5A7WB

Crystal structure of human jmjd2a in complex with compound 35
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
346
structure length
346
Chain Sequence
b'LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAESCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
total genus 101
structure length 346
sequence length 346
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02373 JmjC JmjC domain, hydroxylase
B PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a7wB01
5ANQA 4TN7A 4CCOA 5FWJA 5FY7A 4GJYA 4CCMA 4QXBA 5FYTA 5FUNA 5A7PA 5KR7A 3KV4A 4Y33A 5FYCA 5A7NA 5FBJA 5FPVA 5IVBA 5FZMA 3AL5A 5FZDA 2P5BA 4UF0A 5FY8A 4DIQA 5F3CA 3K3NA 5K4LA 3DXUA 5FZAA 2XDVA 5A1FA 5FZEA 2YBSA 5A3NA 3PTRB 3LDBA 5F2WA 4HOOA 5FPLA 5FZ7A 5A3TA 5A7QA 5FZ4A 3LD8A 4GD4A 4UF0B 4GJZA 5FYZA 4AAPA 4C8DA 3PDQA 4LIUA 5FZ8A 5A80A 3KVBA 3PUQA 2W2IA 2Q8CA 5IVCA 4CCLA 3NJYA 5IW0A 2WWUA 3AL6A 5FJHA 5FJKA 2VD7A 5FUPA 5FZGA 2GP3A 2GP5A 2OT7A 5E6HA 3N9LA 5IVFA 4HONA 5FZBA 5F37A 4Y3OA 3AVSA 1VRBA 5FZIA 4E4HA 5IWFA 3PURA 5FPAA 3KVAA 3N9QA 4QXCA 5FZKA 5ISLA 5FZ9A 2YU1A 5F3EA 2WWJA 2XMLA 3N9OA 5FZFA 5F3GA 3U4SA 4CCNA 5A7WA 4EYUA 4BXFA 5LY1A 5FWEA 3N9NA 5A3WA 4CCKA 4IGQA 4XDPA 5FY0A 4D6RA 4CUGA 2Q8DA 5FP8A 3PU3A 5FZ1A 3K3OA 5FY9A 3N9MA 3PUAA 5FZLA 5FXWA 5F5AA 3ZPOA 4QX7A 4V2VA 5IVEA 3OPWA 2PXJA 4LITA 5FZ6A 5FYUA 4QWNA 3OPTA 5F5CA 5FY1A 2OQ7A 4V2WA 2XXZA 5FZ3A 5F5IA 5FYBA 5FXXA 4EZ4A 3UYJA 5IVJA 5FP4A 4GAZA 5FP3A 4CCJA 3RVHA 3U78A 4DO0A 5FYYA 4NUBA 3AVRA 4LIVA 4QU1A 4LXLA 4D6QA 4BU2A 4QX8A 5LWBA 5F39A 5FYHA 5A7SA 4IGOA 5F32A 3KV5A 5A3PA 4XDOA 2OX0A 3PUSA 2XUEA 4Y4RA 5A7WB 3KV9A 2OS2A 5FP9A 5FPUA 5LY2A 2Q8EA 4URAA 5FYIA 4EZHA 2YBPA 5FXVA 5FZCA 5FZHA 5A7OA 5FY5A 5CEHA 5F2SA 3K2OA 3PU8A 4CSWA 4QXHA 5FXZA 3ZLIA 5IVYA 4AI9A 5IVVA 5FZOA 2OQ6A 2YBKA 5FYSA 5FY4A 4IGPA 3DXTA 5F3IA 5FP7A 2YU2A 5LW9A 3KV6A 5FPBA 3N9PA 5FZ0A 5FZOB 5FV3A 4ASKA 5FYMA 4D6SA 4BISA 2YPDA 5FYVA 5A1LA
chains in the Genus database with same CATH superfamily
2QKDA 4NVPA 2MHFA 4LO8A 4CCOA 1VP6A 2BRTA 4CCMA 4QXBA 1YJLA 3TB0A 2JDNA 2ZGUA 5KR7A 1NX9A 2VMDA 1WMDA 2H0BA 1OMIA 2R7EB 3LAGA 4KH9A 4FFIA 1BVP1 1E5SA 4MGTA 1NCQA 2C9KA 3IN9A 4FP2A 1RUH1 3B93A 1HB1A 4YZ2A 3SITA 4LKSA 3ILRA 4BQ4A 1NY71 2RM23 3VKNA 2CGPA 4XUNA 1SLCA 2ES3A 2XJTA 1YLLA 2DFCA 4AAPA 4FXGB 3A21A 1DZTA 4Y5TA 5I0DA 3DL3A 1H4GA 3ETQA 3POEA 1TQ5A 4M4PA 1ZBE2 1LRHA 5JLVA 4BLIA 2D97A 2GNTA 2X29A 2WT0A 4EWDA 1DGLA 3Q8FA 5CADA 1MS9A 4Q4Y2 1DGWA 3POBA 1DU3D 2R063 4NE9A 2OA2A 1W8NA 2NMOA 5DZGA 4KU8A 1OF3A 1RITA 4E2SA 2GP3A 3B94A 4BH9A 3GHNA 1ND3B 2WIIB 1JH5A 2VW2A 3RZHA 3USSA 5T54A 4LBQB 1LOAA 4RL7A 4YZ3A 1BVVA 5FZ9A 1VBC3 1AYM2 3N9OA 2KXLA 5F3GA 1KD7A 3G6JB 5DABA 1RHI2 3SNMA 3M3EA 4CUGA 2Q8DA 2ZHMA 4K20A 1V9U2 2ZX3A 1ULPA 2HJIA 5JIAA 1O3QA 2BUKA 2J1AA 2DBNA 2DUOA 2BNOA 3KS7A 4PJYA 1DQ0A 1UY4A 2DTYA 3POFA 2ET7A 1FX5A 3OTFA 4XURA 3WW3A 1VBB3 3O5SA 2JENA 1TNFA 2VCMA 4LO5B 3E6CC 2GMEA 2DYCA 3HNBM 2JG9C 1US2A 5J7MA 5FOBB 3MPPG 2EALA 2QQJA 4GWIA 3VDBA 1WKYA 5FP4A 1SPPA 2OW4A 3JZVA 2KR2A 1VBA3 1ONAA 3MICA 3R4UA 3T4VA 2EIGA 2VZTA 4IEVA 1HXS1 1D4M1 4DNYA 2VQ0A 1S1AA 5IAXA 2PAEA 2XBO3 5A3PA 4EWAA 5JIUA 3AP7A 1IPKA 4PIZA 1COV2 1W3XA 1Y4WA 1W90A 3LEKA 4WM7B 1JW6A 4N7IA 1K5MC 1W6NA 2XONA 3ZSKA 4ARYA 4C1XA 5GLTA 3AK0A 1XRUA 1SFPA 4QXKA 5IYYA 1C5HA 2YPJA 1GQHA 2W92A 4XCAA 5IVVA 2R072 3GZUC 1AR82 2ZHKA 5ERLA 5JXGA 2Y6LA 3Q8BA 2RMU1 1S2EA 4IEXA 2ZKLA 1RUD1 3JU9A 4MGSA 3WUCA 3ZXJA 4CP9A 2WQ4A 3NKTA 4JGYC 4XIOA 3WEZA 3KM5A 4ZU7A 3AMMA 3M3QA 1VBE3 2AREA 3L9JT 3W5NA 1HB3A 2X09A 5JXJA 2WNUC 4PBPA 3UV9A 2ZX1A 3ZFEC 5AFBA 4TN7A 2XWBB 4PT6A 2P3YA 3OY8A 4AQSA 4HK9A 1PGW2 1AXYA 3KV4A 1PVXA 2HYXA 4KL1A 3AP4A 4OVEA 4I3GA 5A7NA 1S0FA 2ZXQA 4MGKE 3AL5A 3J7MA 3ME2A 4N90A 3U37A 2J22A 1HV0A 1PIV1 2YY1A 3RMXA 3WHUA 1G9CA 1UCXA 2WKKA 5C9AC 1XB9A 4YG0A 2KD7A 4AI8A 2EA7A 1VBC2 4Q29A 5A1FA 4OHWA 3P6BA 1WBFA 1JOBA 1PZ8A 2ZEXA 1HRI2 2D3PA 1C8M1 1WMXA 2P6HA 1SLLA 3PTRB 4XHXA 3FJSA 3S7IA 5KHGA 3D8CA 1Q8VA 5FQ0B 3NVCA 4OFGA 3VKMA 3PDQA 5ACA2 3UETA 4N43B 1YCIA 1BEV3 5DUWA 5L9BA 4ZXEA 5T55A 2CHHA 1PO13 4AXOA 4NPMA 2W3JA 3D82A 4D3WA 1K5MA 1OH4A 2R0FA 3VBSA 3LDKA 2PHTA 4IEZA 1Z7S2 5A33A 3LEIA 1J83A 1IS5A 3B9CA 1W28A 2OT7A 2JIJA 4AQTA 5F37A 5HCAA 3AVSA 4FVVA 5FZIA 4E4HA 4HPKA 3WNLA 3TEZA 4XUPA 1OD5A 5JXIA 2VW1A 2A6VA 3WW4A 5L9RA 3POIA 4QKBA 3EHKA 4KWKA 5GLUA 4CE8A 1XYNA 2HEYF 4XZPA 3CKHA 2RDRA 2PLV1 3MIFA 4Q4W3 1COV3 1XBFA 5FP8A 2SBAA 1AR62 1AYM3 5F6KA 3EJKA 3ZN6B 3VDDC 2XKOA 1BKZA 5LBFA 1RHI3 3ZSLA 4CDXA 1UU6A 1W8TA 4B29A 1O4TA 1V9U1 3OBRA 2OXBA 1W0OA 4DFSA 2WLPA 5FK7A 4IEYA 3RYKA 5FLIA 1OVPA 4CXXA 4XJWA 3W59A 1LEMA 2QTWB 2PTMA 1ENSA 1AJOA 3FX3A 4KGQA 4WM8A 3ZXDA 1X8EA 4CDWC 5GZCA 4CDQC 2WABA 1W9FA 5G04L 4XC9A 5I93A 2YROA 4YGEA 5BNQA 2QZ3A 4RQPC 3WQ7A 1NZCA 1OQEA 1VRH1 2DBIA 5L36A 1DYKA 4BU2A 4DINB 4XEZA 1W2UA 1S0EA 2O14A 4LK6A 4AVSA 1DQ4A 1H2MA 4YW7A 1Y7BA 3KV5A 4Z82A 1ZYBA 3U1XA 1HB4A 1W9YA 5LY2A 1HDKA 3H42B 3RZGA 1ZBA1 4LMFA 1LKNA 2G4IA 1HQNA 1NOVA 5E89A 3WQ1A 1GQGA 3VBFB 1HV1A 4YVWA 1W8FA 2Q4SA 4G4FA 1RL3A 2B8MA 1YQ6A 4MGYE 3O0WA 3IDAA 1UO9A 3ZMOA 4CDWB 5C33A 5KBFA 4C1WA 1D4VB 3ZSEA 4RHV1 1RUG1 3VGIA 3DXTA 3ES4A 5FP7A 1CPNA 3FE5A 2GNBA 2ZTNA 3HT2A 4OULA 5E88A 5CFCB 5JOZA 3ZFGB 5C4WA 5LA9A 5FAXA 2J1RA 3I2IA 5KXEA 5FY7A 4COWA 4FPYA 4TTGA 1X7NA 2BGCA 2GAUA 4XOGA 1A78A 2PMWB 3H1WA 4A44A 1EAH2 2WNVA 2B42B 4FPKA 1FNYA 1GWLA 2DCZA 2DCKA 3PUHA 2HWE3 4LUMA 4XUOA 2C0ZA 1MEC2 2UY9A 3ZFGA 2C24A 1PGW1 3ZYFA 2B9VA 4AEKA 2EXHA 2PN5A 1PO23 3N7MA 1DIWA 2UWBA 2VH9A 3BTAA 4JGYB 3K3NA 3KCYA 4UWDA 3T08A 3WZ1A 2J42A 5J09A 3FC0A 3NNMA 3C7HA 4CDWA 5I0RA 3VBFA 3LDBA 4L8QA 1JHJA 1OOPC 2YYOA 3WNPA 3WDVA 3MW4A 2TNFA 2F4LA 5FUIA 3A0NA 5C8WA 3T0DA 1K42A 4QQHA 1CAUB 3OG2A 2RDSA 1Z0HA 4LHLA 4QX2A 5CFDA 2ZABA 2PHXA 4M4RA 5CISA 2WYSA 3PVEA 5A6ZA 2J1EA 2VTXA 4Q4V2 5FJKA 3LIGA 4YZ4A 3QLQA 2P1BA 4FPEA 4R9CA 2PHRA 2WNUB 3A7QA 2YDEA 1NCRB 1UOFA 1EAH3 2JWPA 4MXWA 4Y1YA 4XIKA 3KF3A 2VZUA 2ZEYA 1Z7S1 4XUTA 1QEXA 5FPAA 1LEDA 2RDQA 5F5QA 4FTSA 2IFRA 4OZOA 4AOCA 3ZX7A 3U4SA 2Q5TA 2FQPA 2RR11 1YJKA 4NMIA 1X8MA 2ZZJA 4CCKA 2XLGA 2EICA 4D6RA 1ASJ1 1EPZA 1PGL1 3H3ZA 4R4XA 1YC61 3S7EA 5CNAA 4PLNA 1KDMA 3MW3A 2VJXA 1SLBA 4P5YA 1BJQA 3T4HB 3AKPA 4XFBA 4AYUA 3ZPOA 3TN91 4B7EA 1XYPA 4YGDA 3VZKA 4A6SA 4Q0UA 3OUJA 3J26N 4FP3A 4W6WA 5FY1A 4QWNA 1NCQC 2R042 2JICA 3GBFA 4NHYA 4OCTA 2ZHNA 4YGBA 4E27A 4BB3A 1W8WA 1RUE3 3BYWA 3J4UH 4I02A 1ND2A 1W6QB 4EZ4A 1UXXX 2B5HA 1JI6A 1C57A 3NV1A 4FT8A 3V0AB 2AC1A 3ACLA 3THDA 3I7DA 3D0JA 3IBMA 2OVUA 4NOTA 5FP3A 5FYYA 2X8KA 1L3JA 2HWD3 3AVRA 4AAXA 5A33B 1AUYA 4LXLA 1APNA 4XW3A 5D21A 2VZQA 4A45A 1LHNA 2V72A 1UYZA 4N53A 4XBNA 1GV9A 5FYHA 3VBSB 3AZXA 3NNGA 3VBHA 4Y5SA 4HVQA 4FOVA 1WCSA 1VPHA 2VXJA 3VUOA 1MEC3 1ZNPA 1BHGA 3KQRA 3UKNA 2ZEZA 3UGGA 5GLVA 4LEJA 1JOJA 5CEHA 3RJ2X 4FPOB 3ZFFB 1W06A 1DF0A 1FYUA 4XAAA 3MLLA 2OQ6A 5DDJ1 1KS5A 3AMQA 3UKTA 1UMIA 2LW8A 1JZ2A 1AR61 5EP9A 2GSYA 3ILNA 1ZZCA 4HN0A 5FO8B 3N9PA 1JU3A 2MPFA 4CEWA 1PO21 4BCUA 1RYYA 5FY9A 5FYVA 2UYAA 4NRQA 4OUEA 1M06G 3T30A 1YYNA 2HEWF 3EB7A 2NN8A 3ITQA 3DUIA 3POWA 2JE7A 2WT2A 4IV1A 3WP5A 4DUXA 2VO5A 3H7YA 1F15A 3GALA 1H2KA 3ASIA 3LOIA 4Q26A 1RUH2 1QWRA 5FYCA 4BQYA 1UZZA 2UU8A 5A3UA 4K7JA 5I0UA 2YFZA 5DAXA 1OHFA 3L2YA 3TAYA 4SLIA 1GZCA 2TEPA 3HWJA 5JVVA 2WDBA 1UZVA 4YVSA 4CDUC 1HKDA 2B4KA 3DXUA 1RUI3 4MX3A 1CD3G 1UD1A 2P3JA 1RUG3 2ZGKA 4M01A 2NPIA 2G19A 2I74A 2B7YA 3QCWA 2P6CA 5A3TA 3RDIA 2VNVA 3G7DA 1V6MA 2AEZA 2XVKA 1BMV1 3R4SA 5J48A 5A80A 2VNOA 3PUQA 3B3QE 1TME1 3I2HA 2JXAA 3SISA 2DWRA 2VZ3A 4KU7A 4E4DX 1WLCA 2ZACA 2UYBA 3SQOA 1Q5OA 1UZWA 2R1BA 2I45A 3MEPA 1CAVB 3PJQA 4FCAA 4AVTA 2VVFA 1QXJA 1ZZ8A 4HONA 4U2AA 1G9AA 4DS0A 4DXTA 4GKYA 2Z4FA 5FZKA 1HX6A 2VUJA 4H3WA 2NYYA 4JGYA 4UFMA 3WW1A 2ZGLA 4NR1A 4RS5B 4AZZA 4OYUA 2JDKA 5A3WA 1UU5A 2BV4A 3T1LA 3CDZB 5C4WC 4XHBA 3JQXA 5FY0A 3IIIA 4DRVA 2RR12 2VCAA 1H6YA 4CEYA 2E53A 1AR83 4HSLA 3K3OA 3MDPA 1QXRA 2FZ2A 3PUAA 2WC2A 3LPFA 3IPVB 2WQZC 4F3JA 1YEWA 2OYZA 1HLCA 5JPNB 4AE2A 3N7LA 1BLZA 3JD73 4MVTA 4MXVA 4OUSA 3SH4A 2XJPA 4AF9A 3H8XA 3ZO0B 1NLSA 4BLJA 4FSJA 1FXZA 3WY6A 4UW5A 4DXSA 5CAZA 4LBQA 2ZX4A 3ALQA 4WV8A 3MF9A 4XETA 4YFWA 5KHHA 1ND3A 1PK6C 3M4FA 4CYDA 5KHJA 5I8SA 3FUOA 5DDJ3 1E5HA 1MZ5A 2JDUA 3I2GA 4M0HA 4NUBA 4Y20B 2GMPA 2RJKA 2EXJA 4MZUA 4E4SA 1OD3A 1RC6A 1W2TA 2OPKA 3ZVXA 3MGUA 4RGGA 3T3YA 2CAVA 2JIGA 3AP5A 3KV9A 1DGWX 1LHUA 1GNZA 3O12A 5FRAA 1XQNA 1R1A2 1W6PA 4QM9A 4QAWA 4XZUG 5JMOA 4UFLA 4YRDA 1F8VA 2A3YA 5IVYA 5JSOA 1CIYA 4XJAA 3DEMA 4GMP0 2DVBA 4HG6B 4GMP3 1RUJ1 1TG7A 3ZYHA 5K0UB 3O1RA 3VDDB 1UF2C 5F3IA 3V64A 1PO12 3E97A 2A7AA 4UT5A 3BIWE 5JOXA 3D6EA 1TMF2 4W65A 3LCPA 4W6XA 3QACA 1X9TA 4AFBA 2D44A 3KHCA 1C4RA 1GANA 2WS93 3M1HA 1R091 1ZA4A 1PO22 3POYA 4G9SB 3T0AA 3C7GA 3DGTA 4Y33A 1V6IA 1D2SA 4FFHA 1RUF2 4M3CB 3MLKA 4RFT0 2VNGA 3LQCA 4K9SA 4QPYA 1LJ7A 2W1UA 1LOFA 4UF0A 3ZFFC 5HV4A 4GWMA 1U12A 1UKGA 5F3CA 4YZ1A 2VTXJ 4FAHA 4O65A 3NV3A 1SLAA 3LZZA 2XDVA 4WM8C 2A75A 3ZXLA 3CZJA 5A3NA 2VQTA 1DYOA 4IW3A 2XQXA 3AJZA 3SEPA 4D7YA 2E32A 2HEVF 3ZMNA 1T6BX 1YFXA 2P3IA 3VBHC 4CUCA 2AEYA 1OF4A 2RS13 2I2SA 1DQ6A 4GB33 5DG2A 1N1YA 5I0TA 3ZN5A 3TEWA 1US3A 5IVCA 3NJYA 4EN8B 4W6YA 5IW0A 4I3PA 2FCUA 3L2HA 1HB2A 5FOJB 2C26A 3I3EA 2Y6HA 5GJ6A 4FPGA 4XE9A 5K9YA 3S30A 3RZKA 4XF1A 3SLIA 1JYIA 4FFGA 3LKJA 1UZYA 3A4UA 3CU7A 2JDZA 3H1YA 3J7HA 3ROUA 2PLV2 5ISLA 2XJRA 2RS11 3M3CA 5LY1A 1AX0A 1X50A 1QH7A 3VZJA 1V70A 3C2UA 1QJX1 4XDPA 3O7OA 4IV1C 3SKJE 1PZ9A 4RR3C 2HWE1 3M70A 3ZYRA 1ZBE3 3LA2A 4ONUA 1RUE2 2TBVA 4DXZA 3OF1A 3K4DA 2ZMNA 1PMIA 3WDWA 4LITA 1MQTA 5EIYB 1AXKA 1S55A 1OPOA 5FZ3A 1S4CA 4YW3A 4EE2A 1VRH2 4A41A 5FK8A 4ZPIA 4RSUA 1R093 2QQKA 1N47A 2BFUL 4IQPA 1CIWA 1UIKA 2Y6GA 4RR3B 4D6QA 4AVAA 2WS92 1S0BA 2NQYA 3IDCB 3A22A 3VD5A 1I1EA 2ZHLA 1RUD2 2WINB 3RZJA 2IXCA 4QPWA 4FTEA 5FMCA 2AH2A 5A7WB 4Y4RA 1AYN2 1DZQA 5GZDA 4CA9A 1VB4A 2XVLA 1RUJ3 4OLLA 1LU1A 1FOD1 4YWAA 1GOFA 2IZWA 5FZHA 5D8AC 2Q0AA 4ARXA 2DUPA 1PK6B 1U5IA 3MYXA 1H0BA 4OQ9A 1KFUL 2W68A 3B01A 1Q56A 2RM21 3BODA 5KC6A 3HVDA 2P3KA 1GWKA 2JECA 1QXPA 4OHXA 2HWF2 1IOAA 2Y0OA 1XNTA 2ZKNA 3C8XA 5FPBA 1YI9A 1RUH3 2WR9A 1AF9A 4FQ4A 3WP3A 4A7YA 1JYXA 2YPDA 4NAOA 3KGZA 2WUHA 5C3RA 1S0CA 4N7UA 1H1AA 3SKVA 4YARA 2DV9A 3VDDA 5LATA 2ZX2A 2F17A 2Q1MA 5DZFA 4NJ4A 3NJXA 4N8MA 2GNDA 4CU8A 2P5BA 4AI1A 3JD71 1NA1A 2JB8A 4MOAA 3HNMA 3Q9OA 2CNAA 4DXRA 4MG2A 3ENRA 1OH3A 3BOPA 5L7OC 1UOJA 3I3DA 3MI8A 2NMNA 1CAXB 2BJSA 1QNYA 3WDTA 5I8TA 3JCIA 2VCBA 4LO4B 1DDLA 4XQDA 1O8SA 1I9RA 1R1A1 2GC2A 4R4ZA 1QJU2 2ZGOA 4LIUA 3ZR5A 5LA2A 1W0NA 1GSLA 1ODMA 4IESA 2KM2A 1E5IA 4EQVA 4MYEA 5BNNC 1LAJA 3OGSA 1RB8G 1G9FA 3CBNA 3AMNA 2PHWA 4YM2A 1SHWB 1PO11 1MR5A 1K3IA 1ZA7A 1BEV1 3RSJA 3T2TA 2XG3A 1NA1B 3IIAA 2D6MA 1TEIA 2UURA 3O1OA 3N9LA 4XJUA 5DUVA 1WA6X 3FUQA 4MHUA 4CCCA 1R092 4B4PA 3MW2A 4D7TA 4LE3A 4ASMB 4CEYB 1SBFA 1U5ZA 4Q4X1 1AL22 1S0IA 1XSQA 3RPQA 1VALA 1BXHA 2W39A 2FDFA 1PIV3 5A3LA 3RZZA 4BQXA 1GP6A 1XPWA 4JQTA 4RS5A 3U10A 3WQBA 4X8NA 1HRV3 3ZYIB 3TWIA 1MS8A 3OD0A 2W1WA 5FZ1A 2WNOA 1RXFA 1HRV1 4K8RB 2AYHA 3POSA 1SCSA 5FZLA 4OMCA 4IDZA 2ORZA 4YG3A 4XQWA 4PDWB 4DUVA 2CGNA 2HWE2 5CKNA 4IEWA 3RYRA 2V5YA 3AKTA 2VXRA 5I0SA 1RVF1 4P9LA 5FYBA 1BK1A 4OHYA 2WZR1 4Q4X3 3HEIA 3ZPYA 2MEV3 5IVJA 5LK5A 5DAVA 1NQJA 2BWCA 3VBFC 1OOPA 1JMUB 1UMZA 1QJX3 2WYFA 4QX8A 1BYHA 4SBVA 2YHJA 1KJLA 4MV2A 4QD2A 4Y1VA 3JQWA 3FZ3A 5JR7B 1IPJA 1MS3A 3LEMA 4YM3A 1UIJA 5CFCC 1QJEA 2W91A 5IK8A 2OS2A 1AR63 1QMJA 2E6VA 2EIEA 2BPA2 1FPN1 1XNCA 1RMU3 4RA0A 5K8SA 4AQ2A 5T5JA 3U11A 5LA1A 1NE4A 2D3SA 1SEFA 2G1MA 3K2OA 1D4M3 1G7YA 4XQ4A 1LGNA 1WLTA 1NY72 2BGOA 3GZEA 5T5LA 4XJ9A 3M7AA 1MEC1 3TOJA 2VBDA 1QJFA 5C9AB 1GR3A 3KV6A 1Q8PA 1RXGA 3HN3A 3F95A 3W20A 5FYMA 5GALA 1NLQA 2CWSA 5JZGC 1ST8A 5ANQA 2ZBJA 5FWJA 1FAYA 1VLNA 1WCQA 4IE7A 1H8TC 3DCQA 2VVDA 4UW6A 3ZR6A 3PTYA 1Q8QA 3KZ4C 4EJRA 2GMMA 4YM1A 2VM9A 2WO3A 3NL1A 4UFHA 4QKNA 3HOBA 1AXZA 2RVAA 1W9TA 1YNAA 3HT1A 5LBCA 4Q1RA 2Y8KA 3ZKUA 4KG8A 5BYNA 1ZRCA 4LBJA 1GMMA 1TE1B 1V6KA 5A70A 1IS4A 5JI9A 2R043 4HKWA 1L7RA 3PUIA 2FCTA 3OBZA 4QHBA 2BBVA 4YYOA 2DU1A 1C5IA 5IJRA 4DQAA 1O3SA 4I30A 3UGFA 3VBUB 1MPXA 5A32A 1W2AX 2QVSB 5BUVA 4L99A 3I3MA 4RQPA 5ABJB 1KXGA 1MS5A 5D8AB 4GD4A 4GJZA 4L92A 2CL2A 2HH9A 2VOVA 1D2QA 3N36A 1RGSA 2DCTA 4LHNA 2P34A 2R071 3CQOA 4Q2FA 4HKOA 5D1IA 3P3PA 3OJBA 1LHWA 4GH4A 3TRSB 3V56A 4S2HA 2Y60A 4YW6A 5FO7B 5IATA 1Q8SA 1X82A 2A6WA 1BCXA 2BYVE 2RV9A 2WWUA 2UY8A 1JYCA 3I97A 3KF5A 5FLHA 5HCBA 1LENA 4AEJA 2GN7A 5FZGA 2JJ6A 4CU9A 3WG3A 1OA2A 4PI2A 4KWUA 3IDEA 4ORFA 1CESA 4YW1A 3W58A 1Y43B 5JOWA 1IHMA 4M3CA 3VLBB 4CU6A 3I49A 3WINE 5BNPB 2ETEA 3AZWA 1FV2A 2VULA 1KRIA 2HWF3 1J3PA 1IQDC 3CL1A 2R041 3ELNA 3KHBA 3VB9A 1O8PA 4L2NA 3AYAA 1DZRA 3ZFEA 3VBRC 3WNOA 2WT1A 5C3SA 3BTYA 2EIDA 4INDA 2O1QA 2CAUA 3CNAA 2WSUA 2XH6A 3GGLA 2WNVC 3LDRA 3LSEA 5IK4A 4LT5A 1ZBE1 1W03A 4PF1A 5GZEA 1BBT3 2QBXA 1JYTA 4E8DA 2XR4A 5IVEA 4LJHA 5IK5A 3DPRA 4QT6A 4FOQA 4YFZA 3OGVA 2GC1A 1HRV2 3UL2A 5FXXA 3TEYA 4XACA 3H3LA 5LWBA 2JKXA 2PAMA 1N3OA 3WV6A 1VBB2 4UI9L 4CP1A 3R6SA 3WQ0A 4CCJA 5FR3A 2BOJA 1F31A 2BNNA 2XGXA 1RUF3 5JSPA 2VZRA 5F39A 2Z42A 5CB7A 5A7SA 2D6PA 4YZ5A 3KCCA 1WW6A 4AHWA 1O4YA 1GOGA 1K5JA 1OA4A 2BEOA 4Q1PA 4AR2A 4BXSV 4RHV3 1UY0A 5E16A 3URFA 3FFZA 2A3XA 3PVNA 3I4IA 4KMQA 4D0QA 2VU9A 4E9KA 1OFNA 3CZUA 3ZLIA 2QCSB 2ILMA 2Y33A 4BMEA 2K46A 4DEQA 3BVCA 2BOIA 3F2ZA 3IPVA 2LALA 3WP4A 1VIWB 2Z5WA 2Q1FA 5FYSA 3TNQA 2GN3A 4AGVA 4BA6A 3KGLA 3PNAA 3I54A 3JBG3 4GB32 5FKBA 4AL9A 4C90A 4IV3C 4XBQA 3THCA 4XFGA 2D6NA 2OUHA 1W8ZA 3D4KA 4E4ZA 4LKEA 2XVGA 3HNYM 3KT7A 2P17A 2ADDA 3EXUA 3VBRA 3Q8AA 2GNMA 5GLZA 4UFJA 4QX5A 3H3UA 5C3OA 2N7GA 4R9DA 2J1UA 2ARCA 2ZAHA 1LULA 2E7QA 4AQ6A 4QB1A 4B7KA 1QNWA 1XXNA 1NZIA 4JTOA 2VUDA 4GIQA 3SCFA 4CUBA 2W0XA 4IEUA 4F7ZA 3GZAA 1AX1A 2VCCA 4K40A 2V5DA 1CAWB 4RFRB 3AX4A 4CDQA 1UQXA 1HJFA 4GMP1 2RMU2 1ZZ9A 1BZWA 1H8TB 3J8F2 3BIEA 2A70A 3FN9A 5LCWL 2WFF2 4OHZA 2VOKA 2WZEA 4QQPA 3ZYGA 2L9LA 2YG0A 3JB4C 1FMD2 3LSDA 2FBEA 3WUDA 5DUUA 4AFAA 3I8TA 2BU9A 1NYWA 4L11A 2VZOA 4NAMA 3EYPA 2QZ2A 3I2KA 4XF3A 4B1LA 4YGCA 2PHFA 1B35B 5EZWA 2DFBA 3WLUA 4LNVA 1R1A3 2ZEWA 4WVMB 3LA3A 1XJAA 1RTVA 3V0BB 2W46A 4WZFA 4O9EA 3VHPA 4XBLA 2WRAA 3J7LA 1PZ7A 5L7OB 5DZEA 2WA3A 3CMGA 2JG8C 3ON7A 2P2KA 2PHUA 5CIRA 1ZRDA 4LHKA 2NM1A 5C8CA 5FWEA 1DFQA 1C28A 1CAVA 1OKQA 4X8PA 4B4QA 1C1FA 1W8OA 4WVWA 5JZGA 2VUCA 2GALA 1PGL2 3HAGA 1F4HA 4HK8A 5EQUA 3H9AA 4LKFA 4HPKB 1W2NA 1OA3A 2W95A 2YGMA 4V2VA 3BKZA 3HPNA 3N4MA 1F35A 3O1MA 1NA1C 3OCPA 3ZFFA 2ADEA 2OQ7A 5JMCA 3P3NA 4PLOA 2B9UA 4EV0A 4TXWA 1JYVA 1V6LA 2YFUA 4BQ1A 4FPCA 1ASJ3 4Y1XA 2A6ZA 5FMBA 5IFTA 3RZLA 4MH0E 2D7FA 4QB2A 4FPHA 1MQTB 3IM0A 5DMYA 1IG0A 1QOSA 5F32A 3I3BA 3OYWA 2XHNA 3KD4A 2OX0A 1MS1A 3NQHA 1NXMA 1TME3 5APAA 5ANNA 2FMDA 1OLRA 3E5XA 3GZTB 1CZTA 4LBQD 2RM22 4ES9A 5K0UC 1WMEA 1WBLA 3AB0A 3I59B 5F2SA 3VBOB 3VL8A 1DG6A 3B7MA 3VD7A 4ATEA 1WGPA 5H9PA 4QHOA 4V1PA 1OBNA 2H6BA 2W94A 4QX0A 3QOPA 4KG0A 4BM8A 1CJPA 3ZIWA 1OLME 5L19A 2VBPA 1X9PA 1QQP3 3MUY1 4RN5A 5DAPA 2EXKA 5A1LA 1JZ4A 1LODA 2WN3A 1CONA 5H9SA 4LE4A 1VMJA 2CWMA 3N3HA 2XJVA 5HXMA 2RJ2A 5IT6A 3S0MA 5IK7A 4CP9B 3K77A 2Y38A 4CRQA 4XJ8A 1Z78A 2DDUA 2VMCA 3VBHB 4MXWB 2OKXA 4BJ0A 1O6UA 1WLWA 1LOBA 2JG9B 1I5PA 2YGLA 3NJZA 2PHLA 5EHDA 1XNBA 5K4LA 4L0PA 3B02A 2VBBA 4QB6A 3ZIXA 4JX0A 1GLHA 3VV1A 3EMRA 3SEEA 1LTEA 1NG0A 3OB8A 3WF3A 4XJZA 1CAUA 1OC1A 5A7QA 3KLSA 1MZEA 4JQRA 4R9BA 4UF0B 3VHOA 4BWOA 1RINA 3RZMA 1YFUA 1RUOA 5JZGB 4D8MA 2BFUS 5FZ8A 1HQWA 2H6CA 1BK0A 4BQ2A 3U07A 3BCWA 1UW8A 4K3UA 5FMDA 3WG1A 1D0HA 3NKGA 2YMZA 4GB31 4NIAA 4FPJA 3WG4A 2O8OA 5GM0A 2WO2A 1STMA 1Y9MA 4GZ9A 1ZZBA 4TSVA 1ZBA3 4XTPA 4JC1A 1DCSA 4IEOA 2QNKA 2IXJA 5IWFA 4FO9A 4Q4W2 3ILFA 1YHFA 3WT3A 5C70A 4I0AA 3GBGA 4YM0A 1N1SA 1QJY1 3FHQA 4OQ8A 2WSVA 5EXOA 2WNUA 5C4WB 3M2MA 3OGRA 2XOMA 4N9HA 5FBZA 1GZTA 1YQ8A 1H8TA 3GYDA 3D5OA 1GICA 1KFXL 1J59A 3VBUC 4YW2A 4K6BA 5CFDB 2WN2A 2WS91 5F5AA 3B69A 3ZSMA 4GULA 3KT1A 3OPWA 5T3NA 3RG0A 3KWVA 4CP0A 4QPGC 3SH3A 1QIQA 4A7ZA 2JG8B 2D93A 4BQWA 4Y5Z0 4IXLA 1KEXA 4Q4Y3 1RHI1 4CZSA 1DGRN 4I01A 3VHRA 4F8AA 3X29B 1WCKA 2YUEA 5IAVA 5K7PA 1JYNA 2VG9A 3SCGA 4BDVB 4JDOA 5J37A 2G9ZA 4JV4A 2PLV3 1DQ1A 4EN6B 3K75B 1URXA 4ATFA 2E7TA 4IUGA 1JS9A 1FPN2 3VBRB 2ZGPA 4RD7A 4D94A 5HV0A 3P1IA 4UW3A 5H9RA 5CFDC 1AHSA 1SDWA 3U75A 4GH4C 3IAPA 5FFOC 2WNVB 4P9GA 2GH8A 2IXHA 2Q30A 3DKWA 3WF1A 4QGLA 1EP0A 5FYIA 3WG2A 3BI3A 4META 5FY5A 3N7KA 2VZPA 3PU8A 3SCHA 2D5HA 1YQ2A 3WDYA 2NLRA 1PVC1 2VECA 2YBKA 3ACFA 1RMU1 3UK9A 3ZYPA 4Y4YA 1JZ6A 2ET1A 3USUB 2X05A 2EVXA 1DYPA 4H2AA 1N3PA 1ULGA 5JXHA 3JD72 1JODA 1YFYA 3UESA 1ZZ7A 1CX4A 5C71A 5CKMA 1YXWA 4Y26A 4D6SA 1AL23 1M4WA 1Q3EA 3ZXGA 4Q0QA 4TLGA 4BQ3A 4KWLA 1C8M3 4YW4A 1AR91 1UY1A 5LZ6A 1J84A 1JUHA 4GQ7A 1CN1A 1AR81 2EIBA 1EPWA 5B2GB 4LLOA 4FXKB 2LM3A 4AEDC 4CPBD 5ACA1 1L7LA 5FZMA 3DPRC 4LO7A 1O59A 3GCXA 1MQTC 2Y6KA 4Q8KA 3WNXA 4QPGA 3IT8A 1T2XA 3HQRA 4NIHA 4XFFA 2C4XA 3I3QA 2VMGA 4LLFA 2JG9A 2W5FA 1ND2C 2WO1A 1REFA 4UYBA 4WM8B 3E5UA 1LB2A 1L7QA 3D0SA 4ZS3A 2YBSA 2YZ4A 5TSWA 2A73B 1MACA 4UFIA 4ZHNA 4U36A 2FDIA 1VBD3 1W6OB 3K48A 4YVSB 5FZ7A 1H30A 3WSOA 1UN1A 5BNNB 2VZVA 2ZGTA 1RUI2 2YB7A 3M3IA 3WX5A 4DMIA 2XJQA 4B1MA 2Y64A 4HANA 1UNBA 4KBBA 1ULCA 3GHMA 5DUXA 3WHTA 3KVBA 4CDXB 5BNOC 3JBG1 4EN9B 1ZRFA 5LASA 1RUJ2 2WL1A 2R6QA 3HMYA 1V6OA 2G9GA 2AZ5A 2C5DA 2XWJB 4NPLA 5FJHA 4IV1B 1H8VA 5FMOL 1KGYA 1WWYA 4COYA 3K4AA 5BNPA 3NV4A 1C8M2 1MS4A 3AFGA 3EO6A 4AEMA 3GXUA 3AZYA 5KHKA 2J7MA 2ZS6B 1T6GC 4FFFA 4XABA 5SV8A 1OUXA 4PHZA 4Z2AA 2K0GA 1WD4A 5J1XA 3QH6A 4I2OA 4LBMA 4EYUA 4BXFA 4CEWC 5F9TA 1GKBA 2WAAA 4GXLA 5CU1A 2WZR2 1EUUA 3VHNA 1UL9A 1GZWB 3O1SA 1UPIA 4H7MA 1LHOA 2R16A 3ACHA 5GZGA 1POV1 5ABJA 4JGZB 2XLFA 1YUDA 2F4PA 2CTVA 2WJSA 4JRLA 4N9IA 4CVUA 3N9MA 2VOWA 4NHMA 2VW0A 4P08A 4QX7A 5F6LB 1U0AA 4Y24A 2W9XA 1GQPA 2PXJA 1DQ2A 1V00A 1VBB1 2XXZA 1PX4A 4MHRA 5LBEA 1BBT1 1X33A 2CYFA 3DV8A 5I8YA 1PHMA 1W6NB 3MIGA 4Q27A 3UYJA 3ZDSA 2ATFA 2QFEA 3NNJA 4BE3A 2Y6FA 1OVSA 2JX9A 2W52A 2FDHA 2FDGA 1R1ZA 1A6CA 2DCJA 2PQSA 1B35C 3WF0A 4QU1A 3ZM8A 3WCSA 4BOWA 3QD6A 4JKKA 1DBNA 1V0AA 1I6XA 3SC7X 4COUA 3T0BA 5C8CB 3MO4A 1R082 2RJLA 2VE1A 2JEMA 4OUMA 4GWNA 3VKOA 1SFYA 3C3VA 3ORJA 3WF4A 2AR6A 1PX3A 2YBPA 5BNPC 4RYDA 1HJGA 5CKQA 5A7OA 4YW5A 4FBFA 1MVEA 2WAOA 1KITA 4B4RA 4QXHA 3V0BA 1N1VA 1AR72 5BV6A 4BPZA 2JDHA 2VMIA 4DZGA 4ISRA 2BDRA 2BGPA 1JZ3A 1SMVA 2VMEA 4IGPA 5AC91 2YC0A 3T1MA 1RUE1 4E2GA 5FZ0A 2R073 5KC5A 1DP0A 1DQ5A 3P5BA 4Q4V3 4AK3A 4ISQA 3U0ZA 1XC6A 5T50A 3UJOA 4Q0PA 3WNNA 4ZONA 1W9SA 4WM7A 3INAA 1G6NA 4DEVA 5FBJA 3MPBA 2A1XA 1RUG2 4Y1UA 5IVBA 1XNAA 2SLIA 3KQ4B 4LA3A 2Q1ZB 3BPSA 4Z8BA 3IDBB 2D6KA 4LA2A 1W8UA 2A6YA 3MFCA 1H2LA 2EAKA 2A71A 2VY0A 2WQ8A 3HD8B 4H7LA 5J36A 3J8F1 1QGLA 2K2SA 2ZGSA 1XE0A 3GCWA 5DQ0A 4M3CE 1SLTA 3HBKA 4FPLA 3WW2A 3QBQA 1QJX2 2RE9A 3I2DA 1HIXA 5LB6A 3VBOC 4AI2A 5FZ4A 1MZFA 1YQ5A 2HWC3 1XOYA 4PBOA 1EV12 4QMAA 3TNPB 5EV7A 2NZ9A 3FFQA 2Q8CA 2DUQA 4FQZA 4CCLA 2X5IC 4LPLA 1K12A 3FLTA 4Q5OA 4DUWA 5DAQA 4CU7A 3FLPA 3PL0A 5FUPA 1H9PA 2WO7A 3BGAA 2D43A 5C7GA 2ZCWA 1ASJ2 5H9QA 3PIJA 4YVWC 1UYYA 4OI1A 5LA0A 2JDAA 5FZBA 3ES1A 3VZOA 3ST7A 3JB8A 1O4ZA 2WNEA 3RGBA 4NHXA 1LOCA 4XTMA 3UJQA 1QDOA 1CX1A 4LBLA 2XMLA 3AJYA 3TEXA 1XYOA 1W39A 3ETPA 1XNKA 3WCRA 2ARAA 3APBA 2D40A 1TMF3 4I0WB 4OMDA 4P5HA 1J58A 3DYOA 3GBWA 3ACIA 5E8AA 3MUZ1 3CLPA 5BXXA 1AL0G 4NPRA 3PU3A 2MEV1 4E2QA 3HQUA 1NT0A 1GZWA 3AMPA 3AYEA 5SV5A 2Q8OA 2WZR3 3PVOA 1ZM1A 1RVF3 3MBWA 2PHDA 3N35A 4HFSA 3N7JA 5CBLA 1GU3A 1EV13 4KBZA 5DG1A 2Y34A 2E31A 4NROA 1W6MA 1P8JA 2UWCA 5B4NA 2DCYA 3AXEA 3IB3A 3JBG2 1LGBA 2BVVA 4P9YA 1H9WA 3A0KA 4L9BA 1I3HA 5LBBA 1TZOA 2JE9A 1Q8OA 2ZGMA 1WLDA 2DVFA 4JKLA 3MF6A 1BEV2 4K21A 1JYWA 1Q43A 2BBAA 3S5QA 1G9DA 2JB4A 2ZX0A 2YC4A 1QHDA 1FV3A 4AWDA 4EROA 3PUSA 3ZN6A 3LOBA 2W47A 1H1IA 5EWSA 1SCRA 1PIV2 3FHIB 2R32A 4NWWA 1LECA 4J6GA 5FXVA 5FZCA 4ITCA 1KQRA 2ZGNA 2UWAA 5CYYA 1VAVA 2VTFA 3M3OA 3U14A 2LTNA 4TZDA 2D6OX 1UOGA 1WZXA 1SBDA 1UOBA 1ZRIA 2ZA9A 1IS6A 4P00B 4C0BA 1LOGA 1TNRA 5LW9A 2VMFA 2MNGA 3J8F3 3PIGA 4J25A 1HN0A 2HWC2 1VAKA 5C8CC 1V6NA 2ORXA 5FP9A 4B3NA 4S2GA 2D98A 4HBNA 2CSGA 4GJYA 4RS5C 1U5YA 2D5FA 4IEPA 4RR3A 4NIDA 5FUNA 3LWCA 1VR3A 5ABJC 1OXCA 1BBT2 4XUQA 1REEA 5FDBA 3VBUA 2LRPA 4FAGA 1AYM1 4JTNA 1GFF2 5KWRA 2IXKA 1S0JA 3AZZA 3K4ZA 1QOOA 1COV1 1W9WA 1RUC3 1HRI3 2W87A 4ZU4A 5FTTC 4PCRA 5JOYA 2D3RA 2I07B 3RQ0A 4MLOA 2RS53 3ZN4A 3NNLA 3USUA 2HYKA 1LHVA 3KT4A 4ASLA 3ZXAC 5AC93 5C3QA 5LK7B 1BQPA 1H2NA 2VZ1A 4PF5A 5FZEA 4AVVA 2GU9A 4K1YA 2IUWA 2O8QA 2OUJA 3AFKA 3MFAA 5DPNA 3LD8A 4ET7A 5A1AA 4NIGA 2LUWA 3H1MA 1FNZA 2DVAA 2HWB3 3CEWA 1UYXA 4PQQA 5G05L 4MUVA 4P9WA 3RWKX 3POJA 3CJXA 3LF7A 2QDRA 2OZ6A 3LB9A 2Z69A 2XJUA 2BTVC 4ZY9A 3JUUA 1GNHA 3OY8B 4QQ2A 3EBRA 1O7FA 4HT1T 1PNFA 4BK4A 1CVNA 3H7JA 3LGRA 4HXCA 1LOEA 2DVGA 4Y22B 3M8LA 4H14A 3ZOIA 4O7XA 4XFIA 2CDOA 3K51A 2JDPA 1UY3A 4LHSA 1FOD3 4Y3OA 1VRBA 1OPMA 3LE0A 3RI8A 5KXDA 4P02B 3S57A 3GJAA 3RI9A 1W0PA 5C6CA 5F3EA 2VL4A 4KWJA 1DGRA 2BWAA 4IV3A 4PLMA 1SBEA 1UMHA 2IXLA 2HLEA 3D3AA 4HVOA 4F83A 3ACGA 3E6BA 3MIBA 4HZFA 1HRI1 4UXAA 4IGQA 1SQ4A 2QDNA 3MHZA 3GF6A 3ATGA 3PVBB 2XL7A 4K1ZA 1O91A 2FMYA 4M3CF 1A34A 4PI0A 4ZZ8A 1W3VA 4KQ7A 3WF2A 4X6QB 4NN0A 3ZFGC 2OZJA 1XE7A 1UY2A 5FYUA 2A3WA 3NV2A 1VBE1 5HPOA 5EFUA 4BIFA 4CDUA 2VOXA 4QX3A 3PMEA 4D69A 1F4AA 3AZVA 4ZXKA 3AKRA 1RUD3 2X5IB 5A3MA 2RMU3 1QKQA 3DN7A 1IKPA 2K9ZA 4GWJA 2J1TA 4DO0A 4HVRA 5JR2A 1AYN3 4UOJA 3SH5A 3EQEA 1JOPA 4LIVA 4QHZA 5FCCA 4Q4X2 1FMD3 2WWSA 2HBTA 2IFWA 1I5ZA 3LFMA 3OOXA 4IGOA 4LULA 5KXCA 3WDXA 3GJBA 5F7UA 1A8MA 2BERA 1KS4A 1QF3A 4GA9A 3E1F1 2ZAAA 2XBO1 2ZJCA 3BOWA 3IKWA 2ZMLA 3NAPA 4QGMA 1G9BA 1JZ8A 1OURA 3NNFA 1AJKA 1YWKA 2TUNA 1J3RA 1HXS3 1IG3A 4O9GA 5FZOA 3WNMA 3ZKYA 2E33A 1VBD1 3FL7A 4JVAA 4LR4A 1VBA1 1GP4A 2AGSA 2FCVA 2CDPA 2EXIA 3FMGA 5JUVA 1DHKB 5JPMB 1LU2A 3ABZA 4BISA 2V73A 1CQ9A 4PDWC 1ODNA 1C8NA 2HWB2 2VNRA 2VAUA 5FIXA 2HWD1 4ZS2A 4XXPA 3GDBA 1IGOA 2WZ8A 4IEQA 1VMFA 1W05A 4Y20A 5A7PA 4JGZA 1GUIA 4QQLA 3WXPA 1IZ3A 1AR93 1CAXA 5EJ3A 4AI3A 3FWEA 5FPVA 1ENRA 5KHIA 4E8CA 5JDBA 4CUAA 1FI2A 1S0GA 1H6XA 1TMF1 2VC9A 2IWGB 2X10A 4LK7A 4PIXA 3TN93 2A6XA 2P4EA 1HQLA 2B46X 4QGNA 5FKCA 1QJU3 1ULDA 1S0DA 1E5RA 5FREA 3O1UA 4AHXA 2ERFA 4OI2A 3CIHA 1RUC2 4NO4A 2QQVA 4DY5A 3O1VA 5FPLA 1GWMA 3NO8A 1NCQB 5LRRA 3VN4A 3ZSJA 3RFRA 4S2FA 2C1FA 5IHRA 4LBOA 1W8HA 4N53C 2ZPXA 1POQA 2RR13 4LOTA 4D7SA 3VDCA 1KJRA 2GDFA 3DECA 4O61A 2R061 1GNYA 1NUKA 1YRZA 3OYWB 1QJY2 3OGGA 5J96B 1VE0A 1SLIA 4DOUA 1LNSA 1EAH1 4M00A 2VD7A 5B4XA 4XMIA 2HWC1 2O0OA 4L97A 2KA3A 4QKDA 1QJZA 4JCKA 3BPZA 1ZVFA 2FHRA 3CJIA 3KSCA 4JHTA 4QXCA 1MVQA 3BU0A 4XFCA 4EWEA 3THPA 4QPGB 3C7OA 4LBNA 1WD3A 4Q4Y1 3BB6A 3K46A 5E1RA 4X6RB 5A7WA 4BZ4A 4C0HA 2XPJA 4NRMA 1ACCA 2AACA 2V4VA 2XJSA 4AFMA 4BHPA 5AVAA 4XXAA 2RHPA 3CJIB 4I0BA 4K8FA 2A5ZA 4MO3M 4QPIB 4S2DA 1F5JA 2BP6A 4UAPA 3S6PA 1O5LA 2RS12 5LEKA 4Q4V1 4HETA 5F5CA 4DPNA 2WFF1 3S5AA 4YVSC 1QJY3 4LTAA 5EYYA 3ZXEA 4DB5A 3MLJA 3H8UA 5HCFA 3B5LB 5L7OA 2ZGRA 2IC1A 3SHRA 3T2QA 3ZXKA 3U4XA 5HCHA 4AI0A 4XYXA 1WMFA 5EJZB 1VBE2 2J1SA 4WVMA 3IZOA 3MIDA 3VZNA 1PM7A 4BQ5A 2HBUA 1R081 3ECQA 4LQRA 3VZLA 1RMU2 5HBAA 3ZYBA 2RS31 3I2FA 3ZXFA 1ENXA 1S2KA 5BNOA 4QPIC 5EJ1B 4P9XA 4QDSA 2WFPA 5KXBA 2R0HA 4A4AA 5FPUA 4AGRA 1AR71 3DYMA 2Q8EA 1UAIA 1XSRA 1NXD1 2XLAA 2ZMKA 1F9KA 4TLFA 3LPGA 4FI9A 1HW5A 1YQCA 3FLRA 4QU2A 3UKVA 1TVGA 4QDQA 5FXZA 4H55A 5FMOS 4CDQB 1CAWA 1SACA 1CR7A 1YIFA 1OI6A 4AEDB 2JG8A 3DF0A 3IMNA 1LCLA 3VL9A 4A3XA 5L9VA 5FV3A 4ASKA 1VBA2 1VAMA 1W99A 1FMD1 1F5FA 1JXNA 1VRH3 1DLLA 1G8WA 3O1PA 1NLRA 4LUKA 1DLCA 2OIIA 3H8RA 3RS6A 4AFDA 2B39A 4COVA 2JDMA 4C91A 5EPAA 3OGJA 1RUI1 5CG8A 4IE6A 5FPZA 1N1TA 1ND2B 3CO2A 2FDJA 2VOTA 4BMBA 5BY5A 3OBTA 2R49A 1QQP1 3MV01 4J1XA 3O0XA 4DIQA 1CJDA 2CY6A 3UNPA 3NAPB 1WA4A 3VZMA 4R9AA 2GC3A 3CF6E 5DDJ2 2BQPA 1SZBA 1SFNA 3W9AA 4AG4A 2ARBA 4HOOA 1JN2P 2LS6A 5F2WA 5J98B 2LROA 1YO8A 3VDAA 4HLTA 4W8JA 1RJ7A 1UKRA 3OEAA 1QDCA 3MIEA 2V09A 2W2IA 4EN0A 5A6XA 3T2PA 1ZREA 4JZRA 2R1DA 2AUYA 4AW7A 3AL6A 3VD9A 5K0UA 2FD8A 2PAKA 1NCRC 4TWTA 2HWD2 1ENQA 2D6LX 1AR73 1W6PB 1OT5A 1UYPA 3RNSA 4CCEA 3Q8EA 5CG9A 1IQAA 5F1RA 3BTZA 2QQMA 4NRPA 2RS33 2ENRA 2C9AA 3BUCA 4ZU5A 4IETA 1OKOA 4Z07A 5FPXA 5ACA3 2E51A 4TYSA 3DKQA 2R30A 3BTXA 5DN2A 5J3UA 3UGHA 1GYKA 2OPWA 2JDYA 2DVDA 3GNEA 3PHMA 1IPSA 2EF6A 5FXWA 4QX1A 3ZFEB 4AEDA 1JUIA 2DTWA 3LIHA 4MADA 4WZCA 3NWKA 4JDNA 5LEJA 4XILA 4Y22A 4A6OA 1SDDB 1F2NA 2YV8A 5A3OA 4ES8A 3OEBA 1A8DA 2VZSA 4CTEA 2WA4A 5T5OA 4NHKA 3OSDA 5C5UA 4FPFA 1PVC3 3I59A 3PJYA 3VBOA 2FZ1A 1UWWA 3H8OA 1ZRRA 1UXZA 3Q8CA 4A2UA 1QOTA 3HN1A 3LA7A 4I09A 2VVEA 3AYCA 4G3YC 3HIFA 4XDOA 3T2OA 4CXYA 4GH4B 1FATA 1HXS2 5JWPA 2XUEA 3HR9A 5LRSA 1B09A 4Z2WA 2PELA 2QQWA 3C7FA 2RS32 1Z7S3 1QU0A 5T52A 3KMHA 1SG3A 4KNCA 1OSGA 1FT9A 1H1MA 1H4HA 4IE0A 3FBMA 4NWVA 1E57A 3HBZA 4CSWA 2B45X 3JXSA 4OZXA 5A32B 4AFCA 1BMV2 1R64A 4UFKA 2PQQA 3THTA 4GKXA 5C5TA 3VD4A 3RYPA 3MIHA 3CJIC 4HL0A 5FY4A 3IWZA 2ID4A 2RDNA 2J1VA 1HN1A 2Z2SB 4RGAA 4JHZA 3RWNA 2VR4A 1PNGA 3W5MA 5DXDA 1RJ8A 1K45A 1JZ5A 1NKGA 3CHXA 2YXSA 3O14A 1IS3A 2G9FA 1OLMA 2Z79A 3FHAA 3AMHA 5T5PA 1UX7A 2DF7A 5D2AA 3AKQA 3BN6A 4RHV2 3WNKA 4BYYA 3HJRA 4CDXC 5BNOB 1YIPA 3AXDA 3BU7A 4XFAA 4UBGA 1EV11 2QJVA 4HKLA 4BIOA 5FY8A 2E63A 1MS0A 5CZKA 4UBHA 4CXWA 1UU4A 3KB5A 4YG6A 3H50A 1LGCA 5FZAA 1S2BA 5IFPA 3BALA 2P37A 4P14A 1B35A 5FYZA 4B8EA 2WBKA 2W1QA 4XCBA 1CPMA 1AZDA 4Y1ZA 4OI0A 1QY4A 1UPSA 1OQ1A 1U5XA 4QPIA 4XFHA 1VJ2A 2IXIA 5AVPA 4CEWB 1WCDJ 1ULFA 1OLQA 4XMAA 5DAWA 4A42A 2BVBA 3NAPC 2QE3A 1QH6A 1W6MB 3OUIA 5GZFA 3B00A 3TBDA 4WVZA 1RUF1 2GP5A 3AYDA 4DY3A 3IMMA 4QQOA 4AHZA 4AHYA 2MEV2 2X53S 1UX6A 4JKMA 5AFEA 2QQPA 2PA7A 3PURA 4MGQA 4Q8LA 3N9QA 4AVBA 1O3TA 5IUQA 1K5MB 1Y3TA 2WWJA 2XL9A 5BPXA 4CCNA 2JE8A 4Q0VA 2F6BA 1CWPA 2ZOEB 4PDWA 4JRAA 2Y6JA 3OBAA 4N53B 1QQP2 4N43A 1AYN1 4QKFA 4P9IA 3NMBA 3NSTA 5FQ0A 4JGZC 1ZZ6A 1JHNA 2ZZQA 4LO6B 4WM7C 3LFIA 4YLZA 1W2OA 1EUTA 4LOSA 3V0AA 3E6DA 3KCXA 4NIIA 1W6QA 5HI0A 1RIRA 2QQLA 5FZ6A 5A6YA 1WW5A 5A6QA 3AP9A 1LOFC 3OPTA 3RJRA 1V9U3 1WW7A 4WBBA 4V2WA 4BK5A 2IVJA 5F5IA 2BW8A 2AENA 3FBYA 1X36A 2HWF1 1LR5A 3MZHA 3H0OA 2QUOA 4JAAA 4YSFA 3O1TA 1V6JA 4MSVA 5L73A 3RVHA 3U78A 4Q4W1 1N3QA 1GBGA 4J1WA 1GZ9A 1UZ0A 1AR92 4IE4A 3AP6A 4WVVA 2GZWA 4FOWA 4YPJA 3TYJA 2JKBA 1JBCA 1C1LA 3C7EA 2BNMA 1WW4A 1ULEA 2XQRA 5GKAC 3E5QA 4EN7B 5M0TA 2X5IA 2E26A 1CGPA 3WOGA 2VPVA 2BZDA 3VBSC 2EAAA 4XVHA 3T09A 1REDA 1IKQA 2GC0A 3NW4A 4URAA 1D0GA 4EZHA 5JCTA 2W1SA 1AX2A 3AM2A 1CZSA 2VQAA 1NCRA 2RS52 3B9IA 4COZA 3RRDA 3WR0A 4YNIA 3NRUA 1ZBA2 2FDKA 2HKXA 1JTZX 1XU1A 2QQUA 4PQ9A 1ZX5A 4MGZE 1QJU1 2WLQA 3OPZA 4A7KA 5FZOB 2VQUA 2CU5A 3DPRB 3NJVA 4MGIE 3RMYA 4CP2A 4A3ZA 2H0VA 1NAEA 4N43C 4ZKTB 5I91A 1MZ6A 5FYTA 4LBKA 1PMHX 2CV6A 4CEYC 3AKSA 3OUHA 1SPPB 1XNDA 3WP6A 1XU2A 4P9JA 1ULOA 5FZDA 2XUMA 4XF4A 4XDQA 1FOD2 1RUC1 1PM4A 1KDKA 2DURA 2QQNA 5EYXA 3UT0A 3SMHA 1W04A 3ZYJB 1PVC2 1ND3C 1PK6A 1POV3 2XKPA 2GH2A 4XF0A 4CDUB 3V65A 3R05A 1Y9GA 2R062 4C8DA 3PLQA 4QM8A 5FO9B 4CPBA 2IVIB 1C3HA 1D7PM 4QDRA 4AGGA 4LKDA 2JD4A 1PGSA 1FPN3 1J1TA 5CFCA 2NP0A 1YI7A 1GOHA 1O5UA 1OQDA 5GLWA 4LORA 3I2OA 2VGDA 4HMZA 1A3KA 1J1LA 1D4M2 1J3QA 3O0VA 5D8AA 2CGOA 4RQPB 2W08A 2ARXA 1CZVA 3PMSA 4HN1A 5E6HA 4YVWB 3WD5A 3WVJA 2XB6C 1VMHA 2QQIA 2YC2A 5IVFA 4IV3B 5CVRA 4IL7A 2DU0A 4W50A 4HSJA 4Z1VA 3KVAA 4OI4A 2YU1A 4FOYA 1VB2A 1AVBA 5FZFA 1O3RA 1TME2 3ZDVA 3VKLA 4XF9A 3N9NA 3AC0A 2C6SA 1LESA 3LEGA 4IE5A 1WCUA 1GP5A 5JAXA 2VMHA 3R0RA 4W4ZA 1WUVA 1Y9QA 4DRRA 2Y26A 3SXWA 4OHVA 1EY2A 4Z92B 2PFWA 4XPVA 5FLJA 2WZPP 5CA6A 5C9AA 4ZZ5A 5AC92 2RG4A 3QH7A 3TN92 4AVCA 2Y0IA 3A23A 2XBO2 5JSRA 1ALYA 2PYTA 2XHKA 4GAZA 4JDMA 4IERA 2E7AA 2QQOA 3IAQA 1JZ7A 1OUSA 4R8HA 4NHLA 1VBD2 4GALA 5JI7A 1AL21 5C3PA 3DYPA 4FTBA 1W6OA 3R4DB 5BNNA 3VKFC 1VBC1 5F8PA 4M0NA 1G86A 2VUAA 1OFSA 3MV11 3J7NA 4RGKA 4KI5M 2HWB1 1OOPB 1XE8A 3VD3A 4AI9A 2E9QA 1R083 3GM8A 4Q0SA 3POGA 4KGGA 1EYBA 3J9SA 4PIYA 1YFWA 1RVF2 3W21A 2YU2A 2ZGQA 3OD4A 2RS51 3HQXA 1RUNA 2JD9A 4R52A 1POV0 4URTA 1JU4A 1NQDA 3I2JA 2WFF3 2V4AA 3WDUA 4UW4A 1NE6A 4CCDA 5HXVA 1PMJX 4XAEA
chains in the Genus database with same CATH topology
5ANQA 4TN7A 4CCOA 5FWJA 5FY7A 4GJYA 4CCMA 4QXBA 5FYTA 5FUNA 5A7PA 5KR7A 3KV4A 4Y33A 5FYCA 5A7NA 5FBJA 5FPVA 5IVBA 5FZMA 3AL5A 5FZDA 2P5BA 4UF0A 5FY8A 4DIQA 5F3CA 3K3NA 5K4LA 3DXUA 5FZAA 2XDVA 5A1FA 5FZEA 2YBSA 5A3NA 3PTRB 3LDBA 5F2WA 4HOOA 5FPLA 5FZ7A 5A3TA 5A7QA 5FZ4A 3LD8A 4GD4A 4UF0B 4GJZA 5FYZA 4AAPA 4C8DA 3PDQA 4LIUA 5FZ8A 5A80A 3KVBA 3PUQA 2W2IA 2Q8CA 5IVCA 4CCLA 3NJYA 5IW0A 2WWUA 3AL6A 5FJHA 5FJKA 2VD7A 5FUPA 5FZGA 2GP3A 2GP5A 2OT7A 5E6HA 3N9LA 5IVFA 4HONA 5FZBA 5F37A 4Y3OA 3AVSA 1VRBA 5FZIA 4E4HA 5IWFA 3PURA 5FPAA 3KVAA 3N9QA 4QXCA 5FZKA 5ISLA 5FZ9A 2YU1A 5F3EA 2WWJA 2XMLA 3N9OA 5FZFA 5F3GA 3U4SA 4CCNA 5A7WA 4EYUA 4BXFA 5LY1A 5FWEA 3N9NA 5A3WA 4CCKA 4IGQA 4XDPA 5FY0A 4D6RA 4CUGA 2Q8DA 5FP8A 3PU3A 5FZ1A 3K3OA 5FY9A 3N9MA 3PUAA 5FZLA 5FXWA 5F5AA 3ZPOA 4QX7A 4V2VA 5IVEA 3OPWA 2PXJA 4LITA 5FZ6A 5FYUA 4QWNA 3OPTA 5F5CA 5FY1A 2OQ7A 4V2WA 2XXZA 5FZ3A 5F5IA 5FYBA 5FXXA 4EZ4A 3UYJA 5IVJA 5FP4A 4GAZA 5FP3A 4CCJA 3RVHA 3U78A 4DO0A 5FYYA 4NUBA 3AVRA 4LIVA 4QU1A 4LXLA 4D6QA 4BU2A 4QX8A 5LWBA 5F39A 5FYHA 5A7SA 4IGOA 5F32A 3KV5A 5A3PA 4XDOA 2OX0A 3PUSA 2XUEA 4Y4RA 5A7WB 3KV9A 2OS2A 5FP9A 5FPUA 5LY2A 2Q8EA 4URAA 5FYIA 4EZHA 2YBPA 5FXVA 5FZCA 5FZHA 5A7OA 5FY5A 5CEHA 5F2SA 3K2OA 3PU8A 4CSWA 4QXHA 5FXZA 3ZLIA 5IVYA 4AI9A 5IVVA 5FZOA 2OQ6A 2YBKA 5FYSA 5FY4A 4IGPA 3DXTA 5F3IA 5FP7A 2YU2A 5LW9A 3KV6A 5FPBA 3N9PA 5FZ0A 5FZOB 5FV3A 4ASKA 5FYMA 4D6SA 4BISA 2YPDA 5FYVA 5A1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ANQ A;  4TN7 A;  4CCO A;  5FWJ A;  5FY7 A;  4GJY A;  4CCM A;  4QXB A;  5FYT A;  5FUN A;  5A7P A;  5KR7 A;  3KV4 A;  4Y33 A;  5FYC A;  5A7N A;  5FBJ A;  5FPV A;  5IVB A;  5FZM A;  3AL5 A;  5FZD A;  2P5B A;  4UF0 A;  5FY8 A;  4DIQ A;  5F3C A;  3K3N A;  5K4L A;  3DXU A;  5FZA A;  2XDV A;  5A1F A;  5FZE A;  2YBS A;  5A3N A;  3PTR B;  3LDB A;  5F2W A;  4HOO A;  5FPL A;  5FZ7 A;  5A3T A;  5A7Q A;  5FZ4 A;  3LD8 A;  4GD4 A;  4UF0 B;  4GJZ A;  5FYZ A;  4AAP A;  4C8D A;  3PDQ A;  4LIU A;  5FZ8 A;  5A80 A;  3KVB A;  3PUQ A;  2W2I A;  2Q8C A;  5IVC A;  4CCL A;  3NJY A;  5IW0 A;  2WWU A;  3AL6 A;  5FJH A;  5FJK A;  2VD7 A;  5FUP A;  5FZG A;  2GP3 A;  2GP5 A;  2OT7 A;  5E6H A;  3N9L A;  5IVF A;  4HON A;  5FZB A;  5F37 A;  4Y3O A;  3AVS A;  1VRB A;  5FZI A;  4E4H A;  5IWF A;  3PUR A;  5FPA A;  3KVA A;  3N9Q A;  4QXC A;  5FZK A;  5ISL A;  5FZ9 A;  2YU1 A;  5F3E A;  2WWJ A;  2XML A;  3N9O A;  5FZF A;  5F3G A;  3U4S A;  4CCN A;  5A7W A;  4EYU A;  4BXF A;  5LY1 A;  5FWE A;  3N9N A;  5A3W A;  4CCK A;  4IGQ A;  4XDP A;  5FY0 A;  4D6R A;  4CUG A;  2Q8D A;  5FP8 A;  3PU3 A;  5FZ1 A;  3K3O A;  5FY9 A;  3N9M A;  3PUA A;  5FZL A;  5FXW A;  5F5A A;  3ZPO A;  4QX7 A;  4V2V A;  5IVE A;  3OPW A;  2PXJ A;  4LIT A;  5FZ6 A;  5FYU A;  4QWN A;  3OPT A;  5F5C A;  5FY1 A;  2OQ7 A;  4V2W A;  2XXZ A;  5FZ3 A;  5F5I A;  5FYB A;  5FXX A;  4EZ4 A;  3UYJ A;  5IVJ A;  5FP4 A;  4GAZ A;  5FP3 A;  4CCJ A;  3RVH A;  3U78 A;  4DO0 A;  5FYY A;  4NUB A;  3AVR A;  4LIV A;  4QU1 A;  4LXL A;  4D6Q A;  4BU2 A;  4QX8 A;  5LWB A;  5F39 A;  5FYH A;  5A7S A;  4IGO A;  5F32 A;  3KV5 A;  5A3P A;  4XDO A;  2OX0 A;  3PUS A;  2XUE A;  4Y4R A;  5A7W B;  3KV9 A;  2OS2 A;  5FP9 A;  5FPU A;  5LY2 A;  2Q8E A;  4URA A;  5FYI A;  4EZH A;  2YBP A;  5FXV A;  5FZC A;  5FZH A;  5A7O A;  5FY5 A;  5CEH A;  5F2S A;  3K2O A;  3PU8 A;  4CSW A;  4QXH A;  5FXZ A;  3ZLI A;  5IVY A;  4AI9 A;  5IVV A;  5FZO A;  2OQ6 A;  2YBK A;  5FYS A;  5FY4 A;  4IGP A;  3DXT A;  5F3I A;  5FP7 A;  2YU2 A;  5LW9 A;  3KV6 A;  5FPB A;  3N9P A;  5FZ0 A;  5FZO B;  5FV3 A;  4ASK A;  5FYM A;  4D6S A;  4BIS A;  2YPD A;  5FYV A;  5A1L A; 
#chains in the Genus database with same CATH topology
 2QKD A;  4NVP A;  2MHF A;  4LO8 A;  4CCO A;  1VP6 A;  2BRT A;  4CCM A;  4QXB A;  1YJL A;  3TB0 A;  2JDN A;  2ZGU A;  5KR7 A;  1NX9 A;  2VMD A;  1WMD A;  2H0B A;  1OMI A;  2R7E B;  3LAG A;  4KH9 A;  4FFI A;  1BVP 1;  1E5S A;  4MGT A;  1NCQ A;  2C9K A;  3IN9 A;  4FP2 A;  1RUH 1;  3B93 A;  1HB1 A;  4YZ2 A;  3SIT A;  4LKS A;  3ILR A;  4BQ4 A;  1NY7 1;  2RM2 3;  3VKN A;  2CGP A;  4XUN A;  1SLC A;  2ES3 A;  2XJT A;  1YLL A;  2DFC A;  4AAP A;  4FXG B;  3A21 A;  1DZT A;  4Y5T A;  5I0D A;  3DL3 A;  1H4G A;  3ETQ A;  3POE A;  1TQ5 A;  4M4P A;  1ZBE 2;  1LRH A;  5JLV A;  4BLI A;  2D97 A;  2GNT A;  2X29 A;  2WT0 A;  4EWD A;  1DGL A;  3Q8F A;  5CAD A;  1MS9 A;  4Q4Y 2;  1DGW A;  3POB A;  1DU3 D;  2R06 3;  4NE9 A;  2OA2 A;  1W8N A;  2NMO A;  5DZG A;  4KU8 A;  1OF3 A;  1RIT A;  4E2S A;  2GP3 A;  3B94 A;  4BH9 A;  3GHN A;  1ND3 B;  2WII B;  1JH5 A;  2VW2 A;  3RZH A;  3USS A;  5T54 A;  4LBQ B;  1LOA A;  4RL7 A;  4YZ3 A;  1BVV A;  5FZ9 A;  1VBC 3;  1AYM 2;  3N9O A;  2KXL A;  5F3G A;  1KD7 A;  3G6J B;  5DAB A;  1RHI 2;  3SNM A;  3M3E A;  4CUG A;  2Q8D A;  2ZHM A;  4K20 A;  1V9U 2;  2ZX3 A;  1ULP A;  2HJI A;  5JIA A;  1O3Q A;  2BUK A;  2J1A A;  2DBN A;  2DUO A;  2BNO A;  3KS7 A;  4PJY A;  1DQ0 A;  1UY4 A;  2DTY A;  3POF A;  2ET7 A;  1FX5 A;  3OTF A;  4XUR A;  3WW3 A;  1VBB 3;  3O5S A;  2JEN A;  1TNF A;  2VCM A;  4LO5 B;  3E6C C;  2GME A;  2DYC A;  3HNB M;  2JG9 C;  1US2 A;  5J7M A;  5FOB B;  3MPP G;  2EAL A;  2QQJ A;  4GWI A;  3VDB A;  1WKY A;  5FP4 A;  1SPP A;  2OW4 A;  3JZV A;  2KR2 A;  1VBA 3;  1ONA A;  3MIC A;  3R4U A;  3T4V A;  2EIG A;  2VZT A;  4IEV A;  1HXS 1;  1D4M 1;  4DNY A;  2VQ0 A;  1S1A A;  5IAX A;  2PAE A;  2XBO 3;  5A3P A;  4EWA A;  5JIU A;  3AP7 A;  1IPK A;  4PIZ A;  1COV 2;  1W3X A;  1Y4W A;  1W90 A;  3LEK A;  4WM7 B;  1JW6 A;  4N7I A;  1K5M C;  1W6N A;  2XON A;  3ZSK A;  4ARY A;  4C1X A;  5GLT A;  3AK0 A;  1XRU A;  1SFP A;  4QXK A;  5IYY A;  1C5H A;  2YPJ A;  1GQH A;  2W92 A;  4XCA A;  5IVV A;  2R07 2;  3GZU C;  1AR8 2;  2ZHK A;  5ERL A;  5JXG A;  2Y6L A;  3Q8B A;  2RMU 1;  1S2E A;  4IEX A;  2ZKL A;  1RUD 1;  3JU9 A;  4MGS A;  3WUC A;  3ZXJ A;  4CP9 A;  2WQ4 A;  3NKT A;  4JGY C;  4XIO A;  3WEZ A;  3KM5 A;  4ZU7 A;  3AMM A;  3M3Q A;  1VBE 3;  2ARE A;  3L9J T;  3W5N A;  1HB3 A;  2X09 A;  5JXJ A;  2WNU C;  4PBP A;  3UV9 A;  2ZX1 A;  3ZFE C;  5AFB A;  4TN7 A;  2XWB B;  4PT6 A;  2P3Y A;  3OY8 A;  4AQS A;  4HK9 A;  1PGW 2;  1AXY A;  3KV4 A;  1PVX A;  2HYX A;  4KL1 A;  3AP4 A;  4OVE A;  4I3G A;  5A7N A;  1S0F A;  2ZXQ A;  4MGK E;  3AL5 A;  3J7M A;  3ME2 A;  4N90 A;  3U37 A;  2J22 A;  1HV0 A;  1PIV 1;  2YY1 A;  3RMX A;  3WHU A;  1G9C A;  1UCX A;  2WKK A;  5C9A C;  1XB9 A;  4YG0 A;  2KD7 A;  4AI8 A;  2EA7 A;  1VBC 2;  4Q29 A;  5A1F A;  4OHW A;  3P6B A;  1WBF A;  1JOB A;  1PZ8 A;  2ZEX A;  1HRI 2;  2D3P A;  1C8M 1;  1WMX A;  2P6H A;  1SLL A;  3PTR B;  4XHX A;  3FJS A;  3S7I A;  5KHG A;  3D8C A;  1Q8V A;  5FQ0 B;  3NVC A;  4OFG A;  3VKM A;  3PDQ A;  5ACA 2;  3UET A;  4N43 B;  1YCI A;  1BEV 3;  5DUW A;  5L9B A;  4ZXE A;  5T55 A;  2CHH A;  1PO1 3;  4AXO A;  4NPM A;  2W3J A;  3D82 A;  4D3W A;  1K5M A;  1OH4 A;  2R0F A;  3VBS A;  3LDK A;  2PHT A;  4IEZ A;  1Z7S 2;  5A33 A;  3LEI A;  1J83 A;  1IS5 A;  3B9C A;  1W28 A;  2OT7 A;  2JIJ A;  4AQT A;  5F37 A;  5HCA A;  3AVS A;  4FVV A;  5FZI A;  4E4H A;  4HPK A;  3WNL A;  3TEZ A;  4XUP A;  1OD5 A;  5JXI A;  2VW1 A;  2A6V A;  3WW4 A;  5L9R A;  3POI A;  4QKB A;  3EHK A;  4KWK A;  5GLU A;  4CE8 A;  1XYN A;  2HEY F;  4XZP A;  3CKH A;  2RDR A;  2PLV 1;  3MIF A;  4Q4W 3;  1COV 3;  1XBF A;  5FP8 A;  2SBA A;  1AR6 2;  1AYM 3;  5F6K A;  3EJK A;  3ZN6 B;  3VDD C;  2XKO A;  1BKZ A;  5LBF A;  1RHI 3;  3ZSL A;  4CDX A;  1UU6 A;  1W8T A;  4B29 A;  1O4T A;  1V9U 1;  3OBR A;  2OXB A;  1W0O A;  4DFS A;  2WLP A;  5FK7 A;  4IEY A;  3RYK A;  5FLI A;  1OVP A;  4CXX A;  4XJW A;  3W59 A;  1LEM A;  2QTW B;  2PTM A;  1ENS A;  1AJO A;  3FX3 A;  4KGQ A;  4WM8 A;  3ZXD A;  1X8E A;  4CDW C;  5GZC A;  4CDQ C;  2WAB A;  1W9F A;  5G04 L;  4XC9 A;  5I93 A;  2YRO A;  4YGE A;  5BNQ A;  2QZ3 A;  4RQP C;  3WQ7 A;  1NZC A;  1OQE A;  1VRH 1;  2DBI A;  5L36 A;  1DYK A;  4BU2 A;  4DIN B;  4XEZ A;  1W2U A;  1S0E A;  2O14 A;  4LK6 A;  4AVS A;  1DQ4 A;  1H2M A;  4YW7 A;  1Y7B A;  3KV5 A;  4Z82 A;  1ZYB A;  3U1X A;  1HB4 A;  1W9Y A;  5LY2 A;  1HDK A;  3H42 B;  3RZG A;  1ZBA 1;  4LMF A;  1LKN A;  2G4I A;  1HQN A;  1NOV A;  5E89 A;  3WQ1 A;  1GQG A;  3VBF B;  1HV1 A;  4YVW A;  1W8F A;  2Q4S A;  4G4F A;  1RL3 A;  2B8M A;  1YQ6 A;  4MGY E;  3O0W A;  3IDA A;  1UO9 A;  3ZMO A;  4CDW B;  5C33 A;  5KBF A;  4C1W A;  1D4V B;  3ZSE A;  4RHV 1;  1RUG 1;  3VGI A;  3DXT A;  3ES4 A;  5FP7 A;  1CPN A;  3FE5 A;  2GNB A;  2ZTN A;  3HT2 A;  4OUL A;  5E88 A;  5CFC B;  5JOZ A;  3ZFG B;  5C4W A;  5LA9 A;  5FAX A;  2J1R A;  3I2I A;  5KXE A;  5FY7 A;  4COW A;  4FPY A;  4TTG A;  1X7N A;  2BGC A;  2GAU A;  4XOG A;  1A78 A;  2PMW B;  3H1W A;  4A44 A;  1EAH 2;  2WNV A;  2B42 B;  4FPK A;  1FNY A;  1GWL A;  2DCZ A;  2DCK A;  3PUH A;  2HWE 3;  4LUM A;  4XUO A;  2C0Z A;  1MEC 2;  2UY9 A;  3ZFG A;  2C24 A;  1PGW 1;  3ZYF A;  2B9V A;  4AEK A;  2EXH A;  2PN5 A;  1PO2 3;  3N7M A;  1DIW A;  2UWB A;  2VH9 A;  3BTA A;  4JGY B;  3K3N A;  3KCY A;  4UWD A;  3T08 A;  3WZ1 A;  2J42 A;  5J09 A;  3FC0 A;  3NNM A;  3C7H A;  4CDW A;  5I0R A;  3VBF A;  3LDB A;  4L8Q A;  1JHJ A;  1OOP C;  2YYO A;  3WNP A;  3WDV A;  3MW4 A;  2TNF A;  2F4L A;  5FUI A;  3A0N A;  5C8W A;  3T0D A;  1K42 A;  4QQH A;  1CAU B;  3OG2 A;  2RDS A;  1Z0H A;  4LHL A;  4QX2 A;  5CFD A;  2ZAB A;  2PHX A;  4M4R A;  5CIS A;  2WYS A;  3PVE A;  5A6Z A;  2J1E A;  2VTX A;  4Q4V 2;  5FJK A;  3LIG A;  4YZ4 A;  3QLQ A;  2P1B A;  4FPE A;  4R9C A;  2PHR A;  2WNU B;  3A7Q A;  2YDE A;  1NCR B;  1UOF A;  1EAH 3;  2JWP A;  4MXW A;  4Y1Y A;  4XIK A;  3KF3 A;  2VZU A;  2ZEY A;  1Z7S 1;  4XUT A;  1QEX A;  5FPA A;  1LED A;  2RDQ A;  5F5Q A;  4FTS A;  2IFR A;  4OZO A;  4AOC A;  3ZX7 A;  3U4S A;  2Q5T A;  2FQP A;  2RR1 1;  1YJK A;  4NMI A;  1X8M A;  2ZZJ A;  4CCK A;  2XLG A;  2EIC A;  4D6R A;  1ASJ 1;  1EPZ A;  1PGL 1;  3H3Z A;  4R4X A;  1YC6 1;  3S7E A;  5CNA A;  4PLN A;  1KDM A;  3MW3 A;  2VJX A;  1SLB A;  4P5Y A;  1BJQ A;  3T4H B;  3AKP A;  4XFB A;  4AYU A;  3ZPO A;  3TN9 1;  4B7E A;  1XYP A;  4YGD A;  3VZK A;  4A6S A;  4Q0U A;  3OUJ A;  3J26 N;  4FP3 A;  4W6W A;  5FY1 A;  4QWN A;  1NCQ C;  2R04 2;  2JIC A;  3GBF A;  4NHY A;  4OCT A;  2ZHN A;  4YGB A;  4E27 A;  4BB3 A;  1W8W A;  1RUE 3;  3BYW A;  3J4U H;  4I02 A;  1ND2 A;  1W6Q B;  4EZ4 A;  1UXX X;  2B5H A;  1JI6 A;  1C57 A;  3NV1 A;  4FT8 A;  3V0A B;  2AC1 A;  3ACL A;  3THD A;  3I7D A;  3D0J A;  3IBM A;  2OVU A;  4NOT A;  5FP3 A;  5FYY A;  2X8K A;  1L3J A;  2HWD 3;  3AVR A;  4AAX A;  5A33 B;  1AUY A;  4LXL A;  1APN A;  4XW3 A;  5D21 A;  2VZQ A;  4A45 A;  1LHN A;  2V72 A;  1UYZ A;  4N53 A;  4XBN A;  1GV9 A;  5FYH A;  3VBS B;  3AZX A;  3NNG A;  3VBH A;  4Y5S A;  4HVQ A;  4FOV A;  1WCS A;  1VPH A;  2VXJ A;  3VUO A;  1MEC 3;  1ZNP A;  1BHG A;  3KQR A;  3UKN A;  2ZEZ A;  3UGG A;  5GLV A;  4LEJ A;  1JOJ A;  5CEH A;  3RJ2 X;  4FPO B;  3ZFF B;  1W06 A;  1DF0 A;  1FYU A;  4XAA A;  3MLL A;  2OQ6 A;  5DDJ 1;  1KS5 A;  3AMQ A;  3UKT A;  1UMI A;  2LW8 A;  1JZ2 A;  1AR6 1;  5EP9 A;  2GSY A;  3ILN A;  1ZZC A;  4HN0 A;  5FO8 B;  3N9P A;  1JU3 A;  2MPF A;  4CEW A;  1PO2 1;  4BCU A;  1RYY A;  5FY9 A;  5FYV A;  2UYA A;  4NRQ A;  4OUE A;  1M06 G;  3T30 A;  1YYN A;  2HEW F;  3EB7 A;  2NN8 A;  3ITQ A;  3DUI A;  3POW A;  2JE7 A;  2WT2 A;  4IV1 A;  3WP5 A;  4DUX A;  2VO5 A;  3H7Y A;  1F15 A;  3GAL A;  1H2K A;  3ASI A;  3LOI A;  4Q26 A;  1RUH 2;  1QWR A;  5FYC A;  4BQY A;  1UZZ A;  2UU8 A;  5A3U A;  4K7J A;  5I0U A;  2YFZ A;  5DAX A;  1OHF A;  3L2Y A;  3TAY A;  4SLI A;  1GZC A;  2TEP A;  3HWJ A;  5JVV A;  2WDB A;  1UZV A;  4YVS A;  4CDU C;  1HKD A;  2B4K A;  3DXU A;  1RUI 3;  4MX3 A;  1CD3 G;  1UD1 A;  2P3J A;  1RUG 3;  2ZGK A;  4M01 A;  2NPI A;  2G19 A;  2I74 A;  2B7Y A;  3QCW A;  2P6C A;  5A3T A;  3RDI A;  2VNV A;  3G7D A;  1V6M A;  2AEZ A;  2XVK A;  1BMV 1;  3R4S A;  5J48 A;  5A80 A;  2VNO A;  3PUQ A;  3B3Q E;  1TME 1;  3I2H A;  2JXA A;  3SIS A;  2DWR A;  2VZ3 A;  4KU7 A;  4E4D X;  1WLC A;  2ZAC A;  2UYB A;  3SQO A;  1Q5O A;  1UZW A;  2R1B A;  2I45 A;  3MEP A;  1CAV B;  3PJQ A;  4FCA A;  4AVT A;  2VVF A;  1QXJ A;  1ZZ8 A;  4HON A;  4U2A A;  1G9A A;  4DS0 A;  4DXT A;  4GKY A;  2Z4F A;  5FZK A;  1HX6 A;  2VUJ A;  4H3W A;  2NYY A;  4JGY A;  4UFM A;  3WW1 A;  2ZGL A;  4NR1 A;  4RS5 B;  4AZZ A;  4OYU A;  2JDK A;  5A3W A;  1UU5 A;  2BV4 A;  3T1L A;  3CDZ B;  5C4W C;  4XHB A;  3JQX A;  5FY0 A;  3III A;  4DRV A;  2RR1 2;  2VCA A;  1H6Y A;  4CEY A;  2E53 A;  1AR8 3;  4HSL A;  3K3O A;  3MDP A;  1QXR A;  2FZ2 A;  3PUA A;  2WC2 A;  3LPF A;  3IPV B;  2WQZ C;  4F3J A;  1YEW A;  2OYZ A;  1HLC A;  5JPN B;  4AE2 A;  3N7L A;  1BLZ A;  3JD7 3;  4MVT A;  4MXV A;  4OUS A;  3SH4 A;  2XJP A;  4AF9 A;  3H8X A;  3ZO0 B;  1NLS A;  4BLJ A;  4FSJ A;  1FXZ A;  3WY6 A;  4UW5 A;  4DXS A;  5CAZ A;  4LBQ A;  2ZX4 A;  3ALQ A;  4WV8 A;  3MF9 A;  4XET A;  4YFW A;  5KHH A;  1ND3 A;  1PK6 C;  3M4F A;  4CYD A;  5KHJ A;  5I8S A;  3FUO A;  5DDJ 3;  1E5H A;  1MZ5 A;  2JDU A;  3I2G A;  4M0H A;  4NUB A;  4Y20 B;  2GMP A;  2RJK A;  2EXJ A;  4MZU A;  4E4S A;  1OD3 A;  1RC6 A;  1W2T A;  2OPK A;  3ZVX A;  3MGU A;  4RGG A;  3T3Y A;  2CAV A;  2JIG A;  3AP5 A;  3KV9 A;  1DGW X;  1LHU A;  1GNZ A;  3O12 A;  5FRA A;  1XQN A;  1R1A 2;  1W6P A;  4QM9 A;  4QAW A;  4XZU G;  5JMO A;  4UFL A;  4YRD A;  1F8V A;  2A3Y A;  5IVY A;  5JSO A;  1CIY A;  4XJA A;  3DEM A;  4GMP 0;  2DVB A;  4HG6 B;  4GMP 3;  1RUJ 1;  1TG7 A;  3ZYH A;  5K0U B;  3O1R A;  3VDD B;  1UF2 C;  5F3I A;  3V64 A;  1PO1 2;  3E97 A;  2A7A A;  4UT5 A;  3BIW E;  5JOX A;  3D6E A;  1TMF 2;  4W65 A;  3LCP A;  4W6X A;  3QAC A;  1X9T A;  4AFB A;  2D44 A;  3KHC A;  1C4R A;  1GAN A;  2WS9 3;  3M1H A;  1R09 1;  1ZA4 A;  1PO2 2;  3POY A;  4G9S B;  3T0A A;  3C7G A;  3DGT A;  4Y33 A;  1V6I A;  1D2S A;  4FFH A;  1RUF 2;  4M3C B;  3MLK A;  4RFT 0;  2VNG A;  3LQC A;  4K9S A;  4QPY A;  1LJ7 A;  2W1U A;  1LOF A;  4UF0 A;  3ZFF C;  5HV4 A;  4GWM A;  1U12 A;  1UKG A;  5F3C A;  4YZ1 A;  2VTX J;  4FAH A;  4O65 A;  3NV3 A;  1SLA A;  3LZZ A;  2XDV A;  4WM8 C;  2A75 A;  3ZXL A;  3CZJ A;  5A3N A;  2VQT A;  1DYO A;  4IW3 A;  2XQX A;  3AJZ A;  3SEP A;  4D7Y A;  2E32 A;  2HEV F;  3ZMN A;  1T6B X;  1YFX A;  2P3I A;  3VBH C;  4CUC A;  2AEY A;  1OF4 A;  2RS1 3;  2I2S A;  1DQ6 A;  4GB3 3;  5DG2 A;  1N1Y A;  5I0T A;  3ZN5 A;  3TEW A;  1US3 A;  5IVC A;  3NJY A;  4EN8 B;  4W6Y A;  5IW0 A;  4I3P A;  2FCU A;  3L2H A;  1HB2 A;  5FOJ B;  2C26 A;  3I3E A;  2Y6H A;  5GJ6 A;  4FPG A;  4XE9 A;  5K9Y A;  3S30 A;  3RZK A;  4XF1 A;  3SLI A;  1JYI A;  4FFG A;  3LKJ A;  1UZY A;  3A4U A;  3CU7 A;  2JDZ A;  3H1Y A;  3J7H A;  3ROU A;  2PLV 2;  5ISL A;  2XJR A;  2RS1 1;  3M3C A;  5LY1 A;  1AX0 A;  1X50 A;  1QH7 A;  3VZJ A;  1V70 A;  3C2U A;  1QJX 1;  4XDP A;  3O7O A;  4IV1 C;  3SKJ E;  1PZ9 A;  4RR3 C;  2HWE 1;  3M70 A;  3ZYR A;  1ZBE 3;  3LA2 A;  4ONU A;  1RUE 2;  2TBV A;  4DXZ A;  3OF1 A;  3K4D A;  2ZMN A;  1PMI A;  3WDW A;  4LIT A;  1MQT A;  5EIY B;  1AXK A;  1S55 A;  1OPO A;  5FZ3 A;  1S4C A;  4YW3 A;  4EE2 A;  1VRH 2;  4A41 A;  5FK8 A;  4ZPI A;  4RSU A;  1R09 3;  2QQK A;  1N47 A;  2BFU L;  4IQP A;  1CIW A;  1UIK A;  2Y6G A;  4RR3 B;  4D6Q A;  4AVA A;  2WS9 2;  1S0B A;  2NQY A;  3IDC B;  3A22 A;  3VD5 A;  1I1E A;  2ZHL A;  1RUD 2;  2WIN B;  3RZJ A;  2IXC A;  4QPW A;  4FTE A;  5FMC A;  2AH2 A;  5A7W B;  4Y4R A;  1AYN 2;  1DZQ A;  5GZD A;  4CA9 A;  1VB4 A;  2XVL A;  1RUJ 3;  4OLL A;  1LU1 A;  1FOD 1;  4YWA A;  1GOF A;  2IZW A;  5FZH A;  5D8A C;  2Q0A A;  4ARX A;  2DUP A;  1PK6 B;  1U5I A;  3MYX A;  1H0B A;  4OQ9 A;  1KFU L;  2W68 A;  3B01 A;  1Q56 A;  2RM2 1;  3BOD A;  5KC6 A;  3HVD A;  2P3K A;  1GWK A;  2JEC A;  1QXP A;  4OHX A;  2HWF 2;  1IOA A;  2Y0O A;  1XNT A;  2ZKN A;  3C8X A;  5FPB A;  1YI9 A;  1RUH 3;  2WR9 A;  1AF9 A;  4FQ4 A;  3WP3 A;  4A7Y A;  1JYX A;  2YPD A;  4NAO A;  3KGZ A;  2WUH A;  5C3R A;  1S0C A;  4N7U A;  1H1A A;  3SKV A;  4YAR A;  2DV9 A;  3VDD A;  5LAT A;  2ZX2 A;  2F17 A;  2Q1M A;  5DZF A;  4NJ4 A;  3NJX A;  4N8M A;  2GND A;  4CU8 A;  2P5B A;  4AI1 A;  3JD7 1;  1NA1 A;  2JB8 A;  4MOA A;  3HNM A;  3Q9O A;  2CNA A;  4DXR A;  4MG2 A;  3ENR A;  1OH3 A;  3BOP A;  5L7O C;  1UOJ A;  3I3D A;  3MI8 A;  2NMN A;  1CAX B;  2BJS A;  1QNY A;  3WDT A;  5I8T A;  3JCI A;  2VCB A;  4LO4 B;  1DDL A;  4XQD A;  1O8S A;  1I9R A;  1R1A 1;  2GC2 A;  4R4Z A;  1QJU 2;  2ZGO A;  4LIU A;  3ZR5 A;  5LA2 A;  1W0N A;  1GSL A;  1ODM A;  4IES A;  2KM2 A;  1E5I A;  4EQV A;  4MYE A;  5BNN C;  1LAJ A;  3OGS A;  1RB8 G;  1G9F A;  3CBN A;  3AMN A;  2PHW A;  4YM2 A;  1SHW B;  1PO1 1;  1MR5 A;  1K3I A;  1ZA7 A;  1BEV 1;  3RSJ A;  3T2T A;  2XG3 A;  1NA1 B;  3IIA A;  2D6M A;  1TEI A;  2UUR A;  3O1O A;  3N9L A;  4XJU A;  5DUV A;  1WA6 X;  3FUQ A;  4MHU A;  4CCC A;  1R09 2;  4B4P A;  3MW2 A;  4D7T A;  4LE3 A;  4ASM B;  4CEY B;  1SBF A;  1U5Z A;  4Q4X 1;  1AL2 2;  1S0I A;  1XSQ A;  3RPQ A;  1VAL A;  1BXH A;  2W39 A;  2FDF A;  1PIV 3;  5A3L A;  3RZZ A;  4BQX A;  1GP6 A;  1XPW A;  4JQT A;  4RS5 A;  3U10 A;  3WQB A;  4X8N A;  1HRV 3;  3ZYI B;  3TWI A;  1MS8 A;  3OD0 A;  2W1W A;  5FZ1 A;  2WNO A;  1RXF A;  1HRV 1;  4K8R B;  2AYH A;  3POS A;  1SCS A;  5FZL A;  4OMC A;  4IDZ A;  2ORZ A;  4YG3 A;  4XQW A;  4PDW B;  4DUV A;  2CGN A;  2HWE 2;  5CKN A;  4IEW A;  3RYR A;  2V5Y A;  3AKT A;  2VXR A;  5I0S A;  1RVF 1;  4P9L A;  5FYB A;  1BK1 A;  4OHY A;  2WZR 1;  4Q4X 3;  3HEI A;  3ZPY A;  2MEV 3;  5IVJ A;  5LK5 A;  5DAV A;  1NQJ A;  2BWC A;  3VBF C;  1OOP A;  1JMU B;  1UMZ A;  1QJX 3;  2WYF A;  4QX8 A;  1BYH A;  4SBV A;  2YHJ A;  1KJL A;  4MV2 A;  4QD2 A;  4Y1V A;  3JQW A;  3FZ3 A;  5JR7 B;  1IPJ A;  1MS3 A;  3LEM A;  4YM3 A;  1UIJ A;  5CFC C;  1QJE A;  2W91 A;  5IK8 A;  2OS2 A;  1AR6 3;  1QMJ A;  2E6V A;  2EIE A;  2BPA 2;  1FPN 1;  1XNC A;  1RMU 3;  4RA0 A;  5K8S A;  4AQ2 A;  5T5J A;  3U11 A;  5LA1 A;  1NE4 A;  2D3S A;  1SEF A;  2G1M A;  3K2O A;  1D4M 3;  1G7Y A;  4XQ4 A;  1LGN A;  1WLT A;  1NY7 2;  2BGO A;  3GZE A;  5T5L A;  4XJ9 A;  3M7A A;  1MEC 1;  3TOJ A;  2VBD A;  1QJF A;  5C9A B;  1GR3 A;  3KV6 A;  1Q8P A;  1RXG A;  3HN3 A;  3F95 A;  3W20 A;  5FYM A;  5GAL A;  1NLQ A;  2CWS A;  5JZG C;  1ST8 A;  5ANQ A;  2ZBJ A;  5FWJ A;  1FAY A;  1VLN A;  1WCQ A;  4IE7 A;  1H8T C;  3DCQ A;  2VVD A;  4UW6 A;  3ZR6 A;  3PTY A;  1Q8Q A;  3KZ4 C;  4EJR A;  2GMM A;  4YM1 A;  2VM9 A;  2WO3 A;  3NL1 A;  4UFH A;  4QKN A;  3HOB A;  1AXZ A;  2RVA A;  1W9T A;  1YNA A;  3HT1 A;  5LBC A;  4Q1R A;  2Y8K A;  3ZKU A;  4KG8 A;  5BYN A;  1ZRC A;  4LBJ A;  1GMM A;  1TE1 B;  1V6K A;  5A70 A;  1IS4 A;  5JI9 A;  2R04 3;  4HKW A;  1L7R A;  3PUI A;  2FCT A;  3OBZ A;  4QHB A;  2BBV A;  4YYO A;  2DU1 A;  1C5I A;  5IJR A;  4DQA A;  1O3S A;  4I30 A;  3UGF A;  3VBU B;  1MPX A;  5A32 A;  1W2A X;  2QVS B;  5BUV A;  4L99 A;  3I3M A;  4RQP A;  5ABJ B;  1KXG A;  1MS5 A;  5D8A B;  4GD4 A;  4GJZ A;  4L92 A;  2CL2 A;  2HH9 A;  2VOV A;  1D2Q A;  3N36 A;  1RGS A;  2DCT A;  4LHN A;  2P34 A;  2R07 1;  3CQO A;  4Q2F A;  4HKO A;  5D1I A;  3P3P A;  3OJB A;  1LHW A;  4GH4 A;  3TRS B;  3V56 A;  4S2H A;  2Y60 A;  4YW6 A;  5FO7 B;  5IAT A;  1Q8S A;  1X82 A;  2A6W A;  1BCX A;  2BYV E;  2RV9 A;  2WWU A;  2UY8 A;  1JYC A;  3I97 A;  3KF5 A;  5FLH A;  5HCB A;  1LEN A;  4AEJ A;  2GN7 A;  5FZG A;  2JJ6 A;  4CU9 A;  3WG3 A;  1OA2 A;  4PI2 A;  4KWU A;  3IDE A;  4ORF A;  1CES A;  4YW1 A;  3W58 A;  1Y43 B;  5JOW A;  1IHM A;  4M3C A;  3VLB B;  4CU6 A;  3I49 A;  3WIN E;  5BNP B;  2ETE A;  3AZW A;  1FV2 A;  2VUL A;  1KRI A;  2HWF 3;  1J3P A;  1IQD C;  3CL1 A;  2R04 1;  3ELN A;  3KHB A;  3VB9 A;  1O8P A;  4L2N A;  3AYA A;  1DZR A;  3ZFE A;  3VBR C;  3WNO A;  2WT1 A;  5C3S A;  3BTY A;  2EID A;  4IND A;  2O1Q A;  2CAU A;  3CNA A;  2WSU A;  2XH6 A;  3GGL A;  2WNV C;  3LDR A;  3LSE A;  5IK4 A;  4LT5 A;  1ZBE 1;  1W03 A;  4PF1 A;  5GZE A;  1BBT 3;  2QBX A;  1JYT A;  4E8D A;  2XR4 A;  5IVE A;  4LJH A;  5IK5 A;  3DPR A;  4QT6 A;  4FOQ A;  4YFZ A;  3OGV A;  2GC1 A;  1HRV 2;  3UL2 A;  5FXX A;  3TEY A;  4XAC A;  3H3L A;  5LWB A;  2JKX A;  2PAM A;  1N3O A;  3WV6 A;  1VBB 2;  4UI9 L;  4CP1 A;  3R6S A;  3WQ0 A;  4CCJ A;  5FR3 A;  2BOJ A;  1F31 A;  2BNN A;  2XGX A;  1RUF 3;  5JSP A;  2VZR A;  5F39 A;  2Z42 A;  5CB7 A;  5A7S A;  2D6P A;  4YZ5 A;  3KCC A;  1WW6 A;  4AHW A;  1O4Y A;  1GOG A;  1K5J A;  1OA4 A;  2BEO A;  4Q1P A;  4AR2 A;  4BXS V;  4RHV 3;  1UY0 A;  5E16 A;  3URF A;  3FFZ A;  2A3X A;  3PVN A;  3I4I A;  4KMQ A;  4D0Q A;  2VU9 A;  4E9K A;  1OFN A;  3CZU A;  3ZLI A;  2QCS B;  2ILM A;  2Y33 A;  4BME A;  2K46 A;  4DEQ A;  3BVC A;  2BOI A;  3F2Z A;  3IPV A;  2LAL A;  3WP4 A;  1VIW B;  2Z5W A;  2Q1F A;  5FYS A;  3TNQ A;  2GN3 A;  4AGV A;  4BA6 A;  3KGL A;  3PNA A;  3I54 A;  3JBG 3;  4GB3 2;  5FKB A;  4AL9 A;  4C90 A;  4IV3 C;  4XBQ A;  3THC A;  4XFG A;  2D6N A;  2OUH A;  1W8Z A;  3D4K A;  4E4Z A;  4LKE A;  2XVG A;  3HNY M;  3KT7 A;  2P17 A;  2ADD A;  3EXU A;  3VBR A;  3Q8A A;  2GNM A;  5GLZ A;  4UFJ A;  4QX5 A;  3H3U A;  5C3O A;  2N7G A;  4R9D A;  2J1U A;  2ARC A;  2ZAH A;  1LUL A;  2E7Q A;  4AQ6 A;  4QB1 A;  4B7K A;  1QNW A;  1XXN A;  1NZI A;  4JTO A;  2VUD A;  4GIQ A;  3SCF A;  4CUB A;  2W0X A;  4IEU A;  4F7Z A;  3GZA A;  1AX1 A;  2VCC A;  4K40 A;  2V5D A;  1CAW B;  4RFR B;  3AX4 A;  4CDQ A;  1UQX A;  1HJF A;  4GMP 1;  2RMU 2;  1ZZ9 A;  1BZW A;  1H8T B;  3J8F 2;  3BIE A;  2A70 A;  3FN9 A;  5LCW L;  2WFF 2;  4OHZ A;  2VOK A;  2WZE A;  4QQP A;  3ZYG A;  2L9L A;  2YG0 A;  3JB4 C;  1FMD 2;  3LSD A;  2FBE A;  3WUD A;  5DUU A;  4AFA A;  3I8T A;  2BU9 A;  1NYW A;  4L11 A;  2VZO A;  4NAM A;  3EYP A;  2QZ2 A;  3I2K A;  4XF3 A;  4B1L A;  4YGC A;  2PHF A;  1B35 B;  5EZW A;  2DFB A;  3WLU A;  4LNV A;  1R1A 3;  2ZEW A;  4WVM B;  3LA3 A;  1XJA A;  1RTV A;  3V0B B;  2W46 A;  4WZF A;  4O9E A;  3VHP A;  4XBL A;  2WRA A;  3J7L A;  1PZ7 A;  5L7O B;  5DZE A;  2WA3 A;  3CMG A;  2JG8 C;  3ON7 A;  2P2K A;  2PHU A;  5CIR A;  1ZRD A;  4LHK A;  2NM1 A;  5C8C A;  5FWE A;  1DFQ A;  1C28 A;  1CAV A;  1OKQ A;  4X8P A;  4B4Q A;  1C1F A;  1W8O A;  4WVW A;  5JZG A;  2VUC A;  2GAL A;  1PGL 2;  3HAG A;  1F4H A;  4HK8 A;  5EQU A;  3H9A A;  4LKF A;  4HPK B;  1W2N A;  1OA3 A;  2W95 A;  2YGM A;  4V2V A;  3BKZ A;  3HPN A;  3N4M A;  1F35 A;  3O1M A;  1NA1 C;  3OCP A;  3ZFF A;  2ADE A;  2OQ7 A;  5JMC A;  3P3N A;  4PLO A;  2B9U A;  4EV0 A;  4TXW A;  1JYV A;  1V6L A;  2YFU A;  4BQ1 A;  4FPC A;  1ASJ 3;  4Y1X A;  2A6Z A;  5FMB A;  5IFT A;  3RZL A;  4MH0 E;  2D7F A;  4QB2 A;  4FPH A;  1MQT B;  3IM0 A;  5DMY A;  1IG0 A;  1QOS A;  5F32 A;  3I3B A;  3OYW A;  2XHN A;  3KD4 A;  2OX0 A;  1MS1 A;  3NQH A;  1NXM A;  1TME 3;  5APA A;  5ANN A;  2FMD A;  1OLR A;  3E5X A;  3GZT B;  1CZT A;  4LBQ D;  2RM2 2;  4ES9 A;  5K0U C;  1WME A;  1WBL A;  3AB0 A;  3I59 B;  5F2S A;  3VBO B;  3VL8 A;  1DG6 A;  3B7M A;  3VD7 A;  4ATE A;  1WGP A;  5H9P A;  4QHO A;  4V1P A;  1OBN A;  2H6B A;  2W94 A;  4QX0 A;  3QOP A;  4KG0 A;  4BM8 A;  1CJP A;  3ZIW A;  1OLM E;  5L19 A;  2VBP A;  1X9P A;  1QQP 3;  3MUY 1;  4RN5 A;  5DAP A;  2EXK A;  5A1L A;  1JZ4 A;  1LOD A;  2WN3 A;  1CON A;  5H9S A;  4LE4 A;  1VMJ A;  2CWM A;  3N3H A;  2XJV A;  5HXM A;  2RJ2 A;  5IT6 A;  3S0M A;  5IK7 A;  4CP9 B;  3K77 A;  2Y38 A;  4CRQ A;  4XJ8 A;  1Z78 A;  2DDU A;  2VMC A;  3VBH B;  4MXW B;  2OKX A;  4BJ0 A;  1O6U A;  1WLW A;  1LOB A;  2JG9 B;  1I5P A;  2YGL A;  3NJZ A;  2PHL A;  5EHD A;  1XNB A;  5K4L A;  4L0P A;  3B02 A;  2VBB A;  4QB6 A;  3ZIX A;  4JX0 A;  1GLH A;  3VV1 A;  3EMR A;  3SEE A;  1LTE A;  1NG0 A;  3OB8 A;  3WF3 A;  4XJZ A;  1CAU A;  1OC1 A;  5A7Q A;  3KLS A;  1MZE A;  4JQR A;  4R9B A;  4UF0 B;  3VHO A;  4BWO A;  1RIN A;  3RZM A;  1YFU A;  1RUO A;  5JZG B;  4D8M A;  2BFU S;  5FZ8 A;  1HQW A;  2H6C A;  1BK0 A;  4BQ2 A;  3U07 A;  3BCW A;  1UW8 A;  4K3U A;  5FMD A;  3WG1 A;  1D0H A;  3NKG A;  2YMZ A;  4GB3 1;  4NIA A;  4FPJ A;  3WG4 A;  2O8O A;  5GM0 A;  2WO2 A;  1STM A;  1Y9M A;  4GZ9 A;  1ZZB A;  4TSV A;  1ZBA 3;  4XTP A;  4JC1 A;  1DCS A;  4IEO A;  2QNK A;  2IXJ A;  5IWF A;  4FO9 A;  4Q4W 2;  3ILF A;  1YHF A;  3WT3 A;  5C70 A;  4I0A A;  3GBG A;  4YM0 A;  1N1S A;  1QJY 1;  3FHQ A;  4OQ8 A;  2WSV A;  5EXO A;  2WNU A;  5C4W B;  3M2M A;  3OGR A;  2XOM A;  4N9H A;  5FBZ A;  1GZT A;  1YQ8 A;  1H8T A;  3GYD A;  3D5O A;  1GIC A;  1KFX L;  1J59 A;  3VBU C;  4YW2 A;  4K6B A;  5CFD B;  2WN2 A;  2WS9 1;  5F5A A;  3B69 A;  3ZSM A;  4GUL A;  3KT1 A;  3OPW A;  5T3N A;  3RG0 A;  3KWV A;  4CP0 A;  4QPG C;  3SH3 A;  1QIQ A;  4A7Z A;  2JG8 B;  2D93 A;  4BQW A;  4Y5Z 0;  4IXL A;  1KEX A;  4Q4Y 3;  1RHI 1;  4CZS A;  1DGR N;  4I01 A;  3VHR A;  4F8A A;  3X29 B;  1WCK A;  2YUE A;  5IAV A;  5K7P A;  1JYN A;  2VG9 A;  3SCG A;  4BDV B;  4JDO A;  5J37 A;  2G9Z A;  4JV4 A;  2PLV 3;  1DQ1 A;  4EN6 B;  3K75 B;  1URX A;  4ATF A;  2E7T A;  4IUG A;  1JS9 A;  1FPN 2;  3VBR B;  2ZGP A;  4RD7 A;  4D94 A;  5HV0 A;  3P1I A;  4UW3 A;  5H9R A;  5CFD C;  1AHS A;  1SDW A;  3U75 A;  4GH4 C;  3IAP A;  5FFO C;  2WNV B;  4P9G A;  2GH8 A;  2IXH A;  2Q30 A;  3DKW A;  3WF1 A;  4QGL A;  1EP0 A;  5FYI A;  3WG2 A;  3BI3 A;  4MET A;  5FY5 A;  3N7K A;  2VZP A;  3PU8 A;  3SCH A;  2D5H A;  1YQ2 A;  3WDY A;  2NLR A;  1PVC 1;  2VEC A;  2YBK A;  3ACF A;  1RMU 1;  3UK9 A;  3ZYP A;  4Y4Y A;  1JZ6 A;  2ET1 A;  3USU B;  2X05 A;  2EVX A;  1DYP A;  4H2A A;  1N3P A;  1ULG A;  5JXH A;  3JD7 2;  1JOD A;  1YFY A;  3UES A;  1ZZ7 A;  1CX4 A;  5C71 A;  5CKM A;  1YXW A;  4Y26 A;  4D6S A;  1AL2 3;  1M4W A;  1Q3E A;  3ZXG A;  4Q0Q A;  4TLG A;  4BQ3 A;  4KWL A;  1C8M 3;  4YW4 A;  1AR9 1;  1UY1 A;  5LZ6 A;  1J84 A;  1JUH A;  4GQ7 A;  1CN1 A;  1AR8 1;  2EIB A;  1EPW A;  5B2G B;  4LLO A;  4FXK B;  2LM3 A;  4AED C;  4CPB D;  5ACA 1;  1L7L A;  5FZM A;  3DPR C;  4LO7 A;  1O59 A;  3GCX A;  1MQT C;  2Y6K A;  4Q8K A;  3WNX A;  4QPG A;  3IT8 A;  1T2X A;  3HQR A;  4NIH A;  4XFF A;  2C4X A;  3I3Q A;  2VMG A;  4LLF A;  2JG9 A;  2W5F A;  1ND2 C;  2WO1 A;  1REF A;  4UYB A;  4WM8 B;  3E5U A;  1LB2 A;  1L7Q A;  3D0S A;  4ZS3 A;  2YBS A;  2YZ4 A;  5TSW A;  2A73 B;  1MAC A;  4UFI A;  4ZHN A;  4U36 A;  2FDI A;  1VBD 3;  1W6O B;  3K48 A;  4YVS B;  5FZ7 A;  1H30 A;  3WSO A;  1UN1 A;  5BNN B;  2VZV A;  2ZGT A;  1RUI 2;  2YB7 A;  3M3I A;  3WX5 A;  4DMI A;  2XJQ A;  4B1M A;  2Y64 A;  4HAN A;  1UNB A;  4KBB A;  1ULC A;  3GHM A;  5DUX A;  3WHT A;  3KVB A;  4CDX B;  5BNO C;  3JBG 1;  4EN9 B;  1ZRF A;  5LAS A;  1RUJ 2;  2WL1 A;  2R6Q A;  3HMY A;  1V6O A;  2G9G A;  2AZ5 A;  2C5D A;  2XWJ B;  4NPL A;  5FJH A;  4IV1 B;  1H8V A;  5FMO L;  1KGY A;  1WWY A;  4COY A;  3K4A A;  5BNP A;  3NV4 A;  1C8M 2;  1MS4 A;  3AFG A;  3EO6 A;  4AEM A;  3GXU A;  3AZY A;  5KHK A;  2J7M A;  2ZS6 B;  1T6G C;  4FFF A;  4XAB A;  5SV8 A;  1OUX A;  4PHZ A;  4Z2A A;  2K0G A;  1WD4 A;  5J1X A;  3QH6 A;  4I2O A;  4LBM A;  4EYU A;  4BXF A;  4CEW C;  5F9T A;  1GKB A;  2WAA A;  4GXL A;  5CU1 A;  2WZR 2;  1EUU A;  3VHN A;  1UL9 A;  1GZW B;  3O1S A;  1UPI A;  4H7M A;  1LHO A;  2R16 A;  3ACH A;  5GZG A;  1POV 1;  5ABJ A;  4JGZ B;  2XLF A;  1YUD A;  2F4P A;  2CTV A;  2WJS A;  4JRL A;  4N9I A;  4CVU A;  3N9M A;  2VOW A;  4NHM A;  2VW0 A;  4P08 A;  4QX7 A;  5F6L B;  1U0A A;  4Y24 A;  2W9X A;  1GQP A;  2PXJ A;  1DQ2 A;  1V00 A;  1VBB 1;  2XXZ A;  1PX4 A;  4MHR A;  5LBE A;  1BBT 1;  1X33 A;  2CYF A;  3DV8 A;  5I8Y A;  1PHM A;  1W6N B;  3MIG A;  4Q27 A;  3UYJ A;  3ZDS A;  2ATF A;  2QFE A;  3NNJ A;  4BE3 A;  2Y6F A;  1OVS A;  2JX9 A;  2W52 A;  2FDH A;  2FDG A;  1R1Z A;  1A6C A;  2DCJ A;  2PQS A;  1B35 C;  3WF0 A;  4QU1 A;  3ZM8 A;  3WCS A;  4BOW A;  3QD6 A;  4JKK A;  1DBN A;  1V0A A;  1I6X A;  3SC7 X;  4COU A;  3T0B A;  5C8C B;  3MO4 A;  1R08 2;  2RJL A;  2VE1 A;  2JEM A;  4OUM A;  4GWN A;  3VKO A;  1SFY A;  3C3V A;  3ORJ A;  3WF4 A;  2AR6 A;  1PX3 A;  2YBP A;  5BNP C;  4RYD A;  1HJG A;  5CKQ A;  5A7O A;  4YW5 A;  4FBF A;  1MVE A;  2WAO A;  1KIT A;  4B4R A;  4QXH A;  3V0B A;  1N1V A;  1AR7 2;  5BV6 A;  4BPZ A;  2JDH A;  2VMI A;  4DZG A;  4ISR A;  2BDR A;  2BGP A;  1JZ3 A;  1SMV A;  2VME A;  4IGP A;  5AC9 1;  2YC0 A;  3T1M A;  1RUE 1;  4E2G A;  5FZ0 A;  2R07 3;  5KC5 A;  1DP0 A;  1DQ5 A;  3P5B A;  4Q4V 3;  4AK3 A;  4ISQ A;  3U0Z A;  1XC6 A;  5T50 A;  3UJO A;  4Q0P A;  3WNN A;  4ZON A;  1W9S A;  4WM7 A;  3INA A;  1G6N A;  4DEV A;  5FBJ A;  3MPB A;  2A1X A;  1RUG 2;  4Y1U A;  5IVB A;  1XNA A;  2SLI A;  3KQ4 B;  4LA3 A;  2Q1Z B;  3BPS A;  4Z8B A;  3IDB B;  2D6K A;  4LA2 A;  1W8U A;  2A6Y A;  3MFC A;  1H2L A;  2EAK A;  2A71 A;  2VY0 A;  2WQ8 A;  3HD8 B;  4H7L A;  5J36 A;  3J8F 1;  1QGL A;  2K2S A;  2ZGS A;  1XE0 A;  3GCW A;  5DQ0 A;  4M3C E;  1SLT A;  3HBK A;  4FPL A;  3WW2 A;  3QBQ A;  1QJX 2;  2RE9 A;  3I2D A;  1HIX A;  5LB6 A;  3VBO C;  4AI2 A;  5FZ4 A;  1MZF A;  1YQ5 A;  2HWC 3;  1XOY A;  4PBO A;  1EV1 2;  4QMA A;  3TNP B;  5EV7 A;  2NZ9 A;  3FFQ A;  2Q8C A;  2DUQ A;  4FQZ A;  4CCL A;  2X5I C;  4LPL A;  1K12 A;  3FLT A;  4Q5O A;  4DUW A;  5DAQ A;  4CU7 A;  3FLP A;  3PL0 A;  5FUP A;  1H9P A;  2WO7 A;  3BGA A;  2D43 A;  5C7G A;  2ZCW A;  1ASJ 2;  5H9Q A;  3PIJ A;  4YVW C;  1UYY A;  4OI1 A;  5LA0 A;  2JDA A;  5FZB A;  3ES1 A;  3VZO A;  3ST7 A;  3JB8 A;  1O4Z A;  2WNE A;  3RGB A;  4NHX A;  1LOC A;  4XTM A;  3UJQ A;  1QDO A;  1CX1 A;  4LBL A;  2XML A;  3AJY A;  3TEX A;  1XYO A;  1W39 A;  3ETP A;  1XNK A;  3WCR A;  2ARA A;  3APB A;  2D40 A;  1TMF 3;  4I0W B;  4OMD A;  4P5H A;  1J58 A;  3DYO A;  3GBW A;  3ACI A;  5E8A A;  3MUZ 1;  3CLP A;  5BXX A;  1AL0 G;  4NPR A;  3PU3 A;  2MEV 1;  4E2Q A;  3HQU A;  1NT0 A;  1GZW A;  3AMP A;  3AYE A;  5SV5 A;  2Q8O A;  2WZR 3;  3PVO A;  1ZM1 A;  1RVF 3;  3MBW A;  2PHD A;  3N35 A;  4HFS A;  3N7J A;  5CBL A;  1GU3 A;  1EV1 3;  4KBZ A;  5DG1 A;  2Y34 A;  2E31 A;  4NRO A;  1W6M A;  1P8J A;  2UWC A;  5B4N A;  2DCY A;  3AXE A;  3IB3 A;  3JBG 2;  1LGB A;  2BVV A;  4P9Y A;  1H9W A;  3A0K A;  4L9B A;  1I3H A;  5LBB A;  1TZO A;  2JE9 A;  1Q8O A;  2ZGM A;  1WLD A;  2DVF A;  4JKL A;  3MF6 A;  1BEV 2;  4K21 A;  1JYW A;  1Q43 A;  2BBA A;  3S5Q A;  1G9D A;  2JB4 A;  2ZX0 A;  2YC4 A;  1QHD A;  1FV3 A;  4AWD A;  4ERO A;  3PUS A;  3ZN6 A;  3LOB A;  2W47 A;  1H1I A;  5EWS A;  1SCR A;  1PIV 2;  3FHI B;  2R32 A;  4NWW A;  1LEC A;  4J6G A;  5FXV A;  5FZC A;  4ITC A;  1KQR A;  2ZGN A;  2UWA A;  5CYY A;  1VAV A;  2VTF A;  3M3O A;  3U14 A;  2LTN A;  4TZD A;  2D6O X;  1UOG A;  1WZX A;  1SBD A;  1UOB A;  1ZRI A;  2ZA9 A;  1IS6 A;  4P00 B;  4C0B A;  1LOG A;  1TNR A;  5LW9 A;  2VMF A;  2MNG A;  3J8F 3;  3PIG A;  4J25 A;  1HN0 A;  2HWC 2;  1VAK A;  5C8C C;  1V6N A;  2ORX A;  5FP9 A;  4B3N A;  4S2G A;  2D98 A;  4HBN A;  2CSG A;  4GJY A;  4RS5 C;  1U5Y A;  2D5F A;  4IEP A;  4RR3 A;  4NID A;  5FUN A;  3LWC A;  1VR3 A;  5ABJ C;  1OXC A;  1BBT 2;  4XUQ A;  1REE A;  5FDB A;  3VBU A;  2LRP A;  4FAG A;  1AYM 1;  4JTN A;  1GFF 2;  5KWR A;  2IXK A;  1S0J A;  3AZZ A;  3K4Z A;  1QOO A;  1COV 1;  1W9W A;  1RUC 3;  1HRI 3;  2W87 A;  4ZU4 A;  5FTT C;  4PCR A;  5JOY A;  2D3R A;  2I07 B;  3RQ0 A;  4MLO A;  2RS5 3;  3ZN4 A;  3NNL A;  3USU A;  2HYK A;  1LHV A;  3KT4 A;  4ASL A;  3ZXA C;  5AC9 3;  5C3Q A;  5LK7 B;  1BQP A;  1H2N A;  2VZ1 A;  4PF5 A;  5FZE A;  4AVV A;  2GU9 A;  4K1Y A;  2IUW A;  2O8Q A;  2OUJ A;  3AFK A;  3MFA A;  5DPN A;  3LD8 A;  4ET7 A;  5A1A A;  4NIG A;  2LUW A;  3H1M A;  1FNZ A;  2DVA A;  2HWB 3;  3CEW A;  1UYX A;  4PQQ A;  5G05 L;  4MUV A;  4P9W A;  3RWK X;  3POJ A;  3CJX A;  3LF7 A;  2QDR A;  2OZ6 A;  3LB9 A;  2Z69 A;  2XJU A;  2BTV C;  4ZY9 A;  3JUU A;  1GNH A;  3OY8 B;  4QQ2 A;  3EBR A;  1O7F A;  4HT1 T;  1PNF A;  4BK4 A;  1CVN A;  3H7J A;  3LGR A;  4HXC A;  1LOE A;  2DVG A;  4Y22 B;  3M8L A;  4H14 A;  3ZOI A;  4O7X A;  4XFI A;  2CDO A;  3K51 A;  2JDP A;  1UY3 A;  4LHS A;  1FOD 3;  4Y3O A;  1VRB A;  1OPM A;  3LE0 A;  3RI8 A;  5KXD A;  4P02 B;  3S57 A;  3GJA A;  3RI9 A;  1W0P A;  5C6C A;  5F3E A;  2VL4 A;  4KWJ A;  1DGR A;  2BWA A;  4IV3 A;  4PLM A;  1SBE A;  1UMH A;  2IXL A;  2HLE A;  3D3A A;  4HVO A;  4F83 A;  3ACG A;  3E6B A;  3MIB A;  4HZF A;  1HRI 1;  4UXA A;  4IGQ A;  1SQ4 A;  2QDN A;  3MHZ A;  3GF6 A;  3ATG A;  3PVB B;  2XL7 A;  4K1Z A;  1O91 A;  2FMY A;  4M3C F;  1A34 A;  4PI0 A;  4ZZ8 A;  1W3V A;  4KQ7 A;  3WF2 A;  4X6Q B;  4NN0 A;  3ZFG C;  2OZJ A;  1XE7 A;  1UY2 A;  5FYU A;  2A3W A;  3NV2 A;  1VBE 1;  5HPO A;  5EFU A;  4BIF A;  4CDU A;  2VOX A;  4QX3 A;  3PME A;  4D69 A;  1F4A A;  3AZV A;  4ZXK A;  3AKR A;  1RUD 3;  2X5I B;  5A3M A;  2RMU 3;  1QKQ A;  3DN7 A;  1IKP A;  2K9Z A;  4GWJ A;  2J1T A;  4DO0 A;  4HVR A;  5JR2 A;  1AYN 3;  4UOJ A;  3SH5 A;  3EQE A;  1JOP A;  4LIV A;  4QHZ A;  5FCC A;  4Q4X 2;  1FMD 3;  2WWS A;  2HBT A;  2IFW A;  1I5Z A;  3LFM A;  3OOX A;  4IGO A;  4LUL A;  5KXC A;  3WDX A;  3GJB A;  5F7U A;  1A8M A;  2BER A;  1KS4 A;  1QF3 A;  4GA9 A;  3E1F 1;  2ZAA A;  2XBO 1;  2ZJC A;  3BOW A;  3IKW A;  2ZML A;  3NAP A;  4QGM A;  1G9B A;  1JZ8 A;  1OUR A;  3NNF A;  1AJK A;  1YWK A;  2TUN A;  1J3R A;  1HXS 3;  1IG3 A;  4O9G A;  5FZO A;  3WNM A;  3ZKY A;  2E33 A;  1VBD 1;  3FL7 A;  4JVA A;  4LR4 A;  1VBA 1;  1GP4 A;  2AGS A;  2FCV A;  2CDP A;  2EXI A;  3FMG A;  5JUV A;  1DHK B;  5JPM B;  1LU2 A;  3ABZ A;  4BIS A;  2V73 A;  1CQ9 A;  4PDW C;  1ODN A;  1C8N A;  2HWB 2;  2VNR A;  2VAU A;  5FIX A;  2HWD 1;  4ZS2 A;  4XXP A;  3GDB A;  1IGO A;  2WZ8 A;  4IEQ A;  1VMF A;  1W05 A;  4Y20 A;  5A7P A;  4JGZ A;  1GUI A;  4QQL A;  3WXP A;  1IZ3 A;  1AR9 3;  1CAX A;  5EJ3 A;  4AI3 A;  3FWE A;  5FPV A;  1ENR A;  5KHI A;  4E8C A;  5JDB A;  4CUA A;  1FI2 A;  1S0G A;  1H6X A;  1TMF 1;  2VC9 A;  2IWG B;  2X10 A;  4LK7 A;  4PIX A;  3TN9 3;  2A6X A;  2P4E A;  1HQL A;  2B46 X;  4QGN A;  5FKC A;  1QJU 3;  1ULD A;  1S0D A;  1E5R A;  5FRE A;  3O1U A;  4AHX A;  2ERF A;  4OI2 A;  3CIH A;  1RUC 2;  4NO4 A;  2QQV A;  4DY5 A;  3O1V A;  5FPL A;  1GWM A;  3NO8 A;  1NCQ B;  5LRR A;  3VN4 A;  3ZSJ A;  3RFR A;  4S2F A;  2C1F A;  5IHR A;  4LBO A;  1W8H A;  4N53 C;  2ZPX A;  1POQ A;  2RR1 3;  4LOT A;  4D7S A;  3VDC A;  1KJR A;  2GDF A;  3DEC A;  4O61 A;  2R06 1;  1GNY A;  1NUK A;  1YRZ A;  3OYW B;  1QJY 2;  3OGG A;  5J96 B;  1VE0 A;  1SLI A;  4DOU A;  1LNS A;  1EAH 1;  4M00 A;  2VD7 A;  5B4X A;  4XMI A;  2HWC 1;  2O0O A;  4L97 A;  2KA3 A;  4QKD A;  1QJZ A;  4JCK A;  3BPZ A;  1ZVF A;  2FHR A;  3CJI A;  3KSC A;  4JHT A;  4QXC A;  1MVQ A;  3BU0 A;  4XFC A;  4EWE A;  3THP A;  4QPG B;  3C7O A;  4LBN A;  1WD3 A;  4Q4Y 1;  3BB6 A;  3K46 A;  5E1R A;  4X6R B;  5A7W A;  4BZ4 A;  4C0H A;  2XPJ A;  4NRM A;  1ACC A;  2AAC A;  2V4V A;  2XJS A;  4AFM A;  4BHP A;  5AVA A;  4XXA A;  2RHP A;  3CJI B;  4I0B A;  4K8F A;  2A5Z A;  4MO3 M;  4QPI B;  4S2D A;  1F5J A;  2BP6 A;  4UAP A;  3S6P A;  1O5L A;  2RS1 2;  5LEK A;  4Q4V 1;  4HET A;  5F5C A;  4DPN A;  2WFF 1;  3S5A A;  4YVS C;  1QJY 3;  4LTA A;  5EYY A;  3ZXE A;  4DB5 A;  3MLJ A;  3H8U A;  5HCF A;  3B5L B;  5L7O A;  2ZGR A;  2IC1 A;  3SHR A;  3T2Q A;  3ZXK A;  3U4X A;  5HCH A;  4AI0 A;  4XYX A;  1WMF A;  5EJZ B;  1VBE 2;  2J1S A;  4WVM A;  3IZO A;  3MID A;  3VZN A;  1PM7 A;  4BQ5 A;  2HBU A;  1R08 1;  3ECQ A;  4LQR A;  3VZL A;  1RMU 2;  5HBA A;  3ZYB A;  2RS3 1;  3I2F A;  3ZXF A;  1ENX A;  1S2K A;  5BNO A;  4QPI C;  5EJ1 B;  4P9X A;  4QDS A;  2WFP A;  5KXB A;  2R0H A;  4A4A A;  5FPU A;  4AGR A;  1AR7 1;  3DYM A;  2Q8E A;  1UAI A;  1XSR A;  1NXD 1;  2XLA A;  2ZMK A;  1F9K A;  4TLF A;  3LPG A;  4FI9 A;  1HW5 A;  1YQC A;  3FLR A;  4QU2 A;  3UKV A;  1TVG A;  4QDQ A;  5FXZ A;  4H55 A;  5FMO S;  4CDQ B;  1CAW A;  1SAC A;  1CR7 A;  1YIF A;  1OI6 A;  4AED B;  2JG8 A;  3DF0 A;  3IMN A;  1LCL A;  3VL9 A;  4A3X A;  5L9V A;  5FV3 A;  4ASK A;  1VBA 2;  1VAM A;  1W99 A;  1FMD 1;  1F5F A;  1JXN A;  1VRH 3;  1DLL A;  1G8W A;  3O1P A;  1NLR A;  4LUK A;  1DLC A;  2OII A;  3H8R A;  3RS6 A;  4AFD A;  2B39 A;  4COV A;  2JDM A;  4C91 A;  5EPA A;  3OGJ A;  1RUI 1;  5CG8 A;  4IE6 A;  5FPZ A;  1N1T A;  1ND2 B;  3CO2 A;  2FDJ A;  2VOT A;  4BMB A;  5BY5 A;  3OBT A;  2R49 A;  1QQP 1;  3MV0 1;  4J1X A;  3O0X A;  4DIQ A;  1CJD A;  2CY6 A;  3UNP A;  3NAP B;  1WA4 A;  3VZM A;  4R9A A;  2GC3 A;  3CF6 E;  5DDJ 2;  2BQP A;  1SZB A;  1SFN A;  3W9A A;  4AG4 A;  2ARB A;  4HOO A;  1JN2 P;  2LS6 A;  5F2W A;  5J98 B;  2LRO A;  1YO8 A;  3VDA A;  4HLT A;  4W8J A;  1RJ7 A;  1UKR A;  3OEA A;  1QDC A;  3MIE A;  2V09 A;  2W2I A;  4EN0 A;  5A6X A;  3T2P A;  1ZRE A;  4JZR A;  2R1D A;  2AUY A;  4AW7 A;  3AL6 A;  3VD9 A;  5K0U A;  2FD8 A;  2PAK A;  1NCR C;  4TWT A;  2HWD 2;  1ENQ A;  2D6L X;  1AR7 3;  1W6P B;  1OT5 A;  1UYP A;  3RNS A;  4CCE A;  3Q8E A;  5CG9 A;  1IQA A;  5F1R A;  3BTZ A;  2QQM A;  4NRP A;  2RS3 3;  2ENR A;  2C9A A;  3BUC A;  4ZU5 A;  4IET A;  1OKO A;  4Z07 A;  5FPX A;  5ACA 3;  2E51 A;  4TYS A;  3DKQ A;  2R30 A;  3BTX A;  5DN2 A;  5J3U A;  3UGH A;  1GYK A;  2OPW A;  2JDY A;  2DVD A;  3GNE A;  3PHM A;  1IPS A;  2EF6 A;  5FXW A;  4QX1 A;  3ZFE B;  4AED A;  1JUI A;  2DTW A;  3LIH A;  4MAD A;  4WZC A;  3NWK A;  4JDN A;  5LEJ A;  4XIL A;  4Y22 A;  4A6O A;  1SDD B;  1F2N A;  2YV8 A;  5A3O A;  4ES8 A;  3OEB A;  1A8D A;  2VZS A;  4CTE A;  2WA4 A;  5T5O A;  4NHK A;  3OSD A;  5C5U A;  4FPF A;  1PVC 3;  3I59 A;  3PJY A;  3VBO A;  2FZ1 A;  1UWW A;  3H8O A;  1ZRR A;  1UXZ A;  3Q8C A;  4A2U A;  1QOT A;  3HN1 A;  3LA7 A;  4I09 A;  2VVE A;  3AYC A;  4G3Y C;  3HIF A;  4XDO A;  3T2O A;  4CXY A;  4GH4 B;  1FAT A;  1HXS 2;  5JWP A;  2XUE A;  3HR9 A;  5LRS A;  1B09 A;  4Z2W A;  2PEL A;  2QQW A;  3C7F A;  2RS3 2;  1Z7S 3;  1QU0 A;  5T52 A;  3KMH A;  1SG3 A;  4KNC A;  1OSG A;  1FT9 A;  1H1M A;  1H4H A;  4IE0 A;  3FBM A;  4NWV A;  1E57 A;  3HBZ A;  4CSW A;  2B45 X;  3JXS A;  4OZX A;  5A32 B;  4AFC A;  1BMV 2;  1R64 A;  4UFK A;  2PQQ A;  3THT A;  4GKX A;  5C5T A;  3VD4 A;  3RYP A;  3MIH A;  3CJI C;  4HL0 A;  5FY4 A;  3IWZ A;  2ID4 A;  2RDN A;  2J1V A;  1HN1 A;  2Z2S B;  4RGA A;  4JHZ A;  3RWN A;  2VR4 A;  1PNG A;  3W5M A;  5DXD A;  1RJ8 A;  1K45 A;  1JZ5 A;  1NKG A;  3CHX A;  2YXS A;  3O14 A;  1IS3 A;  2G9F A;  1OLM A;  2Z79 A;  3FHA A;  3AMH A;  5T5P A;  1UX7 A;  2DF7 A;  5D2A A;  3AKQ A;  3BN6 A;  4RHV 2;  3WNK A;  4BYY A;  3HJR A;  4CDX C;  5BNO B;  1YIP A;  3AXD A;  3BU7 A;  4XFA A;  4UBG A;  1EV1 1;  2QJV A;  4HKL A;  4BIO A;  5FY8 A;  2E63 A;  1MS0 A;  5CZK A;  4UBH A;  4CXW A;  1UU4 A;  3KB5 A;  4YG6 A;  3H50 A;  1LGC A;  5FZA A;  1S2B A;  5IFP A;  3BAL A;  2P37 A;  4P14 A;  1B35 A;  5FYZ A;  4B8E A;  2WBK A;  2W1Q A;  4XCB A;  1CPM A;  1AZD A;  4Y1Z A;  4OI0 A;  1QY4 A;  1UPS A;  1OQ1 A;  1U5X A;  4QPI A;  4XFH A;  1VJ2 A;  2IXI A;  5AVP A;  4CEW B;  1WCD J;  1ULF A;  1OLQ A;  4XMA A;  5DAW A;  4A42 A;  2BVB A;  3NAP C;  2QE3 A;  1QH6 A;  1W6M B;  3OUI A;  5GZF A;  3B00 A;  3TBD A;  4WVZ A;  1RUF 1;  2GP5 A;  3AYD A;  4DY3 A;  3IMM A;  4QQO A;  4AHZ A;  4AHY A;  2MEV 2;  2X53 S;  1UX6 A;  4JKM A;  5AFE A;  2QQP A;  2PA7 A;  3PUR A;  4MGQ A;  4Q8L A;  3N9Q A;  4AVB A;  1O3T A;  5IUQ A;  1K5M B;  1Y3T A;  2WWJ A;  2XL9 A;  5BPX A;  4CCN A;  2JE8 A;  4Q0V A;  2F6B A;  1CWP A;  2ZOE B;  4PDW A;  4JRA A;  2Y6J A;  3OBA A;  4N53 B;  1QQP 2;  4N43 A;  1AYN 1;  4QKF A;  4P9I A;  3NMB A;  3NST A;  5FQ0 A;  4JGZ C;  1ZZ6 A;  1JHN A;  2ZZQ A;  4LO6 B;  4WM7 C;  3LFI A;  4YLZ A;  1W2O A;  1EUT A;  4LOS A;  3V0A A;  3E6D A;  3KCX A;  4NII A;  1W6Q A;  5HI0 A;  1RIR A;  2QQL A;  5FZ6 A;  5A6Y A;  1WW5 A;  5A6Q A;  3AP9 A;  1LOF C;  3OPT A;  3RJR A;  1V9U 3;  1WW7 A;  4WBB A;  4V2W A;  4BK5 A;  2IVJ A;  5F5I A;  2BW8 A;  2AEN A;  3FBY A;  1X36 A;  2HWF 1;  1LR5 A;  3MZH A;  3H0O A;  2QUO A;  4JAA A;  4YSF A;  3O1T A;  1V6J A;  4MSV A;  5L73 A;  3RVH A;  3U78 A;  4Q4W 1;  1N3Q A;  1GBG A;  4J1W A;  1GZ9 A;  1UZ0 A;  1AR9 2;  4IE4 A;  3AP6 A;  4WVV A;  2GZW A;  4FOW A;  4YPJ A;  3TYJ A;  2JKB A;  1JBC A;  1C1L A;  3C7E A;  2BNM A;  1WW4 A;  1ULE A;  2XQR A;  5GKA C;  3E5Q A;  4EN7 B;  5M0T A;  2X5I A;  2E26 A;  1CGP A;  3WOG A;  2VPV A;  2BZD A;  3VBS C;  2EAA A;  4XVH A;  3T09 A;  1RED A;  1IKQ A;  2GC0 A;  3NW4 A;  4URA A;  1D0G A;  4EZH A;  5JCT A;  2W1S A;  1AX2 A;  3AM2 A;  1CZS A;  2VQA A;  1NCR A;  2RS5 2;  3B9I A;  4COZ A;  3RRD A;  3WR0 A;  4YNI A;  3NRU A;  1ZBA 2;  2FDK A;  2HKX A;  1JTZ X;  1XU1 A;  2QQU A;  4PQ9 A;  1ZX5 A;  4MGZ E;  1QJU 1;  2WLQ A;  3OPZ A;  4A7K A;  5FZO B;  2VQU A;  2CU5 A;  3DPR B;  3NJV A;  4MGI E;  3RMY A;  4CP2 A;  4A3Z A;  2H0V A;  1NAE A;  4N43 C;  4ZKT B;  5I91 A;  1MZ6 A;  5FYT A;  4LBK A;  1PMH X;  2CV6 A;  4CEY C;  3AKS A;  3OUH A;  1SPP B;  1XND A;  3WP6 A;  1XU2 A;  4P9J A;  1ULO A;  5FZD A;  2XUM A;  4XF4 A;  4XDQ A;  1FOD 2;  1RUC 1;  1PM4 A;  1KDK A;  2DUR A;  2QQN A;  5EYX A;  3UT0 A;  3SMH A;  1W04 A;  3ZYJ B;  1PVC 2;  1ND3 C;  1PK6 A;  1POV 3;  2XKP A;  2GH2 A;  4XF0 A;  4CDU B;  3V65 A;  3R05 A;  1Y9G A;  2R06 2;  4C8D A;  3PLQ A;  4QM8 A;  5FO9 B;  4CPB A;  2IVI B;  1C3H A;  1D7P M;  4QDR A;  4AGG A;  4LKD A;  2JD4 A;  1PGS A;  1FPN 3;  1J1T A;  5CFC A;  2NP0 A;  1YI7 A;  1GOH A;  1O5U A;  1OQD A;  5GLW A;  4LOR A;  3I2O A;  2VGD A;  4HMZ A;  1A3K A;  1J1L A;  1D4M 2;  1J3Q A;  3O0V A;  5D8A A;  2CGO A;  4RQP B;  2W08 A;  2ARX A;  1CZV A;  3PMS A;  4HN1 A;  5E6H A;  4YVW B;  3WD5 A;  3WVJ A;  2XB6 C;  1VMH A;  2QQI A;  2YC2 A;  5IVF A;  4IV3 B;  5CVR A;  4IL7 A;  2DU0 A;  4W50 A;  4HSJ A;  4Z1V A;  3KVA A;  4OI4 A;  2YU1 A;  4FOY A;  1VB2 A;  1AVB A;  5FZF A;  1O3R A;  1TME 2;  3ZDV A;  3VKL A;  4XF9 A;  3N9N A;  3AC0 A;  2C6S A;  1LES A;  3LEG A;  4IE5 A;  1WCU A;  1GP5 A;  5JAX A;  2VMH A;  3R0R A;  4W4Z A;  1WUV A;  1Y9Q A;  4DRR A;  2Y26 A;  3SXW A;  4OHV A;  1EY2 A;  4Z92 B;  2PFW A;  4XPV A;  5FLJ A;  2WZP P;  5CA6 A;  5C9A A;  4ZZ5 A;  5AC9 2;  2RG4 A;  3QH7 A;  3TN9 2;  4AVC A;  2Y0I A;  3A23 A;  2XBO 2;  5JSR A;  1ALY A;  2PYT A;  2XHK A;  4GAZ A;  4JDM A;  4IER A;  2E7A A;  2QQO A;  3IAQ A;  1JZ7 A;  1OUS A;  4R8H A;  4NHL A;  1VBD 2;  4GAL A;  5JI7 A;  1AL2 1;  5C3P A;  3DYP A;  4FTB A;  1W6O A;  3R4D B;  5BNN A;  3VKF C;  1VBC 1;  5F8P A;  4M0N A;  1G86 A;  2VUA A;  1OFS A;  3MV1 1;  3J7N A;  4RGK A;  4KI5 M;  2HWB 1;  1OOP B;  1XE8 A;  3VD3 A;  4AI9 A;  2E9Q A;  1R08 3;  3GM8 A;  4Q0S A;  3POG A;  4KGG A;  1EYB A;  3J9S A;  4PIY A;  1YFW A;  1RVF 2;  3W21 A;  2YU2 A;  2ZGQ A;  3OD4 A;  2RS5 1;  3HQX A;  1RUN A;  2JD9 A;  4R52 A;  1POV 0;  4URT A;  1JU4 A;  1NQD A;  3I2J A;  2WFF 3;  2V4A A;  3WDU A;  4UW4 A;  1NE6 A;  4CCD A;  5HXV A;  1PMJ X;  4XAE A; 
#chains in the Genus database with same CATH homology
 5ANQ A;  4TN7 A;  4CCO A;  5FWJ A;  5FY7 A;  4GJY A;  4CCM A;  4QXB A;  5FYT A;  5FUN A;  5A7P A;  5KR7 A;  3KV4 A;  4Y33 A;  5FYC A;  5A7N A;  5FBJ A;  5FPV A;  5IVB A;  5FZM A;  3AL5 A;  5FZD A;  2P5B A;  4UF0 A;  5FY8 A;  4DIQ A;  5F3C A;  3K3N A;  5K4L A;  3DXU A;  5FZA A;  2XDV A;  5A1F A;  5FZE A;  2YBS A;  5A3N A;  3PTR B;  3LDB A;  5F2W A;  4HOO A;  5FPL A;  5FZ7 A;  5A3T A;  5A7Q A;  5FZ4 A;  3LD8 A;  4GD4 A;  4UF0 B;  4GJZ A;  5FYZ A;  4AAP A;  4C8D A;  3PDQ A;  4LIU A;  5FZ8 A;  5A80 A;  3KVB A;  3PUQ A;  2W2I A;  2Q8C A;  5IVC A;  4CCL A;  3NJY A;  5IW0 A;  2WWU A;  3AL6 A;  5FJH A;  5FJK A;  2VD7 A;  5FUP A;  5FZG A;  2GP3 A;  2GP5 A;  2OT7 A;  5E6H A;  3N9L A;  5IVF A;  4HON A;  5FZB A;  5F37 A;  4Y3O A;  3AVS A;  1VRB A;  5FZI A;  4E4H A;  5IWF A;  3PUR A;  5FPA A;  3KVA A;  3N9Q A;  4QXC A;  5FZK A;  5ISL A;  5FZ9 A;  2YU1 A;  5F3E A;  2WWJ A;  2XML A;  3N9O A;  5FZF A;  5F3G A;  3U4S A;  4CCN A;  5A7W A;  4EYU A;  4BXF A;  5LY1 A;  5FWE A;  3N9N A;  5A3W A;  4CCK A;  4IGQ A;  4XDP A;  5FY0 A;  4D6R A;  4CUG A;  2Q8D A;  5FP8 A;  3PU3 A;  5FZ1 A;  3K3O A;  5FY9 A;  3N9M A;  3PUA A;  5FZL A;  5FXW A;  5F5A A;  3ZPO A;  4QX7 A;  4V2V A;  5IVE A;  3OPW A;  2PXJ A;  4LIT A;  5FZ6 A;  5FYU A;  4QWN A;  3OPT A;  5F5C A;  5FY1 A;  2OQ7 A;  4V2W A;  2XXZ A;  5FZ3 A;  5F5I A;  5FYB A;  5FXX A;  4EZ4 A;  3UYJ A;  5IVJ A;  5FP4 A;  4GAZ A;  5FP3 A;  4CCJ A;  3RVH A;  3U78 A;  4DO0 A;  5FYY A;  4NUB A;  3AVR A;  4LIV A;  4QU1 A;  4LXL A;  4D6Q A;  4BU2 A;  4QX8 A;  5LWB A;  5F39 A;  5FYH A;  5A7S A;  4IGO A;  5F32 A;  3KV5 A;  5A3P A;  4XDO A;  2OX0 A;  3PUS A;  2XUE A;  4Y4R A;  5A7W B;  3KV9 A;  2OS2 A;  5FP9 A;  5FPU A;  5LY2 A;  2Q8E A;  4URA A;  5FYI A;  4EZH A;  2YBP A;  5FXV A;  5FZC A;  5FZH A;  5A7O A;  5FY5 A;  5CEH A;  5F2S A;  3K2O A;  3PU8 A;  4CSW A;  4QXH A;  5FXZ A;  3ZLI A;  5IVY A;  4AI9 A;  5IVV A;  5FZO A;  2OQ6 A;  2YBK A;  5FYS A;  5FY4 A;  4IGP A;  3DXT A;  5F3I A;  5FP7 A;  2YU2 A;  5LW9 A;  3KV6 A;  5FPB A;  3N9P A;  5FZ0 A;  5FZO B;  5FV3 A;  4ASK A;  5FYM A;  4D6S A;  4BIS A;  2YPD A;  5FYV A;  5A1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...