4I09A

Structure of the mutant catabolite gene activator protein v132l
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
204
structure length
204
Chain Sequence
PQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKLGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 58
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i09A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i09A01
5IT9K 5DV5A 1S7OA 4IRGA 4IPAA 1S29A 2FSWA 4XF0A 5LHIA 1WWXA 1QWRA 2CV6A 1UB9A 3WGGA 2XAQA 4KMUX 2PI0A 4QM9A 5HS7A 2PA7A 5ILSA 1YW8A 2JT1A 2XKPA 4MTEA 4HVOA 1HSJA 2PN6A 1L3LA 4H7LA 4MHGA 1OI6A 5FB2A 3JSOA 1QBJA 1K78B 4EGYA 2L4MA 3QPTA 4OFGA 1O3TA 2HYFA 3WTTC 1SMTA 5L3CA 3QPHA 3IHUA 3ZMZA 1QPMA 4CHUA 4HMZA 2HKXA 2QWWA 4NQWA 3R6SA 4ENNA 1UPIA 2Z33A 1FSHA 1IPKA 2ETEA 2E7WA 2WC2A 4U7DA 5T3NA 1IAWA 1R58A 2ZNZA 2PEXA 3OOPA 4Q0QA 2QQ9A 4AIJA 1GQHA 1ZRRA 3U0ZA 2XIGA 1W4MA 2DU9A 5EFUA 1OR7A 1H0MA 2D93A 4LUKA 2PMHA 4KIFA 3E6CC 2F5CA 1BM9A 1BI0A 2H0VA 3TO6A 1G4DA 3CO2A 2EA2A 5K1YA 3JTGA 1B4AA 5F6FA 3RYKA 4BQAA 3P9CA 2VPVA 3ZMUA 4HSJA 5DUKA 3ELKA 2AS5F 4X6QB 2QYOA 2IXCA 4KICA 4R1HA 4HLYA 3KLNA 1YIOA 5IT9Z 3C3WA 5A2QZ 2ZFWA 3PQJA 5BPDA 1X7NA 1R1VA 5EZWA 3EO6A 1NE4A 2JZYA 1YLFA 1DP7P 1XCBA 3F8CA 1XN7A 4GCVA 1ZZ7A 2F5DA 2DPUA 4GYGA 3EYIA 1ZX5A 1ZG3A 1ZZ6A 3ECHA 1ZRDA 2DI3A 2HTJA 2H27A 1SFNA 1OKRA 4CDGA 1WSUA 4XLNF 4ORFA 1I6XA 1HKTA 4MEXF 5FFXA 1H9GA 4M72A 3OTFA 2IXJA 2FF4A 1XDSA 1F9NA 4KIGA 1LDDA 3SCGA 1MJAA 2AXLA 3RPQA 5LHHA 4LB5A 4AVPA 4AWXB 2QVSB 1ON1A 2VQAA 4A0XA 1KQ0A 4RGXA 3R0AA 4HVRA 3ERED 5FPZA 2VE8A 2DW4A 4IF4A 3WU1B 4DNCA 1MGTA 1LDKB 2HYGD 3SXWA 1LJ9A 2DAOA 3TOBA 4L0YB 4FAHA 3CUQB 4IHTA 2XLGA 1FSEA 3IC7A 3KE2A 1KGSA 4RGRA 2RDPA 2EA4A 2C6YA 2H6BA 2DO7A 3WTWC 1XDUA 4OIQF 2XAJA 2FNPA 5LGNA 5CADA 2ZCWA 2PTMA 3JW4A 3RJPA 2M30A 2Q8KA 3JZVA 1RC6A 1R1UA 1IW7F 4XBFA 2RGVA 3L00A 2I45A 3Q9VA 2PQQA 4QGLA 4LD5A 2R3SA 3WW2A 2KRFA 1WQ2A 3WTYC 5LHGA 2VBXA 5FLHA 4L9NA 4WXHA 2A61A 3VEPA 3SCFA 3R4KA 3Q9SA 4EM1A 3F22A 1W7PD 1TTYA 3ZMDA 5L3FA 5DCFA 3L09A 4KNYA 2MPFA 4MZUA 3T5XA 1MZBA 4EV0A 1YS6A 2O03A 2GQQA 1T38A 4EVIA 4O5VA 3MDPA 4XFHA 2VC1A 3GZ5A 3NJZA 4LGWA 3KMHA 5HVQC 3KP5A 4L9JA 5L3EA 2IA0A 4AVAA 4ONUA 2Y48A 4WF2A 4HF1A 2B8MA 2Z69A 2X4HA 2QCSB 3G7DA 2RVCA 2VXZA 4FHTA 2B5HA 5I8YA 1FY7A 4HBNA 2Z9OA 1UIJA 3EJKA 3RPUA 3K2ZA 3NQOA 1YO5C 2ELHA 2W57A 5DDGA 2J5OA 3FMSA 1YWKA 3I59B 4CXFA 3KLOA 2HKOA 2ESHA 1QNTA 5BPIA 3FXUA 2A07F 1QZYA 4YG2F 1WI9A 5JR3A 1NXMA 4R8HA 5KBFA 2YX4A 3B02A 4M9ZA 2LF8A 5BXXA 3GYDA 3M3IA 4HW0A 1G3SA 2HGCA 3OCPA 1FPQA 1PMIA 1ZYRF 2CQKA 3SCHA 4KIBA 4ZYDA 5D6EA 2EFNA 3EDPA 1SD4A 1Z7UA 3GFLA 4ENKA 2XAHA 3EUHA 1SEFA 5KHJA 3T8RA 2KXLA 2DBBA 1BJAA 5EEGA 4XF3A 2M5WA 1WKMA 2A6EF 3MZHA 3DFGA 2K27A 3ELNA 1LR5A 4A6DA 3WGHA 4EGZA 1IF1A 2UY9A 1UHMA 4EJTA 1NHAA 2L4AA 3HHGA 2EAAA 1Z05A 3QP5A 1E17A 2Y0OA 4RB1A 1KU7A 3LWFA 1A04A 1B9MA 4YFNF 1DUXC 5E8GA 2DLLA 1I1GA 2GXGA 5FLJA 4QM8A 2VBYA 2P6SA 3HT2A 4ZYEA 5J7MA 4BXUA 3P9IA 1U3EM 1U78A 3MPBA 2HTSA 4U88A 4YARA 4M73A 4WX9A 1U12A 3EQLF 1TQ5A 3BROA 4WBBA 5I0UA 2F2EA 3GFMA 1IXCA 3RKXA 3V7SA 4U0YA 4KDPA 2XUBA 2IW5A 3NRVA 4IEQA 4UBHA 1YW9A 4GO1A 5D8LB 1J7KA 3GVAA 3HUGA 2ZMEA 2VECA 4G6DA 2IC1A 4Y15A 1RGSA 1UCXA 3NW4A 3EETA 3G3ZA 4QWQA 4A5NA 3M9AA 3IKTA 2EVXA 4PGGA 4EWAA 2Q0AA 2GA2A 4L5JA 2YR2A 2L01A 2L54A 2IJLA 4LFUA 2BNNA 1X3UA 1O7FA 3NSTA 1LEAA 4UNOA 1DZRA 2PFWA 5CVVA 3K1NA 2JSCA 4XLPF 3CJNA 3KP7A 1IN8A 1DGRA 1XE7A 1TQMA 4QLCU 2K86A 2GWRA 4XF4A 3H3ZA 1CAUA 3JAMZ 3QRFF 2FRHA 1YFWA 2FMYA 4HDVA 3O6BB 1QZZA 2V79A 5I0TA 3UKVA 1VP6A 1ZARA 2UZKA 4RGUA 3H7JA 1J5YA 3DEUA 1ZRFA 2D2WA 4A6EA 1IN5A 1BIAA 3SQNA 3CLPA 1TW2A 5I0RA 1UFMA 4MH0E 3ROUA 4KA4A 1KQ8A 2VOPA 4IEOA 4I98B 2D1VA 3BDDA 3P7NA 2O61A 1GXPA 3C3VA 2PAKA 5JCTA 4ZU5A 3TNQA 1T98A 4M6XA 1AWCA 3LZZA 2XLAA 4AIHA 1GQGA 5FDBA 4ESBA 5DCMB 2P7CB 4IESA 2ESNA 1AOYA 1XGSA 2OPKA 3MAJA 1HKSA 4E2SA 1FWZA 5D5VB 4EWDA 3KEOA 3VFZA 5KHGA 4D0PA 1F1ZA 1O57A 3MFKA 1ZLJA 2L02A 1GVJA 1PDNC 1U5TC 3QU3A 3M70A 1YUDA 4G7OF 5EEHA 4JTOA 1T39A 4KL1A 1WRJA 5FO5A 2EFWA 3BALA 1F5TA 4XSXF 2FEZA 1U5TB 1Z91A 2W84A 3GX4X 5JHUA 1ODDA 3HOTA 2RV8A 2BNOA 5LLQA 4WK8F 3KEQA 1XGOA 3HRMA 4MQVA 4RB3C 4Z07A 5LEJA 3E5QA 2Z99A 4A2UA 1R22A 2ZBKA 4CO8A 1BBYA 2DQRA 3WTSC 1DDNA 1SD6A 2FBHA 4DINB 4AQ2A 3HRUA 3ECOA 4IERA 3IBMA 3RKWA 3HYIA 4BHCA 5AIPA 2MC3A 4OIRF 4UVBA 3U2RA 3W6KB 4LTAA 1BC7C 1UD1A 2XL9A 3I59A 3D0JA 3LWCA 1X8EA 1TBXA 3ZMVA 2Q4SA 3S7IA 1W7PB 2RN7A 2Y0MA 2EFOA 2X0LA 3E6DA 3G73A 1ZZ8A 4M71A 3GXOA 3QP6A 1O3RA 2PAEA 4RAZA 2N7GA 5FD6A 2OQGA 3F23A 4AVCA 5H6RA 3LFKA 5ICCA 2EK5A 3QAHA 4Q0UA 2QBYA 1C0WA 1YW7A 1MDMB 2Q30A 2IT0A 2STTA 5ED4A 4HQMA 3RI4A 1J9IA 3GBFA 5CLSA 4OOIA 4GXOA 4META 3L2HA 3F72A 3WW3A 2M8EA 2EV6A 4PJYA 1U8RA 3RNSA 3E6MA 1IZ1A 3HSFA 4MV2A 5CVUA 4JV4A 4R52A 2NNNA 3RKYA 2CYYA 2HS5A 1XGMA 3K1MA 2QJVA 5E16A 3L7WA 2PQ8A 2RNJA 1RZ4A 2A5YB 1H1MA 3GWZA 3KGLA 2XASA 3BP8A 4A12A 2VBWA 4N0BA 4EJVA 3AAFA 2PMUA 1FBQA 1DZTA 4KWKA 2MLGA 4NB5A 1YHFA 5L3DA 5KK1A 1MKMA 4HYEA 1Q5OA 4PCQA 5JSPA 1MDMA 5E1ZB 1USTA 3E97A 3T0YA 4YRDA 3I54A 4E70A 4KN4X 5D4SA 3PVBB 3JTHA 3T8TA 1EH6A 3R0JA 3NKTA 4EQQA 3JSPA 2DFIA 1EY2A 4KN7X 5BMZA 2V6CA 1GXQA 1CAVB 3SXYA 5HLIA 4AQ6A 2UYBA 3VOEA 2YU3A 1XCVA 4JVAA 2EWNA 1XB4A 1Y9QA 2EFQA 2P5KA 4YFKF 1DGWA 2ZKLA 2IA1A 4XFGA 1XGNA 4YIIA 1P4WA 4M6YA 4O3MA 2EV5A 3HHHA 2Q0OA 2BEOA 2QENA 3SFZA 3LOIA 4Q4ZF 1JHHA 1IN6A 1IUYA 3CDHA 2OAZA 2FNAA 2OU2A 4IEYA 1DPRA 1CX4A 3WE2A 2GC0A 3RYPA 3KSCA 1SFXA 4UXNA 3WU0A 4L9TA 2KIMA 3MZYA 3WW4A 1SFUA 4MGKE 2IRFG 2V1XA 4IHSA 1ZG1A 4EWEA 1D5VA 1KU3A 2OA4A 2DT5A 2Y75A 3WG9A 1O5UA 5JSRA 3PNAA 3F8BA 4AD9A 2UWMA 4WXCA 1ZZBA 1SAXA 4K2EA 5H6QA 2OA2A 2K4BA 3I0TA 1TNSA 4FX4A 1RUNA 2K7LA 2QQBA 5D6FA 3V8KA 3C1DA 5DUIA 1FI2A 1Q3EA 1S6LA 3FJSA 1YFYA 5D8KB 5DCMA 1UHWA 3H7YA 2FBIA 3J7AO 1J3PA 2ZNYA 3CUOA 3DV8A 4IEUA 4L5IA 1J75A 5CYVA 2IXLA 4L18B 3H9AA 2KKOA 2D1HA 2F5FA 2GIVA 3HOSA 4IJAA 1FZPB 1OD5A 1S7AA 1NYWA 5I91A 3S2WA 5JSOA 4IRIA 2R7DA 3ZPLA 4M9XA 1P4XA 4JTNA 3D82A 2ATFA 4UXAA 1J59A 4S04A 2HFHA 5JR7B 1CF7A 2HR3A 4DQ2A 2DQLA 1CAWA 1P4AA 3ES4A 3DP7A 2IPQX 3V4GA 2CO5A 3I4PA 3OD0A 4UV9A 1JE8A 2KIFA 2O6GE 3KP3A 3LA3A 3F3XA 2XHKA 3KZYA 4OMYA 3FM5A 3F8NA 1USSA 2CSOA 4Q29A 3F6OA 2OZ6A 1KA8A 4RB2C 1FP1D 2VBZA 4OLLA 1QY4A 1BI1A 1ZREA 3TDZC 4Q0VA 4QMAA 4KU8A 3DPLC 2CFXA 3HRTA 2RC4A 3R60A 4OINF 4KMFA 3UKTA 2Q1ZB 1B59A 1CAXA 4XFFA 4LLGF 3PFIA 1K79A 2STWA 4PGHA 2OZJA 1EV7A 1FYKA 1FT9A 1HW2A 4RB0A 3IWFA 1ZVFA 4OIPF 3TGNA 3FXQA 3D0SA 1B9NA 2J5PA 2LDUA 3MYXA 1CF7B 1R00A 3LQRA 1TQIA 3DPTA 2HQNA 2CG4A 3ST7A 1QGPA 1WLTA 2P8TA 4B29A 3H3UA 4P9GA 2G7UA 3WTZA 4FX0A 3HIFA 4E2QA 4Z2YA 2M45A 5FLXZ 3M8EA 2GXBA 2IXKA 4XETA 4IEWA 1FBSA 1XSXA 3UKNA 3RYRA 4HN1A 1MD0A 3L9FA 1RIOH 2IVMA 5KHHA 2A69F 3WTUC 4S05A 1FYLA 5J8FA 1U2WA 3HRSA 4RS8A 1PUEE 2WV0A 4LEJA 4MGRA 2NRAC 1IN4A 3TO7A 1O4TA 4EM2A 3BJAA 4HF2A 5TRDA 2EB7A 2E1CA 5C8WA 3LSTA 4XSZF 1VJ2A 1IRFA 1R5HA 3DQVC 3I64A 1DPUA 2XGXA 3VB2A 2YX7A 4EJUA 1JGSA 4G8XA 5E1XA 4U7BA 2IP2A 3FMQA 5KHIA 3GLXA 1IN7A 2ADUA 2LNBA 3O14A 1FC3A 2CW0F 4WWCA 1EH7A 4GYIA 2ZKZA 3WTXC 1Z9CA 4LULA 1KU9A 4HX7A 4B09A 3N97A 3KCCA 3ABTA 5LGUA 4G7HF 3SHRA 4A0ZA 4CICA 4MGYE 4D7TA 4HZFA 3QOPA 2QQAA 5I0SA 4ZZLA 1RNLA 1OMIA 2BGCA 1RTVA 4KWJA 3COAC 4PDKA 5BV6A 3DKWA 4LA2A 5E17F 2FU4A 2OBPA 2UYAA 3HTUA 4R79A 2D5HA 1EP0A 1ZGAA 5KVRA 4J1WA 1YQAA 4IEXA 4PIXA 5E1WA 1O7LA 4KYWA 3MEXA 3GFJA 2YPRA 3CO6C 3K69A 4XRFA 1TNTA 1IXSB 2JRTA 4LMYA 2H6CA 1SQ4A 1ON2A 3P9KA 2PFBA 3SZPA 3PLQA 1B6AA 4CZZA 3GUDA 2OQRA 3HSEA 4BNCA 3LQQA 3BJ6A 2D40A 3WGIA 1J0RA 5TJJA 1NE6A 3BU7A 1OFNA 2UXXA 4TV7A 1YYVA 2VONA 5HDNA 4BYYA 1O3SA 2OYZA 2TDXA 4U0WA 1KQ9A 4LK1F 3GZ6A 2Z2SB 1HQCA 4XFCA 1G3YA 1RUOA 2XAFA 3E6BA 3QU6A 2P4WA 1JXSA 1ZHFA 4HOBA 4Y13A 3HQXA 2W24A 3LA2A 2GAUA 2IA2A 5C6CA 2JTVA 3TOAA 2PJPA 2LSOA 3KP2A 4I7HA 3H1YA 1S3JA 2E1NA 2O0YA 2ACJA 2QUFA 5JFRA 1KU2A 1UCRA 2FE3A 2PLYA 4ASNA 4LA3A 3SHFA 4Q48A 3MCZA 1O3QA 5CVIA 1VR3A 2ZJ2A 3ISPA 4E2GA 3BPVA 5F64A 3FHZA 1OPCA 4U0VA 1JUHA 3H1MA 5D4RA 3K0LA 2HOEA 3F6VA 3CUQA 4PIYA 1BN5A 2F5EA 3CO7C 2MNGA 1QO0D 2MHFA 2FXAA 3K1PA 5L3BA 5D1IA 2VN2A 1K6OA 4WZCA 5CJ9A 3BWGA 1D3YA 4IRHA 2P5LC 5IT3A 3QACA 1L0OC 3GF2A 1YFUA 4XFAA 4UV8A 4HQEA 4UBGA 3RIRA 3J80Z 4MNUA 5E18F 3EQEA 3TDUC 4ETSA 3ULQB 2P5VA 3MWMA 4HV6A 1CAVA 2ZMEB 1G3TA 1Y0UA 2QVOA 1ZLKA 3GO5A 4IEVA 4HF0A 3RDIA 1KYWA 4BH9A 3VODA 4P9UA 1ZZ9A 2GU9A 2K9ZA 3IKVA 4BHBA 3BPXA 3KZZA 4JK1X 4Q47A 3RZZA 3L2CA 3BCWA 3HT1A 2RQPA 2UY8A 4FAGA 2XRNA 5FCCA 2FBKA 2Z5UA 1Z6TA 1UW8A 2QZ8A 1P92A 2O8XA 2GC1A 3TQNA 5FLXK 3V7RA 4YSFA 3B73A 1W5TA 2KJCA 5AVPA 2M87A 3GFIA 5ERIA 2V9VA 2NNYA 3EBRA 3USSA 4LLNA 3DXJF 2XL7A 4Q0PA 1XRUA 4XEZA 2RKHA 2FQPA 1Y3TA 1HW5A 1QXJA 1HSTA 4AXOA 4MGZE 2VC0A 1V4RA 2P6TA 4G6QA 1J58A 5F1RA 1FNNA 5AIQA 1R36A 2JPCA 4L2NA 4PZJA 1NZCA 4I02A 2ET1A 4Q5SF 5D5WB 1HKQA 1T6SA 2IXHA 4ZZDA 1Q1HA 1OYYA 2FA5A 2PHLA 4ENJA 2PYTA 1BI3A 3FWEA 1ZH5A 3SMHA 1I1SA 5K5RA 4X6RB 1PP7U 2B0LA 1I27A 5HS8A 1W5SA 2P7VB 1V3FA 2Z3YA 1QXRA 3DL3A 2NYXA 1U6GA 5J3UA 1H1IA 3EHKA 1REPC 1K78A 1R5GA 2QLZA 2DTRA 3DF8A 4ZYHA 4RAYA 3BJOA 2A68F 2GA1A 4FT8A 4G9YA 1CAXB 3M8FA 2MA3A 2K02A 3ZQ7A 1D8KA 2DK5A 4A0YA 2VE9A 3TO9A 3D5LA 3F8FA 2P17A 3GEZA 2BV6A 5JAXA 1EYBA 1YLLA 2MD5A 4OMZA 1LB2A 4LUMA 4ZYGA 3IIAA 3O2PE 4O6JA 4P9FA 3OF1A 2VT3A 1IXRC 1XMKA 4LJZF 4IXAA 3U10A 2Q2EA 4K8FA 5ILVA 3ZN0A 2ISZA 4RD7A 5JI6A 3BY6A 5FD5A 4HLTA 2A3SA 2PHDA 3NVCA 1U5TA 4KU7A 3IWZA 3BOQA 2O1QA 5HS9A 1FLIA 1IRGA 4D7SA 1ZAOA 5K8SA 1ZNPA 3J80K 2ETHA 3SZTA 1B1BA 5LGTA 4KUMA 5FQ0A 3H1WA 4EROA 3C7JA 2WWYA 1XD7A 5HDKA 1TW3A 1L3JA 5FPXA 2A6HF 1R7JA 2MBFA 3CJXA 5DEQA 4LK0F 2W85A 3I5UA 3K9TA 4XF1A 2C0ZA 2GH2A 1J2XA 4P5OA 5FFZA 1BOAA 5DD8A 3BB6A 1FP2A 5CVJA 1X82A 3NL1A 2EV0A 3ZDSA 3S0MA 2O8QA 2FOKA 4AVBA 1BC8C 1G3WA 4UHTA 4ZU4A 1QQIA 4MTDA 2NAZA 4I0BA 4BHPA 1ZGJA 5E1RA 5K5OA 2G9WA 4I3PA 4LLOA 3V7CA 4BAYA 3FXRA 4RGSA 2BNMA 1XE8A 3M1EA 3FHIB 4G7ZF 2EFPA 1ZN2A 2E9QA 2CWEA 5BPXA 5E20A 5JVTA 4I0AA 2G7HA 3WE3A 3WW1A 1P6RA 2DK8A 1O5LA 3WTVC 4HLXA 5ILUA 4KFCA 4EM0B 3WODF 2VODA 3KETA 5J48A 3W6JB 1YFHA 4NHJA 2KJBA 4HX8A 4KWLA 2XVCA 3U1DA 5K5QA 1EPZA 4OU0A 2ZXJA 3O3KA 4ESFA 3FM3A 4ON0A 2V09A 4YNIA 1LRHA 2WFPA 4GULA 4I2OA 5DD4A 4MGIE 1F4KA 3LAPA 3E5XA 1MJBA 1VTNC 3E5UA 1HW1A 4EJOA 5BY5A 3PQKA 4FBFA 2XV4S 5BOXA 1K7AA 3BZ6A 1R1TA 2V1DA 2K0GA 4I09A 2GZWA 1ZZCA 4IEPA 4HA8A 4KT5C 5LRSA 3IRQA 5BUVA 3IDCB 5LBQA 5E8IA 2O3FA 2QBYB 4G94A 4I01A 1R23A 3GYHX 4HX4A 3FFQA 1OYIA 3E3VA 2M1BA 2BBYA 4H0EA 5HDGA 2W25A 4O9GA 2D45A 2OD5A 3Q5FA 2UXNA 4LG0A 4CGZA 1ONVA 2HQRA 2HZTA 6PAXA 1RL3A 3OGJA 1CGPA 2VT2A 3FX3A 2R7FA 3CUQC 4XF9A 1ZRCA 5BS6A 4QXKA 1FXZA 3V8LA 1IPJA 3HSRA 3EYYA 4J1XA 4LLLA 3I53A 2HDCA 4ZU7A 2MH2A 3GW2A 1D8JA 5J8CA 4WCGA 2QNKA 3CL1A 4HAMA 3N4MA 5HLHA 2QDRA 2CGPA 4A5MA 2OZUA 3C18A 2KIUA 2VOOA 1MJ9A 4CYDA 3ACLA 2FQ3A 3U11A 4EJWA 4IETA 4EMSA 1G6NA 3S7EA 2B9UA 2EJRA 4TLFA 3CTAA 5I8TA 2YSRA 2CAUA 4HN0A 1V70A 2XAGA 2NS0A 3T1BA 1OYWA 4L9VA 4Y17A 1CAWB 3IRRA 1FOKA 1JHFA 2FMLA 3CEWA 3ETQA 4OIOF 1I5ZA 1LKNA 3H50A 2DCTA 4YYOA 4UUVA 1Z1DA 2GC3A 1HXDA 4JQFA 1ZG5A 1UIKA 4LB6B 4QX5A 4XFBA 3REOA 4P96A 1Q43A 4Z82A 3KGZA 1TLHB 4HVQA 1SD5A 1FX7A 5FQ0B 4ZH4F 1LVAA 1LDJA 2BYVE 2QM3A 4O9EA 5BQTA 4M9SA 2LKPA 4HDUA 4L0ZB 2V1UA 2K4JA 5D5UB 3KFWX 4HSLA 3ZMSA 5ICEA 4QGNA 2HEOA 1E2XA 3LA7A 4IEZA 3RTRA 3ML6A 5AONA 1BI2A 3IL2A 1BIBA 4XFIA 5KHKA 4ENMA 3VHRA 1FBUA 1SD7A 4JBAA 3DN7A 1XMAA 3TKYA 2LF7A 2DPDA 2HWVA 1S8NA 5LEKA 4HBLA 1WA4A 3LAGA 4QGMA 3H92A 4MUVA 3BPZA 4PIZA 3J81Z 5ICFA 1ULYA 3JAMK 3FF5A 1J3RA 1XSDA 2JPBA 3U9GA 3ABUA 4IVNA 1J3QA 3I58A 2MH9A 2ZO4A 3FZ3A 4F7ZA 4AIKA 1J1LA 1FYMA 4UVCA 4N9HA 1P2FA 1YS7A 2MLKA 3MQ0A 1HBXG 3FE5A 2ISYA 1WGPA 4BIFA 3ZN1A 2EA7A 5CVRA 4ESJA 5FGMA 3V8JA 5A2QK 3LAJA 2IXIA 2F4PA 1TQPA 3HTSB 3ES1A 3OV8A 4WXDA 2E7XA 2CAVA 5J6XA 3IDBB 3TNPB 3I71A 1T2KA 1H9TA 1LNWA 1YG2A 5H20A 2PAMA 5HI0A 1YFXA 2XLFA 1KYZA 3CLOA 3F8MA 5ICGA 1LQ1A 2H94A 4N9IA 4Q0SA 4LG0B 4YIFA 3CF6E 3KP6A 3I7DA 3NEUA 2WTEA 5HOOA 1EH8A 2L3DA 3M7GA 1STZA 2XKOA 1PP8F 1RI7A 4UVAA 2ET7A 3ZMTA 2BE5F 3FZVA 5LRRA 5I8SA 5FLIA 3R61A 1GHCA 4B8XA 4HV5A 3ZP5A 1YTYA 2COMA 4M74A 3FMRA 1SFEA 4MQ9F 4WVZA 4L11A 5CU1A 2GC2A 2H09A 1SMYF 5I93A 4GGGA 3F21A 4YFXF 4NVPA 4F8AA 3H8UA 4P55A 2HJIA 1XSVA 1Z6RA 4MEYF 4MX3A 1T0FA 2PBIA 5DYMA 5L3GA 1CAUB 1X8MA 2D5FA 1W7PA 3J81K 3KP4A 1PM7A 1LEBA 2PG4A 5D5XB 5HLGA 2XROA
chains in the Genus database with same CATH superfamily
3SITA 1GZWB 4IRGA 3JREA 1UB9A 1S55A 2LTPA 1V9U3 2PI0A 5E89A 3ZO0B 5BNOC 2PA7A 1YW8A 4AZZA 2DUPA 1PIV2 2I74A 3FK7A 5F37A 1QJU1 5GZCA 4IKFA 4BJ6C 3WG1A 1LFUP 1I3HA 1LOAA 3QPTA 4K21A 1O3TA 1EJ9A 2EZKA 2HWC3 1W6NA 1SMTA 5L3CA 2VUMJ 3QPHA 2WAOA 1LOFA 2ZEWA 2VZPA 4Y26A 2HKXA 4NQWA 3CESA 4NHYA 2ZSHB 3WNKA 1UYXA 1FSHA 4M6VA 4C9YA 2E7WA 2VH9A 2ARBA 4NAOA 4U7DA 5T3NA 5JI9A 1S7EA 4FPFA 2BOLA 3RZJA 4N90A 4AIJA 1DFQA 2YGLA 4XABA 3C2BA 3POSA 4JYKA 2BZTA 3BG6A 1OR7A 2JG8C 4KIFA 3E6CC 4UFKA 2HU9A 1BI0A 3G2BA 3LNQA 3TO6A 1G4DA 3OWTA 1MQTB 2A6XA 2VL4A 3ESWB 2EA2A 3IKWA 4YZ5A 3SFIA 2WY8Q 2JA8J 1WCUA 2JK3A 1PMJX 5DUKA 4DXTA 1W1WE 3L2QA 4RM3A 1WH5A 2IXCA 4KICA 2ZFWA 3PQJA 5BPDA 1R1VA 2XB6C 1UJ8A 5EZWA 3EO6A 2JZYA 3PMEA 1YLFA 3B94A 4LK7A 1ZZ7A 2F5DA 3LFMA 4GYGA 2HYKA 2ZGSA 2HYJA 3ZYJB 5JXIA 2BPA2 3GGLA 3BG3A 3C7GA 2W7NA 3A1YA 3VHOA 1AYM1 1I6XA 1MEC1 4BQ4A 1R093 1GYKA 3VB9A 2XJRA 2OUMA 2ZGNA 4KIGA 4XTMA 3SCGA 3PU3A 5LHHA 2AXLA 3MZ8A 2QVSB 1ON1A 4A0XA 2P2KA 1KQ0A 3VBHC 1GV5A 4W97A 1SLIA 1IOAA 3WU1B 1AYM3 2DYSH 1MGTA 4ASKA 2HYGD 2AEZA 4JAAA 4GB33 3KX2A 5G04L 3ZXFA 4L0YB 4TXWA 2XLGA 2PLV1 5H9RA 4RGRA 4MO7A 4JKMA 4QX8A 4BDVB 1OVPA 2EA4A 3WTWC 1ZM1A 5LGNA 1S1AA 5FYBA 4ES8A 5CADA 4XNFA 1UMIA 2VZOA 4BJ5C 5FXWA 3JW4A 2M30A 2Q8KA 1DGRN 1AR72 1IW7F 5FRNA 3ERMA 3Q9VA 4LD5A 2R3SA 4CXWA 1WQ2A 5LHGA 2F17A 5F2SA 1RUI1 4L9NA 4K8RB 4BQ5A 4A93J 4XOPA 2A61A 4PJJA 2E51A 2DA7A 1QHHD 1OH3A 3VEPA 1K5JA 4S2GA 4EM1A 4N7UA 1XU1A 1W7PD 1KFXL 3DF0A 1TTYA 3E1F1 3ZMDA 3USUA 3VBHB 3L09A 4BA6A 3OYWA 4KNYA 1U5XA 1KJRA 2ZA9A 3WP5A 4Z92B 1CQ9A 4CP1A 4YVSB 3HM5A 2F4MB 4NHXA 3V0AB 4KWUA 2VC1A 1XMXA 1LJ7A 3VKLA 3CC7I 5IVEA 5J36A 4HF1A 5IWFA 2RDRA 4IV1C 3G7DA 5HNFA 2XVLA 1A34A 4HBNA 1UIJA 4RGKA 1YI2I 3IAPA 3K2ZA 1YO5C 1OCZH 3OYCA 3G1LA 1MACA 2ELHA 2W57A 1LODA 2WNUA 4CXFA 3W3CA 4CTEA 1Z3YA 1OQEA 2WZR1 1QNTA 4DPNA 5BPIA 1WW5A 1QZYA 4L5EA 1WI9A 5JR3A 2WDBA 3DGTA 2QQ8A 1NXMA 2YX4A 3B02A 5BXXA 2VNOA 1BBT2 2MD0A 2HGCA 3VZMA 1K42A 2LKSA 2PQSA 2O0OA 2W0XA 2BW3A 1OT5A 4GMP0 2EXHA 3ZKYA 4ENKA 3ZYRA 4IW3A 4QX2A 1SEFA 2DBBA 5EEGA 4IE7A 3LPGA 4EZHA 3TAYA 2QEXI 3MZHA 1UN1A 4RQPC 3K4CA 1X2NA 1LR5A 1GNZA 3WGHA 1BK1A 3VKFC 2UY9A 1ETQA 2L4AA 2EAAA 4CCJA 3WG4A 4RYDA 4DRRA 1KU7A 1W0OA 1A78A 3A02A 4YFNF 4AW7A 1RUI2 2GXGA 5FLJA 1RXGA 3NJYA 5FP4A 4ZYEA 4BXUA 3QBQA 1U3EM 1QDCA 5KCMA 2HTSA 1Y56A 4U88A 2VLAA 4XBNA 4FPGA 4M73A 1WPKA 3BROA 4NIDA 4D9JA 4WBBA 4BDZA 2E36A 5A33A 3RKXA 1O8PA 3NRVA 4IEQA 4UBHA 2YV8A 2WB1N 2EICA 2ZMEA 3VSLA 2EIJH 1RGSA 1UCXA 1SFYA 1LUJB 2NOGA 2EVXA 4IE5A 5CG9A 2Q0AA 1TP4A 4L5JA 3JRHA 1TG7A 2CQNA 2HWD3 4HKOA 4LNVA 4IL7A 1X3UA 2RDQA 1BW5A 3IDAA 3BR6A 1RUH1 2WZ8A 2DU1A 2LKXA 2VMGA 2I2SA 3VL9A 1TWFJ 4XF4A 4Q4Y1 1CAUA 2M7BA 2CGOA 3K6GA 1YFWA 2VJ5A 3O6BB 5FZKA 3CIHA 1BZWA 4RS5A 2B46X 2FX0A 1ZARA 1ZRFA 1ZA4A 4A6EA 5IP6A 4QPWA 5LK5A 2BVLA 3GHMA 1BIAA 2ZMLA 1COV2 2VW1A 4WM8C 1HA8A 3TW7A 3RZDJ 3ROUA 4E4ZA 4FOVA 1D1AA 1GXPA 3C3VA 2PAKA 3TNQA 1T98A 4JDMA 2V6EA 2WWUA 1RXFA 2P81A 3UL2A 5FDBA 4AI3A 2P7CB 2ESNA 1AOYA 4RGAA 1XGSA 1FWZA 5HCHA 1BCXA 1OLME 4XL9A 5KHGA 4D0PA 2ZJCA 1F1ZA 4NR1A 1O57A 1H2MA 1OOPB 2CNAA 2VMIA 3BGAA 3R4SA 5F7UA 1PDNC 4XQWA 3QU3A 3TW6A 4HK8A 3S5AA 3M70A 3ILFA 1WRJA 5FROA 1R091 1H88C 4BPZA 5CISA 4DY3A 3JBG2 5KC5A 2E7TA 2Y6HA 4B7KA 3O1VA 4JC1A 5CFDC 1Y0NA 4NC7A 4YPJA 5JHUA 3ILRA 5FZFA 1FV3A 2RV8A 1CWPA 2BNOA 4HEA2 4LHSA 5LLQA 3HRMA 4RB3C 2MEV3 3BZKA 1C28A 4XPVA 4A2UA 3IDEA 3HMYA 5HPOA 4DINB 3RSJA 3WF0A 3ECOA 3P6BA 1Y39A 3RKWA 2X6YA 4BHCA 4OIRF 3W6KB 2QQWA 3PNYA 3CCJI 1BC7C 4CCNA 2IEKA 1W9FA 1U5ZA 2K3FA 1B35A 2EFOA 3IPVB 2KL4A 3FLTA 5IATA 1DF0A 1VRH2 3BTLA 4M71A 1AL21 3GDBA 3S3OA 1O3RA 2OQGA 3F23A 1X1BA 1LHNA 5H6RA 1WI3A 1R49A 1UHSA 3S30A 2LY1A 1MQTC 2EK5A 4E7SA 5GTHC 1YW7A 1MDMB 1DQ6A 2IT0A 1QJX2 3H8OA 1ONAA 2STTA 4HQMA 1J9IA 2LYCA 2KM2A 3SYTA 4F92B 1V55H 4GXOA 4META 3WR0A 4D5CA 3F72A 4LBQA 1W8NA 1Q8SA 4L97A 4EYUA 2H1KA 3AMHA 1IZ1A 4PSXA 3WU2C 1LAJA 2W00A 2E32A 4BEHA 2WABA 1IDZA 4ATFA 1XPWA 2VW2A 2JIGA 2XOMA 3K1MA 2QJVA 5E16A 3L7WA 2PQ8A 3A21A 2ERFA 1B09A 4UW4A 4AQTA 1H1MA 4EJRA 2K9LA 3OG2A 3GWZA 1R4MB 4QX1A 4H4KC 5FXVA 5DTDA 1O59A 4EJVA 4CU7A 2ES3A 4CEWA 4AYBA 2PMUA 2MLGA 4YG0A 4NB5A 5GTIC 1YHFA 1MKMA 1ND3B 4RQPA 3FC0A 5E1ZB 3RI8A 2DBIA 3DPRC 4YRDA 3I54A 1ALYA 1ENHA 3OUJA 5D4SA 3NQHA 3NWKA 3PVBB 3PDQA 3POBA 1AR82 3O0XA 1UY3A 5E6HA 4EQQA 3LSJA 2D3RA 3I2FA 5FY8A 4EN9B 1EY2A 3OS1A 1ETWA 1CAVB 5T55A 4QDRA 3G6EI 1XCVA 2WS93 2A6YA 2DJNA 4QB6A 3UGHA 1TEIA 1Y9QA 4YFKF 4IHWA 1R082 1DGWA 2ECCA 5FJ8J 5D8AC 1LOEA 2DV9A 3ACIA 4XUOA 4LQRA 3BCAA 1WD4A 3KV5A 4IZZA 3HHHA 1GDTA 2QENA 2XJQA 3N3HA 4FOWA 4S0HB 3N36A 1IUYA 2YU1A 2OU2A 1DPRA 2OW4A 3WXPA 1UY2A 2GC0A 3RYPA 3MIEA 3WW4A 4MGKE 4IHSA 2V1XA 1AVBA 3AZXA 2XMLA 2ZHNA 3LSEA 2DT5A 4BQ1A 1O5UA 3T4HB 5F9TA 1SBFA 3PNAA 4CDWC 2RQQA 4AD9A 1G9AA 1XNAA 2NP0A 2FDGA 4QPIC 4XKVA 1BK0A 2B9VA 2JVHA 3FHNA 1NCQA 1ZQ3P 5CIRA 2LP0A 2VZVA 2YU2A 3HEIA 3C1DA 5BNOB 2R7RA 2CFOA 2I07B 1Q3EA 5T5JA 2Y38A 2QE3A 2ZGTA 5D8KB 2D44A 5IP9J 2DFEA 5E3MA 1KITA 2J1RA 3FFZA 3THCA 4Q5OA 5IVFA 3MKZA 4M4RA 3UT0A 3FDYA 1ENQA 5JLWA 2ZNYA 2BY1A 3WQ1A 1J75A 4AGRA 5CYVA 3HOYJ 2ELJA 3BG7A 2GIVA 4BCUA 1NCRA 1XQNA 4XKCA 1Z67A 3S2WA 2WFF2 1YOVB 4RR3A 5DPNA 4J25A 2R7DA 2ZOEB 4JTNA 1D2QA 2ATFA 1GMMA 2JKXA 1PVC2 5JR7B 1CF7A 5FZMA 3IB3A 1P4AA 2IPQX 4IQPA 1JYIA 3HNMA 3OD0A 1T95A 3WHTA 2CY6A 1JE8A 2O6GE 4FP2A 4JGYA 5IOZA 3KZYA 2D6LX 3F8NA 2CSOA 5TSWA 4HG2A 2VBZA 1BI1A 1Q8PA 2W46A 1X3ZB 1BEV1 4Q0VA 4YELA 2D5VA 2C26A 4CDUC 4OHWA 4QMAA 1F36A 3UR3C 4NPRA 2JG9C 2VJJA 3R60A 1B59A 4LLGF 2DTWA 5E3LA 1EV7A 1FT9A 4XURA 1W0UA 3W20A 1PX4A 4RB0A 5FZ7A 3IWFA 4OI0A 1PK6C 4FO9A 4OIPF 4GZ9A 5IAVA 1IV8A 9ANTA 3TYJA 4AOCA 5FO9B 1CF7B 2EIDA 1R1ZA 3FUQA 3OB8A 4PCRA 5K0UA 3HPHA 3VZOA 4HG6B 4CEWC 1WLTA 4B29A 2ORXA 4FX0A 3S93A 4PSWA 3FBYA 4E2QA 4QWNA 5IVVA 3M8EA 4OI1A 4XETA 4LHKA 3UKNA 1Y7BA 1MD0A 5KHHA 4D69A 2A69F 2RG4A 2CHHA 4Q4V3 2DFFA 3WTUC 3MPPG 1NZIA 4X0GA 1CZVA 2JXAA 4NRMA 4QXCA 2EZHA 5FKBA 1SC7A 3HRSA 2WV0A 2NRAC 1IN4A 1SFKA 1O4TA 3BJAA 2Y31A 1MNDA 1OBNA 4HF2A 1RHI1 5TRDA 4HNUA 5IYCJ 4BE3A 3UNPA 5C9AA 1DHKB 2R5ZA 2E60A 2RM23 4HPKA 3DQVC 2XAUA 1DPUA 2W2IA 3PUFA 4RA0A 4ZKTB 4GAZA 5LCWL 4K20A 2LNBA 2HWF1 3LQCA 1FC3A 4C1XA 1EH7A 3THDA 2ZKZA 4SBVA 1Y1WJ 1IG0A 3JB8A 3KCCA 3ABTA 2RJLA 4AVSA 3SHRA 4A0ZA 2QQAA 2DT7B 1OMIA 3FBMA 1MH3A 4M01A 2KHMA 1JTXA 4XN0A 5EYRA 3DKWA 3W21A 5FYUA 4LA2A 5LFAA 3W5NA 2D5HA 5KVRA 3OPZA 4PIXA 5E1WA 4Y5Z0 4KYWA 3MEXA 4CUGA 4YG6A 2VOKA 2X5IA 3AG4H 3K69A 5J4YA 2X6WA 2JRTA 1QJFA 3OYDA 1SQ4A 4AG4A 1W3VA 3WDYA 1QNYA 2I5UA 3N7MA 3N9OA 5FZGA 3AL5A 3H5NA 1ZBE2 3BJ6A 3H0GJ 2D40A 4GKXA 3B01A 3CKHA 1VFCA 3ZN6A 4BYYA 1VBA2 2TDXA 1RUG2 2VZQA 4YEJA 1PGW1 3LF7A 1FMD1 2QSGX 4AVZA 5FZHA 1J83A 2WO3A 4JRAA 3EXUA 2WLPA 3N05A 4UT5A 3MHZA 3E6BA 3POJA 5E79C 4LKEA 3HQXA 3TP3A 5EYXA 2V4AA 2W24A 4GQ7A 2ENRA 1IDYA 2PJPA 1BMV2 4N8MA 3DTIA 3LOBA 2R7XA 2JD9A 2LK2A 2ZPXA 2X1CA 2FE3A 4K40A 1FOD1 2X5IB 5A6QA 3GJAA 2DCYA 4G12A 3BPVA 1EUTA 3FHZA 1OPCA 1H8VA 2XJTA 1ASJ3 3UJQA 4B3AA 5JMCA 5A7PA 2W1UA 3F6VA 1SFOJ 5G05L 2LVSA 4HRIA 4PIYA 4DJAA 1VQ6I 2MHFA 2FXAA 3K1PA 1Z7S1 5L3BA 2EAKA 3OBAA 3VDBA 1PGL1 3AP5A 5GLZA 4FPYA 1OPMA 4LKFA 2P5LC 5IT3A 3T2TA 3J80Z 3EQEA 1NXD1 3WUCA 3TDUC 1VLNA 5I0DA 1ZGWA 3H36A 3I3QA 1RYYA 1G3TA 3J7YJ 3C2GA 5FKMA 2HQ5A 4HF0A 3RDIA 4WM8B 3U37A 5A7NA 4BHBA 1VBC3 3HT1A 4FAGA 5ISLA 5DDJ1 3S32A 1CQTA 2VUCA 4FPJA 2Z5UA 1AJKA 1UW8A 4LIUA 3TEDA 3PVNA 1SG3A 1P92A 2O8XA 2GC1A 3BIWE 1UZVA 5FFOC 5B1AH 3V7RA 3IN9A 2BZDA 4UF0B 1A31A 2XWBB 4URAA 1WCSA 3GFIA 4MGTA 4BK4A 3OD4A 2V9VA 2NNYA 3PIPF 1CZSA 4AR2A 4CPBA 3EBRA 3ZYIB 1DGWY 2XL7A 1K12A 3SISA 4Q0PA 4XRSG 2WINB 2Y26A 4JGZC 1Y3TA 4IE4A 3W59A 1HSTA 1RUI3 3OYMA 1GUIA 1VBD3 5B4XA 3OR1C 5F1RA 2E33A 3Q8FA 5AIQA 3ZFGC 2ET1A 4BGDA 4YW2A 2IXHA 2VC9A 4QKBA 2FA5A 2VNGA 4DY5A 4BKXA 4QPIB 2GBYA 5K5RA 1O4YA 4X6RB 5HS8A 3AMQA 4RHV2 2GXAA 1OOPC 1RUH2 2A5ZA 1QXRA 3DECA 3VYSB 3MMYB 2R7EB 2VMDA 5J3UA 3DPRB 5TGTA 3H35A 1K78A 3UYJA 1TL8A 1T56A 3MKYB 1Z3XA 2A68F 3J7LA 1RUG1 4DXSA 4G9YA 2VL8A 2ZJRF 1LCLA 4FPCA 3CMEI 3C7FA 1QF3A 2WSVA 4JQTA 3BCBA 2Y6KA 3ZQ7A 4CP0A 1XSQA 2DK5A 3ZDVA 4A0YA 2JVGA 2VE9A 3F8FA 2JDMA 3GEZA 4G6TB 3NKGA 5JAXA 2ZJQF 1LU1A 1ZBA2 2BUKA 4LUMA 5D8AB 4ZYGA 3B9CA 3O2PE 4XRSA 2VT3A 1XMKA 5EZGA 1PX3A 3U10A 1GZ9A 5ILVA 2ISZA 4IX7A 4OZXA 2A3SA 5GZFA 2DF7A 4JZRA 2DCEA 1A5JA 4KU7A 1XYOA 2E34A 3BOQA 3SZGA 3K70D 5HS9A 4YM2A 1NK3P 2PN5A 2E6VA 1F15A 4D7SA 1ZAOA 2DVBA 3V0BA 3SZTA 2O5RA 4KUMA 5FQ0A 1LVKA 4H14A 3C7JA 1XD7A 3DKXA 5FPXA 2MBFA 2X05A 5DEQA 1BLZA 1XB9A 3CDZB 3I5UA 2F48A 3CZUA 2O9LA 4Q8LA 3AZZA 2RV9A 1X82A 1WMEA 2H0BA 4XQ4A 5EGOB 2CWMA 5LA1A 3S0MA 3J7MA 4LO7A 2VUDA 2WBKA 3NO8A 1D1BA 1JZ2A 3NAPA 4BQQA 4UHTA 1K4TA 5FWJA 4L99A 4PDWC 3POYA 4BQWA 2QF7A 3QYFA 2NAZA 4AI8A 3OYAA 3OGVA 4WVMB 3VBSC 5K5OA 5EJCA 4MGQA 4LK6A 1HQLA 1SEUA 4LLOA 1UAAA 3LPFA 5F3EA 2VPLA 2BNMA 2IGKA 1C8M2 3B93A 3RJRA 1H4GA 2IZWA 1B35C 1GLHA 3AYDA 1RUE3 2SBAA 2J1AA 1N1YA 1VRH1 4GWNA 3WW1A 1P6RA 2DK8A 3W2VA 1JKOC 1AR62 1OFCX 4EM0B 4BWOA 3OOUA 4RFT0 4KWLA 1ULPA 2XVCA 5FREA 2VNRA 2VY0A 4AK3A 2BXYA 2WQ4A 2RMU2 4OI4A 2WFPA 3BTYA 5DD4A 5FYMA 3VDDB 2HI3A 2TCTA 3E5XA 1XNCA 2ADEA 4XDQA 2C9AA 3CJTB 1ZRIA 3VBSB 3OUHA 1RUE1 3OBTA 5BY5A 3PQKA 3VDDC 4MADA 3CP8A 4FBFA 4QX7A 3JQXA 2WSUA 2KA3A 2WADA 1V6LA 1OR7C 2A5WA 2YBPA 2BQPA 3O5SA 1YRZA 4HA8A 4KT5C 2FJ1A 4FTHA 3K48A 1CR7A 1Q8VA 3QODA 5A6YA 5E8IA 1DLCA 3DEEA 1VQOI 4ZS3A 1R23A 4HX4A 1OYIA 4H0EA 4JX5A 1UG2A 1S2BA 2JB4A 1AYN2 3DYOA 1RUD1 1W2NA 2DDUA 3FN9A 2D45A 3OEBA 2OD5A 2BERA 3HOXJ 4N43B 2VMHA 4M4PA 3BQZA 2QCOA 1YQ5A 3LIHA 2R7FA 3CUQC 3V56A 3AZWA 4QXKA 5C7GA 2W47A 5CBLA 2LROA 2EIKH 1F5JA 3VD9A 4UFLA 3GW2A 5FO7B 3OY8B 3CL1A 5FOJB 1W6QA 3N4MA 5HLHA 2QDRA 2CGPA 1REFA 1DLLA 2WNVA 4UUSB 1HXS1 5K7ZA 4IETA 3S7EA 1GQPA 5FYSA 3AMPA 2A3XA 1BQPA 4HETA 5I8TA 1VI0A 1OCTC 2ZHMA 2NS0A 3U14A 1OYWA 4AYBN 3IRRA 2J22A 2WYFA 2VQLA 4W6YA 3VGIA 3JD72 3RG0A 4UUVA 5EIYB 1FPN3 1AR81 5F5IA 4JQFA 1ZBA1 3PMSA 1ZG5A 2ADDA 1MMNA 2CWSA 4P96A 5DS9A 2VVEA 2VZTA 1AKHA 5FJHA 5DN2A 1W6OB 4Q1PA 1X58A 1LDJA 2QM3A 1G9FA 4UFHA 3WF2A 5BQTA 1FOXA 3MF9A 1JU4A 4ZJZA 3OMYA 3HGYA 1JUSA 3OGGA 5FP3A 1E2XA 4PBPA 1A8DA 3P1IA 5AONA 1BI2A 1R71A 4ZDLA 1TE1B 2ZX1A 4WM7C 3CCLI 4JBAA 5H9PA 1F43A 3DN7A 2P6CA 1JZ3A 3TKYA 1JYCA 4HBLA 3K7AJ 1SLTA 2K2SA 5A32B 3H92A 2W1OA 3POGA 5ICFA 3AC0A 5DUWA 1SFPA 1DGLA 2BOJA 3JAMK 1J3RA 5K4LA 4IVNA 2JDNA 3ENRA 3I56I 5A70A 4IHYA 4N9HA 2M4KA 3MQ0A 3VYUB 1R6RA 1X1PA 2LBFA 1NG0A 4NPMA 4COYA 4H7MA 4AU7A 4ESJA 5GAEJ 3TBIA 3V8JA 1W2UA 2R7TA 4UOJA 2QSHX 3ASNH 1GV2A 2R061 1TQPA 3OV8A 2A75A 4Q8KA 3AZYA 5FZ0A 2WLQA 4FFFA 5GALA 3BUCA 1YFXA 2XLFA 2BHYA 3ITQA 4NN0A 4F55A 1YIFA 4COUA 4QD2A 2RS51 1RKWA 3S17J 2R1DA 4FXKB 2JDZA 3CF6E 2OVUA 4IGPA 5HOOA 2FBEA 4OHVA 1UQXA 1PP8F 2W08A 2BE5F 1MBFA 3VZJA 3JRBA 4Q4Y3 5LRRA 2OPWA 5I8SA 5FLIA 1VQ5I 2JG9A 4ASMB 3ZP5A 5CKTA 2COMA 4MQ9F 3C7EA 1HRI1 4L11A 1REDA 3KHBA 2GC2A 5I93A 1SMYF 2GALA 3NWTA 4PQQA 3CDIA 1UO9A 1XSVA 4LKDA 3I2KA 4GWJA 5C8CC 4GH4B 4MX3A 4P5HA 1SPPA 2HWD2 2D5FA 1W7PA 5FKCA 1PM7A 1S0EA 5IVCA 5CAZA 1IG7A 1ERDA 2AREA 2CU5A 2P5BA 2FSWA 4OUSA 5LHIA 2LRDA 5DMYA 3WGGA 2WNVB 4C0HA 5CFDA 4FPKA 2M4GA 3PUHA 4M0HA 5IK7A 3N9PA 5FZOA 3WDXA 4QM9A 5HS7A 5FV3A 2X5IC 1JMUB 3ABZA 2XKPA 4P9IA 1HSJA 2PN6A 5FTTC 1TMF1 4YWAA 3JSOA 1QBJA 4EGYA 2HYFA 5L73A 3WTTC 3AZVA 2YS9A 3IHUA 3ZMZA 4CPBD 4CEYC 4A44A 5L9VA 3AK0A 5FO8B 2QBXA 5JLXA 3AMNA 4ENNA 3H9JA 2FMDA 1UPIA 1ENXA 2NLRA 2Z33A 3MKLA 3HPGA 3T08A 5F5CA 3G4SI 2WC2A 2HPMA 3ME2A 5L7OB 2COBA 1IAWA 2PEXA 3M3CA 1ZRRA 3ZCOA 3U0ZA 2XIGA 4OMCA 1GKBA 4KG0A 2WZR2 1WW6A 3PVOA 1YEWA 1YI9A 2YUEA 3MN2A 1W8WA 3T4VA 3FXMA 1OKOA 3AXEA 1MSEC 1GANA 5K1YA 2VBDA 3JTGA 5F6FA 4YVWA 1BVVA 2VPVA 2EBIA 1N1TA 2IAIA 4MLOA 3ZMUA 2R041 4MGSA 2HEWF 4IQJA 3MW3A 4PDWB 3IAS2 2YC2A 1XU2A 2DMUA 3ELKA 3E0JB 3K4KA 2LD5A 2RR11 2XBO2 4Q4X3 4R1HA 4E7IA 1YIOA 5DZFA 3C3WA 3TEZA 1X7NA 1QJY3 5F6LB 3HJEA 3LSRA 1WMFA 2R062 4Z6YA 2FDIA 5IP7J 3LEKA 1WHUA 1ZG3A 2CW7A 3FHQA 1N3QA 1HB3A 4Q1RA 4MSVA 2H27A 2JN6A 1SFNA 2MEV2 1WSUA 4XLNF 3KLSA 4ORFA 1HKTA 4V1PA 3RRDA 5FR3A 2RAEA 1YE9A 4M72A 3OTFA 2A70A 4LBNA 2IXJA 2ARAA 2MABA 4Y4YA 4JCKA 4COWA 2CQQA 1IZ3A 3BR5A 1LDDA 1H9PA 3RPQA 2J1SA 3VBRB 3HN1A 1FATA 2YROA 1I9RA 4XVHA 4RGXA 3R0AA 1QH6A 3ONQA 4N4NB 2R7VA 2VE8A 1MNEA 4IF4A 1S0DA 4IGOA 2JDPA 3LSDA 1C5HA 4DNCA 3W6VA 4Y5SA 3SXWA 3CD6I 3TOBA 2QZ3A 2P34A 4IHTA 1S0GA 1ST8A 3KE2A 3MW4A 1KGSA 3ZFEC 2C6YA 2PJRA 2MW8A 3GTLJ 1XDUA 2FNPA 3WQ7A 1URXA 1F9KA 5A80A 5CKMA 4CEWB 3RJPA 3F95A 1LOFC 1R1UA 4XN3A 3L00A 2I45A 2PQQA 1Z7S2 5FLHA 4Z2WA 1UYPA 5EGOA 5B2GB 1OQYA 4WXHA 4XKWA 4ZZ5A 4IO9F 5A3PA 5F5QA 2D43A 1OA3A 3Q9SA 4QDQA 1B8IB 5FPBA 4XLCA 2NVXJ 3BVCA 2WAEA 2HVSA 5FMCA 3QOEA 3NNFA 3JR9A 2MPFA 2P1BA 4M3FA 2WB1A 5CQEA 1NY71 2O03A 2GQQA 4O5VA 5T5PA 3MDPA 3KT1A 2JJ7A 2FDJA 5GZGA 1YJLA 3KMHA 4L9JA 1OXCA 3TP0A 5L3EA 4AVAA 5GP9A 1VBD2 1JS9A 5EWSA 5BNPA 2X4HA 4OHZA 1CONA 1D1CA 1TNFA 5D8AA 5A6XA 2J5OA 4BXXJ 2W3JA 1JJ8C 3KT4A 2CRGA 3JBG1 3KLOA 1RR8C 3FXUA 2A07F 3WDVA 3BLYA 1N75A 3WINE 1NA1B 2Z79A 5KBFA 4M9ZA 5HCBA 4XOGA 2LF8A 2D3SA 2LW8A 1T08B 3ZQLA 5CQGA 5C8CA 2CQKA 4KIBA 4C1WA 4ZYDA 2EFNA 1Z7UA 3GFLA 2L5QA 4Y1ZA 2XAHA 1T6BX 4NROA 2UUZA 2KXLA 3N9NA 4QQOA 3U78A 4YVWB 3VD3A 2M5WA 2W1QA 3DFGA 2DU0A 2K27A 4A6DA 4JGYB 1W99A 5GJ6A 2GMEA 5FK7A 1UHMA 4EJTA 1UMQA 4U87A 4RB1A 1V6KA 1VBC1 3LWFA 5DZEA 4UF0A 1B9MA 5CPRB 2LM3A 3AJZA 5LA0A 1DUXC 1O8SA 5L7OA 4FASD 1D5YA 5A7WA 3HT2A 1MEC2 5J7MA 3P9IA 3ATGA 1V6JA 1XC6A 4RL7A 2WFF3 4ITCA 4YARA 1REEA 2VUJA 4KBBA 1VBE3 3EQLF 2VOWA 3GFMA 2IS4A 4UB6C 2B7EA 4D7YA 2ZHKA 4KDPA 5LWBA 1NY72 2HDDA 4GO1A 2KR2A 3BR3A 5L36A 3ZXSA 5K0UC 4HFSA 3JCUC 5CG8A 4JRLA 3G3ZA 2AO9A 1SBDA 2ME0A 1MVQA 2FCUA 2HWC1 4E27A 1G9DA 5EJZB 1L7QA 4B1RA 2JRMA 1RJ7A 1R1A1 3S8PA 1GUUA 5JVGF 5CA6A 1WWYA 2BNNA 2JEMA 1O7FA 4DYQA 3JRGA 4HONA 4UNOA 2JSCA 4Q4X1 3H8RA 5LY1A 1W8UA 5T54A 3KCYA 4QLCU 2GWRA 4JX4A 3QRFF 1BBT3 2FMYA 4HDVA 3MV01 4JHZA 5J4VA 5A7OA 1BEV3 1PVXA 4YZ4A 5FJKA 1T8IA 1ZBE1 3UKVA 1VP6A 4YM1A 4RGUA 1DBNA 3M7AA 1ULDA 3KZIC 3NRUA 3SQNA 2XUEA 1TW2A 3NAUA 4GDFA 3MIFA 5I0RA 1QKQA 1UFMA 1XE0A 1KQ8A 1YIJI 1NH3A 1LHVA 2VTFA 1JTZX 2PMZA 3FXLA 5JCTA 3GZNB 5A1LA 2M3AA 1JZ4A 1PIV1 4AIHA 5KWRA 3CF2A 3O0VA 4IESA 5CNAA 3K51A 5IYYA 5JIAA 3ZR6A 4F83A 2EXIA 2KRHA 2L02A 1GVJA 3T1LA 1S0IA 2VR4A 1G2HA 4GA9A 5EEHA 3OPWA 3SKJE 4CH7A 4KL1A 5FO5A 1S4CA 3BALA 2QA4I 4KISA 3HOVJ 3J7AY 1PO23 2OJED 4KT6A 3G1MA 3WZ1A 3HQUA 2IWGB 4YG3A 4P9YA 2C1FA 2L9LA 4WK8F 4XILA 1SLBA 2M0MA 3KEQA 1XGOA 2WAAA 1KFUL 2ZBKA 4CO8A 1IS3A 1BBYA 2DQRA 3VBUB 2FBHA 3ACFA 4AQ2A 4UUSA 3DTKA 1W05A 4IERA 3IAQA 3AP9A 5M3MJ 1F35A 2HWF3 1QJEA 2O7OA 4GKYA 3U2RA 4A3ZA 4JKKA 3J8F1 4LTAA 4XQFA 2XL9A 1VMJA 4YW3A 3LWCA 5IJRA 3JU9A 5F1JA 2V9KA 4FE4A 1WUVA 1HV0A 2Q4SA 2R6QA 4H3WA 4PI2A 2X0LA 3E6DA 2VXDA 4O65A 4P1WA 1ULOA 3QP6A 2PAEA 4RAZA 4DGWB 5FD6A 4LPLA 3I3BA 1MS8A 2ZZQA 5ICCA 1ENSA 3JD71 3O8GA 1C0WA 5LBBA 2MSYA 3L2WA 4PT6A 3VN4A 1TWHJ 3WV6A 2WNEA 5FWEA 4E4HA 1TWAJ 4OOIA 3OYHA 4XJWA 3WW3A 3GCMA 2PMWB 1IPSA 4PJYA 3RNSA 4XJZA 2OUHA 1APNA 3QLQA 3JD73 4MV2A 4CUBA 3FBNB 2HNHA 4MG2A 1NT0A 3M3YJ 3RKYA 2VOXA 2TNFA 1ORKA 3AB0A 1XGMA 2G9FA 3VD5A 4PLOA 4AAPA 1R081 1VE0A 3ZYPA 4A12A 4N0BA 3AAFA 2PHRA 4OWRB 2YFZA 1U9NA 3FXOA 3ZQFA 1IRZA 1SACA 2J1TA 1WJAA 2X6XA 4HYEA 5JSPA 3R0RA 2B39A 2K9SA 4ANJA 4FXGB 1OJLA 1LOCA 4AEMA 1WD3A 3T8TA 2QZ2A 3S15J 1EH6A 1FOD3 2RS33 1N3PA 1QRYA 1HLVA 4KN7X 4C90A 1QZEA 1Y9GA 3BG5A 2JUGA 4OI2A 4GMP1 1QPIA 2UYBA 5F08A 2OS2A 2A05A 2LREA 2EWNA 1W8OA 3M2MA 1XB4A 1OVSA 3VBRC 2EFQA 2IA1A 4V2FA 1ASJ2 4B4PA 1PK6B 4Y24A 5KAFC 3CHXA 4YIIA 4M6YA 3I49A 1VBB3 3SFZA 5FZLA 1E5SA 3CCUI 2OAZA 3KQ4B 5H2FC 4IEYA 1F5FA 4EN8B 4XLHA 1V6IA 4UB8C 3KSCA 3FLRA 3SQOA 2LALA 5CFCA 2Z5WA 2IFRA 1VBC2 3MZYA 4XONA 4ISRA 2FZ2A 4L9BA 4EEFG 3K70C 1HF0A 3J4UH 5HNHA 1D5VA 1KU3A 4XCAA 2OA4A 1U0AA 1UU4A 1HXS3 3I8TA 5DDJ3 5HLTA 2UWMA 1WCKA 2NOJB 2CDOA 1ZZBA 1SAXA 4A3JJ 2OA2A 2D98A 2K4BA 3I0TA 1J1TA 4M00A 4QQ2A 2K7LA 5D6FA 3I97A 1D0ZA 1FI2A 4C2TA 3FJSA 1I39A 2ELKA 2E2IJ 3KV9A 4Q2FA 3HL2A 3H7YA 3I2OA 2R073 2ZGLA 1AXZA 1J3PA 3TEYA 3AYAA 3CUOA 3BR0A 2VZUA 4IEUA 1A3KA 4L5IA 4RHV1 1JN2P 4L18B 3H9AA 5FPLA 2DUQA 2KKOA 4NE9A 2R93J 1FZPB 3K4MA 2Z1DA 4HSRA 3TBDA 4M9XA 1P4XA 2LTNA 4J6GA 1B35B 3D82A 3ZFGA 5AFBA 1J59A 3PU8A 2HFHA 1ZKGA 2X1EA 4DQ2A 2D7FA 2WWJA 3PSIA 3BI3A 2HYXA 3I4PA 4B1LA 4UV9A 1DQ2A 1KGYA 3EUHC 1W0TA 2YPDA 1OQ1A 3FM5A 1TME1 5FUPA 3J7HA 4Q29A 4RB2C 1FP1D 3O1UA 1AHDP 3I3EA 1MS1A 1ZREA 3LDBA 1NG7A 3AP7A 1JYWA 1PZ8A 4FPLA 2AZ5A 4KU8A 3DPLC 4UFIA 3HRTA 2HOAA 1COV3 3MBWA 3UKTA 2Q1ZB 2FZ1A 4XFFA 4AI0A 3OEAA 3PFIA 1IGNA 3ZXAC 3I3LA 2ZGMA 1GNYA 2GIZA 3CF5F 3J8F3 3HXLA 3USUB 1I5PA 3GJBA 3TGNA 1GP6A 1R4NB 1ETVA 1DZQA 1B9NA 2J5PA 3MYXA 4B48A 1R00A 1E5IA 1W36D 3E7LA 3DPTA 2CG4A 3ST7A 1QGPA 2P8TA 4P9GA 2G7UA 4YZ3A 2VQTA 3HIFA 4Z2YA 2M45A 3ABMH 2DMQA 2GXBA 1FBSA 1N78A 5FXXA 1SDWA 3L9FA 2IVMA 4B4QA 4YGEA 5J40A 1CX1A 3B3QE 1FYLA 1IV6A 5J8FA 3WY6A 3LSKA 2BU9A 1HQNA 4LEJA 1NG6A 3ZQQA 1UZWA 2LY2A 2UV1A 4EM2A 5AVAA 4BJTA 3QH7A 1W36C 4CUCA 5C8WA 1WMDA 1LHOA 5D21A 2DA3A 2BGPA 1CD3G 4P9XA 1BXHA 3DYPA 3JBG3 2BJSA 3ECQA 2Z16A 1UYZA 1GOFA 4EJUA 4U7BA 2IP2A 5C3QA 1W9TA 3Q8BA 5KHIA 4IUGA 3GLXA 1IN7A 3O14A 3SH5A 4LO4B 2L0KA 4XXAA 2CW0F 4OAZA 5C4JJ 3VBOC 4FQZA 2VBPA 4GYIA 1Z9CA 4LULA 3N97A 1C8M3 4DYCA 2EALA 4G7HF 4D7TA 5I0SA 4CVUA 2BGCA 1RTVA 3MFAA 3UK9A 4A7KA 1BVP1 4KWJA 3COAC 4PUSA 3U4XA 1WCQA 2H8RA 5HV4A 5M3FJ 3CCVI 2UYAA 3HTUA 2DMTA 3A0HC 4R79A 3GTPJ 1NX9A 3L2UA 1VZ0A 3FLPA 4IEXA 5ANQA 1H2NA 2VXJA 4Y1XA 4M3CF 1WW7A 1HX6A 4XRFA 1TNTA 4B44A 1VRH3 1IXSB 2A3YA 3HR9A 4MO3M 4LMYA 2QQMA 4QAWA 2TRTA 1OC1A 3RZKA 3CCQI 3K75B 1ON2A 1W04A 1ZK8A 1QHGA 3G6JB 5KXBA 1B6AA 5FP7A 4FCYA 1TMF3 3MFCA 3GUDA 3K3OA 1GZWA 5FZ8A 1I3QJ 4BNCA 3U1XA 1OCCH 1POV1 5FPAA 1K4SA 2UXXA 5GAHJ 4R4XA 4YW1A 1YYVA 2VONA 5HDNA 1HOMA 1KQ9A 4LK1F 3PIOF 3GZ6A 3BN6A 2LRPA 1E3PA 1HKDA 1G3YA 2HWE3 3BOPA 1Q8OA 2XAFA 4PJMA 3QU6A 3OIQA 2BV4A 2P4WA 4A3CJ 4W6XA 4HOBA 3GHNA 3JQWA 4V2WA 2VCMA 4CXYA 3MLJA 5C6CA 1AYN3 2ZMKA 2JTVA 3NV2A 1AL0G 2LSOA 1YI7A 5ABJA 1S3JA 2E1NA 5JFRA 1UCRA 4RM2A 1VQ7I 2EIMH 3BYWA 3FMGA 1VBD1 1BW6A 5B4NA 1H4HA 4Q48A 4MVTA 3A4CA 2VVFA 3JRDA 5DUXA 1DQ4A 4E2GA 2KP6A 5K7PA 4WVWA 3OR2C 5F64A 1R092 4U0VA 3ASIA 5JWPA 1AR83 4PBOA 1RESA 4TLGA 4RS5C 2HOEA 4ITVA 2IFWA 4ISQA 4W8JA 5ANNA 3CUQA 1RINA 4CXXA 3HNYM 1TZLA 3HOWJ 3MUZ1 3BTZA 1W2TA 2ZXQA 2F5EA 3HN3A 4RS5B 2MNGA 1QO0D 3WP3A 4FFHA 2M2EA 3EPZA 1G8WA 1PZ9A 1RHI3 4GWIA 4LHLA 1OA4A 3BWGA 1QHDA 1D3YA 4IRHA 5B1BH 2WNVC 3QACA 2E1MC 3WSOA 1YFUA 4UV8A 4UBGA 2JD4A 5A3NA 3F9KA 3KF3A 1UZCA 5DG1A 4ETSA 2R071 3AKSA 4MIMA 4A7YA 4HV6A 2C6SA 3O1RA 2ZMEB 4XJUA 3OPTA 3QCWA 5BNQA 1YC61 3ZKUA 3GO5A 4IEVA 4AHWA 4BH9A 3BTAA 4JX6A 2P3IA 1ZZ9A 2V73A 4XCBA 3NNGA 2K9ZA 3VBFA 3AFKA 3IH2A 4XLFA 3RZZA 3L2CA 1UX6A 3BCWA 2RQPA 2UY8A 1ZBA3 4BQXA 2XRNA 2W87A 5FCCA 1JGGA 4JKLA 3QYBA 1H6XA 3PIGA 1GICA 4YGBA 5APAA 3PL8A 3N9QA 5A32A 2CQ7A 3TQNA 4HSTA 4A6OA 3WNXA 4YSFA 2DVFA 2IXSA 2EZLA 3CMAI 4AI2A 2KJCA 5AVPA 2M87A 3POIA 2NVTJ 2YFUA 1PVC3 1T33A 1W9SA 2ZBJA 2OCEA 2MEV1 3UGFA 1AR71 2HWB3 4XEZA 4FFIA 2RKHA 1RMU3 4M3CA 1GOHA 4MGZE 2VC0A 5J1XA 1V4RA 3KWVA 1J58A 2WAFA 2JPCA 4CCMA 4PZJA 2YMZA 4CU9A 4NO4A 1YQ6A 2G0EA 1UYYA 2Y6FA 1OYYA 2ICWG 3IH3A 2VKEA 2ZEXA 1W06A 5LB6A 2PHLA 4ENJA 3FWEA 4D7NA 1YJWI 1PP7U 1K45A 2B0LA 1W5SA 2P7VB 1FIAA 4IOAF 4LJHA 1I3AA 1FMVA 2JA5J 1HB1A 1DYOA 2ORZA 5CEHA 2NYXA 3K4ZA 1U6GA 4ZPIA 1REPC 4XYXA 2QLZA 3PVEA 4ZYHA 1RUJ1 3BJOA 2GA1A 2D97A 4MFEA 3Q0WA 2OF7A 1QIQA 2JECA 1K83J 4D3WA 2K02A 1D8KA 3GTGJ 3TO9A 1L7LA 3D5LA 5M0TA 4W1UA 4M3CB 5DAQA 1AR63 2MD5A 1ETKA 3IIAA 3FHAA 4LJZF 4IXAA 1JT0A 3AKZA 4RD7A 2H8WA 1JYNA 2RMU3 4FI9A 3K4AA 1C3HA 3AYCA 2RS53 3ZXLA 4TN7A 1CJPA 2PHDA 3T30A 4XMYA 4X6AJ 5IT6A 5C70A 4DBRA 2IGNA 1ZNPA 3J80K 2ETHA 3NV3A 2RM22 4N43C 1DDLA 1C8M1 1W6PB 3CCEI 2WWYA 1YRNA 4QDSA 1U5YA 4FOYA 1TW3A 2F6CA 4XORA 3CJXA 4LK0F 1VBB1 5LBCA 5FY4A 2YYOA 4XF1A 3BG9A 2R0HA 2GH2A 5C3OA 4AGGA 3SEEA 2VQCA 1KD7A 4OCTA 4IE0A 4MXWB 2EV0A 3ZDSA 1ETXA 2VI6A 2E26A 4ZU4A 1RKTA 3QQAA 4MTDA 3S3MA 1RUH3 4BXSV 2AACA 4XAAA 2WFF1 3ZX7A 4I3PA 5GLTA 3FXRA 4RGSA 2XXZA 3M1EA 2GP3A 2EFPA 4MYEA 1ZN2A 4YFZA 4C30A 3ZOIA 3IPVA 5E20A 2RS31 1NOVA 5IW0A 3RI9A 4I0AA 2G7HA 3ZQIA 1EV11 5FKOA 2IUWA 4EN0A 3O1OA 4QPOA 2AQEA 2ZGUA 5A1AA 2VODA 3OSDA 3W6JB 1YFHA 5EYYA 5C44J 4NHJA 1B8IA 5LASA 2W52A 1K3IA 1Y8RB 3U1DA 4OZOA 2ZXJA 3IIIA 3OBZA 1VIWB 1LRHA 3S57A 4PLMA 2FDHA 1O91A 1NUKA 1MJBA 2PLV2 1VTNC 5EJ1B 3MD2A 1VAVA 2HVQA 3E5UA 4R9BA 3KYLA 4P14A 2K9NA 1HRV2 5BOXA 1NA1C 1DYPA 1H2KA 4DYRA 4Y22A 2K0GA 4I09A 2X29A 2GZWA 5FZ4A 5LRSA 3ZSKA 3IRQA 3S2DJ 5BUVA 1AHSA 1BR2A 1JKQC 1F4HA 2XGCA 3EUAA 4F3QA 2TBVA 4YRVA 2HVRA 4M3DA 3GYHX 2VCBA 2XPJA 2CU7A 3FFQA 5JMOA 5LK7B 3I3MA 4Q4X2 2DA6A 1VQMI 3OGSA 1OSGA 1HJGA 3ILNA 3Q5FA 3B6CA 1VBE1 4A3MJ 6PAXA 2Y6GA 1RL3A 5C8CB 3OGJA 1A8MA 3O1TA 3PTYA 1VQNI 4XF9A 5CZKA 4KI5M 1FXZA 1IPJA 2YU9J 4D94A 5T5OA 3VBRA 4LLLA 4B4CA 3O1SA 1RRJA 2JE7A 2K85A 3PO2J 2WA4A 2DUOA 2BW8A 1FNYA 1PK6A 1NLQA 4HAMA 1FOD2 2DMPA 4X8PA 4AIDA 5FZ1A 1GSLA 1EV12 4IXLA 2VO5A 3C18A 3LDRA 4DOUA 3ACLA 2FQ3A 4EJWA 2VVDA 3N9MA 1VPHA 4NHKA 4WM7B 3KHCA 2JENA 2WA0A 5CKQA 3ZM8A 4QT6A 4G4FA 3PHMA 2EZIA 1WLDA 4AC0A 2PMZN 1IS6A 2LLKA 3T0AA 1FOKA 1AR92 2FMLA 3M1CA 3ETQA 4OIOF 1I5ZA 4IQ4A 2ZEZA 2DCTA 1PUFB 1QJX1 1Z1DA 3FL7A 4PJNA 1GV9A 1Q43A 4NHMA 4Z82A 2QQVA 1SD5A 5E88A 1F2NA 3ZFEA 1JJ6C 5JZGA 4ZH4F 2BVVA 1LVAA 1ND2A 2LKPA 2K4JA 5D5UB 4HSLA 1HXS2 3IM0A 2CH0A 1LTEA 4Y1UA 2HEOA 3LA7A 4JP0A 3RTRA 5BYNA 3IL2A 2XDVA 1QU0A 4KG8A 3GTJJ 5FP8A 5F8PA 1MBJA 4IV3B 1SD7A 1FMD2 4A69C 1IGOA 2FDFA 3VZNA 1RUF1 2DPDA 2HWVA 2FCTA 1EF4A 4MUVA 3AKPA 4ZDOA 3O0WA 1QOSA 5F0FA 4IHXA 1H2LA 2ZTNA 2WO1A 3WCSA 3OIOA 1MS0A 3HC7A 5DUVA 3ALQA 1XSDA 3X29B 2B63J 3U4SA 3B7MA 2MH9A 1MMGA 3LSGA 3AG3H 2ID4A 1J1LA 3PTRB 4UVCA 1YS7A 2MLKA 5FXZA 1HBXG 4A3GJ 3FE5A 1LGBA 4Q4W3 5BNGA 4BIFA 3ZFFB 2EA7A 5CVRA 1LULA 3ZMNA 3M4OJ 4BE0A 2IXIA 3T2OA 1ZELA 4XQDA 2PX9A 2F4PA 2EIGA 1QJZA 4OHYA 3TB0A 1AYN1 1QVUA 3QWLA 1YG2A 4R9AA 3OUIA 5HI0A 2ID3A 2F4OB 5A7WB 1ODMA 2VKVA 2W82A 2AHQA 4PK4A 3H3VK 2H94A 1UY0A 2O8KA 2JX9A 4YIFA 4XM3A 1D4M2 3PSFA 4PQ9A 1STMA 3GZEA 1GFF2 1EH8A 3JRFA 1AZDA 1JZ5A 1STZA 2X09A 2Y6JA 4UVAA 4AEJA 2RJ2A 4NNJA 4CZCA 3D5OA 3FZVA 2CV0A 3A7QA 2VAUA 2V1NA 3ZR8X 4CU6A 2DVGA 3AJYA 4M74A 3C2UA 3FMRA 4E4SA 4AYUA 3A4UA 3WDWA 3KD4A 2QSFX 4FETA 5CU1A 4GGGA 3F21A 3CBNA 2RDSA 5FBJA 1ITYA 3CP2A 1Z6RA 5DYMA 5L3GA 3QPLA 1V00A 1RUD2 1X8MA 5GZDA 3J81K 1W6QB 3Q3SA 1CIWA 2PG4A 2XROA 3PO3J 3OY8A 1LECA 5IT9K 2R49A 4HK9A 1PUFA 3LB9A 2MG4A 4IPAA 1S29A 1RUJ2 3OL4A 1QWRA 5A3WA 3L2RA 1TVGA 1XYNA 1BEV2 1V54H 2JE8A 2XAQA 4R9CA 2VKDA 3ZLIA 1RUE2 4AQSA 2NVUB 3ZFFA 3S1RJ 4HVOA 4OAYA 1L3LA 1V6NA 1TWGJ 5IUQA 4MHGA 3WT3A 3RKQA 3MF6A 4QX0A 1K78B 2L4MA 4OFGA 4AFDA 2YBKA 4RQPB 3WUDA 1HCRA 3VYTB 5GLUA 4CDQB 2QWWA 2LC2A 2LUWA 5A3UA 5GADJ 4N53B 1Y8QB 3IZOA 2OKXA 2RNGA 4I3GA 1APLC 1U5IA 1IPKA 2ETEA 4K3UA 4CP2A 3BOWA 1SDDB 1PMHX 1R58A 3OOPA 1GQHA 4D1QA 3TRSB 3FXKA 1MS9A 4CA9A 5M5WJ 4IE6A 3GM8A 5DABA 1H0MA 2PMHA 4RGGA 2Y2ZA 3ZSJA 1XC5A 2F5CA 2H0VA 1JYVA 3CO2A 1XS9A 1JBCA 5JXGA 2HEYF 2UWAA 1B4AA 2GN3A 3P9CA 3LCPA 4YGDA 3BODA 4HSJA 3PURA 3AG1H 1A6QA 1Z77A 3ETPA 4CDWB 4XJ9A 4CDXB 4X1EA 1FAYA 3KLNA 3NJXA 4UFMA 5A2QZ 5BNOA 4A3FJ 3SLIA 2CDPA 5CFCB 3VDCA 1DP7P 2VOTA 3GCXA 1XN7A 5HXMA 4BE2A 2E19A 4W50A 2HWF2 2XC7A 2QKDA 4LBQB 1O4XA 1FEXA 3CDLA 2D6OX 3ECHA 1ZRDA 2DI3A 2HTJA 1PGSA 1OKRA 4JGZA 4MEXF 5FFXA 3LDKA 3OGRA 4COVA 2VMCA 3RCOA 5F39A 4A3XA 2FF4A 1XDSA 1F9NA 4LB5A 4FQGA 4AVPA 4AWXB 3K4DA 4YGCA 1RETA 3ZN5A 2VQAA 1YYNA 1G86A 2K3PA 3CJIB 4HVRA 2OIIA 1MW7A 2DW4A 3HGGA 2Y0SN 1MZEA 5GPCA 2HBTA 1LDKB 1DP3A 5BNPB 1YJKA 1LJ9A 2QUOA 4CDWA 1V5FA 2Y8KA 5F3CA 4BMBA 3CUQB 1RITA 1MBEA 1FSEA 2Y0SA 2C24A 2H6BA 4EQVA 2DO7A 3GZAA 1PJRA 3BKZA 4OIQF 2GN7A 3S1QJ 2WO2A 1HIXA 2ZCWA 3JZVA 1LU2A 4XBFA 2RGVA 3U21A 4QGLA 3WW2A 1YJ9I 2KRFA 1XBFA 3WTYC 3M8JA 4XUNA 3MIBA 1RIRA 1P8JA 1W03A 3R4KA 3KYDB 3VBSA 1POV3 1EKEA 1MEC3 2PHTA 3VKOA 2ME6A 5L3FA 2DTZA 2IGOA 5DCFA 4RA2A 3TMOA 2WYSA 2W1WA 3TOJA 4C3HJ 2E1OA 4MZUA 1MZBA 4EV0A 1AX2A 4XAEA 2BDRA 1PHMA 2PJRB 2R063 3NWSA 5J37A 4C2MJ 4NUBA 3SEPA 3D5RC 4TTGA 5A1FA 4AM3A 1RMU2 5HVQC 2L9NA 3KP5A 5B66C 2Y48A 4XTPA 3THTA 4GB31 3SNMA 4UUTA 2B8MA 5EHDA 3KS7A 2BY0A 3MLKA 3ZPYA 2XR4A 5I8YA 4BU2A 2ZC2A 2Z9OA 1N77A 3GTQJ 1RVF1 3NQOA 1VBB2 3FMSA 2MGQA 3I59B 2OX0A 1WH7A 1ZR4A 1NTCA 4H55A 4I30A 2NVYJ 3AM2A 3W5MA 1XOYA 4XOTA 1D4VB 2ESHA 2VJ4A 3WHCA 5FY7A 3GYDA 3M3IA 4HW0A 1E3OC 2DTYA 3NV4A 4N7IA 2MC4A 1MSFC 3SCHA 2DFHA 5D6EA 3DUIA 3EDPA 4AF9A 3EUHA 5KHJA 3T8RA 5B3SH 2VU9A 3MIDA 2WQZC 3KV4A 5ACA3 2R1BA 2A6EF 2M8GX 2JMWA 4N43A 1FYUA 3ELNA 2DDAA 1YRNB 4YFWA 3PUSA 3RSNA 1NHAA 4JDOA 1RPWA 3X2QH 3I55I 3VD7A 2Y0OA 5FYVA 1Z7S3 2X85A 2A1XA 5EZHA 5JOXA 2DLLA 1I1GA 1PVEA 3HNBM 2XVGA 2P6SA 4SLIA 4PF5A 2NM1A 2YXSA 4FTEA 4C3JJ 4WM8A 2ZXIA 4AEDA 3ZMOA 4TSVA 3CC2I 5C3SA 5TISC 1YX3A 3V7SA 4CE8A 3BTJA 4C2UA 4U0YA 2XUBA 3OYFA 3GVAA 4FISA 3HUGA 2DYCA 2IC1A 4Y15A 4QWQA 3I9V2 3M9AA 3I4NJ 2EXJA 2DOFA 4TWTA 3SDBA 2XBO1 2BW3B 2YR2A 2L01A 2IJLA 4LFUA 2I10A 1SVOA 3NSTA 2XRLA 2VCCA 1DZRA 5FMOL 2ZMNA 1MS3A 1QEXA 1V6MA 1IN8A 1DGRA 1XE7A 3MKWB 1LE8A 1TQMA 1Q56A 5GLWA 1JODA 4AVVA 1QZZA 2XJVA 3L2YA 1X1CA 2UZKA 3H7JA 2X6OA 1J5YA 3DEUA 1R64A 3DPUA 4ZZ8A 3MLLA 5A6ZA 1RUF3 1WGXA 4WZFA 3CLPA 3VBOA 3HOUJ 2VQUA 2TEPA 4RBOA 1F8VA 4KA4A 2VOPA 1ACCA 1RUC2 4I98B 2WZR3 1SCSA 3P7NA 2KISA 3A0KA 1KDMA 4ZU5A 2K46A 2TUNA 2A7AA 2XLAA 3GBWA 5DCMB 3ZXEA 3MAJA 1HKSA 4AUXA 4E2SA 1D0YA 5D5VB 1IO2A 4CCDA 1A35A 3VFZA 4J00A 2J7MA 4XBLA 3Q0VA 4BS9A 3MFKA 3OSGA 1ZLJA 2HLEA 1U5TC 1LOBA 5HXVA 2AH2A 3OYWB 1OLMA 3J7ZI 4JTOA 4U36A 2EFWA 1F5TA 3POWA 1RVF2 1OCRH 3QPSA 4BLIA 2FEZA 4F91B 1U5TB 2W84A 1GLNA 5AC91 4C0BA 4MFDA 3VYRB 4CEYB 1DQ1A 2ZX3A 3PUIA 2IVJA 1JYXA 2E1MB 2DJIA 2FHRA 3B6AA 3E5QA 1R22A 3WTSC 2Y69H 2DCZA 1SD6A 3WNOA 1W6NB 4NIHA 4XLAA 2JUCA 1W90A 2BTVC 2VMEA 1UOFA 4UVBA 4LLFA 4UY8I 2OXBA 2XSDC 2R7ZJ 4BACA 1FOWA 3LSPA 2KIQA 5AFEA 3D0JA 4ZXEA 1NA1A 2EF6A 2W68A 2DA5A 1US2A 4FQ4A 2YPJA 3S7IA 1W7PB 2RN7A 2XH6A 2Y0MA 1HN1A 1BL0A 2GNBA 3G73A 2VG9A 3HBKA 1FMWA 1UPSA 4AVCA 5KR7A 3LFKA 3EUKL 4S2FA 3CJRB 1A6CA 4ARXA 2XF5A 4Q0UA 2QBYA 4QHZA 3ACGA 3JCIA 5HODA 2AUYA 5KNLA 5ED4A 2A3WA 5CLSA 2G4IA 3VZKA 3L2HA 2M8EA 2EV6A 4AEDC 1DQ0A 3HSFA 5CVUA 4R52A 3OYJA 2CYYA 1UAIA 1YIPA 4AHYA 4DEVA 2RNJA 1RZ4A 2JE9A 2Q8DA 1WVRA 2A5YB 5EV7A 4CDXC 3KGLA 2VBWA 4C8DA 3UNGC 4R4ZA 4KGQA 1DZTA 1VQ8I 1W0NA 4LBQD 2L9SA 4E7ZA 1K5MC 1Q5OA 2DBNA 1MDMA 3E97A 4OQ9A 2OTLI 1ACIA 4KN4X 2DOEA 1SVLA 4BBRJ 2W95A 3HG9A 3ZFEB 3RQ4A 1G9BA 1POQA 3NKTA 3JSPA 3VHPA 2DFIA 1GR3A 5BMZA 4XHBA 3TN92 2W4SA 4JX0A 3M3OA 4AQ6A 3VOEA 3TEWA 4J01A 4JVAA 4BB3A 4LOCA 3NNLA 1XX5A 4UI9L 5JIUA 4XZUG 1RHI2 2ZKLA 4XFGA 4CYCA 1PO21 1P4WA 5JXJA 3NAPB 3HUGB 2EV5A 2L7FP 2Q0OA 1CESA 1ULCA 2BEOA 4YW7A 4NOTA 3LOIA 2W9XA 1XG1A 1IN6A 2CW8A 3CDHA 5F04A 5LA2A 4Q4V1 1CX4A 3WLUA 1F4AA 1SFXA 4UXNA 3WU0A 2V9PA 2KIMA 4Y3OA 1UKRA 1IHMA 4OHXA 1SFUA 5HCFA 1ZG1A 5KXDA 2WBMA 3WQBA 2Y75A 1U9OA 3WG9A 4QPIA 3F8BA 2VULA 3KV6A 4WXCA 3RMYA 4K2EA 5H6QA 2QKLB 1QGLA 2CTVA 1OQDA 1TNSA 5EQUA 4QPGB 1RUNA 4HNVA 3FKIJ 2QQBA 3JRCA 2GLOA 3V8KA 5DUIA 1NLRA 2JDHA 3VLBB 5DCMA 2BBVA 3ZVXA 2WRAA 3M3QA 2FBIA 2YGMA 3J7AO 2Y34A 5J47A 1BR1A 2QDNA 1P7IA 2BFUL 4O61A 2IXLA 3HKZN 4YM0A 4YM3A 3OYIA 2D1HA 3FKJA 2F5FA 4IJAA 1OD5A 1NYWA 5I91A 1VAMA 5JSOA 3DEWA 3ZPLA 2ZGOA 4UXAA 2C5DA 3ZN4A 4CSWA 1W5CC 1VQ4I 4S04A 5CFCC 2HR3A 2DQLA 1CAWA 3ES4A 3DP7A 3V4GA 3ON7A 5E3OA 2KIFA 3KP3A 3F3XA 1G9CA 2XSJC 2QQJA 2JDAA 4NBQA 3F6OA 2OZ6A 2LH9A 2CV2A 1WZ2A 1U8BA 2EPFA 1QJU2 4BY1J 1QY4A 2CSGA 3TDZC 2VB6A 2VCAA 4RLFA 5C3EJ 2CFXA 4II3A 2WKKA 3C7HA 1XYPA 1Z7LA 2YZ4A 1CPMA 2KZVA 1KDKA 2STWA 1VRBA 1FYKA 3MICA 4GH4C 2JICA 3DLLF 1ZVFA 3UGGA 4HXCA 5DDJ2 4Y4RA 3FXQA 2K40A 3D0SA