3S5QA

Crystal structure of a putative glycosyl hydrolase (bdi_2473) from parabacteroides distasonis atcc 8503 at 1.85 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
213
structure length
213
Chain Sequence
GSDKIHHHHHHENLYFQGYRPLFDKDLSNADYDSSVWTFKNGILTATADQSIWTKVQYENFILDLEFKTDVNTNSGVVIYCTDKGNWIPSSIEIQIADDHHPEWQSYPEYWRCGSIYGHKGANEQLVVKKPGEWNRMIITAKGQQIDIELNGKHIVSANLADWTSGTTNPDGTEIPEWLPIPYANMPTKGYIGLQGKHGESNIWFRNIQLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative glycosylhydrolase
publication title Crystal structure of a Hypothetical Glycosyl hydrolase (BDI_2473) from Parabacteroides distasonis ATCC 8503 at 1.85 A resolution
rcsb
source organism Parabacteroides distasonis
total genus 57
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2011-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 3s5qA00
3UGGA 3PIJA 2QQUA 3ZR5A 2ADEA 4JQTA 3U75A 4UFLA 3UGHA 4FFFA 4QHZA 1UYPA 5FK8A 2AEZA 2AC1A 2OXBA 5ANNA 1Y9MA 3OSDA 4CCEA 4FFGA 4UFJA 2AEYA 3KF5A 3LF7A 1Y4WA 3HBKA 3LIHA 3LIGA 5FIXA 4B1MA 5FK7A 4AZZA 2QQWA 4CCDA 5FMBA 3UGFA 3LDRA 3LFIA 5FMDA 4UFKA 5FKCA 4EQVA 3U1XA 3KF3A 2XQRA 4CCCA 3PIGA 4UFHA 5FMCA 2ADDA 3LDKA 1ST8A 3S5QA 5FKBA 3NMBA 3H3LA 3IMMA 3SC7X 3U14A 4UFIA 4UFMA 3LEMA 1Y9GA 3RWKX 4B1LA 4HXCA 2QQVA 4FFHA 3ZR6A 4FFIA 1W2TA
chains in the Genus database with same CATH superfamily
3EJKA 1UYZA 5FYYA 3GZTB 1WZXA 5CA6A 2DCYA 3WNLA 3MEPA 3K48A 4I09A 4LKDA 1KDKA 1Y4WA 2LW8A 1EAH1 1CD3G 1LOCA 2R042 4ZXKA 4CEYA 2ZGNA 1PHMA 1JW6A 1NA1B 1RUJ2 3VZJA 2JG8A 2ZTNA 5FREA 2VCBA 4CP9A 3SXWA 3H42B 2XQRA 4J1WA 3CU7A 2RG4A 4YW2A 4NRPA 4Y1UA 1OPMA 2Y6JA 4YARA 3FHAA 4BISA 2P3YA 2X09A 1W04A 3UV9A 3T2OA 4F83A 1TQ5A 4XDOA 2BNMA 1FNYA 2X5IC 5FMOL 3SISA 1QY4A 2RDNA 1LOGA 1UIJA 5D8AB 3WDXA 4EZHA 1ZA7A 3WW3A 3ZIWA 3EO6A 3ACFA 4YFWA 4AWDA 4UFLA 3BPZA 2VC9A 4RL7A 3JD72 5F7UA 2XHNA 1RUJ1 4TLGA 3A21A 4IV3A 4AAPA 2QDRA 5JI7A 1O5LA 2CHHA 4FOVA 4XIOA 1IPKA 5C9AC 1XYPA 3OBTA 1RUG3 4AFBA 1K5MB 1UYXA 1ZBE3 2VVEA 3IDBB 3RMXA 3K51A 2ZS6B 2WLPA 4OYUA 4GJZA 3VHNA 1A78A 3LD8A 1S0CA 4XYXA 4AFMA 4BU2A 3M70A 1GU3A 3JD71 2D93A 3R4DB 2GSYA 2VZUA 5J7MA 1WW6A 1Y9GA 2ORZA 4INDA 3WUCA 1QMJA 2IVIB 3MLJA 3L2HA 3UGGA 4CSWA 1PX3A 4FTSA 4UF0B 3PUHA 2F4PA 2NLRA 4DEQA 3WSOA 3IMNA 5CFDA 1BEV2 1OD3A 2ES3A 2LROA 4M01A 4CU7A 1QH7A 3OEAA 5FMOS 2A75A 5FLJA 4MZUA 3Q8BA 1KFXL 3GHNA 4FCAA 2Q0AA 4Q4W2 3HN1A 1HQLA 3UKNA 1W2UA 2EA7A 2G9ZA 2IXIA 4JDOA 5IVYA 3UYJA 1VBD1 3LDRA 2OKXA 5DAPA 3TRSB 3ZYBA 3I2IA 3ETQA 2BVVA 2ADDA 1LGCA 3TEXA 4RYDA 1U5ZA 5IK7A 1W05A 4D3WA 3WNOA 1GMMA 3HN3A 3LEGA 5CIRA 5FY5A 3WY6A 5FUPA 4GB33 3RPQA 1F2NA 5I0UA 1GOGA 4LOSA 3O0VA 4LO7A 5LA0A 1OKQA 3AX4A 1XJAA 1C8M1 3OF1A 4XEZA 3AP4A 3USUA 4UW3A 2W2IA 1SHWB 4HKWA 4KH9A 5FO7B 3VBOC 1VMFA 2GN3A 3ATGA 5FZ4A 1ZVFA 2C1FA 3AFKA 1CR7A 5SV5A 3WVJA 1UKGA 1CX1A 1Q8QA 5C4WC 2VBDA 2ZGRA 4XTMA 4PLMA 3PMEA 1X7NA 2HWE2 4UW5A 1WWYA 4FVVA 2X5IB 4YGDA 5FZFA 3RI8A 2BNNA 4UFHA 2VULA 3UJOA 3HWJA 2JDMA 2G9FA 2WDBA 2C9AA 1CAUA 2PHLA 3POWA 2TEPA 1IGOA 2E31A 3NAPA 1ONAA 3AYAA 3LQCA 5E89A 4CCKA 1NOVA 1OT5A 1FV2A 4UFMA 5C9AB 4EV0A 1QJEA 3EB7A 1RUNA 4QU1A 5FK8A 4OFGA 4E4HA 2IVJA 4GMP0 2HWE1 4FAHA 4A6OA 1WCKA 1FAYA 1QGLA 5LBBA 3V56A 5FYBA 2W08A 4QXKA 5IAVA 1TMF2 4AF9A 5A7SA 4RSUA 4MLOA 3M3OA 3NNJA 3FFQA 5HCFA 4AG4A 2VPVA 5FP9A 1TE1B 3ZSJA 1ACCA 2JDKA 4OZOA 2PELA 4QX2A 3ELNA 1HRI3 3RSJA 3HEIA 1W8ZA 2WN2A 5FYMA 3AL5A 5LRSA 2XDVA 5JAXA 2YU1A 3HBZA 2JDYA 4OHVA 5F3CA 4BXSV 5CAZA 1JYIA 4GWJA 1NE6A 1K3IA 1QQP3 2PXJA 3HT2A 4LHLA 1VRBA 3KVBA 2VMEA 5I91A 1POQA 3A7QA 1HJGA 1NG0A 2YBKA 3NV1A 4DXRA 4FP2A 2CL2A 1MR5A 1D4M3 5FYIA 5FRAA 3N9QA 4K8FA 1KS5A 1ALYA 2JIJA 2YUEA 1VE0A 3U07A 5EIYB 2O8OA 2Q1ZB 1V6JA 5KXBA 3PNAA 3LA7A 4UOJA 3V0BB 2BOIA 4C91A 3S5QA 4CDXA 1RVF1 3J8F3 4IEYA 5F5AA 3LKJA 5FP4A 1XNAA 3NJYA 3B7MA 2BZDA 4YNIA 3UESA 3VBOB 5FXWA 3RYRA 2JKXA 1QJU1 4O9EA 4FTBA 4E4DX 3WF4A 3EQEA 1WMDA 2HBTA 2XJTA 5FYSA 2W87A 5C4WB 3BTZA 4KWLA 4XXPA 5C3OA 2UWBA 3THDA 4HN1A 2N7GA 4L2NA 2ZX2A 1NKGA 5FK7A 1RUD3 2YROA 3OBAA 4XABA 3KS7A 1RUI2 4ZS2A 2W3JA 2L9LA 4HK9A 1XU2A 5A7WA 2X05A 1UF2C 3ZN5A 1SG3A 2WNEA 1SBEA 1ST8A 4IE6A 4LBMA 4LIUA 4U36A 1QWRA 1JBCA 2KD7A 2DVAA 4NIHA 5GLWA 1O3QA 1UXZA 4QX7A 2QQPA 2E63A 1W3VA 3POBA 3RS6A 1AHSA 1S1AA 2Q1FA 1O59A 1UOFA 2ETEA 3M1HA 5DN2A 4XTPA 4QB6A 3BTXA 1N3OA 3GHMA 1CQ9A 1J3RA 2ORXA 1AYN3 4R9AA 4CCEA 5C33A 3KCXA 4KBBA 3K4DA 4FI9A 4D6QA 2RS13 4C90A 2QUOA 2R061 2VW0A 1NLQA 5FZ0A 3NJZA 1JZ3A 5BNOC 2VM9A 3J4UH 4AI9A 4JDMA 3O1RA 2WL1A 4EQVA 5F5QA 1NXMA 1AR72 3JQWA 4YVWC 1H6YA 2ZGMA 2VNOA 4YSFA 3ROUA 1ND2C 2B45X 4CEWA 5J48A 1XE7A 3P6BA 3S7EA 2JECA 3ZR6A 1UN1A 1RUC1 2GC0A 3NWKA 3O14A 2R043 1VRH2 3WX5A 2R32A 3RMYA 2ILMA 1OA4A 4OI2A 1RYYA 4QDSA 2CWMA 4AQSA 4J6GA 4GWMA 3ITQA 4IERA 1JYVA 2VR4A 3ZVXA 4DUWA 4CEYC 1GZ9A 2XOMA 3BYWA 5SV8A 4MUVA 2JG8C 3I2JA 2Q1MA 2AYHA 3ILNA 4PJYA 5FQ0B 1XNBA 5KC5A 4JAAA 3ZN6A 4DFSA 4ASLA 1POV3 3PU3A 1ZX5A 4XILA 5FO8B 5LB6A 1KGYA 1NUKA 2B8MA 1X8EA 3N7KA 2FCVA 3O1VA 2GNBA 2XKOA 5FY0A 1F4HA 4MXWA 2A73B 2WC2A 4LBQB 1KD7A 1BLZA 4WBBA 1LOAA 4IW3A 3N9NA 5JCTA 4IV3C 2A3WA 2VOTA 3OUJA 4XBNA 2R1BA 2PHFA 3RDIA 1AR92 3TN91 3DL3A 4ISRA 2DFCA 1XQNA 1YYNA 2A6VA 2CAVA 2R30A 1J1TA 1FMD1 3DYPA 4QM9A 5F6KA 3S30A 3D3AA 5DG2A 4D6SA 5M0TA 3MV11 4OZXA 4UFKA 5BPXA 3TYJA 3BALA 3AXEA 2GC1A 2FHRA 3MI8A 4BJ0A 2YYOA 1LENA 2ARXA 1X36A 1LOEA 2R49A 4ASMB 5KHHA 1BEV3 5H9RA 3AKSA 3VZKA 1COV2 1RUH2 3E5QA 1NCRA 2Z2SB 4K8RB 2GMPA 1PO21 1XE0A 1PZ9A 1AR91 2YPJA 3JCIA 1SZBA 4Q4W3 2FDFA 2B5HA 1S0IA 5BNOB 3HNBM 5DPNA 2VQTA 2W1SA 1APNA 3J26N 1G9BA 5CFDC 2PHTA 2WS91 4RN5A 2VQ0A 2H0VA 5IVJA 2ARBA 5HCHA 1V6OA 4TWTA 2ZHKA 4YVWB 5I93A 4CCDA 2QJVA 1GZWB 1WW4A 1JODA 1ND2B 2LALA 1ULEA 5E6HA 3U0ZA 3WCSA 2WZPP 4XFGA 3IDAA 3T2QA 3VKFC 1UOJA 1UPSA 3FHQA 4DXSA 1Z78A 1R1A2 5JSRA 3U14A 3VBRA 2RM21 1UL9A 3J7NA 5JOYA 4JTNA 3VBHA 4B7KA 4M3CE 2D40A 5EYXA 3CF6E 3Q8EA 1DF0A 4PCRA 5FXXA 5LBFA 1AR61 2OIIA 2CY6A 5KXEA 1CZSA 2IXHA 1JHJA 4CEYB 3WF0A 3KVAA 1XE8A 1LKNA 1ZBA1 2C0ZA 2JG8B 3KF5A 2ATFA 2VTFA 4CP9B 1DQ2A 4BH9A 1IS5A 5FZ7A 5L7OA 1ZNPA 2NMOA 2B9VA 3C8XA 2Q30A 2WO1A 5FTTC 1RHI2 2EXKA 3OOXA 4LNVA 2PLV2 5T5JA 1QJFA 4Q8LA 4AHYA 1JYWA 2QCSB 4LJHA 2BGCA 2B9UA 2WZR2 2A70A 3WF3A 2RS33 4BMBA 2HYKA 1C3HA 2VH9A 2ZGTA 4AHZA 1AX0A 2QQVA 3ZFEC 3NAPC 4IV3B 1OFSA 1L7RA 4YZ2A 3MICA 4FO9A 1MACA 1ND3A 1X82A 1TMF3 3OUHA 4CXWA 2VZVA 2ZZQA 4I0AA 1D0HA 4QGLA 5LATA 1DDLA 5HCBA 3FBYA 3B69A 4L97A 2NN8A 5F8PA 1C28A 1RHI1 3K2OA 5DAVA 3OPWA 1UOBA 2VTXJ 4XJZA 4KU8A 5JXGA 1BXHA 4LT5A 4XAEA 5C5TA 2QQKA 5FYTA 2WLQA 3KWVA 4P14A 3I2GA 1SLCA 5KR7A 4EWAA 2BBAA 2BERA 2CU5A 4CZSA 1UZZA 5AFBA 3OGGA 1H30A 4DOUA 4COYA 1H2MA 2DCKA 4YW4A 3W5MA 1YUDA 1W3XA 1F9KA 4AFAA 1ULPA 4Q4Y2 4EYUA 3S0MA 5FPXA 5CFDB 1NCQA 1UX6A 4AYUA 4Y26A 4HVQA 4UW4A 5I0SA 3WW2A 4JQTA 4QX1A 1JI6A 4DXZA 2A7AA 3D0SA 3FX3A 5T50A 5KWRA 1J84A 2RV9A 2VVDA 1BQPA 1HB1A 4W6YA 3JU9A 3BCWA 3PL0A 4FOWA 4FAGA 5J96B 3LIHA 4BQ1A 3T4HB 4JTOA 1SEFA 2HEVF 1MS1A 1QKQA 5T5PA 5JOZA 4Q4Y1 4LPLA 4X6RB 2ZMLA 4I3GA 2OS2A 2K2SA 3SEEA 2DTYA 1YFXA 5A70A 4YG6A 2OYZA 3O1SA 4QPGC 4PLNA 2VZRA 4L11A 1YIFA 1U5IA 1C5HA 4UFIA 4CDXC 2B7YA 4DS0A 1MS4A 1V6LA 2WYFA 4NRMA 1JU4A 2HWB2 3VGIA 4DQAA 5FZIA 1BBT1 2C6SA 4L0PA 5CZKA 4EN6B 1QF3A 2WABA 4JGYA 1AR82 3FN9A 1RUI3 2FZ2A 4M0NA 2WZ8A 5A7OA 1QJY1 5JSPA 3KT1A 3MPPG 4Y4RA 1CGPA 2XBO2 2VUDA 3GDBA 5FP3A 1PIV1 2XKPA 5FFOC 3JXSA 5J3UA 2XWJB 3RZGA 2UWCA 4ONUA 5CADA 5FKCA 2DVDA 5FZ1A 3ZFEB 5J36A 3NAPB 5F39A 4B7EA 3M3QA 2QQIA 3PVBB 4KWUA 5FCCA 1RMU2 4HANA 2JICA 3BI3A 1N3QA 1ENXA 4E4ZA 1AR81 2PQQA 2WO3A 1DP0A 1YQ6A 1SBFA 1TME1 4LBJA 1PX4A 4PQ9A 2Q8EA 3H8OA 1D2QA 4E9KA 2OUHA 3D82A 4BWOA 5FV3A 3AZYA 3CL1A 3R6SA 2JDPA 3OTFA 3ILRA 5BUVA 2ZEXA 5FZ9A 3FFZA 1RB8G 3GZAA 4LA2A 4M3CF 3T0BA 2P37A 3AZVA 2D43A 3LFMA 1AR73 1LGNA 5CEHA 3OJBA 4AGGA 3I49A 2YGLA 1NY72 3MW4A 2XMLA 4ZU7A 2WSVA 2XVKA 2ZJCA 1YEWA 3HOBA 1MZ6A 5A1AA 2Y6KA 3IAPA 5GZDA 4A6SA 4ZU5A 5AFEA 3HNYM 3DXUA 2XLAA 1VRH3 1IZ3A 2WSUA 4SLIA 1VMHA 4D7YA 4UT5A 5IYYA 4CU9A 2JDZA 5AC91 4PLOA 3H9AA 3WNKA 4CEWC 4FOQA 3FLTA 4K40A 3MO4A 4YW6A 1OLQA 4GA9A 3H50A 4AHWA 4RGGA 5FZGA 1DG6A 4RHV2 5IWFA 5LASA 4E4SA 1W9WA 1OMIA 5BNQA 5BNPA 1EV11 3WP4A 1S2KA 4H7LA 4Q4X2 4QPGB 2Z5WA 2OZJA 3EYPA 5IJRA 5KHGA 4CDXB 5IW0A 2NP0A 2RR12 2ZHLA 5CFCA 4BLJA 1QDCA 3MZHA 1I5PA 3MV01 1JZ4A 4KGGA 1US2A 3ZLIA 5KC6A 1R082 1X33A 1UO9A 3B01A 4HKLA 4OMCA 2BVBA 1OKOA 5LWBA 1D0GA 2XG3A 4Q4X1 3TAYA 1MS5A 1WBLA 4H55A 1OOPA 3N36A 1MS3A 2VUCA 3BUCA 1ZZCA 2RR11 1QXPA 3CKHA 1J1LA 5FJHA 5IK4A 5JVVA 5T5OA 4IEPA 5A7WB 4GJYA 2JE9A 3CZJA 2CNAA 4YGEA 3VBSA 4B1MA 3LFIA 3GBFA 4XF9A 5AVPA 1A3KA 1W2OA 2BGPA 3ZYIB 2D6NA 4BPZA 2HWC2 4P9YA 1COV3 1H1MA 3KLSA 5J09A 1RUH3 1YC61 2BDRA 3G7DA 3AXDA 4CUCA 2PHDA 1S0DA 3WG3A 3HAGA 1O3SA 4XFIA 2BBVA 4IL7A 4LO6B 1CZTA 1WLWA 5FZKA 4RS5A 2QVSB 1PNGA 1SQ4A 1VBE1 1K5JA 2YMZA 3N7MA 1NCRC 2VMHA 4OUSA 4LKSA 5HV4A 2AREA 2OXBA 5ANNA 1XNDA 5FZ6A 2RMU2 2HWC1 2OA2A 4MGSA 4CDWA 2FDKA 3WF2A 5A3WA 2YV8A 2J1UA 4OHZA 1DYKA 1D2SA 1VBB2 1W2NA 1R1A3 2YC0A 2Z69A 3BOPA 2DBNA 1W6OA 2W0XA 4QXCA 3LSDA 5JR7B 4QM8A 4IEZA 3KQ4B 1FV3A 2XL7A 3ORJA 3POJA 4K21A 4CEWB 1GOFA 4BLIA 1LU1A 3PVOA 4Y22A 5LBEA 3LA2A 1DZQA 1N1SA 3FJSA 4V2VA 3K77A 4X6QB 1YO8A 2RMU1 2ZGSA 2TBVA 2W68A 3VBHC 1GP6A 3GM8A 3WDVA 2R072 2ZX1A 4LBLA 4PDWC 1UY4A 4FPCA 1UU4A 3URFA 4QX3A 5A3TA 4MH0E 4BB3A 5LEJA 1BMV2 2W1WA 5FXVA 2PLV3 3GCXA 3F95A 4QX5A 2RDRA 1JN2P 2SLIA 4CP2A 1OHFA 1QNWA 1O4ZA 2WZR3 3FC0A 1VB2A 2V5YA 1RL3A 2DV9A 3ZN6B 5L7OC 4Q2FA 3WW1A 1W6NA 1O8SA 1GZCA 4CCCA 4QDQA 1OQEA 3MIGA 4P9LA 4S2FA 2RS52 4NIDA 2GP3A 2K9ZA 1QDOA 2BYVE 3MIHA 3LEMA 1GV9A 2W47A 5ANQA 4HT1T 3MIBA 4TTGA 4Y5TA 1S0EA 1WLTA 4WM7A 3SCHA 1Z7S1 1V70A 4XZPA 4XOGA 1HRV1 1ND3C 2VMIA 3E6BA 3FLRA 3ACGA 1ULFA 3JB4C 4QT6A 3MF6A 1LJ7A 1DZRA 3ZYFA 3JBG2 4D69A 1UWWA 4NHYA 1BVVA 1OC1A 2A6YA 2RS51 3KB5A 5JDBA 1YQ8A 4JC1A 2CYFA 3FUOA 5DZEA 1DYPA 4JKMA 3WG2A 2BPA2 1E5RA 2D3PA 4QWNA 4FPFA 4P00B 1NCRB 1EAH2 4M3CA 3T30A 3TBDA 2ZMKA 1X9TA 3CIHA 4PHZA 4XUTA 2DVBA 1GP5A 2A71A 2YC4A 4HK8A 4LBKA 4CRQA 4BQWA 3B5LB 4FFIA 3POGA 1QU0A 2AH2A 5F9TA 4GWNA 1NCQC 1DLLA 2QQUA 3ZXDA 2WUHA 5KHKA 1GWMA 3H7YA 3IN9A 4LBOA 1LOFA 4IV1A 5JR2A 5EJZB 2GNDA 4IEWA 5DDJ2 4B4RA 4P9WA 3ACIA 2CDOA 4LKEA 2ZBJA 3IZOA 4CE8A 2BTVC 2DCTA 2BUKA 4K7JA 4YW7A 4CCLA 4ZKTB 2Y6LA 1HB2A 3NV3A 1AYM1 4C1XA 1ZM1A 2F17A 2HWB3 4PT6A 4KMQA 4YZ3A 3VBHB 4OCTA 5EFUA 1YIPA 1OA3A 1YI7A 4HVRA 1UYYA 1YJKA 4PDWB 1W6MA 1ZZ7A 1AR83 2WQ8A 2WN3A 2W52A 4HOOA 4N9IA 4RR3A 5DDJ1 5GLZA 4CUAA 5KHJA 5IT6A 1PZ8A 1SPPA 1ZRDA 3IAQA 1S2EA 2ERFA 1AX2A 1W8UA 1WA4A 4AVTA 4QHZA 2XBO3 2D44A 2EIBA 4LORA 1XRUA 4GAZA 4JGYC 3O1PA 2ZEZA 5L7OB 5F5CA 2RVAA 3U4SA 1V0AA 1RMU3 4CXYA 3E1F1 1S4CA 2W95A 3B9CA 4XXAA 5FZOA 1NZIA 2QKDA 1YFYA 1UY0A 4LITA 2V4VA 5DQ0A 4BM8A 3NQHA 4Y5SA 1PM7A 4YM1A 5JI9A 2WFPA 3I2OA 2JKBA 1ND3B 4BZ4A 4R4ZA 1VBD2 3ES4A 3GJBA 3NW4A 1PVC1 1OD5A 2PA7A 2XJQA 4EWDA 1QOOA 4XJ8A 4AOCA 3ABZA 3ZXFA 2CV6A 2GMEA 5ABJA 4PF5A 3CMGA 3SCGA 3OBZA 2PYTA 4IEVA 4ES8A 2Y26A 2W92A 2D7FA 1IS4A 3EBRA 4GQ7A 4XUNA 4EZ4A 2JJ6A 4NIAA 3ZM8A 4AW7A 4IEXA 5LK7B 1C8M2 1F4AA 5FZEA 5GM0A 1WA6X 1DZTA 2EALA 2VOVA 3ZSMA 3J7MA 3O5SA 4F7ZA 1NCQB 5T3NA 4WM8A 5GLVA 4XDQA 4HZFA 3S6PA 1OUSA 2H6BA 4AI3A 1SLIA 2X10A 2YBSA 4RHV3 4LMFA 3DPRA 3T2PA 2OQ6A 1D4VB 4E27A 3FLPA 1LODA 5K0UA 4DB5A 4DPNA 3U4XA 1DQ1A 1QJX1 1REFA 3LCPA 4QKBA 1W9SA 2XXZA 4GH4A 4CU6A 1PO12 5BNPC 3H8RA 3WHUA 4WVMA 3O1OA 1R083 5APAA 2WQ4A 2EAKA 1Q3EA 1T6GC 4BE3A 5FOBB 2YXSA 1NQDA 4QQ2A 5CFCC 1HQWA 4CCOA 1S0FA 2C26A 3TEYA 4JGYB 4P9XA 1HXS2 4CP1A 1BJQA 1W2TA 3AZZA 3OBRA 1IKQA 3ETPA 1PO11 4AI1A 1U0AA 1Y7BA 2IXJA 4IE0A 3ES1A 1CN1A 1WCUA 1X50A 1ZRRA 2TNFA 3DCQA 2OPKA 3HVDA 3IDCB 2H6CA 4MXVA 1OOPC 1LESA 3VBFA 3VD7A 2HWC3 2W94A 3I4IA 4ZPIA 4GMP3 4QAWA 4KI5M 1DU3D 4K6BA 3BIEA 4NVPA 1UZ0A 4YZ5A 2W9XA 3MW2A 1MVQA 4QDRA 3I3BA 1DGWA 2GZWA 1HXS1 4ZY9A 1LHUA 3PUQA 5B4XA 1UMIA 3SLIA 3BB6A 5LY2A 1FOD2 5KXCA 1W90A 2W5FA 4ATFA 1TNFA 1UW8A 4BYYA 4JGZA 1W03A 4W8JA 1GNYA 4FPLA 3LGRA 4KBZA 1A34A 2JEMA 1VJ2A 1WMFA 1KJRA 2DCZA 4RS5C 4JKKA 3T4VA 1OSGA 4Y3OA 5ACA2 1VBB3 4I3PA 1CWPA 1RVF2 3ZPOA 3I8TA 4M00A 1FX5A 1HJFA 3G6JB 4CUBA 4CDWC 2D97A 4WVVA 1FOD1 4EROA 2RHPA 2GH8A 3TEZA 1NYWA 1QJU2 1DBNA 3WLUA 1DQ5A 2BRTA 1AXZA 4FXKB 4GXLA 3JB8A 1PGSA 3S7IA 1DQ4A 4M0HA 4JQRA 4DY5A 2R073 4XUPA 5ACA1 2Y0IA 4LO5B 2Q8OA 4CU8A 3KT7A 1WD3A 1JZ6A 5I0RA 4CXXA 5GZCA 1G9DA 2FMDA 1MPXA 4YZ1A 4W50A 4R52A 5BNPB 3QLQA 1I5ZA 1C5IA 1H2KA 2Y6FA 4H7MA 2BFUL 2E9QA 4Z8BA 2AACA 2J1TA 1ZRCA 3SMHA 3PDQA 1KJLA 1MQTA 2LS6A 1S55A 2WT0A 5IVVA 4Z2WA 2DYCA 2RS53 2IFRA 2XVGA 3RFRA 5FO9B 1AJKA 3AZXA 3NRUA 1W99A 4NRQA 3O0WA 4E2GA 4XIKA 2RJLA 3D4KA 4TZDA 5IATA 4LEJA 3KM5A 1GOHA 5CKNA 3TEWA 2R062 3RZLA 2HWD3 4Q4V2 5C8CA 5E88A 1V6NA 4LO8A 4AK3A 1JTZX 3R0RA 3M7AA 5JIAA 4DNYA 3RNSA 1OOPB 5IVFA 2QDNA 3JBG3 5FZLA 3I2KA 2WWUA 4MSVA 4WM7C 1F5JA 3WUDA 3ZXKA 2O8QA 3OPZA 3ECQA 3NVCA 4IGQA 4YLZA 3PJQA 4BQ2A 2XUEA 1OFNA 3RVHA 5DAQA 3IB3A 1MS8A 5FPUA 3Q8FA 4YRDA 2YB7A 1FPN2 2W39A 4HONA 1RUC2 2VCMA 1XC6A 2DUQA 1EPWA 5FXZA 1EAH3 1YQ5A 2GC2A 3GJAA 4KL1A 2BP6A 4Q4V1 4QXBA 4ARYA 3SH5A 2ARAA 1R1ZA 1F35A 2BFUS 2P6HA 4RS5B 1RTVA 5FPBA 5LY1A 5F2WA 4IGOA 3KCCA 3CLPA 1O8PA 1UY1A 1GNZA 1ZZ8A 1CPNA 2ZOEB 3DV8A 4D8MA 5C6CA 4FFHA 4FBFA 3UT0A 1FPN1 2GP5A 4CDWB 4KNCA 1O4TA 4E2SA 3ZYPA 1W28A 4GULA 3K3OA 2XJRA 3WXPA 2O1QA 1HKDA 1UZYA 3ZDSA 1LOFC 1V9U1 1RUJ3 4IV1C 3GCWA 2PAMA 4L8QA 1W6OB 4LR4A 3VD3A 3INAA 1I1EA 5LEKA 3QACA 1UZVA 2GN7A 1OLRA 2W1UA 4I0WB 3NV2A 4J25A 5A33A 5B4NA 1VLNA 1E5IA 2H0BA 4XMIA 2FDGA 3FMGA 3MHZA 4Y22B 2EXHA 2Y8KA 1AJOA 2NMNA 1TZOA 3AYEA 3GF6A 3TN92 4K20A 3NMBA 4HSJA 4LLOA 3AP6A 5I8YA 1QXRA 3OGRA 2VJXA 2DVGA 1L7LA 1FMD2 1VB4A 2BWAA 3JD73 2WNUA 3OG2A 5FLHA 2XL9A 3VB9A 2J22A 4AAXA 4B1LA 4RR3C 4MO3M 3VD4A 4NMIA 4BOWA 4DUXA 2ZABA 4DXTA 4S2GA 1LHVA 2ZAHA 2WNVA 4HKOA 2LUWA 4AVVA 1DHKB 4BXFA 1ZZ6A 1DYOA 4XCAA 5KHIA 1PO22 1R64A 1W6NB 4WVZA 2VMDA 5FIXA 2WNOA 2J1RA 5FMBA 1AL21 3W59A 1VBD3 1ASJ1 1QH6A 3WV6A 5FZDA 4CYDA 2WS92 2DURA 3DGTA 1W0OA 1JUIA 3E6DA 3T1MA 1WLDA 4WM7B 4A44A 4BK4A 2XONA 2XUMA 2F6BA 4IE4A 5CYYA 2UWAA 1FXZA 3WQBA 2HEWF 4Q26A 4OQ9A 4XETA 3SH3A 3DXTA 3UJQA 4AE2A 3NKTA 1C8M3 3OSDA 4JKLA 2RM22 5FZ8A 2E6VA 3MFCA 5FYZA 3SEPA 4BQ3A 3BVCA 4RQPA 2VY0A 5ABJC 3Q8AA 3C3VA 1AR62 4QPYA 2JD4A 3P3PA 4M3CB 4AHXA 1J59A 1MZEA 3H3UA 2QTWB 5A3OA 1V6MA 1ZBA2 1GQPA 5TSWA 3SCFA 4W6XA 3BGAA 4IUGA 3IMMA 3X29B 4WM8C 2ZHNA 5G05L 4IV1B 2OVUA 4I0BA 3ZSLA 3W5NA 1G9FA 1QOTA 4BQ4A 5T55A 4DY3A 3PU8A 2DWRA 4KWKA 1PO13 5FPZA 3AM2A 4U2AA 3DPRC 2EAAA 3A0NA 2D6MA 1HV1A 2FZ1A 4LE3A 5FY7A 5K0UC 1UU5A 4UWDA 1T2XA 2HWE3 3M3IA 4LUMA 4IE7A 1DGRN 1GLHA 4GH4C 4OUEA 3RYPA 3LOIA 1SMVA 4YGCA 5L19A 4W4ZA 1W39A 1W6MB 1E57A 4O65A 3KHCA 3BKZA 1HXS3 1NA1A 2UYBA 3NL1A 4RR3B 3LDBA 4PI2A 1SPPB 4E8CA 2ZKNA 1LULA 2GMMA 3GXUA 2A6ZA 1PGW1 1VPHA 3U11A 1C4RA 3WQ1A 4QHBA 5J1XA 2ZEYA 1PK6A 3KGZA 1PMIA 1IPJA 2A3XA 5B2GB 1OI6A 1J83A 2GDFA 4XJUA 3PIJA 3VDDA 2EIGA 3AFGA 3ALQA 3VD9A 2AUYA 5D8AA 1LAJA 4LBNA 1E5HA 2AC1A 5BXXA 1URXA 2I07B 1VBC1 1EPZA 1SLAA 2ZA9A 3HIFA 3LWCA 4XJAA 3ZXJA 4CDUC 2NZ9A 3Q8CA 3VBFC 1Y9QA 3O7OA 3HBKA 3WG1A 4X8PA 2V73A 4IESA 1VBA2 3SNMA 3VBUA 3DYMA 4NAMA 3ZXEA 2C9KA 2EXIA 4AVAA 4N43A 3GGLA 1XNTA 1JZ8A 4B4QA 1RIRA 5ACA3 3H8UA 1RVF3 2HEYF 2VCCA 4FPYA 4KG0A 1WCQA 4JGZC 4EN9B 4LLFA 3AZWA 1SCRA 4KGQA 5GZEA 5ABJB 5JPMB 4OHWA 3JQXA 3VKNA 4OHXA 2ZGQA 4D94A 1QJU3 5A32A 1W8WA 1X9PA 2VZTA 3UKTA 4NPLA 1VBA1 1RUF1 3EXUA 4UF0A 5F32A 1MZFA 5D21A 2YG0A 5FY4A 4KU7A 1YLLA 2KA3A 3EHKA 3ZXGA 1BBT2 5D2AA 2UU8A 3LPGA 2MEV2 2UY9A 3WOGA 4WM8B 4Y33A 4TYSA 4CPBD 3ZX7A 1REDA 4C1WA 1QJY2 4S2DA 1CJDA 2JE8A 4XQ4A 3V0AA 3VLBB 3ASIA 3DPRB 4WZFA 3I3EA 1ZYBA 1PIV2 3KCYA 2OX0A 3W58A 5K0UB 4FPOB 3USUB 4GH4B 1RUE2 2MEV1 2Y34A 3HT1A 3HQUA 1PMHX 2AEZA 1EUTA 3IIIA 3NNMA 3FWEA 3QH6A 2DU0A 2XWBB 2A1XA 4JCKA 4WVMB 1G86A 2P17A 3CHXA 1TME2 1W6QA 2VZ1A 5JUVA 1AF9A 4JHZA 5LRRA 2YDEA 1J3PA 3MIFA 3AJYA 4P9GA 4G3YC 2R063 4Q4V3 1YJLA 1MQTC 3N9OA 4G4FA 2VZ3A 4M4RA 2DUPA 4QD2A 5EJ3A 1WW7A 4AEDA 1T6BX 3J7LA 2JDUA 3WDWA 3ZXAC 1CAUB 3SKJE 5C3SA 4R9BA 5A6XA 1G7YA 1RUE1 1MEC1 2I74A 5DZGA 2VMGA 2X5IA 5HI0A 5JLVA 1H6XA 4OQ8A 1UMZA 1PGL1 1Q5OA 4QX8A 1TVGA 2JB8A 3AJZA 3D5OA 3IPVA 3VZMA 3ZMNA 5C8CC 4FTEA 2BWCA 4QHOA 5A7PA 4QU2A 1JZ2A 4RGAA 1FPN3 2XLFA 3VBFB 1ODNA 1SFPA 1RUC3 1IPSA 3MIDA 1W06A 1KITA 2UYAA 3C7OA 5C71A 3MFAA 5A6ZA 2OPWA 2QZ2A 4O9GA 3MDPA 3A0KA 3TB0A 2QNKA 2EVXA 3SITA 2MHFA 4PIZA 5AC92 3D0JA 1AZDA 1UPIA 3VKMA 4EE2A 5IFPA 4RD7A 5FYVA 4QX0A 4BQYA 4GWIA 3RZZA 5DZFA 2JXAA 2ET7A 4JGZB 5LA1A 4B3NA 2P3KA 1EV12 2J42A 2P3JA 3KHBA 4Z82A 2O0OA 1NLSA 1SLTA 1JOJA 2FDHA 1ZRIA 2QQJA 3CJIA 1I6XA 2VG9A 5CISA 4K9SA 2WT2A 2OT7A 4PIYA 3ZYGA 1SLLA 3THTA 2TUNA 4DEVA 2J1AA 4LQRA 1YWKA 4ZU4A 4IQPA 4YW3A 3TOJA 1LNSA 3N7JA 1O4YA 1ZBE1 3TN93 2QQMA 4PBOA 4YM2A 4X8NA 5DUXA 4FOYA 2Z79A 3B93A 1FMD3 2ZEWA 4QPIA 2SBAA 3H8XA 2BW8A 1Q8PA 3IBMA 3OGSA 4LXLA 1E5SA 1XYOA 2VECA 3I97A 1G9AA 2J1SA 1UIKA 3FUQA 4HLTA 4UBGA 4OI1A 4FT8A 2JDNA 5FYHA 3ZPYA 2WNUC 2JDAA 3QOPA 4ET7A 2VQAA 1PO23 3C7HA 1WCDJ 2VBBA 1AR93 2JDHA 3F2ZA 5A6YA 2ZMNA 3UNPA 5F5IA 4R8HA 2VAUA 5LW9A 2WNVC 1HIXA 3I3MA 1O3RA 4A45A 2DU1A 4RFRB 2D6OX 2WS93 3GBWA 3P3NA 3B94A 3KV9A 4WV8A 1VBE2 4B4PA 2UURA 4A41A 1KFUL 5CG9A 1S0BA 5JIUA 5C8CB 1RXFA 2D98A 3PLQA 2R6QA 1QEXA 1CAVA 4PIXA 5I0TA 3E6CC 5IUQA 5FKBA 4EWEA 2YU2A 3HMYA 3SHRA 4GB31 1Y3TA 1LHOA 2RM23 3OUIA 4I02A 3MUZ1 1JYCA 4L9BA 4N7IA 3WNNA 1OPOA 4MHRA 3PUSA 5ERLA 4HBNA 1PZ7A 1DQ6A 2NPIA 2VD7A 3RYKA 1AR63 1CJPA 1Q8VA 4DRRA 2WT1A 3ZMOA 2VZOA 4F8AA 3L2YA 1ZA4A 3PJYA 2X29A 1FNZA 1ZBA3 3DF0A 1QOSA 5FZ3A 3VHOA 4RQPC 4YM3A 2WIIB 4DINB 3Q9OA 4MHUA 1W8NA 1H1AA 1UQXA 2P2KA 1K45A 3LE0A 5DAWA 5FY8A 5EHDA 3ZO0B 3WCRA 1SFYA 3VZOA 5FZCA 1AXKA 3WF1A 4D7TA 1OVSA 1YI9A 2ZX4A 5IHRA 2ID4A 5EV7A 5BY5A 5F6LB 2E26A 2GAUA 5JWPA 3BIWE 4COWA 3CEWA 1W8HA 2GNTA 4A7KA 1QXJA 5E8AA 3VBRC 1GANA 3WW4A 2LTNA 2B4KA 2E53A 4XHBA 4URAA 4BK5A 1S2BA 2V72A 2HLEA 4C0HA 5A33B 1BK0A 1HDKA 4NJ4A 4QQPA 2WRAA 5FUNA 4CDQA 4FFGA 3M8LA 4UFJA 4QKNA 1RHI3 2Q4SA 5EWSA 5F3IA 3OCPA 1JYNA 1Z7S2 2JG9A 4AZZA 2YZ4A 3K4AA 3KD4A 1HRV2 3MF9A 3AC0A 2GC3A 2ZGUA 1XPWA 5A6QA 3OD4A 4AVCA 1D4M2 3B3QE 1V6KA 4FPKA 5C7GA 1DGRA 1HRI1 2WNUB 1GR3A 4XZUG 3LSEA 1NA1C 1NQJA 3OGVA 1YXWA 1H9WA 2GALA 4JRLA 2IUWA 4UYBA 1LCLA 4MXWB 4CCMA 4Y20A 2WNVB 1QQP1 1PK6C 4Y4YA 2VXJA 4KWJA 2ADEA 4K1YA 3AP5A 3VDDC 2WA3A 5H9QA 3ZDVA 2QQOA 3VZNA 3VV1A 5D8AC 1O91A 2R16A 1GZTA 3RZMA 1D4M1 1F15A 3H1WA 4N53A 4HVOA 3POIA 5FWJA 4NAOA 1NLRA 2BQPA 2HJIA 2HH9A 4QXHA 5A80A 1UNBA 5A1LA 4XACA 1W6PA 3AMQA 3T1LA 5JXHA 3AMNA 5F3EA 2ENRA 4Q4Y3 1I3HA 2WINB 3J8F1 5K4LA 3RRDA 3VBUC 4CCJA 3MUY1 4GD4A 2JWPA 4YW5A 1H8TA 1HQNA 4N43C 1JYXA 1A8DA 4IDZA 3A4UA 1XU1A 4DRVA 5HBAA 4UI9L 4FSJA 1HV0A 1AYM2 1OH3A 2V5DA 1W9TA 2Y60A 5CBLA 2Q5TA 3U37A 1NT0A 1JOPA 1BBT3 3SQOA 4IEUA 2MEV3 3ME2A 4RQPB 5CVRA 3DN7A 4NIIA 3T2TA 4D7SA 2Y0OA 1RUD1 3OPTA 1OLME 1QJY3 2DFBA 3ZIXA 4NUBA 2DVFA 1AYN2 2VGDA 2R7EB 4Q1PA 2I2SA 1IKPA 3SKVA 1J58A 1PIV3 2IXCA 2PQSA 2RS12 1GSLA 3P5BA 5FUIA 3VBRB 5ISLA 4EN0A 1GUIA 2CGPA 4XMAA 1RUE3 4LO4B 4TXWA 3SC7X 1AL0G 1HB4A 3C7GA 1OA2A 2FMYA 1K12A 2XB6C 2W91A 4JRAA 4P5YA 3APBA 3H0OA 1GNHA 2XHKA 5A3LA 1TME3 1U5XA 3DECA 2HYXA 1AYN1 4GIQA 2IZWA 2VOXA 2RS11 3W9AA 3I59A 4MG2A 1HB3A 3WG4A 2Z42A 1PVC2 2ZGKA 4BIFA 4ATEA 3LIGA 3FBMA 1YQCA 2QQWA 3JUUA 5FZAA 3H1MA 2RE9A 4WVWA 4XURA 3R05A 5L9VA 1H4HA 5EPAA 4AEDC 4AFCA 1LHWA 4R9DA 2G1MA 3PUAA 4XBQA 4XJWA 1PK6B 5EJ1B 4LTAA 4HFSA 1JXNA 2P3IA 3UK9A 3VDDB 1H4GA 3HQRA 3QD6A 5A7NA 4YFZA 5L73A 4N9HA 4AVBA 1CX4A 4MGQA 3ZOIA 4XCBA 1DLCA 2VMFA 3ON7A 3KSCA 2R041 1UKRA 3BOWA 1KEXA 4FP3A 4ZZ5A 2A6XA 5AC93 1K42A 1CPMA 5FZMA 3UL2A 3IM0A 1BYHA 1KXGA 1J3QA 1KQRA 2DCJA 3B9IA 3MPBA 5FJKA 5T52A 4AI2A 1IG3A 2KXLA 1SDDB 5L9BA 2CWSA 1RUOA 3HQXA 1LOBA 3VBUB 4V1PA 1EV13 2YY1A 4Y1YA 1BMV1 5JXJA 4N43B 3FL7A 1QJX2 3EMRA 2WYSA 2ZPXA 1GYKA 2VXRA 3TWIA 2RJ2A 1YRZA 3POYA 4Q27A 1POV1 3RJRA 2ARCA 3A23A 2WQZC 5A32B 4OVEA 1OUXA 3RZHA 4IGPA 1O7FA 4JHTA 3DKWA 1O3TA 3RWNA 3CJIC 4A4AA 2A3YA 4K3UA 4LKFA 4Q4X3 3D8CA 3OGJA 1UX7A 2Y38A 2VZQA 2XVLA 4WZCA 1W0PA 4PF1A 3L9JT 2VNVA 2RR13 1N1VA 4ZS3A 4BA6A 4B8EA 4XE9A 4ZZ8A 1UY3A 3V0AB 5JZGA 1ULDA 2AR6A 2G4IA 5I0DA 3NKGA 4AGVA 4MVTA 1CZVA 2R1DA 3IKWA 2J7MA 2Q8DA 4QPIC 3KV6A 1BEV1 1U5YA 1MVEA 4XF4A 3W20A 1WKYA 2CDPA 5FAXA 4KQ7A 4Q4W1 1EP0A 4NWWA 5CKQA 2OW4A 4P08A 1A8MA 1VBE3 4ASKA 1W6QB 4A3ZA 1RJ7A 3ZKUA 1GWLA 3S5AA 1BCXA 5JOXA 1VMJA 3PHMA 5DUWA 3USSA 3LZZA 3O1UA 4AEDB 2C5DA 3B02A 4XFAA 5F2SA 3ZYRA 4URTA 2NM1A 2A5ZA 2D6PA 4AI8A 5H9PA 5HXVA 5JSOA 4DZGA 5JMCA 3H3ZA 3VBSC 1XBFA 3I3QA 4RA0A 1KS4A 3DKQA 3IPVB 3T0AA 2B39A 1AUYA 3ZFEA 3D6EA 4XC9A 5L36A 3PVNA 3LOBA 4CTEA 1JMUB 4NN0A 2RMU3 5C70A 5CG8A 4EN8B 3KQRA 2RS32 4FFFA 2JIGA 4YGBA 2PFWA 2Y6HA 4N7UA 4XQDA 2YPDA 3T08A 5A3NA 3AKTA 4KG8A 1M06G 2QE3A 2GH2A 3N9MA 4AI0A 4META 3N9LA 3RG0A 5E1RA 3GZEA 4J1XA 4AL9A 5FMDA 3NO8A 3QBQA 4NROA 4QB1A 4YYOA 3S57A 3AP9A 3BU0A 1ZZBA 2D6LX 4R9CA 4GALA 5DABA 3IIAA 5FY1A 1STMA 2WO2A 2ZKLA 3CJIB 5C3PA 3AK0A 2RS31 2J1EA 2QFEA 1D7PM 4CPBA 3CJXA 5BNNA 2D5HA 1FI2A 1YFUA 4XFHA 1O6UA 4XQWA 4CA9A 1VAKA 1CIWA 1TMF1 4O61A 2WO7A 1JH5A 4XF0A 5EZWA 4XHXA 5LZ6A 4MADA 2VCAA 1Z7S3 4OULA 5JPNB 1HRV3 2WZEA 1PMJX 3VHRA 4TLFA 1N1YA 3MIEA 1UXXX 4CDQC 3VHPA 1OBNA 2J1VA 4QPIB 1Y43B 1OQ1A 1OF4A 3LEIA 1IS6A 1F8VA 2JG9C 5CFCB 4XFBA 4MV2A 4QPGA 5I8SA 4S2HA 4YPJA 2FCTA 3U1XA 5H9SA 3LA3A 2PHWA 1PVXA 1OVPA 3KV5A 3AP7A 3RI9A 2FDJA 2MNGA 2VVFA 2FQPA 5GZGA 5FPLA 4HXCA 5DUVA 1H8VA 3WP5A 1PM4A 2GU9A 1H2NA 2VE1A 4LBQD 4QMAA 4XF3A 3CBNA 3POEA 4Y24A 5GKAC 4XF1A 5FDBA 4OLLA 2BNOA 2QQLA 3VBSB 4RFT0 1GQHA 3WT3A 2PN5A 2AEYA 4FXGB 1XNKA 3UKVA 5HCAA 4N53C 5IVEA 1CAVB 2I45A 3CDZB 4MGKE 2PAEA 1QJZA 3CO2A 1YFWA 4GZ9A 2AZ5A 3T09A 3GZUC 3VDBA 4HN0A 1V9U2 3AL6A 3GYDA 1AYM3 3K4ZA 1R092 4DIQA 1GQGA 2DBIA 2ZX0A 3HD8B 4DO0A 4EN7B 3VD5A 1SCSA 4XFCA 1MS0A 1O5UA 2VOKA 4CVUA 2VUJA 3VUOA 1H8TC 2C24A 2C4XA 4FPEA 2BJSA 5DDJ3 3AYDA 5J98B 1GICA 1WMEA 3FHIB 4GKXA 1HN1A 2E33A 4NPRA 3VL9A 3W21A 3WINE 4HSLA 1UD1A 1LECA 1RUI1 1ZRFA 3QCWA 4NPMA 5LBCA 5J37A 5CKMA 2PAKA 4Q5OA 1H0BA 3MLKA 1R091 4COUA 2WJSA 3N3HA 2E51A 1SACA 4E2QA 2KM2A 1W8OA 3JZVA 4QKDA 4TN7A 1UMHA 2VTXA 3IT8A 2WFF2 3LPFA 3AB0A 3CQOA 2XQXA 2WWSA 4P02B 4Q0VA 4QKFA 1LGBA 3VKOA 1Q43A 1RINA 1XSRA 4NR1A 4Q0SA 2VW1A 4AQ6A 2PHUA 3B00A 1AL22 1IQAA 1ASJ2 4CDQB 1PVC3 1EY2A 3AKQA 4MGTA 3K46A 4A2UA 3UGHA 4JDNA 4I01A 4ARXA 1WLCA 2JG9B 2WKKA 4YVSA 2WFF1 1AR71 5C5UA 3ACHA 3IDEA 2GNMA 1AX1A 1JOBA 3DYOA 4SBVA 1HW5A 3AVSA 4DUVA 2G9GA 3E97A 4UBHA 1C8NA 1POV0 1VALA 1Q8OA 2HWF2 5GALA 5I8TA 2X8KA 3AKPA 5A1FA 4Y20B 2UY8A 1VRH1 3WDYA 4OI0A 4BIOA 3MYXA 1Q8SA 3H3LA 3M3CA 4XUOA 1ZREA 3AMPA 3MLLA 4I30A 4XPVA 2XJPA 4XJ9A 3NNLA 3ZYHA 1BZWA 2VQUA 4N53B 3ZSKA 1F31A 4NWVA 1UYPA 5BV6A 1B35A 3AMHA 5LCWL 1OLMA 2XH6A 1WCSA 5DG1A 5FY9A 2DDUA 2FCUA 1YNAA 1W6PB 2JD9A 3M2MA 4XBLA 1QJX3 1BK1A 2HWF1 2BU9A 3LF7A 5FPAA 3TNPB 1FT9A 2A6WA 3O1MA 1DGLA 1H8TB 2OUJA 1U12A 3OY8A 2DTWA 1CAXA 3V64A 2K46A 3U10A 2D3RA 3I3DA 3ZFGA 5EXOA 2E7AA 4HPKA 3WNPA 5FZHA 2IXLA 3M4FA 4K1ZA 2YFZA 5FP8A 1SDWA 1PNFA 2LM3A 1RC6A 2DUOA 4OUMA 4F3JA 4XFFA 3OYWA 4AVSA 4QPWA 3ZFFA 1CONA 1L3JA 5HPOA 2E32A 2Y64A 3K3NA 1CAWA 4Z07A 3VKLA 4AQTA 3R4SA 1PGW2 4AXOA 1ULOA 4HMZA 1VIWB 2LRPA 4JVAA 4TSVA 3OD0A 5FP7A 4YG0A 1XYNA 4NOTA 1W8TA 4A7YA 1GKBA 1COV1 4COVA 2FBEA 1RUH1 4XUQA 1Z0HA 4ISQA 4PQQA 4BCUA 1OH4A 1VBC2 2CAUA 5JZGC 5FMCA 1V6IA 3LAGA 3O12A 1WGPA 4CUGA 1BVP1 5JMOA 3H1YA 2B42B 4IEOA 2ZCWA 2ZZJA 3MW3A 3RWKX 4BQ5A 1SBDA 4CP0A 5FWEA 4PDWA 4FQ4A 4AEMA 3I59B 5EP9A 4QGNA 3ZR5A 2VZPA 4Y5Z0 4Z92B 4Z1VA 3RZJA 4BDVB 2AENA 2B46X 2IFWA 3V65A 4OHYA 3WQ0A 2CGNA 1UCXA 1CIYA 5GZFA 5FZOB 3CZUA 1S0JA 1R1A1 1M4WA 3I2DA 4LK6A 1H1IA 4L92A 1FOD3 2ZGPA 2XGXA 3J9SA 4NE9A 1LHNA 2MPFA 2KR2A 1KRIA 1JHNA 1CVNA 3H7JA 1DCSA 1RUF2 2VNRA 2ZHMA 5E16A 4BHPA 1K5MA 2K0GA 3LDKA 4HG6B 3RJ2X 4LULA 3ZKYA 2WAOA 4IETA 4LIVA 5LA9A 3ZSEA 5C8WA 3TNQA 2P1BA 3BU7A 3RGBA 4XW3A 1JU3A 2P34A 3U75A 2WR9A 1ZZ9A 4OMDA 4P5HA 1UAIA 3MBWA 3HNMA 2PLV1 4EJRA 5IAXA 1W9FA 4ITCA 1OF3A 3QH7A 4L99A 4ZXEA 5A3MA 3U78A 3I7DA 5FOJB 2WZR1 4R4XA 2X53S 3GNEA 3P1IA 5FYUA 2EF6A 1G8WA 4QB2A 2FDIA 2RDQA 3KZ4C 5AVAA 1DFQA 1LEDA 1UU6A 2BEOA 2OZ6A 3KF3A 5FBJA 5LK5A 5A3UA 5IK8A 3J7HA 1X8MA 2HKXA 4Y1XA 3WZ1A 2WWJA 2XPJA 2JENA 3BN6A 3BTAA 5BNNC 1VR3A 5A3PA 3UETA 5JOWA 1VP6A 1IHMA 4IEQA 1EYBA 2P5BA 2V09A 2JE7A 1MEC2 4MGIE 4NHMA 5HXMA 4Q1RA 4A3XA 4XAAA 3THCA 1KDMA 1ULGA 3WNMA 4B29A 1PGL2 3OB8A 5JZGB 3T0DA 3R4UA 4A42A 3AYCA 1JYTA 2PMWB 3WDUA 1FYUA 1TNRA 2ZX3A 3VDAA 4BQXA 5DXDA 1UY2A 4H14A 1P8JA 4N90A 4YWAA 3KGLA 4NHXA 2IWGB 3I2FA 2CTVA 5HV0A 3GBGA 3AKRA 1GFF2 3WNXA 3AMMA 4C0BA 4NHLA 3HJRA 5DMYA 1CESA 4Z2AA 1RXGA 4CDUB 4JZRA 3NSTA 1C1LA 5K9YA 2W1QA 2VBPA 5DUUA 5C9AA 1H2LA 4MGYE 1NE4A 1V9U3 1XB9A 2CSGA 3WR0A 1R093 3C2UA 1BHGA 4HETA 5CNAA 1LB2A 2P6CA 2IC1A 4UXAA 3ILFA 4ES9A 2HWB1 1L7QA 5EQUA 5A7QA 5K7PA 1ENRA 4YW1A 1G6NA 4RGKA 1EUUA 2JB4A 4LA3A 1H9PA 1MS9A 4LE4A 1RUG2 2VUAA 4UAPA 1ZBE2 3LB9A 2Q8CA 5FYCA 2Z4FA 2P4EA 5F37A 5F1RA 3IWZA 3ZN4A 2XBO1 3T3YA 3O1TA 1IQDC 3NJVA 5F3GA 1DIWA 1UOGA 4CCNA 5FR3A 1N47A 3BPSA 4AQ2A 1JS9A 1QIQA 3N4MA 3E5UA 5T54A 1LR5A 4H3WA 3POFA 1JZ7A 2YBPA 2WFF3 1RMU1 3E5XA 3LEKA 2PHRA 4YM0A 4E8DA 5C3RA 5KXDA 1Q56A 2D3SA 1RUG1 4Q29A 4FPHA 4AEJA 1DGWX 1VAVA 1AL23 5K8SA 1C1FA 3WQ7A 5BNNB 1GWKA 3PIGA 1ASJ3 3C7EA 3VN4A 3VDCA 4P9JA 2Y33A 1B09A 1YQ2A 4N8MA 4YZ4A 1C57A 2G19A 2EXJA 4GKYA 1XSQA 4H2AA 2XJUA 4P9IA 3WP3A 3V0BA 1IOAA 1QNYA 3WHTA 4BMEA 2V4AA 3N35A 3NV4A 5DAXA 4LOTA 3PURA 2E7QA 1HN0A 4FQZA 5T5LA 1NY71 3VBOA 2D6KA 5GLUA 2RJKA 1MQTB 4GB32 4DMIA 1IG0A 2ZAAA 3M3EA 3DUIA 1JUHA 2HWF3 1WUVA 2BGOA 4M4PA 1OQDA 4YVSC 1A6CA 5C4WA 1V00A 3PTYA 4Y1VA 4NO4A 3CNAA 5C3QA 2DF7A 2BV4A 2YFUA 5FBZA 3ST7A 4D0QA 2VNGA 1MZ5A 1NXD1 1N3PA 5IVCA 4XDPA 5EYYA 3WDTA 4RHV1 4PBPA 4MGZE 5IK5A 1SLBA 1XNCA 3PUIA 2VOWA 4G9SB 3C7FA 1RGSA 3BODA 3PVEA 4FPJA 5GJ6A 3ENRA 3SH4A 2Y6GA 1TG7A 2JX9A 2YC2A 1B35C 1ENQA 4AR2A 4QQOA 5IVBA 1TEIA 2XR4A 1R081 4FPGA 3HPNA 2RDSA 1VAMA 3ACLA 4JX0A 4HL0A 3VZLA 4LHKA 3ZXLA 4V2WA 1WD4A 3I54A 2PHXA 3ZFGC 2HBUA 1IS3A 1DQ0A 5D1IA 3KMHA 1OXCA 1NZCA 3FE5A 4LUKA 1HRI2 2WBKA 2EIEA 3A22A 1LU2A 5FPVA 3ZFFC 4OI4A 1W0NA 3DEMA 3RQ0A 1FATA 1GP4A 2VMCA 4ZONA 4PI0A 2AGSA 1ULCA 2XLGA 3NNFA 3O0XA 1VBC3 4GMP1 1RJ8A 5LA2A 1QQP2 5KBFA 1W2AX 2NQYA 3KV4A 3NJXA 2O14A 2QBXA 2CGOA 2VW2A 3WEZA 1LTEA 3PTRB 1N1TA 1RITA 4XVHA 4Q0UA 2D5FA 2VU9A 4W65A 1BKZA 4LHSA 1YCIA 1US3A 3RZKA 2ET1A 1S0GA 4NHKA 1AVBA 1GBGA 3KT4A 4I2OA 4LK7A 3GALA 1QHDA 1XOYA 5CU1A 5FQ0A 3NNGA 1NX9A 2EICA 4W6WA 1YHFA 3ZYJB 1SFNA 1VBB1 4YVSB 2YHJA 4ZHNA 3J8F2 2XJVA 4MOAA 5G04L 1Y9MA 2WAAA 4IE5A 4QQLA 1G9CA 4ORFA 4UW6A 3WP6A 1VBA3 1RUF3 4LBQA 5FLIA 2FD8A 2W46A 4A7ZA 3N9PA 4Q8KA 4Y1ZA 1WW5A 3UGFA 2R0FA 2QZ3A 3POSA 4Q0PA 3BTYA 1ODMA 1I9RA 4D6RA 2VO5A 5IFTA 1OURA 1W8FA 2R071 4CDUA 3WD5A 1F5FA 1RUD2 2YGMA 2R0HA 1K5MC 1LEMA 4MYEA 1NAEA 2IXKA 2VZSA 4COZA 3VL8A 1REEA 2BOJA 2VL4A 3N7LA 1B35B 5L9RA 1ENSA 1XXNA 3K75B 5BYNA 3AVRA 4JV4A 2NYYA 2ZACA 2HWD2 5CB7A 2WA4A 1W9YA 4YG3A 4AFDA 3I2HA 1WMXA 3HR9A 1HX6A 4LHNA 2E7TA 4AEKA 2OQ7A 5GLTA 4AGRA 1HLCA 5BNOA 4QQHA 2QQNA 2F4LA 3OY8B 2ZGLA 4MX3A 5FZBA 1CAXB 2ZGOA 4NIGA 2EIDA 1LRHA 1AXYA 2XJSA 3ZFGB 4HPKB 1UZWA 3MGUA 4YVWA 4QGMA 2ZXQA 4O7XA 2HWD1 1GZWA 4Q0QA 5JXIA 1ND2A 3OYWB 3THPA 3ZFFB 3FZ3A 1MEC3 3PMSA 4IXLA 1WBFA 1CAWB 2PTMA 3JBG1 1JZ5A 3OEBA 4C8DA
chains in the Genus database with same CATH topology
3UGGA 3PIJA 2QQUA 3ZR5A 2ADEA 4JQTA 3U75A 4UFLA 3UGHA 4FFFA 4QHZA 1UYPA 5FK8A 2AEZA 2AC1A 2OXBA 5ANNA 1Y9MA 3OSDA 4CCEA 4FFGA 4UFJA 2AEYA 3KF5A 3LF7A 1Y4WA 3HBKA 3LIHA 3LIGA 5FIXA 4B1MA 5FK7A 4AZZA 2QQWA 4CCDA 5FMBA 3UGFA 3LDRA 3LFIA 5FMDA 4UFKA 5FKCA 4EQVA 3U1XA 3KF3A 2XQRA 4CCCA 3PIGA 4UFHA 5FMCA 2ADDA 3LDKA 1ST8A 3S5QA 5FKBA 3NMBA 3H3LA 3IMMA 3SC7X 3U14A 4UFIA 4UFMA 3LEMA 1Y9GA 3RWKX 4B1LA 4HXCA 2QQVA 4FFHA 3ZR6A 4FFIA 1W2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UGG A;  3PIJ A;  2QQU A;  3ZR5 A;  2ADE A;  4JQT A;  3U75 A;  4UFL A;  3UGH A;  4FFF A;  4QHZ A;  1UYP A;  5FK8 A;  2AEZ A;  2AC1 A;  2OXB A;  5ANN A;  1Y9M A;  3OSD A;  4CCE A;  4FFG A;  4UFJ A;  2AEY A;  3KF5 A;  3LF7 A;  1Y4W A;  3HBK A;  3LIH A;  3LIG A;  5FIX A;  4B1M A;  5FK7 A;  4AZZ A;  2QQW A;  4CCD A;  5FMB A;  3UGF A;  3LDR A;  3LFI A;  5FMD A;  4UFK A;  5FKC A;  4EQV A;  3U1X A;  3KF3 A;  2XQR A;  4CCC A;  3PIG A;  4UFH A;  5FMC A;  2ADD A;  3LDK A;  1ST8 A;  3S5Q A;  5FKB A;  3NMB A;  3H3L A;  3IMM A;  3SC7 X;  3U14 A;  4UFI A;  4UFM A;  3LEM A;  1Y9G A;  3RWK X;  4B1L A;  4HXC A;  2QQV A;  4FFH A;  3ZR6 A;  4FFI A;  1W2T A; 
#chains in the Genus database with same CATH topology
 3EJK A;  1UYZ A;  5FYY A;  3GZT B;  1WZX A;  5CA6 A;  2DCY A;  3WNL A;  3MEP A;  3K48 A;  4I09 A;  4LKD A;  1KDK A;  1Y4W A;  2LW8 A;  1EAH 1;  1CD3 G;  1LOC A;  2R04 2;  4ZXK A;  4CEY A;  2ZGN A;  1PHM A;  1JW6 A;  1NA1 B;  1RUJ 2;  3VZJ A;  2JG8 A;  2ZTN A;  5FRE A;  2VCB A;  4CP9 A;  3SXW A;  3H42 B;  2XQR A;  4J1W A;  3CU7 A;  2RG4 A;  4YW2 A;  4NRP A;  4Y1U A;  1OPM A;  2Y6J A;  4YAR A;  3FHA A;  4BIS A;  2P3Y A;  2X09 A;  1W04 A;  3UV9 A;  3T2O A;  4F83 A;  1TQ5 A;  4XDO A;  2BNM A;  1FNY A;  2X5I C;  5FMO L;  3SIS A;  1QY4 A;  2RDN A;  1LOG A;  1UIJ A;  5D8A B;  3WDX A;  4EZH A;  1ZA7 A;  3WW3 A;  3ZIW A;  3EO6 A;  3ACF A;  4YFW A;  4AWD A;  4UFL A;  3BPZ A;  2VC9 A;  4RL7 A;  3JD7 2;  5F7U A;  2XHN A;  1RUJ 1;  4TLG A;  3A21 A;  4IV3 A;  4AAP A;  2QDR A;  5JI7 A;  1O5L A;  2CHH A;  4FOV A;  4XIO A;  1IPK A;  5C9A C;  1XYP A;  3OBT A;  1RUG 3;  4AFB A;  1K5M B;  1UYX A;  1ZBE 3;  2VVE A;  3IDB B;  3RMX A;  3K51 A;  2ZS6 B;  2WLP A;  4OYU A;  4GJZ A;  3VHN A;  1A78 A;  3LD8 A;  1S0C A;  4XYX A;  4AFM A;  4BU2 A;  3M70 A;  1GU3 A;  3JD7 1;  2D93 A;  3R4D B;  2GSY A;  2VZU A;  5J7M A;  1WW6 A;  1Y9G A;  2ORZ A;  4IND A;  3WUC A;  1QMJ A;  2IVI B;  3MLJ A;  3L2H A;  3UGG A;  4CSW A;  1PX3 A;  4FTS A;  4UF0 B;  3PUH A;  2F4P A;  2NLR A;  4DEQ A;  3WSO A;  3IMN A;  5CFD A;  1BEV 2;  1OD3 A;  2ES3 A;  2LRO A;  4M01 A;  4CU7 A;  1QH7 A;  3OEA A;  5FMO S;  2A75 A;  5FLJ A;  4MZU A;  3Q8B A;  1KFX L;  3GHN A;  4FCA A;  2Q0A A;  4Q4W 2;  3HN1 A;  1HQL A;  3UKN A;  1W2U A;  2EA7 A;  2G9Z A;  2IXI A;  4JDO A;  5IVY A;  3UYJ A;  1VBD 1;  3LDR A;  2OKX A;  5DAP A;  3TRS B;  3ZYB A;  3I2I A;  3ETQ A;  2BVV A;  2ADD A;  1LGC A;  3TEX A;  4RYD A;  1U5Z A;  5IK7 A;  1W05 A;  4D3W A;  3WNO A;  1GMM A;  3HN3 A;  3LEG A;  5CIR A;  5FY5 A;  3WY6 A;  5FUP A;  4GB3 3;  3RPQ A;  1F2N A;  5I0U A;  1GOG A;  4LOS A;  3O0V A;  4LO7 A;  5LA0 A;  1OKQ A;  3AX4 A;  1XJA A;  1C8M 1;  3OF1 A;  4XEZ A;  3AP4 A;  3USU A;  4UW3 A;  2W2I A;  1SHW B;  4HKW A;  4KH9 A;  5FO7 B;  3VBO C;  1VMF A;  2GN3 A;  3ATG A;  5FZ4 A;  1ZVF A;  2C1F A;  3AFK A;  1CR7 A;  5SV5 A;  3WVJ A;  1UKG A;  1CX1 A;  1Q8Q A;  5C4W C;  2VBD A;  2ZGR A;  4XTM A;  4PLM A;  3PME A;  1X7N A;  2HWE 2;  4UW5 A;  1WWY A;  4FVV A;  2X5I B;  4YGD A;  5FZF A;  3RI8 A;  2BNN A;  4UFH A;  2VUL A;  3UJO A;  3HWJ A;  2JDM A;  2G9F A;  2WDB A;  2C9A A;  1CAU A;  2PHL A;  3POW A;  2TEP A;  1IGO A;  2E31 A;  3NAP A;  1ONA A;  3AYA A;  3LQC A;  5E89 A;  4CCK A;  1NOV A;  1OT5 A;  1FV2 A;  4UFM A;  5C9A B;  4EV0 A;  1QJE A;  3EB7 A;  1RUN A;  4QU1 A;  5FK8 A;  4OFG A;  4E4H A;  2IVJ A;  4GMP 0;  2HWE 1;  4FAH A;  4A6O A;  1WCK A;  1FAY A;  1QGL A;  5LBB A;  3V56 A;  5FYB A;  2W08 A;  4QXK A;  5IAV A;  1TMF 2;  4AF9 A;  5A7S A;  4RSU A;  4MLO A;  3M3O A;  3NNJ A;  3FFQ A;  5HCF A;  4AG4 A;  2VPV A;  5FP9 A;  1TE1 B;  3ZSJ A;  1ACC A;  2JDK A;  4OZO A;  2PEL A;  4QX2 A;  3ELN A;  1HRI 3;  3RSJ A;  3HEI A;  1W8Z A;  2WN2 A;  5FYM A;  3AL5 A;  5LRS A;  2XDV A;  5JAX A;  2YU1 A;  3HBZ A;  2JDY A;  4OHV A;  5F3C A;  4BXS V;  5CAZ A;  1JYI A;  4GWJ A;  1NE6 A;  1K3I A;  1QQP 3;  2PXJ A;  3HT2 A;  4LHL A;  1VRB A;  3KVB A;  2VME A;  5I91 A;  1POQ A;  3A7Q A;  1HJG A;  1NG0 A;  2YBK A;  3NV1 A;  4DXR A;  4FP2 A;  2CL2 A;  1MR5 A;  1D4M 3;  5FYI A;  5FRA A;  3N9Q A;  4K8F A;  1KS5 A;  1ALY A;  2JIJ A;  2YUE A;  1VE0 A;  3U07 A;  5EIY B;  2O8O A;  2Q1Z B;  1V6J A;  5KXB A;  3PNA A;  3LA7 A;  4UOJ A;  3V0B B;  2BOI A;  4C91 A;  3S5Q A;  4CDX A;  1RVF 1;  3J8F 3;  4IEY A;  5F5A A;  3LKJ A;  5FP4 A;  1XNA A;  3NJY A;  3B7M A;  2BZD A;  4YNI A;  3UES A;  3VBO B;  5FXW A;  3RYR A;  2JKX A;  1QJU 1;  4O9E A;  4FTB A;  4E4D X;  3WF4 A;  3EQE A;  1WMD A;  2HBT A;  2XJT A;  5FYS A;  2W87 A;  5C4W B;  3BTZ A;  4KWL A;  4XXP A;  5C3O A;  2UWB A;  3THD A;  4HN1 A;  2N7G A;  4L2N A;  2ZX2 A;  1NKG A;  5FK7 A;  1RUD 3;  2YRO A;  3OBA A;  4XAB A;  3KS7 A;  1RUI 2;  4ZS2 A;  2W3J A;  2L9L A;  4HK9 A;  1XU2 A;  5A7W A;  2X05 A;  1UF2 C;  3ZN5 A;  1SG3 A;  2WNE A;  1SBE A;  1ST8 A;  4IE6 A;  4LBM A;  4LIU A;  4U36 A;  1QWR A;  1JBC A;  2KD7 A;  2DVA A;  4NIH A;  5GLW A;  1O3Q A;  1UXZ A;  4QX7 A;  2QQP A;  2E63 A;  1W3V A;  3POB A;  3RS6 A;  1AHS A;  1S1A A;  2Q1F A;  1O59 A;  1UOF A;  2ETE A;  3M1H A;  5DN2 A;  4XTP A;  4QB6 A;  3BTX A;  1N3O A;  3GHM A;  1CQ9 A;  1J3R A;  2ORX A;  1AYN 3;  4R9A A;  4CCE A;  5C33 A;  3KCX A;  4KBB A;  3K4D A;  4FI9 A;  4D6Q A;  2RS1 3;  4C90 A;  2QUO A;  2R06 1;  2VW0 A;  1NLQ A;  5FZ0 A;  3NJZ A;  1JZ3 A;  5BNO C;  2VM9 A;  3J4U H;  4AI9 A;  4JDM A;  3O1R A;  2WL1 A;  4EQV A;  5F5Q A;  1NXM A;  1AR7 2;  3JQW A;  4YVW C;  1H6Y A;  2ZGM A;  2VNO A;  4YSF A;  3ROU A;  1ND2 C;  2B45 X;  4CEW A;  5J48 A;  1XE7 A;  3P6B A;  3S7E A;  2JEC A;  3ZR6 A;  1UN1 A;  1RUC 1;  2GC0 A;  3NWK A;  3O14 A;  2R04 3;  1VRH 2;  3WX5 A;  2R32 A;  3RMY A;  2ILM A;  1OA4 A;  4OI2 A;  1RYY A;  4QDS A;  2CWM A;  4AQS A;  4J6G A;  4GWM A;  3ITQ A;  4IER A;  1JYV A;  2VR4 A;  3ZVX A;  4DUW A;  4CEY C;  1GZ9 A;  2XOM A;  3BYW A;  5SV8 A;  4MUV A;  2JG8 C;  3I2J A;  2Q1M A;  2AYH A;  3ILN A;  4PJY A;  5FQ0 B;  1XNB A;  5KC5 A;  4JAA A;  3ZN6 A;  4DFS A;  4ASL A;  1POV 3;  3PU3 A;  1ZX5 A;  4XIL A;  5FO8 B;  5LB6 A;  1KGY A;  1NUK A;  2B8M A;  1X8E A;  3N7K A;  2FCV A;  3O1V A;  2GNB A;  2XKO A;  5FY0 A;  1F4H A;  4MXW A;  2A73 B;  2WC2 A;  4LBQ B;  1KD7 A;  1BLZ A;  4WBB A;  1LOA A;  4IW3 A;  3N9N A;  5JCT A;  4IV3 C;  2A3W A;  2VOT A;  3OUJ A;  4XBN A;  2R1B A;  2PHF A;  3RDI A;  1AR9 2;  3TN9 1;  3DL3 A;  4ISR A;  2DFC A;  1XQN A;  1YYN A;  2A6V A;  2CAV A;  2R30 A;  1J1T A;  1FMD 1;  3DYP A;  4QM9 A;  5F6K A;  3S30 A;  3D3A A;  5DG2 A;  4D6S A;  5M0T A;  3MV1 1;  4OZX A;  4UFK A;  5BPX A;  3TYJ A;  3BAL A;  3AXE A;  2GC1 A;  2FHR A;  3MI8 A;  4BJ0 A;  2YYO A;  1LEN A;  2ARX A;  1X36 A;  1LOE A;  2R49 A;  4ASM B;  5KHH A;  1BEV 3;  5H9R A;  3AKS A;  3VZK A;  1COV 2;  1RUH 2;  3E5Q A;  1NCR A;  2Z2S B;  4K8R B;  2GMP A;  1PO2 1;  1XE0 A;  1PZ9 A;  1AR9 1;  2YPJ A;  3JCI A;  1SZB A;  4Q4W 3;  2FDF A;  2B5H A;  1S0I A;  5BNO B;  3HNB M;  5DPN A;  2VQT A;  2W1S A;  1APN A;  3J26 N;  1G9B A;  5CFD C;  2PHT A;  2WS9 1;  4RN5 A;  2VQ0 A;  2H0V A;  5IVJ A;  2ARB A;  5HCH A;  1V6O A;  4TWT A;  2ZHK A;  4YVW B;  5I93 A;  4CCD A;  2QJV A;  1GZW B;  1WW4 A;  1JOD A;  1ND2 B;  2LAL A;  1ULE A;  5E6H A;  3U0Z A;  3WCS A;  2WZP P;  4XFG A;  3IDA A;  3T2Q A;  3VKF C;  1UOJ A;  1UPS A;  3FHQ A;  4DXS A;  1Z78 A;  1R1A 2;  5JSR A;  3U14 A;  3VBR A;  2RM2 1;  1UL9 A;  3J7N A;  5JOY A;  4JTN A;  3VBH A;  4B7K A;  4M3C E;  2D40 A;  5EYX A;  3CF6 E;  3Q8E A;  1DF0 A;  4PCR A;  5FXX A;  5LBF A;  1AR6 1;  2OII A;  2CY6 A;  5KXE A;  1CZS A;  2IXH A;  1JHJ A;  4CEY B;  3WF0 A;  3KVA A;  1XE8 A;  1LKN A;  1ZBA 1;  2C0Z A;  2JG8 B;  3KF5 A;  2ATF A;  2VTF A;  4CP9 B;  1DQ2 A;  4BH9 A;  1IS5 A;  5FZ7 A;  5L7O A;  1ZNP A;  2NMO A;  2B9V A;  3C8X A;  2Q30 A;  2WO1 A;  5FTT C;  1RHI 2;  2EXK A;  3OOX A;  4LNV A;  2PLV 2;  5T5J A;  1QJF A;  4Q8L A;  4AHY A;  1JYW A;  2QCS B;  4LJH A;  2BGC A;  2B9U A;  2WZR 2;  2A70 A;  3WF3 A;  2RS3 3;  4BMB A;  2HYK A;  1C3H A;  2VH9 A;  2ZGT A;  4AHZ A;  1AX0 A;  2QQV A;  3ZFE C;  3NAP C;  4IV3 B;  1OFS A;  1L7R A;  4YZ2 A;  3MIC A;  4FO9 A;  1MAC A;  1ND3 A;  1X82 A;  1TMF 3;  3OUH A;  4CXW A;  2VZV A;  2ZZQ A;  4I0A A;  1D0H A;  4QGL A;  5LAT A;  1DDL A;  5HCB A;  3FBY A;  3B69 A;  4L97 A;  2NN8 A;  5F8P A;  1C28 A;  1RHI 1;  3K2O A;  5DAV A;  3OPW A;  1UOB A;  2VTX J;  4XJZ A;  4KU8 A;  5JXG A;  1BXH A;  4LT5 A;  4XAE A;  5C5T A;  2QQK A;  5FYT A;  2WLQ A;  3KWV A;  4P14 A;  3I2G A;  1SLC A;  5KR7 A;  4EWA A;  2BBA A;  2BER A;  2CU5 A;  4CZS A;  1UZZ A;  5AFB A;  3OGG A;  1H30 A;  4DOU A;  4COY A;  1H2M A;  2DCK A;  4YW4 A;  3W5M A;  1YUD A;  1W3X A;  1F9K A;  4AFA A;  1ULP A;  4Q4Y 2;  4EYU A;  3S0M A;  5FPX A;  5CFD B;  1NCQ A;  1UX6 A;  4AYU A;  4Y26 A;  4HVQ A;  4UW4 A;  5I0S A;  3WW2 A;  4JQT A;  4QX1 A;  1JI6 A;  4DXZ A;  2A7A A;  3D0S A;  3FX3 A;  5T50 A;  5KWR A;  1J84 A;  2RV9 A;  2VVD A;  1BQP A;  1HB1 A;  4W6Y A;  3JU9 A;  3BCW A;  3PL0 A;  4FOW A;  4FAG A;  5J96 B;  3LIH A;  4BQ1 A;  3T4H B;  4JTO A;  1SEF A;  2HEV F;  1MS1 A;  1QKQ A;  5T5P A;  5JOZ A;  4Q4Y 1;  4LPL A;  4X6R B;  2ZML A;  4I3G A;  2OS2 A;  2K2S A;  3SEE A;  2DTY A;  1YFX A;  5A70 A;  4YG6 A;  2OYZ A;  3O1S A;  4QPG C;  4PLN A;  2VZR A;  4L11 A;  1YIF A;  1U5I A;  1C5H A;  4UFI A;  4CDX C;  2B7Y A;  4DS0 A;  1MS4 A;  1V6L A;  2WYF A;  4NRM A;  1JU4 A;  2HWB 2;  3VGI A;  4DQA A;  5FZI A;  1BBT 1;  2C6S A;  4L0P A;  5CZK A;  4EN6 B;  1QF3 A;  2WAB A;  4JGY A;  1AR8 2;  3FN9 A;  1RUI 3;  2FZ2 A;  4M0N A;  2WZ8 A;  5A7O A;  1QJY 1;  5JSP A;  3KT1 A;  3MPP G;  4Y4R A;  1CGP A;  2XBO 2;  2VUD A;  3GDB A;  5FP3 A;  1PIV 1;  2XKP A;  5FFO C;  3JXS A;  5J3U A;  2XWJ B;  3RZG A;  2UWC A;  4ONU A;  5CAD A;  5FKC A;  2DVD A;  5FZ1 A;  3ZFE B;  5J36 A;  3NAP B;  5F39 A;  4B7E A;  3M3Q A;  2QQI A;  3PVB B;  4KWU A;  5FCC A;  1RMU 2;  4HAN A;  2JIC A;  3BI3 A;  1N3Q A;  1ENX A;  4E4Z A;  1AR8 1;  2PQQ A;  2WO3 A;  1DP0 A;  1YQ6 A;  1SBF A;  1TME 1;  4LBJ A;  1PX4 A;  4PQ9 A;  2Q8E A;  3H8O A;  1D2Q A;  4E9K A;  2OUH A;  3D82 A;  4BWO A;  5FV3 A;  3AZY A;  3CL1 A;  3R6S A;  2JDP A;  3OTF A;  3ILR A;  5BUV A;  2ZEX A;  5FZ9 A;  3FFZ A;  1RB8 G;  3GZA A;  4LA2 A;  4M3C F;  3T0B A;  2P37 A;  3AZV A;  2D43 A;  3LFM A;  1AR7 3;  1LGN A;  5CEH A;  3OJB A;  4AGG A;  3I49 A;  2YGL A;  1NY7 2;  3MW4 A;  2XML A;  4ZU7 A;  2WSV A;  2XVK A;  2ZJC A;  1YEW A;  3HOB A;  1MZ6 A;  5A1A A;  2Y6K A;  3IAP A;  5GZD A;  4A6S A;  4ZU5 A;  5AFE A;  3HNY M;  3DXU A;  2XLA A;  1VRH 3;  1IZ3 A;  2WSU A;  4SLI A;  1VMH A;  4D7Y A;  4UT5 A;  5IYY A;  4CU9 A;  2JDZ A;  5AC9 1;  4PLO A;  3H9A A;  3WNK A;  4CEW C;  4FOQ A;  3FLT A;  4K40 A;  3MO4 A;  4YW6 A;  1OLQ A;  4GA9 A;  3H50 A;  4AHW A;  4RGG A;  5FZG A;  1DG6 A;  4RHV 2;  5IWF A;  5LAS A;  4E4S A;  1W9W A;  1OMI A;  5BNQ A;  5BNP A;  1EV1 1;  3WP4 A;  1S2K A;  4H7L A;  4Q4X 2;  4QPG B;  2Z5W A;  2OZJ A;  3EYP A;  5IJR A;  5KHG A;  4CDX B;  5IW0 A;  2NP0 A;  2RR1 2;  2ZHL A;  5CFC A;  4BLJ A;  1QDC A;  3MZH A;  1I5P A;  3MV0 1;  1JZ4 A;  4KGG A;  1US2 A;  3ZLI A;  5KC6 A;  1R08 2;  1X33 A;  1UO9 A;  3B01 A;  4HKL A;  4OMC A;  2BVB A;  1OKO A;  5LWB A;  1D0G A;  2XG3 A;  4Q4X 1;  3TAY A;  1MS5 A;  1WBL A;  4H55 A;  1OOP A;  3N36 A;  1MS3 A;  2VUC A;  3BUC A;  1ZZC A;  2RR1 1;  1QXP A;  3CKH A;  1J1L A;  5FJH A;  5IK4 A;  5JVV A;  5T5O A;  4IEP A;  5A7W B;  4GJY A;  2JE9 A;  3CZJ A;  2CNA A;  4YGE A;  3VBS A;  4B1M A;  3LFI A;  3GBF A;  4XF9 A;  5AVP A;  1A3K A;  1W2O A;  2BGP A;  3ZYI B;  2D6N A;  4BPZ A;  2HWC 2;  4P9Y A;  1COV 3;  1H1M A;  3KLS A;  5J09 A;  1RUH 3;  1YC6 1;  2BDR A;  3G7D A;  3AXD A;  4CUC A;  2PHD A;  1S0D A;  3WG3 A;  3HAG A;  1O3S A;  4XFI A;  2BBV A;  4IL7 A;  4LO6 B;  1CZT A;  1WLW A;  5FZK A;  4RS5 A;  2QVS B;  1PNG A;  1SQ4 A;  1VBE 1;  1K5J A;  2YMZ A;  3N7M A;  1NCR C;  2VMH A;  4OUS A;  4LKS A;  5HV4 A;  2ARE A;  2OXB A;  5ANN A;  1XND A;  5FZ6 A;  2RMU 2;  2HWC 1;  2OA2 A;  4MGS A;  4CDW A;  2FDK A;  3WF2 A;  5A3W A;  2YV8 A;  2J1U A;  4OHZ A;  1DYK A;  1D2S A;  1VBB 2;  1W2N A;  1R1A 3;  2YC0 A;  2Z69 A;  3BOP A;  2DBN A;  1W6O A;  2W0X A;  4QXC A;  3LSD A;  5JR7 B;  4QM8 A;  4IEZ A;  3KQ4 B;  1FV3 A;  2XL7 A;  3ORJ A;  3POJ A;  4K21 A;  4CEW B;  1GOF A;  4BLI A;  1LU1 A;  3PVO A;  4Y22 A;  5LBE A;  3LA2 A;  1DZQ A;  1N1S A;  3FJS A;  4V2V A;  3K77 A;  4X6Q B;  1YO8 A;  2RMU 1;  2ZGS A;  2TBV A;  2W68 A;  3VBH C;  1GP6 A;  3GM8 A;  3WDV A;  2R07 2;  2ZX1 A;  4LBL A;  4PDW C;  1UY4 A;  4FPC A;  1UU4 A;  3URF A;  4QX3 A;  5A3T A;  4MH0 E;  4BB3 A;  5LEJ A;  1BMV 2;  2W1W A;  5FXV A;  2PLV 3;  3GCX A;  3F95 A;  4QX5 A;  2RDR A;  1JN2 P;  2SLI A;  4CP2 A;  1OHF A;  1QNW A;  1O4Z A;  2WZR 3;  3FC0 A;  1VB2 A;  2V5Y A;  1RL3 A;  2DV9 A;  3ZN6 B;  5L7O C;  4Q2F A;  3WW1 A;  1W6N A;  1O8S A;  1GZC A;  4CCC A;  4QDQ A;  1OQE A;  3MIG A;  4P9L A;  4S2F A;  2RS5 2;  4NID A;  2GP3 A;  2K9Z A;  1QDO A;  2BYV E;  3MIH A;  3LEM A;  1GV9 A;  2W47 A;  5ANQ A;  4HT1 T;  3MIB A;  4TTG A;  4Y5T A;  1S0E A;  1WLT A;  4WM7 A;  3SCH A;  1Z7S 1;  1V70 A;  4XZP A;  4XOG A;  1HRV 1;  1ND3 C;  2VMI A;  3E6B A;  3FLR A;  3ACG A;  1ULF A;  3JB4 C;  4QT6 A;  3MF6 A;  1LJ7 A;  1DZR A;  3ZYF A;  3JBG 2;  4D69 A;  1UWW A;  4NHY A;  1BVV A;  1OC1 A;  2A6Y A;  2RS5 1;  3KB5 A;  5JDB A;  1YQ8 A;  4JC1 A;  2CYF A;  3FUO A;  5DZE A;  1DYP A;  4JKM A;  3WG2 A;  2BPA 2;  1E5R A;  2D3P A;  4QWN A;  4FPF A;  4P00 B;  1NCR B;  1EAH 2;  4M3C A;  3T30 A;  3TBD A;  2ZMK A;  1X9T A;  3CIH A;  4PHZ A;  4XUT A;  2DVB A;  1GP5 A;  2A71 A;  2YC4 A;  4HK8 A;  4LBK A;  4CRQ A;  4BQW A;  3B5L B;  4FFI A;  3POG A;  1QU0 A;  2AH2 A;  5F9T A;  4GWN A;  1NCQ C;  1DLL A;  2QQU A;  3ZXD A;  2WUH A;  5KHK A;  1GWM A;  3H7Y A;  3IN9 A;  4LBO A;  1LOF A;  4IV1 A;  5JR2 A;  5EJZ B;  2GND A;  4IEW A;  5DDJ 2;  4B4R A;  4P9W A;  3ACI A;  2CDO A;  4LKE A;  2ZBJ A;  3IZO A;  4CE8 A;  2BTV C;  2DCT A;  2BUK A;  4K7J A;  4YW7 A;  4CCL A;  4ZKT B;  2Y6L A;  1HB2 A;  3NV3 A;  1AYM 1;  4C1X A;  1ZM1 A;  2F17 A;  2HWB 3;  4PT6 A;  4KMQ A;  4YZ3 A;  3VBH B;  4OCT A;  5EFU A;  1YIP A;  1OA3 A;  1YI7 A;  4HVR A;  1UYY A;  1YJK A;  4PDW B;  1W6M A;  1ZZ7 A;  1AR8 3;  2WQ8 A;  2WN3 A;  2W52 A;  4HOO A;  4N9I A;  4RR3 A;  5DDJ 1;  5GLZ A;  4CUA A;  5KHJ A;  5IT6 A;  1PZ8 A;  1SPP A;  1ZRD A;  3IAQ A;  1S2E A;  2ERF A;  1AX2 A;  1W8U A;  1WA4 A;  4AVT A;  4QHZ A;  2XBO 3;  2D44 A;  2EIB A;  4LOR A;  1XRU A;  4GAZ A;  4JGY C;  3O1P A;  2ZEZ A;  5L7O B;  5F5C A;  2RVA A;  3U4S A;  1V0A A;  1RMU 3;  4CXY A;  3E1F 1;  1S4C A;  2W95 A;  3B9C A;  4XXA A;  5FZO A;  1NZI A;  2QKD A;  1YFY A;  1UY0 A;  4LIT A;  2V4V A;  5DQ0 A;  4BM8 A;  3NQH A;  4Y5S A;  1PM7 A;  4YM1 A;  5JI9 A;  2WFP A;  3I2O A;  2JKB A;  1ND3 B;  4BZ4 A;  4R4Z A;  1VBD 2;  3ES4 A;  3GJB A;  3NW4 A;  1PVC 1;  1OD5 A;  2PA7 A;  2XJQ A;  4EWD A;  1QOO A;  4XJ8 A;  4AOC A;  3ABZ A;  3ZXF A;  2CV6 A;  2GME A;  5ABJ A;  4PF5 A;  3CMG A;  3SCG A;  3OBZ A;  2PYT A;  4IEV A;  4ES8 A;  2Y26 A;  2W92 A;  2D7F A;  1IS4 A;  3EBR A;  4GQ7 A;  4XUN A;  4EZ4 A;  2JJ6 A;  4NIA A;  3ZM8 A;  4AW7 A;  4IEX A;  5LK7 B;  1C8M 2;  1F4A A;  5FZE A;  5GM0 A;  1WA6 X;  1DZT A;  2EAL A;  2VOV A;  3ZSM A;  3J7M A;  3O5S A;  4F7Z A;  1NCQ B;  5T3N A;  4WM8 A;  5GLV A;  4XDQ A;  4HZF A;  3S6P A;  1OUS A;  2H6B A;  4AI3 A;  1SLI A;  2X10 A;  2YBS A;  4RHV 3;  4LMF A;  3DPR A;  3T2P A;  2OQ6 A;  1D4V B;  4E27 A;  3FLP A;  1LOD A;  5K0U A;  4DB5 A;  4DPN A;  3U4X A;  1DQ1 A;  1QJX 1;  1REF A;  3LCP A;  4QKB A;  1W9S A;  2XXZ A;  4GH4 A;  4CU6 A;  1PO1 2;  5BNP C;  3H8R A;  3WHU A;  4WVM A;  3O1O A;  1R08 3;  5APA A;  2WQ4 A;  2EAK A;  1Q3E A;  1T6G C;  4BE3 A;  5FOB B;  2YXS A;  1NQD A;  4QQ2 A;  5CFC C;  1HQW A;  4CCO A;  1S0F A;  2C26 A;  3TEY A;  4JGY B;  4P9X A;  1HXS 2;  4CP1 A;  1BJQ A;  1W2T A;  3AZZ A;  3OBR A;  1IKQ A;  3ETP A;  1PO1 1;  4AI1 A;  1U0A A;  1Y7B A;  2IXJ A;  4IE0 A;  3ES1 A;  1CN1 A;  1WCU A;  1X50 A;  1ZRR A;  2TNF A;  3DCQ A;  2OPK A;  3HVD A;  3IDC B;  2H6C A;  4MXV A;  1OOP C;  1LES A;  3VBF A;  3VD7 A;  2HWC 3;  2W94 A;  3I4I A;  4ZPI A;  4GMP 3;  4QAW A;  4KI5 M;  1DU3 D;  4K6B A;  3BIE A;  4NVP A;  1UZ0 A;  4YZ5 A;  2W9X A;  3MW2 A;  1MVQ A;  4QDR A;  3I3B A;  1DGW A;  2GZW A;  1HXS 1;  4ZY9 A;  1LHU A;  3PUQ A;  5B4X A;  1UMI A;  3SLI A;  3BB6 A;  5LY2 A;  1FOD 2;  5KXC A;  1W90 A;  2W5F A;  4ATF A;  1TNF A;  1UW8 A;  4BYY A;  4JGZ A;  1W03 A;  4W8J A;  1GNY A;  4FPL A;  3LGR A;  4KBZ A;  1A34 A;  2JEM A;  1VJ2 A;  1WMF A;  1KJR A;  2DCZ A;  4RS5 C;  4JKK A;  3T4V A;  1OSG A;  4Y3O A;  5ACA 2;  1VBB 3;  4I3P A;  1CWP A;  1RVF 2;  3ZPO A;  3I8T A;  4M00 A;  1FX5 A;  1HJF A;  3G6J B;  4CUB A;  4CDW C;  2D97 A;  4WVV A;  1FOD 1;  4ERO A;  2RHP A;  2GH8 A;  3TEZ A;  1NYW A;  1QJU 2;  1DBN A;  3WLU A;  1DQ5 A;  2BRT A;  1AXZ A;  4FXK B;  4GXL A;  3JB8 A;  1PGS A;  3S7I A;  1DQ4 A;  4M0H A;  4JQR A;  4DY5 A;  2R07 3;  4XUP A;  5ACA 1;  2Y0I A;  4LO5 B;  2Q8O A;  4CU8 A;  3KT7 A;  1WD3 A;  1JZ6 A;  5I0R A;  4CXX A;  5GZC A;  1G9D A;  2FMD A;  1MPX A;  4YZ1 A;  4W50 A;  4R52 A;  5BNP B;  3QLQ A;  1I5Z A;  1C5I A;  1H2K A;  2Y6F A;  4H7M A;  2BFU L;  2E9Q A;  4Z8B A;  2AAC A;  2J1T A;  1ZRC A;  3SMH A;  3PDQ A;  1KJL A;  1MQT A;  2LS6 A;  1S55 A;  2WT0 A;  5IVV A;  4Z2W A;  2DYC A;  2RS5 3;  2IFR A;  2XVG A;  3RFR A;  5FO9 B;  1AJK A;  3AZX A;  3NRU A;  1W99 A;  4NRQ A;  3O0W A;  4E2G A;  4XIK A;  2RJL A;  3D4K A;  4TZD A;  5IAT A;  4LEJ A;  3KM5 A;  1GOH A;  5CKN A;  3TEW A;  2R06 2;  3RZL A;  2HWD 3;  4Q4V 2;  5C8C A;  5E88 A;  1V6N A;  4LO8 A;  4AK3 A;  1JTZ X;  3R0R A;  3M7A A;  5JIA A;  4DNY A;  3RNS A;  1OOP B;  5IVF A;  2QDN A;  3JBG 3;  5FZL A;  3I2K A;  2WWU A;  4MSV A;  4WM7 C;  1F5J A;  3WUD A;  3ZXK A;  2O8Q A;  3OPZ A;  3ECQ A;  3NVC A;  4IGQ A;  4YLZ A;  3PJQ A;  4BQ2 A;  2XUE A;  1OFN A;  3RVH A;  5DAQ A;  3IB3 A;  1MS8 A;  5FPU A;  3Q8F A;  4YRD A;  2YB7 A;  1FPN 2;  2W39 A;  4HON A;  1RUC 2;  2VCM A;  1XC6 A;  2DUQ A;  1EPW A;  5FXZ A;  1EAH 3;  1YQ5 A;  2GC2 A;  3GJA A;  4KL1 A;  2BP6 A;  4Q4V 1;  4QXB A;  4ARY A;  3SH5 A;  2ARA A;  1R1Z A;  1F35 A;  2BFU S;  2P6H A;  4RS5 B;  1RTV A;  5FPB A;  5LY1 A;  5F2W A;  4IGO A;  3KCC A;  3CLP A;  1O8P A;  1UY1 A;  1GNZ A;  1ZZ8 A;  1CPN A;  2ZOE B;  3DV8 A;  4D8M A;  5C6C A;  4FFH A;  4FBF A;  3UT0 A;  1FPN 1;  2GP5 A;  4CDW B;  4KNC A;  1O4T A;  4E2S A;  3ZYP A;  1W28 A;  4GUL A;  3K3O A;  2XJR A;  3WXP A;  2O1Q A;  1HKD A;  1UZY A;  3ZDS A;  1LOF C;  1V9U 1;  1RUJ 3;  4IV1 C;  3GCW A;  2PAM A;  4L8Q A;  1W6O B;  4LR4 A;  3VD3 A;  3INA A;  1I1E A;  5LEK A;  3QAC A;  1UZV A;  2GN7 A;  1OLR A;  2W1U A;  4I0W B;  3NV2 A;  4J25 A;  5A33 A;  5B4N A;  1VLN A;  1E5I A;  2H0B A;  4XMI A;  2FDG A;  3FMG A;  3MHZ A;  4Y22 B;  2EXH A;  2Y8K A;  1AJO A;  2NMN A;  1TZO A;  3AYE A;  3GF6 A;  3TN9 2;  4K20 A;  3NMB A;  4HSJ A;  4LLO A;  3AP6 A;  5I8Y A;  1QXR A;  3OGR A;  2VJX A;  2DVG A;  1L7L A;  1FMD 2;  1VB4 A;  2BWA A;  3JD7 3;  2WNU A;  3OG2 A;  5FLH A;  2XL9 A;  3VB9 A;  2J22 A;  4AAX A;  4B1L A;  4RR3 C;  4MO3 M;  3VD4 A;  4NMI A;  4BOW A;  4DUX A;  2ZAB A;  4DXT A;  4S2G A;  1LHV A;  2ZAH A;  2WNV A;  4HKO A;  2LUW A;  4AVV A;  1DHK B;  4BXF A;  1ZZ6 A;  1DYO A;  4XCA A;  5KHI A;  1PO2 2;  1R64 A;  1W6N B;  4WVZ A;  2VMD A;  5FIX A;  2WNO A;  2J1R A;  5FMB A;  1AL2 1;  3W59 A;  1VBD 3;  1ASJ 1;  1QH6 A;  3WV6 A;  5FZD A;  4CYD A;  2WS9 2;  2DUR A;  3DGT A;  1W0O A;  1JUI A;  3E6D A;  3T1M A;  1WLD A;  4WM7 B;  4A44 A;  4BK4 A;  2XON A;  2XUM A;  2F6B A;  4IE4 A;  5CYY A;  2UWA A;  1FXZ A;  3WQB A;  2HEW F;  4Q26 A;  4OQ9 A;  4XET A;  3SH3 A;  3DXT A;  3UJQ A;  4AE2 A;  3NKT A;  1C8M 3;  3OSD A;  4JKL A;  2RM2 2;  5FZ8 A;  2E6V A;  3MFC A;  5FYZ A;  3SEP A;  4BQ3 A;  3BVC A;  4RQP A;  2VY0 A;  5ABJ C;  3Q8A A;  3C3V A;  1AR6 2;  4QPY A;  2JD4 A;  3P3P A;  4M3C B;  4AHX A;  1J59 A;  1MZE A;  3H3U A;  2QTW B;  5A3O A;  1V6M A;  1ZBA 2;  1GQP A;  5TSW A;  3SCF A;  4W6X A;  3BGA A;  4IUG A;  3IMM A;  3X29 B;  4WM8 C;  2ZHN A;  5G05 L;  4IV1 B;  2OVU A;  4I0B A;  3ZSL A;  3W5N A;  1G9F A;  1QOT A;  4BQ4 A;  5T55 A;  4DY3 A;  3PU8 A;  2DWR A;  4KWK A;  1PO1 3;  5FPZ A;  3AM2 A;  4U2A A;  3DPR C;  2EAA A;  3A0N A;  2D6M A;  1HV1 A;  2FZ1 A;  4LE3 A;  5FY7 A;  5K0U C;  1UU5 A;  4UWD A;  1T2X A;  2HWE 3;  3M3I A;  4LUM A;  4IE7 A;  1DGR N;  1GLH A;  4GH4 C;  4OUE A;  3RYP A;  3LOI A;  1SMV A;  4YGC A;  5L19 A;  4W4Z A;  1W39 A;  1W6M B;  1E57 A;  4O65 A;  3KHC A;  3BKZ A;  1HXS 3;  1NA1 A;  2UYB A;  3NL1 A;  4RR3 B;  3LDB A;  4PI2 A;  1SPP B;  4E8C A;  2ZKN A;  1LUL A;  2GMM A;  3GXU A;  2A6Z A;  1PGW 1;  1VPH A;  3U11 A;  1C4R A;  3WQ1 A;  4QHB A;  5J1X A;  2ZEY A;  1PK6 A;  3KGZ A;  1PMI A;  1IPJ A;  2A3X A;  5B2G B;  1OI6 A;  1J83 A;  2GDF A;  4XJU A;  3PIJ A;  3VDD A;  2EIG A;  3AFG A;  3ALQ A;  3VD9 A;  2AUY A;  5D8A A;  1LAJ A;  4LBN A;  1E5H A;  2AC1 A;  5BXX A;  1URX A;  2I07 B;  1VBC 1;  1EPZ A;  1SLA A;  2ZA9 A;  3HIF A;  3LWC A;  4XJA A;  3ZXJ A;  4CDU C;  2NZ9 A;  3Q8C A;  3VBF C;  1Y9Q A;  3O7O A;  3HBK A;  3WG1 A;  4X8P A;  2V73 A;  4IES A;  1VBA 2;  3SNM A;  3VBU A;  3DYM A;  4NAM A;  3ZXE A;  2C9K A;  2EXI A;  4AVA A;  4N43 A;  3GGL A;  1XNT A;  1JZ8 A;  4B4Q A;  1RIR A;  5ACA 3;  3H8U A;  1RVF 3;  2HEY F;  2VCC A;  4FPY A;  4KG0 A;  1WCQ A;  4JGZ C;  4EN9 B;  4LLF A;  3AZW A;  1SCR A;  4KGQ A;  5GZE A;  5ABJ B;  5JPM B;  4OHW A;  3JQX A;  3VKN A;  4OHX A;  2ZGQ A;  4D94 A;  1QJU 3;  5A32 A;  1W8W A;  1X9P A;  2VZT A;  3UKT A;  4NPL A;  1VBA 1;  1RUF 1;  3EXU A;  4UF0 A;  5F32 A;  1MZF A;  5D21 A;  2YG0 A;  5FY4 A;  4KU7 A;  1YLL A;  2KA3 A;  3EHK A;  3ZXG A;  1BBT 2;  5D2A A;  2UU8 A;  3LPG A;  2MEV 2;  2UY9 A;  3WOG A;  4WM8 B;  4Y33 A;  4TYS A;  4CPB D;  3ZX7 A;  1RED A;  4C1W A;  1QJY 2;  4S2D A;  1CJD A;  2JE8 A;  4XQ4 A;  3V0A A;  3VLB B;  3ASI A;  3DPR B;  4WZF A;  3I3E A;  1ZYB A;  1PIV 2;  3KCY A;  2OX0 A;  3W58 A;  5K0U B;  4FPO B;  3USU B;  4GH4 B;  1RUE 2;  2MEV 1;  2Y34 A;  3HT1 A;  3HQU A;  1PMH X;  2AEZ A;  1EUT A;  3III A;  3NNM A;  3FWE A;  3QH6 A;  2DU0 A;  2XWB B;  2A1X A;  4JCK A;  4WVM B;  1G86 A;  2P17 A;  3CHX A;  1TME 2;  1W6Q A;  2VZ1 A;  5JUV A;  1AF9 A;  4JHZ A;  5LRR A;  2YDE A;  1J3P A;  3MIF A;  3AJY A;  4P9G A;  4G3Y C;  2R06 3;  4Q4V 3;  1YJL A;  1MQT C;  3N9O A;  4G4F A;  2VZ3 A;  4M4R A;  2DUP A;  4QD2 A;  5EJ3 A;  1WW7 A;  4AED A;  1T6B X;  3J7L A;  2JDU A;  3WDW A;  3ZXA C;  1CAU B;  3SKJ E;  5C3S A;  4R9B A;  5A6X A;  1G7Y A;  1RUE 1;  1MEC 1;  2I74 A;  5DZG A;  2VMG A;  2X5I A;  5HI0 A;  5JLV A;  1H6X A;  4OQ8 A;  1UMZ A;  1PGL 1;  1Q5O A;  4QX8 A;  1TVG A;  2JB8 A;  3AJZ A;  3D5O A;  3IPV A;  3VZM A;  3ZMN A;  5C8C C;  4FTE A;  2BWC A;  4QHO A;  5A7P A;  4QU2 A;  1JZ2 A;  4RGA A;  1FPN 3;  2XLF A;  3VBF B;  1ODN A;  1SFP A;  1RUC 3;  1IPS A;  3MID A;  1W06 A;  1KIT A;  2UYA A;  3C7O A;  5C71 A;  3MFA A;  5A6Z A;  2OPW A;  2QZ2 A;  4O9G A;  3MDP A;  3A0K A;  3TB0 A;  2QNK A;  2EVX A;  3SIT A;  2MHF A;  4PIZ A;  5AC9 2;  3D0J A;  1AZD A;  1UPI A;  3VKM A;  4EE2 A;  5IFP A;  4RD7 A;  5FYV A;  4QX0 A;  4BQY A;  4GWI A;  3RZZ A;  5DZF A;  2JXA A;  2ET7 A;  4JGZ B;  5LA1 A;  4B3N A;  2P3K A;  1EV1 2;  2J42 A;  2P3J A;  3KHB A;  4Z82 A;  2O0O A;  1NLS A;  1SLT A;  1JOJ A;  2FDH A;  1ZRI A;  2QQJ A;  3CJI A;  1I6X A;  2VG9 A;  5CIS A;  4K9S A;  2WT2 A;  2OT7 A;  4PIY A;  3ZYG A;  1SLL A;  3THT A;  2TUN A;  4DEV A;  2J1A A;  4LQR A;  1YWK A;  4ZU4 A;  4IQP A;  4YW3 A;  3TOJ A;  1LNS A;  3N7J A;  1O4Y A;  1ZBE 1;  3TN9 3;  2QQM A;  4PBO A;  4YM2 A;  4X8N A;  5DUX A;  4FOY A;  2Z79 A;  3B93 A;  1FMD 3;  2ZEW A;  4QPI A;  2SBA A;  3H8X A;  2BW8 A;  1Q8P A;  3IBM A;  3OGS A;  4LXL A;  1E5S A;  1XYO A;  2VEC A;  3I97 A;  1G9A A;  2J1S A;  1UIK A;  3FUQ A;  4HLT A;  4UBG A;  4OI1 A;  4FT8 A;  2JDN A;  5FYH A;  3ZPY A;  2WNU C;  2JDA A;  3QOP A;  4ET7 A;  2VQA A;  1PO2 3;  3C7H A;  1WCD J;  2VBB A;  1AR9 3;  2JDH A;  3F2Z A;  5A6Y A;  2ZMN A;  3UNP A;  5F5I A;  4R8H A;  2VAU A;  5LW9 A;  2WNV C;  1HIX A;  3I3M A;  1O3R A;  4A45 A;  2DU1 A;  4RFR B;  2D6O X;  2WS9 3;  3GBW A;  3P3N A;  3B94 A;  3KV9 A;  4WV8 A;  1VBE 2;  4B4P A;  2UUR A;  4A41 A;  1KFU L;  5CG9 A;  1S0B A;  5JIU A;  5C8C B;  1RXF A;  2D98 A;  3PLQ A;  2R6Q A;  1QEX A;  1CAV A;  4PIX A;  5I0T A;  3E6C C;  5IUQ A;  5FKB A;  4EWE A;  2YU2 A;  3HMY A;  3SHR A;  4GB3 1;  1Y3T A;  1LHO A;  2RM2 3;  3OUI A;  4I02 A;  3MUZ 1;  1JYC A;  4L9B A;  4N7I A;  3WNN A;  1OPO A;  4MHR A;  3PUS A;  5ERL A;  4HBN A;  1PZ7 A;  1DQ6 A;  2NPI A;  2VD7 A;  3RYK A;  1AR6 3;  1CJP A;  1Q8V A;  4DRR A;  2WT1 A;  3ZMO A;  2VZO A;  4F8A A;  3L2Y A;  1ZA4 A;  3PJY A;  2X29 A;  1FNZ A;  1ZBA 3;  3DF0 A;  1QOS A;  5FZ3 A;  3VHO A;  4RQP C;  4YM3 A;  2WII B;  4DIN B;  3Q9O A;  4MHU A;  1W8N A;  1H1A A;  1UQX A;  2P2K A;  1K45 A;  3LE0 A;  5DAW A;  5FY8 A;  5EHD A;  3ZO0 B;  3WCR A;  1SFY A;  3VZO A;  5FZC A;  1AXK A;  3WF1 A;  4D7T A;  1OVS A;  1YI9 A;  2ZX4 A;  5IHR A;  2ID4 A;  5EV7 A;  5BY5 A;  5F6L B;  2E26 A;  2GAU A;  5JWP A;  3BIW E;  4COW A;  3CEW A;  1W8H A;  2GNT A;  4A7K A;  1QXJ A;  5E8A A;  3VBR C;  1GAN A;  3WW4 A;  2LTN A;  2B4K A;  2E53 A;  4XHB A;  4URA A;  4BK5 A;  1S2B A;  2V72 A;  2HLE A;  4C0H A;  5A33 B;  1BK0 A;  1HDK A;  4NJ4 A;  4QQP A;  2WRA A;  5FUN A;  4CDQ A;  4FFG A;  3M8L A;  4UFJ A;  4QKN A;  1RHI 3;  2Q4S A;  5EWS A;  5F3I A;  3OCP A;  1JYN A;  1Z7S 2;  2JG9 A;  4AZZ A;  2YZ4 A;  3K4A A;  3KD4 A;  1HRV 2;  3MF9 A;  3AC0 A;  2GC3 A;  2ZGU A;  1XPW A;  5A6Q A;  3OD4 A;  4AVC A;  1D4M 2;  3B3Q E;  1V6K A;  4FPK A;  5C7G A;  1DGR A;  1HRI 1;  2WNU B;  1GR3 A;  4XZU G;  3LSE A;  1NA1 C;  1NQJ A;  3OGV A;  1YXW A;  1H9W A;  2GAL A;  4JRL A;  2IUW A;  4UYB A;  1LCL A;  4MXW B;  4CCM A;  4Y20 A;  2WNV B;  1QQP 1;  1PK6 C;  4Y4Y A;  2VXJ A;  4KWJ A;  2ADE A;  4K1Y A;  3AP5 A;  3VDD C;  2WA3 A;  5H9Q A;  3ZDV A;  2QQO A;  3VZN A;  3VV1 A;  5D8A C;  1O91 A;  2R16 A;  1GZT A;  3RZM A;  1D4M 1;  1F15 A;  3H1W A;  4N53 A;  4HVO A;  3POI A;  5FWJ A;  4NAO A;  1NLR A;  2BQP A;  2HJI A;  2HH9 A;  4QXH A;  5A80 A;  1UNB A;  5A1L A;  4XAC A;  1W6P A;  3AMQ A;  3T1L A;  5JXH A;  3AMN A;  5F3E A;  2ENR A;  4Q4Y 3;  1I3H A;  2WIN B;  3J8F 1;  5K4L A;  3RRD A;  3VBU C;  4CCJ A;  3MUY 1;  4GD4 A;  2JWP A;  4YW5 A;  1H8T A;  1HQN A;  4N43 C;  1JYX A;  1A8D A;  4IDZ A;  3A4U A;  1XU1 A;  4DRV A;  5HBA A;  4UI9 L;  4FSJ A;  1HV0 A;  1AYM 2;  1OH3 A;  2V5D A;  1W9T A;  2Y60 A;  5CBL A;  2Q5T A;  3U37 A;  1NT0 A;  1JOP A;  1BBT 3;  3SQO A;  4IEU A;  2MEV 3;  3ME2 A;  4RQP B;  5CVR A;  3DN7 A;  4NII A;  3T2T A;  4D7S A;  2Y0O A;  1RUD 1;  3OPT A;  1OLM E;  1QJY 3;  2DFB A;  3ZIX A;  4NUB A;  2DVF A;  1AYN 2;  2VGD A;  2R7E B;  4Q1P A;  2I2S A;  1IKP A;  3SKV A;  1J58 A;  1PIV 3;  2IXC A;  2PQS A;  2RS1 2;  1GSL A;  3P5B A;  5FUI A;  3VBR B;  5ISL A;  4EN0 A;  1GUI A;  2CGP A;  4XMA A;  1RUE 3;  4LO4 B;  4TXW A;  3SC7 X;  1AL0 G;  1HB4 A;  3C7G A;  1OA2 A;  2FMY A;  1K12 A;  2XB6 C;  2W91 A;  4JRA A;  4P5Y A;  3APB A;  3H0O A;  1GNH A;  2XHK A;  5A3L A;  1TME 3;  1U5X A;  3DEC A;  2HYX A;  1AYN 1;  4GIQ A;  2IZW A;  2VOX A;  2RS1 1;  3W9A A;  3I59 A;  4MG2 A;  1HB3 A;  3WG4 A;  2Z42 A;  1PVC 2;  2ZGK A;  4BIF A;  4ATE A;  3LIG A;  3FBM A;  1YQC A;  2QQW A;  3JUU A;  5FZA A;  3H1M A;  2RE9 A;  4WVW A;  4XUR A;  3R05 A;  5L9V A;  1H4H A;  5EPA A;  4AED C;  4AFC A;  1LHW A;  4R9D A;  2G1M A;  3PUA A;  4XBQ A;  4XJW A;  1PK6 B;  5EJ1 B;  4LTA A;  4HFS A;  1JXN A;  2P3I A;  3UK9 A;  3VDD B;  1H4G A;  3HQR A;  3QD6 A;  5A7N A;  4YFZ A;  5L73 A;  4N9H A;  4AVB A;  1CX4 A;  4MGQ A;  3ZOI A;  4XCB A;  1DLC A;  2VMF A;  3ON7 A;  3KSC A;  2R04 1;  1UKR A;  3BOW A;  1KEX A;  4FP3 A;  4ZZ5 A;  2A6X A;  5AC9 3;  1K42 A;  1CPM A;  5FZM A;  3UL2 A;  3IM0 A;  1BYH A;  1KXG A;  1J3Q A;  1KQR A;  2DCJ A;  3B9I A;  3MPB A;  5FJK A;  5T52 A;  4AI2 A;  1IG3 A;  2KXL A;  1SDD B;  5L9B A;  2CWS A;  1RUO A;  3HQX A;  1LOB A;  3VBU B;  4V1P A;  1EV1 3;  2YY1 A;  4Y1Y A;  1BMV 1;  5JXJ A;  4N43 B;  3FL7 A;  1QJX 2;  3EMR A;  2WYS A;  2ZPX A;  1GYK A;  2VXR A;  3TWI A;  2RJ2 A;  1YRZ A;  3POY A;  4Q27 A;  1POV 1;  3RJR A;  2ARC A;  3A23 A;  2WQZ C;  5A32 B;  4OVE A;  1OUX A;  3RZH A;  4IGP A;  1O7F A;  4JHT A;  3DKW A;  1O3T A;  3RWN A;  3CJI C;  4A4A A;  2A3Y A;  4K3U A;  4LKF A;  4Q4X 3;  3D8C A;  3OGJ A;  1UX7 A;  2Y38 A;  2VZQ A;  2XVL A;  4WZC A;  1W0P A;  4PF1 A;  3L9J T;  2VNV A;  2RR1 3;  1N1V A;  4ZS3 A;  4BA6 A;  4B8E A;  4XE9 A;  4ZZ8 A;  1UY3 A;  3V0A B;  5JZG A;  1ULD A;  2AR6 A;  2G4I A;  5I0D A;  3NKG A;  4AGV A;  4MVT A;  1CZV A;  2R1D A;  3IKW A;  2J7M A;  2Q8D A;  4QPI C;  3KV6 A;  1BEV 1;  1U5Y A;  1MVE A;  4XF4 A;  3W20 A;  1WKY A;  2CDP A;  5FAX A;  4KQ7 A;  4Q4W 1;  1EP0 A;  4NWW A;  5CKQ A;  2OW4 A;  4P08 A;  1A8M A;  1VBE 3;  4ASK A;  1W6Q B;  4A3Z A;  1RJ7 A;  3ZKU A;  1GWL A;  3S5A A;  1BCX A;  5JOX A;  1VMJ A;  3PHM A;  5DUW A;  3USS A;  3LZZ A;  3O1U A;  4AED B;  2C5D A;  3B02 A;  4XFA A;  5F2S A;  3ZYR A;  4URT A;  2NM1 A;  2A5Z A;  2D6P A;  4AI8 A;  5H9P A;  5HXV A;  5JSO A;  4DZG A;  5JMC A;  3H3Z A;  3VBS C;  1XBF A;  3I3Q A;  4RA0 A;  1KS4 A;  3DKQ A;  3IPV B;  3T0A A;  2B39 A;  1AUY A;  3ZFE A;  3D6E A;  4XC9 A;  5L36 A;  3PVN A;  3LOB A;  4CTE A;  1JMU B;  4NN0 A;  2RMU 3;  5C70 A;  5CG8 A;  4EN8 B;  3KQR A;  2RS3 2;  4FFF A;  2JIG A;  4YGB A;  2PFW A;  2Y6H A;  4N7U A;  4XQD A;  2YPD A;  3T08 A;  5A3N A;  3AKT A;  4KG8 A;  1M06 G;  2QE3 A;  2GH2 A;  3N9M A;  4AI0 A;  4MET A;  3N9L A;  3RG0 A;  5E1R A;  3GZE A;  4J1X A;  4AL9 A;  5FMD A;  3NO8 A;  3QBQ A;  4NRO A;  4QB1 A;  4YYO A;  3S57 A;  3AP9 A;  3BU0 A;  1ZZB A;  2D6L X;  4R9C A;  4GAL A;  5DAB A;  3IIA A;  5FY1 A;  1STM A;  2WO2 A;  2ZKL A;  3CJI B;  5C3P A;  3AK0 A;  2RS3 1;  2J1E A;  2QFE A;  1D7P M;  4CPB A;  3CJX A;  5BNN A;  2D5H A;  1FI2 A;  1YFU A;  4XFH A;  1O6U A;  4XQW A;  4CA9 A;  1VAK A;  1CIW A;  1TMF 1;  4O61 A;  2WO7 A;  1JH5 A;  4XF0 A;  5EZW A;  4XHX A;  5LZ6 A;  4MAD A;  2VCA A;  1Z7S 3;  4OUL A;  5JPN B;  1HRV 3;  2WZE A;  1PMJ X;  3VHR A;  4TLF A;  1N1Y A;  3MIE A;  1UXX X;  4CDQ C;  3VHP A;  1OBN A;  2J1V A;  4QPI B;  1Y43 B;  1OQ1 A;  1OF4 A;  3LEI A;  1IS6 A;  1F8V A;  2JG9 C;  5CFC B;  4XFB A;  4MV2 A;  4QPG A;  5I8S A;  4S2H A;  4YPJ A;  2FCT A;  3U1X A;  5H9S A;  3LA3 A;  2PHW A;  1PVX A;  1OVP A;  3KV5 A;  3AP7 A;  3RI9 A;  2FDJ A;  2MNG A;  2VVF A;  2FQP A;  5GZG A;  5FPL A;  4HXC A;  5DUV A;  1H8V A;  3WP5 A;  1PM4 A;  2GU9 A;  1H2N A;  2VE1 A;  4LBQ D;  4QMA A;  4XF3 A;  3CBN A;  3POE A;  4Y24 A;  5GKA C;  4XF1 A;  5FDB A;  4OLL A;  2BNO A;  2QQL A;  3VBS B;  4RFT 0;  1GQH A;  3WT3 A;  2PN5 A;  2AEY A;  4FXG B;  1XNK A;  3UKV A;  5HCA A;  4N53 C;  5IVE A;  1CAV B;  2I45 A;  3CDZ B;  4MGK E;  2PAE A;  1QJZ A;  3CO2 A;  1YFW A;  4GZ9 A;  2AZ5 A;  3T09 A;  3GZU C;  3VDB A;  4HN0 A;  1V9U 2;  3AL6 A;  3GYD A;  1AYM 3;  3K4Z A;  1R09 2;  4DIQ A;  1GQG A;  2DBI A;  2ZX0 A;  3HD8 B;  4DO0 A;  4EN7 B;  3VD5 A;  1SCS A;  4XFC A;  1MS0 A;  1O5U A;  2VOK A;  4CVU A;  2VUJ A;  3VUO A;  1H8T C;  2C24 A;  2C4X A;  4FPE A;  2BJS A;  5DDJ 3;  3AYD A;  5J98 B;  1GIC A;  1WME A;  3FHI B;  4GKX A;  1HN1 A;  2E33 A;  4NPR A;  3VL9 A;  3W21 A;  3WIN E;  4HSL A;  1UD1 A;  1LEC A;  1RUI 1;  1ZRF A;  3QCW A;  4NPM A;  5LBC A;  5J37 A;  5CKM A;  2PAK A;  4Q5O A;  1H0B A;  3MLK A;  1R09 1;  4COU A;  2WJS A;  3N3H A;  2E51 A;  1SAC A;  4E2Q A;  2KM2 A;  1W8O A;  3JZV A;  4QKD A;  4TN7 A;  1UMH A;  2VTX A;  3IT8 A;  2WFF 2;  3LPF A;  3AB0 A;  3CQO A;  2XQX A;  2WWS A;  4P02 B;  4Q0V A;  4QKF A;  1LGB A;  3VKO A;  1Q43 A;  1RIN A;  1XSR A;  4NR1 A;  4Q0S A;  2VW1 A;  4AQ6 A;  2PHU A;  3B00 A;  1AL2 2;  1IQA A;  1ASJ 2;  4CDQ B;  1PVC 3;  1EY2 A;  3AKQ A;  4MGT A;  3K46 A;  4A2U A;  3UGH A;  4JDN A;  4I01 A;  4ARX A;  1WLC A;  2JG9 B;  2WKK A;  4YVS A;  2WFF 1;  1AR7 1;  5C5U A;  3ACH A;  3IDE A;  2GNM A;  1AX1 A;  1JOB A;  3DYO A;  4SBV A;  1HW5 A;  3AVS A;  4DUV A;  2G9G A;  3E97 A;  4UBH A;  1C8N A;  1POV 0;  1VAL A;  1Q8O A;  2HWF 2;  5GAL A;  5I8T A;  2X8K A;  3AKP A;  5A1F A;  4Y20 B;  2UY8 A;  1VRH 1;  3WDY A;  4OI0 A;  4BIO A;  3MYX A;  1Q8S A;  3H3L A;  3M3C A;  4XUO A;  1ZRE A;  3AMP A;  3MLL A;  4I30 A;  4XPV A;  2XJP A;  4XJ9 A;  3NNL A;  3ZYH A;  1BZW A;  2VQU A;  4N53 B;  3ZSK A;  1F31 A;  4NWV A;  1UYP A;  5BV6 A;  1B35 A;  3AMH A;  5LCW L;  1OLM A;  2XH6 A;  1WCS A;  5DG1 A;  5FY9 A;  2DDU A;  2FCU A;  1YNA A;  1W6P B;  2JD9 A;  3M2M A;  4XBL A;  1QJX 3;  1BK1 A;  2HWF 1;  2BU9 A;  3LF7 A;  5FPA A;  3TNP B;  1FT9 A;  2A6W A;  3O1M A;  1DGL A;  1H8T B;  2OUJ A;  1U12 A;  3OY8 A;  2DTW A;  1CAX A;  3V64 A;  2K46 A;  3U10 A;  2D3R A;  3I3D A;  3ZFG A;  5EXO A;  2E7A A;  4HPK A;  3WNP A;  5FZH A;  2IXL A;  3M4F A;  4K1Z A;  2YFZ A;  5FP8 A;  1SDW A;  1PNF A;  2LM3 A;  1RC6 A;  2DUO A;  4OUM A;  4F3J A;  4XFF A;  3OYW A;  4AVS A;  4QPW A;  3ZFF A;  1CON A;  1L3J A;  5HPO A;  2E32 A;  2Y64 A;  3K3N A;  1CAW A;  4Z07 A;  3VKL A;  4AQT A;  3R4S A;  1PGW 2;  4AXO A;  1ULO A;  4HMZ A;  1VIW B;  2LRP A;  4JVA A;  4TSV A;  3OD0 A;  5FP7 A;  4YG0 A;  1XYN A;  4NOT A;  1W8T A;  4A7Y A;  1GKB A;  1COV 1;  4COV A;  2FBE A;  1RUH 1;  4XUQ A;  1Z0H A;  4ISQ A;  4PQQ A;  4BCU A;  1OH4 A;  1VBC 2;  2CAU A;  5JZG C;  5FMC A;  1V6I A;  3LAG A;  3O12 A;  1WGP A;  4CUG A;  1BVP 1;  5JMO A;  3H1Y A;  2B42 B;  4IEO A;  2ZCW A;  2ZZJ A;  3MW3 A;  3RWK X;  4BQ5 A;  1SBD A;  4CP0 A;  5FWE A;  4PDW A;  4FQ4 A;  4AEM A;  3I59 B;  5EP9 A;  4QGN A;  3ZR5 A;  2VZP A;  4Y5Z 0;  4Z92 B;  4Z1V A;  3RZJ A;  4BDV B;  2AEN A;  2B46 X;  2IFW A;  3V65 A;  4OHY A;  3WQ0 A;  2CGN A;  1UCX A;  1CIY A;  5GZF A;  5FZO B;  3CZU A;  1S0J A;  1R1A 1;  1M4W A;  3I2D A;  4LK6 A;  1H1I A;  4L92 A;  1FOD 3;  2ZGP A;  2XGX A;  3J9S A;  4NE9 A;  1LHN A;  2MPF A;  2KR2 A;  1KRI A;  1JHN A;  1CVN A;  3H7J A;  1DCS A;  1RUF 2;  2VNR A;  2ZHM A;  5E16 A;  4BHP A;  1K5M A;  2K0G A;  3LDK A;  4HG6 B;  3RJ2 X;  4LUL A;  3ZKY A;  2WAO A;  4IET A;  4LIV A;  5LA9 A;  3ZSE A;  5C8W A;  3TNQ A;  2P1B A;  3BU7 A;  3RGB A;  4XW3 A;  1JU3 A;  2P34 A;  3U75 A;  2WR9 A;  1ZZ9 A;  4OMD A;  4P5H A;  1UAI A;  3MBW A;  3HNM A;  2PLV 1;  4EJR A;  5IAX A;  1W9F A;  4ITC A;  1OF3 A;  3QH7 A;  4L99 A;  4ZXE A;  5A3M A;  3U78 A;  3I7D A;  5FOJ B;  2WZR 1;  4R4X A;  2X53 S;  3GNE A;  3P1I A;  5FYU A;  2EF6 A;  1G8W A;  4QB2 A;  2FDI A;  2RDQ A;  3KZ4 C;  5AVA A;  1DFQ A;  1LED A;  1UU6 A;  2BEO A;  2OZ6 A;  3KF3 A;  5FBJ A;  5LK5 A;  5A3U A;  5IK8 A;  3J7H A;  1X8M A;  2HKX A;  4Y1X A;  3WZ1 A;  2WWJ A;  2XPJ A;  2JEN A;  3BN6 A;  3BTA A;  5BNN C;  1VR3 A;  5A3P A;  3UET A;  5JOW A;  1VP6 A;  1IHM A;  4IEQ A;  1EYB A;  2P5B A;  2V09 A;  2JE7 A;  1MEC 2;  4MGI E;  4NHM A;  5HXM A;  4Q1R A;  4A3X A;  4XAA A;  3THC A;  1KDM A;  1ULG A;  3WNM A;  4B29 A;  1PGL 2;  3OB8 A;  5JZG B;  3T0D A;  3R4U A;  4A42 A;  3AYC A;  1JYT A;  2PMW B;  3WDU A;  1FYU A;  1TNR A;  2ZX3 A;  3VDA A;  4BQX A;  5DXD A;  1UY2 A;  4H14 A;  1P8J A;  4N90 A;  4YWA A;  3KGL A;  4NHX A;  2IWG B;  3I2F A;  2CTV A;  5HV0 A;  3GBG A;  3AKR A;  1GFF 2;  3WNX A;  3AMM A;  4C0B A;  4NHL A;  3HJR A;  5DMY A;  1CES A;  4Z2A A;  1RXG A;  4CDU B;  4JZR A;  3NST A;  1C1L A;  5K9Y A;  2W1Q A;  2VBP A;  5DUU A;  5C9A A;  1H2L A;  4MGY E;  1NE4 A;  1V9U 3;  1XB9 A;  2CSG A;  3WR0 A;  1R09 3;  3C2U A;  1BHG A;  4HET A;  5CNA A;  1LB2 A;  2P6C A;  2IC1 A;  4UXA A;  3ILF A;  4ES9 A;  2HWB 1;  1L7Q A;  5EQU A;  5A7Q A;  5K7P A;  1ENR A;  4YW1 A;  1G6N A;  4RGK A;  1EUU A;  2JB4 A;  4LA3 A;  1H9P A;  1MS9 A;  4LE4 A;  1RUG 2;  2VUA A;  4UAP A;  1ZBE 2;  3LB9 A;  2Q8C A;  5FYC A;  2Z4F A;  2P4E A;  5F37 A;  5F1R A;  3IWZ A;  3ZN4 A;  2XBO 1;  3T3Y A;  3O1T A;  1IQD C;  3NJV A;  5F3G A;  1DIW A;  1UOG A;  4CCN A;  5FR3 A;  1N47 A;  3BPS A;  4AQ2 A;  1JS9 A;  1QIQ A;  3N4M A;  3E5U A;  5T54 A;  1LR5 A;  4H3W A;  3POF A;  1JZ7 A;  2YBP A;  2WFF 3;  1RMU 1;  3E5X A;  3LEK A;  2PHR A;  4YM0 A;  4E8D A;  5C3R A;  5KXD A;  1Q56 A;  2D3S A;  1RUG 1;  4Q29 A;  4FPH A;  4AEJ A;  1DGW X;  1VAV A;  1AL2 3;  5K8S A;  1C1F A;  3WQ7 A;  5BNN B;  1GWK A;  3PIG A;  1ASJ 3;  3C7E A;  3VN4 A;  3VDC A;  4P9J A;  2Y33 A;  1B09 A;  1YQ2 A;  4N8M A;  4YZ4 A;  1C57 A;  2G19 A;  2EXJ A;  4GKY A;  1XSQ A;  4H2A A;  2XJU A;  4P9I A;  3WP3 A;  3V0B A;  1IOA A;  1QNY A;  3WHT A;  4BME A;  2V4A A;  3N35 A;  3NV4 A;  5DAX A;  4LOT A;  3PUR A;  2E7Q A;  1HN0 A;  4FQZ A;  5T5L A;  1NY7 1;  3VBO A;  2D6K A;  5GLU A;  2RJK A;  1MQT B;  4GB3 2;  4DMI A;  1IG0 A;  2ZAA A;  3M3E A;  3DUI A;  1JUH A;  2HWF 3;  1WUV A;  2BGO A;  4M4P A;  1OQD A;  4YVS C;  1A6C A;  5C4W A;  1V00 A;  3PTY A;  4Y1V A;  4NO4 A;  3CNA A;  5C3Q A;  2DF7 A;  2BV4 A;  2YFU A;  5FBZ A;  3ST7 A;  4D0Q A;  2VNG A;  1MZ5 A;  1NXD 1;  1N3P A;  5IVC A;  4XDP A;  5EYY A;  3WDT A;  4RHV 1;  4PBP A;  4MGZ E;  5IK5 A;  1SLB A;  1XNC A;  3PUI A;  2VOW A;  4G9S B;  3C7F A;  1RGS A;  3BOD A;  3PVE A;  4FPJ A;  5GJ6 A;  3ENR A;  3SH4 A;  2Y6G A;  1TG7 A;  2JX9 A;  2YC2 A;  1B35 C;  1ENQ A;  4AR2 A;  4QQO A;  5IVB A;  1TEI A;  2XR4 A;  1R08 1;  4FPG A;  3HPN A;  2RDS A;  1VAM A;  3ACL A;  4JX0 A;  4HL0 A;  3VZL A;  4LHK A;  3ZXL A;  4V2W A;  1WD4 A;  3I54 A;  2PHX A;  3ZFG C;  2HBU A;  1IS3 A;  1DQ0 A;  5D1I A;  3KMH A;  1OXC A;  1NZC A;  3FE5 A;  4LUK A;  1HRI 2;  2WBK A;  2EIE A;  3A22 A;  1LU2 A;  5FPV A;  3ZFF C;  4OI4 A;  1W0N A;  3DEM A;  3RQ0 A;  1FAT A;  1GP4 A;  2VMC A;  4ZON A;  4PI0 A;  2AGS A;  1ULC A;  2XLG A;  3NNF A;  3O0X A;  1VBC 3;  4GMP 1;  1RJ8 A;  5LA2 A;  1QQP 2;  5KBF A;  1W2A X;  2NQY A;  3KV4 A;  3NJX A;  2O14 A;  2QBX A;  2CGO A;  2VW2 A;  3WEZ A;  1LTE A;  3PTR B;  1N1T A;  1RIT A;  4XVH A;  4Q0U A;  2D5F A;  2VU9 A;  4W65 A;  1BKZ A;  4LHS A;  1YCI A;  1US3 A;  3RZK A;  2ET1 A;  1S0G A;  4NHK A;  1AVB A;  1GBG A;  3KT4 A;  4I2O A;  4LK7 A;  3GAL A;  1QHD A;  1XOY A;  5CU1 A;  5FQ0 A;  3NNG A;  1NX9 A;  2EIC A;  4W6W A;  1YHF A;  3ZYJ B;  1SFN A;  1VBB 1;  4YVS B;  2YHJ A;  4ZHN A;  3J8F 2;  2XJV A;  4MOA A;  5G04 L;  1Y9M A;  2WAA A;  4IE5 A;  4QQL A;  1G9C A;  4ORF A;  4UW6 A;  3WP6 A;  1VBA 3;  1RUF 3;  4LBQ A;  5FLI A;  2FD8 A;  2W46 A;  4A7Z A;  3N9P A;  4Q8K A;  4Y1Z A;  1WW5 A;  3UGF A;  2R0F A;  2QZ3 A;  3POS A;  4Q0P A;  3BTY A;  1ODM A;  1I9R A;  4D6R A;  2VO5 A;  5IFT A;  1OUR A;  1W8F A;  2R07 1;  4CDU A;  3WD5 A;  1F5F A;  1RUD 2;  2YGM A;  2R0H A;  1K5M C;  1LEM A;  4MYE A;  1NAE A;  2IXK A;  2VZS A;  4COZ A;  3VL8 A;  1REE A;  2BOJ A;  2VL4 A;  3N7L A;  1B35 B;  5L9R A;  1ENS A;  1XXN A;  3K75 B;  5BYN A;  3AVR A;  4JV4 A;  2NYY A;  2ZAC A;  2HWD 2;  5CB7 A;  2WA4 A;  1W9Y A;  4YG3 A;  4AFD A;  3I2H A;  1WMX A;  3HR9 A;  1HX6 A;  4LHN A;  2E7T A;  4AEK A;  2OQ7 A;  5GLT A;  4AGR A;  1HLC A;  5BNO A;  4QQH A;  2QQN A;  2F4L A;  3OY8 B;  2ZGL A;  4MX3 A;  5FZB A;  1CAX B;  2ZGO A;  4NIG A;  2EID A;  1LRH A;  1AXY A;  2XJS A;  3ZFG B;  4HPK B;  1UZW A;  3MGU A;  4YVW A;  4QGM A;  2ZXQ A;  4O7X A;  2HWD 1;  1GZW A;  4Q0Q A;  5JXI A;  1ND2 A;  3OYW B;  3THP A;  3ZFF B;  3FZ3 A;  1MEC 3;  3PMS A;  4IXL A;  1WBF A;  1CAW B;  2PTM A;  3JBG 1;  1JZ5 A;  3OEB A;  4C8D A; 
#chains in the Genus database with same CATH homology
 3UGG A;  3PIJ A;  2QQU A;  3ZR5 A;  2ADE A;  4JQT A;  3U75 A;  4UFL A;  3UGH A;  4FFF A;  4QHZ A;  1UYP A;  5FK8 A;  2AEZ A;  2AC1 A;  2OXB A;  5ANN A;  1Y9M A;  3OSD A;  4CCE A;  4FFG A;  4UFJ A;  2AEY A;  3KF5 A;  3LF7 A;  1Y4W A;  3HBK A;  3LIH A;  3LIG A;  5FIX A;  4B1M A;  5FK7 A;  4AZZ A;  2QQW A;  4CCD A;  5FMB A;  3UGF A;  3LDR A;  3LFI A;  5FMD A;  4UFK A;  5FKC A;  4EQV A;  3U1X A;  3KF3 A;  2XQR A;  4CCC A;  3PIG A;  4UFH A;  5FMC A;  2ADD A;  3LDK A;  1ST8 A;  3S5Q A;  5FKB A;  3NMB A;  3H3L A;  3IMM A;  3SC7 X;  3U14 A;  4UFI A;  4UFM A;  3LEM A;  1Y9G A;  3RWK X;  4B1L A;  4HXC A;  2QQV A;  4FFH A;  3ZR6 A;  4FFI A;  1W2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...