5BNOA

Crystal structure of human enterovirus d68 in complex with 6'sln
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
296
structure length
286
Chain Sequence
VESIIKTATDTVKSEINAELGVVPSLNAVETGATSNTEPEEAIQTRTVINQHGVSETLVENFLGRAALVSKKSFEYKNHASTHKNFFKWTINTKSFVQLRRKLELFTYLRFDAEITILTTVAVNYMGLPDLTLQAMFVPTGALTPKEQDSFHWQSGSNASVFFKISDPPARMTIPFMCINSAYSVFYDGFAGFEKNGLYGINPADTIGNLCVRIVNEHQPVGFTVTVRVYMKPKHIKAWAPRPPRTMPYMSIANANYKGRDTAPNTLNAIIGNRASVTTMPHNIVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sialic acid-dependent cell entry of human enterovirus D68.
pubmed doi rcsb
molecule tags Virus
molecule keywords Capsid protein VP1
total genus 50
structure length 286
sequence length 296
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5bnoA00
1VBD3 3JB8A 1PO23 4RQPC 1ASJ2 2R061 4JGZC 3VBHB 4CDXB 1PVC3 2BPA2 1COV3 1COV1 3VBHA 4CEWB 1EAH3 4NWWA 4GMP1 2R041 1F2NA 5J98B 4Q4W1 4CDQC 4PDWC 1TME1 4EJRA 1FPN3 2ZZQA 1FPN2 1FOD3 4Q4W2 4GMP3 4N43A 2GSYA 1AL0G 1ND3A 1PGW1 1POV1 2HWC3 2PLV2 5C4WB 4Y5Z0 1RHI2 1RUI2 2R071 1TME3 1RMU2 1VAKA 4QPGA 2HWE1 1X33A 1E57A 1BEV2 1C8M3 1CJDA 2IZWA 2R062 1VBB3 4Q4V3 1IHMA 2X5IB 3VBSA 1MQTA 4Q4V2 4Q4Y3 1RUJ1 1FMD1 1RUJ3 1VRH2 1PVC1 2WFF3 4CDXC 1MQTB 5ACA1 3J8F2 4RS5B 5ABJB 5BNNA 4FTEA 1B35C 2WLPA 2HWE3 4GMP0 3NAPB 1PO22 1PGL2 2WS92 1R081 1RUC2 4Q4X3 1K5MC 4FTBA 4JGZA 4WM8C 1AYM2 5L7OA 5AC91 1ASJ1 1H8TC 4Q4Y1 4CDXA 1PIV1 4JGZB 3VBHC 1ZBE3 1HX6A 4CDUB 5K0UC 4RS5A 5ABJA 1OOPC 5BNNB 4PDWA 3J8F3 5K0UA 1HRV3 1RUE3 1PO21 4YVWB 4CDWC 1AR72 1OOPB 1EV12 3TN92 5K0UB 1ND3C 1FPN1 4N43B 1H8TA 1AL22 2WS93 3ZXAC 2MEV3 2RS52 4QPGC 1NCQB 1F8VA 1V9U1 2HWF3 4IV1C 1NCQC 4QPGB 3JD72 1H8TB 2HWF2 1VBE1 3DPRC 5BNOA 1RUJ2 1VRH3 1QJX1 1NCQA 1QJU1 1WCDJ 2HWD2 1VBC2 4N43C 1NCRC 2XBO2 1MEC2 4YVWC 4CDWB 2RS12 5CFCC 4FSJA 4CDUC 1AR62 1BBT3 1RUD3 1VB4A 1D4M2 2PLV3 4N53A 5FMOL 3CJIC 1RMU3 1M06G 1RMU1 1V9U2 1EV11 4N53B 1HRI3 3TN91 1QQP2 1R083 5JZGC 2PLV1 1K5MB 1R091 1AR92 2RS51 5L7OB 1AR93 1AYN2 1OHFA 1AYN3 5CFDA 2FZ2A 2ZTNA 1HQNA 3IDEA 1ASJ3 1ND2C 4BCUA 1AR82 3M8LA 2RS13 4PDWB 1COV2 1CD3G 3ZFGC 1RUH2 4CEYC 1MQTC 5C8CA 1ZBA1 1R092 1Z7S2 2RR13 5C8CC 5C8CB 1AR91 3LOBA 1B35A 1PO11 1R082 5BNOB 5ACA2 1ND2A 4RFT0 2HWC2 1VB2A 1VBA1 4Q4W3 1ZBE1 4Q4V1 1RUG3 2HWB1 5DDJ2 2BFUL 4RHV2 3ZFEC 4WM8A 5L7OC 4IV1A 4CDUA 1W39A 4CDQB 1BEV1 5D8AA 3VBUA 2R072 1VRH1 1OPOA 4N53C 1RUI1 3ZFFC 1HXS2 5D8AC 4CDQA 1AL21 1PIV3 1PGW2 1R093 1OOPA 2MEV1 5DDJ1 1VBA3 2WWSA 1DDLA 1RHI1 3JBG2 4SBVA 2HWE2 5CFCA 1NY72 2Y26A 1ND2B 1NA1B 1POV3 2HWC1 1RVF3 1PO13 2R042 2RS31 1HRV1 1RUE1 5ACA3 5CFCB 1RUD1 2WZR2 4GB31 5J96B 1BMV1 3VBOB 5BNPA 1A6CA 1RUC3 1TME2 1VBB1 4RHV3 4JGYC 1RUI3 1D4M3 3VBUB 5JZGB 4CDWA 5A32B 1BEV3 4JGYA 2R063 4YVSC 4RR3A 4Q4Y2 1FOD1 2WS91 1QJY2 2RMU1 4RR3B 1RHI3 4AEDA 1QJY3 1RUF3 1K5MA 4GH4C 1RUF2 1PO12 2R043 4IV3C 3S6PA 3VBOA 1NA1C 1VBD2 1C8M2 3J8F1 2WFF1 2BBVA 2RMU3 3VBFC 3JD73 3VBRC 1NG0A 1NY71 5CFDB 1PVC2 4WM8B 3HAGA 5C9AA 4IV1B 3VBFA 4NWVA 1VBC1 4JGYB 5D8AB 1VBC3 1C8NA 4RHV1 1BMV2 2BUKA 4QPIB 2QQPA 4AEDC 3VBSC 2XBO1 3ZFEB 2BFUS 5GKAC 1RUG1 5A33A 1VBD1 1AYN1 2HWD1 2WZR3 1TMF2 1VBE3 1B35B 5A33B 2RS32 5BNOC 2RS33 5BNPC 3VDDA 1EV13 3TN93 1AL23 1ZBA2 1AYM3 5C9AB 2X5IC 3VDDC 5FMOS 2VQ0A 3ZFGA 4CEYA 1BBT1 5A32A 3ZFGB 5C4WC 3ZFEA 4LLFA 4YVSA 3JB4C 1AR83 5LK7B 4FTSA 1RUH3 2TBVA 4GB32 4RS5C 5ABJC 1QJU3 3DPRA 2RMU2 4AEDB 1TMF3 1VBE2 5AC92 1Z7S1 4Q4X2 1Z7S3 1NA1A 4Q4X1 3VDDB 2RR11 1EAH2 3JBG1 2RR12 1RUH1 3VBRA 1HRI2 1ZBA3 1HRI1 3FBMA 5BNPB 5C4WA 5C9AC 4CEYB 1AR81 5CFDC 1EAH1 1QQP3 3VBRB 1HXS1 3VBFB 3CJIB 2RS11 5FOJB 2RM22 4RQPB 1FOD2 4GH4A 2RM23 5JZGA 1MEC3 1AUYA 4IV3A 1BBT2 1D4M1 2HWB3 1QJX3 1AR63 2HWB2 3VBSB 1AR61 1NCRA 1SMVA 1QJX2 1RUD2 1AR73 2ZAHA 1HRV2 1RUE2 1V9U3 1MEC1 2HWF1 4GB33 4CEWA 1VBB2 4QPIC 1RVF1 1R1A2 4WM7A 4CEWC 1TMF1 2WZR1 2DF7A 2MEV2 2RS53 2FZ1A 4WM7C 1PGL1 1R1A1 3JBG3 1ND3B 4GH4B 3VBOC 1RVF2 2HWD3 4IV3B 1RB8G 2XBO3 4RR3C 1NCRB 1QJU2 5BNNC 1RUG2 4QPIA 4YVSB 5AC93 3JD71 2X5IA 3DPRB 1C8M1 4WM7B 1GFF2 1RUC1 2GH8A 2RM21 1RUF1 3ZFFB 1R1A3 1PIV2 1ZBE2 2R073 4YVWA 1HXS3 3VBUC 1VBA2 1QQP1 1AYM1 2XPJA 3ZFFA 2WFF2 3NAPA 1QJZA 4Z92B 1POV0 1QJY1 1X36A 3CJIA 3NAPC 1FMD3 4RQPA 1NOVA 4Y4YA 5DDJ3 1AR71 1FMD2
chains in the Genus database with same CATH superfamily
3T3YA 5FBJA 5FZAA 4AEMA 2JKBA 2WSUA 1W6PB 2DBIA 4DZGA 5KXBA 1W0NA 2R061 3GZTB 2YBPA 4CP1A 5A7QA 4NROA 1W3XA 1JYTA 3SEPA 3WOGA 1ZRDA 1W28A 3VBHA 4CEWB 4GWIA 2JIJA 3P6BA 4NWWA 4NUBA 4MXWB 3WDUA 2ZZJA 3U0ZA 2R041 1XNAA 4E2GA 1QU0A 2VMEA 4IGOA 4CDQC 1DZRA 3AJYA 4Q0UA 4QPYA 1R64A 4AVTA 3E6CC 3AZYA 5LA0A 3HEIA 3AZWA 3LA2A 3NJVA 5FP3A 4CVUA 1PZ9A 1KITA 3J4UH 3MLJA 5EPAA 5GLUA 3GZAA 2C9AA 4ORFA 4YM0A 4BZ4A 3CL1A 1AL0G 1P8JA 1AX1A 2PLV2 2WSVA 4RD7A 2Y0OA 2I74A 4L0PA 3URFA 2BVBA 3ZXKA 4HK8A 3TB0A 3ME2A 3BIWE 2A6XA 2V4AA 3AB0A 1A34A 1UYZA 2ILMA 3AMNA 4Y1XA 2XJPA 2IXJA 2KA3A 1VIWB 4NRPA 3H1MA 1MZ5A 3JQWA 4E27A 2VOVA 1VP6A 2C26A 3AVRA 1VBB3 2W92A 1H1MA 4Q4V3 1UO9A 3SQOA 2QFEA 3U75A 1XNKA 4Q4V2 1NLQA 1RUJ1 3IDCB 3FLTA 3O1TA 4DY5A 1ZZCA 4CXYA 2QNKA 1YIPA 4GIQA 4OHWA 2PHXA 4GWJA 1S2EA 3J8F2 5I0UA 2PELA 3NV2A 4JQTA 3RZKA 5BNNA 1Y4WA 4I30A 2VZUA 4XOGA 2HWE3 3HJRA 3IIIA 1NZCA 2O8QA 4GXLA 5AVAA 3RI9A 1HB2A 2FQPA 3DECA 3ETPA 1PO22 3HOBA 1R081 1RINA 2VQAA 3IWZA 3TBDA 1RUC2 1J83A 4YM1A 2JG9C 5JR7B 1ZRCA 1VAMA 1IPSA 4RN5A 1J3PA 5L7OA 5EJ3A 3RQ0A 4Y1YA 3DGTA 1H8TC 1XYNA 2C24A 4FXGB 1CGPA 1K45A 1MZEA 1PIV1 2FCVA 2DTYA 3UGFA 3P1IA 4AW7A 4JCKA 2RJLA 3ES1A 1ZBE3 5KHJA 2FDGA 5H9PA 4DRVA 3ZOIA 4RS5A 2EALA 3AXEA 1KDMA 4LQRA 1CAUB 4NIAA 1YQ2A 4XJAA 2E6VA 2P3KA 1HRV3 1RUE3 4FP3A 1F15A 4G9SB 1E5IA 5LA2A 2RV9A 3ZXDA 1DYPA 1SHWB 3WDXA 1G9BA 3GBWA 1MPXA 2J1EA 3ZPOA 3O1SA 1ND3C 1FPN1 1QH6A 2J42A 1H8TA 5L9VA 3QH6A 1HKDA 3WXPA 2JWPA 5FZ8A 2OW4A 1JU3A 2B9VA 1SLLA 2QDRA 4QPGC 1NCQB 2LW8A 4IV1C 1W6QA 3JD72 1H8TB 4QKBA 3JZVA 5BNOA 5IWFA 1Q5OA 3WDVA 4CA9A 3EO6A 4Z82A 1QJX1 4CU8A 5GLTA 3ZXJA 1MS9A 4NVPA 3PTRB 2FDHA 1OMIA 1WMEA 2JE8A 3B02A 3V56A 4COVA 1HB4A 5C3SA 1NCRC 2ID4A 2R16A 5FYBA 1PM7A 4HT1T 1CR7A 2BOIA 2EIEA 1G9DA 4NRMA 5F39A 1MEC2 1WD3A 2Z5WA 2RJKA 5FZ0A 1LU1A 3IMMA 1G9CA 5IVJA 1RUNA 2NM1A 1CIYA 5LATA 2VZRA 2A3WA 4S2GA 2VTFA 3TOJA 1EYBA 1RTVA 1RUD3 4IERA 4QM9A 1JZ7A 4EWEA 2PLV3 4FOQA 1FT9A 4EV0A 1G86A 3V0AB 4FPLA 3DYPA 3M7AA 3MLLA 4PBOA 3K77A 3H7JA 1QKQA 2PAMA 5C3QA 3ZYJB 1EV11 1AHSA 1OVSA 1QQP2 4XIKA 2UU8A 3V0AA 1GZWB 3LEMA 2PLV1 5FPVA 1K5MB 3U11A 3M2MA 1R091 3EB7A 3RVHA 1LHNA 1GP6A 2RS51 1DGWA 3OD4A 4NHXA 4RGKA 1LNSA 5DMYA 2BOJA 5LB6A 4JDNA 1FV2A 4I09A 2ZGTA 4UW3A 2UYBA 3L2HA 1CZSA 2JDZA 3LWCA 4ES8A 3SC7X 2FZ2A 1KD7A 1HQNA 3THPA 1US3A 1LECA 3UT0A 4E4ZA 3WF4A 1ND2C 4AI1A 3M8LA 2QQKA 4XFAA 4CUBA 3P3NA 1KQRA 5B4XA 1CD3G 2WNVB 4DNYA 3HNMA 2DURA 3MBWA 3HVDA 1RC6A 3OB8A 4IEQA 4OHVA 1ZBA1 3JCIA 3Q9OA 5J36A 4K1YA 1IGOA 4OI4A 3TAYA 2G4IA 2NYYA 5L73A 4CCLA 2WNVA 2OPWA 2RR13 3N35A 4V2WA 4EZ4A 2W95A 2KD7A 5AFBA 4AFBA 4Y5SA 3DKQA 2WNVC 2BNNA 1UZVA 3LOBA 5J48A 1W8HA 4QHZA 5JPMB 4AR2A 1PGSA 1PNGA 4JDMA 4NHKA 4EN8B 3ACHA 2C9KA 5FK7A 3RZJA 1ND2A 2GMMA 1H8VA 4FPFA 3PUSA 4DEQA 5A3PA 3TWIA 1VB2A 4KMQA 1HW5A 3RPQA 3PVOA 4Q4W3 4W6XA 4XJ9A 5FZBA 3DYOA 1YI7A 1S2BA 1ZBE1 4D6QA 3R4UA 2BWAA 4HN1A 3O1RA 4RHV2 4Z2WA 4JQRA 2A75A 4M01A 1WBFA 2XJQA 5DAWA 5JXIA 4MGYE 4CDUA 2BDRA 1W39A 3D5OA 4CDQB 5D8AA 3MIDA 4V1PA 3H8RA 4OYUA 4P9IA 1X8EA 2YFZA 2NP0A 1TEIA 4N53C 2WT1A 1RUI1 1W8OA 3ZFFC 5D8AC 2IFWA 1AL21 1PIV3 2OXBA 4NPMA 1LOBA 1W9TA 1RJ8A 1OOPA 4ARXA 2DCJA 2YGMA 2QQLA 1GOHA 2WWSA 3N9LA 4H14A 4SBVA 2HKXA 2X09A 1YO8A 3WDWA 1GZWA 2EIGA 2HWE2 4EN6B 5CFCA 1NY72 4BQYA 3BI3A 4N90A 1W6NA 3AP7A 3OOXA 2WBKA 3MUZ1 5CFCB 1HJFA 5T52A 1O4YA 1CZTA 1LESA 3ENRA 4YW4A 1BMV1 5C3RA 3VBOB 5BNPA 4J25A 2ES3A 4QAWA 4LBQA 4ZU4A 5A80A 3O1VA 4PF1A 3AJZA 4AGGA 5A3NA 1TME2 1VBB1 1W9YA 4L92A 3NNLA 2OX0A 3OPZA 3I59B 3BTXA 1K42A 1H2LA 1ENXA 4A6SA 5A32B 5CAZA 1BEV3 2XJRA 2YPDA 4XPVA 4FFFA 4OLLA 1H1AA 2EXHA 2BERA 1J58A 1YHFA 1YWKA 2AACA 4YW6A 1ULFA 3NSTA 4G4FA 4IUGA 4RR3A 4TN7A 5F3CA 2CU5A 3Q8FA 3O0XA 1RXGA 5F8PA 1UY3A 2ARBA 2QZ3A 2WS91 2ZX1A 4H7LA 4RR3B 4XCBA 3W5MA 1RHI3 4LULA 1YRZA 1RUF3 2CSGA 2JICA 3RJ2X 1RUF2 3OG2A 1VR3A 2R043 1W0PA 2VZ1A 4I0BA 4IEOA 4JHTA 5F6KA 5LA9A 5IFTA 2C0ZA 1LOEA 1ONAA 2R30A 3RSJA 5FJKA 4XJZA 1L7QA 1J59A 1NXD1 3PTYA 3LAGA 4X6QB 1ENQA 2J1UA 3JD73 4AEKA 1Y3TA 3L9JT 1JH5A 2ETEA 5DZGA 1WD4A 5D8AB 3BUCA 2DCKA 2VO5A 2W1UA 3MW4A 4DRRA 2D3SA 2ZABA 3A21A 1BMV2 2CV6A 1HIXA 2XGXA 4DO0A 3AMHA 2NLRA 3GXUA 5DUVA 4IW3A 3WD5A 1QOTA 3NNGA 4KGGA 5IHRA 2WNOA 2FHRA 1YJLA 1NLRA 2JE9A 2XBO1 1KGYA 3H9AA 3OGSA 3MUY1 5D21A 5IUQA 2B42B 4BQ5A 4NE9A 3MPPG 2BYVE 2XJVA 2NPIA 1AYN1 4XUQA 3QCWA 2WZR3 1IQDC 3C7FA 3R0RA 1UMHA 3O1MA 1APNA 4CTEA 4MG2A 2WT0A 3GCXA 3WG4A 5JIAA 1C4RA 2VZQA 4XF3A 3GALA 3W20A 1S0GA 5KC5A 5BY5A 5EZWA 1YFUA 5FAXA 3B7MA 4PLNA 1N1YA 2D98A 1UKGA 3I3DA 4B7EA 4FPGA 3RZHA 1UPSA 4PHZA 5C9AB 4FP2A 4YRDA 5IAVA 4HPKB 1CAVA 4HBNA 2W94A 3ZYFA 1WA4A 3IPVA 3SKVA 3VGIA 4LBJA 5FYYA 3C2UA 2Z2SB 5A32A 4HPKA 4GJYA 2ERFA 2AEZA 4P9YA 4QX0A 4LBMA 2BGCA 4DPNA 2BRTA 3NNJA 2JB4A 5F5CA 3WEZA 2ZX0A 3OF1A 4NO4A 3MFAA 1IKQA 1AXYA 4LLFA 4XE9A 5FZMA 5E88A 4FBFA 3VUOA 5LK7B 3HBKA 5JXJA 1ZM1A 3H3LA 4OHZA 3WV6A 3ON7A 3ZLIA 2XUMA 1OF4A 4W6YA 4HG6B 1W6MA 3SEEA 3NQHA 1CJPA 1QDCA 2W0XA 2B9UA 3GHMA 4I01A 5JOZA 3BTYA 3RG0A 3DPRA 4F83A 4BISA 1S0JA 1VMHA 2RMU2 3VZKA 2DUPA 4AEDB 5AC92 1AJOA 2OVUA 2D6NA 3H0OA 4UFLA 5I0SA 1RUOA 3L2YA 4IGQA 3NV1A 3AYDA 1WCQA 4KBBA 1Q8QA 1QIQA 1UOBA 2NMNA 2VUDA 2XLGA 5CU1A 4COWA 4YFZA 3VBRA 4Q0VA 2Y6KA 1W2UA 4LO4B 5IW0A 5K4LA 4AQTA 3VL8A 4IEZA 5C9AC 3T2OA 3I3BA 2DVGA 4PI0A 2PQQA 1JI6A 3VBRB 1O59A 3VBFB 4MGQA 3LEKA 1UCXA 1N1SA 5FOJB 1CAWA 1ODNA 2RM22 3UJQA 4RQPB 4GH4A 4LITA 3AKRA 4XILA 2RM23 3SMHA 1ZRFA 4PBPA 4FQZA 1MEC3 1AUYA 5HXVA 5JOXA 4TZDA 3WNKA 1CAWB 2WJSA 3ILRA 4ARYA 5CISA 2BGOA 1JTZX 1SMVA 1I6XA 1RUD2 3ETQA 3K4AA 1PMJX 4QQPA 2JD9A 4WVWA 5JOWA 1JODA 2O14A 1V9U3 4GB33 1WA6X 1AJKA 5FDBA 3W59A 1EPWA 3B94A 3LPGA 4D7TA 1RVF1 4XTPA 4MSVA 2ARAA 4TWTA 4LE4A 1LENA 2VVEA 4B8EA 4MHRA 1O3TA 3USUA 3BB6A 4AFDA 5BPXA 4WVMB 2WZR1 3VD3A 2PTMA 5DG1A 1UXZA 4N7UA 3JBG3 4KBZA 4KWKA 3PIGA 4XZPA 4NAMA 1LOAA 1ND3B 3FC0A 4QGMA 3VKOA 1X9TA 3NRUA 3WF3A 1CX1A 1S4CA 1WCKA 1DQ1A 4LO6B 4WZCA 3H7YA 4IXLA 1J1TA 5FZ9A 2ZGSA 1UMZA 1WLDA 4B29A 2XBO3 1C57A 4RR3C 1RUG2 4OMCA 4YVSB 3WY6A 2ZGNA 2ARCA 2DFBA 4RYDA 4FCAA 3AP6A 4JV4A 2Y6JA 5FY7A 1GZCA 2Y6HA 3JD71 5FPLA 4CUGA 2KXLA 3BIEA 3THDA 4UW4A 2NMOA 4XMIA 2HYKA 1YYNA 3K46A 4XF9A 4KG0A 3DPRB 3GYDA 4MUVA 4NRQA 4WM7B 3THTA 4C0HA 1GFF2 2GH8A 2VL4A 1RUF1 2BW8A 3LGRA 3PIJA 2YY1A 1KRIA 2R073 5L19A 1IOAA 2VXRA 1QQP1 4IQPA 2YROA 3F2ZA 5CB7A 2QJVA 4K8RB 4DMIA 1JYCA 1JOJA 2WFF2 2XKPA 2WRAA 4M3CE 4PIZA 2ZCWA 4AOCA 5FZKA 4RGGA 3KB5A 5D1IA 4OCTA 2B7YA 1X36A 2RDQA 1SLIA 4XTMA 4LLOA 1UZZA 2JDMA 4H3WA 1QMJA 1W05A 1OQ1A 1AR71 5L9RA 3KCCA 3OYWB 4UF0B 2JE7A 1VBD3 1QOOA 3T0AA 4BQ2A 4E2SA 1OD5A 4IETA 4I3GA 2YXSA 3RMXA 3ZR6A 2R49A 2G19A 1W9SA 4K3UA 4R8HA 3ZSLA 1O5UA 1PVC3 1GUIA 1ULCA 1W9WA 2HYXA 3RGBA 2BPA2 1SZBA 1COV1 1XB9A 2UWBA 2ZACA 1JN2P 4BMEA 5A3LA 3PJYA 1QNWA 4NAOA 1BKZA 1O4TA 1ULGA 4GD4A 4IESA 5FYIA 1BVVA 1KFXL 2D93A 1OA3A 2J22A 4ZXKA 1F2NA 3M4FA 2ZS6B 2EXKA 4K7JA 1W90A 4LT5A 4E4SA 3PVBB 4GJZA 2EICA 2P6CA 4EJRA 4K1ZA 1YI9A 1FPN3 2QQIA 3G7DA 1FPN2 5FR3A 3RZMA 4Q4W2 4GMP3 1N1VA 5IVEA 1VJ2A 3UKNA 4UXAA 4CSWA 5JIUA 1PX3A 4Y5Z0 4INDA 1SFPA 2WA3A 4XABA 5FYCA 1RUI2 2G1MA 5LRRA 3PL0A 4L8QA 1TME3 4QDSA 4FQ4A 1FV3A 1DQ0A 1UY2A 2ZGPA 2D6PA 4AVBA 1X33A 3I8TA 4YGEA 5FFOC 3DL3A 3WHTA 5I8SA 3I3EA 1C8M3 1DG6A 3HT2A 3S57A 3AL6A 5FZIA 1W2TA 3LCPA 3AYEA 4P02B 3ZYPA 1IHMA 2X5IB 4O9EA 1MQTA 2FDJA 1DLLA 4COZA 2UYAA 1UMIA 1VRH2 2W46A 2CY6A 1FX5A 4FPEA 2LRPA 4QXBA 2DVAA 3KS7A 1UU5A 4FO9A 2CTVA 3RYPA 3UK9A 2IXHA 1F31A 1CZVA 2ATFA 2P4EA 1B35C 1UN1A 3OEBA 2WLPA 2W47A 1C1FA 5GZFA 1JUIA 2YYOA 4QD2A 2VNGA 2BQPA 2VNVA 2X8KA 2VMCA 3IDBB 2UWCA 1RGSA 3WSOA 1AX0A 2ADEA 2P1BA 3OBRA 3RYKA 4D6SA 2AC1A 4C90A 5FXVA 3J7NA 5IK7A 1K5MC 4C1WA 5A1AA 2DCTA 3PMEA 2W1WA 1UOJA 4M4PA 4S2DA 4WM8C 1ZZBA 5AC91 1BJQA 1LHUA 3WW4A 4CU9A 1FNYA 3ZN4A 4EWAA 2DV9A 3MEPA 1DQ5A 4OUSA 3PVEA 1IS3A 1UWWA 4JGZB 3SCGA 3VBHC 2DCYA 2A73B 1R1ZA 3K2OA 1LEDA 5A1LA 3WUDA 2VZOA 4AGRA 1HX6A 5K0UC 4AQ2A 5ABJA 3WG3A 4LTAA 3I4IA 4A41A 2CWSA 1PMHX 4NN0A 3AMMA 1G7YA 2J1TA 4YW2A 5K0UA 4PJYA 1GQHA 3BCWA 1EUTA 4W4ZA 3CZJA 4BQ1A 2BTVC 1JZ4A 5I91A 1AR72 2TEPA 4PQ9A 1OOPB 3D8CA 1W6OB 2Z4FA 4LO5B 1EV12 2HLEA 4XQ4A 4AWDA 2A3YA 4IEVA 4MGTA 4QQLA 5EJZB 4XFCA 3FFZA 4NHYA 1S0BA 4M3CB 4BU2A 2H6BA 3INAA 1OVPA 3MIBA 1ZYBA 2A1XA 2EIBA 3ZIWA 3LQCA 2HWF3 2WAOA 4YZ1A 4QWNA 4CZSA 2CNAA 2ZHLA 4QPGB 2HWF2 1SFNA 3T2PA 3WNOA 5JAXA 4A44A 4N7IA 3WNNA 3K4DA 1OA2A 2XVKA 5FZ4A 5FXWA 4C0BA 1QJU1 4LOTA 3KVAA 4BM8A 4QB6A 4PI2A 1M4WA 1VBC2 1ZRRA 1YJKA 3J26N 1ZZ7A 4BPZA 1O6UA 1KFUL 4EWDA 2XBO2 2Y6FA 3ABZA 4IGPA 3T1MA 4HXCA 5C71A 3V0BB 3C7OA 3CQOA 2V4VA 4FSJA 4MADA 1AR62 2VECA 1XC6A 3EYPA 3V0BA 2A6VA 3PMSA 3VKMA 1TG7A 2HEWF 3I2OA 3BU0A 4JVAA 5HCAA 1OFSA 2IXLA 3LSDA 4AK3A 1MACA 4LHKA 2VBPA 1M06G 3W58A 1OI6A 5JLVA 5SV5A 1SG3A 4IEYA 2PHDA 5JXHA 3OBAA 2QQUA 1QY4A 2GNDA 5CG9A 2B4KA 1XNBA 1GMMA 5FY1A 5SV8A 5IVFA 2W1SA 1OHFA 1YNAA 1ST8A 3EMRA 2BNOA 4E4DX 4B4RA 4GA9A 5I8YA 4META 5FKBA 1TVGA 5FPUA 2RE9A 2ZTNA 5A7OA 4SLIA 1Q8OA 5EJ1B 3IDEA 1GQPA 2D6LX 5E8AA 5F5QA 4FXKB 4I0AA 1XE7A 2YMZA 1OURA 3DXTA 4PDWB 3AKSA 2LM3A 3ZFGC 1RUH2 5DAPA 4CEYC 4WVZA 4BMBA 4Z2AA 3O5SA 2D43A 1H4HA 1REFA 2Q30A 5FZDA 1GR3A 1S1AA 3QACA 5FZ7A 2XQRA 3R4SA 5B4NA 1BK1A 1UPIA 3UGHA 3BTZA 4JTNA 4LKSA 1AR91 1NAEA 1PO11 3CIHA 4HN0A 4ZS2A 1R082 5H9QA 3SNMA 3WF2A 3IBMA 2VH9A 2XLFA 1KXGA 4L2NA 2P2KA 1US2A 3ES4A 4S2HA 2WDBA 3WINE 1F5FA 1VBA1 2R6QA 3HIFA 2Y6LA 4Q26A 3ZKYA 4Q4V1 3OY8B 1RUG3 2A6YA 2HWB1 5E16A 1DCSA 3ZFEC 3IPVB 4CCKA 5L7OC 3O1OA 2FD8A 2BGPA 4IV1A 1WMXA 1XJAA 1DGRN 2GNMA 2A6ZA 1I5ZA 4MVTA 3VBUA 3UGGA 1QDOA 2JDNA 3AYCA 5DDJ3 4AVSA 1FXZA 1VRH1 2Z42A 1HXS2 1HQLA 1LOFA 2BU9A 4COUA 1HDKA 5CKNA 2MEV1 4IEUA 1MS0A 5FYSA 5KXDA 3TEYA 3TEXA 4EZHA 5J1XA 3JBG2 1YEWA 5T50A 1RIRA 4ZKTB 1OQEA 4OHYA 5CZKA 4U2AA 1ND2B 2Y26A 2VGDA 1LULA 3JQXA 2GC0A 5DABA 2R042 2YC4A 2D5FA 2ZX3A 1PK6C 4P08A 2ZHNA 1CPMA 3LE0A 3M3CA 4LK7A 4W6WA 5DUXA 5ACA3 3ILNA 4A45A 5FOBB 4LNVA 1KS5A 5GLVA 5LBBA 4LOSA 5J96B 4C1XA 1PK6A 4XQDA 5KXEA 4QX1A 4XFFA 2AREA 2D6KA 2W68A 3H3UA 2CGOA 1UXXX 1ACCA 5T5PA 4DQAA 5EIYB 1IG3A 1U5IA 1XE0A 2XL9A 2A7AA 4JGYC 1FAYA 4Y1VA 3FL7A 1ZVFA 4QPWA 2P17A 1V00A 1QWRA 4O65A 2QZ2A 2QQNA 1SBFA 4JGYA 4KU7A 1JOBA 2PMWB 1SDWA 1N3OA 3WCRA 5F37A 3W5NA 1JHNA 3WCSA 1BQPA 2R063 3TEZA 3ZYHA 2D5HA 4TLGA 1W8UA 4L11A 2BVVA 4TSVA 4YVSC 4WZFA 4Q4Y2 3UESA 5F1RA 5TSWA 1FOD1 4CU6A 5KC6A 5KHGA 4ZONA 1NXMA 4XFHA 3T4VA 5FYMA 5LASA 4AVCA 4K40A 4HKLA 5A3MA 5FPXA 5F3GA 4IV3C 3ZDVA 3MICA 3VBOA 1NA1C 2PHFA 3WG1A 2JG8A 1VBD2 2TNFA 1O8PA 2IXCA 1HLCA 2HEVF 3KV4A 4QKNA 1ZA4A 2WFF1 4XJUA 4XIOA 2D6MA 3FBYA 4YW3A 1JS9A 1SCRA 3LDBA 5C3PA 1PVC2 4UW5A 3ZSKA 4HKOA 3HAGA 2PAEA 2VOTA 3RDIA 2PXJA 4OUMA 4IV1B 4YGDA 3ZN6B 3H8XA 4UOJA 1VBC3 3GJBA 3V64A 1W3VA 4XACA 5J7MA 1OT5A 4CE8A 4LEJA 1PZ8A 3D0SA 4QX5A 3JUUA 2IWGB 3LZZA 2QQPA 3HBZA 4XAAA 2VOXA 5FMCA 2A71A 3WNLA 1I5PA 3VL9A 2BFUS 1MS4A 4BWOA 1RUG1 2Y0IA 5A33A 5JSOA 1YUDA 4K8FA 1UL9A 1W6MB 4QT6A 3CNAA 1B35B 1N1TA 1XNDA 1W8TA 2IC1A 3GM8A 3J7MA 1DLCA 2CWMA 1YFXA 3POBA 4RL7A 1YC61 2WO1A 5BNPC 4H2AA 3TN93 1AL23 1NKGA 2E9QA 3AP9A 3M3OA 4PIYA 4XHXA 4YZ4A 2CHHA 2X5IC 2W9XA 5LZ6A 2VQ0A 3ZFGA 1XXNA 3RWNA 1CVNA 4CEYA 3KHCA 1LAJA 2VNRA 3OYWA 5DAQA 1BBT1 2VMFA 1J84A 2JX9A 3MIGA 4WBBA 3DYMA 5C4WC 3LEIA 3PVNA 4LBKA 4OVEA 4IE6A 4I3PA 1D4VB 1UW8A 2DUOA 3KT1A 3OGGA 4FTSA 1SPPB 1V6JA 1IPJA 2VOWA 1LGCA 2ADDA 3MW2A 1RUH3 2VULA 4GB32 1UU6A 4RS5C 4DUVA 2WN3A 4XBNA 1S2KA 1Q43A 1Y9QA 3OCPA 3DV8A 4Q29A 2VJXA 4J1XA 3NKGA 3OUIA 1TMF3 1VBE2 4LBOA 4QX8A 2Y64A 1NQDA 5ANNA 4UW6A 4XF4A 4Q0SA 5I93A 1ULOA 4Y26A 4AVAA 1LCLA 3VLBB 1UZWA 2RR11 1KEXA 5GZEA 5JDBA 4A3XA 2P5BA 4LKEA 3SITA 1WCSA 2FMYA 5BXXA 2V73A 1ZBA3 1N47A 3PU8A 3WVJA 5C4WA 1AR81 3A4UA 3KCYA 5CFDC 4XVHA 1QHDA 2J1SA 4FPHA 4AFMA 1W04A 1W8WA 4E8CA 3S5AA 3A7QA 4N9HA 3LDRA 5HBAA 5FYHA 3T0BA 1BZWA 2B8MA 2GNBA 4MOAA 1NLSA 4YFWA 5FWJA 4YZ5A 2OQ6A 1D4M1 1TZOA 4YM3A 1AR63 2VZSA 3AFKA 5F3EA 5EXOA 1NCRA 1ULDA 5F5IA 1A8MA 1HV1A 1NQJA 2YC2A 1AR73 4JKKA 4NJ4A 5JCTA 2J1RA 3WT3A 1CWPA 1E5HA 2AYHA 4A42A 2ZAHA 4XETA 2CDPA 2HWF1 3E6BA 5CBLA 4CEWA 3OEAA 1XNTA 5FZGA 4P00B 4QPIC 4Y20A 5LBEA 5C8WA 1JZ5A 2JKXA 5IT6A 4D94A 4WM7A 4CEWC 1UF2C 1GU3A 5FPBA 1YQCA 3RFRA 2DF7A 2MEV2 2RS53 3WNMA 4WM7C 1GZ9A 1F9KA 1WKYA 2WO3A 5DXDA 5E1RA 3SLIA 4GQ7A 1PGL1 4MX3A 1GP4A 1MVEA 2EAAA 2WA4A 2DTWA 4JKMA 3HWJA 5GZDA 4XMAA 4CCOA 2WWUA 1ZZ8A 1AXKA 4GH4B 2VY0A 5FZOA 5DUWA 5G04L 4R9DA 4AHXA 2IXKA 1WLWA 2PYTA 2QDNA 1SEFA 4JRLA 4LHLA 2A6WA 2DVBA 5KHHA 2A5ZA 3AKPA 3N9PA 4BYYA 5IYYA 1EUUA 4QPIA 4BH9A 4FAHA 4IL7A 5FYUA 5AC93 1DP0A 4A6OA 3ZSMA 1V6OA 1VMFA 4LA2A 4DEVA 3GDBA 4XFBA 1MS5A 4GZ9A 2AUYA 1OSGA 1TNFA 2XG3A 4FOWA 4Q0QA 5DG2A 4DFSA 3TEWA 3ACLA 2FDFA 2BZDA 4Z8BA 2VXJA 4QHOA 2V5DA 5JI7A 1ULEA 5E89A 3W21A 4YVWA 1AXZA 4ONUA 3GCWA 3ZYIB 1AYM1 3ORJA 5CA6A 3EXUA 3PURA 1GV9A 3E1F1 4JAAA 4ZS3A 5F32A 3ZFFA 3WNPA 5EV7A 1J3RA 4DB5A 5G05L 1W8FA 2Q1ZB 4LKFA 1JZ6A 4Q5OA 3GBGA 1Q56A 4QX7A 2DVFA 5FPZA 2VCAA 4Y4YA 1OUXA 1H9PA 2SBAA 3VDAA 2G9FA 1DF0A 3JB8A 3ZYRA 4XHBA 3OTFA 4FFHA 2QTWB 4QGNA 3NKTA 4JGZC 2OT7A 2C1FA 4Y4RA 5FXZA 3VBHB 4LJHA 1H30A 5B2GB 1ZREA 5T5OA 1DU3D 1GKBA 2UY9A 4X8NA 2ZKNA 5IFPA 4LORA 4YW7A 1VRBA 1GYKA 3ILFA 3IZOA 1DIWA 1K12A 4GMP1 2QBXA 1LR5A 4JC1A 2I2SA 3MGUA 4LO8A 5J98B 4Q4W1 5ABJC 2YU2A 3N9NA 4LIUA 4PDWC 1TME1 1K3IA 2XJSA 4LUMA 5FP9A 2OIIA 4HOOA 3FWEA 4I2OA 3HMYA 4BDVB 2ZHKA 2NZ9A 5A6XA 4GULA 4N43A 2GSYA 1PVXA 1PGW1 2Z69A 1POV1 1MS1A 2IVJA 4OUEA 3ZYGA 5K7PA 4EN7B 5FZ6A 4O61A 1ZX5A 5EHDA 2PHRA 1RMU2 3KZ4C 3Q8EA 4FPJA 2HWE1 5FY5A 1PZ7A 4P14A 4Y22B 2YZ4A 1BEV2 4DXTA 1UOGA 1CJDA 3C7GA 2PN5A 4GKXA 4QX3A 4NR1A 4CP9B 3LF7A 1IPKA 4BQ3A 3VBSA 3I3QA 1D7PM 4Y33A 4D0QA 4D8MA 1UYXA 1YQ8A 4E2QA 4R9AA 1BXHA 1RUJ3 1PVC1 3NV3A 4COYA 3NJZA 3U4XA 1SBDA 1U12A 2EXIA 2WFF3 1QEXA 4O7XA 2ZMLA 4AVVA 5ABJB 3SXWA 5JMCA 3NJYA 1WW6A 1LOCA 4FTEA 2Y34A 1EY2A 4OZOA 3PUHA 4GMP0 1A78A 1U5YA 2YBKA 2OYZA 2JXAA 1PGL2 3E5XA 2JIGA 3KF3A 5A6YA 1U0AA 4A3ZA 3PUAA 2GMPA 2W52A 4Q4X3 1XYOA 5LWBA 3PHMA 2Y38A 1LGBA 3WQ1A 1O4ZA 1J3QA 4B4PA 1A8DA 5JSRA 2VZ3A 4K20A 4MGKE 1H6YA 1AYM2 4YLZA 4JKLA 4L97A 5FLJA 3AVSA 1ASJ1 4H55A 4Q4Y1 2ENRA 1UX7A 3KQ4B 3KQRA 4BK4A 4KNCA 2F4LA 5FZHA 4GWMA 3OY8A 4OZXA 4LIVA 4NPLA 4R52A 2ET1A 5EFUA 4OHXA 2D3PA 2F6BA 2QCSB 2EIDA 3BTAA 3VZMA 1VPHA 2B5HA 4MGSA 3U1XA 1RL3A 1YQ5A 2GN7A 3O0WA 2GZWA 4BLIA 4LMFA 3H42B 3LSEA 5C5UA 3M70A 2WNUC 1STMA 3ALQA 4AXOA 5JVVA 3I2IA 2JDPA 4A4AA 5DZFA 5I0RA 1BVP1 1W06A 1OA4A 3CLPA 3PLQA 2BV4A 5H9SA 4FFGA 3J7LA 5DQ0A 2OS2A 4N43B 4HVOA 4N8MA 3SH5A 1S55A 3APBA 1AL22 2WS93 2Y33A 2MEV3 2RS52 2AZ5A 1F35A 1V9U1 1NCQC 5A7SA 1WUVA 3DPRC 1VBE1 3MO4A 3ZXEA 2Q1FA 2TUNA 1VRH3 3AL5A 4ASMB 1OC1A 5FLIA 4B7KA 1X7NA 1XU1A 1NCQA 3W9AA 1WCDJ 2VAUA 1W6QB 2QUOA 2XL7A 3I2HA 4UT5A 1MR5A 5FZCA 4B3NA 1WMFA 2R32A 3KWVA 3OBTA 4DY3A 4XUOA 4BQ4A 5C33A 1HB3A 2VW0A 1LHWA 4YVWC 5T3NA 4CDWB 1S0EA 3PUQA 4E8DA 4RGAA 3O0VA 1WW7A 1W2OA 3I2DA 1BBT3 3KVBA 2I07B 1UY0A 4L9BA 4YNIA 4NHLA 1D4M2 2HJIA 1LOGA 2YU1A 4BJ0A 3I3MA 1RMU3 1RMU1 2MHFA 5H9RA 5F9TA 1WMDA 3TN91 4Q0PA 1R083 5JZGC 2JDHA 3P3PA 4FOYA 4EYUA 5A3OA 1V0AA 2WINB 1C28A 4YM2A 1AR92 1W6NB 2WLQA 1OQDA 3D0JA 1ZNPA 4QQ2A 1AR93 5L7OB 1V6MA 4IEWA 3B93A 5T5JA 3FN9A 2VUCA 1IZ3A 1QXRA 5IK8A 2OQ7A 3EHKA 3ZKUA 2VMHA 2K0GA 2IVIB 3K4ZA 3CO2A 4UBHA 2XKOA 3T1LA 3VKLA 3BOPA 4N9IA 3ZXLA 4BCUA 2BJSA 1WLCA 1EP0A 4LK6A 4M00A 2H0VA 2O0OA 2RS13 1QH7A 3BOWA 4HSLA 1SCSA 5FP7A 4AI0A 4P9LA 4YWAA 3S5QA 5EQUA 1MQTC 1KS4A 3B01A 1YLLA 1L7RA 2GDFA 3ZPYA 1GNZA 5C5TA 5JXGA 4QXHA 1HN0A 3LIHA 5F5AA 5LY2A 1YQ6A 4F8AA 1Z7S2 3WP5A 4AFAA 3VD5A 3TRSB 2QQOA 4ISQA 2CGNA 1VALA 1UD1A 1YFWA 1B35A 3WNXA 3HNBM 3ZDSA 4D69A 2DYCA 4BB3A 4DXRA 1VE0A 1I3HA 2WQ8A 1ULPA 5FPAA 4EQVA 1CQ9A 5BNOB 5GALA 2UWAA 4RA0A 1Y9MA 3CF6E 2VVFA 1QOSA 1REDA 1PMIA 2ZX2A 3FUOA 5ACA2 3A23A 3USSA 1MVQA 3CBNA 2EXJA 1V6LA 4JTOA 4AGVA 1VMJA 2XVLA 1WWYA 3T08A 3CEWA 2OPKA 3ZSEA 3B69A 4CU7A 4HETA 1UYPA 3UYJA 4ASKA 4WM8A 1XE8A 4BIOA 4TXWA 1JYIA 1NX9A 2WN2A 4YW5A 2Y8KA 3J7HA 2B45X 4AQ6A 4QKDA 4D7YA 4XDQA 2R072 3WW2A 2FDIA 1BK0A 2ZXQA 2YGLA 1FATA 4CDQA 1Z78A 4U36A 3POEA 4XCAA 3VZOA 2ZAAA 3LD8A 3NL1A 1GQGA 1R093 2WZEA 1W6OA 5DDJ1 2R7EB 4UAPA 4AZZA 1DDLA 1RHI1 5GM0A 2QQVA 3OSDA 2VCBA 1W8ZA 1RJ7A 5FO9B 4UFIA 4AHZA 3VZLA 3NV4A 2HWC1 4YGCA 3MW3A 2PHUA 2ZEZA 3T2TA 5AFEA 1N3QA 2ORXA 4CUAA 5J37A 3MI8A 4LBQB 1RUD1 3I7DA 4XZUG 3G6JB 2UURA 2JECA 4MGZE 3I2KA 1A6CA 1QGLA 4Q8LA 1JOPA 4CCDA 5IK4A 1GNHA 3D4KA 4KH9A 2FBEA 4PF5A 2DUQA 2VOKA 1CONA 1UY1A 3CMGA 1GNYA 3VBUB 1D4M3 5FO8B 2GC3A 5JZGB 4HFSA 3DN7A 1IQAA 4CCMA 5BYNA 1NUKA 2RVAA 1DHKB 1D0GA 4FPYA 3VHOA 4CP2A 3UL2A 4B4QA 4LBLA 4RFRB 4CCEA 4M4RA 3U78A 4CPBD 4D3WA 2VCCA 5L36A 3HNYM 5DAVA 1F4HA 2OUHA 4MV2A 4NHMA 1DBNA 3BPSA 4CXXA 3IMNA 1ENSA 1OXCA 3IIAA 1EPZA 2WNUB 3LB9A 2YFUA 3HQUA 3ZX7A 3QD6A 2JDYA 3FZ3A 3LA3A 3MDPA 5IVYA 4Y20B 2VMDA 4AL9A 2XHKA 1E5SA 1MZ6A 1F4AA 1QJY2 2MNGA 2RMU1 5CKQA 3B3QE 1QJY3 4AEDA 2XR4A 4KQ7A 4XF1A 4ASLA 1PO12 4ATEA 5T55A 1W99A 3ZXGA 5LW9A 1C8M2 5JOYA 3WQ0A 2B46X 5FTTC 2PHWA 2BBVA 4FVVA 3VBFC 2XHNA 5KWRA 5CFDB 3H50A 5FZOB 3RI8A 4WM8B 5A7WB 3WDYA 1DGRA 2W1QA 2VC9A 4QDRA 2E51A 4NWVA 3VBFA 4NIGA 2WC2A 4K6BA 4JGYB 5FY4A 4D6RA 2O1QA 4AI9A 1C8NA 3JU9A 4RHV1 2XQXA 2SLIA 5FIXA 4QPIB 1NE6A 3U4SA 2JG9B 4XAEA 2ARXA 4AEDC 5DUUA 4NIDA 4R4ZA 2XUEA 1GOFA 3HT1A 3PU3A 2I45A 2ZGKA 4XBQA 2JG9A 3IT8A 4CCCA 3U14A 4HMZA 2HWD1 2DVDA 2KR2A 5LK5A 2QQMA 1TMF2 1VBE3 3TNQA 4X8PA 1W8NA 4IEXA 5CG8A 4KG8A 1Y43B 2RS32 4BHPA 5BNOC 4HKWA 5ERLA 3MFCA 3H8OA 2RS33 3VHPA 2XONA 3Q8CA 1XOYA 1ZBA2 3KSCA 5LA1A 1DYKA 1AYM3 2P6HA 4BOWA 4R9CA 3IAPA 2GAUA 1UKRA 3MYXA 4W8JA 5FKCA 5FMOS 3ITQA 4HANA 4TLFA 2YV8A 3ACIA 2ZX4A 2X53S 1G9AA 5A3WA 4A7YA 5A6ZA 2P34A 4WVVA 4B1LA 2P3JA 2A3XA 4CPBA 4JX0A 4HVRA 1W2AX 2ZKLA 1SLBA 1XSRA 3ZFEA 4IEPA 4YVSA 4A7ZA 3NNFA 4E4HA 3KCXA 1JU4A 2J7MA 2W39A 1BCXA 2ZGRA 4MH0E 2Q8OA 4F7ZA 2DWRA 1U5XA 4PIXA 1WCUA 2V09A 3AK0A 1REEA 2VNOA 4LR4A 4MXWA 4HONA 1QJU3 4OI2A 4Q1PA 2XWJB 1CPNA 1KJRA 2QQJA 5IVVA 1JXNA 1Z7S1 4Q4X2 1Z7S3 2X29A 3LFMA 1NA1A 1UNBA 4Q4X1 3N7KA 1W03A 3IM0A 3VDDB 2OA2A 3PDQA 1EAH2 1GWKA 1JYXA 2VVDA 2QKDA 3BYWA 5F3IA 3Q8BA 3CKHA 1GOGA 3QH7A 5C3OA 1AF9A 1HRI2 2E7AA 5JSPA 2C5DA 4XUNA 5DAXA 3VZJA 2YPJA 2B39A 4AEJA 5IJRA 4CEYB 2K2SA 4QU1A 1QQP3 2VQUA 3AX4A 3CU7A 2RDSA 3LKJA 3CJIB 3VN4A 4ZZ8A 5CVRA 3AZXA 1V6NA 1DZTA 1FOD2 3O12A 4Y5TA 3ZVXA 3AM2A 4IV3A 4UF0A 5E6HA 3IKWA 5C7GA 2D97A 2PAKA 1URXA 3AC0A 3RNSA 4H7MA 2FCUA 1QJX3 3GNEA 3VBSB 1AR61 1QJX2 4QB2A 1H2MA 3AZVA 3CHXA 2NQYA 3QBQA 1FNZA 3R4DB 5JI9A 3SKJE 4YG0A 2D44A 4XJWA 3SCHA 5I8TA 3VHRA 3POSA 3POYA 1TMF1 2GH2A 4LHNA 3S0MA 4IE7A 1KJLA 3T0DA 2W08A 2GP5A 3O14A 2DBNA 5FQ0A 3BODA 1QJEA 1XSQA 1UU4A 4K9SA 2LROA 3S7IA 1JMUB 3E5UA 3BU7A 3VBOC 3GZUC 4IE5A 1RVF2 4LXLA 2JG8C 2HWD3 5IATA 3THCA 4NIIA 4C91A 4DXSA 4P9XA 3UJOA 4OI1A 2BNMA 4RSUA 1NCRB 5BNNC 2VBBA 2XWBB 2R1DA 4XYXA 4AFCA 4P9WA 2EAKA 4IDZA 1E5RA 4YZ2A 1FI2A 3ZXFA 4XXAA 2X5IA 5KHKA 1WZXA 3ZMOA 5A70A 2RDNA 1LU2A 4KL1A 1C8M1 2VU9A 2HEYF 5FO7B 2BWCA 1UQXA 1RUC1 2RM21 1YXWA 3KD4A 5J09A 1W2NA 1PNFA 1XQNA 1R1A3 1JW6A 2ZJCA 3KM5A 3I2FA 3VKNA 4YYOA 4GWNA 4OULA 3K3NA 3KF5A 4Q1RA 3VBUC 1VBA2 5FP4A 2D6OX 1T6GC 1H6XA 1AZDA 2VBDA 3NAPA 3AKQA 1O91A 4NIHA 5CYYA 5CKMA 1POV0 1QJY1 3BALA 2ZGQA 3FLRA 4FT8A 4AYUA 1UX6A 1G9FA 2KM2A 2ZBJA 3CJIA 3LA7A 3NAPC 1LRHA 4ZXEA 5I0DA 1GZTA 2IFRA 2D3RA 4RQPA 4P9GA 4DUWA 3N9MA 2LS6A 2DU0A 5FWEA 3K51A 1PO23 1TNRA 4RQPC 2V5YA 1ASJ2 3D82A 5LEJA 3RZLA 2VUJA 5DPNA 4CDXB 4Y22A 2CYFA 2WYFA 4UFHA 1LTEA 2DDUA 1COV3 3E5QA 2Q1MA 1X50A 2VMGA 3R6SA 3WLUA 3WF1A 3TYJA 5HXMA 5T54A 4JDOA 2WFPA 3WR0A 1EAH3 3AP5A 4XUPA 3RRDA 2ZEYA 3E97A 2JB8A 3PJQA 4G3YC 4X6RB 4DINB 4HK9A 1WLTA 4PT6A 2P3IA 4J1WA 1LOFC 3RWKX 3WP3A 2W3JA 5GLWA 4BXSV 3VD4A 3K75B 2BBAA 4YG6A 5GZCA 2GC1A 2Q8EA 3UETA 2ZZQA 1HQWA 5FJHA 3RMYA 3UV9A 4KI5M 4W50A 4BIFA 1UZ0A 3IB3A 3NW4A 1FOD3 4OMDA 4QHBA 4QKFA 5FQ0B 5T5LA 2XOMA 4F3JA 5FY8A 2VD7A 1ND3A 2AEYA 1TQ5A 2HWC3 3IAQA 5C4WB 4UI9L 5FY0A 4MGIE 2O8OA 5KXCA 1RHI2 3BN6A 2R071 1VAKA 4QPGA 4OQ9A 3X29B 1E57A 2NN8A 5EYXA 2E31A 5F7UA 5HPOA 4URTA 2IZWA 1YFYA 5FZEA 2VTXJ 4FI9A 2R062 5F2SA 4D7SA 1CX4A 3SH4A 1CIWA 1OLRA 4Q4Y3 3VKFC 4V2VA 1MS8A 1FMD1 1OH4A 4QB1A 1K5JA 4HLTA 3NMBA 4MO3M 4QGLA 3WZ1A 3SH3A 4CDXC 4XEZA 4E9KA 1MQTB 2LUWA 2Y60A 3T2QA 5ACA1 1JZ8A 4P9JA 4AHYA 4RS5B 1DZQA 1WGPA 2YB7A 2ZGMA 5LY1A 4TTGA 5IK5A 2ZHMA 1OKOA 3OPWA 4BLJA 3VV1A 4Y1ZA 3OGVA 3NAPB 1V70A 3D6EA 2RHPA 4CCNA 5A3TA 4ZY9A 2WS92 4MHUA 4AHWA 2C6SA 3N4MA 4MZUA 3WW3A 1IS6A 4J6GA 2ORZA 1DQ2A 1RITA 5IAXA 1SLCA 4YARA 2XB6C 3CDZB 3MF6A 3VDCA 4BE3A 4LE3A 4ZZ5A 4FTBA 3B00A 4JGZA 1GICA 4GALA 3KV9A 4UWDA 4CDXA 2AGSA 2WIIB 3S7EA 3FUQA 2VUAA 3HN3A 1JHJA 5K9YA 3S30A 1UOFA 1J1LA 3K3OA 1AX2A 1L7LA 3WG2A 3H1YA 1O3SA 4Q2FA 2ZOEB 1OPMA 2DU1A 1C1LA 1LODA 2E7QA 1XPWA 2GNTA 3HN1A 3LDKA 4OFGA 5FV3A 5A7NA 1MZFA 5APAA 4CDUB 1OOPC 4KU8A 1PM4A 5BNNB 3OGJA 3MIFA 3CZUA 3NWKA 3J8F3 4GKYA 1POQA 1XYPA 4PDWA 4Y3OA 4ZU7A 4FPKA 4L99A 4JHZA 3PUIA 3T4HB 4C8DA 2QVSB 2HBUA 4QM8A 1PO21 4YVWB 4LKDA 4CDWC 3OD0A 4B1MA 3QLQA 4ET7A 1H9WA 3TN92 5JMOA 3LOIA 5K0UB 1W0OA 5LCWL 3OBZA 5JWPA 2ZGUA 4AI2A 4BA6A 2XJTA 4I0WB 1OUSA 1GBGA 3MPBA 3POGA 5CIRA 1L3JA 5EYYA 3ZXAC 4HSJA 1JYVA 4CCJA 3KV5A 4MYEA 4CYDA 1F8VA 5LBFA 5GJ6A 1G6NA 5FRAA 5FYZA 1JBCA 1HN1A 1RUJ2 3WUCA 4Y1UA 3GHNA 2G9GA 3CJXA 4M0HA 4WV8A 3V65A 3WW1A 2ZMNA 3ZR5A 1OLQA 4QXCA 4AE2A 2HWD2 2R0FA 5JUVA 4ZHNA 2IUWA 4N43C 2ZPXA 3UKTA 1OKQA 1X82A 5IVBA 1H2NA 2JJ6A 2VZPA 2ZEXA 1DGWX 5GZGA 1CAUA 4XQWA 5M0TA 1I9RA 4R9BA 2RS12 4YW1A 5CFCC 4A7KA 2JD4A 3KGLA 5FUPA 4YPJA 4PLMA 2J1AA 4CDUC 1TE1B 4DIQA 3T30A 2WT2A 2DFCA 1VB4A 3B5LB 3WQ7A 5IVCA 2VW2A 1SFYA 4MLOA 4AAPA 4N53A 5FMOL 2V72A 3VD7A 4BXFA 3LPFA 3CJIC 3DF0A 3N7LA 3AMQA 1VLNA 1F5JA 3O7OA 1ZZ6A 1V9U2 2Y6GA 1OLME 4N53B 1HRI3 4IE0A 3BPZA 4JRAA 3VZNA 2X10A 1DYOA 4XUTA 4AF9A 2JDKA 2JDUA 4FAGA 4KWJA 2C4XA 3JXSA 1AYN2 3C7HA 2CGPA 2YG0A 1AYN3 5A7PA 2RG4A 3I49A 2CAVA 5CFDA 1PK6B 3HD8B 1RXFA 1HV0A 3POJA 4AI8A 2QE3A 1SLTA 5A1FA 1OF3A 2WUHA 1IG0A 1Q8PA 1ASJ3 3MLKA 2ZMKA 1AR82 5FUIA 1OH3A 1DQ4A 4FFIA 3BKZA 1COV2 1JYWA 1SDDB 1LEMA 1QJFA 1ZZ9A 5FXXA 1JZ2A 5C8CA 1D0HA 5CNAA 5ISLA 1R092 3DUIA 4QQOA 4UFMA 2H0BA 1T2XA 3H3ZA 5C8CC 2F4PA 2LTNA 3LEGA 2FCTA 3N7MA 5C8CB 5BUVA 5CEHA 1GWMA 1DGLA 3FJSA 1QXJA 5DN2A 2JENA 3ECQA 4XFGA 2JEMA 3IN9A 4XF0A 2XDVA 4P5HA 2E33A 4PCRA 3Q8AA 2OUJA 1LGNA 3GZEA 2VZTA 4RFT0 2HWC2 1H4GA 1LB2A 2EVXA 3RZZA 2D40A 4FOVA 1PX4A 2GU9A 1QF3A 5DDJ2 1S0FA 2BFUL 1NT0A 3ELNA 2VR4A 3C3VA 5FYTA 3RJRA 4FPOB 5J3UA 1LJ7A 3M3IA 2YC0A 1BEV1 1C3HA 1NE4A 2XXZA 3R05A 2QQWA 2VMIA 2YHJA 1ODMA 4LBQD 2W2IA 4NPRA 3I59A 1OD3A 3KV6A 5C70A 4OI0A 1OPOA 2E32A 3I97A 3ST7A 1UY4A 3FFQA 4XJ8A 4YG3A 5FZLA 2D7FA 5FK8A 3N36A 3I2JA 1PGW2 3SCFA 3VDBA 1X8MA 4S2FA 1NZIA 4Y24A 3ZIXA 1ZA7A 2VPVA 1VBA3 4W65A 3SHRA 5HV0A 3RYRA 2AH2A 2PA7A 2BEOA 4LHSA 5FP8A 4I02A 2R0HA 3DKWA 1A3KA 2WNUA 4QDQA 1POV3 1NA1B 1SBEA 3KMHA 3FLPA 2JDAA 2Q8DA 1CAXB 1RVF3 1PO13 2RS31 5FUNA 1HRV1 1RUE1 2N7GA 3NO8A 2BP6A 1XU2A 3FX3A 1GSLA 4ES9A 2WZR2 4GB31 2Q4SA 1OFNA 5F6LB 1JYNA 3FE5A 1YCIA 3ATGA 4LBNA 5EP9A 1RUC3 1S0IA 2E7TA 3MV01 2ZGLA 3ZO0B 1BLZA 2GN3A 4CUCA 4KWUA 4QU2A 4RHV3 4UYBA 3ZN5A 4EE2A 1RUI3 4PQQA 1UAIA 1XRUA 4A2UA 4ISRA 2WKKA 4CDWA 1GP5A 4DUXA 4K21A 5EWSA 1IS4A 1H2KA 1H1IA 3MV11 2W5FA 3VB9A 2EF6A 2OZJA 1Y7BA 4AQSA 3GGLA 3GF6A 3AZZA 4O9GA 2WO7A 3BVCA 3EBRA 3FHAA 3RZGA 3N9QA 1SLAA 1YIFA 2ZA9A 2E63A 2WYSA 5HCFA 3DCQA 4XC9A 5FLHA 5LBCA 2JG8B 2VZVA 2AENA 5L9BA 4IE4A 4HL0A 2WO2A 1K5MA 4LUKA 3USUB 4GH4C 3AP4A 4M0NA 4DOUA 4WVMA 3WP6A 4ZU5A 3S6PA 3H8UA 3OGRA 4UFJA 1O3RA 1B09A 2WQZC 1FYUA 1HJGA 1RYYA 3EJKA 4ZPIA 3J8F1 1U5ZA 2IXIA 1D2QA 2K9ZA 3J9SA 1XNCA 2RMU3 2WR9A 4QMAA 1S0CA 1NG0A 1BYHA 3VBRC 1NY71 2PHTA 3DXUA 3NNMA 1VAVA 3I2GA 2AR6A 5A3UA 5C9AA 4Z1VA 3AMPA 4CP0A 3D3AA 2WWJA 1GANA 4BK5A 1CAVB 1VBC1 4LO7A 3U10A 4YSFA 1I1EA 3HQXA 2WNEA 4LA3A 5FBZA 1AVBA 2BUKA 2WABA 2YBSA 3B9CA 3ACFA 3ZMNA 1C5IA 5CADA 3AFGA 2R1BA 2GC2A 1G8WA 2Z79A 3VBSC 1Z0HA 3ZFEB 2Q5TA 3HQRA 3IDAA 1N3PA 5GKAC 1T6BX 4KGQA 4AG4A 2XJUA 1SQ4A 4MXVA 4XFIA 1S0DA 4EN9B 1VBD1 3AYAA 3OUJA 5KBFA 3A0NA 4XDOA 2VTXA 3GJAA 3A22A 5C6CA 1CAXA 4LPLA 5A33B 2W91A 1UIJA 5D2AA 1UYYA 2XVGA 1UZYA 4QX2A 1LHOA 3VDDA 1EV13 2UY8A 5K8SA 2VG9A 5HV4A 2X05A 3HR9A 3VDDC 2VW1A 2WL1A 5GLZA 3MIHA 4CRQA 3UKVA 2L9LA 5F2WA 2GMEA 3KGZA 3K48A 1CESA 3ROUA 1BHGA 3MF9A 4UFKA 3O1PA 4NMIA 4ATFA 3ZFGB 5BNQA 4UBGA 3MHZA 3E6DA 5FMDA 4XXPA 3M3EA 2YUEA 3O1UA 5LEKA 3JB4C 1AR83 2H6CA 1O7FA 3POWA 1W9FA 3N9OA 2WQ4A 3KLSA 4XURA 2TBVA 2CDOA 3U37A 1X9PA 1WBLA 4KWLA 1O8SA 4TYSA 1C5HA 5FYVA 3MIEA 4XW3A 2VQTA 3HPNA 4OQ8A 4JZRA 4DXZA 4Z07A 3PNAA 1O3QA 2XPJA 2WAAA 3F95A 3JBG1 2RR12 3POIA 1OBNA 1RUH1 2XMLA 4P5YA 1D2SA 5I0TA 4BQXA 2A70A 1HRI1 4GAZA 2ZEWA 3FBMA 3WDTA 1Q8SA 5BNPB 3P5BA 2WZ8A 3UNPA 3A0KA 1EAH1 3AKTA 3MZHA 3ZN6A 1HXS1 1OLMA 2K46A 3VD9A 2RS11 2VM9A 2GALA 4EN0A 3T09A 3ZSJA 4M3CF 5JZGA 5JPNB 1LHVA 4QXKA 1BBT2 4QQHA 5DZEA 3I54A 3ZM8A 1JZ3A 4DS0A 2HWB3 2VE1A 2RDRA 3OPTA 5HCHA 2HWB2 5HCBA 1Y9GA 2MPFA 4XDPA 3M3QA 5BV6A 2YDEA 2Q0AA 3SISA 5HI0A 1HRV2 1RUE2 3GBFA 1MEC1 4NOTA 2J1VA 3BGAA 1XBFA 3POFA 2HBTA 1Q8VA 1ZRIA 2XLAA 1VBB2 1SACA 2PQSA 2WZPP 3VHNA 1R1A2 2FMDA 5FMBA 2Q8CA 4ITCA 2F17A 5FY9A 2PHLA 1ENRA 2DCZA 4XBLA 2FZ1A 3FHIB 4YZ3A 2XH6A 5KHIA 1R1A1 1QXPA 2CAUA 3ACGA 3N7JA 1Q3EA 3H1WA 3WP4A 1GWLA 5FZFA 1HB1A 1V6IA 4HZFA 2G9ZA 2W87A 5A7WA 2LALA 1IKPA 2P37A 1LKNA 5ANQA 4IV3B 4BQWA 1RB8G 4HVQA 5KR7A 3QOPA 2RJ2A 1ALYA 5FZ1A 5FZ3A 1H0BA 4EROA 3WF0A 1IS5A 1QJU2 4Q8KA 4FPCA 4CXWA 1UIKA 4AI3A 1QNYA 3C7EA 4Q27A 3EQEA 3FMGA 3ZYBA 1O5LA 3DEMA 3C8XA 3OJBA 1SPPA 4URAA 4CP9A 3NJXA 2GP3A 1CN1A 2PFWA 3ASIA 2P3YA 3U07A 3TNPB 3KHBA 1PHMA 4PLOA 1WW4A 5LRSA 3FHQA 2EA7A 3N3HA 3RS6A 4AAXA 2VCMA 1V6KA 3M1HA 1WW5A 3KT7A 2HH9A 2E53A 3AXDA 4R4XA 3WQBA 3ZFFB 1PIV2 2OZ6A 1ZBE2 4YGBA 2FDKA 2ET7A 1HXS3 3OUHA 5A6QA 1DQ6A 1KDKA 1NYWA 3WX5A 3NVCA 3LFIA 2CL2A 1QJZA 3KT4A 4Z92B 5AVPA 2E26A 1DFQA 3LIGA 4M3CA 5FCCA 5FREA 5JR2A 3WHUA 1W6PA 2ZGOA 3B9IA 1FMD3 2OKXA 1JUHA 1NOVA 1GLHA 1MS3A 1FMD2
chains in the Genus database with same CATH topology
4AEMA 2JKBA 2WSUA 1W6PB 4DZGA 5KXBA 2R061 3GZTB 4CP1A 3WOGA 1ZRDA 3VBHA 4CEWB 4NWWA 4MXWB 3WDUA 2ZZJA 3U0ZA 2R041 4E2GA 1QU0A 4CDQC 1DZRA 3AJYA 4Q0UA 4QPYA 4AVTA 3E6CC 3AZYA 3LA2A 3AZWA 1PZ9A 1KITA 3J4UH 3MLJA 5GLUA 4BZ4A 3GZAA 2C9AA 4ORFA 4YM0A 3CL1A 1AL0G 1AX1A 2PLV2 2WSVA 4RD7A 2Y0OA 2I74A 3URFA 2BVBA 3ZXKA 4HK8A 3TB0A 3ME2A 3BIWE 2A6XA 3AB0A 2ILMA 3AMNA 4Y1XA 2XJPA 2IXJA 2KA3A 1VIWB 3H1MA 1MZ5A 3JQWA 4E27A 2VOVA 1VP6A 1VBB3 1H1MA 4Q4V3 2QFEA 1XNKA 4Q4V2 1RUJ1 3IDCB 3FLTA 4DY5A 1ZZCA 2QNKA 1YIPA 4GIQA 4OHWA 2PHXA 3J8F2 5I0UA 2PELA 3NV2A 5BNNA 4I30A 4XOGA 2HWE3 1NZCA 2O8QA 4GXLA 5AVAA 3RI9A 2FQPA 1PO22 1R081 1RINA 2VQAA 3IWZA 3TBDA 1RUC2 4YM1A 2JG9C 5JR7B 1ZRCA 1VAMA 1J3PA 5L7OA 5EJ3A 3RQ0A 4Y1YA 3DGTA 1H8TC 1XYNA 4FXGB 1CGPA 1MZEA 1PIV1 2DTYA 4AW7A 4JCKA 2RJLA 3ES1A 1ZBE3 5KHJA 5H9PA 4DRVA 4RS5A 2EALA 3AXEA 1KDMA 1CAUB 4XJAA 2E6VA 2P3KA 1HRV3 1RUE3 4FP3A 4G9SB 3ZXDA 1DYPA 3WDXA 1G9BA 3GBWA 1ND3C 1FPN1 1QH6A 1H8TA 3QH6A 1HKDA 3WXPA 2OW4A 1SLLA 2QDRA 4QPGC 1NCQB 4IV1C 1W6QA 3JD72 1H8TB 3JZVA 5BNOA 1Q5OA 3WDVA 3EO6A 4Z82A 1QJX1 5GLTA 3ZXJA 1MS9A 4NVPA 1OMIA 1WMEA 3B02A 3V56A 4COVA 1NCRC 2R16A 1PM7A 4HT1T 1CR7A 1G9DA 1MEC2 1WD3A 2Z5WA 2RJKA 1RUNA 1LU1A 1G9CA 2NM1A 2A3WA 4S2GA 3TOJA 1EYBA 1RTVA 1RUD3 4IERA 4QM9A 4EWEA 2PLV3 4FOQA 1FT9A 4EV0A 1G86A 3V0AB 4FPLA 3M7AA 3MLLA 4PBOA 3H7JA 1QKQA 2PAMA 3ZYJB 1EV11 1AHSA 1QQP2 4XIKA 3V0AA 2UU8A 1GZWB 2PLV1 1K5MB 3U11A 3M2MA 1R091 1LHNA 2RS51 1DGWA 3OD4A 4JDNA 1FV2A 4I09A 2ZGTA 4UW3A 2UYBA 3L2HA 2JDZA 3LWCA 4ES8A 2FZ2A 1KD7A 1HQNA 3THPA 1LECA 1ND2C 4AI1A 3M8LA 4XFAA 3P3NA 1KQRA 1CD3G 2WNVB 4DNYA 2DURA 1RC6A 4IEQA 4OHVA 1ZBA1 3JCIA 3Q9OA 5J36A 4K1YA 1IGOA 4OI4A 3TAYA 2G4IA 2NYYA 5L73A 2WNVA 2RR13 3N35A 5AFBA 4AFBA 2WNVC 2BNNA 3LOBA 5J48A 5JPMB 1PGSA 1PNGA 4JDMA 4NHKA 4EN8B 1ND2A 2GMMA 1H8VA 4FPFA 3TWIA 1VB2A 3RPQA 1HW5A 3PVOA 4Q4W3 4W6XA 4XJ9A 1YI7A 1S2BA 1ZBE1 3R4UA 2BWAA 4HN1A 4RHV2 4Z2WA 4JQRA 2A75A 4M01A 1WBFA 2XJQA 4MGYE 4CDUA 1W39A 3D5OA 4CDQB 5D8AA 3MIDA 4V1PA 4P9IA 1X8EA 2NP0A 1TEIA 4N53C 2WT1A 1RUI1 3ZFFC 5D8AC 2IFWA 1AL21 1PIV3 1LOBA 1RJ8A 1OOPA 2DCJA 2YGMA 2WWSA 4H14A 4SBVA 2HKXA 1YO8A 3WDWA 1GZWA 2EIGA 2HWE2 4EN6B 5CFCA 1NY72 4N90A 1W6NA 3AP7A 5CFCB 5T52A 1O4YA 1LESA 3ENRA 4YW4A 1BMV1 3VBOB 5BNPA 2ES3A 4ZU4A 4LBQA 3AJZA 4AGGA 1TME2 1VBB1 4L92A 3OPZA 3I59B 1H2LA 1ENXA 5A32B 5CAZA 1BEV3 2XJRA 4XPVA 4OLLA 1H1AA 2EXHA 1J58A 1YHFA 1YWKA 1ULFA 3NSTA 4G4FA 4RR3A 3O0XA 2ARBA 2QZ3A 2WS91 2ZX1A 4H7LA 4RR3B 1RHI3 4LULA 1YRZA 1RUF3 2JICA 3RJ2X 1RUF2 1VR3A 2R043 1W0PA 4I0BA 4IEOA 5F6KA 2C0ZA 1LOEA 1ONAA 2R30A 3RSJA 4XJZA 1J59A 1NXD1 3PTYA 3LAGA 4X6QB 1ENQA 3JD73 4AEKA 1Y3TA 3L9JT 1JH5A 2ETEA 5DZGA 1WD4A 5D8AB 2DCKA 3MW4A 4DRRA 2D3SA 2ZABA 1BMV2 2CV6A 1HIXA 2XGXA 3AMHA 2NLRA 5DUVA 3WD5A 1QOTA 4KGGA 2FHRA 1YJLA 1NLRA 2JE9A 2XBO1 3H9AA 5IUQA 2B42B 3MPPG 2BYVE 2XJVA 2NPIA 1AYN1 3QCWA 2WZR3 3R0RA 1APNA 4CTEA 2WT0A 3WG4A 5JIAA 1C4RA 4XF3A 3GALA 5KC5A 1S0GA 5BY5A 5EZWA 1YFUA 5FAXA 3B7MA 4PLNA 1N1YA 2D98A 1UKGA 4B7EA 4FPGA 1UPSA 5C9AB 4FP2A 4YRDA 4HPKB 1CAVA 4HBNA 1WA4A 3IPVA 3VGIA 4LBJA 3C2UA 2Z2SB 5A32A 4HPKA 2ERFA 4P9YA 4LBMA 2BGCA 4DPNA 2ZX0A 3OF1A 4NO4A 3MFAA 1IKQA 1AXYA 4LLFA 4XE9A 4FBFA 5E88A 3VUOA 5LK7B 1ZM1A 3WV6A 2XUMA 4W6YA 1W6MA 1CJPA 1QDCA 2W0XA 2B9UA 3GHMA 4I01A 5JOZA 3RG0A 3DPRA 4F83A 1S0JA 2RMU2 3VZKA 4AEDB 2DUPA 5I0SA 5AC92 1AJOA 2OVUA 2D6NA 3H0OA 1RUOA 3L2YA 3NV1A 3AYDA 4KBBA 1Q8QA 2NMNA 2XLGA 5CU1A 4COWA 4YFZA 3VBRA 4Q0VA 1W2UA 4LO4B 4AQTA 3VL8A 4IEZA 5C9AC 2DVGA 2PQQA 3VBRB 3VBFB 1UCXA 1N1SA 5FOJB 1CAWA 2RM22 3UJQA 4RQPB 4GH4A 3AKRA 4XILA 2RM23 3SMHA 1ZRFA 4PBPA 4FQZA 1MEC3 1AUYA 5HXVA 5JOXA 4TZDA 1CAWB 2WJSA 3ILRA 1JTZX 1SMVA 1I6XA 1RUD2 3ETQA 4QQPA 4WVWA 5JOWA 1V9U3 4GB33 1AJKA 5FDBA 3W59A 1EPWA 3B94A 4D7TA 1RVF1 4XTPA 4MSVA 4TWTA 4LE4A 1LENA 2VVEA 4B8EA 1O3TA 3USUA 3BB6A 4AFDA 5BPXA 4WVMB 2WZR1 2PTMA 5DG1A 4N7UA 3JBG3 4KWKA 4XZPA 1LOAA 1ND3B 3FC0A 4QGMA 3VKOA 1WCKA 1DQ1A 4LO6B 4WZCA 3H7YA 4IXLA 1J1TA 2ZGSA 1UMZA 1WLDA 4B29A 2XBO3 1C57A 4RR3C 1RUG2 4YVSB 3WY6A 2ZGNA 2DFBA 4FCAA 3AP6A 4JV4A 1GZCA 3JD71 2KXLA 4UW4A 2NMOA 4XMIA 2HYKA 1YYNA 4XF9A 4KG0A 3DPRB 3GYDA 4MUVA 4WM7B 3THTA 4C0HA 1GFF2 2GH8A 1RUF1 2BW8A 3LGRA 2YY1A 1KRIA 2R073 5L19A 1IOAA 2VXRA 1QQP1 4IQPA 2YROA 5CB7A 4DMIA 2QJVA 1JYCA 1JOJA 2WFF2 2XKPA 4M3CE 4PIZA 2ZCWA 4RGGA 3KB5A 5D1IA 2B7YA 1X36A 1SLIA 4XTMA 4LLOA 1UZZA 4H3WA 1QMJA 1AR71 1OQ1A 3KCCA 3OYWB 2JE7A 1VBD3 1QOOA 4E2SA 1OD5A 4IETA 4I3GA 2YXSA 3RMXA 2R49A 4K3UA 4R8HA 3ZSLA 1O5UA 1PVC3 1ULCA 2BPA2 1COV1 2UWBA 2ZACA 1JN2P 4BMEA 5A3LA 3PJYA 1QNWA 1BKZA 1O4TA 1ULGA 4IESA 1BVVA 1KFXL 2D93A 1OA3A 4ZXKA 1F2NA 3M4FA 2ZS6B 2EXKA 4K7JA 4LT5A 4E4SA 3PVBB 4EJRA 4K1ZA 1YI9A 1FPN3 3G7DA 1FPN2 4Q4W2 4GMP3 1N1VA 1VJ2A 3UKNA 4UXAA 5JIUA 4Y5Z0 4INDA 2WA3A 1RUI2 5LRRA 4L8QA 1TME3 4FQ4A 1FV3A 1DQ0A 2ZGPA 2D6PA 4AVBA 1X33A 3I8TA 4YGEA 5FFOC 3DL3A 3WHTA 5I8SA 1C8M3 1DG6A 3HT2A 3ZYPA 3LCPA 3AYEA 1IHMA 2X5IB 4O9EA 1MQTA 4COZA 1DLLA 2UYAA 1VRH2 2CY6A 1FX5A 4FPEA 2DVAA 3KS7A 1UU5A 4FO9A 2CTVA 3RYPA 3UK9A 2IXHA 1F31A 2ATFA 1B35C 1UN1A 2WLPA 1C1FA 5GZFA 1JUIA 2YYOA 4QD2A 2VNGA 2BQPA 2X8KA 3IDBB 2UWCA 1RGSA 1AX0A 3RYKA 3OBRA 4C90A 5IK7A 1K5MC 4C1WA 2DCTA 3PMEA 4S2DA 4WM8C 1ZZBA 5AC91 1LHUA 1BJQA 3WW4A 1FNYA 3ZN4A 4EWAA 2DV9A 3MEPA 1DQ5A 4OUSA 3PVEA 1IS3A 4JGZB 3SCGA 3VBHC 2DCYA 2A73B 1R1ZA 1LEDA 3WUDA 4AGRA 1HX6A 5K0UC 4AQ2A 5ABJA 3WG3A 4LTAA 3I4IA 2CWSA 4NN0A 3AMMA 1G7YA 4YW2A 5K0UA 4PJYA 1GQHA 3BCWA 4BQ1A 2BTVC 5I91A 1AR72 2TEPA 4PQ9A 1OOPB 3D8CA 1W6OB 4AWDA 4LO5B 1EV12 4XQ4A 2A3YA 4IEVA 4QQLA 4XFCA 3FFZA 1S0BA 4M3CB 2H6BA 3INAA 3MIBA 1ZYBA 3ZIWA 2HWF3 4YZ1A 4CZSA 2CNAA 2ZHLA 4QPGB 2HWF2 1SFNA 5JAXA 4N7IA 4C0BA 1OA2A 2XVKA 1QJU1 4BM8A 1M4WA 1VBC2 1ZRRA 1YJKA 3J26N 1ZZ7A 4BPZA 1KFUL 4EWDA 2XBO2 3T1MA 3V0BB 4FSJA 1AR62 2VECA 3V0BA 2A6VA 3PMSA 3VKMA 2HEWF 4JVAA 5HCAA 1OFSA 2IXLA 3LSDA 4AK3A 1MACA 4LHKA 1M06G 3W58A 1OI6A 5JLVA 5SV5A 4IEYA 2PHDA 1QY4A 2GNDA 5CG9A 1XNBA 5SV8A 1OHFA 1YNAA 2BNOA 4E4DX 4B4RA 4GA9A 5I8YA 4META 2RE9A 2ZTNA 4SLIA 1Q8OA 3IDEA 2D6LX 5E8AA 5F5QA 4FXKB 4I0AA 1XE7A 2YMZA 4PDWB 3AKSA 2LM3A 3ZFGC 1RUH2 4CEYC 4WVZA 4BMBA 3O5SA 2D43A 1H4HA 1REFA 2Q30A 1GR3A 1S1AA 3QACA 3R4SA 1BK1A 1UPIA 4JTNA 1AR91 5H9QA 1PO11 4HN0A 1R082 3SNMA 3IBMA 2VH9A 2XLFA 1KXGA 4L2NA 2P2KA 3ES4A 4S2HA 3WINE 1F5FA 1VBA1 2R6QA 3HIFA 4Q26A 4Q4V1 3OY8B 1RUG3 2A6YA 2HWB1 5E16A 3ZFEC 3IPVB 5L7OC 4IV1A 1DGRN 2GNMA 2A6ZA 1I5ZA 4MVTA 3VBUA 1QDOA 3AYCA 5DDJ3 4AVSA 1FXZA 1VRH1 2Z42A 1HXS2 1HQLA 1LOFA 4COUA 1HDKA 2MEV1 4IEUA 1MS0A 5KXDA 3JBG2 5T50A 1RIRA 4ZKTB 1OQEA 4OHYA 4U2AA 1ND2B 2Y26A 2VGDA 1LULA 3JQXA 2GC0A 2R042 2D5FA 2ZX3A 1PK6C 4W6WA 2ZHNA 1CPMA 3M3CA 5DUXA 5ACA3 5FOBB 3ILNA 4LNVA 1KS5A 5GLVA 5J96B 4C1XA 1PK6A 4XQDA 5KXEA 4XFFA 5T5PA 2AREA 2D6KA 2W68A 3H3UA 2CGOA 4DQAA 1U5IA 2XL9A 2A7AA 4JGYC 1FAYA 4Y1VA 1ZVFA 2P17A 1V00A 1QWRA 2QZ2A 1SBFA 4JGYA 4KU7A 1SDWA 1N3OA 3WCRA 1JHNA 3WCSA 1BQPA 2R063 2D5HA 4TSVA 4L11A 4YVSC 2BVVA 5F1RA 4WZFA 4Q4Y2 5KC6A 5TSWA 1FOD1 5KHGA 1NXMA 4XFHA 4AVCA 4K40A 4HKLA 5A3MA 5FPXA 4IV3C 3MICA 3VBOA 1NA1C 2PHFA 3WG1A 1VBD2 2JG8A 2TNFA 2IXCA 1HLCA 2HEVF 1ZA4A 2WFF1 4XJUA 4XIOA 2D6MA 3FBYA 4YW3A 1SCRA 1PVC2 4UW5A 3ZSKA 4HKOA 3HAGA 2PAEA 3RDIA 3ZN6B 4OUMA 4YGDA 4IV1B 1VBC3 3V64A 5J7MA 4LEJA 1PZ8A 3D0SA 4QX5A 3JUUA 2IWGB 3LZZA 2QQPA 3HBZA 2VOXA 2A71A 4BWOA 3VL9A 2BFUS 1MS4A 1RUG1 2Y0IA 5A33A 5JSOA 1YUDA 4K8FA 1UL9A 1W6MB 4QT6A 3CNAA 1B35B 1N1TA 1XNDA 2IC1A 2CWMA 1YFXA 4RL7A 5BNPC 3TN93 1AL23 2E9QA 3AP9A 3M3OA 4PIYA 4XHXA 4YZ4A 2X5IC 2VQ0A 3ZFGA 1XXNA 3RWNA 1CVNA 4CEYA 2VNRA 3OYWA 1BBT1 2JX9A 3MIGA 4WBBA 5C4WC 3PVNA 4LBKA 4OVEA 4I3PA 1D4VB 1UW8A 2DUOA 3KT1A 3OGGA 4FTSA 1V6JA 1IPJA 2VOWA 1LGCA 3MW2A 2VULA 1RUH3 4GB32 1UU6A 4RS5C 4XBNA 1S2KA 1Q43A 1Y9QA 3OCPA 3DV8A 4Q29A 4J1XA 3NKGA 4LBOA 1TMF3 1VBE2 1NQDA 4UW6A 4XF4A 4Q0SA 5I93A 4Y26A 4AVAA 1LCLA 3VLBB 2RR11 5GZEA 5JDBA 4A3XA 3SITA 1WCSA 2FMYA 5BXXA 2V73A 1ZBA3 1N47A 3WVJA 5C4WA 1AR81 3A4UA 3KCYA 5CFDC 1QHDA 4AFMA 4FPHA 4N9HA 5HBAA 1BZWA 2B8MA 2GNBA 1NLSA 4YFWA 4YZ5A 1D4M1 4YM3A 1AR63 4OHZA 3AFKA 5EXOA 1NCRA 1ULDA 5JCTA 1A8MA 1HV1A 1NQJA 1AR73 3WT3A 2AYHA 2ZAHA 4XETA 2HWF1 3E6BA 5CBLA 4CEWA 4QPIC 4Y20A 5C8WA 5IT6A 4D94A 4WM7A 4CEWC 1UF2C 2DF7A 2MEV2 2RS53 4WM7C 1GZ9A 1F9KA 1PGL1 5DXDA 5E1RA 3SLIA 4GQ7A 4MX3A 1MVEA 2EAAA 2WA4A 2DTWA 3HWJA 5GZDA 4XMAA 1ZZ8A 1AXKA 4GH4B 2VY0A 5DUWA 4R9DA 4AHXA 2IXKA 1WLWA 2PYTA 2QDNA 1SEFA 4JRLA 4LHLA 2A6WA 2DVBA 5KHHA 2A5ZA 3AKPA 4BYYA 4QPIA 4BH9A 4FAHA 4IL7A 5AC93 3ZSMA 1V6OA 4LA2A 4XFBA 1MS5A 2AUYA 1OSGA 1TNFA 2XG3A 4FOWA 4Q0QA 5DG2A 4DFSA 3ACLA 4Z8BA 5JI7A 1ULEA 5E89A 4YVWA 1AXZA 4ONUA 3ZYIB 1AYM1 5CA6A 3EXUA 2XPJA 1GV9A 3ZFFA 4JAAA 4DB5A 5EV7A 1J3RA 2Q1ZB 3GBGA 1Q56A 2DVFA 5FPZA 4Y4YA 1H9PA 2SBAA 2G9FA 1DF0A 3JB8A 3ZYRA 4XHBA 3OTFA 4QGNA 3NKTA 4JGZC 3VBHB 2C1FA 5B2GB 1ZREA 1H30A 5T5OA 1DU3D 1GKBA 2UY9A 4X8NA 2ZKNA 1GYKA 3ILFA 1DIWA 4GMP1 1LR5A 4JC1A 2I2SA 3MGUA 4LO8A 5J98B 4Q4W1 5ABJC 4PDWC 1TME1 2XJSA 4LUMA 2OIIA 3FWEA 4I2OA 3HMYA 2ZHKA 2NZ9A 4GULA 4N43A 2GSYA 1PVXA 1PGW1 2Z69A 1POV1 1MS1A 3ZYGA 5K7PA 4EN7B 1ZX5A 2PHRA 1RMU2 3KZ4C 4FPJA 2HWE1 1PZ7A 4P14A 4Y22B 2YZ4A 1BEV2 1CJDA 2PN5A 4GKXA 4NR1A 1IPKA 4E2QA 3VBSA 4R9AA 1BXHA 1RUJ3 1PVC1 3NV3A 4COYA 3NJZA 3U4XA 1SBDA 1U12A 2EXIA 2WFF3 2ZMLA 4AVVA 5ABJB 3SXWA 5JMCA 1WW6A 1LOCA 4FTEA 1EY2A 4GMP0 1A78A 1U5YA 2OYZA 2JXAA 1PGL2 3E5XA 1U0AA 2GMPA 2W52A 4Q4X3 1XYOA 3PHMA 2Y38A 1LGBA 3WQ1A 1O4ZA 1J3QA 4B4PA 1A8DA 5JSRA 4K20A 4MGKE 1AYM2 4YLZA 4L97A 5FLJA 4H55A 1ASJ1 4Q4Y1 2ENRA 3KQRA 4KNCA 4GWMA 3OY8A 4OZXA 4R52A 2ET1A 5EFUA 4OHXA 2D3PA 2F6BA 2QCSB 3VZMA 3BTAA 2B5HA 1RL3A 3O0WA 2GN7A 2GZWA 4BLIA 3LSEA 3M70A 2WNUC 3ALQA 4AXOA 5JVVA 5DZFA 5I0RA 1BVP1 1OA4A 3CLPA 3PLQA 5H9SA 4N43B 4HVOA 3SH5A 1S55A 3APBA 1AL22 2WS93 2MEV3 2RS52 2AZ5A 1V9U1 1NCQC 1WUVA 3DPRC 1VBE1 3ZXEA 4ASMB 2TUNA 1VRH3 5FLIA 4B7KA 1X7NA 1XU1A 1NCQA 3W9AA 1WCDJ 1W6QB 2XL7A 2QUOA 1MR5A 4B3NA 1WMFA 2R32A 3OBTA 4DY3A 5C33A 2VW0A 1LHWA 4YVWC 5T3NA 4CDWB 1S0EA 3O0VA 1WW7A 3I2DA 1BBT3 2I07B 4YNIA 4L9BA 4NHLA 1D4M2 2HJIA 1LOGA 1RMU3 1RMU1 2MHFA 5H9RA 5F9TA 1WMDA 3TN91 4Q0PA 1R083 5JZGC 4FOYA 3P3PA 2WINB 1C28A 4YM2A 1AR92 1W6NB 2WLQA 1OQDA 3D0JA 1ZNPA 4QQ2A 1AR93 5L7OB 1V6MA 4IEWA 3B93A 5T5JA 1IZ3A 1QXRA 5IK8A 3EHKA 2VMHA 2K0GA 3CO2A 4UBHA 2XKOA 3T1LA 3VKLA 3BOPA