2VD7A

Crystal structure of jmjd2a complexed with inhibitor pyridine-2,4- dicarboxylic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
350
structure length
350
Chain Sequence
ETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords JMJC DOMAIN-CONTAINING HISTONE DEMETHYLATION PROTEIN 3A
publication title Inhibitor scaffolds for 2-oxoglutarate-dependent histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2vd7A01
4GD4A 5FZDA 5FJHA 5FPBA 4D6SA 3KVBA 3PUSA 5FYMA 2XXZA 5A7OA 5FJKA 5FZ9A 5A80A 4BISA 4LITA 5FZMA 5A7WA 5F3EA 5FY0A 4TN7A 5ISLA 1VRBA 4QXHA 2YU2A 5FY5A 3OPWA 5E6HA 4GJYA 5FZ6A 5F3IA 5A3PA 3DXUA 3PTRB 3KV5A 3K2OA 3K3OA 4NUBA 2XDVA 4V2WA 4Y3OA 5A1LA 4Y4RA 5FZBA 4BU2A 5IVJA 3PUAA 4CCMA 3K3NA 2WWJA 2P5BA 3ZPOA 5FPAA 5F3CA 4GJZA 5FPLA 5FZOA 4QXBA 5FZGA 5IVEA 5FUPA 5FP9A 5IWFA 2Q8CA 5FPUA 3PU8A 3RVHA 5FZFA 5A7SA 5A7QA 2OS2A 4DIQA 5FZ1A 5FZHA 3N9PA 3AVSA 5FZCA 3OPTA 4QX8A 5FP3A 4E4HA 5FXWA 4LXLA 5A3NA 5LY2A 5FYUA 5FYZA 5FP4A 2YBSA 5LW9A 5IW0A 4CSWA 5FUNA 4CUGA 2GP3A 4Y33A 5LY1A 2XMLA 4CCOA 5FY1A 5FYIA 2XUEA 3ZLIA 3KV6A 5FYCA 5FYBA 5FZEA 3KV4A 4EZHA 3NJYA 5KR7A 4C8DA 4QX7A 4CCNA 5FYHA 5FZ7A 3PUQA 4LIVA 5FZ0A 4DO0A 5FY4A 4CCLA 4GAZA 4ASKA 2Q8EA 2Q8DA 4QU1A 2OX0A 5FXVA 3PDQA 3KVAA 3N9OA 5FBJA 5LWBA 4LIUA 5FZIA 4D6RA 2PXJA 5A3TA 5FYSA 5A7NA 3LDBA 2VD7A 4IGQA 2GP5A 5FXZA 5FWEA 2YBKA 3KV9A 5F5IA 4XDPA 5FXXA 5IVFA 2OT7A 4AI9A 4D6QA 5IVVA 4CCJA 5F3GA 5FYYA 2OQ6A 3U78A 5FZKA 4UF0B 4BXFA 4V2VA 5FY8A 5F39A 5F37A 5IVCA 5FZ3A 4EZ4A 4IGOA 5IVBA 3N9NA 3PU3A 3PURA 5F5CA 3DXTA 5FY7A 4IGPA 5FWJA 4CCKA 3N9LA 4QWNA 2OQ7A 5FP7A 2WWUA 4XDOA 5F2WA 5FZOB 5FZAA 5FP8A 3UYJA 5F32A 4EYUA 3U4SA 5FV3A 4UF0A 5FPVA 5FZ4A 5F2SA 2YU1A 4HOOA 5IVYA 4AAPA 5FZ8A 2YBPA 5K4LA 3AVRA 2W2IA 5A1FA 5FY9A 5FYVA 5A3WA 5A7WB 5ANQA 3N9QA 2YPDA 3AL5A 5FZLA 5F5AA 5A7PA 5FYTA 5CEHA 4QXCA 4HONA 3N9MA 4URAA 3AL6A 3LD8A
chains in the Genus database with same CATH superfamily
1LEMA 2VMIA 3ACHA 1AR83 4FPOB 2WT2A 2VO5A 4N43B 1QXRA 3D0JA 4P02B 4FTSA 1F9KA 2C1FA 2X8KA 4UWDA 5K7PA 4QKDA 1EUUA 4QXHA 4YW6A 4PF5A 5FY5A 2ENRA 1UKGA 1FMD2 1V6MA 2ADDA 1ENRA 1O91A 3VBFB 5JZGB 1NCQA 1PIV3 3RMXA 1FPN3 4AG4A 5L9VA 3ITQA 3PTRB 2EIEA 4Q27A 3RYKA 3EBRA 4EWEA 1NA1C 4MLOA 2W3JA 2MNGA 3MZHA 1YRZA 4BU2A 5C9AB 3QBQA 3E5UA 1IS6A 1LOAA 1QH7A 3ACIA 4N7IA 3B94A 1K3IA 5DXDA 1MZ6A 2IXHA 4LO7A 1AJOA 1RUD3 3Q8AA 4FP2A 4CUCA 3THTA 1REFA 3FWEA 1VBC1 1J3RA 4LXLA 5A3NA 5FMBA 3URFA 2NM1A 2RR11 5IHRA 1S0GA 2BVBA 2TUNA 2HYKA 3H9AA 2PHDA 3THCA 2W1WA 4NIDA 1GR3A 3RMYA 3VBSC 1QHDA 5FIXA 1TG7A 5LY1A 1R083 1IKQA 1HRV1 2HWC2 3KGLA 3TOJA 1AYM2 4YGEA 2BPA2 4XACA 3WQBA 3H0OA 1GZWB 4HL0A 2A3WA 1SDWA 3NJYA 4NIHA 4YRDA 2WNUC 5GZEA 2RMU2 3ILRA 4YVSB 4LIVA 3MIEA 1TNFA 1X36A 2BJSA 1HB4A 2EIDA 1GOFA 1D4M1 4K9SA 2VOWA 4KWJA 1AXYA 1W04A 5D8AC 4KGQA 1PGSA 2WO3A 3FLRA 1A34A 1PNGA 3ZXLA 2KM2A 3V64A 4D7SA 1UIKA 1WCSA 1R093 1O3TA 3FHQA 1F8VA 3CDZB 4LBQB 1ST8A 3SHRA 4MHRA 3H42B 3MF6A 4D7TA 4EN9B 1NCRA 5F39A 3POEA 2VGDA 3VBHC 2DUOA 3MPPG 4FFHA 2GAUA 1VB2A 1VBB1 2WNOA 1IHMA 3QD6A 4HSJA 3VD7A 4M3CE 2CU5A 4XYXA 4CCKA 3ZMOA 4FPHA 1Y9MA 4BMBA 5K0UC 1IKPA 2A73B 3U0ZA 5I91A 3KSCA 1ZA4A 3KZ4C 4GH4A 4XCAA 2AC1A 2PHUA 4CEWC 2OW4A 2GDFA 2VMHA 4JZRA 1VP6A 3JCIA 3PMEA 4UBHA 4OHZA 4KGGA 2ORXA 3AZVA 1HB3A 3KF3A 3RZHA 2G1MA 2FD8A 1YQ2A 1VBC3 3CNAA 1DYPA 1NLRA 4LHSA 3AX4A 4NPRA 2VULA 1OQ1A 4Q0UA 4Q4W2 1BK0A 1VBA1 2PLV2 2RR13 3WW3A 4CDQC 4COZA 2B39A 3IKWA 4MHUA 1Z0HA 4Y24A 4LHNA 2RS12 5F5AA 1NCQB 5HCBA 5CEHA 5KHGA 4AVCA 3FFQA 2ZX1A 4I3PA 3VZMA 1HRV3 1C5IA 1W6OB 4O61A 3WDTA 2O0OA 1LOCA 1AL0G 1O8PA 5FK7A 4YVWC 1QOOA 5FJHA 2Y0IA 4CXXA 4D6SA 4RQPA 4ONUA 2PQSA 1JOJA 3LFIA 2ZXQA 1W2NA 1VRBA 2BNOA 3FJSA 4XHBA 1NX9A 2GH2A 1OOPC 1REDA 2XGXA 1D4M3 3I4IA 1CAWB 3EHKA 1A8DA 3JD72 2UWCA 1L3JA 3NV3A 1YLLA 1YC61 1NE4A 1SLCA 2VW1A 4V2WA 4Y3OA 2WLQA 2PQQA 1PO11 1CAUA 1SLTA 4M0HA 1LAJA 4AZZA 4BLJA 4QX3A 3PJYA 1QJY1 4WBBA 1QH6A 1QU0A 2B8MA 1W8ZA 3H1WA 1AR91 1JHNA 3BTAA 2G4IA 2XQRA 5BNOB 3WNMA 4X6QB 1DU3D 2RS31 2VMCA 2YC2A 5I8SA 1ASJ1 2CGPA 1AXKA 4RSUA 1S55A 2UWBA 3IDBB 3NMBA 4IE0A 1OUXA 5KXDA 1ZRDA 3AP5A 2DVAA 4JAAA 3FLPA 4HK9A 5LY2A 1JU4A 1LOFC 1WLWA 4Y5TA 4C1XA 2YBSA 1PZ7A 3WNOA 2QTWB 1D7PM 1EYBA 2B4KA 3I2OA 5DAQA 5C71A 2XUEA 2VVEA 1VMHA 1O59A 3KV6A 1XU1A 4FSJA 4CU6A 2DCTA 3TN92 5KXCA 2VXJA 4N90A 2D7FA 2PHTA 4J1XA 1RGSA 3VZKA 4NIAA 5BNNA 5C5TA 3SEEA 4CCLA 1MS5A 1LHNA 1NCRB 4KMQA 3AXEA 1VBA3 4YZ3A 4FAGA 2XUMA 2YXSA 1AR61 5CADA 1A78A 2CTVA 1GP5A 2GP5A 4JKLA 3DPRC 4OLLA 4RYDA 2QFEA 5IUQA 5KC6A 4F8AA 4CVUA 4HZFA 1SPPA 3QLQA 4JGYB 4AGRA 4AQTA 1YQ6A 3CKHA 5FLJA 4U2AA 3B3QE 2FDIA 3PIJA 4QHOA 1S0BA 1SCRA 3H1MA 1W8FA 2G9ZA 5DZEA 3Q8BA 1ND2C 2VNGA 1QOSA 2Y6HA 4JRAA 1WLDA 2P3KA 4FPJA 4I0WB 4L9BA 3PU3A 1UY3A 1EP0A 5FY7A 5KBFA 4AR2A 3HN3A 2NP0A 5EHDA 2QVSB 3DYMA 2PHFA 1JZ6A 3UETA 2WWUA 5F2WA 4AFDA 2Y6KA 2ZKNA 4XVHA 3FFZA 5I0RA 1F2NA 2PHXA 2P17A 3M7AA 1QJY3 2P3IA 2JDAA 3PTYA 3ALQA 3T2QA 3W9AA 2BW8A 1AR93 1G9DA 1NOVA 2YFZA 4TLGA 5H9SA 5SV8A 2XH6A 1SG3A 1ASJ3 3AFGA 1XSQA 4DRVA 4LEJA 2ZTNA 4AXOA 1ND3A 1R1A2 3EXUA 4EN8B 5DMYA 4I0AA 1C8NA 1GOGA 2R49A 3S5AA 1H0BA 1CIWA 3AZXA 1DQ1A 2CWMA 3U37A 1MEC2 2VNRA 4GIQA 1GNZA 1KDKA 2D6MA 5C8CA 2GALA 2J1AA 1X8EA 3ETQA 2XJPA 3C7HA 4XCBA 5C3SA 1H9WA 3AZWA 1AYN2 5FQ0A 2FDFA 4GKYA 3VBUC 1US2A 1V70A 5F8PA 3HOBA 1Q43A 4Q1PA 2VCBA 3PUSA 4ISQA 3SEPA 4BQ1A 5KXBA 5FJKA 1JYVA 1WMDA 2ZMLA 4XUTA 2WR9A 4D7YA 5CA6A 5A7WA 3H8UA 3LIGA 3M2MA 5E6HA 4QPYA 5C4WC 1DQ6A 5JSRA 3ZSEA 2F4PA 3WF4A 4XUPA 3ZFFA 4BWOA 4IETA 2E26A 1AR63 1MS8A 2WFF2 1YQ8A 3PHMA 1DZRA 1O4YA 1VPHA 1GP4A 2VNOA 4GJZA 4IEZA 2E32A 3JBG2 4XF3A 4COYA 3RYPA 3O1OA 1T6GC 3D82A 2D3PA 1S1AA 1DZQA 2YYOA 3NKGA 3VKLA 3VD4A 2D5HA 3ZM8A 2RJ2A 4XEZA 1SLLA 5FZCA 3OPTA 5LA9A 5I93A 1W9WA 3LA3A 4GWNA 5BNNB 2ZOEB 5IK8A 2X09A 3EYPA 1RUC2 1UY0A 3OUHA 5IW0A 1YI9A 3OYWA 4Y33A 4B4RA 2DFBA 2ZZJA 1QJX3 1PX4A 2RS52 2H0VA 4Q8LA 3RFRA 4QB6A 4JHTA 1NXMA 1N3QA 4WZCA 3WG1A 4A42A 1PVC1 4PIXA 5KR7A 5T55A 4K21A 2HWF1 1GNHA 2VU9A 3ZVXA 4AQSA 4C8DA 4CCNA 2OPKA 2GC1A 2H6BA 4V1PA 2D44A 2JG9B 4LO5B 3KQ4B 2W1UA 3ZOIA 2IC1A 5DDJ2 2Q8EA 2Q8DA 1ZBE2 2G19A 4AQ2A 4AVSA 3P6BA 5FBJA 1V0AA 3CJIA 5FMDA 2VVDA 2BFUL 4WM7A 5CFCA 1PMHX 4I2OA 1V9U2 3AMMA 1MQTA 1J1TA 2WA4A 4FP3A 4IEYA 4S2GA 4ITCA 3OGGA 4UBGA 3HAGA 5JMCA 1TEIA 4M00A 4O9GA 4RR3A 4FQ4A 5KHIA 1HB2A 3L2YA 5FYYA 2WC2A 1AUYA 4FPLA 3RZKA 3IPVB 4F83A 5FZKA 1QDOA 3BYWA 4IE4A 3WG2A 1CQ9A 1GQPA 5FZ3A 4OI1A 4J1WA 3JB8A 2WZR1 1W6QB 2XJSA 4NMIA 1FNZA 1C1FA 2FBEA 4IGPA 2EXHA 2J7MA 4LLOA 1LJ7A 1W6NA 4KBBA 2BRTA 2FZ1A 1FOD1 2K9ZA 2X5IC 2D98A 1GANA 1VLNA 3I8TA 4QWNA 2WS93 3Q8FA 3K51A 1I5PA 3GALA 2WFPA 2DU0A 2XBO2 1TMF1 4ARXA 1WUVA 2X29A 4MX3A 2JDZA 3CJXA 4JDOA 4U36A 5LBFA 2WKKA 3NRUA 1GZCA 2OZ6A 3RZLA 1PX3A 3OGRA 3ZFGA 1NE6A 1W39A 4BPZA 5T5JA 4AAPA 2UY8A 3SCGA 3W21A 1H8VA 3LPFA 5A7WB 2Y6GA 3N9QA 5AFBA 4YFZA 3J7MA 5C3QA 4A45A 1ZRCA 5GJ6A 1I1EA 1TNRA 5JDBA 1OMIA 1LOBA 2QDNA 2WO2A 2HWE1 3S5QA 4DUVA 1G9BA 3DUIA 4PI0A 1GOHA 4W6WA 3U1XA 3I7DA 3UKNA 3M8LA 3C3VA 3T2OA 2GSYA 5GZCA 1SDDB 1QJFA 1PVC3 3RJ2X 3U14A 3RNSA 3IZOA 5LRSA 3WF2A 1CVNA 3MW2A 4UXAA 2DCJA 1W2UA 4PCRA 5J1XA 3EMRA 2VUCA 1W0PA 4XDQA 3J8F2 2HWD1 1O4ZA 1UU6A 3GZAA 4NUBA 4Q4Y1 1HQNA 4DXSA 4FFFA 2XPJA 2GMEA 5CBLA 3WDYA 2NZ9A 5ACA1 2Y8KA 1FXZA 2WYFA 4QM9A 3M3IA 1IG0A 2EIGA 3UGHA 2ZCWA 2R32A 1O7FA 1RINA 4H7MA 4COUA 3CZUA 2GU9A 4IV3C 1F5JA 1OQEA 3K77A 3AVSA 1JZ2A 4LKDA 1PGL2 1AL22 1KJLA 5AC93 5I0TA 2E31A 4BZ4A 4LKFA 4AYUA 1VR3A 4P9JA 4DXZA 2R16A 1HQWA 4Y20B 3WNKA 4GH4C 1WW4A 2MEV1 4FAHA 1W06A 2XMLA 4H55A 4MZUA 4LNVA 3RWNA 3ZPYA 1Q56A 2V72A 1TMF3 3ZLIA 4WM8C 2PN5A 2XVGA 3ACFA 5CAZA 4XC9A 3OG2A 2YB7A 1CZSA 3GZTB 2AUYA 3KCYA 3M3QA 1N1SA 5GLTA 3THPA 3TRSB 3AMQA 1LHOA 1D2SA 2WUHA 4JKMA 2BV4A 4ASKA 3TEZA 4QU1A 1QQP2 1HN0A 1SHWB 1T6BX 2D6LX 3VDDA 4LR4A 1C1LA 5FZIA 1LHUA 1UQXA 2W47A 2PXJA 1GKBA 1V6KA 3ILNA 3H7JA 3LDBA 1CZTA 2HWE3 5C6CA 3O1RA 4TLFA 3DECA 1W6NB 3O1VA 2PHWA 5LATA 1BMV1 4RQPC 5J48A 5J09A 1NY72 5FAXA 1H1AA 5IVVA 5T5OA 1U12A 4YG6A 4LKSA 4LMFA 1RUE2 5FY8A 4BXFA 1IS3A 2DVDA 2A3YA 1GSLA 2OUHA 2FCVA 3EO6A 4XFBA 3VV1A 2HJIA 2JICA 4HVOA 1RUI2 3PL0A 4YW1A 2RDSA 1FATA 1XSRA 2IXIA 5LK5A 1Q5OA 4CE8A 3A7QA 4HANA 1XXNA 4Q4Y3 4RD7A 4XPVA 2I07B 3H8OA 4DOUA 1V6OA 5FBZA 5JXGA 1GQGA 4DB5A 5ACA3 2Q5TA 5L7OC 1UW8A 2VBDA 4YLZA 4Q0QA 2O1QA 1YFUA 5LBCA 1CIYA 2XL9A 1RUF1 1FV2A 1NT0A 5A6ZA 5J36A 4E4SA 3IN9A 1WKYA 3VD9A 1CAXB 4KG8A 1DHKB 2R041 2AZ5A 1RMU1 1JUHA 4KWKA 2VZVA 5ANQA 4CCEA 1SLIA 3U10A 3WG3A 2YHJA 2HBTA 3W58A 5A7PA 1OLRA 1UZ0A 1L7RA 2E9QA 5T5LA 5A32A 3N35A 4XF1A 2MEV3 2R062 3D4KA 3LCPA 2NQYA 5DAXA 4Y5Z0 2JENA 5JXHA 1OD5A 4XFHA 1L7QA 2DCZA 2ZA9A 2BBAA 2ZBJA 4JCKA 2QQVA 3I59B 2A70A 1QJZA 1U5XA 4K6BA 5EZWA 5FZMA 4OZXA 2ET1A 4OUSA 5JOWA 1OD3A 1WMXA 3OD0A 5L19A 5IAVA 5BXXA 3RZZA 2A71A 4AK3A 1LHWA 3TNPB 4XJZA 1VAMA 4X8PA 4CZSA 5HCFA 1RUH2 2VQUA 2EXJA 2SLIA 1VIWB 2CAUA 1W90A 2P6CA 5CG9A 1CR7A 2VMGA 1YFXA 1FMD3 2BGOA 3IM0A 1DP0A 5FPUA 1FV3A 1KEXA 2Q8CA 1ZRRA 4NHYA 1HDKA 4KI5M 1YIPA 4LBKA 4DY5A 1POV1 2YC0A 2XLGA 3R6SA 2IXJA 3AYAA 4CP9A 4M01A 2Q4SA 5CISA 1BBT2 1XQNA 4Y22A 5EWSA 3WNNA 2ZX2A 3H3LA 4Y26A 4CDWB 2FDKA 4ZY9A 2HBUA 5CVRA 3A4UA 4YW3A 4RGGA 4K1ZA 3FBYA 4OMCA 3TB0A 2BOIA 4CCOA 3UL2A 5I8TA 2ZKLA 4E4DX 4MXWA 3SKVA 4CDUC 1Y9GA 2IXCA 3DL3A 4IERA 5BUVA 2ARBA 2R0HA 4Q4W1 2VVFA 5FZEA 3MV11 2WLPA 3VHRA 3I49A 1C8M2 1RUF3 1PZ9A 2RS11 4LUMA 1ND3C 3I3DA 4N43A 4QHZA 5BV6A 2QQNA 5IFPA 2R043 2OX0A 1PMJX 1WW5A 3AJZA 4W50A 2GMPA 3VBFA 5JZGA 4JGZA 1XJAA 5C8CC 3ABZA 2IVIB 3ZN6B 2Y0OA 4Z2AA 1X9PA 3GZEA 3M3OA 1QWRA 4GWMA 5IVFA 4AEDA 4URTA 4NPLA 1BHGA 1LHVA 3O7OA 4LBJA 3JD71 3K48A 3R05A 2Y6JA 4WVMB 2RVAA 1Y4WA 3WQ7A 3PNAA 5FCCA 2NN8A 2Z69A 2VL4A 2ZGPA 3HT2A 3ACGA 2XB6C 4NOTA 1UU5A 2CAVA 1QMJA 3ZFFC 5K9YA 4IEWA 1RYYA 4HG6B 4XXAA 3R4DB 2L9LA 2VZRA 3TNQA 1BQPA 2LTNA 2WABA 3O0VA 4LTAA 4TSVA 1BEV1 1BK1A 5FZOB 2FDGA 3MGUA 1F5FA 5F32A 5KHKA 4PIYA 5DN2A 5FV3A 1E5RA 2BWAA 5FPVA 1GZWA 4GB32 2Y6LA 5CNAA 5F2SA 3WF0A 4ZXEA 2VMFA 4LULA 1POV3 1JYWA 1G9FA 3AVRA 4ZXKA 5GLZA 2XJTA 4FOYA 1J3QA 1Q8PA 1RUD1 3DN7A 4XMAA 3O1TA 4AI3A 1NKGA 2CGOA 3KMHA 5ANNA 4BIOA 2VQAA 4C91A 1RVF1 4IEVA 3NL1A 4PDWA 3TN91 5DAPA 4F3JA 1NLSA 4A3ZA 3I2HA 1NUKA 5DG1A 1NZCA 4LT5A 1JZ4A 3F95A 2WO7A 4GD4A 3SH4A 4UFMA 4FPKA 4RHV2 4XBLA 2N7GA 4Q4W3 4L8QA 4PT6A 4XFFA 4LBQA 1JU3A 5FLHA 1OXCA 5LA2A 1H4GA 2RS13 1IQDC 3OBTA 4A7YA 3MO4A 1T2XA 2R7EB 1WCQA 5FLIA 4AHWA 1XYOA 2BOJA 3W59A 2JB4A 4E2GA 3CJIC 3AXDA 4JC1A 1OURA 4OI4A 4QMAA 5F3IA 3T1MA 1H9PA 5JPNB 4WM7C 4KH9A 3KT7A 5CFCC 4Z92B 4FO9A 4IXLA 1NQJA 1YYNA 1MQTC 4RA0A 4QB2A 3CZJA 2VAUA 1W8UA 1ONAA 3ZPOA 2WNVB 4A41A 1UYZA 4MYEA 1LOEA 4RR3C 3CHXA 2VOXA 1CWPA 3QCWA 3KT1A 2E33A 4N9IA 1N3OA 4OHVA 4MXWB 3JD73 1H2NA 1SBEA 5HCAA 1R091 1RC6A 3NV4A 3GF6A 2GNDA 1ZBA2 3PVOA 4KWUA 4XBNA 5JUVA 4DXTA 3MIHA 4PHZA 5FYUA 3OF1A 2VUAA 3WDXA 4CSWA 1POQA 3AYEA 4A6SA 4XJAA 4CUGA 1UYXA 4IQPA 2BUKA 4JGZB 2X05A 1BEV3 4NAOA 3VZLA 1S4CA 5T5PA 1K5MA 1MS0A 2ZHMA 3WR0A 1W6OA 1W9FA 1A3KA 1PO22 1JYXA 1UXZA 2W68A 2QQMA 3ZFGC 4META 2XR4A 3C8XA 3M4FA 4AEDB 3BU0A 1MEC1 4MV2A 4ZU7A 2VMDA 1Z78A 3PUQA 5T3NA 1QXPA 2NMNA 4CXWA 4LJHA 2DVFA 1AYN1 3BGAA 3BIWE 4YSFA 4KU7A 1LGBA 4JKKA 1CAWA 1RVF3 3AYCA 2RDNA 2D97A 2OUJA 5A7NA 2F4LA 1QIQA 3TN93 1PGW2 2X10A 1CJDA 4P9YA 3T4VA 2NMOA 4N53B 5DAVA 3VBRB 1BVVA 3NJXA 3KM5A 4JDNA 3I3BA 4OHYA 2UYAA 1B35A 5F3GA 4OQ9A 4TXWA 2MPFA 4AFAA 1IGOA 5BNOA 3NAPA 4EZ4A 3O1UA 1HV0A 1OPMA 5JLVA 2YDEA 4LPLA 4XFCA 5FWJA 1EAH2 4R4XA 1H2LA 4XAEA 4BQYA 4GMP0 2AREA 1J59A 3H8RA 5I0UA 4QAWA 4JDMA 4P9LA 3N36A 3WUCA 4C0HA 3J7NA 2UURA 1AR71 5FP7A 4XDOA 1DQ5A 1YHFA 2ZEXA 3HPNA 3B7MA 2K0GA 3ZYIB 4PDWB 3DEMA 3CQOA 2W0XA 3QH6A 4AEMA 3ZFEB 3GDBA 3MFCA 4UW4A 2ZMNA 2XJQA 1GWKA 2J1SA 1HJGA 4HOOA 5FOBB 2WBKA 5K4LA 5KWRA 4I0BA 4TTGA 1X50A 1VMJA 3VL9A 3MICA 2YPDA 4O7XA 4FOQA 2A6VA 4KU8A 3N7MA 2CY6A 3USUB 1OT5A 3POGA 2ZGMA 3FUOA 4HONA 1VBD1 4RGKA 5I0SA 4XUQA 3NNMA 1WW6A 5LA0A 3AKRA 4ES9A 4D8MA 1WLCA 4XJUA 4IV1B 4YWAA 2W39A 1R1A3 4AFMA 4AI0A 1QY4A 3SQOA 2OIIA 3K75B 5M0TA 3CU7A 4JGYA 4JTOA 1H8TB 3WNLA 2LRPA 4Z07A 1MEC3 4LE4A 3V0BA 1OSGA 3OY8B 3N7JA 4YW4A 3SCFA 3VDDC 1H6XA 2DFCA 3OEAA 2A75A 2HEWF 2R072 1AYN3 3ON7A 3SISA 4NRMA 2IXKA 3UESA 3VZOA 2ZACA 1WD3A 1IOAA 4L2NA 5BNPC 2P6HA 3WSOA 1DLLA 4Q4V2 4D69A 2OPWA 5IVJA 2R6QA 3FHAA 1HV1A 1YQ5A 1APNA 1E5IA 2AEZA 4SBVA 3WD5A 2DTWA 5IVEA 2VC9A 2JKBA 1C5HA 2VCCA 4EQVA 1K5MB 2JDHA 5T54A 2RM21 3VD3A 4DUWA 1VRH2 5A7SA 3ZN5A 5FMCA 1MS4A 2RDQA 2OYZA 3X29B 3K4AA 4P9XA 2ZZQA 5FZHA 2BVVA 3WW2A 4DIQA 2WFF3 4AGGA 1N1YA 4QX8A 3A23A 1COV2 1X8MA 1SFYA 1LKNA 4K20A 3JBG3 3T3YA 2RV9A 4S2DA 1ZZ7A 5EYXA 5J3UA 3AK0A 2AGSA 3KCXA 1AR73 1LNSA 1MVEA 1RUG2 2PFWA 5FOJB 2VW2A 4JHZA 3SKJE 3VBOA 1VALA 2FDHA 2BBVA 2C6SA 3UT0A 1XNKA 3KV4A 3IDAA 2W1SA 2QQOA 2SBAA 4QX7A 5FR3A 1YFWA 4QPIB 1YEWA 2OVUA 3E6DA 1GMMA 2ORZA 3BTYA 1B35B 3ZR6A 1HRI2 1WBFA 4Y1VA 5L9BA 5KHJA 4DINB 5FK8A 3VZJA 5FXVA 4MGKE 2BDRA 5F9TA 3NAPB 3T2TA 4RN5A 4BH9A 1GZTA 1DDLA 4OI0A 2P3JA 1KITA 1VBD3 5EJ1B 2W92A 1J3PA 1JZ8A 3RGBA 3WLUA 1HB1A 1ZBE3 4D6QA 4INDA 3OTFA 5JOZA 2BU9A 1Z7S1 1W2TA 4BB3A 1ZREA 2KR2A 2OQ6A 4XF9A 2ET7A 2Q0AA 1DGRN 5B4NA 4UW3A 4BDVB 1B09A 4HXCA 1ZZ6A 4R9CA 1OI6A 1QJU1 2CV6A 2JKXA 2V5YA 3WP3A 1PIV2 1IPJA 1FPN2 3GHNA 4HKWA 2YGMA 4JX0A 4LO8A 4CU9A 5BNQA 1GBGA 4E8DA 1QKQA 2EAKA 3RI8A 2GN3A 4NE9A 3T30A 4XILA 3RJRA 2JJ6A 3E5XA 1RJ7A 1JYCA 2PAKA 1SFNA 4HLTA 2WRAA 2RM23 2VZPA 3AB0A 1IG3A 2ZMKA 4ET7A 4IEXA 1IQAA 1C3HA 1AZDA 1W9TA 2BTVC 5G04L 2XHNA 4DFSA 3AFKA 3W5MA 1OQDA 3WY6A 2JG9A 4LLFA 1W6PB 2ZS6B 3WP6A 3V0BB 1WCUA 1ULCA 4AVAA 4ZHNA 2XBO3 4R4ZA 3UGGA 2FMDA 2QQJA 2YFUA 1QEXA 3ES4A 4JV4A 4QXCA 3WF3A 4BXSV 1VMFA 5J98B 3AL6A 3LDKA 1R082 3K46A 1D0GA 4LUKA 1W3VA 2X53S 5CU1A 4FPEA 5LEJA 3RS6A 2XXZA 4K7JA 5A7OA 4LQRA 4N43C 1QJX1 1ZRIA 4J25A 2JEMA 2VE1A 3VHPA 2W46A 1EY2A 3P1IA 4K1YA 1PK6B 4LOSA 4MUVA 3IPVA 1WLTA 1NZIA 1K42A 4W8JA 2WT1A 4KG0A 3VBFC 5JZGC 3PUIA 2D3RA 4QQOA 1W6QA 5FMOL 1XYPA 1UX6A 2A6YA 2IXLA 1QJEA 3K3OA 4NROA 1OVPA 5JR7B 3QOPA 4DEVA 2EF6A 2RJKA 3GBFA 2P37A 3AP7A 5C9AC 1RUE1 4XW3A 2BNNA 2P5BA 3I3QA 1W0NA 2TNFA 4AHZA 4YARA 4QXBA 2VZ1A 3GCWA 4WVWA 5AVAA 3VBOB 4BQ2A 5HCHA 3O12A 3RVHA 4ARYA 4FOWA 1Z7S3 1REEA 3MV01 5A7QA 4K8FA 4EN6B 2FCUA 3H3UA 1NAEA 4CPBA 2B9UA 2A6WA 2VJXA 3WW1A 1QJU3 3J4UH 1Y43B 1KDMA 2IFWA 2ZGKA 1LCLA 5LW9A 4UFKA 4E2QA 1DFQA 5FFOC 1UU4A 4CDXC 4BE3A 1UMZA 4ZU4A 2WDBA 3SC7X 5D1IA 2WS91 3MLKA 4P00B 3WDWA 4QPGA 4HVRA 4YVSC 3NW4A 1HKDA 1RHI2 1YQCA 4EJRA 4ISRA 3ZXJA 1OFSA 2AENA 1OF3A 2RR12 4QX2A 4XIOA 3AM2A 3MLLA 5EXOA 4RFRB 4UFLA 1BVP1 1ZZBA 4XABA 1BXHA 1HRV2 2JG8B 3ACLA 4NHXA 2XHKA 2GN7A 2HH9A 3AKPA 4AI9A 1SACA 4D0QA 1TZOA 2DYCA 1DGRA 3H7YA 1OF4A 5CFDB 1UO9A 2J1RA 2JIJA 4CUAA 4G4FA 4HT1T 2AH2A 2Y34A 1CJPA 3N9NA 1WD4A 2VTXA 1ODNA 1UPSA 4N9HA 1D4M2 5EPAA 4A4AA 3IMMA 3BU7A 3H50A 2P34A 2JD9A 4XQWA 3HWJA 5ABJA 4Q26A 4Y20A 1DG6A 1RUE3 1QF3A 4RFT0 3OUIA 1S0EA 1FT9A 1RUI3 3WOGA 3FX3A 1BBT1 4XQ4A 1J83A 3OUJA 1JTZX 1S0FA 2PYTA 1O8SA 4M3CB 1O3QA 3T09A 4ASLA 2ES3A 4B4PA 1N1VA 2W1QA 1VBE1 4H14A 5C70A 1EV11 1VBB2 3KD4A 4YZ4A 1S2KA 4L97A 5GM0A 1NCQC 3RI9A 3A0KA 2CWSA 1C8M1 1DIWA 2ZPXA 3B69A 4JRLA 1IZ3A 4C0BA 4QX0A 4Z8BA 5AC91 5J37A 3N3HA 1OH3A 1ZA7A 3NSTA 5FZDA 1LTEA 4N8MA 3S7IA 1HLCA 2VPVA 3AC0A 3WNXA 3DYPA 3VDAA 4EWAA 4S2HA 1MR5A 5A3MA 5FKBA 5DG2A 4GJYA 3GJAA 4CEYB 1UPIA 4QT6A 3DXUA 3K2OA 3LE0A 2FHRA 1VBA2 3ZXAC 5B2GB 3HMYA 1PMIA 3FC0A 1ZNPA 5BYNA 1LESA 1MS3A 3HNYM 4W6XA 5FPLA 4BLIA 4ZS3A 4X8NA 4L92A 4AEKA 5F6KA 3POWA 3V0AB 4E4HA 3IWZA 4QPGB 2Z2SB 1XU2A 1KGYA 1UY2A 1CAXA 1W99A 1PNFA 5GZGA 4YM2A 5C5UA 1CAVA 2A3XA 4AI1A 2E7AA 2ZGQA 1QNYA 2DCKA 4R9BA 5DUUA 3FE5A 4NIGA 4PLNA 1PO12 5FYIA 1DZTA 5IK7A 1F4HA 3BKZA 5KHHA 2RHPA 1QJY2 2BQPA 1SBFA 3FN9A 3FZ3A 5FKCA 1BBT3 4XTMA 2OKXA 3VDBA 2DBIA 1AR92 1NYWA 3ZYJB 3TYJA 5FYHA 2DU1A 3I59A 2RS32 3SH3A 3WUDA 1CX4A 5FY4A 1ASJ2 1NCRC 1TME1 1WA4A 1TE1B 1VBE3 3ZYPA 1EV13 3GGLA 3LF7A 2C24A 4D6RA 4AFBA 1XE0A 3OPZA 4W4ZA 1C8M3 1WWYA 2GNMA 1HQLA 2VXRA 1AJKA 3Q8EA 4UFHA 5BPXA 2JWPA 4BA6A 1Y7BA 4IUGA 2OT7A 2VUDA 2WNUA 5ABJB 2H0BA 4JGYC 4XFAA 1D2QA 5EJZB 2W52A 3ASIA 2WT0A 4PIZA 4MGTA 4IL7A 2P3YA 4AVVA 3ST7A 3VKNA 1ZYBA 3KHCA 3LGRA 3C2UA 1GQHA 3NV2A 1O5LA 2D40A 1UWWA 4GMP3 3T2PA 5IJRA 4A44A 4CDWA 1Y9QA 1IS5A 3UYJA 2ZX3A 1W6MA 4A2UA 4EYUA 3OBZA 5F1RA 5JMOA 1FX5A 3U75A 3PVEA 5J7MA 4FI9A 4ZZ8A 4COVA 1OA3A 3FHIB 4BOWA 4ATEA 3VBHA 2V4AA 1V6LA 1UL9A 5HV4A 1W28A 3AMNA 4A3XA 1FMD1 1W8OA 2VUJA 1JMUB 2BZDA 2OZJA 2ZGLA 4RS5B 5A3WA 4AQ6A 3BPSA 2R0FA 3QH7A 4QGNA 4QX1A 1RITA 2Z5WA 3W5NA 3I54A 4OUEA 1LODA 1YCIA 5H9PA 5E16A 1SZBA 3OB8A 5E89A 2D93A 4CCCA 1TVGA 1YIFA 3MUZ1 3WQ0A 1G9CA 2GZWA 2VCAA 2PAEA 5LASA 3ZN6A 1N3PA 3RPQA 1U0AA 5TSWA 5FPBA 1LECA 3IB3A 3E97A 4IESA 5SV5A 4FT8A 5CKQA 3MBWA 2QQKA 3CO2A 3ZSKA 1C28A 1Q8SA 3D0SA 4MGZE 4JQRA 4TN7A 3UJOA 2Q1ZB 1KJRA 4WVMA 3OBAA 3ZMNA 4CDQA 4EV0A 2XWJB 1TME3 5A3PA 2VH9A 2E53A 4MADA 3KT4A 4PQ9A 3SCHA 5B4XA 4PBOA 2XQXA 1NA1B 4RHV3 4FTBA 1RTVA 2HWC1 2VECA 1AYM1 1UZYA 4YVWA 3S57A 1CAVB 2WWJA 4OMDA 3ZYFA 5FZOA 3M3EA 3WXPA 4LBOA 4NAMA 5FUPA 1Q3EA 5IFTA 2HEVF 5IWFA 4R9AA 2RMU1 4M4PA 3T0BA 4KL1A 1OOPA 2Y6FA 2OS2A 5DUVA 4LE3A 2DTYA 2ZGRA 4H2AA 3J26N 2JDUA 3POIA 2A7AA 4MXVA 2B9VA 5BNNC 2K46A 4B7KA 3WCRA 4YM3A 5FP4A 3RG0A 3WV6A 5IT6A 5A33B 1E5HA 3AZZA 3VBSB 2I74A 2ZGOA 2LUWA 3BUCA 5FY1A 1ZX5A 2VBBA 4CU8A 5C8WA 2XVKA 1OVSA 2WNUB 2J1TA 1BYHA 1OH4A 4MGYE 4R52A 2JG9C 5FZ0A 1RJ8A 4Q4X2 3VDCA 4P9WA 1LOFA 1XOYA 2B5HA 4AHYA 3AKTA 5E88A 1PZ8A 2VTXJ 3GBWA 3KVAA 3BPZA 5D8AB 1YJLA 3V65A 1JHJA 4HK8A 1CZVA 2FQPA 3WINE 4IW3A 3G7DA 5GZFA 1S0IA 5C3OA 1UMIA 4HMZA 4PLOA 5F5IA 2WZEA 1OLME 3KF5A 5F6LB 5LBEA 1W6MB 2WNVA 3ETPA 4L0PA 2XKPA 4NRQA 5EQUA 3RZJA 1JYNA 1PVC2 4XJWA 3ZKYA 1RUJ2 2BWCA 3DGTA 1ULGA 2HWF2 3GJBA 3IAPA 4Q4V1 3SITA 3H8XA 1ENSA 2KA3A 3VBHB 3ZYHA 1S0JA 1GNYA 2PLV1 2WN2A 2K2SA 3PURA 2EXKA 3NV1A 4AE2A 2DV9A 1RIRA 3TEWA 1LGNA 1Q8QA 5JSOA 4XZUG 2Y38A 2HWC3 5K0UB 4YG3A 1AX2A 1AYM3 1X7NA 3C7EA 3GZUC 1RXFA 3J7HA 3E5QA 2PTMA 4CEWB 5DABA 1COV1 1YXWA 1IS4A 4MO3M 1HJFA 4E8CA 1W2AX 3I2GA 4JVAA 3LA2A 2RMU3 3J7LA 4IEQA 5H9QA 3VHNA 3ZYGA 2R1DA 1NXD1 3LIHA 1MS9A 3UJQA 1X9TA 3JUUA 5JR2A 1RUG1 1A8MA 2VOTA 2V73A 2WZR2 4CDQB 1U5IA 3O0WA 1STMA 1UOFA 2WQ4A 2Y33A 4I02A 5D2AA 1H6YA 5LBBA 1XE8A 4YW7A 1FOD2 1GUIA 3LB9A 4X6RB 3LZZA 4YNIA 5GALA 1HRI1 3VZNA 3NVCA 5F7UA 4YVWB 4ASMB 1TQ5A 4N53A 1TMF2 3VBRA 2VCMA 1K12A 1NG0A 1UOBA 2FMYA 3I2IA 3RZMA 4MGQA 2VZOA 1M06G 1UX7A 1UNBA 3O1SA 4K8RB 5L9RA 3ZYBA 3AZYA 1OA4A 2VZTA 3AKQA 4DPNA 1OOPB 2DF7A 5E1RA 4K3UA 2ZABA 2EXIA 3ENRA 1JN2P 4RGAA 2UWAA 4YW2A 4BQWA 2FDJA 5I0DA 3RYRA 2CGNA 4AVTA 5FZBA 3VBUA 3PUAA 2ZHKA 2EIBA 3I3EA 5LEKA 2HWE2 3K3NA 3IIAA 1HXS2 3N7KA 4Q5OA 4XURA 5FP9A 3ZFEA 3LSDA 4Y1YA 3L2HA 3DF0A 3AMPA 3ES1A 4Q4V3 4E27A 1LRHA 3NNJA 3POJA 2PLV3 2RDRA 2VG9A 2WNEA 3O1MA 1J58A 4NR1A 2HWD2 4Q4Y2 1VRH3 2VNVA 1W0OA 3USUA 5JXIA 1EPWA 5DAWA 1O5UA 2WA3A 4L11A 5ACA2 2A5ZA 1COV3 2PHRA 2XJUA 2Q8OA 1OLMA 1YUDA 2DWRA 4IV1A 4NWVA 3U07A 1AX1A 2XJRA 3UGFA 3MIGA 4AVBA 1HX6A 2P2KA 3T0DA 5FZ7A 1VAKA 5EFUA 1H8TA 4IDZA 1RUG3 3HQUA 4L99A 4W65A 3RWKX 5JAXA 1G8WA 3OY8A 2W91A 4YM1A 3KHBA 3N9OA 1I5ZA 4LIUA 1OA2A 1XE7A 4NHLA 5EJ3A 2QQWA 3N7LA 4UFJA 1YWKA 1UIJA 3DPRB 3O14A 3PUHA 3FLTA 2MEV2 4Q1RA 1HRI3 1KFUL 2WIIB 3GHMA 3JXSA 4DEQA 1CONA 2EAAA 1LGCA 4CCJA 1W3XA 1LU1A 3RRDA 2J1VA 2EVXA 4FFGA 3T1LA 1W8NA 4UFIA 5A3LA 1ND2B 1R1A1 3EQEA 3HN1A 5A6YA 1O6UA 5AVPA 2O8OA 2B7YA 2BNMA 2C0ZA 4H3WA 4O65A 5A3OA 3N9LA 2GNBA 4QDSA 4QKFA 4Z82A 4F7ZA 2B42B 1W8WA 2V5DA 2XKOA 4Z1VA 3PJQA 4CXYA 1W8HA 2HWB2 4NPMA 4XE9A 3BALA 1UMHA 3B5LB 3JZVA 5J96B 3U4SA 1BMV2 2TEPA 5JIUA 5EV7A 2C5DA 3B01A 4QKNA 4I01A 3OSDA 3MUY1 4DZGA 1VJ2A 3ZXGA 3WF1A 5G05L 4QPIA 5A1FA 3NNFA 3FMGA 2X5IA 3MDPA 2VM9A 3E6BA 1Y3TA 3POFA 1WMEA 2WFF1 1FI2A 2ZHLA 1E5SA 2QKDA 4WVVA 3N9MA 4QQ2A 4A6OA 2XJVA 4KQ7A 1OUSA 1AXZA 3JBG1 1JOBA 2D6NA 3JB4C 3VBUB 4YG0A 1RHI1 4ES8A 2VZ3A 5JI7A 4P14A 3SNMA 4CP2A 2Q30A 4BISA 4KWLA 4EE2A 4NHMA 4QQLA 5A80A 4K40A 2XONA 3CL1A 3LA7A 3TAYA 1RUF2 1ZM1A 4Y5SA 5LK7B 1ZZCA 3ZDVA 2VZQA 4B1MA 5C4WB 1ZVFA 2GNTA 1RUC1 4CDXB 2R042 4LBLA 5JVVA 3NWKA 1RMU2 3SLIA 1UZWA 5EYYA 5A3UA 4LO4B 3LSEA 4LBQD 3NNGA 2RS51 3O0XA 5EP9A 4MG2A 4IEUA 5DPNA 5ERLA 2Z42A 2XVLA 3JU9A 5A6XA 1YI7A 5F5QA 4ZS2A 1SMVA 2VOVA 3EB7A 5FZFA 4PLMA 1K45A 1XNDA 3PIGA 5DDJ1 5FZ1A 1ZBE1 1W9YA 2JE9A 4FQZA 2ZGNA 4XMIA 3BIEA 4I30A 2LM3A 1GWMA 5JCTA 3AP4A 1W6PA 3R4UA 4CDWC 1V9U1 5CYYA 2WINB 3BB6A 2Y64A 4AF9A 4DXRA 2J42A 2E6VA 3DYOA 2ID4A 2ERFA 2QNKA 3UV9A 1C57A 3A0NA 4Q0PA 5HPOA 2P4EA 3VHOA 4QX5A 2VW0A 5FPZA 4IV3A 4R8HA 4I3GA 2QQUA 2W08A 1GZ9A 3B93A 1WGPA 4IE7A 5FMOS 4FBFA 2D6PA 3B02A 3J9SA 4XZPA 4XUNA 2WZPP 3USSA 5GZDA 3WT3A 4E2SA 5KXEA 1CD3G 4UI9L 4GZ9A 5LA1A 1UKRA 2WYSA 1PK6A 1W9SA 4DY3A 2WN3A 1R64A 3DKWA 4CU7A 5A3TA 5FYSA 1SFPA 2VD7A 3IDEA 4FPYA 2VZUA 3MIFA 5FWEA 3MW3A 2LW8A 2XBO1 1UAIA 4WM8A 2UU8A 1URXA 1XNBA 5DZGA 2VZSA 1RHI3 5E8AA 2ZGUA 5HXMA 4TZDA 1CGPA 2QUOA 4LK6A 1ULOA 3ZX7A 2Q1FA 5IK5A 3MF9A 3BCWA 3ZO0B 3NJZA 4DUXA 1G7YA 4Q2FA 1JZ7A 4FPGA 5JSPA 2O8QA 4QQPA 2B46X 4BQ4A 3WCSA 1WA6X 1RUC3 3DXTA 2V4VA 1OLQA 2D43A 2ZEWA 2QE3A 3TEYA 2PHLA 4HKLA 1JYIA 1G86A 2DVGA 2JDNA 4CA9A 4BQ3A 2X5IB 2LALA 5L36A 1SCSA 2JDKA 2RS53 1W8TA 3RSJA 1GV9A 2IFRA 3BOPA 2GC2A 4CP1A 4FXGB 1ZZ8A 4FPCA 2UYBA 3LEKA 4LO6B 2IVJA 1PM7A 3KGZA 3OGVA 4EN0A 5FZ8A 2W95A 2F6BA 5DDJ3 4QPWA 2OXBA 1LR5A 4PJYA 2ARAA 1XRUA 1AR82 1S0DA 1FYUA 1MPXA 3J8F1 3MI8A 5C3PA 1QGLA 3AL5A 1O4TA 3G6JB 1DYKA 1F31A 1W03A 4YGCA 5DUWA 4FVVA 3Q8CA 5HXVA 1BKZA 1S2EA 1V9U3 4OYUA 3IBMA 4HN0A 4UT5A 4URAA 5L7OA 2Q1MA 4CUBA 1F15A 4CP0A 1BEV2 1GFF2 3HR9A 4D3WA 4MVTA 3WEZA 2JG8A 3CMGA 4BQ5A 1KD7A 3D3AA 1H30A 1VBB3 3A22A 4XOGA 2YPJA 5FPXA 1AX0A 1PGL1 1AL21 2JDMA 1NLQA 4AWDA 4HFSA 1DLCA 3VKOA 3JQWA 5CFDA 3OEBA 3HNMA 3K4DA 3HBZA 4LA3A 2D6OX 3S0MA 3I2FA 1RUD2 2HKXA 2BFUS 2J22A 3AP6A 2XDVA 1YNAA 2A6XA 1RVF2 4P5HA 3KCCA 4GA9A 4NJ4A 4CCMA 5F3CA 2XL7A 2JECA 1BJQA 1JODA 2BERA 2ETEA 2WNVC 2PA7A 3MPBA 4LBNA 4QU2A 3KS7A 1JH5A 1ZZ9A 3ECQA 4B4QA 3LQCA 1H1MA 3MIBA 1HW5A 3PU8A 4GWIA 1A6CA 1PVXA 2VY0A 1V6JA 1XB9A 5C3RA 4IV3B 4UAPA 1IPKA 1KRIA 1R1ZA 4M3CA 5CKMA 1QQP1 4LHLA 4OHXA 3RDIA 2ZAHA 2FZ2A 2RE9A 5FXWA 1XNAA 2VBPA 2ATFA 3WDVA 3ZIXA 3UNPA 5FYZA 1JBCA 2WSVA 3BN6A 3LEIA 5H9RA 3PVNA 1YJKA 3O5SA 5FUNA 1H4HA 2NPIA 4GH4B 5IAXA 4JGZC 3VGIA 2DCYA 3W20A 1S0CA 1NY71 4TYSA 3C7OA 1UF2C 3Q9OA 3WNPA 4G9SB 4BK5A 3H3ZA 1SBDA 4Q8KA 2AR6A 4HBNA 4WM8B 3UK9A 4AEDC 2EICA 4IE5A 1RUI1 1R092 1OKOA 1RUNA 1DGWX 5GLWA 3PDQA 3J8F3 1PO13 4GQ7A 3VKFC 4WVZA 4NN0A 4CEYA 3D8CA 3N4MA 4XBQA 1ODMA 4AOCA 4CDUA 2VQ0A 2YUEA 3CLPA 3TEXA 4YW5A 2P1BA 4XDPA 1POV0 2RS33 4N53C 2QZ3A 4RQPB 3VBRC 1X82A 4BYYA 4C1WA 4CRQA 2JE8A 1KS4A 4XFIA 4XJ8A 3WZ1A 2JDYA 5CIRA 1SLBA 2CNAA 1WZXA 1H2KA 3U78A 2CHHA 5BY5A 5AFEA 2E7TA 3ZYRA 4EWDA 2YGLA 1J1LA 2FCTA 1AL23 4PF1A 3IT8A 2KD7A 3NKTA 5LB6A 1MVQA 1PM4A 4GXLA 3ZR5A 3V0AA 1O3RA 4GULA 2Z4FA 2WSUA 2DUPA 1S2BA 1HN1A 4EROA 1CAUB 5D21A 2R061 3HIFA 3CF6E 4NWWA 1WW7A 1VBC2 3IAQA 1CN1A 4AAXA 5CZKA 2C26A 4YZ2A 4PDWC 4DRRA 1VE0A 3SXWA 5L7OB 1N47A 4IEOA 4BIFA 3ZFEC 2R1BA 2QZ2A 4E9KA 5FZ4A 5I8YA 1HIXA 3M1HA 1F35A 5T52A 1Q8VA 4YPJA 2AACA 1UXXX 2YBPA 2WAAA 1QQP3 3DV8A 5FY9A 4XETA 1D0HA 4FFIA 3GM8A 2DBNA 3D6EA 5GLVA 1RUH1 4J6GA 4AW7A 2VTFA 4OQ8A 4FTEA 1LULA 4ATFA 3S30A 3GCXA 3R4SA 1AR72 3NQHA 1UY4A 2DURA 4XUOA 3IDCB 4YGBA 2J1EA 4IV1C 2JIGA 2MHFA 2RJLA 4Q4X1 5FREA 3ZSMA 2WZ8A 4AEJA 3KVBA 5FZ9A 1I6XA 4Q29A 1H8TC 1DQ4A 2DUQA 2C9KA 2CDOA 5ISLA 3NO8A 2B45X 4UYBA 4H7LA 1RXGA 4IE6A 4XHXA 4N7UA 3OOXA 2AYHA 3PMSA 4ORFA 3WQ1A 3KV5A 1BCXA 5A1LA 4Y4RA 2IZWA 1G9AA 1RUJ1 2ZEZA 1I9RA 2QCSB 1VBD2 1SPPB 3INAA 4M4RA 3RQ0A 1U5YA 2ZHNA 1AF9A 3CIHA 3E1F1 1K5MC 2WO1A 4KNCA 2HYXA 1KXGA 3T4HB 5DZFA 1ULFA 1H1IA 2JXAA 3N9PA 1GWLA 1MZ5A 1UYPA 4MSVA 1RUOA 5DQ0A 4C90A 1GLHA 3C7FA 2W5FA 4RS5A 1BLZA 2XWBB 4MH0E 3ZN4A 3FUQA 5LCWL 2YZ4A 2R063 3WP5A 1MACA 2GP3A 2ZGSA 4RL7A 3OGJA 4M3CF 5FRAA 1UZZA 4UW5A 2JD4A 4CPBD 4Y1UA 4CDUB 2EALA 2Z79A 4GMP1 5FYBA 4YZ5A 1US3A 1AVBA 5DUXA 2J1UA 5JIAA 4E4ZA 1SLAA 4QPIC 1N1TA 2RM22 1IPSA 1ND3B 1UZVA 4QGMA 4BM8A 1B35C 1XNTA 1OKQA 2QQIA 4GAZA 4LA2A 3LEMA 4OI2A 4XXPA 3S6PA 4FPFA 4LKEA 5BNOC 2D3SA 3NAPC 5LWBA 5LZ6A 2C4XA 2GC0A 5C8CB 1RUH3 2CDPA 1W2OA 5FQ0B 3LOBA 1NA1A 4LBMA 3UKTA 2WQ8A 3WP4A 4NIIA 2KXLA 2VMEA 3AYDA 3IMNA 3OJBA 4Q4X3 4GB31 3GNEA 3T0AA 1D4VB 4A7KA 4XAAA 3HQXA 4B7EA 2XG3A 2PAMA 5CB7A 4DQAA 3VKMA 4IGOA 2UY9A 1HXS1 2V09A 3MLJA 3LWCA 3TBDA 3ZFFB 5JWPA 2XLAA 4BK4A 3LDRA 1K5JA 1U5ZA 5IATA 1XPWA 3MIDA 4HPKA 4W6YA 5FZAA 3BI3A 1RUJ3 5A33A 3HQRA 1DGWA 5FP8A 2HWF3 5FTTC 5LRRA 3VBSA 4RHV1 2QQLA 3F2ZA 3ZIWA 1JXNA 5T50A 3LEGA 4UF0A 4GALA 4YM0A 2YROA 5FO7B 3HBKA 2PMWB 4MGSA 5FO8B 1JZ3A 1EUTA 1Z7S2 4NHKA 5APAA 5IVYA 3POBA 4UOJA 1OPOA 2W2IA 3B9IA 3LOIA 4AI2A 5FYVA 3ZXFA 5HBAA 2C9AA 4TWTA 1LOGA 1QJU2 3OYWB 2NYYA 2ILMA 3VL8A 3POSA 3MW4A 5D8AA 1ZRFA 4HVQA 1ULDA 2YG0A 2YMZA 1YFYA 3APBA 1GU3A 3MFAA 3LD8A 1MZFA 4FCAA 4QKBA 2HLEA 1UYYA 1UN1A 5FYMA 1X33A 4EN7B 4YZ1A 2WZR3 1AR62 5JPMB 3FL7A 1YO8A 2WQZC 1ZBA1 3ZXEA 3VUOA 5F3EA 5FY0A 1PK6C 4BJ0A 3R0RA 1JYTA 2DVBA 3NNLA 2YU2A 3BTZA 2Y60A 1FOD3 2ARCA 3ZSJA 5HV0A 3KB5A 1DF0A 1AHSA 3CJIB 2RG4A 4OULA 4IEPA 4WM7B 5CFCB 2GC3A 2HEYF 5JI9A 3H1YA 1MQTB 3FBMA 3LPGA 1OFNA 3D5OA 4P5YA 5C33A 3TWIA 2I45A 3AP9A 3P3PA 2E7QA 3BOWA 5K0UA 1DGLA 2IUWA 4RR3B 1ALYA 1PO21 4Q0SA 5FPAA 5FZGA 4HN1A 4ZZ5A 3HJRA 4OZOA 2R30A 1JS9A 3QACA 4GB33 4UW6A 3ZSLA 3VBOC 1CPMA 4CEWA 3KWVA 4AGVA 3MEPA 1VAVA 1QJX2 1DQ2A 3I97A 1OHFA 5FDBA 1V6IA 3M70A 4KBZA 1I3HA 2HWB1 5BNPA 2GH8A 5GKAC 1HXS3 4S2FA 5HI0A 4ZKTB 1WMFA 4OVEA 4WV8A 3I2JA 1PGW1 3L9JT 1ULPA 3OCPA 3VB9A 4QDQA 5EIYB 4QB1A 2ZGTA 1RL3A 4BMEA 5KC5A 4Q0VA 4AI8A 4CTEA 2G9FA 3OBRA 3KQRA 5FYCA 3ZFGB 2XOMA 1KFXL 3P5BA 3T08A 3ME2A 3VN4A 4DO0A 1MZEA 2HWD3 5A1AA 1ACCA 2G9GA 1FNYA 1XYNA 2E63A 1C4RA 1EAH1 1JW6A 3AJYA 1QXJA 3AKSA 3ELNA 1DBNA 4MOAA 4GKXA 4QXKA 2JX9A 4ZONA 3ATGA 5IK4A 3NJVA 4XF4A 4PBPA 5FXZA 5A6QA 3KV9A 1XC6A 1DCSA 5FXXA 2JG8C 4HPKB 3BTXA 3CBNA 1JOPA 4PI2A 2WS92 1ZBA3 3HNBM 4HKOA 4UF0B 4FOVA 2NLRA 4GWJA 4V2VA 5CFDC 1UD1A 3A21A 5IVCA 3DCQA 3VD5A 1GICA 3BVCA 5F5CA 1MS1A 2BGPA 3I3MA 4O9EA 3I2KA 3GYDA 3ILFA 2OQ7A 3HT1A 2LROA 1ENXA 4LORA 3LFMA 1PO23 3BODA 3WVJA 4CCDA 5JOXA 1VB4A 4M0NA 4XQDA 4Z2WA 5FO9B 4ZU5A 1XBFA 4WZFA 2CSGA 2JB8A 4AHXA 3GXUA 4YFWA 4CYDA 2LS6A 4DMIA 2VOKA 1EPZA 2YU1A 4OFGA 1V00A 3HEIA 3S7EA 4XIKA 3ZDSA 4AFCA 4DS0A 2R071 3OGSA 3ZXDA 3PLQA 4YGDA 2ZJCA 4COWA 3DKQA 2HWB3 1M4WA 2BP6A 3WW4A 1LU2A 4YYOA 3GBGA 1BZWA 2A6ZA 1F4AA 3SH5A 3U11A 2GMMA 1QNWA 5FYTA 1P8JA 2YV8A 3SMHA 2DDUA 4QD2A 1OBNA 2WAOA 3VLBB 4D94A 1CPNA 3DPRA 1SEFA 2I2SA 1VRH1 3MHZA 4BHPA 5GLUA 4LITA 1DQ0A 2W9XA 1G6NA 4SLIA 2XLFA 2WL1A 4PQQA 1ND2A 3OPWA 4XTPA 3VDDB 4HSLA 5FZ6A 4CEYC 1EAH3 4JTNA 2ZX0A 1VBE2 1EV12 4DNYA 4OCTA 2QJVA 5BNPB 2ADEA 4P9GA 4QM8A 1WBLA 1QDCA 5AC92 3POYA 1UOJA 5CG8A 2W94A 3ROUA 4B1LA 3B00A 1QOTA 1KS5A 1CX1A 3U4XA 3B9CA 2VQTA 1RMU3 1WCKA 4LOTA 4B8EA 2EA7A 4XFGA 2ZAAA 3PVBB 4ZPIA 3RZGA 4G3YC 1E57A 3EJKA 5C7GA 3HVDA 4JQTA 4QHBA 5FP3A 4QPGC 2ZEYA 1DYOA 3O1PA 2PELA 4P08A 3CEWA 2Y26A 1KQRA 5C9AA 4AL9A 5K8SA 2BEOA 1W05A 2CYFA 1ULEA 4XJ9A 3WHTA 4Y4YA 3JQXA 2WWSA 4QGLA 2D5FA 4B29A 1OC1A 4LK7A 1V6NA 3ZXKA 1AR81 4EZHA 4Y1XA 4Y1ZA 1SQ4A 2QBXA 3WX5A 5JXJA 3ZKUA 3P3NA 4QQHA 4XF0A 2YY1A 4R9DA 4BCUA 1JZ5A 1GP6A 1ENQA 2R073 2AEYA 1LB2A 2BGCA 1PIV1 1FPN1 5C4WA 2VR4A 3THDA 1UY1A 2IWGB 2O14A 3ORJA 3IIIA 5A32B 4CDXA 2JE7A 4IGQA 5CKNA 1WCDJ 3WDUA 3K4ZA 2TBVA 5FUIA 1UOGA 4NO4A 4BQXA 1NQDA 2YBKA 3OD4A 4HETA 2W87A 4NVPA 5ABJC 3MYXA 1Q8OA 2OA2A 4YVSA 2CL2A 2WJSA 4QDRA 3UKVA 4NRPA 5F37A 1J84A 5L73A 2ARXA 2E51A 3C7GA 5IVBA 3LAGA 5IYYA 3V56A 3WG4A 1TME2 2A1XA 1LENA 1R081 5JOYA 1PHMA 1GYKA 3M3CA 4I09A 1UCXA 4MGIE 1O3SA 3I2DA 1H2MA 3HD8B 1JI6A 2ZX4A 5A70A 3AMHA 2JDPA 4OUMA 4CP9B 3E6CC 1LEDA 1L7LA 4RS5C 4Y22B 2D6KA 1JUIA 2QQPA 1RB8G 5FZLA 2QDRA 2F17A 2H6CA 4FXKB 4OHWA 3WHUA 1CESA 1FAYA 4P9IA 4LHKA 4B3NA 2BYVE 1XNCA 2YC4A 4A7ZA 3LKJA 3KLSA
chains in the Genus database with same CATH topology
4GD4A 5FZDA 5FJHA 5FPBA 4D6SA 3KVBA 3PUSA 5FYMA 2XXZA 5A7OA 5FJKA 5FZ9A 5A80A 4BISA 4LITA 5FZMA 5A7WA 5F3EA 5FY0A 4TN7A 5ISLA 1VRBA 4QXHA 2YU2A 5FY5A 3OPWA 5E6HA 4GJYA 5FZ6A 5F3IA 5A3PA 3DXUA 3PTRB 3KV5A 3K2OA 3K3OA 4NUBA 2XDVA 4V2WA 4Y3OA 5A1LA 4Y4RA 5FZBA 4BU2A 5IVJA 3PUAA 4CCMA 3K3NA 2WWJA 2P5BA 3ZPOA 5FPAA 5F3CA 4GJZA 5FPLA 5FZOA 4QXBA 5FZGA 5IVEA 5FUPA 5FP9A 5IWFA 2Q8CA 5FPUA 3PU8A 3RVHA 5FZFA 5A7SA 5A7QA 2OS2A 4DIQA 5FZ1A 5FZHA 3N9PA 3AVSA 5FZCA 3OPTA 4QX8A 5FP3A 4E4HA 5FXWA 4LXLA 5A3NA 5LY2A 5FYUA 5FYZA 5FP4A 2YBSA 5LW9A 5IW0A 4CSWA 5FUNA 4CUGA 2GP3A 4Y33A 5LY1A 2XMLA 4CCOA 5FY1A 5FYIA 2XUEA 3ZLIA 3KV6A 5FYCA 5FYBA 5FZEA 3KV4A 4EZHA 3NJYA 5KR7A 4C8DA 4QX7A 4CCNA 5FYHA 5FZ7A 3PUQA 4LIVA 5FZ0A 4DO0A 5FY4A 4CCLA 4GAZA 4ASKA 2Q8EA 2Q8DA 4QU1A 2OX0A 5FXVA 3PDQA 3KVAA 3N9OA 5FBJA 5LWBA 4LIUA 5FZIA 4D6RA 2PXJA 5A3TA 5FYSA 5A7NA 3LDBA 2VD7A 4IGQA 2GP5A 5FXZA 5FWEA 2YBKA 3KV9A 5F5IA 4XDPA 5FXXA 5IVFA 2OT7A 4AI9A 4D6QA 5IVVA 4CCJA 5F3GA 5FYYA 2OQ6A 3U78A 5FZKA 4UF0B 4BXFA 4V2VA 5FY8A 5F39A 5F37A 5IVCA 5FZ3A 4EZ4A 4IGOA 5IVBA 3N9NA 3PU3A 3PURA 5F5CA 3DXTA 5FY7A 4IGPA 5FWJA 4CCKA 3N9LA 4QWNA 2OQ7A 5FP7A 2WWUA 4XDOA 5F2WA 5FZOB 5FZAA 5FP8A 3UYJA 5F32A 4EYUA 3U4SA 5FV3A 4UF0A 5FPVA 5FZ4A 5F2SA 2YU1A 4HOOA 5IVYA 4AAPA 5FZ8A 2YBPA 5K4LA 3AVRA 2W2IA 5A1FA 5FY9A 5FYVA 5A3WA 5A7WB 5ANQA 3N9QA 2YPDA 3AL5A 5FZLA 5F5AA 5A7PA 5FYTA 5CEHA 4QXCA 4HONA 3N9MA 4URAA 3AL6A 3LD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GD4 A;  5FZD A;  5FJH A;  5FPB A;  4D6S A;  3KVB A;  3PUS A;  5FYM A;  2XXZ A;  5A7O A;  5FJK A;  5FZ9 A;  5A80 A;  4BIS A;  4LIT A;  5FZM A;  5A7W A;  5F3E A;  5FY0 A;  4TN7 A;  5ISL A;  1VRB A;  4QXH A;  2YU2 A;  5FY5 A;  3OPW A;  5E6H A;  4GJY A;  5FZ6 A;  5F3I A;  5A3P A;  3DXU A;  3PTR B;  3KV5 A;  3K2O A;  3K3O A;  4NUB A;  2XDV A;  4V2W A;  4Y3O A;  5A1L A;  4Y4R A;  5FZB A;  4BU2 A;  5IVJ A;  3PUA A;  4CCM A;  3K3N A;  2WWJ A;  2P5B A;  3ZPO A;  5FPA A;  5F3C A;  4GJZ A;  5FPL A;  5FZO A;  4QXB A;  5FZG A;  5IVE A;  5FUP A;  5FP9 A;  5IWF A;  2Q8C A;  5FPU A;  3PU8 A;  3RVH A;  5FZF A;  5A7S A;  5A7Q A;  2OS2 A;  4DIQ A;  5FZ1 A;  5FZH A;  3N9P A;  3AVS A;  5FZC A;  3OPT A;  4QX8 A;  5FP3 A;  4E4H A;  5FXW A;  4LXL A;  5A3N A;  5LY2 A;  5FYU A;  5FYZ A;  5FP4 A;  2YBS A;  5LW9 A;  5IW0 A;  4CSW A;  5FUN A;  4CUG A;  2GP3 A;  4Y33 A;  5LY1 A;  2XML A;  4CCO A;  5FY1 A;  5FYI A;  2XUE A;  3ZLI A;  3KV6 A;  5FYC A;  5FYB A;  5FZE A;  3KV4 A;  4EZH A;  3NJY A;  5KR7 A;  4C8D A;  4QX7 A;  4CCN A;  5FYH A;  5FZ7 A;  3PUQ A;  4LIV A;  5FZ0 A;  4DO0 A;  5FY4 A;  4CCL A;  4GAZ A;  4ASK A;  2Q8E A;  2Q8D A;  4QU1 A;  2OX0 A;  5FXV A;  3PDQ A;  3KVA A;  3N9O A;  5FBJ A;  5LWB A;  4LIU A;  5FZI A;  4D6R A;  2PXJ A;  5A3T A;  5FYS A;  5A7N A;  3LDB A;  2VD7 A;  4IGQ A;  2GP5 A;  5FXZ A;  5FWE A;  2YBK A;  3KV9 A;  5F5I A;  4XDP A;  5FXX A;  5IVF A;  2OT7 A;  4AI9 A;  4D6Q A;  5IVV A;  4CCJ A;  5F3G A;  5FYY A;  2OQ6 A;  3U78 A;  5FZK A;  4UF0 B;  4BXF A;  4V2V A;  5FY8 A;  5F39 A;  5F37 A;  5IVC A;  5FZ3 A;  4EZ4 A;  4IGO A;  5IVB A;  3N9N A;  3PU3 A;  3PUR A;  5F5C A;  3DXT A;  5FY7 A;  4IGP A;  5FWJ A;  4CCK A;  3N9L A;  4QWN A;  2OQ7 A;  5FP7 A;  2WWU A;  4XDO A;  5F2W A;  5FZO B;  5FZA A;  5FP8 A;  3UYJ A;  5F32 A;  4EYU A;  3U4S A;  5FV3 A;  4UF0 A;  5FPV A;  5FZ4 A;  5F2S A;  2YU1 A;  4HOO A;  5IVY A;  4AAP A;  5FZ8 A;  2YBP A;  5K4L A;  3AVR A;  2W2I A;  5A1F A;  5FY9 A;  5FYV A;  5A3W A;  5A7W B;  5ANQ A;  3N9Q A;  2YPD A;  3AL5 A;  5FZL A;  5F5A A;  5A7P A;  5FYT A;  5CEH A;  4QXC A;  4HON A;  3N9M A;  4URA A;  3AL6 A;  3LD8 A; 
#chains in the Genus database with same CATH topology
 1LEM A;  2VMI A;  3ACH A;  1AR8 3;  4FPO B;  2WT2 A;  2VO5 A;  4N43 B;  1QXR A;  3D0J A;  4P02 B;  4FTS A;  1F9K A;  2C1F A;  2X8K A;  4UWD A;  5K7P A;  4QKD A;  1EUU A;  4QXH A;  4YW6 A;  4PF5 A;  5FY5 A;  2ENR A;  1UKG A;  1FMD 2;  1V6M A;  2ADD A;  1ENR A;  1O91 A;  3VBF B;  5JZG B;  1NCQ A;  1PIV 3;  3RMX A;  1FPN 3;  4AG4 A;  5L9V A;  3ITQ A;  3PTR B;  2EIE A;  4Q27 A;  3RYK A;  3EBR A;  4EWE A;  1NA1 C;  4MLO A;  2W3J A;  2MNG A;  3MZH A;  1YRZ A;  4BU2 A;  5C9A B;  3QBQ A;  3E5U A;  1IS6 A;  1LOA A;  1QH7 A;  3ACI A;  4N7I A;  3B94 A;  1K3I A;  5DXD A;  1MZ6 A;  2IXH A;  4LO7 A;  1AJO A;  1RUD 3;  3Q8A A;  4FP2 A;  4CUC A;  3THT A;  1REF A;  3FWE A;  1VBC 1;  1J3R A;  4LXL A;  5A3N A;  5FMB A;  3URF A;  2NM1 A;  2RR1 1;  5IHR A;  1S0G A;  2BVB A;  2TUN A;  2HYK A;  3H9A A;  2PHD A;  3THC A;  2W1W A;  4NID A;  1GR3 A;  3RMY A;  3VBS C;  1QHD A;  5FIX A;  1TG7 A;  5LY1 A;  1R08 3;  1IKQ A;  1HRV 1;  2HWC 2;  3KGL A;  3TOJ A;  1AYM 2;  4YGE A;  2BPA 2;  4XAC A;  3WQB A;  3H0O A;  1GZW B;  4HL0 A;  2A3W A;  1SDW A;  3NJY A;  4NIH A;  4YRD A;  2WNU C;  5GZE A;  2RMU 2;  3ILR A;  4YVS B;  4LIV A;  3MIE A;  1TNF A;  1X36 A;  2BJS A;  1HB4 A;  2EID A;  1GOF A;  1D4M 1;  4K9S A;  2VOW A;  4KWJ A;  1AXY A;  1W04 A;  5D8A C;  4KGQ A;  1PGS A;  2WO3 A;  3FLR A;  1A34 A;  1PNG A;  3ZXL A;  2KM2 A;  3V64 A;  4D7S A;  1UIK A;  1WCS A;  1R09 3;  1O3T A;  3FHQ A;  1F8V A;  3CDZ B;  4LBQ B;  1ST8 A;  3SHR A;  4MHR A;  3H42 B;  3MF6 A;  4D7T A;  4EN9 B;  1NCR A;  5F39 A;  3POE A;  2VGD A;  3VBH C;  2DUO A;  3MPP G;  4FFH A;  2GAU A;  1VB2 A;  1VBB 1;  2WNO A;  1IHM A;  3QD6 A;  4HSJ A;  3VD7 A;  4M3C E;  2CU5 A;  4XYX A;  4CCK A;  3ZMO A;  4FPH A;  1Y9M A;  4BMB A;  5K0U C;  1IKP A;  2A73 B;  3U0Z A;  5I91 A;  3KSC A;  1ZA4 A;  3KZ4 C;  4GH4 A;  4XCA A;  2AC1 A;  2PHU A;  4CEW C;  2OW4 A;  2GDF A;  2VMH A;  4JZR A;  1VP6 A;  3JCI A;  3PME A;  4UBH A;  4OHZ A;  4KGG A;  2ORX A;  3AZV A;  1HB3 A;  3KF3 A;  3RZH A;  2G1M A;  2FD8 A;  1YQ2 A;  1VBC 3;  3CNA A;  1DYP A;  1NLR A;  4LHS A;  3AX4 A;  4NPR A;  2VUL A;  1OQ1 A;  4Q0U A;  4Q4W 2;  1BK0 A;  1VBA 1;  2PLV 2;  2RR1 3;  3WW3 A;  4CDQ C;  4COZ A;  2B39 A;  3IKW A;  4MHU A;  1Z0H A;  4Y24 A;  4LHN A;  2RS1 2;  5F5A A;  1NCQ B;  5HCB A;  5CEH A;  5KHG A;  4AVC A;  3FFQ A;  2ZX1 A;  4I3P A;  3VZM A;  1HRV 3;  1C5I A;  1W6O B;  4O61 A;  3WDT A;  2O0O A;  1LOC A;  1AL0 G;  1O8P A;  5FK7 A;  4YVW C;  1QOO A;  5FJH A;  2Y0I A;  4CXX A;  4D6S A;  4RQP A;  4ONU A;  2PQS A;  1JOJ A;  3LFI A;  2ZXQ A;  1W2N A;  1VRB A;  2BNO A;  3FJS A;  4XHB A;  1NX9 A;  2GH2 A;  1OOP C;  1RED A;  2XGX A;  1D4M 3;  3I4I A;  1CAW B;  3EHK A;  1A8D A;  3JD7 2;  2UWC A;  1L3J A;  3NV3 A;  1YLL A;  1YC6 1;  1NE4 A;  1SLC A;  2VW1 A;  4V2W A;  4Y3O A;  2WLQ A;  2PQQ A;  1PO1 1;  1CAU A;  1SLT A;  4M0H A;  1LAJ A;  4AZZ A;  4BLJ A;  4QX3 A;  3PJY A;  1QJY 1;  4WBB A;  1QH6 A;  1QU0 A;  2B8M A;  1W8Z A;  3H1W A;  1AR9 1;  1JHN A;  3BTA A;  2G4I A;  2XQR A;  5BNO B;  3WNM A;  4X6Q B;  1DU3 D;  2RS3 1;  2VMC A;  2YC2 A;  5I8S A;  1ASJ 1;  2CGP A;  1AXK A;  4RSU A;  1S55 A;  2UWB A;  3IDB B;  3NMB A;  4IE0 A;  1OUX A;  5KXD A;  1ZRD A;  3AP5 A;  2DVA A;  4JAA A;  3FLP A;  4HK9 A;  5LY2 A;  1JU4 A;  1LOF C;  1WLW A;  4Y5T A;  4C1X A;  2YBS A;  1PZ7 A;  3WNO A;  2QTW B;  1D7P M;  1EYB A;  2B4K A;  3I2O A;  5DAQ A;  5C71 A;  2XUE A;  2VVE A;  1VMH A;  1O59 A;  3KV6 A;  1XU1 A;  4FSJ A;  4CU6 A;  2DCT A;  3TN9 2;  5KXC A;  2VXJ A;  4N90 A;  2D7F A;  2PHT A;  4J1X A;  1RGS A;  3VZK A;  4NIA A;  5BNN A;  5C5T A;  3SEE A;  4CCL A;  1MS5 A;  1LHN A;  1NCR B;  4KMQ A;  3AXE A;  1VBA 3;  4YZ3 A;  4FAG A;  2XUM A;  2YXS A;  1AR6 1;  5CAD A;  1A78 A;  2CTV A;  1GP5 A;  2GP5 A;  4JKL A;  3DPR C;  4OLL A;  4RYD A;  2QFE A;  5IUQ A;  5KC6 A;  4F8A A;  4CVU A;  4HZF A;  1SPP A;  3QLQ A;  4JGY B;  4AGR A;  4AQT A;  1YQ6 A;  3CKH A;  5FLJ A;  4U2A A;  3B3Q E;  2FDI A;  3PIJ A;  4QHO A;  1S0B A;  1SCR A;  3H1M A;  1W8F A;  2G9Z A;  5DZE A;  3Q8B A;  1ND2 C;  2VNG A;  1QOS A;  2Y6H A;  4JRA A;  1WLD A;  2P3K A;  4FPJ A;  4I0W B;  4L9B A;  3PU3 A;  1UY3 A;  1EP0 A;  5FY7 A;  5KBF A;  4AR2 A;  3HN3 A;  2NP0 A;  5EHD A;  2QVS B;  3DYM A;  2PHF A;  1JZ6 A;  3UET A;  2WWU A;  5F2W A;  4AFD A;  2Y6K A;  2ZKN A;  4XVH A;  3FFZ A;  5I0R A;  1F2N A;  2PHX A;  2P17 A;  3M7A A;  1QJY 3;  2P3I A;  2JDA A;  3PTY A;  3ALQ A;  3T2Q A;  3W9A A;  2BW8 A;  1AR9 3;  1G9D A;  1NOV A;  2YFZ A;  4TLG A;  5H9S A;  5SV8 A;  2XH6 A;  1SG3 A;  1ASJ 3;  3AFG A;  1XSQ A;  4DRV A;  4LEJ A;  2ZTN A;  4AXO A;  1ND3 A;  1R1A 2;  3EXU A;  4EN8 B;  5DMY A;  4I0A A;  1C8N A;  1GOG A;  2R49 A;  3S5A A;  1H0B A;  1CIW A;  3AZX A;  1DQ1 A;  2CWM A;  3U37 A;  1MEC 2;  2VNR A;  4GIQ A;  1GNZ A;  1KDK A;  2D6M A;  5C8C A;  2GAL A;  2J1A A;  1X8E A;  3ETQ A;  2XJP A;  3C7H A;  4XCB A;  5C3S A;  1H9W A;  3AZW A;  1AYN 2;  5FQ0 A;  2FDF A;  4GKY A;  3VBU C;  1US2 A;  1V70 A;  5F8P A;  3HOB A;  1Q43 A;  4Q1P A;  2VCB A;  3PUS A;  4ISQ A;  3SEP A;  4BQ1 A;  5KXB A;  5FJK A;  1JYV A;  1WMD A;  2ZML A;  4XUT A;  2WR9 A;  4D7Y A;  5CA6 A;  5A7W A;  3H8U A;  3LIG A;  3M2M A;  5E6H A;  4QPY A;  5C4W C;  1DQ6 A;  5JSR A;  3ZSE A;  2F4P A;  3WF4 A;  4XUP A;  3ZFF A;  4BWO A;  4IET A;  2E26 A;  1AR6 3;  1MS8 A;  2WFF 2;  1YQ8 A;  3PHM A;  1DZR A;  1O4Y A;  1VPH A;  1GP4 A;  2VNO A;  4GJZ A;  4IEZ A;  2E32 A;  3JBG 2;  4XF3 A;  4COY A;  3RYP A;  3O1O A;  1T6G C;  3D82 A;  2D3P A;  1S1A A;  1DZQ A;  2YYO A;  3NKG A;  3VKL A;  3VD4 A;  2D5H A;  3ZM8 A;  2RJ2 A;  4XEZ A;  1SLL A;  5FZC A;  3OPT A;  5LA9 A;  5I93 A;  1W9W A;  3LA3 A;  4GWN A;  5BNN B;  2ZOE B;  5IK8 A;  2X09 A;  3EYP A;  1RUC 2;  1UY0 A;  3OUH A;  5IW0 A;  1YI9 A;  3OYW A;  4Y33 A;  4B4R A;  2DFB A;  2ZZJ A;  1QJX 3;  1PX4 A;  2RS5 2;  2H0V A;  4Q8L A;  3RFR A;  4QB6 A;  4JHT A;  1NXM A;  1N3Q A;  4WZC A;  3WG1 A;  4A42 A;  1PVC 1;  4PIX A;  5KR7 A;  5T55 A;  4K21 A;  2HWF 1;  1GNH A;  2VU9 A;  3ZVX A;  4AQS A;  4C8D A;  4CCN A;  2OPK A;  2GC1 A;  2H6B A;  4V1P A;  2D44 A;  2JG9 B;  4LO5 B;  3KQ4 B;  2W1U A;  3ZOI A;  2IC1 A;  5DDJ 2;  2Q8E A;  2Q8D A;  1ZBE 2;  2G19 A;  4AQ2 A;  4AVS A;  3P6B A;  5FBJ A;  1V0A A;  3CJI A;  5FMD A;  2VVD A;  2BFU L;  4WM7 A;  5CFC A;  1PMH X;  4I2O A;  1V9U 2;  3AMM A;  1MQT A;  1J1T A;  2WA4 A;  4FP3 A;  4IEY A;  4S2G A;  4ITC A;  3OGG A;  4UBG A;  3HAG A;  5JMC A;  1TEI A;  4M00 A;  4O9G A;  4RR3 A;  4FQ4 A;  5KHI A;  1HB2 A;  3L2Y A;  5FYY A;  2WC2 A;  1AUY A;  4FPL A;  3RZK A;  3IPV B;  4F83 A;  5FZK A;  1QDO A;  3BYW A;  4IE4 A;  3WG2 A;  1CQ9 A;  1GQP A;  5FZ3 A;  4OI1 A;  4J1W A;  3JB8 A;  2WZR 1;  1W6Q B;  2XJS A;  4NMI A;  1FNZ A;  1C1F A;  2FBE A;  4IGP A;  2EXH A;  2J7M A;  4LLO A;  1LJ7 A;  1W6N A;  4KBB A;  2BRT A;  2FZ1 A;  1FOD 1;  2K9Z A;  2X5I C;  2D98 A;  1GAN A;  1VLN A;  3I8T A;  4QWN A;  2WS9 3;  3Q8F A;  3K51 A;  1I5P A;  3GAL A;  2WFP A;  2DU0 A;  2XBO 2;  1TMF 1;  4ARX A;  1WUV A;  2X29 A;  4MX3 A;  2JDZ A;  3CJX A;  4JDO A;  4U36 A;  5LBF A;  2WKK A;  3NRU A;  1GZC A;  2OZ6 A;  3RZL A;  1PX3 A;  3OGR A;  3ZFG A;  1NE6 A;  1W39 A;  4BPZ A;  5T5J A;  4AAP A;  2UY8 A;  3SCG A;  3W21 A;  1H8V A;  3LPF A;  5A7W B;  2Y6G A;  3N9Q A;  5AFB A;  4YFZ A;  3J7M A;  5C3Q A;  4A45 A;  1ZRC A;  5GJ6 A;  1I1E A;  1TNR A;  5JDB A;  1OMI A;  1LOB A;  2QDN A;  2WO2 A;  2HWE 1;  3S5Q A;  4DUV A;  1G9B A;  3DUI A;  4PI0 A;  1GOH A;  4W6W A;  3U1X A;  3I7D A;  3UKN A;  3M8L A;  3C3V A;  3T2O A;  2GSY A;  5GZC A;  1SDD B;  1QJF A;  1PVC 3;  3RJ2 X;  3U14 A;  3RNS A;  3IZO A;  5LRS A;  3WF2 A;  1CVN A;  3MW2 A;  4UXA A;  2DCJ A;  1W2U A;  4PCR A;  5J1X A;  3EMR A;  2VUC A;  1W0P A;  4XDQ A;  3J8F 2;  2HWD 1;  1O4Z A;  1UU6 A;  3GZA A;  4NUB A;  4Q4Y 1;  1HQN A;  4DXS A;  4FFF A;  2XPJ A;  2GME A;  5CBL A;  3WDY A;  2NZ9 A;  5ACA 1;  2Y8K A;  1FXZ A;  2WYF A;  4QM9 A;  3M3I A;  1IG0 A;  2EIG A;  3UGH A;  2ZCW A;  2R32 A;  1O7F A;  1RIN A;  4H7M A;  4COU A;  3CZU A;  2GU9 A;  4IV3 C;  1F5J A;  1OQE A;  3K77 A;  3AVS A;  1JZ2 A;  4LKD A;  1PGL 2;  1AL2 2;  1KJL A;  5AC9 3;  5I0T A;  2E31 A;  4BZ4 A;  4LKF A;  4AYU A;  1VR3 A;  4P9J A;  4DXZ A;  2R16 A;  1HQW A;  4Y20 B;  3WNK A;  4GH4 C;  1WW4 A;  2MEV 1;  4FAH A;  1W06 A;  2XML A;  4H55 A;  4MZU A;  4LNV A;  3RWN A;  3ZPY A;  1Q56 A;  2V72 A;  1TMF 3;  3ZLI A;  4WM8 C;  2PN5 A;  2XVG A;  3ACF A;  5CAZ A;  4XC9 A;  3OG2 A;  2YB7 A;  1CZS A;  3GZT B;  2AUY A;  3KCY A;  3M3Q A;  1N1S A;  5GLT A;  3THP A;  3TRS B;  3AMQ A;  1LHO A;  1D2S A;  2WUH A;  4JKM A;  2BV4 A;  4ASK A;  3TEZ A;  4QU1 A;  1QQP 2;  1HN0 A;  1SHW B;  1T6B X;  2D6L X;  3VDD A;  4LR4 A;  1C1L A;  5FZI A;  1LHU A;  1UQX A;  2W47 A;  2PXJ A;  1GKB A;  1V6K A;  3ILN A;  3H7J A;  3LDB A;  1CZT A;  2HWE 3;  5C6C A;  3O1R A;  4TLF A;  3DEC A;  1W6N B;  3O1V A;  2PHW A;  5LAT A;  1BMV 1;  4RQP C;  5J48 A;  5J09 A;  1NY7 2;  5FAX A;  1H1A A;  5IVV A;  5T5O A;  1U12 A;  4YG6 A;  4LKS A;  4LMF A;  1RUE 2;  5FY8 A;  4BXF A;  1IS3 A;  2DVD A;  2A3Y A;  1GSL A;  2OUH A;  2FCV A;  3EO6 A;  4XFB A;  3VV1 A;  2HJI A;  2JIC A;  4HVO A;  1RUI 2;  3PL0 A;  4YW1 A;  2RDS A;  1FAT A;  1XSR A;  2IXI A;  5LK5 A;  1Q5O A;  4CE8 A;  3A7Q A;  4HAN A;  1XXN A;  4Q4Y 3;  4RD7 A;  4XPV A;  2I07 B;  3H8O A;  4DOU A;  1V6O A;  5FBZ A;  5JXG A;  1GQG A;  4DB5 A;  5ACA 3;  2Q5T A;  5L7O C;  1UW8 A;  2VBD A;  4YLZ A;  4Q0Q A;  2O1Q A;  1YFU A;  5LBC A;  1CIY A;  2XL9 A;  1RUF 1;  1FV2 A;  1NT0 A;  5A6Z A;  5J36 A;  4E4S A;  3IN9 A;  1WKY A;  3VD9 A;  1CAX B;  4KG8 A;  1DHK B;  2R04 1;  2AZ5 A;  1RMU 1;  1JUH A;  4KWK A;  2VZV A;  5ANQ A;  4CCE A;  1SLI A;  3U10 A;  3WG3 A;  2YHJ A;  2HBT A;  3W58 A;  5A7P A;  1OLR A;  1UZ0 A;  1L7R A;  2E9Q A;  5T5L A;  5A32 A;  3N35 A;  4XF1 A;  2MEV 3;  2R06 2;  3D4K A;  3LCP A;  2NQY A;  5DAX A;  4Y5Z 0;  2JEN A;  5JXH A;  1OD5 A;  4XFH A;  1L7Q A;  2DCZ A;  2ZA9 A;  2BBA A;  2ZBJ A;  4JCK A;  2QQV A;  3I59 B;  2A70 A;  1QJZ A;  1U5X A;  4K6B A;  5EZW A;  5FZM A;  4OZX A;  2ET1 A;  4OUS A;  5JOW A;  1OD3 A;  1WMX A;  3OD0 A;  5L19 A;  5IAV A;  5BXX A;  3RZZ A;  2A71 A;  4AK3 A;  1LHW A;  3TNP B;  4XJZ A;  1VAM A;  4X8P A;  4CZS A;  5HCF A;  1RUH 2;  2VQU A;  2EXJ A;  2SLI A;  1VIW B;  2CAU A;  1W90 A;  2P6C A;  5CG9 A;  1CR7 A;  2VMG A;  1YFX A;  1FMD 3;  2BGO A;  3IM0 A;  1DP0 A;  5FPU A;  1FV3 A;  1KEX A;  2Q8C A;  1ZRR A;  4NHY A;  1HDK A;  4KI5 M;  1YIP A;  4LBK A;  4DY5 A;  1POV 1;  2YC0 A;  2XLG A;  3R6S A;  2IXJ A;  3AYA A;  4CP9 A;  4M01 A;  2Q4S A;  5CIS A;  1BBT 2;  1XQN A;  4Y22 A;  5EWS A;  3WNN A;  2ZX2 A;  3H3L A;  4Y26 A;  4CDW B;  2FDK A;  4ZY9 A;  2HBU A;  5CVR A;  3A4U A;  4YW3 A;  4RGG A;  4K1Z A;  3FBY A;  4OMC A;  3TB0 A;  2BOI A;  4CCO A;  3UL2 A;  5I8T A;  2ZKL A;  4E4D X;  4MXW A;  3SKV A;  4CDU C;  1Y9G A;  2IXC A;  3DL3 A;  4IER A;  5BUV A;  2ARB A;  2R0H A;  4Q4W 1;  2VVF A;  5FZE A;  3MV1 1;  2WLP A;  3VHR A;  3I49 A;  1C8M 2;  1RUF 3;  1PZ9 A;  2RS1 1;  4LUM A;  1ND3 C;  3I3D A;  4N43 A;  4QHZ A;  5BV6 A;  2QQN A;  5IFP A;  2R04 3;  2OX0 A;  1PMJ X;  1WW5 A;  3AJZ A;  4W50 A;  2GMP A;  3VBF A;  5JZG A;  4JGZ A;  1XJA A;  5C8C C;  3ABZ A;  2IVI B;  3ZN6 B;  2Y0O A;  4Z2A A;  1X9P A;  3GZE A;  3M3O A;  1QWR A;  4GWM A;  5IVF A;  4AED A;  4URT A;  4NPL A;  1BHG A;  1LHV A;  3O7O A;  4LBJ A;  3JD7 1;  3K48 A;  3R05 A;  2Y6J A;  4WVM B;  2RVA A;  1Y4W A;  3WQ7 A;  3PNA A;  5FCC A;  2NN8 A;  2Z69 A;  2VL4 A;  2ZGP A;  3HT2 A;  3ACG A;  2XB6 C;  4NOT A;  1UU5 A;  2CAV A;  1QMJ A;  3ZFF C;  5K9Y A;  4IEW A;  1RYY A;  4HG6 B;  4XXA A;  3R4D B;  2L9L A;  2VZR A;  3TNQ A;  1BQP A;  2LTN A;  2WAB A;  3O0V A;  4LTA A;  4TSV A;  1BEV 1;  1BK1 A;  5FZO B;  2FDG A;  3MGU A;  1F5F A;  5F32 A;  5KHK A;  4PIY A;  5DN2 A;  5FV3 A;  1E5R A;  2BWA A;  5FPV A;  1GZW A;  4GB3 2;  2Y6L A;  5CNA A;  5F2S A;  3WF0 A;  4ZXE A;  2VMF A;  4LUL A;  1POV 3;  1JYW A;  1G9F A;  3AVR A;  4ZXK A;  5GLZ A;  2XJT A;  4FOY A;  1J3Q A;  1Q8P A;  1RUD 1;  3DN7 A;  4XMA A;  3O1T A;  4AI3 A;  1NKG A;  2CGO A;  3KMH A;  5ANN A;  4BIO A;  2VQA A;  4C91 A;  1RVF 1;  4IEV A;  3NL1 A;  4PDW A;  3TN9 1;  5DAP A;  4F3J A;  1NLS A;  4A3Z A;  3I2H A;  1NUK A;  5DG1 A;  1NZC A;  4LT5 A;  1JZ4 A;  3F95 A;  2WO7 A;  4GD4 A;  3SH4 A;  4UFM A;  4FPK A;  4RHV 2;  4XBL A;  2N7G A;  4Q4W 3;  4L8Q A;  4PT6 A;  4XFF A;  4LBQ A;  1JU3 A;  5FLH A;  1OXC A;  5LA2 A;  1H4G A;  2RS1 3;  1IQD C;  3OBT A;  4A7Y A;  3MO4 A;  1T2X A;  2R7E B;  1WCQ A;  5FLI A;  4AHW A;  1XYO A;  2BOJ A;  3W59 A;  2JB4 A;  4E2G A;  3CJI C;  3AXD A;  4JC1 A;  1OUR A;  4OI4 A;  4QMA A;  5F3I A;  3T1M A;  1H9P A;  5JPN B;  4WM7 C;  4KH9 A;  3KT7 A;  5CFC C;  4Z92 B;  4FO9 A;  4IXL A;  1NQJ A;  1YYN A;  1MQT C;  4RA0 A;  4QB2 A;  3CZJ A;  2VAU A;  1W8U A;  1ONA A;  3ZPO A;  2WNV B;  4A41 A;  1UYZ A;  4MYE A;  1LOE A;  4RR3 C;  3CHX A;  2VOX A;  1CWP A;  3QCW A;  3KT1 A;  2E33 A;  4N9I A;  1N3O A;  4OHV A;  4MXW B;  3JD7 3;  1H2N A;  1SBE A;  5HCA A;  1R09 1;  1RC6 A;  3NV4 A;  3GF6 A;  2GND A;  1ZBA 2;  3PVO A;  4KWU A;  4XBN A;  5JUV A;  4DXT A;  3MIH A;  4PHZ A;  5FYU A;  3OF1 A;  2VUA A;  3WDX A;  4CSW A;  1POQ A;  3AYE A;  4A6S A;  4XJA A;  4CUG A;  1UYX A;  4IQP A;  2BUK A;  4JGZ B;  2X05 A;  1BEV 3;  4NAO A;  3VZL A;  1S4C A;  5T5P A;  1K5M A;  1MS0 A;  2ZHM A;  3WR0 A;  1W6O A;  1W9F A;  1A3K A;  1PO2 2;  1JYX A;  1UXZ A;  2W68 A;  2QQM A;  3ZFG C;  4MET A;  2XR4 A;  3C8X A;  3M4F A;  4AED B;  3BU0 A;  1MEC 1;  4MV2 A;  4ZU7 A;  2VMD A;  1Z78 A;  3PUQ A;  5T3N A;  1QXP A;  2NMN A;  4CXW A;  4LJH A;  2DVF A;  1AYN 1;  3BGA A;  3BIW E;  4YSF A;  4KU7 A;  1LGB A;  4JKK A;  1CAW A;  1RVF 3;  3AYC A;  2RDN A;  2D97 A;  2OUJ A;  5A7N A;  2F4L A;  1QIQ A;  3TN9 3;  1PGW 2;  2X10 A;  1CJD A;  4P9Y A;  3T4V A;  2NMO A;  4N53 B;  5DAV A;  3VBR B;  1BVV A;  3NJX A;  3KM5 A;  4JDN A;  3I3B A;  4OHY A;  2UYA A;  1B35 A;  5F3G A;  4OQ9 A;  4TXW A;  2MPF A;  4AFA A;  1IGO A;  5BNO A;  3NAP A;  4EZ4 A;  3O1U A;  1HV0 A;  1OPM A;  5JLV A;  2YDE A;  4LPL A;  4XFC A;  5FWJ A;  1EAH 2;  4R4X A;  1H2L A;  4XAE A;  4BQY A;  4GMP 0;  2ARE A;  1J59 A;  3H8R A;  5I0U A;  4QAW A;  4JDM A;  4P9L A;  3N36 A;  3WUC A;  4C0H A;  3J7N A;  2UUR A;  1AR7 1;  5FP7 A;  4XDO A;  1DQ5 A;  1YHF A;  2ZEX A;  3HPN A;  3B7M A;  2K0G A;  3ZYI B;  4PDW B;  3DEM A;  3CQO A;  2W0X A;  3QH6 A;  4AEM A;  3ZFE B;  3GDB A;  3MFC A;  4UW4 A;  2ZMN A;  2XJQ A;  1GWK A;  2J1S A;  1HJG A;  4HOO A;  5FOB B;  2WBK A;  5K4L A;  5KWR A;  4I0B A;  4TTG A;  1X50 A;  1VMJ A;  3VL9 A;  3MIC A;  2YPD A;  4O7X A;  4FOQ A;  2A6V A;  4KU8 A;  3N7M A;  2CY6 A;  3USU B;  1OT5 A;  3POG A;  2ZGM A;  3FUO A;  4HON A;  1VBD 1;  4RGK A;  5I0S A;  4XUQ A;  3NNM A;  1WW6 A;  5LA0 A;  3AKR A;  4ES9 A;  4D8M A;  1WLC A;  4XJU A;  4IV1 B;  4YWA A;  2W39 A;  1R1A 3;  4AFM A;  4AI0 A;  1QY4 A;  3SQO A;  2OII A;  3K75 B;  5M0T A;  3CU7 A;  4JGY A;  4JTO A;  1H8T B;  3WNL A;  2LRP A;  4Z07 A;  1MEC 3;  4LE4 A;  3V0B A;  1OSG A;  3OY8 B;  3N7J A;  4YW4 A;  3SCF A;  3VDD C;  1H6X A;  2DFC A;  3OEA A;  2A75 A;  2HEW F;  2R07 2;  1AYN 3;  3ON7 A;  3SIS A;  4NRM A;  2IXK A;  3UES A;  3VZO A;  2ZAC A;  1WD3 A;  1IOA A;  4L2N A;  5BNP C;  2P6H A;  3WSO A;  1DLL A;  4Q4V 2;  4D69 A;  2OPW A;  5IVJ A;  2R6Q A;  3FHA A;  1HV1 A;  1YQ5 A;  1APN A;  1E5I A;  2AEZ A;  4SBV A;  3WD5 A;  2DTW A;  5IVE A;  2VC9 A;  2JKB A;  1C5H A;  2VCC A;  4EQV A;  1K5M B;  2JDH A;  5T54 A;  2RM2 1;  3VD3 A;  4DUW A;  1VRH 2;  5A7S A;  3ZN5 A;  5FMC A;  1MS4 A;  2RDQ A;  2OYZ A;  3X29 B;  3K4A A;  4P9X A;  2ZZQ A;  5FZH A;  2BVV A;  3WW2 A;  4DIQ A;  2WFF 3;  4AGG A;  1N1Y A;  4QX8 A;  3A23 A;  1COV 2;  1X8M A;  1SFY A;  1LKN A;  4K20 A;  3JBG 3;  3T3Y A;  2RV9 A;  4S2D A;  1ZZ7 A;  5EYX A;  5J3U A;  3AK0 A;  2AGS A;  3KCX A;  1AR7 3;  1LNS A;  1MVE A;  1RUG 2;  2PFW A;  5FOJ B;  2VW2 A;  4JHZ A;  3SKJ E;  3VBO A;  1VAL A;  2FDH A;  2BBV A;  2C6S A;  3UT0 A;  1XNK A;  3KV4 A;  3IDA A;  2W1S A;  2QQO A;  2SBA A;  4QX7 A;  5FR3 A;  1YFW A;  4QPI B;  1YEW A;  2OVU A;  3E6D A;  1GMM A;  2ORZ A;  3BTY A;  1B35 B;  3ZR6 A;  1HRI 2;  1WBF A;  4Y1V A;  5L9B A;  5KHJ A;  4DIN B;  5FK8 A;  3VZJ A;  5FXV A;  4MGK E;  2BDR A;  5F9T A;  3NAP B;  3T2T A;  4RN5 A;  4BH9 A;  1GZT A;  1DDL A;  4OI0 A;  2P3J A;  1KIT A;  1VBD 3;  5EJ1 B;  2W92 A;  1J3P A;  1JZ8 A;  3RGB A;  3WLU A;  1HB1 A;  1ZBE 3;  4D6Q A;  4IND A;  3OTF A;  5JOZ A;  2BU9 A;  1Z7S 1;  1W2T A;  4BB3 A;  1ZRE A;  2KR2 A;  2OQ6 A;  4XF9 A;  2ET7 A;  2Q0A A;  1DGR N;  5B4N A;  4UW3 A;  4BDV B;  1B09 A;  4HXC A;  1ZZ6 A;  4R9C A;  1OI6 A;  1QJU 1;  2CV6 A;  2JKX A;  2V5Y A;  3WP3 A;  1PIV 2;  1IPJ A;  1FPN 2;  3GHN A;  4HKW A;  2YGM A;  4JX0 A;  4LO8 A;  4CU9 A;  5BNQ A;  1GBG A;  4E8D A;  1QKQ A;  2EAK A;  3RI8 A;  2GN3 A;  4NE9 A;  3T30 A;  4XIL A;  3RJR A;  2JJ6 A;  3E5X A;  1RJ7 A;  1JYC A;  2PAK A;  1SFN A;  4HLT A;  2WRA A;  2RM2 3;  2VZP A;  3AB0 A;  1IG3 A;  2ZMK A;  4ET7 A;  4IEX A;  1IQA A;  1C3H A;  1AZD A;  1W9T A;  2BTV C;  5G04 L;  2XHN A;  4DFS A;  3AFK A;  3W5M A;  1OQD A;  3WY6 A;  2JG9 A;  4LLF A;  1W6P B;  2ZS6 B;  3WP6 A;  3V0B B;  1WCU A;  1ULC A;  4AVA A;  4ZHN A;  2XBO 3;  4R4Z A;  3UGG A;  2FMD A;  2QQJ A;  2YFU A;  1QEX A;  3ES4 A;  4JV4 A;  4QXC A;  3WF3 A;  4BXS V;  1VMF A;  5J98 B;  3AL6 A;  3LDK A;  1R08 2;  3K46 A;  1D0G A;  4LUK A;  1W3V A;  2X53 S;  5CU1 A;  4FPE A;  5LEJ A;  3RS6 A;  2XXZ A;  4K7J A;  5A7O A;  4LQR A;  4N43 C;  1QJX 1;  1ZRI A;  4J25 A;  2JEM A;  2VE1 A;  3VHP A;  2W46 A;  1EY2 A;  3P1I A;  4K1Y A;  1PK6 B;  4LOS A;  4MUV A;  3IPV A;  1WLT A;  1NZI A;  1K42 A;  4W8J A;  2WT1 A;  4KG0 A;  3VBF C;  5JZG C;  3PUI A;  2D3R A;  4QQO A;  1W6Q A;  5FMO L;  1XYP A;  1UX6 A;  2A6Y A;  2IXL A;  1QJE A;  3K3O A;  4NRO A;  1OVP A;  5JR7 B;  3QOP A;  4DEV A;  2EF6 A;  2RJK A;  3GBF A;  2P37 A;  3AP7 A;  5C9A C;  1RUE 1;  4XW3 A;  2BNN A;  2P5B A;  3I3Q A;  1W0N A;  2TNF A;  4AHZ A;  4YAR A;  4QXB A;  2VZ1 A;  3GCW A;  4WVW A;  5AVA A;  3VBO B;  4BQ2 A;  5HCH A;  3O12 A;  3RVH A;  4ARY A;  4FOW A;  1Z7S 3;  1REE A;  3MV0 1;  5A7Q A;  4K8F A;  4EN6 B;  2FCU A;  3H3U A;  1NAE A;  4CPB A;  2B9U A;  2A6W A;  2VJX A;  3WW1 A;  1QJU 3;  3J4U H;  1Y43 B;  1KDM A;  2IFW A;  2ZGK A;  1LCL A;  5LW9 A;  4UFK A;  4E2Q A;  1DFQ A;  5FFO C;  1UU4 A;  4CDX C;  4BE3 A;  1UMZ A;  4ZU4 A;  2WDB A;  3SC7 X;  5D1I A;  2WS9 1;  3MLK A;  4P00 B;  3WDW A;  4QPG A;  4HVR A;  4YVS C;  3NW4 A;  1HKD A;  1RHI 2;  1YQC A;  4EJR A;  4ISR A;  3ZXJ A;  1OFS A;  2AEN A;  1OF3 A;  2RR1 2;  4QX2 A;  4XIO A;  3AM2 A;  3MLL A;  5EXO A;  4RFR B;  4UFL A;  1BVP 1;  1ZZB A;  4XAB A;  1BXH A;  1HRV 2;  2JG8 B;  3ACL A;  4NHX A;  2XHK A;  2GN7 A;  2HH9 A;  3AKP A;  4AI9 A;  1SAC A;  4D0Q A;  1TZO A;  2DYC A;  1DGR A;  3H7Y A;  1OF4 A;  5CFD B;  1UO9 A;  2J1R A;  2JIJ A;  4CUA A;  4G4F A;  4HT1 T;  2AH2 A;  2Y34 A;  1CJP A;  3N9N A;  1WD4 A;  2VTX A;  1ODN A;  1UPS A;  4N9H A;  1D4M 2;  5EPA A;  4A4A A;  3IMM A;  3BU7 A;  3H50 A;  2P34 A;  2JD9 A;  4XQW A;  3HWJ A;  5ABJ A;  4Q26 A;  4Y20 A;  1DG6 A;  1RUE 3;  1QF3 A;  4RFT 0;  3OUI A;  1S0E A;  1FT9 A;  1RUI 3;  3WOG A;  3FX3 A;  1BBT 1;  4XQ4 A;  1J83 A;  3OUJ A;  1JTZ X;  1S0F A;  2PYT A;  1O8S A;  4M3C B;  1O3Q A;  3T09 A;  4ASL A;  2ES3 A;  4B4P A;  1N1V A;  2W1Q A;  1VBE 1;  4H14 A;  5C70 A;  1EV1 1;  1VBB 2;  3KD4 A;  4YZ4 A;  1S2K A;  4L97 A;  5GM0 A;  1NCQ C;  3RI9 A;  3A0K A;  2CWS A;  1C8M 1;  1DIW A;  2ZPX A;  3B69 A;  4JRL A;  1IZ3 A;  4C0B A;  4QX0 A;  4Z8B A;  5AC9 1;  5J37 A;  3N3H A;  1OH3 A;  1ZA7 A;  3NST A;  5FZD A;  1LTE A;  4N8M A;  3S7I A;  1HLC A;  2VPV A;  3AC0 A;  3WNX A;  3DYP A;  3VDA A;  4EWA A;  4S2H A;  1MR5 A;  5A3M A;  5FKB A;  5DG2 A;  4GJY A;  3GJA A;  4CEY B;  1UPI A;  4QT6 A;  3DXU A;  3K2O A;  3LE0 A;  2FHR A;  1VBA 2;  3ZXA C;  5B2G B;  3HMY A;  1PMI A;  3FC0 A;  1ZNP A;  5BYN A;  1LES A;  1MS3 A;  3HNY M;  4W6X A;  5FPL A;  4BLI A;  4ZS3 A;  4X8N A;  4L92 A;  4AEK A;  5F6K A;  3POW A;  3V0A B;  4E4H A;  3IWZ A;  4QPG B;  2Z2S B;  1XU2 A;  1KGY A;  1UY2 A;  1CAX A;  1W99 A;  1PNF A;  5GZG A;  4YM2 A;  5C5U A;  1CAV A;  2A3X A;  4AI1 A;  2E7A A;  2ZGQ A;  1QNY A;  2DCK A;  4R9B A;  5DUU A;  3FE5 A;  4NIG A;  4PLN A;  1PO1 2;  5FYI A;  1DZT A;  5IK7 A;  1F4H A;  3BKZ A;  5KHH A;  2RHP A;  1QJY 2;  2BQP A;  1SBF A;  3FN9 A;  3FZ3 A;  5FKC A;  1BBT 3;  4XTM A;  2OKX A;  3VDB A;  2DBI A;  1AR9 2;  1NYW A;  3ZYJ B;  3TYJ A;  5FYH A;  2DU1 A;  3I59 A;  2RS3 2;  3SH3 A;  3WUD A;  1CX4 A;  5FY4 A;  1ASJ 2;  1NCR C;  1TME 1;  1WA4 A;  1TE1 B;  1VBE 3;  3ZYP A;  1EV1 3;  3GGL A;  3LF7 A;  2C24 A;  4D6R A;  4AFB A;  1XE0 A;  3OPZ A;  4W4Z A;  1C8M 3;  1WWY A;  2GNM A;  1HQL A;  2VXR A;  1AJK A;  3Q8E A;  4UFH A;  5BPX A;  2JWP A;  4BA6 A;  1Y7B A;  4IUG A;  2OT7 A;  2VUD A;  2WNU A;  5ABJ B;  2H0B A;  4JGY C;  4XFA A;  1D2Q A;  5EJZ B;  2W52 A;  3ASI A;  2WT0 A;  4PIZ A;  4MGT A;  4IL7 A;  2P3Y A;  4AVV A;  3ST7 A;  3VKN A;  1ZYB A;  3KHC A;  3LGR A;  3C2U A;  1GQH A;  3NV2 A;  1O5L A;  2D40 A;  1UWW A;  4GMP 3;  3T2P A;  5IJR A;  4A44 A;  4CDW A;  1Y9Q A;  1IS5 A;  3UYJ A;  2ZX3 A;  1W6M A;  4A2U A;  4EYU A;  3OBZ A;  5F1R A;  5JMO A;  1FX5 A;  3U75 A;  3PVE A;  5J7M A;  4FI9 A;  4ZZ8 A;  4COV A;  1OA3 A;  3FHI B;  4BOW A;  4ATE A;  3VBH A;  2V4A A;  1V6L A;  1UL9 A;  5HV4 A;  1W28 A;  3AMN A;  4A3X A;  1FMD 1;  1W8O A;  2VUJ A;  1JMU B;  2BZD A;  2OZJ A;  2ZGL A;  4RS5 B;  5A3W A;  4AQ6 A;  3BPS A;  2R0F A;  3QH7 A;  4QGN A;  4QX1 A;  1RIT A;  2Z5W A;  3W5N A;  3I54 A;  4OUE A;  1LOD A;  1YCI A;  5H9P A;  5E16 A;  1SZB A;  3OB8 A;  5E89 A;  2D93 A;  4CCC A;  1TVG A;  1YIF A;  3MUZ 1;  3WQ0 A;  1G9C A;  2GZW A;  2VCA A;  2PAE A;  5LAS A;  3ZN6 A;  1N3P A;  3RPQ A;  1U0A A;  5TSW A;  5FPB A;  1LEC A;  3IB3 A;  3E97 A;  4IES A;  5SV5 A;  4FT8 A;  5CKQ A;  3MBW A;  2QQK A;  3CO2 A;  3ZSK A;  1C28 A;  1Q8S A;  3D0S A;  4MGZ E;  4JQR A;  4TN7 A;  3UJO A;  2Q1Z B;  1KJR A;  4WVM A;  3OBA A;  3ZMN A;  4CDQ A;  4EV0 A;  2XWJ B;  1TME 3;  5A3P A;  2VH9 A;  2E53 A;  4MAD A;  3KT4 A;  4PQ9 A;  3SCH A;  5B4X A;  4PBO A;  2XQX A;  1NA1 B;  4RHV 3;  4FTB A;  1RTV A;  2HWC 1;  2VEC A;  1AYM 1;  1UZY A;  4YVW A;  3S57 A;  1CAV B;  2WWJ A;  4OMD A;  3ZYF A;  5FZO A;  3M3E A;  3WXP A;  4LBO A;  4NAM A;  5FUP A;  1Q3E A;  5IFT A;  2HEV F;  5IWF A;  4R9A A;  2RMU 1;  4M4P A;  3T0B A;  4KL1 A;  1OOP A;  2Y6F A;  2OS2 A;  5DUV A;  4LE3 A;  2DTY A;  2ZGR A;  4H2A A;  3J26 N;  2JDU A;  3POI A;  2A7A A;  4MXV A;  2B9V A;  5BNN C;  2K46 A;  4B7K A;  3WCR A;  4YM3 A;  5FP4 A;  3RG0 A;  3WV6 A;  5IT6 A;  5A33 B;  1E5H A;  3AZZ A;  3VBS B;  2I74 A;  2ZGO A;  2LUW A;  3BUC A;  5FY1 A;  1ZX5 A;  2VBB A;  4CU8 A;  5C8W A;  2XVK A;  1OVS A;  2WNU B;  2J1T A;  1BYH A;  1OH4 A;  4MGY E;  4R52 A;  2JG9 C;  5FZ0 A;  1RJ8 A;  4Q4X 2;  3VDC A;  4P9W A;  1LOF A;  1XOY A;  2B5H A;  4AHY A;  3AKT A;  5E88 A;  1PZ8 A;  2VTX J;  3GBW A;  3KVA A;  3BPZ A;  5D8A B;  1YJL A;  3V65 A;  1JHJ A;  4HK8 A;  1CZV A;  2FQP A;  3WIN E;  4IW3 A;  3G7D A;  5GZF A;  1S0I A;  5C3O A;  1UMI A;  4HMZ A;  4PLO A;  5F5I A;  2WZE A;  1OLM E;  3KF5 A;  5F6L B;  5LBE A;  1W6M B;  2WNV A;  3ETP A;  4L0P A;  2XKP A;  4NRQ A;  5EQU A;  3RZJ A;  1JYN A;  1PVC 2;  4XJW A;  3ZKY A;  1RUJ 2;  2BWC A;  3DGT A;  1ULG A;  2HWF 2;  3GJB A;  3IAP A;  4Q4V 1;  3SIT A;  3H8X A;  1ENS A;  2KA3 A;  3VBH B;  3ZYH A;  1S0J A;  1GNY A;  2PLV 1;  2WN2 A;  2K2S A;  3PUR A;  2EXK A;  3NV1 A;  4AE2 A;  2DV9 A;  1RIR A;  3TEW A;  1LGN A;  1Q8Q A;  5JSO A;  4XZU G;  2Y38 A;  2HWC 3;  5K0U B;  4YG3 A;  1AX2 A;  1AYM 3;  1X7N A;  3C7E A;  3GZU C;  1RXF A;  3J7H A;  3E5Q A;  2PTM A;  4CEW B;  5DAB A;  1COV 1;  1YXW A;  1IS4 A;  4MO3 M;  1HJF A;  4E8C A;  1W2A X;  3I2G A;  4JVA A;  3LA2 A;  2RMU 3;  3J7L A;  4IEQ A;  5H9Q A;  3VHN A;  3ZYG A;  2R1D A;  1NXD 1;  3LIH A;  1MS9 A;  3UJQ A;  1X9T A;  3JUU A;  5JR2 A;  1RUG 1;  1A8M A;  2VOT A;  2V73 A;  2WZR 2;  4CDQ B;  1U5I A;  3O0W A;  1STM A;  1UOF A;  2WQ4 A;  2Y33 A;  4I02 A;  5D2A A;  1H6Y A;  5LBB A;  1XE8 A;  4YW7 A;  1FOD 2;  1GUI A;  3LB9 A;  4X6R B;  3LZZ A;  4YNI A;  5GAL A;  1HRI 1;  3VZN A;  3NVC A;  5F7U A;  4YVW B;  4ASM B;  1TQ5 A;  4N53 A;  1TMF 2;  3VBR A;  2VCM A;  1K12 A;  1NG0 A;  1UOB A;  2FMY A;  3I2I A;  3RZM A;  4MGQ A;  2VZO A;  1M06 G;  1UX7 A;  1UNB A;  3O1S A;  4K8R B;  5L9R A;  3ZYB A;  3AZY A;  1OA4 A;  2VZT A;  3AKQ A;  4DPN A;  1OOP B;  2DF7 A;  5E1R A;  4K3U A;  2ZAB A;  2EXI A;  3ENR A;  1JN2 P;  4RGA A;  2UWA A;  4YW2 A;  4BQW A;  2FDJ A;  5I0D A;  3RYR A;  2CGN A;  4AVT A;  5FZB A;  3VBU A;  3PUA A;  2ZHK A;  2EIB A;  3I3E A;  5LEK A;  2HWE 2;  3K3N A;  3IIA A;  1HXS 2;  3N7K A;  4Q5O A;  4XUR A;  5FP9 A;  3ZFE A;  3LSD A;  4Y1Y A;  3L2H A;  3DF0 A;  3AMP A;  3ES1 A;  4Q4V 3;  4E27 A;  1LRH A;  3NNJ A;  3POJ A;  2PLV 3;  2RDR A;  2VG9 A;  2WNE A;  3O1M A;  1J58 A;  4NR1 A;  2HWD 2;  4Q4Y 2;  1VRH 3;  2VNV A;  1W0O A;  3USU A;  5JXI A;  1EPW A;  5DAW A;  1O5U A;  2WA3 A;  4L11 A;  5ACA 2;  2A5Z A;  1COV 3;  2PHR A;  2XJU A;  2Q8O A;  1OLM A;  1YUD A;  2DWR A;  4IV1 A;  4NWV A;  3U07 A;  1AX1 A;  2XJR A;  3UGF A;  3MIG A;  4AVB A;  1HX6 A;  2P2K A;  3T0D A;  5FZ7 A;  1VAK A;  5EFU A;  1H8T A;  4IDZ A;  1RUG 3;  3HQU A;  4L99 A;  4W65 A;  3RWK X;  5JAX A;  1G8W A;  3OY8 A;  2W91 A;  4YM1 A;  3KHB A;  3N9O A;  1I5Z A;  4LIU A;  1OA2 A;  1XE7 A;  4NHL A;  5EJ3 A;  2QQW A;  3N7L A;  4UFJ A;  1YWK A;  1UIJ A;  3DPR B;  3O14 A;  3PUH A;  3FLT A;  2MEV 2;  4Q1R A;  1HRI 3;  1KFU L;  2WII B;  3GHM A;  3JXS A;  4DEQ A;  1CON A;  2EAA A;  1LGC A;  4CCJ A;  1W3X A;  1LU1 A;  3RRD A;  2J1V A;  2EVX A;  4FFG A;  3T1L A;  1W8N A;  4UFI A;  5A3L A;  1ND2 B;  1R1A 1;  3EQE A;  3HN1 A;  5A6Y A;  1O6U A;  5AVP A;  2O8O A;  2B7Y A;  2BNM A;  2C0Z A;  4H3W A;  4O65 A;  5A3O A;  3N9L A;  2GNB A;  4QDS A;  4QKF A;  4Z82 A;  4F7Z A;  2B42 B;  1W8W A;  2V5D A;  2XKO A;  4Z1V A;  3PJQ A;  4CXY A;  1W8H A;  2HWB 2;  4NPM A;  4XE9 A;  3BAL A;  1UMH A;  3B5L B;  3JZV A;  5J96 B;  3U4S A;  1BMV 2;  2TEP A;  5JIU A;  5EV7 A;  2C5D A;  3B01 A;  4QKN A;  4I01 A;  3OSD A;  3MUY 1;  4DZG A;  1VJ2 A;  3ZXG A;  3WF1 A;  5G05 L;  4QPI A;  5A1F A;  3NNF A;  3FMG A;  2X5I A;  3MDP A;  2VM9 A;  3E6B A;  1Y3T A;  3POF A;  1WME A;  2WFF 1;  1FI2 A;  2ZHL A;  1E5S A;  2QKD A;  4WVV A;  3N9M A;  4QQ2 A;  4A6O A;  2XJV A;  4KQ7 A;  1OUS A;  1AXZ A;  3JBG 1;  1JOB A;  2D6N A;  3JB4 C;  3VBU B;  4YG0 A;  1RHI 1;  4ES8 A;  2VZ3 A;  5JI7 A;  4P14 A;  3SNM A;  4CP2 A;  2Q30 A;  4BIS A;  4KWL A;  4EE2 A;  4NHM A;  4QQL A;  5A80 A;  4K40 A;  2XON A;  3CL1 A;  3LA7 A;  3TAY A;  1RUF 2;  1ZM1 A;  4Y5S A;  5LK7 B;  1ZZC A;  3ZDV A;  2VZQ A;  4B1M A;  5C4W B;  1ZVF A;  2GNT A;  1RUC 1;  4CDX B;  2R04 2;  4LBL A;  5JVV A;  3NWK A;  1RMU 2;  3SLI A;  1UZW A;  5EYY A;  5A3U A;  4LO4 B;  3LSE A;  4LBQ D;  3NNG A;  2RS5 1;  3O0X A;  5EP9 A;  4MG2 A;  4IEU A;  5DPN A;  5ERL A;  2Z42 A;  2XVL A;  3JU9 A;  5A6X A;  1YI7 A;  5F5Q A;  4ZS2 A;  1SMV A;  2VOV A;  3EB7 A;  5FZF A;  4PLM A;  1K45 A;  1XND A;  3PIG A;  5DDJ 1;  5FZ1 A;  1ZBE 1;  1W9Y A;  2JE9 A;  4FQZ A;  2ZGN A;  4XMI A;  3BIE A;  4I30 A;  2LM3 A;  1GWM A;  5JCT A;  3AP4 A;  1W6P A;  3R4U A;  4CDW C;  1V9U 1;  5CYY A;  2WIN B;  3BB6 A;  2Y64 A;  4AF9 A;  4DXR A;  2J42 A;  2E6V A;  3DYO A;  2ID4 A;  2ERF A;  2QNK A;  3UV9 A;  1C57 A;  3A0N A;  4Q0P A;  5HPO A;  2P4E A;  3VHO A;  4QX5 A;  2VW0 A;  5FPZ A;  4IV3 A;  4R8H A;  4I3G A;  2QQU A;  2W08 A;  1GZ9 A;  3B93 A;  1WGP A;  4IE7 A;  5FMO S;  4FBF A;  2D6P A;  3B02 A;  3J9S A;  4XZP A;  4XUN A;  2WZP P;  3USS A;  5GZD A;  3WT3 A;  4E2S A;  5KXE A;  1CD3 G;  4UI9 L;  4GZ9 A;  5LA1 A;  1UKR A;  2WYS A;  1PK6 A;  1W9S A;  4DY3 A;  2WN3 A;  1R64 A;  3DKW A;  4CU7 A;  5A3T A;  5FYS A;  1SFP A;  2VD7 A;  3IDE A;  4FPY A;  2VZU A;  3MIF A;  5FWE A;  3MW3 A;  2LW8 A;  2XBO 1;  1UAI A;  4WM8 A;  2UU8 A;  1URX A;  1XNB A;  5DZG A;  2VZS A;  1RHI 3;  5E8A A;  2ZGU A;  5HXM A;  4TZD A;  1CGP A;  2QUO A;  4LK6 A;  1ULO A;  3ZX7 A;  2Q1F A;  5IK5 A;  3MF9 A;  3BCW A;  3ZO0 B;  3NJZ A;  4DUX A;  1G7Y A;  4Q2F A;  1JZ7 A;  4FPG A;  5JSP A;  2O8Q A;  4QQP A;  2B46 X;  4BQ4 A;  3WCS A;  1WA6 X;  1RUC 3;  3DXT A;  2V4V A;  1OLQ A;  2D43 A;  2ZEW A;  2QE3 A;  3TEY A;  2PHL A;  4HKL A;  1JYI A;  1G86 A;  2DVG A;  2JDN A;  4CA9 A;  4BQ3 A;  2X5I B;  2LAL A;  5L36 A;  1SCS A;  2JDK A;  2RS5 3;  1W8T A;  3RSJ A;  1GV9 A;  2IFR A;  3BOP A;  2GC2 A;  4CP1 A;  4FXG B;  1ZZ8 A;  4FPC A;  2UYB A;  3LEK A;  4LO6 B;  2IVJ A;  1PM7 A;  3KGZ A;  3OGV A;  4EN0 A;  5FZ8 A;  2W95 A;  2F6B A;  5DDJ 3;  4QPW A;  2OXB A;  1LR5 A;  4PJY A;  2ARA A;  1XRU A;  1AR8 2;  1S0D A;  1FYU A;  1MPX A;  3J8F 1;  3MI8 A;  5C3P A;  1QGL A;  3AL5 A;  1O4T A;  3G6J B;  1DYK A;  1F31 A;  1W03 A;  4YGC A;  5DUW A;  4FVV A;  3Q8C A;  5HXV A;  1BKZ A;  1S2E A;  1V9U 3;  4OYU A;  3IBM A;  4HN0 A;  4UT5 A;  4URA A;  5L7O A;  2Q1M A;  4CUB A;  1F15 A;  4CP0 A;  1BEV 2;  1GFF 2;  3HR9 A;  4D3W A;  4MVT A;  3WEZ A;  2JG8 A;  3CMG A;  4BQ5 A;  1KD7 A;  3D3A A;  1H30 A;  1VBB 3;  3A22 A;  4XOG A;  2YPJ A;  5FPX A;  1AX0 A;  1PGL 1;  1AL2 1;  2JDM A;  1NLQ A;  4AWD A;  4HFS A;  1DLC A;  3VKO A;  3JQW A;  5CFD A;  3OEB A;  3HNM A;  3K4D A;  3HBZ A;  4LA3 A;  2D6O X;  3S0M A;  3I2F A;  1RUD 2;  2HKX A;  2BFU S;  2J22 A;  3AP6 A;  2XDV A;  1YNA A;  2A6X A;  1RVF 2;  4P5H A;  3KCC A;  4GA9 A;  4NJ4 A;  4CCM A;  5F3C A;  2XL7 A;  2JEC A;  1BJQ A;  1JOD A;  2BER A;  2ETE A;  2WNV C;  2PA7 A;  3MPB A;  4LBN A;  4QU2 A;  3KS7 A;  1JH5 A;  1ZZ9 A;  3ECQ A;  4B4Q A;  3LQC A;  1H1M A;  3MIB A;  1HW5 A;  3PU8 A;  4GWI A;  1A6C A;  1PVX A;  2VY0 A;  1V6J A;  1XB9 A;  5C3R A;  4IV3 B;  4UAP A;  1IPK A;  1KRI A;  1R1Z A;  4M3C A;  5CKM A;  1QQP 1;  4LHL A;  4OHX A;  3RDI A;  2ZAH A;  2FZ2 A;  2RE9 A;  5FXW A;  1XNA A;  2VBP A;  2ATF A;  3WDV A;  3ZIX A;  3UNP A;  5FYZ A;  1JBC A;  2WSV A;  3BN6 A;  3LEI A;  5H9R A;  3PVN A;  1YJK A;  3O5S A;  5FUN A;  1H4H A;  2NPI A;  4GH4 B;  5IAX A;  4JGZ C;  3VGI A;  2DCY A;  3W20 A;  1S0C A;  1NY7 1;  4TYS A;  3C7O A;  1UF2 C;  3Q9O A;  3WNP A;  4G9S B;  4BK5 A;  3H3Z A;  1SBD A;  4Q8K A;  2AR6 A;  4HBN A;  4WM8 B;  3UK9 A;  4AED C;  2EIC A;  4IE5 A;  1RUI 1;  1R09 2;  1OKO A;  1RUN A;  1DGW X;  5GLW A;  3PDQ A;  3J8F 3;  1PO1 3;  4GQ7 A;  3VKF C;  4WVZ A;  4NN0 A;  4CEY A;  3D8C A;  3N4M A;  4XBQ A;  1ODM A;  4AOC A;  4CDU A;  2VQ0 A;  2YUE A;  3CLP A;  3TEX A;  4YW5 A;  2P1B A;  4XDP A;  1POV 0;  2RS3 3;  4N53 C;  2QZ3 A;  4RQP B;  3VBR C;  1X82 A;  4BYY A;  4C1W A;  4CRQ A;  2JE8 A;  1KS4 A;  4XFI A;  4XJ8 A;  3WZ1 A;  2JDY A;  5CIR A;  1SLB A;  2CNA A;  1WZX A;  1H2K A;  3U78 A;  2CHH A;  5BY5 A;  5AFE A;  2E7T A;  3ZYR A;  4EWD A;  2YGL A;  1J1L A;  2FCT A;  1AL2 3;  4PF1 A;  3IT8 A;  2KD7 A;  3NKT A;  5LB6 A;  1MVQ A;  1PM4 A;  4GXL A;  3ZR5 A;  3V0A A;  1O3R A;  4GUL A;  2Z4F A;  2WSU A;  2DUP A;  1S2B A;  1HN1 A;  4ERO A;  1CAU B;  5D21 A;  2R06 1;  3HIF A;  3CF6 E;  4NWW A;  1WW7 A;  1VBC 2;  3IAQ A;  1CN1 A;  4AAX A;  5CZK A;  2C26 A;  4YZ2 A;  4PDW C;  4DRR A;  1VE0 A;  3SXW A;  5L7O B;  1N47 A;  4IEO A;  4BIF A;  3ZFE C;  2R1B A;  2QZ2 A;  4E9K A;  5FZ4 A;  5I8Y A;  1HIX A;  3M1H A;  1F35 A;  5T52 A;  1Q8V A;  4YPJ A;  2AAC A;  1UXX X;  2YBP A;  2WAA A;  1QQP 3;  3DV8 A;  5FY9 A;  4XET A;  1D0H A;  4FFI A;  3GM8 A;  2DBN A;  3D6E A;  5GLV A;  1RUH 1;  4J6G A;  4AW7 A;  2VTF A;  4OQ8 A;  4FTE A;  1LUL A;  4ATF A;  3S30 A;  3GCX A;  3R4S A;  1AR7 2;  3NQH A;  1UY4 A;  2DUR A;  4XUO A;  3IDC B;  4YGB A;  2J1E A;  4IV1 C;  2JIG A;  2MHF A;  2RJL A;  4Q4X 1;  5FRE A;  3ZSM A;  2WZ8 A;  4AEJ A;  3KVB A;  5FZ9 A;  1I6X A;  4Q29 A;  1H8T C;  1DQ4 A;  2DUQ A;  2C9K A;  2CDO A;  5ISL A;  3NO8 A;  2B45 X;  4UYB A;  4H7L A;  1RXG A;  4IE6 A;  4XHX A;  4N7U A;  3OOX A;  2AYH A;  3PMS A;  4ORF A;  3WQ1 A;  3KV5 A;  1BCX A;  5A1L A;  4Y4R A;  2IZW A;  1G9A A;  1RUJ 1;  2ZEZ A;  1I9R A;  2QCS B;  1VBD 2;  1SPP B;  3INA A;  4M4R A;  3RQ0 A;  1U5Y A;  2ZHN A;  1AF9 A;  3CIH A;  3E1F 1;  1K5M C;  2WO1 A;  4KNC A;  2HYX A;  1KXG A;  3T4H B;  5DZF A;  1ULF A;  1H1I A;  2JXA A;  3N9P A;  1GWL A;  1MZ5 A;  1UYP A;  4MSV A;  1RUO A;  5DQ0 A;  4C90 A;  1GLH A;  3C7F A;  2W5F A;  4RS5 A;  1BLZ A;  2XWB B;  4MH0 E;  3ZN4 A;  3FUQ A;  5LCW L;  2YZ4 A;  2R06 3;  3WP5 A;  1MAC A;  2GP3 A;  2ZGS A;  4RL7 A;  3OGJ A;  4M3C F;  5FRA A;  1UZZ A;  4UW5 A;  2JD4 A;  4CPB D;  4Y1U A;  4CDU B;  2EAL A;  2Z79 A;  4GMP 1;  5FYB A;  4YZ5 A;  1US3 A;  1AVB A;  5DUX A;  2J1U A;  5JIA A;  4E4Z A;  1SLA A;  4QPI C;  1N1T A;  2RM2 2;  1IPS A;  1ND3 B;  1UZV A;  4QGM A;  4BM8 A;  1B35 C;  1XNT A;  1OKQ A;  2QQI A;  4GAZ A;  4LA2 A;  3LEM A;  4OI2 A;  4XXP A;  3S6P A;  4FPF A;  4LKE A;  5BNO C;  2D3S A;  3NAP C;  5LWB A;  5LZ6 A;  2C4X A;  2GC0 A;  5C8C B;  1RUH 3;  2CDP A;  1W2O A;  5FQ0 B;  3LOB A;  1NA1 A;  4LBM A;  3UKT A;  2WQ8 A;  3WP4 A;  4NII A;  2KXL A;  2VME A;  3AYD A;  3IMN A;  3OJB A;  4Q4X 3;  4GB3 1;  3GNE A;  3T0A A;  1D4V B;  4A7K A;  4XAA A;  3HQX A;  4B7E A;  2XG3 A;  2PAM A;  5CB7 A;  4DQA A;  3VKM A;  4IGO A;  2UY9 A;  1HXS 1;  2V09 A;  3MLJ A;  3LWC A;  3TBD A;  3ZFF B;  5JWP A;  2XLA A;  4BK4 A;  3LDR A;  1K5J A;  1U5Z A;  5IAT A;  1XPW A;  3MID A;  4HPK A;  4W6Y A;  5FZA A;  3BI3 A;  1RUJ 3;  5A33 A;  3HQR A;  1DGW A;  5FP8 A;  2HWF 3;  5FTT C;  5LRR A;  3VBS A;  4RHV 1;  2QQL A;  3F2Z A;  3ZIW A;  1JXN A;  5T50 A;  3LEG A;  4UF0 A;  4GAL A;  4YM0 A;  2YRO A;  5FO7 B;  3HBK A;  2PMW B;  4MGS A;  5FO8 B;  1JZ3 A;  1EUT A;  1Z7S 2;  4NHK A;  5APA A;  5IVY A;  3POB A;  4UOJ A;  1OPO A;  2W2I A;  3B9I A;  3LOI A;  4AI2 A;  5FYV A;  3ZXF A;  5HBA A;  2C9A A;  4TWT A;  1LOG A;  1QJU 2;  3OYW B;  2NYY A;  2ILM A;  3VL8 A;  3POS A;  3MW4 A;  5D8A A;  1ZRF A;  4HVQ A;  1ULD A;  2YG0 A;  2YMZ A;  1YFY A;  3APB A;  1GU3 A;  3MFA A;  3LD8 A;  1MZF A;  4FCA A;  4QKB A;  2HLE A;  1UYY A;  1UN1 A;  5FYM A;  1X33 A;  4EN7 B;  4YZ1 A;  2WZR 3;  1AR6 2;  5JPM B;  3FL7 A;  1YO8 A;  2WQZ C;  1ZBA 1;  3ZXE A;  3VUO A;  5F3E A;  5FY0 A;  1PK6 C;  4BJ0 A;  3R0R A;  1JYT A;  2DVB A;  3NNL A;  2YU2 A;  3BTZ A;  2Y60 A;  1FOD 3;  2ARC A;  3ZSJ A;  5HV0 A;  3KB5 A;  1DF0 A;  1AHS A;  3CJI B;  2RG4 A;  4OUL A;  4IEP A;  4WM7 B;  5CFC B;  2GC3 A;  2HEY F;  5JI9 A;  3H1Y A;  1MQT B;  3FBM A;  3LPG A;  1OFN A;  3D5O A;  4P5Y A;  5C33 A;  3TWI A;  2I45 A;  3AP9 A;  3P3P A;  2E7Q A;  3BOW A;  5K0U A;  1DGL A;  2IUW A;  4RR3 B;  1ALY A;  1PO2 1;  4Q0S A;  5FPA A;  5FZG A;  4HN1 A;  4ZZ5 A;  3HJR A;  4OZO A;  2R30 A;  1JS9 A;  3QAC A;  4GB3 3;  4UW6 A;  3ZSL A;  3VBO C;  1CPM A;  4CEW A;  3KWV A;  4AGV A;  3MEP A;  1VAV A;  1QJX 2;  1DQ2 A;  3I97 A;  1OHF A;  5FDB A;  1V6I A;  3M70 A;  4KBZ A;  1I3H A;  2HWB 1;  5BNP A;  2GH8 A;  5GKA C;  1HXS 3;  4S2F A;  5HI0 A;  4ZKT B;  1WMF A;  4OVE A;  4WV8 A;  3I2J A;  1PGW 1;  3L9J T;  1ULP A;  3OCP A;  3VB9 A;  4QDQ A;  5EIY B;  4QB1 A;  2ZGT A;  1RL3 A;  4BME A;  5KC5 A;  4Q0V A;  4AI8 A;  4CTE A;  2G9F A;  3OBR A;  3KQR A;  5FYC A;  3ZFG B;  2XOM A;  1KFX L;  3P5B A;  3T08 A;  3ME2 A;  3VN4 A;  4DO0 A;  1MZE A;  2HWD 3;  5A1A A;  1ACC A;  2G9G A;  1FNY A;  1XYN A;  2E63 A;  1C4R A;  1EAH 1;  1JW6 A;  3AJY A;  1QXJ A;  3AKS A;  3ELN A;  1DBN A;  4MOA A;  4GKX A;  4QXK A;  2JX9 A;  4ZON A;  3ATG A;  5IK4 A;  3NJV A;  4XF4 A;  4PBP A;  5FXZ A;  5A6Q A;  3KV9 A;  1XC6 A;  1DCS A;  5FXX A;  2JG8 C;  4HPK B;  3BTX A;  3CBN A;  1JOP A;  4PI2 A;  2WS9 2;  1ZBA 3;  3HNB M;  4HKO A;  4UF0 B;  4FOV A;  2NLR A;  4GWJ A;  4V2V A;  5CFD C;  1UD1 A;  3A21 A;  5IVC A;  3DCQ A;  3VD5 A;  1GIC A;  3BVC A;  5F5C A;  1MS1 A;  2BGP A;  3I3M A;  4O9E A;  3I2K A;  3GYD A;  3ILF A;  2OQ7 A;  3HT1 A;  2LRO A;  1ENX A;  4LOR A;  3LFM A;  1PO2 3;  3BOD A;  3WVJ A;  4CCD A;  5JOX A;  1VB4 A;  4M0N A;  4XQD A;  4Z2W A;  5FO9 B;  4ZU5 A;  1XBF A;  4WZF A;  2CSG A;  2JB8 A;  4AHX A;  3GXU A;  4YFW A;  4CYD A;  2LS6 A;  4DMI A;  2VOK A;  1EPZ A;  2YU1 A;  4OFG A;  1V00 A;  3HEI A;  3S7E A;  4XIK A;  3ZDS A;  4AFC A;  4DS0 A;  2R07 1;  3OGS A;  3ZXD A;  3PLQ A;  4YGD A;  2ZJC A;  4COW A;  3DKQ A;  2HWB 3;  1M4W A;  2BP6 A;  3WW4 A;  1LU2 A;  4YYO A;  3GBG A;  1BZW A;  2A6Z A;  1F4A A;  3SH5 A;  3U11 A;  2GMM A;  1QNW A;  5FYT A;  1P8J A;  2YV8 A;  3SMH A;  2DDU A;  4QD2 A;  1OBN A;  2WAO A;  3VLB B;  4D94 A;  1CPN A;  3DPR A;  1SEF A;  2I2S A;  1VRH 1;  3MHZ A;  4BHP A;  5GLU A;  4LIT A;  1DQ0 A;  2W9X A;  1G6N A;  4SLI A;  2XLF A;  2WL1 A;  4PQQ A;  1ND2 A;  3OPW A;  4XTP A;  3VDD B;  4HSL A;  5FZ6 A;  4CEY C;  1EAH 3;  4JTN A;  2ZX0 A;  1VBE 2;  1EV1 2;  4DNY A;  4OCT A;  2QJV A;  5BNP B;  2ADE A;  4P9G A;  4QM8 A;  1WBL A;  1QDC A;  5AC9 2;  3POY A;  1UOJ A;  5CG8 A;  2W94 A;  3ROU A;  4B1L A;  3B00 A;  1QOT A;  1KS5 A;  1CX1 A;  3U4X A;  3B9C A;  2VQT A;  1RMU 3;  1WCK A;  4LOT A;  4B8E A;  2EA7 A;  4XFG A;  2ZAA A;  3PVB B;  4ZPI A;  3RZG A;  4G3Y C;  1E57 A;  3EJK A;  5C7G A;  3HVD A;  4JQT A;  4QHB A;  5FP3 A;  4QPG C;  2ZEY A;  1DYO A;  3O1P A;  2PEL A;  4P08 A;  3CEW A;  2Y26 A;  1KQR A;  5C9A A;  4AL9 A;  5K8S A;  2BEO A;  1W05 A;  2CYF A;  1ULE A;  4XJ9 A;  3WHT A;  4Y4Y A;  3JQX A;  2WWS A;  4QGL A;  2D5F A;  4B29 A;  1OC1 A;  4LK7 A;  1V6N A;  3ZXK A;  1AR8 1;  4EZH A;  4Y1X A;  4Y1Z A;  1SQ4 A;  2QBX A;  3WX5 A;  5JXJ A;  3ZKU A;  3P3N A;  4QQH A;  4XF0 A;  2YY1 A;  4R9D A;  4BCU A;  1JZ5 A;  1GP6 A;  1ENQ A;  2R07 3;  2AEY A;  1LB2 A;  2BGC A;  1PIV 1;  1FPN 1;  5C4W A;  2VR4 A;  3THD A;  1UY1 A;  2IWG B;  2O14 A;  3ORJ A;  3III A;  5A32 B;  4CDX A;  2JE7 A;  4IGQ A;  5CKN A;  1WCD J;  3WDU A;  3K4Z A;  2TBV A;  5FUI A;  1UOG A;  4NO4 A;  4BQX A;  1NQD A;  2YBK A;  3OD4 A;  4HET A;  2W87 A;  4NVP A;  5ABJ C;  3MYX A;  1Q8O A;  2OA2 A;  4YVS A;  2CL2 A;  2WJS A;  4QDR A;  3UKV A;  4NRP A;  5F37 A;  1J84 A;  5L73 A;  2ARX A;  2E51 A;  3C7G A;  5IVB A;  3LAG A;  5IYY A;  3V56 A;  3WG4 A;  1TME 2;  2A1X A;  1LEN A;  1R08 1;  5JOY A;  1PHM A;  1GYK A;  3M3C A;  4I09 A;  1UCX A;  4MGI E;  1O3S A;  3I2D A;  1H2M A;  3HD8 B;  1JI6 A;  2ZX4 A;  5A70 A;  3AMH A;  2JDP A;  4OUM A;  4CP9 B;  3E6C C;  1LED A;  1L7L A;  4RS5 C;  4Y22 B;  2D6K A;  1JUI A;  2QQP A;  1RB8 G;  5FZL A;  2QDR A;  2F17 A;  2H6C A;  4FXK B;  4OHW A;  3WHU A;  1CES A;  1FAY A;  4P9I A;  4LHK A;  4B3N A;  2BYV E;  1XNC A;  2YC4 A;  4A7Z A;  3LKJ A;  3KLS A; 
#chains in the Genus database with same CATH homology
 4GD4 A;  5FZD A;  5FJH A;  5FPB A;  4D6S A;  3KVB A;  3PUS A;  5FYM A;  2XXZ A;  5A7O A;  5FJK A;  5FZ9 A;  5A80 A;  4BIS A;  4LIT A;  5FZM A;  5A7W A;  5F3E A;  5FY0 A;  4TN7 A;  5ISL A;  1VRB A;  4QXH A;  2YU2 A;  5FY5 A;  3OPW A;  5E6H A;  4GJY A;  5FZ6 A;  5F3I A;  5A3P A;  3DXU A;  3PTR B;  3KV5 A;  3K2O A;  3K3O A;  4NUB A;  2XDV A;  4V2W A;  4Y3O A;  5A1L A;  4Y4R A;  5FZB A;  4BU2 A;  5IVJ A;  3PUA A;  4CCM A;  3K3N A;  2WWJ A;  2P5B A;  3ZPO A;  5FPA A;  5F3C A;  4GJZ A;  5FPL A;  5FZO A;  4QXB A;  5FZG A;  5IVE A;  5FUP A;  5FP9 A;  5IWF A;  2Q8C A;  5FPU A;  3PU8 A;  3RVH A;  5FZF A;  5A7S A;  5A7Q A;  2OS2 A;  4DIQ A;  5FZ1 A;  5FZH A;  3N9P A;  3AVS A;  5FZC A;  3OPT A;  4QX8 A;  5FP3 A;  4E4H A;  5FXW A;  4LXL A;  5A3N A;  5LY2 A;  5FYU A;  5FYZ A;  5FP4 A;  2YBS A;  5LW9 A;  5IW0 A;  4CSW A;  5FUN A;  4CUG A;  2GP3 A;  4Y33 A;  5LY1 A;  2XML A;  4CCO A;  5FY1 A;  5FYI A;  2XUE A;  3ZLI A;  3KV6 A;  5FYC A;  5FYB A;  5FZE A;  3KV4 A;  4EZH A;  3NJY A;  5KR7 A;  4C8D A;  4QX7 A;  4CCN A;  5FYH A;  5FZ7 A;  3PUQ A;  4LIV A;  5FZ0 A;  4DO0 A;  5FY4 A;  4CCL A;  4GAZ A;  4ASK A;  2Q8E A;  2Q8D A;  4QU1 A;  2OX0 A;  5FXV A;  3PDQ A;  3KVA A;  3N9O A;  5FBJ A;  5LWB A;  4LIU A;  5FZI A;  4D6R A;  2PXJ A;  5A3T A;  5FYS A;  5A7N A;  3LDB A;  2VD7 A;  4IGQ A;  2GP5 A;  5FXZ A;  5FWE A;  2YBK A;  3KV9 A;  5F5I A;  4XDP A;  5FXX A;  5IVF A;  2OT7 A;  4AI9 A;  4D6Q A;  5IVV A;  4CCJ A;  5F3G A;  5FYY A;  2OQ6 A;  3U78 A;  5FZK A;  4UF0 B;  4BXF A;  4V2V A;  5FY8 A;  5F39 A;  5F37 A;  5IVC A;  5FZ3 A;  4EZ4 A;  4IGO A;  5IVB A;  3N9N A;  3PU3 A;  3PUR A;  5F5C A;  3DXT A;  5FY7 A;  4IGP A;  5FWJ A;  4CCK A;  3N9L A;  4QWN A;  2OQ7 A;  5FP7 A;  2WWU A;  4XDO A;  5F2W A;  5FZO B;  5FZA A;  5FP8 A;  3UYJ A;  5F32 A;  4EYU A;  3U4S A;  5FV3 A;  4UF0 A;  5FPV A;  5FZ4 A;  5F2S A;  2YU1 A;  4HOO A;  5IVY A;  4AAP A;  5FZ8 A;  2YBP A;  5K4L A;  3AVR A;  2W2I A;  5A1F A;  5FY9 A;  5FYV A;  5A3W A;  5A7W B;  5ANQ A;  3N9Q A;  2YPD A;  3AL5 A;  5FZL A;  5F5A A;  5A7P A;  5FYT A;  5CEH A;  4QXC A;  4HON A;  3N9M A;  4URA A;  3AL6 A;  3LD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...