4I09A

Structure of the mutant catabolite gene activator protein v132l
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
204
structure length
204
Chain Sequence
b'PQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKLGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 58
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i09A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i09A01
2O8XA 3WTUC 4IF4A 1CF7B 4IHTA 5D1IA 1GQGA 1IRGA 2KRFA 3KEOA 1UCRA 4Q0SA 1QXJA 1Z1DA 4L0ZB 4KNYA 4XLNF 4R1HA 2QZ8A 1ZREA 2MC3A 1P4XA 3IIAA 4JTOA 2DK5A 2JPBA 2M1BA 1NE6A 4WXHA 4OFGA 3HQXA 3RZZA 3FXQA 4R52A 2W85A 3PQKA 3DF8A 3WW4A 3Q5FA 2XRNA 1SD4A 4LG0B 4XF0A 4H0EA 1J9IA 2PN6A 2UXXA 3KEQA 3Q9SA 2CSOA 1YYVA 4N9IA 3F21A 4MTEA 3OV8A 2B8MA 4MGKE 2QUFA 2HKOA 3CLPA 2VOOA 2IT0A 1ON2A 4XRFA 4P9FA 3ETQA 1RIOH 3ST7A 2XV4S 1QQIA 2Q2EA 4RAZA 2LNBA 1LEBA 2V1DA 5IT3A 3LSTA 3C1DA 2J5PA 3QP6A 3BJ6A 3TQNA 4XF4A 4NHJA 4LA2A 3WTYC 4U88A 4IPAA 4OIPF 1LVAA 1HW2A 1XCBA 4HQMA 2W25A 2H6BA 3ZDSA 4AIKA 3K0LA 1BJAA 5FDBA 1ZRCA 2MD5A 2A07F 5E1RA 4OOIA 4L9TA 1O5LA 3OGJA 5CADA 4LB6B 2K4BA 3BJAA 2GH2A 3TO6A 4LK0F 2Y75A 3K9TA 4AQ6A 5FB2A 1P6RA 3WU1B 5KK1A 1J0RA 1W4MA 3VEPA 3U9GA 3K1MA 4WVZA 1RNLA 5K1YA 1LB2A 1Y0UA 2DI3A 3RI4A 2VOPA 1CAXB 1LR5A 1IF1A 2E9QA 3H50A 4UXAA 3KFWX 3GLXA 2K7LA 2LSOA 1AWCA 4R79A 5E16A 1CAWB 1FWZA 2ISZA 1ZVFA 4UV9A 4LUKA 3O6BB 4EM0B 3U0ZA 4P96A 5JSRA 3GEZA 2EV6A 3B02A 3HHGA 3FM3A 2PAMA 4LTAA 1SFNA 3ISPA 3C3WA 1REPC 2O03A 3VB2A 5KHKA 1B1BA 5HS9A 4BNCA 2A6HF 2UXNA 2V1UA 5K5OA 2ZXJA 2Q1ZB 2P7CB 5JR3A 3I71A 1LNWA 1CAVB 3BP8A 3ZMTA 5I91A 2BBYA 2BE5F 5CVIA 4YSFA 2HFHA 1B9NA 2IA2A 4ENNA 5DD4A 2CG4A 4FX0A 2BYVE 2Z33A 5KHJA 4PIYA 2DLLA 3HRUA 5HS7A 2DQRA 4HYEA 4BH9A 2Z3YA 3I0TA 4ZYDA 2FMLA 4AIJA 2J5OA 2JSCA 4EWEA 2F4PA 2GA1A 4LUMA 1S3JA 2DPUA 4ZU7A 1IXCA 2ZNYA 2FNAA 3HIFA 1XDSA 3FX3A 3H92A 4L2NA 3CO2A 1WQ2A 3RIRA 1YIOA 2FBKA 3F8MA 1KQ9A 3NJZA 1UHMA 4DNCA 1J59A 1TTYA 2HOEA 3NSTA 1SAXA 4KMFA 2PTMA 3RKXA 1EH7A 4HN0A 4LLLA 4EGYA 2I45A 3AAFA 1XSXA 2F5FA 3WODF 3UKNA 3MWMA 4ONUA 3EHKA 1BBYA 2A5YB 3LA2A 3RYRA 2PHLA 4JBAA 1KQ8A 4HSJA 4LA3A 2M30A 3CUQB 2A69F 4P5OA 4U0VA 4EJOA 5AIPA 2Q0OA 2CV6A 3HTUA 1UHWA 4Q0UA 2PLYA 4LB5A 2LKPA 3H7JA 4ENMA 3QOPA 1OFNA 2D40A 2EFPA 3HOTA 4CZZA 1DUXC 3LA3A 5IT9Z 1JHHA 4M71A 5D6EA 4P9GA 2IA1A 2HJIA 2OBPA 3I4PA 3D0JA 4WF2A 1MGTA 1R22A 2YR2A 5JVTA 3RYKA 2QQAA 4Q29A 4BQAA 1YFYA 5H6QA 3ZMDA 3ULQB 4BXUA 3N97A 3HRTA 1Q5OA 4PZJA 2MNGA 4I0AA 1MJ9A 2JT1A 4ZH4F 3CF6E 2RV8A 3J81Z 5CVVA 3RDIA 3MZHA 1F4KA 4JV4A 1D3YA 1KQ0A 1EH6A 1VJ2A 4NVPA 1IW7F 2QNKA 1BI1A 4QX5A 2ESNA 5HLHA 4G7HF 3IC7A 5CYVA 3ZN0A 2NYXA 3LZZA 5KVRA 4EJWA 3HUGA 4UUVA 3S7EA 3L2CA 3V8JA 3D82A 4OU0A 1H1MA 1XSVA 4FX4A 3FFQA 2OZ6A 3ROUA 1GVJA 4XFFA 4QM9A 2XUBA 5I8YA 5BS6A 1YO5C 1ONVA 5DCMB 3KLNA 4IEXA 4KWLA 2FXAA 5HS8A 5FCCA 2OD5A 2STTA 5FFXA 3FHIB 4ON0A 2K27A 3OTFA 1G3TA 1L0OC 2GZWA 5K5QA 2KIUA 4NQWA 5JSOA 4HN1A 5ILUA 3M8EA 4PDKA 1J3RA 2XAJA 4YIIA 4EWAA 4JK1X 3IKVA 1HQCA 2EVXA 1BM9A 3F8FA 1K78A 1Z91A 1ZZ6A 4HAMA 3RKWA 2VODA 4B09A 1U5TC 3E6CC 1IRFA 3RPUA 3KP2A 3EYIA 1X3UA 2C0ZA 1SFUA 2BGCA 3T1BA 2P6TA 1GQHA 2WTEA 4HSLA 4LD5A 3KP5A 4QGNA 2FQPA 3RKYA 3V8KA 4J1XA 3H8UA 1BI0A 1G3YA 1XCVA 4OIOF 2RVCA 4NB5A 2G7HA 3F6OA 4O9GA 1MKMA 4KDPA 1ZX5A 5ICEA 5F64A 1DDNA 2XHKA 2DAOA 1R36A 3FM5A 3KP3A 3WTTC 4I09A 3SCGA 1NYWA 2EFOA 4S04A 2VC1A 3QU3A 3QP5A 3MPBA 3E5XA 3E97A 4KWJA 4DINB 2FBIA 1ZZ7A 1X8MA 4ESBA 3HSEA 5HVQC 3ML6A 2ZKZA 3OOPA 4MH0E 4KT5C 1OMIA 2OQRA 4P55A 3KSCA 1FBSA 1FSEA 3WG9A 2CAVA 3MEXA 1PP8F 4O5VA 3REOA 3U11A 2QENA 4RAYA 1U5TB 2VN2A 3EJKA 1WI9A 1ZLKA 1P4WA 2RN7A 4Q0VA 2IRFG 2W84A 2KIFA 4A5MA 2VPVA 2V09A 1OR7A 4EM1A 3HT2A 4FAHA 2D1VA 3FMQA 3K1PA 5LHHA 4HVOA 5JHUA 2H94A 1IN6A 3D5LA 1Q1HA 2PQQA 5HDGA 1JUHA 5L3GA 4IXAA 4ZYEA 1Y3TA 3SHFA 1BC8C 4L9JA 1IPJA 4RB1A 2COMA 1W7PD 4UBHA 1E17A 3F8CA 2Y0OA 1IAWA 3L7WA 1ZG5A 1MDMB 4ZYHA 4MNUA 2HQRA 1NXMA 1OI6A 2OZJA 2HDCA 1EPZA 4M9ZA 4E2GA 4A2UA 2F5EA 1I27A 3TKYA 4HV6A 1TW2A 2G7UA 2B5HA 2FBHA 1HXDA 4HX4A 4M72A 5BPIA 3ECHA 3WU0A 4KU7A 1B9MA 1YHFA 4CXFA 3ZMUA 4AVBA 5C6CA 1LJ9A 4QLCU 1D8JA 5LBQA 5FPXA 1F9NA 3HSFA 1WRJA 2ZKLA 4YFNF 3LAPA 5AVPA 2VQAA 2IA0A 3DXJF 4ESFA 2QDRA 2C6YA 3D0SA 2L4AA 1EV7A 1SQ4A 1S29A 4OIRF 2FMYA 4RB0A 1FYLA 3PNAA 1PUEE 3EQEA 2IP2A 1FI2A 4OINF 4A12A 4EV0A 4MX3A 2HKXA 2JPCA 1S8NA 2V79A 4A0XA 4A6DA 2CYYA 3USSA 5ERIA 3DN7A 3HRSA 4AWXB 2BNNA 5CLSA 1U12A 4PGHA 2XL9A 4ENKA 2EFQA 1MZBA 3I53A 5FLJA 1XMKA 1IN7A 1S6LA 3P9IA 3V8LA 1UD1A 4XFBA 1ULYA 2PJPA 2YU3A 5BMZA 1U78A 2XAFA 3G7DA 1R5GA 2O6GE 1O3SA 1ZGJA 5J6XA 4BIFA 5D6FA 4LULA 3GYDA 1FBUA 1ZZCA 4MTDA 4IRIA 3GFJA 4M6XA 2RDPA 1DZRA 5I93A 1B6AA 1W5SA 2NNYA 2EA7A 1ON1A 1P92A 4XFGA 5IT9K 3RJPA 3M70A 2CQKA 3BY6A 3I5UA 1RL3A 3O14A 3SXWA 1R00A 4HDVA 1MD0A 3CTAA 3GXOA 2A61A 4LLOA 5ICCA 2W24A 5DEQA 1OYYA 1WWXA 3BJOA 4BYYA 2FEZA 2EA4A 2EWNA 5E1WA 2FRHA 3ZN1A 1PP7U 2PHDA 3J81K 4N9HA 4ASNA 2RQPA 5LGNA 1G6NA 1L3JA 3G73A 3R60A 4G7OF 3GW2A 5J7MA 2H09A 4L0YB 4LEJA 4EJUA 5I0RA 3DQVC 4O3MA 1LDJA 3ABUA 2EK5A 1FYKA 3KMHA 3DFGA 3EDPA 3IHUA 5BPXA 3WTWC 4MZUA 3WE3A 3LQQA 5I0TA 2FNPA 3WGGA 5D5XB 2AXLA 4EMSA 5HLGA 2E7XA 2Q4SA 4GGGA 1ZZBA 3MQ0A 1CAWA 4X6QB 1ZYRF 3KLOA 2XKPA 2DT5A 2B9UA 3UKVA 4HVQA 3S7IA 2P4WA 1YG2A 2RC4A 1CAUB 2XGXA 3KZYA 1NZCA 4IEVA 1D8KA 3SCFA 3CDHA 1UIJA 5K5RA 3T0YA 4HA8A 1Z05A 4KIBA 1J7KA 4QGMA 2QCSB 1W7PB 1SMYF 1QBJA 2A6EF 3LAGA 2GC2A 3C7JA 2K86A 3MYXA 5J8FA 4G8XA 4KIGA 3F8NA 1UPIA 1CAVA 1IN8A 1YFXA 1UFMA 3QPTA 2IC1A 4E2QA 2EJRA 1J5YA 5JI6A 1K79A 4FAGA 3CLOA 5DUIA 2RKHA 4HLYA 4BHCA 5L3CA 5BQTA 4KWKA 3GZ5A 2MH9A 3U2RA 1U2WA 4LLNA 1LKNA 1PMIA 1YS6A 3KP6A 3S2WA 2RGVA 1TNSA 5KHGA 2FSWA 5FGMA 3HT1A 5E17F 5L3DA 2MH2A 4EM2A 2PMHA 3CO7C 3FHZA 3LOIA 5F1RA 1EYBA 4HOBA 1Z6RA 1T6SA 2EV0A 2G9WA 3MDPA 2XAQA 4HMZA 3MFKA 3BPVA 2PFWA 3FMRA 4HX8A 1FX7A 1XRUA 5BUVA 4YFXF 1D5VA 4HV5A 3TOBA 3NKTA 2RNJA 4UVBA 3CUQC 5EFUA 4M9SA 3L9FA 4IEOA 4CO8A 3NRVA 1IPKA 3LWFA 4KIFA 1OPCA 2V1XA 3K2ZA 2DO7A 1O3QA 4IEPA 5D5UB 4ESJA 1OD5A 2F2EA 4RGUA 2HZTA 2AS5F 3KGLA 3I7DA 1EY2A 3TOAA 5HDKA 5J8CA 4Q0PA 2Z69A 3BWGA 3H3UA 2K9ZA 2P17A 2MLKA 1I5ZA 2V6CA 1ZNPA 1FZPB 2O8QA 4Z82A 2Q0AA 2GA2A 3C3VA 1C0WA 4H7LA 1T98A 4I01A 1FLIA 1V70A 3BU7A 3H9AA 3IDBB 3R61A 3HYIA 2Z9OA 4IEYA 2A68F 4KYWA 2E7WA 1J3QA 4PIZA 1Q3EA 2P5VA 1OYWA 1KGSA 4P9UA 3GFIA 4AVCA 2D5HA 5HOOA 3N4MA 2TDXA 4EROA 1Q43A 5FD5A 1KU3A 5E8GA 1ZH5A 1FP2A 4HLXA 3SHRA 5JSPA 1QPMA 3WTVC 2DBBA 2Y48A 4LLGF 4HW0A 2VE8A 1YFUA 4IVNA 2OYZA 2GXBA 3BALA 1O4TA 4KU8A 2QWWA 1E2XA 2QQ9A 1CX4A 4OMZA 3GYHX 3R6SA 1DPRA 2M45A 3L00A 5ILSA 1DGRA 4O9EA 4Y15A 2OA2A 1ZZ9A 4G7ZF 4L18B 2KJCA 5DCMA 4Q4ZF 1BN5A 2P8TA 1T2KA 3CEWA 1H9GA 4KICA 3MZYA 1U6GA 1YFWA 5DV5A 2CFXA 4ZZLA 4A6EA 3PQJA 4YARA 5LRSA 2XASA 1FP1D 3GVAA 1R5HA 3GZ6A 2VT3A 5JCTA 2LDUA 1YS7A 3WTZA 2ZBKA 5I8TA 3IDCB 4LK1F 4MGRA 5LGTA 5C8WA 2FOKA 1TQPA 2STWA 5K8SA 4A5NA 4IRGA 3CO6C 2QBYB 1K6OA 2EFNA 1ZLJA 3I59B 4M74A 5KHHA 4M73A 2PMUA 1P4AA 2ETEA 2ET7A 4JVAA 3SZTA 5TRDA 2D93A 5FQ0B 3CJXA 3IRQA 2FE3A 4MGIE 3GFLA 4GCVA 2MHFA 3L2HA 4G94A 2IXHA 2OA4A 2XL7A 4GXOA 3FXRA 5LRRA 1BIAA 2Z2SB 3HRMA 4CDGA 2D2WA 1LQ1A 3DEUA 3ZQ7A 1Y9QA 1XB4A 3TO7A 3C18A 3QU6A 3TNQA 1O7LA 3M8FA 4WK8F 3KZZA 3P7NA 4FBFA 4AXOA 3GX4X 4XEZA 1CGPA 2ZFWA 2A3SA 1U5TA 5J48A 2UYAA 3FZVA 4XLPF 3NQOA 2P6SA 2BNOA 4WCGA 4HZFA 4XFAA 3V7RA 3H1WA 2GIVA 2GC0A 1A04A 2DW4A 5CVJA 3TDUC 4IHSA 3NW4A 1JHFA 3K1NA 2M5WA 5FD6A 4XF9A 2IXCA 2K02A 4LGWA 3S0MA 1TNTA 1YLLA 1V4RA 4HDUA 4IEUA 3ZPLA 2ZMEB 1QNTA 1B4AA 4WBBA 3I64A 1T39A 1J1LA 1H1IA 2VBZA 1MDMA 4L5IA 3ECOA 4RGRA 1RC6A 1ZRFA 3E6MA 1UB9A 3I58A 2O1QA 1OYIA 4XBFA 1FSHA 2XVCA 2NAZA 3M7GA 1BI3A 3DV8A 2L3DA 1ODDA 2ADUA 1G3WA 3WTSC 3DL3A 3GBFA 3E5UA 1YTYA 2IXIA 2K0GA 1QY4A 1W5TA 1ZG3A 3CL1A 1H0MA 1XGMA 3WTXC 3MAJA 4YFKF 2P5LC 1I1GA 3SZPA 4XF1A 4Q48A 2XLAA 3NVCA 3F8BA 4WX9A 2HYFA 4BAYA 3WW1A 4Q47A 3J80Z 1SD6A 1XE7A 3RYPA 4I3PA 2R7FA 5AONA 2GC3A 1PDNC 1X8EA 4UBGA 3WE2A 3TGNA 2HR3A 4YNIA 4GYGA 3T5XA 3TDZC 4JTNA 5J3UA 1CF7A 5D4RA 5L3BA 1LRHA 1YUDA 1QGPA 2PFBA 1VP6A 5I8SA 1H9TA 3COAC 2UY9A 2MA3A 4K8FA 2CWEA 1R7JA 3BDDA 3P9KA 1FT9A 1FC3A 3EQLF 5LHGA 2CW0F 2M87A 4MGZE 3TO9A 4O6JA 5DYMA 3FXUA 1F1ZA 5DUKA 3F3XA 5E1ZB 3LA7A 1R23A 1I1SA 1QXRA 2R7DA 1XMAA 1G4DA 1LDDA 1X7NA 2ATFA 4L9NA 4G6DA 2ZNZA 4MQVA 2UYBA 2H6CA 2DK8A 3ERED 5JR7B 2WC2A 4B8XA 4HF2A 3IKTA 4LG0A 3UKTA 1LDKB 2OU2A 4LFUA 3M3IA 1R1TA 5HI0A 3I54A 3OCPA 1STZA 1ZARA 5D8KB 1TQ5A 3LAJA 2D5FA 3LFKA 1IZ1A 1FYMA 2CO5A 4EGZA 4XFHA 1YW7A 4MEXF 3W6JB 1XGNA 4F8AA 4GYIA 2ZO4A 2GWRA 1HKTA 3GO5A 2XAGA 3J7AO 4KN7X 2MPFA 3R0AA 4EJTA 2IXLA 4EVIA 3WW3A 5BY5A 3GUDA 2H0VA 4FT8A 2HTSA 1USSA 5LEJA 2WV0A 3H1YA 4I2OA 4ORFA 3ACLA 3HTSB 4WXCA 3F6VA 2K4JA 5BV6A 1CAUA 1XE8A 2EB7A 2JRTA 2JZYA 2L02A 4XSXF 1I6XA 4CICA 2DU9A 1UIKA 5CVRA 4I98B 2OQGA 3DPLC 1TBXA 4QXKA 1W7PA 3VFZA 1HW5A 2O0YA 2L01A 4WWCA 3BB6A 3EETA 1HW1A 2NNNA 5I0SA 3WW2A 2MLGA 1CAXA 3KETA 3ZMVA 4B29A 4ZYGA 2YSRA 2HQNA 2UZKA 3FJSA 1WSUA 1XGOA 3PLQA 5E18F 4META 2OZUA 3HOSA 1IN5A 2GU9A 3JSOA 2IJLA 1KU9A 5H20A 4HVRA 2DQLA 5HLIA 2GC1A 1O7FA 1B59A 4AVPA 1ZRRA 2ZJ2A 3ZP5A 2PG4A 4HBLA 1RUNA 3JAMZ 2GAUA 4F7ZA 1J2XA 4L11A 1U3EM 4PJYA 1BOAA 5DDGA 2VONA 5JAXA 1GHCA 4ETSA 3SQNA 3P9CA 1SFEA 2PEXA 2KIMA 1VR3A 3T8TA 4AQ2A 1T38A 1AOYA 2XKOA 3U10A 4IEQA 1WLTA 5D5VB 3IRRA 4I02A 2QLZA 4PGGA 2OPKA 2QQBA 4MQ9F 5BXXA 4GULA 1QO0D 3W6KB 3OD0A 4X6RB 3V7CA 1ZAOA 4ENJA 3MCZA 1SMTA 2LF7A 2DFIA 2EA2A 4HF1A 3WGHA 2NS0A 1IXRC 2BNMA 1S7AA 1T0FA 4YG2F 1QWRA 1WA4A 1F5TA 3FF5A 4D7TA 1TQIA 4MEYF 4RS8A 2BEOA 1R58A 4CYDA 3E3VA 2EAAA 3F22A 4BHPA 3SMHA 3GWZA 1HBXG 4RB3C 5FLXZ 1R1VA 2YX4A 4HBNA 4HX7A 4RGXA 4QM8A 3IWZA 2FA5A 4Y13A 2DCTA 1DP7P 4BHBA 3ZMSA 4U0YA 3FZ3A 1DGWA 5CVUA 1FOKA 2P7VB 5D8LB 3QACA 4JQFA 1O57A 1YW9A 4ZZDA 1HSJA 5DCFA 1WKMA 2KXLA 3VHRA 3H1MA 4E70A 4R8HA 1SEFA 5A2QZ 1S7OA 4I0BA 1J3PA 2E1NA 3CUQA 2F5DA 1JXSA 1IUYA 2CGPA 4ZU4A 2Q8KA 1O3TA 6PAXA 1XDUA 4RGSA 2PYTA 5LEKA 2B0LA 4IJAA 3IWFA 4EJVA 2BV6A 1L3LA 2HGCA 3BZ6A 4M9XA 3R4KA 4QMAA 2R3SA 2HTJA 2QVSB 4XFIA 1IN4A 2VBYA 2X0LA 1QZZA 2IXKA 5EEHA 4IESA 4HLTA 2ETHA 4L5JA 2XAHA 3M9AA 3QPHA 1JE8A 2ZCWA 4EWDA 3RTRA 4Y17A 3OF1A 2QVOA 1TW3A 3BROA 3J80K 3JW4A 2VXZA 1O5UA 4G6QA 3NL1A 4KFCA 3KGZA 4CGZA 5FO5A 2YPRA 2IPQX 2HYGD 1VTNC 3E5QA 1J58A 4GO1A 4I7HA 2F5CA 1RTVA 2QJVA 2DPDA 3RNSA 2N7GA 3BPZA 1UCXA 2DTRA 3KP4A 3EO6A 1TQMA 4TV7A 3SCHA 4D0PA 3VOEA 1KYWA 3HSRA 4IRHA 5L3FA 5BPDA 4XETA 4XSZF 2VE9A 3KP7A 3ES4A 4EQQA 4UVAA 2QBYA 3NEUA 3GFMA 2D45A 1K7AA 3I59A 4WXDA 1NHAA 1ZG1A 4IERA 4YYOA 3FWEA 3DPTA 3GF2A 4S05A 1BIBA 2WFPA 2Z99A 4G9YA 4AD9A 1GXPA 1EP0A 5FQ0A 1HKQA 2KJBA 3JSPA 1FY7A 2PA7A 3SFZA 4OMYA 1TLHB 3R0JA 4FHTA 2UWMA 1LEAA 4WZCA 5T3NA 1HKSA 5FPZA 4J1WA 2PI0A 2X4HA 2M8EA 3IL2A 3H7YA 4KUMA 3WGIA 1SFXA 2E1CA 1X82A 2EFWA 3F23A 5LHIA 4UVCA 3DP7A 2Y0MA 4A0ZA 5KHIA 1WGPA 2GXGA 5FLHA 3FMSA 5EEGA 2ISYA 5E8IA 3T8RA 2GQQA 1Z9CA 2PQ8A 2PAKA 2IXJA 1EH8A 4N0BA 2Z5UA 3L09A 4U7DA 5ICFA 5I0UA 3F72A 4IEZA 2XLGA 3O3KA 2XROA 5D4SA 1R1UA 5ICGA 2ZMEA 3ABTA 4YIFA 5F6FA 4OLLA 3KE2A 4RD7A 1DPUA 3PVBB 2YX7A 1KU2A 4XFCA 2UY8A 4Z07A 3K69A 3BPXA 2PAEA 4PCQA 4AIHA 1GXQA 2HWVA 3ELKA 1BI2A 1HSTA 3H3ZA 5H6RA 5E1XA 1P2FA 4OIQF 1PM7A 3V4GA 1SD7A 2VT2A 2Q30A 2ELHA 5DD8A 4U7BA 4K2EA 4LJZF 1IXSB 5CJ9A 5LLQA 1YW8A 3SXYA 1RI7A 2KKOA 1YQAA 2OAZA 4MHGA 4XF3A 1OKRA 4RB2C 3IBMA 4MUVA 2HS5A 3E6DA 4A0YA 2L4MA 2LF8A 5ED4A 3JAMK 3EYYA 1ZN2A 1YFHA 3HHHA 3JTGA 2XIGA 1ZGAA 1YLFA 4LMYA 2FU4A 1Z7UA 1USTA 2FF4A 3KCCA 3B73A 3V7SA 1K78B 4CHUA 2L54A 1DZTA 1FNNA 2EV5A 3DKWA 4D7SA 2H27A 1ZHFA 2FQ3A 3RPQA 5KBFA 1YWKA 1V3FA 3G3ZA 3M1EA 3JTHA 4PIXA 1SD5A 2ESHA 1ZRDA 4UV8A 4QWQA 3QRFF 2HEOA 3U1DA 2VBXA 1RUOA 4Z2YA 1QZYA 2XLFA 3ZMZA 5EZWA 2ACJA 5HDNA 4AVAA 2ET1A 3O2PE 4IETA 5TJJA 1KU7A 1MJBA 1Z6TA 1RGSA 5FLXK 1KA8A 2IW5A 2P5KA 1FPQA 4YRDA 2V9VA 5BOXA 4MGYE 2O3FA 2VC0A 1ZZ8A 3ELNA 4KA4A 5LGUA 4DQ2A 4IEWA 3PFIA 1RZ4A 3CUOA 1O3RA 2QM3A 4KN4X 5FLIA 1UW8A 3LQRA 1NE4A 4U0WA 1KYZA 4E2SA 5ILVA 3FE5A 4KL1A 5A2QK 4ZU5A 3EUHA 2QYOA 2IVMA 4M6YA 3Q9VA 2O61A 1G3SA 1MJAA 4UNOA 1XD7A 4HQEA 2NRAC 1XSDA 2WWYA 3BOQA 3TNPB 4KMUX 1FXZA 1XGSA 1BC7C 4MV2A 2MBFA 3LWCA 2VBWA 3E6BA 3EBRA 3QAHA 3ES1A 4QGLA 1U8RA 1XN7A 1J75A 4UHTA 3BCWA 2W57A 2JTVA 3VODA 5D5WB 4UXNA 4HF0A 5L3EA 2VECA 4Q0QA 3CJNA 3JZVA 4Q5SF 1JGSA 4L9VA 5JFRA 2D1HA 5AIQA 1FBQA 5FFZA 5E20A 4TLFA 5CU1A 2PBIA 2CAUA
chains in the Genus database with same CATH superfamily
2O8XA 2CW7A 1RUF1 3ZMOA 4E4ZA 4MFDA 1GQGA 1IRGA 2IGMA 5FKBA 1W39A 2WAAA 2YV8A 4BGDA 3D8CA 1W6MB 2QQWA 3WDVA 1P7IA 3F2ZA 2MC3A 3VDBA 3RI8A 2CW8A 1ZR4A 2X6OA 1OCCH 1EKEA 1NE6A 4WXHA 3RZZA 2JB4A 1V9U1 4L8QA 2FDGA 4AEJA 5T54A 2PLV2 5FJKA 1NLRA 4IUGA 2D6LX 1SD4A 4LG0B 2I07B 2PJRA 1MH3A 5FRAA 2G4IA 2RM23 1F5FA 3L2WA 3C2HA 2ZGUA 3CQZJ 2ME0A 3CP8A 4FTHA 3M7AA 2QUFA 4LBJA 3CLPA 5JOYA 4AGRA 3I4MJ 1ON2A 4LKSA 2HOAA 5EG0A 1SC7A 1RIOH 2BW3B 2RNGA 1RUE2 4EZHA 5FZOB 2LNBA 4J19A 2Y6LA 5C4XJ 2J5PA 1YI7A 3QP6A 2PN5A 3LFUA 5B66C 4LA2A 1TWAJ 5BNOC 5JLVA 3CCQI 3SKJE 2E53A 1AYN2 5FLVA 1FEXA 4AI2A 1W2TA 2EH3A 1NTCA 5BNOA 1HJFA 4Z2AA 2PHRA 5HV0A 2VOTA 3BTIA 4OOIA 5BNNA 5CADA 2ZGQA 1TME1 1N1TA 4K8RB 1UO9A 5FZBA 3FDYA 2W0XA 2X1EA 3K9TA 3C7EA 3Q8FA 3WU1B 5KK1A 1J0RA 1SLLA 2VKHA 3N7MA 1CD3G 3U9GA 1KJRA 4WVZA 4ZJZA 4HK9A 3OYJA 2XXZA 4UAPA 2PMWB 3RI4A 1IF1A 1GP5A 3OYWA 4MXWB 4E7SA 4UXAA 2K7LA 1QJX1 1AWCA 1KS5A 4UV9A 4QPGC 2WZPP 5CFCC 2EV6A 3HNBM 5JDBA 4LTAA 3ISPA 2H1LA 1JODA 3LSIA 1REPC 1KS4A 1W0UA 2HVSA 5KHKA 5HS9A 5JXHA 5CFCA 1ZA7A 2UXNA 1Z77A 2GALA 1EAH2 1MH4A 3H5RA 4C8DA 1PVEA 3F0CA 2P7CB 2BHZA 1CAVB 2R7RA 5I91A 2BE5F 2W3JA 3VHOA 3PURA 3VBRC 4GWJA 2RS32 4DXZA 1JJ8C 3S5QA 2IXSA 3RZHA 1IG3A 5HS7A 4BH9A 2CYFA 2WYFA 2KL4A 4ZYDA 2A6WA 2J5OA 1IKPA 3L2UA 1BEV2 2IGNA 1IXCA 1Y9MA 2ZNYA 4FE7A 4NHLA 2YUEA 2DCEA 3K2OA 5F6KA 4L2NA 2L7KA 1OFSA 1YIOA 2FBKA 4ZYAA 3KF5A 3HNMA 1VAMA 5H2FC 2J42A 2Y64A 2BHYA 1W8UA 5A7WB 4QQHA 3RMYA 1Z7LA 2R071 1TTYA 1SAXA 4KMFA 5T55A 3FXLA 2V4VA 4EGYA 3BR6A 2I45A 3AAFA 2F5FA 3WODF 5EZGA 1VE0A 3LIHA 2CU5A 2V9KA 4M0NA 1O8PA 1GBGA 3MWMA 2DDAA 1BBYA 1T8IA 3RYRA 1C1LA 2PHLA 4JBAA 1KQ8A 4QQLA 2PHWA 4Q4X2 2LTPA 4U0VA 2XVLA 2Q0OA 3M3QA 5JPMB 3K4CA 5F39A 3OYKA 2O0OA 2WKKA 5L9VA 3ZRGA 2DA2A 2ADDA 1OFNA 3DBRB 4QKDA 4OQ9A 3PSIA 1FPN2 3HXLA 2W1UA 1UOGA 1SDDB 4XNFA 3LA3A 4M71A 5D6EA 3J7NA 3HNYM 3D0JA 2W47A 4WF2A 4YZ5A 1A8DA 1AL23 1I9RA 4IHXA 3JCIA 4CSWA 3IKWA 1Y1VJ 3ULQB 3VHNA 1FOD2 4IL7A 4PZJA 4IV3A 4BQYA 4I0AA 2RV8A 5EYXA 3GJAA 2ZSIB 5E8AA 3RDIA 2JA5J 3CCUI 3IH4A 4FQ4A 2W46A 4XIOA 1W8OA 3HD8B 2QNKA 2GMPA 1YJKA 4G7HF 2M3AA 1L7RA 3ZN0A 3OUJA 3IP4B 2UWAA 1SLCA 1E5RA 3V8JA 4CH7A 3D82A 1H1AA 1XSVA 3FFQA 5K9YA 1JGGA 1JTZX 2HEYF 3H5NA 3H8OA 4QU1A 5M0TA 1YO5C 5DCMB 2IWGB 3BTAA 5HS8A 5FYIA 3NNMA 4XCAA 2EALA 1D5YA 3FHIB 1LE8B 2X29A 5F37A 3OR1C 3HKZN 4LK6A 3VBOC 2AHQA 1OLQA 1A35A 4NQWA 2W87A 3VYRB 1TNRA 2YB7A 3O1TA 3OL4A 5IW0A 2D6OX 3ON7A 3VBOA 4PDKA 3ZYJB 2VZOA 4Q2FA 1YHQI 2WRAA 3H8RA 5FREA 2XAJA 1KFUL 4WVMB 4XMIA 1YXWA 1XNCA 3IKVA 1GNZA 1J83A 3AC0A 4JP0A 3WD5A 1YRNB 1Z91A 1JTXA 2W91A 2VODA 1U5TC 3E6CC 1RUH3 2EZKA 2ME6A 1F35A 3WDWA 3KP2A 2ZHLA 1F4AA 3JRGA 3PJQA 1IO2A 3AMHA 5DAXA 3VKLA 1HXS3 2L9RA 2P6TA 2R1BA 1GNYA 3J7MA 4CEYA 2WTEA 4LD5A 4CEWA 2FQPA 4J1XA 3H8UA 4OIOF 2DFCA 4N8MA 4NB5A 2G7HA 3PIOF 1MKMA 4KDPA 3HN3A 3QOEA 4QX3A 2VJ4A 2LROA 3C7HA 2OUMA 3WTTC 3PVEA 1NYWA 3MPBA 4XORA 2VBDA 1G9BA 3LOCA 4XBLA 3VD5A 2P6CA 5HVQC 5IYCJ 2TRTA 1C57A 4OHZA 1GYKA 4XQ4A 4BLIA 1FBSA 4OHWA 1PP8F 4EN9B 4O5VA 2O8OA 2QENA 1MIJA 1OBNA 4BB3A 1P4WA 4Q0VA 1JKOC 1JW6A 3R0RA 1GUUA 1E5SA 5FFOC 3H3VK 2OXBA 1UOBA 4FAHA 1AA7A 4HVOA 2H94A 5C9AC 4U36A 5ISLA 1EA3A 2CQXA 1IN6A 2J22A 2VAUA 1Q1HA 5HDGA 5IOZA 4ZYEA 5FZCA 2QQVA 4MGSA 4B3AA 1COV3 1W7PD 1B72B 4RFRB 5L9BA 3FMGA 2VC9A 4BJTA 4MNUA 2HQRA 1NXMA 2OZJA 5M5XJ 1F15A 3GTJJ 1APNA 2F5EA 5EGOA 1X9TA 2JE8A 3TKYA 4HV6A 4PF1A 2F4OB 1AR73 2KHMA 1B9MA 1YHFA 4AVBA 5KR7A 4QLCU 1F9NA 2Q8CA 3HSFA 2XBO2 2JX9A 4HANA 4M01A 1IZ3A 4YFWA 4C1XA 4UB8C 5AVPA 1ULFA 3S32A 2VQAA 2MC4A 1TVGA 2LOOA 2KR2A 1W6MA 5F3EA 1UYXA 2C6YA 1UX7A 3MV01 4IGQA 1SQ4A 1S29A 1X2NA 2HWC3 4URAA 1FYLA 1L7LA 3TN91 1PUEE 1FI2A 4OINF 4NO4A 2QQIA 4MX3A 2B7EA 4OI2A 3NNFA 1IGOA 4A0XA 4A6DA 2CYYA 3MIHA 1AR61 3DN7A 1R081 3T4HB 3GZAA 2BNNA 1RPWA 2J7MA 3F95A 3DLLF 1MMAA 5F0HA 4E8DA 1MZBA 2VNGA 2LKXA 4UFIA 4Y20B 1S6LA 3P9IA 1WGXA 2M0MA 5FYTA 5FKMA 3MKLA 1ULYA 4CCJA 2HQAA 5E6HA 1FMVA 1R5GA 3LDRA 1O3SA 3NAPB 5D6FA 5EJ1B 2C9KA 2BW3A 1HRI2 2EIBA 1OH3A 3JQWA 5FZOA 1AR81 2MW8A 2WWSA 3N05A 5CEHA 1B6AA 1P92A 4COVA 1QJY3 5F5CA 3DTIA 3JRCA 3WXPA 2HNHA 3J7LA 4H3WA 4XLHA 2CGNA 1XC5A 4YG6A 1F36A 1RL3A 2K9QA 1H2KA 4HDVA 2EQRA 1MD0A 5FTTC 2E7QA 2Y60A 1U0AA 3GXOA 2A61A 1OYYA 3BJOA 3KV5A 2D6MA 1UMHA 5BNPB 2EWNA 4YW3A 3ZN1A 3HC7A 4A7YA 4AQTA 3GW2A 2H09A 2KD7A 4L0YB 5I0RA 1LDJA 3ABUA 1CONA 3ZYIB 3DFGA 3DTKA 3IHUA 2I2SA 4CDQC 3MN2A 4MZUA 4PJLA 4BEHB 1WWYA 4XJ9A 4ABZA 2DUOA 5F0CA 1O6UA 1WMEA 4HL0A 4NRPA 3O5SA 1VBD2 5DAPA 5I0TA 1BBT1 4QKNA 2E33A 5FPLA 4Q5OA 1ZZBA 1RJ7A 1ZYRF 1R9TJ 3KLOA 4V2FA 2H8RA 3ZFFC 3ZCOA 5JLXA 4LLFA 2X48A 2P4WA 1YG2A 2R7TA 4XE9A 2MFZA 2BY3A 2EZIA 1MEC3 1NZCA 5KC6A 2K3FA 3I8TA 3G71I 1OOPB 1W9WA 2DMTA 3WF3A 3CDLA 4WM8B 3VWBA 1QOTA 4II3A 2VNRA 4FXKB 1GZWB 4BQ2A 4D7YA 5EYRA 3DPRB 3HGGA 4NUBA 3MYXA 3RQ4A 4G8XA 3SISA 1H8VA 4KIGA 1UPIA 2YDEA 1CAVA 5C5TA 1VQ6I 2IC1A 4E2QA 4FQGA 2PHUA 2X6WA 2C4XA 1J5YA 1R1A1 2V5DA 4HLYA 4KWKA 2Y0SN 2WAQA 3IMMA 3RZKA 3H9GA 1U2WA 1BKZA 5JI9A 3O1MA 1LAJA 5TGTA 3UK9A 1WCQA 5E17F 3GMEA 2MH2A 2WB1A 1G9AA 2XQXA 5ABJB 4EM2A 3SKVA 4FPOB 5IK4A 2A3XA 2P34A 5AC91 5A7WA 3T4VA 3P5BA 2G9WA 4HMZA 3JBG3 2L7FP 1DLCA 1XRUA 1T2XA 1WW5A 2RAEA 2WABA 1S0BA 4QAWA 3LSEA 4ZS3A 4KIFA 4XACA 5FY9A 1OPCA 3K2ZA 1O3QA 1NA1C 4IEPA 4LHNA 2XF7A 4QPOA 5D5UB 4ESJA 2LUWA 2BOLA 1QHDA 4IE5A 2F2EA 5SV5A 3AKQA 5GZDA 2V73A 2QBXA 1UQXA 1UMQA 1VBB2 3C7GA 5HDKA 3BWGA 3PHMA 4QB2A 3VL9A 2MLKA 3HPNA 4R4ZA 1L7QA 4NPRA 2V6CA 1FZPB 2G1MA 3W5NA 2HWF3 1J09A 1C0WA 2FOWA 5IUQA 4QDQA 1FLIA 1CZSA 3IDBB 5FLMJ 3RWKX 3HYIA 2AXTC 4KGGA 4PIZA 4PI2A 3L2RA 2P5VA 2ARXA 3OG2A 4AVCA 4A42A 2D5HA 3IAQA 4JDOA 1Q43A 5IYDJ 2G9GA 1FP2A 5CISA 1QPMA 4LLGF 3WVJA 2VE8A 4IVNA 2VKDA 4C0HA 3H1CA 1K61A 3BALA 1D7PM 3LEMA 1VBC2 4OMZA 3IDEA 4YRVA 3OEBA 4BQ4A 1DZQA 3GYHX 1ZRIA 5ILSA 4O9EA 4YVSA 1ZZ9A 4C90A 5DCMA 1GKBA 4Q4ZF 2J1RA 2P8TA 5D2AA 5FY5A 1BK1A 4QB6A 1QJZA 3B01A 1DHKB 3VV1A 4BY1J 3BOPA 2BW8A 4CCEA 4SBVA 1CIYA 3HN1A 3HG9A 1LE8A 5LRSA 5C8CC 4AIDA 5HCBA 2YGLA 2HPIA 2NZ9A 2VT3A 2PLV3 3TAYA 3PTYA 5CQEA 4IEJA 4Y1XA 1G2HA 1R71A 4MGRA 2X8KA 2ZB9A 4WVMA 1GNHA 1MACA 4A5NA 4RGGA 1YRNA 4XYXA 4XKCA 5DUXA 2CUFA 3CO6C 1A3KA 1ZLJA 5K7PA 4M73A 2PMUA 1P4AA 5FZDA 4AWDA 4JOMA 1UU4A 2VZQA 2QFEA 1RUE3 1AL0G 2ZGRA 2D93A 4FOQA 1VBE2 2FE3A 2JICA 4ZXEA 3WQ0A 3AX4A 3UL2A 1AYN3 3N9OA 4FO9A 1BIAA 3HRMA 2ZMEC 4CDGA 4V19K 2D2WA 3GGLA 4OMDA 1LQ1A 3ZQ7A 1Y9QA 1XB4A 4EATA 3LKJA 4A93J 2OVUA 2WQZC 3HUGB 2ZOEB 5B1AH 1UZCA 3KZZA 1H4HA 2DTYA 1X19A 2M7BA 2HDDA 1KXGA 1NKGA 1CGPA 2YGMA 1ODNA 4QPIB 5J48A 4F3JA 4L97A 4JZRA 1WLWA 3FBMA 2GC0A 1UZ0A 4IZZA 2DMNA 4QXHA 1RETA 3K1NA 4XF9A 1QJEA 4LGWA 3POYA 1V4RA 2HWD1 4HDUA 4LO4B 1YQ8A 2CY6A 4NWWA 3EXUA 4NHYA 1RXFA 3GCXA 2VBZA 3NAUA 3CD6I 4BLJA 2VBBA 1HRV1 4A44A 5F7UA 3OS0A 1PVC1 3ECOA 4PJMA 1F8VA 2N8GA 3A2KA 1ZRFA 1UELB 2M34A 1LOAA 4Q1PA 1EAH3 4D7MA 4XBFA 1FSHA 1SLTA 1BI3A 1GVDA 3DV8A 2Y31A 1TEIA 1MS9A 3WTSC 1LNSA 1W5TA 2RS33 1TME2 4NC7A 1XBFA 1LU1A 2AACA 3WHTA 4ATFA 4XTMA 3MAJA 1WH5A 2W94A 1HX6A 3SZPA 1BEV3 3LD8A 4XTPA 3F8BA 4KT6A 2DUQA 3WW1A 1A5JA 5FYHA 5AONA 2GC3A 4A3GJ 3PIGA 3OGGA 4MOAA 3WE2A 2CU7A 2VW1A 4DFSA 4MYEA 1QJX2 1H30A 5A1LA 5J3UA 2MYSA 1LRHA 3EUHC 1VP6A 4Y20A 4E7JA 3OL3A 1KEXA 4FPKA 4E9KA 3COAC 2MA3A 5GZEA 3ASOH 1PO11 3WP6A 5EP9A 1FC3A 2GNBA 4RS5C 2M87A 4L99A 3FXUA 3QCWA 3NAPA 4Q4X3 2CDPA 1R23A 4GH4C 5I0DA 3MUZ1 3A7QA 2R7DA 4BKXA 3AMQA 4YM3A 4PJ0C 4G9SB 2QQJA 4L9NA 1F5JA 4G6DA 3WNOA 1K45A 2H6CA 4DYRA 4NAMA 2LG4A 4Y26A 1X3ZB 4D3WA 4B8XA 5FYCA 3IKTA 2WO1A 2JA8J 3UKTA 1EV11 2OU2A 4LFUA 3OCPA 1US2A 3POBA 2ZGLA 3LFKA 2DTWA 1IZ1A 3OYNA 1AX1A 5BNPA 4MXVA 1FOD3 1LECA 1W36D 1XGNA 2XUMA 1XPWA 1SEUA 5GTHC 1OVPA 1V6IA 3J7AO 3AYAA 2GN7A 1ND2C 4XN0A 1V6MA 4AGGA 4BEHA 1D0XA 2R072 1YCIA 4FVVA 5GLWA 1DGWY 2HTSA 1USSA 3LDKA 4RQPB 4AFBA 5LEJA 2ZZJA 4P9XA 3HTSB 5K4LA 3VDDB 1SFPA 2A5WA 3F6VA 3AP6A 1W0OA 4WM8C 5FPBA 5BV6A 4F93B 3PIPF 3WHCA 2JDHA 3FBNB 1OOPA 1N1SA 3O0XA 2HOSA 3DPRC 4WM8A 1QKQA 2WDBA 4I98B 1GZWA 3VFZA 1VQ5I 3AKPA 3E7LA 2WY7Q 3EETA 1ENXA 1HW1A 3DLAA 1CAXA 3ZMVA 2XJQA 2YSRA 2AGSA 3FJSA 1WJBA 1V55H 4C2UA 1B35B 4X1EA 3HM5A 2E63A 2Z42A 5E18F 5AFBA 2Y8KA 3ZM8A 3HOSA 1IN5A 1ZQ3P 2GU9A 1B59A 1JYTA 1RYYA 2B9VA 1U5YA 2ZJ2A 2HWB1 3FXOA 2PG4A 4HBLA 2ARAA 2GAUA 1DGRN 4OI1A 1RIRA 3KB5A 2W1OA 2C26A 4PJYA 5ABJA 2VONA 1AJOA 3AP5A 2PEXA 4AQ2A 1LGNA 1RUC2 4YVWB 4IEQA 1D2QA 1WLTA 4Q4Y1 4A3LJ 3WT3A 4TZDA 1QO0D 1UF2C 4X6RB 2Q2EB 3V7CA 1ZAOA 1UL9A 3ZXAC 4XK4A 3MCZA 4XKVA 2LF7A 2EA2A 2EXJA 1CQ9A 1IXRC 4I30A 3Q8BA 2DVGA 4Z1VA 4BDZA 3LF7A 4GMP1 3WG7H 2BEOA 3WF0A 3E3VA 4AEDB 5EWSA 5FLXZ 3CC7I 2H1KA 4HEA2 4QM8A 3IWZA 3ZQLA 3EPZA 2CQNA 1DP7P 5CBLA 3CLQA 2ARBA 1Y6IA 3URFA 3FZ3A 4CCDA 1A36A 5T5LA 2VW2A 5C3OA 5D8LB 1FTTA 2Z4FA 5G05L 5F9TA 5FPVA 5LA9A 1O57A 1HSJA 2KXLA 3VHRA 3H1MA 4E70A 1GLHA 4AVZA 3OSGA 1S7OA 2BXZA 1N1YA 2Y0IA 1R5ID 5FP7A 3SEEA 1DQ6A 4JGZB 5E88A 1Z3XA 1K5MA 2ZGNA 1S2KA 5JOZA 2NYYA 2R16A 2Q8KA 1O3TA 2AUYA 5A33B 1ZM1A 4FPJA 4CDWA 1JZ6A 5GZCA 2HGCA 2DCYA 3R4KA 2ZXQA 5C7GA 2R3SA 4QSHA 5FUPA 3GCWA 2E31A 2XBO3 2X85A 1QZZA 3CDIA 1CX1A 4IESA 3BCAA 3RWNA 3DYOA 5C33A 3H8XA 4A3JJ 1JE8A 1WD4A 2FD5A 3OF1A 5HNFA 1E3HA 1TW3A 3BROA 4DYCA 3I3MA 1H4GA 4LIVA 2VXZA 3I3DA 3M3CA 2MEV1 4UF0A 4G6QA 4YZ4A 3MLLA 3LSGA 1ALYA 2VVFA 1VTNC 3AL6A 1SVLA 1J58A 2VE1A 2F5CA 2DPDA 3ZYFA 2DOAA 3BPZA 2DTRA 3AP7A 2JD9A 1E5HA 4GWNA 3ZYBA 4XLAA 4NROA 3A02A 3U78A 1PUFB 5IHRA 1KZHA 3VOEA 4IRHA 5BPDA 2GDFA 4C3IJ 3PDQA 4XAAA 4EQQA 3LB9A 5FZ8A 1VAKA 4PDWB 2R041 2X1DA 2XOMA 1XNBA 4AW7A 1HRI3 2Z99A 5DQ0A 1DQ0A 1YI9A 1ETKA 2ICWG 1FY7A 5E79C 2W92A 5FP8A 2PA7A 3SFZA 4OMYA 3R0JA 2UWMA 3V0BB 3QODA 3FN9A 5FPZA 4W4ZA 1BA5A 3GHMA 3VN4A 2IVIB 3GTOJ 3RGBA 2WT2A 3HBZA 1N3PA 1W3XA 3TN92 3K4NA 2EIDA 1CJDA 4BDVB 5JZGB 3OB8A 2FZ2A 4YZ1A 1BQPA 2WZR2 2GXGA 3WCRA 4IE4A 4B4PA 4QPIA 1R091 1AR62 2AQFA 1R082 2QCOA 3T8RA 2DFEA 3AL5A 1SPPB 2ZX0A 4TN7A 3MIEA 1FIAA 5HCHA 2PQ8A 1S0DA 2BBAA 2B7YA 3BQZA 3CCEI 1VBD3 1EH8A 2Z5UA 4MG2A 4U7DA 3U07A 3D1NI 5I0UA 2XWBB 3KQ4B 3F72A 2XLGA 3O3KA 2XROA 1RRJA 3LFMA 3K77A 4FPGA 5FROA 2LREA 3BG5A 4OLLA 1DIWA 3VYTB 4KMQA 3PUFA 3PVBB 2BY2A 2RDRA 4COUA 4LXLA 4XFCA 3PU3A 1AR82 3KM5A 5KWRA 3K69A 2PAEA 3BG3A 2Y9ZA 2EZHA 1BI2A 1HSTA 1CESA 3O1PA 2Q30A 3GZTB 1WPKA 2YFUA 5C4WA 4DIQA 5EDNA 4ZXKA 3SXYA 1RI7A 1LOCA 2OAZA 1OKRA 4M4RA 4GMP0 1A6QA 2LF8A 3NJXA 1GSLA 3B5LB 3LPFA 2XIGA 4CDXB 2GSYA 1SMVA 1FNYA 1Z7UA 2GMMA 1W04A 3TP3A 2BY1A 4KH9A 3ZX7A 4LBKA 4AI0A 5LA0A 3AZWA 4XR6A 1K78B 2VOXA 3GNEA 2EV5A 1BBT2 4D7SA 5A7NA 2FQ3A 3RPQA 1IHMA 1YWKA 2KPMA 5LY2A 1V3FA 3ORJA 1OQ1A 2ZGOA 3TRSB 1OR7C 1WCSA 1VQKI 1ZRDA 4UV8A 3MKZA 4CCNA 2GNTA 2WJSA 1QHGA 1RUOA 1GOFA 4OWRB 2XLFA 4FI9A 5HDNA 2ET1A 3O2PE 1YRZA 4JRLA 1RGSA 5FLXK 4K21A 2Y9YA 4AFCA 1BOBA 1OQDA 4AK3A 5FO8B 2GN3A 1VBB3 2O3FA 2VIXA 1ZZ8A 3FLPA 3PTRB 2QQOA 3JB4C 1O3RA 2QM3A 3K7AJ 4KN4X 5FLIA 3LQRA 3WOGA 1NE4A 4U0WA 4NRQA 3FE5A 4KL1A 4E7HA 5KXEA 4HK8A 4XCBA 1Q8VA 3VZOA 4UNOA 2NRAC 1JS9A 1PYVA 2FMDA 3TNPB 4MV2A 2VBWA 3E6BA 3QAHA 3ES1A 1TMF1 1XN7A 4RQPC 4WVVA 4UHTA 1RUI1 1W06A 3HKZA 2ELJA 2VECA 3WF2A 4Q0QA 3CJNA 1YIPA 1VBC3 1CWPA 1JGSA 4ZTJA 2D1HA 4YIRX 5AIQA 1XPXA 3VDDA 4B1LA 5FFZA 4EN0A 2KT0A 2PBIA 5GLUA 2LK2A 1Y39A 3WTUC 1CF7B 2CWMA 4IHTA 3ZKYA 5FPUA 1OCZH 4FPHA 3PNYA 3KEOA 5J3LA 4Q0SA 3SEPA 4D6RA 1Z1DA 4KNYA 4XLNF 2X6XA 2X53S 4DXTA 3S30A 3ZO0B 4K20A 3IIAA 4JGYB 1B35A 2DK5A 1ENQA 4EN8B 2P2KA 3W6VA 4AVTA 1OPMA 2DUPA 3OBTA 2WT0A 1OLTA 4RHV1 3RMXA 5LBCA 3WW4A 3Q5FA 2XRNA 4DZJA 2ZABA 2E35A 3KWVA 3KIOA 4H0EA 5LY1A 4QHBA 3RZMA 1YYVA 4N9IA 3F21A 3SDGA 2LYCA 4D6SA 1MMDA 2WNOA 2B8MA 1NK3P 2HKOA 2FUG2 2VOOA 4YVWA 4JQRA 1VBE3 3ST7A 5J96B 1QQIA 4R9CA 4IHVA 5A3NA 2Q2EA 2VQ0A 4LK7A 2V1DA 5IT3A 2GNDA 4NHJA 4F52A 4AYBN 5A7OA 4IPAA 3AK0A 3R05A 4OIPF 1JYCA 1LVAA 1HW2A 1XCBA 2LLKA 3HPGA 4RYDA 3ECQA 2FZ1A 1RB8G 4COZA 2XJPA 4AEDA 2A07F 5IATA 2E60A 4LB6B 2DF7A 3L2YA 3BJAA 2GNMA 3CCLI 1LEDA 5FWEA 1YJNI 1P6RA 3U1XA 3DU6A 3VEPA 3POEA 1RUD1 5JR2A 2QKMB 1RINA 3JUUA 3VKOA 1RNLA 2VXJA 1W3VA 3T30A 2VOPA 1LR5A 5ANNA 3NJVA 3MI8A 2E9QA 2VKEA 4M3FA 4YW1A 1BYHA 4IOCF 1I3AA 2XONA 3H50A 2WY8Q 4JGZC 3GLXA 4ZDLA 4F3QA 1SLAA 1VBA1 5E16A 1FWZA 1ZVFA 4LUKA 2VH9A 4P96A 4TTGA 4ZDPA 4NN0A 2VPLA 5JSRA 2F48A 3GEZA 3B02A 3HHGA 1JOBA 3FM3A 2PAMA 5J37A 5A33A 4OQ8A 4CCKA 3CHXA 3C3WA 4BACA 3K70C 1DQ2A 5GADJ 2ZKNA 1NG6A 2QZ3A 3MPPG 3H3LA 3M07A 2LM3A 1SVOA 1W5CC 1X1BA 4DBRA 3DEEA 1HB4A 2Q1ZB 2GP3A 1XSQA 2A3YA 2SLIA 2JEMA 4W65A 1GWKA 3BP8A 1TME3 5CVIA 3LIGA 1HOMA 2HFHA 2IA2A 4ENNA 2CG4A 3K4KA 4WVWA 2WADA 3MIGA 1YX3A 2DLLA 3ERMA 3HRUA 3BC8A 4IO9F 3CF5F 5FMBA 2F4PA 5A32B 2DPUA 1Z7S1 4ZU7A 3ZFGB 1OF4A 3C7FA 1XDSA 1UNBA 3TW7A 4XAEA 4IGPA 4EN6B 4FTSA 1QJX3 3OPTA 2XVGA 1ULCA 3PIJA 2HWD2 1K12A 1NY71 2Q8DA 4A45A 4LHKA 3WQ1A 2J1VA 1PUFA 2CQ7A 3ZSJA 3OYBA 1XNAA 4PDWC 5IT6A 5M5WJ 2HOEA 1OC1A 3NSTA 2PTMA 3OY8B 1EH7A 1HRV2 1MBHA 1PVC2 5FYVA 3UKNA 4EEFG 1RMU1 4ONUA 2WQ4A 2A5YB 1QEXA 2VUCA 2QTWB 2W82A 3CUQB 2M30A 1QDCA 4Y1ZA 2A7AA 4JDMA 5DPNA 4H4KC 2FD8A 1V5GA 2JK3A 2MG4A 4RLFA 1UHWA 3V0BA 4ZTFA 4Q0UA 1NCRC 2WS91 4LB5A 2LKPA 5T5OA 4P9WA 4ENMA 1TG7A 4HNUA 1DUXC 3K75B 4AQSA 1SFKA 2XPWA 2HJIA 4CXWA 4DS0A 2ZA9A 3I4PA 2QQ8A 3CCRI 3H36A 5JZGA 2YFZA 4BQAA 4E27A 1AX2A 1ETWA 1I50J 2Y2ZA 4BXUA 3N97A 4LO8A 1Q5OA 5F27A 4ZH4F 1SPPA 4S2HA 4ITCA 3CF6E 3MZHA 3A21A 5KXCA 2R073 1D3YA 4A3IJ 4QKBA 4NVPA 1PX3A 4ES8A 2A70A 1BI1A 2V72A 3AG2H 5HLHA 3LNQA 3OPZA 1PO12 2ZHKA 5JIAA 2QEXI 3NNLA 2NYXA 3K4ZA 1UZWA 4EJWA 4RA0A 3S7EA 1TL8A 4AHWA 4RA2A 4OU0A 2E36A 1H1MA 2Y0SA 2JG8C 1GVJA 5C3PA 1GV5A 5ACA1 1ITYA 1D1CA 2C5DA 3KLNA 4IEXA 3KD4A 4KWLA 2FXAA 1UOJA 5FCCA 1CN1A 2RDQA 3MFCA 2OD5A 4ASKA 1EV12 1AR93 5JVGF 5FFXA 3JRBA 4N4OB 1JI8A 2NXNB 2OQ6A 3VBHB 3OTFA 1B8IB 4UFKA 5IAVA 5L7OB 4YWAA 2RS52 5ILUA 4HN1A 3M8EA 3WP5A 3WU2C 1FIPA 3B3QE 2ID3A 1TT5B 4CDXA 2QQUA 4EWAA 5DAQA 4Y22B 3U75A 4JK1X 3M4OJ 1HQCA 2JKXA 1VQ7I 4BQXA 5KCMA 4W6WA 5ANQA 3F8FA 4BE3A 2HQ5A 1K78A 1ZZ6A 4ZY9A 4HAMA 1FV3A 3RKWA 4B09A 1RUC3 2RJ2A 2B63J 1X2MA 2G0EA 2VMFA 2NQYA 1OCTC 1UG2A 1LULA 3W21A 3FIWA 4QGNA 4HSLA 3JRAA 4W6XA 3V8KA 2RVCA 1GMMA 3RFRA 3L9JT 2JJ7A 5ICEA 4WV8A 5F64A 3KPHA 2DAOA 1R36A 4C0BA 3KP3A 3CP2A 1SBEA 2VC1A 2DOEA 1AKHA 2FBIA 1X8MA 3HSEA 3ML6A 1YJ9I 4H7MA 3OOPA 1YE9A 3GDBA 3WG9A 5K0UB 1Y9GA 4RAYA 2VN2A 1LKXA 4AYUA 2QA4I 5A6ZA 1ZLKA 3BCBA 5JHFA 2IRFG 2MD0A 4A5MA 1Q56A 2HWB2 2V09A 3LEIA 1SAUA 3ACFA 4JQTA 5JHUA 1URXA 3HJRA 1OLRA 4D7NA 5IP7J 2PQQA 1JUHA 3CJTB 5L3GA 1QGLA 4IXAA 2A3WA 4BDYA 3NV4A 1Y3TA 1IPJA 4RB1A 2COMA 4WM7C 3VHPA 4UBHA 2NOGA 4Q4Y2 4AR2A 3L7WA 1ZG5A 4ZYHA 3HBLA 3DKYA 1ETQA 5FO9B 4RGAA 2NVUB 1HC8A 1WW7A 5AFEA 1T6BX 1I27A 3ZQFA 4HXCA 2B5HA 4HX4A 4A4AA 3ECHA 3NJYA 4KU7A 2VZ3A 2XJSA 2RS12 2KLOA 5IOYA 4A3FJ 5JIUA 3VL8A 3S57A 3OBAA 4JGYC 3LAPA 3LSDA 5EYYA 1POV3 2DMPA 1KDKA 3D0SA 2L4AA 4OIRF 4JGYA 4UWDA 3EQEA 4XL9A 3I2OA 1YYNA 2HH9A 1Y8QB 4AUXA 2KMUA 3USSA 3BZKA 5KHDA 1G59A 4AWXB 5FJ8J 1U12A 3OOUA 2W52A 3PFYA 1IS4A 2EFQA 5FRNA 1PHMA 1IN7A 4HKLA 1UD1A 4PT6A 2WNVB 4LBQD 1OSGA 5J6XA 1LHUA 3HOVJ 4BIFA 1I5PA 4LULA 2Q1MA 3GYDA 1VB4A 5IP9J 2RDPA 3FISA 2OTJI 1DZRA 5FZ7A 2L9VA 1GANA 1W90A 2NNYA 1PK6B 1ON1A 1MS8A 3GTQJ 3SDBA 2CQKA 3BY6A 4DRVA 4D94A 2X9DA 3OS2A 3TN93 2MEV2 3CTAA 3ZSLA 3MW4A 4IV1C 3WLUA 5DEQA 3TEXA 3OUHA 2WZR3 2FEZA 3BU0A 3WDUA 4YM2A 2L9NA 3D4KA 4ASNA 1AR63 5LGNA 1G6NA 1R083 1V0AA 2CUJA 3IIIA 1L3JA 1VRH1 5J7MA 3W9AA 4HT1T 2TNFA 1DGLA 3KMHA 3EDPA 1CVNA 4FPLA 1AHSA 1FOWA 3LQQA 2DURA 2DJIA 2FNPA 1WJCA 1KQRA 4GALA 5HLGA 2R042 4XOGA 1W99A 1XB9A 2XKPA 4IQPA 2B9UA 2OPTA 3UKVA 3S7IA 3Q0VA 1H6XA 1CAUB 5FK7A 4L0PA 1F4HA 1AR83 3KZYA 5CPRB 2Y6FA 4IEVA 1ZA4A 1C4RA 1UIJA 2CFOA 2FHRA 2Y6KA 2C9AA 1DCSA 3T0YA 4HA8A 3I9V2 2QCSB 1W7PB 3WDTA 4Y4YA 5C5UA 2A6EF 1XJAA 1GOHA 3LAGA 4OMCA 1BCXA 3FC0A 1MNMC 2R7SA 2I8DA 9ANTA 3IZOA 3AP4A 1IN8A 1UFMA 3I2FA 1E3OC 2YU1A 2WBMA 3KT1A 5JI6A 2LALA 1W2UA 5DUIA 1Y0NA 2RKHA 1QIQA 4BHCA 1R092 3ZFGC 5L3CA 3GZ5A 4ISQA 4XJ8A 2Y6GA 1LKNA 5J1UA 3KP6A 1TNSA 2NPIA 3PVNA 5A32A 1FMWA 3J8F1 3ZFGA 1S7EA 2WNUB 5L3DA 4F92B 3SH4A 1BBT3 5FYMA 1S5LC 3CO7C 1SG3A 4NBQA 5F1RA 1EYBA 5LK5A 3J7HA 1H89C 1K6YA 4HOBA 4XJAA 2EV0A 1TNFA 3VBUB 4F91B 3OY8A 4KBBA 3FMRA 3TEZA 3AXEA 3B9CA 3T2QA 3NKTA 4UVBA 3CUQC 2ERFA 5EFUA 4LORA 2HVRA 4CO8A 5CIRA 2IS1A 1IPKA 3G4SI 2DO7A 1IGNA 2BZDA 3I3EA 3FHAA 1JU4A 4GFBA 3THPA 3BQYA 1N47A 3KT7A 3KGLA 2AS5F 3B69A 4M3BA 1EY2A 4OUEA 3TOAA 4Q0PA 2Z69A 3W3CA 3ZPYA 1H9PA 2W2IA 1ZNPA 1DDLA 2Q0AA 2GA2A 4DEQA 1WLCA 3ASNH 4YW7A 1Z3YA 2AZ5A 3OSDA 3R61A 5CKQA 4Y4RA 2E7WA 4C1WA 4JYKA 2CWSA 2A1XA 1OYWA 4P9UA 3HAGA 4FP3A 3I3BA 3N4MA 2TDXA 4P9IA 4EROA 2X05A 2FQ4A 4PBOA 1H8TC 1KU3A 4XZPA 4HPKB 3SHRA 3ZVXA 5FZ4A 1W2NA 3CJIC 3D6EA 1YFUA 4GQ7A 3GHNA 2GXBA 1MZEA 3VZKA 5DZEA 1G9DA 1MBGA 1NAEA 1O4TA 1R6RA 2QWWA 2DVBA 2VMIA 2ZGKA 1GZCA 1PGSA 3LEKA 3LQCA 2XSJC 1PO21 4D5FA 2ZX1A 1DPRA 3BR5A 3Q8CA 1ND3C 1HLCA 3L00A 1ST8A 2CJJA 1DGRA 3J7YJ 2OA2A 1S0JA 3WZ1A 2KJCA 4DOUA 1BN5A 2Q1FA 3VBHC 2CV1A 3MZYA 2A6VA 5DV5A 3RS6A 4ZZLA 2VY0A 4J6GA 2YMZA 4BMEA 4XRSA 4YARA 3VBHA 4YG3A 4CZSA 1B8IA 2XB6C 3GZ6A 5L7OA 4I76A 1YS7A 2ZBKA 2VTXA 1KD7A 1XC6A 1OD3A 1HLVA 4Y22A 4AI3A 1QPIA 3LL7A 4FSJA 3V56A 2CDOA 2EIKH 2STWA 1TMF2 1RITA 2M7AA 2OKXA 2JECA 3PUIA 1RUI2 5HCFA 5C70A 1G9CA 3O1OA 2HOTA 4LT5A 4NPMA 2DMQA 4M74A 5A3PA 5KHHA 2NVXJ 3OIPA 4DO0A 2ZXHA 4XQWA 4FTEA 4ATEA 3O1VA 2ET7A 1S2EA 3B94A 5TRDA 1C5HA 2XB5A 3H9JA 1FYUA 4JX4A 5FOJB 4XJZA 1HIXA 3GFLA 2K46A 4G94A 2IXHA 3J26N 2JDZA 2OA4A 3FXRA 3DCQA 1YITI 4QX8A 1SACA 2Z2SB 3EMRA 5DUWA 2JIGA 1ASJ1 4UFHA 3DEUA 4QU2A 1I1EA 1GP4A 1VQ8I 4RLQA 2KDOA 5K0UC 5EZHA 3C18A 3TNQA 4FFIA 4FBFA 3IH3A 4DEVA 2AC1A 4PLOA 4CZCA 2W1QA 2UYAA 3OGRA 4RHV2 3NQOA 3MHZA 4QXCA 3VZLA 3VZNA 3USUA 4XFAA 3H1WA 2BOJA 3UT0A 3DECA 5CVJA 3NW4A 2M5WA 2WSUA 2JDYA 3GZUC 2LY2A 4PFOA 1QA6A 2Y34A 1S1AA 3U4XA 3SJMA 4NQWB 4IEUA 4B1RA 3UR3C 3ZPLA 5FUIA 1Q8OA 2BQPA 1UX6A 1QNTA 1B4AA 1XXNA 3I55I 2F17A 4N43C 1U8BA 3GALA 4FCYA 3I58A 2A6TA 2F5VA 2VASA 5GALA 1SLBA 2XVCA 1VQ9I 4BISA 5GAEJ 4ARXA 2L3DA 3CIHA 3JRFA 3E5UA 3W20A 1ZG3A 3KVBA 4RDUA 1KGYA 1H0MA 1BZWA 2P5LC 4PI0A 2IGKA 1UZVA 3VD7A 3L1PA 1FMD3 1ETXA 3ATGA 2WN3A 3WQ7A 2VULA 4WX9A 2HYFA 1ERDA 4BAYA 1RUD2 4Q47A 3FLTA 3LSHA 1ODMA 4I3PA 2VLAA 1MQTB 2R7FA 2I74A 5HCAA 1PDNC 2WBKA 3ZOBA 3TGNA 2HR3A 1RJ8A 2HWD3 2HEWF 1V00A 1VBA2 5FYBA 3AL0C 1PZ7A 5D4RA 5LASA 2WNVC 3NMBA 1H9TA 2UY9A 1D0HA 4BQOA 1HRV3 4K8FA 3BUCA 1PVC3 1R7JA 2LVSA 1FT9A 4N90A 4E4HA 2CW0F 2BJSA 4MGZE 3LSPA 5LBFA 1DF0A 2NP0A 5DYMA 2R7EB 5DUKA 2ZX4A 3IAPA 4II2A 3LA7A 3OIOA 1QXRA 1XMAA 4NIAA 1KONA 2ATFA 3RJ2X 3I2HA 5A80A 3FHQA 1PK6A 2ZNZA 4MQVA 3ERED 1LENA 2AYHA 2P81A 2EIGA 3M3IA 4CU7A 5FKNA 5EGOB 1ZARA 2JIJA 3TWIA 1N3QA 3ZFEB 4NIDA 4PCRA 1SBFA 3MEPA 2AENA 1APLC 5FY8A 4G12A 3TMOA 4MEXF 1NUKA 4JKKA 2PXJA 4GYIA 4LITA 2ZO4A 3PMSA 4J00A 3OPWA 1NY72 2GP5A 4KN7X 4XUQA 2JXAA 3KVAA 2M0CA 1O59A 4EVIA 3WW3A 3GUDA 1PO13 5FY4A 1NZIA 2H0VA 3BR3A 4FT8A 1R64A 2DYRH 3H1YA 4ORFA 2ZMKA 4FFGA 5CNAA 1RMU2 2PELA 4A7ZA 4Q4V1 2DBIA 1CAUA 2EB7A 4GWMA 3SEQA 2B45X 1YIJI 2IS2A 2VQGA 4RGKA 1W7PA 2WS92 4D69A 1HW5A 1EV13 3HEIA 2ZHMA 3VBFB 1AZDA 2NNNA 3WHBA 1D4M1 3DU5A 3KETA 4H2AA 2W9XA 2HQNA 5KAFC 5DXDA 2XB0X 1U5XA 3KQRA 2OZUA 2RS53 1GLNA 3T3YA 4QHOA 2IJLA 4WZFA 5HLIA 1O7FA 3UGFA 1ZRRA 2XDVA 2D7FA 2GIZA 3A0KA 4C3HJ 1W2OA 5BNNC 2ECCA 4F7ZA 1J2XA 4L11A 3E1SA 5FZEA 4P5YA 2WNUA 3MLKA 2BPA2 1W9FA 2RMU1 5DDGA 3VD9A 1EPWA 4ETSA 3P9CA 5IP6A 4OUSA 1NCQB 2KA3A 2XKOA 3U10A 3DEMA 2DWRA 4ZHNA 4HPQA 3BVCA 5BXXA 3VBUA 3B93A 4GULA 3FL7A 3W6KB 3K46A 3BLYA 3PU8A 4ENJA 4B3NA 3IT8A 2DFIA 4LO6B 2LP0A 4OVEA 3WGHA 5M3FJ 5ACA2 1VF9A 2BNMA 1S7AA 1T0FA 1WA4A 5D8AB 3FF5A 1TQIA 5FZAA 1AYM1 4CDUA 1IUFA 1N25A 4BHPA 3GWZA 5BYNA 2JA6J 4RGXA 3FUOA 4Y13A 3UYJA 1C1FA 1JZ2A 3WQBA 2HWB3 1FOXA 5CVUA 2BWCA 2P7VB 4DYQA 4XHBA 1OURA 5FZ9A 5A3OA 2CMPA 2E1MC 4KJZA 1ETVA 1UAAA 1LVKA 5A2QZ 4I0BA 3AKSA 2E1NA 2F5DA 1N77A 5IVEA 4A3KJ 4Q4Y3 5F5AA 3FFZA 4FPEA 4HPKA 3FHNA 2K9NA 3N9LA 4IKFA 4COYA 4Y3OA 2PYTA 1T08B 1UY2A 4YW2A 5J09A 4GMP3 2VPRA 2I10A 4P9JA 2A75A 4I3GA 3LSJA 1AU7A 3WINE 4W97A 1G8WA 4QMAA 2RS13 3HOUJ 3FXJA 2VNOA 1UZZA 1PJRA 2IXKA 5EEHA 2G9ZA 4HLTA 2ETHA 2PLV1 5LATA 3G1OA 3Q8EA 2XAHA 2WFF1 4A6OA 3IV5A 2BZTA 3D3AA 4EWDA 4Y17A 2PHTA 1C3HA 2CTVA 3RPUD 1G9FA 5FY0A 2FDKA 2DT7B 1LHVA 2YZ4A 2O9LA 2IPQX 3POJA 3OGSA 2HYGD 3CMGA 2IBDA 3RZLA 4KNCA 3PMEA 3M8JA 1TE1B 4AYBA 3HOWJ 5LZ6A 4OHXA 3EO6A 1NQJA 4BJ0A 2DYSH 2FDIA 4D0PA 1KYWA 2R0HA 3S1NJ 1HN0A 3LFIA 3KP7A 3ES4A 3VD3A 1AVBA 3GFMA 2D45A 4FCAA 4YW4A 1NHAA 1W0TA 1ZG1A 2P1BA 4IV3C 4IERA 1LFPA 4YYOA 3FWEA 4HETA 4M3DA 2WFPA 3ZDVA 5JLWA 1EP0A 1WW6A 4HKOA 5JXIA 2KJBA 3VYSB 1S0IA 3OD4A 4HOOA 3MIDA 3QYEA 2R061 4WZCA 2YU9J 3WUDA 2X4HA 1QQP1 2M8EA 4MGQA 1OCRH 2D3RA 3ZXJA 2O5RA 4KUMA 2MEV3 1RR7A 1SFXA 3A0BC 2M9HA 2E1CA 5DAVA 4OAYA 3RQ0A 4BPZA 5LHIA 2LFBA 4XIKA 3DP7A 5KHIA 3NWKA 4J25A 5FLHA 3FMSA 4E7ZA 1JI6A 3LCPA 4YVSB 3CF2A 1F31A 5E8IA 2VXDA 3ZXFA 5FMOL 2IEKA 3WV6A 5GAHJ 2GQQA 3OYEA 2D43A 3AZYA 3FXMA 4LQRA 2ECBA 2WA4A 1ETOA 5L73A 5J1YA 1HB1A 2IAIA 2HWE1 1WJAA 3L09A 3AYEA 4PSXA 5ICFA 4AFDA 3VYUB 3C2UA 3TOJA 1VQ4I 5BNGA 2A73B 1AUYA 3CNAA 4YIFA 1JYVA 3KE2A 3JRHA 1DPUA 4BQ1A 2DCJA 3POFA 2RS31 2VMGA 5DDJ1 5B4NA 4OAZA 4DUWA 3K10A 4FOWA 4Z8BA 4PCQA 4AIHA 2LY9A 2V5YA 3H3ZA 5H6RA 5F08A 1XYNA 3V4GA 1ENHA 1ZR2A 4HNTA 4CEYC 4CEWC 1WHUA 4A6SA 5IVVA 1CR7A 2KKOA 3AB0A 1YQAA 4XF3A 4MUVA 3IBMA 1UY0A 2HS5A 1KDMA 2E71A 2L4MA 5FV3A 4XICA 1R093 1W8FA 3EYYA 2DCZA 3MLJA 1VRH2 4XIDA 2BTVC 1LESA 3HHHA 1QMJA 4N4NB 4M3GA 2FU4A 1GV9A 1LGBA 3WCSA 5J4YA 4H55A 4XRSG 3N7KA 3KCCA 1MQTA 3B73A 3V7SA 3I2GA 4IE6A 1DZTA 2DOFA 3SH3A 2VCBA 1S0EA 4M0HA 3DKWA 2ZJRF 4M4PA 2Q5TA 4QXBA 1J1TA 1QJFA 3G3ZA 4BXXJ 2YU2A 3M1EA 5M5YJ 4PIXA 1SD5A 2ESHA 1REDA 4QWQA 2X5IB 1UG0A 2VUMJ 2OUHA 2VBXA 3G1LA 2YXSA 2Z5WA 4IETA 5TJJA 4BXFA 1MJBA 1Z6TA 4K7JA 4D0QA 1IG0A 2FCTA 3QYFA 5DZFA 4OCTA 4YRDA 3QH6A 1JH5A 4MHRA 5LGUA 4XABA 4ASLA 4UFMA 3RKQA 3ZFEC 3RCOA 1NH3A 4PUSA 1DGRM 4NRMA 5ILVA 2JSPA 2CGOA 5A2QK 4ZU5A 2FDFA 2R6QA 3ZFEA 4M6YA 2O61A 3J8F2 1JTYA 5IK5A 5LK7B 1G3SA 1MJAA 4NPLA 2COBA 1XD7A 3NQHA 3K4JA 1FATA 3BOQA 4CPBD 1JUIA 4DB5A 1AJKA 2DVDA 1BC7C 4GIQA 2E2IJ 1SANA 3EBRA 1U8RA 1BK0A 1QNYA 1HCRA 4JCKA 3VODA 3IPVB 2K5CA 2R49A 3I3QA 5A70A 3QPSA 3WNNA 1FBQA 2FCVA 3SITA 5E3OA 2RR11 1MNEA 5CU1A 4XN3A 3OGVA 3AG3H 1C8M1 4GA9A 1TWCJ 5D1IA 2JVHA 1WJ5A 1LOFA 1NXD1 2YC4A 2R7QA 1UJ8A 4L0ZB 3C2BA 3VBFA 3CMMA 4R1HA 1C28A 3K70D 3HJEA 2QZ8A 1ZREA 1LHNA 5JUVA 4R9BA 4JTOA 2XR4A 4MSVA 2UWCA 4DRRA 2WUHA 3IAS2 4XZUG 3VDCA 4OFGA 4XMYA 4JKMA 2RG4A 4XC9A 3UJOA 4R52A 5CFDB 2R7WA 4XKWA 2O14A 2ZMNA 2QSFX 4AHYA 3PQKA 5J36A 2V7FA 1TMF3 4KGQA 4B4RA 2VJJA 1RUI3 4XF0A 1J9IA 5FO7B 1MS5A 3W58A 5EQUA 2CSOA 4NDLA 1OVSA 4MTEA 3OV8A 4XUOA 5EHDA 1NCQA 2JDNA 1WH7A 1HV0A 4ITVA 4PK4A 2IT0A 4XRFA 4P9FA 1US3A 3ETQA 2XV4S 1GDTA 2J1AA 2LD5A 1PO22 2WINB 4RAZA 2E32A 3AG4H 1G7YA 3LSTA 1JYXA 3BJ6A 1YO8A 5DAWA 4Q1RA 5D8AA 3I4IA 3C2GA 2H6BA 4S2GA 2VZ1A 3T0DA 3GZEA 4B43A 1OQYA 3D5SC 1I3HA 1ZRCA 5F8PA 1O5LA 3LSMA 3OGJA 1V6LA 2DT6A 4AGVA 2OV7A 3BI3A 2K4BA 4TWTA 5JMCA 2EF6A 1RHI1 4RHV3 1UZYA 3TO6A 2NMNA 2W39A 4N53B 1Z0XA 5K1YA 4C30A 1CAXB 4U87A 2E2JJ 1OA2A 4XMAA 3KZ4C 3WP3A 2K40A 3KFWX 1Y8RB 4AAXA 4C9YA 1W36C 4ET7A 4R79A 4XBNA 4CUCA 3O6BB 4EM0B 2WYSA 3U0ZA 3R4DB 3DTEA 2P3YA 3ZN5A 3AM2A 1O4XA 1A8MA 1O91A 1W6NA 3S6PA 1VMFA 1I39A 3VB2A 2P3IA 1B1BA 1SCSA 5A3WA 5FXWA 2YY1A 1VI0A 2R4GA 3PUBA 4XDQA 4YPJA 1IRZA 1ZBE1 2ZXJA 1AXYA 1ASJ2 2EXIA 1JYIA 5JR3A 1X9PA 3I71A 5FZLA 4XQDA 3ZMTA 2BBYA 1Q1VA 3ILNA 2KISA 4JX5A 1MZ6A 2JMWA 1B9NA 2JRMA 3IDAA 5DD4A 3M4FA 4FX0A 2Z33A 2L9SA 4IHYA 4BOWA 1Y56A 4HYEA 1RUD3 2Z3YA 3I0TA 2FMLA 2KM2A 4QPGB 2GA1A 5GLVA 2FNAA 4IE7A 3PJRA 3MBWA 2XG3A 5FRMA 1CPMA 2TCTA 3FX3A 5FZ3A 1VBA3 3VZMA 2HZDA 4MHUA 3NRUA 4RSUA 2TBVA 3F8MA 2R7OA 1KQ9A 3NJZA 3WHUA 1HKDA 1SFOJ 1J59A 2JWPA 2W68A 3KV6A 2VZTA 4S2FA 4HN0A 4LLLA 2KZVA 1VLNA 1XSXA 2E51A 2ORZA 3VBRB 2HXOA 1RR8C 4BL0B 4YELA 4HSJA 1ENSA 1Z21A 4EZ4A 4EJOA 5AIPA 2DVAA 2CV6A 5G04L 1K5MB 2VZUA 2JUGA 4XW3A 2TUNA 4DZPA 4CDWB 3IUOA 1JHHA 2J1SA 4P9GA 3N9NA 4YVSC 2KIQA 1MGTA 3RYKA 5JVTA 2QQAA 2YBPA 4Q29A 1YFYA 5H6QA 2XPJA 3GM8A 3HRTA 2QE3A 3WUCA 1M06G 2MNGA 1MJ9A 5A6XA 4LKFA 1HQNA 1X36A 1RXGA 3WSOA 1KQ0A 2VBPA 2P4EA 1EH6A 1VJ2A 2AEZA 2ZGPA 1X50A 4UF0B 1IW7F 5T5JA 3CU7A 3AXDA 1JJ6C 2WZ8A 1T95A 1DYPA 3IC7A 5CYVA 1RMU3 3ZYPA 3NKGA 4UUVA 1H6YA 3A4CA 1W8NA 2R93J 4QWNA 4FX4A 4AE2A 3ROUA 1KFXL 4LBMA 2VZSA 3S1RJ 3IN9A 3JREA 4QM9A 3OMYA 5BS6A 2WS93 2VVDA 4XLEA 4U2AA 2QQNA 4GRIA 5LBEA 2RVAA 2VU9A 2STTA 3S5AA 1ONAA 3ZIWA 2W95A 2K27A 1JZ3A 2JE9A 1K3IA 3O8HA 2UUZA 4LOTA 3O1RA 1G3TA 5K5QA 1DYOA 2CUZA 4V2WA 5JSOA 1HV1A 1RUF2 4ISRA 2EIJH 1OUSA 2X09A 1DU3D 3CMYA 2DTZA 1A6CA 1OFCX 1P9QC 2H8WA 1DG6A 2JVGA 4FETA 3LSRA 4B47A 4QTRA 3GCMA 2R1DA 1GWMA 3X29B 4HG2A 1STMA 4M3CB 3KF3A 2EILH 1QOOA 2X5IC 1V9U2 1SFUA 2JKBA 2BGCA 3T1BA 1MMSA 4Q4V2 2JG9A 3RKYA 4GKXA 2X5IA 5ACA3 3APBA 2BDRA 2AQEA 4O9GA 2WA0A 3TYJA 3WDXA 5FKOA 4X6AJ 4O65A 3O8GA 3BT9A 2BBVA 2KFDA 2XAUA 2ZSHB 4PQ9A 4B4CA 3S93A 2EFOA 4S04A 2WLPA 3QU3A 3QP5A 5C3QA 1D4M2 1LODA 3E5XA 3E97A 2VTFA 4KWJA 3KX2A 4XOTA 2ZGSA 3PO3J 4ESBA 2VZPA 2ZKZA 2R7VA 4P55A 3KSCA 1FSEA 2ZEYA 3REOA 5EJZB 3U11A 3FK7A 2VXRA 1U5TB 3K6GA 1WI9A 2RN7A 2WO3A 2KIFA 2VPVA 4QD2A 4EM1A 4Y52J 1JT6A 3UETA 5C4WB 3H0DA 1X58A 2D1VA 3FMQA 3M3YJ 3H0OA 1VBC1 4HONA 4FTBA 2RMU2 3D5LA 2VCAA 1BC8C 4L9JA 1VALA 1PGL1 1UY1A 2VCCA 3CC4I 1E3PA 2Y0OA 1IAWA 4FXGB 3WY6A 3THTA 3IPVA 1KJLA 3DYMA 3Q9OA 1OI6A 5IFPA 3POSA 2QF7A 5FYYA 4BIOA 1W6PB 1TW2A 2G7UA 2FBHA 4M72A 3UJQA 1TC3C 3TL4X 3WU0A 2EXKA 1AYM2 3BTJA 4DOZA 1EF4A 2WLQA 2VMCA 5FPXA 4NC8A 1WRJA 4YFNF 3BKZA 5C9AB 3OUIA 2GMEA 3NAPC 1T56A 2IA0A 3DXJF 3G6EI 3D5OA 1QU0A 2FMYA 4TXWA 5A6QA 3PNAA 5CFDC 4M00A 2IP2A 2HKXA 3WG4A 2JPCA 1S8NA 1V6KA 5CFDA 4HSTA 3HRSA 1UYYA 3M1HA 4PGHA 1BL0A 4DBQA 1FPN3 2YUSA 2A6XA 5FLJA 5L19A 1XMKA 1JZ7A 5BNPC 1A31A 2HI3A 4CCMA 5GJ6A 2PJPA 5BMZA 1U78A 2XAFA 2B46X 1IJWC 3PNVA 4V2VA 3G7DA 3KT4A 2VMHA 2O6GE 2VOVA 2R30A 1ZGJA 2QQKA 5HV4A 5HXMA 2ZJQF 4IRIA 2HYJA 4M6XA 2RJLA 5C4JJ 1QDOA 4BA6A 5I93A 1KITA 2VKVA 1W5SA 1NG7A 5FZ6A 4XFGA 4KG0A 1T6GC 2A6YA 1D0GA 2WFF2 3Q0WA 1J84A 3THCA 3W59A 3O14A 1R00A 1VPHA 4DMIA 1JUMA 2CHHA 1JN2P 1OOPC 4LLOA 5ICCA 1S0FA 1WWXA 3RI9A 4BYYA 5C3SA 4NIIA 2EA4A 5E1WA 4N53C 2FRHA 5EV7A 1X33A 1WCMJ 3CDZB 2GH8A 3R60A 3MV11 4Y24A 4LBLA 5F5QA 4N53A 2O7OA 1FYKA 5A7SA 5BPXA 3WTWC 2K9SA 4P5HA 2B4KA 4A3EJ 5DG2A 3N3HA 3WE3A 1PGW1 2RDSA 2ZXWH 5FMDA 2F4LA 3WGGA 1DQ1A 5D5XB 2Q4SA 4GGGA 2LMDA 4NR1A 3B6CA 1RVF1 1GQPA 1OA3A 2RC4A 1WCKA 4PJNA 1XNKA 4LOCA 5JXJA 4YZ3A 2YHJA 3K4LA 1D8KA 5ABJC 3CDHA 1WFXA 5K5RA 4QQ2A 3POGA 3DYPA 2R062 4QGMA 1SMYF 3KYCB 1QQP2 5KC5A 2MGQA 4K1ZA 3JQXA 3C7JA 2NVYJ 2K86A 2C6SA 1LFBA 5J8FA 3TP0A 4CDQB 4MO7A 1YFXA 4V2GA 4FPCA 1VRH3 4D9JA 1S4CA 4FASD 2E7AA 5C71A 1E0EA 3CLOA 5DUUA 3UGGA 1OLME 1PMIA 4NWVA 4QPGA 3ZFFB 3WG3A 5KHGA 1MVQA 2FSWA 2YPJA 1U9NA 3AMPA 5CG8A 4QB1A 1GOGA 2HWE2 2PMHA 3LOBA 3FHZA 2BXYA 3LOIA 2F6BA 4RAGA 1Q8SA 2XAQA 4IL6C 4DW6A 3MFKA 3BPVA 2PFWA 3DWLE 4HX8A 1FX7A 5BUVA 5DDJ2 1RKTA 3ACIA 1D5VA 5K7HA 1PNGA 4HV5A 3TOBA 2FJ1A 2ZAHA 4M9SA 3THDA 3VBRA 4XVHA 1G86A 5E3NA 1ULEA 5GLZA 5F1JA 2BGPA 1K5MC 1C8NA 3T1MA 3R4UA 3RZJA 3NARA 4N7UA 1M1EB 1YIFA 3N9PA 1UPSA 4CDWC 4LBQB 4RGUA 2HZTA 5KXBA 3ZR8X 4UW6A 5CG9A 1LPQA 3H3UA 3CCJI 2P17A 1MMNA 2VR4A 4E7KA 2O8QA 4JRAA 4Z82A 2ZC2A 3JD71 4H7LA 1T98A 5L36A 3J8F3 4RN5A 1V70A 5HNHA 5CKNA 3ZLIA 3H9AA 4XUPA 1LOBA 4CP0A 4CYCB 4KYWA 2NN8A 1J3QA 1MW7A 4JX0A 1KGSA 3ABLH 2F6CA 4CUBA 5HOOA 3AYCA 5FD5A 1RESA 4XXPA 1HA8A 5JSPA 3OYAA 3IAM2 1NA1B 2DBBA 1H0BA 3NV3A 1OISA 2ES3A 4HW0A 1XE0A 4NNJA 2JA7J 3QBQA 3V64A 1S55A 4GD4A 4E4DX 4KU8A 1IDYA 1AR91 3BODA 5F04A 3ONQA 2QQ9A 1CX4A 1FOYA 2Y69H 3H5AA 2Y33A 5JOWA 2J1UA 2SBAA 3N7LA 2WAEA 3S1MJ 5D21A 1H9GA 3INAA 1U6GA 2ZZQA 1VQNI 4AFMA 2ZBJA 1MZFA 2XGDA 3S2HJ