3J26N

The 3.5 a resolution structure of the sputnik virophage by cryo-em
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
362
structure length
362
Chain Sequence
b'EPDTVYYDILIPFKPNDQGFSPAIFQAQLTQPIVHNPSEYFLSVVRFSIPTQNIPLTIPQIQPYPNTNVNNTIYSVSIGYNGTYSSQNFVQFDPSLTSPNIPAPNAPTVTSPNVEVTPYYYIYDYSTFLQMINTALENAFNEISAPVGADAPFFFYDSNTEKISLIAQAAYYDRTLTTPIEIYCNVNLFTFFDSIKHIGLGYNTPTGRDILFDVRFLGNNYYQDPETAPSYPPEFIQMQQEYPTLSNWNAVKTIQLVSNLLPINKESIPSFRNSNVGIINAQGILADFVPLVTNGPEARISIDFVATGPWRLIDMFGSVPIYMVDLYVYWTDQTGGQYLINIPPGRILTCKLVFIKKSLSKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords capsid protein V20
molecule tags Virus
publication title Structure of Sputnik, a virophage, at 3.5-A resolution.
pubmed doi rcsb
total genus 25
structure length 362
sequence length 362
ec nomenclature
pdb deposition date 2012-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1100 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3j26N01
3J26N
chains in the Genus database with same CATH superfamily
2J1RA 2JD9A 4LLFA 3PVOA 5FZOA 3PUHA 1RUH3 1C8M2 1JYVA 4C0HA 2B7YA 4FXKB 1X8EA 1GQGA 2JG8C 4GB32 4PDWC 4O9EA 2IXIA 4LA3A 4QPGC 2ZEXA 4UBGA 5LY1A 4YNIA 4JQTA 3WDVA 1JBCA 2DVBA 2CWMA 1YNAA 2FQPA 3H8OA 5FZHA 4AQ2A 1JU3A 3DXTA 4AVTA 1AYN1 4UW6A 5E89A 5I0DA 4FFHA 3LQCA 2D6NA 1RVF1 1YQ5A 2B5HA 3H1MA 5FJKA 4CDXC 5BNNC 5HCFA 3POSA 4E2QA 3T2QA 3IAPA 2WAAA 1BBT2 1UKGA 2RJKA 1NCRA 4JAAA 2BRTA 2LS6A 2VNGA 2Y64A 2VZUA 3DL3A 4BE3A 3HVDA 4Q4Y1 3WXPA 1M06G 3O5SA 2TBVA 5C3OA 1E5HA 3WEZA 1TME2 1MZFA 2OPWA 1CESA 5FP3A 5BNNB 2JKXA 3THPA 1RUF3 4EE2A 3M3OA 4HVOA 4AHZA 2SLIA 4BISA 3THDA 1YEWA 3MO4A 4KBBA 3LOIA 4LR4A 2Y6KA 2VECA 3NV2A 2HWD2 3VDAA 4URAA 2AREA 5CG8A 3VHOA 1AXKA 3WUCA 1UYZA 4LK6A 1J1TA 2P37A 4NRQA 1NQDA 2G9ZA 3ACLA 2XLGA 3O7OA 3FZ3A 1OD5A 2GU9A 2HWF1 2VBBA 2OT7A 3OUJA 1OFSA 1CWPA 5FPAA 5GLTA 2DFBA 4BDVB 1UY1A 4N53B 4XAAA 3SEPA 4FPCA 4CXWA 3BPSA 3KT1A 1VBA3 4IDZA 1PNFA 1OVPA 3V56A 1WA6X 3JBG1 3AJZA 4BMEA 4K8RB 2WQZC 2RMU3 1K5MC 3AZXA 3FFQA 4AXOA 4E2GA 5C33A 2YY1A 1V6IA 4GZ9A 5FZLA 1APNA 1VAVA 5IFTA 4Q4V2 2BJSA 1O91A 1HLCA 5A32B 4N9HA 1R082 1O4ZA 1HRV1 3FMGA 4K6BA 1DQ4A 3DPRB 5DUXA 4Y4YA 3ACIA 3TNPB 2VZPA 1D7PM 2JDAA 2MEV3 3BTAA 3LSDA 4SBVA 1YQCA 1WLTA 2VNRA 2IWGB 1D2QA 2BVBA 2A3YA 2WO7A 1JODA 1W8TA 2WWUA 1FOD1 1GZTA 3BOPA 4W65A 3U1XA 3NWKA 4WM8A 5M0TA 4XQ4A 2YFZA 3VDBA 3K2OA 3MUZ1 3AFKA 1UY4A 4HKLA 2IXHA 3MV11 2VULA 4WVMB 2JJ6A 1ZZCA 3WW3A 2QQJA 1N3OA 1JUIA 3BCWA 5H9PA 5J7MA 1OOPC 4Q4X3 5FYSA 2AC1A 2PTMA 5JR7B 5A7PA 3ZXJA 4LMFA 3FL7A 4P5YA 4PCRA 4AEDA 1GP4A 4LKDA 3D5OA 4AK3A 4I2OA 4NIHA 1H1MA 1C4RA 4B8EA 2IXCA 2Q8OA 4BQ1A 3I2OA 5GM0A 4JQRA 5FK8A 4MGSA 5LRSA 4YZ2A 2D98A 3OBZA 3I2IA 4YFWA 4N7UA 1BHGA 5CVRA 2QQMA 2WZPP 4MGYE 1AR92 4XC9A 3ZYIB 1BEV2 3JD71 2D5FA 4YW4A 1PO23 3VBUC 1H30A 1NAEA 3K4ZA 1UAIA 2ARCA 3ILNA 5FYBA 1SPPB 4C8DA 2MEV1 1AR62 2WNVC 3A21A 4NPRA 4AHXA 1POQA 1R091 3CL1A 2HBUA 2JENA 3BI3A 1KRIA 1ZNPA 1GWLA 2DV9A 3AZVA 4CUBA 2HWB1 1QY4A 1ODMA 4YG3A 3CF6E 2V5DA 3NNMA 2R063 3H1WA 2EAAA 3O1OA 1Q8SA 2OVUA 2ADDA 3AL6A 3PDQA 3Q8CA 4QX0A 5A3WA 4K21A 2WNVB 1HRI2 2FMYA 3V65A 3WY6A 4CDXB 5A6ZA 4B1MA 1IQDC 2ZMKA 2R062 3IDBB 2GP3A 4EN0A 2KD7A 4MZUA 3VD3A 2HWC2 4H2AA 1AXZA 2NN8A 1GOFA 5FZIA 4CEYA 2XVKA 2ZOEB 5A3LA 3RZZA 3GJBA 4FOVA 4NAOA 3EMRA 1NY72 3VBHA 1MS8A 4PF1A 4E9KA 1H8VA 4CE8A 1O3RA 1JHJA 5I0RA 1LOFC 1GICA 3EYPA 1G9CA 3V0AB 1NA1B 1V0AA 4LBNA 3AMNA 4CCMA 3ZYRA 2ZEWA 3I2DA 2X05A 1PK6A 5EHDA 2IUWA 5IUQA 5A3OA 5BYNA 3MBWA 1A8MA 1XNTA 4CCEA 1PMJX 4RFRB 4KL1A 1KQRA 1PX4A 1OT5A 2VZTA 3DPRA 4XHBA 2XKOA 3AP5A 3USUA 3GCWA 5T3NA 4UFKA 4ZS2A 2AYHA 3HD8B 1AL0G 3I2FA 4PLMA 5C3QA 5CAZA 1JZ3A 4I09A 4LBQB 1SZBA 4LBKA 4GAZA 5D8AC 5FV3A 1NA1A 1SACA 4F8AA 3NNFA 1LR5A 3VD9A 5KXCA 3ZIWA 1GZWB 2VC9A 2JIGA 3NJZA 3QH7A 4NRMA 3ZN5A 3EQEA 3VD4A 4CCJA 2W5FA 4Y1UA 1RUH1 2GN7A 4DMIA 1U5YA 1H2NA 1IOAA 1EPWA 4TLFA 5KHJA 1DLLA 1QNWA 4ASMB 5D8AB 4IEOA 3AM2A 3HNMA 2WSUA 2BVVA 4ZZ5A 5C8CC 4B7KA 2CV6A 5CYYA 1OKOA 1X9PA 4QD2A 3WW1A 3EJKA 2OX0A 4BQ2A 4BA6A 1W6QA 1YIPA 1QDCA 5CFDC 1QNYA 4S2GA 1OA4A 4LLOA 4XIOA 4WVWA 3S5QA 3IWZA 3VZMA 3ZIXA 4NAMA 3WG1A 4FCAA 1UIKA 4QAWA 1Y4WA 3UJOA 4MX3A 2HBTA 3D0JA 2PYTA 2NMOA 1LB2A 5CKMA 1WKYA 1FX5A 3AVRA 4XQWA 2GN3A 4AI3A 1QJX2 3KLSA 5CFDB 3JQXA 1COV1 1ONAA 2JDNA 3R4DB 1G8WA 2WFF3 2QKDA 4UAPA 2AEZA 4HBNA 4CDQA 4HK9A 1F31A 2V72A 4JHTA 3LIGA 3E6CC 4AGRA 2ZHMA 3I54A 2NPIA 2HWE3 2ZABA 4W8JA 1W2NA 1DU3D 1NT0A 1ZM1A 2UY8A 4AWDA 4LULA 1U5XA 1IS4A 5GLZA 2BBVA 3C3VA 3S7IA 2IVIB 2W92A 2QQUA 1NUKA 4XIKA 4GJZA 3RMXA 3AXEA 1WGPA 1W9SA 2HWD3 1G9AA 5I8TA 3K3NA 1Q8QA 2Q30A 1OPOA 3IMMA 3U10A 4B3NA 3HJRA 4F7ZA 4Z2AA 3WX5A 1C3HA 2WN2A 3HAGA 3IIIA 3O1VA 3HWJA 2Y60A 4YM2A 4CEYB 2E33A 1A8DA 2V73A 3SITA 4WZCA 1NYWA 4LHSA 2UWBA 5A7NA 4A7YA 4CDUA 4Y5Z0 1FPN3 3K77A 5FYIA 2W91A 4FPKA 2AEYA 4Q4V1 4AQ6A 1XNDA 2AACA 1E57A 1MZ6A 2BQPA 3C7FA 1LEMA 2OKXA 4AR2A 2PFWA 2Y33A 2VOTA 1HQWA 4XZPA 1H8TB 5KXBA 1X82A 5FP8A 4QKFA 2JDZA 3O14A 4Y26A 1O3TA 1SG3A 5F3GA 3KF5A 5FCCA 2VOXA 2KR2A 3IN9A 1K5MA 3BTZA 2ZAHA 2VPVA 3WNXA 4ASKA 4P9GA 1QJZA 2O0OA 5IWFA 5FMDA 4BU2A 4M4PA 4M3CE 2GZWA 4LOSA 2VQTA 2ZEZA 4QQOA 4AHWA 2X8KA 3ZKYA 1EV11 4C0BA 1O59A 4G3YC 4N7IA 4QGNA 4XILA 1XC6A 2HYKA 1OHFA 2BV4A 1EUTA 3MV01 5FYYA 1LGCA 1DZRA 1NA1C 1AYM1 2XJSA 3E5XA 3I4IA 4M3CA 3RZJA 1S0CA 1HRV3 4V2VA 5DPNA 2JX9A 5KC6A 4AAXA 3O1PA 4R9AA 3J8F2 5BUVA 1T6BX 3ZN6B 3OD4A 4QPGA 5FY8A 3T2PA 2RS32 5IK8A 3VBSA 2GMPA 2X5IA 3TNQA 2K9ZA 5E88A 4YW2A 1YRZA 2FD8A 1RUJ1 4HZFA 4J6GA 4OMCA 2WFPA 5LEKA 3M3QA 3POIA 3PURA 3RDIA 2V4VA 1I1EA 4AI2A 1AL21 2AR6A 1CAXA 1KS4A 2HLEA 1H9WA 2VG9A 1W9FA 4I02A 2XLFA 5EPAA 3M4FA 3VBRB 4EWEA 4AQTA 5BNPB 5FK7A 4DRVA 4RD7A 5IK7A 3KVAA 2XHKA 4AHYA 3T0BA 3C8XA 4TXWA 4LE4A 2ZGQA 4LORA 3S5AA 5FZ1A 1NE4A 3ZKUA 2Y38A 3OGRA 3D4KA 4PDWA 3CU7A 3AP4A 3TOJA 4HK8A 2YDEA 3AMMA 2B8MA 4L8QA 1NZCA 2JECA 5ISLA 1X36A 3A0NA 3IPVA 3WOGA 3WD5A 4QQPA 5JSRA 2P2KA 2Z5WA 1VAMA 5LASA 5LEJA 5FMOL 1C8M1 2JEMA 2YGMA 5FXXA 4BLJA 2D93A 3MIFA 1CAVB 3PIGA 2HWB3 3PJQA 5DAWA 4CEWC 1FPN2 4Z82A 4YVSC 3WVJA 4E8CA 1NOVA 5I0TA 1W0PA 4OI1A 5AFBA 4BQ4A 1W6PA 3BTXA 2WNVA 1HW5A 2WS91 4I3GA 1BVP1 2QE3A 3BU7A 4XYXA 1ASJ2 5DUWA 4YW1A 3B94A 4LHLA 4DRRA 1RVF2 3DYOA 2B42B 3H50A 4JHZA 4QXCA 1QXJA 2W52A 4L2NA 4N43C 3WHTA 2PHRA 2JDKA 3SMHA 2R042 4MGZE 4CEWB 4YZ5A 1DZQA 1HRI1 5DUUA 1VMHA 3UKNA 2WLQA 1HX6A 4CPBA 4AI9A 3VBHB 4DXRA 4Q0PA 4IGPA 3M7AA 1IGOA 3VBUA 3UKTA 4CU8A 1VJ2A 2JD4A 1SLAA 5CIRA 2HWE2 1BKZA 2MPFA 2GNTA 4CXXA 2G4IA 2W08A 2DFCA 4GH4B 1FXZA 2VZOA 3TRSB 4BK5A 3HT2A 2GALA 1AR82 1YFWA 2CY6A 2WFF2 1Q3EA 1FT9A 2Z42A 5J1XA 4E4DX 2DURA 2QQWA 4KG8A 2VZ1A 3LFMA 5FBJA 5FZCA 2JDPA 1H1IA 1CD3G 4QPIB 4W4ZA 1LGNA 3IMNA 5IVVA 4CUAA 2RS53 3CJXA 2YC0A 5GZDA 4IUGA 5GZGA 4JV4A 2D6PA 3ZXGA 4HSJA 1ZREA 1QEXA 1HN0A 2PELA 1ZRFA 4HMZA 1UMHA 1JW6A 2NLRA 5C9AB 4JRLA 1GZWA 2HWD1 3TB0A 4AGVA 3I2JA 2X29A 5EJZB 3AJYA 1GP5A 4B1LA 3MF6A 1XBFA 4ZHNA 4IV3C 1DDLA 5FZ6A 4OYUA 1VBD1 2ARBA 2VCCA 1HDKA 2YMZA 3C7OA 5EQUA 5JSOA 3Q9OA 4EN9B 1WLCA 4MHRA 1WW5A 1AR71 2JE9A 5FFOC 1W2OA 2QQPA 1RUG3 2EA7A 3VZLA 5AC91 2W1UA 1QKQA 1W04A 1WBFA 1ACCA 1MS1A 4RR3C 5FPLA 1UZVA 1XU2A 1W6QB 1ZX5A 3PVBB 5H9RA 3WCSA 3M1HA 2DBNA 3T09A 2ENRA 1RINA 3Q8EA 2X53S 1TNRA 2XKPA 5FZ7A 4NE9A 2ZX3A 4URTA 4XF0A 2X5IC 1UX7A 2DF7A 4CDQC 4R4XA 2JG9B 2ZGLA 1NE6A 4JGYB 1V9U1 3WNMA 2J1UA 1UMZA 4ASLA 1XNBA 3HT1A 4LIUA 5I0UA 3U78A 4CCNA 5A1LA 1CPNA 4HANA 4CZSA 1O3SA 1ZBA1 2WZR2 4HONA 5LBFA 2DVGA 3MIBA 2I45A 1FNZA 3HN3A 1DGLA 2R1DA 4NHKA 4LXLA 2QQLA 1KGYA 4K1YA 2VMIA 3RJ2X 3X29B 5IK4A 1UOFA 4AZZA 3POJA 1GQPA 2VVEA 3D0SA 4WBBA 3AC0A 3IT8A 2A6XA 3PU8A 2K0GA 2QNKA 2O8QA 3ES4A 4J25A 4LKEA 3VBSC 2ORXA 2V4AA 3KM5A 4QPYA 5C8CA 3K4AA 3CIHA 5H9QA 3ABZA 1BEV1 1CAWB 1SLTA 2XWBB 3JD72 5A33A 4NWVA 3MFCA 3KHBA 3ZFGC 1VR3A 3WDWA 1QH6A 3ZMOA 5JOYA 3OUIA 3PTYA 4NIIA 3P1IA 5J98B 2RS52 4FP3A 4Q0SA 2O8OA 1XRUA 1W8ZA 1IPJA 5HV0A 3AYCA 2ET1A 2FDFA 5C4WA 2AGSA 2F17A 1AYN3 4XJAA 1SQ4A 4EZHA 1ALYA 4CDUC 1IPKA 2AH2A 5J96B 1SFPA 1PMHX 2HWC3 2E7QA 2TNFA 3I97A 3ZYPA 3SCHA 2VUAA 3DCQA 5A70A 4XJ9A 4C90A 3RYKA 5SV5A 3M3CA 1LHUA 4ZU7A 2B9VA 2QJVA 3EB7A 3KWVA 3TN91 5A33B 2G19A 3TBDA 4XXPA 3VHRA 3ES1A 2WDBA 2VZ3A 3KT7A 1ZZ7A 3O0WA 4M4RA 4MADA 4NROA 3JCIA 1ULOA 4FFGA 4QXBA 3ZFFA 2D44A 1ASJ3 2GMEA 1K5MB 3EO6A 5FPUA 1PGL2 3KCCA 1W6OB 1ZZ9A 2RS12 2VOWA 3UKVA 5J37A 3WZ1A 3LA3A 2IXLA 5L73A 3HNBM 3VKLA 3OY8B 3GBGA 5FMCA 2X10A 1S0JA 3WP5A 3MW2A 4COWA 2YC2A 5F3EA 2JE8A 1BMV1 2QTWB 1RMU3 3I8TA 3ORJA 3KVBA 1LOEA 3DUIA 3MIDA 1C57A 1W6MB 4NHXA 1AX2A 3WW2A 5C3PA 1J58A 4P9XA 1OLME 4AFAA 2WS92 3WG3A 1AR93 3ENRA 5ACA3 1RUI1 1Z7S2 3C7EA 3I59A 1X8MA 2OUJA 4XUTA 1DP0A 4IV3A 5FY1A 5K9YA 2DCJA 3BUCA 3NVCA 4O7XA 2YC4A 4GKXA 5JXJA 4Q4X2 1CVNA 4IEUA 1UOJA 3AYEA 1WCUA 4NVPA 1VBB1 2A6YA 4K3UA 4XURA 4E4SA 4FTSA 2VR4A 1O6UA 4XUQA 5C9AC 3T0AA 4TZDA 2XL9A 3E97A 1Q8VA 1LNSA 4IV3B 5JMOA 3DYMA 3MLLA 1MEC3 1OQDA 1S0IA 3CNAA 1GZ9A 1JZ5A 4PDWB 1S2EA 2AUYA 2D3RA 3P6BA 4GB31 4UXAA 1ND2C 5FO9B 5BXXA 2EIBA 2ZGOA 1YFUA 2LM3A 3PHMA 2J1TA 5FYVA 1X9TA 2ZHKA 3WHUA 3VDDB 3IDEA 4GULA 1O8SA 2G1MA 5C5TA 5EZWA 1RXGA 5FYUA 2ZBJA 1PO12 2RDNA 2XJRA 1OSGA 2W1QA 2E31A 3KD4A 4N43B 2RR11 3VBOB 1LAJA 4JTNA 3WR0A 2A6VA 2X5IB 4ORFA 5DAQA 4CXYA 3NAPA 3MLJA 2R7EB 1ODNA 3ITQA 1Y3TA 2C5DA 3WSOA 1BEV3 2ZGMA 4AGGA 4KGQA 2VMFA 2FDHA 4XDOA 5DUVA 1RUC1 4ZS3A 2DCTA 4CCKA 3BPZA 4IEVA 3KQRA 4XHXA 3ZLIA 3SISA 5C71A 1CIWA 3ZXDA 5C70A 1GWMA 5JOZA 3BVCA 4LA2A 5FO7B 4GKYA 1GKBA 1U12A 1CZTA 1VRH2 2CAUA 2GAUA 1UD1A 3NKTA 4GWJA 4GJYA 2ARXA 1OLQA 1JOJA 3F2ZA 1SLIA 2LROA 1J83A 1DF0A 4XTPA 1KDKA 4CU6A 3OEAA 4PLNA 4LT5A 3ZYJB 1STMA 3RZGA 1V6JA 5F5CA 5JPNB 3ZM8A 4AVVA 3LPFA 3QCWA 3JUUA 2WKKA 1E5SA 1H2MA 4XFFA 4MGTA 4IXLA 1OF3A 5FQ0A 1KFUL 1WMFA 3ZPOA 4IEPA 3RG0A 3ZYHA 3J26N 1ZZBA 2H6CA 2LALA 4QQ2A 4QX1A 4RQPB 5FP9A 4IEYA 1WBLA 2I2SA 3PVEA 5FTTC 3W59A 3ZFGA 4PF5A 1UCXA 3CLPA 3HBZA 1MS4A 1QJX3 2JIJA 1RYYA 1SLCA 3HPNA 5IVFA 3SXWA 4CCLA 4R52A 2JB4A 3MGUA 1J59A 1SCRA 2D5HA 4Y1ZA 3H7YA 4NMIA 2Y0OA 3KV9A 2OQ6A 4XXAA 1UO9A 2VVDA 5IW0A 1DYPA 2XOMA 1RITA 3WT3A 3RI8A 3APBA 1H2LA 5F3IA 5A3PA 1ZBA2 5LATA 4Q0UA 1JYIA 2WO2A 2WA4A 3DF0A 3HBKA 3K4DA 4LKSA 1UWWA 5C8WA 5IT6A 5HI0A 3H3UA 1GOHA 1LENA 2WABA 1S2BA 1RHI2 1SLBA 2VO5A 3J7NA 3KZ4C 4L11A 1W2AX 2YPJA 1RUD3 1GR3A 1RC6A 2P17A 3OD0A 4MV2A 5JXIA 3ME2A 1KEXA 3OG2A 3VZOA 3N9NA 1C5IA 4M00A 4QU1A 4YW7A 3UGHA 4EN6B 1UZWA 5KHIA 5AVAA 1F5FA 2W3JA 3VLBB 2DUQA 5A32A 2W87A 3L2YA 1W3VA 3RSJA 1GNYA 2YBSA 3B3QE 1UW8A 2H0BA 4UI9L 4WV8A 4Y4RA 1YCIA 3ZVXA 4AW7A 4D7TA 4E2SA 1AR81 3MI8A 4Z2WA 1CX4A 1LTEA 1UY3A 5F5AA 5KHHA 1FI2A 1GP6A 3ZXLA 1S2KA 5D2AA 4JCKA 3N35A 1DIWA 4TWTA 2KXLA 2ZGPA 1D0GA 2ZMNA 2VY0A 3S6PA 5FZGA 2YB7A 2ZGSA 5ABJA 5FO8B 5JVVA 3RGBA 4C1XA 3CO2A 5C7GA 4DXSA 1N47A 4RR3A 1DGRA 1RUD1 2QQIA 4LBOA 3KS7A 1W9WA 2VW1A 3P3NA 4CU9A 5FXVA 3H8XA 1IQAA 1WWYA 4A4AA 1XYOA 2WS93 2OYZA 2E26A 2XVLA 4AF9A 4PJYA 4AI1A 5CISA 3ZXEA 3GM8A 1AL22 2VJXA 3FWEA 3POGA 2JB8A 4Q27A 4XF3A 3EHKA 1AF9A 1GV9A 1SDDB 2ZGTA 1KJRA 4PBOA 4L99A 5IFPA 1MS5A 2EVXA 5AVPA 5BNPC 3ZSJA 2CHHA 4AQSA 5JUVA 5F6KA 4DZGA 2FZ1A 1OXCA 3ZFFC 3FLPA 2IVJA 3SCGA 1RMU1 4WM7C 3ZXKA 2ORZA 2D6OX 4FOYA 1O4YA 1V6MA 3IM0A 1PO13 1C28A 4OQ8A 3LCPA 2Y6FA 3LPGA 1XQNA 2BZDA 3TN93 2P34A 5L9RA 1QDOA 2QUOA 4YARA 4P14A 1GWKA 5FYZA 1RUOA 2R0HA 5FRAA 4MH0E 1HRI3 2DWRA 1QJFA 4N53A 1HJFA 5FBZA 2Y0IA 5GLWA 1RXFA 1XSQA 1MEC2 2R16A 2JDYA 1IZ3A 1US2A 1C8NA 4JDNA 3WW4A 2VCMA 3T08A 5C4WC 2P3YA 5FPBA 2Q8DA 5D1IA 3LA7A 5BNOB 5FWJA 2RS31 4D7YA 1JS9A 1WMDA 2WNOA 3QBQA 3B93A 1W6NB 4UOJA 2XMLA 2Y6GA 1AR63 2GC2A 3IB3A 3SKJE 1X50A 1OI6A 1VLNA 3P5BA 1AYM2 2BPA2 1VMJA 4XTMA 3ACFA 2GMMA 3BN6A 4MVTA 4PQQA 2PN5A 5FZ0A 5IK5A 4QB1A 1HIXA 1LJ7A 4DS0A 2VZQA 5FYCA 5K4LA 4AFMA 4FSJA 3KV6A 2FCTA 5JDBA 2R073 4FQZA 4KG0A 4YGCA 4META 3UGFA 2FDJA 2FHRA 2VMCA 4IV1C 1JOPA 3IDCB 4AEMA 4GIQA 2WNUC 1F4AA 1VBC2 3T30A 3ZFEB 3FHQA 3B02A 4GMP1 4OQ9A 4DOUA 4CP0A 3B00A 2EAKA 3N7LA 1QMJA 4QHZA 2A1XA 1TNFA 5IVYA 3LF7A 3LDBA 5A7WA 3GBFA 3ELNA 1LECA 4F83A 1F4HA 4FPJA 2JG8A 4XBQA 2FCUA 5JOXA 1ND3B 2H0VA 2VU9A 3OUHA 3E6BA 2OZ6A 4OI4A 5JXHA 3NO8A 5AC93 3O1RA 3NAPB 4OUSA 3MYXA 4GMP0 4XOGA 2CGNA 2ADEA 2DYCA 2LRPA 4BYYA 4LO5B 4QX3A 2VMDA 4HVQA 2EXIA 1R083 4TLGA 3ZSKA 2QQOA 4BQXA 5HPOA 3OB8A 4KWLA 1RUC2 3DPRC 3OGSA 1AJOA 3S57A 2RDSA 2BNOA 2PA7A 2B4KA 1AYN2 1CJDA 2YZ4A 4IEXA 1LOGA 3RS6A 4FPLA 1FATA 1CZSA 2X09A 5FKBA 4XQDA 2Z69A 3HMYA 3LE0A 3U11A 3LFIA 1WLDA 1OOPB 1YI9A 3B01A 1D4VB 5FREA 1RUE2 3JB8A 1EAH1 1COV3 3M2MA 1JH5A 1WMXA 3Q8FA 1TME1 3OJBA 3WUDA 4H55A 4E8DA 3I3QA 1A34A 4D7SA 2C9AA 1UYPA 3SH3A 2JG9C 2Q8EA 1Q8PA 3PVNA 4K1ZA 1WCQA 4L92A 2Y6HA 5FQ0B 3ZN4A 3I2KA 2QVSB 3KCXA 4V2WA 3MPBA 4BIOA 3MW4A 3R4SA 4V1PA 4FTBA 1HXS3 3H3LA 5T5OA 4CP1A 3T4HB 1YO8A 3O0XA 1W8WA 3QD6A 1O5UA 1Q56A 4DXTA 3ST7A 4QPIC 2VM9A 3LB9A 3VDCA 1VBE2 1XB9A 2QBXA 2B9UA 4LBMA 2J7MA 5LBCA 4FPGA 5J09A 3RZMA 1F9KA 4LPLA 4Z8BA 2XGXA 2R043 4NO4A 3RQ0A 4BQ5A 1FOD3 4PI0A 2GNDA 1POV0 5A6YA 2XH6A 4KWKA 3GZAA 4QKDA 1CZVA 1R092 1Q5OA 1GMMA 2VNVA 2KA3A 1W9TA 1CJPA 2CAVA 4OZXA 4QX7A 3UK9A 3WQ0A 2D43A 3PTRB 5EFUA 1Y9QA 4QQHA 2A75A 1QOTA 1UMIA 2HKXA 1PIV2 4UF0B 2ET7A 5AFEA 4XJUA 3VZKA 1B35A 4B4RA 5LK7B 4CDWC 1AR91 1CX1A 3ZSLA 2K46A 3SHRA 3H1YA 3OBTA 3VKMA 3SC7X 1UY2A 2C9KA 3FBYA 1H8TA 1BMV2 5GZCA 2VBPA 5LBBA 4S2DA 2WRAA 2VQUA 2ZGUA 3KGZA 1LOFA 1YQ8A 4GH4A 3UESA 1Z7S3 2O14A 4LEJA 4Q29A 4YW3A 3AZWA 1NX9A 2QZ3A 2VXRA 5FZBA 4MYEA 5LZ6A 2PLV3 4GH4C 4BXFA 2W47A 2YGLA 5F5IA 1H6XA 3WV6A 5CFCA 2VCBA 5K0UC 1OUXA 3POYA 3OOXA 4P9LA 3FHIB 4MSVA 4UW3A 4W6WA 2EF6A 4NPMA 2WNUA 4DO0A 2PLV1 2XXZA 4JDMA 1RUNA 1YYNA 1W6PB 2ZGRA 4IL7A 1RUJ3 4DXZA 1Z7S1 1RUI2 2QDNA 1CN1A 2AENA 1YXWA 2WYSA 3KSCA 2C1FA 1QHDA 2XJTA 1G6NA 1S0BA 4BZ4A 1SFYA 2HWC1 4H14A 2ZA9A 2MNGA 5LCWL 2DDUA 5K0UB 2UURA 2VOKA 4OHWA 4Z92B 1ENQA 3KV4A 4Q4Y3 5FY7A 3VZNA 2PAMA 4G4FA 5LA2A 3VBSB 2VTXA 4ATFA 5IVBA 3VN4A 4N90A 2CTVA 1DCSA 2LUWA 5BPXA 2WNUB 5CADA 2VZVA 5GJ6A 3SLIA 1JYCA 1GFF2 2FZ2A 5APAA 3F95A 5FZMA 3N9MA 2VUDA 4HL0A 5HXMA 5CEHA 1LEDA 2E51A 4NR1A 1TMF2 3SH5A 4QHOA 4QX8A 4WM7A 3HR9A 2YG0A 5LWBA 5A3NA 5IYYA 4B4QA 3T2TA 1JUHA 1N3QA 2R0FA 3UJQA 4DPNA 3NAPC 4QPIA 2BWAA 4GD4A 4QX5A 4XFCA 3LZZA 2P6CA 1QWRA 4MHUA 3WP6A 3LA2A 2W1SA 1H1AA 3SCFA 1ZBA3 1K3IA 1F15A 3NW4A 1SPPA 4EROA 1SDWA 3HN1A 4HVRA 5FY5A 1NXD1 1WZXA 4XDQA 5A80A 4A3ZA 1OQEA 2UYBA 3CQOA 3LAGA 5HCBA 5SV8A 5KC5A 1W8FA 2BW8A 1ZA4A 3J7HA 2JG8B 4DNYA 4HFSA 2DUOA 2ZHLA 4QPGB 1XNAA 3R6SA 1I3HA 1R64A 3PLQA 4CRQA 4ES9A 3ZDSA 4XBLA 4D6QA 2D6KA 1H6YA 1W05A 4XZUG 3RMYA 5BNPA 4IE7A 5KBFA 1ENRA 3J4UH 1CQ9A 2BYVE 5F2SA 4X8PA 4XEZA 4J1XA 1E5IA 2PQSA 4PLOA 5DDJ1 2P4EA 1DZTA 2A71A 2W2IA 1Z0HA 2GNBA 3RZLA 1G7YA 1O5LA 3GF6A 3T1MA 5IHRA 3PUSA 3DECA 3BU0A 1OURA 3W20A 3B7MA 4IE6A 5E1RA 2QFEA 5ANQA 1VPHA 3NV1A 2R072 2XB6C 3ECQA 4UFHA 3ZFEA 3W5MA 2OZJA 4W6XA 1PM7A 4XMIA 1VBA2 1W0OA 5FUNA 1PGSA 4JKKA 2WT1A 2J1SA 2FCVA 3D8CA 1RUD2 3K51A 1OLRA 5A7WB 4CCCA 1C8M3 2BTVC 2BOIA 2XWJB 1FMD1 4CA9A 3GCXA 4JC1A 3RI9A 2CNAA 4FVVA 2WAOA 4IV1A 1R1A1 1NCQA 1OVSA 1UN1A 1ND2B 4M3CF 5F7UA 3BIEA 1IS5A 1HB2A 3W58A 2WYFA 3LGRA 5ABJC 3WG2A 4RSUA 5K8SA 5DAVA 4ATEA 3HEIA 2MHFA 1LCLA 4MG2A 3FN9A 1O3QA 1LHOA 3WNLA 3OTFA 1CAWA 1WW6A 2EALA 2EIEA 2RJLA 3KB5A 3OEBA 3N3HA 1NXMA 2YPDA 4ZU5A 4PQ9A 4WVVA 2ZX4A 4I01A 4AEKA 4RS5C 3G6JB 4QPWA 4MGIE 3POWA 1PNGA 5CBLA 2W95A 2ZZQA 4JRAA 1JZ6A 1NCQB 2A3WA 3I7DA 3AVSA 4YPJA 1QOOA 4BWOA 2JG9A 5FOJB 1NCRB 2E7AA 2B45X 1OOPA 4Y24A 3PMSA 2CU5A 4CVUA 3BOWA 3RFRA 3IPVB 3RWKX 2WBKA 2BNNA 4AAPA 4X6QB 2PLV2 2ZGNA 1N1YA 3J9SA 4IEZA 4JGYA 5DG2A 3U4SA 1MQTC 4AVCA 3R0RA 4HETA 5CFCC 5HV4A 3J8F1 4MGKE 3LEMA 1W6OA 1H9PA 1EV13 3FX3A 5A7QA 1TZOA 2CSGA 2E7TA 3NV4A 4JVAA 3NNJA 5CZKA 4AL9A 1JN2P 5FUPA 2PHUA 2YHJA 2HWF2 4PIZA 3FJSA 2HJIA 4Z07A 3PL0A 2VTFA 5DXDA 3T2OA 1DG6A 1MZ5A 3WQ1A 1BQPA 4AYUA 5A3UA 1BJQA 1GOGA 3AB0A 4Q2FA 3U4XA 3TEYA 3ZX7A 1S0FA 2GH8A 2WO1A 5FPZA 5CFCB 3ILRA 1DQ6A 2JDHA 2IXKA 4PIYA 4AFDA 4KI5M 5CKQA 2WQ8A 3CHXA 3ZR6A 1BK0A 1GNZA 1QQP3 1UOBA 4FPEA 1Y9MA 4YLZA 5FZDA 3C7HA 4BM8A 3UL2A 5JSPA 1IS3A 1YFYA 3HIFA 1JYXA 2ZS6B 3RWNA 5KR7A 2R6QA 2BGOA 4GQ7A 4H3WA 1H8TC 2LW8A 2WWSA 4CP9B 5D21A 1OH3A 4NN0A 4JX0A 1SCSA 3RZKA 3CJIA 2N7GA 4UF0A 3UETA 3ZFFB 4P5HA 1NQJA 2D97A 2I07B 3ALQA 3FUQA 3LKJA 4PBPA 4TN7A 5FWEA 3GHNA 1OQ1A 4NPLA 5JPMB 3W9AA 1RB8G 4Q0QA 4QWNA 5JAXA 1SLLA 4FPOB 2RE9A 4R9BA 4J1WA 4LTAA 1FMD3 4D6SA 5JI7A 4LUMA 3LWCA 2ZGKA 4FTEA 3T3YA 4WM7B 4BIFA 1WD3A 3QACA 4UT5A 1XU1A 1IS6A 1VIWB 4ISQA 2VXJA 3JD73 2ZJCA 2HYXA 4IESA 4YM1A 5IATA 4A7KA 1LHNA 4O9GA 1BZWA 1W99A 4XAEA 4IEWA 4HXCA 1UPIA 2JKBA 2J1VA 3B9CA 3KGLA 4MXVA 2XJPA 4BLIA 2WA3A 1LODA 3MPPG 2PQQA 3WQ7A 4Q4W1 5EYYA 1OA2A 4TYSA 1QU0A 5F9TA 3AXDA 3WLUA 2VH9A 1BCXA 2IFRA 4K8FA 1D0HA 4RGKA 5DG1A 2R1BA 2V09A 1OD3A 3NMBA 4LO8A 1ZRDA 3ZYFA 5T52A 3QOPA 1Y43B 3MDPA 1HXS1 2WR9A 4OHXA 4GA9A 3B5LB 2EXKA 5L7OB 1JTZX 1KXGA 3LDKA 2YXSA 4IE0A 2DCZA 3CKHA 4XJ8A 4JGZA 4WZFA 4RHV2 4BCUA 1MACA 4AE2A 1HN1A 2E6VA 3VHPA 3MICA 1HKDA 1QXPA 4NOTA 4QGLA 2ERFA 2C26A 3W5NA 3RZHA 4MXWB 1LRHA 1DBNA 4QDQA 3U37A 5GZFA 4Y1YA 3HQUA 2VNOA 1AZDA 1LGBA 2VQ0A 1O8PA 2A6ZA 2XJUA 5TSWA 4Q4W3 3H0OA 1WUVA 4QKNA 3KQ4B 3AYDA 1T2XA 3P3PA 4W6YA 3A7QA 3TWIA 1QJX1 2RHPA 1ND3C 2DU0A 2VMHA 3DN7A 1US3A 4H7LA 4L9BA 4LHNA 1UZ0A 5IVEA 1RUG2 1DQ0A 1P8JA 3AP9A 5IAVA 3AP6A 3H9AA 5BNQA 4AEJA 1X33A 4CCOA 2Y26A 3V0BA 1H4HA 1OKQA 4Y20B 5JZGB 2VQAA 2BFUS 5FYMA 3GDBA 4QDRA 1WLWA 1Y9GA 5FMBA 2XVGA 3WINE 1F2NA 3ZXAC 3WNNA 3BALA 4YVSA 4A45A 1X7NA 5T50A 5DQ0A 2CDPA 2DU1A 1SFNA 1JZ4A 2BGPA 5DAPA 5JXGA 5GKAC 3AP7A 3S30A 2VBDA 4QB2A 3FBMA 4DUVA 5LA1A 2NYYA 4D8MA 4RGGA 2EIGA 3N9OA 1PK6B 2ES3A 5L9BA 3UT0A 4XDPA 1FNYA 1REDA 2FDIA 1B35C 3U75A 4YFZA 3LOBA 4UFJA 4BOWA 2Y6LA 4PT6A 1ST8A 4QQLA 3RPQA 1QQP1 1WA4A 5FZAA 4OMDA 4A6SA 4COVA 1XYPA 2CWSA 4YGBA 1RUC3 4XPVA 5FLJA 1IG0A 2A70A 2R071 4BH9A 3VUOA 4TTGA 4N53C 1OFNA 4S2HA 4B29A 1W9YA 1ULPA 2EIDA 3MUY1 3VBUB 1PVXA 4COUA 4ARXA 1V6NA 4Q26A 4YZ3A 3PIJA 4IW3A 3PUQA 4L97A 3TEXA 2BOJA 4QMAA 4UYBA 1QJY2 5B4XA 3VDDA 1QJU2 1RVF3 3JZVA 4I0BA 4AFCA 3ZFGB 4C91A 1W3XA 5A7SA 1VRBA 4IV1B 2VUCA 1JZ8A 3N9PA 5G05L 4CDXA 2JE7A 3GJAA 5J36A 1W28A 2YUEA 4ZU4A 4LOTA 1REEA 4WVZA 1UXZA 4RS5A 1V6LA 3BKZA 3WQBA 4PHZA 2ZXQA 4QXHA 3DV8A 3DKQA 1G86A 3NRUA 2OQ7A 3RNSA 2OUHA 5ABJB 4BMBA 5I0SA 1GZCA 2D40A 3MEPA 2ILMA 5C9AA 4YWAA 1LU1A 1UU5A 2GC3A 1OPMA 1RUH2 2BBAA 2YFUA 3B9IA 4IERA 4P08A 4XCAA 2EXJA 3SQOA 5DMYA 3U14A 1L3JA 5JMCA 4NIDA 4UFIA 3RYRA 3UV9A 3VZJA 1VBC1 4G9SB 3TEZA 2Q1ZB 1G9DA 1U5ZA 1XNCA 5FLIA 2SBAA 4LBJA 5JI9A 4OVEA 3THCA 4OCTA 3CEWA 2XPJA 1PIV1 4LO6B 3RJRA 2WNEA 5A1FA 4AVBA 2UWAA 5FY0A 4EN8B 5FZFA 3VKOA 3I2HA 2RV9A 2LTNA 2ZX2A 2YBKA 4FT8A 1C5HA 1PZ8A 4DEVA 2D3PA 3PU3A 4AI0A 5FXWA 5T5PA 3LEGA 1OA3A 2ID4A 1SEFA 1XPWA 4R9DA 4XCBA 2Q1MA 4HN1A 3VHNA 4JGZC 2WZ8A 2ZCWA 4KQ7A 4OFGA 2VW0A 1MQTB 5ACA1 3FUOA 4MLOA 1GUIA 4TSVA 4E4ZA 5C5UA 2BFUL 4AVAA 1TME3 3WDUA 4D69A 1TE1B 3WNKA 1YFXA 2IC1A 1S4CA 1K42A 4ET7A 2NZ9A 3J7MA 4CP2A 1POV3 2XBO1 5CU1A 1C1LA 1OUSA 2WN3A 4P00B 4QGMA 5FXZA 4M3CB 1BBT3 3AL5A 1K12A 1L7LA 1UZZA 1XYNA 4RGAA 4CYDA 1SBDA 4WM8B 4BB3A 1NLSA 3E5UA 5GLVA 3N4MA 1CIYA 1JU4A 5E6HA 3AYAA 4BQWA 3MLKA 3VBRC 4DINB 1UX6A 3M3IA 3WF0A 3JBG3 1R081 2W68A 5C8CB 2E9QA 4CEWA 3FC0A 1N1SA 3B69A 1HB3A 1W8NA 2F4PA 2HWB2 3L9JT 2A3XA 4CTEA 3VBRA 2VVFA 4I3PA 4UW4A 1YHFA 3LEIA 5LRRA 3E6DA 1W39A 3VL8A 5KHGA 1ZYBA 5JCTA 1XE8A 3JBG2 4OULA 3ACHA 4QU2A 2VAUA 1G9FA 4LBQD 3VDDC 1JYWA 5FP4A 3DXUA 5CA6A 1GANA 1CR7A 4AG4A 1PGW2 1Y7BA 1UXXX 2RDRA 3K48A 4LHKA 3I49A 1PIV3 3ZSMA 1PVC1 4LBLA 3KT4A 3MIHA 1KS5A 3BTYA 1YJKA 5FZKA 4QT6A 4OUMA 4AEDC 3MZHA 4YZ1A 5I91A 1XXNA 4U36A 2PHXA 1RUF1 2RS13 1W8OA 3Q8AA 4XUNA 3OPZA 4YRDA 1V6KA 5B4NA 3ASIA 2BP6A 3WDYA 5GALA 1VBB2 2D6LX 4XMAA 1UOGA 3CJIC 4UBHA 5FJHA 1DQ2A 1QJY3 3AK0A 3ETPA 4XFAA 1JZ2A 3MW3A 4COYA 2AZ5A 2VOVA 4P9YA 3SEEA 1UYXA 1UU6A 2PHWA 3UGGA 2HEVF 5I93A 4GXLA 2QQNA 1PK6C 3IDAA 2RDQA 3J8F3 5JZGA 1CAXB 2MEV2 3HQXA 3U0ZA 2PMWB 4B4PA 3K46A 1BVVA 1GU3A 3K3OA 2GNMA 1VBA1 2QCSB 1UU4A 3K75B 3NV3A 1YC61 5FKCA 4A6OA 2JDUA 4CDWA 1VMFA 3FLRA 5C3RA 1I5PA 5A7OA 2WJSA 4Q8KA 1ULGA 3NJXA 4EZ4A 4UW5A 4RFT0 2ZKLA 3KF3A 5CB7A 3V64A 4ZXEA 1RHI1 4XABA 1SBEA 2PHFA 3E1F1 4MXWA 4QM9A 1UL9A 4IEQA 1AR73 3OGVA 4Y1VA 2Z2SB 2QZ2A 3NSTA 4UFMA 5E8AA 4YW6A 1U0AA 1ULCA 4FPYA 2DTWA 3HQRA 1LULA 1ULFA 3E5QA 4BQ3A 1VBD3 5A6XA 5FPXA 5F37A 2WZR3 3ATGA 3FHAA 4OUEA 3MF9A 4XE9A 4ZZ8A 2GC1A 3NL1A 3JQWA 1R1A3 2E32A 1W0NA 1UPSA 3USSA 2TEPA 1F35A 2I74A 1T6GC 3SNMA 3W21A 5LA0A 1QGLA 4O65A 1W06A 5FZOB 1RUF2 2R061 2OPKA 2YBPA 3JU9A 5CNAA 2VE1A 4KWJA 3T1LA 1FOD2 3MFAA 2CGPA 3ZXFA 4U2AA 1VRH3 1W2UA 3SH4A 4KBZA 1QJEA 1W6NA 1OMIA 1Q43A 2XLAA 3AZYA 3VD5A 2YU1A 3A22A 4JGZB 4JZRA 5DAXA 5F8PA 1UKRA 4XFGA 2G9GA 5FOBB 1GSLA 2ZTNA 2VUJA 4A44A 3LIHA 2PAKA 4X8NA 4XACA 1B09A 3WNPA 2RM21 4GB33 3VBFC 2RM22 5KWRA 1QH7A 3L2HA 2W39A 1GQHA 1PX3A 2J22A 1B35B 1HQLA 1RUE1 1VAKA 4FOQA 4FOWA 3ZYBA 3MIEA 1OF4A 1K5JA 2ZHNA 2RMU2 5IVCA 1JMUB 3D6EA 5EJ3A 2A6WA 3M8LA 4BPZA 1ENXA 4FFFA 4LO7A 1S0EA 3DEMA 2Z79A 3A23A 1DHKB 2BERA 3J7LA 1CAVA 2UWCA 2YROA 4RQPC 5FIXA 4MOAA 3WF1A 1KITA 4EYUA 2WT2A 4Y3OA 2UU8A 4B7EA 1HV1A 4ISRA 1ND3A 1OH4A 1TMF3 1CONA 1C1FA 1E5RA 2CYFA 2IXJA 5LK5A 5DZGA 4OI0A 3PMEA 2RR12 3PUIA 2ZX1A 1GBGA 3CZJA 5J48A 3OSDA 4YSFA 4D3WA 1A6CA 1VP6A 4YG0A 5KHKA 1AXYA 4GWIA 4D0QA 3CBNA 1AVBA 4A42A 4KMQA 5I8SA 4NIGA 3GNEA 4EWDA 5LBEA 1XJAA 5G04L 4ONUA 5FZ9A 2WLPA 3WF2A 4Q4Y2 2R30A 5FAXA 2VL4A 1EAH3 3BYWA 4QM8A 5FY9A 5H9SA 4AEDB 1Z78A 1XNKA 2J1AA 1ZRCA 4Q5OA 5KXDA 3VBOA 2OW4A 3VGIA 1UZYA 4HT1T 5D8AA 2NM1A 3Q8BA 1J3PA 4S2FA 1EP0A 4Y22A 4YYOA 2Q8CA 3IBMA 3WDTA 1LU2A 2RG4A 1JI6A 4LUKA 3R05A 2D3SA 1Q8OA 1QQP2 2ZMLA 4CCDA 2XBO2 1WCSA 3MHZA 1BK1A 2RMU1 4RYDA 2NQYA 5DDJ2 1PGW1 3N7KA 4P9JA 5EYXA 5C3SA 5F3CA 5HCAA 1RMU2 2PHDA 4Y33A 4FI9A 1QIQA 3N9LA 3D3AA 5F32A 1S0DA 2C6SA 2A7AA 3ETQA 2Z4FA 5ACA2 3CMGA 1DFQA 1OBNA 2V5YA 4GMP3 4I0WB 2VTXJ 4GALA 1H0BA 2HWF3 2IZWA 1NY71 4A41A 4LBQA 4LKFA 4HKWA 5FMOS 3O1UA 2RVAA 4CSWA 2D7FA 1YLLA 2ARAA 2QQVA 3RVHA 4R4ZA 2PXJA 3USUB 3VKFC 4EJRA 2K2SA 1AJKA 5F39A 1J3RA 2P1BA 5FP7A 4O61A 4Y1XA 4BQYA 1XE7A 1NG0A 5BV6A 4ARYA 3ZOIA 3I3BA 4ITCA 1RTVA 1FV2A 4N8MA 2DVAA 4D6RA 1AHSA 2RS33 2W1WA 1F8VA 2Y34A 4Q4V3 2ZACA 1AR72 5CG9A 4RR3B 4P9IA 5FR3A 3PNAA 3TN92 2RR13 2W0XA 1AR61 2XR4A 4SLIA 2XJQA 1RJ8A 1BLZA 3HNYM 4K7JA 3GZEA 4MGQA 3IKWA 3OCPA 1MQTA 2Q4SA 5HCHA 2H6BA 3DGTA 4Z1VA 4FAHA 1MEC1 2BDRA 2VGDA 2FBEA 1J84A 1ZBE1 4NHLA 1GLHA 1D4M3 1W8UA 1JXNA 2R041 2P6HA 1URXA 3CJIB 3H8UA 4R9CA 4YG6A 3POFA 4R8HA 4CDQB 3OBAA 3INAA 1MPXA 2WIIB 5JZGC 3M3EA 5CFDA 4YGDA 5LW9A 1BXHA 1O7FA 2RM23 4XJZA 2WL1A 4AOCA 3ILFA 3O1TA 2J42A 4Q4W2 3H3ZA 2E63A 3RYPA 4IQPA 1QJU3 5F2WA 5B2GB 2WSVA 1D2SA 1F5JA 1EPZA 1VB2A 5HXVA 1ZRRA 1J1LA 3VKNA 2Y6JA 4RA0A 5JLVA 1VE0A 2L9LA 3AFGA 1I6XA 1YQ6A 4MUVA 2EXHA 3WP3A 3C7GA 1QJU1 1I9RA 5A3MA 5FUIA 2IFWA 4CDUB 3OGJA 3O1MA 1PM4A 1UYYA 4OLLA 1CGPA 1ULDA 4IE5A 3GALA 5DABA 2WO3A 1ASJ1 3OPWA 4LITA 3ZO0B 5L7OC 2KM2A 1H4GA 3WF4A 1GYKA 2XONA 3IAQA 4FFIA 4XFHA 5F5QA 5L36A 4M01A 4DB5A 3VB9A 2YYOA 2YU2A 1NKGA 1ZBE3 3QLQA 4LK7A 1PZ9A 4N9IA 5DDJ3 2BEOA 1A78A 1VBC3 2BU9A 2TUNA 2P3JA 3IIAA 3I3EA 3ZFEC 4FAGA 2HEWF 1YWKA 1RHI3 3AMPA 2WZEA 2OA2A 3R4UA 4ZKTB 4DUWA 1TQ5A 2EICA 1D4M1 2XJVA 2W46A 4YM3A 4ZPIA 1AR83 1ENSA 5K0UA 2ZEYA 1VBE1 2DCKA 4QX2A 3H8RA 4E4HA 2GH2A 4I30A 3U07A 3NQHA 4FP2A 1IG3A 4HN0A 5KXEA 3S0MA 4DY5A 4JDOA 1W03A 4FPFA 4C1WA 3OYWB 3AKTA 4YGEA 2GSYA 1R1ZA 3LD8A 4JGYC 4LIVA 1AX0A 1FAYA 1HV0A 4XUPA 3ACGA 3T4VA 2CL2A 3TAYA 1PGL1 4P02B 3H7JA 1CAUB 4QDSA 3VBFB 4YM0A 1K45A 3AZZA 4XBNA 4Y20A 5JR2A 2XQRA 2Q1FA 3GYDA 2OIIA 1RUJ2 5T54A 4I0AA 1VB4A 3AMQA 2DVFA 1DQ1A 1GNHA 3CZUA 4QXKA 5FYTA 4KU7A 1UF2C 4Y22B 1EY2A 2WZR1 3IZOA 3QH6A 2ZKNA 4EWAA 5JIUA 4HPKA 4W50A 4M0HA 4XVHA 1JYTA 4ES8A 3M70A 4UWDA 3JXSA 1OC1A 4RHV3 4FXGB 3NJVA 2JDMA 5ANNA 1MVEA 1WCKA 4FPHA 5DZEA 4EN7B 1JYNA 3BODA 1AL23 1MS3A 1IKQA 4H7MA 3I3DA 4IE4A 2OXBA 2JWPA 4CPBD 2FDKA 2C4XA 5FY4A 2A5ZA 5EJ1B 3BIWE 3GXUA 1DYOA 5J3UA 3EBRA 4RN5A 2O1QA 1S1AA 2DTYA 3AKPA 3DYPA 1FYUA 1LESA 3RRDA 3T0DA 4BXSV 3VBOC 1HB4A 1S55A 2W9XA 5T55A 5FZ3A 5DN2A 5E16A 2UYAA 1PO11 1MZEA 2VCAA 1AYM3 1LOCA 1PZ7A 4KU8A 5C6CA 1DYKA 4EV0A 1YI7A 1EUUA 1W90A 5LA9A 3ZR5A 1PO21 1FV3A 4YZ4A 4OI2A 5IVJA 1ZZ6A 1ZRIA 1BBT1 1V9U2 4PIXA 3ZDVA 4OHVA 1QJY1 4AVSA 3KCYA 4NUBA 5EV7A 3BB6A 4HOOA 4XETA 1PVC2 4Y5TA 1SMVA 1RJ7A 1DGWA 1UY0A 2GDFA 3HOBA 4KNCA 2GP5A 4CP9A 3GHMA 4BK4A 2RS11 2R49A 2JXAA 3KMHA 5L19A 3AX4A 4QB6A 1IHMA 1XOYA 1WW4A 1PVC3 1YUDA 2DVDA 5JIAA 2PHLA 4Q1RA 1PO22 4GWMA 5FDBA 1RIRA 1VBE3 1ZA7A 1UIJA 2VZSA 3VBHC 4RQPA 4Q4X1 5K7PA 3CDZB 2WINB 1WD4A 1M4WA 1LKNA 2OS2A 1LOAA 1RUE3 2Q0AA 1DGWX 3NNGA 4EQVA 4F3JA 1V00A 2J1EA 3WG4A 3ZMNA 2WC2A 4P9WA 3I2GA 3KHCA 5BNOC 5I8YA 4JKMA 1PHMA 1L7QA 4LNVA 5ERLA 1EV12 3TEWA 2ZPXA 1N3PA 2DBIA 2ZAAA 2PHTA 4NHMA 1TEIA 3PUAA 3ZN6A 5IAXA 3N36A 1N1TA 4KH9A 5BNOA 2E53A 4DIQA 3C2UA 3VV1A 2YV8A 4UFLA 4Y5SA 4WVMA 2BUKA 2C0ZA 3EXUA 1ZBE2 1W6MA 3THTA 4YVWC 3UYJA 5EWSA 1XE0A 3DKWA 1KJLA 1HB1A 1PMIA 4BHPA 3VBFA 2ATFA 5FPVA 1SBFA 5L7OA 1VBB3 4E27A 5AC92 5JOWA 2CDOA 4MO3M 1MS9A 1ZZ8A 2QQKA 2B46X 1AX1A 3OBRA 1DQ5A 4LQRA 1V70A 3ZYGA 4DQAA 1VRH1 3BGAA 4INDA 5HBAA 1QF3A 2VMEA 5DZFA 4NRPA 4X6RB 3N9QA 3SKVA 4NWWA 2P3KA 1VBD2 4AI8A 2XG3A 1AUYA 4IGQA 1HQNA 3VL9A 4KWUA 4DUXA 2C24A 1S0GA 1W8HA 4K20A 2D6MA 5BNNA 1EYBA 5EIYB 1HJGA 2GC0A 3NNLA 5LB6A 4DFSA 1LOBA 2VZRA 4OZOA 1O4TA 1ULEA 3GBWA 1NCRC 2JICA 3A0KA 1SHWB 4ZY9A 2BGCA 3OF1A 5FZEA 1KD7A 1UNBA 3FFZA 2F6BA 4XFBA 1L7RA 2P5BA 4LJHA 4K9SA 4OHYA 1G9BA 3VD7A 4Q1PA 3NJYA 4HSLA 1MR5A 2XUMA 1U5IA 2FDGA 5T5JA 1N1VA 4HLTA 4FBFA 5CKNA 1LHWA 1COV2 2FMDA 3O0VA 4K40A 4FO9A 4HKOA 2WT0A 4N43A 4CUGA 3I59B 2NP0A 4RHV1 4NHYA 1FMD2 3AKQA 3LEKA 5JWPA 2VMGA 1JHNA 3POBA 3GZUC 5EXOA 1LHVA 5LY2A 5FLHA 3TYJA 5GZEA 4OHZA 2P3IA 2Q5TA 3FLTA 5FZ8A 2BNMA 1TG7A 1J3QA 4CEYC 4XFIA 4HG6B 2WQ4A 3WP4A 3ON7A 2R32A 3O1SA 2Y8KA 3WNOA 1HRV2 4Q0VA 4AFBA 4M0NA 2RJ2A 4GWNA 5A6QA 4A2UA 2XQXA 1OLMA 4CDWB 1ZVFA 4QHBA 3URFA 3A4UA 1FPN1 3LDRA 2XUEA 2QDRA 4CU7A 3AMHA 5A1AA 1DLCA 3KV5A 5F6LB 1R1A2 3I3MA 3V0BB 2A73B 2B39A 1TMF1 4IETA 4CUCA 4LO4B 1V9U3 5GLUA 2W94A 4A7ZA 3GGLA 4L0PA 4ZXKA 3AKRA 1H2KA 5BY5A 1IPSA 2ETEA 1REFA 2ZX0A 3FE5A 1YIFA 3OY8A 4RS5B 4ZONA 5IJRA 4YW5A 3ROUA 1UQXA 2XL7A 5F1RA 3N7MA 1A3KA 1QOSA 4D94A 5T5LA 3NKGA 2NMNA 4Q8LA 5FYHA 2VD7A 3WF3A 1RL3A 1NCQC 2BWCA 4KGGA 4NIAA 4XF4A 1YJLA 1ND2A 1RUG1 1CAUA 4PI2A 2CGOA 1DGRN 3OGGA 1WW7A 1KFXL 1D4M2 3MIGA 3GZTB 4IGOA 4LE3A 4XJWA 5FZ4A 2F4LA 4FQ4A 1BYHA 4QKBA 4A3XA 5C4WB 1IKPA 4NJ4A 1R093 1XSRA 2G9FA 1CPMA 2WWJA 3G7DA 3H42B 2DUPA 1POV1 2XBO3 3O12A 4YVWA 3ZPYA 1NLRA 1I5ZA 2WFF1 1EAH2 1NLQA 3LSEA 5A3TA 2ZZJA 4DY3A 1NZIA 2DCYA 2VW2A 2UY9A 4HPKB 2HWE1 2XHNA 3N7JA 4DEQA 3V0AA 1YQ2A 2HEYF 1QXRA 3AKSA 3S7EA 3JB4C 3UNPA 1MS0A 1TVGA 1RUI3 4JKLA 2WUHA 4XUOA 2RS51 4RL7A 2HH9A 4WM8C 1KDMA 4YVWB 4COZA 1JZ7A 3WDXA 1HXS2 1RGSA 1VALA 3POEA 4XW3A 2PAEA 2XDVA 1JOBA 4JTOA 4YVSB 3D82A 4BJ0A 1W2TA 1MVQA 3ZSEA 1WCDJ 3OYWA 1WMEA 4XF1A 3WCRA 1V6OA 4XF9A 5L9VA 3PJYA 5EP9A 3OPTA
chains in the Genus database with same CATH topology
4LLFA 3PVOA 1RUH3 1C8M2 4C0HA 2B7YA 4FXKB 1X8EA 1GQGA 2JG8C 4GB32 4PDWC 4O9EA 2IXIA 4LA3A 4QPGC 4UBGA 4YNIA 3WDVA 1JBCA 2DVBA 2CWMA 1YNAA 2FQPA 4AQ2A 4AVTA 1AYN1 4UW6A 5E89A 2D6NA 1RVF1 2B5HA 5BNNC 3H1MA 4CDXC 5HCFA 3POSA 4E2QA 4D69A 1BBT2 1UKGA 2RJKA 1NCRA 4JAAA 2VNGA 3DL3A 4BE3A 4Q4Y1 3WXPA 1M06G 3O5SA 2TBVA 1TME2 1MZFA 1CESA 5BNNB 3THPA 1RUF3 3M3OA 4HVOA 4AHZA 2SLIA 4KBBA 3LOIA 4LR4A 2VECA 3NV2A 2HWD2 2AREA 5CG8A 3VHOA 1AXKA 3WUCA 1J1TA 2P37A 1NQDA 3ACLA 2XLGA 3O7OA 3FZ3A 1OD5A 2GU9A 2HWF1 1OFSA 5GLTA 2DFBA 4N53B 4FPCA 3KT1A 1VBA3 1PNFA 3V56A 3JBG1 3AJZA 4BMEA 2WQZC 2RMU3 1K5MC 3AZXA 3FFQA 4AXOA 4E2GA 5C33A 2YY1A 1V6IA 1APNA 1VAVA 4Q4V2 1O91A 1HLCA 5A32B 4N9HA 1R082 1O4ZA 1HRV1 3FMGA 4K6BA 1DQ4A 3DPRB 5DUXA 4Y4YA 3TNPB 2MEV3 3BTAA 3LSDA 4SBVA 2VNRA 1WLTA 2IWGB 1D2QA 2BVBA 2A3YA 4W65A 1FOD1 3BOPA 3NWKA 4WM8A 4XQ4A 3AFKA 4HKLA 2IXHA 2VULA 4WVMB 2JJ6A 1ZZCA 3WW3A 1N3OA 1JUIA 3BCWA 5H9PA 5J7MA 1OOPC 4Q4X3 2PTMA 5JR7B 3ZXJA 4PCRA 4AEDA 4AK3A 3D5OA 4I2OA 1H1MA 1C4RA 4B8EA 2IXCA 2Q8OA 4BQ1A 5GM0A 4JQRA 5LRSA 4YZ2A 2D98A 4YFWA 4N7UA 5CVRA 2WZPP 4MGYE 1AR92 3ZYIB 1BEV2 3JD71 2D5FA 4YW4A 1PO23 3VBUC 1H30A 1UAIA 3ILNA 2MEV1 1AR62 2WNVC 4NPRA 4AHXA 1R091 3CL1A 2JENA 1KRIA 1ZNPA 2DV9A 3AZVA 2HWB1 1QY4A 4YG3A 3CF6E 2R063 3H1WA 2EAAA 1Q8SA 2OVUA 4K21A 2WNVB 1HRI2 2FMYA 3V65A 3WY6A 4CDXB 2ZMKA 2R062 3IDBB 4EN0A 4MZUA 2HWC2 1AXZA 2NN8A 4CEYA 2XVKA 2ZOEB 5A3LA 3RZZA 4FOVA 1NY72 3VBHA 1MS8A 4E9KA 1H8VA 1O3RA 5I0RA 1LOFC 1GICA 1G9CA 3V0AB 1NA1B 4LBNA 3AMNA 3ZYRA 3I2DA 1PK6A 5IUQA 5BYNA 1A8MA 4KL1A 1KQRA 3DPRA 4XHBA 2XKOA 3AP5A 3USUA 5T3NA 2AYHA 3HD8B 1AL0G 4PLMA 5CAZA 4I09A 4LBQB 4LBKA 5D8AC 1NA1A 1SACA 4F8AA 1LR5A 5KXCA 3ZIWA 1GZWB 3NJZA 3QH7A 3ZN5A 3EQEA 4Y1UA 1RUH1 2GN7A 4DMIA 1U5YA 1H2NA 1IOAA 1EPWA 4TLFA 5KHJA 1DLLA 1QNWA 4ASMB 5D8AB 4IEOA 3AM2A 2WSUA 2BVVA 5C8CC 4B7KA 2CV6A 4QD2A 3WW1A 3EJKA 4BA6A 1W6QA 1YIPA 1QDCA 5CFDC 1QNYA 4S2GA 1OA4A 4LLOA 4XIOA 4WVWA 3ZIXA 3IWZA 3VZMA 3WG1A 4FCAA 1UIKA 3UJOA 4MX3A 3D0JA 2PYTA 2NMOA 1LB2A 1FX5A 4XQWA 2GN3A 4AI3A 1QJX2 3KLSA 5CFDB 3JQXA 1COV1 1ONAA 3R4DB 1G8WA 2WFF3 2QKDA 4HBNA 4CDQA 4HK9A 1F31A 3E6CC 4AGRA 2ZHMA 3I54A 2HWE3 2NPIA 2ZABA 4AWDA 1ZM1A 1DU3D 2UY8A 4LULA 1U5XA 1IS4A 5GLZA 2BBVA 3C3VA 3S7IA 4XIKA 3RMXA 3AXEA 1WGPA 1G9AA 2HWD3 5I8TA 1Q8QA 2Q30A 1OPOA 4B3NA 4F7ZA 3WX5A 1C3HA 3HAGA 3HWJA 4YM2A 4CEYB 1A8DA 2V73A 3SITA 4WZCA 1NYWA 4A7YA 2UWBA 4CDUA 4Y5Z0 1FPN3 4FPKA 4Q4V1 4AQ6A 1XNDA 1E57A 1MZ6A 2BQPA 1LEMA 2PFWA 1HQWA 4XZPA 1H8TB 5KXBA 1X82A 2JDZA 3O14A 4Y26A 1O3TA 5FCCA 2VOXA 3IN9A 1K5MA 2ZAHA 2VPVA 3WNXA 4P9GA 1QJZA 2O0OA 4M3CE 2GZWA 4QQOA 4AHWA 2X8KA 4C0BA 1EV11 4G3YC 4N7IA 4QGNA 4XILA 2HYKA 1OHFA 5H9QA 1LGCA 1DZRA 1NA1C 1AYM1 2XJSA 3E5XA 3I4IA 4M3CA 1S0CA 1HRV3 2JX9A 5KC6A 4R9AA 3J8F2 5BUVA 3ZN6B 3OD4A 4QPGA 2RS32 5IK8A 3VBSA 2GMPA 2X5IA 3TNQA 2K9ZA 5E88A 4YW2A 1YRZA 1RUJ1 4HZFA 4J6GA 5LEKA 2WFPA 3M3QA 3RDIA 1I1EA 4AI2A 1AL21 2AR6A 1CAXA 1KS4A 1H9WA 2VG9A 4I02A 5BNPB 2XLFA 3VBRB 3M4FA 4EWEA 4AQTA 4DRVA 4RD7A 5IK7A 2XHKA 4LE4A 2ZGQA 1NE4A 2Y38A 3D4KA 4PDWA 3CU7A 3AP4A 3TOJA 4HK8A 2YDEA 3AMMA 2B8MA 4L8QA 1NZCA 2JECA 1X36A 3A0NA 3IPVA 3WOGA 3WD5A 4QQPA 5JSRA 2P2KA 2Z5WA 1VAMA 5FMOL 1C8M1 2JEMA 2YGMA 4BLJA 2D93A 3MIFA 1CAVB 2HWB3 3PJQA 4CEWC 1FPN2 4Z82A 4YVSC 3WVJA 1NOVA 5I0TA 1W0PA 4OI1A 1W6PA 2WNVA 1HW5A 2WS91 4I3GA 1BVP1 2QE3A 3BU7A 4XYXA 1ASJ2 5DUWA 4YW1A 3B94A 4LHLA 4DRRA 1RVF2 5AFBA 2B42B 3H50A 1QXJA 2W52A 4L2NA 4N43C 3WHTA 2PHRA 3SMHA 4CEWB 2R042 4MGZE 4YZ5A 1DZQA 1HRI1 5DUUA 3UKNA 2WLQA 1HX6A 3VBHB 4Q0PA 3M7AA 1IGOA 3VBUA 3UKTA 1VJ2A 2JD4A 1SLAA 5CIRA 2HWE2 1BKZA 2MPFA 2GNTA 2G4IA 2W08A 2DFCA 4GH4B 1FXZA 3TRSB 3HT2A 2GALA 2WFF2 1AR82 1YFWA 2CY6A 1Q3EA 1FT9A 2Z42A 4E4DX 2DURA 4KG8A 1H1IA 1CD3G 4QPIB 1LGNA 3IMNA 2RS53 3CJXA 2YC0A 5GZDA 5GZGA 4JV4A 2D6PA 3ZXGA 4HSJA 1ZREA 2PELA 1ZRFA 4HMZA 1JW6A 2NLRA 5C9AB 4JRLA 1GZWA 2HWD1 3TB0A 4AGVA 2X29A 3AJYA 3MF6A 4IV3C 1DDLA 1VBD1 2ARBA 1HDKA 2YMZA 5JSOA 3Q9OA 4EN9B 1WLCA 1WW5A 1AR71 2JE9A 5FFOC 2QQPA 1RUG3 2EA7A 3VZLA 5AC91 1QKQA 1WBFA 1MS1A 4RR3C 1XU2A 1W6QB 1ZX5A 3PVBB 5H9RA 3WCSA 3M1HA 2ENRA 1RINA 2X53S 1TNRA 2XKPA 2ZX3A 4URTA 4XF0A 2X5IC 2DF7A 4CDQC 4R4XA 2JG9B 2ZGLA 1NE6A 4JGYB 1V9U1 4ASLA 1UMZA 1XNBA 3HT1A 5I0UA 1CPNA 4HANA 4CZSA 1O3SA 1ZBA1 2WZR2 2DVGA 3MIBA 2I45A 1FNZA 1DGLA 2R1DA 4NHKA 5IK4A 4K1YA 3RJ2X 3X29B 2VMIA 2VVEA 3D0SA 4WBBA 3IT8A 2A6XA 2K0GA 2QNKA 2O8QA 3ES4A 3VBSC 5C8CA 3KM5A 4QPYA 3U10A 1BEV1 1CAWB 1SLTA 2XWBB 3JD72 5A33A 4NWVA 3MFCA 3ZFGC 1VR3A 3WDWA 1QH6A 3ZMOA 5JOYA 3PTYA 5J98B 2RS52 4FP3A 4Q0SA 2O8OA 1XRUA 1IPJA 3AYCA 2ET1A 5C4WA 2AGSA 4XJAA 1AYN3 1SQ4A 1ALYA 4CDUC 1IPKA 2AH2A 5J96B 3ZYPA 2HWC3 2E7QA 2TNFA 3SCHA 2VUAA 4XJ9A 4C90A 3RYKA 5SV5A 3M3CA 1LHUA 4ZU7A 2QJVA 3TN91 5A33B 3TBDA 4XXPA 3VHRA 3ES1A 3KT7A 3O0WA 1ZZ7A 3ZFFA 3JCIA 2D44A 1ASJ3 2GMEA 1K5MB 3EO6A 1PGL2 3KCCA 1W6OB 1ZZ9A 2RS12 2VOWA 3UKVA 5J37A 3WZ1A 3LA3A 2IXLA 5L73A 3VKLA 3OY8B 3GBGA 3WP5A 1S0JA 3MW2A 4COWA 1BMV1 1RMU3 3I8TA 1LOEA 3DUIA 3MIDA 1C57A 1W6MB 3WW2A 1AX2A 1J58A 4P9XA 4AFAA 2WS92 3WG3A 1AR93 3ENRA 5ACA3 1RUI1 1Z7S2 3I59A 1X8MA 2OUJA 4IV3A 5K9YA 2DCJA 3NVCA 4GKXA 4Q4X2 1CVNA 4IEUA 3AYEA 4NVPA 1VBB1 2A6YA 4K3UA 4E4SA 4FTSA 5C9AC 4TZDA 2XL9A 3E97A 1Q8VA 4IV3B 3MLLA 1MEC3 1OQDA 1S0IA 3CNAA 1GZ9A 4PDWB 2AUYA 2D3RA 4GB31 4UXAA 1ND2C 5FO9B 5BXXA 2ZGOA 1YFUA 2LM3A 3PHMA 2ZHKA 3WHUA 3VDDB 3IDEA 4GULA 5EZWA 2ZBJA 1PO12 2XJRA 1OSGA 4N43B 3KD4A 3VBOB 2RR11 4JTNA 3WR0A 2A6VA 2X5IB 4ORFA 3NAPA 3MLJA 1Y3TA 2C5DA 1BEV3 2ZGMA 4AGGA 4KGQA 5DUVA 1RUC1 2DCTA 3BPZA 4IEVA 3KQRA 4XHXA 3SISA 1CIWA 3ZXDA 5JOZA 4LA2A 5FO7B 4GKYA 1GKBA 1U12A 1VRH2 2CAUA 2GAUA 1UD1A 3NKTA 2ARXA 1OLQA 1JOJA 1SLIA 1DF0A 4XTPA 1KDKA 4PLNA 4LT5A 3ZYJB 1V6JA 4AVVA 3QCWA 3JUUA 2WKKA 1H2MA 4XFFA 4IXLA 5FQ0A 1KFUL 1WMFA 4IEPA 3RG0A 3J26N 1ZZBA 2H6CA 2LALA 4QQ2A 4RQPB 4IEYA 1WBLA 2I2SA 3PVEA 5FTTC 3W59A 3ZFGA 4PF5A 1UCXA 3CLPA 3HBZA 1MS4A 1QJX3 1SLCA 3SXWA 4R52A 3MGUA 1J59A 1SCRA 2D5HA 4Y1ZA 3H7YA 2Y0OA 4XXAA 2VVDA 1DYPA 3WT3A 1RITA 3RI8A 3APBA 1H2LA 1ZBA2 4Q0UA 1JYIA 2WA4A 3DF0A 5C8WA 5IT6A 5HI0A 3H3UA 1LENA 3KZ4C 4L11A 1S2BA 1RHI2 1SLBA 4P9YA 2YPJA 1RUD3 1GR3A 1RC6A 2P17A 3OD0A 4MV2A 3ME2A 3VZOA 4M00A 1C5IA 4EN6B 5KHIA 5AVAA 1F5FA 5A32A 2DUQA 3L2YA 3RSJA 3B3QE 1UW8A 2H0BA 4WV8A 4AW7A 1YCIA 3ZVXA 4D7TA 4E2SA 1AR81 3MI8A 4Z2WA 1CX4A 1LTEA 5KHHA 1FI2A 3ZXLA 1S2KA 4JCKA 3N35A 1DIWA 4TWTA 2KXLA 2ZGPA 1D0GA 2ZMNA 2VY0A 3S6PA 2ZGSA 5ABJA 5FO8B 5JVVA 4C1XA 3CO2A 1N47A 4RR3A 1DGRA 1RUD1 4LBOA 3KS7A 3P3NA 2VW1A 1IQAA 1XYOA 2WS93 2OYZA 2XVLA 4AF9A 4PJYA 4AI1A 3ZXEA 1AL22 3FWEA 4Q27A 4XF3A 3EHKA 1AF9A 1GV9A 2ZGTA 1KJRA 4PBOA 4L99A 1MS5A 2EVXA 5AVPA 5BNPC 3ZSJA 4AQSA 5F6KA 4DZGA 2FZ1A 3ZFFC 3FLPA 3SCGA 1RMU1 4WM7C 3ZXKA 2D6OX 4FOYA 1O4YA 1V6MA 3IM0A 1PO13 1C28A 3LCPA 1XQNA 3TN93 2P34A 1QDOA 2QUOA 4YARA 4P14A 1RUOA 2R0HA 5FRAA 4MH0E 1HRI3 2DWRA 4N53A 5FBZA 5GLWA 2Y0IA 4JDNA 2R16A 1MEC2 1IZ3A 3WW4A 1C8NA 5C4WC 5D1IA 3LA7A 5BNOB 2RS31 4D7YA 1WMDA 3QBQA 3B93A 1W6NB 1AR63 2GC2A 1X50A 1OI6A 1VLNA 1AYM2 2BPA2 4XTMA 2GMMA 5IK5A 4MVTA 2PN5A 1HIXA 1LJ7A 4DS0A 4AFMA 4FSJA 5JDBA 2R073 4FQZA 4KG0A 4YGCA 4META 2FHRA 4IV1C 3IDCB 4AEMA 4GIQA 2WNUC 1VBC2 3ZFEB 3B02A 4GMP1 4DOUA 4CP0A 3B00A 2EAKA 3N7LA 1QMJA 1TNFA 3GBFA 3ELNA 1LECA 4F83A 4FPJA 2JG8A 4XBQA 5JOXA 1ND3B 2H0VA 2VU9A 3E6BA 2OZ6A 4OI4A 3NO8A 5AC93 3NAPB 4OUSA 3MYXA 4GMP0 4XOGA 2CGNA 2DYCA 4BYYA 4LO5B 4HVQA 2EXIA 1R083 3ZSKA 4KWLA 1RUC2 3DPRC 1AJOA 2BNOA 2PA7A 1AYN2 1CJDA 2YZ4A 4IEXA 1LOGA 3RS6A 4FPLA 1FATA 4XQDA 2Z69A 3HMYA 3U11A 3B01A 1WLDA 1OOPB 1YI9A 1D4VB 5FREA 1RUE2 3JB8A 1EAH1 1COV3 3M2MA 1JH5A 1TME1 3OJBA 3WUDA 4H55A 4D7SA 2C9AA 3SH3A 2JG9C 1Q8PA 3PVNA 4K1ZA 4L92A 5FQ0B 3ZN4A 2QVSB 3KCXA 3MPBA 4BIOA 3MW4A 3R4SA 4V1PA 4FTBA 1HXS3 5T5OA 4CP1A 1YO8A 3O0XA 3QD6A 1O5UA 1Q56A 3ST7A 4QPIC 3LB9A 1VBE2 2B9UA 4LBMA 4FPGA 5J09A 1F9KA 4Z8BA 2XGXA 2R043 4NO4A 3RQ0A 1FOD3 2GNDA 1POV0 2XH6A 4KWKA 3GZAA 1R092 1Q5OA 4OZXA 3UK9A 2KA3A 2CAVA 1CJPA 3WQ0A 2D43A 5EFUA 1Y9QA 4QQHA 2A75A 1QOTA 2HKXA 1PIV2 2ET7A 5AFEA 4XJUA 3VZKA 1B35A 4B4RA 5LK7B 4CDWC 1AR91 3ZSLA 3SHRA 3H1YA 3OBTA 3VKMA 3FBYA 1BMV2 1H8TA 5GZCA 4S2DA 2ZGUA 3KGZA 1LOFA 4GH4A 1Z7S3 4Q29A 4LEJA 4YW3A 3AZWA 2QZ3A 2VXRA 4MYEA 2PLV3 4GH4C 2YGLA 3WV6A 5CFCA 5K0UC 4P9LA 3POYA 3FHIB 4MSVA 4UW3A 4W6WA 2EF6A 2WNUA 2PLV1 1RUNA 4JDMA 1YYNA 1W6PB 2ZGRA 4IL7A 1RUJ3 4DXZA 1RUI2 1Z7S1 2QDNA 1CN1A 2AENA 1YXWA 3KSCA 2C1FA 1QHDA 2XJTA 1G6NA 1S0BA 4BZ4A 1SFYA 2HWC1 4H14A 2ZA9A 2MNGA 5K0UB 2UURA 2VOKA 4OHWA 4Z92B 1ENQA 4Q4Y3 3VZNA 2PAMA 4G4FA 3VBSB 4ATFA 3VN4A 4N90A 2CTVA 2LUWA 5BPXA 2WNUB 5CADA 5GJ6A 3SLIA 1JYCA 1GFF2 2FZ2A 4HL0A 1LEDA 2E51A 4NR1A 1TMF2 3SH5A 4WM7A 3HR9A 4B4QA 3T2TA 1JUHA 1N3QA 2R0FA 3UJQA 4DPNA 3NAPC 4QPIA 2BWAA 4QX5A 4XFCA 3LZZA 1QWRA 3WP6A 3LA2A 1H1AA 3SCFA 1ZBA3 3NW4A 4EROA 1SDWA 3HN1A 4HVRA 1NXD1 4XDQA 1OQEA 2UYBA 3LAGA 5HCBA 5SV8A 5KC5A 2BW8A 1ZA4A 4DNYA 2JG8B 4HFSA 2DUOA 2ZHLA 4QPGB 3R6SA 1I3HA 3PLQA 4CRQA 4ES9A 3ZDSA 4XBLA 2D6KA 3RMYA 5BNPA 5KBFA 1ENRA 3J4UH 1CQ9A 2BYVE 4X8PA 4XEZA 4J1XA 4PLOA 5DDJ1 1DZTA 2A71A 1Z0HA 2GNBA 1G7YA 1O5LA 3GF6A 3T1MA 3B7MA 5E1RA 2QFEA 3NV1A 2R072 2XB6C 3ECQA 3ZFEA 2OZJA 4W6XA 1PM7A 4XMIA 1VBA2 1W0OA 1PGSA 2WT1A 3D8CA 3K51A 1RUD2 1OLRA 1C8M3 2BTVC 2XWJB 1FMD1 4JC1A 3RI9A 2CNAA 4FVVA 4IV1A 1R1A1 1NCQA 1UN1A 1ND2B 4M3CF 1IS5A 3W58A 3LGRA 5ABJC 5K8SA 3WG2A 4RSUA 4ATEA 2MHFA 1LCLA 1O3QA 1LHOA 3OTFA 1CAWA 1WW6A 2EALA 2RJLA 3KB5A 3N3HA 1NXMA 4ZU5A 4PQ9A 4WVVA 2ZX4A 4I01A 4AEKA 4RS5C 3G6JB 4MGIE 3POWA 1PNGA 5CBLA 2ZZQA 4JRAA 1NCQB 2A3WA 3I7DA 1QOOA 4BWOA 2JG9A 5FOJB 1NCRB 2E7AA 2B45X 1OOPA 4Y24A 3PMSA 3BOWA 3IPVB 2BNNA 4X6QB 2PLV2 2ZGNA 1N1YA 3J9SA 4IEZA 4JGYA 5DG2A 1MQTC 4AVCA 3R0RA 4HETA 5CFCC 3J8F1 4MGKE 1W6OA 1H9PA 1EV13 3FX3A 2E7TA 3NV4A 4JVAA 1JN2P 2PHUA 2YHJA 2HWF2 4PIZA 3FJSA 2HJIA 4Z07A 5DXDA 4AYUA 1DG6A 1MZ5A 3WQ1A 1BQPA 1BJQA 4Q2FA 3AB0A 3U4XA 3ZX7A 1S0FA 2GH8A 5FPZA 5CFCB 3ILRA 1DQ6A 2IXKA 4PIYA 4AFDA 1GNZA 1QQP3 4FPEA 4YLZA 4BM8A 3UL2A 5JSPA 1IS3A 1YFYA 3HIFA 2ZS6B 3RWNA 2R6QA 4GQ7A 4H3WA 1H8TC 2WWSA 4NN0A 1SCSA 3CJIA 2N7GA 3ZFFB 4P5HA 1NQJA 2D97A 2I07B 3ALQA 3FUQA 3LKJA 4PBPA 3GHNA 1OQ1A 5JPMB 1RB8G 3W9AA 4Q0QA 5JAXA 1SLLA 4FPOB 2RE9A 4R9BA 4J1WA 4LTAA 1FMD3 5JI7A 4LUMA 3LWCA 2ZGKA 4FTEA 4WM7B 4BIFA 1WD3A 3QACA 1XU1A 1IS6A 1VIWB 4ISQA 3JD73 2ZJCA 4IESA 4YM1A 4A7KA 1LHNA 4O9GA 1BZWA 4IEWA 1UPIA 2JKBA 3B9CA 3KGLA 4MXVA 2XJPA 4BLIA 2WA3A 1LODA 3MPPG 2PQQA 3WQ7A 4Q4W1 5EYYA 1OA2A 4TYSA 1QU0A 5F9TA 3AXDA 3WLUA 2VH9A 1BCXA 2IFRA 4K8FA 1D0HA 5DG1A 2R1BA 2V09A 4LO8A 1ZRDA 5T52A 3QOPA 1Y43B 3MDPA 1HXS1 4OHXA 4GA9A 3B5LB 2EXKA 5L7OB 1JTZX 1KXGA 2YXSA 2DCZA 4XJ8A 4JGZA 4WZFA 4RHV2 4BCUA 1MACA 4AE2A 2E6VA 3VHPA 3MICA 1HKDA 1QXPA 4NOTA 4QGLA 2ERFA 4MXWB 1LRHA 1DBNA 5GZFA 4Y1YA 2VNOA 1AZDA 1LGBA 2VQ0A 2A6ZA 2XJUA 5TSWA 4Q4W3 3H0OA 1WUVA 3AYDA 3P3PA 4W6YA 3TWIA 1QJX1 2RHPA 1ND3C 2DU0A 2VMHA 3DN7A 4L9BA 4H7LA 4LHNA 1RUG2 1DQ0A 3AP9A 3AP6A 3H9AA 5BNQA 4AEJA 1X33A 2Y26A 3V0BA 1H4HA 1OKQA 4Y20B 5JZGB 2VQAA 2BFUS 1WLWA 2XVGA 3WINE 1F2NA 3ZXAC 3BALA 4YVSA 1X7NA 5T50A 2DU1A 1SFNA 5GKAC 3AP7A 3S30A 3FBMA 2NYYA 4RGGA 2EIGA 1PK6B 2ES3A 1FNYA 1REDA 1B35C 4YFZA 3LOBA 4BOWA 4QQLA 3RPQA 1QQP1 1WA4A 4COVA 1XYPA 2CWSA 4YGBA 1RUC3 4XPVA 5FLJA 2A70A 2R071 4BH9A 3VUOA 4N53C 1OFNA 4S2HA 4B29A 3VBUB 4COUA 1PVXA 1V6NA 4Q26A 4YZ3A 4L97A 4QMAA 1QJY2 3VDDA 1QJU2 1RVF3 3JZVA 4I0BA 4AFCA 3ZFGB 4C91A 4IV1B 4CDXA 5J36A 2JE7A 2YUEA 4ZU4A 1REEA 4WVZA 4RS5A 1V6LA 3DV8A 1G86A 3RNSA 5ABJB 2OUHA 4BMBA 5I0SA 1GZCA 2D40A 3MEPA 2ILMA 5C9AA 1LU1A 1UU5A 2GC3A 1OPMA 1RUH2 4R9CA 3B9IA 4IERA 2EXJA 1L3JA 5JMCA 3RYRA 3UV9A 3VZJA 1VBC1 4G9SB 2Q1ZB 1G9DA 1U5ZA 1XNCA 5FLIA 2SBAA 4LBJA 5JI9A 4OVEA 3CEWA 2XPJA 1PIV1 4LO6B 3RJRA 2WNEA 4AVBA 2UWAA 4EN8B 3VKOA 2LTNA 2ZX2A 4FT8A 1C5HA 1PZ8A 2D3PA 4AI0A 5T5PA 1OA3A 1SEFA 4R9DA 2Q1MA 4HN1A 3VHNA 4JGZC 2ZCWA 4KQ7A 4OFGA 5ACA1 2VW0A 1MQTB 3FUOA 4MLOA 4TSVA 4E4ZA 2BFUL 4AVAA 1TME3 3WDUA 1TE1B 1YFXA 2IC1A 2NZ9A 4CP2A 1POV3 2XBO1 5CU1A 1C1LA 4QGMA 4M3CB 1BBT3 1UZZA 1XYNA 4RGAA 4CYDA 1SBDA 4WM8B 1NLSA 3E5UA 5GLVA 3N4MA 3AYAA 3MLKA 3VBRC 4DINB 1UX6A 3M3IA 3JBG3 1R081 2W68A 5C8CB 2E9QA 4CEWA 3FC0A 1N1SA 3B69A 2F4PA 2HWB2 3L9JT 2A3XA 4CTEA 3VBRA 2VVFA 4I3PA 4UW4A 1YHFA 5LRRA 3E6DA 1W39A 3VL8A 5KHGA 1ZYBA 5JCTA 1XE8A 3JBG2 4OULA 4QU2A 1G9FA 4LBQD 3VDDC 5CA6A 1GANA 1CR7A 4AG4A 1PGW2 1Y7BA 3K48A 4LHKA 1PIV3 3ZSMA 1PVC1 4LBLA 3KT4A 3MIHA 1KS5A 3MZHA 1YJKA 4AEDC 4QT6A 4OUMA 4YZ1A 5I91A 1XXNA 4U36A 2PHXA 1RUF1 2RS13 4YRDA 3OPZA 1V6KA 3ASIA 3WDYA 5GALA 1VBB2 2D6LX 4XMAA 3CJIC 4UBHA 1DQ2A 1QJY3 3AK0A 4XFAA 3MW3A 4COYA 2AZ5A 2VOVA 1UU6A 2PHWA 2HEVF 5I93A 4GXLA 1PK6C 3J8F3 5JZGA 1CAXB 2MEV2 3HQXA 3U0ZA 4B4PA 1BVVA 2GNMA 1VBA1 2QCSB 1UU4A 3NV3A 4CDWA 3FLRA 2WJSA 4Q8KA 1ULGA 4UW5A 4RFT0 2ZKLA 5CB7A 3V64A 1RHI1 1SBEA 2PHFA 4MXWA 4QM9A 1UL9A 4IEQA 1AR73 4Y1VA 2Z2SB 2QZ2A 3NSTA 5E8AA 1U0AA 1ULCA 4FPYA 2DTWA 1LULA 1ULFA 3E5QA 1VBD3 5FPXA 2WZR3 3ATGA 3MF9A 4XE9A 2GC1A 3NL1A 3JQWA 1R1A3 1UPSA 3USSA 2TEPA 2I74A 1T6GC 3SNMA 1QGLA 1RUF2 2R061 2OPKA 3JU9A 5CNAA 3T1LA 4KWJA 1FOD2 3MFAA 2CGPA 3ZXFA 4U2AA 1VRH3 1W2UA 3SH4A 1W6NA 1OMIA 1Q43A 2XLAA 3AZYA 4JGZB 1UKRA 4XFGA 2G9GA 5FOBB 2ZTNA 1GSLA 2VUJA 2PAKA 4X8NA 1B09A 2RM21 4GB33 3VBFC 2RM22 5KWRA 1QH7A 3L2HA 2W39A 1GQHA 1B35B 1HQLA 1RUE1 1VAKA 4FOQA 4FOWA 3MIEA 2ZHNA 2RMU2 3D6EA 5EJ3A 2A6WA 3M8LA 4BPZA 1ENXA 4LO7A 1S0EA 2Z79A 1DHKB 1CAVA 2UWCA 2YROA 4RQPC 1KITA 2WT2A 2UU8A 4B7EA 1HV1A 4ISRA 1ND3A 1TMF3 1CONA 1C1FA 2CYFA 2IXJA 5LK5A 5DZGA 4OI0A 3PMEA 2RR12 2ZX1A 1GBGA 5J48A 4YSFA 4D3WA 1A6CA 1VP6A 4YG0A 5KHKA 1AXYA 1AVBA 5I8SA 3GNEA 4EWDA 4ONUA 2WLPA 4Q4Y2 2R30A 5FAXA 1EAH3 4QM8A 5H9SA 4AEDB 1Z78A 1XNKA 1ZRCA 5KXDA 3VBOA 2OW4A 3VGIA 1UZYA 4HT1T 5D8AA 2NM1A 4S2FA 1J3PA 4Y22A 1EP0A 4YYOA