1SPPA

The crystal structures of two members of the spermadhesin family reveal the folding of the cub domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
109
structure length
109
Chain Sequence
LDYHACGGRLTDDYGTIFTYKGPKTECVWTLQVDPKYKLLVSIPTLNLTCGKEYVEVLEGAPGSKSLGKFCEGLSILNRGSSGMTVKYKRDSGHPASPYEIIFLRDSQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (seminal plasma protein/spp)
molecule keywords MAJOR SEMINAL PLASMA GLYCOPROTEIN PSP-I
publication title The crystal structures of two spermadhesins reveal the CUB domain fold.
pubmed doi rcsb
total genus 17
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 1997-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 1sppA00
5CKNA 3POIA 4LOSA 2QQMA 4LORA 3POBA 4GZ9A 2WNOA 1SZBA 5CKQA 2QQLA 1NZIA 4LMFA 3KQ4B 1NT0A 5CKMA 2QQKA 1SPPA 1SPPB 3DEMA 3POJA 1SFPA 3POGA 2QQOA 4LOTA 3POEA 3POFA 5CISA
chains in the Genus database with same CATH superfamily
4Z8BA 2ZGTA 4LHSA 1VIWB 5T5OA 3DCQA 1OQ1A 1R081 2WA4A 1RINA 1MS5A 1S55A 5A70A 2VBDA 3A7QA 3GGLA 4GZ9A 2VH9A 1NXMA 4W8JA 3NAPA 4FPKA 3Q8CA 4XMAA 2ZGMA 1LKNA 3ABZA 3HBZA 4MXWA 1NOVA 4QKNA 3S7EA 1XNAA 4BQ5A 3UV9A 3AMHA 4Q2FA 4GWIA 1U5YA 2X10A 1KRIA 4XFBA 5C4WC 2A6ZA 3ZDVA 1LAJA 1UD1A 4H7LA 3LFMA 3U37A 5D2AA 4YGCA 4AHYA 3VD9A 1CZTA 2VCMA 3AZYA 3GCWA 1RXFA 4NROA 1US3A 5D1IA 5CFDA 2FDKA 2W2IA 3RZHA 1HXS1 1WGPA 2HWB3 1G9FA 4Y3OA 3KLSA 3THCA 4RSUA 4LE3A 5J3UA 1BK1A 1LTEA 2Y6GA 4QKBA 1DBNA 1PGW1 3J26N 1JU3A 1H9PA 2GH2A 3BGAA 3DPRA 1W2OA 2EIBA 4XW3A 1PHMA 5CKMA 1LOFA 2HWC1 4GJYA 3A21A 5ABJB 1VP6A 1F35A 1NUKA 2RS51 5F3IA 3POJA 5DUVA 5EV7A 1PX4A 1VE0A 3GJAA 4D94A 4R9DA 2CL2A 1NLSA 1RVF2 1YXWA 2YDEA 3HOBA 4RR3B 5BY5A 1LODA 5KXBA 4GWMA 1N3QA 1MVEA 1VR3A 2WINB 1MEC1 3KT1A 1UIKA 5CKNA 4R9BA 4XDPA 4KI5M 1NE4A 2P3KA 1N3OA 4K3UA 2JB8A 1RHI1 1JI6A 4XJZA 5FZLA 5A1LA 4LBNA 2KD7A 1KXGA 1X9PA 3NAPB 4Q4V3 3P3PA 4ZZ8A 1TQ5A 1LB2A 1NCRA 4FXGB 3OTFA 2X09A 4UW3A 3T2TA 4Q4V2 2BFUS 1H30A 3JZVA 4W50A 3MW4A 3N7KA 2YROA 5FV3A 2BJSA 1SCRA 3WW3A 1UL9A 4LLFA 4LKSA 1GR3A 2UU8A 1AR92 3IWZA 3GZAA 5A7NA 3RI9A 2FDGA 3N35A 1YI9A 2F4LA 4YLZA 4CXWA 2Y26A 4UFMA 4CU6A 4Q4Y1 3WINE 1CWPA 4J6GA 4PLOA 5G05L 4XF3A 4XILA 3MHZA 4A6OA 2RS33 2ARCA 2OT7A 2QQVA 1JMUB 2EIDA 2RM22 3IIIA 5FP9A 3RYKA 1OKOA 3WQBA 3N9NA 2PHXA 4XF4A 1YJLA 2RS32 2Y6FA 4NRPA 1RUI1 2GZWA 5A3MA 5I8YA 5JZGA 4ES9A 4Q4X2 5A3TA 1W9TA 1N3PA 2XWBB 2WL1A 4MH0E 2GC3A 1H2KA 5FYZA 5J37A 3BTZA 4RD7A 1JN2P 2A5ZA 2XHNA 1PIV1 2VUDA 5FR3A 3WEZA 2XDVA 4NIDA 3BALA 5C3PA 5K0UA 1NY72 4PT6A 1HRV1 2WQZC 4P14A 3ZOIA 5F3EA 3D0SA 4LR4A 4OUEA 4CP1A 1JUHA 5JXJA 1W6NA 4YGBA 2ZX3A 1FXZA 4WZCA 4P9LA 3MLKA 2DF7A 4N8MA 5FZOB 3U14A 4BQXA 1GOFA 1HKDA 1VMJA 2BBAA 4MOAA 3WHTA 4IETA 5FWJA 1NCRB 2WZ8A 1BCXA 1H6XA 2MEV3 4Q27A 2FCTA 1SBFA 2D6OX 3WNOA 4DXTA 2CGOA 3VBOA 3WF2A 5KXCA 1K3IA 2AENA 1CIYA 3B93A 4FPCA 1WWYA 3ASIA 5T5PA 1FOD1 1WW7A 4Y4YA 4UI9L 2EXKA 5EPAA 2QJVA 2WSVA 1UO9A 4IE5A 4OUMA 4YRDA 2VVEA 4YGDA 5FRAA 3WF0A 4E4DX 4YZ5A 4YGEA 5CADA 3S6PA 4HK8A 5FOBB 2FD8A 2QQMA 3CU7A 3GM8A 1J84A 4PQ9A 4DRRA 3S5AA 1UCXA 5LATA 1NZCA 3T0DA 1W9SA 2PHLA 2WNOA 1F31A 1JZ3A 4E9KA 1VBC3 5FDBA 3FFQA 5D21A 1C5IA 1NQDA 1MS0A 2GH8A 4LO6B 1SDWA 3VHNA 2UYBA 2PFWA 4CVUA 1OD5A 4QU2A 4H14A 2W47A 3VBHA 3VKNA 1UQXA 3GBGA 5CZKA 1S0FA 2JE8A 3AP6A 3M4FA 2PA7A 4D7YA 1OUXA 2GSYA 3ZPOA 1FX5A 2RG4A 1UYXA 5GLWA 1UMHA 2VQ0A 1REEA 5SV8A 3WXPA 3H3LA 3FX3A 3ZXEA 1H9WA 1CPNA 2ZEYA 4I3PA 3VL8A 2CHHA 5JPNB 1W6NB 2VZOA 3EB7A 4QDSA 2GU9A 3L2YA 4IEOA 3CKHA 4GMP3 4L2NA 3D4KA 4OHXA 5JSOA 1DYPA 5D8AA 3KT7A 2XJUA 3SC7X 1SBEA 3NO8A 2VUJA 2L9LA 3VHRA 5LBBA 5A3PA 2XXZA 2XKPA 4NMIA 5IAVA 5F3GA 1C8M1 1JHJA 4P9XA 5FY0A 2I07B 3I3MA 1KDMA 3POGA 1BK0A 1EUUA 1N1SA 4IEWA 4N9HA 3S5QA 1X9TA 4FPEA 2BERA 4FO9A 4YG6A 3ZVXA 1D0GA 2XL9A 4HOOA 3B3QE 3RWKX 3VB9A 2ERFA 3MO4A 5JCTA 3ILRA 1H8TB 1LESA 4JHTA 1ND2A 1FMD1 4QXKA 5AC92 5A1FA 3ZKUA 4AOCA 3BTXA 1MPXA 1UY2A 2ZJCA 2P34A 1QF3A 1YQ2A 4YVWB 1MACA 1WCSA 1NXD1 4IEQA 3OBAA 3AL6A 4CDWA 1EY2A 4CCDA 3IMMA 4QHOA 3LEKA 4I0BA 4IQPA 1OSGA 3VBHB 4BDVB 1QHDA 1PVC1 1ULDA 2OPWA 4HKWA 4NIGA 1FYUA 1UPIA 3WG1A 3KSCA 4XTMA 1VBB3 2DCKA 5AFEA 2WR9A 1IPJA 5CFCA 2JDUA 4XJ8A 5F6LB 4E8CA 3ZO0B 2R6QA 1UYZA 1VBB2 5FAXA 3U1XA 4AFAA 5HCAA 4B7EA 3W5NA 1PK6A 2ZGUA 3PVBB 3LIHA 3V56A 1H0BA 3U4SA 1QU0A 3TEWA 2YYOA 1VJ2A 2WLPA 4LHNA 4B29A 1O4ZA 1MVQA 3N3HA 3M7AA 1TE1B 2Y64A 5KHHA 3FLTA 4OI4A 2W0XA 3AMQA 3PIJA 2K46A 4CCOA 1W9FA 1F15A 3UKTA 4Y1UA 5EYYA 3ZYPA 4D8MA 2G4IA 2ORZA 1RUH3 1UN1A 1X36A 2OZ6A 1QJU2 1MS1A 4R9AA 4G3YC 3OGVA 5IFTA 1CJDA 4YM1A 2AC1A 3NV3A 5T50A 3AFGA 1QKQA 3ETQA 2ZKLA 5ANNA 3R0RA 4JVAA 1H2MA 3VD4A 1R091 1KQRA 4Y1ZA 4XUNA 2AGSA 1SLLA 5LRSA 4F3JA 1CONA 1Y3TA 4UW4A 1DU3D 1ND2B 2HH9A 4LO4B 2BQPA 3SH3A 2W1UA 4YM2A 3SCHA 4HONA 3I2OA 1FPN1 3BPZA 2DVDA 1RVF1 1F9KA 2DCTA 3I97A 4QXHA 4FSJA 2BNNA 2VTFA 3M2MA 1DGWX 2PTMA 2ZOEB 2JB4A 1QQP3 2JG8A 2VG9A 1BJQA 1PO21 2ZGLA 4CDWB 2EALA 2YMZA 5C9AA 2D3PA 1YFYA 1RUOA 4QXBA 1QQP2 1PMJX 1DG6A 1TG7A 1GBGA 2PHFA 4E4SA 2G9FA 3VBSA 2WNUA 4P9YA 5FP4A 5FZ6A 3IAQA 3PU8A 4LK6A 4QD2A 4CUGA 1PK6B 4FQZA 2ZHKA 2RJKA 3KVAA 5L7OC 3URFA 2RDSA 1LEMA 4EN6B 1WZXA 4MGIE 1O59A 1UY3A 2PHRA 1OT5A 3CL1A 3W58A 3WUDA 1BQPA 1KJLA 2HWF1 1QMJA 2W92A 1QGLA 4Y24A 2CGPA 1BMV2 1REFA 1AJKA 1ZBA1 5A7SA 1VPHA 4YPJA 5IVYA 4XYXA 3ACFA 1YQ8A 2RM21 1SMVA 4YM0A 1R1A3 5IFPA 5SV5A 1Q3EA 2WIIB 4I01A 4Q4X1 1UZ0A 3HNBM 4PQQA 1R1A2 3BIWE 2ZX1A 5FYTA 1ULOA 1OOPC 3U78A 3RVHA 3TWIA 3IZOA 2PQSA 4S2GA 5KBFA 1GKBA 1BBT3 3K77A 4Y33A 2YC2A 1AR73 4KWJA 4A41A 4XOGA 4IUGA 4AVVA 1RUD1 1ZRIA 4HANA 3VL9A 1LGNA 4DEVA 1BBT2 1NY71 2PLV1 4V1PA 1O3RA 4YW5A 4V2WA 3D3AA 4QQHA 1RUG1 1OHFA 4CCJA 5GZEA 2B45X 3JU9A 3OY8B 4DEQA 2QZ2A 4RGKA 3VBSB 5E88A 4EZ4A 5IK4A 1IQDC 5DAWA 4GAZA 5HCBA 5GZGA 1XE0A 2WS92 1GZCA 1UWWA 2JWPA 2WO7A 2R062 4I2OA 1DFQA 3BOWA 3HN3A 3AFKA 2Q8DA 3TOJA 1DYKA 2ZACA 3DXUA 3CMGA 1VBA1 3MI8A 3RJ2X 4JGYA 5A32A 3D0JA 3PMEA 2WNVB 1JYWA 1E57A 2VM9A 5J98B 3CHXA 5AVPA 3LF7A 4AEDA 2NYYA 3NWKA 1WCUA 2QNKA 3K4DA 5LY1A 3O1OA 3AP5A 3JQXA 5FYHA 1ACCA 1RXGA 3FE5A 4EWDA 1W6OA 2HBUA 1DQ2A 1W8HA 4E4HA 5ABJC 1ASJ2 5C8CA 1YFXA 4CDXA 4IGQA 5EZWA 5I93A 4PBOA 3VDDB 5FLHA 1R083 2OQ6A 2YC4A 2P37A 4FPLA 1CAUA 1KITA 4RR3C 4EN8B 3QH6A 2P6CA 2C9KA 4LBJA 2QUOA 1R082 2BP6A 1I5PA 2D6PA 4CCLA 4GB31 3ZFEA 2R16A 2G19A 3J8F1 3AK0A 1COV1 4RQPB 4UFJA 1H1MA 3D5OA 2XKOA 2EXHA 5DABA 1AYM1 1H2LA 2ZHMA 4BQ2A 3NAPC 2LS6A 2C1FA 1AR61 2LTNA 5FXZA 4YARA 3PJQA 2H0VA 4JAAA 4M3CA 3WT3A 1QJY1 3LAGA 3ZSEA 1AL21 1YYNA 1Z78A 2JECA 3ZSJA 1HXS3 3ZR6A 3WVJA 5L73A 1WMDA 4Q8KA 4CZSA 3J4UH 2VCCA 3PUQA 1HXS2 1GZTA 2KA3A 2UWCA 2XJTA 2YBSA 2Z4FA 3HMYA 3JBG2 1AYN1 2W46A 3UT0A 4NHKA 3LQCA 5A32B 4NWWA 2HWC3 4AI3A 4GJZA 5F8PA 5FZCA 2RS53 4AEDB 5F6KA 4ZKTB 1LJ7A 3CNAA 3TYJA 3K46A 3KCYA 2HWC2 4N9IA 1ENXA 4I30A 5FBJA 1WKYA 2RS52 3L2HA 2B5HA 3VBFA 1GMMA 5K7PA 1W6OB 2WZPP 5AC91 1LOFC 1OH3A 1UOFA 2VZUA 4M01A 4AI1A 5C8CB 5IHRA 4CDXB 4NIAA 3RPQA 5JLVA 1K5MA 1MEC3 2Z2SB 2Y0OA 3KMHA 3BIEA 3MGUA 1MZ5A 4R52A 2ARXA 3KV6A 3KWVA 4P9GA 1CAUB 1J3RA 1MEC2 1ST8A 1ULGA 1RHI3 3UESA 3ZIXA 2ZGOA 5EFUA 1PMIA 5K4LA 5FXXA 4HXCA 4FPHA 4CCEA 4A2UA 1DGWA 4XFIA 2EIGA 2GC1A 1ZZ9A 1VBD1 2VPVA 3O1UA 3OOXA 5LA1A 1S0GA 4NWVA 3HAGA 2V4AA 4IL7A 5B4XA 4QGLA 2V72A 1QJZA 2PELA 4LKDA 4DXRA 1L7QA 2C6SA 2I74A 4JDMA 5DZFA 1NCRC 4AAXA 1D0HA 3AZXA 4R9CA 1QH6A 4ET7A 2R32A 2ZXQA 3DF0A 4MGTA 2VMFA 4URTA 1QDOA 1ZNPA 3N4MA 1Y4WA 2VZSA 3AP9A 3DYPA 2VOVA 4YZ3A 4LXLA 4Q4Y3 5IATA 4A7KA 2VOTA 1AL0G 3PUIA 3E6BA 3AC0A 4NAMA 4L92A 3O1TA 3NVCA 2VBPA 2QQLA 3KF3A 1QJU1 3P3NA 4QM8A 4Q4Y2 4WVMA 1HB1A 4X8PA 1U0AA 3VDCA 3GZTB 3NNJA 1UYPA 4K40A 4C91A 2XVKA 4IV1A 5BNPA 1H8VA 1O7FA 2RJLA 1RUI3 1W9WA 2WWSA 4XXAA 4B4RA 2XL7A 5GLVA 3N9QA 2RDQA 4FPJA 1RUI2 3OF1A 3HBKA 4ITCA 3W21A 4CCCA 1U5ZA 2YFZA 3C7GA 4A45A 5LK7B 1KS4A 1PIV3 2WA3A 3T3YA 1PZ9A 4EQVA 4OI1A 5JI7A 3ROUA 1LHVA 1UY0A 4O61A 1FNYA 1PIV2 5AFBA 1K5MB 2WABA 4QT6A 1WCDJ 1K42A 2B42B 1HRV3 3K51A 4HBNA 4AVCA 5BV6A 4QB6A 4JKKA 3U11A 1J3QA 2WQ8A 2BWCA 1SG3A 1OD3A 1HRV2 4XJWA 5FZ1A 1QH7A 4KWLA 3QCWA 1E5HA 2VUCA 4HETA 4AGRA 3IAPA 4M0NA 1JW6A 4PLNA 2C5DA 3C7OA 4QQOA 2AH2A 3WOGA 4P02B 2OX0A 1H1IA 1AXKA 3GZEA 4MGQA 1FOD3 1A3KA 1OA3A 3POIA 4XAEA 1H6YA 3LFIA 4A7YA 3JD71 4N43B 1FOD2 2PHTA 4AFDA 1W8FA 2W39A 3I3QA 2JG9B 4QPIA 2UYAA 4QPWA 3RZKA 4DUXA 4Z2WA 1WD3A 1YFWA 4TLGA 4WVMB 5T55A 3LEGA 1LU2A 2OUJA 3B02A 4YW4A 2PXJA 4NO4A 3RS6A 2W1SA 4IV1B 1GZWA 4B7KA 5BNPB 4FPGA 4ZU7A 1H1AA 1H8TC 2RE9A 2B7YA 2Y34A 3ZX7A 2Z42A 4X6RB 3POSA 4EROA 5JIAA 4W6XA 3I3DA 1RUC1 3WG3A 2VTXJ 3TEZA 2CDPA 2FCUA 2ZHLA 1I6XA 3JQWA 5FJKA 4YVWC 1ZRFA 1QOTA 2FZ1A 3ZFGA 4Y1XA 3VBHC 2RDNA 1A6CA 5JR7B 2ZAHA 3CO2A 2A3YA 3ZPYA 1DZRA 1YRZA 4AI9A 4C8DA 2DTWA 4IDZA 4XFHA 5DG2A 2VY0A 4KBBA 5JOXA 2OA2A 1W03A 5IK8A 4UWDA 3MV01 3TRSB 1S2KA 3IKWA 4NOTA 4BHPA 5CG9A 1S0CA 1WLCA 4CRQA 1JZ8A 1POV0 2X53S 1C8M3 2E31A 1PZ7A 1AVBA 4XUPA 1A78A 1T6GC 3SH5A 1C8M2 1OPMA 3THPA 2B8MA 2R061 1Z7S3 2KR2A 2B46X 1MZEA 3GXUA 3KQRA 4A3XA 4E8DA 2WWJA 1DGRA 3ZYBA 4QPIB 2XWJB 5HCFA 1SZBA 3T08A 4CUAA 2VZ3A 4BA6A 1ND3B 3SLIA 1ZZBA 1FMD3 4LO7A 1PO11 3C2UA 2Y8KA 1OLRA 3MZHA 1HB4A 1FMD2 4P9IA 5FZBA 1S1AA 5FZDA 3UL2A 3M8LA 2W52A 2UWBA 4QHZA 4W4ZA 4FFGA 4CEWA 1PNFA 2YBKA 3D82A 1ND2C 3K3OA 3POEA 2W91A 3THTA 4ZS2A 1FAYA 1LOEA 4MO3M 1W6MA 2D5HA 2E53A 5DDJ1 1BYHA 1PVC3 5L9BA 5I8TA 3H42B 1I3HA 1RMU1 4QX3A 1ZZ8A 2VQTA 1SFNA 5FZIA 3ZDSA 1PVC2 4CDWC 1LEDA 1OA2A 1Y7BA 3NNFA 1JUIA 5ANQA 3VZMA 1DZQA 3CEWA 3I2KA 2E63A 4E2GA 2JIJA 2F4PA 4NUBA 1S0IA 4WVZA 5FO7B 3USUA 1KD7A 3C3VA 4L11A 1CN1A 1W2NA 2JKXA 2CWSA 1C4RA 1CD3G 2RV9A 4INDA 3MIHA 3N9OA 1X82A 4HZFA 3E5QA 2VECA 3ZSLA 1PK6C 3C7EA 1OVPA 1QOOA 4KU8A 3FFZA 3AKTA 4NVPA 4FAGA 1PMHX 1OC1A 5FYMA 2A73B 2RMU1 3DN7A 5IK7A 4DIQA 3JBG1 2Y6KA 3SCGA 2LUWA 4OZOA 3I2FA 1R093 3MIGA 4Q26A 4XJAA 5JOWA 2AACA 2D7FA 4CPBA 1OKQA 5I0RA 1JYTA 3HT1A 4QB2A 1IS6A 4QXCA 1R092 3TBDA 4JHZA 3O14A 2AEZA 4YZ1A 2J1AA 3GHNA 4ZXEA 2XVLA 2WT2A 1FPN3 1RVF3 1NCQB 3NV4A 1BZWA 4I3GA 4WM7A 1O8PA 2VW1A 5FLIA 1BLZA 4CEWB 2FMYA 1DQ0A 4L0PA 3U75A 1PO23 1FPN2 1VAKA 2GC2A 2VXJA 1RUJ2 4ZU5A 1W06A 1W6MB 3ACIA 1PGSA 4XACA 2QKDA 3FC0A 4LQRA 4NIIA 1PO22 4YW2A 3VD7A 4AW7A 5C70A 5IVBA 5M0TA 3HWJA 1OQEA 4JRAA 1O3TA 4LORA 4OI2A 4XJUA 1ENQA 1E5SA 3PU3A 1ONAA 4TWTA 1C28A 4R8HA 2C0ZA 4UFHA 3FZ3A 4LBQA 3VGIA 1OLQA 2JXAA 2HWE1 4RFT0 5FY9A 3WQ0A 1V6IA 4MXWB 1OUSA 5LBFA 5LA2A 2VNOA 3JCIA 3OD0A 2WUHA 2YG0A 2XVGA 4GALA 3W59A 3VBSC 1AR93 3AXEA 3OPTA 3I2JA 3SKVA 2BNOA 4XURA 5LB6A 3RZJA 2ZBJA 4L99A 3U4XA 3GBWA 1HV1A 2GNBA 2HWF3 3AVSA 3ENRA 1SQ4A 5C71A 1DHKB 1JXNA 4ASLA 3WNPA 5CFDB 3CF6E 1ZBA3 1POV1 4CUBA 3A0KA 2XQXA 2YUEA 2HWF2 4GWJA 2MPFA 4BLJA 1UZYA 2WNVC 5FMOL 2WAOA 4OMDA 1GP4A 2RM23 3CLPA 1ZBA2 4BQYA 5IT6A 4IERA 3LDRA 2FZ2A 4PIZA 3WF3A 4EN7B 4DY5A 4NHMA 3IIAA 1B09A 2NLRA 2P6HA 3KV9A 3N9MA 4KGGA 4NRQA 4Q4X3 1TME1 4NE9A 4JDNA 3DPRB 3O0XA 2ZHNA 4P9WA 5IJRA 4D7TA 2OXBA 4ZZ5A 1F4HA 1XNBA 2OW4A 3I3BA 3FLPA 4WM7B 2LW8A 4C1XA 1GNZA 1UX6A 4S2DA 3U10A 3VDDC 3BTAA 5JOYA 3AYDA 2Q1MA 1EPZA 1RUD3 3BODA 4QPGA 4LULA 4Y1VA 2W95A 1MS4A 5DUUA 5FZ0A 3I49A 2X8KA 1RUD2 4OHWA 1RUG3 2BTVC 1X50A 4YSFA 1W6PA 4K1ZA 2PLV2 5FZHA 3AVRA 4RQPC 5F7UA 5HPOA 2QDRA 3O1PA 2GP5A 1RUG2 1P8JA 1J58A 2Y33A 3SISA 2H0BA 2W1QA 4CTEA 1WMFA 2ETEA 1GQPA 1KDKA 4JRLA 2A75A 4H55A 4BCUA 3WF1A 5IVEA 1WBFA 5I0DA 5JI9A 3I2DA 4AE2A 1VBA3 2BUKA 1IG3A 1XXNA 2VO5A 4MXVA 1IPKA 4Q0UA 4E4ZA 4K20A 5KHKA 3RDIA 3S0MA 2LROA 3PTYA 3VD3A 1VBA2 1XNCA 1C1LA 4G4FA 5C3SA 4R4ZA 5E1RA 5AVAA 3JUUA 3V0BA 3AKRA 4AI0A 1T6BX 3UKVA 1QNWA 4ISQA 3H8UA 4Y5SA 5JIUA 2CY6A 3ZXDA 4CU7A 1VB2A 4HSJA 4AEDC 1YUDA 4UFIA 4QWNA 3WLUA 2VW0A 1FV3A 3PVNA 2MNGA 4HSLA 4NAOA 5FO8B 1MZ6A 4K21A 5F32A 2A71A 2W08A 4Y22A 4ZY9A 5C8CC 5JZGB 2Q5TA 1ZZCA 3ZYGA 4CDXC 3SNMA 2XH6A 2JD9A 4GB33 4OFGA 1EUTA 3J8F3 2K0GA 3RZLA 1COV3 4A6SA 5FZ9A 2HWD2 4QPGB 2Z79A 3IN9A 2QQWA 2BV4A 1AF9A 4XABA 4GB32 4AF9A 3J8F2 4HKLA 5FUIA 4OQ9A 1I9RA 1COV2 3CIHA 1XNDA 1HW5A 1URXA 2LM3A 2WYSA 1HN1A 2TUNA 1AR63 1Q56A 4GH4A 4EYUA 3ZFEC 4Y20A 1AYM2 1XRUA 5BNOA 5K0UB 1W6PB 1JYIA 1QJY3 4N90A 1AL23 1AR62 4XF1A 2R49A 5J36A 1F2NA 1QJY2 2A3WA 1AL22 1IS5A 4QU1A 4FTBA 3EJKA 3QD6A 3FHIB 3BYWA 1S0JA 2XBO2 2ZGRA 2DU0A 3AMPA 2V5YA 2W5FA 2WO3A 4CCNA 1AYN3 5HCHA 3NJYA 2GDFA 3VBOB 1AYN2 5KR7A 1DQ4A 4NPRA 3POWA 1KEXA 3LEMA 4OMCA 4NN0A 2WFPA 4HL0A 1M4WA 3ATGA 2XMLA 2NN8A 2OIIA 3PURA 2DVAA 2W9XA 5AC93 1HRI1 1WLDA 4YVSA 3T4HB 4CU8A 2DTYA 3AP4A 3RMXA 4AEJA 4DUWA 3Q8FA 2QQNA 2OUHA 2EA7A 3K2OA 5JPMB 4Q0QA 1AR81 2HJIA 3ES4A 3T1LA 4EV0A 2X29A 4DMIA 4FOQA 4IE4A 1K5MC 4OHYA 3WNNA 5E89A 3ITQA 4GIQA 1V6JA 2R1BA 4Q29A 4CCKA 3RGBA 1VBD3 4N53A 4C0HA 3OBTA 3AMMA 1ZX5A 2JJ6A 2OVUA 5LW9A 1GU3A 3UGFA 1VBD2 4GH4B 4KMQA 5BNOB 1EPWA 2BOJA 3KM5A 4OVEA 4XC9A 2IXIA 1G8WA 1SLTA 4K8RB 5DPNA 3DXTA 5H9RA 2BPA2 3VBRA 3H7YA 1W2UA 2VMIA 3I54A 3HVDA 1YO8A 4HFSA 3ZFFA 3ILFA 5D8AB 4Z07A 1YEWA 2VZTA 1G9DA 3UNPA 2XR4A 4O9GA 3ZIWA 1W39A 2EXIA 1YCIA 4QDRA 1QJU3 5F5QA 2CAUA 3SMHA 4A3ZA 2FDFA 4N43C 4AI2A 1H2NA 4E2SA 5CIRA 3KS7A 4XE9A 4FPYA 2JG9C 4DFSA 1B35A 2JDMA 2VXRA 2YZ4A 2AYHA 5FYCA 1QJX1 5JSPA 1PX3A 1UX7A 1CGPA 4FP3A 3WZ1A 2VOWA 4K6BA 3DGTA 2YXSA 4IV1C 4LOSA 5A3OA 3RI8A 5BNPC 5JXHA 4LIUA 1ZVFA 2D6MA 1NX9A 5IVFA 4YVSB 3AYCA 1ZBE1 2CYFA 4BYYA 3K48A 4YFZA 1VALA 3H0OA 4RA0A 2PMWB 3W9AA 1RUJ1 3WX5A 2TBVA 1H4GA 4C90A 4Q0PA 3RJRA 1O3SA 3AYEA 3WDWA 1JZ7A 2JIGA 1IKPA 3OGRA 1D7PM 3ZYFA 3EXUA 4N53B 3BUCA 1LENA 5L9VA 4TYSA 5J09A 5CFCB 3VHPA 1ENRA 4GWNA 1W0NA 2EXJA 5A6YA 1D4M2 1DLCA 1LECA 2NMOA 5C3QA 1OMIA 3P1IA 2GNDA 3PUAA 3AKQA 1V6KA 2RR11 3T2QA 3VBRB 1X33A 1YLLA 3ORJA 1REDA 1YIFA 3ZFFB 4Q4W1 3J7MA 3VHOA 1UIJA 5EJ1B 1R64A 2D97A 3JD72 4UW5A 1JZ5A 5J7MA 1QJFA 1NG0A 5FJHA 3I4IA 3VKOA 3ZN6A 2VVFA 1DF0A 1V6OA 3FBMA 2VGDA 1OFNA 1EYBA 2D5FA 2R0FA 4QPIC 4QKDA 1B35B 2E9QA 2GN3A 4LBOA 4XUTA 4D6RA 1GWLA 1FATA 3MYXA 1Q8OA 1ND3C 1XB9A 4YZ4A 3WUCA 2MHFA 3VZJA 1RUC3 4HG6B 3B7MA 3O12A 2P2KA 4EJRA 1RJ7A 4QM9A 5A7OA 1RUC2 4P9JA 4BOWA 2OKXA 1KFXL 4XJ9A 4BM8A 4ASMB 5DUWA 4IE7A 3ZN4A 3OUJA 5FQ0A 5GALA 2Z5WA 4QX1A 1CZVA 3TB0A 2QE3A 5CG8A 3KGLA 2JG8B 2ILMA 3T2PA 5C9AB 2Y60A 5E8AA 2DDUA 2JKBA 4XAAA 3AM2A 4EZHA 2RVAA 1WMEA 3I2GA 2ZGSA 2BFUL 4BIOA 3M3EA 3NRUA 3HN1A 3RRDA 5CU1A 3OGJA 2WS93 2WNUB 1N1VA 3WCSA 2R063 1AXYA 2QDNA 1GNHA 5EYXA 5FPAA 5C3RA 4J1WA 3MUZ1 5FPBA 2GNMA 1BEV1 4AFCA 4D7SA 3PLQA 4LBLA 2O1QA 2QTWB 4BISA 4IW3A 4UOJA 5I8SA 1PO13 4TZDA 3O5SA 5FZKA 3ZN6B 3ZXGA 1DQ5A 2P3YA 3MW2A 2ZTNA 1JYVA 1PO12 2QQIA 1CJPA 3FHQA 3ZKYA 4QX2A 5C5TA 1NQJA 4AHZA 2RS11 1QXRA 4MYEA 1ASJ3 5IVVA 5BNQA 2B9UA 1X8MA 1T2XA 2QQPA 4XF9A 1ZYBA 5DDJ3 5HV4A 5A7QA 1RMU3 1PM4A 1SHWB 3GYDA 1NCQC 3M3CA 1SACA 1HB2A 2Y6LA 3N9PA 2R0HA 5DDJ2 2OZJA 2MEV1 4QQPA 5FP8A 2VE1A 3USSA 1RMU2 2Z69A 3ELNA 1MQTA 2PAKA 1NZIA 2VNGA 2HWD1 4YG3A 4AR2A 5K9YA 5DZGA 2HKXA 2NPIA 1W9YA 4LOTA 2RJ2A 1TVGA 2VCBA 1QY4A 3UYJA 3AMNA 5EWSA 3ZXJA 2WLQA 4XXPA 2A70A 1IQAA 1LGCA 2X05A 1LOCA 5FZFA 1HQLA 2VMCA 1UOJA 3WP4A 3GJBA 2NZ9A 3W20A 2RMU3 4NPMA 4QHBA 1UMZA 2XBO1 1JBCA 5FUPA 5GJ6A 4BXSV 2VZVA 3JBG3 3KCCA 1WA6X 4K7JA 4MX3A 2VQUA 3C7HA 2RMU2 1JHNA 4UFKA 5FZ7A 5CFDC 1R1ZA 3CZUA 4XETA 4UT5A 4KL1A 3OPZA 4JGYB 1TEIA 1US2A 1RIRA 2BWAA 2X5IA 4LA2A 5A7WA 2BGPA 4CDUA 4K8FA 1CAVA 2B4KA 5F9TA 1RTVA 1DLLA 2FQPA 1J1LA 5JXIA 2BW8A 5FY1A 5ACA1 2QVSB 5CNAA 3WNMA 3DPRC 3I3EA 2E26A 3O1SA 1O4TA 1CX1A 2VL4A 3B94A 2R042 1C8NA 3QACA 4AYUA 1C5HA 1HQWA 2CGNA 3LD8A 1MS9A 4WM7C 2W3JA 3CJXA 3LE0A 2DFCA 1LR5A 1CX4A 2D43A 4QGNA 4E2QA 1Q8VA 1MQTB 2OS2A 3ES1A 2Q8CA 5KC6A 2ZCWA 2P5BA 2RDRA 2Q30A 4DS0A 4DRVA 3H3UA 5FPUA 2PQQA 4QQLA 3UJQA 3ZFEB 4LEJA 3OPWA 3G7DA 2HWE2 4M3CE 2IFWA 1W0PA 3ACGA 3R05A 2GNTA 4OHZA 3VZNA 4YYOA 5IW0A 1H4HA 1NLQA 3NSTA 3IT8A 5EIYB 1Q8SA 2WKKA 3I59A 4M3CB 4UXAA 5JSRA 1J3PA 4BQWA 1RUF1 1S4CA 5C3OA 3HD8B 1POV3 4AGVA 1GP6A 3J7NA 3KF5A 4COUA 1A34A 2JICA 3WR0A 2IWGB 4XFCA 2ZEZA 4BMBA 3H7JA 4JX0A 3U0ZA 2IFRA 4COWA 3JB4C 2JD4A 3X29B 3BN6A 1EV11 1ZRDA 1W3VA 4B4PA 1U5IA 1FV2A 1S2EA 1TME3 2ZA9A 1SPPA 2P3IA 3WP6A 4ATEA 5T3NA 4XMIA 4CDUB 2X5IB 3HEIA 4GD4A 3RZZA 2NQYA 5KXEA 5IVJA 1GOHA 1TME2 3HR9A 1F5FA 3VZOA 4D0QA 2BEOA 1NA1A 3LEIA 4RGGA 4XUOA 4FVVA 1UU4A 2DV9A 2Y38A 4HVOA 3OYWA 3VBFB 3WDYA 4GA9A 2FBEA 2YGMA 5JZGC 1AZDA 5CEHA 3KV5A 1KGYA 1UKGA 2VZ1A 5F2SA 2Q8EA 4KGQA 1Q43A 2ZGNA 2B9VA 4QPGC 3ZYHA 3TN91 2P4EA 3D8CA 2K2SA 3N7JA 1RUH1 1VRBA 2IXHA 5JOZA 3ZXFA 4C0BA 4KQ7A 3E6DA 1TNRA 5K0UC 1KS5A 2GN7A 1DDLA 2WN3A 3KD4A 4FPFA 5JR2A 3BTYA 3V0AA 1D4M1 3RSJA 3EQEA 1JH5A 1QWRA 4EWEA 4JTOA 3KV4A 4QDQA 4YFWA 2DWRA 3V65A 2ZX4A 4LT5A 4LUMA 3KB5A 3P5BA 3NJVA 3M1HA 1A8DA 2N7GA 4XCAA 3VBOC 1XOYA 2BVBA 3UGGA 3C7FA 3VD5A 4NIHA 5FMDA 1W2TA 2BU9A 4ONUA 2E6VA 2E7AA 5LBEA 2VZRA 3WF4A 1W2AX 4FOWA 4LMFA 4MGYE 2DURA 3OUIA 3ZM8A 3IMNA 4JKLA 3QBQA 1XYPA 1ZM1A 1W8NA 5FBZA 1GZ9A 1SPPB 1GWKA 3GF6A 5CB7A 2JDAA 1UMIA 1HJGA 1L3JA 2VQAA 2C4XA 1XNTA 1FI2A 4M3CF 1ULPA 3WDVA 3WG4A 2AZ5A 1FNZA 1AXZA 3H1MA 5FPLA 3TEXA 1NA1B 2D44A 2YB7A 3AJZA 4HPKA 4Z92B 3S30A 3MUY1 3OG2A 3OYWB 4O9EA 2ES3A 4P00B 2ADEA 2ZGPA 5BXXA 3FHAA 3INAA 4R4XA 2O14A 3IPVA 2YC0A 4GKYA 4XPVA 1EP0A 1GNYA 2GMPA 3ZN5A 4QX0A 4P08A 2YV8A 2VUAA 5CYYA 4KU7A 1LHOA 4FP2A 4LE4A 2XJPA 1XJAA 2ZMNA 3KQ4B 1N1YA 4M4RA 2JDYA 1FT9A 4FOVA 4GH4C 5BNOC 4LKEA 5FYIA 1G9BA 4OQ8A 3DEMA 3RZMA 2QQUA 1LHWA 1OQDA 1WCQA 3OUHA 3WQ7A 5A6XA 3NJZA 1F4AA 4RS5A 2J1UA 2JDNA 1ODNA 3MPBA 3ZMOA 4E27A 3L9JT 3MF6A 1LGBA 1OBNA 2ZEWA 5A80A 4DOUA 5FYBA 2PHDA 5D8AC 1IG0A 2LALA 1CVNA 3H50A 5FCCA 4EE2A 3VUOA 1OLMA 3PL0A 1N47A 3PIGA 1GLHA 4DB5A 2JE7A 1GFF2 1E5RA 1W8UA 3B9CA 2GC0A 3WDUA 1O3QA 3SXWA 1JOJA 4CPBD 5FZMA 1HRI3 4S2HA 1CESA 1I5ZA 4D3WA 5LASA 2JX9A 2WT0A 1BXHA 1AX0A 3MFAA 4UF0A 1UPSA 2FCVA 1HRI2 3PDQA 1DQ6A 4IV3A 1GZWB 3NV2A 4CXYA 4CP0A 1UZVA 5LRRA 1AR83 5LWBA 4YVSC 3QLQA 1CPMA 2V09A 1WD4A 1W90A 4HLTA 4ES8A 5CA6A 1AR82 1ZRRA 4PIXA 4XF0A 1VAMA 2ZMLA 4HPKB 2VNVA 5FIXA 4UYBA 3BI3A 1RUE1 4YG0A 1LULA 2P1BA 1L7LA 3A23A 3MW3A 3MBWA 4SBVA 3IPVB 4L9BA 2VMDA 3PTRB 3K75B 3ZFGB 4YZ2A 1X8EA 2E32A 4YW1A 5FP7A 4BZ4A 1J1TA 2IXCA 4XCBA 4XVHA 4LBQD 5EJ3A 3WNXA 2EAKA 3H1YA 4N53C 4L8QA 1S2BA 4AG4A 5J1XA 2A1XA 1SCSA 4DPNA 4TSVA 2R071 1CAWA 5CFCC 5FMBA 2PAMA 5F5AA 2ZZQA 1LNSA 4I0AA 4OULA 1PGL2 1HDKA 5LEJA 2ET7A 5FY7A 4CUCA 4RS5B 5FMCA 4EN0A 1W8OA 1C1FA 3OBZA 1EAH1 4RHV1 3VBRC 1JODA 1E5IA 3AX4A 3GHMA 4TXWA 3OJBA 4Q1RA 3ZFFC 4BPZA 1DIWA 2DCZA 5GKAC 5FZAA 4N7UA 1QJX3 2BDRA 3JB8A 2P3JA 1GOGA 2XB6C 2PHUA 5BUVA 3AYAA 2ZAAA 1WMXA 2CTVA 1QJX2 1DP0A 2Y6HA 3P6BA 1DYOA 1XPWA 2J42A 4LO8A 2IVJA 1G9CA 1B35C 5FYYA 3R6SA 2DVGA 2E33A 1ZBE3 1DZTA 4UF0B 3CJIA 1QJEA 4LJHA 1VBE1 2WRAA 1ZBE2 3Q9OA 4IV3B 5APAA 4ZXKA 5LA0A 5DAXA 5CBLA 1YHFA 1RUJ3 2PHWA 2DU1A 2WO2A 4XQ4A 3HT2A 3RWNA 1WA4A 2R041 1IPSA 2W87A 4OZXA 3VBUA 3DYMA 3J7HA 4AVAA 3E97A 2BZDA 2XJVA 4AFMA 5HV0A 4KH9A 2WDBA 4IGOA 3POBA 4A7ZA 2HWB2 1SLCA 2JG8C 3KT4A 5C9AC 1W0OA 1RB8G 4MG2A 3VV1A 3T4VA 2WN2A 4JGZA 2RR13 2QZ3A 5FPZA 4P5YA 3USUB 3WD5A 1UU6A 3A0NA 4AVBA 1CAWB 4IEUA 5LA9A 2WBKA 4Y5TA 2RR12 2LRPA 1OI6A 4Q4W3 5T52A 3WP5A 2WNUC 2EF6A 5I0UA 1OF4A 3LPFA 4Z2AA 3LPGA 2SBAA 3RNSA 5IK5A 3Q8BA 1UNBA 3RFRA 4XEZA 1DGRN 4H3WA 4Q4W2 4RL7A 3ZLIA 4AK3A 4WM8A 3O1RA 3R4SA 5F37A 3LA2A 3APBA 4YM3A 1IS3A 2O8QA 4DY3A 3KVBA 2WZR1 3NV1A 4PIYA 4TN7A 5C6CA 3T1MA 5CISA 4WVVA 4MGZE 3TEYA 3KGZA 4META 2XHKA 4CYDA 1JYNA 4LNVA 2FHRA 1OF3A 4AGGA 2DBIA 2XGXA 5FZOA 1V00A 3LCPA 4Q0SA 1ZREA 1IGOA 2XJQA 1SLIA 5BNNA 4KG0A 3NNMA 5F39A 3E5XA 5FFOC 3WSOA 3H8RA 3CJIB 4QKFA 3D6EA 2BBVA 2C9AA 1S0BA 1LHUA 1CQ9A 5GM0A 3T0AA 4XFAA 3AZWA 4CE8A 2VC9A 1BHGA 2ZS6B 3HNYM 4LA3A 2IC1A 3VBUB 4MVTA 1U12A 1YQCA 5HXVA 4PI2A 2PLV3 3WCRA 5FPXA 1HB3A 3IM0A 2EVXA 1HX6A 3CZJA 4X8NA 4XFGA 5LY2A 4AZZA 4EN9B 4QPYA 4LBKA 3LSDA 2HEYF 2IZWA 4J1XA 5FZ4A 1BVVA 3CQOA 5JXGA 2QCSB 2J1SA 4PDWA 4LBQB 4AFBA 4JGZB 2VW2A 1XQNA 3AB0A 4WV8A 3POYA 5LEKA 4B1MA 4BIFA 2WFF1 2ATFA 5IWFA 2CNAA 2VR4A 4FXKB 4AQ2A 1NAEA 1BEV3 4OI0A 5FXVA 3VLBB 4AVSA 4FTEA 3NNLA 2QQOA 1BEV2 4MADA 2F17A 2VZQA 2ZABA 2FMDA 4WM8B 4B8EA 2Q1FA 4XIKA 3ZR5A 2DVFA 5A6QA 5JMCA 4DNYA 2HBTA 3MIFA 2Y6JA 3E5UA 3LSEA 5H9SA 4LUKA 2RS13 3KHBA 5FO9B 1M06G 4JGYC 4AQSA 2IVIB 4C1WA 4PBPA 3IDCB 1JOBA 4QX8A 4IEVA 5L19A 2RS12 4UBHA 2DUQA 2ZKNA 4WBBA 2XPJA 5FXWA 1XBFA 2AUYA 2VOXA 3ZSKA 1QDCA 4AXOA 4B1LA 5BNNB 3WQ1A 4O7XA 3UETA 5FTTC 4KWKA 1VRH1 5FUNA 5DAQA 1W8WA 3SHRA 2MEV2 4F8AA 2HWD3 4NHXA 4MGKE 5KC5A 2PAEA 3IDBB 1A8MA 4YWAA 1MQTC 3BCWA 3GDBA 3R4UA 1AYM3 4AL9A 4CDQA 4KG8A 1UY1A 5KHIA 1BVP1 4XDQA 4A44A 2VVDA 3F95A 3DKQA 1H8TA 4AI8A 1GV9A 2JDZA 5E6HA 5IAXA 1XSRA 3SCFA 2VJXA 2XUMA 2YPJA 4PDWB 2XBO3 4IEXA 4YNIA 3FLRA 1HV0A 4YVWA 3WHUA 1VBC2 3M70A 3O1MA 2OYZA 4JTNA 4CP9A 3NL1A 2E7QA 2HYKA 1SLBA 3E1F1 3MEPA 3U07A 1VLNA 1RYYA 2RHPA 3J9SA 3LIGA 4DZGA 4RGAA 3OEBA 3MIDA 4PI0A 3B9IA 3WV6A 4AQ6A 3BB6A 5EP9A 3IB3A 3OBRA 5T5JA 3ZMNA 4QX5A 5TSWA 1UKRA 2D98A 3GNEA 5ACA3 2UWAA 4LKFA 5L9RA 3V0BB 2J1RA 3THDA 4F7ZA 4UFLA 4M0HA 3PMSA 2Q8OA 4CDUC 2X5IC 5ACA2 2AREA 1Q8PA 4ARXA 1G7YA 5A3LA 4OHVA 3LOBA 3VKMA 4CEYA 1UZWA 4ZS3A 3VBFC 2FDIA 3NJXA 1WLTA 2QQKA 2YGLA 3NMBA 1LRHA 4Y22B 3ZXAC 2QQJA 1TZOA 3VN4A 1SFPA 4Y5Z0 4AEMA 2GALA 2VZPA 5JWPA 5FYVA 1IS4A 3HQRA 5C8WA 3BOPA 4DXZA 4MGSA 2ZX0A 5IVCA 1Z7S1 5DMYA 2UY8A 5FKCA 2YU2A 1XE7A 4MUVA 4LIVA 2E7TA 1MS8A 3RQ0A 3SEPA 2YFUA 4CDQB 3OGSA 2D6NA 1DGLA 3LZZA 4Y20B 5C5UA 2XJSA 2IXKA 5KHJA 1UXZA 2D3SA 2YY1A 2BGCA 1TMF1 3K3NA 1OFSA 4HVRA 3ME2A 5FOJB 1RUF3 2W1WA 2OPKA 2ZEXA 4MHUA 3ACHA 3N7MA 4KWUA 1LOAA 1UAIA 1UY4A 2V5DA 4NJ4A 3WW4A 1PGL1 3ZYRA 3LDBA 3NKTA 1RUF2 1V9U1 2DVBA 1JS9A 3IBMA 5F2WA 2VOKA 3AZVA 5FYUA 5DG1A 4CP9B 3AP7A 3BU7A 3LGRA 3HQUA 3CDZB 1EV13 2DFBA 3FL7A 1ZA4A 5A33A 1O8SA 4N7IA 3H8XA 3I7DA 3M3OA 1QXJA 5FZGA 1EV12 2WNEA 1XYOA 4AAPA 3M3QA 3BU0A 1OVSA 3Q8AA 3S7IA 3RZGA 2DYCA 4FCAA 5GZFA 3A22A 5GZDA 3RG0A 2R7EB 5GLZA 5JVVA 1L7RA 3JXSA 5A1AA 4PF1A 5C4WA 2ZX2A 1YWKA 3N7LA 1QNYA 2ID4A 3H9AA 1NA1C 2JDKA 4ASKA 3HQXA 4CEYB 2I2SA 4JQTA 2QFEA 3VKLA 2ADDA 4FPOB 3TN93 3ON7A 2A6XA 1Q5OA 5JMOA 3BPSA 4TLFA 4HMZA 3TN92 1JYCA 3PHMA 3N9LA 1RUH2 4LHLA 4O65A 4COZA 5I91A 3O1VA 2A7AA 1O91A 2HWB1 3MIEA 3MF9A 4M00A 1OURA 1D4M3 2CSGA 5IUQA 1JYXA 1Z0HA 1POQA 1W8ZA 2G1MA 2XLGA 3SQOA 3H1WA 1K5JA 5I0TA 2P17A 1GSLA 2A3XA 2ZZJA 2VU9A 1GICA 2BGOA 3O7OA 3W5MA 3GZUC 4F83A 3JD73 3LA3A 5FREA 2Q4SA 3GCXA 4QB1A 4CEWC 2NMNA 3VZLA 2JENA 3LDKA 2UY9A 1W99A 3EMRA 1KJRA 4LLOA 4Q0VA 3PUHA 5A33B 5IYYA 1OH4A 1KFUL 4LPLA 1WLWA 4LBMA 3OCPA 2JDHA 4P5HA 1MR5A 1SEFA 3FJSA 4BJ0A 1XE8A 4GMP0 4UW6A 3IDAA 2XOMA 3OY8A 2VTXA 3EO6A 3OGGA 1SBDA 3AKPA 3PVEA 5ERLA 1MS3A 4DUVA 2E51A 4JDOA 5HXMA 3VDBA 4JZRA 5FY4A 1J59A 2JE9A 3LA7A 4Q4V1 5EJZB 4ATFA 3ST7A 5C4WB 3OEAA 1Q8QA 3TAYA 2PN5A 2ZGQA 4XZUG 4GQ7A 1GANA 5CVRA 1W05A 3H3ZA 1AR91 5LK5A 2HEVF 2YHJA 3EBRA 4IESA 3SKJE 5A6ZA 1VMFA 5I0SA 2WNVA 1YJKA 4FI9A 4BMEA 4LTAA 5B2GB 3S57A 1YIPA 3O0WA 3O0VA 4LITA 1STMA 3ALQA 2EIEA 3ZFGC 4Y1YA 4GXLA 1AX1A 1OXCA 3K4AA 4JKMA 1W3XA 3IDEA 5FZ3A 4COVA 4IXLA 2TEPA 4CA9A 4W6WA 4W65A 1V0AA 3ZYIB 1GQHA 2RS31 3LB9A 4OCTA 1NKGA 4QAWA 4KBZA 3VDDA 3AZZA 4RS5C 4L97A 4M4PA 4BK5A 3ZSMA 1ENSA 1JOPA 4XBNA 1IOAA 2SLIA 4GKXA 1RC6A 1Y43B 5EQUA 4BE3A 2CU5A 4WVWA 5FY8A 4XHBA 2BVVA 5JAXA 3UK9A 1SDDB 3V64A 1XSQA 5GLTA 4RQPA 4XUQA 4ZONA 2ENRA 3WNLA 2EAAA 4CP2A 3PUSA 2J1EA 2VULA 1AR72 1D4VB 1UXXX 2VMEA 3DL3A 2XG3A 3EHKA 3QH7A 4A4AA 1WCKA 3MIBA 4XDOA 1QEXA 3FWEA 5EHDA 4PCRA 3F2ZA 3FN9A 2H6CA 1O5UA 4IV3C 3FUOA 1W8TA 1Y9GA 4D6SA 1RUE3 2CV6A 2IXLA 3I2IA 4MLOA 4S2FA 4U2AA 2YBPA 1RUE2 4MZUA 3B5LB 4RN5A 1V70A 4IEZA 1JZ4A 5DUXA 3NQHA 4HKOA 1UZZA 1S0DA 4FFIA 5FQ0B 4ARYA 2IUWA 1SFYA 5DQ0A 2R073 3FBYA 2Q1ZB 4HK9A 3T2OA 4FBFA 1O6UA 4COYA 2ARBA 2R072 1VAVA 4IEYA 4QX7A 3AKSA 4RHV3 1EAH3 5FY5A 4V2VA 1GWMA 4MSVA 3AXDA 4J25A 1U5XA 4AQTA 4XQWA 2K9ZA 5FWEA 2B39A 2DUOA 1YI7A 2J7MA 4RHV2 1EAH2 5DAVA 3Q8EA 3WDXA 1F8VA 1G6NA 2EICA 1VBC1 2XUEA 1TNFA 4TTGA 5F1RA 3TNPB 4NR1A 4D69A 5T54A 4HN0A 1GUIA 4Z82A 3HIFA 1MZFA 2WQ4A 4QMAA 4BQ3A 1W28A 3ILNA 1HQNA 3HNMA 4QQ2A 5FKBA 1XYNA 1CIWA 1NE6A 1IZ3A 4Q1PA 3WY6A 1ZRCA 2VNRA 3T0BA 4X6QB 5F5IA 1VBE3 2VCAA 4Y4RA 1LHNA 1PVXA 3RMYA 3AL5A 5F5CA 5KXDA 4YW6A 4FTSA 3OB8A 2BYVE 1VBE2 2V73A 4IGPA 2R043 2AEYA 3RYRA 3T30A 4CXXA 5C33A 2DUPA 3CJIC 3VDAA 2HEWF 4GMP1 4NPLA 1V6NA 2V4VA 5FZEA 4FFHA 3HJRA 3VBUC 1NYWA 1AX2A 1G86A 3ECQA 3R4DB 4BWOA 4I02A 1IKQA 2KXLA 1PGW2 5DN2A 2HWE3 4BK4A 2VD7A 4XBQA 2O8OA 5JUVA 4XBLA 2D40A 3MFCA 2BRTA 1UOBA 1WW4A 2WYFA 4FQ4A 1GYKA 1WW5A 4PJYA 5FMOS 4GULA 1K12A 1VB4A 1ULEA 5FP3A 1ZZ7A 4JGZC 3LOIA 2ZGKA 2ARAA 1RITA 2KM2A 3PJYA 4JQRA 1PM7A 2BNMA 2WZR3 1CZSA 1XC6A 4IEPA 1C3HA 2D93A 5LZ6A 2XLAA 2G9ZA 5A7PA 4CCMA 2WZR2 2C26A 3NNGA 1F5JA 2XJRA 4DXSA 1JTZX 4UAPA 4WM8C 2WC2A 3ZXLA 2WT1A 2NM1A 4NRMA 5K8SA 3DECA 1PNGA 1LU1A 1XU2A 2O0OA 1RHI2 4HT1T 3UKNA 2VMHA 2R1DA 3DUIA 2FDJA 4ZPIA 1AHSA 4DINB 1VBB1 1CAXA 4ZU4A 5A7WB 4B3NA 1W04A 1RUNA 1CAVB 4PLMA 2PYTA 2Q0AA 5J96B 4BQ1A 1ZZ6A 5L36A 3KHCA 1VMHA 2W94A 5FYSA 5LBCA 1ULFA 5BNNC 1HN0A 4UBGA 5E16A 1DQ1A 2D3RA 1YFUA 5EXOA 2WJSA 3WW2A 3C8XA 4JC1A 4N43A 4DQAA 4Z1VA 3EYPA 5HBAA 1S0EA 2JG9A 3RYPA 4SLIA 1ULCA 1QIQA 1LOGA 4Y26A 1Y9MA 4MHRA 3H8OA 4B4QA 2NP0A 4AEKA 2VBBA 4URAA 1IHMA 5FK7A 3PNAA 4WZFA 5LCWL 1X7NA 3N36A 2WFF3 4A42A 4I0WB 1I1EA 4K9SA 1OPOA 2VAUA 3PVOA 3I8TA 5FK8A 2WFF2 4PDWC 4AHWA 4JV4A 3K4ZA 5ISLA 2Y0IA 1HLCA 5T5LA 2G9GA 3QOPA 1YNAA 3OD4A 3MPPG 3I59B 4HVQA 4QGMA 1LOBA 4YW7A 2GAUA 1QXPA 1CR7A 2GMEA 4Q5OA 5FZ8A 5KHGA 4OLLA 1DCSA 4PHZA 4XFFA 1WW6A 2J22A 2QBXA 1YQ6A 3J7LA 2GMMA 3NKGA 4I09A 2ET1A 2YPDA 4XTPA 5CKQA 2XQRA 4FT8A 5H9QA 2JDPA 5CAZA 1QQP1 1NT0A 3B01A 4BQ4A 5DAPA 1XU1A 4BXFA 3AJYA 3FMGA 3WW1A 5HI0A 1VRH3 1JU4A 4RFRB 3VKFC 2J1VA 5L7OA 1G9AA 1CAXB 3T09A 2VMGA 3ZXKA 3HPNA 4NHYA 3MLJA 3KCXA 1V6LA 1VRH2 4U36A 3BKZA 1SLAA 1UU5A 3WG2A 2JEMA 3SITA 2TNFA 2CDOA 4RYDA 3M3IA 5DZEA 3ACLA 1J83A 4XIOA 1YQ5A 1UF2C 1WBLA 3DKWA 3MDPA 4LK7A 4AHXA 5C7GA 5DXDA 1ND3A 4LHKA 5FLJA 2R30A 2DCYA 1BMV1 4ZHNA 2H6BA 4MV2A 4CDQC 1W6QA 2UURA 2I45A 2HLEA 3A4UA 1NLRA 3TNQA 2D6KA 4OUSA 2CAVA 1O5LA 1D2SA 1GP5A 1UOGA 4H2AA 1JZ6A 3V0AB 3B00A 4ISRA 4KNCA 1OOPA 3LKJA 3GBFA 5BYNA 3B69A 2BOIA 1YC61 2ZPXA 4G9SB 1UYYA 3UJOA 1R1A1 2OQ7A 1WUVA 1GQGA 2A6YA 4BLIA 1APNA 2J1TA 1UW8A 4D6QA 4NHLA 1ALYA 1Y9QA 2DCJA 2YU1A 5A3NA 4IE0A 4EWAA 3WP3A 1RGSA 1AJOA 1V6MA 2WAAA 5A3WA 3LWCA 2ZMKA 4HN1A 1BBT1 4H7MA 1N1TA 5GLUA 1AR71 4AVTA 4CU9A 4FAHA 5JDBA 1OA4A 3MV11 3VZKA 4LO5B 3ZYJB 3UGHA 2WWUA 3DV8A 3GALA 3KZ4C 4IE6A 4CSWA 2AR6A 2CWMA 1K45A 4FOYA 4JCKA 4BB3A 5L7OB 2A6VA 2WSUA 4OYUA 5F3CA 4AWDA 2WO1A 2WS91 3MLLA 5J48A 1BKZA 1XNKA 3OSDA 4CEYC 1HIXA 3CBNA 2HYXA 1ZA7A 2W68A 2XONA 4XHXA 4XQDA 2F6BA 3SEEA 1O4YA 1ODMA 3G6JB 3SH4A 5B4NA 4FFFA 2A6WA 2D6LX 3DYOA 3I2HA 5KWRA 1Z7S2 2GP3A 4DO0A 4YW3A 2C24A 1RL3A 3ETPA 4K1YA 1TMF3 1PZ8A 4Q8LA 4XZPA 4BU2A 2DBNA 1W6QB 1D2QA 1TMF2 5ABJA 1C57A 4ORFA 4BH9A 5FPVA 2WZEA 5BPXA 1V9U3 1NCQA 5GZCA 2FDHA 1HJFA 3BVCA 1QOSA 2XLFA 3MICA 3NW4A 5A3UA 3WDTA 3WNKA 1ASJ1 2ORXA 1JZ2A 1AUYA 1LCLA 1V9U2 4W6YA 5G04L 5H9PA 4RR3A 1OLME 1OOPB 1RJ8A 3FUQA 3E6CC 3POFA 4PF5A 2IXJA
chains in the Genus database with same CATH topology
5CKNA 3POIA 4LOSA 2QQMA 4LORA 3POBA 4GZ9A 2WNOA 1SZBA 5CKQA 2QQLA 1NZIA 4LMFA 3KQ4B 1NT0A 5CKMA 2QQKA 1SPPA 1SPPB 3DEMA 3POJA 1SFPA 3POGA 2QQOA 4LOTA 3POEA 3POFA 5CISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKN A;  3POI A;  4LOS A;  2QQM A;  4LOR A;  3POB A;  4GZ9 A;  2WNO A;  1SZB A;  5CKQ A;  2QQL A;  1NZI A;  4LMF A;  3KQ4 B;  1NT0 A;  5CKM A;  2QQK A;  1SPP A;  1SPP B;  3DEM A;  3POJ A;  1SFP A;  3POG A;  2QQO A;  4LOT A;  3POE A;  3POF A;  5CIS A; 
#chains in the Genus database with same CATH topology
 4Z8B A;  2ZGT A;  4LHS A;  1VIW B;  5T5O A;  3DCQ A;  1OQ1 A;  1R08 1;  2WA4 A;  1RIN A;  1MS5 A;  1S55 A;  5A70 A;  2VBD A;  3A7Q A;  3GGL A;  4GZ9 A;  2VH9 A;  1NXM A;  4W8J A;  3NAP A;  4FPK A;  3Q8C A;  4XMA A;  2ZGM A;  1LKN A;  3ABZ A;  3HBZ A;  4MXW A;  1NOV A;  4QKN A;  3S7E A;  1XNA A;  4BQ5 A;  3UV9 A;  3AMH A;  4Q2F A;  4GWI A;  1U5Y A;  2X10 A;  1KRI A;  4XFB A;  5C4W C;  2A6Z A;  3ZDV A;  1LAJ A;  1UD1 A;  4H7L A;  3LFM A;  3U37 A;  5D2A A;  4YGC A;  4AHY A;  3VD9 A;  1CZT A;  2VCM A;  3AZY A;  3GCW A;  1RXF A;  4NRO A;  1US3 A;  5D1I A;  5CFD A;  2FDK A;  2W2I A;  3RZH A;  1HXS 1;  1WGP A;  2HWB 3;  1G9F A;  4Y3O A;  3KLS A;  3THC A;  4RSU A;  4LE3 A;  5J3U A;  1BK1 A;  1LTE A;  2Y6G A;  4QKB A;  1DBN A;  1PGW 1;  3J26 N;  1JU3 A;  1H9P A;  2GH2 A;  3BGA A;  3DPR A;  1W2O A;  2EIB A;  4XW3 A;  1PHM A;  5CKM A;  1LOF A;  2HWC 1;  4GJY A;  3A21 A;  5ABJ B;  1VP6 A;  1F35 A;  1NUK A;  2RS5 1;  5F3I A;  3POJ A;  5DUV A;  5EV7 A;  1PX4 A;  1VE0 A;  3GJA A;  4D94 A;  4R9D A;  2CL2 A;  1NLS A;  1RVF 2;  1YXW A;  2YDE A;  3HOB A;  4RR3 B;  5BY5 A;  1LOD A;  5KXB A;  4GWM A;  1N3Q A;  1MVE A;  1VR3 A;  2WIN B;  1MEC 1;  3KT1 A;  1UIK A;  5CKN A;  4R9B A;  4XDP A;  4KI5 M;  1NE4 A;  2P3K A;  1N3O A;  4K3U A;  2JB8 A;  1RHI 1;  1JI6 A;  4XJZ A;  5FZL A;  5A1L A;  4LBN A;  2KD7 A;  1KXG A;  1X9P A;  3NAP B;  4Q4V 3;  3P3P A;  4ZZ8 A;  1TQ5 A;  1LB2 A;  1NCR A;  4FXG B;  3OTF A;  2X09 A;  4UW3 A;  3T2T A;  4Q4V 2;  2BFU S;  1H30 A;  3JZV A;  4W50 A;  3MW4 A;  3N7K A;  2YRO A;  5FV3 A;  2BJS A;  1SCR A;  3WW3 A;  1UL9 A;  4LLF A;  4LKS A;  1GR3 A;  2UU8 A;  1AR9 2;  3IWZ A;  3GZA A;  5A7N A;  3RI9 A;  2FDG A;  3N35 A;  1YI9 A;  2F4L A;  4YLZ A;  4CXW A;  2Y26 A;  4UFM A;  4CU6 A;  4Q4Y 1;  3WIN E;  1CWP A;  4J6G A;  4PLO A;  5G05 L;  4XF3 A;  4XIL A;  3MHZ A;  4A6O A;  2RS3 3;  2ARC A;  2OT7 A;  2QQV A;  1JMU B;  2EID A;  2RM2 2;  3III A;  5FP9 A;  3RYK A;  1OKO A;  3WQB A;  3N9N A;  2PHX A;  4XF4 A;  1YJL A;  2RS3 2;  2Y6F A;  4NRP A;  1RUI 1;  2GZW A;  5A3M A;  5I8Y A;  5JZG A;  4ES9 A;  4Q4X 2;  5A3T A;  1W9T A;  1N3P A;  2XWB B;  2WL1 A;  4MH0 E;  2GC3 A;  1H2K A;  5FYZ A;  5J37 A;  3BTZ A;  4RD7 A;  1JN2 P;  2A5Z A;  2XHN A;  1PIV 1;  2VUD A;  5FR3 A;  3WEZ A;  2XDV A;  4NID A;  3BAL A;  5C3P A;  5K0U A;  1NY7 2;  4PT6 A;  1HRV 1;  2WQZ C;  4P14 A;  3ZOI A;  5F3E A;  3D0S A;  4LR4 A;  4OUE A;  4CP1 A;  1JUH A;  5JXJ A;  1W6N A;  4YGB A;  2ZX3 A;  1FXZ A;  4WZC A;  4P9L A;  3MLK A;  2DF7 A;  4N8M A;  5FZO B;  3U14 A;  4BQX A;  1GOF A;  1HKD A;  1VMJ A;  2BBA A;  4MOA A;  3WHT A;  4IET A;  5FWJ A;  1NCR B;  2WZ8 A;  1BCX A;  1H6X A;  2MEV 3;  4Q27 A;  2FCT A;  1SBF A;  2D6O X;  3WNO A;  4DXT A;  2CGO A;  3VBO A;  3WF2 A;  5KXC A;  1K3I A;  2AEN A;  1CIY A;  3B93 A;  4FPC A;  1WWY A;  3ASI A;  5T5P A;  1FOD 1;  1WW7 A;  4Y4Y A;  4UI9 L;  2EXK A;  5EPA A;  2QJV A;  2WSV A;  1UO9 A;  4IE5 A;  4OUM A;  4YRD A;  2VVE A;  4YGD A;  5FRA A;  3WF0 A;  4E4D X;  4YZ5 A;  4YGE A;  5CAD A;  3S6P A;  4HK8 A;  5FOB B;  2FD8 A;  2QQM A;  3CU7 A;  3GM8 A;  1J84 A;  4PQ9 A;  4DRR A;  3S5A A;  1UCX A;  5LAT A;  1NZC A;  3T0D A;  1W9S A;  2PHL A;  2WNO A;  1F31 A;  1JZ3 A;  4E9K A;  1VBC 3;  5FDB A;  3FFQ A;  5D21 A;  1C5I A;  1NQD A;  1MS0 A;  2GH8 A;  4LO6 B;  1SDW A;  3VHN A;  2UYB A;  2PFW A;  4CVU A;  1OD5 A;  4QU2 A;  4H14 A;  2W47 A;  3VBH A;  3VKN A;  1UQX A;  3GBG A;  5CZK A;  1S0F A;  2JE8 A;  3AP6 A;  3M4F A;  2PA7 A;  4D7Y A;  1OUX A;  2GSY A;  3ZPO A;  1FX5 A;  2RG4 A;  1UYX A;  5GLW A;  1UMH A;  2VQ0 A;  1REE A;  5SV8 A;  3WXP A;  3H3L A;  3FX3 A;  3ZXE A;  1H9W A;  1CPN A;  2ZEY A;  4I3P A;  3VL8 A;  2CHH A;  5JPN B;  1W6N B;  2VZO A;  3EB7 A;  4QDS A;  2GU9 A;  3L2Y A;  4IEO A;  3CKH A;  4GMP 3;  4L2N A;  3D4K A;  4OHX A;  5JSO A;  1DYP A;  5D8A A;  3KT7 A;  2XJU A;  3SC7 X;  1SBE A;  3NO8 A;  2VUJ A;  2L9L A;  3VHR A;  5LBB A;  5A3P A;  2XXZ A;  2XKP A;  4NMI A;  5IAV A;  5F3G A;  1C8M 1;  1JHJ A;  4P9X A;  5FY0 A;  2I07 B;  3I3M A;  1KDM A;  3POG A;  1BK0 A;  1EUU A;  1N1S A;  4IEW A;  4N9H A;  3S5Q A;  1X9T A;  4FPE A;  2BER A;  4FO9 A;  4YG6 A;  3ZVX A;  1D0G A;  2XL9 A;  4HOO A;  3B3Q E;  3RWK X;  3VB9 A;  2ERF A;  3MO4 A;  5JCT A;  3ILR A;  1H8T B;  1LES A;  4JHT A;  1ND2 A;  1FMD 1;  4QXK A;  5AC9 2;  5A1F A;  3ZKU A;  4AOC A;  3BTX A;  1MPX A;  1UY2 A;  2ZJC A;  2P34 A;  1QF3 A;  1YQ2 A;  4YVW B;  1MAC A;  1WCS A;  1NXD 1;  4IEQ A;  3OBA A;  3AL6 A;  4CDW A;  1EY2 A;  4CCD A;  3IMM A;  4QHO A;  3LEK A;  4I0B A;  4IQP A;  1OSG A;  3VBH B;  4BDV B;  1QHD A;  1PVC 1;  1ULD A;  2OPW A;  4HKW A;  4NIG A;  1FYU A;  1UPI A;  3WG1 A;  3KSC A;  4XTM A;  1VBB 3;  2DCK A;  5AFE A;  2WR9 A;  1IPJ A;  5CFC A;  2JDU A;  4XJ8 A;  5F6L B;  4E8C A;  3ZO0 B;  2R6Q A;  1UYZ A;  1VBB 2;  5FAX A;  3U1X A;  4AFA A;  5HCA A;  4B7E A;  3W5N A;  1PK6 A;  2ZGU A;  3PVB B;  3LIH A;  3V56 A;  1H0B A;  3U4S A;  1QU0 A;  3TEW A;  2YYO A;  1VJ2 A;  2WLP A;  4LHN A;  4B29 A;  1O4Z A;  1MVQ A;  3N3H A;  3M7A A;  1TE1 B;  2Y64 A;  5KHH A;  3FLT A;  4OI4 A;  2W0X A;  3AMQ A;  3PIJ A;  2K46 A;  4CCO A;  1W9F A;  1F15 A;  3UKT A;  4Y1U A;  5EYY A;  3ZYP A;  4D8M A;  2G4I A;  2ORZ A;  1RUH 3;  1UN1 A;  1X36 A;  2OZ6 A;  1QJU 2;  1MS1 A;  4R9A A;  4G3Y C;  3OGV A;  5IFT A;  1CJD A;  4YM1 A;  2AC1 A;  3NV3 A;  5T50 A;  3AFG A;  1QKQ A;  3ETQ A;  2ZKL A;  5ANN A;  3R0R A;  4JVA A;  1H2M A;  3VD4 A;  1R09 1;  1KQR A;  4Y1Z A;  4XUN A;  2AGS A;  1SLL A;  5LRS A;  4F3J A;  1CON A;  1Y3T A;  4UW4 A;  1DU3 D;  1ND2 B;  2HH9 A;  4LO4 B;  2BQP A;  3SH3 A;  2W1U A;  4YM2 A;  3SCH A;  4HON A;  3I2O A;  1FPN 1;  3BPZ A;  2DVD A;  1RVF 1;  1F9K A;  2DCT A;  3I97 A;  4QXH A;  4FSJ A;  2BNN A;  2VTF A;  3M2M A;  1DGW X;  2PTM A;  2ZOE B;  2JB4 A;  1QQP 3;  2JG8 A;  2VG9 A;  1BJQ A;  1PO2 1;  2ZGL A;  4CDW B;  2EAL A;  2YMZ A;  5C9A A;  2D3P A;  1YFY A;  1RUO A;  4QXB A;  1QQP 2;  1PMJ X;  1DG6 A;  1TG7 A;  1GBG A;  2PHF A;  4E4S A;  2G9F A;  3VBS A;  2WNU A;  4P9Y A;  5FP4 A;  5FZ6 A;  3IAQ A;  3PU8 A;  4LK6 A;  4QD2 A;  4CUG A;  1PK6 B;  4FQZ A;  2ZHK A;  2RJK A;  3KVA A;  5L7O C;  3URF A;  2RDS A;  1LEM A;  4EN6 B;  1WZX A;  4MGI E;  1O59 A;  1UY3 A;  2PHR A;  1OT5 A;  3CL1 A;  3W58 A;  3WUD A;  1BQP A;  1KJL A;  2HWF 1;  1QMJ A;  2W92 A;  1QGL A;  4Y24 A;  2CGP A;  1BMV 2;  1REF A;  1AJK A;  1ZBA 1;  5A7S A;  1VPH A;  4YPJ A;  5IVY A;  4XYX A;  3ACF A;  1YQ8 A;  2RM2 1;  1SMV A;  4YM0 A;  1R1A 3;  5IFP A;  5SV5 A;  1Q3E A;  2WII B;  4I01 A;  4Q4X 1;  1UZ0 A;  3HNB M;  4PQQ A;  1R1A 2;  3BIW E;  2ZX1 A;  5FYT A;  1ULO A;  1OOP C;  3U78 A;  3RVH A;  3TWI A;  3IZO A;  2PQS A;  4S2G A;  5KBF A;  1GKB A;  1BBT 3;  3K77 A;  4Y33 A;  2YC2 A;  1AR7 3;  4KWJ A;  4A41 A;  4XOG A;  4IUG A;  4AVV A;  1RUD 1;  1ZRI A;  4HAN A;  3VL9 A;  1LGN A;  4DEV A;  1BBT 2;  1NY7 1;  2PLV 1;  4V1P A;  1O3R A;  4YW5 A;  4V2W A;  3D3A A;  4QQH A;  1RUG 1;  1OHF A;  4CCJ A;  5GZE A;  2B45 X;  3JU9 A;  3OY8 B;  4DEQ A;  2QZ2 A;  4RGK A;  3VBS B;  5E88 A;  4EZ4 A;  5IK4 A;  1IQD C;  5DAW A;  4GAZ A;  5HCB A;  5GZG A;  1XE0 A;  2WS9 2;  1GZC A;  1UWW A;  2JWP A;  2WO7 A;  2R06 2;  4I2O A;  1DFQ A;  3BOW A;  3HN3 A;  3AFK A;  2Q8D A;  3TOJ A;  1DYK A;  2ZAC A;  3DXU A;  3CMG A;  1VBA 1;  3MI8 A;  3RJ2 X;  4JGY A;  5A32 A;  3D0J A;  3PME A;  2WNV B;  1JYW A;  1E57 A;  2VM9 A;  5J98 B;  3CHX A;  5AVP A;  3LF7 A;  4AED A;  2NYY A;  3NWK A;  1WCU A;  2QNK A;  3K4D A;  5LY1 A;  3O1O A;  3AP5 A;  3JQX A;  5FYH A;  1ACC A;  1RXG A;  3FE5 A;  4EWD A;  1W6O A;  2HBU A;  1DQ2 A;  1W8H A;  4E4H A;  5ABJ C;  1ASJ 2;  5C8C A;  1YFX A;  4CDX A;  4IGQ A;  5EZW A;  5I93 A;  4PBO A;  3VDD B;  5FLH A;  1R08 3;  2OQ6 A;  2YC4 A;  2P37 A;  4FPL A;  1CAU A;  1KIT A;  4RR3 C;  4EN8 B;  3QH6 A;  2P6C A;  2C9K A;  4LBJ A;  2QUO A;  1R08 2;  2BP6 A;  1I5P A;  2D6P A;  4CCL A;  4GB3 1;  3ZFE A;  2R16 A;  2G19 A;  3J8F 1;  3AK0 A;  1COV 1;  4RQP B;  4UFJ A;  1H1M A;  3D5O A;  2XKO A;  2EXH A;  5DAB A;  1AYM 1;  1H2L A;  2ZHM A;  4BQ2 A;  3NAP C;  2LS6 A;  2C1F A;  1AR6 1;  2LTN A;  5FXZ A;  4YAR A;  3PJQ A;  2H0V A;  4JAA A;  4M3C A;  3WT3 A;  1QJY 1;  3LAG A;  3ZSE A;  1AL2 1;  1YYN A;  1Z78 A;  2JEC A;  3ZSJ A;  1HXS 3;  3ZR6 A;  3WVJ A;  5L73 A;  1WMD A;  4Q8K A;  4CZS A;  3J4U H;  2VCC A;  3PUQ A;  1HXS 2;  1GZT A;  2KA3 A;  2UWC A;  2XJT A;  2YBS A;  2Z4F A;  3HMY A;  3JBG 2;  1AYN 1;  2W46 A;  3UT0 A;  4NHK A;  3LQC A;  5A32 B;  4NWW A;  2HWC 3;  4AI3 A;  4GJZ A;  5F8P A;  5FZC A;  2RS5 3;  4AED B;  5F6K A;  4ZKT B;  1LJ7 A;  3CNA A;  3TYJ A;  3K46 A;  3KCY A;  2HWC 2;  4N9I A;  1ENX A;  4I30 A;  5FBJ A;  1WKY A;  2RS5 2;  3L2H A;  2B5H A;  3VBF A;  1GMM A;  5K7P A;  1W6O B;  2WZP P;  5AC9 1;  1LOF C;  1OH3 A;  1UOF A;  2VZU A;  4M01 A;  4AI1 A;  5C8C B;  5IHR A;  4CDX B;  4NIA A;  3RPQ A;  5JLV A;  1K5M A;  1MEC 3;  2Z2S B;  2Y0O A;  3KMH A;  3BIE A;  3MGU A;  1MZ5 A;  4R52 A;  2ARX A;  3KV6 A;  3KWV A;  4P9G A;  1CAU B;  1J3R A;  1MEC 2;  1ST8 A;  1ULG A;  1RHI 3;  3UES A;  3ZIX A;  2ZGO A;  5EFU A;  1PMI A;  5K4L A;  5FXX A;  4HXC A;  4FPH A;  4CCE A;  4A2U A;  1DGW A;  4XFI A;  2EIG A;  2GC1 A;  1ZZ9 A;  1VBD 1;  2VPV A;  3O1U A;  3OOX A;  5LA1 A;  1S0G A;  4NWV A;  3HAG A;  2V4A A;  4IL7 A;  5B4X A;  4QGL A;  2V72 A;  1QJZ A;  2PEL A;  4LKD A;  4DXR A;  1L7Q A;  2C6S A;  2I74 A;  4JDM A;  5DZF A;  1NCR C;  4AAX A;  1D0H A;  3AZX A;  4R9C A;  1QH6 A;  4ET7 A;  2R32 A;  2ZXQ A;  3DF0 A;  4MGT A;  2VMF A;  4URT A;  1QDO A;  1ZNP A;  3N4M A;  1Y4W A;  2VZS A;  3AP9 A;  3DYP A;  2VOV A;  4YZ3 A;  4LXL A;  4Q4Y 3;  5IAT A;  4A7K A;  2VOT A;  1AL0 G;  3PUI A;  3E6B A;  3AC0 A;  4NAM A;  4L92 A;  3O1T A;  3NVC A;  2VBP A;  2QQL A;  3KF3 A;  1QJU 1;  3P3N A;  4QM8 A;  4Q4Y 2;  4WVM A;  1HB1 A;  4X8P A;  1U0A A;  3VDC A;  3GZT B;  3NNJ A;  1UYP A;  4K40 A;  4C91 A;  2XVK A;  4IV1 A;  5BNP A;  1H8V A;  1O7F A;  2RJL A;  1RUI 3;  1W9W A;  2WWS A;  4XXA A;  4B4R A;  2XL7 A;  5GLV A;  3N9Q A;  2RDQ A;  4FPJ A;  1RUI 2;  3OF1 A;  3HBK A;  4ITC A;  3W21 A;  4CCC A;  1U5Z A;  2YFZ A;  3C7G A;  4A45 A;  5LK7 B;  1KS4 A;  1PIV 3;  2WA3 A;  3T3Y A;  1PZ9 A;  4EQV A;  4OI1 A;  5JI7 A;  3ROU A;  1LHV A;  1UY0 A;  4O61 A;  1FNY A;  1PIV 2;  5AFB A;  1K5M B;  2WAB A;  4QT6 A;  1WCD J;  1K42 A;  2B42 B;  1HRV 3;  3K51 A;  4HBN A;  4AVC A;  5BV6 A;  4QB6 A;  4JKK A;  3U11 A;  1J3Q A;  2WQ8 A;  2BWC A;  1SG3 A;  1OD3 A;  1HRV 2;  4XJW A;  5FZ1 A;  1QH7 A;  4KWL A;  3QCW A;  1E5H A;  2VUC A;  4HET A;  4AGR A;  3IAP A;  4M0N A;  1JW6 A;  4PLN A;  2C5D A;  3C7O A;  4QQO A;  2AH2 A;  3WOG A;  4P02 B;  2OX0 A;  1H1I A;  1AXK A;  3GZE A;  4MGQ A;  1FOD 3;  1A3K A;  1OA3 A;  3POI A;  4XAE A;  1H6Y A;  3LFI A;  4A7Y A;  3JD7 1;  4N43 B;  1FOD 2;  2PHT A;  4AFD A;  1W8F A;  2W39 A;  3I3Q A;  2JG9 B;  4QPI A;  2UYA A;  4QPW A;  3RZK A;  4DUX A;  4Z2W A;  1WD3 A;  1YFW A;  4TLG A;  4WVM B;  5T55 A;  3LEG A;  1LU2 A;  2OUJ A;  3B02 A;  4YW4 A;  2PXJ A;  4NO4 A;  3RS6 A;  2W1S A;  4IV1 B;  1GZW A;  4B7K A;  5BNP B;  4FPG A;  4ZU7 A;  1H1A A;  1H8T C;  2RE9 A;  2B7Y A;  2Y34 A;  3ZX7 A;  2Z42 A;  4X6R B;  3POS A;  4ERO A;  5JIA A;  4W6X A;  3I3D A;  1RUC 1;  3WG3 A;  2VTX J;  3TEZ A;  2CDP A;  2FCU A;  2ZHL A;  1I6X A;  3JQW A;  5FJK A;  4YVW C;  1ZRF A;  1QOT A;  2FZ1 A;  3ZFG A;  4Y1X A;  3VBH C;  2RDN A;  1A6C A;  5JR7 B;  2ZAH A;  3CO2 A;  2A3Y A;  3ZPY A;  1DZR A;  1YRZ A;  4AI9 A;  4C8D A;  2DTW A;  4IDZ A;  4XFH A;  5DG2 A;  2VY0 A;  4KBB A;  5JOX A;  2OA2 A;  1W03 A;  5IK8 A;  4UWD A;  3MV0 1;  3TRS B;  1S2K A;  3IKW A;  4NOT A;  4BHP A;  5CG9 A;  1S0C A;  1WLC A;  4CRQ A;  1JZ8 A;  1POV 0;  2X53 S;  1C8M 3;  2E31 A;  1PZ7 A;  1AVB A;  4XUP A;  1A78 A;  1T6G C;  3SH5 A;  1C8M 2;  1OPM A;  3THP A;  2B8M A;  2R06 1;  1Z7S 3;  2KR2 A;  2B46 X;  1MZE A;  3GXU A;  3KQR A;  4A3X A;  4E8D A;  2WWJ A;  1DGR A;  3ZYB A;  4QPI B;  2XWJ B;  5HCF A;  1SZB A;  3T08 A;  4CUA A;  2VZ3 A;  4BA6 A;  1ND3 B;  3SLI A;  1ZZB A;  1FMD 3;  4LO7 A;  1PO1 1;  3C2U A;  2Y8K A;  1OLR A;  3MZH A;  1HB4 A;  1FMD 2;  4P9I A;  5FZB A;  1S1A A;  5FZD A;  3UL2 A;  3M8L A;  2W52 A;  2UWB A;  4QHZ A;  4W4Z A;  4FFG A;  4CEW A;  1PNF A;  2YBK A;  3D82 A;  1ND2 C;  3K3O A;  3POE A;  2W91 A;  3THT A;  4ZS2 A;  1FAY A;  1LOE A;  4MO3 M;  1W6M A;  2D5H A;  2E53 A;  5DDJ 1;  1BYH A;  1PVC 3;  5L9B A;  5I8T A;  3H42 B;  1I3H A;  1RMU 1;  4QX3 A;  1ZZ8 A;  2VQT A;  1SFN A;  5FZI A;  3ZDS A;  1PVC 2;  4CDW C;  1LED A;  1OA2 A;  1Y7B A;  3NNF A;  1JUI A;  5ANQ A;  3VZM A;  1DZQ A;  3CEW A;  3I2K A;  2E63 A;  4E2G A;  2JIJ A;  2F4P A;  4NUB A;  1S0I A;  4WVZ A;  5FO7 B;  3USU A;  1KD7 A;  3C3V A;  4L11 A;  1CN1 A;  1W2N A;  2JKX A;  2CWS A;  1C4R A;  1CD3 G;  2RV9 A;  4IND A;  3MIH A;  3N9O A;  1X82 A;  4HZF A;  3E5Q A;  2VEC A;  3ZSL A;  1PK6 C;  3C7E A;  1OVP A;  1QOO A;  4KU8 A;  3FFZ A;  3AKT A;  4NVP A;  4FAG A;  1PMH X;  1OC1 A;  5FYM A;  2A73 B;  2RMU 1;  3DN7 A;  5IK7 A;  4DIQ A;  3JBG 1;  2Y6K A;  3SCG A;  2LUW A;  4OZO A;  3I2F A;  1R09 3;  3MIG A;  4Q26 A;  4XJA A;  5JOW A;  2AAC A;  2D7F A;  4CPB A;  1OKQ A;  5I0R A;  1JYT A;  3HT1 A;  4QB2 A;  1IS6 A;  4QXC A;  1R09 2;  3TBD A;  4JHZ A;  3O14 A;  2AEZ A;  4YZ1 A;  2J1A A;  3GHN A;  4ZXE A;  2XVL A;  2WT2 A;  1FPN 3;  1RVF 3;  1NCQ B;  3NV4 A;  1BZW A;  4I3G A;  4WM7 A;  1O8P A;  2VW1 A;  5FLI A;  1BLZ A;  4CEW B;  2FMY A;  1DQ0 A;  4L0P A;  3U75 A;  1PO2 3;  1FPN 2;  1VAK A;  2GC2 A;  2VXJ A;  1RUJ 2;  4ZU5 A;  1W06 A;  1W6M B;  3ACI A;  1PGS A;  4XAC A;  2QKD A;  3FC0 A;  4LQR A;  4NII A;  1PO2 2;  4YW2 A;  3VD7 A;  4AW7 A;  5C70 A;  5IVB A;  5M0T A;  3HWJ A;  1OQE A;  4JRA A;  1O3T A;  4LOR A;  4OI2 A;  4XJU A;  1ENQ A;  1E5S A;  3PU3 A;  1ONA A;  4TWT A;  1C28 A;  4R8H A;  2C0Z A;  4UFH A;  3FZ3 A;  4LBQ A;  3VGI A;  1OLQ A;  2JXA A;  2HWE 1;  4RFT 0;  5FY9 A;  3WQ0 A;  1V6I A;  4MXW B;  1OUS A;  5LBF A;  5LA2 A;  2VNO A;  3JCI A;  3OD0 A;  2WUH A;  2YG0 A;  2XVG A;  4GAL A;  3W59 A;  3VBS C;  1AR9 3;  3AXE A;  3OPT A;  3I2J A;  3SKV A;  2BNO A;  4XUR A;  5LB6 A;  3RZJ A;  2ZBJ A;  4L99 A;  3U4X A;  3GBW A;  1HV1 A;  2GNB A;  2HWF 3;  3AVS A;  3ENR A;  1SQ4 A;  5C71 A;  1DHK B;  1JXN A;  4ASL A;  3WNP A;  5CFD B;  3CF6 E;  1ZBA 3;  1POV 1;  4CUB A;  3A0K A;  2XQX A;  2YUE A;  2HWF 2;  4GWJ A;  2MPF A;  4BLJ A;  1UZY A;  2WNV C;  5FMO L;  2WAO A;  4OMD A;  1GP4 A;  2RM2 3;  3CLP A;  1ZBA 2;  4BQY A;  5IT6 A;  4IER A;  3LDR A;  2FZ2 A;  4PIZ A;  3WF3 A;  4EN7 B;  4DY5 A;  4NHM A;  3IIA A;  1B09 A;  2NLR A;  2P6H A;  3KV9 A;  3N9M A;  4KGG A;  4NRQ A;  4Q4X 3;  1TME 1;  4NE9 A;  4JDN A;  3DPR B;  3O0X A;  2ZHN A;  4P9W A;  5IJR A;  4D7T A;  2OXB A;  4ZZ5 A;  1F4H A;  1XNB A;  2OW4 A;  3I3B A;  3FLP A;  4WM7 B;  2LW8 A;  4C1X A;  1GNZ A;  1UX6 A;  4S2D A;  3U10 A;  3VDD C;  3BTA A;  5JOY A;  3AYD A;  2Q1M A;  1EPZ A;  1RUD 3;  3BOD A;  4QPG A;  4LUL A;  4Y1V A;  2W95 A;  1MS4 A;  5DUU A;  5FZ0 A;  3I49 A;  2X8K A;  1RUD 2;  4OHW A;  1RUG 3;  2BTV C;  1X50 A;  4YSF A;  1W6P A;  4K1Z A;  2PLV 2;  5FZH A;  3AVR A;  4RQP C;  5F7U A;  5HPO A;  2QDR A;  3O1P A;  2GP5 A;  1RUG 2;  1P8J A;  1J58 A;  2Y33 A;  3SIS A;  2H0B A;  2W1Q A;  4CTE A;  1WMF A;  2ETE A;  1GQP A;  1KDK A;  4JRL A;  2A75 A;  4H55 A;  4BCU A;  3WF1 A;  5IVE A;  1WBF A;  5I0D A;  5JI9 A;  3I2D A;  4AE2 A;  1VBA 3;  2BUK A;  1IG3 A;  1XXN A;  2VO5 A;  4MXV A;  1IPK A;  4Q0U A;  4E4Z A;  4K20 A;  5KHK A;  3RDI A;  3S0M A;  2LRO A;  3PTY A;  3VD3 A;  1VBA 2;  1XNC A;  1C1L A;  4G4F A;  5C3S A;  4R4Z A;  5E1R A;  5AVA A;  3JUU A;  3V0B A;  3AKR A;  4AI0 A;  1T6B X;  3UKV A;  1QNW A;  4ISQ A;  3H8U A;  4Y5S A;  5JIU A;  2CY6 A;  3ZXD A;  4CU7 A;  1VB2 A;  4HSJ A;  4AED C;  1YUD A;  4UFI A;  4QWN A;  3WLU A;  2VW0 A;  1FV3 A;  3PVN A;  2MNG A;  4HSL A;  4NAO A;  5FO8 B;  1MZ6 A;  4K21 A;  5F32 A;  2A71 A;  2W08 A;  4Y22 A;  4ZY9 A;  5C8C C;  5JZG B;  2Q5T A;  1ZZC A;  3ZYG A;  4CDX C;  3SNM A;  2XH6 A;  2JD9 A;  4GB3 3;  4OFG A;  1EUT A;  3J8F 3;  2K0G A;  3RZL A;  1COV 3;  4A6S A;  5FZ9 A;  2HWD 2;  4QPG B;  2Z79 A;  3IN9 A;  2QQW A;  2BV4 A;  1AF9 A;  4XAB A;  4GB3 2;  4AF9 A;  3J8F 2;  4HKL A;  5FUI A;  4OQ9 A;  1I9R A;  1COV 2;  3CIH A;  1XND A;  1HW5 A;  1URX A;  2LM3 A;  2WYS A;  1HN1 A;  2TUN A;  1AR6 3;  1Q56 A;  4GH4 A;  4EYU A;  3ZFE C;  4Y20 A;  1AYM 2;  1XRU A;  5BNO A;  5K0U B;  1W6P B;  1JYI A;  1QJY 3;  4N90 A;  1AL2 3;  1AR6 2;  4XF1 A;  2R49 A;  5J36 A;  1F2N A;  1QJY 2;  2A3W A;  1AL2 2;  1IS5 A;  4QU1 A;  4FTB A;  3EJK A;  3QD6 A;  3FHI B;  3BYW A;  1S0J A;  2XBO 2;  2ZGR A;  2DU0 A;  3AMP A;  2V5Y A;  2W5F A;  2WO3 A;  4CCN A;  1AYN 3;  5HCH A;  3NJY A;  2GDF A;  3VBO B;  1AYN 2;  5KR7 A;  1DQ4 A;  4NPR A;  3POW A;  1KEX A;  3LEM A;  4OMC A;  4NN0 A;  2WFP A;  4HL0 A;  1M4W A;  3ATG A;  2XML A;  2NN8 A;  2OII A;  3PUR A;  2DVA A;  2W9X A;  5AC9 3;  1HRI 1;  1WLD A;  4YVS A;  3T4H B;  4CU8 A;  2DTY A;  3AP4 A;  3RMX A;  4AEJ A;  4DUW A;  3Q8F A;  2QQN A;  2OUH A;  2EA7 A;  3K2O A;  5JPM B;  4Q0Q A;  1AR8 1;  2HJI A;  3ES4 A;  3T1L A;  4EV0 A;  2X29 A;  4DMI A;  4FOQ A;  4IE4 A;  1K5M C;  4OHY A;  3WNN A;  5E89 A;  3ITQ A;  4GIQ A;  1V6J A;  2R1B A;  4Q29 A;  4CCK A;  3RGB A;  1VBD 3;  4N53 A;  4C0H A;  3OBT A;  3AMM A;  1ZX5 A;  2JJ6 A;  2OVU A;  5LW9 A;  1GU3 A;  3UGF A;  1VBD 2;  4GH4 B;  4KMQ A;  5BNO B;  1EPW A;  2BOJ A;  3KM5 A;  4OVE A;  4XC9 A;  2IXI A;  1G8W A;  1SLT A;  4K8R B;  5DPN A;  3DXT A;  5H9R A;  2BPA 2;  3VBR A;  3H7Y A;  1W2U A;  2VMI A;  3I54 A;  3HVD A;  1YO8 A;  4HFS A;  3ZFF A;  3ILF A;  5D8A B;  4Z07 A;  1YEW A;  2VZT A;  1G9D A;  3UNP A;  2XR4 A;  4O9G A;  3ZIW A;  1W39 A;  2EXI A;  1YCI A;  4QDR A;  1QJU 3;  5F5Q A;  2CAU A;  3SMH A;  4A3Z A;  2FDF A;  4N43 C;  4AI2 A;  1H2N A;  4E2S A;  5CIR A;  3KS7 A;  4XE9 A;  4FPY A;  2JG9 C;  4DFS A;  1B35 A;  2JDM A;  2VXR A;  2YZ4 A;  2AYH A;  5FYC A;  1QJX 1;  5JSP A;  1PX3 A;  1UX7 A;  1CGP A;  4FP3 A;  3WZ1 A;  2VOW A;  4K6B A;  3DGT A;  2YXS A;  4IV1 C;  4LOS A;  5A3O A;  3RI8 A;  5BNP C;  5JXH A;  4LIU A;  1ZVF A;  2D6M A;  1NX9 A;  5IVF A;  4YVS B;  3AYC A;  1ZBE 1;  2CYF A;  4BYY A;  3K48 A;  4YFZ A;  1VAL A;  3H0O A;  4RA0 A;  2PMW B;  3W9A A;  1RUJ 1;  3WX5 A;  2TBV A;  1H4G A;  4C90 A;  4Q0P A;  3RJR A;  1O3S A;  3AYE A;  3WDW A;  1JZ7 A;  2JIG A;  1IKP A;  3OGR A;  1D7P M;  3ZYF A;  3EXU A;  4N53 B;  3BUC A;  1LEN A;  5L9V A;  4TYS A;  5J09 A;  5CFC B;  3VHP A;  1ENR A;  4GWN A;  1W0N A;  2EXJ A;  5A6Y A;  1D4M 2;  1DLC A;  1LEC A;  2NMO A;  5C3Q A;  1OMI A;  3P1I A;  2GND A;  3PUA A;  3AKQ A;  1V6K A;  2RR1 1;  3T2Q A;  3VBR B;  1X33 A;  1YLL A;  3ORJ A;  1RED A;  1YIF A;  3ZFF B;  4Q4W 1;  3J7M A;  3VHO A;  1UIJ A;  5EJ1 B;  1R64 A;  2D97 A;  3JD7 2;  4UW5 A;  1JZ5 A;  5J7M A;  1QJF A;  1NG0 A;  5FJH A;  3I4I A;  3VKO A;  3ZN6 A;  2VVF A;  1DF0 A;  1V6O A;  3FBM A;  2VGD A;  1OFN A;  1EYB A;  2D5F A;  2R0F A;  4QPI C;  4QKD A;  1B35 B;  2E9Q A;  2GN3 A;  4LBO A;  4XUT A;  4D6R A;  1GWL A;  1FAT A;  3MYX A;  1Q8O A;  1ND3 C;  1XB9 A;  4YZ4 A;  3WUC A;  2MHF A;  3VZJ A;  1RUC 3;  4HG6 B;  3B7M A;  3O12 A;  2P2K A;  4EJR A;  1RJ7 A;  4QM9 A;  5A7O A;  1RUC 2;  4P9J A;  4BOW A;  2OKX A;  1KFX L;  4XJ9 A;  4BM8 A;  4ASM B;  5DUW A;  4IE7 A;  3ZN4 A;  3OUJ A;  5FQ0 A;  5GAL A;  2Z5W A;  4QX1 A;  1CZV A;  3TB0 A;  2QE3 A;  5CG8 A;  3KGL A;  2JG8 B;  2ILM A;  3T2P A;  5C9A B;  2Y60 A;  5E8A A;  2DDU A;  2JKB A;  4XAA A;  3AM2 A;  4EZH A;  2RVA A;  1WME A;  3I2G A;  2ZGS A;  2BFU L;  4BIO A;  3M3E A;  3NRU A;  3HN1 A;  3RRD A;  5CU1 A;  3OGJ A;  2WS9 3;  2WNU B;  1N1V A;  3WCS A;  2R06 3;  1AXY A;  2QDN A;  1GNH A;  5EYX A;  5FPA A;  5C3R A;  4J1W A;  3MUZ 1;  5FPB A;  2GNM A;  1BEV 1;  4AFC A;  4D7S A;  3PLQ A;  4LBL A;  2O1Q A;  2QTW B;  4BIS A;  4IW3 A;  4UOJ A;  5I8S A;  1PO1 3;  4TZD A;  3O5S A;  5FZK A;  3ZN6 B;  3ZXG A;  1DQ5 A;  2P3Y A;  3MW2 A;  2ZTN A;  1JYV A;  1PO1 2;  2QQI A;  1CJP A;  3FHQ A;  3ZKY A;  4QX2 A;  5C5T A;  1NQJ A;  4AHZ A;  2RS1 1;  1QXR A;  4MYE A;  1ASJ 3;  5IVV A;  5BNQ A;  2B9U A;  1X8M A;  1T2X A;  2QQP A;  4XF9 A;  1ZYB A;  5DDJ 3;  5HV4 A;  5A7Q A;  1RMU 3;  1PM4 A;  1SHW B;  3GYD A;  1NCQ C;  3M3C A;  1SAC A;  1HB2 A;  2Y6L A;  3N9P A;  2R0H A;  5DDJ 2;  2OZJ A;  2MEV 1;  4QQP A;  5FP8 A;  2VE1 A;  3USS A;  1RMU 2;  2Z69 A;  3ELN A;  1MQT A;  2PAK A;  1NZI A;  2VNG A;  2HWD 1;  4YG3 A;  4AR2 A;  5K9Y A;  5DZG A;  2HKX A;  2NPI A;  1W9Y A;  4LOT A;  2RJ2 A;  1TVG A;  2VCB A;  1QY4 A;  3UYJ A;  3AMN A;  5EWS A;  3ZXJ A;  2WLQ A;  4XXP A;  2A70 A;  1IQA A;  1LGC A;  2X05 A;  1LOC A;  5FZF A;  1HQL A;  2VMC A;  1UOJ A;  3WP4 A;  3GJB A;  2NZ9 A;  3W20 A;  2RMU 3;  4NPM A;  4QHB A;  1UMZ A;  2XBO 1;  1JBC A;  5FUP A;  5GJ6 A;  4BXS V;  2VZV A;  3JBG 3;  3KCC A;  1WA6 X;  4K7J A;  4MX3 A;  2VQU A;  3C7H A;  2RMU 2;  1JHN A;  4UFK A;  5FZ7 A;  5CFD C;  1R1Z A;  3CZU A;  4XET A;  4UT5 A;  4KL1 A;  3OPZ A;  4JGY B;  1TEI A;  1US2 A;  1RIR A;  2BWA A;  2X5I A;  4LA2 A;  5A7W A;  2BGP A;  4CDU A;  4K8F A;  1CAV A;  2B4K A;  5F9T A;  1RTV A;  1DLL A;  2FQP A;  1J1L A;  5JXI A;  2BW8 A;  5FY1 A;  5ACA 1;  2QVS B;  5CNA A;  3WNM A;  3DPR C;  3I3E A;  2E26 A;  3O1S A;  1O4T A;  1CX1 A;  2VL4 A;  3B94 A;  2R04 2;  1C8N A;  3QAC A;  4AYU A;  1C5H A;  1HQW A;  2CGN A;  3LD8 A;  1MS9 A;  4WM7 C;  2W3J A;  3CJX A;  3LE0 A;  2DFC A;  1LR5 A;  1CX4 A;  2D43 A;  4QGN A;  4E2Q A;  1Q8V A;  1MQT B;  2OS2 A;  3ES1 A;  2Q8C A;  5KC6 A;  2ZCW A;  2P5B A;  2RDR A;  2Q30 A;  4DS0 A;  4DRV A;  3H3U A;  5FPU A;  2PQQ A;  4QQL A;  3UJQ A;  3ZFE B;  4LEJ A;  3OPW A;  3G7D A;  2HWE 2;  4M3C E;  2IFW A;  1W0P A;  3ACG A;  3R05 A;  2GNT A;  4OHZ A;  3VZN A;  4YYO A;  5IW0 A;  1H4H A;  1NLQ A;  3NST A;  3IT8 A;  5EIY B;  1Q8S A;  2WKK A;  3I59 A;  4M3C B;  4UXA A;  5JSR A;  1J3P A;  4BQW A;  1RUF 1;  1S4C A;  5C3O A;  3HD8 B;  1POV 3;  4AGV A;  1GP6 A;  3J7N A;  3KF5 A;  4COU A;  1A34 A;  2JIC A;  3WR0 A;  2IWG B;  4XFC A;  2ZEZ A;  4BMB A;  3H7J A;  4JX0 A;  3U0Z A;  2IFR A;  4COW A;  3JB4 C;  2JD4 A;  3X29 B;  3BN6 A;  1EV1 1;  1ZRD A;  1W3V A;  4B4P A;  1U5I A;  1FV2 A;  1S2E A;  1TME 3;  2ZA9 A;  1SPP A;  2P3I A;  3WP6 A;  4ATE A;  5T3N A;  4XMI A;  4CDU B;  2X5I B;  3HEI A;  4GD4 A;  3RZZ A;  2NQY A;  5KXE A;  5IVJ A;  1GOH A;  1TME 2;  3HR9 A;  1F5F A;  3VZO A;  4D0Q A;  2BEO A;  1NA1 A;  3LEI A;  4RGG A;  4XUO A;  4FVV A;  1UU4 A;  2DV9 A;  2Y38 A;  4HVO A;  3OYW A;  3VBF B;  3WDY A;  4GA9 A;  2FBE A;  2YGM A;  5JZG C;  1AZD A;  5CEH A;  3KV5 A;  1KGY A;  1UKG A;  2VZ1 A;  5F2S A;  2Q8E A;  4KGQ A;  1Q43 A;  2ZGN A;  2B9V A;  4QPG C;  3ZYH A;  3TN9 1;  2P4E A;  3D8C A;  2K2S A;  3N7J A;  1RUH 1;  1VRB A;  2IXH A;  5JOZ A;  3ZXF A;  4C0B A;  4KQ7 A;  3E6D A;  1TNR A;  5K0U C;  1KS5 A;  2GN7 A;  1DDL A;  2WN3 A;  3KD4 A;  4FPF A;  5JR2 A;  3BTY A;  3V0A A;  1D4M 1;  3RSJ A;  3EQE A;  1JH5 A;  1QWR A;  4EWE A;  4JTO A;  3KV4 A;  4QDQ A;  4YFW A;  2DWR A;  3V65 A;  2ZX4 A;  4LT5 A;  4LUM A;  3KB5 A;  3P5B A;  3NJV A;  3M1H A;  1A8D A;  2N7G A;  4XCA A;  3VBO C;  1XOY A;  2BVB A;  3UGG A;  3C7F A;  3VD5 A;  4NIH A;  5FMD A;  1W2T A;  2BU9 A;  4ONU A;  2E6V A;  2E7A A;  5LBE A;  2VZR A;  3WF4 A;  1W2A X;  4FOW A;  4LMF A;  4MGY E;  2DUR A;  3OUI A;  3ZM8 A;  3IMN A;  4JKL A;  3QBQ A;  1XYP A;  1ZM1 A;  1W8N A;  5FBZ A;  1GZ9 A;  1SPP B;  1GWK A;  3GF6 A;  5CB7 A;  2JDA A;  1UMI A;  1HJG A;  1L3J A;  2VQA A;  2C4X A;  1XNT A;  1FI2 A;  4M3C F;  1ULP A;  3WDV A;  3WG4 A;  2AZ5 A;  1FNZ A;  1AXZ A;  3H1M A;  5FPL A;  3TEX A;  1NA1 B;  2D44 A;  2YB7 A;  3AJZ A;  4HPK A;  4Z92 B;  3S30 A;  3MUY 1;  3OG2 A;  3OYW B;  4O9E A;  2ES3 A;  4P00 B;  2ADE A;  2ZGP A;  5BXX A;  3FHA A;  3INA A;  4R4X A;  2O14 A;  3IPV A;  2YC0 A;  4GKY A;  4XPV A;  1EP0 A;  1GNY A;  2GMP A;  3ZN5 A;  4QX0 A;  4P08 A;  2YV8 A;  2VUA A;  5CYY A;  4KU7 A;  1LHO A;  4FP2 A;  4LE4 A;  2XJP A;  1XJA A;  2ZMN A;  3KQ4 B;  1N1Y A;  4M4R A;  2JDY A;  1FT9 A;  4FOV A;  4GH4 C;  5BNO C;  4LKE A;  5FYI A;  1G9B A;  4OQ8 A;  3DEM A;  3RZM A;  2QQU A;  1LHW A;  1OQD A;  1WCQ A;  3OUH A;  3WQ7 A;  5A6X A;  3NJZ A;  1F4A A;  4RS5 A;  2J1U A;  2JDN A;  1ODN A;  3MPB A;  3ZMO A;  4E27 A;  3L9J T;  3MF6 A;  1LGB A;  1OBN A;  2ZEW A;  5A80 A;  4DOU A;  5FYB A;  2PHD A;  5D8A C;  1IG0 A;  2LAL A;  1CVN A;  3H50 A;  5FCC A;  4EE2 A;  3VUO A;  1OLM A;  3PL0 A;  1N47 A;  3PIG A;  1GLH A;  4DB5 A;  2JE7 A;  1GFF 2;  1E5R A;  1W8U A;  3B9C A;  2GC0 A;  3WDU A;  1O3Q A;  3SXW A;  1JOJ A;  4CPB D;  5FZM A;  1HRI 3;  4S2H A;  1CES A;  1I5Z A;  4D3W A;  5LAS A;  2JX9 A;  2WT0 A;  1BXH A;  1AX0 A;  3MFA A;  4UF0 A;  1UPS A;  2FCV A;  1HRI 2;  3PDQ A;  1DQ6 A;  4IV3 A;  1GZW B;  3NV2 A;  4CXY A;  4CP0 A;  1UZV A;  5LRR A;  1AR8 3;  5LWB A;  4YVS C;  3QLQ A;  1CPM A;  2V09 A;  1WD4 A;  1W90 A;  4HLT A;  4ES8 A;  5CA6 A;  1AR8 2;  1ZRR A;  4PIX A;  4XF0 A;  1VAM A;  2ZML A;  4HPK B;  2VNV A;  5FIX A;  4UYB A;  3BI3 A;  1RUE 1;  4YG0 A;  1LUL A;  2P1B A;  1L7L A;  3A23 A;  3MW3 A;  3MBW A;  4SBV A;  3IPV B;  4L9B A;  2VMD A;  3PTR B;  3K75 B;  3ZFG B;  4YZ2 A;  1X8E A;  2E32 A;  4YW1 A;  5FP7 A;  4BZ4 A;  1J1T A;  2IXC A;  4XCB A;  4XVH A;  4LBQ D;  5EJ3 A;  3WNX A;  2EAK A;  3H1Y A;  4N53 C;  4L8Q A;  1S2B A;  4AG4 A;  5J1X A;  2A1X A;  1SCS A;  4DPN A;  4TSV A;  2R07 1;  1CAW A;  5CFC C;  5FMB A;  2PAM A;  5F5A A;  2ZZQ A;  1LNS A;  4I0A A;  4OUL A;  1PGL 2;  1HDK A;  5LEJ A;  2ET7 A;  5FY7 A;  4CUC A;  4RS5 B;  5FMC A;  4EN0 A;  1W8O A;  1C1F A;  3OBZ A;  1EAH 1;  4RHV 1;  3VBR C;  1JOD A;  1E5I A;  3AX4 A;  3GHM A;  4TXW A;  3OJB A;  4Q1R A;  3ZFF C;  4BPZ A;  1DIW A;  2DCZ A;  5GKA C;  5FZA A;  4N7U A;  1QJX 3;  2BDR A;  3JB8 A;  2P3J A;  1GOG A;  2XB6 C;  2PHU A;  5BUV A;  3AYA A;  2ZAA A;  1WMX A;  2CTV A;  1QJX 2;  1DP0 A;  2Y6H A;  3P6B A;  1DYO A;  1XPW A;  2J42 A;  4LO8 A;  2IVJ A;  1G9C A;  1B35 C;  5FYY A;  3R6S A;  2DVG A;  2E33 A;  1ZBE 3;  1DZT A;  4UF0 B;  3CJI A;  1QJE A;  4LJH A;  1VBE 1;  2WRA A;  1ZBE 2;  3Q9O A;  4IV3 B;  5APA A;  4ZXK A;  5LA0 A;  5DAX A;  5CBL A;  1YHF A;  1RUJ 3;  2PHW A;  2DU1 A;  2WO2 A;  4XQ4 A;  3HT2 A;  3RWN A;  1WA4 A;  2R04 1;  1IPS A;  2W87 A;  4OZX A;  3VBU A;  3DYM A;  3J7H A;  4AVA A;  3E97 A;  2BZD A;  2XJV A;  4AFM A;  5HV0 A;  4KH9 A;  2WDB A;  4IGO A;  3POB A;  4A7Z A;  2HWB 2;  1SLC A;  2JG8 C;  3KT4 A;  5C9A C;  1W0O A;  1RB8 G;  4MG2 A;  3VV1 A;  3T4V A;  2WN2 A;  4JGZ A;  2RR1 3;  2QZ3 A;  5FPZ A;  4P5Y A;  3USU B;  3WD5 A;  1UU6 A;  3A0N A;  4AVB A;  1CAW B;  4IEU A;  5LA9 A;  2WBK A;  4Y5T A;  2RR1 2;  2LRP A;  1OI6 A;  4Q4W 3;  5T52 A;  3WP5 A;  2WNU C;  2EF6 A;  5I0U A;  1OF4 A;  3LPF A;  4Z2A A;  3LPG A;  2SBA A;  3RNS A;  5IK5 A;  3Q8B A;  1UNB A;  3RFR A;  4XEZ A;  1DGR N;  4H3W A;  4Q4W 2;  4RL7 A;  3ZLI A;  4AK3 A;  4WM8 A;  3O1R A;  3R4S A;  5F37 A;  3LA2 A;  3APB A;  4YM3 A;  1IS3 A;  2O8Q A;  4DY3 A;  3KVB A;  2WZR 1;  3NV1 A;  4PIY A;  4TN7 A;  5C6C A;  3T1M A;  5CIS A;  4WVV A;  4MGZ E;  3TEY A;  3KGZ A;  4MET A;  2XHK A;  4CYD A;  1JYN A;  4LNV A;  2FHR A;  1OF3 A;  4AGG A;  2DBI A;  2XGX A;  5FZO A;  1V00 A;  3LCP A;  4Q0S A;  1ZRE A;  1IGO A;  2XJQ A;  1SLI A;  5BNN A;  4KG0 A;  3NNM A;  5F39 A;  3E5X A;  5FFO C;  3WSO A;  3H8R A;  3CJI B;  4QKF A;  3D6E A;  2BBV A;  2C9A A;  1S0B A;  1LHU A;  1CQ9 A;  5GM0 A;  3T0A A;  4XFA A;  3AZW A;  4CE8 A;  2VC9 A;  1BHG A;  2ZS6 B;  3HNY M;  4LA3 A;  2IC1 A;  3VBU B;  4MVT A;  1U12 A;  1YQC A;  5HXV A;  4PI2 A;  2PLV 3;  3WCR A;  5FPX A;  1HB3 A;  3IM0 A;  2EVX A;  1HX6 A;  3CZJ A;  4X8N A;  4XFG A;  5LY2 A;  4AZZ A;  4EN9 B;  4QPY A;  4LBK A;  3LSD A;  2HEY F;  2IZW A;  4J1X A;  5FZ4 A;  1BVV A;  3CQO A;  5JXG A;  2QCS B;  2J1S A;  4PDW A;  4LBQ B;  4AFB A;  4JGZ B;  2VW2 A;  1XQN A;  3AB0 A;  4WV8 A;  3POY A;  5LEK A;  4B1M A;  4BIF A;  2WFF 1;  2ATF A;  5IWF A;  2CNA A;  2VR4 A;  4FXK B;  4AQ2 A;  1NAE A;  1BEV 3;  4OI0 A;  5FXV A;  3VLB B;  4AVS A;  4FTE A;  3NNL A;  2QQO A;  1BEV 2;  4MAD A;  2F17 A;  2VZQ A;  2ZAB A;  2FMD A;  4WM8 B;  4B8E A;  2Q1F A;  4XIK A;  3ZR5 A;  2DVF A;  5A6Q A;  5JMC A;  4DNY A;  2HBT A;  3MIF A;  2Y6J A;  3E5U A;  3LSE A;  5H9S A;  4LUK A;  2RS1 3;  3KHB A;  5FO9 B;  1M06 G;  4JGY C;  4AQS A;  2IVI B;  4C1W A;  4PBP A;  3IDC B;  1JOB A;  4QX8 A;  4IEV A;  5L19 A;  2RS1 2;  4UBH A;  2DUQ A;  2ZKN A;  4WBB A;  2XPJ A;  5FXW A;  1XBF A;  2AUY A;  2VOX A;  3ZSK A;  1QDC A;  4AXO A;  4B1L A;  5BNN B;  3WQ1 A;  4O7X A;  3UET A;  5FTT C;  4KWK A;  1VRH 1;  5FUN A;  5DAQ A;  1W8W A;  3SHR A;  2MEV 2;  4F8A A;  2HWD 3;  4NHX A;  4MGK E;  5KC5 A;  2PAE A;  3IDB B;  1A8M A;  4YWA A;  1MQT C;  3BCW A;  3GDB A;  3R4U A;  1AYM 3;  4AL9 A;  4CDQ A;  4KG8 A;  1UY1 A;  5KHI A;  1BVP 1;  4XDQ A;  4A44 A;  2VVD A;  3F95 A;  3DKQ A;  1H8T A;  4AI8 A;  1GV9 A;  2JDZ A;  5E6H A;  5IAX A;  1XSR A;  3SCF A;  2VJX A;  2XUM A;  2YPJ A;  4PDW B;  2XBO 3;  4IEX A;  4YNI A;  3FLR A;  1HV0 A;  4YVW A;  3WHU A;  1VBC 2;  3M70 A;  3O1M A;  2OYZ A;  4JTN A;  4CP9 A;  3NL1 A;  2E7Q A;  2HYK A;  1SLB A;  3E1F 1;  3MEP A;  3U07 A;  1VLN A;  1RYY A;  2RHP A;  3J9S A;  3LIG A;  4DZG A;  4RGA A;  3OEB A;  3MID A;  4PI0 A;  3B9I A;  3WV6 A;  4AQ6 A;  3BB6 A;  5EP9 A;  3IB3 A;  3OBR A;  5T5J A;  3ZMN A;  4QX5 A;  5TSW A;  1UKR A;  2D98 A;  3GNE A;  5ACA 3;  2UWA A;  4LKF A;  5L9R A;  3V0B B;  2J1R A;  3THD A;  4F7Z A;  4UFL A;  4M0H A;  3PMS A;  2Q8O A;  4CDU C;  2X5I C;  5ACA 2;  2ARE A;  1Q8P A;  4ARX A;  1G7Y A;  5A3L A;  4OHV A;  3LOB A;  3VKM A;  4CEY A;  1UZW A;  4ZS3 A;  3VBF C;  2FDI A;  3NJX A;  1WLT A;  2QQK A;  2YGL A;  3NMB A;  1LRH A;  4Y22 B;  3ZXA C;  2QQJ A;  1TZO A;  3VN4 A;  1SFP A;  4Y5Z 0;  4AEM A;  2GAL A;  2VZP A;  5JWP A;  5FYV A;  1IS4 A;  3HQR A;  5C8W A;  3BOP A;  4DXZ A;  4MGS A;  2ZX0 A;  5IVC A;  1Z7S 1;  5DMY A;  2UY8 A;  5FKC A;  2YU2 A;  1XE7 A;  4MUV A;  4LIV A;  2E7T A;  1MS8 A;  3RQ0 A;  3SEP A;  2YFU A;  4CDQ B;  3OGS A;  2D6N A;  1DGL A;  3LZZ A;  4Y20 B;  5C5U A;  2XJS A;  2IXK A;  5KHJ A;  1UXZ A;  2D3S A;  2YY1 A;  2BGC A;  1TMF 1;  3K3N A;  1OFS A;  4HVR A;  3ME2 A;  5FOJ B;  1RUF 3;  2W1W A;  2OPK A;  2ZEX A;  4MHU A;  3ACH A;  3N7M A;  4KWU A;  1LOA A;  1UAI A;  1UY4 A;  2V5D A;  4NJ4 A;  3WW4 A;  1PGL 1;  3ZYR A;  3LDB A;  3NKT A;  1RUF 2;  1V9U 1;  2DVB A;  1JS9 A;  3IBM A;  5F2W A;  2VOK A;  3AZV A;  5FYU A;  5DG1 A;  4CP9 B;  3AP7 A;  3BU7 A;  3LGR A;  3HQU A;  3CDZ B;  1EV1 3;  2DFB A;  3FL7 A;  1ZA4 A;  5A33 A;  1O8S A;  4N7I A;  3H8X A;  3I7D A;  3M3O A;  1QXJ A;  5FZG A;  1EV1 2;  2WNE A;  1XYO A;  4AAP A;  3M3Q A;  3BU0 A;  1OVS A;  3Q8A A;  3S7I A;  3RZG A;  2DYC A;  4FCA A;  5GZF A;  3A22 A;  5GZD A;  3RG0 A;  2R7E B;  5GLZ A;  5JVV A;  1L7R A;  3JXS A;  5A1A A;  4PF1 A;  5C4W A;  2ZX2 A;  1YWK A;  3N7L A;  1QNY A;  2ID4 A;  3H9A A;  1NA1 C;  2JDK A;  4ASK A;  3HQX A;  4CEY B;  2I2S A;  4JQT A;  2QFE A;  3VKL A;  2ADD A;  4FPO B;  3TN9 3;  3ON7 A;  2A6X A;  1Q5O A;  5JMO A;  3BPS A;  4TLF A;  4HMZ A;  3TN9 2;  1JYC A;  3PHM A;  3N9L A;  1RUH 2;  4LHL A;  4O65 A;  4COZ A;  5I91 A;  3O1V A;  2A7A A;  1O91 A;  2HWB 1;  3MIE A;  3MF9 A;  4M00 A;  1OUR A;  1D4M 3;  2CSG A;  5IUQ A;  1JYX A;  1Z0H A;  1POQ A;  1W8Z A;  2G1M A;  2XLG A;  3SQO A;  3H1W A;  1K5J A;  5I0T A;  2P17 A;  1GSL A;  2A3X A;  2ZZJ A;  2VU9 A;  1GIC A;  2BGO A;  3O7O A;  3W5M A;  3GZU C;  4F83 A;  3JD7 3;  3LA3 A;  5FRE A;  2Q4S A;  3GCX A;  4QB1 A;  4CEW C;  2NMN A;  3VZL A;  2JEN A;  3LDK A;  2UY9 A;  1W99 A;  3EMR A;  1KJR A;  4LLO A;  4Q0V A;  3PUH A;  5A33 B;  5IYY A;  1OH4 A;  1KFU L;  4LPL A;  1WLW A;  4LBM A;  3OCP A;  2JDH A;  4P5H A;  1MR5 A;  1SEF A;  3FJS A;  4BJ0 A;  1XE8 A;  4GMP 0;  4UW6 A;  3IDA A;  2XOM A;  3OY8 A;  2VTX A;  3EO6 A;  3OGG A;  1SBD A;  3AKP A;  3PVE A;  5ERL A;  1MS3 A;  4DUV A;  2E51 A;  4JDO A;  5HXM A;  3VDB A;  4JZR A;  5FY4 A;  1J59 A;  2JE9 A;  3LA7 A;  4Q4V 1;  5EJZ B;  4ATF A;  3ST7 A;  5C4W B;  3OEA A;  1Q8Q A;  3TAY A;  2PN5 A;  2ZGQ A;  4XZU G;  4GQ7 A;  1GAN A;  5CVR A;  1W05 A;  3H3Z A;  1AR9 1;  5LK5 A;  2HEV F;  2YHJ A;  3EBR A;  4IES A;  3SKJ E;  5A6Z A;  1VMF A;  5I0S A;  2WNV A;  1YJK A;  4FI9 A;  4BME A;  4LTA A;  5B2G B;  3S57 A;  1YIP A;  3O0W A;  3O0V A;  4LIT A;  1STM A;  3ALQ A;  2EIE A;  3ZFG C;  4Y1Y A;  4GXL A;  1AX1 A;  1OXC A;  3K4A A;  4JKM A;  1W3X A;  3IDE A;  5FZ3 A;  4COV A;  4IXL A;  2TEP A;  4CA9 A;  4W6W A;  4W65 A;  1V0A A;  3ZYI B;  1GQH A;  2RS3 1;  3LB9 A;  4OCT A;  1NKG A;  4QAW A;  4KBZ A;  3VDD A;  3AZZ A;  4RS5 C;  4L97 A;  4M4P A;  4BK5 A;  3ZSM A;  1ENS A;  1JOP A;  4XBN A;  1IOA A;  2SLI A;  4GKX A;  1RC6 A;  1Y43 B;  5EQU A;  4BE3 A;  2CU5 A;  4WVW A;  5FY8 A;  4XHB A;  2BVV A;  5JAX A;  3UK9 A;  1SDD B;  3V64 A;  1XSQ A;  5GLT A;  4RQP A;  4XUQ A;  4ZON A;  2ENR A;  3WNL A;  2EAA A;  4CP2 A;  3PUS A;  2J1E A;  2VUL A;  1AR7 2;  1D4V B;  1UXX X;  2VME A;  3DL3 A;  2XG3 A;  3EHK A;  3QH7 A;  4A4A A;  1WCK A;  3MIB A;  4XDO A;  1QEX A;  3FWE A;  5EHD A;  4PCR A;  3F2Z A;  3FN9 A;  2H6C A;  1O5U A;  4IV3 C;  3FUO A;  1W8T A;  1Y9G A;  4D6S A;  1RUE 3;  2CV6 A;  2IXL A;  3I2I A;  4MLO A;  4S2F A;  4U2A A;  2YBP A;  1RUE 2;  4MZU A;  3B5L B;  4RN5 A;  1V70 A;  4IEZ A;  1JZ4 A;  5DUX A;  3NQH A;  4HKO A;  1UZZ A;  1S0D A;  4FFI A;  5FQ0 B;  4ARY A;  2IUW A;  1SFY A;  5DQ0 A;  2R07 3;  3FBY A;  2Q1Z B;  4HK9 A;  3T2O A;  4FBF A;  1O6U A;  4COY A;  2ARB A;  2R07 2;  1VAV A;  4IEY A;  4QX7 A;  3AKS A;  4RHV 3;  1EAH 3;  5FY5 A;  4V2V A;  1GWM A;  4MSV A;  3AXD A;  4J25 A;  1U5X A;  4AQT A;  4XQW A;  2K9Z A;  5FWE A;  2B39 A;  2DUO A;  1YI7 A;  2J7M A;  4RHV 2;  1EAH 2;  5DAV A;  3Q8E A;  3WDX A;  1F8V A;  1G6N A;  2EIC A;  1VBC 1;  2XUE A;  1TNF A;  4TTG A;  5F1R A;  3TNP B;  4NR1 A;  4D69 A;  5T54 A;  4HN0 A;  1GUI A;  4Z82 A;  3HIF A;  1MZF A;  2WQ4 A;  4QMA A;  4BQ3 A;  1W28 A;  3ILN A;  1HQN A;  3HNM A;  4QQ2 A;  5FKB A;  1XYN A;  1CIW A;  1NE6 A;  1IZ3 A;  4Q1P A;  3WY6 A;  1ZRC A;  2VNR A;  3T0B A;  4X6Q B;  5F5I A;  1VBE 3;  2VCA A;  4Y4R A;  1LHN A;  1PVX A;  3RMY A;  3AL5 A;  5F5C A;  5KXD A;  4YW6 A;  4FTS A;  3OB8 A;  2BYV E;  1VBE 2;  2V73 A;  4IGP A;  2R04 3;  2AEY A;  3RYR A;  3T30 A;  4CXX A;  5C33 A;  2DUP A;  3CJI C;  3VDA A;  2HEW F;  4GMP 1;  4NPL A;  1V6N A;  2V4V A;  5FZE A;  4FFH A;  3HJR A;  3VBU C;  1NYW A;  1AX2 A;  1G86 A;  3ECQ A;  3R4D B;  4BWO A;  4I02 A;  1IKQ A;  2KXL A;  1PGW 2;  5DN2 A;  2HWE 3;  4BK4 A;  2VD7 A;  4XBQ A;  2O8O A;  5JUV A;  4XBL A;  2D40 A;  3MFC A;  2BRT A;  1UOB A;  1WW4 A;  2WYF A;  4FQ4 A;  1GYK A;  1WW5 A;  4PJY A;  5FMO S;  4GUL A;  1K12 A;  1VB4 A;  1ULE A;  5FP3 A;  1ZZ7 A;  4JGZ C;  3LOI A;  2ZGK A;  2ARA A;  1RIT A;  2KM2 A;  3PJY A;  4JQR A;  1PM7 A;  2BNM A;  2WZR 3;  1CZS A;  1XC6 A;  4IEP A;  1C3H A;  2D93 A;  5LZ6 A;  2XLA A;  2G9Z A;  5A7P A;  4CCM A;  2WZR 2;  2C26 A;  3NNG A;  1F5J A;  2XJR A;  4DXS A;  1JTZ X;  4UAP A;  4WM8 C;  2WC2 A;  3ZXL A;  2WT1 A;  2NM1 A;  4NRM A;  5K8S A;  3DEC A;  1PNG A;  1LU1 A;  1XU2 A;  2O0O A;  1RHI 2;  4HT1 T;  3UKN A;  2VMH A;  2R1D A;  3DUI A;  2FDJ A;  4ZPI A;  1AHS A;  4DIN B;  1VBB 1;  1CAX A;  4ZU4 A;  5A7W B;  4B3N A;  1W04 A;  1RUN A;  1CAV B;  4PLM A;  2PYT A;  2Q0A A;  5J96 B;  4BQ1 A;  1ZZ6 A;  5L36 A;  3KHC A;  1VMH A;  2W94 A;  5FYS A;  5LBC A;  1ULF A;  5BNN C;  1HN0 A;  4UBG A;  5E16 A;  1DQ1 A;  2D3R A;  1YFU A;  5EXO A;  2WJS A;  3WW2 A;  3C8X A;  4JC1 A;  4N43 A;  4DQA A;  4Z1V A;  3EYP A;  5HBA A;  1S0E A;  2JG9 A;  3RYP A;  4SLI A;  1ULC A;  1QIQ A;  1LOG A;  4Y26 A;  1Y9M A;  4MHR A;  3H8O A;  4B4Q A;  2NP0 A;  4AEK A;  2VBB A;  4URA A;  1IHM A;  5FK7 A;  3PNA A;  4WZF A;  5LCW L;  1X7N A;  3N36 A;  2WFF 3;  4A42 A;  4I0W B;  1I1E A;  4K9S A;  1OPO A;  2VAU A;  3PVO A;  3I8T A;  5FK8 A;  2WFF 2;  4PDW C;  4AHW A;  4JV4 A;  3K4Z A;  5ISL A;  2Y0I A;  1HLC A;  5T5L A;  2G9G A;  3QOP A;  1YNA A;  3OD4 A;  3MPP G;  3I59 B;  4HVQ A;  4QGM A;  1LOB A;  4YW7 A;  2GAU A;  1QXP A;  1CR7 A;  2GME A;  4Q5O A;  5FZ8 A;  5KHG A;  4OLL A;  1DCS A;  4PHZ A;  4XFF A;  1WW6 A;  2J22 A;  2QBX A;  1YQ6 A;  3J7L A;  2GMM A;  3NKG A;  4I09 A;  2ET1 A;  2YPD A;  4XTP A;  5CKQ A;  2XQR A;  4FT8 A;  5H9Q A;  2JDP A;  5CAZ A;  1QQP 1;  1NT0 A;  3B01 A;  4BQ4 A;  5DAP A;  1XU1 A;  4BXF A;  3AJY A;  3FMG A;  3WW1 A;  5HI0 A;  1VRH 3;  1JU4 A;  4RFR B;  3VKF C;  2J1V A;  5L7O A;  1G9A A;  1CAX B;  3T09 A;  2VMG A;  3ZXK A;  3HPN A;  4NHY A;  3MLJ A;  3KCX A;  1V6L A;  1VRH 2;  4U36 A;  3BKZ A;  1SLA A;  1UU5 A;  3WG2 A;  2JEM A;  3SIT A;  2TNF A;  2CDO A;  4RYD A;  3M3I A;  5DZE A;  3ACL A;  1J83 A;  4XIO A;  1YQ5 A;  1UF2 C;  1WBL A;  3DKW A;  3MDP A;  4LK7 A;  4AHX A;  5C7G A;  5DXD A;  1ND3 A;  4LHK A;  5FLJ A;  2R30 A;  2DCY A;  1BMV 1;  4ZHN A;  2H6B A;  4MV2 A;  4CDQ C;  1W6Q A;  2UUR A;  2I45 A;  2HLE A;  3A4U A;  1NLR A;  3TNQ A;  2D6K A;  4OUS A;  2CAV A;  1O5L A;  1D2S A;  1GP5 A;  1UOG A;  4H2A A;  1JZ6 A;  3V0A B;  3B00 A;  4ISR A;  4KNC A;  1OOP A;  3LKJ A;  3GBF A;  5BYN A;  3B69 A;  2BOI A;  1YC6 1;  2ZPX A;  4G9S B;  1UYY A;  3UJO A;  1R1A 1;  2OQ7 A;  1WUV A;  1GQG A;  2A6Y A;  4BLI A;  1APN A;  2J1T A;  1UW8 A;  4D6Q A;  4NHL A;  1ALY A;  1Y9Q A;  2DCJ A;  2YU1 A;  5A3N A;  4IE0 A;  4EWA A;  3WP3 A;  1RGS A;  1AJO A;  1V6M A;  2WAA A;  5A3W A;  3LWC A;  2ZMK A;  4HN1 A;  1BBT 1;  4H7M A;  1N1T A;  5GLU A;  1AR7 1;  4AVT A;  4CU9 A;  4FAH A;  5JDB A;  1OA4 A;  3MV1 1;  3VZK A;  4LO5 B;  3ZYJ B;  3UGH A;  2WWU A;  3DV8 A;  3GAL A;  3KZ4 C;  4IE6 A;  4CSW A;  2AR6 A;  2CWM A;  1K45 A;  4FOY A;  4JCK A;  4BB3 A;  5L7O B;  2A6V A;  2WSU A;  4OYU A;  5F3C A;  4AWD A;  2WO1 A;  2WS9 1;  3MLL A;  5J48 A;  1BKZ A;  1XNK A;  3OSD A;  4CEY C;  1HIX A;  3CBN A;  2HYX A;  1ZA7 A;  2W68 A;  2XON A;  4XHX A;  4XQD A;  2F6B A;  3SEE A;  1O4Y A;  1ODM A;  3G6J B;  3SH4 A;  5B4N A;  4FFF A;  2A6W A;  2D6L X;  3DYO A;  3I2H A;  5KWR A;  1Z7S 2;  2GP3 A;  4DO0 A;  4YW3 A;  2C24 A;  1RL3 A;  3ETP A;  4K1Y A;  1TMF 3;  1PZ8 A;  4Q8L A;  4XZP A;  4BU2 A;  2DBN A;  1W6Q B;  1D2Q A;  1TMF 2;  5ABJ A;  1C57 A;  4ORF A;  4BH9 A;  5FPV A;  2WZE A;  5BPX A;  1V9U 3;  1NCQ A;  5GZC A;  2FDH A;  1HJF A;  3BVC A;  1QOS A;  2XLF A;  3MIC A;  3NW4 A;  5A3U A;  3WDT A;  3WNK A;  1ASJ 1;  2ORX A;  1JZ2 A;  1AUY A;  1LCL A;  1V9U 2;  4W6Y A;  5G04 L;  5H9P A;  4RR3 A;  1OLM E;  1OOP B;  1RJ8 A;  3FUQ A;  3E6C C;  3POF A;  4PF5 A;  2IXJ A; 
#chains in the Genus database with same CATH homology
 5CKN A;  3POI A;  4LOS A;  2QQM A;  4LOR A;  3POB A;  4GZ9 A;  2WNO A;  1SZB A;  5CKQ A;  2QQL A;  1NZI A;  4LMF A;  3KQ4 B;  1NT0 A;  5CKM A;  2QQK A;  1SPP A;  1SPP B;  3DEM A;  3POJ A;  1SFP A;  3POG A;  2QQO A;  4LOT A;  3POE A;  3POF A;  5CIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...