3S5QA

Crystal structure of a putative glycosyl hydrolase (bdi_2473) from parabacteroides distasonis atcc 8503 at 1.85 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
213
structure length
213
Chain Sequence
GSDKIHHHHHHENLYFQGYRPLFDKDLSNADYDSSVWTFKNGILTATADQSIWTKVQYENFILDLEFKTDVNTNSGVVIYCTDKGNWIPSSIEIQIADDHHPEWQSYPEYWRCGSIYGHKGANEQLVVKKPGEWNRMIITAKGQQIDIELNGKHIVSANLADWTSGTTNPDGTEIPEWLPIPYANMPTKGYIGLQGKHGESNIWFRNIQLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative glycosylhydrolase
publication title Crystal structure of a Hypothetical Glycosyl hydrolase (BDI_2473) from Parabacteroides distasonis ATCC 8503 at 1.85 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Hydrolase
total genus 57
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2011-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 3s5qA00
3S5QA 1Y4WA 2AEZA 5ANNA 3KF3A 3LIGA 3NMBA 5FK7A 4UFMA 4FFFA 4UFLA 4AZZA 4UFHA 1Y9MA 3KF5A 2QQWA 3U14A 1ST8A 5FK8A 4FFGA 5FKBA 4HXCA 3HBKA 2QQUA 3H3LA 1Y9GA 4JQTA 3PIJA 4QHZA 2XQRA 4CCDA 4FFHA 2ADEA 3LFIA 3UGGA 4UFKA 2AEYA 5FMCA 3IMMA 3ZR5A 1W2TA 1UYPA 3LDRA 2OXBA 3ZR6A 2ADDA 2AC1A 3LIHA 3U1XA 3RWKX 3UGFA 3UGHA 4B1MA 5FKCA 5FMDA 4FFIA 5FIXA 3PIGA 5FMBA 4CCEA 4UFIA 3SC7X 4B1LA 3LEMA 3LF7A 4CCCA 4EQVA 3LDKA 2QQVA 3OSDA 3U75A 4UFJA
chains in the Genus database with same CATH superfamily
4UXAA 3ZSMA 1GQHA 4TLFA 5FUPA 1UMIA 4HBNA 3DYPA 4AZZA 1J83A 1EAH2 2VH9A 1WA6X 1UAIA 5J96B 3BKZA 5JOYA 4CCDA 1OKQA 4I30A 4NHKA 2A1XA 2VZVA 2XJPA 2W46A 4U2AA 5FY1A 5FP4A 5AC93 5FWJA 3RYPA 4TSVA 3BGAA 5JOWA 4AAPA 3RZZA 4E8CA 2XONA 3AVSA 5KBFA 3QOPA 3UGHA 1I6XA 1O8SA 3EHKA 1V6KA 1APNA 1MZEA 2XMLA 3IWZA 4YM0A 2Q8OA 3TNQA 3A4UA 2IXLA 3T0AA 3SC7X 2FDKA 1W99A 4CCCA 4EQVA 5FR3A 1W8HA 2VW0A 3VDBA 2VY0A 3VHPA 1ZNPA 3T1MA 1ZREA 1LAJA 4LIUA 1LOBA 1NE6A 1V6JA 3LWCA 2D5HA 5LB6A 2JIJA 1QDOA 3E5XA 1RYYA 4LE3A 5FY0A 2HWD2 2VCBA 3BU0A 3GBFA 2XHNA 2D3SA 2W47A 5HI0A 3RS6A 2YROA 2BW8A 3JUUA 3O7OA 4UF0B 5JPNB 5HPOA 4K3UA 4JDMA 4JKKA 3WR0A 2TBVA 2E33A 3H7YA 4WVZA 5LK7B 4NN0A 1BCXA 3MDPA 4KGQA 1VB2A 4NHYA 3IIAA 2JICA 2QVSB 4L8QA 4XFGA 1WMXA 3HQXA 4RA0A 2R043 5GZFA 1QJZA 4AEDC 4CVUA 1H0BA 3KGZA 3GXUA 2D7FA 4AEDB 5A6YA 4HPKA 1N3QA 2VTXJ 1Q56A 1J3RA 3VKOA 1CONA 1SFPA 4O65A 1R093 3FUQA 2W9XA 1W06A 2X8KA 1Z0HA 3NL1A 1I5PA 2J1SA 4AFBA 4BCUA 3V0AB 5F6KA 5CFCC 2X05A 5FBJA 1K3IA 1OA3A 5AC91 5CFCB 1DZQA 3LOBA 2Y26A 2TEPA 3IPVA 5FYBA 5AFBA 4HMZA 2CDPA 4XBQA 5FZBA 5C9AA 2D6PA 2XB6C 5EIYB 1JYXA 1CAWB 1MPXA 5GALA 1GV9A 4KWUA 4D0QA 1WCUA 3GGLA 2G9ZA 2RDQA 4AK3A 5FKBA 5FZ3A 1LNSA 2B9UA 2NMNA 4XFHA 3WG1A 3MF9A 1O4YA 2EIDA 1US3A 2VUAA 3MLJA 4Y26A 1YFWA 2PFWA 3W20A 4A44A 3BOWA 4I01A 3WCRA 1H8TA 3QD6A 3SMHA 1XSQA 1AYM3 2GAUA 3BTAA 1EYBA 4DY5A 5IVCA 5FPZA 2GC0A 3UL2A 1VBB2 1VBA3 3C7FA 2QNKA 3M1HA 1IS4A 1LR5A 3CLPA 3QH7A 5FZKA 4Z2AA 4OZXA 3PL0A 1IHMA 3DEMA 3G7DA 1WW4A 4Q4W2 4NOTA 5AVAA 5FTTC 1NQDA 1VJ2A 3ZVXA 3L2YA 3BUCA 5DAVA 5LRSA 2NMOA 3MV11 2ZABA 2MNGA 2Q1MA 1UOFA 1RUOA 2WFPA 4P9XA 1IKPA 2HWE2 3KV4A 1W3VA 3HVDA 3WV6A 4OI0A 2D3RA 2R041 2RVAA 3NV3A 4Y4RA 1W6PA 2RE9A 5F5CA 1CR7A 1QNWA 3PLQA 5FZ9A 1N1VA 3ILFA 3FMGA 4FOYA 4QQHA 5DQ0A 1O5UA 1OUXA 1K5MC 4Y20B 1YIPA 5ACA3 1LULA 1C4RA 1JUHA 3PIGA 1SLLA 1K5MB 1R091 2W08A 4K8RB 4DUXA 2Y8KA 2PHDA 2R0HA 1X33A 3I49A 5LY2A 2WS93 3C7HA 4UFJA 2JD4A 1HJGA 3LEKA 2CTVA 5KHHA 1NCQA 1W8OA 4QKNA 3I4IA 1UX6A 1IKQA 4YW4A 1XXNA 3KF5A 2XXZA 5FZ7A 2IUWA 3KCXA 4A3ZA 3O1RA 1NE4A 1LB2A 5FYMA 5DUWA 5C71A 5C3PA 1OD5A 1NAEA 1VMHA 4ORFA 2A3XA 1MQTC 2RS51 2VG9A 1PIV2 1PVC3 3J7LA 2RJLA 3POJA 5KXDA 1MQTB 4ASKA 1UWWA 1SBDA 5KWRA 4NJ4A 1YJLA 4H3WA 4RFT0 1F2NA 2WWUA 5JI9A 3IZOA 1AYM1 1GWMA 5FDBA 3SLIA 5JAXA 5K0UC 3WDTA 1EPWA 5E1RA 5K4LA 2A6ZA 4KU8A 1D2QA 1WD3A 1VBA1 3ACHA 4K7JA 4PDWA 4YNIA 5HCHA 4FPGA 5K0UB 5FK8A 3EXUA 4HXCA 4IGPA 2P5BA 4LBQA 1W6MA 2CL2A 3CU7A 1GP4A 4XF1A 1ZBA3 2YZ4A 2YV8A 2DBNA 4LKSA 3VL9A 1G9AA 3P5BA 4MXWA 2BERA 1MVEA 1OQ1A 2QCSB 2WYFA 4W8JA 5IVYA 3TEXA 1PX4A 2CHHA 1JS9A 2VAUA 3O12A 3FHQA 4XUTA 5F3IA 1NLRA 2VZ1A 4CXWA 1AUYA 2VGDA 2I07B 3S7IA 2GN3A 3K3OA 4JX0A 2YBPA 3ZYPA 2ZEWA 2TNFA 1UPIA 5IK8A 4XC9A 2DU1A 3FE5A 1QU0A 3THCA 3N9MA 3VBFA 5ACA1 2PHUA 3OBRA 4YW2A 3WT3A 5C5UA 4OI1A 1JHNA 2DUOA 3HBKA 5D8AC 4DPNA 1DF0A 1KDKA 4F83A 2WS91 2RDRA 2QQLA 3I2IA 1VR3A 3GM8A 4Y33A 5D8AB 1PO13 3R0RA 4AGRA 2WBKA 5LY1A 2VUJA 1GOGA 3HMYA 3UETA 1RIRA 3LIHA 1S0IA 1NZCA 1PNFA 4GH4C 5FPLA 1LJ7A 2BWCA 2E26A 2FZ1A 3IAPA 4NVPA 1CJDA 2BV4A 3MHZA 5F8PA 3WDXA 2GU9A 4GH4B 2HWC3 5FXWA 2G19A 3UKNA 3O1OA 2ZEYA 2C26A 5SV8A 2XJSA 1R64A 1Q3EA 3I7DA 1VLNA 4XFCA 4FOVA 2YXSA 1PVC1 3OUJA 4YWAA 2VXRA 2VJXA 3BIWE 1JOJA 1N1YA 2ZS6B 3AMQA 4PIXA 1ULEA 2L9LA 5IFTA 4QKFA 2PHXA 5GKAC 3MPPG 4XF9A 1W8FA 1L3JA 2QQUA 4LR4A 2RMU3 3GYDA 2HYXA 3WNLA 5C3QA 2XR4A 1MVQA 2VOWA 1XYNA 1RUD3 4C0HA 5JPMB 4RR3C 3AL5A 5DUVA 4KH9A 4RL7A 2X53S 4K20A 2Z79A 1GUIA 2JB8A 1ZBA1 2WWSA 2VR4A 4RR3B 3VKFC 3ZFGB 4LT5A 2WT1A 3LDKA 1WZXA 1QDCA 5IAXA 5AC92 2B5HA 1XNAA 4AI9A 2IXCA 2P37A 4IV3C 4RGKA 2VNVA 3AYEA 2D44A 5F39A 5KC6A 3POWA 4Y5Z0 4IV3B 4NAOA 4COYA 4WM7A 3P6BA 3AKSA 3LA3A 2VQTA 2C1FA 4BQ4A 3SCFA 3RMYA 4PI0A 3DECA 1ULPA 4YG0A 1ULDA 2E7AA 2GMPA 2WO3A 3USSA 2JX9A 4IEWA 4OQ9A 4AEJA 3O5SA 4CA9A 3URFA 1W39A 4N53C 3AJZA 3UK9A 5K7PA 1B09A 4N53B 5FO9B 2OYZA 1PO11 2Q1ZB 3W9AA 2OX0A 3CIHA 1XNCA 2B7YA 4R8HA 3ATGA 1OT5A 1CIWA 3AP4A 5FQ0B 2AENA 3ES1A 4XHXA 2VVEA 2HWC1 2IXKA 4QPWA 4YZ5A 2EAAA 4QPGC 3U14A 1JOPA 5JSOA 2DVBA 2WZPP 3U78A 4QPGB 3PHMA 1DLCA 1H8VA 3PVNA 2AACA 2UURA 4IETA 4OCTA 2E9QA 4NAMA 3WHTA 4N7UA 4XFAA 1F9KA 2R042 3MLKA 4CDXA 4K9SA 1O8PA 1ND3C 1VALA 2DU0A 1I3HA 1OURA 1POQA 2RMU1 1QXPA 1GMMA 1FATA 1ND3B 1Y7BA 2VMGA 3A0KA 4Z07A 5EWSA 5LEJA 3BALA 5JMOA 4GWNA 3I97A 1PM7A 1OD3A 1R092 1RUD1 3EB7A 3Q8AA 1IG3A 3HQRA 4QDQA 4WM8A 3T2QA 4B29A 1HB1A 1OVSA 3B00A 2ZX2A 3VBFB 1UKGA 2Z2SB 5IUQA 3OEBA 1NCRA 4BISA 3ENRA 4YPJA 3Q8CA 4KWJA 1H2KA 3AMNA 3IKWA 3MW4A 5GLZA 3JZVA 2JG8A 2WWJA 2R063 1Q8QA 1GNYA 2BWAA 4PBPA 1QOOA 4AQ2A 5A3UA 4ASMB 4F7ZA 4Q4V3 3ZFFC 1VE0A 4IEUA 2RS52 2JENA 3LSEA 3AXDA 3ZFFB 2R1BA 4AVSA 2VZPA 3WD5A 2GMEA 4CP2A 2BBAA 1W9SA 4OHWA 4ZS3A 5IWFA 1PZ8A 4ZU5A 1ZYBA 3RZGA 4UFLA 1GQPA 1AYM2 4HKWA 1H1IA 3LCPA 3IT8A 1VBA2 3MV01 1DFQA 1UYZA 4DXSA 4KNCA 4P9JA 1UKRA 5J09A 1RUI3 2V73A 1VMFA 3H3UA 4A6SA 4LBKA 3ON7A 3DKQA 1HW5A 4GIQA 2W39A 4P00B 2ZAHA 5LZ6A 1HQLA 2GNDA 3FUOA 4QHBA 3SKVA 4Y1ZA 4IGOA 1LOFC 1XQNA 2D93A 4N9HA 1ENSA 5L73A 4AGGA 2GDFA 3VDDA 5JOXA 3VBOA 4XABA 2XVKA 4HVRA 4AVVA 1SDDB 4FPFA 1H2MA 1W2NA 2PHTA 4NHLA 1JN2P 1VB4A 1C1FA 1ENRA 3L2HA 3ZSEA 1X8MA 2LS6A 3WDUA 3BTYA 5ACA2 1JZ3A 3H42B 2C9KA 2Y6KA 4CEYA 1L7LA 4YZ3A 2QFEA 2YYOA 3B3QE 3KV9A 1XE8A 3IDEA 4CEWC 1VBD3 3MFAA 4QB1A 2WS92 1RHI3 5I8TA 4CEWB 4OI2A 5G05L 3ZYIB 1DQ6A 2BEOA 3BPZA 1AHSA 1IPKA 2JWPA 2GH8A 5A7NA 3T3YA 2UY8A 3ZXGA 4FPJA 4CUBA 4KMQA 5IATA 3RZJA 1BBT3 3FFQA 4ZPIA 3S6PA 2JDKA 3R6SA 2XQXA 3K4AA 4I3PA 4ES8A 4QAWA 2P3KA 1CGPA 1OSGA 4F8AA 2RG4A 4AEMA 4AYUA 4Q4V1 4AI3A 4JHTA 2VW1A 4LK7A 1PVC2 1ZVFA 3NAPA 2Y6LA 2P17A 3NV4A 1AR73 1U0AA 2XWBB 3H0OA 4QM9A 1P8JA 2RV9A 5LBBA 2BFUS 3LPFA 1H1MA 3OTFA 3LE0A 5AVPA 4D6SA 5EHDA 5A3PA 1UZVA 3AZXA 1BVP1 1OFNA 3VGIA 4AVTA 3VZKA 3I3MA 3TEZA 2VTXA 4LO6B 1OF4A 3WLUA 2CAUA 3ZR6A 2OPKA 5FY5A 3AZYA 2QJVA 3WHUA 3THPA 4HZFA 4ZZ5A 4JKLA 3POIA 2Q1FA 3VBHA 4I3GA 2WJSA 1CZVA 1ODMA 3HN3A 1UX7A 4I02A 2ZZQA 3NJXA 5LBFA 5JIAA 2JDHA 4L92A 1RUF3 3P3PA 1RUI1 1ZBA2 3K2OA 3ZXLA 4CDQA 1QXJA 3OY8A 1ULFA 3S5QA 4YM3A 3RDIA 3ZN6B 4Q0VA 3CL1A 4JRAA 4X6QB 2VC9A 4E9KA 3U4SA 4AI2A 2YFUA 1OQEA 5CKQA 1CJPA 1HIXA 5A7OA 3APBA 3SH3A 3NQHA 3QCWA 4DXRA 5C70A 3GZAA 1LOEA 3K51A 3M8LA 1CPMA 2PMWB 2R073 1UZZA 5LBEA 2C5DA 3T2TA 2LM3A 4KQ7A 4XIOA 1RUJ3 1TMF3 2K0GA 5CVRA 4OHZA 3E6CC 3AL6A 2YBKA 2Z69A 4RYDA 4AR2A 1VBD1 2W1WA 2WKKA 2E63A 1RHI1 2DWRA 4YM1A 3MZHA 1GR3A 4S2GA 1PO12 2BTVC 5ABJA 3WG3A 3JQWA 2PTMA 1HLCA 2GC3A 4IUGA 4FFFA 1E57A 1SPPA 1PK6C 5C8CA 1BBT1 1F31A 4GB33 1PK6B 2HWC2 3KT7A 3RI9A 4XILA 4C1XA 1YI9A 1KS4A 2FCVA 3KS7A 4G4FA 4I0BA 5IVVA 2IC1A 5F37A 4C0BA 2C6SA 2IFRA 3HPNA 1OLRA 3PUSA 1CAUB 4EROA 1AR71 3M2MA 5CBLA 4UW3A 2P4EA 2FDJA 2CYFA 2P6HA 3OBZA 4PHZA 4Y1UA 2RJKA 3S30A 2WNVA 5FOJB 4OQ8A 4NIHA 4RS5A 5FZOB 2O1QA 2DBIA 4IDZA 3WUDA 3BI3A 4LA3A 2O8OA 3FN9A 1DLLA 2RMU2 5HV4A 1CAXA 1IS6A 1Y43B 2E32A 5F3GA 4BQ2A 1FYUA 2VO5A 1BZWA 1KITA 1XNBA 4AVCA 1PGW1 2UU8A 2X09A 3X29B 3OOXA 1RUD2 4OI4A 4E4ZA 1AF9A 2GNBA 2WZEA 4AAXA 2E51A 4D6RA 4CU6A 1RUF1 3QH6A 3RYRA 4LPLA 4BK5A 2HLEA 1D4VB 2ZKNA 3I3QA 5DZEA 3WDYA 3HIFA 3WQBA 4ET7A 4KGGA 2VUCA 3SHRA 4DXTA 4URAA 1STMA 1DZRA 1SQ4A 3AKQA 3BCWA 3GCWA 3HT2A 3MIEA 2WL1A 4N8MA 5FJKA 3VZOA 1JOBA 4L99A 3S5AA 1NLSA 2Q4SA 1LGCA 5L36A 4YFWA 3M70A 2R071 4IV1C 4R4ZA 5FPUA 2NQYA 3ZFEA 1R083 1E5IA 4IV1B 5FYHA 4CP1A 1RUJ1 2N7GA 1TMF1 2W1QA 3U07A 3ZXEA 4NIDA 4JDOA 1UXXX 1RINA 4RSUA 5LK5A 1VPHA 3SQOA 4W6WA 4AQSA 4HSJA 3ZDVA 5I93A 1WMFA 3NVCA 2BGPA 3QBQA 2EA7A 2CWSA 3WCSA 1X50A 3AYDA 2X5IC 1F15A 2WFF3 5A7PA 5FPVA 1O3QA 1BYHA 1OLMA 1V70A 2X5IB 1QEXA 4GB31 5IAVA 4NMIA 4FXGB 1ZRCA 2VBPA 5FO8B 1WW5A 3LQCA 4QPIC 1SLTA 1G86A 3FHIB 2BUKA 5FPBA 3D8CA 4UFIA 4AOCA 4HL0A 2DDUA 1XNTA 2XKPA 4Q26A 5JIUA 3OSDA 5A7SA 3TBDA 3A21A 3AYCA 3ZXKA 1S0JA 2MPFA 5FY8A 3BU7A 4AHXA 4CP0A 4CDUA 2O0OA 1U12A 5E6HA 1AX0A 2BVVA 3AFKA 2ZOEB 3D0SA 4YW1A 1UF2C 3WP4A 4CCLA 1FV2A 1Y9GA 2ZHMA 3WNNA 1NG0A 4N43A 5DZFA 1WLTA 1VRBA 4XFFA 2VZUA 4HETA 3LEIA 1GP6A 4QGNA 3GHMA 1URXA 3OEAA 5J98B 4EN0A 3MUY1 1RMU3 1O4TA 3MICA 5CG8A 2JEMA 1LOGA 3DXTA 3V0BA 1GOFA 3D5OA 4L97A 3RZKA 1JMUB 1HDKA 5GZCA 1F5JA 3WW2A 3AM2A 5L7OA 1XE7A 1QOSA 3AZZA 1AL0G 1REEA 3VZJA 1BLZA 5F32A 5CFDC 1W6NB 4Q4V2 4YGEA 3DN7A 3B69A 2Y33A 1LGBA 1TQ5A 5CFDB 4H55A 4YRDA 1R081 4A6OA 1KFUL 4KL1A 5FMCA 2WR9A 4Q1PA 3ZYJB 3ZO0B 5I0RA 5FYIA 3H8UA 1TME3 2J1AA 2F6BA 1AR93 4XTMA 1LHVA 4Z92B 3KQRA 4BZ4A 3S57A 1SMVA 2JDAA 1VIWB 2ZACA 1WMDA 4BB3A 3ZN5A 1S4CA 2YBSA 3BOPA 3FLTA 4AGVA 5JXJA 2WFF1 4BDVB 5BYNA 4W6YA 2D6OX 2VMDA 3T2PA 3S7EA 3ZLIA 3LSDA 4IERA 3RZLA 4BMEA 1OBNA 3D0JA 4HK9A 4MHUA 4P9GA 1RUI2 4XURA 1X9TA 4NIIA 3BIEA 3T1LA 3FX3A 5ANQA 5J36A 4ATFA 2JIGA 4QHZA 2QZ2A 2I74A 1KJRA 2GP3A 4I09A 4SBVA 4W65A 5FYTA 4E27A 1SEFA 4HN0A 1QJEA 4PCRA 1HRV3 3FC0A 4DO0A 1YXWA 4U36A 5HXVA 2ZMLA 2VXJA 5DG1A 2ZGMA 3HAGA 2E6VA 1QJFA 2MEV3 3NWKA 1GZWA 3SCHA 1JYCA 2QBXA 5DUUA 1LEDA 4FPCA 3PUQA 4A4AA 4M3CA 4FCAA 3OGRA 4S2FA 1RMU1 1U5IA 1VBD2 2BJSA 4LBLA 1WD4A 3NMBA 1RHI2 2WLPA 4YW6A 2VOTA 5CB7A 5KHGA 5FPAA 3OPZA 3VN4A 4N9IA 4YGCA 5IK7A 2Y64A 1W9YA 3WY6A 4AHZA 1GQGA 1MS5A 3VB9A 1WLDA 2BNNA 4LULA 3PU8A 1BBT2 1LENA 3DPRC 4RHV3 3IDAA 4JRLA 3WP3A 5ISLA 4EWEA 1TEIA 2ZTNA 1AJOA 2SBAA 2WO2A 3ACGA 3DPRB 2XLFA 4IQPA 4O7XA 1LGNA 1SG3A 2HEWF 3DXUA 4YW7A 5FZGA 5TSWA 2YHJA 1GZCA 3MIDA 1OMIA 5FMDA 1POV3 3IM0A 4BYYA 2NZ9A 1JW6A 4Y4YA 4QX8A 5FFOC 1XYPA 4CP9B 4S2HA 4L2NA 1AR72 3WNPA 5IVFA 4OFGA 3MIGA 1OLQA 2EICA 1OFSA 1DGWX 1B35C 3ZSLA 4AVBA 1TME1 2BZDA 1MEC3 1AR91 1NUKA 2UYAA 4WVMB 1B35B 1X82A 3ORJA 4Q27A 4RQPC 4LO7A 4G9SB 4YG6A 2Z4FA 1BHGA 1PGW2 1ZZ6A 5T5PA 3ETQA 4RQPB 4K8FA 2WQZC 4P9WA 5DAWA 2XQRA 4NROA 2W94A 3IIIA 1RUF2 4CDWA 3OJBA 5BV6A 5L9VA 2VQUA 2OZJA 1ASJ3 1NLQA 3UGFA 2H0BA 1QQP3 2XJRA 3G6JB 2Y60A 3EBRA 4IEQA 5FO7B 5JWPA 1WA4A 2HBUA 3POYA 4DQAA 5H9QA 1ZM1A 3WZ1A 1HRV1 3EYPA 1T6BX 2VMIA 4QPYA 4Y1VA 1DDLA 2R072 5GZGA 1UD1A 3OCPA 2QQNA 4Q1RA 4COVA 1RUJ2 2MEV1 1TMF2 4ARXA 4CDXC 2RS53 2V09A 1O7FA 1RUC3 2D6MA 2EIGA 4E8DA 5CG9A 2ET7A 4MGIE 2BFUL 4WBBA 4XJAA 2RDNA 4BH9A 5IFPA 5LCWL 2PHFA 1ZBE3 2JDNA 4LHNA 4XUOA 3T09A 2FZ2A 2E7QA 4B7KA 2Q8DA 2UWBA 3VBSA 5C3OA 5A32B 4FPOB 1YIFA 4GB32 4RHV1 4GWMA 1CQ9A 4KWKA 1IOAA 2BVBA 4YSFA 1W8UA 2HBTA 3U75A 1OQDA 3FFZA 1HB3A 1POV1 1QJX3 3H50A 3KF3A 3OD0A 3PU3A 4Q0UA 5EZWA 4EYUA 1Y3TA 5FMOS 5BNOA 5DN2A 2CNAA 1UY2A 1ZZBA 2DCZA 2W92A 4HVOA 4OHVA 4BOWA 1WUVA 4P14A 1MEC1 5FRAA 5FLJA 2AEYA 3CBNA 5HV0A 3V64A 2FCTA 2GNTA 2PAKA 1XB9A 1UN1A 2V4VA 2JDUA 3VD3A 1WWYA 2YG0A 5FKCA 4FSJA 4NRQA 4XMIA 3AKTA 3LDBA 1H9WA 3NKGA 2YY1A 4KWLA 4XJ8A 2EF6A 3ZXFA 5JZGC 4P9IA 3DYMA 1V0AA 1IZ3A 1HRI1 3BVCA 4GA9A 1ASJ1 2J7MA 4FQZA 3PVOA 5FAXA 3TN91 3JU9A 1QQP1 5JZGB 4LBMA 3KD4A 2PLV3 2VD7A 3M3CA 1MS4A 1QMJA 1S0EA 2F17A 1H9PA 2XLAA 5JSPA 5A1FA 4Z1VA 1SZBA 3PMEA 4BWOA 2D97A 3ZPYA 4C1WA 5EJ1B 1RJ8A 2HEYF 3ZSJA 1UPSA 2LW8A 2VOXA 1QXRA 3DGTA 4LO8A 1SLBA 3H7JA 3WSOA 4QXBA 3B5LB 1R082 3U4XA 4J1XA 5FZDA 4LKDA 1RUC1 2ZX0A 5FZ0A 4AWDA 3JB4C 3WX5A 1GWKA 4UF0A 1NA1C 5C4WC 1LTEA 2CWMA 3RNSA 5CYYA 1NA1B 4IE4A 5C4WB 2I45A 1ZBE1 3FL7A 1VP6A 4MH0E 5F2SA 5FP8A 3TRSB 2R1DA 1S2KA 2WFF2 3H1WA 4CE8A 2JD9A 2ZGNA 2A7AA 5A3OA 5F9TA 3POGA 2NN8A 1NZIA 2P1BA 3PJQA 4GULA 4EWAA 1AX2A 1W0NA 5A6QA 4AEDA 5FP9A 5KHJA 1FOD3 5GZDA 1QJX1 2JKBA 3H9AA 3IMMA 3NSTA 1NX9A 3VZLA 5C5TA 4A41A 2J1VA 2ZPXA 3TOJA 4Y22B 4ZU7A 2EIEA 3E1F1 2OUJA 5EJ3A 1W0PA 2R7EB 4OMCA 2W5FA 1AR62 4OMDA 2KR2A 3I2DA 4WZCA 1CWPA 2VCCA 1WGPA 1V6MA 2VZ3A 3C7GA 3MIHA 4RN5A 4OHYA 2CGOA 2VOVA 5CFCA 3UKTA 2VZQA 2VBBA 1JZ7A 3MGUA 4QQ2A 3NKTA 2OKXA 5HCFA 1CAWA 1RMU2 2PAEA 2IWGB 1WKYA 2ZGKA 4ZXEA 2BP6A 1KS5A 1PM4A 1FT9A 3MLLA 4NO4A 3O1UA 1BVVA 2PLV1 3C3VA 4QQOA 3NNGA 3AVRA 5J1XA 1O59A 3PVEA 2G9GA 5CIRA 3P3NA 4UYBA 4YM2A 3ZN4A 5KR7A 1EY2A 4JTOA 2VECA 4LOSA 2WO1A 4NIGA 3KQ4B 2OA2A 4SLIA 2XL9A 4R9CA 2VULA 1F35A 3ME2A 3KT4A 2WZ8A 1Y9QA 5KHKA 4UW4A 4MYEA 1HX6A 2JG8C 3UYJA 4B4RA 1TME2 1AR92 2WAOA 3WF4A 1O4ZA 1OA2A 2JG8B 4XTPA 5D2AA 4FAGA 4CTEA 1HJFA 3AMPA 1XJAA 2YFZA 3HNMA 1U5XA 4P9LA 2G1MA 1NY71 4UT5A 3C2UA 3WINE 2W0XA 4YGDA 1UMHA 2WNEA 5LWBA 1PZ7A 4Z2WA 2FD8A 3RWNA 2XUEA 3LB9A 2QQOA 3KVAA 4FQ4A 4QGLA 2I2SA 1O3TA 2A5ZA 3ZFGC 1FPN1 3ECQA 3LKJA 4M00A 1FOD1 5BNNC 5T3NA 1PMIA 4Y20A 5IJRA 5BNNB 4CCNA 4XFBA 2D43A 1K5MA 1LU2A 4NHXA 1PO23 2PQQA 3UNPA 4DIQA 1MS0A 1HRV2 4BQYA 4E4HA 3BTXA 2RHPA 4HT1T 2ZGPA 3VV1A 1UY1A 4Q29A 1CAVB 2CU5A 4YVSC 2E53A 3ACFA 1V6LA 3IAQA 4LBOA 4DEVA 2BYVE 1MACA 4YVSB 3SISA 1C5IA 5I8SA 2MEV2 3LFIA 5FWEA 2Q8EA 3RJ2X 3NNMA 4QHOA 1V6IA 4XVHA 4PLNA 4LXLA 5EXOA 1REFA 4XEZA 2ZGUA 5DAXA 2Y0IA 2Q5TA 2WUHA 1GSLA 1VBE3 2XBO3 5A70A 3DUIA 4EN7B 3OD4A 1MQTA 1UY4A 2GP5A 3W5MA 1DGRA 1UY3A 4RHV2 3WW1A 3ZDSA 3UESA 1REDA 4XCBA 1H2LA 1LRHA 2JXAA 1ZZ8A 1GYKA 3CQOA 1Z78A 2GSYA 1KRIA 2GC2A 4Q4Y3 5K0UA 4AE2A 1RXFA 4YLZA 1YFYA 1O5LA 4DS0A 1C5HA 3EMRA 1XPWA 1FV3A 3N9PA 1MEC2 1N3OA 3N35A 4E4DX 3W59A 1OC1A 4LE4A 2VCAA 5HXMA 1UU5A 4KU7A 2WNUC 2XLGA 4NR1A 5KC5A 1A6CA 2ZA9A 4YGBA 2AYHA 2WNUB 1L7QA 1JYNA 5A6ZA 2ZBJA 1SLIA 2PA7A 1W6QB 5FLIA 4ZZ8A 3S0MA 1LHUA 2EIBA 1JZ5A 1MZFA 2VZRA 3MW3A 1HRI2 1VMJA 5FZ6A 1ASJ2 1AYN1 2ORXA 2XL7A 2Z5WA 3TN92 1QQP2 1EV11 4DUWA 3IMNA 4UW6A 3PNAA 4WVVA 3NW4A 4GKYA 5H9SA 1YFUA 4Q5OA 1PO21 2DUPA 2E31A 2HYKA 2XGXA 5FYVA 2A6YA 3RGBA 3NJYA 4B4PA 3IB3A 4RD7A 4CXYA 5D8AA 5EV7A 4PQQA 3N9QA 2A75A 4L9BA 4AI0A 1TE1B 3CJIC 1EUTA 1D0HA 5IYYA 5DAPA 3CNAA 2BDRA 3CJIB 1RUC2 4CCMA 1C57A 3AP5A 1W9WA 1QF3A 1JXNA 4GH4A 5BUVA 4XMAA 4QKDA 4I0WB 4QX3A 4XE9A 2RJ2A 3Q8EA 2JE8A 4V2WA 4GKXA 1ZBE2 2C24A 1JU4A 3AK0A 4BXSV 1BXHA 1VBE1 1JZ8A 2XBO1 1AXKA 1WW6A 4LKFA 2RS33 4IEZA 2JDMA 5FV3A 5FYUA 2W2IA 4CU7A 4IW3A 4UBGA 4P02B 5T52A 1I5ZA 4XJ9A 1GNHA 2UY9A 3FBMA 2B9VA 1QJX2 4H7MA 1KFXL 5FZEA 2WA4A 2WZR3 5F5QA 4JQRA 2K9ZA 4Q4Y1 2VPVA 1YHFA 3M3EA 3NNLA 1W6OB 3PUIA 4LTAA 4MGKE 1NKGA 4BQ5A 1YFXA 2DCKA 1U5YA 4GZ9A 3BTZA 2ZAAA 4RR3A 4FBFA 3SH5A 4D6QA 4X6RB 2WN2A 4QXKA 1ALYA 3I59B 1CX1A 1UZYA 4QXCA 4HKOA 1LHOA 1X7NA 2VVFA 3A7QA 4CU9A 3ZYGA 1GICA 1XBFA 4AI8A 4A7YA 5C8WA 4BIOA 4I0AA 4IV3A 2LROA 2XJVA 2D98A 5B4XA 4NIAA 2Y38A 2JECA 1J59A 5A7QA 2XUMA 2GALA 3T0BA 3KMHA 3GZEA 4LIVA 4AHWA 2O14A 4GMP3 4HONA 2PLV2 2A3WA 4DZGA 4OUEA 4E4SA 3RFRA 2FHRA 5LA9A 1YI7A 3HD8B 4HFSA 1KDMA 3I2GA 4N53A 3WF1A 5JDBA 3H8XA 5FUIA 2YUEA 4MVTA 5B2GB 4N90A 1JI6A 5FMOL 4QXHA 3THTA 4BU2A 5FXVA 4K21A 1JUIA 1EP0A 4QT6A 3ZX7A 4QWNA 2W1UA 1S2BA 4BQ1A 4DNYA 2ZKLA 2BNOA 2SLIA 5I0TA 1OH4A 1S0GA 4QPGA 1OA4A 4ISRA 4NRMA 1W90A 3UT0A 3PDQA 1NY72 3VBRC 3R05A 5JCTA 2RS31 2ZXQA 3VBRB 4AFMA 1RUG3 5CADA 1AXYA 2LTNA 5JR7B 1BQPA 3ROUA 5A1AA 4FPYA 1DG6A 3B9IA 1FPN2 1ND3A 4FP2A 1QNYA 1FOD2 2VVDA 4I2OA 1LODA 4OHXA 2IXHA 2WZR1 3LIGA 4Y5SA 4HSLA 3HBZA 3HR9A 4LA2A 3ACLA 5KXBA 2HWF3 4YVWC 2AZ5A 1GP5A 1GANA 2DFCA 1OOPC 3NRUA 4LBJA 4MOAA 5CKNA 2VNOA 1ULCA 3FLPA 4YVWB 5FYSA 4CUGA 2BQPA 1OOPB 2R6QA 1V6OA 1N47A 2XJTA 3KCYA 4QDRA 2DTYA 4XQDA 1ENXA 3TB0A 4Z8BA 1W0OA 3M3OA 5BNPC 2ORZA 2OUHA 5BNPB 2ARXA 4MG2A 5CKMA 3LOIA 4IL7A 3RZMA 1JU3A 1KGYA 1LOAA 2NLRA 2P3IA 4GMP1 1SDWA 3VBUC 1W8NA 2A6VA 3ZFFA 2JDZA 1DZTA 4Y1XA 3I2HA 5E89A 3SNMA 4XPVA 4AF9A 3VBUB 5IHRA 4JGZC 4PQ9A 1ZA7A 4MZUA 3AMHA 4JGZB 3AP7A 4QDSA 4D3WA 2YC2A 5A33B 4FFHA 2PHLA 4RFRB 2JE9A 4QU2A 1WLWA 1NYWA 2B46X 2VTFA 2JG9C 2F4PA 2Y6HA 4LO5B 5HCBA 1TVGA 3QLQA 2JKXA 3ILNA 2JG9B 3E6BA 3MF6A 4XAAA 3RRDA 3JXSA 2PHRA 4XBLA 5A7WA 1A34A 2VMCA 2BGOA 2UWCA 5FMBA 3SXWA 4CCEA 3JBG3 5L7OB 2J42A 2LUWA 2QQJA 3AJYA 1S0DA 2E7TA 4LEJA 4V2VA 3N7KA 4BXFA 2ZGQA 1I1EA 1IQDC 5KXEA 1LOFA 1RUG1 1PMJX 1FMD1 1UY0A 2WDBA 1ZA4A 1C3HA 3M3QA 3PJYA 2YC4A 2ENRA 4MLOA 1AYN2 3KLSA 1A78A 1EV12 2WQ8A 5KHIA 4C91A 5GLVA 4A45A 2V5DA 4R4XA 3MIBA 5FY9A 1FAYA 4JGYC 3ZMOA 3O1TA 1PO22 3U1XA 5BNQA 2Y6JA 2HWF1 3OUIA 1OI6A 4Y1YA 5FY7A 3OYWB 4JGYB 5LBCA 1GZTA 2CV6A 1NOVA 3ZOIA 1JZ2A 4CEWA 3WNXA 4QM8A 1HV0A 2XOMA 3Q9OA 5E88A 4A3XA 2XPJA 1O91A 1DP0A 4TTGA 1AL23 4D8MA 2XVLA 1PX3A 3D4KA 1LESA 5F1RA 4J1WA 2ZCWA 3RVHA 1TZOA 1U5ZA 2FQPA 4GWIA 3RJRA 2O8QA 4CUCA 3N7JA 3U37A 1LOCA 2FDGA 3BODA 5D1IA 5F6LB 1QIQA 5EQUA 2K2SA 4DXZA 2VCMA 3W5NA 1VBE2 1XNDA 2CAVA 2XBO2 2DTWA 3INAA 3ITQA 4HG6B 4XDQA 5IVBA 4MUVA 3OGVA 2CSGA 3ZKUA 1DGLA 1POV0 2QKDA 3T30A 1XC6A 4QX5A 2HKXA 4H14A 1SACA 5IW0A 4CPBD 5FZCA 1UYXA 4XYXA 3USUA 1DQ5A 4B1LA 1E5SA 1COV1 1SFNA 3VHNA 4Q4Y2 3NNJA 4UW5A 1ZZCA 3PUHA 1YCIA 2NP0A 1F8VA 5FK7A 3CMGA 3GJBA 1ZX5A 2VZOA 2IXIA 1AR63 3JBG1 4ZONA 3GZTB 3N3HA 3VD7A 3ZN6A 5H9PA 1ND2A 5FY4A 3I54A 1RGSA 1S0CA 4GJYA 2P6CA 3MEPA 5A3LA 1OKOA 3IBMA 4JC1A 3EQEA 1BMV1 4NE9A 4R52A 4QQLA 1S1AA 4LNVA 1TG7A 1UZ0A 2AREA 3AP9A 1YO8A 3HWJA 2J1EA 3WP6A 1LECA 3LF7A 5T5OA 1TNRA 1PMHX 1G6NA 4IEVA 3ASIA 2Y6GA 4DMIA 3OGJA 4HPKB 4B4QA 1ENQA 4H7LA 3GHNA 3MO4A 4BIFA 4XHBA 4CDWB 2BU9A 2OIIA 2W68A 4XDOA 1AL21 2VNRA 1J3PA 5L9BA 1G8WA 1PVXA 1HV1A 1PK6A 1W9FA 1KJLA 2EALA 1EUUA 2WNOA 3WW4A 4FTBA 4PJYA 2EAKA 2ADDA 2VUDA 1O6UA 5C9AC 1PGSA 3IPVB 3FHAA 3RSJA 1LEMA 4PBOA 4AG4A 4PI2A 5C9AB 3CKHA 1CAUA 4D7YA 4AFCA 1W28A 2ARBA 2RS32 2VMHA 2WSUA 4J6GA 3ZYHA 5J48A 3DKWA 3AKPA 3KHCA 1ZRDA 3B94A 2JJ6A 5FZOA 5DMYA 2D6LX 4XIKA 2QQKA 5DAQA 1Q8PA 2CGNA 4UFMA 4WZFA 5AFEA 2DVGA 4MGSA 3N7MA 4XF0A 2OQ6A 1GBGA 2WZR2 4FFGA 1H8TC 4NPRA 2ZZJA 4QB2A 4CCJA 1VBC3 4BM8A 1DQ4A 4DRRA 1H8TB 1DU3D 2RS13 3FJSA 4M01A 2ILMA 2Y34A 4D69A 1SCRA 1ZZ9A 4MV2A 1G9DA 4M0NA 1UYPA 1X9PA 1M4WA 5F3EA 4QKBA 2VL4A 1GZ9A 4XW3A 3AYAA 1AR61 1FXZA 3PVBB 3N7LA 3J26N 4E2QA 3O1VA 3O1MA 4FOQA 4O61A 4IE6A 4XUQA 3HN1A 2NYYA 4EWDA 1AVBA 1QJY3 2AEZA 4DINB 1XE0A 4AFDA 4UWDA 3SEPA 2C0ZA 2ZMNA 1PHMA 1ULOA 4IV1A 1PZ9A 3WQ0A 2NPIA 2D6KA 1W6PB 1DIWA 1CZTA 2ZEZA 1UIKA 2ATFA 3GBWA 4B3NA 1GWLA 3LDRA 5DDJ3 1RVF3 3UJQA 2DCTA 4AHYA 3N9NA 1R1ZA 4ASLA 2QZ3A 3NO8A 4INDA 2WSVA 2VQ0A 4HVQA 3K4ZA 1ZRFA 2X5IA 3SH4A 1BEV1 1NCQC 4QGMA 4CCOA 2DVFA 4OLLA 1MS8A 4WVWA 1QH7A 2KXLA 4FPEA 4D7SA 1NCQB 4LKEA 1LCLA 3D6EA 3TEWA 4P5HA 4HOOA 4QPIA 1AZDA 2W87A 3FBYA 3VL8A 4QX7A 5T54A 4B7EA 2XDVA 3O14A 4LBNA 3ST7A 4NHMA 1RUG2 2V4AA 3JCIA 4ATEA 1FMD2 4FPLA 3B93A 4XFIA 1DQ0A 4Q4X3 2F4LA 4CRQA 3PMSA 3BB6A 3VDAA 2RDSA 1HRI3 2YDEA 1GU3A 4E2SA 3TN93 3LD8A 1VBC1 1IQAA 2HWF2 4IEPA 2RS11 1DQ2A 5FPXA 5IVJA 1F4HA 4PDWC 2R32A 3LEMA 4FVVA 1D4M3 3D82A 4EZHA 1FNZA 3I2KA 2XVGA 2ET1A 3OPWA 1Y4WA 4PDWB 4QQPA 4XOGA 2WINB 1OPMA 4RGAA 4LBQB 1W6MB 2QQWA 3UV9A 5FP3A 1DBNA 3ZSKA 2WN3A 3OGSA 4MXWB 1FX5A 2RM23 5FYCA 4XJWA 3HNBM 1QJY1 1W6NA 1WBFA 2QE3A 4GALA 1XNKA 1J58A 1MZ5A 5CFDA 2V72A 3HNYM 3TNPB 3O1PA 4FXKB 2JB4A 1CIYA 3K46A 5T50A 1YC61 5FOBB 2W95A 1YLLA 3VBFC 4XAEA 3VD9A 4CXXA 4BMBA 2EXKA 1CN1A 2RR13 3E5QA 1RVF1 2WIIB 3GBGA 2WC2A 3HJRA 4PLOA 4XACA 5DDJ1 4NPMA 2GZWA 5ANNA 4BPZA 3AC0A 1DGWA 1COV2 1Q43A 2BNMA 3GALA 5CNAA 2ZX4A 2DCJA 3CDZB 5C33A 4BQWA 2QQPA 4QD2A 1ST8A 1A3KA 1W04A 2X10A 3DV8A 1VAVA 3NV1A 3Q8FA 4LHLA 3JD73 4META 2GNMA 3K48A 4QB6A 3PIJA 5EP9A 4YW5A 3P1IA 4MGQA 3WNOA 4BA6A 3JBG2 3UGGA 1MS1A 2UWAA 4A2UA 3RPQA 4FTEA 5A3WA 5DABA 1W2TA 3R4SA 4R9BA 1F4AA 5HCAA 4FAHA 2VMFA 3WVJA 2DCYA 2QDNA 1YEWA 4FT8A 3LA7A 3OUHA 3T4HB 4DEQA 1BMV2 3I3BA 3AFGA 5I0SA 2VOKA 2QQIA 3C7EA 1J1LA 3U10A 4BK4A 4Q4X1 1JZ6A 4EV0A 5G04L 3WEZA 2ZEXA 1HXS3 3WW3A 4XUNA 2Y6FA 5FCCA 3CF6E 3LPGA 4MADA 3VKNA 3M4FA 1HB4A 3PTRB 3U0ZA 2EXIA 3MBWA 2CGPA 2FDHA 2AGSA 3FZ3A 5LEKA 1GOHA 1YUDA 5F2WA 1D4M1 3B7MA 3MFCA 1PNGA 3C8XA 2IVIB 4NWWA 2FMDA 3ALQA 1AL22 4YZ2A 4GJZA 5LW9A 1S0BA 3RWKX 3DCQA 5C7GA 3DPRA 2X29A 3CEWA 1JYTA 5CISA 2RM21 1GNZA 5CA6A 4BLIA 3WG2A 2MHFA 4WV8A 1D2SA 4CP9A 4WM7C 5GZEA 3POBA 4COUA 2QUOA 1YQ8A 3VHRA 1IPJA 1WCKA 4WM7B 5F7UA 4Y3OA 1CX4A 1H4GA 1W8ZA 2YB7A 4KG8A 1XU2A 4LLOA 4WVMA 3VZMA 2VBDA 1B35A 3V65A 1M06G 3KV5A 4ISQA 2A73B 2J22A 2RR11 4PF5A 1BK1A 2TUNA 2YGMA 4HKLA 4JVAA 1AX1A 2GN7A 1FPN3 4RQPA 2D3PA 4BQXA 5FBZA 4K40A 2AH2A 3ABZA 1W9TA 2UYBA 4QMAA 4XF3A 5I0UA 3E5UA 3I2FA 1G9FA 2WT2A 5A3TA 1C8M3 5T55A 1AJKA 3K75B 2YGLA 3JD71 2BBVA 3R4UA 5C6CA 5FIXA 4D7TA 2H6CA 3KZ4C 1WCDJ 2VM9A 4PT6A 2QQMA 3V0AA 1UL9A 3AZVA 5FZMA 5FZFA 4XBNA 2A71A 5I0DA 3N36A 3GNEA 2W1SA 1SFYA 1IPSA 4EN9B 3POFA 3I3EA 3AZWA 4P5YA 5FZLA 4YFZA 5F3CA 2LRPA 1RTVA 4FOWA 4Q0QA 3GJAA 3ZMNA 4Q0PA 3H3LA 2CY6A 4ZU4A 3K4DA 3MW2A 1WLCA 3Q8BA 3R4DB 4G3YC 2B8MA 1HXS1 3AMMA 4TN7A 4Y5TA 3J9SA 2FDIA 4CDXB 1H2NA 5A3MA 2PAMA 4ONUA 1YRZA 3B01A 1SHWB 4IEOA 4MO3M 4W6XA 2DVAA 5APAA 3IDBB 1PGL1 4LBQD 4WM8C 5DG2A 5CAZA 1W8TA 1W2UA 4JHZA 4CYDA 1WCQA 4DB5A 4WM8B 3SKJE 5A32A 2QQVA 4LMFA 4IE0A 1BEV2 1NCRC 4QX1A 1YQ2A 1KD7A 3BPSA 1GKBA 3K77A 3GDBA 2PHWA 3ELNA 2G9FA 1NCRB 2DYCA 1YQ6A 1C28A 1Y9MA 1Q8OA 2G4IA 3JQXA 2QDRA 1UU6A 3DL3A 1XOYA 4JAAA 4P08A 1H30A 3J7NA 4FO9A 5T5LA 3O1SA 3H1YA 1ZRRA 3MIFA 4MXVA 2B45X 3GF6A 5FYYA 3ETPA 4AXOA 4PIZA 3POSA 3WQ7A 3J8F3 5FUNA 3ZPOA 3T0DA 4COWA 1N1SA 2DF7A 4BE3A 4NWVA 1MR5A 2PELA 3OBAA 3KWVA 1AYN3 1QGLA 1SLAA 4A7ZA 1GFF2 1HN1A 1VBC2 1EV13 2HEVF 1Z7S3 1ZRIA 4M4RA 4R9AA 5CEHA 2RS12 2PN5A 4EN6B 4QX2A 3WOGA 1C8M1 3N9LA 4V1PA 5FYZA 3ZXAC 3A23A 1C8NA 3POEA 4CCKA 3ZXJA 4DOUA 4N7IA 4NPLA 4DFSA 5JZGA 4IGQA 1RITA 2VU9A 5FXZA 5DXDA 4AVAA 2K46A 2LALA 2WABA 2WAAA 3O0XA 1OXCA 4GAZA 2IXJA 5EJZB 1CESA 3WUCA 4BHPA 1N1TA 1T2XA 1SLCA 3PTYA 4K1ZA 1EPZA 4GMP0 4TWTA 5FZ8A 4CZSA 1YYNA 4ZHNA 1QJY2 3LA2A 3VD5A 3VD4A 4LUKA 2ERFA 2WT0A 3VDDC 3WDWA 3JB8A 2JE7A 3VBOC 4XQ4A 5GM0A 5ERLA 2ZX3A 4W4ZA 2YC0A 2WO7A 3VDDB 5F5AA 3VBOB 3ZYBA 3DYOA 2A3YA 2FBEA 5JVVA 1RUE3 4IE7A 4IXLA 2ZGSA 4CEYC 1NT0A 1CPNA 3B02A 4IESA 4ARYA 1NA1A 4P9YA 1QWRA 2OVUA 1RVF2 4MGZE 5DDJ2 5C4WA 5SV5A 4CEYB 4XZPA 3T08A 3WP5A 3I2JA 4M3CF 5CU1A 1X8EA 2A70A 1JYVA 4MGYE 3GZUC 1Q8SA 2ES3A 1CVNA 4AEKA 2P3JA 4TLGA 3IN9A 2Q8CA 2KA3A 4FPKA 4X8PA 4Z82A 1AR83 3A22A 3A0NA 1W2OA 4IEXA 1DGRN 5LASA 5JXHA 4FFIA 2GC1A 1BK0A 2Q30A 1QJU3 3OG2A 4XJZA 3HOBA 4MX3A 3AKRA 3L9JT 3M3IA 4ZY9A 4Y22A 3D3AA 5GJ6A 3MI8A 4HLTA 3NAPC 2YPDA 3J8F1 5K8SA 3NAPB 1DCSA 1UCXA 4Q4X2 5HBAA 3N9OA 3CJXA 5I8YA 3OPTA 1RXGA 1SCSA 3VLBB 1VRH3 3TAYA 1RUH3 4IE5A 1IS3A 1QKQA 4YG3A 1Z7S1 1S55A 1DYKA 4XETA 1QOTA 2ZGTA 5K9YA 3VBHC 1D4M2 1G9CA 2W3JA 4S2DA 1UU4A 5DZGA 3VBHB 1R1A3 1OVPA 1OLME 1JBCA 1SBFA 2BGCA 4JZRA 4KG0A 4CDQC 2YU2A 2H6BA 2R30A 4Q2FA 4CDQB 1MS9A 4UI9L 3OY8B 3FLRA 3IDCB 3PUAA 4LLFA 3NNFA 5EFUA 5B4NA 2RM22 4UOJA 2ETEA 2JDYA 4NRPA 4JKMA 4CU8A 2HWB3 4AQ6A 3KM5A 3RMXA 3ACIA 4IEYA 4DRVA 1DQ1A 2IVJA 2VE1A 3CZJA 2BPA2 1D0GA 3RZHA 4KBZA 1UO9A 2J1TA 1V9U3 1RL3A 1RUE1 1KXGA 5FZ4A 4E2GA 1BJQA 4O9GA 4OZOA 2RR12 1E5RA 1UYYA 4L11A 4ZXKA 5JOZA 4LQRA 5BY5A 1LHWA 1JH5A 2IZWA 1YNAA 2ID4A 1N3PA 1JODA 3C7OA 3ILRA 4ZS2A 4EN8B 5ABJC 2ZGOA 4FPHA 2B42B 4LORA 4R9DA 3JD72 5ABJB 5A3NA 1K12A 5C8CC 3F95A 1AR81 1CD3G 4ITCA 5FREA 1SPPB 5C8CB 3NJZA 3ZFGA 5JLVA 1T6GC 4AFAA 1J1TA 4FI9A 1UOBA 1QJU1 4QX0A 5BNNA 4LUMA 3HQUA 3WG4A 2FDFA 1CAVA 5JMCA 3TEYA 4XXAA 1E5HA 3W58A 3RI8A 2WNVC 1W3XA 2PQSA 4YVSA 2ZGRA 1KEXA 4RS5C 1VRH1 1UXZA 1HXS2 1L7RA 2VW2A 4TXWA 2WNVB 5A7WB 1EAH3 3ZIWA 1RUH1 1WW7A 5J37A 4RS5B 2KM2A 1TNFA 1HN0A 5J7MA 3CZUA 1CAXB 4MSVA 1UOGA 1J3QA 2R0FA 5E8AA 4AQTA 2WA3A 1Q5OA 1PGL2 1QH6A 3ZR5A 3LAGA 1R1A1 2C4XA 3E6DA 2WLQA 4RGGA 5BXXA 2ZHKA 3J7HA 1DYPA 1ULGA 4UAPA 3TWIA 4LO4B 2PXJA 2YPJA 1W05A 1HKDA 5DUXA 3GCXA 5FQ0A 3BN6A 2HWB1 2YU1A 3WF0A 2ADEA 1K5JA 1LHNA 4KBBA 5JSRA 3N4MA 1FI2A 1J84A 2VQAA 3RQ0A 4O9EA 2KD7A 5H9RA 3AB0A 1K42A 1VAMA 5FLHA 5KXCA 1H4HA 2XG3A 4EZ4A 4GXLA 3NJVA 4OULA 2B39A 1V9U1 3ZFEC 4NUBA 2OT7A 2R061 3ZFEB 3OBTA 4KI5M 1FMD3 2HWD3 4C90A 1G7YA 2WNUA 5FZHA 4M3CE 2Z42A 1HQNA 1OH3A 2A6WA 2B4KA 2D6NA 1QHDA 4OUMA 3OGGA 3VKLA 3J7MA 4XXPA 2ZMKA 1OF3A 1W6QA 1RC6A 4M4PA 1YJKA 4YZ4A 5GLTA 1C8M2 4GWJA 4A42A 2GH2A 5IT6A 1A8DA 1JHJA 3VHOA 2ZHLA 4LITA 3H8RA 3NV2A 1RJ7A 1UZWA 3E97A 5FJHA 1W03A 1DHKB 5EPAA 1DYOA 1V00A 4GD4A 5J3UA 4K6BA 1JYIA 4YYOA 3USUB 4MGTA 3EJKA 3H1MA 1WBLA 1UQXA 3WXPA 3KHBA 5L9RA 3EO6A 2D40A 1SBEA 1GLHA 4L0PA 2BRTA 1US2A 1C1LA 4MHRA 5T5JA 4CDUC 1JZ4A 1MZ6A 5M0TA 1ND2C 3CJIA 1EAH1 3VDCA 3ZM8A 4CDUB 5LA0A 2XKOA 4URTA 1ND2B 2A6XA 2Y0OA 2EXJA 3HEIA 4N43C 1Q8VA 2ZJCA 4K1YA 3I3DA 5CZKA 3WDVA 1X36A 5JI7A 4N43B 3TYJA 3UJOA 3OB8A 4FTSA 3F2ZA 3FWEA 3V56A 1NQJA 5LATA 4XF4A 1W2AX 2OXBA 1COV3 4DY3A 2HH9A 3V0BB 2VNGA 4OVEA 1BKZA 5F5IA 1I9RA 1XSRA 4QU1A 5EYYA 4Q8KA 5L7OC 2OQ7A 5JXGA 3CHXA 2P3YA 3VZNA 2XHKA 2OZ6A 2DUQA 3LFMA 5FP7A 1W6OA 1G9BA 3J4UH 4X8NA 3RYKA 2R16A 3SITA 5A80A 2R49A 4ZKTB 5LA1A 2VZTA 2DURA 5FXXA 2DFBA 1XU1A 3J8F2 1HB2A 3KT1A 5I91A 3RG0A 1VBB3 1CZSA 3I59A 1ACCA 2HWD1 3SEEA 3CO2A 5LRRA 1YWKA 4CSWA 5A6XA 3PURA 3OF1A 1Z7S2 1WMEA 2IFWA 4PIYA 4Q4W3 2AC1A 5E16A 2ARAA 2DV9A 4UBHA 5A1LA 3O0VA 3KVBA 2W91A 2ZHNA 4LHKA 2HWE3 1LKNA 4BLJA 3M7AA 3K3NA 4LHSA 3ZIXA 4AW7A 4XDPA 3KV6A 2JDPA 2DVDA 1O3RA 3W21A 1ODNA 4C8DA 1QY4A 1JTZX 1H1AA 2C9AA 4UFHA 5C3RA 1S2EA 2CDOA 1UMZA 2D5FA 4HK8A 2EVXA 3KSCA 4CPBA 5BPXA 4ES9A 3WQ1A 2W52A 1RUE2 2VMEA 4H2AA 4COZA 1WCSA 3I2OA 2H0VA 5LA2A 3WNKA 1GZWB 1UNBA 4M3CB 1MS3A 4XZUG 4D94A 3ZKYA 5IK5A 3VBRA 2OS2A 4OUSA 1JYWA 5D21A 3I8TA 4XCAA 4XUPA 4TZDA 1PIV3 1IG0A 4JV4A 2XH6A 4A7KA 3KB5A 4EE2A 1AR82 5IK4A 2NM1A 2GMMA 3BYWA 1H6YA 3AXEA 1IGOA 1XYOA 5JXIA 2ARCA 1O3SA 1QJU2 3KGLA 3O0WA 1UW8A 3T4VA 2QTWB 2Q0AA 2YMZA 4CUAA 1XRUA 1ZZ7A 4UFKA 4M0HA 1F5FA 2P2KA 2AR6A 3DF0A 3U11A 1UOJA 4HANA 1HQWA 4YVWA 2WQ4A 3ZYFA 4EJRA 1OOPA 1VBB1 2XWJB 1A8MA 3VKMA 2FMYA 1VRH2 3LEGA 1FNYA 3AP6A 3MYXA 3UKVA 3WF2A 1RUH2 1UIJA 3WNMA 5IVEA 4QPIB 3QACA 2WYSA 4OYUA 2WRAA 3HT1A 4YARA 4LK6A 4Q4W1 5BNPA 1OUSA 1OPOA 4XJUA 4J25A 1YQCA 1YQ5A 3LGRA 3SCGA 2ZGLA 1VAKA 1R1A2 2V5YA 2VZSA 4HN1A 2PYTA 4JTNA 4Y24A 5FZAA 4CDWC 2HWE1 2J1RA 4YW3A 5C3SA 4PF1A 5GLWA 3VBUA 4JQTA 2XJUA 4BJ0A 4JGZA 1IS5A 2OW4A 5L19A 1BEV3 3ZYRA 2FCUA 2ZX1A 5JR2A 2HWB2 5A33A 3WF3A 3B9CA 4LOTA 4B1MA 1NXMA 2J1UA 2OPWA 5FZIA 2P34A 5JUVA 1RB8G 3KCCA 5FZ1A 4XQWA 4PLMA 4JCKA 4BQ3A 2JG9A 3MUZ1 1V9U2 2R062 3T2OA 5EYXA 4AL9A 3ES4A 1D7PM 3THDA 1K45A 4F3JA 3H8OA 4DUVA 2XJQA 5DPNA 1OHFA 1H6XA 3ZXDA 1KQRA 5GLUA 4GQ7A 4TYSA 2HJIA 3MPBA 1PIV1 3VBSC 4YZ1A 3LZZA 3H3ZA 2BOJA 1W8WA 4Q8LA 3VBSB 4B8EA 1LU1A 4AI1A 3AX4A 1V6NA 4Q0SA 1RUNA 3VUOA 4JDNA 1ONAA 4LJHA 2EXHA 2BOIA 5BNOC 3OYWA 4JGYA 1S0FA 1NXD1 4FP3A 2AUYA 5BNOB 4W50A 1AXZA
chains in the Genus database with same CATH topology
3S5QA 1Y4WA 2AEZA 5ANNA 3KF3A 3LIGA 3NMBA 5FK7A 4UFMA 4FFFA 4UFLA 4AZZA 4UFHA 1Y9MA 3KF5A 2QQWA 3U14A 1ST8A 5FK8A 4FFGA 5FKBA 4HXCA 3HBKA 2QQUA 3H3LA 1Y9GA 4JQTA 3PIJA 4QHZA 2XQRA 4CCDA 4FFHA 2ADEA 3LFIA 3UGGA 4UFKA 2AEYA 5FMCA 3IMMA 3ZR5A 1W2TA 1UYPA 3LDRA 2OXBA 3ZR6A 2ADDA 2AC1A 3LIHA 3U1XA 3RWKX 3UGFA 3UGHA 4B1MA 5FKCA 5FMDA 4FFIA 5FIXA 3PIGA 5FMBA 4CCEA 4UFIA 3SC7X 4B1LA 3LEMA 3LF7A 4CCCA 4EQVA 3LDKA 2QQVA 3OSDA 3U75A 4UFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S5Q A;  1Y4W A;  2AEZ A;  5ANN A;  3KF3 A;  3LIG A;  3NMB A;  5FK7 A;  4UFM A;  4FFF A;  4UFL A;  4AZZ A;  4UFH A;  1Y9M A;  3KF5 A;  2QQW A;  3U14 A;  1ST8 A;  5FK8 A;  4FFG A;  5FKB A;  4HXC A;  3HBK A;  2QQU A;  3H3L A;  1Y9G A;  4JQT A;  3PIJ A;  4QHZ A;  2XQR A;  4CCD A;  4FFH A;  2ADE A;  3LFI A;  3UGG A;  4UFK A;  2AEY A;  5FMC A;  3IMM A;  3ZR5 A;  1W2T A;  1UYP A;  3LDR A;  2OXB A;  3ZR6 A;  2ADD A;  2AC1 A;  3LIH A;  3U1X A;  3RWK X;  3UGF A;  3UGH A;  4B1M A;  5FKC A;  5FMD A;  4FFI A;  5FIX A;  3PIG A;  5FMB A;  4CCE A;  4UFI A;  3SC7 X;  4B1L A;  3LEM A;  3LF7 A;  4CCC A;  4EQV A;  3LDK A;  2QQV A;  3OSD A;  3U75 A;  4UFJ A; 
#chains in the Genus database with same CATH topology
 4UXA A;  3ZSM A;  1GQH A;  4TLF A;  5FUP A;  1UMI A;  4HBN A;  3DYP A;  4AZZ A;  1J83 A;  1EAH 2;  2VH9 A;  1WA6 X;  1UAI A;  5J96 B;  3BKZ A;  5JOY A;  4CCD A;  1OKQ A;  4I30 A;  4NHK A;  2A1X A;  2VZV A;  2XJP A;  2W46 A;  4U2A A;  5FY1 A;  5FP4 A;  5AC9 3;  5FWJ A;  3RYP A;  4TSV A;  3BGA A;  5JOW A;  4AAP A;  3RZZ A;  4E8C A;  2XON A;  3AVS A;  5KBF A;  3QOP A;  3UGH A;  1I6X A;  1O8S A;  3EHK A;  1V6K A;  1APN A;  1MZE A;  2XML A;  3IWZ A;  4YM0 A;  2Q8O A;  3TNQ A;  3A4U A;  2IXL A;  3T0A A;  3SC7 X;  2FDK A;  1W99 A;  4CCC A;  4EQV A;  5FR3 A;  1W8H A;  2VW0 A;  3VDB A;  2VY0 A;  3VHP A;  1ZNP A;  3T1M A;  1ZRE A;  1LAJ A;  4LIU A;  1LOB A;  1NE6 A;  1V6J A;  3LWC A;  2D5H A;  5LB6 A;  2JIJ A;  1QDO A;  3E5X A;  1RYY A;  4LE3 A;  5FY0 A;  2HWD 2;  2VCB A;  3BU0 A;  3GBF A;  2XHN A;  2D3S A;  2W47 A;  5HI0 A;  3RS6 A;  2YRO A;  2BW8 A;  3JUU A;  3O7O A;  4UF0 B;  5JPN B;  5HPO A;  4K3U A;  4JDM A;  4JKK A;  3WR0 A;  2TBV A;  2E33 A;  3H7Y A;  4WVZ A;  5LK7 B;  4NN0 A;  1BCX A;  3MDP A;  4KGQ A;  1VB2 A;  4NHY A;  3IIA A;  2JIC A;  2QVS B;  4L8Q A;  4XFG A;  1WMX A;  3HQX A;  4RA0 A;  2R04 3;  5GZF A;  1QJZ A;  4AED C;  4CVU A;  1H0B A;  3KGZ A;  3GXU A;  2D7F A;  4AED B;  5A6Y A;  4HPK A;  1N3Q A;  2VTX J;  1Q56 A;  1J3R A;  3VKO A;  1CON A;  1SFP A;  4O65 A;  1R09 3;  3FUQ A;  2W9X A;  1W06 A;  2X8K A;  1Z0H A;  3NL1 A;  1I5P A;  2J1S A;  4AFB A;  4BCU A;  3V0A B;  5F6K A;  5CFC C;  2X05 A;  5FBJ A;  1K3I A;  1OA3 A;  5AC9 1;  5CFC B;  1DZQ A;  3LOB A;  2Y26 A;  2TEP A;  3IPV A;  5FYB A;  5AFB A;  4HMZ A;  2CDP A;  4XBQ A;  5FZB A;  5C9A A;  2D6P A;  2XB6 C;  5EIY B;  1JYX A;  1CAW B;  1MPX A;  5GAL A;  1GV9 A;  4KWU A;  4D0Q A;  1WCU A;  3GGL A;  2G9Z A;  2RDQ A;  4AK3 A;  5FKB A;  5FZ3 A;  1LNS A;  2B9U A;  2NMN A;  4XFH A;  3WG1 A;  3MF9 A;  1O4Y A;  2EID A;  1US3 A;  2VUA A;  3MLJ A;  4Y26 A;  1YFW A;  2PFW A;  3W20 A;  4A44 A;  3BOW A;  4I01 A;  3WCR A;  1H8T A;  3QD6 A;  3SMH A;  1XSQ A;  1AYM 3;  2GAU A;  3BTA A;  1EYB A;  4DY5 A;  5IVC A;  5FPZ A;  2GC0 A;  3UL2 A;  1VBB 2;  1VBA 3;  3C7F A;  2QNK A;  3M1H A;  1IS4 A;  1LR5 A;  3CLP A;  3QH7 A;  5FZK A;  4Z2A A;  4OZX A;  3PL0 A;  1IHM A;  3DEM A;  3G7D A;  1WW4 A;  4Q4W 2;  4NOT A;  5AVA A;  5FTT C;  1NQD A;  1VJ2 A;  3ZVX A;  3L2Y A;  3BUC A;  5DAV A;  5LRS A;  2NMO A;  3MV1 1;  2ZAB A;  2MNG A;  2Q1M A;  1UOF A;  1RUO A;  2WFP A;  4P9X A;  1IKP A;  2HWE 2;  3KV4 A;  1W3V A;  3HVD A;  3WV6 A;  4OI0 A;  2D3R A;  2R04 1;  2RVA A;  3NV3 A;  4Y4R A;  1W6P A;  2RE9 A;  5F5C A;  1CR7 A;  1QNW A;  3PLQ A;  5FZ9 A;  1N1V A;  3ILF A;  3FMG A;  4FOY A;  4QQH A;  5DQ0 A;  1O5U A;  1OUX A;  1K5M C;  4Y20 B;  1YIP A;  5ACA 3;  1LUL A;  1C4R A;  1JUH A;  3PIG A;  1SLL A;  1K5M B;  1R09 1;  2W08 A;  4K8R B;  4DUX A;  2Y8K A;  2PHD A;  2R0H A;  1X33 A;  3I49 A;  5LY2 A;  2WS9 3;  3C7H A;  4UFJ A;  2JD4 A;  1HJG A;  3LEK A;  2CTV A;  5KHH A;  1NCQ A;  1W8O A;  4QKN A;  3I4I A;  1UX6 A;  1IKQ A;  4YW4 A;  1XXN A;  3KF5 A;  2XXZ A;  5FZ7 A;  2IUW A;  3KCX A;  4A3Z A;  3O1R A;  1NE4 A;  1LB2 A;  5FYM A;  5DUW A;  5C71 A;  5C3P A;  1OD5 A;  1NAE A;  1VMH A;  4ORF A;  2A3X A;  1MQT C;  2RS5 1;  2VG9 A;  1PIV 2;  1PVC 3;  3J7L A;  2RJL A;  3POJ A;  5KXD A;  1MQT B;  4ASK A;  1UWW A;  1SBD A;  5KWR A;  4NJ4 A;  1YJL A;  4H3W A;  4RFT 0;  1F2N A;  2WWU A;  5JI9 A;  3IZO A;  1AYM 1;  1GWM A;  5FDB A;  3SLI A;  5JAX A;  5K0U C;  3WDT A;  1EPW A;  5E1R A;  5K4L A;  2A6Z A;  4KU8 A;  1D2Q A;  1WD3 A;  1VBA 1;  3ACH A;  4K7J A;  4PDW A;  4YNI A;  5HCH A;  4FPG A;  5K0U B;  5FK8 A;  3EXU A;  4HXC A;  4IGP A;  2P5B A;  4LBQ A;  1W6M A;  2CL2 A;  3CU7 A;  1GP4 A;  4XF1 A;  1ZBA 3;  2YZ4 A;  2YV8 A;  2DBN A;  4LKS A;  3VL9 A;  1G9A A;  3P5B A;  4MXW A;  2BER A;  1MVE A;  1OQ1 A;  2QCS B;  2WYF A;  4W8J A;  5IVY A;  3TEX A;  1PX4 A;  2CHH A;  1JS9 A;  2VAU A;  3O12 A;  3FHQ A;  4XUT A;  5F3I A;  1NLR A;  2VZ1 A;  4CXW A;  1AUY A;  2VGD A;  2I07 B;  3S7I A;  2GN3 A;  3K3O A;  4JX0 A;  2YBP A;  3ZYP A;  2ZEW A;  2TNF A;  1UPI A;  5IK8 A;  4XC9 A;  2DU1 A;  3FE5 A;  1QU0 A;  3THC A;  3N9M A;  3VBF A;  5ACA 1;  2PHU A;  3OBR A;  4YW2 A;  3WT3 A;  5C5U A;  4OI1 A;  1JHN A;  2DUO A;  3HBK A;  5D8A C;  4DPN A;  1DF0 A;  1KDK A;  4F83 A;  2WS9 1;  2RDR A;  2QQL A;  3I2I A;  1VR3 A;  3GM8 A;  4Y33 A;  5D8A B;  1PO1 3;  3R0R A;  4AGR A;  2WBK A;  5LY1 A;  2VUJ A;  1GOG A;  3HMY A;  3UET A;  1RIR A;  3LIH A;  1S0I A;  1NZC A;  1PNF A;  4GH4 C;  5FPL A;  1LJ7 A;  2BWC A;  2E26 A;  2FZ1 A;  3IAP A;  4NVP A;  1CJD A;  2BV4 A;  3MHZ A;  5F8P A;  3WDX A;  2GU9 A;  4GH4 B;  2HWC 3;  5FXW A;  2G19 A;  3UKN A;  3O1O A;  2ZEY A;  2C26 A;  5SV8 A;  2XJS A;  1R64 A;  1Q3E A;  3I7D A;  1VLN A;  4XFC A;  4FOV A;  2YXS A;  1PVC 1;  3OUJ A;  4YWA A;  2VXR A;  2VJX A;  3BIW E;  1JOJ A;  1N1Y A;  2ZS6 B;  3AMQ A;  4PIX A;  1ULE A;  2L9L A;  5IFT A;  4QKF A;  2PHX A;  5GKA C;  3MPP G;  4XF9 A;  1W8F A;  1L3J A;  2QQU A;  4LR4 A;  2RMU 3;  3GYD A;  2HYX A;  3WNL A;  5C3Q A;  2XR4 A;  1MVQ A;  2VOW A;  1XYN A;  1RUD 3;  4C0H A;  5JPM B;  4RR3 C;  3AL5 A;  5DUV A;  4KH9 A;  4RL7 A;  2X53 S;  4K20 A;  2Z79 A;  1GUI A;  2JB8 A;  1ZBA 1;  2WWS A;  2VR4 A;  4RR3 B;  3VKF C;  3ZFG B;  4LT5 A;  2WT1 A;  3LDK A;  1WZX A;  1QDC A;  5IAX A;  5AC9 2;  2B5H A;  1XNA A;  4AI9 A;  2IXC A;  2P37 A;  4IV3 C;  4RGK A;  2VNV A;  3AYE A;  2D44 A;  5F39 A;  5KC6 A;  3POW A;  4Y5Z 0;  4IV3 B;  4NAO A;  4COY A;  4WM7 A;  3P6B A;  3AKS A;  3LA3 A;  2VQT A;  2C1F A;  4BQ4 A;  3SCF A;  3RMY A;  4PI0 A;  3DEC A;  1ULP A;  4YG0 A;  1ULD A;  2E7A A;  2GMP A;  2WO3 A;  3USS A;  2JX9 A;  4IEW A;  4OQ9 A;  4AEJ A;  3O5S A;  4CA9 A;  3URF A;  1W39 A;  4N53 C;  3AJZ A;  3UK9 A;  5K7P A;  1B09 A;  4N53 B;  5FO9 B;  2OYZ A;  1PO1 1;  2Q1Z B;  3W9A A;  2OX0 A;  3CIH A;  1XNC A;  2B7Y A;  4R8H A;  3ATG A;  1OT5 A;  1CIW A;  3AP4 A;  5FQ0 B;  2AEN A;  3ES1 A;  4XHX A;  2VVE A;  2HWC 1;  2IXK A;  4QPW A;  4YZ5 A;  2EAA A;  4QPG C;  3U14 A;  1JOP A;  5JSO A;  2DVB A;  2WZP P;  3U78 A;  4QPG B;  3PHM A;  1DLC A;  1H8V A;  3PVN A;  2AAC A;  2UUR A;  4IET A;  4OCT A;  2E9Q A;  4NAM A;  3WHT A;  4N7U A;  4XFA A;  1F9K A;  2R04 2;  3MLK A;  4CDX A;  4K9S A;  1O8P A;  1ND3 C;  1VAL A;  2DU0 A;  1I3H A;  1OUR A;  1POQ A;  2RMU 1;  1QXP A;  1GMM A;  1FAT A;  1ND3 B;  1Y7B A;  2VMG A;  3A0K A;  4Z07 A;  5EWS A;  5LEJ A;  3BAL A;  5JMO A;  4GWN A;  3I97 A;  1PM7 A;  1OD3 A;  1R09 2;  1RUD 1;  3EB7 A;  3Q8A A;  1IG3 A;  3HQR A;  4QDQ A;  4WM8 A;  3T2Q A;  4B29 A;  1HB1 A;  1OVS A;  3B00 A;  2ZX2 A;  3VBF B;  1UKG A;  2Z2S B;  5IUQ A;  3OEB A;  1NCR A;  4BIS A;  3ENR A;  4YPJ A;  3Q8C A;  4KWJ A;  1H2K A;  3AMN A;  3IKW A;  3MW4 A;  5GLZ A;  3JZV A;  2JG8 A;  2WWJ A;  2R06 3;  1Q8Q A;  1GNY A;  2BWA A;  4PBP A;  1QOO A;  4AQ2 A;  5A3U A;  4ASM B;  4F7Z A;  4Q4V 3;  3ZFF C;  1VE0 A;  4IEU A;  2RS5 2;  2JEN A;  3LSE A;  3AXD A;  3ZFF B;  2R1B A;  4AVS A;  2VZP A;  3WD5 A;  2GME A;  4CP2 A;  2BBA A;  1W9S A;  4OHW A;  4ZS3 A;  5IWF A;  1PZ8 A;  4ZU5 A;  1ZYB A;  3RZG A;  4UFL A;  1GQP A;  1AYM 2;  4HKW A;  1H1I A;  3LCP A;  3IT8 A;  1VBA 2;  3MV0 1;  1DFQ A;  1UYZ A;  4DXS A;  4KNC A;  4P9J A;  1UKR A;  5J09 A;  1RUI 3;  2V73 A;  1VMF A;  3H3U A;  4A6S A;  4LBK A;  3ON7 A;  3DKQ A;  1HW5 A;  4GIQ A;  2W39 A;  4P00 B;  2ZAH A;  5LZ6 A;  1HQL A;  2GND A;  3FUO A;  4QHB A;  3SKV A;  4Y1Z A;  4IGO A;  1LOF C;  1XQN A;  2D93 A;  4N9H A;  1ENS A;  5L73 A;  4AGG A;  2GDF A;  3VDD A;  5JOX A;  3VBO A;  4XAB A;  2XVK A;  4HVR A;  4AVV A;  1SDD B;  4FPF A;  1H2M A;  1W2N A;  2PHT A;  4NHL A;  1JN2 P;  1VB4 A;  1C1F A;  1ENR A;  3L2H A;  3ZSE A;  1X8M A;  2LS6 A;  3WDU A;  3BTY A;  5ACA 2;  1JZ3 A;  3H42 B;  2C9K A;  2Y6K A;  4CEY A;  1L7L A;  4YZ3 A;  2QFE A;  2YYO A;  3B3Q E;  3KV9 A;  1XE8 A;  3IDE A;  4CEW C;  1VBD 3;  3MFA A;  4QB1 A;  2WS9 2;  1RHI 3;  5I8T A;  4CEW B;  4OI2 A;  5G05 L;  3ZYI B;  1DQ6 A;  2BEO A;  3BPZ A;  1AHS A;  1IPK A;  2JWP A;  2GH8 A;  5A7N A;  3T3Y A;  2UY8 A;  3ZXG A;  4FPJ A;  4CUB A;  4KMQ A;  5IAT A;  3RZJ A;  1BBT 3;  3FFQ A;  4ZPI A;  3S6P A;  2JDK A;  3R6S A;  2XQX A;  3K4A A;  4I3P A;  4ES8 A;  4QAW A;  2P3K A;  1CGP A;  1OSG A;  4F8A A;  2RG4 A;  4AEM A;  4AYU A;  4Q4V 1;  4AI3 A;  4JHT A;  2VW1 A;  4LK7 A;  1PVC 2;  1ZVF A;  3NAP A;  2Y6L A;  2P17 A;  3NV4 A;  1AR7 3;  1U0A A;  2XWB B;  3H0O A;  4QM9 A;  1P8J A;  2RV9 A;  5LBB A;  2BFU S;  3LPF A;  1H1M A;  3OTF A;  3LE0 A;  5AVP A;  4D6S A;  5EHD A;  5A3P A;  1UZV A;  3AZX A;  1BVP 1;  1OFN A;  3VGI A;  4AVT A;  3VZK A;  3I3M A;  3TEZ A;  2VTX A;  4LO6 B;  1OF4 A;  3WLU A;  2CAU A;  3ZR6 A;  2OPK A;  5FY5 A;  3AZY A;  2QJV A;  3WHU A;  3THP A;  4HZF A;  4ZZ5 A;  4JKL A;  3POI A;  2Q1F A;  3VBH A;  4I3G A;  2WJS A;  1CZV A;  1ODM A;  3HN3 A;  1UX7 A;  4I02 A;  2ZZQ A;  3NJX A;  5LBF A;  5JIA A;  2JDH A;  4L92 A;  1RUF 3;  3P3P A;  1RUI 1;  1ZBA 2;  3K2O A;  3ZXL A;  4CDQ A;  1QXJ A;  3OY8 A;  1ULF A;  3S5Q A;  4YM3 A;  3RDI A;  3ZN6 B;  4Q0V A;  3CL1 A;  4JRA A;  4X6Q B;  2VC9 A;  4E9K A;  3U4S A;  4AI2 A;  2YFU A;  1OQE A;  5CKQ A;  1CJP A;  1HIX A;  5A7O A;  3APB A;  3SH3 A;  3NQH A;  3QCW A;  4DXR A;  5C70 A;  3GZA A;  1LOE A;  3K51 A;  3M8L A;  1CPM A;  2PMW B;  2R07 3;  1UZZ A;  5LBE A;  2C5D A;  3T2T A;  2LM3 A;  4KQ7 A;  4XIO A;  1RUJ 3;  1TMF 3;  2K0G A;  5CVR A;  4OHZ A;  3E6C C;  3AL6 A;  2YBK A;  2Z69 A;  4RYD A;  4AR2 A;  1VBD 1;  2W1W A;  2WKK A;  2E63 A;  1RHI 1;  2DWR A;  4YM1 A;  3MZH A;  1GR3 A;  4S2G A;  1PO1 2;  2BTV C;  5ABJ A;  3WG3 A;  3JQW A;  2PTM A;  1HLC A;  2GC3 A;  4IUG A;  4FFF A;  1E57 A;  1SPP A;  1PK6 C;  5C8C A;  1BBT 1;  1F31 A;  4GB3 3;  1PK6 B;  2HWC 2;  3KT7 A;  3RI9 A;  4XIL A;  4C1X A;  1YI9 A;  1KS4 A;  2FCV A;  3KS7 A;  4G4F A;  4I0B A;  5IVV A;  2IC1 A;  5F37 A;  4C0B A;  2C6S A;  2IFR A;  3HPN A;  1OLR A;  3PUS A;  1CAU B;  4ERO A;  1AR7 1;  3M2M A;  5CBL A;  4UW3 A;  2P4E A;  2FDJ A;  2CYF A;  2P6H A;  3OBZ A;  4PHZ A;  4Y1U A;  2RJK A;  3S30 A;  2WNV A;  5FOJ B;  4OQ8 A;  4NIH A;  4RS5 A;  5FZO B;  2O1Q A;  2DBI A;  4IDZ A;  3WUD A;  3BI3 A;  4LA3 A;  2O8O A;  3FN9 A;  1DLL A;  2RMU 2;  5HV4 A;  1CAX A;  1IS6 A;  1Y43 B;  2E32 A;  5F3G A;  4BQ2 A;  1FYU A;  2VO5 A;  1BZW A;  1KIT A;  1XNB A;  4AVC A;  1PGW 1;  2UU8 A;  2X09 A;  3X29 B;  3OOX A;  1RUD 2;  4OI4 A;  4E4Z A;  1AF9 A;  2GNB A;  2WZE A;  4AAX A;  2E51 A;  4D6R A;  4CU6 A;  1RUF 1;  3QH6 A;  3RYR A;  4LPL A;  4BK5 A;  2HLE A;  1D4V B;  2ZKN A;  3I3Q A;  5DZE A;  3WDY A;  3HIF A;  3WQB A;  4ET7 A;  4KGG A;  2VUC A;  3SHR A;  4DXT A;  4URA A;  1STM A;  1DZR A;  1SQ4 A;  3AKQ A;  3BCW A;  3GCW A;  3HT2 A;  3MIE A;  2WL1 A;  4N8M A;  5FJK A;  3VZO A;  1JOB A;  4L99 A;  3S5A A;  1NLS A;  2Q4S A;  1LGC A;  5L36 A;  4YFW A;  3M70 A;  2R07 1;  4IV1 C;  4R4Z A;  5FPU A;  2NQY A;  3ZFE A;  1R08 3;  1E5I A;  4IV1 B;  5FYH A;  4CP1 A;  1RUJ 1;  2N7G A;  1TMF 1;  2W1Q A;  3U07 A;  3ZXE A;  4NID A;  4JDO A;  1UXX X;  1RIN A;  4RSU A;  5LK5 A;  1VPH A;  3SQO A;  4W6W A;  4AQS A;  4HSJ A;  3ZDV A;  5I93 A;  1WMF A;  3NVC A;  2BGP A;  3QBQ A;  2EA7 A;  2CWS A;  3WCS A;  1X50 A;  3AYD A;  2X5I C;  1F15 A;  2WFF 3;  5A7P A;  5FPV A;  1O3Q A;  1BYH A;  1OLM A;  1V70 A;  2X5I B;  1QEX A;  4GB3 1;  5IAV A;  4NMI A;  4FXG B;  1ZRC A;  2VBP A;  5FO8 B;  1WW5 A;  3LQC A;  4QPI C;  1SLT A;  1G86 A;  3FHI B;  2BUK A;  5FPB A;  3D8C A;  4UFI A;  4AOC A;  4HL0 A;  2DDU A;  1XNT A;  2XKP A;  4Q26 A;  5JIU A;  3OSD A;  5A7S A;  3TBD A;  3A21 A;  3AYC A;  3ZXK A;  1S0J A;  2MPF A;  5FY8 A;  3BU7 A;  4AHX A;  4CP0 A;  4CDU A;  2O0O A;  1U12 A;  5E6H A;  1AX0 A;  2BVV A;  3AFK A;  2ZOE B;  3D0S A;  4YW1 A;  1UF2 C;  3WP4 A;  4CCL A;  1FV2 A;  1Y9G A;  2ZHM A;  3WNN A;  1NG0 A;  4N43 A;  5DZF A;  1WLT A;  1VRB A;  4XFF A;  2VZU A;  4HET A;  3LEI A;  1GP6 A;  4QGN A;  3GHM A;  1URX A;  3OEA A;  5J98 B;  4EN0 A;  3MUY 1;  1RMU 3;  1O4T A;  3MIC A;  5CG8 A;  2JEM A;  1LOG A;  3DXT A;  3V0B A;  1GOF A;  3D5O A;  4L97 A;  3RZK A;  1JMU B;  1HDK A;  5GZC A;  1F5J A;  3WW2 A;  3AM2 A;  5L7O A;  1XE7 A;  1QOS A;  3AZZ A;  1AL0 G;  1REE A;  3VZJ A;  1BLZ A;  5F32 A;  5CFD C;  1W6N B;  4Q4V 2;  4YGE A;  3DN7 A;  3B69 A;  2Y33 A;  1LGB A;  1TQ5 A;  5CFD B;  4H55 A;  4YRD A;  1R08 1;  4A6O A;  1KFU L;  4KL1 A;  5FMC A;  2WR9 A;  4Q1P A;  3ZYJ B;  3ZO0 B;  5I0R A;  5FYI A;  3H8U A;  1TME 3;  2J1A A;  2F6B A;  1AR9 3;  4XTM A;  1LHV A;  4Z92 B;  3KQR A;  4BZ4 A;  3S57 A;  1SMV A;  2JDA A;  1VIW B;  2ZAC A;  1WMD A;  4BB3 A;  3ZN5 A;  1S4C A;  2YBS A;  3BOP A;  3FLT A;  4AGV A;  5JXJ A;  2WFF 1;  4BDV B;  5BYN A;  4W6Y A;  2D6O X;  2VMD A;  3T2P A;  3S7E A;  3ZLI A;  3LSD A;  4IER A;  3RZL A;  4BME A;  1OBN A;  3D0J A;  4HK9 A;  4MHU A;  4P9G A;  1RUI 2;  4XUR A;  1X9T A;  4NII A;  3BIE A;  3T1L A;  3FX3 A;  5ANQ A;  5J36 A;  4ATF A;  2JIG A;  4QHZ A;  2QZ2 A;  2I74 A;  1KJR A;  2GP3 A;  4I09 A;  4SBV A;  4W65 A;  5FYT A;  4E27 A;  1SEF A;  4HN0 A;  1QJE A;  4PCR A;  1HRV 3;  3FC0 A;  4DO0 A;  1YXW A;  4U36 A;  5HXV A;  2ZML A;  2VXJ A;  5DG1 A;  2ZGM A;  3HAG A;  2E6V A;  1QJF A;  2MEV 3;  3NWK A;  1GZW A;  3SCH A;  1JYC A;  2QBX A;  5DUU A;  1LED A;  4FPC A;  3PUQ A;  4A4A A;  4M3C A;  4FCA A;  3OGR A;  4S2F A;  1RMU 1;  1U5I A;  1VBD 2;  2BJS A;  4LBL A;  1WD4 A;  3NMB A;  1RHI 2;  2WLP A;  4YW6 A;  2VOT A;  5CB7 A;  5KHG A;  5FPA A;  3OPZ A;  3VN4 A;  4N9I A;  4YGC A;  5IK7 A;  2Y64 A;  1W9Y A;  3WY6 A;  4AHZ A;  1GQG A;  1MS5 A;  3VB9 A;  1WLD A;  2BNN A;  4LUL A;  3PU8 A;  1BBT 2;  1LEN A;  3DPR C;  4RHV 3;  3IDA A;  4JRL A;  3WP3 A;  5ISL A;  4EWE A;  1TEI A;  2ZTN A;  1AJO A;  2SBA A;  2WO2 A;  3ACG A;  3DPR B;  2XLF A;  4IQP A;  4O7X A;  1LGN A;  1SG3 A;  2HEW F;  3DXU A;  4YW7 A;  5FZG A;  5TSW A;  2YHJ A;  1GZC A;  3MID A;  1OMI A;  5FMD A;  1POV 3;  3IM0 A;  4BYY A;  2NZ9 A;  1JW6 A;  4Y4Y A;  4QX8 A;  5FFO C;  1XYP A;  4CP9 B;  4S2H A;  4L2N A;  1AR7 2;  3WNP A;  5IVF A;  4OFG A;  3MIG A;  1OLQ A;  2EIC A;  1OFS A;  1DGW X;  1B35 C;  3ZSL A;  4AVB A;  1TME 1;  2BZD A;  1MEC 3;  1AR9 1;  1NUK A;  2UYA A;  4WVM B;  1B35 B;  1X82 A;  3ORJ A;  4Q27 A;  4RQP C;  4LO7 A;  4G9S B;  4YG6 A;  2Z4F A;  1BHG A;  1PGW 2;  1ZZ6 A;  5T5P A;  3ETQ A;  4RQP B;  4K8F A;  2WQZ C;  4P9W A;  5DAW A;  2XQR A;  4NRO A;  2W94 A;  3III A;  1RUF 2;  4CDW A;  3OJB A;  5BV6 A;  5L9V A;  2VQU A;  2OZJ A;  1ASJ 3;  1NLQ A;  3UGF A;  2H0B A;  1QQP 3;  2XJR A;  3G6J B;  2Y60 A;  3EBR A;  4IEQ A;  5FO7 B;  5JWP A;  1WA4 A;  2HBU A;  3POY A;  4DQA A;  5H9Q A;  1ZM1 A;  3WZ1 A;  1HRV 1;  3EYP A;  1T6B X;  2VMI A;  4QPY A;  4Y1V A;  1DDL A;  2R07 2;  5GZG A;  1UD1 A;  3OCP A;  2QQN A;  4Q1R A;  4COV A;  1RUJ 2;  2MEV 1;  1TMF 2;  4ARX A;  4CDX C;  2RS5 3;  2V09 A;  1O7F A;  1RUC 3;  2D6M A;  2EIG A;  4E8D A;  5CG9 A;  2ET7 A;  4MGI E;  2BFU L;  4WBB A;  4XJA A;  2RDN A;  4BH9 A;  5IFP A;  5LCW L;  2PHF A;  1ZBE 3;  2JDN A;  4LHN A;  4XUO A;  3T09 A;  2FZ2 A;  2E7Q A;  4B7K A;  2Q8D A;  2UWB A;  3VBS A;  5C3O A;  5A32 B;  4FPO B;  1YIF A;  4GB3 2;  4RHV 1;  4GWM A;  1CQ9 A;  4KWK A;  1IOA A;  2BVB A;  4YSF A;  1W8U A;  2HBT A;  3U75 A;  1OQD A;  3FFZ A;  1HB3 A;  1POV 1;  1QJX 3;  3H50 A;  3KF3 A;  3OD0 A;  3PU3 A;  4Q0U A;  5EZW A;  4EYU A;  1Y3T A;  5FMO S;  5BNO A;  5DN2 A;  2CNA A;  1UY2 A;  1ZZB A;  2DCZ A;  2W92 A;  4HVO A;  4OHV A;  4BOW A;  1WUV A;  4P14 A;  1MEC 1;  5FRA A;  5FLJ A;  2AEY A;  3CBN A;  5HV0 A;  3V64 A;  2FCT A;  2GNT A;  2PAK A;  1XB9 A;  1UN1 A;  2V4V A;  2JDU A;  3VD3 A;  1WWY A;  2YG0 A;  5FKC A;  4FSJ A;  4NRQ A;  4XMI A;  3AKT A;  3LDB A;  1H9W A;  3NKG A;  2YY1 A;  4KWL A;  4XJ8 A;  2EF6 A;  3ZXF A;  5JZG C;  4P9I A;  3DYM A;  1V0A A;  1IZ3 A;  1HRI 1;  3BVC A;  4GA9 A;  1ASJ 1;  2J7M A;  4FQZ A;  3PVO A;  5FAX A;  3TN9 1;  3JU9 A;  1QQP 1;  5JZG B;  4LBM A;  3KD4 A;  2PLV 3;  2VD7 A;  3M3C A;  1MS4 A;  1QMJ A;  1S0E A;  2F17 A;  1H9P A;  2XLA A;  5JSP A;  5A1F A;  4Z1V A;  1SZB A;  3PME A;  4BWO A;  2D97 A;  3ZPY A;  4C1W A;  5EJ1 B;  1RJ8 A;  2HEY F;  3ZSJ A;  1UPS A;  2LW8 A;  2VOX A;  1QXR A;  3DGT A;  4LO8 A;  1SLB A;  3H7J A;  3WSO A;  4QXB A;  3B5L B;  1R08 2;  3U4X A;  4J1X A;  5FZD A;  4LKD A;  1RUC 1;  2ZX0 A;  5FZ0 A;  4AWD A;  3JB4 C;  3WX5 A;  1GWK A;  4UF0 A;  1NA1 C;  5C4W C;  1LTE A;  2CWM A;  3RNS A;  5CYY A;  1NA1 B;  4IE4 A;  5C4W B;  2I45 A;  1ZBE 1;  3FL7 A;  1VP6 A;  4MH0 E;  5F2S A;  5FP8 A;  3TRS B;  2R1D A;  1S2K A;  2WFF 2;  3H1W A;  4CE8 A;  2JD9 A;  2ZGN A;  2A7A A;  5A3O A;  5F9T A;  3POG A;  2NN8 A;  1NZI A;  2P1B A;  3PJQ A;  4GUL A;  4EWA A;  1AX2 A;  1W0N A;  5A6Q A;  4AED A;  5FP9 A;  5KHJ A;  1FOD 3;  5GZD A;  1QJX 1;  2JKB A;  3H9A A;  3IMM A;  3NST A;  1NX9 A;  3VZL A;  5C5T A;  4A41 A;  2J1V A;  2ZPX A;  3TOJ A;  4Y22 B;  4ZU7 A;  2EIE A;  3E1F 1;  2OUJ A;  5EJ3 A;  1W0P A;  2R7E B;  4OMC A;  2W5F A;  1AR6 2;  4OMD A;  2KR2 A;  3I2D A;  4WZC A;  1CWP A;  2VCC A;  1WGP A;  1V6M A;  2VZ3 A;  3C7G A;  3MIH A;  4RN5 A;  4OHY A;  2CGO A;  2VOV A;  5CFC A;  3UKT A;  2VZQ A;  2VBB A;  1JZ7 A;  3MGU A;  4QQ2 A;  3NKT A;  2OKX A;  5HCF A;  1CAW A;  1RMU 2;  2PAE A;  2IWG B;  1WKY A;  2ZGK A;  4ZXE A;  2BP6 A;  1KS5 A;  1PM4 A;  1FT9 A;  3MLL A;  4NO4 A;  3O1U A;  1BVV A;  2PLV 1;  3C3V A;  4QQO A;  3NNG A;  3AVR A;  5J1X A;  1O59 A;  3PVE A;  2G9G A;  5CIR A;  3P3N A;  4UYB A;  4YM2 A;  3ZN4 A;  5KR7 A;  1EY2 A;  4JTO A;  2VEC A;  4LOS A;  2WO1 A;  4NIG A;  3KQ4 B;  2OA2 A;  4SLI A;  2XL9 A;  4R9C A;  2VUL A;  1F35 A;  3ME2 A;  3KT4 A;  2WZ8 A;  1Y9Q A;  5KHK A;  4UW4 A;  4MYE A;  1HX6 A;  2JG8 C;  3UYJ A;  4B4R A;  1TME 2;  1AR9 2;  2WAO A;  3WF4 A;  1O4Z A;  1OA2 A;  2JG8 B;  4XTP A;  5D2A A;  4FAG A;  4CTE A;  1HJF A;  3AMP A;  1XJA A;  2YFZ A;  3HNM A;  1U5X A;  4P9L A;  2G1M A;  1NY7 1;  4UT5 A;  3C2U A;  3WIN E;  2W0X A;  4YGD A;  1UMH A;  2WNE A;  5LWB A;  1PZ7 A;  4Z2W A;  2FD8 A;  3RWN A;  2XUE A;  3LB9 A;  2QQO A;  3KVA A;  4FQ4 A;  4QGL A;  2I2S A;  1O3T A;  2A5Z A;  3ZFG C;  1FPN 1;  3ECQ A;  3LKJ A;  4M00 A;  1FOD 1;  5BNN C;  5T3N A;  1PMI A;  4Y20 A;  5IJR A;  5BNN B;  4CCN A;  4XFB A;  2D43 A;  1K5M A;  1LU2 A;  4NHX A;  1PO2 3;  2PQQ A;  3UNP A;  4DIQ A;  1MS0 A;  1HRV 2;  4BQY A;  4E4H A;  3BTX A;  2RHP A;  4HT1 T;  2ZGP A;  3VV1 A;  1UY1 A;  4Q29 A;  1CAV B;  2CU5 A;  4YVS C;  2E53 A;  3ACF A;  1V6L A;  3IAQ A;  4LBO A;  4DEV A;  2BYV E;  1MAC A;  4YVS B;  3SIS A;  1C5I A;  5I8S A;  2MEV 2;  3LFI A;  5FWE A;  2Q8E A;  3RJ2 X;  3NNM A;  4QHO A;  1V6I A;  4XVH A;  4PLN A;  4LXL A;  5EXO A;  1REF A;  4XEZ A;  2ZGU A;  5DAX A;  2Y0I A;  2Q5T A;  2WUH A;  1GSL A;  1VBE 3;  2XBO 3;  5A70 A;  3DUI A;  4EN7 B;  3OD4 A;  1MQT A;  1UY4 A;  2GP5 A;  3W5M A;  1DGR A;  1UY3 A;  4RHV 2;  3WW1 A;  3ZDS A;  3UES A;  1RED A;  4XCB A;  1H2L A;  1LRH A;  2JXA A;  1ZZ8 A;  1GYK A;  3CQO A;  1Z78 A;  2GSY A;  1KRI A;  2GC2 A;  4Q4Y 3;  5K0U A;  4AE2 A;  1RXF A;  4YLZ A;  1YFY A;  1O5L A;  4DS0 A;  1C5H A;  3EMR A;  1XPW A;  1FV3 A;  3N9P A;  1MEC 2;  1N3O A;  3N35 A;  4E4D X;  3W59 A;  1OC1 A;  4LE4 A;  2VCA A;  5HXM A;  1UU5 A;  4KU7 A;  2WNU C;  2XLG A;  4NR1 A;  5KC5 A;  1A6C A;  2ZA9 A;  4YGB A;  2AYH A;  2WNU B;  1L7Q A;  1JYN A;  5A6Z A;  2ZBJ A;  1SLI A;  2PA7 A;  1W6Q B;  5FLI A;  4ZZ8 A;  3S0M A;  1LHU A;  2EIB A;  1JZ5 A;  1MZF A;  2VZR A;  3MW3 A;  1HRI 2;  1VMJ A;  5FZ6 A;  1ASJ 2;  1AYN 1;  2ORX A;  2XL7 A;  2Z5W A;  3TN9 2;  1QQP 2;  1EV1 1;  4DUW A;  3IMN A;  4UW6 A;  3PNA A;  4WVV A;  3NW4 A;  4GKY A;  5H9S A;  1YFU A;  4Q5O A;  1PO2 1;  2DUP A;  2E31 A;  2HYK A;  2XGX A;  5FYV A;  2A6Y A;  3RGB A;  3NJY A;  4B4P A;  3IB3 A;  4RD7 A;  4CXY A;  5D8A A;  5EV7 A;  4PQQ A;  3N9Q A;  2A75 A;  4L9B A;  4AI0 A;  1TE1 B;  3CJI C;  1EUT A;  1D0H A;  5IYY A;  5DAP A;  3CNA A;  2BDR A;  3CJI B;  1RUC 2;  4CCM A;  1C57 A;  3AP5 A;  1W9W A;  1QF3 A;  1JXN A;  4GH4 A;  5BUV A;  4XMA A;  4QKD A;  4I0W B;  4QX3 A;  4XE9 A;  2RJ2 A;  3Q8E A;  2JE8 A;  4V2W A;  4GKX A;  1ZBE 2;  2C24 A;  1JU4 A;  3AK0 A;  4BXS V;  1BXH A;  1VBE 1;  1JZ8 A;  2XBO 1;  1AXK A;  1WW6 A;  4LKF A;  2RS3 3;  4IEZ A;  2JDM A;  5FV3 A;  5FYU A;  2W2I A;  4CU7 A;  4IW3 A;  4UBG A;  4P02 B;  5T52 A;  1I5Z A;  4XJ9 A;  1GNH A;  2UY9 A;  3FBM A;  2B9V A;  1QJX 2;  4H7M A;  1KFX L;  5FZE A;  2WA4 A;  2WZR 3;  5F5Q A;  4JQR A;  2K9Z A;  4Q4Y 1;  2VPV A;  1YHF A;  3M3E A;  3NNL A;  1W6O B;  3PUI A;  4LTA A;  4MGK E;  1NKG A;  4BQ5 A;  1YFX A;  2DCK A;  1U5Y A;  4GZ9 A;  3BTZ A;  2ZAA A;  4RR3 A;  4FBF A;  3SH5 A;  4D6Q A;  4X6R B;  2WN2 A;  4QXK A;  1ALY A;  3I59 B;  1CX1 A;  1UZY A;  4QXC A;  4HKO A;  1LHO A;  1X7N A;  2VVF A;  3A7Q A;  4CU9 A;  3ZYG A;  1GIC A;  1XBF A;  4AI8 A;  4A7Y A;  5C8W A;  4BIO A;  4I0A A;  4IV3 A;  2LRO A;  2XJV A;  2D98 A;  5B4X A;  4NIA A;  2Y38 A;  2JEC A;  1J59 A;  5A7Q A;  2XUM A;  2GAL A;  3T0B A;  3KMH A;  3GZE A;  4LIV A;  4AHW A;  2O14 A;  4GMP 3;  4HON A;  2PLV 2;  2A3W A;  4DZG A;  4OUE A;  4E4S A;  3RFR A;  2FHR A;  5LA9 A;  1YI7 A;  3HD8 B;  4HFS A;  1KDM A;  3I2G A;  4N53 A;  3WF1 A;  5JDB A;  3H8X A;  5FUI A;  2YUE A;  4MVT A;  5B2G B;  4N90 A;  1JI6 A;  5FMO L;  4QXH A;  3THT A;  4BU2 A;  5FXV A;  4K21 A;  1JUI A;  1EP0 A;  4QT6 A;  3ZX7 A;  4QWN A;  2W1U A;  1S2B A;  4BQ1 A;  4DNY A;  2ZKL A;  2BNO A;  2SLI A;  5I0T A;  1OH4 A;  1S0G A;  4QPG A;  1OA4 A;  4ISR A;  4NRM A;  1W90 A;  3UT0 A;  3PDQ A;  1NY7 2;  3VBR C;  3R05 A;  5JCT A;  2RS3 1;  2ZXQ A;  3VBR B;  4AFM A;  1RUG 3;  5CAD A;  1AXY A;  2LTN A;  5JR7 B;  1BQP A;  3ROU A;  5A1A A;  4FPY A;  1DG6 A;  3B9I A;  1FPN 2;  1ND3 A;  4FP2 A;  1QNY A;  1FOD 2;  2VVD A;  4I2O A;  1LOD A;  4OHX A;  2IXH A;  2WZR 1;  3LIG A;  4Y5S A;  4HSL A;  3HBZ A;  3HR9 A;  4LA2 A;  3ACL A;  5KXB A;  2HWF 3;  4YVW C;  2AZ5 A;  1GP5 A;  1GAN A;  2DFC A;  1OOP C;  3NRU A;  4LBJ A;  4MOA A;  5CKN A;  2VNO A;  1ULC A;  3FLP A;  4YVW B;  5FYS A;  4CUG A;  2BQP A;  1OOP B;  2R6Q A;  1V6O A;  1N47 A;  2XJT A;  3KCY A;  4QDR A;  2DTY A;  4XQD A;  1ENX A;  3TB0 A;  4Z8B A;  1W0O A;  3M3O A;  5BNP C;  2ORZ A;  2OUH A;  5BNP B;  2ARX A;  4MG2 A;  5CKM A;  3LOI A;  4IL7 A;  3RZM A;  1JU3 A;  1KGY A;  1LOA A;  2NLR A;  2P3I A;  4GMP 1;  1SDW A;  3VBU C;  1W8N A;  2A6V A;  3ZFF A;  2JDZ A;  1DZT A;  4Y1X A;  3I2H A;  5E89 A;  3SNM A;  4XPV A;  4AF9 A;  3VBU B;  5IHR A;  4JGZ C;  4PQ9 A;  1ZA7 A;  4MZU A;  3AMH A;  4JGZ B;  3AP7 A;  4QDS A;  4D3W A;  2YC2 A;  5A33 B;  4FFH A;  2PHL A;  4RFR B;  2JE9 A;  4QU2 A;  1WLW A;  1NYW A;  2B46 X;  2VTF A;  2JG9 C;  2F4P A;  2Y6H A;  4LO5 B;  5HCB A;  1TVG A;  3QLQ A;  2JKX A;  3ILN A;  2JG9 B;  3E6B A;  3MF6 A;  4XAA A;  3RRD A;  3JXS A;  2PHR A;  4XBL A;  5A7W A;  1A34 A;  2VMC A;  2BGO A;  2UWC A;  5FMB A;  3SXW A;  4CCE A;  3JBG 3;  5L7O B;  2J42 A;  2LUW A;  2QQJ A;  3AJY A;  1S0D A;  2E7T A;  4LEJ A;  4V2V A;  3N7K A;  4BXF A;  2ZGQ A;  1I1E A;  1IQD C;  5KXE A;  1LOF A;  1RUG 1;  1PMJ X;  1FMD 1;  1UY0 A;  2WDB A;  1ZA4 A;  1C3H A;  3M3Q A;  3PJY A;  2YC4 A;  2ENR A;  4MLO A;  1AYN 2;  3KLS A;  1A78 A;  1EV1 2;  2WQ8 A;  5KHI A;  4C91 A;  5GLV A;  4A45 A;  2V5D A;  4R4X A;  3MIB A;  5FY9 A;  1FAY A;  4JGY C;  3ZMO A;  3O1T A;  1PO2 2;  3U1X A;  5BNQ A;  2Y6J A;  2HWF 1;  3OUI A;  1OI6 A;  4Y1Y A;  5FY7 A;  3OYW B;  4JGY B;  5LBC A;  1GZT A;  2CV6 A;  1NOV A;  3ZOI A;  1JZ2 A;  4CEW A;  3WNX A;  4QM8 A;  1HV0 A;  2XOM A;  3Q9O A;  5E88 A;  4A3X A;  2XPJ A;  1O91 A;  1DP0 A;  4TTG A;  1AL2 3;  4D8M A;  2XVL A;  1PX3 A;  3D4K A;  1LES A;  5F1R A;  4J1W A;  2ZCW A;  3RVH A;  1TZO A;  1U5Z A;  2FQP A;  4GWI A;  3RJR A;  2O8Q A;  4CUC A;  3N7J A;  3U37 A;  1LOC A;  2FDG A;  3BOD A;  5D1I A;  5F6L B;  1QIQ A;  5EQU A;  2K2S A;  4DXZ A;  2VCM A;  3W5N A;  1VBE 2;  1XND A;  2CAV A;  2XBO 2;  2DTW A;  3INA A;  3ITQ A;  4HG6 B;  4XDQ A;  5IVB A;  4MUV A;  3OGV A;  2CSG A;  3ZKU A;  1DGL A;  1POV 0;  2QKD A;  3T30 A;  1XC6 A;  4QX5 A;  2HKX A;  4H14 A;  1SAC A;  5IW0 A;  4CPB D;  5FZC A;  1UYX A;  4XYX A;  3USU A;  1DQ5 A;  4B1L A;  1E5S A;  1COV 1;  1SFN A;  3VHN A;  4Q4Y 2;  3NNJ A;  4UW5 A;  1ZZC A;  3PUH A;  1YCI A;  2NP0 A;  1F8V A;  5FK7 A;  3CMG A;  3GJB A;  1ZX5 A;  2VZO A;  2IXI A;  1AR6 3;  3JBG 1;  4ZON A;  3GZT B;  3N3H A;  3VD7 A;  3ZN6 A;  5H9P A;  1ND2 A;  5FY4 A;  3I54 A;  1RGS A;  1S0C A;  4GJY A;  2P6C A;  3MEP A;  5A3L A;  1OKO A;  3IBM A;  4JC1 A;  3EQE A;  1BMV 1;  4NE9 A;  4R52 A;  4QQL A;  1S1A A;  4LNV A;  1TG7 A;  1UZ0 A;  2ARE A;  3AP9 A;  1YO8 A;  3HWJ A;  2J1E A;  3WP6 A;  1LEC A;  3LF7 A;  5T5O A;  1TNR A;  1PMH X;  1G6N A;  4IEV A;  3ASI A;  2Y6G A;  4DMI A;  3OGJ A;  4HPK B;  4B4Q A;  1ENQ A;  4H7L A;  3GHN A;  3MO4 A;  4BIF A;  4XHB A;  4CDW B;  2BU9 A;  2OII A;  2W68 A;  4XDO A;  1AL2 1;  2VNR A;  1J3P A;  5L9B A;  1G8W A;  1PVX A;  1HV1 A;  1PK6 A;  1W9F A;  1KJL A;  2EAL A;  1EUU A;  2WNO A;  3WW4 A;  4FTB A;  4PJY A;  2EAK A;  2ADD A;  2VUD A;  1O6U A;  5C9A C;  1PGS A;  3IPV B;  3FHA A;  3RSJ A;  1LEM A;  4PBO A;  4AG4 A;  4PI2 A;  5C9A B;  3CKH A;  1CAU A;  4D7Y A;  4AFC A;  1W28 A;  2ARB A;  2RS3 2;  2VMH A;  2WSU A;  4J6G A;  3ZYH A;  5J48 A;  3DKW A;  3AKP A;  3KHC A;  1ZRD A;  3B94 A;  2JJ6 A;  5FZO A;  5DMY A;  2D6L X;  4XIK A;  2QQK A;  5DAQ A;  1Q8P A;  2CGN A;  4UFM A;  4WZF A;  5AFE A;  2DVG A;  4MGS A;  3N7M A;  4XF0 A;  2OQ6 A;  1GBG A;  2WZR 2;  4FFG A;  1H8T C;  4NPR A;  2ZZJ A;  4QB2 A;  4CCJ A;  1VBC 3;  4BM8 A;  1DQ4 A;  4DRR A;  1H8T B;  1DU3 D;  2RS1 3;  3FJS A;  4M01 A;  2ILM A;  2Y34 A;  4D69 A;  1SCR A;  1ZZ9 A;  4MV2 A;  1G9D A;  4M0N A;  1UYP A;  1X9P A;  1M4W A;  5F3E A;  4QKB A;  2VL4 A;  1GZ9 A;  4XW3 A;  3AYA A;  1AR6 1;  1FXZ A;  3PVB B;  3N7L A;  3J26 N;  4E2Q A;  3O1V A;  3O1M A;  4FOQ A;  4O61 A;  4IE6 A;  4XUQ A;  3HN1 A;  2NYY A;  4EWD A;  1AVB A;  1QJY 3;  2AEZ A;  4DIN B;  1XE0 A;  4AFD A;  4UWD A;  3SEP A;  2C0Z A;  2ZMN A;  1PHM A;  1ULO A;  4IV1 A;  1PZ9 A;  3WQ0 A;  2NPI A;  2D6K A;  1W6P B;  1DIW A;  1CZT A;  2ZEZ A;  1UIK A;  2ATF A;  3GBW A;  4B3N A;  1GWL A;  3LDR A;  5DDJ 3;  1RVF 3;  3UJQ A;  2DCT A;  4AHY A;  3N9N A;  1R1Z A;  4ASL A;  2QZ3 A;  3NO8 A;  4IND A;  2WSV A;  2VQ0 A;  4HVQ A;  3K4Z A;  1ZRF A;  2X5I A;  3SH4 A;  1BEV 1;  1NCQ C;  4QGM A;  4CCO A;  2DVF A;  4OLL A;  1MS8 A;  4WVW A;  1QH7 A;  2KXL A;  4FPE A;  4D7S A;  1NCQ B;  4LKE A;  1LCL A;  3D6E A;  3TEW A;  4P5H A;  4HOO A;  4QPI A;  1AZD A;  2W87 A;  3FBY A;  3VL8 A;  4QX7 A;  5T54 A;  4B7E A;  2XDV A;  3O14 A;  4LBN A;  3ST7 A;  4NHM A;  1RUG 2;  2V4A A;  3JCI A;  4ATE A;  1FMD 2;  4FPL A;  3B93 A;  4XFI A;  1DQ0 A;  4Q4X 3;  2F4L A;  4CRQ A;  3PMS A;  3BB6 A;  3VDA A;  2RDS A;  1HRI 3;  2YDE A;  1GU3 A;  4E2S A;  3TN9 3;  3LD8 A;  1VBC 1;  1IQA A;  2HWF 2;  4IEP A;  2RS1 1;  1DQ2 A;  5FPX A;  5IVJ A;  1F4H A;  4PDW C;  2R32 A;  3LEM A;  4FVV A;  1D4M 3;  3D82 A;  4EZH A;  1FNZ A;  3I2K A;  2XVG A;  2ET1 A;  3OPW A;  1Y4W A;  4PDW B;  4QQP A;  4XOG A;  2WIN B;  1OPM A;  4RGA A;  4LBQ B;  1W6M B;  2QQW A;  3UV9 A;  5FP3 A;  1DBN A;  3ZSK A;  2WN3 A;  3OGS A;  4MXW B;  1FX5 A;  2RM2 3;  5FYC A;  4XJW A;  3HNB M;  1QJY 1;  1W6N A;  1WBF A;  2QE3 A;  4GAL A;  1XNK A;  1J58 A;  1MZ5 A;  5CFD A;  2V72 A;  3HNY M;  3TNP B;  3O1P A;  4FXK B;  2JB4 A;  1CIY A;  3K46 A;  5T50 A;  1YC6 1;  5FOB B;  2W95 A;  1YLL A;  3VBF C;  4XAE A;  3VD9 A;  4CXX A;  4BMB A;  2EXK A;  1CN1 A;  2RR1 3;  3E5Q A;  1RVF 1;  2WII B;  3GBG A;  2WC2 A;  3HJR A;  4PLO A;  4XAC A;  5DDJ 1;  4NPM A;  2GZW A;  5ANN A;  4BPZ A;  3AC0 A;  1DGW A;  1COV 2;  1Q43 A;  2BNM A;  3GAL A;  5CNA A;  2ZX4 A;  2DCJ A;  3CDZ B;  5C33 A;  4BQW A;  2QQP A;  4QD2 A;  1ST8 A;  1A3K A;  1W04 A;  2X10 A;  3DV8 A;  1VAV A;  3NV1 A;  3Q8F A;  4LHL A;  3JD7 3;  4MET A;  2GNM A;  3K48 A;  4QB6 A;  3PIJ A;  5EP9 A;  4YW5 A;  3P1I A;  4MGQ A;  3WNO A;  4BA6 A;  3JBG 2;  3UGG A;  1MS1 A;  2UWA A;  4A2U A;  3RPQ A;  4FTE A;  5A3W A;  5DAB A;  1W2T A;  3R4S A;  4R9B A;  1F4A A;  5HCA A;  4FAH A;  2VMF A;  3WVJ A;  2DCY A;  2QDN A;  1YEW A;  4FT8 A;  3LA7 A;  3OUH A;  3T4H B;  4DEQ A;  1BMV 2;  3I3B A;  3AFG A;  5I0S A;  2VOK A;  2QQI A;  3C7E A;  1J1L A;  3U10 A;  4BK4 A;  4Q4X 1;  1JZ6 A;  4EV0 A;  5G04 L;  3WEZ A;  2ZEX A;  1HXS 3;  3WW3 A;  4XUN A;  2Y6F A;  5FCC A;  3CF6 E;  3LPG A;  4MAD A;  3VKN A;  3M4F A;  1HB4 A;  3PTR B;  3U0Z A;  2EXI A;  3MBW A;  2CGP A;  2FDH A;  2AGS A;  3FZ3 A;  5LEK A;  1GOH A;  1YUD A;  5F2W A;  1D4M 1;  3B7M A;  3MFC A;  1PNG A;  3C8X A;  2IVI B;  4NWW A;  2FMD A;  3ALQ A;  1AL2 2;  4YZ2 A;  4GJZ A;  5LW9 A;  1S0B A;  3RWK X;  3DCQ A;  5C7G A;  3DPR A;  2X29 A;  3CEW A;  1JYT A;  5CIS A;  2RM2 1;  1GNZ A;  5CA6 A;  4BLI A;  3WG2 A;  2MHF A;  4WV8 A;  1D2S A;  4CP9 A;  4WM7 C;  5GZE A;  3POB A;  4COU A;  2QUO A;  1YQ8 A;  3VHR A;  1IPJ A;  1WCK A;  4WM7 B;  5F7U A;  4Y3O A;  1CX4 A;  1H4G A;  1W8Z A;  2YB7 A;  4KG8 A;  1XU2 A;  4LLO A;  4WVM A;  3VZM A;  2VBD A;  1B35 A;  3V65 A;  1M06 G;  3KV5 A;  4ISQ A;  2A73 B;  2J22 A;  2RR1 1;  4PF5 A;  1BK1 A;  2TUN A;  2YGM A;  4HKL A;  4JVA A;  1AX1 A;  2GN7 A;  1FPN 3;  4RQP A;  2D3P A;  4BQX A;  5FBZ A;  4K40 A;  2AH2 A;  3ABZ A;  1W9T A;  2UYB A;  4QMA A;  4XF3 A;  5I0U A;  3E5U A;  3I2F A;  1G9F A;  2WT2 A;  5A3T A;  1C8M 3;  5T55 A;  1AJK A;  3K75 B;  2YGL A;  3JD7 1;  2BBV A;  3R4U A;  5C6C A;  5FIX A;  4D7T A;  2H6C A;  3KZ4 C;  1WCD J;  2VM9 A;  4PT6 A;  2QQM A;  3V0A A;  1UL9 A;  3AZV A;  5FZM A;  5FZF A;  4XBN A;  2A71 A;  5I0D A;  3N36 A;  3GNE A;  2W1S A;  1SFY A;  1IPS A;  4EN9 B;  3POF A;  3I3E A;  3AZW A;  4P5Y A;  5FZL A;  4YFZ A;  5F3C A;  2LRP A;  1RTV A;  4FOW A;  4Q0Q A;  3GJA A;  3ZMN A;  4Q0P A;  3H3L A;  2CY6 A;  4ZU4 A;  3K4D A;  3MW2 A;  1WLC A;  3Q8B A;  3R4D B;  4G3Y C;  2B8M A;  1HXS 1;  3AMM A;  4TN7 A;  4Y5T A;  3J9S A;  2FDI A;  4CDX B;  1H2N A;  5A3M A;  2PAM A;  4ONU A;  1YRZ A;  3B01 A;  1SHW B;  4IEO A;  4MO3 M;  4W6X A;  2DVA A;  5APA A;  3IDB B;  1PGL 1;  4LBQ D;  4WM8 C;  5DG2 A;  5CAZ A;  1W8T A;  1W2U A;  4JHZ A;  4CYD A;  1WCQ A;  4DB5 A;  4WM8 B;  3SKJ E;  5A32 A;  2QQV A;  4LMF A;  4IE0 A;  1BEV 2;  1NCR C;  4QX1 A;  1YQ2 A;  1KD7 A;  3BPS A;  1GKB A;  3K77 A;  3GDB A;  2PHW A;  3ELN A;  2G9F A;  1NCR B;  2DYC A;  1YQ6 A;  1C28 A;  1Y9M A;  1Q8O A;  2G4I A;  3JQX A;  2QDR A;  1UU6 A;  3DL3 A;  1XOY A;  4JAA A;  4P08 A;  1H30 A;  3J7N A;  4FO9 A;  5T5L A;  3O1S A;  3H1Y A;  1ZRR A;  3MIF A;  4MXV A;  2B45 X;  3GF6 A;  5FYY A;  3ETP A;  4AXO A;  4PIZ A;  3POS A;  3WQ7 A;  3J8F 3;  5FUN A;  3ZPO A;  3T0D A;  4COW A;  1N1S A;  2DF7 A;  4BE3 A;  4NWV A;  1MR5 A;  2PEL A;  3OBA A;  3KWV A;  1AYN 3;  1QGL A;  1SLA A;  4A7Z A;  1GFF 2;  1HN1 A;  1VBC 2;  1EV1 3;  2HEV F;  1Z7S 3;  1ZRI A;  4M4R A;  4R9A A;  5CEH A;  2RS1 2;  2PN5 A;  4EN6 B;  4QX2 A;  3WOG A;  1C8M 1;  3N9L A;  4V1P A;  5FYZ A;  3ZXA C;  3A23 A;  1C8N A;  3POE A;  4CCK A;  3ZXJ A;  4DOU A;  4N7I A;  4NPL A;  4DFS A;  5JZG A;  4IGQ A;  1RIT A;  2VU9 A;  5FXZ A;  5DXD A;  4AVA A;  2K46 A;  2LAL A;  2WAB A;  2WAA A;  3O0X A;  1OXC A;  4GAZ A;  2IXJ A;  5EJZ B;  1CES A;  3WUC A;  4BHP A;  1N1T A;  1T2X A;  1SLC A;  3PTY A;  4K1Z A;  1EPZ A;  4GMP 0;  4TWT A;  5FZ8 A;  4CZS A;  1YYN A;  4ZHN A;  1QJY 2;  3LA2 A;  3VD5 A;  3VD4 A;  4LUK A;  2ERF A;  2WT0 A;  3VDD C;  3WDW A;  3JB8 A;  2JE7 A;  3VBO C;  4XQ4 A;  5GM0 A;  5ERL A;  2ZX3 A;  4W4Z A;  2YC0 A;  2WO7 A;  3VDD B;  5F5A A;  3VBO B;  3ZYB A;  3DYO A;  2A3Y A;  2FBE A;  5JVV A;  1RUE 3;  4IE7 A;  4IXL A;  2ZGS A;  4CEY C;  1NT0 A;  1CPN A;  3B02 A;  4IES A;  4ARY A;  1NA1 A;  4P9Y A;  1QWR A;  2OVU A;  1RVF 2;  4MGZ E;  5DDJ 2;  5C4W A;  5SV5 A;  4CEY B;  4XZP A;  3T08 A;  3WP5 A;  3I2J A;  4M3C F;  5CU1 A;  1X8E A;  2A70 A;  1JYV A;  4MGY E;  3GZU C;  1Q8S A;  2ES3 A;  1CVN A;  4AEK A;  2P3J A;  4TLG A;  3IN9 A;  2Q8C A;  2KA3 A;  4FPK A;  4X8P A;  4Z82 A;  1AR8 3;  3A22 A;  3A0N A;  1W2O A;  4IEX A;  1DGR N;  5LAS A;  5JXH A;  4FFI A;  2GC1 A;  1BK0 A;  2Q30 A;  1QJU 3;  3OG2 A;  4XJZ A;  3HOB A;  4MX3 A;  3AKR A;  3L9J T;  3M3I A;  4ZY9 A;  4Y22 A;  3D3A A;  5GJ6 A;  3MI8 A;  4HLT A;  3NAP C;  2YPD A;  3J8F 1;  5K8S A;  3NAP B;  1DCS A;  1UCX A;  4Q4X 2;  5HBA A;  3N9O A;  3CJX A;  5I8Y A;  3OPT A;  1RXG A;  1SCS A;  3VLB B;  1VRH 3;  3TAY A;  1RUH 3;  4IE5 A;  1IS3 A;  1QKQ A;  4YG3 A;  1Z7S 1;  1S55 A;  1DYK A;  4XET A;  1QOT A;  2ZGT A;  5K9Y A;  3VBH C;  1D4M 2;  1G9C A;  2W3J A;  4S2D A;  1UU4 A;  5DZG A;  3VBH B;  1R1A 3;  1OVP A;  1OLM E;  1JBC A;  1SBF A;  2BGC A;  4JZR A;  4KG0 A;  4CDQ C;  2YU2 A;  2H6B A;  2R30 A;  4Q2F A;  4CDQ B;  1MS9 A;  4UI9 L;  3OY8 B;  3FLR A;  3IDC B;  3PUA A;  4LLF A;  3NNF A;  5EFU A;  5B4N A;  2RM2 2;  4UOJ A;  2ETE A;  2JDY A;  4NRP A;  4JKM A;  4CU8 A;  2HWB 3;  4AQ6 A;  3KM5 A;  3RMX A;  3ACI A;  4IEY A;  4DRV A;  1DQ1 A;  2IVJ A;  2VE1 A;  3CZJ A;  2BPA 2;  1D0G A;  3RZH A;  4KBZ A;  1UO9 A;  2J1T A;  1V9U 3;  1RL3 A;  1RUE 1;  1KXG A;  5FZ4 A;  4E2G A;  1BJQ A;  4O9G A;  4OZO A;  2RR1 2;  1E5R A;  1UYY A;  4L11 A;  4ZXK A;  5JOZ A;  4LQR A;  5BY5 A;  1LHW A;  1JH5 A;  2IZW A;  1YNA A;  2ID4 A;  1N3P A;  1JOD A;  3C7O A;  3ILR A;  4ZS2 A;  4EN8 B;  5ABJ C;  2ZGO A;  4FPH A;  2B42 B;  4LOR A;  4R9D A;  3JD7 2;  5ABJ B;  5A3N A;  1K12 A;  5C8C C;  3F95 A;  1AR8 1;  1CD3 G;  4ITC A;  5FRE A;  1SPP B;  5C8C B;  3NJZ A;  3ZFG A;  5JLV A;  1T6G C;  4AFA A;  1J1T A;  4FI9 A;  1UOB A;  1QJU 1;  4QX0 A;  5BNN A;  4LUM A;  3HQU A;  3WG4 A;  2FDF A;  1CAV A;  5JMC A;  3TEY A;  4XXA A;  1E5H A;  3W58 A;  3RI8 A;  2WNV C;  1W3X A;  2PQS A;  4YVS A;  2ZGR A;  1KEX A;  4RS5 C;  1VRH 1;  1UXZ A;  1HXS 2;  1L7R A;  2VW2 A;  4TXW A;  2WNV B;  5A7W B;  1EAH 3;  3ZIW A;  1RUH 1;  1WW7 A;  5J37 A;  4RS5 B;  2KM2 A;  1TNF A;  1HN0 A;  5J7M A;  3CZU A;  1CAX B;  4MSV A;  1UOG A;  1J3Q A;  2R0F A;  5E8A A;  4AQT A;  2WA3 A;  1Q5O A;  1PGL 2;  1QH6 A;  3ZR5 A;  3LAG A;  1R1A 1;  2C4X A;  3E6D A;  2WLQ A;  4RGG A;  5BXX A;  2ZHK A;  3J7H A;  1DYP A;  1ULG A;  4UAP A;  3TWI A;  4LO4 B;  2PXJ A;  2YPJ A;  1W05 A;  1HKD A;  5DUX A;  3GCX A;  5FQ0 A;  3BN6 A;  2HWB 1;  2YU1 A;  3WF0 A;  2ADE A;  1K5J A;  1LHN A;  4KBB A;  5JSR A;  3N4M A;  1FI2 A;  1J84 A;  2VQA A;  3RQ0 A;  4O9E A;  2KD7 A;  5H9R A;  3AB0 A;  1K42 A;  1VAM A;  5FLH A;  5KXC A;  1H4H A;  2XG3 A;  4EZ4 A;  4GXL A;  3NJV A;  4OUL A;  2B39 A;  1V9U 1;  3ZFE C;  4NUB A;  2OT7 A;  2R06 1;  3ZFE B;  3OBT A;  4KI5 M;  1FMD 3;  2HWD 3;  4C90 A;  1G7Y A;  2WNU A;  5FZH A;  4M3C E;  2Z42 A;  1HQN A;  1OH3 A;  2A6W A;  2B4K A;  2D6N A;  1QHD A;  4OUM A;  3OGG A;  3VKL A;  3J7M A;  4XXP A;  2ZMK A;  1OF3 A;  1W6Q A;  1RC6 A;  4M4P A;  1YJK A;  4YZ4 A;  5GLT A;  1C8M 2;  4GWJ A;  4A42 A;  2GH2 A;  5IT6 A;  1A8D A;  1JHJ A;  3VHO A;  2ZHL A;  4LIT A;  3H8R A;  3NV2 A;  1RJ7 A;  1UZW A;  3E97 A;  5FJH A;  1W03 A;  1DHK B;  5EPA A;  1DYO A;  1V00 A;  4GD4 A;  5J3U A;  4K6B A;  1JYI A;  4YYO A;  3USU B;  4MGT A;  3EJK A;  3H1M A;  1WBL A;  1UQX A;  3WXP A;  3KHB A;  5L9R A;  3EO6 A;  2D40 A;  1SBE A;  1GLH A;  4L0P A;  2BRT A;  1US2 A;  1C1L A;  4MHR A;  5T5J A;  4CDU C;  1JZ4 A;  1MZ6 A;  5M0T A;  1ND2 C;  3CJI A;  1EAH 1;  3VDC A;  3ZM8 A;  4CDU B;  5LA0 A;  2XKO A;  4URT A;  1ND2 B;  2A6X A;  2Y0O A;  2EXJ A;  3HEI A;  4N43 C;  1Q8V A;  2ZJC A;  4K1Y A;  3I3D A;  5CZK A;  3WDV A;  1X36 A;  5JI7 A;  4N43 B;  3TYJ A;  3UJO A;  3OB8 A;  4FTS A;  3F2Z A;  3FWE A;  3V56 A;  1NQJ A;  5LAT A;  4XF4 A;  1W2A X;  2OXB A;  1COV 3;  4DY3 A;  2HH9 A;  3V0B B;  2VNG A;  4OVE A;  1BKZ A;  5F5I A;  1I9R A;  1XSR A;  4QU1 A;  5EYY A;  4Q8K A;  5L7O C;  2OQ7 A;  5JXG A;  3CHX A;  2P3Y A;  3VZN A;  2XHK A;  2OZ6 A;  2DUQ A;  3LFM A;  5FP7 A;  1W6O A;  1G9B A;  3J4U H;  4X8N A;  3RYK A;  2R16 A;  3SIT A;  5A80 A;  2R49 A;  4ZKT B;  5LA1 A;  2VZT A;  2DUR A;  5FXX A;  2DFB A;  1XU1 A;  3J8F 2;  1HB2 A;  3KT1 A;  5I91 A;  3RG0 A;  1VBB 3;  1CZS A;  3I59 A;  1ACC A;  2HWD 1;  3SEE A;  3CO2 A;  5LRR A;  1YWK A;  4CSW A;  5A6X A;  3PUR A;  3OF1 A;  1Z7S 2;  1WME A;  2IFW A;  4PIY A;  4Q4W 3;  2AC1 A;  5E16 A;  2ARA A;  2DV9 A;  4UBH A;  5A1L A;  3O0V A;  3KVB A;  2W91 A;  2ZHN A;  4LHK A;  2HWE 3;  1LKN A;  4BLJ A;  3M7A A;  3K3N A;  4LHS A;  3ZIX A;  4AW7 A;  4XDP A;  3KV6 A;  2JDP A;  2DVD A;  1O3R A;  3W21 A;  1ODN A;  4C8D A;  1QY4 A;  1JTZ X;  1H1A A;  2C9A A;  4UFH A;  5C3R A;  1S2E A;  2CDO A;  1UMZ A;  2D5F A;  4HK8 A;  2EVX A;  3KSC A;  4CPB A;  5BPX A;  4ES9 A;  3WQ1 A;  2W52 A;  1RUE 2;  2VME A;  4H2A A;  4COZ A;  1WCS A;  3I2O A;  2H0V A;  5LA2 A;  3WNK A;  1GZW B;  1UNB A;  4M3C B;  1MS3 A;  4XZU G;  4D94 A;  3ZKY A;  5IK5 A;  3VBR A;  2OS2 A;  4OUS A;  1JYW A;  5D21 A;  3I8T A;  4XCA A;  4XUP A;  4TZD A;  1PIV 3;  1IG0 A;  4JV4 A;  2XH6 A;  4A7K A;  3KB5 A;  4EE2 A;  1AR8 2;  5IK4 A;  2NM1 A;  2GMM A;  3BYW A;  1H6Y A;  3AXE A;  1IGO A;  1XYO A;  5JXI A;  2ARC A;  1O3S A;  1QJU 2;  3KGL A;  3O0W A;  1UW8 A;  3T4V A;  2QTW B;  2Q0A A;  2YMZ A;  4CUA A;  1XRU A;  1ZZ7 A;  4UFK A;  4M0H A;  1F5F A;  2P2K A;  2AR6 A;  3DF0 A;  3U11 A;  1UOJ A;  4HAN A;  1HQW A;  4YVW A;  2WQ4 A;  3ZYF A;  4EJR A;  1OOP A;  1VBB 1;  2XWJ B;  1A8M A;  3VKM A;  2FMY A;  1VRH 2;  3LEG A;  1FNY A;  3AP6 A;  3MYX A;  3UKV A;  3WF2 A;  1RUH 2;  1UIJ A;  3WNM A;  5IVE A;  4QPI B;  3QAC A;  2WYS A;  4OYU A;  2WRA A;  3HT1 A;  4YAR A;  4LK6 A;  4Q4W 1;  5BNP A;  1OUS A;  1OPO A;  4XJU A;  4J25 A;  1YQC A;  1YQ5 A;  3LGR A;  3SCG A;  2ZGL A;  1VAK A;  1R1A 2;  2V5Y A;  2VZS A;  4HN1 A;  2PYT A;  4JTN A;  4Y24 A;  5FZA A;  4CDW C;  2HWE 1;  2J1R A;  4YW3 A;  5C3S A;  4PF1 A;  5GLW A;  3VBU A;  4JQT A;  2XJU A;  4BJ0 A;  4JGZ A;  1IS5 A;  2OW4 A;  5L19 A;  1BEV 3;  3ZYR A;  2FCU A;  2ZX1 A;  5JR2 A;  2HWB 2;  5A33 A;  3WF3 A;  3B9C A;  4LOT A;  4B1M A;  1NXM A;  2J1U A;  2OPW A;  5FZI A;  2P34 A;  5JUV A;  1RB8 G;  3KCC A;  5FZ1 A;  4XQW A;  4PLM A;  4JCK A;  4BQ3 A;  2JG9 A;  3MUZ 1;  1V9U 2;  2R06 2;  3T2O A;  5EYX A;  4AL9 A;  3ES4 A;  1D7P M;  3THD A;  1K45 A;  4F3J A;  3H8O A;  4DUV A;  2XJQ A;  5DPN A;  1OHF A;  1H6X A;  3ZXD A;  1KQR A;  5GLU A;  4GQ7 A;  4TYS A;  2HJI A;  3MPB A;  1PIV 1;  3VBS C;  4YZ1 A;  3LZZ A;  3H3Z A;  2BOJ A;  1W8W A;  4Q8L A;  3VBS B;  4B8E A;  1LU1 A;  4AI1 A;  3AX4 A;  1V6N A;  4Q0S A;  1RUN A;  3VUO A;  4JDN A;  1ONA A;  4LJH A;  2EXH A;  2BOI A;  5BNO C;  3OYW A;  4JGY A;  1S0F A;  1NXD 1;  4FP3 A;  2AUY A;  5BNO B;  4W50 A;  1AXZ A; 
#chains in the Genus database with same CATH homology
 3S5Q A;  1Y4W A;  2AEZ A;  5ANN A;  3KF3 A;  3LIG A;  3NMB A;  5FK7 A;  4UFM A;  4FFF A;  4UFL A;  4AZZ A;  4UFH A;  1Y9M A;  3KF5 A;  2QQW A;  3U14 A;  1ST8 A;  5FK8 A;  4FFG A;  5FKB A;  4HXC A;  3HBK A;  2QQU A;  3H3L A;  1Y9G A;  4JQT A;  3PIJ A;  4QHZ A;  2XQR A;  4CCD A;  4FFH A;  2ADE A;  3LFI A;  3UGG A;  4UFK A;  2AEY A;  5FMC A;  3IMM A;  3ZR5 A;  1W2T A;  1UYP A;  3LDR A;  2OXB A;  3ZR6 A;  2ADD A;  2AC1 A;  3LIH A;  3U1X A;  3RWK X;  3UGF A;  3UGH A;  4B1M A;  5FKC A;  5FMD A;  4FFI A;  5FIX A;  3PIG A;  5FMB A;  4CCE A;  4UFI A;  3SC7 X;  4B1L A;  3LEM A;  3LF7 A;  4CCC A;  4EQV A;  3LDK A;  2QQV A;  3OSD A;  3U75 A;  4UFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...