4I09A

Structure of the mutant catabolite gene activator protein v132l
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
204
structure length
204
Chain Sequence
PQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKLGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 58
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i09A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i09A01
3R6SA 4MHGA 4LGWA 5JSRA 2PN6A 4A12A 3MEXA 1WI9A 2RC4A 5CVIA 4KFCA 4NB5A 2EA4A 4OMYA 2E9QA 1QO0D 4ENJA 3BROA 3ML6A 1EV7A 4IEUA 3WTZA 5KK1A 1ONVA 1OMIA 1O3QA 1HKTA 2YSRA 4A5NA 3FZVA 3R0AA 4EWEA 4WF2A 1B4AA 3NW4A 3CO6C 2L4MA 4RS8A 3QP5A 2B8MA 2YPRA 2CAUA 2K0GA 5LRRA 1J58A 3VODA 1IN6A 2IXHA 2VN2A 1YW9A 4YSFA 4RGSA 2DFIA 2QYOA 2GQQA 3ZPLA 3HTUA 4R52A 3H1MA 2DI3A 3TOAA 2UYAA 2QM3A 4RGRA 4M72A 4YIIA 1H0MA 4A6DA 1ULYA 1EH6A 4YFNF 2AS5F 5JSPA 1GQGA 1ZRDA 4QX5A 1UIJA 1SD5A 2D5FA 1Z91A 2VE8A 3FHIB 2IA0A 2CW0F 4MQ9F 1CAXB 5ILSA 3ZMZA 1ON2A 1PDNC 3F72A 3E3VA 3F8MA 2XV4S 3ZP5A 3S0MA 1ZAOA 2P7VB 4WX9A 1J9IA 4IEPA 4Q48A 4ZYEA 1E2XA 1R36A 1ZYRF 4CYDA 1U2WA 3ABUA 4HA8A 2IPQX 4LB6B 3ST7A 3SXYA 1FBQA 2K86A 3NEUA 4XFGA 1XDSA 1J0RA 2Z3YA 3O14A 1FSHA 4HX7A 4UXNA 2UYBA 1CAVA 5H6RA 1LKNA 2GZWA 3RKYA 4UV9A 4KIBA 2VT3A 4O9GA 4XF4A 3LQRA 3FMRA 4BNCA 1Y3TA 2QBYA 2UY8A 3NRVA 4M9SA 3GVAA 4E2QA 4DQ2A 1QXJA 1T6SA 1MGTA 1BIAA 5DEQA 3M9AA 1U8RA 2IXCA 3H7YA 3CL1A 2R3SA 3U1DA 1XCBA 3F6OA 4LUMA 2RDPA 2DTRA 2UXNA 3BU7A 2MA3A 2HR3A 1SD6A 1SFUA 3LA7A 1JHFA 4LK0F 3F8NA 3IDBB 4O9EA 4L9JA 2O61A 2CAVA 2V09A 5K5QA 3C7JA 2KIFA 5FLXK 3ES1A 5FPXA 2FMLA 3C1DA 3GF2A 4Y15A 2J5PA 5BPDA 1O57A 3BDDA 4E2SA 2Y0OA 1BI0A 2XAHA 3ISPA 3ERED 5I0RA 1W4MA 2CV6A 4IEOA 4AXOA 2QENA 2F5DA 5CVRA 1Z05A 3IIAA 4IEZA 5KHGA 3TO6A 1KU7A 4HVQA 1FNNA 3RI4A 2V9VA 2GXBA 2GC1A 5CYVA 3E5UA 3NSTA 2PAKA 1ZG1A 4L11A 4FAHA 3B02A 3MZHA 4GCVA 3V8LA 1ZRCA 2VT2A 4B09A 2XAJA 4XFHA 4CO8A 3EBRA 1YS6A 2F5CA 5BMZA 4XFCA 3ELKA 1WQ2A 2HTJA 1B6AA 4N0BA 3LZZA 4I09A 4HSJA 3SQNA 1IZ1A 1SFNA 5J3UA 3H92A 1NE4A 4XF9A 1XGNA 4G6QA 4IRIA 2A6EF 3CUQC 2D40A 1J3PA 2P5LC 2MLKA 4L2NA 3CUQB 3ETQA 4IEVA 4HF2A 5E8GA 1BI3A 3R0JA 3LA2A 4OMZA 1HQCA 3EDPA 4HQEA 1VR3A 2PMHA 4ESFA 4KU8A 4EMSA 2WC2A 1S8NA 3EUHA 2GC2A 3RKWA 4MV2A 4BH9A 3PNAA 4JTOA 1MD0A 4PCQA 1YO5C 3HQXA 1MJAA 3O3KA 3HRUA 2PFBA 1XGOA 5LLQA 1KU3A 2HYGD 5JFRA 2EVXA 4PJYA 4XLNF 3FM5A 3COAC 4J1WA 5HS7A 1XE8A 2LDUA 3RPUA 4GO1A 3CLOA 2XIGA 2GIVA 4KIFA 2FBKA 4EJTA 1SD4A 4LA2A 4PDKA 4D7TA 3T8TA 2Z69A 4YFKF 2ZJ2A 1DUXC 3HT1A 2XLGA 1ZX5A 4KN7X 3WU0A 4QM8A 2GWRA 2FBHA 3QPHA 3RPQA 3F8CA 4MEXF 2N7GA 1U12A 2O8XA 4XSXF 2A61A 2JPCA 1LB2A 1OKRA 4ON0A 3O6BB 1BOAA 1X7NA 2ESNA 1JUHA 1IRFA 4HDUA 2D5HA 1Z7UA 1R58A 1KU9A 2IXJA 1IXCA 4MGIE 2UWMA 2ZKLA 1BJAA 2HQNA 3EETA 3HT2A 2YX7A 1YYVA 4ZYDA 1XSVA 3DEUA 3ZMVA 2QVSB 2OPKA 3GLXA 2NS0A 5E17F 1U6GA 3WODF 1O7FA 1C0WA 5E1ZB 3SHRA 5ERIA 1JHHA 2WWYA 5HS9A 5BPIA 2P5KA 2W85A 2ZBKA 3F22A 1K6OA 2QUFA 3KP5A 2IT0A 3F3XA 2UXXA 1LR5A 1O3TA 3VHRA 5LGTA 1ZRRA 3DF8A 5LGNA 2PHLA 3LAJA 3MDPA 2R7DA 1DGRA 3K69A 1FC3A 4G7HF 3DQVC 4A6EA 5D5VB 2BBYA 1T0FA 1TQMA 2PJPA 4S04A 2XAGA 4BQAA 4YNIA 3FJSA 2NNNA 3MPBA 1ZNPA 2Q4SA 1J75A 4UVAA 5FFZA 2BNMA 1H1IA 1QBJA 5FLXZ 3GFMA 4G94A 1Q43A 3H3UA 2OU2A 4RD7A 4AQ2A 3BOQA 2PA7A 5E1RA 1RIOH 3H1WA 2VC0A 4XF3A 3M70A 1I1GA 4IRHA 4L18B 4RB1A 4K2EA 1EH8A 2KIMA 1SD7A 3WW4A 2L4AA 2HKXA 5FD6A 3KP6A 4IESA 1HKQA 3P9CA 3J81K 2PFWA 3E6DA 4MGYE 1O3RA 5I0SA 1KYWA 1TQPA 3PQKA 3S2WA 2X4HA 4HOBA 1FYLA 4QLCU 4XBFA 1J3QA 4K8FA 2V79A 1PM7A 3BB6A 2QWWA 4IXAA 2E1NA 1LJ9A 3TNPB 5D4SA 2DQRA 3M3IA 4I0AA 4RB0A 4UBHA 3NKTA 2ZNZA 1P4AA 3GYDA 2HFHA 1X82A 2QBYB 1CAWB 2ETHA 2LNBA 2D1VA 2I45A 2E7WA 3HSFA 5D8LB 5AIQA 4R1HA 1PMIA 4YG2F 3CLPA 2OQRA 5LEKA 5CU1A 2NRAC 1D8JA 5CVUA 2A6HF 3IKTA 4ZYGA 3E6CC 3L09A 1I1SA 2RQPA 1MZBA 5L3CA 1HBXG 4G7OF 5E16A 3B73A 3IHUA 4I98B 1YQAA 4UXAA 4YIFA 4WXHA 4AQ6A 3IKVA 1ZHFA 1ZG3A 3BY6A 1PUEE 1IN5A 4PIXA 5LHGA 3NL1A 2XKOA 2RN7A 2NAZA 2XKPA 3F6VA 4CZZA 2DO7A 2M8EA 1BC7C 4WZCA 4MEYF 1U5TC 2F5EA 4HYEA 2XL9A 1YIOA 4FT8A 4XF1A 1HXDA 3BJ6A 2MD5A 4XFIA 1U5TB 5D1IA 2YU3A 1R7JA 3ZMSA 4BIFA 1GVJA 4WXCA 3EJKA 3E5QA 3SZPA 1S7OA 3I58A 2EA7A 3LWCA 1HKSA 1HSTA 2IW5A 1YFUA 2F2EA 5JCTA 1UCRA 4Q0UA 2F4PA 2STTA 1VTNC 2W25A 5I8SA 2E7XA 5DV5A 4LULA 3ZMUA 1S7AA 3FM3A 2GH2A 3EHKA 2EAAA 1JE8A 3U2RA 3GZ5A 4KYWA 4BXUA 5FB2A 1BM9A 4M6YA 4U0YA 4XFAA 2PLYA 3I54A 4KU7A 3BWGA 4O3MA 2FNPA 1FSEA 1RZ4A 2P5VA 3JTHA 2HDCA 4Q5SF 3IRQA 1BN5A 2XROA 3J80K 1XGSA 3JSOA 3NJZA 4LD5A 4QGNA 1IAWA 4NHJA 1MDMB 1YG2A 4HBNA 2J5OA 2QCSB 3OOPA 3LOIA 5ICCA 2JPBA 4I02A 3AAFA 1WWXA 3H7JA 1O3SA 1XDUA 3LAGA 2ESHA 4RB2C 1ON1A 3CJNA 1K78B 3NQOA 4KMUX 2M87A 2HWVA 4HX4A 2QNKA 1D8KA 5DUKA 2ZNYA 4AWXB 2XAQA 4MX3A 4MZUA 2A5YB 3C3WA 5BOXA 2ET7A 5EEHA 3DL3A 4LMYA 1OD5A 3SXWA 4ESBA 3MYXA 1IRGA 3VFZA 4LG0A 5BS6A 1OYIA 2ZMEA 2ETEA 2B5HA 1IN8A 3CO7C 4BHCA 2EFWA 4MGZE 5JHUA 1YLFA 2Q0OA 2ZFWA 3C18A 1L3LA 3GXOA 4EJVA 2WFPA 4Y17A 3RYPA 1FBUA 2LF8A 2DPUA 3CDHA 4LLGF 1ZGAA 1QNTA 3KFWX 2B9UA 3BCWA 2W57A 4ZZDA 5L3GA 2MH9A 3JSPA 3DKWA 3CUOA 4J1XA 4HW0A 1GQHA 3F8FA 4NQWA 3FFQA 2K4BA 1HSJA 5D6EA 4MUVA 1TTYA 5E18F 1ZZCA 2ADUA 1P92A 2OQGA 5K8SA 2IVMA 4AD9A 3U11A 3V7RA 3MFKA 5BUVA 1PP7U 4ORFA 3I59B 1CF7A 1RI7A 3RKXA 2B0LA 1TQ5A 5D6FA 2G9WA 3L00A 5BPXA 1EY2A 4L9NA 4CDGA 5CADA 2H0VA 1ZZ8A 3TDUC 3LWFA 1OI6A 1UB9A 3ULQB 2STWA 5EEGA 4A0XA 2QQ9A 1SFEA 3EYIA 5FQ0A 1T39A 1UPIA 1QQIA 4RAYA 4KWLA 4MGRA 4ZU5A 4IERA 3WGHA 4JBAA 4N9IA 3GBFA 5D5WB 1WKMA 3U9GA 2VC1A 2P7CB 1P4WA 5JR3A 1K7AA 4G6DA 2D93A 4B8XA 3GX4X 2M1BA 4PIZA 1D5VA 4XF0A 2HZTA 2ZO4A 4IF4A 4Z82A 2WTEA 2VBYA 5K5OA 4Q0SA 3HSEA 4OIRF 2IRFG 4XFFA 2MH2A 1HW2A 1G4DA 1UW8A 1LEBA 4OU0A 1JGSA 3J7AO 1CAUA 2EK5A 2MHFA 3P9IA 1J3RA 4AVCA 2EFQA 3WW1A 1LDKB 3RZZA 3NVCA 3N97A 3GUDA 1Z6TA 1G3YA 1EPZA 3BJOA 2VBXA 3D82A 2XLFA 2QJVA 5J48A 4FX4A 3HOTA 3RNSA 2PI0A 2OZJA 4AIJA 4LEJA 2OD5A 4XFBA 5EZWA 1ZG5A 1X8MA 2HTSA 5LGUA 2O8QA 5KHIA 3J80Z 3VB2A 4ONUA 1H1MA 3K1PA 1I27A 2P17A 5F64A 2VODA 4B29A 4L5JA 2FQ3A 1LDJA 1OPCA 3FHZA 2Q2EA 1ZLJA 4P9FA 2MC3A 5DCMA 4EGYA 4KWKA 4Z07A 4M71A 4ASNA 3TO9A 2CYYA 4GYIA 4HAMA 3KE2A 4KNYA 2FE3A 3KEQA 2ZKZA 4GXOA 1IF1A 5KHKA 1KQ9A 3R4KA 4EWAA 2DAOA 3O2PE 2Q30A 5JAXA 3DV8A 1UD1A 1G3SA 1JXSA 2IJLA 2VBZA 4BYYA 4OLLA 4HMZA 3TDZC 3H9AA 1T98A 4UUVA 3ZN0A 3M1EA 1NZCA 1NXMA 4PIYA 2V6CA 4JK1X 1USSA 4S05A 4KUMA 3DPLC 4X6QB 3FXRA 2CQKA 5LHIA 1RUNA 4QXKA 4F8AA 1WRJA 4KN4X 1UFMA 1ZH5A 1SFXA 1RC6A 4RGXA 2EFPA 5T3NA 2X0LA 1HW1A 2KRFA 4Q0PA 3H8UA 3QP6A 1A04A 2HEOA 4CHUA 2HOEA 3PLQA 5F1RA 4M9XA 3HHHA 2JZYA 4PZJA 4MTEA 2JT1A 3D5LA 3F23A 3M7GA 2HKOA 2RKHA 2IA2A 4ZU4A 1OYYA 3I4PA 3RYKA 1R00A 4HQMA 2FA5A 2BNOA 2V1DA 1BBYA 5CJ9A 2EB7A 3M8EA 1BI2A 3DFGA 5KVRA 2O3FA 3GYHX 2H27A 3UKTA 1YFYA 4UHTA 1SAXA 1R1UA 2Z33A 4ETSA 5DD8A 1R23A 1LDDA 2IC1A 3HIFA 4FX0A 5AVPA 2HYFA 4HVOA 1NHAA 2PBIA 4UVCA 1TQIA 2VOPA 5K1YA 1F5TA 4LG0B 1W7PA 2TDXA 3U0ZA 2VXZA 2MLGA 5ED4A 1Z6RA 3G73A 4BHBA 2K02A 4META 2FXAA 2GXGA 3ZMDA 2D45A 3TNQA 1XE7A 5H6QA 4GGGA 5EFUA 5JVTA 5E8IA 2UY9A 5CLSA 3WG9A 3EYYA 3F21A 1YFWA 1ZRFA 2M5WA 1I5ZA 2EFNA 1P6RA 2GC3A 3OF1A 4FHTA 5FDBA 4RAZA 3TOBA 5ILVA 1IPJA 3CJXA 1T38A 3LSTA 4RGUA 1VP6A 2L02A 3L7WA 2DPDA 2PHDA 5J7MA 2RNJA 4IVNA 2PAEA 1RGSA 2OYZA 1USTA 1IN4A 2A3SA 5BQTA 3IWZA 4U88A 5HOOA 4UNOA 1EP0A 5LEJA 1U78A 1EYBA 3KGZA 4JTNA 1YUDA 4O5VA 5FCCA 1Q1HA 3GFJA 2QVOA 4IETA 1FP1D 2CWEA 5E1XA 1AOYA 3SMHA 3FF5A 3TQNA 2WV0A 1MJBA 3MWMA 1LVAA 1BIBA 4L5IA 3S7EA 3S7IA 2QZ8A 4EM2A 3WTWC 1HW5A 4LFUA 3ECOA 4EWDA 3TGNA 4EJOA 4ZU7A 2XRNA 4L0ZB 3GWZA 4KWJA 3V7SA 4HZFA 4P5OA 4I0BA 3L9FA 2VQAA 4I7HA 1Q3EA 2ET1A 3HUGA 1V3FA 5J8FA 1CAVB 3HRTA 1IXRC 1LNWA 1L3JA 5L3EA 2VOOA 3LQQA 1FWZA 2A69F 4P96A 4EJUA 2HS5A 5I93A 2P4WA 4PGGA 4UVBA 3JTGA 2OZUA 5FLIA 3MAJA 3UKVA 4I2OA 1YFXA 5FLHA 3FXUA 3QPTA 2CSOA 4EM0B 2HGCA 2PTMA 1REPC 1G3TA 2DBBA 5TRDA 3N4MA 1L0OC 4LK1F 5FGMA 1ODDA 4R79A 2A07F 4QWQA 4ENMA 2QQAA 4CXFA 2P6SA 4MQVA 5JSOA 5JR7B 3HRMA 1GXQA 1YW7A 4LUKA 6PAXA 2JTVA 3QU6A 4ENNA 1PP8F 2JSCA 1LQ1A 2BYVE 5K5RA 3GFIA 2BNNA 4A0YA 3CUQA 1G6NA 2XASA 1CAUB 1RL3A 3EQEA 3TO7A 2FNAA 4IHSA 4WBBA 4XETA 3FWEA 1KYZA 4DNCA 1LEAA 4CICA 1B9NA 3WTTC 3K0LA 3HHGA 4BAYA 3I0TA 2PQ8A 5DDGA 1TNSA 5H20A 2CGPA 1E17A 3WU1B 4KIGA 2H09A 1S3JA 1XRUA 5A2QK 5IT3A 5I8TA 1DDNA 2GAUA 4H7LA 1OFNA 1ZN2A 2DT5A 1KU2A 4WWCA 4WXDA 3D0SA 3RDIA 4OINF 2K7LA 4EJWA 2OBPA 3FMSA 4IEWA 2CO5A 4DINB 3DXJF 3I71A 1K79A 1XMKA 1RUOA 1DPUA 4KT5C 1TNTA 4R8HA 3V7CA 4AVPA 4EVIA 4N9HA 3WTVC 3GO5A 3ES4A 5D8KB 3KZZA 4IEYA 3WW3A 3MZYA 5LRSA 4PGHA 4TV7A 3I64A 1OYWA 1B1BA 5E1WA 5DYMA 4QGLA 1MKMA 3WGGA 3F8BA 5D5UB 2H6CA 3MQ0A 2VONA 2M45A 1KQ0A 3K1NA 1R22A 2EWNA 3R60A 1S6LA 2QLZA 3KZYA 1P4XA 3SFZA 5I8YA 1J7KA 5ICEA 4HN0A 5AONA 4ENKA 3FZ3A 1ZZBA 1F4KA 4EROA 2DCTA 1W5SA 3BPVA 1DGWA 4HDVA 2M30A 3T8RA 3ACLA 2C0ZA 1XGMA 2O6GE 3DN7A 2XHKA 3JZVA 2NYXA 4XEZA 3GEZA 3L2HA 2Q0AA 3Q9SA 3KSCA 1XMAA 1ZVFA 3KEOA 3WE2A 3J81Z 1BC8C 2KIUA 3I7DA 4GULA 1Y0UA 3ELNA 5HS8A 2F5FA 4IEQA 3GZ6A 3BZ6A 2ACJA 5IT9K 1ZZ9A 5FPZA 3CTAA 1B9MA 2H6BA 4HLTA 3D0JA 4L0YB 2O1QA 1O7LA 3SCGA 5L3DA 2DK8A 4OIPF 3RTRA 2CG4A 4U0VA 2OA4A 2DK5A 4HN1A 5HDGA 5C6CA 1SEFA 3M8FA 3V8KA 1W7PB 2OAZA 5LBQA 4LTAA 1IW7F 1J59A 4CGZA 4A5MA 3P7NA 2RGVA 4XLPF 2DQLA 3VEPA 3ECHA 2Z9OA 4EV0A 4L9VA 1XSXA 4G8XA 2A68F 5HI0A 2EV0A 2Q8KA 1O5UA 1SMYF 4HX8A 4M6XA 1QXRA 1WLTA 3IL2A 1UCXA 1TLHB 2BEOA 3LA3A 3OTFA 2CFXA 3DP7A 3SCFA 4G7ZF 4P9UA 2PQQA 3OGJA 1TBXA 4U7BA 3QRFF 5CVVA 1H9TA 1CAWA 3G7DA 3PVBB 2L3DA 2IA1A 1FI2A 2PYTA 1DP7P 3R61A 2FOKA 5I0UA 3BPXA 1IN7A 2FEZA 3WTUC 3SZTA 1FBSA 1X3UA 4WVZA 3IBMA 2ISYA 2OZ6A 4A0ZA 2G7UA 1IXSB 2KKOA 1STZA 3KLNA 3RYRA 3H1YA 1TW3A 3WTYC 3Q9VA 5FLJA 2IP2A 4HVRA 3ROUA 5KHJA 2FU4A 1GHCA 4YARA 4MTDA 3KCCA 1Q5OA 1O4TA 1S29A 1H9GA 4P9GA 2D2WA 2LSOA 2NNYA 1YTYA 1FP2A 1KGSA 5E20A 5A2QZ 5KHHA 1DPRA 3RIRA 2ISZA 1RTVA 4QGMA 1GXPA 4YFXF 1UHWA 2COMA 1J1LA 2GC0A 4MH0E 5L3FA 1QZYA 5BY5A 4M9ZA 1Z1DA 4KDPA 1IUYA 3VOEA 5FFXA 3L2CA 1U5TA 1IPKA 2QQBA 5BXXA 4Q29A 1XSDA 2LF7A 1I6XA 3SHFA 5D5XB 3W6KB 4EQQA 2YR2A 1QWRA 4A2UA 1FZPB 1FXZA 2EV5A 5HLGA 3WTXC 2OA2A 5DD4A 2XAFA 4FAGA 2MPFA 2VE9A 3E5XA 1YLLA 3MCZA 3WGIA 5FO5A 4AIKA 5ICFA 4KMFA 3QOPA 1T2KA 1G3WA 5ICGA 1ZZ6A 4Y13A 1UHMA 4L9TA 1RNLA 1NYWA 1DZRA 3H50A 1MDMA 4JQFA 3E6MA 5HLIA 1QGPA 2XGXA 3FX3A 5I0TA 3OCPA 3OD0A 1QPMA 3W6JB 1CX4A 2Z2SB 3KGLA 1K78A 3LAPA 5KBFA 3BALA 4BHPA 4Q0QA 1ZLKA 1W5TA 3QACA 3JAMK 3HSRA 2KXLA 1TW2A 4AVBA 2FF4A 4M74A 4LA3A 1YHFA 3H3ZA 2K9ZA 2ZXJA 2Y0MA 4OIOF 1FLIA 3K2ZA 2XVCA 5HLHA 4LLNA 1V4RA 5IT9Z 3PFIA 4IPAA 2IXIA 4IEXA 2W24A 5BV6A 2ELHA 1SQ4A 3WW2A 5J6XA 4ZZLA 5JI6A 3K1MA 5HDNA 3T0YA 5DCFA 4HF1A 2E1CA 3BJAA 3Q5FA 2L01A 5TJJA 1LRHA 4HF0A 2GU9A 3KP2A 1QZZA 2RVCA 2C6YA 5J8CA 4KA4A 1KA8A 1U3EM 1R1VA 1CAXA 4IRGA 1WGPA 2FMYA 2K4JA 2Q1ZB 5HVQC 3E97A 2FRHA 4LLLA 5F6FA 1CGPA 1FPQA 2EJRA 2ZMEB 1KQ8A 2BV6A 2IXKA 3EO6A 2UZKA 3P9KA 1ZARA 1D3YA 2BGCA 1R5HA 4ZYHA 4I3PA 3SCHA 3V4GA 1FX7A 2KJCA 3I59A 2Y75A 4NVPA 4JVAA 2LKPA 2L54A 5DUIA 2VBWA 3T1BA 2G7HA 2W84A 4HLYA 4GYGA 3ZMTA 5D4RA 2K27A 1QY4A 4M73A 4OOIA 4HV5A 2ZCWA 3LFKA 1X8EA 2EV6A 3CF6E 3BP8A 3OV8A 4H0EA 1FT9A 3HYIA 2R7FA 2VPVA 4UV8A 3V8JA 4I01A 4X6RB 4HV6A 4U0WA 3HTSB 3QAHA 4OFGA 3I53A 3WTSC 1XN7A 3HRSA 2GA1A 4WCGA 4LJZF 1J2XA 4YYOA 4TLFA 3GFLA 1CF7B 2XL7A 4AVAA 4KICA 1F9NA 1EH7A 4LLOA 1XD7A 1ZZ7A 2FBIA 4QMAA 3K9TA 1R5GA 1R1TA 1YS7A 2DLLA 1XCVA 4LB5A 3KP4A 3KP3A 4P55A 3IDCB 3T5XA 3UKNA 4ZH4F 5FQ0B 4HBLA 3IWFA 1FOKA 4Q4ZF 1O5LA 4O6JA 4F7ZA 1ZGJA 1AWCA 2PEXA 2FSWA 1V70A 3FMQA 3KMHA 3E6BA 4D0PA 3TKYA 1SMTA 4E2GA 4HSLA 2AXLA 2JRTA 4XRFA 2RV8A 3DPTA 4AIHA 5L3BA 1DZTA 3CO2A 3REOA 3ZQ7A 1NE6A 4D7SA 1FY7A 2D1HA 5CVJA 5HDKA 1XB4A 3FE5A 2XUBA 2DU9A 2VECA 2KJBA 4ESJA 2BE5F 1ZREA 1UIKA 5ILUA 3KP7A 3IRRA 2IXLA 2QDRA 2GA2A 2DW4A 2FQPA 1MJ9A 3ABTA 2EFOA 1YFHA 4IHTA 1YW8A 2V1UA 1FYKA 3EQLF 3JAMZ 1B59A 1Y9QA 2V1XA 2HJIA 4KL1A 4HLXA 4IJAA 3FXQA 4MNUA 3C3VA 4QM9A 1Z9CA 3KETA 4Q0VA 3IC7A 1YWKA 1W7PD 4E70A 1J5YA 3GW2A 3PQJA 1P2FA 2HQRA 4YRDA 4UBGA 3KLOA 2MNGA 4XSZF 5I91A 5FD5A 1OR7A 4EGZA 3CEWA 4G9YA 2MBFA 4MGKE 4WK8F 2Z99A 2PG4A 3QU3A 5C8WA 1VJ2A 4Z2YA 2XLAA 3USSA 1WSUA 2O03A 2EA2A 2P8TA 4RB3C 5DCMB 4EM1A 3BPZA 3WE3A 4U7DA 1WA4A 1FYMA 2YX4A 3ZN1A 1F1ZA 2Y48A 2PMUA 4Q47A 4OIQF 2H94A 2PAMA 4JV4A 3I5UA 5LHHA 3JW4A 2P6TA 3U10A 4FBFA 3RJPA 2ATFA 2Z5UA 3ZDSA 5AIPA 2O0YA 3HOSA 3G3ZA 1BI1A
chains in the Genus database with same CATH superfamily
4W6YA 4QU1A 3BTAA 3CMAI 1XNKA 5JSRA 3EXUA 2PN6A 3JD72 2RC4A 4KFCA 4OZXA 3ML6A 1ULPA 1ZBA1 1OQYA 2DN0A 4YM2A 3KYDB 4RMNA 3B00A 1X1DA 1DYPA 2WT1A 4CEYC 5KK1A 2YSRA 2D6LX 2EXHA 5HBAA 3R0AA 4EWEA 3EMRA 4NRQA 3PMSA 4WF2A 1B4AA 3G1OA 3CO6C 2L4MA 1JGGA 2R0QC 1LHOA 3AP7A 1MSFC 1J58A 2ERFA 5JDBA 1T6GC 2VTXJ 3FN9A 2VN2A 4M0NA 4YSFA 2E33A 4RFT0 5C9AC 1WJ5A 3HTUA 2DI3A 2XPJA 3TOAA 1VQ5I 1X3WB 2M3AA 1TMF3 5C9AB 4M72A 3AP6A 1H4HA 2G0EA 1EH6A 4DYCA 3AVRA 1JS9A 1GQGA 1YI7A 1UIJA 2WSVA 4CYCB 1Z91A 3FHIB 2IA0A 1VBB2 3WNOA 4XZPA 4BJ5C 2JDYA 4LBQB 3F72A 2R5YA 3A4UA 2P34A 4GWJA 4E7IA 3S0MA 2P7VB 2FD8A 4Y24A 5FZMA 1OLME 5DAWA 1S0DA 2XXZA 1E2XA 5A32B 2Y9ZA 5JIAA 1QEXA 5F2WA 1G9FA 4HA8A 3U37A 2MG4A 1FBQA 2K86A 1C57A 4M3EA 4DYQA 1PGL2 4A69C 4I76A 1FSHA 4HX7A 2VCAA 3U07A 3T0BA 4CP1A 2NVUB 3D6EA 1CAVA 2J1AA 1RUG3 1VQLI 3POBA 4Y20B 1ZKGA 3RKYA 2D97A 3PJQA 4URTA 3UESA 4KIBA 2VT3A 1W9WA 2YUEA 4BGDA 1OF3A 1TWGJ 5KNLA 1FJLA 1FNZA 1QXJA 3AJYA 1T6SA 1GZWB 4JQRA 1SEUA 5DEQA 3OOXA 5FYCA 1U8RA 5EJ1B 1XCBA 4LUMA 1AA7A 1LJ7A 2UXNA 1U5YA 1K42A 4D94A 2KA3A 1HV1A 4IGOA 3LA7A 2R49A 1KXGA 1W6MA 4YW7A 2JG9C 3H8OA 3K4KA 2AREA 4F83A 5EHDA 3C7JA 4PSXA 2HH9A 5FPXA 1H88C 2J5PA 5BPDA 1O57A 3OSDA 5CEHA 1BI0A 1A6IA 4HPKA 3ISPA 5FZIA 4NPRA 5I0RA 1OCPA 4AXOA 2F5DA 2FCTA 2V9VA 1FMWA 4IHXA 5CYVA 3FUOA 5EV7A 5FR3A 1ZRCA 1LHUA 2VT2A 2XAJA 4CO8A 3EBRA 2VMDA 4XFCA 2C26A 4AI0A 1YO8A 1VMJA 4HSJA 4DZPA 2H8RA 5KCMA 1DYKA 1YHQI 5I0DA 1N3OA 5D8AA 3UR3C 1SPPB 4XF9A 1VAKA 4G6QA 4IRIA 3CUQC 4FPLA 2IFRA 4XXAA 2D40A 4BQ4A 1J3PA 1YXWA 1RUD3 2RDNA 5FUNA 4L2NA 3CUQB 2P3YA 1FYUA 2RVAA 3OYWB 1H8TC 2C4XA 1GWKA 4D6QA 3PIGA 3NNJA 1YI9A 1H8TB 2ZMLA 2PMHA 4ESFA 2WC2A 1S8NA 1ENXA 3IH3A 1QQP1 4BH9A 3PNAA 1YO5C 1MJAA 1VBE2 3APBA 3N7MA 3HRUA 2A3WA 2JIGA 4J1WA 2KIQA 1C8NA 2Y26A 2CWMA 3CLOA 4KIFA 3HD8B 4EJTA 4II3A 3JR9A 1RJ8A 3FK6A 4YZ2A 3PVEA 4PDKA 4QX2A 4YFKF 2DA5A 4YVSA 5FBJA 3DU6A 3CP2A 3JD73 3WU0A 3PJRA 1U12A 2O8XA 1WJBA 1QDOA 2A61A 3TAYA 1OKRA 2ZB9A 3RWNA 2DFBA 4XJ9A 3O6BB 1MS0A 1X7NA 4GWIA 1R58A 3PHMA 4BQNA 2IXJA 1IXCA 4HEA2 4XAEA 3MIFA 3DYMA 3GMEA 1COV1 3HT2A 2B7EA 3ZQFA 1KEXA 1YYVA 1H30A 4PCRA 3GLXA 1APNA 4CDXA 3N9LA 4BE3A 1Y0NA 1DLLA 2M0CA 3DPUA 4HKOA 2XJPA 2CYFA 5ERIA 1JZ5A 3PUQA 3JRAA 3F22A 1K6OA 2QUFA 2FDIA 1LR5A 1O3TA 1ZRRA 5L9BA 3PUIA 2OKXA 3OY8B 5CQEA 3BCAA 1UKGA 3PU3A 1B8IA 3ME2A 1DGRA 3K69A 5J4YA 4OCTA 4G7HF 3DQVC 1VBB3 5FO8B 1T0FA 1WCSA 3PUFA 2C9KA 1VQOI 5FZ7A 1LKXA 4QD2A 4S04A 1DIWA 1KFUL 2Y6FA 2O9LA 2NOJB 2E2IJ 1E5HA 1NOVA 3FJSA 2Q4SA 4UVAA 2A05A 5A6QA 4YELA 2IVIB 1Q43A 3WT3A 4UUSA 4ZS2A 2RDQA 3OYFA 2WUHA 2R7RA 2PA7A 3QH7A 1W0PA 2GOXB 2LKSA 2FHRA 5DUXA 1AR81 4W50A 3G6JB 1VI0A 1MBFA 3O1VA 3FBIB 4IRHA 2QQIA 1V6IA 4K2EA 2KIMA 1AR61 1SD7A 1N47A 2ELKA 2HKXA 4IESA 1HKQA 4RGKA 3J81K 4MGYE 1ZR4A 3BODA 1YQCA 5I0SA 1TQPA 1MQTA 3S2WA 1WD4A 2FOWA 4QLCU 1G8WA 1J3QA 3AL5A 4AZZA 4MXVA 1LJ9A 1XPWA 3TNPB 3ON7A 3HDDA 2JKBA 3RGBA 1JHNA 1AYN3 5HCBA 4RB0A 3OIQA 3NKTA 2ZNZA 1GP5A 4Q1PA 4Q4Y1 1CAWB 5JZGA 3HKZA 2E7WA 3ERMA 2BBVA 4R1HA 4DZJA 1NCQC 2JDMA 3CLPA 2OQRA 1R49A 2NRAC 4X8NA 5CVUA 5FZCA 4ZYGA 1NCQB 3RZGA 2HXOA 2FX0A 3IDEA 5L3CA 1HBXG 5E16A 5KXEA 4IUGA 4YIFA 1LOEA 4KGGA 1W03A 4BY7J 5A6YA 1WCMJ 1ZHFA 2IS6A 3BY6A 2DA7A 1PUEE 4E7SA 4PIXA 1R091 3THPA 2WA0A 2CUZA 1GMMA 2XKPA 5A6ZA 2DO7A 1BC7C 1U5TC 2ARCA 4ATEA 2K85A 2PXJA 3ITQA 4XF1A 4PDWC 3BJ6A 1U5TB 1R7JA 1VFCA 4PF1A 4BIFA 1GVJA 4PJLA 4WXCA 1V6OA 3WP5A 1G9BA 4CU6A 1VQ9I 4PDWB 3OGVA 4CCDA 1S7OA 1S0BA 3OBRA 5A33A 1E0EA 3WXPA 2WKKA 1NLSA 3EPZA 4OAZA 3ZMUA 4AUXA 1N78A 3K75B 2WQ4A 1RETA 1R4NB 2E71A 5FB2A 2GH8A 1VB4A 3CMEI 1A6QA 3RMYA 2IVJA 2FNPA 1FSEA 5IVJA 1RZ4A 3POYA 2I5UA 5KC6A 1BN5A 2ZGNA 1XGSA 4LD5A 4RDUA 3DBLB 2YDEA 1S0FA 1HC8A 3CU7A 4I02A 3AAFA 3ZIWA 2JICA 3GNEA 1XDUA 3T2OA 5HXMA 1ON1A 1K78B 1H9WA 4KMUX 2M87A 2GIZA 2V4VA 1X9PA 4GKYA 4AWXB 4MX3A 4K1YA 3H36A 3SFIA 1WGXA 5C4WA 3TEDA 2ET7A 1W8HA 4F3QA 3DL3A 2YB7A 4LMYA 4ESBA 2ZC2A 4GRIA 4QXCA 4XLAA 4LG0A 2NVQJ 1W0UA 2B5HA 1DU6A 2VOTA 3CO7C 3T3YA 2UU8A 5F32A 5FRAA 3ACIA 4ZTFA 2WLQA 1PVEA 2E34A 3MN2A 3C18A 1L3LA 2RG4A 2RS11 1QU0A 1OLTA 1GZCA 4KBBA 2QQLA 3M3OA 1FBUA 2LF8A 1W9YA 2PX9A 4LLGF 1QNTA 2WAAA 2B9UA 1V9U2 5BNGA 1PIV2 1R081 2W57A 4ZZDA 1H4GA 1JKRC 1B35A 5IOZA 3QQAA 2LTPA 2D6MA 4XRMA 1FEXA 4NC8A 4ARYA 5JOXA 1S5LC 1YCIA 4IGQA 4UB8C 5HNHA 5LFAA 2YC0A 2DMQA 3AKPA 2M8GX 5FY5A 1NLQA 4FTBA 2XMLA 3MO4A 3DLAA 3U11A 4B3XA 1PP7U 3P5BA 3IB3A 4ORFA 4Y4YA 2TCTA 1IZ3A 1CF7A 1RI7A 3IIIA 5D6FA 4YM1A 2G9WA 3L00A 5BPXA 1EY2A 2BU9A 3VBOA 4L9NA 5CADA 5LY1A 2C6SA 5IJRA 3LFMA 1OI6A 1WBFA 1AYM3 4S2GA 4E4ZA 2Y0SA 3V56A 3K2AA 3MKLA 3GJAA 1HOMA 5EEGA 3QWLA 5JR2A 1UPIA 4DRVA 3WQ1A 2M4GA 5FMDA 3WQBA 4MGRA 4H3WA 3QBQA 2J22A 5CB7A 4XHBA 1P4WA 3AP5A 2P6CA 3LKJA 2D93A 5C3PA 2ME6A 2M1BA 1AUYA 4S0HB 2HZTA 2YBSA 3M8LA 2OQ6A 5FKBA 4ASLA 1NT0A 2XPVA 4XW3A 1K4SA 3URFA 2QSHX 1IG7A 1UW8A 1DCSA 2AEZA 1C1FA 1CAUA 1X2NA 3P9IA 1RUC1 3PIPF 2M9HA 3WW1A 4LKSA 3OBTA 3BGAA 1I3QJ 5CKQA 5J36A 3GUDA 2NMNA 1EPZA 3BJOA 1A8MA 2WZ8A 2G4IA 2VBXA 3WU2C 3D82A 2XLFA 2A3XA 2QJVA 2NMOA 3HR9A 5FY0A 3VBSC 1POV1 3HOTA 3ZYJB 1PNFA 2HWC2 4LEJA 2FUG2 2AC1A 2HTSA 1UPSA 1W99A 1Z7LA 3I2JA 3K1PA 2P17A 2ENRA 2VODA 5GLUA 3AYAA 3MZ8A 3FHZA 1NA1A 2MC3A 1K5MC 3VWBA 5LA1A 4Q2FA 4XQ4A 4M71A 4ASNA 3TO9A 4B4PA 5H9PA 3GTKJ 4GYIA 2Z79A 1K5MB 5E88A 1UYXA 5BNPA 3IDAA 2DAOA 2Q30A 3LSGA 2DDUA 3DV8A 1IRZA 3ZQGA 4HNVA 1UD1A 1G3SA 1T95A 3VYUB 1Q1VA 1DQ0A 4HMZA 3TDZC 1E5SA 2D43A 1DF0A 1JKPC 3ZN0A 2TBVA 4NN0A 1G8XA 3SZGA 1NXMA 1NZCA 4JK1X 5CFCC 1D0YA 4RN5A 2DU0A 1UMZA 3D4KA 3ZMOA 1RUNA 5CFCB 5A7NA 1SFXA 1UHSA 1Z67A 4BA6A 2EFPA 1C3HA 1XNAA 2GMPA 1GUIA 3AK0A 3ZQHA 1W2AX 4Q0PA 3H8UA 3ACHA 1A04A 1DZQA 1U0JA 3K4MA 3PLQA 3J8F1 2WB1A 4M9XA 1LEMA 2LY9A 4LO4B 4ZPIA 2HKOA 4K40A 3ZQLA 2RKHA 4FPHA 1OYYA 3I4PA 2BY0A 1R00A 2FA5A 1KRIA 2W91A 4CCEA 1I1EA 5FYSA 5E3MA 2D7FA 4Y4RA 3ZQIA 2WFF1 3DFGA 1UNBA 1X3ZB 4FCYA 3M4FA 3CCEI 1SDDB 3O7OA 3K46A 3GYHX 4BWOA 4CTEA 2H27A 3UKTA 1YFYA 3FISA 4UHTA 1SAXA 1R1UA 2Z33A 4ETSA 2ZHNA 4FASD 1AL0G 1R71A 4RSUA 1VBA1 5EJ3A 5JMOA 1SBDA 2ZX1A 2HYFA 2K9LA 4CP0A 1OKOA 1NHAA 5FP3A 4UVCA 3S5QA 4A45A 3KV6A 3H3LA 5K1YA 1F5TA 4HK8A 3I3BA 2E5ZA 1Z6RA 1HRI1 1V9U3 2K02A 1PIV3 3TB0A 4NAMA 3TNQA 2OCEA 4GGGA 5EFUA 2ZSHB 2UY9A 2QKMB 5J96B 3W58A 2VJXA 5IVFA 3VZMA 1P6RA 2BQPA 4FHTA 2ELJA 5DZEA 3RI8A 3K3OA 3T08A 1IPJA 2AO9A 1LOAA 4LBKA 3LSTA 4W8JA 2N8GA 3L7WA 4B3AA 3DPRA 2RNJA 1XE0A 3TP3A 4GA9A 2DBNA 1W8OA 1IN4A 3IWZA 4U88A 1EYBA 5LEJA 2HI3A 1S0GA 4RHV1 1K12A 2R5YB 4O5VA 2VVEA 1IG0A 1Q1HA 4NRPA 1JZ7A 1S2KA 4H2AA 5FZ0A 3POGA 1FP1D 1VF9A 2CWEA 3SMHA 3S16J 1XNTA 2WV0A 4OHYA 1LVAA 1BIBA 2QUOA 2VVDA 4A3BJ 3S7EA 3S7IA 2QZ8A 1LPQA 1HW5A 3DXTA 4GQ7A 5M0TA 4EJOA 4ZU7A 3PURA 3GWZA 1XS9A 1BEV1 2BGOA 4I0BA 3RI9A 2DVAA 2LC2A 2HBTA 1E5RA 3HUGA 2DTWA 5JI9A 5J8FA 3SISA 1CAVB 3HRTA 5E3LA 2V1NA 4UOJA 2XWJB 3ZXEA 4ZJZA 4IXLA 4Y26A 4EJUA 2VQUA 2R072 1HQWA 4DZGA 1SCSA 1LVKA 2I10A 3UKVA 3I3MA 2CSOA 4EM0B 5FYBA 3LDBA 3W2AA 4QXHA 1G3TA 5B1AH 2KRCA 5TRDA 4IV1A 5FGMA 1D4M1 2RAEA 4W97A 2QQAA 3R4DB 4LIUA 4MQVA 3WHCA 1W6OA 1Y1VJ 5JR7B 5JSOA 2VCCA 2K5CA 1EV12 2RS52 2JTVA 2AEYA 1N1VA 2EIMH 5A3WA 1PP8F 2JSCA 4HPKB 4JGZA 3ZXLA 2FDGA 2BNNA 4ZDOA 3BG5A 1CJDA 2HWC3 2XASA 3BR5A 3TO7A 1X1AA 2XRLA 1AX0A 4FXGB 1UYYA 2VJIA 1KYZA 5FZBA 4YWAA 2JENA 4ET7A 5LBBA 3ZFFA 2IGKA 3O1MA 4EN7B 4LHKA 4AYUA 2O0OA 1PM4A 2E1OA 1IGNA 1C8M2 1W9FA 4OI4A 1TNSA 5H20A 2NM1A 2OTJI 4K9SA 2JDZA 3DCFA 3L2UA 4CCLA 4QT6A 2GAUA 2EZHA 1AR91 4H7LA 5DAPA 1FX5A 1ZN2A 2TUNA 3MV01 3CZUA 2DT5A 4WWCA 4WXDA 2Q2EB 3RDIA 4URAA 2QQ8A 2VUMJ 2DCEA 4OINF 3OUHA 3POIA 2K7LA 4WM7B 2W1UA 2GLOA 3DXJF 3ZXJA 3I71A 1K79A 3BTYA 4KT5C 3V7CA 5LZ6A 3CCUI 4OULA 2QQMA 3GO5A 1MVEA 3QOEA 2WB1N 2LVSA 3NARA 2KPMA 5LRSA 4GWMA 1HN1A 3I64A 1LFBA 2H1LA 3F8BA 2ZEWA 4MFDA 2GALA 2XVKA 3K1NA 1R22A 2EWNA 4NPLA 1XG1A 3ZGKA 3SFZA 2B9VA 3MW2A 3ZYFA 4K3UA 3HNBM 3HBZA 1UU4A 4YVSC 5DZGA 1WLWA 2LYCA 1HIXA 1W6QB 2M30A 1UELB 3T8RA 1POGA 3VL8A 1R1A1 4DGWB 2VGDA 3DN7A 1SVMA 3L2HA 3Q9SA 4A4AA 5J09A 2MW8A 3DKQA 3WE2A 5F39A 4NAOA 5JLVA 3HN3A 3SH5A 2F5FA 4IEQA 4V2GA 3GZ6A 2ZGMA 3BZ6A 2ACJA 4A7YA 4CDXC 3ZSLA 3Q0WA 1S4CA 4UFIA 4FVVA 2AQFA 4HLTA 3SDGA 5DAQA 4L0PA 3T4VA 1GV5A 2DK8A 4OIPF 3RTRA 4U0VA 1LU1A 1OD3A 2VQ0A 4HN1A 1OLQA 3B6CA 1Z7S1 2ZS6B 2QSGX 3K2OA 1SEFA 3M8FA 4XAAA 3V8KA 1W7PB 5FZ6A 4XJ8A 1DQ6A 4E7JA 3PIOF 1J59A 1T0FC 4CGZA 4A5MA 1B8IB 2RGVA 3NV1A 3JBG2 3ECHA 2Z9OA 3AYDA 1ETVA 4NIGA 5FYTA 2AZ5A 1XSXA 4G8XA 5JVVA 1GVDA 2Q8OA 4PK4A 1SVLA 4M3CE 4BQ1A 4EYUA 3CF2A 1MBGA 4M6XA 1MZ6A 1QXRA 4IDZA 4MIMA 3WDYA 5LD2C 3LA3A 3OTFA 2WAOA 5FP4A 5J1XA 4W6XA 4D7NA 2W5FA 1ACCA 4UUSB 3QYEA 1UY4A 1WLCA 2G1MA 2PQQA 2XB6C 1AJKA 3D5RC 4J01A 3QRFF 1H9TA 1DU0A 2IA1A 4A3LJ 2PYTA 2D3PA 2JXAA 2FOKA 2YC2A 4A7KA 1JYWA 5FKLA 4Z8BA 3SZTA 2QQKA 1MQTC 2ISYA 1QJZA 2XUEA 2KKOA 1STZA 2IS4A 2YFZA 5LB6A 1JJ6C 4ZXEA 1ORKA 1MQTB 3S2HJ 4DXSA 1TW3A 5FLJA 4OUSA 2JVHA 2R073 2WZEA 5LY2A 4D7YA 3ROUA 5F0CA 5EF6A 1GHCA 2HWF1 2DDAA 1S29A 1H9GA 4PFPA 2NNYA 4GJYA 3N9MA 3QD6A 1YTYA 4C1XA 5A2QZ 1JTXA 1W05A 1DPRA 2PHFA 3K10A 4QGMA 5KAIC 3TWIA 2GC0A 2RE9A 5L3FA 2VZ3A 3HEFA 5C5TA 2LS6A 4C8DA 1SACA 1NY72 3VOEA 1F4AA 2D3RA 2A6TA 1EV13 2RS53 4CUBA 1XSDA 2LF7A 1MBEA 1I6XA 2BJSA 1TP4A 3I8TA 4AG4A 2EQRA 1CX1A 1RMU1 3BZCA 1EUTA 2CGOA 2WY8Q 2EV5A 1PVC1 3AL6A 5HLGA 1QJX2 2XAFA 1GV2A 2BHZA 1IRXA 2F4MB 3FC0A 3E5XA 5K0UA 4QX3A 2DYCA 3WGIA 5FMBA 4DXTA 3QH6A 5ICFA 1AL21 3NRUA 1C8M3 2LMDA 1UHMA 2Y60A 2R7WA 4M6VA 1VQ7I 2R5ZB 2KLOA 1MDMA 1M06G 3OYKA 2YG0A 2CQ7A 1X2MA 3HJRA 2VMHA 2EH3A 1JOJA 1QPMA 3T2PA 3W6JB 1CX4A 3H42B 5A33B 3R0RA 5F3EA 2WV1A 3QACA 4AVBA 2XOMA 4LA3A 2UUZA 3TYJA 3H3ZA 4OIOF 2V26A 1MS3A 4OI1A 3VHPA 2RHPA 3PFIA 1K83J 3VD5A 2W24A 2D6OX 2ELHA 1PNGA 4IE0A 2QTWB 3N7JA 4D6RA 2JMWA 4AYBN 5HDNA 5M3MJ 1V5FA 3BTIA 3T0YA 4QX7A 3PDQA 5FZ8A 3BJAA 2VZVA 3Q5FA 2JUGA 3Q0VA 3KD4A 3W9AA 3KCXA 1LOFA 5C4WC 3K4DA 3S57A 4KA4A 4B3NA 1WZ2A 4AU7A 3G1MA 3U75A 1HB1A 1R1VA 3VZLA 5C4WB 1WPKA 3G1LA 2ZEZA 2K4JA 3E97A 2NP0A 1XU2A 1ULCA 4LLLA 1DBNA 1CGPA 2EJRA 1KQ8A 3GCXA 2BV6A 2IXKA 4JKLA 5TISC 2VB6A 2MC4A 5FP9A 4UW4A 1ZARA 3O5SA 2BGCA 3V4GA 2CSGA 2PHUA 1FOD1 3I59A 4E8DA 1ENHA 2Y75A 1ZRIA 3A4CA 4NVPA 4ZXKA 3WG1A 4XUNA 2ZGPA 2VQCA 1B35C 2G7HA 4HLYA 1CIWA 3ZMTA 1N3QA 4BQQA 1QY4A 2WZR2 4C3HJ 3E1SA 5FLVA 2C5DA 2VOKA 3OV8A 2D6PA 1FT9A 1OJLA 1V0AA 3TBIA 1O4YA 2BV4A 2R7FA 2VPVA 3V8JA 4OMDA 4I01A 1IS5A 1DGWX 4AFDA 3JBG3 4HV6A 1ZYBA 1XX5A 2VNVA 1FPN1 3WTSC 1LNSA 1XN7A 3HRSA 1W8FA 3T2QA 3Q8AA 1VBC1 2A7AA 4ZONA 3VBOC 1CF7B 1XNCA 2XL7A 3WDUA 3NV4A 4AVSA 2Z16A 4CCJA 2JJ6A 2FBIA 3K9TA 1R5GA 2OS2A 2DCJA 2DLLA 4CZSA 4LB5A 2L0KA 4WVMA 3KP4A 3KP3A 3LPFA 3IDCB 2HU9A 2L9LA 3UKNA 1OQDA 3ZFEA 4HBLA 2ZX4A 4O6JA 3K4ZA 4ES8A 2FSWA 1V70A 3TN91 1STMA 1SMTA 2PJRB 2JRTA 4XRFA 1DZTA 2CL2A 3CO2A 3REOA 3ENRA 1GNZA 1KS4A 1AHDP 1FY7A 5HDKA 3S17J 2DU9A 1HF0A 4XKWA 2VECA 1Z3YA 1JH5A 1AKHB 2WINB 2WR9A 2Y64A 5ILUA 3KP7A 4RM3A 3AKQA 2IXLA 4PJ0C 4PI2A 3L2WA 3V0BA 5C5UA 2VW2A 2XVGA 4LKEA 1YFHA 2TEPA 4XRSG 3A01A 3GTMJ 1FYKA 2HQ5A 1OURA 1Y9QA 4MGQA 4XPVA 3S2DJ 2HJIA 4MXWA 4LBQD 3WNMA 2LG4A 3C3VA 2AXTC 4Q0VA 3ZN6A 3WF2A 3HGYA 5F8PA 2VZQA 2JDNA 4XSZF 2NS7A 1QJX3 4KT6A 5IOYA 3CEWA 4G9YA 3RQ0A 3FFZA 4A3KJ 3I2IA 3OS0A 1NA1C 2WADA 4XBLA 5C3OA 4B48A 2PG4A 4MHRA 2XLAA 3LEKA 1WSUA 2B4KA 1NA1B 2EA2A 4A3CJ 1L7QA 3SH4A 2WWJA 3K77A 1BW6A 5FZDA 3ZYRA 3WE3A 4U7DA 4UAPA 5BNPC 1TME1 1G2HA 5T5JA 2PMUA 2P3JA 3LQCA 4O7XA 2XVLA 4JV4A 2OV7A 3MFCA 1LAJA 5F0HA 2P2KA 4UWDA 4Y1ZA 4LBMA 4ZZ8A 1RUH2 5T54A 3FKIJ 3R6SA 3ZYIB 5K9YA 2EXKA 3VBFA 4A12A 1XB9A 4ZZ5A 3MEXA 5CVIA 4OMYA 2E9QA 1JYCA 3NAPA 2DOEA 4ENJA 1JXNA 5FZ9A 5JOYA 4I30A 3I3QA 1ONVA 3HOYJ 5FYHA 1OMIA 2NPIA 5G04L 1A36A 3A22A 3NW4A 2L9RA 3QP5A 1RITA 2R062 2B8MA 5IK7A 3FDYA 2K0GA 5LRRA 3F0CA 2AR6A 4YGCA 3CBNA 2PQSA 3AJZA 1F35A 2IXHA 3BT9A 1YW9A 2LKXA 3V64A 2QYOA 2GQQA 1MZEA 1VRH1 3H1MA 2DVFA 4NIIA 5IAVA 2E6VA 2EIJH 1WW6A 2WDBA 4A6DA 5M3FJ 5KAFC 4YFNF 5IFPA 5JSPA 3BC8A 4BQYA 1ZGWA 2XB5A 1ZRDA 1GOFA 4QX5A 2VUCA 2E2HJ 2VE8A 3AYEA 1IDYA 5FY8A 1CAXB 2DFFA 3ZMZA 4FFGA 1PDNC 1OCTC 3E3VA 4M3BA 2OUMA 3F8MA 2XV4S 2YY1A 3E1F1 3ZMNA 3ZP5A 4N90A 2E51A 2EIKH 1AZDA 3LIGA 2JSPA 5DN2A 2E5NA 2WZR3 1YIFA 5F04A 4AVZA 1F31A 4I99C 3T1LA 2HWB2 1D2SA 1U2WA 2IPQX 1IPSA 2XSJC 4LB6B 1RR7A 1AXYA 3DPRC 4AI2A 3VD3A 1JI6A 3WDXA 3BN6A 3O14A 2CY6A 3BOWA 1YX5A 3N9OA 4GXLA 1RC9A 1IS6A 3DPRB 4XONA 3NNFA 4E7HA 1AX2A 4O9GA 4BNCA 4Q4X2 2UY8A 3NQHA 3NRVA 4XJZA 3GVAA 2FCVA 4E2QA 4UW6A 4DQ2A 4PQ9A 4FTSA 3BR0A 1SHWB 1XXNA 3W6VA 1NK3P 3U1DA 3JU9A 2BW8A 5LA2A 4LITA 4DS0A 2HR3A 5FO9B 5GP9A 1SFUA 1PX4A 2JQ7A 3CJQB 4AHXA 4L9JA 2CAVA 3GCMA 2WAQN 1XSQA 4EN0A 3F9KA 2KIFA 4XM3A 3JRIA 3HUGB 3CP8A 3BDDA 3P5JA 3WDTA 2XAHA 2DUPA 3ERED 1GLHA 2OTLI 5FJ8J 3I56I 4IEZA 3TO6A 2F4LA 1FNNA 3RI4A 5L9VA 2DA4A 3PTRB 5A7PA 2GXBA 1U9OA 3S3OA 2JECA 1W6PB 1S0IA 3E5UA 1Y39A 3RZOJ 3ILFA 4GCVA 2W1OA 3ZXSA 4IV1C 5F08A 4B09A 4BB3A 4DPNA 4BEHA 4XOPA 3GM8A 1QU3A 4I09A 3Q8FA 2F17A 3SQNA 3FLPA 1V00A 4L99A 4JGZC 5AFEA 1XGNA 1BQPA 2QGUA 4JGZB 2P5LC 1UOFA 3W5NA 3ETQA 1REDA 4BMEA 4HF2A 2DYRH 3R0JA 3NO8A 3ZFFC 4OMZA 3K48A 1JI8A 2LM3A 1HQCA 5AFBA 4HQEA 3ZFFB 2HPMA 1PGW1 5DM7F 3B5LB 1Q8VA 3CJIC 3RWKX 2AQEA 5E79C 4PCQA 4CCMA 3WCSA 4CDWA 3HOZJ 4YW6A 1CPNA 3ALQA 3CJIB 3O3KA 1OVPA 3S6PA 3WG3A 3H5RA 5LLQA 2HYGD 2HWD2 3TEWA 4PJYA 4XLNF 4A42A 4FQ4A 2OXBA 5HS7A 2LDUA 3Q8CA 2XPWA 3JRGA 3BR2A 1S55A 2QEXI 1LHVA 4XDOA 2FBKA 1RUH3 3UV9A 3J9SA 3AZXA 3OGRA 3T8TA 1ERDA 4IE6A 2ZJ2A 3WUCA 3CC7I 1ZX5A 4QM8A 1PMJX 1LODA 2FBHA 5FOJB 1OHFA 1WWYA 3M8JA 2N7GA 3ZXDA 3Q9OA 5FV3A 3DU5A 2HPIA 1GZTA 1MMAA 2W95A 2QKLB 3R4UA 1RUJ1 4XNFA 3EB7A 5FRMA 1KU9A 1QOTA 2R063 2JE9A 2ZKLA 2HQNA 4XKBA 2HDDA 2VR4A 1VBD2 2KM2A 1SVOA 3DEUA 2QVSB 5C3SA 5HV4A 3NAUA 3WDVA 2CUJA 1RUF1 1U9NA 1U6GA 1UZVA 3BYWA 4BOWA 1O7FA 1GNHA 2IGNA 1BR2A 1XJAA 3SHRA 1JHHA 3OYCA 4FPFA 5BPIA 2P5KA 1V5EA 2W85A 4H14A 3M3EA 2IT0A 3F3XA 1D7PM 1NQDA 4GMP3 5GLTA 2R042 1EAH1 3DF8A 5LGNA 2PHLA 2R7DA 3EYPA 3HJEA 3NWSA 4A6EA 2BBYA 2B9SA 1TQMA 3IKWA 3BQYA 1CZSA 4BQAA 1FV3A 4ZYAA 2BNMA 5CIRA 3M3QA 5FLXZ 3GFMA 4G94A 4QDQA 2HWB3 2OU2A 2LH9A 5FY1A 1LEDA 3HM5A 2XR4A 5GAEJ 4JKMA 2CU7A 5FD6A 1WI3A 3P9CA 3E6DA 1ND2B 2H8WA 1RUE1 1KYWA 2EIGA 4Q4X3 4HOBA 1FYLA 2ZHLA 4K8FA 2HOTA 4A3MJ 4IV3C 5GJ6A 3BB6A 4IXAA 2P3KA 2E1NA 3UJQA 1ZBE2 2DODA 4D7MA 4KWUA 1WUVA 3WNLA 4IV3B 1XYOA 2Y8KA 3FBYA 1JT6A 4UBHA 3NV3A 3AC0A 9ANTA 5B3SH 2V7FA 2Y6LA 2QBYB 2R7UA 3ETPA 3MF9A 1GYKA 4C91A 1TL8A 3HOWJ 4NWVA 3SQOA 4AFAA 2Q8CA 5D8LB 5E8AA 1PO21 5FZOA 1QIQA 2WSUA 4XIKA 1P9QC 5LEKA 5CU1A 5JOZA 3IKTA 1PUFA 2GNMA 3WSOA 3VBHA 4HANA 1WCUA 2XB0X 2RQPA 4CXXA 4G7OF 4AQTA 4I98B 4IHWA 1D0ZA 4IOCF 2ME0A 4UXAA 4WXHA 4AQ6A 4ASKA 5A70A 4DBQA 3MIDA 2ZXQA 3WX5A 4RR3A 5EDNA 2K3PA 1GV9A 1BK0A 2I07B 3F6VA 4CZCA 4A93J 4H55A 4WZCA 3OGGA 4TYSA 3FXJA 1HXDA 3LSMA 4BQXA 5D1IA 2CW7A 1UZYA 2QZ2A 2L2OA 3EJKA 5IK5A 1XC5A 3ZIXA 2E53A 3SZPA 3K6GA 1VLNA 4F52A 3LWCA 4GWNA 1HKSA 1HSTA 5F37A 2IW5A 5GLVA 4Q0UA 4C3JJ 2V73A 1W8WA 2F4PA 5T5OA 3KQRA 2STTA 5DV5A 5K0UC 4RGGA 1S7AA 3FM3A 5JXGA 4KYWA 3WNPA 4B1RA 2RMU2 3I54A 4KU7A 5JLWA 4NOTA 3VZNA 1WJEA 4NIAA 1UF2C 1YRZA 1TT5B 2P5VA 4Q5SF 4FETA 3HPNA 3NJZA 3JSOA 1E3HA 5IK4A 2HWD3 2Q8DA 1IAWA 2MSYA 3EUHC 1YG2A 1MDMB 4NHJA 5FXWA 2J5OA 3LOIA 5ICCA 2H1KA 5GZGA 1O3SA 4XUTA 1JJ8C 1V6NA 3NKGA 1EPWA 2ESHA 4XL9A 2LALA 2NZ9A 3CZJA 4YM3A 2KDOA 2A6VA 2KDZA 3GJBA 2E2JJ 3WF0A 3TEYA 3ZOIA 2XAQA 4LHLA 3MHZA 4QHOA 2P1BA 5BOXA 3GTGJ 4A3XA 1O91A 5DDJ2 3A23A 3IAS2 5FPAA 4N4NB 1IN8A 4QQOA 1V6LA 5A3TA 3HXLA 2VW0A 5JHUA 1WKYA 5JOWA 1X58A 4FE4A 2DVDA 2ZFWA 4E4HA 2WFPA 3NJYA 1LOFC 1VBD3 1JT0A 3CCQI 2VXJA 4XXPA 3OBAA 3CDHA 4CDQA 3WG4A 3WLUA 3OR2C 2WAEA 2X6WA 2NLRA 3BCWA 2P81A 4DXZA 3CUOA 2ZGOA 3W5MA 3JRHA 4AOCA 4UFMA 4RAGA 4DY3A 5DUWA 3F8FA 1NXD1 4G4FA 3FFQA 1GLNA 2VI6A 2R043 3SKJE 4CCNA 3K3NA 5D6EA 3GZUC 2W46A 1MS9A 1GBGA 2Q1FA 1UG0A 2BWCA 1P92A 3MW4A 4FPKA 2OQGA 5K8SA 2PHTA 4AD9A 1FV2A 3V7RA 3MFKA 5ACA2 3I59B 1DP0A 5DAXA 1JMUB 3RKXA 3N36A 1AR72 5EQUA 4XBQA 1YIPA 1BVP1 4F91B 4Y5SA 4BUPA 5GTHC 3KYLA 1HXS1 4R9AA 5FQ0A 5KXDA 3BPSA 4ZU5A 2Y6GA 2IFWA 5FZLA 4N9IA 4DUXA 1X1BA 3GBFA 3VYTB 5D5WB 1WKMA 4XURA 4RA2A 4TXWA 3Q0UA 4C9YA 1K7AA 2XQXA 2BY3A 1QJU1 4JZRA 3GX4X 3RRDA 4Y1UA 1SG3A 4PIZA 1Y9GA 5T50A 1ZBE3 2ZO4A 4IF4A 4ITCA 2WTEA 2QQPA 2VBYA 1OCRH 3OYEA 2BDRA 3ZYGA 3HSEA 4BQ2A 2R32A 2IRFG 5JPNB 2MH2A 4PUSA 4Y1VA 4WVMB 1JYIA 1IV6A 1VAVA 4CCOA 5KXCA 1J3RA 3MFAA 4AVCA 2EFQA 2BVMA 3FBNB 2QQOA 3DEMA 3N97A 5FPBA 1ETWA 1Z6TA 4AAXA 3OYNA 2OC6A 1U8BA 1NCRC 4XR6A 4D9JA 3AKZA 2GN7A 1NCRB 2HWE1 4XFBA 2OD5A 2AH2A 3ZCOA 4QKBA 4II2A 1X8MA 3USUA 5IP9J 2CRGA 2O8QA 4BDZA 1UG2A 4QQLA 1I27A 3N7LA 3JCIA 1MSEC 3WP4A 4B29A 4RYDA 2FQ3A 1OPCA 3KWVA 3GZNB 5M5YJ 5FAXA 3AB0A 5DCMA 4KWKA 3VYSB 5FTTC 3VHNA 5C4JJ 2C1FA 1ND3A 2YU2A 4JHZA 3LFIA 3A01B 2FE3A 3KEQA 2ZKZA 1IF1A 3ZN4A 5KHKA 3LB9A 5K4LA 3VYRB 1DGLA 1CESA 5BNOB 4P9LA 3LSPA 1JXSA 2JIJA 4DBRA 2IJLA 3O0WA 3ZN6B 3TEXA 5JXJA 3HBKA 5IYCJ 1FMD2 1EKEA 5FP8A 4UUVA 3BG7A 3PU8A 4ASMB 1KZHA 3U21A 4Y1YA 3CF5F 4C30A 5LASA 2RMU3 2WBMA 1S0EA 4RGXA 3JCUC 4XMYA 4YG3A 2X0LA 1HW1A 5DMYA 4UI9L 3OUIA 2KRFA 3B6AA 2HEOA 3IZOA 4KH9A 2M4KA 3HHHA 4LPLA 2JZYA 2HYJA 4MTEA 2JT1A 3VKLA 1VQ8I 3F23A 3T09A 1JUPA 4EJRA 2IA2A 5HPOA 2BNOA 2DVGA 2HVQA 3VBFC 3M8EA 1RHI2 3NAPC 1O4ZA 2JB8A 3LF7A 3VBFB 1X1PA 4GB32 2Z1DA 1ZM1A 3NAPB 1O59A 5DDJ3 3I3LA 5FP7A 4K8RB 1HB3A 1ULEA 2IC1A 1OT5A 4C90A 4FX0A 5AVPA 3H35A 4XLFA 5KC5A 2DJIA 2RQQA 4UUTA 4COZA 5EJCA 5GZCA 3ASIA 3UGGA 2VOPA 1NTCA 1ASJ2 5GZFA 2TDXA 2V9PA 3U0ZA 3AKRA 4OMCA 3G73A 2RS31 4AEJA 4BHBA 4META 3WY6A 1W0NA 4HK9A 1YI2I 4LK6A 3JQWA 5DABA 2W87A 3WG9A 3HGGA 3F21A 1YQ6A 4QB6A 4V2WA 3GTQJ 2M5WA 2EFNA 2GC3A 1PK6A 2DMNA 4AGGA 5AC91 4RAZA 3TOBA 3VD7A 4YLZA 1T38A 1PYVA 1VP6A 2L02A 3VZOA 2A3SA 5BQTA 4JC1A 1U78A 5ACA3 3KGZA 4JTNA 1RVF1 2G9FA 4ZY9A 4OHVA 2QVOA 4R9DA 4IETA 1B09A 1AR73 5LCWL 2RM22 3DECA 1MJBA 4KG8A 4L5IA 3ECOA 4Y5Z0 4EWDA 3K4CA 3TGNA 5FWJA 2XRNA 3DGTA 4KWJA 1BYHA 5C7GA 4HL0A 3P6BA 2VQAA 4Q1RA 1BBT2 2EZKA 1Q3EA 3QLQA 2ET1A 2ICWG 2ZMNA 3KCYA 3Q8EA 1L3JA 5L3EA 2VOOA 2R7QA 3LQQA 1FWZA 2Y0IA 2PLV1 2ES3A 4HT1T 1XSRA 1S9HA 3CMMA 2DCKA 1ETKA 3LSDA 1YOVB 5IATA 3BUCA 5CKNA 1MNEA 1SANA 3BZKA 4BK5A 5FYZA 1I50J 2HGCA 3DUIA 1REPC 5LWBA 4AEDA 2DBBA 2ZHMA 4XJUA 1ODDA 3AFGA 2OCCH 2KQRA 4H7MA 2J42A 2A07F 4ENMA 1H6YA 4GZ9A 1YW7A 2PMZA 3VB9A 2O14A 1LULA 4IW3A 2X53S 3QU6A 2XH6A 4ENNA 3JRBA 1LQ1A 2EZIA 2BYVE 3MKYB 2I2SA 2XBO2 5DUVA 1UN1A 4XETA 2HYXA 4DNCA 4CICA 2PN5A 1VQNI 1B9NA 3WTTC 2DVBA 4JX6A 1N1YA 2JDUA 4CDUB 1HA8A 1GWLA 3HHGA 4BEHB 2CGPA 3VHOA 1Q8SA 4KIGA 2H09A 3HZJA 1XRUA 3WOGA 5FKMA 5A2QK 3I2GA 3RS6A 3WV6A 3IUOA 4Z6YA 5ANNA 5IK8A 4MO7A 3VBRC 3IAM2 4KQ7A 3PJYA 4GDFA 1FMD3 4Q4W1 4HG2A 1JKQC 3VBRB 2MYSA 5CFDA 4EJWA 3FMSA 4IEWA 1HRV1 3IPVA 2CO5A 2VUDA 5J4VA 4QPIA 1RUOA 3AG1H 1DPUA 2CTVA 5DZFA 3GBGA 4R8HA 4EE2A 5LBCA 2F6CA 1K45A 4CDWC 3WTVC 5D8KB 3VZJA 3HPHA 1CJPA 2XONA 4IEYA 3WW3A 2RR12 4W6WA 1XTAA 1OYWA 1B1BA 3M1CA 5E1WA 3F2ZA 1OC1A 3JRCA 3I4MJ 3WGGA 4QGLA 4CH7A 4BE2A 2W7NA 1YRNB 2QQNA 2YU1A 2B46X 3VV1A 3R60A 2YFUA 4LBNA 1S6LA 1P4XA 5HCAA 4LIVA 5ICEA 1NQJA 1RUI1 4LKFA 3OIPA 1Z21A 3OSFA 5CG9A 3B7MA 1ZZBA 1F4KA 2EIBA 1REEA 4EROA 1RHI3 1Q8PA 3IV5A 4CEYB 2KISA 1SC7A 5IT6A 4GB33 4DEQA 2CW8A 1IGOA 3ACLA 2XF7A 2O6GE 1UMIA 1US2A 2XHKA 1W36C 4GIQA 2NYXA 4XEZA 3GEZA 4Y22A 3KSCA 2LY1A 3FLRA 4ZHNA 4PJNA 1H9PA 4RBOA 3POSA 1JZ2A 3J81Z 1BC8C 2KIUA 5FMOL 4AHWA 3ELNA 1BKZA 4P9JA 1ASJ3 2W94A 2W00A 3RQIA 3D0JA 4L0YB 4AI9A 2AENA 1UKRA 2GMEA 2DK5A 4UF0A 3I2DA 4N7UA 1BR1A 4D8MA 3MF6A 4P9XA 3NJXA 1NG0A 2R7VA 3OS1A 3P7NA 4C3IJ 1IC8A 3VEPA 4BJ0A 4EV0A 1X36A 2JK3A 2L7ZA 4QQPA 1I3HA 4L9VA 2VBBA 2A68F 2GNTA 2J1TA 1H2KA 1SMYF 5J1RA 1LOGA 4MSVA 2RM23 3IL2A 1UCXA 3P1IA 1QJY1 3V65A 4B47A 4XCAA 1H1AA 4P9UA 4YIRX 4Q4V3 3QPLA 3BTJA 1QXPA 3UK9A 2QE3A 5FZGA 4XORA 1BBT3 3PUSA 5EYXA 5GM0A 2FEZA 3IBMA 1YNAA 2WS91 1JZ4A 1RVF2 2VPLA 3OYBA 2VLAA 4LLFA 3KT4A 4DMIA 4HVRA 1UYPA 4AWDA 1IG3A 4M3CB 2PHRA 2MEV2 1QGLA 4MTDA 2JG9B 3KCCA 1O4TA 2ZJRF 2DF7A 3C7GA 5E20A 1UY1A 1WH7A 1T56A 3RIRA 2ISZA 4CUCA 2CQXA 1MEC1 3AP4A 2ZACA 5HV0A 4CU9A 1B72A 5F3IA 4YFXF 1UHWA 3VDDA 4XN3A 5J98B 4MVTA 1FAYA 3AMPA 3OL3A 4KDPA 1IOAA 2E32A 1VQMI 5FZOB 4TLGA 5BXXA 2ZHKA 4ANJA 3SHFA 1PUFB 5D5XB 3X2QH 2YR2A 1QWRA 4XYXA 4A2UA 1BLZA 5E89A 2WIIB 2XBO3 1ITYA 5T5LA 1FXZA 4RR3C 3IH2A 3BR1A 5GPAA 3POJA 4YFZA 2ZAHA 1Z0HA 3RSJA 4RR3B 2GXAA 2L7FP 4FQZA 4RLFA 2UWCA 3J7AY 4AIKA 3RVHA 1H2LA 2IS2A 3N9PA 3L2QA 5JVGF 1Y9MA 4KMFA 1OSGA 4LXLA 3QOPA 1NG6A 2O5RA 4MGTA 4JRLA 3JREA 1IDZA 1BVVA 2XGXA 3I2FA 4XC9A 4IE7A 3OCPA 2ZEXA 3PSFA 1OPOA 2Z2SB 3BALA 4BS9A 4BHPA 5FK8A 2VXDA 3I2KA 2VUJA 3HSRA 1MS4A 4QWNA 5IUQA 1YHFA 1CD3G 1US3A 3I2OA 4X0GA 5BNNA 5IW0A 2K9ZA 2ZXJA 3OOUA 2Y0MA 1FLIA 2P6HA 3Q3SA 2RR13 4P08A 5IT9Z 3BTCA 4J25A 1WCKA 4FOWA 3WW2A 4ZZLA 5IVYA 5JI6A 4JGYA 3K1MA 4AIDA 1FNYA 4ITVA 2CWSA 4HF1A 1NUKA 5EG0B 2X51A 4BK4A 2E1CA 2VD7A 5F9TA 4LO7A 1AU7A 3H5AA 1LRHA 3R4SA 2GM4A 2X6YA 4LOSA 5J8CA 4CYCA 5K7FA 1KA8A 1N75A 4G6TB 4C2MJ 1U3EM 3D3AA 5HODA 1TC3C 5A3UA 3N3HA 2FMYA 3UYJA 3KV9A 1RKTA 2V5DA 2M2EA 4J00A 2JA7J 1ULFA 1GDTA 2EXIA 3EO6A 3U1KA 3AZYA 4ES9A 2YMZA 3GZTB 1OISA 2VY0A 2B63J 3ZKUA 1JYXA 5LA0A 4I3PA 3CQZJ 2ZEYA 1FX7A 1ZBA2 2F5VA 5B2GB 3T30A 4CDQC 1RYYA 4E9KA 2DMUA 1ZTRA 4CDQB 4EN6B 3EUAA 1Z78A 3KB5A 2K27A 4AFMA 4Y20A 3BQZA 3LFKA 3RZLA 1X8EA 2EV6A 3CF6E 4AM3A 4HETA 3RG0A 4X8PA 3CD6I 4H0EA 4EZ4A 3KM5A 1CWPA 2VZTA 3NJVA 1SAUA 4AGVA 4B4RA 2K9NA 2Q5TA 5BYNA 4DO0A 1J2XA 1VQ4I 4CEWA 1F9NA 1EH7A 2W2IA 1Y8QB 4K21A 4QDSA 5LW9A 5F6LB 2P5BA 1YS7A 2W68A 3RSNA 1J1TA 3RZHA 4U87A 5T5PA 4P55A 3A2KA 4QAWA 4ZH4F 5FQ0B 1A5JA 4NROA 4QX1A 5L7OA 1VZ0A 4Q4ZF 1O5LA 2YBKA 1ZGJA 4DEVA 3GBWA 3FMQA 3FHAA 5HLTA 4JCKA 1LHWA 1N25A 3KT7A 2RV8A 4AAPA 1PO11 2VCMA 2VPRA 2NVXJ 1NE6A 2MEV3 2NVYJ 4XMIA 5A1FA 4ESJA 2C9AA 3S14J 1OA3A 4QKNA 2QDRA 2FMDA 2DW4A 3AG3H 1WA6X 5FWEA 4IHTA 3THDA 5L19A 4CPBA 1YW8A 3QODA 2JX9A 5CG8A 1YEWA 4P5YA 3K4LA 2DU1A 2V1XA 2VULA 3KX2A 2EICA 2WL1A 4IJAA 1H8TA 3VBUA 2X05A 3KF5A 4QM9A 1S72I 1Z9CA 3KETA 1YIJI 2MGQA 2ZX3A 1J5YA 3PQJA 1QH6A 2HQRA 4YRDA 3MIBA 4XUQA 5I91A 1OR7A 2QKDA 3USUB 1QHGA 2MBFA 4GD4A 3UL2A 1G9CA 4TTGA 1V54H 1DHKB 1TNRA 2GP3A 2UWBA 5FZ3A 1Z77A 2CH0A 3DBRB 2P8TA 3VSKA 5DCMB 4EM1A 4RB3C 2R7ZJ 3VN4A 2BVBA 1T8IA 4K7JA 1W8TA 2ZKNA 1JODA 4BM8A 2WN2A 3ZN1A 5F2SA 1NKGA 3KVAA 4GALA 4QKDA 3MIGA 4OIQF 1VAMA 5JWPA 3GLLA 1W2NA 1T33A 3U10A 4FBFA 3RJPA 1KDKA 4BDYA 2O0YA 3HOSA 1TMF1 1VBE3 3IN9A 1W8ZA 1BI1A 3JRFA 3S8PA 2VZOA 4ZDLA 2WNOA 3QCWA 1IUFA 2BZTA 1I5PA 1WI9A 2EA4A 1CR7A 2FDHA 2JG8A 3HB9A 4CP9B 2JRMA 1EV7A 3JXSA 1V55H 5C33A 1IHMA 1W9TA 1HKTA 4GKXA 3C7EA 4LJHA 5CA6A 1QQP2 2P37A 2Q1MA 3PO2J 4Y3OA 2YPRA 3POEA 2CAUA 3VODA 1POQA 1IN6A 3PMEA 4TSVA 2WYFA 1FOWA 2KZVA 1QHDA 4RGSA 2DFIA 3J7YJ 1RUG1 3W59A 2QM3A 2I74A 2JN6A 3OYAA 3KV5A 4RGRA 3S3NA 2VC9A 4DRRA 1ULYA 5D2AA 3DXUA 4NHMA 1GU3A 4LK7A 3DKXA 4HG6B 1SD5A 2D5FA 1ETOA 2CW0F 2R7EB 1DGRN 1ON2A 3UGHA 1ZBA3 3ZX7A 2L7MP 3WG2A 4WX9A 4PHZA 4IEPA 4Q48A 2VE1A 3V0AB 1ACIA 2JDPA 1R36A 2YC4A 4CYDA 1COV2 2XHNA 1PK6C 4X6AJ 3ST7A 2B7YA 1SLAA 1PK6B 2ZJCA 3BIWE 2Z3YA 1F36A 3TOJA 4UXNA 5H6RA 1LKNA 1MS8A 3HQUA 4BLIA 2XAUA 4OQ9A 2GZWA 1QNYA 4UV9A 4XQDA 1JHJA 2AHQA 3LQRA 1MZ5A 2VMGA 3FMRA 1Y3TA 2K3FA 4M9SA 2ZGQA 4N8MA 1JZ6A 3S93A 1MGTA 3MD2A 3B93A 3M9AA 5FLMJ 2X9DA 2IXCA 3H7YA 3CL1A 2R3SA 3F6OA 3L9JT 1TE1B 3K4AA 3D5OA 1HJFA 3ILRA 1ETQA 1DLCA 3OGSA 1JHFA 1OOPC 4K6BA 4LK0F 3IDBB 4O9EA 4A3JJ 2DV9A 4QPQA 5IP7J 3ZQCA 2CUEA 1R1ZA 1RUD1 2X5IA 1OOPB 2Y6HA 5K5QA 1DQ4A 2ZZJA 5FLXK 1SFOJ 1MS5A 3C1DA 3GF2A 4QX8A 3HKZN 4E2SA 2Y0OA 1AR82 2CV6A 4IEOA 2QENA 5CNAA 5DG2A 4XICA 2VM9A 1QRYA 1AR62 1Z05A 5GPCA 3J7MA 5KHGA 4HVQA 1NK2P 1W2OA 3C2GA 1LFPA 2GC1A 2DUOA 4U36A 4B1MA 3NSTA 2PAKA 1ZG1A 4AEDC 4FAHA 3MZHA 3OMYA 2WWSA 4AE2A 4XFHA 4FSJA 3WQ0A 2F5CA 2F4IA 4AEDB 5BMZA 1S0JA 2RREA 3ELKA 2HTJA 4N0BA 3MKZA 3LZZA 2BXZA 1YJ9I 3L2RA 3VBSB 3RZMA 1IZ1A 1YJLA 1FMVA 4EEFG 1AF9A 3FHNA 3H92A 2HXIA 1R6RA 4X1EA 2CS3A 3J7HA 4S2HA 3HOUJ 4RA0A 3L2VA 4Q4Y2 3WG7H 3SJMA 4GAZA 5FY9A 1QF3A 3CJTB 3JD71 5C70A 4CUAA 2MLKA 4ZDPA 1SLTA 5FPLA 4XIDA 4IEVA 5E8GA 1KFXL 3WNKA 3GHMA 2F48A 3CCJI 3N05A 4CA9A 3EDPA 3TEZA 3N35A 1VR3A 3OIOA 2GC2A 5DAVA 3RKWA 1W9SA 2DYSH 4IQPA 4MV2A 4JTOA 3IM0A 4LMFA 2RJKA 1HJGA 2CV2A 2VXRA 2EIDA 3BOPA 4E7LA 4LBLA 1V6MA 1XGOA 1FTTA 1R092 1KU3A 2UWAA 5M5WJ 3ZO0B 2HOAA 4RL7A 3D1NI 2ARAA 3RPUA 2A6ZA 2AYHA 2HYKA 5CFDC 3DTKA 2Z5WA 2GIVA 3VDBA 1U5XA 1SD4A 3S1MJ 1UAIA 5F27A 2QQJA 5EP9A 4QTRA 2IUWA 3GXUA 5CFDB 2VZUA 2Z69A 1WJAA 2FCUA 2VJJA 3CCLI 3O1UA 4KN7X 2GWRA 3BKZA 1VBB1 3QPHA 3RPQA 3CIHA 1JTYA 1X19A 2WN3A 3ORJA 3THTA 2VZSA 1LB2A 4AVTA 4ON0A 1BOAA 2SLIA 3FKJA 4HDUA 2D5HA 1Z7UA 2JJ7A 4OUMA 2GSYA 2WA4A 4MGIE 4O65A 1QQP3 3LIHA 2UWMA 2LUWA 1X4OA 1BR4A 1BJAA 3EETA 1F15A 4ZYDA 1XSVA 4NC6A 5JUVA 2OPKA 4YW3A 3CC2I 2ZABA 4BQWA 1PGL1 5E17F 3N9NA 3MV11 3CDLA 1XU1A 1C0WA 5CAZA 2EAKA 3PFYA 4FISA 3FMGA 4R4XA 3KP5A 3CJRB 5LGTA 1WFXA 5EPAA 3LAJA 3MDPA 4Y22B 2Y9YA 1W06A 4E7ZA 1FC3A 2DT6A 4F55A 5D5VB 2XJSA 2R7SA 1AYN1 1PVXA 2YXSA 3F95A 3LGRA 2W47A 1RRJA 3VKOA 5DPNA 1OCZH 4HFSA 4Q26A 5FFOC 4GJZA 2NNNA 1NH3A 3TRSB 3D8CA 5HXVA 5A3OA 3AZZA 5FFZA 1H1IA 5SV8A 5IY5H 3C7OA 3DCQA 3CCRI 3H3UA 2DA6A 1COV3 2RS12 4Z2AA 3LOBA 2Y2ZA 4M01A 4LO6B 3H1WA 4UF0B 2VC0A 3M70A 1I1GA 4LHNA 2Y0SN 2VBPA 2RNGA 4M3FA 3UT0A 1OQEA 2FDFA 1R082 5HNFA 3KP6A 4DFSA 2PFWA 1S0CA 1XBFA 3U14A 3RZKA 1OF4A 2GNDA 1O3RA 1UX6A 2VBDA 3PQKA 1I9RA 2XQRA 2X4HA 3RQ4A 5JMCA 3FLTA 2V6EA 3GCWA 4ZKTB 1BHGA 1ZA4A 2YV8A 5C3QA 4PJJA 5D4SA 2DQRA 4I0AA 2VMCA 5GKAC 4BQ5A 4XTPA 2E7AA 1TZOA 3PL8A 2XSDC 1VALA 2HFHA 1X82A 4JQTA 5F5IA 1D5YA 2UURA 2ZTNA 2ETHA 2LNBA 2D1VA 2I45A 4N43A 1WCQA 1QZEA 2TRTA 5AIQA 1PMIA 2YPDA 3A0NA 1GUUA 3PUHA 2Y33A 3JB4C 1AR83 3L09A 1I1SA 2E1MC 4M4RA 1AR63 1W6MB 3IHUA 4YEJA 2NQYA 2E1MB 5K7ZA 5JXHA 3IKVA 3UETA 2CV1A 3GGLA 5LHGA 3PSIA 4PF5A 1ETXA 4LOCA 4AW7A 3MBWA 2XKOA 3VDDC 2BBAA 3ESWB 2NAZA 4C2TA 4CZZA 1B72B 3CCVI 1QKQA 3VZKA 4XQFA 1BXHA 2A3YA 4DNYA 2XL9A 1GP6A 4BKXA 4FT8A 3X29B 1CONA 4Q4Y3 4XMAA 5CFCA 2K9QA 3E5QA 2AUYA 4FP3A 3I58A 2EA7A 5FYYA 2OX0A 1RUC2 2F2EA 5JCTA 2VH9A 2CDOA 3AX4A 3UNGC 4ZTJA 5D8AC 5EEAA 5D8AB 2GH2A 2EAAA 4SBVA 4BXUA 1BM9A 4M6YA 4U0YA 5B1BH 4M00A 4O3MA 1PZ8A 1H0BA 2HDCA 3JTHA 3A21A 3DYOA 1XMXA 3LNQA 2Y30A 1R093 4QGNA 3OOPA 4F93B 3OYHA 4O61A 4RB2C 4WVWA 3NQOA 4XCBA 3HBLA 4HKWA 2HWVA 3AKSA 4HX4A 3LSKA 2HBUA 4BQOA 1GP4A 5APAA 5BNNC 2G9GA 1WMFA 4YRVA 1VIWB 3HVDA 4BU2A 5K7PA 5EEHA 5BNNB 2EF6A 3SXWA 2O8OA 3ZXGA 1IRGA 3VFZA 5BS6A 2ZMEA 2ETEA 4JGYC 5IVVA 4JAAA 2EALA 3LL7A 4YVSB 4JGYB 4MGZE 1YLFA 5F6KA 4BLJA 1AYM1 5FBZA 2W82A 3ACGA 4HONA 2GN3A 4IHVA 1OUSA 4FP2A 2I8DA 1S2BA 2E19A 3J8F2 3TP0A 2MH9A 1UY3A 2JA5J 3JSPA 4J1XA 3WNXA 4HW0A 2IXSA 2RJLA 1QVUA 4NQWA 2LLKA 4QIWN 2K4BA 1HSJA 1JUSA 4MUVA 1VMFA 1TTYA 5E18F 4CDXB 4NJ4A 1ZZCA 1MH4A 2WFF2 2QQUA 2ADUA 1W04A 1VQKI 2W3JA 1A31A 3ZYBA 5J40A 4YVWA 3ZXAC 1UL9A 1IQDC 2ZGRA 4GFBA 5A3NA 5HCHA 4BJ6C 5IYBJ 3LEMA 1Y6IA 1VBA2 4CCCA 4ABZA 5CPRB 1ZZ8A 3TDUC 3ZSEA 3LWFA 1E5IA 4AHYA 4Y7NJ 2CU5A 4P14A 2VTXA 3HL2A 1UB9A 2RS13 4WV8A 5E6HA 2VW1A 3ULQB 2STWA 2V9KA 3EYIA 2CNAA 4RAYA 3WHTA 1HRI2 1R083 4JX4A 4IERA 3WGHA 4JBAA 5IFTA 1ST8A 4YW2A 1AYN2 3BTXA 2VC1A 2G9ZA 1A78A 2P7CB 4CEWC 4G6DA 4NR1A 4B8XA 4IL6C 5JLXA 2IS1A 3SLIA 2RDSA 2VIXA 3O0VA 1D5VA 4UYBA 4CEWB 4XF0A 1FIPA 5JXIA 4Z82A 1OH4A 1CVNA 4BBSJ 3HNMA 3JUUA 4Q0SA 3U4SA 4OIRF 4QPYA 4M4PA 3QPSA 1DGWY 1HW2A 4RHV2 1S1AA 2VNRA 4XK4A 2DXIA 1MS1A 1LEBA 2QSFX 4LNVA 3OR1C 5L7OC 3AZVA 5FUPA 3J7AO 3SH3A 2JB4A 2WZPP 4HXCA 5L7OB 2HEWF 4EQVA 1C1LA 3RZZA 1R4MB 3LSEA 3LPGA 1W3XA 2WLPA 2DBIA 5JZGC 5J48A 4WZFA 1BEV2 4FX4A 4LO5B 3SYTA 4CXWA 3E7LA 3DTIA 2ARXA 5JZGB 4AIJA 4XVHA 2ZMKA 4Q27A 3PNYA 4YZ3A 3J80Z 4Q5OA 3MW3A 4ONUA 5F64A 1SLBA 4L5JA 3CESA 2A5ZA 2Q2EA 1ZLJA 4P9FA 1U5IA 1UXZA 1UU6A 4WM7A 4QKFA