3J26N

The 3.5 a resolution structure of the sputnik virophage by cryo-em
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
362
structure length
362
Chain Sequence
b'EPDTVYYDILIPFKPNDQGFSPAIFQAQLTQPIVHNPSEYFLSVVRFSIPTQNIPLTIPQIQPYPNTNVNNTIYSVSIGYNGTYSSQNFVQFDPSLTSPNIPAPNAPTVTSPNVEVTPYYYIYDYSTFLQMINTALENAFNEISAPVGADAPFFFYDSNTEKISLIAQAAYYDRTLTTPIEIYCNVNLFTFFDSIKHIGLGYNTPTGRDILFDVRFLGNNYYQDPETAPSYPPEFIQMQQEYPTLSNWNAVKTIQLVSNLLPINKESIPSFRNSNVGIINAQGILADFVPLVTNGPEARISIDFVATGPWRLIDMFGSVPIYMVDLYVYWTDQTGGQYLINIPPGRILTCKLVFIKKSLSKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords capsid protein V20
publication title Structure of Sputnik, a virophage, at 3.5-A resolution.
pubmed doi rcsb
molecule tags Virus
total genus 25
structure length 362
sequence length 362
ec nomenclature
pdb deposition date 2012-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1100 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3j26N01
3J26N
chains in the Genus database with same CATH superfamily
5DUUA 4XFBA 5KWRA 3BOPA 4CCMA 3RZLA 4QPGC 3M3EA 5DQ0A 4YW7A 1ZRDA 4EN6B 5T52A 3PTYA 5JSPA 1U5XA 5CFDB 5GZGA 1W2UA 2CL2A 4BMEA 2FHRA 5CFCC 1SLIA 1W6QA 5C8WA 3M2MA 1AR93 5F3CA 1RVF1 1ULEA 2W1UA 1GLHA 4MGYE 1VBA2 2CWSA 4XMAA 5FY5A 3UYJA 3NO8A 3KM5A 2DCJA 4DFSA 1D2SA 3M3CA 5FYMA 5KHHA 2B9UA 1QJY3 5J7MA 2RVAA 4NUBA 4L99A 2W47A 2Y8KA 3BYWA 2P3IA 4DMIA 3GHMA 4YGBA 1NUKA 5I8TA 4E4DX 2R043 4DXZA 1DGLA 4Q0SA 1JU4A 2GH2A 1ENXA 1XSQA 3H1WA 1NE4A 1FOD2 4AOCA 1GZTA 1WW5A 4AF9A 1ZBE2 2ZX3A 4LO4B 4E2GA 1CN1A 2E7AA 5EV7A 1BXHA 2RS33 3A7QA 4B4RA 3I97A 5EP9A 4GD4A 1HRI1 3H7YA 3FJSA 3PUHA 1S0CA 2RG4A 4EN9B 2PHRA 3NW4A 4YVSC 3BTZA 2EXKA 1WLTA 2Q4SA 3A0NA 4Y26A 3UT0A 4NHXA 1UL9A 2XLGA 2Y33A 1TE1B 2O14A 5I0UA 1MR5A 2WSUA 4JCKA 1KGYA 2CU5A 2PFWA 4K20A 3T2PA 4JHTA 3CJIB 4PDWA 4PLMA 4JTNA 1IG3A 1SZBA 1S2EA 1K5MA 1UY4A 4QX5A 3WR0A 1SLAA 3ZYIB 2WBKA 2R073 1T2XA 5FMBA 2C0ZA 4GWNA 3WW4A 2Q8CA 1VALA 3O0VA 4GH4A 2WFF3 1URXA 3NMBA 3LOIA 5FZ8A 3O14A 3EYPA 5BNNA 2SLIA 3OF1A 4WVVA 5A33B 4KG0A 4OFGA 1HB3A 4ASMB 3P6BA 3WDVA 5JXJA 2VO5A 3RQ0A 1YQ5A 3ZXLA 2NMNA 3WP6A 1BMV2 4OHVA 1JZ7A 1POV3 5J1XA 4K40A 2BOIA 2YZ4A 1UKRA 5EPAA 3RSJA 2HWE3 3HNBM 4FTBA 2VCCA 3S30A 4B29A 4DNYA 4AYUA 5JSRA 1ULGA 3J8F2 1LEMA 4LBKA 1F5FA 2LM3A 4GJYA 1F9KA 4LKSA 4YG6A 1KS4A 1O5LA 2VZSA 3IAQA 5HV0A 1CJDA 2XLAA 3ILRA 4HN0A 5BYNA 2NZ9A 4CP9B 1LOFA 1ZRRA 3W58A 5IVFA 1OOPA 3OPTA 1Y7BA 3U14A 3VL9A 4UBHA 2RDQA 4MG2A 2OA2A 3WVJA 3WUCA 3Q9OA 4PBOA 3PVBB 4S2GA 1TMF3 4H7MA 3VL8A 5KXEA 2EXIA 1AR83 2R30A 5F1RA 1JZ2A 4OUSA 1UZZA 1AYM2 1IS3A 3PHMA 2R7EB 4GH4C 2VZPA 3DYMA 5A7PA 4QDQA 3NV3A 4QHZA 1W3VA 1O3QA 2PAEA 2NMOA 1XC6A 1LGNA 4QPGB 3D3AA 4CU7A 5IK5A 3UJQA 3AKTA 1YIFA 3VKNA 2XUMA 5KHIA 3AMQA 3LEMA 3R0RA 3DPRC 2JDYA 1HXS1 1WW4A 1YJLA 2YMZA 3IPVB 4PIXA 3S5AA 3ZX7A 3LEKA 4K1ZA 2EIDA 3I59B 1XNTA 2D3SA 2WABA 5FK8A 4XJ8A 3U0ZA 4XIKA 3KLSA 4GQ7A 3WCSA 3NJZA 3BU7A 4MXVA 4U2AA 2R1BA 3DKQA 3U4SA 2XBO1 2HH9A 1PO21 3NAPB 2W91A 2WT0A 1O91A 1UU4A 2JE8A 2WWJA 3KV4A 1J3PA 3THTA 1NXD1 2EAKA 2WNEA 3DECA 1OOPC 1VBC3 4LE4A 4Q4V3 2O8OA 3VD3A 3ZN6A 1W8FA 2ES3A 1XQNA 2VOKA 4DS0A 4QB2A 4XFGA 2BGOA 2X5IB 2WQ8A 3CL1A 4S2FA 4IESA 4OYUA 4N53B 2B4KA 3PLQA 2WZR1 4FXGB 3OCPA 3T0AA 1C5IA 2MHFA 3LA3A 2P1BA 4YVSB 5HI0A 1KRIA 1JS9A 4XCBA 1GP5A 4W4ZA 2VY0A 1W99A 3POWA 2WZEA 1IPJA 3H7JA 1OURA 1W6QB 3WY6A 2LALA 1VBB2 3AP9A 4GMP1 1VBA1 2OW4A 1XU1A 2DUQA 4GMP0 1BJQA 1YEWA 2RDSA 4XJWA 3IAPA 4DUVA 2ZEYA 2WO3A 2Q8OA 2G19A 5F6KA 5FKCA 2X53S 3WNXA 1LENA 2Y64A 2BVVA 2AYHA 4K8RB 3WG1A 3KT1A 1LESA 1RUG2 1VBD3 4XF1A 1DLLA 4R8HA 1XU2A 3VDBA 2BU9A 2RM23 1OD3A 3CKHA 4PI2A 2VZ1A 3R6SA 1DIWA 3ZYHA 5IW0A 3QBQA 5ABJA 1SPPB 3OB8A 5F5AA 3RI9A 1ZZ9A 3BPZA 1LECA 4PIYA 5F3IA 4MYEA 2RE9A 5LEKA 3ACHA 1NYWA 3ATGA 3E6BA 2FCUA 4NR1A 4NHYA 2ZKLA 1Y3TA 1QJU3 2WINB 5JOWA 4DUXA 1J3RA 1MZ6A 4FPCA 4LQRA 4PDWB 4NVPA 1MS5A 3B5LB 4HOOA 5C3SA 2HWB2 2E63A 2P37A 1K5MB 4MADA 5HCFA 4MH0E 1J58A 1EV11 3W5MA 3USUB 5ISLA 2DCKA 3OSDA 5ACA3 1A8MA 4OUEA 2ZGTA 3D5OA 2IXLA 4X6RB 4CEYC 1YYNA 4GH4B 5F32A 3IDBB 2ZABA 2ZGUA 3HPNA 4FXKB 5JOXA 4QM9A 2XL9A 5BNNB 1YUDA 5D1IA 1ZA4A 1ND2B 2GALA 4HN1A 4ASLA 3PUAA 1W6NA 4P9JA 1HRV1 1LGBA 3VDAA 4HK9A 1W90A 1RUH1 5A7OA 4FOQA 1V6NA 1W6MA 4LKFA 3WF1A 3FUQA 4A44A 1AYN3 1W9TA 2CHHA 3I2JA 1FMD1 3N9PA 2I74A 5ABJC 3J8F1 1QGLA 2OKXA 5JIUA 4LULA 4EN8B 5A3MA 1FV2A 1PK6A 5IYYA 3FWEA 4AZZA 4OLLA 3EQEA 4NN0A 2VZRA 5BXXA 5FIXA 4RS5A 2VOXA 3MW4A 4GAZA 2RS13 4Z82A 1RC6A 1LHUA 1PVXA 4QKNA 4CCNA 3WNLA 1LHNA 1XYPA 3J4UH 4I02A 2VCBA 4NE9A 4W6WA 1Y9MA 5A1AA 5BNOC 1GU3A 2E53A 3E97A 4QQLA 2FDGA 4K9SA 4FPLA 3HWJA 1RUF2 2D98A 4OVEA 2W2IA 5A6QA 3AKPA 3VBRB 2D6OX 3IN9A 4XFHA 4D0QA 2IZWA 1BLZA 1XPWA 2B39A 4IE7A 2GU9A 4MGKE 3THCA 2HWF3 1NE6A 1WD3A 4XOGA 1Y9QA 3HT2A 5FK7A 3LSDA 5FCCA 1QQP3 3NWKA 5J96B 1QXPA 3I3MA 2PMWB 3SHRA 1UYPA 2ZGQA 4A3ZA 3SMHA 3OUHA 1YFWA 1RMU1 3PIGA 3ZSKA 1W28A 4I2OA 1CAUA 5A6YA 1XXNA 1GOHA 2ARXA 4S2HA 2JDNA 3FZ3A 3U07A 3T2QA 2FDHA 3WW3A 1AR92 4Q2FA 2VUAA 4YZ2A 2PYTA 2FDKA 3AFKA 5F37A 5C3QA 4FAGA 4RS5C 2QQLA 4AVAA 5EYYA 4P9IA 5IFPA 2A6ZA 4XDOA 1QJY2 3FLPA 1TVGA 2OYZA 4RGAA 2IXIA 4I09A 5I0RA 1DGRA 1XOYA 3LOBA 3OPZA 3W59A 4DY5A 2R042 1MVQA 5FZKA 4QWNA 4XHBA 4Y24A 3VBSB 3ZN4A 1UXXX 3ETPA 5EXOA 3DXTA 2PAMA 5E1RA 5LRSA 5ERLA 3ZSJA 1DZTA 4H14A 4EWEA 5L19A 1AX1A 4M3CB 3VBUA 3MIEA 2RS32 1NLQA 2HKXA 1DQ0A 1OF4A 2WKKA 2XJSA 1PGW2 5FYYA 5GLTA 1UOGA 5CKNA 5C3OA 2A75A 4P5HA 1WW6A 1SLBA 1T6BX 2E33A 4YFWA 2Q5TA 4QX1A 4QX0A 2VD7A 2DURA 3NNLA 3APBA 2ZXQA 3PTRB 4A7YA 4FTSA 2WQZC 1WMFA 3T2OA 3ZIWA 1JHNA 2VU9A 3X29B 4WM7A 1CONA 3RZMA 4JGZA 4XUTA 4XQ4A 1G8WA 5KXBA 3KCXA 1QJX1 3BIWE 5CYYA 1MPXA 2ZX4A 4Y1VA 1H4HA 1IG0A 5FBZA 3AP7A 3VDDB 4BZ4A 2E9QA 4XUPA 3RFRA 5L36A 4Y4RA 4XFFA 1RB8G 2Y0IA 5FZOA 1NKGA 2ZPXA 4ISRA 2WFF2 4QU1A 1QU0A 2VH9A 4BWOA 4HKWA 4TTGA 3U10A 4YM3A 2Z69A 1AL0G 3KCCA 2Y6LA 5FLJA 4CUAA 3RZHA 5A3OA 5ABJB 4IW3A 3TEYA 1JYXA 1WCSA 4WVWA 1X9PA 2A3XA 2ZHKA 4AQTA 2Q8DA 1ENQA 5C4WA 2Q30A 4QPIB 1H30A 1R1ZA 3ACIA 2HWE2 3WF3A 2BRTA 1BVP1 2XONA 1MQTA 3O0XA 3VBUC 4HETA 3ZXDA 1AXKA 3BTYA 3J7LA 1OF3A 3OYWA 2CDPA 2VBPA 5JMOA 1JZ5A 2HWB1 3N9QA 1LOBA 2YBKA 2VZQA 3I2IA 1PO11 4XE9A 3VV1A 1KFUL 4JGZC 2VXRA 1ALYA 1CZVA 1ZBE3 3POFA 1S2KA 3ALQA 1FT9A 1PM4A 1F4HA 3ZXJA 2P17A 2D5HA 5A7NA 2VG9A 1FV3A 1TMF2 3WNMA 4D7TA 1AUYA 4Y20B 1J1LA 4IXLA 4DO0A 1BZWA 1AR82 1GSLA 2BQPA 4LBQA 4YM1A 4CCJA 3GYDA 1X8EA 5BNPB 5IAVA 3INAA 1BQPA 1W0PA 4Q4W3 2QQJA 3H3UA 5GALA 5F7UA 1W6MB 2B5HA 2BOJA 4YGEA 4CU8A 5FQ0A 5K0UC 1RUC2 2KM2A 1VBE3 4QXBA 1ZRIA 3OJBA 3AZXA 4FFIA 3Q8EA 2V5YA 4IGQA 4D6SA 5FO8B 2Q0AA 3VHNA 3RJRA 1QH7A 5D2AA 1PK6B 3THPA 5C4WC 2RS51 2A6VA 2GNMA 1HN1A 1OA2A 5IK7A 2W46A 4IERA 1MQTC 4RS5B 4B1MA 3MLLA 5FO9B 2BNOA 3JD73 2ARBA 1Y43B 4Q27A 3S7IA 4E4ZA 4Y22A 4BA6A 2ZGMA 4BLIA 2XPJA 2ZS6B 2EAAA 1S4CA 4MX3A 3EO6A 3VB9A 2AGSA 4H7LA 2RMU2 3GF6A 4FT8A 3O1TA 2H6BA 5CIRA 1V6OA 1AXYA 3UL2A 1RUF1 1VBC2 1PM7A 4Q5OA 5FZ7A 2BDRA 1W8NA 4GWIA 4JGYC 4LBJA 4UFJA 4BPZA 3L2YA 4E4HA 4XJAA 4CZSA 1EYBA 2YHJA 2D6NA 5IJRA 1G6NA 3HJRA 5CG9A 2CY6A 3QCWA 1C1FA 2ZHLA 1REFA 2IC1A 5IVBA 1ZM1A 1LTEA 1CAUB 3A22A 1CAVA 1FAYA 3SEEA 1LOGA 1BK0A 1US2A 4O9EA 4NHLA 1RXFA 5HXVA 1PX3A 1GQGA 2C6SA 4A2UA 4C1XA 1AHSA 1ACCA 3TNQA 4OZXA 1AYM3 1G9FA 5FP3A 2JG8A 2WO1A 1M06G 1VRH3 2TEPA 2PA7A 3AC0A 1QJY1 3VBFC 3E5UA 3THDA 4JHZA 2GC2A 4FOWA 5FUIA 4RQPC 1H9WA 2D43A 5T55A 4LLOA 2R041 4JQRA 4AWDA 1VMFA 3I2GA 1XNAA 1K45A 1IPKA 1LU2A 3KS7A 2RM22 4AFBA 3WDXA 4CYDA 2J1TA 2W87A 3DCQA 3VBUB 4XW3A 1W9WA 3G6JB 1BVVA 3POSA 1TNFA 5ANQA 2J1SA 3HIFA 2E6VA 1PGW1 1GQHA 1ULFA 4KNCA 3S0MA 4I01A 2CGNA 1OSGA 2UYAA 3PUIA 3RGBA 1TQ5A 2J22A 1WA4A 3J7NA 3KQ4B 5FFOC 4ATEA 2YFZA 2YPJA 3WD5A 1MS0A 4WM7B 2QZ3A 1OFSA 1QJU2 4FVVA 3QH7A 4L92A 1W2NA 2DBNA 3M4FA 4QM8A 1A6CA 3VZOA 1HV0A 4OI2A 1HQNA 2J1EA 2VVEA 4UW6A 4NIDA 3D8CA 1SFPA 1IS4A 1NLRA 3GDBA 2PQSA 3POGA 2VXJA 4P9YA 2R071 4HONA 5ACA2 4P5YA 3MICA 5A7QA 4D7SA 3RI8A 1RUNA 2HYKA 3AP5A 2JENA 2ZZQA 1X8MA 2XOMA 2Y0OA 1F2NA 2G9ZA 2WFPA 4E9KA 5CNAA 3T09A 1QHDA 3JQXA 4N43C 4CDXA 1UO9A 4WM8A 4L97A 1VBB3 3WX5A 1POV1 3ZSMA 5C4WB 1NCRA 2WZ8A 1POV0 1MQTB 4GALA 2HWE1 1ULCA 2D6KA 3I4IA 4XAEA 3ZFFC 5HV4A 4MVTA 4HLTA 4QU2A 1W6PB 1QEXA 4CXWA 3OEAA 4ZZ8A 2VOVA 1ENSA 3OYWB 3NKTA 3WSOA 5LBEA 3RS6A 1V0AA 1RUG3 2VL4A 5FLHA 2AZ5A 2BV4A 2ORZA 1O7FA 1Z0HA 4EN0A 4HKLA 2F6BA 5DUXA 3K4AA 2GN7A 1A8DA 2PXJA 3WF0A 3ACFA 3KB5A 1DG6A 4L11A 4DY3A 3FLRA 5A6XA 2A6WA 5FKBA 1COV3 1KDMA 1RUD1 2LTNA 4CEWA 4AE2A 2NQYA 4LBQB 4RGGA 1AR81 5GZFA 5KXDA 1LHVA 3AYDA 3H1YA 2J1AA 2JXAA 2WNUA 5FZCA 4BXFA 5FYTA 3OUIA 2CV6A 2Y6GA 5FQ0B 5CAZA 3K3NA 2HWF2 1EPZA 3WNOA 4AHYA 2Y6FA 1W2OA 1QQP2 2Q1FA 3LE0A 4FQ4A 1UKGA 3H50A 4XJUA 1D4VB 5CADA 2Y60A 5JZGA 5GM0A 4QQOA 1QXJA 2XHNA 3PIJA 1UOJA 3O1PA 3O1VA 4YFZA 4C1WA 2L9LA 1NCQA 3CO2A 1MACA 2FQPA 3PURA 5GZCA 3FHAA 4L0PA 4Y22B 5T5PA 5FXXA 2WYSA 3DUIA 4YZ1A 1GNZA 4FPGA 3V65A 4TXWA 3NL1A 4WZFA 3OOXA 4JVAA 4JZRA 2JECA 2VZTA 4NIGA 1JU3A 2A1XA 4Q4V1 4LITA 1TME3 3N4MA 5EYXA 3ZKYA 2GC3A 2PLV1 1SDDB 1ULPA 2GSYA 2ZHMA 2W52A 4G3YC 3I2DA 4NAMA 4XJ9A 4CEWC 5CFCA 4JDNA 1T6GC 4Q0QA 1W3XA 2WWSA 4Z2WA 3ZDVA 3E6CC 1RYYA 2DUOA 4A7KA 4MLOA 1K5JA 2AREA 2WNUC 2WNVC 1L7LA 4K21A 3CJXA 5T3NA 3N9MA 3BVCA 3RMXA 1VB2A 1K42A 4PQQA 1Q8QA 1CAVB 1HV1A 2C1FA 4IGPA 5D21A 2DWRA 3BN6A 1HQLA 4IE4A 4W50A 1J84A 2BNMA 2XH6A 4CU9A 3LFMA 2V72A 3JXSA 5C7GA 2BBAA 3RNSA 1ZBA3 3KGLA 1RINA 4JV4A 4XHXA 3ZSLA 1GICA 2JG8B 2GZWA 3N7MA 4XTMA 5FP8A 5I0SA 2DTWA 4FP2A 1O6UA 3NV2A 4XBQA 1H4GA 3AL5A 3LDRA 5BY5A 1C8M1 1CX4A 1UIKA 4MZUA 4BHPA 5LB6A 2IFWA 3RZZA 1JOJA 1S0IA 1OUXA 3ZXKA 1BBT1 2BP6A 3MPPG 5CVRA 1VBD1 5HPOA 4FCAA 3ZYGA 2RM21 3WDUA 5CA6A 4MOAA 2P3JA 1JH5A 1OKQA 3PJYA 3VBHA 4CP1A 1O4ZA 4YW2A 1GYKA 2R32A 3HN3A 4R9DA 5FZLA 2ORXA 3ZIXA 3OBZA 1IGOA 2A6XA 4M4PA 4UFKA 1ODNA 5I0TA 4MGIE 4YW6A 4DPNA 3PMEA 4QD2A 3B9IA 2N7GA 3KMHA 3R4SA 2OQ6A 4XQWA 3IMMA 3RVHA 1NG0A 2JDUA 4HL0A 3KVAA 5FZHA 4RHV3 2FMYA 4CCKA 1QJU1 4D6QA 4UT5A 4PF5A 4Q4Y1 2VGDA 5IK8A 1XE8A 3M7AA 1YCIA 3O1OA 5DG1A 3RG0A 2V73A 5E88A 3TB0A 2C4XA 2OS2A 4GWJA 4XDPA 2UWAA 1C8NA 4KU8A 5IAXA 2A3WA 1JI6A 5ACA1 1R081 3WQ7A 1GZ9A 1AL23 1LRHA 1R1A2 3Q8CA 5DN2A 5LA0A 1YC61 2ZMNA 1KS5A 4ZPIA 1H8TB 4CDXB 4WM8B 3GBWA 4C91A 3GZAA 4Q4W2 4IEXA 1NCRB 4N9HA 4CU6A 2R6QA 5FO7B 1NQDA 1WZXA 1C4RA 3VBHC 1AVBA 1AYN1 4DEVA 2G9GA 1VBE2 4UAPA 1VRBA 3HQUA 1H0BA 1YRZA 5B4XA 4QXHA 4LA3A 3RWNA 1H9PA 1LAJA 1PMJX 2HWD2 1LNSA 3SCFA 2P3KA 2ZGKA 2ARCA 4LO6B 1UMHA 2YB7A 3JD72 2RS11 4Y1YA 3ON7A 3ZFEC 1YFXA 1CPMA 3OGSA 3UKNA 1UY1A 1TEIA 1PGL2 4LORA 3AMPA 1NQJA 2YV8A 4IGOA 4E8DA 2VOTA 4MHUA 4Y4YA 5FZ3A 2VBDA 3DPRA 3OD0A 4O7XA 1OVSA 5DDJ2 4ZZ5A 2ILMA 1S0GA 2VNGA 5FMOS 2WNUB 3WNNA 3AXEA 4LNVA 5FWJA 1JYVA 1RHI3 4AVCA 2RHPA 3A0KA 3OGRA 3LEGA 1W9YA 2QTWB 3C7OA 2HWF1 1OFNA 1X36A 2RDRA 3C7FA 4KQ7A 5JIAA 2MEV3 4PI0A 1QQP1 4RD7A 3WDWA 4WVZA 5JZGB 2W92A 2DVGA 1YO8A 5FZ0A 1HB4A 2A5ZA 1AR62 4BH9A 1EAH3 4OULA 3BODA 4P9LA 3ZR5A 3V64A 1NCQB 4R9BA 4D94A 3B01A 3NJYA 4XUOA 3VBOA 5I8YA 2VW1A 1V9U2 1OUSA 2VVDA 5BNQA 2ET1A 1WCQA 5F6LB 2VMFA 3QD6A 1I6XA 5LZ6A 3JBG1 5FZFA 4LBOA 1VRH2 2V09A 3RRDA 4YRDA 3I8TA 1WW7A 3TN92 2A71A 1MS4A 1RUC3 1ND3C 1X7NA 2VNOA 3E1F1 1WLDA 4HT1T 4E27A 2DYCA 4K8FA 2VPVA 3IMNA 3EJKA 5CFCB 3PMSA 1U5ZA 1HB1A 3AMMA 1HX6A 1HN0A 2Z5WA 4A42A 1DYPA 5A1LA 1YQ2A 1GZWA 3NSTA 4UW3A 3I2OA 2F4LA 4H2AA 1XNKA 3JB4C 4LE3A 4GA9A 1GZCA 1RIRA 4M01A 4QB1A 3W20A 3WINE 4AEDC 2Z2SB 2LUWA 5HCAA 1O3TA 2RMU3 3AMNA 4NPRA 3H3LA 4BDVB 1ZZBA 3B7MA 4XEZA 3RMYA 5FY7A 2GNDA 3CMGA 3AL6A 2UY9A 3I3QA 5H9RA 5C33A 2XJVA 1GP4A 3VBOC 4YARA 3AKSA 1PHMA 3RZJA 1SCSA 3AYCA 3J7HA 4EYUA 2JEMA 4IE6A 2TNFA 3T3YA 1KDKA 4P02B 3UETA 1L7QA 4KI5M 4YWAA 3T4HB 1ULDA 2PHUA 3FMGA 2GNTA 3BOWA 3MFAA 1TG7A 3ZFGA 1F15A 4BQ3A 2VM9A 2BGCA 1D0HA 1S0JA 1RGSA 1W9SA 3J9SA 1WA6X 3MIHA 3WNPA 1AXZA 4F83A 5ANNA 4YSFA 4JC1A 1UIJA 1W2TA 5KHKA 1KFXL 1YFUA 2QJVA 2UURA 2UWCA 4LHKA 5G04L 4XFCA 5IWFA 4C0HA 5B4NA 4LEJA 3QLQA 3ZXAC 1G9AA 4CEYA 1IHMA 4BYYA 3AYAA 2RV9A 1LOCA 3LB9A 1OH4A 1YQ8A 5FXWA 3U75A 1YXWA 5CU1A 4NWVA 3VZMA 5F3GA 3LGRA 2YGMA 1N1SA 2BTVC 1AR73 1RUE3 3DV8A 2YU2A 1GANA 1D7PM 1FOD1 1SFYA 1BYHA 3S6PA 3E5QA 1ZBE1 1H6YA 2Y34A 5FY4A 5LWBA 2A7AA 3OY8A 1COV2 4MGZE 1D4M2 2AEZA 1K12A 5AVAA 4FPFA 4YVSA 2F4PA 4E2QA 3ZFGC 1RUI3 5JSOA 5A7WA 4XDQA 4AEMA 2ZTNA 4Q4W1 2IXKA 3KQRA 3I3BA 4QX8A 1SLTA 1W06A 1KXGA 2WS93 1NY72 3MIGA 4HPKA 5BNOA 3S5QA 4Y1UA 4BJ0A 2JICA 2HEYF 4YVWA 5L9RA 1EPWA 2DDUA 4G4FA 3NKGA 5DZEA 3GM8A 1CGPA 1W8UA 2DU0A 2W95A 4DXSA 5GLZA 1RVF3 4QX3A 1J59A 1GR3A 1YNAA 3JD71 3KSCA 2PN5A 5F39A 1HQWA 5IVCA 2IVIB 1OLME 2VMIA 5J09A 1PGL1 1UYZA 2TBVA 3HBZA 4FO9A 5T54A 3VKFC 3A23A 1O4TA 3DPRB 3LF7A 4XF0A 4XMIA 4XF4A 4FTEA 1BMV1 4NOTA 2C9KA 2E7TA 1MZ5A 2VECA 1JBCA 1ONAA 1H2KA 3GJBA 2FMDA 1N1VA 1TME2 2EXJA 3I2HA 4O65A 4DZGA 2ADDA 4XACA 3F2ZA 1S0FA 2RR12 1AZDA 4XUQA 1I3HA 1Q43A 3LZZA 1DGWA 3WOGA 1V6LA 3VHOA 4Y5TA 5B2GB 4LO7A 4NWWA 4XXPA 2R16A 3OBRA 4XBNA 1OOPB 4ZY9A 5LK7B 3Q8AA 3LFIA 2EALA 3OBTA 4BQ5A 5FZDA 3VBOB 2XDVA 3GGLA 1VMJA 2PHWA 1JTZX 3CF6E 3GZUC 3PDQA 3PUQA 4FPEA 3UK9A 4BMBA 3T2TA 4E4SA 1SHWB 5FPLA 4YVWC 1O5UA 1ZBA2 5FBJA 1O4YA 4M00A 3VZNA 2VNVA 1AYM1 2OUHA 5HCHA 4J1WA 2IFRA 2XQRA 4CXYA 3JQWA 4LHNA 4EZHA 1A3KA 3GZEA 3CIHA 4GB32 1JZ4A 4GWMA 5FRAA 2R1DA 4V2VA 2ATFA 1H2NA 3NJXA 5K4LA 4CCCA 4JAAA 1SEFA 4OQ9A 2VAUA 4W6YA 3B93A 4NO4A 1UPSA 2BERA 5JXIA 2WLPA 1VP6A 1X33A 5DAXA 2V4AA 4KGQA 2BFUS 5KHJA 2OT7A 4YLZA 3LPGA 5EZWA 1TZOA 2ZX0A 1L7RA 2FDFA 1HB2A 2W3JA 4X8PA 4ET7A 1G9DA 3HNYM 1W8HA 3M3QA 3KD4A 4IEQA 5IFTA 2JIJA 3DF0A 3ASIA 4QXCA 3W5NA 3LIHA 1H1IA 5FYHA 2WLQA 5FZ6A 2A73B 4LK7A 4LK6A 5KXCA 3NVCA 2ZZJA 4M3CF 3ZN6B 4DXRA 2V4VA 3AKRA 4HK8A 3MPBA 5LA1A 1US3A 4RHV2 2EF6A 1FNYA 4GXLA 4NPMA 1OLRA 5DAVA 2PHDA 3O1RA 3AZWA 3V0BA 2PTMA 4AQ2A 2BWAA 2FDJA 2GP5A 1D0GA 4UF0A 1YHFA 4M0HA 3WG3A 5C8CC 4A6OA 3ZFGB 2P6CA 1WMXA 5JOYA 1AL22 2IXJA 4R4XA 1H1AA 1OH3A 1NZCA 1UCXA 3SKVA 2UWBA 2O0OA 2ZBJA 4OQ8A 5F5IA 5A80A 1S0BA 1MEC2 4Z1VA 2JD9A 2JE9A 3GHNA 2YC4A 3ILNA 1VBB1 1AJKA 5BPXA 4I3PA 1JHJA 3IIIA 2A6YA 4BB3A 4CEYB 1SDWA 1FPN3 1XNDA 3WF4A 1LU1A 5A32A 2XJRA 3EMRA 2B9VA 1TNRA 5FPZA 4CSWA 4YM2A 5EIYB 2XBO3 4CDQC 1RUG1 2IXCA 1PO23 4K6BA 2VCMA 1KQRA 4IDZA 3D4KA 4XYXA 5FZ4A 1UZ0A 5K0UA 3ZYBA 1AX2A 4FAHA 2VW0A 2GN3A 4YZ5A 3ZXGA 2VUCA 4CDWC 2ERFA 1DP0A 1COV1 4XBLA 4XC9A 1S0EA 3HVDA 3PVOA 4GJZA 4BQ4A 2AC1A 4XVHA 3LWCA 5JWPA 1ZREA 2WZR3 1NX9A 5J3UA 3KHCA 2B46X 1RHI2 2KD7A 5SV5A 1JZ3A 2JDKA 3C7HA 1OC1A 4D8MA 4RFRB 4OCTA 4ZXEA 1JZ6A 1E5RA 5EWSA 4AR2A 1QWRA 2OXBA 1MZFA 2H0VA 2MEV2 3LEIA 3PVNA 1NY71 4JQTA 5LBBA 4AW7A 3BTAA 3RDIA 1IS5A 1E5HA 3E5XA 4UFHA 1S0DA 3IBMA 1VJ2A 4M0NA 1EAH2 2EIEA 4BQXA 5JI9A 4LO8A 2P4EA 3K3OA 3BU0A 4Q0PA 4NIHA 1MS8A 4WVMA 5CG8A 4Y5SA 2VTXA 3IZOA 1WLCA 4JGYA 1R1A3 1W8OA 1XE7A 4HFSA 5KHGA 2GMEA 3D0JA 4XJZA 1IOAA 4AHXA 1QJZA 4KWLA 1UD1A 1W6NB 4HVOA 4XZPA 1IZ3A 4CA9A 4AGGA 4LOTA 3KGZA 4RR3A 4AVVA 4HBNA 1DDLA 2UY8A 3MZHA 3CBNA 1PX4A 1U5IA 1CX1A 5FAXA 5JXHA 1TME1 2XVGA 1W2AX 1LULA 4MGQA 1UMIA 5E89A 2MPFA 3MW2A 3GZTB 4BOWA 3TEZA 2P2KA 4QX7A 4ZONA 4R9CA 1CD3G 2HWD3 2FZ1A 3AKQA 4P14A 4QQPA 1GQPA 4HANA 5C6CA 3FFZA 3VBFA 4D69A 1K3IA 4N90A 1S55A 3LQCA 4ITCA 2ZEWA 3M8LA 3N7KA 4AI0A 4RYDA 4AVSA 2A70A 4RQPA 1J1TA 4B4QA 1CVNA 1EUUA 2QDNA 4C0BA 1KJLA 2QNKA 4OUMA 5DDJ3 5IVJA 2ID4A 4CUGA 2ET7A 1DLCA 3MHZA 4KG8A 4BQYA 2XJPA 1E5IA 2JDPA 1S1AA 1ZZ6A 3T30A 1VR3A 4XABA 2G9FA 3ACLA 4A45A 3WHUA 5HCBA 1N1YA 2R0HA 4RR3C 1RUJ3 1ZRFA 4DIQA 1AR63 1ASJ3 4O9GA 1CQ9A 4YW1A 1UAIA 2Y6HA 5A3LA 1DQ5A 4AI2A 2J1RA 5JLVA 1HRV3 4PLNA 3VZJA 4YW5A 5FZ1A 4DUWA 4CRQA 2J1UA 3MFCA 5D8AA 1V9U3 1QH6A 3AB0A 2QUOA 1RITA 1AR91 4N7UA 3RZGA 4JRLA 3T1LA 3D82A 1ZNPA 1YJKA 1OLMA 5M0TA 3IM0A 4AVBA 3FFQA 3QH6A 5GLUA 3N9OA 4YG3A 3TN93 1DQ4A 3BCWA 2D97A 1PIV3 1CIYA 2JDMA 3DEMA 3HEIA 3NQHA 4OMDA 4RHV1 3URFA 3WQBA 2P34A 3JU9A 3ZLIA 4ATFA 4A6SA 1QDOA 4QDRA 4U36A 4N43A 1GWMA 4LBQD 4UF0B 4TYSA 1AR72 1RUE2 4K3UA 4PT6A 1WMDA 2DCTA 1NOVA 4I0AA 1OPMA 4LIUA 3ZFFA 1DZQA 2ENRA 3ZYPA 2BUKA 1SMVA 3T4VA 2Y26A 2RS31 4B7EA 3N7LA 4XF9A 1DYOA 5T50A 3OG2A 1RUI2 4DRVA 2I45A 2DVFA 2OX0A 2XVKA 3S57A 5GZDA 3ZDSA 4XILA 3LD8A 1CAXA 2AEYA 4PBPA 1QF3A 3SH5A 1UZWA 4HKOA 1B35A 4JGZB 1CPNA 3SC7X 5D8AC 2WS92 1RMU3 4KWUA 5A32B 1DQ6A 4CDUA 1WLWA 2VQUA 3WW1A 4AGRA 3V0AA 2BBVA 1ZZCA 2ADEA 5FYVA 1CZTA 5FV3A 5CFDA 5FZOB 3EHKA 2Z42A 1RVF2 3PL0A 2VMDA 3OPWA 1FNZA 2WFF1 1GV9A 4UXAA 5K0UB 1E5SA 2B7YA 2X05A 1JW6A 4CPBA 5FJHA 5I91A 3RPQA 2DCZA 1VE0A 1WUVA 3IB3A 4AQSA 5FMOL 3UGGA 2G1MA 1JYIA 3SXWA 5FZIA 5FZEA 4COUA 4Z92B 1J83A 5LA9A 3W9AA 2WDBA 1STMA 4NJ4A 3EBRA 3H1MA 3ELNA 4P9GA 5T5LA 4FPYA 5FMCA 3WCRA 5FZAA 4PQ9A 2XWBB 4LMFA 5FYZA 2R063 2WNOA 4WZCA 2ZX1A 5JMCA 3KF5A 4FPJA 3ECQA 3M70A 2MEV1 3MI8A 4ES9A 3PUSA 2GH8A 3B00A 5FOJB 1FATA 1PNFA 1UWWA 2EICA 2WJSA 2VZUA 4L9BA 2YG0A 3FLTA 1B35C 1UYXA 2VE1A 4QKBA 2D7FA 3DL3A 1CAWA 3MUY1 4MV2A 4UFIA 4WVMB 4CP0A 4JGYB 3K51A 1QXRA 4CDUC 2I07B 4ZS3A 3WQ0A 2XJTA 3NV4A 4CVUA 5AFBA 1TMF1 5TSWA 1D4M3 4NPLA 3R4UA 1W6OA 4HSLA 4IQPA 5EJ1B 5CFDC 5CKQA 1N3OA 2TUNA 2VZVA 3CJIA 1QJX3 4RR3B 4R52A 4DEQA 2WNVA 1SG3A 2LS6A 2AENA 2W1QA 4LKDA 2JB4A 3NNJA 3VD5A 4I0BA 3J26N 4EE2A 2Y38A 1RUC1 2W94A 3WDYA 3EXUA 1N3PA 1N47A 1BEV3 2VOWA 2WUHA 5L9BA 3UV9A 1WBFA 4UFMA 5A33A 3U37A 5JAXA 1EP0A 4EWDA 3T0DA 2DVDA 5JPMB 4XETA 3ZVXA 3VBFB 3FBYA 5CB7A 4FOYA 4OHZA 4INDA 3CU7A 1QJEA 1F5JA 2E26A 3AZYA 4LHLA 4P9XA 5FZ9A 5JVVA 3ZYFA 1R64A 4HMZA 4RQPB 4Z2AA 4LT5A 4YZ4A 1QY4A 2RMU1 5GLWA 3KWVA 1Y9GA 2JKXA 2D93A 2AACA 2P3YA 3MUZ1 1VBC1 1REDA 1IQAA 3H9AA 4UW5A 2OIIA 4FFFA 5FP9A 5H9SA 2RR13 3VD9A 2W1SA 4CPBD 3GCXA 4QX2A 5FWEA 4ZU7A 3CJIC 5FZBA 1DU3D 1ZX5A 4QDSA 5J36A 5DUVA 4F8AA 1IKPA 2H0BA 4P00B 2PHLA 3VHPA 1QKQA 1NZIA 2CSGA 2WYFA 4CTEA 3Q8FA 5LRRA 5D8AB 4B8EA 4Y33A 5L7OA 2ZMLA 2BZDA 1H2MA 1LJ7A 2E51A 2GNBA 2WWUA 5K9YA 5C71A 1HJFA 2QQOA 3HT1A 1YLLA 1ZYBA 4IUGA 3FBMA 3PU3A 5FYBA 2ZGNA 2WZPP 1FPN2 5JOZA 3AJZA 4GB33 3HOBA 2ZMKA 1GBGA 2GAUA 3AM2A 1POQA 1O3SA 1AJOA 4COYA 2D5FA 1RJ8A 1HJGA 4N43B 4O61A 2UYBA 3FN9A 4UWDA 3FHQA 2XBO2 2ZCWA 4FI9A 4A7ZA 1PO22 1A34A 3MLJA 1AR71 5BV6A 2C9AA 2MNGA 3ZFFB 4MO3M 3O1UA 1Q56A 1I9RA 4UOJA 1PVC3 2WA4A 1Q8PA 4QPYA 5JDBA 1VMHA 2JD4A 3POIA 1HIXA 3IWZA 2YBPA 4Z07A 2DFCA 2E31A 2GP3A 4BISA 2NN8A 5FYUA 2OZJA 2HEVF 3BB6A 5CKMA 2WZR2 4N53A 2WL1A 4FFGA 4AI9A 5AC93 2QFEA 4FP3A 2WN3A 1GKBA 3ZFEA 5G05L 4AI1A 1LOEA 4IV1A 5L7OC 3O7OA 4CDUB 2WS91 2CWMA 5I8SA 5K7PA 3MBWA 2X09A 4NRMA 1UX6A 2RJLA 1QNWA 3V0AB 2Y6KA 2Q8EA 2XVLA 3M3OA 1RUOA 2WA3A 4AI3A 2PHXA 3UKTA 2KXLA 4BCUA 2CTVA 4IV3A 2I2SA 4LBMA 4MHRA 4COWA 4UBGA 3WLUA 4QB6A 4XFIA 2ZX2A 4QMAA 5IVEA 1RTVA 1UNBA 3C7GA 2ZOEB 5I0DA 1OQ1A 3LDKA 1YI7A 1F4AA 1UU5A 1MEC3 2WRAA 1U0AA 1D2QA 3IDCB 4LOSA 5C70A 1DFQA 2K9ZA 2YPDA 2HEWF 2WN2A 3NAPC 1UN1A 4LTAA 5F3EA 5FREA 5FY1A 1UZYA 5GZEA 3NNFA 5E16A 1PZ7A 1DBNA 2LW8A 4BU2A 2CAVA 4JKKA 3DXUA 3POYA 4URAA 1E57A 2V5DA 2DBIA 2AR6A 5JI7A 3HAGA 1XNBA 5JXGA 2X5IC 3H3ZA 3GJAA 4N53C 1U5YA 3VHRA 4B7KA 3OEBA 4V2WA 1SPPA 1VLNA 3ES1A 4EZ4A 4DINB 3B69A 4W8JA 3T08A 1CAWB 1SQ4A 3AP6A 4IV1C 1ND3A 2WT1A 4AI8A 4CEWB 1XE0A 5DG2A 1OI6A 1W6OB 5DAQA 4Q1RA 5IK4A 2XB6C 1QOTA 4OMCA 3SLIA 1CZSA 1U12A 1WD4A 2QVSB 1W8TA 4IV3C 2WNVB 2VTXJ 5FMDA 1EV12 4KBZA 3USUA 2QBXA 1PZ8A 3ZPOA 4ES8A 5A3TA 5HBAA 2BW8A 4H3WA 1GFF2 1ZVFA 2K46A 4AEDA 2HWC3 1ENRA 1V6JA 1JMUB 3HQRA 2BFUL 4AVTA 4S2DA 4GULA 2CGPA 4CCEA 1RUJ2 1OMIA 5T5JA 1ASJ2 4NROA 2RJ2A 3P5BA 1MVEA 1ND2A 4Y1ZA 3CEWA 1HRV2 5KR7A 4MGTA 1APNA 2D6PA 3KHBA 1SBDA 4NAOA 1RUH2 3N3HA 3KT4A 3WHTA 4XQDA 1REEA 2XKPA 1JYCA 4KBBA 3AXDA 4MXWA 1FMD2 3QACA 4DXTA 1FX5A 4BQ1A 4ORFA 4Q29A 3KV5A 4HVQA 3P1IA 5J48A 3L9JT 5IHRA 4I3GA 2P5BA 4UYBA 2XUEA 5BUVA 1PIV2 4A41A 2VBBA 4CXXA 4F7ZA 5FXZA 3MGUA 3MV11 4C8DA 4XZUG 1C5HA 3GBGA 3AFGA 4PDWC 2EIGA 3O1SA 4OHWA 1RUD3 5CBLA 1QOSA 2OVUA 1K5MC 1IQDC 2B45X 2ZKNA 4AHZA 2WAAA 5FDBA 4B4PA 3VUOA 1N1TA 3HNMA 4XTPA 5C9AA 2CAUA 1Z78A 3I54A 4HG6B 4PIZA 3VBRA 3DYPA 2A3YA 5L7OB 1ZA7A 1QMJA 1R093 3ABZA 5FYCA 4NIAA 4YM0A 4JRAA 5BNNC 3LAGA 3SH4A 3MO4A 2OUJA 2WAOA 5GLVA 1ND2C 3B3QE 4Z8BA 2CYFA 3UNPA 1LOAA 3OTFA 4P9WA 5IVVA 3VKMA 3ZO0B 5EFUA 4Q4X3 3SITA 1EUTA 2VW2A 1FPN1 1XYNA 2VZOA 1RMU2 1VAMA 3VDCA 1O8PA 4QKFA 2BWCA 3HBKA 2VVFA 1GMMA 2W9XA 3VD4A 1UOFA 3WEZA 3MDPA 4LXLA 4BE3A 4COZA 4WV8A 3U1XA 2PAKA 3JUUA 1G9CA 1HDKA 3BUCA 1DHKB 4PCRA 3MIDA 2Z4FA 3VBHB 4BLJA 4EV0A 1LOFC 1X9TA 4NHMA 4E8CA 5HXMA 4SBVA 2LRPA 4URTA 4DRRA 5A1FA 2PLV3 2JX9A 2ZACA 1I5PA 5H9PA 3AJYA 3AZVA 4QXKA 5DPNA 3VBSA 5C9AC 3H42B 1BHGA 3ZFEB 1ZRCA 3VBRC 4IV1B 2R062 1Z7S3 3AZZA 4CCOA 2WSVA 3O1MA 4M3CA 4FBFA 1KEXA 3CNAA 3C2UA 2OPKA 3GNEA 5F8PA 2AH2A 3HN1A 2ZGPA 3MIBA 4YYOA 2BNNA 2FCVA 3B94A 2ZJCA 4IV3B 1YQ6A 1ZZ8A 4KL1A 5LW9A 4AK3A 4YPJA 4GKYA 4W6XA 3KCYA 4OI1A 1CESA 1R1A1 1QNYA 3U78A 2WR9A 1YIPA 3VZLA 3LKJA 4YW3A 2QQNA 4L2NA 5A7SA 4AFCA 1YI9A 2D6MA 2XHKA 3ITQA 3ZM8A 4CE8A 4C90A 2NYYA 1QJX2 1XJAA 1C8M3 3CZJA 2HBUA 2XLFA 2CNAA 2VCAA 1W9FA 2DU1A 3TEWA 2H6CA 1MS3A 1BBT3 1FI2A 2D3PA 3UESA 4QGLA 3VDDA 3ZR6A 5LCWL 1VBE1 1BEV2 5FZMA 1UF2C 1FXZA 3BGAA 2ETEA 3B9CA 3K4ZA 1W05A 4OHXA 1EY2A 2O1QA 2B8MA 3OGVA 1DGRN 5A3UA 2HWD1 5JR7B 1CJPA 3AK0A 3IDAA 3VBSC 4Y3OA 5C5UA 1W8ZA 3H8RA 2D3RA 5FP4A 1UMZA 3ZSEA 2JDHA 1VIWB 4OZOA 1ND3B 3CQOA 3RJ2X 2FDIA 4AQ6A 4QPIA 5FPAA 2QKDA 1LGCA 4QGMA 2R0FA 4AXOA 1SACA 2ARAA 5IVYA 2NP0A 3J7MA 4Q4Y3 5LEJA 3DN7A 5FPVA 2VQTA 4TLFA 5DDJ1 4XAAA 2AUYA 3JB8A 4I0WB 3POJA 4AHWA 1H1MA 4BM8A 2BEOA 5JUVA 3DKWA 4CUCA 1PO12 1CR7A 3T1MA 1R083 2LROA 2PHTA 5A3PA 1OD5A 4AEDB 1DCSA 3SNMA 1NLSA 2WIIB 2VJXA 3K77A 2FBEA 5LATA 3WF2A 1HRI3 1RUJ1 5H9QA 1AR61 1ASJ1 2HYXA 2GC1A 2IVJA 4Y20A 5FJKA 4ARXA 5KBFA 1IKQA 3VDDC 5BNPA 4ZU5A 2PQQA 3PJQA 4KWJA 2EA7A 5LASA 4RA0A 4MUVA 1V9U1 1QOOA 2WC2A 4MXWB 1G7YA 1SBFA 5FY8A 3FL7A 1F31A 3H8XA 4J6GA 5C8CA 2D40A 4UFLA 1BK1A 4KU7A 4XUNA 5FLIA 5F5QA 2VMGA 5AFEA 5JR2A 4KWKA 1RL3A 1VRH1 4K7JA 2RS52 4NHKA 5FUPA 3TN91 2VMHA 2J1VA 4QPIC 1PIV1 5DZGA 1V70A 3NRUA 1YFYA 4AAPA 2QQUA 2VULA 2XL7A 1UY0A 4JTOA 4H55A 3WQ1A 1XB9A 3AX4A 1XRUA 1C28A 2B42B 4OHYA 1GZWB 2F17A 3ENRA 3MLKA 4EWAA 4BQ2A 5F2WA 2VC9A 2ZHNA 5C9AB 1PVC2 1XYOA 1MS1A 3FE5A 4NRQA 3DGTA 3FX3A 3LA2A 3RYKA 5F5CA 4LO5B 2XR4A 2ZAHA 3OBAA 4XURA 3BI3A 3CLPA 4I30A 2EXHA 2JE7A 4EROA 4UI9L 4CDQA 3LIGA 3MV01 2R49A 2VQ0A 3I2FA 3OD4A 2E32A 5AC92 5BNPC 5FPXA 1VAKA 4QHOA 2QQIA 1UOBA 2ZGOA 3H8UA 1XSRA 4QGNA 4SLIA 4DOUA 2GC0A 3TYJA 4PJYA 3VGIA 1SLCA 1IPSA 1P8JA 1QJFA 3E6DA 3NJVA 4ISQA 4XF3A 2W08A 4CDWA 2D6LX 3AVSA 1OPOA 2SBAA 5EQUA 1LODA 5J37A 2DF7A 4IEYA 1G86A 3I3EA 1VAVA 1LHOA 1H2LA 1PK6C 1QDCA 3G7DA 3MIFA 4HXCA 4LR4A 1WMEA 3JBG3 5FP7A 2W68A 2DV9A 3USSA 1LEDA 1V6IA 4NIIA 3C7EA 5FY0A 4COVA 2C24A 4TN7A 2YYOA 3KF3A 2X8KA 1OKOA 5FY9A 1MS9A 4CUBA 2QQVA 4FPKA 1I1EA 1V6KA 3HQXA 1BCXA 2YY1A 1HXS3 1OQEA 4IEOA 3K48A 4V1PA 4RSUA 4IEVA 1RXGA 2Y6JA 5DAPA 1JYTA 1YQCA 2WQ4A 4KH9A 2GMMA 4IE5A 1DQ1A 4LKEA 2R061 2NLRA 1I5ZA 1SCRA 2BGPA 3KV6A 1OXCA 1JYWA 4LBLA 4FOVA 4DB5A 1WCUA 4QT6A 3BTXA 3I7DA 1W03A 1GNYA 1UW8A 2DVBA 4BIOA 1Q8VA 1JOBA 4N9IA 5T5OA 3SEPA 5L9VA 4YGDA 1JYNA 3OY8B 1V00A 1X50A 2PHFA 4JX0A 1W8WA 5IT6A 1D4M1 3LPFA 1O59A 1OA4A 2XMLA 2XG3A 2K0GA 3PNAA 2ZAAA 4ASKA 1PZ9A 2X29A 3P3PA 5A7WB 5FZGA 1WBLA 5JCTA 1YWKA 4B1LA 3POEA 1O3RA 1O8SA 4Q26A 2R072 1UXZA 5K8SA 2XQXA 3VD7A 4N8MA 4HPKB 1NAEA 3NNGA 4PHZA 2HWC2 3ILFA 3NNMA 1BEV1 4R4ZA 4AG4A 1OVPA 1L3JA 4TSVA 2JKBA 4YVWB 3C3VA 3VN4A 4HZFA 3SISA 5APAA 3TEXA 4P08A 2YDEA 1DGWX 3AVRA 3U4XA 4GMP3 1VBA3 2YROA 4OI0A 1LKNA 1PGSA 4L8QA 3ST7A 2X10A 1JXNA 4J25A 3MF9A 3B02A 4CP2A 2DFBA 2JG9A 3M3IA 5GKAC 2Z79A 4JDOA 5CZKA 3I3DA 2QQKA 1OA3A 1W6PA 4OI4A 3TNPB 2FZ2A 3ME2A 3HMYA 5IUQA 4LBNA 4AFDA 4QAWA 5J98B 3SH3A 1ST8A 2YUEA 3HR9A 5FUNA 1OT5A 2RR11 4LUKA 3AMHA 1FOD3 4WBBA 3ZYRA 2W0XA 4WM7C 2VUJA 2J7MA 1SBEA 2YXSA 4D3WA 1N3QA 1LCLA 1FYUA 1RUD2 2KR2A 3TRSB 3ZXEA 4XFAA 1W0NA 2C5DA 5F9TA 3D6EA 2OPWA 1MZEA 3FC0A 2WT2A 2NPIA 4Q8KA 3SKJE 4A3XA 3WT3A 4AFMA 2HJIA 2QQMA 4LJHA 3MF6A 1R092 3KZ4C 5LBFA 3WXPA 4X8NA 1LHWA 4ZXKA 5FPUA 1ULOA 3QOPA 3WP4A 5SV8A 4D7YA 3BPSA 1ZBA1 2RDNA 5C8CB 2G4IA 2IWGB 2XXZA 2VQAA 3BALA 4R9AA 4Y5Z0 5DABA 3Q8BA 5LBCA 3SQOA 1EV13 4Q0UA 4Q4X2 1RJ7A 4NMIA 4GB31 1Y4WA 2ZGLA 3I2KA 2QDRA 2W1WA 3ORJA 1CWPA 2PELA 4N7IA 4YW4A 3H8OA 1W04A 3SCHA 1WKYA 3ZN5A 1A78A 2JG9C 3VLBB 4LUMA 3S7EA 4W65A 3WV6A 4RN5A 1C57A 3KVBA 2YU1A 3OUJA 4PF1A 1Q8OA 4QPWA 4FSJA 5LA2A 2OQ7A 2EVXA 5KC5A 3C8XA 3EB7A 4HSJA 1GOFA 2RJKA 4IE0A 3TBDA 1F8VA 1G9BA 1RUH3 3WG4A 1ZZ7A 2OZ6A 2IXHA 3VKLA 1PVC1 4Q4V2 4RFT0 3K4DA 4JKLA 3AP4A 3BIEA 2D44A 3ZMOA 1GUIA 1FMD3 1PNGA 2WO7A 2PLV2 3RZKA 3J8F3 1F35A 1UY3A 3AYEA 5EHDA 4CDQB 3JZVA 4J1XA 1JZ8A 4AAXA 5AC91 1OQDA 3O0WA 3ZYJB 1UY2A 1KJRA 1Q8SA 4UW4A 1WCKA 2IUWA 4ZKTB 3LDBA 1SFNA 4M4RA 1Z7S2 4Q0VA 4PLOA 3V0BB 2GDFA 4MGSA 5AVPA 3T0BA 4CDWB 4BXSV 1H6XA 2YC0A 3HD8B 2BYVE 1HW5A 3UJOA 4AL9A 2ZGSA 1AX0A 2JB8A 1GP6A 1J3QA 5FYIA 3UKVA 1S2BA 1AL21 5DMYA 4BK5A 1OLQA 1PMIA 3SCGA 3CDZB 1NA1A 1MEC1 1WCDJ 4Q1PA 1C8M2 1SLLA 4LLFA 1X82A 3R4DB 2J42A 5C5TA 1NXMA 1AF9A 1BBT2 1VBD2 3A4UA 1JUHA 2QZ2A 2CGOA 5GJ6A 3UGFA 5KC6A 5F2SA 2UU8A 4FQZA 3MW3A 4MSVA 2Q1MA 1KD7A 4ONUA 4F3JA 4Y1XA 2DTYA 3CZUA 4K1YA 4E2SA 3LSEA 5LY1A 4FPOB 2QQPA 1JOPA 2JDAA 4IEPA 1UPIA 4DQAA 4YGCA 2VZ3A 3MYXA 1Q3EA 4X6QB 2BJSA 2VMEA 5FR3A 5IATA 5LY2A 1HLCA 2ZEZA 3JCIA 3PVEA 5C3RA 2XJQA 1DZRA 2DCYA 3N7JA 3I49A 3K46A 4Q4Y2 2DUPA 1GOGA 2W5FA 3OGGA 3O5SA 4XIOA 3O12A 5A70A 1XNCA 2NM1A 5FPBA 1RHI1 2JJ6A 3U11A 3PU8A 1JN2P 2JG8C 4TWTA 1R082 3VKOA 3POBA 3TOJA 1H8VA 2HWC1 1NA1C 1UU6A 1KITA 4D6RA 3K2OA 4BQWA 1HRI2 1VB4A 1UYYA 3LCPA 2W39A 2ZEXA 4GKXA 3KV9A 1EAH1 4TZDA 4XCAA 3P3NA 4IEUA 3ZKUA 1H8TA 4AGVA 2BPA2 2YC2A 3FHIB 5CEHA 2HLEA 4KMQA 2JIGA 4RL7A 5EJZB 3N35A 3IT8A 2O8QA 1AYN2 1DQ2A 4ZS2A 3WDTA 2VTFA 1PMHX 4LA2A 4YZ3A 4ZU4A 2JG9B 3ZXFA 5CISA 4CCLA 4XXAA 4KGGA 5FTTC 5A6ZA 4YG0A 2FD8A 3OGJA 3NV1A 3W21A 3K75B 3ROUA 1UZVA 1C3HA 2QCSB 2RS12 5FYSA 4JKMA 3N9LA 4BK4A 1HKDA 3RYRA 2VUDA 4IL7A 1WGPA 3IKWA 2BVBA 1OHFA 3TWIA 4FFHA 3IDEA 3GXUA 1W0OA 1M4WA 1ODMA 3R05A 1WWYA 1DF0A 1JUIA 1Q5OA 2ZGRA 4META 4HVRA 5L73A 3TAYA 1R091 3H0OA 4G9SB 2CDOA 2EIBA 3N36A 3WG2A 4BIFA 1B09A 3DYOA 3RYPA 1H8TC 5C3PA 2HWB3 4WM8C 4M3CE 4CDXC 4EJRA 3IIAA 3M1HA 2KA3A 3CHXA 3ZPYA 2JWPA 4Q4X1 4CP9A 1PO13 3F95A 1NCRC 3L2HA 4LIVA 4IETA 4EN7B 1UQXA 1GWLA 3WW2A 2YBSA 4CCDA 2VMCA 3ETQA 1NT0A 5DUWA 3VZKA 4AEKA 1QIQA 5FXVA 1XBFA 4JDMA 4NRPA 3ZMNA 1GNHA 3GALA 1JODA 2DVAA 4IEZA 5DAWA 5LK5A 3WNKA 3WZ1A 4ARYA 4B3NA 2XJUA 1UX7A 3JBG2 5BNOB 2WO2A 5A3WA 5A3NA 2GMPA 3MEPA 1OBNA 5E8AA 4LPLA 3WUDA 4QPGA 5DXDA 2JDZA 2QE3A 1LB2A 1CIWA 1W39A 4TLGA 3V56A 1BKZA 4QKDA 1DYKA 1HXS2 4QHBA 5E6HA 3RWKX 4EQVA 3IPVA 2E7QA 4LHSA 4A4AA 2XGXA 2RS53 4AEJA 2FCTA 2P6HA 5JPNB 3I59A 2HBTA 2XKOA 3UGHA 1Z7S1 1GWKA 1V6MA 3FUOA 5FOBB 4FPHA 2K2SA 2C26A 2Q1ZB 1RUE1 2YFUA 3NAPA 4QQ2A 5I93A 3A21A 3WP3A 5JZGC 3BKZA 1VPHA 4GIQA 4YNIA 4IEWA 4QQHA 1RUF3 3LA7A 2VNRA 4Q8LA 1LR5A 3N9NA 3WP5A 1NCQC 3GBFA 3KT7A 1IS6A 3ES4A 3D0SA 5DZFA 1NA1B 2X5IA 4RGKA 4GZ9A 3ZOIA 1RUI1 4ZHNA 2YGLA 2VR4A 1CAXB 4XPVA 1B35B 2XWJB 3GCWA 2QQWA 4AFAA 1C1LA 5EJ3A 2ZA9A 3ACGA
chains in the Genus database with same CATH topology
5DUUA 4XFBA 5KWRA 3BOPA 4QPGC 3M3EA 1ZRDA 4EN6B 5T52A 3PTYA 5JSPA 1U5XA 5CFDB 5GZGA 1W2UA 2CL2A 4BMEA 2FHRA 5CFCC 1SLIA 1W6QA 5C8WA 3M2MA 1AR93 1RVF1 1ULEA 4MGYE 1GLHA 4XMAA 1VBA2 2CWSA 4DFSA 3NO8A 3KM5A 2DCJA 1D2SA 3M3CA 5KHHA 2B9UA 1QJY3 5J7MA 4L99A 2P3IA 4DMIA 3GHMA 4YGBA 5I8TA 4E4DX 2R043 4DXZA 1DGLA 4Q0SA 2GH2A 1ENXA 3H1WA 1NE4A 1FOD2 1WW5A 4AF9A 1ZBE2 2ZX3A 4LO4B 4E2GA 1CN1A 2E7AA 5EV7A 1BXHA 2RS33 4B4RA 1HRI1 3H7YA 3FJSA 1S0CA 4EN9B 2PHRA 3NW4A 4YVSC 2EXKA 1WLTA 2Q4SA 3A0NA 4Y26A 1UL9A 2XLGA 1TE1B 5I0UA 1MR5A 2WSUA 4JCKA 2PFWA 4K20A 4PDWA 3CJIB 4PLMA 4JTNA 3WR0A 1K5MA 4QX5A 3ZYIB 1SLAA 2R073 2C0ZA 4GWNA 3WW4A 1VALA 3O0VA 4GH4A 2WFF3 1URXA 3LOIA 3O14A 5BNNA 2SLIA 3OF1A 4WVVA 5A33B 4KG0A 4OFGA 4ASMB 3WDVA 3RQ0A 3ZXLA 1BMV2 2NMNA 3WP6A 4OHVA 1POV3 4K40A 2YZ4A 1UKRA 3RSJA 2HWE3 4FTBA 3S30A 4B29A 4DNYA 4AYUA 5JSRA 1ULGA 3J8F2 1LEMA 4LBKA 1F5FA 2LM3A 1F9KA 4YG6A 1KS4A 1O5LA 1CJDA 2XLAA 3ILRA 4HN0A 5BYNA 2NZ9A 1LOFA 1ZRRA 3W58A 1OOPA 1Y7BA 3VL9A 4UBHA 2OA2A 3WVJA 3WUCA 3Q9OA 4PBOA 3PVBB 4S2GA 1TMF3 4H7MA 3VL8A 5KXEA 2EXIA 1AR83 2R30A 5F1RA 4OUSA 1UZZA 1AYM2 1IS3A 3PHMA 4GH4C 3NV3A 1O3QA 2PAEA 2NMOA 4QPGB 1LGNA 5IK5A 3UJQA 3AKTA 1YIFA 3VKNA 2XUMA 5KHIA 3AMQA 3R0RA 3DPRC 1HXS1 1WW4A 1YJLA 2YMZA 3IPVB 4PIXA 3ZX7A 4K1ZA 3I59B 2D3SA 4XJ8A 3U0ZA 4XIKA 3KLSA 4GQ7A 3WCSA 3NJZA 3BU7A 4MXVA 4U2AA 2R1BA 2XBO1 1PO21 3NAPB 2WT0A 1O91A 1UU4A 1J3PA 3THTA 1NXD1 2EAKA 2WNEA 1OOPC 1VBC3 4LE4A 4Q4V3 2O8OA 3ZN6A 2ES3A 1XQNA 2VOKA 4DS0A 4XFGA 2X5IB 4S2FA 3CL1A 4IESA 4N53B 3PLQA 2WZR1 4FXGB 3OCPA 1C5IA 2MHFA 3LA3A 4YVSB 5HI0A 1KRIA 2VY0A 3POWA 1IPJA 3H7JA 1W6QB 3WY6A 2LALA 1VBB2 3AP9A 4GMP1 1VBA1 2OW4A 1XU1A 2DUQA 4GMP0 1BJQA 4XJWA 2Q8OA 5F6KA 2X53S 3WNXA 1LENA 2BVVA 2AYHA 3WG1A 3KT1A 1LESA 1RUG2 1VBD3 4XF1A 1DLLA 4R8HA 1XU2A 2RM23 3R6SA 1DIWA 3QBQA 5ABJA 3RI9A 1ZZ9A 3BPZA 1LECA 4PIYA 4MYEA 2RE9A 5LEKA 1NYWA 3ATGA 3E6BA 4NR1A 2ZKLA 1Y3TA 1QJU3 2WINB 5JOWA 1J3RA 1MZ6A 4FPCA 4PDWB 4NVPA 1MS5A 3B5LB 2HWB2 2E63A 2P37A 1K5MB 5HCFA 4MH0E 1J58A 1EV11 3USUB 2DCKA 5ACA3 1A8MA 4X6RB 2ZGTA 3D5OA 2IXLA 4CEYC 1YYNA 4GH4B 3IDBB 2ZABA 2ZGUA 4FXKB 5JOXA 4QM9A 2XL9A 5BNNB 1YUDA 5D1IA 1ZA4A 1ND2B 2GALA 4HN1A 4ASLA 1W6NA 4P9JA 1HRV1 1LGBA 4HK9A 1RUH1 4FOQA 1V6NA 1W6MA 3FUQA 1AYN3 1FMD1 2I74A 5ABJC 3J8F1 1QGLA 5JIUA 4LULA 4EN8B 5A3MA 1FV2A 1PK6A 3FWEA 4OLLA 3EQEA 4NN0A 5BXXA 4RS5A 2VOXA 3MW4A 2RS13 4Z82A 1RC6A 1LHUA 1PVXA 1LHNA 1XYPA 3J4UH 4I02A 5BNOC 4W6WA 2E53A 3E97A 4QQLA 4K9SA 4FPLA 3HWJA 1RUF2 2D98A 4OVEA 3AKPA 3VBRB 2D6OX 3IN9A 4XFHA 2IZWA 2B39A 4MGKE 2GU9A 2HWF3 1NE6A 1WD3A 4XOGA 1Y9QA 3HT2A 5J96B 3LSDA 5FCCA 1QQP3 3NWKA 1QXPA 3SHRA 2ZGQA 3SMHA 1YFWA 1RMU1 3ZSKA 4I2OA 1CAUA 1XXNA 4S2HA 2ARXA 3FZ3A 3U07A 3WW3A 1AR92 4Q2FA 2VUAA 4YZ2A 2PYTA 3AFKA 4FAGA 4RS5C 4AVAA 5EYYA 4P9IA 2A6ZA 1QJY2 3FLPA 2OYZA 4RGAA 2IXIA 4I09A 5I0RA 1DGRA 3LOBA 3OPZA 3W59A 4DY5A 2R042 1MVQA 4XHBA 3VBSB 4Y24A 3ZN4A 5EXOA 2PAMA 5E1RA 5LRSA 3ZSJA 1DZTA 4H14A 4EWEA 5L19A 1AX1A 4M3CB 3VBUA 3MIEA 2RS32 2HKXA 2XJSA 1DQ0A 2WKKA 1PGW2 5GLTA 2A75A 4P5HA 1WW6A 1SLBA 4YFWA 2Q5TA 2DURA 3APBA 4FTSA 4A7YA 2WQZC 1WMFA 3ZIWA 1JHNA 2VU9A 3X29B 4WM7A 1CONA 4JGZA 4XQ4A 1G8WA 5KXBA 3KCXA 1QJX1 3BIWE 2ZX4A 4Y1VA 1H4HA 5FBZA 3AP7A 3VDDB 4BZ4A 2E9QA 5L36A 1RB8G 4XFFA 2Y0IA 2ZPXA 4ISRA 2WFF2 1QU0A 2VH9A 4BWOA 4HKWA 3U10A 4YM3A 2Z69A 1AL0G 3KCCA 5FLJA 5ABJB 1WCSA 4WVWA 2A3XA 4AQTA 2ZHKA 1ENQA 5C4WA 2Q30A 4QPIB 1H30A 1R1ZA 2HWE2 1BVP1 3O0XA 1MQTA 3VBUC 4HETA 3ZXDA 1AXKA 3OYWA 2HWB1 1LOBA 4XE9A 1PO11 3VV1A 1KFUL 4JGZC 2VXRA 1ALYA 1ZBE3 1S2KA 3ALQA 1FT9A 3ZXJA 2P17A 2D5HA 2VG9A 1FV3A 1TMF2 4D7TA 1AUYA 4Y20B 1J1LA 4IXLA 1BZWA 1AR82 1GSLA 2BQPA 4LBQA 4YM1A 5BNPB 3GYDA 1X8EA 3INAA 1BQPA 1W0PA 4Q4W3 3H3UA 5GALA 1W6MB 2B5HA 4YGEA 5FQ0A 5K0UC 1RUC2 2KM2A 1VBE3 3OJBA 3AZXA 5FO8B 2V5YA 2Q0AA 3VHNA 3RJRA 1QH7A 1PK6B 3THPA 5C4WC 2RS51 2A6VA 2GNMA 1OA2A 5IK7A 4IERA 1MQTC 4RS5B 3MLLA 5FO9B 2BNOA 3JD73 2ARBA 1Y43B 4Q27A 3S7IA 4E4ZA 4Y22A 4BA6A 2ZGMA 2XPJA 2ZS6B 2EAAA 4MX3A 3EO6A 2AGSA 4H7LA 2RMU2 3GF6A 4FT8A 2H6BA 5CIRA 1V6OA 1AXYA 3UL2A 1RUF1 1VBC2 1PM7A 4JGYC 4LBJA 4BPZA 3L2YA 4XJAA 4CZSA 1EYBA 2YHJA 2D6NA 1G6NA 5CG9A 2CY6A 3QCWA 1C1FA 2ZHLA 1REFA 2IC1A 1ZM1A 1LTEA 1CAUB 1CAVA 1FAYA 1LOGA 4O9EA 4NHLA 5HXVA 1GQGA 4A2UA 4C1XA 1AHSA 3TNQA 4OZXA 1AYM3 1G9FA 2JG8A 1M06G 1VRH3 2TEPA 2PA7A 1QJY1 3VBFC 3E5UA 2GC2A 4FOWA 4RQPC 1H9WA 2D43A 5T55A 4LLOA 2R041 4JQRA 4AWDA 1IPKA 1LU2A 3KS7A 2RM22 4AFBA 3WDXA 4CYDA 3VBUB 4XW3A 3G6JB 1BVVA 3POSA 1TNFA 3HIFA 2E6VA 1PGW1 1GQHA 1ULFA 4KNCA 3S0MA 4I01A 2CGNA 1OSGA 2UYAA 1TQ5A 1WA4A 4ATEA 5FFOC 2YPJA 3WD5A 1MS0A 4WM7B 2QZ3A 1OFSA 1QJU2 4FVVA 3QH7A 4L92A 3M4FA 4QM8A 1A6CA 3VZOA 1HV0A 4OI2A 1HQNA 2VVEA 4UW6A 3D8CA 1IS4A 1NLRA 5ACA2 4P9YA 2R071 3MICA 4D7SA 3RI8A 1RUNA 2HYKA 3AP5A 2JENA 2ZZQA 1X8MA 2Y0OA 4E9KA 1F2NA 2WFPA 5CNAA 1QHDA 3JQXA 4N43C 4CDXA 4WM8A 4L97A 1VBB3 3WX5A 1POV1 3ZSMA 5C4WB 1NCRA 1POV0 1MQTB 4GALA 2HWE1 1ULCA 2D6KA 3I4IA 3ZFFC 4MVTA 4HLTA 4QU2A 1W6PB 2VOVA 1ENSA 3OYWB 3NKTA 3RS6A 1RUG3 5FLHA 2AZ5A 1O7FA 1Z0HA 4EN0A 4HKLA 2F6BA 5DUXA 2GN7A 1A8DA 3KB5A 1DG6A 4L11A 4DY3A 3FLRA 2A6WA 4CEWA 1COV3 1KDMA 1RUD1 2LTNA 4AE2A 2NQYA 4LBQB 4RGGA 1AR81 5GZFA 5KXDA 1LHVA 3AYDA 3H1YA 2JXAA 2WNUA 2CV6A 5FQ0B 5CAZA 2HWF2 1EPZA 4AHYA 1QQP2 4FQ4A 1UKGA 3H50A 4XJUA 1D4VB 5JZGA 5GM0A 4QQOA 1QXJA 4YFZA 4C1WA 1NCQA 3CO2A 1MACA 2FQPA 5GZCA 4Y22B 5T5PA 3DUIA 4YZ1A 1GNZA 4FPGA 3V65A 3NL1A 4WZFA 4JVAA 2JECA 4Q4V1 3N4MA 1TME3 5EYXA 2GC3A 2PLV1 2ZHMA 2GSYA 4CEWC 2W52A 4G3YC 3I2DA 4XJ9A 5CFCA 4JDNA 1T6GC 4Q0QA 2WWSA 4Z2WA 3E6CC 2DUOA 4A7KA 4MLOA 2AREA 2WNUC 2WNVC 4K21A 3CJXA 5T3NA 3RMXA 1VB2A 1Q8QA 1CAVB 1HV1A 2C1FA 2DWRA 1HQLA 2XH6A 2BNMA 3RNSA 1ZBA3 3KGLA 1RINA 4JV4A 4XHXA 3ZSLA 1GICA 2JG8B 2GZWA 3N7MA 4XTMA 5I0SA 2DTWA 4FP2A 3NV2A 4XBQA 1H4GA 5BY5A 1C8M1 1CX4A 1UIKA 4MZUA 4BHPA 2IFWA 3RZZA 1JOJA 1S0IA 3ZXKA 1BBT1 5CVRA 3MPPG 1VBD1 4FCAA 3ZYGA 2RM21 3WDUA 5CA6A 2P3JA 1JH5A 1OKQA 3PJYA 3VBHA 4CP1A 1O4ZA 4YW2A 1GYKA 2R32A 4R9DA 3ZIXA 1IGOA 2A6XA 5I0TA 4MGIE 4DPNA 3PMEA 4QD2A 3B9IA 2N7GA 3KMHA 3R4SA 4XQWA 1NG0A 4HL0A 4RHV3 2FMYA 1QJU1 4PF5A 4Q4Y1 2VGDA 5IK8A 1XE8A 3M7AA 1YCIA 5DG1A 3RG0A 2V73A 5E88A 3TB0A 2UWAA 1C8NA 4KU8A 2A3WA 5ACA1 1R081 3WQ7A 1GZ9A 1AL23 1LRHA 1R1A2 2ZMNA 1KS5A 1H8TB 4CDXB 4WM8B 3GBWA 4C91A 3GZAA 4Q4W2 4IEXA 1NCRB 4N9HA 2R6QA 5FO7B 1NQDA 1C4RA 3VBHC 1AVBA 1AYN1 2G9GA 1VBE2 1H0BA 1YRZA 4LA3A 3RWNA 1H9PA 2HWD2 3SCFA 2P3KA 2ZGKA 4LO6B 3JD72 2RS11 4Y1YA 3ZFEC 1YFXA 1CPMA 3UKNA 1TEIA 1PGL2 3AMPA 1NQJA 2YV8A 4Y4YA 3DPRA 3OD0A 5DDJ2 2ILMA 1S0GA 2VNGA 5FMOS 2WNUB 3AXEA 4LNVA 1RHI3 4AVCA 2RHPA 3A0KA 2HWF1 1OFNA 1X36A 4KQ7A 5JIAA 2MEV3 1QQP1 4RD7A 3WDWA 4WVZA 5JZGB 2DVGA 1YO8A 2A5ZA 1AR62 4BH9A 1EAH3 4OULA 3BODA 4P9LA 3V64A 1NCQB 4R9BA 4D94A 3B01A 3VBOA 5I8YA 2VW1A 1V9U2 5BNQA 2VVDA 2ET1A 5F6LB 3QD6A 1I6XA 3JBG1 4LBOA 1VRH2 2V09A 3RRDA 4YRDA 3I8TA 1WW7A 3TN92 2A71A 1MS4A 1RUC3 1ND3C 1X7NA 2VNOA 1WLDA 4HT1T 4E27A 2DYCA 4K8FA 2VPVA 3IMNA 3EJKA 5CFCB 3PMSA 1U5ZA 3AMMA 1HX6A 2Z5WA 1DYPA 1GZWA 3NSTA 4UW3A 1XNKA 3JB4C 4LE3A 4GA9A 1GZCA 1RIRA 4M01A 4AEDC 3WINE 5HCAA 2Z2SB 2LUWA 1O3TA 2RMU3 3AMNA 4NPRA 1ZZBA 3B7MA 4XEZA 3RMYA 2GNDA 5H9RA 2UY9A 5C33A 2XJVA 3VBOC 4YARA 3AKSA 1PHMA 1SCSA 3AYCA 2JEMA 2TNFA 1KDKA 4AI8A 3ZFGA 1ULDA 2PHUA 3FMGA 2GNTA 3BOWA 3MFAA 2BGCA 1D0HA 1S0JA 1RGSA 3J9SA 3MIHA 1AXZA 4F83A 4YSFA 4JC1A 1UIJA 5KHKA 1KFXL 1YFUA 2QJVA 2UURA 2UWCA 4LHKA 4C0HA 4XFCA 5CADA 1G9AA 4LEJA 3QLQA 3ZXAC 4CEYA 1IHMA 4BYYA 3AYAA 1LOCA 3LB9A 1YXWA 5CU1A 4NWVA 3VZMA 3LGRA 2YGMA 1N1SA 2BTVC 1AR73 1RUE3 3DV8A 1GANA 1FOD1 1SFYA 1BYHA 3S6PA 3E5QA 1ZBE1 2A7AA 3OY8A 1COV2 4MGZE 1D4M2 5AVAA 4FPFA 4YVSA 2F4PA 4E2QA 3ZFGC 1RUI3 5JSOA 4XDQA 4AEMA 2ZTNA 4Q4W1 2IXKA 3KQRA 1SLTA 1KXGA 2WS93 1NY72 3MIGA 4HPKA 5BNOA 4Y1UA 2JICA 2HEYF 4YVWA 1EPWA 4G4FA 3NKGA 5DZEA 1CGPA 2DU0A 5GLZA 1RVF3 1J59A 1GR3A 1YNAA 3JD71 3KSCA 2PN5A 1HQWA 5J09A 2VMIA 1PGL1 2TBVA 5T54A 3HBZA 4FO9A 3VKFC 1O4TA 3DPRB 4XF0A 4XMIA 4FTEA 4XF4A 1BMV1 4NOTA 2E7TA 1MZ5A 2VECA 1JBCA 1ONAA 1H2KA 2FMDA 1N1VA 1TME2 2EXJA 4DZGA 1S0FA 2RR12 1AZDA 1I3HA 1Q43A 3LZZA 1DGWA 3WOGA 1V6LA 3VHOA 5B2GB 4LO7A 4NWWA 4XXPA 2R16A 3OBRA 4XBNA 1OOPB 5LK7B 2EALA 3OBTA 3VBOB 3GZUC 2PHWA 1JTZX 3CF6E 4FPEA 4BMBA 4E4SA 3UK9A 3T2TA 4YVWC 1O5UA 1ZBA2 1O4YA 4M00A 3VZNA 1AYM1 2OUHA 4J1WA 2IFRA 3JQWA 4LHNA 1A3KA 4GB32 4GWMA 5FRAA 2R1DA 2ATFA 1H2NA 4JAAA 1SEFA 4W6YA 3B93A 4NO4A 1UPSA 2WLPA 1VP6A 1X33A 4KGQA 2BFUS 5KHJA 4YLZA 5EZWA 2ZX0A 4X8PA 1G9DA 3M3QA 3KD4A 4IEQA 3DF0A 3ASIA 1H1IA 2WLQA 2A73B 5KXCA 3NVCA 2ZZJA 4M3CF 3ZN6B 3AKRA 4HK8A 3MPBA 4RHV2 2EF6A 1FNYA 4GXLA 1OLRA 2PHDA 3AZWA 3V0BA 2PTMA 4AQ2A 2BWAA 1D0GA 1YHFA 4M0HA 3WG3A 5C8CC 3ZFGB 5JOYA 1AL22 2IXJA 4R4XA 1H1AA 1NZCA 1UCXA 2UWBA 2O0OA 2ZBJA 1S0BA 1MEC2 4Z1VA 2JE9A 3GHNA 3ILNA 1VBB1 1AJKA 5BPXA 4I3PA 2A6YA 4CEYB 1SDWA 1FPN3 1XNDA 1LU1A 5A32A 2XJRA 1TNRA 5FPZA 4YM2A 2XBO3 4CDQC 1RUG1 2IXCA 1PO23 4K6BA 1KQRA 3D4KA 4XYXA 5K0UA 1AX2A 4FAHA 2VW0A 2GN3A 4YZ5A 3ZXGA 4CDWC 2ERFA 4XBLA 1COV1 1S0EA 3PVOA 5JWPA 3LWCA 1ZREA 2WZR3 5J3UA 2B46X 1RHI2 5SV5A 5EWSA 1QWRA 1MZFA 2H0VA 2MEV2 4AW7A 3PVNA 1NY71 5BNOB 3BTAA 3RDIA 1IS5A 3E5XA 1S0DA 3IBMA 1VJ2A 4M0NA 1EAH2 5JI9A 4LO8A 4Q0PA 1MS8A 4WVMA 5CG8A 1WLCA 4JGYA 1R1A3 1XE7A 4HFSA 5KHGA 2GMEA 3D0JA 4XJZA 1IOAA 4AHXA 1QJZA 4KWLA 1UD1A 1W6NB 4HVOA 4XZPA 1IZ3A 4AGGA 3KGZA 4RR3A 4AVVA 4HBNA 1DDLA 2UY8A 3MZHA 1U5IA 5FAXA 1TME1 2XVGA 1LULA 5E89A 2MPFA 3MW2A 3GZTB 4BOWA 2P2KA 4R9CA 1CD3G 2HWD3 2FZ1A 3AKQA 4P14A 4QQPA 4HANA 5C6CA 3FFZA 3VBFA 4D69A 4N90A 1S55A 4ITCA 3M8LA 3N7KA 4AI0A 4AVSA 2A70A 4RQPA 1J1TA 4B4QA 1CVNA 2QDNA 4C0BA 1KJLA 2QNKA 4OUMA 5DDJ3 2ET7A 4KG8A 2XJPA 1S1AA 1ZZ6A 1VR3A 2G9FA 3ACLA 3WHUA 5HCBA 1N1YA 2R0HA 4RR3C 1RUJ3 1ZRFA 1AR63 1ASJ3 4O9GA 1CQ9A 4YW1A 1UAIA 5A3LA 5JLVA 1DQ5A 1HRV3 4PLNA 3VZJA 4YW5A 4CRQA 3MFCA 5D8AA 1V9U3 1QH6A 3AB0A 2QUOA 1RITA 1AR91 4N7UA 4JRLA 3T1LA 3D82A 1ZNPA 1YJKA 3IM0A 4AVBA 3FFQA 3QH6A 5GLUA 4YG3A 3TN93 1DQ4A 3BCWA 2D97A 1PIV3 4BLIA 3URFA 4RHV1 2P34A 3JU9A 4ATFA 1QDOA 4U36A 4N43A 4LBQD 4TYSA 1AR72 1RUE2 4K3UA 1WMDA 2DCTA 1NOVA 4I0AA 1OPMA 3ZFFA 1DZQA 2ENRA 3ZYPA 2BUKA 1SMVA 2Y26A 2RS31 4B7EA 3N7LA 4XF9A 5T50A 1RUI2 4DRVA 2I45A 2DVFA 2XVKA 5GZDA 3ZDSA 4XILA 4PBPA 1CAXA 1QF3A 3SH5A 4HKOA 4JGZB 1B35A 1CPNA 5D8AC 2WS92 1RMU3 5A32B 4CDUA 1DQ6A 1WLWA 4AGRA 3WW1A 3V0AA 2BBVA 1ZZCA 5CFDA 3EHKA 2Z42A 1RVF2 1FNZA 2WFF1 1GV9A 4UXAA 5K0UB 2B7YA 1JW6A 5I91A 3RPQA 2DCZA 4AQSA 1WUVA 5FMOL 1JYIA 3SXWA 4COUA 4Z92B 3W9AA 3EBRA 3H1MA 3ELNA 4P9GA 5T5LA 4FPYA 3WCRA 4PQ9A 2XWBB 2R063 4WZCA 2ZX1A 5JMCA 4FPJA 4ES9A 3ECQA 3M70A 2MEV1 3MI8A 2GH8A 3B00A 5FOJB 1FATA 1PNFA 2WJSA 4L9BA 3FLTA 1B35C 4WVMB 2D7FA 3DL3A 1CAWA 4MV2A 4CP0A 4JGYB 3K51A 1QXRA 4CDUC 2I07B 3WQ0A 5AFBA 2XJTA 3NV4A 1TMF1 5TSWA 1D4M3 3R4UA 1W6OA 4HSLA 4IQPA 5CFDC 1N3OA 2TUNA 3CJIA 1QJX3 4RR3B 4R52A 2WNVA 2AENA 4I0BA 3J26N 2Y38A 1RUC1 3WDYA 3EXUA 1N3PA 1N47A 1BEV3 2VOWA 3UV9A 1WBFA 5A33A 5JAXA 1EP0A 4EWDA 2DVDA 5JPMB 4XETA 3ZVXA 3VBFB 3FBYA 5CB7A 4FOYA 4OHZA 4INDA 3CU7A 3AZYA 1F5JA 5JVVA 4LHLA 4P9XA 4HMZA 4RQPB 4LT5A 4YZ4A 1QY4A 2RMU1 5GLWA 2D93A 1VBC1 1REDA 1IQAA 3H9AA 4UW5A 2OIIA 5H9SA 2RR13 4ZU7A 3CJIC 1DU3D 1ZX5A 5J36A 5DUVA 4F8AA 1IKPA 2H0BA 2PHLA 3VHPA 1QKQA 4CTEA 5LRRA 5D8AB 4B8EA 5L7OA 2ZMLA 1H2MA 1LJ7A 2E51A 2GNBA 5K9YA 3HT1A 1YLLA 1ZYBA 2WZPP 3FBMA 5JOZA 2ZGNA 1FPN2 3AJZA 4GB33 2ZMKA 1GBGA 2GAUA 3AM2A 1O3SA 1AJOA 4COYA 2D5FA 1RJ8A 4N43B 2UYBA 4A7ZA 2XBO2 2ZCWA 1PO22 3MLJA 1AR71 5BV6A 2C9AA 2MNGA 3ZFFB 1Q56A 1I9RA 1PVC3 2WA4A 1Q8PA 4QPYA 5JDBA 2JD4A 1HIXA 3IWZA 4Z07A 2DFCA 2NN8A 2OZJA 2HEVF 3BB6A 2WZR2 4N53A 2WL1A 5AC93 2QFEA 4FP3A 1GKBA 3ZFEA 4AI1A 1LOEA 4IV1A 5L7OC 3O7OA 4CDUB 2WS91 2CWMA 5I8SA 5K7PA 1UX6A 2RJLA 1QNWA 3V0AB 2XVLA 3M3OA 1RUOA 2WA3A 4AI3A 2PHXA 3UKTA 2KXLA 4BCUA 2CTVA 4IV3A 2I2SA 4LBMA 4COWA 4UBGA 3WLUA 4XFIA 2ZX2A 4QMAA 1RTVA 2ZOEB 1OQ1A 1YI7A 1UU5A 1MEC3 1U0AA 1D2QA 3IDCB 1DFQA 2K9ZA 4LTAA 2HEWF 3NAPC 5FREA 1UN1A 4AI2A 1UZYA 5GZEA 5E16A 1PZ7A 1DBNA 2CAVA 3POYA 1E57A 2AR6A 5JI7A 3HAGA 1XNBA 2X5IC 3H3ZA 4N53C 1U5YA 3VHRA 4B7KA 1VLNA 3ES1A 4DINB 3B69A 1CAWB 1SQ4A 3AP6A 4IV1C 1ND3A 2WT1A 4CEWB 5DG2A 1OI6A 1W6OB 4Q1RA 5IK4A 2XB6C 1QOTA 3SLIA 2QVSB 1U12A 1WD4A 4IV3C 2WNVB 1EV12 3USUA 4ES8A 1PZ8A 5HBAA 2BW8A 4H3WA 1GFF2 1ZVFA 4AEDA 2HWC3 1ENRA 1V6JA 2BFUL 4AVTA 4S2DA 4GULA 2CGPA 1RUJ2 1OMIA 5T5JA 1ASJ2 1MVEA 1ND2A 4Y1ZA 3CEWA 1HRV2 1APNA 2D6PA 1SBDA 1RUH2 3N3HA 3KT4A 3WHTA 4XQDA 1REEA 2XKPA 1JYCA 4KBBA 3AXDA 4MXWA 1FMD2 3QACA 1FX5A 4BQ1A 4ORFA 4Q29A 4HVQA 5J48A 3L9JT 4I3GA 5BUVA 1PIV2 4F7ZA 3MGUA 1C5HA 3GBGA 3AFGA 4PDWC 2EIGA 4OHWA 1RUD3 5CBLA 1QOSA 2OVUA 1K5MC 2B45X 2ZKNA 4AHZA 3VUOA 5FDBA 4B4PA 1N1TA 4XTPA 5C9AA 2CAUA 1Z78A 3I54A 4PIZA 3VBRA 2A3YA 5L7OB 1QMJA 1R093 4YM0A 4JRAA 5BNNC 3LAGA 3SH4A 2OUJA 5GLVA 1ND2C 3B3QE 4Z8BA 2CYFA 1LOAA 3OTFA 4P9WA 3VKMA 3ZO0B 5EFUA 4Q4X3 3SITA 2VW2A 1FPN1 1XYNA 1RMU2 1VAMA 2BWCA 2VVFA 3MDPA 4BE3A 4COZA 4WV8A 1G9CA 2PAKA 3JUUA 1HDKA 1DHKB 4PCRA 3MIDA 3VBHB 4BLJA 4EV0A 1LOFC 4NHMA 4SBVA 4URTA 4DRRA 2PLV3 2JX9A 2ZACA 5H9PA 3AJYA 3AZVA 4QXKA 3VBSA 5C9AC 3ZFEB 1ZRCA 3VBRC 4IV1B 2R062 1Z7S3 3AZZA 2WSVA 4M3CA 4FBFA 3CNAA 3C2UA 2OPKA 3GNEA 2AH2A 3HN1A 2ZGPA 3MIBA 4YYOA 2BNNA 3B94A 4KL1A 2ZJCA 4IV3B 1ZZ8A 4AK3A 4GKYA 4W6XA 3KCYA 4OI1A 1CESA 1R1A1 1QNYA 3VZLA 1YIPA 3LKJA 4YW3A 4L2NA 4AFCA 1YI9A 2D6MA 2XHKA 4C90A 2NYYA 1QJX2 1C8M3 2XLFA 2CNAA 2DU1A 2H6CA 1MS3A 1BBT3 1FI2A 2D3PA 3VDDA 4QGLA 1VBE1 1BEV2 1UF2C 1FXZA 2ETEA 3B9CA 4OHXA 1EY2A 2O1QA 2B8MA 1DGRN 2HWD1 5JR7B 1CJPA 3AK0A 3VBSC 2D3RA 3ZSEA 1UMZA 1VIWB 1ND3B 3RJ2X 4AQ6A 4QPIA 2QKDA 1LGCA 4QGMA 2R0FA 4AXOA 1SACA 2NP0A 5LEJA 4Q4Y3 3DN7A 4TLFA 5DDJ1 2AUYA 3JB8A 4I0WB 4AHWA 1H1MA 4BM8A 2BEOA 3DKWA 1PO12 1CR7A 3T1MA 1R083 2PHTA 1OD5A 4AEDB