2FZ1A

Structure of empty head turnip yellow mosaic virus (atc) at 100 k
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
163
structure length
163
Chain Sequence
SPFTIKQPFQSEVLFAGTKDAEASLTIANIDSVSTLTTFYRHASLESLWVTIHPTLQAPAFPTTVGVCWVPAQSPVTPTQITKTYGGQIFCIGGAIQTLSPLIVKCPLEMMQPRVKDSIQYLDSPKLLISITAQPTAPPASTCIITVSGTLSMHSPLITDTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein
publication title The RNA of turnip yellow mosaic virus exhibits icosahedral order.
pubmed doi rcsb
source organism Turnip yellow mosaic virus
molecule tags Virus
total genus 29
structure length 163
sequence length 163
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00983 Tymo_coat Tymovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2fz1A00
1HRI3 4RQPB 2RS12 5BNOB 1RUI1 1PIV2 1COV1 1AYN2 2GSYA 1QQP2 1NCRB 1RUJ3 4CDUB 4JGYA 1PO22 1TMF3 3TN92 5D8AC 3CJIB 1R1A1 2RR13 2ZAHA 3ZFFA 5CFCB 1TME3 2HWD2 2RS11 1PIV1 2MEV3 1AYN1 2RM22 1QQP1 4NWVA 5D8AB 1BEV2 1ND3C 3VBFC 4IV1B 5FOJB 1FMD2 2WS91 1PO21 4CDWB 5BNOA 2WZR2 2HWB3 1PO12 3J8F3 3VBFB 1VBE3 1ND3B 2X5IB 1ZBA2 2HWF2 2BFUS 3JBG2 2HWC1 5AC91 1PVC3 2RM21 1BEV1 1RUH2 1R091 1FMD1 1VBD1 5JZGC 1RVF2 1B35C 1ND2A 2XPJA 3VBSB 4GMP3 1ZBE3 1X36A 4CEWC 1HRV2 4FTEA 5D8AA 1PO11 4PDWC 1ZBA1 2HWF1 3JBG1 1MEC2 4WM8A 5JZGB 1B35B 4Q4W2 1RB8G 4YVSC 4PDWB 4RR3C 1RMU2 1HRV1 5BNPA 5ABJA 2WLPA 1PGL2 1BBT1 1FOD3 1VRH2 2RMU3 1Z7S2 5J98B 1ASJ3 4Q4W1 1AR92 1AR71 4RR3B 1K5MA 3ZXAC 1C8M2 4QPGC 4QPIA 3ZFFC 3ZFEC 4JGZA 1RMU1 1AL21 1B35A 1RUF1 1VB2A 2BBVA 4CEWA 2HWE1 1VRH1 2Y26A 1POV1 1RUC3 1Z7S1 1RUI2 1AR91 5FMOL 3NAPC 3ZFFB 2FZ2A 3ZFEB 1C8M1 1AR61 2XBO2 1OOPA 1VB4A 2RS13 1PIV3 2R061 1D4M2 1AYN3 4YVSA 1R1A2 1QQP3 3ZFGA 5DDJ1 1RUD2 1PO23 3TN93 4Q4V2 1ND2C 1C8NA 2XBO1 4IV3C 2WS92 2HWD3 2WFF1 4QPGA 1D4M1 3VBRC 1RUG2 4EJRA 3FBMA 2RM23 1BEV3 3ZFEA 1RUD1 4WM8C 1R082 4CDXA 1RUE2 1ND2B 2R042 2WZR3 4Q4V1 2HWC2 3DPRA 5AC92 2BPA2 1V9U2 1HRI2 4RHV2 1R092 1PO13 1VBD2 3NAPA 1ZBA3 2HWF3 4WM8B 5BNPC 2RS32 1RUG1 5ABJC 1GFF2 5CFDC 4AEDA 1QJX1 1RUH3 2VQ0A 4RFT0 1R081 1EV12 1RUE1 1RVF3 2R041 1OHFA 1K5MC 1VBA1 1NOVA 4CEYA 1V9U1 1A6CA 5BNPB 1HRI1 1HRV3 4QPIC 4RHV1 5ABJB 2R073 2QQPA 1W39A 4JGZC 4Q4X2 2RS31 1MQTA 4IV3A 1MEC3 5BNNB 1FPN2 4Q4W3 1K5MB 4GH4A 3VBRA 3VBOC 1EV11 4QPIB 4YVWA 3VBHA 1BBT2 4SBVA 1AR82 4N43C 4JGZB 1RMU3 1OOPC 1AR72 3J8F2 4CEWB 1CD3G 3JD72 4Q4X1 1X33A 2RS52 3VBOB 1Z7S3 3ZFGC 1FPN1 1AL22 1AR93 1RUF2 5K0UC 4N43B 1C8M3 1OOPB 2HWE2 5CFDA 1AR81 2HWB1 4YVSB 1VAKA 1F2NA 3J8F1 3ZFGB 2PLV2 1HX6A 1AR62 3JD71 2RS51 1POV0 1RHI2 4LLFA 1RUI3 1PVC1 4CDQA 4N53A 1NCQC 1COV3 2R062 3M8LA 4CDXC 1NA1C 1IHMA 1VBB2 5DDJ2 2XBO3 3DPRC 1AYM2 1QJY2 4QPGB 5GKAC 2GH8A 3VBOA 1R1A3 5C8CC 4N43A 2PLV1 4CDXB 1FOD2 1NA1B 1RUD3 5C4WA 5A32A 1RHI1 1VBC2 2WFF2 4AEDC 4Q4V3 3DPRB 5FMOS 1EAH2 1VBB1 3NAPB 5K0UA 2WS93 1AYM1 1QJY1 4CEYC 5C8CB 1QJU2 1RUG3 5C9AA 4AEDB 5L7OA 1MQTC 1FOD1 1QJZA 1R083 1RUE3 1VBC1 2RMU1 2R043 4GH4C 5ACA2 4CEYB 2HWC3 4Q4Y2 5AC93 1V9U3 1EAH1 4YVWC 3VBHC 1NY72 1QJX2 4CDUC 1NCQA 4RHV3 3VDDA 1R093 1FMD3 1VBD3 3CJIC 1NA1A 1QJU1 4GB32 1MQTB 4IV3B 3VBUA 2RS33 2ZTNA 1VBA2 5CFCC 1HXS2 4GH4B 3VBRB 4WM7A 1EV13 4YVWB 3VBHB 1RUC1 2DF7A 5C8CA 3JBG3 5ACA1 4IV1C 4Q4Y1 3S6PA 1H8TA 4Y4YA 1NY71 4CDWC 1RUJ2 2BUKA 4GB31 4RS5A 1TMF2 4FSJA 4Q4X3 2FZ1A 1HXS1 1NG0A 2RR12 5A33A 1FPN3 2X5IC 5BNNA 1CJDA 1TME2 4CDQC 5CFDB 4N53C 4RQPA 1BBT3 3TN91 2MEV2 2BFUL 1AR83 3JB8A 4FTSA 1AR73 1NCRA 1OPOA 1RUJ1 3VBSC 2HWD1 1F8VA 1TMF1 3JD73 2TBVA 4CDUA 2RS53 4Z92B 4CDQB 4N53B 2HWB2 2RR11 3CJIA 1AL23 1E57A 5C4WC 3IDEA 1RUF3 1TME1 5CFCA 1VBE2 2HWE3 1VRH3 2MEV1 1SMVA 2WZR1 1POV3 1PVC2 4NWWA 2R072 4IV1A 1WCDJ 2PLV3 1AR63 5C4WB 5A32B 4CDWA 5C9AC 3JB4C 1ZBE2 5L7OC 1RHI3 1AUYA 1DDLA 5J96B 2R063 1RUH1 4FTBA 2ZZQA 1VBE1 1RVF1 1VBB3 5DDJ3 3VBFA 5K0UB 1ND3A 2X5IA 1AYM3 1QJY3 4GMP0 1M06G 3VDDC 1PGW2 5C9AB 5L7OB 2R071 3VBUC 4GMP1 1ZBE1 1MEC1 3LOBA 1VBC3 2WFF3 3VBSA 4WM7C 1D4M3 1AL0G 1HQNA 1NCQB 1EAH3 4JGYC 3VDDB 4BCUA 2WWSA 1BMV2 3HAGA 2RMU2 1H8TC 1QJU3 3VBUB 2IZWA 5JZGA 1PGW1 1ASJ2 4RS5C 4WM7B 1PGL1 4JGYB 4PDWA 5BNNC 1COV2 5ACA3 5LK7B 1H8TB 4Q4Y3 4RQPC 5BNOC 1QJX3 4RS5B 1BMV1 1RUC2 4GB33 1NCRC 1ASJ1 1VBA3 5A33B 1HXS3 4Y5Z0 4RR3A
chains in the Genus database with same CATH superfamily
3MF9A 3ACFA 2K0GA 2EXHA 4Z82A 1O5LA 5E1RA 4CCLA 2RS12 3W9AA 3KT7A 1UY3A 2D6PA 4IEUA 3AL6A 3ETPA 2YU1A 2A3XA 3VD3A 2W39A 2EXJA 1DYKA 3IDCB 2GSYA 2QNKA 2VUCA 2WO2A 5F5QA 1ENRA 4TZDA 3VZLA 4B4RA 1YC61 1S1AA 4FFHA 4AW7A 4MUVA 2BTVC 2SBAA 3TN92 4IE7A 1V6NA 4AEJA 1R1A1 4QB2A 2BOIA 4QPYA 2K46A 2VG9A 1ZA7A 2AR6A 2V5YA 2W94A 1RUNA 2DVFA 4FCAA 3V56A 2RS11 4LMFA 1NLSA 3KMHA 1U12A 1XSQA 5FZKA 1TNRA 2D3RA 2NZ9A 3GCXA 2W1WA 3A4UA 4IEVA 4JKMA 1WLTA 4B4PA 3LD8A 2Q4SA 4CE8A 2RM22 3VBFC 3OBRA 2JG8C 3WD5A 1H6XA 5E8AA 1KS5A 1YJKA 2WZEA 3AK0A 2GNTA 3ETQA 1A34A 3OBTA 1PMHX 5BNOA 4OHXA 2W92A 1LEDA 2D97A 2UYBA 2W0XA 2D43A 3O1MA 3MLKA 5GZEA 1PGSA 4UFJA 2WN3A 3C7EA 3DGTA 1X7NA 2BEOA 3VBFB 2HJIA 2QCSB 2HKXA 4RSUA 3KZ4C 3W5MA 1O6UA 2HWF2 2WAOA 4Q0UA 3J7MA 5EJZB 3T2TA 3UK9A 3S5QA 4S2GA 2FQPA 2HWC1 2Z79A 5T52A 3NKGA 3SH5A 4R52A 2RM21 4OHZA 4EN9B 1HN1A 1QJEA 1Z0HA 2WNVA 5JZGC 1RVF2 3EQEA 3WLUA 5DAVA 2QQUA 2V09A 5LBFA 3N4MA 2OS2A 4MVTA 1OQEA 3MLJA 1KEXA 4F83A 1H2KA 2YUEA 4O9EA 5F1RA 1AJKA 2WYSA 3A21A 2ORXA 3TBDA 2Y64A 5EJ3A 2HWF1 1BQPA 2XJRA 1HQLA 4Y1XA 5JZGB 2Z2SB 3ON7A 4Y22B 1C5IA 1OF3A 4Q4W2 4Y33A 1PX4A 2R7EB 4C1XA 2A7AA 1XSRA 2VOXA 4LO5B 1MS5A 4NAOA 4YVSC 5I0DA 4UAPA 4ISQA 2J22A 4YW2A 3UGHA 5FP8A 4CXYA 1O4TA 4RR3C 3HT2A 4QX8A 4IEWA 2OXBA 1XYOA 1T6BX 3KV9A 3TEWA 3VZJA 1PHMA 3ZYIB 4PQQA 4BA6A 4Y24A 4LK7A 4QKNA 5ERLA 4AI2A 3OSDA 1PZ9A 1PGL2 1BBT1 1FOD3 1VRH2 1S0DA 1UXXX 4K9SA 2PHDA 3A23A 3GZEA 3NNGA 1IQDC 4MO3M 4AFAA 1PZ8A 1UPSA 5FZ0A 1PVXA 4Q4W1 1AR71 4RR3B 2D6LX 1J3RA 4NVPA 2VGDA 5FTTC 3RQ0A 3ZXJA 3IN9A 4UF0B 4WV8A 2PHWA 5H9QA 5HBAA 3V0BA 1LOGA 3ZFFC 4Q29A 1W9YA 3ZFEC 3WDXA 4NIHA 3N35A 1AL21 2H0VA 5HV4A 1RUF1 2VL4A 2VBBA 3A7QA 4Y1UA 3WVJA 4CP9A 4H14A 4X8PA 1X82A 2IXIA 4D69A 2HWE1 1VRH1 2BJSA 2Y26A 5B4NA 1HLCA 1UMHA 3X29B 4DY3A 1HB1A 2BQPA 3E6DA 4AVAA 1SBDA 3AYDA 3MFCA 1Q8PA 4URTA 1SG3A 3RPQA 1CZVA 3GJBA 3ZFFB 2FZ2A 3ZFEB 3V0AA 3INAA 1QY4A 1DIWA 5IAXA 2XJPA 2VVDA 4Q5OA 4D7TA 4X6QB 2R061 2PAMA 1D4M2 2V5DA 4X6RB 3O1TA 4GWIA 3WCSA 3H8RA 2Y6LA 2PHTA 3QH7A 4H7MA 3ZN6A 1WMEA 3AFGA 1S0GA 4Y4RA 4BIOA 4MZUA 1G6NA 3FJSA 2C26A 5CKMA 4LUKA 3J7NA 2L9LA 1I5PA 3WF2A 2QBXA 4LIUA 4CXWA 4EZ4A 3R0RA 1O5UA 5F37A 5JOYA 5JOWA 5E16A 2JKXA 1I5ZA 4XFHA 2VBPA 1XJAA 5EWSA 2ID4A 5FXWA 2W52A 1D4M1 1N3QA 3CMGA 1OXCA 4OUSA 3VZOA 5J1XA 5LWBA 3L9JT 4MG2A 1BKZA 2VZVA 3IDAA 3KB5A 4QX1A 3WNOA 4BM8A 1SQ4A 2AUYA 3AZYA 3ITQA 2OKXA 1UZWA 1E5IA 2AZ5A 2D3PA 2DTYA 2VQUA 4PT6A 4RL7A 4CCOA 1XYNA 2R042 2WZR3 4GXLA 4QB1A 4AEMA 1OLQA 4FI9A 1A8DA 2WZPP 5AC92 2BPA2 5GALA 1YQ5A 1RJ8A 3B02A 2A6YA 4QX7A 1PO13 2HBUA 1VBD2 3A22A 5FLHA 1F35A 1TE1B 2ZJCA 3NV2A 1ZBA3 3EB7A 1ULEA 2RS32 3LE0A 1A78A 4D6QA 4GJZA 1QIQA 1L7QA 1GFF2 2HEVF 4YLZA 2R30A 3GGLA 1RUH3 5C3OA 1FAYA 1HB4A 3FUOA 4EN8B 1OC1A 1Q43A 4R9AA 5KHHA 1MZ5A 4B3NA 2R041 3NJVA 1OHFA 1V6JA 1K5MC 2E9QA 3Q8BA 1QH7A 4AZZA 4KQ7A 5FZBA 2WAAA 3KCXA 1UX7A 1HRV3 3THCA 3MIBA 1W0PA 4ITCA 3LSDA 5LRSA 2BGPA 3PURA 4XJUA 4UXAA 2YPDA 3EXUA 2RS31 3QACA 1LULA 3MBWA 1MEC3 3OGGA 4IV3A 4OCTA 3P6BA 4S2DA 3VHRA 3W21A 1EP0A 2PHFA 3AM2A 2VOTA 1G7YA 1WLDA 1K5MB 1IOAA 1STMA 2IXHA 4OYUA 4LORA 4YW5A 3VBOC 5FZIA 3WNPA 2ARXA 1SFPA 3RFRA 4Z2AA 4YVWA 3VBHA 3R4UA 1LHVA 1IG0A 2YGLA 4AG4A 4CCNA 1UIKA 2A6WA 2VUJA 4FPLA 3WUDA 5D1IA 3L2YA 2RG4A 2VO5A 1FATA 1OOPC 2Y6JA 1UOBA 4KWJA 5T50A 1DQ2A 5FZFA 3WP4A 1LR5A 1LNSA 3RYPA 5DUWA 1EYBA 2ZX3A 5FYIA 5A3NA 5FZOB 4JRLA 1X33A 3VBOB 4I3PA 3LPFA 4MX3A 4DY5A 1Z7S3 4OFGA 3WP5A 4QXBA 4TLGA 3ZFGC 1WLCA 2ZGLA 5H9SA 4Q1PA 2RV9A 1PK6A 1W2OA 3CDZB 4G9SB 4J1WA 3ZIWA 1JZ4A 2DVGA 1OOPB 2GC3A 3IIAA 3ZSKA 4WZFA 3BGAA 5J3UA 3VZMA 2WQ8A 2D5FA 2FMDA 2IUWA 1HDKA 1FYUA 3ZFGB 1JYTA 2VNVA 4ZXKA 1Q8OA 1YQ2A 3BVCA 4TSVA 5FZ1A 4BXFA 3KF3A 1POV0 3CLPA 2VXRA 5DUVA 4LLFA 1BJQA 1RUI3 2QJVA 1X8MA 2J42A 4B1LA 4CDQA 5JI9A 4MGTA 2Y6FA 2FMYA 3M8LA 2WO7A 3MF6A 4LIVA 2V4AA 3H1MA 3MZHA 5D2AA 3W58A 4Q0QA 5FBJA 3T0DA 1CVNA 1OLRA 1W6OB 2ETEA 3U75A 4QPGB 5IK4A 5GKAC 5FZ3A 1FV2A 2XJVA 1POQA 1QEXA 2JDAA 5I93A 3RI8A 4CP1A 4N43A 2VTXJ 1YI7A 1ZNPA 4JV4A 1UD1A 1WD3A 4IETA 4K7JA 4DXSA 2Y0IA 5L73A 5A32A 4UW3A 3FL7A 1BZWA 4YFWA 5A3TA 4LA3A 3TAYA 4DOUA 4XMIA 2D93A 5CA6A 1QOOA 1JOBA 3DXUA 3Q8AA 3C7GA 3NAPB 3QCWA 5FP7A 5K0UA 2WS93 4FPKA 4GALA 1CGPA 5EYXA 5FZMA 1QJU2 3FE5A 1QMJA 1ZYBA 4BU2A 3K75B 1RUG3 3SH4A 2ZAAA 5C9AA 3QD6A 2HYKA 2JG9C 1RUOA 1MQTC 4S2FA 1QJZA 3MV01 4FO9A 1RUE3 4UFMA 1CIWA 4OLLA 4DRRA 4OMCA 5DABA 4NE9A 2VH9A 3RNSA 5ACA2 4DINB 2XVKA 4BHPA 2E7AA 2RHPA 4BK4A 5IUQA 5JUVA 3CQOA 5C3PA 3RZKA 2ARAA 4QWNA 4RHV3 1R093 1YCIA 1DZQA 2GNDA 2OZJA 5IWFA 3WQ1A 4NROA 4CCDA 4FOYA 1QJU1 5T55A 3AX4A 1MQTB 1C1LA 4GB32 3MUY1 2ZTNA 3VBUA 3FLRA 1OD3A 5HI0A 3AVSA 2IXKA 3ZSMA 2QQNA 4BJ0A 4RGAA 3NJZA 4K1ZA 1G9AA 2XWBB 4XDQA 1LENA 2AEZA 1RUC1 1O91A 2YDEA 4QKBA 2DF7A 4ZONA 2CHHA 4E4HA 5LCWL 3H42B 5ACA1 5AFEA 5CB7A 1JN2P 1MACA 3GYDA 5EJ1B 4FBFA 1H8TA 2DYCA 2VULA 4WVMB 5FPVA 4AK3A 4CDWC 1N1VA 4IEZA 2MHFA 4E9KA 1RUJ2 4OQ9A 2ZX4A 2BUKA 1UOJA 1ZZCA 2G9GA 4GB31 4MV2A 4Q4X3 3WW3A 1OURA 5I0TA 3AP5A 4IESA 3HBKA 5A33A 1UAIA 1RITA 3LEKA 4XIKA 5BNNA 1YEWA 1W9WA 1CAWB 1TME2 3EO6A 2W5FA 5E6HA 5JPMB 4XCAA 4N53C 4LNVA 4N7IA 4RQPA 1TG7A 4DEQA 2MEV2 4M3CA 3KF5A 5M0TA 3VGIA 3HQUA 5IFPA 1DBNA 5GLZA 1BK0A 2ZHMA 3POBA 5FYUA 1LOEA 3TNQA 1HV0A 3WF1A 1RUJ1 2WBKA 3VBSC 5JOZA 4C91A 2HWD1 2K2SA 3D0SA 2XONA 2ZGSA 3RMYA 4CDUA 4N90A 4N53B 3CJIA 4HN1A 1QXJA 2RJLA 2W46A 1E57A 4XOGA 2XJSA 3AMPA 4LBNA 1TME1 1QKQA 4XMAA 4YG6A 5F2SA 2NPIA 2PHXA 1KRIA 3AP9A 3O14A 4PHZA 2MEV1 2QDRA 5FYMA 1POV3 5FMCA 4XFGA 4FPFA 4LO6B 4XXAA 5IVYA 3ZOIA 1PVC2 3J26N 3T2PA 3HIFA 4RGKA 3N7LA 4AHWA 3ZYPA 2R072 2PLV3 1AR63 2Q8EA 1J84A 1QXPA 4JC1A 1WCQA 2VUDA 3I2KA 2BVBA 1UY1A 4D8MA 4L92A 1GOFA 2CNAA 4WBBA 4LBQB 1JH5A 1DHKB 2YBPA 4XUQA 5JIUA 1URXA 3RDIA 1SPPB 1VBB3 4YW3A 5F6KA 1NAEA 1ND3A 2BRTA 2LRPA 3N7MA 2EAKA 4NMIA 3HT1A 2B46X 1DQ6A 2QQKA 2F4LA 4ASKA 4A2UA 4K8RB 2W1QA 3KT4A 2PQSA 2VW1A 2JKBA 2R071 4CUCA 4CU8A 3G7DA 4XYXA 3J7HA 4JTOA 4A6SA 4AI9A 3M1HA 5F6LB 2ZKNA 4GMP1 2ADDA 4FVVA 2GMEA 3GDBA 3LOBA 2WFF3 1QHDA 1HN0A 3SMHA 4BQ4A 1LRHA 4WM7C 5CKQA 1OBNA 4Q26A 3M3CA 1GQHA 3ABZA 2G1MA 1NCQB 1EAH3 5JDBA 3GZAA 1JZ8A 2ZA9A 3HR9A 2NM1A 1BMV2 3QBQA 4XHBA 3BB6A 1ASJ2 1W2UA 2XG3A 3U0ZA 2YBSA 2WIIB 4ZS3A 2B45X 3AMNA 4K40A 4NHXA 2DURA 4WM7B 4XF3A 5BXXA 3SCHA 3GBFA 4G4FA 4YPJA 4CCJA 2FDKA 2DBNA 2F4PA 4QD2A 5A3PA 4Y20A 3PMSA 5KHKA 4GWNA 1H6YA 1G86A 1COV2 2YXSA 1OA2A 3AXDA 4FFFA 5FPZA 2KM2A 4MGQA 4Q4Y3 1SLLA 2WQZC 1E5RA 3I7DA 5BNOC 2VXJA 3O0XA 2B5HA 5C71A 2W2IA 1UWWA 5GLUA 1BMV1 3MEPA 4DUVA 1U5ZA 3N9PA 1ASJ1 4E2GA 4Y5Z0 4ET7A 2CYFA 5EXOA 1NE4A 1HRI3 5G05L 1QNWA 3SLIA 3ZR5A 1MZFA 4EZHA 3VD4A 3OEBA 2LROA 3MV11 5BNOB 3OPZA 2EICA 1PIV2 4NUBA 2CL2A 2LALA 1COV1 1IG3A 1UIJA 1V6MA 2XUMA 3NL1A 4UBGA 3WNXA 5FPXA 1CN1A 4IQPA 4LHNA 3USUA 4Y1YA 2ATFA 5F3IA 4B4QA 4LXLA 2Q8OA 4MSVA 4QX0A 1PNGA 5FPBA 3POIA 4JGYA 1PO22 4J1XA 4XBLA 4LBOA 3WZ1A 1J3QA 4GQ7A 2VZOA 3S5AA 2RR13 3NV4A 1WUVA 1LGNA 2A6VA 4AL9A 2ZGPA 3FWEA 5F3EA 5CFCB 5FQ0A 5LY1A 3C7FA 4HZFA 4EE2A 1UYXA 5A7SA 1PIV1 3AP6A 5FZ9A 2G9ZA 3JCIA 4D6RA 3WUCA 2WSUA 3ZDSA 2PAKA 3GZUC 1BEV2 1UOGA 3RJ2X 4LOSA 4IV1B 1VMHA 2A75A 3IM0A 4COVA 1CQ9A 3ZMOA 1NE6A 1PO21 1GQGA 5JVVA 2P3KA 1HKDA 3RI9A 5IVFA 4YARA 3PNAA 2HWB3 4XE9A 2X53S 1JHJA 5FZ7A 1XPWA 2HYXA 2JB4A 2CGOA 3NVCA 1X50A 3J7LA 3J8F3 4LHSA 1VBE3 4XJZA 2X5IB 4AAXA 4NHLA 4PCRA 1S2KA 2ZZJA 4HVOA 1BEV1 2VUAA 2Y60A 4FXGB 2W87A 5EFUA 3THDA 1PM4A 4P9YA 2UY9A 2ZX2A 1ND2A 2XPJA 2J1UA 1Z78A 2FCVA 2DVAA 2Q0AA 4DS0A 3WDWA 2B9UA 2PQQA 1YXWA 2RJKA 2UWCA 5D8AA 5FYVA 5JIAA 4XJ8A 5I0RA 2X29A 3RRDA 4BQXA 1YWKA 3LGRA 2EAAA 3OGRA 1ZZ9A 1A8MA 3TWIA 1RTVA 3T3YA 4WM8A 2ENRA 4A45A 1W3VA 4YSFA 2AACA 2VMIA 4KGGA 1KXGA 1CONA 3NJXA 3B3QE 1MS9A 4A41A 1GP4A 1ACCA 1UQXA 1UY0A 2LTNA 4DEVA 4A3ZA 3HNYM 4DFSA 3I49A 5T5JA 4FOVA 1KS4A 4ZXEA 1NUKA 3LZZA 1J1TA 3PL0A 4KWUA 1REDA 2E51A 1JMUB 4XF0A 4XZPA 4CVUA 2RMU3 1UY4A 3MIHA 1W8TA 3WDVA 3WDTA 1AR92 2D98A 4YM2A 3KGLA 1I6XA 1O3TA 1C8M2 1K12A 5JXHA 1UXZA 1W2TA 2ZEYA 2VCCA 3O1OA 2WSVA 5CKNA 4QPIA 5DAPA 1RGSA 1VMFA 4COYA 3POSA 4JGZA 1B35A 4LJHA 3KVAA 2OX0A 1WW6A 1H8VA 2D6NA 4CEWA 1MVQA 2ARCA 2GAUA 2P2KA 4P14A 3T2OA 2DCYA 3AKPA 3VKNA 1KFUL 3H1WA 1OFNA 1F5JA 3KV6A 3SQOA 4XDOA 1QH6A 4AOCA 1AR91 5K7PA 3HOBA 3K51A 3HPNA 3O5SA 4W4ZA 3TEZA 1VJ2A 1C8M1 3POJA 2Z42A 1OPMA 3PUIA 1GOHA 4E27A 4YGCA 2DCJA 1VB4A 2RS13 2WO3A 2OQ7A 1W8ZA 3HEIA 2XWJB 3RYKA 1OSGA 1R1A2 3ENRA 3IAPA 2D5HA 3KV5A 1W6NB 4P02B 3BI3A 1VAVA 3I3MA 4Q8KA 4LR4A 4LK6A 5DDJ1 4Q27A 1RUD2 3TN93 1CX4A 4HPKB 3UKVA 1KFXL 3WHUA 3V65A 2Y6GA 5FP9A 1VR3A 1JUIA 1TEIA 2XHNA 2WNUC 1VLNA 4C1WA 5GZGA 4FOWA 4IV3C 3HQXA 3LFMA 5B2GB 1C28A 3VL8A 4XFFA 1ZVFA 3IB3A 2O0OA 5HV0A 5FYBA 1YNAA 4XJWA 4W50A 3RJRA 4EJRA 1GV9A 2R16A 2RM23 2WABA 3FZ3A 3LEIA 2C6SA 2WFPA 2MPFA 3WF4A 1UPIA 3HQRA 3KGZA 1RUD1 1WKYA 1R082 3F95A 4HLTA 2WNUB 1OLME 2GP5A 2NN8A 4YW6A 4XQDA 5AVAA 2HWC2 3DPRA 5HCBA 1X9PA 3O1PA 1H1AA 1V9U2 4YZ2A 3WNMA 4RYDA 1DQ1A 1OA4A 4IERA 2DUOA 3LB9A 5CADA 1NLQA 2OVUA 4XEZA 3I3QA 2HWF3 1PK6C 3KCCA 4PIZA 2ZGTA 5BNPC 4YZ5A 5ABJC 5A7NA 1W8HA 3BTYA 3D0JA 1QJX1 2NQYA 1UYPA 4BQ2A 3D8CA 1R081 5FYYA 2VOKA 1EV12 2JG8B 3N7JA 1RVF3 1J3PA 4XCBA 3U78A 5LA1A 3SISA 3WW4A 1VBA1 1WMDA 1V9U1 1A6CA 2JICA 4GKYA 5BNPB 4AYUA 5ABJB 4HG6B 3SC7X 3F2ZA 1W39A 3ZPOA 3PIGA 3IMMA 4OUEA 2XXZA 1N47A 2VECA 3B5LB 5DAQA 1CJPA 4HONA 3N36A 4LUMA 1OD5A 4BXSV 1CAUB 4Q4W3 5J37A 3OYWB 3CO2A 5JSOA 3VBRA 3KVBA 1OI6A 4FQ4A 1EV11 1S2BA 4FP2A 3K2OA 1BBT2 3ZYBA 4M01A 2C5DA 1SLCA 5FZHA 4AXOA 4QX3A 2JDKA 4N43C 5FP4A 4M00A 4MXWA 3M3OA 1EPWA 1PZ7A 3M70A 4ZU5A 3B00A 1AR72 2XGXA 4CUAA 4YG3A 2EXKA 3O0WA 4QM9A 5F32A 2E7TA 1GP6A 2WR9A 3JD72 4ZU7A 4Y26A 1GQPA 1W06A 2PXJA 1UNBA 2J1RA 4BH9A 1AL22 2WA4A 1S0IA 1RUF2 1C57A 3Q8CA 4HOOA 4N43B 3CNAA 3ZO0B 5K0UC 3R4DB 4CU9A 2AYHA 1EY2A 2HWE2 4P9WA 1VPHA 2LM3A 5CFDA 4C0BA 2BGCA 2ET7A 2RVAA 1YRZA 3MUZ1 2O1QA 3WP6A 3I2GA 4YVSB 4JZRA 3IWZA 1LTEA 5FV3A 4O61A 3S0MA 4QGLA 1QWRA 3GF6A 4N7UA 2YHJA 2YB7A 1OFSA 3SCFA 4QU1A 1HX6A 4AE2A 3OGSA 4QQOA 1UN1A 3JD71 4R9DA 4V2WA 3RWNA 3A0KA 1RHI2 2JDNA 3M2MA 4YW7A 2R062 1SCRA 3PJYA 4CDXC 3NV3A 3ZYFA 2WNOA 1D2QA 1KJLA 2ZACA 5K9YA 2A3WA 2GDFA 2GC0A 3N9MA 4HXCA 4IEQA 3WNLA 1GZCA 4LEJA 2GH8A 4LHKA 1HJGA 4XFCA 4XUTA 1ODMA 4K8FA 4XF4A 1H4HA 2ZXQA 3NW4A 3U11A 1H30A 5F2WA 5T3NA 4CDXB 1FOD2 1XU2A 3OF1A 5CNAA 4L0PA 4D3WA 1RHI1 3H1YA 3BYWA 4AEDC 2BERA 2VVFA 2YV8A 2Y0OA 3MO4A 3S30A 3I4IA 2D7FA 3KV4A 1NXD1 2B8MA 5A7WB 2I45A 3AB0A 4XDPA 1AVBA 2QQWA 2JDHA 3OPWA 2C1FA 1DG6A 1OA3A 1D7PM 3ES1A 5GZFA 4CEYC 5JPNB 1UF2C 5FY7A 5A3LA 4KWLA 1LU1A 4S2HA 2GP3A 5L9RA 2ZPXA 3OD4A 3H9AA 2C24A 2OQ6A 5LATA 4AEDB 1W8WA 5L7OA 5FZAA 4PIXA 4NPLA 1JZ5A 1XNKA 1FOD1 3PVBB 2QZ2A 4FP3A 1ZZ6A 5FXXA 5EHDA 1JS9A 2R043 3VZNA 3ZDVA 4GH4C 4CEYB 1ULCA 1CPMA 5AC93 2ZGMA 1WCKA 3OEAA 3D3AA 3ECQA 5IK8A 1E5SA 5JI7A 3T0BA 4CDUC 4RGGA 2QKDA 3PTYA 1FMD3 1VBD3 3WSOA 3CJIC 1O8SA 4KU7A 1CZTA 5GJ6A 4L99A 1GZWA 1AX1A 1A3KA 2ES3A 2RS33 5GLVA 3H8XA 1CZSA 3LDBA 5FZDA 4CU6A 4P9IA 4GH4B 3MFAA 5HCFA 3TOJA 2NMOA 3DYPA 4ARYA 3T30A 5I8YA 4ASLA 1DCSA 1YLLA 1JYCA 4CCEA 3WR0A 3JBG3 4YM3A 5IFTA 2YPJA 4ONUA 4CTEA 2GNBA 3VKMA 2DFBA 1IPKA 3AMQA 3U07A 3LKJA 3LEMA 3NNJA 3AZWA 4U2AA 1IS4A 1NKGA 3TB0A 2UWAA 1DU3D 3POEA 1TVGA 1KDMA 1GZTA 4RS5A 1TMF2 3KLSA 4E2QA 1PM7A 2WZ8A 4YM1A 3FC0A 3IKWA 5FKCA 3VKOA 3O1UA 2FZ1A 3MHZA 3H50A 4QXCA 2D6OX 2VJXA 4I01A 1O3QA 4AHYA 1GOGA 1CJDA 1W6PB 1W6MB 4YFZA 3OY8B 1YJLA 2Q8DA 1WBLA 4QQHA 1HB3A 3DEMA 1YIPA 2Y8KA 4NIDA 4FTSA 1RYYA 1N3OA 3SHRA 3N3HA 4IW3A 4ZS2A 4OQ8A 1JODA 1OPOA 2RJ2A 1WW7A 1PMJX 2HH9A 3BPZA 1F8VA 3DYMA 5JCTA 2OUHA 2XH6A 4IE4A 4UW4A 1H9WA 1TMF1 4BK5A 2TBVA 4BQ3A 3JXSA 4B7EA 4Z92B 3IMNA 1REFA 3POWA 2ZS6B 3FFZA 2BDRA 5LA0A 1N1YA 5C4WC 4XETA 3I3DA 2D44A 4Q2FA 1TQ5A 2DUPA 3ILFA 2VZRA 5FK7A 4AGVA 3N9OA 1WBFA 2GN7A 1SMVA 2WZR1 2ZX1A 3CZJA 4UFLA 4HSJA 3NQHA 5C3RA 3AKTA 1TZOA 4PF1A 2D40A 4FAHA 4I2OA 1BXHA 1O4YA 4MGIE 1S0EA 3IBMA 1LHUA 3I59A 3MPBA 4CUBA 5FYCA 1OT5A 2UU8A 2PHUA 4FT8A 2FD8A 1ZM1A 5C4WB 3ZXFA 1EUUA 5GM0A 1OF4A 3GBWA 3N7KA 1ZBE2 1GNHA 1MS0A 2Y33A 4E4ZA 1YQ6A 4HN0A 4ASMB 3TNPB 2D6MA 1RUH1 4JQTA 4HFSA 2DVBA 2GC1A 4XF9A 4TYSA 5CYYA 3M4FA 5FYTA 2SLIA 3UESA 3UGFA 2NP0A 4FTBA 1CAXB 1DLLA 3O7OA 3VBFA 1G9CA 4Y20B 3WHTA 4LBMA 3ZKYA 4GMP0 5C5TA 1M06G 5GZCA 3BPSA 1V70A 2VMCA 4AEKA 3KHCA 1MZ6A 1Q56A 3VDDC 1OH3A 1K42A 4P5HA 2CWMA 2AREA 3GHNA 1CR7A 1H2MA 1OVSA 2WKKA 3HN1A 2VOVA 1RC6A 5JSPA 3MYXA 4XACA 1ZBE1 2ARBA 1MEC1 3CBNA 4J6GA 1W2NA 4MXVA 1W0OA 3DKQA 2ZMKA 3PHMA 4D7SA 3GM8A 4GIQA 4BE3A 4BQ1A 4JGYC 2VZ3A 3VDDB 4PLOA 3AJZA 5EPAA 3MIGA 4GZ9A 4IUGA 2ERFA 5KR7A 1AX2A 2JWPA 1QJU3 2JXAA 5ISLA 4C8DA 2IZWA 5JZGA 1ULDA 3AFKA 5FDBA 4XUOA 4Y22A 1IS5A 1ENSA 3E97A 4ARXA 3PUQA 2R32A 4K3UA 2QQVA 4JGYB 1QF3A 3U1XA 3AYCA 3E5UA 1EPZA 1C4RA 2R0HA 1ENQA 1S0JA 4N9IA 4WZCA 5ACA3 4UFIA 2A6XA 4KL1A 3WINE 5FQ0B 1SHWB 2DWRA 2QQMA 3ZN4A 2X10A 5FZCA 4Y1ZA 1RUC2 2QE3A 4GB33 1V0AA 1NCRC 4COUA 1Y9GA 1XBFA 3H0OA 2R0FA 1AZDA 3OOXA 1LGBA 2OPKA 4A7ZA 4RR3A 4M4RA 1N3PA 5C3SA 4I0AA 1F5FA 4UF0A 2VZQA 4ORFA 2JG9B 1RUI1 4FPYA 5BY5A 5LRRA 5A7QA 2UWBA 1VMJA 3T09A 1K45A 1AYN2 5BNQA 2GMPA 2WL1A 1IKQA 2O8QA 3T1LA 1QQP2 1NCRB 2ZGKA 5IT6A 4QHBA 2ZCWA 2VW2A 5FLIA 4YNIA 3S57A 1RUJ3 3WT3A 2ZEXA 3OGJA 5D8AC 2JIJA 4EN6B 2XR4A 1GNYA 2VCAA 5LBBA 2ZAHA 5KXBA 3ZFFA 2VM9A 3MW4A 4KNCA 3LSEA 4XBQA 1I1EA 2XLFA 1SBEA 2LW8A 1TME3 4Q0SA 2EA7A 4P00B 2HWD2 4JCKA 4G3YC 4LKFA 1QGLA 3E5QA 2A71A 3R6SA 2MEV3 1AYN1 2RDRA 1ZZBA 1F4AA 1V6IA 3PUHA 1LU2A 1NZIA 2CWSA 1DP0A 1QQP1 5D8AB 2B42B 1O3SA 4IGPA 2FHRA 1U0AA 1XNAA 2EIEA 2OW4A 2WS91 5G04L 5FPUA 5FPLA 2WWJA 4XVHA 5IYYA 5A7WA 4CDWB 3BALA 3SNMA 2IVJA 1UZZA 3PJQA 1QJFA 2CV6A 1S55A 2YC0A 3VZKA 5SV8A 4COZA 4NHKA 5CZKA 1IS3A 3RZHA 2OA2A 3BTAA 2VQAA 5FFOC 4EV0A 1U5XA 2VMGA 2YG0A 3LA2A 1YI9A 1Y9MA 3B9IA 2VOWA 1PVC3 5A7OA 3UT0A 3BUCA 3J9SA 4EWDA 4B1MA 1R091 2E32A 2CU5A 4A6OA 1GU3A 4XJ9A 4KWKA 4M0HA 4XFIA 3T1MA 1OKQA 3NWKA 4QPWA 3GHMA 2Y6HA 3POGA 3U10A 1B35C 3K4DA 5FZGA 1ZZ8A 5KC6A 2XJQA 1CIYA 2RDSA 2C4XA 2PA7A 3E5XA 4GMP3 3VBSB 1X36A 3CZUA 4KGQA 4AI8A 5FMDA 4CU7A 4CEWC 3WY6A 3S7EA 1FNYA 2P34A 2W91A 2ILMA 4HMZA 2YZ4A 4PDWC 5K8SA 1O7FA 1O59A 2XVGA 1WMFA 1GP5A 3B94A 4CZSA 5A6XA 2VBDA 3O1VA 4CYDA 1R64A 3ATGA 5BV6A 1B35B 4NIIA 5HCHA 3ACIA 1XYPA 4KU8A 1CAVB 2PTMA 3ZKUA 1QNYA 4EQVA 1UMZA 5CG8A 1W9SA 1ONAA 2VW0A 3WNKA 4C0HA 2PHRA 4PDWB 4Z1VA 1GWMA 2B39A 1N1TA 2YC2A 2BZDA 2WT0A 1SLIA 3EMRA 3ME2A 1JHNA 3D6EA 1YHFA 1RMU2 1N1SA 4IEYA 2XHKA 2WO1A 2O8OA 4KBZA 1U5IA 5FY8A 2W3JA 1DGRN 2W08A 1DFQA 1KDKA 2JECA 4TLFA 3RMXA 2CAUA 3TYJA 3ZR6A 1QU0A 1OQ1A 3P5BA 1AJOA 3NV1A 5T54A 4L8QA 3MI8A 5J98B 4I09A 1ASJ3 3LFIA 2E6VA 1K5MA 4IEPA 3ZXAC 4E2SA 2Q1ZB 2P5BA 1ENXA 1LKNA 4HK9A 3O0VA 4UOJA 1W28A 4F8AA 4Z8BA 1J1LA 5CVRA 1JXNA 1RMU1 1UYYA 1VB2A 3PDQA 4BPZA 4OZXA 2BBVA 4LE4A 4NIGA 3WOGA 4GD4A 4DXZA 1POV1 1US2A 3K4ZA 5FZOA 4KBBA 4XZUG 4ZKTB 4LLOA 2VD7A 5JR2A 5DXDA 5LY2A 2Q1MA 1GWLA 2DBIA 1AR61 4IE5A 2XBO2 1OOPA 3RZZA 5A3OA 3OTFA 3VUOA 4CPBD 1MS4A 2DVDA 1UU4A 1US3A 5LB6A 1PIV3 4WVWA 2WC2A 4QXKA 1JBCA 4QDRA 1HJFA 4H55A 3RVHA 5IVJA 3HMYA 1W6QA 4O65A 5FUPA 3ZFGA 2W9XA 2ZGOA 4LITA 4QQLA 1ZZ7A 1D0HA 4Q1RA 1PO23 4IEOA 2BWAA 3KHBA 2R1DA 4Q4V2 5DG2A 1OLMA 4P9JA 4NPRA 2WNVC 4ISRA 1SEFA 2BV4A 1UO9A 3VD5A 5L9BA 2XBO1 3THTA 1QOSA 4FPJA 2J1EA 5T5PA 2A73B 2EF6A 4V1PA 2J1AA 4XUNA 5A6YA 1W6OA 2GH2A 2WFF1 4KH9A 1NT0A 2ZX0A 4QPGA 2QQJA 4I3GA 3CL1A 3VBRC 1W9TA 1VALA 5GLTA 3FBMA 5JXIA 3D5OA 3SEPA 1BEV3 2HEWF 4W6XA 4AVVA 3H8OA 2DFCA 5A3WA 2WNVB 4PLNA 4ZPIA 1YFXA 1LHWA 4Q4V1 4UT5A 3FN9A 3LA3A 5E88A 5CEHA 4DPNA 3I2FA 3JZVA 2DU0A 4HSLA 5LEKA 3JU9A 4XW3A 1HRI2 5JAXA 5C6CA 1YFUA 4PI2A 1Q5OA 3WP3A 5IVBA 1Q8VA 3NAPA 2J1TA 1LHOA 1GLHA 1E5HA 1AXKA 2JD9A 2OZ6A 2XKPA 3ZYHA 3SCGA 4DUWA 1MS1A 2E26A 1UKGA 5FIXA 3ES4A 5CFDC 2BWCA 2XQXA 2ZABA 1DQ4A 4XQ4A 5EZWA 5J36A 5JSRA 3OUIA 2WWUA 4RFRB 3KM5A 3MIFA 4MOAA 2QVSB 1CWPA 1OVPA 1XU1A 2FBEA 3JQWA 3EBRA 1HW5A 1ULOA 1NOVA 3LDRA 3PU8A 2Q1FA 4FXKB 4DZGA 4ZU4A 2XDVA 4YZ4A 5C8WA 4EN7B 2ZHLA 5JLVA 1HRI1 2VZPA 2Q30A 3ACHA 2ZEZA 4JAAA 1UCXA 2Y34A 2JDUA 2VNGA 4MHRA 4LBQD 3WQ7A 4YZ1A 5J48A 1JYNA 1MQTA 3ZYJB 4BQWA 5K4LA 5DMYA 5JOXA 1FPN2 4JTNA 5HXMA 4OI0A 4CPBA 2VQTA 1Y7BA 3RS6A 4AI3A 3U37A 3LF7A 4MADA 1L7RA 2CDOA 3P3PA 3GNEA 4XHXA 2B9VA 4QQ2A 4XAAA 4EYUA 3V0BB 2D6KA 4NAMA 2JE9A 5FZLA 4SBVA 1AR82 4HKWA 3O1RA 4YGDA 4NO4A 2QZ3A 4CP9B 5A3UA 3AKRA 3AKSA 3CEWA 3J8F2 1W8OA 4WVMA 4M3CE 4ZZ8A 2Z4FA 5DUXA 2RS52 4XFBA 2BP6A 4AGRA 2A6ZA 1D4VB 3PLQA 1FPN1 3WNNA 1AR93 5F5IA 3V0AB 5A80A 1PMIA 1C8M3 1CAWA 5FY1A 3IDBB 3FHIB 3HVDA 4OMDA 3WEZA 2C9KA 1DYPA 3N9NA 1AR81 2HWB1 2C0ZA 5LASA 3FUQA 4XPVA 2VCBA 3B9CA 3J8F1 3ZN6B 1LB2A 2QFEA 3ROUA 5KHJA 2RS51 3PUAA 1KQRA 1WW5A 1FI2A 4AQSA 1JZ3A 1VP6A 3RSJA 5FBZA 4N53A 3THPA 3U14A 5I8TA 1R1ZA 1XNTA 1H1MA 2DCZA 4PIYA 1IHMA 4IGQA 4AFBA 3BTXA 2FDFA 1UU6A 4QAWA 5DDJ2 4R4ZA 4UI9L 1UL9A 4GA9A 1AYM2 1QJY2 2DU1A 3IZOA 4FQZA 4E8CA 2UYAA 5BUVA 1DQ5A 4PF5A 1JYXA 1JOJA 1R1A3 3O12A 4HVQA 3IAQA 1S0FA 2D3SA 4MGYE 5FK8A 1RUD3 2FCTA 2Y38A 4BIFA 2W95A 4QDSA 1VBC2 5FYSA 3ZXLA 2EIDA 4BB3A 3WF0A 5FMOS 5DZGA 4LBQA 2C9AA 1NXMA 1W8NA 3WG4A 3IPVA 1SPPA 2ZMLA 1PX3A 3B01A 2EIBA 1AYM1 1QJY1 3N9QA 5DAWA 4TN7A 5C33A 1VAMA 1DYOA 2H6CA 2P1BA 5I91A 1ULFA 2ZHKA 1LHNA 5ANNA 5FMBA 4EROA 1MS3A 4HT1T 1LCLA 1V00A 3OBAA 2QUOA 1IPJA 1R083 4ES9A 5JMCA 3OUJA 4BYYA 1GUIA 1VBC1 1Y43B 2RMU1 3BIWE 1IZ3A 2ZBJA 4JKKA 3UNPA 4MGKE 2ZEWA 3GBGA 4GULA 3CU7A 1DGRA 3I3BA 2HWC3 4GWMA 2V4VA 2ZHNA 3PTRB 4FPEA 1V9U3 2WDBA 4YVWC 3EHKA 3VBHC 4QX5A 1NY72 1QJX2 2VMFA 1NCQA 3DCQA 3I2DA 4J25A 1NA1A 4KMQA 1C5HA 1NQDA 3QOPA 4IV3B 1VBA2 4BMBA 1HXS2 1JI6A 5C7GA 4CCCA 2XKOA 4WM7A 1JZ2A 2BVVA 3KWVA 1ZA4A 1EV13 4YVWB 3H8UA 3SXWA 3VBHB 4Q0PA 1BVVA 3JQXA 4MYEA 5C8CA 2P3JA 2YYOA 4YW4A 3TEXA 4JRAA 4N9HA 4UFKA 4GKXA 4OULA 4AFDA 4QQPA 1NY71 3RGBA 4NIAA 2WA3A 3ZSLA 4W8JA 1JTZX 5L36A 2WRAA 4XAEA 1HXS1 1NG0A 3I59B 1PK6B 4LBKA 1XE0A 5EYYA 2EIGA 2PELA 4CDQC 3AYEA 4OI4A 2CSGA 5F3CA 4WVZA 1BBT3 3KSCA 3L2HA 2JDPA 3TN91 5IVEA 2VZ1A 2P3YA 3OB8A 2DCTA 4LKDA 4NRQA 4AQTA 4AVCA 3D4KA 2OIIA 2VMHA 3K3NA 4D6SA 1G9DA 1W03A 2AENA 5L19A 1AR73 2TUNA 3BOPA 3WG1A 1F15A 5JXGA 2VC9A 3JD73 1UZYA 4QDQA 4TXWA 5LBCA 4AFCA 3VV1A 3FBYA 4CDQB 3ZX7A 4FFGA 1CPNA 1AL23 2AGSA 3RZMA 2YROA 1RUF3 5LA9A 5CFCA 3K4AA 2HWE3 2BNOA 4I30A 1VRH3 3OUHA 4Y1VA 4R9BA 1ZRCA 4BOWA 5GLWA 5BPXA 4MGZE 5FUIA 3ZN5A 4NN0A 4AVTA 2IXCA 4NHYA 1W05A 5D21A 5FAXA 3KCYA 3W20A 4IV1A 4MGSA 2G9FA 2KD7A 3HBZA 2XUEA 3T0AA 5A32B 4XXPA 3ST7A 3UKTA 5ANQA 2FDJA 1KD7A 5DAXA 5C9AC 4OVEA 4A4AA 1RHI3 3SKVA 1DDLA 3G6JB 5J96B 2R063 4EN0A 1S0BA 3FMGA 5T5LA 5J09A 1J58A 1KJRA 1UOFA 3H3ZA 4QB6A 3WDYA 1RVF1 3C7OA 5FY4A 2KA3A 4ZZ5A 5K0UB 2X5IA 1WLWA 1JYWA 2XLAA 4AI0A 4GJYA 1I3HA 4QMAA 2CDPA 5FY5A 1W04A 2VZTA 3ACGA 2TNFA 3AJYA 1PGW2 1H9PA 5C9AB 1S0CA 3I97A 3WG2A 2VMEA 1W90A 5H9RA 3UGGA 2BYVE 2IFWA 3VBUC 1X9TA 3OG2A 1MS8A 1U5YA 3MDPA 4B29A 4M3CF 1G9BA 4W6YA 5DG1A 1D4M3 1WD4A 1XNCA 3LA7A 3LDKA 1NYWA 1AL0G 3LCPA 5FO7B 1HQNA 2VU9A 4A42A 2PAEA 4BCUA 4QHOA 1FT9A 2JIGA 2WWSA 4LO8A 4XJAA 3HAGA 3ZXKA 1H8TC 3VBUB 1V6LA 5A1FA 3ORJA 1PGW1 2FDHA 3K46A 1RJ7A 3ZYGA 4BWOA 3ZXGA 2AEYA 1SACA 1DZTA 3OCPA 2UURA 4YM0A 2PFWA 4ATFA 1PGL1 1S2EA 2A5ZA 2IVIB 4UW6A 1W99A 1SLAA 5BNNC 5F3GA 5HXVA 4P08A 1H8TB 4OI1A 5DZEA 1J83A 1XQNA 4RQPC 1L7LA 3OPTA 2P6HA 5FJKA 1Y4WA 2WNEA 5CU1A 1DZRA 1SLTA 2R1BA 3GJAA 4QGNA 4LT5A 5APAA 1O3RA 3DV8A 4AVSA 3Q9OA 4MLOA 2HBTA 5A33B 5KWRA 3BIEA 4OHYA 1OUXA 5BNNB 5CAZA 1W3XA 5IK5A 3DN7A 1BHGA 2VTFA 4RQPB 1AXZA 1UYZA 1V6KA 2HEYF 2JDYA 4M3CB 5LEJA 4BZ4A 4KI5M 5FKBA 3QLQA 3FHQA 1HQWA 3DYOA 4XF1A 3AZVA 2IFRA 4OI2A 4WVVA 3AL5A 3APBA 1H1IA 3OGVA 2VTXA 1NLRA 2B7YA 3DUIA 4HBNA 4COWA 4CDUB 3I8TA 3PU3A 3VHOA 1TMF3 3VDCA 3CJIB 3BODA 4YGBA 1LECA 1WA4A 4UW5A 5C70A 3TEYA 2P3IA 4DXRA 2VAUA 2A3YA 3ELNA 3FX3A 4XBNA 2KR2A 3I2HA 1JU3A 1V6OA 4LA2A 5FUNA 4BQ5A 2J7MA 4AFMA 3KD4A 3NNLA 4L11A 4LBJA 2RE9A 5LW9A 3M7AA 4CUGA 5KXEA 2NMNA 4E4DX 4H3WA 3MLLA 5A6QA 1WA6X 5IHRA 1QXRA 3U4XA 4UFHA 4NWVA 3PVNA 2E33A 1W6NA 1ND3C 2YFUA 4PQ9A 1JU4A 1LOFA 2V73A 3EYPA 2QQIA 1H4GA 2P6CA 3S7IA 1FMD2 1ZRRA 2XJUA 5I8SA 2CGPA 4K21A 1RL3A 3BU0A 5IATA 2YFZA 1D0GA 1APNA 2WZR2 4HPKA 1SFNA 1VIWB 5FREA 4URAA 3BOWA 1ALYA 1L3JA 2ZGUA 5A7PA 5FOBB 3VN4A 3U4SA 3RZLA 1PO12 2Q5TA 3PUSA 2ZGNA 4M4PA 5T5OA 1ND3B 2BOJA 5LK5A 4IE0A 4JVAA 1ZBA2 5FLJA 1NZCA 2BFUS 3JBG2 5KBFA 4FOQA 4NRPA 4ZHNA 2J1SA 5AC91 4GWJA 2N7GA 3ZSEA 2XQRA 3C2UA 1RUH2 4CSWA 4DMIA 1FMD1 1VBD1 2BW8A 3DF0A 4L2NA 4NPMA 1UZ0A 2WNUA 1O8PA 1ZBE3 5FYHA 1GYKA 3FHAA 2VMDA 3NRUA 5IK7A 1GMMA 3KQ4B 3I3EA 1HRV2 1K3IA 4FTEA 1PO11 2YMZA 2YC4A 4CCMA 1XXNA 2X8KA 4UBHA 1OKOA 1ZBA1 1B09A 2DUQA 2YY1A 1LOAA 3B7MA 3JBG1 3KS7A 5CIRA 5IAVA 1MEC2 2YU2A 3PIJA 1Q8SA 3I2IA 4RD7A 4QT6A 1RB8G 3MGUA 5FZ6A 1ULGA 5FO8B 2JG8A 1GKBA 5SV5A 1YQ8A 3AC0A 5EP9A 2BNNA 4P9LA 4W65A 1GR3A 1HRV1 1D2SA 4LO4B 5BNPA 3WF3A 3R05A 5F9TA 5ABJA 2WLPA 2CTVA 5IJRA 2Z69A 5JXJA 1YFWA 1WCUA 2XVLA 5KHIA 1WGPA 1QDOA 2CAVA 1Z7S2 2I74A 1RINA 4IEXA 1MVEA 2VY0A 2X05A 2R49A 4AF9A 1ST8A 1CAUA 2LS6A 1W6QB 4JKLA 3FFQA 3OYWA 4DQAA 3VKFC 4JDMA 4QPGC 2BBAA 4PJYA 5KC5A 5KHGA 3J4UH 1BVP1 4JDNA 3POFA 5C3QA 4YW1A 2A70A 4LBLA 3USUB 3RZGA 5DQ0A 5FRAA 4Y5SA 3HN3A 1UZVA 1LJ7A 2XL7A 2E63A 4TWTA 3MICA 3OBZA 1RXGA 1W8UA 4L97A 3RG0A 5IVCA 4FPHA 4XILA 5CISA 1ZRDA 1RUC3 1Z7S1 1RUI2 2GALA 4AAPA 5L9VA 5BYNA 1YO8A 5FMOL 1WCSA 2LUWA 3NAPC 1SFYA 4QHZA 4Y5TA 1J59A 2MNGA 5KXDA 2EALA 4PLMA 4DIQA 4N8MA 2RDQA 1GICA 1TNFA 4V2VA 3I2OA 4QKDA 5B4XA 1VRBA 1T6GC 4B8EA 1AYN3 4YVSA 1RIRA 3MIDA 1LAJA 3PVEA 5FO9B 4LOTA 1Q8QA 2VVEA 1QQP3 4OHWA 5A6ZA 4QXHA 5IVVA 3UJQA 1F9KA 1BCXA 2JX9A 3NSTA 5FJHA 5FXZA 3I2JA 1JZ7A 4HANA 4DRVA 2NLRA 2ET1A 2K9ZA 4XQWA 1F31A 5FZ8A 5IW0A 3USSA 4YWAA 5FY0A 4P5YA 5FWEA 1ND2C 3M3EA 4FFIA 3KT1A 1C8NA 3P1IA 4M0NA 3WQ0A 2DV9A 3ZPYA 5F7UA 1W8FA 3WQBA 1W2AX 2WS92 2HWD3 1MZEA 4LHLA 3HNMA 4AWDA 1JUHA 2QTWB 1RUG2 1GNZA 4NJ4A 3HJRA 4JDOA 2ZMNA 4X8NA 1ZREA 3VB9A 3ZFEA 2GN3A 1FXZA 4WM8C 2VNRA 4CDXA 1YYNA 3RZJA 1RUE2 1YIFA 1ND2B 3E1F1 3VDBA 2PYTA 2E53A 1IPSA 3ZXDA 1DLCA 3RWKX 1GSLA 1OQDA 3AMHA 1AHSA 1YUDA 3C3VA 2W47A 2DCKA 4D94A 3VD9A 3I54A 2GC2A 4JHZA 1NQJA 1R092 2BNMA 3M3QA 4HK8A 4RHV2 3H7YA 1WW4A 4U36A 5EV7A 1HB2A 4CCKA 3BTZA 3RYRA 2AH2A 4E8DA 3AKQA 4KG8A 2Z5WA 2O14A 5J7MA 4WM8B 2CGNA 1RUG1 4NR1A 3WCRA 3UKNA 4QM8A 1Y3TA 5FZ4A 2OT7A 3DECA 1CESA 3HWJA 4AEDA 2VQ0A 4RFT0 2XMLA 2WT2A 3URFA 1RUE1 4FAGA 4XABA 1S4CA 2ZGQA 3T4VA 3OJBA 1MR5A 2WLQA 4CEYA 2IXLA 4CRQA 3PMEA 1SZBA 3MW2A 1OMIA 2W1UA 4QPIC 3KQRA 4K20A 4RHV1 5FP3A 1O4ZA 4EWEA 2R073 2JDMA 3NNFA 2IXJA 2QQPA 3LIHA 1FV3A 3SH3A 4JGZC 4DXTA 1JYVA 4XTMA 1I9RA 4Q4X2 5F39A 2JDZA 2VZSA 3ILNA 2VCMA 4BMEA 5HPOA 2FDIA 3LWCA 3LEGA 4RN5A 4LE3A 5EIYB 5FZEA 4GH4A 3VL9A 3H7JA 1AF9A 1YQCA 4IE6A 4W6WA 4QPIB 1H0BA 1M4WA 4BLIA 2JE7A 4L9BA 3W5NA 3AP4A 4JGZB 3P3NA 4B7KA 2VPVA 2XOMA 1RMU3 3LOIA 4PBOA 3CJXA 3MPPG 4LULA 4CEWB 2YGMA 2WT1A 5AFBA 1CD3G 1W9FA 2GU9A 2ZKLA 2IWGB 2BGOA 2E7QA 4Q4X1 4R8HA 3ZSJA 4LQRA 4AR2A 3NO8A 4NRMA 3WV6A 5C5UA 3ASIA 1DGWX 4SLIA 4QKFA 4H7LA 4CP2A 1W6PA 1PNFA 1W6MA 3AZZA 1MPXA 4H2AA 4YYOA 4P9GA 3K3OA 1JZ6A 3WXPA 4F7ZA 1XRUA 2I2SA 3HD8B 3OY8A 4I0BA 1QDCA 2VR4A 3T4HB 2OYZA 1VAKA 1F2NA 3ACLA 2WQ4A 2XL9A 4IGOA 3IPVB 2PLV2 1AR62 3ZYRA 1KGYA 4AHXA 3AXEA 2ADEA 2VNOA 2FCUA 4XTPA 5LA2A 1PVC1 1NCQC 1COV3 3UL2A 5DPNA 4YZ3A 3BKZA 1NA1C 4UWDA 3K48A 2BU9A 1VBB2 2XBO3 3T2QA 3ZVXA 3H3LA 4UYBA 2KXLA 3DPRC 4XFAA 1G9FA 1REEA 3C7HA 3VBOA 2YBKA 2EVXA 4NOTA 3VD7A 2FDGA 1IQAA 4A7YA 2NYYA 4LO7A 1Y9QA 1WZXA 3E6CC 5C8CC 3UV9A 2PLV1 1DGLA 4F3JA 2VZUA 1NA1B 3MIEA 1DF0A 5C4WA 2WFF2 3QH6A 4PBPA 4KG0A 4JQRA 3DPRB 2E31A 4Q4V3 2JENA 1P8JA 4Z07A 4BLJA 4O9GA 2P37A 2EXIA 1EAH2 5FR3A 2QDNA 4I0WB 1VBB1 1CAXA 2B4KA 2GZWA 4LTAA 2OPWA 3NNMA 3SKJE 5C8CB 4QGMA 1XOYA 1ZRIA 1UKRA 3GALA 4A7KA 5CBLA 3OD0A 1DGWA 4LPLA 3LAGA 1OUSA 1IKPA 1K5JA 1H2NA 3H3UA 1KITA 4FPGA 3R4SA 4QX2A 2XB6C 2XLGA 2QQOA 4R4XA 3WW2A 2AC1A 1SLBA 2TEPA 2PHLA 2WN2A 2F17A 2JE8A 3VHPA 2A1XA 1LOBA 4Q4Y2 5TSWA 2RDNA 1EAH1 2IC1A 1C1FA 5H9PA 3VDDA 5LBEA 3DXTA 1FNZA 4YG0A 1YFYA 5F5AA 4D7YA 3PVOA 1F4HA 4OUMA 5EQUA 4BISA 1HIXA 3CF6E 1W0NA 3B93A 5CFCC 1GANA 1UU5A 3ZXEA 4HKOA 3VBRB 3UJOA 3Q8EA 3SITA 3ZIXA 3SEEA 1SCSA 1IGOA 5KXCA 4OHVA 1GZ9A 2W1SA 3CKHA 4FPCA 5A1AA 5F5CA 3C8XA 4EWAA 5JWPA 2WUHA 4MXWB 4IV1C 4Q4Y1 1XE8A 5LZ6A 2GNMA 3AVRA 3S6PA 2X09A 4Y4YA 4ATEA 4XURA 4CXXA 1SDDB 5FPAA 5GZDA 3WG3A 2GMMA 4GAZA 2H6BA 5DUUA 4BQYA 3UETA 4P9XA 5FCCA 4DB5A 4RA0A 4FSJA 1G8WA 5FOJB 1BLZA 1XB9A 1LOCA 2RR12 4AQ2A 1FPN3 3VLBB 2CY6A 2X5IC 3WX5A 4AI1A 5A1LA 1EUTA 4Q8LA 4DO0A 3ILRA 5CFDB 1QOTA 1JOPA 4K1YA 4TTGA 5HCAA 2R6QA 2P4EA 2JG9A 3VDAA 2BFUL 2ZOEB 2G4IA 3HNBM 1AR83 3JB8A 3POYA 1BK1A 3B69A 2F6BA 1NCRA 3A0NA 3LPGA 1AX0A 3MW3A 1LEMA 4ZY9A 4D0QA 3CHXA 2JB8A 2RS53 4META 5E89A 5FY9A 2HWB2 2RR11 3DL3A 2JJ6A 4AHZA 4HKLA 1WWYA 3IDEA 4YRDA 3VKLA 4LKEA 2WYFA 4PI0A 1VBE2 2W68A 1OH4A 2Y6KA 2Q8CA 4A44A 3NKTA 1JYIA 1SDWA 4R9CA 5I0UA 3IT8A 3AYAA 3GZTB 1BYHA 2PN5A 4A3XA 4NWWA 3ALQA 4FPOB 3WDUA 1WCDJ 1LESA 3T08A 1XC6A 3JUUA 4CDWA 3JB4C 1FX5A 5L7OC 4OZOA 3VHNA 1AUYA 3N9LA 4K6BA 1SBFA 3ZLIA 3LIGA 2ORZA 4QU2A 2ZZQA 1VBE1 2DTWA 1H2LA 5DDJ3 3V64A 1LODA 3AP7A 4IL7A 2WJSA 1X8EA 2XJTA 4HVRA 1AYM3 1QJY3 1CX1A 2HLEA 4IXLA 3FLTA 1IS6A 2G19A 3ZM8A 5AVPA 5L7OB 4CP0A 4E4SA 1ZRFA 5DN2A 1LGCA 1XNBA 4XIOA 1UX6A 1XNDA 3W59A 2PMWB 3GCWA 4MHUA 1ZX5A 2V72A 4INDA 1UW8A 3IIIA 1VBC3 3BCWA 3FLPA 3VBSA 4AGGA 4CA9A 3O1SA 5A70A 3GXUA 4XC9A 3AMMA 2OUJA 1DQ0A 3NMBA 4DNYA 2DDUA 3BN6A 3TRSB 1GBGA 1WMXA 3BU7A 4AQ6A 5A3MA 2JEMA 4NHMA 2RMU2 4AVBA 1GZWB 5I0SA 3LQCA 1RXFA 2WINB 4JHTA 5F8PA 2VE1A 5JR7B 1NX9A 1Q3EA 2ZGRA 4Y3OA 2P17A 4YGEA 3ZMNA 1CAVA 4RS5C 3WW1A 5DZFA 4IDZA 1JW6A 1T2XA 1UY2A 4Q0VA 2J1VA 3AZXA 1AXYA 3NJYA 4HETA 1C3HA 4PDWA 1VE0A 2JD4A 2QQLA 3D82A 1LOFC 4LKSA 4Z2WA 2H0BA 4XUPA 3UYJA 5LK7B 3CIHA 5FYZA 3K77A 5FXVA 3EJKA 1QJX3 4JX0A 3DKWA 3Q8FA 4MH0E 5JMOA 4O7XA 1XE7A 4RS5B 2UY8A 1GWKA 1UMIA 5CG9A 4BDVB 4C90A 4I02A 2I07B 4ES8A 1VBA3 4HL0A 1HV1A 3E6BA 1HXS3 5FWJA 1ULPA 3M3IA 4DUXA 1ODNA
chains in the Genus database with same CATH topology
3MF9A 2K0GA 2EXHA 4Z82A 1O5LA 5E1RA 2RS12 3W9AA 3KT7A 2D6PA 4IEUA 2A3XA 2W39A 2EXJA 1DYKA 3IDCB 2GSYA 2QNKA 5F5QA 1ENRA 4TZDA 3VZLA 4B4RA 1S1AA 4AW7A 4MUVA 2BTVC 2SBAA 3TN92 1V6NA 4AEJA 1R1A1 4QPYA 2VG9A 2AR6A 2V5YA 1RUNA 2DVFA 4FCAA 3V56A 2RS11 1NLSA 3KMHA 1U12A 1TNRA 2D3RA 2NZ9A 4IEVA 3A4UA 1WLTA 4B4PA 2Q4SA 2RM22 3VBFC 3OBRA 2JG8C 3WD5A 5E8AA 1KS5A 1YJKA 3AK0A 2GNTA 3ETQA 3OBTA 5BNOA 4OHXA 1LEDA 2D97A 2UYBA 2W0XA 2D43A 3MLKA 5GZEA 1PGSA 3DGTA 1X7NA 2BEOA 3VBFB 2HJIA 2QCSB 2HKXA 4RSUA 3KZ4C 2HWF2 4Q0UA 3T2TA 3UK9A 4S2GA 2FQPA 2HWC1 2Z79A 5T52A 3NKGA 3SH5A 4R52A 2RM21 4EN9B 1Z0HA 2WNVA 5JZGC 1RVF2 3EQEA 3WLUA 2V09A 3N4MA 4MVTA 1OQEA 3MLJA 4F83A 1H2KA 2YUEA 4O9EA 5F1RA 1AJKA 3TBDA 5EJ3A 2HWF1 1BQPA 2XJRA 1HQLA 4Y1XA 5JZGB 2Z2SB 4Y22B 1C5IA 4Q4W2 4C1XA 2A7AA 2VOXA 4LO5B 1MS5A 4YVSC 4ISQA 4YW2A 1O4TA 4RR3C 3HT2A 4IEWA 1XYOA 3VZJA 1PHMA 3ZYIB 4BA6A 4Y24A 4AI2A 1PZ9A 1PGL2 1BBT1 1FOD3 1VRH2 1S0DA 4K9SA 2PHDA 4AFAA 1PZ8A 1UPSA 1PVXA 4Q4W1 1AR71 4RR3B 2D6LX 1J3RA 4NVPA 2VGDA 5FTTC 3RQ0A 3ZXJA 3IN9A 4WV8A 2PHWA 5H9QA 5HBAA 3V0BA 1LOGA 3ZFFC 4Q29A 3ZFEC 3WDXA 3N35A 1AL21 2H0VA 1RUF1 3WVJA 4Y1UA 4H14A 4X8PA 1X82A 2IXIA 4D69A 2HWE1 1VRH1 2Y26A 1HLCA 3X29B 4DY3A 2BQPA 3E6DA 4AVAA 1SBDA 3AYDA 3MFCA 1Q8PA 4URTA 3RPQA 3ZFFB 2FZ2A 3ZFEB 3V0AA 3INAA 1QY4A 1DIWA 2XJPA 2VVDA 4D7TA 4X6QB 2R061 2PAMA 1D4M2 4X6RB 3WCSA 2PHTA 3QH7A 4H7MA 3ZN6A 1WMEA 3AFGA 1S0GA 4BIOA 4MZUA 1G6NA 3FJSA 4LUKA 3R0RA 1O5UA 5JOYA 5JOWA 5E16A 1I5ZA 4XFHA 1HXS3 5EWSA 2W52A 1D4M1 1N3QA 3VZOA 4OUSA 3L9JT 1BKZA 3KB5A 4BM8A 1SQ4A 2AUYA 3AZYA 4RL7A 2AZ5A 2D3PA 2DTYA 1XYNA 2R042 2WZR3 4GXLA 4AEMA 1OLQA 1A8DA 2WZPP 5AC92 2BPA2 5GALA 1RJ8A 3B02A 2A6YA 1PO13 1VBD2 5FLHA 1TE1B 2ZJCA 3NV2A 1ZBA3 1ULEA 2RS32 1A78A 2HEVF 1GFF2 4YLZA 2R30A 1RUH3 1FAYA 3FUOA 4EN8B 1Q43A 4R9AA 5KHHA 1MZ5A 4B3NA 2R041 1OHFA 1V6JA 1K5MC 2E9QA 1QH7A 4KQ7A 3KCXA 1HRV3 3MIBA 1W0PA 4ITCA 3LSDA 5LRSA 4XJUA 4UXAA 3EXUA 2RS31 3QACA 1LULA 4IV3A 1MEC3 3OGGA 4S2DA 3VHRA 1EP0A 2PHFA 3AM2A 1G7YA 1WLDA 1K5MB 1IOAA 2IXHA 4YW5A 3VBOC 2ARXA 4YVWA 3VBHA 3R4UA 1LHVA 2YGLA 4AG4A 1UIKA 2A6WA 2VUJA 4FPLA 3WUDA 5D1IA 3L2YA 1FATA 1OOPC 5T50A 4KWJA 1DQ2A 3WP4A 1LR5A 3RYPA 5DUWA 1EYBA 2ZX3A 4JRLA 1X33A 3VBOB 4I3PA 4MX3A 4DY5A 1Z7S3 4OFGA 3WP5A 3ZFGC 1WLCA 2ZGLA 5H9SA 4Q1PA 1PK6A 4G9SB 4J1WA 3ZIWA 2DVGA 1OOPB 2GC3A 3IIAA 3ZSKA 4WZFA 5J3UA 3VZMA 2D5FA 2FMDA 1HDKA 1FYUA 3ZFGB 4ZXKA 1Q8OA 4TSVA 1POV0 3CLPA 2VXRA 5DUVA 4LLFA 1BJQA 1RUI3 2QJVA 1X8MA 4CDQA 5JI9A 2FMYA 3M8LA 3MF6A 3H1MA 3MZHA 3W58A 4Q0QA 1CVNA 1OLRA 1W6OB 2ETEA 4QPGB 5IK4A 5GKAC 1FV2A 2XJVA 5I93A 3RI8A 4CP1A 4N43A 1YI7A 1ZNPA 4JV4A 1UD1A 1WD3A 4IETA 4K7JA 2Y0IA 5L73A 5A32A 4UW3A 4YFWA 1BZWA 4LA3A 3TAYA 4DOUA 4XMIA 2D93A 5CA6A 1QOOA 3NAPB 3QCWA 5K0UA 2WS93 4FPKA 4GALA 1CGPA 5EYXA 1QJU2 3FE5A 1QMJA 1ZYBA 1RUG3 3SH4A 2ZAAA 5C9AA 3QD6A 2HYKA 2JG9C 1RUOA 1MQTC 4S2FA 1QJZA 4FO9A 1RUE3 4DRRA 1CIWA 4OLLA 2VH9A 3RNSA 5ACA2 4DINB 2XVKA 4BHPA 2E7AA 2RHPA 5IUQA 4RHV3 1R093 1YCIA 1DZQA 2GNDA 2OZJA 3WQ1A 4FOYA 1QJU1 5T55A 3AX4A 1MQTB 1C1LA 4GB32 3VBUA 2ZTNA 3FLRA 5HI0A 2IXKA 3ZSMA 1G9AA 4RGAA 3NJZA 4K1ZA 2XWBB 4XDQA 1LENA 1RUC1 1O91A 2YDEA 2DF7A 5AFEA 5ACA1 5CB7A 1JN2P 1MACA 3GYDA 4FBFA 1H8TA 2DYCA 2VULA 4WVMB 4CDWC 4AK3A 4E9KA 1N1VA 4IEZA 2MHFA 1RUJ2 2ZX4A 2BUKA 4GB31 1ZZCA 2G9GA 4MV2A 4Q4X3 3WW3A 5I0TA 3AP5A 4IESA 5A33A 1UAIA 1RITA 4XIKA 5BNNA 3EO6A 1CAWB 1TME2 5JPMB 4N53C 4LNVA 4N7IA 4RQPA 2MEV2 4M3CA 3VGIA 1DBNA 5GLZA 2ZHMA 1LOEA 3TNQA 1HV0A 1RUJ1 3VBSC 5JOZA 4C91A 2HWD1 2K2SA 3D0SA 2ZGSA 4CDUA 3RMYA 4N90A 4N53B 3CJIA 4HN1A 1QXJA 2RJLA 4XOGA 1E57A 2XJSA 3AMPA 4LBNA 1TME1 1QKQA 4XMAA 4YG6A 2NPIA 2PHXA 1KRIA 3AP9A 3O14A 2MEV1 2QDRA 1POV3 4XFGA 4FPFA 4LO6B 4XXAA 1PVC2 3J26N 3HIFA 3N7LA 4AHWA 3ZYPA 2R072 2PLV3 1AR63 4JC1A 1QXPA 2BVBA 4L92A 2CNAA 4WBBA 4LBQB 1JH5A 1DHKB 1URXA 3RDIA 1VBB3 4YW3A 5F6KA 1ND3A 3N7MA 2EAKA 3HT1A 2B46X 1DQ6A 4A2UA 3KT4A 2VW1A 2JKBA 2R071 3G7DA 4XYXA 4JTOA 3M1HA 5F6LB 2ZKNA 4GMP1 4FVVA 2GMEA 3LOBA 2WFF3 1QHDA 3SMHA 1LRHA 4WM7C 4Q26A 3M3CA 1GQHA 1NCQB 1EAH3 5JDBA 3GZAA 2ZA9A 3HR9A 2NM1A 1BMV2 3QBQA 4XHBA 3BB6A 1ASJ2 1W2UA 2XG3A 3U0ZA 2WIIB 2B45X 3AMNA 4K40A 2DURA 4WM7B 4XF3A 5BXXA 3SCHA 3GBFA 4G4FA 4QD2A 2F4PA 4Y20A 3PMSA 5KHKA 4GWNA 1G86A 1COV2 2YXSA 1OA2A 3AXDA 5FPZA 2KM2A 4Q4Y3 1SLLA 2WQZC 3I7DA 5BNOC 3O0XA 2B5HA 5GLUA 1BMV1 3MEPA 1U5ZA 1ASJ1 4E2GA 4Y5Z0 2CYFA 5EXOA 1NE4A 1HRI3 1QNWA 3SLIA 1MZFA 5BNOB 3OPZA 1PIV2 2CL2A 2LALA 1COV1 1UIJA 1V6MA 2XUMA 4UBGA 3NL1A 3WNXA 5FPXA 1CN1A 4IQPA 4LHNA 3USUA 4Y1YA 2ATFA 4B4QA 2Q8OA 4MSVA 1PNGA 4XBLA 4JGYA 1PO22 4J1XA 4LBOA 3WZ1A 1J3QA 4GQ7A 2RR13 3NV4A 1WUVA 1LGNA 2A6VA 2ZGPA 3FWEA 5CFCB 5FQ0A 4HZFA 1PIV1 3AP6A 3JCIA 3WUCA 2WSUA 3ZDSA 2PAKA 3GZUC 1BEV2 3RJ2X 4IV1B 2A75A 3IM0A 4COVA 1CQ9A 3ZMOA 1NE6A 1PO21 1GQGA 5JVVA 2P3KA 1HKDA 3RI9A 4YARA 3PNAA 2HWB3 4XE9A 2X53S 2CGOA 3NVCA 1X50A 3J8F3 1VBE3 4XJZA 2X5IB 4NHLA 4PCRA 1S2KA 2ZZJA 4HVOA 1BEV1 2VUAA 4FXGB 5EFUA 4P9YA 2UY9A 2ZX2A 1ND2A 2XPJA 1Z78A 2DVAA 2Q0AA 4DS0A 3WDWA 2B9UA 2PQQA 1YXWA 2RJKA 2UWCA 5D8AA 5JIAA 5I0RA 4XJ8A 2X29A 3RRDA 1YWKA 3LGRA 2EAAA 1ZZ9A 1A8MA 3TWIA 1RTVA 4WM8A 2ENRA 4YSFA 2VMIA 4KGGA 1KXGA 1CONA 3B3QE 1MS9A 2LTNA 4DFSA 5T5JA 4FOVA 1KS4A 3LZZA 1J1TA 1REDA 2E51A 4XF0A 4XZPA 2RMU3 3MIHA 3WDVA 3WDTA 1AR92 2D98A 4YM2A 3KGLA 1I6XA 1O3TA 1C8M2 2WSVA 4QPIA 1RGSA 4COYA 3POSA 4JGZA 1B35A 1WW6A 1H8VA 2D6NA 4CEWA 1MVQA 2GAUA 2P2KA 4P14A 2DCYA 3AKPA 3VKNA 1KFUL 3H1WA 1OFNA 1F5JA 5K7PA 1QH6A 1AR91 3K51A 3O5SA 1VJ2A 1C8M1 2Z42A 1OPMA 4E27A 4YGCA 2DCJA 1VB4A 2RS13 2XWJB 3RYKA 1OSGA 1R1A2 3ENRA 2D5HA 1W6NB 1VAVA 4Q8KA 4LR4A 5DDJ1 4Q27A 1RUD2 3TN93 1CX4A 4HPKB 3UKVA 1KFXL 3WHUA 3V65A 1VR3A 1JUIA 1TEIA 2WNUC 1VLNA 4C1WA 5GZGA 4FOWA 4IV3C 3HQXA 5B2GB 1C28A 3VL8A 4XFFA 1ZVFA 2O0OA 1YNAA 4XJWA 3RJRA 4EJRA 1GV9A 2R16A 2RM23 3FZ3A 2WFPA 2MPFA 1UPIA 3KGZA 4HLTA 1RUD1 1R082 2WNUB 2NN8A 4XQDA 5AVAA 2HWC2 3DPRA 5HCBA 1H1AA 1V9U2 4YZ2A 1DQ1A 1OA4A 4IERA 2DUOA 3LB9A 5CADA 2OVUA 4XEZA 2HWF3 1PK6C 3KCCA 4PIZA 2ZGTA 5BNPC 4YZ5A 5ABJC 3D0JA 1QJX1 2NQYA 3D8CA 1R081 2VOKA 1EV12 2JG8B 3N7JA 1RVF3 1J3PA 3SISA 3WW4A 1VBA1 1WMDA 1V9U1 1A6CA 2JICA 4GKYA 5BNPB 4AYUA 5ABJB 1W39A 1N47A 2VECA 3B5LB 1CJPA 3N36A 4LUMA 1OD5A 1CAUB 4Q4W3 5J37A 3OYWB 3CO2A 5JSOA 3VBRA 4FQ4A 1OI6A 1EV11 1S2BA 4FP2A 1BBT2 4M01A 2C5DA 1SLCA 4AXOA 4N43C 4M00A 4MXWA 3M3OA 1EPWA 1PZ7A 3M70A 4ZU5A 3B00A 1AR72 2XGXA 4YG3A 2EXKA 3O0WA 4QM9A 2E7TA 3JD72 4ZU7A 4Y26A 4BH9A 1AL22 2WA4A 1S0IA 1RUF2 1C57A 3ZO0B 4N43B 5K0UC 3CNAA 3R4DB 2AYHA 1EY2A 2HWE2 4P9WA 5CFDA 2LM3A 4C0BA 2BGCA 2ET7A 1YRZA 2O1QA 3WP6A 4YVSB 3IWZA 1LTEA 3S0MA 4QGLA 1QWRA 3GF6A 4N7UA 2YHJA 1OFSA 3SCFA 1HX6A 4AE2A 4QQOA 1UN1A 3JD71 4R9DA 3RWNA 3A0KA 1RHI2 3M2MA 2R062 1SCRA 3PJYA 4CDXC 3NV3A 1D2QA 1KJLA 2ZACA 5K9YA 2A3WA 2GDFA 2GC0A 4IEQA 1GZCA 4LEJA 2GH8A 4LHKA 4XFCA 4K8FA 4XF4A 1H4HA 3NW4A 3U11A 1H30A 5T3NA 4CDXB 1FOD2 1XU2A 3OF1A 5CNAA 4D3WA 1RHI1 3H1YA 4AEDC 2VVFA 2YV8A 2Y0OA 3S30A 3I4IA 2D7FA 1NXD1 2B8MA 2I45A 3AB0A 1AVBA 2C1FA 1DG6A 1OA3A 3ES1A 5GZFA 4CEYC 5JPNB 1UF2C 5A3LA 4KWLA 1LU1A 4S2HA 2ZPXA 3OD4A 3H9AA 4AEDB 5L7OA 4PIXA 1XNKA 1FOD1 3PVBB 2QZ2A 4FP3A 1ZZ6A 2R043 3VZNA 4GH4C 4CEYB 1ULCA 1CPMA 5AC93 2ZGMA 1WCKA 3ECQA 5IK8A 5JI7A 4CDUC 4RGGA 2QKDA 3PTYA 1FMD3 1VBD3 3CJIC 4KU7A 5GJ6A 4L99A 1GZWA 1AX1A 1A3KA 2ES3A 2RS33 5GLVA 4P9IA 4GH4B 3MFAA 5HCFA 3TOJA 2NMOA 5I8YA 4ASLA 1YLLA 1JYCA 3WR0A 3JBG3 4YM3A 2YPJA 4ONUA 4CTEA 2GNBA 3VKMA 2DFBA 1IPKA 3AMQA 3U07A 3LKJA 4U2AA 3AZWA 1IS4A 3TB0A 2UWAA 1DU3D 1KDMA 4RS5A 4E2QA 1TMF2 3KLSA 1PM7A 4YM1A 3FC0A 3IKWA 3VKOA 2FZ1A 3H50A 2D6OX 4I01A 1O3QA 4AHYA 1CJDA 1W6PB 1W6MB 4YFZA 3OY8B 1YJLA 1WBLA 4QQHA 1YIPA 4FTSA 1N3OA 3SHRA 3N3HA 1OPOA 1WW7A 3BPZA 1F8VA 5JCTA 2OUHA 2XH6A 4UW4A 1H9WA 1TMF1 2TBVA 4Z92B 4B7EA 3IMNA 1REFA 3POWA 2ZS6B 3FFZA 1N1YA 5C4WC 4XETA 2D44A 4Q2FA 1TQ5A 2DUPA 3ILFA 4AGVA 1WBFA 2GN7A 1SMVA 2WZR1 2ZX1A 4HSJA 3AKTA 2D40A 4FAHA 4I2OA 1BXHA 1O4YA 4MGIE 1S0EA 3IBMA 1LHUA 3I59A 3MPBA 2UU8A 2PHUA 4FT8A 1ZM1A 5C4WB 3ZXFA 5GM0A 3GBWA 3N7KA 1ZBE2 1GNHA 1MS0A 4E4ZA 4HN0A 4ASMB 3TNPB 2D6MA 1RUH1 4HFSA 2DVBA 2GC1A 4XF9A 4TYSA 3M4FA 2SLIA 2NP0A 4FTBA 1CAXB 1DLLA 3O7OA 3VBFA 1G9CA 4Y20B 3WHTA 4LBMA 4GMP0 1M06G 5GZCA 1V70A 4AEKA 1MZ6A 1Q56A 3VDDC 4P5HA 2CWMA 2AREA 3GHNA 1CR7A 1H2MA 2WKKA 3HN1A 2VOVA 1RC6A 5JSPA 3MYXA 1ZBE1 2ARBA 1MEC1 4J6GA 4MXVA 1W0OA 2ZMKA 3PHMA 4D7SA 4GIQA 4BE3A 4BQ1A 4JGYC 3VDDB 4PLOA 3AJZA 3MIGA 2ERFA 1AX2A 1QJU3 2JXAA 2IZWA 5JZGA 1ULDA 3AFKA 5FDBA 4Y22A 1IS5A 1ENSA 3E97A 2R32A 4K3UA 4JGYB 1QF3A 3AYCA 3E5UA 1EPZA 1C4RA 2R0HA 1ENQA 1S0JA 4N9IA 4WZCA 5ACA3 2A6XA 4KL1A 3WINE 5FQ0B 2DWRA 3ZN4A 4Y1ZA 1RUC2 2QE3A 4GB33 1NCRC 4COUA 3H0OA 2R0FA 1AZDA 4A7ZA 1LGBA 2OPKA 4RR3A 1N3PA 4I0AA 1F5FA 4ORFA 2JG9B 1RUI1 4FPYA 5BY5A 5LRRA 2UWBA 1AYN2 5BNQA 2GMPA 2WL1A 1IKQA 2O8QA 3T1LA 1QQP2 1NCRB 2ZGKA 5IT6A 4QHBA 2ZCWA 2VW2A 5FLIA 4YNIA 1RUJ3 3WT3A 3OGJA 5D8AC 4EN6B 2ZAHA 5KXBA 3ZFFA 3MW4A 4KNCA 4XBQA 3LSEA 1I1EA 2XLFA 1SBEA 1TME3 4Q0SA 2EA7A 2HWD2 4JCKA 4G3YC 1QGLA 3E5QA 2A71A 3R6SA 2MEV3 1AYN1 1ZZBA 1V6IA 1LU2A 2CWSA 1QQP1 5D8AB 2B42B 1O3SA 2FHRA 1U0AA 2OW4A 2WS91 4CDWB 3BALA 3SNMA 1UZZA 3PJQA 2CV6A 1S55A 2YC0A 3VZKA 5SV8A 4COZA 4NHKA 1IS3A 2OA2A 3BTAA 2VQAA 5FFOC 4EV0A 1U5XA 2VMGA 3LA2A 1YI9A 3B9IA 2VOWA 1PVC3 3J9SA 4EWDA 1R091 4XJ9A 4KWKA 4M0HA 4XFIA 3T1MA 1OKQA 3NWKA 3GHMA 3U10A 5KC6A 1B35C 1ZZ8A 2XJQA 3VBSB 4GMP3 2PA7A 3E5XA 1X36A 4KGQA 4AI8A 4CEWC 3WY6A 3S7EA 1FNYA 2P34A 2ILMA 4HMZA 2YZ4A 4PDWC 5K8SA 1O7FA 2XVGA 1WMFA 3B94A 4CZSA 4CYDA 3ATGA 5BV6A 1B35B 4KU8A 1XYPA 1CAVB 2PTMA 1QNYA 1UMZA 5CG8A 1ONAA 2VW0A 4C0HA 2PHRA 4PDWB 4Z1VA 2B39A 1N1TA 2WT0A 1SLIA 3ME2A 1JHNA 3D6EA 1YHFA 1RMU2 1N1SA 4IEYA 2XHKA 2O8OA 1U5IA 1DGRN 2W08A 1DFQA 1KDKA 2JECA 4TLFA 3RMXA 2CAUA 3TYJA 1QU0A 1OQ1A 5T54A 1AJOA 3NV1A 4L8QA 3MI8A 5J98B 4I09A 1ASJ3 2E6VA 1K5MA 4IEPA 3ZXAC 4E2SA 2Q1ZB 1ENXA 1LKNA 4HK9A 3O0VA 4F8AA 4Z8BA 1J1LA 5CVRA 1JXNA 1RMU1 1VB2A 4BPZA 4OZXA 2BBVA 4LE4A 3WOGA 4DXZA 1POV1 4ZKTB 4KBBA 4LLOA 5DXDA 2Q1MA 1AR61 2XBO2 1OOPA 3RZZA 3OTFA 3VUOA 1MS4A 2DVDA 1UU4A 1PIV3 4WVWA 2WC2A 4QXKA 1JBCA 4H55A 3HMYA 1W6QA 3ZFGA 2ZGOA 4QQLA 1ZZ7A 1D0HA 4Q1RA 1PO23 4IEOA 2BWAA 2R1DA 4Q4V2 5DG2A 4P9JA 4NPRA 2WNVC 4ISRA 1SEFA 2XBO1 3THTA 1QOSA 4FPJA 5T5PA 2A73B 2EF6A 4V1PA