5FY9A

Crystal structure of the catalytic domain of human jarid1b in complex with pyruvate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
462
structure length
460
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLGGGGARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B, LYSINE-SPECIFIC DEMETHYLASE
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Pyruvate
rcsb
source organism Homo sapiens
total genus 141
structure length 460
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fy9A01
2OQ6A 3KV5A 5FYSA 5FZOA 4NUBA 4BISA 5IW0A 4LIUA 5ANQA 5FY1A 5FZOB 5KR7A 2VD7A 5FP8A 4QXCA 4QX8A 5A3TA 3LD8A 5FZ3A 5FZ4A 5IVBA 4QXBA 5A80A 5A7WA 3N9LA 5A7WB 2P5BA 5FPLA 5A7PA 4XDOA 2YBKA 5FYUA 2YBSA 5FV3A 3N9NA 5FYYA 5FZ7A 5IVCA 2YU1A 5FP7A 4AAPA 5FZ1A 3KV6A 5IVJA 3PURA 5A3NA 4HONA 3DXTA 5FPAA 2Q8CA 2OT7A 5FPBA 5A7OA 5F5CA 5CEHA 4Y4RA 4EYUA 2XUEA 5E6HA 5FZ6A 5FWEA 5FZMA 3UYJA 1VRBA 5FZIA 5FZGA 5FXXA 5FXZA 3PUSA 4EZHA 4URAA 5FP4A 4CCNA 2Q8DA 2OX0A 5FY5A 5FYCA 5LY2A 2XXZA 4D6SA 5FYBA 5FBJA 3PU8A 3KV9A 3N9PA 4XDPA 5F37A 5FYHA 3OPTA 5F3CA 5FY9A 3N9OA 4D6RA 4UF0A 4UF0B 5FZ8A 2YBPA 2YU2A 2YPDA 3KVAA 3K2OA 5LWBA 5IWFA 5FP9A 3ZLIA 5FY0A 4Y3OA 5FZCA 5A3PA 4EZ4A 4TN7A 3KV4A 5FYIA 5FYZA 4IGOA 2XMLA 5A7SA 5A7NA 4CCLA 5FZHA 4GJZA 3PUAA 5IVEA 5A1LA 5FYTA 2W2IA 4V2VA 5F5IA 5FZ0A 3KVBA 3AL5A 4LIVA 5F2WA 2Q8EA 4QWNA 4CCKA 5FZDA 4QX7A 5F5AA 4BXFA 3AVRA 2WWJA 4CSWA 5LW9A 4HOOA 4CCJA 3N9QA 5FZ9A 5FYMA 5FZKA 5F39A 3ZPOA 4GD4A 5F2SA 3U4SA 5FZEA 3K3NA 4C8DA 3DXUA 2GP5A 4GAZA 4D6QA 5FXWA 5FWJA 5FZLA 3NJYA 4IGQA 4AI9A 3PU3A 4LITA 3RVHA 5A1FA 5FP3A 4LXLA 5F3EA 5FY4A 3K3OA 5FJKA 5FZAA 5FPUA 4QU1A 2OQ7A 4IGPA 4V2WA 2WWUA 5FZBA 5K4LA 3PDQA 4DIQA 3AL6A 5FJHA 2OS2A 5IVVA 5F32A 5FY7A 5ISLA 5A3WA 3LDBA 5FUNA 3OPWA 5FZFA 4CCOA 3N9MA 4GJYA 5IVFA 5LY1A 3PUQA 5FXVA 3U78A 4ASKA 4QXHA 2GP3A 5FYVA 5FUPA 2XDVA 5FY8A 5FPVA 2PXJA 4BU2A 5F3GA 3AVSA 5IVYA 4DO0A 3PTRB 4CUGA 4E4HA 5A7QA 5F3IA 4Y33A 4CCMA
chains in the Genus database with same CATH superfamily
3U75A 5I93A 1LGNA 5IW0A 1AJKA 1C5IA 2A3WA 1MS5A 1RUH3 3U11A 5FLHA 2VD7A 3VBHA 5FZ3A 4Z2AA 2XBO3 3K77A 4LEJA 2E33A 4PDWA 2Q30A 4RS5B 3OUJA 1QHDA 2VBBA 3E6DA 5FYUA 3TN93 3H1YA 5FYYA 5FZ7A 2XLGA 1OH3A 2J1EA 4DEVA 1ULOA 1US3A 2TBVA 3PURA 4WVZA 4Q4V1 1S1AA 1KS4A 2ZGPA 5A7OA 1FMD3 5GALA 2X29A 3N7JA 2F6BA 1KFUL 1VRBA 4MVTA 3RI8A 3L9JT 3B5LB 1R64A 1BK0A 5FZGA 1YJKA 5BY5A 4GALA 2OIIA 4IEQA 4QX3A 1FAYA 1RUNA 1NA1A 1AYM1 2MEV3 4HXCA 5EXOA 1IQDC 4LE4A 1EUTA 1JN2P 1D4M3 4RHV3 2GMMA 4RQPA 3WW2A 1UOBA 5FR3A 1W2UA 2WINB 3BOWA 2JG8A 3OPTA 4LUMA 2JG9C 4DXSA 1ND2A 4EQVA 1UZ0A 2E6VA 3ROUA 1FXZA 3SCHA 1E5HA 2DCJA 2PA7A 2ZGMA 2ZMLA 3OF1A 4P5YA 5K0UA 2ET7A 2JDKA 2UURA 3HMYA 3ZLIA 2ZGKA 4WM7A 1IG0A 5SV8A 3UKNA 4BOWA 5JDBA 4CUAA 2V09A 4CXXA 3POBA 1K5MB 3AZZA 5JIAA 2QQPA 4AFCA 4EJRA 2VL4A 4AFMA 4AI3A 1GMMA 2D6PA 5A6QA 3NKTA 2Q0AA 2D3PA 1AL0G 2ZPXA 4YLZA 2ZS6B 1CAXA 2ENRA 2Y0OA 2HWD1 3O0XA 3Q8AA 3LB9A 3VZJA 2PHFA 5DDJ1 2D7FA 2JEMA 3TBDA 3IPVB 1AL22 2WIIB 3OTFA 2QBXA 1ENQA 1LGBA 4ZXKA 3LOBA 1FNZA 1RXGA 3LQCA 3ZFFB 5JVVA 3WF3A 1Q5OA 2R072 4NPMA 1CZTA 1NCRA 2QQVA 2VOTA 2AACA 4UOJA 5CZKA 2A3YA 1OVPA 2O14A 4UW5A 4GH4C 4YG6A 1NQDA 4D69A 4HPKB 3LSDA 2WS92 2CWSA 4YW1A 2JDHA 4RR3B 4B7KA 1CD3G 2VCBA 3VBOB 4CUBA 3JD73 5LASA 3WNXA 1DBNA 4AI0A 3E5XA 4LXLA 2VVEA 1TME3 1WKYA 1MZFA 2WN3A 1OD3A 2OQ7A 4XJWA 4I0WB 2VUJA 1A8MA 4BXSV 3KHBA 4LK6A 2GH2A 4QM8A 2EIDA 3CNAA 5EJZB 2BBVA 1ASJ1 1TMF3 4FBFA 4MGTA 4KU7A 4CCOA 1KQRA 4GJYA 1YYNA 1Q8VA 2ZXQA 2W47A 3DKQA 3PUQA 4G9SB 1SCSA 1LOGA 4KI5M 2LROA 4LLOA 1W3VA 2F4LA 1REDA 2OZ6A 1UPSA 3HQUA 3P6BA 4YG3A 2JDAA 3O14A 3ZIWA 5A6XA 2D6NA 2R043 4YW6A 2BZDA 3AKRA 3DPRC 1BXHA 4E4HA 2BRTA 3BALA 1RUG2 1ZA7A 2UY9A 2XL7A 1JXNA 1R091 2HLEA 3IAQA 3JUUA 1L3JA 5ANQA 4XFHA 1G9BA 5CBLA 2HWE3 2DCTA 4AVBA 1A78A 4GWJA 2XBO2 1V9U1 1F31A 1ALYA 3AP5A 2DUOA 4XE9A 5GLVA 5A32B 5A7WA 3M3IA 4W65A 5JOWA 1JW6A 2P5BA 5CYYA 5F1RA 4WM8C 3RZLA 1DQ5A 3NAPC 1YQ8A 4HETA 4AHYA 4D7YA 5ABJA 4P9JA 4XJ9A 3T1MA 3PVNA 4N43B 4LBMA 4DXTA 3I2HA 3OD4A 5T54A 5HV0A 2JD4A 4JV4A 2IXLA 2OT7A 3MUZ1 3HNYM 1ENSA 1PK6C 2XUEA 4KWLA 3WDUA 4NRMA 1YCIA 1ZBA2 2XVKA 3DYPA 4A2UA 2BNOA 4N53C 4CZSA 1VJ2A 3AZVA 4B7EA 4IQPA 2MEV2 3E6BA 3FFZA 1D4M2 5G04L 2B46X 3N7KA 2VMHA 1WCUA 2NYYA 1PIV3 2ZBJA 2ZHNA 4IV1B 4Q4X3 4Y24A 1E5RA 1LHVA 2JE8A 4CTEA 5FY9A 4LHNA 5A33A 1NE4A 1SQ4A 3AFKA 1CIWA 3EQEA 3ZDSA 2FZ2A 1FATA 1UOJA 1Y43B 1JYWA 1C28A 1UMZA 4ATFA 1WWYA 1DP0A 1BYHA 3KB5A 5C9AB 1O3RA 1RUF1 3WT3A 5A3PA 3V0AB 1D4VB 3K4AA 2VQAA 4XHXA 4YPJA 3I3DA 2G9FA 2R1BA 2ZACA 4CCLA 1CPMA 1SFPA 3WDYA 2WLPA 1W6MB 3PUAA 3WP6A 4XTMA 4YVSA 4DUVA 3LA3A 4MV2A 1JZ7A 2JDYA 3K4ZA 1F4HA 5J1XA 3PNAA 4KBBA 4PBOA 2QQNA 4J1XA 3BTZA 3HBKA 4BXFA 2VCCA 3R05A 4RD7A 3O1TA 1LHWA 2JG9A 3WY6A 1W2TA 5D2AA 1O3SA 4LA2A 5FZEA 4Y5Z0 3GNEA 3WHUA 4C90A 5KC5A 1DQ1A 3VBRA 5FZLA 2W68A 3WCRA 3IDAA 4IGQA 3PU3A 5JOZA 1MS0A 1K3IA 5DAPA 3EYPA 2CAVA 3JD72 3PVBB 5DG2A 5LK5A 1DZRA 3IIAA 1UU6A 1XB9A 3PIGA 1TME2 3CEWA 1RUOA 5G05L 2O0OA 3OD0A 2YMZA 4BQ1A 1KD7A 3AJZA 4RFRB 4MXWB 2BFUL 4AQ2A 5E88A 1YFYA 3J26N 4CU8A 2LALA 2OS2A 2UWAA 4AYUA 5IVVA 1UOGA 1P8JA 4HKLA 2VUDA 3KCYA 4URTA 2VUAA 4QX5A 5FZFA 5IVFA 3S5QA 3U78A 4MO3M 2YXSA 3VKOA 4O61A 1OA3A 1VALA 4XCAA 5A70A 4JRAA 1SBEA 2R042 3W20A 2R071 4Q0QA 2DVGA 5HCBA 5A7QA 2ZHKA 2WT0A 2ZGTA 5DAWA 3ZKUA 3IWZA 3NV4A 5EWSA 2EA7A 1YIPA 2BVBA 3BKZA 1V0AA 1UZYA 2RMU3 2A6WA 2AEYA 2WRAA 3J8F3 5FK7A 2HWE2 3HOBA 5FY1A 5FZOB 2WS91 3WF1A 1YEWA 4XFCA 3RMYA 2P3YA 2HEYF 2V72A 4UFIA 1M4WA 1H2LA 2EXHA 5A80A 1RUJ3 2XWJB 5KXDA 4TSVA 5M0TA 4B3NA 4UXAA 5T5OA 5FPLA 5IK8A 4PF5A 1H1AA 1RUE2 1JI6A 2R0FA 3HD8B 5JLVA 4AAPA 1URXA 1LHNA 3MPBA 2A73B 3I2IA 1HDKA 5CFDB 2V4AA 2JIJA 1VBC1 2ET1A 3MV11 3BIEA 1O6UA 3FN9A 3VHPA 1UW8A 4J25A 2WR9A 3ST7A 4GB33 5FWEA 4GH4B 1HKDA 4NRQA 3GCWA 1WW4A 3DPRA 3VKLA 2V5YA 1UCXA 2VGDA 1YC61 4HKOA 4XVHA 5FXZA 1H9WA 3MBWA 1YFXA 2VECA 4BQ5A 4Q4X2 5E89A 5FYBA 1GZWA 2CSGA 2GC1A 4OUEA 5F37A 2BOIA 2RS32 4GXLA 4RN5A 5F3CA 1TZOA 4HSJA 1B35C 1RUG1 1H6YA 2BW8A 4A41A 3FWEA 3R4UA 4B4PA 4D3WA 2VZSA 2ZGOA 3ZXFA 1Y3TA 3ZDVA 4WM8A 3NRUA 2Q1ZB 2A75A 3BB6A 1O5UA 4YNIA 3KD4A 2RDSA 1XU2A 3OYWB 2QNKA 4AGVA 4FPHA 5FZCA 1A34A 3H3ZA 3VBFC 3Q8FA 1UMIA 3ACFA 2RS51 4N90A 4XZPA 3UKTA 1NT0A 4FO9A 1SLBA 3M2MA 1GICA 4AF9A 3H8OA 3OY8A 1COV2 4FPCA 3H7YA 1GOFA 1UZZA 2W2IA 1SDDB 1W9YA 1ZZBA 3DPRB 5BNPA 4N53A 3UL2A 3VZLA 1JU3A 3VHOA 2RR11 4DINB 4LIVA 2X05A 4XUTA 5DUWA 5EP9A 3FX3A 4I3PA 5IT6A 5E8AA 4UYBA 2YC2A 4ATEA 3KT4A 2E32A 4KNCA 4QHOA 5EJ1B 1YO8A 3DUIA 2ZHMA 3K46A 3WINE 2ZEXA 4AVTA 5FXWA 1NQJA 4Y20A 3NAPB 1DCSA 1RUD2 1AVBA 3AM2A 4IXLA 1QXPA 3IDEA 1OQEA 1BBT3 4I02A 1FPN1 4NHMA 3VHNA 4BQ3A 5JSOA 1KS5A 5JR2A 1OA2A 2JE7A 1TE1B 5J09A 1PK6B 3M3QA 1PX4A 4AFAA 3NJVA 5K4LA 1OFNA 2VTFA 3UNPA 1MEC2 4LBLA 2WO7A 3BPZA 4BIOA 4QQLA 1VIWB 3POIA 2W9XA 2E31A 1G7YA 1SPPB 3E5UA 5CVRA 1OOPC 5FUNA 4PIXA 5KHJA 2VQ0A 4KGQA 2YDEA 1BHGA 4NN0A 4WVWA 2PMWB 4RGGA 5F3GA 1OQDA 4A7YA 1IS5A 5T5JA 4E4SA 3ON7A 1GV9A 3TEXA 4Q4W3 3D82A 3N7MA 1F5JA 4JTNA 5FUIA 1T6BX 3O1SA 1Q56A 3GJAA 5F3IA 1J84A 2VOKA 5TSWA 1XE8A 1C5HA 3J8F2 4GMP3 4JGZB 1W9FA 1YI7A 3LD8A 3WUCA 3T0DA 1GP6A 3DYOA 2K0GA 2QQIA 2Y34A 5FQ0B 2G4IA 4XURA 1PO12 1HB2A 3ABZA 1WW6A 1CJDA 3VBUC 2DFBA 4EN6B 1WD3A 4BQXA 4AEDC 1H4HA 3CJIA 1ZBE3 4LBQD 4YYOA 5C5UA 5CADA 5EYYA 1JHNA 4WBBA 4QU2A 4CDQC 1WMDA 3ZXJA 2PHTA 4FFFA 1O7FA 5GLTA 2BJSA 3PTYA 2CHHA 2JENA 4MYEA 4QXKA 5GZEA 4CDXA 4GB32 1VB4A 3UYJA 1VBA1 2JDMA 5J96B 4QDQA 1RJ7A 3SH4A 3FBMA 5FPZA 1ULDA 1D2QA 1QH7A 2XXZA 4XMAA 1WLTA 4JGYB 5FBJA 3O1RA 3E1F1 3PU8A 5DAQA 4YVWA 2JDPA 4YSFA 4DRVA 5C4WC 1J83A 3NKGA 1SFNA 1CAWB 5FLJA 3T4HB 3AYAA 1DGLA 5IAVA 3X29B 2QJVA 2RHPA 1LR5A 2VNGA 4IV3C 4BIFA 4XDQA 1JZ5A 4XPVA 4EZ4A 4JKLA 4LTAA 4B1LA 2ZX0A 5LBFA 2XMLA 1QOOA 1AJOA 1XOYA 1JHJA 1RUE1 2ZGUA 3POJA 4GQ7A 5CNAA 5IVEA 2DURA 2OYZA 5B2GB 1CJPA 4QWNA 3CMGA 5FK8A 2PAEA 4LQRA 3HR9A 1S2KA 1MVQA 4ES9A 3RDIA 4HOOA 2AGSA 5FOJB 4H2AA 3GM8A 2F4PA 4LBQA 2NQYA 5GLWA 3LKJA 4OI2A 1G9DA 1NAEA 1UKGA 5K7PA 5FREA 4JDNA 3C7OA 4MGQA 2RS31 4AQSA 2E7AA 3K75B 3ZMNA 4Z82A 2YY1A 5HCAA 2G19A 4D8MA 1X8MA 2PHRA 3VBFA 4Z8BA 4P9LA 1CR7A 2KXLA 1W28A 2AREA 4Y22B 4E9KA 1V6OA 4RYDA 3WDWA 1HXS2 3LIHA 4DY3A 4XHBA 1XQNA 2XKOA 1LESA 4RS5C 5I0RA 1N1VA 1NX9A 1UNBA 4HK8A 4V1PA 4PQQA 3KF3A 1WGPA 4FCAA 5F32A 1WCSA 2DWRA 4A3XA 3OGRA 5ISLA 4DQAA 1AR83 2GDFA 4A6SA 2Y6JA 5FXVA 4XW3A 4YM2A 3RRDA 1AR91 1EAH2 1B35B 5HPOA 2HYKA 5CEHA 1BEV2 2OUJA 2YZ4A 3M70A 1GZCA 5IVYA 2JKXA 3BGAA 3K48A 1XSQA 2RVAA 4MGKE 1SLIA 2JX9A 4Q4W2 3AKSA 2DCZA 2ZZJA 1SBDA 2DTYA 3I97A 5F6LB 5LCWL 4QM9A 4QB6A 3GYDA 4NRPA 5LEJA 3I2OA 4D94A 5A6ZA 4B4QA 1VMHA 4IL7A 1EY2A 1UXZA 4FTBA 1RUD1 5DXDA 2GNBA 2R7EB 5JXHA 1GWKA 1PNGA 1Y9MA 1NXMA 3S30A 3JCIA 4LPLA 1JYVA 1D0HA 4CE8A 1AZDA 5A7PA 1BMV2 3KQRA 1ZBE2 3OB8A 2V5DA 3MDPA 3H50A 1HRI2 1MEC1 4XF1A 2YYOA 1QQP1 5T50A 4IERA 3ENRA 4AK3A 1O59A 3MGUA 4PCRA 4E8CA 2VCAA 5C33A 5JUVA 5AFEA 1F5FA 3UT0A 5FZ6A 4AE2A 5CU1A 2DTWA 4NHYA 4E27A 3G6JB 5C71A 1DGWX 1RUI1 1WCQA 3NW4A 2B42B 4URAA 5DPNA 1RIRA 1LEDA 2ORXA 3AKTA 2RV9A 5HXMA 3C7HA 2CY6A 1G9CA 2VW1A 2Q8OA 4XUPA 4MX3A 4ARXA 3CHXA 2CTVA 1H9PA 2HWB2 1FYUA 2XJRA 3WD5A 1WMFA 4CEYB 3ZFEB 3P1IA 4J6GA 2ZABA 5FY0A 5HCFA 4AEDA 4TWTA 1OOPB 5IYYA 2EALA 4RGKA 4IEPA 1IPSA 1CZVA 5C70A 2K9ZA 3SKVA 2BEOA 5FYIA 4IE0A 3CL1A 2A71A 2XHNA 3R6SA 2RG4A 2DVBA 2WNVA 3V0BA 5FCCA 1V6MA 2B9UA 1I5ZA 1ST8A 1UYZA 3NNGA 4HLTA 2I2SA 1DYPA 2QUOA 2DCKA 3MW2A 4MSVA 1FOD3 3RZGA 2ZAAA 4WZFA 1VBE3 4LE3A 2DVFA 3AL5A 5F2WA 1RUF3 2WC2A 5BXXA 3CZUA 2IWGB 2JICA 3H8UA 1ENXA 2B7YA 5F5AA 1ODNA 1MZEA 3GDBA 4FFIA 4CSWA 1JZ6A 4AHWA 1BKZA 3BIWE 3OSDA 5C4WA 5IK4A 1IG3A 1IQAA 2ZMNA 1GP5A 5AFBA 2YV8A 4ZXEA 3VB9A 3DL3A 3VBUB 3JQXA 1OUSA 3H9AA 4META 4PJYA 5GLZA 4IV3A 3RMXA 3AYEA 4YGEA 4I2OA 1JU4A 3RZKA 3W21A 5C3RA 2PFWA 4CDQB 4CCCA 1HJGA 2Q1MA 1Z7S3 3KMHA 5GZFA 5A3UA 1J1LA 5IK7A 3ZN6B 3VUOA 2WYSA 5FPUA 1GSLA 3S57A 4UW3A 1UL9A 5CAZA 1K45A 2HWC2 1J1TA 5DMYA 5J7MA 4A7ZA 4ZZ8A 1H8TB 3AMMA 4NPLA 1LOEA 2VVDA 3IMMA 1AUYA 2BFUS 4F7ZA 4HVRA 3WOGA 2FCVA 1AYN3 1VAMA 5GJ6A 1HRV3 2GP3A 1C8NA 2Q5TA 2PHWA 5FY8A 1R1A1 1W90A 2CNAA 1WUVA 2HEVF 3MI8A 4YW3A 5FMOS 1CAVB 4ET7A 2GNMA 1E5IA 4NPRA 1A6CA 2RM22 4U36A 5ACA3 5HV4A 1EUUA 1HN0A 1DYOA 2WNOA 4LIUA 4PBPA 4ZU5A 3ZSLA 4D7SA 5CKQA 1LAJA 3UESA 1W8FA 5FP8A 4BK4A 5IHRA 3NWKA 5F8PA 4RS5A 1C3HA 3ORJA 3Q9OA 4LBOA 2Y6KA 4G4FA 5EV7A 4QKFA 4IESA 2CGPA 3GBGA 1UMHA 2QDNA 5CB7A 1JYCA 2E7TA 2YFZA 4XBNA 5AC92 1EPZA 2VW0A 1PO22 3PIJA 3BODA 4NOTA 4PT6A 3LF7A 3A0NA 1AR72 3VKNA 1WMEA 4TZDA 1QJX2 2XQRA 1YFWA 1HV1A 4YRDA 4XOGA 3AMHA 1BEV1 2W5FA 3ZSJA 3NNMA 3WW1A 2OA2A 1LKNA 3I2JA 2B8MA 2J1AA 1W8OA 2UWBA 1S0DA 3KCCA 4QMAA 5FYCA 3RGBA 4MXVA 1W99A 4E4DX 4KG8A 5JWPA 4D6RA 4CUCA 4O9GA 3WG2A 4LJHA 4UF0B 2R063 2YU2A 1X82A 3M3CA 5CKNA 4CCDA 4FPOB 4XUQA 2WFF2 3ILRA 4UFJA 1RMU1 4CP1A 3UGFA 3VGIA 4TN7A 1LOFA 1K5MA 4JHZA 5FYZA 1ZZ6A 1JYNA 3BYWA 4UBGA 2LRPA 5KHHA 4LO7A 1UY2A 3ACHA 4LKEA 1VP6A 5A1LA 2C26A 1HRI1 4DZGA 4QHBA 1FOD2 4EWDA 1AX1A 2X8KA 3IPVA 2BGPA 1VBE2 5L73A 4IE4A 4B8EA 3PUIA 3WCSA 5C8CC 1X9PA 3VLBB 2P34A 2WSUA 3ZFFA 4XXPA 1JYIA 3MLLA 2ARXA 2WWJA 2HH9A 2XB6C 3OEBA 5LW9A 5EHDA 3SISA 5FZKA 2CDPA 4C0HA 3J7MA 4GD4A 1OLRA 3AMPA 2QQMA 3WQBA 1VBD1 3CO2A 3O1PA 3NMBA 4HPKA 1IKQA 2A6VA 2RR13 4D6QA 1F15A 1IS6A 4RR3A 2XLFA 3VBOA 3R4DB 4JC1A 4OHYA 2HWB1 1DGWA 1W8UA 5SV5A 3USSA 4TTGA 1NY72 1Z7S2 4H7MA 4AQTA 3SMHA 3A4UA 3ELNA 4OQ9A 1AXZA 3UJOA 2WSVA 4KG0A 2J1TA 4UT5A 1S0IA 3HEIA 2I45A 4DIQA 3AL6A 4P02B 1N1TA 5ANNA 1VPHA 4LA3A 3TAYA 2G9ZA 3WSOA 4KWJA 2CDOA 2X53S 1GLHA 5CFDC 4ZZ5A 2XH6A 2VNRA 4LHLA 2GAUA 5FPVA 3NNLA 4NIHA 4YM0A 3KHCA 1OVSA 2IVJA 3NNFA 3POSA 3C2UA 5EJ3A 3WW3A 4S2GA 5ACA2 1JYXA 4BJ0A 1U5IA 2UYAA 1JUIA 4OLLA 5JXJA 1N3PA 3WG1A 3KSCA 1YLLA 1JH5A 1G8WA 4XAAA 3USUA 5A32A 2BVVA 2A7AA 3N36A 5FO9B 4Q0VA 5T5LA 2IXKA 4DS0A 1OBNA 3MW4A 1CGPA 4FOWA 4OZOA 3VN4A 1RHI1 4N43A 4LOTA 3KV6A 5IVJA 2HWC1 1YIFA 2NZ9A 2FZ1A 2XGXA 4LKFA 4QPYA 2ZOEB 5E16A 5E1RA 1IPKA 4UI9L 1US2A 1QJU1 4XXAA 1S0JA 3B9CA 2ARCA 3LFMA 1FI2A 4K9SA 5FZIA 1Z0HA 3EMRA 2Z42A 1ULCA 4EZHA 1LOAA 5LBEA 3AP4A 3C8XA 1RUH2 1W39A 3NV2A 3DKWA 4IV1A 1IPJA 2WO2A 3BPSA 3BU0A 2QCSB 5L7OB 1OLMA 1MS3A 1AR61 2LUWA 1DF0A 1VBA3 2VZQA 4XF0A 1JZ3A 3WP3A 3MF6A 5D21A 2DF7A 4FI9A 4X6QB 2D3SA 3TN92 4DB5A 2WAOA 1QJY1 4JX0A 2WZR1 5C9AA 2PLV1 3LWCA 4HL0A 3V0AA 3D8CA 1G9AA 3MYXA 5A3LA 2W87A 1FMD2 1WLDA 3TNPB 1W6MA 2O1QA 2E63A 4BM8A 4BQWA 4ITCA 3NVCA 1DFQA 4NIIA 4M0NA 1HQLA 4BB3A 4BPZA 1PO21 5JXGA 4RHV2 4ORFA 4JTOA 3D6EA 1AR71 1QJX1 1XNKA 4L11A 4BQYA 1NE6A 2HWF3 4GKXA 1C8M1 1PGL2 4L97A 2D3RA 2JE9A 5F2SA 2R16A 5I8TA 3O1UA 3AX4A 4C8DA 3OOXA 2JECA 4P9IA 2TEPA 3ZOIA 5FMCA 3RG0A 4W6YA 1AXYA 1XNAA 2ZGNA 2ZX1A 3QH7A 4XZUG 3SEPA 1HQWA 2LS6A 4ZS3A 2B5HA 1MS9A 2VW2A 1RL3A 3HN3A 2GNTA 4JGZC 1ENRA 3IN9A 2WFF1 4L92A 4M3CB 1POV1 1XPWA 3T30A 3CU7A 4MUVA 2FMYA 2ATFA 4UBHA 4MXWA 1J59A 3RZHA 4TLGA 3HQXA 3THCA 5KHIA 4AG4A 3WNLA 1KGYA 1PMJX 3LOIA 4MGZE 2VMFA 4DOUA 4LLFA 4IEYA 2E53A 5L36A 2ID4A 4A4AA 2XKPA 4HN1A 4AEMA 1OQ1A 4HMZA 3VV1A 4BU2A 5IK5A 5F7UA 1PMHX 2W95A 1NZCA 1VR3A 2O8OA 2VTXA 1JTZX 3QOPA 5H9RA 3AZWA 1J3PA 3H3LA 3T0BA 4Q4Y3 3KV5A 1RVF3 4JGYC 5FZOA 4NUBA 4EWEA 3SC7X 1J3QA 3DN7A 4NIAA 3WVJA 4XYXA 4C1WA 1O3TA 1W3XA 2WN2A 2Y33A 1EPWA 4HFSA 4MHUA 3AKQA 1IS4A 5IFPA 1RINA 3N9LA 1N1YA 2JDZA 4I0AA 2PQQA 3WEZA 5LA1A 3F95A 4AHXA 1O5LA 1TMF2 5C8CB 2YBSA 3W59A 1VBB3 2RS13 2KD7A 2ZX2A 3JZVA 5GZGA 2AYHA 1UY4A 5CFDA 4XCBA 1AL21 2CGOA 3LPFA 4NAMA 2Q8CA 3UETA 3DF0A 4COYA 4LO5B 4QDRA 4GH4A 1LOBA 1UYXA 5GKAC 1F4AA 3OGSA 4Y1VA 4XJ8A 2MHFA 4NR1A 1W0OA 2BGCA 3ETPA 1ND3C 1QQP3 2OX0A 5LY2A 2K2SA 2PHXA 4I0BA 2C1FA 1S0BA 2C9AA 4HG6B 3VBSC 2GN3A 2LW8A 3FLRA 1SACA 5JI9A 3GGLA 2W39A 4FPEA 4QHZA 2J1UA 4CU9A 1RUI3 4ZS2A 1UY0A 3JXSA 1PVXA 1GU3A 1NXD1 1RTVA 1WLCA 4QX2A 1XNBA 2BV4A 3OYWA 5ERLA 5JPMB 4EN8B 2FDKA 3WNNA 1SLTA 4Y3OA 1C1LA 3MIBA 1STMA 5DQ0A 5A7SA 1S0GA 3R4SA 3S7IA 3TNQA 5KBFA 3FLPA 1PM7A 3LPGA 4XC9A 3GCXA 2OXBA 1OKOA 4CP9B 2W0XA 4P9XA 2WA4A 5FPXA 4COWA 3BTYA 5JCTA 2FDHA 1AXKA 1Q8QA 3LIGA 3MUY1 1PIV2 2RJ2A 3IAPA 3KZ4C 5FZDA 2FDGA 1W2OA 3QD6A 3VDCA 4CDUC 2GALA 3PMEA 1VRH3 3ECQA 1XYNA 4XACA 1RGSA 5F39A 3FJSA 5FLIA 3BTXA 1RUH1 5F5QA 3ALQA 4P9GA 2ILMA 3NAPA 3V64A 2XBO1 4NROA 2VZUA 3L2HA 5H9PA 1EV13 4ZY9A 4AI9A 1ZREA 4Q29A 1BVP1 2JB4A 2QDRA 2EXJA 3F2ZA 3GF6A 3IDBB 5EQUA 3TRSB 3RVHA 5FP3A 1PK6A 1R083 2EF6A 1QDOA 2EVXA 3RQ0A 1LOCA 5JZGB 5J37A 1OFSA 1NCQC 4X8NA 3JBG3 3HT2A 5DZFA 1W8NA 4C91A 1PVC3 1SPPA 4CEWB 2Q1FA 4O7XA 1UXXX 4N9HA 1X9TA 1O8PA 1ZBA1 2LTNA 1JZ8A 3FE5A 3D5OA 1KXGA 1TNFA 1GP4A 2MEV1 3AP7A 3LEIA 4GULA 4LNVA 5FYVA 4RHV1 1D4M1 2ZEWA 2IFRA 4EROA 2JD9A 1JS9A 1ZZCA 2EIBA 4QB2A 2W3JA 5JOXA 1HN1A 2P3IA 1QF3A 2XJUA 4FPLA 4JCKA 3JU9A 5JPNB 1ZRIA 3VDDC 1RVF2 3B93A 3JQWA 3M4FA 4Q5OA 1HV0A 3MIGA 4AFDA 5CFCB 5KXCA 4GA9A 4JGZA 4K7JA 4Z07A 3NV3A 4C0BA 5LBBA 3TEZA 1CN1A 3KLSA 3OEAA 5EZWA 3S5AA 3HPNA 1C57A 5FQ0A 1D0GA 5GM0A 1KFXL 4XFFA 4CEYC 1OMIA 3VL9A 3ZFEC 4L8QA 1DYKA 3MIHA 1OUXA 1GZ9A 1ODMA 2YBKA 2YFUA 3KCXA 1VBB2 4PIYA 4XDOA 2OKXA 2JXAA 1ZNPA 2HKXA 3AKPA 3OCPA 5FP7A 5FZ1A 2VZTA 3FUOA 2PQSA 5FIXA 2WO3A 2WNUC 2BTVC 3G7DA 4QQPA 4Y5SA 4QDSA 1W9SA 4XILA 3RPQA 5E6HA 1GNHA 5IFTA 1LEMA 4QPGB 2W1UA 2X5IB 2VJXA 2VZVA 3PUSA 3I54A 1X36A 1CX4A 5FP4A 2RMU2 1NOVA 4JGYA 4K21A 5BNNB 2ORZA 3EHKA 2K46A 2BERA 2GZWA 2BYVE 1RUC3 2Y6HA 1SBFA 2GMEA 2VY0A 3TYJA 5FKBA 3VZOA 1CAWA 4DUWA 3JD71 5C3SA 1RUJ2 2ZGRA 3MIEA 4QQHA 3VDAA 4BDVB 1TME1 2RS53 1QXRA 2VO5A 5DUVA 3SITA 3AZXA 1YJLA 3DYMA 1OT5A 4CYDA 5FP9A 2ZA9A 1F8VA 5A3OA 2XJVA 3T1LA 1HW5A 4QQOA 4I01A 1GOHA 2WFPA 3KV4A 1OXCA 4IGOA 1UZVA 2F17A 4AZZA 2CU5A 4P14A 2VQUA 1PZ8A 4IETA 4ZKTB 2VC9A 4E2QA 4XF4A 3N7LA 1H8TC 3CIHA 2FDJA 1QDCA 4YFWA 4LBKA 3ZVXA 2R041 4Q4V3 3NJZA 4F8AA 5FYMA 1VRH2 3VKFC 2ZZQA 3RWKX 1WLWA 2R49A 2C6SA 2H0BA 3H42B 1W6QB 1JODA 1H8VA 2VMDA 3BOPA 3L2YA 5DG1A 2AEZA 2HWE1 1AYM3 1C1FA 2X10A 3O1VA 3RYKA 3ZYFA 4RSUA 4XJUA 1EV12 2Z5WA 4IEZA 3S7EA 3RZMA 3QH6A 1BCXA 3AB0A 3LCPA 4COUA 2A70A 3FHQA 3I2FA 4XETA 4QPWA 4HVOA 1OC1A 4Y22A 1R082 4OULA 2ZMKA 2P37A 4XTPA 1LULA 2WWUA 3JBG2 5FBZA 3LEMA 4ONUA 1GQPA 4XAEA 1IGOA 1L7LA 2G9GA 5FMDA 4N7IA 5F9TA 2BDRA 1I9RA 1ND3B 2PHUA 2NMOA 2XWBB 5A3WA 4NHKA 3RS6A 4AQ6A 3OPWA 4QKBA 3VBSB 1XYPA 1B35A 4NO4A 1G86A 1QMJA 2EICA 1LTEA 3AMQA 2HWD3 3A22A 4Q4X1 1PIV1 4AW7A 5DDJ3 4CXYA 2GH8A 3I59B 4P5HA 2J1VA 5D1IA 2VM9A 4H7LA 1VMJA 5BNQA 1BBT2 4KWKA 2Z2SB 2W1QA 1AX2A 1J58A 1MACA 3J7HA 4LULA 5BNOC 1EYBA 1WBLA 1S2BA 2Y8KA 4IEUA 3LFIA 4OMCA 2J7MA 4QX8A 3GZUC 4QPIC 1PGSA 2IVIB 1LU2A 2D6LX 3HJRA 2VXRA 4GMP0 4JRLA 3HWJA 1JUHA 4L2NA 4K20A 1COV1 1RJ8A 4ISRA 2WZPP 3VD3A 1YUDA 1ZYBA 2WQ8A 4LBNA 2GSYA 1LHOA 2YU1A 4CDUB 1LRHA 5DZGA 1WW5A 4M4PA 5FKCA 1H2KA 3CBNA 3O0WA 5FPAA 2WYFA 1FNYA 2XG3A 3M3OA 3B9IA 1FT9A 2UYBA 4FAHA 4OI0A 2ZGLA 1ASJ3 2Z4FA 1XE7A 2QE3A 4NVPA 1DQ4A 5FXXA 1PNFA 1H2NA 1MZ5A 1QKQA 1RHI3 4UW6A 4XFBA 5KHKA 1QJFA 2VQTA 2WO1A 3ZIXA 2DDUA 2C9KA 3ACLA 3ZYPA 3RYPA 3KV9A 1RUC2 3N9PA 2C0ZA 2P3JA 5CIRA 3TB0A 5T5PA 3N9OA 5D8AC 3LE0A 1NCQB 1VLNA 1T6GC 1W2NA 1W0NA 1W6NB 1YI9A 2P17A 1I5PA 2RS52 2YPDA 4FQZA 4YGCA 4ZPIA 4WV8A 5I0TA 1R093 1N3OA 3ZFEA 4AEJA 4CEYA 1OOPA 1DZQA 3ZFGC 1ULPA 5LK7B 1ONAA 4R9AA 1F2NA 1V6KA 4MADA 2PAKA 5LRSA 1V9U3 4FPGA 4OUMA 4EWAA 1LECA 2YPJA 3VBHC 2I74A 2WZR3 3OJBA 5JXIA 2VBDA 1MS1A 4JAAA 2CV6A 3VDDB 4FPJA 4Q4V2 3WP4A 2XQXA 3ME2A 1CAUB 4WVMB 4LBJA 4E4ZA 1E5SA 4BQ2A 5IVCA 3N9QA 1X33A 2VU9A 4M0HA 4XBLA 3W5NA 2V4VA 2Y64A 1DGRA 2GNDA 2RMU1 3VBUA 3POFA 3J8F1 2P1BA 1AYM2 1YHFA 1OH4A 1X50A 1A3KA 1RUJ1 2QQUA 3FMGA 4CDQA 3UV9A 1PO11 4G3YC 2CWMA 1DLCA 3H8RA 1NA1C 4IEWA 3ZN6A 2WNUB 3PUHA 3QLQA 2DFCA 3V65A 4JQRA 1TEIA 4RQPC 1N47A 4AI1A 2ARBA 4XIKA 3GJBA 5EFUA 2D6KA 2WLQA 1ND2C 3PDQA 1H8TA 3S6PA 1W2AX 5EIYB 3J9SA 5K0UC 4GB31 3SCFA 2IUWA 3RJ2X 2XHKA 3HT1A 2QQJA 4P9WA 1O3QA 4WM7C 1POV3 3ZSKA 4XFAA 4QXHA 2Z69A 5FUPA 4JKKA 2BNMA 4KWUA 1W6PB 4MHRA 4ZU7A 5DAXA 1CAVA 3LAGA 4YW7A 2VNOA 1IS3A 3USUB 2UY8A 3NV1A 2TUNA 3WQ0A 2B39A 4BLJA 3E97A 2W46A 3OBAA 3WF2A 1CESA 4Q1PA 4CCMA 2VMCA 3GXUA 4L9BA 4DXRA 2CAUA 3SLIA 5JMCA 3INAA 5FYSA 3BI3A 5DAVA 1N3QA 5L7OC 4OMDA 1F9KA 2VZOA 4LKSA 3IM0A 3ZXEA 4HT1T 3WDTA 1NCRC 3AXEA 1OPOA 3RI9A 3WV6A 4ISQA 1W6OB 4W6WA 1B09A 1NLRA 4CDWB 1O8SA 1DIWA 1AR82 5C3PA 3B94A 3ZKYA 3KGZA 2W94A 4UWDA 3ASIA 1YQ5A 3FBYA 4CP2A 4HONA 2DBNA 1UY1A 4C1XA 5A3TA 4ZHNA 3SEEA 1AX0A 4AVCA 4CU7A 4BA6A 1ASJ2 4HANA 1G6NA 1V70A 3ZYRA 3I3QA 4QQ2A 5BNOA 3VD4A 3APBA 2GU9A 2E26A 4AR2A 2ZEZA 3MICA 4D6SA 3WXPA 3U14A 1BLZA 3ZSEA 3DEMA 1UY3A 4LMFA 5H9QA 3FHIB 2A1XA 4IW3A 1I3HA 2R073 1ZZ7A 4UF0A 1UX7A 4S2FA 2R6QA 4CRQA 4EV0A 4Y1YA 4XABA 5I8SA 5C5TA 3I3MA 4W8JA 1XNDA 1R092 3BCWA 3K2OA 1HXS1 1XJAA 2DCYA 2JJ6A 2Y26A 5FRAA 1VB2A 1SDWA 1QH6A 4DRRA 2E9QA 3ETQA 2WS93 4HBNA 3KF5A 3AXDA 1V9U2 4DFSA 4LK7A 4E2GA 4FT8A 4XBQA 3U10A 1REEA 3Q8BA 1WMXA 2JWPA 4LOSA 1EAH1 2FHRA 2KR2A 3H1MA 1SG3A 1UD1A 3A7QA 2XJQA 3C7FA 2AC1A 3POYA 4K3UA 4QGLA 3RJRA 3VKMA 4Q4W1 3VD5A 3ZYJB 1VBC3 1L7RA 2D98A 4AVSA 4DNYA 3MW3A 4R4ZA 2ZCWA 2QQWA 2WWSA 4QPIB 2EIEA 1MQTB 2HEWF 3JB8A 4Q8LA 4OZXA 3U4SA 4YGDA 1CPNA 1I1EA 3KWVA 2UWCA 3AZYA 3ZXKA 4Y1ZA 1IHMA 3THPA 4KL1A 4NWVA 2SBAA 4NJ4A 1LB2A 1UKRA 1RUG3 1UIJA 2WQZC 1BMV1 4XMIA 1ZBE1 3ZN4A 3I2GA 2PN5A 5FJKA 3IDCB 2Y6FA 2XJSA 3GZTB 5IATA 3V56A 1DQ0A 2Y6LA 3MIDA 1W8HA 1RUF2 4MGYE 3ZYIB 2W91A 4NAOA 5T55A 2ERFA 2BUKA 4Z92B 1Y9QA 4AOCA 4Z1VA 2FCTA 5L9RA 5D8AB 2VPVA 4NMIA 2DU1A 2H6BA 4QD2A 3AVSA 4DO0A 1ACCA 4FOYA 4TYSA 4YVSC 5BPXA 5LA2A 3MO4A 1UIKA 1ZBA3 1O4YA 1WZXA 3AP6A 3ZFGB 1H0BA 1L7QA 4BCUA 1UAIA 3SH3A 1ULFA 1XNCA 2AZ5A 3O12A 2XVGA 4XQWA 5FMBA 5AVAA 1QNWA 4YFZA 2IXJA 2VR4A 2VXJA 3LEGA 5LEKA 1S4CA 3O0VA 3M1HA 3VBHB 1KRIA 1W9WA 4WVVA 4ES8A 3ZO0B 2GC3A 3FFQA 1NYWA 4PDWB 4BHPA 3WUDA 1FPN3 4NIDA 2DYCA 1Q43A 3HVDA 4LO4B 2D40A 1AYN2 3VBRC 3KT7A 5C6CA 4FTEA 3FL7A 1HRV2 2RJLA 4OCTA 3RZJA 1O91A 3DXTA 2ZKNA 2YB7A 4QT6A 3WF0A 2D43A 2OPWA 4JHTA 4PLNA 4EYUA 3SKJE 1ULEA 2KM2A 1QOTA 1SCRA 1X8EA 1PMIA 2EIGA 3PVEA 4HSLA 4JQTA 3W9AA 4A6OA 4DXZA 4YZ3A 3D0JA 2D6MA 4COZA 3AYDA 4E2SA 3POWA 4KBZA 1GR3A 1NA1B 4IDZA 3VZKA 1W9TA 2XPJA 1HB4A 2EAKA 4YM1A 4OHZA 4RQPB 4XDPA 5L7OA 5JI7A 1HIXA 3ES1A 5FYHA 1S55A 3CQOA 2FDIA 2ETEA 2W1SA 4QKDA 2JG8B 3ITQA 2WZ8A 3ATGA 4N9IA 1ND2B 5F6KA 3T2TA 1W05A 5C8WA 3CJXA 5K0UB 3FHAA 2DVDA 1E57A 4LR4A 1UWWA 2I07B 5IWFA 3ILFA 4Q0SA 5JOYA 5LZ6A 4OYUA 3DV8A 4AI2A 4AXOA 4BMEA 4WM7B 4S2DA 1CQ9A 2W08A 1G9FA 1H2MA 4MOAA 5J36A 4IEXA 4BMBA 3EO6A 1AR81 1HJFA 5JZGC 4NWWA 3VHRA 1Z78A 3WLUA 1NLQA 2ZAHA 3PMSA 4Q2FA 1UYPA 3AP9A 1CAXB 5F5IA 4CEWC 1IZ3A 1JZ4A 1PGW2 3TEWA 3IB3A 1WCKA 1GBGA 1APNA 1VBC2 3OGVA 1OI6A 4QX7A 1OHFA 1YNAA 1HQNA 2CYFA 2RM21 4XUNA 4CCJA 5JIUA 3EXUA 3LA7A 2CGNA 2KA3A 2R062 5EYXA 1NCRB 2IXCA 2D6OX 2JDNA 1BVVA 1T2XA 3UKVA 2VBPA 3P3NA 1MS4A 2XJPA 1BJQA 4KMQA 5FWJA 4A44A 4YARA 1R1ZA 2ADEA 2TNFA 4L99A 5CFCC 3HQRA 5KXBA 4M3CA 4PI2A 1LENA 1IKPA 1M06G 2WZEA 4P08A 5AC91 4R9CA 4AFBA 1PM4A 2XOMA 2FMDA 3HN1A 4QU1A 2P4EA 3I2KA 4W6XA 4R4XA 4W50A 4N7UA 2A6YA 2XJTA 3GHMA 1V6LA 4BWOA 4GWNA 2GN7A 5FJHA 5IJRA 2ZX4A 4EN9B 2LM3A 1J3RA 1V00A 4M3CF 2VVFA 4MGIE 4P00B 2P6HA 5FY7A 1TNRA 1RUE3 3LDBA 2NM1A 3C7EA 4DUXA 1PZ7A 1U12A 4ASKA 4BQ4A 1U5ZA 1LCLA 2XDVA 5KWRA 2RR12 4HZFA 3W58A 3PTRB 4QPGC 2X5IC 4RA0A 1QOSA 2GMPA 1MZ6A 4X8PA 2N7GA 2BP6A 4Y33A 5BNPC 3BUCA 2EXKA 3Q8EA 5BNNC 4BK5A 1SFYA 1SLCA 2PTMA 1JMUB 1DQ2A 3MLJA 1YWKA 3CKHA 3ZR6A 3GZEA 5J3UA 2ZKLA 3S0MA 1UZWA 3AYCA 3ZXGA 2RS33 3WR0A 2MPFA 5J98B 3ACIA 4QXBA 3T3YA 4EE2A 5GLUA 5C8CA 3M3EA 1I6XA 5A7WB 3ZR5A 3SHRA 1FPN2 5FTTC 1QWRA 3CZJA 3RYRA 1FOD1 1HLCA 1W03A 2JB8A 2RDRA 2YHJA 2RDQA 2QTWB 2E7QA 1VBE1 3WNMA 3H8XA 4FTSA 3D3AA 1SHWB 1SLAA 5ABJB 1ZM1A 3IMNA 3LEKA 2XL9A 2VZRA 5F5CA 1W8TA 2WAAA 1KJRA 4UFMA 5FZMA 3GHNA 1RXFA 4LKDA 1COV3 1FV2A 2QQOA 4DEQA 2YGLA 1W8ZA 3HIFA 2OW4A 1REFA 1Y4WA 1AR93 4GWIA 3PJYA 2XR4A 1GYKA 1K12A 1SMVA 4IEVA 1JYTA 4MG2A 1O4TA 1OKQA 2BGOA 5HXVA 4XJAA 3LZZA 1DLLA 1NY71 3E5QA 1Z7S1 2D44A 4LORA 1UOFA 5A33B 3WP5A 5B4NA 1UN1A 3OGGA 2ZJCA 2D5FA 3ZM8A 4ASMB 4YWAA 2ADDA 4TLFA 4XQDA 1RUD3 2WNEA 3KS7A 4XF9A 2AENA 4ZONA 2VZ1A 3AK0A 2XLAA 2D97A 4QGNA 4Y5TA 3U07A 1QY4A 4INDA 1AYN1 4CP9A 1OLQA 1W0PA 4XJZA 5BYNA 1HRV1 2B45X 4YVSB 3ES4A 3GZAA 3P5BA 4K8RB 4L0PA 1F35A 4V2VA 5FZ0A 1MEC3 5LATA 3THDA 4CCKA 3O7OA 3AVRA 1GKBA 3CJIC 5ACA1 4SBVA 4K40A 2FD8A 1LU1A 5FZ9A 2PELA 1VBA2 2ZGSA 4PF1A 5FMOL 2JG9B 2IZWA 3CDZB 4EN7B 3K3NA 1ZX5A 2JKBA 1MR5A 2GP5A 4CDXC 3VD7A 5JSPA 5I0DA 4B4RA 1CVNA 4PLOA 3NJYA 3A21A 3VBRB 3B69A 4COVA 3DECA 4W4ZA 4YZ2A 1FV3A 1JBCA 3EB7A 2GC0A 2C24A 3K3OA 3A23A 3QCWA 4FOVA 4AI8A 5JZGA 4YVWC 2H0VA 1QNYA 3NNJA 1VE0A 3PJQA 1H4GA 1SZBA 3SCGA 4F3JA 3U37A 4NE9A 4CEWA 3IT8A 4IUGA 2PYTA 3EJKA 4FPFA 1PO13 1QEXA 3OPZA 5LRRA 2HWF2 3N35A 2IC1A 4YW5A 1WA6X 3ZSMA 3I4IA 5FDBA 3B00A 1XRUA 4UFHA 2VAUA 5L9VA 2Z79A 4OHVA 1PGW1 4Q26A 3AJYA 4H14A 4CXWA 2HJIA 4UFKA 5JR7B 2ZEYA 3W5MA 3M8LA 1ZA4A 1SLLA 3I3BA 4KU8A 3HAGA 5JSRA 2R30A 4CUGA 3IIIA 2R061 3WNKA 5KC6A 4LHSA 4YZ4A 1YRZA 2OQ6A 5CFCA 3WF4A 3N3HA 3TN91 3ILNA 5C3QA 4BISA 1CIYA 1CWPA 4AHZA 3N4MA 5KR7A 3O1OA 2J22A 4DY5A 1C4RA 4OHXA 4NHLA 4M4RA 1QGLA 5HCHA 3QACA 1FMD1 4SLIA 1RC6A 1XE0A 1OA4A 4OQ8A 4K6BA 1LODA 3HNBM 3TEYA 2ZGQA 4P9YA 3N9NA 1OLME 2W52A 1XNTA 3KM5A 3H0OA 2EXIA 4AEKA 5BNOB 5C3OA 2VOXA 3MHZA 3FLTA 2FBEA 1OF4A 3JB4C 1KDKA 4DMIA 3RNSA 4IEOA 4Y4RA 2YC0A 4E8DA 1GFF2 1A8DA 4HK9A 4GZ9A 4QPGA 2X5IA 4AGRA 1PGL1 1KITA 1NUKA 3T2PA 2DUQA 4Q4Y2 3K51A 4M3CE 5BNNA 1TQ5A 3B7MA 2BQPA 1AR92 2YUEA 3ZXLA 4H3WA 2Q8DA 3MPPG 5FY5A 3MEPA 1N1SA 1R1A3 4XFIA 5BV6A 2AH2A 2DBIA 1GZWB 1WD4A 2D93A 2A6ZA 3FZ3A 3B02A 5A3MA 1GQHA 5B4XA 1ZVFA 2AUYA 4LT5A 3PHMA 5A1AA 1W8WA 2RS12 1V6NA 5LWBA 2NN8A 5FAXA 4WM8B 4K8FA 1UF2C 2J1RA 1UU5A 3SNMA 4UAPA 4B1MA 3VL8A 5I8YA 4RFT0 3A0KA 5A7NA 1WW7A 4XIOA 5CG8A 4YZ1A 1NZIA 3WNOA 2FDFA 3OY8B 4RL7A 1HXS3 1YXWA 2YC4A 3VZNA 4D0QA 3POGA 4XEZA 2HYXA 5BNPB 1QQP2 4N53B 1BK1A 1KDMA 4O65A 3IBMA 2JDUA 3PLQA 4PI0A 5C7GA 1W6QA 3UJQA 1YFUA 2NLRA 3ZPOA 2X09A 2DU0A 1RUI2 1EAH3 4MLOA 5DUUA 1D2SA 5CG9A 5AVPA 5KXEA 1BEV3 3U4XA 3SQOA 2IXHA 2W92A 2J1SA 4GAZA 5FFOC 2A5ZA 4FP3A 3LDKA 1HB1A 1LJ7A 1UX6A 4QB1A 4TXWA 4LITA 3MF9A 4Y20B 5APAA 4CPBD 1TMF1 3HBZA 2UU8A 3WW4A 5DUXA 3NQHA 3VDBA 3WQ1A 3H7JA 5FZAA 2DV9A 1XBFA 2QKDA 3LGRA 3R0RA 4FFHA 1S0EA 2WBKA 3RSJA 1RMU3 4CU6A 3CF6E 3OGJA 3B3QE 3UGHA 2WQ4A 1ND3A 1H1IA 2PAMA 4CDWC 5JAXA 1CONA 3WNPA 3D4KA 1H6XA 4FOQA 3VBSA 4I09A 3VD9A 2WT1A 4A3ZA 5LY1A 3N9MA 1UU4A 4NIGA 3WZ1A 2VCMA 1HRI3 2B4KA 3I59A 2PHLA 2VG9A 2WNVC 2OVUA 2CL2A 2P3KA 2ES3A 3O1MA 5EPAA 1XSRA 1LGCA 2DVAA 1OPMA 3DCQA 4YGBA 3I49A 3H1WA 5FO7B 4AAXA 3T08A 5CISA 2OZJA 5LBCA 1UQXA 1DHKB 1VBD3 4MH0E 4QXCA 1S0CA 3OG2A 2VOWA 1QXJA 4I3GA 4S2HA 3LDRA 4Y26A 4XF3A 1DG6A 4BZ4A 5LA0A 1RB8G 2GC2A 1S0FA 1PVC2 4UFLA 4CCEA 2HWB3 5I91A 1QJZA 3U1XA 1GZTA 2BOJA 4CDUA 2VOVA 3CJIB 2IXIA 2Q4SA 1H30A 4Y1XA 3GBWA 3C3VA 1KJLA 4R9BA 4NHXA 4CPBA 1QU0A 5FPBA 4BLIA 1POQA 2HWF1 3IZOA 3EBRA 3O5SA 3OBTA 4CDXB 3T4VA 4Q8KA 1QJEA 1UPIA 5DABA 1PX3A 3K4DA 1LHUA 4CCNA 1X7NA 1YQ2A 4JDMA 4XUOA 2RDNA 5J48A 4KQ7A 1JZ2A 3ZXAC 1R1A2 4OI4A 4R9DA 4BH9A 2VUCA 1MQTC 3ACGA 4DPNA 2C4XA 4YVWB 1XYOA 1NCQA 2OPKA 1W6NA 3BVCA 4JZRA 1NG0A 4MZUA 3FUQA 2Y0IA 3WX5A 4Q0UA 4AWDA 4FPYA 3KVAA 2BPA2 1NKGA 3AMNA 1K42A 2P2KA 4QAWA 3MFCA 3MZHA 1RYYA 3TOJA 1UO9A 4Y4YA 1Q8PA 4OFGA 3H3UA 1IOAA 2W1WA 4YW2A 4F83A 3URFA 5HBAA 1PZ9A 5FZHA 4GJZA 2O8QA 5FYTA 4EN0A 1V6IA 2QZ2A 3LA2A 2VMGA 2FQPA 3ZXDA 1D7PM 3VDDA 1WA4A 3I2DA 1Y9GA 2HWC3 3KVBA 4M01A 4PLMA 1CAUA 4WVMA 2Q8EA 3RWNA 3T2OA 4IE5A 1QJU3 2Y6GA 1NLSA 2XONA 4XQ4A 3HNMA 4AGGA 4MGSA 1LNSA 4FPKA 4Q4Y1 1V6JA 1RVF1 1KEXA 2WUHA 1JOJA 4LBQB 1DZTA 3NO8A 1JOPA 1MS8A 2ZX3A 4YW4A 3BU7A 3T2QA 1K5JA 3MLKA 3DXUA 1WBFA 5LB6A 4ZU4A 5JMOA 5A6YA 5BUVA 2RM23 2WNUA 3T0AA 1FX5A 1W06A 3I8TA 1AR63 4Q0PA 3VBFB 1O4ZA 3WHTA 4FAGA 1VBB1 2RS11 1VMFA 2EAAA 5F3EA 5FY4A 3PL0A 3E6CC 3UGGA 2D5HA 4QGMA 4IE7A 1MPXA 5I0UA 4CA9A 5FO8B 1QJY3 1RMU2 2G1MA 3OUIA 5FZBA 4PDWC 3OBZA 2PLV3 4FXKB 4XFGA 3NSTA 5DN2A 2QZ3A 1SEFA 3J4UH 2R0HA 4HVQA 3FC0A 1VAVA 3I7DA 2P6CA 5AC93 1ZRRA 2VZPA 3J7LA 4FP2A 1LOFC 1W6PA 1K5MC 1GQGA 4ASLA 2PXJA 1HX6A 1PO23 2RE9A 2A6XA 4GKYA 4R52A 1U0AA 4LUKA 5GZDA 1AF9A 1BQPA 3NJXA 1AR73 4AVAA 2YG0A 4J1WA 1QJX3 5K8SA 2SLIA 5T52A 3ZYHA 1C8M3 4QX1A 4Q1RA 3SXWA 1H1MA 3ZFFC 5H9SA 4D7TA 1VBD2 3ZMOA 3IKWA 2H6CA 1EP0A 1GNZA 2JG8C 5FZ4A 5IVBA 3LSEA 4B29A 3D0SA 2Y60A 3MFAA 4JVAA 1ZRDA 4HKWA 1ZZ8A 1W6OA 4OUSA 5FOBB 3WG3A 4CDWA 2HBTA 3TWIA 2MNGA 1Y7BA 3ZX7A 5FV3A 5KHGA 2VMEA 3ZPYA 2WFF3 1GUIA 1W04A 4R8HA 4FXGB 4RR3C 1CX1A 3VBOC 3C7GA 3THTA 2AR6A 2HWD2 2VZ3A 3BN6A 5A3NA 2QFEA 5DDJ2 1OSGA 1ULGA 4A42A 4OI1A 4YZ5A 3AFGA 4JDOA 4WZCA 1AHSA 3RZZA 1XXNA 5IAXA 1VRH1 3ZYBA 4H55A 4A45A 4QKNA 2ZTNA 4YM3A 3KGLA 1QIQA 3CLPA 3KQ4B 4FQ4A 4UW4A 1S2EA 4KH9A 2WA3A 3SH5A 3ZN5A 2FCUA 5DZEA 3WG4A 1DDLA 4IE6A 4K1ZA 3OUHA 5T3NA 1EV11 4FVVA 4PHZA 2VMIA 2VTXJ 2HBUA 4FFGA 3BTAA 3UK9A 2BWCA 2ARAA 2PHDA 4GIQA 4X6RB 4KGGA 3WDVA 1HB3A 2YBPA 1R081 5FZ8A 4RGAA 3ZYGA 4Z2WA 5K9YA 3QBQA 2WKKA 4LHKA 2WJSA 1BZWA 5CKMA 3JBG1 2B9VA 4AEDB 4OHWA 5CA6A 3AC0A 3M7AA 1PVC1 2ZHLA 1U5YA 1RITA 1GWLA 1Q3EA 4GWMA 4HN0A 1GOGA 5IUQA 3RFRA 5HI0A 2QQLA 5L19A 3U0ZA 2E51A 2WNVB 2XVLA 3V0BB 1YQCA 2WABA 1RHI2 2YGMA 4A7KA 3WQ7A 1GANA 4LO6B 1JOBA 2DUPA 3B01A 3MIFA 3MV01 5I0SA 1ZZ9A 1AL23 2R1DA 1GNYA 3NL1A 1QJU2 3Q8CA 1DU3D 4Y1UA 4QPIA 1MQTA 1BBT1 2A3XA 2Y38A 4N43C 3T09A 1DGRN 1OURA 2RJKA 4PQ9A 5C4WB 1GWMA 1CZSA 4CVUA 1UYYA 2VH9A 4K1YA 4LO8A 1Q8OA 2JIGA 3GALA 2WT2A 4M00A 1ZRFA 4AL9A 4BYYA 1XU1A 3P3PA 4IV3B 2J42A 2C5DA 2V73A 4OVEA 5A1FA 1AR62 3J7NA 2YROA 2VE1A 4IV1C 1OD5A 2VULA 2XUMA 5L9BA 3VZMA 2BU9A 4I30A 2NP0A 1VAKA 3PVOA 4BE3A 4IGPA 4V2WA 1QJY2 4N8MA 2WZR2 1Q8SA 1OF3A 3GBFA 1YQ6A 2PLV2 3POEA 1U5XA 5LA9A 4CP0A 2NPIA 3OBRA 4JKMA 3WDXA 2OUHA 3I3EA 3DGTA 2WL1A 2R32A 5C9AC 5ABJC 4ARYA 5D8AA 2IFWA 2VNVA 4PIZA 4GMP1 4O9EA 2WDBA 2QQKA 4Q27A 4YG0A 4AVVA 2BBAA 1RUC1 2QVSB 1ZRCA 1TG7A 1XC6A 1POV0 2BWAA 1DQ6A 1MVEA 3KT1A 4QX0A 2BNNA 4U2AA 4FSJA 3ZFGA 5GZCA 1PHMA 2L9LA 1WCDJ 1C8M2 2NMNA 1TVGA
chains in the Genus database with same CATH topology
2OQ6A 3KV5A 5FYSA 5FZOA 4NUBA 4BISA 5IW0A 4LIUA 5ANQA 5FY1A 5FZOB 5KR7A 2VD7A 5FP8A 4QXCA 4QX8A 5A3TA 3LD8A 5FZ3A 5FZ4A 5IVBA 4QXBA 5A80A 5A7WA 3N9LA 5A7WB 2P5BA 5FPLA 5A7PA 4XDOA 2YBKA 5FYUA 2YBSA 5FV3A 3N9NA 5FYYA 5FZ7A 5IVCA 2YU1A 5FP7A 4AAPA 5FZ1A 3KV6A 5IVJA 3PURA 5A3NA 4HONA 3DXTA 5FPAA 2Q8CA 2OT7A 5FPBA 5A7OA 5F5CA 5CEHA 4Y4RA 4EYUA 2XUEA 5E6HA 5FZ6A 5FWEA 5FZMA 3UYJA 1VRBA 5FZIA 5FZGA 5FXXA 5FXZA 3PUSA 4EZHA 4URAA 5FP4A 4CCNA 2Q8DA 2OX0A 5FY5A 5FYCA 5LY2A 2XXZA 4D6SA 5FYBA 5FBJA 3PU8A 3KV9A 3N9PA 4XDPA 5F37A 5FYHA 3OPTA 5F3CA 5FY9A 3N9OA 4D6RA 4UF0A 4UF0B 5FZ8A 2YBPA 2YU2A 2YPDA 3KVAA 3K2OA 5LWBA 5IWFA 5FP9A 3ZLIA 5FY0A 4Y3OA 5FZCA 5A3PA 4EZ4A 4TN7A 3KV4A 5FYIA 5FYZA 4IGOA 2XMLA 5A7SA 5A7NA 4CCLA 5FZHA 4GJZA 3PUAA 5IVEA 5A1LA 5FYTA 2W2IA 4V2VA 5F5IA 5FZ0A 3KVBA 3AL5A 4LIVA 5F2WA 2Q8EA 4QWNA 4CCKA 5FZDA 4QX7A 5F5AA 4BXFA 3AVRA 2WWJA 4CSWA 5LW9A 4HOOA 4CCJA 3N9QA 5FZ9A 5FYMA 5FZKA 5F39A 3ZPOA 4GD4A 5F2SA 3U4SA 5FZEA 3K3NA 4C8DA 3DXUA 2GP5A 4GAZA 4D6QA 5FXWA 5FWJA 5FZLA 3NJYA 4IGQA 4AI9A 3PU3A 4LITA 3RVHA 5A1FA 5FP3A 4LXLA 5F3EA 5FY4A 3K3OA 5FJKA 5FZAA 5FPUA 4QU1A 2OQ7A 4IGPA 4V2WA 2WWUA 5FZBA 5K4LA 3PDQA 4DIQA 3AL6A 5FJHA 2OS2A 5IVVA 5F32A 5FY7A 5ISLA 5A3WA 3LDBA 5FUNA 3OPWA 5FZFA 4CCOA 3N9MA 4GJYA 5IVFA 5LY1A 3PUQA 5FXVA 3U78A 4ASKA 4QXHA 2GP3A 5FYVA 5FUPA 2XDVA 5FY8A 5FPVA 2PXJA 4BU2A 5F3GA 3AVSA 5IVYA 4DO0A 3PTRB 4CUGA 4E4HA 5A7QA 5F3IA 4Y33A 4CCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQ6 A;  3KV5 A;  5FYS A;  5FZO A;  4NUB A;  4BIS A;  5IW0 A;  4LIU A;  5ANQ A;  5FY1 A;  5FZO B;  5KR7 A;  2VD7 A;  5FP8 A;  4QXC A;  4QX8 A;  5A3T A;  3LD8 A;  5FZ3 A;  5FZ4 A;  5IVB A;  4QXB A;  5A80 A;  5A7W A;  3N9L A;  5A7W B;  2P5B A;  5FPL A;  5A7P A;  4XDO A;  2YBK A;  5FYU A;  2YBS A;  5FV3 A;  3N9N A;  5FYY A;  5FZ7 A;  5IVC A;  2YU1 A;  5FP7 A;  4AAP A;  5FZ1 A;  3KV6 A;  5IVJ A;  3PUR A;  5A3N A;  4HON A;  3DXT A;  5FPA A;  2Q8C A;  2OT7 A;  5FPB A;  5A7O A;  5F5C A;  5CEH A;  4Y4R A;  4EYU A;  2XUE A;  5E6H A;  5FZ6 A;  5FWE A;  5FZM A;  3UYJ A;  1VRB A;  5FZI A;  5FZG A;  5FXX A;  5FXZ A;  3PUS A;  4EZH A;  4URA A;  5FP4 A;  4CCN A;  2Q8D A;  2OX0 A;  5FY5 A;  5FYC A;  5LY2 A;  2XXZ A;  4D6S A;  5FYB A;  5FBJ A;  3PU8 A;  3KV9 A;  3N9P A;  4XDP A;  5F37 A;  5FYH A;  3OPT A;  5F3C A;  5FY9 A;  3N9O A;  4D6R A;  4UF0 A;  4UF0 B;  5FZ8 A;  2YBP A;  2YU2 A;  2YPD A;  3KVA A;  3K2O A;  5LWB A;  5IWF A;  5FP9 A;  3ZLI A;  5FY0 A;  4Y3O A;  5FZC A;  5A3P A;  4EZ4 A;  4TN7 A;  3KV4 A;  5FYI A;  5FYZ A;  4IGO A;  2XML A;  5A7S A;  5A7N A;  4CCL A;  5FZH A;  4GJZ A;  3PUA A;  5IVE A;  5A1L A;  5FYT A;  2W2I A;  4V2V A;  5F5I A;  5FZ0 A;  3KVB A;  3AL5 A;  4LIV A;  5F2W A;  2Q8E A;  4QWN A;  4CCK A;  5FZD A;  4QX7 A;  5F5A A;  4BXF A;  3AVR A;  2WWJ A;  4CSW A;  5LW9 A;  4HOO A;  4CCJ A;  3N9Q A;  5FZ9 A;  5FYM A;  5FZK A;  5F39 A;  3ZPO A;  4GD4 A;  5F2S A;  3U4S A;  5FZE A;  3K3N A;  4C8D A;  3DXU A;  2GP5 A;  4GAZ A;  4D6Q A;  5FXW A;  5FWJ A;  5FZL A;  3NJY A;  4IGQ A;  4AI9 A;  3PU3 A;  4LIT A;  3RVH A;  5A1F A;  5FP3 A;  4LXL A;  5F3E A;  5FY4 A;  3K3O A;  5FJK A;  5FZA A;  5FPU A;  4QU1 A;  2OQ7 A;  4IGP A;  4V2W A;  2WWU A;  5FZB A;  5K4L A;  3PDQ A;  4DIQ A;  3AL6 A;  5FJH A;  2OS2 A;  5IVV A;  5F32 A;  5FY7 A;  5ISL A;  5A3W A;  3LDB A;  5FUN A;  3OPW A;  5FZF A;  4CCO A;  3N9M A;  4GJY A;  5IVF A;  5LY1 A;  3PUQ A;  5FXV A;  3U78 A;  4ASK A;  4QXH A;  2GP3 A;  5FYV A;  5FUP A;  2XDV A;  5FY8 A;  5FPV A;  2PXJ A;  4BU2 A;  5F3G A;  3AVS A;  5IVY A;  4DO0 A;  3PTR B;  4CUG A;  4E4H A;  5A7Q A;  5F3I A;  4Y33 A;  4CCM A; 
#chains in the Genus database with same CATH topology
 3U75 A;  5I93 A;  1LGN A;  5IW0 A;  1AJK A;  1C5I A;  2A3W A;  1MS5 A;  1RUH 3;  3U11 A;  5FLH A;  2VD7 A;  3VBH A;  5FZ3 A;  4Z2A A;  2XBO 3;  3K77 A;  4LEJ A;  2E33 A;  4PDW A;  2Q30 A;  4RS5 B;  3OUJ A;  1QHD A;  2VBB A;  3E6D A;  5FYU A;  3TN9 3;  3H1Y A;  5FYY A;  5FZ7 A;  2XLG A;  1OH3 A;  2J1E A;  4DEV A;  1ULO A;  1US3 A;  2TBV A;  3PUR A;  4WVZ A;  4Q4V 1;  1S1A A;  1KS4 A;  2ZGP A;  5A7O A;  1FMD 3;  5GAL A;  2X29 A;  3N7J A;  2F6B A;  1KFU L;  1VRB A;  4MVT A;  3RI8 A;  3L9J T;  3B5L B;  1R64 A;  1BK0 A;  5FZG A;  1YJK A;  5BY5 A;  4GAL A;  2OII A;  4IEQ A;  4QX3 A;  1FAY A;  1RUN A;  1NA1 A;  1AYM 1;  2MEV 3;  4HXC A;  5EXO A;  1IQD C;  4LE4 A;  1EUT A;  1JN2 P;  1D4M 3;  4RHV 3;  2GMM A;  4RQP A;  3WW2 A;  1UOB A;  5FR3 A;  1W2U A;  2WIN B;  3BOW A;  2JG8 A;  3OPT A;  4LUM A;  2JG9 C;  4DXS A;  1ND2 A;  4EQV A;  1UZ0 A;  2E6V A;  3ROU A;  1FXZ A;  3SCH A;  1E5H A;  2DCJ A;  2PA7 A;  2ZGM A;  2ZML A;  3OF1 A;  4P5Y A;  5K0U A;  2ET7 A;  2JDK A;  2UUR A;  3HMY A;  3ZLI A;  2ZGK A;  4WM7 A;  1IG0 A;  5SV8 A;  3UKN A;  4BOW A;  5JDB A;  4CUA A;  2V09 A;  4CXX A;  3POB A;  1K5M B;  3AZZ A;  5JIA A;  2QQP A;  4AFC A;  4EJR A;  2VL4 A;  4AFM A;  4AI3 A;  1GMM A;  2D6P A;  5A6Q A;  3NKT A;  2Q0A A;  2D3P A;  1AL0 G;  2ZPX A;  4YLZ A;  2ZS6 B;  1CAX A;  2ENR A;  2Y0O A;  2HWD 1;  3O0X A;  3Q8A A;  3LB9 A;  3VZJ A;  2PHF A;  5DDJ 1;  2D7F A;  2JEM A;  3TBD A;  3IPV B;  1AL2 2;  2WII B;  3OTF A;  2QBX A;  1ENQ A;  1LGB A;  4ZXK A;  3LOB A;  1FNZ A;  1RXG A;  3LQC A;  3ZFF B;  5JVV A;  3WF3 A;  1Q5O A;  2R07 2;  4NPM A;  1CZT A;  1NCR A;  2QQV A;  2VOT A;  2AAC A;  4UOJ A;  5CZK A;  2A3Y A;  1OVP A;  2O14 A;  4UW5 A;  4GH4 C;  4YG6 A;  1NQD A;  4D69 A;  4HPK B;  3LSD A;  2WS9 2;  2CWS A;  4YW1 A;  2JDH A;  4RR3 B;  4B7K A;  1CD3 G;  2VCB A;  3VBO B;  4CUB A;  3JD7 3;  5LAS A;  3WNX A;  1DBN A;  4AI0 A;  3E5X A;  4LXL A;  2VVE A;  1TME 3;  1WKY A;  1MZF A;  2WN3 A;  1OD3 A;  2OQ7 A;  4XJW A;  4I0W B;  2VUJ A;  1A8M A;  4BXS V;  3KHB A;  4LK6 A;  2GH2 A;  4QM8 A;  2EID A;  3CNA A;  5EJZ B;  2BBV A;  1ASJ 1;  1TMF 3;  4FBF A;  4MGT A;  4KU7 A;  4CCO A;  1KQR A;  4GJY A;  1YYN A;  1Q8V A;  2ZXQ A;  2W47 A;  3DKQ A;  3PUQ A;  4G9S B;  1SCS A;  1LOG A;  4KI5 M;  2LRO A;  4LLO A;  1W3V A;  2F4L A;  1RED A;  2OZ6 A;  1UPS A;  3HQU A;  3P6B A;  4YG3 A;  2JDA A;  3O14 A;  3ZIW A;  5A6X A;  2D6N A;  2R04 3;  4YW6 A;  2BZD A;  3AKR A;  3DPR C;  1BXH A;  4E4H A;  2BRT A;  3BAL A;  1RUG 2;  1ZA7 A;  2UY9 A;  2XL7 A;  1JXN A;  1R09 1;  2HLE A;  3IAQ A;  3JUU A;  1L3J A;  5ANQ A;  4XFH A;  1G9B A;  5CBL A;  2HWE 3;  2DCT A;  4AVB A;  1A78 A;  4GWJ A;  2XBO 2;  1V9U 1;  1F31 A;  1ALY A;  3AP5 A;  2DUO A;  4XE9 A;  5GLV A;  5A32 B;  5A7W A;  3M3I A;  4W65 A;  5JOW A;  1JW6 A;  2P5B A;  5CYY A;  5F1R A;  4WM8 C;  3RZL A;  1DQ5 A;  3NAP C;  1YQ8 A;  4HET A;  4AHY A;  4D7Y A;  5ABJ A;  4P9J A;  4XJ9 A;  3T1M A;  3PVN A;  4N43 B;  4LBM A;  4DXT A;  3I2H A;  3OD4 A;  5T54 A;  5HV0 A;  2JD4 A;  4JV4 A;  2IXL A;  2OT7 A;  3MUZ 1;  3HNY M;  1ENS A;  1PK6 C;  2XUE A;  4KWL A;  3WDU A;  4NRM A;  1YCI A;  1ZBA 2;  2XVK A;  3DYP A;  4A2U A;  2BNO A;  4N53 C;  4CZS A;  1VJ2 A;  3AZV A;  4B7E A;  4IQP A;  2MEV 2;  3E6B A;  3FFZ A;  1D4M 2;  5G04 L;  2B46 X;  3N7K A;  2VMH A;  1WCU A;  2NYY A;  1PIV 3;  2ZBJ A;  2ZHN A;  4IV1 B;  4Q4X 3;  4Y24 A;  1E5R A;  1LHV A;  2JE8 A;  4CTE A;  5FY9 A;  4LHN A;  5A33 A;  1NE4 A;  1SQ4 A;  3AFK A;  1CIW A;  3EQE A;  3ZDS A;  2FZ2 A;  1FAT A;  1UOJ A;  1Y43 B;  1JYW A;  1C28 A;  1UMZ A;  4ATF A;  1WWY A;  1DP0 A;  1BYH A;  3KB5 A;  5C9A B;  1O3R A;  1RUF 1;  3WT3 A;  5A3P A;  3V0A B;  1D4V B;  3K4A A;  2VQA A;  4XHX A;  4YPJ A;  3I3D A;  2G9F A;  2R1B A;  2ZAC A;  4CCL A;  1CPM A;  1SFP A;  3WDY A;  2WLP A;  1W6M B;  3PUA A;  3WP6 A;  4XTM A;  4YVS A;  4DUV A;  3LA3 A;  4MV2 A;  1JZ7 A;  2JDY A;  3K4Z A;  1F4H A;  5J1X A;  3PNA A;  4KBB A;  4PBO A;  2QQN A;  4J1X A;  3BTZ A;  3HBK A;  4BXF A;  2VCC A;  3R05 A;  4RD7 A;  3O1T A;  1LHW A;  2JG9 A;  3WY6 A;  1W2T A;  5D2A A;  1O3S A;  4LA2 A;  5FZE A;  4Y5Z 0;  3GNE A;  3WHU A;  4C90 A;  5KC5 A;  1DQ1 A;  3VBR A;  5FZL A;  2W68 A;  3WCR A;  3IDA A;  4IGQ A;  3PU3 A;  5JOZ A;  1MS0 A;  1K3I A;  5DAP A;  3EYP A;  2CAV A;  3JD7 2;  3PVB B;  5DG2 A;  5LK5 A;  1DZR A;  3IIA A;  1UU6 A;  1XB9 A;  3PIG A;  1TME 2;  3CEW A;  1RUO A;  5G05 L;  2O0O A;  3OD0 A;  2YMZ A;  4BQ1 A;  1KD7 A;  3AJZ A;  4RFR B;  4MXW B;  2BFU L;  4AQ2 A;  5E88 A;  1YFY A;  3J26 N;  4CU8 A;  2LAL A;  2OS2 A;  2UWA A;  4AYU A;  5IVV A;  1UOG A;  1P8J A;  4HKL A;  2VUD A;  3KCY A;  4URT A;  2VUA A;  4QX5 A;  5FZF A;  5IVF A;  3S5Q A;  3U78 A;  4MO3 M;  2YXS A;  3VKO A;  4O61 A;  1OA3 A;  1VAL A;  4XCA A;  5A70 A;  4JRA A;  1SBE A;  2R04 2;  3W20 A;  2R07 1;  4Q0Q A;  2DVG A;  5HCB A;  5A7Q A;  2ZHK A;  2WT0 A;  2ZGT A;  5DAW A;  3ZKU A;  3IWZ A;  3NV4 A;  5EWS A;  2EA7 A;  1YIP A;  2BVB A;  3BKZ A;  1V0A A;  1UZY A;  2RMU 3;  2A6W A;  2AEY A;  2WRA A;  3J8F 3;  5FK7 A;  2HWE 2;  3HOB A;  5FY1 A;  5FZO B;  2WS9 1;  3WF1 A;  1YEW A;  4XFC A;  3RMY A;  2P3Y A;  2HEY F;  2V72 A;  4UFI A;  1M4W A;  1H2L A;  2EXH A;  5A80 A;  1RUJ 3;  2XWJ B;  5KXD A;  4TSV A;  5M0T A;  4B3N A;  4UXA A;  5T5O A;  5FPL A;  5IK8 A;  4PF5 A;  1H1A A;  1RUE 2;  1JI6 A;  2R0F A;  3HD8 B;  5JLV A;  4AAP A;  1URX A;  1LHN A;  3MPB A;  2A73 B;  3I2I A;  1HDK A;  5CFD B;  2V4A A;  2JIJ A;  1VBC 1;  2ET1 A;  3MV1 1;  3BIE A;  1O6U A;  3FN9 A;  3VHP A;  1UW8 A;  4J25 A;  2WR9 A;  3ST7 A;  4GB3 3;  5FWE A;  4GH4 B;  1HKD A;  4NRQ A;  3GCW A;  1WW4 A;  3DPR A;  3VKL A;  2V5Y A;  1UCX A;  2VGD A;  1YC6 1;  4HKO A;  4XVH A;  5FXZ A;  1H9W A;  3MBW A;  1YFX A;  2VEC A;  4BQ5 A;  4Q4X 2;  5E89 A;  5FYB A;  1GZW A;  2CSG A;  2GC1 A;  4OUE A;  5F37 A;  2BOI A;  2RS3 2;  4GXL A;  4RN5 A;  5F3C A;  1TZO A;  4HSJ A;  1B35 C;  1RUG 1;  1H6Y A;  2BW8 A;  4A41 A;  3FWE A;  3R4U A;  4B4P A;  4D3W A;  2VZS A;  2ZGO A;  3ZXF A;  1Y3T A;  3ZDV A;  4WM8 A;  3NRU A;  2Q1Z B;  2A75 A;  3BB6 A;  1O5U A;  4YNI A;  3KD4 A;  2RDS A;  1XU2 A;  3OYW B;  2QNK A;  4AGV A;  4FPH A;  5FZC A;  1A34 A;  3H3Z A;  3VBF C;  3Q8F A;  1UMI A;  3ACF A;  2RS5 1;  4N90 A;  4XZP A;  3UKT A;  1NT0 A;  4FO9 A;  1SLB A;  3M2M A;  1GIC A;  4AF9 A;  3H8O A;  3OY8 A;  1COV 2;  4FPC A;  3H7Y A;  1GOF A;  1UZZ A;  2W2I A;  1SDD B;  1W9Y A;  1ZZB A;  3DPR B;  5BNP A;  4N53 A;  3UL2 A;  3VZL A;  1JU3 A;  3VHO A;  2RR1 1;  4DIN B;  4LIV A;  2X05 A;  4XUT A;  5DUW A;  5EP9 A;  3FX3 A;  4I3P A;  5IT6 A;  5E8A A;  4UYB A;  2YC2 A;  4ATE A;  3KT4 A;  2E32 A;  4KNC A;  4QHO A;  5EJ1 B;  1YO8 A;  3DUI A;  2ZHM A;  3K46 A;  3WIN E;  2ZEX A;  4AVT A;  5FXW A;  1NQJ A;  4Y20 A;  3NAP B;  1DCS A;  1RUD 2;  1AVB A;  3AM2 A;  4IXL A;  1QXP A;  3IDE A;  1OQE A;  1BBT 3;  4I02 A;  1FPN 1;  4NHM A;  3VHN A;  4BQ3 A;  5JSO A;  1KS5 A;  5JR2 A;  1OA2 A;  2JE7 A;  1TE1 B;  5J09 A;  1PK6 B;  3M3Q A;  1PX4 A;  4AFA A;  3NJV A;  5K4L A;  1OFN A;  2VTF A;  3UNP A;  1MEC 2;  4LBL A;  2WO7 A;  3BPZ A;  4BIO A;  4QQL A;  1VIW B;  3POI A;  2W9X A;  2E31 A;  1G7Y A;  1SPP B;  3E5U A;  5CVR A;  1OOP C;  5FUN A;  4PIX A;  5KHJ A;  2VQ0 A;  4KGQ A;  2YDE A;  1BHG A;  4NN0 A;  4WVW A;  2PMW B;  4RGG A;  5F3G A;  1OQD A;  4A7Y A;  1IS5 A;  5T5J A;  4E4S A;  3ON7 A;  1GV9 A;  3TEX A;  4Q4W 3;  3D82 A;  3N7M A;  1F5J A;  4JTN A;  5FUI A;  1T6B X;  3O1S A;  1Q56 A;  3GJA A;  5F3I A;  1J84 A;  2VOK A;  5TSW A;  1XE8 A;  1C5H A;  3J8F 2;  4GMP 3;  4JGZ B;  1W9F A;  1YI7 A;  3LD8 A;  3WUC A;  3T0D A;  1GP6 A;  3DYO A;  2K0G A;  2QQI A;  2Y34 A;  5FQ0 B;  2G4I A;  4XUR A;  1PO1 2;  1HB2 A;  3ABZ A;  1WW6 A;  1CJD A;  3VBU C;  2DFB A;  4EN6 B;  1WD3 A;  4BQX A;  4AED C;  1H4H A;  3CJI A;  1ZBE 3;  4LBQ D;  4YYO A;  5C5U A;  5CAD A;  5EYY A;  1JHN A;  4WBB A;  4QU2 A;  4CDQ C;  1WMD A;  3ZXJ A;  2PHT A;  4FFF A;  1O7F A;  5GLT A;  2BJS A;  3PTY A;  2CHH A;  2JEN A;  4MYE A;  4QXK A;  5GZE A;  4CDX A;  4GB3 2;  1VB4 A;  3UYJ A;  1VBA 1;  2JDM A;  5J96 B;  4QDQ A;  1RJ7 A;  3SH4 A;  3FBM A;  5FPZ A;  1ULD A;  1D2Q A;  1QH7 A;  2XXZ A;  4XMA A;  1WLT A;  4JGY B;  5FBJ A;  3O1R A;  3E1F 1;  3PU8 A;  5DAQ A;  4YVW A;  2JDP A;  4YSF A;  4DRV A;  5C4W C;  1J83 A;  3NKG A;  1SFN A;  1CAW B;  5FLJ A;  3T4H B;  3AYA A;  1DGL A;  5IAV A;  3X29 B;  2QJV A;  2RHP A;  1LR5 A;  2VNG A;  4IV3 C;  4BIF A;  4XDQ A;  1JZ5 A;  4XPV A;  4EZ4 A;  4JKL A;  4LTA A;  4B1L A;  2ZX0 A;  5LBF A;  2XML A;  1QOO A;  1AJO A;  1XOY A;  1JHJ A;  1RUE 1;  2ZGU A;  3POJ A;  4GQ7 A;  5CNA A;  5IVE A;  2DUR A;  2OYZ A;  5B2G B;  1CJP A;  4QWN A;  3CMG A;  5FK8 A;  2PAE A;  4LQR A;  3HR9 A;  1S2K A;  1MVQ A;  4ES9 A;  3RDI A;  4HOO A;  2AGS A;  5FOJ B;  4H2A A;  3GM8 A;  2F4P A;  4LBQ A;  2NQY A;  5GLW A;  3LKJ A;  4OI2 A;  1G9D A;  1NAE A;  1UKG A;  5K7P A;  5FRE A;  4JDN A;  3C7O A;  4MGQ A;  2RS3 1;  4AQS A;  2E7A A;  3K75 B;  3ZMN A;  4Z82 A;  2YY1 A;  5HCA A;  2G19 A;  4D8M A;  1X8M A;  2PHR A;  3VBF A;  4Z8B A;  4P9L A;  1CR7 A;  2KXL A;  1W28 A;  2ARE A;  4Y22 B;  4E9K A;  1V6O A;  4RYD A;  3WDW A;  1HXS 2;  3LIH A;  4DY3 A;  4XHB A;  1XQN A;  2XKO A;  1LES A;  4RS5 C;  5I0R A;  1N1V A;  1NX9 A;  1UNB A;  4HK8 A;  4V1P A;  4PQQ A;  3KF3 A;  1WGP A;  4FCA A;  5F32 A;  1WCS A;  2DWR A;  4A3X A;  3OGR A;  5ISL A;  4DQA A;  1AR8 3;  2GDF A;  4A6S A;  2Y6J A;  5FXV A;  4XW3 A;  4YM2 A;  3RRD A;  1AR9 1;  1EAH 2;  1B35 B;  5HPO A;  2HYK A;  5CEH A;  1BEV 2;  2OUJ A;  2YZ4 A;  3M70 A;  1GZC A;  5IVY A;  2JKX A;  3BGA A;  3K48 A;  1XSQ A;  2RVA A;  4MGK E;  1SLI A;  2JX9 A;  4Q4W 2;  3AKS A;  2DCZ A;  2ZZJ A;  1SBD A;  2DTY A;  3I97 A;  5F6L B;  5LCW L;  4QM9 A;  4QB6 A;  3GYD A;  4NRP A;  5LEJ A;  3I2O A;  4D94 A;  5A6Z A;  4B4Q A;  1VMH A;  4IL7 A;  1EY2 A;  1UXZ A;  4FTB A;  1RUD 1;  5DXD A;  2GNB A;  2R7E B;  5JXH A;  1GWK A;  1PNG A;  1Y9M A;  1NXM A;  3S30 A;  3JCI A;  4LPL A;  1JYV A;  1D0H A;  4CE8 A;  1AZD A;  5A7P A;  1BMV 2;  3KQR A;  1ZBE 2;  3OB8 A;  2V5D A;  3MDP A;  3H50 A;  1HRI 2;  1MEC 1;  4XF1 A;  2YYO A;  1QQP 1;  5T50 A;  4IER A;  3ENR A;  4AK3 A;  1O59 A;  3MGU A;  4PCR A;  4E8C A;  2VCA A;  5C33 A;  5JUV A;  5AFE A;  1F5F A;  3UT0 A;  5FZ6 A;  4AE2 A;  5CU1 A;  2DTW A;  4NHY A;  4E27 A;  3G6J B;  5C71 A;  1DGW X;  1RUI 1;  1WCQ A;  3NW4 A;  2B42 B;  4URA A;  5DPN A;  1RIR A;  1LED A;  2ORX A;  3AKT A;  2RV9 A;  5HXM A;  3C7H A;  2CY6 A;  1G9C A;  2VW1 A;  2Q8O A;  4XUP A;  4MX3 A;  4ARX A;  3CHX A;  2CTV A;  1H9P A;  2HWB 2;  1FYU A;  2XJR A;  3WD5 A;  1WMF A;  4CEY B;  3ZFE B;  3P1I A;  4J6G A;  2ZAB A;  5FY0 A;  5HCF A;  4AED A;  4TWT A;  1OOP B;  5IYY A;  2EAL A;  4RGK A;  4IEP A;  1IPS A;  1CZV A;  5C70 A;  2K9Z A;  3SKV A;  2BEO A;  5FYI A;  4IE0 A;  3CL1 A;  2A71 A;  2XHN A;  3R6S A;  2RG4 A;  2DVB A;  2WNV A;  3V0B A;  5FCC A;  1V6M A;  2B9U A;  1I5Z A;  1ST8 A;  1UYZ A;  3NNG A;  4HLT A;  2I2S A;  1DYP A;  2QUO A;  2DCK A;  3MW2 A;  4MSV A;  1FOD 3;  3RZG A;  2ZAA A;  4WZF A;  1VBE 3;  4LE3 A;  2DVF A;  3AL5 A;  5F2W A;  1RUF 3;  2WC2 A;  5BXX A;  3CZU A;  2IWG B;  2JIC A;  3H8U A;  1ENX A;  2B7Y A;  5F5A A;  1ODN A;  1MZE A;  3GDB A;  4FFI A;  4CSW A;  1JZ6 A;  4AHW A;  1BKZ A;  3BIW E;  3OSD A;  5C4W A;  5IK4 A;  1IG3 A;  1IQA A;  2ZMN A;  1GP5 A;  5AFB A;  2YV8 A;  4ZXE A;  3VB9 A;  3DL3 A;  3VBU B;  3JQX A;  1OUS A;  3H9A A;  4MET A;  4PJY A;  5GLZ A;  4IV3 A;  3RMX A;  3AYE A;  4YGE A;  4I2O A;  1JU4 A;  3RZK A;  3W21 A;  5C3R A;  2PFW A;  4CDQ B;  4CCC A;  1HJG A;  2Q1M A;  1Z7S 3;  3KMH A;  5GZF A;  5A3U A;  1J1L A;  5IK7 A;  3ZN6 B;  3VUO A;  2WYS A;  5FPU A;  1GSL A;  3S57 A;  4UW3 A;  1UL9 A;  5CAZ A;  1K45 A;  2HWC 2;  1J1T A;  5DMY A;  5J7M A;  4A7Z A;  4ZZ8 A;  1H8T B;  3AMM A;  4NPL A;  1LOE A;  2VVD A;  3IMM A;  1AUY A;  2BFU S;  4F7Z A;  4HVR A;  3WOG A;  2FCV A;  1AYN 3;  1VAM A;  5GJ6 A;  1HRV 3;  2GP3 A;  1C8N A;  2Q5T A;  2PHW A;  5FY8 A;  1R1A 1;  1W90 A;  2CNA A;  1WUV A;  2HEV F;  3MI8 A;  4YW3 A;  5FMO S;  1CAV B;  4ET7 A;  2GNM A;  1E5I A;  4NPR A;  1A6C A;  2RM2 2;  4U36 A;  5ACA 3;  5HV4 A;  1EUU A;  1HN0 A;  1DYO A;  2WNO A;  4LIU A;  4PBP A;  4ZU5 A;  3ZSL A;  4D7S A;  5CKQ A;  1LAJ A;  3UES A;  1W8F A;  5FP8 A;  4BK4 A;  5IHR A;  3NWK A;  5F8P A;  4RS5 A;  1C3H A;  3ORJ A;  3Q9O A;  4LBO A;  2Y6K A;  4G4F A;  5EV7 A;  4QKF A;  4IES A;  2CGP A;  3GBG A;  1UMH A;  2QDN A;  5CB7 A;  1JYC A;  2E7T A;  2YFZ A;  4XBN A;  5AC9 2;  1EPZ A;  2VW0 A;  1PO2 2;  3PIJ A;  3BOD A;  4NOT A;  4PT6 A;  3LF7 A;  3A0N A;  1AR7 2;  3VKN A;  1WME A;  4TZD A;  1QJX 2;  2XQR A;  1YFW A;  1HV1 A;  4YRD A;  4XOG A;  3AMH A;  1BEV 1;  2W5F A;  3ZSJ A;  3NNM A;  3WW1 A;  2OA2 A;  1LKN A;  3I2J A;  2B8M A;  2J1A A;  1W8O A;  2UWB A;  1S0D A;  3KCC A;  4QMA A;  5FYC A;  3RGB A;  4MXV A;  1W99 A;  4E4D X;  4KG8 A;  5JWP A;  4D6R A;  4CUC A;  4O9G A;  3WG2 A;  4LJH A;  4UF0 B;  2R06 3;  2YU2 A;  1X82 A;  3M3C A;  5CKN A;  4CCD A;  4FPO B;  4XUQ A;  2WFF 2;  3ILR A;  4UFJ A;  1RMU 1;  4CP1 A;  3UGF A;  3VGI A;  4TN7 A;  1LOF A;  1K5M A;  4JHZ A;  5FYZ A;  1ZZ6 A;  1JYN A;  3BYW A;  4UBG A;  2LRP A;  5KHH A;  4LO7 A;  1UY2 A;  3ACH A;  4LKE A;  1VP6 A;  5A1L A;  2C26 A;  1HRI 1;  4DZG A;  4QHB A;  1FOD 2;  4EWD A;  1AX1 A;  2X8K A;  3IPV A;  2BGP A;  1VBE 2;  5L73 A;  4IE4 A;  4B8E A;  3PUI A;  3WCS A;  5C8C C;  1X9P A;  3VLB B;  2P34 A;  2WSU A;  3ZFF A;  4XXP A;  1JYI A;  3MLL A;  2ARX A;  2WWJ A;  2HH9 A;  2XB6 C;  3OEB A;  5LW9 A;  5EHD A;  3SIS A;  5FZK A;  2CDP A;  4C0H A;  3J7M A;  4GD4 A;  1OLR A;  3AMP A;  2QQM A;  3WQB A;  1VBD 1;  3CO2 A;  3O1P A;  3NMB A;  4HPK A;  1IKQ A;  2A6V A;  2RR1 3;  4D6Q A;  1F15 A;  1IS6 A;  4RR3 A;  2XLF A;  3VBO A;  3R4D B;  4JC1 A;  4OHY A;  2HWB 1;  1DGW A;  1W8U A;  5SV5 A;  3USS A;  4TTG A;  1NY7 2;  1Z7S 2;  4H7M A;  4AQT A;  3SMH A;  3A4U A;  3ELN A;  4OQ9 A;  1AXZ A;  3UJO A;  2WSV A;  4KG0 A;  2J1T A;  4UT5 A;  1S0I A;  3HEI A;  2I45 A;  4DIQ A;  3AL6 A;  4P02 B;  1N1T A;  5ANN A;  1VPH A;  4LA3 A;  3TAY A;  2G9Z A;  3WSO A;  4KWJ A;  2CDO A;  2X53 S;  1GLH A;  5CFD C;  4ZZ5 A;  2XH6 A;  2VNR A;  4LHL A;  2GAU A;  5FPV A;  3NNL A;  4NIH A;  4YM0 A;  3KHC A;  1OVS A;  2IVJ A;  3NNF A;  3POS A;  3C2U A;  5EJ3 A;  3WW3 A;  4S2G A;  5ACA 2;  1JYX A;  4BJ0 A;  1U5I A;  2UYA A;  1JUI A;  4OLL A;  5JXJ A;  1N3P A;  3WG1 A;  3KSC A;  1YLL A;  1JH5 A;  1G8W A;  4XAA A;  3USU A;  5A32 A;  2BVV A;  2A7A A;  3N36 A;  5FO9 B;  4Q0V A;  5T5L A;  2IXK A;  4DS0 A;  1OBN A;  3MW4 A;  1CGP A;  4FOW A;  4OZO A;  3VN4 A;  1RHI 1;  4N43 A;  4LOT A;  3KV6 A;  5IVJ A;  2HWC 1;  1YIF A;  2NZ9 A;  2FZ1 A;  2XGX A;  4LKF A;  4QPY A;  2ZOE B;  5E16 A;  5E1R A;  1IPK A;  4UI9 L;  1US2 A;  1QJU 1;  4XXA A;  1S0J A;  3B9C A;  2ARC A;  3LFM A;  1FI2 A;  4K9S A;  5FZI A;  1Z0H A;  3EMR A;  2Z42 A;  1ULC A;  4EZH A;  1LOA A;  5LBE A;  3AP4 A;  3C8X A;  1RUH 2;  1W39 A;  3NV2 A;  3DKW A;  4IV1 A;  1IPJ A;  2WO2 A;  3BPS A;  3BU0 A;  2QCS B;  5L7O B;  1OLM A;  1MS3 A;  1AR6 1;  2LUW A;  1DF0 A;  1VBA 3;  2VZQ A;  4XF0 A;  1JZ3 A;  3WP3 A;  3MF6 A;  5D21 A;  2DF7 A;  4FI9 A;  4X6Q B;  2D3S A;  3TN9 2;  4DB5 A;  2WAO A;  1QJY 1;  4JX0 A;  2WZR 1;  5C9A A;  2PLV 1;  3LWC A;  4HL0 A;  3V0A A;  3D8C A;  1G9A A;  3MYX A;  5A3L A;  2W87 A;  1FMD 2;  1WLD A;  3TNP B;  1W6M A;  2O1Q A;  2E63 A;  4BM8 A;  4BQW A;  4ITC A;  3NVC A;  1DFQ A;  4NII A;  4M0N A;  1HQL A;  4BB3 A;  4BPZ A;  1PO2 1;  5JXG A;  4RHV 2;  4ORF A;  4JTO A;  3D6E A;  1AR7 1;  1QJX 1;  1XNK A;  4L11 A;  4BQY A;  1NE6 A;  2HWF 3;  4GKX A;  1C8M 1;  1PGL 2;  4L97 A;  2D3R A;  2JE9 A;  5F2S A;  2R16 A;  5I8T A;  3O1U A;  3AX4 A;  4C8D A;  3OOX A;  2JEC A;  4P9I A;  2TEP A;  3ZOI A;  5FMC A;  3RG0 A;  4W6Y A;  1AXY A;  1XNA A;  2ZGN A;  2ZX1 A;  3QH7 A;  4XZU G;  3SEP A;  1HQW A;  2LS6 A;  4ZS3 A;  2B5H A;  1MS9 A;  2VW2 A;  1RL3 A;  3HN3 A;  2GNT A;  4JGZ C;  1ENR A;  3IN9 A;  2WFF 1;  4L92 A;  4M3C B;  1POV 1;  1XPW A;  3T30 A;  3CU7 A;  4MUV A;  2FMY A;  2ATF A;  4UBH A;  4MXW A;  1J59 A;  3RZH A;  4TLG A;  3HQX A;  3THC A;  5KHI A;  4AG4 A;  3WNL A;  1KGY A;  1PMJ X;  3LOI A;  4MGZ E;  2VMF A;  4DOU A;  4LLF A;  4IEY A;  2E53 A;  5L36 A;  2ID4 A;  4A4A A;  2XKP A;  4HN1 A;  4AEM A;  1OQ1 A;  4HMZ A;  3VV1 A;  4BU2 A;  5IK5 A;  5F7U A;  1PMH X;  2W95 A;  1NZC A;  1VR3 A;  2O8O A;  2VTX A;  1JTZ X;  3QOP A;  5H9R A;  3AZW A;  1J3P A;  3H3L A;  3T0B A;  4Q4Y 3;  3KV5 A;  1RVF 3;  4JGY C;  5FZO A;  4NUB A;  4EWE A;  3SC7 X;  1J3Q A;  3DN7 A;  4NIA A;  3WVJ A;  4XYX A;  4C1W A;  1O3T A;  1W3X A;  2WN2 A;  2Y33 A;  1EPW A;  4HFS A;  4MHU A;  3AKQ A;  1IS4 A;  5IFP A;  1RIN A;  3N9L A;  1N1Y A;  2JDZ A;  4I0A A;  2PQQ A;  3WEZ A;  5LA1 A;  3F95 A;  4AHX A;  1O5L A;  1TMF 2;  5C8C B;  2YBS A;  3W59 A;  1VBB 3;  2RS1 3;  2KD7 A;  2ZX2 A;  3JZV A;  5GZG A;  2AYH A;  1UY4 A;  5CFD A;  4XCB A;  1AL2 1;  2CGO A;  3LPF A;  4NAM A;  2Q8C A;  3UET A;  3DF0 A;  4COY A;  4LO5 B;  4QDR A;  4GH4 A;  1LOB A;  1UYX A;  5GKA C;  1F4A A;  3OGS A;  4Y1V A;  4XJ8 A;  2MHF A;  4NR1 A;  1W0O A;  2BGC A;  3ETP A;  1ND3 C;  1QQP 3;  2OX0 A;  5LY2 A;  2K2S A;  2PHX A;  4I0B A;  2C1F A;  1S0B A;  2C9A A;  4HG6 B;  3VBS C;  2GN3 A;  2LW8 A;  3FLR A;  1SAC A;  5JI9 A;  3GGL A;  2W39 A;  4FPE A;  4QHZ A;  2J1U A;  4CU9 A;  1RUI 3;  4ZS2 A;  1UY0 A;  3JXS A;  1PVX A;  1GU3 A;  1NXD 1;  1RTV A;  1WLC A;  4QX2 A;  1XNB A;  2BV4 A;  3OYW A;  5ERL A;  5JPM B;  4EN8 B;  2FDK A;  3WNN A;  1SLT A;  4Y3O A;  1C1L A;  3MIB A;  1STM A;  5DQ0 A;  5A7S A;  1S0G A;  3R4S A;  3S7I A;  3TNQ A;  5KBF A;  3FLP A;  1PM7 A;  3LPG A;  4XC9 A;  3GCX A;  2OXB A;  1OKO A;  4CP9 B;  2W0X A;  4P9X A;  2WA4 A;  5FPX A;  4COW A;  3BTY A;  5JCT A;  2FDH A;  1AXK A;  1Q8Q A;  3LIG A;  3MUY 1;  1PIV 2;  2RJ2 A;  3IAP A;  3KZ4 C;  5FZD A;  2FDG A;  1W2O A;  3QD6 A;  3VDC A;  4CDU C;  2GAL A;  3PME A;  1VRH 3;  3ECQ A;  1XYN A;  4XAC A;  1RGS A;  5F39 A;  3FJS A;  5FLI A;  3BTX A;  1RUH 1;  5F5Q A;  3ALQ A;  4P9G A;  2ILM A;  3NAP A;  3V64 A;  2XBO 1;  4NRO A;  2VZU A;  3L2H A;  5H9P A;  1EV1 3;  4ZY9 A;  4AI9 A;  1ZRE A;  4Q29 A;  1BVP 1;  2JB4 A;  2QDR A;  2EXJ A;  3F2Z A;  3GF6 A;  3IDB B;  5EQU A;  3TRS B;  3RVH A;  5FP3 A;  1PK6 A;  1R08 3;  2EF6 A;  1QDO A;  2EVX A;  3RQ0 A;  1LOC A;  5JZG B;  5J37 A;  1OFS A;  1NCQ C;  4X8N A;  3JBG 3;  3HT2 A;  5DZF A;  1W8N A;  4C91 A;  1PVC 3;  1SPP A;  4CEW B;  2Q1F A;  4O7X A;  1UXX X;  4N9H A;  1X9T A;  1O8P A;  1ZBA 1;  2LTN A;  1JZ8 A;  3FE5 A;  3D5O A;  1KXG A;  1TNF A;  1GP4 A;  2MEV 1;  3AP7 A;  3LEI A;  4GUL A;  4LNV A;  5FYV A;  4RHV 1;  1D4M 1;  2ZEW A;  2IFR A;  4ERO A;  2JD9 A;  1JS9 A;  1ZZC A;  2EIB A;  4QB2 A;  2W3J A;  5JOX A;  1HN1 A;  2P3I A;  1QF3 A;  2XJU A;  4FPL A;  4JCK A;  3JU9 A;  5JPN B;  1ZRI A;  3VDD C;  1RVF 2;  3B93 A;  3JQW A;  3M4F A;  4Q5O A;  1HV0 A;  3MIG A;  4AFD A;  5CFC B;  5KXC A;  4GA9 A;  4JGZ A;  4K7J A;  4Z07 A;  3NV3 A;  4C0B A;  5LBB A;  3TEZ A;  1CN1 A;  3KLS A;  3OEA A;  5EZW A;  3S5A A;  3HPN A;  1C57 A;  5FQ0 A;  1D0G A;  5GM0 A;  1KFX L;  4XFF A;  4CEY C;  1OMI A;  3VL9 A;  3ZFE C;  4L8Q A;  1DYK A;  3MIH A;  1OUX A;  1GZ9 A;  1ODM A;  2YBK A;  2YFU A;  3KCX A;  1VBB 2;  4PIY A;  4XDO A;  2OKX A;  2JXA A;  1ZNP A;  2HKX A;  3AKP A;  3OCP A;  5FP7 A;  5FZ1 A;  2VZT A;  3FUO A;  2PQS A;  5FIX A;  2WO3 A;  2WNU C;  2BTV C;  3G7D A;  4QQP A;  4Y5S A;  4QDS A;  1W9S A;  4XIL A;  3RPQ A;  5E6H A;  1GNH A;  5IFT A;  1LEM A;  4QPG B;  2W1U A;  2X5I B;  2VJX A;  2VZV A;  3PUS A;  3I54 A;  1X36 A;  1CX4 A;  5FP4 A;  2RMU 2;  1NOV A;  4JGY A;  4K21 A;  5BNN B;  2ORZ A;  3EHK A;  2K46 A;  2BER A;  2GZW A;  2BYV E;  1RUC 3;  2Y6H A;  1SBF A;  2GME A;  2VY0 A;  3TYJ A;  5FKB A;  3VZO A;  1CAW A;  4DUW A;  3JD7 1;  5C3S A;  1RUJ 2;  2ZGR A;  3MIE A;  4QQH A;  3VDA A;  4BDV B;  1TME 1;  2RS5 3;  1QXR A;  2VO5 A;  5DUV A;  3SIT A;  3AZX A;  1YJL A;  3DYM A;  1OT5 A;  4CYD A;  5FP9 A;  2ZA9 A;  1F8V A;  5A3O A;  2XJV A;  3T1L A;  1HW5 A;  4QQO A;  4I01 A;  1GOH A;  2WFP A;  3KV4 A;  1OXC A;  4IGO A;  1UZV A;  2F17 A;  4AZZ A;  2CU5 A;  4P14 A;  2VQU A;  1PZ8 A;  4IET A;  4ZKT B;  2VC9 A;  4E2Q A;  4XF4 A;  3N7L A;  1H8T C;  3CIH A;  2FDJ A;  1QDC A;  4YFW A;  4LBK A;  3ZVX A;  2R04 1;  4Q4V 3;  3NJZ A;  4F8A A;  5FYM A;  1VRH 2;  3VKF C;  2ZZQ A;  3RWK X;  1WLW A;  2R49 A;  2C6S A;  2H0B A;  3H42 B;  1W6Q B;  1JOD A;  1H8V A;  2VMD A;  3BOP A;  3L2Y A;  5DG1 A;  2AEZ A;  2HWE 1;  1AYM 3;  1C1F A;  2X10 A;  3O1V A;  3RYK A;  3ZYF A;  4RSU A;  4XJU A;  1EV1 2;  2Z5W A;  4IEZ A;  3S7E A;  3RZM A;  3QH6 A;  1BCX A;  3AB0 A;  3LCP A;  4COU A;  2A70 A;  3FHQ A;  3I2F A;  4XET A;  4QPW A;  4HVO A;  1OC1 A;  4Y22 A;  1R08 2;  4OUL A;  2ZMK A;  2P37 A;  4XTP A;  1LUL A;  2WWU A;  3JBG 2;  5FBZ A;  3LEM A;  4ONU A;  1GQP A;  4XAE A;  1IGO A;  1L7L A;  2G9G A;  5FMD A;  4N7I A;  5F9T A;  2BDR A;  1I9R A;  1ND3 B;  2PHU A;  2NMO A;  2XWB B;  5A3W A;  4NHK A;  3RS6 A;  4AQ6 A;  3OPW A;  4QKB A;  3VBS B;  1XYP A;  1B35 A;  4NO4 A;  1G86 A;  1QMJ A;  2EIC A;  1LTE A;  3AMQ A;  2HWD 3;  3A22 A;  4Q4X 1;  1PIV 1;  4AW7 A;  5DDJ 3;  4CXY A;  2GH8 A;  3I59 B;  4P5H A;  2J1V A;  5D1I A;  2VM9 A;  4H7L A;  1VMJ A;  5BNQ A;  1BBT 2;  4KWK A;  2Z2S B;  2W1Q A;  1AX2 A;  1J58 A;  1MAC A;  3J7H A;  4LUL A;  5BNO C;  1EYB A;  1WBL A;  1S2B A;  2Y8K A;  4IEU A;  3LFI A;  4OMC A;  2J7M A;  4QX8 A;  3GZU C;  4QPI C;  1PGS A;  2IVI B;  1LU2 A;  2D6L X;  3HJR A;  2VXR A;  4GMP 0;  4JRL A;  3HWJ A;  1JUH A;  4L2N A;  4K20 A;  1COV 1;  1RJ8 A;  4ISR A;  2WZP P;  3VD3 A;  1YUD A;  1ZYB A;  2WQ8 A;  4LBN A;  2GSY A;  1LHO A;  2YU1 A;  4CDU B;  1LRH A;  5DZG A;  1WW5 A;  4M4P A;  5FKC A;  1H2K A;  3CBN A;  3O0W A;  5FPA A;  2WYF A;  1FNY A;  2XG3 A;  3M3O A;  3B9I A;  1FT9 A;  2UYB A;  4FAH A;  4OI0 A;  2ZGL A;  1ASJ 3;  2Z4F A;  1XE7 A;  2QE3 A;  4NVP A;  1DQ4 A;  5FXX A;  1PNF A;  1H2N A;  1MZ5 A;  1QKQ A;  1RHI 3;  4UW6 A;  4XFB A;  5KHK A;  1QJF A;  2VQT A;  2WO1 A;  3ZIX A;  2DDU A;  2C9K A;  3ACL A;  3ZYP A;  3RYP A;  3KV9 A;  1RUC 2;  3N9P A;  2C0Z A;  2P3J A;  5CIR A;  3TB0 A;  5T5P A;  3N9O A;  5D8A C;  3LE0 A;  1NCQ B;  1VLN A;  1T6G C;  1W2N A;  1W0N A;  1W6N B;  1YI9 A;  2P17 A;  1I5P A;  2RS5 2;  2YPD A;  4FQZ A;  4YGC A;  4ZPI A;  4WV8 A;  5I0T A;  1R09 3;  1N3O A;  3ZFE A;  4AEJ A;  4CEY A;  1OOP A;  1DZQ A;  3ZFG C;  1ULP A;  5LK7 B;  1ONA A;  4R9A A;  1F2N A;  1V6K A;  4MAD A;  2PAK A;  5LRS A;  1V9U 3;  4FPG A;  4OUM A;  4EWA A;  1LEC A;  2YPJ A;  3VBH C;  2I74 A;  2WZR 3;  3OJB A;  5JXI A;  2VBD A;  1MS1 A;  4JAA A;  2CV6 A;  3VDD B;  4FPJ A;  4Q4V 2;  3WP4 A;  2XQX A;  3ME2 A;  1CAU B;  4WVM B;  4LBJ A;  4E4Z A;  1E5S A;  4BQ2 A;  5IVC A;  3N9Q A;  1X33 A;  2VU9 A;  4M0H A;  4XBL A;  3W5N A;  2V4V A;  2Y64 A;  1DGR A;  2GND A;  2RMU 1;  3VBU A;  3POF A;  3J8F 1;  2P1B A;  1AYM 2;  1YHF A;  1OH4 A;  1X50 A;  1A3K A;  1RUJ 1;  2QQU A;  3FMG A;  4CDQ A;  3UV9 A;  1PO1 1;  4G3Y C;  2CWM A;  1DLC A;  3H8R A;  1NA1 C;  4IEW A;  3ZN6 A;  2WNU B;  3PUH A;  3QLQ A;  2DFC A;  3V65 A;  4JQR A;  1TEI A;  4RQP C;  1N47 A;  4AI1 A;  2ARB A;  4XIK A;  3GJB A;  5EFU A;  2D6K A;  2WLQ A;  1ND2 C;  3PDQ A;  1H8T A;  3S6P A;  1W2A X;  5EIY B;  3J9S A;  5K0U C;  4GB3 1;  3SCF A;  2IUW A;  3RJ2 X;  2XHK A;  3HT1 A;  2QQJ A;  4P9W A;  1O3Q A;  4WM7 C;  1POV 3;  3ZSK A;  4XFA A;  4QXH A;  2Z69 A;  5FUP A;  4JKK A;  2BNM A;  4KWU A;  1W6P B;  4MHR A;  4ZU7 A;  5DAX A;  1CAV A;  3LAG A;  4YW7 A;  2VNO A;  1IS3 A;  3USU B;  2UY8 A;  3NV1 A;  2TUN A;  3WQ0 A;  2B39 A;  4BLJ A;  3E97 A;  2W46 A;  3OBA A;  3WF2 A;  1CES A;  4Q1P A;  4CCM A;  2VMC A;  3GXU A;  4L9B A;  4DXR A;  2CAU A;  3SLI A;  5JMC A;  3INA A;  5FYS A;  3BI3 A;  5DAV A;  1N3Q A;  5L7O C;  4OMD A;  1F9K A;  2VZO A;  4LKS A;  3IM0 A;  3ZXE A;  4HT1 T;  3WDT A;  1NCR C;  3AXE A;  1OPO A;  3RI9 A;  3WV6 A;  4ISQ A;  1W6O B;  4W6W A;  1B09 A;  1NLR A;  4CDW B;  1O8S A;  1DIW A;  1AR8 2;  5C3P A;  3B94 A;  3ZKY A;  3KGZ A;  2W94 A;  4UWD A;  3ASI A;  1YQ5 A;  3FBY A;  4CP2 A;  4HON A;  2DBN A;  1UY1 A;  4C1X A;  5A3T A;  4ZHN A;  3SEE A;  1AX0 A;  4AVC A;  4CU7 A;  4BA6 A;  1ASJ 2;  4HAN A;  1G6N A;  1V70 A;  3ZYR A;  3I3Q A;  4QQ2 A;  5BNO A;  3VD4 A;  3APB A;  2GU9 A;  2E26 A;  4AR2 A;  2ZEZ A;  3MIC A;  4D6S A;  3WXP A;  3U14 A;  1BLZ A;  3ZSE A;  3DEM A;  1UY3 A;  4LMF A;  5H9Q A;  3FHI B;  2A1X A;  4IW3 A;  1I3H A;  2R07 3;  1ZZ7 A;  4UF0 A;  1UX7 A;  4S2F A;  2R6Q A;  4CRQ A;  4EV0 A;  4Y1Y A;  4XAB A;  5I8S A;  5C5T A;  3I3M A;  4W8J A;  1XND A;  1R09 2;  3BCW A;  3K2O A;  1HXS 1;  1XJA A;  2DCY A;  2JJ6 A;  2Y26 A;  5FRA A;  1VB2 A;  1SDW A;  1QH6 A;  4DRR A;  2E9Q A;  3ETQ A;  2WS9 3;  4HBN A;  3KF5 A;  3AXD A;  1V9U 2;  4DFS A;  4LK7 A;  4E2G A;  4FT8 A;  4XBQ A;  3U10 A;  1REE A;  3Q8B A;  1WMX A;  2JWP A;  4LOS A;  1EAH 1;  2FHR A;  2KR2 A;  3H1M A;  1SG3 A;  1UD1 A;  3A7Q A;  2XJQ A;  3C7F A;  2AC1 A;  3POY A;  4K3U A;  4QGL A;  3RJR A;  3VKM A;  4Q4W 1;  3VD5 A;  3ZYJ B;  1VBC 3;  1L7R A;  2D98 A;  4AVS A;  4DNY A;  3MW3 A;  4R4Z A;  2ZCW A;  2QQW A;  2WWS A;  4QPI B;  2EIE A;  1MQT B;  2HEW F;  3JB8 A;  4Q8L A;  4OZX A;  3U4S A;  4YGD A;  1CPN A;  1I1E A;  3KWV A;  2UWC A;  3AZY A;  3ZXK A;  4Y1Z A;  1IHM A;  3THP A;  4KL1 A;  4NWV A;  2SBA A;  4NJ4 A;  1LB2 A;  1UKR A;  1RUG 3;  1UIJ A;  2WQZ C;  1BMV 1;  4XMI A;  1ZBE 1;  3ZN4 A;  3I2G A;  2PN5 A;  5FJK A;  3IDC B;  2Y6F A;  2XJS A;  3GZT B;  5IAT A;  3V56 A;  1DQ0 A;  2Y6L A;  3MID A;  1W8H A;  1RUF 2;  4MGY E;  3ZYI B;  2W91 A;  4NAO A;  5T55 A;  2ERF A;  2BUK A;  4Z92 B;  1Y9Q A;  4AOC A;  4Z1V A;  2FCT A;  5L9R A;  5D8A B;  2VPV A;  4NMI A;  2DU1 A;  2H6B A;  4QD2 A;  3AVS A;  4DO0 A;  1ACC A;  4FOY A;  4TYS A;  4YVS C;  5BPX A;  5LA2 A;  3MO4 A;  1UIK A;  1ZBA 3;  1O4Y A;  1WZX A;  3AP6 A;  3ZFG B;  1H0B A;  1L7Q A;  4BCU A;  1UAI A;  3SH3 A;  1ULF A;  1XNC A;  2AZ5 A;  3O12 A;  2XVG A;  4XQW A;  5FMB A;  5AVA A;  1QNW A;  4YFZ A;  2IXJ A;  2VR4 A;  2VXJ A;  3LEG A;  5LEK A;  1S4C A;  3O0V A;  3M1H A;  3VBH B;  1KRI A;  1W9W A;  4WVV A;  4ES8 A;  3ZO0 B;  2GC3 A;  3FFQ A;  1NYW A;  4PDW B;  4BHP A;  3WUD A;  1FPN 3;  4NID A;  2DYC A;  1Q43 A;  3HVD A;  4LO4 B;  2D40 A;  1AYN 2;  3VBR C;  3KT7 A;  5C6C A;  4FTE A;  3FL7 A;  1HRV 2;  2RJL A;  4OCT A;  3RZJ A;  1O91 A;  3DXT A;  2ZKN A;  2YB7 A;  4QT6 A;  3WF0 A;  2D43 A;  2OPW A;  4JHT A;  4PLN A;  4EYU A;  3SKJ E;  1ULE A;  2KM2 A;  1QOT A;  1SCR A;  1X8E A;  1PMI A;  2EIG A;  3PVE A;  4HSL A;  4JQT A;  3W9A A;  4A6O A;  4DXZ A;  4YZ3 A;  3D0J A;  2D6M A;  4COZ A;  3AYD A;  4E2S A;  3POW A;  4KBZ A;  1GR3 A;  1NA1 B;  4IDZ A;  3VZK A;  1W9T A;  2XPJ A;  1HB4 A;  2EAK A;  4YM1 A;  4OHZ A;  4RQP B;  4XDP A;  5L7O A;  5JI7 A;  1HIX A;  3ES1 A;  5FYH A;  1S55 A;  3CQO A;  2FDI A;  2ETE A;  2W1S A;  4QKD A;  2JG8 B;  3ITQ A;  2WZ8 A;  3ATG A;  4N9I A;  1ND2 B;  5F6K A;  3T2T A;  1W05 A;  5C8W A;  3CJX A;  5K0U B;  3FHA A;  2DVD A;  1E57 A;  4LR4 A;  1UWW A;  2I07 B;  5IWF A;  3ILF A;  4Q0S A;  5JOY A;  5LZ6 A;  4OYU A;  3DV8 A;  4AI2 A;  4AXO A;  4BME A;  4WM7 B;  4S2D A;  1CQ9 A;  2W08 A;  1G9F A;  1H2M A;  4MOA A;  5J36 A;  4IEX A;  4BMB A;  3EO6 A;  1AR8 1;  1HJF A;  5JZG C;  4NWW A;  3VHR A;  1Z78 A;  3WLU A;  1NLQ A;  2ZAH A;  3PMS A;  4Q2F A;  1UYP A;  3AP9 A;  1CAX B;  5F5I A;  4CEW C;  1IZ3 A;  1JZ4 A;  1PGW 2;  3TEW A;  3IB3 A;  1WCK A;  1GBG A;  1APN A;  1VBC 2;  3OGV A;  1OI6 A;  4QX7 A;  1OHF A;  1YNA A;  1HQN A;  2CYF A;  2RM2 1;  4XUN A;  4CCJ A;  5JIU A;  3EXU A;  3LA7 A;  2CGN A;  2KA3 A;  2R06 2;  5EYX A;  1NCR B;  2IXC A;  2D6O X;  2JDN A;  1BVV A;  1T2X A;  3UKV A;  2VBP A;  3P3N A;  1MS4 A;  2XJP A;  1BJQ A;  4KMQ A;  5FWJ A;  4A44 A;  4YAR A;  1R1Z A;  2ADE A;  2TNF A;  4L99 A;  5CFC C;  3HQR A;  5KXB A;  4M3C A;  4PI2 A;  1LEN A;  1IKP A;  1M06 G;  2WZE A;  4P08 A;  5AC9 1;  4R9C A;  4AFB A;  1PM4 A;  2XOM A;  2FMD A;  3HN1 A;  4QU1 A;  2P4E A;  3I2K A;  4W6X A;  4R4X A;  4W50 A;  4N7U A;  2A6Y A;  2XJT A;  3GHM A;  1V6L A;  4BWO A;  4GWN A;  2GN7 A;  5FJH A;  5IJR A;  2ZX4 A;  4EN9 B;  2LM3 A;  1J3R A;  1V00 A;  4M3C F;  2VVF A;  4MGI E;  4P00 B;  2P6H A;  5FY7 A;  1TNR A;  1RUE 3;  3LDB A;  2NM1 A;  3C7E A;  4DUX A;  1PZ7 A;  1U12 A;  4ASK A;  4BQ4 A;  1U5Z A;  1LCL A;  2XDV A;  5KWR A;  2RR1 2;  4HZF A;  3W58 A;  3PTR B;  4QPG C;  2X5I C;  4RA0 A;  1QOS A;  2GMP A;  1MZ6 A;  4X8P A;  2N7G A;  2BP6 A;  4Y33 A;  5BNP C;  3BUC A;  2EXK A;  3Q8E A;  5BNN C;  4BK5 A;  1SFY A;  1SLC A;  2PTM A;  1JMU B;  1DQ2 A;  3MLJ A;  1YWK A;  3CKH A;  3ZR6 A;  3GZE A;  5J3U A;  2ZKL A;  3S0M A;  1UZW A;  3AYC A;  3ZXG A;  2RS3 3;  3WR0 A;  2MPF A;  5J98 B;  3ACI A;  4QXB A;  3T3Y A;  4EE2 A;  5GLU A;  5C8C A;  3M3E A;  1I6X A;  5A7W B;  3ZR5 A;  3SHR A;  1FPN 2;  5FTT C;  1QWR A;  3CZJ A;  3RYR A;  1FOD 1;  1HLC A;  1W03 A;  2JB8 A;  2RDR A;  2YHJ A;  2RDQ A;  2QTW B;  2E7Q A;  1VBE 1;  3WNM A;  3H8X A;  4FTS A;  3D3A A;  1SHW B;  1SLA A;  5ABJ B;  1ZM1 A;  3IMN A;  3LEK A;  2XL9 A;  2VZR A;  5F5C A;  1W8T A;  2WAA A;  1KJR A;  4UFM A;  5FZM A;  3GHN A;  1RXF A;  4LKD A;  1COV 3;  1FV2 A;  2QQO A;  4DEQ A;  2YGL A;  1W8Z A;  3HIF A;  2OW4 A;  1REF A;  1Y4W A;  1AR9 3;  4GWI A;  3PJY A;  2XR4 A;  1GYK A;  1K12 A;  1SMV A;  4IEV A;  1JYT A;  4MG2 A;  1O4T A;  1OKQ A;  2BGO A;  5HXV A;  4XJA A;  3LZZ A;  1DLL A;  1NY7 1;  3E5Q A;  1Z7S 1;  2D44 A;  4LOR A;  1UOF A;  5A33 B;  3WP5 A;  5B4N A;  1UN1 A;  3OGG A;  2ZJC A;  2D5F A;  3ZM8 A;  4ASM B;  4YWA A;  2ADD A;  4TLF A;  4XQD A;  1RUD 3;  2WNE A;  3KS7 A;  4XF9 A;  2AEN A;  4ZON A;  2VZ1 A;  3AK0 A;  2XLA A;  2D97 A;  4QGN A;  4Y5T A;  3U07 A;  1QY4 A;  4IND A;  1AYN 1;  4CP9 A;  1OLQ A;  1W0P A;  4XJZ A;  5BYN A;  1HRV 1;  2B45 X;  4YVS B;  3ES4 A;  3GZA A;  3P5B A;  4K8R B;  4L0P A;  1F35 A;  4V2V A;  5FZ0 A;  1MEC 3;  5LAT A;  3THD A;  4CCK A;  3O7O A;  3AVR A;  1GKB A;  3CJI C;  5ACA 1;  4SBV A;  4K40 A;  2FD8 A;  1LU1 A;  5FZ9 A;  2PEL A;  1VBA 2;  2ZGS A;  4PF1 A;  5FMO L;  2JG9 B;  2IZW A;  3CDZ B;  4EN7 B;  3K3N A;  1ZX5 A;  2JKB A;  1MR5 A;  2GP5 A;  4CDX C;  3VD7 A;  5JSP A;  5I0D A;  4B4R A;  1CVN A;  4PLO A;  3NJY A;  3A21 A;  3VBR B;  3B69 A;  4COV A;  3DEC A;  4W4Z A;  4YZ2 A;  1FV3 A;  1JBC A;  3EB7 A;  2GC0 A;  2C24 A;  3K3O A;  3A23 A;  3QCW A;  4FOV A;  4AI8 A;  5JZG A;  4YVW C;  2H0V A;  1QNY A;  3NNJ A;  1VE0 A;  3PJQ A;  1H4G A;  1SZB A;  3SCG A;  4F3J A;  3U37 A;  4NE9 A;  4CEW A;  3IT8 A;  4IUG A;  2PYT A;  3EJK A;  4FPF A;  1PO1 3;  1QEX A;  3OPZ A;  5LRR A;  2HWF 2;  3N35 A;  2IC1 A;  4YW5 A;  1WA6 X;  3ZSM A;  3I4I A;  5FDB A;  3B00 A;  1XRU A;  4UFH A;  2VAU A;  5L9V A;  2Z79 A;  4OHV A;  1PGW 1;  4Q26 A;  3AJY A;  4H14 A;  4CXW A;  2HJI A;  4UFK A;  5JR7 B;  2ZEY A;  3W5M A;  3M8L A;  1ZA4 A;  1SLL A;  3I3B A;  4KU8 A;  3HAG A;  5JSR A;  2R30 A;  4CUG A;  3III A;  2R06 1;  3WNK A;  5KC6 A;  4LHS A;  4YZ4 A;  1YRZ A;  2OQ6 A;  5CFC A;  3WF4 A;  3N3H A;  3TN9 1;  3ILN A;  5C3Q A;  4BIS A;  1CIY A;  1CWP A;  4AHZ A;  3N4M A;  5KR7 A;  3O1O A;  2J22 A;  4DY5 A;  1C4R A;  4OHX A;  4NHL A;  4M4R A;  1QGL A;  5HCH A;  3QAC A;  1FMD 1;  4SLI A;  1RC6 A;  1XE0 A;  1OA4 A;  4OQ8 A;  4K6B A;  1LOD A;  3HNB M;  3TEY A;  2ZGQ A;  4P9Y A;  3N9N A;  1OLM E;  2W52 A;  1XNT A;  3KM5 A;  3H0O A;  2EXI A;  4AEK A;  5BNO B;  5C3O A;  2VOX A;  3MHZ A;  3FLT A;  2FBE A;  1OF4 A;  3JB4 C;  1KDK A;  4DMI A;  3RNS A;  4IEO A;  4Y4R A;  2YC0 A;  4E8D A;  1GFF 2;  1A8D A;  4HK9 A;  4GZ9 A;  4QPG A;  2X5I A;  4AGR A;  1PGL 1;  1KIT A;  1NUK A;  3T2P A;  2DUQ A;  4Q4Y 2;  3K51 A;  4M3C E;  5BNN A;  1TQ5 A;  3B7M A;  2BQP A;  1AR9 2;  2YUE A;  3ZXL A;  4H3W A;  2Q8D A;  3MPP G;  5FY5 A;  3MEP A;  1N1S A;  1R1A 3;  4XFI A;  5BV6 A;  2AH2 A;  2DBI A;  1GZW B;  1WD4 A;  2D93 A;  2A6Z A;  3FZ3 A;  3B02 A;  5A3M A;  1GQH A;  5B4X A;  1ZVF A;  2AUY A;  4LT5 A;  3PHM A;  5A1A A;  1W8W A;  2RS1 2;  1V6N A;  5LWB A;  2NN8 A;  5FAX A;  4WM8 B;  4K8F A;  1UF2 C;  2J1R A;  1UU5 A;  3SNM A;  4UAP A;  4B1M A;  3VL8 A;  5I8Y A;  4RFT 0;  3A0K A;  5A7N A;  1WW7 A;  4XIO A;  5CG8 A;  4YZ1 A;  1NZI A;  3WNO A;  2FDF A;  3OY8 B;  4RL7 A;  1HXS 3;  1YXW A;  2YC4 A;  3VZN A;  4D0Q A;  3POG A;  4XEZ A;  2HYX A;  5BNP B;  1QQP 2;  4N53 B;  1BK1 A;  1KDM A;  4O65 A;  3IBM A;  2JDU A;  3PLQ A;  4PI0 A;  5C7G A;  1W6Q A;  3UJQ A;  1YFU A;  2NLR A;  3ZPO A;  2X09 A;  2DU0 A;  1RUI 2;  1EAH 3;  4MLO A;  5DUU A;  1D2S A;  5CG9 A;  5AVP A;  5KXE A;  1BEV 3;  3U4X A;  3SQO A;  2IXH A;  2W92 A;  2J1S A;  4GAZ A;  5FFO C;  2A5Z A;  4FP3 A;  3LDK A;  1HB1 A;  1LJ7 A;  1UX6 A;  4QB1 A;  4TXW A;  4LIT A;  3MF9 A;  4Y20 B;  5APA A;  4CPB D;  1TMF 1;  3HBZ A;  2UU8 A;  3WW4 A;  5DUX A;  3NQH A;  3VDB A;  3WQ1 A;  3H7J A;  5FZA A;  2DV9 A;  1XBF A;  2QKD A;  3LGR A;  3R0R A;  4FFH A;  1S0E A;  2WBK A;  3RSJ A;  1RMU 3;  4CU6 A;  3CF6 E;  3OGJ A;  3B3Q E;  3UGH A;  2WQ4 A;  1ND3 A;  1H1I A;  2PAM A;  4CDW C;  5JAX A;  1CON A;  3WNP A;  3D4K A;  1H6X A;  4FOQ A;  3VBS A;  4I09 A;  3VD9 A;  2WT1 A;  4A3Z A;  5LY1 A;  3N9M A;  1UU4 A;  4NIG A;  3WZ1 A;  2VCM A;  1HRI 3;  2B4K A;  3I59 A;  2PHL A;  2VG9 A;  2WNV C;  2OVU A;  2CL2 A;  2P3K A;  2ES3 A;  3O1M A;  5EPA A;  1XSR A;  1LGC A;  2DVA A;  1OPM A;  3DCQ A;  4YGB A;  3I49 A;  3H1W A;  5FO7 B;  4AAX A;  3T08 A;  5CIS A;  2OZJ A;  5LBC A;  1UQX A;  1DHK B;  1VBD 3;  4MH0 E;  4QXC A;  1S0C A;  3OG2 A;  2VOW A;  1QXJ A;  4I3G A;  4S2H A;  3LDR A;  4Y26 A;  4XF3 A;  1DG6 A;  4BZ4 A;  5LA0 A;  1RB8 G;  2GC2 A;  1S0F A;  1PVC 2;  4UFL A;  4CCE A;  2HWB 3;  5I91 A;  1QJZ A;  3U1X A;  1GZT A;  2BOJ A;  4CDU A;  2VOV A;  3CJI B;  2IXI A;  2Q4S A;  1H30 A;  4Y1X A;  3GBW A;  3C3V A;  1KJL A;  4R9B A;  4NHX A;  4CPB A;  1QU0 A;  5FPB A;  4BLI A;  1POQ A;  2HWF 1;  3IZO A;  3EBR A;  3O5S A;  3OBT A;  4CDX B;  3T4V A;  4Q8K A;  1QJE A;  1UPI A;  5DAB A;  1PX3 A;  3K4D A;  1LHU A;  4CCN A;  1X7N A;  1YQ2 A;  4JDM A;  4XUO A;  2RDN A;  5J48 A;  4KQ7 A;  1JZ2 A;  3ZXA C;  1R1A 2;  4OI4 A;  4R9D A;  4BH9 A;  2VUC A;  1MQT C;  3ACG A;  4DPN A;  2C4X A;  4YVW B;  1XYO A;  1NCQ A;  2OPK A;  1W6N A;  3BVC A;  4JZR A;  1NG0 A;  4MZU A;  3FUQ A;  2Y0I A;  3WX5 A;  4Q0U A;  4AWD A;  4FPY A;  3KVA A;  2BPA 2;  1NKG A;  3AMN A;  1K42 A;  2P2K A;  4QAW A;  3MFC A;  3MZH A;  1RYY A;  3TOJ A;  1UO9 A;  4Y4Y A;  1Q8P A;  4OFG A;  3H3U A;  1IOA A;  2W1W A;  4YW2 A;  4F83 A;  3URF A;  5HBA A;  1PZ9 A;  5FZH A;  4GJZ A;  2O8Q A;  5FYT A;  4EN0 A;  1V6I A;  2QZ2 A;  3LA2 A;  2VMG A;  2FQP A;  3ZXD A;  1D7P M;  3VDD A;  1WA4 A;  3I2D A;  1Y9G A;  2HWC 3;  3KVB A;  4M01 A;  4PLM A;  1CAU A;  4WVM A;  2Q8E A;  3RWN A;  3T2O A;  4IE5 A;  1QJU 3;  2Y6G A;  1NLS A;  2XON A;  4XQ4 A;  3HNM A;  4AGG A;  4MGS A;  1LNS A;  4FPK A;  4Q4Y 1;  1V6J A;  1RVF 1;  1KEX A;  2WUH A;  1JOJ A;  4LBQ B;  1DZT A;  3NO8 A;  1JOP A;  1MS8 A;  2ZX3 A;  4YW4 A;  3BU7 A;  3T2Q A;  1K5J A;  3MLK A;  3DXU A;  1WBF A;  5LB6 A;  4ZU4 A;  5JMO A;  5A6Y A;  5BUV A;  2RM2 3;  2WNU A;  3T0A A;  1FX5 A;  1W06 A;  3I8T A;  1AR6 3;  4Q0P A;  3VBF B;  1O4Z A;  3WHT A;  4FAG A;  1VBB 1;  2RS1 1;  1VMF A;  2EAA A;  5F3E A;  5FY4 A;  3PL0 A;  3E6C C;  3UGG A;  2D5H A;  4QGM A;  4IE7 A;  1MPX A;  5I0U A;  4CA9 A;  5FO8 B;  1QJY 3;  1RMU 2;  2G1M A;  3OUI A;  5FZB A;  4PDW C;  3OBZ A;  2PLV 3;  4FXK B;  4XFG A;  3NST A;  5DN2 A;  2QZ3 A;  1SEF A;  3J4U H;  2R0H A;  4HVQ A;  3FC0 A;  1VAV A;  3I7D A;  2P6C A;  5AC9 3;  1ZRR A;  2VZP A;  3J7L A;  4FP2 A;  1LOF C;  1W6P A;  1K5M C;  1GQG A;  4ASL A;  2PXJ A;  1HX6 A;  1PO2 3;  2RE9 A;  2A6X A;  4GKY A;  4R52 A;  1U0A A;  4LUK A;  5GZD A;  1AF9 A;  1BQP A;  3NJX A;  1AR7 3;  4AVA A;  2YG0 A;  4J1W A;  1QJX 3;  5K8S A;  2SLI A;  5T52 A;  3ZYH A;  1C8M 3;  4QX1 A;  4Q1R A;  3SXW A;  1H1M A;  3ZFF C;  5H9S A;  4D7T A;  1VBD 2;  3ZMO A;  3IKW A;  2H6C A;  1EP0 A;  1GNZ A;  2JG8 C;  5FZ4 A;  5IVB A;  3LSE A;  4B29 A;  3D0S A;  2Y60 A;  3MFA A;  4JVA A;  1ZRD A;  4HKW A;  1ZZ8 A;  1W6O A;  4OUS A;  5FOB B;  3WG3 A;  4CDW A;  2HBT A;  3TWI A;  2MNG A;  1Y7B A;  3ZX7 A;  5FV3 A;  5KHG A;  2VME A;  3ZPY A;  2WFF 3;  1GUI A;  1W04 A;  4R8H A;  4FXG B;  4RR3 C;  1CX1 A;  3VBO C;  3C7G A;  3THT A;  2AR6 A;  2HWD 2;  2VZ3 A;  3BN6 A;  5A3N A;  2QFE A;  5DDJ 2;  1OSG A;  1ULG A;  4A42 A;  4OI1 A;  4YZ5 A;  3AFG A;  4JDO A;  4WZC A;  1AHS A;  3RZZ A;  1XXN A;  5IAX A;  1VRH 1;  3ZYB A;  4H55 A;  4A45 A;  4QKN A;  2ZTN A;  4YM3 A;  3KGL A;  1QIQ A;  3CLP A;  3KQ4 B;  4FQ4 A;  4UW4 A;  1S2E A;  4KH9 A;  2WA3 A;  3SH5 A;  3ZN5 A;  2FCU A;  5DZE A;  3WG4 A;  1DDL A;  4IE6 A;  4K1Z A;  3OUH A;  5T3N A;  1EV1 1;  4FVV A;  4PHZ A;  2VMI A;  2VTX J;  2HBU A;  4FFG A;  3BTA A;  3UK9 A;  2BWC A;  2ARA A;  2PHD A;  4GIQ A;  4X6R B;  4KGG A;  3WDV A;  1HB3 A;  2YBP A;  1R08 1;  5FZ8 A;  4RGA A;  3ZYG A;  4Z2W A;  5K9Y A;  3QBQ A;  2WKK A;  4LHK A;  2WJS A;  1BZW A;  5CKM A;  3JBG 1;  2B9V A;  4AED B;  4OHW A;  5CA6 A;  3AC0 A;  3M7A A;  1PVC 1;  2ZHL A;  1U5Y A;  1RIT A;  1GWL A;  1Q3E A;  4GWM A;  4HN0 A;  1GOG A;  5IUQ A;  3RFR A;  5HI0 A;  2QQL A;  5L19 A;  3U0Z A;  2E51 A;  2WNV B;  2XVL A;  3V0B B;  1YQC A;  2WAB A;  1RHI 2;  2YGM A;  4A7K A;  3WQ7 A;  1GAN A;  4LO6 B;  1JOB A;  2DUP A;  3B01 A;  3MIF A;  3MV0 1;  5I0S A;  1ZZ9 A;  1AL2 3;  2R1D A;  1GNY A;  3NL1 A;  1QJU 2;  3Q8C A;  1DU3 D;  4Y1U A;  4QPI A;  1MQT A;  1BBT 1;  2A3X A;  2Y38 A;  4N43 C;  3T09 A;  1DGR N;  1OUR A;  2RJK A;  4PQ9 A;  5C4W B;  1GWM A;  1CZS A;  4CVU A;  1UYY A;  2VH9 A;  4K1Y A;  4LO8 A;  1Q8O A;  2JIG A;  3GAL A;  2WT2 A;  4M00 A;  1ZRF A;  4AL9 A;  4BYY A;  1XU1 A;  3P3P A;  4IV3 B;  2J42 A;  2C5D A;  2V73 A;  4OVE A;  5A1F A;  1AR6 2;  3J7N A;  2YRO A;  2VE1 A;  4IV1 C;  1OD5 A;  2VUL A;  2XUM A;  5L9B A;  3VZM A;  2BU9 A;  4I30 A;  2NP0 A;  1VAK A;  3PVO A;  4BE3 A;  4IGP A;  4V2W A;  1QJY 2;  4N8M A;  2WZR 2;  1Q8S A;  1OF3 A;  3GBF A;  1YQ6 A;  2PLV 2;  3POE A;  1U5X A;  5LA9 A;  4CP0 A;  2NPI A;  3OBR A;  4JKM A;  3WDX A;  2OUH A;  3I3E A;  3DGT A;  2WL1 A;  2R32 A;  5C9A C;  5ABJ C;  4ARY A;  5D8A A;  2IFW A;  2VNV A;  4PIZ A;  4GMP 1;  4O9E A;  2WDB A;  2QQK A;  4Q27 A;  4YG0 A;  4AVV A;  2BBA A;  1RUC 1;  2QVS B;  1ZRC A;  1TG7 A;  1XC6 A;  1POV 0;  2BWA A;  1DQ6 A;  1MVE A;  3KT1 A;  4QX0 A;  2BNN A;  4U2A A;  4FSJ A;  3ZFG A;  5GZC A;  1PHM A;  2L9L A;  1WCD J;  1C8M 2;  2NMN A;  1TVG A; 
#chains in the Genus database with same CATH homology
 2OQ6 A;  3KV5 A;  5FYS A;  5FZO A;  4NUB A;  4BIS A;  5IW0 A;  4LIU A;  5ANQ A;  5FY1 A;  5FZO B;  5KR7 A;  2VD7 A;  5FP8 A;  4QXC A;  4QX8 A;  5A3T A;  3LD8 A;  5FZ3 A;  5FZ4 A;  5IVB A;  4QXB A;  5A80 A;  5A7W A;  3N9L A;  5A7W B;  2P5B A;  5FPL A;  5A7P A;  4XDO A;  2YBK A;  5FYU A;  2YBS A;  5FV3 A;  3N9N A;  5FYY A;  5FZ7 A;  5IVC A;  2YU1 A;  5FP7 A;  4AAP A;  5FZ1 A;  3KV6 A;  5IVJ A;  3PUR A;  5A3N A;  4HON A;  3DXT A;  5FPA A;  2Q8C A;  2OT7 A;  5FPB A;  5A7O A;  5F5C A;  5CEH A;  4Y4R A;  4EYU A;  2XUE A;  5E6H A;  5FZ6 A;  5FWE A;  5FZM A;  3UYJ A;  1VRB A;  5FZI A;  5FZG A;  5FXX A;  5FXZ A;  3PUS A;  4EZH A;  4URA A;  5FP4 A;  4CCN A;  2Q8D A;  2OX0 A;  5FY5 A;  5FYC A;  5LY2 A;  2XXZ A;  4D6S A;  5FYB A;  5FBJ A;  3PU8 A;  3KV9 A;  3N9P A;  4XDP A;  5F37 A;  5FYH A;  3OPT A;  5F3C A;  5FY9 A;  3N9O A;  4D6R A;  4UF0 A;  4UF0 B;  5FZ8 A;  2YBP A;  2YU2 A;  2YPD A;  3KVA A;  3K2O A;  5LWB A;  5IWF A;  5FP9 A;  3ZLI A;  5FY0 A;  4Y3O A;  5FZC A;  5A3P A;  4EZ4 A;  4TN7 A;  3KV4 A;  5FYI A;  5FYZ A;  4IGO A;  2XML A;  5A7S A;  5A7N A;  4CCL A;  5FZH A;  4GJZ A;  3PUA A;  5IVE A;  5A1L A;  5FYT A;  2W2I A;  4V2V A;  5F5I A;  5FZ0 A;  3KVB A;  3AL5 A;  4LIV A;  5F2W A;  2Q8E A;  4QWN A;  4CCK A;  5FZD A;  4QX7 A;  5F5A A;  4BXF A;  3AVR A;  2WWJ A;  4CSW A;  5LW9 A;  4HOO A;  4CCJ A;  3N9Q A;  5FZ9 A;  5FYM A;  5FZK A;  5F39 A;  3ZPO A;  4GD4 A;  5F2S A;  3U4S A;  5FZE A;  3K3N A;  4C8D A;  3DXU A;  2GP5 A;  4GAZ A;  4D6Q A;  5FXW A;  5FWJ A;  5FZL A;  3NJY A;  4IGQ A;  4AI9 A;  3PU3 A;  4LIT A;  3RVH A;  5A1F A;  5FP3 A;  4LXL A;  5F3E A;  5FY4 A;  3K3O A;  5FJK A;  5FZA A;  5FPU A;  4QU1 A;  2OQ7 A;  4IGP A;  4V2W A;  2WWU A;  5FZB A;  5K4L A;  3PDQ A;  4DIQ A;  3AL6 A;  5FJH A;  2OS2 A;  5IVV A;  5F32 A;  5FY7 A;  5ISL A;  5A3W A;  3LDB A;  5FUN A;  3OPW A;  5FZF A;  4CCO A;  3N9M A;  4GJY A;  5IVF A;  5LY1 A;  3PUQ A;  5FXV A;  3U78 A;  4ASK A;  4QXH A;  2GP3 A;  5FYV A;  5FUP A;  2XDV A;  5FY8 A;  5FPV A;  2PXJ A;  4BU2 A;  5F3G A;  3AVS A;  5IVY A;  4DO0 A;  3PTR B;  4CUG A;  4E4H A;  5A7Q A;  5F3I A;  4Y33 A;  4CCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...