3J26N

The 3.5 a resolution structure of the sputnik virophage by cryo-em
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
362
structure length
362
Chain Sequence
EPDTVYYDILIPFKPNDQGFSPAIFQAQLTQPIVHNPSEYFLSVVRFSIPTQNIPLTIPQIQPYPNTNVNNTIYSVSIGYNGTYSSQNFVQFDPSLTSPNIPAPNAPTVTSPNVEVTPYYYIYDYSTFLQMINTALENAFNEISAPVGADAPFFFYDSNTEKISLIAQAAYYDRTLTTPIEIYCNVNLFTFFDSIKHIGLGYNTPTGRDILFDVRFLGNNYYQDPETAPSYPPEFIQMQQEYPTLSNWNAVKTIQLVSNLLPINKESIPSFRNSNVGIINAQGILADFVPLVTNGPEARISIDFVATGPWRLIDMFGSVPIYMVDLYVYWTDQTGGQYLINIPPGRILTCKLVFIKKSLSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Sputnik, a virophage, at 3.5-A resolution.
pubmed doi rcsb
molecule tags Virus
molecule keywords capsid protein V20
total genus 25
structure length 362
sequence length 362
ec nomenclature
pdb deposition date 2012-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1100 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3j26N01
3J26N
chains in the Genus database with same CATH superfamily
2DF7A 4RR3A 4IV3C 1NX9A 3QH6A 2GNTA 4HBNA 4DUVA 5FZGA 4E8CA 3ACIA 4L0PA 1G7YA 4D7YA 5CISA 1D7PM 1PX3A 3VBSA 2VZUA 4BQWA 1TZOA 1CZVA 1W8NA 4EROA 1SFYA 3UETA 4KU8A 4FPGA 4YYOA 4WBBA 4N7IA 3RI8A 3INAA 4OQ9A 1ULPA 3CMGA 3H8XA 2ZGKA 3F2ZA 2LW8A 1CX1A 1OA3A 1SCRA 2G1MA 1ZBE3 5JSOA 4AK3A 4UXAA 1LEMA 2YC0A 5BNNA 4PBPA 5A70A 5FPZA 1HQLA 5EFUA 1WD4A 5ACA1 1W03A 2B8MA 1V6IA 4BH9A 2QVSB 3NRUA 4MXWB 4LLFA 1WLDA 4LO8A 3VHOA 2BQPA 4AVCA 2ZMNA 1UU4A 3L2HA 4GZ9A 1RUF1 1W9WA 4NWVA 5T55A 1OOPA 5JI9A 2HWF1 1IKPA 1RUJ3 2VOWA 4WZFA 1TMF2 2ARCA 1ENSA 1IG3A 1QOTA 1JH5A 4O9EA 5B4XA 3RQ0A 4AW7A 4MSVA 2JIJA 1KD7A 3NV1A 2YDEA 3KT4A 3HAGA 4BQ3A 2W1SA 1ZBA3 2JG8B 1AR92 2ZAAA 1PK6B 1LHVA 5LASA 5E8AA 3BTZA 2JDNA 3OY8A 2XQXA 4OI0A 1VBC2 4LA3A 4YPJA 3A4UA 1BKZA 1R64A 1UX7A 4GWIA 5BNNB 1O3RA 3WNNA 1U5ZA 4AI0A 5KBFA 4QDQA 3OBZA 3J7NA 4FFHA 1LOBA 1SLAA 3OG2A 4CEWC 1DLLA 2K9ZA 5ISLA 1CONA 5DUXA 1YRZA 3MUZ1 5A6XA 1CAUB 1V6JA 2J7MA 5DUUA 3TAYA 4BZ4A 1SLBA 4RS5B 3O1RA 1BVP1 2I2SA 4IESA 4YZ5A 1GWKA 5IJRA 4FBFA 4XTMA 3RZKA 3USUA 1W8HA 2B9VA 3GF6A 3ES4A 4I02A 4IEOA 4P5YA 3RVHA 2KA3A 1HRI1 3FBYA 1YIFA 1HRI2 1UZWA 2WN2A 3PLQA 4XTPA 1NCQB 3DV8A 4FPFA 5LBBA 2W46A 4PF5A 2ZHLA 3GHNA 3KCCA 5FYBA 5I8TA 3RZGA 1ZX5A 1W9TA 5KHJA 1RUG2 2PHLA 2JG9C 2RVAA 3BODA 4AVBA 5BNOA 1BEV2 4XFBA 5FZLA 5FY5A 4AYUA 4CXWA 4K40A 4BA6A 3OEBA 4X8NA 2D5HA 3KGLA 3THDA 4N9HA 4C0HA 4L11A 2RR12 3K4ZA 1E5SA 3LE0A 4AEDC 5FYIA 2W1UA 3WDWA 4HANA 2ZHNA 3ILFA 3OCPA 5FP9A 4B4QA 2W1QA 1AVBA 5C3OA 1DZTA 2X09A 4DUWA 4HT1T 2XHKA 5FYYA 4YVSA 2ZX4A 1GP5A 3AL6A 4D6QA 3USSA 3MV01 1QHDA 3R4DB 1MS0A 3B02A 1SACA 3OY8B 2RMU1 2VVDA 3RRDA 4Q4Y3 3WOGA 5BNQA 1Z7S2 4NRMA 2OKXA 2FMYA 3WG2A 1UY0A 4LK6A 4DEVA 3JU9A 4KG0A 5LWBA 1M06G 3P3NA 3LFIA 5GZGA 4AQSA 2ID4A 1HQNA 2LUWA 4XJ8A 4FPHA 4QX2A 4CDWC 4TSVA 3RZJA 3HR9A 3JCIA 1WZXA 2VL4A 3PDQA 1VB2A 3SEEA 1LEDA 2R1BA 4L9BA 1AL23 2UY8A 1ULOA 1YI7A 1UXXX 1LNSA 2HWD3 2MEV3 5ANNA 4N43B 3K3OA 4QQ2A 1TME3 3HD8B 3BU7A 3MGUA 3ZR5A 2VTFA 4J1XA 3SHRA 2EXHA 4NHKA 5J48A 2XPJA 3CKHA 1EY2A 1RUE2 3ZIXA 1XYOA 3VBRC 1W6PA 3CIHA 3HQRA 4M0HA 3ZO0B 1O3SA 4MXWA 2ORXA 3VDDA 5BNPB 1S0EA 1VRH1 4UBGA 3PTYA 5FZIA 5FZKA 4R52A 5AC93 5FMBA 3UT0A 2EA7A 1UZVA 4H2AA 5ACA2 3VD9A 2GC0A 1KS4A 5J36A 3OGGA 2HEWF 4MG2A 4A6OA 5C8WA 2AH2A 4PLNA 1W6QB 4A41A 5DAPA 2IFWA 5A3LA 2BWCA 1Q5OA 1DQ6A 5FZ1A 1IG0A 2PHDA 3T2OA 2E7AA 3VZLA 4B4RA 5FQ0B 4QWNA 2ZAHA 2WZR1 3T2TA 1BZWA 1W2TA 2IUWA 1YFUA 2J42A 2WSUA 4MADA 5F1RA 1DCSA 3BI3A 3T08A 4Q27A 4A42A 2BGPA 1JS9A 4BM8A 1SFPA 5GLVA 3I2IA 2ZGQA 4FXKB 1S2EA 3WQ1A 1G9DA 4Q4V1 4LXLA 2VXJA 3SH3A 2R063 1BBT2 1DF0A 1HIXA 4QM8A 5A80A 3KQ4B 4CCJA 2VCCA 1DGWX 1O5LA 5DPNA 4WVVA 5F5QA 4M0NA 3K2OA 1NQJA 3TNQA 1COV2 4YW3A 4FQZA 1AR61 1GSLA 1OLMA 5F5IA 3WHUA 4LBQA 1LAJA 1W8FA 3ZXEA 4PDWA 4MH0E 5IHRA 1JZ4A 1AR83 2AEZA 4DO0A 1RXFA 1OHFA 1XYPA 5JZGC 1ZYBA 2Q1FA 4JHTA 2E33A 3RPQA 1RUNA 2LALA 4CPBA 5GZFA 4CDXB 3W5NA 1UKGA 3GZTB 1GQGA 3AMNA 4HKLA 4RGGA 5CBLA 1R091 1TMF1 4UFHA 3LQCA 2N7GA 3SCFA 4LULA 3B9CA 1PGW2 5T52A 2YROA 2HWB2 4YGDA 1VBE3 3ALQA 3V0BB 3DN7A 1PX4A 3ZFFA 2JD9A 4LKFA 4TXWA 1JOBA 3ES1A 3HOBA 4GD4A 4XC9A 1JU4A 2ZGOA 5FJKA 1GBGA 1JI6A 1W6MA 2IFRA 4HETA 3C8XA 4XEZA 5LBCA 4XMIA 1ZA7A 3LSEA 4FPOB 4B29A 2HWC2 1G9CA 4EZ4A 3EXUA 1NE4A 1PNFA 1UOBA 3KVBA 2VMIA 2R042 3J9SA 3MO4A 4HZFA 4RQPB 3E5UA 4DPNA 2JDPA 3FLPA 1ND3C 3WG4A 4IEVA 3VDBA 4LKSA 2PQQA 4XF9A 2QDRA 3O1SA 5JOWA 4F7ZA 3I2HA 1QJX2 1LENA 2WO3A 4Q29A 3RYKA 3RZHA 2IXCA 4Q4Y2 5IVJA 2DFBA 2C26A 4NHXA 4LK7A 3MEPA 2DVBA 5I0TA 4Q4X3 2VUJA 4OI4A 1QJU3 1PVC1 1W8TA 1V6MA 1H6YA 2UWAA 3MZHA 3UKTA 1DFQA 4MYEA 1HXS3 1YI9A 1HX6A 2ZOEB 3P1IA 1UZ0A 3CBNA 2HWB1 1AL22 1EAH1 4NHLA 2AENA 2Y6HA 4AFCA 1UXZA 2QKDA 5J7MA 4HK8A 4K21A 2PLV1 1NLQA 4BLJA 1A8MA 1MQTC 2Y0IA 1UU6A 1J3RA 1UYXA 1JZ6A 3DYPA 3OUHA 4RN5A 4FQ4A 4N43C 1V9U2 1NLRA 2ZGNA 4UFJA 2DBNA 3Q8EA 1DGWA 3WF1A 3CJIC 1PO12 5ERLA 2YBKA 3N9MA 1F4AA 1NZIA 2OYZA 4P14A 2JIGA 3BU0A 3WD5A 3OF1A 3HT2A 4Z2WA 2CGPA 4AI3A 4Q1PA 2W1WA 2WRAA 2AR6A 4K7JA 1GANA 4YW5A 1A34A 1HRV1 1BK1A 4IE5A 3W59A 4LEJA 4RHV3 2LS6A 2A3YA 5LY1A 4PLOA 1H9WA 4D7TA 4JGYC 4IEUA 1ULEA 2JDUA 3R05A 3WNPA 4Y4YA 5FLJA 3UJQA 3K51A 2XJRA 3AP5A 2JKXA 1ZRFA 2W68A 1I1EA 2ET7A 4NOTA 4BK4A 2XWJB 1F5FA 2HBUA 4Q4W1 4XQWA 2UWBA 1ASJ2 5JMCA 1A6CA 4COUA 1NG0A 3I3BA 3J26N 1ACCA 4XVHA 4K9SA 3ST7A 3K48A 2I07B 4NIDA 3ASIA 4CDWB 2OA2A 1QQP2 2YHJA 1EPWA 2DDUA 2VH9A 1UWWA 2XOMA 3B69A 5IVCA 3BVCA 3T1MA 3NMBA 4EN7B 3M4FA 1QJX1 5L9VA 1QJY3 3Q8FA 3OYWB 4URTA 4AHXA 2IXIA 5KHIA 1X50A 3APBA 4AVAA 2VW1A 4F83A 2VE1A 4Q8KA 1OQEA 3AZWA 4P9JA 3V0BA 3ZFEB 3KMHA 2R32A 5T3NA 2XJVA 3IB3A 3MBWA 2WFPA 4HPKB 4YVWA 4IW3A 5K4LA 4DXRA 4ZS3A 1RUH2 4WM7A 3VBSB 3OEAA 1OKQA 3TOJA 3WCRA 4EWEA 1UU5A 4XFAA 1W8WA 1VP6A 3NW4A 3N35A 5CB7A 1VBE2 1WCDJ 2J1EA 3I2FA 3USUB 3AMPA 1O91A 2JG9B 1W6NB 4QXKA 1YC61 4L2NA 1VBD3 3LZZA 3QBQA 1D2SA 1WMEA 3ACGA 5ANQA 2A71A 3V64A 1N1VA 5FZBA 1FOD1 5KXDA 4NROA 4DXSA 1JZ7A 1WW6A 4O7XA 2WS92 2GNDA 4NMIA 4XFGA 5FAXA 4CP0A 1KFXL 1OH3A 2R043 4N53B 4O65A 1DGLA 1N3PA 4QPGA 5EIYB 1TQ5A 2JDKA 3WUDA 4A45A 2GNBA 1PO23 4JRAA 3T2QA 2V4VA 4QQLA 3UL2A 4ZONA 3OPTA 1PK6A 2W87A 1JYTA 4JAAA 3WY6A 1SLIA 2D3SA 4Q0VA 4RFT0 1CWPA 1XU2A 3VDAA 4KGGA 2CTVA 3OOXA 4KMQA 1GNYA 1VIWB 3OYWA 5FPLA 2ZHMA 4XQ4A 1RMU2 5C4WC 1W0PA 2WZR2 4P9GA 3FBMA 4FFIA 2E26A 5FY0A 4CEYB 1UY1A 2Y60A 1YXWA 2YXSA 4WM8B 4DB5A 4FAGA 2GMEA 4BPZA 1W8UA 3WXPA 4W50A 1L7QA 1ST8A 4QXCA 2OT7A 1IQAA 4BLIA 1FOD2 5KC6A 4V2WA 1SPPB 2AUYA 3SKVA 3ZYRA 3CZUA 5CIRA 3BTXA 4GKXA 1JUIA 5JVVA 2VZOA 4OHWA 4AEMA 1SG3A 1OVSA 3WNMA 2XMLA 4FXGB 1DQ2A 3VBRB 3U07A 4Y5Z0 3TNPB 5C33A 3C3VA 5EJZB 4BQXA 3C7GA 2P2KA 1VBC3 2HBTA 3T4VA 1LOGA 1KXGA 4GIQA 4IL7A 3AYAA 3NWKA 4O9GA 1BEV3 1RXGA 4ZU4A 3TWIA 3ZXKA 4XUQA 2RS53 1LKNA 1UPIA 2A3WA 2QQVA 4N90A 3WDTA 5A32A 1DDLA 5LEJA 2R072 2BJSA 1UYZA 1DYKA 4FOVA 4YARA 2DBIA 2JXAA 5C71A 5HXVA 1E57A 3T1LA 1PIV1 2X53S 4GB32 4AQ6A 2R0FA 4JTOA 4WM8C 3RMYA 1NY72 1W05A 3NJZA 4QT6A 4QPGC 1QOSA 1CD3G 2A75A 1AXZA 2ZX0A 2X8KA 2WAAA 5KXEA 2D3RA 3WW3A 2V73A 4QGMA 5EXOA 2NQYA 4D0QA 4BHPA 1OT5A 1W2AX 4R9BA 4X6RB 4CDUB 2CSGA 1OC1A 1XBFA 3BALA 1AYM1 4Y26A 5DZEA 4OHZA 4CU7A 4EWAA 2RS12 3WR0A 4JKKA 4LORA 4KGQA 5I0RA 1JBCA 5A3NA 4YM0A 4XUTA 2UYAA 3IPVB 1KFUL 2HWD2 3I7DA 2OZ6A 3LFMA 4M3CF 3E1F1 5GZDA 1LODA 3GCXA 2BYVE 5JIUA 3HJRA 4JTNA 5BY5A 4QD2A 3IN9A 5L7OB 4QB2A 5FZ7A 4XHXA 1QF3A 4AI1A 1BMV1 4Y1VA 2ZCWA 1XXNA 1SCSA 1MEC3 4CP9B 1CZTA 1QNWA 1G6NA 1OXCA 1TEIA 1W6PB 2WT0A 3BOWA 3HNMA 1IKQA 3LWCA 5FBJA 2QQPA 3FMGA 1ZBE2 3EQEA 1J84A 1UQXA 4A6SA 1NE6A 5FFOC 1OFNA 1OUSA 4QM9A 3FN9A 1OSGA 2G4IA 5A6QA 4OMDA 1VMFA 3K75B 4HN1A 4CEWB 5GALA 4C91A 1UZZA 5JMOA 3WF4A 4COYA 1VBD2 4XUOA 4PDWC 1UL9A 3UV9A 5BNPA 3N9NA 3DUIA 4W65A 2VMCA 1MZ6A 3HIFA 3GHMA 4I3GA 2XJTA 3WNOA 3FHAA 1LRHA 3LA3A 3URFA 4EN0A 4YGEA 2QZ3A 2W47A 1AJKA 2VCBA 4G9SB 3RFRA 3ZFGC 4Z82A 1GYKA 2R30A 4AFDA 2FHRA 2ZHKA 2ET1A 1RTVA 3LDKA 4XIOA 4HMZA 2OZJA 3MLLA 2R071 4RFRB 1GP6A 2XDVA 3BKZA 1FMD3 4B3NA 3NV3A 4QXHA 1PO21 2O1QA 3KGZA 4TZDA 2R062 4GH4C 5CFCC 2RM21 1IS6A 1BVVA 2JE8A 2VQAA 4QPIA 3AFKA 2D6LX 1J59A 4AE2A 4QU1A 1RMU3 1K45A 2GP5A 3VL9A 1OLRA 2VMEA 3FWEA 3K3NA 1ZZBA 2A6WA 4N8MA 2C9AA 1VBD1 2W5FA 3MF9A 5M0TA 1ULGA 4WM7B 5FY4A 3WP4A 2BEOA 3H8RA 1GQPA 3POYA 3H8OA 3I2GA 3HVDA 3AYEA 5FOBB 3C2UA 4Y22A 4CA9A 2D43A 1DBNA 1ENQA 3ZPOA 2NYYA 4CCEA 4FTEA 1E5HA 1W9FA 1C57A 4R9CA 3WDYA 4YSFA 3NVCA 2HWE1 4IEQA 3CJIB 3AVSA 2QQWA 3O1PA 1CAXB 1RUI3 1O7FA 4KWKA 2OQ7A 5C9AB 1MS3A 1PM4A 2VW2A 3MYXA 4FOWA 4CDUC 1HLCA 2RS52 4P00B 4YGBA 3PVOA 3I8TA 2E9QA 2ZXQA 2RJKA 3NKTA 5AFBA 3VN4A 1VRBA 3U10A 3LA7A 2W95A 2AZ5A 1JN2P 1WCQA 2X05A 1QJY1 2WL1A 4LUMA 1DYPA 3I54A 4HG6B 1AR82 2EF6A 1RVF1 1A8DA 1RUD3 1TE1B 1UY4A 2A6XA 3CO2A 3GGLA 3U0ZA 3N9LA 3POWA 3BPZA 4P9LA 3KT1A 4LITA 4UF0B 2W0XA 1IQDC 5FV3A 3CJIA 4YLZA 5FO8B 1FI2A 3BGAA 4RS5A 3OBTA 2Z42A 3KB5A 3CZJA 3VBUB 3O12A 1LR5A 4QHBA 5GZEA 3AP4A 4JKMA 3SITA 4GH4A 3T3YA 2JD4A 3POIA 5FP3A 5LATA 4D69A 5CFCA 4JGZB 5HXMA 5EP9A 1OPOA 4XBLA 5A1AA 4Z92B 1NA1B 3UNPA 3SKJE 4AHZA 3H0OA 5H9RA 5I8SA 3VHPA 2VD7A 4ISQA 1OA4A 1WMXA 1J3QA 2P6HA 4FPKA 1O3QA 4XF1A 3RWNA 2GMMA 2V09A 4QX0A 2VMGA 3AB0A 1LGNA 1XE8A 3ELNA 1QH6A 2OUJA 1KDMA 3C7FA 5FYMA 4B7EA 1RUH1 4AF9A 1YYNA 3AC0A 2SLIA 4UFIA 1FATA 2W08A 1VB4A 2PELA 5IATA 1RHI2 1SHWB 4R9AA 3HWJA 2KXLA 3AXDA 1KITA 3UK9A 2IZWA 3MICA 1DIWA 2RDRA 5AC92 3LDBA 1REDA 2W92A 5C3QA 4BE3A 2TUNA 2HH9A 4JCKA 1W8ZA 4Q0QA 4W4ZA 4C8DA 3ORJA 4LE4A 4COZA 2ZX2A 2DCKA 4NRQA 4DRVA 2B5HA 4FAHA 1QMJA 1O59A 1DU3D 1MZEA 2P34A 4Q4W2 2HJIA 4LPLA 4GKYA 4HVOA 1AX1A 2OPWA 2VUAA 5CG8A 3DGTA 3GDBA 2HWE3 1HXS2 2BU9A 4IEWA 4MGKE 1ZA4A 4YVSC 5EJ3A 4YZ1A 3B93A 4MGYE 3TEZA 5FO7B 5JXGA 3ZYHA 4BQ4A 5SV5A 4B8EA 5CU1A 1QJU1 4UI9L 5LB6A 3ZYPA 1K42A 4AI2A 1CPMA 1TG7A 1YNAA 1J83A 4JGYB 1H0BA 2P3KA 2ENRA 1RYYA 2PHFA 4ASMB 1AYN2 1DGRN 2OIIA 5JI7A 4CTEA 2D6OX 2HYKA 2X5IC 4GAZA 4QPYA 2XJPA 2FZ1A 3WF3A 2F17A 1V6LA 4DMIA 2EXIA 3T30A 2MPFA 1YFYA 4E4HA 1JZ5A 1QJZA 2FCTA 2EIGA 4I01A 3O7OA 4QB1A 5SV8A 3WX5A 5FZEA 3TEXA 2ZGRA 5FPUA 1K12A 1O5UA 3I2JA 4RQPA 2RM23 5IK5A 1W6OA 3M1HA 2WNEA 1RUC2 3J4UH 4AVTA 3ACLA 5IVBA 1XYNA 2D40A 4PIZA 1ZZ9A 1PVXA 4Y20B 3OTFA 5FYCA 3I3EA 3U4XA 1CQ9A 1YQ2A 5LW9A 3UGHA 5A3TA 2CV6A 1SDDB 1EP0A 2I45A 2R073 1ND3B 2SBAA 4M00A 2KM2A 1JYCA 4IETA 5ABJC 3WF0A 1H8TC 1MS8A 2XWBB 1CAVB 4YW4A 2FQPA 4LBMA 1VBE1 5G05L 1ND2A 1FV3A 2WA3A 3PUQA 2RJLA 3PVEA 2VG9A 1FPN1 3E5QA 2AEYA 1HB2A 5FYHA 3TEYA 1DYOA 2X5IB 4KBZA 4N53A 4G4FA 1HB1A 4SBVA 1PM7A 1W8OA 4PI2A 5J96B 2GC3A 1D0HA 2B4KA 1PVC2 2VJXA 3TBDA 4AZZA 2FDHA 3SMHA 1QXPA 3DKWA 4XCAA 4C1XA 4U2AA 2BVVA 1YFXA 1JHNA 1QY4A 4Q26A 5A1FA 5FZ6A 1STMA 4DQAA 2YU1A 3HN3A 3JUUA 1QEXA 2MNGA 3KCYA 1PMHX 1VJ2A 1ULCA 2VY0A 3FUQA 1IGOA 1MEC1 2C0ZA 4NN0A 1BLZA 4DY5A 5FO9B 1EPZA 1Y43B 1RUD2 1T6GC 1LU2A 4GMP3 2P37A 1ENXA 1XJAA 3WG3A 3FUOA 4DUXA 5LA2A 1JXNA 4IDZA 4XUNA 3AZVA 2VMHA 3LCPA 1RUH3 1S2BA 5APAA 1REEA 1JZ8A 2J1SA 4K20A 3ZN6B 5F3GA 2UU8A 1JYNA 1XNBA 1CJPA 4HXCA 2W2IA 3VGIA 2VXRA 4MV2A 5HPOA 1JODA 1PMJX 4OI2A 4A3ZA 3MFCA 4XAAA 4J25A 4PLMA 1SFNA 4TTGA 2WZR3 1LHOA 1WCUA 2V72A 1X8EA 2Y64A 5LRSA 1SBEA 3AVRA 5FRAA 5K9YA 4ZY9A 4PIYA 1UMIA 3EJKA 3B00A 4WM8A 5EYYA 2TBVA 2BGOA 2VMFA 4NHMA 4WZCA 1R092 2C1FA 3UGFA 3WQ0A 3O1MA 2JICA 4IXLA 4XETA 2B39A 4OZOA 4LBOA 4IV1A 2JDHA 3Q8CA 2QFEA 1CPNA 1VMHA 4GWMA 3AZYA 4L97A 1RUD1 1NY71 1H6XA 1RVF3 3H3ZA 1ZZCA 4LR4A 3IAPA 5DAQA 1RJ8A 3ZN4A 5DZFA 4BB3A 4E2QA 3D4KA 4LUKA 1S2KA 4LNVA 2BVBA 4AFBA 4PF1A 3R6SA 2K46A 4M4PA 4OCTA 4EN8B 2R49A 5FKBA 4H55A 5JOZA 1NA1A 2XQRA 5FWEA 3FFZA 4QKBA 2BV4A 2ILMA 5CFDA 2WO7A 3THTA 1O8PA 5D21A 3LB9A 3NQHA 1YCIA 1BHGA 1RUI1 3Q8BA 3V0AA 2XVKA 2ZBJA 1AL21 5FMCA 2GN7A 2BPA2 1LGBA 1Q8QA 3AX4A 4Y1ZA 2P1BA 5CKQA 4CUAA 3HBKA 5A7NA 5L36A 4MHRA 5FP8A 4GA9A 2VPVA 2WT1A 1UMHA 5FY9A 3N4MA 2ZEYA 5F3IA 3VBSC 4TN7A 4Y33A 2Y6KA 2JG8A 3ZYGA 2WSVA 2QQLA 5FXXA 2VECA 2ORZA 3SLIA 4Y3OA 2V5YA 4DINB 3VBRA 1OMIA 4NIHA 4Q4Y1 1G86A 2UYBA 1G9FA 1PK6C 4OULA 3RWKX 4CZSA 1CIYA 5JR2A 3HEIA 4BDVB 3GBFA 5A7PA 1QJY2 4CXXA 3SISA 2E51A 1OA2A 1RMU1 2Y6LA 3B3QE 3PIGA 5JSPA 2PAMA 5IYYA 2ZTNA 1OPMA 2LROA 3MPPG 2GP3A 3WEZA 4DOUA 1XC6A 3VBUC 4GJYA 1C5IA 4AGGA 5F6LB 2QTWB 3RZLA 5B2GB 2XUMA 2K0GA 5IK4A 5K0UB 5FY7A 1J3PA 1FMD1 3N7KA 3WNXA 5JPMB 4QQOA 1F5JA 2IC1A 1HN1A 1X9TA 1UYYA 2PLV2 3PU3A 2EIDA 2Q5TA 2OXBA 2YBPA 3FC0A 3BUCA 1DZQA 3CEWA 5DUVA 1RL3A 1WD3A 5FREA 2W39A 2VOKA 1T2XA 5LZ6A 4XACA 1Q3EA 4P08A 3AXEA 3PMEA 4XXPA 4HN0A 1OD3A 3QACA 4PDWB 3F95A 5FJHA 3ZFEC 2YG0A 3K46A 5FDBA 3KZ4C 5CFDC 3NKGA 5FUPA 5KXBA 3S5AA 4CP9A 1I5PA 4MX3A 2J1RA 2O0OA 5FYTA 2VZSA 2RMU2 2Z2SB 4YM1A 1YJKA 3POSA 4NPRA 3AFGA 4A7YA 1HJFA 3LPGA 3W5MA 2ARBA 3VZJA 4EZHA 5FZOA 4LA2A 4LT5A 2MEV2 3OD0A 5IWFA 4E4ZA 2JJ6A 5ABJA 5F2SA 3WQBA 5CFDB 1JW6A 1BXHA 5LCWL 3O1OA 1NAEA 5B4NA 3W9AA 2NMNA 5FUIA 1IPJA 1ND2C 1MQTB 3VHNA 1UF2C 2BBVA 4ATFA 3AKQA 1Y9MA 2Z79A 4N9IA 3NNFA 1US2A 1LB2A 3GM8A 3O1VA 1C8M2 1LOAA 2XJSA 3A7QA 4LHKA 4AQ2A 1AX0A 4YW2A 1RUF3 1PGL1 3WG1A 2BTVC 5JXIA 4Y4RA 1W28A 3VBUA 3V65A 1W9YA 2WYFA 3WDUA 5DAWA 3O0XA 5FY8A 3U37A 5ACA3 5IW0A 4B7KA 1KEXA 2EVXA 2JDAA 2ZZJA 2VQTA 4Q4W3 3I49A 1GV9A 2ZGSA 2YV8A 3IDBB 4I3PA 3MIDA 4HKOA 1H8TB 3HQXA 3M8LA 1W3VA 2CYFA 5KR7A 3C7HA 3AP7A 5FZAA 4RS5C 4ZZ8A 2XLFA 3LEIA 2XKOA 3IDCB 5A1LA 2J1AA 3POFA 3RSJA 2WQ4A 2VZ3A 3IIAA 1V6NA 3VLBB 3AMHA 3VKMA 4YW7A 1RVF2 1HRV3 2D6NA 2OVUA 1U5IA 4MOAA 4EQVA 1S0GA 1PIV3 1W6OB 4OHXA 1GU3A 1CAXA 1G9AA 5FWJA 2XUEA 3AM2A 5H9SA 2LTNA 2WA4A 3UKNA 1TVGA 1A78A 4JQTA 5I93A 4LHNA 3MI8A 3P5BA 1BEV1 4MVTA 2I74A 4GMP1 4LBJA 1S55A 1WMFA 1VBC1 2DVDA 5J3UA 1N1TA 1OFSA 2QQNA 3PUHA 3AJYA 4A44A 4EN6B 2WZ8A 2ZX3A 2ZGTA 5FUNA 3K4AA 1MS5A 4NPMA 4K3UA 4P9IA 3NNJA 4XZPA 1EUTA 1UOGA 2H6CA 3PIJA 4NPLA 3O1UA 3ACHA 4QXBA 2F4PA 1O4YA 5A3MA 1F15A 2PHRA 1DG6A 4U36A 2VNGA 3THPA 2CNAA 3WQ7A 3CF6E 1T6BX 2C9KA 2D7FA 3MLJA 1W2NA 2VZ1A 2WWSA 2QQOA 4BWOA 3FE5A 3IAQA 4PHZA 3RS6A 1MR5A 1FPN3 2UWCA 4BQ1A 3VKOA 4CXYA 1RUOA 1SBDA 3ZPYA 2BDRA 2F6BA 2JENA 1NA1C 3KV5A 2ZGMA 4IE7A 1X82A 1PHMA 4MXVA 1W0OA 3WVJA 2YPDA 4Z8BA 4LBQD 3H3LA 4QX5A 1F35A 1J1LA 4ITCA 4ZPIA 4IE4A 2EALA 2E53A 5L9RA 2WQ8A 1NYWA 2B9UA 2FCVA 2Q30A 4RYDA 3VBFA 3AZZA 4UFLA 3MIFA 4DZGA 1DZRA 2R041 1JZ3A 3ZXAC 2W9XA 3NO8A 1QDOA 1XQNA 5C4WB 1MVQA 2DUPA 2Q8DA 1ZRCA 1JTZX 3E6CC 2XHNA 2A3XA 1AR72 2D93A 2L9LA 4RL7A 4NRPA 1C3HA 1FT9A 2JECA 2XLAA 2DCYA 3ZMNA 3IBMA 1B09A 1AL0G 2A1XA 2HWE2 5LA1A 4FT8A 2E6VA 1QJU2 4C90A 1X33A 2WN3A 4LKEA 4LOTA 4NE9A 3I59B 5FPAA 2B46X 1RUJ2 4A4AA 1TMF3 3MIGA 3Q9OA 5K0UA 4CUGA 2PHTA 5LA9A 5A7QA 5BYNA 2BFUL 4YM2A 4HOOA 5FMDA 5JAXA 1YUDA 1FMD2 1PNGA 5F2WA 4I0WB 1VBA3 3OGVA 3THCA 3ZYJB 3H8UA 2GH8A 4RGAA 4DXZA 1LOFA 1VR3A 1AR81 1C1FA 2VULA 2GH2A 1LECA 1D4M2 1AR91 1QWRA 1YFWA 3VD4A 1E5IA 1AR63 3EYPA 3CL1A 2WO1A 1V70A 4ES9A 5EWSA 1V9U1 2FMDA 4JDNA 4XXAA 1VALA 1GKBA 3ZFEA 2E7TA 3WLUA 4ZHNA 5F39A 2EICA 3IWZA 3ZXLA 1L7RA 2JE7A 4LJHA 2A70A 3B5LB 4Q4V3 3HNBM 1Q43A 2XL9A 3BTYA 2JB4A 4XQDA 1V0AA 5DAXA 2ZJCA 3GNEA 1R1A3 2P6CA 4AAPA 2PQSA 4LE3A 3VBHA 5LRRA 4FP3A 2DFCA 1RC6A 4LTAA 1GFF2 2DU0A 4XOGA 5HV4A 3IT8A 4GMP0 4JGZA 1NCRC 1UOJA 4Y20A 3BIWE 3ITQA 1D0GA 1XSRA 1FV2A 1W2UA 1XSQA 3MHZA 2YU2A 5IAVA 2P3IA 3EMRA 1HRV2 4NJ4A 4RHV1 4RR3B 4OLLA 2VOVA 1PIV2 2JWPA 3H7YA 5C70A 5A3PA 4SLIA 1ZZ6A 4G3YC 2QZ2A 3VDDB 1JZ2A 2C6SA 3BN6A 4XUPA 1TNFA 3LEKA 5AC91 2D44A 3OD4A 1VRH3 3LEGA 3VZKA 1RUG3 4NIIA 4OZXA 1Q8PA 3VHRA 1MS9A 4QKFA 1GZTA 1XPWA 5ABJB 4XYXA 3J7HA 1WMDA 3E97A 4LIVA 4CDQC 1MZFA 3J7MA 4XW3A 1Y3TA 1XOYA 5I0SA 3KF5A 3KVAA 3V56A 3OGRA 2ZKNA 5FZ8A 3MDPA 2K2SA 5JIAA 4EJRA 5FZ9A 2ADEA 3KWVA 4XFFA 1TME1 3DECA 3DKQA 5F37A 1RJ7A 1MACA 2F4LA 5GJ6A 3IIIA 2PMWB 2PLV3 4CCNA 2HWD1 3JB4C 2VR4A 1SLCA 3N9PA 3GYDA 4FI9A 5FZFA 2HWB3 3AKTA 2QQIA 3ZSEA 1KJLA 1IPKA 4MUVA 4MGTA 1S0DA 4LHLA 4CVUA 5LA0A 4H7LA 3ZKYA 3WP5A 3LDRA 3DYMA 5CG9A 1PVC3 2VUCA 5GLZA 3LD8A 2DTWA 1H1AA 3ZN6A 5FK8A 5A7SA 1EUUA 2D6KA 3G7DA 2VQUA 4S2GA 4FPLA 1O4ZA 3H1WA 2WO2A 3LF7A 3MIHA 2RMU3 2VVFA 4AGVA 1M4WA 2WWUA 1OURA 4M3CE 1UKRA 3I3MA 1BBT1 1H8TA 1X8MA 4PQ9A 2JDYA 3PVNA 4NO4A 3ZSLA 5FQ0A 5DDJ2 4HSJA 1W6MB 2B7YA 4W6YA 2VZTA 5D8AA 3WHTA 1GLHA 4CCLA 5BV6A 3POJA 4HPKA 4YVWB 3ZFGB 1JU3A 5F5AA 1O8SA 2JG9A 1IS5A 2ZEZA 5BPXA 2FDGA 3MW2A 1X36A 4Q4X2 5E88A 1UY2A 4FSJA 3QD6A 3ON7A 4TYSA 3U78A 3MPBA 2ZGLA 2BOIA 2CDPA 1CAVA 4COWA 4DXTA 4CDQA 4AEDB 1RUF2 1QNYA 2GMPA 4P9WA 1WA4A 2RS32 5LY2A 1P8JA 2J22A 4UT5A 3T09A 4BJ0A 2EIBA 4KWJA 1R093 1GQHA 2NM1A 3ILRA 3TB0A 2XLGA 3WF2A 5A3WA 1LCLA 2ZEXA 5IFPA 1WWYA 3I2DA 4KL1A 1O4TA 3V0AB 1ZNPA 3T4HB 1VBA2 3MLKA 3ENRA 2A73B 4V2VA 2R1DA 2FDIA 4D94A 2CAUA 4DFSA 4IV3B 5HBAA 3OJBA 2WNVB 4ASLA 5BXXA 1RUC3 4D3WA 2BRTA 2JE9A 1KDKA 5HCBA 1UY3A 2JDZA 1K5MC 2ZPXA 2GDFA 4CEYA 2B45X 2IVIB 5DXDA 2R061 3ZYFA 3NJVA 1MS1A 1QU0A 1AF9A 1A3KA 1CAWA 5LEKA 1UYPA 3POGA 2ATFA 1S0JA 2TEPA 2G19A 2HLEA 1JOJA 1L3JA 2NZ9A 3CDZB 2O8QA 5KC5A 4JC1A 4PCRA 4S2FA 5JUVA 3IKWA 5K0UC 3AKRA 3UESA 3ZOIA 1F9KA 5C9AA 1UPSA 2QUOA 4RGKA 3I97A 5T5JA 1NT0A 4JZRA 4B1MA 1G8WA 1Z0HA 3ROUA 3WZ1A 2CU5A 1PGW1 3H42B 5F5CA 3H7JA 1K3IA 1JMUB 3D3AA 2PAKA 3NV4A 4GALA 2H6BA 2XBO1 1AYM3 1EV13 1GNZA 2VQ0A 3H3UA 5FY1A 3FFQA 4AVVA 5HI0A 1ZBE1 3EB7A 1IPSA 1QQP3 2ERFA 4UW3A 2WLQA 4UFMA 4YWAA 4AVSA 3ATGA 3DYOA 3LOIA 5IAXA 3DPRA 3S5QA 2VNVA 3DXTA 4I30A 4AWDA 2H0VA 4YRDA 1UIJA 3MV11 2XH6A 2YC2A 2QDNA 3ZYBA 3RG0A 4EE2A 2XONA 5HCFA 4JQRA 2E7QA 4FP2A 1H30A 4QMAA 4UWDA 2GSYA 4HFSA 5DN2A 2A6YA 1CZSA 1B35C 4E2GA 3MF6A 1K5MB 3EBRA 2AGSA 3NJXA 4JGZC 2BNOA 3ETQA 2VBDA 2D5FA 1JHJA 3ILNA 2BGCA 3QH7A 1OQDA 2RS51 5JR7B 1WBLA 3ZXDA 2XG3A 4XJAA 4H3WA 4CU8A 3KF3A 5FZ4A 1LU1A 1NLSA 2MEV1 4Z1VA 2QBXA 3FLRA 1YLLA 4D6RA 3T0DA 4YM3A 2D3PA 2XJQA 4Q8LA 2D97A 2FD8A 4S2DA 2VM9A 4BIOA 1H8VA 4LMFA 1WCKA 1AR73 4BISA 3KHCA 3MUY1 2FDKA 3KM5A 1C8M1 4I0BA 1SLTA 5GLWA 1EAH2 1OQ1A 4MO3M 2PN5A 4LKDA 1XE0A 4Z07A 2XXZA 1LJ7A 1HQWA 1POV1 2VGDA 2YB7A 3G6JB 3GBGA 4AXOA 1W9SA 3ZR6A 1LULA 5J98B 3J8F3 2Q8CA 1HV0A 1JYXA 1OD5A 1H4HA 5EQUA 1EYBA 4LBKA 2A6ZA 2QNKA 3H1MA 3VBOB 3HT1A 4MGIE 5H9QA 2IXHA 2YGMA 5CA6A 3NL1A 1J1TA 2WYSA 1PO13 2BW8A 5K8SA 2VW0A 3SH5A 5HV0A 3EHKA 1JOPA 4R4XA 4HLTA 3U75A 4XJUA 1DQ0A 2HWF2 4RR3C 4BYYA 5FZHA 1NXMA 3RGBA 3AP9A 2CHHA 2Z5WA 3W20A 2RS33 3E5XA 5I91A 4F3JA 4QGLA 1W90A 2AREA 2WDBA 2WLPA 1FOD3 3LSDA 1HRI3 2V4AA 1CN1A 3PU8A 5EV7A 4RHV2 1F2NA 4W8JA 5A3OA 3TRSB 4A7ZA 5L19A 4OVEA 5HCAA 5CAZA 2FDJA 1NZCA 1XRUA 3PJQA 1US3A 4MHUA 1ZRRA 4LO6B 4KWLA 4CCDA 4FOYA 4ORFA 1MPXA 4UW5A 1QXRA 4WVWA 3VD3A 3WW4A 5FP7A 3KD4A 3FLTA 3PVBB 4QPIB 1QKQA 2XJUA 3LA2A 1CGPA 4NVPA 1VAVA 3CJXA 5C6CA 2D6MA 2YUEA 3B7MA 1CAUA 3JXSA 2ZS6B 4M3CA 3W58A 1RUI2 1CR7A 4MGZE 3SEPA 4RSUA 4BK5A 4R8HA 3NNGA 3VD5A 3NJYA 1C8NA 4LBLA 2FDFA 4GB33 5KHKA 4CDXC 1ZBA1 3N36A 1BK0A 4OYUA 1FAYA 1QJX3 1JYVA 1LOFC 3VBOA 1RUJ1 3WCSA 4HVQA 4QX3A 3SCGA 3LAGA 4A3XA 3VBFB 3GJBA 4KU7A 1AZDA 2ZGPA 3BYWA 1NQDA 3S7IA 4B1LA 3B94A 1ONAA 4QHZA 5EHDA 2X5IA 3WUCA 1PGSA 1U5XA 4NWWA 5CADA 1C4RA 2JEMA 2DVGA 4TWTA 4BMBA 2JB8A 1BJQA 4AQTA 1FPN2 3JBG1 5A33B 1CJDA 4Q0PA 1HJGA 1K5MA 2RDNA 1HDKA 2VTXJ 4CEYC 5JWPA 5A32B 5D1IA 5E6HA 4LO4B 2Q1MA 4KH9A 3ZSJA 4CP2A 3FZ3A 1V6OA 3O0VA 5D2AA 1CIWA 2D98A 3VV1A 5JZGA 2IXJA 2YYOA 3RJRA 3LOBA 3JZVA 4ISRA 2ARXA 1S4CA 2WC2A 3CNAA 5FMOS 4XILA 4QPWA 2WS93 2G9FA 2J1TA 5KWRA 1YWKA 2HKXA 4FO9A 3PUIA 3X29B 2YMZA 3M3EA 3NV2A 5G04L 2QCSB 4YVSB 1AHSA 4GWNA 1GZWA 3SNMA 1RHI1 1VAMA 3FJSA 5FR3A 2ZGUA 5FPVA 3WP3A 2VOXA 1R083 2G9GA 4BXFA 3O5SA 4CDUA 3S30A 5JLVA 3E6BA 3K4DA 1GWMA 1JYIA 2TNFA 1BQPA 3KV9A 1MVEA 4AAXA 2VBBA 4Y1UA 5IFTA 3PURA 1VE0A 2A7AA 4C0BA 3BPSA 4NUBA 1W0NA 4IUGA 2VCMA 4CE8A 4XJWA 4CUBA 1PZ7A 1ASJ1 4COVA 4E2SA 2VVEA 5I8YA 4CDXA 2RDQA 3VKNA 3BOPA 2NP0A 1BCXA 1DLCA 4JDMA 5FLIA 5FK7A 2BNMA 1EAH3 1OLQA 4XURA 3TN93 1S0IA 5C5UA 1Q8SA 5C5TA 2WFF1 4KNCA 2CL2A 1HXS1 4WM7C 2YZ4A 3AKPA 4AFAA 4YW6A 3A23A 2W3JA 2CWSA 3MW4A 2CGNA 5FTTC 4QU2A 2W94A 4Q4X1 2OPKA 5DG1A 5FXVA 1AR62 5A33A 4JDOA 1IHMA 2VO5A 4LHSA 4DY3A 5BUVA 4S2HA 1YQCA 3MIBA 4PBOA 1UNBA 2PHWA 3KCXA 5TSWA 1DQ4A 1JUHA 4MZUA 2GZWA 1QJEA 2ADDA 5FYSA 3SC7X 5C8CC 3OBAA 4F8AA 1VBB1 3HMYA 3VD7A 1OH4A 3OUJA 3AL5A 4OUMA 2WKKA 4ARYA 3D6EA 4GJZA 1OBNA 4UBHA 2X10A 5JXJA 4DNYA 5L7OC 5C7GA 1W04A 3PUSA 1GR3A 2PAEA 2PFWA 4K8FA 4XBQA 4YFZA 2Q0AA 4CCOA 4WVMA 2W52A 4C1WA 4XPVA 3E6DA 5C3PA 3AJZA 4W6WA 4I2OA 3U1XA 3POBA 3DL3A 5EJ1B 3VZOA 1N1YA 2R16A 1KRIA 1W99A 1REFA 3WP6A 4JKLA 4OFGA 3LPFA 1UIKA 1AX2A 1SEFA 2Y0OA 1GMMA 5E1RA 2IVJA 2WT2A 4JX0A 1V00A 1O3TA 3CLPA 5BNOB 4CYDA 2WNOA 4OUEA 4R9DA 3VKFC 3K77A 5CNAA 5DUWA 1GZCA 5DG2A 1XE7A 3M3CA 1VRH2 4KWUA 2EXJA 5AFEA 1S0BA 2IXLA 3H9AA 1VBB3 4XIKA 3W21A 1ZREA 4HL0A 2Y26A 2P4EA 3RJ2X 1GOHA 4YGCA 5LBEA 1CX4A 1MS4A 5FZ3A 2DTYA 4JGYA 2NN8A 2CAVA 4IEPA 4ATEA 1SQ4A 4FPEA 3IMMA 4KQ7A 4XDOA 5CKMA 5I0UA 5C8CB 2DUQA 1UOFA 2E32A 2VCAA 5F3EA 1WLTA 3ZDSA 4CCMA 1WCSA 3N3HA 3UYJA 1ULDA 2CWMA 2CDOA 3R4UA 1XNKA 3T0AA 1F4HA 3WW2A 1YIPA 5L73A 1FNZA 5L9BA 4AEDA 1D2QA 2JDMA 4NR1A 2ZA9A 3D5OA 4E27A 2Q8OA 2ES3A 1Y9QA 1DHKB 2P17A 4FCAA 4A2UA 3ZSMA 4FFFA 1NCRB 2AC1A 2ZKLA 3OB8A 4QAWA 1D4M3 4YVWC 4E4SA 2DYCA 3LEMA 1RHI3 2AACA 3GBWA 2IXKA 1Z7S1 4XJ9A 1ZRDA 5DQ0A 2DCZA 4X8PA 3NAPA 4QHOA 4CU6A 3UGGA 1COV1 3JQWA 3M2MA 3D82A 3IMNA 2WNUB 4GXLA 3I2KA 3VKLA 1XB9A 1W3XA 2XVLA 2ZX1A 5DMYA 1YJLA 1E5RA 2Y34A 1WLCA 3BB6A 2DVFA 3AK0A 1OI6A 2ZMKA 4Y1XA 2RDSA 1FNYA 3ZMOA 4D6SA 3S57A 1LOCA 1XNCA 4KG8A 1PZ8A 3GZUC 3ACFA 4IQPA 4HSLA 1B35A 2OW4A 3CHXA 4QQHA 3A0KA 3C7OA 3O1TA 3LGRA 1XU1A 2XBO2 4QKNA 1NKGA 5IVYA 4AI9A 4WVZA 4QPGB 5KHHA 3AMQA 4LBQB 5H9PA 5A7WB 1ULFA 1AYN3 2EXKA 3UKVA 2VBPA 3PNAA 1H1MA 1ODMA 1WKYA 2DU1A 2NLRA 3A21A 4P5HA 3RZMA 1IS4A 5CVRA 1S1AA 3U4SA 2WIIB 3O0WA 5JCTA 4W6XA 1WW4A 5BNNC 1PMIA 2XL7A 3DCQA 4XF4A 4EYUA 1WUVA 4PQQA 2NPIA 1W6NA 4FFGA 2RM22 1HB4A 2VZRA 3RYPA 3AKSA 1O6UA 2VU9A 2PTMA 1IZ3A 1YHFA 2CY6A 2O8OA 1Y4WA 5GZCA 3M3IA 2EAKA 1GOGA 1OOPC 1SLLA 4Y22B 4IV1B 1V6KA 3ZFGA 4JV4A 4Z2AA 4ZS2A 5EPAA 3FX3A 1MEC2 2XR4A 4FVVA 2WFF2 1LOEA 4GWJA 3LIHA 3KLSA 3JBG2 2WAOA 1AUYA 5EYXA 5FXWA 3ZKUA 3ZXGA 4BXSV 4YG3A 4ET7A 1JYWA 1YQ8A 1AYM2 4D8MA 4QPIC 1AXYA 1EV12 1QXJA 3GZEA 2WINB 4ZU5A 1K5JA 3ZM8A 4DIQA 1CVNA 1OLME 1QGLA 1H9PA 4RQPC 2WWJA 5J37A 1AJOA 3VB9A 1DQ1A 2E31A 4IGPA 3PUAA 5C8CA 5GKAC 3KV4A 1DGRA 3WSOA 4PT6A 4AEKA 4BMEA 2C5DA 1VBB2 4RD7A 4DEQA 1PO22 1UD1A 2C4XA 5EZWA 3RMXA 3S7EA 4AHYA 3ECQA 3KT7A 1PO11 1WLWA 5A7WA 4P9YA 1DQ5A 2VUDA 4KI5M 2MHFA 4XMAA 3ZVXA 5C9AC 1KQRA 4PIXA 5FYVA 1C1LA 3SH4A 1VAKA 3GALA 3N7MA 1H2MA 4P9XA 2VAUA 1XNAA 3TEWA 1GNHA 4XJZA 2VNRA 4XFIA 1POV3 4NIAA 4IE0A 1Q8VA 4CPBD 2D6PA 2FZ2A 5FYZA 3WW1A 1C8M3 1W06A 1H4GA 5J1XA 2GN3A 3HQUA 2R6QA 5JXHA 1ODNA 2HWF3 3IPVA 3HNYM 2RV9A 3L2YA 4Q0UA 5FZCA 3WDXA 3JD73 1KGYA 2HEYF 5LK7B 5FMOL 4LBNA 4QB6A 1LESA 1UO9A 4K6BA 4BQYA 4IV3A 3L9JT 5HCHA 3GXUA 3KSCA 1SZBA 3R4SA 4HKWA 3HN1A 2EIEA 1ND3A 1LHWA 2PHUA 5FPBA 5LK5A 4Y5TA 3BIEA 2A6VA 4M4RA 3J8F2 1XNDA 4GH4B 1ALYA 5CFCB 3IDAA 1BMV2 3D0JA 1ZBA2 4KBBA 4P02B 2Y38A 1W2OA 3N9OA 2JX9A 1Q8OA 3M3QA 1I3HA 2ARAA 5FBZA 4IERA 4JVAA 3S6PA 5FZ0A 1OUXA 3JQXA 2QQJA 3DF0A 4EV0A 1WGPA 1H2NA 2GALA 2ZEWA 5IT6A 4EN9B 1HW5A 4IEZA 3VBHB 3DXUA 5DAVA 1NUKA 1GZ9A 3PL0A 4E4DX 4QX8A 4OMCA 1BYHA 5E16A 4CUCA 2VNOA 4L8QA 4YNIA 5T5PA 1SMVA 4K1ZA 3BCWA 1QOOA 2OUHA 1QQP1 1POV0 4CCCA 3DEMA 4ZU7A 1D4M1 1WA6X 2QE3A 2PA7A 1APNA 1EV11 1W6QA 5D8AC 2XKPA 3ZDVA 3ZYIB 2RS11 2XBO3 2UY9A 1I9RA 4XABA 1DP0A 3VDDC 1UX6A 2BNNA 3PMSA 1TNRA 3O14A 4CCKA 3JD71 3KS7A 5FIXA 3HPNA 3M3OA 3NAPC 4BU2A 4NAMA 3S0MA 1UMZA 5JOXA 2X29A 3GJAA 2KR2A 3A0NA 4LQRA 4Q1RA 5C4WA 2Q8EA 4CU9A 3ME2A 4UW6A 3ETPA 4Q5OA 2VZQA 3FL7A 2PXJA 2WNVA 3D0SA 1HV1A 2XGXA 3NNMA 2P3YA 3B9IA 2Z69A 5FLHA 5DABA 1H2LA 1IS3A 3RYRA 4J1WA 1NCQA 3JB8A 5A7OA 3SQOA 4URAA 5JZGB 1KS5A 5T5OA 2DCTA 5JSRA 2DV9A 1RUC1 4L99A 4K8RB 2GAUA 5AVAA 2ZZQA 5A6ZA 5IUQA 2JG8C 2GNMA 2GU9A 2LRPA 4K1YA 4XAEA 1ENRA 4XHBA 2VC9A 5KXCA 3QLQA 2XVGA 5BNOC 2QQKA 1QDCA 3RZZA 1L7LA 1RINA 5CZKA 3ZXJA 4QGNA 4AHWA 2WQZC 1KJRA 3IZOA 3M7AA 2UURA 4EWDA 2C24A 3PTRB 1PGL2 1MZ5A 5IVVA 1NOVA 3WNKA 4Y5SA 3I2OA 4RA0A 4YZ4A 4D7SA 2QQUA 5FZDA 2KD7A 3TN92 3OSDA 1HKDA 5FP4A 3LKJA 5E89A 2VTXA 2VZPA 1CESA 1LGCA 4INDA 1YEWA 3ZSKA 2R7EB 4LIUA 1OVPA 5GLTA 5F32A 2VOTA 3RDIA 3ZN5A 2Y33A 2QJVA 1OOPB 2Y6JA 4N53C 1S0FA 2B42B 4ZKTB 4MLOA 1LTEA 4HVRA 2VZVA 2WUHA 4BOWA 2LM3A 3WINE 3VL8A 2E63A 5DDJ1 2YFUA 1BBT3 3POEA 1QIQA 3TYJA 1N3QA 2PYTA 4QKDA 4QX1A 4JRLA 3PJYA 1OKOA 4IEYA 5FKCA 4Q2FA 1HB3A 3OGSA 4LO7A 3SXWA 2WNVC 3NSTA 4GULA 1UAIA 2NMOA 4QDRA 5CYYA 2JKBA 1UZYA 1B35B 2Z4FA 4GQ7A 4OUSA 1U12A 2RHPA 4FPCA 1RUE1 3OBRA 3T0BA 5A3UA 4UYBA 2HWC1 3JD72 4Q4V2 4A7KA 1AYN1 3KQRA 1N3OA 3AYCA 4V1PA 3P3PA 5GM0A 1LHNA 1ZZ7A 2J1UA 4J6GA 3WNLA 5A6YA 3GCWA 3VBFC 4BQ2A 5AVPA 4AGRA 3TN91 1YQ5A 4YZ3A 3WT3A 1R1A2 1FYUA 3LIGA 4XFHA 4BQ5A 4M01A 5IK7A 2DURA 3VUOA 5F9TA 2WNUA 4NHYA 1R1ZA 3N7JA 1FXZA 2WZEA 2Y6GA 1F8VA 4IGOA 4ZXEA 2OQ6A 4BIFA 1UN1A 2YPJA 1OF3A 3Q8AA 4LO5B 1C5HA 2RR13 4CP1A 1GP4A 5CEHA 4FTSA 3EO6A 4PJYA 2DCJA 4HK9A 3ABZA 4QX7A 5BNPC 2BWAA 4FPJA 4HONA 2A5ZA 2DVAA 1COV3 3AYDA 4FOQA 1RUG1 2P5BA 2FCUA 2W91A 3KHBA 4UW4A 1H2KA 2WS91 1Z7S3 5F8PA 4N43A 5KHGA 1W39A 2Q4SA 2QQMA 2ZABA 2RJ2A 3C7EA 3MIEA 1N47A 3P6BA 1PZ9A 4AR2A 4WVMB 4ONUA 4XBNA 1J58A 2EAAA 1WW5A 3AMMA 4YW1A 4IEXA 2RR11 2XB6C 2DWRA 4FPYA 3N9QA 4XCBA 5T54A 2GC1A 3WDVA 3UJOA 3KV6A 4L92A 1U5YA 2YY1A 1IOAA 1X7NA 3JBG3 2BFUS 4TLFA 4CEWA 5DZGA 5FPXA 2VMDA 1R1A1 3GZAA 3VDCA 4I09A 3ZIWA 1SPPA 1H1IA 3DPRB 1C28A 3R0RA 4QQPA 1TME2 1RB8G 3NAPB 3SCHA 5FCCA 3RI9A 4H7MA 2BUKA 1SBFA 4XF3A 3MFAA 2RE9A 5T50A 2HWC3 2G9ZA 1F31A 2IWGB 3VBHC 1RUE3 4DRRA 3CQOA 4QDSA 5L7OA 4JHZA 1NCRA 1QH7A 1V9U3 2WJSA 2Y8KA 3M70A 5F6KA 4ASKA 2WABA 3I4IA 4LLOA 4XFCA 1D4VB 4BCUA 1AR93 4GB31 4ZZ5A 2WNUC 1RITA 1R082 2YFZA 3VZNA 1G9BA 3N7LA 2CGOA 4OHVA 5C3SA 3T2PA 1WBFA 2FBEA 3I59A 1GOFA 3QOPA 5IVEA 1ZVFA 4UOJA 1VMJA 3OPZA 1VBA1 5DDJ3 4CRQA 4ARXA 5D8AB 2P3JA 1Y7BA 3AZXA 4AFMA 3ZFFC 4XE9A 4OHYA 4DS0A 1XNTA 2ZACA 3I3QA 5CKNA 1GZWB 2WBKA 1ZM1A 4XDPA 3B01A 3DPRC 1UW8A 1FX5A 5JDBA 2AYHA 4AEJA 2HYXA 4H14A 1GWLA 1NXD1 4CSWA 4WV8A 3J7LA 4YG0A 5LBFA 1NCQC 5GLUA 3ZX7A 3ZFFB 3VBOC 3CU7A 2BERA 1OF4A 1UCXA 5FOJB 1RIRA 2ETEA 2RS31 4IE6A 5JPNB 4AG4A 3MW3A 2HEVF 3IDEA 4MGSA 1ND2B 1X9PA 4LOSA 3OPWA 1I5ZA 1Q56A 3PHMA 3A22A 1Z78A 3U11A 4YZ2A 4CDWA 1AXKA 2YBSA 5JOYA 5K7PA 4UF0A 4XZUG 4AI8A 4AOCA 1S0CA 3IM0A 3QCWA 3FHIB 1N1SA 2BZDA 2DUOA 3ZXFA 4UAPA 2YC4A 2YGLA 1LHUA 4Y24A 2J1VA 3NNLA 1U0AA 2R0HA 5FZOB 2Y6FA 1GICA 1VPHA 1YO8A 3H1YA 1QJFA 2ZMLA 4B4PA 1GUIA 4O61A 4ZXKA 3FHQA 1ZZ8A 4X6QB 3J8F1 4I0AA 4TLGA 5FZMA 5FYUA 3D8CA 4OQ8A 4META 4PI0A 4NAOA 4XF0A 4CDQB 2OX0A 1MQTA 1Y9GA 5FXZA 3RNSA 4ES8A 5F7UA 4IV1C 2WFF3 2WR9A 4Y1YA 1RGSA 1YQ6A 2RG4A 3I3DA 3ZLIA 5I0DA 3H50A 2V5DA 4E9KA 1HN0A 2WZPP 1AR71 2BP6A 5J09A 1ASJ3 3VZMA 1URXA 4YFWA 4N7UA 3HBZA 5IK8A 4Q0SA 2OS2A 1WW7A 2PHXA 4OI1A 3AP6A 4MGQA 5T5LA 1I6XA 1SDWA 1POQA 1ZRIA 2Q1ZB 3U14A 4NIGA 3OGJA 3OUIA 4M3CB 2H0BA 3BTAA 2GC2A 2RS13 5C3RA 4FTBA 4R4ZA 5IVFA 1CAWB 4IGQA 2BBAA 1R081 2BOJA 4YG6A 4E8DA 5F3CA 3WV6A 1VLNA 4XDQA 4AL9A 2O14A 4UFKA
chains in the Genus database with same CATH topology
2DF7A 4RR3A 4IV3C 3QH6A 2GNTA 4HBNA 1G7YA 4D7YA 3VBSA 4EROA 1SFYA 4KU8A 4FPGA 4YYOA 4WBBA 4N7IA 3RI8A 3INAA 2ZGKA 1OA3A 1SCRA 1ZBE3 5JSOA 4AK3A 4UXAA 1LEMA 2YC0A 5BNNA 4PBPA 5FPZA 1HQLA 5EFUA 1WD4A 5ACA1 2B8MA 1V6IA 4BH9A 2QVSB 4MXWB 4LLFA 1WLDA 4LO8A 3VHOA 2BQPA 4AVCA 2ZMNA 1UU4A 3L2HA 1RUF1 4NWVA 5T55A 1OOPA 5JI9A 2HWF1 1IKPA 1RUJ3 2VOWA 4WZFA 1TMF2 3RQ0A 1ENSA 1QOTA 4O9EA 1JH5A 4AW7A 4MSVA 3NV1A 1KD7A 2YDEA 3KT4A 3HAGA 1ZBA3 2JG8B 1AR92 2ZAAA 1PK6B 1LHVA 5E8AA 3OY8A 4OI0A 1VBC2 4LA3A 3A4UA 1BKZA 5BNNB 1O3RA 1U5ZA 4AI0A 5KBFA 1LOBA 1SLAA 4CEWC 1DLLA 2K9ZA 1CONA 5DUXA 1YRZA 1CAUB 1V6JA 5DUUA 4BZ4A 3TAYA 1SLBA 4RS5B 1BVP1 2I2SA 4IESA 4YZ5A 4FBFA 4XTMA 3USUA 3GF6A 4IEOA 3ES4A 4I02A 2KA3A 1HRI1 3FBYA 1YIFA 1HRI2 3PLQA 4XTPA 1NCQB 3DV8A 4FPFA 4PF5A 2ZHLA 3GHNA 3KCCA 5I8TA 1ZX5A 5KHJA 1RUG2 2PHLA 2JG9C 3BODA 5BNOA 4AVBA 1BEV2 4XFBA 4AYUA 4K40A 4BA6A 4X8NA 2D5HA 3KGLA 4N9HA 4C0HA 4L11A 2RR12 4AEDC 3WDWA 4HANA 2ZHNA 3ILFA 3OCPA 4B4QA 1AVBA 1DZTA 4HT1T 2XHKA 4YVSA 2ZX4A 3USSA 1QHDA 3R4DB 1MS0A 3B02A 1SACA 3OY8B 2RMU1 2VVDA 3RRDA 4Q4Y3 3WOGA 5BNQA 1Z7S2 3WG2A 2FMYA 3JU9A 4KG0A 1M06G 3P3NA 5GZGA 4AQSA 2LUWA 1HQNA 4XJ8A 4CDWC 4FPHA 4TSVA 3HR9A 3JCIA 1VB2A 1LEDA 2R1BA 4L9BA 1AL23 2UY8A 1YI7A 2MEV3 2HWD3 4N43B 4QQ2A 1TME3 3HD8B 3BU7A 3MGUA 4J1XA 3SHRA 2EXHA 4NHKA 5J48A 2XPJA 1EY2A 1RUE2 3ZIXA 1XYOA 3VBRC 1W6PA 4M0HA 3ZO0B 1O3SA 4MXWA 3VDDA 5BNPB 1S0EA 1VRH1 4UBGA 3PTYA 4R52A 5AC93 2EA7A 5ACA2 2GC0A 1KS4A 5J36A 3OGGA 2HEWF 5C8WA 2AH2A 4PLNA 1W6QB 5A3LA 2IFWA 2BWCA 1Q5OA 1DQ6A 2PHDA 2E7AA 3VZLA 4B4RA 5FQ0B 2ZAHA 2WZR1 3T2TA 1BZWA 1YFUA 2WSUA 5F1RA 4Q27A 4BM8A 5GLVA 2ZGQA 4FXKB 3WQ1A 1G9DA 4Q4V1 3SH3A 2R063 1BBT2 1DF0A 1HIXA 4QM8A 1DGWX 1O5LA 4WVVA 5F5QA 4M0NA 3TNQA 1NQJA 1COV2 4YW3A 4FQZA 1AR61 1GSLA 3WHUA 4LBQA 3ZXEA 4PDWA 4MH0E 1AR83 1XYPA 1OHFA 5JZGC 1ZYBA 3RPQA 1RUNA 2LALA 5GZFA 4CDXB 1UKGA 3GZTB 1GQGA 3AMNA 4HKLA 4RGGA 5CBLA 1R091 1TMF1 2N7GA 3SCFA 4LULA 3B9CA 1PGW2 5T52A 2YROA 2HWB2 4YGDA 1VBE3 3ALQA 3V0BB 3DN7A 3ZFFA 3ES1A 2ZGOA 1GBGA 1W6MA 2IFRA 4HETA 4XEZA 4XMIA 3LSEA 4FPOB 4B29A 2HWC2 1G9CA 3EXUA 1NE4A 1PNFA 4HZFA 2VMIA 2R042 3J9SA 4RQPB 3E5UA 4DPNA 3FLPA 1ND3C 3WG4A 4IEVA 2PQQA 4XF9A 2QDRA 5JOWA 4F7ZA 1QJX2 1LENA 4Q29A 3RYKA 2IXCA 4Q4Y2 2DFBA 3MEPA 2DVBA 5I0TA 4Q4X3 2VUJA 4OI4A 1QJU3 1PVC1 1V6MA 2UWAA 3MZHA 3UKTA 1DFQA 4MYEA 1HXS3 1YI9A 1HX6A 2ZOEB 2HWB1 1AL22 1EAH1 4NHLA 2AENA 4AFCA 2QKDA 5J7MA 4HK8A 4K21A 2PLV1 4BLJA 1A8MA 1MQTC 2Y0IA 1UU6A 1J3RA 4FQ4A 4N43C 1V9U2 1NLRA 2ZGNA 1DGWA 3CJIC 1PO12 2OYZA 4P14A 3WD5A 3OF1A 3HT2A 4Z2WA 2CGPA 4AI3A 4Q1PA 2AR6A 4K7JA 1GANA 4YW5A 1HRV1 1BK1A 3W59A 4LEJA 4RHV3 2A3YA 4PLOA 1H9WA 4D7TA 4JGYC 4IEUA 1ULEA 3R05A 4Y4YA 5FLJA 3UJQA 3K51A 2XJRA 3AP5A 1ZRFA 2W68A 1I1EA 2ET7A 4NOTA 2XWJB 1F5FA 4Q4W1 4XQWA 2UWBA 1ASJ2 5JMCA 1A6CA 4COUA 1NG0A 3J26N 4K9SA 3ST7A 3K48A 2I07B 3ASIA 4CDWB 2OA2A 1QQP2 2YHJA 1EPWA 2VH9A 3B69A 3T1MA 4EN7B 3M4FA 1QJX1 1QJY3 3OYWB 4URTA 4AHXA 2IXIA 1X50A 3APBA 4AVAA 2VW1A 4F83A 4Q8KA 1OQEA 3AZWA 4P9JA 3V0BA 3ZFEB 3KMHA 2R32A 5T3NA 2XJVA 2WFPA 4HPKB 4YVWA 1RUH2 4WM7A 3VBSB 3TOJA 1OKQA 3WCRA 4EWEA 1UU5A 4XFAA 1VP6A 3NW4A 3N35A 5CB7A 1VBE2 1WCDJ 3USUB 3AMPA 1O91A 2JG9B 1W6NB 4QXKA 4L2NA 1VBD3 3LZZA 3QBQA 1D2SA 1WMEA 2A71A 3V64A 1N1VA 1FOD1 5KXDA 1WW6A 2WS92 2GNDA 4XFGA 5FAXA 4CP0A 1KFXL 2R043 4N53B 1DGLA 1N3PA 4QPGA 1TQ5A 3WUDA 2GNBA 1PO23 4JRAA 4QQLA 3UL2A 1PK6A 4JAAA 3WY6A 1SLIA 2D3SA 4Q0VA 4RFT0 1XU2A 4KGGA 2CTVA 1VIWB 3OYWA 2ZHMA 4XQ4A 1RMU2 5C4WC 1W0PA 2WZR2 4P9GA 3FBMA 4CEYB 1YXWA 2YXSA 4WM8B 4DB5A 4FAGA 2GMEA 4BPZA 3WXPA 1IQAA 4BLIA 1FOD2 2AUYA 3ZYRA 5CIRA 4GKXA 1JUIA 5JVVA 4OHWA 4AEMA 4FXGB 1DQ2A 3VBRB 3U07A 4Y5Z0 3TNPB 5C33A 3C3VA 2P2KA 1VBC3 1LOGA 1KXGA 4GIQA 4IL7A 3AYAA 3NWKA 4O9GA 1BEV3 3ZXKA 4ZU4A 3TWIA 2RS53 1LKNA 1UPIA 2A3WA 4N90A 3WDTA 5A32A 1DDLA 5LEJA 2R072 1DYKA 4FOVA 4YARA 2JXAA 5HXVA 1E57A 3T1LA 1PIV1 2X53S 4GB32 4AQ6A 2R0FA 4JTOA 4WM8C 3RMYA 1NY72 3NJZA 4QT6A 4QPGC 1QOSA 1CD3G 2A75A 1AXZA 2ZX0A 2X8KA 5KXEA 2D3RA 3WW3A 2V73A 4QGMA 5EXOA 2NQYA 4BHPA 4X6RB 4CDUB 4R9BA 3BALA 1AYM1 4Y26A 5DZEA 4OHZA 4EWAA 2RS12 3WR0A 4KGQA 5I0RA 1JBCA 4YM0A 2UYAA 3IPVB 1KFUL 2HWD2 3I7DA 2OZ6A 4M3CF 5GZDA 1LODA 2BYVE 5JIUA 4JTNA 5BY5A 4QD2A 3IN9A 5L7OB 4XHXA 1QF3A 4AI1A 1BMV1 4Y1VA 2ZCWA 1XXNA 1SCSA 1MEC3 1QNWA 1G6NA 1W6PB 1TEIA 2WT0A 3LWCA 3BOWA 2QQPA 1IKQA 3FMGA 1ZBE2 3EQEA 1NE6A 5FFOC 1OFNA 4QM9A 1OSGA 2G4IA 4HN1A 4CEWB 5GALA 4C91A 1UZZA 4COYA 1VBD2 4PDWC 1UL9A 3UV9A 5BNPA 3DUIA 4W65A 1MZ6A 3HIFA 3GHMA 4I3GA 2XJTA 1LRHA 3LA3A 3URFA 4EN0A 4YGEA 2QZ3A 4G9SB 1AJKA 3ZFGC 4Z82A 1GYKA 2R30A 4AFDA 2FHRA 2ZHKA 2ET1A 1RTVA 4XIOA 4HMZA 2OZJA 3MLLA 2R071 1FMD3 4B3NA 3NV3A 1PO21 2O1QA 3KGZA 4TZDA 2R062 4GH4C 5CFCC 2RM21 1IS6A 1BVVA 2VQAA 4QPIA 3AFKA 2D6LX 1J59A 4AE2A 1RMU3 3VL9A 1OLRA 3FWEA 1ZZBA 2A6WA 2C9AA 1VBD1 3MF9A 1ULGA 4WM7B 3WP4A 2BEOA 3POYA 3AYEA 5FOBB 3C2UA 4Y22A 2D43A 1DBNA 1ENQA 2NYYA 4FTEA 1C57A 4R9CA 3WDYA 4YSFA 3NVCA 2HWE1 4IEQA 3CJIB 1CAXB 1RUI3 1O7FA 4KWKA 5C9AB 1MS3A 3MYXA 2VW2A 4FOWA 4CDUC 1HLCA 2RS52 4YGBA 3PVOA 3I8TA 2E9QA 2RJKA 3NKTA 5AFBA 3VN4A 3U10A 3LA7A 2AZ5A 1JN2P 1QJY1 2WL1A 4LUMA 1DYPA 3I54A 1AR82 2EF6A 1RVF1 1A8DA 1RUD3 1TE1B 2A6XA 3CO2A 3U0ZA 3POWA 3BPZA 4P9LA 3KT1A 2W0XA 3CJIA 4YLZA 5FO8B 1FI2A 4RS5A 3OBTA 2Z42A 3KB5A 3VBUB 3O12A 1LR5A 4QHBA 5GZEA 3AP4A 3SITA 4D69A 4GH4A 5CFCA 2JD4A 4JGZB 1OPOA 4XBLA 4Z92B 1NA1B 4AHZA 3H0OA 5H9RA 5I8SA 3VHPA 4ISQA 1OA4A 1J3QA 4FPKA 1O3QA 4XF1A 3RWNA 2GMMA 2V09A 2VMGA 3AB0A 1LGNA 1XE8A 3ELNA 1QH6A 2OUJA 1KDMA 4B7EA 1RUH1 4AF9A 1YYNA 2SLIA 1FATA 2W08A 1VB4A 2PELA 1RHI2 4R9AA 3HWJA 2KXLA 3AXDA 1KITA 3UK9A 2IZWA 3MICA 1DIWA 5AC92 1REDA 4BE3A 2TUNA 4JCKA 4Q0QA 3U4XA 4FAHA 4LE4A 4COZA 4DRVA 2ZX2A 2DCKA 2B5HA 1QMJA 1DU3D 1MZEA 2P34A 4Q4W2 2HJIA 4GKYA 4HVOA 1AX1A 2VUAA 5CG8A 3DGTA 2HWE3 1HXS2 4IEWA 4MGKE 1ZA4A 4YVSC 5EJ3A 4YZ1A 3B93A 4MGYE 5FO7B 5SV5A 4B8EA 5CU1A 1QJU1 3ZYPA 4AI2A 1CPMA 1YNAA 4JGYB 1H0BA 2P3KA 2ENRA 2PHFA 4ASMB 1AYN2 1DGRN 2OIIA 5JI7A 4CTEA 2D6OX 2HYKA 2X5IC 4QPYA 2XJPA 2FZ1A 1V6LA 4DMIA 2EXIA 2MPFA 1YFYA 1QJZA 2EIGA 4I01A 3O7OA 5SV8A 3WX5A 2ZGRA 1O5UA 4RQPA 2RM23 5IK5A 1W6OA 3M1HA 2WNEA 1RUC2 3J4UH 4AVTA 3ACLA 1XYNA 2D40A 4PIZA 1ZZ9A 1PVXA 4Y20B 3OTFA 1CQ9A 2CV6A 4M00A 2SBAA 1EP0A 2I45A 1ND3B 2R073 2KM2A 1JYCA 4IETA 5ABJC 1H8TC 1MS8A 2XWBB 1CAVB 4YW4A 2FQPA 4LBMA 1VBE1 1ND2A 1FV3A 2WA3A 2RJLA 3PVEA 2VG9A 1FPN1 3E5QA 2X5IB 4N53A 4G4FA 4SBVA 1PM7A 5J96B 2GC3A 1D0HA 1PVC2 3TBDA 3SMHA 1QXPA 3DKWA 4C1XA 4U2AA 2BVVA 1YFXA 1JHNA 1QY4A 4Q26A 4DQAA 3JUUA 3KCYA 2MNGA 1VJ2A 1ULCA 2VY0A 3FUQA 1IGOA 1MEC1 2C0ZA 4NN0A 4DY5A 5FO9B 1EPZA 1Y43B 1RUD2 1T6GC 1LU2A 4GMP3 2P37A 1ENXA 3WG3A 3FUOA 1JXNA 3AZVA 2VMHA 3LCPA 1RUH3 1S2BA 1REEA 4K20A 3ZN6B 2UU8A 1XNBA 1CJPA 3VGIA 2VXRA 4MV2A 4OI2A 3MFCA 4PLMA 1SFNA 2WZR3 1LHOA 1X8EA 5LRSA 1SBEA 5FRAA 5K9YA 4PIYA 3EJKA 3B00A 4WM8A 5EYYA 2TBVA 4NHMA 4WZCA 1R092 2C1FA 3WQ0A 2JICA 4IXLA 4XETA 2B39A 4LBOA 4IV1A 2QFEA 1CPNA 4GWMA 4L97A 3AZYA 1RUD1 1NY71 1RVF3 3H3ZA 1ZZCA 4LR4A 1RJ8A 3ZN4A 5DZFA 4E2QA 3D4KA 4LUKA 1S2KA 4LNVA 2BVBA 4AFBA 3R6SA 4EN8B 2R49A 4H55A 5JOZA 1NA1A 3FFZA 2ILMA 3THTA 5CFDA 3LB9A 1YCIA 3V0AA 1RUI1 2XVKA 2ZBJA 1AL21 2BPA2 2GN7A 1LGBA 1Q8QA 3AX4A 4Y1ZA 5L36A 4GA9A 2VPVA 2WT1A 3N4MA 3VBSC 2JG8A 3ZYGA 2WSVA 2VECA 3SLIA 2V5YA 4DINB 3VBRA 1OMIA 4Q4Y1 1G86A 2UYBA 1G9FA 1PK6C 4OULA 4CZSA 3GBFA 1QJY2 3SISA 2E51A 1OA2A 1RMU1 3B3QE 5JSPA 2PAMA 2ZTNA 1OPMA 3MPPG 4DOUA 3VBUC 4AGGA 1C5IA 5F6LB 5B2GB 2XUMA 2K0GA 5K0UB 1J3PA 1FMD1 3N7KA 3WNXA 5JPMB 4QQOA 1F5JA 2IC1A 2PLV2 2Q5TA 3FC0A 1DZQA 3CEWA 5DUVA 1RL3A 1WD3A 5FREA 2W39A 2VOKA 1Q3EA 3AXEA 3PMEA 4XXPA 4HN0A 3QACA 4PDWB 3ZFEC 5FDBA 3KZ4C 5CFDC 3NKGA 5KXBA 4MX3A 2O0OA 2RMU2 2Z2SB 4YM1A 1YJKA 3POSA 4NPRA 3AFGA 4A7YA 2ARBA 3VZJA 4LA2A 4LT5A 2MEV2 3OD0A 4E4ZA 2JJ6A 5ABJA 5CFDB 1JW6A 1BXHA 3W9AA 2NMNA 1IPJA 1ND2C 1MQTB 3VHNA 1UF2C 2BBVA 4ATFA 3AKQA 2Z79A 4N9IA 1LB2A 1C8M2 1LOAA 2XJSA 4LHKA 4AQ2A 1AX0A 4YW2A 1RUF3 1PGL1 3WG1A 2BTVC 3VBUA 3V65A 3WDUA 3O0XA 5ACA3 4B7KA 2EVXA 2ZZJA 4Q4W3 1GV9A 2ZGSA 2YV8A 3IDBB 4I3PA 3MIDA 4HKOA 1H8TB 3HQXA 3M8LA 2CYFA 3AP7A 4RS5C 2XLFA 2XKOA 3IDCB 3VLBB 3RSJA 2WQ4A 3IIAA 1V6NA 3VKMA 3AMHA 1RVF2 1HRV3 2D6NA 2OVUA 1U5IA 1S0GA 1PIV3 1W6OB 4OHXA 1CAXA 1G9AA 3AM2A 5H9SA 2LTNA 2WA4A 3UKNA 1A78A 5I93A 4LHNA 3MI8A 1BEV1 4MVTA 2I74A 4GMP1 4LBJA 1S55A 1WMFA 1VBC1 2DVDA 5J3UA 1N1TA 1OFSA 3AJYA 4EN6B 2ZX3A 2ZGTA 1MS5A 4K3UA 4P9IA 4XZPA 2H6CA 2F4PA 1O4YA 5A3MA 2PHRA 4U36A 1DG6A 3WQ7A 2VNGA 3THPA 2CNAA 3CF6E 2D7FA 3MLJA 2WWSA 4BWOA 3FE5A 3RS6A 1MR5A 1FPN3 2UWCA 4BQ1A 3VKOA 1RUOA 1SBDA 3ZPYA 2F6BA 2JENA 1NA1C 2ZGMA 1X82A 1PHMA 4MXVA 1W0OA 3WVJA 4Z8BA 4LBQD 4QX5A 1J1LA 4ITCA 2EALA 2E53A 1NYWA 2B9UA 2Q30A 3VBFA 3AZZA 3MIFA 4DZGA 1DZRA 2R041 3ZXAC 3NO8A 1QDOA 1XQNA 5C4WB 1MVQA 2DUPA 1ZRCA 1JTZX 3E6CC 2A3XA 1AR72 2D93A 4RL7A 1C3HA 1FT9A 2JECA 2XLAA 2DCYA 3ZMNA 3IBMA 1B09A 1AL0G 2HWE2 4FT8A 2E6VA 1QJU2 4C90A 1X33A 3I59B 2B46X 1RUJ2 1TMF3 3MIGA 3Q9OA 5K0UA 2PHTA 5BYNA 2BFUL 4YM2A 5JAXA 1YUDA 1FMD2 1PNGA 4I0WB 1VBA3 3ZYJB 3H8UA 2GH8A 4RGAA 4DXZA 1LOFA 1VR3A 1AR81 1C1FA 2VULA 2GH2A 1LECA 1D4M2 1AR91 1QWRA 1YFWA 1AR63 3CL1A 4ES9A 1V70A 5EWSA 1V9U1 2FMDA 4JDNA 4XXAA 1VALA 1GKBA 3ZFEA 2E7TA 3WLUA 3ZXLA 3IWZA 2JE7A 2A70A 3B5LB 4Q4V3 1Q43A 2XL9A 4XQDA 2ZJCA 3GNEA 1R1A3 3VBHA 4LE3A 5LRRA 4FP3A 2DFCA 1RC6A 4LTAA 1GFF2 2DU0A 4XOGA 3IT8A 4GMP0 4JGZA 1NCRC 4Y20A 3BIWE 1D0GA 1FV2A 1W2UA 2P3IA 1HRV2 4RHV1 4RR3B 4OLLA 2VOVA 1PIV2 3H7YA 4SLIA 1ZZ6A 4G3YC 2QZ2A 3VDDB 1TNFA 5AC91 2D44A 3OD4A 1VRH3 3VZKA 1RUG3 4OZXA 1Q8PA 3VHRA 1MS9A 5ABJB 4XYXA 1WMDA 3E97A 4CDQC 1MZFA 4XW3A 1Y3TA 5I0SA 3V56A 2ZKNA 3MDPA 2K2SA 5JIAA 4EJRA 4XFFA 1TME1 1RJ7A 1MACA 5GJ6A 2PLV3 2HWD1 3JB4C 1SLCA 3GYDA 2HWB3 3AKTA 3ZSEA 1KJLA 1IPKA 4MUVA 1S0DA 4LHLA 4H7LA 3WP5A 5CG9A 1PVC3 5GLZA 2DTWA 1H1AA 3ZN6A 2D6KA 3G7DA 4S2GA 4FPLA 1O4ZA 3H1WA 3MIHA 2RMU3 2VVFA 4AGVA 1M4WA 4M3CE 1UKRA 1BBT1 1H8TA 1X8MA 4PQ9A 3ZSLA 3PVNA 4NO4A 5FQ0A 5DDJ2 4HSJA 1W6MB 2B7YA 4W6YA 5D8AA 3WHTA 1GLHA 5BV6A 4HPKA 4YVWB 3ZFGB 2JG9A 1IS5A 5BPXA 3MW2A 1X36A 4Q4X2 5E88A 4FSJA 3QD6A 4TYSA 3MPBA 2ZGLA 1CAVA 4COWA 4CDQA 1RUF2 1QNYA 2GMPA 4P9WA 1WA4A 2RS32 4KWJA 1R093 1GQHA 2NM1A 3ILRA 3TB0A 2XLGA 1LCLA 4KL1A 3I2DA 1O4TA 3V0AB 1ZNPA 1VBA2 3MLKA 3ENRA 2A73B 2R1DA 4D94A 2CAUA 4DFSA 4IV3B 5HBAA 3OJBA 2WNVB 4ASLA 5BXXA 1RUC3 4D3WA 2JE9A 1KDKA 5HCBA 2JDZA 1K5MC 2ZPXA 2GDFA 4CEYA 2B45X 5DXDA 2R061 1MS1A 1QU0A 1AF9A 1A3KA 1CAWA 5LEKA 2ATFA 1S0JA 2TEPA 1JOJA 1L3JA 2NZ9A 2O8QA 5KC5A 4JC1A 4PCRA 4S2FA 3IKWA 5K0UC 3AKRA 1F9KA 5C9AA 1UPSA 2QUOA 5T5JA 1G8WA 1Z0HA 3ROUA 3WZ1A 1PGW1 3H7JA 2PAKA 3NV4A 4GALA 2H6BA 2XBO1 1AYM3 1EV13 1GNZA 2VQ0A 3H3UA 3FFQA 4AVVA 5HI0A 1ZBE1 1QQP3 2ERFA 4UW3A 2WLQA 4AVSA 3ATGA 3LOIA 3DPRA 4I30A 4AWDA 2H0VA 4YRDA 1UIJA 2XH6A 2QDNA 3RG0A 5HCFA 4JQRA 2E7QA 4FP2A 1H30A 4QMAA 2GSYA 4HFSA 2A6YA 1B35C 4E2GA 3MF6A 1K5MB 3EBRA 2AGSA 4JGZC 2BNOA 3ETQA 3ILNA 2D5FA 3QH7A 2BGCA 1OQDA 2RS51 5JR7B 1WBLA 3ZXDA 2XG3A 4XJAA 4H3WA 1LU1A 1NLSA 2MEV1 4Z1VA 3FLRA 1YLLA 4YM3A 2D3PA 2XJQA 4Q8LA 2D97A 4S2DA 4BIOA 1H8VA 1WCKA 1AR73 3KM5A 1C8M1 4I0BA 1SLTA 5GLWA 1EAH2 1OQ1A 2PN5A 4Z07A 1LJ7A 1HQWA 1POV1 2VGDA 3G6JB 3GBGA 4AXOA 1LULA 5J98B 3J8F3 1HV0A 1OD5A 1H4HA 1EYBA 4LBKA 2A6ZA 2QNKA 3H1MA 3VBOB 3HT1A 4MGIE 5H9QA 2IXHA 2YGMA 5CA6A 3NL1A 1J1TA 1PO13 2BW8A 5K8SA 2VW0A 3SH5A 3EHKA 4R4XA 4HLTA 4XJUA 1DQ0A 2HWF2 4RR3C 4BYYA 1NXMA 3AP9A 2Z5WA 2RS33 3E5XA 5I91A 4F3JA 4QGLA 2AREA 2WLPA 5IK4A 1FOD3 3LSDA 1HRI3 5KHIA 1CN1A 5EV7A 4RHV2 1F2NA 4A7ZA 3TRSB 5L19A 4OVEA 5HCAA 5CAZA 1NZCA 1XRUA 3PJQA 1ZRRA 4LO6B 4KWLA 4FOYA 4ORFA 3WW4A 4UW5A 1QXRA 4WVWA 3KD4A 3FLTA 3PVBB 4QPIB 1QKQA 2XJUA 3LA2A 1CGPA 4NVPA 1VAVA 3CJXA 5C6CA 2D6MA 2YUEA 3B7MA 1CAUA 2ZS6B 4M3CA 3W58A 1RUI2 1CR7A 4MGZE 4RSUA 4R8HA 1C8NA 4LBLA 4GB33 5KHKA 4CDXC 1ZBA1 3N36A 1FAYA 1QJX3 1LOFC 3VBOA 1RUJ1 3WCSA 4HVQA 3SCGA 4A3XA 3LAGA 3VBFB 4KU7A 1AZDA 2ZGPA 1NQDA 3S7IA 3B94A 1ONAA 2X5IA 3WUCA 1PGSA 1U5XA 4NWWA 5CADA 1C4RA 2JEMA 2DVGA 4TWTA 4BMBA 1BJQA 4AQTA 1FPN2 3JBG1 5A33B 1CJDA 4Q0PA 1K5MA 1HDKA 4CEYC 5JWPA 5A32B 5D1IA 4LO4B 2Q1MA 4KH9A 3ZSJA 4CP2A 3FZ3A 1V6OA 3O0VA 1CIWA 2D98A 3VV1A 5JZGA 2IXJA 2YYOA 3RJRA 3LOBA 3JZVA 4ISRA 2ARXA 2WC2A 3CNAA 5FMOS 4XILA 2WS93 2G9FA 5KWRA 1YWKA 2HKXA 4FO9A 3X29B 2YMZA 3M3EA 3NV2A 2QCSB 4YVSB 1AHSA 4GWNA 1GZWA 3SNMA 1RHI1 1VAMA 3FJSA 2ZGUA 3WP3A 2VOXA 1R083 2G9GA 3O5SA 4CDUA 3S30A 5JLVA 3E6BA 1JYIA 2TNFA 1BQPA 1MVEA 4Y1UA 2A7AA 4C0BA 4XJWA 1PZ7A 1ASJ1 4COVA 4E2SA 2VVEA 5I8YA 4CDXA 3VKNA 3BOPA 2NP0A 1BCXA 4JDMA 5FLIA 2BNMA 1EAH3 1OLQA 3TN93 1S0IA 1Q8SA 2WFF1 4KNCA 2CL2A 1HXS1 4WM7C 2YZ4A 3AKPA 4AFAA 2CWSA 3MW4A 2CGNA 5FTTC 4QU2A 4Q4X1 2OPKA 5DG1A 1AR62 5A33A 4JDOA 1IHMA 4DY3A 5BUVA 4S2HA 3MIBA 4PBOA 2PHWA 3KCXA 5TSWA 1DQ4A 1JUHA 4MZUA 2GZWA 5C8CC 4F8AA 1VBB1 3HMYA 4OUMA 2WKKA 3D6EA 4UBHA 5L7OC 4DNYA 1GR3A 2PAEA 2PFWA 4K8FA 4XBQA 4YFZA 2Q0AA 4WVMA 2W52A 4C1WA 4XPVA 3E6DA 3AJZA 4W6WA 4I2OA 3VZOA 3DL3A 1N1YA 2R16A 1KRIA 1REFA 3WP6A 4OFGA 1UIKA 1AX2A 1SEFA 2Y0OA 5E1RA 1O3TA 2WT2A 1V00A 3CLPA 5BNOB 4CYDA 4R9DA 3VKFC 5CNAA 5DUWA 1GZCA 5DG2A 1XE7A 3M3CA 1VRH2 2EXJA 5AFEA 1S0BA 2IXLA 3H9AA 1VBB3 4XIKA 1ZREA 4HL0A 2Y26A 3RJ2X 4YGCA 1CX4A 1MS4A 2DTYA 4JGYA 2NN8A 2CAVA 4IEPA 4ATEA 1SQ4A 4FPEA 4KQ7A 5I0UA 5C8CB 2DUQA 1WLTA 3ZDSA 1WCSA 3N3HA 1ULDA 2CWMA 3R4UA 1XNKA 3WW2A 1YIPA 5L73A 1FNZA 4AEDA 1D2QA 4NR1A 2ZA9A 3D5OA 4E27A 2Q8OA 2ES3A 1Y9QA 1DHKB 2P17A 4FCAA 4A2UA 3ZSMA 1NCRB 2ZKLA 4E4SA 1D4M3 4YVWC 2DYCA 1RHI3 3GBWA 2IXKA 1Z7S1 4XJ9A 1ZRDA 2DCZA 4X8PA 3NAPA 1COV1 3JQWA 3M2MA 3D82A 3IMNA 2WNUB 4GXLA 3VKLA 2XVLA 2ZX1A 1YJLA 1WLCA 3BB6A 2DVFA 3AK0A 1OI6A 2ZMKA 4Y1XA 1FNYA 3ZMOA 1LOCA 1XNCA 4KG8A 1PZ8A 3GZUC 4IQPA 4HSLA 1B35A 2OW4A 4QQHA 3A0KA 3LGRA 1XU1A 2XBO2 4WVZA