5A7WB

Crystal structure of human jmjd2a in complex with compound 35
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
346
structure length
346
Chain Sequence
b'LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAESCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 101
structure length 346
sequence length 346
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02373 JmjC JmjC domain, hydroxylase
B PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a7wB01
5IVYA 4EZHA 3AL5A 3AVRA 4IGQA 3KVBA 5A7SA 3RVHA 5F5IA 5LWBA 4CCLA 2VD7A 5FY9A 5FZOB 4BISA 5F3CA 5A3NA 5FZOA 5FZBA 2XMLA 5FZGA 5FZ3A 2OX0A 4UF0B 5FXWA 2P5BA 4XDOA 3LDBA 3U78A 2XDVA 4UF0A 5F3EA 4Y4RA 5FZAA 5F37A 3DXUA 3KV5A 3DXTA 3N9MA 3N9QA 4QX7A 5FZ7A 5FZEA 5FY8A 4AI9A 4CCJA 2XUEA 5A80A 4LIUA 5F2WA 2OS2A 5FP4A 5FYIA 3PTRB 4D6SA 5FXVA 4Y33A 5FYHA 5IVJA 4GJYA 3PURA 2OT7A 4QXBA 4TN7A 4BXFA 5FZ8A 4EZ4A 4CCMA 5FUNA 5FY5A 5FV3A 4CUGA 5FJHA 5IVCA 5K4LA 5F3GA 3PUSA 5FZKA 5FXZA 3OPWA 5A1LA 5A3PA 5FY1A 2WWJA 5IVEA 5FWJA 3N9LA 3PUQA 4GD4A 2YU1A 4D6RA 5FYZA 4HOOA 4URAA 5A7QA 5F5AA 5FZ6A 3AVSA 5F5CA 4Y3OA 5FZ4A 4CCNA 4QWNA 5A7PA 5IVVA 4GJZA 5FBJA 5IVBA 3N9NA 4LIVA 4V2WA 5F2SA 5CEHA 3OPTA 4E4HA 5FYYA 2OQ6A 5FYCA 3LD8A 4QX8A 5FYTA 4DO0A 4CCKA 5FPBA 5A1FA 5A3TA 4QU1A 4D6QA 5FYBA 5FZMA 4V2VA 5FZFA 4DIQA 3N9PA 2OQ7A 5FPUA 4IGPA 5FPLA 3KV6A 3UYJA 5F39A 5FYVA 5IW0A 4AAPA 1VRBA 4BU2A 5IWFA 3PU8A 5FZ0A 5FPVA 4ASKA 2Q8EA 3ZPOA 3K2OA 5FZCA 5FJKA 4IGOA 5FP8A 5FZDA 3N9OA 5FZLA 4QXCA 4QXHA 5A7NA 5LY2A 5FY7A 5FUPA 2YPDA 5F32A 4EYUA 5FXXA 4NUBA 2YU2A 5A7WB 2WWUA 3ZLIA 3K3NA 5FP9A 3AL6A 3PDQA 2PXJA 5FP3A 5A7WA 5ANQA 4CCOA 3U4SA 5LY1A 2W2IA 3PU3A 5FYSA 4LXLA 5FZ1A 5FZIA 2YBKA 2Q8CA 5IVFA 5FP7A 5FY4A 4LITA 4XDPA 3KV4A 2GP3A 5FYMA 3PUAA 5F3IA 5LW9A 3K3OA 4C8DA 3KV9A 4HONA 5FY0A 5A3WA 5A7OA 2YBSA 4CSWA 5FYUA 5KR7A 2GP5A 5FWEA 5FPAA 3NJYA 2YBPA 5ISLA 4GAZA 2Q8DA 3KVAA 2XXZA 5FZHA 5FZ9A 5E6HA
chains in the Genus database with same CATH superfamily
5FO7B 4L2NA 3GHNA 3HQXA 3IMNA 2WNUB 2RM23 3NV2A 4FCAA 2PHTA 2FD8A 3BTAA 2N7GA 4LK6A 1YJLA 1KXGA 4AHXA 3VDDB 1YIFA 2P37A 4DINB 1AYM1 1ULEA 4PBPA 1J84A 2W1WA 5FZGA 3VD3A 5B4NA 2WC2A 1LHNA 4CDUC 1LGCA 2ZGSA 3U11A 2GC3A 1YQ5A 4Z2WA 4QPIA 4HPKA 1QOOA 3DXTA 3A4UA 3GDBA 3R4SA 4QX7A 1JZ5A 5FZEA 4Y1UA 1ZZ8A 4ZPIA 1PNGA 3O1MA 5CZKA 3G7DA 4AHWA 2VH9A 1S4CA 3PUIA 4R9DA 1H2NA 1XRUA 4Y33A 1RGSA 2Y60A 4J1WA 4M4PA 4AI3A 2FDKA 1VBA3 3GXUA 2OT7A 4R9BA 2VQUA 4H55A 5A3LA 1A34A 1ZZ9A 4CUGA 2FCTA 4TYSA 5FJHA 5C3OA 4YM2A 5HI0A 3VKNA 2C9AA 1DZQA 3C7HA 1PIV2 2FZ1A 3M2MA 3Q8BA 1RIRA 2ETEA 2BBVA 1FPN3 3LGRA 1LESA 2QTWB 4C1WA 4NO4A 2A3YA 2FDGA 1SDDB 3AP5A 4IV3A 4AF9A 3JD73 3Q8EA 5FZ6A 1CX4A 1M4WA 4Q4V3 4C90A 3KSCA 4CU8A 4QWNA 1GZTA 2PN5A 2VMDA 5J3UA 1TME2 2JKBA 5AC92 4GWJA 4J1XA 1V6IA 4E9KA 4CCEA 1RUF2 4LBQD 4Y20B 2OQ6A 4LMFA 4QX8A 2J1AA 3HWJA 3WDTA 2VTXJ 5C33A 1CPMA 1JW6A 3GYDA 3OF1A 2HKXA 4WBBA 3HN1A 4OVEA 4IXLA 2YFZA 3UL2A 1OD5A 3N9PA 3CDZB 4ZS3A 3H0OA 4Z1VA 4COUA 1K5MC 3VBRC 5ABJC 1QJFA 1FPN2 5I8YA 3INAA 2VZOA 4D7SA 3POFA 1EPZA 3CJIA 1H9PA 3W59A 4E4ZA 3AYCA 3FFQA 1LOFA 2XJRA 3NV4A 3JD72 3MF6A 1YQ2A 1YLLA 5FZCA 4RR3B 2GH8A 5A32A 1C3HA 1HB3A 2JG9C 4MG2A 1VIWB 2CWMA 1ZZ6A 5DG2A 5C3RA 4AVBA 1ST8A 3H1YA 4BYYA 1OURA 2W52A 4KWLA 3LEMA 3MLKA 4XDQA 1IQDC 5BNNC 1L3JA 4MGYE 2R49A 5L7OB 3VBFC 1GZCA 1ZRRA 4I0BA 1O8SA 3U75A 4CP9A 4XFBA 1FX5A 2XG3A 4META 1EYBA 4CDXA 4FXKB 1IG0A 4MXWB 1G86A 1ZRFA 4TLFA 2XHNA 1H8VA 3THPA 5DAWA 2HWF3 1PK6A 1U5IA 3DGTA 3MPBA 5FWEA 1AR73 5FAXA 5FDBA 3NV1A 4OLLA 1W0NA 1ZBE3 2MPFA 2AGSA 3LQCA 2TBVA 2CAVA 2WO7A 2Y6HA 2XL7A 4JKKA 2ZBJA 4IE4A 2AENA 2VMEA 1VBC2 1XNTA 2KM2A 4FQ4A 3VBSC 4ZU4A 1NQJA 1S0GA 3WF1A 4Y4YA 4LBMA 4XE9A 2ZX2A 2VECA 3I59A 4CVUA 5FK7A 3N36A 4CDUB 1FAYA 5FZBA 1ZREA 1UY2A 4RQPA 2WABA 4L8QA 4FPHA 5HV0A 3BN6A 2VMFA 5D8AC 1UOFA 4EN6B 2ZHKA 4HN0A 1ASJ1 1O3SA 3UK9A 1J3PA 3WY6A 1RUE1 1WZXA 2VZPA 3PVEA 1UU6A 2EIDA 3ZO0B 5C70A 2E7QA 2VJXA 1GOHA 2B39A 3DL3A 4I01A 4DUXA 4KH9A 1YEWA 1K3IA 1ZBE2 2A70A 3HN3A 4GMP3 1MS0A 4HETA 4FOYA 2P6CA 3A22A 5FYHA 5JUVA 1SCSA 4FTSA 3D5OA 2DYCA 2VPVA 4YG0A 4ZHNA 4BXFA 4OUEA 1RMU1 1YNAA 2UY8A 3POSA 4LO4B 3UT0A 3ZFEA 2KXLA 2WS93 4C0BA 1QHDA 3WCRA 1SLIA 3MW4A 4JRLA 1W6PB 2JICA 5KC6A 1SLCA 3WEZA 4FTBA 1BMV1 1HKDA 1IKPA 4MGIE 3AZZA 2D6KA 4N43A 2QQOA 2IC1A 1RUI3 1PX3A 5JZGA 2MNGA 4FPOB 4LO6B 4AQSA 2R041 5DN2A 2VMGA 4R4ZA 1YI9A 3GZTB 2P4EA 4HN1A 1JYXA 2CGPA 1S0BA 5C8CC 3ILFA 4QQOA 2DCJA 1XB9A 4ZONA 5FYCA 1CIYA 1Q56A 2O8OA 2Q0AA 4CCKA 3IMMA 2VU9A 4QU1A 3WXPA 4D6QA 2BNOA 2WFF3 5TSWA 1K5MB 1UYZA 3H8RA 3VBRB 5ABJB 2WT0A 2DV9A 1PM7A 4IGPA 2WS92 5BNPC 3M8LA 5EYYA 3VD7A 1KS5A 2VNRA 3I2OA 4MXVA 3MFAA 1VBB3 2PTMA 2D6PA 5CNAA 1Y3TA 4KG0A 1VAKA 2XQRA 4AGVA 4WM8A 4PI0A 2ADEA 4XJ9A 1RUG2 1SHWB 2C5DA 2JG9B 1UX6A 2VOTA 3PMEA 4CDWA 3FJSA 2FMDA 2J1TA 4QXHA 3AKQA 2FDFA 1Y9MA 1NXMA 2CYFA 4WV8A 4E2QA 3LAGA 2LROA 5A7WB 1Q5OA 2HWD2 1POQA 1FNYA 1QJU2 1W8WA 1BLZA 3UJQA 3VBUA 3OUIA 5BV6A 2P3IA 3VBFB 4JGZC 2EXJA 1ENSA 3SH5A 1ULCA 1ND3C 5F6KA 1LB2A 2K9ZA 2IVJA 4NIAA 4QT6A 1CX1A 4XDPA 5EXOA 1QGLA 1U5XA 3O0XA 3WNOA 4A7YA 4XIKA 5LW9A 3K3OA 4PLNA 4MUVA 5IFTA 2HLEA 4OI4A 3KV9A 4P9XA 4RS5A 1AYN1 2PMWB 2GC0A 3FX3A 1OLRA 5F6LB 4OI1A 3VBSB 3VKOA 1TMF2 2YGMA 1W6MA 2WZR1 1UNBA 1K45A 4MGZE 3ZFGA 4JV4A 1KFXL 4WZFA 2EIGA 2RV9A 3MLJA 1MQTA 2G19A 4L99A 5FY9A 3UGGA 4F83A 5D8AB 1QNYA 5FZOA 3RZZA 2JENA 1H4HA 3H3LA 3HOBA 1VBD3 4GMP0 4KWJA 3WNMA 2EIBA 2VQ0A 3I54A 2BU9A 1EV13 4JQTA 4BIFA 3AXEA 2OZJA 2VNVA 1CAVB 1YQ6A 3B5LB 2FCVA 1HB2A 1MVQA 1R1A1 3N9MA 4FFFA 4WVMA 4QPIC 1NKGA 2FZ2A 1O8PA 1AXZA 1H8TA 4MHUA 4QMAA 1RXGA 4A2UA 1G9FA 1VRH3 3ZSEA 1YRZA 4A6OA 4LIUA 2ADDA 3D6EA 4M00A 5C5UA 1HJFA 5KHKA 4IUGA 1D2SA 1DU3D 3AB0A 1AL22 1O4ZA 2V73A 3ASIA 4QXBA 1XOYA 1PGL2 4P08A 4U2AA 1VB2A 4AEJA 3H1WA 3O0WA 3OUJA 5FOBB 2PFWA 2WWJA 5I91A 3SITA 1H6YA 1C1FA 5DUXA 3O1UA 4NIGA 4XURA 1GQGA 1S0CA 1MEC3 2ARBA 3M70A 5J98B 4XFFA 1OQEA 5F5AA 1OFNA 4IV3C 1AX0A 4KGQA 4E4HA 4BCUA 2XBO1 5C8CB 1NYWA 2WJSA 4JX0A 4AEKA 5DZEA 4D7YA 1GQHA 3WW1A 5CA6A 2XJSA 1HDKA 3ES1A 1FV2A 2JDAA 3WDWA 1LECA 5FYYA 4E4SA 2WYFA 4MYEA 5FYTA 3E6BA 2R063 3R4DB 1CZTA 1C8NA 5FLIA 5BNPB 1RVF1 3ZYHA 3JCIA 5IT6A 3JQWA 4Q4W3 2I07B 2ZTNA 3WHUA 1QNWA 1V9U3 4X6RB 3HJRA 1YQCA 2RG4A 5CKMA 1IPKA 2RDSA 2MHFA 3CJIC 3TNPB 1UXXX 1W04A 5KXBA 1LOFC 5GLUA 1US2A 1XNCA 3TOJA 1C8M3 1PMJX 1QEXA 5BY5A 1Z0HA 1RXFA 4XCAA 1S0JA 3MI8A 4JGZB 4RYDA 1QDOA 5KHJA 1HXS1 2QFEA 2OPWA 5DXDA 5FP3A 3RDIA 1JZ6A 2JE8A 3OOXA 4NE9A 5F8PA 1CWPA 2W2IA 2Q8CA 5GZGA 1S2KA 5EV7A 1BJQA 1VE0A 5JXIA 4QU2A 4AWDA 1DQ6A 3J9SA 4DZGA 1OXCA 3BCWA 4UI9L 3GZUC 4CPBA 1LJ7A 2D3SA 3V56A 3ZN5A 5GLZA 3ZYGA 4CDXC 4OMDA 3HMYA 4HZFA 3QD6A 3SMHA 4OHVA 3U14A 3WP4A 4AFAA 2YBPA 1PK6C 3D8CA 4N9IA 2X05A 2GH2A 4W8JA 1NCRA 4QKBA 3VBOA 4FP2A 1V0AA 5L36A 1IOAA 2EAKA 3AJYA 3AVRA 3VL9A 1TZOA 4AEDA 3NSTA 1I3HA 5CFDA 1YO8A 4Y1YA 5C4WA 2O8QA 2D3RA 2GC1A 3OUHA 1IHMA 2A75A 1WLDA 2XMLA 3LCPA 2BUKA 4LULA 4OUSA 4BQWA 3C7EA 4RQPC 4QPGA 4QPIB 1PO12 1COV3 4HPKB 4J6GA 3SLIA 1CPNA 2GMPA 2ZHLA 5F37A 1HLCA 2I2SA 4DUVA 1DGLA 4WZCA 2ZGTA 1LCLA 1B35B 3OCPA 1NUKA 1M06G 4XHBA 5KXEA 2JDMA 3V65A 5T54A 2IVIB 5FP4A 3IDCB 2UY9A 2HWD1 1WCQA 4PJYA 3SKVA 3A21A 1UZVA 1AXKA 4QQHA 3WOGA 3T2QA 3GALA 2VW1A 2IFWA 1O3TA 1CONA 4TN7A 1I5ZA 4KG8A 4E4DX 3DUIA 3FLPA 5A3MA 5F3GA 3MIBA 1GV9A 3PUSA 3ZFEC 1RUH3 5DPNA 1Q3EA 3PVNA 4IEPA 4LEJA 5A3OA 4PLMA 1N1YA 2VVEA 4MADA 2FHRA 3T3YA 1J1LA 1SACA 5KHHA 4AHYA 4PF1A 5IAXA 3LOIA 3WVJA 4JQRA 1ZBA3 3LOBA 4N43C 4FPJA 2DUQA 1CAWA 5A7PA 4WVZA 2ZMNA 5JZGC 1W2TA 1TMF1 2DVDA 3VBHA 5L9VA 4XF3A 5CEHA 1H2LA 5DZFA 1EAH1 1W2OA 3T0BA 3WLUA 4NPRA 3KQ4B 5C7GA 4IERA 1QWRA 1FYUA 2VMHA 1JTZX 2VAUA 4XF4A 4YZ5A 5FZFA 2WA3A 1RUD2 2ZPXA 1QJZA 2EXKA 2ZKNA 5LBFA 2VXRA 2PQSA 3HAGA 4A45A 5HXMA 2I45A 3D82A 1FI2A 2ATFA 1PO23 3BGAA 4LKFA 3MO4A 4E2GA 5JXGA 1UW8A 3CJIB 3OBTA 1SFYA 4XHXA 3TN91 5IWFA 1NA1A 3PU8A 4XF0A 2DURA 3LF7A 4IE5A 4LKDA 4LO7A 4YW1A 2HWE3 5CKQA 2R1BA 4TLGA 4D7TA 3K2OA 3NAPA 3AP4A 5A32B 1LU1A 2JX9A 4XPVA 4WM8C 1QJY1 5T5PA 4AGRA 3K51A 4CDWC 4UT5A 5J09A 4FFIA 1PGW2 2JD4A 3AK0A 2C24A 1VBE2 4QX3A 2DVAA 4YM0A 3POWA 4K8RB 4HK8A 1CGPA 3CMGA 3AL6A 4M3CE 4TZDA 4NAOA 5SV5A 4OI2A 2VNGA 4HBNA 2XWBB 5EWSA 2C1FA 2DBIA 1HV0A 1Q43A 2VG9A 4XMAA 3VBUC 4CP9B 5JSPA 5JOZA 1ULFA 2VXJA 4QAWA 1DQ2A 4XILA 4QD2A 2OW4A 2ARCA 3DYPA 1APNA 4YW5A 4CDXB 4MGQA 1PO22 2A3WA 2XOMA 5FO9B 1H1AA 1SDWA 4OHZA 1A8DA 2HJIA 1AJOA 1PK6B 1S2BA 3B94A 1OSGA 3ZM8A 3AMNA 3TEYA 4RS5C 4XUNA 2VVDA 2RDRA 2HYXA 3MEPA 1D0GA 2ZZJA 2ZMKA 4XFHA 5HBAA 2Y6LA 4YRDA 5DAPA 3VLBB 2QVSB 2R071 4MH0E 2H6CA 2RS52 4FFGA 2SLIA 3I59B 3IAQA 1KDKA 4KL1A 1NZCA 3NNJA 3ZFGC 2RDQA 2ZGPA 4RQPB 4O9EA 5A6XA 1MQTC 1CVNA 1OKQA 4K6BA 4Y1XA 5CAZA 1SG3A 4WM7C 2HEYF 2K46A 3U37A 4GKYA 4HXCA 2P17A 2EVXA 3HNYM 3OB8A 1OLME 1GKBA 1YUDA 5F3EA 4AEMA 2IUWA 2RS32 2Y0OA 4B4RA 3URFA 5FZ7A 4KBZA 4CXYA 1MACA 1WW6A 3PHMA 2GZWA 4KI5M 1HX6A 3SH3A 3R05A 5FK8A 4LLOA 3B00A 2ORZA 3NJZA 1R091 1LHUA 1QXPA 2CAUA 2GNDA 3IBMA 4GJYA 4CXXA 3V64A 1JYNA 2Q5TA 1N1SA 5LZ6A 1QJX2 3HT1A 5LA0A 4CEYA 4O65A 3ZSJA 1RC6A 1HRI2 3BALA 2GNTA 2XVLA 3POJA 5DAVA 5FY1A 4B29A 3HBKA 5FRAA 1DQ1A 2WBKA 4A41A 4QM9A 5FQ0B 1J59A 1C5HA 1D4M1 2NN8A 4Q8LA 3POEA 2YU1A 2W46A 4Q2FA 4N43B 2YDEA 4A4AA 5JZGB 1KGYA 4XUTA 5CBLA 4AW7A 3DV8A 2QKDA 1Z7S1 1VAVA 1SEFA 2VZSA 1BBT3 1BVVA 1AXYA 2UU8A 2VUCA 4GJZA 2G9ZA 4XZUG 3VDCA 5F2SA 1GYKA 4Q4Y3 3VKLA 3NL1A 2OA2A 1WBFA 1Q8SA 2RR12 4KBBA 5GJ6A 2HWB2 3ZXJA 5I8SA 3ES4A 4GB33 1AX1A 1LHWA 4IE0A 4HANA 4ASMB 2QNKA 1DG6A 3WG4A 5BNOA 4UAPA 2RDNA 4Y24A 4PDWA 4XBLA 4RHV1 3AZXA 5EPAA 2GNBA 3I2JA 4XW3A 3AZVA 5GZEA 1YJKA 3BOWA 1UY3A 4GQ7A 4CEWC 1HN0A 4WM8B 2VZQA 3VHPA 4CDWB 2A71A 4A6SA 1STMA 1LKNA 1OC1A 4NAMA 4YW6A 3T4HB 1RUC1 4K40A 2BNNA 1XU1A 2Y8KA 5KXCA 1OVPA 1JOJA 3SEPA 3C3VA 1OMIA 2RMU2 5FY7A 3VGIA 3WDUA 1BBT2 5F32A 3POBA 4OHXA 2Z2SB 3M1HA 4LE4A 4Q4Y2 4S2HA 3D0SA 3ELNA 4QQLA 5M0TA 3V0AA 4Q8KA 4YVSA 5T55A 2PXJA 1XNKA 1JZ4A 5GM0A 5FYSA 4LXLA 4Z92B 1WW7A 3IM0A 1A8MA 1X9TA 1HIXA 4I2OA 3L2YA 1ASJ3 1OLQA 3J7MA 4LR4A 1JBCA 1XE8A 2ZS6B 3I2HA 1PZ8A 1GWLA 2BGCA 3O14A 2JG8A 4RS5B 1BHGA 4K7JA 3EHKA 3TRSB 1JH5A 2YBSA 4XJUA 3SHRA 4EWDA 2HBTA 5KR7A 4H2AA 2WAOA 4P9WA 1WW5A 1G6NA 4B8EA 2WSVA 2NPIA 1O4YA 4P14A 4S2DA 1VLNA 3GF6A 1W39A 2JEMA 4NPMA 2GALA 5AVPA 2V5YA 3ZDVA 2VE1A 5FZHA 1HQNA 3I3MA 4HKLA 3VBOC 1RMU3 4FTEA 4O7XA 1PZ9A 3KVBA 1JMUB 1WCUA 4HSJA 4K1ZA 4OULA 5F5IA 1MR5A 4GH4C 2I74A 4AEDC 3LEIA 2J22A 3L9JT 4Q29A 3MDPA 4WM7B 5FZOB 1O3RA 4CA9A 5CFDC 5C4WC 4NIDA 1NAEA 5BXXA 2R30A 1E5SA 4FP3A 4ONUA 4P9LA 1XE7A 5FZ3A 2YPJA 2E7TA 4JKMA 2D40A 1HB1A 1ND2C 1X8MA 1H0BA 2O0OA 2PHDA 1VB4A 4BK4A 2X10A 3ORJA 1WD3A 2Z42A 4QPGC 2R7EB 1W9FA 3OGGA 2R043 4UBGA 3KV5A 4FPLA 4Y22B 3KF5A 1WCDJ 1W06A 2VC9A 4QB2A 4QKNA 3MIFA 1CAUB 4CCCA 1PGW1 3HQUA 1JU4A 4FOVA 5F2WA 2OS2A 3ZIWA 2J1SA 2VUDA 1AR91 2GMMA 2WO3A 3H1MA 3J8F3 2DUPA 3E5XA 5A33A 1QXRA 3USSA 4DRVA 5JXHA 1CAXA 3WW3A 2W1SA 3R0RA 4YVWA 1WKYA 1GNHA 4EZ4A 4LO8A 5IVCA 3JB8A 1DYPA 5FKCA 2MEV1 2VZ1A 3NNLA 3T0AA 5JAXA 4HVQA 5JI9A 1QXJA 4NHKA 5GZCA 5FYZA 4JTOA 3P6BA 4QKFA 4YNIA 3EXUA 1UZ0A 2JB4A 3RQ0A 3GCXA 3I3BA 2P3JA 4Y3OA 2WT1A 3DPRA 3RZLA 3M3QA 3MFCA 4H7MA 4RFRB 1W8OA 3RYKA 4BQ1A 3HBZA 4FPKA 1FMD3 2RHPA 1TE1B 2XGXA 3OPTA 3T1MA 3VBHC 1XNDA 2VZ3A 1V6MA 1NXD1 3Q8CA 3J8F2 4HVRA 2FMYA 4WVWA 4A3XA 5CISA 3KGLA 4I0WB 1SFNA 4WVVA 4OZXA 5FZMA 3ZXFA 1AZDA 2RM22 3QLQA 3VHOA 5KHGA 3OJBA 2VOXA 4I3GA 4CEWB 1BK1A 4NWVA 5F39A 5FYVA 2NM1A 5KXDA 5GLVA 1GOGA 4XXPA 5LK7B 1X9PA 2RS31 3OD4A 1AYN3 5HCFA 2JDNA 1OBNA 1DFQA 1GMMA 1OUSA 1NA1C 2Q8EA 3SCHA 4DNYA 5JLVA 1IS6A 4Q27A 2CDOA 1UY1A 2EF6A 4D8MA 2C9KA 3NAPC 4U36A 1RHI1 1KDMA 2VMCA 5JI7A 4LT5A 4LBQA 4HLTA 2QDRA 5GZFA 1GLHA 1UL9A 1UYPA 4LTAA 4BOWA 3H8XA 2VBPA 5C9AA 2WN2A 2SBAA 2XLFA 3LEGA 2JDUA 3UKNA 1HRI1 4Z8BA 1VBA2 1ONAA 4DS0A 2D98A 4GIQA 3AFKA 4YGCA 5FTTC 3ZXDA 1LEDA 2D7FA 2BWCA 2JDKA 1ULDA 1YHFA 3VHRA 3ENRA 2D93A 1R1A3 3SNMA 4A7KA 3DN7A 1SLBA 4ITCA 5A3WA 4CE8A 2ZCWA 5FYUA 1UOJA 5J7MA 4GWMA 3LSEA 4P00B 3VBOB 2Q8DA 4Q4V2 4PT6A 2UWCA 3POYA 4OI0A 2B4KA 2RR11 4FQZA 4GH4B 4HT1T 4AEDB 1SQ4A 4R9CA 5IVYA 4A7ZA 5CFDB 2DVBA 4IGQA 5C4WB 1REFA 5T3NA 3RVHA 3VZOA 2J1VA 4JC1A 3M3CA 1QQP1 4CUCA 5LWBA 4UOJA 2HWC1 3OG2A 1REEA 2WNVA 3IDBB 1ND2B 2YY1A 4NWWA 5HCAA 1SLTA 2BJSA 4XEZA 5J36A 2LW8A 5EYXA 2YYOA 3K4DA 3DCQA 2E32A 2ET1A 3AM2A 2W92A 3MHZA 4N53A 5KWRA 4RD7A 4UYBA 4E2SA 2CTVA 3A0NA 1QU0A 2XBO3 4FPFA 2ZX1A 3KB5A 4GALA 4QKDA 1F5FA 3T2OA 3WP3A 1PVC1 1SPPA 2FQPA 3IB3A 4L9BA 4AI9A 5DDJ1 3PUHA 1XJAA 4ATEA 4XQWA 5EP9A 1X33A 3CIHA 4NOTA 5CU1A 1F4AA 4EN7B 1RVF3 4X8PA 3AFGA 5FZ8A 1RUJ3 4ZZ5A 4Y5TA 3BOPA 2E31A 1E5RA 2VM9A 3ZKUA 3ZN6A 4SBVA 4CEYC 3TEZA 2D97A 2OUJA 2VQAA 2ILMA 3E5UA 3NW4A 4DUWA 1WW4A 1OOPC 2WLQA 4URAA 4FI9A 4YM1A 3IN9A 1SCRA 1AR83 1CAWB 5F5CA 1W6OA 4FPEA 5FIXA 2X5IA 2J1RA 3VBHB 1CQ9A 3EQEA 1GR3A 5ACA1 2HWF2 4I30A 1V6KA 4LOTA 5FBJA 1AR72 2BQPA 5JXJA 3LA2A 1HXS3 2PLV1 1FOD3 5FLHA 4AFMA 2A6ZA 2W94A 3ACGA 3WF2A 1LOAA 2ZEXA 2PQQA 5FO8B 5T5OA 3T0DA 1ENQA 1RUJ2 1GUIA 1GOFA 1GICA 3RYRA 2WNOA 4MHRA 5CFCA 1VALA 3HR9A 1DDLA 5BNOC 1MZ6A 4I02A 4MOAA 2Z4FA 1ODMA 3D4KA 1ODNA 4P9GA 4FAGA 1NA1B 4PDWC 4KWKA 5L73A 3KD4A 1HRV1 2JB8A 5B4XA 3NAPB 5T50A 5C3SA 1N1VA 1AR82 1GWKA 4RGAA 2E6VA 4YZ1A 1FXZA 1R081 3FLTA 3N9OA 5JSRA 3POGA 2XLGA 1F15A 4DOUA 2BFUS 3UNPA 1H2KA 1JUHA 1JOPA 1NY71 2KA3A 1AUYA 3CBNA 5FLJA 3ACLA 5BYNA 1FOD2 2B9UA 5EFUA 2E7AA 4MO3M 1K42A 3GBFA 4X8NA 3NKGA 3U10A 4YVSC 2YV8A 1KRIA 3BYWA 2BP6A 4DQAA 4DPNA 2W9XA 2QZ3A 3W58A 1GNZA 4PF5A 4UFJA 2P3KA 2XQXA 1PM4A 3TYJA 3GGLA 4I3PA 1W03A 1IKQA 1JZ8A 4LNVA 3RWNA 3QH7A 3RS6A 3MV11 1XSRA 1LHVA 2J1UA 5GALA 2JG8C 5LBCA 1O5UA 1WLCA 3ACHA 4W4ZA 5EQUA 1IS3A 5K0UA 3S6PA 4UFLA 4FPYA 1RUI2 4YARA 3GZAA 4TXWA 3S30A 2VUAA 3WDVA 1GZWB 4NVPA 1S2EA 4EZHA 5BNNB 2Q4SA 4K20A 4UXAA 3B02A 2XB6C 2KD7A 4XF9A 1DQ4A 4AGGA 1RL3A 1X36A 3D3AA 4LKEA 2WFF2 1PIV1 2QQWA 3I2KA 4FFHA 3N4MA 5H9SA 3O1PA 4AOCA 2VZRA 1W9TA 2YROA 2VOVA 3IT8A 2XDVA 3U4XA 4Y4RA 3ZXAC 5DZGA 4COYA 3WUDA 1YFXA 1VBB2 2VBDA 3KCCA 4IV1A 3WG1A 3MW2A 2JWPA 1PMHX 1TME1 1KQRA 1EAH3 2K0GA 3BU7A 4LK7A 5AC91 1T2XA 3ETPA 4IL7A 1UMHA 3LIHA 3WHTA 3ZR5A 1RUF1 1IQAA 5T5JA 4Q1RA 1JI6A 2R1DA 2XKOA 4CEYB 3X29B 3V0BA 1BQPA 2A1XA 4CCMA 3WP6A 4YVWC 3IIIA 5FZKA 1OOPB 1OD3A 5FREA 3TN93 1RITA 2Y6KA 4W6XA 5FMOS 4IEUA 1FPN1 1REDA 1V00A 3RI8A 4HOOA 4S2FA 1H4GA 1WA4A 4MVTA 4ZY9A 5A7QA 1LEMA 3ZVXA 4H7LA 1QJY3 5LB6A 4DXTA 1A3KA 1J1TA 3JD71 1UQXA 1BEV3 3AYAA 1XQNA 4GXLA 4LBNA 4BMEA 3OYWA 3O1SA 2RS13 5ERLA 3DPRC 5CADA 4JKLA 1AR63 3M3OA 4R8HA 4YW4A 3ZOIA 1XNBA 2DDUA 1P8JA 1T6GC 3DYMA 5KC5A 3ME2A 4DO0A 3WQ1A 3LB9A 1E57A 4BK5A 5BNOB 2EXIA 2D6NA 2BBAA 3UGHA 3WNKA 4AI2A 1UZZA 2XHKA 4NHYA 4PDWB 3LFMA 4NHXA 1R1ZA 3MUY1 3CZUA 4Q1PA 2ZABA 4AI0A 3AKRA 1UWWA 5IW0A 1FV3A 5JWPA 1VRBA 3ST7A 5A6ZA 4CTEA 1K5JA 1VBD2 4IETA 4FSJA 2WO1A 3AP6A 3FHIB 5L19A 1EV12 3TBDA 3T2TA 5I0DA 4NHLA 5A3UA 5GKAC 5FP8A 1BEV2 1V6JA 1ZA7A 2ZGLA 2ZGNA 1W99A 3CKHA 4I09A 4RGKA 4RL7A 3A0KA 5JR7B 5A7NA 5LY2A 3V0AB 2IXLA 1VRH2 2R073 4JHTA 2PHLA 1DBNA 1AR62 1VBC1 4AXOA 4R52A 1CZVA 3T2PA 1DGRN 1W6NB 3FUOA 2CNAA 1JOBA 1NCQA 4CCOA 3K75B 2AZ5A 2WNUA 5JIAA 5LY1A 5LRSA 1D0HA 3H9AA 5C9AC 2Y6GA 1Y7BA 2IXJA 4BQ2A 2WA4A 2VOWA 3QH6A 1AX2A 3B9IA 2ZXQA 3O1RA 3JBG3 2JKXA 2JG8B 1MZ5A 5DQ0A 5LK5A 4XC9A 4ZKTB 5JIUA 3LKJA 4AAXA 4DRRA 5IK5A 5JMOA 2EIEA 1MEC2 1AF9A 3ZMNA 2YXSA 1GP6A 3RZJA 2OXBA 3HVDA 1U0AA 2ERFA 3KVAA 5IHRA 3P3PA 3B7MA 4LHNA 1ZBE1 2DFBA 5KBFA 1KJRA 5FZ9A 4EJRA 1ND3B 1UF2C 1Q8OA 2CDPA 4Q0VA 4BHPA 2WN3A 2OIIA 4LE3A 4AFCA 1LR5A 2R062 2YC0A 4XBQA 2W1QA 2NQYA 2WNVC 4Y5Z0 2VOKA 4NMIA 1OA3A 2DCYA 3FN9A 2WKKA 2Q1FA 3RGBA 3LDBA 1VMHA 1S0EA 2AUYA 4N53C 4Q4W2 4PLOA 4UF0A 3ZPYA 1LHOA 1GZ9A 4IEQA 1Z7S3 1UY0A 3E1F1 2ZGMA 1V9U2 2BOJA 2ZJCA 2X8KA 2YZ4A 2AEZA 3L2HA 1W8FA 4XUQA 5AVAA 2QZ2A 4Z2AA 1UYYA 1C8M2 1NE4A 1YWKA 1UKGA 2A5ZA 2LRPA 2UYBA 3PLQA 4YVWB 4YW7A 4GMP1 2VCCA 3PURA 4LHKA 3OEBA 4B3NA 4X6QB 3RFRA 4B4QA 1XNAA 5I93A 3P1IA 2BPA2 2H0VA 3EMRA 2NMNA 1KEXA 4AQTA 1JZ2A 2WWSA 4RHV3 5CG9A 2WS91 1F9KA 2XH6A 1WCKA 4D69A 3BTXA 1BZWA 4Y1VA 2D3PA 3RYPA 3F95A 2JDPA 1TVGA 3JXSA 2ZACA 1RUC3 2ES3A 3DPRB 2UYAA 1ZVFA 4YZ4A 3GHMA 1X8EA 2Q8OA 1RUG1 1I1EA 1S0DA 4OQ8A 1F31A 1RUI1 1ZNPA 1JZ7A 2X5IC 3WF3A 4D0QA 4RR3A 5JDBA 4LIVA 4V2WA 1YI7A 3FC0A 3ECQA 3FWEA 3U0ZA 2LTNA 4W50A 4QGNA 3ZFFA 1QJU1 2JDHA 1O7FA 1QY4A 2VGDA 3GZEA 4CYDA 2Q1ZB 1KFUL 1GU3A 3EO6A 1FT9A 2BERA 4HSLA 4XABA 4YGDA 4M01A 5HCHA 1UY4A 2WFF1 1CR7A 4B7EA 3AMMA 4ZU7A 5FPUA 1SLAA 3ZDSA 5L7OA 1X7NA 3I3DA 2ET7A 4BQ3A 4F8AA 3WQBA 1Y43B 5I0UA 4SLIA 3ZN4A 4IV3B 5AFEA 2CHHA 3MIHA 2Y34A 3DYOA 3O5SA 1PHMA 1COV2 3ON7A 1UZWA 1QJEA 3I49A 1W3VA 3NV3A 4LBQB 4QDQA 1W6QA 4QXCA 5KHIA 1T6BX 2EXHA 2HEWF 5JOWA 4P9IA 5FMBA 1G9DA 3OEAA 4OQ9A 1BK0A 5C9AB 3ZLIA 3S5AA 3PDQA 4XCBA 5E1RA 5J37A 5CIRA 1AVBA 2DVGA 3WDXA 4GZ9A 2GSYA 2CGOA 3KT7A 4XFAA 2CY6A 5FY4A 5I0TA 4NIIA 1POV3 2J1EA 2RE9A 2V5DA 2VW2A 2WRAA 1K12A 2WL1A 5F3IA 3NVCA 1RUH2 4Y5SA 3RNSA 1E5IA 1E5HA 1NE6A 4AYUA 4COVA 1GWMA 2WZPP 4GAZA 4Q4X3 2WO2A 5K0UC 1AJKA 1ZBA2 3KCXA 2BTVC 3Q8AA 3HNMA 2XXZA 4PCRA 4BXSV 4NN0A 1AL21 2VL4A 4IE7A 4QQPA 1PGL1 1OF3A 1UPIA 1F5JA 5A7SA 2WNVB 4CCLA 4YPJA 3WW2A 2A6XA 4LBOA 3ITQA 2DWRA 2MEV3 2D6MA 1AYM3 1BVP1 4IESA 4N53B 1XPWA 3E6DA 4LHSA 4NHMA 5IK7A 2P5BA 5C5TA 2A73B 3MIDA 3U78A 4BWOA 4QX5A 4CDQA 5IJRA 2PHWA 4K21A 3UESA 1GFF2 1J3QA 1SPPB 2DF7A 2OUHA 2RVAA 2RJKA 2ZGUA 3SCFA 2B46X 4DB5A 3RZGA 3O1OA 3BI3A 4YG6A 2HWE2 2JDZA 3CO2A 4IV1C 5C71A 2YFUA 5DMYA 2BYVE 1YQ8A 2B5HA 1IS5A 5C6CA 1JN2P 1DLCA 2WNEA 1S1AA 4FAHA 2D5HA 3K46A 2ZX4A 4KQ7A 1DF0A 4G4FA 4PHZA 4YLZA 3VBRA 3SISA 5ABJA 1CIWA 1AYM2 1LRHA 4KU8A 3C8XA 2WYSA 3Q8FA 4AI1A 3K4ZA 1W6OB 3C7FA 2X5IB 3DF0A 4CP0A 2QQLA 1NZIA 3AVSA 3W5MA 5FZ4A 1RHI3 5DAXA 3MICA 2PHFA 1F8VA 1HQWA 3H7JA 5IVBA 5K8SA 5G04L 4A44A 5DUWA 1H30A 1H8TC 3E97A 1LNSA 5IK4A 4KGGA 3QACA 4XIOA 2VNOA 3DECA 2P1BA 3IWZA 4HK9A 3TAYA 1O91A 5A1FA 3TB0A 3MF9A 2Y64A 5A3TA 5H9RA 2R061 3ZFEB 3VBFA 4UFIA 2YMZA 3K48A 1UIJA 3PTYA 2ZEYA 4JDOA 2X09A 3UYJA 5CKNA 2BNMA 2GMEA 2PHRA 2VULA 2DCKA 1QMJA 4AAPA 1VPHA 4YGEA 4YFZA 1RUOA 5FPVA 3ZXEA 1OFSA 2NMOA 5ANNA 3CNAA 1X82A 3ZPOA 5JR2A 3RZKA 2ZZQA 3N7LA 1POV0 2DCTA 3EB7A 2IWGB 3KS7A 1OPOA 3GNEA 3UGFA 2DU0A 4XYXA 4O61A 3NKTA 5FUPA 3VBSA 5A1AA 1DLLA 3RG0A 4HL0A 2IXHA 1HV1A 3LZZA 4YFWA 2A3XA 4INDA 2HWC3 2GAUA 4RGGA 5GLWA 4EQVA 2H0BA 2AR6A 4IQPA 2YBKA 1NCQC 5FP7A 2WNUC 1L7RA 2YGLA 1UX7A 4LITA 1Q8VA 2ZKLA 5JCTA 2GP3A 3EBRA 3BUCA 4BZ4A 2Y6JA 3QBQA 1PO11 1MS4A 1WUVA 3J7LA 3UV9A 4E8DA 4HKWA 1PMIA 1PVC3 4DXRA 5FY0A 5K0UB 5LA1A 4B1MA 2CL2A 2J7MA 3AYDA 5DDJ3 4YW3A 1DGWX 5JOYA 2K2SA 2VCMA 2YC4A 1DYOA 4QDSA 3JB4C 3RZMA 1EUUA 3B93A 4BJ0A 4B7KA 5F7UA 4LBJA 1F2NA 3TEXA 4YW2A 4BE3A 2Y26A 4GULA 1QOSA 3VBUB 3ALQA 5L9RA 2HEVF 2VO5A 1OUXA 1GQPA 4E8CA 1ZZ7A 3OGJA 4XFGA 4M3CA 3DEMA 4GB32 4Q0PA 1L7LA 1YFUA 2AC1A 5EJZB 1EUTA 1V6LA 1X50A 4XOGA 4MSVA 3U1XA 3WT3A 4JVAA 2QQVA 1UMIA 2A7AA 1QKQA 4XJWA 1PX4A 4BQ4A 1RUE3 1H1IA 3Q9OA 2KR2A 3AMQA 1HW5A 3MBWA 4IV1B 1W9WA 2RJ2A 3MGUA 3WZ1A 3ZX7A 5ACA3 1OHFA 4ZS2A 4F7ZA 4J25A 3WF0A 2A6YA 5GLTA 1ZRCA 1MZFA 2PLV3 2XUEA 2VY0A 2AEYA 5A80A 1W6MB 1H1MA 2R6QA 3SEEA 2W39A 3ACIA 3I3EA 4QB6A 2A6WA 3NMBA 3USUA 1NCRC 3KGZA 4B4PA 2EAAA 3V0BB 3ZFGB 1QH6A 1WCSA 4IEVA 4CU9A 1MQTB 4YZ2A 3BPZA 3ZMOA 1RUD1 2D5FA 3T1LA 5FMDA 4ORFA 5A3PA 2LUWA 2GN3A 1NT0A 1HRV3 4LBKA 1OF4A 1ASJ2 5CYYA 3WD5A 1AL0G 3JQXA 3M4FA 4WVMB 1W28A 2XUMA 3KF3A 1OLMA 1R083 3OYWB 4K9SA 3S0MA 1H8TB 5CB7A 5C3PA 4TWTA 2AYHA 1FATA 1VBE1 3AZYA 5BUVA 3OTFA 1O6UA 4QXKA 3MLLA 1CN1A 3ZFFC 4AR2A 1SBDA 2DBNA 2HH9A 2XJTA 1BCXA 1RMU2 2QQMA 1IS4A 2ZHNA 3SQOA 2BGPA 4COZA 1C28A 2OQ7A 4QHBA 3FBYA 2AREA 1QIQA 5E16A 3DKWA 4BB3A 5JSOA 3MIEA 4K1YA 1CJPA 1PO21 2X29A 3NQHA 3PNAA 5L7OC 1W8UA 2BVBA 4FXGB 4KNCA 1BMV2 1SZBA 4FVVA 3WUCA 4LA2A 4ASKA 1OA4A 5CG8A 1F4HA 4IDZA 5A33B 3ZSLA 1MVEA 2E9QA 4EWAA 4XFCA 2R042 3UETA 4QPWA 4UFMA 1SLLA 2DUOA 2JJ6A 5FZLA 3VV1A 4XAAA 3BTYA 4QX0A 5FXXA 1BYHA 3KZ4C 4FPCA 5T52A 3ZXLA 1NCQB 1W9SA 5FOJB 4DFSA 1U5YA 2RS51 3H42B 4C1XA 1PIV3 1C5IA 4AFBA 1C1LA 4HFSA 3G6JB 1ZRIA 1PGSA 2ZX3A 2JDYA 4BLJA 2R0FA 5JOXA 1TEIA 3LA7A 3MIGA 1JYWA 3ACFA 5BNQA 1VMFA 3ZYIB 2XKPA 1VAMA 4JTNA 4C8DA 4XFIA 3VN4A 1KD7A 3R6SA 2XWJB 1V70A 1WLTA 1TME3 1ZM1A 3NJVA 5AC93 4RN5A 5FPAA 4K8FA 1B35A 3OGRA 1RUF3 3T30A 3LEKA 2OPKA 3OBZA 1EP0A 2WZR3 3PJQA 1F35A 5E6HA 2P3YA 5B2GB 1FMD2 3OY8A 4XJAA 3T09A 1N3QA 1QJX1 4CP1A 1YC61 4BISA 3LA3A 4AVVA 2F6BA 4I0AA 1ZX5A 3ZR6A 1J58A 4XZPA 1DYKA 3H50A 3WX5A 2OX0A 3VDAA 3TNQA 3GCWA 1UO9A 2WFPA 4UF0B 3WNXA 5HPOA 1UN1A 3W20A 1WBLA 1LOGA 1YYNA 2G4IA 3UJOA 4CDQC 4LA3A 1AYN2 5JVVA 3VL8A 2D6OX 1WA6X 2YB7A 1W2UA 3WDYA 2E63A 4LKSA 4YWAA 1NCRB 2R0HA 4BPZA 5LATA 1SMVA 1MS1A 1LAJA 5FXVA 2WZR2 2HWB1 1SBFA 4JAAA 3WQ7A 2WQZC 1G8WA 3E6CC 2WAAA 2JXAA 4EN0A 2Y38A 5FUNA 3LDKA 2JIGA 1RJ8A 2VBBA 4P9YA 3OPWA 2WSUA 5F5QA 2UWAA 5FWJA 4Q0SA 1AHSA 1NQDA 2Z69A 3NRUA 4QPGB 2PAKA 4G3YC 4LOSA 3WG3A 4AVCA 4ES8A 3T08A 5D21A 3NWKA 3NNGA 4BA6A 4E27A 1R1A2 2UWBA 4EROA 4L92A 4QX1A 4ARXA 1UD1A 2BDRA 2QQNA 5E88A 1UPSA 1W8HA 5I0RA 2RMU1 1BBT1 1W0OA 3ZFFB 1VBC3 4OZOA 2F4LA 4Q4Y1 1S0FA 3ZIXA 2DVFA 4ISQA 3O1VA 1IG3A 2B8MA 2VR4A 3LD8A 3NNMA 1UCXA 4GB31 4DY5A 4QHZA 3ROUA 3B9CA 4ZZ8A 4MZUA 3CEWA 2VW0A 5FPLA 2OZ6A 5IATA 1N3OA 1XYPA 2QQIA 3OBAA 4ARYA 2V4VA 1HJGA 3LPFA 3VZNA 1QF3A 3ATGA 5FZ0A 3WSOA 2QE3A 1H6XA 4XBNA 1DCSA 1W6QB 2XBO2 1N1TA 3RRDA 3AJZA 4Q26A 1RUNA 5HCBA 4NUBA 1EPWA 2YC2A 2YU2A 2C4XA 3K3NA 4BLIA 1QH7A 1L7QA 4YSFA 2B42B 3PU3A 2FDIA 1TNFA 4EN8B 1RVF2 3GBGA 3QOPA 1LU2A 2CU5A 3ZKYA 4AL9A 2ZGKA 3VD5A 4N7IA 2OKXA 3RJRA 4M3CF 4P5YA 2CSGA 4PQ9A 4F3JA 3PL0A 4A42A 5J96B 2ENRA 3M3IA 2VMIA 3R4UA 4JCKA 2WT2A 3B69A 2PYTA 4JGYA 1J3RA 2WZEA 3AKSA 2AACA 3NO8A 5I8TA 3VZMA 3VZKA 2G9FA 2Z79A 2NYYA 2WZ8A 3PIGA 3I4IA 4IE6A 1URXA 3CJXA 5APAA 1GANA 4UBHA 4XQ4A 3BKZA 4CUAA 3AL5A 1HXS2 1KS4A 2QBXA 1WMEA 3JU9A 1VJ2A 1I9RA 1UXZA 2Y33A 3KM5A 2VD7A 4LUKA 3AXDA 3ZYFA 5A3NA 5H9QA 3C7OA 3I3QA 1N3PA 3VZLA 2BGOA 4CDQB 1WMFA 5FXWA 3RPQA 5FQ0A 1BKZA 1RUG3 4XXAA 4DY3A 4AQ6A 4XQDA 5FZAA 2ORXA 2W95A 5LCWL 1I6XA 1D2QA 3MPPG 5FFOC 3ZYBA 2FBEA 4CCJA 3CLPA 3KHCA 1A6CA 1JHJA 2YHJA 1QJU3 2HWD3 2AH2A 2FCUA 4CCDA 2ZAAA 3M3EA 1GP4A 3J8F1 3WR0A 3PMSA 5JPMB 1ULGA 2P6HA 3WINE 2GN7A 3RWKX 3N7JA 3NNFA 2RM21 1ULOA 4Z07A 5D2AA 5FKBA 4LUMA 4RA0A 3UKTA 4OHWA 3N9LA 3PUQA 5A6YA 5FPZA 4GKXA 4W6WA 3HIFA 4XAEA 3WNNA 1DQ5A 2CWSA 1TMF3 2XJPA 3H8UA 3J7HA 1ENXA 4OHYA 3LPGA 1WWYA 5H9PA 3FLRA 3VDBA 3RMXA 1FMD1 4V1PA 2B9VA 3I8TA 2LM3A 2BZDA 3HQRA 3WF4A 5JMCA 2ZA9A 1O3QA 2FDJA 5FPBA 2WR9A 1JYIA 1VBA1 4V2VA 3EJKA 4L11A 4CP2A 4CU7A 2PAEA 5A6QA 2JD9A 4JDNA 3KV6A 1SBEA 2DU1A 3S7IA 5IAVA 1G7YA 4HMZA 4CRQA 3WG2A 4PBOA 2BVVA 5A70A 4M4RA 2WINB 1JUIA 3N7MA 4O9GA 4N7UA 1C4RA 5DABA 4UW3A 1TQ5A 1W90A 3PVOA 5DUVA 2E51A 4FO9A 1LODA 5IFPA 4Q4V1 1RYYA 1NLRA 1AL23 2QUOA 1JODA 3FBMA 1EAH2 3O12A 2Z5WA 2ZEWA 3IDAA 4QQ2A 4OMCA 1J83A 1IGOA 2OVUA 4ATFA 3I2GA 4H3WA 3BU0A 5IVFA 4WM7A 3GJBA 2R32A 1JU3A 3IKWA 3I2IA 4FOQA 3TWIA 4BH9A 1G9CA 4R4XA 2QQPA 2V09A 3F2ZA 3MUZ1 4XACA 2ZGRA 4UW6A 3P5BA 3TN92 1UIKA 4KU7A 2EALA 1LOEA 5C8WA 5IK8A 1NLSA 4Y22A 3W9AA 4YG3A 5E8AA 3IPVA 3NJXA 4IEWA 3NJYA 4FOWA 1QJY2 1U12A 4KMQA 1CAUA 1DZTA 1B35C 5C3QA 4LJHA 2RS12 3PJYA 4YVSB 3VUOA 1S0IA 1ENRA 1LENA 1IPSA 4M3CB 4QDRA 2DTYA 4Q0UA 3KLSA 4A3ZA 2OYZA 1PNFA 3IZOA 2RJLA 4UWDA 3U07A 2XVKA 2Y6FA 4L0PA 3OSDA 3VDDA 4PIXA 4YZ3A 4XDOA 4AVSA 5T5LA 2X53S 4B1LA 1DGRA 2VCBA 3IIAA 3M7AA 4IEYA 2XLAA 3LE0A 2IXKA 1MZEA 1RTVA 5K7PA 5FY8A 2HWF1 5L9BA 2C26A 1AR71 3USUB 1XYNA 4H14A 2QCSB 1R093 1ZA4A 2W47A 2GU9A 3FE5A 1JS9A 2V4AA 3FUQA 5IVJA 4IEOA 1O5LA 4C0HA 2R072 1XE0A 4L97A 4Q0QA 4ZXKA 3FMGA 4JZRA 1W3XA 2PELA 3FZ3A 1RUJ1 1RB8G 4ASLA 1O59A 1ZZBA 5A1LA 5EIYB 5DG1A 2BOIA 4IEZA 1D4M3 4JHZA 4CEWA 4GD4A 1Y9GA 1LOBA 2Q1MA 4D6RA 3JBG2 5LBEA 4MGKE 4DEQA 2QDNA 4YGBA 3KHBA 1AR81 4CCNA 2XL9A 1YFYA 1RINA 4P5HA 2JIJA 2WDBA 1KITA 4Y1ZA 1TNRA 1DIWA 2ARAA 3BIWE 1FOD1 1OPMA 1R092 1CAXB 2QQUA 4GWIA 4JDMA 2ZGOA 4W65A 3WNPA 4Y20A 4AHZA 3FHQA 2EA7A 3ZXKA 1MS3A 1NOVA 5FYBA 1I5PA 4JRAA 1WMDA 2J42A 4LQRA 4DIQA 3HNBM 4MLOA 2PHUA 5EJ3A 1G9BA 3S5QA 2PHXA 1OI6A 1OT5A 2F4PA 1GBGA 1PO13 1UOGA 2PA7A 4HVOA 5BPXA 3ZYJB 3APBA 1D4M2 4GWNA 4MX3A 5F9TA 3A7QA 4BU2A 3S7EA 2XONA 4XTMA 4ET7A 4CXWA 1QOTA 3AP7A 4CPBD 1ZYBA 3BPSA 4DXZA 2W87A 1Z7S2 4ISRA 5FZDA 3O0VA 4BQXA 1DQ0A 3WQ0A 5JPNB 1XU2A 1OH4A 1W05A 4FPGA 1S55A 3P3NA 4IEXA 1JYCA 4IW3A 3AP9A 4GH4A 3HEIA 4Q5OA 1VP6A 5FP9A 1HQLA 3THDA 3ZSMA 4D3WA 1W9YA 3OBRA 5ANQA 3I2DA 5D1IA 1LGBA 1US3A 4N8MA 4D6SA 5HV4A 4XUOA 4ZU5A 4RFT0 2VZTA 5E89A 1ND2A 1Q8QA 2W3JA 4KWUA 1IPJA 5FYMA 4PIYA 4QPYA 1EY2A 1Y9QA 4RHV2 3W21A 3ZYRA 3O1TA 3KCYA 2V72A 4BQYA 5CFCC 4TTGA 3CL1A 3OD0A 4XUPA 5LEKA 2BFUL 1W2AX 1A78A 1VBB1 4MXWA 1OQ1A 1LOCA 1RUC2 1LULA 4OFGA 4FT8A 3N7KA 4JGYC 2QJVA 2D44A 4HKOA 3OY8B 2XJQA 1WLWA 1OA2A 3J26N 4QGLA 1D7PM 4YM3A 4XTPA 1YFWA 1RUD3 4FBFA 5EZWA 2QQJA 5DAQA 2IZWA 3DKQA 2VZUA 1UZYA 1XBFA 3BVCA 1QDCA 1DHKB 2VTFA 4NPLA 3VHNA 1Y4WA 3IDEA 4PQQA 3SCGA 4CDUA 3CHXA 4OYUA 4EE2A 5FUIA 2JECA 2R16A 3ZSKA 2XJUA 1OVSA 2XVGA 3HD8B 5FPXA 4LPLA 4DMIA 2BRTA 3N9QA 2TEPA 2ZX0A 3K4AA 4CU6A 4LLFA 1VBE3 4AZZA 3H3ZA 1N47A 3VZJA 2E26A 5SV8A 3BB6A 4AI8A 1AR93 1YCIA 2YG0A 4N90A 2WLPA 2ZGQA 1UKRA 5FYIA 1CJDA 5LA2A 3FL7A 4NRPA 4TSVA 3GJAA 5F1RA 3W5NA 5CVRA 3THTA 1JYTA 3SH4A 1O4TA 2UURA 1V6NA 3JUUA 5EJ1B 5K4LA 1NLQA 4Y26A 3A23A 3SC7X 2C6SA 2FDHA 3SKJE 3UKVA 3CF6E 1H2MA 2NZ9A 1VBD1 3RMYA 1W6PA 2NLRA 1GP5A 4AFDA 1W2NA 1KJLA 1EV11 3AZWA 1CESA 2D43A 1BXHA 4LHLA 3RI9A 3WV6A 1BEV1 3B3QE 5IVVA 2JE9A 1JHNA 2DTWA 2RS11 1VR3A 4AE2A 4QGMA 1VRH1 4AG4A 5IYYA 1JXNA 3OGSA 4Q4X2 4XJZA 4NJ4A 1AR61 1AR92 1OH3A 1TG7A 2RS53 5I0SA 5K9YA 1GSLA 1MS8A 2VVFA 1H9WA 2JE7A 3VD4A 5FMOL 3ZN6B 2XJVA 4COWA 2O1QA 2EICA 3J7NA 1B09A 1K5MA 1Q8PA 2MEV2 4QM8A 1JZ3A 1W8TA 1XC6A 4EV0A 2RS33 2VUJA 3BIEA 3MZHA 2C0ZA 2YUEA 3H3UA 1GNYA 3POIA 4UFHA 1OKOA 1MEC1 4N9HA 5LA9A 1Z78A 4UW4A 3AX4A 4PIZA 4IGOA 2WQ4A 2Y0IA 3LWCA 4Z82A 4AVTA 1G9AA 2JG9A 4AK3A 4EYUA 2YPDA 3LIGA 2ZHMA 4MV2A 1R64A 2W5FA 1PVXA 4NRQA 1QJX3 1ULPA 2BW8A 1U5ZA 1GZWA 2DFCA 2ARXA 2W1UA 4QX2A 1C57A 1NX9A 5A7WA 3T4VA 5AFBA 5BNNA 1HRI3 2VTXA 3U4SA 3O7OA 5J48A 4GA9A 3S57A 4OCTA 4PI2A 1PZ7A 1SFPA 3CU7A 3AYEA 1UU5A 3QCWA 5CFCB 5GZDA 3FFZA 4P02B 1WGPA 3KV4A 2W0XA 3KWVA 3PUAA 3VKFC 3MYXA 3JBG1 4NRMA 3H8OA 4Q4W1 3GM8A 3CQOA 2QQKA 3RZHA 2ZOEB 2HBUA 4R9AA 3VKMA 2E33A 4JGYB 4LBLA 5A7OA 3AKTA 2BV4A 1V9U1 3BODA 2IFRA 3THCA 1MS9A 1VMJA 3LDRA 4LO5B 1HB4A 1RJ7A 3C7GA 1UYXA 3EYPA 4BDVB 5ISLA 4EN9B 1NG0A 2ZMLA 3WNLA 1RHI2 2RR13 2HWB3 4M0HA 1C8M1 5DUUA 4AVAA 1QQP3 3N3HA 4XJ8A 2BWAA 4MGSA 1D4VB 5F3CA 4K3UA 1XXNA 2HYKA 2VQTA 1ALYA 3CZJA 1LGNA 5D8AA 5LBBA 1OOPA 4XETA 4ZXEA 5LEJA 3AMHA 3LFIA 3RJ2X 4CUBA 4QB1A 1ZRDA 4RSUA 4HG6B 3KMHA 3VDDC 3MW3A 2E53A 1W8NA 3ILRA 1MPXA 2DCZA 2IXIA 1XYOA 3DXUA 5G05L 1YXWA 2VCAA 3ZXGA 4DEVA 1XSQA 1CAVA 2RMU3 4UFKA 4XVHA 3AMPA 1UMZA 1LTEA 2TNFA 3J4UH 4D94A 4C91A 3C2UA 4QHOA 3KT4A 2G1MA 3PTRB 2O14A 4CZSA 3I7DA 3ZYPA 3RSJA 1QQP2 5FY5A 2HWC2 5FV3A 4P9JA 4BMBA 4MGTA 4UW5A 5FXZA 2CGNA 1DZRA 3HT2A 5IVEA 3ILNA 1MS5A 2ZEZA 1UAIA 2ID4A 2XPJA 2B45X 2WQ8A 4G9SB 1W0PA 3FHAA 5EHDA 1WD4A 4BQ5A 2W68A 1COV1 2GC2A 3WW4A 4NROA 3KQRA 1DGWA 1PVC2 3D0JA 4ES9A 5FR3A 1ACCA 2G9GA 5DDJ2 3N35A 3N9NA 3I97A 5C8CA 5J1XA 3JZVA 2IXCA 1CD3G 3ABZA 1FNZA 2NP0A 2F17A 2XR4A 3AKPA 1W6NA 3IAPA 3WP5A 3VB9A 1UU4A 4NIHA 3I2FA 5BNPA 3AC0A 2WUHA 4OUMA 5HXVA 3KT1A 5FCCA 1RUH1 2LS6A 1WMXA 2P34A 4XMIA 1JYVA 1RUE2 3E5QA 2Q30A 2D6LX 4M0NA 3OPZA 5FJKA 1ZBA1 3B01A 3K77A 5ACA2 3VD9A 2BEOA 4XF1A 3SXWA 2W08A 2B7YA 2PLV2 3ETQA 1V6OA 2CV6A 2WWUA 4RR3C 3WCSA 1HN1A 5IUQA 4JGZA 1OQDA 4W6YA 2GDFA 3GBWA 1ND3A 4NR1A 3MV01 4EWEA 5FZ1A 1UOBA 5FZIA 4DXSA 3LSDA 2WIIB 4URTA 5LASA 5FMCA 2L9LA 2VZVA 1POV1 3H7YA 5LRRA 1CZSA 2P2KA 2ZAHA 3HPNA 4BM8A 3TEWA 4LORA 4YYOA 2H6BA 1HRV2 2PAMA 1W8ZA 4HONA 2LALA 3IPVB 4CSWA 2TUNA 3PIJA 2GP5A 3OGVA 1DP0A 2HWE1 1YIPA 3BTZA 4BIOA 1R082 2GNMA 4AQ2A 1ZZCA 3PVBB 4S2GA 5FBZA 1IZ3A 4Q4X1 1NY72 2W91A 2A6VA
chains in the Genus database with same CATH topology
5IVYA 4EZHA 3AL5A 3AVRA 4IGQA 3KVBA 5A7SA 3RVHA 5F5IA 5LWBA 4CCLA 2VD7A 5FY9A 5FZOB 4BISA 5F3CA 5A3NA 5FZOA 5FZBA 2XMLA 5FZGA 5FZ3A 2OX0A 4UF0B 5FXWA 2P5BA 4XDOA 3LDBA 3U78A 2XDVA 4UF0A 5F3EA 4Y4RA 5FZAA 5F37A 3DXUA 3KV5A 3DXTA 3N9MA 3N9QA 4QX7A 5FZ7A 5FZEA 5FY8A 4AI9A 4CCJA 2XUEA 5A80A 4LIUA 5F2WA 2OS2A 5FP4A 5FYIA 3PTRB 4D6SA 5FXVA 4Y33A 5FYHA 5IVJA 4GJYA 3PURA 2OT7A 4QXBA 4TN7A 4BXFA 5FZ8A 4EZ4A 4CCMA 5FUNA 5FY5A 5FV3A 4CUGA 5FJHA 5IVCA 5K4LA 5F3GA 3PUSA 5FZKA 5FXZA 3OPWA 5A1LA 5A3PA 5FY1A 2WWJA 5IVEA 5FWJA 3N9LA 3PUQA 4GD4A 2YU1A 4D6RA 5FYZA 4HOOA 4URAA 5A7QA 5F5AA 5FZ6A 3AVSA 5F5CA 4Y3OA 5FZ4A 4CCNA 4QWNA 5A7PA 5IVVA 4GJZA 5FBJA 5IVBA 3N9NA 4LIVA 4V2WA 5F2SA 5CEHA 3OPTA 4E4HA 5FYYA 2OQ6A 5FYCA 3LD8A 4QX8A 5FYTA 4DO0A 4CCKA 5FPBA 5A1FA 5A3TA 4QU1A 4D6QA 5FYBA 5FZMA 4V2VA 5FZFA 4DIQA 3N9PA 2OQ7A 5FPUA 4IGPA 5FPLA 3KV6A 3UYJA 5F39A 5FYVA 5IW0A 4AAPA 1VRBA 4BU2A 5IWFA 3PU8A 5FZ0A 5FPVA 4ASKA 2Q8EA 3ZPOA 3K2OA 5FZCA 5FJKA 4IGOA 5FP8A 5FZDA 3N9OA 5FZLA 4QXCA 4QXHA 5A7NA 5LY2A 5FY7A 5FUPA 2YPDA 5F32A 4EYUA 5FXXA 4NUBA 2YU2A 5A7WB 2WWUA 3ZLIA 3K3NA 5FP9A 3AL6A 3PDQA 2PXJA 5FP3A 5A7WA 5ANQA 4CCOA 3U4SA 5LY1A 2W2IA 3PU3A 5FYSA 4LXLA 5FZ1A 5FZIA 2YBKA 2Q8CA 5IVFA 5FP7A 5FY4A 4LITA 4XDPA 3KV4A 2GP3A 5FYMA 3PUAA 5F3IA 5LW9A 3K3OA 4C8DA 3KV9A 4HONA 5FY0A 5A3WA 5A7OA 2YBSA 4CSWA 5FYUA 5KR7A 2GP5A 5FWEA 5FPAA 3NJYA 2YBPA 5ISLA 4GAZA 2Q8DA 3KVAA 2XXZA 5FZHA 5FZ9A 5E6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IVY A;  4EZH A;  3AL5 A;  3AVR A;  4IGQ A;  3KVB A;  5A7S A;  3RVH A;  5F5I A;  5LWB A;  4CCL A;  2VD7 A;  5FY9 A;  5FZO B;  4BIS A;  5F3C A;  5A3N A;  5FZO A;  5FZB A;  2XML A;  5FZG A;  5FZ3 A;  2OX0 A;  4UF0 B;  5FXW A;  2P5B A;  4XDO A;  3LDB A;  3U78 A;  2XDV A;  4UF0 A;  5F3E A;  4Y4R A;  5FZA A;  5F37 A;  3DXU A;  3KV5 A;  3DXT A;  3N9M A;  3N9Q A;  4QX7 A;  5FZ7 A;  5FZE A;  5FY8 A;  4AI9 A;  4CCJ A;  2XUE A;  5A80 A;  4LIU A;  5F2W A;  2OS2 A;  5FP4 A;  5FYI A;  3PTR B;  4D6S A;  5FXV A;  4Y33 A;  5FYH A;  5IVJ A;  4GJY A;  3PUR A;  2OT7 A;  4QXB A;  4TN7 A;  4BXF A;  5FZ8 A;  4EZ4 A;  4CCM A;  5FUN A;  5FY5 A;  5FV3 A;  4CUG A;  5FJH A;  5IVC A;  5K4L A;  5F3G A;  3PUS A;  5FZK A;  5FXZ A;  3OPW A;  5A1L A;  5A3P A;  5FY1 A;  2WWJ A;  5IVE A;  5FWJ A;  3N9L A;  3PUQ A;  4GD4 A;  2YU1 A;  4D6R A;  5FYZ A;  4HOO A;  4URA A;  5A7Q A;  5F5A A;  5FZ6 A;  3AVS A;  5F5C A;  4Y3O A;  5FZ4 A;  4CCN A;  4QWN A;  5A7P A;  5IVV A;  4GJZ A;  5FBJ A;  5IVB A;  3N9N A;  4LIV A;  4V2W A;  5F2S A;  5CEH A;  3OPT A;  4E4H A;  5FYY A;  2OQ6 A;  5FYC A;  3LD8 A;  4QX8 A;  5FYT A;  4DO0 A;  4CCK A;  5FPB A;  5A1F A;  5A3T A;  4QU1 A;  4D6Q A;  5FYB A;  5FZM A;  4V2V A;  5FZF A;  4DIQ A;  3N9P A;  2OQ7 A;  5FPU A;  4IGP A;  5FPL A;  3KV6 A;  3UYJ A;  5F39 A;  5FYV A;  5IW0 A;  4AAP A;  1VRB A;  4BU2 A;  5IWF A;  3PU8 A;  5FZ0 A;  5FPV A;  4ASK A;  2Q8E A;  3ZPO A;  3K2O A;  5FZC A;  5FJK A;  4IGO A;  5FP8 A;  5FZD A;  3N9O A;  5FZL A;  4QXC A;  4QXH A;  5A7N A;  5LY2 A;  5FY7 A;  5FUP A;  2YPD A;  5F32 A;  4EYU A;  5FXX A;  4NUB A;  2YU2 A;  5A7W B;  2WWU A;  3ZLI A;  3K3N A;  5FP9 A;  3AL6 A;  3PDQ A;  2PXJ A;  5FP3 A;  5A7W A;  5ANQ A;  4CCO A;  3U4S A;  5LY1 A;  2W2I A;  3PU3 A;  5FYS A;  4LXL A;  5FZ1 A;  5FZI A;  2YBK A;  2Q8C A;  5IVF A;  5FP7 A;  5FY4 A;  4LIT A;  4XDP A;  3KV4 A;  2GP3 A;  5FYM A;  3PUA A;  5F3I A;  5LW9 A;  3K3O A;  4C8D A;  3KV9 A;  4HON A;  5FY0 A;  5A3W A;  5A7O A;  2YBS A;  4CSW A;  5FYU A;  5KR7 A;  2GP5 A;  5FWE A;  5FPA A;  3NJY A;  2YBP A;  5ISL A;  4GAZ A;  2Q8D A;  3KVA A;  2XXZ A;  5FZH A;  5FZ9 A;  5E6H A; 
#chains in the Genus database with same CATH topology
 5FO7 B;  4L2N A;  3GHN A;  3HQX A;  3IMN A;  2WNU B;  2RM2 3;  3NV2 A;  4FCA A;  2PHT A;  2FD8 A;  3BTA A;  2N7G A;  4LK6 A;  1YJL A;  1KXG A;  4AHX A;  3VDD B;  1YIF A;  2P37 A;  4DIN B;  1AYM 1;  1ULE A;  4PBP A;  1J84 A;  2W1W A;  5FZG A;  3VD3 A;  5B4N A;  2WC2 A;  1LHN A;  4CDU C;  1LGC A;  2ZGS A;  3U11 A;  2GC3 A;  1YQ5 A;  4Z2W A;  4QPI A;  4HPK A;  1QOO A;  3DXT A;  3A4U A;  3GDB A;  3R4S A;  4QX7 A;  1JZ5 A;  5FZE A;  4Y1U A;  1ZZ8 A;  4ZPI A;  1PNG A;  3O1M A;  5CZK A;  3G7D A;  4AHW A;  2VH9 A;  1S4C A;  3PUI A;  4R9D A;  1H2N A;  1XRU A;  4Y33 A;  1RGS A;  2Y60 A;  4J1W A;  4M4P A;  4AI3 A;  2FDK A;  1VBA 3;  3GXU A;  2OT7 A;  4R9B A;  2VQU A;  4H55 A;  5A3L A;  1A34 A;  1ZZ9 A;  4CUG A;  2FCT A;  4TYS A;  5FJH A;  5C3O A;  4YM2 A;  5HI0 A;  3VKN A;  2C9A A;  1DZQ A;  3C7H A;  1PIV 2;  2FZ1 A;  3M2M A;  3Q8B A;  1RIR A;  2ETE A;  2BBV A;  1FPN 3;  3LGR A;  1LES A;  2QTW B;  4C1W A;  4NO4 A;  2A3Y A;  2FDG A;  1SDD B;  3AP5 A;  4IV3 A;  4AF9 A;  3JD7 3;  3Q8E A;  5FZ6 A;  1CX4 A;  1M4W A;  4Q4V 3;  4C90 A;  3KSC A;  4CU8 A;  4QWN A;  1GZT A;  2PN5 A;  2VMD A;  5J3U A;  1TME 2;  2JKB A;  5AC9 2;  4GWJ A;  4J1X A;  1V6I A;  4E9K A;  4CCE A;  1RUF 2;  4LBQ D;  4Y20 B;  2OQ6 A;  4LMF A;  4QX8 A;  2J1A A;  3HWJ A;  3WDT A;  2VTX J;  5C33 A;  1CPM A;  1JW6 A;  3GYD A;  3OF1 A;  2HKX A;  4WBB A;  3HN1 A;  4OVE A;  4IXL A;  2YFZ A;  3UL2 A;  1OD5 A;  3N9P A;  3CDZ B;  4ZS3 A;  3H0O A;  4Z1V A;  4COU A;  1K5M C;  3VBR C;  5ABJ C;  1QJF A;  1FPN 2;  5I8Y A;  3INA A;  2VZO A;  4D7S A;  3POF A;  1EPZ A;  3CJI A;  1H9P A;  3W59 A;  4E4Z A;  3AYC A;  3FFQ A;  1LOF A;  2XJR A;  3NV4 A;  3JD7 2;  3MF6 A;  1YQ2 A;  1YLL A;  5FZC A;  4RR3 B;  2GH8 A;  5A32 A;  1C3H A;  1HB3 A;  2JG9 C;  4MG2 A;  1VIW B;  2CWM A;  1ZZ6 A;  5DG2 A;  5C3R A;  4AVB A;  1ST8 A;  3H1Y A;  4BYY A;  1OUR A;  2W52 A;  4KWL A;  3LEM A;  3MLK A;  4XDQ A;  1IQD C;  5BNN C;  1L3J A;  4MGY E;  2R49 A;  5L7O B;  3VBF C;  1GZC A;  1ZRR A;  4I0B A;  1O8S A;  3U75 A;  4CP9 A;  4XFB A;  1FX5 A;  2XG3 A;  4MET A;  1EYB A;  4CDX A;  4FXK B;  1IG0 A;  4MXW B;  1G86 A;  1ZRF A;  4TLF A;  2XHN A;  1H8V A;  3THP A;  5DAW A;  2HWF 3;  1PK6 A;  1U5I A;  3DGT A;  3MPB A;  5FWE A;  1AR7 3;  5FAX A;  5FDB A;  3NV1 A;  4OLL A;  1W0N A;  1ZBE 3;  2MPF A;  2AGS A;  3LQC A;  2TBV A;  2CAV A;  2WO7 A;  2Y6H A;  2XL7 A;  4JKK A;  2ZBJ A;  4IE4 A;  2AEN A;  2VME A;  1VBC 2;  1XNT A;  2KM2 A;  4FQ4 A;  3VBS C;  4ZU4 A;  1NQJ A;  1S0G A;  3WF1 A;  4Y4Y A;  4LBM A;  4XE9 A;  2ZX2 A;  2VEC A;  3I59 A;  4CVU A;  5FK7 A;  3N36 A;  4CDU B;  1FAY A;  5FZB A;  1ZRE A;  1UY2 A;  4RQP A;  2WAB A;  4L8Q A;  4FPH A;  5HV0 A;  3BN6 A;  2VMF A;  5D8A C;  1UOF A;  4EN6 B;  2ZHK A;  4HN0 A;  1ASJ 1;  1O3S A;  3UK9 A;  1J3P A;  3WY6 A;  1RUE 1;  1WZX A;  2VZP A;  3PVE A;  1UU6 A;  2EID A;  3ZO0 B;  5C70 A;  2E7Q A;  2VJX A;  1GOH A;  2B39 A;  3DL3 A;  4I01 A;  4DUX A;  4KH9 A;  1YEW A;  1K3I A;  1ZBE 2;  2A70 A;  3HN3 A;  4GMP 3;  1MS0 A;  4HET A;  4FOY A;  2P6C A;  3A22 A;  5FYH A;  5JUV A;  1SCS A;  4FTS A;  3D5O A;  2DYC A;  2VPV A;  4YG0 A;  4ZHN A;  4BXF A;  4OUE A;  1RMU 1;  1YNA A;  2UY8 A;  3POS A;  4LO4 B;  3UT0 A;  3ZFE A;  2KXL A;  2WS9 3;  4C0B A;  1QHD A;  3WCR A;  1SLI A;  3MW4 A;  4JRL A;  1W6P B;  2JIC A;  5KC6 A;  1SLC A;  3WEZ A;  4FTB A;  1BMV 1;  1HKD A;  1IKP A;  4MGI E;  3AZZ A;  2D6K A;  4N43 A;  2QQO A;  2IC1 A;  1RUI 3;  1PX3 A;  5JZG A;  2MNG A;  4FPO B;  4LO6 B;  4AQS A;  2R04 1;  5DN2 A;  2VMG A;  4R4Z A;  1YI9 A;  3GZT B;  2P4E A;  4HN1 A;  1JYX A;  2CGP A;  1S0B A;  5C8C C;  3ILF A;  4QQO A;  2DCJ A;  1XB9 A;  4ZON A;  5FYC A;  1CIY A;  1Q56 A;  2O8O A;  2Q0A A;  4CCK A;  3IMM A;  2VU9 A;  4QU1 A;  3WXP A;  4D6Q A;  2BNO A;  2WFF 3;  5TSW A;  1K5M B;  1UYZ A;  3H8R A;  3VBR B;  5ABJ B;  2WT0 A;  2DV9 A;  1PM7 A;  4IGP A;  2WS9 2;  5BNP C;  3M8L A;  5EYY A;  3VD7 A;  1KS5 A;  2VNR A;  3I2O A;  4MXV A;  3MFA A;  1VBB 3;  2PTM A;  2D6P A;  5CNA A;  1Y3T A;  4KG0 A;  1VAK A;  2XQR A;  4AGV A;  4WM8 A;  4PI0 A;  2ADE A;  4XJ9 A;  1RUG 2;  1SHW B;  2C5D A;  2JG9 B;  1UX6 A;  2VOT A;  3PME A;  4CDW A;  3FJS A;  2FMD A;  2J1T A;  4QXH A;  3AKQ A;  2FDF A;  1Y9M A;  1NXM A;  2CYF A;  4WV8 A;  4E2Q A;  3LAG A;  2LRO A;  5A7W B;  1Q5O A;  2HWD 2;  1POQ A;  1FNY A;  1QJU 2;  1W8W A;  1BLZ A;  3UJQ A;  3VBU A;  3OUI A;  5BV6 A;  2P3I A;  3VBF B;  4JGZ C;  2EXJ A;  1ENS A;  3SH5 A;  1ULC A;  1ND3 C;  5F6K A;  1LB2 A;  2K9Z A;  2IVJ A;  4NIA A;  4QT6 A;  1CX1 A;  4XDP A;  5EXO A;  1QGL A;  1U5X A;  3O0X A;  3WNO A;  4A7Y A;  4XIK A;  5LW9 A;  3K3O A;  4PLN A;  4MUV A;  5IFT A;  2HLE A;  4OI4 A;  3KV9 A;  4P9X A;  4RS5 A;  1AYN 1;  2PMW B;  2GC0 A;  3FX3 A;  1OLR A;  5F6L B;  4OI1 A;  3VBS B;  3VKO A;  1TMF 2;  2YGM A;  1W6M A;  2WZR 1;  1UNB A;  1K45 A;  4MGZ E;  3ZFG A;  4JV4 A;  1KFX L;  4WZF A;  2EIG A;  2RV9 A;  3MLJ A;  1MQT A;  2G19 A;  4L99 A;  5FY9 A;  3UGG A;  4F83 A;  5D8A B;  1QNY A;  5FZO A;  3RZZ A;  2JEN A;  1H4H A;  3H3L A;  3HOB A;  1VBD 3;  4GMP 0;  4KWJ A;  3WNM A;  2EIB A;  2VQ0 A;  3I54 A;  2BU9 A;  1EV1 3;  4JQT A;  4BIF A;  3AXE A;  2OZJ A;  2VNV A;  1CAV B;  1YQ6 A;  3B5L B;  2FCV A;  1HB2 A;  1MVQ A;  1R1A 1;  3N9M A;  4FFF A;  4WVM A;  4QPI C;  1NKG A;  2FZ2 A;  1O8P A;  1AXZ A;  1H8T A;  4MHU A;  4QMA A;  1RXG A;  4A2U A;  1G9F A;  1VRH 3;  3ZSE A;  1YRZ A;  4A6O A;  4LIU A;  2ADD A;  3D6E A;  4M00 A;  5C5U A;  1HJF A;  5KHK A;  4IUG A;  1D2S A;  1DU3 D;  3AB0 A;  1AL2 2;  1O4Z A;  2V73 A;  3ASI A;  4QXB A;  1XOY A;  1PGL 2;  4P08 A;  4U2A A;  1VB2 A;  4AEJ A;  3H1W A;  3O0W A;  3OUJ A;  5FOB B;  2PFW A;  2WWJ A;  5I91 A;  3SIT A;  1H6Y A;  1C1F A;  5DUX A;  3O1U A;  4NIG A;  4XUR A;  1GQG A;  1S0C A;  1MEC 3;  2ARB A;  3M70 A;  5J98 B;  4XFF A;  1OQE A;  5F5A A;  1OFN A;  4IV3 C;  1AX0 A;  4KGQ A;  4E4H A;  4BCU A;  2XBO 1;  5C8C B;  1NYW A;  2WJS A;  4JX0 A;  4AEK A;  5DZE A;  4D7Y A;  1GQH A;  3WW1 A;  5CA6 A;  2XJS A;  1HDK A;  3ES1 A;  1FV2 A;  2JDA A;  3WDW A;  1LEC A;  5FYY A;  4E4S A;  2WYF A;  4MYE A;  5FYT A;  3E6B A;  2R06 3;  3R4D B;  1CZT A;  1C8N A;  5FLI A;  5BNP B;  1RVF 1;  3ZYH A;  3JCI A;  5IT6 A;  3JQW A;  4Q4W 3;  2I07 B;  2ZTN A;  3WHU A;  1QNW A;  1V9U 3;  4X6R B;  3HJR A;  1YQC A;  2RG4 A;  5CKM A;  1IPK A;  2RDS A;  2MHF A;  3CJI C;  3TNP B;  1UXX X;  1W04 A;  5KXB A;  1LOF C;  5GLU A;  1US2 A;  1XNC A;  3TOJ A;  1C8M 3;  1PMJ X;  1QEX A;  5BY5 A;  1Z0H A;  1RXF A;  4XCA A;  1S0J A;  3MI8 A;  4JGZ B;  4RYD A;  1QDO A;  5KHJ A;  1HXS 1;  2QFE A;  2OPW A;  5DXD A;  5FP3 A;  3RDI A;  1JZ6 A;  2JE8 A;  3OOX A;  4NE9 A;  5F8P A;  1CWP A;  2W2I A;  2Q8C A;  5GZG A;  1S2K A;  5EV7 A;  1BJQ A;  1VE0 A;  5JXI A;  4QU2 A;  4AWD A;  1DQ6 A;  3J9S A;  4DZG A;  1OXC A;  3BCW A;  4UI9 L;  3GZU C;  4CPB A;  1LJ7 A;  2D3S A;  3V56 A;  3ZN5 A;  5GLZ A;  3ZYG A;  4CDX C;  4OMD A;  3HMY A;  4HZF A;  3QD6 A;  3SMH A;  4OHV A;  3U14 A;  3WP4 A;  4AFA A;  2YBP A;  1PK6 C;  3D8C A;  4N9I A;  2X05 A;  2GH2 A;  4W8J A;  1NCR A;  4QKB A;  3VBO A;  4FP2 A;  1V0A A;  5L36 A;  1IOA A;  2EAK A;  3AJY A;  3AVR A;  3VL9 A;  1TZO A;  4AED A;  3NST A;  1I3H A;  5CFD A;  1YO8 A;  4Y1Y A;  5C4W A;  2O8Q A;  2D3R A;  2GC1 A;  3OUH A;  1IHM A;  2A75 A;  1WLD A;  2XML A;  3LCP A;  2BUK A;  4LUL A;  4OUS A;  4BQW A;  3C7E A;  4RQP C;  4QPG A;  4QPI B;  1PO1 2;  1COV 3;  4HPK B;  4J6G A;  3SLI A;  1CPN A;  2GMP A;  2ZHL A;  5F37 A;  1HLC A;  2I2S A;  4DUV A;  1DGL A;  4WZC A;  2ZGT A;  1LCL A;  1B35 B;  3OCP A;  1NUK A;  1M06 G;  4XHB A;  5KXE A;  2JDM A;  3V65 A;  5T54 A;  2IVI B;  5FP4 A;  3IDC B;  2UY9 A;  2HWD 1;  1WCQ A;  4PJY A;  3SKV A;  3A21 A;  1UZV A;  1AXK A;  4QQH A;  3WOG A;  3T2Q A;  3GAL A;  2VW1 A;  2IFW A;  1O3T A;  1CON A;  4TN7 A;  1I5Z A;  4KG8 A;  4E4D X;  3DUI A;  3FLP A;  5A3M A;  5F3G A;  3MIB A;  1GV9 A;  3PUS A;  3ZFE C;  1RUH 3;  5DPN A;  1Q3E A;  3PVN A;  4IEP A;  4LEJ A;  5A3O A;  4PLM A;  1N1Y A;  2VVE A;  4MAD A;  2FHR A;  3T3Y A;  1J1L A;  1SAC A;  5KHH A;  4AHY A;  4PF1 A;  5IAX A;  3LOI A;  3WVJ A;  4JQR A;  1ZBA 3;  3LOB A;  4N43 C;  4FPJ A;  2DUQ A;  1CAW A;  5A7P A;  4WVZ A;  2ZMN A;  5JZG C;  1W2T A;  1TMF 1;  2DVD A;  3VBH A;  5L9V A;  4XF3 A;  5CEH A;  1H2L A;  5DZF A;  1EAH 1;  1W2O A;  3T0B A;  3WLU A;  4NPR A;  3KQ4 B;  5C7G A;  4IER A;  1QWR A;  1FYU A;  2VMH A;  1JTZ X;  2VAU A;  4XF4 A;  4YZ5 A;  5FZF A;  2WA3 A;  1RUD 2;  2ZPX A;  1QJZ A;  2EXK A;  2ZKN A;  5LBF A;  2VXR A;  2PQS A;  3HAG A;  4A45 A;  5HXM A;  2I45 A;  3D82 A;  1FI2 A;  2ATF A;  1PO2 3;  3BGA A;  4LKF A;  3MO4 A;  4E2G A;  5JXG A;  1UW8 A;  3CJI B;  3OBT A;  1SFY A;  4XHX A;  3TN9 1;  5IWF A;  1NA1 A;  3PU8 A;  4XF0 A;  2DUR A;  3LF7 A;  4IE5 A;  4LKD A;  4LO7 A;  4YW1 A;  2HWE 3;  5CKQ A;  2R1B A;  4TLG A;  4D7T A;  3K2O A;  3NAP A;  3AP4 A;  5A32 B;  1LU1 A;  2JX9 A;  4XPV A;  4WM8 C;  1QJY 1;  5T5P A;  4AGR A;  3K51 A;  4CDW C;  4UT5 A;  5J09 A;  4FFI A;  1PGW 2;  2JD4 A;  3AK0 A;  2C24 A;  1VBE 2;  4QX3 A;  2DVA A;  4YM0 A;  3POW A;  4K8R B;  4HK8 A;  1CGP A;  3CMG A;  3AL6 A;  4M3C E;  4TZD A;  4NAO A;  5SV5 A;  4OI2 A;  2VNG A;  4HBN A;  2XWB B;  5EWS A;  2C1F A;  2DBI A;  1HV0 A;  1Q43 A;  2VG9 A;  4XMA A;  3VBU C;  4CP9 B;  5JSP A;  5JOZ A;  1ULF A;  2VXJ A;  4QAW A;  1DQ2 A;  4XIL A;  4QD2 A;  2OW4 A;  2ARC A;  3DYP A;  1APN A;  4YW5 A;  4CDX B;  4MGQ A;  1PO2 2;  2A3W A;  2XOM A;  5FO9 B;  1H1A A;  1SDW A;  4OHZ A;  1A8D A;  2HJI A;  1AJO A;  1PK6 B;  1S2B A;  3B94 A;  1OSG A;  3ZM8 A;  3AMN A;  3TEY A;  4RS5 C;  4XUN A;  2VVD A;  2RDR A;  2HYX A;  3MEP A;  1D0G A;  2ZZJ A;  2ZMK A;  4XFH A;  5HBA A;  2Y6L A;  4YRD A;  5DAP A;  3VLB B;  2QVS B;  2R07 1;  4MH0 E;  2H6C A;  2RS5 2;  4FFG A;  2SLI A;  3I59 B;  3IAQ A;  1KDK A;  4KL1 A;  1NZC A;  3NNJ A;  3ZFG C;  2RDQ A;  2ZGP A;  4RQP B;  4O9E A;  5A6X A;  1MQT C;  1CVN A;  1OKQ A;  4K6B A;  4Y1X A;  5CAZ A;  1SG3 A;  4WM7 C;  2HEY F;  2K46 A;  3U37 A;  4GKY A;  4HXC A;  2P17 A;  2EVX A;  3HNY M;  3OB8 A;  1OLM E;  1GKB A;  1YUD A;  5F3E A;  4AEM A;  2IUW A;  2RS3 2;  2Y0O A;  4B4R A;  3URF A;  5FZ7 A;  4KBZ A;  4CXY A;  1MAC A;  1WW6 A;  3PHM A;  2GZW A;  4KI5 M;  1HX6 A;  3SH3 A;  3R05 A;  5FK8 A;  4LLO A;  3B00 A;  2ORZ A;  3NJZ A;  1R09 1;  1LHU A;  1QXP A;  2CAU A;  2GND A;  3IBM A;  4GJY A;  4CXX A;  3V64 A;  1JYN A;  2Q5T A;  1N1S A;  5LZ6 A;  1QJX 2;  3HT1 A;  5LA0 A;  4CEY A;  4O65 A;  3ZSJ A;  1RC6 A;  1HRI 2;  3BAL A;  2GNT A;  2XVL A;  3POJ A;  5DAV A;  5FY1 A;  4B29 A;  3HBK A;  5FRA A;  1DQ1 A;  2WBK A;  4A41 A;  4QM9 A;  5FQ0 B;  1J59 A;  1C5H A;  1D4M 1;  2NN8 A;  4Q8L A;  3POE A;  2YU1 A;  2W46 A;  4Q2F A;  4N43 B;  2YDE A;  4A4A A;  5JZG B;  1KGY A;  4XUT A;  5CBL A;  4AW7 A;  3DV8 A;  2QKD A;  1Z7S 1;  1VAV A;  1SEF A;  2VZS A;  1BBT 3;  1BVV A;  1AXY A;  2UU8 A;  2VUC A;  4GJZ A;  2G9Z A;  4XZU G;  3VDC A;  5F2S A;  1GYK A;  4Q4Y 3;  3VKL A;  3NL1 A;  2OA2 A;  1WBF A;  1Q8S A;  2RR1 2;  4KBB A;  5GJ6 A;  2HWB 2;  3ZXJ A;  5I8S A;  3ES4 A;  4GB3 3;  1AX1 A;  1LHW A;  4IE0 A;  4HAN A;  4ASM B;  2QNK A;  1DG6 A;  3WG4 A;  5BNO A;  4UAP A;  2RDN A;  4Y24 A;  4PDW A;  4XBL A;  4RHV 1;  3AZX A;  5EPA A;  2GNB A;  3I2J A;  4XW3 A;  3AZV A;  5GZE A;  1YJK A;  3BOW A;  1UY3 A;  4GQ7 A;  4CEW C;  1HN0 A;  4WM8 B;  2VZQ A;  3VHP A;  4CDW B;  2A71 A;  4A6S A;  1STM A;  1LKN A;  1OC1 A;  4NAM A;  4YW6 A;  3T4H B;  1RUC 1;  4K40 A;  2BNN A;  1XU1 A;  2Y8K A;  5KXC A;  1OVP A;  1JOJ A;  3SEP A;  3C3V A;  1OMI A;  2RMU 2;  5FY7 A;  3VGI A;  3WDU A;  1BBT 2;  5F32 A;  3POB A;  4OHX A;  2Z2S B;  3M1H A;  4LE4 A;  4Q4Y 2;  4S2H A;  3D0S A;  3ELN A;  4QQL A;  5M0T A;  3V0A A;  4Q8K A;  4YVS A;  5T55 A;  2PXJ A;  1XNK A;  1JZ4 A;  5GM0 A;  5FYS A;  4LXL A;  4Z92 B;  1WW7 A;  3IM0 A;  1A8M A;  1X9T A;  1HIX A;  4I2O A;  3L2Y A;  1ASJ 3;  1OLQ A;  3J7M A;  4LR4 A;  1JBC A;  1XE8 A;  2ZS6 B;  3I2H A;  1PZ8 A;  1GWL A;  2BGC A;  3O14 A;  2JG8 A;  4RS5 B;  1BHG A;  4K7J A;  3EHK A;  3TRS B;  1JH5 A;  2YBS A;  4XJU A;  3SHR A;  4EWD A;  2HBT A;  5KR7 A;  4H2A A;  2WAO A;  4P9W A;  1WW5 A;  1G6N A;  4B8E A;  2WSV A;  2NPI A;  1O4Y A;  4P14 A;  4S2D A;  1VLN A;  3GF6 A;  1W39 A;  2JEM A;  4NPM A;  2GAL A;  5AVP A;  2V5Y A;  3ZDV A;  2VE1 A;  5FZH A;  1HQN A;  3I3M A;  4HKL A;  3VBO C;  1RMU 3;  4FTE A;  4O7X A;  1PZ9 A;  3KVB A;  1JMU B;  1WCU A;  4HSJ A;  4K1Z A;  4OUL A;  5F5I A;  1MR5 A;  4GH4 C;  2I74 A;  4AED C;  3LEI A;  2J22 A;  3L9J T;  4Q29 A;  3MDP A;  4WM7 B;  5FZO B;  1O3R A;  4CA9 A;  5CFD C;  5C4W C;  4NID A;  1NAE A;  5BXX A;  2R30 A;  1E5S A;  4FP3 A;  4ONU A;  4P9L A;  1XE7 A;  5FZ3 A;  2YPJ A;  2E7T A;  4JKM A;  2D40 A;  1HB1 A;  1ND2 C;  1X8M A;  1H0B A;  2O0O A;  2PHD A;  1VB4 A;  4BK4 A;  2X10 A;  3ORJ A;  1WD3 A;  2Z42 A;  4QPG C;  2R7E B;  1W9F A;  3OGG A;  2R04 3;  4UBG A;  3KV5 A;  4FPL A;  4Y22 B;  3KF5 A;  1WCD J;  1W06 A;  2VC9 A;  4QB2 A;  4QKN A;  3MIF A;  1CAU B;  4CCC A;  1PGW 1;  3HQU A;  1JU4 A;  4FOV A;  5F2W A;  2OS2 A;  3ZIW A;  2J1S A;  2VUD A;  1AR9 1;  2GMM A;  2WO3 A;  3H1M A;  3J8F 3;  2DUP A;  3E5X A;  5A33 A;  1QXR A;  3USS A;  4DRV A;  5JXH A;  1CAX A;  3WW3 A;  2W1S A;  3R0R A;  4YVW A;  1WKY A;  1GNH A;  4EZ4 A;  4LO8 A;  5IVC A;  3JB8 A;  1DYP A;  5FKC A;  2MEV 1;  2VZ1 A;  3NNL A;  3T0A A;  5JAX A;  4HVQ A;  5JI9 A;  1QXJ A;  4NHK A;  5GZC A;  5FYZ A;  4JTO A;  3P6B A;  4QKF A;  4YNI A;  3EXU A;  1UZ0 A;  2JB4 A;  3RQ0 A;  3GCX A;  3I3B A;  2P3J A;  4Y3O A;  2WT1 A;  3DPR A;  3RZL A;  3M3Q A;  3MFC A;  4H7M A;  4RFR B;  1W8O A;  3RYK A;  4BQ1 A;  3HBZ A;  4FPK A;  1FMD 3;  2RHP A;  1TE1 B;  2XGX A;  3OPT A;  3T1M A;  3VBH C;  1XND A;  2VZ3 A;  1V6M A;  1NXD 1;  3Q8C A;  3J8F 2;  4HVR A;  2FMY A;  4WVW A;  4A3X A;  5CIS A;  3KGL A;  4I0W B;  1SFN A;  4WVV A;  4OZX A;  5FZM A;  3ZXF A;  1AZD A;  2RM2 2;  3QLQ A;  3VHO A;  5KHG A;  3OJB A;  2VOX A;  4I3G A;  4CEW B;  1BK1 A;  4NWV A;  5F39 A;  5FYV A;  2NM1 A;  5KXD A;  5GLV A;  1GOG A;  4XXP A;  5LK7 B;  1X9P A;  2RS3 1;  3OD4 A;  1AYN 3;  5HCF A;  2JDN A;  1OBN A;  1DFQ A;  1GMM A;  1OUS A;  1NA1 C;  2Q8E A;  3SCH A;  4DNY A;  5JLV A;  1IS6 A;  4Q27 A;  2CDO A;  1UY1 A;  2EF6 A;  4D8M A;  2C9K A;  3NAP C;  4U36 A;  1RHI 1;  1KDM A;  2VMC A;  5JI7 A;  4LT5 A;  4LBQ A;  4HLT A;  2QDR A;  5GZF A;  1GLH A;  1UL9 A;  1UYP A;  4LTA A;  4BOW A;  3H8X A;  2VBP A;  5C9A A;  2WN2 A;  2SBA A;  2XLF A;  3LEG A;  2JDU A;  3UKN A;  1HRI 1;  4Z8B A;  1VBA 2;  1ONA A;  4DS0 A;  2D98 A;  4GIQ A;  3AFK A;  4YGC A;  5FTT C;  3ZXD A;  1LED A;  2D7F A;  2BWC A;  2JDK A;  1ULD A;  1YHF A;  3VHR A;  3ENR A;  2D93 A;  1R1A 3;  3SNM A;  4A7K A;  3DN7 A;  1SLB A;  4ITC A;  5A3W A;  4CE8 A;  2ZCW A;  5FYU A;  1UOJ A;  5J7M A;  4GWM A;  3LSE A;  4P00 B;  3VBO B;  2Q8D A;  4Q4V 2;  4PT6 A;  2UWC A;  3POY A;  4OI0 A;  2B4K A;  2RR1 1;  4FQZ A;  4GH4 B;  4HT1 T;  4AED B;  1SQ4 A;  4R9C A;  5IVY A;  4A7Z A;  5CFD B;  2DVB A;  4IGQ A;  5C4W B;  1REF A;  5T3N A;  3RVH A;  3VZO A;  2J1V A;  4JC1 A;  3M3C A;  1QQP 1;  4CUC A;  5LWB A;  4UOJ A;  2HWC 1;  3OG2 A;  1REE A;  2WNV A;  3IDB B;  1ND2 B;  2YY1 A;  4NWW A;  5HCA A;  1SLT A;  2BJS A;  4XEZ A;  5J36 A;  2LW8 A;  5EYX A;  2YYO A;  3K4D A;  3DCQ A;  2E32 A;  2ET1 A;  3AM2 A;  2W92 A;  3MHZ A;  4N53 A;  5KWR A;  4RD7 A;  4UYB A;  4E2S A;  2CTV A;  3A0N A;  1QU0 A;  2XBO 3;  4FPF A;  2ZX1 A;  3KB5 A;  4GAL A;  4QKD A;  1F5F A;  3T2O A;  3WP3 A;  1PVC 1;  1SPP A;  2FQP A;  3IB3 A;  4L9B A;  4AI9 A;  5DDJ 1;  3PUH A;  1XJA A;  4ATE A;  4XQW A;  5EP9 A;  1X33 A;  3CIH A;  4NOT A;  5CU1 A;  1F4A A;  4EN7 B;  1RVF 3;  4X8P A;  3AFG A;  5FZ8 A;  1RUJ 3;  4ZZ5 A;  4Y5T A;  3BOP A;  2E31 A;  1E5R A;  2VM9 A;  3ZKU A;  3ZN6 A;  4SBV A;  4CEY C;  3TEZ A;  2D97 A;  2OUJ A;  2VQA A;  2ILM A;  3E5U A;  3NW4 A;  4DUW A;  1WW4 A;  1OOP C;  2WLQ A;  4URA A;  4FI9 A;  4YM1 A;  3IN9 A;  1SCR A;  1AR8 3;  1CAW B;  5F5C A;  1W6O A;  4FPE A;  5FIX A;  2X5I A;  2J1R A;  3VBH B;  1CQ9 A;  3EQE A;  1GR3 A;  5ACA 1;  2HWF 2;  4I30 A;  1V6K A;  4LOT A;  5FBJ A;  1AR7 2;  2BQP A;  5JXJ A;  3LA2 A;  1HXS 3;  2PLV 1;  1FOD 3;  5FLH A;  4AFM A;  2A6Z A;  2W94 A;  3ACG A;  3WF2 A;  1LOA A;  2ZEX A;  2PQQ A;  5FO8 B;  5T5O A;  3T0D A;  1ENQ A;  1RUJ 2;  1GUI A;  1GOF A;  1GIC A;  3RYR A;  2WNO A;  4MHR A;  5CFC A;  1VAL A;  3HR9 A;  1DDL A;  5BNO C;  1MZ6 A;  4I02 A;  4MOA A;  2Z4F A;  1ODM A;  3D4K A;  1ODN A;  4P9G A;  4FAG A;  1NA1 B;  4PDW C;  4KWK A;  5L73 A;  3KD4 A;  1HRV 1;  2JB8 A;  5B4X A;  3NAP B;  5T50 A;  5C3S A;  1N1V A;  1AR8 2;  1GWK A;  4RGA A;  2E6V A;  4YZ1 A;  1FXZ A;  1R08 1;  3FLT A;  3N9O A;  5JSR A;  3POG A;  2XLG A;  1F15 A;  4DOU A;  2BFU S;  3UNP A;  1H2K A;  1JUH A;  1JOP A;  1NY7 1;  2KA3 A;  1AUY A;  3CBN A;  5FLJ A;  3ACL A;  5BYN A;  1FOD 2;  2B9U A;  5EFU A;  2E7A A;  4MO3 M;  1K42 A;  3GBF A;  4X8N A;  3NKG A;  3U10 A;  4YVS C;  2YV8 A;  1KRI A;  3BYW A;  2BP6 A;  4DQA A;  4DPN A;  2W9X A;  2QZ3 A;  3W58 A;  1GNZ A;  4PF5 A;  4UFJ A;  2P3K A;  2XQX A;  1PM4 A;  3TYJ A;  3GGL A;  4I3P A;  1W03 A;  1IKQ A;  1JZ8 A;  4LNV A;  3RWN A;  3QH7 A;  3RS6 A;  3MV1 1;  1XSR A;  1LHV A;  2J1U A;  5GAL A;  2JG8 C;  5LBC A;  1O5U A;  1WLC A;  3ACH A;  4W4Z A;  5EQU A;  1IS3 A;  5K0U A;  3S6P A;  4UFL A;  4FPY A;  1RUI 2;  4YAR A;  3GZA A;  4TXW A;  3S30 A;  2VUA A;  3WDV A;  1GZW B;  4NVP A;  1S2E A;  4EZH A;  5BNN B;  2Q4S A;  4K20 A;  4UXA A;  3B02 A;  2XB6 C;  2KD7 A;  4XF9 A;  1DQ4 A;  4AGG A;  1RL3 A;  1X36 A;  3D3A A;  4LKE A;  2WFF 2;  1PIV 1;  2QQW A;  3I2K A;  4FFH A;  3N4M A;  5H9S A;  3O1P A;  4AOC A;  2VZR A;  1W9T A;  2YRO A;  2VOV A;  3IT8 A;  2XDV A;  3U4X A;  4Y4R A;  3ZXA C;  5DZG A;  4COY A;  3WUD A;  1YFX A;  1VBB 2;  2VBD A;  3KCC A;  4IV1 A;  3WG1 A;  3MW2 A;  2JWP A;  1PMH X;  1TME 1;  1KQR A;  1EAH 3;  2K0G A;  3BU7 A;  4LK7 A;  5AC9 1;  1T2X A;  3ETP A;  4IL7 A;  1UMH A;  3LIH A;  3WHT A;  3ZR5 A;  1RUF 1;  1IQA A;  5T5J A;  4Q1R A;  1JI6 A;  2R1D A;  2XKO A;  4CEY B;  3X29 B;  3V0B A;  1BQP A;  2A1X A;  4CCM A;  3WP6 A;  4YVW C;  3III A;  5FZK A;  1OOP B;  1OD3 A;  5FRE A;  3TN9 3;  1RIT A;  2Y6K A;  4W6X A;  5FMO S;  4IEU A;  1FPN 1;  1RED A;  1V00 A;  3RI8 A;  4HOO A;  4S2F A;  1H4G A;  1WA4 A;  4MVT A;  4ZY9 A;  5A7Q A;  1LEM A;  3ZVX A;  4H7L A;  1QJY 3;  5LB6 A;  4DXT A;  1A3K A;  1J1T A;  3JD7 1;  1UQX A;  1BEV 3;  3AYA A;  1XQN A;  4GXL A;  4LBN A;  4BME A;  3OYW A;  3O1S A;  2RS1 3;  5ERL A;  3DPR C;  5CAD A;  4JKL A;  1AR6 3;  3M3O A;  4R8H A;  4YW4 A;  3ZOI A;  1XNB A;  2DDU A;  1P8J A;  1T6G C;  3DYM A;  5KC5 A;  3ME2 A;  4DO0 A;  3WQ1 A;  3LB9 A;  1E57 A;  4BK5 A;  5BNO B;  2EXI A;  2D6N A;  2BBA A;  3UGH A;  3WNK A;  4AI2 A;  1UZZ A;  2XHK A;  4NHY A;  4PDW B;  3LFM A;  4NHX A;  1R1Z A;  3MUY 1;  3CZU A;  4Q1P A;  2ZAB A;  4AI0 A;  3AKR A;  1UWW A;  5IW0 A;  1FV3 A;  5JWP A;  1VRB A;  3ST7 A;  5A6Z A;  4CTE A;  1K5J A;  1VBD 2;  4IET A;  4FSJ A;  2WO1 A;  3AP6 A;  3FHI B;  5L19 A;  1EV1 2;  3TBD A;  3T2T A;  5I0D A;  4NHL A;  5A3U A;  5GKA C;  5FP8 A;  1BEV 2;  1V6J A;  1ZA7 A;  2ZGL A;  2ZGN A;  1W99 A;  3CKH A;  4I09 A;  4RGK A;  4RL7 A;  3A0K A;  5JR7 B;  5A7N A;  5LY2 A;  3V0A B;  2IXL A;  1VRH 2;  2R07 3;  4JHT A;  2PHL A;  1DBN A;  1AR6 2;  1VBC 1;  4AXO A;  4R52 A;  1CZV A;  3T2P A;  1DGR N;  1W6N B;  3FUO A;  2CNA A;  1JOB A;  1NCQ A;  4CCO A;  3K75 B;  2AZ5 A;  2WNU A;  5JIA A;  5LY1 A;  5LRS A;  1D0H A;  3H9A A;  5C9A C;  2Y6G A;  1Y7B A;  2IXJ A;  4BQ2 A;  2WA4 A;  2VOW A;  3QH6 A;  1AX2 A;  3B9I A;  2ZXQ A;  3O1R A;  3JBG 3;  2JKX A;  2JG8 B;  1MZ5 A;  5DQ0 A;  5LK5 A;  4XC9 A;  4ZKT B;  5JIU A;  3LKJ A;  4AAX A;  4DRR A;  5IK5 A;  5JMO A;  2EIE A;  1MEC 2;  1AF9 A;  3ZMN A;  2YXS A;  1GP6 A;  3RZJ A;  2OXB A;  3HVD A;  1U0A A;  2ERF A;  3KVA A;  5IHR A;  3P3P A;  3B7M A;  4LHN A;  1ZBE 1;  2DFB A;  5KBF A;  1KJR A;  5FZ9 A;  4EJR A;  1ND3 B;  1UF2 C;  1Q8O A;  2CDP A;  4Q0V A;  4BHP A;  2WN3 A;  2OII A;  4LE3 A;  4AFC A;  1LR5 A;  2R06 2;  2YC0 A;  4XBQ A;  2W1Q A;  2NQY A;  2WNV C;  4Y5Z 0;  2VOK A;  4NMI A;  1OA3 A;  2DCY A;  3FN9 A;  2WKK A;  2Q1F A;  3RGB A;  3LDB A;  1VMH A;  1S0E A;  2AUY A;  4N53 C;  4Q4W 2;  4PLO A;  4UF0 A;  3ZPY A;  1LHO A;  1GZ9 A;  4IEQ A;  1Z7S 3;  1UY0 A;  3E1F 1;  2ZGM A;  1V9U 2;  2BOJ A;  2ZJC A;  2X8K A;  2YZ4 A;  2AEZ A;  3L2H A;  1W8F A;  4XUQ A;  5AVA A;  2QZ2 A;  4Z2A A;  1UYY A;  1C8M 2;  1NE4 A;  1YWK A;  1UKG A;  2A5Z A;  2LRP A;  2UYB A;  3PLQ A;  4YVW B;  4YW7 A;  4GMP 1;  2VCC A;  3PUR A;  4LHK A;  3OEB A;  4B3N A;  4X6Q B;  3RFR A;  4B4Q A;  1XNA A;  5I93 A;  3P1I A;  2BPA 2;  2H0V A;  3EMR A;  2NMN A;  1KEX A;  4AQT A;  1JZ2 A;  2WWS A;  4RHV 3;  5CG9 A;  2WS9 1;  1F9K A;  2XH6 A;  1WCK A;  4D69 A;  3BTX A;  1BZW A;  4Y1V A;  2D3P A;  3RYP A;  3F95 A;  2JDP A;  1TVG A;  3JXS A;  2ZAC A;  1RUC 3;  2ES3 A;  3DPR B;  2UYA A;  1ZVF A;  4YZ4 A;  3GHM A;  1X8E A;  2Q8O A;  1RUG 1;  1I1E A;  1S0D A;  4OQ8 A;  1F31 A;  1RUI 1;  1ZNP A;  1JZ7 A;  2X5I C;  3WF3 A;  4D0Q A;  4RR3 A;  5JDB A;  4LIV A;  4V2W A;  1YI7 A;  3FC0 A;  3ECQ A;  3FWE A;  3U0Z A;  2LTN A;  4W50 A;  4QGN A;  3ZFF A;  1QJU 1;  2JDH A;  1O7F A;  1QY4 A;  2VGD A;  3GZE A;  4CYD A;  2Q1Z B;  1KFU L;  1GU3 A;  3EO6 A;  1FT9 A;  2BER A;  4HSL A;  4XAB A;  4YGD A;  4M01 A;  5HCH A;  1UY4 A;  2WFF 1;  1CR7 A;  4B7E A;  3AMM A;  4ZU7 A;  5FPU A;  1SLA A;  3ZDS A;  5L7O A;  1X7N A;  3I3D A;  2ET7 A;  4BQ3 A;  4F8A A;  3WQB A;  1Y43 B;  5I0U A;  4SLI A;  3ZN4 A;  4IV3 B;  5AFE A;  2CHH A;  3MIH A;  2Y34 A;  3DYO A;  3O5S A;  1PHM A;  1COV 2;  3ON7 A;  1UZW A;  1QJE A;  3I49 A;  1W3V A;  3NV3 A;  4LBQ B;  4QDQ A;  1W6Q A;  4QXC A;  5KHI A;  1T6B X;  2EXH A;  2HEW F;  5JOW A;  4P9I A;  5FMB A;  1G9D A;  3OEA A;  4OQ9 A;  1BK0 A;  5C9A B;  3ZLI A;  3S5A A;  3PDQ A;  4XCB A;  5E1R A;  5J37 A;  5CIR A;  1AVB A;  2DVG A;  3WDX A;  4GZ9 A;  2GSY A;  2CGO A;  3KT7 A;  4XFA A;  2CY6 A;  5FY4 A;  5I0T A;  4NII A;  1POV 3;  2J1E A;  2RE9 A;  2V5D A;  2VW2 A;  2WRA A;  1K12 A;  2WL1 A;  5F3I A;  3NVC A;  1RUH 2;  4Y5S A;  3RNS A;  1E5I A;  1E5H A;  1NE6 A;  4AYU A;  4COV A;  1GWM A;  2WZP P;  4GAZ A;  4Q4X 3;  2WO2 A;  5K0U C;  1AJK A;  1ZBA 2;  3KCX A;  2BTV C;  3Q8A A;  3HNM A;  2XXZ A;  4PCR A;  4BXS V;  4NN0 A;  1AL2 1;  2VL4 A;  4IE7 A;  4QQP A;  1PGL 1;  1OF3 A;  1UPI A;  1F5J A;  5A7S A;  2WNV B;  4CCL A;  4YPJ A;  3WW2 A;  2A6X A;  4LBO A;  3ITQ A;  2DWR A;  2MEV 3;  2D6M A;  1AYM 3;  1BVP 1;  4IES A;  4N53 B;  1XPW A;  3E6D A;  4LHS A;  4NHM A;  5IK7 A;  2P5B A;  5C5T A;  2A73 B;  3MID A;  3U78 A;  4BWO A;  4QX5 A;  4CDQ A;  5IJR A;  2PHW A;  4K21 A;  3UES A;  1GFF 2;  1J3Q A;  1SPP B;  2DF7 A;  2OUH A;  2RVA A;  2RJK A;  2ZGU A;  3SCF A;  2B46 X;  4DB5 A;  3RZG A;  3O1O A;  3BI3 A;  4YG6 A;  2HWE 2;  2JDZ A;  3CO2 A;  4IV1 C;  5C71 A;  2YFU A;  5DMY A;  2BYV E;  1YQ8 A;  2B5H A;  1IS5 A;  5C6C A;  1JN2 P;  1DLC A;  2WNE A;  1S1A A;  4FAH A;  2D5H A;  3K46 A;  2ZX4 A;  4KQ7 A;  1DF0 A;  4G4F A;  4PHZ A;  4YLZ A;  3VBR A;  3SIS A;  5ABJ A;  1CIW A;  1AYM 2;  1LRH A;  4KU8 A;  3C8X A;  2WYS A;  3Q8F A;  4AI1 A;  3K4Z A;  1W6O B;  3C7F A;  2X5I B;  3DF0 A;  4CP0 A;  2QQL A;  1NZI A;  3AVS A;  3W5M A;  5FZ4 A;  1RHI 3;  5DAX A;  3MIC A;  2PHF A;  1F8V A;  1HQW A;  3H7J A;  5IVB A;  5K8S A;  5G04 L;  4A44 A;  5DUW A;  1H30 A;  1H8T C;  3E97 A;  1LNS A;  5IK4 A;  4KGG A;  3QAC A;  4XIO A;  2VNO A;  3DEC A;  2P1B A;  3IWZ A;  4HK9 A;  3TAY A;  1O91 A;  5A1F A;  3TB0 A;  3MF9 A;  2Y64 A;  5A3T A;  5H9R A;  2R06 1;  3ZFE B;  3VBF A;  4UFI A;  2YMZ A;  3K48 A;  1UIJ A;  3PTY A;  2ZEY A;  4JDO A;  2X09 A;  3UYJ A;  5CKN A;  2BNM A;  2GME A;  2PHR A;  2VUL A;  2DCK A;  1QMJ A;  4AAP A;  1VPH A;  4YGE A;  4YFZ A;  1RUO A;  5FPV A;  3ZXE A;  1OFS A;  2NMO A;  5ANN A;  3CNA A;  1X82 A;  3ZPO A;  5JR2 A;  3RZK A;  2ZZQ A;  3N7L A;  1POV 0;  2DCT A;  3EB7 A;  2IWG B;  3KS7 A;  1OPO A;  3GNE A;  3UGF A;  2DU0 A;  4XYX A;  4O61 A;  3NKT A;  5FUP A;  3VBS A;  5A1A A;  1DLL A;  3RG0 A;  4HL0 A;  2IXH A;  1HV1 A;  3LZZ A;  4YFW A;  2A3X A;  4IND A;  2HWC 3;  2GAU A;  4RGG A;  5GLW A;  4EQV A;  2H0B A;  2AR6 A;  4IQP A;  2YBK A;  1NCQ C;  5FP7 A;  2WNU C;  1L7R A;  2YGL A;  1UX7 A;  4LIT A;  1Q8V A;  2ZKL A;  5JCT A;  2GP3 A;  3EBR A;  3BUC A;  4BZ4 A;  2Y6J A;  3QBQ A;  1PO1 1;  1MS4 A;  1WUV A;  3J7L A;  3UV9 A;  4E8D A;  4HKW A;  1PMI A;  1PVC 3;  4DXR A;  5FY0 A;  5K0U B;  5LA1 A;  4B1M A;  2CL2 A;  2J7M A;  3AYD A;  5DDJ 3;  4YW3 A;  1DGW X;  5JOY A;  2K2S A;  2VCM A;  2YC4 A;  1DYO A;  4QDS A;  3JB4 C;  3RZM A;  1EUU A;  3B93 A;  4BJ0 A;  4B7K A;  5F7U A;  4LBJ A;  1F2N A;  3TEX A;  4YW2 A;  4BE3 A;  2Y26 A;  4GUL A;  1QOS A;  3VBU B;  3ALQ A;  5L9R A;  2HEV F;  2VO5 A;  1OUX A;  1GQP A;  4E8C A;  1ZZ7 A;  3OGJ A;  4XFG A;  4M3C A;  3DEM A;  4GB3 2;  4Q0P A;  1L7L A;  1YFU A;  2AC1 A;  5EJZ B;  1EUT A;  1V6L A;  1X50 A;  4XOG A;  4MSV A;  3U1X A;  3WT3 A;  4JVA A;  2QQV A;  1UMI A;  2A7A A;  1QKQ A;  4XJW A;  1PX4 A;  4BQ4 A;  1RUE 3;  1H1I A;  3Q9O A;  2KR2 A;  3AMQ A;  1HW5 A;  3MBW A;  4IV1 B;  1W9W A;  2RJ2 A;  3MGU A;  3WZ1 A;  3ZX7 A;  5ACA 3;  1OHF A;  4ZS2 A;  4F7Z A;  4J25 A;  3WF0 A;  2A6Y A;  5GLT A;  1ZRC A;  1MZF A;  2PLV 3;  2XUE A;  2VY0 A;  2AEY A;  5A80 A;  1W6M B;  1H1M A;  2R6Q A;  3SEE A;  2W39 A;  3ACI A;  3I3E A;  4QB6 A;  2A6W A;  3NMB A;  3USU A;  1NCR C;  3KGZ A;  4B4P A;  2EAA A;  3V0B B;  3ZFG B;  1QH6 A;  1WCS A;  4IEV A;  4CU9 A;  1MQT B;  4YZ2 A;  3BPZ A;  3ZMO A;  1RUD 1;  2D5F A;  3T1L A;  5FMD A;  4ORF A;  5A3P A;  2LUW A;  2GN3 A;  1NT0 A;  1HRV 3;  4LBK A;  1OF4 A;  1ASJ 2;  5CYY A;  3WD5 A;  1AL0 G;  3JQX A;  3M4F A;  4WVM B;  1W28 A;  2XUM A;  3KF3 A;  1OLM A;  1R08 3;  3OYW B;  4K9S A;  3S0M A;  1H8T B;  5CB7 A;  5C3P A;  4TWT A;  2AYH A;  1FAT A;  1VBE 1;  3AZY A;  5BUV A;  3OTF A;  1O6U A;  4QXK A;  3MLL A;  1CN1 A;  3ZFF C;  4AR2 A;  1SBD A;  2DBN A;  2HH9 A;  2XJT A;  1BCX A;  1RMU 2;  2QQM A;  1IS4 A;  2ZHN A;  3SQO A;  2BGP A;  4COZ A;  1C28 A;  2OQ7 A;  4QHB A;  3FBY A;  2ARE A;  1QIQ A;  5E16 A;  3DKW A;  4BB3 A;  5JSO A;  3MIE A;  4K1Y A;  1CJP A;  1PO2 1;  2X29 A;  3NQH A;  3PNA A;  5L7O C;  1W8U A;  2BVB A;  4FXG B;  4KNC A;  1BMV 2;  1SZB A;  4FVV A;  3WUC A;  4LA2 A;  4ASK A;  1OA4 A;  5CG8 A;  1F4H A;  4IDZ A;  5A33 B;  3ZSL A;  1MVE A;  2E9Q A;  4EWA A;  4XFC A;  2R04 2;  3UET A;  4QPW A;  4UFM A;  1SLL A;  2DUO A;  2JJ6 A;  5FZL A;  3VV1 A;  4XAA A;  3BTY A;  4QX0 A;  5FXX A;  1BYH A;  3KZ4 C;  4FPC A;  5T52 A;  3ZXL A;  1NCQ B;  1W9S A;  5FOJ B;  4DFS A;  1U5Y A;  2RS5 1;  3H42 B;  4C1X A;  1PIV 3;  1C5I A;  4AFB A;  1C1L A;  4HFS A;  3G6J B;  1ZRI A;  1PGS A;  2ZX3 A;  2JDY A;  4BLJ A;  2R0F A;  5JOX A;  1TEI A;  3LA7 A;  3MIG A;  1JYW A;  3ACF A;  5BNQ A;  1VMF A;  3ZYI B;  2XKP A;  1VAM A;  4JTN A;  4C8D A;  4XFI A;  3VN4 A;  1KD7 A;  3R6S A;  2XWJ B;  1V70 A;  1WLT A;  1TME 3;  1ZM1 A;  3NJV A;  5AC9 3;  4RN5 A;  5FPA A;  4K8F A;  1B35 A;  3OGR A;  1RUF 3;  3T30 A;  3LEK A;  2OPK A;  3OBZ A;  1EP0 A;  2WZR 3;  3PJQ A;  1F35 A;  5E6H A;  2P3Y A;  5B2G B;  1FMD 2;  3OY8 A;  4XJA A;  3T09 A;  1N3Q A;  1QJX 1;  4CP1 A;  1YC6 1;  4BIS A;  3LA3 A;  4AVV A;  2F6B A;  4I0A A;  1ZX5 A;  3ZR6 A;  1J58 A;  4XZP A;  1DYK A;  3H50 A;  3WX5 A;  2OX0 A;  3VDA A;  3TNQ A;  3GCW A;  1UO9 A;  2WFP A;  4UF0 B;  3WNX A;  5HPO A;  1UN1 A;  3W20 A;  1WBL A;  1LOG A;  1YYN A;  2G4I A;  3UJO A;  4CDQ C;  4LA3 A;  1AYN 2;  5JVV A;  3VL8 A;  2D6O X;  1WA6 X;  2YB7 A;  1W2U A;  3WDY A;  2E63 A;  4LKS A;  4YWA A;  1NCR B;  2R0H A;  4BPZ A;  5LAT A;  1SMV A;  1MS1 A;  1LAJ A;  5FXV A;  2WZR 2;  2HWB 1;  1SBF A;  4JAA A;  3WQ7 A;  2WQZ C;  1G8W A;  3E6C C;  2WAA A;  2JXA A;  4EN0 A;  2Y38 A;  5FUN A;  3LDK A;  2JIG A;  1RJ8 A;  2VBB A;  4P9Y A;  3OPW A;  2WSU A;  5F5Q A;  2UWA A;  5FWJ A;  4Q0S A;  1AHS A;  1NQD A;  2Z69 A;  3NRU A;  4QPG B;  2PAK A;  4G3Y C;  4LOS A;  3WG3 A;  4AVC A;  4ES8 A;  3T08 A;  5D21 A;  3NWK A;  3NNG A;  4BA6 A;  4E27 A;  1R1A 2;  2UWB A;  4ERO A;  4L92 A;  4QX1 A;  4ARX A;  1UD1 A;  2BDR A;  2QQN A;  5E88 A;  1UPS A;  1W8H A;  5I0R A;  2RMU 1;  1BBT 1;  1W0O A;  3ZFF B;  1VBC 3;  4OZO A;  2F4L A;  4Q4Y 1;  1S0F A;  3ZIX A;  2DVF A;  4ISQ A;  3O1V A;  1IG3 A;  2B8M A;  2VR4 A;  3LD8 A;  3NNM A;  1UCX A;  4GB3 1;  4DY5 A;  4QHZ A;  3ROU A;  3B9C A;  4ZZ8 A;  4MZU A;  3CEW A;  2VW0 A;  5FPL A;  2OZ6 A;  5IAT A;  1N3O A;  1XYP A;  2QQI A;  3OBA A;  4ARY A;  2V4V A;  1HJG A;  3LPF A;  3VZN A;  1QF3 A;  3ATG A;  5FZ0 A;  3WSO A;  2QE3 A;  1H6X A;  4XBN A;  1DCS A;  1W6Q B;  2XBO 2;  1N1T A;  3RRD A;  3AJZ A;  4Q26 A;  1RUN A;  5HCB A;  4NUB A;  1EPW A;  2YC2 A;  2YU2 A;  2C4X A;  3K3N A;  4BLI A;  1QH7 A;  1L7Q A;  4YSF A;  2B42 B;  3PU3 A;  2FDI A;  1TNF A;  4EN8 B;  1RVF 2;  3GBG A;  3QOP A;  1LU2 A;  2CU5 A;  3ZKY A;  4AL9 A;  2ZGK A;  3VD5 A;  4N7I A;  2OKX A;  3RJR A;  4M3C F;  4P5Y A;  2CSG A;  4PQ9 A;  4F3J A;  3PL0 A;  4A42 A;  5J96 B;  2ENR A;  3M3I A;  2VMI A;  3R4U A;  4JCK A;  2WT2 A;  3B69 A;  2PYT A;  4JGY A;  1J3R A;  2WZE A;  3AKS A;  2AAC A;  3NO8 A;  5I8T A;  3VZM A;  3VZK A;  2G9F A;  2Z79 A;  2NYY A;  2WZ8 A;  3PIG A;  3I4I A;  4IE6 A;  1URX A;  3CJX A;  5APA A;  1GAN A;  4UBH A;  4XQ4 A;  3BKZ A;  4CUA A;  3AL5 A;  1HXS 2;  1KS4 A;  2QBX A;  1WME A;  3JU9 A;  1VJ2 A;  1I9R A;  1UXZ A;  2Y33 A;  3KM5 A;  2VD7 A;  4LUK A;  3AXD A;  3ZYF A;  5A3N A;  5H9Q A;  3C7O A;  3I3Q A;  1N3P A;  3VZL A;  2BGO A;  4CDQ B;  1WMF A;  5FXW A;  3RPQ A;  5FQ0 A;  1BKZ A;  1RUG 3;  4XXA A;  4DY3 A;  4AQ6 A;  4XQD A;  5FZA A;  2ORX A;  2W95 A;  5LCW L;  1I6X A;  1D2Q A;  3MPP G;  5FFO C;  3ZYB A;  2FBE A;  4CCJ A;  3CLP A;  3KHC A;  1A6C A;  1JHJ A;  2YHJ A;  1QJU 3;  2HWD 3;  2AH2 A;  2FCU A;  4CCD A;  2ZAA A;  3M3E A;  1GP4 A;  3J8F 1;  3WR0 A;  3PMS A;  5JPM B;  1ULG A;  2P6H A;  3WIN E;  2GN7 A;  3RWK X;  3N7J A;  3NNF A;  2RM2 1;  1ULO A;  4Z07 A;  5D2A A;  5FKB A;  4LUM A;  4RA0 A;  3UKT A;  4OHW A;  3N9L A;  3PUQ A;  5A6Y A;  5FPZ A;  4GKX A;  4W6W A;  3HIF A;  4XAE A;  3WNN A;  1DQ5 A;  2CWS A;  1TMF 3;  2XJP A;  3H8U A;  3J7H A;  1ENX A;  4OHY A;  3LPG A;  1WWY A;  5H9P A;  3FLR A;  3VDB A;  3RMX A;  1FMD 1;  4V1P A;  2B9V A;  3I8T A;  2LM3 A;  2BZD A;  3HQR A;  3WF4 A;  5JMC A;  2ZA9 A;  1O3Q A;  2FDJ A;  5FPB A;  2WR9 A;  1JYI A;  1VBA 1;  4V2V A;  3EJK A;  4L11 A;  4CP2 A;  4CU7 A;  2PAE A;  5A6Q A;  2JD9 A;  4JDN A;  3KV6 A;  1SBE A;  2DU1 A;  3S7I A;  5IAV A;  1G7Y A;  4HMZ A;  4CRQ A;  3WG2 A;  4PBO A;  2BVV A;  5A70 A;  4M4R A;  2WIN B;  1JUI A;  3N7M A;  4O9G A;  4N7U A;  1C4R A;  5DAB A;  4UW3 A;  1TQ5 A;  1W90 A;  3PVO A;  5DUV A;  2E51 A;  4FO9 A;  1LOD A;  5IFP A;  4Q4V 1;  1RYY A;  1NLR A;  1AL2 3;  2QUO A;  1JOD A;  3FBM A;  1EAH 2;  3O12 A;  2Z5W A;  2ZEW A;  3IDA A;  4QQ2 A;  4OMC A;  1J83 A;  1IGO A;  2OVU A;  4ATF A;  3I2G A;  4H3W A;  3BU0 A;  5IVF A;  4WM7 A;  3GJB A;  2R32 A;  1JU3 A;  3IKW A;  3I2I A;  4FOQ A;  3TWI A;  4BH9 A;  1G9C A;  4R4X A;  2QQP A;  2V09 A;  3F2Z A;  3MUZ 1;  4XAC A;  2ZGR A;  4UW6 A;  3P5B A;  3TN9 2;  1UIK A;  4KU7 A;  2EAL A;  1LOE A;  5C8W A;  5IK8 A;  1NLS A;  4Y22 A;  3W9A A;  4YG3 A;  5E8A A;  3IPV A;  3NJX A;  4IEW A;  3NJY A;  4FOW A;  1QJY 2;  1U12 A;  4KMQ A;  1CAU A;  1DZT A;  1B35 C;  5C3Q A;  4LJH A;  2RS1 2;  3PJY A;  4YVS B;  3VUO A;  1S0I A;  1ENR A;  1LEN A;  1IPS A;  4M3C B;  4QDR A;  2DTY A;  4Q0U A;  3KLS A;  4A3Z A;  2OYZ A;  1PNF A;  3IZO A;  2RJL A;  4UWD A;  3U07 A;  2XVK A;  2Y6F A;  4L0P A;  3OSD A;  3VDD A;  4PIX A;  4YZ3 A;  4XDO A;  4AVS A;  5T5L A;  2X53 S;  4B1L A;  1DGR A;  2VCB A;  3IIA A;  3M7A A;  4IEY A;  2XLA A;  3LE0 A;  2IXK A;  1MZE A;  1RTV A;  5K7P A;  5FY8 A;  2HWF 1;  5L9B A;  2C26 A;  1AR7 1;  3USU B;  1XYN A;  4H14 A;  2QCS B;  1R09 3;  1ZA4 A;  2W47 A;  2GU9 A;  3FE5 A;  1JS9 A;  2V4A A;  3FUQ A;  5IVJ A;  4IEO A;  1O5L A;  4C0H A;  2R07 2;  1XE0 A;  4L97 A;  4Q0Q A;  4ZXK A;  3FMG A;  4JZR A;  1W3X A;  2PEL A;  3FZ3 A;  1RUJ 1;  1RB8 G;  4ASL A;  1O59 A;  1ZZB A;  5A1L A;  5EIY B;  5DG1 A;  2BOI A;  4IEZ A;  1D4M 3;  4JHZ A;  4CEW A;  4GD4 A;  1Y9G A;  1LOB A;  2Q1M A;  4D6R A;  3JBG 2;  5LBE A;  4MGK E;  4DEQ A;  2QDN A;  4YGB A;  3KHB A;  1AR8 1;  4CCN A;  2XL9 A;  1YFY A;  1RIN A;  4P5H A;  2JIJ A;  2WDB A;  1KIT A;  4Y1Z A;  1TNR A;  1DIW A;  2ARA A;  3BIW E;  1FOD 1;  1OPM A;  1R09 2;  1CAX B;  2QQU A;  4GWI A;  4JDM A;  2ZGO A;  4W65 A;  3WNP A;  4Y20 A;  4AHZ A;  3FHQ A;  2EA7 A;  3ZXK A;  1MS3 A;  1NOV A;  5FYB A;  1I5P A;  4JRA A;  1WMD A;  2J42 A;  4LQR A;  4DIQ A;  3HNB M;  4MLO A;  2PHU A;  5EJ3 A;  1G9B A;  3S5Q A;  2PHX A;  1OI6 A;  1OT5 A;  2F4P A;  1GBG A;  1PO1 3;  1UOG A;  2PA7 A;  4HVO A;  5BPX A;  3ZYJ B;  3APB A;  1D4M 2;  4GWN A;  4MX3 A;  5F9T A;  3A7Q A;  4BU2 A;  3S7E A;  2XON A;  4XTM A;  4ET7 A;  4CXW A;  1QOT A;  3AP7 A;  4CPB D;  1ZYB A;  3BPS A;  4DXZ A;  2W87 A;  1Z7S 2;  4ISR A;  5FZD A;  3O0V A;  4BQX A;  1DQ0 A;  3WQ0 A;  5JPN B;  1XU2 A;  1OH4 A;  1W05 A;  4FPG A;  1S55 A;  3P3N A;  4IEX A;  1JYC A;  4IW3 A;  3AP9 A;  4GH4 A;  3HEI A;  4Q5O A;  1VP6 A;  5FP9 A;  1HQL A;  3THD A;  3ZSM A;  4D3W A;  1W9Y A;  3OBR A;  5ANQ A;  3I2D A;  5D1I A;  1LGB A;  1US3 A;  4N8M A;  4D6S A;  5HV4 A;  4XUO A;  4ZU5 A;  4RFT 0;  2VZT A;  5E89 A;  1ND2 A;  1Q8Q A;  2W3J A;  4KWU A;  1IPJ A;  5FYM A;  4PIY A;  4QPY A;  1EY2 A;  1Y9Q A;  4RHV 2;  3W21 A;  3ZYR A;  3O1T A;  3KCY A;  2V72 A;  4BQY A;  5CFC C;  4TTG A;  3CL1 A;  3OD0 A;  4XUP A;  5LEK A;  2BFU L;  1W2A X;  1A78 A;  1VBB 1;  4MXW A;  1OQ1 A;  1LOC A;  1RUC 2;  1LUL A;  4OFG A;  4FT8 A;  3N7K A;  4JGY C;  2QJV A;  2D44 A;  4HKO A;  3OY8 B;  2XJQ A;  1WLW A;  1OA2 A;  3J26 N;  4QGL A;  1D7P M;  4YM3 A;  4XTP A;  1YFW A;  1RUD 3;  4FBF A;  5EZW A;  2QQJ A;  5DAQ A;  2IZW A;  3DKQ A;  2VZU A;  1UZY A;  1XBF A;  3BVC A;  1QDC A;  1DHK B;  2VTF A;  4NPL A;  3VHN A;  1Y4W A;  3IDE A;  4PQQ A;  3SCG A;  4CDU A;  3CHX A;  4OYU A;  4EE2 A;  5FUI A;  2JEC A;  2R16 A;  3ZSK A;  2XJU A;  1OVS A;  2XVG A;  3HD8 B;  5FPX A;  4LPL A;  4DMI A;  2BRT A;  3N9Q A;  2TEP A;  2ZX0 A;  3K4A A;  4CU6 A;  4LLF A;  1VBE 3;  4AZZ A;  3H3Z A;  1N47 A;  3VZJ A;  2E26 A;  5SV8 A;  3BB6 A;  4AI8 A;  1AR9 3;  1YCI A;  2YG0 A;  4N90 A;  2WLP A;  2ZGQ A;  1UKR A;  5FYI A;  1CJD A;  5LA2 A;  3FL7 A;  4NRP A;  4TSV A;  3GJA A;  5F1R A;  3W5N A;  5CVR A;  3THT A;  1JYT A;  3SH4 A;  1O4T A;  2UUR A;  1V6N A;  3JUU A;  5EJ1 B;  5K4L A;  1NLQ A;  4Y26 A;  3A23 A;  3SC7 X;  2C6S A;  2FDH A;  3SKJ E;  3UKV A;  3CF6 E;  1H2M A;  2NZ9 A;  1VBD 1;  3RMY A;  1W6P A;  2NLR A;  1GP5 A;  4AFD A;  1W2N A;  1KJL A;  1EV1 1;  3AZW A;  1CES A;  2D43 A;  1BXH A;  4LHL A;  3RI9 A;  3WV6 A;  1BEV 1;  3B3Q E;  5IVV A;  2JE9 A;  1JHN A;  2DTW A;  2RS1 1;  1VR3 A;  4AE2 A;  4QGM A;  1VRH 1;  4AG4 A;  5IYY A;  1JXN A;  3OGS A;  4Q4X 2;  4XJZ A;  4NJ4 A;  1AR6 1;  1AR9 2;  1OH3 A;  1TG7 A;  2RS5 3;  5I0S A;  5K9Y A;  1GSL A;  1MS8 A;  2VVF A;  1H9W A;  2JE7 A;  3VD4 A;  5FMO L;  3ZN6 B;  2XJV A;  4COW A;  2O1Q A;  2EIC A;  3J7N A;  1B09 A;  1K5M A;  1Q8P A;  2MEV 2;  4QM8 A;  1JZ3 A;  1W8T A;  1XC6 A;  4EV0 A;  2RS3 3;  2VUJ A;  3BIE A;  3MZH A;  2C0Z A;  2YUE A;  3H3U A;  1GNY A;  3POI A;  4UFH A;  1OKO A;  1MEC 1;  4N9H A;  5LA9 A;  1Z78 A;  4UW4 A;  3AX4 A;  4PIZ A;  4IGO A;  2WQ4 A;  2Y0I A;  3LWC A;  4Z82 A;  4AVT A;  1G9A A;  2JG9 A;  4AK3 A;  4EYU A;  2YPD A;  3LIG A;  2ZHM A;  4MV2 A;  1R64 A;  2W5F A;  1PVX A;  4NRQ A;  1QJX 3;  1ULP A;  2BW8 A;  1U5Z A;  1GZW A;  2DFC A;  2ARX A;  2W1U A;  4QX2 A;  1C57 A;  1NX9 A;  5A7W A;  3T4V A;  5AFB A;  5BNN A;  1HRI 3;  2VTX A;  3U4S A;  3O7O A;  5J48 A;  4GA9 A;  3S57 A;  4OCT A;  4PI2 A;  1PZ7 A;  1SFP A;  3CU7 A;  3AYE A;  1UU5 A;  3QCW A;  5CFC B;  5GZD A;  3FFZ A;  4P02 B;  1WGP A;  3KV4 A;  2W0X A;  3KWV A;  3PUA A;  3VKF C;  3MYX A;  3JBG 1;  4NRM A;  3H8O A;  4Q4W 1;  3GM8 A;  3CQO A;  2QQK A;  3RZH A;  2ZOE B;  2HBU A;  4R9A A;  3VKM A;  2E33 A;  4JGY B;  4LBL A;  5A7O A;  3AKT A;  2BV4 A;  1V9U 1;  3BOD A;  2IFR A;  3THC A;  1MS9 A;  1VMJ A;  3LDR A;  4LO5 B;  1HB4 A;  1RJ7 A;  3C7G A;  1UYX A;  3EYP A;  4BDV B;  5ISL A;  4EN9 B;  1NG0 A;  2ZML A;  3WNL A;  1RHI 2;  2RR1 3;  2HWB 3;  4M0H A;  1C8M 1;  5DUU A;  4AVA A;  1QQP 3;  3N3H A;  4XJ8 A;  2BWA A;  4MGS A;  1D4V B;  5F3C A;  4K3U A;  1XXN A;  2HYK A;  2VQT A;  1ALY A;  3CZJ A;  1LGN A;  5D8A A;  5LBB A;  1OOP A;  4XET A;  4ZXE A;  5LEJ A;  3AMH A;  3LFI A;  3RJ2 X;  4CUB A;  4QB1 A;  1ZRD A;  4RSU A;  4HG6 B;  3KMH A;  3VDD C;  3MW3 A;  2E53 A;  1W8N A;  3ILR A;  1MPX A;  2DCZ A;  2IXI A;  1XYO A;  3DXU A;  5G05 L;  1YXW A;  2VCA A;  3ZXG A;  4DEV A;  1XSQ A;  1CAV A;  2RMU 3;  4UFK A;  4XVH A;  3AMP A;  1UMZ A;  1LTE A;  2TNF A;  3J4U H;  4D94 A;  4C91 A;  3C2U A;  4QHO A;  3KT4 A;  2G1M A;  3PTR B;  2O14 A;  4CZS A;  3I7D A;  3ZYP A;  3RSJ A;  1QQP 2;  5FY5 A;  2HWC 2;  5FV3 A;  4P9J A;  4BMB A;  4MGT A;  4UW5 A;  5FXZ A;  2CGN A;  1DZR A;  3HT2 A;  5IVE A;  3ILN A;  1MS5 A;  2ZEZ A;  1UAI A;  2ID4 A;  2XPJ A;  2B45 X;  2WQ8 A;  4G9S B;  1W0P A;  3FHA A;  5EHD A;  1WD4 A;  4BQ5 A;  2W68 A;  1COV 1;  2GC2 A;  3WW4 A;  4NRO A;  3KQR A;  1DGW A;  1PVC 2;  3D0J A;  4ES9 A;  5FR3 A;  1ACC A;  2G9G A;  5DDJ 2;  3N35 A;  3N9N A;  3I97 A;  5C8C A;  5J1X A;  3JZV A;  2IXC A;  1CD3 G;  3ABZ A;  1FNZ A;  2NP0 A;  2F17 A;  2XR4 A;  3AKP A;  1W6N A;  3IAP A;  3WP5 A;  3VB9 A;  1UU4 A;  4NIH A;  3I2F A;  5BNP A;  3AC0 A;  2WUH A;  4OUM A;  5HXV A;  3KT1 A;  5FCC A;  1RUH 1;  2LS6 A;  1WMX A;  2P34 A;  4XMI A;  1JYV A;  1RUE 2;  3E5Q A;  2Q30 A;  2D6L X;  4M0N A;  3OPZ A;  5FJK A;  1ZBA 1;  3B01 A;  3K77 A;  5ACA 2;  3VD9 A;  2BEO A;  4XF1 A;  3SXW A;  2W08 A;  2B7Y A;  2PLV 2;  3ETQ A;  1V6O A;  2CV6 A;  2WWU A;  4RR3 C;  3WCS A;  1HN1 A;  5IUQ A;  4JGZ A;  1OQD A;  4W6Y A;  2GDF A;  3GBW A;  1ND3 A;  4NR1 A;  3MV0 1;  4EWE A;  5FZ1 A;  1UOB A;  5FZI A;  4DXS A;  3LSD A;  2WII B;  4URT A;  5LAS A;  5FMC A;  2L9L A;  2VZV A;  1POV 1;  3H7Y A;  5LRR A;  1CZS A;  2P2K A;  2ZAH A;  3HPN A;  4BM8 A;  3TEW A;  4LOR A;  4YYO A;  2H6B A;  1HRV 2;  2PAM A;  1W8Z A;  4HON A;  2LAL A;  3IPV B;  4CSW A;  2TUN A;  3PIJ A;  2GP5 A;  3OGV A;  1DP0 A;  2HWE 1;  1YIP A;  3BTZ A;  4BIO A;  1R08 2;  2GNM A;  4AQ2 A;  1ZZC A;  3PVB B;  4S2G A;  5FBZ A;  1IZ3 A;  4Q4X 1;  1NY7 2;  2W91 A;  2A6V A; 
#chains in the Genus database with same CATH homology
 5IVY A;  4EZH A;  3AL5 A;  3AVR A;  4IGQ A;  3KVB A;  5A7S A;  3RVH A;  5F5I A;  5LWB A;  4CCL A;  2VD7 A;  5FY9 A;  5FZO B;  4BIS A;  5F3C A;  5A3N A;  5FZO A;  5FZB A;  2XML A;  5FZG A;  5FZ3 A;  2OX0 A;  4UF0 B;  5FXW A;  2P5B A;  4XDO A;  3LDB A;  3U78 A;  2XDV A;  4UF0 A;  5F3E A;  4Y4R A;  5FZA A;  5F37 A;  3DXU A;  3KV5 A;  3DXT A;  3N9M A;  3N9Q A;  4QX7 A;  5FZ7 A;  5FZE A;  5FY8 A;  4AI9 A;  4CCJ A;  2XUE A;  5A80 A;  4LIU A;  5F2W A;  2OS2 A;  5FP4 A;  5FYI A;  3PTR B;  4D6S A;  5FXV A;  4Y33 A;  5FYH A;  5IVJ A;  4GJY A;  3PUR A;  2OT7 A;  4QXB A;  4TN7 A;  4BXF A;  5FZ8 A;  4EZ4 A;  4CCM A;  5FUN A;  5FY5 A;  5FV3 A;  4CUG A;  5FJH A;  5IVC A;  5K4L A;  5F3G A;  3PUS A;  5FZK A;  5FXZ A;  3OPW A;  5A1L A;  5A3P A;  5FY1 A;  2WWJ A;  5IVE A;  5FWJ A;  3N9L A;  3PUQ A;  4GD4 A;  2YU1 A;  4D6R A;  5FYZ A;  4HOO A;  4URA A;  5A7Q A;  5F5A A;  5FZ6 A;  3AVS A;  5F5C A;  4Y3O A;  5FZ4 A;  4CCN A;  4QWN A;  5A7P A;  5IVV A;  4GJZ A;  5FBJ A;  5IVB A;  3N9N A;  4LIV A;  4V2W A;  5F2S A;  5CEH A;  3OPT A;  4E4H A;  5FYY A;  2OQ6 A;  5FYC A;  3LD8 A;  4QX8 A;  5FYT A;  4DO0 A;  4CCK A;  5FPB A;  5A1F A;  5A3T A;  4QU1 A;  4D6Q A;  5FYB A;  5FZM A;  4V2V A;  5FZF A;  4DIQ A;  3N9P A;  2OQ7 A;  5FPU A;  4IGP A;  5FPL A;  3KV6 A;  3UYJ A;  5F39 A;  5FYV A;  5IW0 A;  4AAP A;  1VRB A;  4BU2 A;  5IWF A;  3PU8 A;  5FZ0 A;  5FPV A;  4ASK A;  2Q8E A;  3ZPO A;  3K2O A;  5FZC A;  5FJK A;  4IGO A;  5FP8 A;  5FZD A;  3N9O A;  5FZL A;  4QXC A;  4QXH A;  5A7N A;  5LY2 A;  5FY7 A;  5FUP A;  2YPD A;  5F32 A;  4EYU A;  5FXX A;  4NUB A;  2YU2 A;  5A7W B;  2WWU A;  3ZLI A;  3K3N A;  5FP9 A;  3AL6 A;  3PDQ A;  2PXJ A;  5FP3 A;  5A7W A;  5ANQ A;  4CCO A;  3U4S A;  5LY1 A;  2W2I A;  3PU3 A;  5FYS A;  4LXL A;  5FZ1 A;  5FZI A;  2YBK A;  2Q8C A;  5IVF A;  5FP7 A;  5FY4 A;  4LIT A;  4XDP A;  3KV4 A;  2GP3 A;  5FYM A;  3PUA A;  5F3I A;  5LW9 A;  3K3O A;  4C8D A;  3KV9 A;  4HON A;  5FY0 A;  5A3W A;  5A7O A;  2YBS A;  4CSW A;  5FYU A;  5KR7 A;  2GP5 A;  5FWE A;  5FPA A;  3NJY A;  2YBP A;  5ISL A;  4GAZ A;  2Q8D A;  3KVA A;  2XXZ A;  5FZH A;  5FZ9 A;  5E6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...