1LOCA

Interaction of a legume lectin with two components of the bacterial cell wall
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
180
structure length
180
Chain Sequence
TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEANVVIAFNAATNVLTVSLTYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEGUME ISOLECTIN I (ALPHA CHAIN)
publication title Interaction of a legume lectin with two components of the bacterial cell wall. A crystallographic study.
pubmed rcsb
molecule tags Sugar binding protein
total genus 27
structure length 180
sequence length 180
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1locA00
4M00A 1APNA 2DURA 3V0BA 3WUDA 3N7MA 1JXNA 2A7AA 2W08A 3IMNA 1LTEA 5KXBA 4BM8A 2DV9A 2DUOA 2H0BA 4R9BA 5JOYA 2ZBJA 1HDKA 1SLTA 2ZZJA 3I8TA 4GXLA 2ZMKA 3AP5A 4HL0A 1NLSA 2P37A 1N1SA 5EWSA 3WHTA 1LOAA 2WT0A 2C5DA 1UZZA 3M3QA 4LBLA 4FOQA 1EPWA 1WLWA 2ZGNA 1DGLA 2WNEA 3AZWA 5DUWA 2ZGTA 2YZ4A 3MW3A 1MVQA 5DXDA 1AF9A 2OUJA 2D6OX 4Y1UA 4YZ5A 1I3HA 1SACA 1LESA 2PHXA 1LHOA 3AP9A 2WSVA 1CJPA 2WT1A 4H55A 4TZDA 3LSDA 5HCFA 3RG0A 4WVWA 1OFSA 3OYWA 5T55A 3AXEA 1GYKA 2LTNA 3NWKA 1VAVA 3VKNA 3ZXJA 4JRAA 3A0KA 2EF6A 5CA6A 4XBNA 4P14A 5GLTA 4YGEA 4M01A 1W6NA 4C1WA 2JE9A 4XTMA 2EXJA 1GNHA 4CZSA 4P9XA 1S0GA 3PMEA 4PF5A 4BPZA 2ZMLA 1S0FA 5L73A 4YG6A 1WW6A 2Q5TA 4LBQD 5T50A 4GA9A 1B09A 4UW5A 3NV4A 4YZ1A 3N3HA 4Q1RA 1N3QA 3FUQA 1FV2A 5GLZA 5T52A 1GBGA 1O4ZA 3GNEA 5GALA 1PZ7A 1SLIA 4UW6A 3WV6A 2OUHA 2VU9A 4LBQA 1IOAA 1FATA 1W6OB 2DU0A 3A0NA 3USUB 2D43A 2E51A 1LEDA 4GALA 4DPNA 2JDZA 2DVBA 1DHKB 2GMMA 3OGGA 4LBNA 1CONA 4YGDA 1WW5A 2ZGKA 1S0CA 2ZGSA 2DVGA 3DGTA 4Q27A 3RS6A 2NMOA 5JDBA 4YW3A 1FNZA 2CWMA 1F9KA 5GM0A 3DUIA 3N7KA 2PHTA 5JOZA 2W52A 1CN1A 1DLLA 1H9PA 1C57A 1W6MA 2DUQA 1LENA 1JW6A 2GDFA 4Q8LA 5GLVA 2A6XA 3B00A 1DYKA 3FLTA 3SLIA 2A6WA 3ZSLA 3ZVXA 5IK5A 2ZGRA 4RA0A 1AZDA 2UWBA 2NYYA 3ZSJA 2ERFA 2JE7A 2XG3A 1DQ0A 4YZ2A 1ENSA 1QU0A 4Y26A 4FPKA 3M1HA 1FAYA 4FOWA 1S0BA 1LGNA 3AYCA 3RSJA 4XBQA 1HQWA 1W0OA 4YM2A 2GN7A 3O5SA 1V6OA 4K1ZA 4BQ1A 1TEIA 1JYIA 1KDMA 1UAIA 1ZA4A 2Z42A 3NV2A 3PVEA 3R4UA 2UWAA 2YMZA 3W59A 2AH2A 3H0OA 2ZHKA 1JYCA 1MVEA 1LHVA 1QNYA 3IPVA 3M3EA 5IK4A 3ATGA 1N1YA 3FBYA 1LOGA 1S0EA 5EYXA 2P34A 3WDXA 4Q2FA 1DQ1A 1LCLA 3WOGA 2R1BA 3JUUA 1V6NA 4IQPA 1VIWB 3N35A 1KITA 1GLHA 1OKQA 1U0AA 2UU8A 1OQ1A 3ZXFA 3O12A 5GZGA 2EXHA 5DUUA 4YW1A 1MR5A 3R4SA 1G9BA 1CESA 2GNTA 1WD4A 1QOTA 3AP6A 2ZHLA 4Y1VA 1N1TA 1WCSA 4FPCA 5T5JA 4UW4A 3B9CA 1S0IA 4YG0A 3WG2A 1Q8VA 1LHWA 2JJ6A 2A3YA 4XIKA 1AVBA 2VW0A 3WHUA 4XOGA 4AWDA 4Y1XA 1A8DA 1BJQA 1GZWA 2PHUA 2EAKA 3MW4A 4Y20A 2ZGQA 1J1TA 1IKQA 2E6VA 5DG1A 3V65A 3V0BB 4GKYA 5GZCA 2DU1A 3FUOA 1HQLA 2GNDA 1ULDA 1LOBA 1V6JA 2R16A 1F31A 3AZXA 3A4UA 3AYDA 4YFWA 5H9RA 3OBTA 1ZM1A 2ZHNA 5EYYA 2DTWA 1SLLA 1ULGA 5GZDA 2WJSA 1LODA 1WLCA 4R9AA 2YY1A 3VV1A 1F5FA 1QOSA 4YM0A 2PHFA 1KRIA 3POSA 5H9QA 5GLUA 1CPMA 2JKBA 5DG2A 3N7LA 2WSUA 3BTAA 3ZSKA 4FP3A 1WBLA 3PJQA 2D3RA 1IKPA 1GV9A 2ZGOA 3VKLA 1FYUA 1WW7A 3WCRA 1SFYA 4M3CA 1X50A 4Z8BA 3WZ1A 3HR9A 1V00A 3APBA 4WV8A 1UZYA 4YW5A 2A3XA 2AUYA 3RRDA 2PHWA 1N3PA 3OYWB 2CNAA 1AXKA 3ZSMA 4ATEA 2HYKA 2R1DA 3HN1A 3JU9A 3LSEA 4XTPA 1G9CA 4YG3A 1YRZA 4LBOA 1A3KA 2A71A 2WLQA 2ZGUA 1W6QA 3V64A 4DRVA 4GKXA 3WDUA 1W6NB 3ZYRA 2A5ZA 3T2TA 5DZEA 5JOXA 3OJBA 4CRQA 1N1VA 1MS4A 2DVDA 2GALA 3WDVA 3PVOA 1MS0A 4YLZA 1QNWA 2D6NA 2AR6A 1Y7BA 1SLBA 3AJYA 4WVVA 4FPHA 2DWRA 3IN9A 3AP4A 4LBQB 3WUCA 4PCRA 1LOCA 1YI7A 4BOWA 5LK5A 4AGRA 3POYA 5KXDA 1G7YA 5GZEA 4YGBA 4BLIA 3L2YA 4FPJA 2CTVA 3VKOA 3D4KA 5CAZA 4BMEA 4C1XA 5DZGA 4P9WA 4F83A 1MACA 5JLVA 2SLIA 2VW2A 2DVAA 1CR7A 3AXDA 1C1FA 1RINA 1MS9A 4L8QA 2DUPA 3WG4A 2ZGMA 3AFKA 4XMAA 4P9YA 3BOPA 2A6ZA 4XE9A 2AGSA 2VW1A 3M2MA 1AX0A 2DVFA 4XHBA 3UK9A 1V6KA 1UX6A 1YXWA 1UPSA 4GWMA 5DUVA 4AVSA 3UJQA 1Q8PA 3T1LA 1Q8QA 1W6MB 4YM1A 4BMBA 3Q9OA 1LECA 2FMDA 2FHRA 2DYCA 3T1MA 1DQ4A 4U36A 1H30A 3V0AA 3N36A 1JN2P 1GNZA 1O4YA 2VH9A 3AK0A 4LBKA 2SBAA 3WG3A 4ZKTB 3SH4A 1KJRA 5T5OA 1ONAA 3PVNA 4XDQA 4KBBA 4XJZA 2EXKA 2OVUA 2D6PA 1Q56A 3WCSA 3ZPYA 1AXZA 4MYEA 4PBOA 4XYXA 3B01A 1ULCA 3W58A 5GJ6A 4RL7A 1H9WA 2VXRA 1LOFA 3KM5A 1W6PA 4W65A 5E89A 1G9AA 5HCBA 5GZFA 3UJOA 1QGLA 1SBEA 4LBJA 1BQPA 2OW4A 3AX4A 2YROA 3RMYA 1GANA 2I2SA 4HANA 3IPVB 1A78A 3M3CA 5IT6A 1QOOA 2LALA 4JC1A 5GLWA 2A6VA 1LHNA 1DYPA 3WDTA 2P3JA 5IK7A 2ARBA 4XJAA 1C4RA 1UMZA 4DRRA 3NV3A 5CNAA 1LJ7A 4FPFA 4FPYA 4CTEA 4Y1YA 4K20A 3WDWA 3WLUA 1D2SA 1DIWA 1UKGA 2ARXA 2E7QA 3OY8A 4OZXA 1FNYA 5BYNA 1LGCA 1WUVA 3FLRA 3AZYA 2KM2A 1YYNA 1ENQA 1WD3A 3FFZA 1G86A 3AZVA 4ISRA 5EXOA 5T54A 3B69A 3O0WA 5E88A 1DBNA 3CNAA 2NMNA 2EALA 1KJLA 2G4IA 5KXEA 4YW4A 1SCSA 1MS3A 5FREA 3IM0A 4DFSA 1GZWB 4Y20B 2VY0A 3ILFA 2P3KA 4PBPA 4Y22A 5F5QA 1LOFC 1LGBA 4XBLA 1SBDA 1MS1A 3ZXKA 5H9SA 1GZCA 1AX2A 1MS8A 1S0DA 2B7YA 4UW3A 4WZFA 2AREA 1N47A 4GWNA 1CIWA 3FLPA 2XB6C 3AP7A 1G8WA 3RMXA 1VLNA 2WT2A 4ASMB 2GNMA 1GSLA 4ISQA 4FVVA 4FQZA 2ES3A 4YFZA 1WBFA 1LU2A 2W68A 4DS0A 1IS5A 2ZGPA 4M3CB 2D44A 4FQ4A 1QKQA 4ZXKA 2D6LX 3RQ0A 4XILA 1D0HA 3SNMA 1Q8OA 4TYSA 1JUIA 4PQ9A 3VKMA 3NV1A 1QDCA 4ITCA 4Q8KA 1HKDA 1IS6A 1SCRA 1V6IA 5H9PA 1CPNA 4YM3A 2A75A 4XJ8A 1W6QB 1AJKA 1SLCA 2NM1A 5CB7A 3ILRA 2PELA 2GMPA 3WDYA 4FPLA 4U2AA 1AJOA 1DFQA 1V6LA 3BODA 5JMCA 3WNXA 2ZGLA 3TAYA 2CL2A 3QCWA 2TEPA 4AGGA 4JCKA 1BXHA 4K1YA 2AYHA 2R49A 1JBCA 3AYAA 3INAA 1XQNA 1IS3A 2A3WA 4K21A 3POWA 4YZ4A 2V5YA 2GMEA 2W39A 1BZWA 4NOTA 1G9DA 3ASIA 3AZZA 4Y24A 1CVNA 1Q8SA 1WW4A 5T5LA 2UURA 1RIRA 2YXSA 1HLCA 3ILNA 4LBMA 3R05A 3C2UA 3SH5A 1QDOA 1WLDA 1DQ5A 3GALA 3O0VA 3O0XA 5JVVA 2CWSA 3SH3A 4AVVA 1W6OA 4YW2A 1QF3A 1UL9A 3OPZA 3USUA 2EIGA 5AVAA 1W0PA 3KQRA 2GN3A 4XZPA 4FP2A 3M3OA 2JD4A 1LOEA 1DZQA 2CY6A 4AVTA 4R9CA 2D6KA 1FV3A 4YZ3A 2EXIA 3BIWE 4FOVA 4NO4A 2VUAA 1AXYA 5IK8A 3V0AB 5T5PA 1SBFA 5KXCA 3B3QE 4I30A 2AENA 4BLJA 1ULFA 1DQ2A 2CYFA 3ZXEA 3UL2A 1I1EA 1IS4A 3D6EA 3OBRA 3QLQA 3MEPA 3U4XA 3LCPA 2ZMNA 5IUQA 3I4IA 1PZ8A 4M3CE 2P2KA 5FRAA 1BYHA 3TB0A 2DTYA 3MPPG 4FPOB 1W6PB 2NP0A 5DUXA 1G9FA 1LHUA 1LEMA 4AYUA 2WQZC 2WKKA 5DZFA 1VALA 3AJZA 2ENRA 1GZ9A 5E8AA 2YV8A 1JOJA 2ZHMA 5CBLA 1MS5A 4XXAA 1LULA 2D6MA 1KQRA 1RITA 4XJWA 4Y1ZA 2JECA 5JOWA 1MZ5A 2A6YA 1GKBA 2PHRA 3VUOA 1JHNA 1AX1A 2ZAAA 3ENRA 3HMYA 1UN1A 3SISA 4XIOA 1YO8A 4Q1PA 2D7FA 3N7JA 3OY8B 2V73A 5SV8A 4AGVA 1V6MA 4XMIA 2ZKNA 1ENRA 4SLIA 4M3CF 2R0HA 2NN8A 2E7TA 2GNBA 3ZYPA 1MZ6A 2NZ9A 2RHPA 4FPGA 2D3PA 2C9AA 1URXA 3AYEA 3SITA 5HCAA 3WVJA 1NXD1 1S0JA 1Z0HA 2D3SA 1CQ9A 2E53A 2R0FA 3IKWA 1GICA 4Q26A 4XJUA 3VKFC 3WG1A 3ZXLA 1FX5A 4YGCA 1C1LA 2BQPA 1PZ9A 1LU1A 2ZABA 2ZACA 4R9DA 4XXPA 1QMJA 1KDKA 4FOYA 1BKZA 4Y22B 4ATFA 3MW2A 5F9TA 1VAMA 4XHXA 4DQAA 2P3IA 1R1ZA 4XJ9A 1N3OA 2A70A 2ZA9A 4FPEA 1YIFA 1DQ6A 3D5OA 1S1AA 1SLAA 4D69A 2UWCA 1ULEA 1Z78A
chains in the Genus database with same CATH superfamily
4YYOA 2MHFA 3N7MA 5DDJ3 5A80A 4D6QA 4A41A 4P5HA 2WWUA 1LTEA 3IMNA 2HWE3 3IDEA 1L7RA 4BM8A 2DUOA 2IXIA 3CEWA 4FI9A 3UKTA 4AHXA 4AVBA 2AEZA 2ZMKA 2XWBB 2BP6A 2P37A 2HWB3 4N53A 2WT0A 1UZZA 1W39A 1EPWA 2ZGNA 1DGLA 1VRH1 2HWD3 2RDQA 2WNEA 1RUI1 2YZ4A 3DECA 4QQPA 1VMHA 4V2WA 5JIAA 5FLHA 2C26A 2D6OX 4XFCA 1JUHA 3IDAA 4LJHA 1LESA 3S7IA 5FZ6A 3W21A 2QQPA 1HXS2 1CZSA 4MLOA 1RUH1 1CJPA 4H55A 5FZOA 3BTYA 2ZX1A 4W50A 3CZUA 5HCFA 1FPN2 5KC6A 3OYWA 3WF0A 2JDHA 3NWKA 4ZS2A 4E27A 2XDVA 1VAVA 4DXTA 1UYYA 1QH7A 1X9PA 4DEQA 4QGMA 5FO7B 3C8XA 1J59A 1R1A1 4KQ7A 1PO11 2JG9C 3IMMA 2O1QA 4COVA 5FR3A 4NIDA 2X5IA 1GNHA 3GCXA 5FBZA 4CUBA 4CZSA 3LEKA 3AMMA 1QJX3 1S0FA 1UU6A 4HK9A 4UOJA 4GA9A 3VBUA 1B09A 5C8CA 4LPLA 3N3HA 5IVBA 1N3QA 3OPTA 2VBDA 3MYXA 5GALA 1WWYA 1C8M1 3SXWA 1OVPA 2OUHA 2RS52 4LBQA 4PQQA 1FATA 1W6OB 2B46X 2DU0A 3A0NA 2D43A 2E51A 3NNMA 4MZUA 4OQ9A 4FXKB 1DHKB 4CEWB 3H50A 1H1MA 5D8AB 2G19A 3TEXA 1XYPA 1JZ2A 4IEWA 3I2KA 4GB32 3VDCA 5IFPA 2A1XA 1Y9QA 4NHYA 1S0CA 2NPIA 2W1SA 1GOHA 3GBGA 4Y5SA 3RS6A 1RB8G 2NMOA 2XQXA 2GSYA 4LEJA 5JDBA 5CYYA 4YW3A 4B8EA 3LWCA 2CWMA 5GM0A 1AYM2 4ARXA 1CJDA 3ZXDA 2WA4A 3UGFA 1RUI3 3HOBA 2XPJA 1H9PA 2VOVA 1W6MA 2GDFA 5FK8A 2A6XA 1NLQA 2XXZA 2OX0A 4NVPA 4XACA 3ZSLA 4QXKA 2D40A 4E4HA 5IK5A 2RR11 1BCXA 2ZGRA 3DL3A 3HAGA 1AZDA 2IXLA 4RA0A 4WM7A 3LDRA 3VGIA 3ZSJA 5FQ0B 4COZA 1O3RA 1MQTA 2BWCA 2X5IC 2Y0OA 1J1LA 1ENSA 1QU0A 5EZWA 1SG3A 4FPKA 2K9ZA 4ARYA 1FAYA 3VHRA 3AYCA 3RSJA 3VBUC 4HG6B 4IW3A 2D98A 5C8CC 3RZHA 3PVBB 4YM2A 3O5SA 3ZM8A 1IPKA 3VBSB 2DCYA 1V6OA 4BQ1A 1JYIA 1PMHX 1PO13 4DO0A 4FTSA 4LQRA 1UAIA 1ZA4A 2Z42A 4KWLA 3W59A 2AH2A 1ZZ9A 3H0OA 3LOBA 1ZVFA 5FMOL 4LHKA 3LE0A 3V56A 1S0EA 5EYXA 4XVHA 4EROA 1ZYBA 3WOGA 1CAUB 2R1BA 5FYCA 3THCA 1C8M3 2Y6LA 4OHYA 1V6NA 1VIWB 1GLHA 3P3PA 2CV6A 1OQ1A 3U37A 1O7FA 5DUUA 3OGRA 1CESA 2GNTA 1NG0A 2Q1FA 1WD4A 1KEXA 1QOTA 2ZEWA 3AP6A 1N1TA 1WCSA 4FPCA 5I0UA 1JZ5A 1ASJ3 1TQ5A 4RQPA 3QD6A 3TRSB 2HKXA 2YBSA 4LUKA 4XFBA 2A3YA 1YC61 4XIKA 3IZOA 1EY2A 4QPGA 2RM22 4RQPB 4WM7C 4XQDA 4XF0A 2WQ4A 3ZYIB 1WMFA 4NN0A 4GMP3 4XOGA 1QHDA 5CFCA 3DPRA 2R042 1CAVB 4Y1XA 1CIYA 5F2WA 1GZWA 1TMF1 2WZR1 2EAKA 3IIAA 4BK4A 2GP5A 4GKYA 3V0BB 2DU1A 3FUOA 1HQLA 2RR13 1JTZX 1LOBA 3AZXA 4IEQA 3RPQA 2VCBA 3ZLIA 1AR83 1RUF1 4JGYB 3AL5A 2VNRA 3VL9A 4AI3A 2PQSA 1WMDA 2VZ1A 2ZHNA 4LK6A 4R8HA 3KV9A 5GZDA 4TSVA 2XVLA 2IZWA 3FC0A 2YY1A 2WO7A 2IWGB 4XUOA 4E2SA 1AYN3 2WS91 2C1FA 2VZSA 3LB9A 4IE5A 5FIXA 2G9ZA 2W46A 3I3BA 3HPNA 5FYVA 5H9QA 3KT4A 4PLNA 3KSCA 1NAEA 4URAA 2Y6GA 5L9RA 1WGPA 2IXHA 3HBKA 4FP3A 4FT8A 4IV3B 3B02A 5FYIA 4DXZA 4IETA 5J48A 2D3RA 4MXVA 2D5FA 5FWJA 2BPA2 2ZGOA 4BQ5A 4YW6A 1FYUA 3VKLA 3ZN6B 3WCRA 5FY4A 4LOTA 2VCMA 1ND2A 1V00A 3HR9A 4P02B 4YPJA 4A3ZA 1I6XA 4WV8A 3MZHA 1US3A 5JMOA 1ND2B 2CNAA 2R1DA 3HN1A 2JWPA 4QPGC 1K5MA 2VTXA 3AKSA 5C3SA 1HW5A 2O8QA 1YRZA 1A3KA 1GWKA 3ZFEB 5CFCC 3DPRC 3JD71 4HPKB 3V64A 3NJYA 5FBJA 2JDKA 1O3SA 1QWRA 3MICA 3ZYRA 2A5ZA 2E9QA 5DZEA 1OLME 1JMUB 5LA2A 1NCRB 1YQCA 1N1VA 3PU3A 5E6HA 2FZ2A 1KRIA 3VD7A 2GALA 4E2GA 1MS0A 4L2NA 1SHWB 1MZEA 1TMF3 2WZR3 1SLBA 4NJ4A 4Y4RA 2C6SA 1QJY2 4PCRA 2MEV2 4KWJA 4N43A 5F39A 5FKCA 5BV6A 1G7YA 1RUF3 2HBTA 2P6CA 3AM2A 5FPXA 5KXDA 2J1SA 4FPJA 1QQP3 4F83A 5DZGA 4P9WA 5FJHA 1MACA 5JLVA 1AR91 5FXWA 4JAAA 3AXDA 4KH9A 4L8QA 3AKPA 5J96B 1F5JA 2ZGMA 4XMAA 4ZXKA 4XE9A 2A6ZA 2VW1A 4XHBA 2QNKA 3DV8A 1UY0A 4JDMA 1YXWA 5DUVA 2J1VA 3T1LA 4NHMA 2JD9A 4YM1A 2GC3A 4KG0A 5A6YA 3VBOB 2DYCA 5AFEA 3T1MA 1K5MC 2XL7A 4CDWA 2QTWB 1JN2P 2VH9A 3TN92 4LBKA 4QXHA 4ZKTB 4IV1B 1I5PA 4IEXA 5FZ7A 4GJZA 1PMJX 1AR61 1ONAA 4XFAA 3AMPA 4IGPA 4KBBA 2OVUA 3QOPA 1F4HA 5EQUA 1Q56A 3WCSA 4MUVA 4PBOA 1QJU2 4ZZ5A 1ULCA 2B8MA 2OXBA 3O14A 3JD73 2VOKA 3WF2A 1C8NA 4UAPA 3C7HA 1W8OA 4O7XA 5CZKA 1KGYA 4XF9A 4OI2A 3UJOA 1UOFA 3NRUA 4LBJA 3AX4A 3CIHA 3RDIA 5FFOC 4UFKA 1GANA 4JV4A 2DCKA 5A3PA 4MGQA 1UMHA 2VL4A 5IT6A 1QOOA 1VP6A 5GLWA 4GH4C 4QX3A 1LHNA 2P3JA 3O1MA 2ARBA 4XJAA 5F32A 1UMZA 2IUWA 4UI9L 4ZPIA 4CTEA 5J7MA 4Y1YA 4A45A 2E7QA 2ARXA 2XGXA 1XU2A 3OY8A 4CP9A 2JDUA 1FNYA 4K8RB 1WUVA 5I8YA 5JXIA 4J25A 1PIV1 4CEYB 3AZYA 3UT0A 4CDWC 2I07B 1VRH2 4QHOA 3O0WA 4RFRB 5A7WB 5E88A 3CNAA 3POGA 1SCSA 2RMU3 1RUH2 4Y20B 2VY0A 3BGAA 4P9IA 3ILFA 2P3KA 2P17A 1Z7S1 4E2QA 4IESA 4M4RA 4PBPA 5F5QA 4RHV2 4WVZA 1AR63 4I0AA 3ZXKA 2BZDA 4PLMA 3LDBA 2QDRA 1ZBE3 3PLQA 3FL7A 3B7MA 1EUTA 2XJPA 1BHGA 4AI1A 1R1A2 3S30A 4FTBA 4V1PA 1U5ZA 4GWNA 4OVEA 4Q4W2 2C0ZA 3FLPA 1HRV2 3NSTA 1OLRA 3K46A 1JU3A 4KBZA 5JI7A 3WD5A 1OQEA 1PX3A 1YQ2A 2ZX4A 3H1WA 4ASMB 1Y43B 2HEYF 5FZFA 3VHPA 4EWAA 1GSLA 4DY5A 4FVVA 1OPOA 1X8EA 3NAPB 4YFZA 4CCEA 1LU2A 4MGTA 4M3CB 4XZUG 3NVCA 4XILA 1CZTA 1D0HA 3D0SA 4TYSA 3ZFGA 1F15A 1VBC2 2WNUC 3H42B 4NAMA 4PQ9A 4KU8A 3TOJA 5J37A 1QDCA 4IE7A 4NRPA 5DQ0A 1SCRA 3POFA 4P9JA 5IYYA 3LIHA 5I0TA 2BTVC 4Z1VA 5L7OB 1SLCA 2NM1A 1X36A 3O1RA 5J09A 3P5BA 4CYDA 4HONA 1PVC1 5CKNA 4JCKA 2PMWB 3ZYHA 4AE2A 4P9LA 1B35A 1JBCA 2Y0IA 3G7DA 4XCAA 2GH8A 3KGZA 3OUIA 5FUNA 5F2SA 1RUD1 1IS3A 4AVAA 4IE0A 1US2A 3K4AA 2GMEA 3LQCA 1YJLA 4NOTA 1AHSA 2PLV2 1NQDA 3ASIA 1Q8SA 1W05A 1O91A 4MV2A 1RIRA 5FZAA 1KS4A 3C2UA 3SH5A 3WQ7A 5HCHA 2E26A 3ZSEA 3O0VA 3O0XA 1Q5OA 2CWSA 3A7QA 2XJVA 3I49A 4LO6B 2QJVA 3USUA 1FPN1 2WFF1 4BIOA 3I3DA 4CPBA 3KQRA 3VDDB 4CU6A 4I0BA 3RZGA 3ZFGC 4JGZC 1NA1C 2JD4A 3WXPA 1LOEA 3AC0A 3PNAA 4QB2A 4Q4V3 4WM8B 4YZ3A 4CP1A 3NO8A 5BNPB 4EN0A 4OHZA 1ZRFA 2RS13 1S2KA 2JXAA 1H6XA 2QZ2A 2JDPA 2VGDA 3PDQA 3J26N 3VZJA 2VXJA 1RJ8A 3BVCA 4AR2A 1DU3D 2WABA 4BLJA 1DQ2A 1M06G 1QJFA 4PDWA 4RGGA 1PNGA 5A7PA 5C4WA 3D6EA 1NKGA 4RFT0 3PU8A 4FO9A 1I1EA 2VTFA 3MEPA 5CIRA 4HSJA 1H2KA 3ES4A 3I4IA 3OG2A 1WCKA 2RS51 1BYHA 1H8TB 2GU9A 4L9BA 3TB0A 2DTYA 1WCQA 4BJ0A 1W6PB 4RN5A 5DABA 4AYUA 4BIFA 2R7EB 2WQZC 5IAVA 2ARAA 2ET1A 4I01A 1GZ9A 4GB31 5F3IA 5ACA1 5A1LA 4N90A 2EIDA 1ZRDA 1HV1A 4OYUA 1MS5A 4XXAA 2OQ7A 3K51A 3TEZA 1O8PA 2JECA 1W3XA 2V5DA 4YARA 1R081 1CZVA 1C5IA 5K7PA 1J3RA 3CF6E 1GMMA 4AEDA 3E6CC 4XIOA 2G1MA 5EJ1B 1D2QA 4AEDB 1HXS3 3N7JA 4I3PA 3VHOA 5BNNB 4AGVA 1W9WA 4AVCA 2WS92 3N4MA 4MADA 3I2GA 2Z5WA 3U0ZA 3LKJA 2W1QA 4SLIA 2K46A 5JZGA 4M3CF 1FPN3 2GNBA 4ONUA 3ZYPA 2NZ9A 2RHPA 2WZ8A 1SFNA 1T2XA 2C9AA 3ZYJB 4PDWC 4LULA 1S0JA 2R0FA 3IAQA 2IVJA 4INDA 1F2NA 4Q26A 3VKFC 5FMDA 4DZGA 5KHGA 5A33B 1C1LA 1PZ9A 4R9DA 1CWPA 2W94A 1K42A 1QMJA 3KCYA 1RUE3 3VBRA 2WL1A 3OD0A 4Y22B 4ATFA 3DKWA 5K9YA 4QPYA 4DQAA 5FP7A 1R1ZA 4Q4X1 4FPEA 3HNYM 3D5OA 4W6YA 4D69A 2Q0AA 3I8TA 2WZPP 2VC9A 4NR1A 3ME2A 1W2NA 3POIA 2CHHA 3AL6A 4M00A 4PI0A 4XUQA 1F35A 2VNVA 2YU2A 2FDHA 5KXBA 1PVXA 1Y3TA 1ZZCA 2H0BA 1W0NA 2ZX2A 4R9BA 2FCTA 1HDKA 1XNDA 2WNVB 1CD3G 2XJTA 4GXLA 4GB33 5K0UA 3WF1A 4A6SA 3DEMA 4CUGA 4A2UA 4CCKA 3WHTA 4DIQA 4S2GA 5CEHA 3FHIB 5FYTA 3MHZA 5IWFA 1AYM3 3AZWA 2RM21 3TNQA 3VBFB 3WF4A 3LA7A 3MW3A 4N9HA 4D6SA 3T09A 3N9PA 3KV6A 5JZGC 2R041 4DUXA 5LWBA 5J98B 4MXWB 3RJ2X 1OA2A 5FP3A 4M0HA 1W99A 1REDA 3WP6A 1AR92 4QX1A 2WSVA 5APAA 1IG0A 3HBZA 2J1EA 3CJIC 1YCIA 4IEVA 3UYJA 4FBFA 1ZRRA 5HV0A 4B29A 5CFDC 4RR3B 3BIEA 3C7FA 1S55A 2BV4A 5T3NA 3VKNA 1GP6A 4NPRA 2PHDA 2VZQA 4JTOA 4XBNA 4DEVA 4IEOA 4YGEA 5GLTA 4RYDA 1W6NA 2FDKA 4C1WA 1JZ6A 3ACFA 1ND3C 2EXJA 4WVMA 4BPZA 4N7UA 4MGYE 4PF5A 2ZMLA 5L73A 4AXOA 1BK1A 1ZZBA 5CG9A 3OEBA 3OGSA 4UW5A 4L99A 4YZ1A 1NCQA 2VJXA 3HVDA 1COV1 5K0UC 5I8SA 1FV2A 5E16A 1GBGA 1O4ZA 4A6OA 4AHZA 2OYZA 5FAXA 2VU9A 3I97A 2H6CA 1W9YA 4RS5B 2EICA 4YWAA 1OD5A 4GALA 4MO3M 1WA4A 3THTA 1GFF2 1GQGA 1UYZA 3ZIXA 1REEA 3H8RA 3OGGA 2BUKA 4YGDA 3ZYGA 1WW5A 2ZGKA 4KWUA 3VBHA 2ORXA 2JB8A 4B1MA 1FNZA 4AAXA 5JCTA 1QEXA 2RM23 3PUHA 4Q0VA 3G6JB 1RUJ2 1JZ3A 3RGBA 5FZ0A 2W52A 1CN1A 2R043 2DUQA 1C57A 3MGUA 4PI2A 3F95A 1QH6A 2R072 3LAGA 4HMZA 4LITA 4Q8LA 5EPAA 3M7AA 1QJY1 1PIV2 2VQUA 1XE0A 2JDMA 3D8CA 2PAKA 1UIJA 5EJ3A 5LCWL 1DLCA 4QU1A 3MDPA 4AFDA 2XG3A 1KXGA 5HXVA 1JS9A 2LUWA 2XH6A 4Y26A 3AKTA 4B4RA 1HN1A 1LGNA 4CE8A 3SCFA 1NCQC 1W0OA 2GN7A 5FYYA 4DY3A 1Z7S2 1DYOA 2BVBA 3DN7A 1DZTA 1YJKA 1KDMA 5ABJC 3NV2A 4A7KA 2BW8A 2OPKA 2UWAA 1WMXA 1LHVA 3IPVA 5EP9A 5ANNA 2WR9A 3ATGA 4W6XA 3FBYA 1LOGA 2B4KA 4I02A 4L11A 4NPMA 3WQ1A 1OI6A 2YC0A 4S2HA 3TYJA 3H7YA 3RZKA 4ZS3A 3GHNA 3T0DA 3ZXFA 1OVSA 1CAWB 2EXHA 1FI2A 1MR5A 4E4DX 1VPHA 2RDRA 4AQTA 1FXZA 3TEYA 3SEPA 1ZZ7A 2IFWA 3B9CA 1S0IA 4HVOA 4YG0A 4NHLA 3WG2A 1ZRIA 4BYYA 4UBHA 5C9AB 4YVSC 5I8TA 2JG9A 3EO6A 1A8DA 5FY9A 2BERA 1BJQA 4E8DA 5C3RA 4Q4Y2 2AZ5A 4V2VA 3N9QA 2JG9B 1J1TA 1IKQA 5DG1A 1BBT1 3ZKYA 1QJY3 4SBVA 1YUDA 2JG8C 5JPNB 3DXTA 1AL0G 2MEV3 2ORZA 3JB8A 2GNDA 3KMHA 1ULDA 2WQ8A 1V6JA 2VMCA 1F31A 4NWVA 2VCAA 2E31A 3AYDA 1UZWA 4CXWA 1LAJA 2BU9A 1YWKA 1PVC2 3OBTA 5C5TA 4P00B 1ZM1A 2DF7A 2XVKA 2DTWA 5EYYA 4COYA 4XFFA 1K5JA 4QX0A 4FAGA 1ULGA 4R4ZA 2ZZQA 5C6CA 2O8OA 2WJSA 1LODA 1RUD2 3B5LB 2V09A 3I59A 3MUY1 4N53B 4R9AA 1TZOA 3VV1A 1F5FA 3WX5A 1RUG1 5DAQA 2VULA 1O8SA 1VRBA 2Q1ZB 3N7LA 2PA7A 1UU5A 5DG2A 4AG4A 3ZSKA 2P1BA 5EV7A 1AL21 1XBFA 5EJZB 3I2OA 1DDLA 3UNPA 3MO4A 4IDZA 1IKPA 2BEOA 2Y6KA 5F6KA 1GV9A 1L7QA 2K0GA 5KHHA 5FXZA 3TN93 2Y33A 2BOJA 1SFYA 5FZOB 4QX2A 4RHV1 2WFF2 3WZ1A 1OT5A 3APBA 3IWZA 3J7MA 2B39A 2KR2A 2AUYA 2PHWA 3OYWB 3ZSMA 1AXKA 3ROUA 5LY1A 1BVVA 3JU9A 3J7HA 4A7ZA 4XTPA 2J22A 1QJU3 5JSPA 1G9CA 2ZXQA 5L36A 2WLQA 2RE9A 3U4SA 3VZKA 4C90A 4DRVA 2FCUA 2TNFA 1DGWA 2D93A 4X8PA 5E1RA 4Q4W1 1HRV1 4XF1A 4UT5A 2X5IB 2Q8CA 2P5BA 4XURA 4PIXA 5A1AA 5FV3A 1VJ2A 3VBUB 2DVDA 4D7YA 5C8CB 4YLZA 1UX7A 2W9XA 2ZS6B 1OURA 2YYOA 3AJYA 4FPHA 3IBMA 4LBQB 1OFNA 3ST7A 4BOWA 2JENA 1VBC1 4AGRA 1MPXA 4I0WB 4AQSA 2GP3A 5HI0A 1XU1A 2VQTA 3TNPB 1BEV1 4D3WA 4LIUA 5ACA2 3KVAA 3K77A 4CVUA 2CTVA 3LPGA 5CAZA 1W03A 4NWWA 1YNAA 5LA0A 2SLIA 2Q8EA 2QQIA 5FTTC 2DVAA 1NY72 3ACGA 3EB7A 1C1FA 1RINA 1MS9A 3BCWA 5FXXA 1VRH3 2V4AA 1OHFA 1X9TA 3AFKA 3I2JA 1R082 2XKOA 1AX0A 3USSA 3WQ0A 2LW8A 1UX6A 1V6KA 4NROA 1OSGA 4GWMA 3UJQA 1PHMA 5JSOA 1Q8PA 2KXLA 4CDXA 5J3UA 5LB6A 1W6MB 4BMBA 1W2AX 3Q9OA 2LRPA 4I3GA 3UGHA 1RUH3 3NNJA 5FKBA 2CSGA 1ODNA 1XJAA 1H30A 1O4YA 2PLV1 4WM7B 3FHAA 5A6XA 4RGKA 4RHV3 1KJRA 5J36A 1RMU1 5T5OA 3PVNA 1MQTB 5C5UA 4XDQA 1PM4A 3MIFA 5C33A 3E97A 1AXZA 1ZZ8A 4MHRA 2EIBA 3BB6A 1R1A3 3PJYA 5FPBA 5GJ6A 5A3MA 1H9WA 4LKEA 4Q4W3 2IVIB 1HRV3 3HT2A 4W65A 2CAVA 1G9AA 5GZFA 4LTAA 4CCCA 3O1SA 4W4ZA 5FY1A 2WIIB 2RS31 4HANA 4HBNA 4Q4X2 5FZ1A 3MFCA 5CU1A 4E4SA 5BNOA 2DCTA 2O14A 2ZAHA 3K48A 1ALYA 1RHI2 4WZCA 1DYPA 1W2TA 2XLGA 3VZOA 5C4WC 3MF6A 3MPBA 5IK7A 4UFMA 3SEEA 4OUMA 3FX3A 1D0GA 1XNAA 1VBC3 2ID4A 1YHFA 5F7UA 1HX6A 1ULOA 2FZ1A 4JZRA 3M70A 5G04L 3E5QA 4CDXC 4CEWC 3JZVA 3FLRA 2GC1A 3TAYA 5T54A 1G86A 5EXOA 4IGQA 2HWF1 4ISRA 1RYYA 4NUBA 1O59A 1NUKA 5IVYA 4QPGB 1JYTA 1DGRA 1KJLA 3T4HB 2ZEYA 4UBGA 4YW4A 5C3PA 2JE8A 3RZZA 5FREA 1MS3A 3DPRB 1UY2A 5CFCB 1ULPA 4DFSA 1GZWB 1VB4A 2W47A 3OSDA 4H14A 3KV5A 3K4DA 4KNCA 2PLV3 3ZO0B 1GR3A 3LOIA 1RC6A 1W9SA 5FZ4A 3NKTA 4LR4A 5HCAA 1MS8A 1W3VA 3Q8FA 3UESA 5A1FA 2B7YA 4HLTA 1RUOA 1WKYA 1EUUA 2X10A 5BNOC 4WZFA 1S2EA 1N47A 2AREA 5F3GA 4O9EA 3JBG1 1VBB1 1CAXA 3P3NA 3VBSC 3AP7A 3RMXA 1EAH1 2WT2A 4QGNA 1GOFA 1RUC1 4LA2A 4TWTA 1COV2 1V0AA 3IAPA 3ZFFA 1VBE2 2BGCA 3ZXAC 5IHRA 2ES3A 2VNGA 2W68A 1TVGA 2ZGPA 5FO9B 1XNCA 4FQ4A 1QKQA 2XMLA 3O1TA 3UGGA 4PJYA 3RQ0A 3CHXA 1Q8OA 3MV11 5JUVA 4H3WA 3VKMA 3BI3A 4COUA 5H9PA 1GQPA 1K5MB 1V6IA 2C24A 3FWEA 3GXUA 5JXHA 2LROA 2VNOA 2P4EA 2A75A 1AJKA 2YB7A 3DCQA 5CB7A 1E5RA 1HRI2 2J1UA 4BQ4A 4BH9A 2VUCA 1POV0 4FPLA 1POV1 1UYPA 4G3YC 4N7IA 1V6LA 3ACLA 3LA2A 2ZGLA 3GJBA 5I0RA 1NZIA 5FUPA 3BYWA 3QCWA 4Y3OA 1XE7A 2TEPA 4JQTA 1BXHA 2F4PA 5LRSA 2R49A 2ZTNA 5LBFA 2GH2A 4LLOA 1PO22 4K21A 4UFHA 4P9GA 4G4FA 2W39A 5K4LA 3RVHA 1G9DA 5F5IA 3CZJA 2QFEA 3IDCB 4N43B 2JDAA 1CVNA 3AB0A 4F3JA 1H2LA 3OD4A 4GH4A 4JKLA 3C3VA 5T5LA 2YXSA 4LBMA 3ILNA 4JGYC 4X8NA 1JZ4A 3OBZA 2WS93 1TE1B 4MVTA 2RVAA 4CP2A 1DQ5A 2J1AA 2XOMA 3ZFFC 3WT3A 4D0QA 3POEA 2RV9A 2MNGA 5AVAA 2X8KA 1MEC1 1W0PA 5DAXA 3WNPA 5BY5A 4D7SA 2GN3A 5IVCA 3FBMA 2XWJB 4FP2A 2CY6A 4R9CA 4CDWB 1NQJA 4FOVA 1UD1A 2VUAA 4XF4A 1UWWA 4B3NA 2XVGA 4BXSV 1K12A 4I30A 2AENA 3ACHA 4Z82A 2OIIA 4QQ2A 4KWKA 5FWEA 1OLQA 2WZEA 3OBRA 2Y64A 3OOXA 3QLQA 4K6BA 4DOUA 1V70A 1HB4A 3LCPA 3LEGA 1XSRA 4M3CE 4EZHA 3ITQA 5ISLA 3MPPG 3Q8CA 1LKNA 1OF3A 5L9BA 2VZOA 5FPUA 1LHUA 3RWNA 1LEMA 2WYSA 4A42A 5DZFA 2J1RA 1VALA 3AJZA 3ELNA 1OC1A 2ENRA 3H3LA 4O65A 5SV5A 2YV8A 3M4FA 3T2OA 3E6DA 2ZHMA 4QHZA 5A3TA 1BBT2 2D6MA 1KQRA 1RITA 2WYFA 3HJRA 5CADA 3CU7A 2A6YA 1RUJ1 4D6RA 1GKBA 2PAMA 1DCSA 4Y5TA 3VUOA 1AR71 1JHNA 3O1VA 4NIHA 1UN1A 2R071 4DB5A 5KHIA 4Q1PA 4GZ9A 3OY8B 1T6GC 1AR93 2QKDA 4CCDA 4CP9B 1NT0A 2QQMA 3EMRA 2LM3A 2HJIA 2WNUA 1V6MA 1VR3A 1RUG2 1ENRA 4NHKA 4XUNA 1XB9A 4AEMA 2N7GA 1W8HA 3S5AA 2R0HA 1U5YA 3BU7A 5JR2A 1AL22 4I2OA 4FPGA 1OLMA 4LT5A 2D3PA 3AYEA 2VUJA 3WVJA 3KGLA 2VM9A 1GICA 1T6BX 2GZWA 4RD7A 3ZXLA 4A44A 5BPXA 2BQPA 1H4GA 1I9RA 3PHMA 4EN7B 2WWJA 3VBOC 4FOYA 3ZYFA 3MW2A 4Q0QA 5F9TA 3ES1A 3PMSA 2YFZA 2RDNA 5C70A 4QX8A 3GGLA 1N3OA 2ZA9A 5LY2A 1E5HA 1YIFA 1DQ6A 5F5AA 4QB6A 1S1AA 3NNGA 1SEFA 4CCOA 1PK6C 2YBKA 1Z78A 1APNA 2DURA 2GC2A 3WUDA 1UOJA 2L9LA 2W08A 3VN4A 2W1WA 2W0XA 1FOD1 4DNYA 5AC91 3I3QA 2DV9A 2OPWA 5JOYA 1SLTA 3R6SA 3LPFA 3H8UA 2E7AA 3AP5A 2DBNA 4HETA 3N9OA 3ZMOA 2XJUA 4FXGB 1LOAA 4YSFA 2C5DA 3M3QA 4QX5A 3EXUA 4LBLA 2Y6HA 4FOQA 1J84A 1VBA2 4JGZA 1NA1A 1STMA 4KGGA 5DUWA 1RUJ3 5FPAA 1L7LA 1WZXA 3B9IA 3THDA 1MVQA 3ZFGB 1BEV2 2OUJA 3S6PA 3M3IA 1I3HA 1HB1A 2R073 2W95A 4Q4Y1 2UYAA 5FMBA 2IC1A 1XPWA 3WW3A 2FDJA 4AF9A 1LHOA 4LHSA 3ZX7A 1PIV3 4UYBA 2WT1A 4AI8A 4TZDA 3LSDA 4BXFA 2E63A 5B4XA 3VZLA 5L9VA 3RG0A 4JHZA 5C8WA 1OFSA 3DYOA 5EIYB 3JXSA 1H1AA 1GYKA 2G9FA 1O5UA 4JRAA 1OA3A 1B35B 5CA6A 4ES8A 1Z7S3 4P14A 2Q1MA 4ZU5A 2OS2A 2P3YA 2ET7A 1ENXA 4M01A 4X6QB 2JE9A 4XTMA 3WP5A 1RMU2 3F2ZA 1S0GA 4AL9A 2WA3A 1WW6A 2Q5TA 3HNBM 3OTFA 4LBQD 2WNOA 3H1MA 4JX0A 4OZOA 1XC6A 3NV4A 3KLSA 4XDOA 2ZX0A 4AQ2A 5FDBA 5I0DA 5T52A 2JDNA 3GCWA 3WV6A 1PZ7A 3B93A 4UW6A 2CDOA 1XRUA 1AUYA 3HD8B 2QQVA 3K3OA 3BPZA 5A3OA 4MSVA 3USUB 3BUCA 1LEDA 2JICA 3OB8A 4JDOA 4BQYA 3MIBA 1GZTA 2GMMA 2RS32 1S2BA 5FZMA 2UYBA 3ON7A 4B4QA 4BQWA 3MLJA 1RJ7A 2VVEA 3LGRA 4LBNA 1CONA 2PN5A 2OZ6A 1X82A 3DGTA 2ZGSA 2DVGA 4Q27A 4CDUA 3O1UA 3PUIA 1UKRA 5KHJA 4LHLA 2VECA 4UFIA 4HN1A 3U75A 1V9U1 4QPIC 1XYOA 3DUIA 3N7KA 2YC2A 3NAPC 4S2FA 5JOZA 2QQNA 4PDWB 1DLLA 5C4WB 4Q4Y3 1SPPA 3B00A 3OUHA 1DYKA 4A3XA 1OUXA 5HPOA 3AKQA 3SLIA 4NAOA 5FK7A 2XBO2 3ZR6A 2HWF2 4E9KA 5FXVA 3T4VA 1P8JA 2F17A 3PUSA 2ERFA 1A8MA 2VO5A 5L7OC 4B1LA 1PVC3 3C7GA 1PGSA 3H3ZA 4OI1A 3UV9A 3I2HA 4FFGA 3M1HA 4N9IA 5FZHA 1UU4A 4FOWA 1OOPC 1S0BA 5LATA 1NY71 4BQXA 4LIVA 1RUD3 1RL3A 3I3EA 4FFIA 4XBQA 4CU9A 4CU7A 2UY9A 1QXJA 1TEIA 3U1XA 4L92A 3KT7A 3JQXA 1D4VB 2FQPA 3PVEA 3R4UA 2YMZA 1IPJA 3Q8BA 4EWDA 4NIIA 2ZHKA 1MVEA 3M3EA 1YFUA 3KVBA 4LMFA 5FY0A 5IK4A 5TSWA 1N1YA 2CAUA 1UZVA 5GKAC 2P34A 1ZX5A 2Y6FA 3WDXA 4Q2FA 1RUNA 1LCLA 2XQRA 4MOAA 4X6RB 2Q30A 3JUUA 2WFF3 1IZ3A 4CDUC 1TNRA 3LFMA 4GWIA 3N35A 3JBG2 1VBB2 1W90A 4J6GA 4W8JA 5JZGB 3RZMA 2WC2A 3THPA 2UU8A 4NPLA 1EAH2 3O12A 1JYNA 4YW1A 1RUC2 2VE1A 3R4SA 4LO4B 3CJIA 3VB9A 3W9AA 4XFHA 2ZHLA 4Y1VA 5T5JA 5L19A 4ZY9A 1FMD1 2WDBA 4QDSA 4UW4A 3VDDC 5DMYA 5JXJA 1E5SA 5CFDA 5A7QA 1J58A 4QWNA 1LHWA 3VBRB 3ZXGA 1AVBA 2VW0A 3KF5A 4HT1T 1W28A 3SCHA 3WHUA 1HQNA 1RVF1 1GUIA 3DF0A 3MIHA 1SDDB 1NXMA 2BFUS 1RHI1 1UY1A 1ND3A 2W87A 2RS53 2CDPA 2PHUA 4LLFA 3S57A 3WNOA 2ZGQA 1K45A 4OMDA 2PYTA 4K7JA 4TLGA 5GZCA 5A70A 1YQ6A 3E5XA 2OQ6A 5AFBA 2R16A 3I3MA 2X53S 1NE6A 3A4UA 3KQ4B 3MIEA 4Z2WA 2G9GA 1H8TC 2D5HA 5ACA3 2HWC2 5K0UB 1SLLA 5LASA 4DUWA 4CCJA 2XONA 3FMGA 4UF0A 2PAEA 1WLCA 3FJSA 4XDPA 3I2DA 1ZBA2 5FUIA 3EQEA 3ABZA 4YM0A 1R083 2PHFA 3POSA 3RI8A 3A22A 3J4UH 5GLUA 1CPMA 3ZN4A 5B2GB 5C3QA 2JKBA 2HYXA 4TXWA 2JX9A 2WSUA 1UXZA 3BTAA 3CLPA 5F37A 4LO7A 1YQ8A 3PJQA 4AHWA 4NIAA 3IIIA 3FN9A 1XSQA 1X8MA 5BUVA 1LNSA 3LZZA 1H6YA 1WW7A 4XEZA 5FYBA 3FFQA 3KZ4C 2VTXJ 5F3EA 3WR0A 1UO9A 1MEC2 4YW5A 2ETEA 2A3XA 3WNLA 2BYVE 2DCZA 1N3PA 3RRDA 4CUCA 4HKLA 2WN3A 4K8FA 3LFIA 5A3UA 3GBWA 3ORJA 3MFAA 4YG3A 4LBOA 1D4M2 4GJYA 4YNIA 2B5HA 1W6QA 1EP0A 3AMQA 4TTGA 4JKKA 4ASLA 1WCUA 2O0OA 4IXLA 1W6NB 2XUEA 3WDUA 4XQWA 3T2TA 2JDYA 4WVMB 5JOXA 1TME2 1R64A 3OJBA 4G9SB 4CRQA 4Q4X3 4UWDA 1JI6A 1VBE1 1NCQB 2HLEA 2VBPA 1RHI3 2AR6A 1Y7BA 4CSWA 5ABJA 2PHLA 3U14A 1H0BA 4WVVA 2WWSA 3TEWA 1X33A 1VE0A 2DWRA 5IJRA 4D8MA 1ODMA 2Z2SB 1UXXX 3O1PA 2ADEA 3POYA 4EZ4A 4QGLA 2E33A 5GZEA 5IAXA 4YGBA 4BLIA 3L2YA 5D21A 1RGSA 3D4KA 4BMEA 1UOGA 3R0RA 2FCVA 4IEYA 1HRI1 5F5CA 2WNVC 3VBHB 1D7PM 3J8F1 1O3TA 1CR7A 2DUPA 3WG4A 5CKMA 4P9YA 3BOPA 2DVFA 1AR72 4NE9A 3T0BA 2J1TA 4AVSA 2BVVA 1A6CA 5EFUA 1RXGA 1GWLA 1Q8QA 3BOWA 3WF3A 1LECA 4OFGA 1IQAA 4AI0A 2FHRA 4CDQA 4EN8B 1PO21 1DQ4A 3V0AA 1GNZA 4YVSA 2IXJA 3AK0A 2SBAA 3WG3A 3U78A 3O7OA 4OUEA 3KV4A 3N9LA 1GU3A 2D6PA 2JG8A 5DAVA 3NJZA 3VLBB 3ZPYA 4AQ6A 4R52A 3I7DA 2Y60A 4MYEA 4XYXA 1VBD1 3B01A 4MGIE 3MV01 5F3CA 1HV0A 3HIFA 2BBVA 3JCIA 4MX3A 4S2DA 1LRHA 3MF9A 1TG7A 2MPFA 4TN7A 5DDJ1 3WSOA 2OW4A 4KGQA 4MG2A 1DG6A 2HWE1 3WP3A 4AHYA 2JIJA 3E6BA 3IPVB 1COV3 2QE3A 2R062 3GZUC 3M3CA 2BNMA 4HVRA 4QX7A 1BVP1 1VBE3 2QQWA 1OMIA 2LALA 2QZ3A 2HWB1 4AZZA 4LORA 4NMIA 4JVAA 1YEWA 3AVRA 3VD5A 4F8AA 5AC92 3ALQA 1FOD2 3NV3A 4XUPA 1LJ7A 3R4DB 2HWD1 4FPYA 1Q43A 2VAUA 3J7LA 2Y34A 3WLUA 2BGOA 1DIWA 5JIUA 3H8XA 5BYNA 3LIGA 2OA2A 4QD2A 1HRI3 2KA3A 4QAWA 1XE8A 5LBCA 4CDQC 2KM2A 1YYNA 1ENQA 1UQXA 1WD3A 3FFZA 3VD9A 3AKRA 3B69A 3POBA 3SCGA 4QM9A 1JZ8A 2NMNA 2VOWA 3A23A 1POQA 3IM0A 2DCJA 2XJRA 1UW8A 5A6QA 4YVWA 1PO23 2Y38A 3HQUA 5KBFA 1HN0A 2PQQA 4LKDA 5FYHA 1LGBA 4XBLA 1SBDA 3BU0A 1MS1A 4IE6A 1QJX1 3N9NA 1GZCA 2YG0A 4P5YA 1AX2A 4NRQA 3ZN5A 2QVSB 4HSLA 3PTYA 3KCXA 3SQOA 3I59B 2YUEA 1CIWA 2EVXA 2Z4FA 2VZPA 4QB1A 5M0TA 1G8WA 4QXCA 1J83A 2I45A 4Q0UA 1LR5A 4ISQA 4C91A 1W8WA 4FQZA 2V72A 2HEWF 5DN2A 5KC5A 2RDSA 1IPSA 1WBFA 5I91A 4NRMA 4L0PA 4H2AA 2QBXA 2VOXA 2AEYA 2V4VA 4JHTA 3SNMA 4HVQA 2JKXA 3NV1A 5LBEA 4ITCA 4Q8KA 5LBBA 1OQDA 1CPNA 2WO2A 3WW2A 4XJ8A 3SKJE 2FDGA 4MHUA 4OHVA 2FMYA 5A3WA 3ILRA 2GMPA 2BFUL 4YVWC 1X7NA 1DFQA 1V9U2 5FZLA 1IHMA 5JMCA 1H4HA 4LA3A 4CP0A 3MIGA 4Z07A 4L97A 2YPDA 5LA1A 4CCNA 5A7NA 2Y8KA 1NZCA 1W8ZA 4AGGA 4K1YA 1BMV1 4W6WA 5IATA 2X09A 1BBT3 3AYAA 4QPWA 3INAA 5C9AC 1XQNA 2YHJA 1VBA1 3POWA 5A7OA 4YZ4A 5HXMA 2V5YA 5FMCA 2WLPA 5FOJB 4WBBA 3AZZA 2ZJCA 3GBFA 2D97A 3AFGA 1WW4A 1QY4A 1RUE2 3ECQA 2FD8A 1EV12 1OA4A 2VZUA 1PX4A 3JQWA 4J1XA 4CPBD 3R05A 4DMIA 3Q8AA 2DFBA 1RUG3 3D82A 1WLDA 5JVVA 4AVVA 2FDFA 4CCLA 3QACA 1W6OA 4YW2A 1UL9A 4FFHA 2NQYA 2EIGA 1WA6X 5KR7A 4N53C 1AL23 1SZBA 2BBAA 5FY5A 2YU1A 4CEWA 1H8VA 2B9UA 5D8AA 1RXFA 4C0HA 4CDXB 5A32A 2Z79A 3M3OA 4AVTA 5A32B 2D6KA 2W92A 4Q0PA 4HK8A 4XPVA 3PUAA 1AXYA 5IK8A 4KMQA 3T2PA 5FP9A 3PIGA 5KXCA 1ASJ1 3OUJA 5FYMA 1ULFA 2UY8A 2VZRA 4ZU7A 4CXXA 3J7NA 3BALA 3CMGA 1Y9GA 4GMP0 1IGOA 4GMP1 2ZMNA 1FMD2 1PZ8A 4OULA 2ATFA 2P2KA 3FHQA 4QQOA 1YFWA 1QXRA 1HB3A 2VQ0A 3H1YA 2B42B 4FPOB 4QKFA 2NP0A 5FQ0A 1G9FA 4Y5Z0 1DGRN 2VMDA 1AR81 1RVF2 1JOJA 5LEJA 5BNOB 3H7JA 2H0VA 5CBLA 2IXCA 3VBSA 4OI4A 4XJWA 1VBA3 4LO5B 5JOWA 1AYN1 2B9VA 1MZ5A 2PHRA 1BEV3 1AX1A 2ZAAA 3ENRA 4JKMA 5HBAA 2ZEXA 3SISA 2ADDA 4BDVB 1YO8A 3NL1A 4BHPA 2D7FA 4Z92B 5D8AC 2V73A 3I2FA 4AFMA 1CAUA 1JU4A 2XBO1 4XMIA 2ZKNA 1UMIA 4EN9B 1R092 1VB2A 4EE2A 1VMFA 2OT7A 5FPVA 4FSJA 2NN8A 4AFAA 5FZIA 3GZEA 3NJVA 4OLLA 3WP4A 5LEKA 1NXD1 1Z0HA 2XUMA 3PUQA 1CQ9A 5FYUA 3TWIA 4AOCA 4XJUA 3WG1A 3AVSA 5KHKA 1FX5A 1MZFA 1H1IA 1S4CA 2JIGA 1RMU3 1KDKA 2W1UA 2ZACA 1OXCA 1WMEA 2C4XA 3VZMA 1VAMA 4XFGA 3MI8A 2P3IA 4HZFA 1EPZA 1CAVA 1JYWA 2WO3A 3ZPOA 5C3OA 3WINE 1XOYA 1MQTC 2UWCA 5FLJA 3T30A 4XABA 3V0BA 5FJKA 5FYSA 1JXNA 2A7AA 2QQKA 2XL9A 1CAXB 2RS33 4JGYA 3OPWA 4QMAA 1DF0A 5G05L 3IB3A 2ZBJA 4GWJA 2ZZJA 4D7TA 4OMCA 3S5QA 4PLOA 4HL0A 3URFA 1NLSA 1H2MA 1N1SA 1OH3A 5EWSA 2WFPA 1QQP1 3ZFFB 5C71A 5EHDA 1W2UA 3AMHA 2BWAA 4E4ZA 5FZEA 1WLWA 4A4AA 4F7ZA 2CGNA 5FYZA 2ZGTA 1ZZ6A 3GZTB 3P1IA 2YPJA 5DXDA 1AF9A 1KFUL 1U12A 4H7MA 4IV3A 3E1F1 4Y1UA 4D94A 5A7SA 4YZ5A 5LZ6A 1SACA 3PL0A 4PIZA 3D3AA 2PHXA 3RZJA 2B45X 3AP9A 3J8F2 4CCMA 2YFUA 3ZN6A 2XBO3 2HWF3 2DBIA 3GHMA 1NX9A 2BDRA 4EV0A 1ZA7A 1OBNA 4EJRA 4WVWA 2HWC1 1QIQA 5IVVA 4RSUA 5T55A 4BB3A 2J42A 3FE5A 2BOIA 3AXEA 4RQPC 2LTNA 2C9KA 2DDUA 2QDNA 2VUDA 2YBPA 3WW4A 4LHNA 3ZFEA 3ZXJA 4HPKA 1ZBA1 2EF6A 2DFCA 2VZ3A 3A0KA 3LEIA 3A21A 3KS7A 5FO8B 4BWOA 4P9XA 3PMEA 5HV4A 3NKGA 2W2IA 1NCRA 4M4PA 4YG6A 5T50A 1KS5A 4GH4B 1HJGA 2VMFA 3QH7A 3KHBA 3VDAA 4Q1RA 2IXKA 1VBD2 3FUQA 5GLZA 3ZR5A 3GNEA 2RJKA 3PTRB 1SLIA 3OCPA 2VQAA 4GD4A 5DDJ2 3JBG3 1VBB3 1IOAA 5DAWA 3GJAA 2A73B 3BKZA 2VZTA 4DPNA 1EAH3 2HWE2 2DVBA 2JDZA 1RUC3 1DGWX 2R30A 3NW4A 4KL1A 3WY6A 1RTVA 1D4M1 4IV3C 2ILMA 2HWB2 3MLLA 2AACA 4BQ3A 1ST8A 1F9KA 1HJFA 1TME1 3MLKA 4LE3A 2LS6A 4MGSA 5FZBA 2HWD2 1ZREA 2PHTA 1U5XA 1VMJA 3ETQA 1E5IA 2VR4A 2GC0A 1LENA 1JW6A 1ND2C 2JB4A 3AMNA 3HT1A 5GLVA 2VMEA 3ETPA 3M8LA 3VBOA 1ZNPA 3FLTA 4AEKA 3VD3A 3T2QA 3W20A 4LUMA 2RMU1 1POV3 4PF1A 2A6WA 5F8PA 3ZFEC 3ZVXA 2X29A 2UWBA 2NYYA 4IV1A 2JE7A 3L9JT 3WEZA 2FBEA 2HWC3 1PK6A 1DQ0A 1XNKA 3ZYBA 4YZ2A 4IERA 1M4WA 3OGJA 4CU8A 1F8VA 1NCRC 1PK6B 1FT9A 4Q29A 2W91A 1HQWA 2PTMA 1ZBE1 4ZXEA 1ZBA3 4QDQA 1H2NA 2YGLA 4K1ZA 4XETA 3T0AA 4LXLA 1JH5A 5CVRA 1UY4A 4AFCA 2OKXA 1QJX2 4B7EA 1JYCA 1QNYA 4O61A 4DUVA 2BNNA 2PXJA 3GF6A 3QBQA 1GWMA 4DXRA 1W8FA 4N43C 1DQ1A 2WNUB 3SKVA 4IQPA 5I0SA 1PNFA 5ANQA 1KITA 1MEC3 1OKQA 4XAEA 1U0AA 3NMBA 5GZGA 3PIJA 1QJZA 1G9BA 1ACCA 4QKBA 3DYPA 4EWEA 1D4M3 1JOPA 3LA3A 4XC9A 3VHNA 1J3QA 5LRRA 4CEYA 4BQ2A 5IVEA 4ZZ8A 3HQRA 1XNTA 4QHBA 1Q8VA 1C3HA 1TME3 2JJ6A 2YC4A 5A7WA 1PGW1 3BTZA 1PGL1 3GM8A 4YRDA 4IV1C 1RUI2 2R061 3J9SA 2YGMA 4UFJA 4AI9A 4AWDA 3EYPA 1E57A 4AAPA 3DYMA 5JWPA 3MW4A 4Y20A 4MGZE 2E6VA 1OD3A 3V65A 5A6ZA 2XHKA 5K8SA 5IW0A 1GOGA 3I54A 3VL8A 4YFWA 5H9RA 1SDWA 1SQ4A 4BZ4A 3VD4A 5JSRA 5C7GA 1BMV2 1REFA 5FZCA 3LEMA 5F1RA 3NJXA 5FZGA 3MIDA 1G6NA 1GP5A 2WAAA 1CX4A 2RJLA 1QOSA 4Z2AA 3CQOA 1PO12 3RYRA 1AR73 4JGZB 1NA1B 4A7YA 2AC1A 2HH9A 1O4TA 1WBLA 2P6HA 2VD7A 3NQHA 4Y33A 2CGOA 2XJSA 2H6BA 4QPIA 3P6BA 3WNKA 1W8NA 5CISA 3NAPA 4NHXA 3KCCA 4ZONA 4P08A 4Q4V1 4JRLA 1Y9MA 4QPIB 5JAXA 5IVFA 4M3CA 1C8M2 1X50A 3RNSA 2RS11 4Z8BA 3ZMNA 3OEAA 4CEYC 1QXPA 2VMIA 1UZYA 5D2AA 2NLRA 3KWVA 3N9MA 4ATEA 1KD7A 4BA6A 2HYKA 3FZ3A 2Y6JA 3LSEA 4LE4A 3CDZB 2A71A 2ZGUA 4C0BA 3RWKX 3IDBB 2W5FA 1XXNA 1UZ0A 5L7OA 4GKXA 2PFWA 3MBWA 3POJA 1ASJ2 1O5LA 1OOPA 4AW7A 2IFRA 4IL7A 4URTA 1YQ5A 2R063 1MS4A 1OOPB 3WDVA 3PVOA 1QNWA 2D6NA 5DPNA 4LK7A 4IEPA 3E5UA 4LKSA 1SFPA 5FP4A 3NNLA 4OI0A 1GP4A 2VMHA 4JDNA 3IN9A 5AC93 3AP4A 1FOD3 3WUCA 1LOCA 1YI7A 1C5HA 2RR12 3BN6A 5LK5A 1BLZA 3I2IA 5BXXA 4M0NA 1AR82 1UF2C 3EHKA 2WO1A 3HN3A 3CKHA 4ORFA 3VKOA 1YLLA 4C1XA 5FY8A 4XUTA 1HXS1 2VW2A 4RGAA 4CDUB 4IEZA 3W5MA 1AYN2 2E32A 3WQBA 3RMYA 3K3NA 2AGSA 3M2MA 1SMVA 1F4AA 2QQOA 3UK9A 4QM8A 4CA9A 1UPSA 4IGOA 4O9GA 1JHJA 3KHCA 3VDDA 4OQ8A 2VVFA 2FMDA 1SPPB 4WM8A 1CGPA 1ZRCA 5BNPA 1UNBA 4U36A 4EYUA 1GNYA 3K4ZA 3RI9A 4J1WA 3N36A 4GULA 3SH4A 4QKDA 4AK3A 1YFYA 3S7EA 1RUE1 5FPLA 1EV11 1KFXL 4XJZA 2EXKA 1UPIA 4B4PA 5IVJA 4Y4YA 1W2OA 4BE3A 3W58A 3GDBA 1H8TA 4EQVA 4RL7A 1W8UA 2WRAA 2VXRA 1OPMA 1LOFA 3KM5A 5CKQA 3X29B 1W6PA 3CJXA 5E89A 2BJSA 1B35C 5HCBA 1QGLA 1SBEA 1W8TA 1BQPA 4MGKE 2YROA 4GQ7A 1W06A 2I2SA 3Q8EA 1K3IA 4UXAA 1A78A 3PURA 1O3QA 2VZVA 4JC1A 4BCUA 2A6VA 1TMF2 2WZR2 5FZ9A 1XYNA 3WDTA 1LB2A 1C4RA 2ARCA 4C8DA 3ZDSA 4DRRA 1AYM1 5FZDA 4CXYA 5CNAA 4FPFA 5FP8A 3EBRA 1RUF2 1UY3A 2K2SA 4K20A 2VPVA 1D2SA 1UKGA 5FZKA 3WDWA 5JI9A 3NNFA 4OZXA 3IT8A 3O1OA 3CJIB 1LGCA 1JOBA 1QQP2 5BNNA 1GQHA 3KB5A 1JYVA 4XAAA 1NOVA 4WM8C 5FPZA 5BNPC 5CFDB 1V9U3 3AZVA 4R4XA 2Z69A 4BK5A 4BISA 3HEIA 3VDBA 1OUSA 1DBNA 5DAPA 3VZNA 2EALA 1NLRA 3RZLA 2G4IA 5KXEA 4KU7A 5BNQA 4H7LA 3RFRA 1ND3B 4QXBA 2GAUA 3DXUA 4IE4A 4MH0E 4FCAA 5A33A 4OUSA 3S0MA 4KG8A 4Y22A 1LOFC 1U5IA 2WUHA 5JR7B 2QQLA 3WNNA 2WN2A 1EV13 5A3LA 5H9SA 3H3UA 3UKVA 1UCXA 4LKFA 1S0DA 4HFSA 2ZEZA 4UF0B 2R6QA 4UW3A 2F4LA 4JQRA 1R091 4OCTA 3JD72 2J7MA 3TBDA 1OF4A 4ES9A 4NIGA 2XLAA 2XB6C 2BRTA 1QJEA 2WNVA 3RYPA 1VLNA 2GNMA 1VAKA 4K40A 2Q8OA 3KF3A 5IFTA 3CL1A 3GZAA 4FTEA 4AEDC 3JB4C 3K75B 1EYBA 4PT6A 4XFIA 1DZRA 4DS0A 5BNNC 1IS5A 3SMHA 2D44A 4LO8A 4OHXA 4K9SA 1W9FA 2D6LX 3VBFA 3KT1A 2TBVA 1JYXA 3UETA 2XLFA 4KI5M 1A34A 1JUIA 5D1IA 4LNVA 2CU5A 1Y4WA 1HKDA 1IS6A 2OZJA 2RJ2A 3GYDA 4MXWA 1FMD3 3KD4A 4YM3A 4EN6B 2RG4A 1W6QB 3BPSA 2ZKLA 1BK0A 2PELA 3WDYA 2WBKA 4U2AA 1AJOA 1Q3EA 4YW7A 2R32A 1HB2A 3BODA 3LD8A 2VMGA 4TLFA 3WNXA 5I93A 1PM7A 3K2OA 1RVF3 2CL2A 1XNBA 4RR3A 3WNMA 4HOOA 5LK7B 2CGPA 3VBRC 1IQDC 2AYHA 5ABJB 2RMU2 4UFLA 1NYWA 2A3WA 2VG9A 1W04A 2QQUA 1BZWA 4QQHA 4FFFA 5F6LB 4META 4DXSA 2VOTA 3ACIA 4Y24A 2QQJA 3EJKA 4FAHA 1AR62 2HEVF 4PIYA 1UOBA 1I5ZA 4HN0A 5FZ8A 2EA7A 2UURA 4Q5OA 5FZ3A 2Q8DA 1HLCA 2I74A 3CO2A 1JODA 4QT6A 5FCCA 1JZ7A 1ZBE2 2ZX3A 1QDOA 4PHZA 5J1XA 1R093 1W9TA 3GALA 3SH3A 2EAAA 3RYKA 4RS5A 1YI9A 3H9AA 1QF3A 5FMOS 3OPZA 3RJRA 3QH6A 3OF1A 5FOBB 3SC7X 2X05A 3VBFC 3SHRA 3WW1A 4XZPA 4HKWA 2F6BA 4DINB 4AI2A 3MUZ1 1DZQA 2VBBA 4CDQB 1FV3A 2EXIA 3BIWE 4NO4A 3V0AB 1TNFA 1SBFA 4YVSB 4JTNA 3OBAA 4XQ4A 5T5PA 3B3QE 2WINB 4IEUA 2CYFA 3ZXEA 4CUAA 5FLIA 3UL2A 4I09A 1IS4A 3C7OA 2QUOA 4QU2A 3ZDVA 3H8OA 2JG8B 2W3JA 4ZHNA 2BNOA 2WAOA 2Y26A 3U07A 2XJQA 4K3UA 4RR3C 5IUQA 4BU2A 3U4XA 5FRAA 3T08A 1OKOA 5FY7A 3U10A 2ZOEB 4AFBA 4B7KA 4E8CA 5JXGA 1NE4A 1PGL2 1PGW2 2MEV1 4XCBA 5DUXA 4XW3A 2WKKA 5JPMB 3HQXA 4Q0SA 2XKPA 5E8AA 1OH4A 3U11A 2VCCA 3DKQA 2XHNA 3LF7A 1LULA 1O6UA 2JEMA 1IG3A 5LA9A 4IUGA 2VVDA 3HNMA 4Y1ZA 3W5NA 3CBNA 5ERLA 1PMIA 4HKOA 4RS5C 1UIKA 4ASKA 3HMYA 3BTXA 1C28A 2EIEA 2FDIA 4COWA 4QDRA 5CG8A 3J8F3 4AEJA 1WCDJ 2QCSB 5SV8A 5B4NA 3L2HA 5KWRA 1L3JA 4LOSA 3ZOIA 3TN91 1DP0A 1YFXA 3VBHC 4N8MA 4QKNA 4HXCA 4XF3A 2E7TA 3C7EA 1CAWA 3OGVA 2ZPXA 1MZ6A 1UYXA 5LW9A 1URXA 1WLTA 3D0JA 3LDKA 2TUNA 4GIQA 3SITA 3IKWA 3HWJA 2D3SA 2E53A 4ZU4A 5AVPA 3T3YA 1QJU1 2Q4SA 4Q4V2 4YVWB 4YGCA 2KD7A 2ZABA 4XXPA 1LU1A 2RS12 2HBUA 2XR4A 3ZKUA 1YIPA 2ZCWA 1BKZA 3B94A 2YDEA 2BGPA 5C9AA 4XHXA 1HIXA 5A3NA 3UKNA 4XJ9A 4ET7A 2A70A 1VBD3 4GAZA 1CX1A 3ZIWA 1SLAA 4OHWA 4QQLA 1ULEA 1J3PA
chains in the Genus database with same CATH topology
4YYOA 2MHFA 3N7MA 5DDJ3 4P5HA 3IMNA 1LTEA 2HWE3 3IDEA 4BM8A 2DUOA 2IXIA 3CEWA 3UKTA 4AHXA 4AVBA 2ZMKA 2XWBB 2P37A 2HWB3 4N53A 2WT0A 1UZZA 1W39A 1EPWA 2ZGNA 1DGLA 1VRH1 2HWD3 2WNEA 4QQPA 1RUI1 2YZ4A 5JIAA 5FLHA 2D6OX 4XFCA 1JUHA 3S7IA 1LESA 2QQPA 1HXS2 4MLOA 1RUH1 1CJPA 4H55A 2ZX1A 5HCFA 1FPN2 5KC6A 3OYWA 3NWKA 4E27A 1VAVA 1QH7A 4QGMA 5FO7B 1J59A 1R1A1 4KQ7A 1PO11 2JG9C 2O1QA 4COVA 2X5IA 1GNHA 5FBZA 4CZSA 3AMMA 1QJX3 1S0FA 1UU6A 4HK9A 4GA9A 3VBUA 1B09A 5C8CA 3N3HA 1N3QA 3MYXA 5GALA 1C8M1 3SXWA 2OUHA 2RS52 4LBQA 1FATA 1W6OB 2B46X 2DU0A 3A0NA 2D43A 2E51A 4MZUA 4FXKB 1DHKB 4CEWB 3H50A 1H1MA 5D8AB 1XYPA 4IEWA 4GB32 1Y9QA 1S0CA 2NPIA 3GBGA 3RS6A 1RB8G 2NMOA 2GSYA 4LEJA 5JDBA 4YW3A 4B8EA 3LWCA 2CWMA 5GM0A 1AYM2 1CJDA 3ZXDA 2WA4A 1RUI3 2XPJA 1H9PA 2VOVA 1W6MA 2GDFA 2A6XA 4NVPA 3ZSLA 4QXKA 2D40A 5IK5A 2RR11 1BCXA 2ZGRA 3DL3A 3HAGA 1AZDA 2IXLA 4RA0A 4WM7A 3VGIA 3ZSJA 5FQ0B 4COZA 1O3RA 1MQTA 2BWCA 2Y0OA 2X5IC 1J1LA 1ENSA 1QU0A 5EZWA 4FPKA 2K9ZA 1FAYA 3VHRA 3AYCA 3RSJA 3VBUC 2D98A 5C8CC 3PVBB 4YM2A 3O5SA 1IPKA 3VBSB 1V6OA 2DCYA 4BQ1A 1JYIA 1PO13 4FTSA 1UAIA 1ZA4A 2Z42A 4KWLA 3W59A 2AH2A 1ZZ9A 3H0OA 3LOBA 1ZVFA 5FMOL 4LHKA 3V56A 1S0EA 5EYXA 4EROA 1ZYBA 3WOGA 1CAUB 2R1BA 4OHYA 1C8M3 1V6NA 1VIWB 1GLHA 3P3PA 2CV6A 1OQ1A 1O7FA 5DUUA 1CESA 2GNTA 1NG0A 1WD4A 1QOTA 3AP6A 1N1TA 1WCSA 4FPCA 5I0UA 1ASJ3 1TQ5A 4RQPA 3QD6A 3TRSB 2HKXA 4LUKA 4XFBA 2A3YA 4XIKA 4QPGA 1EY2A 4WM7C 2RM22 4RQPB 3ZYIB 4XQDA 4XF0A 2WQ4A 1WMFA 4NN0A 4GMP3 4XOGA 1QHDA 5CFCA 3DPRA 2R042 1CAVB 4Y1XA 1GZWA 1TMF1 2WZR1 2EAKA 3IIAA 3V0BB 4GKYA 2DU1A 3FUOA 1HQLA 2RR13 1JTZX 1LOBA 3AZXA 4IEQA 3RPQA 1AR83 1RUF1 4JGYB 2VNRA 3VL9A 4AI3A 1WMDA 2ZHNA 4R8HA 5GZDA 4TSVA 2XVLA 2IZWA 3FC0A 2YY1A 2IWGB 4E2SA 1AYN3 2WS91 2C1FA 3LB9A 1KRIA 5H9QA 3KT4A 4PLNA 3KSCA 1WGPA 2IXHA 4FP3A 4FT8A 4IV3B 4DXZA 3B02A 4IETA 5J48A 2D3RA 4MXVA 2D5FA 2BPA2 2ZGOA 3VKLA 1FYUA 3ZN6B 3WCRA 3HR9A 1ND2A 1V00A 3MZHA 1I6XA 4WV8A 1ND2B 2CNAA 2R1DA 3HN1A 4QPGC 1K5MA 3AKSA 1HW5A 2O8QA 1YRZA 1A3KA 3ZFEB 5CFCC 3DPRC 3JD71 4HPKB 3V64A 1O3SA 1QWRA 3MICA 3ZYRA 2A5ZA 2E9QA 5DZEA 1NCRB 2FZ2A 1N1VA 2GALA 4E2GA 1MS0A 4L2NA 1MZEA 1TMF3 2WZR3 1SLBA 1QJY2 4PCRA 2MEV2 4KWJA 4N43A 5BV6A 5FPXA 1G7YA 1RUF3 3AM2A 5KXDA 4FPJA 1QQP3 4F83A 5DZGA 4P9WA 5JLVA 1MACA 1AR91 4JAAA 3AXDA 4KH9A 4L8QA 3AKPA 5J96B 1F5JA 2ZGMA 4XMAA 4ZXKA 4XE9A 2A6ZA 2VW1A 4XHBA 2QNKA 3DV8A 4JDMA 1YXWA 5DUVA 3T1LA 4NHMA 4YM1A 2GC3A 4KG0A 3VBOB 2DYCA 5AFEA 3T1MA 1K5MC 2XL7A 4CDWA 1JN2P 2VH9A 3TN92 4LBKA 4ZKTB 4IV1B 4IEXA 1AR61 1ONAA 4XFAA 3AMPA 4KBBA 2OVUA 3QOPA 1Q56A 3WCSA 4MUVA 4PBOA 1QJU2 1ULCA 2B8MA 3O14A 3JD73 2VOKA 1C8NA 4XF9A 4OI2A 3UJOA 4LBJA 3RDIA 3AX4A 5FFOC 1GANA 4JV4A 2DCKA 5IT6A 1QOOA 1VP6A 5GLWA 4GH4C 1LHNA 2P3JA 2ARBA 4XJAA 1UMZA 4CTEA 5J7MA 4Y1YA 2E7QA 2ARXA 2XGXA 1XU2A 3OY8A 1FNYA 1WUVA 5I8YA 1PIV1 4CEYB 3AZYA 4CDWC 2I07B 1VRH2 3O0WA 5E88A 3CNAA 1SCSA 2RMU3 1RUH2 4Y20B 2VY0A 4P9IA 3ILFA 2P3KA 2P17A 1Z7S1 4E2QA 4IESA 4PBPA 5F5QA 4RHV2 4WVZA 1AR63 4I0AA 3ZXKA 4PLMA 2QDRA 1ZBE3 3PLQA 3B7MA 4AI1A 2XJPA 1R1A2 3S30A 4FTBA 4V1PA 1U5ZA 4GWNA 4OVEA 4Q4W2 2C0ZA 3FLPA 1HRV2 3NSTA 1OLRA 3WD5A 5JI7A 1OQEA 2ZX4A 3H1WA 4EWAA 4ASMB 1Y43B 2HEYF 3VHPA 1GSLA 4DY5A 4FVVA 1OPOA 1X8EA 3NAPB 4YFZA 1LU2A 4M3CB 3NVCA 4XILA 1D0HA 1DDLA 3D0SA 4TYSA 3ZFGA 1VBC2 2WNUC 4PQ9A 4KU8A 3TOJA 5J37A 1QDCA 1SCRA 4P9JA 5I0TA 2BTVC 4Z1VA 5L7OB 1SLCA 2NM1A 1X36A 5J09A 4CYDA 1PVC1 4JCKA 4AE2A 4P9LA 1B35A 1JBCA 2Y0IA 3G7DA 2GH8A 3KGZA 1RUD1 1IS3A 4AVAA 2GMEA 1YJLA 4NOTA 1AHSA 2PLV2 1NQDA 3ASIA 1Q8SA 1O91A 4MV2A 1RIRA 1KS4A 3C2UA 3SH5A 3WQ7A 3ZSEA 3O0VA 3O0XA 1Q5OA 2CWSA 2XJVA 4LO6B 2QJVA 3USUA 1FPN1 2WFF1 4BIOA 3KQRA 3VDDB 4I0BA 3ZFGC 4JGZC 1NA1C 2JD4A 3WXPA 1LOEA 3PNAA 4WM8B 4Q4V3 4YZ3A 5BNPB 4CP1A 3NO8A 4EN0A 4OHZA 1ZRFA 2RS13 1S2KA 2JXAA 2VGDA 2QZ2A 3VZJA 3J26N 1RJ8A 1DU3D 4BLJA 1M06G 1DQ2A 4PDWA 4RGGA 1PNGA 5C4WA 1I1EA 3D6EA 4RFT0 4FO9A 3MEPA 5CIRA 4HSJA 1H2KA 3ES4A 3I4IA 1WCKA 2RS51 1BYHA 1H8TB 2GU9A 4L9BA 3TB0A 2DTYA 1W6PB 4AYUA 4BIFA 2WQZC 2ET1A 4I01A 1GZ9A 4GB31 5ACA1 4N90A 1ZRDA 1HV1A 1MS5A 4XXAA 3K51A 2JECA 4YARA 1R081 1C5IA 5K7PA 1J3RA 3CF6E 4AEDA 3E6CC 4XIOA 1D2QA 4AEDB 1HXS3 3N7JA 4I3PA 3VHOA 5BNNB 4AGVA 4AVCA 2WS92 3N4MA 2Z5WA 3U0ZA 3LKJA 4SLIA 5JZGA 4M3CF 1FPN3 2GNBA 4ONUA 3ZYPA 2NZ9A 2RHPA 1SFNA 2C9AA 3ZYJB 4PDWC 4LULA 1S0JA 2R0FA 4Q26A 4INDA 4DZGA 1F2NA 3VKFC 5C4WC 5KHGA 5A33B 1C1LA 1PZ9A 4R9DA 1QMJA 3KCYA 1RUE3 3VBRA 2WL1A 3OD0A 4Y22B 4ATFA 3DKWA 5K9YA 4QPYA 4DQAA 1R1ZA 4Q4X1 4FPEA 3D5OA 4W6YA 4D69A 2Q0AA 3I8TA 2WZPP 4NR1A 3WZ1A 3ME2A 4M00A 5KXBA 1PVXA 1Y3TA 1ZZCA 2H0BA 2ZX2A 4R9BA 3WX5A 2WNVB 1HDKA 1XNDA 5K0UA 1CD3G 2XJTA 4GXLA 4GB33 4A2UA 3WHTA 4S2GA 3FHIB 1AYM3 3AZWA 2RM21 3TNQA 3VBFB 3LA7A 3MW3A 4N9HA 5JZGC 2R041 5J98B 4MXWB 3RJ2X 1OA2A 4M0HA 1REDA 3WP6A 1AR92 2WSVA 3HBZA 3CJIC 1YCIA 4IEVA 4FBFA 1ZRRA 4B29A 5CFDC 4RR3B 1S55A 5T3NA 3VKNA 4NPRA 2PHDA 4JTOA 4XBNA 4IEOA 4YGEA 5GLTA 1W6NA 4C1WA 1ND3C 2EXJA 4WVMA 4BPZA 4N7UA 4MGYE 4PF5A 2ZMLA 5L73A 4AXOA 1BK1A 1ZZBA 5CG9A 4UW5A 4L99A 4YZ1A 1NCQA 1COV1 5K0UC 5I8SA 1FV2A 5E16A 1GBGA 1O4ZA 4AHZA 2OYZA 5FAXA 2VU9A 2H6CA 4RS5B 1OD5A 4GALA 1WA4A 3THTA 1GFF2 1GQGA 3ZIXA 1REEA 3OGGA 2BUKA 4YGDA 3ZYGA 1WW5A 2ZGKA 3VBHA 1FNZA 5JCTA 2RM23 4Q0VA 3G6JB 1RUJ2 2W52A 1CN1A 2R043 2DUQA 1C57A 3MGUA 3LAGA 1QH6A 2R072 4HMZA 4Q8LA 3M7AA 1QJY1 1PIV2 3D8CA 2PAKA 1UIJA 5EJ3A 3MDPA 4AFDA 2XG3A 1KXGA 5HXVA 2LUWA 2XH6A 4Y26A 3AKTA 4B4RA 1LGNA 3SCFA 1NCQC 1W0OA 2GN7A 4DY3A 1Z7S2 2BVBA 3DN7A 1DZTA 1YJKA 1KDMA 5ABJC 3NV2A 4A7KA 2BW8A 2OPKA 2UWAA 1LHVA 3IPVA 3ATGA 4W6XA 3FBYA 1LOGA 4I02A 4L11A 3WQ1A 1OI6A 2YC0A 4S2HA 3TYJA 3H7YA 3GHNA 3ZXFA 1CAWB 2EXHA 1FI2A 1MR5A 4E4DX 4AQTA 1FXZA 1ZZ7A 2IFWA 3B9CA 1S0IA 4HVOA 4YG0A 4NHLA 3WG2A 4BYYA 4UBHA 5C9AB 4YVSC 5I8TA 2JG9A 3EO6A 1A8DA 1BJQA 4Q4Y2 2AZ5A 2JG9B 1J1TA 1IKQA 5DG1A 1BBT1 1QJY3 4SBVA 1YUDA 2JG8C 5JPNB 1AL0G 2MEV3 3KMHA 3JB8A 2GNDA 4NWVA 1ULDA 1V6JA 1F31A 3AYDA 1YWKA 1PVC2 3OBTA 1ZM1A 2DF7A 2XVKA 2DTWA 5EYYA 4COYA 4XFFA 4FAGA 1ULGA 4R4ZA 2ZZQA 5C6CA 2O8OA 2WJSA 1LODA 1RUD2 3B5LB 2V09A 3I59A 4N53B 4R9AA 3VV1A 4AHYA 1F5FA 1RUG1 2VULA 2Q1ZB 3N7LA 5DG2A 2PA7A 1UU5A 4AG4A 3ZSKA 5EV7A 1AL21 1IKPA 2BEOA 5F6KA 1GV9A 2K0GA 5KHHA 3TN93 1SFYA 4RHV1 2WFF2 3APBA 3IWZA 2B39A 2AUYA 2PHWA 3OYWB 3ZSMA 1AXKA 3ROUA 1BVVA 3JU9A 4A7ZA 4XTPA 1QJU3 5JSPA 1G9CA 5L36A 2WLQA 2RE9A 3VZKA 4C90A 4DRVA 2TNFA 5E1RA 1DGWA 2D93A 4X8PA 4Q4W1 1HRV1 4XF1A 2X5IB 4PIXA 1VJ2A 3VBUB 2DVDA 4D7YA 5C8CB 4YLZA 2ZS6B 2YYOA 3AJYA 4FPHA 3IBMA 4LBQB 1OFNA 3ST7A 4BOWA 2JENA 1VBC1 4AGRA 5HI0A 4I0WB 4AQSA 1XU1A 3TNPB 1BEV1 4D3WA 5ACA2 2CTVA 5CAZA 4NWWA 1YNAA 2SLIA 5FTTC 2DVAA 1NY72 1C1FA 1RINA 1MS9A 3BCWA 1VRH3 1OHFA 3AFKA 1R082 2XKOA 1AX0A 3USSA 3WQ0A 1UX6A 1V6KA 1OSGA 4GWMA 3UJQA 1PHMA 5JSOA 1Q8PA 2KXLA 4CDXA 5J3UA 1W6MB 4BMBA 3Q9OA 4I3GA 1RUH3 1H30A 1O4YA 2PLV1 4WM7B 4RHV3 1KJRA 5J36A 1RMU1 5T5OA 3PVNA 1MQTB 4XDQA 3MIFA 5C33A 3E97A 1AXZA 1ZZ8A 3BB6A 3PJYA 1R1A3 5GJ6A 5A3MA 1H9WA 4Q4W3 4W65A 3HT2A 1HRV3 1G9AA 2CAVA 5GZFA 4LTAA 2WIIB 2RS31 4HANA 4HBNA 4Q4X2 4E4SA 3MFCA 5CU1A 5BNOA 2DCTA 2ZAHA 3K48A 1ALYA 1RHI2 4WZCA 1DYPA 2XLGA 3VZOA 5IK7A 3MF6A 3MPBA 4OUMA 3FX3A 1D0GA 1VBC3 1YHFA 1HX6A 2FZ1A 3M70A 3E5QA 4CDXC 4CEWC 3JZVA 3FLRA 2GC1A 3TAYA 5T54A 1G86A 5EXOA 4ISRA 2HWF1 4QPGB 1DGRA 1KJLA 4UBGA 4YW4A 3RZZA 5FREA 1MS3A 3DPRB 5CFCB 4DFSA 1GZWB 1VB4A 4H14A 4KNCA 2PLV3 3ZO0B 1GR3A 3LOIA 1RC6A 3NKTA 4LR4A 1MS8A 2B7YA 4HLTA 1RUOA 5BNOC 4WZFA 2AREA 1N47A 4O9EA 3JBG1 1VBB1 1CAXA 3P3NA 3VBSC 3AP7A 3RMXA 1EAH1 2WT2A 4QGNA 1RUC1 4LA2A 4TWTA 1COV2 3ZFFA 1VBE2 2BGCA 3ZXAC 2ES3A 2VNGA 2W68A 2ZGPA 5FO9B 1XNCA 4FQ4A 1QKQA 4PJYA 3RQ0A 1Q8OA