4I09A

Structure of the mutant catabolite gene activator protein v132l
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
204
structure length
204
Chain Sequence
PQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKLGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 58
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i09A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i09A01
1YFYA 1HXDA 5DDGA 1X8EA 3BOQA 3BPZA 4GULA 4QGNA 4LEJA 1FLIA 3K1MA 4IRGA 2JPBA 2KIMA 2JT1A 3IWZA 1GVJA 2D1HA 3E5XA 5ICFA 4A12A 3V7SA 3CJXA 4MGIE 2D45A 4M6XA 2XLGA 1ZG1A 1EY2A 3R60A 3BZ6A 3C1DA 3R0JA 5BOXA 2XLFA 1D8JA 1J3PA 2E9QA 4META 1OKRA 4HQEA 4XLPF 2B9UA 1YTYA 4MNUA 1YS7A 2XV4S 4R1HA 4OIOF 3E6BA 3R61A 4M6YA 2GU9A 2CO5A 5JSPA 3DEUA 1YO5C 3SXYA 3DXJF 2RQPA 3BJ6A 3ACLA 2Q2EA 1I1SA 2WTEA 3GYHX 2XIGA 1PDNC 4E2GA 2QQBA 4HZFA 2IXLA 1SD7A 4I0AA 3MCZA 4QWQA 2YPRA 1S6LA 3RYRA 3IDBB 3ZMDA 3V7RA 1H1IA 2EA7A 4MH0E 4RGRA 4RAYA 5A2QK 1V4RA 1I6XA 2GZWA 2VBYA 1BJAA 5FCCA 3HOTA 2IXHA 1XSVA 1G4DA 1NZCA 1FZPB 4G6DA 3TDZC 2VC1A 4Q5SF 1XSXA 3L2CA 1FY7A 2EFPA 5EFUA 2MH9A 1DPUA 4YFNF 3DPLC 2M30A 4KL1A 1ZN2A 3O3KA 2HWVA 4OMZA 3Q5FA 1YUDA 4KDPA 4KFCA 1HKQA 4D0PA 1FP2A 1L3LA 1DGWA 3CUQC 3J80Z 1W4MA 2O03A 3CEWA 1B59A 3NRVA 3EYIA 5BUVA 5H20A 1EH8A 2Q4SA 2HDCA 4P55A 1Q1HA 1B9NA 4MEYF 1P92A 3RPUA 1UB9A 4BHPA 3IIAA 5HI0A 3WW3A 3WE3A 2PTMA 3WODF 3WTZA 1O3RA 5BXXA 1LDDA 5FDBA 2AS5F 2RN7A 1CX4A 3FX3A 2Y48A 1BOAA 4IESA 4IHSA 1J5YA 4HQMA 4NVPA 1Z91A 2DU9A 1K78A 1BN5A 4KN7X 3C18A 3EBRA 4ZZDA 4KN4X 1LDKB 2VPVA 3QACA 3BWGA 5E17F 3GFMA 2W57A 2PEXA 2BE5F 1BI2A 3RZZA 1OD5A 3R6SA 3ZDSA 1D5VA 2JZYA 4QLCU 3TNQA 2QBYB 1IRFA 1KGSA 3S0MA 3GYDA 3FMRA 3LQRA 3IRRA 5I91A 4FT8A 5E1ZB 5KHIA 1T6SA 1PP7U 2XHKA 1XGNA 3O2PE 4M71A 1U12A 4Y17A 2HJIA 1K79A 1W7PB 2GQQA 4PGGA 5JR7B 1ZG3A 1I27A 3WW4A 2J5OA 5KHJA 1P2FA 2EAAA 3GBFA 3VEPA 5DCMA 1Q5OA 4IPAA 1X82A 4ONUA 5CYVA 4MGKE 3QP5A 3HT2A 5FFXA 3L00A 3HT1A 4ETSA 5FD6A 3DFGA 2Y75A 2Z5UA 3MAJA 1RI7A 4I98B 4I01A 3KZYA 5ICGA 2PA7A 3GZ5A 4MTEA 4RB2C 3EQLF 2XL9A 4IERA 4IEOA 1O7FA 1D8KA 2GA2A 3WG9A 3J80K 4A0YA 4RAZA 4NB5A 3CUQB 3I58A 5J7MA 2IPQX 1H1MA 4FBFA 2CQKA 2HS5A 3D0JA 3F6OA 2E7XA 4UUVA 2KKOA 4TLFA 2DLLA 2L01A 2BYVE 5L3EA 2FBHA 2ZMEB 3FHZA 5BQTA 3G3ZA 4ASNA 1IXSB 3EYYA 2E1NA 4RB3C 4EGZA 1OYYA 5AVPA 3W6KB 3MFKA 3FJSA 3RPQA 1UPIA 2HEOA 1UIJA 4EVIA 3MPBA 4QM9A 1ZRRA 3BB6A 2FQPA 5FPXA 2H6BA 4G9YA 3IBMA 3F23A 2QVOA 1YYVA 3CL1A 1CAVA 3MEXA 1RC6A 2QDRA 2Z33A 4UVCA 4YFXF 2XL7A 3M70A 4R52A 3H3UA 5C8WA 1Z9CA 1S7AA 4E70A 2YSRA 1J9IA 1S3JA 2CFXA 2PMHA 3H9AA 3H1YA 4U0YA 3OOPA 4CXFA 3JAMK 4YRDA 5K5QA 3H1MA 4DQ2A 5I8SA 1HSTA 3LWCA 1XCBA 3I71A 3QOPA 2KRFA 3SQNA 3FXRA 5K5OA 2DK8A 2HFHA 3RKWA 3V7CA 1IPKA 3S7EA 2GC0A 2FU4A 4A5NA 4OIRF 2QM3A 3M7GA 1YWKA 2V1XA 1KYZA 3ZN1A 5BMZA 4MGZE 2ATFA 1KU3A 1LJ9A 1QXJA 3I4PA 2O8QA 2FBKA 1SD6A 2RV8A 1G3SA 4LA2A 4BIFA 3BP8A 4M9XA 2V1UA 2HOEA 2LNBA 3RTRA 3WTSC 4CO8A 4HW0A 5LEJA 2NNYA 1P4AA 1LRHA 3WTWC 3U0ZA 4KYWA 4U7DA 4JK1X 2VBXA 4ESJA 1RZ4A 4L18B 1OI6A 4UVBA 5LGTA 2G7UA 1I1GA 5BY5A 1ODDA 2Z9OA 3HOSA 1XGOA 4GXOA 3MZHA 3M8FA 4EMSA 3F22A 2EV0A 1RUNA 4ENMA 4PZJA 4ZU5A 2FMYA 3PQJA 2ZXJA 4AWXB 3ZMVA 2BV6A 1B9MA 2ETHA 4L5JA 3CO7C 4HV5A 1XGSA 3WTYC 2EV5A 4JQFA 4NHJA 1T98A 1RIOH 3ULQB 2DPDA 1K78B 1WA4A 1LNWA 2L54A 1OR7A 1FBUA 3CJNA 4L0ZB 3GUDA 4WXHA 3LOIA 1O4TA 3HHGA 3KP5A 3CO6C 1V70A 1ZX5A 3QU6A 4EGYA 1X8MA 4BHCA 2GC1A 5AIQA 1K7AA 2IXCA 5FQ0A 1ZLKA 3WW1A 1I5ZA 3BPVA 1GQHA 2O8XA 2VODA 1HW5A 2XKOA 1ZZCA 1SD4A 3QU3A 2MA3A 1FYLA 2EA2A 4HX8A 1R23A 5LRRA 3EQEA 1UHMA 4LD5A 1EH6A 3GX4X 1RTVA 4I09A 4IVNA 4S04A 4XFFA 2CG4A 1KQ8A 2F5FA 1ZRCA 4HAMA 1YG2A 4A0ZA 1NXMA 2FF4A 2D5HA 3H50A 1QWRA 1Z7UA 4XSXF 3ES4A 2D5FA 2XAFA 4OOIA 1CAVB 2JTVA 5FLHA 3USSA 4UVAA 2QVSB 3CUOA 1ZRFA 1L3JA 5I8YA 3KEOA 4RB1A 2MHFA 4BHBA 3FZVA 3K0LA 1BC7C 1VJ2A 5E8IA 4KIGA 3HUGA 3IHUA 3TGNA 5K8SA 1ON1A 1IW7F 4MZUA 3F8NA 5D5XB 2IP2A 5DUKA 2HTJA 4ZYHA 3I54A 4TV7A 4XLNF 3U2RA 3FWEA 4PIZA 2ESNA 4GO1A 1UD1A 1IUYA 1Y3TA 3KGLA 4KWLA 5J6XA 2NNNA 5JFRA 3IRQA 3RJPA 5DV5A 1O5LA 3ERED 3C7JA 2L3DA 3LAJA 3LAPA 1ZAOA 1U5TA 2QBYA 3BALA 4LG0B 1YIOA 4FX0A 1P4WA 1UCXA 2XRNA 3BDDA 1IN7A 3L2HA 5E8GA 5FLIA 3BY6A 4D7TA 2GXBA 2ZCWA 3O14A 1O3TA 2PQ8A 4KNYA 5CU1A 2NRAC 3EHKA 1REPC 2ZNYA 2X0LA 1CAWB 4KIBA 5JSRA 4HMZA 1YS6A 4EJOA 2ESHA 4UBHA 5HS8A 2VBZA 4OFGA 2IRFG 1T0FA 2VE8A 4RS8A 1R1UA 3U11A 1B1BA 5L3CA 1R5GA 3D82A 4ZYGA 2H0VA 3KP2A 5H6RA 2DTRA 4HN1A 4KWKA 4M73A 2FEZA 1YQAA 4HDUA 2FNAA 1LB2A 1Y9QA 2P5LC 1JHHA 4HSJA 2FNPA 2QZ8A 3L09A 1XE7A 1ZZ7A 2B8MA 2LF8A 5BPDA 4QXKA 4AVCA 1RNLA 4EJVA 2DFIA 1QO0D 2BNOA 4PGHA 3S2WA 4OMYA 2MH2A 4L9VA 3RYKA 2ETEA 3TKYA 2CYYA 4EJWA 3OF1A 4ZH4F 2FBIA 4IEYA 3ZMSA 2FSWA 5D8LB 3ZMUA 1MKMA 1MJAA 4LMYA 1SFEA 2K4JA 3SMHA 1XDUA 3H1WA 4CDGA 4JTOA 3EJKA 3GXOA 5J8CA 2VT2A 5ICEA 2STWA 1BIBA 2W85A 1WKMA 4IF4A 3IKVA 3WGGA 4B8XA 4JTNA 4AIKA 4LB6B 3Q9SA 3U10A 5HDGA 3COAC 4HOBA 2F5DA 1R00A 4E2SA 1QGPA 5FGMA 2LSOA 2RDPA 2NS0A 3FXUA 2IXJA 2L02A 2KXLA 4ENJA 3HSRA 1CAWA 2CGPA 2PLYA 3N4MA 5CADA 3DN7A 3BROA 2Y0MA 5I8TA 1HSJA 1Z6TA 3KCCA 2IXKA 1IN4A 3M9AA 3GO5A 4IRHA 5JHUA 3V8KA 2ZKZA 1H9TA 2M45A 1ZZ8A 2XLAA 4AXOA 4L9NA 4D7SA 2R3SA 2Z2SB 3SCHA 2DT5A 5CVJA 1IAWA 1IN5A 1IN8A 3CLPA 4J1WA 4KMFA 1FSHA 1EPZA 2EFOA 3TQNA 1ULYA 2O1QA 4YIFA 4KA4A 4B29A 4HX4A 3P9IA 3JW4A 1YW8A 2XAQA 3HRTA 2EFQA 3P9CA 4NQWA 2EA4A 1B4AA 3GFLA 1ZHFA 2R7DA 1FC3A 1FBQA 3F72A 4AIJA 4LJZF 4HV6A 1ZZ9A 2PAKA 3F8CA 3FMSA 4EWDA 3U9GA 1GQGA 4Q0QA 1TLHB 1ZG5A 3IWFA 5FLXK 2E1CA 3V8JA 2W24A 1FX7A 4J1XA 4Q47A 1XRUA 2DI3A 1KQ9A 4KMUX 2EVXA 5EEGA 4YFKF 2QENA 1LVAA 4Q0SA 2HR3A 1ZZBA 1OYIA 3MQ0A 1OFNA 2D93A 4XFGA 3NQOA 3WGHA 1J58A 1TW2A 2EJRA 2MD5A 1NHAA 5F64A 5I0SA 2DAOA 2P17A 1ZARA 2M87A 1QY4A 4M74A 3KGZA 4WZCA 1Y0UA 3PFIA 2UWMA 1YHFA 4CZZA 1ZNPA 1UCRA 3JAMZ 2WWYA 5J3UA 3FZ3A 4WBBA 2GA1A 3DQVC 4LLOA 3TO6A 4KIFA 2V09A 3H3ZA 1F9NA 4L9TA 1JHFA 3W6JB 3VODA 4LA3A 4L0YB 3DV8A 2P6TA 1WI9A 4M9ZA 3GW2A 2OPKA 3TOBA 4WK8F 3KEQA 1BI0A 2P7VB 4DNCA 2ZMEA 4EV0A 3LA3A 1ONVA 3I59B 4YSFA 4XSZF 5E20A 4LULA 4PIXA 5ILSA 5I0UA 1F5TA 2RNJA 1ON2A 2QCSB 1RUOA 2FRHA 5CVVA 3WU1B 3PLQA 5DYMA 3IC7A 2XVCA 4IEQA 4L11A 2QUFA 1J3QA 1RGSA 2IJLA 4IEUA 4FHTA 5TRDA 1EH7A 5JR3A 5K1YA 4XFCA 2WV0A 1U6GA 1OYWA 3RYPA 3WU0A 4IXAA 2O6GE 1Z05A 1KU7A 5KBFA 2DBBA 3E6MA 2A69F 5LHGA 3FE5A 4MQVA 1IRGA 3J81K 1J2XA 1NE4A 2OZJA 2K86A 3LWFA 1T2KA 2L4MA 3K1PA 3DF8A 2UYAA 2H94A 3WTTC 1UFMA 1TNTA 3EO6A 5A2QZ 4AQ2A 2PQQA 5ERIA 3I64A 1FWZA 1QPMA 3REOA 4LGWA 2LDUA 1TQPA 2H6CA 3UKNA 2PBIA 1PUEE 4G94A 4Q48A 1R1TA 4CYDA 1O3QA 1TNSA 2GC2A 4IEPA 4G7OF 2VONA 3G73A 4BH9A 2BNNA 4N0BA 3FM3A 1ZRDA 2BNMA 3ZMZA 2Q0AA 2A3SA 5D5UB 2RC4A 1IPJA 4B09A 1MJBA 2HKOA 2F5CA 4ENKA 3VOEA 4UBGA 5K5RA 1P6RA 2BEOA 3T8RA 1CAUA 1A04A 5D5WB 4CGZA 3KLNA 2COMA 2DQLA 4UV9A 5IT9K 1T39A 4XEZA 1DPRA 4XF1A 2P7CB 1J59A 2I45A 2XUBA 3P9KA 1DZRA 3FM5A 4LTAA 1J1LA 1RL3A 4FAHA 4IJAA 2PHLA 1FPQA 1WGPA 3TDUC 2KIFA 4I2OA 1DDNA 2IT0A 4ESBA 3GFIA 4AVAA 2EWNA 3B73A 2A68F 2WFPA 5D8KB 2OZUA 4Q0VA 2V1DA 2K9ZA 5TJJA 3FXQA 2BGCA 1LKNA 2PHDA 1MGTA 3I7DA 4WVZA 3OTFA 2GWRA 2LF7A 2OQRA 3HTUA 2IA0A 1XCVA 2HYGD 2JPCA 3LA7A 1SFUA 3PVBB 1YLFA 4KWJA 5DD8A 2VQAA 3KSCA 4XRFA 4HLYA 3VHRA 2Z3YA 1UIKA 5HDNA 4R8HA 1YW7A 2FMLA 4LB5A 2M8EA 4I02A 5E1RA 1SFXA 1LEBA 2AXLA 2Z69A 4XF0A 4LUKA 3PNAA 4N9HA 3SHFA 1R1VA 1FYMA 5EEHA 2DK5A 1U3EM 5HVQC 4Q29A 1V3FA 4MX3A 3M3IA 4BXUA 2XAHA 3NJZA 5ILUA 1JGSA 5D1IA 5EZWA 2D1VA 1O5UA 5FLXZ 1J75A 1U5TB 1Q3EA 5HS9A 1WWXA 3E97A 1YFWA 4LLGF 3HIFA 5E1XA 2H27A 3F21A 1IF1A 2GH2A 5LHHA 4IEZA 2FOKA 5JI6A 4XF3A 1XE8A 5HLHA 1TQ5A 1F4KA 1HKSA 5KK1A 2A07F 1CF7A 2XAGA 1KYWA 2VECA 2EFNA 4ZYEA 4LK0F 2HQNA 1TQIA 2RGVA 4UXNA 1YFXA 1GXQA 4MTDA 2JRTA 2OBPA 2ZKLA 1LDJA 1R5HA 5IT9Z 5CLSA 3KZZA 3J81Z 3F6VA 3R0AA 2VOOA 3HQXA 4M72A 2ZFWA 2YX4A 3S7IA 1H9GA 4XFHA 5ED4A 3KETA 4Q0UA 4HF2A 4HBLA 5I0TA 3K9TA 2HQRA 1YW9A 4K2EA 5AIPA 3IKTA 3E6DA 2MC3A 1O3SA 2QNKA 3LFKA 1OPCA 3WW2A 1R58A 2ZBKA 5KVRA 1YFHA 4RGXA 2FE3A 4AVPA 2PI0A 2CWEA 2O61A 4A0XA 1PMIA 3KE2A 4HLXA 3WTXC 1GXPA 1K6OA 1XSDA 4Q4ZF 4EROA 2Y0OA 1SEFA 2PJPA 3JSPA 2C0ZA 2J5PA 3CF6E 2NAZA 3OCPA 5D6EA 5KHGA 1BI3A 4HYEA 3OV8A 1FBSA 5L3FA 2ISZA 4P5OA 5I93A 4KICA 2A61A 1G3TA 5CVRA 4QGLA 3WE2A 2M1BA 3KP4A 4Y15A 3J7AO 2XGXA 3LA2A 3M8EA 1X3UA 3ST7A 3ZQ7A 4UXAA 3DKWA 1JE8A 4WF2A 3KLOA 1PM7A 2EV6A 5LRSA 1EYBA 2QQ9A 3GVAA 2OU2A 1ZGJA 3KP6A 2CSOA 3NKTA 4K8FA 1J3RA 4EM1A 3QPHA 5LGNA 2VXZA 3LSTA 4ZYDA 3CO2A 5F6FA 2NYXA 2FA5A 1LEAA 3L7WA 5D4SA 4L9JA 5BPXA 2GAUA 2HTSA 3GZ6A 4AQ6A 2PYTA 4LG0A 4MUVA 5E18F 4GCVA 2Q1ZB 3FFQA 3TO9A 2V6CA 1TBXA 3DPTA 5L3GA 2XASA 4MEXF 1E17A 3FHIB 3T1BA 4PIYA 1WQ2A 5J8FA 2OD5A 2MLGA 3CUQA 2LKPA 1SAXA 2PFWA 1O57A 5HLGA 1FYKA 3DP7A 4ZZLA 4G7HF 3NW4A 1Q43A 2XKPA 1F1ZA 5DEQA 3HSFA 3O6BB 2K02A 5KHKA 3SCGA 2P6SA 4HX7A 1QZZA 2VOPA 2OZ6A 2N7GA 3GWZA 4HN0A 3QPTA 2IA1A 3ECHA 1XDSA 2ISYA 4O9EA 4AIHA 3RI4A 1MZBA 4A2UA 2YU3A 2A5YB 2GIVA 1D3YA 4IEXA 3E5UA 1EP0A 1DZTA 4O6JA 4LLNA 1FSEA 1W5SA 5CJ9A 1JUHA 5JCTA 3HRSA 1W5TA 4ON0A 3K1NA 2IXIA 1SMTA 1E2XA 4E2QA 4LUMA 4RD7A 3VB2A 3VFZA 1P4XA 2UY8A 4XBFA 1BI1A 2W84A 2D2WA 2PG4A 2P5VA 4X6RB 2WC2A 2K7LA 5D4RA 1YFUA 3F8FA 4UHTA 5L3DA 4Z2YA 1VR3A 2V79A 4KU7A 2VC0A 5DCMB 4Z07A 5L3BA 3WTUC 1TQMA 1AWCA 1ZLJA 4EWAA 5BPIA 1MDMA 2KIUA 3JSOA 3G7DA 4DINB 1C0WA 2K27A 3RKXA 3OD0A 4RGSA 1U8RA 4HSLA 2TDXA 4P9FA 3BJOA 2EB7A 1TW3A 4XFBA 2Z99A 3HTSB 1WRJA 3IL2A 2G7HA 5LBQA 3T0YA 2MLKA 1XMKA 2IVMA 4H0EA 1FOKA 3MWMA 4QMAA 1KU9A 4LFUA 3FF5A 4OIPF 4FAGA 2MNGA 4LLLA 2QQAA 3JTGA 3EDPA 4P96A 1W7PA 2ET1A 4G7ZF 4HDVA 1FT9A 4I7HA 3MZYA 4L2NA 4ORFA 5FQ0B 2UXNA 1X7NA 4M9SA 4AVBA 3E5QA 3K69A 5FFZA 3SXWA 4IRIA 1SFNA 5KHHA 1STZA 3Q9VA 3DL3A 4P9UA 4U7BA 1EV7A 2Q0OA 1HKTA 4FX4A 3L9FA 3E3VA 4BQAA 2OYZA 4GYGA 4A5MA 2R7FA 1IN6A 3N97A 3UKTA 1DUXC 3ES1A 2P4WA 4YG2F 1KU2A 3D5LA 1BIAA 3CLOA 2BBYA 1KA8A 4YARA 3UKVA 3MYXA 2UZKA 4WCGA 3ROUA 2ZNZA 3CTAA 5HDKA 1H0MA 4AD9A 2EK5A 4EJTA 4S05A 1WSUA 3HSEA 3ABUA 2B0LA 2CW0F 4XF4A 4HA8A 1QXRA 3QAHA 5LLQA 2VT3A 3LQQA 1CF7B 5LGUA 2D40A 3WGIA 4QGMA 4IHTA 1Z1DA 2ADUA 3HHHA 1ZH5A 5E16A 1HW2A 4KU8A 3WTVC 5FD5A 1FI2A 2OA2A 4LK1F 1QNTA 4ZU7A 4UV8A 4Q0PA 4CHUA 1S7OA 5F1RA 1OMIA 1U5TC 5BV6A 3I59A 3RKYA 1U2WA 4MGRA 2CAVA 3TO7A 2DPUA 1BM9A 4O9GA 3F8BA 1VTNC 4MQ9F 2IC1A 5HLIA 4JBAA 3GFJA 3KP7A 2X4HA 1UHWA 1IZ1A 5ICCA 1W7PD 3ZN0A 1XMAA 5DUIA 2IW5A 3OGJA 1BC8C 1SMYF 2QJVA 5E1WA 2RVCA 2ZO4A 1S29A 3JTHA 4YYOA 2OQGA 2HKXA 4RGUA 1ZVFA 4PJYA 3E6CC 4U0VA 3QP6A 4GGGA 5FPZA 3H7YA 4WXDA 5I0RA 4EQQA 4PCQA 1G3YA 1MD0A 4JV4A 1WLTA 2IA2A 2Q8KA 4X6QB 4RB0A 1NE6A 3ZP5A 5FO5A 3HRMA 1R7JA 4G8XA 5JVTA 1QQIA 1R36A 5J48A 3H7JA 4U0WA 3H92A 1CGPA 4ENNA 1CAXA 5IT3A 3SZTA 5BS6A 2VBWA 1VP6A 3FMQA 1R22A 3RIRA 5LEKA 1FP1D 4HF1A 3T5XA 5D6FA 1CAXB 4WWCA 5DCFA 2Q30A 5ILVA 3NVCA 2DW4A 5H6QA 2ET7A 2P8TA 1IXCA 1XD7A 3HYIA 4OINF 3V8LA 5CVIA 4KUMA 1FXZA 2UYBA 3B02A 1ZGAA 3KFWX 1S8NA 1J0RA 1L0OC 3H8UA 2K4BA 4BAYA 2L4AA 3U1DA 1J7KA 2DCTA 5AONA 1O7LA 1FNNA 3SZPA 1DGRA 3I5UA 1BBYA 3ETQA 2O0YA 3RDIA 5JSOA 4HVOA 1G3WA 1Z6RA 3BCWA 4ESFA 5LHIA 1SQ4A 2ELHA 4HVRA 2C6YA 3AAFA 1JXSA 2A6HF 4CICA 2PFBA 2M5WA 4QM8A 1T38A 2MPFA 3PQKA 4GYIA 4F7ZA 3ZMTA 1CAUB 3SFZA 3SHRA 4I3PA 4EJUA 2YR2A 3D0SA 2F4PA 1SD5A 3NEUA 3F3XA 4EWEA 4WX9A 4G6QA 2FXAA 3HRUA 2YX7A 3CDHA 4OLLA 2A6EF 4KT5C 2V9VA 4R79A 2F5EA 3ISPA 2DQRA 4YIIA 1DP7P 1U78A 1USTA 3LZZA 1ZZ6A 1KQ0A 2FQ3A 4H7LA 3K2ZA 1B6AA 5T3NA 3NL1A 4YNIA 2KJBA 3KMHA 4UNOA 3JZVA 2CV6A 1ZYRF 4XFAA 4HVQA 4BNCA 2DO7A 1XN7A 1PP8F 3RNSA 2W25A 3BJAA 5CVUA 1XB4A 1MDMB 3LAGA 3I53A 4MGYE 5FLJA 4QX5A 2HZTA 2RKHA 4XETA 2VE9A 2XAJA 5HOOA 3GEZA 3M1EA 4HBNA 3EUHA 1TTYA 2STTA 3ML6A 1IXRC 3ELKA 3TNPB 3ABTA 4L5IA 3BU7A 4HF0A 3SCFA 1HBXG 3GLXA 2EFWA 2UY9A 5C6CA 4HLTA 4EM2A 2G9WA 2MBFA 1QBJA 4OIQF 2PAEA 1HW1A 3I0TA 2OAZA 3ECOA 4WXCA 4XF9A 3R4KA 6PAXA 5HS7A 4Y13A 4IEWA 2PAMA 4MHGA 2XROA 5D5VB 1GHCA 2P5KA 4IEVA 2KJCA 4BYYA 1QZYA 5JAXA 3BPXA 1HQCA 4MV2A 3V4GA 2CAUA 3T8TA 1LQ1A 4IETA 2GC3A 4PDKA 4F8AA 4JVAA 4A6DA 4XFIA 4I0BA 2PMUA 3NSTA 2GXGA 1USSA 2F2EA 2VN2A 2O3FA 1G6NA 4N9IA 3ELNA 2JSCA 3EETA 2PN6A 4EM0B 1ZREA 2E7WA 2H09A 1YLLA 1MJ9A 2QWWA 4O3MA 2HYFA 5FB2A 4Z82A 2QYOA 2K0GA 3ZPLA 2OA4A 3C3WA 1NYWA 3IDCB 2B5HA 3TOAA 1XGMA 3P7NA 2QLZA 4OU0A 1UW8A 3QRFF 3F8MA 4A6EA 4P9GA 2HGCA 5DD4A 3MDPA 3GF2A 2ACJA 1AOYA 4O5VA 2UXXA 2ZJ2A 3C3VA 3KP3A 1LR5A 4ZU4A 4U88A
chains in the Genus database with same CATH superfamily
2DTWA 1X8EA 3BOQA 3IM0A 4GULA 3I2GA 1NZIA 4IRGA 2JPBA 1XX5A 3H0OA 2DT7B 3E5XA 4BJTA 1H2MA 5ICFA 3V7SA 1R1A1 3ZYIB 2XLGA 1HDDC 2RREA 3C1DA 2WFF1 3R0JA 4RA0A 3JBG1 5BOXA 3NMBA 1J3PA 1VQ4I 4GALA 3VBRB 1VIWB 1OCTC 3O0VA 3DWLE 3HKZN 4R1HA 1GU3A 1NAEA 1OPOA 3P5JA 3E6BA 4L9BA 5A33A 2NPIA 4YVSA 3DEUA 1PM4A 5FY7A 1A35A 2MG4A 3DXJF 4PJJA 1PDNC 3C8XA 2WAFA 4JP0A 2IXLA 4E7IA 3VBFB 1CVNA 2YPRA 3K4NA 3GTJJ 3LF7A 5FY4A 5FY1A 3V7RA 1MBHA 1W2AX 2HPMA 4MH0E 2AUYA 4RGRA 4TLGA 1AL0G 3QYEA 4RAYA 3MIEA 4V2GA 3AYEA 1V4RA 2QQUA 3QLQA 2GZWA 1IS3A 3HOZJ 4ISRA 1A6IA 1BJAA 5CFDC 3HOTA 2IXHA 1G4DA 2R0HA 1NZCA 4G6DA 1JJ6C 3TDZC 2VC1A 4Q5SF 1RUI1 4P00B 5A3MA 3L2CA 1RVF1 1FY7A 2LFBA 5EFUA 2MH9A 3AKQA 2K9LA 3VDDB 2VULA 4FPLA 3PO2J 4IE5A 2HWVA 3OS1A 4QX3A 4D0PA 2QE3A 3APBA 3CC2I 1FP2A 1DGWA 2NVQJ 1JYIA 1B59A 2VJ5A 5EYXA 3NRVA 4PI0A 3R4UA 4FISA 3HBLA 5FZFA 1Y9MA 1IPSA 5C3OA 2HDCA 4P55A 4BBSJ 3RPUA 1L7LA 9ANTA 1UB9A 1NCQB 2WRAA 4XAEA 3WODF 2VQHA 2TBVA 1N3OA 4XIOA 2F6CA 4LIUA 2RN7A 2VJ4A 2RR13 1CJPA 1YI9A 2HI3A 1TWGJ 1IDZA 1W6QA 1OLMA 5EWSA 4NVPA 1Z91A 1N3PA 1K78A 2E5NA 2JA6J 4LKEA 3AJZA 4XORA 1ETYA 3AP9A 5GKAC 2WNUA 4BA6A 3S93A 3DECA 5FO8B 3QACA 1SVOA 3BWGA 1BA5A 5E17F 2RS52 2PEXA 1FEXA 2YMZA 2BE5F 1RIRA 4CDXC 3RS6A 2R7XA 2F48A 4N53C 2EINH 1PVC3 4LO7A 4HSTA 2JG8A 1KGSA 3S0MA 2KDOA 1GUUA 4W6WA 5I91A 3S30A 1PP7U 5SV8A 3OYWA 2CQQA 1VQLI 4RGKA 2P5BA 4DRRA 4ZDPA 5ACA3 1ZG3A 2XJQA 4DW6A 3PIPF 2EAAA 3OPTA 3GLLA 3GBFA 4IPAA 3ERMA 5CYVA 4JKKA 2VY0A 4W4ZA 3HT1A 3KM5A 4E7KA 3GCXA 1D0GA 1PK6B 2Y75A 1FTZA 5FP7A 1RI7A 1T2XA 5ICGA 1DLCA 2QSFX 1HB1A 4YIRX 3VBSB 3PL8A 4IUGA 5F6LB 4IEOA 3WX5A 3WG9A 4ITCA 1ND3A 5C44J 1RJ8A 5EV7A 2LKXA 4XBQA 5CKQA 3I58A 1F5FA 4MVTA 2EZLA 2LROA 4FBFA 3H5NA 2DODA 3OYGA 3D0JA 4OZXA 2E7XA 4XZUG 3DEMA 4RS5B 4ZJZA 4J00A 2IZWA 1I50J 2KKOA 5F7UA 1A6CA 1HJGA 2L01A 2BYVE 2RE9A 4IE6A 1QHDA 4AI8A 4NBQA 5L3EA 2FBHA 2WZ8A 5M5XJ 3FHZA 5BQTA 4ASNA 3EYYA 4RB3C 5DDJ3 1OYYA 3VDAA 1QZEA 5LY2A 2V6EA 4FQZA 3RPQA 2DJNA 2JB4A 2HEOA 4R9CA 4EVIA 3UL2A 1ZRRA 1P7IA 5CEHA 4KI5M 4G9YA 3IBMA 2RS33 3F23A 5EJ3A 2QVOA 1CAVA 2CHHA 1MPXA 5FO7B 5T5JA 4EN0A 4UVCA 3ZFFB 4M3EA 4D8MA 4R52A 1W6NA 3U1KA 3NWKA 3ME2A 2CFXA 2FQ4A 3HJEA 4QB6A 2EXJA 2V5DA 3H9AA 1GR3A 1ZYBA 2HYXA 3LSIA 3OOPA 2W1UA 2VW1A 3NV2A 3L2VA 4IV1B 4F52A 1B8IB 1AR92 5F8PA 1R4NB 4UFKA 3T30A 1W06A 2A71A 2D6MA 4XKVA 4AYUA 3USUB 1XB9A 5J47A 2WZEA 4Z2AA 2ZX3A 2BWCA 3V7CA 2NYYA 4JCKA 4BQYA 3BU0A 2FU4A 4CEWB 2RS13 3ECQA 4LO4B 3OUHA 4XOTA 2A75A 4II2A 4BQ2A 5EGOB 3ZN1A 1H8TB 2FDGA 4MGZE 2ZGQA 3NNLA 3AKRA 4FXGB 2AC1A 4KG8A 3KEYA 2RV8A 1POV3 1G3SA 3BP8A 1ERDA 2YU9J 2LNBA 3RTRA 5JI7A 3WTSC 1MNMC 2VOVA 3KCXA 4HW0A 3AL5A 2VZQA 1HXS2 3I2OA 5FWEA 2A6WA 2VBXA 1G2HA 2Y31A 2BWAA 1OI6A 2IS6A 4YGBA 5LGTA 1YITI 4HG6B 2ARCA 1ODDA 3HOSA 3BTYA 3MZHA 1GANA 2NQYA 4D3WA 2LY1A 5BNNB 4ZS3A 1H9WA 4GH4A 4E27A 4PZJA 1HQLA 1BYHA 3KT7A 4ZU5A 1BMV1 2ETHA 1UHSA 4RR3B 3CO7C 4HV5A 4UW3A 3WTYC 1UKGA 3OUJA 1QKQA 1C5HA 1BCXA 4OI1A 5IVCA 3I97A 5DAWA 2PHWA 3CJNA 3GUDA 4WXHA 4KNCA 2JE9A 4FPHA 1ZX5A 4EGYA 3POJA 1R9TJ 2QKLB 1I5ZA 1APNA 4E7JA 2O8XA 1RUG2 2ZJQF 1HW5A 4GMP1 3LSRA 2WZR3 1QJU2 4YGCA 1YJLA 3JQWA 1FYLA 1OQYA 5FYIA 1R23A 3GTQJ 1TP4A 3JRIA 5FY8A 2FDJA 1UHMA 4Y5TA 3W58A 4I09A 4XFFA 1KQ8A 4II3A 1ZRCA 4HAMA 1BJZA 1XSQA 5A7PA 1YG2A 4A0ZA 1AJOA 5DG2A 2A73B 5JZGA 2NOJB 1Z7UA 3GF6A 2YXSA 4XSXF 1WJDA 5M3FJ 4YGDA 3ZXJA 3USSA 4UVAA 4XLCA 5J37A 2QVSB 1RUC3 3MIBA 1QDCA 2C4XA 2ES3A 2ZZJA 1NK2P 4HFSA 1ACCA 1PVC2 3TEYA 3FZVA 3D6EA 1GZWA 4KIGA 4UB6C 5EJ1B 1HV0A 1ON1A 4MZUA 4YWAA 3SITA 2YHJA 3JD71 3GGLA 2RVAA 4D6SA 2G4IA 1DF0A 2W1SA 3ZXDA 1CZSA 1JOBA 3IRQA 4B47A 3TEDA 2PELA 1MVEA 3LAJA 3LAPA 1ZAOA 1U5TA 3BALA 4LG0B 4PLNA 1UAIA 1YIOA 4DXTA 3A21A 3MO4A 1PUFA 1BKZA 1QU3A 2DFFA 2XRNA 2P3IA 4FI9A 1W5CC 4K1ZA 1IN7A 4NC6A 4XICA 3GTGJ 2G0EA 4AAXA 2YBKA 2BFUL 3HOYJ 5CU1A 1UKRA 1HB2A 3EHKA 2ZNYA 1ZBA1 3BKZA 2X0LA 1CAWB 4KIBA 1SLTA 4UBHA 3ZFGB 1OLME 1WKYA 3F9KA 1H2NA 3UJOA 4XUTA 1DZQA 1XXNA 4CDUC 1B1BA 3C2BA 4ATEA 1YQ6A 4AVZA 3LDRA 5L3CA 5A80A 1R5GA 4A3XA 4CPBA 2JXAA 3PMEA 5GALA 3GZAA 4KWKA 1K61A 4FP3A 3ZYJB 3FBMA 1RINA 3L09A 3B01A 5HV4A 4B8EA 4RM2A 4AVCA 4GH4B 3MVPA 2I74A 2VO5A 1QO0D 4HKOA 4N8MA 5A6QA 4PGHA 3S2WA 1UZCA 2BV4A 2DJIA 2ETEA 2L0KA 4WVMA 4URTA 3IH4A 2VZTA 4OQ9A 2LP0A 2DFEA 4ZH4F 2GNMA 3ZMSA 3I2IA 5D8LB 3RZDJ 2E34A 3VBRC 1QF3A 1MJAA 4EZ4A 2K4JA 2HBTA 3SMHA 4RLQA 5CQEA 1XDUA 1VQPI 2W2IA 4AZZA 3TMOA 2L9VA 4C8DA 1BIBA 1ENHA 3M8JA 2W85A 4IF4A 3T0DA 1OXCA 1Z78A 4B8XA 2ZX2A 5IAVA 2JEMA 1VBB2 4YW6A 3U10A 3COAC 4W65A 1W99A 5FGMA 3OEAA 1VE0A 3WNPA 1ACIA 5F9TA 2R7VA 2L02A 5JOZA 4XN3A 2P6HA 4ENJA 3HSRA 1W3XA 5CADA 4YZ4A 3BROA 1STMA 1Z6TA 3KCCA 4H14A 4OHXA 3GO5A 4IRHA 1Z0HA 5JHUA 1D4M2 2M45A 2XLAA 4AXOA 3ZXKA 4X8NA 2JICA 1BVVA 5JVVA 2W0XA 1IN8A 4J1WA 4KMFA 1EPZA 5KXDA 3TQNA 4Y5SA 1ULYA 4JQTA 2P81A 2O1QA 1UY4A 3S8PA 4MHRA 4Y22A 2RR12 1YW8A 4UFIA 2RV9A 4NQWA 4H3WA 2R7DA 3I3MA 1PUFB 5FZIA 1DP0A 3BIWE 4LJZF 1RXFA 2PAKA 1UMZA 1ZG5A 5FLXK 2IVJA 1LOBA 2ECCA 2VUJA 1G7YA 2W24A 1JU4A 1RMU1 2ZGLA 3LQCA 3MF6A 4A4AA 2BBVA 1XRUA 2JWPA 4KMUX 4BQOA 1YC61 4NMIA 1G9DA 2XPVA 5DQ0A 1PMHX 3OYHA 3UKGA 1TW2A 3ORJA 4A6OA 3DCFA 5F64A 4GMP0 2FCTA 2DAOA 1QY4A 3KGZA 4CCCA 2LH9A 2BW8A 3THPA 1IG3A 2DTYA 4M4PA 1TWAJ 4WBBA 2GA1A 3MIHA 1ULDA 3TO6A 1HRV3 4JRAA 2ZJRF 4PBOA 2DN0A 3AG1H 4AW7A 3VODA 2A1XA 4LA3A 3CCYA 2X53S 1KGYA 2P6TA 1U5ZA 1ENRA 2OPKA 4M6VA 3C7EA 1XYOA 4WK8F 3K3OA 1MW7A 1BI0A 4DNCA 3DTKA 2FHRA 4YSFA 5LZ6A 4XSZF 2XJTA 4LULA 5I0UA 2RNJA 1JTXA 1RUJ1 1ON2A 2V7FA 2QCSB 5CVVA 1UAAA 4FPYA 3ZIXA 3ZSLA 4PBPA 2Z79A 4QSHA 1VALA 4GJZA 1BEV2 1B35A 1U6GA 1XU2A 1Q8SA 1GP5A 4QPGC 2FZ1A 3S1QJ 2YU2A 1ZK8A 5IATA 5FMCA 2L2OA 3J81K 5J4YA 3AMMA 1YQ5A 2C6SA 5HNFA 3PIJA 2L4MA 3MMYB 2NVYJ 2J22A 3WQ1A 2IFWA 1ETWA 3EO6A 4Q4Y3 3A03A 1ASJ1 3T09A 3I64A 3REOA 2ID4A 5F5AA 3SLIA 2QQNA 1TQPA 3O0XA 1ZBA3 5FYUA 2KP6A 4OMCA 1R1TA 4CYDA 4BQNA 1TNSA 2ZAHA 3N9OA 5FAXA 4Z92B 1KJRA 4OI2A 3G73A 4BH9A 5IP7J 3P1IA 1YIJI 1NCRB 1AZDA 5D5UB 2RC4A 1IPJA 4NN0A 5G04L 3HB9A 1JHJA 2GNTA 2E7TA 4F93B 5LB6A 4ENKA 4QX2A 3VSKA 1P6RA 4YW2A 5CB7A 1A04A 4I76A 1Y39A 5L73A 4UV9A 2W82A 2UUZA 2KZVA 2ECBA 1XBFA 3RPUD 1LFBA 3SFIA 1HLVA 3P3PA 1HA8A 3OYCA 1XS9A 3FM5A 4LTAA 1RL3A 2PHLA 1WGPA 1FPQA 1Q8OA 3TDUC 1AR63 4A3MJ 4P08A 3K4KA 2DA6A 2JA8J 4AVAA 3FXLA 3B73A 2WFPA 2WAQN 2D5VA 1RJ7A 5CNAA 5TJJA 2BGCA 4A69C 1LKNA 2PHDA 1MBGA 3PHMA 3N9NA 4AM3A 2OQRA 3HTUA 2WAOA 2JUCA 1XCVA 2RS53 1R6RA 1ETQA 4DYCA 3DEEA 2CDPA 1NX9A 2VTXJ 1C1FA 2HVSA 2WY7Q 1D4M3 4XRFA 4LHNA 1LFPA 4Y20A 4PJNA 5HDNA 1FPN3 5FZDA 3BTJA 1YW7A 1K12A 4LB5A 3IAS2 2B39A 1LEBA 2BRTA 1DGRN 2V72A 5EEHA 5ANQA 5HVQC 1TWCJ 1TG7A 2VQTA 3NJZA 2XAHA 1ZBE2 5KNLA 2ME6A 2DU1A 3ZQCA 4PDWA 2ZACA 1QA6A 2XJPA 2D1VA 2HNHA 1FIPA 5FZ0A 5FLXZ 5BNNC 1J75A 2LVSA 1WWXA 2IGMA 4LLGF 4LBQB 2H27A 5K7HA 1MZ5A 5FZ1A 3BUCA 2GH2A 5LHHA 2O8KA 2QQKA 1XE8A 4FOWA 5FV3A 5KK1A 4QDSA 1AYN2 4FQGA 2XAGA 5KR7A 2E71A 5FP9A 2GALA 3GXUA 4IV3A 1TC3C 2VECA 5JLXA 4JZRA 3DUIA 3AX4A 1MZFA 1TQIA 2XVKA 2W47A 3ZLIA 3F6VA 3BYWA 5SV5A 4RLFA 1F4HA 3AC0A 2ZFWA 5FY0A 3S7IA 3AVSA 4XFHA 1HV1A 5ED4A 2MEV2 5FYVA 3KETA 4Q0UA 2R1BA 4K2EA 1HRV2 1LHNA 3FLPA 2AEYA 4FP2A 1OPCA 2J42A 3WW2A 5KVRA 1MMAA 4M3FA 4RGXA 3NNFA 4NAOA 2HOAA 4Q4W3 2FE3A 2RDQA 2FCUA 4AVPA 3IH2A 3TB0A 2CWEA 3L2UA 4A0XA 4HLXA 1GXPA 4NAMA 1XSDA 1ZR4A 4Q4ZF 2PJPA 1LE8A 2C0ZA 3OEBA 1RUG3 5FMOS 1GZCA 3WDUA 3WNMA 3JBG2 5D6EA 1BI3A 2OTJI 2YY1A 4HYEA 1U9NA 2KM2A 3AZXA 2QQLA 3FDYA 4P5OA 5LA0A 3HEIA 1W0OA 2A61A 5FZ9A 1W2NA 1BW5A 5JPNB 1T8IA 5CVRA 5AC92 2R7QA 3KP4A 2WO3A 2XGXA 3LA2A 2NVUB 3I3LA 2ID6A 3KLOA 3C2GA 2EV6A 2VOKA 1EYBA 3D4KA 2OU2A 4BQ1A 4ATFA 1O6UA 1NT0A 2OPTA 2CSOA 3NKTA 2GDFA 4EM1A 2R062 2PXJA 2VXZA 4QPOA 1GNYA 1W03A 3A0NA 1RUF2 5F6FA 3LB9A 2NYXA 1LEAA 3RQIA 1A78A 3CHXA 1OFCX 2KLOA 3S14J 2RMU3 4AQ6A 2PYTA 5E18F 2Z16A 4NDLA 3FFQA 1X1BA 2K2SA 2RMU1 4CEYC 3DPTA 2YUSA 2DCKA 4AHYA 3PUSA 3SEEA 3HKZA 3B9IA 3O1MA 2BTVC 5DDJ2 3A2KA 2MLGA 4AWDA 3CCEI 3CUQA 2JA7J 2D98A 3MFCA 4XQ4A 2NS7A 4IHWA 3W5NA 1VBA3 4EN6B 1SAXA 5HLGA 4CU7A 2X6YA 1EV12 2X05A 4FE4A 4A42A 1IG0A 1O8SA 5DEQA 2V73A 2VUAA 2EXKA 5FUIA 3NAPC 1H8TC 2JG8C 2N7GA 1HLCA 4HN0A 3QPTA 1I9RA 3F2ZA 1OUXA 2ICWG 4A3ZA 1MZBA 5ANNA 2YU3A 2GIVA 1MMSA 4IEXA 1EP0A 1DZTA 4LLNA 1GOHA 1FSEA 1WBLA 1R1A2 2OIIA 1RUC1 2CGOA 3BR6A 3HRSA 3GJBA 3CJTB 1WJEA 1LOEA 1W6MA 4ON0A 2HWE1 2XPUA 3ZGKA 4E2QA 2FDHA 4LUMA 3VFZA 4WZFA 5ERLA 2VQGA 4RAGA 3BR3A 1EUTA 1Z3XA 1BI1A 2OF7A 1ND2A 3KQRA 2PG4A 2D2WA 2P5VA 2EIDA 1W0PA 1ZBE1 3PJYA 4S2DA 2WO7A 3F8FA 2RM23 4Z2YA 2ZKNA 3WHCA 4ASMB 3K75B 2VASA 5BPIA 2E7AA 2VOWA 3JSOA 4BEHB 2HQ5A 4DINB 1C0WA 5FP4A 4NIGA 1OBNA 2ZBJA 4Y1UA 2YU1A 3L2RA 3BJOA 3OGSA 3FUQA 3JR9A 3HUGB 3VKOA 4XFBA 4GWIA 3HTSB 1WRJA 5FRNA 2Y8KA 5LBQA 1UJ8A 1WH7A 2MLKA 2B45X 3ZR5A 4NC7A 1BBT2 5IAXA 4H0EA 1F36A 5IFTA 1KU9A 4LFUA 4FAGA 2XBO2 4Q4V1 2R92J 2ET1A 3WNOA 4D7NA 4I7HA 4CUCA 3MZYA 2EZKA 2Y6LA 1RUJ2 3VBUB 4BZ4A 4M9SA 3CQZJ 2ORZA 5D2AA 1OCRH 4HKLA 3WG3A 3EPZA 4K3UA 3LSMA 4U7BA 4EN9B 2Q0OA 1KRIA 4BGDA 4FX4A 5CAZA 3L9FA 3E3VA 4E7HA 1LVKA 4GXLA 4ZXEA 2VBPA 3WNKA 3N97A 4KBZA 1GFF2 2P4WA 3ZOBA 1BIAA 2BBYA 2L9NA 4RA2A 1R1A3 1K6YA 2PLV2 2YC4A 3OYAA 1KFUL 5D21A 2DYSH 3CTAA 2EK5A 4ISQA 1UQXA 1LOFA 2R7TA 4S0HB 2JDPA 4AVVA 1PX3A 2R071 4HA8A 1QXRA 1RUI2 1VB4A 3MW2A 2OCCH 1S7EA 1Z1DA 2VMCA 1JHNA 3AMHA 1IRZA 3OBRA 2EXIA 4FSJA 1FI2A 4LK1F 3Q0VA 4ZU7A 4UV8A 4CDWC 1X19A 3MKLA 3JREA 1BLZA 2VUDA 1U2WA 4MGRA 3KV4A 1W0NA 4O9GA 4COZA 1RRJA 3MUZ1 3KF3A 2F17A 1OPMA 2ZGMA 1ZQ3P 4P1WA 1IZ1A 3RJ2X 3ZN0A 1O4YA 4QT6A 3OGJA 2W91A 3GDBA 1JKRC 3MD2A 1C4RA 3J7NA 3HR9A 1LNSA 3K3NA 2OC6A 3QYBA 2OXBA 4MXVA 2QJVA 2RVCA 2LLKA 3JTHA 1MS9A 2OQGA 1QJZA 2HKXA 2W9XA 2H0BA 1R71A 3VL8A 3E6CC 4KWUA 4GGGA 5FPZA 4WXDA 1M06G 4BK5A 2FOWA 3SNMA 4RB0A 5IVVA 5FO5A 2JA2A 3JRGA 2E7QA 5FUPA 5FREA 3H7JA 5H9QA 3H92A 3VKFC 4GH4C 4XN0A 3HGYA 1CAXA 4UW4A 1TEIA 4FOVA 4FETA 4NRPA 1BOBA 3FMQA 1VQ5I 3V56A 1VQ6I 5LEKA 1FP1D 4CCMA 1CAXB 5D6FA 3DF0A 3GHNA 5F37A 1CONA 2ZXHA 5H6QA 1IXCA 2V5YA 2ZEZA 3HYIA 4OINF 3WP4A 4IZZA 4BXSV 3JD73 3KD4A 5IVJA 4AIDA 2UYBA 4QPQA 3B02A 2TUNA 1PZ7A 3KFWX 1DBNA 1WW6A 1S8NA 1J0RA 3H8UA 1RMU2 2K4BA 4BAYA 3U1DA 3H9JA 2DCTA 3I9V2 3H8OA 3SZPA 2MD0A 4B3AA 4MO3M 1BBYA 1Y56A 1G3WA 3V65A 1SQ4A 3BZKA 5FR3A 2C6YA 1W6QB 3MW4A 1JXSA 3OBTA 5CISA 4G4FA 5F5IA 3PQKA 5C5TA 1MS0A 4F7ZA 3ACGA 3SEQA 5FZ7A 3NWSA 3SFZA 2RM22 3IT8A 3SHRA 2F4PA 1SD5A 4BQ5A 3B69A 4EWEA 4WX9A 5CZKA 1GICA 4Y5Z0 4LO6B 5JOWA 3ISPA 4YIIA 1QVTA 1E5RA 5A3OA 3T2TA 2R93J 1W9SA 1CWPA 1F8VA 4G6TB 2DYRH 1JUPA 3NL1A 4URAA 3OY8B 3H0GJ 2D43A 4GA9A 3KMHA 4B1MA 4R4ZA 4EATA 4QIWN 1G86A 4UNOA 4YZ1A 3JBG3 2WS91 1GWKA 1YO8A 1RUD1 5T5LA 5CVUA 1MDMB 5J1XA 4PQ9A 3ZFGA 1PNGA 5FLJA 4AF9A 3U1XA 5FZGA 2BVLA 2JDNA 2VE9A 2ORXA 2BUKA 2R49A 5HOOA 4UT5A 2NVXJ 1RR7A 3D5SC 4BXFA 3ML6A 1UZZA 3B7MA 3RMYA 4IOCF 4L5IA 4KMQA 3BU7A 2MFZA 4CRQA 4NIDA 3FBIB 4HXCA 2CV0A 1V55H 2EFWA 1MACA 1COV1 4HLTA 1X4OA 5IVBA 1BBT3 2PAEA 3I0TA 2OAZA 2PLV3 3ECOA 3LSEA 3R4KA 1QJEA 3OJBA 5HS7A 4NRMA 3PTYA 2J1UA 4DOZA 4MHGA 4FQ4A 4CDQB 4ZZ5A 3K4DA 4P5HA 4NOTA 1IJWC 1WJAA 3ZXSA 3BPXA 1DCSA 1W9WA 4FPCA 2QUOA 2RDRA 2EIJH 4IETA 1EA3A 4E8DA 4FXKB 2NZ9A 4JVAA 5BNQA 1V9U1 3NSTA 4IGQA 1USSA 4Y4RA 3SEPA 1W36C 3BG6A 1Z77A 5GM0A 2F2EA 4CZCA 2O3FA 4N9IA 2E7WA 1MJ9A 1JZ7A 3AKPA 2LM3A 2QWWA 4YW1A 2WQZC 3L2YA 4IGOA 2HYFA 4JDMA 4Z82A 1JZ5A 4DXRA 1JUSA 3SKVA 2H8WA 1CN1A 5JIAA 1S72I 1XGMA 3V0BA 2ME0A 4NROA 4DUXA 4RHV2 1BEV3 3F8MA 4A6EA 3AP6A 4P9GA 2M34A 4A7KA 4BY1J 3BQZA 2RS12 1AF9A 4B1RA 3C3VA 3N7MA 3KP3A 1H30A 2DXIA 4B7EA 4ZU4A 3THTA 4W1UA 1YFYA 1HXDA 1OD3A 3KCYA 3BPZA 4XOPA 1K5JA 2OKXA 4LEJA 3QPSA 2JT1A 2KR2A 3VPRA 3CJXA 5FROA 4I30A 4MGIE 4M3CA 4Q4X3 1W0UA 3B6AA 1WCKA 3R60A 1EAH3 4V19K 5B4NA 1UG0A 2XLFA 1OKQA 3WG4A 4XLPF 5LA1A 1P7JA 2WL1A 4OIOF 2CUFA 2EIBA 3R61A 4M6YA 4S2HA 3AP5A 1MMDA 4IEJA 1D7PM 2A7AA 3SXYA 4UI9L 2RQPA 4LLFA 3ACLA 2Q2EA 3C2HA 3GYHX 4DUVA 2XIGA 3O8GA 3POSA 3G1LA 1SD7A 5K4LA 5GZFA 1S6LA 3MICA 3IDBB 3ZMDA 1XC6A 2EA7A 1JTYA 3KVBA 1W8HA 1ZBE3 3CESA 4HPKA 4PHZA 4CCEA 2ILMA 2VBYA 1WFXA 2WA3A 4XTPA 3WEZA 4LXLA 3ZIWA 5C3QA 2X10A 4UFHA 3DPLC 3ZN6B 4M3CB 1MBKA 1W28A 5A3PA 4HK8A 4KDPA 2R5ZA 3H42B 3CUQC 3MI8A 5LA9A 1UY0A 5BUVA 1NCRC 5K7FA 5C4XJ 2W87A 1P92A 1SLCA 1SANA 3QPLA 1FAYA 2CU7A 5EG0A 3OWTA 4LBQD 1DQ4A 5HI0A 3W3CA 1PO12 3WW3A 4OHYA 2PTMA 4A3KJ 2QQVA 5BXXA 1LDDA 3M3CA 2IUWA 1BOAA 2PN5A 1J5YA 2VKEA 4HQMA 3ZO0B 1FMD3 1WA6X 3C7OA 2A6ZA 2ZTNA 1BN5A 1EJ9A 2RR11 4KN7X 1H6XA 2P6CA 1UMIA 3LSDA 4WM7A 5CG8A 5CFCC 4AHZA 5JWPA 3WP3A 4GWMA 1H0BA 3X29B 4C30A 1BI2A 1WJ5A 2ADEA 1QHGA 3UESA 3MW3A 3LDBA 2R063 3N05A 3ABKH 1X33A 4QD2A 1IRFA 1R092 4Q4X2 2ELKA 3GYDA 5L36A 3LQRA 3H9GA 1AX1A 5E1ZB 4YELA 5GTHC 5KHIA 1ULGA 1COV2 3KZ4C 2FDFA 2ZSIB 4JYKA 1K79A 3AFGA 1C28A 1W7PB 1B72B 3T4HB 4PGGA 3CD6I 1I27A 2KZGA 2J5OA 5BNOB 4LO5B 1F35A 1L7QA 3VEPA 1JZ6A 3J7HA 4MGKE 5FZOB 3QP5A 1N75A 4GWJA 1W39A 2YC0A 4LQRA 2VU9A 2DDAA 3Q8FA 3DFGA 1WD4A 1PK6C 4I98B 3IAPA 5EP9A 2PA7A 3GZ5A 4PK4A 2LG4A 3IN9A 4BLIA 1IDYA 4MTEA 4RB2C 1UZWA 3ZXEA 1YRZA 1UPSA 4A3IJ 2B9VA 1F15A 3OIQA 1VMJA 3CUQB 5L9VA 5J7MA 2IPQX 1H1MA 1K4SA 1OHFA 2CQKA 4HEA2 1XQNA 3FC0A 2M7BA 2ID3A 3F6OA 1KS5A 3OGVA 1W8TA 3TEWA 3KVAA 3VZOA 1S2BA 5EIYB 1VBE1 3MBWA 4Y4YA 2JB8A 2B9SA 3ILNA 1LODA 3CQOA 4QM9A 4YM3A 1NG6A 5FRAA 1WLCA 1XOYA 2H6BA 3BCAA 3WF1A 5BNOA 3CL1A 3NNGA 5GLTA 3RWKX 4Q1RA 3MEXA 4TN7A 1MH3A 4XHBA 4XLAA 4YFXF 3M70A 2VNGA 2ENRA 4HRIA 4E70A 1NCQA 4F83A 3B93A 2QBXA 2XB6C 4B48A 3LSGA 5J36A 2F4IA 1NQDA 3ZFEB 2HWF3 3I4MJ 2PQSA 4AI3A 1MH4A 1HSTA 1Y0NA 3K4CA 1XCBA 4AL9A 1SAUA 3QOPA 1QH6A 3A23A 3SQNA 3FXRA 2HWE3 2WNEA 4LR4A 2DCZA 3RKWA 1IPKA 5FZMA 2Y6KA 4A5NA 2XQRA 4QKNA 1SDWA 3VLBB 5FZKA 1YWKA 1WHUA 1UX7A 2C24A 3LFMA 1KU3A 2OUJA 1T95A 4HONA 3JD72 4PJ0C 1QXJA 3I4PA 4A6SA 2WS93 4LA2A 4LK7A 4M9XA 2VH9A 2QKMB 1VFCA 3WF4A 4RQPB 2P2KA 1SVLA 4Y52J 1VB2A 2NNYA 3WTWC 3FKIJ 3AL0B 3U0ZA 4OUMA 2CRGA 4U7DA 4JK1X 2XRLA 1RZ4A 2Y69H 4ESJA 2I8DA 1QOTA 4UVBA 1ZBA2 2B7YA 1I1GA 5BY5A 2Z9OA 3UGGA 1PO21 1PO13 1B72A 5FMOL 4ENMA 1ULPA 1AL22 3OR2C 1OUSA 3ZMVA 2BV6A 2R4GA 4L5JA 5DS9A 4NHJA 1T98A 1RIOH 3ULQB 1GNHA 4B1LA 2DPDA 5A7SA 1LNWA 1JI8A 2Q1FA 2L54A 1FBUA 4L0ZB 4ES8A 4K21A 4YW7A 3VBOB 1X9PA 3AZWA 3LOIA 2OS2A 3HHGA 3CO6C 4ZTFA 1V70A 3QU6A 4BHCA 2MW8A 1K7AA 2IXCA 2ZMLA 3WW1A 5FQ0A 3I4NJ 1KONA 1RPWA 1ZZCA 5C70A 2ZHNA 3J8F1 1OC1A 3KX2A 3QU3A 2CQ7A 3THDA 2MA3A 2X5IB 4TSVA 1UZYA 4TZDA 3W21A 3EQEA 3HNMA 3PNYA 3GX4X 1RTVA 4IVNA 5F39A 2CG4A 1ND2B 1XNTA 3QODA 2RG4A 3SQOA 2FF4A 5E79C 3H50A 3K4BA 1YX3A 3ES4A 3T2QA 1CAVB 2JTVA 1IS5A 3FHAA 1OH4A 3A0HC 2K9NA 3CUOA 1ZRFA 3A02A 1L3JA 5I8YA 1VI0A 3KYDB 3MKZA 1WW5A 3KEOA 2MHFA 1T0FC 3AYCA 4BHBA 4N7UA 3PFYA 1IV6A 3K0LA 1VJ2A 5E8IA 3TN92 2VIXA 1R081 3IHUA 3TGNA 2G9FA 1K4TA 1IW7F 1XC5A 4NNJA 3ZYRA 3I54A 4XLNF 5TGTA 3L2QA 3BT9A 4XIDA 1IS6A 4PIZA 2MGQA 3DLLF 4Y3OA 3SZGA 5GZEA 1UD1A 4KWLA 4GZ9A 2ZSHB 5JFRA 2UURA 5IUQA 1RITA 2X1EA 4QB2A 3ERED 4Q4W1 3C7JA 2QBYA 5C33A 4A3LJ 2X5IA 2FX0A 3MIFA 4M3CE 3I2JA 3BODA 2XR4A 4P9JA 5E8GA 4O7XA 1OCCH 2ZCWA 1VF9A 3O14A 3KLSA 1O3TA 2PQ8A 4LKSA 1V5FA 3AKSA 1DYOA 2VQCA 2GBYA 2WB1A 3DTIA 2BOJA 2JJ6A 5EHDA 5JSRA 1YS6A 1U9OA 4NUBA 5HS8A 4QU2A 1MEC2 2YDEA 2YBPA 3HOBA 2VE8A 3NAUA 4RS8A 5HXMA 2CW7A 1ULFA 1UMQA 3J8F3 2A3YA 1I39A 1O91A 2OPWA 3ZXGA 1FJLA 5C3RA 4NO4A 1DDLA 2H0VA 4BACA 2DTRA 4M73A 1YQAA 1LB2A 1MS5A 3HZJA 1JHHA 2VXDA 3BTIA 4HSJA 2KPMA 1ZZ7A 5CFDB 2PHXA 2LF8A 5BPDA 1FX5A 1RUD2 4QXKA 2ZEXA 3ENRA 5A32B 4CXXA 4LE3A 2W68A 1Z7LA 3FLRA 4L9VA 4XVHA 3RYKA 1MQTA 5DZEA 4EJWA 4XJ8A 1F9KA 1W6OA 1MS3A 4QU1A 1SLIA 2C9KA 1WLWA 2FSWA 1N3QA 3ILRA 1LE8B 1MKMA 1H2KA 3MV01 3VWBA 1SFEA 1AXYA 5FYCA 3WG7H 5DM7F 4YW3A 5JVGF 3H1WA 3PVNA 1OA3A 1X1AA 3DBRB 3EJKA 4JKLA 2VT2A 2FDKA 5ICEA 4HT1T 3POBA 1I3HA 1OR7C 1ZA4A 1OOPC 3WGGA 4XKCA 1W8FA 5E6HA 4ZXKA 2WO2A 1FTTA 2YFUA 3UNPA 3Q9SA 1IZ3A 4DMIA 4SLIA 4D6QA 5I0DA 2LALA 1REDA 3EUKL 4CSWA 3Q9OA 1CESA 1R00A 2NS0A 1JUMA 1NH3A 1G9BA 2QZ3A 2PLYA 5FMBA 2AHQA 5A3LA 3HWJA 4MYEA 5ABJC 1HXS3 5EJZB 1ETXA 4XMYA 1Y9GA 3ACFA 3N9LA 3LPGA 4WV8A 4B4CA 3EXUA 3V8KA 2Q2EB 1H9TA 4L9NA 2Z2SB 3SCHA 1AKHB 1SFYA 1UZ0A 2HWC3 4XC9A 3CZJA 4MOAA 5JLWA 3GZEA 4HX4A 1BK0A 4FTHA 4DEVA 3P9IA 2PHTA 2DVBA 3ACIA 3VZJA 2VM9A 4UW5A 2W7NA 2E53A 1FBQA 2EILH 3F72A 4AIJA 2VBBA 4CCOA 4HV6A 4RFRB 3FMSA 4EWDA 1GQGA 3IWFA 4B43A 4BJ5C 4YVSC 2G1MA 5F2SA 2DV9A 4ZS2A 1BR1A 4Q0SA 4YM1A 3POGA 1OYIA 2RJKA 1OFNA 1J58A 1K45A 1IRXA 4MSVA 2MD5A 5DAPA 5FZBA 3HAGA 3BVCA 3NKGA 2P17A 3NJVA 4LBMA 3D5RC 1ZARA 2M87A 5LK5A 1YIPA 4WZCA 2BVBA 3PFIA 4E7ZA 2E2IJ 1YHFA 4CZZA 4K7JA 3VZNA 1WW4A 1UCRA 1PGL1 3CJIA 5IJRA 1K3IA 3NJYA 5F27A 1RUH3 3FZ3A 2ZGKA 1OH3A 4BM8A 3H3ZA 1F9NA 4YPJA 3SISA 3QH7A 1KJLA 4L0YB 5JDBA 3M07A 5DTDA 3B3QE 3ILFA 3POIA 4FO9A 1V6NA 3O5SA 3VBRA 1PK6A 1KS4A 4AFDA 3TOBA 1ONVA 5DUWA 1QJU3 3VBOA 2XB5A 2XF5A 5E88A 1VQKI 4QQPA 5ILSA 1LOCA 2FRHA 3WU1B 4XL9A 2CW8A 3I2FA 2XVCA 1VBD2 4IEQA 3VBHB 1R091 1UNBA 1J3QA 1RGSA 2IJLA 4NPRA 5TRDA 1EH7A 1YCIA 2O9LA 2WV0A 1X2NA 1OYWA 3WU0A 1KDMA 5A6ZA 5FZAA 1Z05A 1KU7A 1G8WA 2GOXB 3K77A 4QX8A 3FBYA 3FE5A 1JZ4A 3HN1A 3MN2A 3ZSJA 3K1PA 4UFMA 2H94A 5LK7B 1BR2A 3K70D 1PGSA 2JKXA 4AQ2A 5LD2C 1OCOH 3ETPA 1FATA 5ERIA 3I3DA 1FWZA 2VLAA 1QPMA 1H8TA 2WZPP 3NARA 1ULEA 4W50A 3W20A 5CPRB 2PBIA 4K1YA 5DDJ1 4G94A 3INAA 3W5MA 1V6LA 3VUOA 2GC2A 1B35B 3JCIA 1GSLA 4MXWB 3VHPA 3WOGA 2R041 2CUJA 3K10A 5IVYA 4BIOA 3A01B 2BNNA 2DUPA 1ZRDA 2BNMA 5FZ4A 3ZMZA 4BMEA 3Q0WA 4B09A 3JUUA 1MJBA 5LFAA 2WSUA 3U4SA 2I5UA 3VOEA 2WT2A 2K46A 4K20A 2BEOA 3T8RA 1CAUA 1Z7S2 2PHUA 4IHYA 3RZLA 3KLNA 3IZOA 3WCRA 2COMA 3I55I 2BY3A 5IT9K 1T39A 1XNDA 2ZGSA 1KD7A 2D97A 1QOSA 2ZX0A 1JZ8A 2KMUA 5FZ8A 3HJRA 1J1LA 4C2UA 3AZYA 1OVSA 4D5FA 4BEHA 1QMJA 3IAM2 3N9MA 4A93J 3M3EA 4PI2A 4MGQA 1ZKGA 2A5WA 2OZUA 2V1DA 4L8QA 3FXQA 1MGTA 1IHMA 3CCQI 3OTFA 2ARXA 1TWFJ 3OMYA 3W2AA 2LF7A 5LA2A 1XE0A 4NIIA 4DGWB 2JPCA 1TMF2 4LBQA 4IOAF 1D2SA 3D1NI 5DD8A 3WUDA 1UIKA 4WM7B 4LJHA 3VL9A 4R8HA 1YRNA 4J01A 4R9BA 2DWRA 1DIWA 3HEFA 1UOBA 1SFXA 2WJSA 3CMGA 2Z69A 3TP0A 4N9HA 1R1VA 1FYMA 4O65A 1U3EM 1QQP1 5T50A 3GALA 3I3BA 5JZGB 1HJFA 4Y22B 1POGA 2WUHA 5EZWA 4Q2FA 1R4MB 3GZTB 3N7LA 5JXJA 1O5UA 3BIEA 1Q3EA 5FPUA 4XHXA 3VZKA 4MFDA 2W1OA 4FFFA 5E1XA 4RN5A 2ZZQA 3VYRB 4OZOA 3BTZA 1DU0A 5JI6A 5HLHA 1TQ5A 1F4KA 4Z6YA 1CF7A 1S2KA 4WM7C 4BE1A 1E57A 3RZGA 2ZXWH 1OKOA 3VB9A 2J1AA 1AYM1 4ZYEA 1REEA 4LK0F 2QZ2A 1RETA 1TME1 2QCOA 1TE1B 4Y24A 4GQ7A 1R5HA 4KGQA 5CLSA 5LBCA 3J81Z 5LCWL 2ZB9A 2GN3A 2YX4A 2A6VA 4ASLA 4NC8A 3FXJA 3AFKA 2M4KA 4UFLA 1D2QA 4AFBA 5FUNA 2MC3A 1O3SA 1R58A 3VD3A 5C3EJ 1CPMA 3DPUA 3I2KA 1ONAA 4JKMA 4L97A 2QSGX 1CQ9A 5BNNA 1ODNA 1YE9A 3WTXC 5DN2A 1K6OA 3CBNA 1G8XA 2Y0OA 1SEFA 4PDWC 4UF0B 5DUUA 1DYKA 1MS8A 3BG7A 4CEYA 2J5PA 3UNGC 4IHXA 5ISLA 5CBLA 3HPHA 5KHGA 3ZYHA 1RUF3 4AEDC 1MBFA 5L3FA 3TEZA 4XLHA 5J1YA 5B1AH 3M1CA 4QGLA 2XOMA 3WE2A 5JUVA 2D3SA 5IWFA 3O1OA 4Y15A 4B3XA 1SMVA 2JRMA 3M8EA 1YJWI 3ZQ7A 4UXAA 1LKXA 4WF2A 1PM7A 5LRSA 1SBEA 5GADJ 2XVLA 5J4VA 5BYNA 1ZGJA 5JZGC 1GVDA 3KP6A 2QTWB 4K8FA 3HQUA 1J3RA 3LSTA 4XDQA 3GNEA 4YVSB 2YPJA 1UO9A 1JZ3A 3USUA 1DQUA 4L9JA 3R0RA 1JOJA 2NM1A 3N3HA 2PJRA 4I99C 1W2UA 4MUVA 3WHUA 3M4FA 4GCVA 5A7OA 2VZUA 3WVJA 3PUBA 1O4ZA 4CVUA 3GBWA 1TBXA 5L3GA 2XASA 4AFAA 1GZWB 1VQNI 3WDVA 3FHIB 2PMZA 3S3NA 5DAVA 4M4RA 1QQP3 5K7PA 5E3OA 2LKPA 2TNFA 3WHTA 2PFWA 1WJCA 3DP7A 4ZZLA 3PVOA 2Q8DA 4DBRA 1Q43A 4DJAA 4BXXJ 1VBA1 3HSFA 1SVMA 2K02A 3NV3A 2HEWF 3SCGA 3PO3J 2RM21 1E5IA 2HU9A 2OZ6A 1N47A 2R7ZJ 2QGUA 3ZXAC 2R1DA 1KXGA 4AIHA 2I10A 4A2UA 1FOD3 3CCRI 2JJ7A 4IV3C 3CJRB 3E7LA 1AVBA 1W5SA 4V2WA 3U75A 1FYUA 2XUMA 3J7YJ 3K1NA 1SMTA 1UN1A 3ASIA 3OPZA 5EDNA 4AU7A 3CKHA 3A4UA 1CD3G 3VZLA 3CDIA 4XBFA 5IW0A 4X6RB 5D4RA 1YFUA 3IV5A 2ZHLA 4ANJA 1VBB3 2JD4A 4LKDA 3U07A 1MDMA 1P9QC 4QX7A 2TCTA 2CH0A 2KIUA 3G7DA 3KWVA 3PJQA 5IVFA 5AC93 3VGIA 2GNBA 2W3JA 4FVVA 2HH9A 3ZQFA 1ITYA 1H4HA 4NHKA 2XWBB 2CDOA 1YX5A 4IE0A 3IL2A 3J7MA 2ARAA 1MZ6A 4BE3A 3BR1A 4QQ2A 3WF0A 3PU3A 2NP0A 3FF5A 4OIPF 4LLLA 2QQAA 4HK9A 1FMVA 2CU5A 3CMYA 2VI6A 1FT9A 1W6PB 4PFPA 3DKXA 4QKFA 4PFOA 1K5MA 1E3PA 5FFZA 4DS0A 4IRIA 1SFNA 5KHHA 2M0CA 3N36A 1LESA 4P9UA 1MEC1 2WR9A 4XZPA 1ND2C 1QQP2 2EIKH 2YGLA 4GYGA 1F5JA 1XNCA 4WM8A 2VUMJ 3B00A 2VXJA 4B4RA 3D5LA 2AACA 2R16A 2BOIA 4P9WA 1KA8A 4LBNA 4YARA 4QPYA 3UKVA 1WH5A 2VB6A 3RI9A 1EAH1 3W2VA 2BVVA 3WDTA 3AMQA 4F3JA 5HDKA 1IO2A 3O0WA 4FOYA 1WSUA 3HSEA 1WMDA 5A3WA 1NCQC 1UX6A 3TL4X 4U36A 3IPVB 4IX7A 3QAHA 5LLQA 2VT3A 5LGUA 5J1RA 4QGMA 1UL9A 1VAVA 3RQ4A 4QX0A 1LOFC 2ARBA 5DPNA 3ALQA 1HX6A 4JDOA 5E16A 5IK4A 2OA2A 1QNTA 2EZHA 4Q0PA 3ZQHA 3ZYPA 4XW3A 1U5TC 2BY1A 2YB7A 2EPFA 2CAVA 1ETOA 4ZYAA 1BM9A 1VTNC 2K9SA 2X4HA 1UU4A 2X1CA 1W7PD 3EUAA 2IW5A 5FZ6A 2DMQA 3I8TA 2H1KA 3HGGA 1VLNA 3W2WA 4A44A 3QD6A 4M3DA 1GLNA 2DA5A 1MR5A 3JRBA 4RGUA 4N4NB 4N53A 4U0VA 4XILA 4M0NA 2BJSA 4A3BJ 1MD0A 3AP4A 1VBE3 1QDOA 2AQEA 1NE6A 5E3MA 5JVTA 2WNUC 3ZYBA 1CGPA 1K5MB 4UAPA 4ENNA 1U0AA 4OHVA 2RS31 4PDWB 1HRI1 3ZN4A 1VP6A 2V4JC 3LOBA 1GP4A 2FD5A 1RUJ3 4HF1A 3T5XA 3LPFA 2VAUA 5ILVA 3NVCA 3NRUA 2P8TA 4FFHA 3K51A 1XD7A 2YUEA 1GNZA 1PYVA 5CVIA 3S1MJ 2V1NA 1FXZA 3ZYFA 4P5YA 1L0OC 4LT5A 2FZ2A 2LBFB 1D0HA 1J7KA 4BU2A 5FYSA 3IMMA 4Q8KA 3B5LB 3ETQA 4HVOA 3BCWA 5LHIA 2ELHA 3DEWA 1BJQA 2KRHA 1RUD3 1DGWY 4C3IJ 4DRVA 3IDEA 1T6BX 3ZMTA 1CAUB 1U5YA 2YR2A 1YJKA 3NEUA 4AHXA 1S2EA 3F3XA 5TISC 2GSYA 3WF2A 4FPJA 4JGZC 1OLTA 4G6QA 3HRUA 3CDHA 2A6EF 2ZPXA 4R79A 5C4WA 4JX6A 3MLLA 1U78A 2VNOA 2YZ4A 3AZZA 4XCAA 1USTA 1FOYA 4KGGA 4ET7A 1ZZ6A 3BI3A 1EUUA 5T3NA 2XBO1 4Q4V2 2ADDA 5B4XA 1HRI2 1H9PA 3RMXA 2O7OA 3I3QA 2O0OA 4KG0A 1BEV1 3OSFA 2WNVB 2CV6A 2DUQA 4Q4Y1 3T0BA 4HVQA 4RS5A 5F5QA 3UETA 1SG3A 1XN7A 3RNSA 1SACA 2X6OA 1XB4A 5IY5H 2VW2A 1AKHA 3A0BC 1VQ8I 2YROA 2IEKA 2DVAA 2HZTA 2RKHA 4XETA 4W6XA 3BR0A 1H2LA 4XKWA 5FZ3A 1Y4WA 1AR71 2XAJA 4JGZB 4YLZA 1D0ZA 3M3YJ 2STTA 2E2HJ 1X1PA 1URXA 1IXRC 3TNPB 4C9YA 5LBFA 1W8WA 3UJQA 3A7QA 2CS3A 3ACHA 2KL4A 2UY9A 5FYYA 2AYHA 3DLAA 1HW1A 5F0FA 3S2HJ 4XF9A 3PNVA 3ZQQA 1FNYA 1H6YA 4Y13A 4IEWA 4WM8C 4Y1YA 4Z2WA 4XJUA 4FCAA 2E5ZA 4J6GA 1GHCA 1AX2A 3HBZA 4IEVA 2HWB1 3JXSA 1KFXL 4MV2A 3FHNA 4HNTA 1AYM3 1HQNA 1ZR2A 2BY0A 3VBUC 3FISA 4PDKA 5FY5A 2K9QA 1RUI3 5CKNA 2NOGA 1L7RA 4UB8C 2WA4A 5ACA2 4I0BA 3BG9A 4GFBA 1GP6A 2VPLA 2GXGA 3KHBA 3MEPA 1WCMJ 2VN2A 1G6NA 3ELNA 4A3EJ 2H09A 4V1PA 3FK7A 3JRDA 4XBLA 5A32A 5A6XA 2WT0A 2K0GA 3ZPLA 1WUVA 1TNFA 2CWMA 4JC1A 4LG3A 1Q8VA 4N90A 1VBC2 2IGNA 3QRFF 2YYOA 2IBDA 4K40A 2NXNB 5C4JJ 5GZCA 2ACJA 1AOYA 2KA3A 2OX0A 2UXXA 2ZJ2A 5GPCA 2L7MP 1LR5A 1S0JA 4CUAA 4U88A 4GO1A 1ENQA 3WHBA 4BUPA 5DDGA 1WZXA 1JGGA 4OAZA 4QGNA 4HPKB 3SDBA 1FLIA 3K1MA 1XU1A 1HC8A 2W39A 3IWZA 4FASD 4HSRA 1WCSA 4CEWA 5LW9A 2D1HA 4D0QA 5C8CA 4A12A 4XJ9A 1YI7A 3VYSB 1TZOA 4MXWA 1AU7A 4XMIA 2D45A 1TMF1 5C4WB 1ZG1A 1EY2A 3LKJA 1B35C 3QOEA 4U2AA 3QWLA 5IK5A 1ASJ3 4HQEA 2B9UA 2VZVA 1YTYA 4HKWA 1YS7A 2XV4S 3QYFA 2GU9A 2CO5A 3WSOA 1BVP1 1LHUA 2P3JA 2R043 5A1FA 5E3NA 2VPRA 1I1SA 1W6PA 3GHMA 4HANA 4E2GA 2QQBA 4HZFA 2HDDA 1HCRA 2PJRB 4I0AA 3MCZA 4QWQA 3VDXA 4CXYA 3K4ZA 3RYRA 3ZKUA 4LE4A 1N77A 1X1DA 2OUMA 4F92B 5DAXA 1I6XA 1XSVA 4NHXA 5LWBA 3V0BB 3CMAI 3LEKA 1X58A 1N25A 1DPUA 4YFNF 2HWB2 3H5RA 1WZ2A 2WDBA 4KL1A 3ZFGC 1ZN2A 3Q0UA 5KAFC 3Q5FA 4KFCA 2ZA9A 4PCRA 1K83J 2WWSA 3J80Z 1W4MA 4JX5A 3GTOJ 2Z5WA 3UR3C 3CEWA 3ZOIA 4E4SA 1HN1A 4AEMA 1B09A 1WBFA 5H20A 1ETKA 1EH8A 1Q1HA 4E7SA 4ZHNA 3WV6A 4XAAA 5FDBA 2AS5F 3BTCA 3E0JB 3POWA 1LUJB 4IHSA 5T54A 5FLVA 1ZELA 1FMWA 4CCKA 2DU9A 1SEUA 4RGAA 4D9JA 1AR72 2HXIA 1QGLA 2R5ZB 3AB0A 3J8F2 4L99A 3EBRA 4ZZDA 4KN4X 2DFBA 3I56I 3PM1A 4Y20B 3POYA 4AGGA 3AL6A 3GFMA 1LOAA 1NOVA 2I07B 3AYAA 2R7RA 5KXEA 2X48A 3CCMI 4N4OB 1OD5A 4ARYA 1VMFA 1QEXA 3HM5A 2JZYA 3MZ8A 3ZMOA 3CCLI 4QLCU 2QBYB 1D4VB 5A7NA 3UGFA 3ZFFA 4CYCA 1VBC1 3FMRA 2V4AA 3RWNA 4FT8A 3G71I 3KF5A 1T6SA 1SPPB 5K9YA 2XHKA 1XGNA 3O2PE 4M71A 1U12A 4TXWA 4N43C 4Y17A 2VKVA 2HJIA 2VCCA 4PJLA 3PUHA 5JR7B 5KHJA 1P2FA 4ZONA 2DA4A 4DZPA 1Q5OA 1WJFA 3LL7A 1BL0A 4ONUA 4YVWA 4LITA 5FZCA 5FD6A 2Z5UA 4R4XA 3S5AA 1IG7A 4D7YA 3KZYA 4PLOA 2XL9A 2JIJA 4B44A 4IERA 2GA2A 2WFF2 1GOFA 2EICA 4A0YA 3PUIA 4RAZA 4COYA 1XG1A 5GZGA 1JT0A 3IKWA 5GJ6A 3BN6A 4QKBA 1QJX3 5K7ZA 3M3QA 2G9GA 4NE9A 4QXBA 1FPN1 1WWYA 2E60A 4TLFA 2DLLA 4ZZ8A 2ZMEC 2PMZN 3G3ZA 2WO1A 1IXSB 5AVPA 4D5CA 5EEAA 3HL2A 3B9CA 3U37A 3Q8CA 3KT4A 4QPIB 3M1HA 1SPPA 3B94A 4GB31 1UIJA 5C8CB 2FQPA 5K0UB 1LGBA 3LEIA 3HC7A 2HWB3 2Z33A 5J96B 2JG8B 2EAKA 4GMP3 1MSEC 2TEPA 3J4UH 1LGCA 3MKWB 1Z9CA 2BHYA 5CYYA 4AYBA 2YSRA 1J9IA 4A41A 1S3JA 2PMHA 4KBBA 3H1YA 5A33B 4CXFA 5J09A 3AMNA 5GPAA 3ABMH 3H1MA 1LECA 3J7AY 4DQ2A 5I8SA 2Y60A 5FPBA 2XDVA 3UYJA 2KRFA 1FIAA 5AFEA 5KHDA 2DK8A 4YZ2A 1Q8QA 5G05L 3AYDA 3OR1C 1QJU1 4MADA 5FO9B 2E31A 3G6EI 2WNUB 1W9FA 2X9DA 4NHYA 4Y1VA 1QIQA 4AOCA 2ATFA 5IP6A 1LJ9A 1H8VA 3FLTA 2O8QA 2HVQA 2FBKA 3G2BA 2DMUA 1I3QJ 1IUFA 2HOEA 3WNXA 4CO8A 2K9MA 4MG2A 5LEJA 1P4AA 1DQ1A 5FBZA 1WLDA 2CJJA 4KYWA 4L18B 1NXD1 3H5AA 1ALYA 3CNAA 1MZEA 3ZPOA 3K48A 4CUGA 3OGGA 1AR82 3M8FA 4EMSA 3F22A 5A7QA 5CA6A 2EV0A 5KXBA 2BU9A 5FKMA 2JDZA 1ST8A 2WADA 2FMYA 1SFOJ 2ZXJA 4QPIC 3WY6A 1RB8G 1WMXA 2XGCA 4DEQA 2VZ1A 5C7GA 3KV9A 5CFCB 1SCRA 5M5YJ 3H36A 2CSGA 1WA4A 1V0AA 4FPKA 5JXHA 5A1AA 4GDFA 2XB0X 4IV1A 2AQFA 3ABZA 2PHFA 1NLQA 4BMBA 2WBKA 4CDQC 4LO8A 2GC1A 5AIQA 1GBGA 1JKOC 3VN4A 1MBEA 4IV3B 4CA0A 2VODA 1SD4A 3WP6A 2YS9A 1NUKA 2Y34A 2IVIB 2OV7A 2EA2A 5LRRA 3NNJA 2K40A 3WNNA 4L0PA 1CJDA 1IGOA 3MFAA 5GP9A 4S04A 2IS4A 2ZMKA 3JRFA 2KDZA 5KC6A 1COV3 4HOOA 2GIZA 1PZ9A 1NXMA 1UOFA 3MV11 4FPEA 2LD5A 1F43A 1OVPA 2VVFA 5HNHA 5B2GB 2J1TA 4K6BA 5FLHA 3CC7I 2YGMA 5K0UA 1R093 2AZ5A 4RB1A 4EEFG 5F3EA 1TVGA 1BC7C 3MIGA 3HUGA 4FTEA 5K8SA 2E32A 2AXTC 5D5XB 2W5FA 2M3AA 3HPNA 2VMIA 2HTJA 3JU9A 4PLMA 2B63J 2FCVA 3M3OA 3NV4A 2ESNA 3AFHA 1Y3TA 3KGLA 2E1MC 1PGL2 1N78A 3RJPA 3VBFC 1O5LA 4R9DA 2W4SA 2DA1A 4FX0A 2ERFA 1P4WA 2XXZA 4JGYB 3AJYA 3BDDA 4XLEA 4RHV1 5FLIA 3BY6A 3CP2A 4HL0A 4EQVA 1ORKA 3VD5A 5FKCA 4KNYA 1YIFA 3SH5A 5DUXA 2NRAC 2KT0A 2WFF3 3KS7A 1REPC 3N7KA 2L5QA 4HMZA 2DA2A 5IYBJ 1X2MA 5B3SH 3DBLB 2ZC2A 2IRFG 2GH8A 3DYMA 3ZX7A 4LHLA 4BS9A 2KQRA 5DXDA 1ZTRA 1WJBA 1BR4A 3ZRGA 3D82A 4ZYGA 1VAKA 5C5UA 4GB33 5CQGA 1QJY2 1UOGA 3KP2A 2XPWA 2FEZA 4HDUA 3SJMA 1T6GC 3WCSA 2TRTA 1Y9QA 2P5LC 2FNPA 4E9KA 2QZ8A 1XE7A 1AHDP 2Y2ZA 1CPNA 3HBKA 2B8MA 4NHLA 3NV1A 1RNLA 4EJVA 2DFIA 5HCFA 1MNEA 4XR6A 1ZM1A 4C1WA 4XK4A 4P9LA 4OMYA 1JYXA 2OT7A 3NAPA 2MH2A 1N1SA 3DPRA 2CYYA 2VTFA 1FOD2 2WZR2 3OF1A 5DZGA 3MLJA 1UG2A 4IEYA 4PT6A 4BQXA 1MSFC 4LMYA 1NK3P 1HXS1 2LC2A 3K4LA 5FKBA 4NWVA 1CIYA 4JTOA 5J8CA 5EYRA 2E26A 2XF6A 3R4SA 4CUBA 1FMD1 3A4CA 2WBMA 1UYPA 2LREA 4LB6B 5H9RA 2A6TA 1QGPA 3GMEA 2LSOA 2RDPA 3FXUA 2IXJA 2DF7A 2KXLA 2CUEA 1PHMA 3K2AA 4A3JJ 3S32A 2JG9A 1XSRA 4CP2A 4F55A 1N1YA 1CAWA 5F08A 1IS4A 5T5OA 3RZKA 4GJYA 2CGPA 3P5BA 5L9BA 4OMDA 3PSIA 4RQPA 2X1DA 3CU7A 2OJED 4FFGA 1HSJA 2IXKA 3WQ7A 3M9AA 2E6VA 4D7SA 2DT5A 1IAWA 1IN5A 2BZDA 1US2A 2QQIA 1X50A 1FSHA 4RQPC 1OF4A 1BQPA 3S5QA 4YIFA 4TWTA 1PVC1 4CCDA 4AHWA 4IDZA 4JGYA 4QXCA 2E36A 4SBVA 3JW4A 1QU0A 3HRTA 2XAQA 4RS5C 1AHSA 2EFQA 4OI4A 3TEXA 1DYPA 2QKDA 2GMEA 1B4AA 2D3RA 5M5WJ 3GFLA 1ZHFA 4XDOA 3W6VA 1VRH1 2VOTA 1ZZ9A 1WCDJ 2Y6GA 2BZTA 3U9GA 2AGSA 1SC7A 3V8JA 3VBSA 3KQ4B 4Q47A 1SZBA 1TT0A 3FBNB 4XCBA 4BQWA 5EEGA 1AXZA 3PUQA 3Q3SA 4YFKF 2HR3A 1ZZBA 3MQ0A 2D93A 4Q5OA 4LHKA 3OYIA 1LOGA 2LUWA 2ZGRA 4X6AJ 2EJRA 5F04A 4CU6A 1NHAA 3CJIB 2VNRA 1UYZA 3AG2H 3NO8A 2A05A 1Y0UA 4ZY9A 3BZCA 1ZNPA 5LBBA 3JAMZ 2DA7A 4CDQA 3OBAA 5J3UA 4M3BA 3JRAA 2MYSA 3DQVC 4LLOA 1T56A 4KIFA 1WW7A 1DG6A 1LHVA 2RQQA 4L9TA 1JHFA 3S3MA 1V5EA 1EPWA 1Q56A 3ZR6A 3ZN6A 2N8GA 1VRH2 4XXPA 3GW2A 4ZC3A 1KDKA 2IGOA 2P7VB 4EV0A 2ZMEA 1BMV2 3LA3A 2DVFA 1A3KA 2VE1A 3I59B 5JOXA 3I49A 4PIXA 2C1FA 5DUVA 1RUOA 2VJXA 3OIPA 2A3XA 3IPVA 4QDQA 4ZDOA 3ZM8A 2AO9A 2XF7A 3AG3H 4CTEA 2JECA 4IEUA 4FHTA 3BOWA 5K1YA 4XFCA