2DYCA 3BU7A 1JYCA 3U11A 5C71A 5FR3A 3I3MA 1YLLA 1H2MA 2DVBA 1BK1A 4XZPA 4EN6B 2SBAA 4W65A 2XONA 2QQPA 2WQ8A 5I8TA 4KWJA 5FXXA 1ODMA 3H7JA 4QQOA 4GH4B 4M4RA 5ANQA 1POV0 3A21A 4XFHA 1URXA 1WCKA 3JCIA 3RFRA 2VZUA 3RYRA 4NO4A 3PUIA 4LO5B 4TYSA 2ID4A 3POEA 4XJ8A 4OI0A 1MR5A 3GNEA 1QIQA 1IZ3A 1ALYA 2V4VA 3NJYA 5FZ6A 4RS5A 3V0AB 1ND2A 1IQAA 3Q8FA 1QF3A 1QY4A 4D8MA 1V0AA 3JB8A 1MQTB 5C4WC 3PIJA 1UZ0A 2RJKA 4NHXA 3AVRA 4XUOA 5FP9A 5JZGA 2UWAA 1H9WA 4K1YA 2DUOA 5FXZA 1UOGA 1O5LA 2GC3A 1PO12 1SFNA 2OZ6A 1QH6A 4W50A 2RMU3 2VNOA 3ILNA 4OHYA 4D7TA 1OF3A 2UY9A 3FE5A 3OUJA 5IYYA 1JH5A 3RWNA 3AKTA 4MGQA 5A3MA 4BK5A 5JIUA 3ZYHA 1I1EA 1IS6A 1X9PA 1L3JA 3HNBM 2CAUA 1DP0A 2BNMA 1E5IA 3FN9A 3MW4A 1V9U3 4RGKA 5FFOC 5A80A 3TBDA 2GMMA 2JXAA 4MGIE 4Q4W1 3VHPA 4CEYA 3RVHA 5FOBB 3H1MA 3VDAA 3WDWA 3RZMA 5EXOA 3CZUA 3B94A 4PI2A 5JCTA 1UOJA 5I0TA 3NAPA 1QOSA 1XE0A 5C3RA 4Y22A 2D6MA 5FKBA 3USUA 2P1BA 2ZKNA 4ZZ8A 3K4DA 5T5PA 1RB8G 5FPLA 4H2AA 1POQA 1OMIA 2ENRA 2XXZA 1YI7A 3D82A 4HONA 3POSA 3WP4A 3PMEA 3VDDA 4KWLA 3BUCA 4IGOA 3AX4A 3KQRA 2K0GA 4Y1VA 2PLV3 1JYIA 4Q4X1 1LOFA 2DU1A 2CGNA 2VMGA 3PUQA 5A3LA 1UOBA 1OD3A 4XFGA 5C6CA 3GYDA 2Q8OA 3IN9A 1UYXA 1V00A 1OHFA 1SDDB 3T0DA 3MIGA 4DUXA 1QDOA 3J8F2 1AX2A 4L2NA 3B9CA 3U4SA 4AFBA 4CCDA 4QDRA 3MZHA 5FYMA 1AR82 2Y38A 1Z78A 3L2HA 2NZ9A 4GXLA 1UPSA 3THDA 5LEKA 4JDOA 4MXWB 5FMOS 5FY4A 5FZ0A 3NNGA 3OB8A 4NIDA 3RZZA 4TN7A 3GDBA 2VVDA 2K46A 4IE0A 3U78A 2JDAA 2WT1A 4XUNA 1Z0HA 5L9RA 3LEMA 2BBVA 4DXTA 3FJSA 2PTMA 4PIXA 1RUNA 4ARYA 2VCBA 3RJRA 5GLWA 5AFBA 2F6BA 4A4AA 3DXUA 3SNMA 2WR9A 4E2SA 1R092 4Q0VA 5KWRA 2VQ0A 1W99A 2AEZA 2YPJA 3VL8A 1AJOA 1UMIA 3RI9A 1W04A 5FMOL 4V2WA 5CIRA 1NCRA 1PO13 2NPIA 3U75A 3WD5A 4QB6A 3W9AA 1VAVA 2BU9A 3NKTA 2XOMA 3AK0A 2CGPA 3LA7A 2JDUA 2YBSA 2VTXJ 1OUSA 2QKDA 3CJIB 3MIHA 4FQ4A 1ZZCA 4O65A 2R1BA 4H3WA 5EQUA 2BGOA 1UF2C 2O1QA 3HAGA 3KF3A 1TMF1 1V6JA 3M2MA 4XAEA 2RDRA 3ZSKA 1RC6A 2XJQA 4FPJA 1H4GA 4LQRA 5HCBA 4CXWA 5BNNB 1ZA7A 2R0HA 2WNEA 4FPEA 1D0HA 3AMQA 4NAMA 4CCEA 4PDWA 4YM0A 4JRLA 1BVP1 1WWYA 1YIPA 2CDPA 2WFF2 2YC2A 3A4UA 1RJ8A 1VBC2 1YFWA 4IEPA 4C0BA 1W6OB 2W87A 4IE5A 5EWSA 4MADA 5AVPA 2GC0A 4LBJA 1K12A 4CDXB 3URFA 1TNFA 3J7LA 1F2NA 1WCDJ 3AYDA 4OUSA 5KC6A 2FBEA 1FATA 1STMA 4FOWA 2ILMA 3OD4A 3ON7A 2WA4A 2IFRA 3MV01 4QX5A 4YW1A 3MUZ1 4WBBA 4TSVA 2WAAA 1LULA 1ONAA 1H2NA 4Y5TA 5LWBA 4E8CA 3QCWA 5A3NA 3MUY1 1YO8A 4AEDB 4BQWA 3P3NA 4Q1PA 2P34A 1H1AA 4CCJA 2JDKA 1RUH1 2B4KA 5KHHA 4BQ5A 3WHTA 1XE7A 1OXCA 4HN1A 1A8DA 5FP3A 2Q5TA 2WNVB 4ASMB 2ZX4A 5D8AB 4Q26A 1NOVA 1RVF1 3J4UH 1IG3A 5CAZA 4XF0A 2G1MA 1DGLA 2R071 2JWPA 3AP6A 1FI2A 2DTWA 4XAAA 5FBJA 4QU1A 3K2OA 4K40A 4W4ZA 3SCFA 3NV2A 4URAA 2XLGA 2YYOA 2ZGRA 1AR83 5EPAA 1OLRA 4AHZA 1DZQA 4XACA 2BVBA 5F5CA 4RQPA 4Q29A 5F1RA 5FOJB 4AI2A 2VZOA 3OOXA 3AFKA 4UFKA 1A3KA 1GICA 3JB4C 3S7EA 2ZJCA 3HNYM 1ULCA 2XHKA 4NROA 1RUH2 4M01A 3FHAA 4GWNA 1XNCA 4LUMA 1G6NA 2LS6A 3IKWA 2B7YA 5C8CB 3ASIA 1BMV2 1W2NA 3A23A 2JB8A 3G7DA 2A6YA 2R061 1UZZA 1OLMA 1JI6A 4BWOA 2YDEA 3O1RA 4OI1A 3A22A 4IEQA 4EZHA 2BV4A 1SLBA 4I0WB 4QPWA 5FO9B 1D4M1 1HW5A 2ORXA 5DPNA 3FZ3A 3ST7A 4GJZA 3ZSEA 2P4EA 4LPLA 1VRH1 3VBSC 2Q1FA 4K9SA 1LENA 2EA7A 2EIBA 4CA9A 1RUF1 4K3UA 4LO6B 1JZ2A 4LKSA 2FDHA 2OPKA 2E26A 1FPN2 4GKXA 4JGZA 5FZLA 5F5QA 1DF0A 2WS91 3SHRA 5A6ZA 4KGGA 2GC1A 2GU9A 2Y6GA 1MVEA 1ODNA 1PZ8A 4IEZA 4NOTA 4YW7A 1HQWA 3B69A 3OSDA 5GZGA 5IK8A 4OHXA 3ZX7A 2WFF3 2VTXA 4QXKA 1VBC3 2JE8A 1D4M2 4LE4A 4XFAA 1ZZ7A 1VMFA 3AXDA 3HT2A 4XCBA 1S0CA 4JHZA 1QHDA 4NPMA 5FZMA 3VZKA 3HIFA 5JMCA 1LODA 3MIEA 5FLJA 4LBQA 3TEZA 1JZ8A 1B35A 1C1LA 2W1UA 4KH9A 4XJAA 4CP0A 1MPXA 4Q4Y1 3D5OA 3GBWA 1RUC1 1H6XA 2Y6HA 2O0OA 1CX1A 3ZYBA 1REEA 4CU7A 5IFTA 5CA6A 3KCYA 1FAYA 1YEWA 2VMFA 2UYAA 5GLUA 1CGPA 2VULA 5FYIA 5GKAC 4LMFA 4EWEA 1RUD2 3UKNA 2WSUA 5K0UA 3DN7A 5CYYA 5F3EA 5JUVA 3SCGA 4AFDA 1TME1 2P3YA 3IIAA 4MUVA 4NRQA 2IXLA 2XL9A 2Y6FA 1B09A 2WC2A 3MI8A 1ZRIA 2WFPA 3P6BA 1DIWA 1NA1C 2WZ8A 3L9JT 5IWFA 2EAAA 1BBT1 5CFCB 2VPVA 4RR3C 3IPVA 2B9UA 5JI9A 4HFSA 5ACA1 1WW4A 3WF1A 2Z79A 4X6QB 4D3WA 1G9BA 4Q4Y2 1PK6A 2Q30A 1RUC2 4K8RB 2EIEA 4XMAA 3WP3A 5IK4A 1LOGA 2FD8A 1RUH3 3LZZA 2HWB2 5T54A 1EP0A 3CO2A 2R32A 4YNIA 4URTA 3NJVA 4A45A 2BJSA 1S0DA 1IPKA 1D4VB 1ND2C 4H7MA 5LB6A 5A1LA 2A7AA 5LK7B 2VY0A 5BNOA 1DBNA 4BLJA 2CY6A 2D6KA 2QCSB 1PVXA 2HWE2 3N9QA 4N7IA 3ZOIA 4Q0SA 4L11A 1NAEA 3KV9A 3N7MA 5EP9A 4L8QA 1CN1A 4LOTA 4CDWA 5FTTC 2C9KA 5C9AC 1OA4A 2WNOA 4BLIA 1S0GA 3MLJA 1TZOA 2H6CA 2Q8EA 4AQ2A 1WMEA 1VBD2 3K46A 4XTPA 4GA9A 3RQ0A 5J48A 1CAWA 2YC0A 1FPN3 2X09A 4QD2A 1H8TB 3R0RA 3SLIA 3VBHC 2D5HA 3VBRA 4NR1A 4YM3A 1VBB1 2Z5WA 4CEWC 4AOCA 3INAA 1CZVA 2I07B 4I01A 2VZSA 4WM7A 1CESA 3NAPC 5F6LB 1D4M3 4EE2A 1LB2A 3CZJA 4P00B 4CCCA 3WW1A 2P6HA 1VRH3 4LITA 1HB2A 1W6NB 3H50A 4UF0B 4I30A 2XBO1 3PMSA 5H9PA 1U5XA 4DMIA 2E9QA 3MW2A 3KQ4B 4XJ9A 2VR4A 2DDUA 4YG0A 1UU4A 1DHKB 4NIHA 3ITQA 2X5IB 2XJSA 3I2HA 3U1XA 2FCTA 3Q9OA 5C5TA 4AGVA 3RZKA 1EUUA 3FUOA 4H14A 2ZHKA 2HWC1 2FDJA 3ABZA 4PLNA 1WW6A 4V2VA 5LW9A 4WVMB 4BU2A 4RA0A 2JDZA 4KQ7A 4D6QA 2IXJA 4JTOA 2DCTA 4FAGA 1RUD3 2JX9A 4IV3B 1CR7A 2VBBA 1DYKA 3WG3A 4LKEA 2WNUA 1CVNA 2Y60A 5DAXA 5DUXA 1KRIA 1LTEA 1US2A 4P9WA 2XMLA 3ZXAC 4NVPA 4CP9A 3NW4A 3THCA 3SH5A 2A6VA 4YM1A 5FUIA 3WUCA 5EYYA 1SFPA 4Q4Y3 2VJXA 4CDQA 1YIFA 5CKQA 1RUC3 3VBFA 3OBRA 5A3PA 5L9VA 4EROA 2XVKA 4MO3M 2HWB3 1GV9A 2HBTA 3IDCB 1QJX1 3GZUC 4LA2A 4NIGA 2E33A 4YVSA 4XIOA 3LGRA 3ZFFC 1W8WA 4QDQA 2I2SA 4IE7A 4CDUB 1GQHA 2ZHNA 3VBUA 4H55A 5FRAA 1MZ5A 3U07A 4E4DX 1GP4A 3KT4A 3OYWA 4IUGA 4LXLA 1PIV2 4MV2A 2BEOA 2JG8A 2IXCA 2NMNA 1JXNA 1MS1A 2XQXA 3W20A 3M4FA 4KG8A 4IEVA 1C3HA 5HBAA 3HBZA 4O7XA 1VBD3 1NT0A 1AX0A 1G8WA 1O6UA 1CAUB 1QJX2 3ZPYA 4NAOA 4LK7A 2HYXA 4RSUA 2C9AA 4XXPA 4GAZA 4RN5A 2VL4A 3LE0A 4PDWC 4XVHA 4GD4A 5JXGA 3ZXJA 5JPNB 1HLCA 5GLVA 5AC91 3NQHA 5KHGA 4NRPA 1SPPA 3VD5A 4LHKA 3K4AA 2AREA 1PMIA 1HRI1 5D21A 3WNLA 1V6IA 1PMJX 1UO9A 1W8UA 4IV1C 2FCVA 3N4MA 2JEMA 1W9TA 2IXKA 1SMVA 1NZIA 2OUHA 1VR3A 3CMGA 3FBYA 3MIBA 3NKGA 3O0WA 1WD3A 4XBLA 1P8JA 2E51A 2GDFA 5FYVA 3TN91 3ZYGA 4Q4V1 5A7OA 5IVYA 2WWUA 5CISA 4FFHA 1RUE1 3KVAA 3DPRA 1JHJA 4FPHA 3PLQA 1E57A 4TXWA 5FXVA 4D69A 5K9YA 5LCWL 4FPKA 2IVJA 5AC92 2D98A 3J26N 1VIWB 1DZTA 5A7WA 1A78A 3IIIA 5IVJA 1HRI2 3BN6A 1QOOA 4YZ3A 1IPSA 1YQ5A 5DG2A 1ZRFA 3W5NA 4NWVA 1HKDA 3ENRA 5A1FA 2Y8KA 5ABJB 4BYYA 4QKFA 5F3CA 3LSDA 1DGWA 2NMOA 4HPKB 2YZ4A 1VE0A 2D40A 3IDBB 4UAPA 3WUDA 1EUTA 4ZHNA 1XNBA 3LF7A 5FP7A 5LBCA 3UGHA 1S0JA 3BU0A 1UD1A 4FTEA 4Q4V2 4R9AA 4PLOA 4GZ9A 2NN8A 5DZEA 1Q8PA 1JYVA 1K5JA 1ZBE1 3VD4A 1UW8A 1UYYA 3BPSA 5A33B 1EPWA 5BYNA 4GULA 3GHNA 4XILA 3O1UA 2W68A 3C8XA 3MBWA 1J84A 4SBVA 5CFDA 4OQ8A 4E9KA 4LEJA 3RWKX 3H42B 5F8PA 2WN2A 3HMYA 1ND3C 5DAPA 1JN2P 5K8SA 3VHRA 1PIV3 1ST8A 1YQ2A 1W9SA 2WYFA 3SH4A 4N43C 4GH4A 3ZN4A 5FPXA 2JB4A 3C7OA 2TUNA 3BIEA 3M3CA 1S0BA 5FJKA 2D97A 1XSQA 1GLHA 3TRSB 1GUIA 1FV2A 1QJX3 2WAOA 2V5YA 4P9LA 4U36A 4QX0A 3VD9A 4B29A 4S2GA 3IDEA 5FWEA 4AHWA 1F5FA 2Y34A 3FX3A 4QKNA 3V0AA 5FY7A 3AFGA 4E2QA 4E4HA 3IDAA 3RSJA 1SQ4A 1MQTA 2OS2A 4LO8A 2CSGA 1UZWA 2VZRA 2W3JA 3A0KA 4QKDA 3DXTA 1PZ9A 1AXYA 2WDBA 3N35A 1V6KA 4AWDA 3VDCA 3ACHA 4MGYE 2B45X 5CADA 1YWKA 4Q27A 4YW4A 1KFXL 3I3EA 2VM9A 3AVSA 5HCFA 2VECA 3MFAA 1H9PA 3QBQA 4JKMA 1OQEA 4MHUA 3TYJA 3VZJA 5C4WB 4HBNA 3ZDVA 5IVFA 4OQ9A 4LTAA 4O9EA 1CZSA 3GCWA 1ENQA 1KJLA 4AL9A 4LJHA 3KWVA 2VMEA 3SXWA 1AYM1 2SLIA 3F2ZA 3RMXA 2KR2A 1GZWB 2QVSB 3ILRA 1LHUA 4P02B 5AC93 5T3NA 1O8PA 2CL2A 1W6PB 3OPZA 3DUIA 5K0UC 1UWWA 2XDVA 3O1SA 1WCSA 3OUIA 1HRI3 2PHXA 4MGZE 3VB9A 4JGYC 5KHIA 4AXOA 4FP2A 2J1RA 2BGPA 2FZ2A 1RINA 3HN1A 3UK9A 4HVRA 2ZPXA 3ROUA 4EN7B 1ZRCA 1U5YA 4AVCA 4XFCA 1C28A 3ZKUA 3ZM8A 4A7KA 2ZTNA 2E7AA 4A6SA 1K5MC 2H0BA 3LQCA 1PK6C 1W8OA 4Q4V3 1GFF2 1O4TA 2ZGSA 3UJOA 1D0GA 2IUWA 3THTA 2XJRA 4LIUA 5FREA 5JPMB 1JYWA 3PDQA 4QPGB 1GKBA 1QWRA 1ZNPA 3AB0A 3VBOC 1RUI1 4AI1A 2G9ZA 1GNHA 4L97A 2Q8DA 2YPDA 4AEKA 2FMYA 1OKQA 4UI9L 2VOKA 2YG0A 3BTXA 3WDXA 4QQ2A 1HN0A 1VJ2A 2WO3A 4QX7A 4NHMA 3B3QE 3I8TA 4NHYA 2A3YA 3ZFGC 4K1ZA 2WO2A 3H8XA 4QGNA 4Y1UA 4AG4A 4HKOA 2HWF1 2UURA 4DS0A 4KBBA 4N9IA 1D2SA 3SEPA 2GP5A 1H0BA 2R041 4ZPIA 1CJDA 1XPWA 2D6LX 4MXWA 1UXXX 3WW3A 5LBBA 2UWBA 2IC1A 5FZCA 1OSGA 1XXNA 2ARXA 5A7NA 4P9YA 3JZVA 4RGAA 2YY1A 5F5AA 3HOBA 4D0QA 2WSVA 1C5IA 5LY2A 5IVEA 3D3AA 4WV8A 3RZHA 3A7QA 4JCKA 1ZBA2 4LBQD 3FHIB 4EN8B 4QM9A 5I91A 1OQ1A 3WNNA 1OD5A 2BDRA 2G9FA 5L7OC 3PVEA 2D5FA 5FPUA 3ZYRA 2P2KA 1XOYA 1E5RA 4XF1A 1PGSA 1JUIA 1QJZA 4YZ1A 1HV0A 2PAMA 1NYWA 1GNYA 4QPIC 2BBAA 4DNYA 3X29B 1SDWA 1RUJ1 3CJIA 4L9BA 3WNOA 3ZMOA 2VTFA 4XFFA 1WD4A 4CP1A 4Y20B 4R9DA 4LKFA 4EYUA 1QDCA 1CD3G 3QLQA 3GBGA 2PXJA 2GNMA 5BNNA 2LW8A 4YZ5A 1PHMA 1W6QB 1Q3EA 3MIDA 3Q8CA 1I9RA 5F3GA 4E4ZA 2VC9A 3UL2A 3WG4A 1LNSA 4HK9A 1O91A 2BNNA 2ARAA 4BA6A 4D94A 4OFGA 5BXXA 4KL1A 1SFYA 1IG0A 2A70A 2JDYA 3RJ2X 1Q8QA 4BH9A 1I3HA 4DUWA 1QXJA 1W6OA 5FYBA 4KU8A 4A3ZA 4CDXA 4Z2AA 3S0MA 1YQ8A 2ARBA 2VVFA 2PQSA 2V4AA 2BYVE 1VRBA 4QXBA 5FBZA 2XUMA 1F31A 4CDQC 3I3DA 4Q2FA 4Q8LA 1SZBA 2MNGA 3C2UA 1W03A 4FPFA 4AEDA 5J37A 5JR7B 2YBKA 3E6BA 1GQPA 1PNFA 4Q1RA 4YGBA 3T4VA 3OG2A 1J3QA 2WNVA 2ZEXA 3NV3A 3WT3A 5D8AA 3QOPA 1WUVA 1IKPA 4L92A 5FO7B 5IAVA 1XSRA 4KI5M 4HSJA 3E5UA 2PYTA 1NLRA 2ZX1A 3AP7A 4YLZA 1G9CA 5B4NA 3T30A 3KV5A 3OPTA 2JG8C 3KF5A 4XF4A 1K45A 5IK7A 3L2YA 4LBNA 5DAVA 1GQGA 2VQAA 2HEYF 2E63A 3AKRA 3T09A 5H9SA 3WHUA 2WZR1 5DABA 4NHKA 4QDSA 5T5OA 5FZDA 2W08A 3FLRA 2QZ2A 2ZX2A 3UV9A 4B4RA 3MIFA 4EN0A 2X10A 1O3TA 1PGW1 2X29A 1QJU1 3NRUA 1N3OA 4C8DA 5A32A 3AMHA 2GAUA 2Y33A 1NLQA 1ZBA3 3ZXDA 5C8CA 4NHLA 3ETPA 3LEGA 4P14A 4F7ZA 3IMNA 1REDA 4OYUA 3RRDA 3CU7A 5FMDA 2BTVC 3SCHA 2B46X 4Q4W2 5CEHA 3LEKA 3Q8AA 3SEEA 5FQ0B 4N9HA 3ZDSA 1Y9MA 2DBIA 2R043 1O5UA 1NUKA 5GJ6A 1ZRRA 2AGSA 4GB31 2R7EB 2WIIB 4QX8A 3R4UA 5IK5A 4D7YA 1XBFA 4YRDA 3DECA 2D6OX 1UKGA 1UAIA 1W8FA 1QNYA 4COZA 3OUHA 2Q4SA 3U37A 5JXHA 1VB2A 3ECQA 4DXRA 3CF6E 2YU2A 3DGTA 2ZZQA 4ZXKA 3VBSB 5TSWA 2Z4FA 3HQXA 4FFIA 3KCXA 4B1LA 3S7IA 4DY3A 5BNPC 3POYA 4YPJA 1V6MA 4M3CF 1C8M1 2BQPA 2ZOEB 2EXHA 2W92A 1OF4A 4NRMA 4Q4X2 4JKLA 1HIXA 1W2AX 2VCCA 1IOAA 2J22A 2PAKA 2YC4A 3UESA 4Q8KA 4NN0A 3WX5A 4GB32 4OUMA 5JOZA 2WZEA 1SBFA 3BTYA 1S1AA 1WW7A 1O4YA 1UY0A 3UYJA 1SCRA 3AMMA 2QFEA 2WJSA 4BIFA 2PA7A 2ZGKA 4YARA 2W9XA 4EWAA 4ORFA 4MOAA 1ZYBA 1JTZX 1ZM1A 1W8HA 1W3XA 3WDYA 3FL7A 2G4IA 2C0ZA 1F4AA 2AC1A 4HK8A 3T2PA 1WZXA 3ZN6B 3N9OA 4V1PA 1FXZA 4CUAA 4PI0A 3N9PA 2BUKA 2BZDA 1J58A 2EXKA 4OHWA 5GZEA 2VOWA 4PIZA 1KEXA 4YVWC 3DV8A 2Y26A 3EJKA 5T5JA 5CFCA 4XFIA 5JMOA 5AVAA 2GP3A 3ZFEC 3WP5A 4PBPA 5LBEA 1YQ6A 4GMP1 3WCSA 5IW0A 5CB7A 2DCKA 2ADDA 2RDSA 2XWBB 3HR9A 4LULA 3I7DA 5GLTA 1O3SA 3EYPA 1NA1B 3K77A 3LD8A 5FZ9A 4BHPA 1CPNA 4RR3B 5LRSA 3RZLA 4GWMA 1MS9A 3AP4A 2VUDA 4CUGA 1TMF2 3RI8A 3TAYA 2IFWA 1POV1 1XYOA 4E2GA 2I74A 2OKXA 3KT1A 4Q0QA 4COYA 1ZZBA 4AGRA 2JDMA 3VKNA 3T1MA 1RIRA 1S0FA 4WM8C 2ZEZA 4Q4W3 4XETA 4B1MA 4FPGA 3IB3A 2UU8A 3R6SA 4MGKE 1BEV1 4BQ2A 4CVUA 5JLVA 5FZ4A 3U4XA 2RVAA 3LDRA 1PVC1 4XBNA 4AI8A 3CJXA 4A42A 1ZRDA 2WYSA 1YQCA 3HVDA 4N53C 2CAVA 3KMHA 4LBLA 3VUOA 4MSVA 1H8TA 5C9AB 1C5HA 1MZ6A 2Y6KA 2QE3A 2ZS6B 3ZSLA 5DZFA 3W59A 1EYBA 5CVRA 3PJYA 1OQDA 4Q4X3 4PF5A 4CCKA 1WLWA 4KGQA 5A32B 3BALA 2Y0OA 4OZXA 3VBHB 4IETA 4AW7A 1LU1A 3J7NA 1GWKA 1IHMA 3WLUA 5BV6A 5JSPA 1RVF2 4GB33 4N90A 1J83A 4CEWB 1W6NA 2R072 4MYEA 4UF0A 1HRV1 2PHLA 1RUG1 2VH9A 2XKOA 4TLFA 5FZGA 1GP6A 1LHVA 1QJY1 4HOOA 4WVZA 2IZWA 4CZSA 2ZGNA 4FVVA 1HQLA 1D7PM 4NUBA 1LGNA 2GNDA 2X5IA 3AKQA 1RGSA 1VLNA 4A7ZA 1OBNA 2VO5A 1OFNA 4C1WA 2ES3A 1F5JA 5DMYA 1C8NA 4YW3A 4JHTA 2A6ZA 1LEDA 4WVMA 1KS5A 2VZ1A 2RDQA 3CQOA 3C7FA 3HD8B 4H7LA 4ONUA 4XURA 4EN9B 5C33A 2YGMA 4NPRA 4MG2A 3KLSA 4C0HA 3HT1A 4IV3A 2W46A 3ALQA 5JOXA 1XYPA 5CNAA 3CHXA 2R062 4DOUA 2OIIA 1JYNA 3APBA 4DRRA 5T52A 1AYN1 1UKRA 3KZ4C 4UW5A 1HX6A 5DUWA 1WBFA 5CU1A 4L99A 1S2BA 4KG0A 5BY5A 3CNAA 2LRPA 4I3PA 1VRH2 4XJWA 5DG1A 3H8UA 1QMJA 4M00A 4COUA 2MHFA 3LCPA 3VKLA 1RUF2 2TEPA 1S0IA 4AVAA 4E8DA 2XWJB 4UW6A 3ZXGA 1FOD1 1PM7A 1TMF3 3ZIXA 2CU5A 4TZDA 3I54A 2HEWF 4CDUA 5I0RA 2WS92 2YB7A 4P5HA 3BIWE 4JQRA 5F2SA 1NCQC 1Q5OA 2EXIA 4FPLA 1MEC1 1UCXA 2WT0A 4XUPA 1RUOA 1QOTA 4HN0A 2ZBJA 3AL5A 4GMP3 3ZFFB 3R4DB 4IE6A 3MPBA 2BP6A 4IGQA 2ZGLA 1CQ9A 3GCXA 1G9DA 5HV0A 1LU2A 3HNMA 2J1TA 4EV0A 5C8WA 4OLLA 3M1HA 1CAUA 2XHNA 5ANNA 1O3QA 3ZR5A 2PELA 3LFIA 4UW4A 2YU1A 1W90A 4HETA 1FOD2 4IQPA 4HXCA 3ZXFA 2FCUA 2VZPA 4F83A 2EICA 3ACLA 5B4XA 2D7FA 1YUDA 2QQNA 1V6NA 2DVGA 3PUAA 4RS5C 1TQ5A 3NJZA 1JU4A 3TNQA 1MZFA 2ZKLA 1RVF3 3IBMA 2BW8A 1W05A 1TME2 3IM0A 2R073 1ZA4A 5JZGC 1PVC3 4JZRA 2BOIA 4COVA 1F9KA 4BE3A 2RG4A 4XE9A 2K9ZA 2Z2SB 4Q0UA 4R8HA 4FAHA 1BBT2 3V56A 2R30A 4YW5A 3W58A 1OUXA 3GM8A 1UZYA 4Y5SA 4B8EA 1AX1A 1N3PA 2O14A 3FUQA 5ACA2 2HWD1 3OTFA 4IV1B 5LBFA 3KHCA 4G9SB 3O1VA 2CWSA 5HCAA 3GJAA 4W6XA 1OA3A 5D8AC 5FK7A 1D2QA 4LOSA 4XQ4A 1H4HA 4JQTA 4MXVA 3FBMA 1PX3A 5FUPA 4I3GA 5LA2A 5K4LA 4AFMA 3O1TA 4BB3A 4QAWA 2R063 5FLHA 5ABJA 3FC0A 3C3VA 3M70A 5J1XA 4QT6A 2C24A 3AL6A 2JD4A 4CEYC 4HPKA 1UN1A 3A0NA 1LOBA 1G86A 1W8ZA 4AAPA 5G04L 3KD4A 1JYXA 3I2FA 2PFWA 1W0NA 1GU3A 1DGRA 2VW1A 3DYOA 3V0BB 4M0HA 1V6LA 2VU9A 1DLLA 1N1TA 5SV8A 5IATA 5HCHA 3I59B 1OKOA 1Y3TA 1RUF3 4W6YA 1ULEA 5A33A 1A6CA 4WVVA 5J96B 3EMRA 3S6PA 1F8VA 5JOWA 3PTYA 4JRAA 5DDJ1 4RFT0 3VDDC 3AXEA 3EB7A 4UFHA 3POFA 5FPAA 4D6RA 1VBB2 2WS93 2W94A 1SLLA 4AI9A 1AUYA 2PN5A 2A73B 1LOFC 2VW0A 3OY8B 4QMAA 4JTNA 5E6HA 1AYN3 1BK0A 4OVEA 4A3XA 3POWA 5FY0A 1H1MA 4UWDA 2FQPA 1AJKA 2XJUA 3AMPA 3ATGA 3NNJA 4ITCA 2W39A 3O1PA 5CG8A 4O61A 2ORZA 3I49A 3ETQA 2R49A 2XBO2 3IAPA 1ND3B 5I0DA 1OOPB 2E6VA 4LE3A 3FLPA 5EYXA 1RTVA 2D44A 1LRHA 3T2OA 1FOD3 5DDJ2 1DQ0A 1ASJ1 3HBKA 2V72A 1OVSA 4N7UA 2ZAHA 4M3CB 4Y24A 3THPA 4MH0E 2HWC2 4YW2A 3B7MA 3VKOA 3T3YA 1MEC3 1V6OA 2LM3A 3NNLA 2KA3A 3NNMA 4FPOB 3RS6A 4AQTA 5F6KA 3WR0A 1JBCA 3KHBA 1UX6A 2JIGA 4Q5OA 3WNMA 1GWMA 1S4CA 2FDKA 1QEXA 1I5ZA 1SHWB 2ZEYA 2HJIA 2ZGOA 2IWGB 1TME3 1NXMA 3WDTA 5FIXA 5EJZB 1XE8A 3OBZA 4Y1YA 5C4WA 3ZIWA 3ZKYA 4EJRA 3PNAA 1BBT3 3PU3A 1NCRC 2W52A 4XMIA 5FXWA 4YYOA 3T4HB 2W5FA 5ACA3 4XQDA 5I8YA 1WLDA 2YMZA 3O0XA 2XPJA 4WVWA 4UFLA 3BGAA 1ASJ2 1JHNA 3JQXA 2ZABA 2ZGPA 1U12A 3B00A 1J1LA 3WP6A 1GZWA 2JDNA 5FKCA 4DEQA 1YRZA 1UX7A 4HKWA 4U2AA 3JD71 1ULFA 1BKZA 1W6PA 3G6JB 4JV4A 4DEVA 5C7GA 5IT6A 3ZO0B 1H1IA 1IS5A 2OVUA 4CSWA 1ENSA 4S2FA 4FOQA 1GP5A 5KXCA 1UPIA 2QQJA 2RDNA 4J1XA 4G4FA 2VMDA 3M7AA 4YWAA 1KDKA 3NL1A 5E88A 3NMBA 1W6MB 2QNKA 4BK4A 1QKQA 4J6GA 4Y3OA 5F9TA 1BJQA 3BTAA 4JGYB 2HWD3 3N9MA 4RYDA 4J25A 1VBA1 4P9GA 1X8MA 2H0VA 4BQ4A 4YSFA 2HBUA 3LB9A 4JX0A 2JG9B 2W2IA 4QPGA 2XL7A 1ENXA 3KSCA 1BHGA 1R081 4UOJA 1YC61 5FYHA 2XJTA 2VZQA 3ILFA 1K5MB 5IAXA 3ZYFA 1HDKA 5HPOA 3CL1A 2AACA 1VBB3 4ZKTB 1OH4A 4QXHA 1CAXB 3P5BA 3SC7X 3SISA 4CUCA 1RHI1 2JENA 3KGZA 3VBOB 2WLPA 4IE4A 4PQQA 4FBFA 4PBOA 5FZOA 2VUCA 2XLFA 2ZCWA 1DQ6A 1LHWA 2OQ6A 4LK6A 4DY5A 1GANA 4QQHA 3UGGA 1Y7BA 3UT0A 2WQ4A 1VBA2 2J1SA 4XDPA 4Y4RA 3ZFGB 1UMZA 3BKZA 2XBO3 2GMEA 1R082 3ZXLA 4RQPC 3TN92 3OEBA 4ISQA 5IVVA 3H8OA 5DDJ3 1W39A 4LBMA 1W8TA 3E5QA 3GXUA 2P3JA 3LSEA 1RUE2 4WZFA 1GZTA 4XHXA 5D1IA 3TNPB 4CTEA 1MS4A 3MDPA 2HWC3 1W2TA 1AL0G 2K2SA 3ZMNA 2AR6A 1VB4A 3K48A 3EHKA 1GBGA 2GSYA 4FSJA 4BMBA 1BVVA 5GLZA 1MS3A 1JOPA 1UYPA 3NVCA 2DUQA 5I0UA 2DV9A 4ZU7A 2VUJA 5L7OB 5C5UA 5FP8A 2P3IA 5K7PA 1EV11 4DRVA 4N8MA 3P3PA 4Y20A 1HB4A 2VW2A 1PX4A 5CBLA 3TEYA 2LALA 5FK8A 2QQWA 1F4HA 1ASJ3 1W6QA 2GMPA 1TG7A 4QM8A 2D3SA 1R64A 3IWZA 4QPIB 1AR61 1ZBE2 3OD0A 3JBG1 5FZBA 4AVTA 2IXIA 1JZ4A 4JGZC 4LA3A 1F15A 1YXWA 2ZGMA 4FQZA 4W8JA 2QQMA 4R9CA 3K51A 3TB0A 1LR5A 1MS5A 4Y1ZA 4FI9A 1KD7A 3ZSJA 4QX1A 1SEFA 3PUHA 5IHRA 5A3OA 3OF1A 4GJYA 5FZEA 1US3A 1XNDA 4DZGA 2WT2A 2YROA 2VD7A 5FMBA 3KCCA 2OA2A 4QU2A 3H1YA 2D43A 2VMIA 3WZ1A 1B35C 4OHZA 4LUKA 5FZHA 5FYZA 5LEJA 1AR62 5T50A 1GZ9A 2VXRA 1Y9QA 5FPZA 5FY1A 3WXPA 3H7YA 3ACFA 4CDUC 2RE9A 1CIWA 3GBFA 1PNGA 5EV7A 2GALA 3I97A 3I3BA 3IZOA 2P37A 1QJEA 1JZ6A 3MLLA 1NE6A 3MGUA 2XJVA 1AVBA 3VZNA 4BISA 2FDGA 2WABA 4MZUA 2LTNA 4AI3A 3SQOA 4C91A 3BTZA 1AR91 1CJPA 5C3SA 4I02A 1TNRA 1VBA3 2Y0IA 2PHRA 1VMJA 4G3YC 4QHBA 1APNA 2ZACA 1UY1A 3DF0A 1RMU1 2W1SA 4OI2A 4R9BA 1R083 3D0JA 3C7HA 3TN93 2UYBA 3NJXA 4MLOA 3DYMA 4INDA 4BQ3A 2EIGA 2DUPA 4BPZA 2ARCA 5FJHA 1RUE3 1AYM2 2JE9A 1W2OA 1GMMA 3UETA 1R1A1 4CP2A 1YFUA 2R6QA 3CEWA 2B9VA 1VMHA 3HJRA 2JECA 4YFZA 4K6BA 4OCTA 5FQ0A 5BNOC 4A44A 2D3RA 2W0XA 1AR92 1LEMA 4LO7A 2VVEA 1Q43A 1V9U1 3LDKA 4IESA 4JDMA 1HV1A 2CV6A 3GGLA 5IFPA 4HVQA 4CDWC 1RMU2 4QX3A 4NIAA 3D8CA 4Y26A 2AEYA 2B8MA 5FY8A 4QHOA 2DFBA 4AAXA 1TEIA 4E27A 4AEMA 2C1FA 4YG3A 4BOWA 4NMIA 1FX5A 1SBDA 3VBSA 4FT8A 2VCAA 3UGFA 1R1A2 1SLAA 1ZBE3 5FPBA 1KGYA 5KXDA 4QKBA 2Y64A 1OPOA 2PHTA 3VBRC 1RUI2 3PJQA 4FPCA 2E31A 2GZWA 1IS4A 2A3XA 2XUEA 2FDIA 1NQDA 1C57A 3KV4A 3NV4A 1J3RA 1GNZA 5LY1A 3WDUA 2D3PA 2PLV1 4WM7C 1X7NA 2XLAA 4FOVA 3AC0A 3RDIA 5BNPB 4PT6A 2HWF2 3N9NA 4IW3A 4UXAA 4RL7A 4YM2A 5HI0A 3E1F1 1KDMA 5FYSA 1WA4A 2R042 3MW3A 1JOJA 2A6WA 3I2GA 4Z07A 2VAUA 5F3IA 1X33A 2CDOA 3VV1A 1AR63 2OXBA 1GOHA 5ERLA 3JBG3 3T1LA 1C4RA 1L7LA 3ZN6A 4XFBA 5HV4A 3AYCA 4CRQA 3CKHA 2ZZJA 3I2JA 4AR2A 5FZ3A 5DAQA 3AP5A 4GIQA 3IMMA 2QUOA 3K3OA 2WWSA 3OGJA 1QJFA 5DAWA 5JIAA 4S2DA 2AH2A 3AZXA 1QNWA 1HN1A 3VGIA 1LOAA 5A3WA 5JI7A 2WNUC 2WKKA 5KC5A 4X8NA 1NG0A 2VE1A 1DCSA 1GSLA 4XTMA 3NNFA 1LGBA 4YVWB 3VHOA 3WSOA 2BWCA 3AM2A 2FMDA 2Z42A 4KWUA 1NA1A 1RUJ2 1O7FA 1CAVB 1WGPA 3MLKA 4XDOA 4RR3A 1PO11 1EPZA 3ZFEB 2XH6A
chains in the Genus database with same CATH topology
3W21A 2RDNA 4JZRA 2RG4A 3MGUA 2Y33A 3DKQA 4NHLA 4Y5SA 4NHMA 5L9RA 4NHYA 5L9BA 4J25A 5LBFA 2HBUA 2OPWA 3PL0A 5LBCA 3ITQA 5LA9A 3GJAA 5C5TA 2FCTA 4ZPIA 5LBBA 5IAXA 3BVCA 3HQUA 4XCBA 5LASA 3OUHA 5DAXA 5EQUA 5DAPA 5A3UA 5IATA 2RDRA 2RDQA 3EMRA 4NHXA 5L9VA 4XCAA 2HBTA 4NMIA 3GZEA 4ZONA 2Y34A 3OUJA 4UWDA 3NNJA 3KT4A 5C5UA 4Y5TA 3W20A 4XABA 4XC9A 4BQWA 5M0TA 4IW3A 4BQXA 2JIJA 4MHUA 2V4AA 3HQRA 4NAOA 5LB6A 2A1XA 3NNLA 3NNMA 2G1MA 5LBEA 5ERLA 2JIGA 2G19A 4Q5OA 4XAAA 5HV4A 5EPAA 2RDSA 5EP9A 5HV0A 4XACA 3OBZA 3OUIA 5DAQA 4MHRA 3GJBA 5DAWA 2FCVA 4BQYA 5IAVA 2FCUA 4KBZA 5LATA 3KT1A 3NNFA 5DAVA 3KT7A 4NHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W21 A;  2RDN A;  4JZR A;  2RG4 A;  3MGU A;  2Y33 A;  3DKQ A;  4NHL A;  4Y5S A;  4NHM A;  5L9R A;  4NHY A;  5L9B A;  4J25 A;  5LBF A;  2HBU A;  2OPW A;  3PL0 A;  5LBC A;  3ITQ A;  5LA9 A;  3GJA A;  5C5T A;  2FCT A;  4ZPI A;  5LBB A;  5IAX A;  3BVC A;  3HQU A;  4XCB A;  5LAS A;  3OUH A;  5DAX A;  5EQU A;  5DAP A;  5A3U A;  5IAT A;  2RDR A;  2RDQ A;  3EMR A;  4NHX A;  5L9V A;  4XCA A;  2HBT A;  4NMI A;  3GZE A;  4ZON A;  2Y34 A;  3OUJ A;  4UWD A;  3NNJ A;  3KT4 A;  5C5U A;  4Y5T A;  3W20 A;  4XAB A;  4XC9 A;  4BQW A;  5M0T A;  4IW3 A;  4BQX A;  2JIJ A;  4MHU A;  2V4A A;  3HQR A;  4NAO A;  5LB6 A;  2A1X A;  3NNL A;  3NNM A;  2G1M A;  5LBE A;  5ERL A;  2JIG A;  2G19 A;  4Q5O A;  4XAA A;  5HV4 A;  5EPA A;  2RDS A;  5EP9 A;  5HV0 A;  4XAC A;  3OBZ A;  3OUI A;  5DAQ A;  4MHR A;  3GJB A;  5DAW A;  2FCV A;  4BQY A;  5IAV A;  2FCU A;  4KBZ A;  5LAT A;  3KT1 A;  3NNF A;  5DAV A;  3KT7 A;  4NHK A; 
#chains in the Genus database with same CATH topology
 3MV1 1;  3VBF C;  5CG9 A;  3MO4 A;  5E16 A;  5HXM A;  2VCM A;  4DB5 A;  2JKB A;  1S0E A;  1RJ7 A;  1AYM 3;  2VG9 A;  2VBD A;  1NLS A;  3BB6 A;  4RGG A;  4DXZ A;  1AF9 A;  5JDB A;  1JOD A;  3V64 A;  4AE2 A;  5LA1 A;  1OH3 A;  3MYX A;  4YVS C;  4CCL A;  1ZZ9 A;  5DN2 A;  4GAL A;  3ZXK A;  5L9B A;  3KV6 A;  3LDB A;  4DFS A;  2BGC A;  3VBU C;  4TTG A;  1AR9 3;  3WV6 A;  3N7K A;  5GM0 A;  2TNF A;  1W2U A;  3VN4 A;  4CCO A;  2H6B A;  4IEO A;  1W8N A;  2QJV A;  4QWN A;  1RMU 3;  2OQ7 A;  3AZZ A;  4WM8 B;  4CU6 A;  1UZV A;  1UNB A;  1CIY A;  1VAK A;  2VQU A;  4Y4Y A;  3E6C C;  3T08 A;  2X05 A;  5C9A A;  2L9L A;  1UQX A;  3WNK A;  2Y6J A;  2XKP A;  4HZF A;  5FPV A;  1JUH A;  4L0P A;  1R1A 3;  2WL1 A;  2DUR A;  5LZ6 A;  3LA2 A;  4LHL A;  3T2Q A;  1RUI 3;  3ES1 A;  2HEV F;  1WA6 X;  4N53 B;  4X8P A;  5EZW A;  1DQ4 A;  4Y33 A;  2DWR A;  3VBH A;  3DEM A;  2VMC A;  4XW3 A;  2PMW B;  2V73 A;  4IL7 A;  1HJF A;  5JXI A;  2P17 A;  4CEW A;  3U14 A;  2Q8C A;  2GNT A;  1DQ2 A;  2J1U A;  5DUV A;  3ZYP A;  4ES8 A;  1SG3 A;  5SV5 A;  2QDR A;  2VGD A;  2HWF 3;  2ZGU A;  2EID A;  4AVS A;  2DCY A;  2RJL A;  2XGX A;  2B5H A;  4LNV A;  3C7E A;  5G05 L;  1LJ7 A;  1BXH A;  5H9R A;  1N3Q A;  2WZR 2;  2YXS A;  3J8F 1;  4PQ9 A;  4QPG C;  4FPY A;  2W95 A;  2OX0 A;  1AR8 1;  5IJR A;  3O12 A;  1DGR N;  1PGW 2;  3B02 A;  1QJU 2;  3OGG A;  2E7T A;  5BUV A;  1IPJ A;  1FV3 A;  1DLC A;  3DPR C;  3JXS A;  4XPV A;  2NP0 A;  3ZPO A;  2JJ6 A;  4K7J A;  2PHW A;  4Q0P A;  2G9G A;  1J3P A;  2ETE A;  4P5Y A;  4B7E A;  1KXG A;  3Q8B A;  4YG6 A;  4NII A;  1FT9 A;  1WKY A;  1X82 A;  4I0A A;  3WNP A;  4YFW A;  1A8M A;  1ZZ8 A;  2V5D A;  3OBT A;  3RZG A;  4FTS A;  1R09 1;  2CNA A;  2QTW B;  1BYH A;  4YW6 A;  5JSO A;  2A5Z A;  4QQL A;  1WMD A;  4E4S A;  3N7L A;  5CKN A;  2IVI B;  3I4I A;  1YFX A;  1RUJ 3;  3WQ0 A;  2QQO A;  4FFG A;  1X50 A;  1CWP A;  4IDZ A;  2BNO A;  2BPA 2;  1XJA A;  5EJ3 A;  1KFU L;  3VDB A;  1IS3 A;  2PQQ A;  3VZM A;  4LBK A;  3POB A;  1OT5 A;  5J98 B;  4EWD A;  2J1E A;  5KR7 A;  5GZD A;  4XXA A;  4IEW A;  3MF9 A;  3UKT A;  1C8M 2;  1SLC A;  1O4Z A;  2WZP P;  3PUS A;  1AXK A;  4CXY A;  3B93 A;  2BOJ A;  5CFD C;  3UNP A;  4PLM A;  5LAT A;  3ZFF A;  5ISL A;  3O5S A;  2W91 A;  3DKW A;  5I0S A;  3CIH A;  2W47 A;  1NCQ B;  4OHV A;  5FZ8 A;  2WFF 1;  1LCL A;  3AYE A;  1UYZ A;  4CPB A;  1VBC 1;  1JOB A;  1XNK A;  4ZZ5 A;  1W28 A;  3H3L A;  4GH4 C;  4UT5 A;  4Z82 A;  4ZS2 A;  4B4P A;  3RZJ A;  4XJZ A;  3H9A A;  4XOG A;  2RS3 1;  5FMC A;  4GWI A;  1YYN A;  3TEW A;  4FCA A;  4OI4 A;  3DKQ A;  1HB3 A;  3ZLI A;  4PF1 A;  1I6X A;  1RXF A;  5FLI A;  2D6N A;  1H2K A;  5FY9 A;  3JQW A;  3F95 A;  3LPF A;  1X8E A;  4HG6 B;  3BCW A;  1K42 A;  2OPW A;  1MQT C;  1RIT A;  1N47 A;  3IAQ A;  3LWC A;  1VBE 1;  3O7O A;  3SKV A;  2JKX A;  1M4W A;  1QGL A;  2R16 A;  3WVJ A;  2A3W A;  4YGC A;  2LUW A;  3ACI A;  2WLQ A;  1HB1 A;  2GC2 A;  3BVC A;  2D93 A;  5H9Q A;  2GNB A;  3AYA A;  2ZA9 A;  4RS5 B;  1ND2 B;  2WWJ A;  3H3Z A;  1I5P A;  2WZR 3;  3FWE A;  4IV1 A;  5KHJ A;  2AZ5 A;  3WCR A;  2DFC A;  5JZG B;  2RS3 2;  2OZJ A;  5JSR A;  4QGL A;  3T2T A;  2ATF A;  3O1M A;  1QJU 3;  4MGS A;  2J7M A;  3R05 A;  4LLF A;  4XUT A;  5HXV A;  1GOG A;  2WQZ C;  2X8K A;  3POI A;  1RXG A;  4I2O A;  4HSL A;  3LPG A;  1VBE 2;  2FDF A;  3LAG A;  2Q1M A;  2VMH A;  3N36 A;  1W0O A;  3OEA A;  1DYO A;  2ET7 A;  1FYU A;  4LOR A;  4R4X A;  1BMV 1;  3GF6 A;  1KQR A;  1SAC A;  4Y5Z 0;  5E89 A;  1U0A A;  2DCZ A;  3CLP A;  2C4X A;  1BEV 2;  3V0B A;  3HN3 A;  3J8F 3;  1Q8V A;  4DPN A;  4MET A;  1X36 A;  5FYY A;  1PVC 2;  1YI9 A;  3I59 A;  4CEY B;  4OZO A;  3WF4 A;  1UIJ A;  1WCQ A;  2BER A;  1DFQ A;  1CON A;  3QH6 A;  5FZF A;  3ZYI B;  5EIY B;  2XG3 A;  1UMH A;  2EXJ A;  2W1W A;  3CBN A;  2VNG A;  3NAP B;  4Y22 B;  5T55 A;  2YFU A;  3AZV A;  2VXJ A;  5FP4 A;  3QAC A;  3USU B;  5JR2 A;  3OPW A;  1X9T A;  1R1Z A;  3MIC A;  3OY8 A;  5J7M A;  3WDV A;  2WO7 A;  5M0T A;  2QQK A;  1C8M 3;  1FPN 1;  1DG6 A;  5EFU A;  4AYU A;  4BQX A;  4UW3 A;  5C3Q A;  2QQL A;  4CCN A;  2XJP A;  1T2X A;  4IGP A;  1R09 3;  3VDD B;  1NKG A;  4ZXE A;  5JWP A;  2XVL A;  5F37 A;  2ET1 A;  2CYF A;  1HRV 2;  4KNC A;  1JU3 A;  2ZMK A;  4QB2 A;  1RUG 2;  4CU8 A;  5LA0 A;  3WF0 A;  1ND3 A;  1PZ7 A;  4YGD A;  1QJY 2;  1DZR A;  4HLT A;  1OOP A;  1DU3 D;  3N7J A;  2RR1 1;  5FYC A;  5A6X A;  5FYT A;  5A70 A;  4N43 A;  5LK5 A;  3ACG A;  4M3C A;  5DZG A;  5F39 A;  5A1A A;  4BQY A;  4JAA A;  1ENR A;  2F4L A;  2ERF A;  2CHH A;  3LIG A;  4QPY A;  4UFJ A;  2KXL A;  4AFC A;  1WBL A;  3B9I A;  2WRA A;  3LA3 A;  3PIG A;  1IQD C;  3WG1 A;  1XYN A;  1WMF A;  2DVA A;  1AL2 1;  2JE7 A;  2EVX A;  1HJG A;  1GWL A;  2RS5 1;  4QB1 A;  1NY7 1;  4XUQ A;  3B01 A;  4PJY A;  2JD9 A;  1RUD 1;  1AYN 2;  1WCU A;  1QXR A;  3ZN5 A;  3CDZ B;  2RR1 2;  5FDB A;  3E5X A;  2GH2 A;  5D2A A;  2HKX A;  2ZGT A;  1KJR A;  1MVQ A;  2RS3 3;  3CJI C;  1Y43 B;  3NO8 A;  1QXP A;  1Q8S A;  4OMC A;  2XVG A;  3RGB A;  5AFE A;  4BQ1 A;  1H8V A;  1NCR B;  5BNN C;  2VQT A;  4GWJ A;  4LBO A;  4KU7 A;  3QD6 A;  5A7S A;  2ZHM A;  5JAX A;  2XB6 C;  2VUA A;  1AL2 2;  3DYP A;  3WQB A;  2YBP A;  1POV 3;  2HWB 1;  1VBE 3;  2RS5 2;  5F5I A;  3O1O A;  4D7S A;  1NY7 2;  1DQ5 A;  1LHN A;  1WLT A;  4JKK A;  4UYB A;  2N7G A;  1MEC 2;  2VOV A;  4ATE A;  2B42 B;  1OVP A;  4Z1V A;  3H3U A;  1XC6 A;  5BPX A;  1W6M A;  1QH7 A;  1NXD 1;  2J42 A;  4CDX C;  3KM5 A;  2JDP A;  1BEV 3;  4XHB A;  4JGY A;  4LKD A;  3PVB B;  2C6S A;  5IVB A;  2HWE 1;  4B3N A;  1CPM A;  4HKL A;  4PDW B;  4S2H A;  1FNY A;  2JG9 A;  4HMZ A;  1CX4 A;  3VZO A;  5GAL A;  1DDL A;  3H0O A;  4XZU G;  5C3P A;  5L73 A;  4ET7 A;  2RM2 1;  4IEY A;  1K5M A;  2GH8 A;  5A3U A;  4LLO A;  4AED C;  4EZ4 A;  1N1S A;  3POG A;  2OW4 A;  2AYH A;  3J7M A;  3AP9 A;  1CAX A;  1LES A;  1VBD 1;  5I93 A;  3AZY A;  3LOI A;  2WNV C;  5FZ7 A;  4YZ4 A;  2OUJ A;  4CXX A;  1QQP 1;  1XNA A;  3VBO A;  1XU2 A;  2ZAA A;  1ZX5 A;  4K20 A;  4F3J A;  3O0V A;  1YHF A;  1YCI A;  1A34 A;  3KS7 A;  1AXZ A;  1N1V A;  3M3I A;  3EO6 A;  1G9A A;  1PGL 1;  3ZFG A;  1HRV 3;  5LRR A;  1RUG 3;  1E5S A;  4M4P A;  1YNA A;  3GZA A;  1QJY 3;  4RHV 1;  4ZU5 A;  4K21 A;  3GHM A;  3R4S A;  2RM2 2;  4FTB A;  1H30 A;  2KD7 A;  2DBN A;  2FHR A;  2HWD 2;  1TE1 B;  4P08 A;  3HPN A;  1UL9 A;  1KIT A;  1OLM E;  1W3V A;  5FWJ A;  5FCC A;  1J1T A;  2YHJ A;  1QQP 2;  3AJY A;  5C8C C;  2JIJ A;  1MS0 A;  3FMG A;  4RQP B;  4BXS V;  1H2L A;  1UY2 A;  2A6X A;  2WN3 A;  4AI0 A;  5B2G B;  1EAH 1;  4LT5 A;  3HQR A;  5APA A;  3SKJ E;  4IEX A;  1PGL 2;  4XJU A;  3RMY A;  2UWC A;  5L7O A;  3WF2 A;  3OGR A;  4M3C E;  3M3O A;  5EHD A;  3HWJ A;  2ZHL A;  5KBF A;  1ULD A;  4RHV 2;  3WF3 A;  3P1I A;  4IEU A;  3V65 A;  2RR1 3;  1G7Y A;  4BXF A;  4QX2 A;  2GN3 A;  4FP3 A;  4QPI A;  4UBG A;  1O3R A;  3USS A;  4DIQ A;  4Z2W A;  3MFC A;  1L7R A;  4JC1 A;  2KM2 A;  5C70 A;  1YJL A;  3VHN A;  4KBZ A;  1VPH A;  4NWW A;  3VKM A;  1OUR A;  5J09 A;  4PHZ A;  3AKS A;  3I2D A;  1AL2 3;  1EAH 2;  3K75 B;  4IXL A;  4N43 B;  1ZRE A;  2VZT A;  2NQY A;  2RS5 3;  3WEZ A;  4A2U A;  1FMD 1;  4Z8B A;  4AK3 A;  3JUU A;  4BJ0 A;  1DYP A;  1JS9 A;  2AEN A;  1PO2 1;  4JGZ B;  3W21 A;  1UOF A;  1S2E A;  5GZF A;  5IVC A;  2ZXQ A;  4FXG B;  3TEX A;  3S57 A;  3ZXE A;  1LAJ A;  2WIN B;  2QDN A;  1IGO A;  1LHO A;  1PIV 1;  2DU0 A;  4P9X A;  2QQV A;  5FYU A;  5EJ1 B;  4CE8 A;  1M06 G;  1K3I A;  1C1F A;  4I09 A;  3EBR A;  3QH7 A;  4OMD A;  3NST A;  1H6Y A;  4NJ4 A;  1GR3 A;  1ULP A;  3D6E A;  3PL0 A;  4J1W A;  1SLT A;  1BZW A;  5T5L A;  4LBQ B;  2BRT A;  1O8S A;  1UXZ A;  1B35 B;  1YFY A;  3PTR B;  4BCU A;  3I2O A;  1FMD 2;  3VD3 A;  1CZT A;  4LHN A;  2EF6 A;  3LKJ A;  4AQS A;  2BVV A;  2R0F A;  4LO4 B;  1OFS A;  4ASK A;  4NPL A;  2NM1 A;  2PHF A;  1PO2 2;  1XQN A;  5DXD A;  1JZ7 A;  2WUH A;  3PU8 A;  1COV 1;  1SLI A;  2HYK A;  2LRO A;  2ZX3 A;  3FHQ A;  5FZK A;  4PIY A;  2HWE 3;  4QGM A;  1WMX A;  2AUY A;  5CFC C;  1LGC A;  1WW5 A;  3RPQ A;  4TLG A;  1OC1 A;  2O8Q A;  5FZA A;  2JDH A;  4B4Q A;  2F4P A;  5BNQ A;  4QHZ A;  5FO8 B;  5K0U B;  4DO0 A;  2RM2 3;  3WQ7 A;  1SBE A;  3H1W A;  3BOD A;  4BZ4 A;  3FLT A;  4HAN A;  3E97 A;  4BIO A;  5FUN A;  4ARX A;  3IPV B;  1QQP 3;  3JD7 2;  4X6R B;  4XCA A;  4ZU4 A;  2C5D A;  4IER A;  4LR4 A;  3WIN E;  3ZR6 A;  1W9Y A;  1PK6 B;  1FNZ A;  2CWM A;  1HXS 1;  2XR4 A;  1COV 2;  1JYT A;  2OYZ A;  4HL0 A;  3LOB A;  4XF3 A;  4XIK A;  3N3H A;  1DGW X;  2WO1 A;  4ES9 A;  5J3U A;  2MEV 1;  5I8S A;  4RHV 3;  1Q8O A;  3OGV A;  2RHP A;  4AF9 A;  2ZGQ A;  4O9G A;  1NQJ A;  4P9I A;  1JMU B;  2PAE A;  5BNO B;  3BI3 A;  2UY8 A;  3SMH A;  2ZML A;  4XAB A;  4KMQ A;  4R52 A;  2P6C A;  3M3E A;  4CDW B;  1H8T C;  3Q8E A;  5L19 A;  2D6P A;  3B5L B;  3VL9 A;  4GQ7 A;  3FFQ A;  2DF7 A;  4KWK A;  2HLE A;  1EAH 3;  2CGO A;  1AR7 1;  1HXS 2;  4K8F A;  4HVO A;  2EAK A;  1OA2 A;  1OLQ A;  5BNP A;  1RHI 2;  5KHK A;  1JZ3 A;  2J1A A;  3WW4 A;  1F35 A;  1CAW B;  3VBR B;  1PMH X;  2MEV 2;  5C3O A;  4AHY A;  3E6D A;  1SCS A;  2VBP A;  4RFR B;  1ZZ6 A;  2R1D A;  4ATF A;  4Y1X A;  1JW6 A;  2ZMN A;  1Z7S 1;  3RYP A;  3AZW A;  4MHR A;  3VD7 A;  5DQ0 A;  3S30 A;  4HT1 T;  1YJK A;  3BPZ A;  4WM7 B;  5CKM A;  5J36 A;  3SH3 A;  3N9L A;  2Q1Z B;  1BQP A;  1ACC A;  3C7G A;  3DL3 A;  3U0Z A;  1S2K A;  4XEZ A;  2X5I C;  3PUR A;  1T6G C;  3MPP G;  4W6W A;  3RNS A;  1LEC A;  3ME2 A;  3D0S A;  2VOX A;  3MF6 A;  4XYX A;  4CPB D;  2E53 A;  4OUE A;  3KT7 A;  4B7K A;  1AR7 2;  2DVD A;  1MAC A;  1TVG A;  3SIT A;  2CTV A;  4FO9 A;  4FXK B;  4ASL A;  3ZSM A;  1FMD 3;  4WZC A;  3UJQ A;  2WBK A;  3BOW A;  2NYY A;  4IV3 C;  1PO2 3;  2DTY A;  2BFU S;  4MVT A;  3TWI A;  3ZVX A;  4NE9 A;  1NX9 A;  4JVA A;  2DVF A;  4QXC A;  1Z7S 2;  1VP6 A;  2TBV A;  1GZC A;  3WW2 A;  5F7U A;  1OI6 A;  1EY2 A;  2RJ2 A;  2YGL A;  4FOY A;  4YVW A;  3AJZ A;  4A7Y A;  2VZV A;  2VNR A;  1OOP C;  1VAM A;  5DUU A;  1CAV A;  1UU6 A;  1EV1 2;  1XU1 A;  3UKV A;  1VAL A;  2OT7 A;  4XDQ A;  3ZFE A;  3ES4 A;  4AFA A;  5E8A A;  2ZX0 A;  3IT8 A;  5FY5 A;  2RS1 1;  2WNU B;  2YFZ A;  4YGE A;  5JOY A;  4MX3 A;  1W06 A;  4P9J A;  4CP9 B;  4LHS A;  4COW A;  5JXJ A;  2I45 A;  3T0B A;  3DCQ A;  4A41 A;  3HQU A;  1G9F A;  2BFU L;  3JBG 2;  3JD7 3;  4MGT A;  4BM8 A;  4GKY A;  4C1X A;  3H8R A;  2P5B A;  4CDQ B;  2P3K A;  2C26 A;  3VBF B;  3HEI A;  3WG2 A;  4A6O A;  1COV 3;  2MPF A;  5LAS A;  5FAX A;  1PM4 A;  3WNX A;  4CCM A;  4M0N A;  3VZL A;  3ORJ A;  2PHU A;  2Z69 A;  4WM8 A;  1BCX A;  4YVS B;  2EAL A;  1O59 A;  2HH9 A;  4LIV A;  5FV3 A;  3PVN A;  5GZC A;  1NE4 A;  1T6B X;  2GN7 A;  5A6Y A;  3VBU B;  1Y9G A;  4ISR A;  3M8L A;  1E5H A;  2RS1 2;  5L36 A;  1MS8 A;  5JVV A;  1DQ1 A;  2ADE A;  4Z92 B;  2Q0A A;  3JU9 A;  4TWT A;  3OYW B;  4PCR A;  3NWK A;  2X53 S;  1W9W A;  2DCJ A;  2JG8 B;  3VKF C;  3ZYJ B;  5A3T A;  4N53 A;  4AZZ A;  2Y6L A;  3KB5 A;  3GZE A;  3LIH A;  3I2I A;  3FFZ A;  1BLZ A;  1REF A;  2QQU A;  2RMU 1;  2YV8 A;  4ZON A;  5F2W A;  4OUL A;  4RD7 A;  3T0A A;  5FZI A;  4D6S A;  1HXS 3;  2QBX A;  1QU0 A;  2VNV A;  4ZS3 A;  1RHI 3;  1UIK A;  2V09 A;  4DIN B;  2MEV 3;  1GOF A;  3AKP A;  1LOC A;  1LKN A;  1UU5 A;  1UY4 A;  3NV1 A;  3WQ1 A;  4SLI A;  3D4K A;  3PVO A;  1ZVF A;  4XC9 A;  3TOJ A;  2JG9 C;  4DXS A;  4JDN A;  1AHS A;  5A7Q A;  3LEI A;  3M3Q A;  3OBA A;  1SPP B;  3RYK A;  3RG0 A;  4AGG A;  3VLB B;  1ULG A;  1KS4 A;  3BYW A;  1NZC A;  1XNT A;  3K4Z A;  4F8A A;  1J59 A;  2WA3 A;  4UBH A;  1Y4W A;  2QZ3 A;  4AVV A;  1N1Y A;  1HQN A;  2A1X A;  1W9F A;  2RMU 2;  3S5Q A;  4CUB A;  2IXH A;  1S55 A;  1Q56 A;  4R4Z A;  2B39 A;  1AR7 3;  3EQE A;  4XBQ A;  4BDV B;  2G19 A;  3GAL A;  3I2K A;  1GYK A;  5FZO B;  2O8O A;  3S5A A;  1RYY A;  2PHD A;  4C90 A;  5IUQ A;  2QQI A;  5CZK A;  3AMN A;  2J1V A;  1ZBA 1;  3GZT B;  3W5M A;  2A71 A;  2VZ3 A;  1W0P A;  5KXE A;  4YZ2 A;  3J7H A;  1UY3 A;  5ABJ C;  3DPR B;  5E1R A;  4ZY9 A;  2YUE A;  3GJB A;  1Z7S 3;  3WY6 A;  2E7Q A;  3OCP A;  1U5Z A;  1V9U 2;  4EQV A;  5A7W B;  2F17 A;  2NLR A;  2BWA A;  1U5I A;  2XQR A;  3KGL A;  1EV1 3;  4BME A;  3I3Q A;  2ZEW A;  5A6Q A;  4FFF A;  4DUV A;  3MHZ A;  3J9S A;  1XB9 A;  4XF9 A;  3K3N A;  1V70 A;  5KXB A;  3MEP A;  2W1Q A;  4XQW A;  4CYD A;  2A75 A;  1AZD A;  1MZE A;  5A7P A;  3OGS A;  1LOE A;  1JZ5 A;  1XRU A;  3O14 A;  4AQ6 A;  4CU9 A;  3EXU A;  3BOP A;  3U10 A;  1RL3 A;  2VOT A;  4AVB A;  2RV9 A;  2JIC A;  4UFI A;  3WOG A;  1IKQ A;  3PHM A;  5FZ1 A;  2PLV 2;  4QQP A;  1L7Q A;  4DQA A;  4UFM A;  1NCQ A;  3OJB A;  1WLC A;  3ELN A;  3LFM A;  2E32 A;  4AHX A;  2FZ1 A;  4GMP 0;  1ULO A;  4I0B A;  3POJ A;  5CFD B;  3KVB A;  5LA9 A;  4AEJ A;  1OPM A;  2RS1 3;  5F32 A;  2DYC A;  3BU7 A;  1JYC A;  3U11 A;  5C71 A;  5FR3 A;  3I3M A;  1YLL A;  1H2M A;  2DVB A;  1BK1 A;  4XZP A;  4EN6 B;  2SBA A;  4W65 A;  2XON A;  2QQP A;  2WQ8 A;  5I8T A;  4KWJ A;  5FXX A;  1ODM A;  3H7J A;  4QQO A;  4GH4 B;  4M4R A;  5ANQ A;  1POV 0;  3A21 A;  4XFH A;  1URX A;  1WCK A;  3JCI A;  3RFR A;  2VZU A;  3RYR A;  4NO4 A;  3PUI A;  4LO5 B;  4TYS A;  2ID4 A;  3POE A;  4XJ8 A;  4OI0 A;  1MR5 A;  3GNE A;  1QIQ A;  1IZ3 A;  1ALY A;  2V4V A;  3NJY A;  5FZ6 A;  4RS5 A;  3V0A B;  1ND2 A;  1IQA A;  3Q8F A;  1QF3 A;  1QY4 A;  4D8M A;  1V0A A;  3JB8 A;  1MQT B;  5C4W C;  3PIJ A;  1UZ0 A;  2RJK A;  4NHX A;  3AVR A;  4XUO A;  5FP9 A;  5JZG A;  2UWA A;  1H9W A;  4K1Y A;  2DUO A;  5FXZ A;  1UOG A;  1O5L A;  2GC3 A;  1PO1 2;  1SFN A;  2OZ6 A;  1QH6 A;  4W50 A;  2RMU 3;  2VNO A;  3ILN A;  4OHY A;  4D7T A;  1OF3 A;  2UY9 A;  3FE5 A;  3OUJ A;  5IYY A;  1JH5 A;  3RWN A;  3AKT A;  4MGQ A;  5A3M A;  4BK5 A;  5JIU A;  3ZYH A;  1I1E A;  1IS6 A;  1X9P A;  1L3J A;  3HNB M;  2CAU A;  1DP0 A;  2BNM A;  1E5I A;  3FN9 A;  3MW4 A;  1V9U 3;  4RGK A;  5FFO C;  5A80 A;  3TBD A;  2GMM A;  2JXA A;  4MGI E;  4Q4W 1;  3VHP A;  4CEY A;  3RVH A;  5FOB B;  3H1M A;  3VDA A;  3WDW A;  3RZM A;  5EXO A;  3CZU A;  3B94 A;  4PI2 A;  5JCT A;  1UOJ A;  5I0T A;  3NAP A;  1QOS A;  1XE0 A;  5C3R A;  4Y22 A;  2D6M A;  5FKB A;  3USU A;  2P1B A;  2ZKN A;  4ZZ8 A;  3K4D A;  5T5P A;  1RB8 G;  5FPL A;  4H2A A;  1POQ A;  1OMI A;  2ENR A;  2XXZ A;  1YI7 A;  3D82 A;  4HON A;  3POS A;  3WP4 A;  3PME A;  3VDD A;  4KWL A;  3BUC A;  4IGO A;  3AX4 A;  3KQR A;  2K0G A;  4Y1V A;  2PLV 3;  1JYI A;  4Q4X 1;  1LOF A;  2DU1 A;  2CGN A;  2VMG A;  3PUQ A;  5A3L A;  1UOB A;  1OD3 A;  4XFG A;  5C6C A;  3GYD A;  2Q8O A;  3IN9 A;  1UYX A;  1V00 A;  1OHF A;  1SDD B;  3T0D A;  3MIG A;  4DUX A;  1QDO A;  3J8F 2;  1AX2 A;  4L2N A;  3B9C A;  3U4S A;  4AFB A;  4CCD A;  4QDR A;  3MZH A;  5FYM A;  1AR8 2;  2Y38 A;  1Z78 A;  3L2H A;  2NZ9 A;  4GXL A;  1UPS A;  3THD A;  5LEK A;  4JDO A;  4MXW B;  5FMO S;  5FY4 A;  5FZ0 A;  3NNG A;  3OB8 A;  4NID A;  3RZZ A;  4TN7 A;  3GDB A;  2VVD A;  2K46 A;  4IE0 A;  3U78 A;  2JDA A;  2WT1 A;  4XUN A;  1Z0H A;  5L9R A;  3LEM A;  2BBV A;  4DXT A;  3FJS A;  2PTM A;  4PIX A;  1RUN A;  4ARY A;  2VCB A;  3RJR A;  5GLW A;  5AFB A;  2F6B A;  4A4A A;  3DXU A;  3SNM A;  2WR9 A;  4E2S A;  1R09 2;  4Q0V A;  5KWR A;  2VQ0 A;  1W99 A;  2AEZ A;  2YPJ A;  3VL8 A;  1AJO A;  1UMI A;  3RI9 A;  1W04 A;  5FMO L;  4V2W A;  5CIR A;  1NCR A;  1PO1 3;  2NPI A;  3U75 A;  3WD5 A;  4QB6 A;  3W9A A;  1VAV A;  2BU9 A;  3NKT A;  2XOM A;  3AK0 A;  2CGP A;  3LA7 A;  2JDU A;  2YBS A;  2VTX J;  1OUS A;  2QKD A;  3CJI B;  3MIH A;  4FQ4 A;  1ZZC A;  4O65 A;  2R1B A;  4H3W A;  5EQU A;  2BGO A;  1UF2 C;  2O1Q A;  3HAG A;  3KF3 A;  1TMF 1;  1V6J A;  3M2M A;  4XAE A;  2RDR A;  3ZSK A;  1RC6 A;  2XJQ A;  4FPJ A;  1H4G A;  4LQR A;  5HCB A;  4CXW A;  5BNN B;  1ZA7 A;  2R0H A;  2WNE A;  4FPE A;  1D0H A;  3AMQ A;  4NAM A;  4CCE A;  4PDW A;  4YM0 A;  4JRL A;  1BVP 1;  1WWY A;  1YIP A;  2CDP A;  2WFF 2;  2YC2 A;  3A4U A;  1RJ8 A;  1VBC 2;  1YFW A;  4IEP A;  4C0B A;  1W6O B;  2W87 A;  4IE5 A;  5EWS A;  4MAD A;  5AVP A;  2GC0 A;  4LBJ A;  1K12 A;  4CDX B;  3URF A;  1TNF A;  3J7L A;  1F2N A;  1WCD J;  3AYD A;  4OUS A;  5KC6 A;  2FBE A;  1FAT A;  1STM A;  4FOW A;  2ILM A;  3OD4 A;  3ON7 A;  2WA4 A;  2IFR A;  3MV0 1;  4QX5 A;  4YW1 A;  3MUZ 1;  4WBB A;  4TSV A;  2WAA A;  1LUL A;  1ONA A;  1H2N A;  4Y5T A;  5LWB A;  4E8C A;  3QCW A;  5A3N A;  3MUY 1;  1YO8 A;  4AED B;  4BQW A;  3P3N A;  4Q1P A;  2P34 A;  1H1A A;  4CCJ A;  2JDK A;  1RUH 1;  2B4K A;  5KHH A;  4BQ5 A;  3WHT A;  1XE7 A;  1OXC A;  4HN1 A;  1A8D A;  5FP3 A;  2Q5T A;  2WNV B;  4ASM B;  2ZX4 A;  5D8A B;  4Q26 A;  1NOV A;  1RVF 1;  3J4U H;  1IG3 A;  5CAZ A;  4XF0 A;  2G1M A;  1DGL A;  2R07 1;  2JWP A;  3AP6 A;  1FI2 A;  2DTW A;  4XAA A;  5FBJ A;  4QU1 A;  3K2O A;  4K40 A;  4W4Z A;  3SCF A;  3NV2 A;  4URA A;  2XLG A;  2YYO A;  2ZGR A;  1AR8 3;  5EPA A;  1OLR A;  4AHZ A;  1DZQ A;  4XAC A;  2BVB A;  5F5C A;  4RQP A;  4Q29 A;  5F1R A;  5FOJ B;  4AI2 A;  2VZO A;  3OOX A;  3AFK A;  4UFK A;  1A3K A;  1GIC A;  3JB4 C;  3S7E A;  2ZJC A;  3HNY M;  1ULC A;  2XHK A;  4NRO A;  1RUH 2;  4M01 A;  3FHA A;  4GWN A;  1XNC A;  4LUM A;  1G6N A;  2LS6 A;  3IKW A;  2B7Y A;  5C8C B;  3ASI A;  1BMV 2;  1W2N A;  3A23 A;  2JB8 A;  3G7D A;  2A6Y A;  2R06 1;  1UZZ A;  1OLM A;  1JI6 A;  4BWO A;  2YDE A;  3O1R A;  4OI1 A;  3A22 A;  4IEQ A;  4EZH A;  2BV4 A;  1SLB A;  4I0W B;  4QPW A;  5FO9 B;  1D4M 1;  1HW5 A;  2ORX A;  5DPN A;  3FZ3 A;  3ST7 A;  4GJZ A;  3ZSE A;  2P4E A;  4LPL A;  1VRH 1;  3VBS C;  2Q1F A;  4K9S A;  1LEN A;  2EA7 A;  2EIB A;  4CA9 A;  1RUF 1;  4K3U A;  4LO6 B;  1JZ2 A;  4LKS A;  2FDH A;  2OPK A;  2E26 A;  1FPN 2;  4GKX A;  4JGZ A;  5FZL A;  5F5Q A;  1DF0 A;  2WS9 1;  3SHR A;  5A6Z A;  4KGG A;  2GC1 A;  2GU9 A;  2Y6G A;  1MVE A;  1ODN A;  1PZ8 A;  4IEZ A;  4NOT A;  4YW7 A;  1HQW A;  3B69 A;  3OSD A;  5GZG A;  5IK8 A;  4OHX A;  3ZX7 A;  2WFF 3;  2VTX A;  4QXK A;  1VBC 3;  2JE8 A;  1D4M 2;  4LE4 A;  4XFA A;  1ZZ7 A;  1VMF A;  3AXD A;  3HT2 A;  4XCB A;  1S0C A;  4JHZ A;  1QHD A;  4NPM A;  5FZM A;  3VZK A;  3HIF A;  5JMC A;  1LOD A;  3MIE A;  5FLJ A;  4LBQ A;  3TEZ A;  1JZ8 A;  1B35 A;  1C1L A;  2W1U A;  4KH9 A;  4XJA A;  4CP0 A;  1MPX A;  4Q4Y 1;  3D5O A;  3GBW A;  1RUC 1;  1H6X A;  2Y6H A;  2O0O A;  1CX1 A;  3ZYB A;  1REE A;  4CU7 A;  5IFT A;  5CA6 A;  3KCY A;  1FAY A;  1YEW A;  2VMF A;  2UYA A;  5GLU A;  1CGP A;  2VUL A;  5FYI A;  5GKA C;  4LMF A;  4EWE A;  1RUD 2;  3UKN A;  2WSU A;  5K0U A;  3DN7 A;  5CYY A;  5F3E A;  5JUV A;  3SCG A;  4AFD A;  1TME 1;  2P3Y A;  3IIA A;  4MUV A;  4NRQ A;  2IXL A;  2XL9 A;  2Y6F A;  1B09 A;  2WC2 A;  3MI8 A;  1ZRI A;  2WFP A;  3P6B A;  1DIW A;  1NA1 C;  2WZ8 A;  3L9J T;  5IWF A;  2EAA A;  1BBT 1;  5CFC B;  2VPV A;  4RR3 C;  3IPV A;  2B9U A;  5JI9 A;  4HFS A;  5ACA 1;  1WW4 A;  3WF1 A;  2Z79 A;  4X6Q B;  4D3W A;  1G9B A;  4Q4Y 2;  1PK6 A;  2Q30 A;  1RUC 2;  4K8R B;  2EIE A;  4XMA A;  3WP3 A;  5IK4 A;  1LOG A;  2FD8 A;  1RUH 3;  3LZZ A;  2HWB 2;  5T54 A;  1EP0 A;  3CO2 A;  2R32 A;  4YNI A;  4URT A;  3NJV A;  4A45 A;  2BJS A;  1S0D A;  1IPK A;  1D4V B;  1ND2 C;  4H7M A;  5LB6 A;  5A1L A;  2A7A A;  5LK7 B;  2VY0 A;  5BNO A;  1DBN A;  4BLJ A;  2CY6 A;  2D6K A;  2QCS B;  1PVX A;  2HWE 2;  3N9Q A;  4N7I A;  3ZOI A;  4Q0S A;  4L11 A;  1NAE A;  3KV9 A;  3N7M A;  5EP9 A;  4L8Q A;  1CN1 A;  4LOT A;  4CDW A;  5FTT C;  2C9K A;  5C9A C;  1OA4 A;  2WNO A;  4BLI A;  1S0G A;  3MLJ A;  1TZO A;  2H6C A;  2Q8E A;  4AQ2 A;  1WME A;  1VBD 2;  3K46 A;  4XTP A;  4GA9 A;  3RQ0 A;  5J48 A;  1CAW A;  2YC0 A;  1FPN 3;  2X09 A;  4QD2 A;  1H8T B;  3R0R A;  3SLI A;  3VBH C;  2D5H A;  3VBR A;  4NR1 A;  4YM3 A;  1VBB 1;  2Z5W A;  4CEW C;  4AOC A;  3INA A;  1CZV A;  2I07 B;  4I01 A;  2VZS A;  4WM7 A;  1CES A;  3NAP C;  5F6L B;  1D4M 3;  4EE2 A;  1LB2 A;  3CZJ A;  4P00 B;  4CCC A;  3WW1 A;  2P6H A;  1VRH 3;  4LIT A;  1HB2 A;  1W6N B;  3H50 A;  4UF0 B;  4I30 A;  2XBO 1;  3PMS A;  5H9P A;  1U5X A;  4DMI A;  2E9Q A;  3MW2 A;  3KQ4 B;  4XJ9 A;  2VR4 A;  2DDU A;  4YG0 A;  1UU4 A;  1DHK B;  4NIH A;  3ITQ A;  2X5I B;  2XJS A;  3I2H A;  3U1X A;  2FCT A;  3Q9O A;  5C5T A;  4AGV A;  3RZK A;  1EUU A;  3FUO A;  4H14 A;  2ZHK A;  2HWC 1;  2FDJ A;  3ABZ A;  4PLN A;  1WW6 A;  4V2V A;  5LW9 A;  4WVM B;  4BU2 A;  4RA0 A;  2JDZ A;  4KQ7 A;  4D6Q A;  2IXJ A;  4JTO A;  2DCT A;  4FAG A;  1RUD 3;  2JX9 A;  4IV3 B;  1CR7 A;  2VBB A;  1DYK A;  3WG3 A;  4LKE A;  2WNU A;  1CVN A;  2Y60 A;  5DAX A;  5DUX A;  1KRI A;  1LTE A;  1US2 A;  4P9W A;  2XML A;  3ZXA C;  4NVP A;  4CP9 A;  3NW4 A;  3THC A;  3SH5 A;  2A6V A;  4YM1 A;  5FUI A;  3WUC A;  5EYY A;  1SFP A;  4Q4Y 3;  2VJX A;  4CDQ A;  1YIF A;  5CKQ A;  1RUC 3;  3VBF A;  3OBR A;  5A3P A;  5L9V A;  4ERO A;  2XVK A;  4MO3 M;  2HWB 3;  1GV9 A;  2HBT A;  3IDC B;  1QJX 1;  3GZU C;  4LA2 A;  4NIG A;  2E33 A;  4YVS A;  4XIO A;  3LGR A;  3ZFF C;  1W8W A;  4QDQ A;  2I2S A;  4IE7 A;  4CDU B;  1GQH A;  2ZHN A;  3VBU A;  4H55 A;  5FRA A;  1MZ5 A;  3U07 A;  4E4D X;  1GP4 A;  3KT4 A;  3OYW A;  4IUG A;  4LXL A;  1PIV 2;  4MV2 A;  2BEO A;  2JG8 A;  2IXC A;  2NMN A;  1JXN A;  1MS1 A;  2XQX A;  3W20 A;  3M4F A;  4KG8 A;  4IEV A;  1C3H A;  5HBA A;  3HBZ A;  4O7X A;  1VBD 3;  1NT0 A;  1AX0 A;  1G8W A;  1O6U A;  1CAU B;  1QJX 2;  3ZPY A;  4NAO A;  4LK7 A;  2HYX A;  4RSU A;  2C9A A;  4XXP A;  4GAZ A;  4RN5 A;  2VL4 A;  3LE0 A;  4PDW C;  4XVH A;  4GD4 A;  5JXG A;  3ZXJ A;  5JPN B;  1HLC A;  5GLV A;  5AC9 1;  3NQH A;  5KHG A;  4NRP A;  1SPP A;  3VD5 A;  4LHK A;  3K4A A;  2ARE A;  1PMI A;  1HRI 1;  5D21 A;  3WNL A;  1V6I A;  1PMJ X;  1UO9 A;  1W8U A;  4IV1 C;  2FCV A;  3N4M A;  2JEM A;  1W9T A;  2IXK A;  1SMV A;  1NZI A;  2OUH A;  1VR3 A;  3CMG A;  3FBY A;  3MIB A;  3NKG A;  3O0W A;  1WD3 A;  4XBL A;  1P8J A;  2E51 A;  2GDF A;  5FYV A;  3TN9 1;  3ZYG A;  4Q4V 1;  5A7O A;  5IVY A;  2WWU A;  5CIS A;  4FFH A;  1RUE 1;  3KVA A;  3DPR A;  1JHJ A;  4FPH A;  3PLQ A;  1E57 A;  4TXW A;  5FXV A;  4D69 A;  5K9Y A;  5LCW L;  4FPK A;  2IVJ A;  5AC9 2;  2D98 A;  3J26 N;  1VIW B;  1DZT A;  5A7W A;  1A78 A;  3III A;  5IVJ A;  1HRI 2;  3BN6 A;  1QOO A;  4YZ3 A;  1IPS A;  1YQ5 A;  5DG2 A;  1ZRF A;  3W5N A;  4NWV A;  1HKD A;  3ENR A;  5A1F A;  2Y8K A;  5ABJ B;  4BYY A;  4QKF A;  5F3C A;  3LSD A;  1DGW A;  2NMO A;  4HPK B;  2YZ4 A;  1VE0 A;  2D40 A;  3IDB B;  4UAP A;  3WUD A;  1EUT A;  4ZHN A;  1XNB A;  3LF7 A;  5FP7 A;  5LBC A;  3UGH A;  1S0J A;  3BU0 A;  1UD1 A;  4FTE A;  4Q4V 2;  4R9A A;  4PLO A;  4GZ9 A;  2NN8 A;  5DZE A;  1Q8P A;  1JYV A;  1K5J A;  1ZBE 1;  3VD4 A;  1UW8 A;  1UYY A;  3BPS A;  5A33 B;  1EPW A;  5BYN A;  4GUL A;  3GHN A;  4XIL A;  3O1U A;  2W68 A;  3C8X A;  3MBW A;  1J84 A;  4SBV A;  5CFD A;  4OQ8 A;  4E9K A;  4LEJ A;  3RWK X;  3H42 B;  5F8P A;  2WN2 A;  3HMY A;  1ND3 C;  5DAP A;  1JN2 P;  5K8S A;  3VHR A;  1PIV 3;  1ST8 A;  1YQ2 A;  1W9S A;  2WYF A;  3SH4 A;  4N43 C;  4GH4 A;  3ZN4 A;  5FPX A;  2JB4 A;  3C7O A;  2TUN A;  3BIE A;  3M3C A;  1S0B A;  5FJK A;  2D97 A;  1XSQ A;  1GLH A;  3TRS B;  1GUI A;  1FV2 A;  1QJX 3;  2WAO A;  2V5Y A;  4P9L A;  4U36 A;  4QX0 A;  3VD9 A;  4B29 A;  4S2G A;  3IDE A;  5FWE A;  4AHW A;  1F5F A;  2Y34 A;  3FX3 A;  4QKN A;  3V0A A;  5FY7 A;  3AFG A;  4E2Q A;  4E4H A;  3IDA A;  3RSJ A;  1SQ4 A;  1MQT A;  2OS2 A;  4LO8 A;  2CSG A;  1UZW A;  2VZR A;  2W3J A;  3A0K A;  4QKD A;  3DXT A;  1PZ9 A;  1AXY A;  2WDB A;  3N35 A;  1V6K A;  4AWD A;  3VDC A;  3ACH A;  4MGY E;  2B45 X;  5CAD A;  1YWK A;  4Q27 A;  4YW4 A;  1KFX L;  3I3E A;  2VM9 A;  3AVS A;  5HCF A;  2VEC A;  3MFA A;  1H9P A;  3QBQ A;  4JKM A;  1OQE A;  4MHU A;  3TYJ A;  3VZJ A;  5C4W B;  4HBN A;  3ZDV A;  5IVF A;  4OQ9 A;  4LTA A;  4O9E A;  1CZS A;  3GCW A;  1ENQ A;  1KJL A;  4AL9 A;  4LJH A;  3KWV A;  2VME A;  3SXW A;  1AYM 1;  2SLI A;  3F2Z A;  3RMX A;  2KR2 A;  1GZW B;  2QVS B;  3ILR A;  1LHU A;  4P02 B;  5AC9 3;  5T3N A;  1O8P A;  2CL2 A;  1W6P B;  3OPZ A;  3DUI A;  5K0U C;  1UWW A;  2XDV A;  3O1S A;  1WCS A;  3OUI A;  1HRI 3;  2PHX A;  4MGZ E;  3VB9 A;  4JGY C;  5KHI A;  4AXO A;  4FP2 A;  2J1R A;  2BGP A;  2FZ2 A;  1RIN A;  3HN1 A;  3UK9 A;  4HVR A;  2ZPX A;  3ROU A;  4EN7 B;  1ZRC A;  1U5Y A;  4AVC A;  4XFC A;  1C28 A;  3ZKU A;  3ZM8 A;  4A7K A;  2ZTN A;  2E7A A;  4A6S A;  1K5M C;  2H0B A;  3LQC A;  1PK6 C;  1W8O A;  4Q4V 3;  1GFF 2;  1O4T A;  2ZGS A;  3UJO A;  1D0G A;  2IUW A;  3THT A;  2XJR A;  4LIU A;  5FRE A;  5JPM B;  1JYW A;  3PDQ A;  4QPG B;  1GKB A;  1QWR A;  1ZNP A;  3AB0 A;  3VBO C;  1RUI 1;  4AI1 A;  2G9Z A;  1GNH A;  4L97 A;  2Q8D A;  2YPD A;  4AEK A;  2FMY A;  1OKQ A;  4UI9 L;  2VOK A;  2YG0 A;  3BTX A;  3WDX A;  4QQ2 A;  1HN0 A;  1VJ2 A;  2WO3 A;  4QX7 A;  4NHM A;  3B3Q E;  3I8T A;  4NHY A;  2A3Y A;  3ZFG C;  4K1Z A;  2WO2 A;  3H8X A;  4QGN A;  4Y1U A;  4AG4 A;  4HKO A;  2HWF 1;  2UUR A;  4DS0 A;  4KBB A;  4N9I A;  1D2S A;  3SEP A;  2GP5 A;  1H0B A;  2R04 1;  4ZPI A;  1CJD A;  1XPW A;  2D6L X;  4MXW A;  1UXX X;  3WW3 A;  5LBB A;  2UWB A;  2IC1 A;  5FZC A;  1OSG A;  1XXN A;  2ARX A;  5A7N A;  4P9Y A;  3JZV A;  4RGA A;  2YY1 A;  5F5A A;  3HOB A;  4D0Q A;  2WSV A;  1C5I A;  5LY2 A;  5IVE A;  3D3A A;  4WV8 A;  3RZH A;  3A7Q A;  4JCK A;  1ZBA 2;  4LBQ D;  3FHI B;  4EN8 B;  4QM9 A;  5I91 A;  1OQ1 A;  3WNN A;  1OD5 A;  2BDR A;  2G9F A;  5L7O C;  3PVE A;  2D5F A;  5FPU A;  3ZYR A;  2P2K A;  1XOY A;  1E5R A;  4XF1 A;  1PGS A;  1JUI A;  1QJZ A;  4YZ1 A;  1HV0 A;  2PAM A;  1NYW A;  1GNY A;  4QPI C;  2BBA A;  4DNY A;  3X29 B;  1SDW A;  1RUJ 1;  3CJI A;  4L9B A;  3WNO A;  3ZMO A;  2VTF A;  4XFF A;  1WD4 A;  4CP1 A;  4Y20 B;  4R9D A;  4LKF A;  4EYU A;  1QDC A;  1CD3 G;  3QLQ A;  3GBG A;  2PXJ A;  2GNM A;  5BNN A;  2LW8 A;  4YZ5 A;  1PHM A;  1W6Q B;  1Q3E A;  3MID A;  3Q8C A;  1I9R A;  5F3G A;  4E4Z A;  2VC9 A;  3UL2 A;  3WG4 A;  1LNS A;  4HK9 A;  1O91 A;  2BNN A;  2ARA A;  4BA6 A;  4D94 A;  4OFG A;  5BXX A;  4KL1 A;  1SFY A;  1IG0 A;  2A70 A;  2JDY A;  3RJ2 X;  1Q8Q A;  4BH9 A;  1I3H A;  4DUW A;  1QXJ A;  1W6O A;  5FYB A;  4KU8 A;  4A3Z A;  4CDX A;  4Z2A A;  3S0M A;  1YQ8 A;  2ARB A;  2VVF A;  2PQS A;  2V4A A;  2BYV E;  1VRB A;  4QXB A;  5FBZ A;  2XUM A;  1F31 A;  4CDQ C;  3I3D A;  4Q2F A;  4Q8L A;  1SZB A;  2MNG A;  3C2U A;  1W03 A;  4FPF A;  4AED A;  5J37 A;  5JR7 B;  2YBK A;  3E6B A;  1GQP A;  1PNF A;  4Q1R A;  4YGB A;  3T4V A;  3OG2 A;  1J3Q A;  2WNV A;  2ZEX A;  3NV3 A;  3WT3 A;  5D8A A;  3QOP A;  1WUV A;  1IKP A;  4L92 A;  5FO7 B;  5IAV A;  1XSR A;  4KI5 M;  4HSJ A;  3E5U A;  2PYT A;  1NLR A;  2ZX1 A;  3AP7 A;  4YLZ A;  1G9C A;  5B4N A;  3T30 A;  3KV5 A;  3OPT A;  2JG8 C;  3KF5 A;  4XF4 A;  1K45 A;  5IK7 A;  3L2Y A;  4LBN A;  5DAV A;  1GQG A;  2VQA A;  2HEY F;  2E63 A;  3AKR A;  3T09 A;  5H9S A;  3WHU A;  2WZR 1;  5DAB A;  4NHK A;  4QDS A;  5T5O A;  5FZD A;  2W08 A;  3FLR A;  2QZ2 A;  2ZX2 A;  3UV9 A;  4B4R A;  3MIF A;  4EN0 A;  2X10 A;  1O3T A;  1PGW 1;  2X29 A;  1QJU 1;  3NRU A;  1N3O A;  4C8D A;  5A32 A;  3AMH A;  2GAU A;  2Y33 A;  1NLQ A;  1ZBA 3;  3ZXD A;  5C8C A;  4NHL A;  3ETP A;  3LEG A;  4P14 A;  4F7Z A;  3IMN A;  1RED A;  4OYU A;  3RRD A;  3CU7 A;  5FMD A;  2BTV C;  3SCH A;  2B46 X;  4Q4W 2;  5CEH A;  3LEK A;  3Q8A A;  3SEE A;  5FQ0 B;  4N9H A;  3ZDS A;  1Y9M A;  2DBI A;  2R04 3;  1O5U A;  1NUK A;  5GJ6 A;  1ZRR A;  2AGS A;  4GB3 1;  2R7E B;  2WII B;  4QX8 A;  3R4U A;  5IK5 A;  4D7Y A;  1XBF A;  4YRD A;  3DEC A;  2D6O X;  1UKG A;  1UAI A;  1W8F A;  1QNY A;  4COZ A;  3OUH A;  2Q4S A;  3U37 A;  5JXH A;  1VB2 A;  3ECQ A;  4DXR A;  3CF6 E;  2YU2 A;  3DGT A;  2ZZQ A;  4ZXK A;  3VBS B;  5TSW A;  2Z4F A;  3HQX A;  4FFI A;  3KCX A;  4B1L A;  3S7I A;  4DY3 A;  5BNP C;  3POY A;  4YPJ A;  1V6M A;  4M3C F;  1C8M 1;  2BQP A;  2ZOE B;  2EXH A;  2W92 A;  1OF4 A;  4NRM A;  4Q4X 2;  4JKL A;  1HIX A;  1W2A X;  2VCC A;  1IOA A;  2J22 A;  2PAK A;  2YC4 A;  3UES A;  4Q8K A;  4NN0 A;  3WX5 A;  4GB3 2;  4OUM A;  5JOZ A;  2WZE A;  1SBF A;  3BTY A;  1S1A A;  1WW7 A;  1O4Y A;  1UY0 A;  3UYJ A;  1SCR A;  3AMM A;  2QFE A;  2WJS A;  4BIF A;  2PA7 A;  2ZGK A;  4YAR A;  2W9X A;  4EWA A;  4ORF A;  4MOA A;  1ZYB A;  1JTZ X;  1ZM1 A;  1W8H A;  1W3X A;  3WDY A;  3FL7 A;  2G4I A;  2C0Z A;  1F4A A;  2AC1 A;  4HK8 A;  3T2P A;  1WZX A;  3ZN6 B;  3N9O A;  4V1P A;  1FXZ A;  4CUA A;  4PI0 A;  3N9P A;  2BUK A;  2BZD A;  1J58 A;  2EXK A;  4OHW A;  5GZE A;  2VOW A;  4PIZ A;  1KEX A;  4YVW C;  3DV8 A;  2Y26 A;  3EJK A;  5T5J A;  5CFC A;  4XFI A;  5JMO A;  5AVA A;  2GP3 A;  3ZFE C;  3WP5 A;  4PBP A;  5LBE A;  1YQ6 A;  4GMP 1;  3WCS A;  5IW0 A;  5CB7 A;  2DCK A;  2ADD A;  2RDS A;  2XWB B;  3HR9 A;  4LUL A;  3I7D A;  5GLT A;  1O3S A;  3EYP A;  1NA1 B;  3K77 A;  3LD8 A;  5FZ9 A;  4BHP A;  1CPN A;  4RR3 B;  5LRS A;  3RZL A;  4GWM A;  1MS9 A;  3AP4 A;  2VUD A;  4CUG A;  1TMF 2;  3RI8 A;  3TAY A;  2IFW A;  1POV 1;  1XYO A;  4E2G A;  2I74 A;  2OKX A;  3KT1 A;  4Q0Q A;  4COY A;  1ZZB A;  4AGR A;  2JDM A;  3VKN A;  3T1M A;  1RIR A;  1S0F A;  4WM8 C;  2ZEZ A;  4Q4W 3;  4XET A;  4B1M A;  4FPG A;  3IB3 A;  2UU8 A;  3R6S A;  4MGK E;  1BEV 1;  4BQ2 A;  4CVU A;  5JLV A;  5FZ4 A;  3U4X A;  2RVA A;  3LDR A;  1PVC 1;  4XBN A;  4AI8 A;  3CJX A;  4A42 A;  1ZRD A;  2WYS A;  1YQC A;  3HVD A;  4N53 C;  2CAV A;  3KMH A;  4LBL A;  3VUO A;  4MSV A;  1H8T A;  5C9A B;  1C5H A;  1MZ6 A;  2Y6K A;  2QE3 A;  2ZS6 B;  3ZSL A;  5DZF A;  3W59 A;  1EYB A;  5CVR A;  3PJY A;  1OQD A;  4Q4X 3;  4PF5 A;  4CCK A;  1WLW A;  4KGQ A;  5A32 B;  3BAL A;  2Y0O A;  4OZX A;  3VBH B;  4IET A;  4AW7 A;  1LU1 A;  3J7N A;  1GWK A;  1IHM A;  3WLU A;  5BV6 A;  5JSP A;  1RVF 2;  4GB3 3;  4N90 A;  1J83 A;  4CEW B;  1W6N A;  2R07 2;  4MYE A;  4UF0 A;  1HRV 1;  2PHL A;  1RUG 1;  2VH9 A;  2XKO A;  4TLF A;  5FZG A;  1GP6 A;  1LHV A;  1QJY 1;  4HOO A;  4WVZ A;  2IZW A;  4CZS A;  2ZGN A;  4FVV A;  1HQL A;  1D7P M;  4NUB A;  1LGN A;  2GND A;  2X5I A;  3AKQ A;  1RGS A;  1VLN A;  4A7Z A;  1OBN A;  2VO5 A;  1OFN A;  4C1W A;  2ES3 A;  1F5J A;  5DMY A;  1C8N A;  4YW3 A;  4JHT A;  2A6Z A;  1LED A;  4WVM A;  1KS5 A;  2VZ1 A;  2RDQ A;  3CQO A;  3C7F A;  3HD8 B;  4H7L A;  4ONU A;  4XUR A;  4EN9 B;  5C33 A;  2YGM A;  4NPR A;  4MG2 A;  3KLS A;  4C0H A;  3HT1 A;  4IV3 A;  2W46 A;  3ALQ A;  5JOX A;  1XYP A;  5CNA A;  3CHX A;  2R06 2;  4DOU A;  2OII A;  1JYN A;  3APB A;  4DRR A;  5T52 A;  1AYN 1;  1UKR A;  3KZ4 C;  4UW5 A;  1HX6 A;  5DUW A;  1WBF A;  5CU1 A;  4L99 A;  1S2B A;  4KG0 A;  5BY5 A;  3CNA A;  2LRP A;  4I3P A;  1VRH 2;  4XJW A;  5DG1 A;  3H8U A;  1QMJ A;  4M00 A;  4COU A;  2MHF A;  3LCP A;  3VKL A;  1RUF 2;  2TEP A;  1S0I A;  4AVA A;  4E8D A;  2XWJ B;  4UW6 A;  3ZXG A;  1FOD 1;  1PM7 A;  1TMF 3;  3ZIX A;  2CU5 A;  4TZD A;  3I54 A;  2HEW F;  4CDU A;  5I0R A;  2WS9 2;  2YB7 A;  4P5H A;  3BIW E;  4JQR A;  5F2S A;  1NCQ C;  1Q5O A;  2EXI A;  4FPL A;  1MEC 1;  1UCX A;  2WT0 A;  4XUP A;  1RUO A;  1QOT A;  4HN0 A;  2ZBJ A;  3AL5 A;  4GMP 3;  3ZFF B;  3R4D B;  4IE6 A;  3MPB A;  2BP6 A;  4IGQ A;  2ZGL A;  1CQ9 A;  3GCX A;  1G9D A;  5HV0 A;  1LU2 A;  3HNM A;  2J1T A;  4EV0 A;  5C8W A;  4OLL A;  3M1H A;  1CAU A;  2XHN A;  5ANN A;  1O3Q A;  3ZR5 A;  2PEL A;  3LFI A;  4UW4 A;  2YU1 A;  1W90 A;  4HET A;  1FOD 2;  4IQP A;  4HXC A;  3ZXF A;  2FCU A;  2VZP A;  4F83 A;  2EIC A;  3ACL A;  5B4X A;  2D7F A;  1YUD A;  2QQN A;  1V6N A;  2DVG A;  3PUA A;  4RS5 C;  1TQ5 A;  3NJZ A;  1JU4 A;  3TNQ A;  1MZF A;  2ZKL A;  1RVF 3;  3IBM A;  2BW8 A;  1W05 A;  1TME 2;  3IM0 A;  2R07 3;  1ZA4 A;  5JZG C;  1PVC 3;  4JZR A;  2BOI A;  4COV A;  1F9K A;  4BE3 A;  2RG4 A;  4XE9 A;  2K9Z A;  2Z2S B;  4Q0U A;  4R8H A;  4FAH A;  1BBT 2;  3V56 A;  2R30 A;  4YW5 A;  3W58 A;  1OUX A;  3GM8 A;  1UZY A;  4Y5S A;  4B8E A;  1AX1 A;  1N3P A;  2O14 A;  3FUQ A;  5ACA 2;  2HWD 1;  3OTF A;  4IV1 B;  5LBF A;  3KHC A;  4G9S B;  3O1V A;  2CWS A;  5HCA A;  3GJA A;  4W6X A;  1OA3 A;  5D8A C;  5FK7 A;  1D2Q A;  4LOS A;  4XQ4 A;  1H4H A;  4JQT A;  4MXV A;  3FBM A;  1PX3 A;  5FUP A;  4I3G A;  5LA2 A;  5K4L A;  4AFM A;  3O1T A;  4BB3 A;  4QAW A;  2R06 3;  5FLH A;  5ABJ A;  3FC0 A;  3C3V A;  3M70 A;  5J1X A;  4QT6 A;  2C24 A;  3AL6 A;  2JD4 A;  4CEY C;  4HPK A;  1UN1 A;  3A0N A;  1LOB A;  1G86 A;  1W8Z A;  4AAP A;  5G04 L;  3KD4 A;  1JYX A;  3I2F A;  2PFW A;  1W0N A;  1GU3 A;  1DGR A;  2VW1 A;  3DYO A;  3V0B B;  4M0H A;  1V6L A;  2VU9 A;  1DLL A;  1N1T A;  5SV8 A;  5IAT A;  5HCH A;  3I59 B;  1OKO A;  1Y3T A;  1RUF 3;  4W6Y A;  1ULE A;  5A33 A;  1A6C A;  4WVV A;  5J96 B;  3EMR A;  3S6P A;  1F8V A;  5JOW A;  3PTY A;  4JRA A;  5DDJ 1;  4RFT 0;  3VDD C;  3AXE A;  3EB7 A;  4UFH A;  3POF A;  5FPA A;  4D6R A;  1VBB 2;  2WS9 3;  2W94 A;  1SLL A;  4AI9 A;  1AUY A;  2PN5 A;  2A73 B;  1LOF C;  2VW0 A;  3OY8 B;  4QMA A;  4JTN A;  5E6H A;  1AYN 3;  1BK0 A;  4OVE A;  4A3X A;  3POW A;  5FY0 A;  1H1M A;  4UWD A;  2FQP A;  1AJK A;  2XJU A;  3AMP A;  3ATG A;  3NNJ A;  4ITC A;  2W39 A;  3O1P A;  5CG8 A;  4O61 A;  2ORZ A;  3I49 A;  3ETQ A;  2R49 A;  2XBO 2;  3IAP A;  1ND3 B;  5I0D A;  1OOP B;  2E6V A;  4LE3 A;  3FLP A;  5EYX A;  1RTV A;  2D44 A;  1LRH A;  3T2O A;  1FOD 3;  5DDJ 2;  1DQ0 A;  1ASJ 1;  3HBK A;  2V72 A;  1OVS A;  4N7U A;  2ZAH A;  4M3C B;  4Y24 A;  3THP A;  4MH0 E;  2HWC 2;  4YW2 A;  3B7M A;  3VKO A;  3T3Y A;  1MEC 3;  1V6O A;  2LM3 A;  3NNL A;  2KA3 A;  3NNM A;  4FPO B;  3RS6 A;  4AQT A;  5F6K A;  3WR0 A;  1JBC A;  3KHB A;  1UX6 A;  2JIG A;  4Q5O A;  3WNM A;  1GWM A;  1S4C A;  2FDK A;  1QEX A;  1I5Z A;  1SHW B;  2ZEY A;  2HJI A;  2ZGO A;  2IWG B;  1TME 3;  1NXM A;  3WDT A;  5FIX A;  5EJZ B;  1XE8 A;  3OBZ A;  4Y1Y A;  5C4W A;  3ZIW A;  3ZKY A;  4EJR A;  3PNA A;  1BBT 3;  3PU3 A;  1NCR C;  2W52 A;  4XMI A;  5FXW A;  4YYO A;  3T4H B;  2W5F A;  5ACA 3;  4XQD A;  5I8Y A;  1WLD A;  2YMZ A;  3O0X A;  2XPJ A;  4WVW A;  4UFL A;  3BGA A;  1ASJ 2;  1JHN A;  3JQX A;  2ZAB A;  2ZGP A;  1U12 A;  3B00 A;  1J1L A;  3WP6 A;  1GZW A;  2JDN A;  5FKC A;  4DEQ A;  1YRZ A;  1UX7 A;  4HKW A;  4U2A A;  3JD7 1;  1ULF A;  1BKZ A;  1W6P A;  3G6J B;  4JV4 A;  4DEV A;  5C7G A;  5IT6 A;  3ZO0 B;  1H1I A;  1IS5 A;  2OVU A;  4CSW A;  1ENS A;  4S2F A;  4FOQ A;  1GP5 A;  5KXC A;  1UPI A;  2QQJ A;  2RDN A;  4J1X A;  4G4F A;  2VMD A;  3M7A A;  4YWA A;  1KDK A;  3NL1 A;  5E88 A;  3NMB A;  1W6M B;  2QNK A;  4BK4 A;  1QKQ A;  4J6G A;  4Y3O A;  5F9T A;  1BJQ A;  3BTA A;  4JGY B;  2HWD 3;  3N9M A;  4RYD A;  4J25 A;  1VBA 1;  4P9G A;  1X8M A;  2H0V A;  4BQ4 A;  4YSF A;  2HBU A;  3LB9 A;  4JX0 A;  2JG9 B;  2W2I A;  4QPG A;  2XL7 A;  1ENX A;  3KSC A;  1BHG A;  1R08 1;  4UOJ A;  1YC6 1;  5FYH A;  2XJT A;  2VZQ A;  3ILF A;  1K5M B;  5IAX A;  3ZYF A;  1HDK A;  5HPO A;  3CL1 A;  2AAC A;  1VBB 3;  4ZKT B;  1OH4 A;  4QXH A;  1CAX B;  3P5B A;  3SC7 X;  3SIS A;  4CUC A;  1RHI 1;  2JEN A;  3KGZ A;  3VBO B;  2WLP A;  4IE4 A;  4PQQ A;  4FBF A;  4PBO A;  5FZO A;  2VUC A;  2XLF A;  2ZCW A;  1DQ6 A;  1LHW A;  2OQ6 A;  4LK6 A;  4DY5 A;  1GAN A;  4QQH A;  3UGG A;  1Y7B A;  3UT0 A;  2WQ4 A;  1VBA 2;  2J1S A;  4XDP A;  4Y4R A;  3ZFG B;  1UMZ A;  3BKZ A;  2XBO 3;  2GME A;  1R08 2;  3ZXL A;  4RQP C;  3TN9 2;  3OEB A;  4ISQ A;  5IVV A;  3H8O A;  5DDJ 3;  1W39 A;  4LBM A;  1W8T A;  3E5Q A;  3GXU A;  2P3J A;  3LSE A;  1RUE 2;  4WZF A;  1GZT A;  4XHX A;  5D1I A;  3TNP B;  4CTE A;  1MS4 A;  3MDP A;  2HWC 3;  1W2T A;  1AL0 G;  2K2S A;  3ZMN A;  2AR6 A;  1VB4 A;  3K48 A;  3EHK A;  1GBG A;  2GSY A;  4FSJ A;  4BMB A;  1BVV A;  5GLZ A;  1MS3 A;  1JOP A;  1UYP A;  3NVC A;  2DUQ A;  5I0U A;  2DV9 A;  4ZU7 A;  2VUJ A;  5L7O B;  5C5U A;  5FP8 A;  2P3I A;  5K7P A;  1EV1 1;  4DRV A;  4N8M A;  3P3P A;  4Y20 A;  1HB4 A;  2VW2 A;  1PX4 A;  5CBL A;  3TEY A;  2LAL A;  5FK8 A;  2QQW A;  1F4H A;  1ASJ 3;  1W6Q A;  2GMP A;  1TG7 A;  4QM8 A;  2D3S A;  1R64 A;  3IWZ A;  4QPI B;  1AR6 1;  1ZBE 2;  3OD0 A;  3JBG 1;  5FZB A;  4AVT A;  2IXI A;  1JZ4 A;  4JGZ C;  4LA3 A;  1F15 A;  1YXW A;  2ZGM A;  4FQZ A;  4W8J A;  2QQM A;  4R9C A;  3K51 A;  3TB0 A;  1LR5 A;  1MS5 A;  4Y1Z A;  4FI9 A;  1KD7 A;  3ZSJ A;  4QX1 A;  1SEF A;  3PUH A;  5IHR A;  5A3O A;  3OF1 A;  4GJY A;  5FZE A;  1US3 A;  1XND A;  4DZG A;  2WT2 A;  2YRO A;  2VD7 A;  5FMB A;  3KCC A;  2OA2 A;  4QU2 A;  3H1Y A;  2D43 A;  2VMI A;  3WZ1 A;  1B35 C;  4OHZ A;  4LUK A;  5FZH A;  5FYZ A;  5LEJ A;  1AR6 2;  5T50 A;  1GZ9 A;  2VXR A;  1Y9Q A;  5FPZ A;  5FY1 A;  3WXP A;  3H7Y A;  3ACF A;  4CDU C;  2RE9 A;  1CIW A;  3GBF A;  1PNG A;  5EV7 A;  2GAL A;  3I97 A;  3I3B A;  3IZO A;  2P37 A;  1QJE A;  1JZ6 A;  3MLL A;  1NE6 A;  3MGU A;  2XJV A;  1AVB A;  3VZN A;  4BIS A;  2FDG A;  2WAB A;  4MZU A;  2LTN A;  4AI3 A;  3SQO A;  4C91 A;  3BTZ A;  1AR9 1;  1CJP A;  5C3S A;  4I02 A;  1TNR A;  1VBA 3;  2Y0I A;  2PHR A;  1VMJ A;  4G3Y C;  4QHB A;  1APN A;  2ZAC A;  1UY1 A;  3DF0 A;  1RMU 1;  2W1S A;  4OI2 A;  4R9B A;  1R08 3;  3D0J A;  3C7H A;  3TN9 3;  2UYB A;  3NJX A;  4MLO A;  3DYM A;  4IND A;  4BQ3 A;  2EIG A;  2DUP A;  4BPZ A;  2ARC A;  5FJH A;  1RUE 3;  1AYM 2;  2JE9 A;  1W2O A;  1GMM A;  3UET A;  1R1A 1;  4CP2 A;  1YFU A;  2R6Q A;  3CEW A;  2B9V A;  1VMH A;  3HJR A;  2JEC A;  4YFZ A;  4K6B A;  4OCT A;  5FQ0 A;  5BNO C;  4A44 A;  2D3R A;  2W0X A;  1AR9 2;  1LEM A;  4LO7 A;  2VVE A;  1Q43 A;  1V9U 1;  3LDK A;  4IES A;  4JDM A;  1HV1 A;  2CV6 A;  3GGL A;  5IFP A;  4HVQ A;  4CDW C;  1RMU 2;  4QX3 A;  4NIA A;  3D8C A;  4Y26 A;  2AEY A;  2B8M A;  5FY8 A;  4QHO A;  2DFB A;  4AAX A;  1TEI A;  4E27 A;  4AEM A;  2C1F A;  4YG3 A;  4BOW A;  4NMI A;  1FX5 A;  1SBD A;  3VBS A;  4FT8 A;  2VCA A;  3UGF A;  1R1A 2;  1SLA A;  1ZBE 3;  5FPB A;  1KGY A;  5KXD A;  4QKB A;  2Y64 A;  1OPO A;  2PHT A;  3VBR C;  1RUI 2;  3PJQ A;  4FPC A;  2E31 A;  2GZW A;  1IS4 A;  2A3X A;  2XUE A;  2FDI A;  1NQD A;  1C57 A;  3KV4 A;  3NV4 A;  1J3R A;  1GNZ A;  5LY1 A;  3WDU A;  2D3P A;  2PLV 1;  4WM7 C;  1X7N A;  2XLA A;  4FOV A;  3AC0 A;  3RDI A;  5BNP B;  4PT6 A;  2HWF 2;  3N9N A;  4IW3 A;  4UXA A;  4RL7 A;  4YM2 A;  5HI0 A;  3E1F 1;  1KDM A;  5FYS A;  1WA4 A;  2R04 2;  3MW3 A;  1JOJ A;  2A6W A;  3I2G A;  4Z07 A;  2VAU A;  5F3I A;  1X33 A;  2CDO A;  3VV1 A;  1AR6 3;  2OXB A;  1GOH A;  5ERL A;  3JBG 3;  3T1L A;  1C4R A;  1L7L A;  3ZN6 A;  4XFB A;  5HV4 A;  3AYC A;  4CRQ A;  3CKH A;  2ZZJ A;  3I2J A;  4AR2 A;  5FZ3 A;  5DAQ A;  3AP5 A;  4GIQ A;  3IMM A;  2QUO A;  3K3O A;  2WWS A;  3OGJ A;  1QJF A;  5DAW A;  5JIA A;  4S2D A;  2AH2 A;  3AZX A;  1QNW A;  1HN1 A;  3VGI A;  1LOA A;  5A3W A;  5JI7 A;  2WNU C;  2WKK A;  5KC5 A;  4X8N A;  1NG0 A;  2VE1 A;  1DCS A;  1GSL A;  4XTM A;  3NNF A;  1LGB A;  4YVW B;  3VHO A;  3WSO A;  2BWC A;  3AM2 A;  2FMD A;  2Z42 A;  4KWU A;  1NA1 A;  1RUJ 2;  1O7F A;  1CAV B;  1WGP A;  3MLK A;  4XDO A;  4RR3 A;  1PO1 1;  1EPZ A;  3ZFE B;  2XH6 A; 
#chains in the Genus database with same CATH homology
 3W21 A;  2RDN A;  4JZR A;  2RG4 A;  3MGU A;  2Y33 A;  3DKQ A;  4NHL A;  4Y5S A;  4NHM A;  5L9R A;  4NHY A;  5L9B A;  4J25 A;  5LBF A;  2HBU A;  2OPW A;  3PL0 A;  5LBC A;  3ITQ A;  5LA9 A;  3GJA A;  5C5T A;  2FCT A;  4ZPI A;  5LBB A;  5IAX A;  3BVC A;  3HQU A;  4XCB A;  5LAS A;  3OUH A;  5DAX A;  5EQU A;  5DAP A;  5A3U A;  5IAT A;  2RDR A;  2RDQ A;  3EMR A;  4NHX A;  5L9V A;  4XCA A;  2HBT A;  4NMI A;  3GZE A;  4ZON A;  2Y34 A;  3OUJ A;  4UWD A;  3NNJ A;  3KT4 A;  5C5U A;  4Y5T A;  3W20 A;  4XAB A;  4XC9 A;  4BQW A;  5M0T A;  4IW3 A;  4BQX A;  2JIJ A;  4MHU A;  2V4A A;  3HQR A;  4NAO A;  5LB6 A;  2A1X A;  3NNL A;  3NNM A;  2G1M A;  5LBE A;  5ERL A;  2JIG A;  2G19 A;  4Q5O A;  4XAA A;  5HV4 A;  5EPA A;  2RDS A;  5EP9 A;  5HV0 A;  4XAC A;  3OBZ A;  3OUI A;  5DAQ A;  4MHR A;  3GJB A;  5DAW A;  2FCV A;  4BQY A;  5IAV A;  2FCU A;  4KBZ A;  5LAT A;  3KT1 A;  3NNF A;  5DAV A;  3KT7 A;  4NHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...