4I09A

Structure of the mutant catabolite gene activator protein v132l
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
204
structure length
204
Chain Sequence
PQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKLGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 58
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i09A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i09A01
3RYKA 2VXZA 2GC3A 2GA2A 2P6SA 3TO9A 2CG4A 1T39A 4J1WA 3JSOA 3LSTA 4I98B 2RGVA 3LA7A 4IETA 2RNJA 1HSJA 2DQLA 3IC7A 1YFXA 3G3ZA 5HS8A 3V4GA 3U9GA 3H3UA 4IEWA 3I64A 4M9ZA 2STWA 4OOIA 5D1IA 3VHRA 1R1VA 4AVAA 3H92A 1EP0A 1SD4A 1NZCA 2XL9A 3CJXA 1BOAA 1OFNA 3MWMA 1FSHA 2D5FA 1UIKA 4HW0A 1FOKA 4OMZA 1TLHB 4FAHA 4JTNA 4RAYA 5BPIA 1B6AA 3HT2A 2D45A 3FWEA 3DFGA 4HSLA 3U1DA 3M7GA 3COAC 5AIQA 5C6CA 1IXRC 1XDUA 4GCVA 1QQIA 1J3RA 2X0LA 2Y0MA 5HLHA 3B73A 1K79A 2EV6A 1FLIA 4A6DA 4D7SA 4TLFA 3HYIA 4QWQA 2XLAA 5ICFA 1HW2A 4MZUA 3BP8A 3EQEA 2FU4A 1O57A 3CTAA 5D8LB 4AWXB 3HRTA 2HDCA 3BJAA 1YG2A 2RVCA 4BQAA 2XKPA 4I09A 4YFXF 3IBMA 2DPUA 3K1MA 2QYOA 5LGNA 1XDSA 2PAEA 5AVPA 1J1LA 3BOQA 4H7LA 4RGRA 1MDMB 1BI3A 5LGTA 4OIOF 2ET1A 3M9AA 1Z9CA 2DLLA 4RGSA 5J6XA 2EA2A 4Q0PA 3K0LA 4X6RB 2BGCA 3RI4A 2O6GE 3GUDA 2D5HA 2JT1A 3DKWA 4ON0A 3J80Z 2KKOA 3BROA 5I8TA 2LF8A 3M3IA 3OCPA 4RGUA 2GQQA 5E17F 3FMRA 2GAUA 3U11A 1VJ2A 1XCBA 5CYVA 1BIAA 2FNAA 2M8EA 2IXCA 1X82A 3CDHA 1J5YA 2Q0AA 5HS9A 3GWZA 2EA4A 4XLNF 2K7LA 4XFAA 2R7DA 2ISZA 1FYKA 1I1SA 3CO6C 4P9FA 3K2ZA 3V8KA 5K5OA 3PQJA 4XRFA 4L9VA 3LAGA 2K0GA 1ZZ9A 1WRJA 4LK0F 3N4MA 1IN4A 2GH2A 2P17A 2ZCWA 3C3VA 4LTAA 2PI0A 6PAXA 1L3LA 1HQCA 4X6QB 1R1TA 1O7LA 3FZ3A 4AIKA 1PMIA 2ADUA 4EVIA 3FHIB 4MGKE 1V4RA 2FXAA 3SCGA 2EK5A 1DZRA 4LEJA 3EDPA 4EJVA 3USSA 2FNPA 4HX8A 4HA8A 4EGYA 1RTVA 4XF1A 2ZXJA 5FLHA 1D3YA 2ZMEB 1ONVA 1GXPA 4PGGA 2ESNA 4HDVA 3BJ6A 4Q0QA 3SHRA 4HMZA 2EFOA 1Q3EA 4L0ZB 3L2HA 2D93A 3OF1A 2EFWA 4NVPA 5LLQA 1LEBA 3F8BA 2DU9A 4BAYA 2XAFA 1YS7A 1CAVA 1HW5A 2H27A 2F4PA 3EYYA 1MGTA 4H0EA 1E2XA 3AAFA 1QO0D 2KJBA 5L3FA 2W85A 3ZMDA 3KSCA 1ZX5A 1D8KA 2XAGA 4L11A 4KDPA 4Q48A 1T2KA 4R79A 1BI2A 4N0BA 2A07F 3KCCA 1CF7A 4RS8A 3C3WA 3R0JA 2N7GA 3V7RA 3H1YA 2E1NA 1FBUA 2NYXA 5J8FA 3SCFA 3HRMA 5E8GA 3JSPA 2QNKA 4NHJA 4MGZE 1R5HA 5TRDA 2P7CB 4QGNA 3CO7C 2F2EA 3IDBB 5FDBA 2YX4A 3TDUC 1OI6A 1OPCA 1KQ0A 4G6DA 1RUOA 2VE8A 1QZYA 3ZP5A 2XASA 3ABTA 1DPUA 5HI0A 3HT1A 3ROUA 1D5VA 3TDZC 2VECA 2F5FA 4XFHA 2K4BA 2IVMA 2L54A 2QDRA 4PGHA 1LJ9A 2R7FA 2ESHA 5BOXA 2BE5F 3I0TA 3ZMZA 4MNUA 2XHKA 2DPDA 5FGMA 4YFKF 2PA7A 3ELNA 1XGSA 2Q8KA 2W84A 5FLIA 1J0RA 3ECHA 1MJBA 3TOBA 4KA4A 3HOTA 1QXJA 5J48A 4XEZA 5FFXA 5DDGA 4IHSA 3J7AO 4IVNA 3IWZA 3VOEA 2CW0F 4RGXA 1R00A 3E6MA 1YFUA 1TQMA 3SZTA 2CV6A 1SMTA 1BBYA 2O3FA 2P7VB 4XFCA 1W7PA 2HYGD 2P8TA 3GLXA 5ERIA 4EM2A 2A3SA 4A0YA 1U5TC 4AQ2A 1T98A 1XSVA 2V9VA 3C1DA 1ZRDA 2LF7A 2K02A 1YTYA 4GO1A 3F72A 1YFYA 2B9UA 1GQHA 2LKPA 3GBFA 5H6RA 2HKOA 1B4AA 5FQ0B 3KP6A 1TW3A 2KXLA 2HKXA 1KGSA 5BY5A 2UYAA 4EJOA 4RB1A 3OGJA 1U8RA 2H09A 4BHBA 5KBFA 2EFPA 3ZN1A 4I01A 2UWMA 2GA1A 2NNNA 4YYOA 4G7ZF 3WW3A 3IHUA 1SQ4A 3GXOA 2EB7A 3P9IA 5EEHA 4WK8F 4R8HA 5BPXA 4WBBA 1IPJA 2FMLA 4O3MA 4CO8A 2M1BA 2JTVA 4AVCA 2XLGA 4RB2C 3ZMTA 1Q1HA 1B9MA 2XAHA 3WGIA 4KT5C 1P6RA 3DPLC 1PDNC 1DP7P 4IEPA 3QPHA 5HLGA 1HKSA 2FQ3A 2BEOA 5FCCA 3BDDA 5I91A 2FA5A 4JQFA 1TBXA 3CUQA 1QZZA 2HR3A 3JW4A 2PQQA 4N9HA 3K69A 3RZZA 2QVSB 2BV6A 1CGPA 4HAMA 4YIFA 2L02A 2XGXA 4HX7A 2MA3A 1JHHA 1UIJA 1WI9A 3ACLA 4LA2A 3GFLA 4Q47A 1SFUA 5BQTA 3KP5A 2STTA 1LDDA 2DQRA 1MJ9A 5AONA 3TKYA 3MZYA 2AXLA 3ES1A 4I0BA 3JTGA 1G6NA 1OYWA 1KA8A 1IW7F 2D40A 5HOOA 3FXUA 3RPUA 3JZVA 5DV5A 3KP7A 4D7TA 5KHIA 1W5TA 3JAMZ 5LHHA 1FYMA 3F8MA 1G3WA 5I93A 2A6HF 4UBHA 1TW2A 2IRFG 3TGNA 3P9KA 1KU3A 3TO7A 2CYYA 3WW2A 2XUBA 2C0ZA 5D5WB 2PAKA 1I5ZA 1Q43A 1ZZ8A 3WW4A 3FFQA 5LBQA 4OU0A 3FXQA 2R3SA 3B02A 3F8CA 3WGGA 3RDIA 1YW9A 3F22A 1UCXA 2EFNA 3BZ6A 1RC6A 1JE8A 4MGYE 4MX3A 1K78B 1ZZ6A 3IIAA 1KQ9A 3F3XA 5ILSA 1YLFA 4R52A 4CXFA 3J80K 3R6SA 3P9CA 2VE9A 1I1GA 2L3DA 3GYHX 3K1PA 2Q0OA 4HF1A 5F6FA 1ZRRA 1FT9A 5LHIA 3IDCB 5D5XB 2COMA 2B5HA 2O03A 4A5NA 4ENJA 4UHTA 2FQPA 4HV6A 1XB4A 4LK1F 1FYLA 1OR7A 5JSOA 2LSOA 1V3FA 3R4KA 2G9WA 3I53A 4UVAA 3M70A 1CAUB 3CJNA 1V70A 2LNBA 1QNTA 2XIGA 2XL7A 1WLTA 2CQKA 3FX3A 5LRRA 4U0YA 2RC4A 3M8FA 4EWEA 3DV8A 2V1UA 3EJKA 5DCMB 4HLYA 3S0MA 2OZ6A 3OV8A 4M72A 2IXIA 5BPDA 3ZMSA 1YO5C 3VEPA 3FJSA 4WXHA 1DUXC 5E1WA 3WGHA 3DQVC 2M87A 1TNSA 3BY6A 3T8TA 4E2GA 2HZTA 4GULA 1NXMA 2QM3A 3PNAA 2P6TA 4JK1X 4B8XA 5T3NA 3U0ZA 3FF5A 1J7KA 3D0SA 1A04A 1YW7A 2FMYA 4L9JA 1W7PB 1XD7A 1L0OC 4XSXF 1XRUA 5HVQC 4KL1A 1CX4A 2VBYA 3KLNA 2CAUA 4BYYA 3SZPA 1R36A 4LLLA 1B1BA 5JSPA 3DEUA 4PJYA 2M45A 1WA4A 3KP3A 4HLTA 5E18F 2OZJA 2XAQA 4E70A 4ZYHA 1QBJA 2UXXA 1KU9A 5D4RA 2ET7A 4G94A 2P5VA 2K27A 3BPXA 1SD6A 3KP4A 1R5GA 2K9ZA 1USTA 2D1VA 5JI6A 1HKTA 4GYGA 2QZ8A 4EJTA 3KEOA 4IJAA 5L3CA 1QY4A 5J7MA 3MAJA 4L18B 2PQ8A 3Q9VA 4XFBA 3UKVA 4EJUA 3GX4X 3LFKA 4PIXA 4OIQF 1P4WA 2FBHA 3MEXA 2VOPA 1G3SA 1TQ5A 4BH9A 3BU7A 2A6EF 1S7AA 3HHGA 2QLZA 2VQAA 2YX7A 1HW1A 5D6EA 3NL1A 4NB5A 3IKTA 3HTSB 1FSEA 4AVPA 2BBYA 3MFKA 1U5TA 3RPQA 2GXBA 2OA4A 1LEAA 1QXRA 5A2QZ 1EYBA 1U12A 4ORFA 4U0WA 1TQPA 2XV4S 3CUQB 3QOPA 4R1HA 3EBRA 1FP2A 3ZDSA 5FD6A 1YIOA 2FF4A 3K9TA 3ULQB 1FPQA 3VFZA 3JTHA 3KMHA 1P92A 5HS7A 4Q4ZF 1RI7A 3EO6A 1LDKB 4MHGA 2PG4A 3F6VA 4IF4A 4IEXA 1PUEE 3E6DA 5H6QA 1RNLA 4BHPA 2H6BA 3UKNA 3LA3A 4ETSA 3SXYA 2CFXA 1S29A 2D2WA 1UPIA 3L00A 1GVJA 4IRIA 5I0UA 5J3UA 3WU1B 3NQOA 2BYVE 3KFWX 1J9IA 5DCMA 1W5SA 4Z2YA 2HQNA 4L9NA 3MCZA 3EYIA 3RYPA 3GF2A 4N9IA 2J5OA 4P55A 3F6OA 3ISPA 4K2EA 2Y48A 4MEYF 5CLSA 3T8RA 1CAXA 3UKTA 1HXDA 4LB5A 1WSUA 3WODF 4LD5A 4XF4A 5I0TA 3I58A 1IF1A 3KZYA 2V79A 4B09A 4JVAA 4ESJA 4Q0UA 2FOKA 3WTZA 4OFGA 2IXHA 5BUVA 2IA1A 2VONA 3WTSC 4YRDA 3LQRA 4HF0A 4G7OF 2H94A 1YFWA 1FY7A 4U7DA 3NJZA 4XFGA 4FHTA 1O3TA 3FXRA 3R60A 4KUMA 3E6BA 2JPCA 1X8EA 4JTOA 5EEGA 1L3JA 4LGWA 1WGPA 3CEWA 1IRGA 2OQRA 1BN5A 2FEZA 2MD5A 3U10A 1Z91A 3J81K 2HEOA 5CU1A 5JCTA 3SXWA 1ZGAA 1CAXB 4XFIA 1ZHFA 2MC3A 1YS6A 1OYIA 4IRGA 4ENKA 1CF7B 5LEKA 1ZH5A 5DD8A 3E5XA 4WVZA 1O5LA 1BC8C 4RB0A 1K78A 1H9GA 3WTUC 2P4WA 3G73A 4UUVA 3N97A 3HQXA 1G3YA 5BS6A 3IKVA 3ABUA 3SCHA 4OINF 3O14A 4EWDA 2FBIA 3ZMUA 2RKHA 1H9TA 4M71A 3HHHA 4QLCU 2Q2EA 2EAAA 2D1HA 3HSFA 2FSWA 3S7EA 3R61A 3QP6A 4UVBA 3RKYA 1I6XA 1XGOA 3T1BA 3NSTA 1ZZ7A 2G7HA 4I7HA 2E7WA 3JAMK 2QBYA 1T0FA 3BWGA 1B59A 2HTSA 3REOA 3TQNA 2PYTA 4U7BA 3HSRA 4EGZA 1H0MA 1W7PD 3CL1A 3LZZA 2GC2A 4RAZA 1F4KA 5FLXZ 4HLXA 2EA7A 4LJZF 4LFUA 4UBGA 5F1RA 3K1NA 2NS0A 5D6FA 1ULYA 5DUKA 2ELHA 2UY8A 1R7JA 3GFIA 2X4HA 4ZZLA 4Q0VA 5HDNA 4I0AA 5F64A 4A2UA 4J1XA 1X3UA 5K1YA 3L09A 3V7SA 4CYDA 5DCFA 3CUQC 5CVVA 1O5UA 1E17A 5C8WA 5E20A 3WG9A 4IXAA 4QM8A 1X8MA 2ACJA 3F23A 5I0SA 1KQ8A 1GHCA 1ZZBA 2V1DA 1DGRA 1IRFA 4KU8A 1K6OA 2PLYA 3ZQ7A 3EHKA 2B8MA 2QVOA 5JAXA 3O2PE 2MLGA 2EV0A 1CAWA 1S6LA 1YWKA 2Z33A 4I2OA 3I4PA 5L3BA 4MTEA 1NE6A 4IPAA 3HTUA 2LDUA 2AS5F 3L2CA 2WV0A 4L5IA 2FBKA 3I71A 4O9EA 5JHUA 5JR3A 2QQBA 4HSJA 1FXZA 2KIMA 1LDJA 5DEQA 1YFHA 4LLGF 3MPBA 2ZNYA 2L4AA 1Z7UA 3BJOA 4FBFA 1FBQA 1AWCA 4P9UA 4A6EA 2QBYB 1SEFA 1H1IA 3IRQA 2HJIA 3OTFA 1SMYF 2GIVA 4YG2F 1IN6A 4LLOA 2QUFA 1IN8A 3LOIA 4ZU4A 4XF0A 4CZZA 4MH0E 1LVAA 2XAJA 1WQ2A 4CICA 4WXCA 2Y75A 4HX4A 4MQ9F 1XGMA 4MGIE 1LR5A 2DK8A 4IEQA 5TJJA 4EWAA 3GVAA 3GFMA 5KVRA 4S04A 2IT0A 5HLIA 2VC1A 4KN7X 3QRFF 1J75A 5EZWA 4KYWA 2RV8A 3G7DA 4D0PA 3S2WA 3BPZA 5I0RA 5E16A 2GWRA 5D5UB 1R22A 3RJPA 5IT3A 1YHFA 3MZHA 5JVTA 4WF2A 1HKQA 4WXDA 4XETA 3H1WA 2GXGA 3WE2A 2VBZA 2PHLA 2Z5UA 1UFMA 2OZUA 2XKOA 3WTTC 3KP2A 3WU0A 4HN0A 1LQ1A 3RNSA 1DGWA 2HGCA 3SHFA 4ZU5A 1G4DA 2KRFA 4CDGA 3PLQA 2PBIA 2IW5A 3LA2A 4KWKA 3BB6A 1VP6A 1RZ4A 3OD0A 1J3PA 3F8NA 5ICEA 5CVIA 1IN5A 4Y13A 2CO5A 2OA2A 1KYZA 3DF8A 4META 2XLFA 2VBWA 2QQAA 1ZVFA 2BNMA 2JZYA 2IC1A 5BMZA 4AVBA 3ZMVA 1QGPA 2QCSB 1CAUA 2WTEA 2G7UA 2NAZA 1TQIA 4KN4X 5J8CA 4F7ZA 2PHDA 1BC7C 1O7FA 1UW8A 4PCQA 3Q5FA 2K86A 1H1MA 1XE7A 4XLPF 3GYDA 5FD5A 1MDMA 2DK5A 4UNOA 2WFPA 4U0VA 4KMUX 1ZG5A 1NE4A 4LG0B 4HN1A 4PIYA 2ZMEA 4AD9A 1HSTA 1RGSA 5L3EA 5E1RA 5L3DA 1VR3A 4MQVA 3LAJA 3NW4A 3OOPA 5L3GA 2OYZA 3WW1A 1P2FA 2VOOA 1T6SA 4ONUA 1SD5A 1KU7A 2ZKLA 2E9QA 3RTRA 3BCWA 3HUGA 2ZFWA 4RD7A 4ZYDA 3DP7A 1F5TA 1LRHA 4F8AA 4L5JA 2IJLA 1ZG1A 1EH7A 3WTWC 1OD5A 1EPZA 5KHKA 1WKMA 3FHZA 1Z1DA 2ATFA 2DT5A 4CHUA 3KGZA 1U2WA 2ZO4A 5FO5A 1IN7A 1S8NA 4HBLA 4YNIA 1OKRA 1REPC 4BNCA 1J3QA 5D4SA 2QENA 2VBXA 4Z07A 1R58A 4ESBA 1SAXA 1SFXA 3W6KB 5D8KB 2CSOA 2O8XA 4G6QA 2OD5A 1XN7A 3E97A 4DNCA 1PP7U 2VT3A 2UYBA 4M6YA 3KGLA 2IXJA 1F1ZA 5JR7B 2A68F 4K8FA 4HV5A 1D8JA 1UHMA 2IA2A 3DXJF 4KIBA 3S7IA 1ON2A 1YLLA 3ERED 2CWEA 1X7NA 2XRNA 2Q4SA 2RQPA 1K7AA 4ENNA 3NKTA 3SQNA 3WTVC 2Z3YA 2PFBA 3VODA 1CAWB 2IXLA 3DPTA 3QAHA 3NVCA 1FP1D 3H8UA 2O8QA 3LAPA 4HYEA 2MH9A 2YSRA 1RIOH 2ETHA 2DI3A 4PZJA 3SMHA 2B0LA 5JSRA 4Y15A 5LGUA 1W4MA 2HQRA 1SFNA 4MUVA 4G8XA 4HQMA 2YU3A 3CF6E 3LQQA 2ISYA 5DYMA 1DZTA 3CLPA 5FLXK 2J5PA 1XGNA 2EFQA 4AQ6A 4UV8A 1IUYA 4G9YA 2HYFA 1ZLKA 1USSA 4QM9A 4LUKA 4WWCA 4ENMA 2YPRA 3T5XA 1WWXA 4YIIA 1P4XA 1JGSA 3P7NA 4UV9A 2MNGA 3FMSA 2KJCA 4KWJA 1Y9QA 5CJ9A 2NRAC 4PDKA 2O61A 2QJVA 4IEVA 1ZGJA 3KEQA 4HF2A 2IP2A 3E5UA 4FX0A 1T38A 1YQAA 1KU2A 1ZZCA 5FPZA 2UZKA 2FE3A 5EFUA 5KHJA 3ZPLA 4BHCA 2GC1A 5E8IA 2W57A 4HVRA 1FC3A 1YUDA 2EJRA 4IESA 2IPQX 2RN7A 4Q0SA 3RKWA 4O5VA 1IXCA 3PQKA 2MLKA 1Z6RA 4LMYA 4M73A 4IEUA 1UHWA 5ILUA 1J58A 1ODDA 3H50A 5KHHA 2HTJA 4CGZA 2RDPA 4FX4A 3ZN0A 1PM7A 5KHGA 5E1ZB 2MHFA 2V1XA 4IEYA 2WWYA 1NHAA 3H9AA 4HBNA 5A2QK 1XCVA 4EMSA 4JBAA 2KIFA 1IAWA 2OQGA 3C18A 1XMKA 1Y3TA 3GZ5A 3KZZA 1C0WA 2VODA 1EV7A 2JPBA 2DFIA 4FAGA 3WTYC 2V6CA 4MGRA 1BJAA 4Y17A 5ILVA 1IXSB 1OMIA 2A69F 2Y0OA 1UB9A 4DQ2A 4M6XA 4Q29A 4KU7A 2F5EA 3M1EA 3WTXC 1DPRA 2O0YA 2OBPA 1ZNPA 3V7CA 2PMUA 3SFZA 1BI0A 2MPFA 1ZN2A 3BPVA 3TOAA 2M5WA 3FMQA 4OLLA 4UXNA 2PTMA 2YR2A 2I45A 4L2NA 4XF3A 2NNYA 4QGLA 1YW8A 4S05A 1PP8F 2VC0A 4LA3A 2K4JA 1O3SA 1SD7A 3IL2A 4JV4A 3HOSA 4P5OA 3T0YA 3ST7A 2Z69A 2O1QA 2E7XA 4EV0A 4O6JA 1P4AA 4L0YB 2JRTA 1XE8A 1LB2A 1EY2A 4LG0A 5FPXA 1QPMA 3I7DA 4KNYA 4EM1A 1Z05A 1GXQA 2P5KA 4P96A 5IT9K 3V8LA 1ZRFA 5ED4A 1JUHA 3QP5A 1FWZA 3KETA 1UD1A 3PFIA 4IERA 2QQ9A 2W25A 2PAMA 4M9SA 1U78A 4AXOA 1KYWA 4AIHA 4NQWA 3ES4A 2ETEA 2V09A 3C7JA 3U2RA 5HDKA 4FT8A 2IA0A 1UCRA 3R0AA 4LUMA 2CGPA 4A0ZA 4OIRF 2MBFA 2Z9OA 1QWRA 2DW4A 3I59A 3E6CC 1FZPB 1U6GA 4LLNA 2DAOA 1XMAA 2VPVA 3FE5A 2CAVA 5FLJA 3GEZA 2L4MA 5CADA 4BIFA 1IPKA 1U3EM 1TTYA 2XROA 4ZH4F 4QX5A 3I5UA 4IEOA 4ESFA 3E3VA 3RIRA 2HOEA 4A0XA 4HVQA 4EQQA 1R1UA 5D5VB 1ZYRF 3BALA 3F21A 1G3TA 3ECOA 5CVJA 3EUHA 3M8EA 3O3KA 3I59B 3DL3A 2XVCA 2F5DA 4YSFA 1CAVB 2MH2A 4WX9A 1BM9A 1IZ1A 4KICA 2L01A 2M30A 1Z6TA 2HFHA 4LULA 1I27A 1S3JA 2PMHA 1O3RA 4KIFA 4KWLA 4I3PA 1FI2A 5DUIA 3PVBB 3ETQA 4MEXF 5FQ0A 4KIGA 1ZARA 2A5YB 3TNQA 3NRVA 5I8YA 3LWCA 4MTDA 4EM0B 4GYIA 4B29A 2PFWA 3EETA 2C6YA 4UVCA 4EJWA 1Q5OA 2GU9A 1GQGA 3H7JA 2OAZA 5LEJA 4QMAA 3RKXA 2UY9A 4DINB 4ZU7A 3DN7A 3GFJA 3QACA 4ASNA 2GZWA 2W24A 5LRSA 3HIFA 3MYXA 4EROA 1RL3A 2UXNA 1STZA 1S7OA 3CO2A 2OU2A 4HDUA 1O4TA 3TNPB 1DDNA 4G7HF 4KMFA 1ZAOA 1ZG3A 1AOYA 5I8SA 3GW2A 3J81Z 3CLOA 4YFNF 1YYVA 1ZLJA 3D82A 3I54A 4PIZA 2A61A 4E2QA 4HQEA 1XSXA 2H6CA 4Z82A 1FNNA 3GO5A 3Q9SA 4MV2A 1MKMA 3F8FA 2ZKZA 1MD0A 5K5RA 2Z2SB 3EQLF 1R23A 3MDPA 3ELKA 3D5LA 4OMYA 4WCGA 2FRHA 4TV7A 2JSCA 1TNTA 1HBXG 1FX7A 2WC2A 2PEXA 2QWWA 2OPKA 2VT2A 5ICGA 4UXAA 3O6BB 1JHFA 2DTRA 3L7WA 3FZVA 1MJAA 1VTNC 3WE3A 2TDXA 4XFFA 4HVOA 3IWFA 3TO6A 4ZYEA 5LHGA 1EH8A 3QU3A 2GC0A 3MQ0A 4GXOA 3QPTA 3W6JB 2H0VA 2Q30A 1FBSA 1ZREA 5CVRA 4XBFA 4O9GA 5DD4A 2BNOA 5IT9Z 2ZBKA 5BV6A 2KIUA 3D0JA 4A12A 5E1XA 4E2SA 4XSZF 4M9XA 5H20A 1Y0UA 4GGGA 3H3ZA 1LKNA 2DBBA 1EH6A 1LNWA 3NEUA 1JXSA 3LWFA 4HOBA 4QXKA 3RYRA 3ML6A 3H1MA 3GZ6A 1O3QA 2VN2A 2Z99A 2ZJ2A 3IRRA 2EWNA 3HRSA 4IEZA 1J2XA 4P9GA 3VB2A 3H7YA 2P5LC 4YARA 2HS5A 3HRUA 5ICCA 1J59A 2DCTA 4QGMA 2DO7A 4KFCA 4L9TA 2E1CA 3KE2A 5AIPA 2F5CA 3E5QA 1RUNA 5CVUA 1B9NA 4XF9A 4Q5SF 4WZCA 5K8SA 4IRHA 5K5QA 4U88A 2ZNZA 5KK1A 4OIPF 4AIJA 1ZRCA 4ZYGA 1SFEA 3CUOA 1ON1A 5JFRA 5BXXA 4IHTA 3L9FA 2PJPA 2EV5A 2HWVA 4LB6B 4M74A 5FFZA 4RB3C 3QU6A 5FB2A 4I02A 1BIBA 3FM3A 1BI1A 2PN6A 2Q1ZB 2BNNA 4HZFA 3FM5A 1MZBA 5HDGA 3HSEA 1NYWA 1F9NA 3KLOA 1XSDA 4ZZDA 4BXUA 3V8JA 4A5MA 2IXKA 1U5TB 2EVXA 1OYYA
chains in the Genus database with same CATH superfamily
3RYKA 2GA2A 3TO9A 4QKDA 4J1WA 1JTXA 2WS92 3JSOA 1ZGWA 4FFHA 4I98B 4EN9B 2ERFA 4K21A 1YIJI 1YIFA 3LA7A 4JX4A 1YFXA 3G3ZA 5HS8A 4XHBA 4UAPA 3NMBA 4GH4B 2M4GA 3O8GA 4NHMA 4Z92B 1R1VA 2BHZA 1YJKA 3OYFA 3CJXA 4XRSG 3ME2A 3ZYHA 4LKEA 2R30A 3ZYIB 2FZ2A 3AG4H 3MWMA 2XPUA 4HW0A 3DLLF 4UW6A 2J22A 4JTNA 2M0MA 5BPIA 1B6AA 4WVWA 3S6PA 4GH4A 2FD8A 2A71A 2JA2A 2CGNA 2BGOA 3DBHB 3DFGA 2VTFA 4HSLA 1DGLA 2R042 4YIRX 3COAC 2CV0A 5C6CA 1XDUA 1J3RA 5KC5A 5HLHA 2EV6A 1FLIA 1PVEA 2EZLA 1OLTA 2R1BA 1HW2A 2A5ZA 4O61A 1O57A 3NAPC 4PQ9A 1PO21 2RVCA 4CE8A 2G0EA 2XKPA 1TL8A 4XUPA 1FIPA 3IBMA 4EN0A 3MKYB 2EZHA 3HEIA 1HQNA 5FBZA 5AVPA 5GJ6A 4Y4RA 1MDMB 1S1AA 2JDUA 2XJVA 1RUH2 1T6GC 5J6XA 3ZOBA 2EIEA 2B42B 2EA2A 1KZHA 3K0LA 1VMJA 2D5HA 2JT1A 3DECA 5FMDA 3J80Z 2KKOA 2VJIA 3OCPA 1H2KA 1QA6A 4NUBA 1POV0 2DVBA 2GQQA 3FMRA 4ZJZA 3DGTA 4FPYA 1XCBA 3KYDB 4MFEA 1HB2A 1J5YA 4C91A 5FYMA 3C7OA 1DGRN 2RS52 3L9JT 3MV11 2X6OA 4XFAA 2W1OA 4CDQA 2R7DA 2ISZA 1QJZA 2CW8A 1I1SA 3AKSA 3CO6C 1BR2A 3V8KA 3PQJA 1AR61 1U0JA 4Q2FA 3MW3A 4NHYA 3ABKH 3B3QE 2DBNA 1WRJA 4LK0F 3KYCB 1BL0A 2GH2A 5CQGA 1N78A 1VRH2 3T0BA 1UOJA 3I3EA 1PGSA 1A5JA 2UV1A 4LTAA 1UZZA 1L3LA 4FQZA 3D4KA 1A8DA 5FMOS 3AMPA 1O7LA 1PMIA 2R5ZB 1DZRA 2VCBA 5K4LA 1WBFA 5DDJ1 4HA8A 4EGYA 4XF1A 2ZXJA 3QYFA 5DPNA 1LFBA 2ZGMA 1NOVA 1GXPA 3PL8A 2OT7A 3GCMA 4LG3A 5F3CA 3BJ6A 2BUKA 4Q0QA 3SHRA 2JQ7A 2EFOA 3OPWA 1UY1A 2GSYA 1OPMA 3SYTA 1ND3B 2I8DA 1LEBA 3F8BA 2R7XA 1DGRM 2Y26A 3U4XA 2KFDA 4AI1A 3DCFA 2BW8A 1UMIA 1E2XA 4WM7B 3THPA 3AYAA 2KJBA 2LS6A 5KNLA 3ZXGA 4XXAA 2ZXIA 4AYBA 4AYUA 1D8KA 3G1MA 2D7FA 3OL3A 4R79A 1BI2A 4Y22A 1QJU1 1UAIA 1OQDA 2WT0A 5C9AB 5J8FA 3ZFEC 1H8VA 1E5IA 1QJY3 3LSMA 4BS9A 2KISA 5CKTA 1F31A 4YG0A 5H9PA 1XNTA 3EUAA 4EEFG 2JA5J 2JDPA 3AKRA 3HBZA 5HXVA 2BW3A 4R9CA 4CU8A 2P7CB 3POIA 1PO23 5C4WA 4QQ2A 1RUD1 2KR2A 1MPXA 3I56I 4LR4A 1XYNA 2ZGPA 1OPCA 2Y30A 2BOIA 4G6DA 4M01A 2VECA 3TDZC 3ZN6B 1QJX1 4B1LA 2F5FA 3MIFA 2ECCA 2R041 2K4BA 3LB9A 4RQPB 4YM2A 2A6TA 2XAUA 4PGHA 1LJ9A 4OHVA 2ESHA 1AR71 5GTIC 2BE5F 3ILNA 2L7KA 5FP3A 1JZ6A 3KV6A 1NUKA 2ZHKA 4MNUA 1SDDB 2XHKA 1JKQC 2W39A 4YFKF 4YG6A 4CCMA 5FLIA 5CFCB 3QYEA 2C9KA 1QXJA 5HNHA 4BCUA 4IVNA 4QX3A 3VOEA 1FTTA 1ASJ3 5IATA 4RGXA 3O12A 4O7XA 3E6MA 1YFUA 3M3QA 2E63A 1WLCA 2GMMA 1RHI3 3B7MA 1BBYA 2UWBA 4XFCA 4J00A 5ERLA 1ENXA 2A3SA 2WNVB 1QNWA 1BZWA 1T98A 1N1YA 2W94A 2DDBA 2OV7A 4GO1A 2DVDA 4UB6C 2B9UA 1GQHA 2AQEA 3M3EA 5JMOA 1B4AA 5FQ0B 3KP6A 1NCRB 4FSJA 2KXLA 5FKKA 1KGSA 3I3BA 4RB1A 1MR5A 4MGQA 2ZSIB 2VE1A 1S0GA 2JE7A 1X1CA 1QF3A 5FPLA 2XBO3 4DEVA 1SQ4A 1Z3YA 3BLYA 2EB7A 2Z5WA 4WK8F 4WBBA 2RE9A 4CO8A 2C1FA 1MBEA 1NK2P 4AVCA 2HNHA 2XLGA 1MS1A 1IG0A 3ZMTA 4HRIA 2OPTA 1A3KA 2A70A 2JDKA 4ASLA 1POGA 4TN7A 4BQ1A 4XURA 1PGW2 1VBA2 2WABA 2HWE3 2ZX0A 4D8MA 3WUDA 2DCZA 2V26A 2D6KA 2W82A 4A3JJ 5HLGA 1GLHA 1DGWX 5DG2A 5GZFA 3OGGA 4LBMA 2BEOA 5I91A 3TEDA 2CWMA 3I3DA 2XWBB 3OYIA 2E5ZA 3PVEA 1QZZA 4BA6A 1RUI3 5DUXA 4BE3A 2JDHA 4HAMA 1CQTA 1H8TA 4YIFA 2V5YA 2XB5A 2Y60A 1KEXA 3ACLA 1WCMJ 1FOD1 1UOBA 1SPPB 3KP5A 2L7FP 1T8IA 2YU9J 5DZEA 3W2AA 2PN5A 3JTGA 4L97A 2D40A 2GOMA 4RGKA 3FXUA 5KHIA 3AMMA 4RFRB 4NHXA 1K5MB 1GZ9A 3C7GA 4RHV2 1TW2A 2R6QA 3D6EA 3TGNA 3AZZA 3TO7A 2P6HA 1C4RA 5D5WB 2CV2A 4XIOA 1I5ZA 3ZN6A 3WW4A 1T6BX 4OI2A 5FBJA 3KZ4C 3TOJA 4DO0A 4OU0A 3DWLE 3FXQA 3BG7A 3VYUB 1YW9A 3F22A 4CDWA 2OVUA 1X4OA 3VDDA 5JZGA 1STMA 2V72A 4MX3A 3IIAA 1DHKB 4IHYA 1YLFA 3PUAA 3SEQA 3K2OA 1I1GA 2L3DA 2VM9A 3SH3A 1RUD2 1JZ4A 1VAMA 2H1KA 2VJ5A 5F6FA 1R091 1JZ7A 2V9KA 5D5XB 2ZGRA 2B5HA 1REDA 1JUMA 4MHRA 3RWKX 4HV6A 4LK1F 1OR7A 4FP3A 2LSOA 1DU6A 1V3FA 4QPOA 3JUUA 1WCDJ 2HVRA 1JZ8A 3PMEA 3HMYA 1AR72 2WYSA 4XZPA 3M8FA 2V1UA 2WAOA 4HLYA 3ZDVA 1NAEA 4EN8B 4ITVA 2CSGA 1C8NA 3OV8A 2IXIA 2RREA 4RSUA 3C2BA 3ZQFA 3BTXA 1K3IA 3FJSA 1QH6A 2QKMB 1EF4A 1WPKA 1DUXC 2RR12 5E1WA 3WGHA 3DQVC 2WWJA 2M87A 5C44J 4E2GA 1WJFA 4D6RA 2HZTA 2LVSA 4B4RA 1MACA 4XLHA 4B8EA 1NXMA 3ZYBA 4Y33A 2XH6A 4COWA 1PHMA 2P6TA 4JK1X 4QXCA 2XDVA 5DG1A 3K4KA 4B8XA 3LDRA 3WNOA 1J7KA 4W4ZA 3D0SA 5FP4A 2FMYA 2WY8Q 1HRV3 5M3FJ 2D3PA 2WYFA 2EH3A 3PUIA 1HV1A 4KL1A 1B35C 2VBYA 1NT0A 2W1QA 5BNNC 3ZVXA 5A7WB 3SZPA 1SVMA 5JSPA 4YM0A 1WA4A 2F4OB 2CTVA 4HLTA 5E18F 2LBFB 2RG4A 2VL4A 5EIYB 2YROA 4ZYHA 5IYYA 2GN3A 2UXXA 1WJBA 4Q4Y2 2OUMA 1V6JA 5D4RA 2W87A 5A7OA 1SD6A 4B3XA 3KP4A 1R5GA 1XBFA 2JEMA 2K9ZA 2VNRA 3I2KA 5EG0B 1UY4A 2ZKNA 2PELA 1VBA1 4AQTA 2K9SA 2I5UA 1X9PA 4V19K 4IJAA 4M4PA 1BJQA 5L3CA 1QY4A 3SKJE 4BPZA 3MAJA 5CNAA 2Y6KA 2HEYF 1XX5A 3GX4X 3S3OA 1NCQB 2ADEA 2DFBA 5LB6A 1P4WA 2FBHA 1G3SA 2Q1FA 2WNUA 1S7AA 3HHGA 3SEEA 1Y1VJ 5D6EA 3IKTA 4ZPIA 3HTSB 1VBD1 3KV9A 2BQPA 5GZGA 1YJWI 1VQ8I 1U5TA 1QEXA 1LEAA 5A2QZ 1U12A 4YFZA 3CMMA 3EBRA 5EDNA 2W47A 5A32B 2MD0A 4CU7A 3ULQB 1P92A 1REFA 3F6VA 5A7NA 2WO2A 2ZGLA 4QB1A 4C90A 2ZEYA 4RHV1 4ETSA 1LOFC 2XF6A 4A7YA 1UPIA 1K6YA 1HRI1 3MZ8A 5FZ6A 5I0UA 5HCFA 4IOAF 5J3UA 2ID4A 3KFWX 4JC1A 5JOWA 5JXIA 4GMP3 4CCDA 4L9NA 5FKLA 4PBPA 3A01A 4N9IA 2E2HJ 2J5OA 4M3FA 2BVVA 2HBTA 3KT7A 1PX3A 5J1YA 1O4YA 4YVWC 3CBNA 5LK5A 1UWWA 3ISPA 4HNVA 5FKNA 2Y48A 1XNCA 3MLKA 1F5JA 3S1MJ 3T8RA 3RFRA 3RCOA 3MIEA 4HKWA 3UKTA 2TCTA 1ZYBA 1CPNA 3N9PA 4LD5A 5I0TA 5LZ6A 1R5ID 1CESA 1R092 2DA2A 4B09A 2JB4A 2FOKA 4OFGA 1T08B 1HCRA 4LO6B 5BUVA 4LIVA 3CF2A 1W36C 1FY7A 4NPRA 2A73B 1MS9A 3NJZA 1O3TA 4KNCA 1HQLA 1OLRA 3FKJA 1H2MA 1X8EA 5EEGA 5JR2A 3CEWA 2DU1A 4U36A 4WM7A 4LK7A 3ZFGB 3J81K 2HEOA 5FPUA 1JU3A 1GBGA 4CU9A 4NJ4A 2MC3A 1OYIA 4ENKA 1CF7B 4IZZA 4WVZA 4BK5A 3O1TA 2WKKA 5LW9A 1K78A 1W0OA 4D7NA 5J36A 4C1WA 2Y31A 5DUVA 2GNMA 3WF4A 5BS6A 3ABMH 3ABUA 3O14A 3GLLA 2FBIA 4LOTA 4QLCU 3LNQA 1W0TA 2D1HA 4GA9A 4HNUA 4UVBA 1W2OA 4QHZA 1I6XA 5DMYA 5GALA 3JRAA 3FBMA 4UFKA 2E7WA 3JAMK 5IW0A 3SLIA 2HTSA 1NA1C 4XIDA 1C8M3 3LZZA 4RAZA 2AREA 4Q4Y1 5FLXZ 3S16J 4HLXA 4AZZA 2EA7A 3RZMA 1X2NA 1W39A 2NS0A 5CFDC 5D6FA 4A7KA 3J7YJ 4NO4A 2ELHA 1AVBA 3KCYA 2D44A 1OCPA 3GFIA 1FMWA 4ZZLA 3PM1A 1Y9MA 1ETWA 1X3UA 3A23A 2XG3A 1O5UA 1D0ZA 1Y8RB 1PUFB 1X8MA 2JG8B 2UWCA 3LDKA 1TT0A 2V1DA 3M1CA 3NNGA 3ZQ7A 1LAJA 3ZQHA 4YGCA 5FZCA 1NCQC 4OAZA 5C4WB 1RUH3 3KV4A 4QIWN 2JXAA 1NE6A 4C0HA 4CDWC 3N7KA 2Q8OA 5K0UB 3OUHA 4O9EA 5JR3A 2YBSA 1LUJB 2QQBA 4QPGC 4HSJA 4AEJA 2VGDA 4ISRA 3O7OA 4MVTA 1FXZA 3ECQA 1YFHA 4YM3A 3VBUB 1L7QA 3UGHA 5A6QA 4QU1A 5JI7A 2NYYA 5EYRA 4A6EA 3W21A 1H1IA 4CUAA 3VBHA 1GWKA 2A5WA 4S2DA 4A69C 2YGMA 1UELB 1IN6A 2ZMNA 3MICA 3USUB 1RINA 5BNNB 2WWUA 2K3PA 1B35B 4CICA 1YJNI 5C7GA 4K9SA 4MQ9F 4MGIE 4CCJA 4E8DA 1LR5A 3HGYA 1PMHX 5TJJA 1NQDA 4EWAA 1JT0A 1KS5A 4E9KA 1WCKA 4QPIC 2MSYA 1H6XA 2VUJA 3HGGA 4LBJA 1UYXA 4CDUC 3U4SA 2FJ1A 4KYWA 3DU6A 2WNOA 1MZEA 4LXLA 3EUKL 2R7ZJ 4A3KJ 2GWRA 1R22A 3ZFFC 3AM2A 2W92A 1XU1A 4HFSA 1HKQA 1F43A 4LBQB 1MS8A 3H1WA 5CG9A 5IWFA 5JWPA 2YBPA 4IQJA 2XKOA 1QJFA 4HN0A 1PZ9A 1LQ1A 1IO2A 1DGWA 2VOWA 4N53C 1IS4A 4U87A 3LQCA 2GP3A 2YPDA 5T5JA 1XMXA 5IP9J 3VDDB 3DCQA 1N3QA 4N53B 2HWF1 4QHBA 4CDGA 2IW5A 3LA2A 1MS4A 2ME0A 1J3PA 4Y13A 3U14A 3LKJA 4LO5B 2QQAA 2BNMA 1W8NA 2IC1A 1NY72 1YQ5A 3ZFFB 1CAUA 3VV1A 2XJTA 1XYOA 4CDUB 1AL23 1JKOC 4F7ZA 2B63J 1X3ZB 3WINE 4QPIB 3Q5FA 5DUUA 3IUOA 3J7HA 4UUSB 1PM4A 1H1MA 3GCWA 1XE7A 1SDWA 4FOYA 4XLPF 3GYDA 1BXHA 1PO13 5FD5A 4NHKA 1MDMA 2BY1A 2PHWA 4JQRA 3TB0A 1RUC3 3IM0A 1NE4A 1AR81 4HN1A 2EIJH 3DEEA 4AD9A 5CBLA 4QPGA 4M3DA 5L3EA 5GPAA 4RHV3 1VR3A 4MQVA 4BXSV 2XJRA 5L9VA 3OOPA 1W6QA 5IYBJ 2ECBA 3OIPA 4BQOA 1Z7LA 1T6SA 2DYCA 4CDXB 1SD5A 3RMXA 3VBUC 3O1UA 4RD7A 4QPGB 4CRQA 4F8AA 3LFMA 3AJYA 4C2MJ 2VNVA 5H9QA 3OR2C 1YITI 1OURA 1ENQA 3J7LA 3U75A 1OD5A 1EPZA 3WP3A 1HRV2 2JDNA 5E88A 4CDWB 1ZBA3 2JD9A 4AI3A 1JUSA 1POQA 2JN6A 4XYXA 2MFZA 3KGZA 1YC61 1Y9GA 3KZIC 2ZO4A 1IN7A 3PO2J 4HBLA 2DVFA 3ILRA 4YNIA 2XC7A 3PUHA 4WVVA 1IHMA 1D2SA 1X19A 2QQKA 2W68A 1SAXA 4ESBA 1BCXA 1LODA 1JZ3A 2RS53 3BT9A 3MEPA 3VDCA 5IOYA 4QSHA 2BJSA 1XN7A 1UY0A 1A6QA 2DODA 2IBDA 2DFCA 1OQYA 2IXJA 3ACGA 5JR7B 3AJZA 4CU6A 1UHMA 3K10A 2RS11 2WA3A 4EQVA 3M8LA 3RGBA 1W9SA 4AL9A 4KIBA 4I99C 3BCBA 1XNDA 2XRNA 2Q4SA 2DYRH 1K7AA 5IVVA 3VDXA 4DXTA 4FXGB 3RJ2X 3VODA 3POJA 2IXLA 3DPTA 2XPJA 1PIV3 3NWKA 1NA1B 5FZAA 4HYEA 3AZVA 4PZJA 3VD4A 5JVGF 2CU7A 3H0DA 4MUVA 4K6BA 5B1AH 2YU3A 3LQQA 2ISYA 5DYMA 3CLPA 5FLXK 4DZJA 3Q8AA 2HI3A 1WFXA 1VMFA 1AR83 1ZLKA 1USSA 4QM9A 4LUKA 2X1DA 1G9CA 3R4UA 3AL6A 1WCSA 2QKDA 1V5GA 5AVAA 2JJ7A 1SLAA 5CJ9A 4MOAA 2O61A 4E6KG 4MXVA 1NG6A 2JVHA 3KEQA 3E5UA 4NAOA 1V6OA 1RITA 1KU2A 2VJXA 1ZZCA 5DUWA 3N9NA 3HOZJ 4RQPC 5FPZA 1S0CA 3FK6A 5EHDA 2W57A 4IHVA 4PCRA 3Q8EA 2EJRA 3CP2A 2M7AA 2RN7A 4Q0SA 3RKWA 2RDRA 3PQKA 4J25A 3OBRA 4IEUA 1UHWA 2O14A 5ILUA 1JUPA 1ODDA 3ALQA 5KHHA 1LJ7A 1BA5A 2O8OA 4UWDA 4XZUG 1T33A 4Q5OA 1W0NA 1RUJ1 4TSVA 1L7RA 2ZABA 2RDPA 2J1EA 4FX4A 5KHGA 1PM7A 5E1ZB 4IEYA 3HPNA 2XF5A 2W00A 5A2QK 4EMSA 2PHRA 3PL0A 3S93A 2WQZC 1QQP2 4ET7A 4F83A 4E7IA 4P5YA 3B01A 1WKYA 3OS2A 1EV7A 5IUQA 1MVEA 2I07B 4J01A 1W2NA 1WMDA 4XJ8A 2K85A 1COV1 4LMFA 1UB9A 4DQ2A 3JD71 3ZKUA 3ZIWA 1VQKI 3M1EA 4I6ZA 1RR7A 2FDFA 2O0YA 1H4HA 5KAFC 1GNYA 5F2WA 1SLLA 4Y3OA 1ZNPA 3AKPA 2PMUA 1K4SA 3L2VA 1ZN2A 3BPVA 4OLLA 3FMQA 4XHXA 1MEC3 2BZDA 2VUAA 3ZGKA 2NNYA 1V9U1 1TWCJ 2PX9A 4UFLA 3BC8A 5CPRB 4IUGA 3T0YA 3ST7A 1V9U3 2WFF2 3L2YA 2O1QA 4EV0A 1LESA 2A3WA 4GB31 2JRTA 2E7TA 1LB2A 5M3MJ 1JJ6C 2M9HA 4KNYA 1GXQA 2J1TA 4YGBA 3V8LA 2RV9A 3I97A 3VD3A 1NKGA 3QP5A 1UY3A 3ABZA 2LY1A 1FWZA 3KETA 1UD1A 2W52A 3PFIA 3OYMA 3S14J 5IP6A 4M9SA 4RBOA 1QHDA 4O65A 2LG4A 4AXOA 3JU9A 1VZ0A 4YW5A 4BQWA 3C7JA 3SEPA 5C71A 1O91A 2KP6A 2VZVA 1OOPB 4LUMA 4A0ZA 5JOZA 4Q4W1 2VZSA 1XSRA 4ATEA 2QBXA 2Z9OA 5CFDA 4UOJA 1QWRA 1U6GA 1XMAA 2WO7A 2IS6A 2CAVA 1K5JA 4GMP0 4MHUA 4BIFA 1OJLA 3N7JA 4QX5A 2MEV3 4DY3A 2AHQA 3R0RA 2FCVA 3J7MA 1R1UA 4Z6YA 1LGBA 3BALA 2IFWA 3WNMA 3IH3A 3EUHA 1RHI1 2EF6A 1YQ6A 2DXIA 3A4CA 3NAPB 4DOUA 4UFMA 1BM9A 4BJ5C 4WX9A 4M3CB 2M30A 3RSJA 3ZSJA 2PMHA 1W2UA 2NXNB 4P00B 4UT5A 4KISA 3ETQA 4KITB 1TG7A 2WNUB 1ENHA 2ZS6B 3OGSA 1PO11 1QJY1 3NRVA 3LWCA 4CXXA 3AYCA 4MTDA 4IDZA 4EM0B 1OQ1A 3EETA 5C3RA 5FZ3A 4CEWB 1XC6A 4F55A 3H7JA 4JKKA 2OAZA 3URFA 2ZHNA 1VQNI 2HOSA 1VQ6I 1W6PA 1DQ6A 1RUJ2 4XQ4A 1S7OA 1E3OC 1O4TA 4G7HF 4ASKA 4A4AA 4A7ZA 3MD2A 2J1AA 4W1UA 4F92B 3ZSMA 3WF0A 3KVAA 1YYVA 1ZLJA 5K7ZA 3HBKA 1SACA 1XOYA 2HWD3 1IS5A 4MXWA 2W08A 4Z82A 3FN9A 1UAAA 1RUC1 3UNPA 2PHTA 5FMOL 4MV2A 4OQ8A 4AI2A 5HCHA 4OMYA 3HNYM 3DLAA 4ZS2A 3TAYA 2JSCA 4H3WA 1TNTA 3OYLA 3U1XA 3NV4A 2OPKA 3GALA 2FCUA 2XOMA 2VOKA 1V5FA 1WLDA 2EPFA 5EG0A 1TC3C 2YGLA 1VFCA 1ORKA 3WE3A 1V9U2 5HBAA 2TDXA 3UR3C 3IWFA 3DTIA 3TO6A 1A34A 2A3YA 5DM7F 3MQ0A 2IUWA 1FPN3 4RDUA 4NRPA 3LFUA 3AX4A 2W95A 1MNEA 2R7SA 2X48A 2BNOA 4XBNA 2HEVF 3WQ0A 2KIUA 1PVC2 4A12A 1MBFA 2AO9A 4DNYA 5A1AA 3VBRA 4GGGA 1ZBE3 4W6WA 4XN3A 1CD3G 4QXKA 2Z99A 4IE6A 3IRRA 2FX0A 4PLMA 2JECA 2C24A 2JKXA 1DGWY 1RUG3 2BWCA 4P9GA 3J7ZI 4BXXJ 5LWBA 3ZR8X 4BKXA 3K70D 2IGOA 5ICCA 2ZEZA 4QGMA 1FOWA 4SLIA 2E1CA 3Q0UA 1KDMA 5EYYA 3PHMA 5CVUA 1B9NA 1ZM1A 1H6YA 4IEJA 5K8SA 4CH7A 5F0CA 2PMWB 2IS2A 5A3PA 5KK1A 4OIPF 1SFEA 3D5RC 1XPWA 5B1BH 2EV5A 1S7EA 2HWVA 2CQXA 1IZ3A 3H9JA 1NCRC 2D3SA 2OQ7A 1URXA 2HWB2 1DQUA 3FM5A 1CJDA 2D5VA 2XB6C 3HSEA 2GN7A 3TEWA 1F9NA 3ERMA 2R93J 1H4GA 2XBO2 1OCZH 3OD4A 3V8JA 4A5MA 4JOMA 2AACA 1BW6A 4Y1UA 2EVXA 1H9PA 4PF1A 4AYBN 5K0UA 2VXZA 2GC3A 2JKBA 2YUSA 5FR3A 2B7YA 1AKHA 3VBOC 3IDEA 3LSTA 3ZMNA 3QODA 3C7FA 3P1IA 2VQHA 1HSJA 2DQLA 3M4FA 2EZKA 1NLRA 3DEMA 3V4GA 5CFCC 4IEWA 3I64A 4M9ZA 2K46A 3VHRA 1H30A 4AVAA 1HDKA 4OUMA 4XE9A 3UNGC 1BOAA 3JRDA 4X1EA 5DM6F 1KITA 3ON7A 3LOBA 3CJIA 1Y0NA 4RAYA 3TN91 1LHUA 2CUJA 3BG6A 3CCEI 1F36A 3HT2A 2AUYA 2BBAA 4AGVA 1TWFJ 4AOCA 3CCYA 3AMNA 2BBVA 1IXRC 3BOWA 1OLMA 2XQXA 4QQLA 1QQIA 4COZA 1H8TB 2AYHA 3T4VA 4TLFA 4QWQA 9ANTA 4XBLA 2YU2A 1U5XA 3UGFA 3BP8A 1Z67A 2JUCA 3APBA 1YG2A 2BU9A 3ABLH 3ENRA 4BQAA 1N1VA 2A1XA 1LCLA 2RJKA 2B9VA 5E3MA 2HOAA 4PJNA 5C9AC 2ZGOA 1FMD1 4EN6B 2W0XA 1MMAA 3BTLA 1BR4A 4JYKA 4UYBA 3TEYA 1K61A 3S1QJ 1ACIA 1Y7BA 2D6LX 2GBYA 5BNOB 4OVEA 1A36A 1C8M1 4Q0PA 2R7UA 4X6RB 3RI4A 4ZZ5A 4ON0A 1LOBA 4LNVA 2KDOA 3CDLA 3M3IA 1W8UA 1OBNA 4RGUA 3S1NJ 5E17F 1Y4WA 4P9LA 3W5NA 3S5AA 1W9YA 4ATFA 2QQUA 5CYVA 4RMNA 2M8EA 2KDZA 2Q0AA 4AVTA 4CDXA 5HS9A 3GWZA 2EA4A 1GLNA 4XLNF 3OUJA 4LBOA 3MIBA 1SVLA 1BYHA 3GTLJ 1UY2A 5K5OA 1X36A 4L9VA 4XJ9A 3H9GA 5LBCA 3N4MA 2A7AA 1IN4A 2YYOA 4CEYA 3C3VA 3HPHA 2PI0A 1P7JA 2RVAA 3IP4B 2K9MA 4EVIA 4MGKE 3DPRC 1V4RA 2FXAA 3FXOA 2EK5A 1VQ9I 4LEJA 2LD5A 3EDPA 1QPIA 3PTYA 4HX8A 1RTVA 5FLHA 1GZTA 4ZONA 3UJQA 4HDVA 5EF6A 4YW7A 3NV2A 4L0ZB 3L2HA 4AW7A 3DU5A 5A33A 4NVPA 5LA9A 4Q4V2 2DU9A 2XAFA 1CAVA 4YRVA 2WB1N 1W1WE 1EAH1 4P9XA 2H27A 1JYTA 3ZXEA 3WF1A 2LH9A 3LSHA 2P3KA 1MGTA 3AAFA 2WJSA 1S0JA 5HLTA 4E4DX 4N4NB 2LC2A 4BE0A 1Q56A 2QQPA 3IPVB 2A3XA 4JKLA 4L11A 3AG3H 1AYN1 2GXAA 3JRIA 1T2KA 2A07F 1FAYA 5JZGB 2Y0SN 3POFA 3BR5A 3V7RA 2N7GA 2ZBJA 2E1NA 4JGZA 1MNMC 2LBFA 1MZFA 3SCFA 3BU0A 3HRMA 4U2AA 4Y4YA 2QF7A 3JSPA 1S2KA 2DA1A 1OT5A 5L73A 5A3OA 3T1MA 4QGNA 3OYAA 4CCNA 3CO7C 3VKFC 3IDBB 4BK4A 1MEC2 3HR9A 3CZUA 1RUOA 5H9SA 3ZP5A 2XASA 3K7AJ 1X1BA 5FZ4A 4DXZA 2W1SA 4BUPA 5FZEA 2LTPA 1ASJ1 4XXPA 2A75A 2MC4A 4HSRA 3T0DA 3WG2A 2J1SA 3JR9A 2DPDA 5FGMA 4IV3C 3BKZA 3ELNA 3AXEA 2Q8KA 2K9LA 1AYN3 3HOTA 1SEUA 4XEZA 4QXHA 1W3VA 3GTMJ 4CUGA 5HODA 1DLLA 4GDFA 1G9DA 2CV6A 1FMD2 3LEIA 5F9TA 2O3FA 1KFXL 1W7PA 3HNBM 5ERIA 2XR4A 3OSGA 3DPRA 4OI4A 4ZS3A 1RUH1 1XSVA 3C1DA 3F72A 3HZJA 1YFYA 1RUG1 4JHTA 5EPAA 3GBFA 1AUYA 4FCAA 4RA2A 4E7LA 1I39A 1Y56A 4FOWA 4F3JA 2HXIA 5KBFA 4A6SA 2EFPA 3ZN1A 2DTYA 2UWMA 2JJ6A 4G7ZF 3WW3A 3IHUA 1AR73 5EEHA 3RZLA 2R0HA 2R7EB 3EYPA 5BPXA 1ZBE1 4ZZ8A 2M1BA 2DU0A 3WGIA 2WAQN 4QX8A 1X50A 2DJNA 4KT5C 1P6RA 1SFYA 1DP7P 3VDBA 3W2VA 1OXCA 4YVSB 2LFBA 4QU2A 5FXXA 5KAIC 4YZ4A 1HKSA 1FNZA 3SEZA 3BDDA 5FZ7A 2WZR1 2VU9A 4NWWA 5A80A 5JIAA 2Y6HA 4ZXKA 3ACIA 2EXHA 1FTZA 1CVNA 3PDQA 2BHYA 1VQ4I 2PQQA 2ZX2A 5FO7B 3K69A 3RZZA 1CGPA 2VG9A 4CEWC 4GKXA 3PSIA 2L02A 4XJAA 3PFYA 2L0KA 4CEWA 1RUI1 1CX1A 4LA2A 3GFLA 3TW7A 5BQTA 4CCOA 3ZOIA 1LDDA 2ARXA 2AXLA 1LE8B 1EAH2 4I0BA 3ES1A 1OYWA 3CCSI 2O5RA 4R9DA 1KA8A 1GICA 3T3YA 2WQ8A 3JZVA 3RPUA 2QA4I 4A44A 3PURA 2WIIB 5I93A 3A0NA 2R16A 2DOFA 2E7AA 2IRFG 3ZQGA 2G9GA 3O1RA 4FOVA 2XPVA 3WW2A 2C0ZA 1YIPA 1J84A 2HWD2 3O1SA 1REEA 4PDWA 3P3PA 1FIAA 3WGGA 3IAPA 4AFDA 5JZGC 2EFNA 5EP9A 5EZHA 1QOOA 3GTJJ 1JE8A 2C4XA 2QQJA 4R9AA 3F3XA 4AI0A 5ILSA 3SISA 1JXNA 4R52A 3J80K 1KGYA 3P9CA 2E36A 2Y9YA 1WMFA 2DCYA 3K1PA 2VQLA 5A7SA 2Q0OA 5ANNA 2X1CA 5LHIA 5DXDA 1UYPA 4E4SA 2O03A 4A5NA 1ONAA 5F27A 1OOPC 1IV8A 4Q4W3 3R4KA 4CP9A 2G9WA 3I53A 4XLCA 3M70A 1WZXA 2XL7A 3DV8A 3EJKA 4D69A 4AF9A 4M72A 3VBSC 3ZMSA 4QX1A 3VEPA 3N36A 3VLBB 2DMPA 3VZNA 4WXHA 2YMZA 3UYJA 3LIHA 1AYM3 1LVKA 1IUFA 3LSGA 4CXWA 1RC9A 2PMZA 1AL0G 3PNAA 1RUF2 1OCOH 3Q0VA 3MF6A 4BEHB 4OCTA 3BG5A 1MW7A 2WQ4A 3NRUA 2HDWA 4K40A 4A3ZA 3E1SA 4KJZA 1LNSA 3HJEA 3NNMA 4IQ4A 5BNPA 1L0OC 4L99A 1XRUA 3KF3A 5HVQC 1RVF3 1UMZA 3FBIB 1R1A1 3B9CA 4XTMA 2QQMA 4G4FA 3KLNA 4LIUA 4BYYA 1ETVA 2RS33 3D8CA 4PJYA 5FROA 3U78A 1RUE2 5CFCA 2OZJA 4E70A 4BQ2A 1X1DA 2X51A 3RPUD 2E34A 1W05A 1M1EB 1KU9A 3GJAA 1AU7A 2L9LA 1HKTA 2QZ8A 2WAFA 2WS91 3SC7X 5IPAA 3HM5A 1PVXA 4GWIA 5IAXA 3I2FA 5G04L 1W03A 1JU4A 2VVEA 1LGNA 2PQ8A 3Q9VA 1JOJA 3UKVA 4B4CA 1AYM1 2WZEA 3LFKA 1TVGA 4PIXA 2VOPA 1TQ5A 2WN3A 2ZJCA 3BU7A 1IS6A 1AKHB 4GAZA 2VQAA 5FWEA 2YX7A 1HW1A 3NL1A 1G9FA 4MIMA 4XVHA 3VBRB 1FSEA 1N3OA 5A6ZA 1PUFA 5TSWA 3MFKA 5E89A 3RPQA 3DYMA 2OA4A 4PJ0C 2W1UA 5CYYA 4LBKA 3W59A 1TQPA 4R1HA 4G12A 1R1A3 3ZDSA 1YIOA 3K9TA 3M3CA 4A3IJ 1FPQA 4Z2AA 5K9YA 4Q4ZF 5EJCA 1LDKB 3O0WA 2LY9A 4IF4A 1RNLA 3AYEA 3S1RJ 1G7YA 2H6BA 3G1OA 3SDBA 2IEKA 2WSVA 1PMJX 3SXYA 4S0HB 4F93B 2QDNA 2CFXA 2D2WA 1GVJA 4IRIA 3L1PA 1E0EA 5AC92 1B72B 3WU1B 2QQNA 4X8NA 4M00A 3VBOB 2HQNA 1PVC3 3EYIA 2G1MA 4JX5A 3RYPA 4EJRA 1NG0A 3M1HA 1EAH3 3K46A 4DUXA 3FXKA 4C8DA 1CIWA 2WO1A 2JG9A 2WFF3 1MIJA 2Q8DA 4DOZA 1GQPA 2R5ZA 4FTSA 3CCLI 1WSUA 3WODF 2VLAA 4XF4A 5D2AA 5SV8A 3KM5A 3KZYA 1Z21A 5E3NA 1KD7A 3WTZA 3CESA 5T50A 3OBZA 4HF0A 2EXKA 2H94A 4JDNA 5FY4A 3T4HB 4XFGA 4FHTA 1HJGA 3FXRA 5FOBB 5GAEJ 1OLQA 4JTOA 1SCRA 1L3JA 4KWUA 2OQRA 2CQ7A 2HU9A 2Y8KA 3AL0B 5AFBA 2HVQA 2R32A 1DFQA 1CONA 2UURA 3SXWA 1CAXB 3CC4I 3DBRB 3IV5A 1W0PA 2V73A 1ZR4A 1YS6A 1OF4A 4OQ9A 2A6VA 3ZO0B 3AFHA 4QDSA 1Y43B 1ZH5A 5DD8A 3E5XA 1GOHA 1O5LA 2D6PA 4RB0A 3WD5A 1QNYA 1S0BA 1VRH1 2CQQA 1KJLA 2A6XA 5A3MA 4B3NA 1JOPA 3N97A 4AFBA 3HQXA 3ZXDA 1G3YA 1PIV1 1R64A 1R082 5FZLA 3IKVA 2ZZQA 3SCHA 4WVMB 2W2IA 3DXUA 3ZCOA 3ZMUA 4AUXA 1IJWC 1VRH3 1VAVA 2EAAA 5EZGA 3S7EA 3R61A 4KBZA 1XGOA 3T1BA 2VNGA 4CDXC 5FYYA 3BWGA 2JENA 2NN8A 1AR91 3EPZA 4CP2A 1CZTA 2E1MC 2IXSA 3REOA 2VKDA 1H0MA 1QDCA 2Y34A 2VULA 1VBC3 4XJUA 2EIBA 5CB7A 2E6VA 5F1RA 4DXRA 2TBVA 5DUKA 3A22A 1D1CA 3W2WA 5CA6A 3KVBA 2NVXJ 5DABA 1SBFA 3HOVJ 3OY8A 4FPKA 4XAEA 3ZLIA 5FYBA 5EEAA 3WG9A 4A6OA 3FK7A 2ACJA 1C5IA 1ZZBA 3ZPYA 1BLZA 3NAPA 1IRFA 4KU8A 1K6OA 1RXGA 2D98A 2LK2A 2B8MA 4II2A 1LPQA 5A6XA 3O2PE 4CSWA 2V4AA 2MLGA 2EV0A 1YWKA 4M4RA 2Z33A 4GWJA 4I2OA 4QPWA 2MYSA 3I4PA 3TEZA 5L3BA 1VQPI 3NWTA 1OFSA 3VDDC 3JQWA 5IK4A 2WLPA 4MTEA 1C57A 4N53A 4HONA 3ZN5A 3VKNA 3HG9A 2WV0A 4L5IA 4RAFA 2X53S 1XNAA 2AENA 5JHUA 3L2RA 5ABJC 2NOGA 3WVJA 2VW1A 4LLGF 2ZNYA 1Z7UA 3S3MA 3RJRA 5EV7A 2QBYB 1VBE1 2WNUC 4Z1VA 2EIMH 2HWF3 4RYDA 1OF3A 1RB8G 2QUFA 2SLIA 3LOIA 4N4OB 1WZ2A 1HXS3 4XF0A 1WJEA 5GZCA 3JB4C 2Y75A 5FAXA 4HX4A 5FYCA 3SNMA 3VBOA 1QJU3 2R7WA 4CVUA 3VZOA 3K4LA 5KVRA 3CF5F 1HLVA 2JG9B 1BMV2 2E33A 2VC1A 1O8SA 4LKDA 2RQQA 3V64A 1AHDP 3G7DA 2DVAA 1HDDC 3BPZA 2M34A 5E16A 1YHFA 1NCRA 5IT6A 2X6YA 3PJRA 5JVTA 4CA9A 3BQYA 4V2GA 4BB3A 2LKXA 3OSFA 2VQGA 2GXGA 2VBZA 2PHLA 2XPWA 3MIGA 1W6NA 2TNFA 3WU0A 3IMMA 2HGCA 1OUXA 1TWHJ 3SHFA 1RKWA 1F9KA 5C4WC 2KRFA 2DURA 3PLQA 2QSFX 3HN1A 1VP6A 1RZ4A 3OD0A 1DG6A 3F8NA 5IK8A 3LEMA 2OA2A 4META 2XLFA 4E7JA 1ZVFA 2XQRA 2WLQA 4AVBA 5FP7A 4NAMA 2O7OA 3INAA 1RKTA 2KRCA 2MW8A 2ZXHA 2G7UA 1IDYA 2CDPA 1DQ4A 2ZTNA 1IV6A 4DRVA 1JZ5A 4XQFA 4LOSA 2RMU3 3IDAA 5EYXA 1BC7C 1O7FA 1X4PA 1UW8A 1BEV1 2HYXA 3RI8A 3IKWA 3IZOA 5KXDA 1EJ9A 1DCSA 2LR8A 2GP5A 4ZY9A 3VPRA 5ACA1 4YFWA 1DBNA 2QE3A 2E26A 4XACA 1AXYA 4Y5SA 2WFPA 2WNVA 4LE4A 2ZX4A 4U0VA 2DWRA 4HG2A 4LG0B 4WM8C 1ULFA 1G2HA 4PIYA 3HN3A 3NQHA 1AXKA 1BK1A 3ZXSA 1RGSA 2DF7A 5FUNA 1XG1A 5G05L 4PJLA 5L3DA 4F52A 5L7OC 3OWTA 5CZKA 2BOLA 2OC6A 3IAQA 2P4EA 2NVQJ 5L3GA 2JA8J 2I2SA 2OYZA 5FFOC 5A32A 2VOTA 3A0BC 2GNDA 2VOOA 3VHPA 2E9QA 5B5EC 2ARAA 3GZTB 3HUGA 5A3LA 1HN0A 1F5TA 2QGUA 3I2HA 1LRHA 5JPMB 3Q8FA 1YXWA 4XBQA 3A01B 1JJ8C 1JYNA 3TMOA 3K4AA 3D1NI 1WKMA 2JIGA 3LSEA 5FMCA 5LA0A 1Z1DA 2DT5A 5LBEA 2E35A 1RYYA 5EXOA 3POWA 4MG2A 5GPCA 4IE4A 5FRNA 3OR1C 1OKRA 2ZAAA 4GWMA 3I2DA 3I49A 5B4NA 2RM21 1ND2A 1W2TA 2XJUA 3CKHA 5GLVA 2QENA 4Z07A 4DUWA 5C5TA 1F15A 3S17J 2LRPA 2VZUA 4MGTA 4BQ4A 2HYKA 3H8RA 1AL22 2EIKH 1PO22 3F95A 4G9SB 2WB1A 2A68F 1VBE2 2RR11 4D5CA 4YGEA 2ARCA 5C8CB 3DXJF 4AAXA 3S7IA 1YLLA 2CWEA 2E19A 1OISA 2X5IC 5F3EA 2Z3YA 1T56A 2PFBA 1MMNA 2QQ8A 3QAHA 3RQ0A 2VMDA 3GJBA 4Y1ZA 3CJQB 3LDBA 2XGCA 1CJPA 4QAWA 2MH9A 2YSRA 1ND3A 4GKYA 3SMHA 1CZVA 2DTWA 5JSRA 3QYBA 4MO7A 1UPSA 4HQMA 4MLOA 4ES9A 3WNKA 3G6JB 1HB3A 1XGNA 2EFQA 3MMYB 2XJQA 4UV8A 1IUYA 5B3SH 3MFCA 2RNGA 3DPUA 4ENMA 1A8MA 2ORZA 1WWXA 4YIIA 3JCUC 3FBNB 4KWJA 4PDKA 3N9OA 1ULEA 4AI9A 1X33A 1ZGJA 4MXWB 4HF2A 1VB4A 1W8OA 4PJJA 1T38A 5GADJ 2PLV2 4BDVB 2HWF2 3Q3SA 5KHJA 4BXFA 5C4JJ 2GC1A 4FO9A 3RWNA 2A05A 4HVRA 1FC3A 1YUDA 2IPQX 1ULGA 3BN6A 4O5VA 1J1TA 2R0FA 4FI9A 4IO9F 1JS9A 4LMYA 2GDFA 1S5LC 3V42A 1W8HA 1J58A 3H50A 1VQ5I 3CCVI 1FX5A 4PHZA 5IK5A 4GMP1 2QQIA 5A6YA 2NOJB 1SANA 1WW5A 5K7HA 1YYNA 2E60A 4K8RB 1IRZA 1IS3A 4YG3A 2WWYA 1J09A 3H9AA 4CP0A 3WDTA 3M8JA 2PLV3 3VKLA 1XCVA 3VBFB 4LHNA 4LOCA 2ILMA 3NAUA 1Y3TA 2X10A 3SITA 3GZ5A 3KZZA 1C0WA 2Y38A 5FIXA 2VODA 3B6AA 2W1WA 4AAPA 2V6CA 4MGRA 2X29A 1HRI2 5J98B 3VZKA 3N35A 2Y0OA 5F04A 1JT6A 3I3LA 2WZPP 4B4PA 3WTXC 4UY8I 4P1WA 2LKSA 2EALA 4AHYA 2R063 3OYJA 2MPFA 3TOAA 5A7WA 2M5WA 3LSPA 3HWJA 1OA3A 2VMFA 2JE9A 1PP8F 2VC0A 4LA3A 3VZLA 2HH9A 1X9TA 3O8HA 4P08A 1VBA3 2JE8A 5CG8A 3X29B 3IL2A 1NH3A 3HOSA 2L5QA 4P5OA 5KHDA 3WDYA 1UX7A 4XN0A 2NVTJ 4EE2A 3CC2I 2Z69A 4V1PA 2DA7A 2OTLI 2KZGA 2OKXA 3FC0A 1VLNA 1EY2A 2GNBA 5FPXA 3HOWJ 5J4VA 1K12A 4EM1A 5IT9K 2P5KA 3GXUA 3OEBA 4ASMB 1R49A 2JDYA 3BR3A 2P81A 4FQGA 4NC6A 2QQ9A 2UUZA 4FPHA 1U78A 4AIHA 3VZJA 2LP0A 4NQWA 3ES4A 4EN7B 3U2RA 4FT8A 3QCWA 1UCRA 2OQ6A 1IQAA 3HAGA 5F5IA 3OYKA 3R0AA 4PJMA 3IH4A 2CGPA 4FPLA 1K5MA 5FZ8A 3IAM2 4OIRF 2MBFA 1JI6A 2HOTA 1RMU2 2DW4A 3I59A 4OHYA 4LLNA 2VD7A 5F39A 5JUVA 3GEZA 2NS7A 5DS9A 1JH5A 1OR7C 3K51A 2XROA 4ZH4F 1O6UA 4IEOA 4B3AA 2CUEA 5H2FC 1FPN2 2HOEA 2EQRA 4YEJA 4ITCA 2I74A 5F08A 2ZMLA 2EAKA 5D5VB 2VL8A 3F21A 1G3TA 1D4M3 4IL6C 4E7ZA 1X58A 3DL3A 1X1PA 4XDOA 1UX6A 2C5DA 2F5DA 3Q8CA 1CAVB 2MH2A 4PFOA 1IZ1A 2OCCH 1UHSA 2HFHA 5DZFA 4DMIA 1I27A 2VMCA 1S3JA 1O3RA 1K5MC 4I3PA 3WHUA 2HLEA 2LREA 5FQ0A 5FKCA 3KPHA 2FBEA 4AEDA 1ZRIA 1X3WB 3MF9A 3K2AA 3MPPG 2QQOA 4XOTA 4GYIA 4UVCA 4GQ7A 4L8QA 5K0UC 1SZBA 4QMAA 2UY9A 2TUNA 4NRMA 1N1TA 2GZWA 2W24A 5IHRA 1RL3A 4TTGA 4CEYC 2HWC1 3FL7A 2QQVA 3CO2A 5TISC 4LHKA 3TNPB 5I8SA 1ZG3A 4YZ3A 5FK8A 1VI0A 2GNTA 3CLOA 5FXWA 3MN2A 2WL1A 3I54A 2JG8C 2DCJA 4HQEA 1W9WA 5A3NA 3WHBA 1OKQA 1AJKA 3RQIA 3GO5A 3G71I 3MKLA 4NQWB 4AIDA 4QXBA 2ZKZA 4CXYA 5K5RA 1R23A 3K75B 3MDPA 4GJZA 4XLAA 5CFDB 3BTAA 2WC2A 4Z8BA 2PXJA 2N8GA 5LASA 4UXAA 2E31A 3O6BB 2DTRA 5FKMA 1MQTB 3KV5A 4K1YA 4AM3A 1QKQA 4NBQA 3KB5A 5FWJA 3ITQA 2GMPA 3W58A 2GC0A 2W9XA 4UW4A 2WNVC 4GXOA 5JVVA 5FZOA 2RS32 3ZKYA 1KS4A 2XWJB 2H0BA 4O9GA 1W8TA 3WU2C 4PT6A 5FY7A 5IT9Z 3KS7A 2DA5A 2ZBKA 1NLSA 3OBAA 1D7PM 5E1XA 5H20A 1YRNB 1Y0UA 3GBWA 3H3ZA 2X09A 1EH6A 1Y8QB 4BOWA 4BE2A 3RSNA 1SBEA 3J8F2 2AH2A 4LBNA 4HOBA 1OH4A 4QWNA 3GHMA 1NX9A 2IZWA 3OUIA 3H1MA 1O3QA 1YJLA 1SCSA 4AEDB 3MI8A 3JD73 1W9FA 5IVYA 1GR3A 2YC2A 4IV1B 3VB2A 3HXLA 2HS5A 4XCAA 3HRUA 4GXLA 4Q4W2 1TNRA 2DO7A 4LLFA 3OS0A 3I55I 3Q0WA 3ZFGC 5FZKA 3E5QA 2C26A 2BY0A 1UL9A 5J40A 3BIWE 1MNDA 1NY71 3J7AY 2AQFA 4U88A 3JBG1 2XHNA 4AIJA 1ZRCA 3M7AA 2Y69H 4IHTA 1D1BA 2G9FA 3WF2A 1JTYA 3QU6A 1FPN1 4I02A 3FM3A 3BODA 4N43A 1V5EA 4RGGA 5HDGA 2B9SA 1NYWA 4GWNA 3KLOA 1XSDA 2H8RA 3RQ4A 4ZZDA 1G8WA 3IN9A 1U5TB 4YVWB 2RHPA 4XTPA 1AR82 1UF2C 2P6SA 2HWC3 2OF7A 2CG4A 1CZSA 1T39A 5A7QA 3HOXJ 3PIGA 1U9OA 5F7UA 2BY3A 5FY1A 3LPGA 3JREA 5K7PA 3VSLA 4IETA 2RNJA 1PO12 3IC7A 4RM3A 1F35A 5FO9B 2OUHA 2VZPA 3H3UA 5D1IA 2STWA 3U1KA 4TXWA 1EP0A 1NZCA 2P37A 2DBIA 4OZOA 1GV5A 3WUCA 1VBD2 2R061 1HA8A 3IB3A 4DB5A 4FAHA 2FD5A 4F3QA 4S2FA 1LOCA 3FWEA 4IOCF 1JTZX 3U1DA 3UJOA 3M7GA 3CCJI 3SH5A 5FZFA 5AIQA 3ZIXA 1JOBA 3PO3J 2F17A 4GCVA 1FOYA 4KMQA 5HNFA 2Y0MA 1K79A 2JVGA 3FXLA 1QH7A 1SG3A 3HYIA 2P6CA 4A3XA 2V4JC 1RUC2 4W97A 4MZUA 3EQEA 2FU4A 3CTAA 5JOXA 4HL0A 4DIQA 1Y1WJ 1LKXA 1TME2 3WDUA 2NVYJ 1WBLA 1CWPA 4I09A 1GZWA 2DPUA 3K1MA 1S4CA 2QYOA 5LGNA 3FHAA 1MMGA 1OH3A 2PAEA 2JG8A 1J1LA 4BL0B 4H7LA 2JMWA 4OIOF 1SFOJ 2ET1A 2DLLA 4MFDA 4FXKB 5E3OA 4RGSA 2H1LA 4UUSA 4BJ6C 1FMD3 3FXMA 3QOEA 3DKWA 3I2IA 1WI3A 4XQDA 1WHUA 4Y1VA 3BROA 3AVSA 4YM1A 2LF8A 3ZMOA 3AZWA 4NC7A 4RR3C 1BIAA 3J8F3 2IXCA 3K4MA 1JBCA 1X82A 2YY1A 1VBB1 3CDHA 1PVC1 4JCKA 1BW5A 1TP4A 3AKTA 5JPNB 3GHNA 5BNGA 4P9FA 2VR4A 3K2ZA 2Y0IA 1ERDA 1ZZ9A 5C3SA 1TNFA 2AR6A 4JQTA 1D0HA 2WAAA 2ZCWA 1YCIA 2ZGTA 3T2PA 4X6QB 1JHJA 3AL5A 3FZ3A 1PJRA 5BYNA 4YZ2A 4A3LJ 4EJVA 5FY9A 1ETKA 3H42B 2W3JA 3AP9A 4PGGA 2ESNA 2YV8A 2X05A 3M07A 4XK4A 4HMZA 1Q3EA 3OY9A 1GV2A 3OBTA 4NHLA 2D93A 4PBOA 2EFWA 1LHNA 1S2EA 2YXSA 4GH4C 4NR1A 4BAYA 1YS7A 1YHQI 1NQJA 1YEWA 3RRDA 1QO0D 2B39A 2WNEA 2W85A 5ANQA 2XBO1 2HPIA 3KSCA 3G1LA 1ZX5A 3WP6A 4C9YA 4KDPA 4N0BA 2TRTA 3VBHB 3C3WA 3VBFA 3H1YA 5FZOB 3UK9A 2VKVA 5BNPB 1C5HA 5A3UA 2CU5A 2QKLB 5E8GA 3ASNH 1U5ZA 2R7VA 2VJJA 2QNKA 3JRBA 3FBYA 4MGZE 4NOTA 1BK0A 5FDBA 1I9RA 2CH0A 4P02B 1XC5A 1GP6A 4Y5TA 2R062 2R043 1OI6A 3KT1A 1KQ0A 5DAWA 4BEHA 5DN2A 2VE8A 2V5DA 5HI0A 2JWPA 4L5EA 3ROUA 1HDPA 4XW3A 4QB6A 4XFHA 2FOWA 4YW1A 1UZCA 2IVMA 2QDRA 4JDOA 5BOXA 2DMTA 1Z7S1 5F5AA 3ZMZA 2DVGA 3ZQLA 4XRSA 2YG0A 1JYVA 1N47A 2PA7A 1A6CA 4R4ZA 1EPWA 1XGSA 4CCEA 5IAVA 4I30A 1J0RA 4KA4A 3Q9OA 5FFXA 5J1RA 3J7AO 2BWAA 3IWZA 1R00A 2VBDA 1TQMA 3JQXA 1PYVA 3SZTA 4HXCA 4HPQA 1SMTA 2VVDA 2P7VB 2KL4A 5EJ3A 2HYGD 4A0YA 4AQ2A 4RL7A 3VGIA 2V9VA 2LF7A 1ZRDA 1YTYA 3PUSA 4KI5M 1HF0A 4RS5C 5H6RA 3MUZ1 1TW3A 2OTJI 2HKXA 5BY5A 2UYAA 2GM4A 2FDIA 4EJOA 1VNDA 3CMYA 2IWGB 3OGJA 4FFFA 4BHBA 1LFUP 4I01A 4LPLA 5L9RA 1MS5A 2NNNA 4XORA 4FPEA 3BTJA 4JDMA 2NM1A 1BQPA 2CYFA 4R8HA 3A02A 2QZ2A 4FPJA 1F4AA 1XNBA 2D97A 3N9QA 4B1RA 4H2AA 3CJIB 4HSTA 4URTA 4D6QA 3DPLC 2PMZN 1PDNC 4C1XA 5KR7A 3MBWA 2WZR3 4IEPA 3PSFA 5EJ1B 1QRYA 2E71A 1WW4A 5I0DA 3D3AA 3QPHA 1WCQA 3HJRA 5TGTA 1YE9A 5IJRA 5FCCA 4XUTA 4Q4X1 1XE0A 4HEA2 2KHMA 4JQFA 1TBXA 3CUQA 2F4LA 4ZC3A 3JW4A 5AFEA 3O5SA 2QVSB 4LKFA 2BV6A 2HYJA 1AA7A 1S9HA 1TMF3 3OGRA 2XGXA 1MH3A 4HX7A 1JHHA 1UIJA 1WI9A 3RZGA 4GRIA 2STTA 4XR6A 5AONA 3TKYA 3DBLB 5GP9A 2R7RA 1IW7F 1RXFA 5DV5A 4D7TA 2QSHX 1OLME 5CAZA 1FYMA 3ZXKA 4PLOA 1G3WA 1ULOA 5JMCA 3K6GA 2KMUA 3WG4A 3NKGA 3S3NA 3BR2A 1AYN2 2XF7A 5IY5H 1NLQA 3FIWA 2MEV1 1RPWA 1Q43A 3WNNA 1VBE3 2CDOA 3ZFEB 4JP0A 1HX6A 2QTWB 1LOAA 3BZ6A 1UYYA 1WLWA 3C7EA 2E1OA 2L9NA 4MGYE 1K78B 2BFUS 1GZWB 1KQ9A 4CXFA 4WM7C 4D0QA 3ZYRA 2LUWA 3HKZN 4OMDA 1ZRRA 1FT9A 1ND3C 3IDCB 3THCA 1VE0A 4B7KA 2MG4A 4LHLA 2FQPA 3CJTB 1XB4A 1FYLA 5JSOA 4BLJA 5GZEA 5HCBA 4UVAA 1CAUB 3CJNA 1V70A 4DEQA 4IGOA 1NZIA 1QNTA 2XIGA 3A03A 3TEXA 2CQKA 3FX3A 5LRRA 4OHXA 5F3GA 2RC4A 3FXJA 2ARBA 2COBA 3WHTA 1VBC1 2OZ6A 2R073 1N25A 3BG3A 2HWE1 3CJRB 3S2DJ 1C3HA 4Q8KA 4QKBA 4P9IA 5FREA 3WV6A 3VUOA 5IVEA 1VBB3 3TP0A 3CZ6A 1TNSA 3SZGA 1LU1A 4GULA 4B1MA 3WEZA 4CCKA 3AP7A 3CLQA 1YOVB 2G9ZA 1FOXA 1DP0A 5T3NA 3H8XA 1UKRA 2P0WA 4H4KC 3PIJA 1BBT2 1AX0A 1YW7A 1W6PB 3NV1A 4L9JA 2KLOA 1W7PB 4XSXF 2IGMA 3CCQI 1CX4A 2Z1DA 3BIEA 3N7MA 2BFUL 1R36A 5LK7B 1B1BA 1IOAA 2XONA 4UFIA 3KP3A 2K9NA 1RVF1 2VO5A 1C1FA 4PUSA 5KWRA 1QBJA 5T55A 4Y5Z0 3M3OA 2K9QA 1ZBE2 2R7OA 2K27A 4BDYA 5J09A 3BPXA 5LY1A 1SFPA 2DA4A 2ZC2A 5JI6A 5FY8A 3BUCA 3N05A 4XKBA 2R92J 1YI2I 5D8AC 3AG2H 2CW7A 3PJYA 2F48A 4QPIA 4XFBA 1D1AA 4ZTFA 1YQ2A 3C8XA 1TZOA 1W06A 3MEXA 3WG7H 4BH9A 1HOMA 2A6ZA 3OYCA 2VNOA 2XJSA 2DV9A 2ZACA 4NB5A 2FMDA 3WP4A 2K5CA 3FDYA 5F0HA 3HUGB 3RMYA 3TN92 1QXRA 1EYBA 1W2AX 4D7YA 4ORFA 4W6YA 2CJJA 3MLLA 2XV4S 3CUQB 3QOPA 4YW2A 4ZXEA 4YW6A 5FD6A 2FF4A 3S15J 2ADDA 2HWB3 1JYWA 2WV1A 3EO6A 4MHGA 2CV1A 4QT6A 4E7SA 4PSXA 2FHRA 4IEXA 3E6DA 1PUEE 1AR93 5H6QA 4IW3A 4BHPA 2X1EA 3UKNA 3LA3A 1GNHA 3NNLA 2AEYA 5L19A 4FPGA 3H3LA 1Q8QA 1UNBA 1S29A 3HEFA 3GNEA 3L00A 3MVPA 2MEV2 4LK6A 5FXVA 1COV2 1B72A 2VBPA 5DCMA 4PFPA 2YZ4A 1DQ2A 1LOEA 5DAPA 3LSIA 3MCZA 1EV13 1RJ7A 3WDVA 3GF2A 5LA2A 4GD4A 2P1BA 4WV8A 3AKQA 4LO8A 2BY2A 3TRSB 3CCUI 5CLSA 1S0DA 2A6WA 3C2UA 2J1UA 1KJRA 2VKHA 4LB5A 5FUIA 2IVJA 2OW4A 4Q0UA 2IXHA 2VONA 3WTSC 2WFF1 1W6MB 2R49A 2P3YA 4YRDA 1YFWA 4G7OF 1T95A 3K4JA 4U7DA 1UMQA 4EZHA 3R60A 3E6BA 4UFJA 1VF9A 2JPCA 1ZTRA 4OHWA 3DTEA 1BN5A 2ZEXA 1QQP3 2FEZA 2MD5A 5IOZA 2M8GX 3AB0A 4PDWB 2ZB9A 4QX2A 1ZGAA 2OJED 1CPMA 2XGDA 4UF0B 1ZHFA 3ZPOA 1HC8A 4BQYA 2JX9A 1UJ8A 2P4WA 4KGGA 2B46X 3G73A 4UUVA 3W6VA 4YGDA 3R05A 2BGPA 4GJYA 1RUF1 4IE0A 4OINF 2Y0SA 3MGUA 4EWDA 3AMQA 4H14A 2IGNA 4IHXA 2RKHA 5DDJ2 5GAGJ 3PNVA 4M71A 1BBT1 5FOJB 2FDHA 2Q2EA 3FLPA 1AXZA 1OA2A 3HSFA 3OYGA 4DFSA 2X9DA 3QP6A 4BWOA 4C3IJ 2MGQA 1HN1A 4XAAA 5M0TA 2QCOA 4A45A 2B7EA 2YC4A 3NSTA 2G7HA 2ZX1A 4DYCA 2VTXJ 2QBYA 1T0FA 3EB7A 1RIRA 1B59A 2M0CA 3B69A 3OEAA 1UXZA 2PYTA 1CQ9A 1W9TA 2XRLA 4U7BA 1FOD3 2VZOA 3ZR6A 4JGZC 4EGZA 1A35A 2ZSHB 1E5RA 4PLNA 3CL1A 4OWRB 1R9TJ 5CKMA 2B4KA 1QVUA 2K2SA 5T5PA 1E5SA 1QJU2 4UBGA 3HPGA 1ETYA 3K1NA 4HPKB 4XILA 1W6NB 3A0HC 2X4HA 1OSGA 3DKXA 5F64A 4A2UA 1UMHA 3L09A 4A3GJ 4CYDA 3EUHC 3B5LB 5DCFA 3CUQC 1F2NA 5CVVA 2E51A 2IAIA 1E17A 1SFKA 5I0SA 1GU3A 2VY0A 5A1LA 5C3OA 1TME3