5A7WB

Crystal structure of human jmjd2a in complex with compound 35
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
346
structure length
346
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAESCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 346
sequence length 346
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02373 JmjC JmjC domain, hydroxylase
B PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a7wB01
5IVCA 5FYTA 5FZ8A 4NUBA 5FYZA 5FZEA 3DXTA 2YPDA 2VD7A 4EYUA 2OQ7A 5FYMA 4CCNA 3N9OA 5FZIA 5IVBA 3PUAA 4QX7A 5F2WA 5A7SA 5FZMA 2XUEA 4XDPA 2GP5A 3AVRA 5FY9A 5F5CA 2XDVA 3KV9A 5FZ7A 5IVYA 5LY2A 4CSWA 4URAA 5F3EA 5K4LA 5A3NA 5IW0A 5FV3A 5IVJA 4V2VA 5FWEA 2OX0A 4QXHA 4XDOA 3N9QA 3K3OA 4BXFA 5FZ1A 4GJZA 4EZHA 2P5BA 5ISLA 3PDQA 5FZFA 5FZOA 3UYJA 5FJHA 4LIUA 3KV5A 5A1FA 2YU2A 3KVAA 4E4HA 3LD8A 5FYBA 4IGQA 5LY1A 2YU1A 3DXUA 4IGOA 5FPUA 2W2IA 5LW9A 2XMLA 3N9NA 2GP3A 5FZAA 5KR7A 4GD4A 5FZKA 5FXZA 3AL5A 4C8DA 2OS2A 3OPTA 5FUNA 5FBJA 4AAPA 5IVVA 5E6HA 5A80A 3NJYA 4UF0A 5FYVA 5FYHA 5FXWA 3N9LA 5FZCA 5FPLA 3LDBA 5F5IA 5A3PA 5FPAA 4CUGA 4D6RA 2YBPA 5FY7A 3AVSA 5FZHA 5A7WB 4IGPA 2PXJA 5FYCA 5F2SA 3KV4A 5A7NA 4DIQA 5FWJA 3N9PA 3KVBA 4ASKA 5FZBA 5FY8A 3PURA 5A1LA 3PUSA 3K2OA 5FYSA 5FZ6A 5FPVA 4CCLA 2XXZA 3PUQA 5FXVA 5A7PA 4TN7A 2YBKA 5FYYA 3ZPOA 5FZGA 5F32A 5FY4A 5FP4A 4QXCA 5FJKA 5FZLA 5A3TA 5F3IA 4BISA 3PTRB 3PU3A 5A7QA 4Y33A 4GJYA 5FP9A 3U4SA 5F37A 4UF0B 5F3GA 5IVEA 5FZDA 3U78A 4V2WA 4CCKA 4QU1A 4D6QA 5F5AA 2OT7A 5A3WA 5LWBA 4HONA 5FY5A 5CEHA 4CCMA 5FYUA 3AL6A 4Y3OA 4HOOA 3N9MA 4BU2A 5FYIA 5FUPA 5FY1A 5FZOB 3K3NA 5FPBA 5FZ9A 2WWJA 3ZLIA 4D6SA 5FP3A 4AI9A 1VRBA 5FZ4A 4CCJA 2WWUA 4GAZA 4EZ4A 3OPWA 5ANQA 5FZ3A 5FY0A 5IVFA 2OQ6A 5A7OA 3RVHA 4CCOA 5IWFA 4QX8A 4LITA 4QWNA 5F3CA 4LIVA 2Q8DA 4DO0A 4QXBA 5A7WA 5FP7A 5FP8A 2Q8CA 2YBSA 2Q8EA 5F39A 3KV6A 5FZ0A 4Y4RA 5FXXA 4LXLA 3PU8A
chains in the Genus database with same CATH superfamily
1ZZ6A 4ZS2A 1X33A 3SQOA 1RJ8A 1QQP1 5LCWL 4NUBA 3ASIA 4Q0VA 1Y7BA 4H14A 3AYAA 3OTFA 4R4ZA 3TYJA 1ENQA 1XXNA 3ZFFC 1HQWA 5GLZA 1FV3A 3A0KA 4O7XA 4NROA 3DPRB 3UGFA 1W03A 2EALA 5FMDA 1X9PA 2W1QA 2XL9A 2G4IA 4IV3B 2E63A 2HWF2 2JDPA 3KV9A 3ZSKA 2FQPA 3SEEA 3QCWA 3NNJA 5BY5A 5FPXA 4RL7A 5JSOA 3WP6A 1RXGA 4RS5A 1COV2 4WVZA 3ECQA 3D0JA 2Y0IA 5KWRA 2ADEA 2WNEA 1N1YA 1OBNA 3PMSA 3VZJA 4PHZA 4FOWA 2H0BA 4FO9A 3K4AA 2BGOA 2EXHA 3GYDA 2J42A 3WNNA 5I0DA 1XE8A 2J1SA 4OI1A 3VDDC 3POWA 1T6BX 2P4EA 1WA4A 3H3LA 1OF4A 4CXXA 2HWF1 2IXKA 1QNWA 3OYWA 2VU9A 4N53A 3THCA 1O3QA 3O14A 2ZGUA 1CX4A 1W2TA 2W3JA 1W8HA 1WUVA 5FUNA 1LRHA 1COV1 2DDUA 2R16A 2WNUA 4BMBA 3EHKA 1JYXA 5FYHA 3IDBB 4QX2A 1W6OB 1D4M2 4XJWA 2Z2SB 3LDBA 5JCTA 2E7TA 1W39A 2RS53 4JRLA 3H50A 1VBE2 2YBPA 3POYA 3SKJE 3USSA 1JOJA 3NNFA 4E4DX 1K45A 2J1EA 3AMPA 4DIQA 3KVBA 2JG9A 5CBLA 1UWWA 1UAIA 1WZXA 3DKWA 2P3JA 3GM8A 4RFRB 1IZ3A 1O4ZA 2ZX3A 2BVBA 5BXXA 1MEC2 3WQ1A 1C28A 4ZPIA 1HXS2 4E2QA 1JZ8A 3ZR5A 1RUI2 4KNCA 3WF2A 3EB7A 2VZUA 2OPWA 2VOTA 3LOIA 4JZRA 4SLIA 3WNLA 4A7YA 2AEYA 2VUAA 2CL2A 5DAXA 3QH6A 1D4M1 4Y1ZA 1OA3A 3I59B 4MV2A 1PMJX 2VM9A 3IT8A 1A34A 3OSDA 4QPGB 3V65A 3SLIA 5JMCA 3IWZA 4XAAA 3ZYHA 3Q8EA 2BBAA 1J58A 5BNNC 4XW3A 4XF3A 2Y38A 3WP3A 1MEC1 2ETEA 1UPIA 4ZONA 1HXS1 2IVJA 2OIIA 4CU9A 1RUI1 2FDHA 1D4VB 5FZOB 4CU6A 1T6GC 2ZA9A 5CKQA 1BVP1 1FMD2 1SLAA 3DUIA 1POV1 2SBAA 3AKRA 4CUAA 3T30A 4YPJA 3ZXLA 4DUXA 3M3CA 2DURA 3KLSA 4RR3B 3USUB 4XE9A 1B35A 1Q8QA 2VMEA 2KA3A 1HX6A 3FHIB 4PLOA 1AVBA 3F95A 3EQEA 2OUHA 1LCLA 1ODMA 1PO12 1XNBA 2DVGA 4IESA 3WHTA 3WG3A 1WCKA 1R1A2 4YNIA 1MS0A 1S0CA 1AX0A 1S2BA 5AC93 2X5IC 1CD3G 3IN9A 1FMD1 1W6NB 2W08A 5HCBA 1V6OA 4QX7A 1TQ5A 1PZ7A 2FZ1A 1CAWB 1F31A 2CWMA 3NL1A 3ZYIB 3GGLA 3ELNA 2BVVA 4JC1A 3DYOA 5FZ7A 1F15A 4CSWA 2E32A 2FDFA 2DV9A 1Y9GA 4MVTA 1MZFA 2JECA 3M8LA 2DCJA 4GWNA 4XF1A 3SH5A 1AYN3 3AXEA 1PO11 4Z2AA 2GC1A 3TBDA 1ASJ2 1LHWA 4BZ4A 4EV0A 1R1A1 1K42A 3JQXA 5CFCA 3LFMA 2DCZA 4LJHA 4EWAA 5FK7A 2Z42A 3VDAA 1RIRA 4XQWA 3KM5A 1YIPA 4AI1A 1YQ8A 3UYJA 4CE8A 4Z92B 4YGDA 5K7PA 4R52A 4YG0A 4MZUA 4OHYA 1FOD3 3OF1A 2GNBA 1WWYA 4I09A 5FREA 2BPA2 3LA2A 3O0XA 1FXZA 2XBO2 4YFWA 2WYFA 3BB6A 1PVC3 2OZJA 3O1VA 1LODA 4M3CB 1LOFA 1LOAA 1WGPA 4HKOA 2O0OA 1EY2A 5DG1A 5IVVA 2YB7A 3VB9A 4LHNA 2EAKA 2VZQA 5I0SA 2MEV3 1ASJ1 2WFF2 4CDUA 2HBUA 2CWSA 1HJFA 2ZGKA 1BK0A 1HB2A 1MPXA 3AVSA 1YUDA 2A5ZA 3JBG2 4U2AA 3BU7A 1PGW2 4CDXB 5FWJA 4BQ2A 4KMQA 3N35A 1KXGA 5HXVA 4ASKA 2YC4A 1WCSA 4UFKA 3O7OA 5J36A 2LRPA 2NZ9A 3HQUA 3I3EA 4XURA 3NQHA 5FZ6A 4XBNA 1UNBA 1FYUA 4QGLA 5T5LA 2XBO1 3UKVA 1AHSA 3VHNA 4BQXA 1R093 3GJBA 4UW6A 4TN7A 2J1TA 2KXLA 3J7MA 4R9BA 3AXDA 4BQ1A 3NWKA 5FO8B 1J59A 1BBT3 4ORFA 1GSLA 1CX1A 3MF9A 2WFF1 2LS6A 3LB9A 3L9JT 3ZFFB 4COWA 3VBFC 4GJYA 3JBG1 4L11A 1GNHA 1VAVA 1W04A 2C0ZA 4K40A 1PGW1 2R072 3R0RA 3KGZA 1UOFA 1O4TA 1FT9A 1ZX5A 4IXLA 4B7EA 5BNPA 5KC5A 3W59A 4GWJA 5L73A 3RZZA 3WY6A 1H0BA 1OURA 4JTOA 5FAXA 2B9VA 1NG0A 4NIGA 5FZ9A 2EICA 4K9SA 4AI9A 1VRBA 2JDAA 2QZ3A 2XKPA 5C3RA 2Y6GA 4LKFA 3C7HA 1CGPA 4BK4A 4Q5OA 4XPVA 5C4WA 3U75A 1W8WA 2WO7A 1YO8A 2RVAA 3O1PA 3WUDA 4JKKA 1DZTA 1VBB3 2R071 1CAUA 3VDDB 2PHTA 3OUIA 5CU1A 5FZ0A 1SLLA 2BWAA 4HN0A 2CGNA 2WLPA 3D3AA 1SFPA 2XLAA 1F5FA 3KZ4C 4N43A 4LK6A 1DZQA 1L3JA 4LBLA 4OUEA 1W9TA 4X8NA 3UGHA 2ZGPA 1HV1A 4LA3A 3RSJA 4FOVA 3SITA 3WNPA 1DLCA 3AMMA 3S7IA 1PVXA 4XDPA 2E7AA 5C5UA 3LF7A 1NKGA 2GMMA 3MO4A 1OH4A 1YCIA 5JIAA 4XIKA 2WYSA 4I0BA 5FWEA 1JYIA 4CU7A 1ZRCA 4FPFA 1W8FA 3MIBA 3N7KA 3RMYA 3THTA 4A45A 2WSVA 5JOXA 3CHXA 2JJ6A 3AX4A 4HETA 2WS92 3K75B 4AVCA 3ACGA 5CB7A 2JX9A 1AZDA 4Z8BA 5A1FA 4A6OA 5A1AA 4META 5LY1A 4YVWA 4EN8B 4D3WA 3CZUA 4P9WA 2W2IA 3ZIWA 1I6XA 3O1UA 2XJPA 4H3WA 4LO6B 4FOQA 1DQ6A 1QJFA 3AKPA 4AEKA 2JENA 4D7YA 3NJXA 5DZFA 4CU8A 5BNNB 2ATFA 2XB6C 1N3OA 3LPFA 3SC7X 1BK1A 2DU0A 5I93A 3LKJA 1S2EA 1NQJA 3B94A 2OW4A 5FYVA 5CISA 5FPLA 1W8UA 4E8CA 4MH0E 3ILFA 3AC0A 4IE0A 5C7GA 1YQ5A 1RUJ2 5FY7A 5M0TA 2G9GA 1QY4A 2WS91 2HWC3 5L9BA 4QHOA 5IAXA 5JMOA 1H2NA 1HN1A 2GN3A 5E16A 5E89A 1GNYA 4I01A 4ZZ8A 5LA2A 4HBNA 4GULA 1JBCA 2LM3A 4NRPA 3PJYA 2ORXA 3IAQA 5HI0A 4YYOA 3AKTA 3VBRC 2V73A 3ZSEA 1JU3A 1O3RA 4SBVA 3VZNA 3U14A 4AQ6A 1ULFA 2OVUA 1UOGA 3CBNA 3WHUA 5A3UA 1PMHX 3ACFA 2LW8A 3CL1A 2X5IB 2OPKA 1DGWX 1B09A 3WDTA 3WNXA 1SCRA 1LULA 1RUJ1 3H0OA 3K4ZA 3M3IA 4R9DA 3WW1A 3H8XA 3KS7A 4DEQA 4AI3A 5CVRA 2O8QA 5JZGA 3T2QA 4H7MA 4FTBA 1W6QB 3HNYM 4JHTA 1TMF2 1J1LA 2ARCA 3D5OA 1F5JA 4IE5A 2XWJB 4L2NA 4WVMA 1JU4A 4P14A 3AL6A 4AK3A 5BYNA 1J3QA 2WAAA 3G7DA 2GNTA 5FY1A 3VBSA 3ZYJB 5LBBA 2IZWA 3POEA 1XE7A 3QOPA 3B9CA 1NT0A 1ZRRA 3I2KA 2D3SA 1OSGA 5FBZA 3INAA 1QJY2 4QGMA 1CZVA 4AHWA 1H9WA 1D2SA 1VBA2 2HWB3 4MGIE 3B9IA 1QMJA 1D7PM 1LR5A 5FDBA 3J8F3 3UKNA 1LOBA 3S6PA 2C5DA 4LORA 2WNVA 4AEDC 1FX5A 2BUKA 3WDXA 4Q0QA 3ZM8A 1YEWA 1YIFA 2HKXA 5F6LB 1TMF1 2PHXA 4XUTA 1UCXA 1TG7A 4YW6A 3NAPA 1SEFA 2WABA 4RGAA 4W6WA 1MQTC 1YQ6A 5J98B 3AJZA 3A22A 1P8JA 4LOTA 4E2SA 1AR82 3E97A 1V6KA 3NV2A 3OCPA 3BTAA 1RHI3 3P1IA 4MYEA 3K4DA 2ZMKA 1QJY1 4DXRA 4ET7A 4PDWA 3SCFA 5F7UA 1VBA1 1UY1A 1VALA 3IMMA 1GZWA 3VZMA 1GP4A 2PHRA 3ZMNA 4FBFA 3LA3A 2VY0A 3LSDA 4OZOA 3MEPA 3VBHC 3M4FA 1QGLA 2CYFA 2ID4A 2HLEA 3AKQA 2VMIA 5A3MA 1IPJA 1UF2C 1XOYA 3N4MA 4E4ZA 2LUWA 1AR81 3T0BA 4DMIA 3DECA 3GCWA 3VBFB 3DXUA 4AFDA 3C7FA 3C3VA 5JPMB 2WQZC 2ZX2A 2GNDA 4LO5B 5EP9A 5LW9A 2XJUA 4URTA 1WMXA 1OPMA 2GP3A 5C9AA 1CPNA 2A3WA 1HB4A 1W28A 1IPKA 4M4PA 3RS6A 1ZREA 4QX3A 4BA6A 5AFBA 2QTWB 2VL4A 5J09A 2B7YA 3B00A 5C8CA 3TB0A 4XVHA 2YC2A 1NX9A 3WT3A 2W68A 4AVAA 2J1VA 5HCAA 1W05A 1LGBA 4XEZA 5FYCA 3ZFGC 4QKBA 4KWLA 4XAEA 5IFPA 2TBVA 2C9AA 3X29B 3PHMA 3PL0A 1QJU3 5F5QA 1PM7A 5CG9A 1R082 2FCUA 2VW2A 1S0EA 2ADDA 4UFLA 4QX1A 1OT5A 3D82A 3DYMA 4M0NA 5J3UA 5ERLA 3O0VA 2HJIA 5DN2A 4CEWC 4N9IA 3VDCA 5KXCA 2LTNA 4QXCA 4BYYA 2CDPA 4IEUA 4RHV3 1Z7S3 1RXFA 5KXEA 3N7MA 4L0PA 3ZN6A 5CKNA 4CDWA 3ZYPA 2ZHNA 2ZGLA 2UU8A 4AW7A 2AEZA 2YMZA 1H8TA 2JKXA 1WMEA 5IAVA 4LLOA 5L36A 1W2NA 5DXDA 4BWOA 3RNSA 4Y5Z0 1AR73 1UY0A 5A3WA 5J48A 1LENA 1R081 1ZBA2 2A6VA 2WR9A 2X29A 3NKTA 2ZACA 2WA3A 3TAYA 4BQYA 2HWE2 3HJRA 2V4VA 4CPBD 4DUVA 1IS4A 4L8QA 5D2AA 1UZWA 4MGSA 3FX3A 4P02B 2EIEA 3HQXA 2OQ6A 4YGEA 3RYRA 1XPWA 1DHKB 4AOCA 3I3DA 3OG2A 5DZEA 1ND2A 1W9WA 3LQCA 2UURA 2Q0AA 3A4UA 1A6CA 1S0DA 2NYYA 3A7QA 3GJAA 5A3LA 2ENRA 2BNOA 5FQ0B 5GZFA 1YRZA 4KWUA 1HRV3 4Y4RA 3LAGA 4K6BA 5B4XA 4GH4A 1ODNA 2BU9A 4XDQA 5EQUA 5T50A 1ZBA1 1UMHA 1WKYA 2YXSA 3HD8B 4GALA 4NHKA 3N36A 1RVF2 5FYTA 1W6MB 2HWE1 2IXHA 4CXWA 3CZJA 4EYUA 2OQ7A 4Y24A 5C5TA 1NE6A 2LROA 3N9OA 1UZ0A 1PK6A 4FPEA 1EP0A 1QU0A 2WNUC 4N9HA 3BN6A 5F2WA 1VLNA 2G19A 3PJQA 2D93A 1OH3A 1SPPA 2E7QA 4P9IA 5F5CA 1HV0A 4K3UA 1ZZ7A 4YW7A 1J3RA 2JG9C 4EN6B 3ES1A 3U11A 1LOCA 1EAH2 1REEA 5E88A 5TSWA 2W0XA 2BW8A 3TNQA 3UETA 3VBRB 3EBRA 2V5DA 1DFQA 2DVAA 3HOBA 4WZFA 5FKCA 4A42A 3LDKA 5T54A 4DNYA 1RVF1 1BEV3 3JD72 1EV12 1EUTA 3PDQA 3QBQA 2VMCA 1W9SA 5LRRA 5FR3A 1RUE2 4N7UA 4MADA 1PMIA 2A75A 4E4HA 3LD8A 3ZSMA 1H2KA 4AR2A 4Q4W1 4LO7A 1LHOA 1Z0HA 1GZTA 2GC3A 4IGOA 2XWBB 5CFDA 5EWSA 3PTYA 4PQQA 4IEZA 2ZZJA 4D7SA 1UQXA 1MR5A 5GM0A 2D6OX 4BDVB 2D5HA 1RL3A 1QH6A 4A3XA 2R1BA 2QQWA 1EAH1 3WLUA 1RMU2 3FFQA 2E33A 5F6KA 3JD71 4IUGA 1H1IA 4HPKA 1EV11 3T2OA 1RUG3 3WDUA 1ZRIA 4NPLA 1JN2P 2R042 1RUE1 1HDKA 2VBBA 3W9AA 2ARXA 5GLWA 2I74A 4FPGA 4MSVA 1G9FA 1NCRA 5JWPA 5JPNB 1HN0A 4N90A 3Q8AA 4W6XA 1B35C 2W1UA 2XXZA 3PUQA 4AEDB 4TTGA 1UIJA 3O5SA 1KS5A 2K9ZA 2XGXA 1VBD3 3I2IA 2Y8KA 4LE4A 1X8MA 4WVWA 4O9EA 1BKZA 3OPZA 3PVOA 4QQ2A 2BJSA 1A8MA 3AZXA 4TSVA 4XZUG 2IVIB 5FZLA 5HCHA 1CZSA 1OMIA 1RMU1 4Y5TA 3RZHA 3KCYA 1MQTB 1CAVA 3CJIA 3WR0A 5K0UA 5G04L 3POIA 5DDJ3 2W1WA 1UO9A 2R041 3BIWE 1QH7A 2BTVC 5HBAA 3NKGA 1AXKA 1URXA 1DZRA 3WP5A 3S5AA 3BI3A 2OT7A 4E4SA 1SCSA 4I3PA 1D0GA 2E31A 2WO1A 3NV3A 1VMJA 3RZJA 3H3UA 3VBHB 3AZZA 1QIQA 3EMRA 4WV8A 2ZAAA 3MUZ1 4D6SA 3Q9OA 4PF1A 1WD3A 4RQPC 4FT8A 1HIXA 1QDCA 1JZ6A 2WWUA 5I8TA 4HFSA 2D7FA 2DTYA 3OBTA 1KITA 1PM4A 2N7GA 1CWPA 1UU4A 2NN8A 3KQ4B 5A7OA 2RM22 4BMEA 4COYA 4Y1UA 2QJVA 2R32A 4XFHA 3BALA 4QQPA 4LIVA 3ZPYA 1LECA 4Q29A 4QU2A 4QXBA 3A21A 3PVEA 1ZZ9A 4JGZA 4DY3A 3AYEA 4W4ZA 2VMDA 3NSTA 1W2UA 1UY3A 4B4PA 3R4DB 4ONUA 4EWDA 3UK9A 1FPN2 2WLQA 5T5PA 5A32A 1G6NA 1QF3A 4COZA 1NYWA 1QJX2 4E8DA 2PAKA 1X9TA 4IE6A 4PI2A 5FZ8A 5KHKA 2YPDA 1C8M2 3CF6E 3GF6A 5GLVA 3RFRA 5IFTA 5FZIA 2IC1A 4FAGA 4BJ0A 1U0AA 4AFCA 2BYVE 1HQLA 1WW4A 3OGJA 4AE2A 2FDJA 1W06A 2RM21 3ZFGB 2FDGA 5D1IA 1GZ9A 2D43A 3ZN4A 3OY8A 5CA6A 3RPQA 3DYPA 3ZXKA 4AFMA 3HNBM 1XNCA 3FUOA 5FV3A 2BFUS 3MV11 1N1VA 4QDQA 4XMAA 1W2OA 1CONA 3O1SA 2UYAA 1RUNA 4ZU5A 2Q8OA 1FPN1 5GKAC 4RD7A 4CEWB 1POQA 1QJX1 2RDSA 4HL0A 2L9LA 4HN1A 5JSRA 5G05L 4INDA 1C8M1 4KL1A 1QOTA 2P1BA 2RR12 4XBQA 1X36A 3WCSA 1MZ6A 1YFYA 1PO23 4DOUA 1XBFA 3DF0A 4OLLA 2I2SA 2X53S 1SACA 3OD0A 3I2FA 2ZOEB 3I97A 3T08A 1S0BA 4MUVA 3AP6A 2XMLA 2GU9A 1HRI2 1UOJA 4Q1RA 4Q4X3 3SHRA 3W21A 4BIOA 1GYKA 4CP1A 5FCCA 5FXZA 5GZCA 1XNDA 4YM1A 1L7RA 1SBFA 1ACCA 3MF6A 4LBNA 4NHMA 4XF0A 3NJYA 3RWKX 5BNPC 2VBDA 1YNAA 3NNLA 3UGGA 4QPWA 4I3GA 4MXVA 2VUCA 3H1MA 4QQLA 3I4IA 5IK5A 2WRAA 3ENRA 2C1FA 5A7WB 3ZSLA 1UPSA 2E6VA 1VRH3 2RR11 4IGPA 1YXWA 5IUQA 3N9PA 2X10A 2ZX0A 4P9YA 5FZBA 2QQUA 4ZZ5A 2VH9A 2P6HA 3DPRA 4FP2A 3FHQA 3MV01 4MO3M 1HRI1 5LBCA 1F9KA 2VR4A 2DCYA 2YBKA 1JYNA 2XPJA 4LHKA 4FQZA 2TNFA 3OYWB 4LA2A 4Y5SA 4NHXA 2OXBA 3POBA 4YWAA 1C3HA 1YI7A 3PU3A 4F83A 3RZKA 4F8AA 1KEXA 3T0DA 1XRUA 1WLTA 2WNUB 1OQDA 3RJ2X 1PNFA 3WXPA 4HKWA 4YFZA 2GC2A 3AFKA 4AZZA 5KHHA 3CO2A 1JZ7A 1K5MC 4QU1A 4A7KA 4HMZA 4OI0A 1US3A 1XU2A 2YPJA 5AVPA 4A2UA 3GNEA 1IQDC 3U37A 2JG9B 2V5YA 4UW5A 2HWD3 1DQ0A 1WLDA 2VZPA 2WIIB 4COVA 4NWVA 4A7ZA 2XVLA 4KQ7A 4GXLA 1NCQC 1LNSA 3RRDA 3S7EA 5KHIA 4NHLA 5I0TA 1UYYA 1C5HA 2VQAA 3HN3A 4W6YA 2ZGOA 5KHJA 4U36A 5FMBA 1C1LA 1OUSA 4IETA 5FOBB 5JXJA 1LOEA 2GDFA 3K48A 3B7MA 4CDQC 4Q4V3 2C4XA 3UL2A 1OQ1A 1VBE1 1S0GA 5F39A 1I5ZA 4YZ5A 3WINE 2GH8A 1CIWA 1XC6A 4LBOA 2VQUA 3QACA 2W95A 2C6SA 4LBQB 1E5HA 2BEOA 2NLRA 1U12A 2VVFA 5FZEA 5JOZA 3KD4A 3ZMOA 4CCNA 1TZOA 3PUAA 1YJKA 2RJ2A 3AMNA 1OFNA 1VBC3 2GNMA 4Q26A 2XQRA 3S30A 3I49A 4CZSA 1V9U3 4PT6A 2JE8A 4P9JA 5BPXA 1RUH3 2JDZA 3C2UA 3AVRA 5FY9A 3TN92 3I59A 1UX7A 4QPGA 3FL7A 4M3CE 1BVVA 5FPZA 3QH7A 5HXMA 2ZMNA 1MVQA 3LEMA 1B35B 3AP9A 1BZWA 1W8NA 5IK4A 2RS12 4CP9B 1WW6A 3VD4A 1PZ9A 1SLBA 4UOJA 4GZ9A 4QXKA 2YROA 3LWCA 4YW3A 5FZOA 1OPOA 4YW5A 4DQAA 3IAPA 5I8SA 4QMAA 4PJYA 3WW3A 5BUVA 1YJLA 4WM7C 2FCTA 1M06G 5KXDA 4YM0A 3TN91 3ZDVA 4XXPA 3FHAA 3E1F1 3USUA 1GNZA 5FZAA 1LHVA 2FMYA 1JOBA 1GR3A 1G9AA 3BTYA 4C90A 5C3PA 1JS9A 3IDCB 1G9CA 2BNMA 4B1LA 2GH2A 2RV9A 2PQSA 1QDOA 4UF0A 4JRAA 1S0JA 2AZ5A 1BHGA 4AVSA 4M01A 2RS11 1Q3EA 3MIGA 3PUIA 2ZS6B 4AI2A 2D6KA 2EVXA 4O61A 1D2QA 4RQPB 3ILNA 4KU7A 1JHNA 4KGQA 4MXWA 1I3HA 4XJUA 1CIYA 1Q8VA 3KMHA 4ARYA 4DS0A 1W6NA 2ERFA 2AREA 2YFZA 2QNKA 5FYSA 3I2JA 4CCEA 3LFIA 1CAWA 4Q4Y2 4Z07A 3O1RA 5KBFA 3TEXA 1ZBE3 4Y4YA 4ISRA 2BZDA 5K9YA 3LZZA 1CJPA 2EXIA 3IB3A 3WG4A 2G1MA 3OGVA 2B42B 3ZN5A 3VKNA 4BXSV 3C7EA 2ET1A 1N3QA 2EAAA 1AJOA 1UU5A 1G9DA 4K7JA 3VZOA 3PNAA 3ILRA 3LPGA 4XCBA 4CCKA 1PZ8A 2PLV3 1N1TA 3GBFA 3POFA 4PDWC 4Q4Y1 5C33A 2DVBA 4KI5M 4QKDA 1ZM1A 4MGTA 3H3ZA 3D4KA 3VKFC 3OD4A 2ARBA 3E6BA 3ZFEC 3FBMA 4L97A 1OVSA 4TZDA 4M3CA 2Y6LA 3EJKA 1W8ZA 3ZSJA 2WZR3 1JOPA 2XQXA 3OPWA 3D6EA 4FPYA 3B69A 2VULA 2UWAA 5C3QA 1GANA 4XMIA 1NLSA 3JZVA 4LITA 2ILMA 1RUF3 3T2TA 2WO2A 3AP4A 4AYUA 3ZYBA 4PBOA 2F17A 1SG3A 2ORZA 3M3OA 2P34A 3LSEA 4NN0A 3PU8A 4J1XA 4AGRA 4FXKB 1Y3TA 2QQOA 4AQ2A 4CYDA 1UU6A 4E27A 2WZPP 5AVAA 1NZCA 1GQHA 3UT0A 5BNPB 4C91A 1L7LA 1O3SA 4YG3A 1LKNA 2ZZQA 2AYHA 2J7MA 3ROUA 5IVBA 4QT6A 1GICA 4MGKE 5KC6A 2W46A 1UMIA 1CVNA 1ZA4A 1JYCA 2RDRA 2RS52 4FPLA 2XUEA 2Y6KA 4JGYA 5CNAA 3SCHA 3ME2A 2DUQA 4LTAA 3I3MA 1DF0A 4NJ4A 3LOBA 2K2SA 2VZ3A 3BPSA 3GZAA 2XHKA 2RS33 4NVPA 4Z82A 3JXSA 4GA9A 2P3IA 4P5YA 3C8XA 2J1RA 5L9VA 4Q27A 3K3OA 4NOTA 4HSLA 1VMHA 4GB33 1OA2A 3IPVB 2ZHKA 3R4UA 1JW6A 2YGLA 5GZGA 5FJHA 1DDLA 3THPA 1LOGA 2H0VA 3NO8A 4BQ3A 3H8RA 2RS51 4H7LA 1UMZA 4YVSA 4MHUA 2ET7A 4BOWA 1ZNPA 5CYYA 4ATEA 5GZDA 2VUJA 5FFOC 2CY6A 1AL23 1K5MB 2KM2A 1S55A 4MGZE 1DGRN 1F2NA 3ZX7A 5DZGA 5FBJA 4HK8A 3VDDA 4CP0A 5AFEA 3OOXA 1OKQA 4AVVA 5FXWA 1C4RA 1Q5OA 2W91A 1ZZBA 3AZYA 2Z79A 1H8VA 3KT7A 5A3PA 1MS8A 4TLGA 5ABJA 1LAJA 3L2HA 4OUMA 1NCQB 1LGNA 3BODA 2R7EB 1ZVFA 3U4XA 2XLFA 1US2A 2ZKLA 2WN3A 4KU8A 3H9AA 4JDMA 4CUCA 4XF9A 4XOGA 5FRAA 2WQ8A 4CDQB 4NO4A 1RB8G 3WX5A 3PMEA 3E5QA 4I02A 4ASMB 1PIV3 5FXVA 5L7OC 2DBIA 1KDMA 3MBWA 2WFPA 3WW4A 2BV4A 5EV7A 4RFT0 3MIDA 3WW2A 2GC0A 5A3TA 4HG6B 5F3IA 1R1ZA 4K20A 1NXMA 1GOGA 4XJ8A 3ZXFA 5AC92 3ABZA 4GMP3 4GKXA 3CLPA 5F3GA 2WT1A 4IDZA 1VP6A 1GZCA 3I2OA 1V6NA 3FC0A 3W5MA 2UY9A 4LKSA 1FNZA 1V0AA 3WF3A 1XB9A 1W6PA 1EPZA 3RZMA 5FKBA 5JR2A 4TLFA 1NLRA 3SCGA 1AR93 2QQPA 2FCVA 5BNNA 1AYN2 2NMNA 3P6BA 5GALA 3ZIXA 1CZTA 1RUC3 2JDYA 5FY0A 4Z1VA 4CCOA 5JUVA 1UOBA 4AVBA 1JXNA 2Q5TA 2VTFA 2WZEA 2WNOA 5AC91 2F4PA 1NA1A 4EQVA 3AP5A 5F3CA 1AR63 2CSGA 4LBQD 4WM7B 3NW4A 5FP8A 1UL9A 1F35A 1FOD2 2Q8CA 5LA1A 2XH6A 5JXGA 3DGTA 3K46A 4LKEA 3CEWA 5CFDC 3LEKA 3ZKYA 5IVCA 1PVC2 1W2AX 1YC61 2FBEA 3GBWA 3ZKUA 3RDIA 4YW2A 1REDA 2RJKA 2VQTA 2B9UA 4YG6A 1LESA 2Y6JA 1AYN1 3I2DA 1OOPA 1V00A 2VVDA 4ZXKA 2MEV2 4WVMB 1KDKA 1NAEA 3ST7A 4IEPA 2W1SA 4C1WA 3WNOA 2X5IA 1AYM3 5LRSA 4DPNA 1IHMA 3OGSA 3R4SA 4URAA 4XUNA 5IW0A 3M2MA 1FOD1 1O3TA 4YM2A 4TYSA 4XXAA 4AF9A 1PVC1 1R092 1W6QA 2OUJA 3NNMA 4BXFA 1RITA 2XJSA 2W87A 1HQNA 1Q8PA 3KF5A 2R063 2VZ1A 1BBT2 4LR4A 2MEV1 4DRVA 5JI9A 3POJA 5FYBA 5LBFA 4QAWA 2BGCA 2BERA 1JZ2A 2B5HA 2AUYA 4NRQA 4YLZA 3TEZA 5LEKA 2V72A 2DVDA 4O65A 5ACA3 3UNPA 4RYDA 2YYOA 2OKXA 1GKBA 3AL5A 4OVEA 4M4RA 4UFJA 3VZLA 1OHFA 2OS2A 4PDWB 3NV4A 2BFUL 3VKMA 3GBGA 1DLLA 3PVNA 5FO9B 1GZWB 2O8OA 1R091 5E8AA 3ZFEB 5IK7A 2QQKA 2YDEA 2ES3A 2YV8A 1GLHA 1TNFA 4Y20A 5C3OA 5FZHA 1JTZX 3E6DA 3N3HA 4L9BA 2VVEA 5D8AA 3WDVA 2VOVA 1BBT1 2EIGA 3K77A 3WQ0A 3AM2A 4OFGA 2F4LA 1FNYA 4UI9L 2P2KA 3TNPB 3VHRA 1F8VA 3O0WA 1RUOA 5GLTA 2J1UA 1SLIA 2JEMA 1VBB2 3BKZA 1FV2A 2BOIA 5BNOC 1NUKA 3GCXA 4JGZC 4RA0A 1TNRA 1W8TA 4UBHA 4B8EA 2HYKA 4D94A 2IUWA 3WG2A 2RMU3 1C57A 5FJKA 2EIDA 2JG8A 4IERA 2UWCA 4UT5A 3WVJA 3W58A 5EPAA 1ZZ8A 4GWMA 4XFBA 5F37A 1O8PA 1CR7A 3DCQA 3MICA 1ZA7A 4LK7A 4NPMA 3WUCA 2VJXA 5C6CA 1H2LA 1Y4WA 1TME3 4XYXA 1BYHA 3VBFA 3SH4A 1HLCA 1VBB1 3WZ1A 4CCMA 1OLQA 3ES4A 4Y3OA 3MIFA 5A6XA 5FPBA 4JV4A 2D98A 4HLTA 1YFUA 4QGNA 4XBLA 5FZ4A 3GZUC 3WDWA 3NJVA 4YARA 1Q56A 2P6CA 3MFAA 5IHRA 1ZZCA 3RVHA 1NQDA 5H9PA 2FD8A 3BUCA 3SEPA 4WM8C 4QX8A 4QWNA 4CEYC 4WVVA 3VHOA 5GJ6A 4P9GA 5FP7A 1E5RA 4JDOA 3CIHA 2VNOA 1RUD3 2YBSA 5F8PA 2RJLA 1DGWA 3FWEA 1AL0G 4OQ9A 4LXLA 1H1MA 3AZVA 3H42B 1DP0A 4IEWA 4ZKTB 2WBKA 1UX6A 3RJRA 4B7KA 5J96B 1DGLA 1V6IA 2HBTA 4EWEA 2HEVF 5FYMA 1GOFA 2ZABA 1JUIA 2VW0A 2QQNA 3AFGA 3B3QE 1J83A 1LJ7A 1MS1A 2A3XA 2JE9A 5J7MA 2GP5A 4RS5C 1E57A 3VL8A 4Q2FA 1LB2A 1W0OA 2HWC2 4RN5A 5IVYA 1QOOA 3MW4A 4UW4A 5F3EA 5K4LA 4L99A 1ONAA 4WZCA 1QQP3 3N7LA 3OBZA 5H9SA 5J37A 3MLKA 1AXYA 1MS5A 1XE0A 2VO5A 3AK0A 1ULGA 3OEAA 4CTEA 1NZIA 4IV1A 4NR1A 4UWDA 4DXSA 5L7OB 3O1OA 2FHRA 5EJZB 3WG1A 4MGQA 1WCQA 2Y34A 1SLTA 2ZKNA 3CMGA 3HEIA 2ZBJA 4QDSA 4EN0A 4N53C 1O7FA 2WUHA 1S2KA 2VNGA 2YHJA 5DAQA 4OHXA 4NHYA 3V0BA 1WLCA 2HWC1 3N9NA 1RJ7A 3U10A 5LASA 1SDWA 3T1MA 5FQ0A 3WOGA 3VDBA 1BXHA 4XC9A 2X8KA 5A33A 1V6LA 4FI9A 4KGGA 4ES8A 1F4HA 5FZCA 1XNKA 5LBEA 5IK8A 1BLZA 3O1MA 5A6QA 1W6MA 2JDHA 2WDBA 2HWF3 3MI8A 4XFIA 5H9QA 4OULA 4Q8LA 4F7ZA 1ULPA 5FY8A 1PHMA 1LGCA 4Y1XA 3U07A 3ETQA 2HWB2 2ZTNA 3OEBA 4W50A 5DUUA 1COV3 1ULDA 3J8F2 3MIEA 5CFDB 1JYTA 1CESA 2IWGB 1IS5A 2QKDA 1OC1A 3I8TA 3JB8A 3AZWA 3NNGA 3MFCA 2E53A 5F9TA 2IXCA 4OHZA 4UFMA 2XOMA 2Y64A 1LHNA 2C24A 1OFSA 3LEGA 3U78A 1RHI2 3D8CA 1W3XA 3FUQA 2HWB1 2JKBA 4FFFA 3ZXEA 4MHRA 3MLLA 4B4QA 1JI6A 3WD5A 1GQPA 1ST8A 2BWCA 4CRQA 3W5NA 3J8F1 3Q8FA 4DZGA 4C1XA 3IKWA 1D4M3 2P37A 4FTEA 4HT1T 3ZLIA 5CADA 2H6CA 1IS3A 4GIQA 4W8JA 4CA9A 4Y22B 3ACIA 2AENA 2D6PA 1WD4A 5FZ3A 5IVFA 4XTMA 2JXAA 5CKMA 3VLBB 4KWJA 3VUOA 1ND3A 4P00B 2NM1A 3PVBB 4D69A 3HVDA 4LUMA 3W20A 1MEC3 4I0AA 1HXS3 2WAOA 5DPNA 1RUI3 1MZ5A 1AXZA 3FMGA 1RHI1 3KT1A 3E6CC 1DYKA 3M3QA 4FPKA 1UIKA 2WZ8A 1JH5A 1POV3 4AEJA 3I3QA 3NJZA 3E5UA 4DXTA 2HH9A 1KJRA 3ACLA 2QUOA 5E1RA 4XACA 1LTEA 3DXTA 2Y0OA 1QJZA 1UD1A 3B5LB 1YHFA 3GZTB 3VBUA 4GWIA 3OGRA 2TUNA 3EXUA 3FLRA 2WT0A 1WBFA 4FFIA 4AHYA 3T1LA 1ZRDA 2BQPA 3ZYRA 1CAXA 4R8HA 4LEJA 3SNMA 4BH9A 2ARAA 5A3NA 2Y6FA 5CFCC 2DUOA 4P9XA 1QJU2 1YYNA 4XDOA 3HN1A 1FMD3 4S2GA 2JB4A 1YQCA 2PAEA 3N9QA 5BNOB 4IL7A 1OKOA 3IIIA 4JGZB 2WL1A 4BLJA 1M4WA 3HNMA 4OYUA 5ISLA 4QPIA 3VKOA 5HCFA 5JIUA 1MS4A 5A32B 4RHV2 2CAUA 1MS3A 1Z7S2 4HVOA 4FAHA 1LOFC 3CJXA 3IDAA 3FLPA 1PO13 2XL7A 3ZXDA 3S0MA 1R1A3 4CDUC 4C8DA 1IOAA 4X6QB 1QJU1 4HK9A 2WA4A 5T3NA 3IM0A 3KT4A 1AR72 1MVEA 2Y60A 2YZ4A 3ZDSA 2ZHLA 5CG8A 4MX3A 4DXZA 5T55A 2D5FA 2P17A 1VAMA 4M3CF 1H6YA 1UZYA 4R9CA 4NWWA 5A6ZA 4K8FA 3APBA 4QD2A 2PXJA 4FP3A 1OXCA 4RHV1 3V64A 4LO4B 1Z7S1 3WEZA 1O8SA 2W5FA 3NMBA 4WM8B 3WNMA 5DUWA 4BM8A 3K2OA 2JWPA 4CEYB 4YSFA 1JZ5A 2YUEA 5DUVA 4MG2A 1W0PA 3WF0A 1ASJ3 1AJKA 2TEPA 4ITCA 4RGGA 2IFRA 1DQ2A 2PMWB 3M7AA 3P3NA 1HRV2 3RZLA 2Q1FA 5FYYA 3ZPOA 4ZU7A 1AR71 2VMHA 4S2HA 3MLJA 4QX5A 3VBOA 4CEWA 3K51A 4CCDA 3FJSA 2JIJA 2DUPA 2XBO3 4LULA 3IZOA 4QHZA 1OLME 4RS5B 1W0NA 2WWSA 1S4CA 1UZVA 2D3RA 4F3JA 4JGYC 4ATFA 4DFSA 1IS6A 3WQ7A 2QQIA 3KB5A 4HONA 5FY5A 3TWIA 2PHDA 2YY1A 2J22A 3R6SA 4BHPA 4XFCA 4W65A 2WFF3 5C4WC 5CEHA 3J7NA 5FUPA 3KHCA 1HRV1 4LLFA 3PIGA 2VZSA 3JBG3 1KRIA 4IV3A 3SMHA 4XJ9A 2JDMA 2PA7A 4BQ4A 4EZ4A 5ANQA 1CN1A 1E5IA 4A3ZA 1BEV2 4ZXEA 4K1ZA 1HJGA 1K3IA 4AGGA 2A6ZA 1WA6X 4N53B 3I7DA 3KHBA 2X05A 3IBMA 5J1XA 1IQAA 2O1QA 1WMDA 5A7WA 4N43C 4YW1A 4LUKA 4QQOA 1XNAA 2VW1A 5JVVA 2Q8EA 3KQRA 2NP0A 4FSJA 3RI8A 2A3YA 2GMEA 3HPNA 2Z5WA 4YVSC 2VCCA 4YZ2A 3RZGA 3RMXA 2MPFA 2ZEYA 3EYPA 1K5JA 2C26A 4LNVA 3B93A 2JD4A 3OGGA 1REFA 3S5QA 4DRRA 1H4HA 2DU1A 4B4RA 4G4FA 3OUHA 4RGKA 3T4HB 5CAZA 2CNAA 2R073 4OQ8A 1NY72 2PHUA 2XG3A 3JB4C 1LEDA 1BEV1 3LCPA 3LA7A 3IMNA 4FCAA 1RUG2 5ABJC 2FDIA 1SMVA 4R4XA 3GXUA 3AYDA 1OI6A 2EXJA 5CZKA 4AI8A 3MYXA 3HBZA 1RGSA 2VQ0A 1W6OA 2VOKA 4Q0SA 3MW3A 5LEJA 4YZ1A 4B29A 1YLLA 3CQOA 5KXBA 2ZEWA 4IE7A 3H7JA 1X7NA 4A44A 1FAYA 5T52A 4XUQA 2ZGMA 4XFGA 4CCCA 1VJ2A 1XU1A 1NLQA 1SZBA 4UAPA 1UKGA 1O5UA 4YVWC 1VBD2 2FZ2A 1SDDB 3GDBA 5D21A 2YG0A 1JMUB 4LIUA 3KV5A 2PYTA 4AQSA 1NY71 1RYYA 4XQDA 1QXJA 2B46X 2VNVA 3LDRA 3E5XA 4XIOA 4AWDA 1RUG1 1JZ4A 2IFWA 1QNYA 1GP6A 5DDJ2 3C7GA 4IEXA 4XETA 4YGBA 4GD4A 2VOWA 3LIGA 5FZKA 1Q43A 1OLMA 1EYBA 3OPTA 2XHNA 4EN9B 2ZPXA 4S2FA 1DU3D 2X09A 3H1WA 5EHDA 5F5IA 3DEMA 5FPAA 3A23A 1VBD1 4LBQA 2VECA 4IE4A 3ZXJA 1BMV2 4L92A 4QX0A 1TE1B 1TEIA 2PHWA 2K0GA 3OJBA 1GU3A 4QB1A 2YC0A 1OUXA 1WLWA 5IJRA 1O5LA 5I91A 5FPVA 3GZEA 1SFYA 1NA1C 2JIGA 5DDJ1 3J26N 5DG2A 1WCUA 4RR3A 2W92A 3HMYA 3B01A 5HPOA 3FFZA 2LALA 1GUIA 4OHWA 4FVVA 3WF4A 2R0FA 2WSUA 2WS93 3DKQA 4OI2A 5JOYA 3BIEA 4ZU4A 2R49A 4IEYA 5JZGC 2H6BA 3PIJA 4BISA 2NPIA 3PTRB 4OUSA 1XSQA 2C9KA 4CUBA 4CP9A 5FP9A 5LZ6A 1BMV1 4UF0B 5LA9A 1OOPC 3JQWA 2B39A 3KCXA 3AP7A 2HEWF 4HZFA 2AC1A 3UJOA 3VBSC 1JHJA 1KFXL 5HV4A 3I54A 3O1TA 2AGSA 4MXWB 2A71A 1STMA 1VIWB 5CFCB 5FYUA 4PBPA 4BU2A 4DO0A 5FYIA 2FMDA 3K3NA 1RUJ3 4LBMA 3MIHA 1UW8A 1H6XA 3HT1A 2RE9A 1I5PA 3MPPG 1W9YA 4TWTA 3MZHA 5H9RA 2WNVC 3PLQA 5GLUA 5IWFA 1OLRA 2XUMA 4D8MA 1Q8OA 4BK5A 4D0QA 1CQ9A 4XFFA 4NIHA 4RQPA 1PO22 3FBYA 3NAPC 3WNKA 3JCIA 1VR3A 2UY8A 4AQTA 4QPYA 2VXRA 2XJRA 2ZGTA 4QDRA 4JHZA 5JXHA 3S57A 4R9AA 4YW4A 3I2GA 3LEIA 4CDUB 1V6JA 1VAKA 4Q4X2 1L7QA 4AGVA 5FYZA 4J25A 3GHNA 2Y6HA 4HVRA 1C5IA 4PCRA 5FUIA 1XJAA 1DIWA 2IXLA 2XVGA 5A6YA 2OA2A 4UFHA 1WCDJ 2VTXJ 4XQ4A 5FZMA 4P08A 2CHHA 2QFEA 3TEWA 1S1AA 2NQYA 1VRH2 1TMF3 4JAAA 4BLIA 3TOJA 2Q1MA 1PO21 1UYZA 2GAUA 3OB8A 3HIFA 4UFIA 5D8AC 1ZRFA 3URFA 4ASLA 5FLJA 4V2VA 4BE3A 1A8DA 4LOSA 4S2DA 1GMMA 4FPCA 4JKLA 2EA7A 2PHLA 5LB6A 4FOYA 4CDXA 4Q4X1 1XSRA 3P5BA 4E9KA 1FI2A 2Y33A 5FZ1A 2B8MA 4GJZA 1QJY3 4LE3A 2RDQA 1VBA3 4FTSA 1DYOA 2QZ2A 4LHLA 4OZXA 4AEMA 5C9AC 4LT5A 3RI9A 2A73B 2YU2A 2VNRA 3SH3A 2JG8C 2ZAHA 3VHPA 1W99A 2JD9A 4YRDA 3H8OA 4A4AA 2PQQA 1VRH1 5DMYA 5JOWA 5C8CC 4FPJA 1WW5A 2WT2A 3J4UH 4LPLA 3LE0A 2WJSA 3RWNA 4FQ4A 4GMP0 4JGYB 1GWMA 3MDPA 3ZFFA 4HVQA 1PGL2 3ZVXA 3ORJA 5F1RA 1XNTA 5E6HA 4WM8A 5C4WB 1AR83 3I3BA 4XJZA 3BU0A 2HWD2 1O59A 4IEVA 3WQBA 4XHBA 1U5YA 1CAUB 5F2SA 2JB8A 2WQ4A 3QD6A 5A1LA 2W9XA 1F4AA 4QHBA 2PELA 3VD7A 4AXOA 3RYPA 4GQ7A 4BQ5A 2ZGSA 4N43B 1ULCA 4AFBA 1XYOA 1HB1A 3HT2A 4Q4V2 4XUOA 4YVSB 2DFCA 5FMCA 1J3PA 4CDWC 1U5XA 1PGL1 4XJAA 4CPBA 1JYWA 1N3PA 1H8TC 2BRTA 3T09A 4X6RB 4ZY9A 4J6GA 4MGYE 2HWD1 4E2GA 1Y43B 4A41A 1U5ZA 3QLQA 4Y33A 2QDRA 2A6WA 5A7QA 4QM8A 1S0FA 3IPVA 3P3PA 1VBC2 5JR7B 5ABJB 4PQ9A 1RTVA 1V9U2 3KGLA 5JAXA 1NE4A 1RUH2 3OUJA 3ZR6A 3OBRA 5K8SA 2EIBA 2QE3A 1VB4A 3THDA 3JU9A 2ZGQA 4NAMA 4UW3A 3ZXAC 4Q4V1 1KD7A 1FATA 1HB3A 3N9MA 1ND2C 3CKHA 1K5MA 2VCAA 4BB3A 4QQHA 4GAZA 4YVWB 2QQLA 5JDBA 4IV1C 1EUUA 1AUYA 4NAOA 2VC9A 4KG8A 3ITQA 4GH4C 1W9FA 1GFF2 5LATA 4LKDA 1R083 2Q8DA 2QQVA 3POSA 1NCQA 4OCTA 1VBC1 4G3YC 3HBKA 1RC6A 1V9U1 2XJQA 3VD9A 1RUH1 4LQRA 4ZS3A 1PK6C 2JICA 3J7LA 1IPSA 4UBGA 1XQNA 4CDQA 1J1TA 4PIZA 2OYZA 5FLIA 4I2OA 1J84A 2G9FA 1W6PB 3VGIA 3BTXA 5A7SA 3ETPA 5DAWA 1MS9A 1W3VA 2DVFA 2EXKA 2XDVA 3N7JA 4P5HA 2VZRA 5LY2A 1O6UA 1ZBA3 4YZ3A 3T4VA 5IVJA 2HWE3 2QDNA 2D3PA 1I1EA 1NA1B 2QCSB 2CGOA 4MOAA 3BYWA 1ZBE2 4JX0A 2GMPA 5BV6A 1KJLA 1OVPA 1GBGA 4K8RB 2IXJA 2A70A 1AX1A 2K46A 5FZFA 4XF4A 2VBPA 1G7YA 2Z4FA 3VV1A 2A6XA 5JZGB 1C1FA 4PI0A 1YFWA 5FPUA 2PTMA 2VZVA 2PHFA 5FMOL 3WSOA 1OOPB 1WBLA 2E51A 3I2HA 3CU7A 2AACA 4D7TA 4UYBA 2IXIA 4NIAA 3VBSB 4EROA 5KR7A 2JDUA 1DQ1A 1RVF3 1OF3A 2ZJCA 3FN9A 1V70A 2PLV2 1D0HA 4WM7A 2GZWA 4AAXA 5EJ1B 1GV9A 3KWVA 2P3YA 4EE2A 1QXRA 5DQ0A 3MHZA 1ZBE1 3N9LA 3AMHA 2B45X 4AFAA 3M1HA 4DINB 4Q4W3 2BBVA 2D44A 5LK7B 1NCRC 2D97A 4EJRA 2CDOA 2HEYF 4Z2WA 5B4NA 1OD3A 2DCKA 1VPHA 5DABA 3JUUA 5A7NA 4NIIA 2WNVB 3KV4A 4BCUA 2WZR2 1G9BA 1QHDA 2VGDA 2VAUA 3PURA 3M3EA 3RGBA 3NAPB 1Y9QA 1EAH3 1ND3C 1RUF2 1ENXA 4KG0A 4CCLA 2ZMLA 2DYCA 5C8WA 2W52A 2R0HA 3CJIC 2Q4SA 1NXD1 3VD3A 1KQRA 5K0UC 3JD73 5FOJB 1EV13 2PLV1 5JXIA 1RUE3 1BJQA 1DG6A 2BDRA 2KR2A 3T3YA 3WDYA 5EZWA 3BCWA 4KBBA 1BCXA 1QKQA 3U4SA 2ZX1A 1GWLA 3VBUC 4I0WB 4XFAA 2WZR1 1IGOA 5I0RA 1WW7A 5L9RA 5CIRA 1YWKA 2FDKA 4PF5A 4Y20B 3J7HA 2GN7A 4CVUA 5B2GB 2VMFA 1X8EA 1G86A 4H2AA 1NOVA 1RUF1 5D8AB 5LWBA 4IEOA 4NPRA 4TXWA 5JSPA 1CJDA 1RMU3 3A0NA 5FK8A 5LK5A 5T5OA 5EYYA 4YM3A 2RS32 2QBXA 5LA0A 4Y1YA 1QJEA 3HR9A 3WP4A 5BNQA 4LHSA 2VG9A 5IATA 1U5IA 1K12A 2CV6A 4KWKA 5C71A 4RSUA 2R043 3CNAA 4XHXA 5IYYA 3FZ3A 4GB32 3TEYA 2DCTA 4P9LA 2GSYA 4PIXA 4C0HA 1OD5A 1W90A 5APAA 3ZFEA 4NIDA 5C9AB 4JQTA 1E5SA 4WBBA 4QPIC 3G6JB 2JG8B 1HW5A 2CAVA 5A3OA 4AG4A 1R64A 3UESA 3ZXGA 4AHXA 3F2ZA 1IG3A 5FXXA 4QB6A 5C8CB 1CPMA 2ZGNA 2VCMA 1RINA 1T2XA 3ATGA 1AL22 1MZEA 3NRUA 1AX2A 1UY4A 2RG4A 2RS31 1DQ5A 1C8NA 4JCKA 5JLVA 2W47A 5T5JA 1SBEA 2V4AA 3GHMA 4BQWA 1BQPA 4DB5A 1H4GA 2A6YA 3BPZA 2R6QA 3L2YA 4GB31 2VUDA 4DEVA 3WV6A 1Y9MA 1QWRA 2Z69A 4LO8A 1DYPA 2D6MA 2PAMA 2DFBA 4Y26A 5A70A 3U0ZA 1JODA 3BOWA 2XONA 3IIAA 4O9GA 2JDKA 1DQ4A 2Q1ZB 5JI7A 3BVCA 1AF9A 3ZO0B 3ZN6B 5SV5A 1PIV2 4CDWB 2DBNA 1AL21 3O12A 2EF6A 1PGSA 2RM23 1H8TB 1H30A 2P5BA 5ANNA 4KBZA 4V1PA 3UV9A 4FFHA 2WKKA 4CP2A 2CTVA 1ZYBA 1IG0A 2WO3A 2XR4A 3Q8BA 2RDNA 5EIYB 4OMCA 4IGQA 4PIYA 4OHVA 2ZX4A 3VBOC 4B3NA 2BNNA 1N1SA 2W94A 1VMFA 4Y1VA 1FPN3 3FLTA 1QJX3 2VTXA 3AJYA 1C8M3 2ZGRA 2GALA 2RHPA 2XJVA 3LIHA 2A7AA 2E9QA 1H9PA 1PIV1 3U1XA 1DGRA 1MACA 3Q8CA 3RG0A 1ND2B 4N7IA 1AR92 3B02A 5DUXA 3DPRC 4D6RA 2E26A 1UXZA 2J1AA 4Q8KA 2D40A 4I30A 2AH2A 4IV1B 1QXPA 1RUC2 4QB2A 4IV3C 3M70A 3T0AA 4GH4B 4XZPA 3OBAA 1JZ3A 3PUSA 2DTWA 3SKVA 4COUA 4GMP1 1H1AA 4JDNA 4X8PA 3HWJA 1AR62 3D0SA 4JTNA 1LU1A 4GKYA 3KSCA 4OI4A 5I8YA 4IEQA 1PK6B 1OQEA 3V0BB 1LEMA 5F32A 5FY4A 5FP4A 2YFUA 2RR13 3WF1A 1SHWB 1O4YA 1SBDA 1ULOA 5FLHA 4ES9A 3UJQA 1SPPB 1SQ4A 1AR91 5L7OA 1POV0 2JDNA 3RQ0A 2DWRA 5A33B 2D6NA 2OZ6A 2VZTA 2V09A 1XYNA 1RUC1 3V0AA 1WMFA 2ZXQA 3EO6A 1HRI3 3VD5A 1PNGA 1A78A 5EYXA 4M0HA 5F5AA 1AYM2 3LGRA 5DAPA 3AMQA 3KF3A 4ZHNA 2CGPA 1AR61 4A6SA 1PX3A 1O91A 2A1XA 4HOOA 2XJTA 4HSJA 4J1WA 2W39A 4IQPA 5EXOA 1IKQA 2HYXA 3SXWA 2WWJA 1UZZA 4Q4W2 3BOPA 5FP3A 2I07B 4AL9A 4DUWA 1A3KA 1I9RA 2R1DA 4CXYA 4XABA 3C7OA 5I0UA 4G9SB 2R30A 2UWBA 1KS4A 5FO7B 1APNA 2R062 3VBRA 3VN4A 5C70A 2VE1A 3KV6A 1Z78A 3HAGA 1UYPA 4FXGB 2QQJA 4AVTA 1SFNA 2QQMA 1AYM1 2P3KA 4XUPA 3AYCA 3VZKA 4JKMA 5ACA2 1S0IA 3ACHA 4HANA 4HPKB 2VOXA 4H55A 2PFWA 2VD7A 2VMGA 1JUHA 1GWKA 4OMDA 4QPGC 4JQRA 2UYBA 1NCRB 1ALYA 3SISA 1VBE3 4NRMA 2I45A 5KHGA 2YGMA 3MUY1 3V56A 1DBNA 2R061 3DN7A 2BOJA 2G9ZA 4NE9A 4XILA 2O14A 2VXJA 2WINB 3ZYGA 1ND3B 4FPHA 1Q8SA 2OX0A 4QXHA 1DCSA 1QOSA 4BPZA 2D6LX 3NVCA 1CAVB 2B4KA 3CDZB 3CJIB 5ACA1 5K0UB 4LBKA 2ZHMA 2Y26A 1GQGA 1LU2A 3IDEA 4RR3C 4EZHA 1H2MA 2SLIA 4LBJA 2BP6A 2RMU2 2XVKA 1SLCA 1GOHA 2CU5A 4PLMA 3TRSB 1UN1A 3KVAA 4FFGA 4AEDA 4Y22A 3UKTA 2YU1A 1V6MA 1YI9A 5HV0A 3MW2A 4N8MA 3VBUB 1PX4A 5FMOS 2MHFA 1UXXX 3J9SA 4YZ4A 1CAXB 1MQTA 1TME2 4DY5A 1YFXA 4AAPA 5DAVA 1TVGA 1UYXA 3R05A 5A80A 4B1MA 3HQRA 2VZOA 2VPVA 4Q0UA 1X82A 4CUGA 1ENRA 3TN93 2WN2A 2VCBA 2RMU1 4HXCA 1X50A 3GALA 4K21A 5EFUA 4YGCA 4AHZA 1VB2A 2Q30A 3VBHA 2F6BA 4QPIB 1JYVA 4XTPA 1YQ2A 4MLOA 4C0BA 3ON7A 2ZCWA 3AB0A 4K1YA 1EPWA 1GP5A 2PN5A 5A7PA 2ZEXA 2RS13 1RUD2 4IW3A 3NV1A 4JVAA 2ZEZA 3ALQA 1VE0A 1TME1 3MGUA 5FZGA 1W8OA 4Q1PA 1UKRA 1UY2A 3BTZA 2XLGA 1N47A 3AKSA 5C3SA 4FPOB 3OY8B 1IKPA 4HKLA 2AR6A 1KGYA 4QKFA 3WCRA 4QM9A 1QEXA 5BNOA 5IT6A 3BGAA 5FTTC 3ZYFA 5IVEA 3T2PA 2WC2A 5FZDA 1ULEA 5EJ3A 2NMOA 4ISQA 5L19A 3RYKA 4V2WA 2BGPA 1XYPA 2JE7A 5FIXA 3VL9A 4D6QA 1G8WA 1KFUL 3POGA 4UXAA 1OA4A 3MPBA 3H7YA 5SV8A 4ARXA 4QKNA 1QQP2 2QVSB 1RUD1 2KD7A 4XCAA 1HKDA 3ZFGA 5GZEA 1LHUA 4CCJA 2DF7A 3DL3A 3KCCA 4CDXC 3FE5A 3DV8A 4EN7B 2XKOA 2MNGA 3VKLA 4Q4Y3 4KH9A 3ZOIA 1ENSA 3H8UA 4BIFA 3H1YA 3V0AB 4AI0A 4NMIA 3VBOB 4PLNA 3PUHA 4LMFA 4Q0PA 4M00A 4CEYA
chains in the Genus database with same CATH topology
5IVCA 5FYTA 5FZ8A 4NUBA 5FYZA 5FZEA 3DXTA 2YPDA 2VD7A 4EYUA 2OQ7A 5FYMA 4CCNA 3N9OA 5FZIA 5IVBA 3PUAA 4QX7A 5F2WA 5A7SA 5FZMA 2XUEA 4XDPA 2GP5A 3AVRA 5FY9A 5F5CA 2XDVA 3KV9A 5FZ7A 5IVYA 5LY2A 4CSWA 4URAA 5F3EA 5K4LA 5A3NA 5IW0A 5FV3A 5IVJA 4V2VA 5FWEA 2OX0A 4QXHA 4XDOA 3N9QA 3K3OA 4BXFA 5FZ1A 4GJZA 4EZHA 2P5BA 5ISLA 3PDQA 5FZFA 5FZOA 3UYJA 5FJHA 4LIUA 3KV5A 5A1FA 2YU2A 3KVAA 4E4HA 3LD8A 5FYBA 4IGQA 5LY1A 2YU1A 3DXUA 4IGOA 5FPUA 2W2IA 5LW9A 2XMLA 3N9NA 2GP3A 5FZAA 5KR7A 4GD4A 5FZKA 5FXZA 3AL5A 4C8DA 2OS2A 3OPTA 5FUNA 5FBJA 4AAPA 5IVVA 5E6HA 5A80A 3NJYA 4UF0A 5FYVA 5FYHA 5FXWA 3N9LA 5FZCA 5FPLA 3LDBA 5F5IA 5A3PA 5FPAA 4CUGA 4D6RA 2YBPA 5FY7A 3AVSA 5FZHA 5A7WB 4IGPA 2PXJA 5FYCA 5F2SA 3KV4A 5A7NA 4DIQA 5FWJA 3N9PA 3KVBA 4ASKA 5FZBA 5FY8A 3PURA 5A1LA 3PUSA 3K2OA 5FYSA 5FZ6A 5FPVA 4CCLA 2XXZA 3PUQA 5FXVA 5A7PA 4TN7A 2YBKA 5FYYA 3ZPOA 5FZGA 5F32A 5FY4A 5FP4A 4QXCA 5FJKA 5FZLA 5A3TA 5F3IA 4BISA 3PTRB 3PU3A 5A7QA 4Y33A 4GJYA 5FP9A 3U4SA 5F37A 4UF0B 5F3GA 5IVEA 5FZDA 3U78A 4V2WA 4CCKA 4QU1A 4D6QA 5F5AA 2OT7A 5A3WA 5LWBA 4HONA 5FY5A 5CEHA 4CCMA 5FYUA 3AL6A 4Y3OA 4HOOA 3N9MA 4BU2A 5FYIA 5FUPA 5FY1A 5FZOB 3K3NA 5FPBA 5FZ9A 2WWJA 3ZLIA 4D6SA 5FP3A 4AI9A 1VRBA 5FZ4A 4CCJA 2WWUA 4GAZA 4EZ4A 3OPWA 5ANQA 5FZ3A 5FY0A 5IVFA 2OQ6A 5A7OA 3RVHA 4CCOA 5IWFA 4QX8A 4LITA 4QWNA 5F3CA 4LIVA 2Q8DA 4DO0A 4QXBA 5A7WA 5FP7A 5FP8A 2Q8CA 2YBSA 2Q8EA 5F39A 3KV6A 5FZ0A 4Y4RA 5FXXA 4LXLA 3PU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IVC A;  5FYT A;  5FZ8 A;  4NUB A;  5FYZ A;  5FZE A;  3DXT A;  2YPD A;  2VD7 A;  4EYU A;  2OQ7 A;  5FYM A;  4CCN A;  3N9O A;  5FZI A;  5IVB A;  3PUA A;  4QX7 A;  5F2W A;  5A7S A;  5FZM A;  2XUE A;  4XDP A;  2GP5 A;  3AVR A;  5FY9 A;  5F5C A;  2XDV A;  3KV9 A;  5FZ7 A;  5IVY A;  5LY2 A;  4CSW A;  4URA A;  5F3E A;  5K4L A;  5A3N A;  5IW0 A;  5FV3 A;  5IVJ A;  4V2V A;  5FWE A;  2OX0 A;  4QXH A;  4XDO A;  3N9Q A;  3K3O A;  4BXF A;  5FZ1 A;  4GJZ A;  4EZH A;  2P5B A;  5ISL A;  3PDQ A;  5FZF A;  5FZO A;  3UYJ A;  5FJH A;  4LIU A;  3KV5 A;  5A1F A;  2YU2 A;  3KVA A;  4E4H A;  3LD8 A;  5FYB A;  4IGQ A;  5LY1 A;  2YU1 A;  3DXU A;  4IGO A;  5FPU A;  2W2I A;  5LW9 A;  2XML A;  3N9N A;  2GP3 A;  5FZA A;  5KR7 A;  4GD4 A;  5FZK A;  5FXZ A;  3AL5 A;  4C8D A;  2OS2 A;  3OPT A;  5FUN A;  5FBJ A;  4AAP A;  5IVV A;  5E6H A;  5A80 A;  3NJY A;  4UF0 A;  5FYV A;  5FYH A;  5FXW A;  3N9L A;  5FZC A;  5FPL A;  3LDB A;  5F5I A;  5A3P A;  5FPA A;  4CUG A;  4D6R A;  2YBP A;  5FY7 A;  3AVS A;  5FZH A;  5A7W B;  4IGP A;  2PXJ A;  5FYC A;  5F2S A;  3KV4 A;  5A7N A;  4DIQ A;  5FWJ A;  3N9P A;  3KVB A;  4ASK A;  5FZB A;  5FY8 A;  3PUR A;  5A1L A;  3PUS A;  3K2O A;  5FYS A;  5FZ6 A;  5FPV A;  4CCL A;  2XXZ A;  3PUQ A;  5FXV A;  5A7P A;  4TN7 A;  2YBK A;  5FYY A;  3ZPO A;  5FZG A;  5F32 A;  5FY4 A;  5FP4 A;  4QXC A;  5FJK A;  5FZL A;  5A3T A;  5F3I A;  4BIS A;  3PTR B;  3PU3 A;  5A7Q A;  4Y33 A;  4GJY A;  5FP9 A;  3U4S A;  5F37 A;  4UF0 B;  5F3G A;  5IVE A;  5FZD A;  3U78 A;  4V2W A;  4CCK A;  4QU1 A;  4D6Q A;  5F5A A;  2OT7 A;  5A3W A;  5LWB A;  4HON A;  5FY5 A;  5CEH A;  4CCM A;  5FYU A;  3AL6 A;  4Y3O A;  4HOO A;  3N9M A;  4BU2 A;  5FYI A;  5FUP A;  5FY1 A;  5FZO B;  3K3N A;  5FPB A;  5FZ9 A;  2WWJ A;  3ZLI A;  4D6S A;  5FP3 A;  4AI9 A;  1VRB A;  5FZ4 A;  4CCJ A;  2WWU A;  4GAZ A;  4EZ4 A;  3OPW A;  5ANQ A;  5FZ3 A;  5FY0 A;  5IVF A;  2OQ6 A;  5A7O A;  3RVH A;  4CCO A;  5IWF A;  4QX8 A;  4LIT A;  4QWN A;  5F3C A;  4LIV A;  2Q8D A;  4DO0 A;  4QXB A;  5A7W A;  5FP7 A;  5FP8 A;  2Q8C A;  2YBS A;  2Q8E A;  5F39 A;  3KV6 A;  5FZ0 A;  4Y4R A;  5FXX A;  4LXL A;  3PU8 A; 
#chains in the Genus database with same CATH topology
 1ZZ6 A;  4ZS2 A;  1X33 A;  3SQO A;  1RJ8 A;  1QQP 1;  5LCW L;  4NUB A;  3ASI A;  4Q0V A;  1Y7B A;  4H14 A;  3AYA A;  3OTF A;  4R4Z A;  3TYJ A;  1ENQ A;  1XXN A;  3ZFF C;  1HQW A;  5GLZ A;  1FV3 A;  3A0K A;  4O7X A;  4NRO A;  3DPR B;  3UGF A;  1W03 A;  2EAL A;  5FMD A;  1X9P A;  2W1Q A;  2XL9 A;  2G4I A;  4IV3 B;  2E63 A;  2HWF 2;  2JDP A;  3KV9 A;  3ZSK A;  2FQP A;  3SEE A;  3QCW A;  3NNJ A;  5BY5 A;  5FPX A;  4RL7 A;  5JSO A;  3WP6 A;  1RXG A;  4RS5 A;  1COV 2;  4WVZ A;  3ECQ A;  3D0J A;  2Y0I A;  5KWR A;  2ADE A;  2WNE A;  1N1Y A;  1OBN A;  3PMS A;  3VZJ A;  4PHZ A;  4FOW A;  2H0B A;  4FO9 A;  3K4A A;  2BGO A;  2EXH A;  3GYD A;  2J42 A;  3WNN A;  5I0D A;  1XE8 A;  2J1S A;  4OI1 A;  3VDD C;  3POW A;  1T6B X;  2P4E A;  1WA4 A;  3H3L A;  1OF4 A;  4CXX A;  2HWF 1;  2IXK A;  1QNW A;  3OYW A;  2VU9 A;  4N53 A;  3THC A;  1O3Q A;  3O14 A;  2ZGU A;  1CX4 A;  1W2T A;  2W3J A;  1W8H A;  1WUV A;  5FUN A;  1LRH A;  1COV 1;  2DDU A;  2R16 A;  2WNU A;  4BMB A;  3EHK A;  1JYX A;  5FYH A;  3IDB B;  4QX2 A;  1W6O B;  1D4M 2;  4XJW A;  2Z2S B;  3LDB A;  5JCT A;  2E7T A;  1W39 A;  2RS5 3;  4JRL A;  3H50 A;  1VBE 2;  2YBP A;  3POY A;  3SKJ E;  3USS A;  1JOJ A;  3NNF A;  4E4D X;  1K45 A;  2J1E A;  3AMP A;  4DIQ A;  3KVB A;  2JG9 A;  5CBL A;  1UWW A;  1UAI A;  1WZX A;  3DKW A;  2P3J A;  3GM8 A;  4RFR B;  1IZ3 A;  1O4Z A;  2ZX3 A;  2BVB A;  5BXX A;  1MEC 2;  3WQ1 A;  1C28 A;  4ZPI A;  1HXS 2;  4E2Q A;  1JZ8 A;  3ZR5 A;  1RUI 2;  4KNC A;  3WF2 A;  3EB7 A;  2VZU A;  2OPW A;  2VOT A;  3LOI A;  4JZR A;  4SLI A;  3WNL A;  4A7Y A;  2AEY A;  2VUA A;  2CL2 A;  5DAX A;  3QH6 A;  1D4M 1;  4Y1Z A;  1OA3 A;  3I59 B;  4MV2 A;  1PMJ X;  2VM9 A;  3IT8 A;  1A34 A;  3OSD A;  4QPG B;  3V65 A;  3SLI A;  5JMC A;  3IWZ A;  4XAA A;  3ZYH A;  3Q8E A;  2BBA A;  1J58 A;  5BNN C;  4XW3 A;  4XF3 A;  2Y38 A;  3WP3 A;  1MEC 1;  2ETE A;  1UPI A;  4ZON A;  1HXS 1;  2IVJ A;  2OII A;  4CU9 A;  1RUI 1;  2FDH A;  1D4V B;  5FZO B;  4CU6 A;  1T6G C;  2ZA9 A;  5CKQ A;  1BVP 1;  1FMD 2;  1SLA A;  3DUI A;  1POV 1;  2SBA A;  3AKR A;  4CUA A;  3T30 A;  4YPJ A;  3ZXL A;  4DUX A;  3M3C A;  2DUR A;  3KLS A;  4RR3 B;  3USU B;  4XE9 A;  1B35 A;  1Q8Q A;  2VME A;  2KA3 A;  1HX6 A;  3FHI B;  4PLO A;  1AVB A;  3F95 A;  3EQE A;  2OUH A;  1LCL A;  1ODM A;  1PO1 2;  1XNB A;  2DVG A;  4IES A;  3WHT A;  3WG3 A;  1WCK A;  1R1A 2;  4YNI A;  1MS0 A;  1S0C A;  1AX0 A;  1S2B A;  5AC9 3;  2X5I C;  1CD3 G;  3IN9 A;  1FMD 1;  1W6N B;  2W08 A;  5HCB A;  1V6O A;  4QX7 A;  1TQ5 A;  1PZ7 A;  2FZ1 A;  1CAW B;  1F31 A;  2CWM A;  3NL1 A;  3ZYI B;  3GGL A;  3ELN A;  2BVV A;  4JC1 A;  3DYO A;  5FZ7 A;  1F15 A;  4CSW A;  2E32 A;  2FDF A;  2DV9 A;  1Y9G A;  4MVT A;  1MZF A;  2JEC A;  3M8L A;  2DCJ A;  4GWN A;  4XF1 A;  3SH5 A;  1AYN 3;  3AXE A;  1PO1 1;  4Z2A A;  2GC1 A;  3TBD A;  1ASJ 2;  1LHW A;  4BZ4 A;  4EV0 A;  1R1A 1;  1K42 A;  3JQX A;  5CFC A;  3LFM A;  2DCZ A;  4LJH A;  4EWA A;  5FK7 A;  2Z42 A;  3VDA A;  1RIR A;  4XQW A;  3KM5 A;  1YIP A;  4AI1 A;  1YQ8 A;  3UYJ A;  4CE8 A;  4Z92 B;  4YGD A;  5K7P A;  4R52 A;  4YG0 A;  4MZU A;  4OHY A;  1FOD 3;  3OF1 A;  2GNB A;  1WWY A;  4I09 A;  5FRE A;  2BPA 2;  3LA2 A;  3O0X A;  1FXZ A;  2XBO 2;  4YFW A;  2WYF A;  3BB6 A;  1PVC 3;  2OZJ A;  3O1V A;  1LOD A;  4M3C B;  1LOF A;  1LOA A;  1WGP A;  4HKO A;  2O0O A;  1EY2 A;  5DG1 A;  5IVV A;  2YB7 A;  3VB9 A;  4LHN A;  2EAK A;  2VZQ A;  5I0S A;  2MEV 3;  1ASJ 1;  2WFF 2;  4CDU A;  2HBU A;  2CWS A;  1HJF A;  2ZGK A;  1BK0 A;  1HB2 A;  1MPX A;  3AVS A;  1YUD A;  2A5Z A;  3JBG 2;  4U2A A;  3BU7 A;  1PGW 2;  4CDX B;  5FWJ A;  4BQ2 A;  4KMQ A;  3N35 A;  1KXG A;  5HXV A;  4ASK A;  2YC4 A;  1WCS A;  4UFK A;  3O7O A;  5J36 A;  2LRP A;  2NZ9 A;  3HQU A;  3I3E A;  4XUR A;  3NQH A;  5FZ6 A;  4XBN A;  1UNB A;  1FYU A;  4QGL A;  5T5L A;  2XBO 1;  3UKV A;  1AHS A;  3VHN A;  4BQX A;  1R09 3;  3GJB A;  4UW6 A;  4TN7 A;  2J1T A;  2KXL A;  3J7M A;  4R9B A;  3AXD A;  4BQ1 A;  3NWK A;  5FO8 B;  1J59 A;  1BBT 3;  4ORF A;  1GSL A;  1CX1 A;  3MF9 A;  2WFF 1;  2LS6 A;  3LB9 A;  3L9J T;  3ZFF B;  4COW A;  3VBF C;  4GJY A;  3JBG 1;  4L11 A;  1GNH A;  1VAV A;  1W04 A;  2C0Z A;  4K40 A;  1PGW 1;  2R07 2;  3R0R A;  3KGZ A;  1UOF A;  1O4T A;  1FT9 A;  1ZX5 A;  4IXL A;  4B7E A;  5BNP A;  5KC5 A;  3W59 A;  4GWJ A;  5L73 A;  3RZZ A;  3WY6 A;  1H0B A;  1OUR A;  4JTO A;  5FAX A;  2B9V A;  1NG0 A;  4NIG A;  5FZ9 A;  2EIC A;  4K9S A;  4AI9 A;  1VRB A;  2JDA A;  2QZ3 A;  2XKP A;  5C3R A;  2Y6G A;  4LKF A;  3C7H A;  1CGP A;  4BK4 A;  4Q5O A;  4XPV A;  5C4W A;  3U75 A;  1W8W A;  2WO7 A;  1YO8 A;  2RVA A;  3O1P A;  3WUD A;  4JKK A;  1DZT A;  1VBB 3;  2R07 1;  1CAU A;  3VDD B;  2PHT A;  3OUI A;  5CU1 A;  5FZ0 A;  1SLL A;  2BWA A;  4HN0 A;  2CGN A;  2WLP A;  3D3A A;  1SFP A;  2XLA A;  1F5F A;  3KZ4 C;  4N43 A;  4LK6 A;  1DZQ A;  1L3J A;  4LBL A;  4OUE A;  1W9T A;  4X8N A;  3UGH A;  2ZGP A;  1HV1 A;  4LA3 A;  3RSJ A;  4FOV A;  3SIT A;  3WNP A;  1DLC A;  3AMM A;  3S7I A;  1PVX A;  4XDP A;  2E7A A;  5C5U A;  3LF7 A;  1NKG A;  2GMM A;  3MO4 A;  1OH4 A;  1YCI A;  5JIA A;  4XIK A;  2WYS A;  4I0B A;  5FWE A;  1JYI A;  4CU7 A;  1ZRC A;  4FPF A;  1W8F A;  3MIB A;  3N7K A;  3RMY A;  3THT A;  4A45 A;  2WSV A;  5JOX A;  3CHX A;  2JJ6 A;  3AX4 A;  4HET A;  2WS9 2;  3K75 B;  4AVC A;  3ACG A;  5CB7 A;  2JX9 A;  1AZD A;  4Z8B A;  5A1F A;  4A6O A;  5A1A A;  4MET A;  5LY1 A;  4YVW A;  4EN8 B;  4D3W A;  3CZU A;  4P9W A;  2W2I A;  3ZIW A;  1I6X A;  3O1U A;  2XJP A;  4H3W A;  4LO6 B;  4FOQ A;  1DQ6 A;  1QJF A;  3AKP A;  4AEK A;  2JEN A;  4D7Y A;  3NJX A;  5DZF A;  4CU8 A;  5BNN B;  2ATF A;  2XB6 C;  1N3O A;  3LPF A;  3SC7 X;  1BK1 A;  2DU0 A;  5I93 A;  3LKJ A;  1S2E A;  1NQJ A;  3B94 A;  2OW4 A;  5FYV A;  5CIS A;  5FPL A;  1W8U A;  4E8C A;  4MH0 E;  3ILF A;  3AC0 A;  4IE0 A;  5C7G A;  1YQ5 A;  1RUJ 2;  5FY7 A;  5M0T A;  2G9G A;  1QY4 A;  2WS9 1;  2HWC 3;  5L9B A;  4QHO A;  5IAX A;  5JMO A;  1H2N A;  1HN1 A;  2GN3 A;  5E16 A;  5E89 A;  1GNY A;  4I01 A;  4ZZ8 A;  5LA2 A;  4HBN A;  4GUL A;  1JBC A;  2LM3 A;  4NRP A;  3PJY A;  2ORX A;  3IAQ A;  5HI0 A;  4YYO A;  3AKT A;  3VBR C;  2V73 A;  3ZSE A;  1JU3 A;  1O3R A;  4SBV A;  3VZN A;  3U14 A;  4AQ6 A;  1ULF A;  2OVU A;  1UOG A;  3CBN A;  3WHU A;  5A3U A;  1PMH X;  3ACF A;  2LW8 A;  3CL1 A;  2X5I B;  2OPK A;  1DGW X;  1B09 A;  3WDT A;  3WNX A;  1SCR A;  1LUL A;  1RUJ 1;  3H0O A;  3K4Z A;  3M3I A;  4R9D A;  3WW1 A;  3H8X A;  3KS7 A;  4DEQ A;  4AI3 A;  5CVR A;  2O8Q A;  5JZG A;  3T2Q A;  4H7M A;  4FTB A;  1W6Q B;  3HNY M;  4JHT A;  1TMF 2;  1J1L A;  2ARC A;  3D5O A;  1F5J A;  4IE5 A;  2XWJ B;  4L2N A;  4WVM A;  1JU4 A;  4P14 A;  3AL6 A;  4AK3 A;  5BYN A;  1J3Q A;  2WAA A;  3G7D A;  2GNT A;  5FY1 A;  3VBS A;  3ZYJ B;  5LBB A;  2IZW A;  3POE A;  1XE7 A;  3QOP A;  3B9C A;  1NT0 A;  1ZRR A;  3I2K A;  2D3S A;  1OSG A;  5FBZ A;  3INA A;  1QJY 2;  4QGM A;  1CZV A;  4AHW A;  1H9W A;  1D2S A;  1VBA 2;  2HWB 3;  4MGI E;  3B9I A;  1QMJ A;  1D7P M;  1LR5 A;  5FDB A;  3J8F 3;  3UKN A;  1LOB A;  3S6P A;  2C5D A;  4LOR A;  2WNV A;  4AED C;  1FX5 A;  2BUK A;  3WDX A;  4Q0Q A;  3ZM8 A;  1YEW A;  1YIF A;  2HKX A;  5F6L B;  1TMF 1;  2PHX A;  4XUT A;  1UCX A;  1TG7 A;  4YW6 A;  3NAP A;  1SEF A;  2WAB A;  4RGA A;  4W6W A;  1MQT C;  1YQ6 A;  5J98 B;  3AJZ A;  3A22 A;  1P8J A;  4LOT A;  4E2S A;  1AR8 2;  3E97 A;  1V6K A;  3NV2 A;  3OCP A;  3BTA A;  1RHI 3;  3P1I A;  4MYE A;  3K4D A;  2ZMK A;  1QJY 1;  4DXR A;  4ET7 A;  4PDW A;  3SCF A;  5F7U A;  1VBA 1;  1UY1 A;  1VAL A;  3IMM A;  1GZW A;  3VZM A;  1GP4 A;  2PHR A;  3ZMN A;  4FBF A;  3LA3 A;  2VY0 A;  3LSD A;  4OZO A;  3MEP A;  3VBH C;  3M4F A;  1QGL A;  2CYF A;  2ID4 A;  2HLE A;  3AKQ A;  2VMI A;  5A3M A;  1IPJ A;  1UF2 C;  1XOY A;  3N4M A;  4E4Z A;  2LUW A;  1AR8 1;  3T0B A;  4DMI A;  3DEC A;  3GCW A;  3VBF B;  3DXU A;  4AFD A;  3C7F A;  3C3V A;  5JPM B;  2WQZ C;  2ZX2 A;  2GND A;  4LO5 B;  5EP9 A;  5LW9 A;  2XJU A;  4URT A;  1WMX A;  1OPM A;  2GP3 A;  5C9A A;  1CPN A;  2A3W A;  1HB4 A;  1W28 A;  1IPK A;  4M4P A;  3RS6 A;  1ZRE A;  4QX3 A;  4BA6 A;  5AFB A;  2QTW B;  2VL4 A;  5J09 A;  2B7Y A;  3B00 A;  5C8C A;  3TB0 A;  4XVH A;  2YC2 A;  1NX9 A;  3WT3 A;  2W68 A;  4AVA A;  2J1V A;  5HCA A;  1W05 A;  1LGB A;  4XEZ A;  5FYC A;  3ZFG C;  4QKB A;  4KWL A;  4XAE A;  5IFP A;  2TBV A;  2C9A A;  3X29 B;  3PHM A;  3PL0 A;  1QJU 3;  5F5Q A;  1PM7 A;  5CG9 A;  1R08 2;  2FCU A;  2VW2 A;  1S0E A;  2ADD A;  4UFL A;  4QX1 A;  1OT5 A;  3D82 A;  3DYM A;  4M0N A;  5J3U A;  5ERL A;  3O0V A;  2HJI A;  5DN2 A;  4CEW C;  4N9I A;  3VDC A;  5KXC A;  2LTN A;  4QXC A;  4BYY A;  2CDP A;  4IEU A;  4RHV 3;  1Z7S 3;  1RXF A;  5KXE A;  3N7M A;  4L0P A;  3ZN6 A;  5CKN A;  4CDW A;  3ZYP A;  2ZHN A;  2ZGL A;  2UU8 A;  4AW7 A;  2AEZ A;  2YMZ A;  1H8T A;  2JKX A;  1WME A;  5IAV A;  4LLO A;  5L36 A;  1W2N A;  5DXD A;  4BWO A;  3RNS A;  4Y5Z 0;  1AR7 3;  1UY0 A;  5A3W A;  5J48 A;  1LEN A;  1R08 1;  1ZBA 2;  2A6V A;  2WR9 A;  2X29 A;  3NKT A;  2ZAC A;  2WA3 A;  3TAY A;  4BQY A;  2HWE 2;  3HJR A;  2V4V A;  4CPB D;  4DUV A;  1IS4 A;  4L8Q A;  5D2A A;  1UZW A;  4MGS A;  3FX3 A;  4P02 B;  2EIE A;  3HQX A;  2OQ6 A;  4YGE A;  3RYR A;  1XPW A;  1DHK B;  4AOC A;  3I3D A;  3OG2 A;  5DZE A;  1ND2 A;  1W9W A;  3LQC A;  2UUR A;  2Q0A A;  3A4U A;  1A6C A;  1S0D A;  2NYY A;  3A7Q A;  3GJA A;  5A3L A;  2ENR A;  2BNO A;  5FQ0 B;  5GZF A;  1YRZ A;  4KWU A;  1HRV 3;  4Y4R A;  3LAG A;  4K6B A;  5B4X A;  4GH4 A;  1ODN A;  2BU9 A;  4XDQ A;  5EQU A;  5T50 A;  1ZBA 1;  1UMH A;  1WKY A;  2YXS A;  3HD8 B;  4GAL A;  4NHK A;  3N36 A;  1RVF 2;  5FYT A;  1W6M B;  2HWE 1;  2IXH A;  4CXW A;  3CZJ A;  4EYU A;  2OQ7 A;  4Y24 A;  5C5T A;  1NE6 A;  2LRO A;  3N9O A;  1UZ0 A;  1PK6 A;  4FPE A;  1EP0 A;  1QU0 A;  2WNU C;  4N9H A;  3BN6 A;  5F2W A;  1VLN A;  2G19 A;  3PJQ A;  2D93 A;  1OH3 A;  1SPP A;  2E7Q A;  4P9I A;  5F5C A;  1HV0 A;  4K3U A;  1ZZ7 A;  4YW7 A;  1J3R A;  2JG9 C;  4EN6 B;  3ES1 A;  3U11 A;  1LOC A;  1EAH 2;  1REE A;  5E88 A;  5TSW A;  2W0X A;  2BW8 A;  3TNQ A;  3UET A;  3VBR B;  3EBR A;  2V5D A;  1DFQ A;  2DVA A;  3HOB A;  4WZF A;  5FKC A;  4A42 A;  3LDK A;  5T54 A;  4DNY A;  1RVF 1;  1BEV 3;  3JD7 2;  1EV1 2;  1EUT A;  3PDQ A;  3QBQ A;  2VMC A;  1W9S A;  5LRR A;  5FR3 A;  1RUE 2;  4N7U A;  4MAD A;  1PMI A;  2A75 A;  4E4H A;  3LD8 A;  3ZSM A;  1H2K A;  4AR2 A;  4Q4W 1;  4LO7 A;  1LHO A;  1Z0H A;  1GZT A;  2GC3 A;  4IGO A;  2XWB B;  5CFD A;  5EWS A;  3PTY A;  4PQQ A;  4IEZ A;  2ZZJ A;  4D7S A;  1UQX A;  1MR5 A;  5GM0 A;  2D6O X;  4BDV B;  2D5H A;  1RL3 A;  1QH6 A;  4A3X A;  2R1B A;  2QQW A;  1EAH 1;  3WLU A;  1RMU 2;  3FFQ A;  2E33 A;  5F6K A;  3JD7 1;  4IUG A;  1H1I A;  4HPK A;  1EV1 1;  3T2O A;  1RUG 3;  3WDU A;  1ZRI A;  4NPL A;  1JN2 P;  2R04 2;  1RUE 1;  1HDK A;  2VBB A;  3W9A A;  2ARX A;  5GLW A;  2I74 A;  4FPG A;  4MSV A;  1G9F A;  1NCR A;  5JWP A;  5JPN B;  1HN0 A;  4N90 A;  3Q8A A;  4W6X A;  1B35 C;  2W1U A;  2XXZ A;  3PUQ A;  4AED B;  4TTG A;  1UIJ A;  3O5S A;  1KS5 A;  2K9Z A;  2XGX A;  1VBD 3;  3I2I A;  2Y8K A;  4LE4 A;  1X8M A;  4WVW A;  4O9E A;  1BKZ A;  3OPZ A;  3PVO A;  4QQ2 A;  2BJS A;  1A8M A;  3AZX A;  4TSV A;  4XZU G;  2IVI B;  5FZL A;  5HCH A;  1CZS A;  1OMI A;  1RMU 1;  4Y5T A;  3RZH A;  3KCY A;  1MQT B;  1CAV A;  3CJI A;  3WR0 A;  5K0U A;  5G04 L;  3POI A;  5DDJ 3;  2W1W A;  1UO9 A;  2R04 1;  3BIW E;  1QH7 A;  2BTV C;  5HBA A;  3NKG A;  1AXK A;  1URX A;  1DZR A;  3WP5 A;  3S5A A;  3BI3 A;  2OT7 A;  4E4S A;  1SCS A;  4I3P A;  1D0G A;  2E31 A;  2WO1 A;  3NV3 A;  1VMJ A;  3RZJ A;  3H3U A;  3VBH B;  3AZZ A;  1QIQ A;  3EMR A;  4WV8 A;  2ZAA A;  3MUZ 1;  4D6S A;  3Q9O A;  4PF1 A;  1WD3 A;  4RQP C;  4FT8 A;  1HIX A;  1QDC A;  1JZ6 A;  2WWU A;  5I8T A;  4HFS A;  2D7F A;  2DTY A;  3OBT A;  1KIT A;  1PM4 A;  2N7G A;  1CWP A;  1UU4 A;  2NN8 A;  3KQ4 B;  5A7O A;  2RM2 2;  4BME A;  4COY A;  4Y1U A;  2QJV A;  2R32 A;  4XFH A;  3BAL A;  4QQP A;  4LIV A;  3ZPY A;  1LEC A;  4Q29 A;  4QU2 A;  4QXB A;  3A21 A;  3PVE A;  1ZZ9 A;  4JGZ A;  4DY3 A;  3AYE A;  4W4Z A;  2VMD A;  3NST A;  1W2U A;  1UY3 A;  4B4P A;  3R4D B;  4ONU A;  4EWD A;  3UK9 A;  1FPN 2;  2WLQ A;  5T5P A;  5A32 A;  1G6N A;  1QF3 A;  4COZ A;  1NYW A;  1QJX 2;  4E8D A;  2PAK A;  1X9T A;  4IE6 A;  4PI2 A;  5FZ8 A;  5KHK A;  2YPD A;  1C8M 2;  3CF6 E;  3GF6 A;  5GLV A;  3RFR A;  5IFT A;  5FZI A;  2IC1 A;  4FAG A;  4BJ0 A;  1U0A A;  4AFC A;  2BYV E;  1HQL A;  1WW4 A;  3OGJ A;  4AE2 A;  2FDJ A;  1W06 A;  2RM2 1;  3ZFG B;  2FDG A;  5D1I A;  1GZ9 A;  2D43 A;  3ZN4 A;  3OY8 A;  5CA6 A;  3RPQ A;  3DYP A;  3ZXK A;  4AFM A;  3HNB M;  1XNC A;  3FUO A;  5FV3 A;  2BFU S;  3MV1 1;  1N1V A;  4QDQ A;  4XMA A;  1W2O A;  1CON A;  3O1S A;  2UYA A;  1RUN A;  4ZU5 A;  2Q8O A;  1FPN 1;  5GKA C;  4RD7 A;  4CEW B;  1POQ A;  1QJX 1;  2RDS A;  4HL0 A;  2L9L A;  4HN1 A;  5JSR A;  5G05 L;  4IND A;  1C8M 1;  4KL1 A;  1QOT A;  2P1B A;  2RR1 2;  4XBQ A;  1X36 A;  3WCS A;  1MZ6 A;  1YFY A;  1PO2 3;  4DOU A;  1XBF A;  3DF0 A;  4OLL A;  2I2S A;  2X53 S;  1SAC A;  3OD0 A;  3I2F A;  2ZOE B;  3I97 A;  3T08 A;  1S0B A;  4MUV A;  3AP6 A;  2XML A;  2GU9 A;  1HRI 2;  1UOJ A;  4Q1R A;  4Q4X 3;  3SHR A;  3W21 A;  4BIO A;  1GYK A;  4CP1 A;  5FCC A;  5FXZ A;  5GZC A;  1XND A;  4YM1 A;  1L7R A;  1SBF A;  1ACC A;  3MF6 A;  4LBN A;  4NHM A;  4XF0 A;  3NJY A;  3RWK X;  5BNP C;  2VBD A;  1YNA A;  3NNL A;  3UGG A;  4QPW A;  4I3G A;  4MXV A;  2VUC A;  3H1M A;  4QQL A;  3I4I A;  5IK5 A;  2WRA A;  3ENR A;  2C1F A;  5A7W B;  3ZSL A;  1UPS A;  2E6V A;  1VRH 3;  2RR1 1;  4IGP A;  1YXW A;  5IUQ A;  3N9P A;  2X10 A;  2ZX0 A;  4P9Y A;  5FZB A;  2QQU A;  4ZZ5 A;  2VH9 A;  2P6H A;  3DPR A;  4FP2 A;  3FHQ A;  3MV0 1;  4MO3 M;  1HRI 1;  5LBC A;  1F9K A;  2VR4 A;  2DCY A;  2YBK A;  1JYN A;  2XPJ A;  4LHK A;  4FQZ A;  2TNF A;  3OYW B;  4LA2 A;  4Y5S A;  4NHX A;  2OXB A;  3POB A;  4YWA A;  1C3H A;  1YI7 A;  3PU3 A;  4F83 A;  3RZK A;  4F8A A;  1KEX A;  3T0D A;  1XRU A;  1WLT A;  2WNU B;  1OQD A;  3RJ2 X;  1PNF A;  3WXP A;  4HKW A;  4YFZ A;  2GC2 A;  3AFK A;  4AZZ A;  5KHH A;  3CO2 A;  1JZ7 A;  1K5M C;  4QU1 A;  4A7K A;  4HMZ A;  4OI0 A;  1US3 A;  1XU2 A;  2YPJ A;  5AVP A;  4A2U A;  3GNE A;  1IQD C;  3U37 A;  2JG9 B;  2V5Y A;  4UW5 A;  2HWD 3;  1DQ0 A;  1WLD A;  2VZP A;  2WII B;  4COV A;  4NWV A;  4A7Z A;  2XVL A;  4KQ7 A;  4GXL A;  1NCQ C;  1LNS A;  3RRD A;  3S7E A;  5KHI A;  4NHL A;  5I0T A;  1UYY A;  1C5H A;  2VQA A;  3HN3 A;  4W6Y A;  2ZGO A;  5KHJ A;  4U36 A;  5FMB A;  1C1L A;  1OUS A;  4IET A;  5FOB B;  5JXJ A;  1LOE A;  2GDF A;  3K48 A;  3B7M A;  4CDQ C;  4Q4V 3;  2C4X A;  3UL2 A;  1OQ1 A;  1VBE 1;  1S0G A;  5F39 A;  1I5Z A;  4YZ5 A;  3WIN E;  2GH8 A;  1CIW A;  1XC6 A;  4LBO A;  2VQU A;  3QAC A;  2W95 A;  2C6S A;  4LBQ B;  1E5H A;  2BEO A;  2NLR A;  1U12 A;  2VVF A;  5FZE A;  5JOZ A;  3KD4 A;  3ZMO A;  4CCN A;  1TZO A;  3PUA A;  1YJK A;  2RJ2 A;  3AMN A;  1OFN A;  1VBC 3;  2GNM A;  4Q26 A;  2XQR A;  3S30 A;  3I49 A;  4CZS A;  1V9U 3;  4PT6 A;  2JE8 A;  4P9J A;  5BPX A;  1RUH 3;  2JDZ A;  3C2U A;  3AVR A;  5FY9 A;  3TN9 2;  3I59 A;  1UX7 A;  4QPG A;  3FL7 A;  4M3C E;  1BVV A;  5FPZ A;  3QH7 A;  5HXM A;  2ZMN A;  1MVQ A;  3LEM A;  1B35 B;  3AP9 A;  1BZW A;  1W8N A;  5IK4 A;  2RS1 2;  4CP9 B;  1WW6 A;  3VD4 A;  1PZ9 A;  1SLB A;  4UOJ A;  4GZ9 A;  4QXK A;  2YRO A;  3LWC A;  4YW3 A;  5FZO A;  1OPO A;  4YW5 A;  4DQA A;  3IAP A;  5I8S A;  4QMA A;  4PJY A;  3WW3 A;  5BUV A;  1YJL A;  4WM7 C;  2FCT A;  1M06 G;  5KXD A;  4YM0 A;  3TN9 1;  3ZDV A;  4XXP A;  3FHA A;  3E1F 1;  3USU A;  1GNZ A;  5FZA A;  1LHV A;  2FMY A;  1JOB A;  1GR3 A;  1G9A A;  3BTY A;  4C90 A;  5C3P A;  1JS9 A;  3IDC B;  1G9C A;  2BNM A;  4B1L A;  2GH2 A;  2RV9 A;  2PQS A;  1QDO A;  4UF0 A;  4JRA A;  1S0J A;  2AZ5 A;  1BHG A;  4AVS A;  4M01 A;  2RS1 1;  1Q3E A;  3MIG A;  3PUI A;  2ZS6 B;  4AI2 A;  2D6K A;  2EVX A;  4O61 A;  1D2Q A;  4RQP B;  3ILN A;  4KU7 A;  1JHN A;  4KGQ A;  4MXW A;  1I3H A;  4XJU A;  1CIY A;  1Q8V A;  3KMH A;  4ARY A;  4DS0 A;  1W6N A;  2ERF A;  2ARE A;  2YFZ A;  2QNK A;  5FYS A;  3I2J A;  4CCE A;  3LFI A;  1CAW A;  4Q4Y 2;  4Z07 A;  3O1R A;  5KBF A;  3TEX A;  1ZBE 3;  4Y4Y A;  4ISR A;  2BZD A;  5K9Y A;  3LZZ A;  1CJP A;  2EXI A;  3IB3 A;  3WG4 A;  2G1M A;  3OGV A;  2B42 B;  3ZN5 A;  3VKN A;  4BXS V;  3C7E A;  2ET1 A;  1N3Q A;  2EAA A;  1AJO A;  1UU5 A;  1G9D A;  4K7J A;  3VZO A;  3PNA A;  3ILR A;  3LPG A;  4XCB A;  4CCK A;  1PZ8 A;  2PLV 3;  1N1T A;  3GBF A;  3POF A;  4PDW C;  4Q4Y 1;  5C33 A;  2DVB A;  4KI5 M;  4QKD A;  1ZM1 A;  4MGT A;  3H3Z A;  3D4K A;  3VKF C;  3OD4 A;  2ARB A;  3E6B A;  3ZFE C;  3FBM A;  4L97 A;  1OVS A;  4TZD A;  4M3C A;  2Y6L A;  3EJK A;  1W8Z A;  3ZSJ A;  2WZR 3;  1JOP A;  2XQX A;  3OPW A;  3D6E A;  4FPY A;  3B69 A;  2VUL A;  2UWA A;  5C3Q A;  1GAN A;  4XMI A;  1NLS A;  3JZV A;  4LIT A;  2ILM A;  1RUF 3;  3T2T A;  2WO2 A;  3AP4 A;  4AYU A;  3ZYB A;  4PBO A;  2F17 A;  1SG3 A;  2ORZ A;  3M3O A;  2P34 A;  3LSE A;  4NN0 A;  3PU8 A;  4J1X A;  4AGR A;  4FXK B;  1Y3T A;  2QQO A;  4AQ2 A;  4CYD A;  1UU6 A;  4E27 A;  2WZP P;  5AVA A;  1NZC A;  1GQH A;  3UT0 A;  5BNP B;  4C91 A;  1L7L A;  1O3S A;  4YG3 A;  1LKN A;  2ZZQ A;  2AYH A;  2J7M A;  3ROU A;  5IVB A;  4QT6 A;  1GIC A;  4MGK E;  5KC6 A;  2W46 A;  1UMI A;  1CVN A;  1ZA4 A;  1JYC A;  2RDR A;  2RS5 2;  4FPL A;  2XUE A;  2Y6K A;  4JGY A;  5CNA A;  3SCH A;  3ME2 A;  2DUQ A;  4LTA A;  3I3M A;  1DF0 A;  4NJ4 A;  3LOB A;  2K2S A;  2VZ3 A;  3BPS A;  3GZA A;  2XHK A;  2RS3 3;  4NVP A;  4Z82 A;  3JXS A;  4GA9 A;  2P3I A;  4P5Y A;  3C8X A;  2J1R A;  5L9V A;  4Q27 A;  3K3O A;  4NOT A;  4HSL A;  1VMH A;  4GB3 3;  1OA2 A;  3IPV B;  2ZHK A;  3R4U A;  1JW6 A;  2YGL A;  5GZG A;  5FJH A;  1DDL A;  3THP A;  1LOG A;  2H0V A;  3NO8 A;  4BQ3 A;  3H8R A;  2RS5 1;  4H7L A;  1UMZ A;  4YVS A;  4MHU A;  2ET7 A;  4BOW A;  1ZNP A;  5CYY A;  4ATE A;  5GZD A;  2VUJ A;  5FFO C;  2CY6 A;  1AL2 3;  1K5M B;  2KM2 A;  1S55 A;  4MGZ E;  1DGR N;  1F2N A;  3ZX7 A;  5DZG A;  5FBJ A;  4HK8 A;  3VDD A;  4CP0 A;  5AFE A;  3OOX A;  1OKQ A;  4AVV A;  5FXW A;  1C4R A;  1Q5O A;  2W91 A;  1ZZB A;  3AZY A;  2Z79 A;  1H8V A;  3KT7 A;  5A3P A;  1MS8 A;  4TLG A;  5ABJ A;  1LAJ A;  3L2H A;  4OUM A;  1NCQ B;  1LGN A;  3BOD A;  2R7E B;  1ZVF A;  3U4X A;  2XLF A;  1US2 A;  2ZKL A;  2WN3 A;  4KU8 A;  3H9A A;  4JDM A;  4CUC A;  4XF9 A;  4XOG A;  5FRA A;  2WQ8 A;  4CDQ B;  4NO4 A;  1RB8 G;  3WX5 A;  3PME A;  3E5Q A;  4I02 A;  4ASM B;  1PIV 3;  5FXV A;  5L7O C;  2DBI A;  1KDM A;  3MBW A;  2WFP A;  3WW4 A;  2BV4 A;  5EV7 A;  4RFT 0;  3MID A;  3WW2 A;  2GC0 A;  5A3T A;  4HG6 B;  5F3I A;  1R1Z A;  4K20 A;  1NXM A;  1GOG A;  4XJ8 A;  3ZXF A;  5AC9 2;  3ABZ A;  4GMP 3;  4GKX A;  3CLP A;  5F3G A;  2WT1 A;  4IDZ A;  1VP6 A;  1GZC A;  3I2O A;  1V6N A;  3FC0 A;  3W5M A;  2UY9 A;  4LKS A;  1FNZ A;  1V0A A;  3WF3 A;  1XB9 A;  1W6P A;  1EPZ A;  3RZM A;  5FKB A;  5JR2 A;  4TLF A;  1NLR A;  3SCG A;  1AR9 3;  2QQP A;  2FCV A;  5BNN A;  1AYN 2;  2NMN A;  3P6B A;  5GAL A;  3ZIX A;  1CZT A;  1RUC 3;  2JDY A;  5FY0 A;  4Z1V A;  4CCO A;  5JUV A;  1UOB A;  4AVB A;  1JXN A;  2Q5T A;  2VTF A;  2WZE A;  2WNO A;  5AC9 1;  2F4P A;  1NA1 A;  4EQV A;  3AP5 A;  5F3C A;  1AR6 3;  2CSG A;  4LBQ D;  4WM7 B;  3NW4 A;  5FP8 A;  1UL9 A;  1F35 A;  1FOD 2;  2Q8C A;  5LA1 A;  2XH6 A;  5JXG A;  3DGT A;  3K46 A;  4LKE A;  3CEW A;  5CFD C;  3LEK A;  3ZKY A;  5IVC A;  1PVC 2;  1W2A X;  1YC6 1;  2FBE A;  3GBW A;  3ZKU A;  3RDI A;  4YW2 A;  1RED A;  2RJK A;  2VQT A;  2B9U A;  4YG6 A;  1LES A;  2Y6J A;  1AYN 1;  3I2D A;  1OOP A;  1V00 A;  2VVD A;  4ZXK A;  2MEV 2;  4WVM B;  1KDK A;  1NAE A;  3ST7 A;  4IEP A;  2W1S A;  4C1W A;  3WNO A;  2X5I A;  1AYM 3;  5LRS A;  4DPN A;  1IHM A;  3OGS A;  3R4S A;  4URA A;  4XUN A;  5IW0 A;  3M2M A;  1FOD 1;  1O3T A;  4YM2 A;  4TYS A;  4XXA A;  4AF9 A;  1PVC 1;  1R09 2;  1W6Q A;  2OUJ A;  3NNM A;  4BXF A;  1RIT A;  2XJS A;  2W87 A;  1HQN A;  1Q8P A;  3KF5 A;  2R06 3;  2VZ1 A;  1BBT 2;  4LR4 A;  2MEV 1;  4DRV A;  5JI9 A;  3POJ A;  5FYB A;  5LBF A;  4QAW A;  2BGC A;  2BER A;  1JZ2 A;  2B5H A;  2AUY A;  4NRQ A;  4YLZ A;  3TEZ A;  5LEK A;  2V72 A;  2DVD A;  4O65 A;  5ACA 3;  3UNP A;  4RYD A;  2YYO A;  2OKX A;  1GKB A;  3AL5 A;  4OVE A;  4M4R A;  4UFJ A;  3VZL A;  1OHF A;  2OS2 A;  4PDW B;  3NV4 A;  2BFU L;  3VKM A;  3GBG A;  1DLL A;  3PVN A;  5FO9 B;  1GZW B;  2O8O A;  1R09 1;  5E8A A;  3ZFE B;  5IK7 A;  2QQK A;  2YDE A;  2ES3 A;  2YV8 A;  1GLH A;  1TNF A;  4Y20 A;  5C3O A;  5FZH A;  1JTZ X;  3E6D A;  3N3H A;  4L9B A;  2VVE A;  5D8A A;  3WDV A;  2VOV A;  1BBT 1;  2EIG A;  3K77 A;  3WQ0 A;  3AM2 A;  4OFG A;  2F4L A;  1FNY A;  4UI9 L;  2P2K A;  3TNP B;  3VHR A;  1F8V A;  3O0W A;  1RUO A;  5GLT A;  2J1U A;  1SLI A;  2JEM A;  1VBB 2;  3BKZ A;  1FV2 A;  2BOI A;  5BNO C;  1NUK A;  3GCX A;  4JGZ C;  4RA0 A;  1TNR A;  1W8T A;  4UBH A;  4B8E A;  2HYK A;  4D94 A;  2IUW A;  3WG2 A;  2RMU 3;  1C57 A;  5FJK A;  2EID A;  2JG8 A;  4IER A;  2UWC A;  4UT5 A;  3WVJ A;  3W58 A;  5EPA A;  1ZZ8 A;  4GWM A;  4XFB A;  5F37 A;  1O8P A;  1CR7 A;  3DCQ A;  3MIC A;  1ZA7 A;  4LK7 A;  4NPM A;  3WUC A;  2VJX A;  5C6C A;  1H2L A;  1Y4W A;  1TME 3;  4XYX A;  1BYH A;  3VBF A;  3SH4 A;  1HLC A;  1VBB 1;  3WZ1 A;  4CCM A;  1OLQ A;  3ES4 A;  4Y3O A;  3MIF A;  5A6X A;  5FPB A;  4JV4 A;  2D98 A;  4HLT A;  1YFU A;  4QGN A;  4XBL A;  5FZ4 A;  3GZU C;  3WDW A;  3NJV A;  4YAR A;  1Q56 A;  2P6C A;  3MFA A;  5IHR A;  1ZZC A;  3RVH A;  1NQD A;  5H9P A;  2FD8 A;  3BUC A;  3SEP A;  4WM8 C;  4QX8 A;  4QWN A;  4CEY C;  4WVV A;  3VHO A;  5GJ6 A;  4P9G A;  5FP7 A;  1E5R A;  4JDO A;  3CIH A;  2VNO A;  1RUD 3;  2YBS A;  5F8P A;  2RJL A;  1DGW A;  3FWE A;  1AL0 G;  4OQ9 A;  4LXL A;  1H1M A;  3AZV A;  3H42 B;  1DP0 A;  4IEW A;  4ZKT B;  2WBK A;  1UX6 A;  3RJR A;  4B7K A;  5J96 B;  1DGL A;  1V6I A;  2HBT A;  4EWE A;  2HEV F;  5FYM A;  1GOF A;  2ZAB A;  1JUI A;  2VW0 A;  2QQN A;  3AFG A;  3B3Q E;  1J83 A;  1LJ7 A;  1MS1 A;  2A3X A;  2JE9 A;  5J7M A;  2GP5 A;  4RS5 C;  1E57 A;  3VL8 A;  4Q2F A;  1LB2 A;  1W0O A;  2HWC 2;  4RN5 A;  5IVY A;  1QOO A;  3MW4 A;  4UW4 A;  5F3E A;  5K4L A;  4L99 A;  1ONA A;  4WZC A;  1QQP 3;  3N7L A;  3OBZ A;  5H9S A;  5J37 A;  3MLK A;  1AXY A;  1MS5 A;  1XE0 A;  2VO5 A;  3AK0 A;  1ULG A;  3OEA A;  4CTE A;  1NZI A;  4IV1 A;  4NR1 A;  4UWD A;  4DXS A;  5L7O B;  3O1O A;  2FHR A;  5EJZ B;  3WG1 A;  4MGQ A;  1WCQ A;  2Y34 A;  1SLT A;  2ZKN A;  3CMG A;  3HEI A;  2ZBJ A;  4QDS A;  4EN0 A;  4N53 C;  1O7F A;  2WUH A;  1S2K A;  2VNG A;  2YHJ A;  5DAQ A;  4OHX A;  4NHY A;  3V0B A;  1WLC A;  2HWC 1;  3N9N A;  1RJ7 A;  3U10 A;  5LAS A;  1SDW A;  3T1M A;  5FQ0 A;  3WOG A;  3VDB A;  1BXH A;  4XC9 A;  2X8K A;  5A33 A;  1V6L A;  4FI9 A;  4KGG A;  4ES8 A;  1F4H A;  5FZC A;  1XNK A;  5LBE A;  5IK8 A;  1BLZ A;  3O1M A;  5A6Q A;  1W6M A;  2JDH A;  2WDB A;  2HWF 3;  3MI8 A;  4XFI A;  5H9Q A;  4OUL A;  4Q8L A;  4F7Z A;  1ULP A;  5FY8 A;  1PHM A;  1LGC A;  4Y1X A;  3U07 A;  3ETQ A;  2HWB 2;  2ZTN A;  3OEB A;  4W50 A;  5DUU A;  1COV 3;  1ULD A;  3J8F 2;  3MIE A;  5CFD B;  1JYT A;  1CES A;  2IWG B;  1IS5 A;  2QKD A;  1OC1 A;  3I8T A;  3JB8 A;  3AZW A;  3NNG A;  3MFC A;  2E53 A;  5F9T A;  2IXC A;  4OHZ A;  4UFM A;  2XOM A;  2Y64 A;  1LHN A;  2C24 A;  1OFS A;  3LEG A;  3U78 A;  1RHI 2;  3D8C A;  1W3X A;  3FUQ A;  2HWB 1;  2JKB A;  4FFF A;  3ZXE A;  4MHR A;  3MLL A;  4B4Q A;  1JI6 A;  3WD5 A;  1GQP A;  1ST8 A;  2BWC A;  4CRQ A;  3W5N A;  3J8F 1;  3Q8F A;  4DZG A;  4C1X A;  3IKW A;  1D4M 3;  2P37 A;  4FTE A;  4HT1 T;  3ZLI A;  5CAD A;  2H6C A;  1IS3 A;  4GIQ A;  4W8J A;  4CA9 A;  4Y22 B;  3ACI A;  2AEN A;  2D6P A;  1WD4 A;  5FZ3 A;  5IVF A;  4XTM A;  2JXA A;  5CKM A;  3VLB B;  4KWJ A;  3VUO A;  1ND3 A;  4P00 B;  2NM1 A;  3PVB B;  4D69 A;  3HVD A;  4LUM A;  3W20 A;  1MEC 3;  4I0A A;  1HXS 3;  2WAO A;  5DPN A;  1RUI 3;  1MZ5 A;  1AXZ A;  3FMG A;  1RHI 1;  3KT1 A;  3E6C C;  1DYK A;  3M3Q A;  4FPK A;  1UIK A;  2WZ8 A;  1JH5 A;  1POV 3;  4AEJ A;  3I3Q A;  3NJZ A;  3E5U A;  4DXT A;  2HH9 A;  1KJR A;  3ACL A;  2QUO A;  5E1R A;  4XAC A;  1LTE A;  3DXT A;  2Y0O A;  1QJZ A;  1UD1 A;  3B5L B;  1YHF A;  3GZT B;  3VBU A;  4GWI A;  3OGR A;  2TUN A;  3EXU A;  3FLR A;  2WT0 A;  1WBF A;  4FFI A;  4AHY A;  3T1L A;  1ZRD A;  2BQP A;  3ZYR A;  1CAX A;  4R8H A;  4LEJ A;  3SNM A;  4BH9 A;  2ARA A;  5A3N A;  2Y6F A;  5CFC C;  2DUO A;  4P9X A;  1QJU 2;  1YYN A;  4XDO A;  3HN1 A;  1FMD 3;  4S2G A;  2JB4 A;  1YQC A;  2PAE A;  3N9Q A;  5BNO B;  4IL7 A;  1OKO A;  3III A;  4JGZ B;  2WL1 A;  4BLJ A;  1M4W A;  3HNM A;  4OYU A;  5ISL A;  4QPI A;  3VKO A;  5HCF A;  5JIU A;  1MS4 A;  5A32 B;  4RHV 2;  2CAU A;  1MS3 A;  1Z7S 2;  4HVO A;  4FAH A;  1LOF C;  3CJX A;  3IDA A;  3FLP A;  1PO1 3;  2XL7 A;  3ZXD A;  3S0M A;  1R1A 3;  4CDU C;  4C8D A;  1IOA A;  4X6Q B;  1QJU 1;  4HK9 A;  2WA4 A;  5T3N A;  3IM0 A;  3KT4 A;  1AR7 2;  1MVE A;  2Y60 A;  2YZ4 A;  3ZDS A;  2ZHL A;  5CG8 A;  4MX3 A;  4DXZ A;  5T55 A;  2D5F A;  2P17 A;  1VAM A;  4M3C F;  1H6Y A;  1UZY A;  4R9C A;  4NWW A;  5A6Z A;  4K8F A;  3APB A;  4QD2 A;  2PXJ A;  4FP3 A;  1OXC A;  4RHV 1;  3V64 A;  4LO4 B;  1Z7S 1;  3WEZ A;  1O8S A;  2W5F A;  3NMB A;  4WM8 B;  3WNM A;  5DUW A;  4BM8 A;  3K2O A;  2JWP A;  4CEY B;  4YSF A;  1JZ5 A;  2YUE A;  5DUV A;  4MG2 A;  1W0P A;  3WF0 A;  1ASJ 3;  1AJK A;  2TEP A;  4ITC A;  4RGG A;  2IFR A;  1DQ2 A;  2PMW B;  3M7A A;  3P3N A;  1HRV 2;  3RZL A;  2Q1F A;  5FYY A;  3ZPO A;  4ZU7 A;  1AR7 1;  2VMH A;  4S2H A;  3MLJ A;  4QX5 A;  3VBO A;  4CEW A;  3K51 A;  4CCD A;  3FJS A;  2JIJ A;  2DUP A;  2XBO 3;  4LUL A;  3IZO A;  4QHZ A;  1OLM E;  4RS5 B;  1W0N A;  2WWS A;  1S4C A;  1UZV A;  2D3R A;  4F3J A;  4JGY C;  4ATF A;  4DFS A;  1IS6 A;  3WQ7 A;  2QQI A;  3KB5 A;  4HON A;  5FY5 A;  3TWI A;  2PHD A;  2YY1 A;  2J22 A;  3R6S A;  4BHP A;  4XFC A;  4W65 A;  2WFF 3;  5C4W C;  5CEH A;  3J7N A;  5FUP A;  3KHC A;  1HRV 1;  4LLF A;  3PIG A;  2VZS A;  3JBG 3;  1KRI A;  4IV3 A;  3SMH A;  4XJ9 A;  2JDM A;  2PA7 A;  4BQ4 A;  4EZ4 A;  5ANQ A;  1CN1 A;  1E5I A;  4A3Z A;  1BEV 2;  4ZXE A;  4K1Z A;  1HJG A;  1K3I A;  4AGG A;  2A6Z A;  1WA6 X;  4N53 B;  3I7D A;  3KHB A;  2X05 A;  3IBM A;  5J1X A;  1IQA A;  2O1Q A;  1WMD A;  5A7W A;  4N43 C;  4YW1 A;  4LUK A;  4QQO A;  1XNA A;  2VW1 A;  5JVV A;  2Q8E A;  3KQR A;  2NP0 A;  4FSJ A;  3RI8 A;  2A3Y A;  2GME A;  3HPN A;  2Z5W A;  4YVS C;  2VCC A;  4YZ2 A;  3RZG A;  3RMX A;  2MPF A;  2ZEY A;  3EYP A;  1K5J A;  2C26 A;  4LNV A;  3B93 A;  2JD4 A;  3OGG A;  1REF A;  3S5Q A;  4DRR A;  1H4H A;  2DU1 A;  4B4R A;  4G4F A;  3OUH A;  4RGK A;  3T4H B;  5CAZ A;  2CNA A;  2R07 3;  4OQ8 A;  1NY7 2;  2PHU A;  2XG3 A;  3JB4 C;  1LED A;  1BEV 1;  3LCP A;  3LA7 A;  3IMN A;  4FCA A;  1RUG 2;  5ABJ C;  2FDI A;  1SMV A;  4R4X A;  3GXU A;  3AYD A;  1OI6 A;  2EXJ A;  5CZK A;  4AI8 A;  3MYX A;  3HBZ A;  1RGS A;  2VQ0 A;  1W6O A;  2VOK A;  4Q0S A;  3MW3 A;  5LEJ A;  4YZ1 A;  4B29 A;  1YLL A;  3CQO A;  5KXB A;  2ZEW A;  4IE7 A;  3H7J A;  1X7N A;  4A44 A;  1FAY A;  5T52 A;  4XUQ A;  2ZGM A;  4XFG A;  4CCC A;  1VJ2 A;  1XU1 A;  1NLQ A;  1SZB A;  4UAP A;  1UKG A;  1O5U A;  4YVW C;  1VBD 2;  2FZ2 A;  1SDD B;  3GDB A;  5D21 A;  2YG0 A;  1JMU B;  4LIU A;  3KV5 A;  2PYT A;  4AQS A;  1NY7 1;  1RYY A;  4XQD A;  1QXJ A;  2B46 X;  2VNV A;  3LDR A;  3E5X A;  4XIO A;  4AWD A;  1RUG 1;  1JZ4 A;  2IFW A;  1QNY A;  1GP6 A;  5DDJ 2;  3C7G A;  4IEX A;  4XET A;  4YGB A;  4GD4 A;  2VOW A;  3LIG A;  5FZK A;  1Q43 A;  1OLM A;  1EYB A;  3OPT A;  2XHN A;  4EN9 B;  2ZPX A;  4S2F A;  1DU3 D;  2X09 A;  3H1W A;  5EHD A;  5F5I A;  3DEM A;  5FPA A;  3A23 A;  1VBD 1;  4LBQ A;  2VEC A;  4IE4 A;  3ZXJ A;  1BMV 2;  4L92 A;  4QX0 A;  1TE1 B;  1TEI A;  2PHW A;  2K0G A;  3OJB A;  1GU3 A;  4QB1 A;  2YC0 A;  1OUX A;  1WLW A;  5IJR A;  1O5L A;  5I91 A;  5FPV A;  3GZE A;  1SFY A;  1NA1 C;  2JIG A;  5DDJ 1;  3J26 N;  5DG2 A;  1WCU A;  4RR3 A;  2W92 A;  3HMY A;  3B01 A;  5HPO A;  3FFZ A;  2LAL A;  1GUI A;  4OHW A;  4FVV A;  3WF4 A;  2R0F A;  2WSU A;  2WS9 3;  3DKQ A;  4OI2 A;  5JOY A;  3BIE A;  4ZU4 A;  2R49 A;  4IEY A;  5JZG C;  2H6B A;  3PIJ A;  4BIS A;  2NPI A;  3PTR B;  4OUS A;  1XSQ A;  2C9K A;  4CUB A;  4CP9 A;  5FP9 A;  5LZ6 A;  1BMV 1;  4UF0 B;  5LA9 A;  1OOP C;  3JQW A;  2B39 A;  3KCX A;  3AP7 A;  2HEW F;  4HZF A;  2AC1 A;  3UJO A;  3VBS C;  1JHJ A;  1KFX L;  5HV4 A;  3I54 A;  3O1T A;  2AGS A;  4MXW B;  2A71 A;  1STM A;  1VIW B;  5CFC B;  5FYU A;  4PBP A;  4BU2 A;  4DO0 A;  5FYI A;  2FMD A;  3K3N A;  1RUJ 3;  4LBM A;  3MIH A;  1UW8 A;  1H6X A;  3HT1 A;  2RE9 A;  1I5P A;  3MPP G;  1W9Y A;  4TWT A;  3MZH A;  5H9R A;  2WNV C;  3PLQ A;  5GLU A;  5IWF A;  1OLR A;  2XUM A;  4D8M A;  1Q8O A;  4BK5 A;  4D0Q A;  1CQ9 A;  4XFF A;  4NIH A;  4RQP A;  1PO2 2;  3FBY A;  3NAP C;  3WNK A;  3JCI A;  1VR3 A;  2UY8 A;  4AQT A;  4QPY A;  2VXR A;  2XJR A;  2ZGT A;  4QDR A;  4JHZ A;  5JXH A;  3S57 A;  4R9A A;  4YW4 A;  3I2G A;  3LEI A;  4CDU B;  1V6J A;  1VAK A;  4Q4X 2;  1L7Q A;  4AGV A;  5FYZ A;  4J25 A;  3GHN A;  2Y6H A;  4HVR A;  1C5I A;  4PCR A;  5FUI A;  1XJA A;  1DIW A;  2IXL A;  2XVG A;  5A6Y A;  2OA2 A;  4UFH A;  1WCD J;  2VTX J;  4XQ4 A;  5FZM A;  4P08 A;  2CHH A;  2QFE A;  3TEW A;  1S1A A;  2NQY A;  1VRH 2;  1TMF 3;  4JAA A;  4BLI A;  3TOJ A;  2Q1M A;  1PO2 1;  1UYZ A;  2GAU A;  3OB8 A;  3HIF A;  4UFI A;  5D8A C;  1ZRF A;  3URF A;  4ASL A;  5FLJ A;  4V2V A;  4BE3 A;  1A8D A;  4LOS A;  4S2D A;  1GMM A;  4FPC A;  4JKL A;  2EA7 A;  2PHL A;  5LB6 A;  4FOY A;  4CDX A;  4Q4X 1;  1XSR A;  3P5B A;  4E9K A;  1FI2 A;  2Y33 A;  5FZ1 A;  2B8M A;  4GJZ A;  1QJY 3;  4LE3 A;  2RDQ A;  1VBA 3;  4FTS A;  1DYO A;  2QZ2 A;  4LHL A;  4OZX A;  4AEM A;  5C9A C;  4LT5 A;  3RI9 A;  2A73 B;  2YU2 A;  2VNR A;  3SH3 A;  2JG8 C;  2ZAH A;  3VHP A;  1W99 A;  2JD9 A;  4YRD A;  3H8O A;  4A4A A;  2PQQ A;  1VRH 1;  5DMY A;  5JOW A;  5C8C C;  4FPJ A;  1WW5 A;  2WT2 A;  3J4U H;  4LPL A;  3LE0 A;  2WJS A;  3RWN A;  4FQ4 A;  4GMP 0;  4JGY B;  1GWM A;  3MDP A;  3ZFF A;  4HVQ A;  1PGL 2;  3ZVX A;  3ORJ A;  5F1R A;  1XNT A;  5E6H A;  4WM8 A;  5C4W B;  1AR8 3;  3I3B A;  4XJZ A;  3BU0 A;  2HWD 2;  1O59 A;  4IEV A;  3WQB A;  4XHB A;  1U5Y A;  1CAU B;  5F2S A;  2JB8 A;  2WQ4 A;  3QD6 A;  5A1L A;  2W9X A;  1F4A A;  4QHB A;  2PEL A;  3VD7 A;  4AXO A;  3RYP A;  4GQ7 A;  4BQ5 A;  2ZGS A;  4N43 B;  1ULC A;  4AFB A;  1XYO A;  1HB1 A;  3HT2 A;  4Q4V 2;  4XUO A;  4YVS B;  2DFC A;  5FMC A;  1J3P A;  4CDW C;  1U5X A;  1PGL 1;  4XJA A;  4CPB A;  1JYW A;  1N3P A;  1H8T C;  2BRT A;  3T09 A;  4X6R B;  4ZY9 A;  4J6G A;  4MGY E;  2HWD 1;  4E2G A;  1Y43 B;  4A41 A;  1U5Z A;  3QLQ A;  4Y33 A;  2QDR A;  2A6W A;  5A7Q A;  4QM8 A;  1S0F A;  3IPV A;  3P3P A;  1VBC 2;  5JR7 B;  5ABJ B;  4PQ9 A;  1RTV A;  1V9U 2;  3KGL A;  5JAX A;  1NE4 A;  1RUH 2;  3OUJ A;  3ZR6 A;  3OBR A;  5K8S A;  2EIB A;  2QE3 A;  1VB4 A;  3THD A;  3JU9 A;  2ZGQ A;  4NAM A;  4UW3 A;  3ZXA C;  4Q4V 1;  1KD7 A;  1FAT A;  1HB3 A;  3N9M A;  1ND2 C;  3CKH A;  1K5M A;  2VCA A;  4BB3 A;  4QQH A;  4GAZ A;  4YVW B;  2QQL A;  5JDB A;  4IV1 C;  1EUU A;  1AUY A;  4NAO A;  2VC9 A;  4KG8 A;  3ITQ A;  4GH4 C;  1W9F A;  1GFF 2;  5LAT A;  4LKD A;  1R08 3;  2Q8D A;  2QQV A;  3POS A;  1NCQ A;  4OCT A;  1VBC 1;  4G3Y C;  3HBK A;  1RC6 A;  1V9U 1;  2XJQ A;  3VD9 A;  1RUH 1;  4LQR A;  4ZS3 A;  1PK6 C;  2JIC A;  3J7L A;  1IPS A;  4UBG A;  1XQN A;  4CDQ A;  1J1T A;  4PIZ A;  2OYZ A;  5FLI A;  4I2O A;  1J84 A;  2G9F A;  1W6P B;  3VGI A;  3BTX A;  5A7S A;  3ETP A;  5DAW A;  1MS9 A;  1W3V A;  2DVF A;  2EXK A;  2XDV A;  3N7J A;  4P5H A;  2VZR A;  5LY2 A;  1O6U A;  1ZBA 3;  4YZ3 A;  3T4V A;  5IVJ A;  2HWE 3;  2QDN A;  2D3P A;  1I1E A;  1NA1 B;  2QCS B;  2CGO A;  4MOA A;  3BYW A;  1ZBE 2;  4JX0 A;  2GMP A;  5BV6 A;  1KJL A;  1OVP A;  1GBG A;  4K8R B;  2IXJ A;  2A70 A;  1AX1 A;  2K46 A;  5FZF A;  4XF4 A;  2VBP A;  1G7Y A;  2Z4F A;  3VV1 A;  2A6X A;  5JZG B;  1C1F A;  4PI0 A;  1YFW A;  5FPU A;  2PTM A;  2VZV A;  2PHF A;  5FMO L;  3WSO A;  1OOP B;  1WBL A;  2E51 A;  3I2H A;  3CU7 A;  2AAC A;  4D7T A;  4UYB A;  2IXI A;  4NIA A;  3VBS B;  4ERO A;  5KR7 A;  2JDU A;  1DQ1 A;  1RVF 3;  1OF3 A;  2ZJC A;  3FN9 A;  1V70 A;  2PLV 2;  1D0H A;  4WM7 A;  2GZW A;  4AAX A;  5EJ1 B;  1GV9 A;  3KWV A;  2P3Y A;  4EE2 A;  1QXR A;  5DQ0 A;  3MHZ A;  1ZBE 1;  3N9L A;  3AMH A;  2B45 X;  4AFA A;  3M1H A;  4DIN B;  4Q4W 3;  2BBV A;  2D44 A;  5LK7 B;  1NCR C;  2D97 A;  4EJR A;  2CDO A;  2HEY F;  4Z2W A;  5B4N A;  1OD3 A;  2DCK A;  1VPH A;  5DAB A;  3JUU A;  5A7N A;  4NII A;  2WNV B;  3KV4 A;  4BCU A;  2WZR 2;  1G9B A;  1QHD A;  2VGD A;  2VAU A;  3PUR A;  3M3E A;  3RGB A;  3NAP B;  1Y9Q A;  1EAH 3;  1ND3 C;  1RUF 2;  1ENX A;  4KG0 A;  4CCL A;  2ZML A;  2DYC A;  5C8W A;  2W52 A;  2R0H A;  3CJI C;  2Q4S A;  1NXD 1;  3VD3 A;  1KQR A;  5K0U C;  3JD7 3;  5FOJ B;  1EV1 3;  2PLV 1;  5JXI A;  1RUE 3;  1BJQ A;  1DG6 A;  2BDR A;  2KR2 A;  3T3Y A;  3WDY A;  5EZW A;  3BCW A;  4KBB A;  1BCX A;  1QKQ A;  3U4S A;  2ZX1 A;  1GWL A;  3VBU C;  4I0W B;  4XFA A;  2WZR 1;  1IGO A;  5I0R A;  1WW7 A;  5L9R A;  5CIR A;  1YWK A;  2FDK A;  4PF5 A;  4Y20 B;  3J7H A;  2GN7 A;  4CVU A;  5B2G B;  2VMF A;  1X8E A;  1G86 A;  4H2A A;  1NOV A;  1RUF 1;  5D8A B;  5LWB A;  4IEO A;  4NPR A;  4TXW A;  5JSP A;  1CJD A;  1RMU 3;  3A0N A;  5FK8 A;  5LK5 A;  5T5O A;  5EYY A;  4YM3 A;  2RS3 2;  2QBX A;  5LA0 A;  4Y1Y A;  1QJE A;  3HR9 A;  3WP4 A;  5BNQ A;  4LHS A;  2VG9 A;  5IAT A;  1U5I A;  1K12 A;  2CV6 A;  4KWK A;  5C71 A;  4RSU A;  2R04 3;  3CNA A;  4XHX A;  5IYY A;  3FZ3 A;  4GB3 2;  3TEY A;  2DCT A;  4P9L A;  2GSY A;  4PIX A;  4C0H A;  1OD5 A;  1W90 A;  5APA A;  3ZFE A;  4NID A;  5C9A B;  4JQT A;  1E5S A;  4WBB A;  4QPI C;  3G6J B;  2JG8 B;  1HW5 A;  2CAV A;  5A3O A;  4AG4 A;  1R64 A;  3UES A;  3ZXG A;  4AHX A;  3F2Z A;  1IG3 A;  5FXX A;  4QB6 A;  5C8C B;  1CPM A;  2ZGN A;  2VCM A;  1RIN A;  1T2X A;  3ATG A;  1AL2 2;  1MZE A;  3NRU A;  1AX2 A;  1UY4 A;  2RG4 A;  2RS3 1;  1DQ5 A;  1C8N A;  4JCK A;  5JLV A;  2W47 A;  5T5J A;  1SBE A;  2V4A A;  3GHM A;  4BQW A;  1BQP A;  4DB5 A;  1H4G A;  2A6Y A;  3BPZ A;  2R6Q A;  3L2Y A;  4GB3 1;  2VUD A;  4DEV A;  3WV6 A;  1Y9M A;  1QWR A;  2Z69 A;  4LO8 A;  1DYP A;  2D6M A;  2PAM A;  2DFB A;  4Y26 A;  5A70 A;  3U0Z A;  1JOD A;  3BOW A;  2XON A;  3IIA A;  4O9G A;  2JDK A;  1DQ4 A;  2Q1Z B;  5JI7 A;  3BVC A;  1AF9 A;  3ZO0 B;  3ZN6 B;  5SV5 A;  1PIV 2;  4CDW B;  2DBN A;  1AL2 1;  3O12 A;  2EF6 A;  1PGS A;  2RM2 3;  1H8T B;  1H30 A;  2P5B A;  5ANN A;  4KBZ A;  4V1P A;  3UV9 A;  4FFH A;  2WKK A;  4CP2 A;  2CTV A;  1ZYB A;  1IG0 A;  2WO3 A;  2XR4 A;  3Q8B A;  2RDN A;  5EIY B;  4OMC A;  4IGQ A;  4PIY A;  4OHV A;  2ZX4 A;  3VBO C;  4B3N A;  2BNN A;  1N1S A;  2W94 A;  1VMF A;  4Y1V A;  1FPN 3;  3FLT A;  1QJX 3;  2VTX A;  3AJY A;  1C8M 3;  2ZGR A;  2GAL A;  2RHP A;  2XJV A;  3LIH A;  2A7A A;  2E9Q A;  1H9P A;  1PIV 1;  3U1X A;  1DGR A;  1MAC A;  3Q8C A;  3RG0 A;  1ND2 B;  4N7I A;  1AR9 2;  3B02 A;  5DUX A;  3DPR C;  4D6R A;  2E26 A;  1UXZ A;  2J1A A;  4Q8K A;  2D40 A;  4I30 A;  2AH2 A;  4IV1 B;  1QXP A;  1RUC 2;  4QB2 A;  4IV3 C;  3M70 A;  3T0A A;  4GH4 B;  4XZP A;  3OBA A;  1JZ3 A;  3PUS A;  2DTW A;  3SKV A;  4COU A;  4GMP 1;  1H1A A;  4JDN A;  4X8P A;  3HWJ A;  1AR6 2;  3D0S A;  4JTN A;  1LU1 A;  4GKY A;  3KSC A;  4OI4 A;  5I8Y A;  4IEQ A;  1PK6 B;  1OQE A;  3V0B B;  1LEM A;  5F32 A;  5FY4 A;  5FP4 A;  2YFU A;  2RR1 3;  3WF1 A;  1SHW B;  1O4Y A;  1SBD A;  1ULO A;  5FLH A;  4ES9 A;  3UJQ A;  1SPP B;  1SQ4 A;  1AR9 1;  5L7O A;  1POV 0;  2JDN A;  3RQ0 A;  2DWR A;  5A33 B;  2D6N A;  2OZ6 A;  2VZT A;  2V09 A;  1XYN A;  1RUC 1;  3V0A A;  1WMF A;  2ZXQ A;  3EO6 A;  1HRI 3;  3VD5 A;  1PNG A;  1A78 A;  5EYX A;  4M0H A;  5F5A A;  1AYM 2;  3LGR A;  5DAP A;  3AMQ A;  3KF3 A;  4ZHN A;  2CGP A;  1AR6 1;  4A6S A;  1PX3 A;  1O91 A;  2A1X A;  4HOO A;  2XJT A;  4HSJ A;  4J1W A;  2W39 A;  4IQP A;  5EXO A;  1IKQ A;  2HYX A;  3SXW A;  2WWJ A;  1UZZ A;  4Q4W 2;  3BOP A;  5FP3 A;  2I07 B;  4AL9 A;  4DUW A;  1A3K A;  1I9R A;  2R1D A;  4CXY A;  4XAB A;  3C7O A;  5I0U A;  4G9S B;  2R30 A;  2UWB A;  1KS4 A;  5FO7 B;  1APN A;  2R06 2;  3VBR A;  3VN4 A;  5C70 A;  2VE1 A;  3KV6 A;  1Z78 A;  3HAG A;  1UYP A;  4FXG B;  2QQJ A;  4AVT A;  1SFN A;  2QQM A;  1AYM 1;  2P3K A;  4XUP A;  3AYC A;  3VZK A;  4JKM A;  5ACA 2;  1S0I A;  3ACH A;  4HAN A;  4HPK B;  2VOX A;  4H55 A;  2PFW A;  2VD7 A;  2VMG A;  1JUH A;  1GWK A;  4OMD A;  4QPG C;  4JQR A;  2UYB A;  1NCR B;  1ALY A;  3SIS A;  1VBE 3;  4NRM A;  2I45 A;  5KHG A;  2YGM A;  3MUY 1;  3V56 A;  1DBN A;  2R06 1;  3DN7 A;  2BOJ A;  2G9Z A;  4NE9 A;  4XIL A;  2O14 A;  2VXJ A;  2WIN B;  3ZYG A;  1ND3 B;  4FPH A;  1Q8S A;  2OX0 A;  4QXH A;  1DCS A;  1QOS A;  4BPZ A;  2D6L X;  3NVC A;  1CAV B;  2B4K A;  3CDZ B;  3CJI B;  5ACA 1;  5K0U B;  4LBK A;  2ZHM A;  2Y26 A;  1GQG A;  1LU2 A;  3IDE A;  4RR3 C;  4EZH A;  1H2M A;  2SLI A;  4LBJ A;  2BP6 A;  2RMU 2;  2XVK A;  1SLC A;  1GOH A;  2CU5 A;  4PLM A;  3TRS B;  1UN1 A;  3KVA A;  4FFG A;  4AED A;  4Y22 A;  3UKT A;  2YU1 A;  1V6M A;  1YI9 A;  5HV0 A;  3MW2 A;  4N8M A;  3VBU B;  1PX4 A;  5FMO S;  2MHF A;  1UXX X;  3J9S A;  4YZ4 A;  1CAX B;  1MQT A;  1TME 2;  4DY5 A;  1YFX A;  4AAP A;  5DAV A;  1TVG A;  1UYX A;  3R05 A;  5A80 A;  4B1M A;  3HQR A;  2VZO A;  2VPV A;  4Q0U A;  1X82 A;  4CUG A;  1ENR A;  3TN9 3;  2WN2 A;  2VCB A;  2RMU 1;  4HXC A;  1X50 A;  3GAL A;  4K21 A;  5EFU A;  4YGC A;  4AHZ A;  1VB2 A;  2Q30 A;  3VBH A;  2F6B A;  4QPI B;  1JYV A;  4XTP A;  1YQ2 A;  4MLO A;  4C0B A;  3ON7 A;  2ZCW A;  3AB0 A;  4K1Y A;  1EPW A;  1GP5 A;  2PN5 A;  5A7P A;  2ZEX A;  2RS1 3;  1RUD 2;  4IW3 A;  3NV1 A;  4JVA A;  2ZEZ A;  3ALQ A;  1VE0 A;  1TME 1;  3MGU A;  5FZG A;  1W8O A;  4Q1P A;  1UKR A;  1UY2 A;  3BTZ A;  2XLG A;  1N47 A;  3AKS A;  5C3S A;  4FPO B;  3OY8 B;  1IKP A;  4HKL A;  2AR6 A;  1KGY A;  4QKF A;  3WCR A;  4QM9 A;  1QEX A;  5BNO A;  5IT6 A;  3BGA A;  5FTT C;  3ZYF A;  5IVE A;  3T2P A;  2WC2 A;  5FZD A;  1ULE A;  5EJ3 A;  2NMO A;  4ISQ A;  5L19 A;  3RYK A;  4V2W A;  2BGP A;  1XYP A;  2JE7 A;  5FIX A;  3VL9 A;  4D6Q A;  1G8W A;  1KFU L;  3POG A;  4UXA A;  1OA4 A;  3MPB A;  3H7Y A;  5SV8 A;  4ARX A;  4QKN A;  1QQP 2;  2QVS B;  1RUD 1;  2KD7 A;  4XCA A;  1HKD A;  3ZFG A;  5GZE A;  1LHU A;  4CCJ A;  2DF7 A;  3DL3 A;  3KCC A;  4CDX C;  3FE5 A;  3DV8 A;  4EN7 B;  2XKO A;  2MNG A;  3VKL A;  4Q4Y 3;  4KH9 A;  3ZOI A;  1ENS A;  3H8U A;  4BIF A;  3H1Y A;  3V0A B;  4AI0 A;  4NMI A;  3VBO B;  4PLN A;  3PUH A;  4LMF A;  4Q0P A;  4M00 A;  4CEY A; 
#chains in the Genus database with same CATH homology
 5IVC A;  5FYT A;  5FZ8 A;  4NUB A;  5FYZ A;  5FZE A;  3DXT A;  2YPD A;  2VD7 A;  4EYU A;  2OQ7 A;  5FYM A;  4CCN A;  3N9O A;  5FZI A;  5IVB A;  3PUA A;  4QX7 A;  5F2W A;  5A7S A;  5FZM A;  2XUE A;  4XDP A;  2GP5 A;  3AVR A;  5FY9 A;  5F5C A;  2XDV A;  3KV9 A;  5FZ7 A;  5IVY A;  5LY2 A;  4CSW A;  4URA A;  5F3E A;  5K4L A;  5A3N A;  5IW0 A;  5FV3 A;  5IVJ A;  4V2V A;  5FWE A;  2OX0 A;  4QXH A;  4XDO A;  3N9Q A;  3K3O A;  4BXF A;  5FZ1 A;  4GJZ A;  4EZH A;  2P5B A;  5ISL A;  3PDQ A;  5FZF A;  5FZO A;  3UYJ A;  5FJH A;  4LIU A;  3KV5 A;  5A1F A;  2YU2 A;  3KVA A;  4E4H A;  3LD8 A;  5FYB A;  4IGQ A;  5LY1 A;  2YU1 A;  3DXU A;  4IGO A;  5FPU A;  2W2I A;  5LW9 A;  2XML A;  3N9N A;  2GP3 A;  5FZA A;  5KR7 A;  4GD4 A;  5FZK A;  5FXZ A;  3AL5 A;  4C8D A;  2OS2 A;  3OPT A;  5FUN A;  5FBJ A;  4AAP A;  5IVV A;  5E6H A;  5A80 A;  3NJY A;  4UF0 A;  5FYV A;  5FYH A;  5FXW A;  3N9L A;  5FZC A;  5FPL A;  3LDB A;  5F5I A;  5A3P A;  5FPA A;  4CUG A;  4D6R A;  2YBP A;  5FY7 A;  3AVS A;  5FZH A;  5A7W B;  4IGP A;  2PXJ A;  5FYC A;  5F2S A;  3KV4 A;  5A7N A;  4DIQ A;  5FWJ A;  3N9P A;  3KVB A;  4ASK A;  5FZB A;  5FY8 A;  3PUR A;  5A1L A;  3PUS A;  3K2O A;  5FYS A;  5FZ6 A;  5FPV A;  4CCL A;  2XXZ A;  3PUQ A;  5FXV A;  5A7P A;  4TN7 A;  2YBK A;  5FYY A;  3ZPO A;  5FZG A;  5F32 A;  5FY4 A;  5FP4 A;  4QXC A;  5FJK A;  5FZL A;  5A3T A;  5F3I A;  4BIS A;  3PTR B;  3PU3 A;  5A7Q A;  4Y33 A;  4GJY A;  5FP9 A;  3U4S A;  5F37 A;  4UF0 B;  5F3G A;  5IVE A;  5FZD A;  3U78 A;  4V2W A;  4CCK A;  4QU1 A;  4D6Q A;  5F5A A;  2OT7 A;  5A3W A;  5LWB A;  4HON A;  5FY5 A;  5CEH A;  4CCM A;  5FYU A;  3AL6 A;  4Y3O A;  4HOO A;  3N9M A;  4BU2 A;  5FYI A;  5FUP A;  5FY1 A;  5FZO B;  3K3N A;  5FPB A;  5FZ9 A;  2WWJ A;  3ZLI A;  4D6S A;  5FP3 A;  4AI9 A;  1VRB A;  5FZ4 A;  4CCJ A;  2WWU A;  4GAZ A;  4EZ4 A;  3OPW A;  5ANQ A;  5FZ3 A;  5FY0 A;  5IVF A;  2OQ6 A;  5A7O A;  3RVH A;  4CCO A;  5IWF A;  4QX8 A;  4LIT A;  4QWN A;  5F3C A;  4LIV A;  2Q8D A;  4DO0 A;  4QXB A;  5A7W A;  5FP7 A;  5FP8 A;  2Q8C A;  2YBS A;  2Q8E A;  5F39 A;  3KV6 A;  5FZ0 A;  4Y4R A;  5FXX A;  4LXL A;  3PU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...