2FZ1A

Structure of empty head turnip yellow mosaic virus (atc) at 100 k
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
163
structure length
163
Chain Sequence
b'SPFTIKQPFQSEVLFAGTKDAEASLTIANIDSVSTLTTFYRHASLESLWVTIHPTLQAPAFPTTVGVCWVPAQSPVTPTQITKTYGGQIFCIGGAIQTLSPLIVKCPLEMMQPRVKDSIQYLDSPKLLISITAQPTAPPASTCIITVSGTLSMHSPLITDTST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein
molecule tags Virus
source organism Turnip yellow mosaic virus
publication title The RNA of turnip yellow mosaic virus exhibits icosahedral order.
pubmed doi rcsb
total genus 29
structure length 163
sequence length 163
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00983 Tymo_coat Tymovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2fz1A00
2R063 1VAKA 2X5IA 5J96B 1BEV3 1FOD2 1AR73 1MQTA 1EAH1 1VBD3 5GKAC 4Q4X1 1QJU3 2RS32 1RHI1 4RQPB 1QQP2 1PVC2 5BNNA 2HWD1 5A32A 2VQ0A 3CJIB 2HWD3 1F2NA 1NY72 4N43C 4AEDB 1OOPB 3VBUC 3TN92 5CFDC 4BCUA 1MEC2 4Q4W2 5AC91 4CDWA 1AYM2 1AR71 5CFCA 4IV1A 4Q4W1 4Q4X2 4QPIA 2BBVA 1AR93 1ND3C 1NY71 4FTBA 1AR62 1AL0G 3S6PA 2HWC3 1TME3 1VBB3 2HWF1 1RUI3 4CDUB 1PIV2 5FMOL 1X33A 2PLV3 4Q4V1 5DDJ1 3NAPB 1BEV2 1QJX2 4Y5Z0 2R072 5C9AB 5D8AB 5CFCC 5JZGC 1VBA3 1PO22 4RR3B 3ZFEA 1RUE1 2RM23 2BFUS 4YVSB 5BNNC 1RMU2 4LLFA 4WM8C 1ZBE2 1B35B 4RS5A 1NOVA 1AL21 1AL23 4RFT0 5CFDB 2X5IC 1RVF1 5ACA3 1HRI1 2DF7A 3VDDA 1R092 3VBFA 4WM8B 4CDQC 1EAH2 2HWE2 2RS13 1BBT3 5C8CC 1Z7S1 2QQPA 1NCRC 1ASJ2 5D8AC 1F8VA 1RB8G 4YVSA 4GH4A 1ZBE1 3VBRA 5FMOS 5ABJC 3JBG2 3ZFFA 4Q4V3 5DDJ3 1VBD1 2WZR2 1D4M2 1C8NA 1RUI1 2R062 1VBB1 2HWF3 4CDXB 1BEV1 1M06G 2BFUL 2HWC1 1FOD3 5C4WA 3VBOB 3ZXAC 2R061 1RUD2 1TMF3 1MEC1 4CDWB 4CEYB 4CEYC 2RR11 4QPGB 1BMV1 3VBSB 1NA1B 1AR61 3FBMA 1RUF1 4JGYC 3CJIA 4WM7B 1ND2A 2RS52 1AR91 1AR81 4JGZA 4Q4W3 2XBO2 5L7OA 4GMP1 5ABJB 2GH8A 1RUJ1 4N53B 5AC93 4GB31 3VBRB 1R091 1VRH2 3JB8A 4CEWC 1OHFA 4YVWA 1K5MA 4N43B 4AEDC 1FMD2 1ASJ3 1NG0A 3TN91 1Z7S2 1VBC3 1HRV1 3VBOA 5C4WB 2MEV3 2Y26A 1PO13 3VBHA 4PDWC 1R1A3 1C8M2 2WZR3 5BNPC 1VRH1 3VBSA 1PIV1 1ZBA3 2PLV2 1OOPC 3VBUB 1VBD2 1FPN3 1QJX3 2XBO1 1QJY1 1RUC2 3M8LA 1ND2C 4JGZB 2R073 1RUE2 2ZTNA 5L7OB 1PGW1 4GH4C 4JGYA 5ABJA 5C9AA 4IV3C 1CD3G 5D8AA 1RUH1 3JD73 1AYM3 2R043 2HWE1 4RR3A 3ZFEB 5C4WC 5JZGB 1NCQA 2RS51 2FZ2A 1R081 2WWSA 3VDDB 3VBRC 3IDEA 3J8F2 1B35A 4RHV2 1AYN3 1FMD3 1HXS1 4CDUC 2HWC2 1NCRA 1VBC2 4RHV1 2RMU1 1QJY2 1RUC1 4RS5C 5C8CA 1RMU1 1RUJ2 2IZWA 4GB32 4JGYB 4WM8A 1SMVA 3DPRA 4SBVA 1V9U1 1ZBA2 1COV2 1V9U3 2WS93 2RS12 3VDDC 1FPN2 2WLPA 1HXS2 2FZ1A 1ND3B 1RUG2 2XPJA 2RMU3 4CDXC 1NCQB 1RUG1 1PGL2 1RUD1 1QQP1 3ZFGA 1C8M1 2HWD2 2R042 1COV1 4IV3B 2HWB2 2RS33 1PVC3 3ZFEC 2WFF3 5BNOB 1POV3 4N53A 5K0UC 4FTSA 5K0UB 1NA1A 1AYM1 2R041 1IHMA 1AUYA 1E57A 1EV13 3J8F1 5BNOC 2HWB1 5A33A 1ND3A 1HX6A 5AC92 1TME2 4QPIC 2ZZQA 4Q4Y2 4IV1C 3VBHB 1MQTB 1A6CA 3JBG1 4YVWB 1RUH2 2BUKA 1HXS3 1FMD1 5CFDA 3VBUA 4N43A 1PO21 1VBB2 1HRV3 2MEV2 1D4M3 5BNOA 3ZFGC 1MQTC 1R083 4Z92B 1NA1C 5K0UA 4N53C 1VBE1 2RM22 4CDWC 4GMP3 5A33B 1POV0 1PO23 1AR83 2RR12 3DPRC 1BMV2 4Q4Y1 2XBO3 3ZFFB 1FPN1 4CDUA 4CDXA 1TMF1 1HQNA 1VRH3 1FOD1 2TBVA 1R1A1 5C8CB 4Q4Y3 1DDLA 1PO11 1EV11 3J8F3 4QPGA 2GSYA 1PO12 1AYN2 1NCQC 4WM7A 1ND2B 1H8TA 1W39A 1VBE3 1HRV2 1OPOA 2ZAHA 4GB33 1R082 1B35C 4CDQB 1D4M1 4PDWB 2WS92 2HWF2 4RQPA 1QJU2 5BNNB 4RS5B 1QQP3 1RUD3 5A32B 1TMF2 3JBG3 2RMU2 1WCDJ 1OOPA 3JD72 1HRI3 4RR3C 2RR13 1VB4A 5BNPA 5ACA1 1RVF3 1MEC3 4NWWA 1VBA2 4IV1B 3VBHC 2WS91 3VBFB 3LOBA 4QPIB 4IV3A 5C9AC 5LK7B 2HWB3 4AEDA 1RMU3 4YVWC 3NAPC 5FOJB 4CEWA 1ZBE3 4RHV3 2BPA2 1POV1 1VBA1 3VBSC 2WFF1 1PVC1 4GH4B 4PDWA 1EV12 1GFF2 2RS31 4JGZC 1RHI2 5L7OC 1Z7S3 4EJRA 1BBT1 2RS11 1VBE2 3VBOC 1RUI2 1COV3 1R1A2 1K5MC 1C8M3 5BNPB 2HWE3 1RUG3 4CEYA 1CJDA 1RUH3 1RUF2 1NCRB 3NAPA 1HRI2 1QJX1 1RVF2 4CEWB 3ZFFC 3CJIC 1AR72 3DPRB 2WFF2 1RUC3 2RM21 1RUE3 1VB2A 2WZR1 1AYN1 1AL22 1K5MB 2MEV1 1VBC1 2X5IB 4WM7C 3TN93 5ACA2 1AR82 1ASJ1 1PGW2 4GMP0 4FSJA 4RQPC 3ZFGB 4QPGC 1QJZA 2RS53 1R093 4NWVA 1RHI3 4FTEA 1QJU1 4Q4X3 4YVSC 1X36A 1EAH3 2PLV1 1AR92 1RUJ3 3JD71 1BBT2 1TME1 1H8TC 4Y4YA 3HAGA 5J98B 5CFCB 1V9U2 1PGL1 2R071 1QJY3 4CDQA 1RUF3 3VBFC 1AR63 3JB4C 4Q4V2 5DDJ2 1H8TB 1ZBA1 1PIV3 5JZGA
chains in the Genus database with same CATH superfamily
3URFA 4M3CE 1W6NB 1UZZA 3SEEA 1FOD2 5J96B 3WG1A 1LB2A 3CF6E 3A0NA 4GAZA 3WR0A 3ZXGA 2VCAA 5FP4A 2WN3A 3GCWA 4URTA 5GKAC 1VALA 4Y33A 1IQDC 3PVNA 1DQ0A 3ZO0B 5FJKA 1JS9A 3M3IA 1IG3A 2HYKA 2IC1A 3CJIB 2B46X 4B7KA 2HWD3 1F2NA 1NY72 3HPNA 4N43C 1XRUA 4K40A 1UX6A 3AMPA 3X29B 4XBQA 2JDYA 2XJSA 1DGLA 2VC9A 4NR1A 3WQ7A 5FO7B 3M3CA 5FQ0A 5IK5A 4KBZA 2I45A 4ZKTB 1AR71 4IEXA 1JN2P 3GALA 4IV1A 4NROA 5LK5A 3TOJA 4EWDA 2YB7A 4Q4W1 2GN7A 3RZKA 2YYOA 2OX0A 1V6JA 1NXD1 2BBVA 4E8DA 3MF9A 4OHXA 3H8XA 1AX1A 1HV0A 5DUWA 4AHYA 2W9XA 3MIHA 4IETA 4XJ8A 4FTBA 5F3IA 4IERA 3WINE 4HONA 1F5FA 5T5OA 5HCAA 3F2ZA 4COYA 3FWEA 4Q8LA 2QQNA 3WF4A 1CX1A 2VW2A 5FYVA 4AE2A 4YRDA 3OY8B 5IVVA 2HWC3 3DKWA 1GZWB 4GZ9A 5A3WA 4CU8A 1VBB3 2HWF1 3NJYA 4MX3A 2JB4A 3FHAA 1ULDA 5FMOL 1X33A 4M3CA 4TSVA 2VUAA 1OD3A 4Q4V1 2AEYA 3NAPB 5I0SA 4F8AA 1E5SA 2HEYF 2XJTA 2D98A 2DUPA 2GC1A 4BQYA 1W99A 1TQ5A 3VUOA 1CAXB 3L2YA 4MADA 4AAPA 2BEOA 3CO2A 3ZYJB 4M00A 4V2WA 4ZXKA 4AQSA 3SISA 3K2OA 1RXFA 3GJBA 3LDKA 3ACHA 3MIGA 5D8AB 5KHHA 2YDEA 3VZLA 4DXRA 5CFCC 5JZGC 1PO22 2ZHLA 4GWMA 4OFGA 5LCWL 4NHXA 5JWPA 5FK7A 3MLJA 1JU3A 3IDBB 1O5LA 1V6OA 2BFUS 2XONA 2ZMLA 4PLOA 2H0VA 4UFLA 3VZNA 3WP4A 1UMHA 5GJ6A 3NKGA 4YW3A 1SFPA 1ULOA 1YNAA 4OYUA 1G9CA 1B35B 4XACA 4RS5A 1UMIA 5FYHA 5LA9A 1WBFA 3WDXA 1JZ7A 5FZ7A 5FYMA 2R1DA 2G9GA 1QXRA 4DEVA 1HRI1 4IE0A 3R0RA 4LUKA 3MFCA 4I2OA 2VXRA 3QBQA 4U36A 1T6GC 1MR5A 3ALQA 2OW4A 3LIGA 3VDDA 4E2GA 1PK6C 1R092 4DZGA 2VTXA 3VD4A 3ILFA 1LU1A 3OPTA 5C5TA 3OGGA 4AVVA 2HWE2 1LHUA 4JRAA 4R9DA 2RS13 3KT1A 4FP3A 4X6QB 5EXOA 2VOWA 5HCBA 3O1OA 1SG3A 2Y33A 4NHLA 5CAZA 5J36A 5D2AA 2IWGB 3AYAA 2ID4A 5ABJC 2H0BA 5FMOS 5JXGA 3BCWA 3U4XA 1D4M2 4K21A 5GLZA 4YM2A 5IAVA 3UYJA 1RUI1 2R062 2ZGRA 5LWBA 3OOXA 2V4AA 2YFZA 1XSQA 2BGPA 2HLEA 2LS6A 3AXEA 4YG6A 2F4LA 3UKTA 4CSWA 2D6NA 5FBZA 1PHMA 1W6MA 4CDWB 4CEYB 5I91A 1Q8PA 1LNSA 3B93A 2KM2A 4IEVA 4AVBA 4D0QA 3RZLA 2CGOA 1NA1B 3FBMA 1OFSA 3IWZA 4LIUA 4UAPA 3UESA 3RZGA 2ARCA 4FOQA 2CU5A 1Y9QA 2WBKA 4DY5A 1XE7A 1N1SA 2WNVC 5A6YA 2R49A 1LGBA 5L19A 5LEKA 4B4QA 1OKOA 2FDIA 5EQUA 1AJKA 4GMP1 5ABJB 3FC0A 2VOXA 3WHTA 2Y6GA 4GB31 2IXCA 3KVAA 2WO2A 3IPVA 3ZSKA 3VBRB 2PYTA 1BXHA 3JB8A 4QKFA 4CEWC 2VECA 1SDDB 2RDRA 4Y1VA 3D0SA 3MPPG 1RXGA 1J1LA 4N43B 3T2QA 1NG0A 3WNOA 3VBOA 1MS0A 2Y26A 1PO13 1GMMA 3DXTA 2TUNA 3PMEA 5F6KA 1ST8A 1WCKA 5LBBA 1LOAA 5J1XA 1IS3A 3GYDA 1UOJA 3O14A 3VBSA 4A6SA 1DLLA 1A34A 2VW0A 3HMYA 2D43A 1OOPC 3VBUB 3WDWA 4FPCA 4YM3A 3QLQA 3PVEA 1YUDA 5IHRA 1IKPA 5JOZA 1MACA 1OSGA 2E26A 2XBO1 4JGZB 5L7OB 3KD4A 1GP5A 2WA3A 2ZGNA 3O1PA 2C26A 2VBDA 4IV3C 1DF0A 1O4TA 3VDAA 4QQHA 3ZYBA 2XVGA 3BTYA 1CD3G 1LHOA 1VAMA 2VNOA 3JD73 2R043 3C7OA 2BNNA 4L9BA 2XLGA 4K8FA 4GWJA 1YJLA 5FYZA 1ZREA 4EN0A 1W3VA 2P3IA 3DEMA 2JWPA 2RS51 3N7KA 4QX1A 3ZPOA 1SLIA 4B1LA 3CHXA 2PHUA 4PBPA 3BKZA 1ULGA 3NSTA 1NLSA 2E7TA 3WNXA 2ZGMA 3VBRC 2PHDA 4O7XA 5KC6A 5KHJA 5IK8A 1B35A 3B3QE 3I3QA 1ENRA 1REDA 4O9EA 3ZN4A 3HWJA 4GA9A 2K9ZA 3H50A 4YG3A 3WQ0A 1TE1B 1OI6A 2J42A 3IBMA 4RHV1 3VKLA 1FV3A 2WA4A 2RMU1 3R6SA 5FPUA 1OKQA 2PHTA 2VMEA 4HKOA 4Q27A 1QWRA 5A3NA 4XPVA 1US3A 5IVEA 2QQLA 1V9U1 4KBBA 4SBVA 4BIFA 1Y7BA 2EIGA 4X8NA 4Q0UA 5F3CA 4N90A 1XYNA 2RS12 3VDDC 4A7ZA 4QXKA 5A1LA 2XWJB 1HXS2 2P1BA 4HPKA 5KHKA 3OGSA 3ETPA 4FPYA 3J9SA 3CMGA 3KV4A 4JC1A 4EZ4A 1ALYA 1JYVA 1GOHA 4MO3M 2WFPA 5L9BA 4DB5A 4C91A 1PGL2 1UZ0A 2HWD2 4PIXA 2R042 3AKRA 2JG8B 4FOWA 2RJLA 3TNQA 3GBFA 3HNYM 5BUVA 4XUTA 1YIFA 1C1LA 4KWJA 5A7WA 3SNMA 3VKMA 4IL7A 4L8QA 4XJ9A 5FZAA 5EYXA 3WVJA 4NIIA 5F37A 2D6MA 5FY4A 2QQJA 2EIEA 4YWAA 3AB0A 3ZR5A 3BOWA 2CV6A 5JMCA 4FTSA 2WYSA 2BP6A 3FE5A 1NA1A 1AYM1 5GM0A 5K0UB 3E1F1 1YC61 4IEUA 4YARA 5I8TA 1IHMA 3ZIWA 3IM0A 2HWB1 5FZ4A 2OKXA 3INAA 2Y6KA 3WG4A 1ND3A 4QKDA 3PL0A 3Q8FA 2ENRA 1YRZA 1JZ5A 3VLBB 2OQ6A 4LJHA 1NLRA 3CZUA 4MGZE 2ET7A 4YGDA 1FV2A 4KG0A 3V0BA 5FXXA 4WZFA 4CRQA 4DPNA 2B7YA 4B1MA 1SCSA 4CXXA 1BLZA 4WZCA 2BNOA 4CPBA 2WO3A 5BNOA 4AGRA 4WV8A 4K8RB 1MQTC 4Z92B 3PUQA 4NIHA 1GWMA 4Q1RA 5DXDA 1UIKA 1UX7A 1EPWA 1WBLA 4GWNA 1EP0A 4QHBA 4XFBA 4D7TA 2UY9A 3O0XA 1LOCA 3UL2A 3HIFA 3BODA 3PUHA 4XFIA 4XQWA 4COUA 3SCHA 4A4AA 4QT6A 1QH7A 5LA2A 4XOGA 1PO23 1AR83 3DPRC 3LSEA 4Q4Y1 2UWBA 1O8PA 3LE0A 2XBO3 4LBJA 1GOGA 2WQZC 1YQ8A 5FMDA 1OVSA 5D1IA 1UYXA 1JZ3A 4C0HA 4GWIA 1J1TA 1FOD1 5C3RA 4B8EA 3GHMA 3JU9A 4CCEA 2DYCA 3FN9A 2JG8C 3O1UA 1AXZA 1PO11 1LENA 1SHWB 2GSYA 3E5XA 4AVTA 2QDNA 4XAAA 4ASMB 5F5QA 4GJYA 4FO9A 4LNVA 2XDVA 1VBE3 5DAWA 3M3QA 3FHQA 3WQBA 2Q1ZB 4EROA 4GB33 3AMNA 1G9DA 1CJPA 1BQPA 3K48A 2W46A 4HVOA 1SPPB 1W90A 3THCA 1U5ZA 2ZGKA 4OZOA 3O1VA 1VJ2A 2Y6LA 3WDVA 5A32B 4F3JA 4S2HA 3T09A 1RUNA 5AFEA 1H8VA 2Q1MA 3H3ZA 1BVVA 1DQ1A 2NMOA 4RR3C 1ENXA 4AHWA 1RVF3 3LDBA 1PM4A 3FHIB 1OMIA 4QPYA 4AFMA 3FLRA 4OMCA 1OF3A 4HBNA 5E16A 3AXDA 3DUIA 2WS91 3VBFB 1SZBA 2VZ1A 5CBLA 3ATGA 4XUQA 5C9AC 4KGQA 2IUWA 4JCKA 1DYOA 3OEBA 5C33A 3PURA 2Q4SA 5FUIA 5FTTC 3RG0A 4ZU4A 3POFA 1Z78A 3ZSEA 4P9XA 2BPA2 3GM8A 4JKMA 4AI2A 3U10A 3VBSC 3VHRA 3G7DA 2VQTA 1H4HA 2WFF1 3KGZA 4FXGB 4PDWA 3VZMA 4ES8A 1GFF2 4JGZC 4LA3A 5L7OC 2RS11 2P6HA 1QDCA 3KWVA 4CP9A 5F7UA 1JBCA 4HK9A 1K12A 2J1EA 1COV3 4NO4A 1VIWB 3AK0A 5A7OA 3I3BA 1C8M3 3V64A 4QDRA 1ACCA 4IEZA 2HWE3 5T5JA 1GUIA 3M2MA 1HW5A 3IAQA 4W4ZA 3RI9A 5BNQA 3RJRA 5C3OA 4TN7A 1IPSA 1ULFA 1RINA 4YGCA 1SBEA 5A7NA 3WDTA 5DN2A 2WR9A 4DFSA 5H9RA 2AREA 1ULCA 4LHNA 3DXUA 1S0DA 3OPWA 4MGYE 5GZCA 1HRI2 2D6OX 1Q8QA 1PX4A 1QJX1 5JPMB 4KH9A 2VNRA 5FY1A 4FQ4A 3D5OA 2A6XA 3JZVA 2UYBA 2UU8A 1AR72 1V6IA 3EYPA 4LE3A 2WFF2 1T6BX 4MG2A 2J1VA 1DFQA 2GZWA 1CIWA 1B09A 2P6CA 3T0AA 2EVXA 1DIWA 1AL22 1K5MB 2Y8KA 3N9MA 1VBC1 4OLLA 4WM7C 4ISRA 5ACA2 1AR82 2VJXA 3LQCA 2NLRA 1XU1A 2H6BA 1MVQA 1H2KA 1MS4A 2DVFA 2WNUB 3KT4A 1J3QA 3EBRA 1G8WA 1UPSA 2ZHNA 3R4SA 3LDRA 4KMQA 1YFXA 4XILA 4IGPA 1WCSA 2OS2A 5FCCA 1UXXX 5HV4A 2ZBJA 1RJ7A 2YHJA 3CU7A 3RVHA 1EAH3 2CYFA 3KB5A 1NYWA 3LWCA 5FZ0A 1TEIA 3LKJA 1O4ZA 2W39A 2ZGOA 2E33A 3FMGA 3J26N 4TLFA 4K6BA 1NKGA 4FI9A 3BIEA 1RGSA 3A0KA 3WY6A 5KBFA 2BW8A 3HAGA 4OMDA 1I1EA 2ZX0A 2NQYA 4G3YC 3KF5A 3WV6A 3FJSA 4CDQA 4DINB 1XE8A 5FAXA 4Z1VA 5B4NA 4QPWA 4V1PA 3E97A 3IMMA 2B39A 5DDJ2 2BV4A 1GBGA 4CUAA 3MLLA 4OHVA 1F35A 3KSCA 1SBFA 2EXKA 3I3EA 2GC2A 2NMNA 1J58A 4QXCA 1WLDA 1Q43A 1VPHA 2X5IA 2AGSA 3WF2A 5IAXA 5LEJA 2CSGA 1AF9A 2PELA 1AR73 5FYCA 1XNBA 1NX9A 1O59A 1PNGA 2D7FA 1EAH1 2YFUA 2VBPA 1G6NA 4X6RB 3SMHA 2WYFA 4RD7A 1MS3A 2HWD1 5A32A 1W6PA 2XVLA 1MZEA 4AEDB 2RE9A 3TN92 5CFDC 1PNFA 4XQDA 3V0AB 4PI2A 5A7SA 2YV8A 1O5UA 4YSFA 5AC91 1DGWA 1W6MB 3HVDA 3NKTA 4QHZA 5CU1A 5GLTA 5T50A 4CDWA 5CFCA 4IEQA 3IIAA 5DAPA 2GNTA 3UJQA 4XUPA 3C7EA 2YPJA 2D6PA 4LMFA 1GQPA 3N9OA 1JH5A 1ND3C 4DRRA 1BK0A 3ETQA 1QNYA 4FPJA 2VR4A 3SH4A 4AVAA 3RZMA 5IVYA 1J84A 1UPIA 3AYEA 1O4YA 1W6NA 2A3WA 4XF1A 5FZEA 4CYDA 3I2DA 3E6DA 1AR62 1YI9A 3LEKA 1YHFA 3DKQA 1AL0G 3K4AA 5A3UA 1CPNA 1T2XA 4L0PA 1K45A 4AWDA 1EUTA 2QCSB 2BU9A 4YW7A 4Q0SA 1YQ5A 1W0PA 4Q2FA 2PLV3 3MHZA 1HB3A 3HR9A 5FP7A 2E6VA 3LA7A 2XQRA 1E5RA 3E6BA 3T0BA 4CCMA 1POQA 2Y0IA 4LO8A 4FPKA 5L9VA 5L36A 2BERA 1GOFA 3NW4A 2H6CA 4ZU5A 5J3UA 1H9PA 2YROA 3LGRA 1XPWA 4LBQA 1S4CA 1XB9A 4N9IA 3AYDA 1RUE1 1QKQA 3A21A 4XC9A 2V73A 2VQAA 4PIYA 4EWAA 3U75A 4B7EA 4YVSB 1RMU2 1JI6A 2VMIA 4XIKA 5JI7A 3P5BA 1JUHA 3RRDA 3AMHA 3HN3A 5A80A 2N7GA 5FFOC 3O1TA 2C4XA 3MGUA 2WNUC 5E1RA 1AL21 4RFT0 3E6CC 1TZOA 1WW6A 4L97A 4NAMA 1RVF1 4AG4A 3TEYA 4HANA 2JE8A 1FNYA 3SHRA 4KL1A 3VV1A 1SLBA 2ZGUA 4YW4A 1EYBA 4XFHA 3T1MA 5A7QA 2A1XA 3VBFA 4WM8B 3KQ4B 3L9JT 4TTGA 1X50A 4JZRA 2EXHA 1DQ5A 3NVCA 4MVTA 2CTVA 2OIIA 3W5NA 1HB1A 4OQ9A 3NV2A 4JX0A 2ZGQA 3M70A 1TNRA 3OTFA 4XHBA 4ZY9A 2JDAA 2W1UA 3AZYA 4FP2A 5CADA 2Q8DA 2IXKA 1DZQA 2HBUA 2WN2A 3USUB 1IPJA 1ZBE1 4GH4A 2ZOEB 1LHVA 4OI1A 3T3YA 3JBG2 3LA2A 4MGKE 3D82A 4RN5A 5DDJ3 1JYWA 3ON7A 1VBD1 2WZR2 3K77A 4A3XA 3RWNA 3CBNA 4LK7A 3MIBA 4GJZA 4QM9A 4QAWA 1WD3A 1BEV1 4CDXB 2O14A 1IOAA 3POJA 5CYYA 1K42A 1FOD3 2EIBA 4R52A 3ITQA 5C4WA 3THPA 2R061 4HG6B 1US2A 1ZRCA 4LA2A 3MO4A 4DO0A 2YC2A 3HBZA 1W8TA 4FFHA 4COZA 4A42A 4U2AA 1BMV1 2VZVA 4QPGB 4XDQA 2PAMA 3WXPA 4AOCA 1PVXA 5CEHA 2XJQA 1ZZ6A 4MHUA 2VTFA 2Z2SB 3R05A 4R9BA 2RS52 1AR91 2PN5A 1AR81 1CAVB 2IVIB 2VVEA 1LOFA 1Z0HA 4AQ6A 4XTPA 1HV1A 2VOTA 1V00A 2GH8A 3Q9OA 4M4RA 1RUJ1 2E51A 2XG3A 3DYOA 1C4RA 4IDZA 2JKBA 3APBA 5ANQA 1R091 2W1SA 3A4UA 3H1YA 2ILMA 5FZ1A 2V72A 2WNVA 5EPAA 1WLCA 4AEDC 2GALA 2ERFA 1HJGA 5A70A 1OA2A 2XGXA 1G9AA 2R0FA 2AYHA 1SQ4A 2EXIA 2MEV3 5EHDA 4Y20A 4UI9L 1IGOA 2VZUA 1HB2A 2FD8A 1UF2C 2JDZA 2Q0AA 3I3DA 3RZZA 4LPLA 2W91A 1C8M2 3POIA 1QH6A 2WZR3 4NE9A 1LJ7A 2QQOA 4QM8A 4A41A 5BNPC 1CESA 2DBIA 3AKQA 4ES9A 2QQUA 1OQDA 4G9SB 4LQRA 3SH5A 1DQ6A 5HCHA 4XXAA 3NNGA 1KXGA 2WZPP 3OYWB 3P1IA 2WSUA 3LIHA 1PM7A 5GLWA 4A2UA 3TRSB 4JGYA 3POEA 2JIJA 3DYMA 1LRHA 2QVSB 5FXZA 4DQAA 2OYZA 3BTZA 4NAOA 3IZOA 1RUH1 1ODMA 2JD4A 1AYM3 1BVP1 2FDGA 4LBQB 2JXAA 1LEMA 3D6EA 3O1MA 4MH0E 3ZFEB 4ET7A 3N7JA 4PLNA 5FMBA 2FDJA 2WZEA 4PF5A 1NUKA 2ZAAA 4XXPA 1VAVA 3PVBB 3VHNA 3K4ZA 2WWSA 1U5XA 5BY5A 1PK6A 2ETEA 1WMEA 1GQHA 3MW4A 3ZXEA 2HH9A 2C5DA 3GHNA 4RHV2 1AYN3 5FWEA 3VD3A 1HXS1 2ET1A 1HQWA 5DZGA 4YG0A 1NCRA 4C1XA 4IW3A 1ZZ7A 4KG8A 3KHBA 2CAUA 1AX2A 4RS5C 5FP8A 1XE0A 2RDSA 2ZACA 3O0VA 1UOFA 2DDUA 4MGQA 3AVSA 1CZVA 1W05A 3POWA 2IZWA 5JIUA 4B4PA 5FPAA 4WM8A 1IKQA 4K20A 3SKVA 3MF6A 2X09A 1COV2 4UOJA 1V9U3 2QQIA 1MZ5A 4Z2WA 2AUYA 2VXJA 4WVMB 3RQ0A 5K7PA 5EIYB 2PHLA 3LD8A 5SV5A 4FVVA 2FZ1A 1VE0A 2BWAA 4RSUA 3ZX7A 4DXZA 2UURA 1RITA 2RMU3 3THTA 3WUDA 1NCQB 4A6OA 4CCJA 5FZOB 1LHNA 1RUG1 4KU7A 2VZQA 1V6LA 3U78A 3ZFGA 2VG9A 4A3ZA 4BMEA 3OBZA 2W0XA 3MLKA 1JZ6A 1LEDA 2VZ3A 3UGFA 1JZ8A 4LR4A 4X8PA 2HWB2 3P3NA 3AP7A 1RL3A 2FMDA 2RS33 3I2KA 2WIIB 1U0AA 5H9QA 2G9FA 2WRAA 3UK9A 3ZFEC 3IN9A 2A3XA 5FR3A 1GNZA 2KD7A 3LA3A 1POV3 4NN0A 2CGNA 1ZA7A 4N53A 3SXWA 4AI0A 2WKKA 3KCXA 2DFBA 2GU9A 2R041 4AFCA 2GH2A 3GDBA 3WSOA 1EV13 2XXZA 2WQ8A 3J8F1 2W68A 5JIAA 2X05A 2O8OA 1NZIA 3LEMA 5A33A 3USSA 4CP9B 5FO8B 3MZHA 1ZYBA 1J83A 4JRLA 4H3WA 1W2AX 2BGOA 2JE7A 4BIOA 5E6HA 2ZZQA 3MYXA 1W8OA 1XNAA 5F8PA 1KFUL 1DZTA 1A6CA 5FYYA 3UGHA 4CU9A 2VE1A 2ARXA 3JBG1 4XBNA 5DG2A 4J25A 4V2VA 2J1TA 1H4GA 5LRRA 3D8CA 3C2UA 4YM0A 2MEV2 3KV9A 1ZRDA 5FKCA 3PDQA 2YG0A 3ZFGC 2VW1A 1N3PA 1AVBA 3GZTB 1NA1C 4LBQD 3RSJA 5F1RA 1Q8VA 4DXSA 3GZEA 4N53C 2JDKA 2IFRA 2GNMA 5A3LA 4D8MA 5JUVA 2JIGA 2IXIA 3QH7A 4QU1A 3ZSJA 2P4EA 4GMP3 3LB9A 1XBFA 3ENRA 4XIOA 5A1AA 2W87A 4ONUA 2BQPA 2WNEA 2RR12 4QXBA 3Q8AA 4P00B 3JQXA 5HI0A 5J37A 4LBKA 2RHPA 1FPN1 3K3NA 1K5JA 4BXFA 4DEQA 3HJRA 4CDUA 4CDXA 4P9GA 1A3KA 1HQNA 4CCDA 1OF4A 2OXBA 4HXCA 3N7LA 2B8MA 1UNBA 1R1A1 3ZVXA 4AGGA 5LRSA 3NQHA 5ISLA 4QPGA 4FPHA 1XU2A 4FFGA 4K3UA 5AFBA 4N9HA 2X29A 1HKDA 1NCQC 5F3GA 4CCKA 3AX4A 4AI1A 2VCMA 5FYUA 5A6ZA 3K3OA 3UGGA 2QZ2A 3BU0A 1YIPA 4DS0A 2J1RA 2RDQA 4HZFA 1ONAA 3GBWA 1CAUB 2E53A 1R082 4YM1A 3GJAA 5I8YA 2YC0A 2D3SA 2XJUA 4ZXEA 4YLZA 2QQWA 2WO7A 4OVEA 4CCLA 2DVAA 1JOJA 1QJU2 2PAEA 4WVMA 1GZTA 1QQP3 4LBLA 1RUD3 2WZ8A 2JKXA 1S55A 3JBG3 3C7HA 2RMU2 2W1QA 4UF0B 1ZVFA 4B3NA 4P9LA 1GR3A 1HRI3 2RR13 5BNPA 5F6LB 5LY1A 2FCVA 4QX3A 4R4XA 1MEC3 4CE8A 3MBWA 3LSDA 2XR4A 4Q29A 5ERLA 4DNYA 5LA1A 2GAUA 1VRBA 4NOTA 5DG1A 3PJYA 2EIDA 2WAOA 3KQRA 4I02A 3PU8A 4LKEA 1A8MA 2V09A 1RMU3 1YWKA 4M4PA 1OLRA 4JV4A 3V0AA 1JUIA 1IPKA 1OQ1A 2A73B 4Y1YA 1XSRA 3HQUA 4CEWA 5FQ0B 1D4VB 4CU6A 1POV1 4JDNA 2ZMNA 1GLHA 3J7MA 1BCXA 4P5HA 2ZGPA 5C3PA 2P5BA 5LB6A 4LKSA 5HPOA 4OQ8A 1HN1A 1S0JA 1EV12 1VMHA 5K9YA 2RS31 3MW3A 3WHUA 4O61A 2PXJA 1BBT1 1L7QA 3G6JB 3VBOC 1RUI2 4YGEA 2EAAA 2HYXA 5APAA 4AVCA 3AC0A 2ZX2A 1ZZBA 2OUJA 1K5MC 4QB1A 1V6NA 3N35A 4LXLA 1RUG3 3T30A 1H6XA 3I4IA 3ZXKA 4YZ4A 1UMZA 4Y3OA 4JQTA 1GZWA 3HD8B 3FZ3A 5FZMA 1RUF2 2Z79A 2J1UA 2YY1A 3KCYA 2FHRA 1ZX5A 2VQUA 5IK4A 4ZZ8A 1UOBA 2XUMA 2K2SA 3NAPA 4AFBA 4QX7A 1YFWA 4NHKA 3N4MA 3ZFFC 2VULA 3CJIC 1CAXA 5G04L 3H3UA 5F5CA 2YZ4A 3WDUA 3DYPA 4IEPA 4OCTA 2EA7A 1N1VA 1OH3A 5FY7A 2Q8EA 3AZZA 3ZSLA 2P3YA 4QB6A 2AH2A 2Y64A 1I5PA 4DMIA 1AYN1 4HPKB 4ARYA 4D7YA 3WX5A 2JG9C 4UT5A 1Y43B 3OBAA 1KD7A 2DURA 3AVRA 1W2UA 2ZKLA 3TN93 3U14A 5JSOA 1ASJ1 3A23A 3AP9A 3BGAA 2F6BA 2A6ZA 4FSJA 1OUXA 4PQ9A 3LCPA 1H9WA 2C9AA 5JXJA 5GZFA 2JG8A 2DFCA 4TZDA 4NWVA 1KFXL 2VZRA 4Y22A 1ZM1A 1JODA 1X36A 2ZGLA 4J1XA 5LA0A 2VMHA 1Y9GA 3VKNA 3T4HB 1H1AA 3MDPA 4D6RA 5GALA 1TG7A 2BRTA 4E4SA 4Y5SA 3ZYRA 2TNFA 3SQOA 1V9U2 2GC0A 1PGL1 4JDMA 4BMBA 5GLVA 2RDNA 1ZZ8A 1RUF3 1XNDA 3VBFC 1AR63 1LR5A 3NNLA 1Q8OA 2R32A 5L73A 4CTEA 2Y6FA 1H8TB 5BXXA 2GNBA 5FZBA 3LOIA 4H2AA 2FCUA 1NZCA 4FT8A 4WBBA 5JZGA 3KLSA 4FAGA 2PTMA 1PGSA 1VAKA 2SBAA 2W5FA 4FFIA 3FFQA 4QQOA 1NE6A 4E8CA 1KJRA 3IB3A 5JVVA 2WNUA 3RGBA 3A22A 2ZEXA 3PJQA 3USUA 3ZR6A 3CL1A 3OY8A 1GNHA 3N9PA 3VDBA 4Q4X1 1QJU3 2RS32 4L2NA 3TBDA 4NUBA 3KZ4C 3PIGA 4RQPB 5LZ6A 5BNNA 1DP0A 1UWWA 3AFGA 4UBGA 1OH4A 3T2PA 2XH6A 5FIXA 1BK1A 1C5IA 1W9SA 5DUUA 1Q56A 4BCUA 4OI4A 3DECA 2QTWB 2I2SA 5IATA 4AEJA 4ZHNA 3O0WA 4ZS3A 1AYM2 3MPBA 2W52A 3OUJA 1IS5A 2BGCA 1URXA 2GP3A 1H1MA 2Y6JA 1AR93 4CP1A 1DZRA 1PZ7A 3I59B 4W6WA 5FLJA 4HOOA 3EMRA 1W03A 4FBFA 2IXHA 3H8UA 3WW3A 2CHHA 3BYWA 2WC2A 2W95A 1Y4WA 2CDOA 2WINB 4MGIE 5KWRA 3ZDSA 1A78A 2YPDA 3POGA 1TME3 1EUUA 2YBPA 3M3EA 5H9SA 3VZOA 3LPGA 3MV01 5JXIA 1QXJA 3KMHA 2YMZA 1FXZA 3B7MA 4G4FA 5DDJ1 3RZHA 2WAAA 1GZCA 4H55A 4Y4RA 4JTOA 1BEV2 3TNPB 1XNTA 2Y6HA 4ATEA 5DUVA 1J3PA 1LGCA 4EN9B 4MSVA 5IT6A 3VZJA 3KVBA 5JDBA 5EJ1B 5JXHA 1GZ9A 5A7PA 4LBOA 4AI9A 3EHKA 2ZABA 3NV1A 3S5QA 1N1YA 3OEAA 4XMIA 2PAKA 2BNMA 3MV11 5LBCA 3ZOIA 4AR2A 4QKBA 5IVBA 3BTXA 4IGOA 3ZFEA 1F5JA 2LTNA 2OA2A 1O6UA 2QBXA 1BZWA 3CEWA 4L99A 3EO6A 2GMEA 2RM23 4BLJA 3OF1A 4COWA 3E5QA 4CCNA 2LM3A 4XAEA 1PK6B 5FZGA 1W0OA 2WO1A 2ZEZA 4LO6B 3OJBA 1UY2A 4ASKA 1NOVA 2VO5A 3UKVA 1AL23 2JJ6A 2MNGA 5CFDB 1Q3EA 4HVQA 3BPZA 2YGLA 3I7DA 1WW4A 5ACA3 5C3SA 5HXMA 3H8RA 4BQXA 1LTEA 4TYSA 1JTZX 3NRUA 3M7AA 1YFUA 1CONA 2ZS6B 3NNMA 2JENA 3H9AA 2ARAA 3CNAA 4NPLA 4CDQC 4QGLA 3IKWA 1EAH2 1SEFA 1SACA 2WABA 3TEZA 4OUMA 1W06A 1JW6A 2Z4FA 1QJEA 1H6YA 1QOSA 5FKBA 1Z7S1 4LUMA 1OFNA 3ASIA 2VCCA 3SC7X 4BOWA 1W9WA 3VKOA 1SFNA 2BJSA 2DBNA 1WD4A 4TLGA 4AGVA 5FPXA 3VD9A 1JOPA 2WJSA 5D8AC 2DWRA 1NAEA 4I09A 2K46A 1RB8G 3ILRA 4MOAA 5GZDA 3JQWA 4EZHA 5C70A 3AZWA 4CCOA 4EE2A 1JYNA 4MZUA 3VBRA 5CB7A 5DAQA 3WP3A 3ZFFA 5C3QA 5JOYA 3D4KA 2RV9A 2WT2A 3MICA 1WMFA 1C8NA 2D97A 5CNAA 4PBOA 4GKYA 4D3WA 5CA6A 3LEGA 3VBOB 3ZXAC 1RUD2 4CZSA 3SH3A 2HEWF 1OBNA 4HN0A 4CEYC 5IYYA 4UW4A 1LESA 4Y1XA 2J1AA 1AR61 5GZEA 1RUF1 2G9ZA 4QQ2A 3S5AA 2KR2A 4WM7B 4EV0A 2PQQA 5EZWA 3ACLA 1SLAA 3TYJA 4JGZA 5L7OA 2XBO2 3SCGA 1W2OA 3ZDVA 4Y24A 3H8OA 1W9TA 1DG6A 5AC93 4UXAA 4XYXA 1GU3A 5CIRA 4D69A 1CGPA 3WQ1A 2ARBA 4YFWA 3VN4A 2HBTA 3LFMA 1CPMA 1OHFA 4LOSA 3I59A 1CWPA 5EFUA 4TXWA 1I6XA 4JDOA 2GN3A 4E27A 1K5MA 1JOBA 1FMD2 1ASJ3 2BDRA 3B5LB 3CJXA 3ILNA 1STMA 4PJYA 4ORFA 2KA3A 1GV9A 1PZ8A 2LRPA 3H7YA 1HRV1 4O65A 3TN91 4CVUA 5FWJA 2X53S 4M0NA 5KHIA 2V4VA 4QQPA 1H2LA 3BU7A 3ME2A 4PDWC 3LF7A 5CVRA 2ZKNA 1F15A 2D6LX 4Y22B 5CISA 1VRH1 4NIGA 2VM9A 1XNCA 2B5HA 2QE3A 4XVHA 2PLV2 4IE4A 5DAVA 3KV6A 2PHWA 1VBD2 2XB6C 2DTYA 4YW1A 5FO9B 2BTVC 4KWKA 1UZWA 3MIDA 3HBKA 1ND2C 5HXVA 2ZTNA 3KF3A 2XJVA 4E4DX 3I2FA 1PGW1 5ABJA 3ZLIA 1RYYA 4UW6A 5C9AA 2LROA 3ZN6B 5F5IA 2BYVE 4PI0A 1W28A 4FFFA 5JI9A 3ZMOA 4BE3A 1GQGA 2PHXA 2P3KA 4FXKB 4RR3A 2ADDA 3J7LA 5JZGB 3ZSMA 1XOYA 5A3OA 2AC1A 3M4FA 3FUOA 4IE7A 4TWTA 3OD4A 3POSA 3WCSA 1X8EA 2P17A 2VCBA 1XYPA 3KV5A 4LULA 1R081 3NJVA 5F9TA 4QGMA 1C57A 3OBRA 5KXDA 1ODNA 1JZ4A 4JVAA 3J8F2 3W9AA 4WVZA 3NV4A 2DTWA 3I54A 4W65A 4YZ1A 1UZVA 3MFAA 2WUHA 1FMD3 3AJZA 5CKNA 2VTXJ 4P9IA 1YJKA 2G19A 5F32A 3K75B 2Q5TA 2XHNA 4XURA 3KHCA 1W6QB 3WNNA 3NMBA 1RMU1 1RUJ2 2OZJA 2XL7A 1UO9A 4DUWA 4XTMA 4GD4A 3ZXJA 4GALA 5K8SA 3RNSA 3DPRA 5FZFA 5FZ3A 2DCKA 4GULA 1S2BA 3U4SA 4Z2AA 2CNAA 1P8JA 1F4HA 3OD0A 2XL9A 4K1ZA 5JPNB 1HIXA 2WLPA 1APNA 4H14A 1DLCA 5K4LA 2AEZA 2BOJA 1GKBA 1WKYA 1RUG2 4RA0A 5J09A 1M4WA 3WP6A 5FPLA 2F17A 3AP5A 3OUIA 3H1MA 2F4PA 2TEPA 4Q8KA 1RUOA 3IDAA 3WT3A 1IQAA 1RUD1 1QQP1 2OVUA 1C8M1 2QNKA 2NP0A 4EQVA 2C9KA 2CAVA 1AHSA 4DIQA 3ZMNA 1COV1 4UBHA 5FY0A 3ZPYA 1ZRRA 4EN7B 3ZKYA 2DCZA 2ES3A 1SCRA 1FNZA 1UZYA 3F95A 1SDWA 1SLCA 3HNBM 3ZYHA 4LKDA 4I0BA 5E8AA 1O3SA 2WFF3 3I2JA 1UYYA 5DUXA 2VUCA 2W2IA 4BZ4A 3GGLA 4XW3A 5JMOA 2E9QA 5BNNC 3BUCA 4QX0A 1DQ2A 3PU3A 3IPVB 4D6SA 3R4DB 1AUYA 5C7GA 5BNOC 2ZX4A 4ZZ5A 3B00A 5E88A 2P34A 3SITA 1QY4A 2YBKA 3KT7A 5FZKA 4AK3A 1HX6A 4XF9A 1MZ6A 3C3VA 4PLMA 1TME2 2P2KA 1N3OA 2XWBB 3B9IA 4FPGA 4HKLA 1IZ3A 2VUJA 4IESA 4UFKA 4Q4Y2 4D7SA 1DYPA 4IV1C 1FX5A 1GNYA 1MQTB 3NV3A 5EJZB 3VBHB 3LZZA 4R4ZA 4NRQA 4WVVA 1YI7A 1YCIA 4C1WA 4YVWB 1RUH2 2A6WA 1FMD1 2ZEYA 5CFDA 3GBGA 3H1WA 3B01A 4LE4A 1GWKA 4BA6A 2CGPA 2VZTA 1LULA 1Q8SA 3B94A 2RVAA 4J1WA 1UXZA 4Q0QA 4AAXA 4CA9A 3C7GA 1R083 1VR3A 4CPBD 3PVOA 4MUVA 5K0UA 1KJLA 2A70A 3OGRA 5LW9A 1VBE1 3RI8A 2RM22 1C3HA 1CZSA 1H1IA 1W8UA 1XXNA 4I01A 5ANNA 1JZ2A 2DUQA 2GMPA 1POV0 4LHSA 3ACGA 1KQRA 4UWDA 3UKNA 4XJZA 4OUSA 3VL8A 4QX5A 2W3JA 3WZ1A 2P37A 3CKHA 4FQZA 3KM5A 4IUGA 4MXVA 4XDOA 5FLIA 3ZFFB 3I2GA 5JOWA 3B02A 2VZPA 4ITCA 1OT5A 3OSDA 5DAXA 1TMF1 1D2SA 3OG2A 1VRH3 3ZN5A 2WWUA 4BM8A 1S0FA 4JTNA 5CG8A 4H7MA 4YW2A 3DV8A 5C8CB 4Q4Y3 1DDLA 3ABZA 1EV11 1WGPA 2LW8A 3J8F3 1REFA 3BOPA 1GANA 2ATFA 3CZJA 5FYBA 3WCRA 1QU0A 4BQWA 4BPZA 3FLTA 1O8SA 1AYN2 4QQLA 5JLVA 3UT0A 4OI0A 4QX8A 2VZSA 2O8QA 4QWNA 1ZRFA 1H8TA 4PHZA 3ORJA 5LBEA 4PT6A 1HRV2 2VPVA 1F4AA 5CKQA 3H0OA 3FLPA 3RYKA 1OPOA 1Y3TA 5T5PA 2XQXA 3V56A 3I3MA 1DQ4A 2I07B 4M3CF 4CDQB 1KGYA 2ZCWA 4XJAA 4C8DA 5FY9A 1Q5OA 2X8KA 3SLIA 4RQPA 1JYTA 2VU9A 2AR6A 5BNNB 1LKNA 3T08A 5DMYA 1TMF2 2C0ZA 4WVWA 1WCDJ 3AZVA 1OOPA 3JD72 3AMQA 2R30A 1XC6A 1Y9MA 3WF1A 4QDSA 2OZ6A 5FYSA 5I0UA 1VB4A 4BLIA 5IVCA 1TNFA 3DF0A 3CDZB 5EJ3A 5C6CA 3BVCA 4ZONA 1GWLA 1MS1A 3RFRA 3LOBA 1UIJA 4QPIB 3PMSA 4IV3A 2UWCA 4OULA 5B4XA 3T4VA 4COVA 5LK7B 1NQDA 4NMIA 2DU1A 2HWB3 4RGAA 1K3IA 2EXJA 3C8XA 3HQXA 1KS4A 2WT1A 2RJ2A 4AEDA 1UKRA 1V6KA 1YO8A 2IXLA 3M1HA 2Z42A 1CAWB 1UY0A 4YVWC 4CUCA 4Z07A 5FOJB 4R8HA 1L3JA 4XFGA 2PQSA 2GMMA 4Y1ZA 4BK4A 4OHYA 4UFMA 4AEMA 3MI8A 1VBA1 5FZIA 2VMCA 2LUWA 4B29A 4YPJA 1V6MA 1UCXA 1D0GA 1CIYA 2YGMA 3PLQA 4E4HA 1RHI2 2XKOA 1Z7S3 5FMCA 3FBYA 4UW3A 5FPBA 2JECA 4CU7A 1QOOA 3D0JA 1KDKA 5I93A 3O1SA 4XFAA 2XVKA 1O7FA 2QKDA 1S1AA 1R1A2 2VNGA 1FI2A 1HLCA 1NE4A 4UF0A 2R0HA 1H0BA 2JDUA 2VUDA 2ZPXA 5F5AA 4XE9A 2LALA 1SBDA 2IVJA 4NPRA 1WA6X 1UD1A 2NPIA 2KXLA 1GSLA 1RUH3 2A3YA 2DVDA 5FJHA 4LT5A 3PUSA 4EN8B 3RYPA 2JE9A 3HT2A 4JQRA 1G9FA 3WW4A 2BBAA 1NCRB 2Q8OA 1BHGA 2Z69A 3PUIA 3RS6A 3VD5A 2HEVF 2WSVA 3BTAA 1VLNA 4S2FA 4CEWB 1UU4A 3VHOA 1WWYA 5FLHA 2Y0OA 1L7RA 4MXWB 3S7EA 4BHPA 1VP6A 2CL2A 2RM21 2ZGTA 2WZR1 1KRIA 1V70A 2DV9A 2CWMA 5FY5A 1WMXA 4HFSA 3IDCB 1MVEA 4I30A 3N3HA 4KQ7A 4K1YA 5BV6A 5FRAA 4S2GA 4AVSA 2MEV1 4D6QA 3CLPA 3I97A 2X5IB 1GYKA 3LEIA 2E32A 1JHNA 1PGW2 4GMP0 4RQPC 3ZFGB 3QCWA 1QJZA 1SFYA 2WDBA 2YC4A 1JHJA 4KGGA 4P02B 3T2OA 2RS53 4BH9A 1XJAA 1R093 4CXYA 1RHI3 2PMWB 1ZRIA 4HSJA 2VZOA 4LO4B 4YVSC 4XABA 3ZXLA 4AXOA 5AVAA 3AP4A 1W6PB 4R9AA 2YU2A 1AR92 3OGJA 1RUJ3 1OLMA 1PZ9A 2QUOA 2B4KA 3JD71 3PHMA 1BBT2 4XF3A 1TME1 1NT0A 3J7NA 4OI2A 3W5MA 2JICA 3POBA 2GC3A 4J6GA 1H8TC 4N7UA 2DUOA 4YZ3A 5IK7A 4F83A 5J98B 4AI3A 1SLTA 4QU2A 2A7AA 3TWIA 2ZMKA 5FP3A 2GDFA 4NHYA 1S2EA 3ES4A 4XCAA 2XJRA 1MZFA 3ZM8A 5FREA 1YQCA 5FDBA 5IVJA 4UFHA 4Q4V2 5LASA 4MHRA 1OLQA 1L7LA 4AYUA 1AXKA 3EB7A 2R063 2IXJA 2VVFA 3W20A 4BWOA 5IJRA 1BEV3 2JD9A 2ORXA 2FBEA 2QZ3A 2QQMA 4LO5B 4CDUB 4XUOA 5JCTA 1LAJA 3BB6A 2ZXQA 3E5UA 1MQTA 5AVPA 3L2HA 4A44A 4UFIA 1VBD3 1QEXA 4AHZA 1D2QA 1UY1A 2PHFA 4S2DA 1RHI1 1QQP2 5F2WA 5C71A 1PVC2 3NNFA 4CP2A 3WUCA 2XKPA 4ZPIA 1PX3A 2VQ0A 3J7HA 4JHZA 4BQ4A 3TAYA 4W50A 3UV9A 3N36A 1OOPB 2VAUA 3PNAA 3VBUC 5IUQA 3U37A 3TEXA 3O5SA 4XF0A 4XFFA 2G4IA 2Y34A 1MEC2 2B9VA 3RJ2X 4Q4W2 1SLLA 3OGVA 5FZHA 4FPLA 3WOGA 1AXYA 4BJ0A 5BPXA 3UNPA 4NIDA 1CZTA 1UQXA 4Q4X2 1CR7A 4LLOA 4QPIA 5LBFA 2Z5WA 4M01A 1JYCA 4NRMA 1W9FA 4M0HA 4C0BA 5BYNA 2XMLA 1NY71 5FOBB 3AFKA 3WLUA 3WNKA 4AI8A 4DXTA 5DZEA 2PA7A 2FZ2A 2W47A 5CG9A 4AQTA 1UOGA 4BYYA 1MS5A 1QXPA 1UU5A 5DZFA 2XJPA 4GQ7A 1PMHX 4QMAA 2ZHMA 3S6PA 3PUAA 4HSLA 1OPMA 1XYOA 4SLIA 1RUI3 3VL9A 4CUGA 3AZXA 1HN0A 1FAYA 1PIV2 2WNVB 2ZJCA 5D21A 4META 1WUVA 1DGRA 1D0HA 3ACFA 3NL1A 4I3PA 3DCQA 4QX2A 3UETA 1HQLA 3GNEA 3S57A 2D40A 2DCJA 3BPSA 3RPQA 1QJX2 1QGLA 3OCPA 5DPNA 5FPZA 4Y5Z0 4PIZA 3SEPA 2R072 1ZNPA 2XUEA 4JAAA 4LKFA 2VGDA 5C9AB 5KXEA 4AHXA 3AKTA 1G7YA 4E2SA 1OA3A 2ZA9A 4XUNA 3VB9A 1QNWA 3IT8A 1VBA3 1QIQA 2ZX3A 4E9KA 4N7IA 4BQ5A 4RR3B 3NJZA 3ZYPA 3NO8A 3AP6A 4JKLA 3WW2A 3ROUA 4AW7A 4XZUG 1DU3D 1GP6A 2XOMA 4LLFA 4WM8C 2Y38A 3VDCA 3QD6A 3WNMA 3ZN6A 4AQ2A 1IS6A 2QQVA 1W8FA 1ZBE2 3HEIA 5JAXA 1LU2A 5JSRA 5JSPA 4H7LA 3POYA 1KDMA 4XMAA 3VHPA 4UW5A 4C90A 3V0BB 2FMYA 4FCAA 2X5IC 1KS5A 4RGGA 4CXWA 2A71A 5FZ6A 2DF7A 4AL9A 1W9YA 3SKJE 1OVPA 4CP0A 1GICA 3ZYFA 2DVGA 3AKSA 4HKWA 4P14A 2ADEA 2E63A 3KCCA 2UYAA 2VOVA 1ULPA 2NYYA 5JR7B 2WNOA 2BVVA 1BBT3 2VL4A 5C8CC 4AFAA 3O7OA 3HOBA 2JDHA 2QQPA 1NCRC 2E31A 1E5HA 1ASJ2 1UAIA 4LK6A 1X82A 2AACA 1F8VA 2W94A 4AF9A 4YVSA 2V5YA 1WCQA 5FXWA 4AFDA 2VD7A 4QXHA 2VMFA 1UKGA 1F31A 4Q4V3 1TVGA 1HJFA 1WLTA 5FV3A 2BZDA 4IEOA 5I0RA 2HJIA 5GLUA 1A8DA 1ENSA 1VBB1 2HWF3 3CQOA 3I2IA 1R1ZA 3Q8CA 1W2TA 2BFUL 2HWC1 4YW5A 3W59A 1M06G 5DQ0A 4ARXA 5FZOA 1YLLA 1MS8A 3FUQA 4UYBA 4QKNA 4Y20B 1QMJA 1TMF3 2HKXA 5FZ9A 1MEC1 2VVDA 4RYDA 4CUBA 1W2NA 2RR11 3FL7A 3NWKA 3R4UA 2XLFA 1U5YA 3VBSB 5A6XA 5FUPA 4W8JA 2ZHKA 1I3HA 3KS7A 4JGYC 3CJIA 4Y26A 4FPOB 3ZXFA 5A3MA 1ND2A 1XQNA 1CN1A 5H9PA 2JG9B 4BQ2A 1RC6A 3AKPA 1W8ZA 3OYWA 4Q4W3 5JR2A 3UJOA 1WW5A 4XETA 4N53B 3P3PA 4LOTA 5I0TA 4BK5A 1UL9A 4OZXA 4IGQA 1LODA 1SPPA 2D44A 2DCYA 3DGTA 4KWLA 4XEZA 1VRH2 2DVBA 4GIQA 4ZU7A 2A6VA 2XHKA 2CY6A 4YVWA 1HB4A 4QHOA 4E4ZA 2EF6A 2A5ZA 2R1BA 4EN6B 4QGNA 1OXCA 1JU4A 4HVRA 1X8MA 4LHKA 1Z7S2 1VBC3 5C4WB 3NJXA 1S0GA 2QQKA 1NXMA 3N9QA 5LATA 2CDPA 2MPFA 1RIRA 4MV2A 5FY8A 3VBHA 1R1A3 3JUUA 1HDKA 3HNMA 3KGLA 4I3GA 1PIV1 1KITA 3WNLA 1X7NA 1ZBA3 3DN7A 4P08A 4M3CB 5FP9A 3TEWA 5J48A 1FPN3 4NPMA 1LOFC 1RJ8A 1CAVA 4DRVA 1QJX3 5I0DA 1QJY1 1RUC2 3M8LA 2R073 1RUE2 3Q8BA 1CX4A 4XJUA 2VMGA 1KEXA 4FOVA 3I8TA 4GH4C 2BVBA 4NVPA 4R9CA 1W6OA 4XZPA 3ZYIB 5KR7A 4QD2A 1AZDA 2Q30A 4W6YA 4LEJA 5D8AA 3U0ZA 5A3TA 1JYIA 2YXSA 2ZX1A 2J1SA 1H30A 2FDFA 4BXSV 1U5IA 4YZ5A 2HWE1 4RL7A 3I49A 2G1MA 4KI5M 5C4WC 1MS9A 4KNCA 1REEA 1BKZA 1NCQA 1EPZA 3ECQA 3O1RA 5T3NA 2E7AA 4FPFA 5C8WA 3WNPA 3K51A 3THDA 5FPVA 3M3OA 3VDDB 1OC1A 1J59A 2ZEWA 3GZAA 3EQEA 4IEWA 3IDEA 4LBNA 4HT1T 5T55A 3VD7A 4LO7A 1R64A 3WW1A 5IVFA 5FUNA 3HN1A 2OT7A 1DGWX 3N9LA 1JMUB 3EXUA 1YQ6A 3QACA 1O3TA 4CDUC 4FOYA 2HWC2 1VBC2 3HQRA 3SCFA 4K9SA 1YYNA 1QJY2 1RUC1 4I0WB 3DL3A 1WLWA 1PMIA 2C1FA 5T54A 3MIFA 5C8CA 2YBSA 2BWCA 4YZ2A 2C6SA 1X9TA 4GB32 2PHRA 4JGYB 1SMVA 4LITA 1AJOA 5KC5A 4GKXA 4GXLA 4E2QA 1ZBA2 1FT9A 5F39A 2WS93 3S30A 4A7KA 5FYTA 4YW6A 1FPN2 2PFWA 3NNJA 1MPXA 3MEPA 3RYRA 1N3QA 5J7MA 1ND3B 1D7PM 2A6YA 4KU8A 1OA4A 2XPJA 1BYHA 4PF1A 4CDXC 5KXBA 3MUY1 3ELNA 5CKMA 1CVNA 3H42B 5I8SA 2VOKA 4CCCA 3WG2A 4IXLA 4NHMA 5KXCA 3EJKA 3U1XA 3D3AA 4IV3B 1QOTA 4N8MA 1RTVA 1YEWA 4NJ4A 2B9UA 1PVC3 1CQ9A 2V5DA 3QOPA 3U07A 2FDHA 5A1FA 5BNOB 1W6QA 5CZKA 5HBAA 2DU0A 2I74A 2D6KA 5T5LA 3RWKX 5K0UC 1AX0A 5EYYA 4Z82A 2JB8A 4BDVB 4OUEA 1E57A 2OQ7A 5C5UA 5HV0A 4DUXA 4LIVA 2JX9A 4XHXA 2IFWA 4EYUA 1ULEA 1CAWA 3BI3A 2D5HA 2D93A 2JDPA 3PTYA 4L11A 2K0GA 1FYUA 3V65A 4FAHA 5AC92 4QPIC 3IMNA 5EV7A 1UY3A 1VMJA 1PMJX 4KWUA 2JDNA 1O3RA 3OUHA 1E5IA 1S0BA 3PTRB 1W0NA 3RDIA 2BUKA 1HXS3 3B69A 3T0DA 3VBUA 1WZXA 2L9LA 4N43A 5IWFA 1PO21 1BJQA 4JKKA 3VGIA 3W21A 4Y5TA 4YFZA 1VBB2 1HRV3 1N1TA 1D4M3 3LAGA 1ZZCA 1U12A 4Q26A 2W1WA 3JXSA 3GXUA 3S0MA 3MUZ1 1LECA 1O91A 5JOXA 2AZ5A 2EICA 1I9RA 2NM1A 2VY0A 3LPFA 3N7MA 1LHWA 4YYOA 5SV8A 5B2GB 4ISQA 2VNVA 1VMFA 4AEKA 5HCFA 4CDWC 2JEMA 3PIJA 4PCRA 1O3QA 3AMMA 5A33B 4MGSA 4Q1PA 1WMDA 1ENQA 2WQ4A 5F2SA 5FYIA 3ACIA 1BMV2 1W6OB 4MXWA 1N47A 1WA4A 1H2NA 4K7JA 4NRPA 4XDPA 3TB0A 3FX3A 1W8NA 1UYZA 2J7MA 4HMZA 1IG0A 4LORA 3W58A 1OURA 3RMXA 1UN1A 1H2MA 3B9CA 3H3LA 2R7EB 3AJYA 4I0AA 3IAPA 1EY2A 2TBVA 4XQ4A 2R16A 3MW2A 4HN1A 3ZKUA 4F7ZA 4HK8A 2Q1FA 3I2HA 5FZCA 2FDKA 2GNDA 4XF4A 1FATA 2O0OA 1J3RA 3Q8EA 2GP5A 2UY8A 2OUHA 3C7FA 4Y1UA 1PO12 3RMYA 5FXVA 4DOUA 4DY3A 4WM7A 1ND2B 4RGKA 3VZKA 2JDMA 4QDQA 4RFRB 4HLTA 4XJWA 1W39A 2JG9A 3WF0A 4YGBA 2RG4A 2EALA 1WCUA 3P6BA 5F3EA 3WG3A 2ZAHA 5FZ8A 4P9JA 1B35C 1QHDA 1D4M1 1IS4A 1JXNA 2R6QA 2WS92 2WT0A 4FPEA 2HWF2 4PDWB 3S7IA 4Z8BA 2YUEA 4BU2A 1ZA4A 2C24A 1OUSA 3AYCA 4RS5B 4LTAA 3ES1A 1UYPA 4XFCA 5EP9A 1DBNA 3MIEA 2W92A 5IFPA 1LOGA 1F9KA 1UW8A 2VH9A 2Y60A 3GZUC 4HL0A 4ATFA 5ACA1 5IFTA 1JYXA 4IE5A 1DHKB 5LY2A 4NWWA 4L92A 2QFEA 1VBA2 2B45X 4IV1B 3VBHC 2D3PA 3RZJA 3ZIXA 2QDRA 3T1LA 3FFZA 1I5ZA 4XBLA 1W8HA 5TSWA 3GCXA 5KHGA 5A7WB 3IIIA 4D94A 2OPWA 3BIWE 3LFIA 1XNKA 4LBMA 3WF3A 3WP5A 1QF3A 1W8WA 3NAPC 3AL5A 1C5HA 1ZBE3 4RHV3 4QB2A 5A6QA 1OLME 3VKFC 1GP4A 4P9YA 4AZZA 4IQPA 2WL1A 2ZZJA 1S0CA 1PVC1 4GH4B 4Q0PA 3CIHA 4INDA 4NIAA 2A75A 5FK8A 4EJRA 1VBE2 1YXWA 1LOBA 1ZZ9A 5L9RA 2EAKA 3ST7A 3J4UH 4W6XA 4Q0VA 5GZGA 5DABA 4PQQA 1S0IA 3A7QA 5BNPB 3ZYGA 1G9BA 3BALA 2AENA 3OBTA 1NLQA 4OHWA 2SLIA 4BISA 2Q8CA 4CEYA 1CJDA 5FZLA 1V0AA 2CWSA 2FQPA 2B42B 4A45A 1LCLA 3BN6A 5FZDA 3T2TA 4YNIA 1W3XA 3K4DA 5EWSA 4XCBA 3O12A 4MLOA 4IEYA 4ZS2A 2WWJA 2QJVA 4HETA 4A7YA 4O9GA 4P5YA 1RVF2 1X9PA 2VMDA 5FBJA 1UU6A 1W04A 1QJFA 3AL6A 2UWAA 1NQJA 1YQ2A 2X10A 3OB8A 5IW0A 3I2OA 3DPRB 4EWEA 1RUC3 1RUE3 1VB2A 3WEZA 4OHZA 1G86A 3WDYA 2OPKA 3GF6A 4ASLA 5M0TA 2D5FA 1LGNA 1OQEA 4UFJA 5T52A 4BQ1A 3AM2A 2ORZA 2MHFA 1C1FA 5E89A 3U11A 2P3JA 3JCIA 2YU1A 2J22A 3HT1A 4IE6A 4QPGC 5A3PA 2VBBA 3ZXDA 4P9WA 1WW7A 4FTEA 1QJU1 4Q4X3 2PLV1 3N9NA 4URAA 1DCSA 4BB3A 1QDOA 5G05L 1UY4A 1LOEA 4BQ3A 3H7JA 2WLQA 4Y4YA 4MGTA 2O1QA 3K46A 5CFCB 1CAUA 2W08A 4MYEA 2R071 4Q5OA 4JHTA 4DUVA 1QJY3 2NN8A 1DYKA 3QH6A 1OD5A 2XLAA 1DGRN 4LHLA 1YFYA 2ZGSA 2D3RA 2E7QA 4B4RA 3JB4C 3OPZA 1S2KA 2RJKA 1ZBA1 2BOIA 2NZ9A 2FCTA 1PIV3 1C28A 2DCTA 3WD5A 1S0EA
chains in the Genus database with same CATH topology
3URFA 4M3CE 1W6NB 1UZZA 5J96B 1FOD2 3WG1A 1LB2A 3CF6E 3A0NA 3WR0A 3ZXGA 4URTA 5GKAC 1VALA 3PVNA 1DQ0A 3ZO0B 4B7KA 3M3IA 2HYKA 2IC1A 3CJIB 2B46X 2HWD3 1F2NA 1NY72 4N43C 1XRUA 4K40A 1UX6A 3AMPA 3X29B 4XBQA 2XJSA 1DGLA 4NR1A 3WQ7A 5FO7B 3M3CA 5FQ0A 5IK5A 2I45A 4ZKTB 1AR71 4IEXA 1JN2P 3GALA 4IV1A 5LK5A 3TOJA 4EWDA 4Q4W1 2GN7A 2YYOA 1V6JA 1NXD1 2BBVA 3MF9A 4OHXA 1AX1A 1HV0A 5DUWA 4AHYA 3MIHA 4IETA 4XJ8A 4FTBA 4IERA 3WINE 1F5FA 5T5OA 5HCAA 4COYA 3FWEA 4Q8LA 2VW2A 4AE2A 4YRDA 3OY8B 2HWC3 3DKWA 1GZWB 1VBB3 2HWF1 4MX3A 1ULDA 5FMOL 1X33A 4M3CA 4TSVA 2VUAA 4Q4V1 3NAPB 5I0SA 4F8AA 2HEYF 2XJTA 2D98A 2DUPA 2GC1A 1TQ5A 3VUOA 1CAXB 3L2YA 2BEOA 3CO2A 3ZYJB 4M00A 4AQSA 4ZXKA 3SISA 3MIGA 5D8AB 5KHHA 5CFCC 2YDEA 3VZLA 5JZGC 1PO22 2ZHLA 4GWMA 4OFGA 5JWPA 3MLJA 3IDBB 1O5LA 1V6OA 2BFUS 2ZMLA 4PLOA 2H0VA 3VZNA 3WP4A 5GJ6A 3NKGA 4YW3A 1YNAA 1G9CA 1B35B 4RS5A 3WDXA 1WBFA 2R1DA 2G9GA 1QXRA 1HRI1 3R0RA 4LUKA 3MFCA 4I2OA 2VXRA 3QBQA 4U36A 1T6GC 1MR5A 3ALQA 2OW4A 3VDDA 4E2GA 1PK6C 1R092 4DZGA 3ILFA 1LU1A 3OGGA 4AVVA 2HWE2 1LHUA 4JRAA 4R9DA 2RS13 3KT1A 4FP3A 4X6QB 5EXOA 2VOWA 5HCBA 4NHLA 5CAZA 5J36A 2IWGB 3AYAA 5ABJC 2H0BA 5FMOS 3BCWA 3U4XA 1D4M2 4K21A 5GLZA 4YM2A 1RUI1 2R062 2ZGRA 3AXEA 3UKTA 4YG6A 2D6NA 5FBZA 1PHMA 1W6MA 4CDWB 4CEYB 5I91A 1Q8PA 3B93A 4AVBA 2KM2A 4IEVA 2CGOA 1NA1B 3FBMA 1OFSA 3IWZA 4FOQA 1Y9QA 4DY5A 1XE7A 2WNVC 1N1SA 2R49A 1LGBA 5L19A 5LEKA 4B4QA 1AJKA 4GMP1 5ABJB 3FC0A 2VOXA 3WHTA 4GB31 2IXCA 3IPVA 3ZSKA 3VBRB 2PYTA 1BXHA 3JB8A 4CEWC 2VECA 4Y1VA 3D0SA 3MPPG 1J1LA 4N43B 1NG0A 3VBOA 1MS0A 2Y26A 1PO13 2TUNA 3PMEA 5F6KA 1WCKA 1LOAA 1IS3A 3GYDA 3O14A 3VBSA 1DLLA 2VW0A 3HMYA 2D43A 1OOPC 3VBUB 3WDWA 4FPCA 4YM3A 3QLQA 3PVEA 1YUDA 5JOZA 1IKPA 2XBO1 1MACA 1OSGA 4JGZB 5L7OB 3KD4A 2ZGNA 2WA3A 4IV3C 1DF0A 1O4TA 4QQHA 2XVGA 1CD3G 1LHOA 1VAMA 2VNOA 3JD73 2R043 2BNNA 4L9BA 2XLGA 4K8FA 1YJLA 1ZREA 4EN0A 2P3IA 2RS51 3N7KA 1SLIA 2PHUA 4PBPA 1ULGA 3NSTA 1NLSA 2E7TA 3WNXA 2ZGMA 3VBRC 2PHDA 5KC6A 5KHJA 5IK8A 1B35A 3B3QE 1ENRA 1REDA 4O9EA 3ZN4A 3HWJA 4GA9A 2K9ZA 3H50A 4YG3A 3WQ0A 1TE1B 1OI6A 3IBMA 4RHV1 3VKLA 1FV3A 2WA4A 2RMU1 3R6SA 1OKQA 2PHTA 4HKOA 4Q27A 1QWRA 4XPVA 4SBVA 1V9U1 4KBBA 4BIFA 1Y7BA 2EIGA 4X8NA 4Q0UA 4N90A 1XYNA 2RS12 3VDDC 4A7ZA 4QXKA 2XWJB 1HXS2 4HPKA 5KHKA 4FPYA 3J9SA 4JC1A 1ALYA 4DB5A 1PGL2 2WFPA 4C91A 2HWD2 4PIXA 2R042 3AKRA 2JG8B 4FOWA 2RJLA 3TNQA 3GBFA 5BUVA 1YIFA 1C1LA 4KWJA 3SNMA 3VKMA 4IL7A 4L8QA 4XJ9A 5EYXA 3WVJA 2D6MA 3AB0A 3BOWA 2CV6A 5JMCA 4FTSA 3FE5A 5K0UB 1NA1A 1AYM1 5GM0A 4YARA 4IEUA 5I8TA 1IHMA 3ZIWA 3IM0A 2HWB1 3INAA 3WG4A 1ND3A 2ENRA 1YRZA 3VLBB 1NLRA 4MGZE 2ET7A 4YGDA 1FV2A 4KG0A 3V0BA 4WZFA 4CRQA 4DPNA 2B7YA 1SCSA 4WZCA 2BNOA 5BNOA 4AGRA 4WV8A 4Z92B 1MQTC 4Q1RA 5DXDA 1UIKA 1WBLA 1EPWA 4GWNA 1EP0A 4QHBA 4XFBA 4D7TA 2UY9A 3O0XA 1LOCA 3UL2A 3HIFA 3BODA 4XFIA 4XQWA 4COUA 3SCHA 4QT6A 1QH7A 4XOGA 1PO23 1AR83 3DPRC 3LSEA 4Q4Y1 2UWBA 2XBO3 4LBJA 2WQZC 5D1IA 4C0HA 1J1TA 1FOD1 4B8EA 3GHMA 3JU9A 2DYCA 2JG8C 1AXZA 1PO11 1LENA 2GSYA 3E5XA 4AVTA 2QDNA 4ASMB 5F5QA 4FO9A 4LNVA 1VBE3 3M3QA 2Q1ZB 4EROA 4GB33 3AMNA 1G9DA 1CJPA 1BQPA 3K48A 4HVOA 1U5ZA 2ZGKA 1VJ2A 3WDVA 4F3JA 5A32B 4S2HA 1RUNA 5AFEA 1H8VA 2Q1MA 3H3ZA 1BVVA 1DQ1A 2NMOA 4RR3C 1ENXA 4AHWA 1RVF3 3FHIB 1OMIA 4QPYA 4AFMA 3FLRA 5E16A 4HBNA 3AXDA 3DUIA 2WS91 3VBFB 5CBLA 3ATGA 5C9AC 4KGQA 4JCKA 5C33A 2Q4SA 5FTTC 3RG0A 4ZU4A 1Z78A 3ZSEA 4P9XA 2BPA2 4AI2A 3U10A 3VBSC 3VHRA 3G7DA 2WFF1 1H4HA 3KGZA 4FXGB 4PDWA 3VZMA 4ES8A 1GFF2 4JGZC 4LA3A 5L7OC 2RS11 1QDCA 1JBCA 4HK9A 1COV3 4NO4A 1VIWB 3AK0A 1C8M3 3V64A 4IEZA 2HWE3 5T5JA 3M2MA 1HW5A 3RI9A 5BNQA 3RJRA 1ULFA 1RINA 4YGCA 1SBEA 3WDTA 4DFSA 5H9RA 2AREA 1ULCA 4LHNA 1S0DA 4MGYE 5GZCA 1HRI2 2D6OX 1Q8QA 5JPMB 1QJX1 4KH9A 2VNRA 4FQ4A 3D5OA 2A6XA 3JZVA 2UYBA 2UU8A 1AR72 1V6IA 4LE3A 2WFF2 1DFQA 2GZWA 1CIWA 1B09A 2EVXA 1DIWA 1AL22 1K5MB 1VBC1 4OLLA 4WM7C 4ISRA 5ACA2 1AR82 2NLRA 2WNUB 1XU1A 1MVQA 1H2KA 1MS4A 2DVFA 2H6BA 3KT4A 1J3QA 3EBRA 1G8WA 1UPSA 2ZHNA 3R4SA 1YFXA 4XILA 1WCSA 5FCCA 2ZBJA 1RJ7A 2YHJA 3CU7A 1EAH3 2CYFA 3KB5A 1NYWA 3LWCA 1TEIA 3LKJA 1O4ZA 2W39A 2ZGOA 3FMGA 3J26N 4TLFA 4K6BA 1RGSA 3A0KA 3WY6A 5KBFA 2BW8A 3HAGA 1I1EA 2ZX0A 2NQYA 4G3YC 3WV6A 3FJSA 4CDQA 4DINB 5FAXA 4Z1VA 4V1PA 3E97A 2B39A 5DDJ2 1GBGA 3MLLA 4OHVA 3KSCA 1SBFA 2EXKA 2GC2A 2NMNA 1J58A 1WLDA 1Q43A 2X5IA 5LEJA 2AGSA 1AF9A 2PELA 1AR73 1XNBA 1PNGA 2D7FA 1EAH1 1G6NA 4X6RB 3SMHA 4RD7A 1MS3A 2HWD1 5A32A 1W6PA 2XVLA 1MZEA 4AEDB 2RE9A 3TN92 5CFDC 1PNFA 4XQDA 3V0AB 2YV8A 1O5UA 4YSFA 5AC91 1DGWA 1W6MB 3NKTA 5CU1A 5GLTA 4CDWA 5CFCA 5T50A 4IEQA 3IIAA 2GNTA 3UJQA 2YPJA 2D6PA 1JH5A 1ND3C 4DRRA 3ETQA 1QNYA 4FPJA 3SH4A 4AVAA 1UPIA 3AYEA 1O4YA 1W6NA 2A3WA 4XF1A 4CYDA 3I2DA 3E6DA 1AR62 1YI9A 1YHFA 1AL0G 1CPNA 4AWDA 2QCSB 4Q0SA 1W0PA 4Q2FA 2PLV3 3HR9A 2E6VA 3LA7A 3E6BA 2Y0IA 4LO8A 4FPKA 5L36A 3NW4A 2H6CA 4ZU5A 5J3UA 1H9PA 2YROA 3LGRA 4LBQA 4N9IA 3AYDA 1RUE1 1QKQA 2V73A 2VQAA 4PIYA 4EWAA 4B7EA 4YVSB 1RMU2 5JI7A 2VMIA 4XIKA 1JUHA 3RRDA 3AMHA 2N7GA 5FFOC 3MGUA 2WNUC 1AL21 4RFT0 3E6CC 1WW6A 4L97A 4AG4A 1RVF1 4HANA 1FNYA 3SHRA 4KL1A 3VV1A 1SLBA 2ZGUA 4YW4A 1EYBA 4XFHA 3T1MA 3VBFA 4WM8B 3L9JT 1X50A 2EXHA 1DQ5A 3NVCA 4MVTA 2CTVA 2OIIA 3NV2A 2ZGQA 3M70A 1TNRA 3OTFA 4XHBA 3AZYA 4FP2A 5CADA 2IXKA 1DZQA 3USUB 1IPJA 1ZBE1 4GH4A 2ZOEB 1LHVA 4OI1A 1JYIA 3JBG2 3LA2A 4MGKE 3D82A 5DDJ3 1VBD1 2WZR2 4A3XA 3RWNA 3MIBA 4QM9A 4CDXB 1WD3A 1BEV1 1IOAA 1FOD3 3THPA 4R52A 5C4WA 2R061 4LA2A 3HBZA 4COZA 4U2AA 1BMV1 4QPGB 4XDQA 3WXPA 2PAMA 1PVXA 2XJQA 1ZZ6A 3R05A 2Z2SB 4R9BA 2RS52 1AR91 2PN5A 1AR81 1CAVB 2VVEA 1LOFA 1Z0HA 4AQ6A 4XTPA 1HV1A 1V00A 2GH8A 3Q9OA 1RUJ1 2E51A 2XG3A 1C4RA 2JKBA 3APBA 1R091 3A4UA 3H1YA 2ILMA 2WNVA 1WLCA 4AEDC 2GALA 2ERFA 1OA2A 2XGXA 1G9AA 2R0FA 2AYHA 1SQ4A 2EXIA 2MEV3 4Y20A 1IGOA 1UF2C 2JDZA 2Q0AA 3RZZA 1C8M2 1QH6A 2WZR3 4QM8A 1LJ7A 5BNPC 1CESA 4ES9A 3AKQA 1OQDA 4G9SB 3SH5A 1DQ6A 4XXAA 1KXGA 2WZPP 3OYWB 5GLWA 2WSUA 1PM7A 4A2UA 3TRSB 4JGYA 1LRHA 2QVSB 4DQAA 2OYZA 1RUH1 2JD4A 1AYM3 1BVP1 4LBQB 2JXAA 1LEMA 3D6EA 4MH0E 3ZFEB 3N7JA 4PLNA 4PF5A 2ZAAA 4XXPA 1VAVA 3PVBB 3VHNA 2WWSA 1U5XA 5BY5A 1PK6A 2ETEA 1WMEA 1GQHA 3MW4A 3ZXEA 2C5DA 3GHNA 4RHV2 1AYN3 1HXS1 2ET1A 1HQWA 5DZGA 4YG0A 1NCRA 4C1XA 1ZZ7A 4KG8A 2CAUA 1AX2A 4RS5C 2ZACA 3O0VA 5JIUA 3POWA 2IZWA 4B4PA 4WM8A 1IKQA 4K20A 3MF6A 1COV2 1V9U3 1MZ5A 4Z2WA 2AUYA 4WVMB 3RQ0A 5K7PA 2PHLA 5SV5A 4FVVA 2FZ1A 2BWAA 3ZX7A 4RSUA 4DXZA 2UURA 1RITA 2RMU3 3THTA 3WUDA 1NCQB 1LHNA 1RUG1 4KU7A 1V6LA 3ZFGA 2VG9A 4BMEA 2W0XA 3MLKA 1LEDA 4LR4A 4X8PA 2HWB2 3P3NA 3AP7A 1RL3A 2FMDA 2RS33 2WIIB 1U0AA 5H9QA 2G9FA 3UK9A 3ZFEC 3IN9A 2A3XA 1GNZA 4NN0A 3LA3A 1POV3 3SXWA 2CGNA 4N53A 4AI0A 2WKKA 3KCXA 2DFBA 2GU9A 2R041 4AFCA 2GH2A 1EV13 3J8F1 2W68A 5JIAA 3MZHA 2O8OA 5A33A 5FO8B 3USSA 1ZYBA 4JRLA 4H3WA 2JE7A 4BIOA 2ZZQA 3MYXA 1KFUL 1DZTA 1A6CA 2ARXA 3JBG1 4XBNA 5DG2A 5LRRA 1H4GA 3D8CA 3C2UA 4YM0A 2MEV2 1ZRDA 3ZFGC 2VW1A 1N3PA 1AVBA 3GZTB 1NA1C 4LBQD 3RSJA 1Q8VA 4N53C 2IFRA 2GNMA 5A3LA 2IXIA 3QH7A 3ZSJA 4GMP3 3LB9A 3ENRA 4XIOA 4ONUA 2BQPA 2WNEA 2RR12 3JQXA 5HI0A 5J37A 4LBKA 2RHPA 1FPN1 4CDUA 4CDXA 4P9GA 1A3KA 1HQNA 3N7LA 2B8MA 1R1A1 3ZVXA 4AGGA 5LRSA 4QPGA 4FPHA 1XU2A 4K3UA 5AFBA 4N9HA 2X29A 1HKDA 1NCQC 3AX4A 4AI1A 2QZ2A 1YIPA 4DS0A 4HZFA 1ONAA 3GBWA 1CAUB 2E53A 1R082 4YM1A 5I8YA 2YC0A 2D3SA 2XJUA 4YLZA 4OVEA 2DVAA 1JOJA 1QJU2 2PAEA 4WVMA 1QQP3 4LBLA 1RUD3 1S55A 3JBG3 2RMU2 1ZVFA 4B3NA 4P9LA 1GR3A 1HRI3 2RR13 5BNPA 5F6LB 4R4XA 1MEC3 3LSDA 4Q29A 4DNYA 2GAUA 4NOTA 5DG1A 3PJYA 3KQRA 4I02A 2V09A 1A8MA 1RMU3 1YWKA 1OLRA 4JV4A 3V0AA 1JUIA 1IPKA 1OQ1A 2A73B 4Y1YA 4CEWA 5FQ0B 1D4VB 1POV1 4JDNA 2ZMNA 1GLHA 1BCXA 4P5HA 2ZGPA 1S0JA 1EV12 5K9YA 2RS31 3MW3A 3WHUA 1BBT1 3G6JB 3VBOC 1RUI2 4YGEA 2EAAA 4AVCA 2ZX2A 1ZZBA 2OUJA 1K5MC 1V6NA 3N35A 1RUG3 3I4IA 3ZXKA 4YZ4A 1UMZA 1GZWA 3HD8B 3FZ3A 1RUF2 2Z79A 2YY1A 3KCYA 2FHRA 1ZX5A 5IK4A 2XUMA 3NAPA 2K2SA 4AFBA 3N4MA 1YFWA 4NHKA 3ZFFC 2VULA 3CJIC 1CAXA 3H3UA 2YZ4A 3WDUA 4IEPA 2EA7A 1N1VA 3AZZA 3ZSLA 2AH2A 4DMIA 1AYN1 4HPKB 4D7YA 3WX5A 2JG9C 1Y43B 1KD7A 2DURA 1W2UA 2ZKLA 3TN93 5JSOA 3AP9A 1ASJ1 2F6BA 2A6ZA 4FSJA 4PQ9A 3LCPA 1H9WA 2C9AA 5GZFA 2JG8A 2DFCA 4TZDA 4NWVA 1KFXL 4Y22A 1ZM1A 1X36A 2ZGLA 4J1XA 2VMHA 3VKNA 1H1AA 3MDPA 5GALA 4E4SA 3ZYRA 2TNFA 1V9U2 2GC0A 1PGL1 4JDMA 4BMBA 5GLVA 1ZZ8A 1RUF3 1XNDA 3VBFC 1AR63 1LR5A 1Q8OA 2R32A 5L73A 4CTEA 1H8TB 5BXXA 2GNBA 3LOIA 1NZCA 4FT8A 4WBBA 5JZGA 3KLSA 4FAGA 2PTMA 1PGSA 1VAKA 2SBAA 4QQOA 3FFQA 1NE6A 1KJRA 5JVVA 2WNUA 3PJQA 3USUA 3CL1A 3OY8A 1GNHA 4Q4X1 1QJU3 2RS32 4L2NA 3TBDA 3KZ4C 4RQPB 5BNNA 3AFGA 4UBGA 2XH6A 1BK1A 1C5IA 5DUUA 1Q56A 4BCUA 4OI4A 2I2SA 4AEJA 3O0WA 1AYM2 3MPBA 2W52A 1IS5A 2BGCA 1URXA 1H1MA 1AR93 4CP1A 1DZRA 1PZ7A 3I59B 4W6WA 5FLJA 4FBFA 2IXHA 3H8UA 3WW3A 2WC2A 2WINB 4MGIE 5KWRA 3ZDSA 1A78A 1TME3 5H9SA 3M3EA 3VZOA 1QXJA 3KMHA 2YMZA 1FXZA 3B7MA 4G4FA 5DDJ1 4H55A 1GZCA 4JTOA 1BEV2 3TNPB 4ATEA 5DUVA 1J3PA 1LGCA 4EN9B 4MSVA 5IT6A 3VZJA 5JDBA 1GZ9A 4LBOA 3EHKA 2ZABA 3NV1A 1N1YA 4XMIA 1ZRCA 2PAKA 2BNMA 3ZFEA 1F5JA 2LTNA 2OA2A 1BZWA 3CEWA 4L99A 3EO6A 2GMEA 2RM23 4BLJA 3OF1A 4COWA 3E5QA 2LM3A 1PK6B 1W0OA 4LO6B 3OJBA 1NOVA 3UKVA 1AL23 2JJ6A 2MNGA 5CFDB 1Q3EA 4HVQA 3BPZA 2YGLA 3I7DA 1WW4A 5ACA3 1LTEA 4TYSA 1JTZX 3M7AA 1YFUA 1CONA 2ZS6B 2JENA 3H9AA 3CNAA 4CDQC 4QGLA 3IKWA 1EAH2 1SEFA 1SACA 4OUMA 1JW6A 1QOSA 1Z7S1 4LUMA 1OFNA 3ASIA 4BOWA 3VKOA 1SFNA 4AGVA 5FPXA 1WD4A 2WJSA 5D8AC 2DWRA 4I09A 1RB8G 3ILRA 5GZDA 3JQWA 3AZWA 4MZUA 3VBRA 5CB7A 3WP3A 5JOYA 3ZFFA 3D4KA 2WT2A 3MICA 1WMFA 1C8NA 2D97A 5CNAA 4PBOA 4GKYA 4D3WA 5CA6A 3VBOB 3ZXAC 1RUD2 4CZSA 3SH3A 2HEWF 4CEYC 4HN0A 4UW4A 1LESA 4Y1XA 1AR61 5GZEA 1RUF1 4QQ2A 4EV0A 4WM7B 2PQQA 5EZWA 3ACLA 1SLAA 3TYJA 4JGZA 5L7OA 2XBO2 3SCGA 4Y24A 1DG6A 5AC93 4UXAA 4XYXA 5CIRA 4D69A 1CGPA 3WQ1A 2ARBA 4YFWA 3VN4A 1CPMA 1OHFA 3I59A 5EFUA 1I6XA 4JDOA 2GN3A 4E27A 1K5MA 1FMD2 1ASJ3 3B5LB 3CJXA 3ILNA 4PJYA 4ORFA 1GV9A 1PZ8A 2KA3A 3H7YA 3TN91 1HRV1 2X53S 4M0NA 5KHIA 4QQPA 1H2LA 3BU7A 3ME2A 4PDWC 5CVRA 2ZKNA 4Y22B 2D6LX 1VRH1 1XNCA 2B5HA 2QE3A 2PLV2 2PHWA 1VBD2 2XB6C 2DTYA 4YW1A 5FO9B 2BTVC 4KWKA 3MIDA 5HXVA 1ND2C 2ZTNA 2XJVA 4E4DX 1PGW1 5ABJA 4UW6A 5C9AA 3ZN6B 2BYVE 5JI9A 3ZMOA 4BE3A 1GQGA 2PHXA 2P3KA 4FXKB 4RR3A 5JZGB 3ZSMA 3M4FA 3FUOA 4TWTA 3OD4A 3POSA 3WCSA 1X8EA 2P17A 4LULA 1XYPA 5F9TA 2FZ2A 1R081 4QGMA 1C57A 3OBRA 5KXD<