5A3UA

Hif prolyl hydroxylase 2 (phd2/egln1) in complex with 6-(5-oxo-4-(1h- 1,2,3-triazol-1-yl)-2,5-dihydro-1h-pyrazol-1-yl)nicotinic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
236
structure length
215
Chain Sequence
QTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EGL NINE HOMOLOG 1
publication title Potent and Selective Triazole-Based Inhibitors of the Hypoxia-Inducible Factor Prolyl-Hydroxylases with Activity in the Murine Brain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 55
structure length 215
sequence length 236
chains with identical sequence B, C
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5a3uA00
3GZEA 3NNLA 5LATA 4KBZA 2HBUA 5L9RA 2JIJA 5LBCA 2HBTA 5L9BA 5C5UA 3PL0A 4XCAA 3OUIA 4BQYA 5L9VA 5C5TA 5DAQA 5A3UA 4MHUA 4XABA 2JIGA 5EPAA 4NHLA 4Q5OA 3DKQA 4J25A 4MHRA 4NHXA 3KT7A 3OUHA 4NHMA 3W21A 2OPWA 4XAAA 5LA9A 5LBBA 5HV4A 5DAWA 3HQUA 3MGUA 4JZRA 2RDQA 4XACA 5DAVA 5LBFA 3W20A 4IW3A 3ITQA 5M0TA 2RDNA 3EMRA 4BQWA 4BQXA 2FCTA 5DAXA 5IAXA 2RG4A 2FCVA 3NNMA 2RDSA 2V4AA 3OBZA 4ZPIA 2Y33A 3GJAA 3NNJA 3KT4A 5LB6A 5DAPA 3BVCA 4NAOA 2RDRA 4ZONA 3NNFA 4NHYA 2Y34A 5ERLA 2G1MA 4XCBA 4NHKA 5LASA 5IATA 5IAVA 5HV0A 5EP9A 3HQRA 2FCUA 3GJBA 4NMIA 4UWDA 4Y5SA 5LBEA 4XC9A 3OUJA 4Y5TA 2G19A 2A1XA 5EQUA 3KT1A
chains in the Genus database with same CATH superfamily
1IG3A 2UYAA 2CHHA 3VGIA 4P5YA 2C1FA 5DZEA 2VUAA 5E89A 3ZYHA 2OZJA 4Q2FA 1KJRA 1W6PB 4FPJA 3IAQA 4QPIB 5FZOA 1PGL2 4CSWA 2A73B 1JU3A 2XBO2 4L9BA 4NPLA 4W6XA 1US3A 4YGEA 1K12A 1AZDA 2EALA 1VBB2 2TNFA 4BIFA 3I2JA 5FZHA 4YGBA 3SITA 1TEIA 1HB2A 3THTA 1RHI2 2GH8A 1H1IA 3AMMA 1NA1C 1OVSA 5C9AB 3U0ZA 2R073 2G9GA 2HWF2 1SZBA 5FKCA 5J09A 3BKZA 1JHNA 2ZHKA 1DCSA 3PVNA 4N90A 3I4IA 4EN8B 3DXTA 1J1LA 5ACA2 3FFQA 5FR3A 4XMIA 4B3NA 3S5QA 2D6KA 2BFUL 2D97A 1J3PA 1GP4A 2XJRA 4ZS3A 5J1XA 1GZCA 3KSCA 4NPRA 3K48A 2RS11 3K46A 4IEQA 4JKKA 3M3QA 3TBDA 1HW5A 5FO8B 3ZFGA 1TZOA 2BZDA 2D44A 3I3DA 4A6SA 3AVRA 4JHZA 4IEXA 5FO9B 5A1FA 2TUNA 3OEAA 2EXKA 2AZ5A 1CVNA 3K4DA 5LBFA 5A7OA 1ND2C 2DCYA 2VY0A 4BDVB 5A7PA 2BOIA 5F5AA 1CPNA 5D8AB 4A7ZA 3I2FA 1PZ7A 1FNZA 1FXZA 1MS8A 2BUKA 1WW4A 1VBE2 1VRH1 2A3XA 2J1AA 4W8JA 4XUOA 2FCTA 2JE9A 2RS33 1BMV1 3GZUC 5IAXA 4IV3C 4FCAA 2GN7A 2R041 5IWFA 3BODA 5C8CB 1RUJ3 4FPOB 1UY3A 2VCCA 2WN3A 2XXZA 4MZUA 1GYKA 3PTRB 2VZRA 2UWAA 2AACA 1PX4A 3H1YA 2ET7A 2ORXA 3M70A 4FQ4A 4S2DA 3ZN6A 2VC9A 3WDUA 3SH5A 4GA9A 3QLQA 4UT5A 1DLCA 1ZA7A 1EUTA 2JDUA 3AYAA 3L2HA 2YC4A 2RS13 3AVSA 1RVF3 4L8QA 5FQ0A 4FP2A 3SC7X 1QJU2 4XXPA 1C28A 2FDHA 2VW2A 4CP2A 1LAJA 4C0BA 2P17A 1NCRC 1UMHA 1OH4A 4P9IA 1NCQC 1OF4A 2XVGA 2WNUC 3HNYM 4IE5A 4MADA 5A3MA 5CKNA 2BWAA 1UZZA 1UY1A 3AKSA 5GLVA 4S2HA 2PQQA 4XXAA 1AR62 1K42A 3KV9A 1W28A 1GNZA 2CWSA 3LB9A 3N9PA 3VBFA 1S0IA 2FCUA 2WNVB 1O59A 2ARCA 1OA4A 3LGRA 2VMCA 4UI9L 3ACHA 4GWMA 3A7QA 4ASLA 3K4ZA 4MXVA 4AI8A 5JSRA 1G9BA 3N3HA 4LBQD 4Y1VA 2RS52 5FZOB 1WD4A 2E26A 3AZWA 2JDPA 4EJRA 3WG4A 4YZ5A 1QQP2 5DPNA 2VR4A 4GH4B 3J8F2 4N7IA 2ZGPA 3ZXFA 1H4GA 4INDA 4IE6A 2ZGSA 2VOKA 4FT8A 4BQ5A 1X33A 2VUJA 1W3XA 4G3YC 4Q1PA 4XYXA 4BK4A 2DVFA 2XL9A 5ABJC 5CG8A 1W2TA 1RUD2 1JODA 4QPWA 4OI0A 1NZCA 1G86A 2R16A 3ZSMA 4Y22A 3KF3A 5GZDA 1W39A 2D3RA 2JG9B 1VMHA 4HT1T 3DXUA 5FRAA 2ZEZA 3ZFGB 4D8MA 1DQ1A 2BJSA 3RFRA 4XJAA 4OUEA 2VMIA 5C70A 3I2DA 4JVAA 3NJZA 4QWNA 2P2KA 4D7TA 1GWKA 4ZU5A 5F2WA 3HQXA 3BGAA 5JXHA 4PCRA 1D4M1 5J3UA 2H0VA 5BNNC 1COV2 3HQUA 4JZRA 3WNXA 4AVTA 4QM8A 2VZQA 1V9U2 1YJKA 5M0TA 1OURA 3OTFA 4M3CF 1KFUL 1JZ7A 2W1SA 5DUXA 2DUOA 5IUQA 5LA2A 3MPBA 4WZFA 5F5QA 5I8YA 5HXMA 2YZ4A 3K3OA 1DGLA 5EYYA 2XHKA 2XQXA 3W58A 1O3SA 1S0CA 2GMMA 1BEV1 4IV1C 1AVBA 4QPGC 2DU1A 2YV8A 4Z82A 1IQDC 3ZXEA 1OUXA 1JTZX 3MZHA 2JE8A 4XPVA 2RG4A 4YLZA 4YARA 1XPWA 1BBT3 1F4AA 2FCVA 5LA1A 5IK5A 2RV9A 1RUC3 1NY71 3L2YA 2BOJA 2HEWF 2JDMA 3JU9A 4LO4B 4PF1A 4U2AA 2V72A 5FZEA 4A7KA 2FQPA 5FWJA 4E4SA 3DYOA 1RINA 1IHMA 3FMGA 2K0GA 4IEVA 5JAXA 5JLVA 2NLRA 4AAXA 5J7MA 4PI2A 3V0BA 2D6NA 3WZ1A 4LO6B 4FTBA 5C3OA 1V0AA 3FLTA 4KGGA 1UX6A 2AEZA 3MIHA 3TN93 3W9AA 2F17A 2Y6GA 1D4M3 3POYA 2HLEA 1FATA 2DYCA 2DUQA 2ZGQA 4D7SA 3J7HA 2VL4A 3PNAA 2GU9A 1LHNA 3M4FA 4D69A 3WNLA 3MPPG 3T1MA 3VBOC 4XCBA 2VTXA 2WJSA 4XTPA 2QJVA 5FCCA 5KXCA 3OPTA 2VNGA 4JX0A 1YRZA 1R1A3 1RIRA 4A44A 1S0FA 4M0HA 1AJKA 1KEXA 1PZ8A 1RUI1 3O1SA 4Y4RA 1JYCA 2E7QA 4KQ7A 1UIJA 3BTAA 4KWUA 3AP7A 1HLCA 2A6WA 3IAPA 4COWA 2PYTA 3H3LA 4HG6B 2V4VA 1XE8A 5LY1A 4OHYA 3ZFFA 1J58A 1HV1A 1RUE2 4RR3A 4YPJA 5A6XA 4Q4Y2 3PTYA 5FYHA 2XB6C 1UXXX 4ZY9A 2GZWA 3EJKA 5B4NA 3H3UA 1AF9A 4XTMA 3GM8A 4EZ4A 1L7RA 1HB3A 3KB5A 5I93A 4JGZC 5I0DA 3AZYA 2HEYF 4N8MA 5CEHA 1AL23 2VQTA 5FXXA 4IXLA 3I59A 2W87A 1FYUA 4DXSA 1G9CA 4MVTA 5L9BA 4Y22B 5C5UA 1W8ZA 3JB4C 5CVRA 4C1WA 1GQPA 3JUUA 4GJYA 3KVBA 1YWKA 2JD4A 3ZPYA 4P9WA 4CCOA 4DEQA 3DF0A 2A3YA 4N53B 1HQLA 1OF3A 2OZ6A 1G8WA 1UKRA 3JXSA 2JKXA 3POJA 1GKBA 4Q8LA 2VZTA 5FMOS 3RMYA 1EV12 2TEPA 4Y5Z0 1TME3 1YUDA 2FDGA 4LE4A 3U1XA 2UY8A 3GHNA 4IEUA 4LO7A 5IYYA 2AEYA 3EHKA 2P6CA 2YHJA 5FYUA 5LEKA 1HXS1 1WLCA 1NA1A 1WW6A 4XFCA 1H4HA 4Q29A 4DUXA 5JI9A 3FN9A 5A33A 2VZVA 3RI9A 5L36A 2OA2A 2XJSA 2ENRA 5LA9A 3VKNA 5CBLA 1JZ8A 4A3ZA 4CUBA 2DDUA 1PGW1 4CUCA 1Y9MA 1YQ8A 5JR7B 1WMFA 4NRQA 3OJBA 5LW9A 4D7YA 1UD1A 2XMLA 1UMIA 1Y9GA 2Q8DA 1PO13 1VAKA 3KHBA 1ZBE1 2KXLA 5FLJA 4KL1A 3KZ4C 3DYPA 4LA3A 1MVQA 2CDPA 1E5SA 4LHNA 1ND2A 3BN6A 2D3PA 1JI6A 1FMD3 2R061 3UJQA 1EUUA 3N7LA 2LTNA 3D0JA 3CEWA 2RMU2 3Q8EA 4NE9A 1XU1A 3T4HB 2HWB2 4BOWA 3POSA 4UFLA 2VVFA 3NNMA 2IUWA 1N1TA 2V4AA 4QMAA 1UZ0A 2ZTNA 3SEEA 1SDWA 3OPZA 5FZ4A 3AM2A 5HPOA 1PMJX 2WAAA 2XJVA 3HVDA 4I3GA 3UK9A 2PFWA 3N7KA 3WF0A 2DVDA 4XJZA 1VMFA 1QNWA 2FBEA 2IXJA 2ORZA 2BEOA 3ETPA 5HCFA 5GKAC 3WUDA 4BK5A 2DVBA 3ZSLA 3NAPC 1RMU2 1BVP1 3ETQA 1RITA 2WQ4A 4BU2A 1S1AA 5HCAA 4FAHA 3OB8A 4CPBA 3KF5A 2W1QA 1NX9A 2QUOA 4YW4A 1AR82 4CDXA 2BBVA 2YBKA 2PHFA 2VXJA 5ERLA 4KMQA 1DGRA 2E51A 4AI3A 4ZZ8A 5JXJA 1O8PA 4AVBA 4Z07A 1ZBE3 1W3VA 3IDAA 2VZOA 3R6SA 3M2MA 1NCRA 1ZRIA 4ASKA 1IS6A 2J1UA 2NMNA 2QZ3A 2R072 2R1BA 4JTNA 5F3CA 1H6YA 1ODNA 5E88A 1HRI2 1Z7S1 2WNUA 3BB6A 3ZFFB 4K40A 3ZSKA 4FP3A 4FPKA 2L9LA 4PDWC 3D82A 1UIKA 4L2NA 1UQXA 2EICA 2AGSA 4BMBA 3WW4A 2JG8C 1CIYA 2YGLA 2DVGA 3BUCA 1RUF3 1KRIA 4IGOA 1AYM2 2BGPA 3SXWA 3I59B 1H1AA 1H2NA 1DQ4A 2XHNA 5GM0A 3NQHA 4JGYC 4PLOA 3OBTA 3IZOA 4XFAA 4DY5A 2ZOEB 2P3IA 5L9RA 2D43A 3D4KA 3N9OA 3QH6A 2JX9A 4MYEA 4XJWA 5D2AA 4YZ1A 2X29A 1N3QA 4F83A 3WF4A 4ASMB 2XLFA 3T0DA 3Q8FA 5GLWA 1QJEA 1CAXA 3PL0A 4O9EA 5BNOA 2VU9A 1VBA3 3OD0A 2PHLA 3OUIA 3DEMA 3R4SA 1HN1A 4AHZA 3MFCA 4JQRA 3ALQA 2XLGA 2DCTA 2YDEA 4XW3A 1O3RA 3FE5A 5C4WC 5A3UA 4LHLA 3VBUC 5ABJA 4V1PA 4YVSC 1UOGA 2IWGB 2RJKA 4Q5OA 4X8NA 3AP4A 4YW1A 1AXYA 1Z7S3 4E9KA 1IZ3A 3DKQA 1WWYA 3A22A 5FP7A 4AE2A 4Y1UA 2I07B 3HD8B 4P00B 3VZMA 1TQ5A 4GZ9A 3W21A 3CU7A 4R9AA 5A6ZA 5A6QA 3VBHC 4RQPA 2WT0A 1R1ZA 5FREA 2HWD1 5H9SA 5IHRA 2RS12 5FZ9A 5DAVA 1QXPA 1YLLA 4RGAA 5A32B 5KC5A 2D40A 5CZKA 1U5XA 3LDKA 4B4PA 4UW4A 2JDZA 1WA4A 3ZYFA 2GALA 2QE3A 2C5DA 1OD3A 1IG0A 5BNNA 1FPN3 3RZJA 1N3PA 5FXWA 1VE0A 2VCMA 4GMP0 4QAWA 5KHHA 1ZBA1 3ZXDA 1XYPA 5CIRA 5T5LA 1DQ2A 3NJYA 3EQEA 4DO0A 1S4CA 1VRH2 4O65A 5JZGC 5T52A 4Y3OA 1W2NA 3J26N 2YY1A 2CU5A 1BMV2 3RRDA 1R083 3M8LA 1SCSA 3ZXJA 1T6GC 2R042 3OBZA 4Y20B 1G9FA 1XSQA 4ZPIA 4IV1A 4QPGA 5AC91 4CU8A 1W9FA 2G9ZA 3MEPA 5FAXA 3TB0A 2NZ9A 4FPFA 1CESA 1E57A 2JDHA 1NQDA 4QDQA 2AH2A 1VALA 2JB4A 4HVOA 4CDWC 4F7ZA 1ASJ2 4AHXA 4CDXB 2E32A 3VZOA 5FYCA 4RN5A 4ORFA 1BK0A 1NOVA 2HWD3 3MUY1 2VMDA 1UXZA 4NUBA 3WINE 3NNFA 2YPDA 4CU7A 1NCRB 4NHYA 3RYPA 2O14A 1JYVA 1R091 1F15A 1JZ2A 2WNUB 4E8DA 5FY0A 4Q0UA 3B9CA 1W2UA 1C5HA 1QIQA 5J48A 2YB7A 3VKFC 4FFHA 3TYJA 4AQTA 5BY5A 5FZ8A 2Q30A 4CE8A 2K2SA 2P1BA 1ZM1A 3Q9OA 4CCJA 3ENRA 5EIYB 3VBOA 4UFMA 1C8M1 3HWJA 1MS0A 2FZ1A 4AQSA 5DG2A 4XIKA 5AVPA 5K0UC 5FYSA 2PLV3 2A1XA 5EQUA 3BU0A 5F6LB 5JMCA 2ZS6B 1UCXA 1RUG2 2QCSB 2PHDA 3HN1A 3A0NA 4HK9A 4P08A 4COVA 1CAXB 5J98B 1W8TA 5DDJ1 5BNOB 5FK8A 3EYPA 3NW4A 5BNPB 1DG6A 1YFWA 3VL9A 2WS93 4AVAA 2LALA 3N9MA 3ROUA 4W6YA 2HJIA 3KQRA 4XQ4A 1WMDA 2WYFA 3T08A 1GV9A 2QQVA 2VVEA 2VNOA 4NIDA 4JGZA 3MHZA 3Q8CA 3ZDSA 5F9TA 3WCSA 1JZ3A 1KQRA 3E6BA 3E97A 4NJ4A 2R0FA 2G4IA 4V2VA 4KG0A 2JIGA 3D0SA 3RWKX 2XJPA 3ACIA 1YNAA 4IUGA 1VBC3 2VE1A 4BQ3A 1I1EA 4RQPB 1CPMA 2GC1A 1UN1A 3I49A 1FV3A 1W0OA 4NHXA 3VHNA 2XKOA 1NG0A 1YQ5A 2W95A 1A78A 1LOAA 1QWRA 2ZMKA 1OSGA 1HN0A 4XFFA 4CEWC 3BTXA 5D21A 1SBFA 3D8CA 3DCQA 4U36A 3SEPA 5BNNB 1ULDA 1H30A 5FPZA 4D6RA 1D4M2 5DDJ3 4JDOA 2BERA 4P9JA 2XPJA 4X6RB 1OPMA 1OA2A 1XOYA 2J1VA 4UFJA 2JENA 4EWEA 1CAUA 4PQQA 4M00A 3TEZA 3RZGA 1S55A 2JECA 3LA2A 3HMYA 1DQ0A 3I2IA 3LCPA 3LSDA 5HCHA 1J3RA 1D0HA 4GQ7A 4QPGB 2WZEA 1DFQA 4AI1A 3I97A 4LIVA 3ILNA 3KWVA 2UWBA 3PIJA 2DU0A 1BEV2 1H6XA 2V09A 4AFBA 1APNA 3A4UA 1UX7A 1GOGA 4FXGB 1WCKA 1AR73 2JJ6A 5FLHA 3PU3A 2FDJA 1VMJA 4AEDC 1MVEA 1HB4A 3T4VA 4AHWA 2VMGA 1NY72 4ITCA 1GP5A 2HYXA 4BB3A 2HWE1 2XH6A 2ZKLA 1BQPA 4DRVA 2EIDA 3FUOA 4I3PA 1H0BA 3PUSA 2OUHA 1GICA 4GJZA 2B5HA 5I0RA 1HJGA 5BV6A 1SFNA 2OKXA 4Q4V2 4FOWA 5IK7A 2F6BA 4AK3A 2W94A 1RTVA 3LEMA 4N7UA 3CZJA 2UU8A 2ZHNA 4LMFA 4XJUA 2WLPA 4QX3A 3NAPA 4BH9A 3MIDA 1OLMA 4K21A 3J7NA 2D3SA 3VBOB 1U5IA 2H0BA 1IS4A 3H50A 4LLFA 1LHVA 5CFDB 1UKGA 4IL7A 3VLBB 3VBSC 1CGPA 1SBDA 5JXGA 5FPBA 5A7WA 1BHGA 2R32A 4IESA 2B9VA 2OQ7A 2BGOA 4XE9A 4Y24A 4YYOA 2J1RA 2QDNA 2QQMA 5FY4A 2XWBB 2R1DA 4GWNA 2XDVA 1AJOA 3CQOA 4YVWB 1KS5A 2OS2A 1RUI2 3BI3A 3C8XA 1C1LA 4TN7A 3AYEA 1WA6X 1LHOA 5F39A 3JBG3 1H8TC 3WV6A 1AX2A 5C3PA 4PDWA 2AYHA 1O4YA 2OPKA 3RNSA 3I3QA 4GMP1 4AAPA 2JG8A 1PMHX 4MGZE 4NIIA 3DGTA 2VUCA 4O9GA 2HWE3 2WZ8A 4QQPA 3MF6A 4X6QB 5IJRA 1W05A 3UJOA 2RHPA 3WP5A 4BLIA 4JGYA 3ZIWA 2VZPA 1DQ5A 1Y3TA 1W2AX 4J1WA 4L99A 1NUKA 4LT5A 2DFBA 2BW8A 1CQ9A 1MPXA 3IMMA 1K5JA 5CYYA 1JMUB 5IK8A 2BYVE 5A3LA 3B02A 3WG2A 3KHCA 1N3OA 1OQEA 1LEDA 2DUPA 3LOBA 1QJFA 4M3CE 1SEFA 1JOBA 2WAOA 2XVLA 3I2HA 5FMDA 4EN9B 1FT9A 3VHPA 2WUHA 1ENXA 2GMPA 3PLQA 1AR93 3ACLA 4YNIA 5A3TA 4Q4W1 2FD8A 4NRPA 2A70A 3K3NA 4MOAA 2JWPA 3TWIA 4CDQC 1S0BA 3MV01 2QTWB 5C4WA 5IT6A 1GU3A 1UO9A 3VBUA 3O1MA 4YVSA 4EWAA 1HXS2 3H1MA 5SV8A 4FTSA 3C7GA 2CAVA 2YYOA 3FC0A 2BBAA 2RS31 3PHMA 3VL8A 1GNHA 1CAUB 2IXCA 4LNVA 1CX4A 5EV7A 1UYZA 2Q8CA 3KV5A 1O3QA 1ZRDA 3QH7A 1CAWA 4GMP3 1RUJ1 1H2MA 3OGVA 2Y0IA 4WVMA 3ZKUA 1JYNA 3RZHA 1KS4A 2VBBA 1PGW2 2WFF2 3VBHA 5L73A 3I3MA 5C6CA 1UYYA 1JYXA 3IDBB 5A3WA 1F35A 1OH3A 5DXDA 3TEXA 5JCTA 4YG6A 5KXDA 1E5RA 1SACA 1UOBA 1ZBE2 3OBRA 3RMXA 4XMAA 3LE0A 4K6BA 5T50A 5I0SA 2ZKNA 4ISRA 3O1TA 1JZ4A 3HJRA 1RVF1 4PIXA 1Q56A 1WCUA 3ILFA 4LJHA 2R062 3GYDA 1JN2P 3CF6E 5K9YA 3CZUA 3ZKYA 4NWWA 4PBPA 4ZKTB 1IQAA 1JXNA 4RFRB 3KT4A 2Z79A 3N9LA 4H7LA 5ANNA 3T0BA 5JZGA 1XNBA 5JXIA 4Q4W3 2NYYA 4CEYC 1LGCA 4QX7A 4JKMA 4IEWA 4NRMA 5GLTA 5DAPA 3BVCA 5BUVA 4QDRA 1LOCA 5CAZA 1MEC2 4LO5B 2NN8A 2WO7A 1AX0A 3J4UH 1LNSA 2A6ZA 1HRV3 5FMBA 3HT2A 3WDVA 4CDWA 1SLAA 2WSVA 2J1EA 3AK0A 4LA2A 4DQAA 5FZIA 5JMOA 2JD9A 4RS5A 4H55A 1GR3A 1MZFA 2VZSA 3NV2A 5H9QA 2NQYA 5LASA 2JXAA 3FLRA 4XDOA 1W8NA 4M3CA 2EXJA 3M3EA 3VD7A 3HN3A 1W6MB 3VV1A 4DUVA 2DCZA 4FPEA 2WZPP 4Q27A 4UWDA 4EE2A 3I3EA 2GN3A 3IPVA 4I0BA 1RUH3 1XE0A 3DPRC 3R0RA 4Y5TA 2J22A 3H8UA 4D6SA 4LQRA 3NSTA 4PT6A 4BPZA 4N43C 1Z7S2 2JG8B 4GD4A 3RDIA 4A45A 1D2SA 4GALA 3U4XA 1D7PM 3LIHA 3GZEA 2C0ZA 5C7GA 3LA7A 4Z1VA 2EIGA 2FDFA 3KGZA 4QXKA 4JGYB 5FLIA 4KWLA 5LATA 2AC1A 3B93A 4KBZA 4Y1ZA 4IEOA 1DP0A 2LW8A 4FQZA 4YRDA 3WNOA 2HH9A 2WZR3 2EA7A 3UKTA 3P3NA 1NLQA 4OYUA 1DHKB 1KITA 3MUZ1 5JOZA 5APAA 4A4AA 2CL2A 3ZYPA 3POEA 1HQNA 4LPLA 2GNDA 3CJXA 1DIWA 5FK7A 2QQUA 1JUIA 1SLCA 2QNKA 2VGDA 4DRRA 2A6YA 1MZ6A 3CDZB 5C5TA 3AYCA 1X50A 3PIGA 4PLMA 2C26A 1MZEA 3ZYJB 2DTYA 2Y60A 4M4PA 1G9AA 1EAH2 2PXJA 2JEMA 5JWPA 2ZGTA 2PELA 4HVQA 5C4WB 1JZ5A 3JD71 1QKQA 3MLJA 5KR7A 5EJ3A 2Z42A 4YVSB 1WLTA 2VZ3A 4AWDA 1ZZ7A 1OQ1A 1ZZ9A 3AZXA 3GBGA 5CG9A 5FZDA 4NHMA 5IVVA 4R9DA 5EFUA 3MI8A 4AEJA 1CAWB 3VDBA 3WQ1A 1Q8QA 4WVMB 1WW5A 4RFT0 1OMIA 4RD7A 2XVKA 3VBHB 3RJ2X 4I0AA 2ZZJA 1SPPA 3N9NA 3UGFA 2HWD2 2WABA 1ENRA 1BBT1 1Y43B 4COUA 4CEWA 1RUC1 2WQ8A 4BQXA 2DCKA 4QX2A 1ULPA 4FAGA 5FZCA 3O12A 1QJY3 5CFCC 1IPJA 4AFCA 3U78A 4Z92B 5IFTA 2ZABA 1DDLA 3PVBB 3BPSA 3KCXA 2Q0AA 2YROA 2OVUA 2ZMNA 4HMZA 4Z2AA 4RL7A 5JZGB 1ZBA2 1PK6C 1XNAA 2X5IC 3TN91 3WW3A 4BQ4A 1VBD1 1YQ2A 3KV4A 2W91A 3JD73 3NNJA 4C0HA 1OOPC 1JUHA 2O1QA 5AFBA 1D0GA 2ZX1A 4K3UA 2DURA 1V00A 4CP1A 5AC92 3M3IA 1Q8PA 2VULA 4TYSA 5A1AA 2BWCA 5GALA 1N1YA 1L7QA 1R1A1 2RDRA 5FMOL 1DZRA 1XNDA 3AKQA 4RS5B 3ZXKA 2WWJA 4AEDA 4MLOA 1X9TA 3HBZA 2VOVA 3ZN6B 4M3CB 3WNNA 5F37A 2YBSA 1UZWA 3WHTA 3UNPA 5CU1A 4FFFA 1J83A 5IVJA 1MQTC 3AXEA 4IEPA 3P6BA 5F6KA 3IPVB 4CDUC 5L7OA 5DG1A 1R092 4QX8A 2OYZA 3HT1A 3INAA 4FI9A 2W0XA 4LHSA 3GJBA 5FQ0B 4BM8A 4GKYA 3U37A 1A6CA 2OW4A 4UBHA 4FFGA 4BLJA 3OUJA 2IFWA 4OVEA 3IB3A 2RE9A 4COYA 3VD4A 1AL21 5I0TA 2Y0OA 4IETA 3M1HA 3ON7A 3M3CA 4M0NA 4R4ZA 5F8PA 1BVVA 1DYOA 3LA3A 5LY2A 4AXOA 2PHTA 4YM0A 4EROA 3VBSA 1O3TA 3NV3A 1VBD3 4YW6A 4R8HA 1C8M2 4WM7C 3BALA 3AZZA 1L3JA 2A71A 2J42A 3VBFB 4OMDA 3H0OA 1GFF2 2WKKA 1TME1 1H9WA 3WP6A 1IKQA 1UOFA 1CIWA 3VDDC 1DYKA 1H8TA 1W8HA 2XJTA 5FTTC 2W92A 2C9KA 2AENA 4RGGA 1I9RA 3ACFA 2HEVF 5FMCA 1VRBA 4TSVA 4RYDA 2VO5A 3ZYRA 2WSUA 1LHUA 1YFYA 1YQ6A 5LEJA 4Y1XA 3T3YA 2CNAA 3WDXA 3UV9A 3DUIA 4A2UA 1URXA 1A34A 1B09A 4OULA 2EXHA 3W5NA 2ZX0A 4DXZA 4J25A 4XBQA 4DEVA 3KD4A 4A6OA 4ARXA 4E27A 4UBGA 2ZA9A 5IK4A 1PO11 2B45X 5FYTA 5DZGA 4CCEA 4FPCA 4CXYA 1D4VB 4N9IA 3B94A 1YC61 1AX1A 2VJXA 3ZVXA 3J7MA 5LBBA 5HV4A 1LHWA 3MGUA 5FZ0A 2RDQA 1FMD1 4QKNA 2QQJA 4OHWA 1OD5A 2CYFA 4CDQA 3P5BA 3H7JA 4LULA 1SBEA 4D0QA 1SCRA 2Y6HA 2ZGOA 4YZ3A 2IXLA 5FZMA 1GQGA 5FP4A 1B35C 3RYKA 3IN9A 2PAEA 4HZFA 4P02B 4RSUA 4ZU7A 3VDAA 3BOWA 4CCMA 2GDFA 1XXNA 1XC6A 4B4QA 1VLNA 4GWJA 4AYUA 4MGTA 1PNGA 2ZX3A 4K8RB 3WQ7A 3B5LB 3B7MA 3BTYA 2ZEYA 4XEZA 3AL6A 4Y4YA 4ES8A 4AVCA 4URAA 2JDKA 1CONA 2GNMA 4Q4X3 2ZXQA 1LTEA 3UETA 4NIHA 3ZIXA 2Y33A 4QDSA 4V2WA 3BYWA 1ACCA 5T5JA 2E53A 3GCWA 3RYRA 4AEDB 3AJZA 3ILRA 3AC0A 1DU3D 4MGIE 1WD3A 3JQWA 1XE7A 3PJYA 1PX3A 5C3SA 2P4EA 4LBNA 2HWE2 3OOXA 5L7OB 4RA0A 2UYBA 1XB9A 4TLFA 4W6WA 5FUPA 1HKDA 5JPMB 4FPHA 2FZ2A 1RHI1 1XNKA 3WT3A 1RUF1 1V6NA 1LODA 2IZWA 2WYSA 3V0BB 3HQRA 4HLTA 1LENA 4BCUA 5F3IA 4IV3A 4AL9A 3WX5A 3VBRC 1LRHA 4GB33 1ZREA 3VBSB 2ZJCA 3ZXGA 1RUNA 1ZNPA 1UPIA 4XBLA 3RWNA 3HEIA 2G19A 5I0UA 1GZWA 4K20A 3NV4A 5FJHA 4AGVA 3KT1A 1VBA1 1H2KA 1W9TA 1ZRRA 5DZFA 1FI2A 1LCLA 2WQZC 1H8TB 3T09A 3DPRA 2E6VA 4IGQA 3CNAA 3ZDVA 1W0PA 2VD7A 5FY8A 2ETEA 2Q8EA 5IVCA 1LJ7A 3GNEA 4N43A 5EJ1B 1YJLA 3ZXAC 4UW3A 2UURA 4UFKA 4EN0A 3ACGA 5E8AA 3UESA 4AFDA 3OYWA 1VBE1 1CAVA 1NCQA 4NO4A 4HFSA 4BQ2A 1WMXA 5A7QA 1VBB3 4B4RA 4RR3B 3ZPOA 1CN1A 4QHBA 4J6GA 5JIAA 1RHI3 1CWPA 2P3JA 3GZTB 2YXSA 4EZHA 3VD9A 3ECQA 4J1XA 4XHBA 3T2TA 3WW2A 2VMFA 3BU7A 4W65A 4NWVA 5ACA3 2BVBA 4NHLA 2ZBJA 4YW7A 5C8CC 2DV9A 3GGLA 4HETA 4XUNA 1X8MA 5B2GB 4LLOA 2HWC1 1OLQA 2QQLA 4H7MA 1PNFA 3VD3A 1W04A 3EBRA 3KV6A 5DUUA 3S6PA 4CDQB 1LEMA 1QH7A 1DGWX 2NM1A 1FPN1 3C7EA 4HN1A 2X05A 4B7EA 4CA9A 3NJXA 1QJU1 3AZVA 2D6LX 2XGXA 4YFWA 5FZKA 2XONA 1JS9A 2Z5WA 2GC3A 5F5IA 2VOXA 1STMA 3N9QA 1N47A 3LZZA 3R4DB 2RS32 3EMRA 1R081 2YGMA 2EF6A 1NA1B 1I3HA 3V0AB 2WNOA 2E7AA 3UYJA 5A33B 3I2KA 1RUJ2 2GAUA 1VBE3 4QGLA 2UWCA 4COZA 3AP6A 1FX5A 1DZTA 1PO21 3AXDA 3S7EA 2DCJA 2ZAAA 1US2A 2C4XA 4WVWA 2FDIA 2QBXA 3ZN5A 1C3HA 3VHRA 3ZOIA 2RDSA 4IEYA 2EIBA 4IQPA 5CFCA 1SHWB 5EYXA 3L9JT 2PHXA 4SBVA 5DUVA 1RVF2 2ZX4A 3B00A 2RS51 4QU1A 4QKFA 1F8VA 3JCIA 2GP5A 1A8MA 2HWC3 1ND2B 2W1WA 2WR9A 4IGPA 4XURA 5FFOC 1V6JA 1PK6A 2X5IA 1O7FA 4K1ZA 5LRRA 1U5ZA 3QACA 4UW6A 2B9UA 1OOPA 1G9DA 1PVC1 1QJU3 1NE4A 5T54A 4GH4C 3FFZA 4E4HA 4IV3B 1W06A 4GXLA 1SLTA 4XILA 3RSJA 3WP3A 5I91A 5FZ7A 5FDBA 3FLPA 2AUYA 1O4TA 1LOEA 1OA3A 5KHIA 3ZMOA 3K4AA 2C9AA 1V6LA 2PLV1 3AP9A 5IAVA 3ZYBA 1F5JA 3RJRA 5JPNB 4IE0A 2WFPA 3O14A 2I74A 4ZZ5A 4FVVA 2JG9C 1MQTA 5FV3A 1PO23 3ZFGC 4MSVA 1UU4A 4CDUA 2WS91 3OF1A 4XUTA 5A7SA 3T1LA 4N43B 3SISA 5F3GA 4JRAA 4E2GA 4LORA 2RS53 4DXRA 3EXUA 3GXUA 3LEIA 3OYWB 4NROA 2YFZA 4OHXA 1UMZA 2A6VA 1CAVB 1NCQB 2ZACA 3NKGA 4W4ZA 1K5MC 3B3QE 3WF1A 3I2GA 4AQ2A 1WW7A 1W8FA 1QQP3 2B8MA 2CWMA 4HSJA 1N1VA 1A3KA 5EJZB 1X82A 2SBAA 1VBC1 4OCTA 4WM7A 5JOWA 2MHFA 4IDZA 1BK1A 1PVC3 2I2SA 3O5SA 3NV1A 1AUYA 2XOMA 4NN0A 3GALA 3PDQA 2BQPA 2P6HA 5L9VA 1C4RA 4YM3A 5KWRA 5JVVA 5LWBA 4MO3M 5GLUA 5EZWA 1RUD3 5AVAA 3VDDA 5JOXA 3TOJA 1CD3G 5DAQA 1IS5A 5A3NA 3HNMA 5EPAA 3GCXA 5DMYA 1UAIA 2EXIA 3E1F1 2EAKA 1QF3A 3ME2A 2N7GA 4XFGA 1W8UA 3KT7A 5LK7B 4HOOA 1F5FA 3N35A 4PLNA 4LUMA 4YWAA 2Q8OA 2OUJA 1ULEA 4MGKE 1X36A 3BTZA 3WEZA 3P3PA 1XBFA 1TNRA 3AMPA 2UY9A 1YI9A 4KGQA 4OZXA 1Y7BA 4PIYA 4URTA 1COV3 1DQ6A 2VZUA 3MBWA 5ABJB 5FJKA 3RI8A 1SFPA 2V5YA 4DINB 1OLME 1V9U3 3TNPB 1SMVA 3IIAA 2X53S 4XFHA 1AR71 5GJ6A 3C2UA 4JCKA 2ARAA 4KWKA 3ZSJA 1BBT2 5CFCB 4MX3A 2BTVC 4F3JA 3HR9A 3GBWA 1RUC2 3P1IA 5C71A 4Q8KA 3LPGA 1IOAA 4QD2A 4YW2A 5FZGA 1UF2C 5JUVA 3SHRA 4XDQA 1Q8SA 2IFRA 5IVYA 3USSA 5FO7B 3AX4A 4NVPA 3ZX7A 3ES1A 3G6JB 3ZYGA 4Y1YA 4YGCA 2VOTA 2Z69A 1QJX1 1GMMA 2MNGA 3TN92 2W1UA 1VBD2 5FPAA 2NMOA 5IW0A 5AFEA 5ISLA 5FP3A 2WRAA 1REFA 2PA7A 4QGNA 1F9KA 1DZQA 1X7NA 4Q0SA 1G6NA 2ILMA 2X10A 1QDCA 4XDPA 1PGSA 4IV1B 3LF7A 3RQ0A 1R1A2 2AREA 2G1MA 5EHDA 4QU2A 3WNPA 1MQTB 3ZR5A 2W3JA 4N53C 2ATFA 2LM3A 4CDUB 4IE4A 5A6YA 3JBG1 2YBPA 3JZVA 3U10A 2Q5TA 3FBMA 3POFA 1ONAA 2VQUA 5J37A 3LQCA 2YU1A 2IVIB 2VQAA 4G4FA 2PHUA 3KVAA 4LBMA 3T2QA 1CJDA 2CV6A 3OG2A 1ZZBA 4KH9A 5F32A 3VBRA 3CL1A 1AL22 1PM4A 1ZZ8A 4KU7A 1LOFC 1SG3A 4LKEA 1QJX3 4WM7B 5FPUA 4Q4Y3 4AI2A 2ZMLA 4D6QA 1Q5OA 4LK7A 5G04L 5H9RA 4R4XA 2HBTA 2SLIA 4K9SA 4Q0PA 3U4SA 3SCHA 2JICA 3W59A 2WL1A 5FY9A 3CIHA 3VDDB 4NPMA 3CLPA 1AR91 1U5YA 1TMF1 4XCAA 5FPVA 3BOPA 4JHTA 1S2KA 4LBJA 1TME2 3RGBA 5F5CA 4LXLA 2XR4A 2F4LA 2EVXA 3OGGA 5I8TA 1BLZA 3PMSA 3LAGA 3LEKA 4KU8A 2E31A 3LWCA 1VIWB 1O91A 4LBKA 2RMU1 3ZR6A 3T2PA 4C8DA 4XQDA 3UT0A 3O7OA 4SLIA 3S5AA 3OGSA 1PMIA 5LCWL 2YU2A 3C3VA 1T2XA 1VR3A 2KM2A 3HIFA 3I54A 5FYZA 5KHJA 1UU6A 3MW4A 1EP0A 2QVSB 2OPWA 4Q26A 2Y6KA 5KXEA 4JGZB 2VQ0A 5KHGA 5FKBA 4PJYA 1H1MA 4LR4A 5FZBA 1Z0HA 1ULOA 5C8CA 2QQNA 4XACA 3ZFEC 1PIV1 1JHJA 1PO12 5FXZA 4YW5A 2BNMA 4HL0A 3PU8A 1JYWA 4XOGA 3SKVA 3VD5A 1HDKA 4I2OA 4DOUA 3SCFA 1CZSA 3AMNA 1AR81 2DBNA 4XUPA 1FMD2 1MS1A 4LBOA 5FZ3A 4I09A 3PJQA 3OEBA 1WMEA 3UGGA 4DNYA 5FZFA 1UYPA 4CU6A 1XSRA 3BIWE 1TMF3 4MGSA 1YQCA 1DGRN 4GKXA 4QM9A 4BA6A 4H14A 1Q8OA 4M4RA 5BXXA 3OCPA 4QB1A 1GANA 1NYWA 4ZU4A 4R9CA 4JTOA 4MGQA 2FMDA 5FYMA 2QQPA 2RMU3 1TNFA 4AVVA 3AMQA 3RG0A 4XF9A 5F1RA 4QX5A 3FZ3A 3AKTA 1V70A 1HRV1 1BYHA 1GQHA 4FBFA 2ZZQA 3MICA 4MH0E 3TEWA 4BHPA 2D93A 4OHVA 3VZNA 3WDWA 3ST7A 4XF4A 4RGKA 4BYYA 3O1PA 1RXGA 3I8TA 4QQLA 3MFAA 1QXJA 2E33A 1K3IA 3FX3A 4XQWA 1ND3C 3WSOA 2WNEA 4TTGA 4NIAA 2P34A 2GNBA 4P14A 4Y26A 4CYDA 4PBOA 1RMU3 1BZWA 3OD4A 2CSGA 1PIV3 4BMEA 1GLHA 2PQSA 3Q8BA 1RUH1 1GP6A 1OKQA 4MUVA 2WT1A 1AR83 1OQDA 3KMHA 1W6OA 3K77A 1IPKA 2BV4A 4QQOA 1DGWA 4CPBD 4FTEA 1YFXA 3B01A 4GH4A 4JRLA 5E6HA 3H8RA 3WP4A 1RUF2 2LROA 3VBRB 4UF0A 4RHV1 3T2OA 1HRI3 2R49A 5BYNA 1WLDA 2WZR1 3IBMA 3WNMA 3DN7A 1TVGA 3DV8A 3OSDA 3POGA 2GC2A 4HKWA 4ZS2A 3AKRA 3THPA 2RR11 1LU1A 1XYOA 5FUIA 3NAPB 5T5OA 3NO8A 3VHOA 5ANQA 2JG9A 1AYM3 4WM8C 5DQ0A 1W03A 3PVEA 3GHMA 1I5PA 1MS9A 1AXKA 3AJYA 4P9GA 1SLBA 3SH3A 3WG3A 3WUCA 3FHIB 3O1UA 2QKDA 4DXTA 2QQWA 1VBA2 2WO2A 5A7WB 4PHZA 3B69A 5FZAA 3VZKA 1V6IA 4XJ8A 4L0PA 4AF9A 5LZ6A 2FDKA 1CR7A 3R05A 2ARXA 2GMEA 4B8EA 4BQYA 3DL3A 1Q3EA 1K45A 1AHSA 1K5MA 1LB2A 2GH2A 4OI2A 1OFSA 4QB6A 3GZAA 4OZOA 4PDWB 4XFBA 1QH6A 3ATGA 3POIA 4AFMA 4K1YA 3WXPA 5IFPA 2P5BA 4I0WB 4P9YA 3ES4A 4B1MA 1LGBA 4MHRA 3OY8A 1BCXA 3OUHA 1EY2A 2XG3A 3AMHA 4RHV3 2X8KA 1W8WA 5K0UA 1I5ZA 2VW1A 1ASJ1 2RR13 2HWC2 4UFIA 1OPOA 1QJY1 1FAYA 1UY0A 1PHMA 3A0KA 1POQA 1YI7A 3CO2A 3H9AA 2YMZA 4P5HA 3SNMA 2Y38A 4X8PA 4C1XA 4CDXC 2ADEA 1FPN2 4XHXA 1WCQA 1J59A 1JYTA 4NR1A 2ZAHA 3GDBA 1LR5A 2ID4A 3WF3A 2A3WA 3VBUB 1LOGA 4QX0A 1R082 4XF0A 4MXWA 2IVJA 1GZ9A 3IKWA 3MIBA 1OHFA 3HAGA 1M06G 2QFEA 2VH9A 4HONA 1SQ4A 1POV0 5JSOA 1VRH3 4HPKA 4WVZA 1GNYA 5JI7A 4XETA 3MDPA 3EO6A 4OQ8A 2NP0A 1PO22 3AKPA 2R043 2X09A 1RUG1 1QOTA 3LFMA 4BQ1A 1WCSA 2RVAA 4AHYA 1GSLA 4B29A 1H9PA 1ZVFA 2BFUS 1NLRA 3KS7A 1VAVA 4LOTA 4YW3A 4F8AA 1QHDA 3Q8AA 4CXWA 4G9SB 1W9YA 4I02A 3ZSEA 1WGPA 3O0XA 3QCWA 5JOYA 2R7EB 3AB0A 1ASJ3 1W6NA 2ZCWA 5BNOC 1W6OB 1LGNA 4IERA 3USUA 4OUSA 2Y34A 1UW8A 4AGRA 5BNPC 3H8OA 1C5IA 1S0GA 3DKWA 3R4UA 1AYN1 1Q8VA 2C24A 3POBA 1PVC2 5FY1A 3WY6A 2PAKA 4FSJA 2WDBA 4AEMA 2O8QA 4FPLA 1RC6A 4UF0B 4CCDA 2VBPA 4L92A 5A3PA 5FZLA 1XYNA 5HI0A 2H6BA 1RJ7A 4ISQA 1QDOA 1RGSA 3E5UA 1A8DA 3O1OA 4B7KA 2WINB 3MW3A 2PLV2 1OBNA 3PUAA 1GWLA 3U75A 3AFGA 4N53A 4RQPC 4CDWB 5DN2A 4TZDA 1HX6A 1M4WA 5CKMA 5K4LA 3N7MA 4ATEA 3RZMA 3WG1A 3U07A 3MYXA 3MIEA 1LU2A 4EN7B 5BNQA 2DFCA 4KG8A 4M01A 4ES9A 5TSWA 3NNLA 1RUG3 3UKVA 4A3XA 1DF0A 2WS92 1ULGA 1GOFA 1JBCA 2CGPA 1CX1A 3RZKA 1K5MB 2VG9A 3QOPA 1C57A 3PUHA 2ZEXA 5GZCA 2ZGNA 4NAMA 1LOFA 5FP8A 1QY4A 2HYKA 5B4XA 3WQ0A 4KI5M 3A23A 5FYYA 3TRSB 2PTMA 2XQRA 1VBC2 1AYN3 5IVBA 1EYBA 1FV2A 1NZIA 3OY8B 1MS5A 4QQ2A 4E2SA 5A70A 2F4PA 1DYPA 3CJIC 3HOBA 2OQ6A 1UYXA 1D2QA 2FHRA 3SKJE 5K0UB 4Z8BA 3KLSA 3NMBA 3PURA 2IXHA 5LRSA 4YGDA 2W08A 3EB7A 4NIGA 3E5XA 1HQWA 1YO8A 3OPWA 2VTXJ 3POWA 1UZVA 3UKNA 4PI0A 1GBGA 1W2OA 3C7FA 4LUKA 2K46A 2GSYA 5CB7A 5DDJ2 4AGGA 4C90A 3H3ZA 3VZJA 1YIFA 4Q4V1 2RDNA 1GWMA 1IGOA 2BVVA 2RJ2A 2BRTA 4XAEA 2CDOA 1PVXA 2D5FA 4META 4MXWB 1W6QA 2WWSA 4Q4X1 4EYUA 2YC0A 3ZFEA 2XKPA 1W90A 3PMEA 4YM2A 5DAXA 2VOWA 5SV5A 4LITA 3LDRA 2OXBA 2PN5A 1N1SA 4HPKB 5KHKA 4HKOA 4HVRA 2RM21 2MEV1 4NOTA 1QEXA 2CY6A 3RZLA 2J1TA 1FOD1 3ZXLA 1XJAA 1AR72 1J3QA 2JDAA 2WC2A 4LKSA 5CFDC 4ZHNA 1SPPB 2E9QA 4AOCA 5G05L 1SFYA 3SMHA 4OQ9A 1C1FA 1BEV3 1S0JA 2A6XA 4CEWB 5F2SA 1RL3A 4DFSA 1HIXA 4YVWC 2JE7A 1W6NB 3M3OA 4XBNA 1QXRA 4LOSA 2OIIA 1QU0A 2V5DA 5FBZA 3MIFA 4QXBA 1MACA 2LRPA 5LB6A 3USUB 5LA0A 1WBFA 3VN4A 1ULFA 2BNOA 4OFGA 1QJX2 2XUMA 5K8SA 4YFZA 1U12A 4GAZA 3QBQA 3O1RA 5FOBB 1VAMA 2IC1A 2ZHLA 3JB8A 4AR2A 5A1LA 4GB31 1T6BX 2J1SA 1OI6A 2P3KA 1OFNA 3APBA 4Q4V3 4JAAA 2P3YA 1O5UA 1ND3A 5CKQA 2ZPXA 1GZTA 4I01A 1BXHA 1HV0A 1NAEA 3MIGA 4QKDA 3NKTA 5EP9A 4BWOA 1S0EA 3O0WA 4LKFA 4WZCA 1E5HA 1KD7A 5JSPA 3J9SA 3TNQA 1DBNA 2MEV3 2RM23 2W68A 1O5LA 4XF1A 5K7PA 2Q1ZB 1FOD3 4OUMA 4BXSV 1VP6A 2IXIA 3JBG2 4QQHA 4E4ZA 1SLIA 4IE7A 1PGL1 1O4ZA 2PAMA 2XBO1 4UW5A 1RUI3 1E5IA 2KA3A 2VTFA 5FZ1A 3DYMA 2LUWA 4QPIC 4FPGA 2WIIB 1VBB1 4CEYA 3VUOA 2CGOA 2YG0A 1O6UA 3ZO0B 2JIJA 3NNGA 1WCDJ 1XU2A 1KDKA 3F2ZA 4XUQA 5H9PA 4AVSA 2VNRA 4AW7A 2ZX2A 5KBFA 1ENQA 3VZLA 2XJUA 2WA4A 2HWF1 4LO8A 2WFF1 3J7LA 4QHZA 4CCLA 1POV1 4D94A 2YFUA 3KQ4B 4IEZA 4WM8A 4K7JA 2ES3A 5ACA1 1JW6A 1G7YA 5DUWA 5C9AC 1S0DA 3FHAA 2QQIA 4JQTA 1R64A 4HXCA 4OLLA 4ARYA 1QOOA 2A75A 4BXFA 4LHKA 1UU5A 1UY2A 3CHXA 4ONUA 2B39A 5A32A 4R9BA 2NPIA 1AR92 3H7YA 1TMF2 4ATFA 3LPFA 4XABA 4XIOA 2DTWA 2CTVA 2W52A 1X8EA 4WVVA 1C8NA 4XJ9A 3RZZA 3ABZA 1W99A 1V6MA 1IKPA 3N7JA 3E6CC 1BKZA 4MG2A 2K9ZA 1ZZ6A 3DECA 4AZZA 4EV0A 2Q1FA 4FOYA 3AP5A 3WHUA 4Q1RA 3ASIA 3O1VA 2W5FA 4DS0A 4FOQA 1TG7A 3BCWA 1ZRCA 5C8WA 2E7TA 1W6QB 3E6DA 2VPVA 3W20A 3FJSA 4AG4A 2XBO3 1HXS3 3ITQA 2VCBA 3V56A 1MEC1 1U0AA 2QDRA 4KWJA 3ZFEB 4Y20A 5D8AC 5DABA 2ZGRA 4YG3A 2GNTA 1WLWA 5FZ6A 1PIV2 3FUQA 3IM0A 1ST8A 1AXZA 1WZXA 4HSLA 2HWF3 3T30A 2WFF3 3H1WA 1POV3 4XF3A 2R6QA 4O7XA 2I45A 1HJFA 3FL7A 2VUDA 3THCA 4C91A 3TAYA 1NQJA 1OXCA 1CJPA 2D6MA 4HKLA 3N36A 1YCIA 1SDDB 3MLLA 2KR2A 2W47A 4UAPA 3FWEA 3GJAA 4Q4W2 4Z2WA 2KD7A 3HBKA 2R063 3PVOA 2VBDA 2YUEA 4FXKB 2ZGLA 4JC1A 5FUNA 3T0AA 1NXD1 3S7IA 3K51A 3WQBA 1LESA 2ZGMA 4DB5A 2WT2A 4AI9A 2WLQA 4XFIA 1VB4A 1HRV2 1KGYA 1REEA 1ND3B 3D3AA 4JKLA 1AR61 3JQXA 4TLGA 1VPHA 3URFA 1W9WA 3ZYIB 1MEC3 4JV4A 4I30A 1L7LA 4GIQA 2DVAA 2YPJA 2A7AA 1YYNA 3FHQA 1S2BA 3IT8A 4HBNA 1MZ5A 5A3OA 5C3RA 2WNVC 1O8SA 5CISA 5HV0A 5T5PA 1WBLA 4OHZA 3WVJA 2D7FA 4CVUA 1EAH1 1RUH2 4CP9A 5KXBA 5BNPA 1OC1A 1SLLA 1AL0G 3NL1A 2VMHA 1X9PA 1FNYA 2B46X 1UOJA 3CKHA 3FBYA 3KM5A 2VCAA 1QQP1 3LD8A 4CEYB 1XRUA 1J1TA 3GBFA 4Q0VA 4CCKA 2YC2A 4YG0A 1F31A 3MLKA 2A5ZA 2J7MA 2Y8KA 4RHV2 3J8F1 4AQ6A 2LS6A 2QQKA 4A42A 1V6OA 2WZR2 4CRQA 1LOBA 2VZ1A 4FPYA 1QGLA 3U14A 2HBUA 2RR12 4WM8B 4DIQA 2ET1A 2H6CA 1MR5A 4UYBA 3GF6A 1RUD1 3LEGA 5LBCA 1BJQA 4XZUG 1LULA 1NLSA 1OUSA 5FYIA 3VKLA 1QNYA 1RUOA 3ORJA 1W0NA 4EQVA 5L19A 4D3WA 1MS3A 1YEWA 2WA3A 1AR63 1GZWB 4LBQA 2W39A 3UL2A 4QXHA 4LIUA 3RS6A 3I7DA 1PM7A 2VNVA 3NJVA 3ZM8A 3DPRB 2VVDA 3OGJA 2E63A 5FYVA 3LOIA 1QMJA 2ARBA 2DBIA 4YSFA 2PHRA 2EIEA 5GZEA 3SQOA 3LDBA 3PUIA 1EAH3 5BPXA 3C7HA 2Z2SB 1COV1 3WOGA 2OT7A 4Q0QA 3W5MA 2VXRA 1ZRFA 2DWRA 1V9U1 3PUQA 2B7YA 1UPSA 3CJIA 4XAAA 3OGRA 1YIPA 4HN0A 3ZN4A 3M7AA 1KJLA 3J8F3 4IW3A 4QB2A 4CTEA 3F95A 1NKGA 2B42B 5IVEA 1VJ2A 2PHWA 3MW2A 2BU9A 1F2NA 3VB9A 1QJY2 3C7OA 2JB8A 4RS5C 2Q1MA 5EWSA 4BQWA 1KDMA 4UFHA 5JR2A 4PQ9A 4UXAA 1JU4A 3K75B 2AR6A 3X29B 4CCNA 1H2LA 2OX0A 4QGMA 4H2AA 4W50A 4KNCA 3N4MA 3LKJA 3QD6A 2P37A 2QZ2A 4L97A 4CUGA 5HCBA 3JD72 5D1IA 1WUVA 4GWIA 3ZLIA 4BISA 4AEKA 2ZGUA 1UNBA 1KFXL 1W9SA 2XJQA 4FFIA 5CA6A 2Y6FA 4CCCA 1ZBA3 4TWTA 5E16A 3MF9A 4OMCA 2BGCA 2JDNA 3ELNA 3TEYA 1LKNA 1V6KA 4GULA 3LSEA 3D5OA 2BPA2 5CFDA 1ODMA 3IWZA 2D6PA 1OVPA 2WN2A 1XNCA 1NXMA 4CU9A 5HBAA 5T3NA 1H8VA 2EAAA 2JDYA 5AC93 1F4HA 4BJ0A 4JDNA 2W2IA 3VBFC 4YVWA 2ZEWA 1HB1A 2RJLA 2Q4SA 4CP9B 1ALYA 1B35A 5I8SA 4H3WA 3G7DA 5JDBA 2G9FA 1YXWA 3S30A 1JOPA 4XZPA 1W8OA 4A41A 4CZSA 4NHKA 5T55A 4LK6A 3VKMA 3WD5A 3H42B 4UOJA 1WKYA 1PK6B 2X5IB 1AYN2 5LBEA 2R0HA 5FWEA 3KCCA 1RUE1 1R093 3B9IA 3SLIA 1OOPB 3LFIA 3NWKA 4Q4Y1 3O0VA 4YZ2A 3UGHA 3AFKA 4B1LA 2D5HA 5GZFA 4FO9A 2BNNA 5GLZA 1S2EA 4CUAA 3HPNA 5FPLA 2XUEA 2QQOA 3WR0A 4QHOA 3S0MA 4AI0A 4PIZA 1Y4WA 4BIOA 4LBLA 4E2QA 1CZVA 3OBAA 1C8M3 1NT0A 3RPQA 3V0AA 4LBQB 5F7UA 3WDYA 5FOJB 2C6SA 2GC0A 2WO1A 5CNAA 3VKOA 1EV11 2BDRA 4P9LA 1W6PA 5FIXA 4QPIA 1IPSA 1GOHA 1MS4A 1NE6A 2W46A 4DZGA 3K2OA 3WDTA 1RYYA 3AYDA 2CAUA 4OI4A 1OLRA 3AL5A 4S2GA 4AFAA 2XL7A 5E1RA 5FBJA 5C33A 1QJZA 3S57A 2CGNA 1QOSA 3IDEA 1LECA 4MHUA 1YHFA 3WNKA 2Z4FA 4QX1A 5EXOA 3U11A 4HK8A 1ENSA 5FPXA 5C9AA 1ZYBA 2JKBA 5GZGA 3CJIB 3D6EA 5F3EA 2WO3A 5IVFA 1KXGA 1RUE3 2W9XA 2FMYA 2ERFA 1CZTA 3WLUA 4MV2A 5FXVA 4DMIA 5A80A 1ZZCA 2BP6A 1OT5A 3KCYA 5J96B 2IXKA 4P9XA 1ZX5A 5DAWA 1YFUA 5FY7A 3SCGA 3A21A 4EN6B 2Y26A 2B4KA 4A7YA 3IMNA 4ET7A 4R52A 1Q43A 2GP3A 4N9HA 2O8OA 1GUIA 3NRUA 3BIEA 2VMEA 5HXVA 3VDCA 3MO4A 5C3QA 1TE1B 1UWWA 3H8XA 5L7OC 3I3BA 4PF5A 2VW0A 4S2FA 2HWB1 1EV13 4LEJA 1UZYA 2Y6JA 5D8AA 2MPFA 2XLAA 4E8CA 4Q4X2 4QT6A 1IS3A 4TXWA 5KC6A 1RXFA 1Y9QA 4LKDA 5A7NA 3KGLA 3CMGA 3IDCB 4QKBA 3V64A 2XWJB 4OI1A 4BZ4A 1UY4A 2ZGKA 2RM22 2MEV2 3ZMNA 4YZ4A 2ADDA 3MV11 3RVHA 1FOD2 4L11A 1RMU1 4BE3A 2DF7A 4FOVA 3WW1A 4LTAA 4WV8A 4DY3A 1W6MA 4HANA 2WBKA 3LIGA 2VECA 2Y6LA 5LK5A 4NAOA 1B35B 4LE3A 1XQNA 2VAUA 3CBNA 1EPWA 2R30A 1OKOA 3E5QA 4ZONA 5CADA 3V65A 5FP9A 3I2OA 2R071 4JDMA 4XVHA 4QPYA 5FY5A 4WBBA 1JYIA 1HRI1 2HKXA 4YM1A 1JZ6A 4K8FA 1JOJA 1VB2A 3IIIA 2V73A 3WCRA 1I6XA 5JIUA 1J84A 4O61A 4QXCA 1EPZA 5IATA 1PZ9A 4GB32 3HNBM 4DPNA 2D6OX 3ZFFC 4DUWA 4EWDA 4NMIA 4RR3C 2HWB3 1DLLA 3WF2A 2Y64A 1RB8G 1Z78A 4Y5SA 1AYM1 4E4DX 1JH5A 4XC9A 4ZXKA 1P8JA 3BPZA 2TBVA 1UL9A 2D98A 3SH4A 1ZA4A 4ZXEA 2PMWB 2VM9A 2WNVA 3NVCA 1RJ8A 4MGYE 4KBBA 4CP0A 3THDA 5J36A 4Y33A 2O0OA 5FYBA 4CXXA 1REDA 1XNTA 2WWUA 2ZHMA 1ULCA
chains in the Genus database with same CATH topology
3GZEA 3NNLA 5LATA 4KBZA 2HBUA 5L9RA 2JIJA 5LBCA 2HBTA 5L9BA 5C5UA 3PL0A 4XCAA 3OUIA 4BQYA 5L9VA 5C5TA 5DAQA 5A3UA 4MHUA 4XABA 2JIGA 5EPAA 4NHLA 4Q5OA 3DKQA 4J25A 4MHRA 4NHXA 3KT7A 3OUHA 4NHMA 3W21A 2OPWA 4XAAA 5LA9A 5LBBA 5HV4A 5DAWA 3HQUA 3MGUA 4JZRA 2RDQA 4XACA 5DAVA 5LBFA 3W20A 4IW3A 3ITQA 5M0TA 2RDNA 3EMRA 4BQWA 4BQXA 2FCTA 5DAXA 5IAXA 2RG4A 2FCVA 3NNMA 2RDSA 2V4AA 3OBZA 4ZPIA 2Y33A 3GJAA 3NNJA 3KT4A 5LB6A 5DAPA 3BVCA 4NAOA 2RDRA 4ZONA 3NNFA 4NHYA 2Y34A 5ERLA 2G1MA 4XCBA 4NHKA 5LASA 5IATA 5IAVA 5HV0A 5EP9A 3HQRA 2FCUA 3GJBA 4NMIA 4UWDA 4Y5SA 5LBEA 4XC9A 3OUJA 4Y5TA 2G19A 2A1XA 5EQUA 3KT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZE A;  3NNL A;  5LAT A;  4KBZ A;  2HBU A;  5L9R A;  2JIJ A;  5LBC A;  2HBT A;  5L9B A;  5C5U A;  3PL0 A;  4XCA A;  3OUI A;  4BQY A;  5L9V A;  5C5T A;  5DAQ A;  5A3U A;  4MHU A;  4XAB A;  2JIG A;  5EPA A;  4NHL A;  4Q5O A;  3DKQ A;  4J25 A;  4MHR A;  4NHX A;  3KT7 A;  3OUH A;  4NHM A;  3W21 A;  2OPW A;  4XAA A;  5LA9 A;  5LBB A;  5HV4 A;  5DAW A;  3HQU A;  3MGU A;  4JZR A;  2RDQ A;  4XAC A;  5DAV A;  5LBF A;  3W20 A;  4IW3 A;  3ITQ A;  5M0T A;  2RDN A;  3EMR A;  4BQW A;  4BQX A;  2FCT A;  5DAX A;  5IAX A;  2RG4 A;  2FCV A;  3NNM A;  2RDS A;  2V4A A;  3OBZ A;  4ZPI A;  2Y33 A;  3GJA A;  3NNJ A;  3KT4 A;  5LB6 A;  5DAP A;  3BVC A;  4NAO A;  2RDR A;  4ZON A;  3NNF A;  4NHY A;  2Y34 A;  5ERL A;  2G1M A;  4XCB A;  4NHK A;  5LAS A;  5IAT A;  5IAV A;  5HV0 A;  5EP9 A;  3HQR A;  2FCU A;  3GJB A;  4NMI A;  4UWD A;  4Y5S A;  5LBE A;  4XC9 A;  3OUJ A;  4Y5T A;  2G19 A;  2A1X A;  5EQU A;  3KT1 A; 
#chains in the Genus database with same CATH topology
 1IG3 A;  2UYA A;  2CHH A;  3VGI A;  4P5Y A;  2C1F A;  5DZE A;  2VUA A;  5E89 A;  3ZYH A;  2OZJ A;  4Q2F A;  1KJR A;  1W6P B;  4FPJ A;  3IAQ A;  4QPI B;  5FZO A;  1PGL 2;  4CSW A;  2A73 B;  1JU3 A;  2XBO 2;  4L9B A;  4NPL A;  4W6X A;  1US3 A;  4YGE A;  1K12 A;  1AZD A;  2EAL A;  1VBB 2;  2TNF A;  4BIF A;  3I2J A;  5FZH A;  4YGB A;  3SIT A;  1TEI A;  1HB2 A;  3THT A;  1RHI 2;  2GH8 A;  1H1I A;  3AMM A;  1NA1 C;  1OVS A;  5C9A B;  3U0Z A;  2R07 3;  2G9G A;  2HWF 2;  1SZB A;  5FKC A;  5J09 A;  3BKZ A;  1JHN A;  2ZHK A;  1DCS A;  3PVN A;  4N90 A;  3I4I A;  4EN8 B;  3DXT A;  1J1L A;  5ACA 2;  3FFQ A;  5FR3 A;  4XMI A;  4B3N A;  3S5Q A;  2D6K A;  2BFU L;  2D97 A;  1J3P A;  1GP4 A;  2XJR A;  4ZS3 A;  5J1X A;  1GZC A;  3KSC A;  4NPR A;  3K48 A;  2RS1 1;  3K46 A;  4IEQ A;  4JKK A;  3M3Q A;  3TBD A;  1HW5 A;  5FO8 B;  3ZFG A;  1TZO A;  2BZD A;  2D44 A;  3I3D A;  4A6S A;  3AVR A;  4JHZ A;  4IEX A;  5FO9 B;  5A1F A;  2TUN A;  3OEA A;  2EXK A;  2AZ5 A;  1CVN A;  3K4D A;  5LBF A;  5A7O A;  1ND2 C;  2DCY A;  2VY0 A;  4BDV B;  5A7P A;  2BOI A;  5F5A A;  1CPN A;  5D8A B;  4A7Z A;  3I2F A;  1PZ7 A;  1FNZ A;  1FXZ A;  1MS8 A;  2BUK A;  1WW4 A;  1VBE 2;  1VRH 1;  2A3X A;  2J1A A;  4W8J A;  4XUO A;  2FCT A;  2JE9 A;  2RS3 3;  1BMV 1;  3GZU C;  5IAX A;  4IV3 C;  4FCA A;  2GN7 A;  2R04 1;  5IWF A;  3BOD A;  5C8C B;  1RUJ 3;  4FPO B;  1UY3 A;  2VCC A;  2WN3 A;  2XXZ A;  4MZU A;  1GYK A;  3PTR B;  2VZR A;  2UWA A;  2AAC A;  1PX4 A;  3H1Y A;  2ET7 A;  2ORX A;  3M70 A;  4FQ4 A;  4S2D A;  3ZN6 A;  2VC9 A;  3WDU A;  3SH5 A;  4GA9 A;  3QLQ A;  4UT5 A;  1DLC A;  1ZA7 A;  1EUT A;  2JDU A;  3AYA A;  3L2H A;  2YC4 A;  2RS1 3;  3AVS A;  1RVF 3;  4L8Q A;  5FQ0 A;  4FP2 A;  3SC7 X;  1QJU 2;  4XXP A;  1C28 A;  2FDH A;  2VW2 A;  4CP2 A;  1LAJ A;  4C0B A;  2P17 A;  1NCR C;  1UMH A;  1OH4 A;  4P9I A;  1NCQ C;  1OF4 A;  2XVG A;  2WNU C;  3HNY M;  4IE5 A;  4MAD A;  5A3M A;  5CKN A;  2BWA A;  1UZZ A;  1UY1 A;  3AKS A;  5GLV A;  4S2H A;  2PQQ A;  4XXA A;  1AR6 2;  1K42 A;  3KV9 A;  1W28 A;  1GNZ A;  2CWS A;  3LB9 A;  3N9P A;  3VBF A;  1S0I A;  2FCU A;  2WNV B;  1O59 A;  2ARC A;  1OA4 A;  3LGR A;  2VMC A;  4UI9 L;  3ACH A;  4GWM A;  3A7Q A;  4ASL A;  3K4Z A;  4MXV A;  4AI8 A;  5JSR A;  1G9B A;  3N3H A;  4LBQ D;  4Y1V A;  2RS5 2;  5FZO B;  1WD4 A;  2E26 A;  3AZW A;  2JDP A;  4EJR A;  3WG4 A;  4YZ5 A;  1QQP 2;  5DPN A;  2VR4 A;  4GH4 B;  3J8F 2;  4N7I A;  2ZGP A;  3ZXF A;  1H4G A;  4IND A;  4IE6 A;  2ZGS A;  2VOK A;  4FT8 A;  4BQ5 A;  1X33 A;  2VUJ A;  1W3X A;  4G3Y C;  4Q1P A;  4XYX A;  4BK4 A;  2DVF A;  2XL9 A;  5ABJ C;  5CG8 A;  1W2T A;  1RUD 2;  1JOD A;  4QPW A;  4OI0 A;  1NZC A;  1G86 A;  2R16 A;  3ZSM A;  4Y22 A;  3KF3 A;  5GZD A;  1W39 A;  2D3R A;  2JG9 B;  1VMH A;  4HT1 T;  3DXU A;  5FRA A;  2ZEZ A;  3ZFG B;  4D8M A;  1DQ1 A;  2BJS A;  3RFR A;  4XJA A;  4OUE A;  2VMI A;  5C70 A;  3I2D A;  4JVA A;  3NJZ A;  4QWN A;  2P2K A;  4D7T A;  1GWK A;  4ZU5 A;  5F2W A;  3HQX A;  3BGA A;  5JXH A;  4PCR A;  1D4M 1;  5J3U A;  2H0V A;  5BNN C;  1COV 2;  3HQU A;  4JZR A;  3WNX A;  4AVT A;  4QM8 A;  2VZQ A;  1V9U 2;  1YJK A;  5M0T A;  1OUR A;  3OTF A;  4M3C F;  1KFU L;  1JZ7 A;  2W1S A;  5DUX A;  2DUO A;  5IUQ A;  5LA2 A;  3MPB A;  4WZF A;  5F5Q A;  5I8Y A;  5HXM A;  2YZ4 A;  3K3O A;  1DGL A;  5EYY A;  2XHK A;  2XQX A;  3W58 A;  1O3S A;  1S0C A;  2GMM A;  1BEV 1;  4IV1 C;  1AVB A;  4QPG C;  2DU1 A;  2YV8 A;  4Z82 A;  1IQD C;  3ZXE A;  1OUX A;  1JTZ X;  3MZH A;  2JE8 A;  4XPV A;  2RG4 A;  4YLZ A;  4YAR A;  1XPW A;  1BBT 3;  1F4A A;  2FCV A;  5LA1 A;  5IK5 A;  2RV9 A;  1RUC 3;  1NY7 1;  3L2Y A;  2BOJ A;  2HEW F;  2JDM A;  3JU9 A;  4LO4 B;  4PF1 A;  4U2A A;  2V72 A;  5FZE A;  4A7K A;  2FQP A;  5FWJ A;  4E4S A;  3DYO A;  1RIN A;  1IHM A;  3FMG A;  2K0G A;  4IEV A;  5JAX A;  5JLV A;  2NLR A;  4AAX A;  5J7M A;  4PI2 A;  3V0B A;  2D6N A;  3WZ1 A;  4LO6 B;  4FTB A;  5C3O A;  1V0A A;  3FLT A;  4KGG A;  1UX6 A;  2AEZ A;  3MIH A;  3TN9 3;  3W9A A;  2F17 A;  2Y6G A;  1D4M 3;  3POY A;  2HLE A;  1FAT A;  2DYC A;  2DUQ A;  2ZGQ A;  4D7S A;  3J7H A;  2VL4 A;  3PNA A;  2GU9 A;  1LHN A;  3M4F A;  4D69 A;  3WNL A;  3MPP G;  3T1M A;  3VBO C;  4XCB A;  2VTX A;  2WJS A;  4XTP A;  2QJV A;  5FCC A;  5KXC A;  3OPT A;  2VNG A;  4JX0 A;  1YRZ A;  1R1A 3;  1RIR A;  4A44 A;  1S0F A;  4M0H A;  1AJK A;  1KEX A;  1PZ8 A;  1RUI 1;  3O1S A;  4Y4R A;  1JYC A;  2E7Q A;  4KQ7 A;  1UIJ A;  3BTA A;  4KWU A;  3AP7 A;  1HLC A;  2A6W A;  3IAP A;  4COW A;  2PYT A;  3H3L A;  4HG6 B;  2V4V A;  1XE8 A;  5LY1 A;  4OHY A;  3ZFF A;  1J58 A;  1HV1 A;  1RUE 2;  4RR3 A;  4YPJ A;  5A6X A;  4Q4Y 2;  3PTY A;  5FYH A;  2XB6 C;  1UXX X;  4ZY9 A;  2GZW A;  3EJK A;  5B4N A;  3H3U A;  1AF9 A;  4XTM A;  3GM8 A;  4EZ4 A;  1L7R A;  1HB3 A;  3KB5 A;  5I93 A;  4JGZ C;  5I0D A;  3AZY A;  2HEY F;  4N8M A;  5CEH A;  1AL2 3;  2VQT A;  5FXX A;  4IXL A;  3I59 A;  2W87 A;  1FYU A;  4DXS A;  1G9C A;  4MVT A;  5L9B A;  4Y22 B;  5C5U A;  1W8Z A;  3JB4 C;  5CVR A;  4C1W A;  1GQP A;  3JUU A;  4GJY A;  3KVB A;  1YWK A;  2JD4 A;  3ZPY A;  4P9W A;  4CCO A;  4DEQ A;  3DF0 A;  2A3Y A;  4N53 B;  1HQL A;  1OF3 A;  2OZ6 A;  1G8W A;  1UKR A;  3JXS A;  2JKX A;  3POJ A;  1GKB A;  4Q8L A;  2VZT A;  5FMO S;  3RMY A;  1EV1 2;  2TEP A;  4Y5Z 0;  1TME 3;  1YUD A;  2FDG A;  4LE4 A;  3U1X A;  2UY8 A;  3GHN A;  4IEU A;  4LO7 A;  5IYY A;  2AEY A;  3EHK A;  2P6C A;  2YHJ A;  5FYU A;  5LEK A;  1HXS 1;  1WLC A;  1NA1 A;  1WW6 A;  4XFC A;  1H4H A;  4Q29 A;  4DUX A;  5JI9 A;  3FN9 A;  5A33 A;  2VZV A;  3RI9 A;  5L36 A;  2OA2 A;  2XJS A;  2ENR A;  5LA9 A;  3VKN A;  5CBL A;  1JZ8 A;  4A3Z A;  4CUB A;  2DDU A;  1PGW 1;  4CUC A;  1Y9M A;  1YQ8 A;  5JR7 B;  1WMF A;  4NRQ A;  3OJB A;  5LW9 A;  4D7Y A;  1UD1 A;  2XML A;  1UMI A;  1Y9G A;  2Q8D A;  1PO1 3;  1VAK A;  3KHB A;  1ZBE 1;  2KXL A;  5FLJ A;  4KL1 A;  3KZ4 C;  3DYP A;  4LA3 A;  1MVQ A;  2CDP A;  1E5S A;  4LHN A;  1ND2 A;  3BN6 A;  2D3P A;  1JI6 A;  1FMD 3;  2R06 1;  3UJQ A;  1EUU A;  3N7L A;  2LTN A;  3D0J A;  3CEW A;  2RMU 2;  3Q8E A;  4NE9 A;  1XU1 A;  3T4H B;  2HWB 2;  4BOW A;  3POS A;  4UFL A;  2VVF A;  3NNM A;  2IUW A;  1N1T A;  2V4A A;  4QMA A;  1UZ0 A;  2ZTN A;  3SEE A;  1SDW A;  3OPZ A;  5FZ4 A;  3AM2 A;  5HPO A;  1PMJ X;  2WAA A;  2XJV A;  3HVD A;  4I3G A;  3UK9 A;  2PFW A;  3N7K A;  3WF0 A;  2DVD A;  4XJZ A;  1VMF A;  1QNW A;  2FBE A;  2IXJ A;  2ORZ A;  2BEO A;  3ETP A;  5HCF A;  5GKA C;  3WUD A;  4BK5 A;  2DVB A;  3ZSL A;  3NAP C;  1RMU 2;  1BVP 1;  3ETQ A;  1RIT A;  2WQ4 A;  4BU2 A;  1S1A A;  5HCA A;  4FAH A;  3OB8 A;  4CPB A;  3KF5 A;  2W1Q A;  1NX9 A;  2QUO A;  4YW4 A;  1AR8 2;  4CDX A;  2BBV A;  2YBK A;  2PHF A;  2VXJ A;  5ERL A;  4KMQ A;  1DGR A;  2E51 A;  4AI3 A;  4ZZ8 A;  5JXJ A;  1O8P A;  4AVB A;  4Z07 A;  1ZBE 3;  1W3V A;  3IDA A;  2VZO A;  3R6S A;  3M2M A;  1NCR A;  1ZRI A;  4ASK A;  1IS6 A;  2J1U A;  2NMN A;  2QZ3 A;  2R07 2;  2R1B A;  4JTN A;  5F3C A;  1H6Y A;  1ODN A;  5E88 A;  1HRI 2;  1Z7S 1;  2WNU A;  3BB6 A;  3ZFF B;  4K40 A;  3ZSK A;  4FP3 A;  4FPK A;  2L9L A;  4PDW C;  3D82 A;  1UIK A;  4L2N A;  1UQX A;  2EIC A;  2AGS A;  4BMB A;  3WW4 A;  2JG8 C;  1CIY A;  2YGL A;  2DVG A;  3BUC A;  1RUF 3;  1KRI A;  4IGO A;  1AYM 2;  2BGP A;  3SXW A;  3I59 B;  1H1A A;  1H2N A;  1DQ4 A;  2XHN A;  5GM0 A;  3NQH A;  4JGY C;  4PLO A;  3OBT A;  3IZO A;  4XFA A;  4DY5 A;  2ZOE B;  2P3I A;  5L9R A;  2D43 A;  3D4K A;  3N9O A;  3QH6 A;  2JX9 A;  4MYE A;  4XJW A;  5D2A A;  4YZ1 A;  2X29 A;  1N3Q A;  4F83 A;  3WF4 A;  4ASM B;  2XLF A;  3T0D A;  3Q8F A;  5GLW A;  1QJE A;  1CAX A;  3PL0 A;  4O9E A;  5BNO A;  2VU9 A;  1VBA 3;  3OD0 A;  2PHL A;  3OUI A;  3DEM A;  3R4S A;  1HN1 A;  4AHZ A;  3MFC A;  4JQR A;  3ALQ A;  2XLG A;  2DCT A;  2YDE A;  4XW3 A;  1O3R A;  3FE5 A;  5C4W C;  5A3U A;  4LHL A;  3VBU C;  5ABJ A;  4V1P A;  4YVS C;  1UOG A;  2IWG B;  2RJK A;  4Q5O A;  4X8N A;  3AP4 A;  4YW1 A;  1AXY A;  1Z7S 3;  4E9K A;  1IZ3 A;  3DKQ A;  1WWY A;  3A22 A;  5FP7 A;  4AE2 A;  4Y1U A;  2I07 B;  3HD8 B;  4P00 B;  3VZM A;  1TQ5 A;  4GZ9 A;  3W21 A;  3CU7 A;  4R9A A;  5A6Z A;  5A6Q A;  3VBH C;  4RQP A;  2WT0 A;  1R1Z A;  5FRE A;  2HWD 1;  5H9S A;  5IHR A;  2RS1 2;  5FZ9 A;  5DAV A;  1QXP A;  1YLL A;  4RGA A;  5A32 B;  5KC5 A;  2D40 A;  5CZK A;  1U5X A;  3LDK A;  4B4P A;  4UW4 A;  2JDZ A;  1WA4 A;  3ZYF A;  2GAL A;  2QE3 A;  2C5D A;  1OD3 A;  1IG0 A;  5BNN A;  1FPN 3;  3RZJ A;  1N3P A;  5FXW A;  1VE0 A;  2VCM A;  4GMP 0;  4QAW A;  5KHH A;  1ZBA 1;  3ZXD A;  1XYP A;  5CIR A;  5T5L A;  1DQ2 A;  3NJY A;  3EQE A;  4DO0 A;  1S4C A;  1VRH 2;  4O65 A;  5JZG C;  5T52 A;  4Y3O A;  1W2N A;  3J26 N;  2YY1 A;  2CU5 A;  1BMV 2;  3RRD A;  1R08 3;  3M8L A;  1SCS A;  3ZXJ A;  1T6G C;  2R04 2;  3OBZ A;  4Y20 B;  1G9F A;  1XSQ A;  4ZPI A;  4IV1 A;  4QPG A;  5AC9 1;  4CU8 A;  1W9F A;  2G9Z A;  3MEP A;  5FAX A;  3TB0 A;  2NZ9 A;  4FPF A;  1CES A;  1E57 A;  2JDH A;  1NQD A;  4QDQ A;  2AH2 A;  1VAL A;  2JB4 A;  4HVO A;  4CDW C;  4F7Z A;  1ASJ 2;  4AHX A;  4CDX B;  2E32 A;  3VZO A;  5FYC A;  4RN5 A;  4ORF A;  1BK0 A;  1NOV A;  2HWD 3;  3MUY 1;  2VMD A;  1UXZ A;  4NUB A;  3WIN E;  3NNF A;  2YPD A;  4CU7 A;  1NCR B;  4NHY A;  3RYP A;  2O14 A;  1JYV A;  1R09 1;  1F15 A;  1JZ2 A;  2WNU B;  4E8D A;  5FY0 A;  4Q0U A;  3B9C A;  1W2U A;  1C5H A;  1QIQ A;  5J48 A;  2YB7 A;  3VKF C;  4FFH A;  3TYJ A;  4AQT A;  5BY5 A;  5FZ8 A;  2Q30 A;  4CE8 A;  2K2S A;  2P1B A;  1ZM1 A;  3Q9O A;  4CCJ A;  3ENR A;  5EIY B;  3VBO A;  4UFM A;  1C8M 1;  3HWJ A;  1MS0 A;  2FZ1 A;  4AQS A;  5DG2 A;  4XIK A;  5AVP A;  5K0U C;  5FYS A;  2PLV 3;  2A1X A;  5EQU A;  3BU0 A;  5F6L B;  5JMC A;  2ZS6 B;  1UCX A;  1RUG 2;  2QCS B;  2PHD A;  3HN1 A;  3A0N A;  4HK9 A;  4P08 A;  4COV A;  1CAX B;  5J98 B;  1W8T A;  5DDJ 1;  5BNO B;  5FK8 A;  3EYP A;  3NW4 A;  5BNP B;  1DG6 A;  1YFW A;  3VL9 A;  2WS9 3;  4AVA A;  2LAL A;  3N9M A;  3ROU A;  4W6Y A;  2HJI A;  3KQR A;  4XQ4 A;  1WMD A;  2WYF A;  3T08 A;  1GV9 A;  2QQV A;  2VVE A;  2VNO A;  4NID A;  4JGZ A;  3MHZ A;  3Q8C A;  3ZDS A;  5F9T A;  3WCS A;  1JZ3 A;  1KQR A;  3E6B A;  3E97 A;  4NJ4 A;  2R0F A;  2G4I A;  4V2V A;  4KG0 A;  2JIG A;  3D0S A;  3RWK X;  2XJP A;  3ACI A;  1YNA A;  4IUG A;  1VBC 3;  2VE1 A;  4BQ3 A;  1I1E A;  4RQP B;  1CPM A;  2GC1 A;  1UN1 A;  3I49 A;  1FV3 A;  1W0O A;  4NHX A;  3VHN A;  2XKO A;  1NG0 A;  1YQ5 A;  2W95 A;  1A78 A;  1LOA A;  1QWR A;  2ZMK A;  1OSG A;  1HN0 A;  4XFF A;  4CEW C;  3BTX A;  5D21 A;  1SBF A;  3D8C A;  3DCQ A;  4U36 A;  3SEP A;  5BNN B;  1ULD A;  1H30 A;  5FPZ A;  4D6R A;  1D4M 2;  5DDJ 3;  4JDO A;  2BER A;  4P9J A;  2XPJ A;  4X6R B;  1OPM A;  1OA2 A;  1XOY A;  2J1V A;  4UFJ A;  2JEN A;  4EWE A;  1CAU A;  4PQQ A;  4M00 A;  3TEZ A;  3RZG A;  1S55 A;  2JEC A;  3LA2 A;  3HMY A;  1DQ0 A;  3I2I A;  3LCP A;  3LSD A;  5HCH A;  1J3R A;  1D0H A;  4GQ7 A;  4QPG B;  2WZE A;  1DFQ A;  4AI1 A;  3I97 A;  4LIV A;  3ILN A;  3KWV A;  2UWB A;  3PIJ A;  2DU0 A;  1BEV 2;  1H6X A;  2V09 A;  4AFB A;  1APN A;  3A4U A;  1UX7 A;  1GOG A;  4FXG B;  1WCK A;  1AR7 3;  2JJ6 A;  5FLH A;  3PU3 A;  2FDJ A;  1VMJ A;  4AED C;  1MVE A;  1HB4 A;  3T4V A;  4AHW A;  2VMG A;  1NY7 2;  4ITC A;  1GP5 A;  2HYX A;  4BB3 A;  2HWE 1;  2XH6 A;  2ZKL A;  1BQP A;  4DRV A;  2EID A;  3FUO A;  4I3P A;  1H0B A;  3PUS A;  2OUH A;  1GIC A;  4GJZ A;  2B5H A;  5I0R A;  1HJG A;  5BV6 A;  1SFN A;  2OKX A;  4Q4V 2;  4FOW A;  5IK7 A;  2F6B A;  4AK3 A;  2W94 A;  1RTV A;  3LEM A;  4N7U A;  3CZJ A;  2UU8 A;  2ZHN A;  4LMF A;  4XJU A;  2WLP A;  4QX3 A;  3NAP A;  4BH9 A;  3MID A;  1OLM A;  4K21 A;  3J7N A;  2D3S A;  3VBO B;  1U5I A;  2H0B A;  1IS4 A;  3H50 A;  4LLF A;  1LHV A;  5CFD B;  1UKG A;  4IL7 A;  3VLB B;  3VBS C;  1CGP A;  1SBD A;  5JXG A;  5FPB A;  5A7W A;  1BHG A;  2R32 A;  4IES A;  2B9V A;  2OQ7 A;  2BGO A;  4XE9 A;  4Y24 A;  4YYO A;  2J1R A;  2QDN A;  2QQM A;  5FY4 A;  2XWB B;  2R1D A;  4GWN A;  2XDV A;  1AJO A;  3CQO A;  4YVW B;  1KS5 A;  2OS2 A;  1RUI 2;  3BI3 A;  3C8X A;  1C1L A;  4TN7 A;  3AYE A;  1WA6 X;  1LHO A;  5F39 A;  3JBG 3;  1H8T C;  3WV6 A;  1AX2 A;  5C3P A;  4PDW A;  2AYH A;  1O4Y A;  2OPK A;  3RNS A;  3I3Q A;  4GMP 1;  4AAP A;  2JG8 A;  1PMH X;  4MGZ E;  4NII A;  3DGT A;  2VUC A;  4O9G A;  2HWE 3;  2WZ8 A;  4QQP A;  3MF6 A;  4X6Q B;  5IJR A;  1W05 A;  3UJO A;  2RHP A;  3WP5 A;  4BLI A;  4JGY A;  3ZIW A;  2VZP A;  1DQ5 A;  1Y3T A;  1W2A X;  4J1W A;  4L99 A;  1NUK A;  4LT5 A;  2DFB A;  2BW8 A;  1CQ9 A;  1MPX A;  3IMM A;  1K5J A;  5CYY A;  1JMU B;  5IK8 A;  2BYV E;  5A3L A;  3B02 A;  3WG2 A;  3KHC A;  1N3O A;  1OQE A;  1LED A;  2DUP A;  3LOB A;  1QJF A;  4M3C E;  1SEF A;  1JOB A;  2WAO A;  2XVL A;  3I2H A;  5FMD A;  4EN9 B;  1FT9 A;  3VHP A;  2WUH A;  1ENX A;  2GMP A;  3PLQ A;  1AR9 3;  3ACL A;  4YNI A;  5A3T A;  4Q4W 1;  2FD8 A;  4NRP A;  2A70 A;  3K3N A;  4MOA A;  2JWP A;  3TWI A;  4CDQ C;  1S0B A;  3MV0 1;  2QTW B;  5C4W A;  5IT6 A;  1GU3 A;  1UO9 A;  3VBU A;  3O1M A;  4YVS A;  4EWA A;  1HXS 2;  3H1M A;  5SV8 A;  4FTS A;  3C7G A;  2CAV A;  2YYO A;  3FC0 A;  2BBA A;  2RS3 1;  3PHM A;  3VL8 A;  1GNH A;  1CAU B;  2IXC A;  4LNV A;  1CX4 A;  5EV7 A;  1UYZ A;  2Q8C A;  3KV5 A;  1O3Q A;  1ZRD A;  3QH7 A;  1CAW A;  4GMP 3;  1RUJ 1;  1H2M A;  3OGV A;  2Y0I A;  4WVM A;  3ZKU A;  1JYN A;  3RZH A;  1KS4 A;  2VBB A;  1PGW 2;  2WFF 2;  3VBH A;  5L73 A;  3I3M A;  5C6C A;  1UYY A;  1JYX A;  3IDB B;  5A3W A;  1F35 A;  1OH3 A;  5DXD A;  3TEX A;  5JCT A;  4YG6 A;  5KXD A;  1E5R A;  1SAC A;  1UOB A;  1ZBE 2;  3OBR A;  3RMX A;  4XMA A;  3LE0 A;  4K6B A;  5T50 A;  5I0S A;  2ZKN A;  4ISR A;  3O1T A;  1JZ4 A;  3HJR A;  1RVF 1;  4PIX A;  1Q56 A;  1WCU A;  3ILF A;  4LJH A;  2R06 2;  3GYD A;  1JN2 P;  3CF6 E;  5K9Y A;  3CZU A;  3ZKY A;  4NWW A;  4PBP A;  4ZKT B;  1IQA A;  1JXN A;  4RFR B;  3KT4 A;  2Z79 A;  3N9L A;  4H7L A;  5ANN A;  3T0B A;  5JZG A;  1XNB A;  5JXI A;  4Q4W 3;  2NYY A;  4CEY C;  1LGC A;  4QX7 A;  4JKM A;  4IEW A;  4NRM A;  5GLT A;  5DAP A;  3BVC A;  5BUV A;  4QDR A;  1LOC A;  5CAZ A;  1MEC 2;  4LO5 B;  2NN8 A;  2WO7 A;  1AX0 A;  3J4U H;  1LNS A;  2A6Z A;  1HRV 3;  5FMB A;  3HT2 A;  3WDV A;  4CDW A;  1SLA A;  2WSV A;  2J1E A;  3AK0 A;  4LA2 A;  4DQA A;  5FZI A;  5JMO A;  2JD9 A;  4RS5 A;  4H55 A;  1GR3 A;  1MZF A;  2VZS A;  3NV2 A;  5H9Q A;  2NQY A;  5LAS A;  2JXA A;  3FLR A;  4XDO A;  1W8N A;  4M3C A;  2EXJ A;  3M3E A;  3VD7 A;  3HN3 A;  1W6M B;  3VV1 A;  4DUV A;  2DCZ A;  4FPE A;  2WZP P;  4Q27 A;  4UWD A;  4EE2 A;  3I3E A;  2GN3 A;  3IPV A;  4I0B A;  1RUH 3;  1XE0 A;  3DPR C;  3R0R A;  4Y5T A;  2J22 A;  3H8U A;  4D6S A;  4LQR A;  3NST A;  4PT6 A;  4BPZ A;  4N43 C;  1Z7S 2;  2JG8 B;  4GD4 A;  3RDI A;  4A45 A;  1D2S A;  4GAL A;  3U4X A;  1D7P M;  3LIH A;  3GZE A;  2C0Z A;  5C7G A;  3LA7 A;  4Z1V A;  2EIG A;  2FDF A;  3KGZ A;  4QXK A;  4JGY B;  5FLI A;  4KWL A;  5LAT A;  2AC1 A;  3B93 A;  4KBZ A;  4Y1Z A;  4IEO A;  1DP0 A;  2LW8 A;  4FQZ A;  4YRD A;  3WNO A;  2HH9 A;  2WZR 3;  2EA7 A;  3UKT A;  3P3N A;  1NLQ A;  4OYU A;  1DHK B;  1KIT A;  3MUZ 1;  5JOZ A;  5APA A;  4A4A A;  2CL2 A;  3ZYP A;  3POE A;  1HQN A;  4LPL A;  2GND A;  3CJX A;  1DIW A;  5FK7 A;  2QQU A;  1JUI A;  1SLC A;  2QNK A;  2VGD A;  4DRR A;  2A6Y A;  1MZ6 A;  3CDZ B;  5C5T A;  3AYC A;  1X50 A;  3PIG A;  4PLM A;  2C26 A;  1MZE A;  3ZYJ B;  2DTY A;  2Y60 A;  4M4P A;  1G9A A;  1EAH 2;  2PXJ A;  2JEM A;  5JWP A;  2ZGT A;  2PEL A;  4HVQ A;  5C4W B;  1JZ5 A;  3JD7 1;  1QKQ A;  3MLJ A;  5KR7 A;  5EJ3 A;  2Z42 A;  4YVS B;  1WLT A;  2VZ3 A;  4AWD A;  1ZZ7 A;  1OQ1 A;  1ZZ9 A;  3AZX A;  3GBG A;  5CG9 A;  5FZD A;  4NHM A;  5IVV A;  4R9D A;  5EFU A;  3MI8 A;  4AEJ A;  1CAW B;  3VDB A;  3WQ1 A;  1Q8Q A;  4WVM B;  1WW5 A;  4RFT 0;  1OMI A;  4RD7 A;  2XVK A;  3VBH B;  3RJ2 X;  4I0A A;  2ZZJ A;  1SPP A;  3N9N A;  3UGF A;  2HWD 2;  2WAB A;  1ENR A;  1BBT 1;  1Y43 B;  4COU A;  4CEW A;  1RUC 1;  2WQ8 A;  4BQX A;  2DCK A;  4QX2 A;  1ULP A;  4FAG A;  5FZC A;  3O12 A;  1QJY 3;  5CFC C;  1IPJ A;  4AFC A;  3U78 A;  4Z92 B;  5IFT A;  2ZAB A;  1DDL A;  3PVB B;  3BPS A;  3KCX A;  2Q0A A;  2YRO A;  2OVU A;  2ZMN A;  4HMZ A;  4Z2A A;  4RL7 A;  5JZG B;  1ZBA 2;  1PK6 C;  1XNA A;  2X5I C;  3TN9 1;  3WW3 A;  4BQ4 A;  1VBD 1;  1YQ2 A;  3KV4 A;  2W91 A;  3JD7 3;  3NNJ A;  4C0H A;  1OOP C;  1JUH A;  2O1Q A;  5AFB A;  1D0G A;  2ZX1 A;  4K3U A;  2DUR A;  1V00 A;  4CP1 A;  5AC9 2;  3M3I A;  1Q8P A;  2VUL A;  4TYS A;  5A1A A;  2BWC A;  5GAL A;  1N1Y A;  1L7Q A;  1R1A 1;  2RDR A;  5FMO L;  1DZR A;  1XND A;  3AKQ A;  4RS5 B;  3ZXK A;  2WWJ A;  4AED A;  4MLO A;  1X9T A;  3HBZ A;  2VOV A;  3ZN6 B;  4M3C B;  3WNN A;  5F37 A;  2YBS A;  1UZW A;  3WHT A;  3UNP A;  5CU1 A;  4FFF A;  1J83 A;  5IVJ A;  1MQT C;  3AXE A;  4IEP A;  3P6B A;  5F6K A;  3IPV B;  4CDU C;  5L7O A;  5DG1 A;  1R09 2;  4QX8 A;  2OYZ A;  3HT1 A;  3INA A;  4FI9 A;  2W0X A;  4LHS A;  3GJB A;  5FQ0 B;  4BM8 A;  4GKY A;  3U37 A;  1A6C A;  2OW4 A;  4UBH A;  4FFG A;  4BLJ A;  3OUJ A;  2IFW A;  4OVE A;  3IB3 A;  2RE9 A;  4COY A;  3VD4 A;  1AL2 1;  5I0T A;  2Y0O A;  4IET A;  3M1H A;  3ON7 A;  3M3C A;  4M0N A;  4R4Z A;  5F8P A;  1BVV A;  1DYO A;  3LA3 A;  5LY2 A;  4AXO A;  2PHT A;  4YM0 A;  4ERO A;  3VBS A;  1O3T A;  3NV3 A;  1VBD 3;  4YW6 A;  4R8H A;  1C8M 2;  4WM7 C;  3BAL A;  3AZZ A;  1L3J A;  2A71 A;  2J42 A;  3VBF B;  4OMD A;  3H0O A;  1GFF 2;  2WKK A;  1TME 1;  1H9W A;  3WP6 A;  1IKQ A;  1UOF A;  1CIW A;  3VDD C;  1DYK A;  1H8T A;  1W8H A;  2XJT A;  5FTT C;  2W92 A;  2C9K A;  2AEN A;  4RGG A;  1I9R A;  3ACF A;  2HEV F;  5FMC A;  1VRB A;  4TSV A;  4RYD A;  2VO5 A;  3ZYR A;  2WSU A;  1LHU A;  1YFY A;  1YQ6 A;  5LEJ A;  4Y1X A;  3T3Y A;  2CNA A;  3WDX A;  3UV9 A;  3DUI A;  4A2U A;  1URX A;  1A34 A;  1B09 A;  4OUL A;  2EXH A;  3W5N A;  2ZX0 A;  4DXZ A;  4J25 A;  4XBQ A;  4DEV A;  3KD4 A;  4A6O A;  4ARX A;  4E27 A;  4UBG A;  2ZA9 A;  5IK4 A;  1PO1 1;  2B45 X;  5FYT A;  5DZG A;  4CCE A;  4FPC A;  4CXY A;  1D4V B;  4N9I A;  3B94 A;  1YC6 1;  1AX1 A;  2VJX A;  3ZVX A;  3J7M A;  5LBB A;  5HV4 A;  1LHW A;  3MGU A;  5FZ0 A;  2RDQ A;  1FMD 1;  4QKN A;  2QQJ A;  4OHW A;  1OD5 A;  2CYF A;  4CDQ A;  3P5B A;  3H7J A;  4LUL A;  1SBE A;  4D0Q A;  1SCR A;  2Y6H A;  2ZGO A;  4YZ3 A;  2IXL A;  5FZM A;  1GQG A;  5FP4 A;  1B35 C;  3RYK A;  3IN9 A;  2PAE A;  4HZF A;  4P02 B;  4RSU A;  4ZU7 A;  3VDA A;  3BOW A;  4CCM A;  2GDF A;  1XXN A;  1XC6 A;  4B4Q A;  1VLN A;  4GWJ A;  4AYU A;  4MGT A;  1PNG A;  2ZX3 A;  4K8R B;  3WQ7 A;  3B5L B;  3B7M A;  3BTY A;  2ZEY A;  4XEZ A;  3AL6 A;  4Y4Y A;  4ES8 A;  4AVC A;  4URA A;  2JDK A;  1CON A;  2GNM A;  4Q4X 3;  2ZXQ A;  1LTE A;  3UET A;  4NIH A;  3ZIX A;  2Y33 A;  4QDS A;  4V2W A;  3BYW A;  1ACC A;  5T5J A;  2E53 A;  3GCW A;  3RYR A;  4AED B;  3AJZ A;  3ILR A;  3AC0 A;  1DU3 D;  4MGI E;  1WD3 A;  3JQW A;  1XE7 A;  3PJY A;  1PX3 A;  5C3S A;  2P4E A;  4LBN A;  2HWE 2;  3OOX A;  5L7O B;  4RA0 A;  2UYB A;  1XB9 A;  4TLF A;  4W6W A;  5FUP A;  1HKD A;  5JPM B;  4FPH A;  2FZ2 A;  1RHI 1;  1XNK A;  3WT3 A;  1RUF 1;  1V6N A;  1LOD A;  2IZW A;  2WYS A;  3V0B B;  3HQR A;  4HLT A;  1LEN A;  4BCU A;  5F3I A;  4IV3 A;  4AL9 A;  3WX5 A;  3VBR C;  1LRH A;  4GB3 3;  1ZRE A;  3VBS B;  2ZJC A;  3ZXG A;  1RUN A;  1ZNP A;  1UPI A;  4XBL A;  3RWN A;  3HEI A;  2G19 A;  5I0U A;  1GZW A;  4K20 A;  3NV4 A;  5FJH A;  4AGV A;  3KT1 A;  1VBA 1;  1H2K A;  1W9T A;  1ZRR A;  5DZF A;  1FI2 A;  1LCL A;  2WQZ C;  1H8T B;  3T09 A;  3DPR A;  2E6V A;  4IGQ A;  3CNA A;  3ZDV A;  1W0P A;  2VD7 A;  5FY8 A;  2ETE A;  2Q8E A;  5IVC A;  1LJ7 A;  3GNE A;  4N43 A;  5EJ1 B;  1YJL A;  3ZXA C;  4UW3 A;  2UUR A;  4UFK A;  4EN0 A;  3ACG A;  5E8A A;  3UES A;  4AFD A;  3OYW A;  1VBE 1;  1CAV A;  1NCQ A;  4NO4 A;  4HFS A;  4BQ2 A;  1WMX A;  5A7Q A;  1VBB 3;  4B4R A;  4RR3 B;  3ZPO A;  1CN1 A;  4QHB A;  4J6G A;  5JIA A;  1RHI 3;  1CWP A;  2P3J A;  3GZT B;  2YXS A;  4EZH A;  3VD9 A;  3ECQ A;  4J1X A;  4XHB A;  3T2T A;  3WW2 A;  2VMF A;  3BU7 A;  4W65 A;  4NWV A;  5ACA 3;  2BVB A;  4NHL A;  2ZBJ A;  4YW7 A;  5C8C C;  2DV9 A;  3GGL A;  4HET A;  4XUN A;  1X8M A;  5B2G B;  4LLO A;  2HWC 1;  1OLQ A;  2QQL A;  4H7M A;  1PNF A;  3VD3 A;  1W04 A;  3EBR A;  3KV6 A;  5DUU A;  3S6P A;  4CDQ B;  1LEM A;  1QH7 A;  1DGW X;  2NM1 A;  1FPN 1;  3C7E A;  4HN1 A;  2X05 A;  4B7E A;  4CA9 A;  3NJX A;  1QJU 1;  3AZV A;  2D6L X;  2XGX A;  4YFW A;  5FZK A;  2XON A;  1JS9 A;  2Z5W A;  2GC3 A;  5F5I A;  2VOX A;  1STM A;  3N9Q A;  1N47 A;  3LZZ A;  3R4D B;  2RS3 2;  3EMR A;  1R08 1;  2YGM A;  2EF6 A;  1NA1 B;  1I3H A;  3V0A B;  2WNO A;  2E7A A;  3UYJ A;  5A33 B;  3I2K A;  1RUJ 2;  2GAU A;  1VBE 3;  4QGL A;  2UWC A;  4COZ A;  3AP6 A;  1FX5 A;  1DZT A;  1PO2 1;  3AXD A;  3S7E A;  2DCJ A;  2ZAA A;  1US2 A;  2C4X A;  4WVW A;  2FDI A;  2QBX A;  3ZN5 A;  1C3H A;  3VHR A;  3ZOI A;  2RDS A;  4IEY A;  2EIB A;  4IQP A;  5CFC A;  1SHW B;  5EYX A;  3L9J T;  2PHX A;  4SBV A;  5DUV A;  1RVF 2;  2ZX4 A;  3B00 A;  2RS5 1;  4QU1 A;  4QKF A;  1F8V A;  3JCI A;  2GP5 A;  1A8M A;  2HWC 3;  1ND2 B;  2W1W A;  2WR9 A;  4IGP A;  4XUR A;  5FFO C;  1V6J A;  1PK6 A;  2X5I A;  1O7F A;  4K1Z A;  5LRR A;  1U5Z A;  3QAC A;  4UW6 A;  2B9U A;  1OOP A;  1G9D A;  1PVC 1;  1QJU 3;  1NE4 A;  5T54 A;  4GH4 C;  3FFZ A;  4E4H A;  4IV3 B;  1W06 A;  4GXL A;  1SLT A;  4XIL A;  3RSJ A;  3WP3 A;  5I91 A;  5FZ7 A;  5FDB A;  3FLP A;  2AUY A;  1O4T A;  1LOE A;  1OA3 A;  5KHI A;  3ZMO A;  3K4A A;  2C9A A;  1V6L A;  2PLV 1;  3AP9 A;  5IAV A;  3ZYB A;  1F5J A;  3RJR A;  5JPN B;  4IE0 A;  2WFP A;  3O14 A;  2I74 A;  4ZZ5 A;  4FVV A;  2JG9 C;  1MQT A;  5FV3 A;  1PO2 3;  3ZFG C;  4MSV A;  1UU4 A;  4CDU A;  2WS9 1;  3OF1 A;  4XUT A;  5A7S A;  3T1L A;  4N43 B;  3SIS A;  5F3G A;  4JRA A;  4E2G A;  4LOR A;  2RS5 3;  4DXR A;  3EXU A;  3GXU A;  3LEI A;  3OYW B;  4NRO A;  2YFZ A;  4OHX A;  1UMZ A;  2A6V A;  1CAV B;  1NCQ B;  2ZAC A;  3NKG A;  4W4Z A;  1K5M C;  3B3Q E;  3WF1 A;  3I2G A;  4AQ2 A;  1WW7 A;  1W8F A;  1QQP 3;  2B8M A;  2CWM A;  4HSJ A;  1N1V A;  1A3K A;  5EJZ B;  1X82 A;  2SBA A;  1VBC 1;  4OCT A;  4WM7 A;  5JOW A;  2MHF A;  4IDZ A;  1BK1 A;  1PVC 3;  2I2S A;  3O5S A;  3NV1 A;  1AUY A;  2XOM A;  4NN0 A;  3GAL A;  3PDQ A;  2BQP A;  2P6H A;  5L9V A;  1C4R A;  4YM3 A;  5KWR A;  5JVV A;  5LWB A;  4MO3 M;  5GLU A;  5EZW A;  1RUD 3;  5AVA A;  3VDD A;  5JOX A;  3TOJ A;  1CD3 G;  5DAQ A;  1IS5 A;  5A3N A;  3HNM A;  5EPA A;  3GCX A;  5DMY A;  1UAI A;  2EXI A;  3E1F 1;  2EAK A;  1QF3 A;  3ME2 A;  2N7G A;  4XFG A;  1W8U A;  3KT7 A;  5LK7 B;  4HOO A;  1F5F A;  3N35 A;  4PLN A;  4LUM A;  4YWA A;  2Q8O A;  2OUJ A;  1ULE A;  4MGK E;  1X36 A;  3BTZ A;  3WEZ A;  3P3P A;  1XBF A;  1TNR A;  3AMP A;  2UY9 A;  1YI9 A;  4KGQ A;  4OZX A;  1Y7B A;  4PIY A;  4URT A;  1COV 3;  1DQ6 A;  2VZU A;  3MBW A;  5ABJ B;  5FJK A;  3RI8 A;  1SFP A;  2V5Y A;  4DIN B;  1OLM E;  1V9U 3;  3TNP B;  1SMV A;  3IIA A;  2X53 S;  4XFH A;  1AR7 1;  5GJ6 A;  3C2U A;  4JCK A;  2ARA A;  4KWK A;  3ZSJ A;  1BBT 2;  5CFC B;  4MX3 A;  2BTV C;  4F3J A;  3HR9 A;  3GBW A;  1RUC 2;  3P1I A;  5C71 A;  4Q8K A;  3LPG A;  1IOA A;  4QD2 A;  4YW2 A;  5FZG A;  1UF2 C;  5JUV A;  3SHR A;  4XDQ A;  1Q8S A;  2IFR A;  5IVY A;  3USS A;  5FO7 B;  3AX4 A;  4NVP A;  3ZX7 A;  3ES1 A;  3G6J B;  3ZYG A;  4Y1Y A;  4YGC A;  2VOT A;  2Z69 A;  1QJX 1;  1GMM A;  2MNG A;  3TN9 2;  2W1U A;  1VBD 2;  5FPA A;  2NMO A;  5IW0 A;  5AFE A;  5ISL A;  5FP3 A;  2WRA A;  1REF A;  2PA7 A;  4QGN A;  1F9K A;  1DZQ A;  1X7N A;  4Q0S A;  1G6N A;  2ILM A;  2X10 A;  1QDC A;  4XDP A;  1PGS A;  4IV1 B;  3LF7 A;  3RQ0 A;  1R1A 2;  2ARE A;  2G1M A;  5EHD A;  4QU2 A;  3WNP A;  1MQT B;  3ZR5 A;  2W3J A;  4N53 C;  2ATF A;  2LM3 A;  4CDU B;  4IE4 A;  5A6Y A;  3JBG 1;  2YBP A;  3JZV A;  3U10 A;  2Q5T A;  3FBM A;  3POF A;  1ONA A;  2VQU A;  5J37 A;  3LQC A;  2YU1 A;  2IVI B;  2VQA A;  4G4F A;  2PHU A;  3KVA A;  4LBM A;  3T2Q A;  1CJD A;  2CV6 A;  3OG2 A;  1ZZB A;  4KH9 A;  5F32 A;  3VBR A;  3CL1 A;  1AL2 2;  1PM4 A;  1ZZ8 A;  4KU7 A;  1LOF C;  1SG3 A;  4LKE A;  1QJX 3;  4WM7 B;  5FPU A;  4Q4Y 3;  4AI2 A;  2ZML A;  4D6Q A;  1Q5O A;  4LK7 A;  5G04 L;  5H9R A;  4R4X A;  2HBT A;  2SLI A;  4K9S A;  4Q0P A;  3U4S A;  3SCH A;  2JIC A;  3W59 A;  2WL1 A;  5FY9 A;  3CIH A;  3VDD B;  4NPM A;  3CLP A;  1AR9 1;  1U5Y A;  1TMF 1;  4XCA A;  5FPV A;  3BOP A;  4JHT A;  1S2K A;  4LBJ A;  1TME 2;  3RGB A;  5F5C A;  4LXL A;  2XR4 A;  2F4L A;  2EVX A;  3OGG A;  5I8T A;  1BLZ A;  3PMS A;  3LAG A;  3LEK A;  4KU8 A;  2E31 A;  3LWC A;  1VIW B;  1O91 A;  4LBK A;  2RMU 1;  3ZR6 A;  3T2P A;  4C8D A;  4XQD A;  3UT0 A;  3O7O A;  4SLI A;  3S5A A;  3OGS A;  1PMI A;  5LCW L;  2YU2 A;  3C3V A;  1T2X A;  1VR3 A;  2KM2 A;  3HIF A;  3I54 A;  5FYZ A;  5KHJ A;  1UU6 A;  3MW4 A;  1EP0 A;  2QVS B;  2OPW A;  4Q26 A;  2Y6K A;  5KXE A;  4JGZ B;  2VQ0 A;  5KHG A;  5FKB A;  4PJY A;  1H1M A;  4LR4 A;  5FZB A;  1Z0H A;  1ULO A;  5C8C A;  2QQN A;  4XAC A;  3ZFE C;  1PIV 1;  1JHJ A;  1PO1 2;  5FXZ A;  4YW5 A;  2BNM A;  4HL0 A;  3PU8 A;  1JYW A;  4XOG A;  3SKV A;  3VD5 A;  1HDK A;  4I2O A;  4DOU A;  3SCF A;  1CZS A;  3AMN A;  1AR8 1;  2DBN A;  4XUP A;  1FMD 2;  1MS1 A;  4LBO A;  5FZ3 A;  4I09 A;  3PJQ A;  3OEB A;  1WME A;  3UGG A;  4DNY A;  5FZF A;  1UYP A;  4CU6 A;  1XSR A;  3BIW E;  1TMF 3;  4MGS A;  1YQC A;  1DGR N;  4GKX A;  4QM9 A;  4BA6 A;  4H14 A;  1Q8O A;  4M4R A;  5BXX A;  3OCP A;  4QB1 A;  1GAN A;  1NYW A;  4ZU4 A;  4R9C A;  4JTO A;  4MGQ A;  2FMD A;  5FYM A;  2QQP A;  2RMU 3;  1TNF A;  4AVV A;  3AMQ A;  3RG0 A;  4XF9 A;  5F1R A;  4QX5 A;  3FZ3 A;  3AKT A;  1V70 A;  1HRV 1;  1BYH A;  1GQH A;  4FBF A;  2ZZQ A;  3MIC A;  4MH0 E;  3TEW A;  4BHP A;  2D93 A;  4OHV A;  3VZN A;  3WDW A;  3ST7 A;  4XF4 A;  4RGK A;  4BYY A;  3O1P A;  1RXG A;  3I8T A;  4QQL A;  3MFA A;  1QXJ A;  2E33 A;  1K3I A;  3FX3 A;  4XQW A;  1ND3 C;  3WSO A;  2WNE A;  4TTG A;  4NIA A;  2P34 A;  2GNB A;  4P14 A;  4Y26 A;  4CYD A;  4PBO A;  1RMU 3;  1BZW A;  3OD4 A;  2CSG A;  1PIV 3;  4BME A;  1GLH A;  2PQS A;  3Q8B A;  1RUH 1;  1GP6 A;  1OKQ A;  4MUV A;  2WT1 A;  1AR8 3;  1OQD A;  3KMH A;  1W6O A;  3K77 A;  1IPK A;  2BV4 A;  4QQO A;  1DGW A;  4CPB D;  4FTE A;  1YFX A;  3B01 A;  4GH4 A;  4JRL A;  5E6H A;  3H8R A;  3WP4 A;  1RUF 2;  2LRO A;  3VBR B;  4UF0 A;  4RHV 1;  3T2O A;  1HRI 3;  2R49 A;  5BYN A;  1WLD A;  2WZR 1;  3IBM A;  3WNM A;  3DN7 A;  1TVG A;  3DV8 A;  3OSD A;  3POG A;  2GC2 A;  4HKW A;  4ZS2 A;  3AKR A;  3THP A;  2RR1 1;  1LU1 A;  1XYO A;  5FUI A;  3NAP B;  5T5O A;  3NO8 A;  3VHO A;  5ANQ A;  2JG9 A;  1AYM 3;  4WM8 C;  5DQ0 A;  1W03 A;  3PVE A;  3GHM A;  1I5P A;  1MS9 A;  1AXK A;  3AJY A;  4P9G A;  1SLB A;  3SH3 A;  3WG3 A;  3WUC A;  3FHI B;  3O1U A;  2QKD A;  4DXT A;  2QQW A;  1VBA 2;  2WO2 A;  5A7W B;  4PHZ A;  3B69 A;  5FZA A;  3VZK A;  1V6I A;  4XJ8 A;  4L0P A;  4AF9 A;  5LZ6 A;  2FDK A;  1CR7 A;  3R05 A;  2ARX A;  2GME A;  4B8E A;  4BQY A;  3DL3 A;  1Q3E A;  1K45 A;  1AHS A;  1K5M A;  1LB2 A;  2GH2 A;  4OI2 A;  1OFS A;  4QB6 A;  3GZA A;  4OZO A;  4PDW B;  4XFB A;  1QH6 A;  3ATG A;  3POI A;  4AFM A;  4K1Y A;  3WXP A;  5IFP A;  2P5B A;  4I0W B;  4P9Y A;  3ES4 A;  4B1M A;  1LGB A;  4MHR A;  3OY8 A;  1BCX A;  3OUH A;  1EY2 A;  2XG3 A;  3AMH A;  4RHV 3;  2X8K A;  1W8W A;  5K0U A;  1I5Z A;  2VW1 A;  1ASJ 1;  2RR1 3;  2HWC 2;  4UFI A;  1OPO A;  1QJY 1;  1FAY A;  1UY0 A;  1PHM A;  3A0K A;  1POQ A;  1YI7 A;  3CO2 A;  3H9A A;  2YMZ A;  4P5H A;  3SNM A;  2Y38 A;  4X8P A;  4C1X A;  4CDX C;  2ADE A;  1FPN 2;  4XHX A;  1WCQ A;  1J59 A;  1JYT A;  4NR1 A;  2ZAH A;  3GDB A;  1LR5 A;  2ID4 A;  3WF3 A;  2A3W A;  3VBU B;  1LOG A;  4QX0 A;  1R08 2;  4XF0 A;  4MXW A;  2IVJ A;  1GZ9 A;  3IKW A;  3MIB A;  1OHF A;  3HAG A;  1M06 G;  2QFE A;  2VH9 A;  4HON A;  1SQ4 A;  1POV 0;  5JSO A;  1VRH 3;  4HPK A;  4WVZ A;  1GNY A;  5JI7 A;  4XET A;  3MDP A;  3EO6 A;  4OQ8 A;  2NP0 A;  1PO2 2;  3AKP A;  2R04 3;  2X09 A;  1RUG 1;  1QOT A;  3LFM A;  4BQ1 A;  1WCS A;  2RVA A;  4AHY A;  1GSL A;  4B29 A;  1H9P A;  1ZVF A;  2BFU S;  1NLR A;  3KS7 A;  1VAV A;  4LOT A;  4YW3 A;  4F8A A;  1QHD A;  3Q8A A;  4CXW A;  4G9S B;  1W9Y A;  4I02 A;  3ZSE A;  1WGP A;  3O0X A;  3QCW A;  5JOY A;  2R7E B;  3AB0 A;  1ASJ 3;  1W6N A;  2ZCW A;  5BNO C;  1W6O B;  1LGN A;  4IER A;  3USU A;  4OUS A;  2Y34 A;  1UW8 A;  4AGR A;  5BNP C;  3H8O A;  1C5I A;  1S0G A;  3DKW A;  3R4U A;  1AYN 1;  1Q8V A;  2C24 A;  3POB A;  1PVC 2;  5FY1 A;  3WY6 A;  2PAK A;  4FSJ A;  2WDB A;  4AEM A;  2O8Q A;  4FPL A;  1RC6 A;  4UF0 B;  4CCD A;  2VBP A;  4L92 A;  5A3P A;  5FZL A;  1XYN A;  5HI0 A;  2H6B A;  1RJ7 A;  4ISQ A;  1QDO A;  1RGS A;  3E5U A;  1A8D A;  3O1O A;  4B7K A;  2WIN B;  3MW3 A;  2PLV 2;  1OBN A;  3PUA A;  1GWL A;  3U75 A;  3AFG A;  4N53 A;  4RQP C;  4CDW B;  5DN2 A;  4TZD A;  1HX6 A;  1M4W A;  5CKM A;  5K4L A;  3N7M A;  4ATE A;  3RZM A;  3WG1 A;  3U07 A;  3MYX A;  3MIE A;  1LU2 A;  4EN7 B;  5BNQ A;  2DFC A;  4KG8 A;  4M01 A;  4ES9 A;  5TSW A;  3NNL A;  1RUG 3;  3UKV A;  4A3X A;  1DF0 A;  2WS9 2;  1ULG A;  1GOF A;  1JBC A;  2CGP A;  1CX1 A;  3RZK A;  1K5M B;  2VG9 A;  3QOP A;  1C57 A;  3PUH A;  2ZEX A;  5GZC A;  2ZGN A;  4NAM A;  1LOF A;  5FP8 A;  1QY4 A;  2HYK A;  5B4X A;  3WQ0 A;  4KI5 M;  3A23 A;  5FYY A;  3TRS B;  2PTM A;  2XQR A;  1VBC 2;  1AYN 3;  5IVB A;  1EYB A;  1FV2 A;  1NZI A;  3OY8 B;  1MS5 A;  4QQ2 A;  4E2S A;  5A70 A;  2F4P A;  1DYP A;  3CJI C;  3HOB A;  2OQ6 A;  1UYX A;  1D2Q A;  2FHR A;  3SKJ E;  5K0U B;  4Z8B A;  3KLS A;  3NMB A;  3PUR A;  2IXH A;  5LRS A;  4YGD A;  2W08 A;  3EB7 A;  4NIG A;  3E5X A;  1HQW A;  1YO8 A;  3OPW A;  2VTX J;  3POW A;  1UZV A;  3UKN A;  4PI0 A;  1GBG A;  1W2O A;  3C7F A;  4LUK A;  2K46 A;  2GSY A;  5CB7 A;  5DDJ 2;  4AGG A;  4C90 A;  3H3Z A;  3VZJ A;  1YIF A;  4Q4V 1;  2RDN A;  1GWM A;  1IGO A;  2BVV A;  2RJ2 A;  2BRT A;  4XAE A;  2CDO A;  1PVX A;  2D5F A;  4MET A;  4MXW B;  1W6Q A;  2WWS A;  4Q4X 1;  4EYU A;  2YC0 A;  3ZFE A;  2XKP A;  1W90 A;  3PME A;  4YM2 A;  5DAX A;  2VOW A;  5SV5 A;  4LIT A;  3LDR A;  2OXB A;  2PN5 A;  1N1S A;  4HPK B;  5KHK A;  4HKO A;  4HVR A;  2RM2 1;  2MEV 1;  4NOT A;  1QEX A;  2CY6 A;  3RZL A;  2J1T A;  1FOD 1;  3ZXL A;  1XJA A;  1AR7 2;  1J3Q A;  2JDA A;  2WC2 A;  4LKS A;  5CFD C;  4ZHN A;  1SPP B;  2E9Q A;  4AOC A;  5G05 L;  1SFY A;  3SMH A;  4OQ9 A;  1C1F A;  1BEV 3;  1S0J A;  2A6X A;  4CEW B;  5F2S A;  1RL3 A;  4DFS A;  1HIX A;  4YVW C;  2JE7 A;  1W6N B;  3M3O A;  4XBN A;  1QXR A;  4LOS A;  2OII A;  1QU0 A;  2V5D A;  5FBZ A;  3MIF A;  4QXB A;  1MAC A;  2LRP A;  5LB6 A;  3USU B;  5LA0 A;  1WBF A;  3VN4 A;  1ULF A;  2BNO A;  4OFG A;  1QJX 2;  2XUM A;  5K8S A;  4YFZ A;  1U12 A;  4GAZ A;  3QBQ A;  3O1R A;  5FOB B;  1VAM A;  2IC1 A;  2ZHL A;  3JB8 A;  4AR2 A;  5A1L A;  4GB3 1;  1T6B X;  2J1S A;  1OI6 A;  2P3K A;  1OFN A;  3APB A;  4Q4V 3;  4JAA A;  2P3Y A;  1O5U A;  1ND3 A;  5CKQ A;  2ZPX A;  1GZT A;  4I01 A;  1BXH A;  1HV0 A;  1NAE A;  3MIG A;  4QKD A;  3NKT A;  5EP9 A;  4BWO A;  1S0E A;  3O0W A;  4LKF A;  4WZC A;  1E5H A;  1KD7 A;  5JSP A;  3J9S A;  3TNQ A;  1DBN A;  2MEV 3;  2RM2 3;  2W68 A;  1O5L A;  4XF1 A;  5K7P A;  2Q1Z B;  1FOD 3;  4OUM A;  4BXS V;  1VP6 A;  2IXI A;  3JBG 2;  4QQH A;  4E4Z A;  1SLI A;  4IE7 A;  1PGL 1;  1O4Z A;  2PAM A;  2XBO 1;  4UW5 A;  1RUI 3;  1E5I A;  2KA3 A;  2VTF A;  5FZ1 A;  3DYM A;  2LUW A;  4QPI C;  4FPG A;  2WII B;  1VBB 1;  4CEY A;  3VUO A;  2CGO A;  2YG0 A;  1O6U A;  3ZO0 B;  2JIJ A;  3NNG A;  1WCD J;  1XU2 A;  1KDK A;  3F2Z A;  4XUQ A;  5H9P A;  4AVS A;  2VNR A;  4AW7 A;  2ZX2 A;  5KBF A;  1ENQ A;  3VZL A;  2XJU A;  2WA4 A;  2HWF 1;  4LO8 A;  2WFF 1;  3J7L A;  4QHZ A;  4CCL A;  1POV 1;  4D94 A;  2YFU A;  3KQ4 B;  4IEZ A;  4WM8 A;  4K7J A;  2ES3 A;  5ACA 1;  1JW6 A;  1G7Y A;  5DUW A;  5C9A C;  1S0D A;  3FHA A;  2QQI A;  4JQT A;  1R64 A;  4HXC A;  4OLL A;  4ARY A;  1QOO A;  2A75 A;  4BXF A;  4LHK A;  1UU5 A;  1UY2 A;  3CHX A;  4ONU A;  2B39 A;  5A32 A;  4R9B A;  2NPI A;  1AR9 2;  3H7Y A;  1TMF 2;  4ATF A;  3LPF A;  4XAB A;  4XIO A;  2DTW A;  2CTV A;  2W52 A;  1X8E A;  4WVV A;  1C8N A;  4XJ9 A;  3RZZ A;  3ABZ A;  1W99 A;  1V6M A;  1IKP A;  3N7J A;  3E6C C;  1BKZ A;  4MG2 A;  2K9Z A;  1ZZ6 A;  3DEC A;  4AZZ A;  4EV0 A;  2Q1F A;  4FOY A;  3AP5 A;  3WHU A;  4Q1R A;  3ASI A;  3O1V A;  2W5F A;  4DS0 A;  4FOQ A;  1TG7 A;  3BCW A;  1ZRC A;  5C8W A;  2E7T A;  1W6Q B;  3E6D A;  2VPV A;  3W20 A;  3FJS A;  4AG4 A;  2XBO 3;  1HXS 3;  3ITQ A;  2VCB A;  3V56 A;  1MEC 1;  1U0A A;  2QDR A;  4KWJ A;  3ZFE B;  4Y20 A;  5D8A C;  5DAB A;  2ZGR A;  4YG3 A;  2GNT A;  1WLW A;  5FZ6 A;  1PIV 2;  3FUQ A;  3IM0 A;  1ST8 A;  1AXZ A;  1WZX A;  4HSL A;  2HWF 3;  3T30 A;  2WFF 3;  3H1W A;  1POV 3;  4XF3 A;  2R6Q A;  4O7X A;  2I45 A;  1HJF A;  3FL7 A;  2VUD A;  3THC A;  4C91 A;  3TAY A;  1NQJ A;  1OXC A;  1CJP A;  2D6M A;  4HKL A;  3N36 A;  1YCI A;  1SDD B;  3MLL A;  2KR2 A;  2W47 A;  4UAP A;  3FWE A;  3GJA A;  4Q4W 2;  4Z2W A;  2KD7 A;  3HBK A;  2R06 3;  3PVO A;  2VBD A;  2YUE A;  4FXK B;  2ZGL A;  4JC1 A;  5FUN A;  3T0A A;  1NXD 1;  3S7I A;  3K51 A;  3WQB A;  1LES A;  2ZGM A;  4DB5 A;  2WT2 A;  4AI9 A;  2WLQ A;  4XFI A;  1VB4 A;  1HRV 2;  1KGY A;  1REE A;  1ND3 B;  3D3A A;  4JKL A;  1AR6 1;  3JQX A;  4TLG A;  1VPH A;  3URF A;  1W9W A;  3ZYI B;  1MEC 3;  4JV4 A;  4I30 A;  1L7L A;  4GIQ A;  2DVA A;  2YPJ A;  2A7A A;  1YYN A;  3FHQ A;  1S2B A;  3IT8 A;  4HBN A;  1MZ5 A;  5A3O A;  5C3R A;  2WNV C;  1O8S A;  5CIS A;  5HV0 A;  5T5P A;  1WBL A;  4OHZ A;  3WVJ A;  2D7F A;  4CVU A;  1EAH 1;  1RUH 2;  4CP9 A;  5KXB A;  5BNP A;  1OC1 A;  1SLL A;  1AL0 G;  3NL1 A;  2VMH A;  1X9P A;  1FNY A;  2B46 X;  1UOJ A;  3CKH A;  3FBY A;  3KM5 A;  2VCA A;  1QQP 1;  3LD8 A;  4CEY B;  1XRU A;  1J1T A;  3GBF A;  4Q0V A;  4CCK A;  2YC2 A;  4YG0 A;  1F31 A;  3MLK A;  2A5Z A;  2J7M A;  2Y8K A;  4RHV 2;  3J8F 1;  4AQ6 A;  2LS6 A;  2QQK A;  4A42 A;  1V6O A;  2WZR 2;  4CRQ A;  1LOB A;  2VZ1 A;  4FPY A;  1QGL A;  3U14 A;  2HBU A;  2RR1 2;  4WM8 B;  4DIQ A;  2ET1 A;  2H6C A;  1MR5 A;  4UYB A;  3GF6 A;  1RUD 1;  3LEG A;  5LBC A;  1BJQ A;  4XZU G;  1LUL A;  1NLS A;  1OUS A;  5FYI A;  3VKL A;  1QNY A;  1RUO A;  3ORJ A;  1W0N A;  4EQV A;  5L19 A;  4D3W A;  1MS3 A;  1YEW A;  2WA3 A;  1AR6 3;  1GZW B;  4LBQ A;  2W39 A;  3UL2 A;  4QXH A;  4LIU A;  3RS6 A;  3I7D A;  1PM7 A;  2VNV A;  3NJV A;  3ZM8 A;  3DPR B;  2VVD A;  3OGJ A;  2E63 A;  5FYV A;  3LOI A;  1QMJ A;  2ARB A;  2DBI A;  4YSF A;  2PHR A;  2EIE A;  5GZE A;  3SQO A;  3LDB A;  3PUI A;  1EAH 3;  5BPX A;  3C7H A;  2Z2S B;  1COV 1;  3WOG A;  2OT7 A;  4Q0Q A;  3W5M A;  2VXR A;  1ZRF A;  2DWR A;  1V9U 1;  3PUQ A;  2B7Y A;  1UPS A;  3CJI A;  4XAA A;  3OGR A;  1YIP A;  4HN0 A;  3ZN4 A;  3M7A A;  1KJL A;  3J8F 3;  4IW3 A;  4QB2 A;  4CTE A;  3F95 A;  1NKG A;  2B42 B;  5IVE A;  1VJ2 A;  2PHW A;  3MW2 A;  2BU9 A;  1F2N A;  3VB9 A;  1QJY 2;  3C7O A;  2JB8 A;  4RS5 C;  2Q1M A;  5EWS A;  4BQW A;  1KDM A;  4UFH A;  5JR2 A;  4PQ9 A;  4UXA A;  1JU4 A;  3K75 B;  2AR6 A;  3X29 B;  4CCN A;  1H2L A;  2OX0 A;  4QGM A;  4H2A A;  4W50 A;  4KNC A;  3N4M A;  3LKJ A;  3QD6 A;  2P37 A;  2QZ2 A;  4L97 A;  4CUG A;  5HCB A;  3JD7 2;  5D1I A;  1WUV A;  4GWI A;  3ZLI A;  4BIS A;  4AEK A;  2ZGU A;  1UNB A;  1KFX L;  1W9S A;  2XJQ A;  4FFI A;  5CA6 A;  2Y6F A;  4CCC A;  1ZBA 3;  4TWT A;  5E16 A;  3MF9 A;  4OMC A;  2BGC A;  2JDN A;  3ELN A;  3TEY A;  1LKN A;  1V6K A;  4GUL A;  3LSE A;  3D5O A;  2BPA 2;  5CFD A;  1ODM A;  3IWZ A;  2D6P A;  1OVP A;  2WN2 A;  1XNC A;  1NXM A;  4CU9 A;  5HBA A;  5T3N A;  1H8V A;  2EAA A;  2JDY A;  5AC9 3;  1F4H A;  4BJ0 A;  4JDN A;  2W2I A;  3VBF C;  4YVW A;  2ZEW A;  1HB1 A;  2RJL A;  2Q4S A;  4CP9 B;  1ALY A;  1B35 A;  5I8S A;  4H3W A;  3G7D A;  5JDB A;  2G9F A;  1YXW A;  3S30 A;  1JOP A;  4XZP A;  1W8O A;  4A41 A;  4CZS A;  4NHK A;  5T55 A;  4LK6 A;  3VKM A;  3WD5 A;  3H42 B;  4UOJ A;  1WKY A;  1PK6 B;  2X5I B;  1AYN 2;  5LBE A;  2R0H A;  5FWE A;  3KCC A;  1RUE 1;  1R09 3;  3B9I A;  3SLI A;  1OOP B;  3LFI A;  3NWK A;  4Q4Y 1;  3O0V A;  4YZ2 A;  3UGH A;  3AFK A;  4B1L A;  2D5H A;  5GZF A;  4FO9 A;  2BNN A;  5GLZ A;  1S2E A;  4CUA A;  3HPN A;  5FPL A;  2XUE A;  2QQO A;  3WR0 A;  4QHO A;  3S0M A;  4AI0 A;  4PIZ A;  1Y4W A;  4BIO A;  4LBL A;  4E2Q A;  1CZV A;  3OBA A;  1C8M 3;  1NT0 A;  3RPQ A;  3V0A A;  4LBQ B;  5F7U A;  3WDY A;  5FOJ B;  2C6S A;  2GC0 A;  2WO1 A;  5CNA A;  3VKO A;  1EV1 1;  2BDR A;  4P9L A;  1W6P A;  5FIX A;  4QPI A;  1IPS A;  1GOH A;  1MS4 A;  1NE6 A;  2W46 A;  4DZG A;  3K2O A;  3WDT A;  1RYY A;  3AYD A;  2CAU A;  4OI4 A;  1OLR A;  3AL5 A;  4S2G A;  4AFA A;  2XL7 A;  5E1R A;  5FBJ A;  5C33 A;  1QJZ A;  3S57 A;  2CGN A;  1QOS A;  3IDE A;  1LEC A;  4MHU A;  1YHF A;  3WNK A;  2Z4F A;  4QX1 A;  5EXO A;  3U11 A;  4HK8 A;  1ENS A;  5FPX A;  5C9A A;  1ZYB A;  2JKB A;  5GZG A;  3CJI B;  3D6E A;  5F3E A;  2WO3 A;  5IVF A;  1KXG A;  1RUE 3;  2W9X A;  2FMY A;  2ERF A;  1CZT A;  3WLU A;  4MV2 A;  5FXV A;  4DMI A;  5A80 A;  1ZZC A;  2BP6 A;  1OT5 A;  3KCY A;  5J96 B;  2IXK A;  4P9X A;  1ZX5 A;  5DAW A;  1YFU A;  5FY7 A;  3SCG A;  3A21 A;  4EN6 B;  2Y26 A;  2B4K A;  4A7Y A;  3IMN A;  4ET7 A;  4R52 A;  1Q43 A;  2GP3 A;  4N9H A;  2O8O A;  1GUI A;  3NRU A;  3BIE A;  2VME A;  5HXV A;  3VDC A;  3MO4 A;  5C3Q A;  1TE1 B;  1UWW A;  3H8X A;  5L7O C;  3I3B A;  4PF5 A;  2VW0 A;  4S2F A;  2HWB 1;  1EV1 3;  4LEJ A;  1UZY A;  2Y6J A;  5D8A A;  2MPF A;  2XLA A;  4E8C A;  4Q4X 2;  4QT6 A;  1IS3 A;  4TXW A;  5KC6 A;  1RXF A;  1Y9Q A;  4LKD A;  5A7N A;  3KGL A;  3CMG A;  3IDC B;  4QKB A;  3V64 A;  2XWJ B;  4OI1 A;  4BZ4 A;  1UY4 A;  2ZGK A;  2RM2 2;  2MEV 2;  3ZMN A;  4YZ4 A;  2ADD A;  3MV1 1;  3RVH A;  1FOD 2;  4L11 A;  1RMU 1;  4BE3 A;  2DF7 A;  4FOV A;  3WW1 A;  4LTA A;  4WV8 A;  4DY3 A;  1W6M A;  4HAN A;  2WBK A;  3LIG A;  2VEC A;  2Y6L A;  5LK5 A;  4NAO A;  1B35 B;  4LE3 A;  1XQN A;  2VAU A;  3CBN A;  1EPW A;  2R30 A;  1OKO A;  3E5Q A;  4ZON A;  5CAD A;  3V65 A;  5FP9 A;  3I2O A;  2R07 1;  4JDM A;  4XVH A;  4QPY A;  5FY5 A;  4WBB A;  1JYI A;  1HRI 1;  2HKX A;  4YM1 A;  1JZ6 A;  4K8F A;  1JOJ A;  1VB2 A;  3III A;  2V73 A;  3WCR A;  1I6X A;  5JIU A;  1J84 A;  4O61 A;  4QXC A;  1EPZ A;  5IAT A;  1PZ9 A;  4GB3 2;  3HNB M;  4DPN A;  2D6O X;  3ZFF C;  4DUW A;  4EWD A;  4NMI A;  4RR3 C;  2HWB 3;  1DLL A;  3WF2 A;  2Y64 A;  1RB8 G;  1Z78 A;  4Y5S A;  1AYM 1;  4E4D X;  1JH5 A;  4XC9 A;  4ZXK A;  1P8J A;  3BPZ A;  2TBV A;  1UL9 A;  2D98 A;  3SH4 A;  1ZA4 A;  4ZXE A;  2PMW B;  2VM9 A;  2WNV A;  3NVC A;  1RJ8 A;  4MGY E;  4KBB A;  4CP0 A;  3THD A;  5J36 A;  4Y33 A;  2O0O A;  5FYB A;  4CXX A;  1RED A;  1XNT A;  2WWU A;  2ZHM A;  1ULC A; 
#chains in the Genus database with same CATH homology
 3GZE A;  3NNL A;  5LAT A;  4KBZ A;  2HBU A;  5L9R A;  2JIJ A;  5LBC A;  2HBT A;  5L9B A;  5C5U A;  3PL0 A;  4XCA A;  3OUI A;  4BQY A;  5L9V A;  5C5T A;  5DAQ A;  5A3U A;  4MHU A;  4XAB A;  2JIG A;  5EPA A;  4NHL A;  4Q5O A;  3DKQ A;  4J25 A;  4MHR A;  4NHX A;  3KT7 A;  3OUH A;  4NHM A;  3W21 A;  2OPW A;  4XAA A;  5LA9 A;  5LBB A;  5HV4 A;  5DAW A;  3HQU A;  3MGU A;  4JZR A;  2RDQ A;  4XAC A;  5DAV A;  5LBF A;  3W20 A;  4IW3 A;  3ITQ A;  5M0T A;  2RDN A;  3EMR A;  4BQW A;  4BQX A;  2FCT A;  5DAX A;  5IAX A;  2RG4 A;  2FCV A;  3NNM A;  2RDS A;  2V4A A;  3OBZ A;  4ZPI A;  2Y33 A;  3GJA A;  3NNJ A;  3KT4 A;  5LB6 A;  5DAP A;  3BVC A;  4NAO A;  2RDR A;  4ZON A;  3NNF A;  4NHY A;  2Y34 A;  5ERL A;  2G1M A;  4XCB A;  4NHK A;  5LAS A;  5IAT A;  5IAV A;  5HV0 A;  5EP9 A;  3HQR A;  2FCU A;  3GJB A;  4NMI A;  4UWD A;  4Y5S A;  5LBE A;  4XC9 A;  3OUJ A;  4Y5T A;  2G19 A;  2A1X A;  5EQU A;  3KT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...