2VQAA

Protein-folding location can regulate mn versus cu- or zn-binding. crystal structure of mnca.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
356
structure length
356
Chain Sequence
WRSLSNVVWGKDLPAFTYAFSKTPLVLYDGGTTKQVGTYNFPVSKGMAGVYMSLEPGAIRELHWHANAAEWAYVMEGRTRITLTSPEGKVEIADVDKGGLWYFPRGWGHSIEGIGPDTAKFLLVFNDGTFSEGATFSVTDWLSHTPIAWVEENLGWTAAQVAQLPKKQVYISSYGPASGPLASATPQGQTAKIEVPHTHNLLGQQPLVSLGGNELRLASAKEFPGSFNMTGALIHLEPGAMRQLHWHPNADEWQYVLDGEMDLTVFASEGKASVSRLQQGDVGYVPKGYGHAIRNSSQKPLDIVVVFNDGDYQSIDLSTWLASNPSSVLGNTFQISPELTKKLPVQDTIFSLPTQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SLL1358 PROTEIN
publication title Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Metal binding protein
total genus 89
structure length 356
sequence length 356
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vqaA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vqaA01
2ET1A 1XE7A 3BB6A 4B29A 3OD0A 4E2SA 3NW4A 3E5QA 5CU1A 3CLPA 2P17A 1Q5OA 1YFWA 4JTNA 4WVZA 1J3RA 3NVCA 1J59A 3ZDSA 1YFXA 4XFHA 3LA7A 5FQ0A 1FXZA 2BGCA 4QM8A 4MGIE 1PMIA 4ONUA 1DZRA 4O9EA 1WLTA 2QCSB 4X6QB 4WBBA 2IXLA 3H3UA 2PYTA 1ZZ6A 3D82A 2D5FA 3USSA 2UY8A 2EAAA 1H1IA 2GC2A 2EVXA 1OD5A 1UIKA 3GYDA 3WW1A 1H1MA 4AQ2A 4HN1A 2K9ZA 4EWAA 2OZJA 2XKPA 2VECA 3H1MA 1EPZA 3WW4A 3H1YA 5KHKA 1CAXB 4PIYA 3HT1A 3BPZA 4MH0E 1O5LA 3HQXA 5F1RA 1O3QA 4I2OA 2QNKA 4KWJA 5D1IA 2GC3A 4MGKE 3E6DA 4KWLA 4A2UA 1LRHA 1ZNPA 3RZZA 2VPVA 4I0AA 4N9HA 4IEPA 1RGSA 4XETA 4AVAA 4EV0A 3OCPA 5AVPA 4J1WA 1YHFA 4OFGA 5BPXA 1X8MA 4KU7A 4MUVA 5FPZA 3CEWA 1LKNA 3PNAA 2F4PA 1UW8A 3SCGA 4XFGA 1LB2A 5I0TA 2FMYA 3LOIA 5T3NA 4HMZA 2Z69A 1QXJA 2H6CA 5I0SA 4I0BA 5FLJA 4Q0PA 1EP0A 4MX3A 4Z07A 4BH9A 1RUNA 4XFFA 1SFNA 2GZWA 2XKOA 1DGRA 3NKTA 4IEWA 4NVPA 3DV8A 3RPQA 4MZUA 2GH2A 1UIJA 2CAVA 1WA4A 3H7YA 1PM7A 4LUMA 2XGXA 4YRDA 2WFPA 3ETQA 3E5UA 3I59B 3FX3A 5E16A 5I8TA 1RL3A 3H8UA 1UCXA 1TQ5A 1O4TA 1FT9A 1GQGA 2GC0A 1I5ZA 1X8EA 4FBFA 3QOPA 4QGNA 1OFNA 4AQ6A 1YWKA 3R6SA 1DGWA 4EWEA 1OMIA 5FLHA 4R52A 1YLLA 1ZZ7A 2XLAA 4Z82A 4KWKA 3GBFA 5I91A 4YARA 3M3IA 1O3SA 1Q3EA 4JV4A 1X7NA 3LAGA 4XFIA 4QGLA 3B02A 5KHJA 1XE8A 5I8SA 1CAUB 4IEZA 1QXRA 4IETA 2XL9A 4F8AA 1CAWB 1SQ4A 4BHPA 2QJVA 3I7DA 1J1LA 1RUOA 3HT2A 3ROUA 5FPXA 5E1RA 2IXCA 2PAKA 3BALA 3S7EA 4D7TA 4AXOA 2V09A 2IXIA 2PAMA 2PQQA 2MNGA 2E9QA 3CL1A 2ET7A 3BCWA 1Q43A 3G7DA 4QGMA 3ELNA 3RYPA 4K8FA 3IWZA 5J7MA 2BNMA 4AVCA 1QWRA 4HVOA 1Y9QA 3TNPB 5J3UA 3UKNA 1YFUA 2OZ6A 4MGYE 2O8QA 5KHIA 4QXKA 4LA2A 5KBFA 4UXAA 1WGPA 3M70A 1X82A 2WC2A 1IPKA 3I59A 3FJSA 2B5HA 3NL1A 4IEVA 2O1QA 3KMHA 1NE6A 5JAXA 4YNIA 4I3PA 2HKXA 2MPFA 3IDBB 3JZVA 4L2NA 3FFQA 4ZU7A 2BNNA 1CAVB 5JR7B 3C3VA 4Q0SA 4TLFA 4N9IA 3H7JA 2ATFA 1I6XA 3PVBB 1NZCA 3CJXA 4RD7A 2N7GA 3WW3A 1RTVA 3SHRA 4IESA 4KU8A 3O14A 2MHFA 4BYYA 2ZCWA 2XLGA 2D93A 4QMAA 3LA3A 5BY5A 4FAGA 1L3JA 1U12A 4E2QA 2ETEA 2XHKA 3RYKA 4I01A 5FLIA 2GU9A 1O3RA 1ZX5A 2CGPA 1G6NA 5LRRA 4LULA 5HI0A 3RDIA 4PJYA 4HVQA 2PAEA 4XEZA 5FQ0B 3H3ZA 4QX5A 2Y0OA 2IXHA 4IEQA 3RNSA 4Q0QA 4LEJA 5JSRA 1ZZBA 2IXJA 4FT8A 1QY4A 1Y3TA 2H6BA 1ZZ9A 3RYRA 5JCTA 3EJKA 5K8SA 5LEKA 4E2GA 2EA7A 4XF9A 4BIFA 1CAXA 2Z2SB 1SEFA 2HJIA 5C6CA 3DL3A 2I45A 4O9GA 3IIAA 4ORFA 3ES4A 2KXLA 4Q0UA 3VHRA 2IC1A 3NJZA 4LLOA 4PIXA 4QM9A 2D40A 5BUVA 5CADA 3OF1A 1UPIA 4LTAA 1IPJA 3KSCA 2PHLA 3KGZA 4ZU5A 1HW5A 1ZZ8A 1ZRRA 3KGLA 2BEOA 4AVBA 1ZZCA 1DZTA 3SCFA 2BYVE 3I54A 3FE5A 3QACA 5J48A 3MYXA 4WZCA 3SXWA 1JUHA 3CF6E 4JTOA 5EFUA 2Q4SA 4HSLA 5I0UA 1ZRDA 3LZZA 4UBHA 4H7LA 5JSPA 4Q29A 4P9GA 2C0ZA 2UY9A 3BU7A 3D0SA 5CVRA 4LA3A 4I02A 1VP6A 2PFWA 2UYBA 3FZ3A 1O3TA 1ZREA 2B9UA 3D0JA 5JSOA 4I09A 4D7SA 2BNOA 1GQHA 5KHGA 3H50A 3E6BA 1NYWA 3ES1A 3LWCA 4L11A 3ACLA 5LRSA 1O5UA 3PLQA 5FDBA 4XF3A 4EROA 1FI2A 3OGJA 3OTFA 4CYDA 4Q0VA 3KCCA 4R8HA 4MV2A 1J3PA 4UBGA 5C8WA 2K0GA 2XLFA 1EY2A 3E6CC 3U10A 4EWDA 4LUKA 1EYBA 3UKTA 5BV6A 4YYOA 3HIFA 2CV6A 3SCHA 2QVSB 1CGPA 5BXXA 1YFYA 4PIZA 3SMHA 4XFAA 3ST7A 3FWEA 3CO2A 2D5HA 1NE4A 3LA2A 4MGZE 1CAUA 4HN0A 4ZU4A 2QDRA 5FCCA 2XL7A 4J1XA 3MPBA 1CAWA 2PHDA 1CX4A 5KHHA 2OA2A 4IEYA 2B8MA 1ZRCA 3EHKA 3H1WA 1ZVFA 3UKVA 3E5XA 2CAUA 3L2HA 2DCTA 2OPKA 4HBNA 4X6RB 3H9AA 4KL1A 1UD1A 1VR3A 3DKWA 2PA7A 4IEXA 4YSFA 2Q1ZB 1XRUA 3WW2A 4HSJA 3EO6A 2PTMA 3EQEA 3IBMA 3FHIB 4GULA 2Q30A 4XF1A 2Q0AA 3S0MA 3DN7A 3IDCB 4XFBA 5I93A 1O7FA 5I0RA 4XF4A 2GC1A 4XFCA 1J58A 4META 3NSTA 2FQPA 3E97A 4IERA 4HLTA 5EZWA 1OI6A 1VJ2A 4XF0A 3S7IA 4F7ZA 4JVAA 4HZFA 2H0VA 4OLLA 3U11A 2GAUA 1CAVA 1RC6A 2VQAA 4HVRA 4DINB 5LEJA 2IXKA 3U0ZA 4IEUA 3MZHA 3MDPA 3N4MA 1ZRFA 5I8YA 1NXMA 1V70A 4FAHA 2UYAA 2ZKLA 3TNQA 1LR5A 1J3QA 3EBRA 2OYZA 4IEOA 1YUDA
chains in the Genus database with same CATH superfamily
4DEVA 2ET1A 1V9U3 3ZIXA 3HD8B 4H3WA 2VVEA 3QLQA 5HXVA 1PO13 4YLZA 5CIRA 1G9FA 4LKEA 1S0CA 1DZQA 3E5QA 3ZKYA 3D5OA 5C8CA 4WVZA 4OUSA 1YCIA 5LBBA 5FYVA 3ZDSA 2RJLA 4JKLA 4KBZA 4JCKA 2CHHA 1HLCA 3AMMA 1OVPA 1PMIA 2VTXA 3M3OA 4ONUA 4IGQA 3UGHA 1NT0A 3VGIA 5JWPA 2J1RA 3PUIA 4ASKA 4O9EA 1DQ4A 3ZR5A 4BB3A 1AR72 2IXLA 2NM1A 4HETA 5FPVA 3UT0A 1QH7A 3JQXA 1AR91 4XUQA 5FO8B 4QX0A 3TN93 2WZR1 2TNFA 5FV3A 4XW3A 4BOWA 1JYCA 1R1A1 2A6ZA 2EVXA 2HWC3 2A5ZA 2VE1A 2VUJA 4LO5B 1W0PA 2BV4A 4PLOA 2QFEA 5FWEA 3BOPA 5A3WA 1G9CA 1KRIA 2GNDA 4LKFA 2VECA 2K46A 4NROA 2HEVF 4JGZC 2QUOA 2V5YA 2XB6C 2VMGA 3H1YA 3LFIA 5A80A 1O3QA 4LBKA 1O5LA 1BCXA 3HQXA 4MH0E 4PDWA 4KWJA 5D1IA 4BQ4A 5D8AB 1ZBA3 4NHXA 1WCUA 4XJ8A 2VUAA 5ACA3 1ACCA 2C5DA 3E6DA 4MGKE 4YM0A 1W06A 3POGA 2R062 3SEPA 1LRHA 1ZNPA 1K5MC 2VPVA 5FY5A 2A73B 4KBBA 1JZ5A 1O8PA 1HB3A 4XETA 3I4IA 4CEWA 2GDFA 5H9QA 4PF1A 3GNEA 5FKBA 4CVUA 4LK7A 2XBO3 2F17A 4OZXA 4YGCA 5BPXA 3SKVA 1DGWX 4MVTA 3C8XA 2VTFA 2Y6KA 4Q4V2 1QOOA 2JB8A 3PNAA 4DUWA 2FD8A 1OA3A 4CXXA 2Q5TA 1S2EA 1S0FA 2NYYA 5FFOC 4HMZA 1S55A 1SMVA 4HKOA 2PELA 2Z69A 5FZ0A 3AYDA 4SLIA 3WG1A 3VL8A 1HN1A 3W9AA 5FZ7A 1VB4A 2BGPA 1SACA 4B4PA 2DVFA 2HYXA 3C7GA 4OHVA 5FLJA 5C3QA 2JE8A 4CZSA 3HAGA 4MX3A 1GV9A 3GDBA 4GALA 4NHMA 4NR1A 4XQDA 2GNBA 4Z07A 4BH9A 1CPMA 3ENRA 3IDEA 3ZN6B 2MEV2 1MPXA 4NVPA 4D6RA 2FBEA 2ZX0A 1KQRA 4GH4B 1VALA 2QQIA 1WA4A 3CNAA 2BJSA 1FPN1 1GNHA 2W87A 4Q4V1 3NJVA 1PM7A 4YW4A 3CBNA 3LDBA 1DBNA 4CCCA 4S2GA 1PGL1 2AEYA 2JXAA 2WDBA 4N53C 2WFPA 4AEDA 2Y6JA 2QQUA 1RXFA 2C9AA 2OUJA 2OKXA 3FX3A 2BWCA 1RUE3 2DCZA 1RMU3 5FYMA 2GMPA 1GOGA 3B93A 4DXTA 4X8NA 4Q4W2 1AX1A 1RL3A 4WVMB 2Z4FA 3H8UA 4P9WA 4G3YC 3JBG3 2YXSA 2VQ0A 3P1IA 5FUNA 1O4TA 3ZXGA 2GC0A 3AZYA 1C5IA 1I5ZA 2ZTNA 2NN8A 1VE0A 3AZWA 4GXLA 4P14A 3DPRC 5K0UC 5M0TA 2YPJA 4M4RA 3R6SA 3WINE 2ZMLA 1OMIA 3RVHA 4CDWC 3JUUA 4CEYB 3KQRA 3N36A 3WD5A 3LQCA 4R52A 1YLLA 4COVA 4WM8A 1QJX3 4Z2WA 2JDUA 1S4CA 2HH9A 3S5QA 5DDJ2 4CPBA 4KWKA 4ASMB 5J96B 4TTGA 2DCYA 3AMNA 4DXZA 5FYTA 4YARA 1Z7S1 1ODMA 4ATFA 5SV5A 1X7NA 1YJKA 4Q4W1 5C70A 4QGLA 3VKLA 2XUMA 1QNYA 2XJPA 4HFSA 5BNNC 1XE0A 3GXUA 3LSDA 3VD7A 1S1AA 2W0XA 5FO7B 1JYVA 3AX4A 1IKQA 5FZDA 3MIEA 1CAWB 1SQ4A 4F8AA 1T6GC 4NRMA 4BJ0A 2Z79A 1AL0G 1OT5A 3HT2A 5FZAA 5FPXA 2WFF3 1W03A 2IXCA 4D7TA 1EAH3 3BALA 1RUH3 3AFGA 3KV4A 2WSUA 5FK7A 5IVBA 2IVIB 2P4EA 3OB8A 4ES8A 1MEC3 3VBRC 5L19A 2R1DA 2ET7A 2RDQA 3CL1A 3OYWA 2WL1A 1H8VA 3ABZA 3C7HA 3EMRA 5C3SA 2QZ2A 1SLIA 3WG2A 5JXHA 2PHXA 3DCQA 3DKQA 1WMFA 3IWZA 4A3XA 1AZDA 1AVBA 1LHOA 5L36A 5ABJC 1QWRA 2FCVA 2VZSA 5J3UA 2X8KA 4UFHA 4CSWA 4AI3A 1YC61 2AC1A 2OT7A 3VDDA 4DRVA 4DY3A 5CFDC 5T5LA 1AR63 5KHIA 3IMNA 3CDZB 5DAXA 3N7MA 5DMYA 1ASJ2 2DUOA 3NNLA 4Q4Y2 2XPJA 5FZ6A 3ZIWA 3I59A 3ZFFB 3FJSA 4QXBA 5GZFA 1JI6A 3OG2A 2G9GA 2YC4A 3POBA 3VDAA 4NJ4A 4A6SA 3VUOA 1W2UA 3WQ0A 5FKCA 4I3PA 2HBTA 3LD8A 5FZLA 2HKXA 5JPNB 1ULDA 3VDBA 4GJZA 5AFBA 5FR3A 1F2NA 3NRUA 2BGOA 3ITQA 5A33B 1K5JA 4L2NA 2ERFA 4Y20A 5FXXA 3PU3A 2Q8DA 4RQPA 4ZU7A 1LHUA 1CZSA 5JR7B 3I2GA 1PZ9A 4N7IA 1KDKA 2RDNA 1RIRA 1US2A 4JGZA 4DS0A 4QPIB 2E51A 3PVBB 5CZKA 1E57A 1WD4A 1ASJ1 2VOXA 1PMHX 4Q4Y1 1B35C 5FXZA 2DV9A 5FY4A 1NZCA 2N7GA 3CIHA 4Y1ZA 4AZZA 1O59A 3U75A 3LKJA 3AKRA 1H8TC 1CR7A 4D3WA 5H9PA 1W9TA 4LHNA 4QKFA 4BYYA 2XLGA 1DDLA 1UQXA 4AOCA 3LA3A 2QTWB 2W92A 3AP5A 5LZ6A 2EF6A 1DLLA 5JMCA 3Q8BA 3CJIA 3KHCA 3AC0A 3U4SA 2XHKA 2BQPA 1FMD1 1AL21 4MLOA 1OLMA 2GU9A 3A7QA 3RYKA 1ZX5A 2GP3A 4MHUA 5A1FA 1G6NA 1AJOA 3LEGA 4CCLA 5L7OB 1GICA 1MS1A 2QQMA 1COV2 3AXDA 1UOBA 1AR73 1WD3A 3RDIA 3D3AA 1QHDA 3R4DB 4PJYA 1UMHA 1CWPA 5A7WA 1UZYA 2PAEA 5FZ3A 3H3LA 4DRRA 4XEZA 2D7FA 4B1LA 3UJQA 3GALA 4QX5A 2YB7A 5EWSA 2A1XA 3SC7X 2ILMA 3UYJA 1QOTA 4Q0QA 3EXUA 5LA9A 1RUJ1 5JUVA 1SLCA 1UX6A 2V73A 1MS5A 4GA9A 4N90A 5EQUA 4DEQA 3MUY1 3ZFEC 2CWSA 1ZZ9A 2OIIA 2YHJA 3HN1A 2WN3A 3VZJA 1ND3B 1CJPA 4YZ3A 2ZHKA 2ZGMA 2ORXA 2UWBA 4IV3C 5KXEA 4E2GA 4BQ1A 2JG9C 3OUHA 5F9TA 1UZWA 5C6CA 2UU8A 5IAVA 3ECQA 4HXCA 2E7AA 3ATGA 3DL3A 3MPPG 2R063 4K21A 4ORFA 4PCRA 5DABA 3C7EA 4Q0UA 4N53A 1ULPA 2ARXA 2DCJA 1PIV2 2ZGNA 3O12A 4JGYB 4BWOA 2VC9A 2FCUA 5A3MA 1SLLA 3KF3A 4S2DA 3RFRA 4CP0A 4BK5A 4O7XA 2FHRA 4BLJA 3K4AA 3ILNA 4NRPA 4XMAA 5FAXA 1ALYA 3ETPA 4XOGA 2FDGA 2FZ2A 3JD72 2LS6A 1W04A 2XQRA 1C4RA 1MQTC 3AKQA 3L9JT 2LTNA 4Q4V3 1GBGA 1ZZCA 3O1UA 2EXJA 5DZGA 4C1WA 3WNOA 5GZDA 3DPRA 3QACA 5K0UA 3ZYPA 5J48A 1J83A 3J7LA 4WZCA 3VBOC 1Q8QA 2XONA 2FCTA 2AACA 4CDWA 3I8TA 1YO8A 3MIBA 2X05A 5A1LA 2R1BA 1IS4A 1EV12 2JDYA 5FBZA 4CP1A 1GOFA 2WKKA 4FQ4A 1TVGA 5I0UA 3VBFC 3N35A 4Q1PA 4LKDA 1GWMA 1PIV1 1TNRA 2C26A 2VZVA 3OGSA 3M1HA 5T54A 1G9BA 3HVDA 1A8MA 1NCQC 3OBTA 4P9GA 1BEV2 2WLPA 3VZOA 4LA3A 2X5IA 1RUF2 4CU9A 2R49A 2BOJA 2MEV3 3UL2A 5JR2A 2WO2A 2WWSA 3ZXKA 1BVVA 1XU1A 2UYBA 2A6XA 1YQCA 2ZEWA 3GCWA 5FP4A 5BNNA 3GBWA 2QKDA 3KVAA 3NNGA 2VCBA 4RYDA 5JSOA 5FWJA 1HRV3 1VIWB 1LOAA 4I09A 4QPGB 3D4KA 4D7SA 1OPMA 2YV8A 5A6XA 4JKKA 5FXVA 1RJ8A 3ES1A 2O14A 3LWCA 2IWGB 1KS5A 1AX0A 5FY9A 4BLIA 4P5HA 5LRSA 4PQQA 3LOBA 1REDA 1XQNA 3MO4A 3PLQA 4P02B 5IW0A 5FDBA 2LRPA 4XF3A 4G9SB 5DPNA 3KT4A 4ZS3A 3WDXA 3WT3A 4Y1YA 2ZGTA 2ZEZA 1ZBE2 4EROA 2P1BA 5GJ6A 3VBRA 2TBVA 1DYOA 1GFF2 4BU2A 4Y22B 4MV2A 3HBKA 1O91A 1PK6A 3KS7A 1HKDA 3N9NA 3AM2A 4UBGA 1Y4WA 4QQ2A 3ZLIA 5HCBA 2BP6A 5A32B 4RHV1 4RL7A 3ZDVA 4CDQA 1FNYA 5ABJA 2WNVB 4MXVA 4XUOA 4EWDA 4QU1A 4LUKA 1EYBA 4LK6A 4AVSA 3UKTA 2VR4A 4CCKA 5CFDA 5FREA 1TE1B 4NOTA 2DUPA 3FC0A 5DDJ3 3RMXA 2YU1A 3MW4A 5J98B 4AAPA 5GKAC 4PIZA 4XFAA 4EN0A 2XXZA 1NG0A 2DF7A 1LHWA 2DDUA 3SQOA 5LA1A 3R4SA 3ZSKA 3SITA 1Q8PA 2D5HA 3A21A 3ZXDA 2Z5WA 3MW2A 4QB6A 4ZS2A 1FV3A 3RG0A 4MGZE 4XXPA 2QDRA 5FMDA 5IK5A 1YXWA 3BI3A 2XJUA 1C8M2 5EJ3A 3R4UA 4UWDA 1KS4A 1ZA7A 2JX9A 1CX1A 2CDPA 1CX4A 1ND2B 2B42B 4QHZA 1E5RA 2DUQA 4XZPA 4DIQA 5KHHA 3ZXEA 1UOGA 1WCQA 5GLUA 2A3WA 1B35A 1PMJX 1VBA2 1YQ8A 1GZWA 1V6LA 1W6QA 2G9FA 4KI5M 2QBXA 4Y5SA 3M3EA 3WF4A 1XU2A 3I2FA 4OMDA 3VD4A 1VBB1 1LGNA 5HCHA 2RM21 3B3QE 3T30A 1MZEA 1MR5A 3S30A 4QDRA 2BTVC 2VU9A 1Y43B 3NWKA 2AGSA 5A7OA 1C8M1 4RS5C 4LLFA 1CIWA 3AL5A 3VBSB 2Y38A 2Q30A 3POFA 5DXDA 2WS93 5ANQA 1VBA1 4I0WB 4CU8A 2R32A 4QKBA 4QQHA 5CA6A 1J1TA 2EICA 2PQSA 2NQYA 1LHNA 1AF9A 1IPSA 1CZTA 2VXJA 3NSTA 2J42A 2X53S 4FOVA 4IERA 1OI6A 1W2AX 3INAA 4Q5OA 1O4ZA 4L92A 4OHYA 5FXWA 1AYN1 4GMP1 3H0OA 4HZFA 4UFMA 5L9BA 3T2PA 3WNNA 2H0VA 4NWVA 2Z42A 1BXHA 2DFBA 1NY72 2ZEXA 1LJ7A 2G9ZA 4IV3A 2VBDA 3I3QA 1RUC2 1N1SA 1PNFA 2WQ4A 3GHNA 2YUEA 1SLAA 1JTZX 2JG9A 2KD7A 4XMIA 5FZIA 3U0ZA 4QDSA 3VHOA 1S2KA 5FP3A 3MDPA 4NRQA 3N4MA 4Y5TA 5EPAA 2GH8A 2YMZA 4FAHA 1DCSA 3H8XA 1LR5A 2QQJA 1Y9MA 1OHFA 4K1YA 4GWIA 5EYYA 1POV3 1KFUL 4GB32 5AVAA 1YUDA 5GLVA 2DCKA 4IV1A 3I2JA 2VQTA 5A3PA 2WWJA 2LROA 2W9XA 4H55A 3PUQA 1IQAA 1MQTA 4AEMA 1COV3 5LA0A 1CN1A 3RWKX 4GH4C 3ZPOA 3NW4A 2VCCA 2WAAA 5CU1A 4QX2A 4D6QA 1UU5A 2P17A 3BIWE 4LE3A 3VBOA 1YFWA 1PNGA 4MSVA 1HRI2 4XBQA 4CRQA 4FP2A 4LHKA 1J84A 4Y24A 3IDAA 3R05A 5FP8A 3SLIA 3ILFA 5FQ0A 5JXGA 3KCYA 2VNRA 1UF2C 1C1LA 1H6XA 1LECA 1QJY1 5IT6A 1PX4A 5FZHA 1NOVA 4BK4A 1UOJA 1WLTA 2QCSB 5T5OA 3GBGA 3MIDA 4HKWA 3H3UA 4QDQA 1ZZ6A 4BQ2A 1G7YA 2Y8KA 1DHKB 2ARCA 2EAAA 1LULA 2XJVA 3ZMNA 1F9KA 2YZ4A 3A23A 3VHPA 4DXRA 4XDOA 1R092 3PVEA 1W8OA 2E6VA 5IUQA 4AF9A 2R072 3VKOA 4LHSA 3FL7A 2BVBA 1FYUA 3SNMA 4W6YA 5IVCA 3KWVA 4XJZA 2ZXQA 3C2UA 2P3YA 4M01A 2K9ZA 3RS6A 2BFUL 1PIV3 1U5XA 4EWAA 4KGQA 3V0AB 1HXS2 1ZM1A 1F31A 1CAXB 4MXWA 1VRH3 1YRZA 5BNOB 5C4WC 5C71A 4CP9B 4LIVA 2GC3A 4OI4A 5FYCA 3JD73 3VBHC 3ZFGB 2BBVA 4KWLA 1D4VB 3WF0A 4EZ4A 4Q26A 1XXNA 3QH7A 4RR3B 4N9HA 4I0AA 1O6UA 1HQWA 3K77A 2BWAA 1QQP2 2F6BA 4XJUA 3ZX7A 1WKYA 4AVAA 1EV13 3OCPA 4XE9A 4EV0A 5AVPA 1H4GA 5BYNA 1YHFA 3W59A 5FYYA 4N43B 3WDWA 4BXSV 5J37A 4MOAA 1BEV3 1NLQA 2YFZA 2AUYA 3CEWA 2K2SA 3GJBA 5FPZA 1RUF3 3AP4A 4Q27A 1LEMA 4AW7A 4HG6B 3KB5A 4YVSB 1LGBA 1V6JA 5I0TA 3ZXAC 2ZBJA 5T3NA 4Q8KA 3UESA 1FOD3 1AR82 5IK8A 5CG9A 5I0SA 3FHAA 1W8WA 4FPKA 4TZDA 4BMEA 5C7GA 5A6ZA 2JDAA 3I3BA 4Q4X1 4AE2A 1OXCA 2J1AA 5CB7A 4D0QA 4YG3A 3RZHA 4NIGA 4IXLA 2HWF1 1YQ6A 2VTXJ 4OCTA 4IEWA 4W50A 1H2MA 3GHMA 3NKTA 1YIPA 4OI0A 4MZUA 4OI2A 1N1YA 1ZBE3 3B69A 3POIA 2CAVA 2NMNA 2Y26A 1GZCA 3BTAA 3T0BA 3T0AA 5GZEA 1CONA 1XYNA 2XJTA 3I2DA 4QQOA 4BE3A 4CCEA 3ZN4A 4CUGA 2FDHA 4H2AA 4WVVA 3E5UA 1X50A 1YYNA 4JHZA 1AR81 1OBNA 2W68A 2BU9A 1R64A 3NJYA 1VMHA 3NV3A 1UWWA 1RITA 4PI0A 4V2WA 3A4UA 3UGFA 2ZGKA 3J7NA 5C3RA 1UCXA 4RS5A 4A7ZA 1OOPB 1TQ5A 2D3RA 4LBQB 1FT9A 2W1WA 3MEPA 4QGNA 4LBNA 5HBAA 4U36A 1JODA 1NQJA 2CNAA 2DTWA 4IUGA 1SCSA 5SV8A 2W52A 2PLV3 4Z8BA 3THDA 5FLHA 4QX3A 4CDUB 2GN3A 1CJDA 2RJ2A 1NCRB 2RVAA 1EUUA 2WWUA 1YI7A 2WNUB 4WM7B 2OX0A 4Z82A 2WN2A 4JDOA 1GR3A 1GANA 4Y3OA 5I91A 2RG4A 4YVWC 3HJRA 2DVGA 2KM2A 1AR92 1Q3EA 4FFIA 4XBLA 2WZR2 3LAGA 2WSVA 1IOAA 3WDYA 1R1A2 4BMBA 1JZ3A 2EALA 3GCXA 5LBCA 3HPNA 5KC6A 1QXRA 3DYPA 1WW7A 4P9IA 4K20A 3I7DA 1J1LA 2CL2A 2JDPA 3OBRA 5E1RA 5APAA 4TLGA 1ULFA 1UY0A 3M4FA 1OUXA 4XIOA 3SH3A 3G6JB 4E4ZA 1T6BX 1N3OA 4GMP3 4UW3A 4CXYA 2BUKA 2PAMA 2PQQA 2MNGA 2E9QA 2YC2A 3TEXA 3TEYA 4J25A 1NA1C 2W1SA 1VLNA 2CYFA 3BCWA 1KJLA 3S6PA 3S57A 2CWMA 4M3CF 1JOPA 4LQRA 1UU4A 2JKXA 4OUMA 4LOTA 3WHUA 1QGLA 5AC93 1JW6A 5GLWA 1IKPA 2D6LX 4HOOA 3RYPA 5JI9A 4L99A 4K8FA 4YW5A 5FYIA 4AVCA 3TNPB 2ZZQA 4XUNA 3UKNA 3HNBM 3AJYA 3NJXA 4HT1T 4L8QA 1NQDA 2VXRA 4LORA 2BERA 4K40A 4NIAA 2Y33A 3LCPA 4MGTA 2I74A 2OS2A 1OLQA 2VBBA 4UT5A 3AMHA 3LEIA 4UXAA 1WGPA 1WLWA 4Y4YA 1QMJA 2WC2A 1IPKA 2B5HA 2PHFA 3FBMA 1IZ3A 4MADA 3MFAA 5F5CA 4AHWA 2HWE3 1IS6A 2O1QA 2ZPXA 1APNA 2QZ3A 3KMHA 4DY5A 4F83A 2WA3A 4WVMA 3O1OA 5FZMA 1RUC3 3USUA 2O8OA 1QF3A 2ADEA 2MPFA 3KV9A 4IQPA 4PQ9A 1W6MB 4NAOA 5FZFA 2VZUA 4QAWA 1FX5A 2PHWA 5EXOA 1FATA 2R042 2UWCA 4LJHA 3ZSLA 1O8SA 3Q8FA 4D8MA 1CAVB 1JH5A 2V4VA 3C3VA 3KT1A 1OVSA 2E63A 4N9IA 2VY0A 1H1AA 3LDRA 4GB33 3VLBB 2WT1A 1FPN2 4GJYA 4GZ9A 5A6YA 5C4WA 3WW3A 1XNKA 1VBD2 3VBHA 1OF3A 2RMU2 3AMPA 3OGRA 1RTVA 3LIGA 4LHLA 3B7MA 5A7PA 3VKFC 3RZJA 1PGL2 3X29B 2D44A 1YNAA 3AYEA 4XZUG 2ZCWA 5IVYA 1OD3A 1RHI2 1W8FA 3IPVA 5CAZA 3I2KA 1HRI3 2HEWF 1US3A 1A78A 4QPGC 4Y1UA 1K12A 4TWTA 4XTPA 2R041 4E2QA 4YZ2A 4H7MA 3LIHA 1YI9A 1PO23 4YPJA 4B3NA 4I01A 5IATA 1O3RA 5C3OA 4HKLA 1BK0A 4L97A 1SFYA 2NMOA 1WCDJ 5EP9A 1LTEA 4LULA 4LO7A 3V0BA 4AG4A 3PMSA 5C8CB 2B4KA 5JIAA 4P9XA 1UXXX 4XBNA 3WF3A 1VBD1 3MIHA 2RMU1 3H3ZA 1VB2A 3MICA 4BA6A 4A4AA 1R093 2IXHA 3WR0A 4LBMA 4C0HA 1KJRA 2R073 4LEJA 5JSRA 2ZGQA 1V6IA 1RHI1 1NUKA 1LOGA 1Z7S2 1QIQA 3CU7A 5FMOL 4NIIA 1JYIA 5HXMA 2WO3A 1HXS3 2QDNA 5F3GA 3NO8A 4E4DX 1WLDA 4XJAA 3L2YA 3U37A 1BBT2 3WEZA 3JXSA 4URTA 1HQNA 1WW5A 4YFZA 3KHBA 4C8DA 1UOFA 3T2QA 2IC1A 3NJZA 2GNMA 5B4NA 3T1MA 5C9AC 2BW8A 1W8ZA 2D40A 1QQP3 4MG2A 5BNQA 4PDWB 3IT8A 3P3NA 5LY2A 3KSCA 4CXWA 2DU0A 2J1UA 5A6QA 4AK3A 1UKGA 4JDNA 5JOZA 4JX0A 4AVBA 2BEOA 4P08A 2XQXA 1QJU2 1XJAA 2P3IA 5C5TA 1JYXA 4FFGA 3SCFA 2BYVE 1PGW2 1BBT1 2JEMA 3FE5A 3I54A 1TEIA 4RFRB 3U14A 3HQRA 4WVWA 3WQ1A 4CEWB 3CF6E 3PVOA 1HJFA 2D3SA 5CFCC 3QD6A 2IUWA 5JMOA 4HSLA 1JBCA 2A6VA 3LZZA 4N8MA 3WHTA 5CKQA 2RS52 3VZMA 1E5HA 4Y33A 3AVSA 3FMGA 1WLCA 2UY9A 2RS13 4RGGA 4UI9L 3O0WA 5CVRA 3T2OA 5FZ8A 4MO3M 3HNMA 4YVWA 5FO9B 4AVVA 4AHXA 5IHRA 1VP6A 3FZ3A 2PMWB 3Q9OA 4ZXEA 4NPMA 4HPKA 1QJU1 3NAPB 1ZREA 2B9UA 1OUSA 3VBSC 1S0DA 5CKMA 3KF5A 4NE9A 3ZYHA 1PGW1 2BNOA 3KT7A 3E6BA 1RUD1 2H0BA 4L11A 4B1MA 1K42A 4HL0A 1D4M2 3ZSMA 1UZVA 3ACLA 1LOEA 5LW9A 2PHRA 1GOHA 1H9PA 3OY8A 3K46A 1UZ0A 3PUAA 1LESA 4EJRA 2RS51 2VOWA 1ENRA 3DUIA 1FI2A 3AB0A 3OTFA 4XDQA 4OI1A 3VBUC 1NA1A 1NX9A 2XUEA 1N1TA 1DQ5A 3SH4A 1JYWA 4BDVB 1ULGA 1RUG2 1W39A 1J3PA 4UOJA 5IWFA 4QQPA 1JOJA 1BJQA 3SKJE 3E6CC 2Q8CA 3U10A 2FDIA 2XOMA 3FUQA 2XDVA 3M8LA 4DPNA 1FMD2 1AL22 2RDSA 4JDMA 3URFA 1RB8G 3HIFA 1D4M1 1DQ6A 2QVSB 1YFYA 3S5AA 1W6PA 3MF6A 4OHXA 1M06G 4TSVA 1AR93 2WZR3 2VOKA 3CO2A 1PM4A 2B39A 1R1A3 4WM8B 2WNOA 1NE4A 1RUG1 3THPA 1F5FA 1K5MA 3WQBA 1RUJ2 1CAUA 1EPWA 2WO7A 2VMEA 4J1XA 1JU4A 4ARYA 1L7LA 4FO9A 5G04L 3H8OA 3LDKA 1UY1A 1NLSA 2WJSA 2ZEYA 1W6OA 3VZLA 3W21A 3TYJA 1KD7A 4Y1XA 5E89A 1GZ9A 4FXGB 4EN9B 4HONA 4IEYA 4ZZ5A 4FPYA 1LU1A 3TB0A 4D6SA 1AJKA 5FMBA 4LBQD 1LOFC 2A75A 4AFDA 2SLIA 1GWKA 3E5XA 1WWYA 2OPKA 4UF0A 4X6RB 3LPGA 1W9YA 1S0BA 2E26A 3TBDA 2C24A 1LOBA 1V6NA 3ZOIA 3FHQA 4UFLA 2SBAA 3DKWA 4XC9A 2GP5A 3IB3A 3W5MA 4IEXA 3CMGA 4JC1A 5DN2A 3OYWB 2R0FA 2W94A 4K3UA 1EUTA 1PVC1 1XRUA 2OPWA 2WYFA 2WUHA 3F95A 3EO6A 3I97A 4HSJA 2PTMA 2QQWA 4UYBA 3ZSJA 5CYYA 3POEA 3FHIB 4A7KA 4GULA 3I3MA 5JVVA 4K7JA 5K4LA 1H2KA 1VBE2 2HWB1 4AGVA 5FYBA 2YBKA 3DN7A 3KD4A 3VKNA 3IAQA 1SPPA 1Q8SA 3VDDB 2ZOEB 2WIIB 1O7FA 2BFUS 2YPDA 1ULOA 5GZGA 4OUEA 4XF4A 4FOWA 1I5PA 2WBKA 4OMCA 4GQ7A 4XFCA 4Y22A 2DWRA 4PT6A 5FYSA 4ZXKA 2JDMA 3IZOA 3HN3A 4HLTA 3T4VA 4KWUA 3RJ2X 2YBPA 5BNPC 3AK0A 1LAJA 4JVAA 3O0VA 5JZGC 1SLBA 1ULEA 1D0GA 1ST8A 1AYM1 4LO8A 4GWNA 4OLLA 2X09A 3U11A 3TEWA 3RRDA 2EIDA 1RC6A 3J7HA 5F8PA 4E8DA 2BPA2 5DQ0A 1FPN3 2W39A 3OUIA 5LEJA 4Y20B 3N9MA 1VBD3 1W90A 4IE6A 2X10A 1VBE1 2ZS6B 4RQPB 2IXKA 3GGLA 4AGGA 1JZ4A 3WNKA 3M2MA 4IEUA 2OQ7A 3POYA 1W3XA 4YVSC 3BPSA 1NXMA 2Q8OA 3WV6A 1RHI3 2UYAA 4JGZB 3A0NA 5GLZA 5C9AA 4NIHA 2W2IA 2G19A 4JRLA 4IEOA 4UFJA 3DXTA 4AI8A 4E4HA 2DTYA 1QJFA 4O65A 4RGKA 3JQWA 3RZKA 2AREA 2J1TA 1SCRA 2QQVA 3BB6A 1GZTA 4RN5A 2NP0A 1W9WA 4AEKA 5DAQA 2B45X 4KNCA 5T55A 2G1MA 2EIEA 2I2SA 1ODNA 3BGAA 4RHV2 3UK9A 3WZ1A 3NV1A 3ZR6A 4CDXC 1Q5OA 3CJIB 1S2BA 4YGEA 4JTNA 1J3RA 2ARAA 1J59A 5CFCA 1Q8VA 1YFXA 1PVXA 3JB4C 3V64A 2D98A 4PBPA 4XFHA 1MS8A 1FXZA 2JECA 4FCAA 4K8RB 1JZ7A 4R9DA 1Z7S3 1XNBA 3N7LA 4Y4RA 5FJKA 3BOWA 4LNVA 3AYCA 5A7WB 4A45A 1TME1 3NNMA 3EYPA 4Q4W3 4WBBA 2YC0A 1N47A 1V00A 5JOWA 3I2HA 1WZXA 2A70A 3D82A 1BBT3 2D5FA 3USSA 3FFZA 2UY8A 1I9RA 3B00A 2JDHA 1W2OA 1H1IA 2IFRA 2RS32 4FPCA 3VBSA 3VL9A 1OD5A 2IFWA 2ORZA 3HNYM 1GYKA 3TOJA 3J26N 2A6WA 4OYUA 1UIKA 1UY2A 2C4XA 3B9IA 3GYDA 5A7SA 4URAA 4PI2A 4AQ2A 2D6KA 4HN1A 3POJA 5EJ1B 2OZJA 4CTEA 3H1MA 4XIKA 4CDUC 3J9SA 1BVP1 4I3GA 1NCRC 3ZKUA 3ZO0B 4PLMA 5C33A 2WNUC 3RZMA 4WM7C 1IS3A 4CUCA 1L7RA 1OH4A 2B46X 3BPZA 3HT1A 4AR2A 4I2OA 2QNKA 1WBFA 3PDQA 1VRBA 2G4IA 3PUSA 2YYOA 3VBUA 1VBB2 4N53B 5F3CA 2RM22 4AL9A 4YW6A 1OQ1A 3RZZA 1ZA4A 2R7EB 1W05A 3GZAA 1UMZA 2RS31 2XH6A 3W58A 2ZHMA 1ONAA 2AEZA 4QXHA 2YBSA 4J1WA 5CBLA 5DG1A 3LFMA 1MZ5A 1CPNA 2FDJA 3J8F2 3WF2A 4KU7A 1P8JA 1W28A 4NO4A 3M3QA 4CCNA 2VCMA 4CUBA 1LKNA 1Q8OA 2WT0A 3HR9A 2F4PA 4OZOA 4CDWB 1MS9A 2RR11 2V72A 2VUDA 1POV0 2VNVA 4XJWA 5FZKA 1SDDB 3WLUA 4TYSA 1OKQA 2FMYA 1LB2A 3LOIA 1D2QA 1H8TA 1ENQA 4M3CA 4BM8A 4G4FA 2ZGPA 3ZXFA 4UW6A 1HV1A 4I0BA 1HB2A 3T0DA 4IE0A 2X5IB 2Q8EA 1AYN2 2F4LA 5JIUA 1D4M3 3ZXJA 4B4RA 1SFPA 5BNNB 4XFFA 1SFNA 2XVGA 2ZGRA 4FP3A 4LOSA 1ASJ3 1BQPA 4AHYA 3J8F1 3N9LA 4Q4Y3 5A3TA 3RPQA 3LEMA 2QQPA 3MIGA 1HN0A 1H0BA 1UIJA 2GH2A 3O5SA 3BODA 4XUTA 4A3ZA 4DMIA 2VZQA 4A6OA 3ZYGA 5GZCA 1BHGA 2YG0A 4OQ9A 2VOTA 4LUMA 1LOFA 4FOYA 5D8AC 5C3PA 3ZYRA 3IM0A 3ETQA 2XWBB 2JE9A 4JHTA 2WQ8A 4XVHA 3WCSA 3UGGA 5EIYB 3GJAA 2JDKA 1FMD3 1AL23 4FPJA 4YM1A 4DO0A 2FZ1A 2AH2A 5JXIA 1PK6B 2ZAAA 2JKBA 3ZFEA 3RSJA 4AGRA 1OPOA 2JJ6A 3MHZA 2VZ1A 1BLZA 4FOQA 5A3OA 1GQGA 1JN2P 4R9CA 4R4XA 3TN92 1XOYA 3QOPA 1PO11 2JICA 3MFCA 2WLQA 4YGDA 4CDQB 5ABJB 4AQ6A 1XBFA 1YWKA 3POWA 1DGWA 4EWEA 5CFDB 4E4SA 4XILA 5CKNA 3O1MA 5KXCA 4ET7A 2D6NA 1V6MA 1N3PA 1RUJ3 1KXGA 5FZGA 1JUIA 5HPOA 1LU2A 3BUCA 1OC1A 3Q8AA 3BN6A 1QJY2 4P9YA 4BZ4A 4EYUA 3W5NA 1SBDA 5BNPA 1DG6A 3AJZA 1ZRIA 4K1ZA 5JZGA 3M3IA 1UMIA 2GMEA 2VZPA 1O3SA 1MZFA 5ACA2 3APBA 3B02A 3WF1A 2Y64A 1NXD1 3ACHA 2ZKNA 1XE8A 2JG8B 5I8SA 5KHJA 5A7NA 3TN91 2VZ3A 2XJSA 3IMMA 2ZABA 3J4UH 5C8CC 2W95A 2WRAA 2HWC1 1F4AA 1H4HA 3D8CA 1RUOA 1AHSA 3ROUA 1QKQA 1KFXL 1KITA 1WCSA 2XBO2 1OKOA 1XNCA 2BOIA 2PAKA 4M0HA 3PU8A 3RWNA 3VBFA 1KGYA 4YW7A 4AXOA 1B35B 2P2KA 5FY8A 2IXIA 4NN0A 4SBVA 1W6QB 3THTA 4XABA 5A70A 1NCQA 3CHXA 1MVEA 1Q43A 3RI8A 3T4HB 3RGBA 5HV4A 1W9SA 3G7DA 3TEZA 2VG9A 1ZBA1 3VN4A 4PLNA 1VBE3 4R9BA 5ACA1 3NV4A 3ELNA 2NLRA 2VULA 1W6NA 3MBWA 2BNMA 4QHOA 1Y7BA 5F3EA 5FMOS 4E8CA 5A3LA 3K48A 3WXPA 4CDXA 4CPBD 5FOJB 3KV6A 1GNYA 3NKGA 1GSLA 2LALA 1YFUA 4ZONA 3AFKA 4CEYC 1S0EA 1WMXA 2O8QA 2PXJA 4PBOA 1HIXA 4QWNA 4QXKA 1T2XA 5KBFA 2XBO1 3LB9A 3M70A 5DG2A 3RI9A 5GALA 3NL1A 4COZA 2WNEA 4COYA 4IEVA 5FBJA 1NE6A 4YWAA 2DBNA 4W8JA 1UYYA 4LE4A 5TSWA 4BISA 1SZBA 3RZGA 3IDBB 4LR4A 4B7KA 4W6WA 4Q4X2 1UU6A 3JZVA 2OW4A 5FZOA 2HWF2 3ACIA 1WW6A 3ZMOA 4YW1A 3MLLA 1JZ8A 4Q0SA 4IV3B 5CNAA 3H7JA 1UX7A 2Q1FA 2AENA 4WM7A 4BQ5A 4KH9A 4BQXA 3CJXA 4RD7A 2ZGLA 3BTXA 2A3YA 3M3CA 4PF5A 4OVEA 2EXHA 2VOVA 3PHMA 4KU8A 3O14A 4RHV3 5LBEA 1QJX2 3WP6A 1JOBA 3NAPC 3PIJA 3BU0A 3J7MA 4JQTA 4Q2FA 4IV1B 1W99A 5LATA 1DYPA 1L3JA 1U12A 1RUE1 5JOXA 1RMU1 1R1ZA 3PTRB 1MQTB 3WUCA 4AAXA 2JD9A 1UYZA 1DU3D 2WAOA 3JBG1 3GM8A 3VBOB 1FAYA 4V1PA 4C91A 4GMP0 4P9JA 3ZFFC 1H9WA 3I2OA 1AX2A 1W0OA 5FQ0B 1N1VA 4HANA 4QKDA 4AHZA 2RS33 3WY6A 3ZVXA 3HOBA 4ISQA 3SH5A 3WP5A 4NIDA 1EAH2 3D6EA 1QJX1 1ZZBA 1RUH2 2IXJA 3JB8A 2VMIA 4FT8A 5HCFA 4CU6A 3DF0A 3K4DA 3Q8CA 3ZYFA 3RYRA 2W3JA 3T3YA 3VB9A 4GKXA 2BZDA 5K8SA 4FFFA 3RQ0A 3VKMA 5LEKA 1XNTA 5FIXA 2EA7A 4QPIC 1STMA 1W9FA 2Z2SB 1SEFA 2HJIA 1DGLA 1QOSA 2V5DA 1VBB3 2ID4A 3IN9A 4Y1VA 2I45A 2ZMNA 2RM23 1BKZA 3IIAA 4IDZA 3W20A 2VVDA 2A7AA 1A6CA 3P3PA 2KXLA 5D8AA 1QNWA 5FY0A 2D6OX 4LLOA 3VHRA 5DAWA 5CEHA 5J36A 1XSQA 1AR62 1YQ5A 3WDUA 5CADA 3OF1A 1V0AA 4MXWB 2VCAA 5DZFA 3WG3A 5DUVA 2ZX2A 1IPJA 2W91A 1EAH1 1RUH1 2WYSA 1Z0HA 1C8M3 1YJLA 2JB4A 4YG0A 3BIEA 1H2NA 1ZRRA 4DOUA 4XAAA 3KZ4C 1MEC1 3UV9A 2VVFA 1X9TA 5L7OC 1VBA3 2WT2A 2XMLA 3N3HA 3KVBA 3SXWA 2VZOA 4LO6B 1JUHA 1RINA 4ES9A 1CZVA 1LCLA 4NUBA 2CTVA 3AKSA 3O0XA 1LGCA 4CCMA 1ZRDA 4YG6A 3WVJA 3I3EA 1AR61 4H7LA 1AYN3 5FYUA 2C0ZA 2CGOA 2VAUA 1VMJA 1G9AA 5KXDA 3UNPA 5LASA 1ND3C 3ZN6A 2CSGA 2YY1A 4GH4A 4ZY9A 4QU2A 3WP3A 4YM3A 2EAKA 3H50A 5FTTC 3VDDC 2RV9A 2UWAA 4NHLA 1QH6A 4MYEA 4AFAA 1O5UA 4S2FA 4WZFA 4A42A 5FJHA 4JGYC 4H14A 4XDPA 1BMV2 3ZM8A 1RXGA 4XHBA 3JU9A 4RGAA 3OGJA 4FBFA 3UJOA 4E27A 2E33A 1E5SA 4M4PA 4Q0VA 3KCCA 2QE3A 4UW5A 4Z1VA 5T5PA 2DVDA 2XLFA 1L7QA 1EY2A 3OEBA 3WUDA 4RQPC 2VH9A 1TNFA 1OA2A 2VGDA 2YGMA 4AQSA 1SDWA 3FN9A 5F3IA 2W5FA 4RS5B 5LCWL 4CEYA 4LT5A 2XG3A 3PVNA 3C7OA 1QJY3 2ZGUA 1CVNA 1WBLA 2GSYA 1CGPA 5BXXA 3SMHA 2QQLA 5FPBA 3AXEA 1YIFA 2Y6GA 3GF6A 3H42B 1BMV1 3O7OA 2VUCA 2O0OA 3CZJA 3WNPA 5EV7A 1AR71 1REFA 2J22A 2VZTA 1GP5A 3K2OA 5FZCA 1V6OA 4QHBA 3R0RA 4M0NA 3H8RA 4YW3A 3HWJA 1WUVA 2R6QA 3LPFA 5FUPA 1NKGA 4OQ8A 3AKTA 3LGRA 5FCCA 5LK7B 3CJIC 3MPBA 1CAWA 1DF0A 2PHDA 5E8AA 2C6SA 1HX6A 3ZSEA 1R082 2GALA 3WDVA 3N9OA 2C1FA 4L9BA 4EN8B 1TMF2 2AR6A 2B8MA 4A41A 1XPWA 2CDOA 3EHKA 3H1WA 3DYMA 1ZVFA 3ZN5A 3UKVA 3L2HA 2AYHA 1RVF2 1DLCA 4I30A 3AVRA 2R061 3H9AA 1OLRA 4C0BA 3NAPA 4CA9A 1JMUB 1ENXA 1OQDA 1VR3A 4QXCA 2VBPA 4YSFA 2PHUA 3FLTA 2Q1ZB 3OGGA 4FTSA 2WNVC 2E53A 2DBIA 1IG3A 3WW2A 1K3IA 2VMFA 4FPFA 4FSJA 5F37A 3EQEA 1OQEA 3AMQA 3IBMA 2XVLA 4YGBA 1R081 3RMYA 2EXKA 4COWA 3O1SA 1W2TA 3PURA 2Q0AA 3AZVA 3LE0A 5GLTA 3S0MA 3QBQA 1TMF1 3IDCB 1N3QA 1HRV2 3ZFFA 4IE5A 2EXIA 5EYXA 1CQ9A 1OH3A 1UZZA 1AXYA 3PTYA 1VAVA 1Y9GA 3T1LA 4OHZA 2YDEA 2L9LA 3WQ7A 2GC1A 3Q8EA 2Y6LA 4A7YA 1J58A 5I0RA 3O1RA 1RVF1 2QQOA 2XJRA 4META 4Q4X3 5FPUA 2FQPA 3E97A 2ADDA 2VMHA 4M3CE 4XF0A 3WDTA 2HWF3 4LBLA 4LBJA 3S7IA 4F7ZA 5A33A 4CU7A 1F15A 3OEAA 5B2GB 5IJRA 2IZWA 3LEKA 2GAUA 3USUB 2HLEA 2VJXA 2MEV1 3B9CA 5ERLA 1ND2C 1G86A 4FI9A 5D21A 1WA6X 1W8UA 1MS3A 4QPIA 4CE8A 2B7YA 5JPMB 1NZIA 4YFWA 2J7MA 1RUD2 2XWJB 4YZ5A 1ZRFA 1HRV1 3POSA 4OHWA 4UFIA 5I8YA 1GKBA 1V70A 2TEPA 1AR83 4XURA 2ZKLA 4DB5A 3TNQA 4LO4B 4ASLA 3ON7A 2VM9A 4B4QA 1J3QA 2OYZA 1QXPA 5C4WB 3RZLA 3VBHB 1W8HA 2OQ6A 2X5IC 3OSDA 2VL4A 2E7QA 4V2VA 1XE7A 4XTMA 1S0JA 4COUA 1IGOA 5IAXA 3BYWA 3DGTA 5FY1A 4B29A 1BYHA 3OD0A 4EN6B 3IPVB 3VDCA 4AI1A 4E2SA 5L7OA 3CLPA 2ZGOA 4IE7A 5FZ9A 4NWWA 4BCUA 3I49A 3GZUC 2VMDA 1XYOA 1H6YA 4QKNA 1KDMA 3NVCA 1UY4A 4QX8A 5IVJA 4FQZA 4R9AA 1F4HA 4Q8LA 3LA7A 4AI2A 2BGCA 4FPLA 1ENSA 4MGIE 4QM8A 5C5UA 3V0BB 2VO5A 5DDJ1 5L9VA 3ACFA 1DZRA 1K45A 3MLJA 4YZ1A 5KWRA 2YU2A 4X6QB 3BVCA 1JXNA 1UNBA 4Z2AA 1DIWA 2PYTA 5JDBA 1IS5A 1PK6C 1W8NA 2JDNA 4AEDB 4FTEA 4JRAA 1W2NA 3AP9A 3ZPYA 1QJEA 4QB1A 1ND3A 2JENA 2VD7A 4XXAA 1UN1A 4CCJA 2GC2A 5AFEA 4FXKB 5L73A 4CDQC 2CY6A 2NPIA 5JLVA 4DFSA 3WW1A 1I3HA 1VBC2 1MZ6A 3BTYA 1H1MA 4R4ZA 4K6BA 1O4YA 2XKPA 1EPZA 3WW4A 1NLRA 5FYHA 1OA4A 1QDOA 3FLRA 4QX1A 5KHKA 4JGYA 4PIYA 4DZGA 5HCAA 4D7YA 2C9KA 1GUIA 1XB9A 5F1RA 2A6YA 4KQ7A 1W8TA 2JIJA 2Y60A 1HB1A 2WS92 2VMCA 4JAAA 1W0NA 4NMIA 2W1UA 5D2AA 4LIUA 3SEEA 3UETA 4DXSA 4EQVA 1JZ6A 4A2UA 3O1PA 1SLTA 1D0HA 2JG8C 1V6KA 4GAZA 4IEPA 1RGSA 3MLKA 4QPWA 1A8DA 5FZ4A 3I3DA 1C57A 1PVC2 1VBC1 2ARBA 1SBFA 4EN7B 5F6KA 4OFGA 4ATEA 1X33A 5F7UA 1XNAA 5IYYA 1X8MA 5K7PA 4MUVA 3THCA 1UPSA 2HWB2 3LF7A 2VNGA 2JWPA 1F5JA 4P9LA 4O61A 4RFT0 3VD3A 1UW8A 2E31A 4GKYA 2RJKA 3SCGA 4XFGA 4TXWA 1U5ZA 2ENRA 4YZ4A 2Y6FA 2WS91 5FMCA 1XC6A 2CGNA 5J1XA 1GU3A 2R30A 2HYKA 3OPZA 1QXJA 2H6CA 3MGUA 1UYXA 3OGVA 1DQ2A 3MV11 2DU1A 4FPHA 4YVWB 5IFPA 4Q0PA 1AYM2 1X9PA 4QPGA 1EP0A 2WZ8A 1B09A 3P6BA 1JZ2A 1RUNA 5FOBB 4W65A 3VV1A 4HPKB 5IVFA 2GZWA 2XKOA 1DGRA 2XR4A 3DV8A 2ZA9A 1POQA 3B5LB 1WMDA 2PHTA 2OUHA 2P3JA 1UO9A 3H7YA 4UW4A 3ZYBA 4YW2A 4AEJA 5BNOC 2BVVA 1HDKA 2XGXA 3ALQA 4YRDA 2D6PA 3ZFGC 4D94A 3N7KA 3OY8B 5F5IA 3K75B 2W08A 1OFSA 2Y0IA 2YFUA 4CCOA 3I59B 4RR3C 3DECA 5LWBA 3O1VA 2R043 4KG8A 1SG3A 4TN7A 1F35A 3OBZA 1NA1B 5E16A 5A32A 1SBEA 2WNVA 5I8TA 3T09A 1POV1 3DXUA 2WZEA 1S0GA 1D2SA 5CG8A 4N43C 1QDCA 1X8EA 2VZRA 4DUXA 1OFNA 5FRAA 3WCRA 1COV1 2VW2A 3K51A 1DP0A 2ZMKA 2RMU3 2OXBA 4AWDA 2VW1A 2KR2A 3AKPA 3AP6A 3A22A 2Y6HA 4NPRA 5CISA 1ZZ7A 5LA2A 2XLAA 1GWLA 1W6PB 1VAMA 3GBFA 5LB6A 3PJQA 2D6MA 4ZPIA 3WSOA 1TME2 3DEMA 2WR9A 4IV1C 4ARXA 1VRH2 2HWD2 3CKHA 3OUJA 4ZZ8A 1LHVA 1R083 4JV4A 4XFIA 4F3JA 1K5MB 2DVAA 3K3NA 1TMF3 2GNTA 1C1FA 1CAUB 1ND2A 1RJ7A 2W47A 5EJZB 2DURA 4IEZA 4IETA 2XL9A 4XHXA 4BHPA 2B9VA 2QJVA 2JE7A 2LM3A 2ZX3A 1QJZA 1RVF3 1W6OB 2VNOA 3PJYA 5FZBA 1MS0A 2QQKA 1FNZA 5H9RA 1XYPA 5DUXA 3S7EA 4DUVA 1PZ7A 4IGOA 2V09A 1GP4A 3WOGA 4D69A 2AZ5A 1A34A 1JS9A 2P6CA 2E7TA 4P5YA 1VRH1 2HWD1 4UF0B 2CU5A 2D97A 4QGMA 4QT6A 3JD71 2W1QA 1PHMA 5DUUA 1VMFA 3ILRA 2D3PA 1OOPC 3I2IA 1FOD2 1RUI2 5J7MA 3KCXA 3QCWA 1Y9QA 4HVOA 4JKMA 3B01A 1DGRN 4ZHNA 4B7EA 2EIGA 2OZ6A 4MGYE 1EV11 4BIOA 3C7FA 4LA2A 1X82A 4ZKTB 2D43A 1SPPB 3B94A 2RR12 1BEV1 4DQAA 5F2SA 3ZXLA 1RUF1 1Z78A 5B4XA 4AVTA 1DYKA 1QJU3 2A3XA 2IVJA 5JAXA 2HBUA 4YNIA 3OJBA 3K3OA 3VD5A 4GWMA 4GWJA 1QEXA 3NNFA 1C8NA 3GZEA 1RUD3 1FOD1 1RUI1 2WA4A 2FDFA 3FFQA 3MW3A 3OBAA 3HMYA 2BNNA 2J1SA 1U5IA 3OOXA 1HJGA 4TLFA 2WO1A 4IL7A 2W46A 5IK4A 2ATFA 2RS53 4BQYA 1I6XA 3DPRB 5K0UB 3VHNA 5FP7A 1X36A 3DYOA 4QPYA 1ZBE1 1SHWB 3U07A 4C90A 1QU0A 4P00B 3EB7A 3NQHA 3SHRA 4IESA 2PLV2 5C9AB 3MUZ1 1UKRA 3OPWA 2MHFA 1OURA 2XJQA 1UYPA 2D93A 3N9PA 2DFCA 2JG8A 3NMBA 3NNJA 4QMAA 5BY5A 5ISLA 1HB4A 2ZHNA 4KG0A 4FAGA 2ETEA 3CQOA 5FPLA 5FLIA 1V9U2 2CGPA 4S2HA 2P37A 5LRRA 1PO12 5ANNA 4BQ3A 2FDKA 3BTZA 3QH6A 4X8PA 5E6HA 5KC5A 2JDZA 1YQ2A 5HI0A 4FFHA 1GP6A 4RA0A 5CFCB 4HVQA 2E32A 4C1XA 4N7UA 4Y5Z0 1RUG3 1WMEA 4XQ4A 2PLV1 2Y0OA 3VD9A 3AYAA 4IEQA 3RNSA 3IIIA 1JHNA 5IFTA 3E1F1 3MI8A 1VBC3 1TZOA 1CESA 2ES3A 1QY4A 3V65A 3VBRB 1Y3TA 2FMDA 1TG7A 2H6BA 3IKWA 5K9YA 5KXBA 1JYNA 5A7QA 2ZX1A 5JCTA 5T50A 3EJKA 4ITCA 1IHMA 2ZACA 4Q1RA 3RJRA 3V0AA 1V9U1 1GNZA 5JI7A 5AC92 5DAVA 4XF9A 5F5AA 4BIFA 4QB2A 1LODA 1CAXA 2HWC2 3KM5A 4XCAA 4O9GA 2WINB 5F32A 5BNOA 4CP9A 1G8WA 4EE2A 4PHZA 2LW8A 2I07B 3ES4A 4IE4A 2QQNA 4PIXA 4QM9A 2RE9A 4RSUA 3ZFGA 2X29A 1VPHA 5BUVA 1UPIA 2KA3A 1M4WA 4IW3A 4LTAA 1OSGA 4RR3A 4UAPA 3CZUA 5A3NA 1AUYA 3MIFA 1PVC3 4XPVA 5H9SA 2PHLA 4WV8A 3KGZA 3TAYA 3ORJA 3VBUB 4ZU5A 1ZYBA 2HWE2 1HW5A 1A3KA 1ZZ8A 4YM2A 1ZBA2 3KGLA 4GD4A 2HWB3 1PGSA 3IAPA 4FVVA 4BQWA 4N43A 1DZTA 3PMEA 4U2AA 2TUNA 4MGQA 1WCKA 5AC91 2J1VA 2P3KA 3MYXA 4FPOB 4JTOA 5EFUA 1BZWA 1JHJA 2LUWA 4LPLA 1HV0A 4YVSA 2OVUA 2Q4SA 5LY1A 5F5QA 4HK8A 4K9SA 3U1XA 3VZKA 4JZRA 1CIYA 4MHRA 2GN7A 2HEYF 4UBHA 1S0IA 5JSPA 4Q29A 5FP9A 1AYM3 1GLHA 1GZWB 3HQUA 5EHDA 3BU7A 3D0SA 2XHNA 3KV5A 4I02A 2RHPA 1H8TB 4QD2A 3FUOA 2HWE1 2PFWA 4M3CB 2DYCA 5F6LB 4EZHA 1O3TA 2YROA 5DUWA 3TRSB 5IVVA 1NY71 3OD4A 3D0JA 4AQTA 3WNLA 2BRTA 1RUC1 2J1EA 4LITA 3ZYIB 2GMMA 1GQHA 2P6HA 4LXLA 1C5HA 4NHKA 4Y26A 5L9RA 1KEXA 1NYWA 4KMQA 5KHGA 1GMMA 1C3HA 1D7PM 3JCIA 3PUHA 4UFKA 2VQUA 3K4ZA 5DAPA 1PO22 4NHYA 4NAMA 3O1TA 1NAEA 1BK1A 2XVKA 3ACGA 4PDWC 2P34A 3A0KA 3F2ZA 1JU3A 1FV2A 4GB31 4CYDA 3N9QA 1UY3A 5A1AA 1ULCA 4J6GA 3U78A 4R8HA 4AFCA 4AI0A 3ASIA 5C8WA 2K0GA 2Q1MA 1OOPA 1PZ8A 2R0HA 1REEA 3ZYJB 4LBQA 4XJ9A 1LNSA 3WX5A 3V56A 3KLSA 4XCBA 4AFMA 4CEWC 1DFQA 1RUE2 1E5IA 1RMU2 5FK8A 3TWIA 3ZFEB 1I1EA 3HEIA 1HRI1 2WABA 5BV6A 4LMFA 4YYOA 2CV6A 3SCHA 4CDUA 2BBAA 3JBG2 1PO21 1NCRA 1TME3 2WNUA 2JG9B 2HWD3 2ZHLA 3AP7A 3ST7A 3FWEA 3HBZA 3AZXA 3GZTB 1W3VA 4LBOA 1AXKA 3LA2A 5T52A 3VZNA 3PL0A 2PN5A 1VAKA 5BNPB 1DQ0A 2R16A 1R091 4HN0A 4ZU4A 4DNYA 5JZGB 2XL7A 2R071 5FYZA 1H2LA 2ZX4A 4MGSA 2Y34A 1OF4A 5FZ1A 3WP4A 2V4AA 3PIGA 5GM0A 4CP2A 2ZAHA 5IVEA 2NZ9A 1C28A 1HXS1 2OA2A 4GIQA 3WNMA 4B8EA 3U4XA 4KGGA 1MS4A 1LOCA 4FPEA 5JXJA 4NPLA 4QX7A 4XUPA 1ZRCA 5LK5A 4Z92B 4BPZA 1MACA 5FUIA 2CAUA 2DCTA 4HBNA 3VBFB 4AEDC 3WNXA 4ISRA 5DZEA 1RUI3 2WFF2 5FY7A 1WW4A 1U5YA 4KL1A 4JQRA 1PX3A 1UD1A 1XSRA 1NCQB 4CUAA 4E9KA 2PA7A 1QQP1 4INDA 2JD4A 4CCDA 4XYXA 1JYTA 2BDRA 5KR7A 3M7AA 2EIBA 2RS12 2DVBA 4QQLA 4XAEA 5G05L 3BKZA 1MEC2 1LEDA 3AL6A 4HK9A 5JOYA 1UAIA 1UL9A 3NV2A 4XACA 1W6NB 1Q56A 4XF1A 2RR13 3MF9A 2WZPP 1F8VA 5FPAA 3T08A 4A44A 4CDXB 3WG4A 1URXA 5I0DA 2JIGA 4XFBA 5T5JA 3T2TA 2WQZC 5F2WA 4OULA 3MV01 1H30A 5I93A 5HV0A 4FTBA 4W6XA 4WM8C 4AI9A 3KQ4B 2WFF1 2VW0A 1GQPA 4L0PA 5EZWA 4M00A 2YGLA 1VJ2A 3FBYA 1W6MA 4IGPA 1LENA 5E88A 1AXZA 1UXZA 3SISA 5LBFA 1IG0A 2RS11 3J8F3 1CD3G 4W4ZA 1CAVA 3LSEA 2UURA 5F39A 2VQAA 2ZJCA 1HQLA 4HVRA 1OLME 2ZZJA 4DINB 5IK7A 2P5BA 4AFBA 5FZOB 3FLPA 1XNDA 2ZGSA 4LKSA 3AZZA 4XQWA 3MZHA 1YEWA 3P5BA 4BXFA 1IQDC 5FZEA 1U0AA 1RYYA 3N7JA 3ME2A 5A3UA 1G9DA 2A71A 1MVQA 1DQ1A 3OPTA 4AYUA 3EBRA 2RDRA 4FPGA 5J09A
chains in the Genus database with same CATH topology
2ET1A 1V9U3 3ZIXA 3HD8B 4H3WA 2VVEA 3QLQA 5HXVA 1PO13 4YLZA 5CIRA 1G9FA 1S0CA 1DZQA 3E5QA 3D5OA 5C8CA 4WVZA 4OUSA 1YCIA 3ZDSA 2RJLA 4JCKA 3AMMA 1HLCA 1PMIA 3M3OA 4ONUA 3VGIA 5JWPA 4O9EA 1DQ4A 1AR72 2IXLA 2NM1A 4HETA 1QH7A 3JQXA 1AR91 5FO8B 3TN93 2WZR1 2TNFA 4BOWA 4XW3A 1JYCA 1R1A1 2A6ZA 2EVXA 2HWC3 2A5ZA 2VUJA 4LO5B 1W0PA 4PLOA 2QFEA 3BOPA 1G9CA 1KRIA 2GNDA 2VECA 2HEVF 4JGZC 2QUOA 2V5YA 2XB6C 2VMGA 3H1YA 1O3QA 4LBKA 1O5LA 1BCXA 3HQXA 4MH0E 4PDWA 4KWJA 5D1IA 5D8AB 1ZBA3 4XJ8A 2VUAA 5ACA3 4MGKE 2C5DA 3E6DA 4YM0A 2R062 1LRHA 1ZNPA 1K5MC 2VPVA 2A73B 4KBBA 4XETA 3I4IA 4CEWA 2GDFA 5H9QA 3GNEA 2XBO3 4OZXA 4YGCA 5BPXA 1DGWX 4MVTA 4Q4V2 1QOOA 3PNAA 1OA3A 2Q5TA 1S0FA 2NYYA 5FFOC 4HMZA 1S55A 1SMVA 4HKOA 2PELA 2Z69A 3AYDA 4SLIA 3WG1A 3VL8A 3W9AA 1VB4A 1SACA 4B4PA 2DVFA 4OHVA 5FLJA 4CZSA 3HAGA 4MX3A 1GV9A 4GALA 4XQDA 4NHMA 4NR1A 4Z07A 2GNBA 4BH9A 1CPMA 3ENRA 3IDEA 3ZN6B 2MEV2 4NVPA 2FBEA 2ZX0A 1KQRA 4GH4B 1VALA 1WA4A 3CNAA 4Q4V1 1FPN1 1GNHA 1PM7A 4YW4A 1DBNA 1PGL1 4S2GA 2JXAA 4N53C 2WFPA 4AEDA 2OUJA 2C9AA 3FX3A 2BWCA 1RUE3 2DCZA 1RMU3 2GMPA 3B93A 4X8NA 4Q4W2 1AX1A 1RL3A 4WVMB 4P9WA 3H8UA 4G3YC 3JBG3 2YXSA 2VQ0A 1O4TA 3ZXGA 2GC0A 3AZYA 1C5IA 1I5ZA 2ZTNA 2NN8A 3AZWA 4GXLA 4FBFA 4P14A 3DPRC 5K0UC 2YPJA 3R6SA 3WINE 2ZMLA 1OMIA 4CDWC 3JUUA 4CEYB 3KQRA 3N36A 3WD5A 4R52A 1YLLA 4COVA 4WM8A 1QJX3 4Z2WA 5DDJ2 4KWKA 4ASMB 5J96B 2DCYA 3AMNA 4DXZA 4YARA 1Z7S1 4ATFA 5SV5A 1X7NA 1YJKA 4Q4W1 4QGLA 3VKLA 2XUMA 1QNYA 2XJPA 4HFSA 5BNNC 3LSDA 1S1AA 2W0XA 5FO7B 3AX4A 1IKQA 3MIEA 1CAWB 1SQ4A 4F8AA 1T6GC 2Z79A 1AL0G 3HT2A 5FPXA 2WFF3 2IXCA 4D7TA 1EAH3 3BALA 1RUH3 3AFGA 2WSUA 1MEC3 3VBRC 5L19A 2R1DA 2ET7A 3CL1A 3OYWA 2WL1A 1H8VA 2QZ2A 1SLIA 3WG2A 2PHXA 1WMFA 3IWZA 4A3XA 1AZDA 1AVBA 1LHOA 5L36A 5ABJC 1QWRA 5J3UA 2X8KA 4DRVA 4AI3A 5CFDC 3VDDA 4DY3A 5T5LA 1AR63 5KHIA 3IMNA 3N7MA 1ASJ2 2DUOA 2XPJA 4Q4Y2 3ZIWA 3I59A 3ZFFB 3FJSA 5GZFA 2G9GA 3VUOA 1W2UA 3WQ0A 4I3PA 2HKXA 5JPNB 1ULDA 5AFBA 1F2NA 5A33B 4L2NA 2ERFA 4Y20A 4ZU7A 4RQPA 1LHUA 5JR7B 1PZ9A 4N7IA 1KDKA 1RIRA 4JGZA 4DS0A 4QPIB 2E51A 3PVBB 1E57A 1WD4A 1ASJ1 2VOXA 4COWA 4Q4Y1 1B35C 2DV9A 1NZCA 2N7GA 4Y1ZA 3LKJA 3AKRA 1H8TC 1CR7A 4D3WA 5H9PA 4LHNA 4BYYA 2XLGA 1DDLA 3LA3A 3AP5A 2EF6A 1DLLA 5JMCA 3CJIA 2XHKA 2BQPA 1FMD1 1AL21 4MLOA 3RYKA 2GU9A 1ZX5A 1G6NA 1AJOA 5L7OB 1GICA 1MS1A 1COV2 3AXDA 1AR73 1WD3A 3RDIA 1QHDA 3R4DB 4PJYA 1UZYA 2PAEA 4DRRA 4XEZA 2D7FA 3UJQA 3GALA 4QX5A 5EWSA 2ILMA 1QOTA 4Q0QA 3EXUA 1RUJ1 1SLCA 1UX6A 2V73A 1MS5A 4GA9A 4N90A 3ZFEC 2CWSA 1ZZ9A 2OIIA 2YHJA 3HN1A 3VZJA 1ND3B 1CJPA 4YZ3A 2ZHKA 2ZGMA 2UWBA 4IV3C 5KXEA 4E2GA 4BQ1A 2JG9C 5F9TA 5C6CA 2UU8A 3ECQA 2E7AA 3ATGA 3DL3A 3MPPG 2R063 4K21A 4ORFA 4PCRA 4Q0UA 4N53A 2DCJA 2ARXA 4BWOA 1PIV2 2ZGNA 3O12A 4JGYB 5A3MA 1SLLA 4CP0A 4S2DA 2FHRA 4BLJA 3ILNA 4XMAA 5FAXA 1ALYA 4XOGA 2FZ2A 3JD72 3AKQA 1C4RA 1MQTC 3L9JT 2LTNA 4Q4V3 1GBGA 1ZZCA 2EXJA 5DZGA 4C1WA 5GZDA 3DPRA 3QACA 5K0UA 3ZYPA 5J48A 4WZCA 3VBOC 1Q8QA 4CDWA 3I8TA 1YO8A 3MIBA 2R1BA 1IS4A 1EV12 5FBZA 4CP1A 2WKKA 4FQ4A 5I0UA 3VBFC 3N35A 4Q1PA 1PIV1 1TNRA 5T54A 1G9BA 3M1HA 4P9GA 1A8MA 1NCQC 3OBTA 1BEV2 2WLPA 3VZOA 4LA3A 2X5IA 1RUF2 2R49A 2MEV3 3UL2A 2WWSA 3ZXKA 1BVVA 1XU1A 2UYBA 2A6XA 5BNNA 3GBWA 2QKDA 5JSOA 1HRV3 1VIWB 1LOAA 4I09A 4QPGB 3D4KA 4D7SA 1OPMA 2YV8A 1RJ8A 3ES1A 3LWCA 2IWGB 1KS5A 1AX0A 4BLIA 4P5HA 5LRSA 3LOBA 1REDA 1XQNA 3PLQA 5FDBA 4XF3A 4G9SB 3KT4A 3WDXA 3WT3A 4Y1YA 2ZGTA 1ZBE2 4EROA 5GJ6A 3VBRA 2TBVA 1GFF2 4Y22B 4MV2A 1O91A 1PK6A 3KS7A 1HKDA 3AM2A 4UBGA 4QQ2A 5HCBA 5A32B 4RHV1 4RL7A 4CDQA 1FNYA 5ABJA 2WNVB 4MXVA 4EWDA 4LUKA 1EYBA 4AVSA 3UKTA 5CFDA 5FREA 1TE1B 4NOTA 2DUPA 3FC0A 5DDJ3 3RMXA 3MW4A 5J98B 5GKAC 4PIZA 4XFAA 4EN0A 1NG0A 2DF7A 1LHWA 3R4SA 3ZSKA 3SITA 1Q8PA 2D5HA 3ZXDA 2Z5WA 3MW2A 1FV3A 3RG0A 4MGZE 4XXPA 2QDRA 5IK5A 1YXWA 2XJUA 1C8M2 5EJ3A 3R4UA 1KS4A 2JX9A 4XZPA 1CX4A 1ND2B 2B42B 2DUQA 5KHHA 3ZXEA 5GLUA 2A3WA 1B35A 1VBA2 1GZWA 1V6LA 1W6QA 2G9FA 3M3EA 1XU2A 1VBB1 1LGNA 2RM21 3B3QE 1MZEA 1MR5A 3S30A 2BTVC 2VU9A 1Y43B 3NWKA 2AGSA 1C8M1 4RS5C 4LLFA 1CIWA 3VBSB 2Y38A 2Q30A 5DXDA 2WS93 1VBA1 4I0WB 2R32A 4QQHA 5CA6A 1J1TA 2NQYA 1LHNA 1AF9A 3NSTA 2X53S 4FOVA 4IERA 1OI6A 3INAA 4OHYA 1O4ZA 4L92A 1AYN1 4GMP1 3H0OA 4HZFA 2H0VA 4NWVA 2Z42A 1BXHA 2DFBA 1NY72 1LJ7A 4IV3A 1RUC2 1N1SA 1PNFA 2WQ4A 3GHNA 2YUEA 1SLAA 1JTZX 2JG9A 4XMIA 3U0ZA 3VHOA 1S2KA 3MDPA 3N4MA 2GH8A 2YMZA 4FAHA 1LR5A 1OHFA 4K1YA 5EYYA 1POV3 1KFUL 4GB32 5AVAA 1YUDA 5GLVA 2DCKA 4IV1A 4H55A 1IQAA 1MQTA 4AEMA 1COV3 1CN1A 4ES8A 4GH4C 3NW4A 5CU1A 1UU5A 2P17A 3BIWE 4LE3A 3VBOA 1YFWA 1PNGA 4MSVA 1HRI2 4XBQA 4CRQA 4FP2A 4LHKA 4Y24A 5FQ0A 3R05A 3SLIA 3ILFA 3KCYA 2VNRA 1UF2C 1C1LA 1LECA 1QJY1 5IT6A 1NOVA 1WLTA 2QCSB 5T5OA 3GBGA 3MIDA 4HKWA 3H3UA 1ZZ6A 1G7YA 1DHKB 2EAAA 1LULA 2XJVA 3ZMNA 1F9KA 2YZ4A 3VHPA 1R092 3PVEA 2E6VA 5IUQA 4AF9A 2R072 3VKOA 2BVBA 1FYUA 3SNMA 4W6YA 4XJZA 3C2UA 4M01A 2K9ZA 3RS6A 2BFUL 1PIV3 1U5XA 4EWAA 4KGQA 3V0AB 1HXS2 1ZM1A 1F31A 1CAXB 4MXWA 1VRH3 1YRZA 5BNOB 5C4WC 3VBHC 2GC3A 4OI4A 3JD73 3ZFGB 2BBVA 4KWLA 1D4VB 4Q26A 1XXNA 3QH7A 4RR3B 4N9HA 4I0AA 1HQWA 2BWAA 1QQP2 2F6BA 4XJUA 3ZX7A 4AVAA 1EV13 3OCPA 4XE9A 4EV0A 5AVPA 1H4GA 5BYNA 1YHFA 3W59A 4N43B 3WDWA 5J37A 1BEV3 4EN8B 5FPZA 2AUYA 3CEWA 2K2SA 1RUF3 3AP4A 4Q27A 1LEMA 4AW7A 3KB5A 4YVSB 1LGBA 1V6JA 5I0TA 3ZXAC 2ZBJA 5T3NA 4Q8KA 1FOD3 1AR82 5IK8A 5CG9A 5I0SA 4FPKA 4TZDA 4BMEA 4Q4X1 4AE2A 5CB7A 4YG3A 4IXLA 2HWF1 4IEWA 4OI0A 1H2MA 3GHMA 3NKTA 1YIPA 4MZUA 4OI2A 1N1YA 1ZBE3 3B69A 2CAVA 2NMNA 2Y26A 1GZCA 3BTAA 5GZEA 1CONA 1XYNA 2XJTA 3I2DA 4QQOA 4BE3A 3ZN4A 4WVVA 3E5UA 1X50A 1YYNA 1AR81 2W68A 3NV3A 1RITA 3A4UA 2ZGKA 1UCXA 4RS5A 4A7ZA 1OOPB 1TQ5A 2D3RA 4LBQB 1FT9A 3MEPA 4QGNA 4LBNA 5HBAA 4U36A 1NQJA 2CNAA 2DTWA 1SCSA 5SV8A 2W52A 2PLV3 4Z8BA 5FLHA 4CDUB 2GN3A 1CJDA 1NCRB 1YI7A 2WNUB 4WM7B 4Z82A 4JDOA 1GR3A 1GANA 5I91A 4YVWC 2DVGA 2KM2A 1AR92 1Q3EA 4XBLA 2WZR2 3LAGA 2WSVA 1IOAA 3WDYA 1R1A2 4BMBA 2EALA 5KC6A 1QXRA 1WW7A 4P9IA 4K20A 3I7DA 1J1LA 2CL2A 3OBRA 5E1RA 1ULFA 3M4FA 3SH3A 4XIOA 3G6JB 4E4ZA 1N3OA 4GMP3 4UW3A 2BUKA 2PAMA 2PQQA 2MNGA 2E9QA 1NA1C 1VLNA 2CYFA 3BCWA 1KJLA 3S6PA 2CWMA 4M3CF 1UU4A 4OUMA 3WHUA 5AC93 1QGLA 1JW6A 5GLWA 1IKPA 2D6LX 5JI9A 3RYPA 4L99A 4K8FA 4YW5A 4AVCA 3TNPB 2ZZQA 3UKNA 3AJYA 4HT1T 4L8QA 1NQDA 2VXRA 4K40A 3LCPA 2I74A 1OLQA 3AMHA 4UXAA 1WGPA 1WLWA 4Y4YA 1QMJA 2WC2A 1IPKA 2B5HA 2PHFA 3FBMA 1IZ3A 3MFAA 4AHWA 2HWE3 1IS6A 2O1QA 2ZPXA 1APNA 2QZ3A 3KMHA 4DY5A 4F83A 2WA3A 4WVMA 1RUC3 3USUA 2O8OA 1QF3A 4IQPA 2MPFA 4PQ9A 1W6MB 1FX5A 2PHWA 5EXOA 1FATA 2R042 2UWCA 3ZSLA 1CAVB 1JH5A 3C3VA 3KT1A 2E63A 4N9IA 2VY0A 1H1AA 4GB33 3VLBB 2WT1A 1FPN2 5C4WA 3WW3A 1XNKA 1VBD2 3VBHA 2RMU2 4LHLA 3AMPA 1RTVA 1PGL2 3B7MA 3VKFC 3X29B 2D44A 1YNAA 3AYEA 2ZCWA 1RHI2 3IPVA 5CAZA 1HRI3 2HEWF 1A78A 4QPGC 4Y1UA 4TWTA 4XTPA 2R041 4E2QA 4YZ2A 4H7MA 1YI9A 1PO23 4B3NA 4I01A 1O3RA 4HKLA 4L97A 1SFYA 2NMOA 1WCDJ 1LTEA 4LULA 4LO7A 3V0BA 4AG4A 3PMSA 5C8CB 5JIAA 4P9XA 4XBNA 1VBD1 3MIHA 2RMU1 3H3ZA 1VB2A 3MICA 4BA6A 1R093 2IXHA 3WR0A 4LBMA 4C0HA 1KJRA 2R073 4LEJA 5JSRA 2ZGQA 1V6IA 1RHI1 1LOGA 1Z7S2 3CU7A 5FMOL 1JYIA 1HXS3 2QDNA 3NO8A 4E4DX 1WLDA 4XJAA 3L2YA 1BBT2 4URTA 1HQNA 1WW5A 4YFZA 2IC1A 3NJZA 2GNMA 3T1MA 5C9AC 2BW8A 2D40A 1QQP3 5BNQA 4PDWB 3IT8A 3P3NA 3KSCA 2DU0A 4AK3A 1UKGA 4JDNA 5JOZA 4AVBA 2BEOA 1QJU2 2P3IA 3SCFA 2BYVE 1PGW2 1BBT1 2JEMA 3FE5A 3I54A 1TEIA 4CEWB 4WVWA 3WQ1A 3CF6E 3PVOA 2D3SA 5CFCC 3QD6A 4HSLA 1JBCA 2A6VA 3LZZA 3WHTA 3VZMA 2RS52 3FMGA 1WLCA 2UY9A 2RS13 4RGGA 3O0WA 5CVRA 4YVWA 5FO9B 4AVVA 4AHXA 1VP6A 3FZ3A 3Q9OA 4HPKA 1QJU1 3NAPB 1ZREA 2B9UA 3VBSC 1S0DA 1PGW1 2BNOA 3KT7A 3E6BA 1RUD1 2H0BA 4L11A 4HL0A 1D4M2 3ZSMA 3ACLA 1LOEA 2PHRA 1H9PA 3OY8A 1LESA 4EJRA 2RS51 2VOWA 1ENRA 3DUIA 1FI2A 3AB0A 3OTFA 4XDQA 4OI1A 3VBUC 1NA1A 1N1TA 1DQ5A 3SH4A 1ULGA 1RUG2 1W39A 1J3PA 4QQPA 1JOJA 1BJQA 3E6CC 3U10A 3FUQA 3M8LA 4DPNA 1FMD2 1AL22 1RB8G 4JDMA 3URFA 3HIFA 1D4M1 1DQ6A 2QVSB 1YFYA 1W6PA 3MF6A 4OHXA 1M06G 4TSVA 1AR93 2WZR3 2VOKA 3CO2A 2B39A 1R1A3 4WM8B 1NE4A 1RUG1 3THPA 1F5FA 1K5MA 1RUJ2 1CAUA 1EPWA 4J1XA 4FO9A 1NLSA 2WJSA 3VZLA 1W6OA 3TYJA 1KD7A 4Y1XA 5E89A 1GZ9A 4FXGB 4EN9B 4IEYA 4FPYA 1LU1A 3TB0A 1AJKA 4LBQD 1LOFC 2A75A 4AFDA 2SLIA 3E5XA 2OPKA 4X6RB 1S0BA 3TBDA 1LOBA 1V6NA 2SBAA 3DKWA 4IEXA 4JC1A 3OYWB 2R0FA 4K3UA 1PVC1 1XRUA 4HSJA 3EO6A 2PTMA 3ZSJA 4A7KA 3FHIB 4GULA 5JVVA 4K7JA 1H2KA 1VBE2 2HWB1 4AGVA 3DN7A 3KD4A 3VKNA 1Q8SA 3VDDB 2ZOEB 2WIIB 1O7FA 2BFUS 5GZGA 4XF4A 4FOWA 4ZXKA 4XFCA 4Y22A 4GQ7A 2DWRA 4HLTA 3RJ2X 5BNPC 3AK0A 4JVAA 3O0VA 5JZGC 1SLBA 1ULEA 1D0GA 4LO8A 1AYM1 4GWNA 4OLLA 3U11A 3RRDA 1RC6A 2BPA2 1FPN3 2W39A 5LEJA 4Y20B 1VBD3 4RQPB 1VBE1 2ZS6B 2IXKA 4AGGA 3M2MA 4IEUA 3POYA 4YVSC 1NXMA 2Q8OA 3WV6A 1RHI3 2UYAA 4JGZB 3A0NA 5GLZA 5C9AA 4JRLA 4IEOA 4AI8A 2DTYA 3JQWA 2AREA 3BB6A 1SCRA 2NP0A 4AEKA 2B45X 4KNCA 5T55A 4RHV2 3WZ1A 2I2SA 3UK9A 3NV1A 4CDXC 1Q5OA 3CJIB 1S2BA 4YGEA 4JTNA 1J3RA 1J59A 5CFCA 1Q8VA 1YFXA 1PVXA 3JB4C 3V64A 2D98A 4PBPA 4XFHA 1MS8A 1FXZA 2JECA 4FCAA 4R9DA 1Z7S3 1XNBA 3N7LA 3BOWA 4LNVA 3AYCA 1TME1 4Q4W3 4WBBA 2YC0A 1N47A 1V00A 5JOWA 2A70A 3D82A 1BBT3 2D5FA 3USSA 3FFZA 2UY8A 1I9RA 3B00A 1H1IA 2IFRA 2RS32 4FPCA 3VBSA 3VL9A 1OD5A 2IFWA 3TOJA 1GYKA 3J26N 2A6WA 1UIKA 3B9IA 3GYDA 4AQ2A 2D6KA 4HN1A 2OZJA 4CTEA 3H1MA 4XIKA 4CDUC 3J9SA 1BVP1 4I3GA 1NCRC 3ZO0B 5C33A 4PLMA 2WNUC 4WM7C 1IS3A 3HT1A 2B46X 3BPZA 4I2OA 2QNKA 1WBFA 2G4IA 2YYOA 3VBUA 1VBB2 4N53B 2RM22 1OQ1A 3RZZA 1ZA4A 3GZAA 1UMZA 2RS31 2XH6A 3W58A 2ZHMA 1ONAA 4J1WA 5CBLA 5DG1A 1MZ5A 1CPNA 3J8F2 4KU7A 4NO4A 3M3QA 1LKNA 1Q8OA 2WT0A 3HR9A 2F4PA 4CDWB 1MS9A 2RR11 1POV0 4XJWA 1LB2A 3WLUA 4TYSA 1OKQA 2FMYA 3LOIA 1D2QA 1H8TA 1ENQA 4M3CA 4BM8A 4G4FA 2ZGPA 3ZXFA 4UW6A 1HV1A 4I0BA 2X5IB 1AYN2 5JIUA 1D4M3 3ZXJA 4B4RA 5BNNB 4XFFA 1SFNA 2XVGA 2ZGRA 4FP3A 1ASJ3 1BQPA 3J8F1 4Q4Y3 3RPQA 2QQPA 3MIGA 2GH2A 1H0BA 1UIJA 3O5SA 3BODA 4DMIA 3ZYGA 5GZCA 4LUMA 1LOFA 4FOYA 5D8AC 3ZYRA 3IM0A 3ETQA 2XWBB 2JE9A 3WCSA 1FMD3 1AL23 4FPJA 4YM1A 2FZ1A 2AH2A 1PK6B 2ZAAA 2JKBA 3ZFEA 3RSJA 4AGRA 1OPOA 2JJ6A