1SPPA

The crystal structures of two members of the spermadhesin family reveal the folding of the cub domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
109
structure length
109
Chain Sequence
LDYHACGGRLTDDYGTIFTYKGPKTECVWTLQVDPKYKLLVSIPTLNLTCGKEYVEVLEGAPGSKSLGKFCEGLSILNRGSSGMTVKYKRDSGHPASPYEIIFLRDSQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR SEMINAL PLASMA GLYCOPROTEIN PSP-I
publication title The crystal structures of two spermadhesins reveal the CUB domain fold.
pubmed doi rcsb
molecule tags Complex (seminal plasma protein/spp)
total genus 17
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 1997-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 1sppA00
3POJA 4LORA 1SZBA 1SPPB 5CISA 3POEA 4LOTA 4GZ9A 2QQOA 3POGA 2WNOA 3KQ4B 4LOSA 2QQLA 1NZIA 3POIA 1NT0A 3POBA 2QQMA 5CKNA 4LMFA 5CKMA 5CKQA 1SPPA 2QQKA 1SFPA 3POFA 3DEMA
chains in the Genus database with same CATH superfamily
2ZMNA 3KS7A 3QD6A 4YZ4A 1S55A 2HEYF 4OFGA 3VBFB 1MEC2 1HDKA 1UW8A 3NAPA 4HK8A 3URFA 4FTEA 3MPBA 5A80A 3IZOA 3R4DB 5C4WC 4IEOA 5FZGA 1CD3G 4CXYA 1XU2A 3U4XA 1PO23 5J7MA 2CAVA 4JDOA 4WV8A 2PYTA 1LHWA 1W39A 3HNBM 4AGRA 3I4IA 4DXRA 4FAGA 5CG9A 1ZRDA 4CPBD 5A7SA 3WHUA 1RUH3 2Y6LA 3QBQA 1NCRB 4CVUA 4TSVA 4CDXC 1UQXA 2O1QA 1PO22 2P17A 4ARYA 2JECA 3D0JA 5KHKA 1W8WA 5KC6A 4OHYA 1BQPA 4CP0A 1W8NA 4WM8C 3DL3A 4MLOA 4XUNA 3C7HA 1UKGA 2VD7A 3DKWA 4ISRA 4X8NA 3N4MA 1LHVA 1ODMA 3R6SA 3D3AA 3MPPG 3J8F2 4LBKA 3O1PA 4R9DA 4DRVA 3E5UA 4CDQA 5A1AA 5AFBA 3ZLIA 2WBKA 1AL0G 2D43A 2EALA 1VPHA 2ZEXA 5T55A 1O3QA 2IFWA 5A3TA 1MS3A 2JDNA 1NQJA 1G8WA 4GMP0 4XUOA 3ATGA 3S6PA 1MS8A 1VB2A 2HWD1 4Q2FA 3KT4A 3JBG1 3P3NA 5LATA 4AEKA 2A3YA 5JMCA 4U36A 4W6WA 1H6XA 1NA1B 1WCSA 3GHNA 2MEV3 1H30A 1MS1A 2ZZQA 3VUOA 2V5YA 2E32A 3IMMA 4EWEA 3A22A 2Q8OA 1JU3A 3TAYA 4BISA 2AUYA 4EZHA 4DXTA 4JGZC 1O4YA 2FZ2A 3MZHA 3VBSC 4LR4A 1A78A 1XYOA 2G9ZA 4BQYA 1S2KA 4AI9A 3AJYA 2XMLA 4XFHA 5FYIA 3H7JA 4RA0A 2C0ZA 3ZIXA 1GP5A 1WBFA 1XPWA 4GWJA 1N1VA 4P5HA 3I3BA 4TTGA 5DUVA 5CEHA 2XXZA 3JQXA 1UMIA 4Q5OA 5FQ0B 1JI6A 2P3YA 1RUI1 3E1F1 3JU9A 4KBBA 1R091 4MUVA 4XOGA 5EJ3A 5FPLA 3V56A 2GH2A 4MGQA 3WW3A 2WZ8A 2R0HA 4HKLA 1KFUL 5FY1A 3IKWA 2AC1A 3FFZA 4YM0A 3WDYA 3ZYJB 3QCWA 3GBWA 3PU3A 4IDZA 3WUCA 3RZKA 1JBCA 2VMHA 4H2AA 1R1A2 3O1TA 2V5DA 3ZFFA 3SC7X 3WD5A 3NSTA 2WLPA 4AI1A 3APBA 3ZVXA 2YBPA 3MHZA 3ZSEA 1SBEA 1O8SA 2HWE1 3N9MA 4COWA 5CKNA 2VMCA 1G9BA 1ULDA 2IZWA 1O3SA 2J42A 1O3RA 5T52A 1Z78A 1XBFA 3T3YA 3RSJA 4RR3A 3RZMA 1LOBA 1S0DA 3IWZA 1DU3D 4MH0E 1WGPA 3IDAA 2TUNA 3SLIA 1AYM2 1RC6A 1LB2A 3K51A 1VJ2A 2RM23 2IUWA 4QX2A 2C5DA 5BNPB 5F3GA 1J84A 5FZEA 5JCTA 4RGKA 3AKQA 3POEA 5D8AC 1S0GA 2H6BA 4PQQA 3FJSA 4Z92B 5IVFA 4AFBA 3C8XA 2Y6HA 2VW2A 2Y33A 2ADDA 2BFUL 3VBRA 1UZYA 5J96B 2ARAA 2OPWA 4XFFA 2OA2A 1MVEA 1LGCA 2BGOA 2BYVE 2QZ2A 4XC9A 2W87A 2JG8A 1QJX3 3SQOA 1W8UA 4MZUA 2WNUB 3WQ1A 3WF2A 1RJ8A 4CU6A 3JD73 5FP9A 3WX5A 2Q1MA 5ISLA 1XNKA 1NLRA 3BCWA 4Y1YA 3VKNA 3KMHA 1ND3C 2AYHA 2IXCA 4C8DA 4D7SA 1OI6A 1OOPB 5F1RA 2EIDA 4XBLA 1QJX2 4HPKB 4SLIA 4CSWA 4EV0A 3L2HA 3PVEA 4YW1A 4A44A 2VE1A 4LO5B 1N1TA 5FYUA 1NCRA 4JGYB 3W58A 1OLMA 4Q0VA 1MS0A 3KB5A 2XJQA 3GCXA 2CDOA 1U5IA 1SDWA 4QXHA 2KD7A 2SLIA 4H55A 5HBAA 5C33A 3POSA 1S1AA 3U75A 4A3ZA 1C8M1 2ID4A 5DAVA 1ND2C 4QPIA 3DPRA 2WS93 3WT3A 3M4FA 3CDZB 2CGPA 1HX6A 3ZFGB 3KF3A 1TQ5A 1W04A 1HV1A 1YQCA 3M3EA 3OF1A 1PNFA 3OGGA 3AB0A 2Q8EA 1YIFA 2D44A 1PK6B 4QGMA 3KV6A 2EA7A 4M4RA 4I3PA 4JDMA 1BLZA 2WS92 3FN9A 1VBD1 4L11A 5F3CA 4BMBA 4DUVA 1LOCA 1O5UA 1C8NA 1BEV2 2BDRA 3J26N 2WKKA 3N3HA 3CL1A 4CP9B 2GC2A 1IQDC 4NMIA 1AR73 3NL1A 4N53B 3FLPA 2ET7A 4YARA 1IS4A 1PHMA 1RVF3 5LBBA 1DGRN 1Y4WA 5FYVA 3S7EA 5IHRA 1A3KA 1Y7BA 4P9GA 1W8TA 4K21A 4HVRA 2VJXA 4YLZA 2JE7A 5JWPA 1OKOA 4AFAA 5FYYA 3OCPA 3TOJA 4DUXA 4KL1A 5BYNA 3IAPA 4AI3A 1SZBA 2W5FA 4IESA 3U0ZA 4CCEA 1EPZA 3KGLA 3ZFEC 5C5TA 2XQRA 1VMJA 4FPHA 2WFF1 3KCXA 4UBHA 4XW3A 3SEEA 1OSGA 2CGOA 4OZOA 5FQ0A 1R64A 1VAKA 1ENQA 1G9FA 2FHRA 2BUKA 2VXRA 4NPRA 2Y34A 3RZZA 2CYFA 5K4LA 5D21A 3WW4A 2UWAA 4XCAA 2VULA 3MUY1 2J1RA 4G9SB 5GZGA 3WNOA 1UNBA 4DEVA 4LA3A 1C1FA 2BFUS 5F5CA 2ZTNA 4BHPA 2Q30A 1Y3TA 4AQTA 2W39A 5CVRA 4NIDA 5ERLA 4XQWA 3T08A 4XAEA 2RDQA 5FBJA 1O3TA 1GP6A 2ADEA 5C5UA 4QB1A 4LLOA 1R1A1 2AEZA 4BQWA 5LY2A 5DZGA 1GWKA 5H9SA 5C9AC 4NWVA 1VRH1 2QQPA 1VAMA 2R061 2WYFA 5LA1A 4XCBA 5DG2A 1CX4A 4AI2A 2BW8A 4EE2A 3DN7A 2J1TA 4WVVA 4ZS3A 3P5BA 1H9WA 1W6MB 1N3PA 4LBMA 1XSQA 2DYCA 5A32B 5FWEA 2VECA 1ACCA 1SPPA 1WLTA 3VDAA 2TNFA 2VXJA 1MR5A 3AK0A 3RMYA 2JKXA 4NE9A 4DXZA 4YM3A 3AJZA 5FK7A 3BB6A 2Q8DA 2CDPA 1LECA 4CDUA 3ALQA 4QDRA 2A73B 3VHOA 4JRLA 2DVDA 1GFF2 4GB31 1GZ9A 2PXJA 4BXFA 2Q1ZB 2JDYA 3WG2A 1RTVA 2WFPA 1O4TA 4H7MA 4Q4Y2 3HPNA 3RZLA 2GMEA 2PQQA 4XJ9A 3MO4A 1OOPA 4UWDA 3JB8A 2O8QA 2DV9A 3ABZA 1RUE2 1XB9A 4H3WA 5CA6A 4YRDA 4UFHA 4HPKA 1QOTA 1ZNPA 3N35A 1GU3A 2P2KA 1URXA 1REEA 2A3XA 5HXVA 3T4VA 5KXCA 1QY4A 4AHYA 2D5HA 4JGYA 2HYXA 4DRRA 5C8CB 2WZR3 4AK3A 3MF9A 3O0XA 1AR62 1SQ4A 5J37A 1UY3A 4UW4A 1GNZA 4W4ZA 4JQRA 2G1MA 1RHI1 3USSA 2F4PA 1UIJA 4N43A 2WINB 1W3VA 3LA7A 5CB7A 3ME2A 1F4HA 2WZR2 1FPN3 2P6HA 2EXIA 1JXNA 4RS5B 4OHZA 3ZFGA 1BCXA 2ORXA 2AH2A 2Z69A 1SACA 1LENA 3AMHA 4KGGA 5FUNA 5A33A 4OI4A 4FPOB 2WT0A 2D3RA 2LS6A 2VPVA 1UAIA 1FOD2 1PK6A 1K42A 1FV2A 1POQA 3LA3A 3N9PA 5FZ9A 5JLVA 1LGNA 4BK4A 1BJQA 2JD9A 4XTPA 1E5HA 2BEOA 1ENXA 4RD7A 4XDQA 5BNQA 2FDHA 1FPN2 3IDEA 4YW5A 4Q1PA 2HEWF 2IC1A 2BQPA 1V9U3 1WMXA 3BGAA 4YM1A 4CP9A 3POGA 3KQ4B 4IQPA 4BCUA 1QH6A 1BEV1 4KWJA 5AVPA 2JB8A 1W90A 3D4KA 1KEXA 2R49A 4URAA 3KHCA 4X8PA 3A23A 1UOFA 1JZ2A 4NUBA 1GKBA 1H2MA 1O6UA 5FUIA 2ETEA 5IK8A 4KH9A 1JUHA 3ZIWA 1NOVA 2X5IA 4DINB 5FTTC 5EHDA 2WO7A 3ZFFC 2X09A 4MYEA 1YI9A 2EICA 3B7MA 3LWCA 3R4UA 4JV4A 4LHLA 3WOGA 5IAXA 1RUD1 1CONA 1WW7A 2JDHA 2PA7A 3O1VA 2RDNA 2EXJA 2I07B 3E5QA 3DYOA 4Z07A 1EY2A 4AE2A 5CAZA 1UU4A 2CAUA 4PBPA 2OXBA 2WDBA 3LAGA 4IEPA 1JW6A 1KS5A 5HCAA 2GH8A 2F17A 4AVSA 3KWVA 5ACA1 3GJAA 5FZMA 3ETQA 2XUEA 4RR3C 3E6DA 4GIQA 4XFAA 2A75A 2ZGSA 2DUOA 4E4DX 4CUCA 4XXAA 1ULEA 4IEZA 3SH3A 1SLLA 1X36A 4QAWA 3LGRA 1Q8VA 1ASJ3 1SEFA 5DABA 1OD5A 2J1EA 4NRMA 2WYSA 3DYMA 3EMRA 3WW2A 5FO8B 4AFCA 2GSYA 1HN0A 2P1BA 2RS52 2WUHA 2X8KA 2CGNA 4KG0A 4G3YC 4Q4X2 4QHOA 2VW0A 4PQ9A 1I5ZA 4FPEA 2PHUA 1DQ2A 3Q8AA 4Y4YA 3OY8B 1W8ZA 4HVOA 4V2WA 2NLRA 3FHQA 3UESA 1UX7A 3VBFC 1TMF3 3ZX7A 1D2SA 1W6MA 4O7XA 2VVEA 4HN0A 3ZXDA 4GH4B 5A32A 1MZEA 3FMGA 2C9AA 4INDA 4PHZA 1AYN3 2BNMA 3FUOA 1H1IA 1Q56A 4FPLA 4IL7A 4RGGA 2GP3A 5JPMB 1OVPA 3K77A 4XIKA 1TMF2 1Z0HA 4FPYA 1ENRA 2JICA 3AC0A 2WA4A 4QXCA 1SG3A 2A6XA 1KJLA 1QJU3 3NJZA 2G4IA 4WZCA 3T30A 1NCRC 2RS13 1UU5A 3VGIA 1CIYA 4EN9B 1HRV2 4JTOA 1VBE3 3RI9A 1GSLA 1NCQB 5JSPA 2OW4A 3BI3A 1PM7A 2PHDA 1AX0A 2W94A 2XPJA 4UI9L 1W05A 4K40A 4HBNA 4WZFA 3ILFA 1RMU1 1RUC1 5T5PA 4MG2A 3MW3A 4YZ3A 2VTFA 2RS12 3VZMA 2ZX3A 2DU1A 3THTA 5IFPA 1VBE2 2YMZA 1H8VA 2QKDA 2XWJB 5C6CA 1UOGA 3TNPB 3TYJA 2W92A 2WA3A 3PIGA 5LK5A 3S7IA 4ZPIA 1RUG3 3O1SA 1LHUA 3AMNA 3BTYA 3WNXA 4OUEA 1ZA4A 2FMDA 4PJYA 2K46A 3AL5A 3TNQA 3TEZA 3C7GA 4ZONA 4AHZA 2PTMA 4HN1A 1NG0A 1UL9A 3S5QA 1VBA2 4LBQD 5A6QA 1RUG2 2JDKA 2Q0AA 1QQP2 4FOYA 1NA1C 5I93A 2E7TA 3OEBA 4RS5A 3VBUB 2V73A 3T2TA 4EQVA 5L73A 4C1WA 2JWPA 3LA2A 4UFJA 3I8TA 4WVMA 2VCBA 1OPOA 2IXIA 4AFMA 1XYNA 4LUMA 1HRI2 5DAXA 2PELA 3MLKA 3FE5A 4MGSA 4DXSA 4YGEA 1PGW2 2E63A 5FZ0A 3FLTA 4D94A 5J09A 2Y64A 3VD7A 1XSRA 1PIV3 4OYUA 1COV2 1N3OA 1ZZCA 1ENSA 3ZN5A 3USUB 1KITA 2MNGA 1AR93 1SCRA 1BZWA 2OQ6A 3OPTA 4RHV3 5EQUA 2QJVA 5JR2A 1VR3A 2XVGA 3VHRA 3O7OA 1UOBA 1RUF3 1LAJA 2ES3A 3NW4A 2V09A 2XBO3 1PIV2 4S2HA 4DQAA 2NMNA 5FPUA 4FXGB 4GWMA 2VNOA 4E8CA 1AR92 5JIAA 2R041 3BOPA 3H9AA 3TEWA 3ON7A 2D6KA 3OPWA 3HNMA 3ORJA 3E6CC 3TN91 3H1YA 4OULA 1DYOA 2H0VA 2LTNA 3X29B 2XBO2 5M0TA 1HXS3 3FLRA 2JDPA 5I8YA 2EAAA 2P3IA 3KV9A 3B3QE 1WKYA 3DEMA 1J1LA 2GU9A 3BTXA 2YC4A 3WG4A 1UX6A 2NQYA 1LODA 4LA2A 3C7EA 3Q8FA 5A7OA 1EV13 3GXUA 3O1UA 5AC92 4Q1RA 3I54A 1HXS2 2BVBA 1KS4A 2UYBA 3OBAA 3M8LA 2QQLA 4Q27A 2Y6JA 1UF2C 5F5QA 4QU2A 3VV1A 5CYYA 5A3UA 5BNPC 1GV9A 5JDBA 2ZABA 1W0NA 5T5LA 3PU8A 3OD4A 5BNNB 4BB3A 3BPZA 2PAEA 3ZPYA 3OGRA 2G9GA 2QDRA 5ANQA 1LOGA 1S2BA 2ZACA 5DPNA 2PLV1 3UGHA 3N7LA 4B3NA 4CDQB 5KC5A 1DQ6A 2NMOA 5FYCA 4BXSV 2QQIA 3ZO0B 2RS51 1ZA7A 3OY8A 1LULA 1RXFA 1KXGA 4A2UA 3LPFA 5BV6A 2WNUC 1LJ7A 2RS31 4CXWA 1H6YA 4GH4A 1YFUA 1Z7S2 4FFHA 4GQ7A 3AP6A 2R6QA 2ORZA 1H1AA 4TYSA 1CR7A 2XLGA 4AVTA 5ABJA 1OOPC 1WMEA 2DVFA 4Q4V2 2B45X 2UYAA 5DDJ3 4QQ2A 4CTEA 1VRBA 5FP3A 3M2MA 5FO9B 4CEYB 1ZZ9A 1S0IA 2JX9A 3CHXA 2JEMA 3I3QA 5CFCA 4PF1A 1GZCA 4JGYC 4BIOA 1AVBA 2DVBA 1ULCA 2PHFA 4I2OA 1CAWB 2VZOA 4ARXA 2PHXA 2OUHA 5LRRA 1JTZX 3MBWA 5IUQA 3H3ZA 5FXXA 2XL7A 1NY71 5C71A 1QXPA 4M01A 1F15A 1W2NA 2JDUA 3ZFGC 3LIHA 4R9CA 1CZVA 4Y5TA 4Y26A 1H4HA 4GALA 3D6EA 3RJ2X 4C1XA 2WO1A 5FR3A 1GUIA 1PK6C 3AZWA 3OD0A 1TME2 1MQTB 3NV2A 4AEMA 5A3OA 1ONAA 1YNAA 2ZS6B 4LK6A 2VOXA 1QMJA 1GMMA 1ZVFA 1J58A 2RV9A 3MIGA 2DCZA 3M1HA 4ORFA 2DUQA 4YZ5A 4AYUA 1PO13 3CJXA 3SISA 4HKWA 3CNAA 1OQ1A 2XVKA 4MGIE 5BNOB 2CV6A 4N53C 3VBUA 2B39A 3RQ0A 3RZHA 3BIWE 5LZ6A 1LHOA 1GP4A 2K9ZA 2WAAA 1OMIA 4IEXA 4GD4A 1ZRIA 2FDFA 2OQ7A 3K4ZA 1F4AA 1PO12 4IE4A 4TWTA 2OZ6A 4MVTA 4AGVA 5JSRA 3F2ZA 2D98A 5FIXA 1RL3A 5FK8A 2XWBB 3Q8BA 4FCAA 2E51A 3WNKA 4QD2A 2BOJA 4MGYE 1EAH1 4PBOA 1GBGA 2ZX2A 5L7OB 3CBNA 4FQ4A 4QHZA 2VUDA 3LEMA 3GZTB 4IEUA 3PNAA 4NWWA 3ES4A 4AEJA 4FPGA 5JI7A 3USUA 4Y1ZA 1ZZ8A 3UL2A 3BU7A 1GWMA 3WR0A 1PX4A 3DXTA 4UW5A 4CUAA 4LKSA 1COV1 4QQLA 5I8SA 3LEGA 3POFA 3U11A 4LHNA 2X10A 3EYPA 1JYXA 1GWLA 3RYKA 2JG8B 3EJKA 5IK7A 3IIAA 2E26A 1E5RA 2BNNA 2P37A 4GZ9A 2DCKA 5JIUA 4NVPA 4HVQA 3WINE 1GNYA 3PIJA 5GALA 1RUNA 4NO4A 2I2SA 4EROA 1D2QA 5A3WA 1BYHA 2QTWB 2B7YA 2CY6A 5FBZA 2YG0A 4YW2A 3OUIA 4NIHA 2YPDA 4OUSA 5CKQA 2R1DA 1CIWA 2VQ0A 3DCQA 4BM8A 3UGFA 3VHPA 3W20A 1YJLA 2LRPA 2WLQA 3OEAA 2PAMA 3I2OA 3HT1A 5EWSA 4YGBA 1WW5A 2CWMA 3AKRA 2QQUA 4QPIB 4FTSA 1RUH2 3DPRB 5BNNA 4DNYA 3O14A 2WZPP 1C8M3 2ZMKA 5FZ1A 1RINA 3GBFA 2IXKA 4IE0A 5T5JA 3H8OA 5H9PA 2DTWA 2ZGKA 5FJKA 3RZJA 3CO2A 4XXPA 4QX5A 4RGAA 4LO8A 1IS6A 1LOFC 2A71A 4PDWA 2NM1A 1JYIA 2R071 5GJ6A 3CEWA 1UYYA 1HB3A 3CU7A 4BDVB 3I2JA 4CCJA 1JHNA 5LK7B 3J9SA 3PJYA 4HSJA 3M7AA 1UXXX 3NV3A 5EJ1B 4QPWA 2HH9A 3INAA 4LBQA 2RMU1 1YUDA 4CEYA 3W5MA 4BE3A 2JDMA 3TBDA 4GA9A 2D93A 3VDDB 3ZKYA 4L92A 3ZXJA 2CSGA 5C8CC 3JXSA 2VQAA 2MEV2 1CAWA 3POIA 2YU2A 5E6HA 1RGSA 1SFYA 1GZWA 1NX9A 2Z79A 2QQMA 3PMEA 1O91A 2ZGUA 4CCCA 4GJZA 1OURA 1X9TA 4NAMA 2E9QA 4PT6A 1FMD3 1ALYA 2CU5A 1W2OA 3I3EA 4B4QA 5IVBA 1MS5A 2WFF3 3B9IA 4RS5C 2E31A 2BTVC 3BODA 4AI8A 3MGUA 2JENA 2JKBA 1DGRA 3PLQA 4K7JA 5F5IA 1OLRA 1QU0A 1LCLA 2EAKA 4ZZ8A 2W2IA 2WIIB 3VKMA 1FMD2 2P3JA 1UZWA 4XQDA 1MQTA 1W06A 2BJSA 5K0UA 3RS6A 2K2SA 4OHXA 5GLWA 4IV1B 2W1SA 5LRSA 3CF6E 4A4AA 5CBLA 1H2NA 1TG7A 2DFCA 1W8FA 2HWF3 4S2FA 4B1MA 4GMP3 5EIYB 2VMDA 5FZDA 4QWNA 5I8TA 3ES1A 2NZ9A 1HQWA 3POYA 5GZDA 2YFZA 4YYOA 2JDAA 1QGLA 5BNOA 2P5BA 1JZ6A 1Q8OA 1YI7A 1PM4A 1EP0A 1D4M1 3WDTA 5DN2A 2OIIA 1UWWA 2HWF2 1X8EA 1VRH3 1NXD1 4HANA 3I2DA 5FZ7A 3PTRB 2R063 4XTMA 5FZ3A 2ZJCA 3GZEA 5JZGB 4K1ZA 3F95A 5FXVA 1QJZA 1GOGA 1WWYA 4HSLA 4EYUA 3N7KA 2B9VA 1RUJ3 2NYYA 2W9XA 5FYBA 3ZMOA 4A41A 4ATEA 1W9SA 1SPPB 4QX8A 5L7OA 3HMYA 5JSOA 2C4XA 2HWB3 1HN1A 1OH3A 1O7FA 1RJ7A 4MXWA 4ZKTB 5F7UA 4BU2A 3NVCA 3I2KA 4D69A 3THCA 1NZIA 4OMCA 1DLCA 4QGLA 4C0BA 1T6GC 4CZSA 1JZ4A 4CDUB 3BOWA 1XNBA 2J1VA 2RM22 3H8UA 3L2YA 1AL21 1POV1 5GZEA 2HWB2 1BK0A 2JDZA 2DURA 4EN0A 3RWNA 4L8QA 3TWIA 5BPXA 1VBB1 2OVUA 2WN2A 4FFGA 4GB33 2D6NA 2B42B 4P02B 1UY4A 3ASIA 5F6KA 4MGZE 3KGZA 4DB5A 4LHKA 3K4AA 4TZDA 2O8OA 1BK1A 2OT7A 2OKXA 4I0BA 1MEC1 1YC61 5FZ6A 3A7QA 3ZXKA 1MS4A 1U5XA 3GM8A 4CYDA 5DQ0A 1YQ5A 3DYPA 3I49A 4KU8A 5GKAC 1NQDA 2ZHKA 3JD72 4N7IA 1BMV2 1PZ8A 5KHIA 4AG4A 3MF6A 2ZAAA 3B9CA 4JRAA 2BV4A 3H50A 3NV4A 2VZSA 4GH4C 4AGGA 1MZ5A 1W2UA 5EZWA 3RVHA 1PO21 5A6YA 1K45A 2YHJA 2ZGPA 4N43B 3ZYHA 1G9DA 1RHI3 4ZXEA 3LFMA 1YRZA 5A33B 2WT1A 1LR5A 3ACGA 1X50A 5DAQA 1YXWA 2VMEA 3H0OA 3WCSA 1OT5A 4AEDB 5FZ8A 1JOJA 3J8F1 4UYBA 4EWAA 5DZFA 4WVZA 4BQ1A 1NCQC 4XF9A 4URTA 2VBDA 3WF4A 1X33A 4IE6A 4XF1A 3MV01 5F3IA 4CP1A 4C91A 1PZ7A 3V0AB 5HCHA 2Y6FA 4ZXKA 3BYWA 4A7YA 2A7AA 3IAQA 2AEYA 3D5OA 5F39A 3ZDSA 3RJRA 2XVLA 4QQPA 5L9VA 5A7WB 3QACA 3U78A 4EN6B 4XJAA 4NHMA 2VCAA 2HYKA 4JAAA 3M70A 3VDDA 5EPAA 1I3HA 2ZGOA 2ZHMA 3PVOA 2Y60A 4FOQA 3VD4A 4OHWA 5A7QA 3OJBA 4FO9A 4J6GA 1H8TB 1BKZA 2X5IB 4GXLA 4JCKA 1AR72 5IVVA 1TVGA 1RVF2 3NNGA 1JN2P 1ZZBA 3ZXLA 3E5XA 5DAWA 5FPAA 1QOSA 4FP3A 4PLOA 5IW0A 1M4WA 5G04L 3GYDA 1YFYA 4L99A 3UETA 1UY0A 3RZGA 2QBXA 5C7GA 3VBUC 3POBA 2GN3A 4XAAA 4O61A 1VP6A 4NHYA 3IM0A 5JI9A 3NRUA 3L9JT 4IEVA 5ACA3 4IV1A 3VLBB 2BGCA 3C7OA 3LSDA 5C3RA 4NIAA 1OQEA 5JAXA 4JTNA 4TLFA 4SBVA 1U0AA 3CLPA 1IG0A 5IT6A 1WLCA 4BWOA 1Q43A 2DFBA 5A3LA 2YBKA 2V4VA 4Y24A 4GKXA 5E88A 5LEJA 4JHZA 5FO7B 4ONUA 2RJKA 1IHMA 4D6QA 3Q9OA 2EXHA 1UU6A 2XJSA 1OF4A 1US3A 1LOAA 2ZAHA 4QKFA 3MFCA 3BN6A 4XZUG 3GCWA 1C5HA 4CCOA 5JOYA 1ZYBA 5CG8A 4L97A 4QKDA 5JZGA 3HWJA 1PVC3 3ZSMA 3KZ4C 4CPBA 3NAPC 2ZEWA 4MHRA 4MXVA 3WNLA 3POWA 3TRSB 1PGL2 3MIHA 1NLSA 4DMIA 4HG6B 5HXMA 1PGSA 4I02A 4UFKA 5JXJA 1AYM1 1DQ1A 1O5LA 4ES8A 4NAOA 1PVC2 1KQRA 3CZUA 1CZSA 3IN9A 5D1IA 3AX4A 5JXGA 4E9KA 2WT2A 4M3CF 1W0OA 1R083 4PIYA 3PVNA 3LPGA 4R4ZA 3WDXA 3WF1A 1B35B 1D0HA 4YVSB 1YWKA 5FYSA 4B29A 3U07A 1H2KA 4LUKA 4E27A 2OS2A 4YW3A 4DO0A 1NUKA 2WL1A 4Q29A 4H14A 1SFNA 1GQGA 2XLAA 4DY5A 5BNNC 1R082 1DGWA 3UKNA 2GN7A 1K5MB 3QH7A 1HLCA 4MV2A 4PF5A 1I1EA 5FPZA 3U4SA 4GAZA 4CDQC 1UY2A 5A3NA 4QB2A 4P9JA 1L7QA 1YFXA 5J48A 2XG3A 4XYXA 3OPZA 1QJX1 4ZHNA 1ZBA3 2A6YA 1JOBA 3MIFA 5FZCA 2XJVA 3RGBA 1UYXA 2Y38A 5IYYA 1O4ZA 4XEZA 1DYKA 1KGYA 4Q26A 2XL9A 1ZX5A 1AXKA 2CL2A 2N7GA 2VMFA 2R7EB 2E53A 3LEKA 4A7KA 2C1FA 1PX3A 3MDPA 3T09A 4PIZA 2P6CA 2P3KA 1JZ7A 4FOWA 4CEYC 4CU9A 2XQXA 4OI2A 4YWAA 4AAXA 5FY0A 4WVMB 3WDWA 2DBNA 4F83A 4AEDA 2BPA2 4Z8BA 5H9RA 1AR83 3GJBA 4BQ3A 5L36A 3IB3A 3ZM8A 3NJXA 1ZBE3 2UY9A 4XETA 1XRUA 1FX5A 2MHFA 2EVXA 3UK9A 3V0AA 2XDVA 4D3WA 4NHKA 1QNYA 1U12A 2WS91 3OYWB 4Y4RA 5GZCA 4OLLA 1G6NA 1GQPA 5FZ4A 4FPCA 4GWNA 3T4HB 4EN8B 1J59A 2LW8A 1AR82 3IMNA 3OGSA 5H9QA 5A7WA 3G7DA 4A3XA 2WNVB 4XVHA 4Q4W3 3LOIA 1ZBE2 3NNJA 3I59B 2D7FA 3K48A 1JU4A 1U5ZA 3FZ3A 1UYZA 1V9U2 3R0RA 3ZYFA 2DCJA 2B46X 4X6QB 1H8TA 4P14A 3EQEA 1OKQA 1OA4A 3VBHA 4Q4W2 5FAXA 2R043 3J7MA 2AENA 2CNAA 3LOBA 3PJQA 4P5YA 2B8MA 2ZX0A 3GNEA 4CEWB 3THPA 3TN93 5BNOC 4CCDA 5FV3A 3K75B 2YV8A 4LKEA 2YROA 1ULOA 1RUOA 4L9BA 3SH4A 4ZS2A 1WD4A 1WA4A 3VKFC 1WMFA 3LDBA 1W6NB 1YJKA 2WQ4A 2F6BA 5LCWL 1L7RA 3OGJA 3ZYBA 4OUMA 4DPNA 1G7YA 4XHXA 5L7OC 4AF9A 4YG0A 1BBT3 2YU1A 2VW1A 4BOWA 3DUIA 4MX3A 1YCIA 1LOEA 1LU1A 4LBOA 4Q8KA 4QX7A 1W9WA 1WCUA 3UV9A 3VBRC 1ASJ2 2PLV3 3Q8EA 5LBCA 2CHHA 2KM2A 3W5NA 2JG8C 1V6MA 1BBT2 4Y1UA 2Y0IA 5A7NA 3CJIB 4Y20B 2MPFA 3ZN6B 3RMXA 4XFIA 1VMHA 2RS33 4Z2WA 5C4WA 4COUA 2GDFA 5I91A 1W8OA 1SLAA 2W95A 5ABJB 3UNPA 1CAVB 1QJY3 2NN8A 1FXZA 2XJRA 1NE6A 4QX3A 4XMAA 1OA3A 4CP2A 3RRDA 1EUUA 5KR7A 1LTEA 1X82A 5I0RA 1Y9MA 2E6VA 5J3UA 3NKTA 3WQ0A 2YDEA 4LO7A 4XE9A 2YC2A 3RNSA 5CFCB 1LKNA 5L9RA 4FSJA 1IPJA 1AYN2 3ZSLA 3BKZA 3OUJA 3I97A 4Y33A 1B35A 2C26A 2HLEA 4KI5M 4LIVA 4YVSA 4FBFA 2D6OX 1REDA 5LBFA 5EP9A 3VHNA 4EJRA 1W2TA 1AXYA 4E4HA 1AUYA 4IE5A 3JQWA 3WQBA 4Q0QA 3O1RA 3PL0A 2ZEZA 1QJU2 2ZPXA 4K8FA 4QPIC 4RQPB 3DPRC 4AVCA 3FX3A 4Q4Y1 1K5MA 2WQZC 4J25A 1QXJA 4LE3A 5E89A 4AWDA 3WG3A 5CFDB 3VKOA 1XOYA 5KBFA 1SLIA 1RUE1 2QQKA 1QDOA 3DGTA 1OVSA 4GULA 4MSVA 3U37A 4UFMA 3PDQA 1O8PA 2UU8A 3M3QA 1OXCA 5FMDA 2QQVA 4QM8A 3FBYA 4BZ4A 3MICA 3OBZA 1TNFA 2A6ZA 4Y5SA 5D2AA 1DYPA 1AR61 3LZZA 3PUQA 4BJ0A 2BERA 1BHGA 5B4NA 1M06G 2FDGA 5FPXA 1F31A 1C5IA 1LEMA 2W0XA 4XBNA 5E1RA 3AFKA 4K3UA 4YGCA 3VDDC 1NT0A 2ZKLA 2VO5A 1PMIA 2WZR1 3V64A 4ASKA 1ULGA 2VZ1A 4BQ4A 5JOXA 5CKMA 2D40A 1VBC3 4M4PA 1FOD1 2EF6A 3EHKA 4A45A 5JOWA 4AR2A 3ZFEB 1S4CA 5EJZB 3OYWA 1UZZA 3PUIA 3IPVB 3GALA 1FPN1 2HWC3 4NHXA 2WNVA 5FLHA 1VBC2 3P1IA 3EB7A 1UIKA 2D6PA 3AFGA 4L2NA 4BK5A 3I59A 1W2AX 3ZR6A 2RR13 2V4AA 1GLHA 1XE8A 2FZ1A 2XH6A 5IWFA 4CA9A 5DXDA 5L9BA 5FZKA 5CU1A 1H2LA 5F8PA 3VL8A 2HWC2 5GLUA 4YVWB 1S0EA 2QVSB 4RHV2 3T2QA 4LO4B 2JD4A 3T2OA 2DUPA 4AOCA 1NLQA 2YXSA 1AJOA 1E5SA 4IERA 5T50A 1RUF2 1DBNA 4CXXA 3SHRA 5KHGA 2J1SA 4FQZA 4CEWA 1S2EA 3V0BA 4LE4A 3ZYRA 1WCDJ 2YBSA 3ACLA 4LXLA 4XUTA 2VTXJ 1OC1A 5HV4A 4XQ4A 4B8EA 2GZWA 2FQPA 4K20A 5F6LB 2W08A 2QNKA 1Q5OA 3ZDVA 1W6NA 5JZGC 4KMQA 2BOIA 2W68A 1CPNA 1ZZ7A 4G4FA 1W3XA 5A6ZA 4QQOA 3N9OA 4DZGA 1IOAA 2ZEYA 4B4RA 2A3WA 2KR2A 2VQUA 2GC0A 4MHUA 3SEPA 1KDKA 3O1OA 1V6KA 4XACA 4P9WA 1F5FA 2KXLA 1EV12 5D8AA 4LT5A 2A6WA 4R9AA 4AVBA 4IUGA 4HKOA 1A6CA 4CDUC 4UOJA 2XHNA 3O0VA 5APAA 1DF0A 2BWAA 3FUQA 5GZFA 5JVVA 5SV8A 2ZZJA 3UGGA 4P9XA 1EYBA 4CDWB 3ZYIB 2BNOA 4D8MA 4Q4X1 1PMJX 2YC0A 3CJIA 4Y20A 2X05A 3ZN6A 3VD9A 3FC0A 2QQWA 1LEDA 4PDWB 2ZHLA 4V2VA 2A70A 3H42B 3HJRA 4CU7A 5FRAA 2PN5A 2DCTA 2HWD3 1CAVA 3AMQA 3JBG3 2VZUA 4W8JA 3ZOIA 5B2GB 1HB1A 2PHRA 4LBQB 3AKSA 4C90A 3P3PA 5C3QA 2GNTA 4XUPA 1CVNA 1JMUB 1TMF1 3DECA 3VB9A 5A3MA 1CJPA 2HWD2 3AMMA 4I0AA 3JBG2 4Y22A 2ZCWA 5DDJ2 3W9AA 1GZWB 1W99A 1PVXA 2FBEA 1N1SA 1XNDA 4NR1A 2VTXA 5FZBA 4N9IA 1J3RA 1HRV1 1XNCA 2LM3A 5FZOB 1KDMA 4RQPA 1WBLA 1JYNA 4N43C 2VH9A 1ND2A 5GLVA 1I5PA 1SLCA 2W1UA 4U2AA 4YG6A 3R05A 2YY1A 5J36A 5CFDA 2B5HA 4DS0A 1YHFA 4ATFA 3BUCA 1RUI3 1QJU1 2FCTA 3AP5A 1R093 3ZSKA 1UPSA 2RS11 4NN0A 1POV0 1YO8A 1SHWB 2VVDA 2XKOA 4AEDC 1VBE1 2BZDA 3WF0A 5I0SA 5K0UB 3WNPA 1AHSA 3MV11 2FD8A 3IDBB 2Q8CA 1VIWB 4Q0PA 3SCFA 2VMIA 2BGPA 1RUI2 1R092 2ZX1A 4WBBA 4J1WA 4IV3B 1W9TA 5DUXA 1UYPA 4UF0A 5FPVA 3TB0A 3RPQA 1HKDA 5CNAA 5FMOL 1YFWA 1VBA1 1RUG1 3I2IA 2OUJA 1RXGA 2HWE3 1QQP1 1XNTA 2VQTA 4DOUA 2YFUA 3CIHA 5CISA 4FFIA 1OF3A 3KLSA 4ITCA 3TEYA 2AGSA 4LEJA 3BPSA 2X53S 1C57A 1H8TC 2X5IC 4YPJA 2YZ4A 5F32A 2HWE2 3ZFEA 1HRI1 1U5YA 4MXWB 3IPVA 3QOPA 4NJ4A 1MZFA 4LJHA 1PGW1 5DZEA 3ACHA 1DIWA 3IIIA 4W6YA 2ZGNA 4I01A 2VR4A 4LHSA 1HB4A 2JIGA 4A42A 1C1LA 2R0FA 4E4SA 1W9FA 4E2QA 2Y0OA 3H1MA 4AQSA 4ASMB 4QXBA 2GP5A 2ZBJA 3J7HA 1POV3 4LBLA 1QNWA 2VZTA 4LITA 1US2A 3MFAA 2ARCA 4QMAA 5KHHA 4YVWA 5BXXA 3N7JA 3N9NA 1VBB3 3HQXA 1PIV1 1H4GA 4HXCA 1ZRCA 4OCTA 1AR91 1AX1A 3LF7A 4WM7B 2VU9A 2BWCA 1GOFA 1UPIA 3WP6A 4DIQA 1XNAA 1MEC3 2LUWA 2AACA 2HKXA 4LBJA 1RUF1 1DZTA 2WO2A 2Q1FA 3UT0A 2E33A 4GWIA 2IXHA 3JZVA 4R52A 1V6NA 1UCXA 2XBO1 4CCKA 1REFA 3T1MA 3NNFA 4A6OA 3BVCA 1W0PA 5LA9A 5LY1A 1R1ZA 5A7PA 4XABA 1GYKA 3POJA 3PUSA 3LD8A 4YW6A 4C0HA 4K1YA 4XURA 4YGDA 4D0QA 1JZ8A 1YLLA 3M3CA 5EFUA 5AC91 5C8WA 4XDOA 1HXS1 4CCLA 1TE1B 4S2DA 3GGLA 4BH9A 2VNRA 1PMHX 3A0NA 5CIRA 2OX0A 2XJPA 2PHWA 5I0TA 3MIEA 3S57A 3SKVA 4OQ8A 3DKQA 3CQOA 4IGQA 5GM0A 3RG0A 2VUCA 1EV11 3RYPA 4CDWA 4HT1T 4Y3OA 3SMHA 1B35C 2OPKA 4ZU5A 1C8M2 1QJFA 4YVSC 2VZQA 1XC6A 3J8F3 4IEWA 1VB4A 3U1XA 2C9KA 1VBD3 3LQCA 2ZHNA 2D6LX 4XILA 5F5AA 5T5OA 4BLIA 2BVVA 3ACFA 3AVRA 3AYDA 1RYYA 2OZJA 1K5MC 5FMBA 2GNBA 1Z7S1 1UD1A 3CKHA 4HFSA 5FZFA 3WP5A 4UFIA 1HJFA 5HCBA 4F3JA 4B7EA 1V6JA 3MYXA 2PAKA 3AYEA 3W21A 1VBD2 4Q4V1 1DLLA 4IEQA 2VZVA 4XF3A 3RYRA 3A4UA 5FMOS 5JPNB 1HQLA 3PMSA 4L0PA 2O14A 1YYNA 1AX2A 3MEPA 4K6BA 3T0DA 5FZLA 5IK4A 5IVCA 3H8RA 1NAEA 4LMFA 3M3OA 2VOVA 3OBTA 2AREA 5FZOA 5DDJ1 5EXOA 4XZPA 3SH5A 1CPMA 5LASA 4NHLA 5CADA 1WCKA 3EXUA 4LBNA 1SBDA 1JYWA 4ZZ5A 3VD5A 1VAVA 1YEWA 5FZIA 2XJUA 3ZSJA 1IGOA 1FV3A 4LIUA 1A8MA 4IE7A 1NZCA 3AM2A 3OTFA 1WMDA 1PNGA 2DCYA 3H7YA 4TLGA 2WFF2 1QKQA 2E7QA 4NOTA 2JG9B 5JXHA 2VY0A 2XR4A 2VVFA 5FP7A 4LPLA 2EIBA 4ZU7A 1K3IA 1TME1 4AW7A 5HCFA 3O12A 4IV3A 4YG3A 5F3EA 4P00B 2WSVA 3ETPA 3ZXFA 1PZ9A 2WNVC 1R1A3 1OLQA 1DQ5A 2Z5WA 3B93A 4QHBA 2FDJA 1O59A 1DDLA 2VBPA 3V65A 3WUDA 4XDPA 1DZRA 4UXAA 1IKQA 2ZKNA 3ST7A 4UBGA 4MGKE 4QPGB 5FLIA 3VBOB 4YSFA 4MADA 1PO11 4QT6A 4XF4A 5FYZA 4IGPA 4PI2A 3T2PA 3O0WA 5BY5A 1VRH2 2XONA 2DTYA 2A6VA 2R062 3FHIB 4RN5A 2R1BA 1J3QA 3HN3A 3VL9A 4CEWC 3THDA 3HN1A 1AYM3 1E5IA 1RUJ2 3KSCA 1IPKA 3MIDA 2FCVA 1P8JA 5IK5A 3O1MA 4IETA 3BTZA 2YUEA 4OHVA 1YQ2A 3VZLA 1WA6X 5F2WA 2JJ6A 3R4SA 1DP0A 1SBFA 3T1LA 2RDSA 1KJRA 2PHTA 1G9CA 1Y9GA 3AKTA 2JXAA 3AKPA 4FI9A 4YM2A 4HLTA 1X7NA 4UW6A 4FTBA 1OFSA 3VN4A 3LEIA 4AVVA 2J7MA 3WVJA 3I2GA 4WM7A 4Y5Z0 5C3SA 4KG8A 4QDQA 3KT1A 5FP4A 4Q8LA 4BA6A 3KVAA 5FY9A 4GB32 2ZGTA 4QDSA 3AYAA 4BQXA 3WQ7A 1W6QB 2RVAA 1OFNA 2W91A 4XJUA 4EZ4A 4LQRA 4NRQA 1UXZA 1YIPA 2ZGLA 4E2GA 2GC3A 2WZEA 3CJIC 4LULA 3VBFA 4F8AA 4D7TA 1DGWX 1H9PA 2VZ3A 3SITA 5FOBB 5IFTA 1CAUB 1SFPA 2VOKA 5ABJC 1SLTA 5FFOC 1CWPA 2C6SA 2HJIA 3WDVA 2GNMA 4IW3A 2O0OA 4MGTA 3CMGA 4M0NA 1JOPA 4YW7A 5LBEA 1RUH1 2ARXA 5CFCC 3GBGA 5LEKA 3ZXAC 1QH7A 2RG4A 1C28A 1LRHA 1UKRA 1UOJA 1WLDA 1RHI2 2WJSA 3FHAA 1K12A 1JZ5A 5FKBA 2QUOA 2XKPA 3A21A 4RQPC 4XMIA 3QH6A 4W65A 5A1LA 4I0WB 5CFDC 5FYMA 1XQNA 2Y6GA 4FPJA 1G9AA 1BEV3 3JCIA 2QFEA 1WZXA 5AFEA 3LB9A 3WXPA 3RFRA 4I3GA 2UWBA 3C7FA 3LIGA 3E6BA 2D6MA 3HD8B 2DBIA 4RL7A 2ILMA 2ARBA 2VZPA 3MW2A 4LK7A 3VBHB 2WNOA 4UFLA 2VOWA 3GDBA 3OB8A 4NIGA 3VDCA 2WRAA 4YNIA 2MEV1 1HW5A 2ET1A 1WW6A 3S0MA 2ZXQA 2A5ZA 1NA1A 2VNVA 1RUD3 3GF6A 4CCNA 1N1YA 3KHBA 1UY1A 5FUPA 1GANA 3LKJA 4Y1XA 1S0BA 1DHKB 1STMA 2YGLA 1OUXA 2YB7A 3N7MA 4CU8A 2DVGA 4GKYA 2IWGB 4HETA 4F7ZA 2P4EA 5FXZA 2QZ3A 4AI0A 3NWKA 4I09A 3LDRA 4AVAA 1W6OB 1I6XA 1TZOA 4PLMA 2VNGA 4CE8A 2IFRA 3I2HA 2WAOA 1RUD2 3PTYA 4DFSA 2RE9A 5CZKA 3LSEA 2ZX4A 3WEZA 2JG9A 4LKFA 4XFGA 4CCMA 4XFCA 1F2NA 3AXDA 3WP3A 4BQ2A 1FMD1 4COVA 2PFWA 1AZDA 3GZAA 1DG6A 3NO8A 5ACA2 4LLFA 4DUWA 4JKLA 4RYDA 3MIBA 4FP2A 3AP7A 4AQ6A 1OH4A 5GLZA 3BIEA 1W03A 4I30A 2VGDA 1NE4A 1IG3A 1ODNA 2WWSA 3D8CA 3PURA 4QPYA 2BBVA 3N9QA 5JR7B 2CTVA 4FFFA 4JDNA 4QXKA 2QE3A 2XB6C 1H0BA 1FI2A 1VLNA 3PVBB 5DUUA 4PCRA 4YVWC 3VBOA 1IQAA 2HWF1 1Q3EA 2UWCA 4QPGA 3WW1A 4GMP1 1JYVA 2TEPA 2XOMA 5C4WB 4MOAA 4PIXA 3ECQA 3K2OA 1W6PB 3ZKUA 4E4ZA 3ACIA 1BVVA 1ZRFA 3RDIA 5F2SA 4BPZA 2G9FA 1S0JA 3HNYM 4QB6A 4KWLA 2E7AA 4EWDA 4JVAA 1F8VA 2XUMA 4FXKB 1JYCA 2Q5TA 1SMVA 2ZGQA 3QLQA 4QKBA 1JS9A 1FT9A 2VZRA 1QIQA 1RUJ1 2J1UA 3ZMNA 2DU0A 4CDXB 4CRQA 3CZJA 2RM21 2SBAA 5FP8A 1APNA 2HWB1 4DY3A 2IVIB 2GALA 5BNPA 1V6IA 3C3VA 4WM8B 5IVYA 1SLBA 4UT5A 3UKVA 4YZ2A 1RMU3 1RUC3 2JE9A 3KM5A 3LCPA 5IVJA 4Q4Y3 3ZYPA 1WD3A 4AXOA 2R30A 3SCGA 1W6QA 1OBNA 4N9HA 5KWRA 1XE7A 1KRIA 4CDWC 4O9EA 2X29A 4PI0A 2VC9A 3I2FA 1RMU2 1RUC2 1CAXB 1RUE3 2UURA 3JD71 2RJLA 1BMV1 2WNUA 3BU0A 4PDWC 3NQHA 1AJKA 3H3UA 4FPKA 1CAUA 4OQ9A 1QXRA 4QX1A 1D7PM 4H7LA 3DF0A 4Z2AA 3WLUA 1ZBA2 1AR63 4BIFA 4YZ1A 1UZ0A 3ZPOA 2WNEA 4NRPA 3GHMA 1SCSA 3WY6A 4P08A 2A1XA 2IXLA 4XBQA 2H6CA 1OHFA 4JGZB 4XJWA 4DEQA 4ET7A 3VBSB 2D3PA 2FCUA 1GOHA 2WABA 3BALA 5EYXA 2VCMA 3J7NA 5FXWA 4NPLA 5B4XA 5F9TA 4TXWA 2B4KA 4XF0A 1A8DA 1KD7A 3I7DA 3MW4A 4KQ7A 4META 2LROA 4KBZA 1FOD3 3WV6A 1QDCA 4BYYA 3SNMA 3SKJE 3K46A 4HK9A 1F35A 2C24A 2P34A 5SV5A 1GQHA 1GNHA 1MACA 5L19A 1L7LA 3ZYGA 5KHJA 1EPWA 3NNLA 2FDIA 1WUVA 4AZZA 3M3IA 4N8MA 4NROA 3D0SA 1S0FA 4Q0SA 3AZYA 4XHBA 3H3LA 4QU1A 5I0UA 4AFDA 5K0UC 1MQTC 5C3OA 1BXHA 2BP6A 1OD3A 1XYPA 2D97A 3WNMA 1UN1A 1TNRA 2VM9A 4B7KA 5A3PA 5K9YA 4Y1VA 2PMWB 2CWSA 5IJRA 4TN7A 5A1FA 5FCCA 1N3QA 1ST8A 4KNCA 5JUVA 4OI0A 4CUBA 5J1XA 1UMZA 3V0BB 4IV3C 1AR71 3EO6A 4LOTA 1RVF1 1J83A 5DUWA 3S5AA 4N53A 2DVAA 3MI8A 2EIGA 4P9YA 1HV0A 1QOOA 3OGVA 4HOOA 2YPJA 4R4XA 2R042 1E57A 1W6OA 4OI1A 3HOBA 3VZOA 5IVEA 1HIXA 3TN92 2JIJA 3NKGA 1UZVA 3NMBA 5FZAA 3RI8A 1LGBA 3MLLA 4XJ8A 4QM9A 3OOXA 3AZZA 1MS9A 4M3CE 1ZM1A 3KCYA 3AP4A 2Z42A 1N47A 1AF9A 4YW4A 4Z82A 3HEIA 5FY8A 3OSDA 5D8AB 3SXWA 4BMEA 3UYJA 3OG2A 3U10A 3UJQA 4XPVA 3WSOA 1V70A 4IEYA 5LA0A 1W8HA 4A6SA 5F37A 2H0BA 3HQUA 1K5JA 3MLJA 4KGQA 1RITA 2RS53 3G6JB 3ENRA 4Q4X3 3HVDA 3UKTA 1CX1A 2XJTA 3KD4A 5FDBA 1ND3B 3FBMA 2PLV2 2VMGA 1W6PA 2ZMLA 2FDKA 2Y8KA 3A0KA 4WM7C 2WR9A 1PGL1 3LDKA 1CQ9A 1TEIA 1G86A 4Q0UA 4KU7A 5FPBA 5JXIA 3ILNA 1RB8G 2NP0A 3FFQA 5GLTA 1SDDB 2RS32 2W46A 2W52A 1KFXL 1PVC1 2G19A 3J7LA 1LESA 4Y22B 4CDXA 1QJY2 3H1WA 1T6BX 4RFT0 5JMOA 1OQDA 4YFZA 2B9UA 2QQOA 4JC1A 1JYTA 2BBAA 1J1TA 2JE8A 4WM8A 2QQJA 2WWUA 3ZN4A 1ND2B 1RIRA 2J22A 1HRV3 4XJZA 3N9LA 1C3HA 2Y26A 4WVWA 2BU9A 4Z1VA 1H1MA 1VALA 3ILRA 4OZXA 1R081 4R9BA 3ZXGA 4HL0A 4UW3A 4BLJA 4JX0A 5KXEA 5KXBA 5AVAA 4D6RA 1FAYA 2FMYA 3KCCA 5DAPA 2W47A 5FREA 1CAXA 2WC2A 3B69A 3KT7A 4W50A 5FZHA 5IATA 4E8DA 1NY72 2L9LA 1LOFA 2GC1A 3OBRA 4ASLA 3AL6A 3KV4A 4YFWA 4KWKA 5A6XA 1GR3A 1T2XA 1HQNA 1V0AA 4UF0B 1JH5A 2GMPA 2WQ8A 2W1QA 4OMDA 1I9RA 4AAPA 1IZ3A 1OPMA 3AZVA 4CUGA 3B94A 1VBA3 4JGZA 1ZBA1 2GAUA 4K9SA 3I3MA 3HBZA 3VBSA 4RSUA 1IKPA 1BVP1 1QQP3 1Q8PA 4K8RB 1OUSA 5C8CA 3JB4C 2ZGRA 1B09A 5DMYA 3HR9A 2W3JA 1D4VB 2R16A 2YYOA 4BQ5A 1DCSA 1EUTA 2BRTA 1CN1A 1ULFA 1QEXA 1CJDA 4J1XA 1Y43B 1EAH3 3T0BA 2RJ2A 1IS5A 2TBVA 2W1WA 2QCSB 1HRI3 2J1AA 3GZUC 3B00A 3NJYA 5LWBA 2D3SA 4O65A 3JUUA 1YQ8A 4M00A 1AR81 2AZ5A 1COV3 1CZTA 4QQHA 4EN7B 1EAH2 1QWRA 1X8MA 3AMPA 4LTAA 1ZBE1 3EBRA 5FYTA 4IV1C 3P6BA 3UJOA 5FWJA 1ZZ6A 1Q8QA 1QJEA 3K3NA 4AHWA 2JG9C 4XUQA 2KA3A 3VDBA 2Y6KA 1CGPA 1X9PA 1V9U1 4OVEA 4P9LA 4X6RB 4AHXA 3H8XA 2RR12 1JODA 4S2GA 5EYYA 2XGXA 4NIIA 3B01A 1Q8SA 4W6XA 4Q4W1 3WNNA 5FY5A 2VG9A 5T54A 1FYUA 1VMFA 5E8AA 5C9AB 5I0DA 4M3CB 4FAHA 1V00A 3VZJA 5FMCA 1V6LA 1JZ3A 3FWEA 3KF5A 3WP4A 1JHJA 4IGOA 3ELNA 3IBMA 2VBBA 4HONA 3NAPB 4QPGC 1MPXA 4JQTA 3VBOC 4AQ2A 2NPIA 1D0GA 4LKDA 4HZFA 3RWKX 1L3JA 5EV7A 1DFQA 4JHTA 5AC93 4KWUA 5ANNA 1WW4A 2GNDA 4V1PA 5HV0A 3HQRA 2WN3A 2VAUA 2ZGMA 3MUZ1 1NXMA 1QF3A 3C2UA 4JKKA 3WCRA 1CESA 5E16A 5LW9A 2ERFA 3HIFA 2PHLA 5DG1A 4JZRA 3Q8CA 1XJAA 5HPOA 1NYWA 1HB2A 2RDRA 1VE0A 4LORA 1DGLA 5FJHA 1ASJ1 1XU1A 3KQRA 3SCHA 5K7PA 4RFRB 2HEVF 1IPSA 1MVQA 4LOSA 1BBT1 3DV8A 5BUVA 5FOJB 1ND3A 5G05L 3WZ1A 2R32A 3VD3A 3IDCB 2R073 1WLWA 4FVVA 1OLME 3VZNA 2VUJA 4R8HA 3NJVA 3WHTA 1Z7S3 1MZ6A 2VL4A 4FPFA 3ITQA 1F9KA 2RMU3 3NNMA 2DWRA 4Q4V3 4AL9A 4COZA 2R072 3D82A 3AP9A 4O9GA 1AYN1 4N90A 3W59A 2Z2SB 2RMU2 4P9IA 5FY4A 1QJY1 2WO3A 1LNSA 2ZOEB 3AXEA 5K8SA 2ZA9A 1QHDA 2LALA 3LE0A 4FT8A 5FY7A 5LA2A 5C70A 5HI0A 1ZREA 2PQSA 2XLFA 3J4UH 5FKCA 5IAVA 2JB4A 2DDUA 1UMHA 1J3PA 1ZRRA 3OUHA 2Q4SA 1DQ4A 2HBUA 4XFBA 3K3OA 1F5JA 1LU2A 3WG1A 2RHPA 3FL7A 3LFIA 4M0HA 4XIOA 1OA2A 1NCQA 2HBTA 3HT2A 5FLJA 2D5FA 2ENRA 1W28A 5A70A 2EIEA 2AR6A 3AYCA 4MO3M 3WDUA 4COYA 3IT8A 3HBKA 2DF7A 3NV1A 1AXZA 1TME3 3ZR5A 3HAGA 1NKGA 2VCCA 4JKMA 5T3NA 5TSWA 3S30A 2VUAA 4QGNA 4QX0A 2WSUA 4UAPA 1DZQA 1XXNA 1S0CA 2I45A 2I74A 2OYZA 1W9YA 1D4M3 4D6SA 2V72A 3PHMA 2F4LA 4A7ZA 3TEXA 2YGMA 3AZXA 3O5SA 4D7YA 3VBHC 3U14A 1WCQA 2Z4FA 3VKLA 3ZFFB 1XE0A 4B1LA 4PLNA 3KV5A 1D4M2 1FATA 4HMZA 4ZU4A 1JUIA 1HJGA 3KVBA 4N7UA 2ATFA 3E97A 3N36A 4FOVA 1FNZA 3I3DA 4E2SA 3DXUA 3PUHA 2WWJA 4QKNA 3AVSA 4ES9A 3WF3A 1V6OA 4RR3B 1AL23 1VBC1 4ISQA 5KXDA 2QQNA 3B02A 1LHNA 3VZKA 5J98B 3ROUA 1GZTA 2GMMA 2IVJA 5C3PA 4NPMA 2UY8A 2XHKA 4ZY9A 2HWC1 1IS3A 1DQ0A 1FNYA 1UO9A 1YQ6A 2QDNA 3PUAA 4GJYA 4IXLA 1AL22 3K4DA 4RHV1 3T0AA 3ZXEA 1Y9QA 3B5LB 1A34A 2RR11 4B4PA 5LB6A 5C9AA 1C4RA 1VBB2 1GICA 1ULPA 2K0GA 3BTAA 4M3CA 2EXKA 5FYHA 3VBRB 2IXJA 4LNVA 5JOZA 2VOTA 4LO6B
chains in the Genus database with same CATH topology
3POJA 4LORA 1SZBA 1SPPB 5CISA 3POEA 4LOTA 4GZ9A 2QQOA 3POGA 2WNOA 3KQ4B 4LOSA 2QQLA 1NZIA 3POIA 1NT0A 3POBA 2QQMA 5CKNA 4LMFA 5CKMA 5CKQA 1SPPA 2QQKA 1SFPA 3POFA 3DEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3POJ A;  4LOR A;  1SZB A;  1SPP B;  5CIS A;  3POE A;  4LOT A;  4GZ9 A;  2QQO A;  3POG A;  2WNO A;  3KQ4 B;  4LOS A;  2QQL A;  1NZI A;  3POI A;  1NT0 A;  3POB A;  2QQM A;  5CKN A;  4LMF A;  5CKM A;  5CKQ A;  1SPP A;  2QQK A;  1SFP A;  3POF A;  3DEM A; 
#chains in the Genus database with same CATH topology
 2ZMN A;  3KS7 A;  3QD6 A;  4YZ4 A;  1S55 A;  2HEY F;  4OFG A;  3VBF B;  1MEC 2;  1HDK A;  1UW8 A;  3NAP A;  4HK8 A;  3URF A;  4FTE A;  3MPB A;  5A80 A;  3IZO A;  3R4D B;  5C4W C;  4IEO A;  5FZG A;  1CD3 G;  4CXY A;  1XU2 A;  3U4X A;  1PO2 3;  5J7M A;  2CAV A;  4JDO A;  4WV8 A;  2PYT A;  1LHW A;  1W39 A;  3HNB M;  4AGR A;  3I4I A;  4DXR A;  4FAG A;  5CG9 A;  1ZRD A;  4CPB D;  5A7S A;  3WHU A;  1RUH 3;  2Y6L A;  3QBQ A;  1NCR B;  4CVU A;  4TSV A;  4CDX C;  1UQX A;  2O1Q A;  1PO2 2;  2P17 A;  4ARY A;  2JEC A;  3D0J A;  5KHK A;  1W8W A;  5KC6 A;  4OHY A;  1BQP A;  4CP0 A;  1W8N A;  4WM8 C;  3DL3 A;  4MLO A;  4XUN A;  3C7H A;  1UKG A;  2VD7 A;  3DKW A;  4ISR A;  4X8N A;  3N4M A;  1LHV A;  1ODM A;  3R6S A;  3D3A A;  3MPP G;  3J8F 2;  4LBK A;  3O1P A;  4R9D A;  4DRV A;  3E5U A;  4CDQ A;  5A1A A;  5AFB A;  3ZLI A;  2WBK A;  1AL0 G;  2D43 A;  2EAL A;  1VPH A;  2ZEX A;  5T55 A;  1O3Q A;  2IFW A;  5A3T A;  1MS3 A;  2JDN A;  1NQJ A;  1G8W A;  4GMP 0;  4XUO A;  3ATG A;  3S6P A;  1MS8 A;  1VB2 A;  2HWD 1;  4Q2F A;  3KT4 A;  3JBG 1;  3P3N A;  5LAT A;  4AEK A;  2A3Y A;  5JMC A;  4U36 A;  4W6W A;  1H6X A;  1NA1 B;  1WCS A;  3GHN A;  2MEV 3;  1H30 A;  1MS1 A;  2ZZQ A;  3VUO A;  2V5Y A;  2E32 A;  3IMM A;  4EWE A;  3A22 A;  2Q8O A;  1JU3 A;  3TAY A;  4BIS A;  2AUY A;  4EZH A;  4DXT A;  4JGZ C;  1O4Y A;  2FZ2 A;  3MZH A;  3VBS C;  4LR4 A;  1A78 A;  1XYO A;  2G9Z A;  4BQY A;  1S2K A;  4AI9 A;  3AJY A;  2XML A;  4XFH A;  5FYI A;  3H7J A;  4RA0 A;  2C0Z A;  3ZIX A;  1GP5 A;  1WBF A;  1XPW A;  4GWJ A;  1N1V A;  4P5H A;  3I3B A;  4TTG A;  5DUV A;  5CEH A;  2XXZ A;  3JQX A;  1UMI A;  4Q5O A;  5FQ0 B;  1JI6 A;  2P3Y A;  1RUI 1;  3E1F 1;  3JU9 A;  4KBB A;  1R09 1;  4MUV A;  4XOG A;  5EJ3 A;  5FPL A;  3V56 A;  2GH2 A;  4MGQ A;  3WW3 A;  2WZ8 A;  2R0H A;  4HKL A;  1KFU L;  5FY1 A;  3IKW A;  2AC1 A;  3FFZ A;  4YM0 A;  3WDY A;  3ZYJ B;  3QCW A;  3GBW A;  3PU3 A;  4IDZ A;  3WUC A;  3RZK A;  1JBC A;  2VMH A;  4H2A A;  1R1A 2;  3O1T A;  2V5D A;  3ZFF A;  3SC7 X;  3WD5 A;  3NST A;  2WLP A;  4AI1 A;  3APB A;  3ZVX A;  2YBP A;  3MHZ A;  3ZSE A;  1SBE A;  1O8S A;  2HWE 1;  3N9M A;  4COW A;  5CKN A;  2VMC A;  1G9B A;  1ULD A;  2IZW A;  1O3S A;  2J42 A;  1O3R A;  5T52 A;  1Z78 A;  1XBF A;  3T3Y A;  3RSJ A;  4RR3 A;  3RZM A;  1LOB A;  1S0D A;  3IWZ A;  1DU3 D;  4MH0 E;  1WGP A;  3IDA A;  2TUN A;  3SLI A;  1AYM 2;  1RC6 A;  1LB2 A;  3K51 A;  1VJ2 A;  2RM2 3;  2IUW A;  4QX2 A;  2C5D A;  5BNP B;  5F3G A;  1J84 A;  5FZE A;  5JCT A;  4RGK A;  3AKQ A;  3POE A;  5D8A C;  1S0G A;  2H6B A;  4PQQ A;  3FJS A;  4Z92 B;  5IVF A;  4AFB A;  3C8X A;  2Y6H A;  2VW2 A;  2Y33 A;  2ADD A;  2BFU L;  3VBR A;  1UZY A;  5J96 B;  2ARA A;  2OPW A;  4XFF A;  2OA2 A;  1MVE A;  1LGC A;  2BGO A;  2BYV E;  2QZ2 A;  4XC9 A;  2W87 A;  2JG8 A;  1QJX 3;  3SQO A;  1W8U A;  4MZU A;  2WNU B;  3WQ1 A;  3WF2 A;  1RJ8 A;  4CU6 A;  3JD7 3;  5FP9 A;  3WX5 A;  2Q1M A;  5ISL A;  1XNK A;  1NLR A;  3BCW A;  4Y1Y A;  3VKN A;  3KMH A;  1ND3 C;  2AYH A;  2IXC A;  4C8D A;  4D7S A;  1OI6 A;  1OOP B;  5F1R A;  2EID A;  4XBL A;  1QJX 2;  4HPK B;  4SLI A;  4CSW A;  4EV0 A;  3L2H A;  3PVE A;  4YW1 A;  4A44 A;  2VE1 A;  4LO5 B;  1N1T A;  5FYU A;  1NCR A;  4JGY B;  3W58 A;  1OLM A;  4Q0V A;  1MS0 A;  3KB5 A;  2XJQ A;  3GCX A;  2CDO A;  1U5I A;  1SDW A;  4QXH A;  2KD7 A;  2SLI A;  4H55 A;  5HBA A;  5C33 A;  3POS A;  1S1A A;  3U75 A;  4A3Z A;  1C8M 1;  2ID4 A;  5DAV A;  1ND2 C;  4QPI A;  3DPR A;  2WS9 3;  3WT3 A;  3M4F A;  3CDZ B;  2CGP A;  1HX6 A;  3ZFG B;  3KF3 A;  1TQ5 A;  1W04 A;  1HV1 A;  1YQC A;  3M3E A;  3OF1 A;  1PNF A;  3OGG A;  3AB0 A;  2Q8E A;  1YIF A;  2D44 A;  1PK6 B;  4QGM A;  3KV6 A;  2EA7 A;  4M4R A;  4I3P A;  4JDM A;  1BLZ A;  2WS9 2;  3FN9 A;  1VBD 1;  4L11 A;  5F3C A;  4BMB A;  4DUV A;  1LOC A;  1O5U A;  1C8N A;  1BEV 2;  2BDR A;  3J26 N;  2WKK A;  3N3H A;  3CL1 A;  4CP9 B;  2GC2 A;  1IQD C;  4NMI A;  1AR7 3;  3NL1 A;  4N53 B;  3FLP A;  2ET7 A;  4YAR A;  1IS4 A;  1PHM A;  1RVF 3;  5LBB A;  1DGR N;  1Y4W A;  5FYV A;  3S7E A;  5IHR A;  1A3K A;  1Y7B A;  4P9G A;  1W8T A;  4K21 A;  4HVR A;  2VJX A;  4YLZ A;  2JE7 A;  5JWP A;  1OKO A;  4AFA A;  5FYY A;  3OCP A;  3TOJ A;  4DUX A;  4KL1 A;  5BYN A;  3IAP A;  4AI3 A;  1SZB A;  2W5F A;  4IES A;  3U0Z A;  4CCE A;  1EPZ A;  3KGL A;  3ZFE C;  5C5T A;  2XQR A;  1VMJ A;  4FPH A;  2WFF 1;  3KCX A;  4UBH A;  4XW3 A;  3SEE A;  1OSG A;  2CGO A;  4OZO A;  5FQ0 A;  1R64 A;  1VAK A;  1ENQ A;  1G9F A;  2FHR A;  2BUK A;  2VXR A;  4NPR A;  2Y34 A;  3RZZ A;  2CYF A;  5K4L A;  5D21 A;  3WW4 A;  2UWA A;  4XCA A;  2VUL A;  3MUY 1;  2J1R A;  4G9S B;  5GZG A;  3WNO A;  1UNB A;  4DEV A;  4LA3 A;  1C1F A;  2BFU S;  5F5C A;  2ZTN A;  4BHP A;  2Q30 A;  1Y3T A;  4AQT A;  2W39 A;  5CVR A;  4NID A;  5ERL A;  4XQW A;  3T08 A;  4XAE A;  2RDQ A;  5FBJ A;  1O3T A;  1GP6 A;  2ADE A;  5C5U A;  4QB1 A;  4LLO A;  1R1A 1;  2AEZ A;  4BQW A;  5LY2 A;  5DZG A;  1GWK A;  5H9S A;  5C9A C;  4NWV A;  1VRH 1;  2QQP A;  1VAM A;  2R06 1;  2WYF A;  5LA1 A;  4XCB A;  5DG2 A;  1CX4 A;  4AI2 A;  2BW8 A;  4EE2 A;  3DN7 A;  2J1T A;  4WVV A;  4ZS3 A;  3P5B A;  1H9W A;  1W6M B;  1N3P A;  4LBM A;  1XSQ A;  2DYC A;  5A32 B;  5FWE A;  2VEC A;  1ACC A;  1SPP A;  1WLT A;  3VDA A;  2TNF A;  2VXJ A;  1MR5 A;  3AK0 A;  3RMY A;  2JKX A;  4NE9 A;  4DXZ A;  4YM3 A;  3AJZ A;  5FK7 A;  3BB6 A;  2Q8D A;  2CDP A;  1LEC A;  4CDU A;  3ALQ A;  4QDR A;  2A73 B;  3VHO A;  4JRL A;  2DVD A;  1GFF 2;  4GB3 1;  1GZ9 A;  2PXJ A;  4BXF A;  2Q1Z B;  2JDY A;  3WG2 A;  1RTV A;  2WFP A;  1O4T A;  4H7M A;  4Q4Y 2;  3HPN A;  3RZL A;  2GME A;  2PQQ A;  4XJ9 A;  3MO4 A;  1OOP A;  4UWD A;  3JB8 A;  2O8Q A;  2DV9 A;  3ABZ A;  1RUE 2;  1XB9 A;  4H3W A;  5CA6 A;  4YRD A;  4UFH A;  4HPK A;  1QOT A;  1ZNP A;  3N35 A;  1GU3 A;  2P2K A;  1URX A;  1REE A;  2A3X A;  5HXV A;  3T4V A;  5KXC A;  1QY4 A;  4AHY A;  2D5H A;  4JGY A;  2HYX A;  4DRR A;  5C8C B;  2WZR 3;  4AK3 A;  3MF9 A;  3O0X A;  1AR6 2;  1SQ4 A;  5J37 A;  1UY3 A;  4UW4 A;  1GNZ A;  4W4Z A;  4JQR A;  2G1M A;  1RHI 1;  3USS A;  2F4P A;  1UIJ A;  4N43 A;  2WIN B;  1W3V A;  3LA7 A;  5CB7 A;  3ME2 A;  1F4H A;  2WZR 2;  1FPN 3;  2P6H A;  2EXI A;  1JXN A;  4RS5 B;  4OHZ A;  3ZFG A;  1BCX A;  2ORX A;  2AH2 A;  2Z69 A;  1SAC A;  1LEN A;  3AMH A;  4KGG A;  5FUN A;  5A33 A;  4OI4 A;  4FPO B;  2WT0 A;  2D3R A;  2LS6 A;  2VPV A;  1UAI A;  1FOD 2;  1PK6 A;  1K42 A;  1FV2 A;  1POQ A;  3LA3 A;  3N9P A;  5FZ9 A;  5JLV A;  1LGN A;  4BK4 A;  1BJQ A;  2JD9 A;  4XTP A;  1E5H A;  2BEO A;  1ENX A;  4RD7 A;  4XDQ A;  5BNQ A;  2FDH A;  1FPN 2;  3IDE A;  4YW5 A;  4Q1P A;  2HEW F;  2IC1 A;  2BQP A;  1V9U 3;  1WMX A;  3BGA A;  4YM1 A;  4CP9 A;  3POG A;  3KQ4 B;  4IQP A;  4BCU A;  1QH6 A;  1BEV 1;  4KWJ A;  5AVP A;  2JB8 A;  1W90 A;  3D4K A;  1KEX A;  2R49 A;  4URA A;  3KHC A;  4X8P A;  3A23 A;  1UOF A;  1JZ2 A;  4NUB A;  1GKB A;  1H2M A;  1O6U A;  5FUI A;  2ETE A;  5IK8 A;  4KH9 A;  1JUH A;  3ZIW A;  1NOV A;  2X5I A;  4DIN B;  5FTT C;  5EHD A;  2WO7 A;  3ZFF C;  2X09 A;  4MYE A;  1YI9 A;  2EIC A;  3B7M A;  3LWC A;  3R4U A;  4JV4 A;  4LHL A;  3WOG A;  5IAX A;  1RUD 1;  1CON A;  1WW7 A;  2JDH A;  2PA7 A;  3O1V A;  2RDN A;  2EXJ A;  2I07 B;  3E5Q A;  3DYO A;  4Z07 A;  1EY2 A;  4AE2 A;  5CAZ A;  1UU4 A;  2CAU A;  4PBP A;  2OXB A;  2WDB A;  3LAG A;  4IEP A;  1JW6 A;  1KS5 A;  5HCA A;  2GH8 A;  2F17 A;  4AVS A;  3KWV A;  5ACA 1;  3GJA A;  5FZM A;  3ETQ A;  2XUE A;  4RR3 C;  3E6D A;  4GIQ A;  4XFA A;  2A75 A;  2ZGS A;  2DUO A;  4E4D X;  4CUC A;  4XXA A;  1ULE A;  4IEZ A;  3SH3 A;  1SLL A;  1X36 A;  4QAW A;  3LGR A;  1Q8V A;  1ASJ 3;  1SEF A;  5DAB A;  1OD5 A;  2J1E A;  4NRM A;  2WYS A;  3DYM A;  3EMR A;  3WW2 A;  5FO8 B;  4AFC A;  2GSY A;  1HN0 A;  2P1B A;  2RS5 2;  2WUH A;  2X8K A;  2CGN A;  4KG0 A;  4G3Y C;  4Q4X 2;  4QHO A;  2VW0 A;  4PQ9 A;  1I5Z A;  4FPE A;  2PHU A;  1DQ2 A;  3Q8A A;  4Y4Y A;  3OY8 B;  1W8Z A;  4HVO A;  4V2W A;  2NLR A;  3FHQ A;  3UES A;  1UX7 A;  3VBF C;  1TMF 3;  3ZX7 A;  1D2S A;  1W6M A;  4O7X A;  2VVE A;  4HN0 A;  3ZXD A;  4GH4 B;  5A32 A;  1MZE A;  3FMG A;  2C9A A;  4IND A;  4PHZ A;  1AYN 3;  2BNM A;  3FUO A;  1H1I A;  1Q56 A;  4FPL A;  4IL7 A;  4RGG A;  2GP3 A;  5JPM B;  1OVP A;  3K77 A;  4XIK A;  1TMF 2;  1Z0H A;  4FPY A;  1ENR A;  2JIC A;  3AC0 A;  2WA4 A;  4QXC A;  1SG3 A;  2A6X A;  1KJL A;  1QJU 3;  3NJZ A;  2G4I A;  4WZC A;  3T30 A;  1NCR C;  2RS1 3;  1UU5 A;  3VGI A;  1CIY A;  4EN9 B;  1HRV 2;  4JTO A;  1VBE 3;  3RI9 A;  1GSL A;  1NCQ B;  5JSP A;  2OW4 A;  3BI3 A;  1PM7 A;  2PHD A;  1AX0 A;  2W94 A;  2XPJ A;  4UI9 L;  1W05 A;  4K40 A;  4HBN A;  4WZF A;  3ILF A;  1RMU 1;  1RUC 1;  5T5P A;  4MG2 A;  3MW3 A;  4YZ3 A;  2VTF A;  2RS1 2;  3VZM A;  2ZX3 A;  2DU1 A;  3THT A;  5IFP A;  1VBE 2;  2YMZ A;  1H8V A;  2QKD A;  2XWJ B;  5C6C A;  1UOG A;  3TNP B;  3TYJ A;  2W92 A;  2WA3 A;  3PIG A;  5LK5 A;  3S7I A;  4ZPI A;  1RUG 3;  3O1S A;  1LHU A;  3AMN A;  3BTY A;  3WNX A;  4OUE A;  1ZA4 A;  2FMD A;  4PJY A;  2K46 A;  3AL5 A;  3TNQ A;  3TEZ A;  3C7G A;  4ZON A;  4AHZ A;  2PTM A;  4HN1 A;  1NG0 A;  1UL9 A;  3S5Q A;  1VBA 2;  4LBQ D;  5A6Q A;  1RUG 2;  2JDK A;  2Q0A A;  1QQP 2;  4FOY A;  1NA1 C;  5I93 A;  2E7T A;  3OEB A;  4RS5 A;  3VBU B;  2V73 A;  3T2T A;  4EQV A;  5L73 A;  4C1W A;  2JWP A;  3LA2 A;  4UFJ A;  3I8T A;  4WVM A;  2VCB A;  1OPO A;  2IXI A;  4AFM A;  1XYN A;  4LUM A;  1HRI 2;  5DAX A;  2PEL A;  3MLK A;  3FE5 A;  4MGS A;  4DXS A;  4YGE A;  1PGW 2;  2E63 A;  5FZ0 A;  3FLT A;  4D94 A;  5J09 A;  2Y64 A;  3VD7 A;  1XSR A;  1PIV 3;  4OYU A;  1COV 2;  1N3O A;  1ZZC A;  1ENS A;  3ZN5 A;  3USU B;  1KIT A;  2MNG A;  1AR9 3;  1SCR A;  1BZW A;  2OQ6 A;  3OPT A;  4RHV 3;  5EQU A;  2QJV A;  5JR2 A;  1VR3 A;  2XVG A;  3VHR A;  3O7O A;  1UOB A;  1RUF 3;  1LAJ A;  2ES3 A;  3NW4 A;  2V09 A;  2XBO 3;  1PIV 2;  4S2H A;  4DQA A;  2NMN A;  5FPU A;  4FXG B;  4GWM A;  2VNO A;  4E8C A;  1AR9 2;  5JIA A;  2R04 1;  3BOP A;  3H9A A;  3TEW A;  3ON7 A;  2D6K A;  3OPW A;  3HNM A;  3ORJ A;  3E6C C;  3TN9 1;  3H1Y A;  4OUL A;  1DYO A;  2H0V A;  2LTN A;  3X29 B;  2XBO 2;  5M0T A;  1HXS 3;  3FLR A;  2JDP A;  5I8Y A;  2EAA A;  2P3I A;  3KV9 A;  3B3Q E;  1WKY A;  3DEM A;  1J1L A;  2GU9 A;  3BTX A;  2YC4 A;  3WG4 A;  1UX6 A;  2NQY A;  1LOD A;  4LA2 A;  3C7E A;  3Q8F A;  5A7O A;  1EV1 3;  3GXU A;  3O1U A;  5AC9 2;  4Q1R A;  3I54 A;  1HXS 2;  2BVB A;  1KS4 A;  2UYB A;  3OBA A;  3M8L A;  2QQL A;  4Q27 A;  2Y6J A;  1UF2 C;  5F5Q A;  4QU2 A;  3VV1 A;  5CYY A;  5A3U A;  5BNP C;  1GV9 A;  5JDB A;  2ZAB A;  1W0N A;  5T5L A;  3PU8 A;  3OD4 A;  5BNN B;  4BB3 A;  3BPZ A;  2PAE A;  3ZPY A;  3OGR A;  2G9G A;  2QDR A;  5ANQ A;  1LOG A;  1S2B A;  2ZAC A;  5DPN A;  2PLV 1;  3UGH A;  3N7L A;  4B3N A;  4CDQ B;  5KC5 A;  1DQ6 A;  2NMO A;  5FYC A;  4BXS V;  2QQI A;  3ZO0 B;  2RS5 1;  1ZA7 A;  3OY8 A;  1LUL A;  1RXF A;  1KXG A;  4A2U A;  3LPF A;  5BV6 A;  2WNU C;  1LJ7 A;  2RS3 1;  4CXW A;  1H6Y A;  4GH4 A;  1YFU A;  1Z7S 2;  4FFH A;  4GQ7 A;  3AP6 A;  2R6Q A;  2ORZ A;  1H1A A;  4TYS A;  1CR7 A;  2XLG A;  4AVT A;  5ABJ A;  1OOP C;  1WME A;  2DVF A;  4Q4V 2;  2B45 X;  2UYA A;  5DDJ 3;  4QQ2 A;  4CTE A;  1VRB A;  5FP3 A;  3M2M A;  5FO9 B;  4CEY B;  1ZZ9 A;  1S0I A;  2JX9 A;  3CHX A;  2JEM A;  3I3Q A;  5CFC A;  4PF1 A;  1GZC A;  4JGY C;  4BIO A;  1AVB A;  2DVB A;  1ULC A;  2PHF A;  4I2O A;  1CAW B;  2VZO A;  4ARX A;  2PHX A;  2OUH A;  5LRR A;  1JTZ X;  3MBW A;  5IUQ A;  3H3Z A;  5FXX A;  2XL7 A;  1NY7 1;  5C71 A;  1QXP A;  4M01 A;  1F15 A;  1W2N A;  2JDU A;  3ZFG C;  3LIH A;  4R9C A;  1CZV A;  4Y5T A;  4Y26 A;  1H4H A;  4GAL A;  3D6E A;  3RJ2 X;  4C1X A;  2WO1 A;  5FR3 A;  1GUI A;  1PK6 C;  3AZW A;  3OD0 A;  1TME 2;  1MQT B;  3NV2 A;  4AEM A;  5A3O A;  1ONA A;  1YNA A;  2ZS6 B;  4LK6 A;  2VOX A;  1QMJ A;  1GMM A;  1ZVF A;  1J58 A;  2RV9 A;  3MIG A;  2DCZ A;  3M1H A;  4ORF A;  2DUQ A;  4YZ5 A;  4AYU A;  1PO1 3;  3CJX A;  3SIS A;  4HKW A;  3CNA A;  1OQ1 A;  2XVK A;  4MGI E;  5BNO B;  2CV6 A;  4N53 C;  3VBU A;  2B39 A;  3RQ0 A;  3RZH A;  3BIW E;  5LZ6 A;  1LHO A;  1GP4 A;  2K9Z A;  2WAA A;  1OMI A;  4IEX A;  4GD4 A;  1ZRI A;  2FDF A;  2OQ7 A;  3K4Z A;  1F4A A;  1PO1 2;  4IE4 A;  4TWT A;  2OZ6 A;  4MVT A;  4AGV A;  5JSR A;  3F2Z A;  2D98 A;  5FIX A;  1RL3 A;  5FK8 A;  2XWB B;  3Q8B A;  4FCA A;  2E51 A;  3WNK A;  4QD2 A;  2BOJ A;  4MGY E;  1EAH 1;  4PBO A;  1GBG A;  2ZX2 A;  5L7O B;  3CBN A;  4FQ4 A;  4QHZ A;  2VUD A;  3LEM A;  3GZT B;  4IEU A;  3PNA A;  4NWW A;  3ES4 A;  4AEJ A;  4FPG A;  5JI7 A;  3USU A;  4Y1Z A;  1ZZ8 A;  3UL2 A;  3BU7 A;  1GWM A;  3WR0 A;  1PX4 A;  3DXT A;  4UW5 A;  4CUA A;  4LKS A;  1COV 1;  4QQL A;  5I8S A;  3LEG A;  3POF A;  3U11 A;  4LHN A;  2X10 A;  3EYP A;  1JYX A;  1GWL A;  3RYK A;  2JG8 B;  3EJK A;  5IK7 A;  3IIA A;  2E26 A;  1E5R A;  2BNN A;  2P37 A;  4GZ9 A;  2DCK A;  5JIU A;  4NVP A;  4HVQ A;  3WIN E;  1GNY A;  3PIJ A;  5GAL A;  1RUN A;  4NO4 A;  2I2S A;  4ERO A;  1D2Q A;  5A3W A;  1BYH A;  2QTW B;  2B7Y A;  2CY6 A;  5FBZ A;  2YG0 A;  4YW2 A;  3OUI A;  4NIH A;  2YPD A;  4OUS A;  5CKQ A;  2R1D A;  1CIW A;  2VQ0 A;  3DCQ A;  4BM8 A;  3UGF A;  3VHP A;  3W20 A;  1YJL A;  2LRP A;  2WLQ A;  3OEA A;  2PAM A;  3I2O A;  3HT1 A;  5EWS A;  4YGB A;  1WW5 A;  2CWM A;  3AKR A;  2QQU A;  4QPI B;  4FTS A;  1RUH 2;  3DPR B;  5BNN A;  4DNY A;  3O14 A;  2WZP P;  1C8M 3;  2ZMK A;  5FZ1 A;  1RIN A;  3GBF A;  2IXK A;  4IE0 A;  5T5J A;  3H8O A;  5H9P A;  2DTW A;  2ZGK A;  5FJK A;  3RZJ A;  3CO2 A;  4XXP A;  4QX5 A;  4RGA A;  4LO8 A;  1IS6 A;  1LOF C;  2A71 A;  4PDW A;  2NM1 A;  1JYI A;  2R07 1;  5GJ6 A;  3CEW A;  1UYY A;  1HB3 A;  3CU7 A;  4BDV B;  3I2J A;  4CCJ A;  1JHN A;  5LK7 B;  3J9S A;  3PJY A;  4HSJ A;  3M7A A;  1UXX X;  3NV3 A;  5EJ1 B;  4QPW A;  2HH9 A;  3INA A;  4LBQ A;  2RMU 1;  1YUD A;  4CEY A;  3W5M A;  4BE3 A;  2JDM A;  3TBD A;  4GA9 A;  2D93 A;  3VDD B;  3ZKY A;  4L92 A;  3ZXJ A;  2CSG A;  5C8C C;  3JXS A;  2VQA A;  2MEV 2;  1CAW A;  3POI A;  2YU2 A;  5E6H A;  1RGS A;  1SFY A;  1GZW A;  1NX9 A;  2Z79 A;  2QQM A;  3PME A;  1O91 A;  2ZGU A;  4CCC A;  4GJZ A;  1OUR A;  1X9T A;  4NAM A;  2E9Q A;  4PT6 A;  1FMD 3;  1ALY A;  2CU5 A;  1W2O A;  3I3E A;  4B4Q A;  5IVB A;  1MS5 A;  2WFF 3;  3B9I A;  4RS5 C;  2E31 A;  2BTV C;  3BOD A;  4AI8 A;  3MGU A;  2JEN A;  2JKB A;  1DGR A;  3PLQ A;  4K7J A;  5F5I A;  1OLR A;  1QU0 A;  1LCL A;  2EAK A;  4ZZ8 A;  2W2I A;  2WII B;  3VKM A;  1FMD 2;  2P3J A;  1UZW A;  4XQD A;  1MQT A;  1W06 A;  2BJS A;  5K0U A;  3RS6 A;  2K2S A;  4OHX A;  5GLW A;  4IV1 B;  2W1S A;  5LRS A;  3CF6 E;  4A4A A;  5CBL A;  1H2N A;  1TG7 A;  2DFC A;  1W8F A;  2HWF 3;  4S2F A;  4B1M A;  4GMP 3;  5EIY B;  2VMD A;  5FZD A;  4QWN A;  5I8T A;  3ES1 A;  2NZ9 A;  1HQW A;  3POY A;  5GZD A;  2YFZ A;  4YYO A;  2JDA A;  1QGL A;  5BNO A;  2P5B A;  1JZ6 A;  1Q8O A;  1YI7 A;  1PM4 A;  1EP0 A;  1D4M 1;  3WDT A;  5DN2 A;  2OII A;  1UWW A;  2HWF 2;  1X8E A;  1VRH 3;  1NXD 1;  4HAN A;  3I2D A;  5FZ7 A;  3PTR B;  2R06 3;  4XTM A;  5FZ3 A;  2ZJC A;  3GZE A;  5JZG B;  4K1Z A;  3F95 A;  5FXV A;  1QJZ A;  1GOG A;  1WWY A;  4HSL A;  4EYU A;  3N7K A;  2B9V A;  1RUJ 3;  2NYY A;  2W9X A;  5FYB A;  3ZMO A;  4A41 A;  4ATE A;  1W9S A;  1SPP B;  4QX8 A;  5L7O A;  3HMY A;  5JSO A;  2C4X A;  2HWB 3;  1HN1 A;  1OH3 A;  1O7F A;  1RJ7 A;  4MXW A;  4ZKT B;  5F7U A;  4BU2 A;  3NVC A;  3I2K A;  4D69 A;  3THC A;  1NZI A;  4OMC A;  1DLC A;  4QGL A;  4C0B A;  1T6G C;  4CZS A;  1JZ4 A;  4CDU B;  3BOW A;  1XNB A;  2J1V A;  2RM2 2;  3H8U A;  3L2Y A;  1AL2 1;  1POV 1;  5GZE A;  2HWB 2;  1BK0 A;  2JDZ A;  2DUR A;  4EN0 A;  3RWN A;  4L8Q A;  3TWI A;  5BPX A;  1VBB 1;  2OVU A;  2WN2 A;  4FFG A;  4GB3 3;  2D6N A;  2B42 B;  4P02 B;  1UY4 A;  3ASI A;  5F6K A;  4MGZ E;  3KGZ A;  4DB5 A;  4LHK A;  3K4A A;  4TZD A;  2O8O A;  1BK1 A;  2OT7 A;  2OKX A;  4I0B A;  1MEC 1;  1YC6 1;  5FZ6 A;  3A7Q A;  3ZXK A;  1MS4 A;  1U5X A;  3GM8 A;  4CYD A;  5DQ0 A;  1YQ5 A;  3DYP A;  3I49 A;  4KU8 A;  5GKA C;  1NQD A;  2ZHK A;  3JD7 2;  4N7I A;  1BMV 2;  1PZ8 A;  5KHI A;  4AG4 A;  3MF6 A;  2ZAA A;  3B9C A;  4JRA A;  2BV4 A;  3H50 A;  3NV4 A;  2VZS A;  4GH4 C;  4AGG A;  1MZ5 A;  1W2U A;  5EZW A;  3RVH A;  1PO2 1;  5A6Y A;  1K45 A;  2YHJ A;  2ZGP A;  4N43 B;  3ZYH A;  1G9D A;  1RHI 3;  4ZXE A;  3LFM A;  1YRZ A;  5A33 B;  2WT1 A;  1LR5 A;  3ACG A;  1X50 A;  5DAQ A;  1YXW A;  2VME A;  3H0O A;  3WCS A;  1OT5 A;  4AED B;  5FZ8 A;  1JOJ A;  3J8F 1;  4UYB A;  4EWA A;  5DZF A;  4WVZ A;  4BQ1 A;  1NCQ C;  4XF9 A;  4URT A;  2VBD A;  3WF4 A;  1X33 A;  4IE6 A;  4XF1 A;  3MV0 1;  5F3I A;  4CP1 A;  4C91 A;  1PZ7 A;  3V0A B;  5HCH A;  2Y6F A;  4ZXK A;  3BYW A;  4A7Y A;  2A7A A;  3IAQ A;  2AEY A;  3D5O A;  5F39 A;  3ZDS A;  3RJR A;  2XVL A;  4QQP A;  5L9V A;  5A7W B;  3QAC A;  3U78 A;  4EN6 B;  4XJA A;  4NHM A;  2VCA A;  2HYK A;  4JAA A;  3M70 A;  3VDD A;  5EPA A;  1I3H A;  2ZGO A;  2ZHM A;  3PVO A;  2Y60 A;  4FOQ A;  3VD4 A;  4OHW A;  5A7Q A;  3OJB A;  4FO9 A;  4J6G A;  1H8T B;  1BKZ A;  2X5I B;  4GXL A;  4JCK A;  1AR7 2;  5IVV A;  1TVG A;  1RVF 2;  3NNG A;  1JN2 P;  1ZZB A;  3ZXL A;  3E5X A;  5DAW A;  5FPA A;  1QOS A;  4FP3 A;  4PLO A;  5IW0 A;  1M4W A;  5G04 L;  3GYD A;  1YFY A;  4L99 A;  3UET A;  1UY0 A;  3RZG A;  2QBX A;  5C7G A;  3VBU C;  3POB A;  2GN3 A;  4XAA A;  4O61 A;  1VP6 A;  4NHY A;  3IM0 A;  5JI9 A;  3NRU A;  3L9J T;  4IEV A;  5ACA 3;  4IV1 A;  3VLB B;  2BGC A;  3C7O A;  3LSD A;  5C3R A;  4NIA A;  1OQE A;  5JAX A;  4JTN A;  4TLF A;  4SBV A;  1U0A A;  3CLP A;  1IG0 A;  5IT6 A;  1WLC A;  4BWO A;  1Q43 A;  2DFB A;  5A3L A;  2YBK A;  2V4V A;  4Y24 A;  4GKX A;  5E88 A;  5LEJ A;  4JHZ A;  5FO7 B;  4ONU A;  2RJK A;  1IHM A;  4D6Q A;  3Q9O A;  2EXH A;  1UU6 A;  2XJS A;  1OF4 A;  1US3 A;  1LOA A;  2ZAH A;  4QKF A;  3MFC A;  3BN6 A;  4XZU G;  3GCW A;  1C5H A;  4CCO A;  5JOY A;  1ZYB A;  5CG8 A;  4L97 A;  4QKD A;  5JZG A;  3HWJ A;  1PVC 3;  3ZSM A;  3KZ4 C;  4CPB A;  3NAP C;  2ZEW A;  4MHR A;  4MXV A;  3WNL A;  3POW A;  3TRS B;  1PGL 2;  3MIH A;  1NLS A;  4DMI A;  4HG6 B;  5HXM A;  1PGS A;  4I02 A;  4UFK A;  5JXJ A;  1AYM 1;  1DQ1 A;  1O5L A;  4ES8 A;  4NAO A;  1PVC 2;  1KQR A;  3CZU A;  1CZS A;  3IN9 A;  5D1I A;  3AX4 A;  5JXG A;  4E9K A;  2WT2 A;  4M3C F;  1W0O A;  1R08 3;  4PIY A;  3PVN A;  3LPG A;  4R4Z A;  3WDX A;  3WF1 A;  1B35 B;  1D0H A;  4YVS B;  1YWK A;  5FYS A;  4B29 A;  3U07 A;  1H2K A;  4LUK A;  4E27 A;  2OS2 A;  4YW3 A;  4DO0 A;  1NUK A;  2WL1 A;  4Q29 A;  4H14 A;  1SFN A;  1GQG A;  2XLA A;  4DY5 A;  5BNN C;  1R08 2;  1DGW A;  3UKN A;  2GN7 A;  1K5M B;  3QH7 A;  1HLC A;  4MV2 A;  4PF5 A;  1I1E A;  5FPZ A;  3U4S A;  4GAZ A;  4CDQ C;  1UY2 A;  5A3N A;  4QB2 A;  4P9J A;  1L7Q A;  1YFX A;  5J48 A;  2XG3 A;  4XYX A;  3OPZ A;  1QJX 1;  4ZHN A;  1ZBA 3;  2A6Y A;  1JOB A;  3MIF A;  5FZC A;  2XJV A;  3RGB A;  1UYX A;  2Y38 A;  5IYY A;  1O4Z A;  4XEZ A;  1DYK A;  1KGY A;  4Q26 A;  2XL9 A;  1ZX5 A;  1AXK A;  2CL2 A;  2N7G A;  2VMF A;  2R7E B;  2E53 A;  3LEK A;  4A7K A;  2C1F A;  1PX3 A;  3MDP A;  3T09 A;  4PIZ A;  2P6C A;  2P3K A;  1JZ7 A;  4FOW A;  4CEY C;  4CU9 A;  2XQX A;  4OI2 A;  4YWA A;  4AAX A;  5FY0 A;  4WVM B;  3WDW A;  2DBN A;  4F83 A;  4AED A;  2BPA 2;  4Z8B A;  5H9R A;  1AR8 3;  3GJB A;  4BQ3 A;  5L36 A;  3IB3 A;  3ZM8 A;  3NJX A;  1ZBE 3;  2UY9 A;  4XET A;  1XRU A;  1FX5 A;  2MHF A;  2EVX A;  3UK9 A;  3V0A A;  2XDV A;  4D3W A;  4NHK A;  1QNY A;  1U12 A;  2WS9 1;  3OYW B;  4Y4R A;  5GZC A;  4OLL A;  1G6N A;  1GQP A;  5FZ4 A;  4FPC A;  4GWN A;  3T4H B;  4EN8 B;  1J59 A;  2LW8 A;  1AR8 2;  3IMN A;  3OGS A;  5H9Q A;  5A7W A;  3G7D A;  4A3X A;  2WNV B;  4XVH A;  4Q4W 3;  3LOI A;  1ZBE 2;  3NNJ A;  3I59 B;  2D7F A;  3K48 A;  1JU4 A;  1U5Z A;  3FZ3 A;  1UYZ A;  1V9U 2;  3R0R A;  3ZYF A;  2DCJ A;  2B46 X;  4X6Q B;  1H8T A;  4P14 A;  3EQE A;  1OKQ A;  1OA4 A;  3VBH A;  4Q4W 2;  5FAX A;  2R04 3;  3J7M A;  2AEN A;  2CNA A;  3LOB A;  3PJQ A;  4P5Y A;  2B8M A;  2ZX0 A;  3GNE A;  4CEW B;  3THP A;  3TN9 3;  5BNO C;  4CCD A;  5FV3 A;  3K75 B;  2YV8 A;  4LKE A;  2YRO A;  1ULO A;  1RUO A;  4L9B A;  3SH4 A;  4ZS2 A;  1WD4 A;  1WA4 A;  3VKF C;  1WMF A;  3LDB A;  1W6N B;  1YJK A;  2WQ4 A;  2F6B A;  5LCW L;  1L7R A;  3OGJ A;  3ZYB A;  4OUM A;  4DPN A;  1G7Y A;  4XHX A;  5L7O C;  4AF9 A;  4YG0 A;  1BBT 3;  2YU1 A;  2VW1 A;  4BOW A;  3DUI A;  4MX3 A;  1YCI A;  1LOE A;  1LU1 A;  4LBO A;  4Q8K A;  4QX7 A;  1W9W A;  1WCU A;  3UV9 A;  3VBR C;  1ASJ 2;  2PLV 3;  3Q8E A;  5LBC A;  2CHH A;  2KM2 A;  3W5N A;  2JG8 C;  1V6M A;  1BBT 2;  4Y1U A;  2Y0I A;  5A7N A;  3CJI B;  4Y20 B;  2MPF A;  3ZN6 B;  3RMX A;  4XFI A;  1VMH A;  2RS3 3;  4Z2W A;  5C4W A;  4COU A;  2GDF A;  5I91 A;  1W8O A;  1SLA A;  2W95 A;  5ABJ B;  3UNP A;  1CAV B;  1QJY 3;  2NN8 A;  1FXZ A;  2XJR A;  1NE6 A;  4QX3 A;  4XMA A;  1OA3 A;  4CP2 A;  3RRD A;  1EUU A;  5KR7 A;  1LTE A;  1X82 A;  5I0R A;  1Y9M A;  2E6V A;  5J3U A;  3NKT A;  3WQ0 A;  2YDE A;  4LO7 A;  4XE9 A;  2YC2 A;  3RNS A;  5CFC B;  1LKN A;  5L9R A;  4FSJ A;  1IPJ A;  1AYN 2;  3ZSL A;  3BKZ A;  3OUJ A;  3I97 A;  4Y33 A;  1B35 A;  2C26 A;  2HLE A;  4KI5 M;  4LIV A;  4YVS A;  4FBF A;  2D6O X;  1RED A;  5LBF A;  5EP9 A;  3VHN A;  4EJR A;  1W2T A;  1AXY A;  4E4H A;  1AUY A;  4IE5 A;  3JQW A;  3WQB A;  4Q0Q A;  3O1R A;  3PL0 A;  2ZEZ A;  1QJU 2;  2ZPX A;  4K8F A;  4QPI C;  4RQP B;  3DPR C;  4AVC A;  3FX3 A;  4Q4Y 1;  1K5M A;  2WQZ C;  4J25 A;  1QXJ A;  4LE3 A;  5E89 A;  4AWD A;  3WG3 A;  5CFD B;  3VKO A;  1XOY A;  5KBF A;  1SLI A;  1RUE 1;  2QQK A;  1QDO A;  3DGT A;  1OVS A;  4GUL A;  4MSV A;  3U37 A;  4UFM A;  3PDQ A;  1O8P A;  2UU8 A;  3M3Q A;  1OXC A;  5FMD A;  2QQV A;  4QM8 A;  3FBY A;  4BZ4 A;  3MIC A;  3OBZ A;  1TNF A;  2A6Z A;  4Y5S A;  5D2A A;  1DYP A;  1AR6 1;  3LZZ A;  3PUQ A;  4BJ0 A;  2BER A;  1BHG A;  5B4N A;  1M06 G;  2FDG A;  5FPX A;  1F31 A;  1C5I A;  1LEM A;  2W0X A;  4XBN A;  5E1R A;  3AFK A;  4K3U A;  4YGC A;  3VDD C;  1NT0 A;  2ZKL A;  2VO5 A;  1PMI A;  2WZR 1;  3V64 A;  4ASK A;  1ULG A;  2VZ1 A;  4BQ4 A;  5JOX A;  5CKM A;  2D40 A;  1VBC 3;  4M4P A;  1FOD 1;  2EF6 A;  3EHK A;  4A45 A;  5JOW A;  4AR2 A;  3ZFE B;  1S4C A;  5EJZ B;  3OYW A;  1UZZ A;  3PUI A;  3IPV B;  3GAL A;  1FPN 1;  2HWC 3;  4NHX A;  2WNV A;  5FLH A;  1VBC 2;  3P1I A;  3EB7 A;  1UIK A;  2D6P A;  3AFG A;  4L2N A;  4BK5 A;  3I59 A;  1W2A X;  3ZR6 A;  2RR1 3;  2V4A A;  1GLH A;  1XE8 A;  2FZ1 A;  2XH6 A;  5IWF A;  4CA9 A;  5DXD A;  5L9B A;  5FZK A;  5CU1 A;  1H2L A;  5F8P A;  3VL8 A;  2HWC 2;  5GLU A;  4YVW B;  1S0E A;  2QVS B;  4RHV 2;  3T2Q A;  4LO4 B;  2JD4 A;  3T2O A;  2DUP A;  4AOC A;  1NLQ A;  2YXS A;  1AJO A;  1E5S A;  4IER A;  5T50 A;  1RUF 2;  1DBN A;  4CXX A;  3SHR A;  5KHG A;  2J1S A;  4FQZ A;  4CEW A;  1S2E A;  3V0B A;  4LE4 A;  3ZYR A;  1WCD J;  2YBS A;  3ACL A;  4LXL A;  4XUT A;  2VTX J;  1OC1 A;  5HV4 A;  4XQ4 A;  4B8E A;  2GZW A;  2FQP A;  4K20 A;  5F6L B;  2W08 A;  2QNK A;  1Q5O A;  3ZDV A;  1W6N A;  5JZG C;  4KMQ A;  2BOI A;  2W68 A;  1CPN A;  1ZZ7 A;  4G4F A;  1W3X A;  5A6Z A;  4QQO A;  3N9O A;  4DZG A;  1IOA A;  2ZEY A;  4B4R A;  2A3W A;  2KR2 A;  2VQU A;  2GC0 A;  4MHU A;  3SEP A;  1KDK A;  3O1O A;  1V6K A;  4XAC A;  4P9W A;  1F5F A;  2KXL A;  1EV1 2;  5D8A A;  4LT5 A;  2A6W A;  4R9A A;  4AVB A;  4IUG A;  4HKO A;  1A6C A;  4CDU C;  4UOJ A;  2XHN A;  3O0V A;  5APA A;  1DF0 A;  2BWA A;  3FUQ A;  5GZF A;  5JVV A;  5SV8 A;  2ZZJ A;  3UGG A;  4P9X A;  1EYB A;  4CDW B;  3ZYI B;  2BNO A;  4D8M A;  4Q4X 1;  1PMJ X;  2YC0 A;  3CJI A;  4Y20 A;  2X05 A;  3ZN6 A;  3VD9 A;  3FC0 A;  2QQW A;  1LED A;  4PDW B;  2ZHL A;  4V2V A;  2A70 A;  3H42 B;  3HJR A;  4CU7 A;  5FRA A;  2PN5 A;  2DCT A;  2HWD 3;  1CAV A;  3AMQ A;  3JBG 3;  2VZU A;  4W8J A;  3ZOI A;  5B2G B;  1HB1 A;  2PHR A;  4LBQ B;  3AKS A;  4C90 A;  3P3P A;  5C3Q A;  2GNT A;  4XUP A;  1CVN A;  1JMU B;  1TMF 1;  3DEC A;  3VB9 A;  5A3M A;  1CJP A;  2HWD 2;  3AMM A;  4I0A A;  3JBG 2;  4Y22 A;  2ZCW A;  5DDJ 2;  3W9A A;  1GZW B;  1W99 A;  1PVX A;  2FBE A;  1N1S A;  1XND A;  4NR1 A;  2VTX A;  5FZB A;  4N9I A;  1J3R A;  1HRV 1;  1XNC A;  2LM3 A;  5FZO B;  1KDM A;  4RQP A;  1WBL A;  1JYN A;  4N43 C;  2VH9 A;  1ND2 A;  5GLV A;  1I5P A;  1SLC A;  2W1U A;  4U2A A;  4YG6 A;  3R05 A;  2YY1 A;  5J36 A;  5CFD A;  2B5H A;  4DS0 A;  1YHF A;  4ATF A;  3BUC A;  1RUI 3;  1QJU 1;  2FCT A;  3AP5 A;  1R09 3;  3ZSK A;  1UPS A;  2RS1 1;  4NN0 A;  1POV 0;  1YO8 A;  1SHW B;  2VVD A;  2XKO A;  4AED C;  1VBE 1;  2BZD A;  3WF0 A;  5I0S A;  5K0U B;  3WNP A;  1AHS A;  3MV1 1;  2FD8 A;  3IDB B;  2Q8C A;  1VIW B;  4Q0P A;  3SCF A;  2VMI A;  2BGP A;  1RUI 2;  1R09 2;  2ZX1 A;  4WBB A;  4J1W A;  4IV3 B;  1W9T A;  5DUX A;  1UYP A;  4UF0 A;  5FPV A;  3TB0 A;  3RPQ A;  1HKD A;  5CNA A;  5FMO L;  1YFW A;  1VBA 1;  1RUG 1;  3I2I A;  2OUJ A;  1RXG A;  2HWE 3;  1QQP 1;  1XNT A;  2VQT A;  4DOU A;  2YFU A;  3CIH A;  5CIS A;  4FFI A;  1OF3 A;  3KLS A;  4ITC A;  3TEY A;  2AGS A;  4LEJ A;  3BPS A;  2X53 S;  1C57 A;  1H8T C;  2X5I C;  4YPJ A;  2YZ4 A;  5F32 A;  2HWE 2;  3ZFE A;  1HRI 1;  1U5Y A;  4MXW B;  3IPV A;  3QOP A;  4NJ4 A;  1MZF A;  4LJH A;  1PGW 1;  5DZE A;  3ACH A;  1DIW A;  3III A;  4W6Y A;  2ZGN A;  4I01 A;  2VR4 A;  4LHS A;  1HB4 A;  2JIG A;  4A42 A;  1C1L A;  2R0F A;  4E4S A;  1W9F A;  4E2Q A;  2Y0O A;  3H1M A;  4AQS A;  4ASM B;  4QXB A;  2GP5 A;  2ZBJ A;  3J7H A;  1POV 3;  4LBL A;  1QNW A;  2VZT A;  4LIT A;  1US2 A;  3MFA A;  2ARC A;  4QMA A;  5KHH A;  4YVW A;  5BXX A;  3N7J A;  3N9N A;  1VBB 3;  3HQX A;  1PIV 1;  1H4G A;  4HXC A;  1ZRC A;  4OCT A;  1AR9 1;  1AX1 A;  3LF7 A;  4WM7 B;  2VU9 A;  2BWC A;  1GOF A;  1UPI A;  3WP6 A;  4DIQ A;  1XNA A;  1MEC 3;  2LUW A;  2AAC A;  2HKX A;  4LBJ A;  1RUF 1;  1DZT A;  2WO2 A;  2Q1F A;  3UT0 A;  2E33 A;  4GWI A;  2IXH A;  3JZV A;  4R52 A;  1V6N A;  1UCX A;  2XBO 1;  4CCK A;  1REF A;  3T1M A;  3NNF A;  4A6O A;  3BVC A;  1W0P A;  5LA9 A;  5LY1 A;  1R1Z A;  5A7P A;  4XAB A;  1GYK A;  3POJ A;  3PUS A;  3LD8 A;  4YW6 A;  4C0H A;  4K1Y A;  4XUR A;  4YGD A;  4D0Q A;  1JZ8 A;  1YLL A;  3M3C A;  5EFU A;  5AC9 1;  5C8W A;  4XDO A;  1HXS 1;  4CCL A;  1TE1 B;  4S2D A;  3GGL A;  4BH9 A;  2VNR A;  1PMH X;  3A0N A;  5CIR A;  2OX0 A;  2XJP A;  2PHW A;  5I0T A;  3MIE A;  3S57 A;  3SKV A;  4OQ8 A;  3DKQ A;  3CQO A;  4IGQ A;  5GM0 A;  3RG0 A;  2VUC A;  1EV1 1;  3RYP A;  4CDW A;  4HT1 T;  4Y3O A;  3SMH A;  1B35 C;  2OPK A;  4ZU5 A;  1C8M 2;  1QJF A;  4YVS C;  2VZQ A;  1XC6 A;  3J8F 3;  4IEW A;  1VB4 A;  3U1X A;  2C9K A;  1VBD 3;  3LQC A;  2ZHN A;  2D6L X;  4XIL A;  5F5A A;  5T5O A;  4BLI A;  2BVV A;  3ACF A;  3AVR A;  3AYD A;  1RYY A;  2OZJ A;  1K5M C;  5FMB A;  2GNB A;  1Z7S 1;  1UD1 A;  3CKH A;  4HFS A;  5FZF A;  3WP5 A;  4UFI A;  1HJF A;  5HCB A;  4F3J A;  4B7E A;  1V6J A;  3MYX A;  2PAK A;  3AYE A;  3W21 A;  1VBD 2;  4Q4V 1;  1DLL A;  4IEQ A;  2VZV A;  4XF3 A;  3RYR A;  3A4U A;  5FMO S;  5JPN B;  1HQL A;  3PMS A;  4L0P A;  2O14 A;  1YYN A;  1AX2 A;  3MEP A;  4K6B A;  3T0D A;  5FZL A;  5IK4 A;  5IVC A;  3H8R A;  1NAE A;  4LMF A;  3M3O A;  2VOV A;  3OBT A;  2ARE A;  5FZO A;  5DDJ 1;  5EXO A;  4XZP A;  3SH5 A;  1CPM A;  5LAS A;  4NHL A;  5CAD A;  1WCK A;  3EXU A;  4LBN A;  1SBD A;  1JYW A;  4ZZ5 A;  3VD5 A;  1VAV A;  1YEW A;  5FZI A;  2XJU A;  3ZSJ A;  1IGO A;  1FV3 A;  4LIU A;  1A8M A;  4IE7 A;  1NZC A;  3AM2 A;  3OTF A;  1WMD A;  1PNG A;  2DCY A;  3H7Y A;  4TLG A;  2WFF 2;  1QKQ A;  2E7Q A;  4NOT A;  2JG9 B;  5JXH A;  2VY0 A;  2XR4 A;  2VVF A;  5FP7 A;  4LPL A;  2EIB A;  4ZU7 A;  1K3I A;  1TME 1;  4AW7 A;  5HCF A;  3O12 A;  4IV3 A;  4YG3 A;  5F3E A;  4P00 B;  2WSV A;  3ETP A;  3ZXF A;  1PZ9 A;  2WNV C;  1R1A 3;  1OLQ A;  1DQ5 A;  2Z5W A;  3B93 A;  4QHB A;  2FDJ A;  1O59 A;  1DDL A;  2VBP A;  3V65 A;  3WUD A;  4XDP A;  1DZR A;  4UXA A;  1IKQ A;  2ZKN A;  3ST7 A;  4UBG A;  4MGK E;  4QPG B;  5FLI A;  3VBO B;  4YSF A;  4MAD A;  1PO1 1;  4QT6 A;  4XF4 A;  5FYZ A;  4IGP A;  4PI2 A;  3T2P A;  3O0W A;  5BY5 A;  1VRH 2;  2XON A;  2DTY A;  2A6V A;  2R06 2;  3FHI B;  4RN5 A;  2R1B A;  1J3Q A;  3HN3 A;  3VL9 A;  4CEW C;  3THD A;  3HN1 A;  1AYM 3;  1E5I A;  1RUJ 2;  3KSC A;  1IPK A;  3MID A;  2FCV A;  1P8J A;  5IK5 A;  3O1M A;  4IET A;  3BTZ A;  2YUE A;  4OHV A;  1YQ2 A;  3VZL A;  1WA6 X;  5F2W A;  2JJ6 A;  3R4S A;  1DP0 A;  1SBF A;  3T1L A;  2RDS A;  1KJR A;  2PHT A;  1G9C A;  1Y9G A;  3AKT A;  2JXA A;  3AKP A;  4FI9 A;  4YM2 A;  4HLT A;  1X7N A;  4UW6 A;  4FTB A;  1OFS A;  3VN4 A;  3LEI A;  4AVV A;  2J7M A;  3WVJ A;  3I2G A;  4WM7 A;  4Y5Z 0;  5C3S A;  4KG8 A;  4QDQ A;  3KT1 A;  5FP4 A;  4Q8L A;  4BA6 A;  3KVA A;  5FY9 A;  4GB3 2;  2ZGT A;  4QDS A;  3AYA A;  4BQX A;  3WQ7 A;  1W6Q B;  2RVA A;  1OFN A;  2W91 A;  4XJU A;  4EZ4 A;  4LQR A;  4NRQ A;  1UXZ A;  1YIP A;  2ZGL A;  4E2G A;  2GC3 A;  2WZE A;  3CJI C;  4LUL A;  3VBF A;  4F8A A;  4D7T A;  1DGW X;  1H9P A;  2VZ3 A;  3SIT A;  5FOB B;  5IFT A;  1CAU B;  1SFP A;  2VOK A;  5ABJ C;  1SLT A;  5FFO C;  1CWP A;  2C6S A;  2HJI A;  3WDV A;  2GNM A;  4IW3 A;  2O0O A;  4MGT A;  3CMG A;  4M0N A;  1JOP A;  4YW7 A;  5LBE A;  1RUH 1;  2ARX A;  5CFC C;  3GBG A;  5LEK A;  3ZXA C;  1QH7 A;  2RG4 A;  1C28 A;  1LRH A;  1UKR A;  1UOJ A;  1WLD A;  1RHI 2;  2WJS A;  3FHA A;  1K12 A;  1JZ5 A;  5FKB A;  2QUO A;  2XKP A;  3A21 A;  4RQP C;  4XMI A;  3QH6 A;  4W65 A;  5A1L A;  4I0W B;  5CFD C;  5FYM A;  1XQN A;  2Y6G A;  4FPJ A;  1G9A A;  1BEV 3;  3JCI A;  2QFE A;  1WZX A;  5AFE A;  3LB9 A;  3WXP A;  3RFR A;  4I3G A;  2UWB A;  3C7F A;  3LIG A;  3E6B A;  2D6M A;  3HD8 B;  2DBI A;  4RL7 A;  2ILM A;  2ARB A;  2VZP A;  3MW2 A;  4LK7 A;  3VBH B;  2WNO A;  4UFL A;  2VOW A;  3GDB A;  3OB8 A;  4NIG A;  3VDC A;  2WRA A;  4YNI A;  2MEV 1;  1HW5 A;  2ET1 A;  1WW6 A;  3S0M A;  2ZXQ A;  2A5Z A;  1NA1 A;  2VNV A;  1RUD 3;  3GF6 A;  4CCN A;  1N1Y A;  3KHB A;  1UY1 A;  5FUP A;  1GAN A;  3LKJ A;  4Y1X A;  1S0B A;  1DHK B;  1STM A;  2YGL A;  1OUX A;  2YB7 A;  3N7M A;  4CU8 A;  2DVG A;  4GKY A;  2IWG B;  4HET A;  4F7Z A;  2P4E A;  5FXZ A;  2QZ3 A;  4AI0 A;  3NWK A;  4I09 A;  3LDR A;  4AVA A;  1W6O B;  1I6X A;  1TZO A;  4PLM A;  2VNG A;  4CE8 A;  2IFR A;  3I2H A;  2WAO A;  1RUD 2;  3PTY A;  4DFS A;  2RE9 A;  5CZK A;  3LSE A;  2ZX4 A;  3WEZ A;  2JG9 A;  4LKF A;  4XFG A;  4CCM A;  4XFC A;  1F2N A;  3AXD A;  3WP3 A;  4BQ2 A;  1FMD 1;  4COV A;  2PFW A;  1AZD A;  3GZA A;  1DG6 A;  3NO8 A;  5ACA 2;  4LLF A;  4DUW A;  4JKL A;  4RYD A;  3MIB A;  4FP2 A;  3AP7 A;  4AQ6 A;  1OH4 A;  5GLZ A;  3BIE A;  1W03 A;  4I30 A;  2VGD A;  1NE4 A;  1IG3 A;  1ODN A;  2WWS A;  3D8C A;  3PUR A;  4QPY A;  2BBV A;  3N9Q A;  5JR7 B;  2CTV A;  4FFF A;  4JDN A;  4QXK A;  2QE3 A;  2XB6 C;  1H0B A;  1FI2 A;  1VLN A;  3PVB B;  5DUU A;  4PCR A;  4YVW C;  3VBO A;  1IQA A;  2HWF 1;  1Q3E A;  2UWC A;  4QPG A;  3WW1 A;  4GMP 1;  1JYV A;  2TEP A;  2XOM A;  5C4W B;  4MOA A;  4PIX A;  3ECQ A;  3K2O A;  1W6P B;  3ZKU A;  4E4Z A;  3ACI A;  1BVV A;  1ZRF A;  3RDI A;  5F2S A;  4BPZ A;  2G9F A;  1S0J A;  3HNY M;  4QB6 A;  4KWL A;  2E7A A;  4EWD A;  4JVA A;  1F8V A;  2XUM A;  4FXK B;  1JYC A;  2Q5T A;  1SMV A;  2ZGQ A;  3QLQ A;  4QKB A;  1JS9 A;  1FT9 A;  2VZR A;  1QIQ A;  1RUJ 1;  2J1U A;  3ZMN A;  2DU0 A;  4CDX B;  4CRQ A;  3CZJ A;  2RM2 1;  2SBA A;  5FP8 A;  1APN A;  2HWB 1;  4DY3 A;  2IVI B;  2GAL A;  5BNP A;  1V6I A;  3C3V A;  4WM8 B;  5IVY A;  1SLB A;  4UT5 A;  3UKV A;  4YZ2 A;  1RMU 3;  1RUC 3;  2JE9 A;  3KM5 A;  3LCP A;  5IVJ A;  4Q4Y 3;  3ZYP A;  1WD3 A;  4AXO A;  2R30 A;  3SCG A;  1W6Q A;  1OBN A;  4N9H A;  5KWR A;  1XE7 A;  1KRI A;  4CDW C;  4O9E A;  2X29 A;  4PI0 A;  2VC9 A;  3I2F A;  1RMU 2;  1RUC 2;  1CAX B;  1RUE 3;  2UUR A;  3JD7 1;  2RJL A;  1BMV 1;  2WNU A;  3BU0 A;  4PDW C;  3NQH A;  1AJK A;  3H3U A;  4FPK A;  1CAU A;  4OQ9 A;  1QXR A;  4QX1 A;  1D7P M;  4H7L A;  3DF0 A;  4Z2A A;  3WLU A;  1ZBA 2;  1AR6 3;  4BIF A;  4YZ1 A;  1UZ0 A;  3ZPO A;  2WNE A;  4NRP A;  3GHM A;  1SCS A;  3WY6 A;  4P08 A;  2A1X A;  2IXL A;  4XBQ A;  2H6C A;  1OHF A;  4JGZ B;  4XJW A;  4DEQ A;  4ET7 A;  3VBS B;  2D3P A;  2FCU A;  1GOH A;  2WAB A;  3BAL A;  5EYX A;  2VCM A;  3J7N A;  5FXW A;  4NPL A;  5B4X A;  5F9T A;  4TXW A;  2B4K A;  4XF0 A;  1A8D A;  1KD7 A;  3I7D A;  3MW4 A;  4KQ7 A;  4MET A;  2LRO A;  4KBZ A;  1FOD 3;  3WV6 A;  1QDC A;  4BYY A;  3SNM A;  3SKJ E;  3K46 A;  4HK9 A;  1F35 A;  2C24 A;  2P34 A;  5SV5 A;  1GQH A;  1GNH A;  1MAC A;  5L19 A;  1L7L A;  3ZYG A;  5KHJ A;  1EPW A;  3NNL A;  2FDI A;  1WUV A;  4AZZ A;  3M3I A;  4N8M A;  4NRO A;  3D0S A;  1S0F A;  4Q0S A;  3AZY A;  4XHB A;  3H3L A;  4QU1 A;  5I0U A;  4AFD A;  5K0U C;  1MQT C;  5C3O A;  1BXH A;  2BP6 A;  1OD3 A;  1XYP A;  2D97 A;  3WNM A;  1UN1 A;  1TNR A;  2VM9 A;  4B7K A;  5A3P A;  5K9Y A;  4Y1V A;  2PMW B;  2CWS A;  5IJR A;  4TN7 A;  5A1F A;  5FCC A;  1N3Q A;  1ST8 A;  4KNC A;  5JUV A;  4OI0 A;  4CUB A;  5J1X A;  1UMZ A;  3V0B B;  4IV3 C;  1AR7 1;  3EO6 A;  4LOT A;  1RVF 1;  1J83 A;  5DUW A;  3S5A A;  4N53 A;  2DVA A;  3MI8 A;  2EIG A;  4P9Y A;  1HV0 A;  1QOO A;  3OGV A;  4HOO A;  2YPJ A;  4R4X A;  2R04 2;  1E57 A;  1W6O A;  4OI1 A;  3HOB A;  3VZO A;  5IVE A;  1HIX A;  3TN9 2;  2JIJ A;  3NKG A;  1UZV A;  3NMB A;  5FZA A;  3RI8 A;  1LGB A;  3MLL A;  4XJ8 A;  4QM9 A;  3OOX A;  3AZZ A;  1MS9 A;  4M3C E;  1ZM1 A;  3KCY A;  3AP4 A;  2Z42 A;  1N47 A;  1AF9 A;  4YW4 A;  4Z82 A;  3HEI A;  5FY8 A;  3OSD A;  5D8A B;  3SXW A;  4BME A;  3UYJ A;  3OG2 A;  3U10 A;  3UJQ A;  4XPV A;  3WSO A;  1V70 A;  4IEY A;  5LA0 A;  1W8H A;  4A6S A;  5F37 A;  2H0B A;  3HQU A;  1K5J A;  3MLJ A;  4KGQ A;  1RIT A;  2RS5 3;  3G6J B;  3ENR A;  4Q4X 3;  3HVD A;  3UKT A;  1CX1 A;  2XJT A;  3KD4 A;  5FDB A;  1ND3 B;  3FBM A;  2PLV 2;  2VMG A;  1W6P A;  2ZML A;  2FDK A;  2Y8K A;  3A0K A;  4WM7 C;  2WR9 A;  1PGL 1;  3LDK A;  1CQ9 A;  1TEI A;  1G86 A;  4Q0U A;  4KU7 A;  5FPB A;  5JXI A;  3ILN A;  1RB8 G;  2NP0 A;  3FFQ A;  5GLT A;  1SDD B;  2RS3 2;  2W46 A;  2W52 A;  1KFX L;  1PVC 1;  2G19 A;  3J7L A;  1LES A;  4Y22 B;  4CDX A;  1QJY 2;  3H1W A;  1T6B X;  4RFT 0;  5JMO A;  1OQD A;  4YFZ A;  2B9U A;  2QQO A;  4JC1 A;  1JYT A;  2BBA A;  1J1T A;  2JE8 A;  4WM8 A;  2QQJ A;  2WWU A;  3ZN4 A;  1ND2 B;  1RIR A;  2J22 A;  1HRV 3;  4XJZ A;  3N9L A;  1C3H A;  2Y26 A;  4WVW A;  2BU9 A;  4Z1V A;  1H1M A;  1VAL A;  3ILR A;  4OZX A;  1R08 1;  4R9B A;  3ZXG A;  4HL0 A;  4UW3 A;  4BLJ A;  4JX0 A;  5KXE A;  5KXB A;  5AVA A;  4D6R A;  1FAY A;  2FMY A;  3KCC A;  5DAP A;  2W47 A;  5FRE A;  1CAX A;  2WC2 A;  3B69 A;  3KT7 A;  4W50 A;  5FZH A;  5IAT A;  4E8D A;  1NY7 2;  2L9L A;  1LOF A;  2GC1 A;  3OBR A;  4ASL A;  3AL6 A;  3KV4 A;  4YFW A;  4KWK A;  5A6X A;  1GR3 A;  1T2X A;  1HQN A;  1V0A A;  4UF0 B;  1JH5 A;  2GMP A;  2WQ8 A;  2W1Q A;  4OMD A;  1I9R A;  4AAP A;  1IZ3 A;  1OPM A;  3AZV A;  4CUG A;  3B94 A;  1VBA 3;  4JGZ A;  1ZBA 1;  2GAU A;  4K9S A;  3I3M A;  3HBZ A;  3VBS A;  4RSU A;  1IKP A;  1BVP 1;  1QQP 3;  1Q8P A;  4K8R B;  1OUS A;  5C8C A;  3JB4 C;  2ZGR A;  1B09 A;  5DMY A;  3HR9 A;  2W3J A;  1D4V B;  2R16 A;  2YYO A;  4BQ5 A;  1DCS A;  1EUT A;  2BRT A;  1CN1 A;  1ULF A;  1QEX A;  1CJD A;  4J1X A;  1Y43 B;  1EAH 3;  3T0B A;  2RJ2 A;  1IS5 A;  2TBV A;  2W1W A;  2QCS B;  1HRI 3;  2J1A A;  3GZU C;  3B00 A;  3NJY A;  5LWB A;  2D3S A;  4O65 A;  3JUU A;  1YQ8 A;  4M00 A;  1AR8 1;  2AZ5 A;  1COV 3;  1CZT A;  4QQH A;  4EN7 B;  1EAH 2;  1QWR A;  1X8M A;  3AMP A;  4LTA A;  1ZBE 1;  3EBR A;  5FYT A;  4IV1 C;  3P6B A;  3UJO A;  5FWJ A;  1ZZ6 A;  1Q8Q A;  1QJE A;  3K3N A;  4AHW A;  2JG9 C;  4XUQ A;  2KA3 A;  3VDB A;  2Y6K A;  1CGP A;  1X9P A;  1V9U 1;  4OVE A;  4P9L A;  4X6R B;  4AHX A;  3H8X A;  2RR1 2;  1JOD A;  4S2G A;  5EYY A;  2XGX A;  4NII A;  3B01 A;  1Q8S A;  4W6X A;  4Q4W 1;  3WNN A;  5FY5 A;  2VG9 A;  5T54 A;  1FYU A;  1VMF A;  5E8A A;  5C9A B;  5I0D A;  4M3C B;  4FAH A;  1V00 A;  3VZJ A;  5FMC A;  1V6L A;  1JZ3 A;  3FWE A;  3KF5 A;  3WP4 A;  1JHJ A;  4IGO A;  3ELN A;  3IBM A;  2VBB A;  4HON A;  3NAP B;  4QPG C;  1MPX A;  4JQT A;  3VBO C;  4AQ2 A;  2NPI A;  1D0G A;  4LKD A;  4HZF A;  3RWK X;  1L3J A;  5EV7 A;  1DFQ A;  4JHT A;  5AC9 3;  4KWU A;  5ANN A;  1WW4 A;  2GND A;  4V1P A;  5HV0 A;  3HQR A;  2WN3 A;  2VAU A;  2ZGM A;  3MUZ 1;  1NXM A;  1QF3 A;  3C2U A;  4JKK A;  3WCR A;  1CES A;  5E16 A;  5LW9 A;  2ERF A;  3HIF A;  2PHL A;  5DG1 A;  4JZR A;  3Q8C A;  1XJA A;  5HPO A;  1NYW A;  1HB2 A;  2RDR A;  1VE0 A;  4LOR A;  1DGL A;  5FJH A;  1ASJ 1;  1XU1 A;  3KQR A;  3SCH A;  5K7P A;  4RFR B;  2HEV F;  1IPS A;  1MVQ A;  4LOS A;  1BBT 1;  3DV8 A;  5BUV A;  5FOJ B;  1ND3 A;  5G05 L;  3WZ1 A;  2R32 A;  3VD3 A;  3IDC B;  2R07 3;  1WLW A;  4FVV A;  1OLM E;  3VZN A;  2VUJ A;  4R8H A;  3NJV A;  3WHT A;  1Z7S 3;  1MZ6 A;  2VL4 A;  4FPF A;  3ITQ A;  1F9K A;  2RMU 3;  3NNM A;  2DWR A;  4Q4V 3;  4AL9 A;  4COZ A;  2R07 2;  3D82 A;  3AP9 A;  4O9G A;  1AYN 1;  4N90 A;  3W59 A;  2Z2S B;  2RMU 2;  4P9I A;  5FY4 A;  1QJY 1;  2WO3 A;  1LNS A;  2ZOE B;  3AXE A;  5K8S A;  2ZA9 A;  1QHD A;  2LAL A;  3LE0 A;  4FT8 A;  5FY7 A;  5LA2 A;  5C70 A;  5HI0 A;  1ZRE A;  2PQS A;  2XLF A;  3J4U H;  5FKC A;  5IAV A;  2JB4 A;  2DDU A;  1UMH A;  1J3P A;  1ZRR A;  3OUH A;  2Q4S A;  1DQ4 A;  2HBU A;  4XFB A;  3K3O A;  1F5J A;  1LU2 A;  3WG1 A;  2RHP A;  3FL7 A;  3LFI A;  4M0H A;  4XIO A;  1OA2 A;  1NCQ A;  2HBT A;  3HT2 A;  5FLJ A;  2D5F A;  2ENR A;  1W28 A;  5A70 A;  2EIE A;  2AR6 A;  3AYC A;  4MO3 M;  3WDU A;  4COY A;  3IT8 A;  3HBK A;  2DF7 A;  3NV1 A;  1AXZ A;  1TME 3;  3ZR5 A;  3HAG A;  1NKG A;  2VCC A;  4JKM A;  5T3N A;  5TSW A;  3S30 A;  2VUA A;  4QGN A;  4QX0 A;  2WSU A;  4UAP A;  1DZQ A;  1XXN A;  1S0C A;  2I45 A;  2I74 A;  2OYZ A;  1W9Y A;  1D4M 3;  4D6S A;  2V72 A;  3PHM A;  2F4L A;  4A7Z A;  3TEX A;  2YGM A;  3AZX A;  3O5S A;  4D7Y A;  3VBH C;  3U14 A;  1WCQ A;  2Z4F A;  3VKL A;  3ZFF B;  1XE0 A;  4B1L A;  4PLN A;  3KV5 A;  1D4M 2;  1FAT A;  4HMZ A;  4ZU4 A;  1JUI A;  1HJG A;  3KVB A;  4N7U A;  2ATF A;  3E97 A;  3N36 A;  4FOV A;  1FNZ A;  3I3D A;  4E2S A;  3DXU A;  3PUH A;  2WWJ A;  4QKN A;  3AVS A;  4ES9 A;  3WF3 A;  1V6O A;  4RR3 B;  1AL2 3;  1VBC 1;  4ISQ A;  5KXD A;  2QQN A;  3B02 A;  1LHN A;  3VZK A;  5J98 B;  3ROU A;  1GZT A;  2GMM A;  2IVJ A;  5C3P A;  4NPM A;  2UY8 A;  2XHK A;  4ZY9 A;  2HWC 1;  1IS3 A;  1DQ0 A;  1FNY A;  1UO9 A;  1YQ6 A;  2QDN A;  3PUA A;  4GJY A;  4IXL A;  1AL2 2;  3K4D A;  4RHV 1;  3T0A A;  3ZXE A;  1Y9Q A;  3B5L B;  1A34 A;  2RR1 1;  4B4P A;  5LB6 A;  5C9A A;  1C4R A;  1VBB 2;  1GIC A;  1ULP A;  2K0G A;  3BTA A;  4M3C A;  2EXK A;  5FYH A;  3VBR B;  2IXJ A;  4LNV A;  5JOZ A;  2VOT A;  4LO6 B; 
#chains in the Genus database with same CATH homology
 3POJ A;  4LOR A;  1SZB A;  1SPP B;  5CIS A;  3POE A;  4LOT A;  4GZ9 A;  2QQO A;  3POG A;  2WNO A;  3KQ4 B;  4LOS A;  2QQL A;  1NZI A;  3POI A;  1NT0 A;  3POB A;  2QQM A;  5CKN A;  4LMF A;  5CKM A;  5CKQ A;  1SPP A;  2QQK A;  1SFP A;  3POF A;  3DEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...