3J26N

The 3.5 a resolution structure of the sputnik virophage by cryo-em
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
362
structure length
362
Chain Sequence
EPDTVYYDILIPFKPNDQGFSPAIFQAQLTQPIVHNPSEYFLSVVRFSIPTQNIPLTIPQIQPYPNTNVNNTIYSVSIGYNGTYSSQNFVQFDPSLTSPNIPAPNAPTVTSPNVEVTPYYYIYDYSTFLQMINTALENAFNEISAPVGADAPFFFYDSNTEKISLIAQAAYYDRTLTTPIEIYCNVNLFTFFDSIKHIGLGYNTPTGRDILFDVRFLGNNYYQDPETAPSYPPEFIQMQQEYPTLSNWNAVKTIQLVSNLLPINKESIPSFRNSNVGIINAQGILADFVPLVTNGPEARISIDFVATGPWRLIDMFGSVPIYMVDLYVYWTDQTGGQYLINIPPGRILTCKLVFIKKSLSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords capsid protein V20
publication title Structure of Sputnik, a virophage, at 3.5-A resolution.
pubmed doi rcsb
total genus 25
structure length 362
sequence length 362
ec nomenclature
pdb deposition date 2012-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1100 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3j26N01
3J26N
chains in the Genus database with same CATH superfamily
2ORZA 4AFCA 2NM1A 2FDHA 4D6SA 3C3VA 3J7LA 3X29B 4QM8A 5HBAA 1PVC1 3QOPA 2Z69A 2W9XA 1LHOA 1NKGA 5EPAA 4FO9A 4CXYA 3VBFB 3NL1A 4YWAA 1PIV2 2E26A 1GWMA 4HSLA 4B4RA 5A3MA 3J7NA 5FPAA 1CN1A 4DINB 4JTNA 2QQWA 4ITCA 1JYWA 4YARA 1S2BA 4MGQA 2HEWF 3ZDSA 3NMBA 1X9PA 5F5AA 5FZ9A 3T4VA 2CU5A 2QQLA 4N8MA 1DYOA 1VAVA 4DQAA 2DVGA 1GOFA 4TN7A 4YGDA 5DABA 3ES1A 5DG1A 3E97A 3ZYPA 1HB2A 2R073 5L7OA 1R1A2 1QJX2 4XETA 5G05L 2Z79A 4XUQA 3GHMA 3VB9A 1AYM1 1K5MC 1VP6A 2PFWA 2DFBA 3KZ4C 3LDRA 5C7GA 3UK9A 3ZIXA 1WMXA 2GALA 4FP2A 1PX4A 2CGOA 3FLRA 2PYTA 2R071 4CP1A 4JV4A 4IV3B 4R9DA 3NJXA 1RVF2 3UL2A 4OCTA 3OPWA 5B4NA 1VBE1 3U4XA 3ZN6B 4CDUB 3HT2A 2BZDA 1SLTA 1LU1A 3LIHA 3SXWA 3JZVA 4E8CA 3MF9A 1OD3A 2VZPA 3POWA 3RVHA 4DRRA 2BGCA 3HNBM 5HXVA 1XXNA 3AK0A 2Y6HA 1PO23 2CHHA 2FDKA 2AENA 2V4VA 4ZS3A 2GDFA 3V0BB 1H9PA 5FY1A 1RUJ3 1NA1C 2Y8KA 1CJPA 1VRBA 3AB0A 3FWEA 4LOTA 3VBHB 1MS5A 4CDQA 1S0IA 1MQTB 3ILRA 4AXOA 2XR4A 2X5IC 1FMD1 1EAH2 3KCYA 1Z7S1 1RUJ1 3OYWA 1GWKA 1URXA 4HKWA 4L0PA 3HN3A 2WLPA 2C26A 3UNPA 4FFFA 5EP9A 1BXHA 2BNNA 4WM7C 1OF3A 4Y22B 5C71A 1Q8PA 5LK7B 1Z78A 1UKRA 2X09A 4HVRA 4XJ8A 4YG6A 4LE4A 1OKOA 4FAHA 3L2YA 2ORXA 3WG3A 1BBT3 2FBEA 2JX9A 2DFCA 5IVEA 1O7FA 3ATGA 2RJ2A 4OHVA 1ZZ9A 5C4WB 4RL7A 1VB4A 4MGSA 4DXZA 2YPDA 4ZXKA 5CFDB 4ZU5A 4KG8A 1XU1A 3POJA 2BOIA 4QXBA 4YGCA 1JYVA 2UY9A 4YGEA 1RUF1 3OGRA 5IVJA 1LJ7A 4CCOA 1QIQA 3K3OA 4NOTA 3NNJA 3BU0A 3MPBA 4EQVA 4N9HA 5FYCA 3MW4A 1F35A 4G3YC 5J3UA 2E6VA 2GC0A 1H2MA 5L9RA 3HMYA 3POBA 4OVEA 5F39A 3WT3A 1ZNPA 5FBZA 1FPN2 4LPLA 2RR13 1W6NA 3NAPC 1RUE2 5FZ8A 2Q8DA 3VHRA 2DTYA 2RDRA 3JQWA 4QHBA 4V1PA 3JQXA 3S6PA 2WT2A 1PZ8A 4SLIA 3WLUA 4EV0A 4BU2A 1WLWA 4AQSA 4CCDA 4JGYC 3Q9OA 4YVWB 3ZM8A 1OBNA 4FTSA 2ZGLA 4XW3A 1VBA1 3O0VA 2V5DA 2RMU2 1MS0A 1UW8A 3B02A 2D6KA 1OVSA 3PDQA 1JODA 4W8JA 1DQ4A 1STMA 2ZCWA 3WUDA 4CXWA 5FZ0A 2GU9A 1PMJX 2B46X 2W52A 5C9AA 3DXTA 1H1MA 1HB3A 2QDNA 4TSVA 3FLPA 1YQ5A 1BHGA 4BLIA 3TNQA 2KXLA 3OOXA 2Y6FA 4QAWA 2B42B 2R0HA 1NOVA 1QHDA 4LT5A 3O0XA 3H42B 1OA4A 2MNGA 3MICA 3OEBA 1X33A 3VN4A 1POV1 3AZYA 4JHZA 2WZR3 4D7TA 5K7PA 5EFUA 4COZA 5ABJB 2KR2A 1DGWX 5T54A 2J1SA 4Y26A 5LA2A 1TME2 2G1MA 2UU8A 4HT1T 3T0AA 1SBEA 2WKKA 5I0TA 2GMEA 4LNVA 3T30A 3CKHA 2R49A 2WZR1 5CKQA 5EYYA 1XSRA 1ASJ1 1W03A 2E9QA 3I7DA 4Y1VA 4M4RA 1LEMA 3I8TA 1I5PA 4R52A 3WG1A 2W08A 1H2NA 3B5LB 1UY2A 1AF9A 3AMHA 1BVP1 4HPKA 1EV12 4PDWB 3MV11 1I6XA 1OC1A 1LGBA 2JDKA 2WYFA 5FJHA 4UFLA 4DB5A 2AZ5A 5LW9A 5GKAC 1C8M3 1DGWA 3KQRA 5LB6A 1ZBE1 1SG3A 2MEV2 4CDXC 3RDIA 3D5OA 2A5ZA 2V5YA 4JAAA 2JB8A 1J3RA 2QQNA 2B5HA 1GV9A 1CJDA 5I8YA 1V9U3 4Q0SA 1C8M1 2RG4A 5GJ6A 3J4UH 3ZYRA 4R9BA 3DPRC 1WA4A 4AHYA 3WDXA 1AR91 4I01A 4DUWA 1MQTA 1C1LA 1V9U1 3RWNA 4K40A 3OF1A 3VKLA 2W95A 5FZBA 1RL3A 3BOWA 3JB4C 4YW5A 4CCCA 1LOFA 3EBRA 4CUBA 4K1YA 3OJBA 2R043 4DXTA 1H0BA 3CJIC 1JUIA 4QD2A 2HH9A 1QQP3 1XNAA 3D0SA 4QKDA 4CDWA 5J37A 1UIJA 1RUH1 5A7PA 3MW3A 3LQCA 5C3PA 3LSDA 3WCSA 1JZ4A 2QQKA 4LJHA 5FUNA 2R041 5J7MA 4FVVA 3OPZA 3WQBA 3O12A 2HJIA 4G4FA 4D0QA 1JZ7A 1XC6A 1AYN3 5LBCA 4N9IA 1W6OA 5CZKA 1CGPA 3KD4A 3MFAA 1D4VB 2Q0AA 3UV9A 4YW1A 1H9WA 2AACA 4RS5B 4NROA 1SFYA 1AYN1 4Z82A 4CEYA 4BQ4A 5C8CC 3DGTA 5D8AB 3U1XA 2R1BA 2VNRA 5A7NA 2JG9A 2YZ4A 4JQRA 3BTZA 1XSQA 3N9LA 2EICA 3OGGA 4HBNA 3WOGA 1W0OA 2OUHA 1IQAA 4R4XA 2W92A 1OOPA 3ZSJA 3CO2A 1NG0A 4BZ4A 1VMFA 3BTAA 2A71A 3IB3A 2ZHNA 1RXFA 4K1ZA 1OUXA 5IVCA 5T5PA 5JOZA 4YFZA 3ZFFB 4MHUA 1JYCA 1AR81 1ZVFA 4K3UA 4S2GA 1RUD2 5LY1A 3VZOA 4E2SA 1LESA 1AJOA 1MVQA 3GF6A 1VBD3 1PGW2 2VQAA 2SBAA 5CB7A 3ASIA 3J9SA 4UWDA 2XBO1 3WEZA 3I54A 5DZGA 5CFCC 3VBFC 4TTGA 3IPVA 3OBZA 3WW4A 1UD1A 5DUUA 4AFBA 2ZA9A 1XNKA 3GBGA 1JYIA 4RA0A 4GJYA 1FNZA 3C7FA 2XUEA 5A80A 5J48A 2ZX4A 5FY9A 5BNOB 2WIIB 5GLVA 5C33A 5EIYB 5APAA 5FZIA 3TEXA 4N43C 4IE6A 3E1F1 4Z1VA 2B9VA 4XJ9A 4Q27A 1JW6A 3UGGA 4FPHA 5GLTA 3BALA 3F95A 4CP0A 1OPOA 2RS52 1RMU1 4GZ9A 5EJ1B 4UW6A 1OLQA 1G9DA 4BE3A 4A6SA 3OD0A 2Q8CA 3P3PA 4FPFA 2QUOA 2B7YA 5FP4A 2JDNA 1PVC2 4QQPA 4CP2A 1YEWA 5L19A 2R16A 2RS13 3K75B 4MH0E 4IEPA 2A3WA 1W8WA 2XLFA 2ZGPA 5FWEA 4IV3C 1ULPA 2WNOA 3POIA 1QJU3 2C5DA 1US3A 2B39A 3SCGA 1JZ2A 1GNZA 1WLDA 1E5SA 2DCTA 1YI7A 1ENQA 4LUMA 4NN0A 1GZ9A 1LHNA 3HEIA 2JDYA 2YV8A 5K0UB 1HXS1 1QJU1 3NNFA 1NUKA 1WUVA 5EWSA 3VBUA 1HX6A 2W1UA 1ZYBA 4WZFA 2P4EA 3EYPA 4YM1A 2ZEYA 2PELA 1G9FA 3ZIWA 1HQNA 1B09A 3CIHA 3SH4A 2PAMA 5J36A 1F4AA 3RYKA 1FT9A 4K9SA 4BYYA 1WMEA 4BDVB 4J6GA 2UY8A 2VOKA 3ABZA 2IXHA 2R072 4XQ4A 1J58A 3I3BA 2OYZA 1QH6A 5HV0A 4UFJA 4XZPA 2LALA 4FPJA 4GXLA 3THDA 2WQ4A 5IK8A 4NO4A 5F2SA 2JDMA 2YFZA 2EXKA 1Y9QA 1K42A 4PT6A 5J96B 4ZONA 2Z2SB 3DKQA 2JE8A 2W1QA 2GAUA 1IS3A 4U36A 5F6KA 3EMRA 3WP3A 4E8DA 2VMHA 2OQ6A 1SFNA 2W1SA 4QPIB 2ZGOA 5EQUA 5FYSA 1W8NA 4LHNA 5FXVA 2K0GA 3OUIA 3SH5A 2WO3A 2PN5A 4XCAA 1F15A 4P9GA 4CE8A 3BVCA 4H55A 4IV1A 4BM8A 3LIGA 1BQPA 1PO22 1YQ6A 2DVAA 3ZR6A 1HV1A 1RITA 2DBIA 4RR3B 1ZZ7A 4KWUA 1RUJ2 1CX1A 1FX5A 2CAVA 2VMGA 3DL3A 1WW7A 5B4XA 4ISRA 3A21A 4MSVA 5T55A 4MV2A 1VMJA 1X8MA 2ZHMA 1UU5A 4OI0A 3DXUA 2P17A 2VOWA 2DCZA 3ZMNA 2J1RA 1MS9A 2XJQA 3ZXJA 2WRAA 4COVA 2QBXA 3MIDA 1DG6A 1FXZA 2ILMA 2PHTA 2HWF3 2W0XA 3PMEA 5GLUA 2N7GA 3ZPOA 5FK7A 3I2HA 3KT1A 5FFOC 1XE0A 1Y9MA 3GBWA 5FY8A 3VHPA 2ZKNA 4YG3A 4WVMA 3GALA 3ZXEA 1OF4A 4META 2HWF1 1YQ8A 5FP9A 3AJYA 4QT6A 4FTEA 3ETPA 4JDMA 5DZFA 3AVRA 1VBC2 1UPSA 1BBT2 2ARCA 3M3IA 4QMAA 1K5MB 4XJZA 1UF2C 1R1ZA 4K21A 4KGGA 3VDBA 5DAPA 1O4YA 2P3KA 2Y6GA 5D21A 4GALA 3ZXKA 3AX4A 1W8OA 3BOPA 2PLV1 3ILFA 1RHI1 2Q1ZB 3PVOA 4DUXA 4XBLA 3A7QA 4IGPA 1SACA 5FZLA 3GNEA 4IXLA 4LHKA 1WW5A 4YVSA 1CESA 3PL0A 3RZKA 1FAYA 3ECQA 4D6RA 1W28A 4AAPA 2O8OA 1XNCA 3WHUA 3WF3A 3AP7A 2CGPA 4BIOA 4A44A 4B3NA 4ZU7A 1WMDA 4JVAA 5JXJA 4QPWA 5JMOA 3BB6A 4DFSA 2W87A 1CAUA 2RR12 3ORJA 3GYDA 1C8NA 4LQRA 2Y6JA 3M8LA 1GQGA 1BLZA 4AEKA 3JBG1 2P6HA 2X5IB 1HRI3 3DF0A 1HKDA 4JZRA 3MO4A 5HV4A 3N9PA 4XUTA 3I4IA 3LE0A 4AE2A 3UETA 1QF3A 4OZOA 3PIJA 2VCBA 3WF0A 5JOXA 1CAVA 5CNAA 3FHIB 4BK5A 3MYXA 1HRI1 2CY6A 4UFIA 4M3CF 3ELNA 4PDWC 2JIJA 2XJRA 4WM7B 5FUIA 4V2WA 3H3LA 2NQYA 1SLLA 4JGZB 3ZFEA 2J7MA 2K9ZA 5T50A 1ENRA 2VECA 4YM2A 2D6LX 2RS33 1D7PM 2YY1A 5K0UA 4BPZA 4P9JA 3C7HA 3MFCA 2HWC1 3THTA 2FCUA 3WXPA 1T6BX 2GH8A 1RGSA 1EUTA 4D6QA 1BEV1 1QU0A 2VG9A 2WZR2 4DNYA 4B4QA 3T1LA 3LEGA 2BW8A 3FHAA 4XAAA 2HWD3 5A6YA 5IAVA 3NNLA 1SLIA 4RFT0 4DRVA 3WW2A 2WWSA 1KGYA 3P6BA 1W6PB 3HNMA 3NV4A 4YW2A 1OD5A 4PLMA 5LATA 1J3PA 2QDRA 1NCRB 1IKPA 2UURA 3HAGA 3Q8FA 4RQPA 4F83A 1W2OA 3J8F2 5A33B 1GICA 1L3JA 2BYVE 3HWJA 1G86A 2AUYA 4Q0QA 3WQ1A 1JOBA 3PUQA 1UMHA 3D4KA 1C4RA 5FP3A 3SNMA 3KHBA 2DUQA 4IW3A 2P37A 1OI6A 2AEYA 4RD7A 5CA6A 2D6MA 2WO2A 3DYMA 2VM9A 2D44A 3NAPB 3FLTA 2WT0A 2VNOA 4Q4Y2 3TOJA 3Q8BA 4DMIA 4FFHA 1OT5A 4QX5A 1BK1A 2OZ6A 3NW4A 2BBVA 4YZ2A 1LOEA 1DHKB 1VBB2 4UFMA 5FZMA 5LY2A 4OQ8A 4Q4W1 4COUA 1NLRA 4RS5C 2A73B 1AJKA 1V9U2 4L11A 4ASLA 2YPJA 2BGOA 1YCIA 1FOD1 1XB9A 4QM9A 5A1AA 1ULFA 4XHXA 4X6QB 4YYOA 3TBDA 2CYFA 2JDHA 4R8HA 4N90A 4ZZ5A 4A7ZA 3VBRC 1H30A 5JR2A 4JHTA 5DDJ1 2VQUA 1O3TA 4FOWA 4ZY9A 3CNAA 4Y20B 4YW7A 4COYA 1E5IA 3RJ2X 3LOIA 3NNMA 4AVTA 3RYPA 2CWMA 4ONUA 3T09A 4FQZA 3ZFFC 1QQP2 4GH4B 3WX5A 2XDVA 4TLFA 1JUHA 2RDQA 5IFTA 4LTAA 3N7LA 3OD4A 1JZ5A 5ISLA 1NE4A 1I9RA 2HYKA 1YXWA 4XDOA 4XE9A 1JZ6A 3AYDA 5DMYA 4LE3A 2BWCA 2X05A 4PHZA 4PF1A 2FDJA 2PAKA 2PQQA 4AFDA 1AYN2 4P14A 4QPGC 3BTXA 3DV8A 1IS6A 4QB6A 1IGOA 1O4ZA 4PBPA 5FUPA 3H0OA 2W5FA 4A41A 4FOYA 5BUVA 1JYXA 1MEC3 2AR6A 3W21A 5JDBA 3MDPA 4AYUA 3KT7A 3IMMA 4LLOA 1DLLA 4IEZA 1LHUA 5A32B 4FQ4A 4KBBA 3NV1A 4CDXB 5FOJB 4N53C 5HCAA 3LAGA 5J09A 3KM5A 3MLJA 2GC1A 2AREA 4K8FA 5KC5A 2D98A 2H0VA 2QQOA 4XFBA 3ZFGA 1KXGA 2EAKA 2RV9A 1NA1A 2D5HA 1QNYA 2JKXA 2QKDA 1G9AA 1UOJA 2ARXA 1WW4A 1VMHA 4NAOA 1G9BA 2BDRA 3QH6A 2DU1A 1VBD2 2X5IA 1UO9A 4C90A 2WT1A 3ZR5A 4MXWA 2WWUA 1ZZ8A 1OFNA 5IHRA 1B35A 1AR61 2XVKA 4YG0A 3CJIB 1GUIA 5F1RA 3ES4A 4Y5TA 3ZDVA 1UY3A 2D5FA 3O14A 4NHXA 3SLIA 3ENRA 4PIYA 2FZ1A 1ND3B 5FZOB 4HKLA 4EZ4A 1PGL1 1H8VA 3AMMA 4H7MA 1L7RA 2J1AA 1ENSA 4PIZA 2C24A 1BK0A 4XPVA 1RUI1 4YSFA 5IAXA 2XJUA 4Q8KA 1ZBA1 3JD73 4IETA 2IFRA 1PVXA 1TVGA 3VBSA 1D0GA 5JMCA 2OS2A 2XGXA 2ZMLA 1W3VA 3ZYHA 4E27A 2CWSA 1S0BA 4Q26A 2B4KA 1VAKA 5C8CB 5IK7A 3JD71 4JRAA 1SCRA 4XUOA 1A6CA 3RMXA 3WNLA 4LBQB 2D7FA 2RS12 3VZKA 2ZEZA 3NSTA 2LRPA 2XVGA 1QJU2 1XBFA 1O91A 1W2AX 4BJ0A 5B2GB 4P02B 5A33A 4XF1A 4Q0VA 1UAIA 3FBYA 3K3NA 4C8DA 5F9TA 2OX0A 2DCKA 2JDPA 3RFRA 5SV8A 2O0OA 4KU7A 4QDQA 3URFA 2XHKA 1JHNA 3FBMA 1GR3A 3NAPA 4LBKA 5IK5A 4OYUA 2XB6C 5JSRA 2PHXA 2WA3A 4RR3C 4CCJA 5A7WB 4JRLA 5JSOA 4Y1YA 4NIDA 1RJ8A 4JGYA 5CFCB 5T5OA 4NAMA 3RI8A 1RUNA 4XUNA 3B69A 2GP3A 2D6NA 2ZACA 4LLFA 4LHLA 5SV5A 3RYRA 1X50A 1UU4A 5FMOL 1SLAA 3RZZA 1F5FA 5IJRA 1JHJA 2HWB3 2NZ9A 3WV6A 1X8EA 4N43B 3I3MA 2WC2A 4NIHA 1O3QA 1AYM3 5IWFA 1MZFA 3N9OA 2OVUA 4XCBA 2ZKLA 1H4GA 2HWB1 3SITA 5C3SA 3RZJA 5AC93 3GBFA 1WW6A 1QOOA 2GZWA 5JXIA 3KGZA 4GJZA 3BI3A 2O8QA 4AQ2A 3WUCA 1ZZCA 1W2UA 1PX3A 2W91A 1PO11 1VBE3 3KCXA 5FQ0B 3SC7X 4CCEA 4PQ9A 5AC91 3KF3A 4AGVA 1M06G 3AYAA 1KQRA 1IPJA 4O7XA 4LK7A 4XMIA 3S5QA 2E7TA 3FL7A 3VD5A 3VKNA 1F31A 4HXCA 2F17A 2BBAA 3PLQA 3S5AA 2FDFA 3USUA 1DQ2A 4AL9A 4BHPA 5C3QA 2EIDA 2XG3A 2RJLA 4UBGA 3I3EA 3KVBA 4XVHA 4YRDA 5IYYA 1PK6B 3H1WA 4YNIA 4KWKA 1QMJA 2QNKA 3AKTA 2DWRA 3HOBA 1WBFA 3CHXA 4WM8C 2JE9A 2Y60A 1ULDA 1WD4A 1FMD3 3WNKA 3IDBB 5IT6A 1CZVA 1YUDA 2HWF2 1Z7S3 1WCUA 3H7YA 3IIIA 4IDZA 4P5HA 2WZPP 4MOAA 4XJAA 4CP9B 2ZZJA 1XJAA 2ZX0A 1TZOA 3NKTA 5JI7A 1W9TA 5JZGC 3AMQA 3DPRA 4IL7A 5A6XA 1GZWB 1OH3A 1DP0A 3T2OA 2JD4A 2W68A 4D8MA 4EYUA 2WNVB 3CU7A 1XNDA 4I0AA 4A4AA 1S2EA 1LEDA 4LOSA 2VOVA 1VIWB 1UN1A 3SHRA 3WP6A 4GB31 1W9FA 4JGZC 4UF0A 2GNBA 1HDKA 3LEKA 3P5BA 2Q8OA 3UT0A 3HIFA 1UQXA 2VUJA 5IK4A 4IE7A 1Y9GA 2A6VA 2VPVA 5ANQA 4BB3A 5C8WA 3E5XA 4XF0A 3FX3A 5LK5A 2A6ZA 3N7MA 1RUF3 3POYA 2VH9A 4DIQA 1ODNA 3J7MA 3PHMA 3TRSB 2XKPA 2D6PA 1TMF3 2RDSA 4EN9B 4EWEA 4O9EA 3OUJA 3RRDA 1JN2P 1GP4A 1UMIA 2PA7A 5I0UA 1H2KA 2W39A 4ARXA 1TMF1 1NCRC 2HYXA 2JEMA 5T5JA 1HRI2 5FCCA 4B4PA 3D0JA 2HWE1 1GP6A 1H1IA 3MEPA 5BNPC 3E5QA 2XQXA 4O61A 3R05A 4XFCA 4J25A 1DBNA 3NRUA 3T3YA 3ZLIA 4C0HA 4E2QA 1V6IA 4JKMA 1PHMA 3P3NA 4MADA 5KR7A 3BN6A 5FZGA 1QJEA 3FE5A 4NJ4A 5C5UA 2D40A 3BPSA 1V6JA 3M1HA 4M01A 5EXOA 5A7SA 1OQEA 3UESA 1V00A 2ZPXA 3NVCA 1VRH1 3IBMA 1F4HA 2VZRA 4B1MA 1AL21 1VBA3 2EA7A 1N3PA 1IG0A 4KI5M 5FPXA 2XLAA 3N9NA 3KV4A 2ZZQA 4GMP0 2CTVA 2RS32 3FJSA 3VUOA 1DIWA 1KS4A 2Z5WA 4MUVA 1C5HA 4HZFA 2WN2A 2XKOA 3CF6E 1ZX5A 1NY71 4M3CB 2L9LA 2Y33A 4BQ5A 1YO8A 1YQCA 3USSA 1TE1B 1Q8VA 2ZGSA 2HWD2 1POV3 5HCFA 3VBFA 3U75A 4A45A 1Q8QA 5H9PA 4YM0A 1BMV2 3GJBA 1YHFA 4QU1A 2UYBA 4LULA 2XHNA 4MG2A 3PTRB 3WHTA 4Z8BA 4FFIA 2VW0A 4GH4C 1DQ0A 3WNNA 3ZO0B 1ASJ3 1J1TA 4L92A 1F9KA 1JOPA 5C3OA 2NPIA 1NXD1 1J59A 3R0RA 1EPZA 2RVAA 1IPSA 2R063 3APBA 2RM21 3D6EA 1BJQA 1MZEA 4FPCA 2JWPA 2WFF1 5HI0A 1OLME 5FYYA 1MVEA 2HBTA 1ZBE3 1F8VA 1PNGA 2RHPA 2R1DA 2ES3A 3OTFA 4IV3A 3OEAA 4XFIA 4ZXEA 3W59A 4DY3A 3AP4A 2R061 4UFKA 1I3HA 2VE1A 3SEPA 3I3DA 3M7AA 1MACA 2XJTA 4L99A 4CUGA 1CWPA 2VCAA 3ZN6A 4CDUA 2QQVA 3PJQA 3UGFA 3BIEA 1VJ2A 4NWVA 1ZRDA 5K4LA 3E6BA 3K46A 2WJSA 3MIGA 1FI2A 3JUUA 3OGVA 4EN6B 3WD5A 2ATFA 1AR93 2QFEA 4JQTA 1Q8OA 2OPKA 2VW1A 3TN93 1D4M1 5M0TA 3V0BA 4AVAA 4RGGA 4LKDA 5CYYA 5T52A 1JZ3A 3OG2A 2CDPA 4FCAA 3T0DA 3VBHA 1W6QB 2VGDA 3N7KA 1CZSA 5D1IA 3LCPA 3M3OA 3TN91 1QJY1 1W2NA 3FHQA 1S0FA 2OIIA 1ACCA 1IKQA 4NRMA 1RUH3 2LW8A 1NZIA 4NUBA 5EV7A 5LBEA 2Y0IA 2JXAA 5JOYA 4MGTA 2IC1A 2ARAA 3EJKA 1CD3G 2BVBA 1VLNA 2B45X 4XHBA 1ULCA 1FATA 1V6OA 5FZ4A 3AM2A 3WY6A 4JDOA 5FIXA 3O1UA 2Z42A 1MEC2 1ND3C 4Y22A 2NN8A 4COWA 1BZWA 1CIWA 1COV1 1SLCA 5IVFA 2GN3A 3K2OA 4BQXA 2BERA 4R4ZA 1A3KA 5LRRA 3A4UA 5JSPA 4QHZA 5C4WA 3H8XA 1TEIA 2VD7A 4MGIE 4XIOA 3S0MA 5CFDA 1UYYA 2JG8B 2XJVA 1RJ7A 2Y0OA 3ILNA 3ON7A 4UT5A 4LBJA 2F4LA 1I5ZA 2JIGA 2HBUA 2IXKA 4Y4RA 3VBRB 3D3AA 5DQ0A 4B7KA 3K4ZA 3FZ3A 1AR83 5J98B 1W9YA 2G4IA 2WR9A 3ACLA 1BCXA 5I0SA 4LKEA 3TB0A 1GFF2 2DCYA 4MLOA 3ZYIB 3AP5A 1PGL2 2VZ1A 3GXUA 2IZWA 3AYEA 3B3QE 1LODA 2JE7A 5ERLA 3AL5A 3I3QA 2XBO3 3RQ0A 5F7UA 3HR9A 2CDOA 1HJFA 2NMOA 3VGIA 1JZ8A 3OSDA 3OB8A 1FYUA 1MPXA 4A42A 5A1FA 5ACA3 2ERFA 3ZYJB 3RJRA 2R30A 1XPWA 2YC4A 1UYPA 2VY0A 3W58A 5KXCA 4A3ZA 3U4SA 4YVWA 2EXHA 3ZN5A 2KA3A 4MXVA 4QPGB 3JD72 5H9RA 2NYYA 3OPTA 3WDVA 5IVVA 2XL7A 5F2WA 3AMNA 1DYPA 3HQRA 4OI4A 4DEQA 5ACA1 2YUEA 2ZX2A 4UW4A 2VO5A 5FYVA 2ZOEB 1RMU3 4JDNA 4OI2A 2B9UA 5H9QA 1FNYA 2ZMKA 4E9KA 5AFEA 2GN7A 3VKOA 2VNGA 4AVSA 1HW5A 2W1WA 2WA4A 2OUJA 2VW2A 5KHKA 1O3RA 3MI8A 5IVYA 2WNEA 4AQ6A 2QQUA 3DCQA 1LGNA 4LBMA 1HV0A 4Y1XA 4NHKA 4Q4X1 4N53B 5FJKA 3WP4A 1VALA 3OY8B 3ETQA 2DVFA 4NWWA 5C9AC 3H8OA 3LOBA 5I91A 1RUC3 1BYHA 1IHMA 1WLCA 4S2HA 3C7GA 5ABJA 4D3WA 3KHCA 2QQMA 3VZMA 3LB9A 1ULOA 3POEA 1W8UA 1HQLA 1UXXX 5FMDA 1RUC1 3LKJA 1HXS3 4N7IA 1EYBA 3ZN4A 2UWCA 1LOBA 4LA3A 2P5BA 1U5YA 4CEWB 1H8TB 1YNAA 4ATEA 4UFHA 4JKKA 3BPZA 5FYMA 4O9GA 2F4PA 4TLGA 1R083 2VAUA 1PK6C 2VZSA 4V2VA 3WQ7A 3LEIA 2CAUA 3M4FA 1ULEA 4PDWA 1NXMA 1R093 2D93A 1JU3A 2HWB2 3GM8A 3R6SA 1W8ZA 1R081 3O1TA 3AVSA 4ZPIA 4X8NA 2ZBJA 2UWAA 1V6KA 1AYM2 1R091 4LK6A 3NV2A 4RHV3 3KV6A 4UW5A 3VDDB 4EWAA 5EZWA 5FZ3A 3U37A 1O8SA 2D3PA 2JJ6A 5A3UA 4DEVA 2C4XA 4JKLA 5BNQA 1JBCA 4GWJA 3VL8A 4Y24A 1LHWA 3PVBB 3MUZ1 4RHV1 4OUSA 3KSCA 2K46A 1ZZBA 2WNVC 1VBE2 2XONA 1G8WA 1P8JA 4IEYA 4I02A 2E33A 4AWDA 4FFGA 4JC1A 2TBVA 1LU2A 2ZS6B 1WLTA 3IT8A 2YXSA 4AK3A 4OHWA 2WS91 1CVNA 4TXWA 5FZDA 4NRQA 5FXXA 3NV3A 1LOCA 4XQWA 5FMOS 1OH4A 3NJVA 1UX7A 1EPWA 3SCFA 2K2SA 1WA6X 5FZ1A 1K3IA 1OQ1A 2Y6KA 2Y64A 1QJFA 5EYXA 5FAXA 4YZ5A 2A6XA 3HVDA 1FMD2 4R9CA 4CDWC 1CPNA 1HLCA 1LENA 1PIV1 1Z7S2 4LUKA 4BQWA 5LBFA 2GNMA 2WQZC 2Z4FA 3T2QA 1WD3A 1KFUL 4OQ9A 2Q5TA 1UX6A 1OXCA 2QZ2A 4NMIA 3RWKX 1CZTA 4HLTA 4RS5A 3N4MA 2G9ZA 2UWBA 4AHXA 5D8AA 4OHYA 2C6SA 3K51A 4BMBA 3PUIA 3ZKUA 3RZLA 4LORA 1HJGA 1UOBA 4XBQA 4IUGA 3VBRA 2ZGTA 1OVPA 5EHDA 1R1A1 4FSJA 1QJX1 1WCKA 1DCSA 3ST7A 4JCKA 3JU9A 3WINE 4CEYC 5JXHA 1V70A 3WP5A 4Q5OA 4XILA 4P9XA 1HB1A 2AC1A 4PJYA 4OLLA 4RGKA 2JG9C 4AOCA 4CU9A 3ZFFA 2PLV3 2Q30A 1RHI3 2A3XA 3B01A 3KT4A 4ZKTB 5A1LA 2E51A 2JDUA 4AI9A 1L7QA 1RUF2 3H3ZA 2PHRA 2W3JA 4UXAA 2XVLA 3W9AA 2Q4SA 3LFMA 5G04L 3CQOA 5K9YA 1TMF2 2W94A 1Y3TA 5FKCA 1O8PA 1J83A 3CBNA 4I3GA 1D2SA 2OKXA 4QPGA 3FMGA 4URAA 3FFQA 4QX3A 3MUY1 4E4ZA 2BQPA 4AEMA 5JCTA 1GYKA 3N7JA 4MZUA 2VL4A 4NPMA 1W99A 3VZNA 5BNOA 2XWBB 1QXJA 4WM8B 4YZ4A 3JBG3 1PMIA 1GP5A 4K6BA 3KGLA 4UI9L 1EAH1 1A34A 4WVZA 5IVBA 3RZHA 3UGHA 4YFWA 3VD3A 1GNHA 1VBA2 2BNOA 1ONAA 3IWZA 1OUSA 2EAAA 3INAA 2KD7A 3RZMA 5JZGB 4Q1RA 4YW4A 1RUG3 1SDWA 3DYPA 3KS7A 4XTPA 1M4WA 4CCMA 1GOHA 1KRIA 1O5UA 1SMVA 3WDYA 2JICA 4BQ3A 1SPPB 2JENA 1O6UA 2VQTA 3LA3A 1UIKA 3JB8A 4PQQA 3KCCA 1RUG1 2HWC3 2VCMA 3F2ZA 4OHXA 1QGLA 3WZ1A 1CAWB 1AXKA 3MIHA 4CU7A 2H6BA 2R32A 4PLNA 1BEV3 4IESA 1REFA 1YC61 1ND2B 1CAXB 5FPUA 1AXZA 4GA9A 2XPJA 2GP5A 3GDBA 3M3QA 4LO5B 2FCVA 4WVVA 1S1AA 1T6GC 2BGPA 2Y34A 4FP3A 4I30A 4AEDB 3IZOA 5KXBA 1UYXA 3SQOA 2ZGNA 2WZ8A 4YGBA 2DCJA 1ASJ2 3ZSEA 2O1QA 1H2LA 3VBUC 3RNSA 3WF4A 2VUDA 4P9WA 5CIRA 3I2OA 4K8RB 2ZJCA 4YZ3A 1O59A 2XL9A 1NLQA 5FXWA 5LA0A 3DYOA 2R062 2WQ8A 1FPN1 5F5IA 5BNPB 2EALA 1IS4A 1UYZA 3UJOA 1TNFA 1FV3A 1POV0 4PBOA 2VQ0A 1ZBE2 2R6QA 3WVJA 5KHHA 1QJZA 4Q4W3 5E6HA 4CCKA 1LOGA 1J1LA 3SCHA 4D94A 5KXDA 2BWAA 1UPIA 2RMU1 2WNUC 2YROA 1C8M2 4QPIA 4MGKE 4NHYA 1FOD3 4QHOA 4W65A 4E4DX 5FYTA 3NJYA 3C7EA 2IXLA 4IQPA 3CL1A 2HKXA 3U0ZA 1AR92 1DZQA 2OPWA 2EIBA 1TNRA 3TN92 4QWNA 4XZUG 2JG8C 2PAEA 4RR3A 5DDJ3 2FDIA 4MYEA 4R9AA 5F32A 4I2OA 2AEZA 5F6LB 4BOWA 4Z07A 5A70A 5A6QA 3IM0A 4B29A 3WF2A 5I93A 4I09A 1VB2A 4HOOA 1BKZA 4KGQA 3BCWA 1RUH2 4D7YA 2QTWB 2VUAA 1AX2A 1TME1 2ZGUA 3WCRA 3ZSKA 1IS5A 5DN2A 2R042 2YGMA 3GZTB 4A7KA 2JDAA 1GANA 3WDTA 5FYHA 4HONA 1YWKA 1JOJA 4RFRB 1C5IA 3LA7A 4AFMA 4CXXA 2CV6A 3H1YA 2WL1A 3NJZA 3I2DA 2P2KA 4LEJA 3IAQA 4QGNA 5DAVA 3MLKA 2YYOA 3ROUA 5A7QA 1JI6A 1AX1A 2VBBA 1K5MA 5E8AA 3LPGA 3NQHA 4IEQA 3ALQA 5I0RA 3HNYM 4NRPA 5I0DA 2GC3A 4MGYE 3HBKA 4AFAA 3B94A 5L7OB 3ZOIA 2LM3A 3CMGA 5FPLA 1XE8A 1W8FA 1SQ4A 4IERA 2ZGRA 4ASMB 3CZJA 1Q56A 2VVFA 4AG4A 3MV01 3E6DA 4IEWA 4A7YA 1XE7A 1AR82 1MS3A 2PQSA 2BU9A 4M00A 4WM8A 2ETEA 1E5HA 3HQXA 5FP7A 3WG2A 3AKQA 4W4ZA 2XBO2 4PCRA 4HMZA 4ES9A 1AR63 2Q1FA 5BNNC 4DXSA 5F3CA 4DXRA 5ACA2 3Q8EA 4CEWC 3GGLA 1H8TC 3AZWA 2BTVC 1EY2A 3SKVA 5JZGA 2JKBA 3LSEA 1W8HA 3TEWA 4GIQA 3IIAA 1IZ3A 1IQDC 2VZQA 5LZ6A 1WKYA 4CDQB 3RMYA 1RUI3 1ZBA3 4AQTA 4WM7A 1CIYA 2I2SA 3KB5A 3TAYA 4B1LA 4JGZA 1RMU2 1QKQA 2DDUA 5DUXA 5FLIA 4I0WB 3OYWB 4B7EA 5E16A 1S4CA 1GWLA 1DGRA 4G9SB 2OW4A 5DAXA 3S57A 1CAXA 3VDDC 2A1XA 2A75A 3A0KA 2DVDA 5HPOA 4IGOA 3KF5A 4NE9A 4NHLA 4RGAA 5TSWA 5FV3A 1UXZA 4XFHA 3VLBB 1RUOA 1RUC2 3WNPA 2I07B 3KQ4B 5CAZA 1VE0A 5JAXA 3VHOA 4ET7A 3AZVA 3VHNA 4UW3A 4LR4A 5A3WA 3HN1A 4F3JA 3IKWA 4XF4A 4DZGA 1W6PA 2A3YA 1NT0A 3C2UA 1HXS2 4FOQA 1NCRA 5F8PA 2FMDA 2X10A 3LEMA 2E31A 3EXUA 1Y7BA 3GHNA 1W39A 5BNPA 1RUD1 1AUYA 4Q0PA 3AFGA 5JIAA 5E89A 3TEZA 1R082 3UKVA 4ISQA 2QQPA 5JPNB 3J26N 1JYTA 4CRQA 3AP9A 5DUWA 1HRV3 2F6BA 3DN7A 2BJSA 1W0NA 2RDNA 3EQEA 4Y5SA 4Y4YA 2X8KA 3GZAA 1JU4A 1DF0A 1NQDA 2E32A 1LRHA 3H8RA 3BTYA 1OSGA 1QOTA 2BOJA 1YQ2A 3BODA 2WBKA 3V65A 4XOGA 1C28A 2RS53 1HRV1 1AX0A 1W6NB 4XC9A 5CKNA 5HXMA 5IFPA 4B8EA 5GLWA 4QQ2A 4HVQA 4Q29A 2XH6A 1EP0A 5FZFA 4J1WA 4FXKB 4CCLA 4ORFA 5A3NA 5C6CA 1AHSA 4FPEA 2RS51 1G7YA 3H8UA 1YFWA 1A8DA 4FI9A 1ZRRA 2XLGA 4P9YA 4GWIA 4XUPA 3EB7A 1PO13 3S30A 1ALYA 2PHFA 4Y20A 1UZZA 5C9AB 4MHRA 1LR5A 3AYCA 3IMNA 4DY5A 2V73A 4GH4A 2FDGA 5H9SA 4UOJA 1C3HA 1U12A 3M70A 5DG2A 3FC0A 2CNAA 1WGPA 1U5IA 3B00A 4OUEA 1W6MB 4LIVA 4OMCA 4Z92B 4P5YA 1C1FA 4BCUA 2CL2A 3HQUA 4LBLA 1REDA 4F7ZA 1NE6A 5CADA 5L9VA 1LHVA 2YMZA 3AZXA 3I2FA 3NNGA 4YLZA 3THCA 4QDRA 2YDEA 2J22A 2PHWA 1QEXA 3I2JA 3HT1A 3SKJE 3C7OA 4CU6A 4OULA 4CVUA 3ZXDA 2LTNA 1MS4A 1JS9A 4GKYA 1KS5A 2VMDA 3GZEA 4A6OA 4X8PA 5A32A 1KDKA 3MIFA 5FPBA 1N3OA 4QGLA 4BH9A 4CDXA 1GQHA 4LO6B 4A2UA 1MR5A 4HPKB 1O3SA 1ZRFA 3OGJA 4HN1A 2ET7A 5L7OC 1XQNA 4GB33 4UBHA 4BXSV 3DKWA 2PLV2 5CU1A 1EUUA 4K7JA 1RHI2 3LF7A 3S7EA 4CPBA 4DUVA 2FCTA 2WSVA 2VNVA 4GAZA 4DPNA 1NQJA 2Q8EA 4AGRA 1LULA 3VD4A 4KG0A 5DAQA 3ZFGC 2IXJA 2R0FA 4UYBA 4CUCA 1PGSA 3U10A 4CU8A 1UZYA 1OURA 5DZEA 5FYIA 4IE4A 3CJIA 4XURA 4E2GA 5KBFA 4EROA 1ND2C 1PO21 2E7AA 2D3RA 2ZGKA 4LHSA 2ADDA 4CYDA 4LKFA 5JIUA 3LDKA 4TZDA 1ND3A 4FXGB 4HETA 5FZOA 3SEEA 4ATFA 1AVBA 1UOFA 3E5UA 3H9AA 4AEDC 2LUWA 2ID4A 1B35C 3JBG2 2A6YA 4AVVA 3AXEA 1CPMA 2DTWA 2WINB 4CDWB 2HWE3 4FAGA 5JLVA 1GSLA 3POGA 1W0PA 2ARBA 2W2IA 3HJRA 1QDOA 3PUAA 2VXRA 3UKTA 4FPKA 5FZEA 5C8CA 1VPHA 1VRH3 2AGSA 1OA2A 3ACGA 1VBC3 4O65A 1AL23 1Y4WA 1RUG2 1W6OB 4QX0A 4Y1UA 3HD8B 4LBQA 5FZHA 3U78A 3VBOC 3VBSC 4AR2A 5K8SA 3PURA 2E63A 3ZYBA 1QDCA 4QQLA 5F37A 4QXKA 5LRSA 2EVXA 1DU3D 1OLRA 3KMHA 2BEOA 1VBC1 4W50A 1BBT1 4CEYB 3I59B 2HWC2 3RZGA 3PVEA 1RTVA 3WDUA 1AR73 4C0BA 2I45A 5FRAA 3VV1A 1NCQC 4X6RB 1BEV2 2VZ3A 5HCBA 2JG9B 4LKSA 1K12A 4GD4A 4QPYA 1PZ9A 1AR71 1W9SA 1OOPB 3CJXA 3I97A 3JCIA 3ACIA 5A7WA 4H2AA 2QZ3A 4N7UA 5FZCA 2VBDA 5CKMA 1BVVA 4XMAA 3S7IA 5BYNA 2QCSB 5CFCA 1KD7A 1GNYA 5AFBA 4Q8LA 4MO3M 1PMHX 1UCXA 2IFWA 4JTOA 1H6XA 4L97A 3ZXFA 2OZJA 2IVIB 3G7DA 3K48A 1ZM1A 2P6CA 3BU7A 4IEOA 4QB1A 1YI9A 2IVJA 2RR11 1ENXA 2DYCA 5F3GA 5KXEA 4N43A 1GZCA 3IPVB 4L2NA 2FD8A 1ZZ6A 2Y38A 2RM23 2BV4A 3AFKA 4KH9A 5IUQA 3T2PA 2WFF3 2TEPA 3LGRA 2OQ7A 1W8TA 4Q4W2 4ZU4A 1APNA 1YLLA 4C1XA 3L2HA 5C70A 3MIBA 2JDZA 2BP6A 1POQA 3B9CA 4FBFA 1GZTA 1LB2A 3WNXA 1FOD2 2WYSA 3QLQA 2J1TA 4EN0A 5FQ0A 3AMPA 4CSWA 1W6MA 4SBVA 1SEFA 1DQ1A 2ENRA 3BYWA 5DDJ2 3UKNA 5FO8B 3K77A 1U0AA 3Q8AA 1MS8A 1D4M3 4YZ1A 1DYKA 2QE3A 4QX7A 3H50A 4XF3A 4YW3A 1PK6A 2GNTA 2VCCA 2ZMNA 2YB7A 3R4UA 1IG3A 1N1VA 3ME2A 3EHKA 5A7OA 5C5TA 3J8F3 2VULA 5A3PA 3D8CA 1QJY3 5DPNA 4IEUA 4FPLA 1KJRA 1YIPA 4EZHA 3ZKYA 3WF1A 4CP9A 4QX1A 1GU3A 3HBZA 2ZHKA 1K45A 4OZXA 4WBBA 4XAEA 3J8F1 3VBUB 1X82A 5L73A 4AGGA 5GZFA 4AVBA 4Q4Y3 4YW6A 2YC2A 4AZZA 3N9MA 4OHZA 1COV3 1GZWA 1UKGA 2IXCA 2C9AA 4NPLA 5LBBA 1PM4A 1KITA 4CDQC 1VBB3 3QACA 2WNVA 4LIUA 4Q4Y1 4BQYA 1MZ6A 2YU2A 2B8MA 4J1XA 3LD8A 5BV6A 4URTA 2VMEA 1KDMA 1YYNA 4BQ2A 1W04A 1VBB1 3ACHA 3POFA 4HANA 3VD9A 3AKPA 2CSGA 2A7AA 1S0DA 2WNUB 3O1OA 4M4PA 2FZ2A 3WW3A 2OXBA 4LA2A 5GZEA 1DGLA 2ADEA 3W5MA 5FY7A 1ZA7A 4MVTA 3OBTA 2WSUA 1UOGA 4YPJA 5T5LA 3W5NA 3O1MA 2WAOA 1ZREA 1GOGA 1RXGA 1UWWA 1S2KA 5I8TA 2VTXJ 3VZJA 1G9CA 2ZXQA 2DURA 1UZVA 1ZA4A 4LO8A 2SLIA 1UU6A 4KWLA 5EJZB 2OA2A 1AR62 1QY4A 2P3JA 3LZZA 5KHGA 1H6YA 4IV1B 3WW1A 1RYYA 1QQP1 3BGAA 4Y33A 3ZMOA 2GSYA 4I0BA 3VKFC 1G6NA 1QXPA 1W2TA 2WLQA 5KHIA 1LNSA 1S0JA 3BKZA 3O1PA 4BMEA 5FZKA 4W6WA 1JH5A 1RUI2 4QXCA 4E4SA 2VVDA 2V09A 1ZBA2 4RN5A 1N47A 1Q5OA 3A23A 4D7SA 5A3OA 4Y3OA 2D3SA 3D82A 3I59A 4Z2WA 3V0AB 3PMSA 1DZTA 2VOTA 4Q4V3 4LO7A 4AEJA 5J1XA 4IE5A 3TWIA 3OCPA 3AL6A 4FPGA 2YBKA 5LWBA 3NWKA 4Q0UA 5GALA 2EF6A 4KBZA 2TUNA 4QDSA 3UYJA 2BRTA 2ZTNA 3GCXA 4INDA 4WVMB 4Q4V1 2AYHA 3DECA 4M3CA 4MGZE 3U07A 3MLLA 2VVEA 5CEHA 2XJSA 3MW2A 4CZSA 1ODMA 1GLHA 2D97A 4Q4X3 4XFFA 2DUPA 4ZZ8A 2VXJA 4YM3A 3KLSA 4AI2A 4NVPA 3B7MA 2BFUL 4C1WA 2VZUA 2FQPA 3QBQA 4EN8B 2HEYF 4OFGA 5E88A 2ZAAA 3VD7A 4HKOA 4LMFA 2MHFA 1UMZA 1W06A 2P1BA 1V0AA 3AXDA 1AXYA 2PHUA 1DGRN 3THPA 2PMWB 1PNFA 1U5ZA 3J7HA 4M0HA 3W20A 2WO7A 4S2DA 1VBD1 2RJKA 4HK8A 2YBSA 4YVSB 2HLEA 2VMCA 3PJYA 4XFAA 4BQ1A 3OGSA 2IWGB 3KV5A 4QX2A 1SZBA 3RG0A 5BNNB 1HRV2 1JYNA 5CG8A 1RC6A 3O7OA 4P08A 2V72A 4QKFA 3H7JA 4F8AA 3I2KA 5JI9A 5FO9B 3B9IA 5IATA 4PLOA 1KEXA 2PHDA 2VTFA 2G19A 3CEWA 1JMUB 5JXGA 3ACFA 5FY5A 1CAUB 1N1TA 1WCQA 2VR4A 5I8SA 3NO8A 4ZS2A 2YG0A 1V6NA 4S2FA 5HCHA 1K5JA 3H1MA 5FY4A 3AC0A 5KC6A 3ZXGA 5CISA 1CAVB 4U2AA 3IAPA 2PTMA 2VBPA 4KNCA 1ULGA 5FPVA 3U14A 4QKNA 1PO12 5FLHA 2W47A 5AC92 1HIXA 3ZFEB 2RS11 4CDUC 1XNTA 2GC2A 2EXIA 2QQJA 3RGBA 1TG7A 1W3XA 2DBNA 1W6QA 1NLSA 4XJUA 2LS6A 1WCDJ 2WS93 1VR3A 3WG4A 1IPKA 2VOXA 1XYNA 2QQIA 3TYJA 1W05A 2EIEA 2VUCA 2KM2A 4A3XA 2D43A 3ZYFA 2J1VA 1N3QA 3WR0A 3VBHC 5FWJA 2YGLA 3SMHA 2BPA2 1MQTC 4QQOA 5BPXA 4FPOB 2OT7A 1PIV3 1LOFC 1MZ5A 3RI9A 2FMYA 3U11A 4BXFA 4HK9A 4RQPB 4CCNA 3E6CC 1QOSA 1KJLA 1R64A 1RINA 3FN9A 4GQ7A 4HVOA 1YRZA 4XXAA 4CA9A 2WNUA 5FYUA 2HEVF 4AHWA 1YFXA 4IGQA 2YHJA 4P00B 3WNOA 4XQDA 1C57A 4QB2A 2C9KA 2ET1A 3AJZA 4JX0A 2WAAA 1R1A3 2J42A 1QJX3 1V6MA 2JG8A 2NMNA 1J84A 4GB32 3CLPA 2H0BA 5AVPA 4CPBD 3AZZA 1RIRA 2GH2A 5C4WC 3SISA 4GULA 3MBWA 1I1EA 4ASKA 5CFDC 4FPYA 2YFUA 1RVF3 4Q2FA 5LEJA 1Q3EA 4PIXA 2X53S 4Z2AA 2Y26A 4RSUA 2JB4A 3T1MA 3WSOA 2JD9A 5A3TA 4MX3A 5EJ3A 2NLRA 1NX9A 1GQPA 3MPPG 1U5XA 3LFIA 1RVF1 1SDDB 1UY0A 5FZ7A 2E53A 3A22A 3O0WA 3ZYGA 1X36A 1OOPC 3FUQA 3V0AA 1DDLA 1A78A 2J1UA 5JWPA 4QU2A 4XYXA 4BWOA 5D2AA 2D6OX 2YBPA 2HWE2 1J3QA 1CR7A 3GZUC 2BUKA 3V64A 4LXLA 1NAEA 1X7NA 1WWYA 5F5CA 2G9GA 3B93A 3K4DA 3LWCA 4BK4A 1EAH3 5FTTC 4NHMA 1Z0HA 2P3YA 1LKNA 1VRH2 3PIGA 4YVWC 1REEA 3TNPB 1AL22 4GKXA 4LBQD 3ZSLA 3ZXLA 1CONA 3DEMA 4HSJA 1NZCA 2XMLA 4DOUA 2MPFA 1CQ9A 1LGCA 3QH7A 3IDEA 3R4DB 4H3WA 4N53A 1ST8A 3OY8A 4HFSA 4XIKA 4WV8A 3V56A 5FPZA 1A8MA 1AR72 1NY72 3M2MA 3UJQA 4AF9A 1LAJA 1QH7A 2FHRA 1NYWA 2VMFA 3EO6A 4P9IA 4NIAA 5LA1A 3ZX7A 5BXXA 3ZVXA 5FYZA 1H4HA 3LA2A 5BNNA 4UAPA 1KFXL 2J1EA 2QJVA 5LASA 4GMP3 4EJRA 3ZSMA 5ABJC 4L8QA 3ZFGB 5ANNA 5F3EA 1H8TA 4CEWA 4OI1A 4ARYA 3QCWA 4IE0A 1NA1B 2XWJB 1UL9A 3VL9A 2P34A 5FZ6A 2JECA 4GMP1 2WZEA 3R4SA 3CZUA 3LPFA 4XBNA 3O1SA 3GJAA 3I2GA 4H7LA 3MZHA 5JUVA 4XF9A 3AKSA 3IN9A 1OFSA 1PM7A 2ZGMA 1SFPA 2RE9A 2VJXA 3KVAA 1B35B 4KU8A 4MXWB 4BA6A 2O14A 1YJKA 2WDBA 2RM22 1FPN3 2BNMA 1LTEA 5DUVA 3VDDA 1RUE3 2WFF2 4AI3A 3RS6A 2VZTA 4IEXA 3SH3A 3TEYA 5FXZA 5FMCA 1XRUA 3FFZA 3DUIA 2EIGA 4I3PA 4EWDA 1ZRIA 4LITA 1E57A 2DF7A 3PNAA 1D2QA 4EN7B 1RUE1 3VBOB 1N1YA 1DLCA 3VBSB 2RMU3 3AKRA 1FV2A 5FLJA 3ITQA 1OA3A 2A70A 2RS31 1MS1A 1SCSA 1DFQA 1UY1A 4HL0A 1XU2A 5FY0A 1HB4A 4PF5A 4XDQA 3VKMA 1Q8SA 1D4M2 1NCQB 4QKBA 1US2A 3O1RA 4M3CE 3M3EA 3NKGA 1YFUA 1O4TA 2ZGQA 4LBOA 1H1AA 1LCLA 2XOMA 3OBRA 3P1IA 2ZX3A 2HWD1 4HG6B 5L9BA 2WN3A 4XFGA 5KHJA 5LEKA 1QJY2 3L9JT 3N9QA 4QX8A 1BMV1 2V4AA 1E5RA 3KV9A 5LA9A 5FDBA 3ZXAC 1GBGA 1TME3 4ES8A 3BUCA 3O5SA 3PVNA 1W9WA 1DZRA 3VDCA 4GWMA 3WQ0A 4IV1C 4CTEA 3N36A 3G6JB 2H6CA 2UYAA 5GZCA 2Q1MA 3N35A 1S0EA 2WWJA 5FZAA 4LBNA 1OQDA 5JVVA 1GKBA 5E1RA 4LO4B 1L7LA 1COV2 4AAXA 1UZWA 2ZHLA 3IDCB 2C1FA 2TNFA 3T4HB 4JGYB 5FOBB 4FTBA 1OKQA 4QQHA 2XXZA 1W90A 3LDBA 4OUMA 4Q1PA 2X29A 1IOAA 1EV13 1QXRA 3WDWA 3MHZA 5D8AC 4DS0A 1VAMA 1T2XA 2ZEWA 2W46A 3M3CA 1OHFA 2DUOA 2GMMA 1N1SA 2IXIA 3AP6A 4XACA 5FMBA 2ZABA 1XYOA 3MGUA 4E4HA 2MEV3 2VMIA 4XABA 1EV11 3MF6A 1TQ5A 3GCWA 1HQWA 4KWJA 1GMMA 3RPQA 1RB8G 2GNDA 2YU1A 4TWTA 2IUWA 4NIIA 4AI0A 2G9FA 1AL0G 2MEV1 2PHLA 2YC0A 4IEVA 4KQ7A 2P3IA 1XNBA 1SBFA 5F3IA 5GZGA 3C8XA 2C0ZA 2Y6LA 1JXNA 3O1VA 3OBAA 3PUSA 4AI8A 3HPNA 4NIGA 5KWRA 1WCSA 4Y5Z0 2WO1A 2AH2A 2DV9A 2A6WA 4BIFA 4BLJA 2VU9A 5C3RA 1QNWA 3POSA 1D0HA 3USUB 1CX4A 4WVWA 4YVSC 3ZPYA 5FR3A 5L36A 5JOWA 4AHZA 5GZDA 5BNOC 5GLZA 4D69A 1SLBA 3H3UA 4Y1ZA 4Q4V2 4FOVA 3PU3A 4CUAA 2VZVA 4H14A 2XQRA 4PI0A 1V6LA 2XUMA 2NP0A 1MEC1 5JPMB 1HN0A 1AZDA 5AVAA 5FKBA 4C91A 4XXPA 2WABA 1WMFA 5BY5A 1O5LA 1SPPA 1YFYA 4L9BA 3T0BA 5CBLA 1UZ0A 3JXSA 1SBDA 3PU8A 1UNBA 1CAWA 3DPRB 3BIWE 4K20A 2XJPA 4Q4X2 2ZEXA 1OPMA 4QGMA 4AVCA 4DO0A 4EE2A 1LECA 4AW7A 4W6XA 3RSJA 4KMQA 4WZCA 1S55A 1ZRCA 4XEZA 1SHWB 1OMIA 2I74A 1ND2A 2EXJA 2ZAHA 4M0NA 1WBLA 2R7EB 5CVRA 4XTMA 3PTYA 1LOAA 4UF0B 1DQ6A 5FK8A 3ZFEC 4QXHA 1S0GA 4AEDA 5DAWA 1Q43A 3N3HA 5K0UC 4NPRA 4NR1A 5FP8A 1WZXA 1XYPA 2BVVA 1HN1A 1RUD3 4FT8A 1YJLA 5FREA 2QVSB 1OLMA 2WFPA 3KWVA 3VDAA 5FO7B 1PZ7A 3I2IA 5A6ZA 3I49A 2VZOA 4BISA 2VC9A 4KL1A 1DQ5A 4PI2A 3PUHA 5DXDA 4RYDA 3T2TA 2E7QA 3VBOA 3A0NA 1S0CA 5T3NA 3WNMA 1PGW1 3MIEA 4P9LA 2LROA 4AI1A 1XOYA 2DVBA 4TYSA 5FYBA 4RQPC 4ZHNA 1QWRA 1R092 1X9TA 3QD6A 2BFUS 1Y43B 3IDAA 4W6YA 5CG9A 3FUOA 1YIFA 3K4AA 1NCQA 3T08A 1F5JA 5LCWL 2CGNA 4HN0A 1JTZX 4RHV2 3VZLA 2VTXA 3CDZB 5FBJA 5IW0A 2ZX1A 1F2NA 5GM0A 2GMPA 5F5QA 4QPIC 5JR7B 1UY4A 5A3LA 1PVC3 2DU0A 2PXJA 2WUHA 3OUHA 4XDPA 3Q8CA 4GWNA 4XJWA 2WS92 4OMDA
chains in the Genus database with same CATH topology
4AFCA 2NM1A 3C3VA 3X29B 4QM8A 5HBAA 1PVC1 3QOPA 2Z69A 1LHOA 4FO9A 3VBFB 3NL1A 1PIV2 4HSLA 4B4RA 5A3MA 1CN1A 4DINB 4JTNA 4ITCA 4YARA 1S2BA 2HEWF 3ZDSA 1VAVA 4DQAA 2DVGA 4YGDA 3ES1A 5DG1A 3E97A 3ZYPA 2R073 5L7OA 1R1A2 1QJX2 4XETA 2Z79A 3GHMA 1AYM1 1K5MC 1VP6A 2PFWA 2DFBA 3KZ4C 3UK9A 3ZIXA 2GALA 4FP2A 2CGOA 3FLRA 2PYTA 2R071 4CP1A 4JV4A 4IV3B 4R9DA 1RVF2 3UL2A 1VBE1 3U4XA 3ZN6B 4CDUB 3HT2A 1SLTA 1LU1A 3SXWA 3JZVA 3MF9A 3POWA 4DRRA 2BGCA 5HXVA 1XXNA 3AK0A 1PO23 2AENA 2GDFA 3V0BB 1H9PA 1RUJ3 1NA1C 1CJPA 3AB0A 3FWEA 3VBHB 1MS5A 4CDQA 1S0IA 1MQTB 3ILRA 4AXOA 2X5IC 1FMD1 1EAH2 3KCYA 1Z7S1 1RUJ1 3OYWA 1URXA 4HKWA 2WLPA 1BXHA 2BNNA 4WM7C 4Y22B 1Q8PA 5LK7B 1Z78A 1UKRA 4HVRA 4XJ8A 4YG6A 4LE4A 4FAHA 3L2YA 3WG3A 1BBT3 2FBEA 2JX9A 2DFCA 1O7FA 3ATGA 5C4WB 4OHVA 1ZZ9A 4RL7A 1VB4A 4ZXKA 5CFDB 4ZU5A 4KG8A 1XU1A 4YGCA 2UY9A 4YGEA 1RUF1 1LJ7A 4NOTA 3MPBA 4N9HA 3MW4A 4G3YC 5J3UA 2E6VA 2GC0A 1H2MA 3HMYA 4OVEA 3WT3A 1ZNPA 5FBZA 1FPN2 2RR13 1W6NA 3NAPC 1RUE2 3VHRA 2DTYA 3JQWA 4QHBA 4V1PA 3JQXA 3S6PA 2WT2A 1PZ8A 4SLIA 3WLUA 4EV0A 1WLWA 4AQSA 4JGYC 3Q9OA 4YVWB 4FTSA 2ZGLA 4XW3A 1VBA1 3O0VA 3B02A 2RMU2 1MS0A 1UW8A 2D6KA 1DQ4A 2ZCWA 3WUDA 2GU9A 2B46X 2W52A 5C9AA 1H1MA 2QDNA 4TSVA 3FLPA 4BLIA 3TNQA 2KXLA 2B42B 2R0HA 1NOVA 1QHDA 4LT5A 3O0XA 1OA4A 2MNGA 3MICA 1X33A 3VN4A 1POV1 3AZYA 4D7TA 2WZR3 5K7PA 5EFUA 4COZA 5ABJB 1DGWX 5T54A 4Y26A 1TME2 2UU8A 4HT1T 1SBEA 2WKKA 5I0TA 2GMEA 4LNVA 2R49A 2WZR1 5EYYA 1ASJ1 2E9QA 3I7DA 4Y1VA 1LEMA 3I8TA 4R52A 3WG1A 2W08A 1H2NA 3B5LB 3AMHA 1AF9A 1BVP1 4HPKA 1EV12 4PDWB 1I6XA 1LGBA 4DB5A 2AZ5A 5GKAC 1C8M3 1DGWA 3KQRA 1ZBE1 2MEV2 4CDXC 3RDIA 3D5OA 2A5ZA 2V5YA 4JAAA 1J3RA 2B5HA 1GV9A 1CJDA 5I8YA 1V9U3 4Q0SA 1C8M1 5GJ6A 3J4UH 3ZYRA 4R9BA 3DPRC 1WA4A 4AHYA 3WDXA 1AR91 4I01A 1MQTA 1C1LA 1V9U1 3RWNA 4K40A 3OF1A 3VKLA 1RL3A 3BOWA 3JB4C 4YW5A 1LOFA 3EBRA 4K1YA 3OJBA 2R043 1H0BA 3CJIC 1JUIA 4QD2A 4CDWA 1QQP3 3D0SA 5J37A 1UIJA 1RUH1 3MW3A 3LSDA 3WCSA 2R041 5J7MA 4FVVA 3OPZA 3O12A 2HJIA 4G4FA 1AYN3 4N9IA 1W6OA 1CGPA 3KD4A 3MFAA 1D4VB 2Q0AA 3UV9A 4YW1A 1H9WA 4RS5B 4Z82A 1SFYA 1AYN1 5C8CC 4CEYA 3DGTA 5D8AB 2R1BA 2VNRA 2JG9A 2YZ4A 4JQRA 3OGGA 4HBNA 3WOGA 1W0OA 2OUHA 1IQAA 4R4XA 1OOPA 3ZSJA 3CO2A 1NG0A 4BZ4A 3BTAA 2A71A 4K1ZA 2ZHNA 5JOZA 5T5PA 4YFZA 3ZFFB 1JYCA 1AR81 1ZVFA 4K3UA 4S2GA 1RUD2 3VZOA 4E2SA 1LESA 1AJOA 1MVQA 3GF6A 1VBD3 1PGW2 2VQAA 2SBAA 5CB7A 3ASIA 3J9SA 2XBO1 3I54A 5DZGA 5CFCC 3VBFC 3IPVA 3WW4A 1UD1A 5DUUA 4AFBA 2ZA9A 1XNKA 3GBGA 1JYIA 4RA0A 1FNZA 5J48A 2ZX4A 5BNOB 2WIIB 5GLVA 5C33A 4N43C 4Z1VA 4XJ9A 4Q27A 1JW6A 4FPHA 5GLTA 3BALA 4CP0A 1OPOA 2RS52 1RMU1 4UW6A 1OLQA 1G9DA 4BE3A 3OD0A 3P3PA 4FPFA 2QUOA 2B7YA 1PVC2 4QQPA 4CP2A 5L19A 2R16A 2RS13 4MH0E 4IEPA 2A3WA 2XLFA 2ZGPA 4IV3C 3SCGA 1QJU3 2C5DA 2B39A 1GNZA 1WLDA 4NN0A 1YI7A 2DCTA 1ENQA 4LUMA 1GZ9A 1LHNA 2YV8A 5K0UB 1HXS1 1QJU1 5EWSA 3VBUA 1WUVA 1HX6A 1ZYBA 4WZFA 4YM1A 2PELA 1G9FA 3ZIWA 1HQNA 1B09A 3SH4A 2PAMA 5J36A 3RYKA 1FT9A 4K9SA 4BYYA 1WMEA 4J6GA 2UY8A 2VOKA 2IXHA 2R072 4XQ4A 1J58A 2OYZA 1QH6A 4XZPA 2LALA 4FPJA 4GXLA 5IK8A 2WQ4A 4NO4A 2EXKA 1Y9QA 5J96B 2Z2SB 2GAUA 1IS3A 4U36A 5F6KA 3WP3A 2VMHA 1SFNA 4QPIB 2ZGOA 4LHNA 2K0GA 3SH5A 2PN5A 4P9GA 4H55A 4IV1A 4BM8A 1BQPA 1PO22 2DVAA 1HV1A 1RITA 4RR3B 1ZZ7A 1RUJ2 1FX5A 2CAVA 2VMGA 3DL3A 1WW7A 4ISRA 5T55A 4MSVA 4MV2A 4OI0A 1X8MA 2ZHMA 1UU5A 2P17A 2VOWA 2DCZA 3ZMNA 3ZXJA 1MS9A 2XJQA 4COVA 3MIDA 1DG6A 1FXZA 2ILMA 2PHTA 2HWF3 2W0XA 3PMEA 5GLUA 2N7GA 3KT1A 5FFOC 3GBWA 3VHPA 2ZKNA 4YG3A 4WVMA 3GALA 3ZXEA 4META 2HWF1 3AJYA 4QT6A 4FTEA 4JDMA 5DZFA 1VBC2 1UPSA 1BBT2 3M3IA 4QMAA 1K5MB 4XJZA 1UF2C 1R1ZA 4K21A 4KGGA 1O4YA 2P3KA 4GALA 3ZXKA 3AX4A 3BOPA 2PLV1 3ILFA 1RHI1 2Q1ZB 3PVOA 4XBLA 1SACA 3GNEA 4IXLA 4LHKA 1WW5A 4YVSA 1CESA 1FAYA 3ECQA 2O8OA 1XNCA 3WHUA 2CGPA 3AP7A 4BIOA 4B3NA 4ZU7A 1WMDA 4JVAA 3BB6A 4DFSA 1CAUA 2RR12 3GYDA 1C8NA 3M8LA 1GQGA 4AEKA 3JBG1 2X5IB 1HRI3 3DF0A 1HKDA 4AE2A 3I4IA 1QF3A 5JOXA 1CAVA 5CNAA 3FHIB 3MYXA 1HRI1 2CY6A 4M3CF 3ELNA 4PDWC 2XJRA 4WM7B 2NQYA 1SLLA 4JGZB 3ZFEA 2K9ZA 5T50A 1ENRA 2VECA 4YM2A 2D6LX 2RS33 2YY1A 5K0UA 4BPZA 4P9JA 3MFCA 2HWC1 3THTA 3WXPA 2GH8A 1RGSA 1BEV1 1QU0A 2VG9A 2WZR2 4DNYA 4B4QA 3T1LA 2BW8A 2HWD3 1SLIA 4RFT0 4DRVA 3WW2A 2WWSA 1W6PB 3NV4A 4YW2A 1OD5A 4PLMA 2QDRA 1J3PA 1NCRB 1IKPA 2UURA 3HAGA 4RQPA 4F83A 3J8F2 5A33B 1GICA 1L3JA 2BYVE 3HWJA 1G86A 2AUYA 4Q0QA 3WQ1A 3D4KA 1C4RA 3SNMA 2DUQA 2P37A 1OI6A 4RD7A 5CA6A 2D6MA 3NAPB 2D44A 3FLTA 2WT0A 2VNOA 4Q4Y2 3TOJA 4DMIA 4QX5A 1BK1A 2OZ6A 3NW4A 2BBVA 4YZ2A 1LOEA 1DHKB 1VBB2 4Q4W1 4COUA 1NLRA 4RS5C 2A73B 1AJKA 1V9U2 4L11A 4ASLA 2YPJA 4QM9A 1YCIA 1FOD1 1ULFA 4XHXA 4X6QB 4YYOA 3TBDA 2CYFA 4R8HA 4N90A 4A7ZA 3VBRC 1H30A 5DDJ1 1O3TA 4FOWA 3CNAA 4Y20B 4COYA 3RJ2X 3LOIA 4AVTA 3RYPA 2CWMA 4ONUA 3ZFFC 4FQZA 1QQP2 4GH4B 3WX5A 4TLFA 1JUHA 4LTAA 3N7LA 3OD4A 1NE4A 1I9RA 2HYKA 1YXWA 4XE9A 3AYDA 4LE3A 2BWCA 2PAKA 2PQQA 4AFDA 1AYN2 4P14A 4QPGC 3DV8A 1IS6A 1IGOA 1O4ZA 4PBPA 3H0OA 4FOYA 5BUVA 1MEC3 2AR6A 5JDBA 3MDPA 4AYUA 3KT7A 4LLOA 1DLLA 4IEZA 1LHUA 5A32B 4FQ4A 4KBBA 3NV1A 4CDXB 5FOJB 4N53C 5HCAA 3LAGA 5J09A 3KM5A 3MLJA 2GC1A 2AREA 4K8FA 5KC5A 2D98A 2H0VA 4XFBA 3ZFGA 1KXGA 2EAKA 1NA1A 2D5HA 1QNYA 2QKDA 1G9AA 2ARXA 1WW4A 1G9BA 3QH6A 2DU1A 1VBD2 2X5IA 4C90A 2WT1A 4MXWA 1ZZ8A 1OFNA 1B35A 1AR61 2XVKA 4YG0A 3CJIB 5F1RA 3ES4A 2D5FA 3O14A 3SLIA 3ENRA 4PIYA 2FZ1A 1ND3B 4HKLA 1PGL1 1H8VA 3AMMA 4H7MA 1ENSA 4PIZA 4YSFA 4XPVA 1RUI1 2XJUA 4Q8KA 1ZBA1 3JD73 4IETA 2IFRA 1PVXA 3VBSA 1D0GA 5JMCA 2XGXA 2ZMLA 4E27A 2CWSA 1S0BA 4Q26A 5C8CB 1VAKA 5IK7A 3JD71 4JRAA 1SCRA 3RMXA 1A6CA 4LBQB 2D7FA 2RS12 3VZKA 3NSTA 2XVGA 1QJU2 1O91A 5B2GB 5A33A 4XF1A 4Q0VA 1UAIA 3FBYA 5F9TA 2DCKA 5SV8A 2O0OA 4KU7A 3URFA 2XHKA 1JHNA 3FBMA 1GR3A 3NAPA 4LBKA 5IK5A 2XB6C 5JSRA 2PHXA 2WA3A 4RR3C 4JRLA 5JSOA 4Y1YA 1RJ8A 4JGYA 5CFCB 5T5OA 3RI8A 1RUNA 3B69A 4LLFA 2D6NA 2ZACA 5SV5A 4LHLA 3RYRA 1X50A 1UU4A 5FMOL 1SLAA 3RZZA 1F5FA 2HWB3 2NZ9A 3WV6A 1X8EA 4N43B 2WC2A 1O3QA 1AYM3 1MZFA 2OVUA 2ZKLA 1H4GA 2HWB1 3SITA 5AC93 3GBFA 1WW6A 1QOOA 2GZWA 3KGZA 2O8QA 4AQ2A 3WUCA 1ZZCA 1W2UA 1PO11 1VBE3 3KCXA 5FQ0B 4PQ9A 5AC91 4AGVA 1M06G 3AYAA 1KQRA 1IPJA 4XMIA 2E7TA 1F31A 3PLQA 3USUA 1DQ2A 4BHPA 2XG3A 2RJLA 4UBGA 4YRDA 1PK6B 3H1WA 4YNIA 4KWKA 1QMJA 2QNKA 3AKTA 2DWRA 1WBFA 4WM8C 2JE9A 1ULDA 1WD4A 1FMD3 5CG8A 3IDBB 5IT6A 1YUDA 2HWF2 1Z7S3 3H7YA 3VKNA 4P5HA 2WZPP 4XJAA 2ZZJA 2ZX0A 3NKTA 5JI7A 5JZGC 3AMQA 3DPRA 4IL7A 1GZWB 2JD4A 2W68A 2WNVB 3CU7A 1XNDA 4I0AA 1LEDA 2VOVA 1VIWB 1UN1A 3SHRA 3WP6A 4GB31 2Q8OA 4JGZC 2GNBA 1HDKA 3HIFA 2VUJA 5IK4A 2A6VA 2VPVA 5C8WA 3E5XA 4XF0A 3FX3A 5LK5A 2A6ZA 3N7MA 1RUF3 3POYA 2VH9A 3PHMA 3TRSB 2XKPA 2D6PA 1TMF3 4EN9B 4EWEA 4O9EA 3RRDA 1JN2P 2PA7A 5I0UA 1H2KA 2W39A 1TMF1 1NCRC 2JEMA 5T5JA 1HRI2 5FCCA 4B4PA 3D0JA 2HWE1 1H1IA 3MEPA 5BNPC 3E5QA 4XFCA 3R05A 4C0HA 1DBNA 4E2QA 1V6IA 1PHMA 3P3NA 3FE5A 2D40A 3M1HA 1V6JA 4M01A 5EXOA 1OQEA 1V00A 2ZPXA 3NVCA 1VRH1 3IBMA 1AL21 1VBA3 2EA7A 1N3PA 5FPXA 2XLAA 2ZZQA 4GMP0 2CTVA 2RS32 3FJSA 3VUOA 1DIWA 1KS4A 2Z5WA 4MUVA 1C5HA 4HZFA 2XKOA 3CF6E 1ZX5A 1NY71 4M3CB 1YO8A 3USSA 1TE1B 1Q8VA 2ZGSA 2HWD2 1POV3 5HCFA 3VBFA 1BMV2 1Q8QA 5H9PA 4YM0A 1YHFA 2UYBA 4LULA 3WHTA 4Z8BA 2VW0A 4GH4C 1DQ0A 3ZO0B 1ASJ3 1J1TA 4L92A 1F9KA 2NPIA 1NXD1 1J59A 3R0RA 1EPZA 4FPCA 2R063 3APBA 2RM21 3D6EA 1BJQA 1MZEA 2WFF1 5HI0A 1MVEA 1ZBE3 1F8VA 1PNGA 2RHPA 2R1DA 2ES3A 3OTFA 4IV3A 3W59A 4XFIA 4DY3A 5L7OC 3AP4A 2R061 1I3HA 3M7AA 4L99A 1MACA 2XJTA 3ZN6A 4CDUA 3PJQA 1ZRDA 1VJ2A 4NWVA 3E6BA 3MIGA 2WJSA 1FI2A 3JUUA 4EN6B 3WD5A 2ATFA 1AR93 2QFEA 1Q8OA 2OPKA 2VW1A 3TN93 1D4M1 3V0BA 4AVAA 4RGGA 5T52A 4FCAA 3VBHA 1W6QB 2VGDA 3N7KA 5D1IA 3LCPA 3M3OA 3TN91 1QJY1 1S0FA 2OIIA 1IKQA 1RUH3 5EV7A 2Y0IA 2JXAA 5JOYA 2IC1A 3EJKA 1CD3G 2BVBA 1VLNA 2B45X 4XHBA 1ULCA 1FATA 1V6OA 3AM2A 3WY6A 4JDOA 2Z42A 1MEC2 1ND3C 4Y22A 2NN8A 4COWA 1BZWA 1CIWA 1COV1 1SLCA 2GN3A 4R4ZA 1A3KA 5LRRA 3A4UA 5JSPA 5C4WA 1TEIA 4MGIE 4XIOA 3S0MA 5CFDA 2JG8B 2XJVA 1RJ7A 2Y0OA 3ILNA 4LBJA 1I5ZA 2IXKA 3VBRB 4B7KA 3FZ3A 1AR83 5J98B 3ACLA 2G4IA 5I0SA 1BCXA 3TB0A 1GFF2 2DCYA 4MLOA 3ZYIB 3AP5A 1PGL2 2IZWA 3AYEA 3B3QE 1LODA 2JE7A 2XBO3 3RQ0A 3HR9A 2NMOA 3VGIA 1FYUA 5ACA3 2ERFA 3ZYJB 3RJRA 2R30A 3W58A 5KXCA 2VY0A 4YVWA 2EXHA 3ZN5A 2KA3A 4MXVA 4QPGB 3JD72 5H9RA 2NYYA 3WDVA 2XL7A 3AMNA 1DYPA 4OI4A 5ACA1 2YUEA 2ZX2A 4UW4A 2ZOEB 1RMU3 4JDNA 4OI2A 2B9UA 5H9QA 1FNYA 2ZMKA 4E9KA 5AFEA 2GN7A 3VKOA 2VNGA 4AVSA 1HW5A 5KHKA 2WA4A 2OUJA 2VW2A 1O3RA 3MI8A 2WNEA 4AQ6A 4Y1XA 1LGNA 4LBMA 1HV0A 4DXZA 4NHKA 4Q4X1 4N53B 3WP4A 1VALA 3OY8B 3ETQA 2DVFA 4NWWA 5C9AC 3LOBA 5I91A 1RUC3 1BYHA 1IHMA 1WLCA 4S2HA 5ABJA 4D3WA 3VZMA 3LB9A 1HQLA 1RUC1 3LKJA 1HXS3 4N7IA 1EYBA 3ZN4A 2UWCA 1LOBA 4LA3A 1U5YA 4CEWB 1H8TB 1YNAA 4ATEA 3BPZA 4O9GA 2F4PA 1R083 1PK6C 3WQ7A 2CAUA 3M4FA 1ULEA 4PDWA 1NXMA 1R093 2D93A 2HWB2 3R6SA 1R081 4X8NA 2ZBJA 2UWAA 1V6KA 1AYM2 1R091 4RHV3 3NV2A 4UW5A 3VDDB 4EWAA 5EZWA 2D3PA 2JJ6A 5BNQA 1JBCA 3VL8A 4Y24A 1LHWA 3PVBB 4RHV1 4OUSA 3KSCA 1ZZBA 2WNVC 1VBE2 1G8WA 4IEYA 4I02A 4AWDA 4JC1A 2TBVA 1LU2A 2ZS6B 1WLTA 3IT8A 2YXSA 4AK3A 4OHWA 2WS91 1CVNA 3NV3A 1LOCA 4XQWA 5FMOS 1EPWA 3SCFA 2K2SA 1OQ1A 5EYXA 5FAXA 4YZ5A 2A6XA 1FMD2 4R9CA 4CDWC 1CPNA 1HLCA 1LENA 1PIV1 1Z7S2 4LUKA 2GNMA 2WQZC 1WD3A 1KFUL 2Q5TA 1UX6A 2QZ2A 4HLTA 4RS5A 3N4MA 2UWBA 4AHXA 5D8AA 4OHYA 3K51A 4BMBA 4XBQA 3VBRA 2ZGTA 4FSJA 1R1A1 1QJX1 1WCKA 3ST7A 4JCKA 3JU9A 3WINE 4CEYC 1V70A 3WP5A 4XILA 4P9XA 4PJYA 4OLLA 2JG9C 3ZFFA 2PLV3 2Q30A 1RHI3 2A3XA 3B01A 3KT4A 4ZKTB 2E51A 1RUF2 3H3ZA 2PHRA 4UXAA 2XVLA 3W9AA 2Q4SA 5K9YA 1TMF2 1Y3TA 4I3GA 1D2SA 4QPGA 3FMGA 3FFQA 4E4ZA 2BQPA 4AEMA 5JCTA 1GYKA 3N7JA 4MZUA 3VZNA 5BNOA 2XWBB 1QXJA 4WM8B 4YZ4A 3JBG3 1PMIA 4K6BA 3KGLA 1EAH1 4WVZA 4YFWA 1GNHA 1VBA2 2BNOA 1ONAA 3IWZA 2EAAA 3INAA 5JZGB 4Q1RA 4YW4A 1RUG3 1SDWA 3KS7A 4XTPA 1M4WA 1KRIA 1O5UA 1SMVA 3WDYA 2JICA 2JENA 3LA3A 1UIKA 3JB8A 3KCCA 1RUG1 2HWC3 4OHXA 1QGLA 3WZ1A 1CAWB 1AXKA 3MIHA 2H6BA 2R32A 4PLNA 1BEV3 4IESA 1REFA 1ND2B 1CAXB 1AXZA 4GA9A 2XPJA 3M3QA 4LO5B 4WVVA 1S1AA 1T6GC 4AEDB 4I30A 4FP3A 5KXBA 2ZGNA 4YGBA 2DCJA 1ASJ2 3ZSEA 2O1QA 1H2LA 3VBUC 3RNSA 4P9WA 5CIRA 2ZJCA 4YZ3A 2XL9A 2R062 1FPN1 5BNPB 2EALA 1IS4A 3UJOA 1TNFA 1FV3A 1POV0 4PBOA 2VQ0A 1ZBE2 2R6QA 3WVJA 5KHHA 1QJZA 4Q4W3 4D94A 5KXDA 1LOGA 1J1LA 3SCHA 2BWAA 1UPIA 2YROA 2RMU1 2WNUC 1C8M2 4QPIA 4MGKE 4W65A 1FOD3 4E4DX 4IQPA 2IXLA 3CL1A 2HKXA 3U0ZA 1AR92 1DZQA 1TNRA 3TN92 5DDJ3 2JG8C 2PAEA 4RR3A 4MYEA 4R9AA 4I2OA 5F6LB 4BOWA 4Z07A 3IM0A 4B29A 5I93A 4I09A 1VB2A 4KGQA 1BKZA 3BCWA 1RUH2 4D7YA 2VUAA 1AX2A 1TME1 2ZGUA 3WCRA 3ZSKA 1IS5A 2R042 2YGMA 3GZTB 4A7KA 1GANA 3WDTA 1YWKA 1JOJA 4AFMA 1C5IA 3LA7A 2CV6A 3H1YA 2WL1A 3NJZA 3I2DA 2P2KA 4LEJA 4QGNA 3MLKA 2YYOA 3ROUA 1AX1A 1K5MA 5E8AA 4IEQA 3ALQA 5I0RA 2GC3A 4MGYE 4AFAA 3B94A 5L7OB 2LM3A 1XE8A 1SQ4A 4IERA 2ZGRA 4ASMB 1Q56A 2VVFA 4AG4A 4IEWA 3E6DA 4A7YA 1XE7A 1AR82 1MS3A 4M00A 4WM8A 2ETEA 3HQXA 3WG2A 3AKQA 2XBO2 4PCRA 4HMZA 4ES9A 1AR63 5BNNC 5ACA2 4CEWC 1H8TC 3AZWA 2BTVC 1EY2A 5JZGA 2JKBA 3LSEA 4GIQA 3IIAA 1IZ3A 4CDQB 3RMYA 1RUI3 1ZBA3 4AQTA 4WM7A 3TAYA 2I2SA 3KB5A 4JGZA 1RMU2 1QKQA 5DUXA 5FLIA 4I0WB 3OYWB 4B7EA 5E16A 1DGRA 4G9SB 2OW4A 1CAXA 3VDDC 2A75A 3A0KA 2DVDA 3VLBB 4NHLA 4RGAA 5TSWA 1RUOA 4XFHA 1RUC2 5CAZA 2I07B 5JAXA 3VHOA 3AZVA 3VHNA 4UW3A 4LR4A 4F3JA 3HN1A 3IKWA 4XF4A 4DZGA 1W6PA 2A3YA 3C2UA 1HXS2 4FOQA 1NCRA 2FMDA 3EXUA 1Y7BA 3GHNA 1W39A 5BNPA 1RUD1 1AUYA 4Q0PA 3AFGA 5JIAA 5E89A 1R082 3UKVA 4ISQA 2QQPA 5JPNB 3J26N 4CRQA 3AP9A 5DUWA 1HRV3 2F6BA 3DN7A 3EQEA 4Y4YA 2X8KA 3GZAA 1NQDA 1DF0A 1LRHA 1OSGA 1QOTA 3BODA 3V65A 4XOGA 2RS53 1C28A 1HRV1 1AX0A 1W6NB 4B8EA 5GLWA 4QQ2A 4HVQA 4Q29A 2XH6A 1EP0A 4J1WA 4FXKB 5C6CA 4ORFA 1AHSA 4FPEA 2RS51 1G7YA 3H8UA 1YFWA 1A8DA 1ZRRA 2XLGA 4P9YA 1PO13 3S30A 1ALYA 2PHFA 4Y20A 1UZZA 5C9AB 1LR5A 3AYCA 3IMNA 4DY5A 2V73A 4GH4A 5H9SA 1C3HA 1U12A 3M70A 5DG2A 3FC0A 2CNAA 1WGPA 1U5IA 3B00A 1W6MB 4Z92B 4BCUA 1C1FA 2CL2A 4LBLA 1REDA 4F7ZA 1NE6A 5CADA 1LHVA 2YMZA 3AZXA 4YLZA 2YDEA 2PHWA 3HT1A 4OULA 3ZXDA 2LTNA 1MS4A 4GKYA 1KS5A 4X8PA 5A32A 1KDKA 3MIFA 4BH9A 1N3OA 4QGLA 4CDXA 1GQHA 4LO6B 4A2UA 1MR5A 4HPKB 1O3SA 1ZRFA 3OGJA 4HN1A 2ET7A 1XQNA 4GB33 4UBHA 3DKWA 2PLV2 5CU1A 4K7JA 3S7EA 1RHI2 2WSVA 4DPNA 1NQJA 4AGRA 1LULA 4KG0A 3ZFGC 2IXJA 2R0FA 1PGSA 3U10A 1UZYA 5DZEA 3CJIA 4E2GA 5KBFA 4EROA 1ND2C 1PO21 2E7AA 2D3RA 2ZGKA 4CYDA 4TZDA 5JIUA 1ND3A 4FXGB 4HETA 4ATFA 1AVBA 3E5UA 3H9AA 4AEDC 2LUWA 1B35C 3JBG2 2A6YA 4AVVA 3AXEA 1CPMA 2DTWA 2WINB 4CDWB 2HWE3 4FAGA 5JLVA 1GSLA 1W0PA 2ARBA 1QDOA 2VXRA 3UKTA 4FPKA 5C8CA 1VRH3 2AGSA 1OA2A 1VBC3 1AL23 1RUG2 1W6OB 3VBOC 4Y1UA 3HD8B 4LBQA 5K8SA 3VBSC 2E63A 1QDCA 4QQLA 4QXKA 5LRSA 2EVXA 1DU3D 1OLRA 3KMHA 2BEOA 1VBC1 1BBT1 4CEYB 3I59B 2HWC2 3PVEA 1RTVA 3WDUA 1AR73 4C0BA 2I45A 5FRAA 3VV1A 1NCQC 4X6RB 1BEV2 5HCBA 2JG9B 4QPYA 1PZ9A 1AR71 1OOPB 3CJXA 3JCIA 2QZ3A 4N7UA 1BVVA 4XMAA 3S7IA 5BYNA 2QCSB 5CFCA 1KD7A 5AFBA 4Q8LA 1UCXA 2IFWA 4JTOA 4L97A 3ZXFA 2OZJA 3G7DA 3K48A 1ZM1A 3BU7A 4IEOA 5KXEA 1YI9A 2RR11 1ENXA 2DYCA 4N43A 1GZCA 3IPVB 4L2NA 1ZZ6A 2Y38A 2RM23 3AFKA 4KH9A 5IUQA 2WFF3 2TEPA 3LGRA 4Q4W2 4ZU4A 1APNA 1YLLA 4C1XA 3L2HA 3MIBA 2JDZA 1LB2A 4FBFA 3B9CA 3WNXA 1FOD2 3QLQA 4EN0A 5FQ0A 3AMPA 1W6MA 4SBVA 1SEFA 1DQ1A 2ENRA 5DDJ2 3UKNA 5FO8B 1U0AA 1MS8A 1D4M3 4YZ1A 1DYKA 2QE3A 4YW3A 3H50A 4XF3A 1PK6A 2GNTA 2ZMNA 3R4UA 1N1VA 3ME2A 3EHKA 3J8F3 2VULA 3D8CA 1QJY3 4IEUA 4FPLA 1KJRA 1YIPA 3VBUB 3HBZA 4OZXA 2ZHKA 4WBBA 3J8F1 1X82A 5L73A 4AGGA 5GZFA 4AVBA 4Q4Y3 4OHZA 1COV3 1GZWA 1UKGA 2IXCA 2C9AA 1KITA 4CDQC 1VBB3 3QACA 2WNVA 4Q4Y1 1MZ6A 2B8MA 4J1XA 5BV6A 4URTA 1KDMA 1YYNA 1VBB1 4HANA 3AKPA 2A7AA 1S0DA 2WNUB 2FZ2A 3WW3A 4LA2A 5GZEA 1DGLA 4MVTA 3OBTA 2WSUA 5T5LA 1ZREA 1S2KA 5I8TA 3VZJA 1G9CA 2DURA 1ZA4A 4LO8A 2SLIA 1UU6A 4KWLA 2OA2A 1AR62 1QY4A 2P3JA 3LZZA 5KHGA 4IV1B 3WW1A 1QQP1 3ZMOA 2GSYA 4I0BA