4I09A

Structure of the mutant catabolite gene activator protein v132l
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
204
structure length
204
Chain Sequence
PQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKLGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 58
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i09A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i09A01
4KN4X 2G7HA 1UPIA 3PNAA 2XLGA 4AIKA 4IEZA 3GUDA 4G6QA 5LLQA 4U7BA 4LUMA 2QVSB 2V1XA 3NKTA 1XSDA 4CO8A 1U6GA 1LB2A 3HSFA 2RNJA 3LAJA 1P4XA 2Z33A 3GW2A 2W57A 3P9KA 1PUEE 1K6OA 1UW8A 1X3UA 2XAHA 4FBFA 4ON0A 3QAHA 2P5LC 1DDNA 1MJAA 1H0MA 3GBFA 1T38A 5L3DA 3BPZA 2LF7A 2CGPA 4HF1A 4BHBA 2O03A 2EFNA 2QBYB 3K9TA 1R22A 4XSXF 4HVOA 1O3TA 1Z7UA 1CGPA 1MJ9A 2P6SA 3GX4X 4L0ZB 2Y0MA 2Y75A 5DCFA 3H8UA 2CQKA 4MEXF 4H7LA 4KN7X 1LEBA 2LF8A 2ZMEA 4YFNF 4EWEA 3U2RA 3KLNA 3HOSA 3FMRA 4IRIA 5E16A 2Z5UA 4A12A 4EGZA 3M8EA 4Z2YA 2UY9A 5CJ9A 2DU9A 2J5OA 3CLPA 3O14A 2YPRA 5CYVA 2H6CA 4HLTA 3KP2A 2P4WA 4J1XA 5HDKA 4RB3C 1IN8A 5FFXA 3I54A 3ZMVA 5I8SA 4NB5A 5D4RA 1T39A 4WF2A 5I91A 1MDMB 3EQEA 1R7JA 1R1UA 2COMA 1OYYA 3WW1A 1X82A 4MGYE 4FX4A 4ZU5A 3BY6A 1VJ2A 4ZU4A 1YW8A 2EV0A 2HWVA 3D82A 3HHGA 3QP6A 1XN7A 1UD1A 5HS9A 4N9HA 3OD0A 3I53A 1SMTA 4HX7A 1RUNA 2VBZA 3H7YA 1B9MA 1WGPA 2CW0F 3U9GA 5ICFA 4HA8A 4G7HF 2YU3A 2FEZA 1FOKA 2QQ9A 2V6CA 3JTHA 1KQ0A 2ISZA 2E9QA 3KP7A 4R1HA 1J9IA 2IXLA 5I93A 2NYXA 4OU0A 1ZAOA 4KDPA 1KYZA 4E2QA 1BI1A 3FHZA 3P9IA 2HQRA 2LSOA 5BY5A 5JSPA 1DPRA 5T3NA 2M87A 5D8LB 4ONUA 2HZTA 4XFHA 4UVCA 1D3YA 2KJBA 2H0VA 4ZH4F 3IDBB 2YX4A 3MWMA 1WSUA 4IHSA 5E1ZB 4G9YA 5JAXA 3O3KA 4RB1A 3PLQA 1J5YA 1XGOA 2XGXA 2RC4A 3R61A 3NJZA 5K5OA 2O6GE 1ZVFA 4WXDA 1FZPB 2ATFA 3ZN1A 2PI0A 3WU1B 2PHDA 4ZZLA 2KRFA 5D6EA 1FBSA 4Q5SF 4O3MA 4O9GA 1SD7A 3IIAA 2DTRA 4HMZA 3DEUA 4PGGA 1XRUA 5BPDA 1G6NA 4DINB 4YFKF 3HQXA 5FQ0A 4EVIA 2PN6A 2RVCA 1JHFA 1P4WA 1F9NA 3T0YA 2L4MA 2FQ3A 3CUQB 2CAVA 2VT3A 3H1MA 4HBLA 2ZNZA 3DFGA 4KYWA 2IA0A 4IVNA 3L2CA 4XF1A 4MGZE 4MGKE 3I59B 3RNSA 4XLNF 1U78A 2GIVA 2VE9A 1L0OC 3HSEA 1OYIA 1KU3A 3FE5A 1BM9A 4UNOA 1NE4A 3L9FA 5H6RA 2Q0AA 3RDIA 2FE3A 3U10A 1ZLKA 2VODA 4EMSA 4XF3A 3KGZA 2DO7A 5CADA 3KEQA 4IXAA 2FMLA 1OI6A 2L01A 3DL3A 1BI0A 2XRNA 3HTUA 2XAJA 1ULYA 3F6VA 2GU9A 3ACLA 1J3RA 2RGVA 3J81K 1Z91A 4LEJA 1J58A 2WC2A 5FQ0B 1OR7A 3GO5A 1O4TA 4HX8A 4I02A 1W7PB 3UKNA 4P55A 1ZH5A 2O0YA 1QWRA 3U11A 1BJAA 3WTUC 2O8XA 4FHTA 3WG9A 3J80Z 5HDNA 1S7OA 1CF7B 2NNYA 2GA2A 2A6EF 1C0WA 3GLXA 1LQ1A 1B9NA 2W24A 5I8YA 3FXRA 1K78A 4IEYA 3E6MA 2ELHA 5J7MA 4XFGA 4HOBA 3MYXA 3F22A 2WTEA 1IN5A 4K2EA 2ZJ2A 2HS5A 3H7JA 4PGHA 3M9AA 4OLLA 2IA2A 5L3BA 3FXUA 2VBYA 1CF7A 1UCRA 2K9ZA 1U5TA 2Q0OA 3REOA 2ZCWA 1X8MA 1O7LA 4AXOA 5BS6A 4UBGA 3IC7A 3SXYA 1OKRA 3VHRA 4Z07A 3JSOA 3TKYA 2H6BA 5DCMA 4BXUA 4LA2A 2A07F 2NRAC 2DK5A 1FLIA 5CVVA 2VT2A 2XVCA 5D8KB 1HW5A 2R7FA 1B59A 2Z3YA 2CO5A 2QENA 5FDBA 4PDKA 1XCVA 1IF1A 3BALA 3DF8A 3LQQA 3LZZA 5JHUA 5DUKA 3T1BA 4OFGA 5C8WA 3UKVA 1FT9A 2XIGA 5HLIA 2ET7A 2PMUA 5LHGA 4BIFA 2E1NA 2PAKA 3RYKA 4KMFA 4GYIA 2RQPA 5D6FA 4EJTA 3FMSA 3CO6C 4ORFA 2DLLA 2M30A 4FT8A 1YUDA 2QWWA 1W5SA 1GXQA 2PQ8A 1S3JA 4HV6A 5ILSA 1IW7F 1F4KA 1S8NA 4YIIA 1CAUB 3P9CA 1RI7A 4KWLA 6PAXA 3SHFA 1YLFA 3WTTC 3I5UA 3RYPA 2DPDA 1IN6A 2STWA 2N7GA 3L09A 2IJLA 3EO6A 5F6FA 5E8GA 1J0RA 2A5YB 4B8XA 1EYBA 4CYDA 1O5LA 2VBXA 1LJ9A 3HIFA 3I64A 1QXRA 1R5HA 4B29A 1KA8A 3IBMA 3L00A 2RV8A 4XRFA 3F8BA 2XV4S 3T8TA 5D4SA 4YSFA 4O9EA 3QRFF 1HQCA 4WXHA 5ICCA 3E5UA 4D0PA 4LLNA 3CL1A 4Q0VA 3FHIB 2Z2SB 1V3FA 1XGMA 1ZZ8A 5FLHA 1U8RA 3OOPA 3ETQA 3RPUA 4F7ZA 5DD8A 4HZFA 2BYVE 4EM1A 5D1IA 1FWZA 1E17A 3DXJF 5J3UA 1YS7A 1XDUA 1J3PA 2OYZA 3LWCA 2K02A 3IKVA 1H9TA 2HYFA 3GFIA 3B73A 1TQIA 5KHIA 4U0YA 3CJXA 2BGCA 4L5IA 3ECHA 1YFYA 5LGTA 2QUFA 1A04A 5IT9K 2VBWA 3S7IA 3WU0A 4KWJA 3ROUA 5DUIA 4S04A 3T5XA 1TNSA 1FSEA 5DCMB 2QNKA 2P7CB 4ZYDA 3TOBA 2UXNA 4WXCA 3GVAA 3JZVA 2OPKA 5ERIA 4D7TA 2PHLA 2CV6A 4JVAA 4XF9A 2Y48A 4MUVA 4AVBA 2Q1ZB 2KIMA 2ESHA 3BB6A 4EJWA 2XKPA 4QLCU 1FC3A 3TQNA 3SCFA 2QBYA 3JAMZ 2DQLA 2JT1A 2DBBA 1HKTA 4XFCA 4HYEA 4UV9A 1E2XA 1YW9A 1YYVA 4KICA 3IRQA 1JHHA 1J2XA 1Z05A 3D5LA 4GYGA 3BPVA 2C6YA 3F21A 2MLGA 4P9GA 5BUVA 2NNNA 4A5MA 1XMAA 4IEPA 4MV2A 3FZVA 4EM0B 4AQ6A 3LQRA 1DP7P 5JSRA 5LEKA 2MA3A 3VB2A 2VOPA 2EB7A 4AIHA 4IEWA 3ES4A 2VC0A 2ACJA 2O61A 5D5XB 1NE6A 3LWFA 1LNWA 2OA4A 1YFWA 4ESJA 1X7NA 1HW1A 2RN7A 3ELNA 5A2QZ 4OIRF 3O6BB 2IXIA 3GEZA 5FD6A 1Q43A 3K2ZA 4XEZA 3N4MA 1X8EA 4IEQA 4U7DA 1QNTA 3CO7C 1AOYA 2BEOA 2EK5A 5DEQA 1R00A 2ZNYA 5D5WB 1XDSA 2HKXA 3V7RA 1T98A 5E1WA 1GQHA 5BV6A 2Q2EA 5DD4A 4EV0A 4OINF 3VFZA 3FWEA 4LFUA 2B9UA 3JTGA 3PVBB 2P7VB 1WKMA 1JE8A 3VODA 1P4AA 1I1SA 2UWMA 3ERED 4QGMA 1UCXA 4A5NA 2CAUA 4WVZA 3V8JA 4U88A 1W5TA 2KKOA 3QACA 1I27A 4KMUX 5DDGA 1Y0UA 2JPBA 4IEOA 3BJOA 3G3ZA 2QVOA 2F2EA 3HRMA 3CF6E 3RKXA 1IPJA 2CG4A 5CVRA 4HSLA 2DAOA 4I0BA 4I3PA 2Q8KA 3HUGA 2FQPA 1WA4A 2K86A 2FOKA 1TNTA 1RNLA 1G3WA 2GA1A 3B02A 3V7SA 1YLLA 4P5OA 5J6XA 1O3RA 4IEUA 2EA7A 4EROA 4L0YB 4A6EA 3K0LA 4MX3A 3ZMTA 2BNOA 4QM9A 3CUOA 3J81Z 4IEXA 1S6LA 2EFWA 2V09A 1BIAA 5D5VB 2LNBA 4FAHA 5I0RA 5CU1A 2XROA 5HI0A 1J59A 2Z9OA 4G7OF 2D5HA 4N0BA 1F5TA 3GWZA 5TJJA 4KUMA 3G73A 3J7AO 1U2WA 4IF4A 1B4AA 4Q4ZF 3C1DA 4KIGA 3R60A 2KIUA 1FY7A 2H09A 3ZPLA 2O1QA 1STZA 2CFXA 3NEUA 2B8MA 3NVCA 2HYGD 3H92A 3KP5A 1UHWA 5I8TA 2O8QA 2ADUA 4RAZA 2P5KA 3BZ6A 1ZRCA 1HXDA 2IP2A 2HTSA 1KU9A 1TTYA 1YFUA 1REPC 1CAWB 4HW0A 4ZU7A 4UXNA 2VOOA 1B6AA 1DUXC 1GQGA 3TDZC 3HRTA 1G3TA 3WE2A 4FAGA 2IA1A 3WW3A 2V79A 4HF0A 3E5XA 4AVCA 2QJVA 3WW4A 5F1RA 4JQFA 4LK0F 4J1WA 4HLYA 3KZZA 1FNNA 2ZMEB 3HSRA 1QY4A 2IXHA 4Y15A 4ZZDA 2GC1A 4BQAA 3FXQA 3V8KA 3EHKA 5LHHA 3BWGA 5HS8A 4ESBA 2HGCA 4HBNA 3MCZA 2E7XA 4CZZA 2ISYA 3K69A 4I2OA 5JFRA 4X6QB 3E6BA 1TQPA 2E1CA 3N97A 5H6QA 4D7SA 3HOTA 4HN0A 3D0JA 2D1VA 2Y0OA 2YR2A 4Z82A 2XLAA 4YNIA 5FD5A 2O3FA 1DGRA 3DKWA 2GXGA 1KU2A 4MQ9F 2L54A 3HT2A 4ENKA 3LAGA 1LVAA 4EWDA 4G7ZF 1CX4A 4OMYA 1QZYA 3HYIA 1LRHA 4QX5A 1K78B 5HVQC 4YYOA 4RS8A 3I0TA 4LTAA 2GZWA 1ZHFA 5ICGA 1O3SA 1YTYA 2XHKA 4M6YA 3QU6A 2UY8A 1QBJA 5FLXK 5E20A 3WGHA 1ZGAA 1T0FA 3RTRA 2HKOA 3TO9A 1ZREA 2IW5A 4P9FA 1RZ4A 1W7PA 4PIZA 4OIPF 3O2PE 2B0LA 4HN1A 1HW2A 1FBUA 1WI9A 2ZFWA 1ZZ9A 2QLZA 1ZLJA 3TDUC 1RL3A 1T6SA 5LGNA 3DV8A 2W84A 4JV4A 1QO0D 2ESNA 3NRVA 2L4AA 3PQJA 3ZMZA 5DV5A 3WTYC 2DQRA 1BN5A 3HTSB 3MEXA 4P96A 3FFQA 1P2FA 3T8RA 3M7GA 3RYRA 2WWYA 4LB6B 3GYHX 3ZMUA 4QGLA 3IWZA 5LHIA 4IRGA 5I0UA 4TLFA 1L3JA 4EGYA 4O6JA 4CGZA 4L9JA 3KLOA 3EDPA 1YFXA 4NVPA 1XE8A 3KP4A 3BJAA 1QGPA 1XGSA 1S7AA 1YQAA 5KHKA 4R79A 2EWNA 5FGMA 3V7CA 5JI6A 4KA4A 5DYMA 2HJIA 1FPQA 2FA5A 1EH6A 3QPHA 1R58A 3R0JA 2XL7A 4OMZA 5FPZA 4K8FA 4M71A 4RB2C 3BDDA 3CDHA 2A6HF 2XL9A 1YHFA 2OBPA 2FSWA 1YW7A 1MZBA 5E18F 3E6DA 2BNNA 4IESA 3SZTA 4XFBA 3M1EA 3U1DA 3DPTA 3SQNA 3SZPA 3KSCA 3ABTA 1R5GA 5EEHA 5J48A 1DZTA 1XB4A 4KWKA 1ZARA 3ZP5A 2XAGA 3TNPB 1CAVA 2QZ8A 2CSOA 2GH2A 1KU7A 2JTVA 1IXCA 4MNUA 2VPVA 1R23A 2GC3A 2FBKA 4OIOF 5K8SA 4LULA 5I0SA 3M8FA 4EQQA 1I5ZA 3SFZA 2YSRA 1ZZBA 3IRRA 2XAQA 4CICA 1BI2A 2Z69A 3KP3A 2YX7A 1IUYA 1KGSA 4XETA 2V9VA 3RKYA 1ZG1A 5AONA 4XF4A 2QQBA 1SFEA 1BC7C 2ZKLA 4LMYA 1IN7A 1PDNC 5HLHA 4UVBA 4M6XA 4G94A 3WE3A 3NL1A 1BI3A 3F8MA 1CAWA 1OYWA 2J5PA 3WTVC 1SQ4A 2KIFA 3GZ5A 1EPZA 1G4DA 4YARA 3OF1A 2P8TA 3VEPA 3Q5FA 1LDDA 5FLIA 3R0AA 2M45A 3CUQA 2L3DA 4IRHA 4LJZF 1HKQA 1OFNA 5K5QA 2UZKA 2GC0A 4AVAA 1FYLA 2MHFA 1FP1D 1PM7A 2E7WA 4WK8F 2IXCA 3CO2A 2FU4A 2UYBA 1Z6RA 1ZGJA 4OIQF 3RI4A 1SEFA 1PMIA 3GZ6A 2X0LA 1ZN2A 4I98B 1XMKA 1SFNA 4LG0B 2MC3A 2R3SA 4AD9A 2KXLA 1RIOH 1U12A 2GXBA 4FX0A 4AWXB 1ODDA 2M5WA 2F4PA 3KEOA 1TQMA 2MD5A 2HDCA 3GF2A 4MGIE 4NQWA 3HRSA 5CVIA 1ZG3A 2FBIA 4QXKA 2HTJA 2IC1A 4LGWA 2ZBKA 2PFBA 1J7KA 2BBYA 4PCQA 5CVUA 3KE2A 2FNAA 3RIRA 1KYWA 2HQNA 1TQ5A 3LA2A 4M9XA 4GO1A 2W25A 2KJCA 4HX4A 4KNYA 2QYOA 1IRGA 4F8AA 4EJUA 4RGXA 1SD4A 5LEJA 3JAMK 3QU3A 4IPAA 4L9NA 2W85A 4KIBA 4LLGF 1BBYA 5ILVA 3P7NA 5L3EA 3DN7A 3EETA 1U5TC 2M8EA 2JRTA 2STTA 2DW4A 4YFXF 1QPMA 2D5FA 4AVPA 1LR5A 2EV5A 2H27A 2A68F 1EH8A 4CXFA 4LUKA 5LRSA 4G8XA 2B5HA 1Q1HA 1IXRC 2L02A 3GXOA 1LKNA 2GQQA 1R36A 4E2GA 3G7DA 3I59A 2PLYA 1TLHB 3KFWX 1FYKA 3ZN0A 4KU8A 3J80K 2FNPA 5JR7B 1FSHA 1ZZ6A 2DFIA 3F23A 2V1UA 3ISPA 4PZJA 4MGRA 3H1YA 5D5UB 3SHRA 3F6OA 5JVTA 1SAXA 1V4RA 1MDMA 5KBFA 5EFUA 4WX9A 2BV6A 1Z6TA 4MTEA 3S7EA 1HSJA 5HLGA 3I4PA 3NQOA 1IPKA 1F1ZA 4ENJA 1Q3EA 3ST7A 1UFMA 1XD7A 1FYMA 2EVXA 3USSA 4R52A 4A0YA 5BXXA 1DZRA 3KMHA 3M3IA 1GVJA 5AVPA 2OQRA 4BNCA 2HFHA 4KIFA 2MBFA 3EYYA 3DQVC 1FX7A 4BAYA 4HVRA 1JXSA 2QDRA 2QM3A 4DQ2A 4A6DA 3I71A 1R1TA 5FFZA 1D8JA 3CLOA 4UBHA 4WZCA 4L18B 2IVMA 3KZYA 1CAXB 3L7WA 4RGSA 2OZUA 4Q48A 5ED4A 1D5VA 1IAWA 4JTOA 4WWCA 4HAMA 3C18A 3F8NA 2ET1A 2K4BA 1P92A 1ZYRF 4XFIA 4A0ZA 3RZZA 3JSPA 4LD5A 1SFXA 4EJVA 1P6RA 1QZZA 2VECA 2X4HA 1TBXA 4Q0QA 1XE7A 3BROA 3MZHA 3OCPA 3D0SA 2XASA 4H0EA 1FI2A 2IT0A 4QGNA 2VONA 5E1RA 4Q0PA 4KT5C 2V1DA 5L3CA 2EA2A 3SCGA 2EFOA 4GGGA 4Y17A 3ECOA 3V4GA 4G6DA 4IJAA 1NHAA 1SD5A 3LFKA 2EFQA 1JGSA 1V70A 3BPXA 1XGNA 3EUHA 5L3GA 1HKSA 1IXSB 2WFPA 1SFUA 1UB9A 3H3ZA 2A61A 3H3UA 1ZRDA 2VE8A 4UV8A 5FCCA 3CTAA 4O5VA 1ON2A 5HDGA 4L5JA 3GFLA 2JZYA 2OZ6A 5L3FA 1CAUA 4DNCA 1Y3TA 1WLTA 3SCHA 3E6CC 4PJYA 3L2HA 3Q9SA 2F5FA 3H1WA 2K27A 5HS7A 3ZMDA 1FXZA 4I09A 5KK1A 5E1XA 4PIYA 3MFKA 4AQ2A 1ZX5A 3ELKA 2FBHA 2ZXJA 5F64A 2Q4SA 4ZYHA 2ZO4A 3V8LA 4Q0UA 2EFPA 1MKMA 3KP6A 4RD7A 3TNQA 1RC6A 3TGNA 3S2WA 4A0XA 1R1VA 3F8CA 4CHUA 5IT3A 2UXXA 5BOXA 1WRJA 3SMHA 2EJRA 3WW2A 3F72A 4MEYF 1WQ2A 1UIKA 2FXAA 2RKHA 5AIPA 4HDUA 1G3SA 2OA2A 1ON1A 1EH7A 1J1LA 4ENMA 5JCTA 4UUVA 1J75A 2XLFA 3LAPA 4L11A 4E70A 2IPQX 1YS6A 1ZZ7A 3KGLA 2EV6A 3QPTA 3DPLC 3S0MA 4KL1A 3BCWA 4M73A 4U0WA 4IERA 4Q47A 2D45A 1K7AA 3U0ZA 4BHCA 2OQGA 4TV7A 2IXJA 1H1IA 3Q9VA 3IKTA 1FP2A 3BU7A 2PMHA 5KVRA 2MH9A 2MLKA 2P6TA 1YO5C 3W6KB 1SD6A 2BE5F 3FM3A 2G7UA 3FMQA 5K1YA 3MQ0A 1L3LA 4YRDA 2EA4A 1HSTA 2H94A 2BNMA 4L2NA 1Z1DA 3FM5A 1Y9QA 4M72A 4NHJA 4RGRA 2IXKA 3GFMA 3LA7A 4M9ZA 2XAFA 4RB0A 5BPXA 2D1HA 2D93A 4HDVA 1UIJA 1MJBA 3TO7A 2XKOA 1WWXA 3PQKA 2PTMA 2D2WA 5AIQA 1PP8F 4XSZF 3MAJA 3ES1A 4A2UA 3OTFA 4XBFA 4MZUA 3R6SA 3R4KA 2DPUA 2PAMA 3MDPA 1Q5OA 3RKWA 4HVQA 3FZ3A 2K4JA 2XUBA 4EJOA 2C0ZA 5FLXZ 1EP0A 3ABUA 3RJPA 1YFHA 1OD5A 4MHGA 4ENNA 4HLXA 3I7DA 4Q29A 5EEGA 3CUQC 1GHCA 5A2QK 3WTWC 3M70A 1USTA 4R8HA 2I45A 2JPCA 3WTXC 1O7FA 3C3VA 5KHHA 3H9AA 2MPFA 3ULQB 1D8KA 4YIFA 2Q30A 4IETA 3ZMSA 1O3QA 4META 1USSA 4MTDA 2PBIA 3LA3A 5J8CA 3ZQ7A 2OD5A 2CWEA 5C6CA 2LKPA 2VQAA 3IDCB 4M74A 4EWAA 3WGGA 4WBBA 4WCGA 3DP7A 2NAZA 3BJ6A 3LOIA 2ZKZA 1XSXA 5BPIA 2F5EA 2A3SA 4PIXA 5E17F 2DK8A 5ICEA 4MQVA 3UKTA 2EAAA 4L9TA 1J3QA 1EY2A 1MGTA 3CJNA 4S05A 4Y13A 1K79A 5CVJA 1DGWA 1LDKB 4N9IA 2PYTA 2UYAA 2QQAA 4ASNA 4XF0A 1YG2A 1DPUA 3COAC 3QP5A 1AWCA 1NXMA 1TW3A 5KHGA 4MH0E 2MH2A 4GCVA 4RAYA 2NS0A 3WODF 2M1BA 1BOAA 4YG2F 3C3WA 1ZZCA 4UXAA 4I0AA 4IEVA 4QWQA 3K1PA 3OGJA 1IN4A 2ETHA 5H20A 4LLOA 1HBXG 4Q0SA 4U0VA 3EBRA 1W4MA 3E97A 3MZYA 3WTZA 2RDPA 2MNGA 5TRDA 1ZG5A 1KQ9A 1VTNC 1RTVA 4LK1F 4JTNA 2DT5A 5JSOA 3SXWA 2OAZA 2OZJA 2OU2A 2FF4A 2CYYA 5FB2A 2F5DA 4XLPF 1W7PD 3EQLF 1FBQA 1NZCA 5FLJA 4IHTA 5IT9Z 5KHJA 4L9VA 1XCBA 2HR3A 2JSCA 2IRFG 3IWFA 1NYWA 2DI3A 3LSTA 4AIJA 3GYDA 4GXOA 1U5TB 4KU7A 3ZDSA 2VC1A 3WGIA 3KETA 1JUHA 1YWKA 1QXJA 1S29A 1IZ1A 2PG4A 2GWRA 1BIBA 1O57A 4HF2A 4GULA 2GC2A 3VOEA 1OMIA 4JBAA 3WTSC 5EZWA 2P17A 1PP7U 2FMYA 4LA3A 1LDJA 1UHMA 1LEAA 3C7JA 3HRUA 3GFJA 3NSTA 3H50A 4BH9A 1ZNPA 1TW2A 1O5UA 1CAXA 5J8FA 3AAFA 4ZYEA 3NW4A 3F8FA 3FF5A 4ZYGA 2A69F 1YIOA 3E5QA 2VXZA 5K5RA 1SMYF 5BMZA 5I0TA 1KQ8A 1H9GA 3QOPA 2D40A 2K0GA 3IL2A 2Z99A 1Z9CA 2K7LA 1H1MA 4ESFA 5CLSA 3E3VA 1QQIA 5LRRA 1T2KA 3MPBA 5ILUA 2TDXA 3KCCA 4JK1X 4I7HA 3I58A 5LBQA 2PA7A 4QMAA 4LG0A 5E8IA 4LB5A 3RPQA 4BYYA 1ZRRA 4LLLA 4E2SA 4UVAA 4KFCA 1GXPA 5BQTA 2P5VA 4ETSA 3CEWA 4UHTA 4HV5A 1RUOA 2PAEA 2PFWA 3HT1A 2QCSB 4CDGA 4HSJA 4P9UA 3FX3A 1XSVA 2FRHA 1G3YA 5FPXA 2HOEA 4XFFA 1VP6A 1I1GA 1IRFA 1BC8C 3BOQA 3EYIA 4X6RB 3JW4A 1ZRFA 4B09A 3OV8A 2DCTA 4QM8A 3K1MA 2PJPA 2HEOA 3W6JB 2VN2A 4RGUA 4BHPA 1U3EM 2LDUA 2AS5F 2R7DA 3PFIA 4M9SA 3TO6A 4XFAA 1VR3A 5FO5A 4HQEA 4HQMA 2PEXA 3ML6A 1RGSA 3K1NA 2ETEA 3TOAA 2F5CA 2WV0A 3BP8A 3EJKA 1B1BA 5LGUA 3F3XA 1I6XA 1EV7A 4EM2A 5JR3A 2PQQA 2GAUA 4OOIA 3FJSA 3IHUA 1MD0A 5HOOA 1CAVB 1ONVA 2G9WA 3HHHA 4I01A 1OPCA 2AXLA
chains in the Genus database with same CATH superfamily
3O1VA 1FOD1 5FYHA 2XWJB 1FEXA 1TL8A 2XLGA 3PNAA 3PNVA 3WD5A 3GUDA 3O0XA 3L2VA 4Q4Y3 2V1XA 1ZYBA 1BMV1 4ES8A 1XSDA 5FBJA 1U6GA 3LAJA 1P4XA 3GW2A 2W57A 3P9KA 1UW8A 1X3UA 3ZKYA 1Q1VA 2R1BA 4FBFA 2RDQA 1AU7A 3GBFA 2H1LA 5L3DA 4IEJA 3ZXAC 3RKQA 4KG8A 2O03A 1MBEA 1GWLA 2YBPA 4K8RB 3ZFEB 1REFA 4S2GA 1O3TA 1CGPA 3APBA 3AB0A 3NAPA 2Y0MA 1W2UA 4BXSV 2CQKA 4J19A 3VBSC 3SISA 5LA0A 3TBDA 5IPAA 2ZMEA 3K70C 4W97A 4CDQA 5LBBA 4HANA 3HOSA 5KXEA 3TAYA 3ACHA 4IRIA 5E16A 4A12A 1J09A 4EGZA 4W50A 1LUJB 3BOWA 4Z2YA 5C71A 2P2KA 4HLTA 2P4WA 4RB3C 1SLTA 1YQ6A 1IN8A 5FFXA 3ZMVA 3DUIA 3VPRA 4WM7A 5D4RA 2ARCA 2ECBA 3EQEA 4LXLA 1XBFA 3RSJA 5B3SH 1CIWA 1X82A 4MGYE 4ZU5A 3BY6A 1VJ2A 2EV0A 3WZ1A 1CZSA 4RS5B 1B8IB 3D5SC 5FIXA 5KXDA 1AR72 3H5AA 1R71A 3H7YA 1WGPA 1XS9A 5JI7A 3BN6A 5ICFA 4HA8A 4OZXA 1NUKA 1KQ0A 3I9V2 2A6TA 2ISZA 3A01B 4R1HA 2WS91 4KDPA 1KYZA 4B3AA 4N4OB 3N36A 1BI1A 4HXCA 5EQUA 1RHI2 4HKOA 1CN1A 3Q8EA 2BU9A 5FPVA 3ZXSA 1WSUA 1OISA 5E1ZB 5KCMA 2IAIA 3WF1A 4G9YA 3CCSI 4LQRA 3EYPA 3PLQA 3NJZA 5K5OA 2QA4I 3DYMA 2ATFA 3WU1B 4AW7A 4B1MA 4ZZLA 2LC2A 3PUBA 2WO2A 4I99C 4DZPA 1GSLA 3ORJA 3AXDA 5E79C 4PGGA 5LBEA 4IL7A 1G6NA 2ZKNA 1FMD1 1DBNA 5FQ0A 3UL2A 4P5HA 1PVC1 2Y6HA 4OVEA 2RVCA 2HOTA 3BTCA 4AG4A 1COV1 1LVKA 3BVCA 2L4MA 3HUGB 1DYKA 2EALA 1R1ZA 3H1MA 4HBLA 4AHXA 1MEC1 1NX9A 4KYWA 3NKGA 2Y0SA 4FPKA 4XF1A 4ZDLA 3I59B 3X2QH 2B9SA 1GP5A 1DQ2A 4B1RA 2JX9A 1Y7BA 2CTVA 2ZTNA 3DU6A 4YGDA 4QHBA 5C3QA 1RJ8A 3HSEA 4IO9F 3FE5A 1MBHA 5H6RA 2Q0AA 3QWLA 3I2KA 4GZ9A 2HU9A 1WPKA 2VODA 3HKZA 3ZRGA 2W1OA 2FMLA 1OI6A 2QZ3A 3DL3A 1BI0A 4KJZA 5DQ0A 1LULA 2JECA 1I1EA 3F6VA 2RGVA 3J81K 2RR11 4UAPA 1UXZA 4LEJA 3UGFA 4ZKTB 1J58A 1DU3D 5FZOA 4HX8A 4I02A 5A7NA 4BDVB 4E27A 4QQPA 1JHNA 2DDAA 1PZ9A 1OA3A 1K4TA 1BJAA 5CA6A 2EQRA 3PVOA 5GM0A 3PIOF 3S1QJ 1CF7B 3T2TA 5FMOL 3W5NA 3GLXA 2ZX1A 1WZ2A 5LA2A 2MGQA 2E60A 5I8YA 3E6MA 4LO8A 1M4WA 2EF6A 3BTIA 2GOXB 2WTEA 4TWTA 1QU0A 4K2EA 4B8EA 3M9AA 5L3BA 2K9LA 1U0AA 3PM1A 2HWE2 2ZJPF 2E5ZA 2VBYA 5E3LA 1C1FA 1N47A 4X8PA 1U5TA 2Q0OA 1V6OA 3CJRB 4BQ2A 4EN7B 3TW7A 2ELKA 2H6BA 2BHZA 5DCMA 5FKNA 4LA2A 4DXRA 1NA1A 2W52A 4BDYA 4AEJA 2E19A 2VT2A 5CVVA 2GALA 4GH4B 1OHFA 1T6BX 1HW5A 3CD6I 4JGZB 4COVA 2CO5A 5FDBA 2VQCA 4EEFG 3KF5A 2D6LX 3T4HB 3DF8A 2QSGX 5JHUA 5DUKA 4CCEA 3HNYM 4HFSA 3Q8FA 3UKVA 1YIJI 3IAQA 3VLBB 3AYDA 2P1BA 4P00B 2OIIA 3OIPA 1SHWB 3RYKA 3H0OA 3T2PA 4C0BA 2LREA 3HOUJ 4ORFA 4FT8A 1TWAJ 4NHKA 2R0HA 4NOTA 1W5SA 3W3CA 3ZIXA 1DGWY 3CJIA 1IW7F 1F4KA 1CAUB 1VMJA 4BEHA 1YHQI 4XXAA 4KWLA 2HWB3 1NCQA 1PK6C 2NM1A 2AO9A 2DPDA 2RREA 2STWA 4JKMA 2QQ8A 3UT0A 3RJRA 1APLC 3E7LA 2CMPA 4YFZA 4B8XA 2VBXA 1LJ9A 1LGCA 1SVLA 4EN8B 3WQ0A 1KA8A 1YRZA 3IBMA 1Y8QB 3HL2A 2ZHMA 2JVHA 1YRNA 2IGKA 2ME0A 2ZHLA 1ACIA 1G9DA 3KV6A 4EN9B 4RQPB 4OHZA 1UL9A 3ZOIA 2OJED 1SDDB 3QRFF 1HQCA 3E5UA 2EXHA 4LLNA 1MS8A 4RS5C 3CL1A 2LY9A 4PCRA 3VDDB 3H5NA 4XJZA 1WH5A 4F7ZA 3T1LA 4EM1A 2BWCA 3JB8A 5GZCA 1XC6A 2CL2A 4YW6A 4A3ZA 5CIRA 3RWNA 4C30A 5FO7B 1AYM3 3KQ4B 2KHMA 1GT0C 2X10A 5HXMA 5KHIA 3WF3A 4U0YA 2BW3A 1FATA 3CJXA 2BGCA 2ZGSA 3AKZA 5IT9K 4U87A 5DUIA 4LORA 2XJUA 3T5XA 2J1RA 4JGYB 4NROA 4H55A 1FSEA 5DCMB 3WUCA 2P7CB 1SVMA 4V2WA 4GXLA 5J09A 2UXNA 3DXTA 5ERIA 2W82A 1Y6IA 2K3PA 2PHLA 2CV6A 4JCKA 4XF9A 1FJLA 3J4UH 4AVBA 4ATFA 1N1SA 2Q1ZB 4F91B 3OGSA 2ESHA 4FTEA 4Z8BA 2ZSHB 2R063 3TQNA 1D4M2 4LLFA 2JT1A 5TSWA 2DBBA 1OKQA 1JZ6A 4FXGB 1YW9A 4LK7A 1YYVA 3J8F1 4KICA 3WNPA 2OQ6A 1R4NB 4XZPA 1Y56A 3VD4A 4P9GA 3U78A 1JUIA 5FTTC 1HA8A 5EWSA 2Y31A 4IEPA 2LG4A 4CUGA 2R073 4KITB 3EB7A 4MV2A 1U8BA 5C4WC 1WW4A 4NC7A 2RM22 4YW7A 1DP7P 1P9QC 4GFBA 1LOFC 2RNGA 1AUYA 2J42A 2EB7A 2ZZJA 1VBB1 4IEWA 5B5EC 1K45A 2VC0A 2D5VA 1PVC3 2ACJA 4NUBA 3HNBM 5IJRA 1NE6A 3LWFA 4ESJA 1X7NA 4OUEA 1HW1A 2ZX3A 2GM4A 2ZA9A 1K5MB 3OY9A 2K85A 2IGMA 3LSPA 1GICA 1AYM1 3M3CA 1Q43A 3N4MA 2RS53 1H8TB 3W2AA 2VZRA 4V2GA 5D5WB 1XDSA 4UFJA 3S16J 3BG3A 1CZTA 5FYVA 3PUAA 1ST8A 1GQPA 1TMF1 4XUTA 2R1DA 2Q2EA 4IQPA 3GLLA 4EV0A 3VFZA 1LOGA 4LFUA 1QOOA 2B9UA 3PVBB 4Z2WA 1FPN3 5C8CA 1PIV1 1P4AA 1MEC2 4R9CA 3ERED 4QAWA 2E63A 1STMA 1F9KA 2OT7A 4IGOA 5BNOC 3HN3A 4CDWC 2HXOA 3QACA 3LL7A 1I27A 1HQWA 1Y0UA 1G9FA 1QJU3 3ENRA 2L0KA 2R4GA 3VDAA 4IEOA 3LE0A 2Y34A 4JGYC 3MF9A 5FO9B 3TEWA 4XBQA 4UW4A 1OUXA 2QF7A 1RYYA 2GNMA 4HSLA 5LBCA 5JHFA 1UY0A 2P5BA 1AR83 4GJYA 4RAFA 4I3PA 2FQPA 5C9AB 4YFWA 1HN1A 4XACA 3LSEA 1TNTA 1W9YA 1RNLA 3PMSA 1FAYA 1QDCA 3HEIA 5J6XA 2EZKA 4XXPA 2EA7A 4L0YB 3WHCA 4MX3A 3ZMTA 4OYUA 2FCVA 2DJNA 2VPLA 4IEXA 1BIAA 2ZGTA 2YBKA 1BEV1 5CFCB 2EZIA 1PGW1 3J7LA 2HWD3 4I0WB 3DPUA 2XROA 5HI0A 3I8TA 1VBD1 4QQ2A 2A5ZA 4DXSA 2JRMA 4KIGA 4XBLA 3NJXA 1VF9A 1MH4A 1UX6A 3THCA 2KIUA 2X6XA 2H09A 4D1QA 1STZA 1RKWA 2RS51 4GMP0 2YXSA 2ADUA 4RAZA 2P5KA 1QKQA 5FZ6A 5F2WA 1ZRCA 4IV1A 2Q8EA 1KU9A 1YFUA 4XOGA 1EF4A 5H9SA 5A70A 3LFUA 2DU1A 3AMQA 2VOOA 5FUPA 3TDZC 3HRTA 3HBLA 3WE2A 2AACA 3HAGA 1S9HA 5FAXA 1FMD3 1F31A 2V79A 4HF0A 3I3QA 4QDQA 3QYEA 4JQRA 1FPN1 1WCKA 3UNGC 4QX3A 1ULEA 3KZZA 1FNNA 3M4OJ 1IPSA 1IOAA 1QY4A 1EV12 2IXHA 1IQDC 4Y15A 1CX1A 3VDDC 1L7RA 5BNOA 1ITYA 2LBFA 2AYHA 2W48A 1JZ8A 2DMQA 3MPPG 2WV1A 3U4XA 4ESBA 2W4SA 3MCZA 5GZEA 5J96B 4IV3C 4X6QB 2FDFA 4OHVA 3N97A 5H6QA 3MIGA 2DOAA 2FUG2 3DKXA 4YNIA 5A3PA 2E53A 1Y1VJ 1KU2A 2HEWF 2L54A 3ZXKA 3HT2A 2VH9A 3ZPOA 1RUI3 1IHMA 1UZVA 1EV13 3HR9A 1SZBA 2XGCA 4CDXC 1OA4A 1QIQA 2ILMA 2QQVA 2JE8A 3L2QA 1JU4A 2DMTA 3AC0A 1K78B 5HVQC 4RS8A 1UOGA 2ERFA 2EH3A 2GZWA 2JA6J 2NVQJ 1YTYA 3HOBA 4CP1A 2UY8A 3VSLA 1QBJA 1JYWA 5AFBA 4NBQA 4AVSA 2HKOA 4ISRA 3WXPA 1EA3A 3TO9A 4A6SA 3JRAA 1W7PA 3G1LA 4OIPF 4HKWA 2GH8A 4HN1A 3I2GA 1NTCA 2H1KA 5FZIA 4BQYA 2ZFWA 3TL4X 1ZLJA 3NJVA 3NRVA 3PQJA 3OYHA 4N4NB 3ZMZA 3SNMA 3M2MA 1X2MA 1NY71 1B72B 4TSVA 3MEXA 4RGGA 3VZKA 2M4GA 5E3OA 1VLNA 4AI3A 4D5FA 5C3SA 3EDPA 4NVPA 2NMNA 3KP4A 4I76A 1QGPA 5L9BA 4TXWA 3ZR8X 3OGVA 2HVQA 4RGAA 5A3NA 5KHKA 2WB1A 1HDPA 4R79A 5FGMA 1QJFA 3PTYA 4N8MA 4EZ4A 1D5YA 2RJKA 3VBUA 1KITA 4ANJA 3DLAA 2HJIA 5DTDA 1RUH3 1VQ7I 2KR2A 1L7LA 4GJZA 4QKBA 2GLOA 4XKBA 2XL7A 1ULGA 4OMZA 1V00A 3I3LA 2JA5J 3IPVA 2XL9A 3BIEA 2M4KA 2FSWA 4DPNA 1WCQA 3E6DA 2JDZA 3AX4A 2NZ9A 4QX8A 2EPFA 1RUE2 3SZTA 1HIXA 2C26A 1S55A 3R4SA 3SQNA 3KSCA 2DFCA 5FYUA 1XB4A 2L2OA 4ZY9A 5A3MA 1CAVA 4LR4A 2CSOA 1C8M3 2GH2A 2JTVA 4XMAA 5DDJ1 4XJAA 4MNUA 4DJAA 5GLVA 5IW0A 1R23A 3NNJA 5F0FA 2BFUS 3FKJA 1NK3P 4XUNA 4XTPA 1CR7A 3M8FA 4EQQA 1VMHA 4YW4A 4XDPA 2ZB9A 3KP3A 1IGOA 1IUYA 3V65A 4P9WA 2E34A 1PO23 3CCRI 3OS1A 1SFEA 3HZJA 2VBBA 1BC7C 5LCWL 5D21A 5HLHA 4UVBA 1IO2A 4M3EA 1G9CA 1OYWA 4QPIC 3JBG2 2MC4A 3VBOA 2WYFA 3GZ5A 1EPZA 4IGPA 3OF1A 4M3CE 2JSPA 1AA7A 2HWC3 3TMOA 4EZHA 3WG1A 5FLMJ 2B63J 2L3DA 4IRHA 3ZIWA 4LJZF 2GC0A 1OFNA 1BMV2 4AVAA 1FYLA 2R16A 2ID4A 1FP1D 1PM7A 4BIOA 4WK8F 3CO2A 2JXAA 2UYBA 4XM3A 1LHOA 2JDUA 3WEZA 4FOYA 1OJLA 2X0LA 4PJLA 1VBB3 3D5RC 4GAZA 2IFRA 2LR8A 1DQ5A 3KV5A 1PVEA 4PJNA 1NLQA 2F4PA 1XC5A 5L9VA 2PMWB 4HK8A 3OYFA 3HRSA 5J4VA 4XRSG 4Y4YA 1W8NA 1ZG3A 3O5SA 2HTJA 2JUGA 1JOPA 2JA8J 4IZZA 5IWFA 3KE2A 3RIRA 1OA2A 1TQ5A 1C8M1 2FOWA 4B4CA 5EZGA 3BODA 2CH0A 3ZOBA 2ZAHA 1K83J 1K42A 3BLYA 4KNYA 1IRGA 1XNDA 5FREA 1SD4A 2E1OA 4L9NA 2MG4A 1RUI1 2E7AA 1BBYA 3DBHB 1XNKA 5JZGA 1W39A 3NV4A 5CKMA 2DVGA 2WRAA 3LEMA 4AVPA 1HXS3 3ZYPA 1WI3A 1Q1HA 1IXRC 1TNRA 2W91A 2VOWA 1PNFA 2W1SA 2QGUA 2PX9A 1IS5A 3LDRA 3BR0A 1RINA 4BISA 3I59A 2VCCA 3S5QA 1FYKA 1CVNA 5JR7B 3VHPA 2R041 4XJ9A 5LW9A 1ZM1A 2V1UA 5FKBA 3ISPA 2LW8A 3H1YA 4GALA 3SHRA 4M01A 5JVTA 1ENRA 5FXZA 2PHFA 3N9QA 4S2FA 3V0AB 3L2RA 4MTEA 3QPLA 5HLGA 3I4PA 1IPKA 4ENJA 2P3IA 1UFMA 3K51A 1D2QA 2YUEA 1JKRC 5BXXA 3KMHA 3M3IA 2B4KA 5AVPA 4BNCA 4AL9A 2MBFA 2WN2A 1LENA 1HDDC 1OVPA 5GLUA 4BAYA 3JRCA 2V7FA 4C8DA 4DS0A 3O1MA 2DWRA 2X9DA 4L5EA 2RS13 4AAPA 2BJSA 1PYVA 2WZEA 5FKCA 1CAXB 2L9NA 3OYJA 4Y1VA 4RGSA 2YYOA 4CXYA 4ISQA 3HD8B 4WWCA 2ZMKA 4HAMA 1ZYRF 5EYRA 1WJ5A 3BGAA 3RZZA 4LD5A 3VL9A 4XUOA 3AFHA 1ZBE1 3MZHA 3OCPA 3D0SA 5FZHA 1D0HA 2JJ7A 3LSDA 3G71I 4Y17A 3PSIA 2EXIA 3C2UA 1OH3A 1NHAA 4S2HA 2KM2A 5FYIA 2R7QA 3LFKA 1JGSA 1AXZA 2LK2A 3NV1A 1UB9A 2WNUC 4YM0A 3WNXA 1JZ3A 2A61A 1S4CA 1ZRDA 4UV8A 5FCCA 2KIQA 3GFLA 1H89C 2JZYA 5ISLA 2OZ6A 4XIKA 5L3FA 1NG7A 3S1MJ 3UV9A 5IYYA 1S0CA 3PNYA 4G4FA 3HB9A 2F4OB 4D9JA 5FWJA 2W3JA 3PU8A 2K27A 5HS7A 1NY72 1SFYA 3ZMDA 1WKYA 5KK1A 2CWSA 2RMU3 5E1XA 1QHHD 2XXZA 3I3BA 1ZX5A 2WS93 4BXFA 3BOPA 3UJOA 4QXCA 1MKMA 3KP6A 4RD7A 2LKSA 4RLQA 3KD4A 1BHGA 1E5IA 4A0XA 1U5IA 3WNKA 3OBAA 1ETOA 4AIDA 1QJY2 1YJ9I 4CCKA 1W05A 3SMHA 3DWLE 1GANA 3B6CA 4MEYF 2A73B 3U14A 3HQRA 2WAAA 5FP8A 1US3A 3K10A 3ZYJB 1HB1A 4L92A 3IDEA 1ON1A 1EH7A 4AYUA 5IK4A 4DYCA 3AFGA 4IQ4A 1O8PA 1EPWA 4JDOA 1H8AC 5IYCJ 3LAPA 4E70A 1S0IA 5FMDA 1JYNA 2IPQX 1YS6A 3U07A 3FBMA 3KGLA 2E71A 3QPTA 2CFOA 4KL1A 4M73A 4U0WA 4C2TA 1JZ7A 2GN7A 4Q47A 2ZZQA 2J1UA 2WZPP 3U0ZA 3Q9VA 2VZUA 1FP2A 2JD4A 2X6YA 5K0UC 4C3IJ 2MH9A 2QEXI 2R5YA 2XBO2 4XKCA 5FFOC 1SD6A 2BE5F 1C8NA 1WLCA 2QQUA 3MQ0A 1WWYA 1HSTA 2BNMA 5FZ0A 2IXKA 3OPZA 3GFMA 4M9ZA 1HRI3 4AI8A 3ZXEA 2XAFA 3BG9A 5BPXA 4NAOA 5F3EA 4HDVA 4OMDA 1APNA 2GNDA 2VMEA 1NG6A 3PQKA 1CIYA 4AHWA 1PP8F 3MAJA 3AFKA 2YZ4A 1VI0A 2DA5A 2O7OA 4XBFA 3R6SA 1C8M2 3S1NJ 4ASKA 2WNUB 5EV7A 1WCDJ 3H0GJ 2K4JA 5C3RA 3O1PA 4YWAA 4XK4A 5J37A 2UURA 2NN8A 1OD5A 4MXVA 4ENNA 4HLXA 3I7DA 3WNOA 5KC5A 2OV7A 4EYUA 2XOMA 3N9MA 3CUQC 1GHCA 2GBYA 2CGNA 1USTA 1JYCA 3VBOC 4DUXA 1AKHA 1PIV2 2JPCA 3C3VA 3RQIA 1AX2A 2OVUA 4MGTA 1X1CA 1H4HA 2Q30A 4IHVA 5FZLA 1O3QA 1JMUB 4FXKB 1JYIA 1ZA7A 5DXDA 1XSQA 3LA3A 4XABA 2E35A 2XF5A 4UFKA 4PF5A 4YGCA 1BYHA 4BOWA 2BPA2 4WBBA 5GADJ 3NJYA 5A1LA 3FBYA 5FWEA 3LOIA 3VDBA 3WDTA 2IWGB 3K4MA 2VUDA 2UWAA 3NO8A 3UKTA 4L9TA 1EY2A 4CTEA 3ACFA 3CJNA 2WWJA 4Y13A 1K79A 5CVJA 1DGWA 1QDOA 4N9IA 4COUA 2UYAA 5A3UA 1OFSA 2RV9A 2QQAA 1X9PA 1YG2A 1DPUA 3QP5A 1YQ2A 1WJEA 5IOYA 2DMPA 3HJEA 3HOYJ 3CJIB 5KHGA 3N3HA 3OSFA 5EJCA 1OF3A 4GCVA 3O1UA 3AYAA 3A0NA 1AR62 1N3QA 3AP4A 4Q4X1 3C3WA 1ZZCA 4N53C 2M7AA 5T5PA 3OGJA 3DKQA 3VZOA 4W8JA 1P8JA 1OLMA 4FETA 1HBXG 4Q0SA 2ECCA 4U0VA 1FMVA 1TME2 2ORZA 4OAYA 3MF6A 3MZYA 3WTZA 2X53S 3I3DA 2KRCA 2VO5A 3RZOJ 2VOXA 5H9RA 4UI9L 3ZQGA 5E6HA 4OUSA 4AZZA 4K7JA 3KIOA 2C6SA 1ZBA3 2W92A 2F5DA 4XLPF 3AP6A 2HR3A 1XNAA 3IWFA 4Y22B 1DP0A 4AI2A 5FOBB 3K77A 4R4XA 1K4SA 4HEA2 3CP2A 3BKZA 1YWKA 3CC7I 1QXJA 1S29A 2MEV3 2BV4A 1BIBA 1W5CC 4HF2A 3ZVXA 2GC2A 5EZWA 1SEUA 4LA3A 4XKWA 1LEAA 3GDBA 3BZKA 3H50A 1ENXA 4C9YA 4IHWA 1OBNA 1ZNPA 3NAUA 2XQXA 2V72A 3CNAA 2DT7B 3N35A 3AAFA 1S1AA 4TTGA 3F8FA 1EV11 2A69F 2VXZA 3BR2A 1SMYF 5I0TA 1QJX3 1KQ8A 2FMDA 3IL2A 2QKDA 2VTFA 2JDPA 3UK9A 3J8F2 1T2KA 3AJYA 2TDXA 2CSGA 4BE1A 1KGYA 3KCCA 4I7HA 5LBQA 2PA7A 1ZRRA 4LLLA 4XMIA 1LHUA 4GIQA 2X1CA 2P5VA 1GNZA 3K70D 3IP4B 2WKKA 2PFWA 2PAEA 5KNLA 1JKOC 2QCSB 4NHYA 1VALA 4AI1A 1ZTRA 3FX3A 4Q4W1 2FRHA 3Q8AA 5F5CA 3RG0A 2DBNA 3JXSA 1VP6A 3DECA 3IB3A 3I97A 3W2WA 3JW4A 2YB7A 3OV8A 5D8AC 3B01A 1RMU1 4Q5OA 3Q3SA 4MHRA 2JE9A 4E6KG 2LD5A 4KBBA 4BQOA 2VUCA 1T95A 2LDUA 2R7DA 4GMP1 1HV1A 4N43C 4M9SA 1O6UA 3TO6A 3K3NA 5FO5A 4FFGA 4HQMA 3ZFEA 1KDKA 2VU9A 2J1VA 3TOAA 5JOZA 2BGPA 2F5CA 2R49A 1HLCA 3VZJA 1EV7A 4EM2A 2VZTA 3K7AJ 3WQ1A 5JR3A 2PQQA 4UB6C 5HOOA 1TT5B 3HHHA 1OPCA 2AXLA 3WG2A 3T2OA 3FLTA 3OEAA 3UESA 2PMZN 4KN4X 1FV2A 1MQTB 4DRVA 2D7FA 1UPIA 3M4FA 4G6QA 1P7JA 2F48A 3OG2A 4LUMA 2QVSB 2VMHA 2XVGA 2R30A 4CO8A 5FYMA 3HSFA 5A32A 2Z33A 3HBZA 4V19K 2YC0A 1DQ1A 2VNRA 5ACA2 1P7IA 3ZYBA 1MBGA 3QAHA 3H0DA 5F3GA 1KRIA 3BPZA 2LF7A 4AVTA 4BHBA 1Z7UA 1ZK8A 3ZXDA 2P6SA 4HSTA 1I6HJ 4R9BA 2DCKA 2QQMA 4QQHA 4KN7X 1IG7A 4A3KJ 4DO0A 2LF8A 5FROA 4EWEA 3K6GA 3KLNA 3FMRA 1QQP3 4AEKA 4PLNA 2Z5UA 1N75A 4NHXA 5CJ9A 2XONA 2V4JC 3PJYA 2JUCA 3KP2A 2VZ3A 2DF7A 4FASD 5BNNB 5T55A 1Z0HA 3ZFGB 5K7ZA 1OQYA 2ZXHA 4NB5A 1T39A 4KT6A 4WF2A 1R7JA 3VD7A 1OYYA 3WW1A 5GTHC 1VQ6I 1RUC2 3D82A 3QP6A 3AL0C 2BY0A 1D1AA 3EUKL 4FP3A 2D97A 3U9GA 1FOKA 2QQ9A 3W9AA 1AJOA 2E9QA 4OI4A 5I93A 2Z4FA 1ZAOA 3C7FA 5DM6F 5CKNA 1AL21 1VAKA 1F36A 3MIBA 4LBMA 3FHZA 3AL0B 4F83A 5BY5A 4P08A 3MEPA 5JXJA 2M87A 1ONAA 2IS4A 4XFHA 4UVCA 1TZOA 3EMRA 4BQWA 1D3YA 2KJBA 2YX4A 3MWMA 4MXWB 3IKWA 1JYVA 2IEKA 2LTPA 2XGXA 4DMIA 3R61A 2RC4A 3MKWB 3BR6A 5HCAA 2IXSA 3GM8A 1W8HA 1FZPB 3ZN1A 2PI0A 1EJ9A 3HJRA 1HXS1 2KRFA 5D6EA 4Q5SF 5CG9A 3VBFB 3L2UA 1FX5A 4HMZA 1XRUA 2VNOA 1H1AA 2QQNA 3HOWJ 5IOZA 2E32A 3PHMA 1QVTA 4AFCA 3AJZA 1AHSA 4A69C 4WVMB 1VBE3 5H9PA 1F9NA 1IS6A 1MZEA 1SC7A 3NWSA 4D3WA 2IA0A 4IVNA 4WVWA 4MGZE 1B35B 4BJ0A 3NQHA 5AC91 1K61A 2QQLA 3HNMA 4FI9A 4MIMA 1L0OC 4XPVA 1K5JA 5FZ4A 4DB5A 2CJJA 3AVRA 3RDIA 1UZCA 3PUHA 4XF3A 2DO7A 5CADA 2PXJA 4IXAA 2L01A 3N9NA 3HTUA 1UMHA 1DQUA 4XW3A 3ACLA 2GU9A 1J3RA 4FTHA 3LIGA 1XOYA 2M7BA 3IAS2 5FMCA 2WC2A 3FKIJ 1BLZA 5EJ1B 1O4TA 1GUUA 4BK4A 1AXYA 5EJ3A 1W7PB 5F7UA 2I10A 4ATEA 1Z3XA 4B7KA 5JPMB 4PK4A 3DPRC 4CDQB 1QWRA 2XWBB 1A6CA 2AH2A 2WIIB 3LSIA 4JHZA 5F6LB 4FHTA 3WG9A 3J80Z 1Q8VA 4QKDA 4YG0A 3VBRA 1TME3 5CFCC 5HDNA 5CZKA 2NNYA 3MW4A 5M0TA 1LESA 1W6MB 5A7OA 2BQPA 2ZX4A 1K78A 4IEYA 2ELHA 1V9U2 4HOBA 3ZQCA 3MYXA 2B9VA 3IZOA 4CEYB 4M3GA 3QCWA 4XIOA 2VZ1A 1IN5A 2WS92 4PGHA 1W6PA 2RM23 1GZWA 2IA2A 2XSDC 1UG0A 3FXUA 3OYAA 3AP7A 5EG0A 3GZEA 4NIAA 1UCRA 2K9ZA 3REOA 2NVYJ 5BS6A 4UBGA 2EXJA 4Z07A 1AYN3 1PIV3 3ITQA 2WO7A 2DK5A 1JODA 4DY3A 1GFF2 4YVSC 4BM8A 1AR91 3T1BA 2D6OX 3S2DJ 3QH7A 5C8WA 2VPRA 2IFWA 2BY3A 3P1IA 4G9SB 2ZGMA 2ET7A 1UYPA 2J1TA 2DBIA 1BK0A 4E4HA 1US2A 2PAKA 1QQP1 3KHBA 1MZ6A 1BJQA 4CDUC 1M06G 2RQPA 2XQRA 5D6FA 1W03A 3LSHA 3CO6C 5EXOA 1ALYA 3KWVA 2ARBA 2LYCA 1GXQA 1W6MA 1S3JA 4XN0A 4YM2A 5ILSA 1NQDA 4I3GA 3ZR5A 5HPOA 3OPWA 5M5YJ 2VVEA 1RI7A 3SHFA 1YLFA 3WTTC 4KH9A 3HVDA 3RYPA 5A1FA 3L09A 1ENQA 5FPLA 3EO6A 2VMDA 5E8GA 3OSDA 2A5YB 4AU7A 1EYBA 1LOBA 1YX3A 3JRDA 3HIFA 1QXRA 1R5HA 2MABA 3L00A 5KHDA 1QMJA 3T8TA 2ZX0A 2ENRA 5BNGA 4LT5A 4GRIA 3KS7A 5FP7A 4D6SA 1QJX2 2WY7Q 4QPYA 4Q0VA 2Z2SB 1V3FA 1XGMA 1ZZ8A 1CQ9A 1UXXX 3G1OA 1U8RA 1MS9A 3ETQA 3NV2A 4KGQA 3DXJF 5J3UA 2RM21 4EE2A 3PO3J 1A36A 1J3PA 1XYOA 4FPHA 2HYXA 4HNUA 3IKVA 5JXGA 4CXXA 2DCYA 4FPOB 2AEYA 4HPQA 4M4PA 3H3LA 4L5IA 2F4IA 1Y39A 2DU0A 3ECHA 3THDA 1OLRA 1W28A 2KLOA 4K3UA 1AR63 4S04A 1ULCA 3TOBA 1RETA 2WO3A 3GVAA 2OPKA 4JQTA 4IL6C 2I8DA 3GZTB 2OX0A 2PHXA 4MUVA 5EYYA 1W9TA 3AZWA 2Q1MA 5FZAA 3ZSLA 2KIMA 5IT6A 3BB6A 4EJWA 2XKPA 1HV0A 1YQ5A 4LBQD 4QLCU 1FC3A 3U1XA 3LFIA 2H8RA 3G4SI 5FPUA 3JAMZ 1ERDA 2DQLA 4XFCA 2HYJA 4M3BA 2BBAA 4UV9A 1W6NA 3FC0A 3IRQA 5LK7B 2OPWA 5A3WA 5IVJA 2X1DA 2C6YA 3F21A 2MLGA 1VAVA 1BZWA 4IDZA 3M8JA 4DFSA 1XMAA 1KS4A 4LMFA 3QYFA 5C5TA 4EM0B 2FDGA 2JIJA 3LQRA 1SMVA 1QEXA 5LEKA 3GBGA 4MYEA 3VB2A 1A8DA 1N77A 2FZ2A 4AIHA 2M34A 3WCRA 2XB0X 2O61A 3R4UA 3K4LA 4YELA 2X5IC 5D5XB 2NLRA 3FHAA 1YFWA 4YRVA 3ELNA 3WNMA 5A2QZ 2I2SA 2PLV2 3POGA 2YS9A 2X09A 1WJBA 2DYRH 2IXIA 1VBC1 4F55A 4XEZA 3ZXLA 1J84A 1T0FC 4W6YA 3CO7C 5JR2A 2EK5A 4BEHB 3CKHA 5DEQA 1VMFA 3E1SA 4YW5A 2WQ8A 3V7RA 1W8OA 3A0BC 2BDRA 3OUHA 1GQHA 5BV6A 3JQWA 2GMPA 2RG4A 3VD9A 4YLZA 1OSGA 2IS6A 3FWEA 4CCMA 1TWCJ 2QFEA 3AP5A 2RE9A 4XL9A 3JTGA 2P7VB 2KQRA 1Z78A 2SLIA 3JRHA 4NNJA 1ODMA 5FRMA 2CAUA 3HBKA 2NYYA 3ZN5A 2ZJQF 2YHJA 4U88A 1QHGA 2R7WA 4QPIB 2KKOA 3S57A 5DDGA 3TYJA 1RITA 1VQOI 4FQZA 2ZBJA 3BJOA 3CQZJ 4Y5Z0 2WA0A 2E5NA 3HRMA 4IE4A 2CG4A 2R061 1A34A 5CVRA 2DAOA 4WM7C 3UGGA 4JOMA 3ZR6A 1O91A 5CFCA 1WA4A 2R043 2GOMA 4P14A 1BL0A 2F17A 2VY0A 2GA1A 4AR2A 4AHYA 2PJRA 1RUJ3 3CZUA 2W7NA 3L1PA 4EROA 4MGQA 3K0LA 3CMAI 4AVVA 2EXKA 3CUOA 1S6LA 1QJEA 2LNBA 2WFF1 3WHTA 1J59A 3WDXA 1UN1A 2Z9OA 4G7OF 4OQ9A 4QT6A 4JX6A 2EIGA 4KUMA 2JDNA 3J26N 1ZBE3 2WL1A 2I5UA 4IF4A 1MPXA 1W8FA 4YZ3A 2E7TA 1URXA 2E2IJ 4K1YA 2VD7A 2HYGD 3H92A 4V2FA 1UHWA 4FFIA 1YI2I 1RR8C 4PSWA 4XKVA 3AMNA 1HXDA 2TEPA 2XMLA 5FZOB 1W9SA 2HTSA 2EICA 4TYSA 1FMD2 1CAWB 1MNMC 3J7HA 2M3AA 1B6AA 5BNNA 5BNOB 4PQQA 2EIKH 3N9LA 3LSGA 2F4LA 4CCOA 1U5YA 1VQKI 1GU3A 3OYGA 2Q8CA 4Y4RA 3SQOA 4LK0F 2ZMEB 4NPLA 1LKXA 3HSRA 2GC1A 4BQAA 3FXQA 2W39A 2W95A 3EHKA 2HH9A 5HS8A 5LFAA 1JH5A 5IVBA 2JIGA 1ZBE2 1C57A 3LQCA 2E7XA 1UQXA 2ISYA 3K69A 5C3EJ 4I2OA 5JFRA 1V6LA 4R9DA 2NVXJ 4QIWN 3E6BA 4D7SA 1VRH1 1QQP2 3C2HA 3GHMA 4IE5A 1QVUA 2D1VA 2FD5A 4C1WA 2VVDA 3ZGKA 3AZYA 2ZGLA 3DKWA 4ENKA 5FY1A 3LAGA 1LVAA 3PDQA 2WR9A 5JWPA 5FV3A 1TME1 1QZYA 4BA6A 1LRHA 4B1LA 1RUC1 4CDXB 4YYOA 4HRIA 3I0TA 4LTAA 1Y0NA 4M3CA 4AGVA 5F32A 1FIAA 5DUXA 2MFZA 4CDUB 2XSJC 2HWE3 3ASIA 2XHKA 3QU6A 2D6KA 4K6BA 1ULDA 1I3HA 1ZGAA 4ZTFA 2HWF1 4LBQB 3KQRA 4JX5A 3BTAA 4URAA 1TE1B 2LTNA 2IW5A 3DYPA 4PIZA 1QA6A 2B0LA 1UAAA 1FBUA 2QLZA 5LGNA 2A71A 2BVMA 2W84A 2IS1A 2A1XA 1ENHA 4JV4A 2JA2A 2L4AA 5K7HA 2CRGA 1LEDA 1UZZA 4O65A 1A35A 1YYNA 4P96A 3FFQA 3T30A 2RR12 3T8RA 1R1A3 4W1UA 2WWYA 4LB6B 3GYHX 2L9LA 4DRRA 5FY5A 3IWZA 1A6IA 4IRGA 4BQXA 5I0UA 4TLFA 4ZDPA 1XU2A 1L3JA 4O6JA 2HQ5A 2OXBA 2VAUA 1YITI 3VYSB 4RM3A 3DTEA 1W3XA 4YVWA 1XGSA 1S7AA 4IX7A 2WAQA 4KA4A 4CA9A 2O14A 4AM3A 4UFHA 1FPQA 1W8ZA 1J83A 2K9QA 1UMIA 2FA5A 1YX5A 3U4SA 1EH6A 3I49A 5T52A 3QPHA 1R58A 3R0JA 4CU7A 4UYBA 2XDVA 5FPZA 1PGSA 5A32B 4RB2C 3BDDA 1MVQA 3CDHA 2A6HF 5IP7J 2OBPA 1YW7A 4DY5A 5AVAA 1PM4A 3ACIA 3RQ4A 1GNHA 3DPTA 3SZPA 5L73A 3ABTA 3FL7A 2JDAA 1R5GA 2LP0A 4D7YA 1DZTA 2C9AA 2P6HA 2H8WA 1ZARA 3SDBA 2XAGA 1IXCA 5GZFA 4OIOF 4JDNA 5K8SA 4N43A 2VKHA 1MMNA 4TN7A 5I0SA 1XG1A 2XH6A 2CHHA 4RAGA 5FXVA 2JB4A 5DZEA 2YSRA 1UU6A 1ZZBA 2O0OA 3RWKX 2CWMA 4MLOA 2A3XA 1RUG3 3DEMA 4XETA 3PL0A 3RKYA 2QQPA 1ZG1A 5AONA 5GZGA 5HXVA 1N1YA 2QQBA 2YPJA 1COV3 2KPMA 4AFBA 4LMYA 4RR3C 4ZS2A 4Q27A 3Q0VA 4AYBA 1BI3A 3F8MA 3WLUA 5JPNB 5IK8A 3F0CA 2J5PA 1DG6A 2WT2A 3IDAA 1XNCA 4A7KA 4C2UA 4ZZ8A 4QXHA 2IS2A 2XC7A 1HXS2 3OS0A 3ZFFC 5HLTA 4ES9A 3VEPA 1DGWX 4XOPA 3KPHA 1LDDA 5FKOA 5BNPC 3AKTA 2AEZA 2M45A 5K5QA 3W2VA 1SLCA 5FZ3A 2L7FP 4NN0A 2IXCA 2FU4A 4MO7A 4UB8C 4OIQF 4XLFA 4HL0A 1PMIA 2KFDA 3GZ6A 3MIFA 4I98B 1RHI3 2R3SA 4QX0A 4AD9A 1POV3 2KXLA 1W99A 3KZ4C 2VR4A 4AWXB 2HPMA 5C4WA 1ODDA 1JS9A 3D5OA 3POSA 3A03A 1DGLA 1ZR4A 3PO2J 4BY7J 2FBIA 1WFXA 2WYSA 2IC1A 2JG8A 2BBYA 4PCQA 1AYN1 4JHTA 2FNAA 2W47A 3POFA 1LHWA 5GLZA 3LA2A 4PJ0C 5GALA 3PSFA 3FIWA 4CPBA 2W25A 2FD8A 2C4XA 2JICA 3S3MA 4IPAA 4KIBA 1B8IA 4B47A 5JOXA 5L3EA 4AFAA 5ABJC 4ASMB 1JUMA 4NC8A 2XPWA 2M8EA 1YI9A 2E1MB 2TUNA 2D3RA 4XAAA 4YFXF 5FZCA 1Y1WJ 1QPMA 1X33A 1RUG1 3OD4A 3A01A 5FY7A 1R081 2D5FA 5FPBA 1LR5A 2A68F 2F5VA 3PIGA 1EH8A 4ITCA 4LUKA 1CJPA 1DQ4A 3GXOA 1LKNA 3PNTA 3TB0A 4E2GA 2DA6A 3G7DA 2NVTJ 1TLHB 2PLYA 4UFLA 4KU8A 2W1WA 2FNPA 1FSHA 5H9QA 2WAFA 2AXTC 1KXGA 4MGRA 4A7YA 3F6OA 1YQ8A 3AKQA 1XPWA 1MDMA 1ETVA 1GYKA 2WAOA 2YY1A 3MIHA 3ZX7A 3BI3A 3ST7A 5GZDA 3IT8A 3LCPA 3V42A 1XD7A 4R52A 3VWBA 1H4GA 4L0PA 3VKOA 1F5FA 1UWWA 2XVLA 1GVJA 3RGBA 1OC1A 1YRNB 3DEWA 4KIFA 5M5WJ 2JG8C 5F5QA 3WP3A 3F95A 3EYYA 1XSRA 1GLNA 4QXBA 4QB1A 4HVRA 2QM3A 3PJRA 2KP6A 1MQTC 2B42B 4NMIA 1GOGA 4QU1A 4QDSA 3CCQI 4A6DA 3I71A 5FFZA 3JR9A 1D8JA 4PDWC 3CLOA 1ETKA 5EP9A 3U1KA 1U9NA 5A1AA 1W6PB 5EHDA 4AE2A 4X1EA 1TP4A 5C5UA 1IZ3A 5ACA3 3PL8A 1D5VA 4JTOA 5A6XA 4PF1A 2DA4A 3C18A 3F8NA 2ET1A 1SLIA 1E0EA 4LE4A 3MKZA 1EAH3 3GCWA 1SFXA 1P6RA 3KYDB 1WGXA 4Q4X3 3I55I 1UY2A 2JG8B 4DXTA 3A0KA 3USUB 1XE7A 3BT9A 2XASA 2HNHA 1RUI2 5GJ6A 4KT5C 2V5YA 2VBPA 3SH3A 1RXGA 2E1MC 4MHUA 4LKDA 1KD7A 3SEZA 1SD5A 3Q0WA 1PMJX 4IXLA 3C8XA 3OIOA 2P0WA 4AAXA 2ZXWH 3BPXA 4RN5A 3EUHA 1V55H 2V73A 3T0BA 2WFPA 1ND2B 3AP9A 2ZJCA 1U5ZA 1CJDA 4XCBA 1HQLA 1B72A 4A3LJ 1ON2A 3CDIA 1CAUA 4DNCA 1Y3TA 2R7VA 4CUAA 4Y26A 1WLTA 3L2HA 5IAVA 2F5FA 4P9JA 1S5LC 3VKNA 2RS31 3H1WA 5FP9A 3ON7A 4ZDOA 5M5XJ 4A3BJ 5FY8A 2HWF2 2FBHA 1R9TJ 1BKZA 3MLLA 1LJ7A 2ZO4A 1CWPA 2WSVA 2UXXA 3PUSA 1QGLA 3VDDA 5KC6A 2V6EA 5DDJ3 2VQLA 1ETYA 1V5EA 2FXAA 3P6BA 4HDUA 2OA2A 1XTAA 5FYCA 3H9GA 2LRPA 4ENMA 3I2HA 3HPNA 3K4AA 5JCTA 3P5BA 1H8TC 4YW1A 2ZGKA 3FXKA 1ND3C 2WT0A 4DYQA 4I30A 4CCDA 2EV6A 2XGDA 3VBFC 4OUMA 1UF2C 4BQ4A 2VM9A 1UO9A 4LKFA 4FPYA 4M0HA 3AZVA 3IKTA 2QBXA 3HGGA 1W8TA 5KVRA 4A42A 4DUVA 2QTWB 3ZDVA 2WAEA 3FM3A 2G7UA 3FMQA 1OCZH 1YOVB 1TWFJ 1V6NA 1Y9QA 2V5DA 4NHJA 2WNUA 5JIAA 4CP0A 4YM1A 3QPSA 5EZHA 1KJLA 3LA7A 4A3IJ 4P1WA 2ARXA 4ZTJA 3S6PA 3W59A 4EN0A 2D93A 3K2AA 1UIJA 3WY6A 1MJBA 3TO7A 5FP3A 2XKOA 1WWXA 3LDKA 3SJMA 2D2WA 4XSZF 2NP0A 3K4DA 4PBOA 1OKOA 3HM5A 4JKLA 2IZWA 1X2NA 4A2UA 4RL7A 3OTFA 3OBZA 4LK6A 4MZUA 5FZ7A 4TZDA 3H9JA 4E7IA 1X50A 1UY4A 3MDPA 3RKWA 2VW1A 4HVQA 3FZ3A 5C7GA 5FLXZ 5A7QA 4M3DA 1DFQA 3OR1C 3ABUA 1YFHA 2XF7A 2WBKA 1GBGA 2PELA 3CC2I 5A2QK 3WTWC 3VYTB 1IGNA 4R8HA 4DQAA 4M4RA 3PVNA 5DZGA 2B7YA 1O7FA 4M3CF 1RUF3 2XJRA 5KHHA 1NKGA 4UFIA 4META 5DAXA 1W04A 1NA1C 3G1MA 3ZQ7A 1XE0A 3ZO0B 4AEDA 2OD5A 5D8AA 2LKPA 3K2OA 3WGGA 5E3MA 3BJ6A 2O9LA 2Y26A 4YW3A 2P37A 5BPIA 3LDBA 1RVF3 5ICEA 3OL3A 1VQMI 3LGRA 2HWD1 1J3QA 1AJKA 4X6AJ 1UKGA 2EIMH 3TWIA 2Z42A 3CQOA 4ASNA 3COAC 2TNFA 5DAPA 2QUOA 1H2KA 1TW3A 2E33A 2ARAA 2ZPXA 3MUY1 1Z7S1 2WZR1 1LFPA 4U2AA 3WODF 3M8LA 3IN9A 1ZGWA 4DZJA 3D8CA 4CDQC 3GJBA 1FIPA 2ETHA 5H20A 5CG8A 4Y22A 3WNNA 3E1F1 3RZMA 1W4MA 4QU2A 1BBT1 1PNGA 4JZRA 1W90A 4K40A 3ECQA 1Y8RB 1DLLA 1KQ9A 1RTVA 2ORXA 1MS1A 2VZSA 4H2AA 1AHDP 2OZJA 5FB2A 5JIUA 4XUPA 1FBQA 2DA2A 2RR13 1DYPA 1KFXL 2M0MA 2IRFG 3K4KA 4AIJA 2JWTA 2AHQA 2FDIA 3OYBA 2Q8DA 3KYLA 3S30A 3TP0A 1TZLA 4KU7A 2VC1A 2CUJA 5FKKA 3KETA 1MS4A 3IAM2 1JUHA 1IZ1A 4LO4B 3VYUB 3T3YA 3SLIA 5C3OA 2D3SA 4UW6A 3L2YA 2PMZA 2BRTA 3WTSC 5FZKA 2P17A 2KDZA 3C7JA 1RUF1 3HRUA 1IG3A 2P4EA 3GFJA 4S2DA 2XBO3 4HT1T 2Y30A 2VZVA 3RS6A 5C9AC 3VBFA 1O5UA 1R1A2 1UYZA 2KL4A 3AK0A 4DNYA 4XONA 1CAXA 3DF0A 4Q4Y1 4ZYEA 1D0YA 2I74A 4HK9A 3NW4A 2JDYA 3PMEA 3POIA 4FOVA 5K5RA 2OKXA 5BMZA 2R071 1H9GA 2VMGA 2Z99A 2K7LA 4ESFA 4YZ5A 2D43A 5CLSA 4YEJA 5LRRA 1IKPA 4AEDB 3CCEI 4QPOA 2XJQA 5A6YA 4IUGA 2X29A 3S32A 3I58A 4XORA 3RPQA 2RS32 1DU6A 1D0GA 2A6VA 2DUOA 4E2SA 4JX4A 4DW6A 5J40A 5FKMA 1GXPA 3CMGA 3CEWA 1T2XA 3IH3A 5F8PA 4DEQA 2V1NA 5DAQA 4IE6A 4P9UA 3DU5A 4FCYA 1XX5A 1YI7A 4CXWA 1WW6A 2QKLB 5E3NA 5FPXA 1M1EB 1FOWA 1I1GA 1IRFA 5JLXA 5GPAA 3BOQA 3EYIA 2DTYA 2HI3A 4B09A 1K5MC 3INAA 5A7SA 1XNTA 4RMNA 2DFBA 1JBCA 1U3EM 1LHNA 3MW2A 1A8MA 1H2NA 4LOTA 1HF0A 1GZCA 5B66C 2LS6A 5DPNA 4G6TB 2ETEA 4PI2A 2WV0A 2LVSA 2TCTA 3F3XA 4XICA 3I3EA 1QOSA 3VKLA 4XUQA 1DGRN 4OHYA 4ITVA 5SV8A 5F39A 1MBJA 1NLRA 1AR92 3C2GA 1CAVB 1ONVA 2DYSH 5F37A 4I01A 4LHNA 4CCLA 1ZR2A 4M3CB 3BG6A 2ZEXA 1K3IA 2G7HA 3PVEA 3BUCA 3H36A 4QB2A 4OHXA 4XE9A 3AKSA 4U7BA 1DQ6A 2LRDA 3CJTB 4QTRA 1LB2A 3ZQFA 5GPCA 2HWB2 3MBWA 1YXWA 4A44A 1PUEE 1K6OA 4AUXA 4ON0A 1DDNA 1VBD2 1OCOH 1MJAA 1H0MA 1QZEA 1T38A 4PJMA 2Y33A 3DKYA 2QBYB 3K9TA 1R22A 4HVOA 5GKAC 1V6KA 2HWC1 4A4AA 1MJ9A 3GX4X 4L0ZB 1GV5A 3ERMA 4FE7A 3TN91 4H7LA 2BW8A 3GALA 2WWUA 1LEBA 4ABZA 1E5RA 4GH4A 1OD3A 4QSHA 3M8EA 2DU9A 3CLPA 4A45A 4XLCA 1S2EA 5T50A 2HQAA 2H6CA 3B00A 1OPMA 4GD4A 3LOCA 1GOHA 5HDKA 1HRI2 4ARYA 3NNGA 1ZRIA 5APAA 4AYBN 1TWGJ 3I54A 4MFDA 5FYSA 1RUJ2 5I8SA 3WF0A 5FXWA 5I91A 1MDMB 1HRV3 4FX4A 4ZU4A 2DUPA 1YW8A 2HWVA 1SBEA 1UD1A 4CU9A 3RZGA 4DUWA 5HS9A 3HOZJ 3OD0A 2MW8A 1ETXA 1SMTA 1RUNA 1B9MA 4UF0B 4XTMA 1WJFA 4RBOA 2CW0F 1K5MA 2YU3A 1MIJA 2FEZA 2V6CA 2A6XA 3JTHA 2FDKA 5JLVA 5KAIC 2G0EA 3A23A 3KP7A 1J9IA 2NYXA 2M0CA 1RHI1 2B45X 3I4IA 2CQ7A 2X5IB 2HQRA 1OF4A 3OR2C 1DPRA 4CPBD 3SEPA 2VJ5A 4ONUA 5IVYA 2CY6A 1GV2A 3SKVA 2H0VA 3K48A 4ZH4F 5LATA 3CP8A 1GWMA 2UU8A 5JAXA 2BERA 1J5YA 1XGOA 3K4BA 3B7MA 3TRSB 5GP9A 4WXDA 1S7EA 1PO22 2PHDA 1OLQA 1RRJA 2DA1A 4ZPIA 4O3MA 1SD7A 1YQCA 2HEVF 1ACCA 2VQTA 3IIAA 5BPDA 3ZN6A 4FSJA 4DINB 3HQXA 4EVIA 1MMAA 5CFDC 1JHFA 1P4WA 3T0YA 1HCRA 4Y1YA 2FQ3A 4BLIA 4BL0B 4L9BA 3DFGA 3BCBA 3L2CA 1UYXA 3ZYFA 5J1RA 4QX2A 5HCHA 2GIVA 3J7ZI 2VE9A 3BC8A 4II2A 3L9FA 1W3VA 4HNVA 2FE3A 1RVF2 1ZLKA 3KGZA 3CCUI 1WVRA 3I2DA 2XRNA 1WW7A 1BBT2 2LY2A 1V6IA 4XDQA 1ND2A 3OSGA 1Z91A 1ENSA 4PT6A 5FK8A 1OR7A 1A6QA 3GO5A 3MLJA 5FLVA 3UKNA 4M0NA 2CV1A 4E7SA 2LLKA 4Q4V3 2OCEA 3U11A 3WTUC 4H7MA 2O8XA 5FZBA 4JRLA 4YM3A 2C24A 2E26A 3NAPB 3DLLF 2A6EF 1C0WA 4BPZA 1RUD3 1B9NA 2W24A 1JJ8C 3FXRA 1AR82 1WD4A 4XFGA 3F22A 3DTKA 4NQWB 2VULA 4CDWA 3OUIA 3TEYA 2ZJ2A 4LNVA 1D0XA 4P5YA 4ZC3A 4OLLA 3BR1A 1CF7A 3VBSA 1NCRC 2ZCWA 1O7LA 2RVAA 1OKRA 3VHRA 3JSOA 1COV2 2A07F 2BP6A 1MH3A 2DFEA 2NRAC 5FYBA 1QHDA 4A3CJ 3ZMOA 2WWSA 4XVHA 2XF6A 1HDKA 4L8QA 2MD0A 3MV11 3TEXA 2Z3YA 1WLDA 1GV9A 3FK6A 1IF1A 5C8CB 5AC92 3BALA 1LOAA 2W1QA 1ZBA2 1NLSA 1G59A 1G8WA 2KISA 2R7RA 1FT9A 5HLIA 4PLOA 1U0JA 2HWB1 3CESA 1XU1A 2WZ8A 4KMFA 2GNBA 4NIIA 4UT5A 4EJTA 5L7OB 2DLLA 2M30A 1NAEA 4BQNA 3ATGA 4UW3A 2ZABA 4HV6A 5FZ1A 1TT0A 3MN2A 1BK1A 3R4DB 4B3NA 1S8NA 2IGNA 4P9LA 2YFUA 3VZNA 3I5UA 2VTXJ 1IN6A 3KF3A 2N7GA 2ID3A 2NOGA 3NWTA 3L2WA 2IJLA 3MW3A 2DA3A 1J0RA 3KT1A 1GP4A 1O5LA 2Y6FA 4B29A 2VW2A 2RV8A 4XRFA 3F8BA 2XV4S 3A22A 3QBQA 4U36A 4YSFA 1GWKA 4CP2A 4NWWA 5IVVA 3GTQJ 3IM0A 4WXHA 2A70A 2D6NA 4D0PA 4DBQA 2L9VA 3OOPA 1R093 3OOXA 1T33A 3RRDA 3S17J 3FUOA 2BYVE 1ORKA 4F3JA 3ME2A 5LASA 3Q8BA 5KXCA 1YS7A 3GXUA 5JLWA 1S0DA 3CIHA 1XDUA 3LWCA 1G7YA 2K02A 3ZPYA 3NNMA 1H9TA 3GFIA 3B73A 1TQIA 5H2FC 5DUWA 1V6JA 5LGTA 3OYLA 1A04A 4KWJA 3H8XA 3ROUA 1TG7A 3WNLA 3IMNA 1TNSA 4PDWB 3N7LA 3VBUC 1GLHA 2QNKA 1BR2A 4ZYDA 2R042 1OFCX 3ONQA 3BZCA 4PFPA 3GF6A 3T2QA 1NA1B 4IV1B 1FTTA 2BHYA 4JVAA 3VKFC 2Y48A 3UGHA 2MEV1 4F93B 2AREA 3WHBA 3I2IA 3K75B 1UOBA 3SCFA 3RI9A 1HKTA 2WJSA 3MFAA 4HYEA 1E2XA 1JHHA 2HEYF 1J2XA 1Z05A 5B1AH 3BPVA 2QQOA 4LKEA 3LNQA 3FZVA 2HWF3 4AQ6A 1A5JA 3ILRA 4AQTA 4COZA 2VQUA 2MA3A 1C1LA 3CF2A 2FBEA 3JUUA 2WNVC 2FHRA 1A31A 3HQUA 4A3GJ 3I3MA 2OA4A 2WNVB 1RPWA 1ETWA 5C70A 5F04A 3QH6A 1WZXA 5LZ6A 5FKLA 4OIRF 3K2ZA 1NCRA 4F52A 4JRAA 2DVBA 2UV1A 1X8EA 4U7DA 1AOYA 3NWKA 4CH7A 5FUIA 1AYM2 4LIVA 3Q9OA 3C7GA 2HKXA 2OCCH 1T98A 3AG4H 5J4YA 1PGL2 4Z6YA 5E1WA 1S2BA 2ZEWA 4B43A 5DD4A 5B2GB 1W2AX 1VQPI 2LBFB 1F4HA 3EXUA 1JE8A 1RXFA 1BBT3 2UWMA 1UPSA 1UCXA 1AR81 2VUAA 1VQNI 1W5TA 1VBA1 2JPBA 2WAQN 2Q8OA 5KXBA 3G3ZA 2QVOA 3CF6E 4HSRA 1IPJA 5FOJB 4NHLA 5B1BH 2ZX2A 2WDBA 3BTXA 2AGSA 2EIDA 2Q8KA 3HUGA 5F9TA 4AQSA 2K86A 4Q8KA 3PJQA 3J7MA 3WG3A 3BQZA 2AC1A 2F6CA 4FPLA 4WM8C 5LBFA 2R7UA 2V4VA 1YLLA 1H6XA 3POEA 4P5OA 1LCLA 2W0XA 4IQJA 1O3RA 4IEUA 5EIYB 1VIWB 3HOVJ 2J1AA 4QQLA 2P81A 3JCUC 4QM9A 3J81Z 2E2JJ 3GNEA 5D8AB 4LHKA 2EFWA 3ESWB 5I0RA 3R0RA 4RQPA 4RR3B 4GKXA 5C9AA 2D5HA 1SLAA 1F5TA 2FQ4A 1BEV2 3J7AO 1GR3A 4QX7A 4RQPC 3R60A 1FY7A 2O1QA 4IV1C 2B8MA 3NVCA 3KP5A 5I8TA 2O8QA 2YFZA 5A7PA 4XIDA 3BZ6A 1YNAA 3N9OA 1VBD3 2L7KA 5K4LA 3HG9A 1TTYA 1MBKA 4NRQA 1KS5A 1D1BA 4HW0A 4NWVA 4ZU7A 2HVRA 1DUXC 3KVAA 3LB9A 3MIEA 2YGMA 1G3TA 4GB33 2IA1A 3WW3A 4Q4W3 1AR73 2K2SA 1GOFA 1R1A1 3E5XA 3GBWA 4N7UA 3VD3A 4AVCA 5IVEA 2QJVA 3WW4A 2PHTA 1ZQ3P 1VQ8I 3T0AA 2LKXA 4JQFA 4JGYA 2R92J 4J1WA 4HLYA 4D0QA 1LTEA 4ZONA 1VBA3 4WM8A 1AL22 3S5AA 3S3NA 5LHHA 3BWGA 1QJU1 1SDWA 1NT0A 4CZZA 1RUD1 4XCAA 4QPGA 1BXHA 3MICA 1TQPA 1LFUP 1BR1A 4WVVA 3QD6A 1W2TA 1IRZA 1OCRH 2OPTA 3O8GA 2YR2A 1SPPB 2XLAA 2W87A 2WSUA 2D6MA 4BCUA 2O3FA 1DGRA 2GXGA 1BVP1 4XQWA 2KZVA 5IAXA 4RHV1 4D5CA 4N90A 4BGDA 1UZ0A 2FJ1A 1HQNA 2QQKA 5FUNA 3HYIA 3U37A 4QX5A 4HG2A 2DCJA 4BU2A 2BOLA 4PUSA 1OOPB 5IVCA 1O4ZA 1ZHFA 4MADA 4EN6B 2B46X 5ICGA 3WP5A 1O3SA 1RKTA 4IHXA 4OI2A 1E3PA 2ZS6B 4WZFA 4N53B 3M07A 2MYSA 5E20A 2A3WA 4V2VA 3HGYA 1MNDA 3RTRA 3NAPC 3T09A 1ZREA 2YC2A 3O2PE 4D7NA 1HW2A 4BBSJ 2BVLA 3M3YJ 5J47A 1ZZ9A 2GXAA 3TDUC 1T6SA 2VGDA 1C5IA 1AL0G 1Z0XA 1POGA 4GH4C 4AFDA 3IH2A 3WTYC 2DQRA 2ZMEC 1BN5A 4Q1PA 3HTSB 5A80A 2AQFA 2JMWA 2XB5A 4KISA 1LOFA 2LROA 3M7GA 1X19A 2F6BA 2QDNA 5CAZA 4OHWA 1W1WE 3TN92 4BQQA 4QX1A 1XMXA 1C3HA 4X8NA 5EGOB 2CNAA 1T08B 1YJWI 3J7AY 1U5XA 1YFXA 1IS3A 3BJAA 3RMYA 2TRTA 1MS0A 1FOXA 5CPRB 4XRMA 3V7CA 2ME6A 1BCXA 1IG0A 4ZXKA 1MMDA 1IV8A 3QODA 1VQ4I 3OEBA 5F5IA 3SKJE 1CPNA 1QNWA 1YIFA 4B4RA 1N1VA 1VRH3 2BXYA 1W2OA 4K8FA 3ZCOA 4M71A 1YC61 2A7AA 1YHFA 2YPDA 1IDYA 1MZBA 3TP3A 5E18F 2BNNA 4M3FA 4E9KA 4IESA 3TEZA 4XFBA 3U1DA 2SBAA 2JA7J 3THPA 1RVF1 5CQEA 5EEHA 5J48A 5ANQA 1MBFA 3A2KA 1WCSA 3OOUA 1DDLA 3ZP5A 3OYCA 1SACA 3TNPB 1WA6X 2HYKA 2CU7A 1CQTA 2VPVA 2EIEA 2FBKA 3OYNA 1DLCA 1JYXA 4LULA 5JOWA 1FMWA