2VQAA

Protein-folding location can regulate mn versus cu- or zn-binding. crystal structure of mnca.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
356
structure length
356
Chain Sequence
b'WRSLSNVVWGKDLPAFTYAFSKTPLVLYDGGTTKQVGTYNFPVSKGMAGVYMSLEPGAIRELHWHANAAEWAYVMEGRTRITLTSPEGKVEIADVDKGGLWYFPRGWGHSIEGIGPDTAKFLLVFNDGTFSEGATFSVTDWLSHTPIAWVEENLGWTAAQVAQLPKKQVYISSYGPASGPLASATPQGQTAKIEVPHTHNLLGQQPLVSLGGNELRLASAKEFPGSFNMTGALIHLEPGAMRQLHWHPNADEWQYVLDGEMDLTVFASEGKASVSRLQQGDVGYVPKGYGHAIRNSSQKPLDIVVVFNDGDYQSIDLSTWLASNPSSVLGNTFQISPELTKKLPVQDTIFSLPTQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SLL1358 PROTEIN
publication title Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Metal binding protein
total genus 89
structure length 356
sequence length 356
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vqaA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vqaA01
5I8SA 1EYBA 2PQQA 4EROA 3LZZA 4XF3A 4D7TA 3LOIA 1RC6A 1DGWA 4PIZA 4Q0UA 5FQ0B 4AQ2A 4HZFA 1O3TA 2I45A 3FX3A 4YNIA 1LKNA 2EVXA 3CL1A 4XFFA 1ZZ7A 3E97A 4AVBA 4R8HA 1U12A 2IXIA 3HT1A 1ZRCA 4E2QA 3H50A 2CV6A 4FAHA 3D82A 4HSLA 4LUMA 3BU7A 4XFAA 3U11A 4MUVA 2OZJA 3NKTA 1J58A 4IEVA 4PIXA 5J3UA 2V09A 3WW2A 4ORFA 4HMZA 3I7DA 4HN0A 1YFUA 1ZZ8A 3HT2A 3LA3A 1EY2A 3EO6A 4N9IA 1YFYA 5I0TA 3H3ZA 3DKWA 3IDBB 4PJYA 3WW3A 2GC3A 1I6XA 3VHRA 1CX4A 3OD0A 4I02A 2MHFA 3OGJA 1J59A 2PTMA 2ET7A 4X6QB 4HVOA 4UXAA 2GC2A 2Y0OA 4B29A 5FPXA 3GYDA 3OF1A 4X6RB 2XL7A 1CAXB 4IESA 3FE5A 4XF4A 1Q5OA 1UCXA 4PIYA 1HW5A 4I0BA 4IEXA 4HLTA 2CAUA 3DL3A 2PFWA 4ZU7A 2OYZA 2QVSB 1X82A 5JCTA 3RPQA 5T3NA 3RZZA 5CADA 1CAWA 4META 1J1LA 3S7EA 4J1XA 4EWAA 3SCFA 5KHKA 2K0GA 3H1WA 2GU9A 3S0MA 4MV2A 2IXJA 3E6DA 1ZRFA 1CAVB 2PYTA 2PHDA 4QM8A 4WZCA 3JZVA 2IC1A 3MPBA 3ELNA 4IEZA 4WVZA 3PNAA 1EP0A 4XFIA 4R52A 1ZZCA 2F4PA 3E6BA 4LULA 5LEKA 3MYXA 4QMAA 2XLAA 2UYAA 2GC0A 2XKOA 2GAUA 5KBFA 4HN1A 2BNOA 3H7JA 5J48A 4XF9A 2Q0AA 4UBGA 3LWCA 2IXKA 1ZZ9A 1O7FA 5BXXA 2IXLA 4LA3A 2ZCWA 2XHKA 4L2NA 5KHHA 5JSRA 1UW8A 1J3QA 2GZWA 3M3IA 4LTAA 1OD5A 1GQGA 4XEZA 4BYYA 5J7MA 4NVPA 4I0AA 4IEPA 1VR3A 2EAAA 3CEWA 4F7ZA 3N4MA 3DV8A 2ZKLA 4N9HA 2B8MA 2Z2SB 3UKNA 4QGNA 4MZUA 3SHRA 4AXOA 3ETQA 3RYRA 3UKTA 2KXLA 1QXJA 5D1IA 3SXWA 1YUDA 1RUOA 3D0SA 1IPKA 1NZCA 3KGLA 3SMHA 4BHPA 5BY5A 3ES1A 3WW1A 3BCWA 5BV6A 1QWRA 4KL1A 2ETEA 4ZU5A 5I8TA 3HQXA 3U10A 1FT9A 3O14A 4JVAA 1LR5A 4P9GA 4H7LA 4EV0A 5C6CA 4CYDA 2D5HA 2B5HA 1XE8A 3FWEA 3I59A 4TLFA 1CAWB 4XFGA 5EFUA 2C0ZA 3ACLA 1RTVA 4Q29A 4I01A 3BALA 2FQPA 4JTOA 3IBMA 4MGZE 1Y9QA 1YFWA 3LAGA 3NVCA 3EHKA 2BGCA 1NE6A 1UIKA 1O4TA 1ZVFA 5FLHA 3KMHA 4FT8A 1X8MA 4MH0E 4HSJA 1ZNPA 3PLQA 1RGSA 4AVCA 4XF1A 4KU7A 1WGPA 2MNGA 3MDPA 4KWKA 4QGLA 2HJIA 1OI6A 3ZDSA 3S7IA 2K9ZA 1H1MA 2EA7A 2QNKA 5BUVA 5FLIA 4BIFA 3D0JA 3NL1A 3RYPA 1NYWA 5FCCA 2Z69A 4ZU4A 1LRHA 3EQEA 4XETA 2VECA 5E16A 1YWKA 4HBNA 3FHIB 5AVPA 3H1MA 3H8UA 4IEYA 1ZX5A 3E5XA 4I2OA 4OFGA 2OPKA 3RNSA 2D5FA 3MZHA 1RUNA 4XFBA 5CU1A 3R6SA 3SCHA 1OFNA 2UYBA 5HI0A 2E9QA 4FAGA 1YLLA 3H7YA 4AVAA 2P17A 2BNNA 1YHFA 3NSTA 4XFHA 4Q0SA 3H9AA 3OTFA 4E2SA 4I3PA 5I0UA 4LA2A 5FDBA 2DCTA 2GH2A 4JV4A 2QDRA 3E6CC 3DN7A 1ZZBA 2Q30A 3LA7A 5FLJA 5BPXA 5JR7B 4D7SA 1RL3A 1LB2A 3LA2A 4MGKE 1XE7A 1SEFA 5KHIA 3CJXA 2H6BA 2ATFA 1ZRDA 2QJVA 2N7GA 3KSCA 3GBFA 1UPIA 5LEJA 3FJSA 5JAXA 1Q43A 4LLOA 2OZ6A 1UD1A 1QY4A 5CVRA 2Q4SA 5I91A 2BEOA 2MPFA 4Q0PA 2PAKA 4YSFA 2O1QA 4F8AA 3I59B 4KWLA 3IDCB 2VPVA 2XL9A 3TNPB 1ZZ6A 3HIFA 4A2UA 1CAUA 1O3RA 2H0VA 2H6CA 2OA2A 3NW4A 2UY8A 1NE4A 4IERA 3KGZA 1O3SA 5JSOA 2D40A 3I54A 2PAMA 3FZ3A 2IXCA 1ZREA 5F1RA 3H3UA 2CAVA 5FQ0A 3EJKA 4HVRA 2VQAA 4HVQA 1SQ4A 3E5QA 2XLGA 4IEQA 5LRRA 1IPJA 2ET1A 1O5UA 1FI2A 3CLPA 2CGPA 3H1YA 1J3PA 3SCGA 2GC1A 1NXMA 2PA7A 4Z82A 2UY9A 5KHGA 4OLLA 1DGRA 2QCSB 3TNQA 3WW4A 3QACA 1VP6A 1V70A 3C3VA 1WLTA 4KWJA 3U0ZA 1CGPA 2HKXA 4K8FA 3CO2A 2B9UA 1YFXA 4FBFA 4IEOA 1XRUA 4LEJA 4AQ6A 4YARA 4IETA 4BH9A 2PAEA 1Y3TA 4L11A 1ZRRA 4J1WA 4UBHA 5E1RA 4GULA 1FXZA 4MGIE 4O9GA 5FPZA 3EBRA 1TQ5A 4DINB 1PM7A 1X7NA 4MGYE 5JSPA 3NJZA 3CF6E 4I09A 5I0SA 5I93A 3UKVA 4Q0QA 5EZWA 4EWDA 5LRSA 1CAXA 4KU8A 3FFQA 4Z07A 4IEWA 2IXHA 3IWZA 4XFCA 4QGMA 3B02A 2O8QA 3L2HA 4YYOA 2WFPA 3OCPA 3BPZA 1VJ2A 1PMIA 5KHJA 4EWEA 1X8EA 2PHLA 4QM9A 2D93A 2XKPA 3IIAA 1QXRA 1JUHA 1G6NA 4JTNA 4RD7A 2BYVE 2XLFA 2BNMA 3PVBB 1J3RA 1WA4A 3ROUA 3G7DA 4QX5A 3BB6A 4LUKA 1GQHA 1DZTA 3ES4A 1SFNA 2Q1ZB 4XF0A 3RYKA 4Q0VA 4O9EA 2FMYA 1CAVA 2XGXA 2WC2A 3E5UA 4MX3A 3M70A 1O5LA 4IEUA 5I0RA 5K8SA 1H1IA 4YRDA 4ONUA 1DZRA 1Q3EA 3KCCA 1O3QA 5I8YA 4E2GA 1I5ZA 3RDIA 3USSA 5C8WA 1OMIA 1UIJA 1CAUB 1L3JA 3QOPA 1EPZA 4QXKA 3ST7A 4WBBA
chains in the Genus database with same CATH superfamily
4YW3A 4PHZA 4D7TA 2PHWA 3LOIA 3VBHB 2E53A 4PIZA 1RUD2 4Q0UA 1NZIA 5FQ0B 2K2SA 1WMEA 1MS9A 2FHRA 4YGCA 5FPLA 1O3TA 5FYHA 1YIPA 1PO21 2AUYA 2D6MA 4Q1PA 1G9CA 1POV3 1XB9A 3BVCA 3VD4A 5FWJA 3EMRA 3OJBA 1N1VA 1S2KA 4D6SA 1WW6A 2RDNA 1NOVA 2IXIA 4CDQC 5A1AA 4BMEA 3O1RA 3H50A 1V6KA 2YXSA 5LATA 1RUI3 2ILMA 4P9IA 5JIUA 1V6LA 4IV1B 2OZJA 2QE3A 1NA1A 1UNBA 2WSUA 2BRTA 1JW6A 3O1TA 4IEVA 4XMIA 1ZBE2 1OBNA 3W9AA 2R073 3HNBM 3MLJA 2Q8DA 2VG9A 2YUEA 1QJX3 1S0BA 3JBG1 3VN4A 5JOWA 1C4RA 1MS1A 3HT2A 2W68A 2YGMA 1HX6A 1EY2A 2A6XA 1YFYA 5FYUA 2JKBA 2XJSA 3DKWA 3IDBB 4LT5A 1PMJX 5DUUA 3UGHA 3VHRA 3B94A 1CX4A 1NQJA 4QPIA 3J7MA 1R083 3DPRC 2JIJA 4XTMA 4Q4X3 4HG6B 4LBQB 1LHUA 1GKBA 4LKEA 1J59A 3Q8BA 1RUI2 2JENA 2R6QA 2ZGRA 1ACCA 5FOBB 3TEYA 1PO13 3OF1A 2XWBB 4X6RB 2BWCA 2XL7A 1CAXB 3T2QA 1FPN3 1HV0A 1UYXA 1KEXA 3FE5A 3VBFA 4MG2A 1JH5A 5LA1A 3FFZA 1I3HA 2R072 5J36A 4HLTA 2CAUA 3DL3A 1QJX2 4QDRA 4XABA 2P3JA 5C4WA 5T55A 2OYZA 3ZKUA 4FOYA 4CP9A 4NMIA 2W95A 5T3NA 5A70A 4NHYA 3GJAA 4Y1VA 4JGZC 4BA6A 1I5PA 1W8HA 1BMV1 3ZXEA 5GZGA 4NJ4A 1Q8SA 1R082 4XDPA 4EWAA 4YW7A 3ZIWA 4C1WA 2GU9A 3V0AA 2A6ZA 1S0GA 3JB8A 5M0TA 3ZYBA 3ILRA 2ZGOA 3E6DA 3QH6A 1PO12 3LQCA 2WJSA 3I2OA 1FPN2 1HXS3 1W39A 2PHXA 1CJDA 2JD4A 2RDRA 1DDLA 3CIHA 2JB8A 4CZSA 4NUBA 4LITA 2VCCA 3AYCA 3B5LB 1UX7A 2E31A 2QDNA 5A7OA 3MPBA 5EJZB 4GQ7A 4OVEA 2FMDA 3AC0A 2W3JA 2PHRA 5CFDC 1VALA 5SV8A 5C7GA 5CFCC 4WVZA 2VNOA 3PNAA 4CCEA 4DXRA 2XJQA 5LBBA 3NV4A 3WT3A 1S2BA 3MHZA 4LO8A 3U14A 2YU2A 4AHZA 2Y60A 2GMPA 4CCOA 1Z0HA 2W9XA 1L7QA 3I3EA 4TYSA 4COVA 4DEQA 4QMAA 5H9RA 3VHOA 2UYAA 2GC0A 3CJIC 2UWCA 4HN1A 3C7FA 3PURA 3MV01 3K4ZA 3H7JA 3OY8A 3VGIA 4BLIA 1FYUA 4Q4W3 5FZAA 4XF9A 1HXS2 1K5MA 3B3QE 4IL7A 5D21A 2VMCA 4L97A 1S0JA 4KMQA 1JYIA 3AVSA 4FTSA 1DLLA 1ZZ9A 1OF4A 4XQDA 3S30A 1NG0A 2ZCWA 1KFUL 1XYNA 1BVP1 1P8JA 1ZRIA 2VQ0A 2XHKA 3APBA 1IPSA 3IPVA 4QXHA 4EN9B 4CA9A 4GWNA 5JSRA 1VBE3 3OPZA 2CU5A 1GQGA 3TAYA 4BYYA 1DQ1A 3B93A 4RL7A 1VR3A 2DVBA 2EAAA 3CEWA 3MIHA 1NA1B 4A41A 2X5IA 1OUSA 4HXCA 2ZKLA 3N4MA 2UWAA 2PN5A 2XONA 3M7AA 1BBT1 2J1TA 2Z2SB 1ULGA 3J26N 4QXCA 3UKNA 4ZHNA 1OT5A 1HKDA 4QGNA 4MZUA 4CDXC 3SHRA 5DABA 5DDJ1 1H2MA 2JDHA 3UKTA 2KXLA 1QXJA 2RS32 3B9CA 5D1IA 1PO23 4BB3A 4CCMA 4JZRA 3WZ1A 1GZTA 4CDUC 4P5YA 1YUDA 1CWPA 1PZ7A 2RJ2A 1N3QA 2BFUL 5BY5A 3D4KA 4QPIB 4DY5A 1LGBA 4QPYA 4KNCA 1GFF2 3PUHA 1VBE2 5FZ7A 4SLIA 2A1XA 1GLHA 2XJTA 4ZU5A 5T5JA 3ZXKA 4MLOA 2VMFA 5I8TA 4ZS3A 1ENRA 4P9LA 4LIVA 5FUIA 3SLIA 4LHSA 1GWMA 2BGPA 1GBGA 2VU9A 3TRSB 4BPZA 1UY4A 2P5BA 3N9PA 4Y4RA 1SLIA 4JVAA 3VBFB 3WDTA 4YG3A 4DQAA 1OA4A 2VZSA 3JBG3 5C6CA 1VBD3 2GN3A 1XNCA 2F4LA 1QJU3 5C4WB 2GNTA 3PVEA 4BDVB 5DAWA 1S0DA 4ASLA 4CP9B 5CEHA 4NIIA 3DPRA 4TLFA 3I59A 1N3PA 2P37A 3NRUA 3IKWA 4RA0A 3ILNA 4C90A 5EFUA 4AVVA 4MYEA 3AZYA 4WM7A 2WFF3 1GYKA 3ACIA 4JTOA 2FQPA 3HOBA 4RN5A 3AKSA 3IBMA 4QB1A 4GH4A 5FJKA 5FZLA 3SITA 3AL6A 3ZN4A 2I07B 2JG8C 2VH9A 4JHZA 2W91A 2JE9A 4S2DA 1TME1 3P3PA 3ACGA 2V5YA 1FNZA 3GALA 4AGRA 4BQWA 2VM9A 1OLQA 3P5BA 3VZNA 5LA0A 1UY3A 3KMHA 4L99A 5FYMA 1RUJ1 3WUCA 4AFBA 1ND3C 3ZYHA 4Q1RA 1LODA 3JBG2 1VBD2 1VRBA 3U37A 1QJU2 1W3XA 1Z7S1 4TWTA 4RFRB 4FPYA 4XIKA 4BE3A 3MDPA 1K3IA 5IVFA 4UT5A 1ENQA 1D2QA 1F15A 2YGLA 3KVAA 3ZDSA 2QQIA 2WT0A 3ZSLA 1AR83 2K9ZA 2WFF2 4UI9L 5SV5A 2ID4A 5JI9A 2W1WA 5FLIA 2AH2A 1WCUA 5F5IA 3RYPA 3WQ7A 4BQ3A 3OY8B 2LUWA 2YFZA 5FCCA 4ZU4A 1LRHA 3WV6A 5BNNC 1C5IA 1K5MB 2H0BA 3EQEA 5DAQA 4AFCA 1BK1A 4BISA 4QQ2A 1RB8G 1HB1A 3ILFA 3S5AA 5F8PA 3IPVB 1ZX5A 4GZ9A 3E5XA 4IUGA 5C8CA 3I8TA 3IMNA 3RZGA 4OFGA 4CCDA 2OPKA 3GHNA 4FOVA 4NR1A 5E8AA 1UZWA 5EJ3A 1HN1A 3R0RA 3WDUA 2ARBA 4JRLA 3AYAA 1UO9A 1AR82 2X5IB 3CJIA 3OYWA 1COV1 1NCQA 2QQUA 3H7YA 3OOXA 4GALA 4GJZA 2R16A 2HBTA 2P17A 5F5QA 3N7JA 5FV3A 1W0OA 4NROA 1GZWA 2WWUA 3HR9A 5FZDA 4E2SA 3KHCA 4Q0SA 3WDVA 3CBNA 3S5QA 4GA9A 1UU5A 4I3PA 1GUIA 4XXPA 1AR71 2WLPA 1MS0A 3WX5A 2QDRA 5FREA 3DN7A 2QKDA 4N8MA 5TSWA 1NX9A 1ZZBA 2VZOA 3PIGA 5FLJA 4D7SA 2ZX1A 4IW3A 4LHLA 3ZXGA 4CEWC 4COWA 2JD9A 4MGKE 4YG0A 3AP7A 1RHI1 1XE7A 1A78A 4FQZA 2C24A 2BTVC 1SEFA 2AZ5A 4PI2A 4QT6A 1MS8A 2XDVA 1WCKA 4MADA 3UNPA 1FMD1 3CQOA 2XJRA 2CY6A 3IIIA 1AUYA 3RWNA 1Q43A 1RIRA 1E5IA 1LCLA 1UD1A 1QY4A 4XUPA 1RUE1 5BNPA 1PMHX 2B42B 2JECA 2BEOA 2MPFA 4QU1A 4CDUA 4CRQA 2GMMA 2ZOEB 4QD2A 3NNGA 4YSFA 5FYVA 2AR6A 4OI0A 1ULFA 3DPRB 1AZDA 5FWEA 3VD7A 3I59B 4E9KA 2VZ1A 4KWLA 3IDCB 5LK5A 3GF6A 3NJYA 4WM7B 5D8AA 5LK7B 2BGOA 4Q27A 5IK7A 3G6JB 4A2UA 4GH4B 3BTZA 3NV1A 2OW4A 3SH3A 2EIDA 1CQ9A 4S2HA 4DOUA 1O3RA 2VTXJ 2OA2A 2ORXA 2EIEA 3N9LA 1GU3A 1W9TA 4GWMA 3VBHC 5JSOA 2CTVA 4CXWA 3DKQA 4DY3A 3W58A 3GGLA 1UPSA 2CAVA 3ZVXA 2NZ9A 2D3SA 3QLQA 3HD8B 4P08A 4COUA 2CWSA 2VMGA 4HVQA 5HV0A 4TTGA 4K6BA 1F2NA 4QX2A 5A6ZA 2ET1A 1O5UA 1FI2A 2Z42A 1Y9MA 2DUQA 3CLPA 4RQPA 1UY0A 2OPWA 3M3CA 2CGPA 1J3PA 1ULPA 4G4FA 4XZPA 5G04L 1T6GC 4XCBA 3W5MA 1NXMA 2VW1A 1UU4A 4N43C 4IV1C 1VE0A 1Q8VA 4BCUA 4OLLA 4YGEA 2DVDA 1DGRA 1YQCA 5FXXA 1VP6A 1TME3 3C3VA 3U0ZA 3JD71 1ZM1A 2G1MA 1H6YA 1WBFA 3AL5A 2YC4A 2E33A 3SEEA 3NJVA 2G9FA 1RUJ3 5AVAA 3KWVA 1EUTA 4GKYA 2CWMA 4JQTA 2HYKA 1XRUA 4LEJA 4NE9A 4YARA 3BUCA 1QDCA 3MEPA 4HONA 4XUOA 1WKYA 5C8CB 3LFIA 1W8TA 4L11A 1KFXL 1W90A 3ZSMA 5FPZA 4AEMA 1WW7A 5APAA 3POYA 3EBRA 2FZ2A 4AVTA 1TQ5A 4Q5OA 5T5OA 3OGSA 3DCQA 3FN9A 3CJIB 3OYWB 4MHRA 1TG7A 1NCQB 1SMVA 2UWBA 4AG4A 5I93A 1LENA 2Q8EA 2ENRA 1REFA 1GZWB 5EZWA 4EWDA 1AJOA 2WA4A 5A3PA 5KC5A 1S1AA 1PX4A 5LWBA 4AZZA 5A6XA 4IEWA 1TME2 4XFCA 1RXFA 4ES9A 5FY7A 1R093 1PGW1 3BPZA 3KV9A 4QQHA 1VJ2A 3TWIA 1GR3A 5A3TA 2EIGA 1RUJ2 4ASMB 5KHJA 3K3NA 2YYOA 5JUVA 1GP6A 2JDZA 2XKPA 3GZEA 3IIAA 1YRZA 3VKOA 1MQTC 2VNRA 4XYXA 3DXUA 1G6NA 4BM8A 1LGNA 1ND2C 4AFDA 4K40A 1SBDA 2F6BA 2BNMA 2XLFA 1YCIA 1DGLA 3RWKX 4XDOA 4D0QA 4QX5A 2WR9A 1YNAA 1JZ7A 2Q8OA 2A3XA 2ZGQA 3J4UH 1KGYA 4PQ9A 1U5YA 5ISLA 1HRV1 2TUNA 3E5UA 1D4VB 4MX3A 2WYFA 2RMU3 5FZ1A 4XOGA 5BNPB 4CDUB 4IEUA 3ZXAC 2GNBA 5T52A 5K8SA 1R092 2YBKA 1AR73 1EAH1 2ZEXA 4ZS2A 5A3NA 2FD8A 5ABJA 3KV4A 1US3A 3I2FA 3POGA 4M3CF 3MLLA 2B4KA 2EAKA 5D8AB 5A1LA 3RDIA 2VTXA 1OMIA 1UIJA 3LDRA 4K3UA 1RHI3 3QOPA 1EPZA 1VMFA 1GOGA 3PJYA 5A7SA 1L7RA 4WBBA 4YWAA 5GZCA 1WLDA 1LULA 2B9VA 3KQRA 5I8SA 1EYBA 2D6OX 4YM0A 3LZZA 4XF3A 4M3CE 1RC6A 4FPOB 1VBC3 2RM22 4OI4A 2XVLA 3USUA 4BIOA 5B2GB 2D7FA 1RUE3 3HQUA 4LBJA 4YM1A 2RMU2 2I45A 1KDKA 3ON7A 1DQ5A 1UOBA 2OT7A 4YNIA 3UV9A 3C2UA 4GKXA 5HXVA 3SH4A 2IFRA 4GJYA 4CU8A 4OHWA 4BK4A 1AR72 3R4UA 5FTTC 4RQPB 1XXNA 4JDMA 1V9U3 4M0HA 2NYYA 1D4M1 5DAVA 2VVFA 4RHV2 3D82A 2A6WA 3I4IA 3CDZB 4LUMA 3MF6A 2HWE1 2W47A 4LXLA 1PZ9A 4XFAA 1NA1C 5FP7A 4MUVA 5AFBA 1RHI2 1DQ2A 3VHNA 3NKTA 4ET7A 5JXHA 4YW1A 1J58A 3URFA 1OC1A 4PIXA 3FC0A 5J3UA 4XIOA 4C0HA 4W4ZA 3ZMOA 2D44A 2V09A 3A0KA 4XPVA 5LA2A 2QTWB 3WW2A 1I9RA 2W1QA 4ORFA 1VBC2 2XWJB 1RUE2 5JWPA 3JQXA 2JDKA 3TEZA 1JYVA 2VZVA 2WL1A 1O4YA 5I0TA 1AL21 3WW3A 5A80A 2IFWA 3M2MA 4QPIC 3PMEA 1I6XA 4JQRA 4NAMA 4ASKA 2ARCA 2E7QA 5GZEA 1V6OA 3UL2A 4N43A 3ZN5A 3ITQA 1V9U2 1VMHA 5DAPA 3MPPG 2PTMA 1C1FA 1POQA 2XXZA 4UXAA 2Y0OA 2Q5TA 3KVBA 3ZR6A 3NMBA 3VBFC 4OCTA 1H9WA 3JD73 4P9WA 1Q5OA 1UCXA 3WF0A 5EIYB 1EPWA 2XOMA 4PIYA 2DYCA 1HW5A 3WNOA 1OSGA 4I0BA 3A23A 5KXBA 2IVIB 5C4WC 4AFMA 3KT4A 2HWD1 3KCYA 4ZU7A 2J1VA 4JKLA 1HJGA 5T54A 5IT6A 4AR2A 1LAJA 1W03A 3RPQA 1H2NA 2OIIA 4P14A 3TEXA 2J1AA 2R041 2W2IA 2VR4A 2DTYA 4NPRA 5FFOC 3W21A 4YVSC 2C9AA 2OUJA 3LPGA 3POBA 5GLUA 3C7GA 4D6RA 5LBFA 3H1WA 1JN2P 4NRQA 5L19A 2QQNA 4IDZA 5DG2A 4DNYA 3B00A 3IAQA 1SBFA 3IAPA 1WD3A 2VMIA 2VW2A 3WG2A 3FLPA 4C8DA 1W0NA 4DO0A 3VLBB 3JD72 3VZLA 1C1LA 4J6GA 1DZQA 4XUNA 3WD5A 1F9KA 4KI5M 4LO5B 4CXXA 2XQRA 4NWWA 5T5LA 1RUH3 4KGGA 2W87A 2DBIA 1JU4A 1QXPA 5K4LA 5KXDA 1HQLA 1MQTA 4QQOA 5ABJB 4Y4YA 3HPNA 1UOGA 1ND2A 4FPHA 1AYN3 4Y20A 4TSVA 3FUOA 1D7PM 3RI9A 4YW2A 1K5JA 5FP4A 3VZJA 3KV5A 2WO3A 1ZZCA 5FZMA 1IQDC 2V72A 2WO7A 3MIBA 4LULA 3O5SA 4ZY9A 4HKOA 3VL8A 4A3ZA 4E4HA 2VQUA 3I3QA 2DCYA 4ISRA 2XLAA 4HFSA 3WDXA 3WP4A 4CTEA 3OUHA 3AXDA 1GOHA 2WS93 4WZFA 3ME2A 1ONAA 1HRV3 3USUB 5KBFA 5LZ6A 3LB9A 5L73A 1HB4A 3N7LA 4QHOA 5LASA 5J48A 4UBGA 3WDWA 3WF3A 1HQNA 1TMF1 1YQ8A 1PGL2 1EAH3 1QNYA 3DYOA 1O7FA 3WF2A 1NLRA 1RUH2 2XH6A 1BXHA 3GNEA 3WQ1A 3AYEA 4BOWA 3GZTB 1QOSA 3WOGA 3Q8EA 4NAOA 1UW8A 1J3QA 2GZWA 1E5HA 2OS2A 3MIFA 4BQ4A 5FZ9A 1AYN2 5J7MA 1VB4A 1XSRA 1W9SA 4QXBA 1UXXX 4NVPA 2X5IC 4IEPA 1R1A1 4LORA 4F7ZA 2ZMLA 1DHKB 3ZFGA 4LPLA 5E88A 2R1BA 1FOD1 4XQ4A 4BXFA 1ENSA 2A6YA 3HVDA 4GAZA 4TXWA 1BEV1 4M0NA 5FZ8A 3ZXFA 4AXOA 1RXGA 2WS92 3BOWA 1HRV2 2MEV2 1YQ2A 5A32A 5IVJA 3WNNA 5DQ0A 2B45X 1JS9A 4YFWA 1IPKA 1EAH2 4WVMA 5FAXA 3AZVA 2AREA 4N43B 5BV6A 1VLNA 3U75A 1MZ6A 4A42A 1MEC1 3A21A 4YGBA 3J7LA 2FCUA 1OVSA 2I74A 1W06A 3O14A 2JDUA 3SQOA 2XJUA 1PK6A 4FPJA 1UZ0A 1H30A 3M3EA 1KJLA 1WWYA 3GCWA 4EV0A 5CG8A 1NAEA 4P9YA 2L9LA 4CYDA 2VD7A 5A3LA 2JJ6A 1AL23 2BDRA 1PGSA 2GN7A 5JXJA 2V4AA 4WM7C 5A7PA 4GWJA 4URAA 2PHFA 1POV0 2ZGLA 3W59A 2XB6C 5JDBA 4QQPA 4Q29A 4GH4C 1A8MA 4I01A 1AYM1 3BALA 2FCTA 4AQTA 1YFWA 5FY5A 2CNAA 1GSLA 1NY71 3WY6A 5BYNA 3EHKA 1QGLA 4CUAA 2BZDA 1S55A 1UIKA 3UESA 5JZGA 3VKLA 4V1PA 3LEIA 4LKFA 4UAPA 1H0BA 2Q1FA 5FY8A 2BBAA 4JHTA 1WCQA 5FLHA 4FT8A 4MH0E 5J98B 1VAKA 4HSJA 1ZNPA 3I2KA 4QKFA 2VOVA 2KM2A 2ZMNA 3A22A 5K0UA 5KXCA 1SLLA 2OUHA 1BKZA 2W5FA 2VNVA 1E57A 4ISQA 3V65A 4OI2A 1MQTB 2KD7A 4XF1A 2MNGA 2WNOA 4YVSA 4UW6A 1ND2B 4Q4X2 4K8RB 4QGLA 4Y20B 2HJIA 1ALYA 2ZKNA 1F4AA 1OI6A 1J1TA 3AKQA 3QCWA 2EXHA 3HJRA 2JDNA 2VE1A 1UF2C 4XQWA 3MW2A 3GXUA 2QNKA 5BUVA 1KD7A 1AR91 1LEDA 2BV4A 3D0JA 1HN0A 4YM2A 2SLIA 1REDA 5LBCA 2HWF3 1OUXA 2Z69A 1H8TA 2PHTA 5F3EA 1N1YA 1HJFA 4XETA 2ES3A 3GDBA 3H8XA 2VECA 5E16A 1YWKA 4Y24A 4HBNA 3WHUA 3FHIB 3FUQA 3H1MA 3OGVA 5AVPA 3AKPA 5C8CC 2DFBA 1HLCA 2B39A 3SH5A 5L36A 4CE8A 4OHVA 3FHQA 1D0HA 5F3GA 3MZHA 1RUNA 3HN3A 3R6SA 4G3YC 1NCQC 2WZPP 1JZ4A 4FAGA 4M4RA 3KB5A 3ZFGB 3T1LA 1AXKA 1JI6A 1YLLA 3POSA 4XACA 4AVAA 4QPGC 4FXKB 3GZUC 3AZXA 3H9AA 3OTFA 2DU0A 2BFUS 2O8OA 2V4VA 3SEPA 5A1FA 2HWF2 2HWB1 3B69A 1G7YA 2RJKA 5A32B 4NHXA 3SNMA 2OVUA 1TMF3 3CU7A 2DCTA 4A6SA 4ITCA 3AXEA 1OLME 3E6CC 1OH4A 2RDSA 3AMMA 4WVMB 4CPBA 4N53A 4O61A 5BPXA 3ZKYA 5JR7B 4ZONA 1RL3A 5FMOS 1X9PA 3DEMA 3TOJA 1IZ3A 5A6YA 4AYUA 2R7EB 1L7LA 5FO7B 1UY2A 4TLGA 3TBDA 4OULA 2XG3A 4U36A 4UFMA 1BHGA 2WZEA 1KJRA 1R1A3 2ZGSA 5JMCA 3KSCA 1UPIA 4M3CA 2NQYA 4R4XA 1FOD3 1PK6B 4Q4W2 1G8WA 5BNPC 1LNSA 3AP4A 2OZ6A 4CCCA 5JLVA 2NLRA 3S6PA 5CVRA 2IVJA 3MICA 1W2AX 2Q4SA 1KITA 4YVWC 1W28A 3PVNA 1APNA 3RZJA 2W92A 3HAGA 3MGUA 1EV11 4Q0PA 4XURA 5GALA 4LE3A 4KWUA 1TMF2 4OHZA 2VZ3A 5A3WA 1HRI1 3AK0A 2YBSA 1LOFA 4S2FA 4UF0A 4YZ4A 5D8AC 3BYWA 1CONA 2XL9A 2VZQA 3H3LA 1W6MA 4LKDA 5L9RA 1MEC3 1CJPA 1CZVA 3K48A 2AACA 4PF5A 5F3CA 1BCXA 5C3QA 4R9BA 4QAWA 1ASJ1 5A3MA 1W8ZA 4Q8KA 3NW4A 1SLAA 1R1A2 3LKJA 4FI9A 3KGZA 1PNFA 4IERA 4YG6A 3ZFEA 2D40A 4DXTA 1DLCA 4YFZA 4QKDA 5JZGB 3KT1A 1FOD2 1N3OA 2IXCA 1ZREA 5FXWA 3T0BA 1PO22 3VL9A 5F1RA 5IAVA 5K9YA 3C7OA 2WRAA 3U4SA 3UJOA 2ZGUA 2VOXA 1O8PA 2A6VA 2RG4A 4FPCA 4PLOA 5K0UB 2JDMA 2TNFA 4B4PA 4DMIA 4H3WA 3KZ4C 5LRRA 1IPJA 2YROA 4RQPC 4YVSB 2ZABA 2W94A 3IB3A 1K42A 3RG0A 5FR3A 2RS11 2QQPA 2BU9A 3JB4C 2YHJA 5E89A 3WEZA 3KM5A 1H6XA 3WQBA 2ZACA 4A6OA 4ZKTB 1AYM3 1C3HA 2VC9A 5AFEA 1W2OA 1MEC2 4Z82A 4ARXA 2NP0A 1W2TA 5L9BA 1K45A 1RJ8A 5FUPA 1G86A 3WW4A 4CUCA 1PVC1 1V70A 4LQRA 1LOEA 2SBAA 1F35A 2XBO1 2HKXA 3IM0A 3N36A 4L92A 3TN91 3UJQA 1H8TB 3HQRA 5FP3A 2B46X 2AEYA 1REEA 1AHSA 1NKGA 2WNVC 3WCRA 1IS4A 2JE8A 4FPLA 4IEOA 2D3PA 1JOBA 5DN2A 4AQ6A 1YXWA 2YMZA 2O0OA 4RGAA 1RUF1 4XTPA 3RS6A 2PAEA 1TE1B 4K20A 3MW3A 3VKFC 4XJ8A 2A3WA 4Q4Y1 4W6YA 2D6KA 1FXZA 2ZA9A 3AKRA 4MGIE 1OVPA 1OLRA 4DZGA 2PQSA 2Z5WA 3NNFA 3N3HA 4DINB 4FFFA 3KQ4B 4FPKA 4MGYE 4HT1T 2R061 5JOXA 3NJZA 1IKPA 4DXZA 1AYM2 2Y6FA 4IE6A 3VV1A 5F7UA 2DVFA 3CF6E 4I09A 1AR93 5I0SA 4Q0QA 3VDDA 4KU8A 4AW7A 4Z07A 3DYPA 2BOIA 1W0PA 3L2HA 4YYOA 4XJAA 2WN3A 3T09A 3MLKA 4CCKA 3MW4A 1CIYA 2WFPA 3AMPA 3OCPA 4BU2A 4XAEA 4GB31 4EWEA 3J9SA 4Q8LA 5CIRA 3VD5A 3WNPA 4OQ8A 3X29B 1BMV2 5HV4A 4QM9A 1MVEA 4N53B 4HOOA 1G9FA 5EPAA 1QXRA 2WLQA 3VD9A 1LJ7A 1ZA4A 1OA2A 2GP5A 5FXVA 4JTNA 3WVJA 1Q8OA 1Y9GA 3PL0A 3PVBB 1J3RA 1LHNA 4AI3A 3K3OA 4OMCA 1FX5A 1NT0A 1VBB1 4QPGA 4OQ9A 4M4PA 5BNQA 1DZTA 2W52A 5GLWA 2Q1ZB 4NPLA 4M3CB 5FPVA 4GMP1 1PIV1 1RYYA 3AKTA 2ZGTA 1AR92 1CAVA 2A75A 4CPBD 1W8FA 2P6CA 3O1VA 3OBRA 4X8NA 1WLWA 1AR61 1O5LA 2HWB3 2ZX0A 5DXDA 1ULCA 5DMYA 2BERA 4I30A 4H7MA 5LBEA 4Y26A 3ZFFC 1A8DA 4BQYA 2V73A 5ABJC 3ZLIA 4LBKA 2FBEA 1XPWA 1MS5A 4UF0B 4EZ4A 5HCAA 2WZR1 2NMNA 2CL2A 1D2SA 3LSDA 1I5ZA 1U5XA 2WABA 1W6MB 1QMJA 2FDGA 1J83A 3USSA 5C8WA 1YEWA 4FQ4A 4AL9A 1WMDA 1BBT3 2RE9A 2YC2A 5F39A 2VO5A 1QQP1 1YI9A 2P3YA 2XHNA 2BVBA 2F17A 1JXNA 3MFAA 4B7KA 2WO1A 2D3RA 2RDQA 3THCA 4YZ1A 5FBJA 3ENRA 3ZFEB 1VRH1 5DDJ3 3VBUC 4UYBA 2PQQA 4EROA 4YVWA 3MUY1 1DGWA 1Z78A 2Z4FA 4NO4A 4EJRA 2VMEA 1A34A 2JG9A 1KQRA 4AQ2A 5AC91 1DGRN 2EXJA 4HZFA 2ZAAA 3FX3A 2E7TA 1F5JA 1HIXA 1H4GA 4LBOA 5IUQA 2HWB2 4BK5A 3ZIXA 1QOTA 5C3OA 2EVXA 1XJAA 1LGCA 4XFFA 1ZZ7A 2WUHA 3BPSA 3E97A 4NIHA 1HRI3 4AVBA 1U12A 2VZPA 3HT1A 2E63A 1ZRCA 2D98A 1ULOA 3HNYM 4FAHA 4JCKA 2PMWB 2ARXA 2JDYA 4FXGB 1BBT2 1UL9A 4WM8A 5DUWA 1ASJ3 4OUMA 3MIGA 2W46A 5FZCA 1U0AA 2YV8A 4HPKA 3H8OA 2WZ8A 3I2DA 2WNUC 5DDJ2 5J96B 4AWDA 3P6BA 1QOOA 3O0XA 3MIDA 3I7DA 4HN0A 4HMZA 1JBCA 1YFUA 4FFHA 1CESA 4Z1VA 1ZZ8A 2WQ8A 1VAVA 2XR4A 3ZMNA 1OPMA 4DRRA 3LA3A 3EO6A 1OQEA 4N9IA 3ZYGA 4ES8A 3H3ZA 1M4WA 2WO2A 1Q8QA 1IG3A 1O4ZA 1OQ1A 1DCSA 1SFYA 4ZPIA 1QDOA 3OD0A 3PU8A 4URTA 5L7OA 4B3NA 3OBTA 4FSJA 1HRI2 2MHFA 5H9SA 1LHOA 2HYXA 2HEYF 2ET7A 1J84A 1D0GA 4HVOA 3JU9A 4B29A 1S2EA 5FPXA 5FOJB 5G05L 4CXYA 4XVHA 3BIEA 3ABZA 5A7NA 3VDDB 1ASJ2 3NJXA 4IE4A 2WNVA 4OHXA 2G4IA 5JCTA 4XF4A 1S0EA 2XBO3 2P6HA 1H9PA 3CZJA 3T2TA 4A4AA 4JRAA 5CA6A 1Z7S3 2XUEA 1W3VA 5FYCA 2PFWA 3M3QA 3OEBA 4NIAA 2AC1A 4KBZA 1X82A 2QQJA 1RUF3 2RR11 2VJXA 4FPEA 3MF9A 5DZFA 3RZZA 4DUVA 3CHXA 1UXZA 3ECQA 2IZWA 3NNMA 4META 1J1LA 3FL7A 4J1XA 2VUAA 4Q4Y3 4V2WA 4H2AA 1S0FA 4OMDA 1OD3A 3N9QA 4YLZA 5FMDA 4CSWA 1OURA 4QPGB 1IS5A 2R063 3RZKA 4MV2A 3O0VA 1O8SA 4PT6A 3AFKA 1VMJA 3PIJA 5J37A 1CD3G 1CAVB 2PYTA 2PHDA 1AX1A 1LOAA 3BTAA 1CIWA 2WAOA 4QM8A 1A6CA 2XBO2 3NV2A 4XJZA 4WZCA 5CKQA 2W08A 1O6UA 5H9QA 1US2A 4KQ7A 1Z7S2 2ZMKA 2IC1A 4LR4A 3WNXA 3GBWA 1GZCA 3BI3A 4GB33 2PHUA 2WQZC 3RJRA 1XBFA 1XNAA 4CDWA 4R4ZA 3NO8A 3OUIA 2EICA 1RUF2 3H8RA 1SFPA 4IEZA 4PLMA 2VUDA 2WWSA 4Y33A 1COV3 2JE7A 2AYHA 2J22A 5FY0A 3RZMA 4R52A 2Y34A 4UW5A 3U78A 4RR3A 5LEKA 2GNDA 3WLUA 1UU6A 3T0DA 1OQDA 2R062 3AB0A 2O14A 4F3JA 4DFSA 4GMP3 1PIV3 4YVWB 2XKOA 4FP2A 3U4XA 1LECA 2BNOA 2JG9B 2R49A 3HWJA 4LLFA 1IQAA 1QHDA 2DTWA 4QX1A 4U2AA 3ZFFA 3MFCA 2XUMA 5T5PA 1N1SA 1OLMA 4M01A 5FKBA 2J1UA 2D6LX 1UZZA 2Y8KA 3FBMA 3MV11 3WP5A 4WVWA 3N7KA 4GB32 3LEMA 3RSJA 2J7MA 3T4VA 2WZR3 4DIQA 3M3IA 4LTAA 1OD5A 1FMD3 4P5HA 4QDSA 4XEZA 1COV2 4HK9A 1XQNA 1V6IA 3ZFGC 1QQP3 4WM8B 3VBUA 2JX9A 2OXBA 4G9SB 3AYDA 3DV8A 5C9AA 1W6NA 1XYPA 2WINB 3ZYPA 4MO3M 4N9HA 2B8MA 4HPKB 1VRH3 2E26A 1JOPA 5JPMB 2BQPA 1YC61 3OEAA 2TBVA 2X29A 1PIV2 1ZBE1 5FZOA 5EYYA 5AC93 1JZ3A 4XC9A 1ODMA 3RRDA 1T2XA 1KS4A 1QJZA 1DYKA 1RUOA 2BPA2 1NZCA 3KGLA 3SMHA 5IAXA 5J09A 5F6KA 5F2WA 1DYPA 4PQQA 4S2GA 5HXMA 5L7OB 3BCWA 4YPJA 3KV6A 5JXIA 1FMD2 4HKLA 4AI0A 4AI9A 4KL1A 4ZZ8A 5C3SA 3KT7A 2YDEA 4XILA 1QQP2 1PK6C 2WNUA 4FTBA 2WQ4A 1FT9A 5CKNA 2WNVB 4K7JA 3VZOA 3WG1A 3ZOIA 1SCRA 4UW3A 5FO9B 3KD4A 1LR5A 1VRH2 2RS51 4NRMA 2CYFA 3I3DA 1H2KA 5AC92 4JGYA 2FDKA 4INDA 5GJ6A 3KF5A 4RFT0 2JDAA 2B5HA 4A45A 1XE8A 1QJX1 1W2NA 5A7WA 1MZFA 5HCHA 3O1SA 2C6SA 2P1BA 4XFGA 1DQ6A 2C0ZA 1ODNA 3ACLA 2ZJCA 1RTVA 2JWPA 2FDJA 3T1MA 5JOZA 2ADDA 1IOAA 1NQDA 3GZAA 2X05A 1DP0A 2C26A 4Y22A 4MGZE 3T0AA 4F83A 1R081 3RVHA 2VBPA 4HL0A 1GP5A 3K4DA 4AQSA 1BQPA 1LOBA 3LAGA 5FPAA 5JZGC 3B7MA 5FMCA 4QHBA 2WYSA 3POJA 5FY9A 3O1PA 1WCDJ 2HLEA 2B7YA 3ACHA 3AVRA 5FP8A 1O4TA 1ZVFA 3A0NA 5EXOA 1HQWA 2JIGA 4UFHA 4CU7A 1ENXA 5K0UC 2HBUA 1X8MA 3GJBA 4MXVA 1IKQA 3BTYA 3PLQA 3LDBA 1RGSA 4AVCA 1HB2A 4CDWB 2RR13 3U07A 1T6BX 3AP6A 1SG3A 2A3YA 2NPIA 4KWKA 3O1OA 2ZHLA 4IGPA 3QBQA 4JAAA 1U5ZA 4NPMA 3C7EA 1DQ4A 2QZ3A 3ATGA 3E1F1 4RR3B 3VBSC 1JYCA 2EA7A 2VAUA 4Z2AA 4BIFA 5F3IA 5FYZA 3NL1A 2AGSA 3AX4A 2HH9A 4YW5A 4PBPA 1HV1A 4I0WB 1H8TC 1UZVA 2LRPA 2ZHNA 1NYWA 1FV2A 3GM8A 1C28A 1EUUA 2XJPA 3T30A 2Y6GA 4I3GA 3WG4A 3ZFFB 1XU2A 1X36A 5JPNB 4Q4V1 1GICA 1XSQA 3W5NA 1QIQA 4CUGA 4D7YA 5DZEA 1YI7A 4AVSA 1LOGA 1W9FA 4IEYA 4QQLA 2CDOA 5IFPA 2ADEA 2RR12 4NHLA 4W6XA 5IWFA 2YY1A 1WW5A 2D5FA 3WQ0A 4BQ2A 3AZWA 5C33A 3ZX7A 3SCHA 2QUOA 2VZRA 1OFNA 2UYBA 4BLJA 2WBKA 1GP4A 1VB2A 3VBUB 5F5CA 5FZIA 3LCPA 3ZXDA 5C9AB 1W6NB 2DF7A 1OXCA 4JDNA 1IS6A 5JIAA 3ZO0B 4P9XA 3OUJA 3LGRA 5BNOA 2NMOA 1YHFA 2ZBJA 4XFHA 3VBOA 1CX1A 2P3KA 1PGW2 5FZOB 4UFJA 1LOCA 5I0UA 2ZGNA 3PJQA 5F5AA 5FZ4A 4AK3A 1PNGA 3R4DB 5F37A 2GH2A 5FDBA 3TEWA 4JV4A 1RUC1 1VAMA 2Q1MA 3WDYA 4N53C 2RS31 3EYPA 3PTYA 1VBA1 5K7PA 2Y6KA 3VBRC 4L0PA 2Q30A 2X09A 2VOWA 1XU1A 4XAAA 1W6PA 1WBLA 2YG0A 4ZXKA 4W6WA 1JZ6A 2EXIA 3LA2A 4MHUA 1RINA 5FYSA 2BWAA 3O12A 5E6HA 1DYOA 4WVVA 5CYYA 1ZA7A 4E4DX 5KHIA 2H6BA 3VB9A 1VBE1 3TYJA 2ATFA 3O1UA 2WNUB 1JU3A 2QJVA 2Y64A 5LEJA 5JAXA 3FMGA 1GWLA 2VUCA 4LLOA 4OZOA 4RGKA 1G9BA 2VOTA 2KA3A 1NLQA 1NUKA 3D5OA 4EN8B 3VDBA 1H2LA 4WV8A 2DURA 5I91A 2CHHA 4Y5Z0 1ZBA1 2Y6LA 3WHTA 4CU9A 2ZGMA 4E4ZA 4JGYB 2PAKA 4AHXA 3CKHA 3UK9A 1D4M3 4AOCA 1F4HA 5A7WB 4FPGA 3I3BA 1LOFC 2PLV1 1SHWB 4COZA 2HWE3 4LBLA 2G9GA 4J25A 1ZZ6A 1N47A 4D94A 2FCVA 4YM3A 5FUNA 5FZGA 3FBYA 4Y22B 1CAUA 2XPJA 4XHXA 3ZFEC 1XNBA 1URXA 2H0VA 2OQ6A 2CSGA 1XNKA 3N9NA 2UURA 4OUSA 3V64A 1RITA 4QX8A 5GLZA 5GLVA 2LTNA 2PAMA 3FZ3A 3HBZA 4QU2A 4Y1XA 2JICA 4N90A 2CGNA 2RS53 3AP9A 1OKOA 3WUDA 3ZM8A 1FV3A 3EJKA 2VQAA 3NAPC 4FTEA 1XYOA 2J1EA 1C8M1 3MIEA 3KLSA 1SQ4A 1TEIA 2ZGKA 4CP1A 3AZZA 3ZXLA 5KC6A 1D4M2 2FDFA 3J7NA 1VBD1 3DXTA 4KG8A 5A3OA 1QJU1 4XXAA 1OF3A 4RYDA 2G9ZA 2YPJA 2HWE2 5JMOA 5IK5A 4Z8BA 1V00A 5CZKA 3V56A 2YC0A 4UW4A 3U1XA 1KDMA 2UY9A 5KHGA 2ZHKA 2HWC1 2QQOA 2WFF1 1QJY1 2OX0A 4FPFA 4O7XA 3TNQA 5HBAA 5F2SA 5ANQA 5LY2A 2HWD3 1SACA 1H1AA 2BP6A 4K9SA 3LF7A 2W1SA 2B9UA 2X8KA 4X8PA 1JYWA 3HNMA 2RS52 1AL22 4YZ3A 2R043 2VVDA 4Z92B 1W6QA 4AAXA 1XNTA 3AM2A 4IETA 1G9DA 4BH9A 1SZBA 1UMZA 1YJLA 2WA3A 4JX0A 1Y3TA 1W9YA 4IE7A 1ZRRA 3AJZA 3WF1A 1O91A 4UBHA 4O9GA 3POFA 4W50A 3VBSA 2Y26A 1WZXA 1JYTA 1QU0A 2R0FA 4YW6A 2GNMA 2X10A 5FXZA 2LROA 4Z2WA 1AXZA 3VDDC 2VZTA 3FLTA 3WG3A 3O7OA 5BNOB 3F2ZA 4A7ZA 1AR81 4FO9A 3VBOB 3VZMA 5JXGA 3THPA 5LRSA 2DCJA 1XOYA 3FFQA 3OPWA 3OB8A 2IXHA 3IWZA 2ZPXA 4Y1ZA 2O8QA 2WNEA 2HWD2 3NNLA 2JXAA 4NN0A 4XJWA 5H9PA 1LHWA 4AFAA 1K12A 4Q4V3 2E7AA 1BK0A 4XBLA 2VVEA 4XBQA 4A3XA 1R64A 3W20A 2R042 3N9OA 4LOTA 1DQ0A 3M8LA 4RS5A 5FPBA 4GIQA 5FZ6A 4EE2A 3AMQA 1GZ9A 1W6PB 2QQWA 3RMYA 2WWJA 4BQ5A 4AI2A 4BMBA 5C70A 5FK7A 1JHNA 1HDKA 2XJVA 4IV3A 1WA4A 5FRAA 5GKAC 1BZWA 1KXGA 2YPDA 5EWSA 3S57A 3ES4A 5CKMA 3RYKA 1WLCA 4O9EA 2Z79A 4Y5TA 1LTEA 4L9BA 3T2PA 1GV9A 2ARAA 2D97A 4OYUA 3LDKA 2WC2A 4R9DA 4K1YA 4AEJA 3AFGA 1UKRA 3WXPA 3M4FA 1SLTA 5I0RA 1F31A 3C8XA 3CMGA 4YRDA 5FJHA 1DZRA 3PUQA 3KCCA 2VCAA 3VBRA 1B35A 1RUC3 4QX0A 3THDA 4Q4V2 1GNHA 2RS33 1VBA3 4XUQA 5I8YA 2DVAA 2XQXA 5DAXA 3KS7A 2ZZQA 2JEMA 3KF3A 2VXRA 2A7AA 1NCRC 1CAUB 1L3JA 1YJKA 2VGDA 4JKMA 4O65A 4B7EA 4QXKA 3VDAA 2ZS6B 1BEV3 1MACA 4KBBA 5LW9A 4K21A 3I2GA 4ZZ5A 1OOPA 4GD4A 2PXJA 2GH8A 2NM1A 2JG9C 4LO4B 1F5FA 1RMU1 3PUAA 5FBZA 4AI1A 1F8VA 4EZHA 4IGOA 1DBNA 2ZZJA 1ZBA3 2EF6A 4DUXA 1NLSA 5KR7A 1OA3A 2I2SA 4LKSA 4LOSA 1LKNA 3OD4A 4CU6A 3HBKA 4IE0A 3CL1A 2Y6JA 2W1UA 2PLV3 1RUC2 4B4RA 4R8HA 3L9JT 1VBA2 4E2QA 4TN7A 1ULEA 5ANNA 4BWOA 2CV6A 4CDQA 4HSLA 4UFKA 3ZDVA 3MUZ1 4BQXA 4E8DA 3BU7A 4V2VA 1V6MA 4WM8C 3Q8CA 1X33A 3U11A 3UGFA 2R1DA 1X9TA 1YQ6A 2Q8CA 2A5ZA 2EIBA 3J8F1 1BEV2 1YIFA 4C0BA 4Q2FA 1RUG1 4W65A 5C5UA 3NAPA 1WD4A 5T50A 5C3RA 3A7QA 2NN8A 5FYYA 5FMOL 3WNMA 1JHJA 4QX3A 2A73B 4XUTA 1BJQA 1ZBA2 1W6QB 3BN6A 1C8M3 4QWNA 5IHRA 4FP3A 4B8EA 5DPNA 4PJYA 5IK4A 1SCSA 1SLCA 2GC3A 5F6LB 5L7OC 1S0CA 3WF4A 1ULDA 5FZ3A 4I02A 2PLV2 3N35A 3LSEA 1GNZA 1QF3A 3AJYA 2QFEA 3VBSB 3OGJA 1TZOA 3RMXA 5FPUA 2RJLA 2Y38A 4X6QB 1UAIA 2GC2A 2E51A 2VMDA 5EJ1B 3GYDA 5IVYA 1GOFA 2E32A 1O59A 2HWC3 1QJY3 2ZEWA 2R30A 3IDEA 4OZXA 5DZGA 5I0DA 2FDIA 3PU3A 4IESA 2OQ7A 1PX3A 4UFIA 5A6QA 1SPPA 4IEXA 2XVGA 2ZAHA 3TB0A 4ATEA 4QDQA 1H4HA 2WT2A 3LD8A 1JOJA 2QVSB 4AE2A 4DXSA 4E27A 3I3MA 4RS5B 1C8M2 2J1RA 5CADA 1V6JA 2IUWA 1CAWA 3JUUA 4Y1YA 4AEDC 3S7EA 2CGOA 3ACFA 5F9TA 3VD3A 3AMNA 4JGZA 2OKXA 3K2OA 3MO4A 1CZSA 4XJUA 5KHKA 2VTFA 3SCFA 2VMHA 1NXD1 1NY72 1UOJA 2BJSA 2K0GA 4IV3B 4JKKA 4XE9A 3RFRA 1AF9A 2DCZA 4EN0A 1Y4WA 2C5DA 3P3NA 3S0MA 1UMHA 2IXJA 2Y0IA 3IZOA 3R4SA 2HWC2 4MSVA 2QZ2A 1QJY2 1AVBA 3WNLA 1ZRFA 4Y3OA 2AENA 3KHBA 1UMIA 3LPFA 5FZEA 3JZVA 1LU2A 3O0WA 4GWIA 2DVGA 2W39A 2DV9A 5GM0A 3VBRB 1S4CA 5FO8B 1B35B 1DG6A 4CDWC 2DFCA 5JI7A 1MS3A 1R091 2W0XA 3ELNA 3LEKA 1W8WA 3NWKA 5HCFA 4SBVA 5CFDA 1W9WA 5JVVA 5CFCA 1EP0A 2BUKA 4QKBA 4XFIA 4RR3C 2F4PA 2YFUA 3E6BA 4FCAA 1YO8A 1CZTA 2EALA 4NWVA 1CR7A 5EV7A 3PDQA 1OOPB 3MYXA 1BYHA 1MR5A 3JCIA 2GAUA 3DYMA 4PDWC 3DUIA 1MVQA 2VY0A 5A7QA 1UQXA 5FZ0A 2Q0AA 3V0BA 5LCWL 2RM21 1WMXA 5EQUA 3NKGA 3LWCA 4NRPA 2IXKA 2RMU1 5BXXA 1W8OA 3VDCA 5FY4A 5CISA 2IXLA 4LA3A 3LOBA 4E8CA 3FHAA 3IMMA 2D43A 4CUBA 2WT1A 1JZ2A 1I1EA 4H55A 1Y7BA 1NCRA 4L2NA 5KHHA 3THTA 3OPTA 3UT0A 4CDQB 1JODA 1C5HA 4ZXEA 4I0AA 5IFTA 5C9AC 3POEA 3IT8A 4RHV1 2PELA 1V6NA 1STMA 1UN1A 4LBNA 2VCMA 4TZDA 4IE5A 1EV13 3NAPB 1YYNA 1RMU3 1E5SA 1CPNA 3ETQA 4M00A 3RYRA 2Y33A 3PMSA 1DF0A 2WN2A 4CDXA 1QJFA 4FFGA 3VHPA 5IVBA 2VQTA 3OGGA 1VBC1 2YBPA 4XBNA 1FNYA 4N7IA 1MZEA 2ZGPA 3SXWA 4IQPA 3D0SA 4LHNA 3I97A 4JC1A 1LEMA 3SC7X 4AGVA 1UX6A 5D2AA 4BHPA 4EN7B 3RJ2X 1KRIA 1BLZA 3B9IA 3ES1A 3WW1A 4A7YA 4XZUG 2HEVF 3PHMA 3WP3A 4D69A 5IVEA 4CEYC 4HETA 1PM4A 1OKQA 1QWRA 2GP3A 4QB2A 4EYUA 4EQVA 3BKZA 3EB7A 1V9U1 4ARYA 2ETEA 1TNRA 1WMFA 1S0IA 5L9VA 5FZBA 2DWRA 1GANA 2ZXQA 3PUIA 4LBMA 3HQXA 3ZSKA 1G9AA 1GWKA 3U10A 1RVF1 2ZX2A 3J8F3 3AP5A 4C91A 1RUG3 1TNFA 5EP9A 4P9GA 4H7LA 4XJ9A 1EV12 3HEIA 1SPPB 4NHKA 1CN1A 4PF1A 4JGYC 5FY1A 1RMU2 3DECA 4CP0A 1UKGA 1XE0A 3LE0A 3M1HA 2D5HA 2RS13 4AEKA 4AHYA 3SKVA 4YZ2A 1FATA 2DCKA 3FWEA 3IN9A 4XDQA 1CAWB 4PLNA 1AJKA 1UY1A 3IDAA 4JGZB 3VKNA 1R1ZA 2VBBA 1AXYA 2QBXA 1Y43B 5FZHA 1GQPA 1PVC3 1UYPA 1JUIA 4CCLA 2ZEYA 3C7HA 3TN93 1Y9QA 3UGGA 4CVUA 2RV9A 3NVCA 3JXSA 2BGCA 2JG8A 1NE6A 5IATA 3J8F2 3OG2A 3T08A 3K77A 1RUG2 2C4XA 2QQLA 4MGSA 2WAAA 4P9JA 3RZHA 1QKQA 5A33A 4LO7A 3BGAA 3I2JA 4OI1A 1W6OA 3K51A 4XMAA 4IXLA 1ND3A 1PHMA 4AEDA 1N1TA 4QHZA 4KU7A 1WGPA 2RS12 3DGTA 5DUXA 5IW0A 1FAYA 3BU0A 2QQKA 2VOKA 5CFDB 1M06G 2JDPA 1UWWA 2D6PA 5CFCB 4LE4A 1DGWX 3S7IA 4NOTA 3WP6A 5FYIA 1MPXA 2LS6A 1AX2A 3RQ0A 4E4SA 1C8NA 2R0HA 2VW0A 3ZPYA 1PVC2 1H1MA 4OUEA 3ASIA 3D8CA 4K1ZA 1WW4A 3BODA 1JMUB 2GDFA 3TN92 3O1MA 3WNKA 3Q9OA 4DPNA 2VL4A 2DUPA 4PI0A 5CNAA 5FYBA 4D6QA 3OBAA 4HK8A 1IS3A 2R32A 2UU8A 2XVKA 1V0AA 1PVXA 3HN1A 3ZN6A 4KGQA 4LK7A 1A3KA 3V0BB 4QX7A 5BNNA 2P4EA 3GCXA 4BQ1A 3ZR5A 1UYZA 3MI8A 5LY1A 1CPMA 3H8UA 1TVGA 4Q4Y2 4RGGA 1PGL1 4I2OA 2P3IA 1C57A 2D6NA 3NNJA 4QB6A 1NCRB 4PCRA 1RUH1 1VBB3 3FLRA 4LJHA 3RNSA 4BJ0A 1W99A 2RHPA 2JB4A 4XFBA 3L2YA 1W8NA 4XHBA 4Y5SA 5CU1A 3ZYFA 5ACA1 3KCXA 4CCJA 2BW8A 2E9QA 3CNAA 4DUWA 5HI0A 2ZX3A 1AYN1 4Q26A 2BBVA 3EXUA 5BNOC 1GMMA 3PUSA 4PDWA 4R9AA 1AR63 3BIWE 1RUD1 3VBOC 4ATFA 2BNNA 2ERFA 2WIIB 4UWDA 1CVNA 5FKCA 1UZYA 2CDPA 2E6VA 3NSTA 1JZ8A 4MGTA 4RSUA 5IVVA 2FZ1A 1BVVA 2V5DA 1ZYBA 3LFMA 1WA6X 4CDXB 5KXEA 4NIGA 4Y1UA 4LA2A 2RM23 3P1IA 2WS91 2MEV1 2P2KA 1QEXA 4IGQA 2VZUA 2A70A 4LIUA 2WKKA 3T4HB 3LA7A 3T2OA 1W05A 2A71A 1XNDA 1LB2A 3CZUA 1GNYA 1SDWA 4DRVA 3Q8FA 1YQ5A 1VBB2 2KR2A 5FP9A 3RGBA 4CEWA 1JYXA 4UFLA 1JYNA 2P34A 3CJXA 4N7UA 4RHV3 1ZRDA 3MBWA 5FZKA 2N7GA 3GBFA 2ZX4A 2ZEZA 3FJSA 3V0AB 1AR62 4OHYA 3DF0A 3GBGA 1QH7A 2VUJA 4YGDA 4GMP0 2VULA 4XW3A 2O1QA 3QH7A 3ZSJA 1POV1 2X53S 4MXWA 4F8AA 4YZ5A 2WZR2 5FIXA 3F95A 5GZDA 5KWRA 4CEYA 5DG1A 2VPVA 4NHMA 5C71A 3TNPB 5B4XA 3HIFA 4GXLA 5LA9A 2J42A 4MOAA 1RUI1 1HB3A 3RZLA 4CCNA 1SLBA 2QQVA 5GZFA 4DS0A 4YW4A 2C1FA 2ZHMA 4AAPA 2H6CA 3Q8AA 2LW8A 2JG8B 3B01A 2UY8A 1NE4A 4LMFA 4QKNA 4BXSV 1RVF3 4DB5A 5J1XA 1O3SA 4NIDA 2K46A 2R071 3WR0A 3I54A 3VBHA 3ALQA 4LNVA 4LHKA 3H3UA 3H42B 5A33B 5FQ0A 1W8UA 5GLTA 5IYYA 1MZ5A 3QD6A 4HVRA 3UYJA 1W6OB 4B1LA 4JDOA 3I49A 1ND3B 2IWGB 2FDHA 3LIHA 4AEDB 1IHMA 2XLGA 3E5QA 4IEQA 1OPOA 4CP2A 2VNGA 2VCBA 3NQHA 1JZ5A 2BVVA 3I2IA 4L8QA 2JKXA 4D8MA 3D3AA 1LHVA 3PTRB 2LALA 3H1YA 1SDDB 3SCGA 2GC1A 4P02B 4Q4X1 5DUVA 4P00B 5CAZA 5HCBA 3ZPOA 2PA7A 2YU1A 1PO11 2GALA 4KG0A 4IV1A 4UOJA 2QCSB 4AI8A 2EXKA 3QACA 1FPN1 4KWJA 1WLTA 1CGPA 1OHFA 3GHMA 3I2HA 5FMBA 3ZN6B 4A7KA 1DFQA 3RI8A 1RVF2 3LIGA 3POIA 4K8FA 4MVTA 4DEVA 2G19A 4R9CA 2RVAA 2ZTNA 1QNWA 3CO2A 5C5TA 4FBFA 1YFXA 2C9KA 3OBZA 5BNNB 4LK6A 3WINE 4EN6B 1DU3D 1IG0A 5FYTA 3D6EA 1WUVA 3OSDA 3A4UA 1Q8PA 3LEGA 1UYYA 4FFIA 1DIWA 4J1WA 3N7MA 5E1RA 4GULA 3NV3A 5IVCA 3BOPA 1AX0A 2DDUA 1Q56A 4H14A 1VPHA 5FK8A 1PZ8A 2DUOA 2LM3A 1E5RA 3JQWA 1PM7A 4LBQA 1X7NA 1MS4A 3R05A 5JSPA 4MGQA 2Y6HA 3HMYA 4PDWB 4BZ4A 3OGRA 4FOQA 1XC6A 2BOJA 4KH9A 3UKVA 3VKMA 1W04A 1SBEA 3K46A 1CAXA 1AL0G 2GMEA 2WDBA 1HXS1 1UOFA 3J7HA 4QGMA 3B02A 3WSOA 3BTXA 4LO6B 5HPOA 2WSVA 2HWF1 1OH3A 1IGOA 1KS5A 3H0OA 1PMIA 1H8VA 5ERLA 4C1XA 4RS5C 1X8EA 4D3WA 5CG9A 1ST8A 2PHLA 5JR2A 1W2UA 3VUOA 5B4NA 5A3UA 2D93A 2VBDA 4A44A 4COYA 2ORZA 5CBLA 3ZYRA 3M3OA 3SISA 3ZYJB 1QH6A 1JUHA 1RJ7A 2HEWF 3ETPA 4IV3C 1LESA 4AHWA 4CEWB 4PBOA 4RD7A 2YZ4A 5FZFA 5ACA3 2BYVE 3ROUA 4AGGA 3G7DA 1VIWB 1U5IA 3BB6A 4LUKA 1GQHA 2XMLA 4B4QA 1SFNA 4XF0A 1B09A 2QQMA 3T3YA 4Q0VA 1RUD3 3UETA 3SKJE 4XCAA 2FMYA 2XGXA 3AMHA 3INAA 3K4AA 3ORJA 3M70A 4Q4W1 5F32A 1JTZX 1LU1A 5IJRA 3ZYIB 2DU1A 5EHDA 3POWA 1B35C 1X50A 1H1IA 4LBQD 2AEZA 4MXWB 4ONUA 5IK8A 1Q3EA 2MEV3 4HANA 1K5MC 3WCSA 3ZSEA 4W8JA 3VZKA 5LB6A 1O3QA 3N9MA 4AF9A 4FOWA 4CEYB 3PVOA 4FVVA 4HKWA 4E2GA 2DBNA 1QJEA 1OFSA 2J1SA 3K75B 2YB7A 3ZXJA 2GSYA 5C3PA 2VXJA 4QPWA 5ACA2 3ST7A 5EYXA 1OOPC 2TEPA 4B1MA 1WCSA 1ZBE3 5CB7A 5JOYA
chains in the Genus database with same CATH topology
4YW3A 4D7TA 2PHWA 3LOIA 3VBHB 2E53A 4PIZA 1RUD2 4Q0UA 5FQ0B 2K2SA 1WMEA 1MS9A 2FHRA 4YGCA 1O3TA 1YIPA 1PO21 2AUYA 2D6MA 4Q1PA 1POV3 3OJBA 1N1VA 1S2KA 1WW6A 1NOVA 2IXIA 4CDQC 4BMEA 3H50A 1V6KA 2YXSA 1RUI3 2ILMA 4P9IA 5JIUA 1V6LA 4IV1B 2OZJA 2QE3A 1NA1A 2WSUA 1JW6A 4IEVA 4XMIA 1ZBE2 3W9AA 2R073 3MLJA 2VG9A 2YUEA 1QJX3 1S0BA 3JBG1 3VN4A 5JOWA 1C4RA 1MS1A 3HT2A 2W68A 2YGMA 1HX6A 1EY2A 2A6XA 1YFYA 2JKBA 2XJSA 3DKWA 3IDBB 4LT5A 5DUUA 3VHRA 3B94A 1CX4A 1NQJA 4QPIA 1R083 3DPRC 4XTMA 4Q4X3 4LBQB 1LHUA 1GKBA 1J59A 1RUI2 2JENA 2R6QA 2ZGRA 5FOBB 1PO13 3OF1A 2XWBB 4X6RB 2BWCA 2XL7A 1CAXB 1FPN3 1HV0A 3FE5A 3VBFA 1JH5A 3FFZA 1I3HA 2R072 5J36A 4HLTA 2CAUA 3DL3A 1QJX2 2P3JA 5C4WA 5T55A 2OYZA 4FOYA 5T3NA 4Y1VA 4BA6A 4JGZC 1BMV1 3ZXEA 5GZGA 1Q8SA 1R082 4EWAA 3ZIWA 4C1WA 2GU9A 3V0AA 2A6ZA 1S0GA 3JB8A 3ILRA 2ZGOA 3E6DA 3QH6A 1PO12 2WJSA 1FPN2 1HXS3 1W39A 2PHXA 1CJDA 2JD4A 1DDLA 4CZSA 3B5LB 3AYCA 2QDNA 3MPBA 4GQ7A 4OVEA 2FMDA 5CFDC 2PHRA 1VALA 5SV8A 5CFCC 4WVZA 2VNOA 3PNAA 2XJQA 3NV4A 3WT3A 1S2BA 4LO8A 4AHZA 2GMPA 1Z0HA 4TYSA 4COVA 4QMAA 5H9RA 3VHOA 2UYAA 2GC0A 3CJIC 2UWCA 4HN1A 3VGIA 3OY8A 3H7JA 4BLIA 1FYUA 4Q4W3 4XF9A 1HXS2 1K5MA 3B3QE 4IL7A 4L97A 1S0JA 1JYIA 4FTSA 1DLLA 1ZZ9A 4XQDA 3S30A 1NG0A 2ZCWA 1KFUL 1XYNA 1BVP1 2XHKA 3APBA 2VQ0A 3IPVA 4EN9B 4GWNA 5JSRA 1VBE3 3OPZA 1GQGA 3TAYA 4BYYA 1DQ1A 3B93A 4RL7A 1VR3A 2DVBA 2EAAA 3CEWA 3MIHA 1NA1B 3N4MA 2X5IA 2ZKLA 2UWAA 2PN5A 3M7AA 1BBT1 2Z2SB 3J26N 1ULGA 3UKNA 4QGNA 1HKDA 4MZUA 4CDXC 3SHRA 5DDJ1 1H2MA 3UKTA 2KXLA 1QXJA 2RS32 3B9CA 5D1IA 1PO23 3WZ1A 4CDUC 1YUDA 1PZ7A 1N3QA 2BFUL 5BY5A 3D4KA 4QPIB 4DY5A 1LGBA 4QPYA 4KNCA 1GFF2 1VBE2 4SLIA 1GLHA 2XJTA 4ZU5A 5T5JA 3ZXKA 4MLOA 5I8TA 1ENRA 4P9LA 3SLIA 1GBGA 2VU9A 3TRSB 4BPZA 3VBFB 1SLIA 4JVAA 4YG3A 4DQAA 1OA4A 3JBG3 5C6CA 1VBD3 2GN3A 1XNCA 1QJU3 5C4WB 2GNTA 3PVEA 1S0DA 4ASLA 3DPRA 4TLFA 3I59A 1N3PA 2P37A 3IKWA 4RA0A 3ILNA 4C90A 5EFUA 4AVVA 4MYEA 3AZYA 4WM7A 2WFF3 1GYKA 4JTOA 2FQPA 3AKSA 3IBMA 3ZN4A 4GH4A 3SITA 4AI3A 3V0AB 2I07B 2JG8C 2VH9A 2JE9A 4S2DA 1TME1 3P3PA 2V5YA 1FNZA 3GALA 4AGRA 1OLQA 3VZNA 3KMHA 4L99A 3WUCA 1RUJ1 4AFBA 1ND3C 4Q1RA 1LODA 3JBG2 1VBD2 1QJU2 1Z7S1 4TWTA 4FPYA 4XIKA 4BE3A 3MDPA 1ENQA 1D2QA 2YGLA 3ZDSA 2WT0A 3ZSLA 1AR83 2K9ZA 2WFF2 5SV5A 5JI9A 5FLIA 2AH2A 3RYPA 3WQ7A 3OY8B 2LUWA 5FCCA 4ZU4A 1LRHA 3WV6A 5BNNC 1C5IA 1K5MB 2H0BA 3EQEA 4AFCA 1BK1A 1RB8G 4QQ2A 3ILFA 3IPVB 1ZX5A 3E5XA 5C8CA 3I8TA 3IMNA 4OFGA 2OPKA 3GHNA 4FOVA 4NR1A 5E8AA 5EJ3A 3R0RA 3WDUA 2ARBA 4JRLA 3AYAA 1AR82 2X5IB 3CJIA 3OYWA 1COV1 1NCQA 3H7YA 4GALA 5F5QA 2R16A 2P17A 1G9CA 3N7JA 1W0OA 1GZWA 3HR9A 4E2SA 4Q0SA 3WDVA 4GA9A 1UU5A 4I3PA 4XXPA 1AR71 2WLPA 1MS0A 3WX5A 2QDRA 5FREA 3DN7A 2QKDA 5TSWA 1ZZBA 4D7SA 5FLJA 2ZX1A 4LHLA 3ZXGA 4CEWC 4COWA 4MGKE 4YG0A 3AP7A 1RHI1 1XE7A 1A78A 4FQZA 2BTVC 1SEFA 2AZ5A 4QT6A 1MS8A 1WCKA 1FMD1 2XJRA 2CY6A 1AUYA 3RWNA 1Q43A 1RIRA 1LCLA 1UD1A 1QY4A 1RUE1 5BNPA 2B42B 2JECA 2BEOA 2MPFA 4CDUA 4CRQA 2GMMA 2ZOEB 4QD2A 4YSFA 2AR6A 4OI0A 1ULFA 3DPRB 1AZDA 3I59B 4E9KA 4KWLA 3IDCB 5LK5A 3GF6A 4WM7B 5D8AA 5LK7B 4Q27A 5IK7A 3G6JB 4A2UA 4GH4B 3NV1A 2OW4A 3SH3A 4S2HA 1CQ9A 4DOUA 1O3RA 2OA2A 4GWMA 3VBHC 5JSOA 2CTVA 4DY3A 3W58A 1UPSA 2CAVA 3ZVXA 2NZ9A 2D3SA 3QLQA 3HD8B 4COUA 2CWSA 2VMGA 4HVQA 4K6BA 1F2NA 2ET1A 1O5UA 1FI2A 2Z42A 2DUQA 3CLPA 4RQPA 3M3CA 2CGPA 1J3PA 4G4FA 4XZPA 1T6GC 1NXMA 2VW1A 1UU4A 4N43C 4IV1C 1Q8VA 4BCUA 4OLLA 4YGEA 2DVDA 1DGRA 1VP6A 1TME3 3C3VA 3U0ZA 3JD71 1ZM1A 1WBFA 2G9FA 1RUJ3 5AVAA 4GKYA 2CWMA 2HYKA 1XRUA 4LEJA 4YARA 1QDCA 3MEPA 5C8CB 4L11A 1KFXL 3ZSMA 5FPZA 4AEMA 1WW7A 3POYA 3EBRA 2FZ2A 4AVTA 1TQ5A 5T5OA 3CJIB 3OYWB 1NCQB 1SMVA 2UWBA 4AG4A 5I93A 1LENA 2ENRA 1REFA 1GZWB 5EZWA 4EWDA 1AJOA 2WA4A 5KC5A 1S1AA 4IEWA 1TME2 4XFCA 4ES9A 1R093 1PGW1 3BPZA 3TWIA 4QQHA 1VJ2A 1GR3A 2EIGA 1RUJ2 4ASMB 5KHJA 2YYOA 2JDZA 2XKPA 3IIAA 1YRZA 3VKOA 1MQTC 2VNRA 4XYXA 4BM8A 1G6NA 1LGNA 1ND2C 4AFDA 4K40A 2XLFA 1SBDA 2BNMA 2F6BA 1YCIA 1DGLA 4QX5A 1YNAA 2Q8OA 2A3XA 2ZGQA 3J4UH 4PQ9A 1U5YA 1HRV1 2TUNA 3E5UA 1D4VB 4MX3A 5BNPB 2RMU3 4XOGA 4CDUB 4IEUA 3ZXAC 2GNBA 5T52A 5K8SA 1R092 1AR73 1EAH1 5ABJA 4M3CF 3MLLA 2EAKA 5D8AB 3RDIA 1OMIA 1UIJA 4K3UA 1RHI3 3QOPA 1EPZA 3PJYA 4WBBA 5GZCA 1WLDA 1LULA 3KQRA 5I8SA 1EYBA 2D6OX 4YM0A 3LZZA 4XF3A 4M3CE 1RC6A 4FPOB 1VBC3 2RM22 4OI4A 2XVLA 3USUA 4BIOA 5B2GB 2D7FA 1RUE3 4LBJA 4YM1A 2RMU2 2I45A 1KDKA 1DQ5A 4YNIA 3UV9A 3C2UA 4GKXA 5HXVA 3SH4A 2IFRA 4OHWA 1AR72 3R4UA 5FTTC 4RQPB 1XXNA 4JDMA 1V9U3 4M0HA 2NYYA 1D4M1 2VVFA 4RHV2 3D82A 2A6WA 3I4IA 4LUMA 3MF6A 2HWE1 4XFAA 1PZ9A 1NA1C 4MUVA 5AFBA 1RHI2 1DQ2A 3VHNA 3NKTA 4YW1A 1J58A 3URFA 4PIXA 3FC0A 5J3UA 4XIOA 4C0HA 3ZMOA 2D44A 2V09A 3A0KA 4XPVA 3WW2A 1I9RA 4ORFA 1VBC2 2XWJB 1RUE2 5JWPA 3JQXA 2WL1A 1O4YA 5I0TA 1AL21 3WW3A 2IFWA 3M2MA 4QPIC 3PMEA 1I6XA 4JQRA 2E7QA 5GZEA 1V6OA 3UL2A 4N43A 3ZN5A 1V9U2 3MPPG 2PTMA 1C1FA 4UXAA 2Y0OA 2Q5TA 3VBFC 1H9WA 3JD73 4P9WA 1Q5OA 1UCXA 1EPWA 4PIYA 2DYCA 1HW5A 1OSGA 4I0BA 5KXBA 5C4WC 4AFMA 3KT4A 2HWD1 3KCYA 4ZU7A 5T54A 5IT6A 3RPQA 1H2NA 2OIIA 4P14A 2R041 2DTYA 4NPRA 5FFOC 4YVSC 2C9AA 2OUJA 5GLUA 3H1WA 1JN2P 5L19A 5DG2A 4DNYA 3B00A 1SBFA 1WD3A 2VMIA 2VW2A 3WG2A 3FLPA 3VLBB 3JD72 3VZLA 1C1LA 4J6GA 1DZQA 3WD5A 1F9KA 4LO5B 4NWWA 5T5LA 1RUH3 4KGGA 5KXDA 1QXPA 1HQLA 1MQTA 4QQOA 5ABJB 4Y4YA 1ND2A 4FPHA 1AYN3 4Y20A 4TSVA 3FUOA 3RI9A 4YW2A 3VZJA 1ZZCA 3MIBA 4LULA 3O5SA 4HKOA 3VL8A 2DCYA 4ISRA 2XLAA 4HFSA 3WDXA 3WP4A 4CTEA 3AXDA 4WZFA 2WS93 5KBFA 3ME2A 1ONAA 1HRV3 3USUB 3LB9A 5L73A 3N7LA 5J48A 4UBGA 3WDWA 1HQNA 1TMF1 1PGL2 1EAH3 1QNYA 1O7FA 1NLRA 1RUH2 2XH6A 1BXHA 3GNEA 3WQ1A 3AYEA 4BOWA 3GZTB 1QOSA 3WOGA 1UW8A 1J3QA 2GZWA 3MIFA 1AYN2 5J7MA 1VB4A 4NVPA 2X5IC 4IEPA 1R1A1 4F7ZA 2ZMLA 1DHKB 3ZFGA 5E88A 2R1BA 1FOD1 4XQ4A 1ENSA 2A6YA 1BEV1 4M0NA 3ZXFA 4AXOA 2WS92 3BOWA 1HRV2 2MEV2 5A32A 2B45X 4YFWA 1IPKA 1EAH2 4WVMA 5FAXA 3AZVA 2AREA 4N43B 5BV6A 1VLNA 1MZ6A 1MEC1 4YGBA 2I74A 3O14A 2XJUA 1PK6A 4FPJA 1H30A 3M3EA 1KJLA 4EV0A 5CG8A 4P9YA 4CYDA 5A3LA 2JJ6A 1AL23 1PGSA 2GN7A 4WM7C 2PHFA 1POV0 2ZGLA 3W59A 2XB6C 5JDBA 4QQPA 4Q29A 4GH4C 1A8MA 4I01A 1AYM1 3BALA 4AQTA 1YFWA 2CNAA 1GSLA 1NY71 3WY6A 5BYNA 3EHKA 1QGLA 1S55A 1UIKA 5JZGA 3VKLA 4V1PA 1H0BA 5FLHA 4FT8A 4MH0E 5J98B 1VAKA 4HSJA 1ZNPA 2VOVA 2KM2A 2ZMNA 5K0UA 5KXCA 1SLLA 2OUHA 1BKZA 4ISQA 1E57A 3V65A 4OI2A 1MQTB 4XF1A 2MNGA 4YVSA 4UW6A 1ND2B 4Q4X2 4QGLA 4Y20B 2HJIA 1ALYA 2ZKNA 1OI6A 1J1TA 3AKQA 3QCWA 2EXHA 4XQWA 1UF2C 3MW2A 5BUVA 2QNKA 1KD7A 1AR91 1LEDA 3D0JA 4YM2A 2SLIA 1REDA 2HWF3 2Z69A 1H8TA 2PHTA 1N1YA 4XETA 2ES3A 2VECA 5E16A 1YWKA 4Y24A 4HBNA 3WHUA 3FHIB 3FUQA 3H1MA 5AVPA 5C8CC 3AKPA 2DFBA 1HLCA 2B39A 3SH5A 5L36A 4OHVA 1D0HA 3MZHA 1RUNA 3R6SA 4G3YC 1NCQC 2WZPP 4FAGA 3KB5A 3ZFGB 3T1LA 1AXKA 1YLLA 3POSA 4AVAA 4QPGC 4FXKB 3GZUC 3AZXA 3H9AA 3OTFA 2DU0A 2BFUS 2O8OA 2HWF2 2HWB1 3B69A 1G7YA 2RJKA 5A32B 3SNMA 2OVUA 1TMF3 3CU7A 2DCTA 4ITCA 3AXEA 3E6CC 3AMMA 4WVMB 4N53A 5BPXA 5JR7B 1RL3A 5FMOS 3TOJA 1IZ3A 4AYUA 5FO7B 3TBDA 4OULA 2XG3A 4U36A 2ZGSA 1KJRA 1R1A3 5JMCA 3KSCA 1UPIA 4M3CA 2NQYA 4R4XA 1FOD3 1PK6B 4Q4W2 1G8WA 5BNPC 3AP4A 2OZ6A 5JLVA 2NLRA 3S6PA 5CVRA 3MICA 2Q4SA 1KITA 4YVWC 3PVNA 1APNA 3HAGA 4Q0PA 3MGUA 1EV11 5GALA 4LE3A 1TMF2 4OHZA 1HRI1 3AK0A 1LOFA 4S2FA 4YZ4A 5D8AC 1CONA 2XL9A 1W6MA 1MEC3 1CJPA 3K48A 4PF5A 1BCXA 4R9BA 1ASJ1 5A3MA 4Q8KA 3NW4A 1SLAA 1R1A2 3LKJA 4IERA 3KGZA 1PNFA 4YG6A 3ZFEA 5JZGB 2D40A 4YFZA 3KT1A 1FOD2 1N3OA 2IXCA 1ZREA 3VL9A 1PO22 5F1RA 5K9YA 3UJOA 2ZGUA 2VOXA 2A6VA 4FPCA 4PLOA 5K0UB 2TNFA 4B4PA 4DMIA 4H3WA 3KZ4C 5LRRA 1IPJA 2YROA 4RQPC 4YVSB 2ZABA 3RG0A 2QQPA 2RS11 3JB4C 2YHJA 5E89A 3KM5A 4ZKTB 2ZACA 1AYM3 1C3HA 5AFEA 2NP0A 1MEC2 4Z82A 1RJ8A 1G86A 3WW4A 1PVC1 1V70A 1LOEA 2SBAA 2XBO1 3IM0A 2HKXA 3TN91 3N36A 4L92A 3UJQA 1H8TB 2B46X 1REEA 1AHSA 2WNVC 3WCRA 1IS4A 4FPLA 4IEOA 2D3PA 4AQ6A 1YXWA 2YMZA 2O0OA 4RGAA 1RUF1 4XTPA 3RS6A 2PAEA 1TE1B 4K20A 3MW3A 3VKFC 4XJ8A 2A3WA 4Q4Y1 4W6YA 2D6KA 1FXZA 2ZA9A 3AKRA 4MGIE 4DZGA 1OLRA 2Z5WA 3N3HA 4DINB 4FPKA 4MGYE 4HT1T 2R061 5JOXA 3NJZA 1IKPA 4DXZA 1AYM2 3VV1A 2DVFA 3CF6E 4I09A 1AR93 5I0SA 4Q0QA 3VDDA 4KU8A 4AW7A 4Z07A 1W0PA 3L2HA 4YYOA 4XJAA 3MLKA 3MW4A 3AMPA 2WFPA 3OCPA 4GB31 4EWEA 3J9SA 4Q8LA 5CIRA 3X29B 1BMV2 4QM9A 1MVEA 4N53B 1G9FA 1QXRA 2WLQA 1LJ7A 1ZA4A 1OA2A 4JTNA 3WVJA 1Q8OA 3PVBB 1J3RA 1LHNA 1FX5A 4QPGA 1VBB1 5BNQA 1DZTA 2W52A 5GLWA 2Q1ZB 4M3CB 4GMP1 1PIV1 3AKTA 2ZGTA 1AR92 1CAVA 2A75A 3OBRA 4X8NA 1WLWA 1AR61 1O5LA 2HWB3 2ZX0A 5DXDA 1ULCA 4I30A 4H7MA 4Y26A 3ZFFC 1A8DA 2V73A 5ABJC 4LBKA 2FBEA 1MS5A 5HCAA 2WZR1 2NMNA 2CL2A 1D2SA 3LSDA 1I5ZA 1U5XA 1W6MB 1QMJA 3USSA 5C8WA 4FQ4A 1WMDA 2RE9A 1BBT3 1QQP1 1YI9A 4B7KA 2BVBA 3MFAA 1JXNA 2D3RA 4YZ1A 3ENRA 3ZFEB 1VRH1 5DDJ3 3VBUC 2PQQA 4EROA 4YVWA 1DGWA 1Z78A 4NO4A 4EJRA 2JG9A 1KQRA 4AQ2A 5AC91 1DGRN 2EXJA 4HZFA 2ZAAA 3FX3A 2E7TA 1F5JA 1HIXA 1H4GA 4LBOA 5IUQA 2HWB2 3ZIXA 1QOTA 2EVXA 1LGCA 4XFFA 1ZZ7A 3E97A 1HRI3 4AVBA 1U12A 3HT1A 2E63A 1ZRCA 2D98A 4FAHA 4JCKA 2ARXA 4FXGB 1BBT2 1UL9A 4WM8A 5DUWA 1ASJ3 4OUMA 3MIGA 1U0AA 2YV8A 4HPKA 3I2DA 2WNUC 5DDJ2 5J96B 4AWDA 1QOOA 3O0XA 3MIDA 3I7DA 4HN0A 4HMZA 1JBCA 1YFUA 4Z1VA 1CESA 1ZZ8A 4DRRA 1VAVA 3ZMNA 1OPMA 3LA3A 3EO6A 1OQEA 4N9IA 3ZYGA 4ES8A 3H3ZA 1M4WA 1Q8QA 1O4ZA 1OQ1A 1SFYA 1QDOA 3OD0A 4URTA 5L7OA 4B3NA 3OBTA 4FSJA 1HRI2 2MHFA 5H9SA 1LHOA 2HEYF 2ET7A 1D0GA 4HVOA 3JU9A 4B29A 5FPXA 5FOJB 3VDDB 1ASJ2 2WNVA 4OHXA 2G4IA 4XF4A 1S0EA 2XBO3 1H9PA 3T2TA 4JRAA 1Z7S3 2PFWA 3M3QA 5JCTA 1X82A 2RR11 1RUF3 4FPEA 5DZFA 3MF9A 3RZZA 3ECQA 2IZWA 4META 1J1LA 4J1XA 2VUAA 4Q4Y3 1S0FA 4YLZA 4QPGB 1IS5A 2R063 4MV2A 3O0VA 3AFKA 5J37A 1CD3G 1CAVB 2PYTA 2PHDA 1AX1A 1LOAA 3BTAA 1CIWA 4QM8A 1A6CA 2XBO2 3NV2A 4XJZA 4WZCA 5H9QA 2W08A 4KQ7A 1Z7S2 2ZMKA 2IC1A 4LR4A 3WNXA 3GBWA 1GZCA 4GB33 2PHUA 2WQZC 3RJRA 4CDWA 4R4ZA 3NO8A 1RUF2 4PLMA 4IEZA 2WWSA 1COV3 2JE7A 2AYHA 4R52A 4UW5A 4RR3A 5LEKA 2GNDA 3WLUA 1UU6A 1OQDA 2R062 3AB0A 4F3JA 4DFSA 4GMP3 1PIV3 4YVWB 2XKOA 4FP2A 3U4XA 1LECA 2BNOA 2JG9B 2R49A 3HWJA 4LLFA 1IQAA 1QHDA 2DTWA 4U2AA 3ZFFA 3MFCA 2XUMA 5T5PA 1N1SA