3S5QA

Crystal structure of a putative glycosyl hydrolase (bdi_2473) from parabacteroides distasonis atcc 8503 at 1.85 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
213
structure length
213
Chain Sequence
GSDKIHHHHHHENLYFQGYRPLFDKDLSNADYDSSVWTFKNGILTATADQSIWTKVQYENFILDLEFKTDVNTNSGVVIYCTDKGNWIPSSIEIQIADDHHPEWQSYPEYWRCGSIYGHKGANEQLVVKKPGEWNRMIITAKGQQIDIELNGKHIVSANLADWTSGTTNPDGTEIPEWLPIPYANMPTKGYIGLQGKHGESNIWFRNIQLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Hypothetical Glycosyl hydrolase (BDI_2473) from Parabacteroides distasonis ATCC 8503 at 1.85 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Hydrolase
molecule keywords Putative glycosylhydrolase
total genus 57
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2011-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 3s5qA00
1Y9GA 3S5QA 3UGFA 3PIGA 5FKCA 5FMBA 4CCDA 4FFHA 3UGHA 3RWKX 4FFGA 5FKBA 3ZR6A 3H3LA 5FK8A 1Y4WA 4QHZA 5FIXA 4CCCA 2AEZA 3KF3A 3LFIA 4UFIA 3U75A 3U1XA 2QQWA 2AEYA 2ADEA 3LEMA 3LF7A 1ST8A 3UGGA 4B1LA 2QQVA 3SC7X 4JQTA 4AZZA 2XQRA 3NMBA 3LIHA 4B1MA 4UFMA 5FMDA 4UFJA 4UFKA 3OSDA 1Y9MA 4UFLA 3IMMA 5FK7A 3LDRA 4UFHA 3PIJA 5FMCA 2OXBA 3LDKA 4FFFA 1UYPA 4CCEA 3U14A 2QQUA 4FFIA 2ADDA 1W2TA 5ANNA 3ZR5A 4EQVA 3KF5A 4HXCA 3LIGA 3HBKA 2AC1A
chains in the Genus database with same CATH superfamily
4P02B 1XNKA 2WWSA 1NCQA 3OB8A 4H3WA 1FXZA 3VBOB 3FFZA 2WUHA 3VDAA 3WZ1A 5DDJ1 5A7QA 1OXCA 4L2NA 2A6ZA 2KM2A 1IKPA 3NV1A 2BQPA 5FO9B 1JYXA 1I1EA 3WUCA 4AXOA 4CUCA 1JYCA 2D3PA 2DCYA 4FPGA 2W0XA 2W5FA 4P14A 5HXVA 4CEYB 5A70A 1PMJX 3ZN5A 2QQVA 5A6ZA 5JZGA 2DYCA 3RZJA 2XLAA 3AZYA 2IC1A 1DGWA 4YVWC 1GP6A 3PUQA 5FZMA 2QE3A 4LOTA 2H0BA 1YQ5A 4ORFA 4QPIB 4NJ4A 4AI8A 2WT2A 2GAUA 4XVHA 1SPPB 1LU1A 2D5HA 2GN7A 4OMCA 4UW4A 4WVWA 3EXUA 4G4FA 4ZS2A 4KI5M 3OPTA 2O8QA 2R1DA 3KVBA 3OF1A 1CAXA 4PBPA 1H9PA 4I0BA 1JZ2A 4B4RA 3KQ4B 3L2YA 5KHIA 2QVSB 2W1WA 5CFDC 3D5OA 4Q4W2 5FIXA 1ZYBA 2D6MA 3KV9A 4XBQA 3VBOC 2E7TA 2GNTA 2LM3A 2J1VA 2UYAA 4OCTA 1UWWA 5L73A 3WDVA 1JYIA 1LESA 2QQIA 1OQEA 1SFYA 4W50A 4OULA 4QKNA 2GNDA 4IL7A 5KHHA 4IEYA 4YSFA 3WF2A 2WN3A 5HXMA 3OGJA 4AG4A 4E2GA 1DGLA 2VZUA 2VJXA 4TXWA 5DAVA 5E6HA 4OI4A 4JGYB 1OA2A 4BPZA 5A1LA 5HCAA 3BIEA 1Y7BA 2XJQA 2DVAA 1QDCA 1E57A 3B9CA 3IKWA 3MUZ1 4H7MA 4UFLA 5E8AA 5FMOS 5FY1A 5J3UA 4GWJA 4GMP0 1W6PA 1RUE1 4LHNA 1DGRN 1CAUB 2VZQA 1WW4A 3IMNA 5JSOA 1DIWA 3MV11 3U4XA 4QPIC 4WZFA 1IS6A 4EZHA 1IQAA 1XE7A 2YROA 4BZ4A 3ZN6B 1IQDC 1LKNA 3NNJA 1A8DA 5JR7B 5T54A 3UV9A 4F83A 1H1IA 3WG3A 2BBVA 5D2AA 5C71A 5CFDB 4HFSA 4QM9A 4D3WA 2ZZJA 3BCWA 1OH4A 4RR3C 5FUPA 3H8OA 1C4RA 2D6LX 5FPXA 5FO8B 2RDRA 5C6CA 2NMOA 4HBNA 3ZYHA 4DOUA 1NE4A 4XTMA 4CDXA 4AI3A 1R091 4CPBA 2XUMA 4NPLA 3O1MA 1UYZA 3VBFC 1UPSA 2YYOA 3NJYA 3C7GA 3ZN4A 2W1SA 1ZVFA 2P6CA 3PVBB 5FZKA 1RL3A 2VOXA 2ZGSA 5GALA 2VD7A 1J83A 1W6QB 3WR0A 2VZSA 2CAVA 2WO3A 4W4ZA 3N9MA 5L7OA 2TNFA 5FPUA 2JX9A 1QNWA 2OVUA 5GZGA 2RMU1 2QQWA 2WQ8A 3WDYA 5I8TA 3MIDA 2GC3A 3O14A 2P37A 3M1HA 5J09A 5FZGA 4Q8LA 3W21A 3NQHA 3LIHA 5EFUA 5FPLA 3FMGA 2B46X 3IM0A 1VRH3 2PQQA 1SBDA 3K77A 1OLQA 3MLJA 4UF0A 3INAA 5FXXA 1JYWA 4AL9A 2BGCA 1RUF2 3RJ2X 1VLNA 1KDKA 2FDGA 4C90A 3V0BA 1FNZA 2CGOA 3KF5A 4OMDA 1BBT3 1OD3A 3O12A 2DDUA 4FO9A 4J25A 2BDRA 1DG6A 3QH6A 3M70A 2J7MA 5A80A 1W8FA 3S7IA 5A32A 2X09A 3VHRA 3OUHA 4XILA 5A7WA 2RM22 3BPSA 3GBWA 3WW1A 4H55A 3NNGA 5FZAA 5AC92 3VLBB 5M0TA 1Z7S1 3O0WA 3UESA 2VUDA 4XURA 2ZXQA 2UURA 1OVPA 5LEKA 3BUCA 3OEAA 3MIBA 2OKXA 3SISA 4GH4C 5EPAA 3ZXAC 5T52A 4LBQA 4UYBA 2SBAA 2YU1A 4W6WA 4LIVA 5FWEA 3PUAA 3OY8B 4XZPA 2P3JA 1PMHX 2BGPA 2ZCWA 3RRDA 3B9IA 1HXS3 5EV7A 1F4AA 2R6QA 5F1RA 2PHLA 2HWB3 3POWA 3RZKA 3OYWA 4LK7A 3HT2A 4HZFA 1YIPA 2XVGA 4OHYA 2ZHLA 4CDXC 1Q5OA 5DN2A 1SQ4A 1B35A 5DAPA 2WNOA 1DFQA 2HWD1 4M3CF 3VKLA 3TEYA 1AZDA 1W8TA 3OBTA 3WEZA 1GV9A 4K20A 1SBFA 2E31A 1V9U3 3BN6A 5C4WC 4SLIA 1K5MB 4XF4A 2QQNA 4ZZ5A 4NO4A 3ZMOA 3FHQA 5ACA2 1AYN2 3AXEA 4AK3A 2JG8C 2ZGLA 3M8LA 4LBMA 1HKDA 1NLRA 5DXDA 2AC1A 3SEPA 1G9BA 1B09A 4A45A 1UY0A 2R32A 1PO21 4NN0A 3ACLA 3T08A 5B4NA 3MIEA 2XUEA 1MQTC 4XFBA 4S2FA 2AREA 5FZDA 4ARYA 1VAVA 1NA1C 4Q5OA 1PGW1 2WN2A 5FBJA 1QJY3 1F15A 2J1SA 4L92A 4L8QA 5FY0A 4XMAA 5I0UA 4E8CA 2ZPXA 1UY2A 1CAWB 1OLRA 1J3RA 3O1TA 3K4AA 1NCQC 4FAGA 1QKQA 4ZXEA 1EYBA 1V70A 5G05L 1AL0G 1HRI2 1ZBA2 4JDNA 1HN0A 5FYHA 4H14A 3UJOA 3S0MA 4QXBA 4LORA 3CL1A 4LO6B 5FRAA 5IWFA 1JZ4A 2VY0A 1N3OA 4XXAA 2YMZA 5GM0A 2D6KA 3TEZA 4C1WA 3HQUA 4XDQA 1BVVA 4WZCA 2ZS6B 2L9LA 4R9CA 3JBG3 2XONA 3POYA 3AVSA 3VZNA 4CDWA 5FR3A 1XU1A 2PFWA 2VZVA 3VBHC 4Q4Y2 1RUJ3 1EV11 4P9GA 5C8CA 1DU3D 3B01A 4RGAA 3THCA 1JTZX 2XB6C 3W5NA 5J7MA 3WG2A 2IVIB 4YZ2A 3K48A 1H0BA 1OFNA 3AZZA 1H8TC 5F8PA 3ZFGB 4I02A 1QY4A 4URTA 1IPSA 1VR3A 1H2LA 5CFDA 1CESA 2ZKLA 4ZHNA 1RUG2 5LBBA 3PUSA 1KEXA 2YBSA 2XQXA 1OC1A 1VBA2 3I2FA 4HSLA 4I3PA 4LBQB 2VZ1A 4LXLA 1JU4A 1SFPA 2GC2A 1H2KA 1LOAA 1TQ5A 1VMJA 3PU3A 4FPOB 1YCIA 5DDJ2 4QAWA 2D6PA 1PM4A 1QMJA 4IERA 2QFEA 4WM7B 2XQRA 4ZPIA 1SEFA 4LPLA 5JSRA 1ALYA 5FY5A 1AJOA 4K6BA 2QBXA 1GZTA 5GLWA 1K12A 3OUIA 3RNSA 1YXWA 1W6PB 3MI8A 3OG2A 3TWIA 5JOZA 4BMBA 1JZ8A 2HWE1 2BEOA 1MS5A 2NP0A 3IDAA 4L9BA 4YVWA 3ZXDA 5FYMA 4MXVA 3FE5A 4BQYA 1C5IA 2RS52 2Z4FA 4MLOA 1VBB3 2JDNA 4IEOA 3PU8A 5BY5A 4YW1A 3H0OA 4QQLA 3ZYJB 3VD9A 3ITQA 2XJSA 4GMP1 5B2GB 1REEA 4NIAA 3N35A 1JU3A 1YFYA 3U10A 1XNTA 3SXWA 5CA6A 3KZ4C 3FLTA 3BTAA 4B4QA 1OQDA 4BISA 4MGIE 4WV8A 4DUWA 1OMIA 2CTVA 2H0VA 2X5IB 3B00A 1JZ6A 2E9QA 3AKQA 3I2HA 3MO4A 4IV3B 4LMFA 4COVA 3DECA 5F9TA 4AR2A 5J96B 3RS6A 1WMFA 3I3EA 1UX7A 4H2AA 4LTAA 2WBKA 3H1YA 3DF0A 4JHTA 1Z78A 1PVC2 1QNYA 4IE6A 2FCVA 4NUBA 5FYBA 3WNMA 4ASLA 5ABJB 4Z92B 2OQ6A 1M06G 4WVVA 4CU8A 1R081 4Y33A 2FHRA 2F4LA 3I2IA 3VBHA 5F3GA 3W20A 1X8MA 3V56A 3KT1A 4JKKA 4OHZA 4Q0SA 2ZGQA 4C0HA 4BXSV 1AX0A 3BVCA 4COUA 4LA3A 4GKYA 1POV0 3LPGA 1PNFA 2P4EA 3RZLA 2BRTA 2R0FA 4KBBA 1JI6A 1FX5A 2WWJA 1ND2C 4CTEA 2ATFA 2FDJA 1BK0A 4QX0A 4CDUC 1Z7S2 4LEJA 4YARA 5FUNA 1LHUA 4XUTA 3RQ0A 3WD5A 2QCSB 3POFA 5E89A 3S5QA 3WOGA 3D8CA 1W0OA 4LBLA 1L7RA 4KWLA 3QBQA 4DRRA 4E8DA 5DAXA 3ZFEB 1D4VB 5FV3A 1W6NB 2MEV2 3AYDA 4CEWA 4ATFA 4HKLA 5ABJC 1N1TA 3IAPA 1HXS1 1PVXA 5FZEA 2D6OX 4GJZA 2RS13 3JXSA 2HBUA 2Y6HA 4ZS3A 5A3WA 1BCXA 3DV8A 1KD7A 1YFXA 1XNCA 4LO4B 4QQPA 4ES8A 4Q8KA 1F5JA 4YW6A 3MF9A 4ZU4A 3KCXA 1UF2C 5FQ0B 5LATA 3VBRB 2Y33A 2XJRA 2DV9A 1JYNA 2O14A 3I54A 2CWMA 5FJKA 1DQ6A 2WIIB 5FZCA 5C9AA 3Q9OA 4NPRA 3SH3A 2RR11 1SPPA 1N1VA 2ZZQA 1LOCA 4OZOA 2VR4A 1STMA 3DKQA 2VE1A 3OUJA 3ZDSA 3U4SA 3WLUA 1ZZCA 3I8TA 3NW4A 1QIQA 3CMGA 5FFOC 2YC0A 4Y22B 2VAUA 4FPCA 1G6NA 2MEV3 1NX9A 1QOSA 4XOGA 1TME2 2VOTA 4LK6A 5LW9A 4NHLA 4QPWA 3PMEA 1W6MB 4KGGA 2JENA 2HEWF 2HWE3 2C24A 1UY3A 5FZLA 5ANQA 4NIGA 2JECA 5T3NA 1AR72 3VN4A 2GP5A 4RS5B 2R49A 5FP4A 1EV12 5FAXA 4IETA 2E63A 3ME2A 4LBQD 1FI2A 1GOGA 2C4XA 1BKZA 1TMF1 2HWC1 5FOBB 2PTMA 4R8HA 4MXWB 4XQWA 1W05A 2A6XA 4RGGA 1JODA 5HI0A 3WG4A 4OYUA 4M3CA 2DURA 4LITA 5FY9A 1WMXA 5F3EA 4U36A 3DL3A 4PHZA 5EJ3A 4HETA 1E5IA 5KC6A 1PGSA 2A71A 2R16A 1JOBA 3I2JA 3RZGA 3OCPA 2RS11 2VQAA 1ZBE2 3K3NA 2GMMA 3I3DA 1XBFA 2EXJA 3GCWA 5IVJA 2YFUA 1TVGA 5G04L 5AVAA 5BNNC 4BB3A 5E1RA 3HVDA 1H30A 3ES4A 4CP0A 5KHJA 1JYTA 4Q1PA 3SMHA 3T2OA 2XH6A 4YNIA 4XBNA 3VDDA 1Q8OA 1BYHA 1W8UA 1ZZ9A 2P6HA 1C8M1 4ZXKA 3MHZA 5D1IA 1IS4A 3BTYA 5CG9A 2BWAA 3OGGA 4DEVA 1AYN1 5J1XA 4QX5A 3UNPA 3OSDA 1AX2A 1DHKB 3JD73 3LDRA 5A1FA 2WS91 5F5QA 5A6XA 3THDA 2BV4A 2RJLA 4QHBA 1R093 2W2IA 2UY9A 1OI6A 2ERFA 4PLOA 1CZTA 4XHBA 5C3SA 2ET7A 5DAQA 3J26N 3M3OA 2DWRA 4NRQA 4AEDC 1IOAA 4M0NA 2WA4A 5AVPA 5FZ1A 2Q1FA 4XYXA 4CXXA 3WNXA 2Z2SB 3HN3A 3UETA 3AYCA 1LR5A 1OLME 4QKFA 1AVBA 3VZKA 1ENXA 2RMU3 3EJKA 3I59B 3WF1A 1VBA3 2J1EA 2JB4A 2WNUA 2JICA 1EP0A 4JVAA 4QPGC 5JWPA 1F5FA 1UQXA 2JDYA 4YLZA 5F5AA 3T2PA 5F6KA 4COYA 5A3LA 1KGYA 1RHI3 4AI0A 3RJRA 5LZ6A 5F32A 3WXPA 5FJHA 2VOVA 4UI9L 1F8VA 4DMIA 1WW6A 1SLBA 4EE2A 4V2VA 2GMPA 2HWB1 2BWCA 1RUOA 2RS33 4AQTA 4ATEA 3CDZB 2R30A 4XJUA 5CVRA 5ERLA 5A32B 3BIWE 4E4SA 4E9KA 3W5MA 4JV4A 4XF1A 3AMQA 5JZGB 2WFF2 3LPFA 4OLLA 4QGNA 1HDKA 5FMOL 4RA0A 1BMV2 1RUE2 2BJSA 2XJUA 1JXNA 4ZZ8A 4BA6A 3O1PA 1SLLA 4B1MA 4IV3A 4FP2A 2XKPA 2ZGPA 4I2OA 1W8ZA 2MNGA 1JW6A 1ULEA 1LB2A 1AR61 1LGNA 2XHNA 4XQDA 1AR73 3JB8A 3J7HA 3MZHA 1OOPC 3HAGA 1KJRA 1W3XA 4V2WA 2DTYA 2K9ZA 1YI9A 3VDDC 5LK7B 1QJY2 1HV0A 1Q8QA 3AYEA 4UWDA 1YQCA 4CDQC 1YJLA 4JTOA 5GLTA 2B9UA 5FPZA 2CDOA 4N9HA 3OD4A 5DABA 1K5JA 1QHDA 4A41A 2G1MA 5IYYA 3H50A 4PCRA 1XU2A 3WSOA 4CVUA 1MS0A 4PDWB 4YPJA 4DXRA 1JN2P 1L3JA 4JZRA 5C33A 1POV1 2VULA 3RGBA 2R041 2VO5A 3VKOA 3IDBB 3BGAA 2Y34A 4MX3A 4PJYA 4I30A 5L19A 2JEMA 1D4M2 1UKRA 4IE0A 3KT4A 4AGRA 1AF9A 1FOD2 3C7FA 5F2WA 2B9VA 5DG1A 1FV3A 3DPRB 2G9ZA 4NAOA 2YB7A 2HJIA 1ASJ2 1GNZA 5F2SA 4LHKA 3LD8A 4SBVA 4XJWA 5LA2A 3RZZA 2BFUS 3J7MA 4QU2A 2ZABA 1PHMA 2XJVA 3D82A 5CB7A 2BYVE 4MGTA 1KJLA 3VHNA 1Q3EA 2PHXA 1ZRIA 2XG3A 3E5XA 2Z5WA 5C3QA 1GWKA 2MPFA 3ILFA 1QWRA 4YZ1A 1OFSA 4KQ7A 4FPFA 4UFJA 2WFF1 1UIKA 4PDWC 2R071 2WFPA 1AL23 1MS1A 1RVF1 4KH9A 4RQPC 1Z7S3 1VAKA 5JCTA 1ZZ8A 3ZIWA 5ABJA 5K0UC 2DF7A 5FY8A 5HCBA 1SCRA 4CCJA 4XC9A 1HRI1 1JS9A 1ZBA1 3I3MA 4FFGA 5H9SA 3DPRC 3O1OA 5FY4A 1UY4A 2QTWB 1J59A 2IVJA 2OX0A 3ZXEA 3VD3A 1H2NA 4YZ3A 3VGIA 5JDBA 2RM23 3HD8B 2XOMA 4AEJA 3S5AA 4QQ2A 5CAZA 1UXZA 2FDKA 4FPKA 1Y43B 2V5DA 4P9LA 4AVVA 2VNRA 3DYOA 1VALA 1FMD1 4TLFA 3ETQA 3T0AA 3ZOIA 2VC9A 1W9FA 1MZFA 1PVC3 1D2QA 1IKQA 1V6KA 5JXGA 4AQSA 4QB6A 3HNBM 1S4CA 4XFGA 5JAXA 1LECA 1RUF3 1UD1A 3VKFC 4QPIA 1POV3 1YQ6A 3HNMA 1SBEA 2ZEZA 3ZIXA 2WRAA 4E4DX 2VBBA 3AVRA 4XFHA 5LEJA 1EUTA 3RMXA 4C91A 5JOXA 4BQ3A 4FSJA 1ZRRA 2ARBA 5LASA 4LQRA 1Z0HA 5FYYA 4BQ2A 2J1RA 4D6QA 1CD3G 1D7PM 3UJQA 4AGGA 1U0AA 4DXSA 1AR63 3NV4A 5A3UA 2IFWA 2RS53 1QJX1 3VBSC 3WX5A 1DGRA 1YFWA 5FMDA 1W39A 3TNQA 3K4DA 2YXSA 3LAGA 2W46A 3NAPC 3IDCB 2WNVC 2F6BA 2Q30A 4MVTA 2CV6A 2H6CA 1VAMA 2EIDA 4DEQA 4HOOA 5FLIA 4KL1A 1O4TA 1SLCA 3P3PA 4CUGA 2QQLA 4YW3A 3P6BA 4LO7A 3HPNA 2ORXA 2D98A 4YM3A 3GALA 2QZ3A 2ZJCA 4ASKA 3A0KA 1BZWA 1MR5A 1Y3TA 1V6MA 1RINA 2JG9B 4FPLA 3VDCA 2O0OA 4CP9B 2QKDA 1Y9QA 3AFGA 3H9AA 4XQ4A 2VBDA 3FHAA 3GZEA 3SHRA 1QQP1 1WLCA 2ZX4A 3W59A 1JZ7A 2VQTA 1HB3A 2Y38A 3HWJA 4INDA 3WINE 2IXKA 2R061 2VMCA 2VZPA 1W0NA 3ZR5A 4DUVA 2D97A 2CU5A 4LUMA 2VOWA 1AXYA 4EN0A 2LROA 1UZWA 3U11A 2EIBA 4LJHA 4Q4Y3 1OKOA 3DYPA 1GQGA 2YDEA 2ZGRA 2PHDA 3B93A 4CE8A 3CZUA 3EQEA 1RUC1 5FLHA 3VKNA 2EAKA 1G9AA 4Y4RA 2X53S 3E6BA 3KHCA 3ES1A 2RG4A 1RVF3 1L7QA 4M3CE 5D21A 4Y26A 3KQRA 1NCRA 3OJBA 5AFBA 5I0SA 1MS4A 1QXPA 4CEYA 4DQAA 1TEIA 3HQRA 3MUY1 1HRI3 1AR93 1ZBA3 3ZFFA 1MQTA 1QJFA 1M4WA 1MZ6A 4FI9A 1LHWA 1U5ZA 2I74A 1RUD1 1W8WA 2WAOA 3ZXJA 4Q1RA 1A6CA 2XJTA 2W1QA 1LHNA 2DU1A 2Q1MA 3SCFA 2A6VA 4Y4YA 4XJZA 2WZR3 1JH5A 3NL1A 1UU6A 4QMAA 1MZ5A 5F5CA 3ACIA 2IUWA 4Q4X2 2X5IA 2VCCA 5L7OB 3CO2A 3LEMA 3ZLIA 3TRSB 1PIV1 4BE3A 3SCHA 5I8SA 4E4ZA 3VZLA 3D0JA 5FK7A 2CDPA 2R1BA 5FXZA 4IE7A 2JJ6A 5ACA3 1GP4A 3WDXA 4EJRA 1TMF3 3N3HA 4XDOA 3ENRA 5FZHA 3NJVA 4D7YA 1V9U2 1IPKA 2B7YA 2VMDA 2Y6GA 5FKCA 3TN91 1VBE3 5IVBA 2W3JA 1LRHA 1X33A 4DO0A 2CNAA 5I93A 2VUCA 2ET1A 1QF3A 5EJZB 4L99A 1DBNA 1S0EA 3AYAA 5IUQA 1I9RA 1RUI3 1W6OB 4AFMA 1UNBA 1YWKA 5FYZA 2HWB2 3PDQA 4XETA 3S30A 3J7LA 1YUDA 3UL2A 1KFXL 5CFCA 5FP3A 2VCAA 2OUJA 3AXDA 1COV1 3NRUA 3HIFA 5LB6A 1OPMA 2VZTA 4XAEA 1S0FA 4BDVB 4N7UA 1C1LA 1N3PA 1XQNA 3GYDA 3I2OA 3TEXA 4CP9A 2NN8A 5CNAA 4AGVA 3MW4A 4IEUA 1OA3A 3KLSA 5KXEA 1Y9GA 2XWJB 4QB1A 1RUC2 3FX3A 4OI2A 4MGYE 3BPZA 5J98B 4A6SA 3OYWB 1I5PA 3VD5A 4CRQA 4Q27A 5CG8A 3LEGA 5IATA 2AEZA 2DU0A 3M2MA 4R9AA 2PYTA 1ENSA 5FDBA 2GALA 4YW5A 4V1PA 4MHUA 5C4WB 3VHPA 3CLPA 3WV6A 2WQ4A 1RC6A 3FN9A 4HMZA 3D3AA 2IFRA 3UT0A 2VVFA 2JG8B 4UFMA 1QQP2 2BUKA 2VTXA 2WS92 4WM7C 1FMD3 3OPWA 3BALA 3L9JT 1ZA7A 2C9AA 4XMIA 3P5BA 4GB31 4B7KA 2R043 3FL7A 3VD4A 1MQTB 4RN5A 4JKLA 3N36A 1U5IA 5F3IA 5TSWA 3ZVXA 4XJAA 5CADA 1WA4A 2AUYA 4Y1UA 3N7JA 3CJIC 4Q4V2 2OYZA 1BJQA 1HW5A 2OQ7A 2TEPA 2Y8KA 1V9U1 3TN92 1C8NA 2RHPA 3U1XA 1N1YA 4IXLA 4AVTA 2IXJA 4GA9A 4Z8BA 4AAXA 4CU9A 4META 4F8AA 4EN7B 4CCLA 1A34A 1UCXA 3PJYA 2VXRA 4IEWA 1NY71 2RS51 2QQMA 3AMHA 4CCMA 1RUH2 3THTA 3VZMA 1CZSA 1OBNA 2A70A 4H7LA 3I2KA 3ACFA 5L9RA 3TBDA 1UL9A 1NLQA 4AVAA 1BEV1 4XTPA 1MACA 5L36A 5JLVA 4U2AA 2BNNA 1K5MA 4N53C 4A7YA 3JU9A 1W6QA 3IPVB 2D7FA 1H8VA 1ZZ7A 1UMZA 1DP0A 3WF0A 1PZ7A 1XE0A 1HN1A 1DLLA 2HWD2 2HWC3 3NNLA 4MHRA 3UKVA 2BW8A 2EF6A 1WMEA 3D4KA 5APAA 5EHDA 4L11A 1QH6A 1I5ZA 3WF3A 3ZFGC 2W94A 2VM9A 4RFRB 5BV6A 1VB4A 4N43A 4KMQA 2WNVA 4KBZA 2XPJA 4IV1A 3R0RA 3CKHA 4Q2FA 5FPAA 1JZ5A 3CQOA 3UKTA 4DZGA 5EP9A 3UYJA 2Z69A 3WP3A 2LS6A 1OURA 2B42B 1W9SA 2DVBA 3EB7A 3JBG1 2BZDA 2V73A 4FT8A 3B69A 3K4ZA 4G9SB 4GB33 3T1LA 2ZBJA 2HWD3 4UFIA 1XB9A 4WM7A 1J3PA 4BXFA 2BFUL 1WW5A 4GQ7A 2XL7A 1PK6B 4PIZA 2XBO1 4Q4W3 2W95A 4QQHA 4R9BA 3DUIA 4AEKA 5BNQA 2HWF2 5C70A 3AKRA 3POIA 5EIYB 4CEYC 3CZJA 3UKNA 2OZJA 5JIUA 1VIWB 3S7EA 1YQ2A 2XWBB 4E2QA 3CJIA 4AFBA 4BYYA 5JVVA 2QQUA 3QCWA 4X8PA 4WM8A 4CCEA 2J22A 2JE9A 5DZEA 1O3RA 4I0WB 3RI9A 4PIXA 1SG3A 3JUUA 4FPJA 2Z42A 3ZXGA 4DINB 1YFUA 2EICA 2TUNA 4QDQA 1R1ZA 3HR9A 2GU9A 4LBNA 1ND2A 4XACA 4W65A 1QOTA 3WVJA 3CHXA 1SACA 1GWLA 2X29A 4YG6A 2EXHA 2GNMA 5FYIA 1ULGA 4Y1ZA 2D5FA 2GN3A 1PZ8A 4ISQA 2ORZA 4R4ZA 3RYPA 4AVBA 5DUXA 5HPOA 3PTRB 4EYUA 3AX4A 1PK6C 4P08A 3ZFFB 4DFSA 2R042 2FCUA 2VVDA 4PBOA 1CGPA 5GZFA 3ZSEA 3HNYM 3CIHA 3KHBA 2ZACA 3ORJA 4AI1A 5IVEA 5FZOB 1GBGA 5FPBA 3G7DA 2WYFA 2WT1A 2X10A 5T5PA 1R1A2 4ZU5A 4QX7A 3OGVA 1BHGA 4XF0A 1CPMA 2A1XA 5K9YA 1Q56A 2BPA2 1CN1A 2ES3A 3H7JA 2VBPA 4KU8A 1AR81 1H9WA 1OKQA 1VBD3 4XE9A 2AEYA 1H1AA 5DZFA 2PLV3 3D0SA 5DZGA 5JIAA 1RUJ1 5JPMB 4UOJA 4PLNA 4CDUB 1O8SA 3E5UA 3LA7A 2R062 5CFCC 4DXZA 1BEV3 2D3SA 1VPHA 3C3VA 3FLPA 1CWPA 4RR3B 1RB8G 2V5YA 2Q8OA 4A7KA 5LRRA 5L9VA 4FFIA 4YGCA 5LY1A 1TZOA 4EWEA 1BEV2 1XRUA 1YI7A 2G9GA 4N43B 4DIQA 3IIAA 3I97A 2PHUA 2VW0A 4LUKA 3FUQA 4D94A 2UWCA 4K8FA 4P9YA 4GAZA 3N4MA 2VCBA 4P9WA 3N7MA 5BNPB 1XE8A 1UOJA 1XNDA 1WW7A 1RUI2 4BQWA 1RJ7A 2ZX3A 1UIJA 3OY8A 3KCCA 4YVSA 3WW4A 2RM21 4OZXA 2FD8A 4HN1A 2W47A 3Q8FA 1ENRA 4XUOA 3MGUA 3EMRA 3EYPA 1NKGA 2B4KA 3DXUA 4Q0PA 1Y9MA 4YFWA 1T2XA 1TMF2 1N1SA 3WUDA 1L7LA 2ZX1A 5JUVA 1JOPA 3AZXA 2WNUC 4EROA 3LGRA 3PIGA 4N90A 3N9QA 4AQ6A 3Q8AA 2DVFA 2OIIA 2C1FA 1KDMA 1UYXA 5ACA1 1R1A1 3WQ7A 3RYRA 5E88A 2ZGNA 4P00B 3LOBA 2Y64A 2XLFA 5F6LB 4CXYA 4YZ5A 4GALA 4K9SA 1NZCA 4Q4X3 5C3RA 5BPXA 4AEDB 2TBVA 2Y6JA 4CUAA 3HJRA 2WZ8A 1DZTA 3RI8A 4IUGA 4BCUA 1RUNA 4D69A 3TOJA 3M7AA 3F2ZA 5LK5A 4YGEA 3MPBA 2PMWB 4RHV3 1G9DA 1BBT1 5F3CA 5EXOA 5KR7A 1IG3A 3KS7A 2D6NA 5SV8A 1WZXA 3ZSMA 1WBFA 2HH9A 3RVHA 2CYFA 2HWF3 4BLJA 2JDMA 3RWKX 4MSVA 4BOWA 5FK8A 4AAPA 1DZQA 2QQPA 5FREA 5C7GA 3R4SA 1VBB1 2C9KA 2VQ0A 2XKOA 4ISRA 1HJGA 2VVEA 2Y0OA 4D6RA 1V6JA 1MEC1 4GB32 4GWIA 4CPBD 3J8F3 3LOIA 1S0JA 2YC2A 4XABA 5JZGC 1MEC2 2V4VA 1H4GA 4Y3OA 1Q8SA 1O59A 1XNAA 2A3WA 4QT6A 5BNNB 2Y6LA 4UXAA 1QGLA 3Q8CA 1D0HA 2OPWA 1ZNPA 4FFFA 2FBEA 4HKOA 2UYBA 4LHLA 4BU2A 2GDFA 3HBZA 4MADA 3ROUA 5T5OA 1QH7A 4EZ4A 4XXPA 4PQ9A 4TLGA 1A78A 2W39A 5C9AC 3GM8A 2AZ5A 1W2AX 2OT7A 4YRDA 1DF0A 2DUPA 4QHZA 1OT5A 3VDDB 2PHFA 4NIIA 1FNYA 2QNKA 1RJ8A 2HWC2 3ZO0B 1MVEA 5IK7A 1S0GA 5FOJB 1QJX2 4JQTA 2YGLA 3POGA 1SHWB 2P3KA 4UW6A 1X8EA 1DQ2A 3ILNA 5ISLA 1QOOA 5GZDA 5JR2A 1GSLA 2WKKA 3AM2A 3JCIA 4IV1B 5FYSA 2D93A 1OQ1A 4D7TA 2XR4A 5C8CB 3ALQA 4YM0A 5FWJA 4JRLA 1X82A 2YFZA 3MLLA 1OUSA 4BK5A 3K75B 4OI0A 2XMLA 4M4PA 2WT0A 5FP7A 2ZHKA 4O65A 4XF3A 2YGMA 3BOPA 4KG0A 4NOTA 3I2GA 4O9EA 1CAXB 4XCAA 1HIXA 3LCPA 5EJ1B 4Q4V3 1AXZA 3LSDA 2ARCA 1DQ5A 1DQ1A 1PGL2 3ZPYA 2VNVA 1G7YA 2YG0A 3AKTA 1LAJA 1JUIA 3WHUA 4Z82A 2NMNA 2ZX0A 3BOWA 4IEVA 2FDFA 1ZBE1 1CQ9A 3K3OA 1AUYA 1DYKA 4UT5A 4GWNA 2ZGTA 5BYNA 2O1QA 3A0NA 1J1TA 4WM8B 5FZ9A 4FBFA 4RQPA 5FZFA 3IAQA 2ILMA 1QQP3 3QOPA 1CPNA 5CEHA 1F31A 1S55A 2O8OA 2P34A 2PELA 2VG9A 3CF6E 3JQXA 1Y4WA 2WSUA 2FQPA 3JQWA 1ND3B 2YC4A 3FLRA 4X6QB 1HRV2 4CZSA 1J58A 2XBO2 4RSUA 1ZRCA 1KQRA 1W9WA 4IESA 4X6RB 5KHKA 2BP6A 1QJU2 3T30A 4DPNA 1RUI1 1VBD1 5FY7A 1T6GC 1YO8A 3NKGA 2BNOA 1RUC3 4MYEA 3ZYRA 4YGBA 3R4DB 3AKPA 3AJYA 2JD9A 2CGPA 1UKGA 4IGOA 2JDKA 3AMMA 2G19A 2RS31 2JG8A 4JC1A 1F2NA 2VMHA 2ENRA 2OXBA 3MYXA 3OGSA 4IW3A 4EN6B 1FPN2 1YRZA 3E5QA 4HPKA 4YGDA 5JMCA 2BOIA 4HXCA 1JHNA 2ZMKA 4GXLA 3RYKA 5C5TA 3H8RA 3DPRA 4TSVA 3OBAA 2J42A 2PAMA 5CKQA 5JXJA 4YVSB 1G86A 4WVMB 3MIHA 4BM8A 3TAYA 2VH9A 4KG8A 3QH7A 5CISA 1VRBA 1RXGA 1NA1A 3HN1A 2XL9A 2W92A 1GR3A 2FDIA 3E97A 3KM5A 2P2KA 5IVFA 4QU1A 1V6IA 2LW8A 4I0AA 4Y1XA 4PI2A 4HPKB 3AL5A 1JOJA 3ABZA 1VBE2 5IHRA 2J1TA 1ASJ3 5I0DA 5A33A 4CA9A 1W6NA 4CEWB 1GOHA 1DGWX 1COV2 3V0AA 4WVMA 3VBSB 2WLQA 4A44A 2GSYA 1D4M3 2A73B 1S2EA 4QHOA 4GH4A 3WQBA 4XFAA 4IV3C 1C8M2 3Q8EA 4FP3A 5LBCA 1E5RA 3GJBA 4XFFA 2WR9A 2VXJA 1PNGA 3HOBA 4Q29A 4R9DA 4AHZA 1UPIA 4LOSA 2ZKNA 5FBZA 5CKMA 2JKBA 1PO12 2GC1A 3GZAA 4CU6A 2ZAHA 4YVSC 1XYNA 3BU0A 2HEYF 5FTTC 1GP5A 4RQPB 5A3PA 3H1WA 1FAYA 2WZR2 3P3NA 4AF9A 3X29B 3F95A 4FOWA 4LKSA 5K0UB 1O3QA 1V6NA 4L97A 1HB4A 5A7WB 4MO3M 1I6XA 2E53A 3LSEA 4O61A 5IFPA 4EWAA 3H42B 3PIJA 1MS9A 1CIYA 5GKAC 3WF4A 1W03A 3PHMA 3VL9A 2ZGKA 1AR92 5BXXA 3ZYFA 2QDRA 2YHJA 5A6YA 3PMSA 1OUXA 4JKMA 5FKBA 4AWDA 2P5BA 4MV2A 3BYWA 4A3ZA 2QJVA 4W6YA 3ZKUA 3R05A 4CDQA 4DUXA 3V0AB 2VU9A 2W1UA 2XXZA 3MIGA 1ODMA 1RUE3 1RVF2 4LLOA 4FQ4A 5FO7B 4CXWA 1H1MA 2VMIA 1GANA 2UY8A 1NLSA 3NV3A 4B3NA 2ZEWA 4J1XA 1HV1A 3NMBA 1RIRA 1EPWA 2A7AA 4XBLA 4DY3A 3J8F1 1X7NA 4HVRA 5EYXA 2SLIA 3SH5A 5D8AA 1EAH1 1OSGA 2ZHMA 3H3ZA 4S2DA 3VBUA 1SMVA 1RTVA 1ZM1A 2WAAA 4NWVA 1ENQA 1RHI2 1W6MA 5FYTA 1POQA 4K7JA 1UZ0A 4GZ9A 5HCHA 3AC0A 5BNOA 1RHI1 1V6OA 3DGTA 3WDUA 3EHKA 3AK0A 5FCCA 1KS4A 1ULDA 3IZOA 4CCDA 1RMU1 1LULA 3WNKA 2WZEA 3DN7A 1NAEA 4XHXA 1GU3A 1D4M1 3AZWA 4CCCA 3KCYA 2ZX2A 1AXKA 5EQUA 4AYUA 1LTEA 1LCLA 4IDZA 2PQSA 2KXLA 2A6YA 3GZUC 2HYXA 5AC91 5JMOA 3SC7X 5KWRA 2W87A 4FOVA 4GH4B 4PIYA 4Q0QA 5L7OC 3WDTA 5BNOB 3VV1A 2K0GA 4FPEA 4FTSA 2JXAA 4OUMA 1REFA 1QXJA 4ZU7A 4QGMA 4UFHA 4K21A 1UMIA 3O0VA 3JD72 5GLVA 4LA2A 4HG6B 2Q4SA 1RITA 5IT6A 4QQOA 1BVP1 3LFMA 4P5HA 1LENA 1VBC3 3KB5A 1PO11 3MFAA 5A7OA 3JZVA 2CHHA 1URXA 2JG9C 4M01A 1AR62 1X36A 4UF0B 2DVDA 3RMYA 5A3TA 2WZR1 2XVKA 1JZ3A 2CSGA 1UMHA 3UGGA 1UOGA 2AACA 4JHZA 3RPQA 4B1LA 3GHNA 1UOFA 1R083 3I4IA 2E32A 2EALA 2FMYA 2XJPA 3ZFEA 4EWDA 2BGOA 1HQWA 2AH2A 1G9FA 1EAH2 3RZHA 2WNEA 2ZMNA 3LA2A 3LDKA 3MDPA 2EAAA 5BNOC 1JYVA 1ZRFA 4IE5A 3B5LB 2JDZA 1RXFA 5FXWA 3U07A 4XFIA 4IGPA 3N9NA 3KV4A 1OA4A 1BK1A 4NHKA 2D44A 1ONAA 2JDAA 5KHGA 2QDNA 2R0HA 3JB4C 1ULFA 1SLAA 4YYOA 5A6QA 1NQJA 1N3QA 5IAXA 4HLTA 1BLZA 4LIUA 5FPVA 4Q0VA 2QQKA 5A3OA 3RWNA 2PAKA 1C57A 4QX3A 1OH3A 1AJKA 3ZSKA 4AHWA 1GLHA 1NCQB 3CEWA 3NJZA 4N8MA 1YEWA 3KD4A 3GJAA 1YLLA 3NV2A 4ET7A 3ZSJA 1NY72 3PNAA 3ATGA 5LA1A 1YQ8A 2OW4A 1QJU1 2ARXA 3I3QA 4XCBA 1AL22 1W9TA 3LIGA 5KXDA 5KXCA 4TN7A 2VGDA 3ZYIB 2YBKA 4HVOA 4TYSA 4BLIA 3MLKA 1KITA 2CY6A 3WQ0A 4NRPA 4CP2A 2E7AA 1YJKA 1TME3 4LO8A 4PLMA 1OLMA 2AYHA 2C5DA 3LFIA 3M3CA 4EV0A 1UX6A 2HKXA 2DFBA 3AL6A 2C0ZA 1HB2A 1PMIA 4NIHA 5C3PA 1AYM3 2E26A 2YPJA 1DDLA 3ZYGA 2RVAA 1RUD3 4N9IA 1F4HA 2R072 4NIDA 5KBFA 3ZXFA 2Y26A 1GNHA 3C2UA 4C0BA 3T4HB 2YBPA 1FOD3 1UU4A 1J1LA 3AZVA 5C3OA 1HLCA 1GFF2 2HWF1 2WL1A 1NUKA 4QX8A 4QX1A 5FYCA 3T2QA 4K8RB 2AENA 5KXBA 3DKWA 4PQQA 3LWCA 1RUD2 3POEA 4CCKA 1CJPA 4PT6A 2DBIA 1V6LA 3FBMA 3TNPB 5IK5A 4LE3A 2RS12 1LOFA 3KF3A 4ZY9A 1PGL1 2D3RA 4PI0A 2K46A 1XOYA 4QM8A 1ST8A 2JKXA 5FYVA 2NM1A 2N7GA 4YM2A 3ZYBA 5LBEA 3PUHA 3WQ1A 3NJXA 2RDSA 4OHWA 1S2KA 1X9TA 1FATA 4LKEA 1NCRC 4NMIA 1O4YA 4ASMB 1LOBA 3BTXA 1ACCA 2IXLA 4AE2A 4M0HA 3VBFA 1CR7A 4BQXA 2G9FA 4R4XA 2PAEA 1Q8PA 4YWAA 4QXHA 2FCTA 4AQ2A 1BXHA 4ARXA 5BNNA 1QDOA 3KGLA 4CYDA 2JDPA 1XYPA 4QD2A 4E4HA 2BVBA 4XDPA 2WSVA 2ETEA 2LUWA 1VB2A 3M3IA 4JAAA 2JE7A 5FXVA 1IHMA 4BIFA 3S6PA 1YC61 1IZ3A 1SZBA 1UYYA 3IB3A 1UW8A 5GZCA 3N7LA 4KNCA 2WFF3 4JGZA 3OGRA 5GLZA 3WNOA 5AFEA 2X5IC 2Y0IA 2EA7A 5DUVA 3A4UA 2CGNA 2RS32 3HEIA 5CIRA 3HMYA 1US3A 1WLDA 4FCAA 2PHWA 3RSJA 2NPIA 4K40A 2VZ3A 4MGKE 1EUUA 1QEXA 3LQCA 1OPOA 4UFKA 1IPJA 4HVQA 1JBCA 1H6YA 4W6XA 1NCRB 1CVNA 3CJIB 4NROA 4PF5A 3FFQA 3FC0A 2EIGA 5DG2A 1PIV2 2ID4A 3AKSA 3GGLA 3KGZA 4GKXA 3T3YA 3U75A 2BOJA 4WBBA 3I7DA 3MFCA 3JD71 5KC5A 1LJ7A 2RMU2 4OVEA 2WO2A 3V65A 5EWSA 1E5HA 2PXJA 4LE4A 4Q4V1 3KSCA 1PO22 4MZUA 4AFDA 1SLIA 3B94A 4OHVA 3KVAA 3PLQA 4QDRA 5I91A 1US2A 3LEKA 4QXCA 1VBB2 4XZUG 3M4FA 1IS5A 1RUF1 4HSJA 5T5LA 3USUA 1EY2A 4XUPA 1W8NA 3SNMA 3AP6A 3I2DA 5LY2A 4JCKA 1R092 4OUSA 3CU7A 1H6XA 1GOFA 1HX6A 2BU9A 5ANNA 5A3MA 1ODNA 1D2SA 2BBAA 4MUVA 1OD5A 1LODA 4YG0A 5FZOA 5IVCA 3EBRA 2NQYA 2WA3A 4AVCA 5FLJA 3M3QA 4KGQA 1ZX5A 3W9AA 4QPYA 1W8OA 3ACHA 2Q8CA 4XAAA 4QXKA 3M3EA 3VKMA 5JXIA 3T0DA 3SQOA 5FZ4A 1PO23 2VMFA 3KWVA 2LTNA 3VBUC 4CDWB 1C28A 3NAPA 5J36A 3E6DA 4FOQA 5CYYA 2E51A 3H3UA 1RUG3 2GZWA 4NWWA 3BU7A 1PIV3 5C8WA 2Y6KA 3IMMA 1E5SA 3O7OA 4DY5A 4RR3A 3ZPOA 3DYMA 4FPHA 3D6EA 5CFCB 4A42A 1ZBE3 2W52A 5DQ0A 4IEQA 3QACA 1NG0A 1DQ4A 4AOCA 3ZKYA 5JSPA 2LRPA 1DYOA 3MEPA 1O7FA 4DB5A 1JMUB 3J7NA 5CZKA 4XFCA 3GCXA 1GQPA 1GQHA 3KV5A 3POSA 3BI3A 4LHSA 2RDQA 3ELNA 4JGYC 2ZGMA 2BVVA 2DVGA 3O1SA 3S57A 2D40A 2Q1ZB 3DCQA 5A7PA 2B45X 2IWGB 4UW5A 2VUAA 3ZXLA 3LKJA 4KWJA 3KMHA 3SKJE 3VBUB 3LB9A 1OF4A 4CDWC 5GZEA 3WCSA 3V0BB 1LOGA 1DQ0A 1EV13 2DTWA 4A4AA 4JX0A 1MS3A 1RGSA 1V0AA 2OUHA 1T6BX 1VJ2A 5K7PA 4NVPA 3HBKA 2GP3A 3VHOA 4X8NA 2HWE2 2FDHA 4J1WA 3ON7A 3NAPB 3I3BA 2WNUB 2WNVB 3K51A 3QD6A 3LZZA 4M4RA 3AMNA 4YZ4A 4Q4X1 1NXMA 1XXNA 3BB6A 5FYUA 3ECQA 3ZFFC 3SH4A 3A21A 4LO5B 1QXRA 1PO13 1PM7A 3ST7A 4AEMA 2IXCA 4AHYA 1GNYA 5FP8A 4RS5A 1B35B 3RG0A 3Q8BA 3SLIA 3WW3A 1U12A 1CZVA 2OA2A 3CJXA 5DAWA 3VBFB 4CDXB 4CSWA 2IXHA 3O5SA 1AYN3 5K0UA 4BH9A 1COV3 4MOAA 5LWBA 3OD0A 3N9OA 1LGBA 5JOWA 1W04A 2CL2A 1K5MC 2R073 4N53A 1PX4A 4D7SA 4YG3A 3U0ZA 1W90A 4QKDA 2J1UA 2WINB 1GZ9A 1UZYA 1AYM2 3ZXKA 2UU8A 3VD7A 5CBLA 1U5XA 1UZVA 2ZEYA 3WDWA 1OHFA 2HEVF 4OQ8A 3KT7A 3ZFGA 4E2SA 4B4PA 1HJFA 2ZMLA 2J1AA 1WMDA 4NHXA 2ZEXA 3ASIA 2B8MA 4A6OA 1B35C 3NNFA 4XW3A 1CAUA 1LOEA 4NR1A 1CX1A 3MBWA 2X8KA 4N7IA 4R52A 3R6SA 3RFRA 4KWKA 3I49A 3C7EA 3UGHA 4PDWA 3MPPG 3WY6A 2W08A 2NLRA 2WDBA 2BNMA 2JIJA 1QJU3 3E1F1 1RUG1 1TG7A 2VZOA 2RJ2A 4D6SA 1H2MA 2JWPA 1GICA 2XBO3 4Q4W1 4HT1T 4CCNA 1N47A 3N9LA 1UN1A 2GNBA 2I07B 1SDDB 2B5HA 2IZWA 3PL0A 2BTVC 4UW3A 1CAVB 2EIEA 4OHXA 4B29A 3IWZA 4K1YA 4Z07A 5J37A 1BBT2 3RZMA 3N9PA 3H8XA 2NZ9A 3ETPA 3AP9A 1AYM1 2JIGA 4NE9A 2AR6A 2DCJA 4Y24A 4ES9A 4IEXA 1VBC1 4RYDA 1EAH3 5FZ8A 1CX4A 1O3TA 1VP6A 1F35A 2E33A 1C1FA 3CNAA 4JQRA 1VRH2 2XVLA 2YPDA 4AFAA 1AR71 5DMYA 5F7UA 3A23A 3WW2A 1DZRA 2VNGA 1P8JA 3KV6A 1O8PA 1R082 1H8TB 2A75A 4K3UA 3O1VA 3B7MA 2EXIA 3ZDVA 3A7QA 1PVC1 2NYYA 3TB0A 3LF7A 1SDWA 2VECA 3H8UA 1FV2A 2ZGOA 1PK6A 2C26A 3OBRA 3WP6A 1OOPB 4GIQA 4L0PA 3ZN6A 1LOFC 1VBC2 3QLQA 4BJ0A 5K8SA 2XLGA 2CWSA 4GD4A 5LA9A 3WP4A 4TTGA 3OPZA 3O1RA 2IXIA 4EQVA 5K4LA 4M00A 4FAHA 4HONA 3VBSA 3ILRA 4XJ8A 3BODA 4PF1A 2DCKA 4IGQA 1RYYA 1WWYA 4YW4A 4MG2A 1GMMA 1NA1B 5DDJ3 3OBZA 1W2UA 1O4ZA 4JRAA 1QJZA 1S0IA 3AP7A 5IJRA 3URFA 4ZKTB 1LHOA 3B02A 4Q26A 1ND3C 1K45A 1O6UA 5BNPA 3FBYA 2FMDA 1BMV1 3CBNA 2ZOEB 4COZA 1EPZA 3IPVA 1WCUA 4DXTA 2JD4A 4D8MA 1W06A 4D0QA 1UYPA 3SEEA 4KWUA 5JI7A 1VMFA 4CU7A 3NSTA 1SLTA 4LNVA 1AHSA 4F7ZA 5FMBA 1RUJ2 2VL4A 3LEIA 4COWA 2KD7A 1OF3A 4GULA 3ZM8A 4FTBA 4Q0UA 2Y6FA 3IIIA 3JBG2 3T1MA 1IG0A 5A7SA 2VPVA 5JPNB 1S0BA 4YM1A 2K2SA 2PHRA 3VBHB 2AGSA 5LA0A 3ZX7A 4IV1C 5FZBA 1FPN1 4FTEA 3ZSLA 1ASJ1 1KFUL 2HBTA 4Z1VA 5T55A 2E7QA 4MGZE 4JDMA 1KXGA 1TE1B 1FOD1 3LDBA 4LT5A 4CCOA 4Q4Y1 1RUH1 1C5HA 1H8TA 3MW3A 5HBAA 4KU7A 2QZ2A 3LE0A 1ZZBA 3PVEA 5D8AB 5IK8A 1HQNA 2ADDA 5I0RA 1BQPA 5F39A 4TZDA 2WO1A 1QJEA 4XIKA 5I0TA 2BERA 2A5ZA 2ZTNA 5GJ6A 4HK9A 4AHXA 4AZZA 4Z2WA 1HRV1 1ND2B 5JI9A 1W0PA 3GXUA 3VZOA 5FZIA 4QB2A 5T5JA 1XYOA 2EXKA 4M3CB 1DYPA 1TNRA 2YV8A 1HB1A 1I3HA 3K2OA 4UBHA 1O91A 1UOBA 1UZZA 3GF6A 4ZONA 3PTYA 2Q8DA 1WLWA 3OOXA 4AI9A 5IAVA 3R4UA 3I59A 4C1XA 5HV4A 1KRIA 4EN8B 2B39A 2W91A 3POBA 1MS8A 4WM8C 5IFTA 3NKTA 1O5UA 2WWUA 3PVNA 1C8M3 3VB9A 3IDEA 5I8YA 2UWAA 5JOYA 1H4HA 2MEV1 4AVSA 4YW2A 1W99A 1XC6A 3AB0A 1NQDA 4RD7A 1W8HA 4IEZA 3SITA 3U14A 1UY1A 3O1UA 1GZWB 3NVCA 1U5YA 3EO6A 3O0XA 3T09A 5D8AC 3VBRC 1ZA4A 3ZR6A 5H9PA 5LBFA 2XHKA 4Y22A 1Q43A 4CDUA 2JE8A 3GNEA 2EVXA 5CU1A 4C8DA 4A3XA 4XEZA 1JHJA 1APNA 4BHPA 2FZ2A 1D0GA 2WLPA 3ZMNA 1HXS2 2DUOA 3IN9A 3TEWA 3G6JB 4HANA 5B4XA 2WJSA 4UBGA 4P5YA 5DUUA 2X05A 3ZYPA 1AR82 3GZTB 1MPXA 4FXKB 5L9BA 4HK8A 4OUEA 4LKFA 2WQZC 2A3YA 2WYSA 4ITCA 1FPN3 4JGYA 4P9IA 4CUBA 4LKDA 4K1ZA 2I2SA 1YHFA 5T50A 1ULPA 1VMHA 5EZWA 1W28A 2V09A 4GJYA 3WNNA 2R7EB 2I45A 3BKZA 2P1BA 3WT3A 2VW2A 1PX3A 5SV5A 2PA7A 2W68A 4RS5C 2VMEA 2VOKA 1GYKA 2PLV2 3FJSA 4XF9A 3SKVA 4O7XA 5AC93 4DS0A 5C5UA 1O3SA 3MIFA 1HRV3 2ADEA 3HQXA 4CEWC 2OPKA 1W2NA 1NXD1 4NHMA 3SCGA 5LCWL 1R1A3 1DCSA 3PUIA 4P9JA 3WHTA 4FVVA 2YZ4A 4Y1VA 3H7YA 3DXTA 5IW0A 2VZRA 3J4UH 2DCZA 3USUB 4LLFA 2VTFA 1AR91 2LALA 1O5LA 4B7EA 1AX1A 2V72A 2XDVA 3ZFEC 1CAWA 2RR12 3APBA 5HCFA 2PN5A 4FPYA 5FZ3A 4RHV1 1A8MA 1J84A 1TNFA 1WBLA 2VW1A 2VNOA 1SCSA 3T0BA 1LU2A 4YFZA 2VUJA 4Y5TA 4A2UA 5IVYA 2VTXJ 3VBOA 2UWBA 1LNSA 3GBGA 4XIOA 2ARAA 5A1AA 5DPNA 1AL21 2F4PA 3VUOA 1UAIA 1CONA 2QQJA 1WD3A 1OVSA 2ZHNA 3C7OA 4BQ1A 2GMEA 1ZZ6A 3W58A 1UU5A 1VBA1 4FOYA 4Y1YA 3WP5A 1RMU2 1X50A 1NZIA 3U37A 3UGFA 1XPWA 3OTFA 5CKNA 1J3QA 3MV01 1LHVA 1C3HA 3H3LA 1WGPA 4MGQA 3H1MA 1WD4A 1QJX3 4A7ZA 4QX2A 2PLV1 4MXWA 4CP1A 3C8XA 2VCMA 5HV0A 1JUHA 2YU2A 4N43C 4NRMA 4LBJA 2MHFA 3A22A 3BTZA 3K46A 3NWKA 4NPMA 4AFCA 1S0DA 5FZ7A 5A7NA 3OEBA 1WCDJ 4XJ9A 5BNPC 1NOVA 3AJZA 3VZJA 4FXGB 4IEPA 2CAUA 1SFNA 2FZ1A 4J6GA 1QJY1 1NT0A 2Y60A 4W8JA 4QDSA 2WZPP 3AMPA 2GH2A 1F9KA 1W2TA 3IT8A 4QPGB 5E16A 5BUVA 5F37A 1W3VA 2W9XA 4JDOA 2HYKA 3AP4A 1X9PA 3FUOA 1TME1 1WCQA 4FFHA 5GLUA 3V64A 4NAMA 1G9CA 1MEC3 3J8F2 2D43A 3FHIB 4ONUA 4DRVA 1W9YA 3NO8A 4QWNA 1REDA 4E27A 2Q8EA 2VMGA 1YIFA 2KA3A 2KR2A 2ZGUA 3POJA 4WVZA 3MF6A 5DUWA 1ND3A 3WG1A 4F3JA 2JDHA 4BK4A 3B3QE 5F5IA 1PGW2 1GKBA 4IE4A 2P17A 1CJDA 5FUIA 2GC0A 4Y20B 1ZREA 4DNYA 2DBNA 1MVQA 3T2TA 3UK9A 3N7KA 4OQ9A 3GHMA 1GZCA 1RMU3 2Q0AA 4RGKA 4Y5SA 3U78A 3C7HA 4OI1A 2JB8A 2OS2A 1W2OA 4HL0A 4EN9B 1HQLA 4MH0E 4LULA 1RUH3 2P3IA 1NE6A 3FZ3A 4RHV2 2WABA 4BQ4A 4AI2A 3WCRA 4UAPA 1GWMA 1S1AA 4XUQA 3USSA 1K42A 1UXXX 2XGXA 2E6VA 3T4VA 1CAVA 4BMEA 2P3YA 4JGZB 1GUIA 3THPA 4HKWA 5IK4A 5H9QA 5FZ0A 4O9GA 3TN93 2A6WA 5C4WA 4CDQB 1VE0A 5LRSA 2G4IA 1YNAA 3PJQA 1FT9A 2V4AA 5FZ6A 1IGOA 1VRH1 3WNPA 4GWMA 4TWTA 5J48A 4B8EA 3FWEA 1WUVA 4XUNA 2RR13 1WLTA 1YYNA 1KS5A 2DCTA 3GBFA 3IBMA 2DUQA 1WKYA 1K3IA 3GDBA 4LBOA 2WO7A 1V00A 2RE9A 3DEMA 5FP9A 3MICA 1FMD2 2ZA9A 1G8WA 4S2GA 2F17A 2WS93 4Y20A 4BWOA 5A3NA 4G3YC 3VL8A 4IQPA 4RFT0 4OFGA 4Y5Z0 1MZEA 4AEDA 2JDUA 4QKBA 3WNLA 1A3KA 2C6SA 2RV9A 4I01A 2OZ6A 2GH8A 5C9AB 1LEDA 1LEMA 1XNBA 4JGZC 3PVOA 4GMP3 4QPGA 3AP5A 4RL7A 5H9RA 2YY1A 4Z2AA 1WA6X 5EYYA 1W6OA 3AFKA 3E6CC 1IS3A 2ZAAA 1XJAA 4HN0A 2YUEA 4NHYA 4AW7A 1DLCA 3LA3A 3P1IA 4QGLA 5FMCA 4P9XA 1FYUA 2RDNA 4N53B 4JTNA 5FQ0A 3VDBA 2Z79A 3ACGA 1GZWA 3VBRA 1AR83 1LGCA 2QUOA 1PZ9A 1Q8VA 2R063 4LBKA 2RJKA 4I3GA 5A33B 5JXHA 1R64A 3PURA 2PHTA 3TYJA 5IVVA 1CIWA 4I09A 5C8CC 2HLEA 2JG9A 2H6BA 1VBD2 2A3XA 2DFCA 2Q5TA 3L2HA 3NNMA 4URAA 1WCSA 4YVWB 4LR4A 3HT1A 1S0CA 4FQZA 1ULOA 2WC2A 4YW7A 4MGSA 1ULCA 2VQUA 4BQ5A 3MW2A 1NYWA 4XPVA 1S2BA 4S2HA 1XSQA 1OOPA 4BIOA 1UO9A 1WCKA 1XSRA 1VBE1 1ZRDA 3J9SA 1QU0A 2QQOA 3RDIA
chains in the Genus database with same CATH topology
1Y9GA 3S5QA 3UGFA 3PIGA 5FKCA 5FMBA 4CCDA 4FFHA 3UGHA 3RWKX 4FFGA 5FKBA 3ZR6A 3H3LA 5FK8A 1Y4WA 4QHZA 5FIXA 4CCCA 2AEZA 3KF3A 3LFIA 4UFIA 3U75A 3U1XA 2QQWA 2AEYA 2ADEA 3LEMA 3LF7A 1ST8A 3UGGA 4B1LA 2QQVA 3SC7X 4JQTA 4AZZA 2XQRA 3NMBA 3LIHA 4B1MA 4UFMA 5FMDA 4UFJA 4UFKA 3OSDA 1Y9MA 4UFLA 3IMMA 5FK7A 3LDRA 4UFHA 3PIJA 5FMCA 2OXBA 3LDKA 4FFFA 1UYPA 4CCEA 3U14A 2QQUA 4FFIA 2ADDA 1W2TA 5ANNA 3ZR5A 4EQVA 3KF5A 4HXCA 3LIGA 3HBKA 2AC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y9G A;  3S5Q A;  3UGF A;  3PIG A;  5FKC A;  5FMB A;  4CCD A;  4FFH A;  3UGH A;  3RWK X;  4FFG A;  5FKB A;  3ZR6 A;  3H3L A;  5FK8 A;  1Y4W A;  4QHZ A;  5FIX A;  4CCC A;  2AEZ A;  3KF3 A;  3LFI A;  4UFI A;  3U75 A;  3U1X A;  2QQW A;  2AEY A;  2ADE A;  3LEM A;  3LF7 A;  1ST8 A;  3UGG A;  4B1L A;  2QQV A;  3SC7 X;  4JQT A;  4AZZ A;  2XQR A;  3NMB A;  3LIH A;  4B1M A;  4UFM A;  5FMD A;  4UFJ A;  4UFK A;  3OSD A;  1Y9M A;  4UFL A;  3IMM A;  5FK7 A;  3LDR A;  4UFH A;  3PIJ A;  5FMC A;  2OXB A;  3LDK A;  4FFF A;  1UYP A;  4CCE A;  3U14 A;  2QQU A;  4FFI A;  2ADD A;  1W2T A;  5ANN A;  3ZR5 A;  4EQV A;  3KF5 A;  4HXC A;  3LIG A;  3HBK A;  2AC1 A; 
#chains in the Genus database with same CATH topology
 4P02 B;  1XNK A;  2WWS A;  1NCQ A;  3OB8 A;  4H3W A;  1FXZ A;  3VBO B;  3FFZ A;  2WUH A;  3VDA A;  3WZ1 A;  5DDJ 1;  5A7Q A;  1OXC A;  4L2N A;  2A6Z A;  2KM2 A;  1IKP A;  3NV1 A;  2BQP A;  5FO9 B;  1JYX A;  1I1E A;  3WUC A;  4AXO A;  4CUC A;  1JYC A;  2D3P A;  2DCY A;  4FPG A;  2W0X A;  2W5F A;  4P14 A;  5HXV A;  4CEY B;  5A70 A;  1PMJ X;  3ZN5 A;  2QQV A;  5A6Z A;  5JZG A;  2DYC A;  3RZJ A;  2XLA A;  3AZY A;  2IC1 A;  1DGW A;  4YVW C;  1GP6 A;  3PUQ A;  5FZM A;  2QE3 A;  4LOT A;  2H0B A;  1YQ5 A;  4ORF A;  4QPI B;  4NJ4 A;  4AI8 A;  2WT2 A;  2GAU A;  4XVH A;  1SPP B;  1LU1 A;  2D5H A;  2GN7 A;  4OMC A;  4UW4 A;  4WVW A;  3EXU A;  4G4F A;  4ZS2 A;  4KI5 M;  3OPT A;  2O8Q A;  2R1D A;  3KVB A;  3OF1 A;  1CAX A;  4PBP A;  1H9P A;  4I0B A;  1JZ2 A;  4B4R A;  3KQ4 B;  3L2Y A;  5KHI A;  2QVS B;  2W1W A;  5CFD C;  3D5O A;  4Q4W 2;  5FIX A;  1ZYB A;  2D6M A;  3KV9 A;  4XBQ A;  3VBO C;  2E7T A;  2GNT A;  2LM3 A;  2J1V A;  2UYA A;  4OCT A;  1UWW A;  5L73 A;  3WDV A;  1JYI A;  1LES A;  2QQI A;  1OQE A;  1SFY A;  4W50 A;  4OUL A;  4QKN A;  2GND A;  4IL7 A;  5KHH A;  4IEY A;  4YSF A;  3WF2 A;  2WN3 A;  5HXM A;  3OGJ A;  4AG4 A;  4E2G A;  1DGL A;  2VZU A;  2VJX A;  4TXW A;  5DAV A;  5E6H A;  4OI4 A;  4JGY B;  1OA2 A;  4BPZ A;  5A1L A;  5HCA A;  3BIE A;  1Y7B A;  2XJQ A;  2DVA A;  1QDC A;  1E57 A;  3B9C A;  3IKW A;  3MUZ 1;  4H7M A;  4UFL A;  5E8A A;  5FMO S;  5FY1 A;  5J3U A;  4GWJ A;  4GMP 0;  1W6P A;  1RUE 1;  4LHN A;  1DGR N;  1CAU B;  2VZQ A;  1WW4 A;  3IMN A;  5JSO A;  1DIW A;  3MV1 1;  3U4X A;  4QPI C;  4WZF A;  1IS6 A;  4EZH A;  1IQA A;  1XE7 A;  2YRO A;  4BZ4 A;  3ZN6 B;  1IQD C;  1LKN A;  3NNJ A;  1A8D A;  5JR7 B;  5T54 A;  3UV9 A;  4F83 A;  1H1I A;  3WG3 A;  2BBV A;  5D2A A;  5C71 A;  5CFD B;  4HFS A;  4QM9 A;  4D3W A;  2ZZJ A;  3BCW A;  1OH4 A;  4RR3 C;  5FUP A;  3H8O A;  1C4R A;  2D6L X;  5FPX A;  5FO8 B;  2RDR A;  5C6C A;  2NMO A;  4HBN A;  3ZYH A;  4DOU A;  1NE4 A;  4XTM A;  4CDX A;  4AI3 A;  1R09 1;  4CPB A;  2XUM A;  4NPL A;  3O1M A;  1UYZ A;  3VBF C;  1UPS A;  2YYO A;  3NJY A;  3C7G A;  3ZN4 A;  2W1S A;  1ZVF A;  2P6C A;  3PVB B;  5FZK A;  1RL3 A;  2VOX A;  2ZGS A;  5GAL A;  2VD7 A;  1J83 A;  1W6Q B;  3WR0 A;  2VZS A;  2CAV A;  2WO3 A;  4W4Z A;  3N9M A;  5L7O A;  2TNF A;  5FPU A;  2JX9 A;  1QNW A;  2OVU A;  5GZG A;  2RMU 1;  2QQW A;  2WQ8 A;  3WDY A;  5I8T A;  3MID A;  2GC3 A;  3O14 A;  2P37 A;  3M1H A;  5J09 A;  5FZG A;  4Q8L A;  3W21 A;  3NQH A;  3LIH A;  5EFU A;  5FPL A;  3FMG A;  2B46 X;  3IM0 A;  1VRH 3;  2PQQ A;  1SBD A;  3K77 A;  1OLQ A;  3MLJ A;  4UF0 A;  3INA A;  5FXX A;  1JYW A;  4AL9 A;  2BGC A;  1RUF 2;  3RJ2 X;  1VLN A;  1KDK A;  2FDG A;  4C90 A;  3V0B A;  1FNZ A;  2CGO A;  3KF5 A;  4OMD A;  1BBT 3;  1OD3 A;  3O12 A;  2DDU A;  4FO9 A;  4J25 A;  2BDR A;  1DG6 A;  3QH6 A;  3M70 A;  2J7M A;  5A80 A;  1W8F A;  3S7I A;  5A32 A;  2X09 A;  3VHR A;  3OUH A;  4XIL A;  5A7W A;  2RM2 2;  3BPS A;  3GBW A;  3WW1 A;  4H55 A;  3NNG A;  5FZA A;  5AC9 2;  3VLB B;  5M0T A;  1Z7S 1;  3O0W A;  3UES A;  2VUD A;  4XUR A;  2ZXQ A;  2UUR A;  1OVP A;  5LEK A;  3BUC A;  3OEA A;  3MIB A;  2OKX A;  3SIS A;  4GH4 C;  5EPA A;  3ZXA C;  5T52 A;  4LBQ A;  4UYB A;  2SBA A;  2YU1 A;  4W6W A;  4LIV A;  5FWE A;  3PUA A;  3OY8 B;  4XZP A;  2P3J A;  1PMH X;  2BGP A;  2ZCW A;  3RRD A;  3B9I A;  1HXS 3;  5EV7 A;  1F4A A;  2R6Q A;  5F1R A;  2PHL A;  2HWB 3;  3POW A;  3RZK A;  3OYW A;  4LK7 A;  3HT2 A;  4HZF A;  1YIP A;  2XVG A;  4OHY A;  2ZHL A;  4CDX C;  1Q5O A;  5DN2 A;  1SQ4 A;  1B35 A;  5DAP A;  2WNO A;  1DFQ A;  2HWD 1;  4M3C F;  3VKL A;  3TEY A;  1AZD A;  1W8T A;  3OBT A;  3WEZ A;  1GV9 A;  4K20 A;  1SBF A;  2E31 A;  1V9U 3;  3BN6 A;  5C4W C;  4SLI A;  1K5M B;  4XF4 A;  2QQN A;  4ZZ5 A;  4NO4 A;  3ZMO A;  3FHQ A;  5ACA 2;  1AYN 2;  3AXE A;  4AK3 A;  2JG8 C;  2ZGL A;  3M8L A;  4LBM A;  1HKD A;  1NLR A;  5DXD A;  2AC1 A;  3SEP A;  1G9B A;  1B09 A;  4A45 A;  1UY0 A;  2R32 A;  1PO2 1;  4NN0 A;  3ACL A;  3T08 A;  5B4N A;  3MIE A;  2XUE A;  1MQT C;  4XFB A;  4S2F A;  2ARE A;  5FZD A;  4ARY A;  1VAV A;  1NA1 C;  4Q5O A;  1PGW 1;  2WN2 A;  5FBJ A;  1QJY 3;  1F15 A;  2J1S A;  4L92 A;  4L8Q A;  5FY0 A;  4XMA A;  5I0U A;  4E8C A;  2ZPX A;  1UY2 A;  1CAW B;  1OLR A;  1J3R A;  3O1T A;  3K4A A;  1NCQ C;  4FAG A;  1QKQ A;  4ZXE A;  1EYB A;  1V70 A;  5G05 L;  1AL0 G;  1HRI 2;  1ZBA 2;  4JDN A;  1HN0 A;  5FYH A;  4H14 A;  3UJO A;  3S0M A;  4QXB A;  4LOR A;  3CL1 A;  4LO6 B;  5FRA A;  5IWF A;  1JZ4 A;  2VY0 A;  1N3O A;  4XXA A;  2YMZ A;  5GM0 A;  2D6K A;  3TEZ A;  4C1W A;  3HQU A;  4XDQ A;  1BVV A;  4WZC A;  2ZS6 B;  2L9L A;  4R9C A;  3JBG 3;  2XON A;  3POY A;  3AVS A;  3VZN A;  4CDW A;  5FR3 A;  1XU1 A;  2PFW A;  2VZV A;  3VBH C;  4Q4Y 2;  1RUJ 3;  1EV1 1;  4P9G A;  5C8C A;  1DU3 D;  3B01 A;  4RGA A;  3THC A;  1JTZ X;  2XB6 C;  3W5N A;  5J7M A;  3WG2 A;  2IVI B;  4YZ2 A;  3K48 A;  1H0B A;  1OFN A;  3AZZ A;  1H8T C;  5F8P A;  3ZFG B;  4I02 A;  1QY4 A;  4URT A;  1IPS A;  1VR3 A;  1H2L A;  5CFD A;  1CES A;  2ZKL A;  4ZHN A;  1RUG 2;  5LBB A;  3PUS A;  1KEX A;  2YBS A;  2XQX A;  1OC1 A;  1VBA 2;  3I2F A;  4HSL A;  4I3P A;  4LBQ B;  2VZ1 A;  4LXL A;  1JU4 A;  1SFP A;  2GC2 A;  1H2K A;  1LOA A;  1TQ5 A;  1VMJ A;  3PU3 A;  4FPO B;  1YCI A;  5DDJ 2;  4QAW A;  2D6P A;  1PM4 A;  1QMJ A;  4IER A;  2QFE A;  4WM7 B;  2XQR A;  4ZPI A;  1SEF A;  4LPL A;  5JSR A;  1ALY A;  5FY5 A;  1AJO A;  4K6B A;  2QBX A;  1GZT A;  5GLW A;  1K12 A;  3OUI A;  3RNS A;  1YXW A;  1W6P B;  3MI8 A;  3OG2 A;  3TWI A;  5JOZ A;  4BMB A;  1JZ8 A;  2HWE 1;  2BEO A;  1MS5 A;  2NP0 A;  3IDA A;  4L9B A;  4YVW A;  3ZXD A;  5FYM A;  4MXV A;  3FE5 A;  4BQY A;  1C5I A;  2RS5 2;  2Z4F A;  4MLO A;  1VBB 3;  2JDN A;  4IEO A;  3PU8 A;  5BY5 A;  4YW1 A;  3H0O A;  4QQL A;  3ZYJ B;  3VD9 A;  3ITQ A;  2XJS A;  4GMP 1;  5B2G B;  1REE A;  4NIA A;  3N35 A;  1JU3 A;  1YFY A;  3U10 A;  1XNT A;  3SXW A;  5CA6 A;  3KZ4 C;  3FLT A;  3BTA A;  4B4Q A;  1OQD A;  4BIS A;  4MGI E;  4WV8 A;  4DUW A;  1OMI A;  2CTV A;  2H0V A;  2X5I B;  3B00 A;  1JZ6 A;  2E9Q A;  3AKQ A;  3I2H A;  3MO4 A;  4IV3 B;  4LMF A;  4COV A;  3DEC A;  5F9T A;  4AR2 A;  5J96 B;  3RS6 A;  1WMF A;  3I3E A;  1UX7 A;  4H2A A;  4LTA A;  2WBK A;  3H1Y A;  3DF0 A;  4JHT A;  1Z78 A;  1PVC 2;  1QNY A;  4IE6 A;  2FCV A;  4NUB A;  5FYB A;  3WNM A;  4ASL A;  5ABJ B;  4Z92 B;  2OQ6 A;  1M06 G;  4WVV A;  4CU8 A;  1R08 1;  4Y33 A;  2FHR A;  2F4L A;  3I2I A;  3VBH A;  5F3G A;  3W20 A;  1X8M A;  3V56 A;  3KT1 A;  4JKK A;  4OHZ A;  4Q0S A;  2ZGQ A;  4C0H A;  4BXS V;  1AX0 A;  3BVC A;  4COU A;  4LA3 A;  4GKY A;  1POV 0;  3LPG A;  1PNF A;  2P4E A;  3RZL A;  2BRT A;  2R0F A;  4KBB A;  1JI6 A;  1FX5 A;  2WWJ A;  1ND2 C;  4CTE A;  2ATF A;  2FDJ A;  1BK0 A;  4QX0 A;  4CDU C;  1Z7S 2;  4LEJ A;  4YAR A;  5FUN A;  1LHU A;  4XUT A;  3RQ0 A;  3WD5 A;  2QCS B;  3POF A;  5E89 A;  3S5Q A;  3WOG A;  3D8C A;  1W0O A;  4LBL A;  1L7R A;  4KWL A;  3QBQ A;  4DRR A;  4E8D A;  5DAX A;  3ZFE B;  1D4V B;  5FV3 A;  1W6N B;  2MEV 2;  3AYD A;  4CEW A;  4ATF A;  4HKL A;  5ABJ C;  1N1T A;  3IAP A;  1HXS 1;  1PVX A;  5FZE A;  2D6O X;  4GJZ A;  2RS1 3;  3JXS A;  2HBU A;  2Y6H A;  4ZS3 A;  5A3W A;  1BCX A;  3DV8 A;  1KD7 A;  1YFX A;  1XNC A;  4LO4 B;  4QQP A;  4ES8 A;  4Q8K A;  1F5J A;  4YW6 A;  3MF9 A;  4ZU4 A;  3KCX A;  1UF2 C;  5FQ0 B;  5LAT A;  3VBR B;  2Y33 A;  2XJR A;  2DV9 A;  1JYN A;  2O14 A;  3I54 A;  2CWM A;  5FJK A;  1DQ6 A;  2WII B;  5FZC A;  5C9A A;  3Q9O A;  4NPR A;  3SH3 A;  2RR1 1;  1SPP A;  1N1V A;  2ZZQ A;  1LOC A;  4OZO A;  2VR4 A;  1STM A;  3DKQ A;  2VE1 A;  3OUJ A;  3ZDS A;  3U4S A;  3WLU A;  1ZZC A;  3I8T A;  3NW4 A;  1QIQ A;  3CMG A;  5FFO C;  2YC0 A;  4Y22 B;  2VAU A;  4FPC A;  1G6N A;  2MEV 3;  1NX9 A;  1QOS A;  4XOG A;  1TME 2;  2VOT A;  4LK6 A;  5LW9 A;  4NHL A;  4QPW A;  3PME A;  1W6M B;  4KGG A;  2JEN A;  2HEW F;  2HWE 3;  2C24 A;  1UY3 A;  5FZL A;  5ANQ A;  4NIG A;  2JEC A;  5T3N A;  1AR7 2;  3VN4 A;  2GP5 A;  4RS5 B;  2R49 A;  5FP4 A;  1EV1 2;  5FAX A;  4IET A;  2E63 A;  3ME2 A;  4LBQ D;  1FI2 A;  1GOG A;  2C4X A;  1BKZ A;  1TMF 1;  2HWC 1;  5FOB B;  2PTM A;  4R8H A;  4MXW B;  4XQW A;  1W05 A;  2A6X A;  4RGG A;  1JOD A;  5HI0 A;  3WG4 A;  4OYU A;  4M3C A;  2DUR A;  4LIT A;  5FY9 A;  1WMX A;  5F3E A;  4U36 A;  3DL3 A;  4PHZ A;  5EJ3 A;  4HET A;  1E5I A;  5KC6 A;  1PGS A;  2A71 A;  2R16 A;  1JOB A;  3I2J A;  3RZG A;  3OCP A;  2RS1 1;  2VQA A;  1ZBE 2;  3K3N A;  2GMM A;  3I3D A;  1XBF A;  2EXJ A;  3GCW A;  5IVJ A;  2YFU A;  1TVG A;  5G04 L;  5AVA A;  5BNN C;  4BB3 A;  5E1R A;  3HVD A;  1H30 A;  3ES4 A;  4CP0 A;  5KHJ A;  1JYT A;  4Q1P A;  3SMH A;  3T2O A;  2XH6 A;  4YNI A;  4XBN A;  3VDD A;  1Q8O A;  1BYH A;  1W8U A;  1ZZ9 A;  2P6H A;  1C8M 1;  4ZXK A;  3MHZ A;  5D1I A;  1IS4 A;  3BTY A;  5CG9 A;  2BWA A;  3OGG A;  4DEV A;  1AYN 1;  5J1X A;  4QX5 A;  3UNP A;  3OSD A;  1AX2 A;  1DHK B;  3JD7 3;  3LDR A;  5A1F A;  2WS9 1;  5F5Q A;  5A6X A;  3THD A;  2BV4 A;  2RJL A;  4QHB A;  1R09 3;  2W2I A;  2UY9 A;  1OI6 A;  2ERF A;  4PLO A;  1CZT A;  4XHB A;  5C3S A;  2ET7 A;  5DAQ A;  3J26 N;  3M3O A;  2DWR A;  4NRQ A;  4AED C;  1IOA A;  4M0N A;  2WA4 A;  5AVP A;  5FZ1 A;  2Q1F A;  4XYX A;  4CXX A;  3WNX A;  2Z2S B;  3HN3 A;  3UET A;  3AYC A;  1LR5 A;  1OLM E;  4QKF A;  1AVB A;  3VZK A;  1ENX A;  2RMU 3;  3EJK A;  3I59 B;  3WF1 A;  1VBA 3;  2J1E A;  2JB4 A;  2WNU A;  2JIC A;  1EP0 A;  4JVA A;  4QPG C;  5JWP A;  1F5F A;  1UQX A;  2JDY A;  4YLZ A;  5F5A A;  3T2P A;  5F6K A;  4COY A;  5A3L A;  1KGY A;  1RHI 3;  4AI0 A;  3RJR A;  5LZ6 A;  5F32 A;  3WXP A;  5FJH A;  2VOV A;  4UI9 L;  1F8V A;  4DMI A;  1WW6 A;  1SLB A;  4EE2 A;  4V2V A;  2GMP A;  2HWB 1;  2BWC A;  1RUO A;  2RS3 3;  4AQT A;  4ATE A;  3CDZ B;  2R30 A;  4XJU A;  5CVR A;  5ERL A;  5A32 B;  3BIW E;  4E4S A;  4E9K A;  3W5M A;  4JV4 A;  4XF1 A;  3AMQ A;  5JZG B;  2WFF 2;  3LPF A;  4OLL A;  4QGN A;  1HDK A;  5FMO L;  4RA0 A;  1BMV 2;  1RUE 2;  2BJS A;  2XJU A;  1JXN A;  4ZZ8 A;  4BA6 A;  3O1P A;  1SLL A;  4B1M A;  4IV3 A;  4FP2 A;  2XKP A;  2ZGP A;  4I2O A;  1W8Z A;  2MNG A;  1JW6 A;  1ULE A;  1LB2 A;  1AR6 1;  1LGN A;  2XHN A;  4XQD A;  1AR7 3;  3JB8 A;  3J7H A;  3MZH A;  1OOP C;  3HAG A;  1KJR A;  1W3X A;  4V2W A;  2DTY A;  2K9Z A;  1YI9 A;  3VDD C;  5LK7 B;  1QJY 2;  1HV0 A;  1Q8Q A;  3AYE A;  4UWD A;  1YQC A;  4CDQ C;  1YJL A;  4JTO A;  5GLT A;  2B9U A;  5FPZ A;  2CDO A;  4N9H A;  3OD4 A;  5DAB A;  1K5J A;  1QHD A;  4A41 A;  2G1M A;  5IYY A;  3H50 A;  4PCR A;  1XU2 A;  3WSO A;  4CVU A;  1MS0 A;  4PDW B;  4YPJ A;  4DXR A;  1JN2 P;  1L3J A;  4JZR A;  5C33 A;  1POV 1;  2VUL A;  3RGB A;  2R04 1;  2VO5 A;  3VKO A;  3IDB B;  3BGA A;  2Y34 A;  4MX3 A;  4PJY A;  4I30 A;  5L19 A;  2JEM A;  1D4M 2;  1UKR A;  4IE0 A;  3KT4 A;  4AGR A;  1AF9 A;  1FOD 2;  3C7F A;  5F2W A;  2B9V A;  5DG1 A;  1FV3 A;  3DPR B;  2G9Z A;  4NAO A;  2YB7 A;  2HJI A;  1ASJ 2;  1GNZ A;  5F2S A;  4LHK A;  3LD8 A;  4SBV A;  4XJW A;  5LA2 A;  3RZZ A;  2BFU S;  3J7M A;  4QU2 A;  2ZAB A;  1PHM A;  2XJV A;  3D82 A;  5CB7 A;  2BYV E;  4MGT A;  1KJL A;  3VHN A;  1Q3E A;  2PHX A;  1ZRI A;  2XG3 A;  3E5X A;  2Z5W A;  5C3Q A;  1GWK A;  2MPF A;  3ILF A;  1QWR A;  4YZ1 A;  1OFS A;  4KQ7 A;  4FPF A;  4UFJ A;  2WFF 1;  1UIK A;  4PDW C;  2R07 1;  2WFP A;  1AL2 3;  1MS1 A;  1RVF 1;  4KH9 A;  4RQP C;  1Z7S 3;  1VAK A;  5JCT A;  1ZZ8 A;  3ZIW A;  5ABJ A;  5K0U C;  2DF7 A;  5FY8 A;  5HCB A;  1SCR A;  4CCJ A;  4XC9 A;  1HRI 1;  1JS9 A;  1ZBA 1;  3I3M A;  4FFG A;  5H9S A;  3DPR C;  3O1O A;  5FY4 A;  1UY4 A;  2QTW B;  1J59 A;  2IVJ A;  2OX0 A;  3ZXE A;  3VD3 A;  1H2N A;  4YZ3 A;  3VGI A;  5JDB A;  2RM2 3;  3HD8 B;  2XOM A;  4AEJ A;  3S5A A;  4QQ2 A;  5CAZ A;  1UXZ A;  2FDK A;  4FPK A;  1Y43 B;  2V5D A;  4P9L A;  4AVV A;  2VNR A;  3DYO A;  1VAL A;  1FMD 1;  4TLF A;  3ETQ A;  3T0A A;  3ZOI A;  2VC9 A;  1W9F A;  1MZF A;  1PVC 3;  1D2Q A;  1IKQ A;  1V6K A;  5JXG A;  4AQS A;  4QB6 A;  3HNB M;  1S4C A;  4XFG A;  5JAX A;  1LEC A;  1RUF 3;  1UD1 A;  3VKF C;  4QPI A;  1POV 3;  1YQ6 A;  3HNM A;  1SBE A;  2ZEZ A;  3ZIX A;  2WRA A;  4E4D X;  2VBB A;  3AVR A;  4XFH A;  5LEJ A;  1EUT A;  3RMX A;  4C91 A;  5JOX A;  4BQ3 A;  4FSJ A;  1ZRR A;  2ARB A;  5LAS A;  4LQR A;  1Z0H A;  5FYY A;  4BQ2 A;  2J1R A;  4D6Q A;  1CD3 G;  1D7P M;  3UJQ A;  4AGG A;  1U0A A;  4DXS A;  1AR6 3;  3NV4 A;  5A3U A;  2IFW A;  2RS5 3;  1QJX 1;  3VBS C;  3WX5 A;  1DGR A;  1YFW A;  5FMD A;  1W39 A;  3TNQ A;  3K4D A;  2YXS A;  3LAG A;  2W46 A;  3NAP C;  3IDC B;  2WNV C;  2F6B A;  2Q30 A;  4MVT A;  2CV6 A;  2H6C A;  1VAM A;  2EID A;  4DEQ A;  4HOO A;  5FLI A;  4KL1 A;  1O4T A;  1SLC A;  3P3P A;  4CUG A;  2QQL A;  4YW3 A;  3P6B A;  4LO7 A;  3HPN A;  2ORX A;  2D98 A;  4YM3 A;  3GAL A;  2QZ3 A;  2ZJC A;  4ASK A;  3A0K A;  1BZW A;  1MR5 A;  1Y3T A;  1V6M A;  1RIN A;  2JG9 B;  4FPL A;  3VDC A;  2O0O A;  4CP9 B;  2QKD A;  1Y9Q A;  3AFG A;  3H9A A;  4XQ4 A;  2VBD A;  3FHA A;  3GZE A;  3SHR A;  1QQP 1;  1WLC A;  2ZX4 A;  3W59 A;  1JZ7 A;  2VQT A;  1HB3 A;  2Y38 A;  3HWJ A;  4IND A;  3WIN E;  2IXK A;  2R06 1;  2VMC A;  2VZP A;  1W0N A;  3ZR5 A;  4DUV A;  2D97 A;  2CU5 A;  4LUM A;  2VOW A;  1AXY A;  4EN0 A;  2LRO A;  1UZW A;  3U11 A;  2EIB A;  4LJH A;  4Q4Y 3;  1OKO A;  3DYP A;  1GQG A;  2YDE A;  2ZGR A;  2PHD A;  3B93 A;  4CE8 A;  3CZU A;  3EQE A;  1RUC 1;  5FLH A;  3VKN A;  2EAK A;  1G9A A;  4Y4R A;  2X53 S;  3E6B A;  3KHC A;  3ES1 A;  2RG4 A;  1RVF 3;  1L7Q A;  4M3C E;  5D21 A;  4Y26 A;  3KQR A;  1NCR A;  3OJB A;  5AFB A;  5I0S A;  1MS4 A;  1QXP A;  4CEY A;  4DQA A;  1TEI A;  3HQR A;  3MUY 1;  1HRI 3;  1AR9 3;  1ZBA 3;  3ZFF A;  1MQT A;  1QJF A;  1M4W A;  1MZ6 A;  4FI9 A;  1LHW A;  1U5Z A;  2I74 A;  1RUD 1;  1W8W A;  2WAO A;  3ZXJ A;  4Q1R A;  1A6C A;  2XJT A;  2W1Q A;  1LHN A;  2DU1 A;  2Q1M A;  3SCF A;  2A6V A;  4Y4Y A;  4XJZ A;  2WZR 3;  1JH5 A;  3NL1 A;  1UU6 A;  4QMA A;  1MZ5 A;  5F5C A;  3ACI A;  2IUW A;  4Q4X 2;  2X5I A;  2VCC A;  5L7O B;  3CO2 A;  3LEM A;  3ZLI A;  3TRS B;  1PIV 1;  4BE3 A;  3SCH A;  5I8S A;  4E4Z A;  3VZL A;  3D0J A;  5FK7 A;  2CDP A;  2R1B A;  5FXZ A;  4IE7 A;  2JJ6 A;  5ACA 3;  1GP4 A;  3WDX A;  4EJR A;  1TMF 3;  3N3H A;  4XDO A;  3ENR A;  5FZH A;  3NJV A;  4D7Y A;  1V9U 2;  1IPK A;  2B7Y A;  2VMD A;  2Y6G A;  5FKC A;  3TN9 1;  1VBE 3;  5IVB A;  2W3J A;  1LRH A;  1X33 A;  4DO0 A;  2CNA A;  5I93 A;  2VUC A;  2ET1 A;  1QF3 A;  5EJZ B;  4L99 A;  1DBN A;  1S0E A;  3AYA A;  5IUQ A;  1I9R A;  1RUI 3;  1W6O B;  4AFM A;  1UNB A;  1YWK A;  5FYZ A;  2HWB 2;  3PDQ A;  4XET A;  3S30 A;  3J7L A;  1YUD A;  3UL2 A;  1KFX L;  5CFC A;  5FP3 A;  2VCA A;  2OUJ A;  3AXD A;  1COV 1;  3NRU A;  3HIF A;  5LB6 A;  1OPM A;  2VZT A;  4XAE A;  1S0F A;  4BDV B;  4N7U A;  1C1L A;  1N3P A;  1XQN A;  3GYD A;  3I2O A;  3TEX A;  4CP9 A;  2NN8 A;  5CNA A;  4AGV A;  3MW4 A;  4IEU A;  1OA3 A;  3KLS A;  5KXE A;  1Y9G A;  2XWJ B;  4QB1 A;  1RUC 2;  3FX3 A;  4OI2 A;  4MGY E;  3BPZ A;  5J98 B;  4A6S A;  3OYW B;  1I5P A;  3VD5 A;  4CRQ A;  4Q27 A;  5CG8 A;  3LEG A;  5IAT A;  2AEZ A;  2DU0 A;  3M2M A;  4R9A A;  2PYT A;  1ENS A;  5FDB A;  2GAL A;  4YW5 A;  4V1P A;  4MHU A;  5C4W B;  3VHP A;  3CLP A;  3WV6 A;  2WQ4 A;  1RC6 A;  3FN9 A;  4HMZ A;  3D3A A;  2IFR A;  3UT0 A;  2VVF A;  2JG8 B;  4UFM A;  1QQP 2;  2BUK A;  2VTX A;  2WS9 2;  4WM7 C;  1FMD 3;  3OPW A;  3BAL A;  3L9J T;  1ZA7 A;  2C9A A;  4XMI A;  3P5B A;  4GB3 1;  4B7K A;  2R04 3;  3FL7 A;  3VD4 A;  1MQT B;  4RN5 A;  4JKL A;  3N36 A;  1U5I A;  5F3I A;  5TSW A;  3ZVX A;  4XJA A;  5CAD A;  1WA4 A;  2AUY A;  4Y1U A;  3N7J A;  3CJI C;  4Q4V 2;  2OYZ A;  1BJQ A;  1HW5 A;  2OQ7 A;  2TEP A;  2Y8K A;  1V9U 1;  3TN9 2;  1C8N A;  2RHP A;  3U1X A;  1N1Y A;  4IXL A;  4AVT A;  2IXJ A;  4GA9 A;  4Z8B A;  4AAX A;  4CU9 A;  4MET A;  4F8A A;  4EN7 B;  4CCL A;  1A34 A;  1UCX A;  3PJY A;  2VXR A;  4IEW A;  1NY7 1;  2RS5 1;  2QQM A;  3AMH A;  4CCM A;  1RUH 2;  3THT A;  3VZM A;  1CZS A;  1OBN A;  2A70 A;  4H7L A;  3I2K A;  3ACF A;  5L9R A;  3TBD A;  1UL9 A;  1NLQ A;  4AVA A;  1BEV 1;  4XTP A;  1MAC A;  5L36 A;  5JLV A;  4U2A A;  2BNN A;  1K5M A;  4N53 C;  4A7Y A;  3JU9 A;  1W6Q A;  3IPV B;  2D7F A;  1H8V A;  1ZZ7 A;  1UMZ A;  1DP0 A;  3WF0 A;  1PZ7 A;  1XE0 A;  1HN1 A;  1DLL A;  2HWD 2;  2HWC 3;  3NNL A;  4MHR A;  3UKV A;  2BW8 A;  2EF6 A;  1WME A;  3D4K A;  5APA A;  5EHD A;  4L11 A;  1QH6 A;  1I5Z A;  3WF3 A;  3ZFG C;  2W94 A;  2VM9 A;  4RFR B;  5BV6 A;  1VB4 A;  4N43 A;  4KMQ A;  2WNV A;  4KBZ A;  2XPJ A;  4IV1 A;  3R0R A;  3CKH A;  4Q2F A;  5FPA A;  1JZ5 A;  3CQO A;  3UKT A;  4DZG A;  5EP9 A;  3UYJ A;  2Z69 A;  3WP3 A;  2LS6 A;  1OUR A;  2B42 B;  1W9S A;  2DVB A;  3EB7 A;  3JBG 1;  2BZD A;  2V73 A;  4FT8 A;  3B69 A;  3K4Z A;  4G9S B;  4GB3 3;  3T1L A;  2ZBJ A;  2HWD 3;  4UFI A;  1XB9 A;  4WM7 A;  1J3P A;  4BXF A;  2BFU L;  1WW5 A;  4GQ7 A;  2XL7 A;  1PK6 B;  4PIZ A;  2XBO 1;  4Q4W 3;  2W95 A;  4QQH A;  4R9B A;  3DUI A;  4AEK A;  5BNQ A;  2HWF 2;  5C70 A;  3AKR A;  3POI A;  5EIY B;  4CEY C;  3CZJ A;  3UKN A;  2OZJ A;  5JIU A;  1VIW B;  3S7E A;  1YQ2 A;  2XWB B;  4E2Q A;  3CJI A;  4AFB A;  4BYY A;  5JVV A;  2QQU A;  3QCW A;  4X8P A;  4WM8 A;  4CCE A;  2J22 A;  2JE9 A;  5DZE A;  1O3R A;  4I0W B;  3RI9 A;  4PIX A;  1SG3 A;  3JUU A;  4FPJ A;  2Z42 A;  3ZXG A;  4DIN B;  1YFU A;  2EIC A;  2TUN A;  4QDQ A;  1R1Z A;  3HR9 A;  2GU9 A;  4LBN A;  1ND2 A;  4XAC A;  4W65 A;  1QOT A;  3WVJ A;  3CHX A;  1SAC A;  1GWL A;  2X29 A;  4YG6 A;  2EXH A;  2GNM A;  5FYI A;  1ULG A;  4Y1Z A;  2D5F A;  2GN3 A;  1PZ8 A;  4ISQ A;  2ORZ A;  4R4Z A;  3RYP A;  4AVB A;  5DUX A;  5HPO A;  3PTR B;  4EYU A;  3AX4 A;  1PK6 C;  4P08 A;  3ZFF B;  4DFS A;  2R04 2;  2FCU A;  2VVD A;  4PBO A;  1CGP A;  5GZF A;  3ZSE A;  3HNY M;  3CIH A;  3KHB A;  2ZAC A;  3ORJ A;  4AI1 A;  5IVE A;  5FZO B;  1GBG A;  5FPB A;  3G7D A;  2WYF A;  2WT1 A;  2X10 A;  5T5P A;  1R1A 2;  4ZU5 A;  4QX7 A;  3OGV A;  1BHG A;  4XF0 A;  1CPM A;  2A1X A;  5K9Y A;  1Q56 A;  2BPA 2;  1CN1 A;  2ES3 A;  3H7J A;  2VBP A;  4KU8 A;  1AR8 1;  1H9W A;  1OKQ A;  1VBD 3;  4XE9 A;  2AEY A;  1H1A A;  5DZF A;  2PLV 3;  3D0S A;  5DZG A;  5JIA A;  1RUJ 1;  5JPM B;  4UOJ A;  4PLN A;  4CDU B;  1O8S A;  3E5U A;  3LA7 A;  2R06 2;  5CFC C;  4DXZ A;  1BEV 3;  2D3S A;  1VPH A;  3C3V A;  3FLP A;  1CWP A;  4RR3 B;  1RB8 G;  2V5Y A;  2Q8O A;  4A7K A;  5LRR A;  5L9V A;  4FFI A;  4YGC A;  5LY1 A;  1TZO A;  4EWE A;  1BEV 2;  1XRU A;  1YI7 A;  2G9G A;  4N43 B;  4DIQ A;  3IIA A;  3I97 A;  2PHU A;  2VW0 A;  4LUK A;  3FUQ A;  4D94 A;  2UWC A;  4K8F A;  4P9Y A;  4GAZ A;  3N4M A;  2VCB A;  4P9W A;  3N7M A;  5BNP B;  1XE8 A;  1UOJ A;  1XND A;  1WW7 A;  1RUI 2;  4BQW A;  1RJ7 A;  2ZX3 A;  1UIJ A;  3OY8 A;  3KCC A;  4YVS A;  3WW4 A;  2RM2 1;  4OZX A;  2FD8 A;  4HN1 A;  2W47 A;  3Q8F A;  1ENR A;  4XUO A;  3MGU A;  3EMR A;  3EYP A;  1NKG A;  2B4K A;  3DXU A;  4Q0P A;  1Y9M A;  4YFW A;  1T2X A;  1TMF 2;  1N1S A;  3WUD A;  1L7L A;  2ZX1 A;  5JUV A;  1JOP A;  3AZX A;  2WNU C;  4ERO A;  3LGR A;  3PIG A;  4N90 A;  3N9Q A;  4AQ6 A;  3Q8A A;  2DVF A;  2OII A;  2C1F A;  1KDM A;  1UYX A;  5ACA 1;  1R1A 1;  3WQ7 A;  3RYR A;  5E88 A;  2ZGN A;  4P00 B;  3LOB A;  2Y64 A;  2XLF A;  5F6L B;  4CXY A;  4YZ5 A;  4GAL A;  4K9S A;  1NZC A;  4Q4X 3;  5C3R A;  5BPX A;  4AED B;  2TBV A;  2Y6J A;  4CUA A;  3HJR A;  2WZ8 A;  1DZT A;  3RI8 A;  4IUG A;  4BCU A;  1RUN A;  4D69 A;  3TOJ A;  3M7A A;  3F2Z A;  5LK5 A;  4YGE A;  3MPB A;  2PMW B;  4RHV 3;  1G9D A;  1BBT 1;  5F3C A;  5EXO A;  5KR7 A;  1IG3 A;  3KS7 A;  2D6N A;  5SV8 A;  1WZX A;  3ZSM A;  1WBF A;  2HH9 A;  3RVH A;  2CYF A;  2HWF 3;  4BLJ A;  2JDM A;  3RWK X;  4MSV A;  4BOW A;  5FK8 A;  4AAP A;  1DZQ A;  2QQP A;  5FRE A;  5C7G A;  3R4S A;  1VBB 1;  2C9K A;  2VQ0 A;  2XKO A;  4ISR A;  1HJG A;  2VVE A;  2Y0O A;  4D6R A;  1V6J A;  1MEC 1;  4GB3 2;  4GWI A;  4CPB D;  3J8F 3;  3LOI A;  1S0J A;  2YC2 A;  4XAB A;  5JZG C;  1MEC 2;  2V4V A;  1H4G A;  4Y3O A;  1Q8S A;  1O59 A;  1XNA A;  2A3W A;  4QT6 A;  5BNN B;  2Y6L A;  4UXA A;  1QGL A;  3Q8C A;  1D0H A;  2OPW A;  1ZNP A;  4FFF A;  2FBE A;  4HKO A;  2UYB A;  4LHL A;  4BU2 A;  2GDF A;  3HBZ A;  4MAD A;  3ROU A;  5T5O A;  1QH7 A;  4EZ4 A;  4XXP A;  4PQ9 A;  4TLG A;  1A78 A;  2W39 A;  5C9A C;  3GM8 A;  2AZ5 A;  1W2A X;  2OT7 A;  4YRD A;  1DF0 A;  2DUP A;  4QHZ A;  1OT5 A;  3VDD B;  2PHF A;  4NII A;  1FNY A;  2QNK A;  1RJ8 A;  2HWC 2;  3ZO0 B;  1MVE A;  5IK7 A;  1S0G A;  5FOJ B;  1QJX 2;  4JQT A;  2YGL A;  3POG A;  1SHW B;  2P3K A;  4UW6 A;  1X8E A;  1DQ2 A;  3ILN A;  5ISL A;  1QOO A;  5GZD A;  5JR2 A;  1GSL A;  2WKK A;  3AM2 A;  3JCI A;  4IV1 B;  5FYS A;  2D93 A;  1OQ1 A;  4D7T A;  2XR4 A;  5C8C B;  3ALQ A;  4YM0 A;  5FWJ A;  4JRL A;  1X82 A;  2YFZ A;  3MLL A;  1OUS A;  4BK5 A;  3K75 B;  4OI0 A;  2XML A;  4M4P A;  2WT0 A;  5FP7 A;  2ZHK A;  4O65 A;  4XF3 A;  2YGM A;  3BOP A;  4KG0 A;  4NOT A;  3I2G A;  4O9E A;  1CAX B;  4XCA A;  1HIX A;  3LCP A;  5EJ1 B;  4Q4V 3;  1AXZ A;  3LSD A;  2ARC A;  1DQ5 A;  1DQ1 A;  1PGL 2;  3ZPY A;  2VNV A;  1G7Y A;  2YG0 A;  3AKT A;  1LAJ A;  1JUI A;  3WHU A;  4Z82 A;  2NMN A;  2ZX0 A;  3BOW A;  4IEV A;  2FDF A;  1ZBE 1;  1CQ9 A;  3K3O A;  1AUY A;  1DYK A;  4UT5 A;  4GWN A;  2ZGT A;  5BYN A;  2O1Q A;  3A0N A;  1J1T A;  4WM8 B;  5FZ9 A;  4FBF A;  4RQP A;  5FZF A;  3IAQ A;  2ILM A;  1QQP 3;  3QOP A;  1CPN A;  5CEH A;  1F31 A;  1S55 A;  2O8O A;  2P34 A;  2PEL A;  2VG9 A;  3CF6 E;  3JQX A;  1Y4W A;  2WSU A;  2FQP A;  3JQW A;  1ND3 B;  2YC4 A;  3FLR A;  4X6Q B;  1HRV 2;  4CZS A;  1J58 A;  2XBO 2;  4RSU A;  1ZRC A;  1KQR A;  1W9W A;  4IES A;  4X6R B;  5KHK A;  2BP6 A;  1QJU 2;  3T30 A;  4DPN A;  1RUI 1;  1VBD 1;  5FY7 A;  1T6G C;  1YO8 A;  3NKG A;  2BNO A;  1RUC 3;  4MYE A;  3ZYR A;  4YGB A;  3R4D B;  3AKP A;  3AJY A;  2JD9 A;  2CGP A;  1UKG A;  4IGO A;  2JDK A;  3AMM A;  2G19 A;  2RS3 1;  2JG8 A;  4JC1 A;  1F2N A;  2VMH A;  2ENR A;  2OXB A;  3MYX A;  3OGS A;  4IW3 A;  4EN6 B;  1FPN 2;  1YRZ A;  3E5Q A;  4HPK A;  4YGD A;  5JMC A;  2BOI A;  4HXC A;  1JHN A;  2ZMK A;  4GXL A;  3RYK A;  5C5T A;  3H8R A;  3DPR A;  4TSV A;  3OBA A;  2J42 A;  2PAM A;  5CKQ A;  5JXJ A;  4YVS B;  1G86 A;  4WVM B;  3MIH A;  4BM8 A;  3TAY A;  2VH9 A;  4KG8 A;  3QH7 A;  5CIS A;  1VRB A;  1RXG A;  1NA1 A;  3HN1 A;  2XL9 A;  2W92 A;  1GR3 A;  2FDI A;  3E97 A;  3KM5 A;  2P2K A;  5IVF A;  4QU1 A;  1V6I A;  2LW8 A;  4I0A A;  4Y1X A;  4PI2 A;  4HPK B;  3AL5 A;  1JOJ A;  3ABZ A;  1VBE 2;  5IHR A;  2J1T A;  1ASJ 3;  5I0D A;  5A33 A;  4CA9 A;  1W6N A;  4CEW B;  1GOH A;  1DGW X;  1COV 2;  3V0A A;  4WVM A;  3VBS B;  2WLQ A;  4A44 A;  2GSY A;  1D4M 3;  2A73 B;  1S2E A;  4QHO A;  4GH4 A;  3WQB A;  4XFA A;  4IV3 C;  1C8M 2;  3Q8E A;  4FP3 A;  5LBC A;  1E5R A;  3GJB A;  4XFF A;  2WR9 A;  2VXJ A;  1PNG A;  3HOB A;  4Q29 A;  4R9D A;  4AHZ A;  1UPI A;  4LOS A;  2ZKN A;  5FBZ A;  5CKM A;  2JKB A;  1PO1 2;  2GC1 A;  3GZA A;  4CU6 A;  2ZAH A;  4YVS C;  1XYN A;  3BU0 A;  2HEY F;  5FTT C;  1GP5 A;  4RQP B;  5A3P A;  3H1W A;  1FAY A;  2WZR 2;  3P3N A;  4AF9 A;  3X29 B;  3F95 A;  4FOW A;  4LKS A;  5K0U B;  1O3Q A;  1V6N A;  4L97 A;  1HB4 A;  5A7W B;  4MO3 M;  1I6X A;  2E53 A;  3LSE A;  4O61 A;  5IFP A;  4EWA A;  3H42 B;  3PIJ A;  1MS9 A;  1CIY A;  5GKA C;  3WF4 A;  1W03 A;  3PHM A;  3VL9 A;  2ZGK A;  1AR9 2;  5BXX A;  3ZYF A;  2QDR A;  2YHJ A;  5A6Y A;  3PMS A;  1OUX A;  4JKM A;  5FKB A;  4AWD A;  2P5B A;  4MV2 A;  3BYW A;  4A3Z A;  2QJV A;  4W6Y A;  3ZKU A;  3R05 A;  4CDQ A;  4DUX A;  3V0A B;  2VU9 A;  2W1U A;  2XXZ A;  3MIG A;  1ODM A;  1RUE 3;  1RVF 2;  4LLO A;  4FQ4 A;  5FO7 B;  4CXW A;  1H1M A;  2VMI A;  1GAN A;  2UY8 A;  1NLS A;  3NV3 A;  4B3N A;  2ZEW A;  4J1X A;  1HV1 A;  3NMB A;  1RIR A;  1EPW A;  2A7A A;  4XBL A;  4DY3 A;  3J8F 1;  1X7N A;  4HVR A;  5EYX A;  2SLI A;  3SH5 A;  5D8A A;  1EAH 1;  1OSG A;  2ZHM A;  3H3Z A;  4S2D A;  3VBU A;  1SMV A;  1RTV A;  1ZM1 A;  2WAA A;  4NWV A;  1ENQ A;  1RHI 2;  1W6M A;  5FYT A;  1POQ A;  4K7J A;  1UZ0 A;  4GZ9 A;  5HCH A;  3AC0 A;  5BNO A;  1RHI 1;  1V6O A;  3DGT A;  3WDU A;  3EHK A;  3AK0 A;  5FCC A;  1KS4 A;  1ULD A;  3IZO A;  4CCD A;  1RMU 1;  1LUL A;  3WNK A;  2WZE A;  3DN7 A;  1NAE A;  4XHX A;  1GU3 A;  1D4M 1;  3AZW A;  4CCC A;  3KCY A;  2ZX2 A;  1AXK A;  5EQU A;  4AYU A;  1LTE A;  1LCL A;  4IDZ A;  2PQS A;  2KXL A;  2A6Y A;  3GZU C;  2HYX A;  5AC9 1;  5JMO A;  3SC7 X;  5KWR A;  2W87 A;  4FOV A;  4GH4 B;  4PIY A;  4Q0Q A;  5L7O C;  3WDT A;  5BNO B;  3VV1 A;  2K0G A;  4FPE A;  4FTS A;  2JXA A;  4OUM A;  1REF A;  1QXJ A;  4ZU7 A;  4QGM A;  4UFH A;  4K21 A;  1UMI A;  3O0V A;  3JD7 2;  5GLV A;  4LA2 A;  4HG6 B;  2Q4S A;  1RIT A;  5IT6 A;  4QQO A;  1BVP 1;  3LFM A;  4P5H A;  1LEN A;  1VBC 3;  3KB5 A;  1PO1 1;  3MFA A;  5A7O A;  3JZV A;  2CHH A;  1URX A;  2JG9 C;  4M01 A;  1AR6 2;  1X36 A;  4UF0 B;  2DVD A;  3RMY A;  5A3T A;  2WZR 1;  2XVK A;  1JZ3 A;  2CSG A;  1UMH A;  3UGG A;  1UOG A;  2AAC A;  4JHZ A;  3RPQ A;  4B1L A;  3GHN A;  1UOF A;  1R08 3;  3I4I A;  2E32 A;  2EAL A;  2FMY A;  2XJP A;  3ZFE A;  4EWD A;  2BGO A;  1HQW A;  2AH2 A;  1G9F A;  1EAH 2;  3RZH A;  2WNE A;  2ZMN A;  3LA2 A;  3LDK A;  3MDP A;  2EAA A;  5BNO C;  1JYV A;  1ZRF A;  4IE5 A;  3B5L B;  2JDZ A;  1RXF A;  5FXW A;  3U07 A;  4XFI A;  4IGP A;  3N9N A;  3KV4 A;  1OA4 A;  1BK1 A;  4NHK A;  2D44 A;  1ONA A;  2JDA A;  5KHG A;  2QDN A;  2R0H A;  3JB4 C;  1ULF A;  1SLA A;  4YYO A;  5A6Q A;  1NQJ A;  1N3Q A;  5IAX A;  4HLT A;  1BLZ A;  4LIU A;  5FPV A;  4Q0V A;  2QQK A;  5A3O A;  3RWN A;  2PAK A;  1C57 A;  4QX3 A;  1OH3 A;  1AJK A;  3ZSK A;  4AHW A;  1GLH A;  1NCQ B;  3CEW A;  3NJZ A;  4N8M A;  1YEW A;  3KD4 A;  3GJA A;  1YLL A;  3NV2 A;  4ET7 A;  3ZSJ A;  1NY7 2;  3PNA A;  3ATG A;  5LA1 A;  1YQ8 A;  2OW4 A;  1QJU 1;  2ARX A;  3I3Q A;  4XCB A;  1AL2 2;  1W9T A;  3LIG A;  5KXD A;  5KXC A;  4TN7 A;  2VGD A;  3ZYI B;  2YBK A;  4HVO A;  4TYS A;  4BLI A;  3MLK A;  1KIT A;  2CY6 A;  3WQ0 A;  4NRP A;  4CP2 A;  2E7A A;  1YJK A;  1TME 3;  4LO8 A;  4PLM A;  1OLM A;  2AYH A;  2C5D A;  3LFI A;  3M3C A;  4EV0 A;  1UX6 A;  2HKX A;  2DFB A;  3AL6 A;  2C0Z A;  1HB2 A;  1PMI A;  4NIH A;  5C3P A;  1AYM 3;  2E26 A;  2YPJ A;  1DDL A;  3ZYG A;  2RVA A;  1RUD 3;  4N9I A;  1F4H A;  2R07 2;  4NID A;  5KBF A;  3ZXF A;  2Y26 A;  1GNH A;  3C2U A;  4C0B A;  3T4H B;  2YBP A;  1FOD 3;  1UU4 A;  1J1L A;  3AZV A;  5C3O A;  1HLC A;  1GFF 2;  2HWF 1;  2WL1 A;  1NUK A;  4QX8 A;  4QX1 A;  5FYC A;  3T2Q A;  4K8R B;  2AEN A;  5KXB A;  3DKW A;  4PQQ A;  3LWC A;  1RUD 2;  3POE A;  4CCK A;  1CJP A;  4PT6 A;  2DBI A;  1V6L A;  3FBM A;  3TNP B;  5IK5 A;  4LE3 A;  2RS1 2;  1LOF A;  3KF3 A;  4ZY9 A;  1PGL 1;  2D3R A;  4PI0 A;  2K46 A;  1XOY A;  4QM8 A;  1ST8 A;  2JKX A;  5FYV A;  2NM1 A;  2N7G A;  4YM2 A;  3ZYB A;  5LBE A;  3PUH A;  3WQ1 A;  3NJX A;  2RDS A;  4OHW A;  1S2K A;  1X9T A;  1FAT A;  4LKE A;  1NCR C;  4NMI A;  1O4Y A;  4ASM B;  1LOB A;  3BTX A;  1ACC A;  2IXL A;  4AE2 A;  4M0H A;  3VBF A;  1CR7 A;  4BQX A;  2G9F A;  4R4X A;  2PAE A;  1Q8P A;  4YWA A;  4QXH A;  2FCT A;  4AQ2 A;  1BXH A;  4ARX A;  5BNN A;  1QDO A;  3KGL A;  4CYD A;  2JDP A;  1XYP A;  4QD2 A;  4E4H A;  2BVB A;  4XDP A;  2WSV A;  2ETE A;  2LUW A;  1VB2 A;  3M3I A;  4JAA A;  2JE7 A;  5FXV A;  1IHM A;  4BIF A;  3S6P A;  1YC6 1;  1IZ3 A;  1SZB A;  1UYY A;  3IB3 A;  1UW8 A;  5GZC A;  3N7L A;  4KNC A;  2WFF 3;  4JGZ A;  3OGR A;  5GLZ A;  3WNO A;  5AFE A;  2X5I C;  2Y0I A;  2EA7 A;  5DUV A;  3A4U A;  2CGN A;  2RS3 2;  3HEI A;  5CIR A;  3HMY A;  1US3 A;  1WLD A;  4FCA A;  2PHW A;  3RSJ A;  2NPI A;  4K40 A;  2VZ3 A;  4MGK E;  1EUU A;  1QEX A;  3LQC A;  1OPO A;  4UFK A;  1IPJ A;  4HVQ A;  1JBC A;  1H6Y A;  4W6X A;  1NCR B;  1CVN A;  3CJI B;  4NRO A;  4PF5 A;  3FFQ A;  3FC0 A;  2EIG A;  5DG2 A;  1PIV 2;  2ID4 A;  3AKS A;  3GGL A;  3KGZ A;  4GKX A;  3T3Y A;  3U75 A;  2BOJ A;  4WBB A;  3I7D A;  3MFC A;  3JD7 1;  5KC5 A;  1LJ7 A;  2RMU 2;  4OVE A;  2WO2 A;  3V65 A;  5EWS A;  1E5H A;  2PXJ A;  4LE4 A;  4Q4V 1;  3KSC A;  1PO2 2;  4MZU A;  4AFD A;  1SLI A;  3B94 A;  4OHV A;  3KVA A;  3PLQ A;  4QDR A;  5I91 A;  1US2 A;  3LEK A;  4QXC A;  1VBB 2;  4XZU G;  3M4F A;  1IS5 A;  1RUF 1;  4HSJ A;  5T5L A;  3USU A;  1EY2 A;  4XUP A;  1W8N A;  3SNM A;  3AP6 A;  3I2D A;  5LY2 A;  4JCK A;  1R09 2;  4OUS A;  3CU7 A;  1H6X A;  1GOF A;  1HX6 A;  2BU9 A;  5ANN A;  5A3M A;  1ODN A;  1D2S A;  2BBA A;  4MUV A;  1OD5 A;  1LOD A;  4YG0 A;  5FZO A;  5IVC A;  3EBR A;  2NQY A;  2WA3 A;  4AVC A;  5FLJ A;  3M3Q A;  4KGQ A;  1ZX5 A;  3W9A A;  4QPY A;  1W8O A;  3ACH A;  2Q8C A;  4XAA A;  4QXK A;  3M3E A;  3VKM A;  5JXI A;  3T0D A;  3SQO A;  5FZ4 A;  1PO2 3;  2VMF A;  3KWV A;  2LTN A;  3VBU C;  4CDW B;  1C28 A;  3NAP A;  5J36 A;  3E6D A;  4FOQ A;  5CYY A;  2E51 A;  3H3U A;  1RUG 3;  2GZW A;  4NWW A;  3BU7 A;  1PIV 3;  5C8W A;  2Y6K A;  3IMM A;  1E5S A;  3O7O A;  4DY5 A;  4RR3 A;  3ZPO A;  3DYM A;  4FPH A;  3D6E A;  5CFC B;  4A42 A;  1ZBE 3;  2W52 A;  5DQ0 A;  4IEQ A;  3QAC A;  1NG0 A;  1DQ4 A;  4AOC A;  3ZKY A;  5JSP A;  2LRP A;  1DYO A;  3MEP A;  1O7F A;  4DB5 A;  1JMU B;  3J7N A;  5CZK A;  4XFC A;  3GCX A;  1GQP A;  1GQH A;  3KV5 A;  3POS A;  3BI3 A;  4LHS A;  2RDQ A;  3ELN A;  4JGY C;  2ZGM A;  2BVV A;  2DVG A;  3O1S A;  3S57 A;  2D40 A;  2Q1Z B;  3DCQ A;  5A7P A;  2B45 X;  2IWG B;  4UW5 A;  2VUA A;  3ZXL A;  3LKJ A;  4KWJ A;  3KMH A;  3SKJ E;  3VBU B;  3LB9 A;  1OF4 A;  4CDW C;  5GZE A;  3WCS A;  3V0B B;  1LOG A;  1DQ0 A;  1EV1 3;  2DTW A;  4A4A A;  4JX0 A;  1MS3 A;  1RGS A;  1V0A A;  2OUH A;  1T6B X;  1VJ2 A;  5K7P A;  4NVP A;  3HBK A;  2GP3 A;  3VHO A;  4X8N A;  2HWE 2;  2FDH A;  4J1W A;  3ON7 A;  3NAP B;  3I3B A;  2WNU B;  2WNV B;  3K51 A;  3QD6 A;  3LZZ A;  4M4R A;  3AMN A;  4YZ4 A;  4Q4X 1;  1NXM A;  1XXN A;  3BB6 A;  5FYU A;  3ECQ A;  3ZFF C;  3SH4 A;  3A21 A;  4LO5 B;  1QXR A;  1PO1 3;  1PM7 A;  3ST7 A;  4AEM A;  2IXC A;  4AHY A;  1GNY A;  5FP8 A;  4RS5 A;  1B35 B;  3RG0 A;  3Q8B A;  3SLI A;  3WW3 A;  1U12 A;  1CZV A;  2OA2 A;  3CJX A;  5DAW A;  3VBF B;  4CDX B;  4CSW A;  2IXH A;  3O5S A;  1AYN 3;  5K0U A;  4BH9 A;  1COV 3;  4MOA A;  5LWB A;  3OD0 A;  3N9O A;  1LGB A;  5JOW A;  1W04 A;  2CL2 A;  1K5M C;  2R07 3;  4N53 A;  1PX4 A;  4D7S A;  4YG3 A;  3U0Z A;  1W90 A;  4QKD A;  2J1U A;  2WIN B;  1GZ9 A;  1UZY A;  1AYM 2;  3ZXK A;  2UU8 A;  3VD7 A;  5CBL A;  1U5X A;  1UZV A;  2ZEY A;  3WDW A;  1OHF A;  2HEV F;  4OQ8 A;  3KT7 A;  3ZFG A;  4E2S A;  4B4P A;  1HJF A;  2ZML A;  2J1A A;  1WMD A;  4NHX A;  2ZEX A;  3ASI A;  2B8M A;  4A6O A;  1B35 C;  3NNF A;  4XW3 A;  1CAU A;  1LOE A;  4NR1 A;  1CX1 A;  3MBW A;  2X8K A;  4N7I A;  4R52 A;  3R6S A;  3RFR A;  4KWK A;  3I49 A;  3C7E A;  3UGH A;  4PDW A;  3MPP G;  3WY6 A;  2W08 A;  2NLR A;  2WDB A;  2BNM A;  2JIJ A;  1QJU 3;  3E1F 1;  1RUG 1;  1TG7 A;  2VZO A;  2RJ2 A;  4D6S A;  1H2M A;  2JWP A;  1GIC A;  2XBO 3;  4Q4W 1;  4HT1 T;  4CCN A;  1N47 A;  3N9L A;  1UN1 A;  2GNB A;  2I07 B;  1SDD B;  2B5H A;  2IZW A;  3PL0 A;  2BTV C;  4UW3 A;  1CAV B;  2EIE A;  4OHX A;  4B29 A;  3IWZ A;  4K1Y A;  4Z07 A;  5J37 A;  1BBT 2;  3RZM A;  3N9P A;  3H8X A;  2NZ9 A;  3ETP A;  3AP9 A;  1AYM 1;  2JIG A;  4NE9 A;  2AR6 A;  2DCJ A;  4Y24 A;  4ES9 A;  4IEX A;  1VBC 1;  4RYD A;  1EAH 3;  5FZ8 A;  1CX4 A;  1O3T A;  1VP6 A;  1F35 A;  2E33 A;  1C1F A;  3CNA A;  4JQR A;  1VRH 2;  2XVL A;  2YPD A;  4AFA A;  1AR7 1;  5DMY A;  5F7U A;  3A23 A;  3WW2 A;  1DZR A;  2VNG A;  1P8J A;  3KV6 A;  1O8P A;  1R08 2;  1H8T B;  2A75 A;  4K3U A;  3O1V A;  3B7M A;  2EXI A;  3ZDV A;  3A7Q A;  1PVC 1;  2NYY A;  3TB0 A;  3LF7 A;  1SDW A;  2VEC A;  3H8U A;  1FV2 A;  2ZGO A;  1PK6 A;  2C26 A;  3OBR A;  3WP6 A;  1OOP B;  4GIQ A;  4L0P A;  3ZN6 A;  1LOF C;  1VBC 2;  3QLQ A;  4BJ0 A;  5K8S A;  2XLG A;  2CWS A;  4GD4 A;  5LA9 A;  3WP4 A;  4TTG A;  3OPZ A;  3O1R A;  2IXI A;  4EQV A;  5K4L A;  4M00 A;  4FAH A;  4HON A;  3VBS A;  3ILR A;  4XJ8 A;  3BOD A;  4PF1 A;  2DCK A;  4IGQ A;  1RYY A;  1WWY A;  4YW4 A;  4MG2 A;  1GMM A;  1NA1 B;  5DDJ 3;  3OBZ A;  1W2U A;  1O4Z A;  4JRA A;  1QJZ A;  1S0I A;  3AP7 A;  5IJR A;  3URF A;  4ZKT B;  1LHO A;  3B02 A;  4Q26 A;  1ND3 C;  1K45 A;  1O6U A;  5BNP A;  3FBY A;  2FMD A;  1BMV 1;  3CBN A;  2ZOE B;  4COZ A;  1EPZ A;  3IPV A;  1WCU A;  4DXT A;  2JD4 A;  4D8M A;  1W06 A;  4D0Q A;  1UYP A;  3SEE A;  4KWU A;  5JI7 A;  1VMF A;  4CU7 A;  3NST A;  1SLT A;  4LNV A;  1AHS A;  4F7Z A;  5FMB A;  1RUJ 2;  2VL4 A;  3LEI A;  4COW A;  2KD7 A;  1OF3 A;  4GUL A;  3ZM8 A;  4FTB A;  4Q0U A;  2Y6F A;  3III A;  3JBG 2;  3T1M A;  1IG0 A;  5A7S A;  2VPV A;  5JPN B;  1S0B A;  4YM1 A;  2K2S A;  2PHR A;  3VBH B;  2AGS A;  5LA0 A;  3ZX7 A;  4IV1 C;  5FZB A;  1FPN 1;  4FTE A;  3ZSL A;  1ASJ 1;  1KFU L;  2HBT A;  4Z1V A;  5T55 A;  2E7Q A;  4MGZ E;  4JDM A;  1KXG A;  1TE1 B;  1FOD 1;  3LDB A;  4LT5 A;  4CCO A;  4Q4Y 1;  1RUH 1;  1C5H A;  1H8T A;  3MW3 A;  5HBA A;  4KU7 A;  2QZ2 A;  3LE0 A;  1ZZB A;  3PVE A;  5D8A B;  5IK8 A;  1HQN A;  2ADD A;  5I0R A;  1BQP A;  5F39 A;  4TZD A;  2WO1 A;  1QJE A;  4XIK A;  5I0T A;  2BER A;  2A5Z A;  2ZTN A;  5GJ6 A;  4HK9 A;  4AHX A;  4AZZ A;  4Z2W A;  1HRV 1;  1ND2 B;  5JI9 A;  1W0P A;  3GXU A;  3VZO A;  5FZI A;  4QB2 A;  5T5J A;  1XYO A;  2EXK A;  4M3C B;  1DYP A;  1TNR A;  2YV8 A;  1HB1 A;  1I3H A;  3K2O A;  4UBH A;  1O91 A;  1UOB A;  1UZZ A;  3GF6 A;  4ZON A;  3PTY A;  2Q8D A;  1WLW A;  3OOX A;  4AI9 A;  5IAV A;  3R4U A;  3I59 A;  4C1X A;  5HV4 A;  1KRI A;  4EN8 B;  2B39 A;  2W91 A;  3POB A;  1MS8 A;  4WM8 C;  5IFT A;  3NKT A;  1O5U A;  2WWU A;  3PVN A;  1C8M 3;  3VB9 A;  3IDE A;  5I8Y A;  2UWA A;  5JOY A;  1H4H A;  2MEV 1;  4AVS A;  4YW2 A;  1W99 A;  1XC6 A;  3AB0 A;  1NQD A;  4RD7 A;  1W8H A;  4IEZ A;  3SIT A;  3U14 A;  1UY1 A;  3O1U A;  1GZW B;  3NVC A;  1U5Y A;  3EO6 A;  3O0X A;  3T09 A;  5D8A C;  3VBR C;  1ZA4 A;  3ZR6 A;  5H9P A;  5LBF A;  2XHK A;  4Y22 A;  1Q43 A;  4CDU A;  2JE8 A;  3GNE A;  2EVX A;  5CU1 A;  4C8D A;  4A3X A;  4XEZ A;  1JHJ A;  1APN A;  4BHP A;  2FZ2 A;  1D0G A;  2WLP A;  3ZMN A;  1HXS 2;  2DUO A;  3IN9 A;  3TEW A;  3G6J B;  4HAN A;  5B4X A;  2WJS A;  4UBG A;  4P5Y A;  5DUU A;  2X05 A;  3ZYP A;  1AR8 2;  3GZT B;  1MPX A;  4FXK B;  5L9B A;  4HK8 A;  4OUE A;  4LKF A;  2WQZ C;  2A3Y A;  2WYS A;  4ITC A;  1FPN 3;  4JGY A;  4P9I A;  4CUB A;  4LKD A;  4K1Z A;  2I2S A;  1YHF A;  5T50 A;  1ULP A;  1VMH A;  5EZW A;  1W28 A;  2V09 A;  4GJY A;  3WNN A;  2R7E B;  2I45 A;  3BKZ A;  2P1B A;  3WT3 A;  2VW2 A;  1PX3 A;  5SV5 A;  2PA7 A;  2W68 A;  4RS5 C;  2VME A;  2VOK A;  1GYK A;  2PLV 2;  3FJS A;  4XF9 A;  3SKV A;  4O7X A;  5AC9 3;  4DS0 A;  5C5U A;  1O3S A;  3MIF A;  1HRV 3;  2ADE A;  3HQX A;  4CEW C;  2OPK A;  1W2N A;  1NXD 1;  4NHM A;  3SCG A;  5LCW L;  1R1A 3;  1DCS A;  3PUI A;  4P9J A;  3WHT A;  4FVV A;  2YZ4 A;  4Y1V A;  3H7Y A;  3DXT A;  5IW0 A;  2VZR A;  3J4U H;  2DCZ A;  3USU B;  4LLF A;  2VTF A;  1AR9 1;  2LAL A;  1O5L A;  4B7E A;  1AX1 A;  2V72 A;  2XDV A;  3ZFE C;  1CAW A;  2RR1 2;  3APB A;  5HCF A;  2PN5 A;  4FPY A;  5FZ3 A;  4RHV 1;  1A8M A;  1J84 A;  1TNF A;  1WBL A;  2VW1 A;  2VNO A;  1SCS A;  3T0B A;  1LU2 A;  4YFZ A;  2VUJ A;  4Y5T A;  4A2U A;  5IVY A;  2VTX J;  3VBO A;  2UWB A;  1LNS A;  3GBG A;  4XIO A;  2ARA A;  5A1A A;  5DPN A;  1AL2 1;  2F4P A;  3VUO A;  1UAI A;  1CON A;  2QQJ A;  1WD3 A;  1OVS A;  2ZHN A;  3C7O A;  4BQ1 A;  2GME A;  1ZZ6 A;  3W58 A;  1UU5 A;  1VBA 1;  4FOY A;  4Y1Y A;  3WP5 A;  1RMU 2;  1X50 A;  1NZI A;  3U37 A;  3UGF A;  1XPW A;  3OTF A;  5CKN A;  1J3Q A;  3MV0 1;  1LHV A;  1C3H A;  3H3L A;  1WGP A;  4MGQ A;  3H1M A;  1WD4 A;  1QJX 3;  4A7Z A;  4QX2 A;  2PLV 1;  4MXW A;  4CP1 A;  3C8X A;  2VCM A;  5HV0 A;  1JUH A;  2YU2 A;  4N43 C;  4NRM A;  4LBJ A;  2MHF A;  3A22 A;  3BTZ A;  3K46 A;  3NWK A;  4NPM A;  4AFC A;  1S0D A;  5FZ7 A;  5A7N A;  3OEB A;  1WCD J;  4XJ9 A;  5BNP C;  1NOV A;  3AJZ A;  3VZJ A;  4FXG B;  4IEP A;  2CAU A;  1SFN A;  2FZ1 A;  4J6G A;  1QJY 1;  1NT0 A;  2Y60 A;  4W8J A;  4QDS A;  2WZP P;  3AMP A;  2GH2 A;  1F9K A;  1W2T A;  3IT8 A;  4QPG B;  5E16 A;  5BUV A;  5F37 A;  1W3V A;  2W9X A;  4JDO A;  2HYK A;  3AP4 A;  1X9P A;  3FUO A;  1TME 1;  1WCQ A;  4FFH A;  5GLU A;  3V64 A;  4NAM A;  1G9C A;  1MEC 3;  3J8F 2;  2D43 A;  3FHI B;  4ONU A;  4DRV A;  1W9Y A;  3NO8 A;  4QWN A;  1RED A;  4E27 A;  2Q8E A;  2VMG A;  1YIF A;  2KA3 A;  2KR2 A;  2ZGU A;  3POJ A;  4WVZ A;  3MF6 A;  5DUW A;  1ND3 A;  3WG1 A;  4F3J A;  2JDH A;  4BK4 A;  3B3Q E;  5F5I A;  1PGW 2;  1GKB A;  4IE4 A;  2P17 A;  1CJD A;  5FUI A;  2GC0 A;  4Y20 B;  1ZRE A;  4DNY A;  2DBN A;  1MVQ A;  3T2T A;  3UK9 A;  3N7K A;  4OQ9 A;  3GHM A;  1GZC A;  1RMU 3;  2Q0A A;  4RGK A;  4Y5S A;  3U78 A;  3C7H A;  4OI1 A;  2JB8 A;  2OS2 A;  1W2O A;  4HL0 A;  4EN9 B;  1HQL A;  4MH0 E;  4LUL A;  1RUH 3;  2P3I A;  1NE6 A;  3FZ3 A;  4RHV 2;  2WAB A;  4BQ4 A;  4AI2 A;  3WCR A;  4UAP A;  1GWM A;  1S1A A;  4XUQ A;  3USS A;  1K42 A;  1UXX X;  2XGX A;  2E6V A;  3T4V A;  1CAV A;  4BME A;  2P3Y A;  4JGZ B;  1GUI A;  3THP A;  4HKW A;  5IK4 A;  5H9Q A;  5FZ0 A;  4O9G A;  3TN9 3;  2A6W A;  5C4W A;  4CDQ B;  1VE0 A;  5LRS A;  2G4I A;  1YNA A;  3PJQ A;  1FT9 A;  2V4A A;  5FZ6 A;  1IGO A;  1VRH 1;  3WNP A;  4GWM A;  4TWT A;  5J48 A;  4B8E A;  3FWE A;  1WUV A;  4XUN A;  2RR1 3;  1WLT A;  1YYN A;  1KS5 A;  2DCT A;  3GBF A;  3IBM A;  2DUQ A;  1WKY A;  1K3I A;  3GDB A;  4LBO A;  2WO7 A;  1V00 A;  2RE9 A;  3DEM A;  5FP9 A;  3MIC A;  1FMD 2;  2ZA9 A;  1G8W A;  4S2G A;  2F17 A;  2WS9 3;  4Y20 A;  4BWO A;  5A3N A;  4G3Y C;  3VL8 A;  4IQP A;  4RFT 0;  4OFG A;  4Y5Z 0;  1MZE A;  4AED A;  2JDU A;  4QKB A;  3WNL A;  1A3K A;  2C6S A;  2RV9 A;  4I01 A;  2OZ6 A;  2GH8 A;  5C9A B;  1LED A;  1LEM A;  1XNB A;  4JGZ C;  3PVO A;  4GMP 3;  4QPG A;  3AP5 A;  4RL7 A;  5H9R A;  2YY1 A;  4Z2A A;  1WA6 X;  5EYY A;  1W6O A;  3AFK A;  3E6C C;  1IS3 A;  2ZAA A;  1XJA A;  4HN0 A;  2YUE A;  4NHY A;  4AW7 A;  1DLC A;  3LA3 A;  3P1I A;  4QGL A;  5FMC A;  4P9X A;  1FYU A;  2RDN A;  4N53 B;  4JTN A;  5FQ0 A;  3VDB A;  2Z79 A;  3ACG A;  1GZW A;  3VBR A;  1AR8 3;  1LGC A;  2QUO A;  1PZ9 A;  1Q8V A;  2R06 3;  4LBK A;  2RJK A;  4I3G A;  5A33 B;  5JXH A;  1R64 A;  3PUR A;  2PHT A;  3TYJ A;  5IVV A;  1CIW A;  4I09 A;  5C8C C;  2HLE A;  2JG9 A;  2H6B A;  1VBD 2;  2A3X A;  2DFC A;  2Q5T A;  3L2H A;  3NNM A;  4URA A;  1WCS A;  4YVW B;  4LR4 A;  3HT1 A;  1S0C A;  4FQZ A;  1ULO A;  2WC2 A;  4YW7 A;  4MGS A;  1ULC A;  2VQU A;  4BQ5 A;  3MW2 A;  1NYW A;  4XPV A;  1S2B A;  4S2H A;  1XSQ A;  1OOP A;  4BIO A;  1UO9 A;  1WCK A;  1XSR A;  1VBE 1;  1ZRD A;  3J9S A;  1QU0 A;  2QQO A;  3RDI A; 
#chains in the Genus database with same CATH homology
 1Y9G A;  3S5Q A;  3UGF A;  3PIG A;  5FKC A;  5FMB A;  4CCD A;  4FFH A;  3UGH A;  3RWK X;  4FFG A;  5FKB A;  3ZR6 A;  3H3L A;  5FK8 A;  1Y4W A;  4QHZ A;  5FIX A;  4CCC A;  2AEZ A;  3KF3 A;  3LFI A;  4UFI A;  3U75 A;  3U1X A;  2QQW A;  2AEY A;  2ADE A;  3LEM A;  3LF7 A;  1ST8 A;  3UGG A;  4B1L A;  2QQV A;  3SC7 X;  4JQT A;  4AZZ A;  2XQR A;  3NMB A;  3LIH A;  4B1M A;  4UFM A;  5FMD A;  4UFJ A;  4UFK A;  3OSD A;  1Y9M A;  4UFL A;  3IMM A;  5FK7 A;  3LDR A;  4UFH A;  3PIJ A;  5FMC A;  2OXB A;  3LDK A;  4FFF A;  1UYP A;  4CCE A;  3U14 A;  2QQU A;  4FFI A;  2ADD A;  1W2T A;  5ANN A;  3ZR5 A;  4EQV A;  3KF5 A;  4HXC A;  3LIG A;  3HBK A;  2AC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...