4I09A

Structure of the mutant catabolite gene activator protein v132l
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
204
structure length
204
Chain Sequence
PQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKLGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 58
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i09A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i09A01
5LHGA 1YYVA 3I58A 2O03A 2VN2A 5CU1A 2R3SA 3E5QA 2TDXA 1ONVA 3CJNA 1WGPA 3ELNA 3L00A 2Q0OA 5CVRA 2IPQX 3MZYA 2XLGA 4A6DA 2IXLA 4EGYA 1LDJA 2UY8A 3H3UA 3FZVA 3BP8A 4M71A 1CF7A 3LA3A 3QU3A 5HS9A 3K0LA 3B02A 4HZFA 1SD6A 1R5GA 4B8XA 2LNBA 1SFXA 1ON2A 4EM0B 1JUHA 2CFXA 2DK5A 3CO7C 4I09A 4RB1A 4HF1A 3IKTA 3KZZA 4PZJA 1U3EM 2Q0AA 2GXBA 3L2CA 2UY9A 2PJPA 2DFIA 5K8SA 1W7PB 2EV6A 3KFWX 4MEXF 5FO5A 3F6VA 4IETA 4MTDA 2CO5A 2Q30A 4WBBA 1QNTA 1FYKA 4EM1A 1FT9A 3V7SA 4HLYA 4XFAA 2FQPA 4MNUA 2GC0A 4PCQA 4MEYF 3LA7A 2BGCA 2XAJA 2OQGA 2G7UA 1ZAOA 1J59A 1PP8F 1OYIA 5ED4A 2XL9A 1BI2A 1P2FA 4ESFA 4HA8A 1IN8A 4IJAA 4BYYA 4DNCA 1R1VA 1V3FA 4CGZA 1EH8A 2H27A 2W84A 2Z33A 2P6SA 1CAVA 2RGVA 3DP7A 4M9ZA 3J81Z 3GUDA 3TDZC 5ERIA 3EDPA 4LGWA 3U10A 2Q1ZB 4P9FA 2P7CB 4G7OF 3SHRA 3BJ6A 2Z69A 4OFGA 3RI4A 4ZYHA 2Y0MA 5LHHA 5D4SA 4CHUA 1ZN2A 4BIFA 4PIZA 2XIGA 5E20A 1QO0D 1FPQA 3AAFA 4YSFA 2A61A 3FM5A 3KP7A 1UIKA 2XGXA 5EEGA 2EA2A 4MUVA 1SQ4A 2RVCA 3QPHA 1J58A 4Q0QA 2DBBA 2VXZA 2IXHA 1R1TA 1TQ5A 1EP0A 1QBJA 5C6CA 1YFYA 2PFWA 2NAZA 1X7NA 4B29A 1MDMB 4EROA 2MPFA 1PM7A 1ON1A 2X4HA 3BROA 3OF1A 2MLGA 4BHPA 3CO6C 4I0AA 3PNAA 2VBXA 3F8CA 1R36A 2W24A 1CX4A 5IT3A 1XSDA 5T3NA 3USSA 2GQQA 2Y48A 3GFMA 1F1ZA 3FMRA 1Z9CA 2XKPA 1FYLA 4MQVA 3P9CA 2MHFA 3I54A 4EJWA 4WXCA 1YTYA 2JSCA 1P4XA 4LUKA 3BPXA 3BALA 4RD7A 2XROA 1H9GA 4YFXF 3H7YA 3T1BA 3C1DA 4S05A 5FQ0B 2EV5A 3RIRA 3ZPLA 3TNQA 3HSEA 3ISPA 1GQGA 4MH0E 1YO5C 4QMAA 2PAEA 1ZRDA 2OYZA 2Z3YA 5EZWA 4LG0B 2BE5F 1H0MA 2VC0A 3HTSB 2L54A 5FB2A 1UB9A 1BN5A 4E70A 2XLFA 2ET1A 3IIAA 1SEFA 1O7FA 3WGHA 2PAKA 2O0YA 4LTAA 4MV2A 3ZDSA 3GFLA 5E1ZB 2JT1A 5D6FA 4GYGA 4L9VA 1U5TC 4P5OA 3K1MA 5DCMB 3HOSA 5KVRA 3WW2A 5AVPA 3UKTA 2HEOA 1TNTA 1KU7A 4OIOF 1PMIA 2VT3A 1QXRA 2BBYA 1RGSA 4U0YA 2MNGA 3RKXA 1ZZ8A 4IESA 1F4KA 4A0XA 4DQ2A 4XEZA 2E7WA 3SCHA 3CDHA 3H7JA 2Z5UA 2XHKA 1CAXA 3QAHA 3K69A 3RPQA 3OOPA 2HYGD 5I0RA 3EJKA 2ET7A 4GGGA 1H1IA 1IZ1A 2VBYA 3CEWA 1RUNA 4QX5A 4G7ZF 3M7GA 4OLLA 4L5JA 4QGMA 6PAXA 3ML6A 2FSWA 3FXQA 4I2OA 4XLPF 4WZCA 1FLIA 3SZPA 3WW1A 3P9KA 2QLZA 4AQ6A 3OTFA 3JAMK 2ETHA 5BPDA 1DUXC 2ZO4A 4FT8A 1R58A 1YLLA 5L3CA 2STTA 3RYRA 1ZYRF 3OV8A 1YFWA 2UZKA 2ZKLA 2K4JA 1BJAA 3S7IA 1DDNA 4QXKA 2W25A 2JPCA 3HT2A 1FNNA 2EFOA 1IXSB 5D6EA 4FHTA 3GYDA 3CL1A 2QCSB 2VECA 1H1MA 4IERA 1PUEE 2OA2A 4QGNA 5HLHA 2BNNA 4HQMA 1J3PA 3HSFA 4A0YA 2IA1A 3MWMA 2JPBA 1YG2A 4LD5A 1D5VA 1CAUB 3IWZA 3FX3A 4OMZA 4ZYEA 1S8NA 5LEKA 3JSPA 1L3LA 3VODA 1T98A 1WSUA 2Z2SB 5F1RA 1HW1A 3KEOA 3Q9VA 5FD6A 1SD5A 1IUYA 2RC4A 5IT9Z 3ZP5A 5DDGA 4EJTA 3J81K 3LZZA 4ESBA 4RGUA 3P7NA 1REPC 3D0SA 2JRTA 4IRHA 3B73A 3KEQA 3IDCB 2FNAA 3GVAA 1ZRRA 2Y0OA 1FP1D 1ZLJA 1XSXA 4UV8A 5ICFA 5JAXA 3SFZA 4NQWA 4O9EA 1BBYA 1LR5A 4PIXA 4ZZLA 3L2HA 5I93A 5I0UA 4ONUA 1SFUA 3P9IA 4L18B 1KYWA 3PVBB 2HGCA 3LAGA 1KQ8A 4R1HA 4F7ZA 3WTTC 1IXRC 2EWNA 1S6LA 1R5HA 2YR2A 2L4MA 5FFZA 2DW4A 4KMFA 3T8TA 3M70A 4JK1X 4GULA 1FBSA 1C0WA 2IT0A 2K9ZA 4E2QA 2H6BA 1NHAA 2UYAA 2W57A 4R79A 3PLQA 4IEUA 1UCXA 4LK0F 5A2QZ 5D1IA 1K78A 3EYIA 4A2UA 2QENA 4KIGA 1EV7A 2HFHA 3SMHA 4ENJA 4KT5C 1VJ2A 1OYWA 2K27A 3MCZA 4G9YA 3MQ0A 3RYPA 1P6RA 1XSVA 4UVBA 3PFIA 2F5EA 5D8LB 3E6BA 1SMTA 2PBIA 2DI3A 4R52A 3FWEA 4LJZF 1D8KA 2YPRA 1USSA 3CF6E 2ELHA 2FMYA 3R61A 2BYVE 4JTNA 2D1HA 4MTEA 3U0ZA 4WXDA 4CZZA 1ZHFA 2EV0A 1J3RA 1KA8A 1KQ9A 2GA2A 4Q5SF 1S7OA 1ZZCA 4Q0SA 1FY7A 5JCTA 3ES4A 4ENMA 1TQPA 4EJUA 3ZMTA 2OD5A 1G3YA 2XAQA 5L3DA 5E8IA 2CQKA 3FFQA 4IEQA 2K7LA 2CW0F 2VC1A 2P5VA 3WW4A 4LK1F 2OBPA 1XRUA 4L9NA 4ESJA 4A0ZA 4MGRA 4GXOA 1TW2A 2NYXA 1S29A 2EFQA 2ESNA 4G94A 3L09A 3WE2A 4G6DA 1F9NA 4EWEA 3O2PE 5BPIA 3K2ZA 4M9SA 4XF0A 2LKPA 1ODDA 1X3UA 2G9WA 2RKHA 1Q3EA 4HV6A 3ECHA 3HRMA 4UUVA 3T5XA 3QRFF 1EH7A 3V8JA 3HT1A 4HYEA 1ZRCA 2QM3A 2A3SA 2IVMA 3WTXC 4ZU5A 1X82A 1DP7P 4KICA 3F8FA 3EYYA 2V1DA 3KCCA 4RGSA 5DV5A 3WU0A 3C3VA 4XF4A 1G3WA 3BJOA 4Q29A 1DZRA 4KL1A 4M6XA 4A5MA 2OU2A 4O5VA 4AIJA 3L7WA 1UHMA 2MD5A 4ENKA 1GXQA 2RV8A 1TQIA 3EUHA 1UCRA 3IL2A 1USTA 4KU7A 1HKSA 1BI0A 2AXLA 1IN7A 5KHKA 2CYYA 5LLQA 2XLAA 3KP3A 2V1UA 3NW4A 5FLJA 2R7DA 3NSTA 4RS8A 2O1QA 1UW8A 3JTGA 2QQBA 3ERED 1FZPB 4DINB 2PI0A 3LAJA 1SAXA 1IRFA 4HF2A 1WQ2A 1P4WA 5H6QA 4HVRA 1UHWA 2IXJA 3LA2A 4KWKA 3HYIA 1Z91A 1D8JA 1SD4A 2EFWA 3KP4A 4Q4ZF 3HRTA 3SXWA 2GC2A 1RL3A 4KN7X 2HOEA 4KIFA 3OD0A 4Q0VA 4BQAA 3GO5A 4Q47A 1MDMA 1IXCA 2P5KA 1NXMA 1FBQA 3DN7A 3HQXA 3H8UA 3NKTA 5E18F 2Y75A 2OAZA 4ASNA 1SFEA 2CSOA 2L3DA 1ZG3A 4XFCA 2O3FA 4HF0A 1FXZA 2BNOA 3TNPB 2A6HF 3SXYA 1I6XA 5LGUA 5IT9K 2B8MA 4EWAA 3J7AO 2HDCA 2B9UA 1YHFA 5FCCA 3I59A 4PGGA 2E7XA 5ILVA 2ZCWA 5DD8A 3NVCA 3IRRA 2HQRA 2DU9A 1LJ9A 3I7DA 2HS5A 3ZMUA 3FHZA 4LG0A 3BB6A 5EEHA 3WTVC 2PLYA 4FBFA 4L0YB 1JHHA 4WX9A 4QLCU 1TNSA 4LLGF 1HKTA 4MHGA 3ZMSA 1WA4A 2ZFWA 2QNKA 3M8FA 2XAFA 2PHLA 3MPBA 1FWZA 1YS7A 3QACA 2QWWA 1XGMA 4KYWA 3L9FA 3SCFA 3VHRA 1U78A 3V8KA 1T6SA 4ZYDA 1O4TA 1T39A 4HN1A 1CF7B 3GX4X 1JXSA 2XL7A 2ZBKA 3R4KA 1S7AA 2GU9A 3CLOA 5LGNA 1T38A 3M9AA 4OU0A 4ETSA 3H50A 3KGZA 3J80Z 4LB6B 5A2QK 1QWRA 3BU7A 2COMA 4GYIA 1LQ1A 1ZVFA 4HSLA 2ZMEA 2L02A 4UXAA 4WXHA 5DYMA 1P92A 4ENNA 4XF9A 1Y3TA 4H0EA 4UXNA 2F5FA 4X6QB 4ZZDA 1F5TA 4EM2A 3MFKA 4YRDA 5J48A 4L2NA 4HVOA 1KU2A 1L3JA 1B9NA 1O5LA 5H20A 2YSRA 3PQKA 3TGNA 5BOXA 2D93A 2VE8A 3K1NA 3F22A 4MGYE 1J75A 1T2KA 2F2EA 1Q1HA 1IRGA 1FI2A 2FXAA 2UXXA 1CAVB 3ECOA 4RGRA 2WWYA 2QBYA 1P4AA 2VBZA 3IRQA 4J1XA 4Q0UA 2XV4S 5I91A 1W4MA 1XGSA 3QP5A 2P4WA 3TOBA 4D7TA 1U8RA 1DPUA 2Q8KA 3ELKA 1NYWA 2LDUA 1TBXA 1E17A 3E5UA 1U5TA 2DQRA 4YFKF 2M45A 2YU3A 2A69F 3ABTA 4IEOA 3HUGA 3QOPA 4HDUA 1BC7C 2IXIA 3V8LA 1EH6A 2JTVA 1IW7F 3HHGA 2GA1A 2VE9A 3GZ6A 3HOTA 3RPUA 5CVIA 3ZN1A 2IP2A 3TDUC 2PG4A 3CUOA 5ICGA 3FZ3A 3W6JB 2IJLA 1PP7U 5KBFA 1R23A 3DFGA 3ULQB 5D5UB 1GQHA 2D2WA 5KHHA 2EAAA 4H7LA 1LEBA 4JV4A 1HBXG 1HW2A 1XCVA 1BIBA 1O3RA 4FAHA 3KP5A 5HVQC 3E5XA 2PHDA 2C6YA 3DQVC 3F21A 3DEUA 5KHJA 4M9XA 4LLLA 2Z9OA 4O6JA 1ZGJA 2KXLA 3ST7A 2NNYA 3LWCA 3FMQA 3OCPA 2OPKA 2O6GE 4M73A 4HW0A 5JI6A 4IF4A 1HXDA 4BXUA 3WE3A 1LB2A 1AWCA 2IW5A 3KLOA 1OPCA 3SQNA 2XAGA 1QXJA 4PGHA 4WWCA 1RTVA 2O8XA 3WODF 2K4BA 2QZ8A 2M30A 1HSJA 4X6RB 2PMHA 4I3PA 5H6RA 4CICA 4AD9A 4BHBA 4U0WA 4MQ9F 5DUKA 1B1BA 3KMHA 1X8EA 5L3FA 1SMYF 1B6AA 4IHSA 5CVVA 4G7HF 3F6OA 3T0YA 5JVTA 2VOPA 5FGMA 2C0ZA 1CAWA 4N9HA 4MX3A 5HI0A 3EQEA 4UV9A 5D8KB 1IPJA 5JR7B 1U12A 4L0ZB 2A6EF 3GWZA 3KETA 4LUMA 3WTYC 3KP6A 4XFFA 2E1NA 1W5SA 1HQCA 3GLXA 2GC3A 4AVPA 5FLXZ 2FEZA 4RB2C 4I7HA 3N97A 2XRNA 1YFXA 4OOIA 1CAXB 2MC3A 1YFUA 4WF2A 2I45A 4N0BA 5BS6A 3K1PA 1JE8A 4EQQA 4JTOA 2MH2A 2HKOA 2ZJ2A 2LF8A 2W85A 4IEXA 2HJIA 3KLNA 5CYVA 1V4RA 1KQ0A 1O3QA 1ZZ9A 2KJCA 1TLHB 2BEOA 1FBUA 1MGTA 1IN4A 3HRSA 1R7JA 2P5LC 4LA3A 3D0JA 1UFMA 3V7RA 2XAHA 2DT5A 2R7FA 2N7GA 3VFZA 1IN6A 2FBKA 1Y9QA 3E97A 1JHFA 2HWVA 1WRJA 4OMYA 5JSPA 4HDVA 4RAZA 1RZ4A 4ZYGA 1UIJA 1O5UA 1BI1A 2XUBA 3EHKA 4AWXB 3I4PA 5HLGA 1ZG5A 3BWGA 5J3UA 3PQJA 3UKVA 3LQQA 1EPZA 3IBMA 3J80K 2IA0A 4MGIE 1ZH5A 2IXKA 1YFHA 3KZYA 4P55A 4HLTA 4EMSA 5LRRA 4Z2YA 4A12A 5D5XB 3QU6A 1LRHA 4Y13A 3DPTA 3REOA 5FLIA 5BQTA 4IPAA 1NZCA 1RNLA 1O3TA 1XCBA 4D7SA 1KYZA 3EO6A 3TOAA 4AVBA 2QVOA 1QPMA 3WW3A 5AIQA 3FMSA 4B09A 1I1GA 4M72A 4EWDA 2CAUA 3MAJA 1ZLKA 1WWXA 3F8MA 4AIHA 3KGLA 1HKQA 1MZBA 2HZTA 4K8FA 1YIOA 4XF3A 4KUMA 5TJJA 4IEYA 3M3IA 3VB2A 4D0PA 4YIIA 1OR7A 4F8AA 3H9AA 2Q2EA 1CGPA 2QUFA 3F8NA 4MGZE 4A5NA 3CUQB 5E1XA 3MDPA 2FA5A 2PAMA 1V70A 2QDRA 1KU3A 1SFNA 4OIRF 5F6FA 5DD4A 3G73A 5E1RA 4XLNF 4RAYA 1Y0UA 5HDGA 5ILSA 4OINF 4EGZA 1PDNC 4XETA 3DKWA 1AOYA 1K7AA 4NHJA 5HDKA 1QQIA 2ATFA 1YQAA 1ZGAA 2EB7A 4XFIA 2DAOA 4PIYA 1Q5OA 1R1UA 2KJBA 4ORFA 3U9GA 1JGSA 1W7PA 4HV5A 2VBWA 3CLPA 2D5FA 4Q0PA 4AVCA 1IN5A 3Q5FA 4IHTA 2KRFA 4TLFA 2X0LA 1FX7A 3R0JA 1YLFA 1W5TA 3U2RA 3BCWA 1YW9A 4O3MA 1Z7UA 2B0LA 3O3KA 3E6CC 1OFNA 4Z07A 1K78B 3JZVA 1XB4A 5D5WB 2HYFA 4RB3C 2VPVA 1UPIA 3V4GA 5E8GA 2HKXA 2GH2A 3ACLA 4LMYA 1Q43A 1J5YA 1WI9A 4HX8A 5BY5A 1FP2A 3IC7A 5L3BA 3E3VA 5CJ9A 5K5OA 4HN0A 3M8EA 4E2SA 2ADUA 2UYBA 2FE3A 1XGOA 2F5DA 2FQ3A 1GHCA 1Z6TA 3BOQA 1WLTA 4U88A 3SHFA 3GFJA 1HW5A 3MZHA 1GVJA 5FLHA 5JR3A 3HTUA 4HX7A 1I5ZA 2KIMA 3S0MA 2OZ6A 2ZKZA 3IKVA 3LFKA 2DO7A 4Q48A 1ZNPA 5LHIA 5CLSA 4HX4A 1G3TA 4FAGA 4L11A 3JAMZ 1ZX5A 2A07F 3QP6A 4YYOA 1ZARA 4HBNA 3F72A 3SCGA 3G3ZA 5J7MA 2GIVA 1DGRA 1LDKB 2UXNA 3DF8A 3GW2A 2HTJA 1NE6A 4IRIA 4KNYA 5J8CA 3FHIB 3TKYA 4KMUX 3N4MA 2YX7A 3HHHA 2MLKA 4CDGA 3R6SA 5FLXK 4IEVA 5BV6A 4G8XA 4LB5A 1MJBA 1MKMA 1E2XA 3K9TA 3NEUA 1RI7A 1ZG1A 1K6OA 1J9IA 3RYKA 1BI3A 4XSXF 2AS5F 3H1YA 3WGGA 2RNJA 1FSHA 2D1VA 5CVUA 5E1WA 4MGKE 5FQ0A 3V7CA 2V6CA 4P96A 4AIKA 2JZYA 1EY2A 3OGJA 4KN4X 3S2WA 4CXFA 2WC2A 2M1BA 3BJAA 3R60A 5I0TA 5KHGA 3E6DA 2A68F 2V79A 4LA2A 3F3XA 3ROUA 4YFNF 2EFNA 3TO9A 5FFXA 4YIFA 2MBFA 2P17A 1Z05A 5DUIA 4UBGA 1YW8A 1FYMA 5HS7A 4IEPA 5E17F 2D5HA 3RKYA 1J7KA 4XF1A 4ZU4A 3HSRA 4Z82A 4HOBA 2QQAA 5DCMA 5HS8A 1LDDA 5JHUA 1BOAA 4G6QA 2OA4A 2QYOA 4HQEA 3BDDA 4CYDA 2NNNA 2EA4A 2KKOA 2ZNYA 4L9TA 3ETQA 1B59A 2FRHA 4N9IA 2BNMA 1LKNA 1TW3A 4FX4A 3GYHX 3H92A 2L4AA 3T8RA 1I1SA 1XDUA 4META 5BUVA 2FMLA 5FPXA 3RDIA 4U7DA 2V9VA 2LSOA 1SD7A 3ZMVA 4PDKA 3EBRA 1S3JA 3KP2A 1LNWA 1DZTA 4UVAA 1O7LA 4QWQA 4EVIA 2UWMA 1QY4A 1RC6A 4ZU7A 1UD1A 4LLNA 2O8QA 2ISZA 5CVJA 2B5HA 1FSEA 3ZQ7A 1EYBA 5LGTA 2HQNA 1BC8C 1OYYA 1ULYA 5F64A 2L01A 2EJRA 4CO8A 5J6XA 3I59B 3F23A 4YG2F 3KSCA 3CTAA 5AIPA 3HRUA 4JQFA 1J3QA 1BIAA 4K2EA 2DPDA 3LOIA 3Q9SA 1QGPA 2NRAC 4JVAA 3I5UA 5HDNA 2PMUA 4A6EA 2GXGA 1T0FA 3LQRA 5ICEA 1H9TA 4HAMA 3EQLF 4OIQF 4LLOA 4LEJA 3WTWC 4KA4A 5ILUA 1XGNA 1GXPA 2PA7A 1MD0A 1XN7A 3IWFA 1XE7A 3FJSA 2WTEA 3RKWA 2K02A 1MJAA 2MA3A 5DCFA 3WTZA 3ZMZA 3NJZA 1LVAA 2EA7A 4JBAA 2CG4A 2QJVA 4IEZA 3BZ6A 4LULA 1CAUA 2RQPA 3ZMDA 2DPUA 4KWJA 5I8TA 3D5LA 1ZZ7A 3MYXA 3D82A 5I8SA 4IEWA 2H6CA 5JFRA 3LSTA 2GZWA 4PJYA 2ZMEB 2ACJA 5CADA 3ES1A 4XRFA 3QPTA 5HLIA 4XFHA 3U11A 5EFUA 4RB0A 4HMZA 3BPVA 4QM9A 3ABUA 2OZUA 4I02A 1X8MA 1ZZ6A 3C18A 3FM3A 3I53A 3TO7A 1U6GA 2ZNZA 3M1EA 2F4PA 2HTSA 4UVCA 2RN7A 2IC1A 3FE5A 3BY6A 2CWEA 3G7DA 3RTRA 3NL1A 1OKRA 5BMZA 3DXJF 5JSOA 1KU9A 2FBIA 5DEQA 2PTMA 2YX4A 3H3ZA 4WCGA 4WK8F 5ICCA 2OQRA 3WG9A 2Z99A 5BPXA 2QBYB 2DK8A 5KK1A 2D45A 4Y17A 2H09A 2RDPA 3WU1B 1O3SA 4KIBA 1U5TB 2K86A 2WFPA 4AVAA 1XDSA 2EK5A 2H94A 2STWA 4E2GA 4HVQA 4BNCA 3BPZA 1Z6RA 1TTYA 5FPZA 1VP6A 3WTUC 2XASA 4U7BA 5K1YA 2CGPA 2M8EA 2XVCA 2CV6A 1B4AA 3H1MA 4YNIA 4Y15A 4MZUA 2VOOA 3NQOA 1R00A 1NE4A 3R0AA 5JSRA 3GXOA 1XD7A 3LWFA 4IVNA 5TRDA 2PQQA 4O9GA 1LEAA 3I64A 2EVXA 4AXOA 1QZZA 1B9MA 4FX0A 2QVSB 1HSTA 1Z1DA 2H0VA 4EJOA 3WTSC 1RUOA 5LBQA 5L3GA 1OD5A 1L0OC 1I27A 1XMKA 3O14A 2DTRA 4KWLA 4QGLA 3I71A 4NB5A 2LF7A 1DGWA 5K5QA 4I98B 2DLLA 3COAC 1WKMA 1IF1A 3IHUA 3GZ5A 1K79A 4EV0A 2FNPA 2PQ8A 3VOEA 5FDBA 5LEJA 4R8HA 3CUQA 4QM8A 2FF4A 3I0TA 4P9UA 4TV7A 4YARA 1FC3A 2KIUA 3JTHA 2DQLA 5I8YA 3CUQC 3WGIA 2ZXJA 5L3EA 3GF2A 3LAPA 2VODA 2KIFA 2MH9A 3VEPA 3FF5A 4IXAA 2ISYA 3ZN0A 3TQNA 4HBLA 1YW7A 5E16A 5AONA 3FXUA 2VQAA 2J5OA 4GCVA 1BM9A 2G7HA 2E1CA 4UNOA 4I0BA 1CAWB 2IA2A 1QZYA 2FBHA 3DV8A 4IRGA 4WVZA 3EETA 4HSJA 1KGSA 3GEZA 5I0SA 3GFIA 4BH9A 3IDBB 4KU8A 4BAYA 1TQMA 3CJXA 2EFPA 3GBFA 2CAVA 4M6YA 3C3WA 3DPLC 1ZREA 2F5CA 4M74A 1J0RA 1D3YA 4L5IA 1YUDA 3JW4A 2VONA 1U2WA 5D4RA 2GC1A 2XKOA 3MEXA 4ZH4F 1STZA 4KFCA 5FD5A 1A04A 1YS6A 2NS0A 2A5YB 2OZJA 4I01A 3HIFA 1ZRFA 2PEXA 2PFBA 3C7JA 1R22A 2FU4A 1VR3A 3NRVA 5HOOA 1XE8A 3E6MA 1ZZBA 2PN6A 4XFGA 4OIPF 4P9GA 2E9QA 2P7VB 2IRFG 1MJ9A 2GWRA 4NVPA 5BXXA 4UHTA 2FOKA 1G6NA 3SZTA 4XSZF 2ETEA 1J2XA 4KDPA 2Q4SA 2BV6A 2M87A 3JSOA 3TO6A 1XMAA 5KHIA 3KE2A 4L9JA 3H1WA 2QQ9A 4GO1A 2P8TA 2D40A 4J1WA 3FXRA 2VT2A 4XFBA 3RJPA 2IXCA 2M5WA 4AQ2A 2PYTA 5LRSA 1G3SA 2HR3A 5J8FA 4UBHA 2K0GA 1RIOH 2GAUA 5D5VB 3CO2A 1OI6A 3DL3A 2O61A 1J1LA 4RGXA 4EJVA 4ON0A 2ESHA 2DCTA 1IPKA 2V09A 1G4DA 3UKNA 3U1DA 3S7EA 3O6BB 4S04A 1YWKA 1DPRA 4BHCA 4U0VA 1IAWA 1FOKA 4LFUA 2J5PA 4HLXA 4XBFA 2WV0A 3W6KB 3RZZA 3F8BA 1W7PD 2P6TA 2V1XA 1VTNC 1OMIA 1O57A 5C8WA 5K5RA 3RNSA
chains in the Genus database with same CATH superfamily
5LHGA 3RSJA 5FPBA 3I58A 3CCEI 3VYTB 1ONVA 1R71A 3CJNA 1WGPA 1D2SA 5D8AA 2BHZA 3EUHC 2Q0OA 5A7WB 4A6DA 4QX0A 1LDJA 1OH4A 2E1MC 3HC7A 3FZVA 5FZ8A 2WINB 4M71A 2JDZA 1SDDB 5HS9A 4Q1RA 3K0LA 3TB0A 4HZFA 2LNBA 1GDTA 2A1XA 4QDSA 2WNVB 2VW2A 5DN2A 3W5MA 1IKPA 4HF1A 1IDYA 2ME6A 1JZ5A 1RMU2 2DFIA 3OYAA 1GNHA 4MXWB 1W7PB 2EV6A 3KFWX 2Q30A 1FT9A 3V7SA 5FJ8J 3S14J 1A8DA 2BGCA 1GMMA 2OQGA 1J59A 1D4VB 1IN8A 1E5SA 1ZBE3 4BYYA 1EH8A 4FPHA 2J1RA 3L2YA 3QH6A 2DMNA 2A6YA 5FXZA 2IEKA 4AVVA 3J81Z 4Y1YA 4LGWA 1FPN1 2L9NA 4XE9A 3U10A 2J1EA 2F6BA 2EINH 2ECBA 1H88C 3MIBA 4CDUA 5LHHA 3OPTA 3ZFFC 4AFAA 2CQNA 4PIZA 1YCIA 3V56A 1WMEA 2FD5A 4IHVA 2NVXJ 4OHZA 3HEIA 4E7KA 4XZPA 1JODA 2XGXA 4CP9A 4RGKA 3WEZA 2IXHA 2IGKA 3AZWA 4PLMA 2JMWA 4PDWC 5FZEA 1UXXX 3DU5A 4YWAA 1W05A 4B44A 1ZA7A 3V64A 4CH7A 2PFWA 3SEPA 1X7NA 4EROA 2MPFA 1ON1A 4GMP0 1KQRA 4BHPA 1Y9GA 3A03A 3MLJA 2QQLA 2EIMH 3F8CA 1R36A 2W24A 1LHUA 3FMRA 1WLDA 3AKTA 3T30A 4MQVA 3GNEA 3GM8A 3I54A 4BDZA 1GZWA 2JSCA 4LBLA 5FZMA 3HZJA 3T1BA 1JUSA 4A3CJ 3HSEA 1GQGA 1KFXL 2OYZA 5H9RA 2IS1A 5EZWA 2BE5F 2BU9A 3ESWB 3HTSB 4P9XA 4FVVA 4MHUA 4XUPA 4XORA 2XLFA 1JTZX 3GTMJ 1SEFA 1RUG1 4I3GA 1HN1A 3T2PA 2HPIA 3S1MJ 2LY9A 4QPYA 3K1MA 4XQFA 5EEAA 5DCMB 2OTLI 4L9BA 2VY0A 4P1WA 2HEOA 2DXIA 1PMIA 2BOIA 3FLTA 1XQNA 4U0YA 5LD2C 3CDHA 3VBOB 2Z5UA 2A7AA 2XHKA 4Q5OA 5K0UB 3BTCA 2HYGD 4CUAA 1F9KA 2PLV2 4CCOA 4LO7A 4CCLA 3CEWA 4KBBA 1Z3YA 1W39A 3M7GA 3MLLA 2DMUA 6PAXA 4A3BJ 3B94A 4OWRB 3FBMA 3FXQA 1FLIA 4PFPA 3VN4A 3SZPA 5IVCA 3SISA 4BXFA 5L9BA 1UOGA 3OTFA 1LOAA 4YZ4A 1D7PM 3HNMA 3NAPC 4IHXA 3QWLA 5FPUA 4FETA 4PJMA 5L3CA 2A6WA 3RYRA 4AFCA 1ENXA 4M3CF 2QE3A 4Z2AA 1I9RA 1QJX3 4Q4Y3 4XKWA 1FNNA 1DU0A 3MD2A 1DQ1A 5D6EA 2W5FA 3K3OA 3MIFA 4CDWA 5J37A 4M01A 4FPKA 1WLCA 4IERA 4IV1A 2EBIA 3ABKH 2CV0A 3SYTA 4HKWA 3VD4A 1QF3A 1VQNI 1ETOA 2JPBA 5L7OC 3FDYA 3S8PA 4LD5A 3DF0A 2BVMA 3C2GA 3IWZA 1OFCX 4QX1A 1G9DA 4I0WB 2VLAA 2LR8A 4XN0A 5DDGA 1U5XA 2KFDA 1NK3P 3P7NA 1AU7A 2EIBA 2VW0A 4IRHA 1DQ5A 1YX3A 3KEQA 2OQ6A 2Y0OA 3IN9A 4D5CA 5A7QA 2RS13 4O9EA 2DVDA 1R4NB 5DZFA 1LR5A 4PIXA 3L2HA 3CMAI 3P9IA 4L18B 3PVBB 2HGCA 2BY1A 5A3UA 2LBFB 2AGSA 3WVJA 4NUBA 2BFUS 3WTTC 2HBUA 2VKEA 1EV13 2HH9A 5FZAA 1DGRM 2XSDC 1A78A 1H8TA 2WB1A 5FFZA 2DW4A 4KMFA 1OF4A 2MEV2 3DXTA 1PO11 3HGYA 1IC8A 1SVMA 3OGGA 4JK1X 2K9ZA 4GKYA 1MMAA 4QQ2A 2A3WA 1W2TA 1DYOA 4DRRA 3BTAA 1P8JA 5FZ7A 4R79A 4FPEA 3PLQA 3T09A 4IEUA 5FKBA 1UCXA 4E4ZA 4LK0F 1PJRA 2XHNA 1ENHA 3PO3J 3VBSA 3JRBA 3EYIA 4FISA 2RS31 4KIGA 3VDDA 3K4NA 3MKWB 5T5OA 3SMHA 4ENJA 1VJ2A 5IK5A 2KA3A 1OYWA 3LSPA 1XJAA 2CY6A 3JR9A 4UVBA 5D8LB 1ORKA 2PBIA 5CQGA 3RVHA 3ZYRA 1F4HA 3WZ1A 5CBLA 2DI3A 4TXWA 2ARBA 3U14A 3RCOA 4LORA 2FZ2A 4LJZF 3ZN6A 1D8KA 1NCQB 1ZK8A 2FMYA 1BCXA 1WKYA 4BQ2A 3WF0A 1FMD3 1N1TA 1PVC1 3BI3A 4COYA 5IK8A 3QOEA 3POBA 1S7OA 4HK8A 2GH8A 2K9NA 3N36A 3CDIA 3ES4A 4ENMA 1TQPA 4EJUA 2OD5A 4BY1J 3FIWA 2XAQA 5E8IA 3IMNA 3KQRA 2CW0F 2P5VA 3WW4A 1XRUA 4L9NA 4ESJA 3VBRC 1ETKA 2C1FA 3O1OA 5FV3A 3LSRA 3DEMA 1RUC1 2NYXA 5IY5H 3AK0A 4G94A 2QQKA 2M0CA 2LROA 2WADA 5BPIA 4AUXA 3K2ZA 3K4BA 3NRUA 2LKPA 2TEPA 2JWPA 3JD73 3ECHA 3HRMA 1ND3B 5BNNB 2ECCA 5J1XA 3VSLA 2VJXA 1ASJ1 4AEKA 4HYEA 3WTXC 2RR12 5CYYA 1YJ9I 1DP7P 4E7IA 4KICA 1RRJA 4H55A 4LHLA 4RGSA 5FY8A 4LKDA 5C3PA 4HKLA 4XF4A 1AYM3 4LO5B 2FZ1A 1DZRA 2LMDA 3CCSI 4AIJA 1UHMA 5FZIA 4FFIA 1GXQA 4INDA 1UCRA 5CKQA 4BQ4A 1QIQA 2VCCA 1USTA 4KU7A 4XRSG 2AXLA 1VBD2 1IN7A 2CHHA 1SC7A 1P7JA 5KHKA 3MO4A 5LLQA 1POV0 2V1UA 2X53S 1IHMA 2QTWB 5LBFA 4WVMA 3JTGA 3ERED 1HOMA 1FZPB 3FMGA 4PSWA 1DGWX 4ZTJA 2PI0A 1W8FA 2W1QA 3OYIA 4HF2A 5JOYA 1P4WA 3VBFC 1JBCA 1SVLA 4KWKA 4GB33 2BWAA 4QQPA 1QH7A 4XJ9A 2VB6A 1IUFA 1XSRA 3SXWA 5T54A 1L7LA 4W8JA 4EZHA 5DUXA 3O12A 3WG2A 1C8M3 1NA1B 3GO5A 2PMWB 4Q47A 1IXCA 3RZDJ 3IH4A 3IKWA 4QXCA 2GNBA 2HWB3 2Y75A 3DCFA 4GQ7A 4GWIA 4N8MA 1VQOI 2CSOA 1ZG3A 4XFCA 2W08A 2O3FA 1UOJA 4V19K 3WP5A 4BXSV 5FZ6A 3K4AA 1WA6X 3GBGA 2LUWA 4TSVA 2HDCA 3HPGA 2B9UA 4PGGA 2E7XA 1JYWA 4N90A 1FOXA 1ZBE1 1MPXA 2YY1A 1LJ9A 1XMXA 4NRQA 3FHZA 2HVSA 1QXPA 2EILH 2ZPXA 5FMCA 2OTJI 2IVJA 3VD3A 3A1YA 5C4WC 3OYHA 5T55A 4ZKTB 4WX9A 3NO8A 4QLCU 4LLGF 3VKFC 5HNFA 2E1MB 3NWTA 3ZFGC 2QWWA 1BYHA 4LLFA 1XGMA 2OJED 4KYWA 2V4VA 4UUTA 1VBE2 3V8KA 1Z7S2 2VNVA 3SEEA 1T39A 4CUGA 3FXMA 3MUZ1 3WNPA 3LSEA 4TLGA 2F4OB 3WHTA 5CG9A 3H50A 1AR83 4GYIA 1LQ1A 4LBOA 4HSLA 2ZMEA 4UXAA 1VE0A 4WXHA 4AI0A 5KWRA 5A3NA 2JDAA 1GLHA 2G4IA 3JRIA 2L9VA 5F3GA 3O0WA 4X6QB 4ZZDA 5FBJA 3MFKA 5J48A 4JGZA 4H7MA 4HVOA 1KU2A 1O5LA 4OULA 1RXFA 2E35A 2YSRA 5FP3A 5BOXA 2VE8A 4DYQA 2H1LA 4ZDPA 3K1NA 1MS4A 2OKXA 2D6NA 2F2EA 1Q1HA 2X1DA 1FI2A 2UXXA 2XBO3 1B8IB 3AVSA 4YLZA 3IRQA 4Q0UA 2XV4S 5I91A 3HOXJ 3QP5A 3TOBA 4D7TA 1DPUA 3ZFFB 1NYWA 1ND2A 1UU4A 1E17A 1PUFB 4D94A 5IYBJ 3ABTA 3ME2A 2RMU2 1RUE3 4CCJA 2XVGA 2IXIA 3V8LA 3O1MA 4RHV2 2UWCA 2GA1A 2VE9A 2DFFA 4R9BA 1WW6A 1VBC1 2HXIA 4MXVA 4PDWB 2CRGA 3MW4A 3TEYA 4AR2A 3CUOA 3I2OA 5CIRA 4DOUA 3FZ3A 5FJHA 2R7TA 2IJLA 2KP6A 4B1RA 5LCWL 3S57A 1AJOA 3ZR5A 5EJCA 1BVP1 3F0CA 1QJFA 4XLCA 5KHHA 5F7UA 5JXIA 4PF5A 2GSYA 4NHXA 2YC4A 3VZLA 2YPDA 1YI7A 2PHDA 4MFDA 2C6YA 1OHFA 4X0GA 1AHDP 2VBDA 3GJAA 5KHJA 4NHYA 2XRLA 4YVWC 2M9HA 4LLLA 2BGOA 2FDJA 2V72A 2KXLA 2O7OA 5KCMA 2R043 4M3CE 2CFOA 5K7ZA 3POIA 2OPKA 3BVCA 5IP6A 4HW0A 1AWCA 4Y1VA 3ZR6A 3T0AA 4AE2A 2IW5A 3SQNA 3L2QA 3FXLA 1HLCA 3MGUA 1GFF2 3LFIA 4X6RB 2PMHA 2D3PA 1WWYA 1Q8OA 5FP8A 1SVOA 5DUKA 2AACA 1X8EA 5EGOB 4G7HF 4LOSA 5JVTA 4ISRA 1DFQA 1WCQA 1KITA 4DFSA 2VOPA 4HANA 4CYCA 2BP6A 1MSFC 2WYFA 3EQEA 1W28A 3HJRA 2YC0A 1QJX1 2K9MA 1WCUA 4Q4Y1 2RJ2A 5CFDC 3CP2A 3TEZA 2XB6C 3AXDA 1OA2A 3GWZA 3KETA 3WTYC 4O61A 4XFFA 5DAVA 2VZUA 2X9DA 1PGW1 2E1NA 2YBKA 3GLXA 5FLXZ 4BQNA 4RB2C 1KXGA 4I7HA 2VOTA 3ILNA 1MNEA 5J36A 1CAXB 1FNYA 2JRMA 1POV3 1YFUA 2I45A 2JENA 3LSJA 1JE8A 1PGSA 4EQQA 4JTOA 2MH2A 1AJKA 3CQOA 3JB4C 2OUMA 3HOBA 1ULGA 1LHNA 2W85A 1BVVA 4C8DA 2J1UA 3ZIWA 4XTPA 1AX1A 4BQOA 3LSIA 5CYVA 1IS4A 1I5PA 3PNTA 1KQ0A 2DA1A 2WR9A 1FBUA 4R9AA 1PMHX 3VD9A 3V7RA 5AC93 2N7GA 2WO7A 3FUQA 4R9DA 1JHFA 1FEXA 2HWVA 5F32A 4OMYA 4HDVA 4KWUA 4RAZA 4AEDB 4RFRB 2NYYA 3NNFA 2Y9YA 4Q1PA 4DUVA 4I30A 1O5UA 4CEWC 1T56A 3VKMA 1PZ7A 3FBYA 3PQJA 2OC6A 1EV11 1Q56A 5F2WA 1H89C 2JDMA 2UUZA 2IA0A 3D1NI 1EAH2 2V9PA 3H36A 2B7YA 1MBHA 3OS0A 3ZQFA 3OGVA 2C4XA 5LRRA 4A12A 4B3XA 2X1CA 5IJRA 5D5XB 3HN1A 1D0ZA 1LRHA 1TNRA 1NCRC 2M8GX 1JKOC 4BJ0A 1XSQA 2VCBA 1I1GA 4M72A 4EWDA 3VZNA 3ILFA 3N7JA 2WKKA 3F8MA 5LWBA 2WN2A 3WUCA 1MZBA 4Q26A 5FP9A 2WZEA 4K8FA 4XF3A 2DMPA 3OYKA 3M3IA 2VXDA 4F8AA 5BNOB 1SLCA 2JD4A 4IQ4A 2N8GA 2HPMA 3F8NA 1O59A 4PLNA 1NTCA 1HJFA 2W7NA 1FMD1 5IP7J 5A7WA 2LS6A 2PAMA 3BCBA 2ZGQA 2LKXA 3ZXAC 4ATFA 5E1RA 5DUUA 3ZYIB 4NQWB 2VTFA 1Y0UA 5DDJ3 3CC4I 3A22A 1DQ2A 1K7AA 2WNVA 5HDKA 4C91A 4BJTA 5E3OA 2V73A 2EB7A 2DTZA 4XMYA 4ORFA 3U9GA 1TL8A 1JGSA 4AGGA 2DUQA 1W7PA 4HV5A 2H8RA 2D5FA 3ACFA 3Q5FA 2KRFA 2X0LA 4Q4W2 4BBRJ 3R0JA 3PVEA 3LDKA 3AMPA 3W2AA 3JD71 3S93A 3BCWA 1YW9A 3KX2A 3ZXSA 1OFNA 4Z07A 4ZHNA 3H9JA 1K78B 3JZVA 2WA0A 5FLMJ 3PTRB 5BNPC 4MOAA 1VRBA 3ACLA 4QKDA 1UMQA 2BVLA 1LGNA 3HBKA 2NS8A 4MSVA 1FP2A 4JDMA 1Z3XA 4GWNA 1LAJA 5CAZA 1WJFA 4B8EA 1GHCA 1AYM1 2VUJA 3OYMA 4C2MJ 5DXDA 3LL7A 2ZX1A 2KIMA 5A6YA 3S0MA 1JTYA 3K4ZA 3ZQHA 2OZ6A 2Y30A 3D4KA 3IKVA 3LFKA 4E7LA 2C9KA 1ZNPA 4NRPA 1H9WA 1S9HA 1HB3A 2VULA 1RUJ3 3A4CA 1DLCA 2E71A 2BDRA 5IK7A 3OBZA 2HBTA 3ZSMA 1QDOA 1A6IA 4CU9A 1DGRA 1GZTA 5D8AC 2UXNA 3K10A 1RITA 4GJZA 1NE6A 4GB31 2Y34A 3PUBA 1XPXA 4IO9F 4A93J 3FHIB 3TKYA 4YW2A 3HHHA 1QOSA 1UY4A 3R6SA 3U07A 2W1OA 1C8M1 3BQZA 2OPWA 4W50A 1MKMA 3NEUA 1JZ8A 1RI7A 3OY9A 5FOJB 1J9IA 1MZ5A 1TMF3 1BI3A 3ERMA 2VZ1A 5F3CA 2HWB1 4AF9A 2AS5F 3U1KA 3H1YA 1TZLA 1FSHA 4XJZA 2JJ6A 3AG1H 1CESA 5E79C 2QEXI 2D1VA 4MGKE 3V7CA 3X2QH 2JZYA 3F95A 1RUF3 1IJWC 1UPSA 3BJAA 2QGUA 1QJY2 4JRLA 5KHGA 2DTWA 1GUUA 1OLTA 4XM3A 4Y1ZA 3ZSJA 3ROUA 4YFNF 3AC0A 5FFXA 4D6QA 4UWDA 3S6PA 2DFBA 5E3MA 1YW8A 5FY4A 5A33A 2JA8J 3VBFB 1OQ1A 1YHQI 5DCMA 1A6CA 4UAPA 3DTKA 2E7AA 3GCMA 4M3CA 3KYLA 1E0EA 1W9FA 4RN5A 1SLAA 4HQEA 4A7KA 4CYDA 2NNNA 2EA4A 2KKOA 5LZ6A 4UW3A 2BQPA 5KHDA 1MZEA 3VBOA 2B4KA 3C7EA 3BTYA 3KCXA 4FX4A 2WNUB 3AKSA 5K0UA 1UYZA 4LG3A 2DT7B 2QDNA 3SDGA 3NAUA 4HOOA 2FMLA 3LSDA 2I8DA 1HLVA 1AR81 4UFLA 5FPXA 2C24A 3WF4A 2R49A 1LODA 2V9VA 3ZQQA 3BTZA 4PDKA 5F2SA 1PO23 1TWFJ 2KL4A 2GNTA 2B39A 4ARYA 4UVAA 4QWQA 2J1TA 5JXJA 3OJBA 5FYZA 1DP3A 3OYGA 2ISZA 2JWTA 1BC8C 4NIDA 4CO8A 5GZCA 5EZGA 3PVOA 3I59B 3F23A 2Y60A 2VBPA 3AZYA 1MMSA 3KT1A 3O8HA 2JG9C 1GANA 1QHHD 2P1BA 2AQFA 2WO3A 2JK3A 3I5UA 4JVAA 1W9TA 2XBO1 2VVFA 3E1F1 4W6YA 4DZGA 1AKHB 1A35A 1Q8SA 2XAUA 2W68A 3EQLF 1H4GA 1OJLA 4LLOA 1LE8A 1MS9A 1X19A 1XGNA 1MD0A 1RUE1 3IUOA 1UYPA 3NJZA 2ZMLA 2EA7A 4IHWA 4A4AA 4JQRA 3PIOF 4EN8B 1W8NA 3LCPA 4LULA 2QQJA 1W1WE 4Y4RA 1UZZA 2YXSA 3D82A 5I8SA 4QDQA 3LSTA 1LKXA 4XFHA 5EFUA 4QM9A 1X9PA 2V4AA 3ABUA 2YU9J 1ZA4A 2WWUA 5L73A 4XURA 4LQRA 3M1EA 5ABJC 2RV9A 2IC1A 2GXAA 2F4LA 3SDBA 3G7DA 1OKRA 4JKKA 2PTMA 3AMHA 2R041 5H9QA 5ICCA 4X1EA 2OQRA 2LBFA 1K5JA 4M3EA 3AM2A 3LPFA 5BPXA 2QBYB 2HI3A 4OMCA 1AZDA 3D3AA 1ENQA 4UY8I 2RDPA 3WU1B 1I39A 4E7ZA 1XDSA 2EK5A 2H94A 2R7ZJ 2Y6HA 1TTYA 1VP6A 3WTUC 3H1MA 3ZXJA 3P5BA 3NQOA 1R00A 4DO0A 1NE4A 3R0AA 1GWLA 3FXJA 1XD7A 4FP3A 1LEAA 3I64A 1F8VA 2Y0SA 4FX0A 1AF9A 4P00B 3M1CA 5K7PA 3WTSC 4YFZA 4LE3A 4DIQA 1WMXA 2E7TA 4ASMB 1G9CA 3O14A 1DGWA 1NCQA 5GLTA 1GNYA 3HNYM 5FYHA 1RR7A 3ZFEC 1POV1 4FOWA 1ITYA 5FYUA 3VDAA 2PQ8A 4XIOA 2HOAA 1MEC2 3POJA 5LEJA 4BQWA 3AL0C 4QM8A 1XYNA 3EPZA 3I0TA 4YARA 2XMLA 5K7FA 1FC3A 2L0KA 2KIUA 5JI7A 5I8YA 3GCWA 2Z4FA 3WGIA 2ZXJA 3K4JA 3DYPA 2QFEA 2KIFA 2ISYA 1JUMA 3ZN0A 5AC91 2QKMB 4QD2A 1R5ID 4YG0A 5J98B 5JWPA 3H3VK 5FZ3A 2QQMA 3FXUA 4D9JA 4J01A 1ND3A 1X3WB 5C9AB 5BNNA 2G7HA 3ONQA 2CH0A 4UNOA 2CMPA 5EV7A 1LOEA 4WVZA 4BQQA 3EETA 1HF0A 3DXUA 3WQ0A 3ZYGA 1JJ6C 3OBTA 2OF7A 3IDBB 4KU8A 5A3OA 3HPHA 3C3WA 3DPLC 3VBSC 3PUFA 3NKGA 4A69C 4GKXA 5KXCA 3LMMA 1FV3A 1ZQ3P 2VONA 5D4RA 3ZVXA 2GC1A 4BEHB 1ACCA 3MEXA 4UW5A 3BIWE 2JXAA 4BDVB 3VKNA 2WAQN 1RHI3 4I01A 4MADA 3FLRA 2PEXA 3MVPA 2PFBA 3KZ4C 3UJOA 1R22A 1YITI 1VR3A 3NJXA 4Z92B 3NRVA 3FBIB 4EJRA 4YGBA 3E6MA 1OLQA 3AL6A 4N53B 3G4SI 2IRFG 4NVPA 4AEJA 4ARXA 1BMV1 2ETEA 4CEWB 5DDJ1 2M87A 3JSOA 4UYBA 3WNMA 1XMAA 2HEVF 4L9JA 5FKNA 5C8CB 1IQDC 3IH2A 3QYEA 4DBQA 3RGBA 3W59A 3OOXA 1R4MB 2VMGA 3GDBA 2I07B 5LRSA 1SLIA 2HR3A 4AWDA 2PLV3 1RIOH 4XTMA 3FK7A 5ERLA 4ON0A 2ESHA 2DCKA 2HQ5A 1IPKA 1JU4A 2DCTA 1C5IA 2R073 2WT2A 5CA6A 1R1A1 5DPNA 1YWKA 4IE7A 3SITA 4XDQA 1QHDA 1G7YA 1FOKA 4LFUA 5FZGA 4YG6A 2IZWA 3BODA 3BG5A 3LB9A 3P6BA 4A3JJ 2P6TA 2V1XA 3W58A 3B01A 4WVVA 2OUHA 3C7GA 3H1CA 2PHFA 1YYVA 4YM1A 4P9JA 5CU1A 2R3SA 3E5QA 2TDXA 1K61A 2VCMA 1RUH3 1T2XA 5H9SA 3L00A 3CC7I 1JXNA 5FKLA 1DBNA 2IXLA 2BW8A 1K83J 2DMQA 2HWC3 1W0OA 3BP8A 3LA3A 2WL1A 4L97A 4B8XA 1RUJ1 1Y0NA 1ON2A 4EM0B 3USUB 2Z16A 4YPJA 2ENRA 3HR9A 2WQZC 4QQOA 2OW4A 2JIJA 4W4ZA 3IKTA 4PZJA 1WVRA 2VOXA 2Q0AA 3ZXKA 1K5MC 4QU2A 2UY9A 1QJX2 2XPJA 2XB5A 2G9GA 4IETA 3HN3A 4QXBA 5FUPA 4ZS3A 2GC0A 4PCQA 2ZGUA 5IPAA 1PGW2 5BNPB 4E7JA 3UETA 2XAJA 2G7UA 1TMF1 1MR5A 2E2IJ 2Y69H 4HA8A 4DNCA 1JOPA 2WS93 1V3FA 2W84A 2Z33A 2CW8A 2P6SA 2A6XA 1B8IA 3O1RA 3DP7A 4RL7A 1OQDA 3GUDA 1G2HA 3TDZC 2CUEA 3EDPA 3ZFFA 1RUF1 1REFA 2Q1ZB 4P9FA 3CBNA 1C28A 1WJAA 1PUFA 2VQTA 3DLAA 3BJ6A 2Z69A 1WPKA 4YW6A 4ZYHA 1PM4A 5J47A 2D5VA 2VQCA 4E8CA 3I3QA 4BIFA 2MEV3 5KR7A 3RZLA 3CZ6A 5DUVA 5C5TA 1QO0D 1B72B 4A3GJ 3AAFA 1YEWA 4PDWA 2D3RA 3W9AA 2R93J 3S30A 2RS12 4LOTA 4QB6A 2EA2A 1CZVA 2R7UA 3QPHA 1IS6A 1TQ5A 3KLSA 1JH5A 3B5LB 3L9JT 4E4SA 4PK4A 5C6CA 4Q8LA 1EV12 3HBLA 2ZGLA 1F5JA 4GXLA 2MABA 4WV8A 2L2OA 3CO6C 3SQOA 4PFOA 5F9TA 5IT3A 2GQQA 2EIEA 4XXAA 4V2GA 3P9CA 2DA6A 2WY8Q 4WXCA 3BPXA 3Q0UA 2XROA 4YFXF 4PJLA 3H7YA 4S05A 1XNTA 2ILMA 3RIRA 1DIWA 3CNAA 3TNQA 3ISPA 4MH0E 1YO5C 1ZELA 2PAEA 1X9TA 2A73B 1UB9A 1BN5A 2I74A 3AJZA 5FRMA 4HKOA 3FXKA 4A45A 1O7FA 5EGOA 1FMD2 2KDOA 4LTAA 2M4GA 4MV2A 3K3NA 3GFLA 1SDWA 1CWPA 4NHLA 2W95A 3WT3A 4Q4V3 2KT0A 2JT1A 5GAGJ 5DS9A 3ITQA 4P5OA 3MKYB 4AI3A 2F48A 5KVRA 3RWNA 3WW2A 3H8OA 2VTXJ 4FQGA 5FMOS 5J1RA 4OIOF 2A6ZA 1PK6C 1RGSA 2PHWA 3JBG2 4IESA 1DP0A 4DQ2A 1FNZA 4GFBA 2WBKA 4XEZA 2E7WA 3M3QA 1BLZA 3H7JA 4RS5B 1CAXA 3RPQA 4FTHA 4EZ4A 5I0RA 2QSHX 3EJKA 4Y5SA 2QQNA 4AFDA 2WZPP 4NO4A 2VBYA 4OAYA 4CA9A 4G7ZF 4ASLA 1X1AA 1VBD3 1A34A 1J09A 1ST8A 1DZQA 3DKXA 5LATA 4E4DX 4BQ5A 3VL9A 3P9KA 2QLZA 2CU5A 2J1VA 5FZBA 1AYM2 5B4NA 1K3IA 4ZPIA 2ETHA 5BPDA 1SFOJ 4AEDA 3LDRA 2ZO4A 4FT8A 1R58A 1W6OB 4C3JJ 5FKCA 1W6QB 3JB8A 3THDA 2WO1A 3OV8A 1YFWA 5FYYA 1KFUL 4KNCA 1PNGA 1MS0A 4LBQD 4YZ1A 5JLXA 1CD3G 3DPRB 1DDNA 4E6KG 4JDNA 2L7KA 3N7LA 1OCTC 2X5IC 3O1VA 5J1UA 3GYDA 2E51A 5BYNA 3Q8EA 3R05A 1H1MA 1RMU1 3WF3A 3ZKYA 3ZPYA 2I5UA 2RDRA 2AHQA 5C5UA 5HLHA 1DQ0A 2BNNA 1XXNA 1J3PA 3AG4H 5F3EA 4A0YA 1X1DA 2IA1A 4UT5A 5FJKA 2VMHA 1D5VA 3V0BB 2X51A 3HQUA 5GALA 4OMZA 5LEKA 3B9CA 5BNGA 4XAEA 3VODA 3WSOA 1XC5A 1JYIA 5ABJB 2HWB2 5FD6A 2GMEA 5IT9Z 3KWVA 4H4KC 1REPC 2VPLA 1TEIA 1APNA 4AYUA 3B73A 3IDCB 3KV9A 2R7SA 4UFJA 2FNAA 2X6OA 2LVSA 3OEBA 1ZLJA 1XSXA 1TME3 4NQWA 4ZZLA 5I93A 1T6GC 3KV4A 2VQ0A 2OXBA 4RA2A 1Z7S3 2JJ7A 2IWGB 1KQ8A 1MMGA 3WY6A 4F7ZA 4ZS2A 3PIPF 1IXRC 2Y6GA 4HSRA 1R5HA 1MBFA 2YR2A 3NQHA 2L4MA 1C0WA 4IQJA 1IRZA 2RVAA 5BNQA 4E2QA 1GWKA 1VQ9I 3J7AY 2UYAA 2W57A 1EUUA 2ZB9A 5D1IA 1V55H 1K78A 2W92A 1LEDA 1EV7A 2CDOA 4AI9A 2LREA 3MIDA 4KT5C 2ADEA 3MCZA 1JHNA 3RYPA 3UESA 4DPNA 4URAA 1SMTA 1RINA 3ZOIA 1AR82 2BW3B 5T5JA 2GDFA 3ZFEB 2ID3A 1USSA 3CF6E 1FAYA 3KT4A 4OI2A 1RUI2 2ZHNA 4MTEA 2KZGA 4CZZA 3GHMA 1ZHFA 2EV0A 5FR3A 3U21A 3VKLA 1W8TA 4X6AJ 1KA8A 1CR7A 1KQ9A 3AL0B 4Q5SF 2Y6KA 5FXVA 4PI2A 2RMU3 5JCTA 5FOBB 4AHWA 3BPSA 2JX9A 5L3DA 4QQHA 5IAVA 4IEQA 4CDXB 5KXBA 2AQEA 2OUJA 2XBO2 4A3ZA 4LK1F 1JKQC 1DCSA 2OBPA 2LY1A 4A0ZA 1FJLA 2W1UA 3R4DB 1S29A 3L09A 2D6KA 3I4IA 5HCHA 4AGVA 3J8F2 3PJYA 4XF0A 3JRCA 1ODDA 2RKHA 1Q3EA 4P08A 4HV6A 2BZDA 5T5LA 2WNVC 1H6YA 2QUOA 3QRFF 1REDA 1Z7LA 4Y1XA 2ORZA 4LK6A 2V4JC 3VZKA 3V8JA 3HT1A 1ZRCA 4ZU5A 2PLV1 5DZEA 3KCCA 4Y7NJ 1JTXA 5DV5A 5FLVA 5G05L 1G3WA 2R071 3BJOA 1ZBA2 3UKGA 2OU2A 2HQAA 3CJQB 4ENKA 4D3WA 4LPLA 3S16J 3G6JB 4XCBA 2W82A 3QODA 3RZMA 5JMOA 3ZYFA 3IAS2 2XLAA 5FLJA 2R7DA 1L7RA 2O1QA 2WZR3 3DTEA 1QZEA 2QQBA 1IPSA 5FZFA 4IW3A 3VBFA 2LTPA 4RM3A 3POYA 4DINB 2RM22 1ULPA 3LAJA 3K77A 1WQ2A 1RUH1 2EAKA 2JVGA 5H6QA 4HVRA 3BYWA 3LA2A 2K2SA 1KS5A 2EFWA 3DBHB 3KP4A 2HWC1 2W3JA 4Q4ZF 3HRTA 5DQ0A 3VZMA 2JG8B 2DUPA 4KN7X 4LO8A 3PNVA 4B1LA 5L9VA 4Q0VA 3LNQA 3OPWA 4BQAA 3JRFA 1MDMA 2P5KA 3DN7A 3HQXA 3MIHA 4PHZA 2VZQA 3H8UA 3OY8B 1K4SA 3NKTA 1H2KA 5E18F 3VBHC 2LKSA 4L0PA 3B00A 1SFEA 5HBAA 3I2IA 4YGDA 4FXKB 2E5ZA 4AI1A 2NQYA 2L3DA 4E27A 1TWGJ 5EIYB 4BACA 4EEFG 3MLKA 4HF0A 3OBRA 1JMUB 4F83A 3KV5A 5LGUA 2B8MA 5HCFA 2JA7J 1W8WA 5AFEA 3I59A 3UT0A 2XJQA 3IV5A 1SCRA 3HWJA 2H1KA 5CKNA 2WS91 2QQIA 4LG0A 4CUCA 3BB6A 3VKOA 5EEHA 4CCKA 2W48A 3WTVC 3PUAA 4FBFA 1O4XA 1AKHA 4MHGA 3LIHA 2ZFWA 4ZZ8A 5C70A 3M8FA 1TZOA 2PHLA 2XWBB 3SJMA 2VJIA 1YS7A 3T4HB 3QACA 5JOXA 4PUSA 4CCDA 2P2KA 3SCFA 3VHRA 2ID6A 2MEV1 3TWIA 1YRNB 3IB3A 3OR1C 2DDUA 4ZYDA 2Y9ZA 5JDBA 2CTVA 2RG4A 1VQ8I 1W6PB 1KEXA 5AC92 2KM2A 2ZBKA 5CNAA 1S7AA 1BR4A 2GU9A 4HRIA 3CLOA 5LGNA 1K5MB 1JJ8C 3H8XA 3KGZA 1MH3A 3J80Z 5A2QK 4MG2A 3BU7A 3IIIA 2OPTA 3IPVB 3K4DA 4V2FA 2L02A 2DVFA 5EXOA 2HWF3 1Y3TA 4H0EA 4UXNA 5ISLA 5JPNB 1JOJA 3VBOC 3H8RA 4QHZA 4EM2A 4HPQA 3BC8A 4L2NA 2MSYA 1XOYA 1KS4A 1V5GA 3WF2A 5FZDA 4MGYE 4FE4A 1XNBA 2ZGOA 2FXAA 3DLLF 1WD4A 2XJTA 4W1UA 4RGRA 4RQPB 3FHQA 2R30A 1CPNA 2QBYA 2VBZA 2YGMA 2RS52 1K12A 2NVQJ 1W4MA 2P4WA 3I9V2 5F1JA 4BWOA 3ELKA 2Q8KA 2LDUA 5EG0B 1TBXA 3MUY1 4PJJA 1UNBA 2VZPA 2X1EA 1Z0XA 2M45A 2A69F 4AVSA 4IEOA 3HUGA 4HDUA 1MMDA 1BC7C 4AYBA 4DEVA 3D5RC 5IWFA 2J22A 3HOTA 4NPLA 4FQ4A 4Q4W3 3R0RA 3OR2C 3TDUC 4Q4V1 1D4M2 2PG4A 4NHMA 4Y5TA 3ASOH 2ZGNA 3W6JB 1ZYBA 5L9RA 1PP7U 1JI8A 4C3IJ 2IAIA 2EXHA 4WM8B 4FTBA 3ZDVA 5D5UB 3MKZA 3KVAA 2IGOA 2EAAA 4AK3A 4JV4A 2VJ5A 3FKJA 4GIQA 1XCVA 1LCLA 4FAHA 4YVWA 1N25A 2L5QA 3J7NA 1JYXA 3F21A 5A6ZA 2WAFA 4RM2A 4M9XA 2B9SA 3PNYA 1B35C 3LWCA 3CCYA 3O1UA 5JPMB 2O6GE 2HZDA 4YVSC 4IF4A 1SEUA 1VBD1 4BXUA 1NXD1 3HOZJ 1LOFC 1H2LA 3KLOA 2XAGA 1LU1A 4AQTA 1A8MA 4PGHA 1Y1WJ 1U5ZA 1VQ6I 3WODF 2BGPA 2QZ8A 1P9QC 2EALA 2MYSA 2K46A 3KMHA 3G1LA 3K7AJ 3IZOA 2CQXA 1SMYF 4P5YA 4IHSA 3CU7A 5C9AA 5CFDA 2R7VA 3T0YA 2KLOA 1DU3D 4ZJZA 2C0ZA 4N9HA 3I2FA 5HI0A 3BR5A 3B9IA 4UV9A 5D8KB 1IPJA 1MNMC 5JR7B 1RUJ2 2A6EF 5E88A 3KP6A 1PX4A 2VD7A 1W5SA 2HEWF 4CSWA 1QOOA 5FRNA 4CUBA 2NVTJ 1W8HA 2VZRA 3N97A 2XRNA 4N0BA 1HQNA 4BEHA 3OBAA 2L7ZA 3SEZA 1QJY3 1OISA 4B4CA 2HKOA 2ZJ2A 4G12A 1OH3A 4EATA 3KLNA 4XOTA 2ZTNA 3AMMA 1NT0A 4X8PA 2MD0A 3A01B 1ULFA 2R5ZB 1ZZ9A 2AYHA 4BKXA 3BR0A 1MGTA 4YG3A 4S2FA 3OSGA 1MSEC 3N7MA 3PMEA 3HJEA 3ORJA 4CEWA 3VFZA 1TT5B 5HV0A 3PM1A 3INAA 4MYEA 2VKDA 5C8CA 1TNFA 1Z7S1 3EHKA 4JC1A 4AWXB 4J25A 5J3UA 3ALQA 1PHMA 4EYUA 1QRYA 3IBMA 3MW2A 1UZ0A 1NQDA 2IXKA 3AZZA 1YFHA 3KZYA 2HU9A 5GLVA 1NCRA 3BIEA 4EMSA 2ZGMA 4KGGA 2XXZA 3V0AB 4FXGB 3DPTA 1WZ2A 5BQTA 1NZCA 1RNLA 3Q8FA 5ACA2 2Y64A 1OUSA 1XCBA 2QQWA 1KYZA 3EO6A 5FMBA 2FHRA 3JCUC 3HM5A 2W4SA 2QVOA 2E2JJ 1QPMA 1GVDA 1Y39A 4Y5Z0 3MAJA 1ZLKA 1WWXA 3KGLA 1HKQA 2HZTA 1W6MB 3S1NJ 2FX0A 2KR2A 3PUHA 3OUJA 3DBRB 1PO22 1DGWY 2O14A 5TJJA 4IEYA 4A41A 1NUKA 5FPVA 2P37A 1DQ4A 5JR2A 3LDBA 3VWBA 4CE8A 3CUQB 1FMWA 3JXSA 1O8PA 3I3EA 1XNKA 4LKFA 1SFNA 2K40A 4FQZA 5DD4A 2RMU1 5ILSA 1GWMA 2R7EB 1PDNC 1T95A 4ZC3A 4XETA 3USUA 1LOCA 1AOYA 1QQIA 2M34A 2JSPA 2ATFA 3D6EA 3OSFA 2PMZA 1WBLA 2TBVA 4CZCA 3AP6A 4X8NA 2ZMNA 1VPHA 2Q1MA 4XACA 3W20A 2VBWA 3UV9A 5APAA 4G6TB 5HCAA 1YLFA 1RJ8A 5T52A 3TW6A 1ULCA 4XQ4A 2VOKA 2XPWA 1WJBA 1NA1C 3Q8CA 3FLPA 4F3QA 5BNPA 2J42A 2O5RA 1HRV2 3LQCA 4ZY9A 1Z7UA 2B0LA 2CNAA 1MS3A 1QOTA 3ZX7A 4S0HB 3H5RA 1ETQA 2W52A 4II2A 4LMYA 1DLLA 4AC0A 3OGRA 2XQRA 3S5AA 2RQQA 3ASNH 3E3VA 5IVFA 3M8EA 1UX7A 2C6SA 2FE3A 4P9YA 1WLTA 5F5IA 1D0YA 3SHFA 5C33A 3MZHA 5FLHA 5EYYA 4HX7A 1I5ZA 2VM9A 3M8JA 2VUCA 2ZKZA 3N9QA 4Q48A 1B72A 2WZR1 4HX4A 2BPA2 2EF6A 3THTA 4U36A 2RJLA 1UY1A 3RKQA 4RYDA 4PBPA 2A07F 1VAMA 3N9NA 1ZARA 4HBNA 3F72A 3SCGA 5J7MA 2GIVA 3RSNA 2KPMA 1GP6A 5JVVA 4B48A 3W2VA 2VUDA 5J4YA 3GW2A 2HTJA 4NIHA 4BQXA 4IRIA 4OCTA 4OQ9A 4ANJA 4ET7A 4KNYA 3SH5A 4JOMA 1QVUA 4BISA 3Q0WA 2VXJA 5BV6A 4LO6B 2E31A 2V26A 1MJBA 1E2XA 1ZG1A 1PZ9A 1GZCA 5SV8A 4AM3A 5EYRA 2ARXA 3VL8A 1GV9A 3GZUC 1JUPA 4URTA 1DYPA 2BRTA 3VSKA 4MLOA 2RNJA 2CUFA 3PTYA 4HL0A 4HPKB 4U87A 3POEA 5C3RA 2KRHA 1SFPA 3I4MJ 5CVUA 5E1WA 2RE9A 1MEC3 2V6CA 2BUKA 1US3A 3QPSA 3POGA 2VXRA 2XH6A 3WX5A 2D6PA 2WC2A 3VYRB 2M1BA 3WDYA 4LBMA 3O1PA 2V79A 4LA2A 1MQTC 2XJVA 2NXNB 2E53A 2VZ3A 3F3XA 2K9QA 3TO9A 2QQ8A 2MBFA 3I2GA 3OYNA 3RQIA 1WJEA 5DUIA 3OYDA 3BOWA 1KDMA 2JA6J 1FYMA 3FXOA 3L1PA 5E17F 1D5YA 4QHBA 3UGFA 1J7KA 1QJZA 4XF1A 2EIJH 2NN8A 4CDQC 4SLIA 4HOBA 5HS8A 3S15J 4AFMA 5JHUA 3MPPG 3G1OA 5CISA 2QYOA 5DG2A 5FY7A 3BDDA 4G3YC 1EAH1 2ZNYA 1Y8RB 5IK4A 1GZ9A 1B59A 4RS5A 4OHWA 1TW3A 3OS2A 2DCEA 1FX5A 3T2TA 3VBHB 3OIQA 5A3PA 5BUVA 5FY0A 1S0JA 2YV8A 4U7DA 4FFHA 4COZA 2LSOA 1SD7A 1OCZH 3KP2A 9ANTA 1LNWA 3C2BA 1TT0A 1DZTA 5FZOB 2VQHA 5F5AA 2M0MA 1QY4A 2HWF1 2DFHA 1X1CA 4BXXJ 1C5HA 4LLNA 3K4MA 5CVJA 2B5HA 4JKMA 1FSEA 1EYBA 4KT6A 5LGTA 1GV2A 2JG9A 2HQNA 2MG4A 2TNFA 4MFEA 1ULYA 5F64A 2Z79A 1ZR2A 2L01A 1PNFA 3GHNA 4V2VA 4QX8A 2ELKA 2E5NA 4YG2F 2VCAA 1WW5A 4EN9B 2DPDA 4FPGA 2V9KA 1QVTA 1DGLA 1W6OA 2NRAC 5IT6A 2PMUA 1W6QA 2PJRB 3TP3A 4CDUB 1OSGA 3HGGA 3VZJA 1RHI2 1D1BA 1H9TA 4K8RB 1C1FA 4OIQF 2V5YA 2QQVA 3AKPA 4DRVA 3CCLI 1T08B 4KA4A 1T0FC 1HJGA 2GALA 4C1WA 4Y3OA 1X2NA 1DG6A 3M3YJ 4FCAA 3J9SA 2R7XA 1LVAA 5FY5A 2VIXA 3FHAA 4Q4W1 2DFCA 3V0BA 4BQ3A 3ZQLA 2WQ4A 5I8TA 4XNFA 2E1OA 5JFRA 4JX6A 2GZWA 5CADA 3ES1A 4XRFA 4ISQA 5ABJA 1UU6A 3VHNA 3KV6A 3AG2H 3I53A 1CJDA 3RPUD 4LBQA 4ITVA 1HDPA 3TO7A 2ZNZA 2F4PA 3KF5A 2WAAA 3QD6A 3WNNA 4DS0A 2RN7A 2R32A 2CWEA 4XYXA 3RTRA 1KU9A 1N78A 2R072 3W3CA 2YX4A 2KRCA 4E4HA 1JKPC 4DXZA 1YNAA 5M5WJ 4LIVA 1F4AA 4WK8F 5JOWA 1JZ2A 4BY7J 3EUKL 1CQTA 5KK1A 1WI3A 3ZMNA 4Y17A 1ODNA 3WV6A 1AR93 5FZLA 1E3PA 1OFSA 5FYMA 1U5TB 3L2RA 2WFPA 4FPYA 3BPZA 1Z6RA 2VGDA 4U7BA 2M8EA 2XVCA 1RUH2 1Q8QA 4MZUA 2VOOA 3ACIA 4AEDC 1JUIA 5AVAA 1AX0A 5JSRA 1HB1A 2PQQA 4O9GA 2HWC2 4Q4X3 5F3IA 5LBEA 3LEIA 1PZ8A 1HSTA 1Z1DA 4EJOA 4M00A 4S2DA 3H5AA 1UAAA 3NV3A 3NNMA 5LBQA 5L3GA 1OD5A 5F5QA 1SZBA 1L0OC 5GZGA 1XMKA 4CP0A 1UL9A 2ZX4A 4QGLA 2ZXWH 3PO2J 4I6ZA 2LF7A 5FIXA 3ZFEA 4M3FA 4MO3M 3CQZJ 1H2NA 1B35B 1IF1A 2G9FA 4CEYB 3GZ5A 4DEQA 1QJY1 4EV0A 1COV2 4YVSB 5FAXA 4XABA 4M3GA 2DOAA 1NAEA 3ABLH 2IVIB 2WS92 4XJUA 3MI8A 5BNOC 4CDXA 5IAXA 4BUPA 1X2MA 3VZOA 2DWRA 3LEMA 1QJU2 3H9GA 4OZOA 2V1NA 5DZGA 1XNAA 1S0EA 3TQNA 5DTDA 3I4NJ 4HBLA 3G2BA 2RNGA 5E16A 1JZ6A 2OT7A 1HXS2 1PIV2 2J5OA 4LE4A 2WV1A 2H8WA 4CDWB 2E1CA 3WR0A 1CAWB 2IXSA 1OT5A 4IV1B 1S0GA 1SFKA 2Y38A 2D6LX 2FBHA 2KIQA 3DV8A 1D1AA 5LA9A 4JX4A 3QYFA 1KGSA 4UFKA 2R5YA 4FPJA 1ONAA 1W8ZA 3GFIA 2X85A 3BG9A 4BH9A 4BE1A 3GBFA 2JEMA 4UI9L 2CAVA 1BR2A 4G9SB 4XDOA 1H30A 5DAPA 1ZREA 2F5CA 1J0RA 3R4UA 4L92A 1YUDA 4FPLA 3CLQA 4IGQA 3UR3C 2LRPA 4QKNA 3ZXEA 2BTVC 2XKOA 1WCSA 4KFCA 1JYCA 4RLFA 1UU5A 3HNBM 1YS6A 2NS0A 2V6EA 3H9QA 3K4LA 1G9AA 4HONA 2GP5A 2FQ4A 1OA3A 1U9OA 1G86A 4JGYC 3ENRA 1V6MA 4YW5A 2IFRA 5FZ4A 4XFGA 1Q1VA 4P9GA 1QMJA 2E9QA 2QQPA 4FI9A 4QPGC 5BXXA 2FOKA 1WCMJ 4JP0A 1AA7A 4B7EA 4Q8KA 1J2XA 3I55I 2Q4SA 1WJDA 3DEWA 3JBG3 3TO6A 2YS9A 4GMP3 1PGL2 3KE2A 1H8TB 2ZC2A 5T50A 1N3PA 1V5EA 1ZKGA 2QQ9A 4DXTA 3CJIB 3OY8A 3ZQCA 1ETYA 4COVA 5FKMA 4NIIA 3Q3SA 4BS9A 4Q4V2 5J40A 1BK0A 4XK4A 4AHXA 4AQ2A 1JW6A 2GAUA 4BQ1A 4R4ZA 5D5VB 1CZTA 2A70A 2O61A 4EJVA 5H2FC 3J7LA 1G4DA 2CWSA 5F6LB 1YI2I 5JVGF 4S04A 3ACHA 1DPRA 4U0VA 4QPQA 1OVPA 3NJVA 5J96B 3ZN6B 3WD5A 4HLXA 4FPFA 2WV0A 1R49A 3SNMA 4LKEA 1GLNA 4FSJA 3AJYA 3KVBA 5K5RA 2ORXA 1LOBA 1JT0A 2O03A 1LHVA 2VN2A 1A5JA 4D8MA 1BXHA 1YQCA 1HQLA 2Q2EB 4A3EJ 3ELNA 4FPOB 3ZYBA 4COWA 4HFSA 1BQPA 1SBDA 4QPIC 2IPQX 4XUOA 3MZYA 4EGYA 1YRNA 3H3UA 2W39A 2EPFA 1W0UA 1W6PA 4MGTA 3NNJA 3KQ4B 3QU3A 4BPZA 3WG7H 2DDAA 2DCZA 4BA6A 1SD6A 1YJWI 1IGOA 2DCYA 1K5MA 4XJAA 2CFXA 5F39A 1XYOA 4RB1A 4LK7A 5EJ1B 3IPVA 3M1HA 5A3TA 2TCTA 1U3EM 2WA4A 2GXBA 4CTEA 2RREA 3L2CA 5JIAA 1A6QA 2PJPA 2C5DA 5K8SA 3N9PA 4HG6B 5FO5A 1FTZA 2HLEA 4MTDA 5KAIC 5FREA 1FYKA 1WCKA 2DCJA 4HLYA 4XFAA 2WNUC 2LH9A 2FQPA 2GLOA 2M2EA 1R082 3CD6I 3N05A 3CCQI 1JT6A 3NJYA 3LA7A 1HDDC 3SZGA 1S2KA 4UW6A 1ZAOA 1PP8F 5ED4A 3FL7A 4XKBA 3KZIC 2C26A 2F5VA 2BFUL 1AR72 1R1VA 3RG0A 1MBJA 4KITB 2H27A 1V6KA 4RQPA 2RGVA 4M9ZA 3G6EI 3OYBA 1MEC1 2P34A 3I56I 2VTXA 5EG0A 1FOD3 5A70A 4OFGA 4K20A 4BOWA 3RI4A 1OCPA 5FKOA 3LOCA 4CHUA 3SKVA 1LENA 1GV5A 5F8PA 2XIGA 3LOBA 2XPVA 3ETPA 4YSFA 4Y20A 1TME2 3H0OA 3KP7A 1UIKA 3S32A 1VQKI 4XJWA 3AMQA 3W6VA 4MUVA 1SQ4A 3GTPJ 1ENRA 1J58A 1W9YA 2DBBA 2VXZA 2VOVA 4E7HA 5IOZA 3P3PA 4WM8A 3B7MA 1EP0A 2G1MA 1U9NA 4B29A 4FP2A 3MF6A 2C9AA 1BW5A 1PM7A 2MLGA 5A6XA 2ZFUA 3PNAA 1YO8A 2F17A 5C3EJ 4HSTA 3USSA 1TWHJ 2Y48A 1F1ZA 4GAZA 2MHFA 3LKJA 1RUI3 3I2JA 3M4OJ 3GF6A 4IOCF 3G1MA 4EJWA 4KJZA 4LUKA 1AX2A 4KQ7A 1A36A 3WLUA 4RD7A 1H9GA 3MHZA 1I3AA 5LA0A 2IGMA 1ZTRA 3WHBA 2XJUA 2EV5A 5F5CA 5A3LA 4QMAA 1MQTB 2Z3YA 1H0MA 5JI9A 2Q8OA 2VC0A 5JXGA 2L54A 5H9PA 4RSUA 4E70A 2ET1A 2JKXA 2VNRA 3BUCA 1NQJA 1NKGA 1E5HA 3UGGA 2BHYA 3AG3H 2O0YA 4Y52J 3J8F3 1C57A 3T3YA 3ZDSA 4CDQB 2HWE3 4ZXKA 3DPUA 3V42A 1DYKA 1NX9A 1ZRIA 2VG9A 5D6FA 1PK6A 4GYGA 4L9VA 2QSGX 2NM1A 3CJTB 1UMHA 3HOSA 4NN0A 2GN3A 3WQ1A 2VZOA 1TNTA 4BQYA 1KU7A 4E7SA 2BBYA 3ILRA 3RKXA 1ZZ8A 1F4KA 3RZOJ 2ARAA 3SCHA 3KT7A 2A3XA 2E33A 3CIHA 1ERDA 3QAHA 3K69A 1YJKA 1IG7A 4PF1A 5F0CA 3GJBA 3A2KA 1ZBA3 2ET7A 3ZO0B 3WF1A 1Z67A 4JAAA 2R1DA 4GGGA 1F31A 4JGZB 1S0IA 1KDKA 3BT9A 2RJKA 4EN0A 2WN3A 3VBUB 4L5JA 4QGMA 3ML6A 3A01A 3IAPA 3BR2A 2R5ZA 1N75A 4WZCA 4LO4B 4TWTA 4YZ5A 2RM23 3WW1A 3HVDA 1V54H 4A7ZA 2XF5A 3S3OA 4ES9A 4YW1A 2YC2A 4OI4A 1LESA 3ZOBA 2OX0A 4XIDA 2STTA 1ENSA 3UNPA 5FWEA 1JZ3A 2K4JA 4FO9A 1BJAA 2X5IA 3S7IA 1WLWA 2WZR2 3WP3A 3WG3A 3T0BA 4QXKA 2W25A 1AR91 1UG2A 3HT2A 1SAUA 2EFOA 1IXSB 4OQ8A 3AVRA 1MW7A 3MFCA 3N9MA 2JDPA 2D98A 2L9RA 4HK9A 3CL1A 2VE1A 3U1XA 2VECA 1AL0G 3V0AA 4XPVA 1H0BA 3OB8A 1UOFA 5C9AC 4QGNA 2LP0A 2OCEA 4AAXA 4Q4X1 3HSFA 3MWMA 4D6RA 4IE6A 1YG2A 4XL9A 5IFTA 1CAUB 1S8NA 1QH6A 1L3LA 2ZAHA 1QHGA 1W6MA 1WSUA 2Z2SB 3K48A 2L7FP 4PJNA 5F1RA 1HW1A 3KEOA 3Q9VA 2ZJQF 3ABMH 5M5YJ 2AUYA 3ZP5A 4NOTA 4EJTA 3J81K 3LZZA 4RGUA 4NE9A 4LHNA 1RKTA 1IG3A 1NLRA 3D0SA 1VLNA 2BZTA 1OA4A 1WBFA 4PLOA 3GVAA 1W0NA 1ZRRA 2GOXB 4HETA 1FP1D 4UV8A 5ICFA 4B43A 3DWLE 1SG3A 5JAXA 4S2GA 4ONUA 2XUMA 4R1HA 3GZAA 1N1YA 2XONA 2IGNA 2RS11 1RXGA 4N53C 4C9YA 1AR62 3UYJA 2W46A 1ZGWA 3T8TA 3MKLA 2LALA 2BERA 3M70A 1VQMI 4XW3A 4CYCB 4W65A 4DY3A 1REEA 2RS33 1KRIA 2LK2A 2AZ5A 5HXVA 4MIMA 2ARCA 2VZTA 2H6BA 1PVEA 5C8CC 3U4XA 1VRH2 2WWJA 4A2UA 1LHWA 2QENA 3FISA 2HFHA 2LG4A 2XB0X 2PQSA 4G9YA 3MQ0A 2A3YA 3VDXA 1P6RA 1XU1A 1XSVA 3PFIA 2F5EA 1FYUA 3E6BA 2Z1DA 1PVC3 3BR1A 4W6WA 5GZFA 3WP6A 1A3KA 3FWEA 1UY3A 5LK7B 2DA3A 3JQWA 2YPRA 3WHCA 2HWF2 1E3OC 3QQAA 3R61A 2RS53 2XC7A 2BBAA 4JTNA 2D1HA 3I3MA 3U0ZA 4YM0A 1J3RA 3OYFA 1F5FA 4JHTA 2GA2A 2FCUA 3HXLA 1ZZCA 1FY7A 4XOGA 2WB1N 2YUSA 4AOCA 3ZMTA 5IOYA 1GSLA 2JDHA 1YQ5A 4SBVA 2K7LA 5A32B 1ODMA 4RMNA 1F43A 1D4M3 2TUNA 3IDAA 4IEJA 3ATGA 5A3MA 1F35A 2K5CA 2ESNA 2VU9A 3WE2A 1KJLA 5D21A 4EWEA 4XAAA 1SBFA 4RBOA 4M9SA 3JBG1 4GMP1 1X3UA 1O4YA 2DBNA 2JB8A 3RMXA 3WNLA 2B45X 2VR4A 3OL3A 4MXWA 1UG0A 3T5XA 5DAQA 5FYTA 4MO7A 5GADJ 1V6IA 2QM3A 2A3SA 2VBBA 2IVMA 1QKQA 2D44A 1X82A 3F8FA 2YPJA 3EYYA 1GYKA 4ATEA 3WU0A 3C3VA 4KL1A 4A5MA 1BEV2 1CQ9A 4NRMA 4O5VA 3L7WA 2MD5A 2RV8A 1TQIA 4OAZA 1QEXA 2P3KA 1HKSA 2WT1A 1BI0A 3PFYA 4ZYAA 4AIDA 1V6OA 2VVEA 4JGYB 1IOAA 3KP3A 1NLSA 2O9LA 1WH7A 3CDZB 4QPGB 1SAXA 1MH4A 5CEHA 1UHWA 3HYIA 1Z91A 4LBNA 1VI0A 1SD4A 2HXOA 3S17J 1N3OA 2K85A 5JOZA 1JN2P 5A7PA 4KIFA 4XN3A 3VBHA 2WLPA 3OD0A 2NVUB 3S1RJ 3K75B 1DU6A 2QQUA 2WFF3 2WQ8A 2M7AA 3T4VA 4CXYA 5FZ1A 1CPMA 3ZRGA 4V2WA 2OAZA 5FZOA 3MV11 2NPIA 1VMJA 3HL2A 2BJSA 3H35A 2YBPA 1FXZA 1RETA 3TNPB 3NV4A 3LGRA 2A6HF 3SXYA 4EWAA 1CIWA 2JDYA 3J7AO 1SLTA 1YHFA 4D7YA 5ILVA 5DD8A 3I3LA 1XNCA 4HXCA 1YQ8A 4CZSA 2HS5A 4XBQA 1LEMA 2PJRA 3K70C 4LITA 3AP7A 4L0YB 1TNSA 1HKTA 5LA1A 3S1QJ 1YJLA 3PDQA 3ZMSA 4QPIB 1MNDA 2QNKA 1FOD1 2XAFA 3MPBA 2PHXA 1IV6A 2WA3A 1V6NA 5E8AA 2LFBA 2EIKH 5FZHA 3L9FA 1W3VA 4OUSA 1U78A 2EZKA 1XG1A 2ZEZA 4HN1A 4NMIA 3WP4A 4ZZ5A 1CF7B 1VBB3 3BTJA 3GX4X 5FK7A 1JS9A 1KZHA 2XL7A 4NIGA 3R4KA 2HYXA 4CU8A 1T38A 1FV2A 3M9AA 4OU0A 4ETSA 1H6XA 1QWRA 5ACA3 2COMA 3BG6A 5EDNA 5KXDA 3HKZN 1QQP2 3OYCA 1S72I 4A6OA 5LBCA 2Y8KA 5DYMA 2E32A 1P92A 4W6XA 3LIGA 2NP0A 4ENNA 2VQUA 2F5FA 1F5TA 4RS5C 4XZUG 4YRDA 3OIOA 4RDUA 1L3JA 1B9NA 5H20A 4K21A 3TGNA 1MS8A 2D93A 2E34A 1RUI1 5HODA 4BL0B 4QXHA 1J75A 1T2KA 3CHXA 4XHBA 4UFIA 1ZR4A 1CAVB 3ECOA 3TP0A 5I0DA 3CZUA 1I50J 1UO9A 1XGSA 2VAUA 1J1TA 5E3LA 2ZGKA 1Q8VA 3E5UA 1U5TA 3JRDA 1VBC3 4YFKF 2EIDA 2YU3A 3J4UH 5A80A 3HPNA 3LE0A 1N77A 5A33B 1SACA 1MZ6A 1EH6A 3K2OA 3CESA 2YG0A 2EZIA 1Y9MA 3RPUA 5CVIA 3J8F1 4M0NA 2HWE1 4M3CB 3K46A 3DPRC 5CKTA 4Y1UA 3MZ8A 3ZQIA 4YM2A 1HRV3 1HV1A 4AL9A 5KBFA 2M4KA 3K6GA 2P3JA 3DYOA 5ANNA 1GQHA 2D2WA 4DUXA 4MVTA 2DODA 1LEBA 4AI2A 4Z2WA 4LBKA 1HW2A 4JYKA 1BIBA 5KNLA 1O3RA 5HVQC 3E5XA 1OKOA 4LHSA 5LA2A 3OMYA 3DQVC 1B35A 1W6NB 1YOVB 3DEUA 3ON7A 3ZYHA 2V5DA 4CEYA 1AXZA 1ZBA1 4CPBA 4O6JA 2OCCH 4YVSA 1ZGJA 3ST7A 4II3A 4HG2A 1LOFA 3FMQA 4CP2A 5M0TA 4XMAA 1SPPB 3I2HA 4M73A 3OS1A 2W9XA 4F93B 3UJQA 3BTIA 5DM7F 2R0HA 5M3MJ 3DUIA 4D1QA 1LB2A 1VB4A 3DEEA 2Y31A 1AL22 3D5SC 1OPCA 1UYYA 1L7QA 1RTVA 3GTGJ 2ZHLA 2O8XA 1RKWA 4F55A 4GJYA 4NROA 2RM21 2M30A 1JI6A 2EQRA 3GALA 3O0VA 1W5CC 4I3PA 4CICA 4AD9A 4BHBA 4U0WA 5FYVA 3WOGA 5L3FA 3E0JB 2Q8EA 1B6AA 1LE8B 3F6OA 3OYEA 3MIEA 1RJ7A 5CZKA 2G9ZA 5FGMA 1CAWA 2LTNA 4MX3A 3E1SA 3KHBA 3MFAA 2DA5A 3EB7A 2ZHMA 4LKSA