3J26N

The 3.5 a resolution structure of the sputnik virophage by cryo-em
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
362
structure length
362
Chain Sequence
EPDTVYYDILIPFKPNDQGFSPAIFQAQLTQPIVHNPSEYFLSVVRFSIPTQNIPLTIPQIQPYPNTNVNNTIYSVSIGYNGTYSSQNFVQFDPSLTSPNIPAPNAPTVTSPNVEVTPYYYIYDYSTFLQMINTALENAFNEISAPVGADAPFFFYDSNTEKISLIAQAAYYDRTLTTPIEIYCNVNLFTFFDSIKHIGLGYNTPTGRDILFDVRFLGNNYYQDPETAPSYPPEFIQMQQEYPTLSNWNAVKTIQLVSNLLPINKESIPSFRNSNVGIINAQGILADFVPLVTNGPEARISIDFVATGPWRLIDMFGSVPIYMVDLYVYWTDQTGGQYLINIPPGRILTCKLVFIKKSLSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords capsid protein V20
publication title Structure of Sputnik, a virophage, at 3.5-A resolution.
pubmed doi rcsb
molecule tags Virus
total genus 25
structure length 362
sequence length 362
ec nomenclature
pdb deposition date 2012-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1100 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3j26N01
3J26N
chains in the Genus database with same CATH superfamily
2O0OA 4C1XA 4BQYA 3JQWA 2VY0A 2UY9A 2UY8A 3MPBA 4IEUA 4IW3A 2J1AA 2N7GA 2QQKA 3OUJA 2FDIA 4O9EA 5KXDA 1ASJ3 3EYPA 1H2MA 1O3TA 1RC6A 2IC1A 2JG9A 1A8MA 5FZBA 1SLAA 4AFBA 1UW8A 4YG6A 2WNVB 4PIYA 4AI9A 4AVTA 1PIV3 1UWWA 2J1RA 3BIWE 1AR83 4CDUB 1C8NA 5T5OA 4L0PA 3WD5A 2Z5WA 4XUOA 1MS5A 1C28A 1GANA 5JOXA 1KDMA 5IK4A 4LUMA 1RUI3 1EV12 1VMJA 1WA6X 1S55A 5T55A 1VBD3 4YG3A 5LBEA 4XQDA 1RMU1 5EYXA 3PU8A 3B00A 4BQWA 1UX7A 4H2AA 4HVOA 2B39A 1O3RA 1BKZA 3GJAA 5FYHA 3ZKUA 2EALA 5LASA 1RHI2 2FDJA 5H9QA 5JOYA 4CXXA 4N9HA 4KWLA 2PAKA 2VAUA 5ABJB 5FZCA 5GKAC 1LHUA 3MIDA 4E2QA 1ND3A 4ES8A 2KR2A 3WXPA 4Y20A 4F8AA 3WG4A 1W3XA 5F37A 1JBCA 2VQ0A 3WNLA 1EAH2 3U14A 2P4EA 1SPPA 3FX3A 3SHRA 4CDWA 1H1IA 2GNMA 2NPIA 4KBZA 4W6XA 3RMYA 4C0HA 2Z79A 3UGFA 4CEYA 5FMBA 4ZZ8A 1YWKA 5APAA 5J1XA 1ZRIA 1D4VB 3PDQA 5FOJB 3W59A 2RS12 3D6EA 3HQXA 3RGBA 5C4WC 3VZMA 4AVBA 3RZHA 3INAA 1ZRFA 3AYCA 4OUEA 2CL2A 1C3HA 2XL9A 2VUAA 4RR3A 1ZNPA 5LBFA 3ASIA 1LESA 3AP9A 3FWEA 1GNZA 2MPFA 4XMIA 1DQ4A 3QD6A 2PQSA 3NJZA 4XE9A 4AHXA 4YVWA 1RITA 1RUJ2 4CCNA 3RSJA 2VG9A 3BCWA 3HJRA 3UK9A 1NLQA 3MGUA 4J6GA 4QPIC 2VULA 5FFOC 4AFMA 3O1RA 3BPSA 5IVVA 2OPKA 4FQ4A 5CVRA 3VDBA 1GZ9A 1RYYA 2VQTA 3DKWA 1YQ5A 3C8XA 3PHMA 4NHYA 1W8FA 5E16A 3U4XA 5FUPA 2R041 1IOAA 1TNRA 2BGPA 2ZGMA 3IMNA 1OVPA 3POJA 4L92A 1WCSA 1W05A 3AFKA 4CCEA 2DV9A 3UYJA 3VBHB 1UY0A 3N9MA 3OG2A 5FZ0A 1UY1A 4FPYA 4P9YA 1BBT1 2ZS6B 1OH4A 2Q8OA 4QDRA 3POSA 2Q1FA 2ZJCA 1ZRRA 3BYWA 1AF9A 2W1QA 2Y60A 2X53S 1W8NA 3OBRA 3Q8FA 3PVEA 5DZFA 4URAA 1FV3A 2GDFA 5T52A 1RTVA 2QQWA 1WMDA 2R071 1FV2A 2X05A 3QOPA 1NLRA 4QU2A 4QQHA 4MADA 3I49A 2KXLA 3AYEA 4D69A 4HFSA 5TSWA 2ZGSA 2V4AA 5D1IA 2VVEA 1O91A 4XW3A 2JD4A 1S0EA 4XFCA 1ASJ1 3K75B 4FQZA 4IE4A 5HCFA 1PZ9A 2AR6A 5I8SA 3CEWA 4QQOA 3ECQA 1G9BA 2OYZA 3JBG2 2Q5TA 5FMDA 4NUBA 3LWCA 5HBAA 3O1VA 1PMJX 2RS51 2WQ4A 4GJYA 2QDRA 3K46A 2F17A 4XQWA 1OOPB 3FZ3A 2ZGTA 4LBQA 4XJ8A 2DUOA 3OSDA 4H7LA 3GM8A 4KQ7A 4XJZA 1AYN2 2WLQA 4OUMA 1IS6A 3ZOIA 4BMEA 1IQDC 3OD0A 4QKBA 4EWEA 4JCKA 4XTMA 5C6CA 3AK0A 4ZS3A 4EE2A 5B4NA 3SNMA 1GOHA 3MFCA 4AGRA 4F3JA 1VBB3 3BI3A 2I07B 1N1YA 4XF9A 2Y6KA 3U75A 1QHDA 4PIZA 4FTEA 3WNPA 3ZIWA 3WW3A 5FZIA 5L9VA 4MG2A 3ON7A 2LM3A 1OT5A 2O1QA 2W2IA 2ZX3A 3KV6A 3UGHA 4MGTA 3M3QA 2I2SA 4ASKA 3S6PA 4QXBA 3ZYBA 2BVVA 2BQPA 4RGAA 1H4GA 1RUH1 2JG8A 1L7RA 2J1TA 4XUQA 3MLJA 2XJPA 4LMFA 4NWVA 4BXSV 4E8DA 1AR91 4DNYA 3RS6A 4CP1A 1W6MB 1PO21 3VKNA 3ZN6A 1SDWA 2BPA2 1WWYA 2W92A 4E4DX 2ZGKA 1P8JA 3KLSA 4JC1A 2QE3A 4FFGA 3ZKYA 4UOJA 3OY8A 3T08A 3AMNA 3TYJA 1GZCA 4UF0A 3OGRA 1Y4WA 2G1MA 2A6VA 3LE0A 1JW6A 3ACHA 3RZGA 1W9SA 3I59A 3V64A 1H4HA 2WNVA 4XACA 4EZ4A 1WZXA 1BMV2 5A3PA 4L97A 4Y1UA 2D44A 4CDUA 3FLPA 1TMF2 4D94A 1L3JA 2UYAA 4KGGA 5F2WA 4L99A 1PX4A 4CRQA 5T5LA 4AE2A 1LOBA 1MEC2 4DPNA 1IS4A 3N9PA 1VBA2 1MS8A 5FZ8A 4BA6A 3PURA 3O12A 2WAAA 3V65A 1CD3G 1QJY1 3ORJA 1KJLA 2YGMA 3AP6A 4JQTA 4C1WA 5LW9A 5FJKA 1F31A 3GNEA 1QJX2 2R0HA 1IHMA 1L7LA 4GH4A 2K2SA 4BB3A 5A6XA 2Q4SA 2E31A 5ABJA 5JAXA 1TME2 2ET7A 3ENRA 2IXCA 2EAAA 1HRI1 2YBKA 4RQPC 1J3RA 3T0BA 4XURA 2HWF3 1YO8A 4Q4X1 4ZU7A 1RXFA 1HJGA 1CZVA 4Y26A 3KB5A 3ZSEA 4CA9A 5K0UC 2OVUA 2W87A 1WLTA 3PLQA 3WNXA 2YDEA 1PO13 3CHXA 1UO9A 3IIIA 2DF7A 3S5AA 1W2UA 3MW4A 2XUEA 1OLMA 1RXGA 2ZGNA 4MXVA 5AFEA 4QKDA 3RZLA 5IVFA 3B9CA 4Q4Y2 4OCTA 3I2FA 3RWKX 2WA4A 1H2KA 3H42B 3JD72 4YNIA 3TN93 3VZOA 2ZGLA 4META 4CUCA 3N9LA 2YU1A 1LGCA 1UY2A 3D4KA 4N9IA 3ROUA 4D7SA 4ZY9A 2EXKA 1EV11 3WNMA 2R32A 4P02B 4AEKA 2C9AA 2CY6A 3WUCA 2YFUA 5FYZA 4QPGC 5DZGA 3SH3A 1D4M2 4E2SA 3A4UA 3NRUA 3ME2A 1OPMA 3OBAA 4IGPA 1YFWA 3RYPA 3KZ4C 3OEAA 4A3ZA 4NPRA 4XUNA 3HIFA 5FZ9A 3WZ1A 4FPCA 4E9KA 1ULEA 4IV1C 3BTYA 2FD8A 1YFXA 4FAGA 4K9SA 2ZEZA 5BNOB 4CPBA 1EAH1 4LK7A 1UU6A 5EJ3A 5I8TA 4IV3B 4B3NA 1K45A 2PHUA 2DVBA 3J8F3 3ZXJA 2OXBA 2XVGA 4E4SA 4JRLA 2VOKA 3QCWA 2RDRA 4Q4V2 1R1A3 2W1WA 4GMP1 2RS11 4FSJA 1GWKA 5CFCC 3LEIA 4JHTA 4NHKA 1F5FA 3NAPB 2NLRA 4FFHA 5FJHA 3VBUC 1W8OA 1HDKA 1X82A 4Y1XA 1CVNA 5C3RA 4WBBA 5BNQA 3RRDA 2PHDA 1BCXA 1VAKA 1PK6B 5FPUA 3HEIA 1NCQB 2VW0A 2ZPXA 3IN9A 1IPJA 1HB2A 4QD2A 1V6NA 1ODMA 4R9AA 3OEBA 5I0SA 3TNQA 4J1XA 1OH3A 4COYA 5C8CA 1MZFA 4AVCA 2VMDA 2E53A 4EN0A 5A32A 3ZFEA 1AR73 1QF3A 3MEPA 3TAYA 4YWAA 3WDXA 3TEWA 3LA7A 4CTEA 3BPZA 3IAPA 1RIRA 3C7GA 4MH0E 4MSVA 5J3UA 5FAXA 1FNZA 1RUD2 3D8CA 3D3AA 2EA7A 5D21A 4YFZA 2AEYA 1HQLA 3KS7A 4FXKB 1HB4A 2CTVA 1GLHA 3D5OA 4UFKA 1UYZA 1W6PB 3BKZA 3A21A 1VBE2 4BPZA 2P2KA 3AXDA 3KV5A 3OUHA 2GH8A 4CEWB 2TUNA 1O5UA 4NIAA 3CL1A 4RN5A 3WQ0A 4KWUA 5HV0A 4WVVA 3LA2A 2XLAA 1QNWA 5DAWA 4PIXA 1NE6A 1F35A 4AW7A 5CAZA 3BODA 5FXZA 1VE0A 3JBG1 5H9RA 1B35B 4PQQA 4MGSA 5C7GA 1TZOA 4HK8A 3H50A 5ACA1 5ISLA 4BWOA 2BW8A 3WNOA 1V6LA 2ERFA 1MZ5A 2JG9C 1VAMA 2VMGA 1W0OA 2PLV3 2XWBB 4AI3A 2HEYF 2YYOA 1W99A 5FIXA 5FO7B 1AYN1 2DWRA 1NXMA 3P3NA 4Z92B 1A8DA 4CDQB 4D6QA 4V1PA 1PZ8A 2DVAA 5CKNA 4UXAA 2K9ZA 5F32A 3LQCA 3LB9A 5J37A 1ZREA 4YFWA 3JZVA 4JHZA 4GAZA 3RI8A 5JZGA 3PMEA 1JXNA 3I3BA 4XFAA 3POYA 4AGGA 3O1TA 4LO8A 5DG1A 1WBFA 5EJ1B 5FZFA 3THTA 3HN3A 2JD9A 4XAAA 3QBQA 4GKXA 1QJU2 1WUVA 5DXDA 5I91A 4JGZA 3W5NA 3Q8BA 3ALQA 3ACGA 4CDWC 1UF2C 1J83A 1LULA 2HWB3 2Z69A 2IVIB 4R52A 1UYXA 1QOSA 4CEYC 2IFRA 2WT0A 4UAPA 3DXTA 1IZ3A 1ZBA1 4E2GA 2R0FA 4RHV2 2LUWA 4NRQA 1S0DA 2XDVA 2RV9A 4SBVA 2WSUA 4LQRA 3OJBA 3VB9A 4DY3A 4EN9B 4RR3C 1DQ5A 3VDCA 4PQ9A 4XF0A 5FCCA 3FFQA 3RDIA 1LHWA 4LHKA 3NSTA 2VD7A 2DCYA 1TQ5A 3O0XA 4YVWC 5L9BA 4AHYA 3B02A 3Q8CA 4IDZA 5CYYA 1EP0A 2A6YA 2Q8EA 1X9TA 3ILFA 3LFMA 1QOTA 2QQIA 4LKEA 3SKVA 4AFAA 1MEC1 2XJVA 4YW3A 5FZLA 2XKPA 5LZ6A 2G9FA 2HH9A 1Y9MA 4MOAA 1V6JA 3NJXA 3P5BA 3DKQA 2FMYA 3H7YA 3PJQA 3JCIA 3TRSB 5F7UA 3WV6A 2VPVA 2R6QA 1W9YA 2E7AA 3M3CA 1CWPA 1JN2P 1DGLA 1TME1 2PHXA 3P3PA 4IE7A 4XF4A 4DS0A 5BNOA 4GA9A 1SMVA 1DQ2A 1PX3A 3WNKA 5LCWL 1M4WA 2VMHA 2PN5A 1H0BA 4FPEA 4P9JA 1HJFA 3MBWA 4DMIA 1VB4A 2VNRA 4QB6A 3LOIA 2CYFA 2TEPA 2YPDA 2GNTA 4CP9B 2FDHA 5ANQA 1COV1 1YQ8A 1W9WA 1HV0A 3WHTA 3DCQA 1PNFA 3A0NA 3IZOA 5FUIA 2EF6A 1CPNA 5DG2A 1LU2A 2GC3A 1U5IA 4LHSA 4Q5OA 4UT5A 5FQ0B 1NX9A 3R05A 1VR3A 2IXKA 4R8HA 5A7WB 2Y6LA 2XG3A 3FLRA 3JD71 2J1UA 3VDDA 1PK6A 1UCXA 4ZONA 5EZWA 4XILA 1ND2B 1NCQA 3J9SA 2H6CA 4A6OA 5FXVA 4HLTA 4XVHA 3WF1A 3LEMA 2WNEA 1KXGA 4QU1A 1RUG3 1SBDA 1DHKB 5FR3A 1VMFA 4AEJA 4XUTA 4E8CA 3ZDSA 1CR7A 1HQNA 1RUF3 1Z7S3 1BVP1 4Z07A 3UKVA 1RB8G 2DCZA 1D4M1 3EXUA 1HRV2 4WZCA 4Q4W3 4SLIA 3ZIXA 1T6BX 5FK7A 2ZGOA 3ZYHA 5IYYA 5FO8B 1JYTA 2E26A 2OQ6A 4QX5A 2WZPP 4LOTA 3ZR5A 3RZZA 2D93A 3DYPA 2B4KA 2V4VA 2B5HA 2XJQA 2HWE3 3X29B 3RJ2X 5KHJA 1NYWA 1V9U3 2DVGA 4B1MA 5K7PA 3H3ZA 4IEXA 1OFNA 4CYDA 1CAWB 4ZPIA 3WCRA 1DLLA 4LR4A 4N53C 3LEGA 5LRRA 2BVBA 4BMBA 4CEWA 2HWD3 1HX6A 4ZZ5A 1CAVB 1S1AA 2JG8C 4Q4V1 1LU1A 2HWB1 4G9SB 3P1IA 4I02A 1JYCA 1Q8OA 3TNPB 4A7ZA 2UU8A 4P9WA 3F95A 4S2HA 1LKNA 3PU3A 1N3PA 1S0IA 5CZKA 3MFAA 5L73A 2ARCA 5BY5A 1LENA 2R062 3ZO0B 1DGRN 2W9XA 1QU0A 4IE6A 2G19A 2PFWA 4D8MA 2LROA 2VECA 1X33A 2RR11 4BCUA 1ZBE2 5SV5A 2H6BA 2YBSA 3EMRA 1BBT2 4K20A 5CADA 3MV01 2WNVC 2XXZA 3NNMA 4DY5A 1ND3B 1POQA 4IETA 1LOCA 4RD7A 2Q8CA 3PNAA 4CDUC 4XCAA 1QH7A 1RUE1 2D40A 3PL0A 2A6XA 3UNPA 3UETA 1FOD3 4CEYB 3KHBA 3URFA 3LOBA 1W8ZA 1W6NA 5LATA 2R30A 1K3IA 2A3WA 1RUD1 3UJQA 4DXTA 1XYPA 3QH6A 3J7NA 4PHZA 4FOVA 4KWJA 4NRPA 4QHZA 5FPBA 2AENA 4CU7A 5LY1A 2CU5A 2LALA 2F6BA 3VV1A 3WF2A 1ASJ2 4GH4C 1FMD3 4J25A 5EPAA 2NYYA 1VBE1 3I2OA 1PVC3 3LIGA 4LLFA 4AAXA 1WBLA 5FTTC 5ABJC 5LEJA 3I3DA 3WCSA 4QXKA 2WRAA 1YCIA 2RS52 1C1LA 1PIV2 4Y3OA 1FI2A 4MGQA 5FZMA 1S0CA 3B5LB 2BTVC 1AR82 2DVFA 2VW1A 1YXWA 4QMAA 2JKBA 3I2IA 1GQGA 5A7SA 2JE8A 4GMP0 1RUI2 3SKJE 1VBD2 3EB7A 3AMQA 4HG6B 2FBEA 2X29A 3CKHA 1IKPA 1SBEA 2WS91 2BZDA 4KMQA 4MGIE 1ULFA 2WIIB 4XC9A 4HONA 1ZZ6A 2D98A 3NKTA 2NQYA 1XE7A 2D3PA 4GB33 1NZIA 2XBO3 4DXRA 3AJYA 4LIUA 2QQJA 4FOYA 1LODA 2BNOA 2JDKA 3HT1A 1ZZCA 1LRHA 1UMZA 1X36A 3IKWA 5FOBB 3K4ZA 4QQLA 5EP9A 3LD8A 2I45A 3A23A 1RUH2 2X5IB 1QH6A 1Z7S1 1C8M3 4JDNA 3HN1A 3M3IA 1AR92 1I5PA 4TZDA 2FZ2A 3WF4A 5FKCA 2ZMLA 4OZOA 3PVOA 4MO3M 4OI1A 3H1WA 3RPQA 3U4SA 4I30A 3VBHC 3E6CC 1F8VA 1FPN3 3AYAA 3LSEA 3I7DA 2A75A 2AZ5A 2D6MA 2IXIA 1IG0A 2EVXA 1QJU1 2XJRA 2JDNA 4UBHA 4XDOA 1SLTA 1ZA7A 2OIIA 5EV7A 1EPWA 1OKOA 1AXZA 4LBQB 4YW2A 5L36A 1QXJA 4A3XA 1LHOA 3POIA 3DXUA 1F9KA 1PMHX 3B3QE 3MV11 5CFCB 1IPKA 1CONA 1UAIA 3C7HA 2LS6A 3C2UA 3PUQA 4BH9A 4FPKA 3WUDA 5A80A 2JJ6A 5JIAA 4AFDA 4GXLA 4YPJA 4C91A 5FQ0A 3TEZA 5A7WA 4GALA 1CAUA 1ODNA 2WYSA 2PAMA 1ND2A 3O7OA 3CNAA 2EIGA 3CZJA 2DUPA 3AKPA 4ZXKA 3HBKA 4DRVA 4NIIA 1OOPC 4HANA 5LK5A 3IM0A 1O4ZA 1XU1A 2WDBA 4LOSA 5KXEA 2WR9A 4ASMB 1UD1A 4N7IA 4Q4X2 4IERA 4RSUA 4KGQA 3W58A 1U12A 2YC0A 1GZWB 4L8QA 5AFBA 2ZHLA 1N3QA 4PJYA 1XC6A 1BZWA 5A3WA 2OQ7A 3OY8B 4UF0B 4UFMA 3VD3A 3VBRA 3H0OA 5FZ7A 2QQPA 2WZEA 4WVZA 2QTWB 3LAGA 1S2KA 2A5ZA 2E7TA 3WF0A 1I3HA 2AH2A 3I59B 1CAWA 2C9KA 1WLDA 2HKXA 3PUIA 4NJ4A 1W6OB 2A3XA 2GNBA 2P1BA 5F3CA 4K21A 4LBOA 4YZ4A 1YQ2A 5JSRA 1G9CA 1CAVA 1QIQA 4LKFA 3WDWA 3FHQA 1F15A 2BBVA 4TLGA 4JGYA 4BXFA 3ZMNA 2HEVF 2JIJA 3JXSA 4YM0A 3WQBA 4HPKA 4MVTA 2H0BA 5A1LA 3NV1A 1OD5A 2VMFA 5FYIA 2ZKNA 1PMIA 2Z2SB 1VBB2 3A22A 5GZDA 4XXPA 1UZVA 2VTFA 2XBO1 2JDHA 4OYUA 3R6SA 4GH4B 2VOVA 2CV6A 1CJPA 3K4DA 4QM9A 4B7KA 4NAMA 2GU9A 4XF3A 5FXWA 3ZLIA 2DVDA 3ZYIB 4WVWA 2WFF3 3WHUA 4LUKA 1R081 3OD4A 1V0AA 5AVPA 3AZVA 2VW2A 3LDKA 1HRV1 1Q56A 2RJKA 3USUB 2Y6FA 1JYWA 2AACA 1BHGA 4PDWB 3TOJA 3P6BA 4Y24A 4Y4YA 1QY4A 1MS0A 4QDSA 1PM4A 4NIGA 4AI0A 1CIYA 2OZJA 4OLLA 4MYEA 2WABA 4P9IA 4DINB 5JZGC 2ZEXA 3T2OA 2XWJB 4NMIA 1ZX5A 4IESA 3G7DA 4UFLA 2VXRA 3VBOB 3DPRB 2NN8A 3AL6A 3ZYGA 2NP0A 4Z2AA 4PF5A 2MEV1 2P34A 1DQ6A 2HJIA 3K51A 3FUQA 5FLJA 4LA2A 1Y7BA 1LEDA 5KHIA 3SQOA 5AC93 3JB4C 2ZHKA 3OPWA 1UMIA 3WG2A 2YMZA 5FYCA 5J98B 2R061 1BXHA 5EFUA 1Q5OA 2Q1MA 2V5YA 3MLKA 2K46A 3IWZA 4TWTA 3E6DA 1V6OA 1ZBE1 2XGXA 2ZGUA 1E57A 1OUSA 2C5DA 2W1UA 3ITQA 5IK5A 4BYYA 3FUOA 3ETPA 3R4SA 4AXOA 2FDKA 2FCVA 2RS33 3CIHA 5A1AA 3I4IA 5J09A 5KXCA 3ZYPA 1NZCA 3QLQA 3PIJA 4INDA 1W28A 4YVSA 2VCBA 1O7FA 4ZU5A 5JR2A 5BNPB 3JUUA 4IEVA 2X5IA 5JOWA 2C0ZA 3E5UA 4RS5A 2HWF2 3UKTA 4Y1YA 4QQPA 2D6NA 1TVGA 4ITCA 1PO12 3K2OA 1C5IA 1VRH3 1EYBA 1D7PM 5A3TA 4LBKA 5LEKA 2ZZQA 1PGW1 3PUSA 1SBFA 2J1SA 1JZ2A 5IVCA 4W6WA 3T0DA 1F2NA 1HXS3 2A6WA 2JEMA 5I0TA 4CE8A 5C5TA 3WW1A 5IT6A 1ZZ7A 3DF0A 2FDFA 4FOWA 5FREA 4E27A 5L7OB 5BNOC 4GWNA 2NMNA 2IUWA 5LB6A 1PIV1 3GDBA 5ACA2 3PVNA 2DCJA 1NT0A 2RM23 2Q30A 3OB8A 3TN92 4IV3C 1AR81 3WDTA 1VPHA 3ZM8A 5AVAA 2CGPA 5CFCA 3OGGA 1H2LA 2RJ2A 1POV0 4CCCA 1MVQA 2Y6HA 4MUVA 1RUI1 4I0BA 5IW0A 5C8CB 1VBD1 5LA9A 1W9TA 2VMCA 5A32B 5L9RA 2DTYA 1QJFA 3N36A 3ZFEB 4OHYA 1UPSA 1S0JA 2BGCA 2ZTNA 2W3JA 5C71A 4XQ4A 2GN7A 3TEYA 3NAPC 1UQXA 4XZPA 5KC6A 1LGNA 3A0KA 3U78A 4Z2WA 1W8UA 1MS4A 2XLFA 3DEMA 4JTOA 4R4ZA 1PK6C 1W39A 1OUXA 2R7EB 2YU2A 3VLBB 3FL7A 4G3YC 1NCQC 4AEMA 2GC1A 4GWJA 1F4HA 1SFYA 2PHLA 3R0RA 1XB9A 2WJSA 1EUTA 4QPWA 1K12A 2DDUA 4DIQA 5HCBA 4YZ1A 4NPMA 1EUUA 5IK8A 4WZFA 1GZWA 5FKBA 4XDQA 3MDPA 4UYBA 2HEWF 2BFUL 4IE5A 1W04A 4NPLA 1UY4A 1GMMA 1RHI3 4I09A 2FQPA 1ZBA2 2YB7A 4I0WB 3MW2A 3HQUA 2VQAA 5C9AB 3BTZA 1HN0A 4AI1A 1LB2A 1LOGA 3HR9A 3IDBB 1W6OA 2ET1A 2VZ3A 2WZ8A 4CCLA 3MI8A 3AP7A 1JZ5A 3N7JA 3AMHA 1Q43A 4RA0A 5DAPA 4CEWC 1XBFA 1KFUL 2BDRA 5JWPA 5AC91 3F2ZA 1MQTB 4K1ZA 1HB3A 1S2EA 4NE9A 4AK3A 3BOWA 1X8EA 4IXLA 2P3IA 3EJKA 5F8PA 1IG3A 2QUOA 1H8TB 2ZHMA 4NO4A 4WVMA 2YC2A 5JZGB 1B35C 2IZWA 4S2DA 1UXXX 3NL1A 1OFSA 4HK9A 4OUSA 5A3NA 4UW4A 2HYKA 3RWNA 1XE0A 3T3YA 2ZMKA 2NMOA 2PHTA 3LZZA 2E32A 2EXJA 1GNYA 3I3EA 1OSGA 2EXIA 2W68A 3VHNA 2DU1A 4JGZB 4W8JA 2DCKA 1MS1A 1SLCA 4QQ2A 5DAQA 2UWCA 3USUA 4ZHNA 4P08A 5DABA 4CDQC 4BIFA 4COUA 2BU9A 4PDWA 2VBBA 1QQP3 4NWWA 4LLOA 1COV2 2ZAAA 1A34A 1CIWA 3K4AA 1RUNA 1J3QA 1T2XA 4FXGB 1H9WA 2QZ3A 4AVAA 2Y38A 3VL8A 1W6QA 4PT6A 2OA2A 1C4RA 1FXZA 3GCXA 3VBOA 1PGL2 3DPRA 1WCUA 1G9DA 1CESA 1UZYA 1BK1A 3ZSLA 4Z1VA 4Q0QA 3WINE 2PLV2 2VGDA 1ZVFA 5DMYA 1A78A 3CJXA 1VBC3 5C3SA 2VTXJ 1JYVA 1DZRA 3FFZA 2VM9A 4QAWA 1JUHA 1XSRA 1WW6A 2UYBA 4JDMA 4M00A 1FNYA 2CDOA 1VBB1 4HZFA 1QEXA 4Y5SA 4N43A 1X9PA 1UPIA 4BQ4A 1O4YA 2VZRA 1MS9A 4R9CA 5LA2A 1OI6A 3VBFA 4P9LA 4NHMA 5DDJ3 2ZBJA 1FT9A 4O65A 5FYTA 2P37A 1WCKA 3QH7A 5BNPA 4OI0A 2OUHA 2VZPA 4KU8A 4XUPA 1NY72 4LHLA 2ILMA 2G4IA 4LBMA 4JKMA 5JR7B 3OUIA 5FXXA 2HWB2 2EIEA 4M0NA 1RGSA 1Z0HA 1AR63 2IXLA 2YPJA 3ZFFB 5JIUA 5F6LB 2B8MA 2WBKA 3IPVB 4XDPA 3ZR6A 5KR7A 2ZXQA 4YW4A 4LO6B 1ZM1A 3KT7A 2AREA 4YM3A 1GUIA 1N1SA 3MW3A 4HVRA 1G9AA 3T2PA 5F9TA 1QKQA 4AEDB 1M06G 1R093 5L7OA 2RR12 4MGKE 4QPYA 3VDDB 1IKQA 1XPWA 3DL3A 4K7JA 4LNVA 3T4HB 3C7FA 5D8AB 4FPGA 1RUC3 3AZWA 4QT6A 4P5HA 5FWEA 1LNSA 3NW4A 1DF0A 2XQRA 2GSYA 4R9DA 4XEZA 2OUJA 1W0PA 2WA3A 5GLZA 3KV4A 1RUE2 2BYVE 3WDUA 4UW5A 4ZS2A 5IUQA 1WW4A 2TNFA 4AQ2A 5E88A 1J84A 1UYPA 1OF3A 5F5AA 1DYOA 1W2TA 3LFIA 5K4LA 5FZ3A 2YFZA 4A41A 2ZEWA 3ACLA 3BN6A 1JMUB 1RVF3 1JH5A 2GAUA 4CU8A 3U07A 3K48A 4FAHA 1ND2C 2XB6C 5FK8A 5GLVA 4LXLA 4AI8A 4QGLA 1AL0G 1VALA 1CAXB 1N1TA 1D2QA 4DUVA 3Q9OA 1JOJA 5FBZA 2HWF1 4UBGA 1BJQA 3AKSA 5HPOA 5BUVA 4Y1VA 2XVKA 3GHNA 3UESA 1PO11 3MPPG 2GMMA 1ZA4A 1XXNA 4QHBA 2XL7A 1YQ6A 5FZEA 1XNTA 2BBAA 3IDCB 4D6RA 3KQ4B 3M7AA 2WS92 1ACCA 5C9AA 4KH9A 5IJRA 3WLUA 4EROA 3I8TA 3TN91 4W4ZA 1MVEA 4TYSA 4ISRA 5C70A 2WZR3 2GH2A 4JKLA 3JB8A 1U5ZA 4LTAA 1RUG2 4IEQA 1VBC1 1MQTA 4DOUA 1Z7S2 3OF1A 1SQ4A 3VZJA 4AR2A 5JMCA 4COZA 4LKDA 4P9XA 5IATA 5CBLA 1W6NB 1XRUA 4BK4A 5JXHA 2ZMNA 3KF3A 5H9PA 2QQNA 1FX5A 1XYNA 4Q4Y3 2BP6A 1H8TA 4BIOA 1UOBA 2WO2A 1SCRA 3NNLA 3GALA 4FPOB 5G04L 1AL23 4P00B 5GLWA 5T5PA 3MZHA 3ST7A 2HWE2 3E97A 2L9LA 2QQUA 4C90A 1V9U2 4GWMA 4XFGA 3KHCA 4HMZA 1UZ0A 3HNMA 1ND3C 2MNGA 3OBTA 3KWVA 3J8F1 5JXGA 2CAVA 4CU9A 1HB1A 4KI5M 2HWD2 4MX3A 2TBVA 4Q1RA 2RMU3 3AKRA 1CX4A 1R1A1 3J7LA 1JYNA 1DYKA 2VU9A 3ES4A 4RFT0 5F1RA 5FYMA 2BJSA 5A33A 4XFIA 4XXAA 3M4FA 2B9UA 1PGSA 3N9NA 3NKGA 1X50A 4Y22A 3O5SA 4JTNA 5DUXA 4YGEA 5HXMA 3C7EA 3BIEA 2JDZA 4TN7A 3Q8EA 2VCAA 3VGIA 4NROA 4AFCA 5LK7B 3PTRB 4Q2FA 4HKWA 5BPXA 2W5FA 3RYKA 3DN7A 4QPIA 3DUIA 2RDSA 3WP4A 1AYM3 1NE4A 1W8HA 3E5QA 5F6KA 4MGZE 5A3UA 3CMGA 1H1AA 1AVBA 3C7OA 4UW3A 4BM8A 1JYIA 1POV3 3S30A 2E33A 4UI9L 4BLIA 4D0QA 3FHIB 4CVUA 2Q0AA 5KHKA 1AR71 2RHPA 3VD4A 3N4MA 1QOOA 1SCSA 4GIQA 4PBOA 5FYUA 1U5YA 5HCAA 1KGYA 2CGOA 1AX0A 2PHWA 3UKNA 2FZ1A 5FZ6A 1ZRDA 3ACIA 4S2FA 2XPJA 5DQ0A 2W52A 1OA3A 2LRPA 1OA4A 1HIXA 3GF6A 4LBNA 2XUMA 4HL0A 4D3WA 2JXAA 4X6QB 3T2TA 4AVSA 2HYXA 3AJZA 5FYYA 1QGLA 3LDRA 3N9QA 5J7MA 2O14A 1REDA 4H55A 2AYHA 1YIPA 1OQDA 2HLEA 1FMD2 2QQMA 3AKTA 3CJIB 4EZHA 2CGNA 1DFQA 1JHJA 2XH6A 3AMMA 2WL1A 3AMPA 3LPGA 1JZ8A 1WMEA 4YVSC 5I0RA 3ZFGB 4R4XA 1UX6A 2E9QA 2X5IC 3OPTA 5FY4A 2ZHNA 4AWDA 4CP2A 2F4PA 4LT5A 3POWA 1VB2A 4XETA 3ZFFA 4CSWA 4FTBA 5FRAA 4D7YA 3IPVA 3AXEA 2DBIA 4PBPA 4ASLA 1G6NA 1Q3EA 2VMIA 1GWLA 4FO9A 1H6XA 2FHRA 2WNUB 3VDAA 5A7OA 4AEDA 1QJZA 5BNNB 1PGL1 4OQ9A 3GXUA 1CAUB 1REFA 4DZGA 1XOYA 2EAKA 2VH9A 4GB32 2XBO2 2H0VA 3ZX7A 2WT1A 4WM8B 3GJBA 5D8AA 1K5MB 1UY3A 2PLV1 2WNOA 3LCPA 4Q0UA 2WZR1 2JKXA 3KVBA 2EIBA 1R082 4FPFA 3WY6A 5EJZB 3NNFA 4HETA 1LR5A 3W20A 1WA4A 2QQLA 3ZDVA 4O7XA 3ZN5A 4BLJA 4CUGA 3WDVA 4OI2A 1C8M2 5E8AA 1JOPA 3VBSB 4COVA 2HWC3 1KRIA 5LBCA 3QACA 4PI2A 3LEKA 1UOGA 3MF6A 4L2NA 3VBRB 1UIJA 1V6MA 1E5HA 1FPN2 1PZ7A 4UW6A 3RG0A 4HOOA 4BQ5A 1UKRA 3M70A 5IAVA 5JLVA 4YSFA 1CAXA 3O14A 1NQJA 1W3VA 4PLOA 1U5XA 5JVVA 3R4DB 1NY71 5ANNA 5D2AA 4TTGA 4DEVA 2MEV2 4FPHA 4NOTA 5FY5A 2A1XA 4F83A 2V73A 2VNOA 3FLTA 4X8PA 4D7TA 4JGYB 3HBZA 3N9OA 4ARYA 4Q1PA 2ZA9A 1WMXA 2PMWB 4HBNA 1MZ6A 4M3CF 4HPKB 2JB4A 2YY1A 2WO3A 2ZX2A 4QXHA 1GSLA 1IQAA 4MGYE 5DN2A 1UMHA 1JZ6A 1CGPA 2AEZA 3H8UA 1S0BA 3C3VA 3D82A 4TSVA 1JOBA 1YC61 4X8NA 2GZWA 4ZXEA 5HXVA 3K77A 1I5ZA 3I54A 4UFHA 4BHPA 1V70A 3DECA 1SEFA 1O4TA 1GNHA 2ARXA 5GLTA 1JZ3A 4RYDA 3SLIA 2Q1ZB 4YGCA 3FJSA 4BQ3A 1NA1B 5A1FA 3HVDA 5IHRA 2P5BA 5DZEA 4FBFA 4EN6B 2AGSA 4A45A 5JSOA 3VUOA 1WCQA 1UKGA 4RHV3 4CCJA 3RNSA 2JICA 4DUWA 4I2OA 1W2OA 5A6ZA 5IWFA 4Z8BA 5HCHA 5FZKA 2DURA 3J7MA 1YFUA 1PGW2 1XJAA 1X8MA 4IGOA 2Y6GA 1VRBA 1G86A 5CISA 2F4LA 5E6HA 5KBFA 2VVFA 4XTPA 2VUCA 1KJRA 4GWIA 1OMIA 1Y9GA 1D2SA 1JODA 3KGZA 1DIWA 2IXJA 4LBLA 3VHPA 4I3PA 3IB3A 1AJOA 4OHWA 4CU6A 3NO8A 1APNA 2OX0A 3KCCA 1SLIA 2WFPA 3B7MA 2E51A 3GZTB 1UIKA 5A7NA 4PDWC 2W94A 4C0BA 4QKNA 1GP5A 3AVSA 4XJWA 2C6SA 1NLSA 4RS5B 4NVPA 5F2SA 4B8EA 3VKOA 4DXSA 3USSA 3U37A 3WOGA 3VBOC 5H9SA 4UFJA 1UU4A 1ZYBA 3DPRC 5JDBA 2O8QA 3THPA 2VE1A 1RUG1 4YVSB 1URXA 5KWRA 2D43A 2J1EA 2WFF2 2WO7A 3IT8A 3WW2A 4CUAA 3DYMA 4AZZA 1YYNA 1RUF1 4Q27A 2DBNA 4ZU4A 1JS9A 4BZ4A 1WLWA 4OHZA 2VO5A 2E63A 1RMU3 4Q4W1 5CFDB 1JYXA 2WWUA 3NJYA 4MZUA 4Y1ZA 4QDQA 4KU7A 4XBLA 4CCOA 1UZZA 5FZGA 5I8YA 2RG4A 1ZZBA 2BOIA 4IV1A 3LF7A 4XFFA 3AZZA 2HWE1 3H9AA 1SLLA 4N43C 2WWSA 4BU2A 1V9U1 1NCRB 5CKQA 3CJIA 4Q8KA 1QXPA 2VXJA 1DQ1A 4COWA 4PCRA 4W6YA 2VUDA 3CZUA 2HWD1 2ZGQA 3ZFGA 1N1VA 4QB2A 5E1RA 2BERA 1NXD1 5BNPC 1WW5A 2W47A 3PUAA 3RI9A 3WT3A 5JOZA 4XAEA 1Q8SA 4OHXA 3ZVXA 3G6JB 5AC92 1OHFA 4HKOA 2WT2A 1BLZA 4AOCA 5JUVA 1SACA 3VD5A 1YI7A 2ADDA 1TNFA 2CAUA 1JHNA 3VZLA 2JDMA 4HXCA 4PI0A 5JXJA 2WNUA 2ZX1A 1ENXA 4FTSA 5BNNA 1ENSA 2Z42A 3RZKA 3LKJA 1DU3D 4AQ6A 4WM8A 1K5MA 5L7OC 4XPVA 1IPSA 1GFF2 3DYOA 5DUUA 4Q0SA 5I93A 5FPZA 3L2YA 3MIHA 3UGGA 2W46A 4LKSA 2HBTA 3UT0A 1PM7A 1DGWX 1MS3A 3H3LA 4TXWA 1FOD1 1FYUA 1AJKA 1UL9A 4AVVA 5C8CC 4QXCA 3LPFA 1AZDA 5CU1A 4BE3A 3VBSA 2A3YA 2W1SA 1W06A 3AB0A 3ZFEC 3ZXKA 1GQHA 2WN3A 3DGTA 1O3QA 2R043 5F5QA 1VRH2 4YZ2A 1GP6A 1EPZA 1OKQA 3GGLA 3BTXA 2D6KA 4ES9A 1OURA 3O1UA 2WN2A 1BBT3 1HXS2 1AUYA 2HBUA 3RMXA 1FMD1 2BRTA 1HV1A 4Q29A 3O1OA 1PVC1 3IDAA 1W8WA 2RDNA 1CQ9A 4EV0A 2Y26A 2B9VA 2PYTA 3N3HA 5EYYA 2R073 2W0XA 3J4UH 2CHHA 3BU7A 2VZUA 3RYRA 2ZZJA 1ENRA 3POFA 3OPZA 5F3IA 5LA1A 5EIYB 4AGVA 1DDLA 2C26A 4KBBA 3V0AB 1WW7A 3UJOA 5K8SA 4M3CE 4GB31 4N8MA 1O59A 3ZYRA 1NG0A 4WVMB 2A7AA 5A3MA 5C9AC 2RS53 3R4UA 4R9BA 2O8OA 2D5FA 4EN8B 3K3OA 3POGA 4E4HA 1SZBA 2UWAA 1LOFA 1NA1A 3FN9A 4NN0A 3BB6A 4AAPA 3OCPA 1JZ7A 4B1LA 5FO9B 3THDA 2OZ6A 4YZ3A 1C8M1 3WQ7A 1MACA 5KC5A 1MQTC 2XOMA 4Q8LA 1H1MA 2VC9A 2QNKA 4YRDA 1LGBA 5IVJA 1O3SA 4B4PA 4YW6A 4I0AA 3MUZ1 1FPN1 4QX0A 1H8TC 3WF3A 2JE7A 2R49A 5FY7A 2QVSB 1W6QB 1ULDA 4ARXA 1DP0A 4BISA 2D7FA 1BEV3 4LA3A 4EWAA 5C8WA 1RUH3 2A6ZA 3O0VA 5GZFA 4GULA 1K5JA 4KG0A 5KXBA 4MHUA 2A71A 3W5MA 1AR93 4IEOA 1A6CA 4JGZC 5M0TA 1I1EA 2IVJA 3L2HA 1PO23 2QDNA 3PVBB 5KHHA 4L9BA 3U1XA 5J36A 1RINA 1W2NA 2G9GA 4HT1T 2P3KA 2RDQA 2ZAHA 1T6GC 2PXJA 4LO4B 4FI9A 1CZSA 1PVXA 4AG4A 4IEZA 3L9JT 3PIGA 3KF5A 4M4RA 3AP4A 3HQRA 1I6XA 4N43B 3HD8B 1Q8PA 1J3PA 2P3YA 4I01A 1B09A 1V00A 1STMA 3VBFB 2XVLA 3CDZB 3THCA 3D0JA 1O8SA 3ABZA 5IAXA 1NKGA 2V72A 4KG8A 3RQ0A 3T4VA 3WR0A 3HWJA 4CCMA 3ACFA 5F5CA 2VMEA 1TE1B 2ZABA 2PAEA 4W65A 2ZACA 5CFDA 4EWDA 5A3LA 2CSGA 5A6YA 2X10A 1QQP2 4OHVA 3ETQA 1QJY3 2X8KA 4K3UA 1C1FA 5A3OA 2WQZC 1YEWA 1NCRA 2BOJA 3EBRA 3J7HA 3RZMA 1HRI3 2PTMA 4QX8A 4IL7A 2KM2A 2W08A 5GALA 3CLPA 1AXKA 4Q4X3 1RUOA 2IXHA 5T50A 3IMMA 1YIFA 2RJLA 1GP4A 5IK7A 2YHJA 4HSLA 2ID4A 3K3NA 1VBC2 3AZXA 3S5QA 3M2MA 3ZFFC 1GR3A 1CPMA 4YM2A 1HLCA 3BALA 3I2HA 1UZWA 1WGPA 5FZDA 5FP3A 5BV6A 1VLNA 1OXCA 1Y43B 2BNMA 1QDOA 1QXRA 3I97A 1IGOA 3V0BB 2VCCA 4AEDC 4LORA 4JDOA 3VDDC 2QFEA 3AFGA 4CDXA 5CG8A 1SHWB 1LCLA 2WFF1 3NWKA 5D8AC 5DDJ2 2JECA 3TEXA 5JPMB 2VNGA 4HN1A 1EV13 2YC4A 4JQRA 2B42B 3J8F2 5FBJA 5C3OA 5DAVA 5LA0A 3BU0A 3KVAA 5FMOS 1FATA 5FYVA 1R1A2 4FPLA 3BOPA 1R1ZA 3PUHA 4QGNA 4XBQA 4OI4A 4BJ0A 4OVEA 3SH5A 2D6LX 1AR62 1UYYA 4QB1A 1ONAA 5IVEA 2VQUA 2R1BA 2R16A 3OGJA 3SEPA 4P9GA 5A7PA 3ZPOA 4XBNA 3GBFA 3HAGA 3OBZA 4YW5A 1QJEA 3VKLA 3AZYA 1Q8QA 2VZQA 1R092 1EAH3 2P17A 2ZX0A 4N53A 3ZYFA 1BEV1 3O1PA 5T54A 1QNYA 4WM7A 3ZSMA 1RUC2 1YUDA 4M3CB 1GBGA 1OC1A 2BEOA 5JI9A 4GMP3 3S7IA 1S0FA 2RS13 4DUXA 5J96B 2EIDA 2QQOA 3O1SA 4DQAA 4JV4A 5LBBA 1AR72 4CXYA 3NJVA 4RL7A 4YGDA 3V0AA 1GU3A 3AP5A 5FY0A 1S4CA 5I0UA 1GV9A 2JB8A 1XNKA 3AKQA 2DTWA 1H6YA 1RUJ3 3N7LA 2RS31 4O61A 5GLUA 1ZZ9A 4GJZA 3SH4A 1RVF2 1Y3TA 2C24A 3SMHA 4X6RB 3GZUC 1TEIA 1YFYA 3APBA 1SFNA 4XCBA 2JWPA 3MIFA 3SCHA 3RZJA 2WAOA 3NQHA 4IEYA 4LE4A 1BVVA 2JIGA 4B29A 2VOXA 4XJ9A 2QKDA 1WLCA 1IS5A 1JU4A 2VZSA 2WKKA 4IEWA 4YM1A 1VRH1 2AC1A 2GNDA 2WLPA 2XR4A 5EWSA 4ATEA 5C4WB 2VZOA 3MICA 2GP5A 3O1MA 4AI2A 5A33B 1XQNA 3SISA 3NNGA 3CBNA 1DCSA 1HXS1 3SC7X 4LO7A 4QM8A 4Y22B 1ULPA 4A42A 3S7EA 2XONA 1WKYA 4ORFA 2WWJA 1H30A 1DG6A 1ZZ8A 1GWMA 1KD7A 3WP6A 2RM21 4FPJA 4IQPA 1W0NA 2DUQA 3LIHA 2P6HA 4QPIB 2QBXA 4XMAA 1KFXL 4O9GA 2WZR2 3BTAA 5CG9A 4JVAA 1PNGA 5GZEA 1ULCA 1H8VA 2V09A 1O5LA 2VOTA 5FP7A 1UNBA 5C3QA 3AYDA 3VKMA 2ENRA 4B4QA 1DGWA 1GKBA 2D3SA 3SITA 4QX7A 2J42A 1W90A 1REEA 2YROA 5EHDA 3JBG3 2R1DA 1VIWB 3V56A 2YG0A 5ACA3 1AL22 3B94A 3KT4A 4P14A 3DV8A 1OQEA 4QWNA 2A70A 2VBPA 5F39A 2RE9A 3LGRA 4GKYA 3FMGA 1F4AA 3GCWA 5FZ4A 4OZXA 1JZ4A 1ALYA 5FZ1A 1FAYA 3OGVA 3U11A 3HNYM 1AYN3 3UL2A 2OPWA 4Q0PA 4XJAA 2FCUA 4NIDA 5IVYA 4XF1A 2D97A 3FBYA 1VMHA 3H8XA 5JPNB 2RMU2 2C1FA 1RHI1 1YJLA 2XMLA 3VBHA 4F7ZA 1WD4A 2NM1A 4QGMA 5LRSA 5C5UA 2OKXA 4MXWB 2BGOA 2XHKA 3WSOA 4JAAA 5DUWA 2J1VA 4A7YA 3VD9A 1CZTA 3WG1A 4L11A 3GZAA 3AC0A 2Z4FA 2KA3A 5ERLA 1GYKA 3W21A 5FY9A 3CJIC 1LHNA 4QX3A 1KEXA 1N3OA 1AYM2 2WO1A 5F3EA 4YARA 3ZFGC 4IUGA 1LTEA 4DFSA 3ZPYA 5EXOA 1X7NA 5E89A 1OPOA 1DYPA 5C3PA 3VKFC 4NAOA 4AL9A 4PLMA 1ZBA3 4FCAA 4FP3A 2ETEA 2MHFA 3ILNA 2ATFA 3H3UA 4NRMA 3ILRA 1OLQA 4LBQD 5T5JA 3V0BA 3H1YA 4S2GA 2WNUC 1D0HA 1RUJ1 1DZQA 1XNDA 2OS2A 3MO4A 3U0ZA 2B7YA 5BNNC 2XLGA 4RGGA 4AHZA 3AX4A 1OOPA 1RJ8A 1ZRCA 1TMF3 4WM8C 1K5MC 3WDYA 2DFBA 4LO5B 1EY2A 1JI6A 3ZSKA 4JX0A 1YI9A 3AL5A 1MEC3 1G8WA 2BWAA 3JQXA 1VBA3 2WC2A 4XFHA 4M01A 5GZGA 4V2WA 5FZOB 1QQP1 2J22A 4LEJA 4KNCA 3Q8AA 3VBSC 3ZMOA 3MHZA 2NZ9A 4K1YA 1QJX3 2J7MA 3H7JA 1KQRA 3CO2A 3GZEA 4FOQA 2WYFA 5JSPA 5LWBA 5HV4A 4FFIA 4BQXA 4D6SA 3VBRC 3FC0A 3KT1A 2ARAA 1TME3 1KS4A 2RVAA 3JU9A 1J58A 2PA7A 4HVQA 3ATGA 1NQDA 3TB0A 4XYXA 5A6QA 1RL3A 3I2KA 4GQ7A 3NV4A 4K6BA 5SV8A 4LK6A 4M3CA 1O8PA 3O0WA 4LBJA 1GOFA 1ST8A 3KV9A 1W6MA 2DYCA 2JDUA 3MF9A 3N7KA 2WSVA 5DAXA 1COV3 4Y33A 4OMDA 2ZKLA 2CWSA 1RUF2 2GP3A 4JGYC 2VVDA 3S57A 1SG3A 1S2BA 5FV3A 1NUKA 4Q4W2 1YHFA 5FZAA 3D0SA 2W95A 5FYSA 1CJDA 3AM2A 4YW7A 5B4XA 3WX5A 4DEQA 4DXZA 2HWC2 2VUJA 4QHOA 2Y0OA 3IDEA 4NR1A 1W8TA 3JD73 3ZXEA 3M8LA 1LAJA 2WUHA 1ULGA 1ULOA 3LDBA 2QZ2A 4U2AA 2DCTA 2PELA 2Y8KA 5DDJ1 2GALA 2GN3A 4RQPB 2JDYA 1GICA 1WMFA 1JUIA 2VL4A 1RJ7A 5CIRA 5K0UB 4BOWA 3HPNA 1WCDJ 1LOFC 1NA1C 2DU0A 2Q8DA 1OLRA 3WW4A 3VL9A 2P3JA 4LJHA 1D4M3 2PHRA 4DRRA 5C4WA 1AR61 4URTA 1XU2A 3T30A 1C57A 5BXXA 2XQXA 3E1F1 3OGSA 2QQVA 4K40A 5FPVA 4Y4RA 5J48A 4A44A 2B46X 1R091 3SEEA 4U36A 2GC2A 1XNBA 3NMBA 1RUC1 1CN1A 2W91A 2BUKA 3LA3A 3B01A 4CP0A 4EYUA 5GM0A 3I2DA 4OULA 4G4FA 4IE0A 3S0MA 1N47A 1KS5A 4Q4V3 1BYHA 4WV8A 2C4XA 3VN4A 5FP4A 2E6VA 2V5DA 5LY2A 4QPGB 5FUNA 5I0DA 3UV9A 1FOD2 5B2GB 1G9FA 2JDPA 3I2GA 3N35A 2D6PA 3NVCA 2FMDA 2EXHA 4LIVA 4A6SA 2ES3A 1E5IA 1KITA 5FPLA 3GYDA 1GZTA 1SFPA 5FMCA 5JI7A 4XIOA 4A4AA 2RR13 3ELNA 3ZN4A 4IV1B 3NV2A 4K8RB 1RVF1 2I74A 4JRAA 4RS5C 1US2A 1BMV1 4KWKA 1TMF1 1HN1A 4LE3A 3RVHA 2FCTA 1PVC2 4HN0A 2VTXA 4TLFA 2XHNA 3OYWB 2IFWA 2K0GA 1OVSA 1RUE3 4BQ2A 5FPAA 3MIBA 1VBA1 4P5YA 4GD4A 5FZHA 3ZXLA 2AUYA 2KD7A 5CFDC 1YNAA 1QDCA 1HKDA 3LSDA 5FY1A 3WP3A 4ATFA 4W50A 1RUD3 1QJX1 4LULA 2D3RA 3VBUB 4CPBD 2BFUS 2QCSB 1XYOA 4FFFA 4MXWA 2E7QA 1W03A 3PJYA 3VZKA 4C8DA 4RGKA 1KDKA 4N90A 3SCFA 2Y34A 4YYOA 1BQPA 4UFIA 1VBE3 1YQCA 1NCRC 3T1MA 2VBDA 4IV3A 4XIKA 4DO0A 2QJVA 3KM5A 4H3WA 2GC0A 1OA2A 4M4PA 4BQ1A 2G9ZA 3T1LA 3KSCA 1Q8VA 2D6OX 4PLNA 1VP6A 3POBA 3EQEA 1QWRA 1OBNA 1U0AA 1LOAA 3ZXAC 1RMU2 4NHLA 3NAPA 4YGBA 5GZCA 2IWGB 2WS93 1AX2A 2PHFA 4Q4Y1 4K8FA 2YBPA 4HKLA 4XHXA 3T0AA 4CUBA 1HQWA 3WQ1A 1AL21 3HOBA 3N7MA 4Q0VA 2YV8A 3B93A 3SXWA 3EO6A 1HW5A 3I3QA 5DPNA 1BK0A 2BV4A 4HSJA 4I3GA 5K9YA 4ONUA 4EQVA 5KHGA 5DUVA 2UURA 3B69A 1XSQA 4CDXC 1QMJA 2ORZA 4CXWA 5IVBA 2EICA 4Z82A 1ENQA 3W9AA 1GOGA 2SLIA 4FVVA 2RMU1 3PMSA 5FZOA 2WINB 3KGLA 1LEMA 2X09A 4H7MA 4M0HA 1MPXA 3OOXA 1YLLA 1DZTA 1DGRA 4MLOA 3VHRA 4OQ8A 3BGAA 2ADEA 3GHMA 4B7EA 3I2JA 1R64A 5IFPA 1F5JA 2LTNA 1W9FA 2CDPA 1W6PA 2JG9B 2OT7A 1QJU3 3KCXA 4Q26A 4XABA 1SLBA 1US3A 4XJUA 4XOGA 1AYM1 5FLHA 3J26N 1AX1A 2WQ8A 4QX2A 3TWIA 3IIAA 1POV1 1O6UA 3SCGA 4YG0A 1V6IA 4WM7C 1AXYA 5FP8A 2ZGRA 2JX9A 3HMYA 4OFGA 2YZ4A 2XKOA 2UWBA 4AHWA 3T09A 3GBWA 3WNNA 4MV2A 1YRZA 3MYXA 4YW1A 4LHNA 1DQ0A 2VZVA 1MR5A 2R042 5CB7A 1I9RA 1B35A 1UU5A 2B45X 5EQUA 1UN1A 2XJSA 3OTFA 3BUCA 2GMPA 2DFCA 2ZCWA 2YUEA 2ZX4A 3HNBM 5FPXA 4RQPA 4AF9A 2XJTA 4Y20B 5A70A 5FMOL 5K0UA 3FHAA 3I3MA 3ES1A 1SPPB 4CDWB 4CDQA 1OD3A 2LW8A 3VHOA 2R072 5FP9A 2D5HA 1V6KA 3ZXFA 4EJRA 2FDGA 2ORXA 2ZOEB 1XNCA 5CEHA 4V2VA 3A7QA 2YXSA 1Y9QA 4YLZA 5L19A 1TG7A 2BWCA 2CNAA 2XJUA 1K42A 3H8OA 2OW4A 1XE8A 4JKKA 2JE9A 3FE5A 2YGLA 1GQPA 1JTZX 4RR3B 4N7UA 3WEZA 5FWJA 1OF4A 4E4ZA 4BK5A 5CA6A 1VAVA 3CQOA 4NHXA 5FY8A 4YVWB 5GJ6A 1LECA 4XHBA 4CZSA 2W39A 1OLME 5CKMA 3ZSJA 4B4RA 4LITA 1UOFA 3VZNA 4Y5Z0 5FDBA 4MHRA 1UXZA 4QPGA 3CU7A 2VZ1A 4JZRA 3PTYA 4IGQA 2VR4A 4CCKA 3MIEA 3BVCA 1UOJA 3IBMA 2VCMA 3NNJA 1SDDB 2HWC1 5T3NA 5IFTA 1NAEA 4NIHA 4QX1A 2P6CA 1JU3A 1S0GA 3VD7A 1LJ7A 3H8RA 1E5RA 1L7QA 3WG3A 4CCDA 1LHVA 2ZEYA 3VBFC 3E6BA 3OYWA 1R083 3MLLA 4ZKTB 5JMOA 1BEV2 1MZEA 4BDVB 4ET7A 3RFRA 5C33A 4FP2A 1HRV3 5FLIA 1WD3A 3ZXGA 3H1MA 3NV3A 3TBDA 1A3KA 1PO22 1NOVA 3T2QA 1IS3A 2Y6JA 2A73B 4Y5TA 3VBUA 2CWMA 4LPLA 4RFRB 5JXIA 1OQ1A 2VOWA 4AYUA 1PHMA 2SBAA 1E5SA 3ZYJB 4XFBA 5CNAA 3CF6E 2ARBA 3KMHA 4GZ9A 1XNAA 2PQQA 3MUY1 3FBMA 5FYBA 2RS32 5G05L 4J1WA 1J1LA 2Y33A 2ZGPA 3HT2A 3RJRA 4AQSA 4A7KA 1D0GA 4CDXB 2MEV3 2GMEA 3B9IA 4A2UA 4CP9A 1J1TA 3M1HA 4FT8A 1J59A 2VNVA 4ISQA 4RHV1 4DB5A 5HI0A 4YZ5A 2BNNA 3IAQA 2R063 2JENA 1W2AX 4AQTA 3KCYA 4KL1A 3WVJA 3GBGA 4UWDA 4H14A 3KQRA 1AHSA 5BYNA 1ZBE3 1QJY2 4OMCA 3M3OA 5F5IA 1Z78A 3EHKA 3POEA 3KD4A 4PF1A 3ZXDA 5JCTA 1G7YA 1C5HA 1H9PA 2VJXA 1DBNA 3M3EA 5F3GA 5A7QA 2VZTA 4XZUG 2Y0IA 4N53B 3AVRA 4EN7B 1YJKA 1DLCA 1H2NA 1VJ2A 1HRI2 2JG8B 1LOEA 3U10A 2RM22 1CX1A 4IEPA 4WM7B 4QKFA 2Y64A 3E5XA 2JDAA 3ZN6B 3WP5A 3MIGA
chains in the Genus database with same CATH topology
2O0OA 4C1XA 3JQWA 2VY0A 2UY9A 2UY8A 3MPBA 4IEUA 2N7GA 4O9EA 5KXDA 1ASJ3 1H2MA 1O3TA 1RC6A 2IC1A 2JG9A 1A8MA 1SLAA 4AFBA 1UW8A 4YG6A 2WNVB 4PIYA 4AVTA 1PIV3 3BIWE 1AR83 4CDUB 1C8NA 5T5OA 3WD5A 2Z5WA 1MS5A 1C28A 1GANA 5JOXA 1KDMA 5IK4A 4LUMA 1RUI3 1EV12 5T55A 1S55A 1VBD3 4YG3A 4XQDA 1RMU1 5EYXA 3B00A 4HVOA 2B39A 1O3RA 1BKZA 2EALA 1RHI2 5H9QA 5JOYA 4N9HA 4KWLA 2PAKA 5ABJB 5GKAC 1LHUA 3MIDA 4E2QA 1ND3A 4ES8A 3WXPA 4F8AA 4Y20A 3WG4A 1JBCA 2VQ0A 1EAH2 3FX3A 3SHRA 4CDWA 1H1IA 2GNMA 2NPIA 4W6XA 3RMYA 4C0HA 4CEYA 2Z79A 1YWKA 1D4VB 5FOJB 3W59A 2RS12 3D6EA 3HQXA 5C4WC 3VZMA 4AVBA 3INAA 1ZRFA 3AYCA 2CL2A 1C3HA 2XL9A 2VUAA 4RR3A 1ZNPA 3ASIA 1LESA 3AP9A 3FWEA 1GNZA 2MPFA 4XMIA 1DQ4A 3QD6A 3NJZA 4XE9A 5H9SA 4AHXA 4YVWA 1RITA 1RUJ2 3RSJA 2VG9A 3BCWA 3UK9A 3MGUA 4J6GA 4QPIC 5FFOC 2VULA 4AFMA 2OPKA 4FQ4A 5CVRA 1GZ9A 3DKWA 3PHMA 5E16A 3U4XA 2R041 1IOAA 1TNRA 2ZGMA 3IMNA 4DMIA 4L92A 1WCSA 3AFKA 2DV9A 3VBHB 4FPYA 4P9YA 1BBT1 2ZS6B 2Q8OA 3POSA 2ZJCA 1ZRRA 5DUVA 1AF9A 3OBRA 2X53S 5DZFA 3PVEA 1FV3A 2GDFA 5T52A 1RTVA 2R071 1WMDA 1FV2A 3QOPA 1NLRA 4QU2A 4QQHA 2KXLA 3AYEA 4D69A 4HFSA 5TSWA 2ZGSA 5D1IA 2VVEA 1O91A 4XW3A 2JD4A 1S0EA 4XFCA 1ASJ1 5HCFA 4FQZA 1PZ9A 2AR6A 5I8SA 3CEWA 4QQOA 3ECQA 1G9BA 2OYZA 3JBG2 2Q5TA 3LWCA 5HBAA 2RS51 2WQ4A 2QDRA 4XQWA 1OOPB 3FZ3A 2ZGTA 4LBQA 4XJ8A 2DUOA 4H7LA 4KQ7A 4XJZA 1AYN2 2WLQA 4OUMA 1IS6A 4BMEA 3OD0A 4EWEA 4JCKA 4XTMA 5C6CA 3AK0A 3SNMA 3MFCA 4AGRA 4F3JA 1VBB3 2I07B 1N1YA 4XF9A 1QHDA 4PIZA 4FTEA 3ZIWA 3WW3A 2LM3A 2O1QA 2ZX3A 3M3QA 2I2SA 3S6PA 2BVVA 2BQPA 4RGAA 1H4GA 1RUH1 2JG8A 3MLJA 2XJPA 4NWVA 1AR91 4DNYA 3RS6A 4CP1A 1W6MB 1PO21 3VKNA 3ZN6A 1SDWA 2BPA2 4E4DX 2ZGKA 3KLSA 4JC1A 2QE3A 3OY8A 3AMNA 3TYJA 1GZCA 2A6VA 1JW6A 3I59A 3V64A 1H4HA 2WNVA 1BMV2 4L97A 4Y1UA 2D44A 4CDUA 3FLPA 1TMF2 4D94A 1L3JA 2UYAA 4KGGA 4L99A 4CRQA 5T5LA 4AE2A 1LOBA 1MEC2 4DPNA 1IS4A 1VBA2 1MS8A 4BA6A 3O12A 3V65A 1CD3G 1QJY1 4C1WA 1KJLA 2YGMA 3AP6A 1F31A 3GNEA 1QJX2 2R0HA 1IHMA 4GH4A 2K2SA 2Q4SA 5ABJA 5JAXA 1TME2 2ET7A 3ENRA 2IXCA 2EAAA 1HRI1 4RQPC 1J3RA 2HWF3 1YO8A 4Q4X1 4ZU7A 3ZSEA 4Y26A 5K0UC 3KB5A 2OVUA 3PLQA 1WLTA 3WNXA 2YDEA 1PO13 2DF7A 1W2UA 3MW4A 2ZGNA 4MXVA 5AFEA 3B9CA 4Q4Y2 2WA4A 1H2KA 3JD72 4YNIA 3TN93 3VZOA 2ZGLA 4META 1LGCA 3ROUA 3D4KA 4N9IA 4D7SA 2EXKA 1EV11 2R32A 4AEKA 2C9AA 2CY6A 3WUCA 4QPGC 5DZGA 3SH3A 1D4M2 4E2SA 3A4UA 3ME2A 1OPMA 1YFWA 3RYPA 3KZ4C 4NPRA 3HIFA 3WZ1A 4FPCA 4E9KA 1ULEA 4IV1C 1YFXA 4FAGA 4K9SA 5BNOB 1EAH1 1UU6A 5EJ3A 5I8TA 4IV3B 4B3NA 2PHUA 2DVBA 3J8F3 3ZXJA 2XVGA 4E4SA 4JRLA 2VOKA 3QCWA 4Q4V2 1R1A3 4GMP1 2RS11 4FSJA 4NHKA 1F5FA 3NAPB 2NLRA 3VBUC 1HDKA 1X82A 4Y1XA 1CVNA 4WBBA 5BNQA 3RRDA 2PHDA 1BCXA 1VAKA 1PK6B 1NCQB 2VW0A 2ZPXA 3IN9A 1IPJA 4QD2A 1V6NA 4R9AA 5I0SA 3TNQA 4J1XA 4COYA 5C8CA 1MZFA 4AVCA 2E53A 4EN0A 5A32A 3ZFEA 1AR73 1QF3A 3MEPA 3TAYA 3WDXA 3LA7A 4CTEA 3BPZA 1RIRA 4MSVA 4MH0E 5J3UA 5FAXA 1FNZA 1RUD2 3D8CA 2EA7A 4YFZA 1HQLA 3KS7A 4FXKB 2CTVA 1GLHA 3D5OA 1W6PB 1VBE2 4BPZA 2P2KA 3AXDA 2GH8A 4CEWB 2TUNA 1O5UA 3CL1A 3WQ0A 4WVVA 3LA2A 2XLAA 1QNWA 4PIXA 1NE6A 4AW7A 5CAZA 3BODA 5H9RA 3JBG1 1B35B 4HK8A 3H50A 5ACA1 4BWOA 2BW8A 1V6LA 2ERFA 1MZ5A 2JG9C 1VAMA 2VMGA 1W0OA 2PLV3 2XWBB 4AI3A 2HEYF 2YYOA 5FO7B 1AYN1 2DWRA 1NXMA 3P3NA 4Z92B 1A8DA 4CDQB 4V1PA 1PZ8A 2DVAA 4UXAA 2K9ZA 3LB9A 5J37A 1ZREA 4YFWA 3JZVA 3RI8A 5JZGA 3PMEA 1JXNA 4XFAA 3POYA 4AGGA 4LO8A 5DG1A 1WBFA 3THTA 3QBQA 4GKXA 1QJU2 1WUVA 5DXDA 5I91A 4JGZA 3ALQA 4CDWC 1UF2C 1LULA 2HWB3 2Z69A 4CEYC 4R52A 1QOSA 2IFRA 2WT0A 1IZ3A 1ZBA1 4E2GA 2R0FA 4RHV2 2LUWA 1S0DA 4SBVA 2WSUA 3OJBA 4DY3A 4EN9B 4RR3C 1DQ5A 4PQ9A 4XF0A 5FCCA 3FFQA 3RDIA 1LHWA 4LHKA 3NSTA 2DCYA 1TQ5A 3O0XA 4YVWC 4AHYA 3B02A 1EP0A 2A6YA 3ILFA 1QOTA 4AFAA 1MEC1 2XJVA 4YW3A 2XKPA 2G9FA 1V6JA 2FMYA 3H7YA 3PJQA 3JCIA 3TRSB 3WV6A 2VPVA 2R6QA 2E7AA 3M3CA 1JN2P 1DGLA 1TME1 2PHXA 3P3PA 4XF4A 4DS0A 5BNOA 4GA9A 1SMVA 1DQ2A 1M4WA 2VMHA 2PN5A 1H0BA 4FPEA 4P9JA 1VB4A 2VNRA 3LOIA 2CYFA 2TEPA 2GNTA 1COV1 1HV0A 3WHTA 1PNFA 3A0NA 2EF6A 1CPNA 5DG2A 1LU2A 2GC3A 1U5IA 5FQ0B 3R05A 4R8HA 1VR3A 2IXKA 2XG3A 3FLRA 3JD71 3VDDA 1PK6A 1UCXA 5EZWA 4XILA 1ND2B 1NCQA 3J9SA 2H6CA 4HLTA 2WNEA 1KXGA 1RUG3 1SBDA 1DHKB 4AEJA 3ZDSA 1CR7A 1HQNA 1RUF3 1Z7S3 1BVP1 4Z07A 3UKVA 1RB8G 2DCZA 1D4M1 3EXUA 1HRV2 4WZCA 4Q4W3 4SLIA 3ZIXA 2ZGOA 5FO8B 4QX5A 2WZPP 3RZZA 2D93A 2B5HA 2XJQA 2HWE3 3X29B 3RJ2X 5KHJA 1NYWA 1V9U3 2DVGA 5K7PA 3H3ZA 4IEXA 1OFNA 4CYDA 1CAWB 3WCRA 1DLLA 4LR4A 4N53C 5LRRA 2BVBA 4BMBA 4CEWA 2HWD3 1HX6A 1CAVB 1S1AA 2JG8C 4Q4V1 1LU1A 2HWB1 4G9SB 4I02A 1JYCA 1Q8OA 3TNPB 4A7ZA 2UU8A 4P9WA 4S2HA 1LKNA 1N3PA 1S0IA 3MFAA 5L73A 5BY5A 1LENA 2R062 3ZO0B 1DGRN 1QU0A 2PFWA 2VECA 1X33A 2RR11 4BCUA 1ZBE2 5SV5A 2H6BA 1BBT2 4K20A 5CADA 2WNVC 4DY5A 1ND3B 4IETA 1LOCA 4RD7A 3PNAA 4CDUC 1QH7A 1RUE1 2D40A 2A6XA 1FOD3 4CEYB 3LOBA 3URFA 1W6NA 2R30A 2A3WA 1RUD1 3UJQA 1XYPA 3QH6A 4FOVA 4KWJA 2AENA 2LALA 2F6BA 3VV1A 1ASJ2 4GH4C 1FMD3 2NYYA 1VBE1 1PVC3 5ABJC 4LLFA 1WBLA 5FTTC 5LEJA 3WCSA 4QXKA 1YCIA 2RS52 1C1LA 1PIV2 1FI2A 1S0CA 3B5LB 2BTVC 1AR82 2DVFA 2VW1A 1YXWA 4QMAA 2JKBA 1GQGA 4GMP0 1RUI2 1VBD2 3AMQA 2FBEA 2X29A 1IKPA 1SBEA 2WS91 4MGIE 1ULFA 2WIIB 1ZZ6A 2D98A 3NKTA 2NQYA 1XE7A 2D3PA 4GB33 2XBO3 3AJYA 4FOYA 1LODA 2BNOA 3HT1A 1ZZCA 1LRHA 1UMZA 1X36A 3IKWA 5FOBB 4QQLA 2I45A 1RUH2 2X5IB 1QH6A 1Z7S1 1C8M3 4JDNA 3HN1A 3M3IA 1AR92 4TZDA 2FZ2A 2ZMLA 3PVOA 4OI1A 3H1WA 3RPQA 4I30A 3VBHC 3E6CC 1F8VA 1FPN3 3AYAA 3LSEA 3I7DA 2A75A 2AZ5A 2D6MA 2IXIA 2EVXA 2XJRA 1QJU1 4UBHA 1SLTA 2OIIA 5EV7A 1EPWA 4LBQB 1AXZA 4YW2A 5L36A 1QXJA 4A3XA 1LHOA 1F9KA 3B3QE 5CFCB 1IPKA 1CONA 1UAIA 3C2UA 4BH9A 4FPKA 3WUDA 4AFDA 2JJ6A 5JIAA 4GXLA 4C91A 5FQ0A 4GALA 1CAUA 2PAMA 1ND2A 3O7OA 3CNAA 2EIGA 2DUPA 3AKPA 4ZXKA 4DRVA 1OOPC 4HANA 5LK5A 3IM0A 1O4ZA 1XU1A 5KXEA 4ASMB 1UD1A 4N7IA 4Q4X2 4IERA 4RSUA 4KGQA 3W58A 1U12A 2YC0A 1GZWB 4L8QA 5AFBA 2ZHLA 1N3QA 4PJYA 1BZWA 3OY8B 3VBRA 3H0OA 2QQPA 4WVZA 3LAGA 1S2KA 2A5ZA 2E7TA 1I3HA 2AH2A 3I59B 1CAWA 2HKXA 1WLDA 1W6OB 2A3XA 2GNBA 4K21A 4LBOA 4YZ4A 1G9CA 5JSRA 1CAVA 3WDWA 2BBVA 4JGYA 3ZMNA 2HEVF 4YM0A 4HPKA 4MVTA 2H0BA 3NV1A 1OD5A 2ZKNA 1PMIA 2Z2SB 1VBB2 5GZDA 4XXPA 2XBO1 3R6SA 4GH4B 2VOVA 2CV6A 1CJPA 4QM9A 4B7KA 2GU9A 4XF3A 2DVDA 3ZYIB 4WVWA 2WFF3 3WHUA 4LUKA 1R081 3OD4A 5AVPA 3AZVA 2VW2A 1HRV1 1Q56A 2RJKA 3USUB 4PDWB 3TOJA 4Y24A 4Y4YA 1QY4A 1MS0A 4AI0A 2OZJA 4OLLA 4MYEA 4P9IA 4DINB 5JZGC 2XWJB 1ZX5A 4IESA 3G7DA 3VBOB 2VXRA 3DPRB 2NN8A 2NP0A 3ZYGA 4PF5A 2MEV1 2P34A 1DQ6A 2HJIA 3K51A 3FUQA 5FLJA 4LA2A 1Y7BA 1LEDA 5KHIA 5AC93 3JB4C 2ZHKA 3WG2A 2YMZA 5J98B 2R061 1BXHA 5EFUA 1Q5OA 2Q1MA 2V5YA 3MLKA 3IWZA 4TWTA 3E6DA 1V6OA 1ZBE1 2XGXA 2ZGUA 1E57A 4RS5A 2C5DA 5IK5A 4BYYA 3FUOA 3R4SA 4AXOA 2RS33 3I4IA 5J09A 5KXCA 3ZYPA 1NZCA 3QLQA 4INDA 4YVSA 1O7FA 4ZU5A 5BNPB 3JUUA 4IEVA 2X5IA 5JOWA 2C0ZA 3E5UA 3UKTA 2HWF2 4Y1YA 4QQPA 2D6NA 4ITCA 1PO12 1C5IA 1VRH3 1EYBA 5LEKA 4LBKA 2ZZQA 1PGW1 1SBFA 4W6WA 1F2NA 1HXS3 2A6WA 2JEMA 5I0TA 3WW1A 5IT6A 1ZZ7A 3DF0A 4FOWA 5FREA 4E27A 5L7OB 5BNOC 4GWNA 2NMNA 1PIV1 5ACA2 3PVNA 2DCJA 2RM23 3TN92 2Q30A 3WDTA 4IV3C 1AR81 5AVAA 2CGPA 5CFCA 3OGGA 1H2LA 1POV0 1MVQA 4MUVA 5C8CB 1RUI1 4I0BA 1VBD1 5A32B 2DTYA 3ZFEB 3N36A 4OHYA 1UPSA 1S0JA 2BGCA 2ZTNA 4XQ4A 2GN7A 3NAPC 4XZPA 5KC6A 1LGNA 3A0KA 4Z2WA 2XLFA 1MS4A 4JTOA 4R4ZA 1PK6C 1W39A 4AEMA 3VLBB 4G3YC 1NCQC 2GC1A 1SFYA 2PHLA 3R0RA 2WJSA 5HCBA 4YZ1A 5IK8A 4WZFA 1GZWA 4XDQA 3MDPA 2BFUL 2HEWF 1RHI3 4I09A 2FQPA 1ZBA2 4I0WB 3MW2A 2VQAA 5C9AB 4AI1A 1LB2A 1LOGA 3HR9A 3IDBB 1W6OA 2ET1A 3MI8A 3AP7A 3N7JA 3AMHA 1Q43A 4RA0A 4CEWC 1KFUL 5JWPA 5AC91 1MQTB 4K1ZA 4AK3A 3BOWA 1X8EA 4IXLA 2P3IA 3EJKA 2QUOA 1H8TB 2ZHMA 4NO4A 4WVMA 5JZGB 1B35C 2IZWA 4S2DA 3NL1A 4HK9A 1OFSA 4OUSA 4UW4A 2HYKA 3RWNA 2ZMKA 2NMOA 2PHTA 3LZZA 2EXJA 1OSGA 2EXIA 2W68A 3VHNA 2DU1A 4JGZB 2DCKA 1MS1A 1SLCA 4QQ2A 3USUA 2UWCA 4CDQC 4BIFA 4COUA 4PDWA 1QQP3 4NWWA 4LLOA 1COV2 2ZAAA 1CIWA 1RUNA 1J3QA 4FXGB 1H9WA 2QZ3A 4AVAA 2Y38A 3VL8A 1W6QA 2OA2A 1C4RA 1FXZA 3VBOA 1PGL2 3DPRA 1G9DA 1CESA 1UZYA 1BK1A 3ZSLA 4Z1VA 4Q0QA 3WINE 2PLV2 2VGDA 1ZVFA 1A78A 3CJXA 1VBC3 1DZRA 3FFZA 1JUHA 1WW6A 2UYBA 4JDMA 4M00A 1FNYA 1VBB1 4HZFA 4N43A 1UPIA 1O4YA 1MS9A 4R9CA 1OI6A 3VBFA 4P9LA 4NHMA 5DDJ3 2ZBJA 1FT9A 2P37A 1WCKA 3QH7A 5BNPA 4OI0A 2OUHA 4KU8A 1NY72 4LHLA 2ILMA 2G4IA 4LBMA 5JR7B 2HWB2 4M0NA 1RGSA 1Z0HA 2YPJA 1AR63 2IXLA 3ZFFB 5JIUA 5F6LB 2B8MA 3IPVB 4YW4A 4LO6B 1ZM1A 3KT7A 2AREA 4YM3A 1N1SA 3MW3A 4HVRA 1G9AA 5F9TA 1QKQA 4AEDB 1M06G 1R093 5L7OA 2RR12 4MGKE 4QPYA 3VDDB 1IKQA 3DL3A 4K7JA 4LNVA 5D8AB 4FPGA 1RUC3 3AZWA 4QT6A 4P5HA 3NW4A 1DF0A 4R9DA 2GSYA 4XEZA 2OUJA 1W0PA 2WA3A 5GLZA 1RUE2 2BYVE 3WDUA 4UW5A 5IUQA 1WW4A 2TNFA 4AQ2A 5E88A 3ACLA 1RVF3 1JH5A 2GAUA 3U07A 3K48A 4FAHA 1ND2C 2XB6C 5GLVA 4AI8A 4QGLA 1AL0G 1VALA 1CAXB 1N1TA 1D2QA 3Q9OA 1JOJA 5FBZA 2HWF1 4UBGA 1BJQA 3AKSA 5BUVA 4Y1VA 2XVKA 3GHNA 1PO11 3MPPG 2GMMA 1ZA4A 1XXNA 4QHBA 2XL7A 3IDCB 3M7AA 2WS92 5C9AA 4KH9A 4EROA 3WLUA 3I8TA 3TN91 1MVEA 4TYSA 4ISRA 2WZR3 2GH2A 3JB8A 1U5ZA 4LTAA 1RUG2 4IEQA 1VBC1 1MQTA 4DOUA 1Z7S2 3OF1A 1SQ4A 3VZJA 5JMCA 4P9XA 5CBLA 1W6NB 1XRUA 2ZMNA 5H9PA 1FX5A 1XYNA 4Q4Y3 1H8TA 4BIOA 1SCRA 3GALA 4FPOB 1AL23 5GLWA 5T5PA 3MZHA 3ST7A 2HWE2 3E97A 4C90A 1V9U2 4GWMA 4XFGA 4HMZA 1ND3C 2MNGA 3OBTA 3J8F1 2CAVA 2HWD2 4MX3A 2TBVA 4Q1RA 2RMU3 3AKRA 1CX4A 1R1A1 1DYKA 2VU9A 3ES4A 4RFT0 5F1RA 5A33A 4XFIA 4XXAA 3M4FA 2B9UA 1PGSA 3NKGA 1X50A 4Y22A 3O5SA 4JTNA 5DUXA 4YGEA 2JDZA 3VGIA 4AFCA 5LK7B 4Q2FA 5BPXA 4HKWA 3RYKA 3DN7A 4QPIA 3DUIA 3WP4A 1AYM3 1NE4A 3E5QA 5F6KA 4MGZE 1H1AA 1AVBA 4UW3A 4BM8A 1JYIA 1POV3 3S30A 4BLIA 3FHIB 2Q0AA 5KHKA 1AR71 2RHPA 3N4MA 1QOOA 1SCSA 4GIQA 4PBOA 1U5YA 5HCAA 2PHWA 2CGOA 1AX0A 3UKNA 2FZ1A 1ZRDA 4S2FA 2XPJA 2W52A 1OA3A 1OA4A 1HIXA 3GF6A 4LBNA 2XUMA 4HL0A 4D3WA 2JXAA 4X6QB 3T2TA 4AVSA 3AJZA 1QGLA 5J7MA 1REDA 4H55A 2AYHA 1YIPA 1OQDA 1FMD2 3CJIB 3AKTA 2CGNA 1DFQA 2XH6A 3AMMA 2WL1A 3AMPA 1WMEA 4YVSC 5I0RA 3ZFGB 4R4XA 1UX6A 2E9QA 2X5IC 4AWDA 2ZHNA 4CP2A 2F4PA 4LT5A 3POWA 1VB2A 4XETA 3ZFFA 4FTBA 5FRAA 4D7YA 3IPVA 3AXEA 4PBPA 4ASLA 1G6NA 1Q3EA 2VMIA 4FO9A 2FHRA 2WNUB 4AEDA 1QJZA 5BNNB 1PGL1 1CAUB 1REFA 4DZGA 2EAKA 2VH9A 4GB32 2XBO2 2H0VA 3ZX7A 2WT1A 4WM8B 5D8AA 1K5MB 2PLV1 3LCPA 4Q0UA 2WZR1 1R082 4FPFA 3WY6A 5CFCC 4HETA 1LR5A 1WA4A 3ZN5A 4BLJA 3WDVA 4OI2A 1C8M2 5E8AA 3VBSB 4COVA 2HWC3 1KRIA 3QACA 3MF6A 4L2NA 3VBRB 1UIJA 1V6MA 1FPN2 1PZ7A 4UW6A 3RG0A 1UKRA 3M70A 5JLVA 4YSFA 1CAXA 3O14A 1NQJA 4PLOA 1U5XA 5JVVA 3R4DB 1NY71 2MEV2 4FPHA 4NOTA 4F83A 2V73A 2VNOA 3FLTA 4X8PA 4D7TA 4JGYB 3HBZA 4Q1PA 2ZA9A 4HBNA 1MZ6A 4M3CF 4HPKB 2YY1A 2ZX2A 1GSLA 1IQAA 4MGYE 1CGPA 3H8UA 1S0BA 3C3VA 3D82A 4TSVA 4X8NA 2GZWA 5HXVA 1I5ZA 3I54A 4BHPA 1V70A 1SEFA 1O4TA 1GNHA 2ARXA 5GLTA 3SLIA 2Q1ZB 4YGCA 3FJSA 1NA1B 5DZEA 4FBFA 4EN6B 2AGSA 5JSOA 3VUOA 1UKGA 4RHV3 4I2OA 3RNSA 2JICA 4Z8BA 2DURA 1YFUA 1PGW2 1X8MA 1G86A 5KBFA 2VVFA 4XTPA 1KJRA 1OMIA 1D2SA 3KGZA 1DIWA 2IXJA 4LBLA 3VHPA 4I3PA 1AJOA 4OHWA 3NO8A 1APNA 3KCCA 1SLIA 2WFPA 3B7MA 2E51A 3GZTB 1UIKA 4PDWC 4C0BA 4XJWA 1NLSA 4RS5B 4NVPA 4B8EA 3VKOA 3USSA 3WOGA 3VBOC 1UU4A 1ZYBA 3DPRC 5JDBA 2O8QA 3THPA 1RUG1 4YVSB 1URXA 5KWRA 2D43A 2WFF2 3WW2A 3IT8A 1YYNA 1RUF1 4Q27A 4ZU4A 4BZ4A 1WLWA 4OHZA 2E63A 1RMU3 4Q4W1 5CFDB 4Y1ZA 4MZUA 4XBLA 4KU7A 1UZZA 5I8YA 1ZZBA 4IV1A 4XFFA 3AZZA 2HWE1 3H9AA 1SLLA 4N43C 2WWSA 1V9U1 1NCRB 3CJIA 4Q8KA 1QXPA 1DQ1A 4COWA 4PCRA 4W6YA 2HWD1 2ZGQA 3ZFGA 1N1VA 5E1RA 1NXD1 5BNPC 1WW5A 3RI9A 3WT3A 5JOZA 1Q8SA 4OHXA 3ZVXA 3G6JB 5AC92 1OHFA 4HKOA 2WT2A 1SACA 1YI7A 1TNFA 2CAUA 1JHNA 3VZLA 2WNUA 2ZX1A 1ENXA 4FTSA 5BNNA 1ENSA 2Z42A 3LKJA 1DU3D 4AQ6A 4WM8A 1K5MA 5L7OC 4XPVA 1GFF2 5DUUA 4Q0SA 5I93A 5FPZA 3L2YA 3MIHA 1PM7A 1DGWX 1MS3A 4AVVA 1FOD1 1FYUA 1AJKA 1UL9A 5C8CC 1AZDA 5CU1A 4BE3A 3VBSA 2A3YA 3ZFEC 3AB0A 3ZXKA 1GQHA 3DGTA 1O3QA 2R043 5F5QA 1VRH2 4YZ2A 1EPZA 1OKQA 2D6KA 4ES9A 1BBT3 1HXS2 1AUYA 3RMXA 1FMD1 1HV1A 4Q29A 1PVC1 1CQ9A 4EV0A 2Y26A 2PYTA 3N3HA 5EYYA 2R073 2W0XA 3J4UH 3RYRA 3BU7A 2ZZJA 1ENRA 3OPZA 4AGVA 1DDLA 4KBBA 3V0AB 1WW7A 3UJOA 5K8SA 4M3CE 4GB31 3ZYRA 1NG0A 4WVMB 2A7AA 5A3MA 5C9AC 2RS53 3R4UA 4R9BA 2O8OA 2D5FA 4EN8B 2UWAA 1LOFA 1NA1A 4NN0A 3BB6A 3OCPA 5FO9B 2OZ6A 4YZ3A 1C8M1 3WQ7A 1MACA 5KC5A 1MQTC 4Q8LA 1H1MA 2QNKA 4YRDA 1LGBA 1O3SA 4B4PA 4I0AA 1FPN1 1H8TC 2JE7A 2R49A 2QVSB 1W6QB 1ULDA 2D7FA 1BEV3 4LA3A 4EWAA 5C8WA 1RUH3 2A6ZA 3O0VA 5GZFA 4GULA 4KG0A 5KXBA 2A71A 1AR93 4IEOA 1A6CA 4JGZC 1I1EA 3L2HA 3PVBB 1PO23 2QDNA 5KHHA 4L9BA 5J36A 1RINA 2G9GA 4HT1T 2P3KA 2ZAHA 1T6GC 4LO4B 1PVXA 4IEZA 3L9JT 3AP4A 1I6XA 4N43B 3HD8B 1Q8PA 1J3PA 4I01A 1B09A 1V00A 3VBFB 2XVLA 3D0JA 3WR0A 4KG8A 3RQ0A 3HWJA 1TE1B 2ZABA 2PAEA 4W65A 2ZACA 5CFDA 4EWDA 5A3LA 1QQP2 4OHVA 3ETQA 1QJY3 2X8KA 4K3UA 1C1FA 2WQZC 1NCRA 3EBRA 1HRI3 2PTMA 4IL7A 2KM2A 2W08A 5GALA 3CLPA 1AXKA 4Q4X3 1RUOA 2IXHA 5T50A 1YIFA 2RJLA 5IK7A 2YHJA 4HSLA 1VBC2 3AZXA 3M2MA 3ZFFC 1GR3A 1CPMA 4YM2A 1HLCA 3BALA 1WGPA 5BV6A 1VLNA 1Y43B 2BNMA 1QDOA 1QXRA 3V0BB 1IGOA 4AEDC 4JDOA 3VDDC 2QFEA 3AFGA 4CDXA 5CG8A 1LCLA 2WFF1 3NWKA 5D8AC 5DDJ2 2JECA 5JPMB 2VNGA 4HN1A 1EV13 4JQRA 2B42B 3J8F2 5FMOS 1FATA 1R1A2 4FPLA 3BOPA 1R1ZA 4QGNA 4XBQA 4OI4A 4OVEA 3SH5A 2D6LX 1AR62 1ONAA 2R1BA 2R16A 3OGJA 4P9GA 4XBNA 3GBFA 3HAGA 4YW5A 3VKLA 3AZYA 1Q8QA 2ZX0A 1R092 2P17A 1EAH3 4N53A 1BEV1 5T54A 1QNYA 4WM7A 3ZSMA 1RUC2 1YUDA 4M3CB 1GBGA 2BEOA 5JI9A 4GMP3 3S7IA 1S0FA 2RS13 5J96B 4DQAA 4JV4A 1AR72 4RL7A 4YGDA 3V0AA 3AP5A 5I0UA 1GV9A 1XNKA 3AKQA 2DTWA 1RUJ3 3N7LA 2RS31 5GLUA 1ZZ9A 3SMHA 3SH4A 1RVF2 1Y3TA 4X6RB 3GZUC 1TEIA 1YFYA 3APBA 1SFNA 3MIFA 3SCHA 4IEYA 4LE4A 1BVVA 4B29A 2VOXA 4XJ9A 2QKDA 1WLCA 1IS5A 4IEWA 2WKKA 4YM1A 1VRH1 2GNDA 5EWSA 2WLPA 4ATEA 5C4WB 3MICA 4AI2A 5A33B 1XQNA 3SISA 1HXS1 4LO7A 4QM8A 4Y22B 3S7EA 4ORFA 1H30A 1DG6A 1ZZ8A 3WP6A 1KD7A 2RM21 4FPJA 4IQPA 2DUQA 4QPIB 4XMAA 1KFXL 4O9GA 2WZR2 3BTAA 5CG9A 4JVAA 1PNGA