5FY9A

Crystal structure of the catalytic domain of human jarid1b in complex with pyruvate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
462
structure length
460
Chain Sequence
b'SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLGGGGARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B, LYSINE-SPECIFIC DEMETHYLASE
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Pyruvate
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 141
structure length 460
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fy9A01
5FV3A 3OPWA 5FYUA 4DO0A 3UYJA 2YBKA 5FZBA 5FZCA 3PUQA 5FXVA 4D6SA 4UF0B 5A3NA 5FYZA 4Y33A 2OS2A 5FYIA 2WWJA 4QWNA 2GP3A 5A1FA 5FZDA 4Y3OA 5F2WA 5F5CA 4BXFA 4V2WA 2OQ6A 5FYHA 5FZAA 4Y4RA 5FYVA 5FZOA 4AAPA 2PXJA 4EYUA 3AL6A 5A1LA 5F39A 5FPLA 5FZGA 3KVAA 5A3TA 5FZKA 4GJYA 5FP4A 5FZ0A 3AVSA 3DXUA 3LD8A 3N9QA 3PUSA 4IGQA 5FZIA 5A7WA 5KR7A 5F32A 2Q8EA 5FZHA 5F2SA 3KV6A 3KV5A 3ZPOA 4QXCA 5FY4A 2W2IA 5FXXA 4QX7A 4E4HA 5FY0A 5FYMA 5FY9A 5A3PA 5FXWA 4URAA 5FUNA 1VRBA 5FZFA 5FWJA 5IWFA 5FY7A 5IVBA 3U78A 2XMLA 4HONA 5FP8A 4GJZA 4DIQA 5A80A 5FP7A 5FXZA 5A3WA 5ANQA 2XXZA 5FPBA 4LXLA 3K3OA 2OQ7A 5FYYA 4BISA 4CCOA 4D6QA 3N9OA 2XUEA 3PDQA 5FZ6A 2GP5A 5FPUA 4QU1A 3K2OA 3PTRB 5FZLA 5FZOB 5IVEA 4CCKA 2VD7A 5FY1A 5F5AA 5FZ7A 3RVHA 5FZ8A 3KV9A 5FZ3A 5FUPA 3OPTA 5FPAA 3N9PA 5K4LA 4CSWA 3PU8A 2YU1A 3U4SA 2YBSA 3N9MA 5IVFA 3DXTA 4CCMA 5A7OA 5A7WB 4ASKA 5F3EA 2YBPA 3LDBA 5FYSA 5FY5A 2Q8CA 4IGOA 4IGPA 5F5IA 3PURA 5FZMA 4XDOA 5FBJA 2OX0A 5FYCA 4UF0A 4XDPA 3AVRA 4QXBA 2P5BA 5FWEA 5LWBA 5E6HA 4V2VA 3N9NA 4LITA 3PU3A 4CCLA 5FP9A 5IVYA 4LIUA 2YU2A 4QX8A 3KVBA 5FZEA 4GAZA 4NUBA 5F3CA 5LW9A 5IVVA 3N9LA 5FYBA 5FZ4A 3NJYA 5IW0A 2WWUA 5FZ1A 4QXHA 5IVJA 4CUGA 4CCJA 3PUAA 3KV4A 5FJHA 2OT7A 4EZ4A 5A7NA 4CCNA 4EZHA 5F3IA 2Q8DA 4GD4A 4AI9A 5FPVA 5FJKA 5FY8A 4LIVA 5F3GA 5FYTA 5A7SA 5F37A 4C8DA 5CEHA 5IVCA 5FZ9A 4BU2A 3ZLIA 4TN7A 5FP3A 5ISLA 4HOOA 3AL5A 5A7PA 4D6RA 3K3NA 2XDVA 5LY2A 5LY1A 2YPDA 5A7QA
chains in the Genus database with same CATH superfamily
1PM7A 2XGXA 4DO0A 3OBAA 1APNA 1RHI1 4YSFA 3M4FA 3LDKA 2VZ3A 4UF0B 5GLTA 1BKZA 4YZ3A 5L9RA 3NSTA 4DXZA 1QJX3 5CFCB 5A1FA 1NKGA 1SLIA 5A3MA 1W8HA 4Y3OA 3MI8A 2OW4A 4E27A 3M2MA 4LBQB 2QQUA 4QPWA 2ZHMA 3LFIA 1HRI1 1QJU1 2C6SA 2GNTA 1RJ7A 1QJX2 2PXJA 3OUHA 4SBVA 2QDNA 5C5UA 3SH4A 4FTEA 2XWBB 2BP6A 1B09A 4LHKA 2G4IA 2VULA 2P37A 4LA2A 4YWAA 4Z07A 1IZ3A 2XH6A 1IHMA 1YQ6A 4DY3A 4PIXA 3OY8B 4XF1A 1QOSA 3AP5A 2W2IA 1ZRRA 1KD7A 2J1AA 1RJ8A 4XQWA 2BBAA 3AMNA 2TEPA 1PK6B 3M3QA 2BUKA 4N90A 4W6XA 1O3SA 2PYTA 2Z69A 1L7LA 3MUZ1 1XBFA 3ZYBA 2QZ3A 2J1EA 4UFIA 5FO9B 1ZBA3 4GMP3 3RYKA 4DRVA 4OHVA 4EV0A 2OQ7A 4LBMA 5FYYA 2HBTA 3N9OA 3BCWA 1ODNA 5J96B 4R9DA 3PTRB 1RUD3 3MDPA 1YWKA 1ZBA2 5GLWA 1W6PA 1YQCA 3KV9A 1QOOA 4UXAA 1FV3A 2BNNA 5C8CA 4D8MA 4FPOB 2VGDA 3H42B 5JMOA 4Q4Y2 3HJRA 1ZRCA 4JDOA 5GJ6A 4YVSA 1F31A 1RUD2 2Q0AA 5IVFA 4UT5A 1OQDA 2Y6FA 1RXFA 4PQ9A 2XOMA 2ZA9A 2ZZJA 4IGOA 4HN0A 3HNMA 3Q8EA 4BA6A 1F9KA 4PT6A 2WLPA 1DDLA 2IXHA 3GF6A 1V0AA 5DDJ1 2KM2A 3TWIA 3N36A 3SCGA 3QH6A 2YB7A 5E6HA 4RS5C 1QF3A 3N9NA 2RV9A 3PU3A 2ZHNA 4CCLA 1Z7S3 1AR83 3HR9A 1KFUL 4IEOA 3ZSMA 4LLOA 5FCCA 4LEJA 1OH3A 1VBD3 4I30A 2D5FA 2NLRA 5IW0A 2BFUL 4FOYA 3ZN4A 2QQKA 2QDRA 2WFPA 4AQ6A 2ETEA 1Z7S2 4QPYA 1AR82 2ID4A 4MXVA 2E7QA 4Y5Z0 1VRH3 2WNOA 3UESA 3WCRA 3O1TA 1JZ6A 4KWJA 2O8OA 4IEQA 2W1WA 5F5QA 2J42A 3I2DA 3KT7A 4DOUA 1VBD2 2P34A 3MYXA 2UURA 5LK7B 3AM2A 1J1LA 2W92A 1DZTA 3POBA 4QM8A 1VRH2 3AL5A 2XQXA 1CJDA 4WVWA 1YI7A 4Y1ZA 3D5OA 3MPPG 1VJ2A 5FYUA 3J9SA 1MPXA 2YBKA 3LQCA 2P4EA 3D0JA 1UYXA 3T0AA 1RVF1 5EJ1B 2R7EB 4OZXA 3ZYGA 2PELA 4DXTA 2UY8A 2BFUS 4MGZE 4BXFA 4FPKA 3TEWA 3VD4A 3AP7A 3J7MA 1RITA 1A8DA 1XNCA 2C0ZA 4H7LA 5FYHA 1KRIA 3TYJA 4ARXA 1ULCA 1ZNPA 2LALA 2CDPA 2EIBA 1Q5OA 4Y4YA 5FTTC 1LULA 4B3NA 4NHLA 5A6QA 3OBZA 2O1QA 3RMXA 1LOBA 1RYYA 4WM7A 1W0OA 3CBNA 2YMZA 4I3PA 2V09A 2WO7A 1WWYA 3E1F1 2D6OX 5FKBA 5K8SA 3PUSA 4XFCA 5C7GA 2VM9A 1RC6A 5C4WC 2EXJA 2VZSA 1VB4A 3FHIB 1SFPA 1J84A 1HRV1 1EAH1 3OEAA 4RD7A 1WUVA 1QU0A 5IWFA 1LHWA 3BPZA 4XFAA 5FY7A 5BPXA 3N35A 1OOPA 1KQRA 4XABA 4AWDA 2VMDA 1S0GA 4EQVA 4MZUA 1JYTA 5E1RA 1C8NA 1CVNA 1T6GC 3KSCA 1AL21 4FPGA 4KQ7A 4R52A 2QQVA 3AP4A 1R1A1 3TEXA 3VZKA 3I49A 3PUIA 4UW5A 2DF7A 3I4IA 5KXBA 1W8WA 2V5DA 2A6YA 4GH4C 3ATGA 4Y1YA 3RZLA 3HD8B 3K4DA 3RZJA 1CAWA 1M06G 2D40A 5FY1A 5F5AA 5ABJA 3MF6A 4UWDA 1VALA 2AC1A 4P9IA 1EPZA 3USUB 3VLBB 5FUPA 5I8YA 2ZOEB 3N9PA 3E5UA 4AVVA 4HPKA 4A41A 4C1WA 3MZHA 1WCDJ 1RMU3 2H6CA 2JICA 4Q0VA 1QQP3 1W6MA 4GKYA 2WNUC 3O1VA 2L9LA 5LEJA 3KWVA 1DQ0A 2Y38A 5FYSA 2ZKNA 2OXBA 3D4KA 4PBOA 2W46A 3TNQA 1BK0A 3GGLA 2JDKA 4IE5A 4XJWA 1RMU2 3CJIC 3IDCB 3MIGA 1QQP2 3DYPA 2VQTA 1G86A 1EUTA 1S0JA 3LPGA 4SLIA 4LK6A 3DF0A 4MGTA 3O1OA 3VBRB 1COV3 2VOWA 1DQ1A 1L3JA 2R073 3IT8A 5LRRA 4UFHA 3ZYJB 5LW9A 1ZVFA 2X5IB 2A1XA 4HETA 3A23A 1DZRA 3CHXA 3E97A 4Y20A 4HVOA 2B45X 5FZ1A 3WR0A 2VZUA 3PUAA 1COV2 1QEXA 2R072 3BIEA 3P3NA 5BYNA 2KR2A 2CGOA 2E31A 4X8NA 1UXXX 3NAPA 1GKBA 3VDDB 4RN5A 1C3HA 1SCSA 2ZPXA 1OLME 4LMFA 4XUQA 2DU1A 3UKNA 3ZYHA 2PQQA 2CYFA 1GQGA 2RS11 2O8QA 1RGSA 4NHYA 2W1SA 3AMQA 2YPDA 2JDHA 1TEIA 3I2HA 4QKNA 2JE9A 4CEYA 5FR3A 5JAXA 4NE9A 5JPNB 4M0HA 2JX9A 4Q4V3 1FV2A 2WO1A 1OKQA 2J1VA 3RFRA 1CZTA 2DCKA 1K5MC 1PVC1 1TNFA 3MLJA 5CKMA 1DYOA 1S2EA 3U11A 5FLIA 1W6QB 3H1YA 5FYVA 1CAUA 5C6CA 1GQPA 1OC1A 1PO13 4QQHA 4D3WA 4QX5A 5A6YA 5DUWA 2Q4SA 1EY2A 2ADEA 3VHRA 2OZJA 3OYWA 4X6QB 5FZ0A 3WNNA 3NKGA 3L9JT 4RQPC 1QOTA 3N4MA 5C9AC 1VB2A 2XVGA 2K2SA 3ZFFB 2WRAA 2VZVA 3LOIA 3R4SA 1UY2A 1XNKA 3C7GA 3QACA 1SBDA 3M3CA 3RS6A 1ZBA1 3VZMA 4EN0A 5C3QA 5FY0A 4AEDA 3AZZA 4AFAA 2HWC2 5D1IA 5FXWA 4ZXEA 4HZFA 4ZKTB 1PGW2 3TNPB 2B5HA 1H8TC 4E8CA 4LHSA 2RDRA 3SQOA 4PF5A 5KHJA 2EF6A 4HONA 4XTPA 4I3GA 5DUXA 1RUD1 4QDRA 4YM3A 4Q2FA 2ZZQA 1W8UA 3VKLA 2VZQA 3GJBA 4XHBA 5LBEA 1YJLA 1ULPA 1BHGA 2C5DA 2IFWA 2VZTA 2NMOA 2RMU3 3KT1A 4YGBA 3WDUA 4CXXA 3JB4C 4CCKA 3X29B 4L99A 2JDZA 4HANA 2PFWA 1LOAA 1V00A 3H1WA 1ND2C 1Y9GA 1W06A 4AI1A 2RMU2 3SKVA 1QNYA 4QDQA 4CSWA 5GZCA 5J1XA 1OKOA 3LEKA 4XURA 5CYYA 2FDHA 1HB2A 2V5YA 2ZJCA 1QXJA 4QMAA 4BE3A 1V6MA 3PHMA 1OURA 5IK5A 2VR4A 1D0GA 1FNYA 2WDBA 3OUIA 4QPIA 4AF9A 4AI0A 3AYCA 2PHTA 5IATA 2ZGTA 4IEXA 4CP0A 4CDUA 4Q0QA 2ZGUA 2TUNA 3FHQA 1UYPA 2ZABA 4JKKA 5F1RA 3UK9A 4Q4X3 1Q8QA 4QT6A 3UGHA 1G8WA 2E6VA 2BOIA 2ZMNA 3ZR5A 2A71A 2ARCA 2X8KA 3GM8A 2D6MA 4KWKA 4AK3A 4Y1UA 2QQPA 2YGLA 2XWJB 2ORZA 2V72A 4UAPA 4HXCA 4QXHA 4Q4X2 3IMMA 1D0HA 4EROA 4DUVA 5JLVA 2OT7A 4MXWA 4Y1VA 1FPN3 1BLZA 3FLRA 1JZ8A 3ZYIB 4CU6A 3GDBA 3S57A 5CZKA 4RS5B 2AGSA 2DBNA 3VB9A 3L2YA 5F37A 1EV13 1HXS3 1RUH2 1W6OA 1DHKB 1UZ0A 2PAMA 4Q26A 4YW6A 4HFSA 3PJYA 3WEZA 4JQTA 2ZGRA 1RUOA 3HT2A 1MR5A 3BGAA 3VDBA 1FPN2 1ENQA 1OOPB 4OI1A 5LY1A 5FPZA 1I9RA 4OUMA 5FAXA 1LENA 3BYWA 3KB5A 3PMSA 3RRDA 1EV12 1HXS2 1JS9A 2C24A 4IV3C 2QJVA 5FZBA 3SNMA 3AZXA 3ABZA 3VBFA 3WQ1A 2XVLA 1QJY3 5EJ3A 1LEDA 5A3NA 5C71A 4KGGA 4O61A 4XJAA 4BJ0A 3NO8A 2JE8A 4OFGA 2Z4FA 4UFLA 1S2BA 4ZONA 1FNZA 4ATFA 2E32A 1MEC3 4TSVA 1B35C 4YM0A 4B7EA 1DU3D 5FZAA 1W9WA 3VBUA 1GZ9A 4Y4RA 3RJRA 1DZQA 4B7KA 2GNDA 5JI9A 1QJY2 2GC1A 4RR3A 3O5SA 3OBRA 3VBSA 4QB1A 4XZUG 1U12A 3FLTA 4XXPA 5BNNC 5A3TA 4XCBA 1MEC2 1LOGA 2A3WA 1XJAA 2EXHA 2IXJA 2VTXJ 1G9BA 3O1PA 2QQLA 2YY1A 3POIA 1RUI3 4HK8A 4H2AA 5FZHA 5HCBA 1DLLA 5DG1A 3ZPOA 3ZXGA 1F35A 5FY4A 5K0UC 4FPCA 2R1DA 2FMDA 4PIZA 4EWDA 3T4HB 1J3QA 1ZZBA 5FY9A 3CF6E 5A32B 2N7GA 1E5RA 2X05A 1RUI2 5CG8A 1ZZ8A 1CPNA 5GLVA 3T0BA 5T55A 4WBBA 5ANQA 4R4XA 4NIAA 1I6XA 5T3NA 1UZYA 3ZFGC 1UWWA 3MO4A 4JCKA 1OA4A 4RL7A 1NXD1 4F7ZA 5L36A 4WM8C 3CIHA 1DBNA 3T3YA 3ZDVA 2B8MA 3BI3A 2YZ4A 3K4AA 1DQ4A 5C4WB 5BXXA 4ZU7A 2PQSA 1JU4A 1QQP1 2VJXA 1SLTA 1SACA 1SLLA 4JRAA 4D7SA 1N1YA 1W3VA 1CZSA 2H0VA 1HRI3 1QJU3 3H8UA 3K48A 3LB9A 3W58A 2NMNA 4QKBA 4M3CE 5D21A 2P6CA 1AX2A 1NCQC 4XETA 3T2TA 2YU1A 4AG4A 4A6OA 5LRSA 2VQ0A 3NRUA 3U07A 2GMEA 3GNEA 1QKQA 1HRI2 1QJU2 4ONUA 4QX3A 1OF3A 2PHWA 4N9HA 4GWIA 4JDMA 1S0DA 4AI2A 1YUDA 4BH9A 5FOJB 2R071 4V1PA 4L9BA 2WSVA 3KCXA 4UF0A 2JKXA 2YFZA 1H9PA 3AMMA 1KXGA 4K21A 4CA9A 4KG0A 5CFCA 2ZAAA 4XDQA 5JSOA 1KGYA 1X36A 2D3RA 1JZ2A 3ZFEC 4LBQA 2P3YA 4N43C 4XXAA 5CNAA 3B9CA 4K1ZA 1UU4A 2OVUA 3D3AA 4R9AA 3WHTA 3RZGA 5FQ0B 1GP6A 3N7LA 3OYWB 3ZYRA 5FOBB 1H1IA 2FHRA 2LTNA 2J1SA 2WO2A 3NNLA 2C9AA 1WA6X 1UL9A 2Q30A 4OULA 5ERLA 1PMIA 3B01A 1R64A 2DDUA 1FAYA 3CJIB 1AJOA 2WZR1 3KLSA 5F3IA 3IB3A 2SLIA 3I2KA 4Y5SA 4AEJA 1GNYA 4PIYA 4QQOA 1JU3A 4Q4V1 4WVZA 5I0TA 4AEDB 2JG9B 3WG4A 4HN1A 1XNTA 5IAVA 5ISLA 4CTEA 5C70A 3OUJA 4ES9A 1YFXA 3D6EA 2Y8KA 4JGYC 4LO8A 3KMHA 3Q8BA 3LF7A 4F83A 5LA2A 1PGSA 1DF0A 2ZMKA 2XQRA 1PO11 1UPIA 3ZXJA 1W04A 4FBFA 2F6BA 2XVKA 2R49A 1ND3C 2BGCA 3HAGA 3WZ1A 4CE8A 2GZWA 1YQ5A 1BYHA 2VZRA 1H2NA 2XLFA 3B94A 3BN6A 3Q8CA 4V2WA 4AGRA 5JSRA 1PGW1 4W6WA 2D5HA 1SBFA 3WF1A 2ARXA 4EYUA 1QJZA 1RUJ1 1W9FA 2GN3A 2WT0A 3BOWA 5DQ0A 2OA2A 2Q5TA 5F39A 2A6VA 3IAQA 2HEVF 4IV1C 4PI0A 5CKQA 3MLKA 3B02A 2DUQA 3B93A 3P6BA 1QH7A 4PDWC 3VZLA 4S2GA 5JSPA 3RZKA 5F2SA 5AVAA 4R8HA 1SQ4A 3LPFA 1IS6A 2Z2SB 1OA3A 3FN9A 2VAUA 1IS4A 2B39A 3ACGA 2ZX0A 4P08A 2RMU1 4Y22A 3OD4A 3VD3A 3ZOIA 5C33A 1VMHA 1OD3A 4DIQA 1W8TA 2E33A 5C3SA 4ES8A 2WFF3 1XU2A 3I3EA 3OPZA 3WW2A 1RVF3 1WD3A 1PGL2 1OUXA 2WINB 2R32A 3BTYA 2JB4A 2XJQA 3IIIA 1AF9A 1Q43A 3IN9A 2BOJA 2VD7A 1GOHA 4BDVB 1VE0A 2DTWA 2RHPA 1NA1B 3IDEA 1ENXA 2WFF2 2YYOA 5GLUA 3LEGA 3WT3A 2Q1FA 2OUJA 5D8AA 1RVF2 5FPAA 4CCCA 4XF0A 1GYKA 3AXDA 5JIUA 1N3PA 2BU9A 3N9MA 3WDWA 4CCMA 1JMUB 2QNKA 4ASKA 4QPGC 4CPBD 4XOGA 3J4UH 2YFUA 4CDQB 2VXRA 4Q4X1 1VLNA 3BALA 5JXGA 1G6NA 1NX9A 2PHDA 3O0WA 1UX6A 3BU0A 4XIKA 4Z8BA 1LKNA 3NMBA 3AKSA 3BKZA 2QVSB 2AENA 3EB7A 1UZVA 3H1MA 4QXBA 3WQBA 4HBNA 3D0SA 1OUSA 2D3PA 3LSEA 2QTWB 3W20A 1UMIA 3GZEA 2NYYA 1H30A 5CFDB 1ZREA 3ACHA 5FP9A 4GKXA 1O7FA 1V6NA 2JG8C 1H8VA 3KVBA 1AL23 4LQRA 5FO8B 1R1A3 5FYBA 1EV11 3CDZB 3WW1A 2Y0OA 2XJPA 2R063 2A73B 1Y7BA 5EV7A 1C5IA 3MUY1 2XLGA 2D3SA 2CHHA 3H8XA 4INDA 3KHCA 1AL22 2D7FA 1LR5A 2DFBA 4LK7A 3ZO0B 1R1A2 3B00A 3IZOA 4Y24A 4BHPA 1PMHX 3I2GA 2R062 5I8SA 3L2HA 4FT8A 3O1RA 3CMGA 1U5IA 4HOOA 2VBDA 1ULFA 3DKQA 5BNPC 1O3QA 2QBXA 1J3RA 2IVJA 4RHV3 5GZGA 1NLRA 2YPJA 2ATFA 5FLHA 3DUIA 3U1XA 3PUQA 5APAA 3P5BA 5FXVA 4EE2A 2A6XA 1TG7A 4GB31 4XIOA 2QKDA 2EICA 4RHV2 1GQHA 4D69A 1NZCA 3FE5A 3MW3A 1XE8A 4F3JA 2PHUA 3AX4A 4B4RA 1R083 4JVAA 3A0NA 5FKCA 1TME1 2AREA 3ZIXA 1LHUA 1Q56A 3USUA 3ZKUA 1SFNA 1V6KA 2X53S 2WN3A 4Q0PA 5FBZA 4P9YA 4FPFA 3ZSJA 5FP4A 2ZGLA 3LWCA 4UW3A 4G9SB 5T5PA 3PIGA 4ZS2A 2DVFA 5T5OA 4DNYA 2P1BA 5DAPA 4B1LA 2FZ1A 1YYNA 3KV6A 2XR4A 4OCTA 2LM3A 3MLLA 1U5ZA 2RS13 5CKNA 3SCHA 2E9QA 4AHZA 1UZWA 3O1UA 1L7QA 1S55A 5BNNB 4FP3A 5FP8A 4Q5OA 3U4XA 3AZWA 3QCWA 4FAGA 1IG0A 2FBEA 3BOPA 4MGIE 5A3WA 5IT6A 3LE0A 2PAEA 2W68A 2RS12 3E6BA 3M3EA 3VBRA 5C8CC 1NQJA 2BEOA 2XONA 4GZ9A 4KBBA 5JXHA 4L8QA 2X5IA 4CUAA 1KEXA 1ZM1A 1JOPA 2MEV1 1REDA 2ZX1A 1PVC3 4DEQA 1Y9QA 5FZOB 4DUXA 1FT9A 5K0UB 2Z79A 5FIXA 1POQA 1YRZA 3VD5A 4FPEA 1LU1A 2LW8A 1IKQA 2BTVC 4K40A 2JWPA 2JDNA 1J59A 1PVC2 1UOGA 2C9KA 4OZOA 3VDDA 2RDNA 1US3A 2IXLA 4J25A 2ENRA 1RUF1 2VOVA 5T54A 4NAOA 4Z2WA 3HNYM 3PVBB 5JIAA 5LZ6A 5B4XA 1RUG1 1S2KA 1OPMA 3RZHA 1HQLA 4MHRA 2VVEA 1HIXA 4HSLA 5SV5A 2FMYA 1BK1A 3AVRA 3IKWA 4LKDA 4XDPA 4AL9A 5LWBA 1O3RA 2F4LA 4GWJA 1SFYA 4JKLA 1GOGA 4FXKB 4LITA 4MLOA 1NCQB 1AR71 2VW1A 2D98A 2WA3A 3DKWA 3VGIA 1YJKA 3APBA 3ZMNA 2RS33 1VBB1 1BBT1 4A45A 5F8PA 5FZEA 1W6QA 3WP5A 4ZZ8A 2BPA2 4TLFA 3RWNA 1KITA 3WVJA 3WP4A 1CESA 4QAWA 1GV9A 1W0NA 2EXKA 2ZS6B 4IQPA 1E57A 4PBPA 5G04L 3OD0A 4AFCA 1WMFA 2VUJA 1VMJA 1AHSA 3ECQA 1DYPA 1GFF2 2W08A 1PIV1 5E16A 2AH2A 4CCNA 4XUTA 5L7OC 3GCWA 5LBFA 3BTZA 2LROA 5F3GA 3AZVA 3ZYFA 2WKKA 2B4KA 4OMDA 1CAVA 2WC2A 3RPQA 3ZFFA 2B9VA 3ZFEB 3POFA 5I91A 2HWF1 4KMQA 4Y22B 3RQ0A 5KXDA 1YIPA 4YW5A 1JI6A 4E4ZA 1NE4A 3VZNA 4TTGA 1H2LA 3TB0A 2BBVA 1H2MA 4XE9A 1S0EA 3C8XA 3OPWA 4CP2A 4O9EA 4YG6A 1OHFA 3G6JB 1LHVA 2YC2A 3H9AA 1JYVA 5CISA 1SG3A 2X09A 5DAXA 1TNRA 4A6SA 1RUC1 2QQOA 1JOJA 1PZ9A 1XSQA 5T50A 2Y34A 3A21A 3AK0A 5AC93 3SXWA 1HN0A 3HEIA 5HXMA 3H0OA 4RGKA 5D8AB 2VQAA 1OVSA 2CL2A 5IUQA 4A2UA 4E9KA 1SEFA 2IXIA 4PF1A 2ZKLA 3J7HA 1Y43B 3AKPA 3U75A 4C1XA 3WX5A 4GJYA 2FCVA 2GALA 4BQ2A 2FDGA 3PVEA 4K9SA 1F2NA 1IGOA 4OLLA 5I93A 5J09A 3PL0A 4NRPA 4P5HA 1PGL1 4MV2A 3ILRA 4LHNA 4DPNA 1LTEA 4CP9B 1ND3B 1CPMA 3KV5A 4QX7A 1KS4A 3H3UA 2WFF1 4NPRA 2BVBA 1W2TA 2BRTA 3FFZA 4ZS3A 1ZRDA 5FUIA 2WJSA 3JD73 3NWKA 5FWJA 4AEKA 2FDKA 2D43A 3EQEA 2Y6GA 2JJ6A 5A80A 5GZEA 4J1XA 3J8F1 1BVVA 5FPBA 2P2KA 4JTOA 2W9XA 4LXLA 4PI2A 4PDWB 3T30A 5L9BA 3JD72 1JYWA 1H0BA 2XUEA 3ACIA 4YW7A 5GALA 1FXZA 2VMGA 2BYVE 5FZLA 1W28A 2QQWA 1IQDC 4UBGA 2BNMA 4N8MA 4OHXA 1T6BX 4RGGA 1VBE1 2DV9A 1OXCA 4IE6A 4YVWB 3UKTA 4AE2A 4XUOA 4E2GA 4IEPA 1UAIA 4RS5A 4DRRA 3RDIA 2JKBA 1CQ9A 3I8TA 1GNHA 3DV8A 4NIIA 3AYAA 5A7WB 3HBKA 1NCRC 1QMJA 4ISRA 1KDMA 5FMDA 5JZGB 1K3IA 2DUPA 4YRDA 4WZFA 2YV8A 1Y3TA 5H9RA 3SKJE 1MZ6A 5LB6A 4BPZA 2YG0A 4CU9A 3OTFA 5FYCA 3J7LA 2NN8A 4P5YA 1TZOA 2BJSA 2Y0IA 5CADA 5IHRA 1OSGA 1G7YA 2R061 4Y5TA 1MQTC 3BIWE 3CJXA 1Z0HA 4LUKA 1WGPA 3FUQA 1WCKA 3R0RA 4KBZA 1JTZX 4XCAA 4NHMA 1FI2A 4GAZA 4NUBA 1SHWB 3VKFC 3NAPC 1ASJ1 2RG4A 5TSWA 2RM21 3MHZA 1XOYA 1JYCA 4IESA 4RHV1 2Q8DA 4BWOA 2JIGA 4CEYC 4C91A 4JC1A 4Z82A 4CDWB 2RDQA 4AFMA 4HKOA 4COZA 3CZUA 1YLLA 2VNRA 1W05A 2QFEA 4HKWA 2WNVC 3WQ7A 3OB8A 4BLIA 2KXLA 1F5JA 2PLV3 1MS0A 4Q8KA 5C5TA 2XDVA 3OOXA 5A32A 5B4NA 1PX4A 3K46A 5F9TA 4N53C 1RUNA 2UYAA 4P9JA 5CIRA 4LOTA 4LUMA 4MYEA 1GANA 3QH7A 4YFZA 2FCUA 1R081 3CLPA 3POGA 4CRQA 2H6BA 4EJRA 1NT0A 4E8DA 2PLV2 1UIJA 4YPJA 1DGLA 3ZMOA 3ENRA 5EPAA 5F5CA 4BCUA 5F6KA 1FOD1 3OBTA 1DP0A 2OQ6A 4LLFA 5C4WA 2FDIA 1VPHA 2HBUA 2VBPA 4R9CA 3AMPA 2VOKA 2WZEA 2HEWF 1CIYA 3U14A 2VTFA 3VBHC 1CWPA 2ET1A 2UWCA 4X6RB 5BNPB 5JMCA 2AACA 4N7IA 5FPLA 4IETA 5FZGA 4AYUA 2MNGA 4A7KA 5JXIA 1DIWA 1DG6A 1OT5A 2JIJA 3WNLA 4A3ZA 2WZR3 2YROA 1AX1A 4IE7A 1X9PA 1C1FA 2HYKA 1UKRA 3WW4A 4GXLA 4HL0A 4AI8A 2LS6A 4DINB 5DAQA 4L0PA 1UOFA 4E4HA 1H1MA 1NY72 1ULOA 2D97A 2XKPA 3DPRC 4WVMB 2VO5A 3WNOA 2WZR2 3W5NA 5FZFA 3LFMA 3T0DA 4LO6B 5I0RA 3S6PA 2BVVA 4FP2A 1W9SA 4LKFA 4MO3M 4XILA 4Q4V2 2XUMA 1JW6A 2ZEWA 2ZXQA 1I1EA 1XC6A 1JH5A 3OCPA 4XQ4A 2WQ8A 4HKLA 2ZGKA 3JBG1 2W1UA 5I0DA 5FQ0A 4OUSA 1GZWB 2WA4A 3OEBA 4XMIA 1N3OA 4QX2A 2NZ9A 2VZOA 3J26N 3NKTA 4LO7A 3H8OA 1EUUA 1PO12 3CJIA 5HCFA 1NG0A 2XKOA 1H4HA 1CAVB 3OPTA 4QPIC 5FZ3A 5K4LA 2EVXA 1RUJ3 2A7AA 3NJXA 3RWKX 1MVQA 2UWBA 1LU2A 2W47A 2Z5WA 4I0AA 1QY4A 2YBSA 5CVRA 2ADDA 2JG9A 4J6GA 3HQUA 3R6SA 4QU2A 2VNGA 4CDUC 5GKAC 3I97A 5C3PA 5FFOC 5F3EA 4BIFA 1YC61 1REEA 2VECA 2OKXA 4ZHNA 1RUJ2 2JEMA 4P9GA 4IL7A 4ORFA 4AGVA 3RI9A 4LHLA 2RS31 3W9AA 5FBJA 2WUHA 3OG2A 1Q8PA 2E7TA 4MSVA 4KL1A 3WCSA 4AVCA 1CR7A 4YYOA 1UCXA 3OGVA 3HMYA 4Q27A 2PTMA 3PNAA 3E6CC 3HOBA 3T1LA 1K5JA 2YU2A 4NPMA 2X29A 4YW4A 5H9QA 1GICA 2AEYA 1FYUA 3FC0A 2GMMA 5C3RA 5IVVA 2ZCWA 4O9GA 1CD3G 2DFCA 1TMF1 4XF4A 3BU7A 4YW3A 3VBOC 3I3QA 1LESA 3H50A 3VHNA 1J3PA 1YIFA 5GLZA 4CCJA 4CUGA 4YZ1A 1G9AA 4IDZA 4GD4A 4AOCA 5IFTA 1JN2P 4C8DA 1D2SA 5IVCA 1DGRN 4DS0A 2XPJA 3VBFC 3CQOA 1J83A 2RDSA 3OJBA 1X7NA 4NO4A 1AYN3 2ARBA 1S4CA 3C7HA 3PLQA 1LRHA 5AC91 2JB8A 3UYJA 3VBUC 1GBGA 5KHHA 4D6SA 3OF1A 3RYRA 1QJFA 3VBSC 5LEKA 4Q0SA 3KCCA 2WZPP 3WDYA 1AYN2 1FX5A 2K9ZA 5FZDA 3SEEA 5L7OB 1LOFC 1Y4WA 1HJFA 2WT2A 2OPWA 3H3ZA 4BYYA 3UJOA 1G9FA 4PLNA 4IE4A 1P8JA 2E53A 5EYYA 1WMXA 4XBQA 5JI7A 3H8RA 3HN1A 1NA1A 1TE1B 4IUGA 2VOTA 3POEA 1H8TA 3KVAA 1QDCA 1OVPA 3INAA 4NHKA 2J1UA 5H9PA 1QH6A 1SLBA 3JD71 3WD5A 2WZ8A 3ZXFA 1YHFA 3MIEA 3MV11 4XBLA 2XL9A 3GALA 1RL3A 4ZXKA 4CDQA 3S30A 3WXPA 3A0KA 1OLQA 4DFSA 5FUNA 1QNWA 3PJQA 1ZZCA 2WT1A 3I7DA 2E7AA 3NL1A 2XMLA 4ZZ5A 5IVBA 2PHRA 4CDXC 4NR1A 5HV0A 2DYCA 3JQWA 5FP7A 3DCQA 2UWAA 3A7QA 4XFFA 5CFDA 2NQYA 4E2SA 1AYM3 4GB33 5JPMB 4CCOA 3ZXEA 4D6QA 3UKVA 4BQ3A 1STMA 1ZZ9A 1UN1A 3GZAA 4RSUA 3T2OA 1TME3 1I5PA 2BV4A 3I3BA 1ZA4A 4OUEA 5FZ7A 3IMNA 2D44A 3PVNA 4A7ZA 1AYM2 1OLRA 4GB32 1GWKA 1W8OA 5F7UA 3WF3A 4A42A 1Y9MA 4FQZA 5T5LA 5LA0A 1HX6A 3R4DB 4L92A 4ZU5A 5JVVA 2V4AA 1TME2 4HVRA 3LDBA 5CFCC 1H2KA 1O59A 1UD1A 3LA7A 5DPNA 3R05A 3RZMA 1HKDA 3FMGA 5A3OA 5FREA 1LCLA 1UY0A 1EP0A 4AW7A 3GHNA 1GR3A 3OGGA 4AVTA 2GMPA 3H7JA 4WZCA 5AFBA 1CX4A 4URTA 1BZWA 1WD4A 1ENRA 1LGBA 4M4RA 1HB4A 5SV8A 3S7IA 2XJUA 5FRAA 4QX8A 3LA2A 4E4DX 3LZZA 2A6WA 5F3CA 1NCRB 1OI6A 1RXGA 4H55A 4KWUA 1U0AA 4CZSA 4OQ9A 4G4FA 2VUCA 2MEV3 2Q8OA 4DMIA 4QGMA 4M00A 5DG2A 2PLV1 3C7FA 4E2QA 4IV3A 1SLAA 1PK6C 3NNJA 2D6LX 3I3MA 4F8AA 2ZGOA 5A7SA 5EQUA 5JOZA 5CEHA 4AHXA 1ZZ6A 4GH4B 3RSJA 2HYXA 2MEV2 2ZBJA 4I02A 3KM5A 4X8PA 5I0SA 2CTVA 4EN7B 2EIDA 4UFMA 3GXUA 1RUF3 5LY2A 4ISQA 4QM9A 4O7XA 4B29A 2BDRA 3ILNA 4K8RB 3CNAA 5FV3A 4AQSA 4EWAA 4JHZA 5DUUA 3VUOA 1NUKA 5BNNA 1RUG3 1UY4A 4NVPA 3SMHA 3TRSB 4CUCA 3NV4A 1IPSA 2VVDA 2WNUB 1UYZA 3IPVB 4CYDA 3KQ4B 4TXWA 2XBO1 4JKMA 5KWRA 1RUF2 4P9WA 3NQHA 4BB3A 1W8FA 2VTXA 1HV1A 1Q8OA 2ZEXA 1NY71 4ZY9A 1AR73 1QWRA 1E5IA 3AFGA 1LHOA 3J7NA 2WNVB 1RUG2 3LIGA 5FZOA 1VBB3 1BBT3 1PHMA 5K0UA 4CDWA 3MEPA 3V64A 2RJLA 2EIGA 2VBBA 3D82A 3JB8A 4N53B 4R9BA 3BVCA 1AL0G 4D7YA 5FZKA 3F95A 2Y6JA 1F4AA 1AR72 1UW8A 2DVDA 3MIBA 3VV1A 5EJZB 1VBB2 1BBT2 2E51A 4MVTA 1PIV3 4CUBA 2J22A 4K8FA 5DABA 4CPBA 1K42A 2JD9A 2EA7A 2BQPA 2HWF3 1GP5A 4CCDA 1JYNA 3VBHB 3ACLA 3FL7A 1VRBA 5EP9A 3OGJA 1PIV2 4FOQA 4TWTA 4M4PA 4UYBA 4AXOA 4HG6B 2QQIA 5FXZA 1NCQA 2AEZA 3MW4A 2HWF2 1W6NB 4Y26A 4YG3A 3K3OA 3N3HA 4FFFA 1CJPA 2JDYA 2VQUA 3ME2A 4JX0A 4L11A 4XC9A 3UL2A 2ORXA 1RUC3 3PDQA 4ATEA 4R4ZA 2RE9A 4KNCA 3POJA 4XFBA 1XNAA 5FK7A 3HWJA 3DPRB 4LNVA 2PN5A 4UOJA 5KBFA 1XXNA 1F8VA 1K5MB 3ALQA 3WDTA 1W90A 4AR2A 4YZ2A 2ZGQA 1ZZ7A 2FQPA 2A75A 3P1IA 4FXGB 1DGWX 1RUC2 3BUCA 1F15A 4Z2AA 4LULA 1VBC3 3MV01 2WIIB 4DEVA 1AVBA 1AUYA 3Q8FA 3ZFEA 3EHKA 5LA1A 1N1VA 2HKXA 3GYDA 4MGYE 2YBPA 5DZFA 1PNFA 2QZ2A 2V4VA 5J36A 4NWVA 1GNZA 3PURA 2WAAA 1DGRA 1SBEA 2NM1A 1VAMA 4XAEA 4XDOA 5FZMA 4COUA 2VW2A 3FUOA 1UIKA 1ULEA 4RQPB 1H6YA 1CZVA 3B9IA 2BGPA 5C9AB 5HXVA 3S5QA 4WVVA 1GLHA 2ZGPA 1OQEA 3O1MA 5IJRA 1WW7A 3WUDA 5ACA1 3SLIA 2CY6A 3J8F3 4JGZC 2YDEA 1ALYA 2OYZA 1V6LA 1BEV3 1S0BA 2XHNA 3DYMA 4K7JA 1SDDB 1H8TB 3N9LA 2VE1A 1V9U1 5FZ4A 2WNEA 3FLPA 1Q8VA 3POWA 5FLJA 5C8WA 5DXDA 3TOJA 4LBNA 2GU9A 5FJHA 1D2QA 3EXUA 1AYN1 3J8F2 1VBE3 4GALA 4A3XA 4EZHA 3BPSA 5BNOC 1RUE3 4AI9A 4EN9B 4XACA 4BU2A 1K12A 3C2UA 4CP9A 1ND3A 2VUAA 4BM8A 1YNAA 2C4XA 4XYXA 3K75B 4NN0A 5JXJA 4HLTA 1DFQA 1VBE2 1W03A 3UETA 4BQXA 4FTSA 1ND2B 2RS53 4LBJA 1RUE2 3ORJA 4A44A 1WW6A 4K1YA 5GZFA 4BQYA 3VBOB 1JYXA 5KHGA 3HIFA 1J1TA 4AQTA 1SMVA 2DCZA 5KHIA 5FYZA 3WP3A 1XRUA 2WWJA 4QWNA 4M3CB 4HVQA 4CEWC 5E89A 2RS52 2QUOA 4PDWA 1IG3A 4MHUA 4META 1S0CA 1PO21 1AXYA 2DCJA 3VZJA 4AAPA 3DYOA 1GSLA 4YVWA 2VXJA 1SPPB 1URXA 2XG3A 1ASJ3 3ILFA 2WO3A 2R6QA 3UT0A 2RM23 3MGUA 1S0IA 5E8AA 4GA9A 3FZ3A 3LD8A 1OA2A 3I3DA 2BWCA 4S2FA 1DQ2A 5FZIA 5A7WA 1KFXL 1HN1A 3RG0A 1ASJ2 5JZGA 5KC5A 2PHLA 4DXSA 2RM22 5FYMA 4P14A 1JUHA 3LIHA 3KZ4C 3THPA 1W2AX 1AYM1 4LE4A 1FMD3 4CU8A 2X5IC 2HJIA 3VD9A 3MIHA 4AVSA 5HCAA 3CL1A 1O91A 4WV8A 3U10A 5CA6A 4XFHA 2R0HA 4ZPIA 2R041 2RR13 2XLAA 3BTAA 3KF5A 1E5SA 5DN2A 1FMD2 4OYUA 4XHXA 3AJYA 2G9FA 3ZX7A 4QHOA 3VDDC 1FOD3 4QU1A 4IV3B 1S0FA 2VCAA 5FDBA 5KHKA 1SCRA 1R082 1XYPA 4D7TA 5JDBA 2B42B 3SCFA 2RR12 1HV0A 5CB7A 2R0FA 4Q1PA 4LOSA 4YGCA 2ZX4A 1WMEA 3KQRA 4LKSA 4YFWA 5EXOA 2ZGMA 2QE3A 3WDVA 1B35B 2MPFA 1FOD2 1YFUA 3CO2A 4I09A 4UFJA 3S7EA 4XVHA 2WAOA 2P3JA 4NRQA 3N7KA 5A6XA 3EJKA 1GWLA 1VIWB 2ET7A 2RVAA 2VZ1A 2VC9A 2Q8CA 5JUVA 5F5IA 4PCRA 5EFUA 2ILMA 1GOFA 1WLCA 1T2XA 2PHFA 1W2OA 1U5XA 1UPSA 3SHRA 5BY5A 4NIDA 3WG1A 3ZSEA 4KU7A 2WQ4A 1G9DA 4YVSC 2F17A 2WWSA 1BVP1 1WCUA 4B1MA 3KF3A 1OQ1A 3O0VA 2ZTNA 1LNSA 4FPHA 5FK8A 2YHJA 3H3LA 3BTXA 4AAXA 4W50A 1KS5A 4XBNA 5EHDA 3JBG3 3ZFFC 5BNPA 3NJYA 1C8M3 4KU8A 3VDCA 2FDJA 2J1RA 3T2QA 3N7JA 1U5YA 3ZFGB 1XSRA 2PAKA 1UY3A 2BNOA 3JXSA 4IE0A 4WM8B 3IAPA 3LCPA 3WF4A 1AR61 2EXIA 4LIVA 3JBG2 1CAXB 1C8M2 3WDXA 4IERA 4MG2A 3ZM8A 3AKQA 4NJ4A 3ZIWA 2HWD1 1BMV2 4WVMA 2Y6LA 2Y64A 1C28A 5A7QA 5IK7A 1JBCA 1JZ7A 5A6ZA 1M4WA 3P3PA 4W8JA 4AI3A 2R16A 3I2OA 1NLQA 1POV3 4COYA 3G7DA 4ZU4A 3R4UA 2XJVA 3VD7A 2GP3A 4ET7A 3NW4A 1ULDA 2P3IA 4GULA 2BWAA 2HLEA 4LORA 3KS7A 1YXWA 1WW4A 4XFIA 1YCIA 1GZWA 2RS32 2ZX2A 3MFAA 4YARA 3ZSLA 4XAAA 3OSDA 3C7EA 4IW3A 3AL6A 5LA9A 3T08A 3U0ZA 4COVA 3EBRA 4Q4Y3 4ARYA 1TMF3 4N43B 2JECA 1QGLA 4QHZA 1CONA 1MZ5A 2GH8A 2H0BA 3TEZA 4NIHA 1VBA3 2Q8EA 2J1TA 1R1ZA 1I3HA 2WS93 4QXCA 4FCAA 5I0UA 1AR91 1TMF2 2LUWA 5T52A 3RMYA 5FMOL 3SISA 4XPVA 5FMBA 4URAA 3IIAA 1C4RA 2W5FA 2W94A 3E6DA 3EYPA 2HWE3 1VBA2 3AKTA 1O3TA 1XE7A 4WM7C 2ZX3A 3PIJA 4GJZA 1JHNA 1WLTA 2WS92 4N9IA 1TQ5A 4BIOA 5JR2A 2VNOA 2UU8A 2JDPA 1W0PA 3PMEA 4N7UA 3NNMA 4GQ7A 2ZMLA 4JGYB 2ERFA 3V0BB 2OIIA 1NXMA 2HWE2 2G1MA 3ITQA 5FZ6A 1UU5A 1VBC1 4XEZA 4QKFA 2A3YA 3WOGA 5AC92 2WSUA 1LAJA 1ZRFA 3BB6A 2B9UA 2YGMA 1MS4A 5FZ8A 3V0AA 1OOPC 4FAHA 4HMZA 1LJ7A 4YGDA 1OBNA 5CU1A 1OF4A 1LOCA 4FOWA 3U4SA 1X50A 1K45A 3GCXA 3MIDA 4MH0E 3I59B 5FMOS 3DXTA 4M0NA 5LBCA 1LGNA 2QQMA 5ANNA 5EWSA 5CAZA 4MADA 1W99A 4GIQA 4FVVA 1C1LA 1BQPA 4I2OA 5EIYB 4IGPA 2JENA 3O14A 1GZTA 1RB8G 4IEZA 4TYSA 2BW8A 5ABJC 4IV1B 1UO9A 2OZ6A 4KGQA 3T09A 1BEV1 1UOBA 3SH3A 2W1QA 1H4GA 1NOVA 1AZDA 4HT1T 1F4HA 4RYDA 4NIGA 4V2VA 1S1AA 1JUIA 1R091 2YUEA 4L97A 3C3VA 3TBDA 5L7OA 2VUDA 3ON7A 3QBQA 1RUE1 3I2IA 3I2JA 3B7MA 4XTMA 3AZYA 5LCWL 5AVPA 2QCSB 1IPKA 3KT4A 1HDKA 2VCCA 1NZIA 1ACCA 1VAKA 3A22A 3K4ZA 4AGGA 4FFIA 3M70A 1AXZA 1NLSA 1BJQA 1UZZA 4AEMA 2RS51 3TN91 3LOBA 1VAVA 1YQ8A 2G9ZA 4XF3A 2CAUA 1UMHA 4P9LA 5IYYA 3RGBA 4KG8A 2DWRA 1RINA 4TN7A 4A4AA 4FI9A 5FP3A 4JGZB 4DB5A 4JRLA 1SZBA 4H14A 3WW3A 1HQWA 2I45A 5FO7B 1X9TA 2ZHLA 3FHAA 1ENSA 4GWNA 3MBWA 5KXEA 3WINE 3TEYA 2QQJA 5FZCA 4UI9L 3UV9A 2WABA 2OS2A 3FFQA 4B4QA 2Q1ZB 3CU7A 4QPGB 4NWWA 4S2DA 4D94A 5BNOB 2I2SA 4PHZA 4YZ4A 2DVBA 4W65A 1OLMA 5M0TA 3MF9A 1W9YA 1TVGA 1JZ4A 3K51A 4OHYA 3FBYA 5G05L 2ZEYA 3T4VA 3PUHA 2IFRA 3DL3A 4OI2A 3HVDA 1UYYA 1D7PM 4NPLA 4C90A 1Z78A 1H9WA 5A1LA 3O1SA 4YW1A 3QD6A 2R1BA 3O0XA 3LEMA 1W8NA 5A33A 3W59A 2V73A 2JG8B 2WLQA 1FMD1 2QQNA 1OFSA 3HT1A 1MVEA 3JZVA 3N9QA 4CEWB 3GBGA 4IGQA 3MIFA 5L19A 4B4PA 1YQ2A 3ZN6B 1MZFA 2G19A 2JDUA 2WYFA 1WZXA 4QHBA 5EYXA 2DCTA 1RTVA 2RR11 1V6JA 4YW2A 3VZOA 4LKEA 3IBMA 4YLZA 4RGAA 4B8EA 4OI0A 4LTAA 1CIWA 1N1SA 3LAGA 2UYBA 2D6PA 4YM1A 2KD7A 2Q1MA 2XXZA 3WF0A 4XJZA 1G9CA 2XBO3 2VCBA 4BISA 4OI4A 1BXHA 1NCRA 2HWB3 4BMBA 1ONAA 4AEDC 2JG9C 1DYKA 3K2OA 2XJTA 2B46X 4TLGA 2ZEZA 2XBO2 4QB2A 4IEVA 2HWB2 2Y6KA 2P6HA 2VVFA 3PU8A 4YZ5A 1MS8A 1WCSA 1H6XA 1MQTA 4GH4A 3VHPA 3VL8A 1IS3A 2IC1A 4AHWA 3FJSA 4DXRA 4AZZA 4IEUA 1QXRA 2CGNA 3ZN5A 1JOBA 2I74A 4XW3A 2A6ZA 4FPYA 3HN3A 4PJYA 4JZRA 3VHOA 1QJX1 2IXCA 2PA7A 4MGQA 2WNUA 3IPVA 1C8M1 5C3OA 3AP6A 4FQ4A 3KHBA 1HQNA 1A8MA 1BMV1 1Q3EA 2A5ZA 1HLCA 5IVYA 3NV3A 1XYNA 2OUHA 3ZDSA 2WNVA 1W2NA 3LKJA 5LASA 3MFCA 2J7MA 1L7RA 3ES1A 4W6YA 3RNSA 4XJ9A 2VMEA 5B2GB 2UY9A 2VL4A 4N53A 2W52A 4BOWA 5IVJA 2IUWA 1PM4A 1W6PB 4NOTA 5A7NA 1XNBA 4H3WA 4Q1RA 5C8CB 2VU9A 1F5FA 4XZPA 1C5HA 4ITCA 5BV6A 3FBMA 4MX3A 4OMCA 4YVSB 4XJUA 1POV1 4QQPA 2E26A 2F4PA 4W4ZA 3ZLIA 2CGPA 1D4M3 2VMCA 4Q0UA 1EPWA 5T5JA 2HWC3 5F6LB 3JQXA 1QIQA 2YC0A 3IDBB 3WG3A 1A6CA 4Q4W3 2ARAA 1IOAA 1LGCA 1YO8A 3VBHA 2IZWA 3SC7X 3NJZA 2PHXA 3URFA 3POYA 3GZTB 4LA3A 3W21A 2VZPA 4NHXA 4NROA 4GMP1 1D4M2 2D6NA 3AFKA 4Y33A 2GC2A 1NA1C 2VMFA 4RFRB 5A3UA 1H1AA 1W6NA 4Q4W2 1XE0A 1QHDA 1VP6A 1NAEA 4Q4Y1 3GZUC 1C57A 3LGRA 1KJLA 3T2PA 2DBIA 2IXKA 5ACA3 3V0AB 1VBA1 1UY1A 3DPRA 2BGOA 5JOWA 3DN7A 4CXYA 1LHNA 1K5MA 2CDOA 1V9U3 2DU0A 2WS91 4BK4A 4CDQC 4AFBA 1SDWA 4HSJA 4LBKA 5ACA2 1UOJA 4QXKA 3USSA 3SEPA 3GBFA 4BLJA 3V56A 1A3KA 2HWE1 1JZ3A 1OD5A 1VMFA 3HNBM 1XNDA 3RJ2X 3SH5A 3V65A 3RYPA 4C0HA 1V9U2 4FOVA 4YGEA 5CFDC 4RR3C 2GDFA 1RIRA 3QOPA 1ZRIA 4EWEA 4RQPA 5D2AA 3RI8A 4G3YC 4MUVA 4K20A 3ZXKA 3T1MA 5C9AA 3POSA 3UGGA 1WBFA 1Z7S1 1AR81 3GBWA 3EMRA 5HCHA 1ODMA 1W39A 4QQ2A 4XJ8A 2FZ2A 5FPXA 1VBD1 2B7YA 2JXAA 5J37A 1WMDA 1EYBA 2C1FA 5J48A 1CGPA 5A3LA 1REFA 1IKPA 2LRPA 1PO23 1VRH1 4Y1XA 1A34A 3ZKYA 5L73A 4NRMA 4LR4A 4FPLA 1PVXA 5HBAA 3WHUA 1XYOA 4XUNA 4AHYA 1ST8A 1RUH3 4WM7B 4KI5M 2DCYA 2P17A 3M1HA 4ASLA 5IAXA 1QDOA 1V6IA 2IWGB 5K9YA 1PO22 4FFHA 4BQ1A 2VG9A 1LB2A 2YC4A 5FY5A 4P02B 2A70A 4QKDA 3WUCA 4CP1A 1KDKA 1ND2A 3NVCA 1PNGA 2ZAHA 2DTYA 4Z92B 2FDFA 3FWEA 3VBOA 1LODA 3HPNA 5IFPA 1ZBE3 4I0BA 3NJVA 2YXSA 4M3CF 5FWEA 3O7OA 3HBZA 4NAMA 4YM2A 4M3CA 2JD4A 1PZ8A 3ETQA 2DUOA 5I8TA 1JZ5A 3D8CA 3Q9OA 1ZBE2 2R043 1GMMA 1NYWA 2W0XA 1LOEA 2Y33A 4JTNA 5A33B 1YEWA 2WWUA 3BODA 1N3QA 1SPPA 1CAWB 3EO6A 4M01A 5JOYA 2CSGA 2W39A 3OGRA 4J1WA 5ABJB 4OQ8A 5H9SA 3AXEA 4UBHA 2R042 1GU3A 1NE6A 4HPKB 3WLUA 4JV4A 5FY8A 2CWMA 1HB1A 5HI0A 5K7PA 1I5ZA 1X82A 3GJAA 4TZDA 1LOFA 3PVOA 1JHJA 1W6MB 4BZ4A 1DQ5A 1XQNA 4CXWA 2TBVA 5A7PA 1JODA 3AJZA 3WQ0A 4QQLA 1MS3A 2CWSA 4COWA 3VKOA 1X33A 3I2FA 3THTA 3UJQA 4LBOA 1DLCA 4FO9A 3JU9A 1WW5A 2GNMA 3Q8AA 3A4UA 2VPVA 1OH4A 3LSDA 1N47A 5FYIA 3VDAA 1AJKA 3WSOA 2CAVA 1HW5A 5F2WA 4PLMA 4ASMB 2ES3A 3KGLA 3WNKA 2DVAA 4LO4B 1MS9A 1QXPA 1VR3A 5HV4A 5FMCA 1RHI3 4LT5A 1MACA 3ST7A 5BNQA 1UF2C 3NNGA 5J7MA 4Q29A 4IXLA 4AVBA 2PMWB 4Y20B 4BMEA 2VCMA 1MQTB 2Y26A 1W9TA 4PQQA 1RMU1 2XJSA 3AMHA 3AVSA 1B35A 4CDXA 3MICA 4U2AA 1RHI2 3THDA 2JDAA 2AUYA 1SLCA 1HJGA 2VW0A 3SITA 3WG2A 3ZPYA 3NAPB 2W95A 1AR63 4LBLA 4PLOA 1UMZA 2K46A 5GM0A 1O4ZA 1YFWA 4QD2A 4E4SA 2O0OA 1O4TA 4U36A 5FXXA 5J98B 1UNBA 4YNIA 5CG9A 2HWD3 1O8PA 3FX3A 3M8LA 4CEYB 3B3QE 3WY6A 5A1AA 2HWB1 1GWMA 2JDMA 1WLDA 5LATA 3U78A 4DUWA 1O4YA 1FATA 5AFEA 1AR62 3ZXDA 3AKRA 1MS1A 1YFYA 2KA3A 1COV1 4CVUA 1JYIA 2W91A 4QGLA 2HWD2 1GP4A 3OGSA 5E88A 2BZDA 4QB6A 3AB0A 4QGNA 1MS5A 5A70A 2GP5A 1W8ZA 3ACFA 3U37A 1UX7A 1CAUB 1N1TA 2I07B 1O5UA 4O65A 3RVHA 2XJRA 2VNVA 4BQWA 3ZFGA 1NQDA 4FFGA 2NP0A 4UFKA 4DZGA 3M3IA 1D4VB 4WM8A 4IEWA 3LA3A 5DZEA 5BUVA 4Z1VA 1CAXA 1W2UA 1OMIA 5A7OA 3S0MA 2GH2A 1OPOA 2EALA 4P9XA 4C0BA 4FTBA 4DY5A 2JE7A 2G9GA 3QLQA 3ZXAC 4CCEA 2RJ2A 2IVIB 3OY8A 1AR93 5GZDA 4IEYA 4OHWA 4QX0A 5D8AC 1QJEA 1V70A 2FCTA 1PK6A 3CKHA 1W3XA 1WCQA 3DECA 2C26A 4QDSA 3WV6A 3DGTA 2W3JA 1XU1A 4LIUA 1PMJX 1AR92 4KH9A 1LEMA 4I0WB 3ZXLA 4A7YA 2GC0A 5LBBA 1POV0 1XB9A 4OVEA 5EZWA 5DDJ3 3CEWA 2ZACA 1PX3A 2WYSA 3VKNA 4RFT0 3WP6A 2VMHA 3O12A 2VMIA 1D4M1 4EN6B 2HWC1 4S2HA 4N43A 1AX0A 2D6KA 4Q4W1 4DQAA 5DDJ2 4GMP0 5FJKA 5FPVA 3ZYPA 3M7AA 5FZ9A 3VL9A 5L9VA 4XF9A 2GN7A 4K6BA 1VBC2 1O6UA 5CBLA 4KWLA 3W5MA 2ZGSA 4MGSA 3TAYA 3K3NA 4QPIB 4RA0A 2DVGA 1UKGA 3AC0A 2CNAA 3KGZA 4NMIA 3AYEA 4EN8B 1IPJA 2NPIA 2GC3A 2CV6A 4CDUB 4MOAA 3KD4A 2HEYF 4YG0A 3I54A 4YVWC 2BERA 2XL7A 3LEIA 4LJHA 1ZX5A 3NNFA 4HK9A 4LBQD 4JGYA 1R093 5LK5A 3ELNA 3WNXA 3V0BA 2WQZC 3HQXA 3H7YA 4GWMA 3UNPA 2OPKA 2D93A 1BEV2 1WBLA 1X8EA 3UGFA 2RJKA 3ZSKA 5IK4A 5JZGC 5J3UA 1CX1A 1R092 2E63A 2HH9A 2EAAA 3WNPA 4AVAA 3DXUA 3B69A 4MXWB 2WN2A 4Q8LA 5HPOA 3I59A 3TN93 4XMAA 2Z42A 5KR7A 5F32A 1W6OB 5DAVA 1DQ6A 4FPJA 4JQRA 3ETPA 4XFGA 1GZCA 3C7OA 3F2ZA 4BK5A 3WNMA 4LO5B 2TNFA 4IV1A 5A3PA 1US2A 3M3OA 1YI9A 2X10A 1IQAA 1CN1A 3TN92 1AXKA 4JAAA 1ZYBA 1PZ7A 1IS5A 1E5HA 1UQXA 3E5XA 3N7MA 3VBFB 3VKMA 3MW2A 4H7MA 5DMYA 2Y6HA 3K77A 2CU5A 1A78A 5JOXA 1WA4A 2P3KA 1HRV3 2AZ5A 1EAH3 5JWPA 3DEMA 4JDNA 3WF2A 4D0QA 3IM0A 1O8SA 1RUH1 4BXSV 4CDWC 5DAWA 5DUVA 3VBUB 4BQ5A 5FPUA 2WR9A 3B5LB 4AFDA 5IVEA 3CZJA 1OFNA 4RR3B 3VBSB 1UU6A 1FPN1 1WLWA 3ZR6A 2K0GA 1HRV2 4FSJA 1EAH2 3AYDA 1V6OA 1HXS1 3IWZA 3IDAA 5IK8A 1UXZA 1DGWA 2VOXA 3VBRC 2EIEA 3E5QA 1ZBE1 3HQRA 5JR7B 1XPWA 2A3XA 1ZA7A 4JGZA 4LE3A 4K3UA 4QX1A 3NV2A 1KJRA 3GHMA 3S5AA 1ULGA 4P00B 4BQ4A 4MGKE 2VY0A 2XHKA 3MPBA 3ZVXA 1J58A 1QJY1 2OX0A 2R30A 1WKYA 3KCYA 2DURA 2P5BA 4CU7A 2GNBA 4LPLA 4QPGA 5BNOA 1MZEA 1MEC1 3JCIA 2SBAA 2AR6A 4UW6A 5DZGA 2FD8A 3ROUA 3RZZA 1X8MA 1JXNA 2GSYA 4L2NA 3ASIA 2ZHKA 2EAKA 4CDXB 1HB3A 3JUUA 1LECA 4XUPA 3PTYA 4OHZA 3KV4A 4AQ2A 1O5LA 4EZ4A 3THCA 1Q8SA 2JG8A 2WBKA 3LDRA 2AYHA 2W87A 3VN4A 2MHFA 1RUI1 4CEWA 2O14A 1DCSA 2ZGNA 5FYTA 5KXCA 2VH9A 1GUIA 5JCTA 4UW4A 4XQDA 3ZN6A 4I01A 3AP9A 1BCXA 2WL1A 2XB6C 2Y60A 3NV1A 4JHTA 3ES4A 2GAUA 4D6RA 5KC6A
chains in the Genus database with same CATH topology
5FV3A 3OPWA 5FYUA 4DO0A 3UYJA 2YBKA 5FZBA 5FZCA 3PUQA 5FXVA 4D6SA 4UF0B 5A3NA 5FYZA 4Y33A 2OS2A 5FYIA 2WWJA 4QWNA 2GP3A 5A1FA 5FZDA 4Y3OA 5F2WA 5F5CA 4BXFA 4V2WA 2OQ6A 5FYHA 5FZAA 4Y4RA 5FYVA 5FZOA 4AAPA 2PXJA 4EYUA 3AL6A 5A1LA 5F39A 5FPLA 5FZGA 3KVAA 5A3TA 5FZKA 4GJYA 5FP4A 5FZ0A 3AVSA 3DXUA 3LD8A 3N9QA 3PUSA 4IGQA 5FZIA 5A7WA 5KR7A 5F32A 2Q8EA 5FZHA 5F2SA 3KV6A 3KV5A 3ZPOA 4QXCA 5FY4A 2W2IA 5FXXA 4QX7A 4E4HA 5FY0A 5FYMA 5FY9A 5A3PA 5FXWA 4URAA 5FUNA 1VRBA 5FZFA 5FWJA 5IWFA 5FY7A 5IVBA 3U78A 2XMLA 4HONA 5FP8A 4GJZA 4DIQA 5A80A 5FP7A 5FXZA 5A3WA 5ANQA 2XXZA 5FPBA 4LXLA 3K3OA 2OQ7A 5FYYA 4BISA 4CCOA 4D6QA 3N9OA 2XUEA 3PDQA 5FZ6A 2GP5A 5FPUA 4QU1A 3K2OA 3PTRB 5FZLA 5FZOB 5IVEA 4CCKA 2VD7A 5FY1A 5F5AA 5FZ7A 3RVHA 5FZ8A 3KV9A 5FZ3A 5FUPA 3OPTA 5FPAA 3N9PA 5K4LA 4CSWA 3PU8A 2YU1A 3U4SA 2YBSA 3N9MA 5IVFA 3DXTA 4CCMA 5A7OA 5A7WB 4ASKA 5F3EA 2YBPA 3LDBA 5FYSA 5FY5A 2Q8CA 4IGOA 4IGPA 5F5IA 3PURA 5FZMA 4XDOA 5FBJA 2OX0A 5FYCA 4UF0A 4XDPA 3AVRA 4QXBA 2P5BA 5FWEA 5LWBA 5E6HA 4V2VA 3N9NA 4LITA 3PU3A 4CCLA 5FP9A 5IVYA 4LIUA 2YU2A 4QX8A 3KVBA 5FZEA 4GAZA 4NUBA 5F3CA 5LW9A 5IVVA 3N9LA 5FYBA 5FZ4A 3NJYA 5IW0A 2WWUA 5FZ1A 4QXHA 5IVJA 4CUGA 4CCJA 3PUAA 3KV4A 5FJHA 2OT7A 4EZ4A 5A7NA 4CCNA 4EZHA 5F3IA 2Q8DA 4GD4A 4AI9A 5FPVA 5FJKA 5FY8A 4LIVA 5F3GA 5FYTA 5A7SA 5F37A 4C8DA 5CEHA 5IVCA 5FZ9A 4BU2A 3ZLIA 4TN7A 5FP3A 5ISLA 4HOOA 3AL5A 5A7PA 4D6RA 3K3NA 2XDVA 5LY2A 5LY1A 2YPDA 5A7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FV3 A;  3OPW A;  5FYU A;  4DO0 A;  3UYJ A;  2YBK A;  5FZB A;  5FZC A;  3PUQ A;  5FXV A;  4D6S A;  4UF0 B;  5A3N A;  5FYZ A;  4Y33 A;  2OS2 A;  5FYI A;  2WWJ A;  4QWN A;  2GP3 A;  5A1F A;  5FZD A;  4Y3O A;  5F2W A;  5F5C A;  4BXF A;  4V2W A;  2OQ6 A;  5FYH A;  5FZA A;  4Y4R A;  5FYV A;  5FZO A;  4AAP A;  2PXJ A;  4EYU A;  3AL6 A;  5A1L A;  5F39 A;  5FPL A;  5FZG A;  3KVA A;  5A3T A;  5FZK A;  4GJY A;  5FP4 A;  5FZ0 A;  3AVS A;  3DXU A;  3LD8 A;  3N9Q A;  3PUS A;  4IGQ A;  5FZI A;  5A7W A;  5KR7 A;  5F32 A;  2Q8E A;  5FZH A;  5F2S A;  3KV6 A;  3KV5 A;  3ZPO A;  4QXC A;  5FY4 A;  2W2I A;  5FXX A;  4QX7 A;  4E4H A;  5FY0 A;  5FYM A;  5FY9 A;  5A3P A;  5FXW A;  4URA A;  5FUN A;  1VRB A;  5FZF A;  5FWJ A;  5IWF A;  5FY7 A;  5IVB A;  3U78 A;  2XML A;  4HON A;  5FP8 A;  4GJZ A;  4DIQ A;  5A80 A;  5FP7 A;  5FXZ A;  5A3W A;  5ANQ A;  2XXZ A;  5FPB A;  4LXL A;  3K3O A;  2OQ7 A;  5FYY A;  4BIS A;  4CCO A;  4D6Q A;  3N9O A;  2XUE A;  3PDQ A;  5FZ6 A;  2GP5 A;  5FPU A;  4QU1 A;  3K2O A;  3PTR B;  5FZL A;  5FZO B;  5IVE A;  4CCK A;  2VD7 A;  5FY1 A;  5F5A A;  5FZ7 A;  3RVH A;  5FZ8 A;  3KV9 A;  5FZ3 A;  5FUP A;  3OPT A;  5FPA A;  3N9P A;  5K4L A;  4CSW A;  3PU8 A;  2YU1 A;  3U4S A;  2YBS A;  3N9M A;  5IVF A;  3DXT A;  4CCM A;  5A7O A;  5A7W B;  4ASK A;  5F3E A;  2YBP A;  3LDB A;  5FYS A;  5FY5 A;  2Q8C A;  4IGO A;  4IGP A;  5F5I A;  3PUR A;  5FZM A;  4XDO A;  5FBJ A;  2OX0 A;  5FYC A;  4UF0 A;  4XDP A;  3AVR A;  4QXB A;  2P5B A;  5FWE A;  5LWB A;  5E6H A;  4V2V A;  3N9N A;  4LIT A;  3PU3 A;  4CCL A;  5FP9 A;  5IVY A;  4LIU A;  2YU2 A;  4QX8 A;  3KVB A;  5FZE A;  4GAZ A;  4NUB A;  5F3C A;  5LW9 A;  5IVV A;  3N9L A;  5FYB A;  5FZ4 A;  3NJY A;  5IW0 A;  2WWU A;  5FZ1 A;  4QXH A;  5IVJ A;  4CUG A;  4CCJ A;  3PUA A;  3KV4 A;  5FJH A;  2OT7 A;  4EZ4 A;  5A7N A;  4CCN A;  4EZH A;  5F3I A;  2Q8D A;  4GD4 A;  4AI9 A;  5FPV A;  5FJK A;  5FY8 A;  4LIV A;  5F3G A;  5FYT A;  5A7S A;  5F37 A;  4C8D A;  5CEH A;  5IVC A;  5FZ9 A;  4BU2 A;  3ZLI A;  4TN7 A;  5FP3 A;  5ISL A;  4HOO A;  3AL5 A;  5A7P A;  4D6R A;  3K3N A;  2XDV A;  5LY2 A;  5LY1 A;  2YPD A;  5A7Q A; 
#chains in the Genus database with same CATH topology
 1PM7 A;  2XGX A;  4DO0 A;  3OBA A;  1APN A;  1RHI 1;  4YSF A;  3M4F A;  3LDK A;  2VZ3 A;  4UF0 B;  5GLT A;  1BKZ A;  4YZ3 A;  5L9R A;  3NST A;  4DXZ A;  1QJX 3;  5CFC B;  5A1F A;  1NKG A;  1SLI A;  5A3M A;  1W8H A;  4Y3O A;  3MI8 A;  2OW4 A;  4E27 A;  3M2M A;  4LBQ B;  2QQU A;  4QPW A;  2ZHM A;  3LFI A;  1HRI 1;  1QJU 1;  2C6S A;  2GNT A;  1RJ7 A;  1QJX 2;  2PXJ A;  3OUH A;  4SBV A;  2QDN A;  5C5U A;  3SH4 A;  4FTE A;  2XWB B;  2BP6 A;  1B09 A;  4LHK A;  2G4I A;  2VUL A;  2P37 A;  4LA2 A;  4YWA A;  4Z07 A;  1IZ3 A;  2XH6 A;  1IHM A;  1YQ6 A;  4DY3 A;  4PIX A;  3OY8 B;  4XF1 A;  1QOS A;  3AP5 A;  2W2I A;  1ZRR A;  1KD7 A;  2J1A A;  1RJ8 A;  4XQW A;  2BBA A;  3AMN A;  2TEP A;  1PK6 B;  3M3Q A;  2BUK A;  4N90 A;  4W6X A;  1O3S A;  2PYT A;  2Z69 A;  1L7L A;  3MUZ 1;  1XBF A;  3ZYB A;  2QZ3 A;  2J1E A;  4UFI A;  5FO9 B;  1ZBA 3;  4GMP 3;  3RYK A;  4DRV A;  4OHV A;  4EV0 A;  2OQ7 A;  4LBM A;  5FYY A;  2HBT A;  3N9O A;  3BCW A;  1ODN A;  5J96 B;  4R9D A;  3PTR B;  1RUD 3;  3MDP A;  1YWK A;  1ZBA 2;  5GLW A;  1W6P A;  1YQC A;  3KV9 A;  1QOO A;  4UXA A;  1FV3 A;  2BNN A;  5C8C A;  4D8M A;  4FPO B;  2VGD A;  3H42 B;  5JMO A;  4Q4Y 2;  3HJR A;  1ZRC A;  4JDO A;  5GJ6 A;  4YVS A;  1F31 A;  1RUD 2;  2Q0A A;  5IVF A;  4UT5 A;  1OQD A;  2Y6F A;  1RXF A;  4PQ9 A;  2XOM A;  2ZA9 A;  2ZZJ A;  4IGO A;  4HN0 A;  3HNM A;  3Q8E A;  4BA6 A;  1F9K A;  4PT6 A;  2WLP A;  1DDL A;  2IXH A;  3GF6 A;  1V0A A;  5DDJ 1;  2KM2 A;  3TWI A;  3N36 A;  3SCG A;  3QH6 A;  2YB7 A;  5E6H A;  4RS5 C;  1QF3 A;  3N9N A;  2RV9 A;  3PU3 A;  2ZHN A;  4CCL A;  1Z7S 3;  1AR8 3;  3HR9 A;  1KFU L;  4IEO A;  3ZSM A;  4LLO A;  5FCC A;  4LEJ A;  1OH3 A;  1VBD 3;  4I30 A;  2D5F A;  2NLR A;  5IW0 A;  2BFU L;  4FOY A;  3ZN4 A;  2QQK A;  2QDR A;  2WFP A;  4AQ6 A;  2ETE A;  1Z7S 2;  4QPY A;  1AR8 2;  2ID4 A;  4MXV A;  2E7Q A;  4Y5Z 0;  1VRH 3;  2WNO A;  3UES A;  3WCR A;  3O1T A;  1JZ6 A;  4KWJ A;  2O8O A;  4IEQ A;  2W1W A;  5F5Q A;  2J42 A;  3I2D A;  3KT7 A;  4DOU A;  1VBD 2;  2P34 A;  3MYX A;  2UUR A;  5LK7 B;  3AM2 A;  1J1L A;  2W92 A;  1DZT A;  3POB A;  4QM8 A;  1VRH 2;  3AL5 A;  2XQX A;  1CJD A;  4WVW A;  1YI7 A;  4Y1Z A;  3D5O A;  3MPP G;  1VJ2 A;  5FYU A;  3J9S A;  1MPX A;  2YBK A;  3LQC A;  2P4E A;  3D0J A;  1UYX A;  3T0A A;  1RVF 1;  5EJ1 B;  2R7E B;  4OZX A;  3ZYG A;  2PEL A;  4DXT A;  2UY8 A;  2BFU S;  4MGZ E;  4BXF A;  4FPK A;  3TEW A;  3VD4 A;  3AP7 A;  3J7M A;  1RIT A;  1A8D A;  1XNC A;  2C0Z A;  4H7L A;  5FYH A;  1KRI A;  3TYJ A;  4ARX A;  1ULC A;  1ZNP A;  2LAL A;  2CDP A;  2EIB A;  1Q5O A;  4Y4Y A;  5FTT C;  1LUL A;  4B3N A;  4NHL A;  5A6Q A;  3OBZ A;  2O1Q A;  3RMX A;  1LOB A;  1RYY A;  4WM7 A;  1W0O A;  3CBN A;  2YMZ A;  4I3P A;  2V09 A;  2WO7 A;  1WWY A;  3E1F 1;  2D6O X;  5FKB A;  5K8S A;  3PUS A;  4XFC A;  5C7G A;  2VM9 A;  1RC6 A;  5C4W C;  2EXJ A;  2VZS A;  1VB4 A;  3FHI B;  1SFP A;  1J84 A;  1HRV 1;  1EAH 1;  3OEA A;  4RD7 A;  1WUV A;  1QU0 A;  5IWF A;  1LHW A;  3BPZ A;  4XFA A;  5FY7 A;  5BPX A;  3N35 A;  1OOP A;  1KQR A;  4XAB A;  4AWD A;  2VMD A;  1S0G A;  4EQV A;  4MZU A;  1JYT A;  5E1R A;  1C8N A;  1CVN A;  1T6G C;  3KSC A;  1AL2 1;  4FPG A;  4KQ7 A;  4R52 A;  2QQV A;  3AP4 A;  1R1A 1;  3TEX A;  3VZK A;  3I49 A;  3PUI A;  4UW5 A;  2DF7 A;  3I4I A;  5KXB A;  1W8W A;  2V5D A;  2A6Y A;  4GH4 C;  3ATG A;  4Y1Y A;  3RZL A;  3HD8 B;  3K4D A;  3RZJ A;  1CAW A;  1M06 G;  2D40 A;  5FY1 A;  5F5A A;  5ABJ A;  3MF6 A;  4UWD A;  1VAL A;  2AC1 A;  4P9I A;  1EPZ A;  3USU B;  3VLB B;  5FUP A;  5I8Y A;  2ZOE B;  3N9P A;  3E5U A;  4AVV A;  4HPK A;  4A41 A;  4C1W A;  3MZH A;  1WCD J;  1RMU 3;  2H6C A;  2JIC A;  4Q0V A;  1QQP 3;  1W6M A;  4GKY A;  2WNU C;  3O1V A;  2L9L A;  5LEJ A;  3KWV A;  1DQ0 A;  2Y38 A;  5FYS A;  2ZKN A;  2OXB A;  3D4K A;  4PBO A;  2W46 A;  3TNQ A;  1BK0 A;  3GGL A;  2JDK A;  4IE5 A;  4XJW A;  1RMU 2;  3CJI C;  3IDC B;  3MIG A;  1QQP 2;  3DYP A;  2VQT A;  1G86 A;  1EUT A;  1S0J A;  3LPG A;  4SLI A;  4LK6 A;  3DF0 A;  4MGT A;  3O1O A;  3VBR B;  1COV 3;  2VOW A;  1DQ1 A;  1L3J A;  2R07 3;  3IT8 A;  5LRR A;  4UFH A;  3ZYJ B;  5LW9 A;  1ZVF A;  2X5I B;  2A1X A;  4HET A;  3A23 A;  1DZR A;  3CHX A;  3E97 A;  4Y20 A;  4HVO A;  2B45 X;  5FZ1 A;  3WR0 A;  2VZU A;  3PUA A;  1COV 2;  1QEX A;  2R07 2;  3BIE A;  3P3N A;  5BYN A;  2KR2 A;  2CGO A;  2E31 A;  4X8N A;  1UXX X;  3NAP A;  1GKB A;  3VDD B;  4RN5 A;  1C3H A;  1SCS A;  2ZPX A;  1OLM E;  4LMF A;  4XUQ A;  2DU1 A;  3UKN A;  3ZYH A;  2PQQ A;  2CYF A;  1GQG A;  2RS1 1;  2O8Q A;  1RGS A;  4NHY A;  2W1S A;  3AMQ A;  2YPD A;  2JDH A;  1TEI A;  3I2H A;  4QKN A;  2JE9 A;  4CEY A;  5FR3 A;  5JAX A;  4NE9 A;  5JPN B;  4M0H A;  2JX9 A;  4Q4V 3;  1FV2 A;  2WO1 A;  1OKQ A;  2J1V A;  3RFR A;  1CZT A;  2DCK A;  1K5M C;  1PVC 1;  1TNF A;  3MLJ A;  5CKM A;  1DYO A;  1S2E A;  3U11 A;  5FLI A;  1W6Q B;  3H1Y A;  5FYV A;  1CAU A;  5C6C A;  1GQP A;  1OC1 A;  1PO1 3;  4QQH A;  4D3W A;  4QX5 A;  5A6Y A;  5DUW A;  2Q4S A;  1EY2 A;  2ADE A;  3VHR A;  2OZJ A;  3OYW A;  4X6Q B;  5FZ0 A;  3WNN A;  3NKG A;  3L9J T;  4RQP C;  1QOT A;  3N4M A;  5C9A C;  1VB2 A;  2XVG A;  2K2S A;  3ZFF B;  2WRA A;  2VZV A;  3LOI A;  3R4S A;  1UY2 A;  1XNK A;  3C7G A;  3QAC A;  1SBD A;  3M3C A;  3RS6 A;  1ZBA 1;  3VZM A;  4EN0 A;  5C3Q A;  5FY0 A;  4AED A;  3AZZ A;  4AFA A;  2HWC 2;  5D1I A;  5FXW A;  4ZXE A;  4HZF A;  4ZKT B;  1PGW 2;  3TNP B;  2B5H A;  1H8T C;  4E8C A;  4LHS A;  2RDR A;  3SQO A;  4PF5 A;  5KHJ A;  2EF6 A;  4HON A;  4XTP A;  4I3G A;  5DUX A;  1RUD 1;  4QDR A;  4YM3 A;  4Q2F A;  2ZZQ A;  1W8U A;  3VKL A;  2VZQ A;  3GJB A;  4XHB A;  5LBE A;  1YJL A;  1ULP A;  1BHG A;  2C5D A;  2IFW A;  2VZT A;  2NMO A;  2RMU 3;  3KT1 A;  4YGB A;  3WDU A;  4CXX A;  3JB4 C;  4CCK A;  3X29 B;  4L99 A;  2JDZ A;  4HAN A;  2PFW A;  1LOA A;  1V00 A;  3H1W A;  1ND2 C;  1Y9G A;  1W06 A;  4AI1 A;  2RMU 2;  3SKV A;  1QNY A;  4QDQ A;  4CSW A;  5GZC A;  5J1X A;  1OKO A;  3LEK A;  4XUR A;  5CYY A;  2FDH A;  1HB2 A;  2V5Y A;  2ZJC A;  1QXJ A;  4QMA A;  4BE3 A;  1V6M A;  3PHM A;  1OUR A;  5IK5 A;  2VR4 A;  1D0G A;  1FNY A;  2WDB A;  3OUI A;  4QPI A;  4AF9 A;  4AI0 A;  3AYC A;  2PHT A;  5IAT A;  2ZGT A;  4IEX A;  4CP0 A;  4CDU A;  4Q0Q A;  2ZGU A;  2TUN A;  3FHQ A;  1UYP A;  2ZAB A;  4JKK A;  5F1R A;  3UK9 A;  4Q4X 3;  1Q8Q A;  4QT6 A;  3UGH A;  1G8W A;  2E6V A;  2BOI A;  2ZMN A;  3ZR5 A;  2A71 A;  2ARC A;  2X8K A;  3GM8 A;  2D6M A;  4KWK A;  4AK3 A;  4Y1U A;  2QQP A;  2YGL A;  2XWJ B;  2ORZ A;  2V72 A;  4UAP A;  4HXC A;  4QXH A;  4Q4X 2;  3IMM A;  1D0H A;  4ERO A;  4DUV A;  5JLV A;  2OT7 A;  4MXW A;  4Y1V A;  1FPN 3;  1BLZ A;  3FLR A;  1JZ8 A;  3ZYI B;  4CU6 A;  3GDB A;  3S57 A;  5CZK A;  4RS5 B;  2AGS A;  2DBN A;  3VB9 A;  3L2Y A;  5F37 A;  1EV1 3;  1HXS 3;  1RUH 2;  1W6O A;  1DHK B;  1UZ0 A;  2PAM A;  4Q26 A;  4YW6 A;  4HFS A;  3PJY A;  3WEZ A;  4JQT A;  2ZGR A;  1RUO A;  3HT2 A;  1MR5 A;  3BGA A;  3VDB A;  1FPN 2;  1ENQ A;  1OOP B;  4OI1 A;  5LY1 A;  5FPZ A;  1I9R A;  4OUM A;  5FAX A;  1LEN A;  3BYW A;  3KB5 A;  3PMS A;  3RRD A;  1EV1 2;  1HXS 2;  1JS9 A;  2C24 A;  4IV3 C;  2QJV A;  5FZB A;  3SNM A;  3AZX A;  3ABZ A;  3VBF A;  3WQ1 A;  2XVL A;  1QJY 3;  5EJ3 A;  1LED A;  5A3N A;  5C71 A;  4KGG A;  4O61 A;  4XJA A;  4BJ0 A;  3NO8 A;  2JE8 A;  4OFG A;  2Z4F A;  4UFL A;  1S2B A;  4ZON A;  1FNZ A;  4ATF A;  2E32 A;  1MEC 3;  4TSV A;  1B35 C;  4YM0 A;  4B7E A;  1DU3 D;  5FZA A;  1W9W A;  3VBU A;  1GZ9 A;  4Y4R A;  3RJR A;  1DZQ A;  4B7K A;  2GND A;  5JI9 A;  1QJY 2;  2GC1 A;  4RR3 A;  3O5S A;  3OBR A;  3VBS A;  4QB1 A;  4XZU G;  1U12 A;  3FLT A;  4XXP A;  5BNN C;  5A3T A;  4XCB A;  1MEC 2;  1LOG A;  2A3W A;  1XJA A;  2EXH A;  2IXJ A;  2VTX J;  1G9B A;  3O1P A;  2QQL A;  2YY1 A;  3POI A;  1RUI 3;  4HK8 A;  4H2A A;  5FZH A;  5HCB A;  1DLL A;  5DG1 A;  3ZPO A;  3ZXG A;  1F35 A;  5FY4 A;  5K0U C;  4FPC A;  2R1D A;  2FMD A;  4PIZ A;  4EWD A;  3T4H B;  1J3Q A;  1ZZB A;  5FY9 A;  3CF6 E;  5A32 B;  2N7G A;  1E5R A;  2X05 A;  1RUI 2;  5CG8 A;  1ZZ8 A;  1CPN A;  5GLV A;  3T0B A;  5T55 A;  4WBB A;  5ANQ A;  4R4X A;  4NIA A;  1I6X A;  5T3N A;  1UZY A;  3ZFG C;  1UWW A;  3MO4 A;  4JCK A;  1OA4 A;  4RL7 A;  1NXD 1;  4F7Z A;  5L36 A;  4WM8 C;  3CIH A;  1DBN A;  3T3Y A;  3ZDV A;  2B8M A;  3BI3 A;  2YZ4 A;  3K4A A;  1DQ4 A;  5C4W B;  5BXX A;  4ZU7 A;  2PQS A;  1JU4 A;  1QQP 1;  2VJX A;  1SLT A;  1SAC A;  1SLL A;  4JRA A;  4D7S A;  1N1Y A;  1W3V A;  1CZS A;  2H0V A;  1HRI 3;  1QJU 3;  3H8U A;  3K48 A;  3LB9 A;  3W58 A;  2NMN A;  4QKB A;  4M3C E;  5D21 A;  2P6C A;  1AX2 A;  1NCQ C;  4XET A;  3T2T A;  2YU1 A;  4AG4 A;  4A6O A;  5LRS A;  2VQ0 A;  3NRU A;  3U07 A;  2GME A;  3GNE A;  1QKQ A;  1HRI 2;  1QJU 2;  4ONU A;  4QX3 A;  1OF3 A;  2PHW A;  4N9H A;  4GWI A;  4JDM A;  1S0D A;  4AI2 A;  1YUD A;  4BH9 A;  5FOJ B;  2R07 1;  4V1P A;  4L9B A;  2WSV A;  3KCX A;  4UF0 A;  2JKX A;  2YFZ A;  1H9P A;  3AMM A;  1KXG A;  4K21 A;  4CA9 A;  4KG0 A;  5CFC A;  2ZAA A;  4XDQ A;  5JSO A;  1KGY A;  1X36 A;  2D3R A;  1JZ2 A;  3ZFE C;  4LBQ A;  2P3Y A;  4N43 C;  4XXA A;  5CNA A;  3B9C A;  4K1Z A;  1UU4 A;  2OVU A;  3D3A A;  4R9A A;  3WHT A;  3RZG A;  5FQ0 B;  1GP6 A;  3N7L A;  3OYW B;  3ZYR A;  5FOB B;  1H1I A;  2FHR A;  2LTN A;  2J1S A;  2WO2 A;  3NNL A;  2C9A A;  1WA6 X;  1UL9 A;  2Q30 A;  4OUL A;  5ERL A;  1PMI A;  3B01 A;  1R64 A;  2DDU A;  1FAY A;  3CJI B;  1AJO A;  2WZR 1;  3KLS A;  5F3I A;  3IB3 A;  2SLI A;  3I2K A;  4Y5S A;  4AEJ A;  1GNY A;  4PIY A;  4QQO A;  1JU3 A;  4Q4V 1;  4WVZ A;  5I0T A;  4AED B;  2JG9 B;  3WG4 A;  4HN1 A;  1XNT A;  5IAV A;  5ISL A;  4CTE A;  5C70 A;  3OUJ A;  4ES9 A;  1YFX A;  3D6E A;  2Y8K A;  4JGY C;  4LO8 A;  3KMH A;  3Q8B A;  3LF7 A;  4F83 A;  5LA2 A;  1PGS A;  1DF0 A;  2ZMK A;  2XQR A;  1PO1 1;  1UPI A;  3ZXJ A;  1W04 A;  4FBF A;  2F6B A;  2XVK A;  2R49 A;  1ND3 C;  2BGC A;  3HAG A;  3WZ1 A;  4CE8 A;  2GZW A;  1YQ5 A;  1BYH A;  2VZR A;  1H2N A;  2XLF A;  3B94 A;  3BN6 A;  3Q8C A;  4V2W A;  4AGR A;  5JSR A;  1PGW 1;  4W6W A;  2D5H A;  1SBF A;  3WF1 A;  2ARX A;  4EYU A;  1QJZ A;  1RUJ 1;  1W9F A;  2GN3 A;  2WT0 A;  3BOW A;  5DQ0 A;  2OA2 A;  2Q5T A;  5F39 A;  2A6V A;  3IAQ A;  2HEV F;  4IV1 C;  4PI0 A;  5CKQ A;  3MLK A;  3B02 A;  2DUQ A;  3B93 A;  3P6B A;  1QH7 A;  4PDW C;  3VZL A;  4S2G A;  5JSP A;  3RZK A;  5F2S A;  5AVA A;  4R8H A;  1SQ4 A;  3LPF A;  1IS6 A;  2Z2S B;  1OA3 A;  3FN9 A;  2VAU A;  1IS4 A;  2B39 A;  3ACG A;  2ZX0 A;  4P08 A;  2RMU 1;  4Y22 A;  3OD4 A;  3VD3 A;  3ZOI A;  5C33 A;  1VMH A;  1OD3 A;  4DIQ A;  1W8T A;  2E33 A;  5C3S A;  4ES8 A;  2WFF 3;  1XU2 A;  3I3E A;  3OPZ A;  3WW2 A;  1RVF 3;  1WD3 A;  1PGL 2;  1OUX A;  2WIN B;  2R32 A;  3BTY A;  2JB4 A;  2XJQ A;  3III A;  1AF9 A;  1Q43 A;  3IN9 A;  2BOJ A;  2VD7 A;  1GOH A;  4BDV B;  1VE0 A;  2DTW A;  2RHP A;  1NA1 B;  3IDE A;  1ENX A;  2WFF 2;  2YYO A;  5GLU A;  3LEG A;  3WT3 A;  2Q1F A;  2OUJ A;  5D8A A;  1RVF 2;  5FPA A;  4CCC A;  4XF0 A;  1GYK A;  3AXD A;  5JIU A;  1N3P A;  2BU9 A;  3N9M A;  3WDW A;  4CCM A;  1JMU B;  2QNK A;  4ASK A;  4QPG C;  4CPB D;  4XOG A;  3J4U H;  2YFU A;  4CDQ B;  2VXR A;  4Q4X 1;  1VLN A;  3BAL A;  5JXG A;  1G6N A;  1NX9 A;  2PHD A;  3O0W A;  1UX6 A;  3BU0 A;  4XIK A;  4Z8B A;  1LKN A;  3NMB A;  3AKS A;  3BKZ A;  2QVS B;  2AEN A;  3EB7 A;  1UZV A;  3H1M A;  4QXB A;  3WQB A;  4HBN A;  3D0S A;  1OUS A;  2D3P A;  3LSE A;  2QTW B;  3W20 A;  1UMI A;  3GZE A;  2NYY A;  1H30 A;  5CFD B;  1ZRE A;  3ACH A;  5FP9 A;  4GKX A;  1O7F A;  1V6N A;  2JG8 C;  1H8V A;  3KVB A;  1AL2 3;  4LQR A;  5FO8 B;  1R1A 3;  5FYB A;  1EV1 1;  3CDZ B;  3WW1 A;  2Y0O A;  2XJP A;  2R06 3;  2A73 B;  1Y7B A;  5EV7 A;  1C5I A;  3MUY 1;  2XLG A;  2D3S A;  2CHH A;  3H8X A;  4IND A;  3KHC A;  1AL2 2;  2D7F A;  1LR5 A;  2DFB A;  4LK7 A;  3ZO0 B;  1R1A 2;  3B00 A;  3IZO A;  4Y24 A;  4BHP A;  1PMH X;  3I2G A;  2R06 2;  5I8S A;  3L2H A;  4FT8 A;  3O1R A;  3CMG A;  1U5I A;  4HOO A;  2VBD A;  1ULF A;  3DKQ A;  5BNP C;  1O3Q A;  2QBX A;  1J3R A;  2IVJ A;  4RHV 3;  5GZG A;  1NLR A;  2YPJ A;  2ATF A;  5FLH A;  3DUI A;  3U1X A;  3PUQ A;  5APA A;  3P5B A;  5FXV A;  4EE2 A;  2A6X A;  1TG7 A;  4GB3 1;  4XIO A;  2QKD A;  2EIC A;  4RHV 2;  1GQH A;  4D69 A;  1NZC A;  3FE5 A;  3MW3 A;  1XE8 A;  4F3J A;  2PHU A;  3AX4 A;  4B4R A;  1R08 3;  4JVA A;  3A0N A;  5FKC A;  1TME 1;  2ARE A;  3ZIX A;  1LHU A;  1Q56 A;  3USU A;  3ZKU A;  1SFN A;  1V6K A;  2X53 S;  2WN3 A;  4Q0P A;  5FBZ A;  4P9Y A;  4FPF A;  3ZSJ A;  5FP4 A;  2ZGL A;  3LWC A;  4UW3 A;  4G9S B;  5T5P A;  3PIG A;  4ZS2 A;  2DVF A;  5T5O A;  4DNY A;  2P1B A;  5DAP A;  4B1L A;  2FZ1 A;  1YYN A;  3KV6 A;  2XR4 A;  4OCT A;  2LM3 A;  3MLL A;  1U5Z A;  2RS1 3;  5CKN A;  3SCH A;  2E9Q A;  4AHZ A;  1UZW A;  3O1U A;  1L7Q A;  1S55 A;  5BNN B;  4FP3 A;  5FP8 A;  4Q5O A;  3U4X A;  3AZW A;  3QCW A;  4FAG A;  1IG0 A;  2FBE A;  3BOP A;  4MGI E;  5A3W A;  5IT6 A;  3LE0 A;  2PAE A;  2W68 A;  2RS1 2;  3E6B A;  3M3E A;  3VBR A;  5C8C C;  1NQJ A;  2BEO A;  2XON A;  4GZ9 A;  4KBB A;  5JXH A;  4L8Q A;  2X5I A;  4CUA A;  1KEX A;  1ZM1 A;  1JOP A;  2MEV 1;  1RED A;  2ZX1 A;  1PVC 3;  4DEQ A;  1Y9Q A;  5FZO B;  4DUX A;  1FT9 A;  5K0U B;  2Z79 A;  5FIX A;  1POQ A;  1YRZ A;  3VD5 A;  4FPE A;  1LU1 A;  2LW8 A;  1IKQ A;  2BTV C;  4K40 A;  2JWP A;  2JDN A;  1J59 A;  1PVC 2;  1UOG A;  2C9K A;  4OZO A;  3VDD A;  2RDN A;  1US3 A;  2IXL A;  4J25 A;  2ENR A;  1RUF 1;  2VOV A;  5T54 A;  4NAO A;  4Z2W A;  3HNY M;  3PVB B;  5JIA A;  5LZ6 A;  5B4X A;  1RUG 1;  1S2K A;  1OPM A;  3RZH A;  1HQL A;  4MHR A;  2VVE A;  1HIX A;  4HSL A;  5SV5 A;  2FMY A;  1BK1 A;  3AVR A;  3IKW A;  4LKD A;  4XDP A;  4AL9 A;  5LWB A;  1O3R A;  2F4L A;  4GWJ A;  1SFY A;  4JKL A;  1GOG A;  4FXK B;  4LIT A;  4MLO A;  1NCQ B;  1AR7 1;  2VW1 A;  2D98 A;  2WA3 A;  3DKW A;  3VGI A;  1YJK A;  3APB A;  3ZMN A;  2RS3 3;  1VBB 1;  1BBT 1;  4A45 A;  5F8P A;  5FZE A;  1W6Q A;  3WP5 A;  4ZZ8 A;  2BPA 2;  4TLF A;  3RWN A;  1KIT A;  3WVJ A;  3WP4 A;  1CES A;  4QAW A;  1GV9 A;  1W0N A;  2EXK A;  2ZS6 B;  4IQP A;  1E57 A;  4PBP A;  5G04 L;  3OD0 A;  4AFC A;  1WMF A;  2VUJ A;  1VMJ A;  1AHS A;  3ECQ A;  1DYP A;  1GFF 2;  2W08 A;  1PIV 1;  5E16 A;  2AH2 A;  4CCN A;  4XUT A;  5L7O C;  3GCW A;  5LBF A;  3BTZ A;  2LRO A;  5F3G A;  3AZV A;  3ZYF A;  2WKK A;  2B4K A;  4OMD A;  1CAV A;  2WC2 A;  3RPQ A;  3ZFF A;  2B9V A;  3ZFE B;  3POF A;  5I91 A;  2HWF 1;  4KMQ A;  4Y22 B;  3RQ0 A;  5KXD A;  1YIP A;  4YW5 A;  1JI6 A;  4E4Z A;  1NE4 A;  3VZN A;  4TTG A;  1H2L A;  3TB0 A;  2BBV A;  1H2M A;  4XE9 A;  1S0E A;  3C8X A;  3OPW A;  4CP2 A;  4O9E A;  4YG6 A;  1OHF A;  3G6J B;  1LHV A;  2YC2 A;  3H9A A;  1JYV A;  5CIS A;  1SG3 A;  2X09 A;  5DAX A;  1TNR A;  4A6S A;  1RUC 1;  2QQO A;  1JOJ A;  1PZ9 A;  1XSQ A;  5T50 A;  2Y34 A;  3A21 A;  3AK0 A;  5AC9 3;  3SXW A;  1HN0 A;  3HEI A;  5HXM A;  3H0O A;  4RGK A;  5D8A B;  2VQA A;  1OVS A;  2CL2 A;  5IUQ A;  4A2U A;  4E9K A;  1SEF A;  2IXI A;  4PF1 A;  2ZKL A;  3J7H A;  1Y43 B;  3AKP A;  3U75 A;  4C1X A;  3WX5 A;  4GJY A;  2FCV A;  2GAL A;  4BQ2 A;  2FDG A;  3PVE A;  4K9S A;  1F2N A;  1IGO A;  4OLL A;  5I93 A;  5J09 A;  3PL0 A;  4NRP A;  4P5H A;  1PGL 1;  4MV2 A;  3ILR A;  4LHN A;  4DPN A;  1LTE A;  4CP9 B;  1ND3 B;  1CPM A;  3KV5 A;  4QX7 A;  1KS4 A;  3H3U A;  2WFF 1;  4NPR A;  2BVB A;  1W2T A;  2BRT A;  3FFZ A;  4ZS3 A;  1ZRD A;  5FUI A;  2WJS A;  3JD7 3;  3NWK A;  5FWJ A;  4AEK A;  2FDK A;  2D43 A;  3EQE A;  2Y6G A;  2JJ6 A;  5A80 A;  5GZE A;  4J1X A;  3J8F 1;  1BVV A;  5FPB A;  2P2K A;  4JTO A;  2W9X A;  4LXL A;  4PI2 A;  4PDW B;  3T30 A;  5L9B A;  3JD7 2;  1JYW A;  1H0B A;  2XUE A;  3ACI A;  4YW7 A;  5GAL A;  1FXZ A;  2VMG A;  2BYV E;  5FZL A;  1W28 A;  2QQW A;  1IQD C;  4UBG A;  2BNM A;  4N8M A;  4OHX A;  1T6B X;  4RGG A;  1VBE 1;  2DV9 A;  1OXC A;  4IE6 A;  4YVW B;  3UKT A;  4AE2 A;  4XUO A;  4E2G A;  4IEP A;  1UAI A;  4RS5 A;  4DRR A;  3RDI A;  2JKB A;  1CQ9 A;  3I8T A;  1GNH A;  3DV8 A;  4NII A;  3AYA A;  5A7W B;  3HBK A;  1NCR C;  1QMJ A;  4ISR A;  1KDM A;  5FMD A;  5JZG B;  1K3I A;  2DUP A;  4YRD A;  4WZF A;  2YV8 A;  1Y3T A;  5H9R A;  3SKJ E;  1MZ6 A;  5LB6 A;  4BPZ A;  2YG0 A;  4CU9 A;  3OTF A;  5FYC A;  3J7L A;  2NN8 A;  4P5Y A;  1TZO A;  2BJS A;  2Y0I A;  5CAD A;  5IHR A;  1OSG A;  1G7Y A;  2R06 1;  4Y5T A;  1MQT C;  3BIW E;  3CJX A;  1Z0H A;  4LUK A;  1WGP A;  3FUQ A;  1WCK A;  3R0R A;  4KBZ A;  1JTZ X;  4XCA A;  4NHM A;  1FI2 A;  4GAZ A;  4NUB A;  1SHW B;  3VKF C;  3NAP C;  1ASJ 1;  2RG4 A;  5TSW A;  2RM2 1;  3MHZ A;  1XOY A;  1JYC A;  4IES A;  4RHV 1;  2Q8D A;  4BWO A;  2JIG A;  4CEY C;  4C91 A;  4JC1 A;  4Z82 A;  4CDW B;  2RDQ A;  4AFM A;  4HKO A;  4COZ A;  3CZU A;  1YLL A;  2VNR A;  1W05 A;  2QFE A;  4HKW A;  2WNV C;  3WQ7 A;  3OB8 A;  4BLI A;  2KXL A;  1F5J A;  2PLV 3;  1MS0 A;  4Q8K A;  5C5T A;  2XDV A;  3OOX A;  5A32 A;  5B4N A;  1PX4 A;  3K46 A;  5F9T A;  4N53 C;  1RUN A;  2UYA A;  4P9J A;  5CIR A;  4LOT A;  4LUM A;  4MYE A;  1GAN A;  3QH7 A;  4YFZ A;  2FCU A;  1R08 1;  3CLP A;  3POG A;  4CRQ A;  2H6B A;  4EJR A;  1NT0 A;  4E8D A;  2PLV 2;  1UIJ A;  4YPJ A;  1DGL A;  3ZMO A;  3ENR A;  5EPA A;  5F5C A;  4BCU A;  5F6K A;  1FOD 1;  3OBT A;  1DP0 A;  2OQ6 A;  4LLF A;  5C4W A;  2FDI A;  1VPH A;  2HBU A;  2VBP A;  4R9C A;  3AMP A;  2VOK A;  2WZE A;  2HEW F;  1CIY A;  3U14 A;  2VTF A;  3VBH C;  1CWP A;  2ET1 A;  2UWC A;  4X6R B;  5BNP B;  5JMC A;  2AAC A;  4N7I A;  5FPL A;  4IET A;  5FZG A;  4AYU A;  2MNG A;  4A7K A;  5JXI A;  1DIW A;  1DG6 A;  1OT5 A;  2JIJ A;  3WNL A;  4A3Z A;  2WZR 3;  2YRO A;  1AX1 A;  4IE7 A;  1X9P A;  1C1F A;  2HYK A;  1UKR A;  3WW4 A;  4GXL A;  4HL0 A;  4AI8 A;  2LS6 A;  4DIN B;  5DAQ A;  4L0P A;  1UOF A;  4E4H A;  1H1M A;  1NY7 2;  1ULO A;  2D97 A;  2XKP A;  3DPR C;  4WVM B;  2VO5 A;  3WNO A;  2WZR 2;  3W5N A;  5FZF A;  3LFM A;  3T0D A;  4LO6 B;  5I0R A;  3S6P A;  2BVV A;  4FP2 A;  1W9S A;  4LKF A;  4MO3 M;  4XIL A;  4Q4V 2;  2XUM A;  1JW6 A;  2ZEW A;  2ZXQ A;  1I1E A;  1XC6 A;  1JH5 A;  3OCP A;  4XQ4 A;  2WQ8 A;  4HKL A;  2ZGK A;  3JBG 1;  2W1U A;  5I0D A;  5FQ0 A;  4OUS A;  1GZW B;  2WA4 A;  3OEB A;  4XMI A;  1N3O A;  4QX2 A;  2NZ9 A;  2VZO A;  3J26 N;  3NKT A;  4LO7 A;  3H8O A;  1EUU A;  1PO1 2;  3CJI A;  5HCF A;  1NG0 A;  2XKO A;  1H4H A;  1CAV B;  3OPT A;  4QPI C;  5FZ3 A;  5K4L A;  2EVX A;  1RUJ 3;  2A7A A;  3NJX A;  3RWK X;  1MVQ A;  2UWB A;  1LU2 A;  2W47 A;  2Z5W A;  4I0A A;  1QY4 A;  2YBS A;  5CVR A;  2ADD A;  2JG9 A;  4J6G A;  3HQU A;  3R6S A;  4QU2 A;  2VNG A;  4CDU C;  5GKA C;  3I97 A;  5C3P A;  5FFO C;  5F3E A;  4BIF A;  1YC6 1;  1REE A;  2VEC A;  2OKX A;  4ZHN A;  1RUJ 2;  2JEM A;  4P9G A;  4IL7 A;  4ORF A;  4AGV A;  3RI9 A;  4LHL A;  2RS3 1;  3W9A A;  5FBJ A;  2WUH A;  3OG2 A;  1Q8P A;  2E7T A;  4MSV A;  4KL1 A;  3WCS A;  4AVC A;  1CR7 A;  4YYO A;  1UCX A;  3OGV A;  3HMY A;  4Q27 A;  2PTM A;  3PNA A;  3E6C C;  3HOB A;  3T1L A;  1K5J A;  2YU2 A;  4NPM A;  2X29 A;  4YW4 A;  5H9Q A;  1GIC A;  2AEY A;  1FYU A;  3FC0 A;  2GMM A;  5C3R A;  5IVV A;  2ZCW A;  4O9G A;  1CD3 G;  2DFC A;  1TMF 1;  4XF4 A;  3BU7 A;  4YW3 A;  3VBO C;  3I3Q A;  1LES A;  3H50 A;  3VHN A;  1J3P A;  1YIF A;  5GLZ A;  4CCJ A;  4CUG A;  4YZ1 A;  1G9A A;  4IDZ A;  4GD4 A;  4AOC A;  5IFT A;  1JN2 P;  4C8D A;  1D2S A;  5IVC A;  1DGR N;  4DS0 A;  2XPJ A;  3VBF C;  3CQO A;  1J83 A;  2RDS A;  3OJB A;  1X7N A;  4NO4 A;  1AYN 3;  2ARB A;  1S4C A;  3C7H A;  3PLQ A;  1LRH A;  5AC9 1;  2JB8 A;  3UYJ A;  3VBU C;  1GBG A;  5KHH A;  4D6S A;  3OF1 A;  3RYR A;  1QJF A;  3VBS C;  5LEK A;  4Q0S A;  3KCC A;  2WZP P;  3WDY A;  1AYN 2;  1FX5 A;  2K9Z A;  5FZD A;  3SEE A;  5L7O B;  1LOF C;  1Y4W A;  1HJF A;  2WT2 A;  2OPW A;  3H3Z A;  4BYY A;  3UJO A;  1G9F A;  4PLN A;  4IE4 A;  1P8J A;  2E53 A;  5EYY A;  1WMX A;  4XBQ A;  5JI7 A;  3H8R A;  3HN1 A;  1NA1 A;  1TE1 B;  4IUG A;  2VOT A;  3POE A;  1H8T A;  3KVA A;  1QDC A;  1OVP A;  3INA A;  4NHK A;  2J1U A;  5H9P A;  1QH6 A;  1SLB A;  3JD7 1;  3WD5 A;  2WZ8 A;  3ZXF A;  1YHF A;  3MIE A;  3MV1 1;  4XBL A;  2XL9 A;  3GAL A;  1RL3 A;  4ZXK A;  4CDQ A;  3S30 A;  3WXP A;  3A0K A;  1OLQ A;  4DFS A;  5FUN A;  1QNW A;  3PJQ A;  1ZZC A;  2WT1 A;  3I7D A;  2E7A A;  3NL1 A;  2XML A;  4ZZ5 A;  5IVB A;  2PHR A;  4CDX C;  4NR1 A;  5HV0 A;  2DYC A;  3JQW A;  5FP7 A;  3DCQ A;  2UWA A;  3A7Q A;  4XFF A;  5CFD A;  2NQY A;  4E2S A;  1AYM 3;  4GB3 3;  5JPM B;  4CCO A;  3ZXE A;  4D6Q A;  3UKV A;  4BQ3 A;  1STM A;  1ZZ9 A;  1UN1 A;  3GZA A;  4RSU A;  3T2O A;  1TME 3;  1I5P A;  2BV4 A;  3I3B A;  1ZA4 A;  4OUE A;  5FZ7 A;  3IMN A;  2D44 A;  3PVN A;  4A7Z A;  1AYM 2;  1OLR A;  4GB3 2;  1GWK A;  1W8O A;  5F7U A;  3WF3 A;  4A42 A;  1Y9M A;  4FQZ A;  5T5L A;  5LA0 A;  1HX6 A;  3R4D B;  4L92 A;  4ZU5 A;  5JVV A;  2V4A A;  1TME 2;  4HVR A;  3LDB A;  5CFC C;  1H2K A;  1O59 A;  1UD1 A;  3LA7 A;  5DPN A;  3R05 A;  3RZM A;  1HKD A;  3FMG A;  5A3O A;  5FRE A;  1LCL A;  1UY0 A;  1EP0 A;  4AW7 A;  3GHN A;  1GR3 A;  3OGG A;  4AVT A;  2GMP A;  3H7J A;  4WZC A;  5AFB A;  1CX4 A;  4URT A;  1BZW A;  1WD4 A;  1ENR A;  1LGB A;  4M4R A;  1HB4 A;  5SV8 A;  3S7I A;  2XJU A;  5FRA A;  4QX8 A;  3LA2 A;  4E4D X;  3LZZ A;  2A6W A;  5F3C A;  1NCR B;  1OI6 A;  1RXG A;  4H55 A;  4KWU A;  1U0A A;  4CZS A;  4OQ9 A;  4G4F A;  2VUC A;  2MEV 3;  2Q8O A;  4DMI A;  4QGM A;  4M00 A;  5DG2 A;  2PLV 1;  3C7F A;  4E2Q A;  4IV3 A;  1SLA A;  1PK6 C;  3NNJ A;  2D6L X;  3I3M A;  4F8A A;  2ZGO A;  5A7S A;  5EQU A;  5JOZ A;  5CEH A;  4AHX A;  1ZZ6 A;  4GH4 B;  3RSJ A;  2HYX A;  2MEV 2;  2ZBJ A;  4I02 A;  3KM5 A;  4X8P A;  5I0S A;  2CTV A;  4EN7 B;  2EID A;  4UFM A;  3GXU A;  1RUF 3;  5LY2 A;  4ISQ A;  4QM9 A;  4O7X A;  4B29 A;  2BDR A;  3ILN A;  4K8R B;  3CNA A;  5FV3 A;  4AQS A;  4EWA A;  4JHZ A;  5DUU A;  3VUO A;  1NUK A;  5BNN A;  1RUG 3;  1UY4 A;  4NVP A;  3SMH A;  3TRS B;  4CUC A;  3NV4 A;  1IPS A;  2VVD A;  2WNU B;  1UYZ A;  3IPV B;  4CYD A;  3KQ4 B;  4TXW A;  2XBO 1;  4JKM A;  5KWR A;  1RUF 2;  4P9W A;  3NQH A;  4BB3 A;  1W8F A;  2VTX A;  1HV1 A;  1Q8O A;  2ZEX A;  1NY7 1;  4ZY9 A;  1AR7 3;  1QWR A;  1E5I A;  3AFG A;  1LHO A;  3J7N A;  2WNV B;  1RUG 2;  3LIG A;  5FZO A;  1VBB 3;  1BBT 3;  1PHM A;  5K0U A;  4CDW A;  3MEP A;  3V64 A;  2RJL A;  2EIG A;  2VBB A;  3D82 A;  3JB8 A;  4N53 B;  4R9B A;  3BVC A;  1AL0 G;  4D7Y A;  5FZK A;  3F95 A;  2Y6J A;  1F4A A;  1AR7 2;  1UW8 A;  2DVD A;  3MIB A;  3VV1 A;  5EJZ B;  1VBB 2;  1BBT 2;  2E51 A;  4MVT A;  1PIV 3;  4CUB A;  2J22 A;  4K8F A;  5DAB A;  4CPB A;  1K42 A;  2JD9 A;  2EA7 A;  2BQP A;  2HWF 3;  1GP5 A;  4CCD A;  1JYN A;  3VBH B;  3ACL A;  3FL7 A;  1VRB A;  5EP9 A;  3OGJ A;  1PIV 2;  4FOQ A;  4TWT A;  4M4P A;  4UYB A;  4AXO A;  4HG6 B;  2QQI A;  5FXZ A;  1NCQ A;  2AEZ A;  3MW4 A;  2HWF 2;  1W6N B;  4Y26 A;  4YG3 A;  3K3O A;  3N3H A;  4FFF A;  1CJP A;  2JDY A;  2VQU A;  3ME2 A;  4JX0 A;  4L11 A;  4XC9 A;  3UL2 A;  2ORX A;  1RUC 3;  3PDQ A;  4ATE A;  4R4Z A;  2RE9 A;  4KNC A;  3POJ A;  4XFB A;  1XNA A;  5FK7 A;  3HWJ A;  3DPR B;  4LNV A;  2PN5 A;  4UOJ A;  5KBF A;  1XXN A;  1F8V A;  1K5M B;  3ALQ A;  3WDT A;  1W90 A;  4AR2 A;  4YZ2 A;  2ZGQ A;  1ZZ7 A;  2FQP A;  2A75 A;  3P1I A;  4FXG B;  1DGW X;  1RUC 2;  3BUC A;  1F15 A;  4Z2A A;  4LUL A;  1VBC 3;  3MV0 1;  2WII B;  4DEV A;  1AVB A;  1AUY A;  3Q8F A;  3ZFE A;  3EHK A;  5LA1 A;  1N1V A;  2HKX A;  3GYD A;  4MGY E;  2YBP A;  5DZF A;  1PNF A;  2QZ2 A;  2V4V A;  5J36 A;  4NWV A;  1GNZ A;  3PUR A;  2WAA A;  1DGR A;  1SBE A;  2NM1 A;  1VAM A;  4XAE A;  4XDO A;  5FZM A;  4COU A;  2VW2 A;  3FUO A;  1UIK A;  1ULE A;  4RQP B;  1H6Y A;  1CZV A;  3B9I A;  2BGP A;  5C9A B;  5HXV A;  3S5Q A;  4WVV A;  1GLH A;  2ZGP A;  1OQE A;  3O1M A;  5IJR A;  1WW7 A;  3WUD A;  5ACA 1;  3SLI A;  2CY6 A;  3J8F 3;  4JGZ C;  2YDE A;  1ALY A;  2OYZ A;  1V6L A;  1BEV 3;  1S0B A;  2XHN A;  3DYM A;  4K7J A;  1SDD B;  1H8T B;  3N9L A;  2VE1 A;  1V9U 1;  5FZ4 A;  2WNE A;  3FLP A;  1Q8V A;  3POW A;  5FLJ A;  5C8W A;  5DXD A;  3TOJ A;  4LBN A;  2GU9 A;  5FJH A;  1D2Q A;  3EXU A;  1AYN 1;  3J8F 2;  1VBE 3;  4GAL A;  4A3X A;  4EZH A;  3BPS A;  5BNO C;  1RUE 3;  4AI9 A;  4EN9 B;  4XAC A;  4BU2 A;  1K12 A;  3C2U A;  4CP9 A;  1ND3 A;  2VUA A;  4BM8 A;  1YNA A;  2C4X A;  4XYX A;  3K75 B;  4NN0 A;  5JXJ A;  4HLT A;  1DFQ A;  1VBE 2;  1W03 A;  3UET A;  4BQX A;  4FTS A;  1ND2 B;  2RS5 3;  4LBJ A;  1RUE 2;  3ORJ A;  4A44 A;  1WW6 A;  4K1Y A;  5GZF A;  4BQY A;  3VBO B;  1JYX A;  5KHG A;  3HIF A;  1J1T A;  4AQT A;  1SMV A;  2DCZ A;  5KHI A;  5FYZ A;  3WP3 A;  1XRU A;  2WWJ A;  4QWN A;  4M3C B;  4HVQ A;  4CEW C;  5E89 A;  2RS5 2;  2QUO A;  4PDW A;  1IG3 A;  4MHU A;  4MET A;  1S0C A;  1PO2 1;  1AXY A;  2DCJ A;  3VZJ A;  4AAP A;  3DYO A;  1GSL A;  4YVW A;  2VXJ A;  1SPP B;  1URX A;  2XG3 A;  1ASJ 3;  3ILF A;  2WO3 A;  2R6Q A;  3UT0 A;  2RM2 3;  3MGU A;  1S0I A;  5E8A A;  4GA9 A;  3FZ3 A;  3LD8 A;  1OA2 A;  3I3D A;  2BWC A;  4S2F A;  1DQ2 A;  5FZI A;  5A7W A;  1KFX L;  1HN1 A;  3RG0 A;  1ASJ 2;  5JZG A;  5KC5 A;  2PHL A;  4DXS A;  2RM2 2;  5FYM A;  4P14 A;  1JUH A;  3LIH A;  3KZ4 C;  3THP A;  1W2A X;  1AYM 1;  4LE4 A;  1FMD 3;  4CU8 A;  2X5I C;  2HJI A;  3VD9 A;  3MIH A;  4AVS A;  5HCA A;  3CL1 A;  1O91 A;  4WV8 A;  3U10 A;  5CA6 A;  4XFH A;  2R0H A;  4ZPI A;  2R04 1;  2RR1 3;  2XLA A;  3BTA A;  3KF5 A;  1E5S A;  5DN2 A;  1FMD 2;  4OYU A;  4XHX A;  3AJY A;  2G9F A;  3ZX7 A;  4QHO A;  3VDD C;  1FOD 3;  4QU1 A;  4IV3 B;  1S0F A;  2VCA A;  5FDB A;  5KHK A;  1SCR A;  1R08 2;  1XYP A;  4D7T A;  5JDB A;  2B42 B;  3SCF A;  2RR1 2;  1HV0 A;  5CB7 A;  2R0F A;  4Q1P A;  4LOS A;  4YGC A;  2ZX4 A;  1WME A;  3KQR A;  4LKS A;  4YFW A;  5EXO A;  2ZGM A;  2QE3 A;  3WDV A;  1B35 B;  2MPF A;  1FOD 2;  1YFU A;  3CO2 A;  4I09 A;  4UFJ A;  3S7E A;  4XVH A;  2WAO A;  2P3J A;  4NRQ A;  3N7K A;  5A6X A;  3EJK A;  1GWL A;  1VIW B;  2ET7 A;  2RVA A;  2VZ1 A;  2VC9 A;  2Q8C A;  5JUV A;  5F5I A;  4PCR A;  5EFU A;  2ILM A;  1GOF A;  1WLC A;  1T2X A;  2PHF A;  1W2O A;  1U5X A;  1UPS A;  3SHR A;  5BY5 A;  4NID A;  3WG1 A;  3ZSE A;  4KU7 A;  2WQ4 A;  1G9D A;  4YVS C;  2F17 A;  2WWS A;  1BVP 1;  1WCU A;  4B1M A;  3KF3 A;  1OQ1 A;  3O0V A;  2ZTN A;  1LNS A;  4FPH A;  5FK8 A;  2YHJ A;  3H3L A;  3BTX A;  4AAX A;  4W50 A;  1KS5 A;  4XBN A;  5EHD A;  3JBG 3;  3ZFF C;  5BNP A;  3NJY A;  1C8M 3;  4KU8 A;  3VDC A;  2FDJ A;  2J1R A;  3T2Q A;  3N7J A;  1U5Y A;  3ZFG B;  1XSR A;  2PAK A;  1UY3 A;  2BNO A;  3JXS A;  4IE0 A;  4WM8 B;  3IAP A;  3LCP A;  3WF4 A;  1AR6 1;  2EXI A;  4LIV A;  3JBG 2;  1CAX B;  1C8M 2;  3WDX A;  4IER A;  4MG2 A;  3ZM8 A;  3AKQ A;  4NJ4 A;  3ZIW A;  2HWD 1;  1BMV 2;  4WVM A;  2Y6L A;  2Y64 A;  1C28 A;  5A7Q A;  5IK7 A;  1JBC A;  1JZ7 A;  5A6Z A;  1M4W A;  3P3P A;  4W8J A;  4AI3 A;  2R16 A;  3I2O A;  1NLQ A;  1POV 3;  4COY A;  3G7D A;  4ZU4 A;  3R4U A;  2XJV A;  3VD7 A;  2GP3 A;  4ET7 A;  3NW4 A;  1ULD A;  2P3I A;  4GUL A;  2BWA A;  2HLE A;  4LOR A;  3KS7 A;  1YXW A;  1WW4 A;  4XFI A;  1YCI A;  1GZW A;  2RS3 2;  2ZX2 A;  3MFA A;  4YAR A;  3ZSL A;  4XAA A;  3OSD A;  3C7E A;  4IW3 A;  3AL6 A;  5LA9 A;  3T08 A;  3U0Z A;  4COV A;  3EBR A;  4Q4Y 3;  4ARY A;  1TMF 3;  4N43 B;  2JEC A;  1QGL A;  4QHZ A;  1CON A;  1MZ5 A;  2GH8 A;  2H0B A;  3TEZ A;  4NIH A;  1VBA 3;  2Q8E A;  2J1T A;  1R1Z A;  1I3H A;  2WS9 3;  4QXC A;  4FCA A;  5I0U A;  1AR9 1;  1TMF 2;  2LUW A;  5T52 A;  3RMY A;  5FMO L;  3SIS A;  4XPV A;  5FMB A;  4URA A;  3IIA A;  1C4R A;  2W5F A;  2W94 A;  3E6D A;  3EYP A;  2HWE 3;  1VBA 2;  3AKT A;  1O3T A;  1XE7 A;  4WM7 C;  2ZX3 A;  3PIJ A;  4GJZ A;  1JHN A;  1WLT A;  2WS9 2;  4N9I A;  1TQ5 A;  4BIO A;  5JR2 A;  2VNO A;  2UU8 A;  2JDP A;  1W0P A;  3PME A;  4N7U A;  3NNM A;  4GQ7 A;  2ZML A;  4JGY B;  2ERF A;  3V0B B;  2OII A;  1NXM A;  2HWE 2;  2G1M A;  3ITQ A;  5FZ6 A;  1UU5 A;  1VBC 1;  4XEZ A;  4QKF A;  2A3Y A;  3WOG A;  5AC9 2;  2WSU A;  1LAJ A;  1ZRF A;  3BB6 A;  2B9U A;  2YGM A;  1MS4 A;  5FZ8 A;  3V0A A;  1OOP C;  4FAH A;  4HMZ A;  1LJ7 A;  4YGD A;  1OBN A;  5CU1 A;  1OF4 A;  1LOC A;  4FOW A;  3U4S A;  1X50 A;  1K45 A;  3GCX A;  3MID A;  4MH0 E;  3I59 B;  5FMO S;  3DXT A;  4M0N A;  5LBC A;  1LGN A;  2QQM A;  5ANN A;  5EWS A;  5CAZ A;  4MAD A;  1W99 A;  4GIQ A;  4FVV A;  1C1L A;  1BQP A;  4I2O A;  5EIY B;  4IGP A;  2JEN A;  3O14 A;  1GZT A;  1RB8 G;  4IEZ A;  4TYS A;  2BW8 A;  5ABJ C;  4IV1 B;  1UO9 A;  2OZ6 A;  4KGQ A;  3T09 A;  1BEV 1;  1UOB A;  3SH3 A;  2W1Q A;  1H4G A;  1NOV A;  1AZD A;  4HT1 T;  1F4H A;  4RYD A;  4NIG A;  4V2V A;  1S1A A;  1JUI A;  1R09 1;  2YUE A;  4L97 A;  3C3V A;  3TBD A;  5L7O A;  2VUD A;  3ON7 A;  3QBQ A;  1RUE 1;  3I2I A;  3I2J A;  3B7M A;  4XTM A;  3AZY A;  5LCW L;  5AVP A;  2QCS B;  1IPK A;  3KT4 A;  1HDK A;  2VCC A;  1NZI A;  1ACC A;  1VAK A;  3A22 A;  3K4Z A;  4AGG A;  4FFI A;  3M70 A;  1AXZ A;  1NLS A;  1BJQ A;  1UZZ A;  4AEM A;  2RS5 1;  3TN9 1;  3LOB A;  1VAV A;  1YQ8 A;  2G9Z A;  4XF3 A;  2CAU A;  1UMH A;  4P9L A;  5IYY A;  3RGB A;  4KG8 A;  2DWR A;  1RIN A;  4TN7 A;  4A4A A;  4FI9 A;  5FP3 A;  4JGZ B;  4DB5 A;  4JRL A;  1SZB A;  4H14 A;  3WW3 A;  1HQW A;  2I45 A;  5FO7 B;  1X9T A;  2ZHL A;  3FHA A;  1ENS A;  4GWN A;  3MBW A;  5KXE A;  3WIN E;  3TEY A;  2QQJ A;  5FZC A;  4UI9 L;  3UV9 A;  2WAB A;  2OS2 A;  3FFQ A;  4B4Q A;  2Q1Z B;  3CU7 A;  4QPG B;  4NWW A;  4S2D A;  4D94 A;  5BNO B;  2I2S A;  4PHZ A;  4YZ4 A;  2DVB A;  4W65 A;  1OLM A;  5M0T A;  3MF9 A;  1W9Y A;  1TVG A;  1JZ4 A;  3K51 A;  4OHY A;  3FBY A;  5G05 L;  2ZEY A;  3T4V A;  3PUH A;  2IFR A;  3DL3 A;  4OI2 A;  3HVD A;  1UYY A;  1D7P M;  4NPL A;  4C90 A;  1Z78 A;  1H9W A;  5A1L A;  3O1S A;  4YW1 A;  3QD6 A;  2R1B A;  3O0X A;  3LEM A;  1W8N A;  5A33 A;  3W59 A;  2V73 A;  2JG8 B;  2WLQ A;  1FMD 1;  2QQN A;  1OFS A;  3HT1 A;  1MVE A;  3JZV A;  3N9Q A;  4CEW B;  3GBG A;  4IGQ A;  3MIF A;  5L19 A;  4B4P A;  1YQ2 A;  3ZN6 B;  1MZF A;  2G19 A;  2JDU A;  2WYF A;  1WZX A;  4QHB A;  5EYX A;  2DCT A;  1RTV A;  2RR1 1;  1V6J A;  4YW2 A;  3VZO A;  4LKE A;  3IBM A;  4YLZ A;  4RGA A;  4B8E A;  4OI0 A;  4LTA A;  1CIW A;  1N1S A;  3LAG A;  2UYB A;  2D6P A;  4YM1 A;  2KD7 A;  2Q1M A;  2XXZ A;  3WF0 A;  4XJZ A;  1G9C A;  2XBO 3;  2VCB A;  4BIS A;  4OI4 A;  1BXH A;  1NCR A;  2HWB 3;  4BMB A;  1ONA A;  4AED C;  2JG9 C;  1DYK A;  3K2O A;  2XJT A;  2B46 X;  4TLG A;  2ZEZ A;  2XBO 2;  4QB2 A;  4IEV A;  2HWB 2;  2Y6K A;  2P6H A;  2VVF A;  3PU8 A;  4YZ5 A;  1MS8 A;  1WCS A;  1H6X A;  1MQT A;  4GH4 A;  3VHP A;  3VL8 A;  1IS3 A;  2IC1 A;  4AHW A;  3FJS A;  4DXR A;  4AZZ A;  4IEU A;  1QXR A;  2CGN A;  3ZN5 A;  1JOB A;  2I74 A;  4XW3 A;  2A6Z A;  4FPY A;  3HN3 A;  4PJY A;  4JZR A;  3VHO A;  1QJX 1;  2IXC A;  2PA7 A;  4MGQ A;  2WNU A;  3IPV A;  1C8M 1;  5C3O A;  3AP6 A;  4FQ4 A;  3KHB A;  1HQN A;  1A8M A;  1BMV 1;  1Q3E A;  2A5Z A;  1HLC A;  5IVY A;  3NV3 A;  1XYN A;  2OUH A;  3ZDS A;  2WNV A;  1W2N A;  3LKJ A;  5LAS A;  3MFC A;  2J7M A;  1L7R A;  3ES1 A;  4W6Y A;  3RNS A;  4XJ9 A;  2VME A;  5B2G B;  2UY9 A;  2VL4 A;  4N53 A;  2W52 A;  4BOW A;  5IVJ A;  2IUW A;  1PM4 A;  1W6P B;  4NOT A;  5A7N A;  1XNB A;  4H3W A;  4Q1R A;  5C8C B;  2VU9 A;  1F5F A;  4XZP A;  1C5H A;  4ITC A;  5BV6 A;  3FBM A;  4MX3 A;  4OMC A;  4YVS B;  4XJU A;  1POV 1;  4QQP A;  2E26 A;  2F4P A;  4W4Z A;  3ZLI A;  2CGP A;  1D4M 3;  2VMC A;  4Q0U A;  1EPW A;  5T5J A;  2HWC 3;  5F6L B;  3JQX A;  1QIQ A;  2YC0 A;  3IDB B;  3WG3 A;  1A6C A;  4Q4W 3;  2ARA A;  1IOA A;  1LGC A;  1YO8 A;  3VBH A;  2IZW A;  3SC7 X;  3NJZ A;  2PHX A;  3URF A;  3POY A;  3GZT B;  4LA3 A;  3W21 A;  2VZP A;  4NHX A;  4NRO A;  4GMP 1;  1D4M 2;  2D6N A;  3AFK A;  4Y33 A;  2GC2 A;  1NA1 C;  2VMF A;  4RFR B;  5A3U A;  1H1A A;  1W6N A;  4Q4W 2;  1XE0 A;  1QHD A;  1VP6 A;  1NAE A;  4Q4Y 1;  3GZU C;  1C57 A;  3LGR A;  1KJL A;  3T2P A;  2DBI A;  2IXK A;  5ACA 3;  3V0A B;  1VBA 1;  1UY1 A;  3DPR A;  2BGO A;  5JOW A;  3DN7 A;  4CXY A;  1LHN A;  1K5M A;  2CDO A;  1V9U 3;  2DU0 A;  2WS9 1;  4BK4 A;  4CDQ C;  4AFB A;  1SDW A;  4HSJ A;  4LBK A;  5ACA 2;  1UOJ A;  4QXK A;  3USS A;  3SEP A;  3GBF A;  4BLJ A;  3V56 A;  1A3K A;  2HWE 1;  1JZ3 A;  1OD5 A;  1VMF A;  3HNB M;  1XND A;  3RJ2 X;  3SH5 A;  3V65 A;  3RYP A;  4C0H A;  1V9U 2;  4FOV A;  4YGE A;  5CFD C;  4RR3 C;  2GDF A;  1RIR A;  3QOP A;  1ZRI A;  4EWE A;  4RQP A;  5D2A A;  3RI8 A;  4G3Y C;  4MUV A;  4K20 A;  3ZXK A;  3T1M A;  5C9A A;  3POS A;  3UGG A;  1WBF A;  1Z7S 1;  1AR8 1;  3GBW A;  3EMR A;  5HCH A;  1ODM A;  1W39 A;  4QQ2 A;  4XJ8 A;  2FZ2 A;  5FPX A;  1VBD 1;  2B7Y A;  2JXA A;  5J37 A;  1WMD A;  1EYB A;  2C1F A;  5J48 A;  1CGP A;  5A3L A;  1REF A;  1IKP A;  2LRP A;  1PO2 3;  1VRH 1;  4Y1X A;  1A34 A;  3ZKY A;  5L73 A;  4NRM A;  4LR4 A;  4FPL A;  1PVX A;  5HBA A;  3WHU A;  1XYO A;  4XUN A;  4AHY A;  1ST8 A;  1RUH 3;  4WM7 B;  4KI5 M;  2DCY A;  2P17 A;  3M1H A;  4ASL A;  5IAX A;  1QDO A;  1V6I A;  2IWG B;  5K9Y A;  1PO2 2;  4FFH A;  4BQ1 A;  2VG9 A;  1LB2 A;  2YC4 A;  5FY5 A;  4P02 B;  2A70 A;  4QKD A;  3WUC A;  4CP1 A;  1KDK A;  1ND2 A;  3NVC A;  1PNG A;  2ZAH A;  2DTY A;  4Z92 B;  2FDF A;  3FWE A;  3VBO A;  1LOD A;  3HPN A;  5IFP A;  1ZBE 3;  4I0B A;  3NJV A;  2YXS A;  4M3C F;  5FWE A;  3O7O A;  3HBZ A;  4NAM A;  4YM2 A;  4M3C A;  2JD4 A;  1PZ8 A;  3ETQ A;  2DUO A;  5I8T A;  1JZ5 A;  3D8C A;  3Q9O A;  1ZBE 2;  2R04 3;  1GMM A;  1NYW A;  2W0X A;  1LOE A;  2Y33 A;  4JTN A;  5A33 B;  1YEW A;  2WWU A;  3BOD A;  1N3Q A;  1SPP A;  1CAW B;  3EO6 A;  4M01 A;  5JOY A;  2CSG A;  2W39 A;  3OGR A;  4J1W A;  5ABJ B;  4OQ8 A;  5H9S A;  3AXE A;  4UBH A;  2R04 2;  1GU3 A;  1NE6 A;  4HPK B;  3WLU A;  4JV4 A;  5FY8 A;  2CWM A;  1HB1 A;  5HI0 A;  5K7P A;  1I5Z A;  1X82 A;  3GJA A;  4TZD A;  1LOF A;  3PVO A;  1JHJ A;  1W6M B;  4BZ4 A;  1DQ5 A;  1XQN A;  4CXW A;  2TBV A;  5A7P A;  1JOD A;  3AJZ A;  3WQ0 A;  4QQL A;  1MS3 A;  2CWS A;  4COW A;  3VKO A;  1X33 A;  3I2F A;  3THT A;  3UJQ A;  4LBO A;  1DLC A;  4FO9 A;  3JU9 A;  1WW5 A;  2GNM A;  3Q8A A;  3A4U A;  2VPV A;  1OH4 A;  3LSD A;  1N47 A;  5FYI A;  3VDA A;  1AJK A;  3WSO A;  2CAV A;  1HW5 A;  5F2W A;  4PLM A;  4ASM B;  2ES3 A;  3KGL A;  3WNK A;  2DVA A;  4LO4 B;  1MS9 A;  1QXP A;  1VR3 A;  5HV4 A;  5FMC A;  1RHI 3;  4LT5 A;  1MAC A;  3ST7 A;  5BNQ A;  1UF2 C;  3NNG A;  5J7M A;  4Q29 A;  4IXL A;  4AVB A;  2PMW B;  4Y20 B;  4BME A;  2VCM A;  1MQT B;  2Y26 A;  1W9T A;  4PQQ A;  1RMU 1;  2XJS A;  3AMH A;  3AVS A;  1B35 A;  4CDX A;  3MIC A;  4U2A A;  1RHI 2;  3THD A;  2JDA A;  2AUY A;  1SLC A;  1HJG A;  2VW0 A;  3SIT A;  3WG2 A;  3ZPY A;  3NAP B;  2W95 A;  1AR6 3;  4LBL A;  4PLO A;  1UMZ A;  2K46 A;  5GM0 A;  1O4Z A;  1YFW A;  4QD2 A;  4E4S A;  2O0O A;  1O4T A;  4U36 A;  5FXX A;  5J98 B;  1UNB A;  4YNI A;  5CG9 A;  2HWD 3;  1O8P A;  3FX3 A;  3M8L A;  4CEY B;  3B3Q E;  3WY6 A;  5A1A A;  2HWB 1;  1GWM A;  2JDM A;  1WLD A;  5LAT A;  3U78 A;  4DUW A;  1O4Y A;  1FAT A;  5AFE A;  1AR6 2;  3ZXD A;  3AKR A;  1MS1 A;  1YFY A;  2KA3 A;  1COV 1;  4CVU A;  1JYI A;  2W91 A;  4QGL A;  2HWD 2;  1GP4 A;  3OGS A;  5E88 A;  2BZD A;  4QB6 A;  3AB0 A;  4QGN A;  1MS5 A;  5A70 A;  2GP5 A;  1W8Z A;  3ACF A;  3U37 A;  1UX7 A;  1CAU B;  1N1T A;  2I07 B;  1O5U A;  4O65 A;  3RVH A;  2XJR A;  2VNV A;  4BQW A;  3ZFG A;  1NQD A;  4FFG A;  2NP0 A;  4UFK A;  4DZG A;  3M3I A;  1D4V B;  4WM8 A;  4IEW A;  3LA3 A;  5DZE A;  5BUV A;  4Z1V A;  1CAX A;  1W2U A;  1OMI A;  5A7O A;  3S0M A;  2GH2 A;  1OPO A;  2EAL A;  4P9X A;  4C0B A;  4FTB A;  4DY5 A;  2JE7 A;  2G9G A;  3QLQ A;  3ZXA C;  4CCE A;  2RJ2 A;  2IVI B;  3OY8 A;  1AR9 3;  5GZD A;  4IEY A;  4OHW A;  4QX0 A;  5D8A C;  1QJE A;  1V70 A;  2FCT A;  1PK6 A;  3CKH A;  1W3X A;  1WCQ A;  3DEC A;  2C26 A;  4QDS A;  3WV6 A;  3DGT A;  2W3J A;  1XU1 A;  4LIU A;  1PMJ X;  1AR9 2;  4KH9 A;  1LEM A;  4I0W B;  3ZXL A;  4A7Y A;  2GC0 A;  5LBB A;  1POV 0;  1XB9 A;  4OVE A;  5EZW A;  5DDJ 3;  3CEW A;  2ZAC A;  1PX3 A;  2WYS A;  3VKN A;  4RFT 0;  3WP6 A;  2VMH A;  3O12 A;  2VMI A;  1D4M 1;  4EN6 B;  2HWC 1;  4S2H A;  4N43 A;  1AX0 A;  2D6K A;  4Q4W 1;  4DQA A;  5DDJ 2;  4GMP 0;  5FJK A;  5FPV A;  3ZYP A;  3M7A A;  5FZ9 A;  3VL9 A;  5L9V A;  4XF9 A;  2GN7 A;  4K6B A;  1VBC 2;  1O6U A;  5CBL A;  4KWL A;  3W5M A;  2ZGS A;  4MGS A;  3TAY A;  3K3N A;  4QPI B;  4RA0 A;  2DVG A;  1UKG A;  3AC0 A;  2CNA A;  3KGZ A;  4NMI A;  3AYE A;  4EN8 B;  1IPJ A;  2NPI A;  2GC3 A;  2CV6 A;  4CDU B;  4MOA A;  3KD4 A;  2HEY F;  4YG0 A;  3I54 A;  4YVW C;  2BER A;  2XL7 A;  3LEI A;  4LJH A;  1ZX5 A;  3NNF A;  4HK9 A;  4LBQ D;  4JGY A;  1R09 3;  5LK5 A;  3ELN A;  3WNX A;  3V0B A;  2WQZ C;  3HQX A;  3H7Y A;  4GWM A;  3UNP A;  2OPK A;  2D93 A;  1BEV 2;  1WBL A;  1X8E A;  3UGF A;  2RJK A;  3ZSK A;  5IK4 A;  5JZG C;  5J3U A;  1CX1 A;  1R09 2;  2E63 A;  2HH9 A;  2EAA A;  3WNP A;  4AVA A;  3DXU A;  3B69 A;  4MXW B;  2WN2 A;  4Q8L A;  5HPO A;  3I59 A;  3TN9 3;  4XMA A;  2Z42 A;  5KR7 A;  5F32 A;  1W6O B;  5DAV A;  1DQ6 A;  4FPJ A;  4JQR A;  3ETP A;  4XFG A;  1GZC A;  3C7O A;  3F2Z A;  4BK5 A;  3WNM A;  4LO5 B;  2TNF A;  4IV1 A;  5A3P A;  1US2 A;  3M3O A;  1YI9 A;  2X10 A;  1IQA A;  1CN1 A;  3TN9 2;  1AXK A;  4JAA A;  1ZYB A;  1PZ7 A;  1IS5 A;  1E5H A;  1UQX A;  3E5X A;  3N7M A;  3VBF B;  3VKM A;  3MW2 A;  4H7M A;  5DMY A;  2Y6H A;  3K77 A;  2CU5 A;  1A78 A;  5JOX A;  1WA4 A;  2P3K A;  1HRV 3;  2AZ5 A;  1EAH 3;  5JWP A;  3DEM A;  4JDN A;  3WF2 A;  4D0Q A;  3IM0 A;  1O8S A;  1RUH 1;  4BXS V;  4CDW C;  5DAW A;  5DUV A;  3VBU B;  4BQ5 A;  5FPU A;  2WR9 A;  3B5L B;  4AFD A;  5IVE A;  3CZJ A;  1OFN A;  4RR3 B;  3VBS B;  1UU6 A;  1FPN 1;  1WLW A;  3ZR6 A;  2K0G A;  1HRV 2;  4FSJ A;  1EAH 2;  3AYD A;  1V6O A;  1HXS 1;  3IWZ A;  3IDA A;  5IK8 A;  1UXZ A;  1DGW A;  2VOX A;  3VBR C;  2EIE A;  3E5Q A;  1ZBE 1;  3HQR A;  5JR7 B;  1XPW A;  2A3X A;  1ZA7 A;  4JGZ A;  4LE3 A;  4K3U A;  4QX1 A;  3NV2 A;  1KJR A;  3GHM A;  3S5A A;  1ULG A;  4P00 B;  4BQ4 A;  4MGK E;  2VY0 A;  2XHK A;  3MPB A;  3ZVX A;  1J58 A;  1QJY 1;  2OX0 A;  2R30 A;  1WKY A;  3KCY A;  2DUR A;  2P5B A;  4CU7 A;  2GNB A;  4LPL A;  4QPG A;  5BNO A;  1MZE A;  1MEC 1;  3JCI A;  2SBA A;  2AR6 A;  4UW6 A;  5DZG A;  2FD8 A;  3ROU A;  3RZZ A;  1X8M A;  1JXN A;  2GSY A;  4L2N A;  3ASI A;  2ZHK A;  2EAK A;  4CDX B;  1HB3 A;  3JUU A;  1LEC A;  4XUP A;  3PTY A;  4OHZ A;  3KV4 A;  4AQ2 A;  1O5L A;  4EZ4 A;  3THC A;  1Q8S A;  2JG8 A;  2WBK A;  3LDR A;  2AYH A;  2W87 A;  3VN4 A;  2MHF A;  1RUI 1;  4CEW A;  2O14 A;  1DCS A;  2ZGN A;  5FYT A;  5KXC A;  2VH9 A;  1GUI A;  5JCT A;  4UW4 A;  4XQD A;  3ZN6 A;  4I01 A;  3AP9 A;  1BCX A;  2WL1 A;  2XB6 C;  2Y60 A;  3NV1 A;  4JHT A;  3ES4 A;  2GAU A;  4D6R A;  5KC6 A; 
#chains in the Genus database with same CATH homology
 5FV3 A;  3OPW A;  5FYU A;  4DO0 A;  3UYJ A;  2YBK A;  5FZB A;  5FZC A;  3PUQ A;  5FXV A;  4D6S A;  4UF0 B;  5A3N A;  5FYZ A;  4Y33 A;  2OS2 A;  5FYI A;  2WWJ A;  4QWN A;  2GP3 A;  5A1F A;  5FZD A;  4Y3O A;  5F2W A;  5F5C A;  4BXF A;  4V2W A;  2OQ6 A;  5FYH A;  5FZA A;  4Y4R A;  5FYV A;  5FZO A;  4AAP A;  2PXJ A;  4EYU A;  3AL6 A;  5A1L A;  5F39 A;  5FPL A;  5FZG A;  3KVA A;  5A3T A;  5FZK A;  4GJY A;  5FP4 A;  5FZ0 A;  3AVS A;  3DXU A;  3LD8 A;  3N9Q A;  3PUS A;  4IGQ A;  5FZI A;  5A7W A;  5KR7 A;  5F32 A;  2Q8E A;  5FZH A;  5F2S A;  3KV6 A;  3KV5 A;  3ZPO A;  4QXC A;  5FY4 A;  2W2I A;  5FXX A;  4QX7 A;  4E4H A;  5FY0 A;  5FYM A;  5FY9 A;  5A3P A;  5FXW A;  4URA A;  5FUN A;  1VRB A;  5FZF A;  5FWJ A;  5IWF A;  5FY7 A;  5IVB A;  3U78 A;  2XML A;  4HON A;  5FP8 A;  4GJZ A;  4DIQ A;  5A80 A;  5FP7 A;  5FXZ A;  5A3W A;  5ANQ A;  2XXZ A;  5FPB A;  4LXL A;  3K3O A;  2OQ7 A;  5FYY A;  4BIS A;  4CCO A;  4D6Q A;  3N9O A;  2XUE A;  3PDQ A;  5FZ6 A;  2GP5 A;  5FPU A;  4QU1 A;  3K2O A;  3PTR B;  5FZL A;  5FZO B;  5IVE A;  4CCK A;  2VD7 A;  5FY1 A;  5F5A A;  5FZ7 A;  3RVH A;  5FZ8 A;  3KV9 A;  5FZ3 A;  5FUP A;  3OPT A;  5FPA A;  3N9P A;  5K4L A;  4CSW A;  3PU8 A;  2YU1 A;  3U4S A;  2YBS A;  3N9M A;  5IVF A;  3DXT A;  4CCM A;  5A7O A;  5A7W B;  4ASK A;  5F3E A;  2YBP A;  3LDB A;  5FYS A;  5FY5 A;  2Q8C A;  4IGO A;  4IGP A;  5F5I A;  3PUR A;  5FZM A;  4XDO A;  5FBJ A;  2OX0 A;  5FYC A;  4UF0 A;  4XDP A;  3AVR A;  4QXB A;  2P5B A;  5FWE A;  5LWB A;  5E6H A;  4V2V A;  3N9N A;  4LIT A;  3PU3 A;  4CCL A;  5FP9 A;  5IVY A;  4LIU A;  2YU2 A;  4QX8 A;  3KVB A;  5FZE A;  4GAZ A;  4NUB A;  5F3C A;  5LW9 A;  5IVV A;  3N9L A;  5FYB A;  5FZ4 A;  3NJY A;  5IW0 A;  2WWU A;  5FZ1 A;  4QXH A;  5IVJ A;  4CUG A;  4CCJ A;  3PUA A;  3KV4 A;  5FJH A;  2OT7 A;  4EZ4 A;  5A7N A;  4CCN A;  4EZH A;  5F3I A;  2Q8D A;  4GD4 A;  4AI9 A;  5FPV A;  5FJK A;  5FY8 A;  4LIV A;  5F3G A;  5FYT A;  5A7S A;  5F37 A;  4C8D A;  5CEH A;  5IVC A;  5FZ9 A;  4BU2 A;  3ZLI A;  4TN7 A;  5FP3 A;  5ISL A;  4HOO A;  3AL5 A;  5A7P A;  4D6R A;  3K3N A;  2XDV A;  5LY2 A;  5LY1 A;  2YPD A;  5A7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...