2VD7A

Crystal structure of jmjd2a complexed with inhibitor pyridine-2,4- dicarboxylic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
350
structure length
350
Chain Sequence
ETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JMJC DOMAIN-CONTAINING HISTONE DEMETHYLATION PROTEIN 3A
publication title Inhibitor scaffolds for 2-oxoglutarate-dependent histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 107
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2vd7A01
3K3OA 4QX8A 5IVEA 5FJHA 4CCJA 3KV9A 3K2OA 5FZ6A 5FZ8A 4D6QA 5FZCA 5IW0A 4GJYA 4CSWA 5E6HA 3PUSA 4Y3OA 5ANQA 5F3GA 5FZ4A 5IVYA 4IGPA 3LD8A 2VD7A 5FP9A 4EZHA 3KV6A 5A7QA 5A3TA 3RVHA 5ISLA 3AVSA 5IVCA 5FY7A 5A3WA 4V2VA 5FJKA 3DXUA 4UF0A 5FYUA 5FZ7A 2OQ7A 3PUQA 4LIVA 3N9QA 5FYTA 4EYUA 5FWJA 5K4LA 5IVVA 3KVAA 4IGOA 4XDOA 5A7NA 5A3PA 3KV4A 5F32A 5FY8A 5F3EA 4NUBA 2YU2A 5FXVA 4QXHA 3AVRA 5FY5A 4URAA 5FP8A 5A80A 3U4SA 2YBKA 3PDQA 3AL5A 5FZHA 5FY9A 5KR7A 4QX7A 5FZAA 5FYZA 4BXFA 5FYCA 4LITA 5FUPA 4DO0A 2GP5A 4Y33A 2WWUA 5FZ1A 5A7PA 3U78A 4LIUA 4D6RA 5LY1A 5FZGA 5LW9A 4C8DA 4D6SA 2OX0A 4TN7A 5F5IA 5FUNA 4HOOA 5F5CA 2PXJA 2YU1A 5FXWA 4CUGA 3ZPOA 5FZOB 3KV5A 3N9LA 5FY0A 2YPDA 4CCLA 4HONA 4XDPA 5F2WA 3N9MA 5FPBA 4CCKA 4BISA 5FZ0A 2Q8CA 5FYBA 3NJYA 5FPVA 3UYJA 5A1FA 2OS2A 3LDBA 5IWFA 2YBPA 5FZFA 3ZLIA 2WWJA 4V2WA 5FZOA 3DXTA 5A7WB 4CCOA 5FPLA 5FZKA 3PU3A 4QWNA 4AAPA 3AL6A 5FYIA 2OQ6A 5A1LA 2XXZA 2XUEA 4AI9A 5CEHA 5FZDA 5FP4A 5FBJA 4CCMA 5F5AA 5FP7A 5FPAA 3KVBA 1VRBA 5FWEA 4BU2A 5A7WA 5FV3A 4DIQA 3N9OA 3PU8A 3OPWA 4ASKA 5IVBA 4LXLA 5FZEA 5A7OA 5FYYA 3N9PA 5FZIA 5FY4A 4GAZA 2Q8EA 5FZBA 2XDVA 5FZ9A 5FZ3A 2P5BA 2OT7A 4IGQA 4UF0B 5FXZA 4EZ4A 5F39A 3K3NA 5F3CA 4QXCA 2XMLA 5FYHA 5FYSA 5IVFA 2Q8DA 5FPUA 2GP3A 4QU1A 4Y4RA 5FP3A 3PURA 4GD4A 5F3IA 4CCNA 3PTRB 5LWBA 2YBSA 3OPTA 3PUAA 5FYMA 5FXXA 5IVJA 5F37A 5F2SA 5LY2A 5FYVA 4QXBA 4E4HA 4GJZA 3N9NA 5FY1A 5FZLA 5A3NA 2W2IA 5A7SA 5FZMA
chains in the Genus database with same CATH superfamily
1OKOA 4PIYA 3AMMA 4YNIA 5IK5A 2WNEA 2JG8B 4XDQA 1X9PA 2IXCA 4Q29A 2RG4A 5FZCA 3OY8B 1ENRA 3VD9A 3VL9A 4A7KA 2WBKA 3AFGA 1HN1A 2H6CA 4FBFA 5DAWA 3V65A 1DGRN 5F3GA 2P6HA 2VD7A 5LA1A 4IEVA 4JAAA 1CX1A 3CO2A 3A0KA 4XUQA 1W0NA 3K51A 1CQ9A 1NX9A 5C4WB 2VZSA 1NQJA 1YCIA 5FZ7A 4XZPA 3JUUA 1A8MA 1LR5A 1LEMA 1OVPA 1Z0HA 2HWE1 2JDNA 2XWJB 2WQ8A 2YMZA 4ISRA 4KGGA 2VXRA 2TBVA 3AXEA 4IEPA 3WCSA 3ZX7A 4N9IA 1H4HA 3H50A 3VN4A 1M06G 4XXPA 1DLCA 2WT1A 1HJFA 5FXVA 1CAXB 5LK5A 2BGCA 2ZGMA 3VBFC 2VBPA 1YUDA 4IV1C 2YBKA 4XXAA 1W2NA 5A33B 1QXRA 2HWE3 2RS11 1CAUA 3OGGA 4C90A 3O1UA 1O3SA 1YO8A 5J7MA 1CZVA 1NY72 3PL0A 3WSOA 2VVFA 3UETA 5GZCA 1WLWA 2VQTA 1UX7A 3KSCA 4UW3A 4LQRA 2RDNA 3JD72 2B9VA 2RS13 3HNBM 3FBYA 3ZN4A 5F5IA 3A4UA 2C4XA 4LHSA 1CWPA 1H6YA 2OUHA 1QJU2 5HBAA 1O3QA 2HEWF 2W91A 2W1WA 2XL9A 3ZIXA 3RZLA 2DUPA 1LB2A 2HWC1 2W08A 3VBHA 4Z8BA 2D7FA 3UJQA 1H2LA 2W46A 1SFPA 4V1PA 1PGL1 1LOFA 2VOWA 3VBSB 1OQ1A 1W06A 4K1YA 4DB5A 1Y9GA 5LBFA 3TNQA 4XHBA 1O4TA 3S7IA 4D94A 4PCRA 3WHUA 2HWC3 4QDRA 5A3UA 3N7MA 4GB32 2JG9C 5FMOL 5ACA2 4ONUA 2NMOA 3I2JA 1BQPA 4CU6A 1CAXA 5HCBA 2JWPA 3S7EA 5A7WA 4Q4Y2 3C7OA 5JXJA 4AXOA 4Z92B 2XJTA 4AHWA 5IK8A 4WM8B 4XF0A 2JKBA 4LK6A 5K0UC 3DYMA 1OVSA 2HEVF 1AR71 4WBBA 5GLVA 1G9BA 1A34A 5FZ9A 2VOTA 1ZZ8A 4COYA 3SLIA 4R9AA 4URTA 1BK0A 5A3LA 1YNAA 2UWBA 2FDGA 3LOIA 5IK7A 2FDHA 1LULA 1SLCA 1AR73 4R8HA 3SQOA 5FP3A 1NZIA 3VHPA 2LW8A 2XONA 3EJKA 1LGBA 2K2SA 2O1QA 3M70A 3PJYA 5JXHA 1XYOA 2VE1A 3HQUA 3VBSA 2VBDA 1YFUA 2WN3A 1Q8SA 3WOGA 3WZ1A 1DG6A 3GZAA 4IEQA 4CZSA 5C7GA 4OHYA 3R05A 3GZEA 4B4PA 5J1XA 1XNKA 1VPHA 3B93A 2Y6LA 4CEYC 1UZWA 4FT8A 5FIXA 3MI8A 1ND3C 1UQXA 3GJAA 1G9AA 2GNDA 3ASIA 4R9BA 1PX4A 3O1SA 4M01A 2HWE2 1F35A 4F7ZA 3S57A 2XVKA 1GOFA 1HRI1 5J96B 1CPNA 1NCRB 4WM8A 1Y9MA 3ZYFA 5K8SA 1E5IA 3FX3A 4PDWC 3O1RA 2AZ5A 3IMMA 4K1ZA 4KWKA 2RS12 1ZRCA 2TNFA 3K4AA 4IESA 4RS5B 3KS7A 1YI7A 2DU1A 3T4VA 1HRI3 4IEYA 1VALA 1OOPB 3IIAA 4GZ9A 5K4LA 4XBLA 1L7RA 2G9GA 5DUXA 3KV4A 4UFIA 4XAAA 5FY8A 1GQHA 2VL4A 4PF5A 3OD4A 1ULDA 5FY5A 4BLIA 5LBCA 4Z2AA 2PHLA 4TXWA 1REFA 4NHXA 2YC0A 2YB7A 2JJ6A 2YG0A 2OPKA 5CB7A 3V64A 2HWC2 5JR2A 1AJKA 1NA1C 1CJPA 1DYPA 1W8NA 1AYN1 4COWA 1PGL2 2R1BA 1ZBA3 4IE6A 2XBO1 1O5LA 4JC1A 1N1YA 1ULPA 4P5YA 5HI0A 1W9WA 2ZMNA 1Q3EA 4WZFA 1BVVA 5F5CA 1UZYA 4META 2P3YA 4NHLA 1BKZA 4BCUA 4YW2A 1R1ZA 2UY9A 3H8OA 4AI3A 3S0MA 1IPJA 1AYN3 2WNUA 4N53A 2RJKA 3S5QA 1NCRA 1E5SA 2XBO3 4R52A 3HN3A 4CCKA 3AZVA 3SISA 5GLUA 3WG1A 1DQ5A 3POEA 2XJRA 3LDBA 2ZGSA 2RMU1 1XU1A 2YGLA 3ILRA 4RS5A 2BFUS 3VZKA 2XG3A 5FZKA 5DG1A 1OOPA 1E5RA 4AAPA 2V4AA 3AL6A 4XJ8A 1CIWA 2WT0A 3MIDA 4A7YA 2MEV1 2LALA 1AR72 2ZBJA 4M3CE 3NNLA 4OZOA 2RMU3 3K4DA 3LFMA 1T6BX 2HWF3 1X82A 2RDQA 2BDRA 4GIQA 4LA3A 2MEV3 2NMNA 4A3XA 4QQPA 3W59A 1LESA 1UL9A 3A22A 3WDVA 4RR3C 2B39A 5T55A 5C9AC 4R4XA 5IFPA 3IAQA 2HEYF 1EV11 1G8WA 3VZMA 4LEJA 3WUCA 5LB6A 1OF4A 3WVJA 1SLAA 1XQNA 3BTZA 3TEWA 1H1IA 3C7EA 3X29B 4GD4A 1V6OA 1EV13 5C33A 2J1VA 3WG2A 1AX1A 1ODNA 2BPA2 5FYMA 4LBMA 5FMDA 3B9IA 1HDKA 5A1AA 1HKDA 1HQWA 2VZQA 3HPNA 4QXBA 4HVOA 4JQRA 3GCXA 5H9QA 4E4HA 1HRI2 3M7AA 1QQP1 1PZ7A 1S0FA 1WW6A 1YI9A 4BIOA 4CA9A 3J4UH 2Q0AA 4EWAA 3ATGA 1NAEA 3H1WA 5FJHA 4AI1A 4QPGB 5ERLA 5AVPA 3C2UA 1V00A 1W6MB 1DIWA 1AR61 2E6VA 2ZGRA 2F6BA 2B4KA 2VULA 4M4RA 1QQP3 2XL7A 2ZGKA 4JX0A 1JYTA 4ZXEA 3CNAA 4HK8A 4YPJA 3VB9A 1NZCA 4IV3C 4ZPIA 5EIYB 5JOWA 1XBFA 1O3TA 3J7NA 2VECA 4BDVB 4CDQA 2HWD1 1AR63 4XFCA 3ES1A 1ZBA2 3INAA 4NR1A 4YWAA 5A3WA 2V73A 3VKLA 3SCFA 3KLSA 4AAXA 1PNFA 5BUVA 1LU2A 3ZFFB 1V6LA 5BNOB 3DYOA 3KVAA 3MW2A 1W28A 3V0AB 4ATEA 4XDOA 2DCZA 4ZU4A 5F7UA 5A3PA 2HWD3 3H7JA 1AYN2 5J98B 4Y1ZA 3Q8AA 5F3EA 2VNVA 2XBO2 2E7TA 1KITA 3WDXA 3ZO0B 3LE0A 4E9KA 3GBFA 3WNMA 4Z1VA 1ZREA 1O4YA 4B4RA 1X8EA 2AH2A 5I0RA 5ABJB 1F15A 2XQXA 4FPJA 2KD7A 5IT6A 1NLRA 2VTXA 2NN8A 1ONAA 1ZRFA 5DAPA 5A7PA 2XHKA 3U14A 4BQXA 4QPGA 3OBZA 3ZXLA 1JZ6A 4NO4A 2RMU2 5IHRA 2WQZC 4LTAA 3RJRA 2V72A 1V9U1 1WGPA 3VD5A 2JEMA 3IN9A 2HWF2 2ZEZA 4HL0A 5FY0A 2VMHA 2Y6KA 2W94A 2MEV2 2WA3A 3L2YA 1LCLA 3B9CA 4LKSA 4YVSA 1GZWA 1YIFA 2ADDA 4G4FA 4YGBA 4D0QA 5FMBA 3VBOC 5JR7B 2D40A 4ITCA 1K5MC 1RL3A 2VG9A 3VKOA 2D3PA 1DU3D 3WLUA 1DGWA 2E31A 2VUDA 4OYUA 1ZVFA 5LASA 4JDNA 3UKVA 2WZEA 1C28A 2D6OX 4RQPB 2CNAA 2ZACA 2WAAA 2JDZA 1MACA 2WKKA 5FZDA 1JU4A 5DZEA 2Y64A 2OPWA 5E8AA 1EV12 2VMGA 5FP7A 4EQVA 2R071 2Y0IA 3FFZA 4Q0QA 3MW3A 3J7LA 3NV2A 3PLQA 4UYBA 4YFZA 2KM2A 1MS1A 1COV1 1P8JA 4MGYE 3CQOA 4W6YA 4YYOA 3T0DA 3E1F1 1DZRA 5JPNB 2WO3A 1OMIA 1W8UA 3RNSA 5FZBA 2R073 2PHWA 4CDWB 3I97A 1ULOA 1SCSA 2CWMA 2JG8C 4D7SA 2EIDA 2VZOA 1U5XA 1COV3 3K3NA 3OF1A 2Y34A 4JKMA 3TAYA 3LEKA 3A23A 3OBRA 4GH4B 1QQP2 2ZJCA 3OUHA 2V4VA 5CG9A 4KWUA 2DV9A 3FUQA 5BNNB 1UYYA 4J6GA 3PURA 1LTEA 2LRPA 3FWEA 4W4ZA 4B1LA 4GXLA 3FLRA 3PUAA 3RYKA 5FXXA 1AR62 1DFQA 5IVJA 1XRUA 4R9CA 4QHOA 5CISA 1OXCA 1WUVA 4DXRA 3UNPA 1BZWA 2L9LA 2VCCA 1MEC3 4AVVA 2VZ3A 3VDCA 2OVUA 1C4RA 2HWD2 3EHKA 5FZMA 5FO9B 4NOTA 3UGHA 2XR4A 1Z7S1 3ZDSA 4YSFA 1CZTA 4Q1PA 3WW2A 5CG8A 4YZ1A 3K2OA 4LKEA 5JOYA 1NCQB 1V0AA 3HT1A 1L7QA 1MZFA 1YEWA 2EAKA 2P6CA 4LO7A 4CSWA 1JZ4A 4GALA 3HN1A 1VBD1 4M4PA 2FDFA 3H3LA 4W50A 4AEDA 1F5JA 1IG0A 4TYSA 1Z7S3 2VH9A 2C5DA 2P3JA 3ACGA 1K5JA 3RYPA 2AGSA 4IL7A 2X8KA 5F5QA 1KEXA 2RVAA 2HYXA 3D3AA 1VBE1 3WW3A 3D82A 3NNGA 1VBD3 1XNAA 4CCEA 4GMP1 1QOOA 4LMFA 1JYWA 4XPVA 4Q0PA 4LE4A 2VNRA 2TUNA 3NAPC 3OPZA 1VBE3 3DCQA 1ENQA 5A80A 5FO7B 1TG7A 4GMP3 5FY9A 4CDXC 2VTFA 1HN0A 2JECA 5JZGC 3AYAA 5FUPA 2QVSB 4AQTA 2GP5A 2PMWB 1F8VA 1HB4A 1GWLA 3WF0A 4ISQA 1ND2B 1I3HA 4IERA 1BVP1 1U12A 3R4SA 4OVEA 5FXWA 4FFGA 1HX6A 2J42A 2R041 3KV5A 3ZMOA 3NJVA 1MS4A 3I2IA 1HW5A 4IETA 3POSA 1O3RA 2WN2A 2Z79A 1LHOA 2C26A 1DZQA 1WD4A 1F9KA 1XE0A 2R072 5FPZA 3U0ZA 1ZRRA 2R043 1W9SA 1N1SA 2YBPA 4I02A 5I93A 3ZPYA 1COV2 3NV3A 3RMXA 4OUEA 4DY3A 5L19A 3ST7A 1DQ0A 1PZ9A 3OCPA 3AMHA 4FOWA 5EXOA 2VUCA 1AZDA 3AMPA 3WINE 1QOTA 5FKCA 3CJIA 4RD7A 2I74A 4FOQA 4XMAA 3MZHA 2TEPA 5FV3A 4BQ5A 5DUUA 1W6NB 1W8TA 4LBJA 5GM0A 4XCAA 3EQEA 2VZPA 5IVBA 5IJRA 3WQ1A 3ZXEA 3MO4A 1MQTA 4LBQB 5FZ3A 1HJGA 3BALA 3AMQA 1N3PA 4LO5B 4AEJA 4NPMA 2VTXJ 3T2TA 1WD3A 2ZGQA 4LBQD 1PVXA 5F9TA 1IG3A 4NAMA 1UPSA 5K0UA 4CPBA 5FYSA 1WMDA 5BNQA 2DF7A 2BOJA 3I2GA 3AFKA 4QU1A 4Y4RA 5EJ1B 4B7EA 1Z7S2 4UFKA 3MPPG 3ZXFA 5C8CA 1VE0A 2ZGNA 5KHIA 2A3XA 5F37A 2YROA 3GZTB 3IDCB 2VOKA 4LBLA 4PF1A 1VBD2 5CFCA 3VHRA 2WFF3 3AP7A 1QJX1 2JE9A 3KMHA 1UF2C 1FV3A 2IXJA 2GN7A 1UD1A 2ZA9A 1VBE2 4XUOA 2JKXA 1MPXA 4XACA 4XFIA 2WSVA 4JHZA 5D8AA 1HIXA 4LPLA 3FL7A 2X05A 4ASLA 4BE3A 1NXMA 1W6OB 1QJX3 4FPHA 3BTAA 2RS51 4IEOA 1ACCA 2F4LA 4XAEA 4GQ7A 2ZX3A 2GC0A 2QQLA 4CEYA 3LD8A 3T30A 1QNWA 1ULCA 4LBQA 3O1OA 5EWSA 5CU1A 3AKTA 5A32B 5IAXA 2JX9A 2KR2A 2RS53 2WL1A 1US3A 4NAOA 4FCAA 1K3IA 2YFZA 3VHOA 1OT5A 1RITA 5JOXA 2Y6JA 2ZEYA 3OOXA 1QH7A 3D4KA 1VBB1 1UO9A 4GKYA 3VDBA 4CEWC 3VBUB 1UWWA 2R042 4MO3M 4HVQA 4D8MA 4IEXA 4S2GA 1Y4WA 2W39A 4RGGA 3USUB 1LOAA 2W92A 3LQCA 5L7OB 1VBB3 3HIFA 3VV1A 3WG4A 1MVQA 1OPOA 3DPRA 1OQEA 3WXPA 3ZSKA 3ZN6A 4CP2A 4D6RA 4YZ2A 5LY1A 1YLLA 4R9DA 1YYNA 1OA2A 2D5FA 2D98A 1UMZA 4DFSA 4BMBA 1NA1A 1GR3A 4Y22A 2BV4A 1W6QA 1J3PA 5J48A 3ZYRA 1O8SA 1QWRA 5A1FA 4GKXA 2IVIB 3KGLA 4M3CF 1VLNA 4XQ4A 5KHJA 1JYNA 2GC3A 5T5LA 1ULFA 1WA4A 3ACHA 3RWKX 3BTYA 3DXTA 2WDBA 3UT0A 3OSDA 1KJRA 4RHV1 3WP3A 1ZNPA 3ACFA 3IPVB 4FPGA 4WM7C 4H3WA 2Y60A 5A1LA 1I6XA 5T52A 5EP9A 2VAUA 3I3MA 2RJ2A 2ORXA 3ZFGB 1W9TA 2BWAA 2JB4A 4AI0A 1LNSA 5CYYA 1RB8G 2ARCA 1H2MA 4RHV3 2VZUA 1O91A 2E63A 3B5LB 5LZ6A 3FC0A 3ZYPA 2GSYA 1VP6A 3UV9A 4FAHA 3PUHA 4YW3A 5T5PA 4MYEA 3CU7A 4H55A 5M0TA 2BEOA 1WCSA 2WFF2 4WVMA 4YM3A 4RL7A 2VC9A 3N7LA 2XLGA 1JUIA 4NRMA 1G7YA 3B00A 3NSTA 4IGQA 1KFUL 4OI2A 3WQBA 5E89A 1UY2A 2UURA 3KF5A 1JZ3A 1VBA1 1QJX2 5IVFA 1YC61 1GOHA 1OKQA 5DUWA 4ET7A 2H6BA 1GZ9A 2ERFA 2J1RA 1AJOA 1UOJA 4UW4A 2XJUA 4HSLA 2QQOA 1J3RA 3R0RA 4UBHA 2XPJA 1RXGA 5F6LB 1VBA3 1VMHA 1W8ZA 5LY2A 3ZFFC 4XJ9A 5BNOC 2RS52 3JB8A 4RGKA 1WZXA 4RA0A 1XNBA 4BA6A 3MFAA 3ZXDA 4QB2A 2E51A 4HSJA 3K3OA 4QX8A 4F83A 5ACA1 5IVEA 5KC5A 2GC2A 3RDIA 4HKWA 4MLOA 3RQ0A 5FOBB 4MOAA 3I8TA 4P9GA 1R083 4JCKA 1W2OA 5CFDC 5L9VA 3H0OA 5DXDA 1TQ5A 1HQNA 4LBKA 5H9RA 2Z4FA 1C5IA 3GZUC 2ZHLA 2WAOA 2WC2A 4IGPA 3VKMA 1OH3A 4B29A 4CVUA 1VBB2 2XB6C 4EN9B 1JI6A 4ARYA 2W1UA 4BWOA 2YDEA 3KHBA 4KBBA 1RUNA 1VRH1 3LIGA 1CAUB 3P3PA 4MGSA 5IYYA 4XILA 2W3JA 2R32A 4CYDA 1D4M1 5BNPA 2OW4A 4MADA 1RUC1 4PLMA 4TLFA 3MHZA 3EMRA 3ZSMA 1VRH3 2MHFA 2RDSA 2VW2A 1ZZ7A 3GDBA 1D4M3 4K8FA 3OYWA 4DXTA 1GICA 2WJSA 3MDPA 3VKNA 3CF6E 1RUC3 2RDRA 3ZSLA 1V6NA 1MS8A 1W8FA 2V09A 4FPEA 4PBPA 2DFBA 4RQPC 4Y33A 3VBHB 4EN8B 2JICA 2I07B 3BCWA 1O5UA 4PLNA 4NIGA 2GNTA 3H8UA 4JDOA 4OQ9A 4MXWA 2W5FA 4JV4A 4RHV2 1OLQA 4OMDA 1K42A 1ODMA 1DZTA 2ES3A 3BPZA 4XHXA 4EWEA 1J1LA 1YHFA 2PA7A 1I1EA 4W6XA 1U0AA 2O8QA 2UWAA 1H8TA 5LATA 4I30A 1JYXA 2NZ9A 3O12A 5LK7B 4ZU7A 5IAVA 2I2SA 2UYAA 2BZDA 1D7PM 1SLTA 2PFWA 5A7WB 4X8NA 5FAXA 5IATA 4ZZ5A 3TEZA 4DMIA 3WHTA 4JKKA 3ME2A 1R093 4AVAA 1B35B 2CV6A 4AHZA 3AP9A 4CRQA 4DEQA 5CEHA 4R4ZA 5I0SA 3WD5A 2JIJA 1YQ2A 4IE7A 3NV1A 1ALYA 4NMIA 4UBGA 1POQA 1UZVA 2V5YA 4BU2A 1DQ2A 1K12A 3UESA 1UMIA 1GOGA 3HQXA 1VBA2 2B5HA 2EALA 3LCPA 1W2TA 2C9AA 3E6DA 3BTXA 2WRAA 3S30A 3LGRA 2FDJA 3DN7A 4CXWA 4BIFA 4OHVA 1EPZA 2H0VA 2IVJA 3ECQA 4L0PA 1IPSA 4TLGA 1W2AX 3W9AA 3KZ4C 1LENA 1UZZA 4LJHA 5DZGA 5JSRA 1H4GA 4YG3A 4BZ4A 1R082 5HCAA 3FBMA 3KT7A 4NPLA 3VBRC 2GP3A 4Q1RA 2A7AA 5F3IA 1W9YA 1YJKA 3T08A 3H8RA 1VMFA 3LAGA 5FDBA 2FDIA 2BVBA 1B09A 1TME1 2OIIA 3EB7A 5A7SA 2FHRA 1B35A 4YRDA 1WA6X 4E8DA 1HRV1 2DCKA 4CCJA 1V6MA 3NO8A 4K20A 4XJWA 2WNVC 2ZX4A 5JMCA 3I3EA 4YVWC 2HBUA 1SHWB 1VRH2 1W05A 4QM9A 4Z07A 1W8WA 3M1HA 1UNBA 1UU4A 4XF3A 4M3CB 4UOJA 1TME3 2J22A 4IW3A 1D4M2 4IE4A 3PUSA 3ROUA 1HQLA 3WNOA 1HRV3 1TZOA 1RUC2 3BPSA 2G9ZA 1LRHA 1OQDA 3SH5A 4Q4V1 5A7QA 4EZHA 2G19A 1OPMA 4XFBA 3HVDA 1X50A 4HZFA 5JLVA 5F6KA 5FYTA 3GYDA 5FBZA 2W95A 2BFUL 2IFRA 2ZX2A 3BVCA 4WVWA 4Y5SA 4LHLA 4UT5A 4Z82A 4Q4V3 1RUG3 3C3VA 1YQ5A 2PHTA 2Z69A 3GM8A 4NWWA 4XUTA 2C9KA 3QOPA 4Y4YA 3RSJA 2JE7A 2W9XA 2B7YA 3NKTA 3TWIA 5FP8A 4LO4B 2K0GA 2EF6A 3ZXJA 4CDUA 2ZMLA 3CHXA 1UCXA 3I4IA 3VZLA 2VOVA 3NAPA 4NHMA 1QJY1 2WNUB 4O7XA 3BU0A 4N53B 2VO5A 2NYYA 5FZ1A 2WSUA 1R092 4YG0A 2WYFA 1H6XA 2IC1A 1BLZA 1S55A 1G86A 4TN7A 2BNNA 2IXIA 4QB6A 1EPWA 5JZGA 1QJY3 2KXLA 3D0JA 4M3CA 3FHQA 1O4ZA 1RC6A 4K8RB 4P9IA 3N9MA 1EUUA 4GULA 4HKLA 1SQ4A 5E88A 4OI1A 4LE3A 4YW1A 3ETQA 4FOYA 3AKPA 5AFEA 4GWIA 4N7UA 1W2UA 4PQ9A 2AUYA 2WWJA 1GFF2 1V6IA 1ZBA1 1SFYA 1W04A 2R6QA 4E2SA 3R6SA 4QHBA 4JGZC 4BK5A 4LUKA 5G05L 3I59A 2DWRA 2WS91 4CCCA 3WEZA 1F4HA 4SLIA 3FMGA 5FP4A 1ENXA 1OFNA 2LTNA 2Y26A 1YRZA 3I2DA 5DZFA 3PMSA 4CCMA 3RZJA 1YFYA 1RUF1 4XF1A 4JGYC 1J1TA 3WNPA 3OBAA 3WW4A 5LA9A 1DF0A 1VAMA 4M00A 1AF9A 1LHVA 2P4EA 2WS93 5FLIA 1UYPA 5FMOS 3L2HA 5D2AA 5LBEA 4XJUA 5HXVA 4ASKA 5KHHA 2PHXA 1RUF3 3IAPA 3LZZA 1DQ1A 1PHMA 2ZHMA 4QPWA 4FTEA 3APBA 4UF0B 4QPIB 3WF1A 1C3HA 1DYKA 2DBNA 4EZ4A 4QXCA 3PJQA 5JI9A 4P9LA 1IHMA 1O7FA 1PK6B 2RR11 1TME2 2AREA 1SPPA 2HWF1 4HT1T 1OD5A 3BKZA 4OUMA 2QE3A 2NQYA 1HRV2 2FZ1A 4FPCA 1Y9QA 4NVPA 4QMAA 5JCTA 3W5NA 5CKQA 4DINB 3NJZA 4O9EA 2R30A 3AXDA 2ARAA 5A6YA 2RR13 2BUKA 3FLPA 2DTWA 4KG0A 3ZN5A 1VB4A 3POGA 3RS6A 5C8WA 1KDKA 4G9SB 3UK9A 4Q4V2 2EICA 1QH6A 2BBAA 3S5AA 4CDQB 3I49A 1QXPA 3NV4A 1IS4A 1GQGA 1ZM1A 3VBUC 2AR6A 3WP5A 3WDWA 1DBNA 5GLZA 4BJ0A 5CBLA 1EP0A 4NJ4A 4AG4A 5C70A 1AYM1 1EYBA 1DP0A 3ES4A 2ZPXA 2XQRA 1Q8PA 5FZ4A 5L7OC 3TEYA 2BW8A 1BJQA 3RVHA 1DYOA 5GALA 1KGYA 4E8CA 2FDKA 3MLLA 4UF0A 4QPIA 2SLIA 3D5OA 1AYM3 1GWMA 5K9YA 4QX5A 1PZ8A 5DAXA 4P5HA 3MV11 1QJY2 1PK6A 5JIUA 5J37A 3ILFA 1U5YA 2OA2A 1JBCA 3QCWA 4XE9A 4B3NA 1YFWA 1JYVA 3AVRA 2OXBA 2X10A 1XB9A 3V0BA 1GNZA 4PHZA 1JH5A 4OQ8A 4QX7A 1Q8QA 2GN3A 1C57A 4XBNA 3UL2A 5C3RA 3I3BA 2D6NA 5FUIA 4KQ7A 2W68A 4YVSB 1GZWB 3U78A 3ZFGC 4PLOA 4INDA 1E57A 2PXJA 3KCCA 2VCMA 2XKPA 1RMU1 1GMMA 2GNMA 2BNMA 1LKNA 1OUXA 4YGEA 4CP9A 4HONA 2WS92 4XABA 1QKQA 2VUAA 3WF2A 2XVGA 2PQQA 1KDMA 2G9FA 4OFGA 4C1WA 1FAYA 3ZMNA 1BHGA 4OCTA 1AXYA 1RUF2 1FNZA 2JENA 3ZKYA 2OS2A 4TTGA 5FPXA 1RMU3 1ZA4A 3ZLIA 4OI0A 2A73B 3NMBA 2VW0A 4ARXA 3MEPA 3ZR6A 3WQ0A 4MGTA 3PU3A 3RI9A 2JD9A 4QWNA 3U10A 3QD6A 1SLLA 1VAKA 5EPAA 4DUXA 4GMP0 3PVBB 2QJVA 3IDBB 3IDAA 2MNGA 2WZPP 4FSJA 4JRAA 1LODA 4LK7A 3K77A 4KL1A 2WO2A 4FP3A 4D7TA 2D43A 2R061 5CZKA 3BIEA 4XTMA 4ZXKA 2RR12 3FLTA 1YJLA 3WDTA 1I5ZA 4XOGA 3BOPA 1BEV1 2AYHA 4P00B 4QQLA 3ZFEC 2R063 5FOJB 5JSOA 4KGQA 2OT7A 4UW6A 3BOWA 4MHUA 4NHKA 4DOUA 1AL21 5A70A 5LCWL 2B45X 4N43A 1BEV3 2HYKA 5FYHA 1K45A 2ATFA 3QACA 1TMF3 3CEWA 3KT1A 4LKFA 3HT2A 3B7MA 2JDMA 1STMA 1RHI3 4XUNA 4ZZ8A 4ZHNA 4QQ2A 3RZGA 1CAVB 1OH4A 1AL23 2PELA 2I45A 1S0IA 1GP6A 2D6KA 3BI3A 3AP4A 3K48A 1LOGA 5GLTA 1AYM2 2BGPA 2QNKA 1J58A 4IEZA 4YG6A 4YW6A 3VDDA 1AR83 1LOBA 4BB3A 4AR2A 4GWNA 1QXJA 1W0OA 2HBTA 5A3NA 5JWPA 4AEDB 2WZ8A 3GBGA 2A5ZA 1KXGA 2ZZJA 2Y6GA 4BOWA 1ZX5A 3MF9A 1WCUA 3AZWA 3F95A 4AFCA 2HKXA 1UZ0A 2FCUA 2EVXA 4A41A 4CTEA 4CUCA 2CY6A 5B2GB 3LA3A 5L36A 1EUTA 4XIOA 2NM1A 3LWCA 2Y8KA 3P6BA 4DXZA 3H3UA 5FRAA 4Y20B 1RTVA 2A6YA 4W6WA 2DBIA 4LO6B 2IUWA 1MEC1 4XVHA 5BPXA 3VBHC 1UPIA 1OF3A 2ZGPA 2Q5TA 1LOFC 2A6XA 3LEIA 5FWJA 2DFCA 3SCGA 5C4WC 2E53A 5FO8B 5JSPA 3HR9A 4LNVA 4AEMA 2X5IA 4YW4A 5IUQA 2CU5A 1VR3A 2CGPA 4JQTA 3ZYBA 2JDHA 4BXSV 1UIJA 2XH6A 4RFT0 1CAVA 1LAJA 5FZHA 1OC1A 5I0TA 1RMU2 5FQ0A 1UKGA 2VZ1A 1MS9A 3POFA 3PNAA 4LITA 1W6PA 4QX2A 1SDWA 3OEAA 5FKBA 3GF6A 3WP6A 3I54A 3L9JT 1JS9A 3CZUA 4QAWA 3CZJA 4XTPA 2PN5A 3O7OA 4UWDA 2LM3A 5KXEA 4HOOA 3OTFA 1JOPA 5DAVA 5JIAA 1N3OA 1UN1A 4I09A 2VMIA 3AM2A 2FMYA 1JMUB 4K40A 4LORA 4OLLA 4P08A 3VHNA 4Y20A 4LKDA 5EJZB 1W03A 3CJIB 1XNTA 4TSVA 2R062 2XOMA 1N1VA 1XYNA 2LROA 5HV4A 1ZA7A 1RUI1 2J1EA 3VBSC 4CCOA 1MZ6A 4KBZA 3SXWA 1FMD1 2W1SA 5DG2A 4D7YA 4NIDA 3FZ3A 4DQAA 1BEV2 2ZCWA 4D69A 2AENA 2XXZA 1WW5A 1QU0A 1CN1A 3BGAA 3VBFA 4CU7A 2ENRA 1MQTB 2AC1A 4C0BA 4UAPA 4IV1A 1RUI3 1RHI2 2ILMA 4BM8A 3DEMA 4NWVA 1FMD3 1F31A 2IXKA 1AL22 3G7DA 2ZHKA 3VD3A 4NIHA 2PHFA 5K0UB 2ZHNA 5A7OA 4P9WA 3UKTA 4WM8C 1SLBA 3NNFA 4FO9A 4A6OA 1S0GA 1GZCA 2QQKA 5T50A 5C8CB 5C5TA 5FXZA 4CPBD 5GZFA 1SBFA 2FQPA 4O65A 2XGXA 2GZWA 3NNJA 5I0UA 5CFCB 2QTWB 1DGLA 5AFBA 2Q8DA 3T3YA 2NPIA 5E1RA 5JXIA 4QHZA 2GMEA 4Z2WA 1FNYA 4LBNA 4XFFA 1YQCA 4ORFA 5A6XA 4KH9A 2A75A 4A3ZA 1ASJ1 3BIWE 5LEJA 5D8AB 1IS6A 1H8VA 2IZWA 2XHNA 1CX4A 4FPLA 1PGSA 3T4HB 5FY1A 3VBRA 3J26N 2JG9A 3AKSA 2Z2SB 4L2NA 4JKLA 1MEC2 2X29A 4A45A 4CEYB 1ASJ3 1GNYA 1S0EA 1O6UA 1CJDA 1JHJA 4LT5A 1SEFA 1ZRIA 3MF6A 4AVCA 4E4ZA 1IS3A 1JHNA 1AR93 3FHAA 4L92A 3O5SA 3KM5A 4B8EA 1CONA 2FCTA 1BXHA 3W20A 2CAUA 3NNMA 2GU9A 1SBDA 3FN9A 3ZVXA 2QDRA 2WNUC 4PDWB 4N53C 1NCRC 3DYPA 5CNAA 2YZ4A 1W90A 2WFF1 5A6ZA 5IVCA 3GCWA 4V2VA 4XFAA 5KC6A 3OBTA 3AZYA 4BQ4A 4LIVA 3ZYIB 3N9QA 4ES8A 1N1TA 2XWBB 4RS5C 2O8OA 3AP6A 1OOPC 2PAEA 2VM9A 1VIWB 4Y24A 4N7IA 4B7KA 3DPRB 2EXHA 2IXLA 3OUIA 4RGAA 3ZN6B 3U4SA 4CXXA 3N36A 4MHRA 3IKWA 4OMCA 4YW5A 1S4CA 3VZOA 5KR7A 5FYZA 4Q8KA 2WWSA 1NA1B 2YV8A 4Y22B 3RPQA 2J7MA 3NRUA 1XJAA 1WMFA 4HN0A 1POV1 5FK8A 2Y0OA 2JDKA 1W6QB 3LPGA 3AC0A 4LIUA 3VDAA 5I8YA 1XE7A 1IQAA 3BYWA 2PHUA 4HPKA 1CR7A 4HXCA 1ND3A 3AJYA 2VZRA 1RUI2 4EN0A 2P3KA 4AFDA 1H30A 2YU1A 1NE4A 1FMD2 1W8OA 2P2KA 3ZPOA 4LLFA 4CUGA 3N9LA 1POV3 1SMVA 2D5HA 1QNYA 4XJAA 4PDWA 4S2HA 3RZKA 4QU2A 4AGRA 1SBEA 4WV8A 4DY5A 3C7FA 4CP1A 1W99A 3SEEA 1CIYA 4J1WA 5T3NA 2K9ZA 1FXZA 1H1AA 1PM7A 1FYUA 1REEA 2DVDA 1UAIA 5FZOA 4M0NA 3HQRA 4UFMA 3I3DA 4LULA 3I2HA 5BYNA 1KD7A 2XUEA 3IDEA 4WVMB 1YQ8A 3ETPA 1CAWA 4IEUA 4LLOA 1H2NA 2P34A 3TN91 4XF4A 2R0FA 3N9OA 1C8M1 3JQXA 1MR5A 3BU7A 2GMMA 3I2OA 3IZOA 4MV2A 4RR3B 2VMDA 1PO11 2BRTA 1OA4A 4KU8A 4QGLA 4JGYA 4CDQC 3B3QE 3TN93 1ASJ2 4I0BA 1S2BA 3P3NA 2BWCA 1C8M3 1UY1A 1TVGA 5CIRA 3TNPB 4DUWA 5LW9A 4FXKB 1G9FA 2ZS6B 3IT8A 4JTNA 4ZU5A 2WIIB 5HPOA 1JW6A 2XMLA 1PO13 1NG0A 3AYCA 4FFFA 3RRDA 5JUVA 2J1TA 2Q1ZB 3ON7A 1SDDB 2GAUA 1S2KA 1FI2A 3DGTA 3E97A 4PBOA 4BQWA 5DUVA 4BQ3A 3HOBA 2SBAA 1GYKA 1MS5A 2BGOA 3QH6A 5F2SA 2DVFA 2XUMA 4QX0A 4QPYA 1W39A 4GJZA 4C0HA 3OEBA 5FREA 5FK7A 2ZTNA 3CLPA 2DTYA 3ZYHA 2QBXA 3ZXGA 1ZZCA 2Y6HA 2H0BA 3DUIA 1OFSA 3KV9A 3Q8FA 3CL1A 4QPGC 3FUOA 2XLFA 5FZ6A 3U4XA 2A3WA 3I3QA 1GQPA 3ZM8A 5IW0A 4GJYA 1XOYA 4IV3B 4KG8A 3VD4A 3KD4A 2W52A 1PMHX 1UW8A 1WMXA 5BNPB 3IB3A 4FQ4A 1UYXA 4RR3A 2B42B 5C9AA 5ISLA 1DQ4A 1JZ8A 4RYDA 4AHYA 1GV9A 3E5QA 3M4FA 5FJKA 1OLRA 4TWTA 1RUJ1 1QF3A 2B8MA 3MIBA 2BU9A 1LOCA 4GWJA 3OYWB 4IGOA 5GZGA 2DCTA 2JDUA 2A3YA 3AYEA 2RJLA 1O59A 1R081 3H3ZA 4GA9A 4C91A 1APNA 1QIQA 4N8MA 2ADEA 3MW4A 2C0ZA 1CGPA 3LSDA 1RGSA 1RUJ3 3POIA 4EWDA 3AJZA 3SHRA 1ZYBA 2E32A 5DQ0A 2O0OA 3D8CA 1KS5A 1S2EA 2G4IA 3PMEA 4MXWB 4PIXA 1UOFA 5ABJC 2RV9A 2WLPA 2A70A 3USSA 1SFNA 5HXMA 2WWUA 3RJ2X 2DUQA 3DKQA 3QBQA 3SH4A 3Q8CA 1H8TB 3DECA 1E5HA 4PIZA 3POWA 4D6SA 3AYDA 5DABA 3O1TA 1V6JA 4UI9L 4B1MA 2Z5WA 3RYRA 1XSQA 4IV3A 5F2WA 3WT3A 3M2MA 2ZGOA 3VBOB 4QDQA 4WVVA 2JXAA 1K5MB 2Q8CA 4Q0SA 4NIIA 3NJYA 2YC2A 1F4AA 5FLJA 1OA3A 3AKQA 3MGUA 1RUD1 3HEIA 4L9BA 5FZFA 2JE8A 3TN92 1C8M2 5FPLA 1RIRA 1VBC1 3NQHA 3O14A 4ZS3A 5SV5A 3MICA 2P1BA 1A78A 2EIBA 3CKHA 3IIIA 3MYXA 1PO12 4P9YA 1Q8OA 2CAVA 2QQPA 4Q26A 3VUOA 2CGOA 5EFUA 1RUD3 4X8PA 3BODA 4Y5Z0 1VBC3 2D3SA 3BB6A 1OLME 2ARBA 4HBNA 4QDSA 2WLQA 3SC7X 4EROA 4KI5M 2B46X 3PU8A 3EBRA 2AEYA 3O0XA 3VD7A 2X09A 5FYYA 5FZIA 5I8SA 2D3RA 4GAZA 5L9RA 3MIEA 4XC9A 1H0BA 1MS0A 1VJ2A 4AEDC 4AZZA 1GLHA 2FD8A 4J25A 4AYUA 1R091 1WLCA 2UY8A 1REDA 4CDWC 1JN2P 4AI2A 2PAKA 4CU8A 3T2QA 2D6LX 4XJZA 3MIFA 3M3IA 3WUDA 4I01A 1AXKA 2QZ3A 2IFWA 3MLKA 4GH4C 4KMQA 3ZFEA 1RJ7A 1X33A 3VBOA 4YLZA 4IE5A 4YW7A 1K5MA 3I2FA 5BNNC 1G6NA 1VMJA 2C6SA 3MUZ1 1DCSA 3RI8A 1GSLA 3H1YA 1JYIA 1KQRA 1UOGA 4ASMB 5FYVA 3KF3A 4AOCA 1YWKA 2VZTA 3N9NA 1RINA 2DVBA 3IWZA 2X53S 4J1XA 2EA7A 4MSVA 5SV8A 2QQUA 1UXZA 3PIJA 2V5DA 2GMPA 2JIGA 1RUJ2 4DRVA 4ZS2A 2DVAA 3LDKA 3H1MA 5FZ8A 4F8AA 4OHZA 1MVEA 1J84A 4OULA 4JRLA 1NCQC 3UGFA 5F1RA 3E5UA 2OUJA 2O14A 1IOAA 5ANQA 4XZUG 2ZOEB 4QM8A 2WYSA 3ELNA 1X7NA 3KV6A 2DCJA 1C1FA 2JG8A 3T0AA 1D2SA 4JZRA 5FY7A 4ZKTB 1BK1A 1CZSA 1DDLA 2P17A 3PUQA 4NHYA 3OY8A 4CDUB 4BHPA 1OBNA 1GZTA 2Q30A 5A7NA 3B69A 1PM4A 3OGVA 3NAPB 5GJ6A 2BOIA 2BBVA 2EAAA 1CESA 2YU2A 1LJ7A 1UOBA 3WY6A 1I5PA 4P02B 1BYHA 4XMIA 1QJEA 3CJIC 3G6JB 1QDCA 4WZCA 5FCCA 5C4WA 4AF9A 3E6CC 2HWB1 4CDXB 3MFCA 3OD0A 1NYWA 4BXFA 1QJZA 2CDPA 3R4DB 4AGGA 2DURA 5JZGB 3ACIA 2ZGUA 4JTOA 2FMDA 4BLJA 4H7MA 4DO0A 2HJIA 2D44A 1R64A 4Q0VA 2EXKA 1MQTC 2HWB3 3KCXA 1JUHA 1RUG1 4AFAA 4C8DA 4HMZA 1U5IA 1HXS1 1ND2C 1RUD2 3PUIA 5A33A 2RS31 4LBOA 1VBC2 3O1PA 1HB2A 1IKQA 2ZKLA 1GP4A 1GP5A 4IDZA 2CTVA 1UYZA 1WWYA 2GH2A 2CGNA 5JPMB 1LHNA 2EIGA 3I59B 3MIHA 3ORJA 1FATA 1HXS3 4FQZA 3FHIB 3FJSA 4DZGA 3AK0A 3F2ZA 2RS33 3KCYA 4MGKE 5C6CA 5C8CC 4MZUA 4MG2A 3LPFA 1VB2A 4LOTA 4V2WA 4FFHA 2CDOA 1LGNA 4BMEA 2VVEA 4MUVA 3J7HA 5CFCC 4L99A 4D3WA 4DPNA 2VY0A 3THPA 1SLIA 5I0DA 1XNCA 3UKNA 2UU8A 4NROA 5CA6A 3M3OA 1A6CA 3JXSA 2Q8OA 5FWEA 3AP5A 4CDXA 5B4XA 5D8AC 1YXWA 1IGOA 3R4UA 1V70A 2ZGTA 4FAGA 4E2QA 4YZ5A 1W0PA 1UKRA 3Q8EA 1CD3G 2YYOA 4LXLA 1SPPB 5FZEA 5FR3A 4FXGB 4QKDA 1URXA 4F3JA 1KFXL 1TNRA 2QQVA 4YM1A 3HJRA 4ZONA 4EJRA 5ANNA 2R7EB 4PI2A 5F39A 3O1VA 1PGW1 2A6WA 2QFEA 3RGBA 5CKMA 2EIEA 4W8JA 5J09A 3KHCA 4XURA 2VQUA 1EAH1 1R1A1 4Y5TA 1WMEA 4A42A 4OZXA 1S1AA 3ZR5A 2ZAHA 1L3JA 5KBFA 3LEMA 4CCNA 2Y38A 3LF7A 4O61A 3UGGA 3PTYA 1HB3A 1UIKA 2FBEA 3T1LA 5A6QA 1M4WA 1XXNA 2D6PA 4NE9A 4YM2A 5CKNA 1EAH3 1R1A3 5JDBA 2VJXA 4L97A 3WV6A 3AZZA 4BPZA 4Q0UA 1BBT1 3N3HA 4AGVA 5EJ3A 4DXSA 1YFXA 2GALA 2ORZA 3IM0A 4E2GA 3DPRC 2OZJA 2NLRA 1Q56A 2BQPA 4QKBA 4K3UA 1FPN1 2VVDA 4FPKA 1S0JA 3RMYA 4AFBA 1BBT3 4YZ4A 5E6HA 1KS4A 3A21A 3E5XA 4Y3OA 4K21A 2WA4A 1H2KA 5IVYA 2VUJA 3SNMA 3VZNA 4AVBA 1UY0A 2VPVA 5IK4A 5JXGA 3U11A 3ZXAC 1F5FA 1FPN3 2HWB2 3V0BB 2XJPA 3LIHA 3DF0A 5FYUA 2OQ7A 1US2A 4EYUA 1Y7BA 3GGLA 4MX3A 1RJ8A 4OHXA 1IS5A 2QDNA 3TYJA 1H1MA 1SZBA 1H9PA 4DRRA 2E26A 3OB8A 2JB8A 1RUG2 1GKBA 1YQ6A 2VQ0A 2W47A 1HXS2 3SCHA 4CEWB 1HV1A 4COVA 1PVC1 2RS32 3NWKA 3N7JA 1WBFA 3SEPA 4OI4A 4QX1A 3TOJA 4ES9A 3U1XA 3ZDVA 2D6MA 2VMFA 2A1XA 4CP9B 5T5OA 3CDZB 1FOD1 1KJLA 3OJBA 4AVTA 5AC91 3LEGA 5LRSA 1PVC3 2VCBA 4HETA 1SCRA 4IXLA 1DGWX 2QQMA 3U37A 5BY5A 3LSEA 4LO8A 1FV2A 3QLQA 1FOD3 2YPDA 2ZMKA 2Q1MA 5AC93 3HD8B 4XDPA 1NLQA 2A6ZA 3AZXA 1GBGA 1LOEA 1PMIA 2VMCA 4HLTA 3T2OA 1MS3A 5C3OA 3LDRA 1ZZ6A 1ULGA 3MLJA 3H7YA 1JZ7A 1W3XA 4LHKA 4Q8LA 3LB9A 3OGRA 5E16A 5IWFA 3VL8A 5HV0A 4EE2A 1SG3A 3KB5A 3A7QA 4OHWA 1Q8VA 1X8MA 4HK9A 4WM7B 2RHPA 4AQSA 3K75B 5H9SA 3N4MA 4A6SA 4AI9A 2E9QA 3T09A 4FPFA 4HN1A 5FBJA 1CPMA 2CL2A 2EXIA 5F5AA 3WDYA 4CEWA 5FPAA 4AI8A 3ALQA 1XE8A 1QY4A 3WW1A 1PGW2 4C1XA 5FMCA 4K9SA 1QHDA 2WZR1 4N43B 1EAH2 1R1A2 3OUJA 2GNBA 5JOZA 3HNMA 3OPWA 1T6GC 1W3VA 3D6EA 3J7MA 4I2OA 5J36A 3V56A 3N9PA 5FY4A 4FFIA 4UFLA 4X6RB 5I8TA 5DPNA 4QQHA 3QH7A 5GLWA 1IQDC 3OGJA 2WZR3 3THCA 3PHMA 2QQIA 4I0AA 5F3CA 2ZKNA 2GC1A 5JMOA 1XC6A 2QQJA 2ZAAA 3B94A 4YZ3A 2WQ4A 3MV01 1BBT2 4H14A 3VDDB 2PQSA 2XVLA 3TB0A 5BNPC 4MH0E 1S0BA 5C3QA 4Q5OA 3P1IA 2BERA 1JZ2A 1XPWA 2JDPA 3NVCA 3POYA 4UFHA 5DDJ1 3RFRA 1FPN2 4QXKA 3EXUA 4PJYA 2E33A 5B4NA 2EXJA 1ZZBA 3JQWA 1ENSA 4IEWA 4WM7A 5G04L 4COUA 2IXHA 5FZLA 3B02A 2WO7A 1A3KA 2W2IA 3K46A 4Q4X1 1KRIA 3EO6A 5DDJ3 1U5ZA 3T2PA 1TMF1 3WP4A 5DAQA 2JD4A 4Y1XA 2VXJA 3SMHA 1RHI1 4D6QA 5CFDB 4NN0A 4BYYA 2BYVE 4L8QA 3P5BA 3IMNA 4Q4X3 2X5IB 3AMNA 4GWMA 5EHDA 4AE2A 1TE1B 4YFWA 1AR81 5FFOC 5FP9A 5L73A 1H8TC 4AK3A 3RG0A 4CUBA 1PVC2 3AVSA 1W6MA 1NQDA 2Y6FA 1AX2A 4IQPA 1Q43A 2OYZA 1WW4A 5IVVA 5LEKA 5FQ0B 2BTVC 3PVEA 4AFMA 5HCHA 4O9GA 4RN5A 1MZ5A 4WVZA 1FOD2 1W6PB 4YM0A 1S0CA 4PT6A 5AC92 1QEXA 5F32A 4NUBA 1AHSA 5LRRA 5AVAA 4MGQA 3W21A 1V9U3 1W8HA 4XCBA 3THTA 4URAA 1G9DA 3PDQA 1UU5A 4N9HA 2VMEA 2CYFA 3ZFFA 2D97A 5KHKA 5FZAA 5BNOA 3MBWA 3M3QA 3V0AA 3FFQA 2LUWA 3GXUA 1OI6A 5GKAC 2BJSA 4XF9A 3BUCA 5KXCA 2CHHA 1NE6A 2A71A 2DU0A 2Y33A 3POBA 5A3OA 4AHXA 3H9AA 3I7DA 5FZGA 3J9SA 4H7LA 3ACLA 2CWSA 3PIGA 5FUNA 3ZYJB 5FTTC 5CFDA 5ABJA 1FT9A 3D0SA 2UWCA 3WR0A 4CCLA 2J1AA 1LHUA 3LFIA 1S0DA 4HANA 3VZJA 3VBFB 3LA7A 4UW5A 2E7QA 2PHRA 4IV1B 1X9TA 3UYJA 2DCYA 2Q4SA 4P9JA 3WX5A 2WZR2 5GZEA 4NRPA 3CBNA 1V6KA 3KQ4B 4QT6A 3HAGA 1IPKA 1IZ3A 2OQ6A 1XU2A 4A4AA 1LU1A 3HBZA 3H8XA 1T2XA 1UX6A 1UU6A 4BQ1A 4CU9A 1B35C 1N47A 5EYYA 2OKXA 1WLDA 2C24A 2GH8A 1UXXX 1RUOA 2J1SA 4IE0A 4AQ6A 1WKYA 2YUEA 5LBBA 3GALA 1DHKB 4RQPA 4AWDA 4E4DX 4NIAA 1PMJX 3HBKA 2XLAA 3GNEA 4CP0A 2WUHA 3A0NA 3JZVA 3NW4A 4FOVA 2QCSB 1POV0 5DDJ2 3WNNA 1QJFA 2IWGB 1GWKA 4CCDA 1BMV1 1O8PA 1HLCA 2WFPA 1GUIA 1MZEA 2JG9B 3N7KA 4XFHA 4HG6B 4FPOB 5L9BA 3VBRB 2ET1A 5FPUA 2YXSA 2AEZA 4Q4X2 3WF4A 5IFTA 4CDWA 2C1FA 3HNYM 4NPRA 1TMF2 3PTRB 3H42B 2YBSA 4P9XA 4RSUA 5LA0A 2VCAA 3WCRA 4AEKA 5KWRA 4EN6B 4JDMA 4GH4A 2W87A 4YGCA 3ITQA 4CDUC 1JYCA 4DUVA 2FZ2A 2GDFA 5KXBA 1ZZ9A 1XYPA 3THDA 2ZXQA 5BNNA 1AR82 2QQNA 4K7JA 4U2AA 1N3QA 2W1QA 2WNVB 4CUAA 4Q2FA 4YVWB 3VKFC 4QQOA 3ZXKA 1V9U2 2J1UA 5JVVA 4I3PA 2ID4A 3RWNA 2DYCA 5APAA 1DQ6A 3ZIWA 1ZRDA 3WF3A 2JDAA 4XYXA 3WG3A 3NJXA 3POJA 1WLTA 4CXYA 2ARXA 4QB1A 1D0GA 5H9PA 1JXNA 2VNGA 5A3TA 2VW1A 1PIV1 3MPBA 4PQQA 3DXUA 2HLEA 1NCQA 4Y1VA 1LEDA 1OURA 1NKGA 2XJVA 3O0VA 4ATFA 2R1DA 1GNHA 1YIPA 4NRQA 3LKJA 1JU3A 2JDYA 1AR91 4MGZE 4XBQA 3CJXA 2YHJA 1PIV3 3SITA 2WABA 1JTZX 3W58A 4BK4A 4COZA 5EZWA 4Q27A 3DL3A 1RUE1 2ETEA 4HPKB 1ND3B 2ZZQA 2FCVA 1Z78A 4XQWA 4K6BA 2PAMA 1PO21 3VGIA 3M3EA 3AKRA 3J8F1 4KWLA 1JOBA 1QMJA 2YGMA 3NKGA 2VOXA 4KWJA 2E7AA 5J3UA 3WNLA 1RUE3 3BN6A 1NT0A 1LGCA 5D21A 3RZZA 5DMYA 2WNVA 4XETA 3C8XA 4XEZA 2DDUA 2OX0A 4YVWA 3SH3A 1JZ5A 1PO23 3J8F3 3ILNA 3ZOIA 2ZEWA 4G3YC 5FZOB 3WDUA 1RUH1 4UFJA 2MPFA 1TNFA 1ZBE1 4LUMA 1C5HA 1WCKA 1RVF1 1AXZA 2UYBA 4XW3A 5FPBA 3IBMA 2LS6A 4JHTA 1ND2A 4BISA 2KA3A 4Q4W1 1WCQA 5FPVA 1CAWB 4EN7B 1RUH3 3M3CA 2RM21 1UY3A 3HWJA 1ZBE3 4FI9A 2XKOA 2XJSA 4JGZB 4I0WB 5T5JA 2Q1FA 3RZHA 1UMHA 1RVF3 2RE9A 1XNDA 5FYIA 3NL1A 5JAXA 2VQAA 1Y43B 4FPYA 2CSGA 4Q4W3 3KGZA 2DUOA 1A8DA 4JGYB 2RM23 4S2DA 3KVBA 4AVSA 1C1LA 5DN2A 4DIQA 3PVNA 4ZY9A 2ZX0A 3WNXA 1BMV2 1VAVA 2R49A 1AL0G 4KU7A 3DV8A 1OUSA 1DGRA 3KQRA 5BV6A 4KNCA 2ZABA 3JBG1 2BNOA 1UY4A 3GBWA 2P5BA 1RXFA 2P3IA 3B01A 4H2AA 4S2FA 3C7HA 1DLLA 3ENRA 1RYYA 4QPIC 4BQYA 1W6NA 1C8NA 1L7LA 3JU9A 2QZ2A 1PK6C 3FE5A 3JBG3 1D0HA 3CIHA 3O0WA 3TRSB 1JOJA 2PLV1 3MIGA 1J59A 2BP6A 4U36A 5LWBA 3OPTA 5I91A 4QGNA 2QKDA 4FVVA 3LOBA 1TEIA 3UJOA 4MXVA 5BXXA 1I9RA 5KXDA 4JGZA 2OZ6A 4LA2A 3W5MA 4XIKA 1H9WA 2PLV3 1F2NA 1GU3A 2W0XA 5T54A 2K46A 1PIV2 5C9AB 3E6BA 2HH9A 2PHDA 2R16A 3JB4C 1WW7A 1AX0A 4EV0A 5CADA 5C3PA 1J83A 1NUKA 4XFGA 4OUSA 1AR92 2G1MA 1QGLA 4XUPA 4A2UA 4SBVA 4X6QB 1XSRA 4JVAA 4LHNA 3N35A 1RUE2 4CE8A 3U75A 4M0HA 2PTMA 1OSGA 1PO22 3URFA 1W6OA 3J8F2 1WCDJ 2AACA 2R0HA 3T1MA 4N90A 4PI0A 1NXD1 1QOSA 1SACA 2P37A 4IUGA 3T0BA 4QXHA 5LA2A 3VLBB 3DKWA 3SKVA 4A44A 1ULEA 4DNYA 3AL5A 5A32A 3U07A 4HFSA 2VBBA 3ABZA 4FTBA 3I2KA 1RUH2 5FYCA 3KT4A 1ZBE2 3KWVA 5EV7A 1GANA 2WNOA 1BCXA 1IKPA 5FLHA 1RVF2 3M8LA 1OD3A 5C5UA 5K7PA 2BVVA 3AB0A 3HMYA 4Y1YA 3TBDA 4AW7A 2QQWA 4B4QA 2WO1A 4Q4W2 4QD2A 3GHNA 4YVSC 3ZYGA 2ZGLA 3VBUA 2VGDA 3S6PA 2RM22 2YFUA 5EQUA 4Y26A 4QKFA 1PX3A 3CMGA 1LHWA 2VNOA 4FTSA 2WR9A 1CVNA 2N7GA 1EY2A 4N43C 3USUA 1NY71 1AUYA 5L7OA 1HB1A 3C7GA 3K4ZA 1OLMA 4MGIE 3WQ7A 1Y3TA 5FZ0A 5KHGA 3AX4A 3SKJE 3TEXA 4HKOA 3JD71 5FYBA 1JODA 1NOVA 2F17A 4YGDA 1W9FA 2ZX1A 2VU9A 1D4VB 3WNKA 4UXAA 3LA2A 1QJU1 3GJBA 4BQ2A 4MVTA 3ZKUA 1LECA 3VDDC 1WBLA 3JD73 5C71A 3JBG2 4QX3A 1FX5A 3EYPA 5HCFA 1QDOA 3ZSEA 2YY1A 4RFRB 5JI7A 2XJQA 1G9CA 2B9UA 4DEVA 1VRBA 1QJU3 5GZDA 2YC4A 4P14A 5A3MA 1X36A 2Z42A 2PYTA 4W65A 4DS0A 3IPVA 4AQ2A 1OHFA 2YPJA 3O1MA 2QUOA 3MUY1 4GB31 2PLV2 3ZFEB 3JCIA 2Q8EA 2WINB 4L11A 3ZFGA 2XDVA 1J3QA 2ET7A 4LR4A 1HV0A 4I3GA 5CVRA 1D2QA 2D93A 4AL9A 2A6VA 3OG2A 4XQDA 3ZSJA 5CAZA 4E4SA 4Q4Y1 1PNGA 1NLSA 4YARA 4GB33 5D1IA 5ACA3 4QKNA 3Q8BA 3RZMA 5F8PA 2X5IC 2VZVA 3PVOA 2ZEXA 4BH9A 5C3SA 1Q5OA 3OGSA 2WT2A 2DVGA 2VR4A 4FP2A 5TSWA 4HVRA 1AVBA 4Q4Y3 4Y1UA 4TZDA 4LOSA 3Q9OA 4QGMA 2NP0A 3GHMA 5EYXA 4E27A 1ST8A 4A7ZA 2F4PA
chains in the Genus database with same CATH topology
3K3OA 4QX8A 5IVEA 5FJHA 4CCJA 3KV9A 3K2OA 5FZ6A 5FZ8A 4D6QA 5FZCA 5IW0A 4GJYA 4CSWA 5E6HA 3PUSA 4Y3OA 5ANQA 5F3GA 5FZ4A 5IVYA 4IGPA 3LD8A 2VD7A 5FP9A 4EZHA 3KV6A 5A7QA 5A3TA 3RVHA 5ISLA 3AVSA 5IVCA 5FY7A 5A3WA 4V2VA 5FJKA 3DXUA 4UF0A 5FYUA 5FZ7A 2OQ7A 3PUQA 4LIVA 3N9QA 5FYTA 4EYUA 5FWJA 5K4LA 5IVVA 3KVAA 4IGOA 4XDOA 5A7NA 5A3PA 3KV4A 5F32A 5FY8A 5F3EA 4NUBA 2YU2A 5FXVA 4QXHA 3AVRA 5FY5A 4URAA 5FP8A 5A80A 3U4SA 2YBKA 3PDQA 3AL5A 5FZHA 5FY9A 5KR7A 4QX7A 5FZAA 5FYZA 4BXFA 5FYCA 4LITA 5FUPA 4DO0A 2GP5A 4Y33A 2WWUA 5FZ1A 5A7PA 3U78A 4LIUA 4D6RA 5LY1A 5FZGA 5LW9A 4C8DA 4D6SA 2OX0A 4TN7A 5F5IA 5FUNA 4HOOA 5F5CA 2PXJA 2YU1A 5FXWA 4CUGA 3ZPOA 5FZOB 3KV5A 3N9LA 5FY0A 2YPDA 4CCLA 4HONA 4XDPA 5F2WA 3N9MA 5FPBA 4CCKA 4BISA 5FZ0A 2Q8CA 5FYBA 3NJYA 5FPVA 3UYJA 5A1FA 2OS2A 3LDBA 5IWFA 2YBPA 5FZFA 3ZLIA 2WWJA 4V2WA 5FZOA 3DXTA 5A7WB 4CCOA 5FPLA 5FZKA 3PU3A 4QWNA 4AAPA 3AL6A 5FYIA 2OQ6A 5A1LA 2XXZA 2XUEA 4AI9A 5CEHA 5FZDA 5FP4A 5FBJA 4CCMA 5F5AA 5FP7A 5FPAA 3KVBA 1VRBA 5FWEA 4BU2A 5A7WA 5FV3A 4DIQA 3N9OA 3PU8A 3OPWA 4ASKA 5IVBA 4LXLA 5FZEA 5A7OA 5FYYA 3N9PA 5FZIA 5FY4A 4GAZA 2Q8EA 5FZBA 2XDVA 5FZ9A 5FZ3A 2P5BA 2OT7A 4IGQA 4UF0B 5FXZA 4EZ4A 5F39A 3K3NA 5F3CA 4QXCA 2XMLA 5FYHA 5FYSA 5IVFA 2Q8DA 5FPUA 2GP3A 4QU1A 4Y4RA 5FP3A 3PURA 4GD4A 5F3IA 4CCNA 3PTRB 5LWBA 2YBSA 3OPTA 3PUAA 5FYMA 5FXXA 5IVJA 5F37A 5F2SA 5LY2A 5FYVA 4QXBA 4E4HA 4GJZA 3N9NA 5FY1A 5FZLA 5A3NA 2W2IA 5A7SA 5FZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K3O A;  4QX8 A;  5IVE A;  5FJH A;  4CCJ A;  3KV9 A;  3K2O A;  5FZ6 A;  5FZ8 A;  4D6Q A;  5FZC A;  5IW0 A;  4GJY A;  4CSW A;  5E6H A;  3PUS A;  4Y3O A;  5ANQ A;  5F3G A;  5FZ4 A;  5IVY A;  4IGP A;  3LD8 A;  2VD7 A;  5FP9 A;  4EZH A;  3KV6 A;  5A7Q A;  5A3T A;  3RVH A;  5ISL A;  3AVS A;  5IVC A;  5FY7 A;  5A3W A;  4V2V A;  5FJK A;  3DXU A;  4UF0 A;  5FYU A;  5FZ7 A;  2OQ7 A;  3PUQ A;  4LIV A;  3N9Q A;  5FYT A;  4EYU A;  5FWJ A;  5K4L A;  5IVV A;  3KVA A;  4IGO A;  4XDO A;  5A7N A;  5A3P A;  3KV4 A;  5F32 A;  5FY8 A;  5F3E A;  4NUB A;  2YU2 A;  5FXV A;  4QXH A;  3AVR A;  5FY5 A;  4URA A;  5FP8 A;  5A80 A;  3U4S A;  2YBK A;  3PDQ A;  3AL5 A;  5FZH A;  5FY9 A;  5KR7 A;  4QX7 A;  5FZA A;  5FYZ A;  4BXF A;  5FYC A;  4LIT A;  5FUP A;  4DO0 A;  2GP5 A;  4Y33 A;  2WWU A;  5FZ1 A;  5A7P A;  3U78 A;  4LIU A;  4D6R A;  5LY1 A;  5FZG A;  5LW9 A;  4C8D A;  4D6S A;  2OX0 A;  4TN7 A;  5F5I A;  5FUN A;  4HOO A;  5F5C A;  2PXJ A;  2YU1 A;  5FXW A;  4CUG A;  3ZPO A;  5FZO B;  3KV5 A;  3N9L A;  5FY0 A;  2YPD A;  4CCL A;  4HON A;  4XDP A;  5F2W A;  3N9M A;  5FPB A;  4CCK A;  4BIS A;  5FZ0 A;  2Q8C A;  5FYB A;  3NJY A;  5FPV A;  3UYJ A;  5A1F A;  2OS2 A;  3LDB A;  5IWF A;  2YBP A;  5FZF A;  3ZLI A;  2WWJ A;  4V2W A;  5FZO A;  3DXT A;  5A7W B;  4CCO A;  5FPL A;  5FZK A;  3PU3 A;  4QWN A;  4AAP A;  3AL6 A;  5FYI A;  2OQ6 A;  5A1L A;  2XXZ A;  2XUE A;  4AI9 A;  5CEH A;  5FZD A;  5FP4 A;  5FBJ A;  4CCM A;  5F5A A;  5FP7 A;  5FPA A;  3KVB A;  1VRB A;  5FWE A;  4BU2 A;  5A7W A;  5FV3 A;  4DIQ A;  3N9O A;  3PU8 A;  3OPW A;  4ASK A;  5IVB A;  4LXL A;  5FZE A;  5A7O A;  5FYY A;  3N9P A;  5FZI A;  5FY4 A;  4GAZ A;  2Q8E A;  5FZB A;  2XDV A;  5FZ9 A;  5FZ3 A;  2P5B A;  2OT7 A;  4IGQ A;  4UF0 B;  5FXZ A;  4EZ4 A;  5F39 A;  3K3N A;  5F3C A;  4QXC A;  2XML A;  5FYH A;  5FYS A;  5IVF A;  2Q8D A;  5FPU A;  2GP3 A;  4QU1 A;  4Y4R A;  5FP3 A;  3PUR A;  4GD4 A;  5F3I A;  4CCN A;  3PTR B;  5LWB A;  2YBS A;  3OPT A;  3PUA A;  5FYM A;  5FXX A;  5IVJ A;  5F37 A;  5F2S A;  5LY2 A;  5FYV A;  4QXB A;  4E4H A;  4GJZ A;  3N9N A;  5FY1 A;  5FZL A;  5A3N A;  2W2I A;  5A7S A;  5FZM A; 
#chains in the Genus database with same CATH topology
 1OKO A;  4PIY A;  3AMM A;  4YNI A;  5IK5 A;  2WNE A;  2JG8 B;  4XDQ A;  1X9P A;  2IXC A;  4Q29 A;  2RG4 A;  5FZC A;  3OY8 B;  1ENR A;  3VD9 A;  3VL9 A;  4A7K A;  2WBK A;  3AFG A;  1HN1 A;  2H6C A;  4FBF A;  5DAW A;  3V65 A;  1DGR N;  5F3G A;  2P6H A;  2VD7 A;  5LA1 A;  4IEV A;  4JAA A;  1CX1 A;  3CO2 A;  3A0K A;  4XUQ A;  1W0N A;  3K51 A;  1CQ9 A;  1NX9 A;  5C4W B;  2VZS A;  1NQJ A;  1YCI A;  5FZ7 A;  4XZP A;  3JUU A;  1A8M A;  1LR5 A;  1LEM A;  1OVP A;  1Z0H A;  2HWE 1;  2JDN A;  2XWJ B;  2WQ8 A;  2YMZ A;  4ISR A;  4KGG A;  2VXR A;  2TBV A;  3AXE A;  4IEP A;  3WCS A;  3ZX7 A;  4N9I A;  1H4H A;  3H50 A;  3VN4 A;  1M06 G;  4XXP A;  1DLC A;  2WT1 A;  1HJF A;  5FXV A;  1CAX B;  5LK5 A;  2BGC A;  2ZGM A;  3VBF C;  2VBP A;  1YUD A;  4IV1 C;  2YBK A;  4XXA A;  1W2N A;  5A33 B;  1QXR A;  2HWE 3;  2RS1 1;  1CAU A;  3OGG A;  4C90 A;  3O1U A;  1O3S A;  1YO8 A;  5J7M A;  1CZV A;  1NY7 2;  3PL0 A;  3WSO A;  2VVF A;  3UET A;  5GZC A;  1WLW A;  2VQT A;  1UX7 A;  3KSC A;  4UW3 A;  4LQR A;  2RDN A;  3JD7 2;  2B9V A;  2RS1 3;  3HNB M;  3FBY A;  3ZN4 A;  5F5I A;  3A4U A;  2C4X A;  4LHS A;  1CWP A;  1H6Y A;  2OUH A;  1QJU 2;  5HBA A;  1O3Q A;  2HEW F;  2W91 A;  2W1W A;  2XL9 A;  3ZIX A;  3RZL A;  2DUP A;  1LB2 A;  2HWC 1;  2W08 A;  3VBH A;  4Z8B A;  2D7F A;  3UJQ A;  1H2L A;  2W46 A;  1SFP A;  4V1P A;  1PGL 1;  1LOF A;  2VOW A;  3VBS B;  1OQ1 A;  1W06 A;  4K1Y A;  4DB5 A;  1Y9G A;  5LBF A;  3TNQ A;  4XHB A;  1O4T A;  3S7I A;  4D94 A;  4PCR A;  3WHU A;  2HWC 3;  4QDR A;  5A3U A;  3N7M A;  4GB3 2;  2JG9 C;  5FMO L;  5ACA 2;  4ONU A;  2NMO A;  3I2J A;  1BQP A;  4CU6 A;  1CAX A;  5HCB A;  2JWP A;  3S7E A;  5A7W A;  4Q4Y 2;  3C7O A;  5JXJ A;  4AXO A;  4Z92 B;  2XJT A;  4AHW A;  5IK8 A;  4WM8 B;  4XF0 A;  2JKB A;  4LK6 A;  5K0U C;  3DYM A;  1OVS A;  2HEV F;  1AR7 1;  4WBB A;  5GLV A;  1G9B A;  1A34 A;  5FZ9 A;  2VOT A;  1ZZ8 A;  4COY A;  3SLI A;  4R9A A;  4URT A;  1BK0 A;  5A3L A;  1YNA A;  2UWB A;  2FDG A;  3LOI A;  5IK7 A;  2FDH A;  1LUL A;  1SLC A;  1AR7 3;  4R8H A;  3SQO A;  5FP3 A;  1NZI A;  3VHP A;  2LW8 A;  2XON A;  3EJK A;  1LGB A;  2K2S A;  2O1Q A;  3M70 A;  3PJY A;  5JXH A;  1XYO A;  2VE1 A;  3HQU A;  3VBS A;  2VBD A;  1YFU A;  2WN3 A;  1Q8S A;  3WOG A;  3WZ1 A;  1DG6 A;  3GZA A;  4IEQ A;  4CZS A;  5C7G A;  4OHY A;  3R05 A;  3GZE A;  4B4P A;  5J1X A;  1XNK A;  1VPH A;  3B93 A;  2Y6L A;  4CEY C;  1UZW A;  4FT8 A;  5FIX A;  3MI8 A;  1ND3 C;  1UQX A;  3GJA A;  1G9A A;  2GND A;  3ASI A;  4R9B A;  1PX4 A;  3O1S A;  4M01 A;  2HWE 2;  1F35 A;  4F7Z A;  3S57 A;  2XVK A;  1GOF A;  1HRI 1;  5J96 B;  1CPN A;  1NCR B;  4WM8 A;  1Y9M A;  3ZYF A;  5K8S A;  1E5I A;  3FX3 A;  4PDW C;  3O1R A;  2AZ5 A;  3IMM A;  4K1Z A;  4KWK A;  2RS1 2;  1ZRC A;  2TNF A;  3K4A A;  4IES A;  4RS5 B;  3KS7 A;  1YI7 A;  2DU1 A;  3T4V A;  1HRI 3;  4IEY A;  1VAL A;  1OOP B;  3IIA A;  4GZ9 A;  5K4L A;  4XBL A;  1L7R A;  2G9G A;  5DUX A;  3KV4 A;  4UFI A;  4XAA A;  5FY8 A;  1GQH A;  2VL4 A;  4PF5 A;  3OD4 A;  1ULD A;  5FY5 A;  4BLI A;  5LBC A;  4Z2A A;  2PHL A;  4TXW A;  1REF A;  4NHX A;  2YC0 A;  2YB7 A;  2JJ6 A;  2YG0 A;  2OPK A;  5CB7 A;  3V64 A;  2HWC 2;  5JR2 A;  1AJK A;  1NA1 C;  1CJP A;  1DYP A;  1W8N A;  1AYN 1;  4COW A;  1PGL 2;  2R1B A;  1ZBA 3;  4IE6 A;  2XBO 1;  1O5L A;  4JC1 A;  1N1Y A;  1ULP A;  4P5Y A;  5HI0 A;  1W9W A;  2ZMN A;  1Q3E A;  4WZF A;  1BVV A;  5F5C A;  1UZY A;  4MET A;  2P3Y A;  4NHL A;  1BKZ A;  4BCU A;  4YW2 A;  1R1Z A;  2UY9 A;  3H8O A;  4AI3 A;  3S0M A;  1IPJ A;  1AYN 3;  2WNU A;  4N53 A;  2RJK A;  3S5Q A;  1NCR A;  1E5S A;  2XBO 3;  4R52 A;  3HN3 A;  4CCK A;  3AZV A;  3SIS A;  5GLU A;  3WG1 A;  1DQ5 A;  3POE A;  2XJR A;  3LDB A;  2ZGS A;  2RMU 1;  1XU1 A;  2YGL A;  3ILR A;  4RS5 A;  2BFU S;  3VZK A;  2XG3 A;  5FZK A;  5DG1 A;  1OOP A;  1E5R A;  4AAP A;  2V4A A;  3AL6 A;  4XJ8 A;  1CIW A;  2WT0 A;  3MID A;  4A7Y A;  2MEV 1;  2LAL A;  1AR7 2;  2ZBJ A;  4M3C E;  3NNL A;  4OZO A;  2RMU 3;  3K4D A;  3LFM A;  1T6B X;  2HWF 3;  1X82 A;  2RDQ A;  2BDR A;  4GIQ A;  4LA3 A;  2MEV 3;  2NMN A;  4A3X A;  4QQP A;  3W59 A;  1LES A;  1UL9 A;  3A22 A;  3WDV A;  4RR3 C;  2B39 A;  5T55 A;  5C9A C;  4R4X A;  5IFP A;  3IAQ A;  2HEY F;  1EV1 1;  1G8W A;  3VZM A;  4LEJ A;  3WUC A;  5LB6 A;  1OF4 A;  3WVJ A;  1SLA A;  1XQN A;  3BTZ A;  3TEW A;  1H1I A;  3C7E A;  3X29 B;  4GD4 A;  1V6O A;  1EV1 3;  5C33 A;  2J1V A;  3WG2 A;  1AX1 A;  1ODN A;  2BPA 2;  5FYM A;  4LBM A;  5FMD A;  3B9I A;  1HDK A;  5A1A A;  1HKD A;  1HQW A;  2VZQ A;  3HPN A;  4QXB A;  4HVO A;  4JQR A;  3GCX A;  5H9Q A;  4E4H A;  1HRI 2;  3M7A A;  1QQP 1;  1PZ7 A;  1S0F A;  1WW6 A;  1YI9 A;  4BIO A;  4CA9 A;  3J4U H;  2Q0A A;  4EWA A;  3ATG A;  1NAE A;  3H1W A;  5FJH A;  4AI1 A;  4QPG B;  5ERL A;  5AVP A;  3C2U A;  1V00 A;  1W6M B;  1DIW A;  1AR6 1;  2E6V A;  2ZGR A;  2F6B A;  2B4K A;  2VUL A;  4M4R A;  1QQP 3;  2XL7 A;  2ZGK A;  4JX0 A;  1JYT A;  4ZXE A;  3CNA A;  4HK8 A;  4YPJ A;  3VB9 A;  1NZC A;  4IV3 C;  4ZPI A;  5EIY B;  5JOW A;  1XBF A;  1O3T A;  3J7N A;  2VEC A;  4BDV B;  4CDQ A;  2HWD 1;  1AR6 3;  4XFC A;  3ES1 A;  1ZBA 2;  3INA A;  4NR1 A;  4YWA A;  5A3W A;  2V73 A;  3VKL A;  3SCF A;  3KLS A;  4AAX A;  1PNF A;  5BUV A;  1LU2 A;  3ZFF B;  1V6L A;  5BNO B;  3DYO A;  3KVA A;  3MW2 A;  1W28 A;  3V0A B;  4ATE A;  4XDO A;  2DCZ A;  4ZU4 A;  5F7U A;  5A3P A;  2HWD 3;  3H7J A;  1AYN 2;  5J98 B;  4Y1Z A;  3Q8A A;  5F3E A;  2VNV A;  2XBO 2;  2E7T A;  1KIT A;  3WDX A;  3ZO0 B;  3LE0 A;  4E9K A;  3GBF A;  3WNM A;  4Z1V A;  1ZRE A;  1O4Y A;  4B4R A;  1X8E A;  2AH2 A;  5I0R A;  5ABJ B;  1F15 A;  2XQX A;  4FPJ A;  2KD7 A;  5IT6 A;  1NLR A;  2VTX A;  2NN8 A;  1ONA A;  1ZRF A;  5DAP A;  5A7P A;  2XHK A;  3U14 A;  4BQX A;  4QPG A;  3OBZ A;  3ZXL A;  1JZ6 A;  4NO4 A;  2RMU 2;  5IHR A;  2WQZ C;  4LTA A;  3RJR A;  2V72 A;  1V9U 1;  1WGP A;  3VD5 A;  2JEM A;  3IN9 A;  2HWF 2;  2ZEZ A;  4HL0 A;  5FY0 A;  2VMH A;  2Y6K A;  2W94 A;  2MEV 2;  2WA3 A;  3L2Y A;  1LCL A;  3B9C A;  4LKS A;  4YVS A;  1GZW A;  1YIF A;  2ADD A;  4G4F A;  4YGB A;  4D0Q A;  5FMB A;  3VBO C;  5JR7 B;  2D40 A;  4ITC A;  1K5M C;  1RL3 A;  2VG9 A;  3VKO A;  2D3P A;  1DU3 D;  3WLU A;  1DGW A;  2E31 A;  2VUD A;  4OYU A;  1ZVF A;  5LAS A;  4JDN A;  3UKV A;  2WZE A;  1C28 A;  2D6O X;  4RQP B;  2CNA A;  2ZAC A;  2WAA A;  2JDZ A;  1MAC A;  2WKK A;  5FZD A;  1JU4 A;  5DZE A;  2Y64 A;  2OPW A;  5E8A A;  1EV1 2;  2VMG A;  5FP7 A;  4EQV A;  2R07 1;  2Y0I A;  3FFZ A;  4Q0Q A;  3MW3 A;  3J7L A;  3NV2 A;  3PLQ A;  4UYB A;  4YFZ A;  2KM2 A;  1MS1 A;  1COV 1;  1P8J A;  4MGY E;  3CQO A;  4W6Y A;  4YYO A;  3T0D A;  3E1F 1;  1DZR A;  5JPN B;  2WO3 A;  1OMI A;  1W8U A;  3RNS A;  5FZB A;  2R07 3;  2PHW A;  4CDW B;  3I97 A;  1ULO A;  1SCS A;  2CWM A;  2JG8 C;  4D7S A;  2EID A;  2VZO A;  1U5X A;  1COV 3;  3K3N A;  3OF1 A;  2Y34 A;  4JKM A;  3TAY A;  3LEK A;  3A23 A;  3OBR A;  4GH4 B;  1QQP 2;  2ZJC A;  3OUH A;  2V4V A;  5CG9 A;  4KWU A;  2DV9 A;  3FUQ A;  5BNN B;  1UYY A;  4J6G A;  3PUR A;  1LTE A;  2LRP A;  3FWE A;  4W4Z A;  4B1L A;  4GXL A;  3FLR A;  3PUA A;  3RYK A;  5FXX A;  1AR6 2;  1DFQ A;  5IVJ A;  1XRU A;  4R9C A;  4QHO A;  5CIS A;  1OXC A;  1WUV A;  4DXR A;  3UNP A;  1BZW A;  2L9L A;  2VCC A;  1MEC 3;  4AVV A;  2VZ3 A;  3VDC A;  2OVU A;  1C4R A;  2HWD 2;  3EHK A;  5FZM A;  5FO9 B;  4NOT A;  3UGH A;  2XR4 A;  1Z7S 1;  3ZDS A;  4YSF A;  1CZT A;  4Q1P A;  3WW2 A;  5CG8 A;  4YZ1 A;  3K2O A;  4LKE A;  5JOY A;  1NCQ B;  1V0A A;  3HT1 A;  1L7Q A;  1MZF A;  1YEW A;  2EAK A;  2P6C A;  4LO7 A;  4CSW A;  1JZ4 A;  4GAL A;  3HN1 A;  1VBD 1;  4M4P A;  2FDF A;  3H3L A;  4W50 A;  4AED A;  1F5J A;  1IG0 A;  4TYS A;  1Z7S 3;  2VH9 A;  2C5D A;  2P3J A;  3ACG A;  1K5J A;  3RYP A;  2AGS A;  4IL7 A;  2X8K A;  5F5Q A;  1KEX A;  2RVA A;  2HYX A;  3D3A A;  1VBE 1;  3WW3 A;  3D82 A;  3NNG A;  1VBD 3;  1XNA A;  4CCE A;  4GMP 1;  1QOO A;  4LMF A;  1JYW A;  4XPV A;  4Q0P A;  4LE4 A;  2VNR A;  2TUN A;  3NAP C;  3OPZ A;  1VBE 3;  3DCQ A;  1ENQ A;  5A80 A;  5FO7 B;  1TG7 A;  4GMP 3;  5FY9 A;  4CDX C;  2VTF A;  1HN0 A;  2JEC A;  5JZG C;  3AYA A;  5FUP A;  2QVS B;  4AQT A;  2GP5 A;  2PMW B;  1F8V A;  1HB4 A;  1GWL A;  3WF0 A;  4ISQ A;  1ND2 B;  1I3H A;  4IER A;  1BVP 1;  1U12 A;  3R4S A;  4OVE A;  5FXW A;  4FFG A;  1HX6 A;  2J42 A;  2R04 1;  3KV5 A;  3ZMO A;  3NJV A;  1MS4 A;  3I2I A;  1HW5 A;  4IET A;  3POS A;  1O3R A;  2WN2 A;  2Z79 A;  1LHO A;  2C26 A;  1DZQ A;  1WD4 A;  1F9K A;  1XE0 A;  2R07 2;  5FPZ A;  3U0Z A;  1ZRR A;  2R04 3;  1W9S A;  1N1S A;  2YBP A;  4I02 A;  5I93 A;  3ZPY A;  1COV 2;  3NV3 A;  3RMX A;  4OUE A;  4DY3 A;  5L19 A;  3ST7 A;  1DQ0 A;  1PZ9 A;  3OCP A;  3AMH A;  4FOW A;  5EXO A;  2VUC A;  1AZD A;  3AMP A;  3WIN E;  1QOT A;  5FKC A;  3CJI A;  4RD7 A;  2I74 A;  4FOQ A;  4XMA A;  3MZH A;  2TEP A;  5FV3 A;  4BQ5 A;  5DUU A;  1W6N B;  1W8T A;  4LBJ A;  5GM0 A;  4XCA A;  3EQE A;  2VZP A;  5IVB A;  5IJR A;  3WQ1 A;  3ZXE A;  3MO4 A;  1MQT A;  4LBQ B;  5FZ3 A;  1HJG A;  3BAL A;  3AMQ A;  1N3P A;  4LO5 B;  4AEJ A;  4NPM A;  2VTX J;  3T2T A;  1WD3 A;  2ZGQ A;  4LBQ D;  1PVX A;  5F9T A;  1IG3 A;  4NAM A;  1UPS A;  5K0U A;  4CPB A;  5FYS A;  1WMD A;  5BNQ A;  2DF7 A;  2BOJ A;  3I2G A;  3AFK A;  4QU1 A;  4Y4R A;  5EJ1 B;  4B7E A;  1Z7S 2;  4UFK A;  3MPP G;  3ZXF A;  5C8C A;  1VE0 A;  2ZGN A;  5KHI A;  2A3X A;  5F37 A;  2YRO A;  3GZT B;  3IDC B;  2VOK A;  4LBL A;  4PF1 A;  1VBD 2;  5CFC A;  3VHR A;  2WFF 3;  3AP7 A;  1QJX 1;  2JE9 A;  3KMH A;  1UF2 C;  1FV3 A;  2IXJ A;  2GN7 A;  1UD1 A;  2ZA9 A;  1VBE 2;  4XUO A;  2JKX A;  1MPX A;  4XAC A;  4XFI A;  2WSV A;  4JHZ A;  5D8A A;  1HIX A;  4LPL A;  3FL7 A;  2X05 A;  4ASL A;  4BE3 A;  1NXM A;  1W6O B;  1QJX 3;  4FPH A;  3BTA A;  2RS5 1;  4IEO A;  1ACC A;  2F4L A;  4XAE A;  4GQ7 A;  2ZX3 A;  2GC0 A;  2QQL A;  4CEY A;  3LD8 A;  3T30 A;  1QNW A;  1ULC A;  4LBQ A;  3O1O A;  5EWS A;  5CU1 A;  3AKT A;  5A32 B;  5IAX A;  2JX9 A;  2KR2 A;  2RS5 3;  2WL1 A;  1US3 A;  4NAO A;  4FCA A;  1K3I A;  2YFZ A;  3VHO A;  1OT5 A;  1RIT A;  5JOX A;  2Y6J A;  2ZEY A;  3OOX A;  1QH7 A;  3D4K A;  1VBB 1;  1UO9 A;  4GKY A;  3VDB A;  4CEW C;  3VBU B;  1UWW A;  2R04 2;  4MO3 M;  4HVQ A;  4D8M A;  4IEX A;  4S2G A;  1Y4W A;  2W39 A;  4RGG A;  3USU B;  1LOA A;  2W92 A;  3LQC A;  5L7O B;  1VBB 3;  3HIF A;  3VV1 A;  3WG4 A;  1MVQ A;  1OPO A;  3DPR A;  1OQE A;  3WXP A;  3ZSK A;  3ZN6 A;  4CP2 A;  4D6R A;  4YZ2 A;  5LY1 A;  1YLL A;  4R9D A;  1YYN A;  1OA2 A;  2D5F A;  2D98 A;  1UMZ A;  4DFS A;  4BMB A;  1NA1 A;  1GR3 A;  4Y22 A;  2BV4 A;  1W6Q A;  1J3P A;  5J48 A;  3ZYR A;  1O8S A;  1QWR A;  5A1F A;  4GKX A;  2IVI B;  3KGL A;  4M3C F;  1VLN A;  4XQ4 A;  5KHJ A;  1JYN A;  2GC3 A;  5T5L A;  1ULF A;  1WA4 A;  3ACH A;  3RWK X;  3BTY A;  3DXT A;  2WDB A;  3UT0 A;  3OSD A;  1KJR A;  4RHV 1;  3WP3 A;  1ZNP A;  3ACF A;  3IPV B;  4FPG A;  4WM7 C;  4H3W A;  2Y60 A;  5A1L A;  1I6X A;  5T52 A;  5EP9 A;  2VAU A;  3I3M A;  2RJ2 A;  2ORX A;  3ZFG B;  1W9T A;  2BWA A;  2JB4 A;  4AI0 A;  1LNS A;  5CYY A;  1RB8 G;  2ARC A;  1H2M A;  4RHV 3;  2VZU A;  1O91 A;  2E63 A;  3B5L B;  5LZ6 A;  3FC0 A;  3ZYP A;  2GSY A;  1VP6 A;  3UV9 A;  4FAH A;  3PUH A;  4YW3 A;  5T5P A;  4MYE A;  3CU7 A;  4H55 A;  5M0T A;  2BEO A;  1WCS A;  2WFF 2;  4WVM A;  4YM3 A;  4RL7 A;  2VC9 A;  3N7L A;  2XLG A;  1JUI A;  4NRM A;  1G7Y A;  3B00 A;  3NST A;  4IGQ A;  1KFU L;  4OI2 A;  3WQB A;  5E89 A;  1UY2 A;  2UUR A;  3KF5 A;  1JZ3 A;  1VBA 1;  1QJX 2;  5IVF A;  1YC6 1;  1GOH A;  1OKQ A;  5DUW A;  4ET7 A;  2H6B A;  1GZ9 A;  2ERF A;  2J1R A;  1AJO A;  1UOJ A;  4UW4 A;  2XJU A;  4HSL A;  2QQO A;  1J3R A;  3R0R A;  4UBH A;  2XPJ A;  1RXG A;  5F6L B;  1VBA 3;  1VMH A;  1W8Z A;  5LY2 A;  3ZFF C;  4XJ9 A;  5BNO C;  2RS5 2;  3JB8 A;  4RGK A;  1WZX A;  4RA0 A;  1XNB A;  4BA6 A;  3MFA A;  3ZXD A;  4QB2 A;  2E51 A;  4HSJ A;  3K3O A;  4QX8 A;  4F83 A;  5ACA 1;  5IVE A;  5KC5 A;  2GC2 A;  3RDI A;  4HKW A;  4MLO A;  3RQ0 A;  5FOB B;  4MOA A;  3I8T A;  4P9G A;  1R08 3;  4JCK A;  1W2O A;  5CFD C;  5L9V A;  3H0O A;  5DXD A;  1TQ5 A;  1HQN A;  4LBK A;  5H9R A;  2Z4F A;  1C5I A;  3GZU C;  2ZHL A;  2WAO A;  2WC2 A;  4IGP A;  3VKM A;  1OH3 A;  4B29 A;  4CVU A;  1VBB 2;  2XB6 C;  4EN9 B;  1JI6 A;  4ARY A;  2W1U A;  4BWO A;  2YDE A;  3KHB A;  4KBB A;  1RUN A;  1VRH 1;  3LIG A;  1CAU B;  3P3P A;  4MGS A;  5IYY A;  4XIL A;  2W3J A;  2R32 A;  4CYD A;  1D4M 1;  5BNP A;  2OW4 A;  4MAD A;  1RUC 1;  4PLM A;  4TLF A;  3MHZ A;  3EMR A;  3ZSM A;  1VRH 3;  2MHF A;  2RDS A;  2VW2 A;  1ZZ7 A;  3GDB A;  1D4M 3;  4K8F A;  3OYW A;  4DXT A;  1GIC A;  2WJS A;  3MDP A;  3VKN A;  3CF6 E;  1RUC 3;  2RDR A;  3ZSL A;  1V6N A;  1MS8 A;  1W8F A;  2V09 A;  4FPE A;  4PBP A;  2DFB A;  4RQP C;  4Y33 A;  3VBH B;  4EN8 B;  2JIC A;  2I07 B;  3BCW A;  1O5U A;  4PLN A;  4NIG A;  2GNT A;  3H8U A;  4JDO A;  4OQ9 A;  4MXW A;  2W5F A;  4JV4 A;  4RHV 2;  1OLQ A;  4OMD A;  1K42 A;  1ODM A;  1DZT A;  2ES3 A;  3BPZ A;  4XHX A;  4EWE A;  1J1L A;  1YHF A;  2PA7 A;  1I1E A;  4W6X A;  1U0A A;  2O8Q A;  2UWA A;  1H8T A;  5LAT A;  4I30 A;  1JYX A;  2NZ9 A;  3O12 A;  5LK7 B;  4ZU7 A;  5IAV A;  2I2S A;  2UYA A;  2BZD A;  1D7P M;  1SLT A;  2PFW A;  5A7W B;  4X8N A;  5FAX A;  5IAT A;  4ZZ5 A;  3TEZ A;  4DMI A;  3WHT A;  4JKK A;  3ME2 A;  1R09 3;  4AVA A;  1B35 B;  2CV6 A;  4AHZ A;  3AP9 A;  4CRQ A;  4DEQ A;  5CEH A;  4R4Z A;  5I0S A;  3WD5 A;  2JIJ A;  1YQ2 A;  4IE7 A;  3NV1 A;  1ALY A;  4NMI A;  4UBG A;  1POQ A;  1UZV A;  2V5Y A;  4BU2 A;  1DQ2 A;  1K12 A;  3UES A;  1UMI A;  1GOG A;  3HQX A;  1VBA 2;  2B5H A;  2EAL A;  3LCP A;  1W2T A;  2C9A A;  3E6D A;  3BTX A;  2WRA A;  3S30 A;  3LGR A;  2FDJ A;  3DN7 A;  4CXW A;  4BIF A;  4OHV A;  1EPZ A;  2H0V A;  2IVJ A;  3ECQ A;  4L0P A;  1IPS A;  4TLG A;  1W2A X;  3W9A A;  3KZ4 C;  1LEN A;  1UZZ A;  4LJH A;  5DZG A;  5JSR A;  1H4G A;  4YG3 A;  4BZ4 A;  1R08 2;  5HCA A;  3FBM A;  3KT7 A;  4NPL A;  3VBR C;  2GP3 A;  4Q1R A;  2A7A A;  5F3I A;  1W9Y A;  1YJK A;  3T08 A;  3H8R A;  1VMF A;  3LAG A;  5FDB A;  2FDI A;  2BVB A;  1B09 A;  1TME 1;  2OII A;  3EB7 A;  5A7S A;  2FHR A;  1B35 A;  4YRD A;  1WA6 X;  4E8D A;  1HRV 1;  2DCK A;  4CCJ A;  1V6M A;  3NO8 A;  4K20 A;  4XJW A;  2WNV C;  2ZX4 A;  5JMC A;  3I3E A;  4YVW C;  2HBU A;  1SHW B;  1VRH 2;  1W05 A;  4QM9 A;  4Z07 A;  1W8W A;  3M1H A;  1UNB A;  1UU4 A;  4XF3 A;  4M3C B;  4UOJ A;  1TME 3;  2J22 A;  4IW3 A;  1D4M 2;  4IE4 A;  3PUS A;  3ROU A;  1HQL A;  3WNO A;  1HRV 3;  1TZO A;  1RUC 2;  3BPS A;  2G9Z A;  1LRH A;  1OQD A;  3SH5 A;  4Q4V 1;  5A7Q A;  4EZH A;  2G19 A;  1OPM A;  4XFB A;  3HVD A;  1X50 A;  4HZF A;  5JLV A;  5F6K A;  5FYT A;  3GYD A;  5FBZ A;  2W95 A;  2BFU L;  2IFR A;  2ZX2 A;  3BVC A;  4WVW A;  4Y5S A;  4LHL A;  4UT5 A;  4Z82 A;  4Q4V 3;  1RUG 3;  3C3V A;  1YQ5 A;  2PHT A;  2Z69 A;  3GM8 A;  4NWW A;  4XUT A;  2C9K A;  3QOP A;  4Y4Y A;  3RSJ A;  2JE7 A;  2W9X A;  2B7Y A;  3NKT A;  3TWI A;  5FP8 A;  4LO4 B;  2K0G A;  2EF6 A;  3ZXJ A;  4CDU A;  2ZML A;  3CHX A;  1UCX A;  3I4I A;  3VZL A;  2VOV A;  3NAP A;  4NHM A;  1QJY 1;  2WNU B;  4O7X A;  3BU0 A;  4N53 B;  2VO5 A;  2NYY A;  5FZ1 A;  2WSU A;  1R09 2;  4YG0 A;  2WYF A;  1H6X A;  2IC1 A;  1BLZ A;  1S55 A;  1G86 A;  4TN7 A;  2BNN A;  2IXI A;  4QB6 A;  1EPW A;  5JZG A;  1QJY 3;  2KXL A;  3D0J A;  4M3C A;  3FHQ A;  1O4Z A;  1RC6 A;  4K8R B;  4P9I A;  3N9M A;  1EUU A;  4GUL A;  4HKL A;  1SQ4 A;  5E88 A;  4OI1 A;  4LE3 A;  4YW1 A;  3ETQ A;  4FOY A;  3AKP A;  5AFE A;  4GWI A;  4N7U A;  1W2U A;  4PQ9 A;  2AUY A;  2WWJ A;  1GFF 2;  1V6I A;  1ZBA 1;  1SFY A;  1W04 A;  2R6Q A;  4E2S A;  3R6S A;  4QHB A;  4JGZ C;  4BK5 A;  4LUK A;  5G05 L;  3I59 A;  2DWR A;  2WS9 1;  4CCC A;  3WEZ A;  1F4H A;  4SLI A;  3FMG A;  5FP4 A;  1ENX A;  1OFN A;  2LTN A;  2Y26 A;  1YRZ A;  3I2D A;  5DZF A;  3PMS A;  4CCM A;  3RZJ A;  1YFY A;  1RUF 1;  4XF1 A;  4JGY C;  1J1T A;  3WNP A;  3OBA A;  3WW4 A;  5LA9 A;  1DF0 A;  1VAM A;  4M00 A;  1AF9 A;  1LHV A;  2P4E A;  2WS9 3;  5FLI A;  1UYP A;  5FMO S;  3L2H A;  5D2A A;  5LBE A;  4XJU A;  5HXV A;  4ASK A;  5KHH A;  2PHX A;  1RUF 3;  3IAP A;  3LZZ A;  1DQ1 A;  1PHM A;  2ZHM A;  4QPW A;  4FTE A;  3APB A;  4UF0 B;  4QPI B;  3WF1 A;  1C3H A;  1DYK A;  2DBN A;  4EZ4 A;  4QXC A;  3PJQ A;  5JI9 A;  4P9L A;  1IHM A;  1O7F A;  1PK6 B;  2RR1 1;  1TME 2;  2ARE A;  1SPP A;  2HWF 1;  4HT1 T;  1OD5 A;  3BKZ A;  4OUM A;  2QE3 A;  2NQY A;  1HRV 2;  2FZ1 A;  4FPC A;  1Y9Q A;  4NVP A;  4QMA A;  5JCT A;  3W5N A;  5CKQ A;  4DIN B;  3NJZ A;  4O9E A;  2R30 A;  3AXD A;  2ARA A;  5A6Y A;  2RR1 3;  2BUK A;  3FLP A;  2DTW A;  4KG0 A;  3ZN5 A;  1VB4 A;  3POG A;  3RS6 A;  5C8W A;  1KDK A;  4G9S B;  3UK9 A;  4Q4V 2;  2EIC A;  1QH6 A;  2BBA A;  3S5A A;  4CDQ B;  3I49 A;  1QXP A;  3NV4 A;  1IS4 A;  1GQG A;  1ZM1 A;  3VBU C;  2AR6 A;  3WP5 A;  3WDW A;  1DBN A;  5GLZ A;  4BJ0 A;  5CBL A;  1EP0 A;  4NJ4 A;  4AG4 A;  5C70 A;  1AYM 1;  1EYB A;  1DP0 A;  3ES4 A;  2ZPX A;  2XQR A;  1Q8P A;  5FZ4 A;  5L7O C;  3TEY A;  2BW8 A;  1BJQ A;  3RVH A;  1DYO A;  5GAL A;  1KGY A;  4E8C A;  2FDK A;  3MLL A;  4UF0 A;  4QPI A;  2SLI A;  3D5O A;  1AYM 3;  1GWM A;  5K9Y A;  4QX5 A;  1PZ8 A;  5DAX A;  4P5H A;  3MV1 1;  1QJY 2;  1PK6 A;  5JIU A;  5J37 A;  3ILF A;  1U5Y A;  2OA2 A;  1JBC A;  3QCW A;  4XE9 A;  4B3N A;  1YFW A;  1JYV A;  3AVR A;  2OXB A;  2X10 A;  1XB9 A;  3V0B A;  1GNZ A;  4PHZ A;  1JH5 A;  4OQ8 A;  4QX7 A;  1Q8Q A;  2GN3 A;  1C57 A;  4XBN A;  3UL2 A;  5C3R A;  3I3B A;  2D6N A;  5FUI A;  4KQ7 A;  2W68 A;  4YVS B;  1GZW B;  3U78 A;  3ZFG C;  4PLO A;  4IND A;  1E57 A;  2PXJ A;  3KCC A;  2VCM A;  2XKP A;  1RMU 1;  1GMM A;  2GNM A;  2BNM A;  1LKN A;  1OUX A;  4YGE A;  4CP9 A;  4HON A;  2WS9 2;  4XAB A;  1QKQ A;  2VUA A;  3WF2 A;  2XVG A;  2PQQ A;  1KDM A;  2G9F A;  4OFG A;  4C1W A;  1FAY A;  3ZMN A;  1BHG A;  4OCT A;  1AXY A;  1RUF 2;  1FNZ A;  2JEN A;  3ZKY A;  2OS2 A;  4TTG A;  5FPX A;  1RMU 3;  1ZA4 A;  3ZLI A;  4OI0 A;  2A73 B;  3NMB A;  2VW0 A;  4ARX A;  3MEP A;  3ZR6 A;  3WQ0 A;  4MGT A;  3PU3 A;  3RI9 A;  2JD9 A;  4QWN A;  3U10 A;  3QD6 A;  1SLL A;  1VAK A;  5EPA A;  4DUX A;  4GMP 0;  3PVB B;  2QJV A;  3IDB B;  3IDA A;  2MNG A;  2WZP P;  4FSJ A;  4JRA A;  1LOD A;  4LK7 A;  3K77 A;  4KL1 A;  2WO2 A;  4FP3 A;  4D7T A;  2D43 A;  2R06 1;  5CZK A;  3BIE A;  4XTM A;  4ZXK A;  2RR1 2;  3FLT A;  1YJL A;  3WDT A;  1I5Z A;  4XOG A;  3BOP A;  1BEV 1;  2AYH A;  4P00 B;  4QQL A;  3ZFE C;  2R06 3;  5FOJ B;  5JSO A;  4KGQ A;  2OT7 A;  4UW6 A;  3BOW A;  4MHU A;  4NHK A;  4DOU A;  1AL2 1;  5A70 A;  5LCW L;  2B45 X;  4N43 A;  1BEV 3;  2HYK A;  5FYH A;  1K45 A;  2ATF A;  3QAC A;  1TMF 3;  3CEW A;  3KT1 A;  4LKF A;  3HT2 A;  3B7M A;  2JDM A;  1STM A;  1RHI 3;  4XUN A;  4ZZ8 A;  4ZHN A;  4QQ2 A;  3RZG A;  1CAV B;  1OH4 A;  1AL2 3;  2PEL A;  2I45 A;  1S0I A;  1GP6 A;  2D6K A;  3BI3 A;  3AP4 A;  3K48 A;  1LOG A;  5GLT A;  1AYM 2;  2BGP A;  2QNK A;  1J58 A;  4IEZ A;  4YG6 A;  4YW6 A;  3VDD A;  1AR8 3;  1LOB A;  4BB3 A;  4AR2 A;  4GWN A;  1QXJ A;  1W0O A;  2HBT A;  5A3N A;  5JWP A;  4AED B;  2WZ8 A;  3GBG A;  2A5Z A;  1KXG A;  2ZZJ A;  2Y6G A;  4BOW A;  1ZX5 A;  3MF9 A;  1WCU A;  3AZW A;  3F95 A;  4AFC A;  2HKX A;  1UZ0 A;  2FCU A;  2EVX A;  4A41 A;  4CTE A;  4CUC A;  2CY6 A;  5B2G B;  3LA3 A;  5L36 A;  1EUT A;  4XIO A;  2NM1 A;  3LWC A;  2Y8K A;  3P6B A;  4DXZ A;  3H3U A;  5FRA A;  4Y20 B;  1RTV A;  2A6Y A;  4W6W A;  2DBI A;  4LO6 B;  2IUW A;  1MEC 1;  4XVH A;  5BPX A;  3VBH C;  1UPI A;  1OF3 A;  2ZGP A;  2Q5T A;  1LOF C;  2A6X A;  3LEI A;  5FWJ A;  2DFC A;  3SCG A;  5C4W C;  2E53 A;  5FO8 B;  5JSP A;  3HR9 A;  4LNV A;  4AEM A;  2X5I A;  4YW4 A;  5IUQ A;  2CU5 A;  1VR3 A;  2CGP A;  4JQT A;  3ZYB A;  2JDH A;  4BXS V;  1UIJ A;  2XH6 A;  4RFT 0;  1CAV A;  1LAJ A;  5FZH A;  1OC1 A;  5I0T A;  1RMU 2;  5FQ0 A;  1UKG A;  2VZ1 A;  1MS9 A;  3POF A;  3PNA A;  4LIT A;  1W6P A;  4QX2 A;  1SDW A;  3OEA A;  5FKB A;  3GF6 A;  3WP6 A;  3I54 A;  3L9J T;  1JS9 A;  3CZU A;  4QAW A;  3CZJ A;  4XTP A;  2PN5 A;  3O7O A;  4UWD A;  2LM3 A;  5KXE A;  4HOO A;  3OTF A;  1JOP A;  5DAV A;  5JIA A;  1N3O A;  1UN1 A;  4I09 A;  2VMI A;  3AM2 A;  2FMY A;  1JMU B;  4K40 A;  4LOR A;  4OLL A;  4P08 A;  3VHN A;  4Y20 A;  4LKD A;  5EJZ B;  1W03 A;  3CJI B;  1XNT A;  4TSV A;  2R06 2;  2XOM A;  1N1V A;  1XYN A;  2LRO A;  5HV4 A;  1ZA7 A;  1RUI 1;  2J1E A;  3VBS C;  4CCO A;  1MZ6 A;  4KBZ A;  3SXW A;  1FMD 1;  2W1S A;  5DG2 A;  4D7Y A;  4NID A;  3FZ3 A;  4DQA A;  1BEV 2;  2ZCW A;  4D69 A;  2AEN A;  2XXZ A;  1WW5 A;  1QU0 A;  1CN1 A;  3BGA A;  3VBF A;  4CU7 A;  2ENR A;  1MQT B;  2AC1 A;  4C0B A;  4UAP A;  4IV1 A;  1RUI 3;  1RHI 2;  2ILM A;  4BM8 A;  3DEM A;  4NWV A;  1FMD 3;  1F31 A;  2IXK A;  1AL2 2;  3G7D A;  2ZHK A;  3VD3 A;  4NIH A;  2PHF A;  5K0U B;  2ZHN A;  5A7O A;  4P9W A;  3UKT A;  4WM8 C;  1SLB A;  3NNF A;  4FO9 A;  4A6O A;  1S0G A;  1GZC A;  2QQK A;  5T50 A;  5C8C B;  5C5T A;  5FXZ A;  4CPB D;  5GZF A;  1SBF A;  2FQP A;  4O65 A;  2XGX A;  2GZW A;  3NNJ A;  5I0U A;  5CFC B;  2QTW B;  1DGL A;  5AFB A;  2Q8D A;  3T3Y A;  2NPI A;  5E1R A;  5JXI A;  4QHZ A;  2GME A;  4Z2W A;  1FNY A;  4LBN A;  4XFF A;  1YQC A;  4ORF A;  5A6X A;  4KH9 A;  2A75 A;  4A3Z A;  1ASJ 1;  3BIW E;  5LEJ A;  5D8A B;  1IS6 A;  1H8V A;  2IZW A;  2XHN A;  1CX4 A;  4FPL A;  1PGS A;  3T4H B;  5FY1 A;  3VBR A;  3J26 N;  2JG9 A;  3AKS A;  2Z2S B;  4L2N A;  4JKL A;  1MEC 2;  2X29 A;  4A45 A;  4CEY B;  1ASJ 3;  1GNY A;  1S0E A;  1O6U A;  1CJD A;  1JHJ A;  4LT5 A;  1SEF A;  1ZRI A;  3MF6 A;  4AVC A;  4E4Z A;  1IS3 A;  1JHN A;  1AR9 3;  3FHA A;  4L92 A;  3O5S A;  3KM5 A;  4B8E A;  1CON A;  2FCT A;  1BXH A;  3W20 A;  2CAU A;  3NNM A;  2GU9 A;  1SBD A;  3FN9 A;  3ZVX A;  2QDR A;  2WNU C;  4PDW B;  4N53 C;  1NCR C;  3DYP A;  5CNA A;  2YZ4 A;  1W90 A;  2WFF 1;  5A6Z A;  5IVC A;  3GCW A;  4V2V A;  4XFA A;  5KC6 A;  3OBT A;  3AZY A;  4BQ4 A;  4LIV A;  3ZYI B;  3N9Q A;  4ES8 A;  1N1T A;  2XWB B;  4RS5 C;  2O8O A;  3AP6 A;  1OOP C;  2PAE A;  2VM9 A;  1VIW B;  4Y24 A;  4N7I A;  4B7K A;  3DPR B;  2EXH A;  2IXL A;  3OUI A;  4RGA A;  3ZN6 B;  3U4S A;  4CXX A;  3N36 A;  4MHR A;  3IKW A;  4OMC A;  4YW5 A;  1S4C A;  3VZO A;  5KR7 A;  5FYZ A;  4Q8K A;  2WWS A;  1NA1 B;  2YV8 A;  4Y22 B;  3RPQ A;  2J7M A;  3NRU A;  1XJA A;  1WMF A;  4HN0 A;  1POV 1;  5FK8 A;  2Y0O A;  2JDK A;  1W6Q B;  3LPG A;  3AC0 A;  4LIU A;  3VDA A;  5I8Y A;  1XE7 A;  1IQA A;  3BYW A;  2PHU A;  4HPK A;  1CR7 A;  4HXC A;  1ND3 A;  3AJY A;  2VZR A;  1RUI 2;  4EN0 A;  2P3K A;  4AFD A;  1H30 A;  2YU1 A;  1NE4 A;  1FMD 2;  1W8O A;  2P2K A;  3ZPO A;  4LLF A;  4CUG A;  3N9L A;  1POV 3;  1SMV A;  2D5H A;  1QNY A;  4XJA A;  4PDW A;  4S2H A;  3RZK A;  4QU2 A;  4AGR A;  1SBE A;  4WV8 A;  4DY5 A;  3C7F A;  4CP1 A;  1W99 A;  3SEE A;  1CIY A;  4J1W A;  5T3N A;  2K9Z A;  1FXZ A;  1H1A A;  1PM7 A;  1FYU A;  1REE A;  2DVD A;  1UAI A;  5FZO A;  4M0N A;  3HQR A;  4UFM A;  3I3D A;  4LUL A;  3I2H A;  5BYN A;  1KD7 A;  2XUE A;  3IDE A;  4WVM B;  1YQ8 A;  3ETP A;  1CAW A;  4IEU A;  4LLO A;  1H2N A;  2P34 A;  3TN9 1;  4XF4 A;  2R0F A;  3N9O A;  1C8M 1;  3JQX A;  1MR5 A;  3BU7 A;  2GMM A;  3I2O A;  3IZO A;  4MV2 A;  4RR3 B;  2VMD A;  1PO1 1;  2BRT A;  1OA4 A;  4KU8 A;  4QGL A;  4JGY A;  4CDQ C;  3B3Q E;  3TN9 3;  1ASJ 2;  4I0B A;  1S2B A;  3P3N A;  2BWC A;  1C8M 3;  1UY1 A;  1TVG A;  5CIR A;  3TNP B;  4DUW A;  5LW9 A;  4FXK B;  1G9F A;  2ZS6 B;  3IT8 A;  4JTN A;  4ZU5 A;  2WII B;  5HPO A;  1JW6 A;  2XML A;  1PO1 3;  1NG0 A;  3AYC A;  4FFF A;  3RRD A;  5JUV A;  2J1T A;  2Q1Z B;  3ON7 A;  1SDD B;  2GAU A;  1S2K A;  1FI2 A;  3DGT A;  3E97 A;  4PBO A;  4BQW A;  5DUV A;  4BQ3 A;  3HOB A;  2SBA A;  1GYK A;  1MS5 A;  2BGO A;  3QH6 A;  5F2S A;  2DVF A;  2XUM A;  4QX0 A;  4QPY A;  1W39 A;  4GJZ A;  4C0H A;  3OEB A;  5FRE A;  5FK7 A;  2ZTN A;  3CLP A;  2DTY A;  3ZYH A;  2QBX A;  3ZXG A;  1ZZC A;  2Y6H A;  2H0B A;  3DUI A;  1OFS A;  3KV9 A;  3Q8F A;  3CL1 A;  4QPG C;  3FUO A;  2XLF A;  5FZ6 A;  3U4X A;  2A3W A;  3I3Q A;  1GQP A;  3ZM8 A;  5IW0 A;  4GJY A;  1XOY A;  4IV3 B;  4KG8 A;  3VD4 A;  3KD4 A;  2W52 A;  1PMH X;  1UW8 A;  1WMX A;  5BNP B;  3IB3 A;  4FQ4 A;  1UYX A;  4RR3 A;  2B42 B;  5C9A A;  5ISL A;  1DQ4 A;  1JZ8 A;  4RYD A;  4AHY A;  1GV9 A;  3E5Q A;  3M4F A;  5FJK A;  1OLR A;  4TWT A;  1RUJ 1;  1QF3 A;  2B8M A;  3MIB A;  2BU9 A;  1LOC A;  4GWJ A;  3OYW B;  4IGO A;  5GZG A;  2DCT A;  2JDU A;  2A3Y A;  3AYE A;  2RJL A;  1O59 A;  1R08 1;  3H3Z A;  4GA9 A;  4C91 A;  1APN A;  1QIQ A;  4N8M A;  2ADE A;  3MW4 A;  2C0Z A;  1CGP A;  3LSD A;  1RGS A;  1RUJ 3;  3POI A;  4EWD A;  3AJZ A;  3SHR A;  1ZYB A;  2E32 A;  5DQ0 A;  2O0O A;  3D8C A;  1KS5 A;  1S2E A;  2G4I A;  3PME A;  4MXW B;  4PIX A;  1UOF A;  5ABJ C;  2RV9 A;  2WLP A;  2A70 A;  3USS A;  1SFN A;  5HXM A;  2WWU A;  3RJ2 X;  2DUQ A;  3DKQ A;  3QBQ A;  3SH4 A;  3Q8C A;  1H8T B;  3DEC A;  1E5H A;  4PIZ A;  3POW A;  4D6S A;  3AYD A;  5DAB A;  3O1T A;  1V6J A;  4UI9 L;  4B1M A;  2Z5W A;  3RYR A;  1XSQ A;  4IV3 A;  5F2W A;  3WT3 A;  3M2M A;  2ZGO A;  3VBO B;  4QDQ A;  4WVV A;  2JXA A;  1K5M B;  2Q8C A;  4Q0S A;  4NII A;  3NJY A;  2YC2 A;  1F4A A;  5FLJ A;  1OA3 A;  3AKQ A;  3MGU A;  1RUD 1;  3HEI A;  4L9B A;  5FZF A;  2JE8 A;  3TN9 2;  1C8M 2;  5FPL A;  1RIR A;  1VBC 1;  3NQH A;  3O14 A;  4ZS3 A;  5SV5 A;  3MIC A;  2P1B A;  1A78 A;  2EIB A;  3CKH A;  3III A;  3MYX A;  1PO1 2;  4P9Y A;  1Q8O A;  2CAV A;  2QQP A;  4Q26 A;  3VUO A;  2CGO A;  5EFU A;  1RUD 3;  4X8P A;  3BOD A;  4Y5Z 0;  1VBC 3;  2D3S A;  3BB6 A;  1OLM E;  2ARB A;  4HBN A;  4QDS A;  2WLQ A;  3SC7 X;  4ERO A;  4KI5 M;  2B46 X;  3PU8 A;  3EBR A;  2AEY A;  3O0X A;  3VD7 A;  2X09 A;  5FYY A;  5FZI A;  5I8S A;  2D3R A;  4GAZ A;  5L9R A;  3MIE A;  4XC9 A;  1H0B A;  1MS0 A;  1VJ2 A;  4AED C;  4AZZ A;  1GLH A;  2FD8 A;  4J25 A;  4AYU A;  1R09 1;  1WLC A;  2UY8 A;  1RED A;  4CDW C;  1JN2 P;  4AI2 A;  2PAK A;  4CU8 A;  3T2Q A;  2D6L X;  4XJZ A;  3MIF A;  3M3I A;  3WUD A;  4I01 A;  1AXK A;  2QZ3 A;  2IFW A;  3MLK A;  4GH4 C;  4KMQ A;  3ZFE A;  1RJ7 A;  1X33 A;  3VBO A;  4YLZ A;  4IE5 A;  4YW7 A;  1K5M A;  3I2F A;  5BNN C;  1G6N A;  1VMJ A;  2C6S A;  3MUZ 1;  1DCS A;  3RI8 A;  1GSL A;  3H1Y A;  1JYI A;  1KQR A;  1UOG A;  4ASM B;  5FYV A;  3KF3 A;  4AOC A;  1YWK A;  2VZT A;  3N9N A;  1RIN A;  2DVB A;  3IWZ A;  2X53 S;  4J1X A;  2EA7 A;  4MSV A;  5SV8 A;  2QQU A;  1UXZ A;  3PIJ A;  2V5D A;  2GMP A;  2JIG A;  1RUJ 2;  4DRV A;  4ZS2 A;  2DVA A;  3LDK A;  3H1M A;  5FZ8 A;  4F8A A;  4OHZ A;  1MVE A;  1J84 A;  4OUL A;  4JRL A;  1NCQ C;  3UGF A;  5F1R A;  3E5U A;  2OUJ A;  2O14 A;  1IOA A;  5ANQ A;  4XZU G;  2ZOE B;  4QM8 A;  2WYS A;  3ELN A;  1X7N A;  3KV6 A;  2DCJ A;  1C1F A;  2JG8 A;  3T0A A;  1D2S A;  4JZR A;  5FY7 A;  4ZKT B;  1BK1 A;  1CZS A;  1DDL A;  2P17 A;  3PUQ A;  4NHY A;  3OY8 A;  4CDU B;  4BHP A;  1OBN A;  1GZT A;  2Q30 A;  5A7N A;  3B69 A;  1PM4 A;  3OGV A;  3NAP B;  5GJ6 A;  2BOI A;  2BBV A;  2EAA A;  1CES A;  2YU2 A;  1LJ7 A;  1UOB A;  3WY6 A;  1I5P A;  4P02 B;  1BYH A;  4XMI A;  1QJE A;  3CJI C;  3G6J B;  1QDC A;  4WZC A;  5FCC A;  5C4W A;  4AF9 A;  3E6C C;  2HWB 1;  4CDX B;  3MFC A;  3OD0 A;  1NYW A;  4BXF A;  1QJZ A;  2CDP A;  3R4D B;  4AGG A;  2DUR A;  5JZG B;  3ACI A;  2ZGU A;  4JTO A;  2FMD A;  4BLJ A;  4H7M A;  4DO0 A;  2HJI A;  2D44 A;  1R64 A;  4Q0V A;  2EXK A;  1MQT C;  2HWB 3;  3KCX A;  1JUH A;  1RUG 1;  4AFA A;  4C8D A;  4HMZ A;  1U5I A;  1HXS 1;  1ND2 C;  1RUD 2;  3PUI A;  5A33 A;  2RS3 1;  4LBO A;  1VBC 2;  3O1P A;  1HB2 A;  1IKQ A;  2ZKL A;  1GP4 A;  1GP5 A;  4IDZ A;  2CTV A;  1UYZ A;  1WWY A;  2GH2 A;  2CGN A;  5JPM B;  1LHN A;  2EIG A;  3I59 B;  3MIH A;  3ORJ A;  1FAT A;  1HXS 3;  4FQZ A;  3FHI B;  3FJS A;  4DZG A;  3AK0 A;  3F2Z A;  2RS3 3;  3KCY A;  4MGK E;  5C6C A;  5C8C C;  4MZU A;  4MG2 A;  3LPF A;  1VB2 A;  4LOT A;  4V2W A;  4FFH A;  2CDO A;  1LGN A;  4BME A;  2VVE A;  4MUV A;  3J7H A;  5CFC C;  4L99 A;  4D3W A;  4DPN A;  2VY0 A;  3THP A;  1SLI A;  5I0D A;  1XNC A;  3UKN A;  2UU8 A;  4NRO A;  5CA6 A;  3M3O A;  1A6C A;  3JXS A;  2Q8O A;  5FWE A;  3AP5 A;  4CDX A;  5B4X A;  5D8A C;  1YXW A;  1IGO A;  3R4U A;  1V70 A;  2ZGT A;  4FAG A;  4E2Q A;  4YZ5 A;  1W0P A;  1UKR A;  3Q8E A;  1CD3 G;  2YYO A;  4LXL A;  1SPP B;  5FZE A;  5FR3 A;  4FXG B;  4QKD A;  1URX A;  4F3J A;  1KFX L;  1TNR A;  2QQV A;  4YM1 A;  3HJR A;  4ZON A;  4EJR A;  5ANN A;  2R7E B;  4PI2 A;  5F39 A;  3O1V A;  1PGW 1;  2A6W A;  2QFE A;  3RGB A;  5CKM A;  2EIE A;  4W8J A;  5J09 A;  3KHC A;  4XUR A;  2VQU A;  1EAH 1;  1R1A 1;  4Y5T A;  1WME A;  4A42 A;  4OZX A;  1S1A A;  3ZR5 A;  2ZAH A;  1L3J A;  5KBF A;  3LEM A;  4CCN A;  2Y38 A;  3LF7 A;  4O61 A;  3UGG A;  3PTY A;  1HB3 A;  1UIK A;  2FBE A;  3T1L A;  5A6Q A;  1M4W A;  1XXN A;  2D6P A;  4NE9 A;  4YM2 A;  5CKN A;  1EAH 3;  1R1A 3;  5JDB A;  2VJX A;  4L97 A;  3WV6 A;  3AZZ A;  4BPZ A;  4Q0U A;  1BBT 1;  3N3H A;  4AGV A;  5EJ3 A;  4DXS A;  1YFX A;  2GAL A;  2ORZ A;  3IM0 A;  4E2G A;  3DPR C;  2OZJ A;  2NLR A;  1Q56 A;  2BQP A;  4QKB A;  4K3U A;  1FPN 1;  2VVD A;  4FPK A;  1S0J A;  3RMY A;  4AFB A;  1BBT 3;  4YZ4 A;  5E6H A;  1KS4 A;  3A21 A;  3E5X A;  4Y3O A;  4K21 A;  2WA4 A;  1H2K A;  5IVY A;  2VUJ A;  3SNM A;  3VZN A;  4AVB A;  1UY0 A;  2VPV A;  5IK4 A;  5JXG A;  3U11 A;  3ZXA C;  1F5F A;  1FPN 3;  2HWB 2;  3V0B B;  2XJP A;  3LIH A;  3DF0 A;  5FYU A;  2OQ7 A;  1US2 A;  4EYU A;  1Y7B A;  3GGL A;  4MX3 A;  1RJ8 A;  4OHX A;  1IS5 A;  2QDN A;  3TYJ A;  1H1M A;  1SZB A;  1H9P A;  4DRR A;  2E26 A;  3OB8 A;  2JB8 A;  1RUG 2;  1GKB A;  1YQ6 A;  2VQ0 A;  2W47 A;  1HXS 2;  3SCH A;  4CEW B;  1HV1 A;  4COV A;  1PVC 1;  2RS3 2;  3NWK A;  3N7J A;  1WBF A;  3SEP A;  4OI4 A;  4QX1 A;  3TOJ A;  4ES9 A;  3U1X A;  3ZDV A;  2D6M A;  2VMF A;  2A1X A;  4CP9 B;  5T5O A;  3CDZ B;  1FOD 1;  1KJL A;  3OJB A;  4AVT A;  5AC9 1;  3LEG A;  5LRS A;  1PVC 3;  2VCB A;  4HET A;  1SCR A;  4IXL A;  1DGW X;  2QQM A;  3U37 A;  5BY5 A;  3LSE A;  4LO8 A;  1FV2 A;  3QLQ A;  1FOD 3;  2YPD A;  2ZMK A;  2Q1M A;  5AC9 3;  3HD8 B;  4XDP A;  1NLQ A;  2A6Z A;  3AZX A;  1GBG A;  1LOE A;  1PMI A;  2VMC A;  4HLT A;  3T2O A;  1MS3 A;  5C3O A;  3LDR A;  1ZZ6 A;  1ULG A;  3MLJ A;  3H7Y A;  1JZ7 A;  1W3X A;  4LHK A;  4Q8L A;  3LB9 A;  3OGR A;  5E16 A;  5IWF A;  3VL8 A;  5HV0 A;  4EE2 A;  1SG3 A;  3KB5 A;  3A7Q A;  4OHW A;  1Q8V A;  1X8M A;  4HK9 A;  4WM7 B;  2RHP A;  4AQS A;  3K75 B;  5H9S A;  3N4M A;  4A6S A;  4AI9 A;  2E9Q A;  3T09 A;  4FPF A;  4HN1 A;  5FBJ A;  1CPM A;  2CL2 A;  2EXI A;  5F5A A;  3WDY A;  4CEW A;  5FPA A;  4AI8 A;  3ALQ A;  1XE8 A;  1QY4 A;  3WW1 A;  1PGW 2;  4C1X A;  5FMC A;  4K9S A;  1QHD A;  2WZR 1;  4N43 B;  1EAH 2;  1R1A 2;  3OUJ A;  2GNB A;  5JOZ A;  3HNM A;  3OPW A;  1T6G C;  1W3V A;  3D6E A;  3J7M A;  4I2O A;  5J36 A;  3V56 A;  3N9P A;  5FY4 A;  4FFI A;  4UFL A;  4X6R B;  5I8T A;  5DPN A;  4QQH A;  3QH7 A;  5GLW A;  1IQD C;  3OGJ A;  2WZR 3;  3THC A;  3PHM A;  2QQI A;  4I0A A;  5F3C A;  2ZKN A;  2GC1 A;  5JMO A;  1XC6 A;  2QQJ A;  2ZAA A;  3B94 A;  4YZ3 A;  2WQ4 A;  3MV0 1;  1BBT 2;  4H14 A;  3VDD B;  2PQS A;  2XVL A;  3TB0 A;  5BNP C;  4MH0 E;  1S0B A;  5C3Q A;  4Q5O A;  3P1I A;  2BER A;  1JZ2 A;  1XPW A;  2JDP A;  3NVC A;  3POY A;  4UFH A;  5DDJ 1;  3RFR A;  1FPN 2;  4QXK A;  3EXU A;  4PJY A;  2E33 A;  5B4N A;  2EXJ A;  1ZZB A;  3JQW A;  1ENS A;  4IEW A;  4WM7 A;  5G04 L;  4COU A;  2IXH A;  5FZL A;  3B02 A;  2WO7 A;  1A3K A;  2W2I A;  3K46 A;  4Q4X 1;  1KRI A;  3EO6 A;  5DDJ 3;  1U5Z A;  3T2P A;  1TMF 1;  3WP4 A;  5DAQ A;  2JD4 A;  4Y1X A;  2VXJ A;  3SMH A;  1RHI 1;  4D6Q A;  5CFD B;  4NN0 A;  4BYY A;  2BYV E;  4L8Q A;  3P5B A;  3IMN A;  4Q4X 3;  2X5I B;  3AMN A;  4GWM A;  5EHD A;  4AE2 A;  1TE1 B;  4YFW A;  1AR8 1;  5FFO C;  5FP9 A;  5L73 A;  1H8T C;  4AK3 A;  3RG0 A;  4CUB A;  1PVC 2;  3AVS A;  1W6M A;  1NQD A;  2Y6F A;  1AX2 A;  4IQP A;  1Q43 A;  2OYZ A;  1WW4 A;  5IVV A;  5LEK A;  5FQ0 B;  2BTV C;  3PVE A;  4AFM A;  5HCH A;  4O9G A;  4RN5 A;  1MZ5 A;  4WVZ A;  1FOD 2;  1W6P B;  4YM0 A;  1S0C A;  4PT6 A;  5AC9 2;  1QEX A;  5F32 A;  4NUB A;  1AHS A;  5LRR A;  5AVA A;  4MGQ A;  3W21 A;  1V9U 3;  1W8H A;  4XCB A;  3THT A;  4URA A;  1G9D A;  3PDQ A;  1UU5 A;  4N9H A;  2VME A;  2CYF A;  3ZFF A;  2D97 A;  5KHK A;  5FZA A;  5BNO A;  3MBW A;  3M3Q A;  3V0A A;  3FFQ A;  2LUW A;  3GXU A;  1OI6 A;  5GKA C;  2BJS A;  4XF9 A;  3BUC A;  5KXC A;  2CHH A;  1NE6 A;  2A71 A;  2DU0 A;  2Y33 A;  3POB A;  5A3O A;  4AHX A;  3H9A A;  3I7D A;  5FZG A;  3J9S A;  4H7L A;  3ACL A;  2CWS A;  3PIG A;  5FUN A;  3ZYJ B;  5FTT C;  5CFD A;  5ABJ A;  1FT9 A;  3D0S A;  2UWC A;  3WR0 A;  4CCL A;  2J1A A;  1LHU A;  3LFI A;  1S0D A;  4HAN A;  3VZJ A;  3VBF B;  3LA7 A;  4UW5 A;  2E7Q A;  2PHR A;  4IV1 B;  1X9T A;  3UYJ A;  2DCY A;  2Q4S A;  4P9J A;  3WX5 A;  2WZR 2;  5GZE A;  4NRP A;  3CBN A;  1V6K A;  3KQ4 B;  4QT6 A;  3HAG A;  1IPK A;  1IZ3 A;  2OQ6 A;  1XU2 A;  4A4A A;  1LU1 A;  3HBZ A;  3H8X A;  1T2X A;  1UX6 A;  1UU6 A;  4BQ1 A;  4CU9 A;  1B35 C;  1N47 A;  5EYY A;  2OKX A;  1WLD A;  2C24 A;  2GH8 A;  1UXX X;  1RUO A;  2J1S A;  4IE0 A;  4AQ6 A;  1WKY A;  2YUE A;  5LBB A;  3GAL A;  1DHK B;  4RQP A;  4AWD A;  4E4D X;  4NIA A;  1PMJ X;  3HBK A;  2XLA A;  3GNE A;  4CP0 A;  2WUH A;  3A0N A;  3JZV A;  3NW4 A;  4FOV A;  2QCS B;  1POV 0;  5DDJ 2;  3WNN A;  1QJF A;  2IWG B;  1GWK A;  4CCD A;  1BMV 1;  1O8P A;  1HLC A;  2WFP A;  1GUI A;  1MZE A;  2JG9 B;  3N7K A;  4XFH A;  4HG6 B;  4FPO B;  5L9B A;  3VBR B;  2ET1 A;  5FPU A;  2YXS A;  2AEZ A;  4Q4X 2;  3WF4 A;  5IFT A;  4CDW A;  2C1F A;  3HNY M;  4NPR A;  1TMF 2;  3PTR B;  3H42 B;  2YBS A;  4P9X A;  4RSU A;  5LA0 A;  2VCA A;  3WCR A;  4AEK A;  5KWR A;  4EN6 B;  4JDM A;  4GH4 A;  2W87 A;  4YGC A;  3ITQ A;  4CDU C;  1JYC A;  4DUV A;  2FZ2 A;  2GDF A;  5KXB A;  1ZZ9 A;  1XYP A;  3THD A;  2ZXQ A;  5BNN A;  1AR8 2;  2QQN A;  4K7J A;  4U2A A;  1N3Q A;  2W1Q A;  2WNV B;  4CUA A;  4Q2F A;  4YVW B;  3VKF C;  4QQO A;  3ZXK A;  1V9U 2;  2J1U A;  5JVV A;  4I3P A;  2ID4 A;  3RWN A;  2DYC A;  5APA A;  1DQ6 A;  3ZIW A;  1ZRD A;  3WF3 A;  2JDA A;  4XYX A;  3WG3 A;  3NJX A;  3POJ A;  1WLT A;  4CXY A;  2ARX A;  4QB1 A;  1D0G A;  5H9P A;  1JXN A;  2VNG A;  5A3T A;  2VW1 A;  1PIV 1;  3MPB A;  4PQQ A;  3DXU A;  2HLE A;  1NCQ A;  4Y1V A;  1LED A;  1OUR A;  1NKG A;  2XJV A;  3O0V A;  4ATF A;  2R1D A;  1GNH A;  1YIP A;  4NRQ A;  3LKJ A;  1JU3 A;  2JDY A;  1AR9 1;  4MGZ E;  4XBQ A;  3CJX A;  2YHJ A;  1PIV 3;  3SIT A;  2WAB A;  1JTZ X;  3W58 A;  4BK4 A;  4COZ A;  5EZW A;  4Q27 A;  3DL3 A;  1RUE 1;  2ETE A;  4HPK B;  1ND3 B;  2ZZQ A;  2FCV A;  1Z78 A;  4XQW A;  4K6B A;  2PAM A;  1PO2 1;  3VGI A;  3M3E A;  3AKR A;  3J8F 1;  4KWL A;  1JOB A;  1QMJ A;  2YGM A;  3NKG A;  2VOX A;  4KWJ A;  2E7A A;  5J3U A;  3WNL A;  1RUE 3;  3BN6 A;  1NT0 A;  1LGC A;  5D21 A;  3RZZ A;  5DMY A;  2WNV A;  4XET A;  3C8X A;  4XEZ A;  2DDU A;  2OX0 A;  4YVW A;  3SH3 A;  1JZ5 A;  1PO2 3;  3J8F 3;  3ILN A;  3ZOI A;  2ZEW A;  4G3Y C;  5FZO B;  3WDU A;  1RUH 1;  4UFJ A;  2MPF A;  1TNF A;  1ZBE 1;  4LUM A;  1C5H A;  1WCK A;  1RVF 1;  1AXZ A;  2UYB A;  4XW3 A;  5FPB A;  3IBM A;  2LS6 A;  4JHT A;  1ND2 A;  4BIS A;  2KA3 A;  4Q4W 1;  1WCQ A;  5FPV A;  1CAW B;  4EN7 B;  1RUH 3;  3M3C A;  2RM2 1;  1UY3 A;  3HWJ A;  1ZBE 3;  4FI9 A;  2XKO A;  2XJS A;  4JGZ B;  4I0W B;  5T5J A;  2Q1F A;  3RZH A;  1UMH A;  1RVF 3;  2RE9 A;  1XND A;  5FYI A;  3NL1 A;  5JAX A;  2VQA A;  1Y43 B;  4FPY A;  2CSG A;  4Q4W 3;  3KGZ A;  2DUO A;  1A8D A;  4JGY B;  2RM2 3;  4S2D A;  3KVB A;  4AVS A;  1C1L A;  5DN2 A;  4DIQ A;  3PVN A;  4ZY9 A;  2ZX0 A;  3WNX A;  1BMV 2;  1VAV A;  2R49 A;  1AL0 G;  4KU7 A;  3DV8 A;  1OUS A;  1DGR A;  3KQR A;  5BV6 A;  4KNC A;  2ZAB A;  3JBG 1;  2BNO A;  1UY4 A;  3GBW A;  2P5B A;  1RXF A;  2P3I A;  3B01 A;  4H2A A;  4S2F A;  3C7H A;  1DLL A;  3ENR A;  1RYY A;  4QPI C;  4BQY A;  1W6N A;  1C8N A;  1L7L A;  3JU9 A;  2QZ2 A;  1PK6 C;  3FE5 A;  3JBG 3;  1D0H A;  3CIH A;  3O0W A;  3TRS B;  1JOJ A;  2PLV 1;  3MIG A;  1J59 A;  2BP6 A;  4U36 A;  5LWB A;  3OPT A;  5I91 A;  4QGN A;  2QKD A;  4FVV A;  3LOB A;  1TEI A;  3UJO A;  4MXV A;  5BXX A;  1I9R A;  5KXD A;  4JGZ A;  2OZ6 A;  4LA2 A;  3W5M A;  4XIK A;  1H9W A;  2PLV 3;  1F2N A;  1GU3 A;  2W0X A;  5T54 A;  2K46 A;  1PIV 2;  5C9A B;  3E6B A;  2HH9 A;  2PHD A;  2R16 A;  3JB4 C;  1WW7 A;  1AX0 A;  4EV0 A;  5CAD A;  5C3P A;  1J83 A;  1NUK A;  4XFG A;  4OUS A;  1AR9 2;  2G1M A;  1QGL A;  4XUP A;  4A2U A;  4SBV A;  4X6Q B;  1XSR A;  4JVA A;  4LHN A;  3N35 A;  1RUE 2;  4CE8 A;  3U75 A;  4M0H A;  2PTM A;  1OSG A;  1PO2 2;  3URF A;  1W6O A;  3J8F 2;  1WCD J;  2AAC A;  2R0H A;  3T1M A;  4N90 A;  4PI0 A;  1NXD 1;  1QOS A;  1SAC A;  2P37 A;  4IUG A;  3T0B A;  4QXH A;  5LA2 A;  3VLB B;  3DKW A;  3SKV A;  4A44 A;  1ULE A;  4DNY A;  3AL5 A;  5A32 A;  3U07 A;  4HFS A;  2VBB A;  3ABZ A;  4FTB A;  3I2K A;  1RUH 2;  5FYC A;  3KT4 A;  1ZBE 2;  3KWV A;  5EV7 A;  1GAN A;  2WNO A;  1BCX A;  1IKP A;  5FLH A;  1RVF 2;  3M8L A;  1OD3 A;  5C5U A;  5K7P A;  2BVV A;  3AB0 A;  3HMY A;  4Y1Y A;  3TBD A;  4AW7 A;  2QQW A;  4B4Q A;  2WO1 A;  4Q4W 2;  4QD2 A;  3GHN A;  4YVS C;  3ZYG A;  2ZGL A;  3VBU A;  2VGD A;  3S6P A;  2RM2 2;  2YFU A;  5EQU A;  4Y26 A;  4QKF A;  1PX3 A;  3CMG A;  1LHW A;  2VNO A;  4FTS A;  2WR9 A;  1CVN A;  2N7G A;  1EY2 A;  4N43 C;  3USU A;  1NY7 1;  1AUY A;  5L7O A;  1HB1 A;  3C7G A;  3K4Z A;  1OLM A;  4MGI E;  3WQ7 A;  1Y3T A;  5FZ0 A;  5KHG A;  3AX4 A;  3SKJ E;  3TEX A;  4HKO A;  3JD7 1;  5FYB A;  1JOD A;  1NOV A;  2F17 A;  4YGD A;  1W9F A;  2ZX1 A;  2VU9 A;  1D4V B;  3WNK A;  4UXA A;  3LA2 A;  1QJU 1;  3GJB A;  4BQ2 A;  4MVT A;  3ZKU A;  1LEC A;  3VDD C;  1WBL A;  3JD7 3;  5C71 A;  3JBG 2;  4QX3 A;  1FX5 A;  3EYP A;  5HCF A;  1QDO A;  3ZSE A;  2YY1 A;  4RFR B;  5JI7 A;  2XJQ A;  1G9C A;  2B9U A;  4DEV A;  1VRB A;  1QJU 3;  5GZD A;  2YC4 A;  4P14 A;  5A3M A;  1X36 A;  2Z42 A;  2PYT A;  4W65 A;  4DS0 A;  3IPV A;  4AQ2 A;  1OHF A;  2YPJ A;  3O1M A;  2QUO A;  3MUY 1;  4GB3 1;  2PLV 2;  3ZFE B;  3JCI A;  2Q8E A;  2WIN B;  4L11 A;  3ZFG A;  2XDV A;  1J3Q A;  2ET7 A;  4LR4 A;  1HV0 A;  4I3G A;  5CVR A;  1D2Q A;  2D93 A;  4AL9 A;  2A6V A;  3OG2 A;  4XQD A;  3ZSJ A;  5CAZ A;  4E4S A;  4Q4Y 1;  1PNG A;  1NLS A;  4YAR A;  4GB3 3;  5D1I A;  5ACA 3;  4QKN A;  3Q8B A;  3RZM A;  5F8P A;  2X5I C;  2VZV A;  3PVO A;  2ZEX A;  4BH9 A;  5C3S A;  1Q5O A;  3OGS A;  2WT2 A;  2DVG A;  2VR4 A;  4FP2 A;  5TSW A;  4HVR A;  1AVB A;  4Q4Y 3;  4Y1U A;  4TZD A;  4LOS A;  3Q9O A;  4QGM A;  2NP0 A;  3GHM A;  5EYX A;  4E27 A;  1ST8 A;  4A7Z A;  2F4P A; 
#chains in the Genus database with same CATH homology
 3K3O A;  4QX8 A;  5IVE A;  5FJH A;  4CCJ A;  3KV9 A;  3K2O A;  5FZ6 A;  5FZ8 A;  4D6Q A;  5FZC A;  5IW0 A;  4GJY A;  4CSW A;  5E6H A;  3PUS A;  4Y3O A;  5ANQ A;  5F3G A;  5FZ4 A;  5IVY A;  4IGP A;  3LD8 A;  2VD7 A;  5FP9 A;  4EZH A;  3KV6 A;  5A7Q A;  5A3T A;  3RVH A;  5ISL A;  3AVS A;  5IVC A;  5FY7 A;  5A3W A;  4V2V A;  5FJK A;  3DXU A;  4UF0 A;  5FYU A;  5FZ7 A;  2OQ7 A;  3PUQ A;  4LIV A;  3N9Q A;  5FYT A;  4EYU A;  5FWJ A;  5K4L A;  5IVV A;  3KVA A;  4IGO A;  4XDO A;  5A7N A;  5A3P A;  3KV4 A;  5F32 A;  5FY8 A;  5F3E A;  4NUB A;  2YU2 A;  5FXV A;  4QXH A;  3AVR A;  5FY5 A;  4URA A;  5FP8 A;  5A80 A;  3U4S A;  2YBK A;  3PDQ A;  3AL5 A;  5FZH A;  5FY9 A;  5KR7 A;  4QX7 A;  5FZA A;  5FYZ A;  4BXF A;  5FYC A;  4LIT A;  5FUP A;  4DO0 A;  2GP5 A;  4Y33 A;  2WWU A;  5FZ1 A;  5A7P A;  3U78 A;  4LIU A;  4D6R A;  5LY1 A;  5FZG A;  5LW9 A;  4C8D A;  4D6S A;  2OX0 A;  4TN7 A;  5F5I A;  5FUN A;  4HOO A;  5F5C A;  2PXJ A;  2YU1 A;  5FXW A;  4CUG A;  3ZPO A;  5FZO B;  3KV5 A;  3N9L A;  5FY0 A;  2YPD A;  4CCL A;  4HON A;  4XDP A;  5F2W A;  3N9M A;  5FPB A;  4CCK A;  4BIS A;  5FZ0 A;  2Q8C A;  5FYB A;  3NJY A;  5FPV A;  3UYJ A;  5A1F A;  2OS2 A;  3LDB A;  5IWF A;  2YBP A;  5FZF A;  3ZLI A;  2WWJ A;  4V2W A;  5FZO A;  3DXT A;  5A7W B;  4CCO A;  5FPL A;  5FZK A;  3PU3 A;  4QWN A;  4AAP A;  3AL6 A;  5FYI A;  2OQ6 A;  5A1L A;  2XXZ A;  2XUE A;  4AI9 A;  5CEH A;  5FZD A;  5FP4 A;  5FBJ A;  4CCM A;  5F5A A;  5FP7 A;  5FPA A;  3KVB A;  1VRB A;  5FWE A;  4BU2 A;  5A7W A;  5FV3 A;  4DIQ A;  3N9O A;  3PU8 A;  3OPW A;  4ASK A;  5IVB A;  4LXL A;  5FZE A;  5A7O A;  5FYY A;  3N9P A;  5FZI A;  5FY4 A;  4GAZ A;  2Q8E A;  5FZB A;  2XDV A;  5FZ9 A;  5FZ3 A;  2P5B A;  2OT7 A;  4IGQ A;  4UF0 B;  5FXZ A;  4EZ4 A;  5F39 A;  3K3N A;  5F3C A;  4QXC A;  2XML A;  5FYH A;  5FYS A;  5IVF A;  2Q8D A;  5FPU A;  2GP3 A;  4QU1 A;  4Y4R A;  5FP3 A;  3PUR A;  4GD4 A;  5F3I A;  4CCN A;  3PTR B;  5LWB A;  2YBS A;  3OPT A;  3PUA A;  5FYM A;  5FXX A;  5IVJ A;  5F37 A;  5F2S A;  5LY2 A;  5FYV A;  4QXB A;  4E4H A;  4GJZ A;  3N9N A;  5FY1 A;  5FZL A;  5A3N A;  2W2I A;  5A7S A;  5FZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...