3J26N

The 3.5 a resolution structure of the sputnik virophage by cryo-em
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
362
structure length
362
Chain Sequence
EPDTVYYDILIPFKPNDQGFSPAIFQAQLTQPIVHNPSEYFLSVVRFSIPTQNIPLTIPQIQPYPNTNVNNTIYSVSIGYNGTYSSQNFVQFDPSLTSPNIPAPNAPTVTSPNVEVTPYYYIYDYSTFLQMINTALENAFNEISAPVGADAPFFFYDSNTEKISLIAQAAYYDRTLTTPIEIYCNVNLFTFFDSIKHIGLGYNTPTGRDILFDVRFLGNNYYQDPETAPSYPPEFIQMQQEYPTLSNWNAVKTIQLVSNLLPINKESIPSFRNSNVGIINAQGILADFVPLVTNGPEARISIDFVATGPWRLIDMFGSVPIYMVDLYVYWTDQTGGQYLINIPPGRILTCKLVFIKKSLSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Sputnik, a virophage, at 3.5-A resolution.
pubmed doi rcsb
molecule tags Virus
molecule keywords capsid protein V20
total genus 25
structure length 362
sequence length 362
ec nomenclature
pdb deposition date 2012-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1100 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3j26N01
3J26N
chains in the Genus database with same CATH superfamily
2QJVA 3N9NA 2A3WA 3LEGA 3A0NA 2JDUA 5JIUA 2X10A 1IS4A 4AOCA 4XCBA 3HBKA 1O3QA 4FVVA 4HXCA 1M4WA 2C6SA 2RS11 4Q0QA 1LOAA 4OMDA 3T0DA 3ZDVA 5I91A 1W6MA 2W08A 2VNRA 1SG3A 4Y5Z0 3AKTA 4O7XA 4JGYC 1OKQA 1OFSA 4OHVA 2NLRA 2ZX0A 2YYOA 1XNTA 3IDCB 5A3NA 1FNYA 3AZYA 1LESA 1VBC2 4AFMA 4A45A 1K5MB 3MICA 1W8NA 1YFWA 2JKXA 4FFGA 2HBTA 4JRLA 5JI7A 4BQ1A 4XFBA 2E6VA 3L2YA 4GAZA 3NJVA 4HFSA 3W58A 4YFWA 5CISA 4CEYA 3R0RA 4XQWA 1UNBA 3PDQA 3QH7A 3USUB 1YCIA 2YU1A 3CJIB 4YYOA 3HD8B 1SLBA 1V6JA 4N43B 3VKNA 1OUXA 4E2SA 3RS6A 5FYCA 1Y9MA 1W8UA 5FXVA 4G9SB 1KFXL 4NN0A 4FP3A 5JZGB 1H8TA 1CJDA 4LQRA 4RD7A 2ZABA 4WVZA 1S2BA 4GXLA 1GP5A 5L9RA 3PJQA 3ETQA 1W6PB 1YI9A 2VUJA 4AW7A 1CONA 3WZ1A 1TG7A 2WQZC 4RR3B 1YHFA 5C8CA 1RC6A 1GICA 2WN3A 3ZFFC 2WZ8A 2EAKA 1H9WA 4YGDA 2EVXA 3USUA 4A6SA 5K0UC 3A7QA 1LHVA 1BVVA 4HSJA 4XF3A 4YVWA 4J1XA 1NQDA 5JSOA 3MPPG 1PVC1 1C1LA 1RUI3 3OEBA 1MZEA 2JDZA 1ZNPA 4YZ3A 2YXSA 2WO1A 2RDRA 4I30A 1W9FA 3MEPA 2PHXA 2CSGA 2LALA 3DKQA 3PURA 2A7AA 4ES9A 2WBKA 2PHUA 3NRUA 2C4XA 5BNNA 4A7YA 1U5ZA 3V0BA 4B1LA 1JYNA 3NW4A 1ENQA 4JVAA 1NQJA 3ZXKA 3BIEA 3I8TA 4X6RB 1PVC2 2Q8EA 4MZUA 3KWVA 4XTMA 1UN1A 2DUQA 1HV1A 1W6MB 1ENXA 2DWRA 1OLMA 2ZOEB 5GLVA 3RZKA 1I1EA 2WJSA 3LAGA 4AEDA 2ZGNA 4NIHA 5A7OA 2HLEA 1RYYA 3PVNA 3ZPYA 3W5MA 3HNYM 3AXDA 2D6OX 4QQPA 4PDWB 4BIOA 5ISLA 3KCCA 1VBD1 1QQP1 3LA7A 1NCRA 1R091 1VRH1 3FE5A 3ZSJA 2CTVA 1GZWA 2WA4A 3JBG1 3NAPB 1NA1C 3E6CC 5K4LA 4NAMA 4GQ7A 3TAYA 1NXMA 2VTXJ 5A33B 1AR71 1R093 3LIHA 3POFA 4K9SA 2WNUB 2ES3A 1DYPA 3LDBA 2XPJA 4PJYA 4EROA 3T0BA 4OI4A 3VZOA 4B4RA 4LNVA 3OGVA 1WBLA 4N7UA 2K9ZA 3OJBA 2XUMA 4CDUA 1I5ZA 2CGNA 4FPFA 4YG6A 4AI2A 4H55A 1C5HA 2XVGA 5FMDA 2J1SA 5H9SA 4AVSA 3ZXJA 3M2MA 3TRSB 2GH8A 4CPBD 4CUBA 2GNTA 4HONA 4JDNA 4Q29A 5C3SA 1A6CA 3M1HA 3U78A 1RUG2 3ZYJB 1OFNA 2P3KA 2FQPA 1J1TA 3D82A 4OFGA 4P9LA 2QTWB 3GCXA 1GQPA 4BYYA 2VZUA 4GB32 3I2JA 4ATFA 4QGMA 3VHRA 3Q8EA 5DAPA 5C3QA 5IVEA 1JYWA 2WFF1 5IVFA 4M3CA 3UL2A 4D8MA 5HXVA 1LNSA 4XJ9A 4GD4A 3AZWA 3C7OA 3ZMOA 2UY8A 3WW1A 1NXD1 1UOFA 1W2OA 2V73A 4MXVA 1S0IA 2CAUA 5FV3A 1REDA 2OZJA 1SBEA 3H3ZA 5CU1A 2NYYA 4HL0A 2ZX2A 3J26N 4CCCA 4X8NA 4E4ZA 1W6QB 1H9PA 3OSDA 1H2NA 1EPWA 2PELA 5FLIA 2ZBJA 4O61A 2NMOA 3WG3A 1ZRDA 1Q3EA 3CNAA 2RR12 4C90A 5IFPA 2KR2A 3WX5A 2CAVA 3FHQA 1DZRA 3VD4A 2W46A 4IGPA 2RDQA 5J36A 3U10A 1MACA 1CPMA 3ZIWA 3OY8B 4D94A 3VD3A 5K9YA 1SBFA 1SLCA 1TMF3 3A22A 4RL7A 5FMOL 1SEFA 1UZWA 5CZKA 2VNGA 5JAXA 1KRIA 1CZSA 2JDHA 3FZ3A 4ZY9A 4R4XA 3KV5A 3GJBA 2MNGA 4CDUC 4BQ5A 1C1FA 5C3RA 1ODNA 1N3OA 4FQZA 3B7MA 5EFUA 2R0FA 2R072 1WLDA 2YGMA 3DKWA 5FZFA 2G4IA 5A3WA 4ARYA 1GNYA 4IEUA 4NE9A 3THPA 4QQHA 4DO0A 3FHIB 5I93A 1BKZA 4WVWA 1MS0A 2N7GA 4AHWA 4LA2A 4RQPA 1PX3A 1UOBA 2LTNA 5FKBA 1ND3C 2ZGQA 3VDCA 3ASIA 1JU3A 3B01A 1S0EA 1XSQA 1APNA 2BZDA 3JUUA 2QQMA 5FKCA 3WUDA 5FREA 1E57A 1RUJ2 3ZN4A 4TN7A 3H50A 1LCLA 3KCYA 3M8LA 1KFUL 2PHTA 3SCHA 4LUMA 1GP4A 2R0HA 1PO12 4COZA 1LAJA 5GJ6A 2ZCWA 1EY2A 2HWF3 2IVIB 5HCFA 3IIIA 3AL6A 5DMYA 2ZGOA 2JB4A 4GULA 1ZREA 5F5QA 1PNGA 1OD5A 2OT7A 4N53B 4KWLA 2YFZA 1WLTA 4UFKA 5I0DA 3RQ0A 5C5UA 4YZ4A 3J7MA 1SFPA 1W2AX 1XNAA 1J3QA 3I49A 4FCAA 4MLOA 3VBUC 3NV4A 1URXA 2WAAA 5FUIA 2R7EB 4XZPA 4S2FA 5C4WC 3VHNA 1JXNA 4L9BA 5BUVA 5HPOA 5HCBA 2XHNA 2VOWA 5A3MA 5FP9A 1W39A 1XYNA 2Y6LA 4XEZA 1DIWA 3B5LB 5F3GA 1WA4A 4RFT0 4DS0A 4AHZA 2BFUS 2RS51 5LWBA 1C5IA 1H8VA 4MXWA 2XHKA 3DUIA 4NRMA 2GP3A 2LS6A 2EA7A 4YARA 5CFDB 3BI3A 3LSEA 4PLMA 3CMGA 5DXDA 3VBFA 2WR9A 4CEWB 1UL9A 5KHIA 1X36A 4Y33A 3WNOA 3NL1A 5DABA 2W39A 4CP9A 2PMWB 5B4NA 1QY4A 1JMUB 1XE8A 3IDBB 3SKJE 1NCQB 1DQ4A 3UESA 2WIIB 1YXWA 3MIGA 1JYVA 5DZGA 4BH9A 5F1RA 4QKBA 1Z0HA 3IN9A 1HXS2 4LKSA 1IHMA 1VBE3 2KM2A 5HI0A 1ULFA 2WSUA 4J25A 4I3GA 4Y3OA 3RSJA 5KC6A 1HQWA 1IS5A 4HT1T 3ZLIA 3T3YA 5A7WA 3N7MA 1C8M3 5DPNA 4ATEA 1EAH1 3I7DA 1LB2A 2CY6A 1RJ7A 2D40A 3AMHA 1H2LA 3DXUA 3K75B 1YJKA 4MHUA 3LEKA 4P9XA 4RHV3 3AP7A 5E88A 5J37A 1EYBA 1TME3 3INAA 1MEC3 4FOVA 4O9EA 5T5LA 1UXZA 3T0AA 1AR81 1OOPC 1Z7S1 5A7SA 3WF2A 1J59A 1YRZA 4IXLA 1TVGA 5FZAA 1KS5A 2TUNA 4IV1C 4A7ZA 4Y20B 4OQ9A 4DQAA 5C9AB 4I3PA 5GM0A 2WKKA 5J7MA 1AR83 1Z7S3 2X8KA 5FY8A 4E27A 2NP0A 2W1WA 3T2QA 4Y1YA 1V9U1 1XU1A 1US2A 1N47A 2ZMLA 3VKFC 5C71A 1UU4A 1CAWA 2F17A 3D8CA 1YO8A 5LW9A 4LBQA 2X53S 2VMDA 4YW5A 4FOYA 2YBSA 2E7TA 3NAPA 3LFMA 1QJU3 4C91A 1JZ7A 5EJ3A 3ZFEA 4KU7A 5F5IA 1QF3A 1REEA 4XETA 4EJRA 4K20A 4OVEA 4CCNA 2PLV1 3I3MA 2VXJA 2W9XA 1YC61 3SEPA 1MS1A 3VD5A 2JKBA 5J96B 3VBRA 1WCKA 2JWPA 2RJ2A 5T55A 4NO4A 1WCSA 1ND3A 1RUH2 4HKOA 2VO5A 4Q4X3 2XKOA 4RS5C 2E51A 1RUOA 4XIKA 1RUG1 4U36A 1DLCA 4QXKA 1Y7BA 5CG9A 3GBFA 1RVF1 1XXNA 1FOD1 2VGDA 3X29B 1CVNA 1HIXA 5A3TA 1JU4A 3PMEA 4QHZA 1PK6C 1F35A 1XOYA 1ZRRA 3IPVA 4NPMA 2ZX1A 1XU2A 2YV8A 4RFRB 3IAPA 1JZ2A 1ND3B 4LMFA 2RDSA 5A7QA 2XJPA 4IUGA 4XUOA 1FOD3 4XFHA 4MHRA 4YFZA 4JQTA 3JBG2 4B1MA 4RGKA 3WXPA 2J1VA 3N7JA 4F7ZA 2XLAA 3RZMA 3HAGA 5ABJA 4XJAA 5D21A 3VKMA 4W8JA 5J1XA 5LRSA 5DUXA 3T2PA 4LE3A 1G9AA 4LT5A 3MLKA 3PVEA 3OF1A 5EWSA 5FZ3A 1OOPA 4YLZA 4BE3A 4P5HA 2X5IA 4WM7C 2Y38A 4XACA 1LODA 2O1QA 1RXGA 2XR4A 3HIFA 3N9PA 5C33A 2ZGSA 2F4PA 3H1MA 4D3WA 5FWJA 3ES4A 2ILMA 4UW6A 2VUDA 1F4AA 4YW2A 5GZFA 2VE1A 4AVTA 5L7OC 1O3SA 1VBA2 3ZFGB 4RQPC 4GH4C 4LA3A 4LBLA 4YM2A 3AMQA 4PBPA 4YG0A 3DL3A 3ME2A 4AI8A 4WVMA 2GN3A 2ZTNA 3VV1A 1K3IA 5GLZA 1V70A 2ZA9A 3LQCA 1WGPA 3VHOA 1RUC1 4BQYA 2GNMA 2K46A 4QX2A 4XFCA 1BYHA 2ZGPA 3AP9A 4MH0E 3CU7A 4YZ5A 3VZNA 3PLQA 3TEXA 2MEV3 4BDVB 4UYBA 5JXGA 2YGLA 2QQLA 4LBKA 4RS5A 4KBZA 2R1DA 5JSRA 3OGGA 3LDKA 2D6KA 5JR7B 4NR1A 4ISRA 3R6SA 1GR3A 1XRUA 1R1A2 3R4DB 4BXSV 5APAA 1B35A 1JN2P 2K0GA 2LROA 1SACA 4LO7A 1SLIA 3NO8A 1UIJA 3ZFFB 3GALA 4BJ0A 1O4ZA 1RUD3 3GZEA 1PGW1 1WMFA 3D5OA 2WT1A 1WW5A 1CGPA 3H8UA 3ZFGC 3DYMA 3WUCA 3GGLA 1RVF3 5CFDA 3FFZA 3MF9A 5JZGC 4AK3A 2WABA 3U07A 2UU8A 1BHGA 3F95A 4RS5B 2I07B 4QPWA 3VGIA 4XURA 2XL7A 2VMFA 5EIYB 4O65A 3RDIA 4XF9A 3NNLA 3NWKA 4KGGA 5FQ0A 4MX3A 3ZN6B 2Y6HA 2LM3A 2DBNA 5AVPA 5DDJ2 4FPCA 1ZRFA 1UMZA 1G6NA 1JHNA 2GDFA 2WZEA 5A3UA 4M4RA 2WNVC 2ZHLA 1KS4A 4KNCA 1XJAA 2VZTA 4Q8LA 2O8OA 1PIV1 1VE0A 5FO7B 2JIGA 4FPHA 4N9IA 2C5DA 3NAPC 1X8MA 1ONAA 4MGSA 3UGHA 2MEV1 5C3PA 4CUGA 5FY7A 1A34A 3VBSB 2XWJB 2PYTA 5FTTC 2Q5TA 5JOZA 3WNNA 3H8OA 1OQ1A 2XVLA 4IV1B 1CPNA 1AXKA 2QKDA 4AVVA 4AFDA 4OUSA 2ENRA 3TNQA 1JODA 2OA2A 1MZFA 1PMJX 4CXXA 3BIWE 4QT6A 1IS3A 1D4M2 5T50A 1G9FA 4QXCA 5FWEA 4AI0A 2DU1A 1MPXA 4RQPB 3GJAA 4AVBA 4CCEA 1RGSA 4E2GA 5LA0A 2PAMA 3Q8AA 4FXGB 4PF1A 2H0BA 4Y22B 3WT3A 5KHGA 3LCPA 4MXWB 1QOTA 5CIRA 3VD7A 4AAXA 4GMP0 4QPIA 1YJLA 5ABJC 1PK6A 1NT0A 4BISA 4P9YA 4CU9A 1FPN2 1OT5A 1GOFA 3WF1A 2IWGB 4MV2A 4Q4V3 1X50A 1BVP1 1BCXA 3DYOA 3FHAA 3GBWA 3NJXA 4FPJA 1IPKA 4CEYB 1YI7A 3PUQA 1EUUA 1FATA 3B9IA 3HWJA 4YVWC 1XNBA 2B7YA 3ZVXA 5FMOS 2VPVA 2XG3A 4KI5M 5KHHA 2FDKA 2P6HA 2VCAA 4OZXA 2ATFA 2JG9A 4Q27A 4XJZA 3N4MA 4JHZA 4FTEA 1K5MA 3ILFA 3T1LA 4CEWC 1C3HA 4GWJA 1AX1A 4IEOA 5DDJ3 4P9GA 3O1VA 4YW6A 2Q0AA 2ZJCA 1WWYA 4UBGA 3ZKUA 2JDPA 5KXEA 3V0AA 4K6BA 1W6NA 5F6KA 4Z2AA 4CEYC 2PHLA 3GXUA 5A1AA 5F5AA 4NPLA 4FPLA 1D0HA 3NNMA 5L9VA 2XBO2 5A70A 5FLJA 4UFIA 3KT1A 3RMXA 2AENA 5ABJB 4OHWA 2XB6C 3AB0A 5T5JA 1ZBA3 1V6NA 2E32A 3EMRA 2ZKNA 4MGKE 4N43C 3VKLA 1WLCA 4NROA 5IT6A 3WP5A 2BBVA 2QQPA 1D4M1 5EZWA 3SCFA 4IEZA 3WNMA 5EHDA 3JB4C 3MV11 1K5JA 1XNCA 3SNMA 1R092 3FUOA 4LIVA 3GHNA 3KQ4B 5AC93 1WKYA 2CNAA 3DEMA 1A78A 2V09A 4COUA 1POQA 3B3QE 4NAOA 2IXJA 3BTXA 4UI9L 3H7YA 1DYOA 5A32B 3ZFGA 3POWA 5FY0A 2E63A 1AL23 2EIEA 2MEV2 3FC0A 4AEDB 3GM8A 5D8AA 3NNJA 3KM5A 3TWIA 2CV6A 1CAVA 1RINA 5C9AC 1J1LA 4AFBA 5I8TA 2E31A 1GSLA 4FQ4A 1RHI3 4P9JA 4DXTA 1JZ4A 4IE4A 1ST8A 2ZZQA 5BYNA 4GMP3 4AFAA 4GKXA 4D7SA 5C6CA 3QD6A 3VZKA 2FCTA 2WQ8A 1POV1 2OQ7A 2XUEA 4UW5A 5FZCA 3PHMA 4Z8BA 1VJ2A 4Y1ZA 3OPWA 4XJUA 3P5BA 5EQUA 1ZBE2 3RI8A 4CEWA 1G7YA 3AP4A 1GP6A 1DU3D 4N9HA 1C28A 4AF9A 2DCJA 3H9AA 2D43A 2ZXQA 2DCTA 2VVDA 3CZJA 2QQVA 3BTYA 2WO7A 1UYXA 5CKMA 2QQNA 3OGJA 4OQ8A 1SFYA 1ZBE1 2DFCA 5LB6A 4PDWA 3ZFEB 1ZZ8A 1N1SA 1D2SA 1RL3A 1E5RA 2VOVA 3EBRA 4W6WA 5IVJA 4P02B 1X82A 5CKQA 2Y6JA 2FDGA 2ZHNA 5FPBA 1J3RA 4CCOA 3HNMA 5FYVA 5M0TA 5FZ8A 2QE3A 3RMYA 3OGSA 2RMU3 3E5XA 3OOXA 4P08A 4R52A 4B7EA 5FYUA 5CFDC 5A32A 3G6JB 5A3OA 3KV9A 2B42B 3MGUA 4AGGA 2WDBA 4XDPA 2Q30A 3I3DA 5FP7A 3U37A 1Q8VA 3CDZB 1OQDA 1WW6A 1H0BA 4KGQA 4KG0A 4CDUB 2R061 4QPGC 2OYZA 1UY1A 3D0JA 2A3YA 4QQ2A 3KS7A 3VL8A 4AI1A 4EYUA 4GZ9A 4JHTA 1SPPB 3KCXA 2QQWA 4IGOA 1POV3 5CG8A 4SLIA 3AYAA 3D0SA 3A4UA 2JDYA 3E5UA 4XJWA 4K3UA 3S6PA 3OBTA 4R8HA 4IL7A 4DINB 3ABZA 4QU2A 4IEWA 2WZR2 4Q4Y1 2ET7A 2G9GA 1XQNA 3S7IA 4MO3M 3OBZA 1AZDA 1ZZ6A 4LBNA 4A41A 2PLV2 1GZ9A 3VBOC 3BKZA 3WW3A 2DUPA 4LJHA 3KV6A 3M4FA 2DBIA 2IXKA 3FFQA 1YLLA 2W68A 1NAEA 4L2NA 3OTFA 2GMEA 1QIQA 5GALA 1O3TA 3O1OA 2RHPA 2BWCA 4QDRA 3LOIA 4JGZC 2NQYA 1S0DA 2P4EA 4BHPA 1NCQA 1QJY3 2WWUA 3ZXGA 1GU3A 1QJZA 4CDXA 5DUWA 3LZZA 4BQ3A 5ACA3 5KC5A 3I2KA 1EAH3 3M3EA 4B3NA 3EB7A 2A6ZA 1NA1B 3LEIA 1GMMA 4CP0A 4AEMA 5KXDA 3MW2A 4GJYA 4LBQD 1PZ9A 2ZACA 1LHNA 3SMHA 2UY9A 2W52A 4CDWB 2GNBA 1HRI2 1TME1 4LULA 5FY9A 4LBJA 4ZZ5A 3C7FA 3IAQA 3BPSA 1BK1A 1DFQA 3HJRA 5FZ4A 1US3A 2VCBA 3N9MA 1D7PM 1UKGA 4TXWA 4XIOA 4CUCA 3JCIA 5BPXA 1FV2A 3NJYA 4YW3A 2Q8OA 2WNEA 1BEV1 2YHJA 1WA6X 4YGCA 5C8WA 4IESA 1PO21 1ZA7A 1VAKA 2R6QA 4XJ8A 3ORJA 1HB3A 1OURA 5FJHA 1R082 5A1LA 4LOTA 1CQ9A 4DXZA 1ENRA 5KBFA 4YG3A 1J83A 5FK7A 1Y43B 5BNPC 2OXBA 4V2WA 2YG0A 4NHLA 4XXAA 4PI0A 4PIYA 3GCWA 2VBPA 2I74A 2P1BA 1RUC3 2A1XA 3WP3A 1FMD1 4HMZA 2GP5A 1EV11 1IPJA 3WP4A 4IEYA 3PUAA 1QH6A 2VNOA 1RTVA 2B4KA 3LDRA 2CWMA 3SH4A 1SCRA 2UWCA 2YROA 1SMVA 1LRHA 1RUD2 5IK5A 1MEC2 4H2AA 3AYCA 3ALQA 3HQUA 3R05A 3ZM8A 1WW7A 1XYPA 1ZZCA 2VVFA 4JV4A 4DUXA 3TEWA 2UWBA 2HKXA 3JU9A 3JXSA 3MUY1 1V6KA 1A3KA 3APBA 3PVBB 2VZVA 1ENSA 2RS52 1U5IA 1AL22 1QMJA 2GSYA 2WZR1 2GNDA 2NMNA 3VBHA 1PGL2 1POV0 2R30A 1DHKB 3PIJA 5CB7A 4HVRA 3T2TA 2PQQA 4IEPA 4N7IA 4HOOA 4Q4W1 1AYN1 2HYXA 4F8AA 1DLLA 5AC92 1HXS3 3I59A 1V6OA 2W1SA 1ASJ2 2RS32 4INDA 1VB2A 2HWC1 3SISA 2HEVF 1OH3A 4LBQB 4D6RA 1TQ5A 5K0UA 3MLLA 1X7NA 2LW8A 5I0TA 3THDA 1R1A3 4HKWA 1CESA 5BNPB 1FNZA 5EJ1B 2YZ4A 2BPA2 1UCXA 4EZ4A 2HWB3 5FZHA 2PAKA 5FRAA 2FDJA 3D6EA 1AR63 1WMXA 3ACLA 3LSDA 4FPYA 5JMOA 1BQPA 4W65A 3ZYIB 3MYXA 3OYWA 5FZ6A 3WD5A 3WOGA 3O7OA 1RUH3 1VAMA 1YUDA 1O4TA 2HWB1 1O6UA 3CBNA 4IW3A 4W50A 4B8EA 4JTOA 4BQXA 4CXYA 3AMNA 4XAEA 4KL1A 2YPJA 4NHMA 2GMMA 3C3VA 3OD0A 3VBOA 2JX9A 2VZRA 5LK7B 3CZUA 2EICA 2HH9A 4DRRA 5FPXA 3WV6A 1KJRA 3RWKX 2OW4A 2ID4A 1NLSA 2ARXA 3B00A 5L9BA 2Y6KA 1QJU2 1RITA 4FFIA 1ACCA 3ETPA 3HPNA 1JBCA 1AJKA 3C7EA 3JBG3 2YBKA 4LORA 2DVBA 3SLIA 4ES8A 4WV8A 2WZR3 4HK8A 4DFSA 1GZWB 1UIKA 1N3QA 4L8QA 4M0NA 3LD8A 1VIWB 4KU8A 5ANNA 4ASMB 1HX6A 4UAPA 1W2UA 3J4UH 2A6YA 4UFLA 4FOWA 2VOXA 4COYA 3AKQA 3F2ZA 3IB3A 2XKPA 1NKGA 4P9IA 3M70A 4BQ2A 5FO9B 2Q1MA 4UFHA 1U5YA 4XHXA 2BNOA 5JZGA 4CSWA 3WQ1A 2WT2A 5HV0A 4YWAA 3PVOA 3BPZA 1H30A 1HKDA 2FMYA 4IQPA 3CJIA 1CR7A 3H1YA 2WT0A 3GDBA 2OIIA 3NJZA 4E8CA 5E89A 5C8CC 4K1YA 1LGNA 1RUI1 4GIQA 3K3OA 4HZFA 4E4HA 2A6VA 4GWNA 4WM8B 1A8DA 4OMCA 5EXOA 1PVXA 4OZOA 3RNSA 3RYPA 3LB9A 3T08A 1W6OA 1W99A 2HWC3 3SQOA 3TN92 1LGBA 2JXAA 2FMDA 2ZAHA 5LRRA 3O1PA 1JYIA 1W8ZA 4CTEA 1BMV1 3PUIA 1KJLA 2SLIA 1WZXA 5EYYA 5KXCA 1SLAA 1ZRIA 2QVSB 2RJKA 3RZLA 2EIBA 1COV3 1GFF2 1EP0A 1QJX1 5E6HA 3W20A 2ARBA 4HLTA 4FFFA 1CX4A 1Y9GA 1UAIA 2XJQA 3VBSA 1PM7A 5GZGA 1UWWA 2VBDA 3N9OA 1R083 2VC9A 1AR62 5IW0A 4M4PA 1PIV2 4CE8A 1RVF2 3WDTA 4K21A 1ND2C 1QQP3 1AX0A 3MLJA 4HKLA 5HCHA 4JGZA 2LRPA 4QPIC 4ISQA 5IK4A 4WZCA 4YGBA 4Q0PA 3H8XA 1PGL1 1PM4A 1QXRA 2BW8A 1CAUA 1S2EA 5FYSA 1YIPA 4A44A 1R1ZA 4E4SA 5AFBA 4KG8A 4IV3B 3AVSA 1XB9A 1GQGA 2R041 1VBD3 2R062 4NIAA 4L99A 1H8TB 3SEEA 1FT9A 4CU7A 2HWE3 1SZBA 1I6XA 4YNIA 1T2XA 5FMBA 3AK0A 5IK7A 3L9JT 2WO3A 1LOFC 4A42A 2Z2SB 1QJEA 4QWNA 2Q1ZB 3DPRC 2Q1FA 1RUJ3 1I5PA 5C8CB 3PIGA 1K45A 1KITA 1F5FA 1UY0A 1S0FA 3MF6A 2UURA 4R9DA 2WUHA 4TLGA 1AYM2 5EYXA 5FYYA 2FHRA 4CCJA 3H1WA 4LBOA 2HJIA 2WNVA 3KT7A 4Y1UA 3TOJA 4ITCA 2WLQA 3TN93 5FUNA 3N9LA 2F6BA 4ZU5A 4DMIA 3VBFB 1V9U2 1W6QA 3VBOB 4CP2A 1UZYA 4CZSA 2EXHA 3PU3A 3AYEA 4MGTA 3POBA 4C0BA 4YM3A 5A3PA 2W92A 2DU0A 2ADEA 2B5HA 1QOSA 3ZYGA 3TEZA 3LIGA 1U0AA 4DUWA 1VMJA 4YW7A 5IYYA 4XYXA 3VZMA 2WFF3 2GC3A 4YVSC 5FP3A 1HV0A 3W21A 4M01A 3CQOA 1HQLA 3FBYA 5FYIA 3H3UA 5D8AC 4CRQA 2WINB 5I8SA 1D4M3 2KA3A 5JOYA 1OA3A 1S4CA 1QJX3 3MDPA 4BZ4A 4SBVA 1G86A 3LPGA 1QHDA 1CIYA 1SLTA 2GC1A 2JDKA 1IG3A 1ZBA2 3VBHC 3O0XA 4NWWA 5B4XA 1Q8SA 5A6QA 2J1AA 1EUTA 3T2OA 4FI9A 4E2QA 3P3PA 2GH2A 3L2HA 2RJLA 2RMU2 4R4ZA 1VRH3 3BGAA 5FP4A 2VL4A 2PXJA 3W9AA 5GZCA 3O1TA 5C3OA 3RI9A 4E8DA 5FIXA 1NY71 4HPKA 3WQ7A 4AE2A 4FP2A 1HLCA 4KWKA 4KMQA 4YW1A 1WBFA 4P14A 5JXJA 2RG4A 4LBMA 1OF4A 1W9YA 4WBBA 5T3NA 1HDKA 4B7KA 2WN2A 1QU0A 2QQKA 2YPDA 4HN0A 5GZEA 4M00A 1X33A 1OXCA 4OCTA 3UKTA 5JWPA 2PA7A 5FZ0A 1HB1A 5J09A 3OYWB 1Y9QA 4HN1A 5LEJA 1W04A 1LU1A 2W5FA 2IC1A 4HBNA 4QKFA 4LITA 3J8F1 2H6CA 2DFBA 2AEZA 2DVDA 4RR3C 1IKQA 4RGAA 2HWB2 2RR13 1UU5A 2QQIA 2D6MA 2XJTA 5J48A 3O1RA 1JOJA 3LEMA 4PLOA 1VMFA 3H3LA 5IUQA 5JVVA 4AZZA 1OLME 4AVAA 1G8WA 2E7AA 4LLFA 1H2MA 3SC7X 1LOCA 3SKVA 2P3YA 4AAPA 4ZU4A 4MGYE 4NJ4A 3IMNA 5JMCA 3CL1A 1JI6A 1UY3A 1W03A 2VVEA 4IE6A 1DYKA 1KEXA 2XDVA 5LBFA 5K7PA 4FPEA 2P2KA 5CNAA 4QPIB 1GWMA 2RMU1 2YC2A 4D7YA 3V0BB 4AEDC 3URFA 3SHRA 3GHMA 1W2NA 3ZO0B 1Q8OA 1U12A 4I01A 2EXKA 4FSJA 2P3JA 3RYRA 2WNUC 5DN2A 2Z5WA 5JOXA 1IG0A 4KH9A 2C1FA 2MPFA 2VY0A 2VULA 2OZ6A 1LOFA 1UD1A 3ATGA 3PTRB 1NA1A 1K5MC 3NV1A 1NOVA 2A6XA 4DIQA 4DRVA 1C4RA 3CHXA 3P6BA 1NG0A 5FY4A 1NLRA 1L3JA 4QGLA 4CCDA 2V5YA 2JEMA 4XMIA 4BWOA 3OEAA 2BGCA 5JR2A 4BK5A 4Y22A 4Q0SA 3WDYA 1O8PA 1R64A 5JOWA 5JPNB 3MIHA 1F15A 2Y64A 4OI0A 2MHFA 3J8F3 4K7JA 1B09A 2CGPA 2BGOA 3KB5A 3WW4A 1YQ5A 3QACA 5GKAC 4OHXA 1RHI1 1UW8A 2FDIA 1WMEA 1UKRA 2ZKLA 1UX6A 2V4AA 1HB4A 3I2IA 3QH6A 2QBXA 4JQRA 2DDUA 4RR3A 4CU8A 4QQLA 2VZSA 1H6XA 3A0KA 3DECA 4LKDA 2WFPA 3AM2A 4FT8A 4PI2A 5ACA1 1GQHA 2GC0A 3O1MA 4K40A 4K8FA 1FPN1 1OMIA 3UKVA 1W8WA 1K12A 2HWD3 3J7NA 1U5XA 3S5AA 1JW6A 1YNAA 1B35C 1F4HA 3KHBA 4IEQA 3K51A 2DTYA 3K48A 3LFIA 5L36A 1CD3G 2VZ3A 5DG1A 5FZMA 2RR11 3VB9A 4BMEA 3I54A 3ZFFA 2GMPA 2E7QA 1HW5A 2AR6A 3ST7A 3GYDA 2X09A 2Z4FA 3LGRA 1EAH2 3R4SA 2ZEYA 2B39A 5FUPA 5LY1A 1F8VA 5H9RA 1BEV3 1RMU2 2HWF1 4XDOA 5E1RA 3VN4A 5BNPA 2I45A 1FX5A 1DZQA 2VQTA 1N3PA 3FLTA 5L7OB 3AZZA 5FBZA 5A7PA 4QMAA 3NV3A 3PUHA 5F8PA 1WCUA 1SCSA 3C7GA 5FR3A 3N35A 2PLV3 3RJRA 2XBO3 1UYYA 2YUEA 5DUUA 4AEJA 1FMD3 3M3QA 3O1UA 3BU7A 1VBB3 3HR9A 5D2AA 3QLQA 3IKWA 3UT0A 2EIDA 1HN1A 4IEVA 3B69A 3M3IA 1ZZBA 2GN7A 1IPSA 5EPAA 1NLQA 1OA4A 1RUI2 2W87A 2GU9A 1HRI1 1TME2 2EAAA 3WW2A 4QGNA 1PNFA 1GZCA 4XF1A 3OUIA 4EN6B 1R1A1 3BCWA 2WFF2 4LKFA 1W9WA 4HSLA 3K4DA 3UKNA 1QGLA 1QNYA 5J98B 4QX3A 1QJY1 2BOIA 1YFXA 2FZ1A 2VOKA 4FPKA 4LO4B 2VTXA 1LOBA 4ZXKA 3EQEA 4Q0UA 3USSA 2P6CA 2VQAA 4HPKB 5BNOB 1W0OA 5CAZA 3LA3A 5F3EA 5CFCA 5F2SA 2VMEA 5FYZA 1JH5A 4XUPA 4Q4X2 2WSVA 4Y26A 2VAUA 3AL5A 1JUHA 4Q1RA 1OVSA 2AEYA 2HWD1 4TLFA 1OH4A 3HQRA 4CDXC 5FOJB 5LK5A 4Z92B 3LPFA 4QPGB 1H6YA 2CU5A 5JI9A 5BNNC 5GLTA 1WUVA 1JYXA 4UW3A 3D3AA 4CA9A 1RUC2 1XE7A 4XAAA 2A71A 4LXLA 2VZ1A 1G9CA 1MS3A 3FX3A 4Y4YA 3O0VA 1GWLA 5AFEA 4S2DA 3ILRA 4CDWA 3HT1A 4LO8A 3O12A 4GA9A 5FYHA 4BQWA 5A3LA 1FMD2 3N3HA 2AREA 1GOGA 1V6MA 2VG9A 5FJKA 2PHWA 1AR73 2D97A 5I8YA 1ZYBA 1XSRA 1SHWB 2O0OA 2WNOA 3EO6A 1ULOA 5F37A 4YW4A 2FBEA 1J84A 3ON7A 1L7QA 4FO9A 4H7MA 2ZGUA 1AYM3 2DVAA 5FLHA 3U11A 1GWKA 2JENA 1QH7A 1NCRC 1PZ8A 2BUKA 1I3HA 3KV4A 4YRDA 5D8AB 4URAA 3ITQA 3D4KA 2RVAA 4Q4V1 5A6YA 1SQ4A 1JYCA 3WR0A 3G7DA 5CYYA 2VW1A 5FZGA 2G1MA 4UF0A 5JXHA 1ULCA 1PO13 1C8M2 3HQXA 5FPUA 3MZHA 1FYUA 4WM8C 4Q4W2 3AFGA 2WC2A 2Z42A 2EALA 4J6GA 4C1XA 4ASLA 4B29A 1Y3TA 1H2KA 2CDOA 1Z78A 3E1F1 4ZONA 1ZVFA 5FAXA 2JDNA 4Z1VA 1W28A 1O91A 3I3EA 1OHFA 4QB6A 5A7WB 1DDLA 3VBFC 2OPWA 4FPGA 1KDKA 5FZDA 3OGRA 5IVCA 4RGGA 1IOAA 1HB2A 3AZXA 4XUQA 3V0AB 5FZKA 5GZDA 1L7LA 2J42A 4IGQA 3EHKA 1UMIA 1LECA 1O59A 5CBLA 1CZTA 1HXS1 2VU9A 3I3BA 5IVBA 3ZR6A 4QD2A 1XBFA 4ZXEA 1RXFA 1TNFA 4YPJA 4A7KA 4X8PA 1W0NA 1AX2A 5CKNA 4NHKA 2QDRA 4KWUA 4CUAA 2YMZA 3UGFA 2KXLA 2BYVE 1OLRA 1COV1 2OUJA 2BU9A 1KXGA 2W0XA 3OY8A 4XMAA 3UYJA 4LEJA 5FZ1A 1BXHA 5IFTA 5FXXA 3KZ4C 4Z2WA 2R043 2DYCA 3WCRA 4D6QA 1AR82 2H0VA 1V00A 1TEIA 1UYZA 1Z7S2 1R081 2R49A 2XJVA 2A6WA 3IWZA 1AVBA 3QOPA 4KBBA 1GNHA 5FXWA 5FZ9A 1K42A 3ZKYA 2KD7A 5E16A 5F6LB 1RJ8A 1ZA4A 2W94A 3N7LA 3KD4A 1EPZA 3K4ZA 4AI9A 5ACA2 5HBAA 1F31A 3H7JA 5B2GB 2WNVB 4AQTA 2C24A 2VXRA 1W3VA 5DZEA 3PNAA 4EQVA 1MQTA 1XC6A 2BBAA 4Q4X1 3CKHA 3ZFEC 3ZXDA 3MPBA 3VZJA 2A73B 2BFUL 3C2UA 5BNQA 2XQRA 4NVPA 2FDHA 2DVGA 4QQOA 3KMHA 5CFCC 1CZVA 1UMHA 1OA2A 2HYKA 5JXIA 4XE9A 4XBNA 4XW3A 2ORXA 1VP6A 4LHNA 2JG9C 1SPPA 2Z69A 3ZYFA 1F2NA 1ZBE3 1W06A 3FUQA 5JPMB 4BK4A 3TN91 4GWMA 5FPVA 2W1QA 1PX4A 3K77A 2ZGRA 4X6QB 4MGQA 4DXRA 4ONUA 2PQSA 2VOTA 1WW4A 2IVJA 2V5DA 3GZTB 4EWDA 4Q26A 4NIGA 4UFMA 4WVVA 2J1EA 5LBCA 1W8FA 1RUE2 2AGSA 1HRV1 1NUKA 4JTNA 2Y34A 2BWAA 2VZOA 1HJFA 2JD4A 2J1TA 3OD4A 3H42B 4AQSA 4YZ2A 3AC0A 1AHSA 3JD72 2EXJA 4PIXA 4UOJA 4TZDA 2DV9A 1T6BX 2DCKA 2RS53 2R1BA 4TWTA 2VCCA 1VBE2 2ARAA 4C0HA 1MZ5A 2JG8B 3S57A 5FDBA 2DCYA 3GNEA 4XUNA 2WQ4A 3HBZA 2D7FA 3ILNA 4S2GA 3JD71 5FZEA 2BP6A 2YBPA 3ELNA 4GH4B 2P37A 2D3PA 3RG0A 4CP1A 5JSPA 5L7OA 1OPOA 2A70A 5H9QA 5A7NA 4LK6A 4JDOA 4JKLA 1JOBA 4PT6A 3DPRA 3THCA 4A3XA 2RM21 2D5FA 3POSA 3NNFA 4HVOA 4D69A 2XMLA 3N7KA 4BCUA 4IE7A 4NUBA 4IDZA 5E8AA 4CCKA 3OUHA 4IEXA 4C8DA 5A1FA 4YZ1A 5I0SA 4OHYA 5LA9A 5DDJ1 3IT8A 2RM23 5IATA 2ET1A 2D44A 1HRV2 4AYUA 3Q9OA 5C7GA 2BEOA 3QCWA 1RUD1 4PQ9A 1UX7A 2BJSA 4AGVA 1GANA 3KLSA 2P5BA 1RUF3 1O3RA 2NN8A 2QCSB 4XBQA 3H8RA 2WA3A 2RDNA 1YIFA 1X9PA 1PMIA 3NKGA 3ZSKA 1PVC3 4YVWB 3U4XA 1ALYA 2QZ3A 4PQQA 1RHI2 5FY1A 4CPBA 1VLNA 4NOTA 5DAXA 3PTYA 3BUCA 2R071 1W6NB 4NHYA 3BOWA 1T6GC 1VBC1 3TB0A 3AXEA 3FL7A 1H1MA 1D4VB 3K3NA 1JZ6A 5DAQA 1IQAA 1QWRA 1YQ2A 4OUMA 1MR5A 4QX0A 1W0PA 3WDWA 3AMMA 1W90A 2JDAA 3E97A 1NX9A 1DBNA 1OD3A 3U14A 3WQBA 3IM0A 2D98A 1HJGA 1QJU1 1GYKA 1DGRA 3OPZA 4LLOA 4XFGA 5ANQA 3WDUA 1QJY2 2JB8A 2L9LA 1FV3A 3ZXAC 1RIRA 2VJXA 2NPIA 2QDNA 3HEIA 4JC1A 1PO23 3O5SA 1TMF1 2XH6A 3IPVB 2CYFA 3MIBA 4RN5A 3SITA 2PHFA 2JIJA 1JS9A 2C9AA 3GZAA 4AI3A 4EN8B 4F83A 1A8MA 3I2OA 1O5UA 1MQTB 3AYDA 2B45X 1NZIA 3H0OA 4QX1A 3U75A 1W8TA 5FCCA 2OQ6A 1VB4A 4JCKA 5FBJA 4AR2A 4E9KA 4CDQB 1FAYA 1WD4A 2WNUA 4QDSA 1ULDA 4A4AA 2FDFA 3LOBA 4ZZ8A 2WWJA 1F9KA 1MQTC 1MS9A 3M3OA 3NMBA 2XL9A 3T4VA 1SDWA 1ZX5A 2AH2A 5BV6A 2SBAA 1COV2 4OLLA 3U4SA 2Y33A 2UYAA 3U1XA 2P3IA 2EXIA 3DN7A 4TYSA 1AF9A 4RYDA 1DQ5A 3J7HA 3QBQA 4R9BA 5T5PA 1IGOA 3FJSA 3GZUC 5C5TA 4GB31 3RZJA 4C1WA 1H4HA 3RGBA 3MBWA 1LHWA 3B02A 2JG9B 4GKYA 3OCPA 2DURA 1VBC3 4DB5A 1QDOA 4YGEA 1W9SA 2CWSA 1V6IA 3ECQA 4XBLA 3JQXA 4YVSA 1UOJA 4META 4QB2A 3E5QA 2DUOA 2E33A 4EN9B 3JZVA 2C26A 1RUF1 4DPNA 4H3WA 4RHV2 2Y6FA 5CADA 3AJZA 2P17A 2W95A 4WVMB 4JGZB 3WNKA 1AR61 2UYBA 1DGWA 4EV0A 3ZSLA 4I09A 3MW3A 3OBRA 3VLBB 1UXXX 4OYUA 3WHUA 1UOGA 2VNVA 3LF7A 1CN1A 1ULPA 2CGOA 2XWBB 3BN6A 4W6YA 4OHZA 3VL9A 3WG2A 5FO8B 2ZZJA 1QEXA 2O8QA 5IJRA 2PHDA 4EE2A 3SCGA 4W6XA 3HVDA 3POIA 3RRDA 3R4UA 4XVHA 1OOPB 4LK7A 4U2AA 4M3CF 3WNPA 3ZSMA 1V9U3 1UPIA 4QDQA 2Z79A 1OBNA 3PMSA 1H1IA 2V72A 5FYMA 3A23A 5LA1A 2DCZA 1C8NA 4COWA 4QXBA 1FI2A 4JRAA 3V64A 3WLUA 2E53A 1DG6A 1UZVA 1LJ7A 1IQDC 1VBB1 3ACHA 4OI2A 4DUVA 1MZ6A 4IETA 3EXUA 2X05A 3NSTA 1O5LA 4AG4A 3HN3A 3POJA 4JX0A 2X29A 4LPLA 3J8F2 2Q4SA 2TNFA 1JUIA 2V4VA 3LWCA 2ZGTA 1VPHA 1VRBA 2AZ5A 1OQEA 1B35B 5JDBA 2FZ2A 3FMGA 1XNDA 3ZX7A 2BNNA 4QX7A 1BJQA 1EV13 2XONA 3I2HA 2R32A 3KQRA 5TSWA 3RWNA 1ASJ1 2RS31 2UWAA 4NMIA 2J7MA 4XC9A 5FXZA 4BQ4A 3ZYPA 1YQCA 1UPSA 1UY4A 3B94A 3BOPA 4MUVA 1IKPA 1UYPA 4PCRA 5KHKA 1GV9A 2XQXA 3SXWA 3KF3A 5F39A 1GOHA 3VZLA 1RMU1 1LEDA 1YEWA 2HWF2 3KSCA 3MV01 3TNPB 3MI8A 1S0JA 2WL1A 1JHJA 2DF7A 2B46X 1LEMA 2XJUA 2ADDA 1CIWA 4LO6B 4PBOA 3T4HB 1S0GA 4J1WA 3T1MA 4R9AA 5F32A 3WY6A 3UNPA 2BDRA 5LZ6A 4AQ2A 4QKDA 4FBFA 1AXZA 1OF3A 2VW2A 2WRAA 3HN1A 5CFCB 1AYN3 2JDMA 5FZIA 4BU2A 4L11A 2BTVC 4Y20A 2A5ZA 3I3QA 1AR93 3E6DA 3WP6A 2AACA 2D6PA 3FLPA 4AQ6A 1YFUA 4XILA 2OVUA 5FZ7A 2W91A 2JG8C 4QPYA 4N53C 4I0BA 3V65A 4A3ZA 4EN7B 4ZU7A 1N1VA 4G3YC 4I0AA 5LBEA 4CYDA 3POGA 5FYTA 1Q43A 5J3UA 2I2SA 3ZPOA 3FWEA 2W3JA 2RS12 2VH9A 2YFUA 1W2TA 2BGPA 2D3SA 2O14A 3ZYHA 4YM0A 4ET7A 3NV2A 4AHXA 2BOJA 3Q8BA 2BQPA 1GBGA 3WCSA 3RZHA 2Y60A 3VBSC 4BLIA 2JD9A 2YDEA 5EV7A 4LO5B 5EP9A 4QHOA 5BXXA 2WAOA 1PMHX 4MGIE 1ND2A 1QDCA 4Z82A 3O14A 4UW4A 1G9BA 1PO22 5G05L 5KHJA 4DEVA 2BRTA 3HMYA 1IZ3A 1LENA 4ARXA 1YFYA 1H4GA 1MVEA 3WSOA 3DPRB 4XPVA 4LOSA 1AL0G 1BLZA 2WLPA 5JLVA 1I9RA 3FLRA 5IVYA 4L97A 1LR5A 5FPZA 3V56A 1N1YA 4EZHA 2NM1A 3ZXEA 3ZR5A 4FXKB 5LBBA 5FZLA 3VBRB 1RUJ1 4GALA 1H8TC 4DZGA 4LHKA 1OPMA 5LY2A 4JDMA 2XOMA 4IV3C 1GUIA 1KQRA 2R042 5DUVA 3MFAA 4HETA 1OC1A 2AUYA 1NCRB 3I97A 1Q8QA 3OPTA 1QJX2 1BBT1 3ZYRA 5DG2A 3O0WA 2PFWA 1C8M1 3K2OA 2W2IA 2ZS6B 4B4PA 2A75A 1S0BA 5AVAA 4XFFA 5L19A 1BMV2 4LHSA 5F2WA 4B4QA 1CX1A 4H14A 3IDEA 2B8MA 4MYEA 5EJZB 2VW0A 5LEKA 4GH4A 4RSUA 2Q8CA 5C9AA 2HEWF 2ZEZA 1DP0A 1WD3A 1UQXA 4ZS3A 2YU2A 2FCUA 1AYN2 5AC91 3W5NA 2ZEWA 3W59A 1SDDB 4CDQC 1E5HA 2VTFA 1DCSA 1CAUB 2RS13 2ZMKA 4JGYA 4I2OA 3RVHA 5BNNB 4F3JA 5FQ0B 1KGYA 3LKJA 2F4LA 1X8EA 3M3CA 4XZUG 4EWAA 1E5IA 2K2SA 3WVJA 5JIAA 2RM22 2XXZA 5C70A 3KHCA 4GMP1 3DV8A 3U0ZA 2HBUA 4KQ7A 4DOUA 1AJOA 5BY5A 1UO9A 4Y4RA 2JE7A 3TYJA 1CAXB 1MS4A 3VDDB 5K8SA 2ZX4A 3NQHA 3CJXA 1BK0A 1X9TA 4Q0VA 1NZCA 2Y0OA 3RJ2X 1JZ5A 3PL0A 5JUVA 1QQP2 1D0GA 3HOBA 2VMCA 3JD73 3SH5A 3MIDA 4G4FA 4Z07A 5SV5A 3VDAA 1W6PA 4COVA 3BYWA 1DF0A 3POEA 1S2KA 4RA0A 3ZXFA 1O7FA 2TEPA 1W3XA 3CLPA 4LIUA 5FZOB 2D6NA 5FPAA 4PF5A 3BVCA 1QJFA 2R16A 4S2HA 1LHUA 2DTWA 2ZEXA 3DYPA 1UF2C 4DY5A 3AZVA 4UT5A 4DEQA 4Q5OA 1Q56A 2VCMA 3UETA 2CDPA 4XFIA 4NIDA 1MS5A 3J7LA 5HV4A 4WZFA 1UY2A 3KF5A 3HT2A 1PIV3 1HRV3 1S55A 3IBMA 1KDMA 4XCAA 1PO11 3FBMA 1BZWA 1XYOA 4ZPIA 1PK6B 4ZS2A 4JZRA 5KXBA 4Q8KA 1DQ2A 4IE5A 2WO2A 5IAVA 5BNOC 1REFA 4M3CE 1DZTA 3E6BA 3IZOA 2JE9A 1WLWA 3WF4A 4H7LA 5F3CA 1OSGA 4PDWC 3Q8FA 4HG6B 5A6XA 1XE0A 2VZPA 5IK8A 3KVAA 5DAWA 5I0UA 1FXZA 4CXWA 3T09A 4N53A 3N36A 4CDQA 2HWE2 1ULGA 3OUJA 4JKMA 3ZMNA 1VBD2 2R063 3RZZA 4Y5SA 1O4YA 1ULEA 3MW4A 3AMPA 1OVPA 4DNYA 2ETEA 4LR4A 4IERA 4OUEA 5HCAA 1D2QA 2IFRA 1DGWX 1ND2B 2J1UA 2ORZA 2X5IB 4LUKA 4M3CB 5LASA 5JCTA 2BERA 1NY72 3ZXLA 1LULA 3JQWA 4Q4V2 4ZHNA 3BODA 3CO2A 3TEYA 2JE8A 3KT4A 3WDXA 2VR4A 3VUOA 4QM8A 1LOEA 4K1ZA 2QQJA 4QHBA 4QX8A 4AFCA 1TNRA 5CEHA 2Y8KA 2JJ6A 2VZQA 5LATA 1G9DA 1RB8G 1GNZA 5T5OA 5DQ0A 3UGGA 2IFWA 5SV8A 3S0MA 3RPQA 4XDQA 4GWIA 3IMMA 4Y24A 1Q8PA 1NYWA 1AL21 3CEWA 2FD8A 2Y26A 4FAHA 1LKNA 4L92A 4QU1A 2Y0IA 1MVQA 3ACIA 3AP6A 3BTAA 3AKPA 4YM1A 1CWPA 5F5CA 2GALA 4QM9A 2B9UA 2EF6A 2G19A 2VMGA 3ENRA 3ACFA 1DQ1A 2NZ9A 2XGXA 3WNXA 4BPZA 1LHOA 1SFNA 3J9SA 3BALA 2R073 1J58A 4XQDA 3RFRA 2JECA 4ORFA 1UU6A 4UBHA 1AUYA 2ZGKA 2WYFA 4HK9A 3CIHA 1S0CA 2IUWA 5FPLA 3FN9A 3ACGA 2WWSA 2Y6GA 3UJQA 4AHYA 2JG8A 3EJKA 4WM7B 3VHPA 4AL9A 4BLJA 2YC4A 3AKRA 2VQ0A 3LE0A 4CCLA 5LCWL 4FOQA 4FPOB 4TSVA 3O1SA 4UXAA 3WHTA 5GLUA 1F5JA 1HN0A 1NCQC 4Y5TA 3GBGA 4OULA 2AYHA 3AKSA 1O8SA 3THTA 4QAWA 1LOGA 4AWDA 1AR92 4EWEA 1MS8A 1DGRN 2Q8DA 1BEV2 5K0UB 2VBBA 3P3NA 2G9ZA 1PZ7A 5FZOA 5KR7A 1L7RA 5T54A 4LTAA 1ZZ9A 4CCMA 2E26A 4IV3A 2JICA 3EYPA 2VM9A 4XQ4A 1BBT2 3LA2A 1W9TA 2WS93 2LUWA 4Q4Y2 5GLWA 2ARCA 2OUHA 3I4IA 4D7TA 2VUAA 3DGTA 4AGRA 3VBHB 2QQUA 4QKNA 2WS91 4PHZA 3DCQA 4XXPA 2XLFA 4KWJA 2VQUA 4ASKA 3A21A 4NPRA 2C9KA 4P9WA 1SBDA 3B9CA 3RYKA 3AP5A 1VALA 2XBO1 4D0QA 2C0ZA 3B93A 1XNKA 4JKKA 4URTA 5FZBA 3VBUA 5A80A 4BB3A 3HNBM 4Y1VA 5FP8A 3VDBA 3CF6E 1RUNA 2H6BA 2HEYF 4GB33 4NRQA 2QQOA 1JZ3A 3AFKA 4IV1A 4XUTA 3UV9A 3TBDA 1V6LA 1LTEA 3NVCA 4FFHA 2PAEA 1CJPA 1QOOA 2RE9A 1OLQA 5HXMA 5LA2A 5IVVA 5T52A 5IHRA 5BNOA 3K46A 1PHMA 4AVCA 1W05A 3MHZA 5D1IA 4Y1XA 5A33A 1YQ6A 1OI6A 3SH3A 2E9QA 2CL2A 3KVBA 4XF4A 3MIFA 2HWE1 2D3RA 3KGZA 4N43A 5F7UA 1PGSA 2EIGA 1GLHA 2ZAAA 1W8OA 4CDXB 4LHLA 2QFEA 4CP9B 2OX0A 2XJSA 4A6OA 1FPN3 1KD7A 4XHBA 2WS92 3I2GA 1LU2A 3WINE 2VECA 1DGLA 1W6OB 4ZKTB 4O9GA 1S1AA 1P8JA 1V0AA 1TE1B 4W4ZA 4QXHA 2B9VA 5G04L 4I0WB 1UZZA 1VMHA 1ZBA1 1RUE3 3CJIC 3WF0A 3VD9A 3MO4A 4L0PA 1GKBA 2A3XA 3WF3A 2IXIA 2WZPP 2IZWA 1WCDJ 1ZZ7A 1W8HA 1Y4WA 4LKEA 2W1UA 4K8RB 4QX5A 4Q4Y3 1AR91 2WYSA 2AC1A 3OBAA 5F9TA 1CAXA 1HQNA 2ZGMA 3PJYA 3POYA 2XVKA 3VDDA 3WDVA 4E4DX 5IAXA 2IXCA 1CAVB 5CVRA 3WG1A 5DZFA 4BOWA 2PN5A 4LE4A 2X5IC 2OPKA 3MUZ1 3MIEA 3WEZA 4NIIA 5C4WA 1YWKA 1QNWA 1WCQA 3MFCA 3OB8A 2RV9A 1E5SA 1ODMA 4JGYB 4FAGA 4XFAA 1Q5OA 1VR3A 2W47A 4I02A 1TMF2 2TBVA 3M7AA 1H1AA 4HANA 5FMCA 3ES1A 5L73A 3JB8A 5C4WB 2J1RA 2D93A 1ZRCA 4UF0B 3VBUB 1YYNA 3VKOA 2HWC2 1VAVA 4YVSB 3I2DA 4BM8A 1QXJA 3AJYA 3AX4A 4CDWC 3DF0A 4EN0A 1YQ8A 2IXHA 3VBRC 4TTGA 1VBE1 3WNLA 4CVUA 4IE0A 1QKQA 1VRH2 4R9CA 2BV4A 5IWFA 4DY3A 3NKTA 5F3IA 2ERFA 1JZ8A 4MOAA 3I2FA 4MADA 2VD7A 4BXFA 3IIAA 3T30A 1JOPA 5FK8A 3I59B 4HVQA 2OS2A 4DXSA 3N9QA 4RHV1 2XLGA 3P1IA 1M06G 4Q2FA 1JYTA 1RMU3 2HWD2 1MEC1 4V2VA 5CA6A 3RZGA 4AXOA 3WQ0A 1PGW2 2XJRA 4PLNA 2ZHMA 1XPWA 3ZDSA 2IXLA 1FOD2 2ZX3A 4WM8A 1GZTA 2QUOA 4CU6A 4NHXA 4XABA 4A2UA 1QXPA 4V1PA 3DXTA 3KGLA 4YSFA 4QPGA 3AVRA 4PIZA 3BB6A 3ZYBA 1OKOA 1VBB2 2FCVA 4WM7A 3VDDC 4MGZE 1WMDA 1J3PA 3C8XA 4UWDA 3S5QA 1LGCA 3S7EA 1DQ6A 2VMHA 2YC0A 2OKXA 4P5YA 1RUF2 5FOBB 3WG4A 1C57A 1RUE1 1RUH1 2ZMNA 3ZOIA 3S30A 4Q1PA 4BA6A 2YY1A 2BNMA 4XOGA 1VBA3 2DVFA 5DAVA 3ROUA 2D5HA 4MG2A 4FTSA 2CHHA 4JAAA 4D6SA 1SLLA 1ZM1A 4NWVA 3PUSA 2GZWA 2G9FA 1STMA 1VBA1 1RUG3 2PTMA 4NRPA 4P00B 2J22A 3K4AA 1AYM1 1AXYA 5FYBA 4MVTA 1DQ0A 2GC2A 5FFOC 1CAWB 2BVBA 4GJZA 3ZIXA 3NNGA 3OG2A 2D6LX 1NE6A 4M0HA 4XF0A 3IDAA 5FY5A 3PU8A 3Q8CA 5KWRA 2ZHKA 2P34A 4BMBA 1UZ0A 4AEKA 3GF6A 1N1TA 4MSVA 4N8MA 4BIFA 3ZSEA 2BVVA 2ZGLA 3BTZA 4QB1A 5H9PA 2ZPXA 3UJOA 3BU0A 4FTBA 1JTZX 1TZOA 5ERLA 5A6ZA 1OUSA 5I0RA 4N90A 1ASJ3 2RS33 2PHRA 2QZ2A 3UK9A 2YB7A 4XTPA 3ZN5A 2VMIA 2VUCA 2GAUA 1HRI3 1EV12 4UFJA 1NE4A 3C7HA 3ZN6A 4Q4W3 1AR72 4OI1A 2QNKA 1BBT3 1IS6A
chains in the Genus database with same CATH topology
2QJVA 2A3WA 3A0NA 5JIUA 1IS4A 1O3QA 4FVVA 1M4WA 2RS11 4Q0QA 1LOAA 5I91A 1W6MA 2W08A 2VNRA 4Y5Z0 3AKTA 4JGYC 1OKQA 1OFSA 4OHVA 2NLRA 2ZX0A 2YYOA 3IDCB 1FNYA 3AZYA 1LESA 1VBC2 4AFMA 1K5MB 3MICA 1YFWA 5JI7A 4JRLA 4BQ1A 4XFBA 2E6VA 3L2YA 4HFSA 3W58A 4YFWA 4CEYA 3R0RA 4XQWA 3QH7A 3USUB 1YCIA 3CJIB 4YYOA 3HD8B 1SLBA 1V6JA 4N43B 3VKNA 4E2SA 3RS6A 4G9SB 1KFXL 4NN0A 4FP3A 5JZGB 1H8TA 1CJDA 4RD7A 2ZABA 4WVZA 1S2BA 4GXLA 3PJQA 3ETQA 1W6PB 1YI9A 2VUJA 4AW7A 1CONA 3WZ1A 2WQZC 4RR3B 1YHFA 5C8CA 1RC6A 1GICA 3ZFFC 4YGDA 2EAKA 1H9WA 2EVXA 3USUA 5K0UC 1LHVA 1BVVA 4HSJA 4XF3A 4YVWA 4J1XA 1NQDA 5JSOA 3MPPG 1PVC1 1C1LA 1RUI3 1MZEA 2JDZA 1ZNPA 4YZ3A 2YXSA 4I30A 3MEPA 2PHXA 2LALA 2A7AA 4ES9A 2PHUA 5BNNA 4A7YA 1U5ZA 3V0BA 3NW4A 1ENQA 4JVAA 1NQJA 3ZXKA 3I8TA 4X6RB 1PVC2 4MZUA 4XTMA 1UN1A 2DUQA 1HV1A 1W6MB 1ENXA 2DWRA 2ZOEB 5GLVA 1I1EA 2WJSA 3LAGA 4AEDA 2ZGNA 3PVNA 3ZPYA 3AXDA 2D6OX 4QQPA 4PDWB 4BIOA 3KCCA 1VBD1 1QQP1 3LA7A 1NCRA 1R091 1VRH1 3FE5A 3ZSJA 2CTVA 1GZWA 2WA4A 3JBG1 3NAPB 1NA1C 3E6CC 4GQ7A 3TAYA 1NXMA 5A33B 1AR71 1R093 4K9SA 2WNUB 2ES3A 1DYPA 2XPJA 4PJYA 4EROA 4OI4A 3VZOA 4B4RA 4LNVA 1WBLA 4N7UA 2K9ZA 3OJBA 2XUMA 4CDUA 1I5ZA 2CGNA 4FPFA 4YG6A 4AI2A 4H55A 1C5HA 2XVGA 4AVSA 5H9SA 3ZXJA 3M2MA 3TRSB 2GH8A 2GNTA 4JDNA 4Q29A 1A6CA 3M1HA 1RUG2 3ZYJB 1OFNA 2P3KA 2FQPA 1J1TA 3D82A 4OFGA 4P9LA 4BYYA 4GB32 4ATFA 4QGMA 3VHRA 2WFF1 4M3CA 3UL2A 5HXVA 4XJ9A 3AZWA 3ZMOA 2UY8A 3WW1A 1NXD1 2V73A 4MXVA 1S0IA 2CAUA 1REDA 2OZJA 1SBEA 3H3ZA 5CU1A 2NYYA 4HL0A 2ZX2A 3J26N 4X8NA 4E4ZA 1W6QB 1H9PA 1H2NA 1EPWA 2PELA 5FLIA 2ZBJA 2NMOA 3WG3A 1ZRDA 1Q3EA 3CNAA 2RR12 4C90A 3WX5A 2CAVA 1DZRA 5J36A 3U10A 1MACA 1CPMA 3ZIWA 3OY8B 4D94A 5K9YA 1SBFA 1SLCA 1TMF3 5FMOL 4RL7A 5JAXA 1SEFA 1KRIA 2VNGA 3FZ3A 4R4XA 2MNGA 4CDUC 1C1FA 1N3OA 4FQZA 3B7MA 5EFUA 2R0FA 2R072 1WLDA 2YGMA 3DKWA 2G4IA 4IEUA 3THPA 4QQHA 3FHIB 5I93A 1BKZA 4WVWA 1MS0A 2N7GA 4AHWA 4LA2A 4RQPA 2LTNA 1ND3C 2ZGQA 3ASIA 3B01A 3ZYIB 1S0EA 3JUUA 1APNA 3WUDA 5FREA 1E57A 1RUJ2 3ZN4A 3H50A 1LCLA 3KCYA 3M8LA 1KFUL 2PHTA 3SCHA 4LUMA 2R0HA 1PO12 4COZA 5GJ6A 2ZCWA 1EY2A 2HWF3 5HCFA 2ZGOA 1ZREA 4GULA 5F5QA 1PNGA 1OD5A 4N53B 4KWLA 1WLTA 3RQ0A 4YZ4A 1J3QA 4FCAA 4MLOA 3VBUC 3NV4A 1URXA 4XZPA 4S2FA 5C4WC 3VHNA 1JXNA 4L9BA 5HCBA 2VOWA 5A3MA 1W39A 1XYNA 4XEZA 1DIWA 3B5LB 1WA4A 4RFT0 4DS0A 4AHZA 2BFUS 2RS51 1C5IA 1H8VA 4MXWA 2XHKA 3DUIA 2EA7A 4YARA 5CFDB 3LSEA 4PLMA 5DXDA 3VBFA 4CEWB 1UL9A 5KHIA 1X36A 3NL1A 2W39A 1QY4A 1XE8A 3IDBB 1NCQB 1DQ4A 2WIIB 1YXWA 3MIGA 5DZGA 4BH9A 5F1RA 1Z0HA 3IN9A 1HXS2 1IHMA 1VBE3 2KM2A 5HI0A 1ULFA 2WSUA 4I3GA 3RSJA 5KC6A 1HQWA 1IS5A 4HT1T 3N7MA 1C8M3 1LB2A 4ATEA 1EAH1 3I7DA 2CY6A 1RJ7A 2D40A 3AMHA 1H2LA 1YJKA 4P9XA 4RHV3 3AP7A 5E88A 5J37A 1EYBA 1TME3 3INAA 1MEC3 4FOVA 4O9EA 5T5LA 1AR81 1OOPC 1Z7S1 1J59A 1YRZA 4IXLA 1KS5A 2TUNA 4IV1C 4A7ZA 4Y20B 4DQAA 5C9AB 4I3PA 5GM0A 2WKKA 5J7MA 1AR83 1Z7S3 2X8KA 4E27A 2NP0A 4Y1YA 1V9U1 1XU1A 3VKFC 1N47A 2ZMLA 1UU4A 1CAWA 3D8CA 1YO8A 4LBQA 2X53S 4YW5A 4FOYA 4C91A 2E7TA 3NAPA 1QJU3 5EJ3A 3ZFEA 4KU7A 1QF3A 1REEA 4XETA 4EJRA 4K20A 4OVEA 2PLV1 1MS1A 2JKBA 5J96B 3VBRA 1WCKA 5T55A 4NO4A 1WCSA 1ND3A 1RUH2 4HKOA 4Q4X3 2XKOA 4RS5C 2E51A 1RUOA 4XIKA 1RUG1 4U36A 4QXKA 1Y7BA 5CG9A 3GBFA 1RVF1 1XXNA 1FOD1 2VGDA 3X29B 1CVNA 1HIXA 3PMEA 1PK6C 3UK9A 3IPVA 1ZRRA 2ZX1A 1XU2A 2YV8A 1ND3B 2XJPA 1FOD3 4XFHA 4YFZA 3JBG2 3WXPA 3N7JA 4F7ZA 2XLAA 3HAGA 5ABJA 4XJAA 3VKMA 5LRSA 5DUXA 1G9AA 4LE3A 4LT5A 3MLKA 3PVEA 3OF1A 5EWSA 1OOPA 4YLZA 4BE3A 4P5HA 2X5IA 4WM7C 2Y38A 1LODA 2O1QA 3HIFA 5C33A 2ZGSA 2F4PA 3H1MA 4D3WA 3ES4A 2ILMA 4UW6A 4YW2A 5GZFA 4AVTA 5L7OC 1O3SA 1VBA2 3ZFGB 4RQPC 4GH4C 4LA3A 4LBLA 4YM2A 3AMQA 4PBPA 4YG0A 3DL3A 3ME2A 4AI8A 4WVMA 2GN3A 2ZTNA 3VV1A 5GLZA 1V70A 2ZA9A 1WGPA 3VHOA 1RUC1 2GNMA 4XFCA 1BYHA 2ZGPA 3AP9A 4MH0E 3CU7A 4YZ5A 3VZNA 3PLQA 2MEV3 2YGLA 4LBKA 4RS5A 2R1DA 5JSRA 3OGGA 5JR7B 2D6KA 4NR1A 4ISRA 3R6SA 1GR3A 1XRUA 1R1A2 3R4DB 1B35A 1JN2P 2K0GA 1SACA 4LO7A 1SLIA 3NO8A 1UIJA 3ZFFB 3GALA 1O4ZA 1RUD3 1PGW1 1WMFA 3D5OA 2WT1A 1WW5A 1CGPA 3H8UA 3ZFGC 3WUCA 1RVF3 5CFDA 3FFZA 3MF9A 5JZGC 4AK3A 3U07A 2UU8A 4RS5B 2I07B 3VGIA 2XL7A 3RDIA 4XF9A 3NWKA 4KGGA 5FQ0A 4MX3A 3ZN6B 2LM3A 5AVPA 5DDJ2 4FPCA 1ZRFA 1UMZA 1G6NA 1JHNA 2GDFA 2WNVC 2ZHLA 1KS4A 4KNCA 4Q8LA 2O8OA 1PIV1 5FO7B 4FPHA 4N9IA 2C5DA 3NAPC 1X8MA 1ONAA 2MEV1 3VBSB 2XWJB 2PYTA 5FTTC 2Q5TA 5JOZA 1OQ1A 2XVLA 4IV1B 1CPNA 1AXKA 2QKDA 4AVVA 4AFDA 4OUSA 2ENRA 3TNQA 2OA2A 1MZFA 3BIWE 4QT6A 1IS3A 1D4M2 5T50A 1G9FA 4AI0A 2DU1A 4RQPB 4AVBA 1RGSA 4E2GA 2PAMA 4FXGB 2H0BA 4Y22B 3WT3A 5KHGA 3LCPA 4MXWB 1QOTA 5CIRA 4GMP0 4QPIA 1YJLA 5ABJC 1PK6A 4P9YA 1FPN2 2IWGB 4MV2A 4Q4V3 1X50A 1BVP1 1BCXA 4FPJA 3GBWA 1IPKA 4CEYB 1YI7A 1FATA 3B9IA 3HWJA 4YVWC 1XNBA 2B7YA 3ZVXA 5FMOS 2VPVA 2XG3A 5KHHA 4XJZA 4OZXA 2ATFA 2JG9A 4Q27A 3N4MA 4FTEA 1K5MA 3ILFA 3T1LA 4CEWC 1C3HA 5DDJ3 1AX1A 4IEOA 4P9GA 2Q0AA 2ZJCA 4UBGA 5KXEA 3V0AA 4K6BA 1W6NA 5F6KA 4CEYC 2PHLA 4FPLA 1D0HA 2XBO2 5FLJA 3KT1A 3RMXA 2AENA 5ABJB 4OHWA 2XB6C 3AB0A 5T5JA 1ZBA3 1V6NA 3VKLA 4MGKE 2ZKNA 4N43C 1WLCA 5IT6A 3WP5A 2BBVA 2QQPA 1D4M1 5EZWA 3SCFA 4IEZA 3JB4C 1XNCA 3SNMA 1R092 3FUOA 3GHNA 5AC93 2CNAA 1A78A 2V09A 4COUA 3B3QE 2IXJA 3H7YA 5A32B 3ZFGA 3POWA 2E63A 1AL23 4AEDB 2MEV2 3FC0A 5D8AA 3TWIA 3KM5A 2CV6A 1CAVA 1RINA 5C9AC 1J1LA 4AFBA 5I8TA 4FQ4A 1GSLA 4P9JA 1RHI3 2ZZQA 5BYNA 4GMP3 4AFAA 4GKXA 4D7SA 5C6CA 3QD6A 3VZKA 1POV1 4UW5A 3PHMA 4Z8BA 1VJ2A 4Y1ZA 4XJUA 1ZBE2 3RI8A 4CEWA 1G7YA 3AP4A 1DU3D 4N9HA 1C28A 4AF9A 2DCJA 3H9AA 2D43A 2DCTA 2VVDA 3OGJA 1SFYA 1ZBE1 2DFCA 3ZFEB 4PDWA 1ZZ8A 1N1SA 1D2SA 1RL3A 3EBRA 2VOVA 4W6WA 1X82A 2ZHNA 1J3RA 3RMYA 2QE3A 2RMU3 3E5XA 4R52A 4B7EA 5CFDC 5A32A 3G6JB 2B42B 3MGUA 4AGGA 2Q30A 1Q8VA 1OQDA 1WW6A 1H0BA 4KGQA 4KG0A 4CDUB 2R061 4QPGC 2OYZA 3D0JA 2A3YA 4QQ2A 3KS7A 3VL8A 4AI1A 3KCXA 1POV3 5CG8A 4SLIA 3AYAA 3D0SA 3A4UA 3E5UA 3S6PA 4XJWA 4K3UA 3OBTA 4R8HA 4IL7A 4DINB 4QU2A 4IEWA 2WZR2 4Q4Y1 2ET7A 2G9GA 1XQNA 3S7IA 1AZDA 1ZZ6A 4LBNA 2PLV2 1GZ9A 3VBOC 3WW3A 2DUPA 3M4FA 2IXKA 3FFQA 1YLLA 2W68A 4L2NA 3OTFA 2GMEA 5GALA 1O3TA 2RHPA 2BWCA 3LOIA 4JGZC 2NQYA 1S0DA 4BHPA 1NCQA 1QJY3 3ZXGA 1QJZA 4CDXA 5ACA3 5DUWA 3LZZA 5KC5A 1EAH3 3M3EA 4B3NA 1NA1B 2A6ZA 4CP0A 4AEMA 5KXDA 3MW2A 4LBQD 1PZ9A 2ZACA 1LHNA 3SMHA 2UY9A 2W52A 4CDWB 2GNBA 1HRI2 1TME1 4LULA 4LBJA 1BK1A 1DFQA 4XIOA 1UKGA 3JCIA 5BPXA 1FV2A 4YW3A 2Q8OA 2WNEA 1BEV1 2YHJA 4YGCA 5C8WA 4IESA 1PO21 4XJ8A 1VAKA 2R6QA 1R082 1CQ9A 4DXZA 1ENRA 5KBFA 4YG3A 1Y43B 5BNPC 4NHLA 4XXAA 4PIYA 2I74A 1RUC3 3WP3A 1FMD1 4HMZA 1EV11 1IPJA 3WP4A 4IEYA 1QH6A 2VNOA 1RTVA 3SH4A 2CWMA 1SCRA 2UWCA 2YROA 1SMVA 1LRHA 1RUD2 5IK5A 1MEC2 3AYCA 3ALQA 3R05A 1WW7A 1XYPA 1ZZCA 2VVFA 4JV4A 2UWBA 2HKXA 3JU9A 3PVBB 1V6KA 1A3KA 3APBA 1ENSA 2RS52 1U5IA 1AL22 1QMJA 2GSYA 2WZR1 2GNDA 2NMNA 3VBHA 1PGL2 1POV0 2R30A 1DHKB 3T2TA 5CB7A 4HVRA 2PQQA 4IEPA 4N7IA 4Q4W1 1AYN1 4F8AA 5AC92 1DLLA 1HXS3 3I59A 1V6OA 1ASJ2 2RS32 4INDA 1VB2A 2HWC1 3SISA 2HEVF 4LBQB 1TQ5A 5K0UA 3MLLA 1X7NA 5I0TA 1R1A3 4HKWA 1CESA 5BNPB 1FNZA 2YZ4A 2BPA2 1UCXA 2HWB3 2PAKA 5FRAA 3D6EA 1AR63 3ACLA 3LSDA 4FPYA 1BQPA 4W65A 3MYXA 3OYWA 3WD5A 3WOGA 3O7OA 1RUH3 1VAMA 1YUDA 1O4TA 2HWB1 4B8EA 4JTOA 3AMNA 4KL1A 2YPJA 4NHMA 2GMMA 3C3VA 3OD0A 3VBOA 2JX9A 5LK7B 5FPXA 4DRRA 3WV6A 1KJRA 2OW4A 1NLSA 2ARXA 3B00A 1QJU2 1RITA 1JBCA 1AJKA 3JBG3 2DVBA 3SLIA 4ES8A 4WV8A 2WZR3 4HK8A 4DFSA 1GZWB 1UIKA 1N3QA 4L8QA 4M0NA 1VIWB 4KU8A 4ASMB 1HX6A 1W2UA 3J4UH 2A6YA 4FOWA 2VOXA 4COYA 3AKQA 2XKPA 4P9IA 3M70A 5FO9B 2Q1MA 4XHXA 1U5YA 5JZGA 2BNOA 3WQ1A 2WT2A 3PVOA 3BPZA 1H30A 1HKDA 2FMYA 4IQPA 3CJIA 1CR7A 3H1YA 2WT0A 2OIIA 3NJZA 5E89A 5C8CC 4K1YA 1LGNA 1RUI1 4GIQA 4HZFA 2A6VA 4GWNA 4WM8B 1A8DA 5EXOA 1PVXA 3RNSA 3RYPA 3LB9A 1W6OA 2HWC3 3TN92 1LGBA 2JXAA 2FMDA 2ZAHA 5LRRA 1JYIA 4CTEA 1BMV1 1KJLA 2SLIA 5EYYA 5KXCA 1SLAA 2QVSB 2RJKA 1COV3 1GFF2 1EP0A 1QJX1 2ARBA 4HLTA 1CX4A 1UAIA 2XJQA 3VBSA 1PM7A 5GZGA 1R083 1AR62 1PIV2 1RVF2 3WDTA 4K21A 1ND2C 1QQP3 1AX0A 3MLJA 4HKLA 4JGZA 4QPIC 4ISQA 5IK4A 4WZCA 4YGBA 4Q0PA 1PGL1 1QXRA 2BW8A 1CAUA 1YIPA 1R1ZA 4E4SA 5AFBA 4KG8A 4IV3B 1GQGA 2R041 1VBD3 2R062 4L99A 1H8TB 1FT9A 2HWE3 4YNIA 1I6XA 3AK0A 5IK7A 3L9JT 1LOFC 2Z2SB 2Q1ZB 3DPRC 1RUJ3 5C8CB 1KITA 1F5FA 1S0FA 3MF6A 4R9DA 2UURA 5EYXA 1AYM2 2FHRA 3H1WA 4LBOA 2HJIA 2WNVA 3KT7A 4Y1UA 3TOJA 4ITCA 2WLQA 3TN93 4ZU5A 2F6BA 4DMIA 3VBFB 1V9U2 1W6QA 3VBOB 4CP2A 1UZYA 4CZSA 2EXHA 3AYEA 4C0BA 4YM3A 2DU0A 2B5HA 1QOSA 3ZYGA 1U0AA 4XYXA 3VZMA 2WFF3 2GC3A 4YVSC 1HV0A 4M01A 1HQLA 3FBYA 3H3UA 5D8AC 4CRQA 2WINB 5I8SA 1D4M3 2KA3A 5JOYA 1OA3A 1QJX3 3MDPA 4BZ4A 4SBVA 1G86A 1QHDA 1SLTA 2GC1A 3VBHC 1ZBA2 3O0XA 4NWWA 1Q8SA 4E2QA 3P3PA 2GH2A 3L2HA 2RJLA 2RMU2 4R4ZA 1VRH3 5GZCA 3W9AA 3RI9A 1NY71 4HPKA 3WQ7A 4AE2A 4FP2A 1HLCA 4KWKA 4YW1A 1WBFA 4P14A 4LBMA 4WBBA 5T3NA 1HDKA 4B7KA 1QU0A 4HN0A 5GZEA 4M00A 1X33A 3UKTA 5JWPA 2PA7A 5J09A 3OYWB 1Y9QA 4HN1A 5LEJA 1LU1A 2IC1A 4HBNA 3J8F1 2H6CA 2DFBA 2DVDA 4RR3C 1IKQA 4RGAA 2HWB2 2RR13 1UU5A 2D6MA 2XJTA 1JOJA 4PLOA 5IUQA 5JVVA 4AVAA 1G8WA 2E7AA 4LLFA 1H2MA 1LOCA 4ZU4A 4MGYE 3IMNA 5JMCA 3CL1A 2VVEA 1DYKA 5K7PA 4FPEA 2P2KA 5CNAA 4QPIB 2RMU1 4D7YA 3V0BB 4AEDC 3URFA 3SHRA 3GHMA 3ZO0B 1Q8OA 1U12A 4I01A 2EXKA 4FSJA 2P3JA 3RYRA 2WNUC 2Z5WA 5JOXA 4KH9A 2C1FA 2MPFA 2VY0A 2VULA 2OZ6A 1LOFA 1UD1A 3ATGA 1NA1A 1K5MC 3NV1A 1NOVA 2A6XA 4DRVA 1C4RA 1NG0A 1NLRA 1L3JA 4QGLA 2V5YA 2JEMA 4XMIA 4BWOA 2BGCA 4Y22A 4Q0SA 3WDYA 5JOWA 5JPNB 3MIHA 4OI0A 2MHFA 3J8F3 4K7JA 1B09A 2CGPA 3KB5A 3WW4A 3QACA 5GKAC 4OHXA 1RHI1 1UW8A 1WMEA 1UKRA 2ZKLA 1UX6A 4JQRA 3QH6A 4RR3A 4QQLA 3A0KA 5ACA1 2WFPA 3AM2A 4FT8A 1GQHA 2GC0A 4K40A 4K8FA 1FPN1 1OMIA 3UKVA 2HWD3 1U5XA 1JW6A 1YNAA 1B35C 4IEQA 3K51A 2DTYA 3K48A 5L36A 1CD3G 5DG1A 4BMEA 2RR11 3I54A 3ZFFA 2GMPA 2E7QA 1HW5A 2AR6A 3ST7A 3GYDA 3R4SA 3LGRA 1EAH2 2B39A 1F8VA 5H9RA 1BEV3 1RMU2 2HWF1 5E1RA 3VN4A 5BNPA 2I45A 1FX5A 1DZQA 3FLTA 1N3PA 5L7OB 3AZZA 5FBZA 4QMAA 3NV3A 1SCSA 3N35A 2PLV3 3RJRA 2XBO3 2YUEA 5DUUA 4AEJA 1FMD3 3M3QA 3BU7A 1VBB3 3HR9A 3QLQA 3IKWA 4IEVA 3B69A 3M3IA 1ZZBA 2GN7A 1OA4A 1RUI2 2GU9A 1HRI1 1TME2 2EAAA 3WW2A 4QGNA 1PNFA 1GZCA 4XF1A 4EN6B 1R1A1 3BCWA 2WFF2 4HSLA 3UKNA 1QGLA 1QNYA 5J98B 1QJY1 1YFXA 2FZ1A 2VOKA 4FPKA 4LO4B 4ZXKA 1LOBA 3EQEA 4Q0UA 3USSA 5BNOB 2VQAA 4HPKB 1W0OA 5CAZA 3LA3A 5CFCA 1JH5A 4Q4X2 2WSVA 4Y26A 1JUHA 4Q1RA 2HWD1 4Z92B 4TLFA 5FOJB 5LK5A 4QPGB 5JI9A 5BNNC 5GLTA 1WUVA 4UW3A 1RUC2 1XE7A 2A71A 1G9CA 1MS3A 3FX3A 4Y4YA 3O0VA 5AFEA 4S2DA 3ILRA 4CDWA 3HT1A 4LO8A 3O12A 4GA9A 5A3LA 1FMD2 3N3HA 2AREA 1V6MA 2VG9A 2PHWA 1AR73 2D97A 5I8YA 1ZYBA 2O0OA 3EO6A 4YW4A 2FBEA 4FO9A 4H7MA 3U11A 2ZGUA 1AYM3 2DVAA 5FLHA 2JENA 1QH7A 1NCRC 1PZ8A 2BUKA 1I3HA 4YRDA 5D8AB 3D4KA 4Q4V1 1SQ4A 1JYCA 3WR0A 3G7DA 2VW1A 1ULCA 1PO13 1C8M2 3HQXA 3MZHA 1FYUA 4WM8C 4Q4W2 3AFGA 2WC2A 2Z42A 2EALA 4J6GA 4C1XA 4ASLA 4B29A 1Y3TA 1H2KA 5FAXA 1Z78A 1ZVFA 4Z1VA 1O91A 1OHFA 1DDLA 3VBFC 4FPGA 1KDKA 4RGGA 1IOAA 3AZXA 3V0AB 5GZDA 3EHKA 1LECA 5CBLA 2VU9A 1HXS1 4QD2A 1TNFA 4A7KA 4X8PA 1AX2A 4NHKA 2QDRA 2YMZA 2KXLA 2BYVE 1OLRA 1COV1 2OUJA 2W0XA 1KXGA 3OY8A 4XMAA 4LEJA 1BXHA 3KZ4C 4Z2WA 2R043 2DYCA 3WCRA 1AR82 1V00A 1TEIA 1Z7S2 2H0VA 2XJVA 1R081 2R49A 3IWZA 2A6WA 1AVBA 3QOPA 4KBBA 1GNHA 5E16A 5F6LB 1RJ8A 1ZA4A 3N7LA 3KD4A 1EPZA 5HBAA 5ACA2 1F31A 3H7JA 5B2GB 2WNVB 4AQTA 2VXRA 5DZEA 3PNAA 1MQTA 4Q4X1 3ZXDA 3ZFEC 3MPBA 3VZJA 2A73B 2BFUL 3C2UA 5BNQA 4NVPA 2DVGA 4QQOA 3KMHA 5CFCC 1OA2A 2HYKA 4XE9A 4XBNA 4XW3A 1VP6A 4LHNA 2Z69A 2JG9C 5JPMB 1F2NA 1ZBE3 3FUQA 3TN91 4GWMA 2ZGRA 4X6QB 4ONUA 1WW4A 4EWDA 3GZTB 4Q26A 4WVVA 1RUE2 2AGSA 1HRV1 4JTNA 2BWAA 2JD4A 4AQSA 3OD4A 4YZ2A 1AHSA 3JD72 2EXJA 4PIXA 4TZDA 2DV9A 2DCKA 2RS53 2R1BA 4TWTA 1VBE2 4C0HA 1MZ5A 2JG8B 5FDBA 2DCYA 3GNEA 2WQ4A 3HBZA 2D7FA 3ILNA 4S2GA 3JD71 3ELNA 4GH4B 2P37A 2D3PA 3RG0A 4CP1A 5JSPA 5L7OA 1OPOA 2A70A 5H9QA 4JDOA 3DPRA 4A3XA 2RM21 2D5FA 3POSA 4HVOA 4D69A 3N7KA 4BCUA 5E8AA 4IEXA 5I0SA 4YZ1A 4OHYA 5DDJ1 3IT8A 2RM23 2ET1A 2D44A 1HRV2 4AYUA 3Q9OA 2BEOA 3QCWA 1RUD1 4PQ9A 4AGVA 1GANA 3KLSA 1RUF3 1O3RA 2NN8A 2QCSB 4XBQA 2WA3A 1YIFA 1PMIA 3NKGA 3ZSKA 1PVC3 4YVWB 3U4XA 1ALYA 2QZ3A 1RHI2 1VLNA 4NOTA 3PTYA 2R071 1W6NB 3BOWA 1T6GC 1VBC1 3TB0A 3AXEA 1H1MA 1D4VB 1IQAA 1QWRA 4OUMA 3WDWA 1MR5A 1W0PA 3AMMA 3E97A 1DBNA 3IM0A 2D98A 3OPZA 1QJU1 1GYKA 1DGRA 4XFGA 4LLOA 3WDUA 5BUVA 1QJY2 3ZXAC 1FV3A 1RIRA 2NPIA 2QDNA 4JC1A 1PO23 3O5SA 1TMF1 2XH6A 3IPVB 2CYFA 3MIBA 3SITA 2PHFA 4EN8B 2C9AA 3GZAA 4AI3A 4F83A 1A8MA 1O5UA 1MQTB 3AYDA 2B45X 3H0OA 5FCCA 1VB4A 4JCKA 4E9KA 4CDQB 1FAYA 1WD4A 2WNUA 1ULDA 3LOBA 1F9KA 1MQTC 1MS9A 3M3OA 2XL9A 1SDWA 1ZX5A 2AH2A 5BV6A 2SBAA 1COV2 4OLLA 2UYAA 2P3IA 3DN7A 2EXIA 4TYSA 1AF9A 1DQ5A 5T5PA 3QBQA 4R9BA 1IGOA 3FJSA 3GZUC 4GB31 4C1WA 1H4HA 1LHWA 3B02A 2JG9B 4GKYA 3OCPA 2DURA 1VBC3 4DB5A 1QDOA 4YGEA 2CWSA 1V6IA 3ECQA 4XBLA 3JQXA 4YVSA 4META 3E5QA 2DUOA 4EN9B 3JZVA 1RUF1 4DPNA 4H3WA 4RHV2 5CADA 3AJZA 2P17A 4WVMB 4JGZB 1AR61 2UYBA 1DGWA 3ZSLA 4I09A 3MW3A 3OBRA 3VLBB 3WHUA 1CN1A 2XWBB 2CGOA 4OHZA 4W6YA 3VL9A 3WG2A 5FO8B 2ZZJA 2O8QA 2PHDA 3SCGA 4W6XA 3RRDA 3ZSMA 3R4UA 1OOPB 4U2AA 4M3CF 1V9U3 1UPIA 2Z79A 3PMSA 1H1IA 2DCZA 1C8NA 4COWA 1FI2A 4JRAA 3V64A 3WLUA 2E53A 1DG6A 1LJ7A 1VBB1 4OI2A 1MZ6A 4IETA 3EXUA 4AG4A 3NSTA 1O5LA 2X29A 3J8F2 2Q4SA 2TNFA 1JUIA 3LWCA 2ZGTA 2AZ5A 1OQEA 1B35B 5JDBA 2FZ2A 3FMGA 1XNDA 3ZX7A 2BNNA 1BJQA 1EV13 5TSWA 3RWNA 2R32A 3KQRA 1ASJ1 2RS31 2UWAA 3ZYPA 1UPSA 3B94A 3BOPA 4MUVA 1IKPA 4PCRA 5KHKA 1GV9A 3SXWA 3VZLA 1RMU1 1LEDA 2HWF2 3KSCA 3TNPB 3MI8A 1S0JA 2WL1A 2DF7A 2B46X 1LEMA 2XJUA 4LO6B 1CIWA 4PBOA 1S0GA 4J1WA 3T1MA 4R9AA 3WY6A 4AQ2A 4FBFA 1AXZA 2VW2A 3HN1A 5CFCB 1AYN3 4L11A 2BTVC 4Y20A 2A5ZA 1AR93 3E6DA 3WP6A 4AQ6A 2D6PA 3FLPA 1YFUA 4XILA 2OVUA 2JG8C 4QPYA 4N53C 4I0BA 3V65A 4EN7B 4ZU7A 1N1VA 4G3YC 4I0AA 5J3UA 4CYDA 1Q43A 2I2SA 3FWEA 2RS12 2VH9A 2D3SA 4YM0A 3NV2A 4AHXA 2BQPA 1GBGA 3WCSA