4I09A

Structure of the mutant catabolite gene activator protein v132l
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
204
structure length
204
Chain Sequence
PQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKLGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Catabolite gene activator
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
total genus 58
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i09A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i09A01
1Q43A 4L0YB 5FPXA 1H0MA 4OIQF 1CAVB 2A61A 4MQ9F 2K27A 4MEYF 4GCVA 4NQWA 3OOPA 5LEJA 1UCXA 1RL3A 4JVAA 3TOAA 1JXSA 1X82A 5FLXK 1WGPA 1QNTA 4M9SA 5J7MA 5KVRA 5LLQA 4QXKA 5CVIA 4WBBA 2RVCA 3ZMZA 5LGUA 3HOTA 1JE8A 2L54A 2PQQA 3VFZA 3R4KA 3EBRA 2BYVE 2IXJA 4BXUA 5T3NA 3DFGA 2FQPA 2ATFA 1O5UA 4EJTA 4ESJA 5J3UA 1IAWA 4P55A 5FDBA 2EK5A 4IRGA 3M9AA 2L3DA 3R0AA 3KZYA 3HSFA 3P9KA 1PP7U 1OFNA 2P5VA 3LAPA 1PMIA 2K7LA 2MC3A 4XLNF 1Y0UA 2QWWA 2A5YB 1BI1A 1T6SA 4OIOF 1J9IA 1W4MA 4A6EA 1FBSA 2F5FA 2D40A 4R52A 2VT3A 3MPBA 4EM2A 1PDNC 3I53A 2QQBA 3OF1A 3G3ZA 2OZ6A 4EGYA 4XFHA 1H1MA 4ZU4A 2JRTA 2HOEA 4FHTA 1EPZA 3KP3A 3GLXA 3GYDA 2ET7A 1Z91A 1C0WA 5HS8A 3GFLA 4ZU7A 1QPMA 3SXYA 1E17A 1IZ1A 3KCCA 4MTDA 5KHHA 2MLGA 3E6DA 1IXRC 2DI3A 1DPUA 3UKVA 1G6NA 3ABUA 4KICA 1IRGA 2D5FA 4YARA 4EWAA 1TW2A 2DQRA 2VBZA 1U78A 2UXNA 4HF0A 4RAYA 2MNGA 1FSHA 2ZNYA 5KHIA 1J0RA 1R5HA 4LK0F 1BIBA 2GQQA 4OOIA 4EVIA 1ZZ9A 2V1DA 5E1ZB 2MA3A 3HSRA 4ZYDA 1D3YA 2E9QA 3K1PA 1IXSB 4KNYA 3K0LA 1F9NA 3TOBA 2LDUA 2D5HA 2ZKZA 3DEUA 3LA2A 1NZCA 3C7JA 1CAXB 4RS8A 3WGGA 2L01A 5DCFA 1TNTA 3CO7C 3CLPA 1SFXA 1CF7B 4Q29A 5F64A 1I5ZA 4MV2A 1ZG3A 4KDPA 2HFHA 1TQIA 2PBIA 2JZYA 2KRFA 3H3ZA 3JAMZ 3QP6A 4WXHA 1XGNA 2QM3A 3O3KA 2C0ZA 1STZA 5BQTA 4E2QA 2FA5A 3I5UA 1YUDA 1XE8A 4UBHA 1U8RA 4MHGA 3QOPA 4M6XA 4HLXA 5CVJA 4KFCA 3J80K 3V4GA 3OV8A 2BBYA 4IETA 2PQ8A 3F6OA 2NRAC 3I7DA 3R0JA 2GC2A 2XIGA 3FE5A 2ESNA 1OI6A 5FPZA 2L4AA 4ENJA 1BC8C 3L2CA 3GX4X 1LEAA 1JHFA 5K8SA 3DXJF 1U5TC 4WXCA 5HDNA 3ZMDA 3HYIA 3VHRA 3EO6A 2A07F 3RKXA 1U2WA 3M1EA 5C6CA 3TO7A 4Q48A 4D7SA 4E70A 5C8WA 2FSWA 3T8RA 1BBYA 3WTZA 4UV9A 2BGCA 4LA2A 2EFOA 5LHHA 4XBFA 1IW7F 4XRFA 2K86A 2GC0A 2M45A 2LKPA 3BU7A 3CO6C 5LEKA 3Q9SA 1X8MA 1AOYA 3VODA 1NE4A 4AXOA 3H3UA 3IHUA 2JPBA 4L5JA 3ZMTA 3LA3A 1MD0A 3LSTA 1XMKA 5FLXZ 4IXAA 2XAHA 2HQRA 4EWEA 4LG0A 3CUQB 2K0GA 2DLLA 5BV6A 5I0SA 2Z3YA 5ICCA 4XF9A 5DUIA 1VP6A 3KP6A 3CLOA 2Q8KA 2Q0OA 4Z82A 4L11A 2JT1A 4E2GA 2XLAA 4HX4A 2XKPA 2V1UA 4M9ZA 5J6XA 2P4WA 4P5OA 2R7FA 3EHKA 1LVAA 4F7ZA 3KEQA 2GH2A 2FU4A 3RIRA 3QACA 1G3SA 4LUMA 4LLNA 1IN5A 1J3PA 2K4BA 3NSTA 4OIPF 1U5TA 1TBXA 5D4RA 1RZ4A 1QXRA 2V1XA 1F4KA 1J3RA 4U7BA 2W85A 1FPQA 1S7AA 3JTGA 2ZXJA 2CAVA 3RPUA 1LRHA 1GHCA 3DQVC 4OMYA 4F8AA 3U10A 3ZMVA 4HX7A 4Q47A 5I0TA 3GUDA 4ZYHA 1CAUA 2XVCA 1RC6A 2F5DA 4GXOA 3WU1B 4U0YA 2QDRA 1ZZ8A 3HRMA 2KXLA 2VOOA 4L2NA 3W6KB 3HT1A 3DPTA 2W57A 4I0AA 3HQXA 2HWVA 3GO5A 4M6YA 2OU2A 2UYBA 3H1WA 3LAJA 4EGZA 4XFGA 4OIRF 3WTWC 4RB1A 1O3TA 3LQRA 3E6CC 4ENKA 3C3VA 2TDXA 3M70A 1K79A 3TKYA 3LWFA 1V70A 4U0VA 2GA1A 1QGPA 2QCSB 2QQ9A 2VQAA 4YG2F 1USSA 4Q5SF 1UHMA 2HKOA 4EM0B 1DGRA 3V7CA 3MZHA 3GVAA 5AVPA 2GC3A 2O0YA 3C1DA 4UUVA 1DZRA 1XMAA 4BAYA 1DDNA 3HTUA 3V7RA 5L3GA 3V8JA 4MNUA 4CZZA 3RKWA 3MAJA 2PAKA 4U0WA 1XB4A 2RKHA 1SAXA 2VXZA 2VT2A 4JTNA 3WW1A 2ACJA 2Z69A 1R7JA 4G9YA 4HQMA 3H7JA 3HRSA 2IC1A 2PHDA 3BROA 1D5VA 2VOPA 1HW1A 1USTA 5D5WB 3RJPA 1J1LA 4HF1A 3WTSC 3BY6A 1K78B 2RQPA 4WF2A 2ZKLA 2JTVA 4NHJA 4Y13A 5H6RA 5FLIA 4Z2YA 3H1YA 4FAHA 4IEXA 4N0BA 2W84A 3WTTC 3IKTA 2G7UA 4GYIA 3RYRA 3KGZA 4ONUA 4HDVA 3KGLA 2DCTA 3UKTA 3WE2A 2HQNA 3HTSB 3VEPA 5H6QA 3L09A 4MEXF 1OR7A 3QPTA 5F1RA 5ICGA 1J58A 3J80Z 1B4AA 3B02A 2LSOA 1NYWA 1XD7A 4QX5A 3I64A 2FQ3A 1ZRCA 3MFKA 2PG4A 3ZDSA 4HVOA 4LLOA 1BI2A 2VONA 2Y0OA 5I93A 1TQPA 5DCMB 1B9MA 4HOBA 3K1NA 1P4WA 4PZJA 4QGLA 4G6DA 1Y9QA 2XHKA 5EZWA 5D6EA 5JR7B 1WRJA 1UIKA 2CW0F 1Z9CA 2PTMA 3I71A 1DZTA 5FO5A 2IPQX 3VOEA 1Y3TA 2K02A 5L3FA 2XL7A 2GC1A 1MGTA 3HSEA 1OKRA 3QAHA 1RUOA 1LKNA 4G7OF 5K5QA 3TDUC 3S7IA 5HI0A 3DN7A 5LBQA 3CO2A 1UW8A 1FXZA 4LLGF 3F22A 5F6FA 1ZZ7A 5E1XA 3VB2A 1K78A 4XETA 4IHTA 4WX9A 1YIOA 1BI0A 4BH9A 1YWKA 3ECOA 1ODDA 1U3EM 3IC7A 3T0YA 2ET1A 4AIKA 2DBBA 2UXXA 1FC3A 4O5VA 1IF1A 2QBYB 3IKVA 2O03A 1UFMA 2GU9A 3IDCB 2WWYA 4IEVA 5I91A 1G3TA 2VBYA 3OCPA 1R58A 3NL1A 4DINB 4ZZDA 4Y17A 3M3IA 1S8NA 1YFXA 5D8LB 2OBPA 3FMRA 1HKQA 5JFRA 3FM3A 3IL2A 2FOKA 2P7VB 4EM1A 2Q2EA 3IBMA 1J59A 4A6DA 2MBFA 4QM9A 1XN7A 3WG9A 2R3SA 2YSRA 2M5WA 3CTAA 3EYYA 2RV8A 4MGKE 5BUVA 4R1HA 2G9WA 1Q1HA 5A2QK 4P9FA 1ZREA 3BJ6A 1FZPB 3TO6A 4L9TA 1A04A 4UHTA 2GWRA 4U88A 4BIFA 2KIMA 3QP5A 3IIAA 4META 4XFCA 4I2OA 3H9AA 1F5TA 3S7EA 3V8KA 2BEOA 2MHFA 4HSLA 2RNJA 3AAFA 2YU3A 3MWMA 1L3LA 1YS6A 2QJVA 1G3WA 4HBNA 1ZZ6A 1BC7C 4ASNA 2EFWA 1OYYA 1MKMA 1Z6RA 2JSCA 4Q0VA 1T39A 4O3MA 2IA1A 1FP2A 4R79A 1HBXG 5L3CA 3SHFA 1CAVA 1O5LA 1D8JA 2XAQA 2E1NA 1R23A 1V3FA 1MDMB 4I0BA 1W7PB 1XGOA 2YX4A 5JAXA 5AONA 3MCZA 1YFWA 3IRRA 1YO5C 2KIFA 5JCTA 5LRSA 3KLNA 1FYKA 2F5CA 3RZZA 2EV5A 1ONVA 4AIJA 3ZMUA 3JW4A 4XF4A 2HYFA 5JR3A 1WKMA 4LUKA 3GYHX 3ZQ7A 4HMZA 2GZWA 2P6SA 2V9VA 4YIIA 3QU6A 3DP7A 1FWZA 2D93A 4G7ZF 2CFXA 4ESBA 4UXAA 3KMHA 3WU0A 4JV4A 4Z07A 1U12A 2VE8A 2RC4A 5ICEA 1ZH5A 3FXQA 4O6JA 1BIAA 3F8NA 5CLSA 3HOSA 2EA2A 5BS6A 1QBJA 4LB5A 3F21A 3H50A 2FMLA 3IWZA 2EFQA 4QM8A 2A68F 3U9GA 1ZAOA 1W7PD 3FM5A 1B1BA 2IXLA 2XGXA 3CF6E 1LR5A 2HTJA 4JBAA 2DQLA 5IT9K 2L02A 3E5XA 4RB0A 2GIVA 2IRFG 3JTHA 3ETQA 4QMAA 1J5YA 4HBLA 4LTAA 1X7NA 2NNYA 1KU9A 1KGSA 5FB2A 4X6RB 5HS9A 3CJNA 3PQKA 4IF4A 5L3EA 5BPDA 2N7GA 4RAZA 1I1SA 5I8SA 4G7HF 5HLGA 2IW5A 1MDMA 3CUOA 3BPVA 1L0OC 5JI6A 1F1ZA 1W7PA 2K9ZA 3J81K 3FZ3A 3K2ZA 4L5IA 2V6CA 2ISZA 3ZN1A 3N97A 4UV8A 1R00A 2NYXA 2Z5UA 5K1YA 3O6BB 3QPHA 4PGHA 2VPVA 4OU0A 1O3SA 4ORFA 3ML6A 5FLHA 4D0PA 3WGIA 3PFIA 1P2FA 2DO7A 3SZPA 4EJOA 2P5LC 4XFAA 5HLHA 4H7LA 2HYGD 5L3DA 2H0VA 3BCWA 1HQCA 1J2XA 4XFBA 5HDKA 5FGMA 1LEBA 2AXLA 2OAZA 4KT5C 1K7AA 1V4RA 4ENNA 1FYMA 2O1QA 1BOAA 3BPXA 4RGUA 4IEUA 3GFJA 3KP4A 1SEFA 2D1VA 4PJYA 1UB9A 4BHPA 1U6GA 4ENMA 2IA2A 4NVPA 3WW3A 3GW2A 1RGSA 5E18F 2A6HF 5TJJA 4RB2C 2CAUA 1CAXA 1G4DA 1XGSA 1WI9A 2EA4A 1YTYA 1ZX5A 3RDIA 3PNAA 3H92A 4UVAA 4GULA 1FNNA 1CF7A 4MGIE 4B29A 4LK1F 5ILUA 1EP0A 3LA7A 4ON0A 4MH0E 3N4MA 3H1MA 3FZVA 1QQIA 4L9VA 3NKTA 5JSPA 3C3WA 2QVSB 2GA2A 3CUQC 1PM7A 3W6JB 2H94A 3EJKA 4Y15A 1WQ2A 3DV8A 5E17F 3UKNA 4A5NA 3FXUA 4IEQA 4IEWA 3O2PE 2XROA 5CVVA 1HW5A 4M71A 3FHIB 4KYWA 2ELHA 5KK1A 1LB2A 1MJAA 1TW3A 4UVBA 4J1WA 1TLHB 3K69A 3M7GA 2ETEA 5FQ0B 1BI3A 2FXAA 4WXDA 3L2HA 4IEPA 4YFKF 3ES1A 2VC1A 3KE2A 1TQMA 2Y0MA 1SD5A 2IP2A 4AVPA 1ZARA 1SFNA 2VODA 3E6BA 1WA4A 2CYYA 3LWCA 5D8KB 1Z1DA 4J1XA 5FD6A 2IXKA 4PIXA 3CJXA 3P7NA 3K9TA 2M87A 1ZN2A 3F8MA 3ZPLA 5I8TA 1UHWA 2UY8A 4EJVA 2STTA 5E16A 3BALA 2FNPA 1P6RA 2LF7A 4CXFA 2IXIA 1NHAA 1KU3A 1QZYA 1E2XA 4JK1X 4MUVA 2O8QA 1BJAA 1B59A 5CJ9A 2VC0A 5KHGA 4E2SA 3BZ6A 2E7WA 1P4AA 3SFZA 3ELKA 4K8FA 2OD5A 3FWEA 1NXMA 1X3UA 4AIHA 2QZ8A 1FLIA 3NW4A 1IN4A 2P5KA 1LDKB 1Z6TA 3I59B 3CUQA 3NRVA 3EETA 2EA7A 4EMSA 1TQ5A 4HVQA 3H7YA 2P6TA 1DGWA 4KL1A 3EDPA 2ZMEB 1GVJA 1ULYA 2PI0A 2D45A 5BXXA 1WSUA 3ABTA 2ZJ2A 4B8XA 3U11A 1RIOH 2Z99A 4PDKA 1FBUA 5J8FA 1UIJA 4B09A 1XSXA 3PQJA 3ZN0A 2M30A 4RB3C 4LEJA 1K6OA 4XF3A 4BHBA 4LFUA 2CWEA 5K5RA 3D82A 3U1DA 2UYAA 3BJAA 3KP5A 3DF8A 3LAGA 4PCQA 1XCVA 3H8UA 1BN5A 4HQEA 3GFMA 5HDGA 4LD5A 3KP7A 3GBFA 3REOA 3HT2A 1UPIA 3T5XA 3BPZA 1OD5A 4AVCA 2IVMA 2OZUA 3IDBB 4RGSA 1GXPA 5JHUA 2ZFWA 2H27A 1SQ4A 4ETSA 1OPCA 4A0ZA 4HN1A 2CSOA 4I98B 1ZRRA 3P9IA 3U2RA 4M74A 5BOXA 3GZ5A 3ROUA 2VECA 2E7XA 2W24A 3WE3A 1LDDA 5DDGA 4IVNA 4IESA 4Q0SA 4JQFA 3FX3A 4TV7A 5E8GA 2C6YA 2OPKA 1KYZA 4HA8A 3J81Z 4UNOA 3HRUA 3ECHA 2EJRA 4HX8A 5D5XB 2PMHA 4JTOA 4AVAA 5IT3A 2FEZA 4ZYGA 3KFWX 2XL9A 4XF1A 1FX7A 2HEOA 4D7TA 1ZYRF 4Q0UA 1XSVA 4G94A 4XF0A 3F8BA 2WC2A 3I4PA 1VJ2A 3JZVA 4RD7A 4DQ2A 4WCGA 4N9IA 3EUHA 4EROA 4P96A 5DD4A 5DV5A 2EFPA 2ZMEA 1GQHA 2WV0A 3FF5A 4MGRA 3ZMSA 4KIFA 1AWCA 4TLFA 2KKOA 2EFNA 2STWA 5EEGA 2D2WA 2PMUA 3J7AO 4XEZA 3V8LA 4HSJA 3RYPA 2FMYA 2BE5F 2PHLA 2ZCWA 1NE6A 1LQ1A 2A6EF 1WLTA 2IXHA 3L9FA 5EEHA 1I6XA 2B0LA 2NNNA 5JSRA 4WZCA 2HZTA 3PVBB 3WODF 1WWXA 1MZBA 2ZO4A 4AQ2A 1YW9A 2PN6A 3M8EA 3NQOA 1FT9A 3KEOA 5BMZA 1IN7A 3R60A 4IEOA 4HN0A 1XDSA 3MQ0A 3F8CA 2PAMA 3BB6A 2CO5A 4MQVA 3E5UA 2UWMA 3I0TA 3L00A 3F23A 4KMFA 4EJWA 4EQQA 4ZU5A 4XSXF 4N9HA 2O61A 3TGNA 3TO9A 4A0YA 4M9XA 1JGSA 1HSTA 2QQAA 3SZTA 1TNSA 3HHGA 4PIYA 2MH2A 1SD7A 2ADUA 4IERA 5LGTA 1XRUA 4WK8F 4IEYA 1R36A 4GGGA 4AWXB 1HSJA 3U0ZA 2F2EA 4LMYA 4WVZA 1CGPA 2V09A 1JUHA 3SMHA 5E8IA 1KQ9A 4G8XA 4U7DA 5DCMA 2VBXA 1T38A 1KA8A 4I01A 4EV0A 4QGMA 3CDHA 1R5GA 2XLGA 3MDPA 2O8XA 2VN2A 2K4JA 2PEXA 4CGZA 4Q0PA 3MYXA 2LF8A 3EQEA 1GXQA 4KMUX 3Q9VA 2PAEA 4KIGA 1QZZA 4GYGA 4HLTA 4YSFA 1SMYF 3C18A 4BYYA 1KQ0A 1FYLA 4LJZF 2FNAA 3ISPA 4EJUA 5CYVA 3TDZC 2EV6A 1IPKA 2E1CA 1CAWB 3HUGA 1FOKA 4X6QB 1CX4A 2JPCA 2OA2A 3TNQA 2EWNA 2IXCA 2GXBA 2PYTA 3PLQA 4R8HA 1YHFA 2DPUA 1YQAA 4QGNA 5J48A 1YS7A 1O57A 2QBYA 5ED4A 4Q4ZF 1UCRA 3OD0A 1KU7A 2KIUA 2NAZA 2DT5A 1REPC 4MX3A 4P9UA 2BNOA 3KSCA 1FBQA 3SCFA 2GXGA 4CHUA 2WTEA 3F6VA 2Z2SB 4EWDA 2BV6A 2J5PA 2PA7A 2PLYA 5CVRA 1S6LA 2OA4A 2WFPA 2OYZA 1S7OA 1R1UA 3S2WA 1EYBA 3CEWA 2H6BA 1FY7A 2QVOA 2CV6A 4M73A 3ES4A 1ZRFA 4FAGA 3ST7A 4S04A 1LNWA 4QLCU 2F5EA 3USSA 1KYWA 2Q30A 4IEZA 5E20A 1FSEA 3RKYA 3GF2A 4HV5A 2OQGA 4A5MA 2Y48A 3NVCA 4I3PA 1DP7P 4XSZF 4OMZA 4OLLA 5I0UA 5LHIA 3SXWA 5DUKA 2OQRA 1EH7A 4HLYA 4IJAA 3B73A 2ZBKA 1EH6A 5HS7A 1CAWA 1R1TA 1TTYA 2FF4A 4KWJA 4HV6A 4KWKA 2FBHA 5BPXA 1ZLJA 5JSOA 5HLIA 4KU8A 4KN7X 5KHKA 3ELNA 1OYIA 4AQ6A 4MGYE 3NEUA 5AIQA 1J7KA 4HVRA 3IRQA 3L7WA 3R6SA 5ILVA 4Q0QA 2GAUA 4KN4X 3GXOA 2PJPA 2HGCA 5EFUA 2EAAA 4CDGA 3DPLC 4FX0A 4XLPF 2D1HA 3P9CA 2XKOA 1YFUA 1W5SA 2CGPA 1PUEE 3ACLA 4XFIA 3SQNA 1O4TA 2A69F 4ZH4F 2XV4S 1RTVA 2BNNA 4M72A 4LG0B 5FLJA 5KHJA 2XRNA 5K5OA 4IHSA 1YG2A 4I09A 4L0ZB 5DYMA 2RN7A 3BDDA 3M8FA 6PAXA 1B6AA 3EYIA 2Y75A 5LGNA 4O9GA 1KQ8A 4A12A 5H20A 3LZZA 1OMIA 2UY9A 4AVBA 1FP1D 1Z05A 1ON1A 2QENA 4XFFA 4H0EA 1S29A 2IJLA 2AS5F 1B9NA 2ESHA 2FE3A 1EH8A 4UVCA 3RNSA 5D5UB 3S0MA 1ZZCA 2J5OA 3D5LA 5HVQC 3JSPA 2IT0A 1U5TB 1EY2A 1IN8A 4O9EA 3KP2A 1LJ9A 4MTEA 4WWCA 1DUXC 3D0SA 2XAFA 2HR3A 4HF2A 2BNMA 5ILSA 2XLFA 3GFIA 2VBWA 5TRDA 2Z33A 2ETHA 3TQNA 4IPAA 3RI4A 4RGRA 1ON2A 2LNBA 1ZNPA 4LA3A 3KLOA 2DTRA 1HXDA 5L3BA 1YW8A 2H09A 4MZUA 3OGJA 4CYDA 3DL3A 3WTYC 4G6QA 5LHGA 3T8TA 4FBFA 3KZZA 1CAUB 2B5HA 1ZGJA 2COMA 5LRRA 5FCCA 1R22A 2Q4SA 5D1IA 2XASA 1GQGA 2Q0AA 4HW0A 4OINF 4P9GA 1MJ9A 4CO8A 3GEZA 2M1BA 1O3RA 4KIBA 3WW4A 5A2QZ 3LQQA 4YIFA 2DAOA 4QWQA 1O3QA 2X0LA 1IPJA 1XCBA 1ZVFA 5FD5A 4S05A 2G7HA 1UD1A 5E1WA 2XAJA 3RYKA 3RTRA 3MEXA 3JSOA 2DK5A 3F3XA 5D4SA 1H9TA 1ZRDA 2F4PA 3SHRA 4YYOA 4GO1A 2V79A 4L9NA 1PP8F 4L9JA 2RDPA 5KBFA 5HOOA 3ULQB 2KJBA 3SCHA 2MPFA 3TNPB 1T0FA 2ZNZA 4LULA 1EV7A 1SFUA 1O7LA 3NJZA 3WTXC 1QO0D 5JVTA 1I27A 3IWFA 2CQKA 5E1RA 4HAMA 2DFIA 1YFYA 1OYWA 2XAGA 2I45A 2HTSA 1H1IA 2YR2A 2P8TA 1T2KA 1R1VA 5ICFA 1XE7A 4KWLA 5DEQA 2Z9OA 2FBIA 4KA4A 3LOIA 2VE9A 2O3FA 5AIPA 5D6FA 3LFKA 3G7DA 2IA0A 2KJCA 3BOQA 1Z7UA 5BY5A 4BQAA 5ERIA 2B9UA 4LLLA 2HKXA 1IN6A 5DD8A 1ZLKA 2Q1ZB 1IUYA 4YFXF 1DPRA 3ZP5A 4CICA 4A2UA 2UZKA 1IRFA 3FJSA 1D8KA 4DNCA 1LDJA 2EVXA 4KUMA 3E3VA 4YFNF 1SFEA 5FQ0A 3F72A 3E5QA 1JHHA 4FT8A 2P17A 1SMTA 3FHZA 4KU7A 2XUBA 4PGGA 2FBKA 3R61A 3OTFA 2CG4A 4BHCA 3T1BA 4AD9A 4LGWA 4ZYEA 4UBGA 1QWRA 1H9GA 4NB5A 5FFXA 1ZHFA 4PIZA 3GZ6A 4LB6B 2HDCA 2MD5A 3WTUC 2B8MA 5CADA 2L4MA 1I1GA 2A3SA 2PFWA 1RUNA 2YX7A 2R7DA 1ZG1A 3O14A 5IT9Z 3E6MA 3WTVC 2FRHA 3Q5FA 1XSDA 3HHHA 1ZG5A 2QNKA 1SD6A 1Q3EA 3KETA 5CU1A 3SCGA 4HZFA 1YLLA 3HIFA 3I54A 4OFGA 2O6GE 2PFBA 3E97A 4K2EA 4IRHA 2W25A 3QRFF 1VTNC 2DU9A 3I59A 1X8EA 1YFHA 4L18B 4HDUA 1ZGAA 1VR3A 1YW7A 5D5VB 1P92A 3BJOA 5FFZA 3RPQA 1T98A 1QY4A 1P4XA 4ESFA 1SD4A 4MGZE 2MH9A 1Q5OA 1QXJA 3JAMK 1IXCA 1BM9A 3HRTA 4IRIA 1HKSA 4I02A 2X4HA 3DKWA 1ZZBA 5CVUA 1L3JA 4YNIA 2HJIA 2DK8A 1FI2A 1HKTA 2HS5A 2QLZA 3MZYA 2RGVA 3CL1A 5I0RA 1YYVA 1RI7A 3BWGA 1S3JA 3F8FA 4YRDA 3FMSA 2OZJA 3WGHA 5J8CA 4I7HA 4RGXA 3D0JA 1YLFA 4UXNA 4ZZLA 2M8EA 1MJBA 4HYEA 1W5TA 4A0XA 1J3QA 1O7FA 3BP8A 2DPDA 2YPRA 3FMQA 3GWZA 3EQLF 3V7SA 3I58A 2MLKA 1HW2A 2NS0A 1RNLA 3ERED 1J75A 1G3YA 1XDUA 2ISYA 2QYOA 2EV0A 3G73A 5BPIA 1KU2A 2H6CA 2QUFA 3COAC 4BNCA 5I8YA 3FFQA 3WW2A 3QU3A 3K1MA 1XGMA 2P7CB 2DW4A 4FX4A 2EB7A 3FXRA
chains in the Genus database with same CATH superfamily
5FPXA 1NQJA 3LOBA 1UY0A 3WU2C 4HXCA 3A0BC 3GDBA 2RQQA 1VQLI 3TOAA 1JXSA 2XMLA 3NKGA 1QNTA 4AGVA 3D3AA 3POFA 3M8LA 3PL8A 4LBJA 3I3QA 3HOVJ 2VNGA 1JYNA 3HOTA 1J83A 2PQQA 2ARBA 2BYVE 2IXJA 3Q3SA 4BXUA 3S30A 4ASLA 1EJ9A 3KZIC 2W2IA 1X3WB 4EJTA 5J3UA 4RS5C 1Z7LA 4PJMA 5FDBA 5DZFA 2HYKA 2EK5A 1RUC1 4LO8A 4XKWA 2LBFB 3TP3A 2OIIA 1PP7U 3NQHA 4D6SA 3ZPYA 1PYVA 2K7LA 2MC3A 2QDNA 1FOD3 1HN1A 1Y0UA 1COV3 1H4GA 2VJJA 5FZOA 4AI8A 1UY4A 3E7LA 3UGFA 2Y0SN 1W4MA 1FBSA 4DRRA 1K42A 4R52A 1C1LA 3MPBA 4EM2A 5FUPA 3P3NA 2X5IB 4P5HA 2JD4A 4CDUA 4EGYA 4XFHA 1H1MA 1EPZA 2LTPA 3VYUB 2ET7A 3N9LA 2X6YA 1C0WA 4YZ2A 3KV6A 1QPMA 1E17A 3RZJA 4MTDA 2ZAHA 3BT9A 2DI3A 2XG3A 2JWTA 4Z6YA 3L2RA 2UU8A 3OL3A 4QHBA 1OFCX 2Y6FA 3KWVA 4PBOA 4HK8A 1MBJA 4P9IA 2UXNA 4HF0A 2CYFA 1S0CA 2VTXJ 1SVOA 2HWF1 5LATA 1B72B 2WS93 4OOIA 4EN7B 1AL22 3L2QA 1W0OA 4HNTA 3AYCA 4P9XA 1OCRH 4YVSA 2GNDA 3OBZA 5FO8B 2LBFA 1IXSB 1YJLA 3ABLH 5IUQA 3LFMA 1IRZA 1PK6C 2LDUA 2CQQA 2D5HA 4D5FA 1X1AA 2OCCH 3C7JA 3CP8A 3LDRA 3WP5A 5FO7B 5DTDA 4RS8A 3WNNA 3T2QA 3CLPA 2ZHNA 3ZIXA 1SFXA 4Q29A 5F64A 1S0IA 2P0WA 1I5ZA 1ZG3A 1Y56A 4I6ZA 4KDPA 2X5IA 5L7OA 2PBIA 3WCSA 4AVVA 1SFKA 2KRFA 2ZXQA 3O3KA 2CFOA 1QHDA 3GJBA 3MHZA 4E2QA 5EV7A 4BQ5A 2JEMA 4IV1B 1AVBA 3O1VA 5FXVA 4A3ZA 2PQ8A 4AOCA 3F6OA 3TOJA 3VKOA 3ITQA 2WBKA 2GC2A 3FE5A 2A75A 1W05A 1HF0A 2L4AA 3BR2A 2PMZN 1B72A 2RM23 1SDDB 1BC8C 5K0UB 1LEAA 1JHFA 2KZGA 5ANNA 2IVJA 1U5TC 2ZEXA 1WCMJ 4WXCA 2O0OA 3CC2I 5GAHJ 4QPWA 1VAVA 5DZEA 2A07F 4XE9A 1FEXA 1HOMA 2LRDA 4Q48A 1REDA 4E70A 5LK7B 1X2NA 3SITA 4AEKA 2X85A 3WTZA 3J7AY 4LR4A 2RJ2A 3GTQJ 1K5JA 4XOPA 3LKJA 1I3QJ 3QOEA 2C9AA 4GH4C 4XRFA 1W8FA 4KI5M 2GC0A 4RR3C 4C91A 4B8EA 1XYNA 3DKXA 1Y1WJ 3ZQHA 1JKOC 4ZS2A 1MS0A 4Y1ZA 1IKPA 3U4XA 1MD0A 4X0GA 1HDPA 3SH4A 4Y5Z0 1RUE3 4LG0A 1BMV2 5A6ZA 4IV1A 1QMJA 4XABA 2OQ6A 3J8F3 3A2KA 5ICCA 5CAZA 4CEYC 2E2HJ 1RHI2 5KNLA 2M3AA 2Q0OA 4Z82A 3JRAA 1HN0A 2HWE3 2XLAA 1W1WE 5D8AA 2V1UA 2CWSA 1W3VA 4MIMA 2P4WA 4BACA 1LVAA 5K0UA 2GH2A 3RIRA 1VQ5I 2GOXB 3B01A 1BVVA 2FDGA 2VIXA 3DPRC 3NAPC 3TW6A 4AFCA 4BZ4A 3PIOF 1RZ4A 1JOBA 4PI0A 3J9SA 1J3RA 3ZIWA 2EH3A 3JTGA 2W9XA 3RPUA 5J1RA 4XDQA 4FFHA 4F8AA 3OIOA 2ID4A 1XG1A 2NS7A 3ZFGB 3VKFC 1CAUA 2F5DA 5GLUA 4YW5A 5A7WB 1ETXA 4U0YA 3WU1B 4HONA 4ES9A 1ZZ8A 2AZ5A 3KB5A 4OYUA 1SBEA 2VOOA 2KXLA 4L2NA 4Y52J 1V6LA 2WAAA 2W57A 3U75A 1Y6IA 1RUC3 1PVC1 2AQFA 1LOEA 2XJPA 4BMEA 1G9AA 4EGZA 4LORA 5HV0A 3K2OA 4RB1A 3E0JB 4YVWA 3E6CC 4ENKA 2QQOA 1K79A 5FZLA 5JZGB 5IVJA 3HOZJ 1FOXA 2UURA 2P34A 2QCSB 5FPLA 1UHMA 2HKOA 3V7CA 2GC3A 3PL0A 2O0YA 3OYLA 2R16A 1DZRA 4Y4YA 5IK4A 4CCDA 1UZYA 1DDNA 2HPMA 1AR82 1QQP2 4NWWA 2NVQJ 2WNOA 4N53C 4Y4RA 4JRLA 1XQNA 4DZGA 1MS5A 2FMDA 2LP0A 4FPFA 3S3OA 2RKHA 4PCRA 1FPN2 2VG9A 2Z69A 1JTXA 2W1SA 2RS51 4FQGA 1J1LA 2EINH 3WTSC 1K78B 4WF2A 3OWTA 1JJ6C 2JTVA 4NHJA 4Y13A 1EA3A 5H6RA 2XVGA 4WM7B 3HPHA 4Z2YA 5FLIA 2HWF3 5ERLA 2BOLA 5A7WA 5JWPA 2HI3A 1C4RA 3KGZA 1W0TA 3DEEA 4ONUA 2ZC2A 3FDYA 2HQNA 3SEPA 4BE1A 3TEDA 1OR7A 1BOBA 3QPTA 2R7WA 4HL0A 4QU1A 1X3ZB 2NMOA 4QX5A 4BOWA 3BCAA 3I64A 4XOTA 3MFKA 2PG4A 1FV3A 3ZDSA 2F6CA 4Z92B 1SFPA 2VONA 4YLZA 1VLNA 4FPYA 4PZJA 4G6DA 3JUUA 5EZWA 1N25A 2PTMA 1DZTA 5FO5A 2EXIA 5FRAA 2IPQX 3VOEA 1OVSA 1V54H 5F5QA 2XL7A 3R0RA 3A22A 2GC1A 1MGTA 3ZN6B 4Q4Y1 3QAHA 1RUOA 4AG4A 4Y3OA 2VKEA 5FKMA 3OPTA 5CZKA 2RVAA 3O1TA 4ZS3A 2VZSA 1FXZA 5A3LA 4LLGF 2OXBA 3VB2A 1K78A 9ANTA 2YS9A 4BH9A 3ECOA 3MLKA 1WPKA 3BQZA 2E33A 3IC7A 4AIKA 1QJX1 2IS2A 2UXXA 1FC3A 4O5VA 2QBYB 4AI3A 2GU9A 1XPXA 2E53A 1N77A 2DA6A 2BOIA 3NL1A 5E3OA 1AXZA 4YW6A 5KAIC 4AFBA 1ZGWA 5D8LB 5FZ1A 2VVFA 4A69C 1XJAA 4XICA 3GXUA 3IL2A 3TEWA 2Q2EA 2B39A 2MBFA 1NK3P 3FN9A 2D3RA 4DY3A 3EYYA 4S2FA 2DYSH 2ELJA 4P9FA 1ZREA 3I49A 2XDVA 1V5FA 1FZPB 3WF0A 4L9TA 2VW0A 1A04A 4JQRA 4U88A 4BIFA 2R6QA 2KIMA 3QP5A 2XJUA 3ZN6A 4I2OA 3H9AA 1F5TA 1R091 3BTCA 1UO9A 2R0HA 4CUAA 4S2GA 2XBO1 1AZDA 3ZM8A 2J7MA 4HSRA 4HBNA 5IP7J 2KD7A 4XIKA 2F6BA 2EFWA 1G86A 1OYYA 3OBTA 2KRHA 5CA6A 4NHLA 1DDLA 3BR0A 4DUXA 2IA1A 2R7VA 2HYXA 1UKRA 1BYHA 2W91A 4R79A 4MOAA 3AKTA 5F0FA 2XSDC 1LOFC 3S1NJ 1A31A 1NY72 1RJ7A 1V3FA 4FPGA 3PDQA 1W0PA 2NXNB 3POBA 2YX4A 1OCTC 5LRSA 1UY3A 1R1ZA 3JB4C 1BR2A 5E88A 1JH5A 1I5PA 5JR3A 1WKMA 4QPGC 2IGKA 3SYTA 3BIWE 3VHNA 2ZSHB 2HVRA 4YZ5A 3QU6A 3IPVA 1F4AA 1FWZA 1NUKA 2D93A 1OLME 4BQ3A 5EYYA 2JUCA 2R042 1ERDA 1PVC3 2LKXA 4JV4A 2FD8A 1ZTRA 4FP2A 2FQ4A 3LOCA 1SLAA 3VL8A 5CLSA 2LD5A 1T08B 3JD72 2DJNA 5DMYA 2OQ7A 4CUBA 3IDAA 1HRV2 5DS9A 2XGXA 1G2HA 3O0WA 5C9AC 1JYWA 3E5XA 1MEC2 2G9ZA 3ETQA 2WAQA 4XLFA 5FKOA 4LJHA 5E79C 1UYPA 4N4OB 4KH9A 4X6RB 4XW3A 3PQKA 3M3CA 4LKFA 1KEXA 1H30A 5AC91 5I8SA 4G7HF 1CESA 2IW5A 2QA4I 3UETA 3CUOA 5JI6A 3VYSB 3UV9A 4YEJA 3T2OA 4AK3A 3J81K 3FZ3A 4DXRA 2RS53 4P14A 2KDZA 4DQAA 3U4SA 2NYXA 2VNRA 1K5MB 3SKJE 2Z5UA 1IJWC 2C5DA 3O6BB 1ZBE2 2VPVA 5LBBA 4OU0A 4D9JA 4ORFA 5FLHA 3WGIA 2R92J 3PFIA 1F5JA 3VDDC 3SZPA 4EJOA 2TBVA 4CCEA 5L3DA 5FY4A 3H5NA 2H0VA 2BJSA 2B9SA 1LEBA 2AXLA 2OAZA 5IWFA 4G3YC 2VKHA 1D2QA 3J4UH 4KQ7A 3W20A 3GFJA 2EZKA 3KP4A 2D1VA 1BZWA 1SEFA 1UB9A 4BHPA 4QD2A 3PHMA 3UESA 3MGUA 4ENMA 5BYNA 2VM9A 2Z79A 1W8NA 3KT1A 4JRAA 1GZ9A 3G4SI 5TJJA 1RRJA 1CAXA 3LGRA 3GBWA 1NG6A 1YYNA 4YGEA 2Q8CA 5F3CA 3K4JA 3C2BA 4UVAA 1CF7A 3THCA 4MGIE 2I10A 5ILUA 1QOSA 2P6CA 2HXIA 2EZIA 3H1MA 5FZ6A 2F4IA 4CYCB 2E5ZA 4PLOA 2GA2A 4I76A 5BNNA 4D8MA 5FRMA 4Q4Y3 3W6JB 2O7OA 4Y15A 2JA6J 4I30A 3NWTA 2AQEA 3FXUA 1ETYA 4IEWA 1HW5A 2XPJA 4G12A 3LMMA 2K46A 3V0AB 1AX1A 3CCLI 3OOXA 1TW3A 1QJX3 2FXAA 4WXDA 1FYUA 2VOWA 3FBMA 1A34A 1SBFA 2C9KA 3S16J 3AP7A 4NOTA 1D0HA 1PNGA 2LS6A 1H8TA 4V1PA 3ZXGA 4J1XA 5FD6A 4PIXA 2G1MA 3CJXA 2GMPA 2KHMA 1W6OA 3OY8B 3VZKA 3F8MA 3VLBB 1Z3XA 4Y5TA 4JX4A 4A45A 2LF7A 2XB6C 2E7AA 1B59A 5CJ9A 5KHGA 4QQOA 4E2SA 2VUJA 2E7WA 1P4AA 1HXS1 1AXKA 3OYHA 3ELKA 4RAGA 3CU7A 1JN2P 1GOHA 3LSRA 1E5SA 3T1MA 3CMYA 4M3CE 4AIHA 2QZ8A 3KQ4B 2BBVA 3OUIA 2FDJA 1R093 3CUQA 2DFHA 3NRVA 2XBO3 1F35A 1X1CA 1BEV2 1A6CA 1TQ5A 3POJA 4NAOA 5LBEA 3EUHC 2ES3A 1YCIA 3VBUB 2AREA 2ZMEC 4XCBA 2E51A 2E36A 4KL1A 3V0AA 2WZPP 3OJBA 2ORXA 4RQPA 5F0HA 1YJKA 1RITA 2PI0A 4B3AA 1W8WA 4M3CA 4PDKA 1FBUA 1UIJA 2WT0A 5EYXA 4B09A 3PFYA 3CCMI 2WABA 2QCOA 2ZGKA 3B5LB 2OUHA 4RB3C 5DXDA 5CQGA 3WHBA 5SV5A 4K40A 5FKCA 2DA2A 5J96B 2RR11 1APNA 3D82A 4CEWB 3BJAA 3S1RJ 2V4JC 3MKWB 3OY8A 3LAGA 1XCVA 1BN5A 2GBYA 1UYYA 4B44A 5IAVA 2M0CA 3WF2A 1D4M1 3J7LA 4XHBA 5CQEA 1UPIA 1YQ8A 5IYYA 1SZBA 2IVMA 1F15A 1E3HA 3WD5A 2LK2A 1JZ4A 2MD0A 2GH8A 2ZFWA 1Z77A 2BY1A 2H27A 4ETSA 3K48A 1CJPA 5IJRA 3LSGA 2JXAA 3I2DA 1VPHA 3GZ5A 2VECA 3F2ZA 2W24A 1LDDA 4AYBN 4CCJA 3W21A 5FYZA 4TV7A 2C6YA 3GNEA 3J81Z 5A7OA 2EJRA 4HX8A 4AVAA 2KL4A 2RS12 2E34A 1R6RA 1W6MB 4G94A 2JRMA 2VBDA 2XUMA 1VI0A 4XF0A 1Y0NA 1UY1A 3VBUA 3JZVA 4RD7A 4XILA 3MW3A 4H2AA 1POGA 5FYHA 4MGRA 3DCFA 3NMBA 4KIFA 2K3FA 2D2WA 4XLEA 4HSJA 1GZCA 2IZWA 5CFCC 2VW1A 4F3JA 2R7UA 1U5XA 3WG4A 2A6EF 1W8UA 1QJY2 2DFBA 4L97A 5J40A 1WLTA 3WP4A 5E8AA 4WZCA 2HZTA 5C3PA 1NOVA 3WODF 1WWXA 1MZBA 1UAIA 4AQ2A 4F52A 3ZFFB 1YITI 4LKDA 1TMF1 5J09A 3GMEA 2R7RA 1WCQA 1J84A 2DA5A 4Q1RA 4W50A 3P3PA 4M3CF 3O1SA 4A6SA 3F23A 4KMFA 4EJWA 4OI2A 4N9HA 3ABKH 3ON7A 3TGNA 4M9XA 5FZ3A 5AFEA 1VQKI 1ND2B 1TNSA 3BR3A 3PJQA 4PIYA 3A01A 1SD7A 2ADUA 2B4KA 4IERA 1IGNA 4IEYA 1R36A 1VRBA 4GGGA 4AWXB 3U0ZA 4P1WA 5C8CC 1ETWA 1Y8RB 3SMHA 4XJUA 4FQ4A 4G8XA 4U7DA 2R7SA 2M4GA 4FVVA 1HB1A 1R5GA 1WW7A 1LGBA 3N7MA 4CGZA 3MYXA 2KA3A 3RZOJ 3EQEA 1RB8G 2E7TA 1GXQA 4KMUX 2VAUA 1WCDJ 2PAEA 1QZZA 3FXJA 1NA1B 4HLTA 1SLTA 4BIOA 1KQ0A 2WZ8A 3KZ4C 4XN3A 3KYCB 1EAH1 1GUIA 5EWSA 3SEQA 1UMQA 3TDZC 1HQLA 3D4KA 5EG0A 3ZFFA 3ZYBA 3QH6A 5IVBA 1YQ5A 3J7HA 3QBQA 4FPHA 4EE2A 2JDAA 3VDCA 2JPCA 3TNQA 2EWNA 5FYCA 2IXCA 3ZGKA 1K4TA 2KRCA 2PYTA 4JDMA 3ILNA 2K9LA 3ZN5A 1PO21 1YQAA 4QGNA 1O57A 5FTTC 2QGUA 4Q4ZF 2G4IA 4NRPA 3OD0A 5AFBA 1RUH1 2DT5A 4MX3A 4BJ0A 3SCFA 2GXGA 4CHUA 3JQXA 2WTEA 3F6VA 1A78A 3VBRC 2PA7A 1W6PA 1OUSA 4QKFA 4D69A 2DURA 4E4SA 5CVRA 3OR2C 2YBKA 5K9YA 2WFPA 5E89A 3CEWA 4B3XA 5FXZA 1Y4WA 4M73A 1PVEA 2RJKA 4FAGA 2IS6A 2R061 1LNWA 4QLCU 1HXS3 1KYWA 1TP4A 5E20A 1FSEA 1ITYA 3GF2A 5LA0A 2ZJCA 4AIDA 1DGRN 1DP7P 4OMZA 2FCUA 4QSHA 2CH0A 3SXWA 2OQRA 2XJVA 4HT1T 4HLYA 4IJAA 1SCRA 3S5QA 5HS7A 3C2UA 1TTYA 2Q5TA 4KWJA 4D7MA 4KWKA 1RUD1 2FBHA 1XNDA 3QCWA 2ZZQA 5JSOA 1W28A 4ASMB 4AHZA 4OQ8A 4KN7X 2F48A 2D6PA 2L9LA 1LESA 4AQ6A 2FZ2A 3NEUA 3VZNA 5AIQA 3LCPA 3WP3A 3IRQA 5ILVA 2YFUA 1RR7A 1AUYA 2RR13 2ZEZA 3JCUC 2PJPA 5ABJC 4RFT0 4ARXA 2EAAA 4A3CJ 4W1UA 4HRIA 1YFUA 3PUIA 3OUHA 2YUSA 3ACLA 4XFIA 4N8MA 1RTVA 5C4WA 5I0DA 3N9NA 4M72A 1AYM1 5KHJA 2G9FA 3MW4A 1VQ4I 1GYKA 4CPBD 5K5OA 4IHYA 2M9HA 4PK4A 6PAXA 3C7GA 1B6AA 2NOGA 5H9PA 2Y75A 2WO3A 5H20A 4E4DX 1OMIA 4L5EA 2XJTA 2C24A 1FP1D 2J1EA 4AEDA 4AVBA 4XJ8A 1XSQA 3A1YA 4H0EA 4BDYA 4A3DJ 2MG4A 3PU8A 1S29A 1B9NA 5DUUA 2ESHA 3MEPA 4NIAA 1EH8A 4UVCA 1LFBA 1WGXA 2DMTA 3UR3C 2VXDA 2VZ3A 1GZTA 1ZZCA 3CF2A 4E9KA 4Z2WA 2HXOA 3D5LA 3JSPA 1TNRA 4X8NA 2D6LX 1JZ6A 4WWCA 4M00A 2XAFA 4P9JA 3VN4A 3FHQA 2XLFA 1AR62 3TQNA 3AVRA 2ARAA 1ON2A 3RJ2X 2DTRA 1DQ4A 4IE7A 4QXCA 4MZUA 5FJHA 3AKRA 3OGJA 4DEQA 1YQ2A 3DL3A 2RHPA 3OIPA 4G6QA 1O8PA 5LHGA 2LYCA 3KZZA 3CMGA 2COMA 1XC5A 3Q8BA 2JG8B 4OHYA 3I3BA 2WA3A 3ACHA 1TMF3 2CV2A 2Q4SA 3I3MA 2VZUA 3QLQA 3OEAA 2Q0AA 4P9GA 3NJYA 1E3OC 1VBB2 2JG9B 5A2QZ 3LQQA 2DAOA 1Q8OA 4QWQA 2X0LA 3CCQI 4XORA 4OMDA 2MFZA 3DLAA 2VO5A 4XHXA 4XN0A 1EUUA 1PZ8A 3RTRA 3MEXA 3F3XA 1H9TA 2F4PA 1NH3A 3I2FA 4YYOA 2I74A 1FNZA 4L9NA 1M06G 4G6TB 5C3RA 2KM2A 3NAUA 5J1YA 5HOOA 2KJBA 4R9BA 3SCHA 2ZNZA 1D4VB 2YXSA 5LFAA 4CDQC 2WO2A 2UWCA 5JVTA 1I27A 1OYWA 2XAGA 2HTSA 2YR2A 2KDOA 4PDWC 2XQXA 1XE7A 1UMIA 3WQ0A 4IL7A 3LOIA 1IV6A 1PHMA 3G7DA 2IA0A 4MVTA 5B4NA 1O59A 1ZR2A 3RJRA 3OMYA 4YM2A 5FUIA 1KZHA 1EAH3 4GALA 2WNEA 4EN6B 2CSGA 2WO1A 4JX6A 1W9FA 3FUQA 1UU6A 4YFXF 5BNQA 2ZTNA 1IRFA 1FMD1 3FJSA 1D8KA 3BTYA 5T5OA 1SFEA 1E5RA 1PO23 3HKZA 4LK6A 3MW2A 2FBKA 4BHCA 1K4SA 2JDYA 4AQTA 3W9AA 1RUH3 1T6BX 1R1A1 3QPLA 4ZYEA 4MO7A 3CD6I 5CYYA 1T8IA 1QWRA 4XRSG 5A3UA 3ZFEC 5SV8A 2MD5A 4CP9B 5E3MA 1PJRA 1I1GA 4CUGA 4JGZB 1RUNA 3JB8A 2YX7A 2GNTA 4CZCA 3GBGA 1ZG5A 2H8RA 4HNUA 1VBD1 4BBRJ 3CQOA 4GMP0 4AU7A 1SD6A 1Q3EA 2R063 3M3YJ 1PIV2 3TN91 3GTKJ 3TYJA 3AZYA 3DXTA 3HIFA 2HWD2 2ID3A 5EDNA 1QOOA 4DJAA 4UF0B 2M0MA 4AHYA 3WG3A 1QNYA 4EATA 3QRFF 2ILMA 2DU9A 3I59A 1X8EA 1RIRA 1BBT3 3GZNB 5DM6F 1YFHA 1VR3A 3R05A 4GMP1 1QY4A 4A7KA 1A6IA 4NIHA 2Q8OA 1SD4A 1REEA 1QXJA 1RUD3 3JAMK 1UOFA 1JKPC 1E5IA 3P5JA 3A23A 1OD3A 3KCYA 4FOYA 2PHXA 2LR8A 5K7PA 3CLQA 5CVUA 3O5SA 2CUJA 1L3JA 3G6EI 2IUWA 3GHNA 3MFAA 3MIHA 3WG7H 2A1XA 5FYTA 2RGVA 3AXDA 1LEMA 5DAQA 2BERA 1VBC2 4K9SA 1Q1VA 2NM1A 2R5ZB 2VLAA 3MIGA 4O7XA 2JN6A 4C30A 3F8FA 4JGZA 4MXVA 4NRMA 1QDCA 2EXJA 4J6GA 4YRDA 3MN2A 3WGHA 1IG0A 3MIDA 4CXWA 1W2OA 1ASJ2 2M8EA 2GN7A 3OYCA 4Q4V2 1AYM3 2VB6A 1W5TA 3JRIA 3GWZA 2NVYJ 4IEJA 1I9RA 5F3IA 1QNWA 1O8SA 3DBLB 1Q8SA 3MKZA 4BPZA 2KISA 4C3IJ 3G73A 4QPOA 2QUFA 4EEFG 3COAC 4BNCA 5I8YA 3WW2A 1E57A 1JXNA 3AZZA 3BG6A 1MQTB 2UV1A 2EB7A 3T30A 2ADEA 1Q43A 3S3MA 2ZXHA 1H0MA 2WFF2 1CAVB 5CFDC 2A61A 1O4XA 2K27A 2LMDA 3OOPA 4BY1J 1D1CA 4ZPIA 1RL3A 4JHTA 1IPSA 1X82A 2BRTA 2PN5A 1W2TA 1OUXA 5KVRA 5LLQA 4DBQA 3Q0UA 2RVCA 5A3OA 3OYJA 3RQ4A 2A6VA 4O61A 3EBRA 3ESWB 4RYDA 4RHV2 2FQPA 4K1ZA 1H9WA 1IS4A 1IAWA 2EBIA 4P55A 2HDWA 3DBRB 4RS5B 5CNAA 4A93J 2XPWA 5A1LA 5T50A 4GB31 1W6NB 3IZOA 4AR2A 4DFSA 3M3EA 2PXJA 2XUEA 3KZYA 4D6QA 3P9KA 2D6NA 4BUPA 1LE8B 1EF4A 2L9SA 5FYIA 1PMIA 2W39A 3WOGA 3GTLJ 2Y31A 1FOD2 5FAXA 1C3HA 4AYUA 3G2BA 2KFDA 1IUFA 4OIOF 1UKGA 3T3YA 5FYBA 4PFPA 3OF1A 4WVMB 1R71A 4UI9L 2ZX4A 4FHTA 3GZTB 3K70C 3TW7A 1Z91A 4ZU7A 5HS8A 3ZXSA 2R5YB 3KCCA 5KHHA 4W6YA 3BI3A 3JBG1 4QPIB 4KICA 1Z67A 4RGAA 1X19A 1HCRA 1IRGA 1FIAA 4XL9A 2BY3A 1TW2A 3C2GA 2DQRA 1UMHA 2MNGA 1JHNA 3UJOA 1FSHA 1W39A 2HPIA 2I07B 2W3JA 1J0RA 5KHIA 1HA8A 4LK0F 5A6YA 1X9TA 1BIBA 2GQQA 3KM5A 1R64A 2QKDA 2XB5A 3WZ1A 1F43A 1IOAA 4RS5A 1D3YA 2YY1A 2MEV1 2WLQA 2IGMA 1WMFA 1W6NA 1CJDA 1GR3A 2OPTA 2R7QA 2PLV1 2DYRH 4W65A 4NPRA 1FMD3 2ZKZA 3FKIJ 1PK6B 1AJOA 3PMEA 1VRH1 1A6QA 1QEXA 1MS9A 2OPWA 3ZQFA 3PSIA 4C0BA 1XB9A 2DTYA 1VBE2 4CA9A 1MNDA 1LHNA 1H4HA 3IUOA 1TNTA 2M7BA 1R1A3 1JU3A 4Q4X1 4E7JA 1W2AX 1JYIA 4LT5A 1X1BA 2HFHA 4WVMA 1TQIA 2K85A 2QQPA 4DO0A 2JZYA 4FOWA 4C0HA 3H3ZA 3K2AA 3JAMZ 2QM3A 4ZDOA 4H7MA 2R5YA 2R072 4UBHA 4MHGA 4M6XA 4Y7NJ 2ZGQA 5HXMA 2JIJA 3TN93 3MKLA 3V4GA 2VMIA 3OV8A 4W6WA 2R4GA 3R0JA 4U36A 3MV01 5FRNA 2ZA9A 4V2VA 3OYBA 2XIGA 2QQLA 1OT5A 3T08A 5GZGA 5HLTA 1JT0A 4IGQA 2RM22 2W48A 3L2CA 1D1AA 2J1VA 4NHMA 2L7MP 1JBCA 3CCJI 2JA7J 4GMP3 1X2MA 4UW6A 3SLIA 3KYLA 3EO6A 5JXJA 1XU2A 5C6CA 2XONA 3TO7A 3D6EA 4DS0A 5C8WA 1PK6A 3T8RA 2Q8EA 4AGGA 5DM7F 3M7AA 1WD4A 1WH7A 1Q8PA 3LSEA 3ZYIB 3LFUA 3MF6A 5FYUA 5LEKA 1X8MA 2WBMA 3RCOA 1NE4A 2BBAA 3AL5A 4EQVA 4R9DA 4K21A 2VBBA 3V65A 4XQDA 3JRCA 3ZMTA 4XMIA 3HBLA 1OISA 3OS0A 4A7YA 2FX0A 3A0HC 4FSJA 3I2HA 4LIVA 3BTJA 1RUE2 3ZXJA 2K0GA 3AG1H 4QXHA 5FYSA 2DLLA 3B3QE 5KXBA 3T1LA 5C3EJ 5FIXA 3CZJA 2K9SA 5FZMA 1SMVA 3BG5A 3M8JA 2AUYA 3J8F2 1VP6A 3HGGA 1G9BA 3CLOA 2NQYA 4L11A 2V26A 2JT1A 3TP0A 3K4AA 3I2JA 2WAFA 1KJLA 4BE0A 2HWE2 4HX4A 5F5IA 2M2EA 5J6XA 2R7FA 3HQUA 2FU4A 1WCUA 3QACA 1G3SA 1J3PA 2K4BA 4OIPF 1NTCA 1U5TA 4NO4A 4TSVA 1RKWA 2XF7A 2XVLA 1MW7A 1QXRA 1F4KA 5C5TA 4U7BA 2W85A 4ABZA 1LRHA 2EILH 3ZMVA 1DU3D 1PO11 3WSOA 3GUDA 1AJKA 4ZYHA 4A3MJ 4GH4A 1SLIA 2XVCA 2KZVA 5GJ6A 2WRAA 3JCIA 4RR3A 1NCRC 3SQOA 3HRMA 4I0AA 2ZX0A 3ZYGA 1GV2A 3GO5A 4HK9A 4GB33 2OU2A 2IGNA 2A3XA 3H1WA 4P00B 5FROA 4OIRF 1N3QA 3WTWC 4PF5A 1F31A 1O3TA 2TDXA 3M70A 3MPPG 3LWFA 2JA5J 1J09A 2GOMA 1QOTA 3WUDA 3PU3A 1U0AA 3AFKA 4CEYA 3MZHA 5AVPA 5T5JA 4MG2A 1PMJX 4II2A 4B1RA 4F55A 5DUWA 1XMAA 1QF3A 3S5AA 1MR5A 2WV1A 3ZOIA 3HTUA 4E4ZA 1Q8VA 2WQZC 2VCBA 1D1BA 4CZZA 3FFZA 2JKBA 3MAJA 3PIGA 3VBSC 1S0DA 2QTWB 1YE9A 4N53B 3VDXA 3AKPA 3WW1A 2ACJA 4LO4B 3U14A 2VJ5A 1R7JA 3BQYA 3DPRA 4HQMA 3HRSA 3NAPA 2PHDA 3BROA 2JECA 3ZVXA 1JUSA 1D7PM 3BR5A 3JBG3 2QBXA 3IMNA 1USTA 2CNAA 5D5WB 3RJPA 3VKNA 4XKVA 1W2NA 2RQPA 1JMUB 3O1MA 1GP6A 2K2SA 4UFIA 3T4HB 1WW4A 3H9GA 4CTEA 1PUFB 5GP9A 4FAHA 1NLSA 4IEXA 2HWF2 1V0AA 2LRPA 3IKTA 4FPCA 1W0UA 3WUCA 2DCTA 4XBNA 3NARA 2RS31 3W59A 5CKNA 5H6QA 3AMNA 3ZXEA 4S0HB 3Q0VA 5F1RA 5ICGA 3RMXA 3WDUA 1TG7A 1CVNA 2PLV3 2ZJRF 2LSOA 2YC0A 2PHTA 4Q2FA 2PHUA 3POIA 1VRH3 2FQ3A 4XONA 4GQ7A 3OGRA 5G04L 2DCKA 1B9MA 4HOBA 1Y9QA 4Q4X3 3C7OA 2OF7A 5D6EA 3D5RC 1UIKA 2CW0F 4UUSB 2WB1A 4JOMA 3I97A 1OOPC 4UFMA 3BVCA 4N53A 4CCOA 1N1YA 4E8DA 4PT6A 1I39A 3SZGA 1OKRA 2HWC1 1LKNA 4G7OF 4M3EA 5K5QA 3TDUC 3S7IA 3HPGA 2R7ZJ 3DN7A 4O65A 5LBQA 5HI0A 3CO2A 5F1JA 1RYYA 4QKBA 1UW8A 4FPKA 1RVF1 1RHI1 3F22A 4XETA 1ZZ7A 5E1XA 1Y9GA 4IHTA 2BWAA 1YIOA 2ZJPF 2VMDA 2IS1A 1W8OA 5BNOB 3M4FA 2ZHKA 1DP0A 3BZKA 2DBBA 5C44J 4MFEA 3FXMA 1IF1A 5GLTA 1H2KA 3CDIA 3G1MA 2FBEA 2WA0A 4XC9A 3IDCB 1UHSA 1I3HA 1G3TA 2QQVA 5JOXA 5FV3A 1G8XA 1WLCA 3AKSA 2W47A 3L1PA 3CMEI 2L7FP 4RSUA 1S9HA 5A7SA 3GTPJ 5ACA2 1CZVA 3IBMA 4A6DA 2VY0A 1XN7A 4OI1A 2WIIB 5GLVA 2M5WA 2LKSA 4MGKE 5BUVA 4R1HA 5EYRA 4DXZA 1Q1HA 2R49A 2E2IJ 5F2WA 3S7EA 3TMOA 3J7YJ 3BOWA 2O14A 4JYKA 4YELA 1RUJ2 4HSLA 4JZRA 2RNJA 1RUF1 4CH7A 3TRSB 5C3QA 1LECA 4KGGA 2F4OB 1ZBA1 1ZZ6A 2ZXIA 1BC7C 5L73A 2RDRA 1D0ZA 1Z6RA 3NNMA 4BQ4A 4Q0VA 1T39A 1HV1A 4NIIA 4O3MA 4U87A 1ONAA 1R49A 3CC4I 1XYPA 1QJU1 4AVSA 4GRIA 2I8DA 5GPCA 5L3CA 1GWLA 2XAQA 1R23A 3R4SA 1MDMB 1C8M1 1ZQ3P 5A33A 1W7PB 4H14A 4HFSA 5AONA 3TWIA 3MCZA 3IRRA 2KIFA 4QKDA 5JCTA 4ZZ5A 4XLCA 1FYKA 3RZZA 2EV5A 1ONVA 2Y9YA 2R1BA 4LMFA 3K4NA 5KCMA 1PO13 3BKZA 1T56A 2IEKA 4QX2A 3ZQ7A 1LFUP 2P6SA 1Y8QB 1BW5A 4G7ZF 5FK8A 4ESBA 4AEDC 2X8KA 4OZOA 3SEZA 1PVC2 4ATFA 2V72A 1DYPA 3FXQA 4QQLA 4O6JA 1UZZA 1UU4A 3HOSA 4CVUA 5BS6A 4PJJA 1JOJA 3H50A 3IWZA 1H8VA 2F17A 4NDLA 2IXLA 4JBAA 4RB0A 2VZQA 2IRFG 3JTHA 5C9AB 3H0OA 4QMAA 1J5YA 4LTAA 2NNYA 1DGWX 5HS9A 3CJNA 5BPDA 2VUDA 3PNVA 4W4ZA 1MDMA 3PIJA 3CJRB 1K12A 1W7PA 1LOFA 3K2ZA 3AJZA 3OYGA 2EIJH 2V6CA 3CC7I 1UWWA 2RS52 3MF9A 3ZN1A 2J1SA 3WF4A 3UK9A 2ZHLA 1RUG1 3HN3A 3H9QA 1A3KA 1X50A 2ARCA 4LE3A 1O3SA 3ME2A 1HX6A 1MS1A 3IH4A 4QPGA 1VQNI 2DO7A 2RMU2 5HLHA 4H7LA 1DQ2A 3BCWA 2ZAAA 1J2XA 4XFBA 2RS33 2Z16A 1V4RA 4IEUA 4PJYA 3S14J 1WZXA 2YDEA 1XBFA 1OHFA 3H0GJ 3WW3A 2X1EA 3LEIA 1ETVA 3J7NA 2R93J 5E18F 2JDZA 2CAUA 4QX1A 1QXPA 5C7GA 2KP6A 1ULCA 3AJYA 3T4VA 5F39A 2ID6A 5FXXA 1ZX5A 2VZ1A 3RI8A 1WCKA 3H92A 1FNNA 1A8MA 4B29A 4LK1F 5C9AA 5FO9B 3I2KA 2C6SA 2DMNA 3ZYFA 4MH0E 1QQIA 3NKTA 5JSPA 4Q4Y2 2I5UA 3CJIC 1S0EA 2V6EA 2BXYA 3OIQA 3DV8A 1FIPA 5E17F 1YI7A 1DHKB 1DU0A 3SC7X 4F93B 1WCSA 3ZQLA 4IEQA 1RVF3 4M71A 1RHI3 1UELB 4COZA 2ELHA 2XJQA 1LB2A 1GICA 1MJAA 1YI9A 3WNKA 2X6XA 1MMDA 3QWLA 4DZPA 1TLHB 1OQYA 2PHWA 3HOYJ 1BI3A 2JDNA 4A42A 2QQKA 1QJX2 4EZ4A 2WQ8A 2VTFA 3ES1A 3DU6A 3VDDA 4HEA2 1AL0G 2BV4A 3KE2A 1COV1 3GM8A 2VOKA 1MSEC 1ZARA 1JGGA 4PJ0C 1WA4A 3LWCA 5JPNB 4QHOA 5D8KB 1Z1DA 2E31A 3P7NA 3A4CA 4BBSJ 2B45X 1ZN2A 4F3QA 4LHNA 5C3OA 1LVKA 2F4MB 3BR1A 4QX0A 3HPNA 3LIHA 1MZFA 4BDVB 2VL4A 3BALA 3LNQA 3ZFGC 1P6RA 4CXFA 3HJRA 1NHAA 2Y0SA 2O8QA 3AYEA 3SNMA 1OBNA 4NHKA 3APBA 3B9CA 1LJ7A 5C5UA 2OD5A 3FWEA 1ULDA 3THPA 1NXMA 4BM8A 1X3UA 2BFUL 3N05A 3NW4A 1LDKB 4BQNA 1QHGA 5JZGC 2WS91 4OAYA 2DWRA 2DMPA 2XBO2 4N7UA 2W68A 4EMSA 4IQJA 1TWGJ 1RUF3 4HVQA 2L7ZA 3H7YA 3POSA 5DAPA 4B4CA 1N1VA 1ZBA3 3H8XA 2ZMEB 1X33A 5IAXA 1GVJA 5BXXA 2WO7A 1WSUA 1NZIA 2OW4A 2OKXA 3U11A 5J8FA 2JVHA 5L19A 1AR83 3ZN0A 4GKYA 2M30A 4B1MA 1S7EA 1ENHA 4LEJA 2FDFA 5FWJA 4TWTA 1K6OA 3PUHA 2WZR1 5FWEA 3POGA 1C8M3 2CS3A 4F92B 3KP5A 4B7KA 1UQXA 4A3GJ 3H8UA 1SVLA 3GFMA 5HDGA 2FZ1A 5IYDJ 4LD5A 3RVHA 5EJZB 1ACIA 5GLWA 2IWGB 3T5XA 3BPZA 4WM7C 1RETA 4MXWB 5B1AH 1GP5A 2OZUA 3IDBB 1AR72 1ZKGA 3GTJJ 1YQ6A 1SBDA 2I2SA 1ZYBA 5JHUA 5IYBJ 4QB6A 1SQ4A 2BW8A 1OPCA 4A0ZA 4DXTA 2OVUA 1ZRRA 5GAGJ 3P9IA 3U2RA 4M74A 1W0NA 5EIYB 3P5BA 3J26N 4JQFA 4M3BA 2GMEA 2OPKA 2J1AA 4E8CA 3ECHA 5D5XB 4JTOA 5IT3A 1OVPA 2XL9A 4XF1A 1XPWA 1YX5A 3OSGA 5DAVA 1VJ2A 2BZDA 1S4CA 4N9IA 4XBLA 3EUHA 3A4UA 3FKJA 4EROA 4FE4A 5CEHA 4P96A 5DV5A 2ZMEA 2X6WA 2WV0A 2HDDA 3Q8AA 3ZMSA 1Y7BA 2JDMA 3IIIA 4CU6A 4TLFA 2XWJB 4DIQA 5EEGA 4F91B 2R0FA 2DTZA 2FMYA 2BE5F 1PNFA 1W9TA 1WZ2A 2AACA 1NE6A 2Y30A 3VZJA 5CFCB 4RGGA 5EEHA 5AC92 1XOYA 2B0LA 1ODNA 2QSFX 2EAKA 3ZXLA 4OUSA 2DFCA 3OYWA 2EZLA 3S1MJ 3NQOA 3RZKA 3BC8A 1RUG3 3HWJA 1FT9A 4R4XA 5BMZA 4LLFA 1IN7A 2DT7B 1G9FA 3ZYRA 2WN2A 3IB3A 3I0TA 4ZU5A 2A6YA 1YIPA 3FLTA 2BUKA 2QQAA 5FZOB 2RDNA 5FOJB 3IKWA 3WQ1A 2ERFA 2W7NA 5EHDA 4WK8F 2KPMA 2F2EA 4B43A 1CGPA 1JUHA 5C8CB 5DCMA 2A70A 2VBXA 5GZFA 1C8NA 2XB0X 4EV0A 4QGMA 4ZDLA 3NNFA 4FPJA 3CDHA 4Y24A 3HDDA 3HGYA 3JXSA 1E3PA 5DN2A 3ACIA 4HPKA 5CFCA 5JXHA 4YSFA 1SMYF 4BYYA 1MS4A 2R1DA 4LJZF 3H0DA 3ISPA 4EJUA 5CYVA 3PO2J 4ZYAA 3C7HA 3OB8A 2OX0A 3WF3A 4YVSB 2CU7A 3W5NA 3JREA 1VAMA 4X6QB 5EGOA 2TNFA 2GLOA 1MS8A 4U2AA 1W9WA 5FP8A 2DDBA 4CU8A 5FMDA 2DBNA 3ZDVA 5LD2C 2OTLI 2NYYA 1V6NA 2VTXA 2QQNA 2NAZA 1S0FA 2JMWA 2JE8A 4BQQA 1LHVA 2BOJA 1T33A 5J98B 5FZ7A 2JIGA 1YEWA 5L7OB 1IDZA 4K3UA 3U1XA 2AYHA 3VV1A 3WDWA 2CTVA 2ZOEB 4AF9A 1BKZA 4HPQA 3W3CA 4GAZA 2H6BA 5C8CA 2BW3B 4WVVA 1CQ9A 5JDBA 4CXYA 2CV6A 3KT4A 4L92A 1DG6A 2ZX1A 1ZRFA 3CJQB 1V5EA 4S04A 4MGQA 2F5EA 2Q30A 1HXS2 4IEZA 1B8IB 3HMYA 2R043 4HV5A 4CA0A 1UL9A 4WVWA 1WJDA 4ZDPA 1WJAA 5FY9A 1WLWA 4TXWA 3U1KA 5IK8A 3VBHA 4AW7A 1EH6A 2WT1A 2E1MC 1XNCA 2J1TA 2RE9A 2FF4A 5EPAA 3S3NA 4YGBA 5HLIA 2COBA 4AM3A 5C4XJ 2VU9A 4OHXA 2X1CA 4FPOB 3H1CA 4Q4W1 3H8RA 1J7KA 2QE3A 1MBHA 2XQRA 2WZR3 1AA7A 2VZRA 2MGQA 1D0YA 1GNYA 2E35A 4KN4X 4W97A 2HGCA 5T55A 3VBRA 2ENRA 4ZXKA 1K5MC 4FETA 3P9CA 1A35A 2XKOA 1W5SA 2WNVC 2AR6A 5M5XJ 1D4M2 3SQNA 1O4TA 2XV4S 3EXUA 2BW3A 3WR0A 4ISQA 3SKVA 4LG0B 3RSNA 4E7SA 1YG2A 2W08A 5DYMA 2Y9ZA 4QXBA 1B8IA 1VF9A 3MD2A 2L2OA 2AEZA 1GV9A 1KQ8A 1BJQA 1KGYA 3OS1A 1Z05A 5D8AB 1T0FC 1DYOA 4XFFA 3R4DB 3S93A 2AS5F 3OYNA 1CD3G 2LTNA 5D5UB 3K75B 3L2WA 1FAYA 3KV4A 3AZWA 2V9PA 2YPJA 4B4QA 2R32A 1WW5A 1DUXC 1YNAA 3D0SA 2VGDA 1PGW1 1E0EA 5TRDA 4II3A 1JTYA 3RI4A 3BG7A 2HU9A 4HKOA 5KR7A 3K4BA 2VULA 3ACFA 5L3BA 4A3XA 1QKQA 4EJRA 4CYDA 2DA4A 2NOJB 5LA9A 4FBFA 3ZCOA 2R7OA 1CAUB 3PJYA 4CRQA 1PGL1 1SC7A 3OSDA 1FX5A 1R22A 5T52A 3FMGA 3LSKA 4A3LJ 3LEMA 5ABJA 4Y20A 4DB5A 1TMF2 3L2VA 2CW7A 2DCEA 3E1SA 4HW0A 3GGLA 1MJ9A 3GEZA 3HOUJ 1MBEA 1Z0XA 3KPHA 3F9KA 4YVWB 2JDPA 1O3QA 1XCBA 5FD5A 4YFWA 4Q5OA 3SHRA 4XKBA 2KLOA 4GO1A 2V79A 3UKGA 1PP8F 3IH2A 4ATEA 3K3NA 4XAAA 4AWDA 3N7JA 4GWIA 1EV7A 1GNHA 3WTXC 4BEHA 5E1RA 2CQKA 4N4NB 1XS9A 3ATGA 2I45A 2P8TA 1T2KA 4LPLA 3I2OA 1R1VA 5ICFA 3DKYA 2W5FA 5EZGA 4KWLA 5KXCA 4FTEA 4D5CA 1QGLA 2FBIA 5FUNA 2ZKNA 3ETPA 3WXPA 5JR2A 5GZEA 2HLEA 2KJCA 3AMHA 2X29A 3BOQA 1Z7UA 1EAH2 2RNGA 2YROA 2EXKA 1HJFA 2E1OA 1IS6A 3VBOC 4N90A 2QQIA 5HCAA 2Q1ZB 4H4KC 3HR9A 4DYCA 3K51A 1LU2A 3ZP5A 4CICA 4X1EA 2VOTA 4LBNA 4XJAA 2EVXA 4KUMA 5FQ0A 4QT6A 3F72A 1PO22 1LOAA 1JHHA 4I99C 2P17A 4PGGA 2CG4A 2LREA 5HV4A 4CEWC 4NPMA 4BXFA 1RUH2 3FHNA 4CCMA 1T95A 3LD8A 4M6VA 1YRNB 1ZHFA 4PIZA 4FXKB 1YOVB 3WTUC 3ZFEB 2B8MA 4J00A 5CADA 2L4MA 3WHTA 2R7DA 3O14A 5IT9Z 1JI6A 1KXGA 2FUG2 3AYAA 3WTVC 2FRHA 1XSDA 4CDQA 3LSIA 5IVVA 4UT5A 2XR4A 1D2SA 2R062 3ZXKA 3L9JT 1YLLA 4PDWA 4UFHA 3RS6A 1MS3A 3I54A 2O6GE 2PFBA 2D3SA 2LLKA 3CJTB 2VZTA 1CZSA 2BZTA 3K77A 2G0EA 4D7NA 4L18B 2DMUA 4HDUA 1YW7A 1P92A 5D5VB 3QYFA 5E3LA 1T98A 5KAFC 4NQWB 1URXA 2JVGA 1UF2C 3CMMA 1Q5OA 1OF4A 1RUD2 3D8CA 1J1TA 4YW1A 3DECA 3HRTA 1JZ3A 1MSFC 3AKZA 4IRIA 2BQPA 1H89C 2EIMH 3OBRA 5M5YJ 3I8TA 1NQDA 2YU2A 4COWA 5H9RA 2DODA 4YNIA 4Q4W3 2Q2EB 1FI2A 1LOBA 3MVPA 4ZJZA 1U8BA 2HS5A 1S55A 2DOEA 5I0RA 1YRNA 4BJ5C 3CCVI 1ZM1A 5A6XA 3ZFEA 1S3JA 2VMFA 4JKMA 3DF0A 4I3GA 1T6GC 5J8CA 2VQHA 1H88C 4IX7A 3D0JA 4RGXA 4BA6A 4ZZLA 5JOYA 1VBB1 3MLLA 2ME6A 1MJBA 5FZFA 4A0XA 1J3QA 1AYM2 2K9NA 3BP8A 4CP2A 2YPRA 3FMQA 4IUGA 4IOCF 5IW0A 5FFOC 1ND2C 4MSVA 1HW2A 1W8ZA 5LY2A 2ZX3A 2V5DA 1XDUA 2ISYA 2QYOA 4CCCA 2EV0A 4X8PA 3AP6A 4CU9A 4ZTJA 5LBFA 4YGCA 1V6MA 5ANQA 1Y39A 4IE5A 3K1MA 2GP3A 2XGDA 4FX4A 2W1WA 5JLXA 1DFQA 4L0YB 2VQCA 3GLLA 3RZGA 4A44A 3K3OA 4NQWA 1YXWA 1UCXA 1H6YA 4YG3A 2O5RA 3K6GA 2EIBA 2YUEA 1WGPA 1OLRA 5J7MA 1ST8A 1BK0A 4WBBA 5EJCA 2E6VA 5CBLA 3ZMZA 5LGUA 1JE8A 4LOCA 1NA1C 4SBVA 4M4PA 1IS3A 3VFZA 3R4KA 5T3NA 2CW8A 1XE0A 2CUFA 5J4VA 2X9DA 3F0CA 2ATFA 1O5UA 5IK7A 3GTOJ 4UAPA 3ZR8X 3IPVB 1LOCA 2WWUA 1BL0A 4YM0A 4IRGA 3BYWA 2CUEA 4L99A 5FZ8A 1TZOA 5FBJA 1R5ID 1PZ9A 2P5VA 4BE2A 1TVGA 1X36A 4EN9B 2X6OA 4IO9F 3THDA 2QWWA 1N78A 1G9DA 4MGTA 2A5YB 3QQAA 1WMEA 5FY1A 1SDWA 1SFYA 1J9IA 2X1DA 3M3OA 2BHYA 2IXSA 5IT6A 3I53A 2QQBA 1QIQA 3G3ZA 4OZXA 4UUTA 2JDKA 2NMNA 4ZU4A 2HOEA 3LEKA 3GLXA 5C3SA 3GYDA 3ZRGA 3ZMOA 2L9VA 1GNZA 2WADA 2YHJA 1BK1A 2L9NA 5CFDA 4CUCA 1IZ1A 2MLGA 2AH2A 3KV9A 3E6DA 3UKVA 2HWD1 2D5FA 4A3EJ 3H42B 2VBZA 1U78A 2ARXA 3I3LA 2VKDA 3PNTA 4CE8A 5L9BA 1ZZ9A 4EVIA 5E1ZB 2L5QA 3PVOA 2MA3A 4UB8C 3HSRA 4P02B 2ECBA 4XURA 2E9QA 4IV3C 3MKYB 3Q9OA 4KNYA 5B5EC 3K0LA 5CB7A 3TOBA 4NR1A 3MV11 1XNAA 1FMD2 3ZQGA 4BXSV 1HRI1 3ONQA 4PFOA 1CAXB 1GLNA 1K6YA 2Y26A 4J19A 2ZGUA 2EZHA 1OLMA 4AYBA 4JKLA 3WGGA 1IG3A 4AI2A 2QQMA 1R1A2 2JE7A 1CF7B 1RPWA 2VOXA 3WDVA 3POWA 1GU3A 4WXHA 2BFUS 1XGNA 3N35A 2C0ZA 5BNNB 1STZA 1Z7S2 3I5UA 2JJ7A 2GNBA 2YYOA 2Y6KA 1U8RA 4YZ1A 5T54A 1VBD2 3WHUA 2L7KA 1BLZA 2VOVA 2VJ4A 5CVJA 3BGAA 1LKXA 4N7IA 1VQMI 4GWMA 4ZY9A 3TN92 4IETA 3VD9A 2NRAC 3I7DA 2BY2A 1VALA 5FP7A 3U37A 5M3FJ 4ENJA 3GX4X 3K7AJ 4HKLA 5JXIA 5HDNA 1MNMC 2XWBB 4CPBA 5JLVA 1M4WA 1U2WA 1H8TB 1QHHD 1R4MB 5FMOS 1W6OB 2FSWA 2Y60A 1BBYA 2BGCA 4LA2A 3FISA 5HODA 1RXGA 3WNMA 5LHHA 4ET7A 5JPMB 1A8DA 1S5LC 2K86A 2JG8C 3ILFA 2M45A 3IAM2 2LKPA 2A05A 4UOJA 3G6JB 3LFIA 4XAEA 1JYCA 3BU7A 3CBNA 3Q9SA 1AU7A 1AOYA 5M5WJ 3VODA 4AXOA 3H3UA 2WZEA 3LSMA 3IHUA 2JPBA 5GZCA 3LA3A 3LSTA 4IXAA 2JG9C 3CCRI 3M07A 2VVDA 1DYKA 2HQRA 2NVXJ 3OYAA 1VBB3 4COVA 3CUQB 1DQ1A 1G9CA 3K4MA 3DYOA 4IE0A 3J7ZI 2Z3YA 4XF9A 4C2MJ 2P2KA 3HNBM 1POV0 2Q8KA 4RQPB 1X4PA 2A6ZA 4E2GA 4M3CB 4YPJA 2VE1A 3DTIA 1D5YA 1W8TA 1EV12 5CG8A 1YQCA 2XF6A 2XKPA 1I50J 4P5OA 1UXZA 3N9QA 4F7ZA 3H36A 4LUMA 4LLNA 1IN5A 1V9U1 3KV5A 2QQ8A 1DQ0A 1BQPA 2HVSA 3B93A 3NSTA 3DLLF 3BTIA 4NC8A 4B3NA 2JSPA 3WDTA 5D4RA 1VMFA 2V1XA 1POV1 2DDUA 3X2QH 2YPDA 1FPQA 2ZXJA 2CAVA 4FFIA 1WI3A 4LBMA 2WDBA 4OMYA 5G05L 3QH7A 2R7EB 1HQNA 1QZEA 1B35C 1VQ8I 5I0TA 2Y33A 4BQOA 1RC6A 2D97A 1I1EA 2QDRA 4QDQA 4MHRA 3W6KB 3TAYA 3HT1A 3DPTA 2HEVF 2VKVA 1U5IA 3WINE 1BR1A 4M6YA 2UYBA 4GB32 1TEIA 3ZKYA 3LAJA 2VCAA 1LPQA 1S2BA 2OCEA 2GP5A 4FTSA 3C3VA 5IP9J 4NROA 3TKYA 5A3PA 5LA2A 5HXVA 1V70A 4U0VA 2GA1A 2VQAA 1USSA 1VBE1 4Q5SF 3U78A 1DGRA 4S2DA 3GVAA 4FOQA 2HBTA 3IV5A 1YC61 3ZXFA 5J3LA 4BAYA 3LE0A 3V7RA 4LNVA 3V8JA 4MNUA 3IMMA 4YG6A 2HOAA 1AYN1 1HKDA 2PAKA 4U0WA 1XB4A 1SAXA 2VXZA 3VD4A 4FPLA 4JTNA 4Q1PA 2R071 4K7JA 4G9YA 2XAUA 2IC1A 2H1KA 1D5VA 3H3VK 2VOPA 1HW1A 3VYRB 3JBG2 3FC0A 1PX3A 2HWD3 1WKYA 1H2NA 3AP5A 3GCXA 1UG2A 5IFTA 2A5ZA 2ZX2A 1WHUA 4HOOA 1SFOJ 4C1XA 3VZLA 2DA1A 4N0BA 1NKGA 2HVQA 2W84A 3ASOH 2G7UA 4GYIA 4NAMA 4D6RA 1Z78A 3IDEA 4OCTA 5KC6A 3UKTA 3WE2A 5FZ0A 4S2HA 1NCRA 1FMVA 3HTSB 4LHLA 3L09A 1DCSA 2MEV2 2X10A 3A01B 1GP4A 1NAEA 1X58A 1AR92 4QX7A 2PLV2 2L9RA 2A6WA 3CESA 1NYWA 2Y6JA 5FY5A 2YGMA 2LM3A 1XD7A 1HRI3 4LG3A 1VRH2 1ZRCA 2DVBA 2Y8KA 2TCTA 5I93A 1YHQI 4NN0A 1P4WA 5H9QA 2VR4A 4QGLA 3PJRA 1UZVA 4Q4X2 2D6OX 2FCVA 5JR7B 1Z9CA 1TWAJ 3PIPF 3I71A 1Y3TA 2WL1A 3HSEA 1JKQC 3VBSA 1TT0A 4Q4V3 1FOWA 4EN8B 1RUI2 5EG0B 2ELKA 4LO6B 1P7IA 4MYEA 1MH4A 3MO4A 4WX9A 5FPUA 4D1QA 1BI0A 1YWKA 1GKBA 1Y1VJ 2W46A 1MQTC 2ZBJA 1U3EM 3T0YA 2ET1A 3NO8A 3LSJA 4OHZA 2R7TA 2Y0IA 5FLVA 2O03A 1UFMA 2ZGTA 4FO9A 4IEVA 2VBYA 1R58A 2P1BA 1ULEA 1IKQA 4RDUA 4ZZDA 1W6PB 1YJ9I 2OBPA 4HKWA 3DXUA 2CGOA 3HJEA 3PO3J 1W6QA 4LHSA 4RHV3 3BG3A 3IT8A 1DGRM 3WG9A 4QWNA 4RFRB 2YSRA 2RV8A 2D6KA 3DUIA 2HOSA 4A41A 5A2QK 3AZXA 3BJ6A 3W2WA 3I55I 3TO6A 3URFA 1JYVA 4NJ4A 3IIAA 4XFCA 3VBFC 1O6UA 3AM2A 5GADJ 1OOPA 3G1OA 2BEOA 1VBA1 3P6BA 4NUBA 1CPNA 1XC6A 2AC1A 2MHFA 4IZZA 1F5FA 3VBHC 4LBQB 1SVMA 5A6QA 4FFGA 3DTEA 3MWMA 2ZMLA 1YS6A 4Y1YA 3HBZA 4ASNA 3R4UA 3LIGA 4H55A 5F5CA 5FZGA 4P9WA 2NPIA 1OKOA 3WNLA 1FP2A 3JRBA 1RKTA 5L9RA 3VD5A 1U9OA 1V9U3 1HBXG 4NC7A 2WNUC 3SHFA 1KS4A 2M34A 3KLSA 1XTAA 2E1NA 1DLLA 4COYA 1N75A 1XGOA 4QPIC 3KF5A 4XM3A 3AMMA 1POV3 1VQPI 2X53S 4L9BA 1A5JA 2BU9A 3CCSI 1JOPA 2A3WA 3KLNA 1XNBA 2F5CA 4NC6A 4AIJA 3ZMUA 3JW4A 2P5BA 3ZXAC 5C4WB 4NBQA 1PO12 4AI0A 1IV8A 4BQYA 1GT0C 3GYHX 3LDBA 4HMZA 2V9VA 4OWRB 5J1XA 3FBNB 3DP7A 1ND3C 2ZGPA 5JMCA 2CFXA 2LY9A 4UXAA 3WU0A 1AX2A 1UZWA 4AEDB 2RC4A 5ICEA 4C1WA 1ZH5A 3GZAA 1BIAA 1BBT1 3I2GA 2A5WA 1RXFA 5HPOA 4LBQA 1QBJA 4LB5A 3F21A 1GV5A 2EFQA 4QM8A 2A68F 4RA2A 2G9GA 1W7PD 1VBE3 3FM5A 2DCYA 2JDHA 5DUVA 3MICA 2QQWA 3CF6E 2VQLA 2HTJA 2WN3A 5GTHC 2GIVA 5H2FC 3BTAA 4OHWA 4HBLA 1RJ8A 3QD6A 3D5SC 3MI8A 1KU9A 1KGSA 3H9JA 2YFZA 1R081 1AYN3 2Y69H 3ECQA 4IF4A 3IAQA 4XLHA 1OCPA 2P3IA 5FKKA 2NLRA 4YZ4A 5GKAC 4EYUA 3HZJA 4YG0A 3WDXA 2R073 3BPVA 3S1QJ 3RG0A 2UWAA 2ZXWH 5LZ6A 2ISZA 2V9KA 3N97A 4YM3A 5JXGA 5J4YA 2YGLA 2P3JA 2ZABA 3SEEA 1R00A 2AO9A 3QPHA 4XQWA 1S0JA 1UMZA 3ML6A 1H6XA 1HB4A 2PMWB 4HETA 4RN5A 1JZ5A 4XJWA 2P5LC 4XFAA 3MFCA 4LE4A 2HYGD 1FTZA 1HQCA 1OQ1A 2NVTJ 4KT5C 1K7AA 2O1QA 2RS32 1UG0A 1BOAA 3BPXA 4RGUA 3VZOA 2DOFA 1OFSA 1U6GA 4PJLA 2A73B 3GW2A 5F6KA 3BODA 2Z4FA 2A6HF 4RB2C 5ACA1 1G4DA 4PSXA 1WI9A 5A3MA 4C3JJ 2D6MA 4URTA 5JOZA 3PNAA 4B47A 1NG7A 4ON0A 3FZVA 3KVAA 3CNAA 4L9VA 3C3WA 2VNOA 3E1F1 3ASNH 2VJIA 1CZTA 3T0BA 1PM7A 2H94A 2HZDA 3EJKA 3LF7A 2HWC2 1RUJ1 2DYCA 1WQ2A 3K4DA 3CJIB 5FJKA 3S57A 4A5NA 4ITVA 4M0HA 2XROA 5CVVA 1RVF2 4LO7A 2VUAA 1TL8A 2WWSA 3I2IA 1CONA 5JIUA 3C7FA 4KYWA 5L36A 2D98A 4J1WA 3TEZA 1IC8A 2DOAA 2RJLA 4FPEA 5EJ3A 4JDNA 4IEPA 4UY8I 5FKNA 3UL2A 1PX4A 3K10A 2VC1A 4DUVA 3TBIA 1SD5A 2IP2A 2V7FA 2DFEA 1XMXA 4AVPA 1YI2I 5F5AA 2WUHA 1SFNA 2VODA 4XJ9A 3E6BA 2IXKA 3OGSA 3S32A 3IAS2 4GXLA 1TME1 1ENXA 3KF3A 2M87A 2JB4A 3H8OA 2DA3A