5FY9A

Crystal structure of the catalytic domain of human jarid1b in complex with pyruvate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
462
structure length
460
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLGGGGARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Pyruvate
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B, LYSINE-SPECIFIC DEMETHYLASE
total genus 141
structure length 460
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fy9A01
5FZOB 4QWNA 2XXZA 5FJKA 4CCJA 4D6QA 2WWUA 5FYUA 2Q8CA 5F3IA 5FY9A 2OX0A 3PU3A 2WWJA 5FXVA 3PUAA 5FZCA 5FZEA 5FYBA 3PUQA 4QXBA 2XDVA 3PDQA 5FV3A 5F5AA 4BXFA 5FZ7A 5FY5A 3N9QA 5FP9A 4GD4A 3AL6A 3AVRA 4QX7A 5FZIA 5F3CA 2OT7A 5CEHA 5FUPA 5F32A 4HONA 2XUEA 3PU8A 5FP7A 5FYMA 3DXTA 5A1LA 5FPBA 3KV6A 2YU1A 5FZDA 5FPUA 3KVAA 4EYUA 5FZHA 4UF0B 4BU2A 5FZ6A 4D6SA 2Q8DA 3LD8A 4EZ4A 1VRBA 4GJZA 5FZAA 3U78A 5F5IA 5FZOA 5F2SA 3PUSA 4NUBA 5FXXA 4CUGA 5KR7A 5FZLA 5FZ8A 5FYZA 4LIUA 5FZKA 3N9PA 5A7PA 5F2WA 4UF0A 5IVCA 5FWEA 5FYCA 5FYTA 2YBPA 5FZMA 3N9NA 3KVBA 5FXWA 4BISA 5A7OA 5IVFA 3OPTA 4CCKA 4CSWA 5FP8A 5FY0A 4HOOA 4Y3OA 3K3OA 3KV4A 4DIQA 5A7SA 5IVJA 5FWJA 3K2OA 5FPAA 4GJYA 2GP5A 5F37A 5K4LA 5A3NA 4LIVA 5FZ1A 3PTRB 5A3WA 4CCMA 5FPLA 4XDOA 5FXZA 4ASKA 5A3PA 5LW9A 3ZPOA 4C8DA 4DO0A 4CCOA 3AL5A 5FZ9A 5FZ4A 3DXUA 2XMLA 5A80A 5LY2A 4XDPA 3OPWA 4QX8A 5ANQA 4QU1A 5FPVA 2YBKA 5FP4A 5FYVA 5A3TA 5A7QA 2Q8EA 3UYJA 5FY1A 4IGQA 5FY7A 5E6HA 4QXHA 5ISLA 2YU2A 5FY4A 5FZ3A 2VD7A 5IVYA 5FJHA 4V2VA 4IGOA 5LY1A 5A7WB 4CCNA 4Y33A 5F3GA 5IW0A 4LXLA 4GAZA 5IWFA 4AAPA 4CCLA 5LWBA 3AVSA 3NJYA 4Y4RA 3N9OA 4QXCA 5FYSA 5FBJA 5FYIA 5F39A 2YBSA 4AI9A 5FP3A 2PXJA 5IVBA 5A7WA 2OS2A 3RVHA 2YPDA 3PURA 4E4HA 5IVVA 5FYYA 2P5BA 3ZLIA 5FZBA 2W2IA 5IVEA 5A7NA 3K3NA 5FY8A 4URAA 2OQ7A 5FUNA 3LDBA 5F3EA 4V2WA 2GP3A 4D6RA 3N9MA 3N9LA 3U4SA 4IGPA 3KV9A 4LITA 5A1FA 2OQ6A 5FZGA 4EZHA 5FZFA 5FYHA 5FZ0A 5F5CA 3KV5A 4TN7A
chains in the Genus database with same CATH superfamily
1I3HA 1AL22 3SKVA 2VZOA 1MZ6A 2XXZA 4XUNA 4JGYA 3OY8A 2DF7A 3TEYA 4HPKB 4YVSA 3TB0A 4TXWA 4GWIA 4B29A 5C3OA 4LK6A 5ERLA 1EUUA 2XLAA 3S5AA 1O8SA 4LPLA 2ATFA 4DUWA 1QJU3 1UQXA 4RYDA 5FZ7A 3VKFC 1R1A3 1AX2A 2HWD2 3VZJA 1XOYA 2D6PA 2DWRA 1OURA 4EN7B 2OPWA 4FAGA 5FZDA 2XQRA 4EYUA 4NIDA 3NVCA 3K4AA 2JDYA 4XCBA 1PO22 4EZ4A 2WAOA 4GJZA 2YMZA 1A8MA 5KHKA 5J7MA 1HB1A 4XTPA 2YV8A 2W39A 1RVF1 1UN1A 5K0UB 4FPJA 4LHSA 2BWCA 1RUD3 2X10A 5F2WA 4XDQA 3OOXA 5FYCA 1BEV1 2UWAA 3LPFA 5JUVA 2ZKLA 3JB4C 4AWDA 5A6YA 3RDIA 2WFF1 3ILRA 1WZXA 1V6JA 4FP2A 5AVAA 4HETA 5ABJA 2D40A 3DL3A 1OF4A 4MH0E 2VCBA 3WY6A 4CA9A 3T2TA 1JZ8A 2UY8A 4BDVB 4DIQA 2G19A 3VHPA 3ZM8A 1RUC1 1UKGA 4FPCA 4HN1A 1RINA 4IEYA 1PGSA 4JQTA 2CY6A 3GALA 4GB33 4XQWA 1V6IA 5F37A 4RHV3 1GOGA 1K5MC 2I45A 1QJFA 4Y1YA 1APNA 1SHWB 2HWB2 4P9GA 2ZGUA 1UU6A 4DZGA 1QF3A 2BZDA 3KSCA 3WLUA 1VBB1 2ADDA 5GLTA 4COWA 2RS32 4XUOA 2RDQA 2D6OX 5LK5A 4CDXC 2WZR3 1FPN2 4DFSA 4Y1XA 1GYKA 1HB3A 1AXYA 3KGLA 3TEWA 2A3WA 3O1TA 2VBDA 4QDQA 2D6KA 2QQOA 2Y6GA 3M3OA 2X29A 3K4ZA 2F17A 3OPZA 2VBPA 3VBOB 4LORA 4NAOA 1JZ7A 3KHCA 1WLWA 4PIYA 1HXS1 1KS4A 3LEGA 3O12A 3H42B 1WMDA 3PUHA 4XAAA 3I2OA 5T5JA 2YDEA 3WHUA 5HCHA 2WABA 4YYOA 1RUH1 3O14A 2YG0A 3V0AB 1FMD2 3TRSB 3ZMNA 4AFCA 2O14A 2WNOA 5J98B 1H1AA 5LWBA 1RUI3 4BQYA 2ENRA 1I5PA 2CAVA 2IVJA 4GZ9A 4K40A 4QXCA 1IPKA 5FYSA 3RZJA 4Q1PA 4R9DA 5K9YA 5T5PA 1O8PA 5A7WA 2ARXA 1C8M3 1RJ7A 1VBA3 1ZRFA 4MVTA 3UGHA 2VQAA 5FZBA 3AK0A 3LA7A 3C8XA 3LEMA 3OB8A 3USUB 4SLIA 4HANA 5FY8A 1AR83 2BDRA 2WC2A 1OD5A 2ZMNA 5EQUA 2IZWA 1UZZA 2Z4FA 2DVGA 1SQ4A 2WZR1 4RL7A 1ULCA 5EFUA 2R042 2OXBA 4U36A 4LBOA 3MEPA 4B1LA 3AVRA 3AYDA 4QWNA 4GWJA 2E9QA 4GALA 4XF9A 3H9AA 1NZIA 2CSGA 3O0WA 1IG3A 2RS53 1V9U1 1W9FA 1UYXA 2D6NA 1HXS2 2VMDA 3WG4A 5JAXA 1ENRA 1O7FA 2DTWA 2WWJA 3LIGA 1YUDA 3PDQA 1Z7S2 5T5LA 1NOVA 4MXWA 2P2KA 4OMDA 4OYUA 5KBFA 1AXZA 1XB9A 2JIJA 1AR63 2IXHA 2W0XA 3SCFA 4L99A 5FP7A 2JDKA 2PHRA 4DINB 1NY72 5FPBA 3ACFA 2VMIA 2UYBA 2A3XA 4YM1A 3MYXA 4LBLA 1GUIA 4IERA 2E53A 4C0BA 1R093 1WBLA 3VDDB 2EXIA 3ZFFB 3ETQA 4OQ8A 1F2NA 1J3PA 1KRIA 1FOD2 1LHOA 1W9YA 2A6WA 2Y6JA 3A23A 5FZAA 3U75A 4CP9A 3PMSA 1RUF2 1I9RA 1MZEA 5I8YA 4XQDA 1WWYA 4N8MA 1ZZCA 5LA1A 4B4RA 1EAH2 4ITCA 4LIUA 3SEEA 1IGOA 3RSJA 2RE9A 5DG1A 5A7PA 3AP7A 5BNOB 4YW7A 1G86A 3OYWB 4AHWA 4PQ9A 1BHGA 5EV7A 5T52A 3TNQA 1QKQA 5FP8A 2JG8B 1JHJA 2QDNA 1NUKA 2E33A 4ZS2A 4AGVA 4BMEA 4BOWA 1UY3A 2VAUA 5I0SA 2BERA 5ABJB 2X5IB 2JE9A 4LT5A 2DUPA 3M7AA 2A75A 4QQPA 4AVAA 5LATA 2FD8A 3P3NA 2R0HA 2VZUA 3SEPA 4GKXA 4NPRA 4QXKA 3OY8B 1JMUB 3QLQA 1UCXA 2J22A 5D1IA 2QQIA 1HIXA 2ZHLA 1LEDA 4KBZA 3SXWA 3R05A 5IK8A 4C8DA 2WS92 3KF5A 3UKNA 2LUWA 2QQLA 1N1SA 2L9LA 3CF6E 5KWRA 1G6NA 3OUIA 4V1PA 4FPYA 1JN2P 1OH3A 3IN9A 3VL8A 1PVC2 2XQXA 1ODNA 3ASIA 1QOTA 4FO9A 4U2AA 5L7OB 4BA6A 3PIGA 5FP4A 4GB31 3I2IA 1RITA 1YI7A 2R49A 3B7MA 3POIA 3ZXFA 4JVAA 5C4WC 1D7PM 2EF6A 3VB9A 1Y9QA 5FLHA 1HQNA 4A44A 2QZ2A 5A6QA 1GQPA 1L7QA 2GC0A 2PLV1 1GR3A 4JRLA 3WXPA 1Q8QA 1NQDA 5IW0A 2GALA 5IWFA 1OLME 3H3UA 2PHFA 5BNPC 4J25A 3VGIA 1UY2A 2FZ2A 3MPBA 2XBO2 3ALQA 2ZX4A 5FTTC 1DGRN 3EYPA 5CFCA 1JBCA 3HN3A 2YXSA 1US3A 2VUDA 1F5FA 1S0DA 2F4LA 4JV4A 3FLRA 3RVHA 1O3SA 4QD2A 5DAXA 3OGRA 1GZWA 2D3RA 4UFJA 1ASJ3 3TAYA 1RJ8A 2D7FA 5EYYA 5FKBA 4IEUA 2D6LX 2JDHA 2JECA 2HWF1 4OUEA 4IGPA 1R1A2 2D5FA 2OQ6A 1RUE1 4D7TA 1FOD1 1BKZA 1PNFA 5FK8A 2Q4SA 4GA9A 2B42B 4P9YA 2BBVA 1JYTA 4XZUG 2WS91 1A3KA 1TVGA 3H8XA 5DAQA 1VBD3 3C7GA 1PHMA 3TYJA 3CIHA 2PLV3 2WDBA 3ZFGC 2TUNA 1UOGA 2VZPA 4AVSA 5CFCC 1VMHA 1XC6A 3NV2A 5FRAA 2FMYA 4YPJA 1PGW2 1F5JA 2AH2A 3S30A 1H0BA 2GH8A 3R0RA 1UWWA 4L97A 4IUGA 1F9KA 5L7OA 5F32A 4NE9A 4RFT0 4D7SA 3BVCA 4QGNA 1YO8A 4PDWC 3MW4A 5FPUA 3ORJA 1YIFA 1P8JA 1WW6A 5FZ6A 3WDWA 2XJQA 3KGZA 4COUA 2ZGNA 2YB7A 3A0NA 2XL9A 3TN92 3M3EA 3WNOA 3WNPA 4CUGA 3VN4A 2ZA9A 1RUE3 3LCPA 2FDJA 4P5HA 4FFHA 2DV9A 1QDCA 5CG9A 3P3PA 4PLMA 2BBAA 3TOJA 1NZCA 2HJIA 3A0KA 4XJ9A 2ZZJA 5BNPA 3CJIC 4AE2A 3USUA 3ZO0B 3I2GA 1FNYA 4RGGA 2PHDA 2DFBA 1H30A 2GAUA 3CJIB 3CZUA 4HSLA 2Q30A 2JG8A 1NLRA 1W8ZA 3K2OA 5FPAA 1QH6A 1OLMA 4TLFA 4FP3A 2CWSA 5JWPA 3ZKUA 1SBEA 3GZEA 5FPLA 2VCMA 1C1LA 5FO8B 3WNMA 5LW9A 1QNYA 4UFLA 1LOFA 4RA0A 2NQYA 3MIFA 4UBHA 3ZPOA 1LRHA 3LPGA 4CDUB 5IT6A 5T54A 2MNGA 1GV9A 4H3WA 4HFSA 2BEOA 4N53C 5BV6A 2R072 5FPVA 5J37A 4EN0A 1GP5A 3JBG2 1B35C 1QJX2 3C2UA 4XW3A 3WG3A 5KC6A 4UFHA 2RS33 2V4VA 3I2JA 1BQPA 2HBUA 1PX3A 1GSLA 3KM5A 4N9HA 3LEIA 1PK6A 4URTA 2JIGA 5D8AC 2ZABA 5JPNB 5EJ3A 4M0HA 4K8FA 3U0ZA 5LK7B 1JZ2A 4QPGC 4PLNA 4IV1A 1UYZA 1AJKA 2XJRA 2QQVA 4AW7A 4WBBA 1HN1A 1HQLA 3TN93 2GZWA 1KS5A 1CZVA 2WA4A 4NWVA 3ZYPA 5GZEA 2ET7A 2FCTA 3ZIWA 1XBFA 1TMF2 4G9SB 2P3YA 4ZHNA 3U1XA 1X82A 3IAQA 1NA1B 4N7UA 3KT1A 1N1VA 3WDTA 1RVF2 3MF6A 1RXGA 4JKMA 3I3QA 4EN9B 4URAA 1OA3A 1W39A 4NVPA 4META 2OIIA 4Y5SA 5E89A 1COV2 1S0EA 1C8NA 1MZFA 3MV11 3UV9A 3ZDVA 4EWEA 1JYNA 3MFCA 1S1AA 4I0WB 5FQ0B 5FO9B 4BZ4A 5J96B 1H2MA 5JOZA 1VBD2 3SITA 1DQ2A 4QPYA 4KWKA 4TTGA 1VAKA 5F3IA 2PHLA 3T09A 1UX7A 1DU3D 4QHZA 1ZX5A 1OVPA 2PQQA 2VVDA 3MDPA 4OUMA 4Q0PA 5F5AA 4TLGA 3WCRA 1FYUA 4XCAA 1RUJ3 2WQZC 3RZMA 4LO7A 2BOIA 3WT3A 4XETA 2VL4A 4PIZA 1OD3A 2R062 4LUMA 5IFTA 3TEZA 4MGSA 3WW4A 1LHVA 3C7FA 3W20A 5L9VA 3MW3A 3M70A 3THDA 3M3IA 1W0PA 4XBQA 3J8F1 5LBBA 3NNGA 4IEXA 1O59A 1VRBA 2XBO3 1LHUA 5I0UA 1W0NA 1K5MA 4XJ8A 1NKGA 1ZRCA 3NNFA 4OLLA 2D43A 4HT1T 3SH4A 5FZLA 3VD9A 1QJEA 4G3YC 4XIOA 3OJBA 2EA7A 5FWEA 4AVBA 2VO5A 4A7ZA 3WV6A 2K2SA 2D98A 4LKSA 3RMXA 1HQWA 1W6NA 2DCZA 5GLUA 4DOUA 4CDQB 1YQCA 5E88A 2PA7A 5FLJA 3WX5A 3ZMOA 4BISA 4H7MA 3H7YA 4ZPIA 5EHDA 1D4M3 2HWE2 4GIQA 1FV2A 2Q8OA 1H1MA 3N35A 3AMPA 4LULA 4YVWC 3KV4A 3RMYA 3AB0A 4G4FA 4LOSA 1YQ8A 1DIWA 1ZM1A 1KD7A 4BM8A 5FPXA 4AFAA 2VNVA 4N53B 4XF4A 4FPOB 4QKDA 4HKWA 4LA2A 5DUVA 3RZGA 1POV3 1O5UA 3WD5A 4EWAA 3Q8CA 3QD6A 5A3WA 2QQMA 2QFEA 2VBBA 3ELNA 3LSEA 5D8AB 1GZCA 2RS12 3KWVA 3SMHA 4ZZ5A 1JZ3A 3LDRA 4CCOA 4FSJA 3ZYIB 4LE4A 2CWMA 2QCSB 2XMLA 4PCRA 5LY2A 1DG6A 4MGQA 2DCJA 2RM21 4MOAA 2YBKA 1REEA 3SH3A 3ZN6A 5BUVA 2WFPA 3TNPB 4DB5A 2RMU3 1MS1A 1DQ5A 1OBNA 3ZYBA 3D0JA 5JXJA 5E6HA 4FPEA 3OD4A 1W6PA 1X8EA 2VY0A 1S0GA 4K1YA 1C4RA 1WUVA 2VOVA 4CXYA 4JDNA 4M3CF 1YQ2A 2TNFA 4NRQA 5CA6A 1IS5A 1SG3A 5H9QA 5JMCA 3NRUA 1N3QA 4NO4A 2BNMA 4XIKA 3JQWA 2YPDA 4XMAA 3AZVA 1Y7BA 1JXNA 3E6DA 1C1FA 1LAJA 2RV9A 1AL0G 1SCSA 3IZOA 3THPA 2KXLA 3I97A 3WUDA 4MYEA 1ZRDA 4QPIA 4V2WA 3VBOA 4CXXA 4YSFA 1PMIA 4PDWB 5A1FA 1LULA 5CG8A 1SFNA 3JD71 1UZVA 5BY5A 4LQRA 3KV5A 4PHZA 4P5YA 4BJ0A 1CVNA 4GXLA 3W5NA 1OUXA 3NQHA 5T5OA 4I2OA 1W90A 4YVWA 3UJOA 5GZDA 3FX3A 2DCYA 2VXJA 2WWUA 4LUKA 1PGL1 1XYPA 2YHJA 3HQRA 3JBG1 3B02A 4XHXA 3RYKA 4XYXA 5FZEA 3BOWA 2ZGKA 3JUUA 1NCRB 3AXEA 1OH4A 3FHIB 4WVMB 1AR62 1CGPA 3NNMA 3N9QA 2PYTA 4COZA 1UU5A 2Y26A 2LS6A 4OHXA 2EIGA 1BBT3 2OT7A 4UW4A 4BHPA 2R32A 3U11A 4INDA 4S2GA 5I8TA 2MEV1 3I2KA 3E1F1 2W1UA 5LB6A 1S2BA 1V6LA 5E16A 5SV5A 5AC91 5C3QA 1AYN1 2B39A 4XAEA 2VJXA 1UNBA 4CEYA 3V0AA 1RUI1 1DF0A 2XLFA 3GDBA 5G04L 3OBRA 1HRV2 3BTXA 4GKYA 3NW4A 1UZYA 3MW2A 5HBAA 4AQTA 5BNNA 4XZPA 1YNAA 3O1VA 1YI9A 4P02B 1WGPA 4YZ5A 1G9CA 2W95A 1NCRC 4HBNA 4RR3C 2RR11 3ACIA 4QMAA 5EYXA 5B2GB 5ACA1 5JSPA 3KD4A 5HCAA 2P1BA 1NCQB 4AYUA 2YFUA 3QH7A 3FLPA 4XFHA 1C8M2 1CD3G 3WDVA 1MPXA 1J3RA 2PFWA 5FLIA 2RDRA 4GWNA 1ND2B 3HR9A 5A7SA 4ES9A 5CADA 3HBKA 2WINB 1PGW1 3M3CA 1O4YA 4QX2A 4N7IA 1W9WA 4PQQA 2XKOA 5K7PA 4UFIA 3GZUC 3O1PA 1OXCA 1OC1A 1R64A 4N53A 4YG6A 1VRH3 3J26N 4TSVA 1CZTA 4RHV2 3VL9A 1OFSA 3P5BA 4ASLA 2RM22 2R1DA 3CKHA 3J4UH 4FFFA 2WYSA 1K45A 4XEZA 1F4HA 1ZBE2 4YG0A 1OQEA 1YEWA 2RS11 4K7JA 2E51A 4XFCA 5LA2A 4AHZA 2HWF2 5HCFA 4I09A 1POV1 4IV1C 2DUOA 4YWAA 3BIEA 4FQ4A 3L2YA 4TZDA 3WP5A 4W6XA 4GH4C 3PL0A 3RG0A 4B1MA 3UGFA 4M00A 3BI3A 3AMQA 2B5HA 1MQTA 2D44A 4CCLA 2Y0OA 1JYWA 2A5ZA 1Y9MA 1MQTB 3GBWA 4NRMA 3ZSJA 5AFBA 1DCSA 2WKKA 1QXJA 2DVDA 2YUEA 2PXJA 3PVOA 4NHYA 1OPMA 5IK4A 2QNKA 2AZ5A 2HWE3 2QJVA 1PO21 4MG2A 1ND3B 1L7RA 3WQBA 2ZX3A 4H14A 4MUVA 1QJY1 4CE8A 2CNAA 4CDWC 1C57A 1W6NB 1SCRA 1VRH1 3SQOA 5B4XA 2AEYA 3KT7A 1GBGA 2C24A 3IMMA 1AR92 3OG2A 3LZZA 5E8AA 2WT2A 1EAH3 4FPLA 1MS3A 4BQ2A 3N7JA 3LF7A 4HVOA 1UY0A 5FPZA 3LIHA 1JU3A 3J8F2 4AVCA 3I54A 3WEZA 1IOAA 1DGRA 4D6QA 5A6ZA 3VBFA 3ZFFC 4AG4A 4BH9A 3NAPC 1NXMA 1HW5A 3GYDA 4DQAA 1W2NA 3V56A 2GMPA 4AR2A 1HB2A 3PUQA 4R52A 5KC5A 3T1LA 2EIEA 5GZCA 4FVVA 4LBKA 4P9XA 1YIPA 1CR7A 2R1BA 5F3CA 4QPIC 1QNWA 1KEXA 3IDCB 1E57A 1IQDC 3P1IA 1DYKA 3BU0A 4LR4A 2V73A 4S2HA 3ZFGB 1B09A 5A32A 1MS9A 1RIRA 1BVP1 2A6VA 4CYDA 2QTWB 2WSUA 1A34A 2ARAA 3SH5A 2PELA 1GMMA 3VBSC 4FBFA 4QAWA 5DZFA 1BBT1 3CQOA 2XG3A 3TWIA 1HX6A 1UX6A 2OZJA 2Y64A 5FZKA 1CJDA 3HQUA 3DPRB 4FXKB 2MEV3 2JE8A 4HVQA 5FYTA 4CXWA 2YGLA 2DCKA 1AYN3 1BVVA 2ZGRA 4UFKA 2NP0A 2Q1FA 4QPWA 1N1TA 2XKPA 3NJZA 5GZFA 2ES3A 4CSWA 4I3PA 5C70A 1OLRA 5CKNA 3B9IA 1IPJA 1ND2C 2ZBJA 3AMHA 4YW4A 1ZBE1 2WZPP 3W58A 3ZXDA 4AGRA 5C4WB 3MPPG 3WZ1A 2W9XA 4AHYA 3VDBA 1FMD3 1WCQA 2V4AA 1D4VB 2AEZA 5KHIA 3PTRB 1H9WA 3HMYA 1XPWA 1ZZ6A 3FL7A 1YWKA 1QJX3 1SEFA 1GOHA 1ZREA 1AF9A 1CAVA 3G7DA 1PNGA 5ANQA 3RZZA 4QQ2A 3DYOA 1UMHA 4B7KA 2XVGA 2ZX2A 4BQWA 2TEPA 2HYKA 2LROA 2I2SA 2IUWA 3HBZA 1S2EA 5CFDB 4XFGA 1IZ3A 4J1WA 5FY4A 5HV0A 1RUOA 2VVFA 4KI5M 1CONA 3NV1A 3RRDA 5JOWA 3ROUA 3RZHA 3LOIA 4BK5A 4LO6B 4Q26A 1OT5A 1IG0A 1SMVA 2R041 3Q8EA 3ZOIA 3PVEA 1C5HA 1VMJA 2WR9A 3AVSA 4Y4RA 2OKXA 3UL2A 4X8NA 4LO8A 5CNAA 3T2PA 4AL9A 1XNBA 3ZIXA 3DV8A 5HPOA 1WW7A 4BCUA 1D2SA 2KA3A 1FMD1 1PO12 1U5ZA 2NMOA 3T0BA 4JTOA 3SISA 1SLTA 5JSRA 5IVEA 1AYN2 4CDUC 3SC7X 4UFMA 1TZOA 3NO8A 3WG2A 3SHRA 1IS3A 4P08A 3AYEA 1DP0A 4L11A 2VULA 1X9TA 4YARA 1OFNA 5DMYA 2J1AA 3WNLA 2NYYA 3K75B 4YGDA 5LBFA 4AF9A 5CKMA 3BODA 2LW8A 5EXOA 4JHZA 3HNYM 4CCJA 5FREA 3B9CA 4QPIB 3CJXA 3R4DB 2WBKA 2YROA 4NIAA 3ZYRA 1UPSA 2D93A 2VMFA 4YM0A 2Q1MA 3PUAA 5FYBA 1PMJX 4RR3B 2YC0A 3WG1A 3VHOA 2J1VA 2R043 2BVVA 1LGNA 4Q4X1 3WP6A 5FP9A 3ACLA 5C8CC 2GU9A 1GZWB 1AR82 2E7TA 2XUEA 5I93A 5JXIA 2A1XA 3BGAA 3DXTA 3KS7A 2DTYA 2E7AA 3KV6A 4Q5OA 4NOTA 4EN6B 4F3JA 2W47A 1UY1A 1W05A 1LOGA 2EXKA 5DDJ3 4DUVA 1W28A 1VPHA 4AEMA 1HV1A 1S0FA 1SPPB 2O8OA 4YM3A 1U0AA 1CIYA 2Y34A 4UBGA 4HK8A 4LKFA 2CGOA 1Z0HA 1OHFA 4EROA 4M3CA 2Y0IA 3BU7A 4MGKE 1E5IA 1AR93 3ZFGA 5IUQA 1OOPB 4QGMA 5FZMA 5HV4A 2JDMA 3E97A 4MXVA 4WM8A 3DUIA 1X7NA 1SZBA 3UT0A 3OPTA 1V00A 2JENA 1C28A 5DZGA 4OFGA 3UGGA 3WP4A 3GF6A 5C8CA 5JDBA 4BB3A 1QQP2 1MS8A 3K3OA 1DDLA 4NAMA 4P14A 1BXHA 1FT9A 1CAXB 1V0AA 2A7AA 3BPZA 1S0BA 2R30A 3OGSA 2ZZQA 4UT5A 5C5UA 1LOEA 4K8RB 4LK7A 3FWEA 4LIVA 1VP6A 2P4EA 3IDEA 3OUHA 2Q0AA 2WZ8A 4PT6A 4Q1RA 4ET7A 4XBLA 2JDPA 4P00B 3DXUA 3B01A 5A80A 1RUG2 1OF3A 3L9JT 3OYWA 1QQP3 1XE0A 3OSDA 2ERFA 3LAGA 2VU9A 2ZJCA 1GWMA 2BTVC 4IETA 5DAVA 4XC9A 3WNNA 2HKXA 2GN3A 3CZJA 4EJRA 1XYNA 4IEQA 3GJBA 1RHI3 1VBE2 2JX9A 5JXHA 1LU2A 3AJYA 2JG9A 2J1RA 3OBTA 4XHBA 5F3GA 2JD4A 3S7IA 3H1MA 4AXOA 3N7KA 1K5MB 1COV1 1FXZA 1V70A 4FOVA 3PNAA 4CZSA 1CQ9A 1SPPA 4LE3A 4CP2A 3HPNA 2GC1A 1CAXA 4B4PA 1UU4A 2VZTA 4CRQA 1J59A 1RMU2 3N3HA 2D3PA 5JSOA 3RZLA 3T4VA 4A4AA 2ET1A 1TMF1 4IEPA 5F6LB 4Y22A 1L3JA 4BIFA 4AI1A 2XWBB 2DBIA 5DN2A 5EWSA 4F7ZA 3ME2A 4TWTA 2GP3A 2XL7A 4Q2FA 2VOXA 4HKOA 4LITA 1BMV1 2E31A 2NN8A 2J1UA 4DXTA 5CFCB 2X5IC 1UIKA 4M3CB 2XHKA 2JJ6A 2GNBA 5FCCA 3EHKA 5FYHA 5H9SA 5F5CA 1QIQA 1FOD3 3J9SA 3VBRC 1OOPA 2C26A 4QM9A 1HXS3 1YYNA 4QPGA 4Q0SA 5DDJ2 1RHI1 1W99A 1XQNA 1QH7A 1ZZ9A 1W0OA 1KDKA 1WA6X 3AKSA 3KB5A 4QXBA 3VHRA 3K48A 3ZXGA 5KHJA 4RS5B 3AZYA 3IDAA 5LASA 4Q27A 2Z69A 3T2OA 3AFKA 3R6SA 2G1MA 3PLQA 4CU6A 1Z7S3 3AMNA 5LBCA 4JGZB 4HONA 4QX1A 3AYAA 2HYXA 4LOTA 2A6ZA 1U5XA 5CVRA 4DRVA 3PMEA 4N43B 1GZ9A 4RFRB 1MEC3 4UF0B 2OPKA 2GMMA 2YFZA 3AZXA 3MV01 1N3OA 1B35A 4CUBA 1GLHA 1ZZBA 1DZQA 2YYOA 1OQDA 4D0QA 3BN6A 4DEQA 3LOBA 3J7LA 4RQPA 4ZS3A 3VBUC 3I7DA 5FBZA 3WF1A 1YC61 3AXDA 4AEDB 1XU1A 1IHMA 4FXGB 4CEYB 3ZYJB 4CUCA 2FDFA 2YBPA 2VPVA 1NCRA 1G8WA 1V9U3 5IYYA 2C4XA 4DMIA 4CCKA 1SLCA 3OF1A 4PDWA 2BW8A 2OVUA 2XR4A 4ES8A 3IPVA 5L9BA 1OLQA 2PAEA 4Y3OA 4B8EA 2WJSA 1VR3A 3LA2A 4QT6A 3HOBA 1VAVA 1JYXA 1RYYA 4OHVA 4QKFA 1JZ6A 4Y5TA 2AUYA 4AQSA 5A1AA 1VALA 2Z79A 4YG3A 3O1MA 4YZ4A 1AR61 4BLIA 2UURA 3VZLA 1VBE3 3BKZA 1RHI2 2V72A 1Q3EA 1EPZA 2HWC2 5FKCA 2A6XA 1HDKA 2RMU2 3AL5A 5IAVA 5FZ4A 5C4WA 4Q4W2 3VDDC 5LCWL 3ENRA 5T55A 3OGVA 2ZPXA 5T3NA 4QU1A 1W04A 1X33A 2JDUA 2BFUL 2ZX1A 2RS31 1GQHA 1T2XA 4PJYA 3RWNA 1WCSA 1CESA 1O4TA 1ZBA2 1V6NA 4IGQA 2UYAA 2HWB1 1K5JA 3POBA 4UOJA 2VMEA 1JH5A 1T6BX 1VMFA 3WHTA 2HEVF 4A7KA 4Y33A 1XNKA 1I5ZA 1NLQA 2ZEYA 3FFQA 1NE6A 1YQ5A 4D94A 1RUE2 4RS5A 4ATEA 1UY4A 5F7UA 1JW6A 5DUWA 5KXDA 4AI8A 5EZWA 2WZEA 4HVRA 4R8HA 4GWMA 4QB1A 4XUPA 1XNAA 3KCXA 4XFFA 2JE7A 4PBPA 4E4HA 2BFUS 3AX4A 3DKWA 1KXGA 2B4KA 3E6BA 3KCYA 3OGJA 2ZOEB 3OTFA 5DAPA 4A42A 2RDSA 3FE5A 3H1WA 4PI0A 4OI1A 3MUY1 5I91A 3LDBA 2G9GA 1RUD2 1YLLA 2AR6A 4Q4V2 3U4SA 2PN5A 3VBUA 3AMMA 1S2KA 4AFMA 4FPGA 1XU2A 4EZHA 1Y43B 3AKPA 3B3QE 1Q5OA 1HRI3 2PLV2 2WYFA 3GGLA 4NHMA 4BQ3A 5JOXA 4IE7A 3T0AA 4IE4A 2LM3A 4SBVA 2VW0A 4IV3C 5FMOS 5K0UA 1H8TB 1ALYA 4COVA 1PIV3 1AL23 2OX0A 3LKJA 4YRDA 1ULOA 1O5LA 1S55A 1UYPA 3ZR6A 1G9BA 4C0HA 4IV3B 1PVC1 1ODMA 1WD4A 4FCAA 4OCTA 5DZEA 3GNEA 5CAZA 3MHZA 4Y20A 1NLSA 1UF2C 3EBRA 5CEHA 5FUPA 2A3YA 4RD7A 3I2DA 5JR2A 2WN3A 2VQ0A 5FYMA 3V64A 3H1YA 3MLLA 3IB3A 4UAPA 1PIV2 4W6YA 4BU2A 2A71A 4AFBA 3NKTA 3LD8A 2BWAA 4QGLA 2C1FA 2MHFA 3U78A 3WDYA 3J8F3 4Z07A 1DYOA 2RVAA 4I0AA 1JHNA 1H2KA 3RFRA 3VKOA 1N3PA 2ZEXA 2VOTA 2WNEA 2XBO1 4R4XA 4K9SA 2CYFA 2YY1A 3VBFB 3ZVXA 3RJ2X 1NQJA 1N1YA 2VNRA 2VMHA 4QKBA 5D2AA 5B4NA 2EAAA 1DFQA 1D4M1 4DXRA 1W6MA 4HSJA 2HEWF 4LBQB 2CTVA 1EAH1 1OI6A 3H8UA 3AZWA 4X8PA 3VV1A 4MXWB 3D82A 4QDSA 2ZCWA 3KCCA 1Z78A 2R061 4CPBA 2QKDA 4QB2A 4DXZA 2R0FA 1REFA 2D3SA 4M01A 4D69A 5KXBA 4QHBA 3QCWA 4QHOA 1NY71 4KG0A 3CLPA 2ZGTA 3VBRA 4FTEA 2JKBA 3GCWA 1NYWA 4Q4Y1 3C7HA 5T50A 1CIWA 2VUJA 4XF0A 3VKLA 4JQRA 1VBD1 2WQ4A 5KHHA 2DU1A 5FMBA 4K1ZA 4XFIA 4FQZA 4YGBA 3ILNA 2R6QA 2O0OA 2RMU1 2XHNA 2GC3A 1XSQA 2ZS6B 4HXCA 4EWDA 1XSRA 2WLPA 1LOAA 1V9U2 5A3LA 5C5TA 4QQHA 2D6MA 4AQ6A 2H6CA 4YNIA 3JB8A 3NWKA 5A7WB 4CCNA 2RHPA 3DEMA 3JXSA 3POJA 1FNZA 3LGRA 1RGSA 4XXAA 4KH9A 4AI3A 4BXSV 2RR12 4LXLA 2WUHA 3WR0A 4LHLA 4GAZA 2TBVA 3NJYA 4FFIA 4R9CA 1M06G 2ETEA 3GM8A 4A45A 1AYM2 1DGLA 3WDXA 1YFXA 4UW6A 1VAMA 2YZ4A 2GMEA 1UMIA 1R092 3QBQA 4N43A 3PURA 1MEC2 5A33B 5CYYA 3MGUA 1QJZA 4W8JA 5FYYA 2KD7A 3VBOC 2VGDA 4LBMA 3K3NA 1TG7A 2WSVA 2CL2A 3UKTA 3ZKYA 2H0VA 4CDQC 4QDRA 5FMDA 5M0TA 4E8CA 4FPKA 3N9LA 5I8SA 2C6SA 2WQ8A 4YZ1A 3D8CA 4AEDA 3H0OA 5EJ1B 5FZFA 1UZWA 4Q0UA 2CGPA 3JD73 3RWKX 3IAPA 5FJKA 4K3UA 1ULGA 1UZ0A 1EV13 1RTVA 2N7GA 3PU3A 4MSVA 3CNAA 5C6CA 4C1XA 4W6WA 2ZHMA 5DQ0A 1IS6A 1X50A 5FY5A 5J1XA 1XNDA 3I3DA 4Q8LA 1R082 3NJXA 1VB4A 1ULPA 5DPNA 3T4HB 3OCPA 5KXCA 1QOOA 2DVBA 5FK7A 1O3TA 3OD0A 2J1TA 4PLOA 2YU1A 3MI8A 3M4FA 4YW5A 5A3MA 5FZHA 5HXVA 4TYSA 2GN7A 2V5DA 4OUSA 4Y26A 2JG9B 4Z82A 4D6SA 3M2MA 4OHYA 5AC93 1RMU3 2DCTA 3CHXA 2CDPA 2XJSA 3NSTA 1BMV2 4FT8A 1F8VA 2W1WA 4NIIA 2E32A 4NUBA 4XABA 3WUCA 5KR7A 2RR13 3N36A 2QQWA 2WFF2 4Q0QA 1RL3A 2IXLA 1AR73 3N9PA 2A70A 4LBJA 5FMOL 1ENXA 2G9FA 2QZ3A 1DHKB 1EYBA 1MVQA 4ZZ8A 5C9AB 5GM0A 2FDHA 4CP0A 1X8MA 1QMJA 1SBFA 1ZRIA 1RUH2 3MLJA 2K46A 1WKYA 3OEBA 5FIXA 2IFRA 3T1MA 5ACA3 5IVFA 2YPJA 1PM7A 1Y9GA 4ZONA 4ORFA 4BMBA 1E5HA 4HOOA 4L2NA 4KU8A 5FMCA 1W6OA 4IEOA 5JVVA 1UAIA 3VLBB 5D21A 5LA0A 1LGBA 3NV4A 3IMNA 4H55A 4JTNA 1UPIA 4MV2A 4B4QA 2EICA 3AP5A 3K77A 1W2AX 4KG8A 4Y4YA 2WRAA 3WNXA 3OEAA 5A3NA 2ZEWA 3RQ0A 4XDOA 3DYPA 4YM2A 4D7YA 3ZSLA 1TNRA 4ASKA 5A3PA 5L7OC 5IFPA 4GB32 4R4ZA 1NX9A 1YJLA 3ZDSA 4GQ7A 2XJPA 2X8KA 4IW3A 2BUKA 4WZCA 1A8DA 4MHRA 1PM4A 1D2QA 2JDZA 5FYVA 2IXKA 3WNKA 4QKNA 3FHAA 2EIDA 1RUJ1 5I0RA 2W94A 2RS13 3POYA 2BVBA 4K21A 4N43C 5BYNA 1F4AA 1VRH2 2GC2A 2ZGMA 3O5SA 5FJHA 3RYPA 3KHBA 5LY1A 5EJZB 4XF1A 2F6BA 2W68A 2Y6FA 3BUCA 2Z5WA 2ZXQA 1JOJA 1U5IA 5GLVA 4FTSA 1QU0A 1RUD1 5EIYB 2HH9A 2VQTA 1OKQA 2YBSA 3LFIA 1PO23 2JXAA 1W3XA 4DY5A 3LDKA 1AVBA 4A41A 1QDOA 1QEXA 2UY9A 2P5BA 1SACA 1VLNA 1GFF2 4P9WA 4QM8A 4XXPA 3SCHA 1RUF1 3GBGA 3GBFA 1RUJ2 4IL7A 1OQ1A 3PVBB 4Z8BA 4P9LA 3KZ4C 5K0UC 3T0DA 3CL1A 2Y8KA 1AZDA 2OZ6A 2RJ2A 5L36A 2DBNA 4NHKA 3KQRA 3LA3A 1H2LA 5FZOB 4DEVA 1HRV3 4LKDA 2ZACA 4DY3A 3CDZB 3J7HA 5GLWA 4FI9A 2V5YA 1TEIA 3BYWA 4LTAA 1Q8SA 1XE7A 1ZBA1 1LHNA 1LTEA 3IT8A 5FXVA 1YQ6A 4BE3A 4NRPA 1QWRA 1DQ1A 1GQGA 1ND2A 4D8MA 1Q8OA 5LZ6A 1H6XA 4CDWA 4HN0A 3O1RA 1Y3TA 4O7XA 5GALA 4XURA 4QX7A 3APBA 4BPZA 1OOPC 1UOFA 4RHV1 2IC1A 2ZGQA 2IXIA 1O91A 3P6BA 1NA1A 4QB6A 3PIJA 4XOGA 4OI0A 3UNPA 1XYOA 1S0CA 3MIEA 3K51A 2ZKNA 2BU9A 3WW3A 4HK9A 3D3AA 2GH2A 4JKLA 4XPVA 3AYCA 3C3VA 4MGYE 5F8PA 1CN1A 1GOFA 1ZYBA 4ARXA 1H8VA 3LFMA 3UJQA 3BPSA 1C8M1 3KT4A 3Q9OA 5IK7A 3O1SA 1BJQA 2A73B 4L92A 3Q8AA 5CFDA 3I59A 4QQOA 1ZVFA 2R7EB 2WNUC 3SNMA 4A7YA 1ZBA3 4JZRA 5FXWA 5A3UA 4O61A 5J48A 1ZBE3 1ULDA 1R081 1J1TA 4OI4A 2CU5A 4KBBA 4MADA 4E2QA 4I3GA 2GP5A 1QXRA 2ID4A 5I0TA 1ACCA 1WLDA 3IBMA 3WVJA 4QPGB 2J1SA 1GP6A 4CP1A 1RXFA 2ZAAA 1HN0A 4HKLA 1PZ8A 2ORZA 3ACHA 1KFUL 2W92A 3AKTA 2ZGLA 1US2A 5HXMA 5JZGC 1T6GC 4A6OA 5I0DA 1OA2A 1LKNA 1W2TA 2VOWA 3JBG3 2IXCA 1KDMA 1UXZA 3ACGA 2VECA 4KWJA 4XDPA 1REDA 4QX3A 5BNQA 1PK6B 2WNUA 5JCTA 2VUCA 4Q4Y2 4GMP1 5CB7A 3MO4A 2I07B 1FPN3 2WZR2 2XOMA 5FFOC 3HQXA 4WM7B 1HJFA 4X6QB 4LBNA 4NIGA 4KGQA 4XUTA 5IVYA 1MACA 1L7LA 3NV3A 4V2VA 2J1EA 4WM7C 2XLGA 1O6UA 3JQXA 4YVWB 4E8DA 4RQPB 1UMZA 3T08A 4R9AA 2WO1A 3WF4A 3G6JB 1GU3A 1MVEA 2C5DA 3UESA 1W8OA 1WMFA 1UD1A 3POWA 4KQ7A 4LLFA 5FP3A 3CO2A 2WNVA 1JOBA 4IEVA 3FFZA 5CZKA 1D4M2 1ZA7A 3U4XA 1NE4A 4PF5A 5IVVA 3C7OA 4YFZA 1LCLA 1ULEA 1LR5A 3ZLIA 2BJSA 2VTXA 4LBQA 4E2GA 1M4WA 2GNTA 4CVUA 3ES1A 3ZN6B 2WL1A 5L73A 3T30A 4D3WA 3RI8A 3U07A 3DPRC 2H0BA 3IWZA 3LEKA 5JOYA 5CBLA 2VW2A 1GNYA 2CGNA 2JKXA 3I3BA 5FZ0A 3WCSA 1WW4A 4AAPA 4CDQA 1FI2A 2EIBA 1WCDJ 3I59B 4KU7A 1ENQA 3ILFA 3FJSA 5FYUA 3WQ0A 3WDUA 4W50A 3NJVA 5FDBA 1PZ7A 5DDJ1 1WLCA 5DABA 5FY9A 1SFPA 3K4DA 2BV4A 3KLSA 1KQRA 3AFGA 3U14A 2GDFA 1GP4A 3E5QA 3AJZA 2RG4A 1W8UA 3J7NA 1YRZA 5LBEA 2ZTNA 5CKQA 1S0JA 2PQSA 3W5MA 3TEXA 1XE8A 2XJUA 1LOCA 4Q4X3 3H7JA 4Q29A 2D97A 3BTYA 3WF0A 2RJKA 4NPLA 3FLTA 4P9JA 3VZMA 4IE0A 3USSA 3VKNA 5BNOA 5JLVA 1CAWB 3E5UA 5JZGA 1CJPA 1QJY3 3AP4A 4XMIA 4Y20B 3ABZA 4W4ZA 3O0XA 4CDWB 5JZGB 1E5SA 3SLIA 4ZU7A 5J3UA 2EALA 4L0PA 3ZXEA 2E6VA 5A3OA 2V09A 1N47A 1AR91 1EUTA 4CCEA 1DBNA 3HJRA 5C3PA 2FBEA 4LHKA 4XTMA 1ASJ2 4CU8A 1RVF3 3TBDA 1ASJ1 3U10A 2NM1A 4AI2A 3HT2A 5L19A 2HWF3 5DG2A 3MLKA 4Y1VA 3LB9A 1YJKA 1QXPA 1RUC3 1YFYA 2A6YA 2W3JA 5FWJA 4Z2WA 3D4KA 3DF0A 3Q8FA 1CWPA 1WLTA 4HZFA 3VZNA 2WS93 3OBZA 4Z1VA 4Y24A 1H2NA 2GNMA 3CEWA 3DECA 3POFA 5FZ1A 2ZGPA 4Q8KA 3IDBB 3ZXKA 3D5OA 1ZRRA 3ITQA 5FUIA 3WSOA 4CUAA 4P9IA 1LB2A 5JR7B 2ZX0A 1SLIA 5LEJA 4ZKTB 2AENA 3RS6A 2BYVE 1J84A 4M4RA 5GJ6A 1HLCA 3VBSB 1WMEA 2FMDA 1D0GA 2Y38A 2G9ZA 3MICA 1QQP1 4Q4W3 4YW2A 5SV8A 4BQ4A 3GCXA 4Q4V1 1O3RA 3H8RA 1RUH3 3QOPA 3KF3A 3EQEA 2YU2A 2C9AA 1VBB3 1CZSA 1UIJA 2VD7A 1Q56A 1JODA 5CU1A 3V0BA 4Y1UA 1X36A 4BQ5A 1CAWA 2XVLA 4DXSA 2WN2A 3W9AA 2UWBA 4R9BA 3OBAA 4IV3A 1TME1 2ARBA 4CEWA 2WO2A 2BGCA 2Q5TA 4EN8B 4GMP3 1VBA1 2D5HA 3ECQA 5CISA 2CAUA 2B7YA 2X5IA 3NKGA 1G9FA 3ZYGA 1NT0A 4CCCA 5ABJC 2PTMA 4BQXA 1WD3A 5IK5A 5C3RA 1U12A 1DZRA 5J09A 2BGOA 3SCGA 1JUHA 5APAA 5A7NA 3OGGA 3I2HA 3K46A 4K6BA 4E9KA 2R063 3LWCA 1NG0A 5EP9A 1AR72 2BP6A 3N9MA 1W06A 1LHWA 1AXKA 4PF1A 1QY4A 5GZGA 3AZZA 1W03A 4KNCA 4DS0A 1J58A 1LENA 3BB6A 1POV0 2R071 1KITA 3IIAA 3RI9A 3AP9A 1XNCA 2QQNA 4F83A 4Q4W1 3MF9A 4YW6A 4N90A 5F9TA 4WVVA 2FHRA 5E1RA 1BK1A 2P3KA 2QQJA 1HKDA 2RS51 1W9SA 2DVFA 3F2ZA 4X6RB 1GKBA 1W6QA 2VZVA 3POSA 4YGEA 5F6KA 1MQTC 5FV3A 1W8HA 1TME3 1LJ7A 4XQ4A 1V6OA 2P6CA 1K12A 2QQUA 1OVSA 1W8NA 3O0VA 3PU8A 4PBOA 4EV0A 4WVMA 1W8WA 4XJWA 1PGL2 2QBXA 3KVAA 4BWOA 3D6EA 3WINE 3B00A 3DN7A 3WQ1A 2QDRA 3I3EA 1JU4A 1PO11 4H7LA 2BQPA 5F1RA 1YHFA 1PK6C 1ULFA 2ZEZA 3H8OA 4JDOA 4QU2A 1AYM1 2W87A 4J1XA 2GNDA 2VXRA 3B69A 4PI2A 2IVIB 5FYZA 2WO3A 1WCKA 4UF0A 2VM9A 1CAVB 5GKAC 2AGSA 2X05A 2WA3A 4XJAA 4UW5A 4XBNA 2PHTA 4FPFA 4XF3A 4BLJA 3A22A 1H1IA 3H3LA 1LODA 5A7OA 4RS5C 1YCIA 5BPXA 5FY0A 1HB4A 2W08A 2W1QA 4JRAA 4IDZA 2EXHA 4AFDA 2P17A 3VZOA 4GH4A 2JDNA 1VB2A 1G7YA 1UYYA 4LA3A 5IVJA 3NAPA 1TNFA 5HI0A 1W6MB 2KM2A 2BGPA 1W9TA 4HLTA 4ZXKA 3VHNA 3FUOA 3VBRB 1VBE1 5FAXA 3O7OA 4FOQA 2JWPA 4RQPC 2DDUA 3MIDA 4JGYB 2K0GA 2VMGA 1VBB2 1W8TA 3BIWE 1CPNA 1X9PA 3MUZ1 2IXJA 1XRUA 5JI9A 4DO0A 3L2HA 3IIIA 4EQVA 2CV6A 3NMBA 1EY2A 5FZ9A 1AX0A 4JGYC 4XVHA 3FBMA 3VBUB 3ZFEC 4COYA 1E5RA 1OPOA 1NA1C 4H2AA 1GNZA 4JCKA 1QJU1 4CEWC 1RUC2 4NIHA 1RUG3 3B93A 4KGGA 2ZAHA 4CDUA 3THCA 2O8QA 5A7QA 3ZFEB 3UYJA 2VZRA 3I49A 4QXHA 5ISLA 1C5IA 5FZ3A 2UU8A 1DLLA 2C9KA 2HWB3 1S4CA 4ATFA 3V0BB 2B9VA 2LRPA 3A21A 5KXEA 5DUUA 2JICA 2R16A 2P34A 2VE1A 1CX4A 4NHXA 2W46A 4N9IA 3BCWA 5CFDC 5D8AA 5A32B 5IVBA 1SLLA 4CTEA 3AKRA 1QJY2 4JKKA 4ISQA 3VZKA 1UKRA 1IKPA 1C3HA 3N7LA 3WW2A 4AK3A 3INAA 2C0ZA 3FC0A 1CAUB 5DAWA 4NJ4A 1KJLA 2OQ7A 1PIV1 4FPHA 5FUNA 4Q0VA 4XFBA 4HPKA 4YVSB 2HLEA 2WFF3 1VJ2A 3KV9A 1J3QA 2VZ3A 5FZGA 4XJUA 4J6GA 4E4SA 2Y6LA 3HAGA 3NAPB 4TN7A 1RUG1 3PHMA 5C33A 3AKQA 3B94A 1AX1A 2ARCA 2XVKA 4CU9A 2KR2A 3ZPYA 4UI9L 4NROA 3ETPA 1G9AA 2JD9A 2PHWA 3ZSKA 4NWWA 4XACA 2VQUA 2NLRA 2QQKA 1QHDA 4Q4X2 4RSUA 1LGCA 1RUNA 4M4PA 4MZUA 3T3YA 1COV3 4B3NA 3GZTB 4GD4A 5H9RA 5C8CB 4NHLA 4IEWA 1FV3A 2Z42A 3CU7A 1J1LA 5FZIA 2JB8A 1KFXL 4XILA 3UKVA 5BNNB 5A1LA 1ZNPA 4F8AA 1KJRA 4RR3A 3ZFEA 1BZWA 2ADEA 4DUXA 1XJAA 4M3CE 2DYCA 2VZQA 1LOBA 4MX3A 1F35A 2NZ9A 4FOYA 5BNNC 1DYPA 1BCXA 4KL1A 4NN0A 3VDAA 1MS4A 1PVXA 2SBAA 4JC1A 1HRI2 4OHWA 2FDGA 4LKEA 3PUSA 5F2SA 4JDMA 1XXNA 2CDOA 4CP9B 3MIGA 2ILMA 3V65A 4Z92B 1H8TA 2DURA 1GANA 3SKJE 1HJGA 1PMHX 4YW3A 3ZSMA 1DQ4A 5DXDA 4L9BA 3N9NA 2FQPA 2PHXA 3GHMA 4K20A 5LRSA 1JZ5A 1PO13 1U5YA 1JOPA 1TMF3 3ST7A 2WIIB 3PVNA 1SFYA 1WA4A 2VH9A 4WM8C 1GICA 1AR81 3CBNA 1NAEA 1AYM3 2VCAA 3QACA 1ZZ8A 2OA2A 4BIOA 1RUI2 2EVXA 1GWLA 3PUIA 4HL0A 4WM8B 4YFWA 1Z7S1 1QOSA 4I30A 2HEYF 3H50A 3NNLA 4IV1B 5A33A 2BNOA 5BXXA 2PHUA 2XJVA 4IE6A 4AEJA 1W6OB 4LO4B 5LRRA 4MHUA 1JS9A 1UO9A 1W3VA 3ZXJA 4YZ2A 4O9EA 2E63A 2YC2A 1OMIA 4OI2A 1SLAA 4OVEA 1ENSA 3ZR5A 3F95A 3ON7A 1POQA 5JPMB 4Q4Y3 4QX8A 5C9AA 3UETA 2AACA 2WT0A 4ARYA 4LBQD 4C1WA 5F5QA 4AVVA 1BYHA 1NCQA 1JTZX 1SBDA 2Q8EA 4E4ZA 4HMZA 3MBWA 2XWJB 3EB7A 3KMHA 4LO5B 3VBHC 4S2DA 3POEA 3E5XA 4IQPA 4L8QA 5AVPA 3RYRA 5A6XA 3I3MA 1O3QA 2QVSB 4YW1A 3HVDA 2Y6KA 1BLZA 1MEC1 2VW1A 1ZZ7A 1R091 1UOJA 4JX0A 4RGAA 1URXA 1UL9A 4WM7A 3N9OA 3WW1A 1W8FA 4KWUA 2FCVA 1JUIA 5C8WA 4Z2AA 1Y4WA 5C3SA 1H6YA 3E6CC 2FDIA 4XJZA 3RPQA 2WNVC 2IWGB 4LLOA 4DNYA 1WBFA 2B46X 1ONAA 1RC6A 2EXJA 2I74A 3LSDA 4JGZA 3N7MA 3VKMA 3I2FA 1R083 2MEV2 4AEKA 1BBT2 3W59A 4D6RA 4A6SA 2WNVB 3TN91 1TE1B 1TME2 3ZX7A 2XH6A 4I0BA 4O9GA 2ORXA 4RGKA 4AI0A 4Y22B 1OUSA 4BQ1A 3M3QA 3R4UA 1IPSA 5AFEA 3X29B 1A78A 3KQ4B 3HD8B 5HCBA 3VDCA 2RS52 1OKOA 3PTYA 2Q8CA 1MS5A 2PMWB 3VD7A 1W6PB 5FZCA 4I01A 3EO6A 2Y60A 1LNSA 3WQ7A 2BPA2 2XDVA 3ES4A 2DVAA 3VD5A 5CIRA 4BXFA 1S0IA 2OYZA 2BNNA 2HWD3 2W5FA 2VZ1A 3GJAA 2XB6C 4QQLA 4Y5Z0 5JXGA 3GHNA 4Y1ZA 3HWJA 2WLQA 1AR71 1GZTA 3FHQA 4IEZA 4XE9A 1WW5A 5JIAA 4EE2A 3POGA 3ZN5A 2FDKA 2EAKA 2PAKA 5A70A 4WZFA 4IESA 3VD3A 4CU7A 4ZU5A 4A3ZA 2AREA 4WV8A 1LU1A 1H4HA 3DKQA 5F5IA 4CEWB 5FZOA 3MIBA 5FXXA 1LOFC 4YZ3A 3BALA 2P3JA 1QGLA 1ZA4A 1GNHA 2Z2SB 5C7GA 2QQPA 1YFUA 4BYYA 1XNTA 5IVCA 3FMGA 1HRI1 3VUOA 4NR1A 4CPBD 5JI7A 2OUJA 2K9ZA 3NL1A 4ZY9A 2J7MA 3KVBA 5IHRA 1IKQA 1OSGA 3JCIA 3LQCA 5IJRA 1I6XA 2OW4A 3GXUA 2LALA 2E7QA 2ZMKA 2WWSA 3FBYA 1MS0A 3FN9A 1STMA 1PVC3 2VTXJ 4UWDA 4WVZA 4DPNA 3AC0A 2HWD1 3WF2A 4GJYA 3M8LA 5JIUA 1K3IA 4YVSC 3O1UA 4AEDC 5K4LA 3MZHA 1WCUA 3GZAA 3A7QA 2P3IA 2ZMLA 3HNBM 4YLZA 2RDNA 5FO7B 4LMFA 4CCMA 1Q43A 4GMP0 4CCDA 2B9UA 4MGIE 4S2FA 3VBFC 4E4DX 1IQAA 2OUHA 1F31A 1AL21 1ND3A 2XGXA 4OULA 3RJRA 4AVTA 4QX5A 3OPWA 1BK0A 1VE0A 1JZ4A 1D0HA 4W65A 5FOBB 2B45X 5L9RA 1VBC3 2VNOA 2VC9A 2RM23 2XONA 3PJYA 5A3TA 5G05L 2J42A 4A3XA 4CDXA 3T2QA 3RZKA 5FY1A 1SLBA 3W21A 4E2SA 2Y6HA 2SLIA 4WVWA 3WOGA 2JG8C 2W52A 5IATA 3AP6A 5KHGA 4NMIA 1JI6A 3VDDA 3DGTA 3JZVA 2G4IA 4OZOA 3ATGA 4OHZA 1DLCA 2W91A 5F39A 5FBJA 2CHHA 1RB8G 2DUQA 4AI9A 5EPAA 2NMNA 2AYHA 3MIHA 2AC1A 2VCCA 4RN5A 1A6CA 1WMXA 2YC4A 1V6MA 3WF3A 3HNMA 4XFAA 5ACA2 2F4PA 4PIXA 3EXUA 1EPWA 3N4MA 2W2IA 2O1QA 5FQ0A 1ST8A 1I1EA 1NCQC 1J83A 3FUQA 4FOWA 1MR5A 2IFWA 2WNUB 2JEMA 3VBHA 2P6HA 2Y33A 4KWLA 3RNSA 3HIFA 4E27A 4NPMA 5BNOC 3A4UA 1F15A 1DGWA 1HRV1 1Q8VA 2RJLA 1QJU2 3MFAA 1RUF3 1JYCA 2VUAA 1R1ZA 4OMCA 1HV0A 4FFGA 5IAXA 4JAAA 1G9DA 1VBC1 4ASMB 1EV12 3S7EA 5AC92 3IPVB 3ZXAC 3BOPA 1IS4A 1AJOA 1QJX1 3EMRA 2ZHKA 1H9PA 3ZYFA 4B7EA 1NXD1 3Q8BA 3IKWA 4UXAA 1FATA 1YXWA 3ZXLA 1DZTA 5LEKA 1EP0A 3ZFFA 3I4IA 4M0NA 2LTNA 3AL6A 4MO3M 4Q4V3 1FX5A 2QUOA 2HWC1 4OZXA 4LHNA 1Q8PA 1FAYA 3J7MA 4JHTA 4HG6B 2P37A 4O65A 3I8TA 4UYBA 1W2UA 1BEV3 2VMCA 4OQ9A 3DPRA 3HT1A 2DFCA 2Q8DA 2YGMA 2B8MA 1H8TC 2BOJA 2WAAA 4ZXEA 3JD72 1SDWA 4XUQA 2JB4A 3S0MA 1JYIA 1K42A 1YFWA 1AHSA 1GWKA 1VIWB 4ISRA 4LEJA 2VOKA 3HN1A 3VD4A 3THTA 4MLOA 2MPFA 5FZ8A 3RGBA 3S57A 3CJIA 2VVEA 4FTBA 2QE3A 4IE5A 1W2OA 3NNJA 3OUJA 5LA9A 4AQ2A 3EJKA 4UW3A 2ZHNA 5BNPB 2VZSA 1CPMA 2VTFA 4MGTA 1H4GA 1VBA2 4GH4B 1JYVA 3LE0A 3ZN4A 2R073 3VBHB 3BTZA 4AHXA 3O1OA 5FR3A 4C91A 1LEMA 1UOBA 4ZU4A 3R4SA 2HWC3 4LNVA 4MGZE 2WO7A 4ONUA 1B35B 3WP3A 3ZSEA 2FZ1A 4IXLA 4C90A 5K8SA 5FXZA 1ND3C 2VG9A 4CEYC 5C71A 2JG9C 1EV11 5ANNA 2XPJA 5GLZA 3IM0A 1VBC2 3U37A 3ZYHA 4A2UA 1FPN1 1O4ZA 3DYMA 4BK4A 2PAMA 1UXXX 3H3ZA 5J36A 3CMGA 5DUXA 3FZ3A 2Q1ZB 2WT1A 4AOCA 4GULA 5FY7A 2W1SA 3S5QA 5JMOA 4CDXB 3B5LB 5C9AC 2X09A 5H9PA 4FAHA 4IGOA 1DGWX 1UW8A 3VBSA 4QX0A 1DQ6A 3UK9A 3URFA 5FOJB 4AZZA 2ZGOA 2GSYA 1DQ0A 2HBTA 2VNGA 3C7EA 1W6QB 1R1A1 1RMU1 2E26A 1MZ5A 1SDDB 1TQ5A 3BTAA 1LESA 2VR4A 5FYIA 1PZ9A 2HWE1 1OA4A 2DU0A 2ZGSA 2XJTA 4I02A 4AAXA 3AM2A 3D0SA 2OS2A 3DCQA 3PJQA 5TSWA 3S6PA 4DRRA 2BRTA 4AGGA 1BEV2 3JU9A 2X53S 2NPIA 2XUMA 1AUYA 1LECA 3M1HA 4YGCA 1PX4A 5F3EA 1CX1A 3QH6A 2JDAA 2FCUA 3HEIA 4JGZC 1KGYA 4LJHA 2UWCA 2H6BA 1CAUA 4KMQA 1V6KA
chains in the Genus database with same CATH topology
5FZOB 4QWNA 2XXZA 5FJKA 4CCJA 4D6QA 2WWUA 5FYUA 2Q8CA 5F3IA 5FY9A 2OX0A 3PU3A 2WWJA 5FXVA 3PUAA 5FZCA 5FZEA 5FYBA 3PUQA 4QXBA 2XDVA 3PDQA 5FV3A 5F5AA 4BXFA 5FZ7A 5FY5A 3N9QA 5FP9A 4GD4A 3AL6A 3AVRA 4QX7A 5FZIA 5F3CA 2OT7A 5CEHA 5FUPA 5F32A 4HONA 2XUEA 3PU8A 5FP7A 5FYMA 3DXTA 5A1LA 5FPBA 3KV6A 2YU1A 5FZDA 5FPUA 3KVAA 4EYUA 5FZHA 4UF0B 4BU2A 5FZ6A 4D6SA 2Q8DA 3LD8A 4EZ4A 1VRBA 4GJZA 5FZAA 3U78A 5F5IA 5FZOA 5F2SA 3PUSA 4NUBA 5FXXA 4CUGA 5KR7A 5FZLA 5FZ8A 5FYZA 4LIUA 5FZKA 3N9PA 5A7PA 5F2WA 4UF0A 5IVCA 5FWEA 5FYCA 5FYTA 2YBPA 5FZMA 3N9NA 3KVBA 5FXWA 4BISA 5A7OA 5IVFA 3OPTA 4CCKA 4CSWA 5FP8A 5FY0A 4HOOA 4Y3OA 3K3OA 3KV4A 4DIQA 5A7SA 5IVJA 5FWJA 3K2OA 5FPAA 4GJYA 2GP5A 5F37A 5K4LA 5A3NA 4LIVA 5FZ1A 3PTRB 5A3WA 4CCMA 5FPLA 4XDOA 5FXZA 4ASKA 5A3PA 5LW9A 3ZPOA 4C8DA 4DO0A 4CCOA 3AL5A 5FZ9A 5FZ4A 3DXUA 2XMLA 5A80A 5LY2A 4XDPA 3OPWA 4QX8A 5ANQA 4QU1A 5FPVA 2YBKA 5FP4A 5FYVA 5A3TA 5A7QA 2Q8EA 3UYJA 5FY1A 4IGQA 5FY7A 5E6HA 4QXHA 5ISLA 2YU2A 5FY4A 5FZ3A 2VD7A 5IVYA 5FJHA 4V2VA 4IGOA 5LY1A 5A7WB 4CCNA 4Y33A 5F3GA 5IW0A 4LXLA 4GAZA 5IWFA 4AAPA 4CCLA 5LWBA 3AVSA 3NJYA 4Y4RA 3N9OA 4QXCA 5FYSA 5FBJA 5FYIA 5F39A 2YBSA 4AI9A 5FP3A 2PXJA 5IVBA 5A7WA 2OS2A 3RVHA 2YPDA 3PURA 4E4HA 5IVVA 5FYYA 2P5BA 3ZLIA 5FZBA 2W2IA 5IVEA 5A7NA 3K3NA 5FY8A 4URAA 2OQ7A 5FUNA 3LDBA 5F3EA 4V2WA 2GP3A 4D6RA 3N9MA 3N9LA 3U4SA 4IGPA 3KV9A 4LITA 5A1FA 2OQ6A 5FZGA 4EZHA 5FZFA 5FYHA 5FZ0A 5F5CA 3KV5A 4TN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZO B;  4QWN A;  2XXZ A;  5FJK A;  4CCJ A;  4D6Q A;  2WWU A;  5FYU A;  2Q8C A;  5F3I A;  5FY9 A;  2OX0 A;  3PU3 A;  2WWJ A;  5FXV A;  3PUA A;  5FZC A;  5FZE A;  5FYB A;  3PUQ A;  4QXB A;  2XDV A;  3PDQ A;  5FV3 A;  5F5A A;  4BXF A;  5FZ7 A;  5FY5 A;  3N9Q A;  5FP9 A;  4GD4 A;  3AL6 A;  3AVR A;  4QX7 A;  5FZI A;  5F3C A;  2OT7 A;  5CEH A;  5FUP A;  5F32 A;  4HON A;  2XUE A;  3PU8 A;  5FP7 A;  5FYM A;  3DXT A;  5A1L A;  5FPB A;  3KV6 A;  2YU1 A;  5FZD A;  5FPU A;  3KVA A;  4EYU A;  5FZH A;  4UF0 B;  4BU2 A;  5FZ6 A;  4D6S A;  2Q8D A;  3LD8 A;  4EZ4 A;  1VRB A;  4GJZ A;  5FZA A;  3U78 A;  5F5I A;  5FZO A;  5F2S A;  3PUS A;  4NUB A;  5FXX A;  4CUG A;  5KR7 A;  5FZL A;  5FZ8 A;  5FYZ A;  4LIU A;  5FZK A;  3N9P A;  5A7P A;  5F2W A;  4UF0 A;  5IVC A;  5FWE A;  5FYC A;  5FYT A;  2YBP A;  5FZM A;  3N9N A;  3KVB A;  5FXW A;  4BIS A;  5A7O A;  5IVF A;  3OPT A;  4CCK A;  4CSW A;  5FP8 A;  5FY0 A;  4HOO A;  4Y3O A;  3K3O A;  3KV4 A;  4DIQ A;  5A7S A;  5IVJ A;  5FWJ A;  3K2O A;  5FPA A;  4GJY A;  2GP5 A;  5F37 A;  5K4L A;  5A3N A;  4LIV A;  5FZ1 A;  3PTR B;  5A3W A;  4CCM A;  5FPL A;  4XDO A;  5FXZ A;  4ASK A;  5A3P A;  5LW9 A;  3ZPO A;  4C8D A;  4DO0 A;  4CCO A;  3AL5 A;  5FZ9 A;  5FZ4 A;  3DXU A;  2XML A;  5A80 A;  5LY2 A;  4XDP A;  3OPW A;  4QX8 A;  5ANQ A;  4QU1 A;  5FPV A;  2YBK A;  5FP4 A;  5FYV A;  5A3T A;  5A7Q A;  2Q8E A;  3UYJ A;  5FY1 A;  4IGQ A;  5FY7 A;  5E6H A;  4QXH A;  5ISL A;  2YU2 A;  5FY4 A;  5FZ3 A;  2VD7 A;  5IVY A;  5FJH A;  4V2V A;  4IGO A;  5LY1 A;  5A7W B;  4CCN A;  4Y33 A;  5F3G A;  5IW0 A;  4LXL A;  4GAZ A;  5IWF A;  4AAP A;  4CCL A;  5LWB A;  3AVS A;  3NJY A;  4Y4R A;  3N9O A;  4QXC A;  5FYS A;  5FBJ A;  5FYI A;  5F39 A;  2YBS A;  4AI9 A;  5FP3 A;  2PXJ A;  5IVB A;  5A7W A;  2OS2 A;  3RVH A;  2YPD A;  3PUR A;  4E4H A;  5IVV A;  5FYY A;  2P5B A;  3ZLI A;  5FZB A;  2W2I A;  5IVE A;  5A7N A;  3K3N A;  5FY8 A;  4URA A;  2OQ7 A;  5FUN A;  3LDB A;  5F3E A;  4V2W A;  2GP3 A;  4D6R A;  3N9M A;  3N9L A;  3U4S A;  4IGP A;  3KV9 A;  4LIT A;  5A1F A;  2OQ6 A;  5FZG A;  4EZH A;  5FZF A;  5FYH A;  5FZ0 A;  5F5C A;  3KV5 A;  4TN7 A; 
#chains in the Genus database with same CATH topology
 1I3H A;  1AL2 2;  3SKV A;  2VZO A;  1MZ6 A;  2XXZ A;  4XUN A;  4JGY A;  3OY8 A;  2DF7 A;  3TEY A;  4HPK B;  4YVS A;  3TB0 A;  4TXW A;  4GWI A;  4B29 A;  5C3O A;  4LK6 A;  5ERL A;  1EUU A;  2XLA A;  3S5A A;  1O8S A;  4LPL A;  2ATF A;  4DUW A;  1QJU 3;  1UQX A;  4RYD A;  5FZ7 A;  3VKF C;  1R1A 3;  1AX2 A;  2HWD 2;  3VZJ A;  1XOY A;  2D6P A;  2DWR A;  1OUR A;  4EN7 B;  2OPW A;  4FAG A;  5FZD A;  2XQR A;  4EYU A;  4NID A;  3NVC A;  3K4A A;  2JDY A;  4XCB A;  1PO2 2;  4EZ4 A;  2WAO A;  4GJZ A;  2YMZ A;  1A8M A;  5KHK A;  5J7M A;  1HB1 A;  4XTP A;  2YV8 A;  2W39 A;  1RVF 1;  1UN1 A;  5K0U B;  4FPJ A;  4LHS A;  2BWC A;  1RUD 3;  2X10 A;  5F2W A;  4XDQ A;  3OOX A;  5FYC A;  1BEV 1;  2UWA A;  3LPF A;  5JUV A;  2ZKL A;  3JB4 C;  4AWD A;  5A6Y A;  3RDI A;  2WFF 1;  3ILR A;  1WZX A;  1V6J A;  4FP2 A;  5AVA A;  4HET A;  5ABJ A;  2D40 A;  3DL3 A;  1OF4 A;  4MH0 E;  2VCB A;  3WY6 A;  4CA9 A;  3T2T A;  1JZ8 A;  2UY8 A;  4BDV B;  4DIQ A;  2G19 A;  3VHP A;  3ZM8 A;  1RUC 1;  1UKG A;  4FPC A;  4HN1 A;  1RIN A;  4IEY A;  1PGS A;  4JQT A;  2CY6 A;  3GAL A;  4GB3 3;  4XQW A;  1V6I A;  5F37 A;  4RHV 3;  1GOG A;  1K5M C;  2I45 A;  1QJF A;  4Y1Y A;  1APN A;  1SHW B;  2HWB 2;  4P9G A;  2ZGU A;  1UU6 A;  4DZG A;  1QF3 A;  2BZD A;  3KSC A;  3WLU A;  1VBB 1;  2ADD A;  5GLT A;  4COW A;  2RS3 2;  4XUO A;  2RDQ A;  2D6O X;  5LK5 A;  4CDX C;  2WZR 3;  1FPN 2;  4DFS A;  4Y1X A;  1GYK A;  1HB3 A;  1AXY A;  3KGL A;  3TEW A;  2A3W A;  3O1T A;  2VBD A;  4QDQ A;  2D6K A;  2QQO A;  2Y6G A;  3M3O A;  2X29 A;  3K4Z A;  2F17 A;  3OPZ A;  2VBP A;  3VBO B;  4LOR A;  4NAO A;  1JZ7 A;  3KHC A;  1WLW A;  4PIY A;  1HXS 1;  1KS4 A;  3LEG A;  3O12 A;  3H42 B;  1WMD A;  3PUH A;  4XAA A;  3I2O A;  5T5J A;  2YDE A;  3WHU A;  5HCH A;  2WAB A;  4YYO A;  1RUH 1;  3O14 A;  2YG0 A;  3V0A B;  1FMD 2;  3TRS B;  3ZMN A;  4AFC A;  2O14 A;  2WNO A;  5J98 B;  1H1A A;  5LWB A;  1RUI 3;  4BQY A;  2ENR A;  1I5P A;  2CAV A;  2IVJ A;  4GZ9 A;  4K40 A;  4QXC A;  1IPK A;  5FYS A;  3RZJ A;  4Q1P A;  4R9D A;  5K9Y A;  5T5P A;  1O8P A;  5A7W A;  2ARX A;  1C8M 3;  1RJ7 A;  1VBA 3;  1ZRF A;  4MVT A;  3UGH A;  2VQA A;  5FZB A;  3AK0 A;  3LA7 A;  3C8X A;  3LEM A;  3OB8 A;  3USU B;  4SLI A;  4HAN A;  5FY8 A;  1AR8 3;  2BDR A;  2WC2 A;  1OD5 A;  2ZMN A;  5EQU A;  2IZW A;  1UZZ A;  2Z4F A;  2DVG A;  1SQ4 A;  2WZR 1;  4RL7 A;  1ULC A;  5EFU A;  2R04 2;  2OXB A;  4U36 A;  4LBO A;  3MEP A;  4B1L A;  3AVR A;  3AYD A;  4QWN A;  4GWJ A;  2E9Q A;  4GAL A;  4XF9 A;  3H9A A;  1NZI A;  2CSG A;  3O0W A;  1IG3 A;  2RS5 3;  1V9U 1;  1W9F A;  1UYX A;  2D6N A;  1HXS 2;  2VMD A;  3WG4 A;  5JAX A;  1ENR A;  1O7F A;  2DTW A;  2WWJ A;  3LIG A;  1YUD A;  3PDQ A;  1Z7S 2;  5T5L A;  1NOV A;  4MXW A;  2P2K A;  4OMD A;  4OYU A;  5KBF A;  1AXZ A;  1XB9 A;  2JIJ A;  1AR6 3;  2IXH A;  2W0X A;  3SCF A;  4L99 A;  5FP7 A;  2JDK A;  2PHR A;  4DIN B;  1NY7 2;  5FPB A;  3ACF A;  2VMI A;  2UYB A;  2A3X A;  4YM1 A;  3MYX A;  4LBL A;  1GUI A;  4IER A;  2E53 A;  4C0B A;  1R09 3;  1WBL A;  3VDD B;  2EXI A;  3ZFF B;  3ETQ A;  4OQ8 A;  1F2N A;  1J3P A;  1KRI A;  1FOD 2;  1LHO A;  1W9Y A;  2A6W A;  2Y6J A;  3A23 A;  5FZA A;  3U75 A;  4CP9 A;  3PMS A;  1RUF 2;  1I9R A;  1MZE A;  5I8Y A;  4XQD A;  1WWY A;  4N8M A;  1ZZC A;  5LA1 A;  4B4R A;  1EAH 2;  4ITC A;  4LIU A;  3SEE A;  1IGO A;  3RSJ A;  2RE9 A;  5DG1 A;  5A7P A;  3AP7 A;  5BNO B;  4YW7 A;  1G86 A;  3OYW B;  4AHW A;  4PQ9 A;  1BHG A;  5EV7 A;  5T52 A;  3TNQ A;  1QKQ A;  5FP8 A;  2JG8 B;  1JHJ A;  2QDN A;  1NUK A;  2E33 A;  4ZS2 A;  4AGV A;  4BME A;  4BOW A;  1UY3 A;  2VAU A;  5I0S A;  2BER A;  5ABJ B;  2X5I B;  2JE9 A;  4LT5 A;  2DUP A;  3M7A A;  2A75 A;  4QQP A;  4AVA A;  5LAT A;  2FD8 A;  3P3N A;  2R0H A;  2VZU A;  3SEP A;  4GKX A;  4NPR A;  4QXK A;  3OY8 B;  1JMU B;  3QLQ A;  1UCX A;  2J22 A;  5D1I A;  2QQI A;  1HIX A;  2ZHL A;  1LED A;  4KBZ A;  3SXW A;  3R05 A;  5IK8 A;  4C8D A;  2WS9 2;  3KF5 A;  3UKN A;  2LUW A;  2QQL A;  1N1S A;  2L9L A;  3CF6 E;  5KWR A;  1G6N A;  3OUI A;  4V1P A;  4FPY A;  1JN2 P;  1OH3 A;  3IN9 A;  3VL8 A;  1PVC 2;  2XQX A;  1ODN A;  3ASI A;  1QOT A;  4FO9 A;  4U2A A;  5L7O B;  4BA6 A;  3PIG A;  5FP4 A;  4GB3 1;  3I2I A;  1RIT A;  1YI7 A;  2R49 A;  3B7M A;  3POI A;  3ZXF A;  4JVA A;  5C4W C;  1D7P M;  2EF6 A;  3VB9 A;  1Y9Q A;  5FLH A;  1HQN A;  4A44 A;  2QZ2 A;  5A6Q A;  1GQP A;  1L7Q A;  2GC0 A;  2PLV 1;  1GR3 A;  4JRL A;  3WXP A;  1Q8Q A;  1NQD A;  5IW0 A;  2GAL A;  5IWF A;  1OLM E;  3H3U A;  2PHF A;  5BNP C;  4J25 A;  3VGI A;  1UY2 A;  2FZ2 A;  3MPB A;  2XBO 2;  3ALQ A;  2ZX4 A;  5FTT C;  1DGR N;  3EYP A;  5CFC A;  1JBC A;  3HN3 A;  2YXS A;  1US3 A;  2VUD A;  1F5F A;  1S0D A;  2F4L A;  4JV4 A;  3FLR A;  3RVH A;  1O3S A;  4QD2 A;  5DAX A;  3OGR A;  1GZW A;  2D3R A;  4UFJ A;  1ASJ 3;  3TAY A;  1RJ8 A;  2D7F A;  5EYY A;  5FKB A;  4IEU A;  2D6L X;  2JDH A;  2JEC A;  2HWF 1;  4OUE A;  4IGP A;  1R1A 2;  2D5F A;  2OQ6 A;  1RUE 1;  4D7T A;  1FOD 1;  1BKZ A;  1PNF A;  5FK8 A;  2Q4S A;  4GA9 A;  2B42 B;  4P9Y A;  2BBV A;  1JYT A;  4XZU G;  2WS9 1;  1A3K A;  1TVG A;  3H8X A;  5DAQ A;  1VBD 3;  3C7G A;  1PHM A;  3TYJ A;  3CIH A;  2PLV 3;  2WDB A;  3ZFG C;  2TUN A;  1UOG A;  2VZP A;  4AVS A;  5CFC C;  1VMH A;  1XC6 A;  3NV2 A;  5FRA A;  2FMY A;  4YPJ A;  1PGW 2;  1F5J A;  2AH2 A;  3S30 A;  1H0B A;  2GH8 A;  3R0R A;  1UWW A;  4L97 A;  4IUG A;  1F9K A;  5L7O A;  5F32 A;  4NE9 A;  4RFT 0;  4D7S A;  3BVC A;  4QGN A;  1YO8 A;  4PDW C;  3MW4 A;  5FPU A;  3ORJ A;  1YIF A;  1P8J A;  1WW6 A;  5FZ6 A;  3WDW A;  2XJQ A;  3KGZ A;  4COU A;  2ZGN A;  2YB7 A;  3A0N A;  2XL9 A;  3TN9 2;  3M3E A;  3WNO A;  3WNP A;  4CUG A;  3VN4 A;  2ZA9 A;  1RUE 3;  3LCP A;  2FDJ A;  4P5H A;  4FFH A;  2DV9 A;  1QDC A;  5CG9 A;  3P3P A;  4PLM A;  2BBA A;  3TOJ A;  1NZC A;  2HJI A;  3A0K A;  4XJ9 A;  2ZZJ A;  5BNP A;  3CJI C;  4AE2 A;  3USU A;  3ZO0 B;  3I2G A;  1FNY A;  4RGG A;  2PHD A;  2DFB A;  1H30 A;  2GAU A;  3CJI B;  3CZU A;  4HSL A;  2Q30 A;  2JG8 A;  1NLR A;  1W8Z A;  3K2O A;  5FPA A;  1QH6 A;  1OLM A;  4TLF A;  4FP3 A;  2CWS A;  5JWP A;  3ZKU A;  1SBE A;  3GZE A;  5FPL A;  2VCM A;  1C1L A;  5FO8 B;  3WNM A;  5LW9 A;  1QNY A;  4UFL A;  1LOF A;  4RA0 A;  2NQY A;  3MIF A;  4UBH A;  3ZPO A;  1LRH A;  3LPG A;  4CDU B;  5IT6 A;  5T54 A;  2MNG A;  1GV9 A;  4H3W A;  4HFS A;  2BEO A;  4N53 C;  5BV6 A;  2R07 2;  5FPV A;  5J37 A;  4EN0 A;  1GP5 A;  3JBG 2;  1B35 C;  1QJX 2;  3C2U A;  4XW3 A;  3WG3 A;  5KC6 A;  4UFH A;  2RS3 3;  2V4V A;  3I2J A;  1BQP A;  2HBU A;  1PX3 A;  1GSL A;  3KM5 A;  4N9H A;  3LEI A;  1PK6 A;  4URT A;  2JIG A;  5D8A C;  2ZAB A;  5JPN B;  5EJ3 A;  4M0H A;  4K8F A;  3U0Z A;  5LK7 B;  1JZ2 A;  4QPG C;  4PLN A;  4IV1 A;  1UYZ A;  1AJK A;  2XJR A;  2QQV A;  4AW7 A;  4WBB A;  1HN1 A;  1HQL A;  3TN9 3;  2GZW A;  1KS5 A;  1CZV A;  2WA4 A;  4NWV A;  3ZYP A;  5GZE A;  2ET7 A;  2FCT A;  3ZIW A;  1XBF A;  1TMF 2;  4G9S B;  2P3Y A;  4ZHN A;  3U1X A;  1X82 A;  3IAQ A;  1NA1 B;  4N7U A;  3KT1 A;  1N1V A;  3WDT A;  1RVF 2;  3MF6 A;  1RXG A;  4JKM A;  3I3Q A;  4EN9 B;  4URA A;  1OA3 A;  1W39 A;  4NVP A;  4MET A;  2OII A;  4Y5S A;  5E89 A;  1COV 2;  1S0E A;  1C8N A;  1MZF A;  3MV1 1;  3UV9 A;  3ZDV A;  4EWE A;  1JYN A;  3MFC A;  1S1A A;  4I0W B;  5FQ0 B;  5FO9 B;  4BZ4 A;  5J96 B;  1H2M A;  5JOZ A;  1VBD 2;  3SIT A;  1DQ2 A;  4QPY A;  4KWK A;  4TTG A;  1VAK A;  5F3I A;  2PHL A;  3T09 A;  1UX7 A;  1DU3 D;  4QHZ A;  1ZX5 A;  1OVP A;  2PQQ A;  2VVD A;  3MDP A;  4OUM A;  4Q0P A;  5F5A A;  4TLG A;  3WCR A;  1FYU A;  4XCA A;  1RUJ 3;  2WQZ C;  3RZM A;  4LO7 A;  2BOI A;  3WT3 A;  4XET A;  2VL4 A;  4PIZ A;  1OD3 A;  2R06 2;  4LUM A;  5IFT A;  3TEZ A;  4MGS A;  3WW4 A;  1LHV A;  3C7F A;  3W20 A;  5L9V A;  3MW3 A;  3M70 A;  3THD A;  3M3I A;  1W0P A;  4XBQ A;  3J8F 1;  5LBB A;  3NNG A;  4IEX A;  1O59 A;  1VRB A;  2XBO 3;  1LHU A;  5I0U A;  1W0N A;  1K5M A;  4XJ8 A;  1NKG A;  1ZRC A;  3NNF A;  4OLL A;  2D43 A;  4HT1 T;  3SH4 A;  5FZL A;  3VD9 A;  1QJE A;  4G3Y C;  4XIO A;  3OJB A;  2EA7 A;  5FWE A;  4AVB A;  2VO5 A;  4A7Z A;  3WV6 A;  2K2S A;  2D98 A;  4LKS A;  3RMX A;  1HQW A;  1W6N A;  2DCZ A;  5GLU A;  4DOU A;  4CDQ B;  1YQC A;  5E88 A;  2PA7 A;  5FLJ A;  3WX5 A;  3ZMO A;  4BIS A;  4H7M A;  3H7Y A;  4ZPI A;  5EHD A;  1D4M 3;  2HWE 2;  4GIQ A;  1FV2 A;  2Q8O A;  1H1M A;  3N35 A;  3AMP A;  4LUL A;  4YVW C;  3KV4 A;  3RMY A;  3AB0 A;  4G4F A;  4LOS A;  1YQ8 A;  1DIW A;  1ZM1 A;  1KD7 A;  4BM8 A;  5FPX A;  4AFA A;  2VNV A;  4N53 B;  4XF4 A;  4FPO B;  4QKD A;  4HKW A;  4LA2 A;  5DUV A;  3RZG A;  1POV 3;  1O5U A;  3WD5 A;  4EWA A;  3Q8C A;  3QD6 A;  5A3W A;  2QQM A;  2QFE A;  2VBB A;  3ELN A;  3LSE A;  5D8A B;  1GZC A;  2RS1 2;  3KWV A;  3SMH A;  4ZZ5 A;  1JZ3 A;  3LDR A;  4CCO A;  4FSJ A;  3ZYI B;  4LE4 A;  2CWM A;  2QCS B;  2XML A;  4PCR A;  5LY2 A;  1DG6 A;  4MGQ A;  2DCJ A;  2RM2 1;  4MOA A;  2YBK A;  1REE A;  3SH3 A;  3ZN6 A;  5BUV A;  2WFP A;  3TNP B;  4DB5 A;  2RMU 3;  1MS1 A;  1DQ5 A;  1OBN A;  3ZYB A;  3D0J A;  5JXJ A;  5E6H A;  4FPE A;  3OD4 A;  1W6P A;  1X8E A;  2VY0 A;  1S0G A;  4K1Y A;  1C4R A;  1WUV A;  2VOV A;  4CXY A;  4JDN A;  4M3C F;  1YQ2 A;  2TNF A;  4NRQ A;  5CA6 A;  1IS5 A;  1SG3 A;  5H9Q A;  5JMC A;  3NRU A;  1N3Q A;  4NO4 A;  2BNM A;  4XIK A;  3JQW A;  2YPD A;  4XMA A;  3AZV A;  1Y7B A;  1JXN A;  3E6D A;  1C1F A;  1LAJ A;  2RV9 A;  1AL0 G;  1SCS A;  3IZO A;  3THP A;  2KXL A;  3I97 A;  3WUD A;  4MYE A;  1ZRD A;  4QPI A;  4V2W A;  3VBO A;  4CXX A;  4YSF A;  1PMI A;  4PDW B;  5A1F A;  1LUL A;  5CG8 A;  1SFN A;  3JD7 1;  1UZV A;  5BY5 A;  4LQR A;  3KV5 A;  4PHZ A;  4P5Y A;  4BJ0 A;  1CVN A;  4GXL A;  3W5N A;  1OUX A;  3NQH A;  5T5O A;  4I2O A;  1W90 A;  4YVW A;  3UJO A;  5GZD A;  3FX3 A;  2DCY A;  2VXJ A;  2WWU A;  4LUK A;  1PGL 1;  1XYP A;  2YHJ A;  3HQR A;  3JBG 1;  3B02 A;  4XHX A;  3RYK A;  4XYX A;  5FZE A;  3BOW A;  2ZGK A;  3JUU A;  1NCR B;  3AXE A;  1OH4 A;  3FHI B;  4WVM B;  1AR6 2;  1CGP A;  3NNM A;  3N9Q A;  2PYT A;  4COZ A;  1UU5 A;  2Y26 A;  2LS6 A;  4OHX A;  2EIG A;  1BBT 3;  2OT7 A;  4UW4 A;  4BHP A;  2R32 A;  3U11 A;  4IND A;  4S2G A;  5I8T A;  2MEV 1;  3I2K A;  3E1F 1;  2W1U A;  5LB6 A;  1S2B A;  1V6L A;  5E16 A;  5SV5 A;  5AC9 1;  5C3Q A;  1AYN 1;  2B39 A;  4XAE A;  2VJX A;  1UNB A;  4CEY A;  3V0A A;  1RUI 1;  1DF0 A;  2XLF A;  3GDB A;  5G04 L;  3OBR A;  1HRV 2;  3BTX A;  4GKY A;  3NW4 A;  1UZY A;  3MW2 A;  5HBA A;  4AQT A;  5BNN A;  4XZP A;  1YNA A;  3O1V A;  1YI9 A;  4P02 B;  1WGP A;  4YZ5 A;  1G9C A;  2W95 A;  1NCR C;  4HBN A;  4RR3 C;  2RR1 1;  3ACI A;  4QMA A;  5EYX A;  5B2G B;  5ACA 1;  5JSP A;  3KD4 A;  5HCA A;  2P1B A;  1NCQ B;  4AYU A;  2YFU A;  3QH7 A;  3FLP A;  4XFH A;  1C8M 2;  1CD3 G;  3WDV A;  1MPX A;  1J3R A;  2PFW A;  5FLI A;  2RDR A;  4GWN A;  1ND2 B;  3HR9 A;  5A7S A;  4ES9 A;  5CAD A;  3HBK A;  2WIN B;  1PGW 1;  3M3C A;  1O4Y A;  4QX2 A;  4N7I A;  1W9W A;  4PQQ A;  2XKO A;  5K7P A;  4UFI A;  3GZU C;  3O1P A;  1OXC A;  1OC1 A;  1R64 A;  4N53 A;  4YG6 A;  1VRH 3;  3J26 N;  4TSV A;  1CZT A;  4RHV 2;  3VL9 A;  1OFS A;  3P5B A;  4ASL A;  2RM2 2;  2R1D A;  3CKH A;  3J4U H;  4FFF A;  2WYS A;  1K45 A;  4XEZ A;  1F4H A;  1ZBE 2;  4YG0 A;  1OQE A;  1YEW A;  2RS1 1;  4K7J A;  2E51 A;  4XFC A;  5LA2 A;  4AHZ A;  2HWF 2;  5HCF A;  4I09 A;  1POV 1;  4IV1 C;  2DUO A;  4YWA A;  3BIE A;  4FQ4 A;  3L2Y A;  4TZD A;  3WP5 A;  4W6X A;  4GH4 C;  3PL0 A;  3RG0 A;  4B1M A;  3UGF A;  4M00 A;  3BI3 A;  3AMQ A;  2B5H A;  1MQT A;  2D44 A;  4CCL A;  2Y0O A;  1JYW A;  2A5Z A;  1Y9M A;  1MQT B;  3GBW A;  4NRM A;  3ZSJ A;  5AFB A;  1DCS A;  2WKK A;  1QXJ A;  2DVD A;  2YUE A;  2PXJ A;  3PVO A;  4NHY A;  1OPM A;  5IK4 A;  2QNK A;  2AZ5 A;  2HWE 3;  2QJV A;  1PO2 1;  4MG2 A;  1ND3 B;  1L7R A;  3WQB A;  2ZX3 A;  4H14 A;  4MUV A;  1QJY 1;  4CE8 A;  2CNA A;  4CDW C;  1C57 A;  1W6N B;  1SCR A;  1VRH 1;  3SQO A;  5B4X A;  2AEY A;  3KT7 A;  1GBG A;  2C24 A;  3IMM A;  1AR9 2;  3OG2 A;  3LZZ A;  5E8A A;  2WT2 A;  1EAH 3;  4FPL A;  1MS3 A;  4BQ2 A;  3N7J A;  3LF7 A;  4HVO A;  1UY0 A;  5FPZ A;  3LIH A;  1JU3 A;  3J8F 2;  4AVC A;  3I54 A;  3WEZ A;  1IOA A;  1DGR A;  4D6Q A;  5A6Z A;  3VBF A;  3ZFF C;  4AG4 A;  4BH9 A;  3NAP C;  1NXM A;  1HW5 A;  3GYD A;  4DQA A;  1W2N A;  3V56 A;  2GMP A;  4AR2 A;  1HB2 A;  3PUQ A;  4R52 A;  5KC5 A;  3T1L A;  2EIE A;  5GZC A;  4FVV A;  4LBK A;  4P9X A;  1YIP A;  1CR7 A;  2R1B A;  5F3C A;  4QPI C;  1QNW A;  1KEX A;  3IDC B;  1E57 A;  1IQD C;  3P1I A;  1DYK A;  3BU0 A;  4LR4 A;  2V73 A;  4S2H A;  3ZFG B;  1B09 A;  5A32 A;  1MS9 A;  1RIR A;  1BVP 1;  2A6V A;  4CYD A;  2QTW B;  2WSU A;  1A34 A;  2ARA A;  3SH5 A;  2PEL A;  1GMM A;  3VBS C;  4FBF A;  4QAW A;  5DZF A;  1BBT 1;  3CQO A;  2XG3 A;  3TWI A;  1HX6 A;  1UX6 A;  2OZJ A;  2Y64 A;  5FZK A;  1CJD A;  3HQU A;  3DPR B;  4FXK B;  2MEV 3;  2JE8 A;  4HVQ A;  5FYT A;  4CXW A;  2YGL A;  2DCK A;  1AYN 3;  1BVV A;  2ZGR A;  4UFK A;  2NP0 A;  2Q1F A;  4QPW A;  1N1T A;  2XKP A;  3NJZ A;  5GZF A;  2ES3 A;  4CSW A;  4I3P A;  5C70 A;  1OLR A;  5CKN A;  3B9I A;  1IPJ A;  1ND2 C;  2ZBJ A;  3AMH A;  4YW4 A;  1ZBE 1;  2WZP P;  3W58 A;  3ZXD A;  4AGR A;  5C4W B;  3MPP G;  3WZ1 A;  2W9X A;  4AHY A;  3VDB A;  1FMD 3;  1WCQ A;  2V4A A;  1D4V B;  2AEZ A;  5KHI A;  3PTR B;  1H9W A;  3HMY A;  1XPW A;  1ZZ6 A;  3FL7 A;  1YWK A;  1QJX 3;  1SEF A;  1GOH A;  1ZRE A;  1AF9 A;  1CAV A;  3G7D A;  1PNG A;  5ANQ A;  3RZZ A;  4QQ2 A;  3DYO A;  1UMH A;  4B7K A;  2XVG A;  2ZX2 A;  4BQW A;  2TEP A;  2HYK A;  2LRO A;  2I2S A;  2IUW A;  3HBZ A;  1S2E A;  5CFD B;  4XFG A;  1IZ3 A;  4J1W A;  5FY4 A;  5HV0 A;  1RUO A;  2VVF A;  4KI5 M;  1CON A;  3NV1 A;  3RRD A;  5JOW A;  3ROU A;  3RZH A;  3LOI A;  4BK5 A;  4LO6 B;  4Q26 A;  1OT5 A;  1IG0 A;  1SMV A;  2R04 1;  3Q8E A;  3ZOI A;  3PVE A;  1C5H A;  1VMJ A;  2WR9 A;  3AVS A;  4Y4R A;  2OKX A;  3UL2 A;  4X8N A;  4LO8 A;  5CNA A;  3T2P A;  4AL9 A;  1XNB A;  3ZIX A;  3DV8 A;  5HPO A;  1WW7 A;  4BCU A;  1D2S A;  2KA3 A;  1FMD 1;  1PO1 2;  1U5Z A;  2NMO A;  3T0B A;  4JTO A;  3SIS A;  1SLT A;  5JSR A;  5IVE A;  1AYN 2;  4CDU C;  3SC7 X;  4UFM A;  1TZO A;  3NO8 A;  3WG2 A;  3SHR A;  1IS3 A;  4P08 A;  3AYE A;  1DP0 A;  4L11 A;  2VUL A;  1X9T A;  4YAR A;  1OFN A;  5DMY A;  2J1A A;  3WNL A;  2NYY A;  3K75 B;  4YGD A;  5LBF A;  4AF9 A;  5CKM A;  3BOD A;  2LW8 A;  5EXO A;  4JHZ A;  3HNY M;  4CCJ A;  5FRE A;  3B9C A;  4QPI B;  3CJX A;  3R4D B;  2WBK A;  2YRO A;  4NIA A;  3ZYR A;  1UPS A;  2D93 A;  2VMF A;  4YM0 A;  2Q1M A;  3PUA A;  5FYB A;  1PMJ X;  4RR3 B;  2YC0 A;  3WG1 A;  3VHO A;  2J1V A;  2R04 3;  2BVV A;  1LGN A;  4Q4X 1;  3WP6 A;  5FP9 A;  3ACL A;  5C8C C;  2GU9 A;  1GZW B;  1AR8 2;  2E7T A;  2XUE A;  5I93 A;  5JXI A;  2A1X A;  3BGA A;  3DXT A;  3KS7 A;  2DTY A;  2E7A A;  3KV6 A;  4Q5O A;  4NOT A;  4EN6 B;  4F3J A;  2W47 A;  1UY1 A;  1W05 A;  1LOG A;  2EXK A;  5DDJ 3;  4DUV A;  1W28 A;  1VPH A;  4AEM A;  1HV1 A;  1S0F A;  1SPP B;  2O8O A;  4YM3 A;  1U0A A;  1CIY A;  2Y34 A;  4UBG A;  4HK8 A;  4LKF A;  2CGO A;  1Z0H A;  1OHF A;  4ERO A;  4M3C A;  2Y0I A;  3BU7 A;  4MGK E;  1E5I A;  1AR9 3;  3ZFG A;  5IUQ A;  1OOP B;  4QGM A;  5FZM A;  5HV4 A;  2JDM A;  3E97 A;  4MXV A;  4WM8 A;  3DUI A;  1X7N A;  1SZB A;  3UT0 A;  3OPT A;  1V00 A;  2JEN A;  1C28 A;  5DZG A;  4OFG A;  3UGG A;  3WP4 A;  3GF6 A;  5C8C A;  5JDB A;  4BB3 A;  1QQP 2;  1MS8 A;  3K3O A;  1DDL A;  4NAM A;  4P14 A;  1BXH A;  1FT9 A;  1CAX B;  1V0A A;  2A7A A;  3BPZ A;  1S0B A;  2R30 A;  3OGS A;  2ZZQ A;  4UT5 A;  5C5U A;  1LOE A;  4K8R B;  4LK7 A;  3FWE A;  4LIV A;  1VP6 A;  2P4E A;  3IDE A;  3OUH A;  2Q0A A;  2WZ8 A;  4PT6 A;  4Q1R A;  4ET7 A;  4XBL A;  2JDP A;  4P00 B;  3DXU A;  3B01 A;  5A80 A;  1RUG 2;  1OF3 A;  3L9J T;  3OYW A;  1QQP 3;  1XE0 A;  3OSD A;  2ERF A;  3LAG A;  2VU9 A;  2ZJC A;  1GWM A;  2BTV C;  4IET A;  5DAV A;  4XC9 A;  3WNN A;  2HKX A;  2GN3 A;  3CZJ A;  4EJR A;  1XYN A;  4IEQ A;  3GJB A;  1RHI 3;  1VBE 2;  2JX9 A;  5JXH A;  1LU2 A;  3AJY A;  2JG9 A;  2J1R A;  3OBT A;  4XHB A;  5F3G A;  2JD4 A;  3S7I A;  3H1M A;  4AXO A;  3N7K A;  1K5M B;  1COV 1;  1FXZ A;  1V70 A;  4FOV A;  3PNA A;  4CZS A;  1CQ9 A;  1SPP A;  4LE3 A;  4CP2 A;  3HPN A;  2GC1 A;  1CAX A;  4B4P A;  1UU4 A;  2VZT A;  4CRQ A;  1J59 A;  1RMU 2;  3N3H A;  2D3P A;  5JSO A;  3RZL A;  3T4V A;  4A4A A;  2ET1 A;  1TMF 1;  4IEP A;  5F6L B;  4Y22 A;  1L3J A;  4BIF A;  4AI1 A;  2XWB B;  2DBI A;  5DN2 A;  5EWS A;  4F7Z A;  3ME2 A;  4TWT A;  2GP3 A;  2XL7 A;  4Q2F A;  2VOX A;  4HKO A;  4LIT A;  1BMV 1;  2E31 A;  2NN8 A;  2J1U A;  4DXT A;  5CFC B;  2X5I C;  1UIK A;  4M3C B;  2XHK A;  2JJ6 A;  2GNB A;  5FCC A;  3EHK A;  5FYH A;  5H9S A;  5F5C A;  1QIQ A;  1FOD 3;  3J9S A;  3VBR C;  1OOP A;  2C26 A;  4QM9 A;  1HXS 3;  1YYN A;  4QPG A;  4Q0S A;  5DDJ 2;  1RHI 1;  1W99 A;  1XQN A;  1QH7 A;  1ZZ9 A;  1W0O A;  1KDK A;  1WA6 X;  3AKS A;  3KB5 A;  4QXB A;  3VHR A;  3K48 A;  3ZXG A;  5KHJ A;  4RS5 B;  3AZY A;  3IDA A;  5LAS A;  4Q27 A;  2Z69 A;  3T2O A;  3AFK A;  3R6S A;  2G1M A;  3PLQ A;  4CU6 A;  1Z7S 3;  3AMN A;  5LBC A;  4JGZ B;  4HON A;  4QX1 A;  3AYA A;  2HYX A;  4LOT A;  2A6Z A;  1U5X A;  5CVR A;  4DRV A;  3PME A;  4N43 B;  1GZ9 A;  4RFR B;  1MEC 3;  4UF0 B;  2OPK A;  2GMM A;  2YFZ A;  3AZX A;  3MV0 1;  1N3O A;  1B35 A;  4CUB A;  1GLH A;  1ZZB A;  1DZQ A;  2YYO A;  1OQD A;  4D0Q A;  3BN6 A;  4DEQ A;  3LOB A;  3J7L A;  4RQP A;  4ZS3 A;  3VBU C;  3I7D A;  5FBZ A;  3WF1 A;  1YC6 1;  3AXD A;  4AED B;  1XU1 A;  1IHM A;  4FXG B;  4CEY B;  3ZYJ B;  4CUC A;  2FDF A;  2YBP A;  2VPV A;  1NCR A;  1G8W A;  1V9U 3;  5IYY A;  2C4X A;  4DMI A;  4CCK A;  1SLC A;  3OF1 A;  4PDW A;  2BW8 A;  2OVU A;  2XR4 A;  4ES8 A;  3IPV A;  5L9B A;  1OLQ A;  2PAE A;  4Y3O A;  4B8E A;  2WJS A;  1VR3 A;  3LA2 A;  4QT6 A;  3HOB A;  1VAV A;  1JYX A;  1RYY A;  4OHV A;  4QKF A;  1JZ6 A;  4Y5T A;  2AUY A;  4AQS A;  5A1A A;  1VAL A;  2Z79 A;  4YG3 A;  3O1M A;  4YZ4 A;  1AR6 1;  4BLI A;  2UUR A;  3VZL A;  1VBE 3;  3BKZ A;  1RHI 2;  2V72 A;  1Q3E A;  1EPZ A;  2HWC 2;  5FKC A;  2A6X A;  1HDK A;  2RMU 2;  3AL5 A;  5IAV A;  5FZ4 A;  5C4W A;  4Q4W 2;  3VDD C;  5LCW L;  3ENR A;  5T55 A;  3OGV A;  2ZPX A;  5T3N A;  4QU1 A;  1W04 A;  1X33 A;  2JDU A;  2BFU L;  2ZX1 A;  2RS3 1;  1GQH A;  1T2X A;  4PJY A;  3RWN A;  1WCS A;  1CES A;  1O4T A;  1ZBA 2;  1V6N A;  4IGQ A;  2UYA A;  2HWB 1;  1K5J A;  3POB A;  4UOJ A;  2VME A;  1JH5 A;  1T6B X;  1VMF A;  3WHT A;  2HEV F;  4A7K A;  4Y33 A;  1XNK A;  1I5Z A;  1NLQ A;  2ZEY A;  3FFQ A;  1NE6 A;  1YQ5 A;  4D94 A;  1RUE 2;  4RS5 A;  4ATE A;  1UY4 A;  5F7U A;  1JW6 A;  5DUW A;  5KXD A;  4AI8 A;  5EZW A;  2WZE A;  4HVR A;  4R8H A;  4GWM A;  4QB1 A;  4XUP A;  1XNA A;  3KCX A;  4XFF A;  2JE7 A;  4PBP A;  4E4H A;  2BFU S;  3AX4 A;  3DKW A;  1KXG A;  2B4K A;  3E6B A;  3KCY A;  3OGJ A;  2ZOE B;  3OTF A;  5DAP A;  4A42 A;  2RDS A;  3FE5 A;  3H1W A;  4PI0 A;  4OI1 A;  3MUY 1;  5I91 A;  3LDB A;  2G9G A;  1RUD 2;  1YLL A;  2AR6 A;  4Q4V 2;  3U4S A;  2PN5 A;  3VBU A;  3AMM A;  1S2K A;  4AFM A;  4FPG A;  1XU2 A;  4EZH A;  1Y43 B;  3AKP A;  3B3Q E;  1Q5O A;  1HRI 3;  2PLV 2;  2WYF A;  3GGL A;  4NHM A;  4BQ3 A;  5JOX A;  4IE7 A;  3T0A A;  4IE4 A;  2LM3 A;  4SBV A;  2VW0 A;  4IV3 C;  5FMO S;  5K0U A;  1H8T B;  1ALY A;  4COV A;  1PIV 3;  1AL2 3;  2OX0 A;  3LKJ A;  4YRD A;  1ULO A;  1O5L A;  1S55 A;  1UYP A;  3ZR6 A;  1G9B A;  4C0H A;  4IV3 B;  1PVC 1;  1ODM A;  1WD4 A;  4FCA A;  4OCT A;  5DZE A;  3GNE A;  5CAZ A;  3MHZ A;  4Y20 A;  1NLS A;  1UF2 C;  3EBR A;  5CEH A;  5FUP A;  2A3Y A;  4RD7 A;  3I2D A;  5JR2 A;  2WN3 A;  2VQ0 A;  5FYM A;  3V64 A;  3H1Y A;  3MLL A;  3IB3 A;  4UAP A;  1PIV 2;  4W6Y A;  4BU2 A;  2A71 A;  4AFB A;  3NKT A;  3LD8 A;  2BWA A;  4QGL A;  2C1F A;  2MHF A;  3U78 A;  3WDY A;  3J8F 3;  4Z07 A;  1DYO A;  2RVA A;  4I0A A;  1JHN A;  1H2K A;  3RFR A;  3VKO A;  1N3P A;  2ZEX A;  2VOT A;  2WNE A;  2XBO 1;  4R4X A;  4K9S A;  2CYF A;  2YY1 A;  3VBF B;  3ZVX A;  3RJ2 X;  1NQJ A;  1N1Y A;  2VNR A;  2VMH A;  4QKB A;  5D2A A;  5B4N A;  2EAA A;  1DFQ A;  1D4M 1;  4DXR A;  1W6M A;  4HSJ A;  2HEW F;  4LBQ B;  2CTV A;  1EAH 1;  1OI6 A;  3H8U A;  3AZW A;  4X8P A;  3VV1 A;  4MXW B;  3D82 A;  4QDS A;  2ZCW A;  3KCC A;  1Z78 A;  2R06 1;  4CPB A;  2QKD A;  4QB2 A;  4DXZ A;  2R0F A;  1REF A;  2D3S A;  4M01 A;  4D69 A;  5KXB A;  4QHB A;  3QCW A;  4QHO A;  1NY7 1;  4KG0 A;  3CLP A;  2ZGT A;  3VBR A;  4FTE A;  2JKB A;  3GCW A;  1NYW A;  4Q4Y 1;  3C7H A;  5T50 A;  1CIW A;  2VUJ A;  4XF0 A;  3VKL A;  4JQR A;  1VBD 1;  2WQ4 A;  5KHH A;  2DU1 A;  5FMB A;  4K1Z A;  4XFI A;  4FQZ A;  4YGB A;  3ILN A;  2R6Q A;  2O0O A;  2RMU 1;  2XHN A;  2GC3 A;  1XSQ A;  2ZS6 B;  4HXC A;  4EWD A;  1XSR A;  2WLP A;  1LOA A;  1V9U 2;  5A3L A;  5C5T A;  4QQH A;  2D6M A;  4AQ6 A;  2H6C A;  4YNI A;  3JB8 A;  3NWK A;  5A7W B;  4CCN A;  2RHP A;  3DEM A;  3JXS A;  3POJ A;  1FNZ A;  3LGR A;  1RGS A;  4XXA A;  4KH9 A;  4AI3 A;  4BXS V;  2RR1 2;  4LXL A;  2WUH A;  3WR0 A;  4LHL A;  4GAZ A;  2TBV A;  3NJY A;  4FFI A;  4R9C A;  1M06 G;  2ETE A;  3GM8 A;  4A45 A;  1AYM 2;  1DGL A;  3WDX A;  1YFX A;  4UW6 A;  1VAM A;  2YZ4 A;  2GME A;  1UMI A;  1R09 2;  3QBQ A;  4N43 A;  3PUR A;  1MEC 2;  5A33 B;  5CYY A;  3MGU A;  1QJZ A;  4W8J A;  5FYY A;  2KD7 A;  3VBO C;  2VGD A;  4LBM A;  3K3N A;  1TG7 A;  2WSV A;  2CL2 A;  3UKT A;  3ZKY A;  2H0V A;  4CDQ C;  4QDR A;  5FMD A;  5M0T A;  4E8C A;  4FPK A;  3N9L A;  5I8S A;  2C6S A;  2WQ8 A;  4YZ1 A;  3D8C A;  4AED A;  3H0O A;  5EJ1 B;  5FZF A;  1UZW A;  4Q0U A;  2CGP A;  3JD7 3;  3RWK X;  3IAP A;  5FJK A;  4K3U A;  1ULG A;  1UZ0 A;  1EV1 3;  1RTV A;  2N7G A;  3PU3 A;  4MSV A;  3CNA A;  5C6C A;  4C1X A;  4W6W A;  2ZHM A;  5DQ0 A;  1IS6 A;  1X50 A;  5FY5 A;  5J1X A;  1XND A;  3I3D A;  4Q8L A;  1R08 2;  3NJX A;  1VB4 A;  1ULP A;  5DPN A;  3T4H B;  3OCP A;  5KXC A;  1QOO A;  2DVB A;  5FK7 A;  1O3T A;  3OD0 A;  2J1T A;  4PLO A;  2YU1 A;  3MI8 A;  3M4F A;  4YW5 A;  5A3M A;  5FZH A;  5HXV A;  4TYS A;  2GN7 A;  2V5D A;  4OUS A;  4Y26 A;  2JG9 B;  4Z82 A;  4D6S A;  3M2M A;  4OHY A;  5AC9 3;  1RMU 3;  2DCT A;  3CHX A;  2CDP A;  2XJS A;  3NST A;  1BMV 2;  4FT8 A;  1F8V A;  2W1W A;  4NII A;  2E32 A;  4NUB A;  4XAB A;  3WUC A;  5KR7 A;  2RR1 3;  3N36 A;  2QQW A;  2WFF 2;  4Q0Q A;  1RL3 A;  2IXL A;  1AR7 3;  3N9P A;  2A70 A;  4LBJ A;  5FMO L;  1ENX A;  2G9F A;  2QZ3 A;  1DHK B;  1EYB A;  1MVQ A;  4ZZ8 A;  5C9A B;  5GM0 A;  2FDH A;  4CP0 A;  1X8M A;  1QMJ A;  1SBF A;  1ZRI A;  1RUH 2;  3MLJ A;  2K46 A;  1WKY A;  3OEB A;  5FIX A;  2IFR A;  3T1M A;  5ACA 3;  5IVF A;  2YPJ A;  1PM7 A;  1Y9G A;  4ZON A;  4ORF A;  4BMB A;  1E5H A;  4HOO A;  4L2N A;  4KU8 A;  5FMC A;  1W6O A;  4IEO A;  5JVV A;  1UAI A;  3VLB B;  5D21 A;  5LA0 A;  1LGB A;  3NV4 A;  3IMN A;  4H55 A;  4JTN A;  1UPI A;  4MV2 A;  4B4Q A;  2EIC A;  3AP5 A;  3K77 A;  1W2A X;  4KG8 A;  4Y4Y A;  2WRA A;  3WNX A;  3OEA A;  5A3N A;  2ZEW A;  3RQ0 A;  4XDO A;  3DYP A;  4YM2 A;  4D7Y A;  3ZSL A;  1TNR A;  4ASK A;  5A3P A;  5L7O C;  5IFP A;  4GB3 2;  4R4Z A;  1NX9 A;  1YJL A;  3ZDS A;  4GQ7 A;  2XJP A;  2X8K A;  4IW3 A;  2BUK A;  4WZC A;  1A8D A;  4MHR A;  1PM4 A;  1D2Q A;  2JDZ A;  5FYV A;  2IXK A;  3WNK A;  4QKN A;  3FHA A;  2EID A;  1RUJ 1;  5I0R A;  2W94 A;  2RS1 3;  3POY A;  2BVB A;  4K21 A;  4N43 C;  5BYN A;  1F4A A;  1VRH 2;  2GC2 A;  2ZGM A;  3O5S A;  5FJH A;  3RYP A;  3KHB A;  5LY1 A;  5EJZ B;  4XF1 A;  2F6B A;  2W68 A;  2Y6F A;  3BUC A;  2Z5W A;  2ZXQ A;  1JOJ A;  1U5I A;  5GLV A;  4FTS A;  1QU0 A;  1RUD 1;  5EIY B;  2HH9 A;  2VQT A;  1OKQ A;  2YBS A;  3LFI A;  1PO2 3;  2JXA A;  1W3X A;  4DY5 A;  3LDK A;  1AVB A;  4A41 A;  1QDO A;  1QEX A;  2UY9 A;  2P5B A;  1SAC A;  1VLN A;  1GFF 2;  4P9W A;  4QM8 A;  4XXP A;  3SCH A;  1RUF 1;  3GBG A;  3GBF A;  1RUJ 2;  4IL7 A;  1OQ1 A;  3PVB B;  4Z8B A;  4P9L A;  3KZ4 C;  5K0U C;  3T0D A;  3CL1 A;  2Y8K A;  1AZD A;  2OZ6 A;  2RJ2 A;  5L36 A;  2DBN A;  4NHK A;  3KQR A;  3LA3 A;  1H2L A;  5FZO B;  4DEV A;  1HRV 3;  4LKD A;  2ZAC A;  4DY3 A;  3CDZ B;  3J7H A;  5GLW A;  4FI9 A;  2V5Y A;  1TEI A;  3BYW A;  4LTA A;  1Q8S A;  1XE7 A;  1ZBA 1;  1LHN A;  1LTE A;  3IT8 A;  5FXV A;  1YQ6 A;  4BE3 A;  4NRP A;  1QWR A;  1DQ1 A;  1GQG A;  1ND2 A;  4D8M A;  1Q8O A;  5LZ6 A;  1H6X A;  4CDW A;  4HN0 A;  3O1R A;  1Y3T A;  4O7X A;  5GAL A;  4XUR A;  4QX7 A;  3APB A;  4BPZ A;  1OOP C;  1UOF A;  4RHV 1;  2IC1 A;  2ZGQ A;  2IXI A;  1O91 A;  3P6B A;  1NA1 A;  4QB6 A;  3PIJ A;  4XOG A;  4OI0 A;  3UNP A;  1XYO A;  1S0C A;  3MIE A;  3K51 A;  2ZKN A;  2BU9 A;  3WW3 A;  4HK9 A;  3D3A A;  2GH2 A;  4JKL A;  4XPV A;  3AYC A;  3C3V A;  4MGY E;  5F8P A;  1CN1 A;  1GOF A;  1ZYB A;  4ARX A;  1H8V A;  3LFM A;  3UJQ A;  3BPS A;  1C8M 1;  3KT4 A;  3Q9O A;  5IK7 A;  3O1S A;  1BJQ A;  2A73 B;  4L92 A;  3Q8A A;  5CFD A;  3I59 A;  4QQO A;  1ZVF A;  2R7E B;  2WNU C;  3SNM A;  4A7Y A;  1ZBA 3;  4JZR A;  5FXW A;  5A3U A;  4O61 A;  5J48 A;  1ZBE 3;  1ULD A;  1R08 1;  1J1T A;  4OI4 A;  2CU5 A;  4KBB A;  4MAD A;  4E2Q A;  4I3G A;  2GP5 A;  1QXR A;  2ID4 A;  5I0T A;  1ACC A;  1WLD A;  3IBM A;  3WVJ A;  4QPG B;  2J1S A;  1GP6 A;  4CP1 A;  1RXF A;  2ZAA A;  1HN0 A;  4HKL A;  1PZ8 A;  2ORZ A;  3ACH A;  1KFU L;  2W92 A;  3AKT A;  2ZGL A;  1US2 A;  5HXM A;  5JZG C;  1T6G C;  4A6O A;  5I0D A;  1OA2 A;  1LKN A;  1W2T A;  2VOW A;  3JBG 3;  2IXC A;  1KDM A;  1UXZ A;  3ACG A;  2VEC A;  4KWJ A;  4XDP A;  1RED A;  4QX3 A;  5BNQ A;  1PK6 B;  2WNU A;  5JCT A;  2VUC A;  4Q4Y 2;  4GMP 1;  5CB7 A;  3MO4 A;  2I07 B;  1FPN 3;  2WZR 2;  2XOM A;  5FFO C;  3HQX A;  4WM7 B;  1HJF A;  4X6Q B;  4LBN A;  4NIG A;  4KGQ A;  4XUT A;  5IVY A;  1MAC A;  1L7L A;  3NV3 A;  4V2V A;  2J1E A;  4WM7 C;  2XLG A;  1O6U A;  3JQX A;  4YVW B;  4E8D A;  4RQP B;  1UMZ A;  3T08 A;  4R9A A;  2WO1 A;  3WF4 A;  3G6J B;  1GU3 A;  1MVE A;  2C5D A;  3UES A;  1W8O A;  1WMF A;  1UD1 A;  3POW A;  4KQ7 A;  4LLF A;  5FP3 A;  3CO2 A;  2WNV A;  1JOB A;  4IEV A;  3FFZ A;  5CZK A;  1D4M 2;  1ZA7 A;  3U4X A;  1NE4 A;  4PF5 A;  5IVV A;  3C7O A;  4YFZ A;  1LCL A;  1ULE A;  1LR5 A;  3ZLI A;  2BJS A;  2VTX A;  4LBQ A;  4E2G A;  1M4W A;  2GNT A;  4CVU A;  3ES1 A;  3ZN6 B;  2WL1 A;  5L73 A;  3T30 A;  4D3W A;  3RI8 A;  3U07 A;  3DPR C;  2H0B A;  3IWZ A;  3LEK A;  5JOY A;  5CBL A;  2VW2 A;  1GNY A;  2CGN A;  2JKX A;  3I3B A;  5FZ0 A;  3WCS A;  1WW4 A;  4AAP A;  4CDQ A;  1FI2 A;  2EIB A;  1WCD J;  3I59 B;  4KU7 A;  1ENQ A;  3ILF A;  3FJS A;  5FYU A;  3WQ0 A;  3WDU A;  4W50 A;  3NJV A;  5FDB A;  1PZ7 A;  5DDJ 1;  1WLC A;  5DAB A;  5FY9 A;  1SFP A;  3K4D A;  2BV4 A;  3KLS A;  1KQR A;  3AFG A;  3U14 A;  2GDF A;  1GP4 A;  3E5Q A;  3AJZ A;  2RG4 A;  1W8U A;  3J7N A;  1YRZ A;  5LBE A;  2ZTN A;  5CKQ A;  1S0J A;  2PQS A;  3W5M A;  3TEX A;  1XE8 A;  2XJU A;  1LOC A;  4Q4X 3;  3H7J A;  4Q29 A;  2D97 A;  3BTY A;  3WF0 A;  2RJK A;  4NPL A;  3FLT A;  4P9J A;  3VZM A;  4IE0 A;  3USS A;  3VKN A;  5BNO A;  5JLV A;  1CAW B;  3E5U A;  5JZG A;  1CJP A;  1QJY 3;  3AP4 A;  4XMI A;  4Y20 B;  3ABZ A;  4W4Z A;  3O0X A;  4CDW B;  5JZG B;  1E5S A;  3SLI A;  4ZU7 A;  5J3U A;  2EAL A;  4L0P A;  3ZXE A;  2E6V A;  5A3O A;  2V09 A;  1N47 A;  1AR9 1;  1EUT A;  4CCE A;  1DBN A;  3HJR A;  5C3P A;  2FBE A;  4LHK A;  4XTM A;  1ASJ 2;  4CU8 A;  1RVF 3;  3TBD A;  1ASJ 1;  3U10 A;  2NM1 A;  4AI2 A;  3HT2 A;  5L19 A;  2HWF 3;  5DG2 A;  3MLK A;  4Y1V A;  3LB9 A;  1YJK A;  1QXP A;  1RUC 3;  1YFY A;  2A6Y A;  2W3J A;  5FWJ A;  4Z2W A;  3D4K A;  3DF0 A;  3Q8F A;  1CWP A;  1WLT A;  4HZF A;  3VZN A;  2WS9 3;  3OBZ A;  4Z1V A;  4Y24 A;  1H2N A;  2GNM A;  3CEW A;  3DEC A;  3POF A;  5FZ1 A;  2ZGP A;  4Q8K A;  3IDB B;  3ZXK A;  3D5O A;  1ZRR A;  3ITQ A;  5FUI A;  3WSO A;  4CUA A;  4P9I A;  1LB2 A;  5JR7 B;  2ZX0 A;  1SLI A;  5LEJ A;  4ZKT B;  2AEN A;  3RS6 A;  2BYV E;  1J84 A;  4M4R A;  5GJ6 A;  1HLC A;  3VBS B;  1WME A;  2FMD A;  1D0G A;  2Y38 A;  2G9Z A;  3MIC A;  1QQP 1;  4Q4W 3;  4YW2 A;  5SV8 A;  4BQ4 A;  3GCX A;  4Q4V 1;  1O3R A;  3H8R A;  1RUH 3;  3QOP A;  3KF3 A;  3EQE A;  2YU2 A;  2C9A A;  1VBB 3;  1CZS A;  1UIJ A;  2VD7 A;  1Q56 A;  1JOD A;  5CU1 A;  3V0B A;  4Y1U A;  1X36 A;  4BQ5 A;  1CAW A;  2XVL A;  4DXS A;  2WN2 A;  3W9A A;  2UWB A;  4R9B A;  3OBA A;  4IV3 A;  1TME 1;  2ARB A;  4CEW A;  2WO2 A;  2BGC A;  2Q5T A;  4EN8 B;  4GMP 3;  1VBA 1;  2D5H A;  3ECQ A;  5CIS A;  2CAU A;  2B7Y A;  2X5I A;  3NKG A;  1G9F A;  3ZYG A;  1NT0 A;  4CCC A;  5ABJ C;  2PTM A;  4BQX A;  1WD3 A;  5IK5 A;  5C3R A;  1U12 A;  1DZR A;  5J09 A;  2BGO A;  3SCG A;  1JUH A;  5APA A;  5A7N A;  3OGG A;  3I2H A;  3K46 A;  4K6B A;  4E9K A;  2R06 3;  3LWC A;  1NG0 A;  5EP9 A;  1AR7 2;  2BP6 A;  3N9M A;  1W06 A;  1LHW A;  1AXK A;  4PF1 A;  1QY4 A;  5GZG A;  3AZZ A;  1W03 A;  4KNC A;  4DS0 A;  1J58 A;  1LEN A;  3BB6 A;  1POV 0;  2R07 1;  1KIT A;  3IIA A;  3RI9 A;  3AP9 A;  1XNC A;  2QQN A;  4F83 A;  4Q4W 1;  3MF9 A;  4YW6 A;  4N90 A;  5F9T A;  4WVV A;  2FHR A;  5E1R A;  1BK1 A;  2P3K A;  2QQJ A;  1HKD A;  2RS5 1;  1W9S A;  2DVF A;  3F2Z A;  4X6R B;  1GKB A;  1W6Q A;  2VZV A;  3POS A;  4YGE A;  5F6K A;  1MQT C;  5FV3 A;  1W8H A;  1TME 3;  1LJ7 A;  4XQ4 A;  1V6O A;  2P6C A;  1K12 A;  2QQU A;  1OVS A;  1W8N A;  3O0V A;  3PU8 A;  4PBO A;  4EV0 A;  4WVM A;  1W8W A;  4XJW A;  1PGL 2;  2QBX A;  3KVA A;  4BWO A;  3D6E A;  3WIN E;  3B00 A;  3DN7 A;  3WQ1 A;  2QDR A;  3I3E A;  1JU4 A;  1PO1 1;  4H7L A;  2BQP A;  5F1R A;  1YHF A;  1PK6 C;  1ULF A;  2ZEZ A;  3H8O A;  4JDO A;  4QU2 A;  1AYM 1;  2W87 A;  4J1X A;  2GND A;  2VXR A;  3B69 A;  4PI2 A;  2IVI B;  5FYZ A;  2WO3 A;  1WCK A;  4UF0 A;  2VM9 A;  1CAV B;  5GKA C;  2AGS A;  2X05 A;  2WA3 A;  4XJA A;  4UW5 A;  4XBN A;  2PHT A;  4FPF A;  4XF3 A;  4BLJ A;  3A22 A;  1H1I A;  3H3L A;  1LOD A;  5A7O A;  4RS5 C;  1YCI A;  5BPX A;  5FY0 A;  1HB4 A;  2W08 A;  2W1Q A;  4JRA A;  4IDZ A;  2EXH A;  4AFD A;  2P17 A;  3VZO A;  4GH4 A;  2JDN A;  1VB2 A;  1G7Y A;  1UYY A;  4LA3 A;  5IVJ A;  3NAP A;  1TNF A;  5HI0 A;  1W6M B;  2KM2 A;  2BGP A;  1W9T A;  4HLT A;  4ZXK A;  3VHN A;  3FUO A;  3VBR B;  1VBE 1;  5FAX A;  3O7O A;  4FOQ A;  2JWP A;  4RQP C;  2DDU A;  3MID A;  4JGY B;  2K0G A;  2VMG A;  1VBB 2;  1W8T A;  3BIW E;  1CPN A;  1X9P A;  3MUZ 1;  2IXJ A;  1XRU A;  5JI9 A;  4DO0 A;  3L2H A;  3III A;  4EQV A;  2CV6 A;  3NMB A;  1EY2 A;  5FZ9 A;  1AX0 A;  4JGY C;  4XVH A;  3FBM A;  3VBU B;  3ZFE C;  4COY A;  1E5R A;  1OPO A;  1NA1 C;  4H2A A;  1GNZ A;  4JCK A;  1QJU 1;  4CEW C;  1RUC 2;  4NIH A;  1RUG 3;  3B93 A;  4KGG A;  2ZAH A;  4CDU A;  3THC A;  2O8Q A;  5A7Q A;  3ZFE B;  3UYJ A;  2VZR A;  3I49 A;  4QXH A;  5ISL A;  1C5I A;  5FZ3 A;  2UU8 A;  1DLL A;  2C9K A;  2HWB 3;  1S4C A;  4ATF A;  3V0B B;  2B9V A;  2LRP A;  3A21 A;  5KXE A;  5DUU A;  2JIC A;  2R16 A;  2P34 A;  2VE1 A;  1CX4 A;  4NHX A;  2W46 A;  4N9I A;  3BCW A;  5CFD C;  5D8A A;  5A32 B;  5IVB A;  1SLL A;  4CTE A;  3AKR A;  1QJY 2;  4JKK A;  4ISQ A;  3VZK A;  1UKR A;  1IKP A;  1C3H A;  3N7L A;  3WW2 A;  4AK3 A;  3INA A;  2C0Z A;  3FC0 A;  1CAU B;  5DAW A;  4NJ4 A;  1KJL A;  2OQ7 A;  1PIV 1;  4FPH A;  5FUN A;  4Q0V A;  4XFB A;  4HPK A;  4YVS B;  2HLE A;  2WFF 3;  1VJ2 A;  3KV9 A;  1J3Q A;  2VZ3 A;  5FZG A;  4XJU A;  4J6G A;  4E4S A;  2Y6L A;  3HAG A;  3NAP B;  4TN7 A;  1RUG 1;  3PHM A;  5C33 A;  3AKQ A;  3B94 A;  1AX1 A;  2ARC A;  2XVK A;  4CU9 A;  2KR2 A;  3ZPY A;  4UI9 L;  4NRO A;  3ETP A;  1G9A A;  2JD9 A;  2PHW A;  3ZSK A;  4NWW A;  4XAC A;  2VQU A;  2NLR A;  2QQK A;  1QHD A;  4Q4X 2;  4RSU A;  1LGC A;  1RUN A;  4M4P A;  4MZU A;  3T3Y A;  1COV 3;  4B3N A;  3GZT B;  4GD4 A;  5H9R A;  5C8C B;  4NHL A;  4IEW A;  1FV3 A;  2Z42 A;  3CU7 A;  1J1L A;  5FZI A;  2JB8 A;  1KFX L;  4XIL A;  3UKV A;  5BNN B;  5A1L A;  1ZNP A;  4F8A A;  1KJR A;  4RR3 A;  3ZFE A;  1BZW A;  2ADE A;  4DUX A;  1XJA A;  4M3C E;  2DYC A;  2VZQ A;  1LOB A;  4MX3 A;  1F35 A;  2NZ9 A;  4FOY A;  5BNN C;  1DYP A;  1BCX A;  4KL1 A;  4NN0 A;  3VDA A;  1MS4 A;  1PVX A;  2SBA A;  4JC1 A;  1HRI 2;  4OHW A;  2FDG A;  4LKE A;  3PUS A;  5F2S A;  4JDM A;  1XXN A;  2CDO A;  4CP9 B;  3MIG A;  2ILM A;  3V65 A;  4Z92 B;  1H8T A;  2DUR A;  1GAN A;  3SKJ E;  1HJG A;  1PMH X;  4YW3 A;  3ZSM A;  1DQ4 A;  5DXD A;  4L9B A;  3N9N A;  2FQP A;  2PHX A;  3GHM A;  4K20 A;  5LRS A;  1JZ5 A;  1PO1 3;  1U5Y A;  1JOP A;  1TMF 3;  3ST7 A;  2WII B;  3PVN A;  1SFY A;  1WA4 A;  2VH9 A;  4WM8 C;  1GIC A;  1AR8 1;  3CBN A;  1NAE A;  1AYM 3;  2VCA A;  3QAC A;  1ZZ8 A;  2OA2 A;  4BIO A;  1RUI 2;  2EVX A;  1GWL A;  3PUI A;  4HL0 A;  4WM8 B;  4YFW A;  1Z7S 1;  1QOS A;  4I30 A;  2HEY F;  3H50 A;  3NNL A;  4IV1 B;  5A33 A;  2BNO A;  5BXX A;  2PHU A;  2XJV A;  4IE6 A;  4AEJ A;  1W6O B;  4LO4 B;  5LRR A;  4MHU A;  1JS9 A;  1UO9 A;  1W3V A;  3ZXJ A;  4YZ2 A;  4O9E A;  2E63 A;  2YC2 A;  1OMI A;  4OI2 A;  1SLA A;  4OVE A;  1ENS A;  3ZR5 A;  3F95 A;  3ON7 A;  1POQ A;  5JPM B;  4Q4Y 3;  4QX8 A;  5C9A A;  3UET A;  2AAC A;  2WT0 A;  4ARY A;  4LBQ D;  4C1W A;  5F5Q A;  4AVV A;  1BYH A;  1NCQ A;  1JTZ X;  1SBD A;  2Q8E A;  4E4Z A;  4HMZ A;  3MBW A;  2XWJ B;  3EB7 A;  3KMH A;  4LO5 B;  3VBH C;  4S2D A;  3POE A;  3E5X A;  4IQP A;  4L8Q A;  5AVP A;  3RYR A;  5A6X A;  3I3M A;  1O3Q A;  2QVS B;  4YW1 A;  3HVD A;  2Y6K A;  1BLZ A;  1MEC 1;  2VW1 A;  1ZZ7 A;  1R09 1;  1UOJ A;  4JX0 A;  4RGA A;  1URX A;  1UL9 A;  4WM7 A;  3N9O A;  3WW1 A;  1W8F A;  4KWU A;  2FCV A;  1JUI A;  5C8W A;  4Z2A A;  1Y4W A;  5C3S A;  1H6Y A;  3E6C C;  2FDI A;  4XJZ A;  3RPQ A;  2WNV C;  2IWG B;  4LLO A;  4DNY A;  1WBF A;  2B46 X;  1ONA A;  1RC6 A;  2EXJ A;  2I74 A;  3LSD A;  4JGZ A;  3N7M A;  3VKM A;  3I2F A;  1R08 3;  2MEV 2;  4AEK A;  1BBT 2;  3W59 A;  4D6R A;  4A6S A;  2WNV B;  3TN9 1;  1TE1 B;  1TME 2;  3ZX7 A;  2XH6 A;  4I0B A;  4O9G A;  2ORX A;  4RGK A;  4AI0 A;  4Y22 B;  1OUS A;  4BQ1 A;  3M3Q A;  3R4U A;  1IPS A;  5AFE A;  3X29 B;  1A78 A;  3KQ4 B;  3HD8 B;  5HCB A;  3VDC A;  2RS5 2;  1OKO A;  3PTY A;  2Q8C A;  1MS5 A;  2PMW B;  3VD7 A;  1W6P B;  5FZC A;  4I01 A;  3EO6 A;  2Y60 A;  1LNS A;  3WQ7 A;  2BPA 2;  2XDV A;  3ES4 A;  2DVA A;  3VD5 A;  5CIR A;  4BXF A;  1S0I A;  2OYZ A;  2BNN A;  2HWD 3;  2W5F A;  2VZ1 A;  3GJA A;  2XB6 C;  4QQL A;  4Y5Z 0;  5JXG A;  3GHN A;  4Y1Z A;  3HWJ A;  2WLQ A;  1AR7 1;  1GZT A;  3FHQ A;  4IEZ A;  4XE9 A;  1WW5 A;  5JIA A;  4EE2 A;  3POG A;  3ZN5 A;  2FDK A;  2EAK A;  2PAK A;  5A70 A;  4WZF A;  4IES A;  3VD3 A;  4CU7 A;  4ZU5 A;  4A3Z A;  2ARE A;  4WV8 A;  1LU1 A;  1H4H A;  3DKQ A;  5F5I A;  4CEW B;  5FZO A;  3MIB A;  5FXX A;  1LOF C;  4YZ3 A;  3BAL A;  2P3J A;  1QGL A;  1ZA4 A;  1GNH A;  2Z2S B;  5C7G A;  2QQP A;  1YFU A;  4BYY A;  1XNT A;  5IVC A;  3FMG A;  1HRI 1;  3VUO A;  4NR1 A;  4CPB D;  5JI7 A;  2OUJ A;  2K9Z A;  3NL1 A;  4ZY9 A;  2J7M A;  3KVB A;  5IHR A;  1IKQ A;  1OSG A;  3JCI A;  3LQC A;  5IJR A;  1I6X A;  2OW4 A;  3GXU A;  2LAL A;  2E7Q A;  2ZMK A;  2WWS A;  3FBY A;  1MS0 A;  3FN9 A;  1STM A;  1PVC 3;  2VTX J;  4UWD A;  4WVZ A;  4DPN A;  3AC0 A;  2HWD 1;  3WF2 A;  4GJY A;  3M8L A;  5JIU A;  1K3I A;  4YVS C;  3O1U A;  4AED C;  5K4L A;  3MZH A;  1WCU A;  3GZA A;  3A7Q A;  2P3I A;  2ZML A;  3HNB M;  4YLZ A;  2RDN A;  5FO7 B;  4LMF A;  4CCM A;  1Q43 A;  4GMP 0;  4CCD A;  2B9U A;  4MGI E;  4S2F A;  3VBF C;  4E4D X;  1IQA A;  2OUH A;  1F31 A;  1AL2 1;  1ND3 A;  2XGX A;  4OUL A;  3RJR A;  4AVT A;  4QX5 A;  3OPW A;  1BK0 A;  1VE0 A;  1JZ4 A;  1D0H A;  4W65 A;  5FOB B;  2B45 X;  5L9R A;  1VBC 3;  2VNO A;  2VC9 A;  2RM2 3;  2XON A;  3PJY A;  5A3T A;  5G05 L;  2J42 A;  4A3X A;  4CDX A;  3T2Q A;  3RZK A;  5FY1 A;  1SLB A;  3W21 A;  4E2S A;  2Y6H A;  2SLI A;  4WVW A;  3WOG A;  2JG8 C;  2W52 A;  5IAT A;  3AP6 A;  5KHG A;  4NMI A;  1JI6 A;  3VDD A;  3DGT A;  3JZV A;  2G4I A;  4OZO A;  3ATG A;  4OHZ A;  1DLC A;  2W91 A;  5F39 A;  5FBJ A;  2CHH A;  1RB8 G;  2DUQ A;  4AI9 A;  5EPA A;  2NMN A;  2AYH A;  3MIH A;  2AC1 A;  2VCC A;  4RN5 A;  1A6C A;  1WMX A;  2YC4 A;  1V6M A;  3WF3 A;  3HNM A;  4XFA A;  5ACA 2;  2F4P A;  4PIX A;  3EXU A;  1EPW A;  3N4M A;  2W2I A;  2O1Q A;  5FQ0 A;  1ST8 A;  1I1E A;  1NCQ C;  1J83 A;  3FUQ A;  4FOW A;  1MR5 A;  2IFW A;  2WNU B;  2JEM A;  3VBH A;  2P6H A;  2Y33 A;  4KWL A;  3RNS A;  3HIF A;  4E27 A;  4NPM A;  5BNO C;  3A4U A;  1F15 A;  1DGW A;  1HRV 1;  1Q8V A;  2RJL A;  1QJU 2;  3MFA A;  1RUF 3;  1JYC A;  2VUA A;  1R1Z A;  4OMC A;  1HV0 A;  4FFG A;  5IAX A;  4JAA A;  1G9D A;  1VBC 1;  4ASM B;  1EV1 2;  3S7E A;  5AC9 2;  3IPV B;  3ZXA C;  3BOP A;  1IS4 A;  1AJO A;  1QJX 1;  3EMR A;  2ZHK A;  1H9P A;  3ZYF A;  4B7E A;  1NXD 1;  3Q8B A;  3IKW A;  4UXA A;  1FAT A;  1YXW A;  3ZXL A;  1DZT A;  5LEK A;  1EP0 A;  3ZFF A;  3I4I A;  4M0N A;  2LTN A;  3AL6 A;  4MO3 M;  4Q4V 3;  1FX5 A;  2QUO A;  2HWC 1;  4OZX A;  4LHN A;  1Q8P A;  1FAY A;  3J7M A;  4JHT A;  4HG6 B;  2P37 A;  4O65 A;  3I8T A;  4UYB A;  1W2U A;  1BEV 3;  2VMC A;  4OQ9 A;  3DPR A;  3HT1 A;  2DFC A;  2Q8D A;  2YGM A;  2B8M A;  1H8T C;  2BOJ A;  2WAA A;  4ZXE A;  3JD7 2;  1SDW A;  4XUQ A;  2JB4 A;  3S0M A;  1JYI A;  1K42 A;  1YFW A;  1AHS A;  1GWK A;  1VIW B;  4ISR A;  4LEJ A;  2VOK A;  3HN1 A;  3VD4 A;  3THT A;  4MLO A;  2MPF A;  5FZ8 A;  3RGB A;  3S57 A;  3CJI A;  2VVE A;  4FTB A;  2QE3 A;  4IE5 A;  1W2O A;  3NNJ A;  3OUJ A;  5LA9 A;  4AQ2 A;  3EJK A;  4UW3 A;  2ZHN A;  5BNP B;  2VZS A;  1CPM A;  2VTF A;  4MGT A;  1H4G A;  1VBA 2;  4GH4 B;  1JYV A;  3LE0 A;  3ZN4 A;  2R07 3;  3VBH B;  3BTZ A;  4AHX A;  3O1O A;  5FR3 A;  4C91 A;  1LEM A;  1UOB A;  4ZU4 A;  3R4S A;  2HWC 3;  4LNV A;  4MGZ E;  2WO7 A;  4ONU A;  1B35 B;  3WP3 A;  3ZSE A;  2FZ1 A;  4IXL A;  4C90 A;  5K8S A;  5FXZ A;  1ND3 C;  2VG9 A;  4CEY C;  5C71 A;  2JG9 C;  1EV1 1;  5ANN A;  2XPJ A;  5GLZ A;  3IM0 A;  1VBC 2;  3U37 A;  3ZYH A;  4A2U A;  1FPN 1;  1O4Z A;  3DYM A;  4BK4 A;  2PAM A;  1UXX X;  3H3Z A;  5J36 A;  3CMG A;  5DUX A;  3FZ3 A;  2Q1Z B;  2WT1 A;  4AOC A;  4GUL A;  5FY7 A;  2W1S A;  3S5Q A;  5JMO A;  4CDX B;  3B5L B;  5C9A C;  2X09 A;  5H9P A;  4FAH A;  4IGO A;  1DGW X;  1UW8 A;  3VBS A;  4QX0 A;  1DQ6 A;  3UK9 A;  3URF A;  5FOJ B;  4AZZ A;  2ZGO A;  2GSY A;  1DQ0 A;  2HBT A;  2VNG A;  3C7E A;  1W6Q B;  1R1A 1;  1RMU 1;  2E26 A;  1MZ5 A;  1SDD B;  1TQ5 A;  3BTA A;  1LES A;  2VR4 A;  5FYI A;  1PZ9 A;  2HWE 1;  1OA4 A;  2DU0 A;  2ZGS A;  2XJT A;  4I02 A;  4AAX A;  3AM2 A;  3D0S A;  2OS2 A;  3DCQ A;  3PJQ A;  5TSW A;  3S6P A;  4DRR A;  2BRT A;  4AGG A;  1BEV 2;  3JU9 A;  2X53 S;  2NPI A;  2XUM A;  1AUY A;  1LEC A;  3M1H A;  4YGC A;  1PX4 A;  5F3E A;  1CX1 A;  3QH6 A;  2JDA A;  2FCU A;  3HEI A;  4JGZ C;  1KGY A;  4LJH A;  2UWC A;  2H6B A;  1CAU A;  4KMQ A;  1V6K A; 
#chains in the Genus database with same CATH homology
 5FZO B;  4QWN A;  2XXZ A;  5FJK A;  4CCJ A;  4D6Q A;  2WWU A;  5FYU A;  2Q8C A;  5F3I A;  5FY9 A;  2OX0 A;  3PU3 A;  2WWJ A;  5FXV A;  3PUA A;  5FZC A;  5FZE A;  5FYB A;  3PUQ A;  4QXB A;  2XDV A;  3PDQ A;  5FV3 A;  5F5A A;  4BXF A;  5FZ7 A;  5FY5 A;  3N9Q A;  5FP9 A;  4GD4 A;  3AL6 A;  3AVR A;  4QX7 A;  5FZI A;  5F3C A;  2OT7 A;  5CEH A;  5FUP A;  5F32 A;  4HON A;  2XUE A;  3PU8 A;  5FP7 A;  5FYM A;  3DXT A;  5A1L A;  5FPB A;  3KV6 A;  2YU1 A;  5FZD A;  5FPU A;  3KVA A;  4EYU A;  5FZH A;  4UF0 B;  4BU2 A;  5FZ6 A;  4D6S A;  2Q8D A;  3LD8 A;  4EZ4 A;  1VRB A;  4GJZ A;  5FZA A;  3U78 A;  5F5I A;  5FZO A;  5F2S A;  3PUS A;  4NUB A;  5FXX A;  4CUG A;  5KR7 A;  5FZL A;  5FZ8 A;  5FYZ A;  4LIU A;  5FZK A;  3N9P A;  5A7P A;  5F2W A;  4UF0 A;  5IVC A;  5FWE A;  5FYC A;  5FYT A;  2YBP A;  5FZM A;  3N9N A;  3KVB A;  5FXW A;  4BIS A;  5A7O A;  5IVF A;  3OPT A;  4CCK A;  4CSW A;  5FP8 A;  5FY0 A;  4HOO A;  4Y3O A;  3K3O A;  3KV4 A;  4DIQ A;  5A7S A;  5IVJ A;  5FWJ A;  3K2O A;  5FPA A;  4GJY A;  2GP5 A;  5F37 A;  5K4L A;  5A3N A;  4LIV A;  5FZ1 A;  3PTR B;  5A3W A;  4CCM A;  5FPL A;  4XDO A;  5FXZ A;  4ASK A;  5A3P A;  5LW9 A;  3ZPO A;  4C8D A;  4DO0 A;  4CCO A;  3AL5 A;  5FZ9 A;  5FZ4 A;  3DXU A;  2XML A;  5A80 A;  5LY2 A;  4XDP A;  3OPW A;  4QX8 A;  5ANQ A;  4QU1 A;  5FPV A;  2YBK A;  5FP4 A;  5FYV A;  5A3T A;  5A7Q A;  2Q8E A;  3UYJ A;  5FY1 A;  4IGQ A;  5FY7 A;  5E6H A;  4QXH A;  5ISL A;  2YU2 A;  5FY4 A;  5FZ3 A;  2VD7 A;  5IVY A;  5FJH A;  4V2V A;  4IGO A;  5LY1 A;  5A7W B;  4CCN A;  4Y33 A;  5F3G A;  5IW0 A;  4LXL A;  4GAZ A;  5IWF A;  4AAP A;  4CCL A;  5LWB A;  3AVS A;  3NJY A;  4Y4R A;  3N9O A;  4QXC A;  5FYS A;  5FBJ A;  5FYI A;  5F39 A;  2YBS A;  4AI9 A;  5FP3 A;  2PXJ A;  5IVB A;  5A7W A;  2OS2 A;  3RVH A;  2YPD A;  3PUR A;  4E4H A;  5IVV A;  5FYY A;  2P5B A;  3ZLI A;  5FZB A;  2W2I A;  5IVE A;  5A7N A;  3K3N A;  5FY8 A;  4URA A;  2OQ7 A;  5FUN A;  3LDB A;  5F3E A;  4V2W A;  2GP3 A;  4D6R A;  3N9M A;  3N9L A;  3U4S A;  4IGP A;  3KV9 A;  4LIT A;  5A1F A;  2OQ6 A;  5FZG A;  4EZH A;  5FZF A;  5FYH A;  5FZ0 A;  5F5C A;  3KV5 A;  4TN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...