1LOCA

Interaction of a legume lectin with two components of the bacterial cell wall
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
180
structure length
180
Chain Sequence
TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEANVVIAFNAATNVLTVSLTYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords LEGUME ISOLECTIN I (ALPHA CHAIN)
publication title Interaction of a legume lectin with two components of the bacterial cell wall. A crystallographic study.
pubmed rcsb
total genus 27
structure length 180
sequence length 180
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1locA00
1DFQA 1F31A 2ZMLA 2D6PA 2DTYA 4GWNA 4XYXA 3B3QE 3GALA 1JUIA 1LTEA 1WLWA 5DG2A 5T5LA 2OUHA 4LBMA 4TZDA 3RRDA 1FX5A 1S0CA 2CWSA 5GM0A 2LTNA 4KBBA 2EXIA 1KITA 5F5QA 5E8AA 2DVBA 4FPGA 1WBFA 2A3WA 1QGLA 2DVAA 1W6QB 5DUXA 3RS6A 2DURA 2EF6A 3HN1A 5IK7A 2YROA 1AZDA 3WDYA 1AJOA 1ENSA 2FMDA 4LBQD 2P37A 4WVWA 3ZSJA 3M3EA 1W6PA 3R05A 4K20A 1G9DA 1DQ6A 3BIWE 2NZ9A 1BZWA 4Y20A 1V6OA 4M3CE 1S0GA 1CR7A 3ILNA 3M2MA 3MW4A 1N3PA 4P9YA 1WUVA 3AP9A 3ZPYA 1GANA 4YFWA 3B01A 5GLZA 4ATFA 2ZHMA 3N3HA 1IKQA 1NLSA 3RMYA 4K1ZA 1J1TA 4UW6A 2JD4A 1V6IA 1ONAA 1QNWA 2JJ6A 1VLNA 4XXPA 2D6OX 4YM2A 4XHXA 1SBDA 3C2UA 2DU0A 4BM8A 1LOFA 1MVEA 1LEMA 3USUA 4XJAA 1S1AA 3FFZA 4IQPA 4JC1A 1LHNA 3OBRA 1DHKB 2WT0A 1DLLA 1GKBA 5H9SA 5DXDA 2E7QA 1I1EA 1UX6A 1WD3A 3IPVB 5IK5A 3NV4A 2HYKA 4XBQA 2W68A 4U2AA 2WKKA 1QDCA 1ULFA 4SLIA 5GLVA 5H9QA 3UJOA 3OY8A 1LOBA 3SH3A 1LGBA 1GNHA 2VW1A 2WSUA 4R9BA 3VKOA 3V64A 5T50A 3WCSA 1IOAA 1WLCA 2WSVA 1BJQA 4F83A 4XJUA 5H9RA 2ZGRA 2WLQA 3POYA 4XTMA 1IS4A 1V6JA 1W6NB 3A4UA 3ILRA 1V6NA 3UL2A 3OGGA 2G4IA 4DS0A 4BMBA 1YI7A 5JOXA 3TB0A 1CESA 2YY1A 4XMIA 3VKNA 5GLTA 1FATA 2OUJA 1GBGA 2PHTA 3AP7A 3FUOA 1F5FA 2BQPA 1H30A 2A3YA 4JCKA 1QF3A 3WCRA 3ZYPA 2NYYA 5EYYA 5GZEA 4GALA 1S0BA 3RQ0A 3PVNA 2YV8A 3ILFA 4DRVA 1WW7A 3L2YA 3AZVA 3NV1A 4M3CA 4FPOB 5FRAA 4Z8BA 3PVEA 4XMAA 5T5PA 4CRQA 4Y1ZA 3W58A 1URXA 1D2SA 2ZACA 1V6LA 2CNAA 1A8DA 2R1DA 3V65A 1QNYA 2JECA 2CYFA 1GICA 5E89A 2D3RA 1A3KA 3HMYA 3WHTA 1O4YA 3AYEA 4DRRA 1FNZA 1RIRA 1C1FA 1LOFC 4FPKA 4C1WA 3WG2A 4FQ4A 2ZBJA 1SLLA 2Q5TA 4Y22B 1QKQA 2WT1A 3JU9A 4ISRA 3QCWA 4Q2FA 1KJRA 5E88A 1W0PA 4U36A 2ZGOA 1LESA 2DTWA 5FREA 3VKFC 5DUWA 1JYIA 3INAA 2ZMNA 3NV3A 2DVDA 3PVOA 3WLUA 4BMEA 1G9BA 5GZCA 1PZ9A 2ARBA 2E7TA 1IS6A 3M1HA 5GLUA 4GWMA 1N47A 5SV8A 4M00A 2YZ4A 3SLIA 1DIWA 1UN1A 3ZXKA 2I2SA 3OY8B 3AJZA 3SH5A 1H9WA 1SCSA 3NWKA 4UW5A 1KDMA 1ZM1A 4Q8KA 1IS5A 4XJ9A 2A71A 3T1MA 3WG3A 1G9AA 1X50A 1JW6A 1GZ9A 1JXNA 1N3QA 4Y1UA 1C1LA 2NP0A 2ZKNA 4BPZA 3QLQA 2PHRA 4R9DA 4JRAA 3T2TA 3SISA 4W65A 1UAIA 1W6MB 3AX4A 5T52A 1S0IA 2JDZA 4ZKTB 3M3QA 3N7JA 4YGEA 4AVVA 4XIKA 2A70A 5CNAA 4YGDA 1N1YA 1YIFA 3OBTA 4AVSA 5JLVA 4YW1A 4YZ4A 1ULEA 2CTVA 4YG3A 3SITA 1S0EA 2P3KA 3UJQA 3ENRA 5JOZA 1RITA 3N35A 5IK4A 1JOJA 1GZWB 3D6EA 4XZPA 1YRZA 4Q1PA 2EXKA 2YXSA 3ZXEA 4DQAA 1AXKA 2P3JA 1Q8PA 4XTPA 4YM1A 1LOCA 3WDXA 4ASMB 1WCSA 3AJYA 4ZXKA 2DYCA 4Y1VA 1DQ4A 3T1LA 2D43A 2ZZJA 4HL0A 4YGBA 1ENQA 2AUYA 3ZSKA 4ISQA 2GNBA 3Q9OA 1GYKA 2ARXA 1DGLA 1SBFA 2ZGUA 1DBNA 1ZA4A 3KQRA 3WUDA 2AENA 2JE7A 1HDKA 3OPZA 1WD4A 4LBQB 4PBOA 3O0XA 1F9KA 2PELA 2ZMKA 1CQ9A 1MR5A 4M01A 1HQWA 4XILA 3DUIA 2GN3A 3OYWA 4AGVA 1KDKA 4AWDA 2E6VA 4XXAA 5DZFA 2P3IA 5JOYA 1FAYA 2ENRA 2GN7A 2OVUA 4XJZA 4YW4A 2ZGQA 2DUOA 3AZXA 4LBKA 4P14A 2ZGKA 4NOTA 3V0AA 1LHWA 2D6KA 2D44A 5LK5A 2PHWA 2Z42A 2W52A 1SACA 2XB6C 2VH9A 2XG3A 3WDWA 5BYNA 2AREA 3GNEA 4AGGA 1O4ZA 4XOGA 1MS3A 1U0AA 1SLTA 1QMJA 3WZ1A 1VALA 1V6MA 1UZZA 5GJ6A 3VKLA 3V0BB 1SBEA 3OJBA 4PBPA 1KQRA 2PHXA 3ATGA 1FV3A 1GNZA 2A7AA 3ZSLA 1DQ5A 3FLPA 4AYUA 3UK9A 2ZGSA 5HCAA 4BQ1A 3WVJA 2ZGMA 2UURA 5HCFA 4UW3A 1JYCA 5AVAA 4PQ9A 5CB7A 3WG1A 4D69A 4FOYA 2V73A 2CY6A 2SLIA 1VAVA 2D6MA 2FHRA 1AX1A 2UWAA 4LBOA 4PF5A 4CTEA 1MS8A 1WW6A 1G9FA 1MZ6A 2C9AA 2DVFA 2A6WA 3FLTA 3B9CA 1OFSA 1S0FA 4Q1RA 4Q26A 1H9PA 1G86A 1NXD1 1W6PB 1LHOA 2R16A 3LSEA 2ZHNA 1CVNA 5DZGA 1BXHA 2DWRA 4UW4A 1QDOA 3AZYA 1Q56A 4XIOA 1G7YA 1CIWA 2A5ZA 2GALA 4FOWA 1B09A 4Y20B 2ZGTA 5GALA 5GZDA 1AXYA 2GMMA 2SBAA 1W0OA 1MS9A 3N7MA 3MW2A 2D6NA 1W6QA 1LU1A 2DUQA 1W6OA 3AYCA 1S0DA 4FPLA 4WV8A 4YZ1A 1Q8SA 2UU8A 5JVVA 4GKXA 3VKMA 1Y7BA 4FPCA 3WDTA 1AVBA 1YO8A 3R4SA 3I4IA 1RINA 5JDBA 1LU2A 1XQNA 1OKQA 1DYKA 1SLAA 2E51A 3AP5A 3LSDA 4K21A 3SH4A 3USUB 4FPJA 3OYWB 1IKPA 4LBNA 1OQ1A 1WW5A 5EWSA 1LOEA 2UWBA 3BTAA 4YZ2A 1SFYA 1G9CA 1KJLA 1LJ7A 1MS5A 3ZXJA 4XE9A 4OZXA 4FVVA 3VUOA 2JE9A 1MZ5A 2NM1A 3FUQA 3AXDA 1C57A 4BLJA 1UKGA 2YMZA 5GZGA 3N7LA 1LECA 4Q27A 4TYSA 2D3SA 1DQ0A 1QOOA 4FPHA 1YYNA 4YW3A 1SLCA 3RG0A 1GZCA 2A6YA 4PCRA 1WW4A 2A6XA 4LBJA 3PJQA 1UZYA 4YW2A 3SNMA 3LCPA 4GKYA 1VIWB 2ZAAA 3IPVA 3AFKA 1MS0A 1FYUA 1V6KA 3WHUA 5JOWA 3WG4A 2UWCA 4HANA 3POWA 3ZXFA 4Y1XA 2DV9A 4WZFA 1FNYA 3CNAA 4YW5A 4YLZA 1ULDA 3ZXLA 1LODA 3MW3A 5IK8A 2R0FA 1UMZA 4XJWA 4Y26A 4C1XA 4K1YA 1ULCA 1SLBA 2D6LX 1LULA 4M3CB 1AX0A 3IM0A 3IN9A 4YZ3A 1A78A 1EPWA 2AYHA 1ENRA 2EAKA 4FPEA 1SLIA 3D5OA 1N3OA 1PZ7A 1W6NA 1DQ2A 2AGSA 4P9XA 5H9PA 4YFZA 1CN1A 2EXHA 2WJSA 3AZWA 3O0VA 1Z0HA 1GV9A 3FBYA 1V00A 1AXZA 1N1VA 1MS1A 2DUPA 4BOWA 2R1BA 3AYDA 1W6OB 1QOTA 4DFSA 2WNEA 3B00A 1YXWA 1PZ8A 2A6VA 2V5YA 2GNMA 1LGNA 2ZHLA 1Q8VA 2W39A 5KXBA 5DUVA 5T54A 4AVTA 3A0NA 3IMNA 4RA0A 3ASIA 4YM0A 2KM2A 2RHPA 3WNXA 2B7YA 1DYPA 5JMCA 5KXDA 3JUUA 3KM5A 2ZA9A 3N36A 3ZSMA 1MACA 4WVVA 3APBA 1QU0A 3W59A 4H55A 3BOPA 1FV2A 4NO4A 3A0KA 1I3HA 4Y22A 2A6ZA 2ZGNA 2E53A 4FQZA 2VW0A 4FPFA 2ES3A 1N1SA 2R0HA 2OW4A 1SCRA 5KXCA 3M3OA 1CONA 4RL7A 1AX2A 1JN2P 4XDQA 1MVQA 2GDFA 1BKZA 3AP4A 2ZABA 1N1TA 5CBLA 4ITCA 2D7FA 2TEPA 5HCBA 2DVGA 2VUAA 2NMOA 5IUQA 2NN8A 4Q8LA 2DU1A 1HQLA 1BYHA 3AXEA 3ZVXA 4DPNA 4L8QA 1JHNA 2JKBA 3VV1A 3D4KA 3AP6A 1GLHA 2P34A 2EXJA 3B69A 3RMXA 4XHBA 3TAYA 3WV6A 1CPNA 1Q8OA 3O5SA 4GXLA 1UPSA 1WBLA 2GMPA 3N7KA 5CAZA 1D0HA 4MYEA 1TEIA 4YZ5A 5KXEA 1AF9A 5T5JA 3WUCA 1WLDA 1LOAA 4XBLA 5DUUA 2PHUA 5GZFA 3WDUA 1CPMA 3M3CA 4P9WA 4GA9A 1LGCA 1ULGA 1MS4A 2WQZC 2VW2A 1LENA 2ERFA 1W6MA 3AYAA 3MPPG 4ATEA 3RSJA 1CJPA 4Y1YA 3FLRA 2NMNA 3WDVA 4R9AA 1DZQA 1R1ZA 4M3CF 5T5OA 4R9CA 4YG0A 1GSLA 2R49A 5EYXA 1BQPA 1Z78A 2VY0A 1IS3A 3POSA 3R4UA 1AJKA 2GMEA 4FPYA 2CL2A 1GZWA 1LHVA 2A3XA 2AH2A 1LHUA 1UL9A 2LALA 3DGTA 4FOQA 2ZGPA 2GNTA 2EIGA 2EALA 4YM3A 4CZSA 1APNA 3BODA 1DQ1A 5T55A 5IT6A 3V0AB 3HR9A 2ZHKA 1HLCA 3U4XA 1Q8QA 5DG1A 3PMEA 2VXRA 4I30A 2AR6A 4LBQA 3AZZA 4XJ8A 5EXOA 3ZYRA 1S0JA 4LBLA 3WOGA 1LCLA 1KRIA 3O0WA 1JBCA 2WT2A 4BLIA 3IKWA 5DZEA 5L73A 3I8TA 4FOVA 2D3PA 1LEDA 1C4RA 1VAMA 2ZGLA 2W08A 4YG6A 3NV2A 4XBNA 3H0OA 5CA6A 2GNDA 3O12A 4FP3A 3MEPA 5F9TA 1G8WA 2P2KA 1LOGA 4FP2A 4Y24A 4YGCA 2VU9A 4AGRA 3V0BA 2H0BA 2C5DA 2A75A 5GLWA 1QOSA 2CWMA 2PHFA 1HKDA 3AK0A
chains in the Genus database with same CATH superfamily
1DFQA 2VQAA 2ZMLA 1JZ2A 4RSUA 2D6PA 1XNDA 3B9IA 4XYXA 3GALA 1JUIA 1W3XA 5T5LA 1GQPA 3ZFGA 2RR13 5D8AA 2C0ZA 4Z07A 5BUVA 3VL9A 1JI6A 1U5XA 2E33A 2FDGA 2LTNA 1S4CA 2EXIA 1KITA 1JZ7A 5F5QA 2IUWA 2R062 3A21A 5CFDA 4QX7A 5A3UA 2DVAA 4G4FA 3RS6A 2I07B 4D7YA 5K8SA 5F3EA 3RZMA 1NA1C 1VPHA 1ZRFA 3HN1A 4AAPA 1X82A 4C0BA 4HKWA 1TMF3 3RFRA 2P37A 4GH4A 4WVWA 3BPZA 4IDZA 2QQIA 5FYMA 4FTEA 5K0UC 3NVCA 3BIWE 2VCMA 2CAVA 5FYSA 2D5FA 1V6OA 3VL8A 2E9QA 3ZPYA 3RYRA 2OPKA 5FZEA 4ES9A 5A6YA 5K0UB 1LR5A 2ZHMA 3POJA 2BBAA 2IXHA 3NJZA 4XPVA 1J3QA 2P4EA 2VQ0A 1ONAA 1QNWA 4B7KA 1V9U1 4LE4A 4QDRA 5F5IA 5LBCA 4CDUB 5FZOB 2DU0A 1ASJ1 1UYYA 1A8MA 2HKXA 4TXWA 2RS52 1S1AA 3H1MA 2QQPA 3FFZA 1POQA 1PIV1 4UWDA 4RHV1 1VE0A 4LHLA 5FPBA 1UY2A 4BIFA 4QQPA 5FMBA 1GMMA 1DLLA 1GKBA 3E5XA 4IE7A 2BERA 3ACLA 1UX6A 5BNOC 3AKSA 4FT8A 5FPLA 3WQ0A 5AVPA 4AHXA 1QJU3 4QPGA 1CJDA 4HZFA 2XR4A 4CUCA 1EUTA 1W05A 4NROA 3UGFA 4CEWB 3VBUC 2OQ6A 3S30A 3V64A 4AQ2A 2YGMA 4MZUA 1OD3A 1W8HA 2F4LA 2UYAA 2XXZA 3OGJA 5FLJA 3WCSA 1ZBA1 3CDZB 4AR2A 2B8MA 5A7WA 5KHHA 4AFBA 1OVSA 4XJUA 4BH9A 5H9RA 2WLQA 3FE5A 4LLFA 2JX9A 4JKKA 3ILRA 3OGGA 1IG3A 4IV3B 1HIXA 2G9FA 4BMBA 2NPIA 2UY8A 3H7JA 3KCCA 5LASA 3R4DB 3VKNA 5FR3A 3GGLA 5FYCA 3J7HA 2A3YA 3NNGA 1ZZBA 1O8PA 1RUD3 1POV3 3TN91 2Z2SB 5JUVA 3ELNA 5HXVA 1CAXA 2XJUA 1HXS2 4X8NA 1RUG1 3JBG1 4LIVA 3ILFA 4B1LA 1YJLA 3AZVA 3O1UA 4IUGA 1UWWA 1BCXA 1J3PA 2WN2A 1URXA 5HPOA 2VD7A 4HG6B 2GH2A 2W47A 1UOBA 4QD2A 4N90A 4BE3A 1QNYA 4MSVA 1GICA 4O61A 3T0DA 3GBFA 1E5SA 4HKOA 4R52A 1C1FA 1LOFC 1RUH1 2IFWA 2JICA 2Y8KA 3HIFA 3WG2A 2D5HA 4C1WA 1VBC3 3KWVA 2Q5TA 2HEWF 1R64A 1QKQA 4ISRA 2OZJA 4Q2FA 1STMA 1Q3EA 4QXHA 4U36A 3MV01 5EHDA 5FREA 2P6CA 3INAA 1KD7A 3NV3A 2DVDA 4G9SB 1X36A 3PVOA 5IW0A 1R093 2PQQA 4BMEA 5GZCA 2XVGA 4EWEA 1D0GA 3I3DA 2E63A 2VMIA 5GLUA 2ZEWA 2FZ2A 4CXXA 2PLV3 1K12A 4PQQA 5BNNA 1UN1A 3C7OA 4WM8C 3EYPA 1O3SA 1RUE1 1Q5OA 4CCNA 4LJHA 2G19A 1H1IA 4CDWB 3AJZA 3AKRA 4O9EA 3SH5A 1H9WA 1TMF1 4XUTA 4JQRA 4UW5A 5FP4A 4CCDA 4DUVA 2WNUB 4BQ5A 4Q8KA 2JDPA 4HKLA 3BU7A 4QDQA 3BOWA 3WG3A 1JW6A 4AI1A 2BV4A 5FJKA 1GZ9A 5CFCA 5LATA 2ZKNA 4AQ6A 2DCTA 2C1FA 2C26A 1UU4A 4GAZA 4QX3A 4MG2A 5T52A 1YC61 5I8TA 1JOBA 3FL7A 4ZKTB 1K45A 4A6SA 3MIBA 4XIKA 3ZFEB 4AVVA 2BGOA 4FSJA 3OBTA 3E97A 2VZOA 1C5HA 2PQSA 2PN5A 3T0AA 5IVVA 1ULEA 2CTVA 4YG3A 5JOZA 2WZR1 1JOJA 3UKTA 3KB5A 3MLJA 3D6EA 2JG9B 3OTFA 5AFBA 1CX1A 4Q1PA 5D2AA 4AHYA 1AXKA 1UY4A 5HV0A 4XTPA 4ASMB 1CD3G 2VOWA 3RPQA 4ZXKA 3LA2A 4AFMA 1F8VA 2HWC2 4BDVB 3GJBA 2ZZJA 4YGBA 1H6XA 3I2DA 1C8M3 3KV4A 2BUKA 3CU7A 2R042 1GYKA 1QJU1 1SBFA 1DBNA 1ZA4A 2JG8A 3IMMA 3KQRA 1HDKA 1OC1A 1WD4A 2L9LA 3BN6A 3VBHC 2PELA 2WNVA 4IGQA 1PVC3 2GN3A 4N7IA 3O1PA 4XUQA 1VBB2 5DZFA 5T3NA 2Z5WA 5JOYA 1FAYA 1PO13 1VMHA 2ENRA 2OVUA 1AL22 2X09A 5DQ0A 4YW4A 3AZXA 2GSYA 4LBKA 1OXCA 2BZDA 2D6KA 2PHWA 1VBA2 2XB6C 1W9FA 2VH9A 3KF5A 2Y34A 2AREA 3GNEA 3QH7A 3WDWA 3CL1A 1XOYA 4XOGA 3HWJA 1U0AA 5LA1A 1W8OA 4EQVA 2VZUA 3BALA 1V6MA 2X5IA 5GJ6A 2VNGA 3VKLA 1POV1 5FPZA 5FQ0A 4PBPA 5EV7A 2HWE2 4HMZA 3RWNA 1RUC3 2CDPA 3ATGA 3ZXDA 5C4WC 1LB2A 1QJY1 1VRH1 1GNZA 2XJQA 4BYYA 3FLPA 3KMHA 2ZGSA 4WM7B 4BQ1A 4JAAA 2ZGMA 5L19A 4JTNA 2VCBA 2UURA 4DZGA 3B94A 5C4WB 4LO5B 3E5QA 1JYCA 1TME3 1Y9MA 4IEQA 2Q4SA 5CB7A 1W8NA 3MUY1 2R32A 3MHZA 4I3PA 4N9IA 2MEV2 2B39A 3GYDA 5K9YA 1VAVA 3Q8CA 1W3VA 2TBVA 2HYXA 2D6MA 2UYBA 3J8F3 1ZVFA 3VZKA 4CTEA 4X6RB 1VBC1 4CDQB 1EPZA 1WW6A 4H14A 1G9FA 2C9AA 2HWD2 1K3IA 2FQPA 5CU1A 2CHHA 3N9LA 1G86A 2ZAHA 1JOPA 1W6PB 3LSEA 1AR93 5DZGA 1CAVA 3AZYA 5BV6A 2VMGA 5FZ0A 2GALA 5GZDA 2GMMA 4SBVA 2SBAA 4N43C 4XFIA 4L99A 1R091 4QXCA 5EPAA 3HNBM 3RYPA 3KT7A 2DUQA 1EAH2 1NE4A 2PLV1 4GB33 3CF6E 3ACGA 4FPLA 4WV8A 5J09A 1NCQA 1IGOA 4HXCA 3F95A 4L2NA 3DKWA 1AVBA 1YO8A 1GQGA 1YCIA 3I4IA 1W9TA 4AOCA 5JDBA 1NCRC 5A80A 3SH4A 3USUB 1M06G 4QX1A 2EIDA 3CKHA 3PUIA 3SCFA 4FPJA 3RGBA 5HCHA 2Y6KA 4W6WA 4K40A 4NHKA 4UI9L 5EWSA 1Y9QA 2WZ8A 3BTAA 1SFYA 3LA3A 1KJLA 1XXNA 1BEV3 3HQRA 4XE9A 4RR3A 2Y33A 4FVVA 4DINB 1OPMA 1IPJA 4AEKA 3C7FA 5BNPC 4BLJA 1B35B 4Z2AA 4Q27A 4TYSA 4QMAA 4RYDA 4YVWC 2D3SA 1QOOA 1SLCA 3J4UH 1EV11 3OGRA 5JSRA 3RZGA 2ADDA 2PYTA 1BVVA 2BFUS 3LDBA 4PCRA 3DEMA 3PJQA 3RYKA 2W91A 4UAPA 5LWBA 2IWGB 1VIWB 4OCTA 1ULPA 1M4WA 3KS7A 4OUEA 4AZZA 4C90A 1SDWA 4PDWB 1ZBE2 2UWCA 4HANA 4UYBA 1NQDA 1NE6A 3ZXFA 3A23A 2VE1A 3H3UA 3WP3A 3ZFFC 5C8WA 1AYN3 2HWF2 4YLZA 2TNFA 1GU3A 3AVRA 3ZXLA 2VVDA 3MW3A 4OI4A 5CYYA 4FFIA 1QJX3 4PF1A 4IXLA 4XJWA 3KHBA 4C1XA 5FMCA 1LULA 4XW3A 1O8SA 1PK6C 3LIHA 2EAKA 1SLIA 3D5OA 1ND2B 4JGZC 1W6NA 4LHNA 4P9XA 4YVSB 5L9RA 5A7NA 3ZSEA 1RTVA 2VUDA 5FZCA 2RM23 1PO11 3QBQA 4E4HA 1Z0HA 2B42B 5ABJA 3VD5A 3FBYA 5M0TA 1OLMA 4WVZA 3KD4A 3OGVA 4QT6A 4OMCA 3WXPA 2WO3A 1NLQA 4IE4A 3VZOA 2MPFA 1HRI1 3USSA 2BW8A 1AYM3 4BXFA 2GNMA 4LHKA 2RMU2 4E8CA 5A6XA 1FMD1 1LGNA 2JKXA 4YYOA 5SV5A 4CP9A 3GZAA 1DU3D 3D3AA 4P9GA 5DUVA 1RUC1 4D6RA 1XB9A 3WEZA 5IVYA 2XUMA 3H8OA 3CHXA 4RA0A 3LA7A 3O1MA 1DGWA 5JMCA 5IJRA 4A7YA 5EQUA 3JUUA 1XYPA 1F4HA 4CDXA 5FPUA 2LRPA 1OF4A 1MACA 3A22A 1TME1 1QQP3 3ETPA 4XF4A 5JZGC 2FDKA 4NO4A 3NNMA 3A0KA 1OH3A 5ACA2 4ASLA 2A6ZA 5KWRA 2C6SA 3MIFA 4I0AA 4YNIA 3Q8AA 4FQZA 5FUNA 1S55A 4MV2A 1BBT3 3K2OA 2PAKA 3VN4A 1HV0A 2IXJA 3VBFB 2OX0A 1Q43A 1CONA 2WA4A 1AX2A 2YBSA 4MX3A 2XL9A 1MVQA 1US2A 4XDQA 1H1AA 3AP4A 4HN1A 2BP6A 5A33B 2NMOA 4XFFA 1W8ZA 1RXGA 2VZ1A 3LEGA 1JYXA 1MZEA 1L3JA 1H2MA 1FT9A 3IDBB 2JKBA 2P1BA 3B69A 3VBRA 3TAYA 3RMXA 4XHBA 3WV6A 3FHQA 5FYVA 4GWJA 4JV4A 2GMPA 4I2OA 4CEYB 1RUI2 5FZBA 3VDDA 3WP6A 1DGRN 5FZKA 5KXEA 2ZJCA 1WLDA 2W1SA 4C0HA 1WLTA 3WDUA 4JDMA 3I2GA 2J1RA 2WQZC 4KWUA 1RVF3 2VMFA 1AR72 2XDVA 3AYAA 1BEV1 2C4XA 3IIIA 1S2BA 3RSJA 3E6BA 3FLRA 3SCHA 4XACA 3MF6A 1OHFA 3I2HA 3UV9A 4L92A 2VY0A 2ZEXA 3U1XA 3ZN4A 2VGDA 1VBD3 3B5LB 2QQMA 4H7MA 1ZRCA 3PU8A 5HXMA 2DFCA 2HLEA 3C7GA 1LHVA 2ZS6B 1OFNA 3DGTA 5FDBA 2EALA 4IW3A 1JZ8A 3BODA 5ANQA 2N7GA 1DQ1A 3PU3A 5T55A 5J48A 3VHRA 4KQ7A 3MIGA 1J59A 2LUWA 3VZLA 4MGIE 3RI8A 1Q8QA 2VZRA 5FYTA 2P17A 4I30A 2AR6A 4LBQA 4S2FA 2RJLA 5EXOA 2P3YA 5BNQA 4HT1T 3Q8FA 1S0JA 1ULOA 2GH8A 2VXJA 4JGYC 1QJX1 4BLIA 1UF2C 3IKWA 4ZU4A 4AF9A 5AC93 4A4AA 4Z2WA 3THCA 2ARAA 3KCXA 4CCOA 1RXFA 5CA6A 5FMOS 3P3PA 1XSRA 2ZKLA 4AEDA 3MEPA 1G8WA 2RM21 1FOD2 2XJSA 5EJ1B 1GFF2 1NT0A 3R6SA 2X29A 4YGCA 4PT6A 5EJZB 1L7RA 5EP9A 2QQKA 4CCLA 1T2XA 1W9SA 1CZVA 1UU5A 1HKDA 4LNVA 1AYM1 1SPPB 3D0SA 1K5JA 1RUNA 4QU1A 4K7JA 1XNBA 1SQ4A 2EICA 4KWLA 2Y64A 3D8CA 2IXKA 4QHOA 4MXVA 3DXTA 3RRDA 5GM0A 4INDA 4D6QA 3E5UA 4FPGA 3N9OA 1QGLA 4UF0A 4ZY9A 2DURA 2F17A 1D4M1 3NNFA 4MGKE 4K6BA 1GWLA 1PO21 3WDYA 4J1WA 1AJOA 1XU1A 2FMDA 2R071 2RJKA 4LBQD 1KFXL 3HQUA 3J7NA 4URTA 5ERLA 5DN2A 2BVBA 3NJYA 4K20A 1DQ6A 1POV0 3ZXAC 4Y20A 4M3CE 5BPXA 1CR7A 3ILNA 2KXLA 5FUPA 4UFHA 4BQ3A 1WUVA 3UNPA 3WW1A 5I0SA 1GANA 3S0MA 4YFWA 2QTWB 4UFJA 4ATFA 1IKQA 4RS5A 3RMYA 2RV9A 4UW6A 5IVJA 1JU4A 1VLNA 1YFXA 2BOJA 4OMDA 4JKMA 4QPIA 2W87A 5F3GA 2VVEA 3C2UA 5A3WA 3ZX7A 2FCTA 2YGLA 2XUEA 5C7GA 1QHDA 4XJAA 1AHSA 1R1A2 5L7OA 3W9AA 5IHRA 1LHNA 3EB7A 3LDRA 2BBVA 3U4SA 2XLAA 1JZ3A 1ND3B 4NRQA 5DXDA 2VOXA 3IPVB 4DEVA 1VMJA 1MZFA 3VBOB 1AR62 1ASJ2 3POFA 4IEZA 4NAMA 2V09A 2W68A 4R4XA 1ENXA 5IVBA 2X53S 1QDCA 1ULFA 3WNLA 5FWJA 4Z92B 1I5ZA 1PIV2 2WSUA 2Y0IA 4R9BA 4R4ZA 4RHV2 3NAPB 4PLNA 1OOPA 5D8AC 4BQ2A 1AUYA 1VBD1 4W6YA 5KR7A 2B46X 3RZJA 5D1IA 2OXBA 2ZGRA 3U07A 4BCUA 4DY3A 3AMNA 4NAOA 5CFDC 1V6JA 5A32A 2PHDA 5JOXA 2RS11 5E16A 2BU9A 4ZU5A 1DDLA 2EVXA 3TB0A 1RB8G 3KF3A 2YY1A 3MIDA 5GLTA 1FATA 2ARCA 1GBGA 3WCRA 2BQPA 1RUF3 1OA2A 1COV3 4GH4C 4HN0A 3ZYPA 5EYYA 4GALA 4NIAA 1O59A 3H9AA 3PVNA 3WSOA 4EWAA 4Z1VA 1MEC3 4KH9A 5KBFA 3I59B 4LO6B 3PL0A 4DRVA 3NV1A 4WBBA 2MNGA 4IV1B 5FRAA 3PVEA 5T5PA 4AHZA 3SXWA 1HRV2 2VMEA 4MHUA 1D2SA 3P6BA 3OG2A 1H2KA 5J96B 2R1DA 4YRDA 4QX0A 3VLBB 3V65A 1Y4WA 1XC6A 2QQVA 5E89A 2CYFA 1ZRDA 2CDOA 1GWKA 3NW4A 4MXWB 4LMFA 2WC2A 3FZ3A 5FPXA 5C9AA 1O4YA 2WS91 4DRRA 1FNZA 1RIRA 4FPKA 1QEXA 4HSLA 5K7PA 2ZBJA 1XE0A 3EMRA 3OBAA 1YHFA 3JBG3 2LM3A 3LEKA 1MQTB 1R081 2DBNA 4OQ8A 5E88A 1U5YA 2WWJA 3GHMA 3WP4A 1CWPA 1JYIA 2DTWA 3SKJE 4B3NA 3BIEA 3CBNA 1RUH2 4JHTA 4TN7A 2VC9A 5GKAC 4NWWA 4QPGC 5ANNA 3CJIA 4LO7A 5FV3A 2EIBA 4XFAA 5FZ1A 2WINB 4O65A 1HV1A 5IATA 1UOJA 3JB8A 2VOKA 4HBNA 3ZYJB 2ZEYA 4N53B 2VZPA 1XU2A 3WW3A 4JKLA 4JHZA 2ZX4A 4BK5A 1DYOA 2ZTNA 1PMJX 5A7PA 4A41A 3HAGA 3OCPA 3KZ4C 5LK7B 2WR9A 1KDMA 2JDAA 1ZM1A 2RR12 3SHRA 3URFA 2NQYA 4XJ9A 1JMUB 2XJTA 5FP8A 5JSOA 1KGYA 4QGNA 1D2QA 4Q4V2 3BU0A 1N3QA 2G9GA 3ACIA 4Y1UA 4AL9A 2D93A 4R9DA 5FY8A 1YNAA 5LB6A 3SISA 1UU6A 1W6MB 4QX5A 1RUE3 4PIYA 3FJSA 1UZ0A 3M3QA 2BVVA 5LA0A 4CSWA 3BUCA 2A70A 1HX6A 4YGDA 1N1YA 4NJ4A 4AVSA 2JD9A 1H8TA 2JENA 2WO2A 1LKNA 3FX3A 3ENRA 1E57A 1NA1B 1WZXA 5FZ8A 5FZHA 2YXSA 3CQOA 5JWPA 1K5MA 2P3JA 1Q8PA 4HPKA 1ZZ7A 4YM1A 3Q8EA 3MBWA 5FXXA 1DQ4A 2ET1A 2IXCA 2FDFA 3ZSKA 2AC1A 3GZTB 3P3NA 4ISQA 2FDHA 2GNBA 4P9LA 3Q9OA 5IYYA 1G9CA 3WUDA 2AENA 2JE7A 3OPZA 5FOJB 4LR4A 1BMV2 2ZOEB 2WZR3 3O0XA 3TNPB 2LW8A 1PM7A 2QKDA 3LD8A 3PTYA 3T08A 1F4AA 1QH7A 3OYWA 3I97A 1XPWA 2W3JA 2E6VA 5C8CA 2EA7A 1QJEA 4CCKA 4X8PA 5BNNC 2ZGKA 4QKBA 3V0AA 1LHWA 3T30A 3T2QA 4UOJA 2XBO3 1SACA 2XG3A 3K4DA 1O4ZA 4KG0A 1MS3A 1DLCA 1QMJA 1SLTA 2GC0A 1QY4A 1RUF1 4RFRB 5BNOB 1COV1 1UZZA 2WO1A 3DV8A 5L7OC 3V0BB 1SBEA 3OJBA 3ZR6A 5LA9A 1PNFA 1MEC1 3WX5A 1FV3A 5CFCC 4UFIA 4AI3A 3ZKYA 4AYUA 2RS53 2JDNA 5FZDA 5KC5A 3VBUB 2XJVA 3ZDVA 2JDUA 1AR82 4N8MA 5FBZA 3LQCA 4Q4Y1 3LDKA 3S5QA 1UMIA 2EAAA 2ZZQA 3GXUA 5AVAA 3RDIA 3WG1A 2VO5A 4CUAA 4FOYA 1TZOA 4GJZA 4IE6A 1RUD2 3HT1A 2QE3A 4NIIA 4LO4B 4KMQA 2PFWA 2YU1A 3I2KA 1GNYA 1AX1A 4XQ4A 3WNKA 1OLQA 3CJXA 3ORJA 1MS8A 2LS6A 3P5BA 1QJY3 1VRH3 2J1VA 2JIJA 2IVIB 2A6WA 3FLTA 3B9CA 1H4GA 4KWKA 4Q26A 2YBPA 4S2HA 1H9PA 5HI0A 4D6SA 2RS31 3VD9A 1NXD1 2PAEA 2R16A 4NRPA 4OI1A 2VBPA 2DWRA 2K0GA 2WABA 1QDOA 5IAVA 3AL6A 2MHFA 2IVJA 4NUBA 1G7YA 5FYYA 4URAA 2YB7A 4FFGA 1P8JA 1AXYA 4EN0A 1HQNA 3J26N 3BTZA 1VBC2 1ZZ9A 2JG8C 2D6NA 1KXGA 4KGGA 2X8KA 1LU1A 4KGQA 2VTXJ 4N7UA 3WT3A 3H3LA 1PGW2 2E26A 4GKXA 4KG8A 2WNVC 2QFEA 5JVVA 1Y7BA 1NZIA 4CXWA 3WDTA 4QX8A 1ZZ8A 1HXS3 3THDA 1E5IA 1LU2A 2WZEA 2RDQA 2E51A 2W94A 3AP5A 1R092 5CG8A 1O3RA 1YIPA 3E1F1 3ES1A 5DAPA 4AFAA 5JR2A 5ISLA 1OQ1A 4J1XA 4CCMA 5A3PA 1H2LA 2J1EA 5K0UA 1W9YA 4OZXA 3RI9A 3MUZ1 2X5IC 2ZCWA 3VUOA 4LK7A 5A7OA 2JE9A 1MZ5A 3SCGA 4MLOA 3PUSA 3AXDA 2JEMA 3RJ2X 1UZWA 5FZOA 4CDUA 5GZGA 4XDPA 1JUHA 2VCAA 4FPHA 2JIGA 4YW3A 4NR1A 5DAXA 2VMCA 4N9HA 4GJYA 2A6YA 3IAPA 5DMYA 4WM8B 2WL1A 3SNMA 2AACA 5LY1A 1UZYA 3IZOA 1NYWA 3FFQA 3T09A 1WMXA 1OSGA 3LCPA 4Q4X1 2E7AA 5C6CA 2HWB2 3AFKA 1MS0A 4F3JA 1V6KA 1PNGA 3WHUA 4OUSA 4D7TA 1JYVA 4Y1XA 3MI8A 4WZFA 3HEIA 1Y3TA 4YW5A 5IFPA 4AI9A 4CEWA 3S7IA 2VNVA 1VJ2A 4O7XA 2R061 1EV13 5CVRA 3I2OA 1QJZA 4CU8A 4K1YA 4OULA 4B1MA 1E5RA 4M3CB 2OT7A 5FFOC 3IN9A 4EN9B 4L11A 1EPWA 4FPEA 2X10A 1XSQA 4BU2A 1J84A 3FMGA 1PZ7A 2V4VA 5H9PA 4IV3A 3O1OA 2WJSA 3EJKA 3H1YA 5EFUA 3V56A 3O0VA 3OEAA 1C8M2 4BQWA 1BHGA 3LB9A 1RMU2 3KGLA 1WCDJ 1V00A 4NHLA 3AVSA 1RHI2 4IEXA 1MS1A 3GZEA 2XBO1 4BOWA 4C91A 2R1BA 5C3QA 3AYDA 3OOXA 1QOTA 3B00A 1U5IA 1PZ8A 1WCUA 1W06A 2DCZA 2V5YA 2Z79A 3KSCA 1PVC2 5DAWA 2Z69A 4XCAA 1CGPA 1Q8VA 2AZ5A 4A45A 5KXBA 4ZXEA 4CU6A 4PI2A 1PGSA 5T54A 3A0NA 5FZ7A 1H4HA 3HOBA 3AL5A 4RR3C 3LZZA 5CIRA 3VBHB 3O7OA 4YM0A 5F37A 2J1TA 2RS51 2B7YA 4B4PA 3KM5A 4K9SA 4FFFA 4HSJA 4LHSA 4LUKA 1C3HA 1CAWB 3ZM8A 4CP2A 1O3TA 4ZZ5A 1TG7A 2DDUA 1HRI3 3K4AA 3HN3A 1I3HA 3CMGA 3NL1A 5BY5A 2ZGNA 1FMD3 1YQ8A 2ES3A 2H0VA 2R043 2R0HA 3RWKX 2QCSB 1J58A 1SCRA 1C5IA 1H6YA 4COVA 2D97A 2IZWA 1OBNA 4QQOA 4ZZ8A 3GCWA 4COYA 4DIQA 1BKZA 5JMOA 1W39A 1ZYBA 2VUAA 2GC3A 1VBB3 2NN8A 1ZA7A 4HK8A 4Q8LA 1HQLA 5LRRA 2VR4A 1PGL2 2XH6A 1BYHA 5DABA 2WAOA 3J8F2 3KLSA 2Y6GA 4L8QA 5FY0A 4HFSA 4GQ7A 1JHNA 3RZZA 5FJHA 5A1AA 1VBA3 4S2GA 1RYYA 3AC0A 3LIGA 1LAJA 1VMFA 4QHBA 4W8JA 4EYUA 4CDWA 4A7KA 1Q8OA 4PJYA 2VECA 3O5SA 1BLZA 2ID4A 5F6LB 1AR92 3ME2A 2WNUA 5CAZA 4KNCA 4Q0SA 1D0HA 2Q30A 4UXAA 5C3RA 1UIJA 1YUDA 4ARXA 5FO8B 1HXS1 3NKTA 4NPMA 5B4NA 2XPJA 2J42A 3IDCB 5ABJC 1RC6A 5GZFA 5LCWL 1NXMA 3ST7A 4P9WA 1ULGA 2WYSA 4GB32 4Y5Z0 4QB6A 1GP6A 2VUJA 5C5TA 1CJPA 4Y1YA 3NQHA 3ZFEA 3N4MA 1FPN2 1WMFA 1O4TA 2OYZA 4N43B 2QDRA 4R9AA 3ZYIB 5T5OA 3H42B 1GSLA 3OPTA 1BQPA 1Z78A 3POSA 4XUNA 4FPYA 4B4QA 4CCEA 3M4FA 2JG9A 4CDXC 5C33A 2AH2A 2Q1MA 1UL9A 4W6XA 4KWJA 1CAUB 2GNTA 1DP0A 4IL7A 2V72A 4UFLA 4B8EA 1APNA 4IEVA 3W20A 1NCRB 5IT6A 3ZN5A 1DG6A 4LT5A 3I3EA 3ZIXA 4PHZA 4OQ9A 3HR9A 1HLCA 5DG1A 2VXRA 4XJ8A 4YWAA 4XVHA 3ETQA 1A6CA 1U5ZA 3WOGA 3O0WA 5BNPB 1KEXA 1JBCA 5F3CA 3LOBA 1GP4A 5DZEA 5L73A 3NJXA 3PMSA 3I8TA 4FOVA 4YVWB 5J36A 4XUOA 3C7HA 2ZGLA 2W08A 4YG6A 1VRBA 1ACCA 4LQRA 4XBNA 2CU5A 4JVAA 4D8MA 3O12A 1AYN2 1NKGA 4FP3A 3VBRC 4BWOA 3F2ZA 5IVCA 1LOGA 5FZ3A 3J7LA 1TE1B 4MGTA 2GC2A 2OA2A 5JXIA 2VU9A 4AGRA 2C5DA 3VDDC 1QOSA 2CWMA 1RL3A 4Y5TA 2PHFA 3T4HB 3AK0A 3ZFFB 4AXOA 1F31A 4CE8A 2Q8CA 4DXTA 2DTYA 3ACFA 3LF7A 4GWNA 4WM7A 1ZRIA 1LTEA 1Z7S2 2XJPA 2GP3A 4Q0QA 1DZRA 2OUHA 2BGPA 3K3NA 4O9GA 3TEZA 2XONA 4TZDA 2BNNA 3WQ1A 4NIDA 2BOIA 1FX5A 1W2NA 4QU2A 4K8FA 5A3OA 1PK6B 3FC0A 1F15A 5FAXA 1SEFA 5LBBA 5DUXA 1WBFA 4JGZB 1W6QB 5FXVA 2J7MA 2EF6A 2BJSA 1JU3A 1WA4A 2D98A 5I0DA 4CDQA 2HWC1 5G04L 5IK7A 1AZDA 2HWF3 3DF0A 1L7LA 2R041 1W6PA 1EUUA 3M3EA 4MO3M 1HW5A 2WO7A 2W1WA 2YBKA 4H2AA 1G9DA 4P9JA 1NZCA 2NZ9A 4HOOA 4FFHA 1S0GA 2DCYA 2YFZA 3M2MA 1N3PA 2GC1A 1QQP2 1UY3A 2A73B 5FZFA 3B01A 5GLZA 2OKXA 3N3HA 1VBB1 1J1TA 2J22A 4IETA 4K1ZA 3VZMA 1D4M3 1UOGA 2JD4A 4Y4YA 1AL21 5EZWA 4XXPA 4PIXA 1PO23 4NIHA 1BBT2 3C8XA 1SBDA 2R073 4BM8A 1VBA1 3ZPOA 1OUSA 2JDYA 3KT4A 4CP0A 2W46A 5JI9A 5JZGB 3GF6A 1MVEA 4DOUA 3USUA 1EP0A 5A3NA 2RMU3 1MPXA 4JC1A 2Y6LA 3OBRA 1DHKB 5AFEA 3EO6A 3ZLIA 2HWE1 4AEDC 3IDAA 5JXGA 5H9SA 5FLIA 3FHIB 4DB5A 1I1EA 4COWA 2QQJA 3NV4A 3P1IA 1YQ5A 2HYKA 3ZMNA 1W2OA 3M7AA 2RVAA 4XBQA 5I8YA 5FZAA 1B35A 3LOIA 5H9QA 2DCJA 1SG3A 3LKJA 4SLIA 5GLVA 3OY8A 1LOBA 2VZQA 1LGBA 1GNHA 2VW1A 3AB0A 4XEZA 5F39A 5ACA3 3CO2A 5T50A 1IZ3A 3JQWA 3EBRA 4WVMB 1CIYA 1WA6X 3GZUC 4IGOA 5DDJ3 4F83A 2HWD1 3I54A 3POYA 3MO4A 1RVF2 3UL2A 1H0BA 3A4UA 4PDWA 1V6NA 4DS0A 2G4IA 2PMWB 4RGKA 3T3YA 1W8UA 3WINE 2YC0A 4GD4A 4RQPA 5DPNA 4MGYE 2VBBA 4XMIA 1U12A 1IHMA 2WWSA 4EN8B 2OUJA 3AP7A 1WWYA 2PHTA 4JCKA 3THPA 1H30A 1YEWA 2DCKA 4XETA 3UKVA 4UF0B 4AQTA 2NYYA 3U0ZA 5GZEA 4NIGA 1S0BA 3BVCA 3IT8A 3I3BA 3WW2A 3SKVA 3B93A 2BWCA 3ZN6B 4ET7A 1WW7A 1YJKA 3L2YA 1EAH1 1W8TA 2GZWA 4Z8BA 1A34A 4V2WA 4XMAA 4COUA 4CRQA 3KQ4B 1ND2A 1V6LA 2CNAA 3LAGA 4YVSA 4F7ZA 3DYPA 4DMIA 2C9KA 1X33A 2RS13 2WWUA 4RS5C 1WMDA 4QPIC 5FK7A 3VB9A 2D3RA 2PXJA 3G7DA 3AMPA 4K8RB 5FZ9A 5I8SA 3WHTA 3NKGA 1VBE2 1YLLA 4QXKA 5FWEA 4FQ4A 1SLLA 1AR73 1UY1A 4Y22B 1OUXA 2WT1A 2XLGA 3JU9A 1ST8A 1GWMA 3SEEA 5JIUA 4CVUA 1I6XA 2XWBB 4CU7A 2R6QA 1IG0A 3NRUA 5AC92 1KJRA 2WFF3 1DF0A 1OT5A 2WBKA 3A7QA 4GULA 2VMDA 3WF4A 4Q4W2 3AMQA 5DUWA 4EROA 5CG9A 3KVAA 2A1XA 2RDNA 4JGYB 2JDHA 4LKSA 1PZ9A 2E7TA 2WS93 1GZTA 1IS6A 4EJRA 4OHWA 4BA6A 4GWMA 1N47A 2YYOA 1TNRA 4M00A 5SV8A 5A6QA 2YZ4A 3WNPA 2WFPA 3PHMA 1DIWA 3SLIA 1R083 1OOPC 1XNCA 3VGIA 3U14A 4EE2A 3ZXKA 5LEKA 4COZA 4Y4RA 4AG4A 2I2SA 1REDA 4HVRA 3VBFA 2HWF1 1SCSA 3NWKA 5G05L 4WZCA 3DCQA 3HNMA 3PTRB 1NY72 2A71A 2OS2A 1W8FA 3T1MA 1G9AA 1X50A 3N9QA 1UXXX 5A33A 3H8UA 1OD5A 3DXUA 5LY2A 4OHVA 2NP0A 1HB1A 1C1LA 5FBJA 4BPZA 2PHRA 4K3UA 2CV6A 1D4VB 2ZX0A 4JRAA 5LA2A 3T2TA 5JPMB 4GMP3 2DFBA 3FWEA 2PAMA 4OFGA 1OA4A 1UO9A 2JDZA 3LWCA 3PJYA 3N7JA 1FOD3 1HB3A 1ZNPA 2HJIA 5D21A 5JLVA 3HBKA 1YFWA 4YW1A 3LFMA 5F2WA 3UJQA 3VD7A 2Y38A 4CEYA 2G9ZA 3PNAA 1RITA 5KHJA 3N35A 2PTMA 5KC6A 4GIQA 1GZWB 2Y6HA 2RMU1 2EXKA 4IEUA 3SQOA 4DQAA 5C9AC 4L97A 3ITQA 4LORA 4QQHA 1LOCA 3KGZA 1WCSA 2OIIA 3AJYA 3VBSA 1QIQA 5DAQA 3ZR5A 2DYCA 4I0BA 1X8MA 4M4RA 1REFA 4Q0VA 2D43A 4IERA 3O1TA 1WCKA 4PLMA 4HVOA 5F6KA 1ENQA 4DXRA 1RUJ3 3DPRA 2ILMA 5APAA 2Y6JA 4ES8A 2ZGUA 2WN3A 4IEYA 1FXZA 1UYPA 3H50A 4PBOA 3S7EA 4UT5A 1F9KA 4JQTA 4B4RA 2ZMKA 1MR5A 4XQDA 3NMBA 4M01A 5ACA1 4AVCA 5FY5A 3DUIA 3CJIC 2XKOA 3POBA 1HB4A 2TUNA 4AWDA 4KU7A 3JZVA 4XXAA 1BK0A 4NHYA 3RZLA 4W50A 3B02A 5DDJ1 1O91A 1XYOA 1O3QA 1V9U2 2BNOA 4NPRA 3GBWA 4NOTA 5LK5A 3TBDA 5J37A 4LA3A 3K51A 1JZ4A 3JB4C 1HB2A 4AGGA 4XAAA 3AM2A 2WLPA 1VALA 2BFUL 4XFBA 2ETEA 3UETA 1KQRA 2KA3A 3IIAA 4HK9A 5EJ3A 1W2TA 3ZFGC 5E6HA 4OHZA 5JSPA 2A7AA 5JXHA 3DECA 1DQ5A 3ZSLA 5FMDA 3UK9A 3POIA 5HCAA 2KR2A 5I91A 1ZZCA 4I0WB 5HCFA 5JCTA 4UW3A 3ZFGB 4LA2A 5D8AB 2OQ7A 2V73A 1COV2 4D7SA 1JYNA 3MFAA 2Q8OA 2VBDA 2ZX1A 3ES4A 4AW7A 2YDEA 5A7SA 1H8TC 4I09A 2FHRA 1AR63 4PIZA 1MEC2 2VG9A 5CFDB 1ZBA2 4LBOA 4PF5A 3TRSB 4BJ0A 3I7DA 4NN0A 3WQ7A 1AR71 4Q0UA 2XHKA 1SPPA 1EY2A 2ZX2A 2O8QA 3WR0A 3GBGA 4AFDA 4E2SA 1K42A 1K5MC 1S0FA 4BHPA 4GH4B 2VTXA 4Q29A 1DGRA 1LHOA 2ZHNA 1CVNA 2WFF1 4Q4Y3 4P9IA 4CPBA 4MH0E 3H8RA 1J1LA 1Q56A 2RDSA 4XIOA 5GALA 2B45X 1NLRA 4FOWA 4M0HA 3TN92 2Y6FA 1W0OA 5FKCA 4RD7A 3VD3A 2O14A 1SFNA 3MW2A 1RUG2 3JBG2 3N7MA 1DZTA 4QM9A 1NX9A 2WRAA 5FXWA 3MF9A 1W6OA 3AYCA 1KFUL 1S0DA 4RFT0 4YZ1A 2Q1ZB 1W03A 1Q8SA 2VM9A 2QQNA 3JD73 2J1AA 1O5UA 3OEBA 1ZREA 4H3WA 2RS33 1GOGA 5C8CC 5B4XA 2H6CA 1W2UA 3R4SA 1RINA 3LSDA 1XQNA 1DYKA 1SLAA 1LRHA 3GHNA 4B7EA 2VZVA 3VHPA 3OYWB 4LBNA 5CKMA 1HRV3 1WW5A 4QGLA 4DNYA 4YZ2A 4XAEA 1HJFA 3ZXJA 4JDOA 3TYJA 3FN9A 5FXZA 3RVHA 2W9XA 4AI2A 4QB1A 2NM1A 2ZPXA 5A1LA 4QPGB 4TTGA 3K4ZA 3N7LA 3D0JA 4GMP1 5HBAA 1TVGA 5I0TA 2BPA2 1DQ0A 1DGWX 1FOD1 4FI9A 2DF7A 1NQJA 3HNYM 3UGHA 2DBIA 5KHKA 1WW4A 2A6XA 3NNJA 4IE5A 4YW2A 5A7WB 2VNRA 1H2NA 1AL0G 1ND3A 1OLRA 4MGZE 4GKYA 4CPBD 3IPVA 3VBOA 3WG4A 1RUE2 3POWA 1FNYA 2IFRA 2VZTA 1TMF2 1XE8A 4LK6A 3IDEA 1RUJ1 4PI0A 4ONUA 1LODA 1X9TA 3NAPA 1CAXB 1UMHA 2R0FA 2W5FA 4Y26A 1ULCA 1SLBA 3H8XA 2D6LX 5F32A 2VAUA 4YZ3A 1A78A 4Q4X3 2QQUA 3ECQA 3KHCA 5IWFA 1ZRRA 2AGSA 1DQ2A 4YFZA 2K9ZA 1CN1A 2EXHA 4QPWA 3MIEA 4BK4A 5F1RA 3GM8A 2X05A 2FCUA 2VL4A 1HJGA 1NG0A 1GR3A 1AXZA 2VTFA 4Q4V3 2G1MA 2XLFA 4ZS3A 1O5LA 4CP1A 4I3GA 5JAXA 2R063 2WZR2 4DFSA 1YXWA 3I59A 1SFPA 3T2OA 2V5DA 4IV1A 2VZ3A 4AAXA 4E8DA 4AI0A 4GWIA 4QXBA 3POGA 3IMNA 3T4VA 3WNXA 5TSWA 2RHPA 3ZO0B 4QDSA 4CUBA 5KXDA 1C8NA 2WDBA 4MXWA 2QVSB 1R1A1 2XBO2 5B2GB 5FOBB 3NJVA 1QJU2 2ZA9A 4CDUC 4UBHA 2VJXA 4WVVA 3APBA 1QU0A 3W59A 4H7LA 1FV2A 1UYZA 4XUPA 3AMMA 4LEJA 5FP9A 4X6QB 5FYIA 5BNNB 1MQTA 1AR61 1YFUA 2VW0A 3MGUA 3MDPA 3VZNA 1N1SA 3OPWA 3PURA 4META 4Z82A 4OI0A 5KXCA 2RJ2A 4RL7A 3HT2A 5CISA 4HETA 5FMOL 3OUJA 2J1SA 2WZPP 4F8AA 1SMVA 1I9RA 2KD7A 1N1TA 5FO7B 5JI7A 4FCAA 4P02B 5HCBA 5CBLA 4XDOA 5CFCB 3I2IA 4CEWC 2YC4A 2ADEA 2WUHA 3WQBA 3AXEA 1ODMA 4N53A 1OQEA 2HH9A 1QJY2 3VV1A 1VRH2 3D4KA 4FXKB 1V70A 3AP6A 4OHXA 2P34A 2EXJA 3UKNA 3JD71 4GXLA 1QXJA 2Z4FA 4D94A 1WBLA 3N7KA 4IV3C 1I5PA 1RJ8A 2QQLA 2OPWA 3AKQA 4MYEA 4QX2A 4YZ5A 3ZMOA 2B5HA 1D7PM 1AF9A 5T5JA 5FY1A 1LOAA 1WMEA 2PHUA 5CKNA 4OI2A 1JZ6A 1CPMA 1GOHA 3PVBB 3M3CA 4W4ZA 4GA9A 1HRV1 1LGCA 4BQYA 1AR83 1MS4A 1OQDA 5C3PA 1LENA 1W6MA 1JTZX 4ATEA 2QDNA 5FCCA 4MVTA 3T2PA 2E32A 4QHZA 3WDVA 1DZQA 1R1ZA 4M3CF 4R9CA 3R0RA 4CXYA 1YI9A 2JG8B 2R49A 4LITA 2RG4A 3R4UA 2GMEA 4LO8A 3J7MA 3SEPA 1NA1A 1VP6A 5CZKA 5JPNB 1W90A 4NWVA 2WNVB 4P5HA 3ZYFA 2JB4A 3J9SA 2LALA 2W1UA 3DKQA 2P6HA 2EIGA 3LGRA 2PLV2 3NNLA 1PM4A 5FP7A 1XNTA 1E5HA 4LPLA 1W2AX 3M3IA 3BTXA 3BB6A 2WYFA 3VDBA 3LEIA 3ZOIA 1RUOA 4OLLA 1JODA 4LXLA 1J3RA 4BIOA 5BXXA 3WF2A 1UNBA 1UKRA 2X5IB 5FQ0B 5LBEA 3LE0A 2I45A 4LBLA 1LCLA 2ZX3A 3PIJA 4HONA 4DXSA 3HD8B 2WT2A 1O7FA 4QAWA 4RGAA 5LEJA 3VHNA 1X9PA 2W95A 3MPBA 5A1FA 1UD1A 1C4RA 5FZ4A 1JYTA 3NV2A 2PHLA 4AHWA 2BWAA 2HBTA 2RR11 2GNDA 1T6GC 4AEMA 2YG0A 4Y24A 4CDWC 2QQOA 3I3MA 2VUCA 1SZBA 5F3IA 4CCJA 2O1QA 1EV12 1UY0A 2FZ1A 1T6BX 5FY4A 4FAHA 5BNOA 2K46A 2WNUC 4Q4V1 3V0BA 3PLQA 4E4SA 2A75A 5GLWA 5F5AA 1KS4A 2XGXA 4NHMA 2B9UA 4J25A 1ZZ6A 3OUIA 3B3QE 1W99A 3VBUA 4JRLA 1WLWA 5DG2A 4YW6A 4IEWA 4KU8A 5E1RA 1CAVB 1GQHA 4LBMA 3PUQA 4MADA 1PMIA 1VB4A 2JE8A 3CZUA 2E31A 3OBZA 4FBFA 3ZFEC 4Y3OA 1S0CA 2CWSA 3QD6A 2QZ2A 1NCQC 4KBBA 4A3ZA 2HWB3 4Q5OA 3VDAA 3CEWA 4XABA 5E8AA 2DVBA 2A3WA 3M8LA 2JG9C 1NCQB 2YROA 3S5AA 2BYVE 3ROUA 1ENSA 3H7YA 3ZSJA 3C3VA 3R05A 3AKPA 1PO12 5J1XA 5IVFA 4ZU7A 1BMV1 2F6BA 1BZWA 2BDRA 1BVP1 3MW4A 4P9YA 2CGOA 3AP9A 1TNFA 3MYXA 3D82A 1HRI2 1C28A 1JHJA 1NLSA 2ORXA 2QBXA 4EN6B 4RR3B 1PVXA 1FMD2 1V6IA 1OA3A 2HWC3 2JJ6A 2D6OX 4YM2A 1RMU3 4XHXA 1RUC2 1RHI3 3JQXA 3ZIWA 2NLRA 4ZPIA 1LOFA 3LPFA 1PMHX 3U37A 5A3LA 1LEMA 1PHMA 2FCVA 5L9VA 4NPLA 4LUMA 4IQPA 4CA9A 3HBZA 3U78A 1TME2 2WT0A 2YC2A 4XF3A 2BGCA 3O1VA 2AEZA 3UYJA 3DL3A 1W0NA 2E7QA 1CZSA 1WD3A 5IK5A 4XFGA 3BKZA 2QZ3A 1AL23 2XWJB 1AR81 4M0NA 4U2AA 2WKKA 3BPSA 3U11A 3UJOA 4DY5A 4WM7C 2VOTA 3SH3A 1RUD1 3VKOA 3NSTA 2Q8DA 1OPOA 3BCWA 4NMIA 1QWRA 1IOAA 4WM8A 1WLCA 1H1MA 2WSVA 5F7UA 2HWE3 4TWTA 2ZXQA 5A3TA 1BJQA 4UFMA 5CKQA 1UXZA 4EZ4A 4XTMA 2Y26A 4AVAA 1IS4A 1W6NB 5IAXA 3OUHA 4KBZA 3VD4A 1YI7A 3VHOA 4A3XA 3RZKA 3N9MA 1CESA 4CDQC 5KHIA 2CAUA 4P00B 5ABJB 3FUOA 1F5FA 3UGGA 2ET7A 1QF3A 2MEV3 2QNKA 3KV6A 3MV11 1IQAA 2IXIA 5FYBA 4A2UA 3RQ0A 2YV8A 5LBFA 4IEOA 4M3CA 2K2SA 1RGSA 4FPOB 4CP9B 1PGW1 4GMP0 2HWD3 4Y1ZA 3W58A 5IFTA 2ZACA 4XF0A 4BQ4A 2BRTA 1XE7A 1W9WA 1A8DA 1BEV2 1UQXA 4UFKA 4BZ4A 3GCXA 2JECA 1XNAA 1A3KA 4A42A 3OF1A 3HMYA 4CDXB 2O0OA 4E2QA 3AYEA 4IESA 5IVEA 4E2GA 4ORFA 2VZSA 3TWIA 1ZX5A 4DUWA 5CADA 5C3OA 5FPVA 3TNQA 2XL7A 4ARYA 3PUAA 1EAH3 3FHAA 1FPN3 3ZDSA 1YWKA 5FYHA 3QCWA 1OURA 1IPKA 1W0PA 2D40A 3I3QA 2ZGOA 1LESA 3C7EA 1IQDC 1X7NA 3VKFC 3VBHA 2ZMNA 2GAUA 2XVKA 1UZVA 3K75B 3WLUA 1JYWA 3FBMA 1G9BA 2ARBA 2IC1A 4HVQA 1B35C 1CAWA 3M1HA 3IBMA 3WNNA 3HPNA 4I01A 1QJFA 2VCCA 4YPJA 2C24A 5JR7B 5FZGA 2HWB1 3BI3A 1QJX2 2R30A 1PX3A 1US3A 2WIIB 3EQEA 2YPJA 1UIKA 3OY8B 3VBRB 3GJAA 1BK1A 5CEHA 4PDWC 5LZ6A 3VDDB 4RQPC 1IS5A 2XKPA 3K77A 5C4WA 2RM22 3WW4A 4EWDA 5A3MA 1J83A 3M70A 4Y5SA 4BXSV 2CGNA 1JXNA 1VR3A 3TOJA 4DUXA 1X8EA 2VOVA 2QQWA 5FZIA 3SMHA 3MIHA 3QLQA 4IGPA 4RQPB 3RZHA 4W65A 1XYNA 4LKEA 1UAIA 2VNOA 3AX4A 1AYM2 1ZBE3 3BTYA 4FTSA 1S0IA 2ORZA 4YGEA 1C8M1 1YFYA 1VB2A 3NO8A 4HLTA 4J6GA 1YIFA 5CNAA 4A44A 1RMU1 1ND2C 3PIGA 5DAVA 4XFCA 4YVSC 1RHI1 4YZ4A 3SITA 4M4PA 3T0BA 1S0EA 2P3KA 1ALYA 5IK4A 5LW9A 2BNMA 2CSGA 3ZYGA 4XZPA 3MZHA 1YRZA 3ZXEA 1PVC1 1ODNA 4QKFA 4DEQA 1Z7S3 3L2HA 4JTOA 3WDXA 1YQ6A 2XHNA 1D4M2 1F5JA 1JZ5A 5LRSA 3OD0A 3QACA 4Y1VA 3T1LA 5I0RA 1PO22 3THTA 5HV4A 2O8OA 1OH4A 2R072 2AUYA 3K48A 4HL0A 4RGGA 4ZHNA 4XFHA 2YPDA 4N43A 3UESA 2ARXA 3IAQA 1DGLA 5FUIA 4MUVA 4LKDA 4G3YC 4LBQB 4OZOA 1CQ9A 2GP5A 1HQWA 5F8PA 5K4LA 4XILA 1O6UA 3EXUA 2ATFA 1CAUA 4AGVA 1KDKA 4C8DA 1PX4A 2P3IA 2ZEZA 4TLGA 2GN7A 2Q0AA 4XJZA 3TEXA 1TQ5A 4ZS2A 1NCRA 2ZGQA 2DUOA 3BYWA 4P14A 3W21A 2D44A 3MFCA 2Z42A 2W52A 4AEDB 5JXJA 1F35A 3VBFC 4V1PA 3WF1A 2FD8A 4E4ZA 3WZ1A 1PGL1 1OI6A 2MEV1 3J8F1 1W8WA 1H8VA 2JXAA 1YQCA 2PHXA 3DN7A 3KT1A 5BNPA 1CZTA 3OD4A 1IPSA 5DDJ2 2F4PA 2VVFA 3POEA 3QH6A 1UPIA 3E6DA 4YVWA 3WF0A 3W5MA 3WVJA 5FY9A 1AR91 4NVPA 4PQ9A 4D69A 1XBFA 1S2KA 2CY6A 2SLIA 2B4KA 1UYXA 4OUMA 3S57A 3ZXGA 4CEYC 2UWAA 3GDBA 5A7QA 4BB3A 3U10A 1VBD2 4IEPA 4GB31 5L36A 5A70A 3ZFFA 1MZ6A 4D3WA 4YARA 1XNKA 2DVFA 4Q1RA 3G6JB 1OFSA 2RDRA 3ZYHA 1FPN1 3MLLA 2RS12 4AK3A 3BGAA 3K46A 2WNOA 2JWPA 5FK8A 3VBSC 1FI2A 2VQTA 1BXHA 4UW4A 1EYBA 1RUI3 2A5ZA 1CIWA 5BYNA 4TSVA 1B09A 4Y20B 2ZGTA 2EIEA 4EN7B 4CU9A 2RE9A 1JH5A 1PK6A 3DPRC 3Q8BA 1WCQA 3UT0A 1MS9A 4XF9A 3VBSB 3WD5A 4JGZA 3VDCA 3N9NA 1W6QA 2XQRA 1W04A 4CCCA 4RS5B 3I2FA 3CZJA 2XMLA 2BTVC 2XOMA 3OSDA 3ZYBA 4P08A 2UU8A 2P5BA 4QPIB 3JCIA 3DPRB 3VKMA 4FPCA 5F2SA 1F2NA 2WFF2 3WNMA 2HEVF 2Y60A 2GU9A 3E6CC 4K21A 1OKQA 1GOFA 4NHXA 4NE9A 5FTTC 5L7OB 2WS92 5JIAA 5C5UA 1IKPA 2UY9A 4JDNA 4XURA 1LOEA 2UWBA 2VMHA 3L9JT 1UW8A 4MGSA 3ACHA 4P5YA 1LJ7A 1MS5A 1QXPA 1NAEA 1R082 4RN5A 1KS5A 3FUQA 2V4AA 1C57A 1UKGA 2YMZA 4KI5M 5FO9B 1VBE3 1LECA 1ZBE1 1AYN1 2YU2A 5JZGA 1LNSA 4PLOA 4GZ9A 1YYNA 3RG0A 1GZCA 4MOAA 5FLHA 1OOPB 3KVBA 4LBJA 4MGQA 2WAAA 1REEA 3ALQA 2XQXA 5FIXA 2Q8EA 2ZAAA 3LEMA 4Q4W3 3CLPA 4DXZA 5A32B 1FYUA 3KV5A 5JOWA 2YHJA 1Z7S1 4LOTA 4R8HA 4CUGA 3CIHA 2DV9A 3OGSA 3CNAA 4FTBA 3H3ZA 1Y43B 4QB2A 1S2EA 1ULDA 3K3OA 3HJRA 4KL1A 5J7MA 2B9VA 5IK8A 3EHKA 4LKFA 1UMZA 1Y9GA 1OKOA 2J1UA 4WVMA 5EIYB 1AX0A 3IM0A 4QQ2A 3ON7A 2AYHA 3WP5A 1ENRA 1XJAA 2HEYF 2W0XA 3O1SA 5FZ6A 1N3OA 2R7EB 4Y33A 5FP3A 3TEYA 3AZWA 2XVLA 1RUJ2 2JDMA 2FMYA 2JDKA 1GV9A 1GUIA 2W2IA 1YQ2A 4UBGA 4AFCA 5C9AB 3N9PA 1N1VA 1SHWB 4JZRA 4XF1A 1QQP1 4MHRA 2DUPA 3WF3A 2XJRA 1W6OB 4AVBA 3LPGA 4XC9A 2WNEA 3ZN6A 3ZKUA 2A6VA 4V2VA 2YUEA 1QH6A 2AEYA 2ZHLA 5A6ZA 1CX4A 2I74A 2LROA 4AI8A 2W39A 2IXLA 5C3SA 1JS9A 1BBT1 2W92A 1G6NA 3KV9A 4AVTA 4XQWA 5I0UA 2FDIA 3ASIA 3MLKA 2KM2A 5FPAA 1DYPA 3HQXA 2WQ4A 4S2DA 4EV0A 2VQUA 3DYOA 4QWNA 2WA3A 5FYUA 5KHGA 3N36A 3CJIB 3ZSMA 4E4DX 4LIUA 2VULA 1OF3A 3BOPA 4H55A 1GP5A 5I93A 3HVDA 1UCXA 3I2JA 3AMHA 4YW7A 2YFUA 4Y22A 4D0QA 2E53A 4E27A 4ASKA 4FPFA 3SC7X 2HBUA 1RJ7A 1ND3C 2OW4A 3M3OA 2Y0OA 4QGMA 4QKDA 4E9KA 4LOSA 3VBOC 1JN2P 5FZMA 2GDFA 4JGYA 1R1A3 4LTAA 4XCBA 2ZABA 4ITCA 2D7FA 2TEPA 2DVGA 3RJRA 4BISA 5IUQA 1RUI1 2DU1A 1UX7A 1RUF2 1HN1A 3QOPA 4QKNA 3ZVXA 1V9U3 3NAPC 4TLFA 4DPNA 3VZJA 1RVF1 2VPVA 1ASJ3 3PUHA 5J98B 2BEOA 1GLHA 3U75A 4QPYA 4AQSA 2Q1FA 5C70A 4IE0A 1CPNA 4LE3A 5L9BA 4JX0A 4EZHA 2QJVA 4LLOA 4Q4Y2 1H8TB 1PIV3 1UPSA 4RHV3 4BQXA 1TEIA 4L9BA 3WUCA 5F5CA 3WNOA 4XBLA 2FBEA 5DUUA 1K5MB 4HPKB 1DCSA 2VW2A 3RNSA 2ERFA 3MPPG 4Q0PA 5FYZA 3TEWA 1L7QA 3JD72 3IB3A 4IV1C 2NMNA 2W1QA 4XZUG 1WGPA 2RS32 4LULA 1OLME 4YG0A 5EYXA 1VBE1 1IS3A 1ZBA3 1AJKA 1OVPA 2CL2A 1GZWA 4FXGB 4I02A 3S6PA 4AE2A 2A3XA 1LHUA 4A6OA 4FOQA 1V0AA 2ZGPA 3B7MA 4YM3A 5AC91 5C8CB 2PA7A 3OB8A 4OVEA 4CZSA 4DO0A 3AKTA 3AFGA 4NRMA 4A7ZA 4Q4W1 4YSFA 1MQTC 3V0AB 2WQ8A 3DYMA 2FDJA 3TN93 2ZHKA 4OHYA 4QM8A 4CYDA 3U4XA 1W28A 3W5NA 1RUG3 3PMEA 5FKBA 3PDQA 3AZZA 3JXSA 4OYUA 3O1RA 3H1WA 3ZYRA 1XRUA 1HN0A 1KRIA 5FY7A 1QXRA 3X29B 4FAGA 3I49A 3LFIA 4B29A 2D3PA 1LEDA 2QUOA 1VAMA 4N53C 3WY6A 3O14A 3H0OA 4QQLA 5C71A 2CGPA 3IWZA 1RUH3 5J3UA 1NY71 5F9TA 2P2KA 4FP2A 3MICA 4ZONA 4FO9A 5FZLA 1SDDB 2OZ6A 1VAKA 1NOVA 4L0PA 2H0BA 2H6BA 1NUKA 4AEJA 1UOFA 3ABZA 2JB8A 1OMIA 1WKYA 3KCYA 4Q4X2
chains in the Genus database with same CATH topology
1DFQA 2VQAA 2ZMLA 4RSUA 2D6PA 1XNDA 3B9IA 4XYXA 3GALA 1JUIA 5T5LA 3ZFGA 2RR13 5D8AA 2C0ZA 4Z07A 5BUVA 3VL9A 1U5XA 2LTNA 2EXIA 1KITA 5F5QA 2R062 5CFDA 2DVAA 4G4FA 3RS6A 2I07B 4D7YA 5K8SA 1ZRFA 1NA1C 3HN1A 1X82A 4HKWA 1TMF3 2P37A 4GH4A 4WVWA 3BPZA 4FTEA 5K0UC 3NVCA 3BIWE 2CAVA 2D5FA 1V6OA 3VL8A 2E9QA 3ZPYA 3RYRA 2OPKA 4ES9A 5K0UB 1LR5A 2ZHMA 2IXHA 3NJZA 4XPVA 1J3QA 2VQ0A 1ONAA 1QNWA 4B7KA 1V9U1 4LE4A 4CDUB 2DU0A 1ASJ1 1A8MA 2HKXA 2RS52 1S1AA 3H1MA 2QQPA 3FFZA 1PIV1 4RHV1 4LHLA 4BIFA 4QQPA 1DLLA 1GKBA 3E5XA 3ACLA 1UX6A 5BNOC 3AKSA 4FT8A 3WQ0A 5AVPA 4AHXA 1QJU3 4QPGA 1CJDA 4HZFA 4CEWB 3VBUC 3S30A 3V64A 4AQ2A 2YGMA 4MZUA 5FLJA 2UYAA 3OGJA 3WCSA 4C0BA 1ZBA1 2B8MA 5KHHA 4AFBA 4XJUA 4BH9A 5H9RA 2WLQA 3FE5A 4LLFA 2JX9A 3ILRA 3OGGA 4IV3B 1HIXA 2G9FA 4BMBA 2NPIA 2UY8A 3H7JA 3KCCA 3R4DB 3VKNA 2A3YA 1ZZBA 1RUD3 1POV3 3TN91 2Z2SB 3ELNA 5HXVA 1CAXA 2XJUA 1HXS2 4X8NA 1RUG1 3JBG1 3ILFA 1YJLA 3AZVA 1BCXA 1J3PA 1URXA 2GH2A 4QD2A 4N90A 4BE3A 1QNYA 4MSVA 1GICA 3GBFA 4HKOA 4R52A 1C1FA 1LOFC 1RUH1 2IFWA 2JICA 3HIFA 4C1WA 3WG2A 2D5HA 1VBC3 2Q5TA 2HEWF 1QKQA 4ISRA 2OZJA 4Q2FA 1Q3EA 4U36A 5FREA 3INAA 1KD7A 3NV3A 2DVDA 4G9SB 1X36A 3PVOA 4BMEA 1R093 2PQQA 5GZCA 2XVGA 4EWEA 1D0GA 2E63A 2VMIA 5GLUA 2FZ2A 2PLV3 5BNNA 1UN1A 4WM8C 1O3SA 1RUE1 1Q5OA 1H1IA 4CDWB 3AJZA 3AKRA 4O9EA 3SH5A 1H9WA 1TMF1 4JQRA 4UW5A 2WNUB 4Q8KA 4HKLA 3BU7A 3WG3A 3BOWA 1JW6A 4AI1A 5CFCA 1GZ9A 2ZKNA 4AQ6A 2DCTA 2C1FA 1UU4A 5T52A 5I8TA 4ZKTB 3MIBA 4XIKA 3ZFEB 4AVVA 4FSJA 3OBTA 3E97A 1C5HA 2PN5A 1ULEA 2CTVA 4YG3A 5JOZA 2WZR1 1JOJA 3UKTA 3KB5A 3MLJA 3D6EA 2JG9B 3OTFA 5AFBA 4Q1PA 4AHYA 1AXKA 4XTPA 4ASMB 1CD3G 2VOWA 3RPQA 4ZXKA 3LA2A 4AFMA 1F8VA 2HWC2 2ZZJA 4YGBA 3I2DA 1C8M3 2BUKA 3CU7A 2R042 1GYKA 1QJU1 1SBFA 1DBNA 1ZA4A 2JG8A 3KQRA 1HDKA 1WD4A 3VBHC 2PELA 2WNVA 1PVC3 2GN3A 4N7IA 1VBB2 5DZFA 5T3NA 2Z5WA 5JOYA 2OVUA 1FAYA 1PO13 2ENRA 1AL22 4YW4A 3AZXA 2GSYA 4LBKA 2D6KA 2PHWA 1VBA2 2XB6C 2VH9A 3WDWA 3QH7A 2AREA 3GNEA 3CL1A 4XOGA 3HWJA 1U0AA 3BALA 2X5IA 1V6MA 5GJ6A 2VNGA 3VKLA 1POV1 5FPZA 5FQ0A 4PBPA 5EV7A 2HWE2 4HMZA 3RWNA 1RUC3 3ATGA 3ZXDA 5C4WC 1LB2A 1QJY1 1VRH1 1GNZA 2XJQA 4BYYA 3FLPA 3KMHA 2ZGSA 4WM7B 4BQ1A 4JAAA 2ZGMA 5L19A 4JTNA 4DZGA 2UURA 3B94A 5C4WB 4LO5B 3E5QA 1JYCA 1TME3 4IEQA 2Q4SA 5CB7A 2R32A 4I3PA 4N9IA 5K9YA 2MEV2 2B39A 3GYDA 1VAVA 2TBVA 2D6MA 2UYBA 3J8F3 1ZVFA 3VZKA 4CTEA 4X6RB 1VBC1 4CDQB 1EPZA 1WW6A 4H14A 1G9FA 2C9AA 2HWD2 2FQPA 5CU1A 1G86A 2ZAHA 1W6PB 3LSEA 1AR93 5DZGA 1CAVA 3AZYA 5BV6A 2VMGA 2GALA 5GZDA 2GMMA 4SBVA 2SBAA 4N43C 4XFIA 4L99A 1R091 3RYPA 3KT7A 2DUQA 1EAH2 1NE4A 2PLV1 4GB33 3CF6E 5J09A 4FPLA 4WV8A 1NCQA 1IGOA 4L2NA 3DKWA 1AVBA 1YO8A 1GQGA 1YCIA 3I4IA 5JDBA 1NCRC 3SH4A 3USUB 1M06G 3SCFA 4FPJA 4W6WA 4K40A 4NHKA 5EWSA 1Y9QA 3BTAA 3LA3A 1SFYA 1KJLA 1XXNA 1BEV3 4XE9A 4RR3A 4FVVA 4DINB 1OPMA 1IPJA 4AEKA 5BNPC 4BLJA 1B35B 4Q27A 4TYSA 4QMAA 4YVWC 2D3SA 1QOOA 1SLCA 3J4UH 1EV11 5JSRA 2PYTA 1BVVA 2BFUS 4PCRA 3PJQA 3RYKA 2IWGB 1VIWB 1M4WA 3KS7A 4C90A 1SDWA 4PDWB 1ZBE2 2UWCA 4HANA 1NQDA 1NE6A 3ZXFA 3WP3A 3H3UA 3ZFFC 5C8WA 1AYN3 2HWF2 4YLZA 2TNFA 3ZXLA 2VVDA 3MW3A 4OI4A 1QJX3 4IXLA 4XJWA 4C1XA 1LULA 4XW3A 1PK6C 2EAKA 1SLIA 3D5OA 1ND2B 4JGZC 1W6NA 4LHNA 4P9XA 4YVSB 3ZSEA 1RTVA 2RM23 1PO11 3QBQA 1Z0HA 2B42B 5ABJA 3FBYA 4WVZA 3KD4A 4QT6A 3WXPA 3VZOA 2MPFA 1HRI1 3USSA 2BW8A 1AYM3 2GNMA 4LHKA 2RMU2 1FMD1 1LGNA 4YYOA 5SV5A 3GZAA 1DU3D 5DUVA 4P9GA 1RUC1 2XUMA 4RA0A 3LA7A 1DGWA 5JMCA 4A7YA 3JUUA 1XYPA 4CDXA 1MACA 1TME1 1QQP3 5JZGC 4XF4A 4NO4A 3A0KA 5ACA2 4ASLA 2A6ZA 5KWRA 4YNIA 3MIFA 4I0AA 4FQZA 1S55A 4MV2A 1BBT3 2PAKA 3VN4A 1HV0A 2IXJA 3VBFB 2WA4A 1Q43A 1CONA 1AX2A 4MX3A 2XL9A 1MVQA 4XDQA 1H1AA 3AP4A 4HN1A 5A33B 2NMOA 4XFFA 1MZEA 1L3JA 1H2MA 1FT9A 3IDBB 2JKBA 3B69A 3VBRA 3TAYA 3RMXA 4XHBA 3WV6A 4JV4A 2GMPA 4I2OA 4CEYB 1RUI2 3VDDA 3WP6A 1DGRN 5KXEA 2ZJCA 1WLDA 1WLTA 3WDUA 4JDMA 2WQZC 1RVF3 3AYAA 1AR72 1BEV1 3RSJA 1S2BA 3E6BA 3FLRA 3SCHA 3MF6A 1OHFA 3UV9A 4L92A 2VY0A 3ZN4A 2VGDA 1VBD3 3B5LB 4H7MA 1ZRCA 2DFCA 1LHVA 2ZS6B 1OFNA 3DGTA 5FDBA 2EALA 3BODA 2N7GA 1DQ1A 5T55A 5J48A 3VHRA 4KQ7A 3MIGA 1J59A 2LUWA 3VZLA 4MGIE 3RI8A 1Q8QA 2P17A 4I30A 2AR6A 4LBQA 4S2FA 2RJLA 5EXOA 5BNQA 4HT1T 1S0JA 2GH8A 4JGYC 1QJX1 4BLIA 1UF2C 3IKWA 4ZU4A 4AF9A 5AC93 4Z2WA 3KCXA 5CA6A 5FMOS 3P3PA 2ZKLA 4AEDA 3MEPA 1G8WA 2RM21 1FOD2 2XJSA 1GFF2 3R6SA 2X29A 4YGCA 1UU5A 1HKDA 4LNVA 1AYM1 3D0SA 1RUNA 4K7JA 1XNBA 1SQ4A 4KWLA 3D8CA 2IXKA 4MXVA 3RRDA 5GM0A 4INDA 3E5UA 4FPGA 1QGLA 2DURA 1D4M1 4MGKE 4K6BA 1PO21 3WDYA 4J1WA 1AJOA 1XU1A 2FMDA 2R071 2RJKA 4LBQD 1KFXL 4URTA 2BVBA 4K20A 1DQ6A 1POV0 3ZXAC 4Y20A 4M3CE 5BPXA 1CR7A 3ILNA 2KXLA 1WUVA 3WW1A 5I0SA 1GANA 3S0MA 4YFWA 4ATFA 1IKQA 4RS5A 3RMYA 4UW6A 1VLNA 1YFXA 4QPIA 2VVEA 3C2UA 3ZX7A 2YGLA 1QHDA 4XJAA 1AHSA 1R1A2 5L7OA 3W9AA 1LHNA 2BBVA 2XLAA 1ND3B 5DXDA 2VOXA 3IPVB 1MZFA 3VBOB 1AR62 1ASJ2 4IEZA 2V09A 2W68A 4R4XA 1ENXA 2X53S 1QDCA 1ULFA 4Z92B 1I5ZA 1PIV2 2WSUA 2Y0IA 4R9BA 4R4ZA 4RHV2 3NAPB 4PLNA 1OOPA 5D8AC 1AUYA 1VBD1 4W6YA 2B46X 5D1IA 2ZGRA 3U07A 4BCUA 4DY3A 3AMNA 5CFDC 1V6JA 5A32A 2PHDA 5JOXA 2RS11 5E16A 1DDLA 4ZU5A 2EVXA 3TB0A 1RB8G 2YY1A 3MIDA 5GLTA 1FATA 1GBGA 3WCRA 2BQPA 1RUF3 1OA2A 1COV3 4GH4C 4HN0A 3ZYPA 5EYYA 4GALA 3H9AA 3PVNA 4EWAA 4Z1VA 1MEC3 4KH9A 5KBFA 3I59B 4LO6B 4DRVA 3NV1A 4WBBA 2MNGA 4IV1B 5FRAA 3PVEA 5T5PA 4AHZA 3SXWA 1HRV2 1D2SA 5J96B 1H2KA 2R1DA 4YRDA 3VLBB 3V65A 5E89A 2CYFA 1ZRDA 4MXWB 3NW4A 2WC2A 3FZ3A 5FPXA 5C9AA 1O4YA 2WS91 4DRRA 1FNZA 1RIRA 4FPKA 4HSLA 5K7PA 2ZBJA 1YHFA 3JBG3 2LM3A 1MQTB 1R081 5E88A 1U5YA 3GHMA 3WP4A 1JYIA 2DTWA 4B3NA 1RUH2 5GKAC 4NWWA 4QPGC 3CJIA 4LO7A 4XFAA 2WINB 1HV1A 3JB8A 2VOKA 4HBNA 3ZYJB 4N53B 3WW3A 1XU2A 2ZX4A 2ZTNA 3HAGA 3OCPA 3KZ4C 5LK7B 1KDMA 1ZM1A 2RR12 3SHRA 3URFA 2NQYA 4XJ9A 2XJTA 5JSOA 4QGNA 1D2QA 4Q4V2 1N3QA 2G9GA 4Y1UA 2D93A 4R9DA 1YNAA 3SISA 1UU6A 1W6MB 4QX5A 1RUE3 4PIYA 3FJSA 3M3QA 2BVVA 2A70A 1HX6A 4YGDA 1N1YA 4AVSA 1H8TA 2JENA 1LKNA 3FX3A 3ENRA 1E57A 1NA1B 2YXSA 5JWPA 1K5MA 2P3JA 1Q8PA 4HPKA 1ZZ7A 4YM1A 1DQ4A 2ET1A 2IXCA 3ZSKA 4ISQA 3GZTB 3P3NA 2GNBA 4P9LA 3Q9OA 1G9CA 3WUDA 2AENA 2JE7A 3OPZA 5FOJB 4LR4A 1BMV2 2ZOEB 2WZR3 3O0XA 3TNPB 1PM7A 2QKDA 3PTYA 1QH7A 3OYWA 2E6VA 5C8CA 2EA7A 4X8PA 5BNNC 2ZGKA 3V0AA 1LHWA 2XBO3 1SACA 2XG3A 1O4ZA 4KG0A 1MS3A 1SLTA 1QMJA 2GC0A 1QY4A 1RUF1 5BNOB 1COV1 1UZZA 3DV8A 3V0BB 1SBEA 3OJBA 1PNFA 1MEC1 3WX5A 1FV3A 5CFCC 4AI3A 4AYUA 2RS53 5KC5A 3VBUB 2XJVA 1AR82 5FBZA 4Q4Y1 2EAAA 2ZZQA 3RDIA 5AVAA 3WG1A 4FOYA 1RUD2 3HT1A 2QE3A 4LO4B 2PFWA 1AX1A 4XQ4A 1OLQA 3CJXA 1MS8A 1QJY3 1VRH3 3FLTA 2A6WA 4KWKA 3B9CA 1H4GA 4Q26A 4S2HA 1H9PA 5HI0A 2RS31 1NXD1 2PAEA 2R16A 4OI1A 2DWRA 2K0GA 1QDOA 2MHFA 1G7YA 4EN0A 1AXYA 1HQNA 3J26N 1VBC2 1ZZ9A 2JG8C 2D6NA 1KXGA 4KGGA 2X8KA 1LU1A 4KGQA 4N7UA 3WT3A 1PGW2 5JVVA 4GKXA 4KG8A 2WNVC 2QFEA 1Y7BA 3WDTA 1ZZ8A 1HXS3 1LU2A 3AP5A 2E51A 1O3RA 1R092 5CG8A 1YIPA 3ES1A 4AFAA 1OQ1A 4J1XA 1H2LA 5K0UA 4OZXA 3RI9A 2X5IC 2ZCWA 3VUOA 2JE9A 1MZ5A 3SCGA 4MLOA 3AXDA 2JEMA 3RJ2X 4CDUA 5GZGA 1JUHA 4FPHA 4YW3A 4NR1A 4N9HA 2A6YA 4WM8B 2WL1A 3SNMA 1UZYA 1NYWA 3FFQA 1OSGA 3LCPA 4Q4X1 2E7AA 5C6CA 2HWB2 3AFKA 1MS0A 4F3JA 1V6KA 1PNGA 3WHUA 4OUSA 4D7TA 4Y1XA 3MI8A 4WZFA 1Y3TA 4YW5A 4CEWA 3S7IA 1VJ2A 2R061 1EV13 5CVRA 1QJZA 4K1YA 4OULA 4M3CB 5FFOC 3IN9A 4EN9B 4L11A 1EPWA 4FPEA 3FMGA 1PZ7A 5H9PA 4IV3A 2WJSA 3EJKA 3H1YA 5EFUA 3V56A 3O0VA 1C8M2 3LB9A 1RMU2 3KGLA 1WCDJ 1V00A 4NHLA 4IEXA 1RHI2 1MS1A 2XBO1 4BOWA 4C91A 2R1BA 3AYDA 1QOTA 3B00A 1U5IA 1PZ8A 2DCZA 2Z79A 2V5YA 3KSCA 1PVC2 2Z69A 1CGPA 1Q8VA 2AZ5A 5KXBA 5T54A 1PGSA 3A0NA 1H4HA 4RR3C 3LZZA 5CIRA 3VBHB 3O7OA 4YM0A 2RS51 2B7YA 4B4PA 3KM5A 4K9SA 4HSJA 4LUKA 1C3HA 1CAWB 4CP2A 1O3TA 1HRI3 1I3HA 5BY5A