1LOCA

Interaction of a legume lectin with two components of the bacterial cell wall
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
180
structure length
180
Chain Sequence
TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEANVVIAFNAATNVLTVSLTYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEGUME ISOLECTIN I (ALPHA CHAIN)
publication title Interaction of a legume lectin with two components of the bacterial cell wall. A crystallographic study.
pubmed rcsb
molecule tags Sugar binding protein
total genus 27
structure length 180
sequence length 180
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1locA00
2DVFA 4XBQA 2ZGTA 1ULCA 5DZFA 1GZWA 4CZSA 2CWSA 4XMIA 4NO4A 3A0KA 3W58A 3AP5A 1IS3A 1LOFC 4P14A 1AVBA 1S0FA 2VY0A 3KM5A 3OY8B 3SISA 3HMYA 1MS3A 4YG3A 4RL7A 1W6MA 3M3EA 3ILRA 1N1TA 2ZGQA 1N47A 3ENRA 1YRZA 1C1LA 1LJ7A 4Q8LA 1OKQA 2C9AA 5DXDA 4YW1A 1WD3A 4LBJA 5JOZA 1IS6A 3WUDA 1Q8VA 2WKKA 1H30A 3AK0A 4YGBA 1YIFA 1HLCA 1JBCA 3AP6A 2ZABA 4LBOA 1W6PA 2D6PA 4WVVA 5DUVA 1Q56A 5SV8A 1G8WA 4AGRA 2DU0A 3WDTA 4YM2A 1TEIA 4XXAA 3AP7A 3AP4A 4K20A 1CPMA 1MS1A 1SBFA 4GWMA 3NV3A 3ZYRA 2D3PA 4PCRA 2W08A 3QCWA 1QGLA 2A75A 4K1ZA 1QDOA 2ZACA 2EXKA 3O0WA 4TZDA 2ZMKA 3SH3A 2WNEA 2ENRA 1QMJA 2ZGKA 4YG6A 3N7KA 3VKNA 3MPPG 1MR5A 1W6QB 1N1YA 4XE9A 4D69A 2UWAA 1LHUA 4YW5A 4K21A 3ZSLA 4Y24A 4LBQD 1MS5A 1SLAA 2A3YA 2A3WA 2DVAA 3INAA 3AXDA 3BTAA 3OPZA 2EAKA 4FOQA 1S0JA 1FAYA 1W6NA 2YY1A 1PZ9A 2PHTA 4MYEA 4XMAA 1G9DA 3V0AA 4R9DA 5T54A 1MVEA 2W39A 4DPNA 4GXLA 5CNAA 1Q8PA 1MACA 4WZFA 2ZZJA 3BOPA 4BLIA 3WHUA 3SH4A 1AXYA 3IM0A 1VAMA 5EYYA 3LSEA 4AVVA 2P3KA 1A8DA 4KBBA 1GSLA 4CRQA 2WSUA 3N3HA 4Q1RA 4M3CF 1WW7A 2A7AA 2VW2A 2PHXA 3U4XA 2ZGRA 3R4UA 3WDUA 2JDZA 2ZMLA 1QOTA 3AX4A 4ITCA 3UK9A 2A71A 4M3CA 4YGEA 2VUAA 4YG0A 4XZPA 3WCRA 2YMZA 4DS0A 1V6JA 3O12A 4AVSA 1GZCA 1BXHA 2NMOA 3B00A 2A6WA 3HR9A 3L2YA 2RHPA 2NMNA 4XJWA 4YW4A 3BODA 1MS0A 5JDBA 4XBNA 2DYCA 1Q8OA 4LBNA 2A6ZA 2UURA 1UZZA 2CNAA 3AZZA 4YGDA 4W65A 5GZDA 5DG2A 1S1AA 5DG1A 1F31A 1LGNA 2TEPA 3M3OA 1NLSA 1DQ6A 3QLQA 1CN1A 1CQ9A 3OYWB 2D7FA 2SBAA 2CY6A 5FREA 1DLLA 2NN8A 2B7YA 1SLBA 3AZVA 3M3CA 4SLIA 2R49A 5GLTA 3TAYA 1V6OA 1OQ1A 1FNZA 1UL9A 3ZSKA 3SNMA 4FPEA 5EWSA 4DQAA 3A4UA 1LHVA 1WBFA 2ERFA 4I30A 4YZ2A 2AUYA 1ONAA 3FUOA 3ZVXA 1FATA 5E89A 2FHRA 4GKYA 1LOBA 3RMYA 5JVVA 3AYAA 1U0AA 4Y1XA 1FYUA 4UW3A 5CA6A 2DU1A 3OY8A 1WW4A 4BMBA 1S0GA 5KXBA 4U2AA 1AJKA 3FBYA 3V0BB 4Q1PA 1SCRA 2DUPA 1AX0A 1KDKA 4FP3A 1H9WA 4Y1VA 1DFQA 3ZYPA 3A0NA 1UZYA 2WLQA 5T5LA 3LSDA 5GZCA 4ZKTB 1FV2A 3AJYA 1JHNA 2JKBA 3DGTA 2FMDA 4XILA 4FPYA 3AZXA 5EXOA 3ZXLA 4XJZA 3USUB 1DQ2A 1LU1A 2CTVA 4Q2FA 4FVVA 4M00A 5GALA 1UAIA 3C2UA 1DQ5A 4XJ8A 2ZHMA 5HCBA 4BLJA 1SCSA 1X50A 3VUOA 1AF9A 1S0BA 1AXZA 2A5ZA 4XOGA 1ENSA 1WBLA 2LTNA 2ES3A 3AXEA 5KXDA 1QKQA 1O4ZA 5H9RA 2UWBA 4Q26A 1APNA 1VIWB 1V6LA 4ISQA 1DBNA 3N36A 4BOWA 1N1VA 3POYA 1W6QA 1W6OB 1UX6A 3WG3A 1WW6A 1D2SA 4TYSA 3ZXKA 3T1LA 3WHTA 1HKDA 1O4YA 3MW2A 1QDCA 2JD4A 3AFKA 4XIOA 3WG1A 4JCKA 4Q27A 1MZ6A 4YW2A 1CR7A 4F83A 3AYDA 2ZMNA 1V6NA 3RSJA 2GNBA 2NM1A 5IK7A 4YGCA 2P37A 3VKMA 1G7YA 1N1SA 5CB7A 1QOSA 4Y22B 5LK5A 3UJOA 2AREA 1F5FA 4YFWA 1QF3A 1YO8A 2DVGA 2ZHNA 1LHOA 1AJOA 1V6MA 2GMMA 3AYCA 2ZGMA 1DIWA 5IK5A 4ATFA 3NV4A 4XJUA 2EXHA 1G86A 2DTYA 3H0OA 2DVDA 4YM1A 1C57A 1ZA4A 1KQRA 1XQNA 3ZXJA 2R16A 4FPJA 1LECA 3PVEA 5T5OA 1HDKA 1V6IA 4M3CE 4FPCA 3ASIA 2OW4A 2A6XA 4DRVA 1R1ZA 5GJ6A 2VXRA 1G9FA 2R1BA 4L8QA 3PMEA 5JOXA 1DQ0A 3TB0A 4GALA 4GA9A 1MS8A 3Q9OA 3OBTA 1LOAA 2D43A 2YV8A 4FPGA 4YZ5A 1ENRA 4C1WA 2AH2A 3POWA 1LGBA 1QNWA 4LBQB 3WUCA 1WLCA 2ZKNA 2AR6A 1W6PB 2PELA 2OUJA 1GNZA 2ZGLA 3IPVB 3OYWA 2BQPA 3WCSA 1GLHA 4Y20B 5GZFA 4BMEA 1W0PA 1RINA 1S0DA 2ZGPA 4XYXA 4AVTA 5KXCA 4ATEA 5GLUA 5H9PA 3WG2A 3WDYA 1F9KA 2XG3A 1LHWA 3CNAA 1FX5A 5GLWA 2ARBA 1VALA 4XTPA 5T55A 3NWKA 3WLUA 1H9PA 3RMXA 3B01A 5T5PA 4P9WA 2ZHKA 1GKBA 2VW0A 2WT2A 1IOAA 4Y1ZA 3WZ1A 2GN3A 3B3QE 2PHRA 1OFSA 3B9CA 4ISRA 2AGSA 2EXIA 2GN7A 1AX2A 1DGLA 2P34A 2VW1A 4FOVA 1S0IA 1GZ9A 2KM2A 3ZSJA 1DQ1A 1LENA 1VLNA 1I3HA 1WLWA 3V0BA 1AX1A 5T5JA 2UU8A 4JC1A 5E8AA 2DVBA 2PHUA 1ULGA 2HYKA 1ULDA 2E6VA 2P3IA 2VU9A 3MW4A 3AZYA 1Q8SA 3LCPA 3RQ0A 1V00A 3AYEA 3N7LA 4PBOA 4NOTA 3USUA 3WDXA 2WJSA 3ILNA 5T50A 1D0HA 1GICA 5JLVA 3AP9A 4FP2A 3T2TA 2NYYA 1CESA 2WSVA 1IKQA 1N3PA 3POSA 3V64A 2GNDA 1GANA 4BQ1A 3UL2A 3D6EA 2W52A 3KQRA 1IS5A 3RG0A 4HL0A 2E53A 4RA0A 5JMCA 5IK8A 1CJPA 1LHNA 1UPSA 3FFZA 1Q8QA 1MZ5A 3M2MA 3PJQA 4P9YA 4XHXA 1W0OA 5GM0A 5GZEA 2JE9A 2EF6A 3GNEA 4FOYA 4M3CB 3WV6A 5F9TA 5HCFA 1PZ8A 2PHWA 2ZGUA 4H55A 4CTEA 3FUQA 2UWCA 1LOGA 1Y7BA 1LOEA 4C1XA 2WQZC 2DURA 3I8TA 1W6OA 1V6KA 2D6OX 1BJQA 3BIWE 2A6YA 5GZGA 2GMEA 1C4RA 3V65A 3VKFC 4DRRA 2DTWA 2H0BA 1VAVA 3PVNA 2GMPA 1N3QA 4Y22A 1Z78A 3ZSMA 3IMNA 4Z8BA 1S0EA 3AZWA 1HQLA 2EIGA 1CONA 1KJLA 1SLLA 1SACA 2CL2A 2DV9A 1LU2A 1RIRA 2JE7A 3N35A 3VKOA 5CAZA 4AGVA 2DUQA 1YXWA 1CPNA 1WUVA 4R9BA 1LULA 4JRAA 5FRAA 4GWNA 4XHBA 2G4IA 4IQPA 2CYFA 2E51A 1BZWA 4HANA 3ZXEA 1ZM1A 4XTMA 4FOWA 3PVOA 1LESA 4FPHA 4XXPA 4Y26A 1DHKB 5DUWA 2YXSA 4Y1YA 1JW6A 2ZGNA 2PHFA 3R05A 2YROA 4FPLA 5DUXA 5DZGA 3OBRA 5T52A 3WNXA 2D6KA 1MVQA 3ILFA 4XJ9A 4YZ4A 1SLTA 3OGGA 3VV1A 3UJQA 1B09A 1QNYA 2GALA 1IKPA 1JOJA 2VH9A 1BYHA 3FLRA 1DQ4A 2GNTA 1LEDA 1WCSA 2R0HA 4LBQA 4UW5A 3ZPYA 2GNMA 4YM0A 1GYKA 5KXEA 1LTEA 1LODA 4XDQA 5IT6A 1LOCA 4XJAA 3IPVA 2DWRA 4Y20A 1SBDA 4XIKA 2YZ4A 1GZWB 4R9AA 2ZAAA 4ASMB 3MEPA 4GKXA 1YYNA 3I4IA 2ZBJA 4ZXKA 1LGCA 3SITA 1DYPA 1FV3A 1ULEA 1CVNA 1W6MB 1CIWA 3N7JA 4AWDA 1BKZA 2D3SA 2AENA 2Q5TA 1JXNA 1SLIA 2AYHA 2V5YA 3DUIA 4FQZA 1LCLA 3SLIA 1JUIA 1MS4A 1QU0A 2A70A 1LEMA 1N3OA 5L73A 1WLDA 4FPKA 3SH5A 4FPFA 3RRDA 2JJ6A 2D6NA 3VKLA 2ZGSA 2A6VA 1JYCA 4YM3A 4R9CA 5H9SA 2W68A 5GLZA 1SLCA 1S0CA 2EXJA 1KDMA 1A3KA 2EALA 1DZQA 1KITA 3HN1A 5CBLA 2WT1A 2ZGOA 3WDWA 1YI7A 4YLZA 2LALA 3O5SA 1DYKA 3FLPA 3M1HA 5DZEA 1KRIA 3JU9A 2P3JA 4YZ1A 2D44A 2R1DA 2NZ9A 4OZXA 2XB6C 5HCAA 5DUUA 1G9BA 4BM8A 1G9CA 3IKWA 1AZDA 1JYIA 1PZ7A 4M01A 1MS9A 3W59A 4Q8KA 2I2SA 4AGGA 1NXD1 4DFSA 1IS4A 1UMZA 1C1FA 4PQ9A 2P2KA 1UKGA 4YFZA 5AVAA 1GV9A 4U36A 1URXA 1W6NB 5IUQA 3V0AB 3APBA 1WD4A 4PBPA 3AJZA 3WDVA 3N7MA 4YZ3A 5F5QA 2CWMA 1AXKA 2V73A 3B69A 2WT0A 2A3XA 4UW6A 2C5DA 1Z0HA 2Z42A 2SLIA 3O0XA 1RITA 2NP0A 5H9QA 2R0FA 1QOOA 3WOGA 5EYXA 5E88A 4K1YA 2D6LX 2D6MA 3D5OA 4WV8A 4FQ4A 4PF5A 4UW4A 4BPZA 5BYNA 3ZXFA 1J1TA 2GDFA 3NV2A 3T1MA 3OJBA 1UN1A 4LBMA 4P9XA 4LBLA 5GLVA 2ARXA 3IN9A 3NV1A 4LBKA 1FNYA 4FPOB 1WW5A 3M3QA 3FLTA 3D4KA 2E7QA 1ULFA 2JECA 3WVJA 1ENQA 4XBLA 5JOYA 1KJRA 1SFYA 3O0VA 1GNHA 2OUHA 3WG4A 3JUUA 5IK4A 1I1EA 2ZA9A 3ATGA 4Y1UA 3MW3A 1EPWA 4WVWA 4YW3A 2D3RA 2DUOA 5JOWA 2ZHLA 1G9AA 1HQWA 3RS6A 1SBEA 2E7TA 4AYUA 3R4SA 1BQPA 1JN2P 2OVUA 1A78A 1GBGA 3GALA 1LOFA
chains in the Genus database with same CATH superfamily
4XBQA 2ZXQA 2ZX4A 1WA4A 3VBSC 4CEWA 5LY2A 3WF3A 2WA3A 5FYVA 1NT0A 1XBFA 4LEJA 2DCYA 2PLV2 2VY0A 2VOVA 4ORFA 3SISA 3VD4A 3JD71 4OZOA 1CGPA 5FUNA 4CEWC 1PO11 4YW1A 4GB32 1HN0A 1EV11 1WD3A 4LORA 3WXPA 5JOZA 4MGSA 3GXUA 1Q8VA 2WKKA 4AHWA 3WNKA 4YGBA 4F3JA 2IXCA 4W50A 1YIFA 1JBCA 2Y64A 2YC4A 1V9U3 5JIAA 2ZABA 4LBOA 1JOPA 1W6PA 1YWKA 3N9OA 1RUC3 4Y4RA 3S0MA 4URTA 2DU0A 2BGCA 4JKMA 4NIIA 1XNBA 1SFPA 4C90A 5LEKA 3AP7A 4H14A 2WNUC 3ZYJB 3PURA 5FZ4A 2P3YA 3ZYRA 2D3PA 4PCRA 3QCWA 2UY9A 1QGLA 2A75A 4LK6A 4MX3A 1QDOA 1X82A 4TLGA 4TZDA 4NHKA 3W5NA 4HBNA 5FZ8A 1RUNA 3SH3A 2O8QA 2WWUA 4GMP1 3VKNA 4QQ2A 3N7KA 4AI9A 4ZZ5A 4XFFA 3I3MA 1ULOA 2J7MA 4XE9A 2HWB3 3VBRA 5LBFA 3THCA 3WNLA 1OOPA 4GWIA 5HPOA 4M4RA 2A3WA 2ET1A 3OPZA 4FOQA 4GD4A 2EAKA 1S0JA 1MQTA 1FAYA 3DN7A 3JD73 4LOTA 4KWKA 1PZ9A 4EWEA 4QPYA 1PO13 3HD8B 3TEYA 2H6CA 1MVEA 1XJAA 2DCTA 1J3RA 2Y0OA 4LTAA 1EV13 5CKNA 3BOPA 5FKBA 4BLIA 5DAPA 3MUZ1 5A6QA 4NRQA 4HONA 4KG8A 1NE4A 4LE3A 5LWBA 1K3IA 4Q1RA 2UYBA 2YDEA 1WMXA 4DOUA 4QT6A 2A7AA 2VQAA 4XEZA 2VW2A 3BB6A 5K9YA 3K75B 1ND2B 1W2TA 2WLPA 3KF3A 5FXWA 3U14A 4ITCA 3WDUA 3HOBA 3UK9A 4RQPB 4CUCA 1T6BX 2RS11 1OI6A 2R062 3ZDSA 1LKNA 2WAAA 1H1AA 2YMZA 4EWAA 2EIEA 4CCNA 3MFCA 5FCCA 1V6JA 3J7NA 3O12A 4AVSA 3ACHA 4XETA 2HWE1 1NUKA 2NMOA 2IXKA 2NMNA 2D98A 5F2WA 3B02A 2FQPA 4GMP3 1U5IA 1OA3A 3MIGA 4PDWC 5KHIA 4YGDA 3P6BA 1UW8A 4OULA 1VMHA 2RS31 1DGWX 2QDNA 5L9RA 1YEWA 2ETEA 5DG2A 1DGRN 3GBWA 2TEPA 1LGNA 3J7LA 4FBFA 2ORZA 2J22A 3QLQA 3VBHB 1POV0 2QDRA 2VOTA 5D8AA 5FREA 5LB6A 2NN8A 4EE2A 3TNQA 4CUGA 4OI1A 5IWFA 3ZSKA 5C8CB 2EAAA 1W0NA 1NG0A 3MDPA 2FCUA 1LHVA 1NA1B 3JB8A 1AL0G 2ERFA 4I30A 5A7QA 3MYXA 2QZ3A 4IEWA 3ZVXA 5E89A 2FHRA 2TBVA 1LOBA 5AC92 3UNPA 2VTXJ 5JVVA 4UW3A 5CA6A 3NSTA 1WW4A 3OY8A 2WFF1 2WIIB 3VHPA 3RNSA 2JDHA 2RS13 2XVLA 3FBYA 5DAQA 2R30A 1SCRA 1QQP2 1PIV1 1UU5A 4HK9A 4XPVA 4O61A 3ES1A 2HWE3 3A0NA 2WLQA 2WQ4A 5GZCA 1BEV2 4N43A 1FV2A 4IESA 4QXBA 4CP1A 4LKEA 1XB9A 2ARAA 4MOAA 3K77A 3ZFEC 2TUNA 4PIYA 5FMBA 3I2FA 3VZKA 4B1LA 2RS33 3T2QA 4XJ8A 3RFRA 5FYMA 1SCSA 4QQPA 4Q4V2 3KCYA 4KQ7A 5IVEA 1S0BA 3KT7A 3IAPA 1D4M1 4AEJA 3I59B 1FMD2 5BNNC 2UYAA 3S5QA 1CWPA 5KXDA 1YI9A 2RVAA 5EJ3A 4CDXC 2AACA 2PHLA 4AK3A 3S7EA 4DXSA 4MGTA 3J8F2 1WMEA 3H1WA 4IERA 4LPLA 2VR4A 5CU1A 1AHSA 3POYA 2JDAA 1GOHA 1UX6A 4A6SA 4TYSA 2LW8A 2Y6HA 3MW2A 1O4YA 1AR61 1QDCA 2JD4A 1UYXA 4DINB 1JZ8A 1U5ZA 3ZFFA 1SPPB 2E31A 1EP0A 3THTA 2MEV2 2ZMNA 1V6NA 4AG4A 2WFF3 2ZS6B 3IDEA 3LA3A 5IK7A 5FY1A 2P37A 1DGWA 4UI9L 4Y4YA 1G7YA 1DDLA 1PIV3 1QOSA 3ZFFC 3GCXA 5KHJA 5F8PA 1QF3A 4Z2AA 3CJIB 1LHOA 1AJOA 1V6MA 3P3NA 5CFDC 1C28A 4BIFA 1CAVB 2RE9A 3QBQA 5A7NA 4CPBD 1CJDA 3URFA 5A3UA 2DVDA 4YM1A 1ZA4A 2PAEA 4AFAA 3H1MA 4BWOA 5FYZA 4MZUA 3PVEA 1EAH1 4ZU4A 4CDWA 4LITA 1D4M3 2WDBA 4AAXA 4L9BA 1D2QA 5C9AB 3KCXA 5JZGA 2YPDA 4FPCA 3SQOA 1QJEA 1I6XA 3K46A 2A6XA 2ZX1A 2R32A 4OUEA 2QUOA 5LW9A 2WO7A 5JOXA 4CDWC 2HWD2 3DCQA 1YQ2A 3JXSA 3O1RA 2WS92 3Q9OA 3LE0A 5CKQA 1H2NA 1R082 5EP9A 1OHFA 3WX5A 1ZBE2 2I74A 5FZ6A 1AR63 1J58A 2D93A 3WNNA 3ORJA 3I3DA 1W6PB 4WM7B 2XL9A 1Y3TA 2Y6LA 3LPFA 5FZCA 3IPVB 3OYWA 3WP6A 4CU7A 1WWYA 1W0PA 5LBBA 2XL7A 1DU3D 5GLUA 2QVSB 4OHVA 4D3WA 1F9KA 5BXXA 1NYWA 3WF4A 5FZMA 1QJY3 4XTPA 2Z4FA 3NWKA 1RUI1 3U10A 3WQBA 1H9PA 4COZA 4P9WA 4YW6A 1MEC2 2WT2A 1IOAA 2RJKA 5TSWA 3NRUA 3VBFB 3WZ1A 2PHRA 1AR92 1OFSA 4MGIE 4AVAA 4XUTA 2AGSA 1AX2A 2VW1A 1SZBA 4CP2A 1ZNPA 4P5YA 4QU2A 1ND3C 1Y9MA 1EAH3 1ENXA 4FCAA 1VLNA 4OQ9A 4H2AA 3TN92 4JC1A 1IQAA 5C3SA 2BP6A 4G4FA 2J42A 4NPLA 1ULGA 3T2OA 5KHGA 2G9FA 2P3IA 2UY8A 3EB7A 4XF4A 3LCPA 3B9IA 3N7LA 2R072 2NPIA 4QD2A 4IV3C 3ILNA 5T50A 1GICA 4GH4B 3AP9A 4JTOA 1QJZA 1POV1 2C26A 5JSRA 2Z79A 1IG0A 1SDWA 1GANA 2GNDA 4CDQA 5KWRA 2W52A 4H7MA 5FBJA 1ZRIA 2AC1A 3H50A 4NR1A 1XPWA 3H3LA 3RG0A 4IEXA 2O0OA 5JMCA 1UOGA 4NHXA 3ZYBA 3PJQA 3T0DA 2FDKA 3LFIA 5GM0A 2JE9A 3GNEA 4FOYA 3SCHA 3T4VA 2V4AA 2VUJA 1ASJ2 1AYN1 4IEQA 4CTEA 4P9GA 4YWAA 1RUI3 1RXGA 1Y7BA 1LOEA 2HEWF 4HKOA 2D6OX 4JKKA 1RB8G 1BJQA 1O91A 3BIWE 4AFMA 3WQ1A 2XH6A 3O14A 4EN0A 4KU8A 4UF0B 4DRRA 1AR72 4AEDC 3RI8A 2WNOA 4LULA 3O1SA 1CAUA 4JV4A 1MZFA 5A3WA 2X5IB 4RS5B 1CZVA 4B7KA 2BRTA 4GIQA 4XC9A 4Y22A 2CDPA 3ZSMA 4WZCA 4IDZA 4AI3A 4QB1A 1JZ4A 3AZWA 3PNAA 3UKNA 3V56A 1LU2A 1PK6B 4AQ2A 1YXWA 3AKTA 5FRAA 4CEYA 1PVC2 4HG6B 1POV3 4Q0PA 2VVDA 2G4IA 1UU6A 5FIXA 2CYFA 2E51A 3ZR5A 1BZWA 4QX7A 1O5LA 1BBT1 4DUVA 2B8MA 3OUJA 4XTMA 3Q8EA 3GM8A 4R4XA 2RJ2A 2WZR3 4XXPA 4A7YA 1HB1A 3VN4A 2ILMA 4Y1YA 5FR3A 4GWJA 1CD3G 1JW6A 2ZGNA 5IVVA 2DFCA 5DZGA 1AYN3 4JQRA 2D6KA 2QNKA 3NNGA 3OGGA 5ABJC 4QPGA 5FMOL 5FUPA 2VH9A 3FLRA 3OGRA 1DQ4A 4A44A 4UW5A 1LEDA 1Z7S1 2R0HA 3ZPYA 5M0TA 2GNMA 5FOJB 1YJLA 2HWF2 2CGNA 2IVJA 5KXEA 2E7AA 5L7OB 2XLGA 4XIKA 3RGBA 1DG6A 4AR2A 2B46X 3RPQA 3MEPA 4QX3A 4YVWC 3I4IA 2IXIA 4MSVA 2YYOA 1DYPA 3VL8A 1ULEA 4BMEA 3N7JA 1CIWA 2IZWA 4OFGA 4ES8A 1X33A 2XJRA 3DUIA 2V5YA 5L36A 5C6CA 3PUAA 2QFEA 3WNPA 1MS4A 1N3OA 5L73A 3DXTA 1F4HA 2JJ6A 1OVSA 3ON7A 2JWPA 3NAPC 1BBT3 2ZGSA 2CV6A 1YLLA 4LHLA 1UZVA 4NE9A 5FJKA 4R9CA 1SFNA 1JZ5A 3EJKA 3DYPA 2D5HA 1S0CA 1B35B 1KDMA 1RJ8A 3S5AA 1KITA 2JG9B 4J6GA 3E1F1 1GMMA 3WNOA 1RUF3 2DCJA 1DYKA 1TMF2 1OF4A 3M1HA 4WVMA 5DZEA 3L2HA 4OI4A 4RR3A 2WABA 4LKSA 4QPWA 2W87A 4B1MA 1JYTA 1Z7S3 5FPVA 4ZY9A 5LRSA 4NROA 1G9BA 3K4ZA 4BM8A 1G9CA 5KC6A 2GP3A 3IKWA 4FTEA 4NVPA 3TNPB 1AZDA 4FAGA 4FO9A 2VUDA 3DF0A 4RR3C 1NXD1 3BCWA 3VBOC 3LEMA 2CGPA 3BALA 3WW3A 2P2KA 3BVCA 4R52A 4YFZA 4OMDA 5LATA 3NNJA 3PDQA 4I09A 1H8TA 3PUQA 1O6UA 1W6NB 3QH6A 3APBA 4PBPA 3WDVA 3AJZA 5IVFA 5FZ7A 5F5QA 3HNBM 4B7EA 2VCCA 4CVUA 1EPZA 1AXKA 4NAMA 5DQ0A 1H8TC 2A3XA 5EFUA 3MIFA 4E2SA 4JZRA 2Z42A 4D6RA 5BY5A 4UBGA 1G6NA 5H9QA 3I97A 3WOGA 1WCUA 3OTFA 4I0WB 4Q4Y2 3N9MA 3POJA 4IV1A 2PXJA 1J84A 2HH9A 5HXMA 1TME1 1VBE2 5IW0A 5LRRA 1J1TA 2G9GA 3A22A 3CHXA 1CAXA 4Q4W2 4CA9A 1UN1A 4P9XA 3ZN4A 3U11A 1HB3A 2JXAA 3IN9A 2BBAA 3JCIA 4WM8B 1AR81 1FNYA 1UXXX 3D8CA 3WF2A 4EZHA 3D4KA 5A7PA 2X09A 5JPMB 4W4ZA 4ARXA 2F4PA 3FN9A 1BVVA 3WVJA 1OVPA 3MLKA 4CCJA 5JOYA 2J1VA 3HJRA 3O0VA 2OUHA 1RUJ2 3ATGA 4Y1UA 4XFIA 5C3RA 4WVWA 4YW3A 3IDBB 4N90A 2Z69A 3J9SA 5KHKA 3O1TA 3M4FA 2FDIA 1W9FA 1SBEA 3IAQA 1ZZ8A 3IZOA 3RS6A 5I91A 5J1XA 2BOJA 5FMDA 2OVUA 3BIEA 3KQ4B 2ZGTA 3QOPA 3KHBA 4PIZA 4CDQB 3MO4A 3UETA 1V70A 2CWSA 4XMIA 2VZQA 3A0KA 4NO4A 5FLJA 5JCTA 4IXLA 1ULPA 2P6HA 4AFBA 1D4VB 1AVBA 5APAA 3RWKX 1MS3A 2YFUA 5CIRA 3GHNA 2VZOA 1TME3 2NQYA 3M3EA 2ZGQA 5CVRA 1C1LA 4Q8LA 2C9AA 3CU7A 3WUDA 2ZAHA 3PHMA 3W9AA 5IVBA 3H8XA 1AR83 3AP6A 4E8CA 3SEPA 1TE1B 2D6PA 1DCSA 1O3SA 3ZDVA 5A33B 2WC2A 4QQHA 5A7OA 4YVSB 4BH9A 4INDA 2DBIA 4C0HA 4PI2A 1CAUB 1W3VA 3AMQA 3TEXA 3ECQA 5JAXA 4KG0A 4GMP0 4GWMA 2BWCA 1RJ7A 1PHMA 1EYBA 1QJX2 1GOGA 5FY7A 2EXKA 2OPWA 4IE0A 2GP5A 4EWDA 5CFCB 4N53A 1X7NA 5C3QA 2WNEA 1QMJA 3KLSA 4QMAA 4YG6A 3IBMA 1QEXA 3LDRA 4YW5A 4LIUA 3WY6A 2ZOEB 1MS5A 4N53C 1K42A 3ZFGB 1DYOA 3BTAA 4QHBA 1GR3A 2RM21 3D3AA 3E5XA 4QPIB 5FQ0A 3B94A 2P1BA 2PHTA 3N9NA 4MYEA 1G9DA 4R9DA 5BNPB 4XUPA 4JX0A 4DPNA 4GXLA 5CNAA 5FXZA 5G04L 2IUWA 4URAA 1O5UA 2IFRA 2GU9A 3ZXAC 4FFHA 4JVAA 3SXWA 5EQUA 1K5MA 2RG4A 1RHI2 3LSEA 5FZHA 2VZPA 1W39A 3NO8A 5F6KA 2WSUA 3ALQA 3RWNA 2W1SA 4CRQA 1RUG2 4HVOA 4XVHA 4M4PA 2JG8B 2XR4A 4MADA 5D2AA 3AX4A 1QOTA 4P00B 3MUY1 4M3CA 1VBD2 3EMRA 2VUAA 2XDVA 3RJ2X 4IE5A 2HEVF 4YG0A 4XZPA 4AVBA 5I0RA 1RUOA 2BDRA 4NPRA 4DS0A 1GZCA 3NW4A 2A6WA 3VBHC 4NRPA 3L2YA 4AOCA 4ARYA 4UFMA 2WWSA 3BODA 1MS0A 2QQMA 2DYCA 3QACA 4LBNA 2J1SA 2G1MA 4HXCA 2CNAA 5F3GA 4C91A 4LKDA 1XNTA 4W65A 4BYYA 1NX9A 5A3NA 4Z2WA 1XYOA 5IAXA 1S1AA 3NNMA 1F31A 3MICA 5AFBA 1DQ6A 1W06A 3CEWA 3CIHA 4HSLA 4MUVA 1CQ9A 2RM23 3U4SA 2CY6A 4LIVA 3LDKA 5LY1A 5C5TA 2B7YA 1SLBA 3M3CA 4FAHA 1OFNA 2BZDA 2R49A 5GLTA 1OQ1A 3OGJA 2WA4A 1RUE2 1OH3A 3ZYHA 3U1XA 1WBFA 4TN7A 2WQ8A 1YFYA 1VPHA 2G19A 2H0VA 3FUOA 3JBG2 4IW3A 5FZOA 5L9BA 1FATA 2KD7A 3RMYA 4E4ZA 1UCXA 1QJU2 4ZHNA 3J7HA 4CUAA 1FYUA 1ZYBA 5FO9B 3SCFA 1XRUA 2BEOA 1S0GA 3HT2A 3GZUC 1AJKA 3V0BB 3IDAA 2QQPA 4BQ4A 5LEJA 1YFXA 1KDKA 1NE6A 1TQ5A 3AMPA 3LSDA 4JGZA 1XNKA 3VBSA 1BK0A 2JKBA 3KV5A 4FPYA 5EXOA 2VTFA 5KHHA 1UKRA 1VB2A 1LU1A 2VZ3A 1RC6A 4M00A 3JBG1 4A41A 4JGZC 2JDYA 1AYM2 1UYYA 4CCOA 2Y8KA 3VUOA 4B3NA 1AXZA 2JB8A 3UGFA 3R4DB 1ENSA 3MLLA 1WBLA 2QTWB 2GH8A 1EUUA 2C6SA 5C33A 5L9VA 1Q5OA 2R042 1PO22 1KS4A 4Q0SA 5A3MA 3Q8CA 1APNA 2GC2A 3DKQA 1VIWB 1V6LA 2HWC3 4ISQA 4R8HA 3USSA 3N36A 3KD4A 1N1VA 2PA7A 2VMHA 3LEIA 4UFLA 4AHYA 1W6QA 4BOWA 2WNUA 2XJTA 3T1LA 3CJIC 1HKDA 3WG1A 4AI8A 4JCKA 5FPXA 4YW2A 2QZ2A 3AYDA 3VBUB 2DDUA 5C70A 3RI9A 1WMFA 2FCTA 4NPMA 4BB3A 2YGLA 4YGCA 4XDOA 3F95A 1R1A2 2YBKA 1HX6A 4QGLA 2PLV1 1E5IA 5CB7A 3UJOA 2VL4A 4NUBA 4D7SA 2QBXA 4YFWA 1WA6X 4ZU5A 2ZHNA 2R6QA 4GB31 2GMMA 2VECA 3N9LA 2WNVB 5CISA 3GHMA 4IL7A 3BN6A 2YPJA 4NHYA 1JI6A 3JBG3 3WNMA 4N9IA 1NCQC 2OA2A 3H0OA 1C57A 1KQRA 2R16A 2QQJA 3MV01 3ZYIB 1A6CA 5FZEA 1OLMA 4EROA 1NCRB 5K0UB 1Y43B 2XQXA 1V6IA 3NJZA 1PGSA 3OB8A 5J37A 3HT1A 3OUIA 3ASIA 2OW4A 1VBA2 4WM7C 2C0ZA 4FXGB 5GJ6A 4H3WA 2JIGA 2R1BA 4AXOA 3PMEA 2KA3A 3TB0A 5C4WB 1ZRCA 3BPZA 1NLRA 4QU1A 1PGL2 4UWDA 1LOAA 1ENRA 1IQDC 1YJKA 5JI7A 1YQ6A 2W1UA 5SV5A 1W03A 3ACFA 2ZGLA 1GP4A 1GLHA 1C8M2 1RINA 4AVTA 2F17A 3VHOA 3MFAA 2OQ7A 2PLV3 4ATEA 2XG3A 4ZPIA 1JYNA 1UX7A 4PDWA 3H3UA 5DAXA 2F6BA 1RUH2 4EYUA 3WLUA 2XPJA 3ES4A 4GB33 4XUOA 2LROA 2PHDA 3B01A 5T5PA 2VQ0A 4Q4X2 3B3QE 1GNYA 3B9CA 3FMGA 2XWJB 1NY72 1DGLA 4FOVA 4MXWA 1VE0A 4GH4C 3ACLA 1M06G 5KXCA 2XKPA 4AL9A 1DQ1A 4JHTA 1WLWA 2VMFA 3ZLIA 1K12A 4A2UA 2UU8A 2R061 1ALYA 2X29A 1HRV2 2HYKA 1ULDA 5BPXA 3HAGA 1RVF2 1Q8SA 2W9XA 3USUA 1XNCA 2W5FA 2WJSA 3L9JT 2CGOA 1CAWA 5JLVA 4FP2A 4QDRA 4BK4A 2NYYA 5I8SA 3C7EA 1IKQA 3POSA 4BQ1A 1K5MB 1VJ2A 4L92A 3UL2A 1BMV2 3AFGA 3D6EA 1PM7A 1ZZ9A 4AE2A 4QB2A 5CG9A 2I07B 4O65A 4QX8A 3KQRA 1IS5A 1NQJA 4HOOA 2VPVA 1CJPA 1UPSA 3M2MA 3FFZA 2XOMA 4P9YA 4J1WA 4ES9A 4FT8A 4CCKA 2XJPA 3HEIA 5FZGA 4M3CB 3ZFEA 3WV6A 1PZ8A 2X5IC 4RGAA 5D21A 1LOGA 4N8MA 5A7SA 2FZ1A 3FZ3A 3MF9A 1S2BA 2Y60A 1W6OA 5ACA2 2A6YA 2GMEA 1J3QA 2OX0A 3T2PA 5BNNA 1PK6C 5F39A 1W8WA 2G9ZA 2H0BA 1K45A 2RDSA 4CDXA 1H2MA 3PVNA 5AC91 1CIYA 3TEWA 1O3TA 2GMPA 3VGIA 4C8DA 4X6RB 1N3QA 4YW7A 2QCSB 1Z78A 2R063 3IMNA 2BU9A 3I2IA 4ZS3A 3HNYM 4V1PA 3JQXA 1QQP1 1HQLA 4CUBA 2EIGA 3N35A 2EIDA 1SACA 4HSJA 2DV9A 3ZXGA 1BEV1 3J26N 4XAAA 2WZPP 2Q1MA 2LS6A 4QAWA 4IQPA 2IXLA 2Y0IA 5IVCA 2J1RA 1VR3A 2ZTNA 3I2HA 1UXZA 4QM9A 3ZXEA 2XHNA 1RYYA 2KR2A 1A34A 3PVOA 3GJAA 2BJSA 4Q4V1 4Y5Z0 5CFDA 3X29B 2YXSA 5IFTA 1FMD1 3R05A 4FPLA 2YROA 5DUXA 5AFEA 1LR5A 5L7OC 3OBRA 1OPOA 2A73B 3OEAA 3K48A 3E6CC 4MGYE 4QXKA 3RYRA 4UFJA 4AQSA 1B09A 1REDA 3VZJA 1QNYA 1IKPA 3VBSB 5I93A 4CDUB 2GNTA 3J8F1 4LBQA 1XOYA 4JGYB 1W9WA 1COV2 3ZN6A 5AC93 4XJAA 2RS52 4Y20A 5EJZB 4CEWB 1O3QA 2MEV1 1F5JA 4NIDA 4R9AA 4ASMB 3J4UH 4GKXA 1KFUL 3LQCA 4ZU7A 5T3NA 5FP3A 2ZBJA 1QQP3 2Q8CA 4AQ6A 1B35C 1CVNA 2W0XA 1H0BA 1SEFA 4AWDA 1BEV3 2AENA 1O8PA 2JG9C 2AYHA 5KBFA 4OLLA 2FD8A 4RHV2 3SLIA 3T09A 2A70A 1QU0A 1XYPA 3IDCB 3MIEA 3ZKYA 4FPFA 1R64A 1JYWA 4CP9A 2IC1A 4N7IA 4E4DX 2A6VA 4G3YC 4D0QA 1W28A 4YM3A 4XF0A 4PLMA 5GLZA 3MIDA 2VQTA 2ZZQA 4Q4V3 2EALA 4JRLA 5CBLA 1FMD3 2WT1A 4IETA 4DUXA 4BQ5A 3OPWA 4YLZA 3C3VA 1X8MA 3LKJA 4J1XA 3FLPA 3PU8A 4PF1A 2VAUA 4I2OA 3SKVA 2HWD1 3SC7X 1ND3A 2P3JA 3J8F3 2WS91 2D44A 2R1DA 5FZIA 4YZ1A 1R081 4RHV1 4UAPA 2XB6C 3VDDA 4EN6B 1NKGA 5KC5A 3ABZA 1XU1A 1ZBE1 3OSDA 2LUWA 1PZ7A 1JYIA 1R092 3W59A 2I2SA 4DFSA 1HV1A 4LMFA 3VBRB 3M70A 1OBNA 2MEV3 5A32A 1OOPB 4Q29A 3QD6A 3ST7A 5JR2A 3VDDC 2HKXA 4IV3A 3NVCA 5FZBA 3LGRA 2ZX0A 1MQTB 1URXA 1XYNA 2VNGA 5B4XA 5IUQA 1JZ6A 1WD4A 3N7MA 5IJRA 4BIOA 1ST8A 1IG3A 5FZFA 1OC1A 3LDBA 5A7WA 2WT0A 2GC1A 4AFCA 3O1UA 1MEC1 1ZRFA 4MV2A 2QQWA 4LKFA 2C5DA 4PIXA 3T30A 1AR91 3O0XA 2P17A 1RITA 5FO8B 2NP0A 2VMEA 1PMIA 1R091 1QOOA 2RDQA 3CO2A 5EYXA 4WM8C 3BPSA 5E88A 3ZR6A 1F4AA 2D6LX 3D5OA 4KI5M 4FQ4A 4PF5A 3ZIXA 5BYNA 1NXMA 3TN91 1Q43A 1S55A 4AEDA 3NV2A 4LK7A 2HWD3 3OJBA 4LBMA 5HCHA 2R071 2AZ5A 2VVFA 2ARXA 2WS93 2YC2A 1R083 1SHWB 2WO1A 4NN0A 2QQUA 1YUDA 2BFUS 2XLFA 3NV1A 1ZBE3 4LBKA 2VULA 4AW7A 3U0ZA 2PFWA 2VZTA 2E7QA 1ULFA 2JECA 5EIYB 2V72A 2E32A 5BNOA 1REFA 4XBLA 3OD4A 3I49A 1GNHA 1I1EA 2ZA9A 5A1AA 4CU8A 3D0JA 2VMCA 4QXHA 2BVBA 5JOWA 4KU7A 2HJIA 3PTYA 2ZHLA 1ASJ1 1OPMA 1OT5A 3O7OA 5D8AB 3D0SA 5G05L 2VO5A 3UGGA 5BNOC 1I5PA 2X05A 1X36A 1GQHA 1BQPA 1M4WA 3CQOA 1A78A 2WAOA 3R4SA 1MEC3 4XFAA 4YRDA 3VL9A 1IHMA 4TLFA 3WW4A 1AR93 2VJXA 1JHJA 5FYTA 3FL7A 3HVDA 3PTRB 2O14A 2PN5A 4NJ4A 1AR71 1KD7A 1R093 1GZWA 4CZSA 3FBMA 4AI1A 3W58A 1JTZX 2HLEA 3AP5A 4Q5OA 5ABJA 2ATFA 1S0FA 3DYOA 3M7AA 3OY8B 3PUHA 3RZLA 1FPN2 1RL3A 3PL0A 4P02B 3TN93 4HVQA 1PGW2 1W6MA 1J83A 4YVSC 3O1VA 3ILRA 1U12A 1N1TA 2V5DA 1N47A 2ZEYA 2XKOA 3ENRA 1LJ7A 2ARCA 4IEYA 5DXDA 3BKZA 1UNBA 1UYPA 2Q8DA 1PMHX 4CE8A 3SHRA 2R073 2W1QA 4I3PA 4N43B 5I0TA 3AK0A 3MZHA 2JDUA 2Y38A 1VBB2 3BOWA 1PVC1 1S2KA 2XUEA 3HPNA 5FY8A 4YVWA 4IE7A 2IXHA 4BU2A 5BNNB 1XU2A 2YGMA 4WVVA 1Q56A 1G8WA 3C7OA 4YM2A 4XXAA 3AP4A 3DPRA 5F5CA 3KF5A 1GFF2 1SBFA 3NV3A 3LF7A 5I0UA 3AKRA 1J3PA 1ASJ3 3ZFGC 3I3BA 2VE1A 3CZUA 3NAPA 3O0WA 4LO4B 4QPIC 2ZMKA 3DPRC 3T0BA 2R7EB 5BNPC 3T3YA 2ENRA 1U5YA 1JZ2A 3VB9A 1N1YA 1NZIA 5A3TA 4D69A 3VZMA 5KR7A 1LHUA 2HWF1 1AR73 3ZSLA 3LPGA 1RXFA 3ZMNA 3ZFFB 4DUWA 3PUIA 2DVAA 2XGXA 3AXDA 3INAA 5A6ZA 3HQXA 5DAWA 4BQYA 2HBTA 3K2OA 3UESA 5CFDB 3DKWA 3V0AA 4IEUA 1UY0A 5A3LA 1RMU2 4Q0VA 1UMHA 5T54A 1VMJA 2VZUA 5D1IA 1Q8PA 1GUIA 2ZZJA 3SH4A 3VBOA 1AXYA 3OCPA 2OXBA 1Q3EA 3IM0A 4OI0A 4RN5A 1VAMA 3GBFA 1PVC3 4QX5A 2VNVA 4AVVA 3POEA 3H1YA 3LIHA 4KBBA 1GSLA 4FTSA 4DEVA 3N3HA 1ZZBA 5FXVA 2BWAA 1WW7A 2PHXA 2ZGRA 3NNFA 3R4UA 2JDZA 2ZMLA 4CDWB 4MLOA 3FHQA 4ZXEA 3U37A 4MGZE 4E4HA 5JZGB 1VBC2 4IEVA 1RMU1 1BXHA 3FE5A 1W04A 3HR9A 4B29A 1TMF1 1O3RA 1ZZCA 1AUYA 4H7LA 3FJSA 4AEMA 4XJWA 3CF6E 4DY5A 2BPA2 5A6YA 3LA2A 4XURA 3AZZA 1YCIA 2Y33A 2HEYF 3RDIA 2HWF3 4QQOA 3WF1A 1F15A 4QB6A 1W9SA 2WN3A 4CXXA 2C9KA 3WQ0A 3NJVA 2JDNA 4XUNA 3OYWB 2D7FA 4E27A 1YFWA 1RGSA 4UBHA 1DLLA 3AZVA 3S7IA 1I5ZA 3O1OA 3EHKA 4SLIA 4LE4A 3HBZA 1V6OA 1FNZA 1UL9A 4GJYA 5FZ9A 3SNMA 3A23A 4COVA 1UZWA 3AKQA 5EWSA 4ET7A 4DQAA 4NWVA 3A4UA 5FO7B 3AB0A 3POGA 3U78A 1HRI2 3VZNA 1ACCA 4Z1VA 3B5LB 2RR12 2AEYA 2LRPA 4P9JA 5FFOC 5FLIA 4QDQA 2J1TA 3LOBA 1VRH2 3AYAA 3ZM8A 1U0AA 4Y1XA 4Z92B 4BMBA 2I45A 2BVVA 2RDNA 4M0NA 3W20A 1VMFA 2FDJA 4Q1PA 4Q4Y1 2DUPA 1AX0A 3WW2A 4FP3A 1H9WA 5A1LA 2YHJA 1DFQA 4Y1VA 3BUCA 3ZYPA 1VBE1 1UZYA 4BXSV 2X8KA 1TMF3 3E5UA 4RGKA 5T5LA 3WQ7A 4ZKTB 3BU0A 1JHNA 1KXGA 1US2A 2FMDA 4Q4W1 4XILA 3AZXA 1UWWA 2FZ2A 3EO6A 2CTVA 4Q2FA 3LD8A 1UAIA 1UQXA 1DQ5A 2XJQA 1U5XA 1RUD2 2Y6KA 2EVXA 2ZHMA 2Q0AA 4YNIA 4BLJA 1E5RA 2QQOA 4D8MA 2XMLA 2J1UA 3TOJA 2A5ZA 3H8UA 4XOGA 2WO2A 4MO3M 4J25A 4JHZA 2ES3A 3AXEA 1RUJ1 3FHAA 1PNFA 3VBUC 3BTYA 4BCUA 3AM2A 1O4ZA 5H9RA 4BHPA 1ZBA2 2UWBA 3GZAA 5ERLA 1W90A 2PYTA 3SKJE 4QKNA 4HKWA 3KZ4C 3WG3A 1WW6A 3WHTA 5A80A 1GU3A 4XIOA 5FV3A 2WNVC 1MZ6A 2JD9A 5E6HA 5FXXA 1CR7A 4F83A 2VBBA 1IGOA 5FZLA 3VD3A 2AEZA 3JB4C 4LHKA 3ZN5A 2GNBA 1UYZA 1ZX5A 2NM1A 3E5QA 3WEZA 4BQ2A 2ID4A 3MI8A 4Q4Y3 3Q8FA 4MHUA 3VKMA 2OZ6A 1N1SA 1W2UA 2EA7A 2YU1A 4RYDA 2ZEXA 4XDPA 4Y22B 5DAVA 4XF3A 4A7KA 1NCRC 2AREA 2DF7A 1DGRA 1F5FA 1VBE3 2F4LA 2WWJA 5K0UC 2DVGA 1YO8A 1YFUA 4K7JA 5FBZA 2RJLA 5CADA 3AYCA 3H8OA 1OD3A 2GC3A 4L11A 4OUMA 4Q4W3 1DIWA 3KCCA 2CAUA 5IK5A 1H2KA 5CZKA 4ATFA 2EIBA 4XFHA 4KMQA 4WVZA 4XJUA 4CEYB 2ZCWA 2XJUA 3U75A 2NLRA 3ZXJA 1UMIA 1ND2A 1XQNA 2VM9A 4PLOA 3M8LA 2RMU2 1LECA 2VCAA 4RQPA 5FYUA 5T5OA 1LB2A 5IHRA 4Y5SA 4UFKA 4AEKA 4E8DA 5LA0A 4MG2A 1RUJ3 4COYA 1ND2C 4CCCA 5C3OA 1H2LA 2VXRA 4RQPC 1QJX1 4X6QB 4GA9A 3UYJA 1MS8A 1YQCA 2A1XA 1YHFA 3OBTA 2D43A 2YV8A 4FPGA 1OURA 4QPGB 4YZ5A 4L99A 2AH2A 3POWA 1LGBA 1QNWA 1T2XA 2ZJCA 4YARA 1WLCA 2AR6A 3D82A 3T08A 3VHRA 3C7HA 3VHNA 4A45A 1KEXA 3LZZA 1W8UA 3K4AA 2D5FA 5BV6A 2PELA 2GC0A 1GNZA 1OA2A 2OUJA 2W3JA 1OMIA 2Z2SB 3HQUA 5GZFA 3VBHA 3WCSA 4NAOA 1S0DA 4BXFA 2BGPA 4LA2A 4XYXA 3KVAA 1W2NA 1JYVA 5H9PA 5I0DA 3WG2A 3WDYA 1Y9QA 3GJBA 4Z82A 5DABA 1LHWA 1W8HA 1E5HA 5GLWA 1AL22 1VALA 2ARBA 1UU4A 4K6BA 5T55A 4A6OA 5C8CA 5JSOA 1NA1A 4XW3A 2Q1ZB 1IPJA 4Y1ZA 2VW0A 3H3ZA 4W8JA 4AAPA 4BQWA 3RZMA 4IUGA 2QKDA 1QH7A 1X9PA 3EBRA 1RHI1 4ISRA 4RFT0 5FLHA 5C8CC 1GWMA 2P34A 1BVP1 2VMDA 4L0PA 1JOBA 1GZ9A 1RUG1 1NA1C 1UY1A 3ZKUA 4PI0A 5FY4A 2CDOA 3CLPA 4KNCA 1AX1A 5T5JA 2WRAA 4I0BA 5FY9A 1VBD1 1H1IA 2DVBA 2PHUA 2VBPA 5HI0A 2VU9A 2E6VA 4QX2A 1QJX3 3K3OA 3S30A 1SQ4A 3ZXDA 1V00A 3BU7A 2XLAA 3ELNA 2VMGA 3WDXA 4WVMB 4QHZA 5K4LA 3EYPA 3OEBA 1D0HA 4RR3B 4EN9B 4CYDA 3VDBA 1V9U2 2WSVA 4LQRA 2JENA 2WZEA 1RUC2 2YUEA 4TXWA 1NQDA 2DCZA 1CZSA 2VNOA 1LNSA 3I59A 3RVHA 1ODMA 4RA0A 2YU2A 1JU4A 4DRVA 3MIHA 4B4RA 3DYMA 1PM4A 1W0OA 1PNGA 2EF6A 1H8TB 2PHWA 3K4DA 4H55A 2MNGA 2YBSA 4K3UA 4LLFA 1H6YA 4QX0A 2WQZC 1RUE1 1YNAA 1SDDB 2WL1A 3MBWA 4FXKB 4E2QA 1RHI3 4GAZA 4EQVA 1VP6A 3VKFC 2HWB2 1SPPA 3IIAA 3A7QA 1UY2A 2DTWA 3POBA 1RUG3 3BTZA 1VAVA 2XJVA 3H7YA 3HWJA 5B2GB 1WCQA 3I2KA 1QJU1 3JD72 3GCWA 1NOVA 4QDSA 1VBD3 5DPNA 4Z07A 2D40A 1X9TA 1PO12 4FFIA 1S0EA 3R6SA 1H4HA 4XABA 3RJRA 4CXWA 5J09A 4META 3CJIA 3NJYA 3F2ZA 1EV12 1IZ3A 4IV1B 1KJLA 3VKOA 2Y26A 1RIRA 3TYJA 4M0HA 1D0GA 4AGVA 1CAVA 2DUQA 1CAXB 1CPNA 1WUVA 4KGGA 1JMUB 4JRAA 4P9LA 4F7ZA 1YQ5A 4XHBA 5J7MA 3AKPA 1XE7A 4NHLA 2HWB1 4HANA 3VZOA 4CDUC 1ZM1A 1AYM1 3ACIA 4FOWA 4Q0UA 5C9AA 4JGYC 4Y26A 2JB4A 4JKLA 2B9VA 2B39A 1KS5A 2PHFA 3CBNA 2ZEWA 1HJFA 4COWA 4FTBA 3MLJA 3WNXA 3ILFA 4YZ4A 5LBCA 4XJ9A 2BERA 5C9AC 1NCQA 2VZVA 2R041 1PO21 2QQLA 4HN0A 3UJQA 5IVJA 2GALA 1RUE3 3A21A 3OGVA 1JOJA 2IVIB 4I3GA 3HNMA 2B5HA 3GDBA 5EPAA 4D6QA 3OBZA 1QWRA 1JH5A 1W8TA 1T6GC 1CZTA 1GYKA 4K8RB 2ADEA 4TSVA 4CU9A 1LTEA 1LODA 4WM7A 5IT6A 1LOCA 3MF6A 1QXRA 3IPVA 4LXLA 4QGNA 2DWRA 5FWJA 3CZJA 1QJU3 2YZ4A 3LEKA 4WBBA 1H6XA 5A3PA 2BV4A 1YYNA 3P3PA 4QQLA 1R1A1 5FK8A 2Q8EA 4ZXKA 1LGCA 5J36A 3SITA 4IE4A 4OQ8A 1ZRDA 2VUCA 1BKZA 2Y6FA 2L9LA 1SLIA 3VBFA 3I3QA 1TNRA 1JUIA 2YC0A 3FHIB 4FPKA 3SH5A 1IPSA 3THDA 2C1FA 2D6NA 1PX4A 4HMZA 3DXUA 3H9AA 2FBEA 2JDMA 1AYM3 4CP0A 4HVRA 3VBFC 2W68A 2TNFA 1ZZ7A 4E2GA 3WSOA 2RS12 3HN1A 1EUTA 2W46A 3FFQA 3I7DA 3S57A 3K3NA 3VBRC 1YI7A 2XUMA 4HKLA 3OUHA 2LALA 4JDOA 1OOPC 1DZTA 1VBA1 2HWE2 1LRHA 3KGLA 4IGQA 4MGQA 4K40A 2R043 2XBO2 1PO23 1W99A 1KRIA 1C8NA 2VD7A 3JU9A 2CHHA 3NKGA 4GH4A 2VBDA 1MQTC 4LA3A 4ZONA 2W91A 4EV0A 3RZHA 4QM8A 1ZREA 1UO9A 2NZ9A 4OZXA 3FC0A 4UYBA 5E1RA 4N53B 2VQUA 4ZS2A 5HCAA 2RS32 3RYPA 4GQ7A 2PQQA 1MS9A 3GF6A 5LA1A 3WF0A 1FT9A 1LAJA 1C1FA 4QWNA 4BK5A 1C8M1 2X10A 4GZ9A 1R1A3 1C5HA 5JSPA 5EHDA 5FQ0B 3CKHA 3B7MA 2E63A 4ASKA 4CCMA 4UOJA 1RUH1 3NNLA 2XBO1 2CWMA 4AF9A 4SBVA 3B69A 2B45X 3Q8AA 5FTTC 3FX3A 4UF0A 4UW6A 1W8NA 4IEPA 1VB4A 1Z0HA 4Q4X1 5JUVA 2SLIA 2WN2A 3PU3A 4DZGA 3PIJA 1NY71 3QH7A 4O9GA 2VTXA 2X5IA 4X8NA 5LBEA 3ZYFA 1CX4A 4RS5A 5CG8A 2WFF2 2VNRA 4K1YA 5FPZA 5L19A 2D6MA 3OGSA 4P5HA 4RGGA 1W9TA 1PIV2 4BPZA 1HN1A 3J7MA 4S2HA 1VBA3 4HZFA 5J98B 2JE8A 3ZXFA 3KHCA 2DFBA 1PK6A 1HRV1 2VC9A 2WZ8A 2ORXA 4RS5C 4AI0A 2GDFA 4A4AA 1RVF1 4MXVA 4LR4A 5GLVA 4KH9A 2WR9A 1L3JA 3VD7A 1W2AX 2CAVA 5C5UA 5D8AC 3AMMA 1PX3A 4COUA 4KBZA 3S6PA 4AHZA 2QQVA 4FPOB 4TTGA 2D97A 1WW5A 3M3QA 3E97A 4ONUA 4A3ZA 3AKSA 1BMV1 1O7FA 3FWEA 1VAKA 3W21A 4CCLA 3RZKA 4IEZA 1D4M2 4RSUA 5JXGA 1A8MA 5ISLA 2JEMA 1ENQA 1UY3A 4UFIA 1KJRA 1SFYA 4XF1A 1C8M3 4CSWA 1UIJA 3W5MA 4XUQA 2P6CA 1O8SA 3MW3A 5J96B 1GWLA 1W2OA 2D3RA 2DUOA 3VDAA 1BCXA 1HQWA 2Q30A 3ROUA 4DB5A 1RUH3 2E7TA 2XBO3 4AYUA 5IYYA 3AL5A 1JN2P 5FZ0A 4AVCA 4LUKA 1LOFA 4OCTA 4Q4X3 5ACA1 1I9RA 5B4NA 5JIUA 2DVFA 1AR62 5JXIA 2WYFA 4CCEA 5L7OA 5FZOB 1ULCA 2XHKA 4N43C 5DZFA 3WP3A 3EXUA 4QKFA 1UOJA 3SEEA 4HT1T 3ZMOA 4P14A 1IS3A 1LOFC 3KM5A 3GZEA 4EN8B 3HMYA 4YG3A 1QXPA 3JQWA 1QJY2 4RL7A 4KL1A 4TWTA 4DNYA 1TG7A 1FXZA 4BQXA 4KWJA 1HRV3 1YRZA 1OKQA 4A3XA 1RVF3 4LBJA 4E4SA 1IS6A 4CPBA 3C8XA 4JGZB 1H30A 1L7LA 4AHXA 1HLCA 3RZJA 5FZAA 1EY2A 2WYSA 3AMHA 3MIBA 3E6BA 5DUVA 3HQRA 1K5JA 5SV8A 1B35A 1EAH2 4S2FA 3ZO0B 4AGRA 3WDTA 1TEIA 2JG9A 4K20A 3N4MA 2VOKA 1CPMA 1F2NA 1MS1A 2KXLA 5IAVA 1QHDA 4NIGA 3NKTA 2W08A 5F3IA 2XVGA 2E33A 3BGAA 1QJY1 2Z5WA 1OQDA 3CDZB 4I0AA 4K1ZA 2K2SA 2ZACA 4NIAA 5FYSA 5F3EA 1GQGA 4IEOA 2K9ZA 2K46A 2ZGKA 2RV9A 4P9IA 5ACA3 2HBUA 3MPPG 1MR5A 3OF1A 3PUSA 2C4XA 4B4QA 1W6QB 4Y5TA 5CKMA 2WNUB 5FMOS 2UWAA 2Q4SA 1COV1 1V0AA 4EN7B 4K21A 4LO5B 4W6WA 3U07A 4Y24A 4LBQD 2A3YA 1FOD2 1SLAA 2RS51 1OLRA 5LASA 1P8JA 4LO8A 3PMSA 1XNAA 1W6NA 4OMCA 2PQSA 2YY1A 4XMAA 2X53S 3WD5A 1HIXA 1L7RA 2JKXA 5F32A 1RUI2 3ZYGA 2W39A 1MACA 3AVRA 5EJ1B 4WZFA 3WP4A 3WHUA 2FDGA 1BHGA 1NCQB 5JZGC 1CX1A 1Y9GA 4AFDA 2BYVE 4BJ0A 5FYHA 2BNMA 5EYYA 2OPKA 1US3A 5F2SA 3ZIWA 2N7GA 5BUVA 2P3KA 2VGDA 1KGYA 1A8DA 3KT4A 4M3CF 5F5IA 4MVTA 3U4XA 3CMGA 1HW5A 4PT6A 4K8FA 1FOD1 1BLZA 4AQTA 1QJFA 2A71A 4YGEA 1YIPA 2OQ6A 3LEGA 1DLCA 3OPTA 3LIGA 5FWEA 3WCRA 4MGKE 3I2JA 2BOIA 3B00A 3CL1A 2B42B 4DXZA 2RHPA 2W1WA 3AMNA 5HBAA 4YW4A 3TEZA 5JDBA 4XBNA 4ASLA 1Q8OA 4RFRB 4WM8A 1REEA 2A6ZA 2UURA 1UZZA 2FMYA 4UT5A 5JMOA 2FDHA 1TVGA 3HIFA 5ANQA 1COV3 3C7FA 5GZDA 5F7UA 1UZ0A 2RS53 5DG1A 3M3OA 2WZR2 1NLSA 4PJYA 1RTVA 5LCWL 4ZZ8A 1CN1A 1UOFA 2IFWA 4QHOA 4BA6A 5I8YA 1GQPA 1AYN2 2BW8A 4PDWB 3TAYA 4PLNA 3P1IA 4XAEA 5FJHA 3HBKA 4FPEA 2B9UA 3WP5A 1ZRRA 4RHV3 1BK1A 2W2IA 2H6BA 1OH4A 1OUSA 4YZ2A 2AUYA 1ONAA 2MHFA 4FI9A 5FYCA 2YBPA 4GKYA 5FZ3A 1OA4A 4P08A 3POFA 5CEHA 4MXWB 4CCDA 2DU1A 1FOD3 3EQEA 1GWKA 2W92A 2WZR1 4K9SA 4BQ3A 5DN2A 5KXBA 4U2AA 1QXJA 1GP6A 2QQIA 4CDQC 5FZKA 1XC6A 4LLOA 2VZRA 4HK8A 3C7GA 3DV8A 4R4ZA 3KGZA 3N9QA 1MPXA 3THPA 5A6XA 3AJYA 2WINB 1L7QA 3DGTA 4I01A 4QKDA 5FYYA 1YQ8A 4NRMA 5FP8A 2OIIA 3ZXLA 4UFHA 4JTNA 4XJZA 3USUB 1WMDA 1DQ2A 1UY4A 2DCKA 5A70A 3BTXA 1CAWB 1JU3A 4Y3OA 5A33A 4FVVA 1HB2A 1BBT2 5GALA 1UF2C 3C2UA 4YVSA 2GSYA 2WO3A 5HCBA 2JDPA 2PMWB 1X50A 3GYDA 4HPKA 1AF9A 4XQWA 1XXNA 4MH0E 3WW1A 3ITQA 3DL3A 4DY3A 2LTNA 1QKQA 1RUF2 2W95A 3ZFEB 2ADDA 4B8EA 4Q26A 3TBDA 5CFCA 1OKOA 5J48A 3H8RA 1Z7S2 1DBNA 1WZXA 4N9HA 4CU6A 3GZTB 1W6OB 1D2SA 3ZXKA 4XQDA 4L97A 5EV7A 4DXRA 3AFKA 2BGOA 4Q27A 5GKAC 5CFCC 2XJSA 4LHSA 3IB3A 3LWCA 3PVBB 3WR0A 3ZFGA 4LHNA 1QIQA 4C0BA 1OSGA 4CEYC 2ZX3A 3BYWA 4QPIA 3RSJA 4CDXB 5E16A 2XVKA 1XE0A 5BNPA 4A7ZA 1FPN1 3ETPA 3OBAA 5LK5A 1PGW1 1RUF1 1UD1A 3POIA 4LT5A 3DEMA 4BZ4A 5FUIA 5A3OA 2VZSA 2ZGMA 2B4KA 1ODNA 3NV4A 4HLTA 4LJHA 2EXHA 1E57A 1G86A 1OQEA 1VBB1 2DTYA 2CU5A 2JG8A 2YG0A 3E6DA 5FP4A 1ZVFA 2VCMA 3HN3A 3LOIA 4FFFA 4QPGC 4FPJA 4QGMA 1HDKA 1W9YA 4OUSA 4M3CE 5FDBA 1JZ7A 4FFGA 3O1PA 2JG8C 4Q0QA 5JWPA 3IWZA 1R1ZA 1TNFA 1OF3A 3I54A 4L8QA 1G9FA 5DDJ2 1DQ0A 1HJGA 2OZJA 4GALA 4KWUA 1KFXL 1W8OA 2OS2A 3BI3A 5JR7B 4B4PA 2QQNA 4OHWA 3UT0A 1O4TA 5FYIA 3PJYA 4C1WA 3WUCA 4LBQB 2ZKNA 4JDNA 3ZN6B 4NMIA 5ANNA 2JDKA 3I3EA 2BQPA 4Y20B 5FZDA 2ZGPA 4IGOA 3KSCA 2V4VA 3KS7A 1FPN3 3RYKA 1XSQA 3CNAA 1FX5A 3H42B 3I2GA 4D7TA 5FK7A 3VLBB 3VD9A 2GH2A 3RMXA 5DDJ1 2WUHA 1NAEA 2ZHKA 1GKBA 2WBKA 3KT1A 4YSFA 1XE8A 2GN3A 1C5IA 1DZRA 1VBB3 5FP7A 2EXIA 4HN1A 2GN7A 2J1AA 4KGQA 1S0IA 4CP9B 3TWIA 2KM2A 2P5BA 2E9QA 3ZSJA 2MPFA 5LA9A 3GBGA 4E9KA 1LENA 4BISA 1I3HA 3V0BA 4KWLA 3R0RA 1XNDA 2DBNA 2QQKA 5A1FA 5E8AA 5HXVA 1TME2 1HB4A 4OYUA 2LM3A 2BUKA 5BNQA 4LO7A 1VBC1 3MW4A 5HV4A 3AZYA 3RQ0A 2BFUL 2VXJA 4PBOA 3AYEA 4NOTA 5LK7B 4QX1A 5JXJA 2IWGB 1H1MA 1ND3B 3KV4A 1D7PM 1AR82 1X8EA 1CESA 2GAUA 3H7JA 1N3PA 3K51A 3T2TA 3V64A 3VDDB 5FPAA 3KB5A 5FYBA 4CXYA 3ACGA 4YPJA 1OLQA 3IMMA 4L2NA 5FP9A 4HL0A 2E53A 5IK8A 3G6JB 4XFBA 1LHNA 4XHXA 1HQNA 1Q8QA 1MZ5A 4XQ4A 5A32B 3UKVA 4S2DA 5GZEA 4IV3B 5IATA 5F9TA 5HCFA 2ZGUA 3P5BA 1RMU3 5K7PA 3FUQA 2UWCA 2PTMA 4LUMA 4W6XA 4XCBA 4XFGA 3ZSEA 3DECA 4A42A 5DDJ3 2YB7A 4C1XA 4D6SA 3IIIA 2DURA 3ZPOA 3I8TA 1V6KA 2XXZA 3WINE 3VDCA 5GZGA 4IV1C 4XZUG 5A7WB 1C4RA 1POQA 1HRI1 3V65A 4AI2A 5C3PA 1E5SA 2RR11 3VBUA 4IGPA 3NL1A 3NJXA 3LAGA 4BE3A 3RZGA 1PGL1 4IE6A 1TZOA 1VRH1 4QKBA 1WLTA 4GJZA 4HETA 5FZ1A 4DEQA 5DMYA 3RZZA 1S4CA 2Y6JA 3KV6A 3T4HB 2QJVA 4NIHA 3AC0A 2Q8OA 4Z8BA 1W8FA 4XFCA 4DO0A 5F5AA 1VBC3 1CONA 2E26A 1SLLA 2WNVA 2CL2A 5K8SA 1UPIA 2JE7A 2XQRA 5CAZA 3KWVA 4AEDB 3MHZA 4R9BA 1NLQA 1LULA 2ZPXA 3SMHA 1SMVA 1DF0A 2VZ1A 4GWNA 5I0SA 4I02A 3UGHA 4W6YA 1YC61 3VZLA 2VMIA 1NCRA 5K0UA 1RUD1 1OLME 1HV0A 1LESA 3Q8BA 4FPHA 5JI9A 5FPBA 1DHKB 3MGUA 4LO6B 5DUWA 1XSRA 5BNOB 4EJRA 2PAMA 4S2GA 5J3UA 2K0GA 5T52A 1J59A 3OOXA 1MVQA 5C4WA 1FI2A 1SLTA 3CJXA 1OUXA 4JDMA 3VV1A 2BBVA 5JXHA 1ZZ6A 1WCKA 1ZBA1 2W94A 5F37A 1C3HA 4XF9A 1BYHA 1WCSA 2WFPA 2Y34A 5F3CA 4XCAA 3IT8A 1S2EA 1HRI3 4YM0A 4DXTA 5FPUA 5C4WC 1IPKA 2RR13 4X8PA 1J1LA 4JAAA 4XDQA 1QH6A 4O7XA 3G7DA 1SBDA 1VRH3 4JQTA 5CYYA 4OHZA 4D94A 4HPKB 1GZWB 2RM22 3WT3A 2ZAAA 1O59A 5LZ6A 3LFMA 4UXAA 4OVEA 3ZX7A 5ABJB 4F8AA 1GP5A 1FV3A 4BDVB 4D7YA 1W6MB 4OHXA 2OKXA 2JICA 5FY5A 3OG2A 2D3SA 3JZVA 1QY4A 2Q5TA 1JXNA 3KMHA 4FQZA 1UIKA 1LCLA 5LA2A 2BTVC 5FKCA 1LEMA 3T0AA 1DP0A 1WLDA 2BNNA 2YFZA 5FAXA 5FY0A 3ZOIA 3RRDA 1HXS2 2IXJA 3VKLA 1ZA7A 4YVWB 2QE3A 1PVXA 5F1RA 1JYCA 1RUD3 2W47A 5H9SA 1JODA 1SLCA 4DIQA 2ET7A 2RMU1 2EXJA 1A3KA 3VD5A 1DZQA 5AVPA 5HV0A 5JPNB 1NZCA 4V2WA 3ME2A 2ZGOA 3DPRB 3WDWA 1WGPA 5IFPA 4HFSA 3O5SA 2FDFA 1ZBA3 3NAPB 1SG3A 2GZWA 2O8OA 2VG9A 4V2VA 1VRBA 2VCBA 4G9SB 5DUUA 2CSGA 1H8VA 1UOBA 2JX9A 1HXS1 1F35A 3NQHA 4M01A 5C8WA 4Q8KA 1JS9A 4AGGA 5I8TA 3KVBA 4FSJA 1IS4A 1UMZA 2XONA 4PQ9A 3LB9A 4O9EA 1K5MC 1UKGA 4MHRA 1WCDJ 5AVAA 4OHYA 1GV9A 2JIJA 2XWBB 4U36A 2C24A 5FMCA 3V0AB 1AL21 4YZ3A 4LNVA 2HWC2 2V09A 2V73A 3O1MA 5FOBB 3VBOB 3I2OA 3I2DA 1H4GA 3PLQA 2OYZA 2VVEA 2VOWA 5FPLA 2R0FA 3UV9A 3LA7A 3B93A 2Q1FA 2RMU3 4PHZA 1OXCA 1MZEA 2ZX2A 5C7GA 2FCVA 5IVYA 4WV8A 2OT7A 2RDRA 5F6LB 2P4EA 4UW4A 4XACA 4AZZA 1GZTA 1OD5A 2HYXA 3AVSA 3NMBA 4OI2A 1JZ3A 3ETQA 2J1EA 3GGLA 2BNOA 3T1MA 1GOFA 1Y4WA 1W3XA 4LBLA 2HWC1 4N7UA 1JYXA 4Y33A 1JUHA 1W8ZA 5EZWA 2O1QA 1V9U1 2PAKA 3TRSB 4PQQA 1HXS3 2ZKLA 3PIGA 3N9PA 3FLTA 3SCGA 1RUC1 4DMIA 4LOSA 5C71A 3OD0A 2Y6GA 1W05A 1STMA 4YYOA 4RD7A 3WG4A 2EICA 3JUUA 3MPBA 4NHMA 5IK4A 1WKYA 1PMJX 3MV11 1EPWA 4EZ4A 3AL6A 4NWWA 1F8VA 2ZEZA 1G9AA 1AL23 4QXCA 4CDUA 4GULA 3M3IA 3GALA 3UKTA 1GBGA 4JGYA 2SBAA 2VOXA 3KV9A
chains in the Genus database with same CATH topology
4XBQA 2ZX4A 1WA4A 3VBSC 4CEWA 2WA3A 4LEJA 2DCYA 2PLV2 2VY0A 2VOVA 4ORFA 3SISA 3JD71 1CGPA 4CEWC 1PO11 4YW1A 4GB32 1EV11 1WD3A 3WXPA 5JOZA 4F3JA 4AHWA 1Q8VA 2WKKA 4YGBA 2IXCA 1YIFA 1JBCA 1V9U3 5JIAA 2ZABA 4LBOA 1W6PA 1YWKA 1RUC3 3S0MA 4URTA 2DU0A 2BGCA 4C90A 5LEKA 1XNBA 3AP7A 4H14A 2WNUC 3ZYJB 3ZYRA 2D3PA 4PCRA 3QCWA 2UY9A 1QGLA 2A75A 4MX3A 1QDOA 1X82A 4TZDA 4NHKA 4HBNA 1RUNA 3SH3A 2O8QA 4GMP1 3VKNA 4QQ2A 3N7KA 4XFFA 4XE9A 2HWB3 3VBRA 1OOPA 2A3WA 2ET1A 3OPZA 4FOQA 2EAKA 1S0JA 1MQTA 1FAYA 3DN7A 3JD73 4EWEA 4KWKA 1PZ9A 4QPYA 1PO13 3HD8B 2H6CA 1MVEA 2DCTA 1J3RA 2Y0OA 4LTAA 1EV13 3BOPA 4BLIA 4KG8A 1NE4A 4LE3A 4Q1RA 2UYBA 2YDEA 4DOUA 4QT6A 2A7AA 2VQAA 4XEZA 2VW2A 3BB6A 5K9YA 1ND2B 2WLPA 3WDUA 4ITCA 3UK9A 4RQPB 2RS11 1OI6A 2R062 3ZDSA 1LKNA 1H1AA 2YMZA 4EWAA 3MFCA 5FCCA 1V6JA 3O12A 4AVSA 4XETA 2HWE1 2NMOA 2IXKA 2NMNA 2D98A 3B02A 2FQPA 4GMP3 1U5IA 1OA3A 3MIGA 4PDWC 5KHIA 4YGDA 1UW8A 4OULA 2RS31 1DGWX 2QDNA 5DG2A 2ETEA 1DGRN 3GBWA 2TEPA 1LGNA 4FBFA 3QLQA 3VBHB 1POV0 2QDRA 5D8AA 5FREA 2NN8A 3TNQA 4OI1A 5C8CB 3ZSKA 2EAAA 1NG0A 3MDPA 1LHVA 1NA1B 3JB8A 1AL0G 2ERFA 4I30A 3MYXA 2QZ3A 4IEWA 3ZVXA 5E89A 2FHRA 2TBVA 1LOBA 5AC92 5JVVA 4UW3A 5CA6A 3NSTA 1WW4A 3OY8A 2WFF1 2WIIB 3VHPA 3RNSA 2RS13 2XVLA 3FBYA 2R30A 1SCRA 1QQP2 1PIV1 1UU5A 4HK9A 4XPVA 3ES1A 2HWE3 3A0NA 2WLQA 2WQ4A 5GZCA 1BEV2 4N43A 1FV2A 4IESA 4CP1A 3ZFEC 2TUNA 4PIYA 3VZKA 2RS33 4XJ8A 1SCSA 4QQPA 4Q4V2 3KCYA 4KQ7A 1S0BA 3KT7A 4AEJA 1D4M1 3I59B 1FMD2 5BNNC 2UYAA 5KXDA 1YI9A 5EJ3A 4CDXC 2PHLA 4AK3A 3S7EA 3J8F2 1WMEA 3H1WA 4IERA 5CU1A 1AHSA 3POYA 1UX6A 4TYSA 3MW2A 1O4YA 1AR61 1QDCA 2JD4A 4DINB 1U5ZA 3ZFFA 1EP0A 3THTA 2MEV2 2ZMNA 1V6NA 4AG4A 2WFF3 2ZS6B 3IDEA 3LA3A 5IK7A 2P37A 1DGWA 4Y4YA 1G7YA 1DDLA 1PIV3 1QOSA 3ZFFC 5KHJA 1QF3A 3CJIB 1LHOA 1AJOA 1V6MA 3P3NA 5CFDC 1C28A 4BIFA 1CAVB 2RE9A 3QBQA 1CJDA 3URFA 2DVDA 4YM1A 1ZA4A 2PAEA 4AFAA 3H1MA 4BWOA 4MZUA 3PVEA 1EAH1 4ZU4A 4CDWA 1D4M3 4L9BA 1D2QA 5C9AB 3KCXA 5JZGA 4FPCA 1I6XA 2A6XA 2ZX1A 2R32A 2QUOA 5JOXA 4CDWC 2HWD2 2WS92 3Q9OA 1H2NA 1R082 1OHFA 3WX5A 1ZBE2 2I74A 1AR63 1J58A 2D93A 1W6PB 4WM7B 2XL9A 1Y3TA 3IPVB 3OYWA 3WP6A 1W0PA 2XL7A 1DU3D 5GLUA 2QVSB 4OHVA 4D3WA 1F9KA 5BXXA 1NYWA 1QJY3 4XTPA 3NWKA 1RUI1 3U10A 1H9PA 4COZA 4P9WA 1MEC2 2WT2A 1IOAA 2RJKA 5TSWA 3VBFB 3WZ1A 4AVAA 2PHRA 1AR92 1OFSA 4MGIE 2AGSA 1AX2A 2VW1A 4CP2A 1ZNPA 4QU2A 1ND3C 1EAH3 1ENXA 4FCAA 1VLNA 3TN92 4JC1A 1IQAA 4G4FA 1ULGA 5KHGA 2G9FA 2P3IA 2UY8A 4XF4A 3LCPA 3B9IA 3N7LA 2R072 2NPIA 4QD2A 4IV3C 3ILNA 5T50A 1GICA 4GH4B 3AP9A 4JTOA 1QJZA 1POV1 5JSRA 2Z79A 1SDWA 2GNDA 1GANA 4CDQA 5KWRA 2W52A 4H7MA 3H50A 4NR1A 3RG0A 4IEXA 2O0OA 5JMCA 3PJQA 5GM0A 2JE9A 3GNEA 4FOYA 3SCHA 2VUJA 1ASJ2 1AYN1 4IEQA 4CTEA 4P9GA 1RUI3 1Y7BA 1LOEA 2HEWF 4HKOA 2D6OX 1RB8G 1BJQA 1O91A 3BIWE 4AFMA 3WQ1A 2XH6A 3O14A 4EN0A 4KU8A 4DRRA 1AR72 4AEDC 3RI8A 4LULA 1CAUA 4JV4A 1MZFA 2X5IB 4RS5B 4B7KA 4GIQA 4Y22A 3ZSMA 4WZCA 4AI3A 3AZWA 3PNAA 3UKNA 3V56A 1LU2A 1PK6B 4AQ2A 1YXWA 3AKTA 5FRAA 4CEYA 1PVC2 4Q0PA 1POV3 2VVDA 2G4IA 1UU6A 2CYFA 2E51A 1BZWA 1O5LA 1BBT1 2B8MA 4XTMA 4R4XA 4XXPA 2WZR3 4A7YA 3VN4A 2ILMA 4Y1YA 1CD3G 1JW6A 2ZGNA 2DFCA 5DZGA 1AYN3 4JQRA 2D6KA 2QNKA 3OGGA 5ABJC 4QPGA 5FMOL 2VH9A 3FLRA 1DQ4A 4UW5A 1LEDA 1Z7S1 2R0HA 3ZPYA 2GNMA 5FOJB 1YJLA 2HWF2 2CGNA 5KXEA 2E7AA 5L7OB 2XLGA 4XIKA 1DG6A 2B46X 3RPQA 3MEPA 4YVWC 3I4IA 2IXIA 4MSVA 2YYOA 1DYPA 3VL8A 1ULEA 3N7JA 1CIWA 2IZWA 4OFGA 4ES8A 1X33A 2XJRA 3DUIA 2V5YA 5L36A 5C6CA 2QFEA 1MS4A 1N3OA 5L73A 2JJ6A 3NAPC 1BBT3 2ZGSA 2CV6A 1YLLA 4LHLA 4R9CA 1SFNA 3EJKA 2D5HA 1S0CA 1B35B 1KDMA 1RJ8A 1KITA 2JG9B 4J6GA 1RUF3 2DCJA 1DYKA 1TMF2 3M1HA 4WVMA 5DZEA 3L2HA 4OI4A 4RR3A 1Z7S3 5LRSA 1G9BA 4BM8A 1G9CA 5KC6A 4FTEA 3IKWA 4NVPA 3TNPB 1AZDA 4FAGA 4FO9A 3DF0A 4RR3C 1NXD1 3BCWA 3VBOC 2CGPA 3BALA 3WW3A 2P2KA 4R52A 4YFZA 4I09A 1H8TA 1W6NB 3QH6A 3APBA 4PBPA 3WDVA 3AJZA 5F5QA 4B7EA 1EPZA 1AXKA 1H8TC 2A3XA 5EFUA 3MIFA 4E2SA 2Z42A 4UBGA 1G6NA 5H9QA 3WOGA 3OTFA 4I0WB 4Q4Y2 4IV1A 1TME1 1VBE2 5LRRA 1J1TA 2G9GA 1CAXA 4Q4W2 1UN1A 4P9XA 3ZN4A 3U11A 2JXAA 3IN9A 3JCIA 4WM8B 1AR81 1FNYA 3D8CA 3D4KA 5JPMB 2F4PA 1BVVA 3WVJA 3MLKA 5JOYA 3O0VA 2OUHA 1RUJ2 3ATGA 4Y1UA 4XFIA 4WVWA 4YW3A 3IDBB 4N90A 2Z69A 3J9SA 5KHKA 3M4FA 3RS6A 1SBEA 1ZZ8A 5I91A 2OVUA 2ZGTA 3QOPA 4PIZA 4CDQB 1V70A 2CWSA 4XMIA 4NO4A 3A0KA 5FLJA 5JCTA 4IXLA 4AFBA 1D4VB 1AVBA 1MS3A 5CIRA 3GHNA 1TME3 2NQYA 3M3EA 2ZGQA 5CVRA 1C1LA 4Q8LA 2C9AA 3CU7A 3WUDA 2ZAHA 3PHMA 3W9AA 1AR83 3AP6A 1TE1B 2D6PA 1O3SA 5A33B 2WC2A 4QQHA 4YVSB 4BH9A 4INDA 4C0HA 1CAUB 3AMQA 3ECQA 5JAXA 4KG0A 4GMP0 4GWMA 2BWCA 1RJ7A 1PHMA 1EYBA 1QJX2 2EXKA 4EWDA 5CFCB 4N53A 1X7NA 2WNEA 1QMJA 3KLSA 4QMAA 4YG6A 3IBMA 4YW5A 3WY6A 2ZOEB 1MS5A 4N53C 3ZFGB 3BTAA 4QHBA 1GR3A 2RM21 4QPIB 3E5XA 5FQ0A 3B94A 4MYEA 2PHTA 1G9DA 4R9DA 5BNPB 4DPNA 4GXLA 5CNAA 1O5UA 2IFRA 2GU9A 3ZXAC 4JVAA 3SXWA 1K5MA 3LSEA 1RHI2 1W39A 3NO8A 5F6KA 2WSUA 3ALQA 3RWNA 4CRQA 1RUG2 4HVOA 2JG8B 3AX4A 1QOTA 4M3CA 1VBD2 3RJ2X 2VUAA 4AVBA 4YG0A 2HEVF 4XZPA 5I0RA 1RUOA 4NPRA 4DS0A 1GZCA 3NW4A 2A6WA 3VBHC 3L2YA 2WWSA 3BODA 1MS0A 2DYCA 3QACA 4LBNA 2CNAA 4C91A 4W65A 4BYYA 4Z2WA 1XYOA 1S1AA 1F31A 3MICA 5AFBA 1DQ6A 3CEWA 4HSLA 4MUVA 1CQ9A 2RM23 2CY6A 2B7YA 1SLBA 3M3CA 1OFNA 2R49A 5GLTA 1OQ1A 3OGJA 2WA4A 1RUE2 1WBFA 1YFYA 3JBG2 2H0VA 3FUOA 1FATA 3RMYA 4E4ZA 1UCXA 1QJU2 5FO9B 1FYUA 1ZYBA 3SCFA 1XRUA 2BEOA 1S0GA 3HT2A 3GZUC 1AJKA 3V0BB 2QQPA 5LEJA 1YFXA 1KDKA 1NE6A 1TQ5A 3AMPA 3LSDA 4JGZA 1XNKA 3VBSA 2JKBA 4FPYA 5EXOA 5KHHA 1UKRA 1VB2A 1LU1A 1RC6A 4M00A 3JBG1 4JGZC 1AYM2 3VUOA 4B3NA 1AXZA 3R4DB 1ENSA 3MLLA 1WBLA 2GH8A 5C33A 1Q5OA 2R042 1PO22 1KS4A 4Q0SA 5A3MA 1APNA 2GC2A 4R8HA 1VIWB 1V6LA 2HWC3 4ISQA 3USSA 4AHYA 3N36A 3KD4A 1N1VA 2PA7A 2VMHA 4BOWA 1W6QA 2WNUA 2XJTA 3T1LA 3CJIC 1HKDA 3WG1A 4AI8A 4JCKA 5FPXA 4YW2A 2QZ2A 3AYDA 3VBUB 3RI9A 1WMFA 2YGLA 4YGCA 1R1A2 1HX6A 4QGLA 2PLV1 5CB7A 3UJOA 4D7SA 4YFWA 4ZU5A 2ZHNA 2R6QA 4GB31 2GMMA 2VECA 2WNVB 3GHMA 4IL7A 2YPJA 3JBG3 4N9IA 1NCQC 2OA2A 3H0OA 1C57A 1KQRA 2R16A 3ZYIB 1A6CA 4EROA 1NCRB 5K0UB 1Y43B 1V6IA 3NJZA 1PGSA 5J37A 3HT1A 3ASIA 2OW4A 1VBA2 4WM7C 2C0ZA 4FXGB 5GJ6A 4H3WA 2R1BA 4AXOA 3PMEA 2KA3A 3TB0A 5C4WB 1ZRCA 3BPZA 1NLRA 1PGL2 1LOAA 1ENRA 1YJKA 5JI7A 5SV5A 2ZGLA 1GLHA 1C8M2 1RINA 4AVTA 3VHOA 3MFAA 2PLV3 4ATEA 2XG3A 4PDWA 3H3UA 2F6BA 1RUH2 3WLUA 2XPJA 3ES4A 4GB33 2PHDA 3B01A 5T5PA 2VQ0A 4Q4X2 3B3QE 3B9CA 3FMGA 2XWJB 1NY72 1DGLA 4FOVA 4MXWA 4GH4C 3ACLA 1M06G 2XKPA 1DQ1A 1WLWA 4A2UA 2UU8A 2R061 1ALYA 2X29A 1HRV2 2HYKA 1ULDA 5BPXA 3HAGA 1RVF2 1Q8SA 3USUA 1XNCA 2WJSA 3L9JT 2CGOA 1CAWA 5JLVA 4FP2A 2NYYA 5I8SA 3POSA 1IKQA 4BQ1A 1K5MB 1VJ2A 4L92A 3UL2A 1BMV2 3AFGA 3D6EA 1PM7A 1ZZ9A 4AE2A 5CG9A 2I07B 3KQRA 1IS5A 1NQJA 2VPVA 1CJPA 1UPSA 3M2MA 3FFZA 4P9YA 4J1WA 4ES9A 4FT8A 2XJPA 4M3CB 3ZFEA 3WV6A 1PZ8A 2X5IC 4RGAA 1LOGA 2FZ1A 3FZ3A 3MF9A 1S2BA 1W6OA 5ACA2 2A6YA 2GMEA 1J3QA 5BNNA 1PK6C 2H0BA 4CDXA 5AC91 1H2MA 3PVNA 1O3TA 2GMPA 3VGIA 4X6RB 1N3QA 2QCSB 1Z78A 2R063 3IMNA 4V1PA 3JQXA 1QQP1 1HQLA 2EIGA 3N35A 1SACA 4HSJA 2DV9A 3ZXGA 1BEV1 3J26N 2WZPP 2Q1MA 4IQPA 2IXLA 2Y0IA 1VR3A 2ZTNA 4QM9A 3ZXEA 3PVOA 4Y5Z0 4Q4V1 5CFDA 3X29B 2YXSA 1FMD1 3R05A 4FPLA 2YROA 5DUXA 5AFEA 1LR5A 5L7OC 3OBRA 1OPOA 2A73B 3K48A 3E6CC 4MGYE 4QXKA 3RYRA 4AQSA 1B09A 1REDA 3VZJA 1QNYA 1IKPA 3VBSB 5I93A 4CDUB 2GNTA 3J8F1 4LBQA 4JGYB 1COV2 3ZN6A 5AC93 4XJAA 2RS52 4Y20A 4CEWB 1O3QA 2MEV1 1F5JA 4R9AA 4ASMB 3J4UH 4GKXA 1KFUL 4ZU7A 5T3NA 2ZBJA 1QQP3 4AQ6A 1B35C 1CVNA 2W0XA 1H0BA 1SEFA 4AWDA 1BEV3 2AENA 2JG9C 2AYHA 5KBFA 4OLLA 4RHV2 3SLIA 2A70A 1QU0A 1XYPA 3IDCB 3MIEA 4FPFA 2IC1A 4N7IA 4E4DX 2A6VA 4G3YC 4YM3A 4XF0A 4PLMA 5GLZA 3MIDA 2ZZQA 4Q4V3 2EALA 4JRLA 5CBLA 1FMD3 2WT1A 4IETA