2FZ1A

Structure of empty head turnip yellow mosaic virus (atc) at 100 k
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
163
structure length
163
Chain Sequence
SPFTIKQPFQSEVLFAGTKDAEASLTIANIDSVSTLTTFYRHASLESLWVTIHPTLQAPAFPTTVGVCWVPAQSPVTPTQITKTYGGQIFCIGGAIQTLSPLIVKCPLEMMQPRVKDSIQYLDSPKLLISITAQPTAPPASTCIITVSGTLSMHSPLITDTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Coat protein
publication title The RNA of turnip yellow mosaic virus exhibits icosahedral order.
pubmed doi rcsb
source organism Turnip yellow mosaic virus
total genus 29
structure length 163
sequence length 163
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00983 Tymo_coat Tymovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2fz1A00
4N53C 1RUJ1 4Q4X3 2WS92 3ZFFB 4Q4X2 1VBE1 1BBT3 1VBD3 2BFUL 1OPOA 1ND3C 1BBT2 4RHV3 1VBC1 4NWWA 5DDJ2 2GSYA 1POV0 3DPRC 4PDWB 4RHV2 1RVF2 1RMU1 1B35C 5D8AB 1VBB1 3ZFEB 2WLPA 1EAH1 4QPIB 3VBUC 5C8CC 1X36A 1RUE1 4JGYA 1E57A 1V9U2 1TME3 4WM7A 5C9AB 2RS33 4RR3A 2ZTNA 5L7OC 1NCQA 4RS5C 2R041 2RS32 2HWF3 4GH4C 3VBSB 2HWD2 3IDEA 1HRV1 1HX6A 1RUD2 2HWF2 3VBFB 1AYM1 5DDJ1 2MEV3 1RVF1 4WM8B 1AL23 5ACA3 2MEV2 3VDDC 3VBOC 4Y5Z0 4Q4Y3 1HRI1 1MQTB 1F8VA 1QJX1 1PO11 4SBVA 1V9U1 3S6PA 3CJIA 4YVSC 4CDWC 5BNNB 1VRH3 4CDXC 5ABJB 1OOPA 1VRH2 2HWD1 3NAPC 1RUF3 1NA1C 4AEDA 1RUD1 5FMOS 1RUI3 2HWE2 4IV1B 1RUF2 4CDUB 1Z7S3 1OHFA 3JB4C 1RUI2 4CEWB 3VBHA 4YVWA 5JZGA 1Z7S2 5A33B 5CFCB 4CDQC 3VBRB 5AC92 1NCRC 2DF7A 2R061 4Q4W1 3ZFGC 1RB8G 5A32A 2BBVA 1QJZA 2X5IC 3JBG1 2RS11 1ND2B 1ASJ3 4JGYB 4IV3B 1RUJ3 2HWE1 1VAKA 1RUC2 4N53A 4QPGC 4RR3B 1ASJ2 1TMF2 1QJY1 1RUJ2 5C4WB 1COV1 4JGZA 1VBE3 5BNOA 2IZWA 1R1A1 5BNPC 5AC91 1ND3A 1VBC3 1VBA1 2RMU2 1VBC2 3DPRA 1BEV1 1DDLA 1VBB3 3ZFFC 1B35A 3J8F1 1EAH3 1RHI1 1RMU2 1ZBE1 1VBB2 1RUE3 4GMP1 4Z92B 1EAH2 1RUC1 1TMF1 5K0UB 2BUKA 1RUE2 4PDWC 1OOPB 2R043 4RQPB 1H8TB 3ZFEC 4AEDB 4QPIC 1HRV3 2R042 4FTSA 1AYM3 1NG0A 5DDJ3 4FTBA 3TN92 1HRV2 2RMU1 1RUG1 1RVF3 1AYM2 3VBHB 1AYN1 4YVWB 5JZGB 1GFF2 1HRI3 3VBOA 3VBSC 5CFDB 1QJX3 1PO13 1R092 1D4M1 5FMOL 1V9U3 1HRI2 3VBFC 3HAGA 1C8NA 1QJX2 1PO12 4CDWA 4N43B 4WM8C 4CDXA 2HWD3 1ZBA1 1MQTC 1RUD3 3NAPA 1NA1A 2BPA2 3TN91 5LK7B 4JGZB 2R071 5BNNC 5BNOB 1X33A 5ABJC 1K5MA 1R091 2R063 1AR92 4Q4W3 4FSJA 4IV1C 4CDUC 3ZFGA 4FTEA 1SMVA 2R062 4CEWC 4Q4W2 3JBG3 2RS13 4GB32 1VBD1 1AR61 2RM21 2RR11 5CFCC 2HWE3 3JBG2 2RS12 3VBRC 4QPGA 1QJY3 1PGL1 1COV3 4EJRA 1AR71 1PGW1 1QJY2 1COV2 1R1A3 1EV11 1ND2C 5AC93 4CEYA 1VBA3 4JGYC 5BNPA 4IV3C 1C8M1 1AR91 1R1A2 1HXS1 2HWC1 1PIV1 1VBA2 1BEV3 1QJU1 3J8F3 5C4WC 1M06G 4GB31 2PLV1 1RHI3 1ZBE3 2RS51 3JD71 1BEV2 1AR82 3J8F2 4GMP3 1RUC3 1RHI2 1ZBE2 1TMF3 4WM7B 1NCQB 4PDWA 1VB4A 4Q4Y1 4QPIA 2XBO1 2RMU3 1RUH1 5K0UC 1AYN3 1OOPC 1RUG2 4RQPC 1K5MB 1RMU3 1AYN2 1AR81 1H8TC 1QQP1 3VBSA 1D4M3 4AEDC 3VBUA 4Y4YA 5C8CA 1POV1 1D4M2 2TBVA 3CJIB 1NOVA 4YVWC 5JZGC 2HWB1 5L7OA 1ZBA3 1BMV1 5D8AC 4RS5A 5CFDC 4GH4A 3TN93 1ZBA2 2ZAHA 1FMD1 2R073 4N43C 5C9AC 1PO21 2R072 1FPN1 1MEC2 5ABJA 2Y26A 1R081 1R093 3ZXAC 4CEYB 3JB8A 3VDDA 4RFT0 2WZR1 1PVC1 4IV1A 4JGZC 4CDUA 4CEWA 4YVSA 5BNOC 5A32B 1AR63 2RM23 2RR13 5A33A 1FOD1 2VQ0A 1VBD2 5CFCA 1AL0G 1AR62 2RM22 4Q4V1 2RR12 3VBRA 4N53B 1VB2A 4GMP0 5GKAC 1AR73 4NWVA 1PGL2 1HQNA 1MEC1 5J96B 1EV13 1AR72 2WFF1 3FBMA 1PGW2 1ND2A 1C8M3 1AR93 1EV12 4IV3A 1ND3B 1HXS3 4CDQA 2HWC3 2WS91 1PIV3 1NCRA 1QJU3 1C8M2 4GB33 2PLV3 3DPRB 1TME2 1HXS2 4Q4X1 5C4WA 2HWC2 2RS53 1PIV2 3JD73 1B35B 1QJU2 2PLV2 1BBT1 3VBUB 2RS52 2X5IA 5C8CB 3JD72 1F2NA 4RHV1 5L7OB 5J98B 4RS5B 1W39A 1AL22 5ACA2 4GH4B 2BFUS 2XBO3 1RUH3 1WCDJ 4Q4Y2 1CD3G 5K0UA 2XBO2 4WM7C 1RUH2 4RR3C 1TME1 1NCQC 2FZ2A 2RS31 1QQP3 1AR83 4RQPA 3VDDB 2FZ1A 1H8TA 3VBOB 3ZFFA 2XPJA 2HWF1 1QQP2 1POV3 4YVSB 2HWB3 4CDWB 1NY72 2MEV1 5FOJB 4CDXB 1K5MC 1AL21 5ACA1 2HWB2 5D8AA 1A6CA 5CFDA 1CJDA 3NAPB 3ZFEA 3LOBA 1BMV2 1FMD3 1NA1B 2GH8A 3CJIC 1RUG3 1PO23 1FMD2 4N43A 1FPN3 4LLFA 5C9AA 2WWSA 1AUYA 1R083 1VRH1 1PO22 1FPN2 1R082 4CDQB 1RUF1 1NCRB 2WZR3 1PVC3 1RUI1 3VBFA 3ZFGB 1NY71 2WZR2 1PVC2 1Z7S1 3VBHC 2QQPA 1FOD3 4WM8A 1VBE2 2X5IB 4CEYC 4Q4V3 1FOD2 1MQTA 4BCUA 4QPGB 3M8LA 2ZZQA 4Q4V2 1MEC3 5BNNA 1IHMA 2WFF3 2WFF2 5BNPB 2WS93 1ASJ1
chains in the Genus database with same CATH superfamily
3BN6A 4ZXEA 2JDYA 4N53C 1N1YA 5A3MA 2WS92 4D3WA 2VQUA 4FQ4A 2WWJA 3M70A 2CL2A 1VBD3 1YFXA 2HYXA 2EA7A 4LBQA 4LBJA 3J9SA 3RQ0A 2DBIA 4Q5OA 4RN5A 1FV3A 2G9ZA 4KG8A 1W06A 2VBPA 4EWAA 1BK0A 3J26N 1POV0 4PDWB 1YCIA 1V00A 4OHZA 1QH7A 1B35C 1VBB1 2V4VA 1S0EA 2X09A 2XOMA 2ZGRA 3TEXA 2D6MA 4QPIB 3VBUC 4RA0A 5KXBA 2GDFA 4GJYA 1X36A 2BZDA 2QE3A 3NV2A 1GMMA 3UGHA 1N47A 4FO9A 5FZ1A 1V9U2 1TME3 4S2FA 4CUCA 1LGBA 2C1FA 4RR3A 1W3VA 2KD7A 5EYYA 1FV2A 1OA4A 1C5IA 1NCQA 1WLCA 5JXGA 3KZ4C 5L7OC 2WNUA 2XJVA 4FPGA 1O59A 1YWKA 2RS32 2VZRA 4Y4RA 3VBSB 3WNMA 4X8PA 1UMIA 4JDNA 3FZ3A 1BK1A 3WDUA 5C3SA 4TXWA 3WF3A 4DY5A 1HRV1 5AVAA 1HX6A 2HWF2 3BKZA 4YW5A 1WBFA 2B7YA 2QQWA 5JI9A 2XHNA 4LMFA 2Q8OA 1JW6A 4CCNA 5E89A 4XCAA 5LEKA 3GZAA 5ERLA 4GJZA 4ZS2A 3RZKA 1RVF1 4KU7A 4A2UA 3MLKA 4KI5M 1UOJA 2MEV2 4LR4A 1QOOA 5FYBA 4QM9A 1CAVB 1F15A 2W92A 1HRI1 3OSDA 4BA6A 2WIIB 1DGRA 1X8MA 3MW3A 1QJX1 1PO11 5SV8A 1SBEA 2J42A 3IMMA 1SLCA 2BGOA 2YDEA 4YW6A 4AQTA 3B69A 2JE9A 1C28A 2ZEZA 3CJIA 3H3ZA 5FLHA 3ROUA 5BNNB 3VUOA 1DU3D 3INAA 3LDBA 4QX2A 4W6WA 2JG9C 4TSVA 2VBBA 5ABJB 4NMIA 1OLRA 2QTWB 4M01A 2VXRA 2XDVA 3LFIA 2VNRA 2ORZA 3AX4A 3ZIWA 5FZBA 4D94A 3NAPC 4AEDA 4AVBA 1RUD1 3THPA 4M4PA 2VCMA 4AK3A 1GNHA 2B9VA 1D7PM 1RUF2 2E26A 1Z7S3 5FZKA 1RUI2 2VE1A 3KCCA 1TE1B 4L9BA 3AXDA 5FZCA 1W0NA 3DL3A 1WMEA 4BOWA 4CEWB 4YVWA 2HEVF 3AP9A 5JZGA 2DBNA 4P5YA 2PHLA 1QJFA 2RVAA 2ARXA 4QQLA 3WDWA 4A4AA 4CTEA 5CFCB 4DEQA 5FP8A 2QQIA 5BUVA 2VZPA 4CUBA 3W5MA 4FPYA 4IGPA 3EMRA 5AC92 2XVGA 3HQRA 1I3HA 3S7EA 1K3IA 2W1WA 1Y9QA 2LW8A 4Q4W1 3ZR6A 5BNQA 1KD7A 1VAVA 2C5DA 4XCBA 3CNAA 2QUOA 3BB6A 4TYSA 2BBVA 5DAXA 3NKTA 2D93A 3PTRB 5LRRA 3VZKA 2R7EB 4LJHA 3HQUA 4OMCA 1XYNA 5AVPA 2UWBA 1APNA 2Y33A 3ABZA 1KFXL 4WVMB 3W21A 3WP5A 4AEMA 1GBGA 2E6VA 4IV3B 4QPWA 4K3UA 2HWE1 1AF9A 4Y1XA 4EN9B 1JYIA 1J1LA 4QPGC 1ASJ2 1W6MA 1TMF2 2PHUA 3SH3A 4H3WA 4CP9A 4HSJA 3USUA 4ASKA 5C4WB 1EP0A 1O7FA 4P9YA 2B39A 3ENRA 1RINA 3WNOA 2EXIA 4R4XA 4IE7A 2AYHA 2PMWB 2FDHA 1L3JA 4AFAA 4CU7A 3I2IA 1YFUA 1J3PA 1AHSA 2ADEA 2PHDA 3GBGA 5BNPC 2JENA 1VBC3 1JZ4A 1NX9A 1A3KA 3VHPA 5A7WB 2RMU2 1NKGA 3M2MA 5LW9A 1N1SA 2D7FA 2V72A 2VZQA 3K4AA 1BEV1 4K40A 4LHNA 2WDBA 1U5ZA 2Y60A 4QB6A 3ZFFC 4YM0A 1QWRA 2ZGQA 4BQWA 1EAH3 1HV0A 3I2JA 4LULA 2F6BA 4HKLA 4QGMA 3RWNA 2VD7A 4GQ7A 4XTPA 2VUJA 1VBB2 2BBAA 4FOVA 1YJKA 4AFMA 2BNNA 3ZMNA 1RUC1 5DXDA 4XF4A 4B3NA 2ZGPA 3DF0A 3B02A 3QH7A 2D98A 1WMFA 2X05A 1CIYA 5KC5A 2ZJCA 4W8JA 1OOPB 2GAUA 4WZFA 3JCIA 1LR5A 3RG0A 5FP9A 4CU6A 3IDAA 4YW7A 1ENXA 1TZOA 1DYPA 3P1IA 4CCEA 5CADA 4OULA 4PBPA 3GF6A 2BEOA 5FWJA 1W8FA 3WF2A 4HVOA 1HRV2 3LPFA 2WNVA 5C33A 1RUG1 3UGGA 1PK6C 4NJ4A 4OCTA 3FUQA 3OY8B 2ZX3A 4CXYA 1GFF2 4PF1A 1SPPA 4N9HA 2E53A 3VBOA 1IQDC 4ZZ8A 4GXLA 5CFDB 2TEPA 5D2AA 1D4M1 2AR6A 4YM1A 3IWZA 1V9U3 4AW7A 1HRI2 5A6ZA 5LA0A 3HAGA 2B9UA 3AYDA 4W6YA 1QJX2 1PO12 1L7LA 4CDWA 4N43B 4JCKA 1LESA 5FZ4A 1H2NA 2A75A 1E5RA 2ZACA 3ZX7A 4CUGA 5FYCA 2V73A 5FWEA 3C8XA 4YGDA 4BQ5A 1GP6A 3WDYA 3CU7A 3PMEA 2BPA2 3RZLA 1LAJA 4O7XA 1XNAA 3GDBA 4JGZB 3FHQA 3EO6A 1RGSA 4XF1A 1HB4A 2R1BA 2D6PA 2PTMA 3E5UA 4QB1A 3SKVA 1JXNA 3IB3A 2BP6A 5IYYA 5K7PA 4JC1A 5EQUA 2YC0A 1W6PA 2VMCA 5F3GA 1K5MA 1QU0A 3TWIA 3UJQA 5C3RA 2QQJA 2B8MA 1KQRA 5LBCA 1O3TA 1CESA 4Y1ZA 2FMYA 5JOWA 2EXKA 4IV1C 3WP6A 1LGNA 4H7MA 4IEPA 1SMVA 4Q0QA 3UETA 1JZ8A 4MZUA 5HCBA 3NVCA 4FTEA 1J58A 4Q4W2 1RUOA 2MPFA 4I01A 4KH9A 3I3EA 5C5TA 2VZUA 1VP6A 3V0AA 1UU6A 2OW4A 3ZXGA 2YBPA 4YPJA 5CKNA 5FJHA 1T2XA 2P3JA 1XSRA 2G4IA 3L2YA 4EROA 5CEHA 2YHJA 4XEZA 4UBHA 2GH2A 5GLVA 3WDTA 4DXTA 2A3XA 1COV3 2YPDA 3HJRA 2N7GA 5IVJA 2QZ3A 4GALA 5G05L 3TEZA 1AR71 1DBNA 4LTAA 1PGW1 3C2UA 3DECA 4HPKB 4AEJA 4MXVA 5ISLA 3R0RA 1R1A3 3FUOA 2ENRA 4FXKB 5AC93 3AVRA 1Q43A 4XZPA 4CEYA 5FZ3A 4V2VA 2Y0IA 3AZZA 4LNVA 1LHVA 1IZ3A 5T5OA 4WBBA 4HLTA 4MGIE 1SDDB 1LOEA 1JZ5A 3G7DA 1OT5A 2CYFA 2VTXJ 1W0OA 2XXZA 1RHI3 2IUWA 1DCSA 1BEV2 5LZ6A 4GAZA 1NUKA 2WJSA 2DCTA 3DN7A 2P2KA 3MUY1 1TMF3 4AFDA 5GALA 5F3CA 3ZYJB 3OG2A 1SHWB 2ZGLA 3N9NA 3DXUA 4LE4A 4PDWA 3NWKA 3SH5A 4B29A 3OGGA 5T5PA 2O14A 1VB4A 3CKHA 4QPIA 1I5PA 3NQHA 2DTWA 3WV6A 1A34A 4N90A 2XBO1 1W03A 2A3WA 1RUH1 2QQVA 2RMU3 2XH6A 3KCYA 4QKNA 4Y24A 4EZHA 2IWGB 5K0UC 4AHWA 2ZHMA 5I93A 5JAXA 1LOBA 2ERFA 4OI1A 2JD9A 2JDUA 4FPFA 3R6SA 1RUG2 4XDOA 2XUEA 3OCPA 3V65A 1QIQA 1GLHA 1PGSA 3VBSA 2K46A 3POBA 1N3PA 1GZ9A 1QGLA 1UYXA 3IPVA 4LHSA 2UURA 1UQXA 1XRUA 2KXLA 3GGLA 3RYKA 1D4M2 2TBVA 1XE0A 1XE8A 3WQ7A 1JZ2A 4E2SA 4EN7B 5FZ0A 4NR1A 1OLQA 1O3RA 4BIFA 2OKXA 2VGDA 1Z78A 4YARA 2DFCA 3MBWA 1XU1A 1ZBA3 4AFCA 1YQ5A 3B3QE 2W47A 5CG9A 4Q8KA 1WLTA 2WN2A 2ZAHA 1CWPA 5A80A 4YGBA 1EPWA 3D4KA 4QGLA 1ZZ7A 2K9ZA 4Y1UA 1F31A 2EXJA 3I8TA 3SCHA 1KDMA 4JKLA 5ABJA 2Y26A 3RYPA 3D5OA 3DKWA 3NNJA 3OBTA 5FYUA 3JQWA 5L9RA 4DY3A 2GU9A 2ZOEB 3BGAA 2JE7A 4YG0A 4OI4A 1YJLA 3O0XA 1LOFA 4P14A 2VH9A 2WZ8A 5JIUA 1HB3A 3NNLA 5A7SA 4MX3A 4BJ0A 3A0KA 4CEWA 4CCOA 1FI2A 3ZKUA 5BNOC 1FNYA 2WO1A 3MEPA 2RM23 5FPXA 1DQ4A 5C7GA 3WG4A 4R9CA 1FOD1 1WUVA 3FFZA 4JHTA 5CFCA 2VU9A 2W2IA 3WSOA 1H4GA 2G19A 4M3CE 2OT7A 4N53B 4P9IA 3A22A 1KJLA 4QHZA 1UW8A 4XW3A 2JB4A 3BCWA 5GKAC 3FJSA 1PNFA 1AXKA 2O8OA 2OA2A 3EHKA 2CAUA 1MEC1 5JMCA 1O3SA 3AYEA 3OPTA 3POSA 2JDKA 4FOWA 1EV13 5T5JA 4BU2A 5DABA 1AR72 2WFF1 5DAVA 4IEXA 1PGW2 1W90A 3H9AA 5FZOB 1C8M3 1XNBA 2VO5A 3B00A 4IV3A 3UKNA 3HT1A 4CPBA 4U36A 2NYYA 2C9KA 3N9LA 2CNAA 3DYMA 3C3VA 4UWDA 1VLNA 4Y5SA 2PLV3 4HZFA 5C4WA 2YMZA 3NW4A 1W9SA 4OHXA 1GZWB 1B35B 1GWMA 2UWCA 2OZJA 3G6JB 2XWJB 5A3UA 4XJUA 1CGPA 3POIA 2VJXA 5F3IA 1GP4A 2SLIA 2VXJA 3H1WA 1YEWA 4NHKA 4QX8A 5GZFA 5DZEA 3VBUB 2ZHNA 3WP4A 4YZ2A 4Y26A 2BGCA 1H6XA 1LJ7A 1G9CA 2W94A 1S4CA 5FO8B 2VUDA 3H0OA 1MPXA 1OD3A 2B45X 2PXJA 3ZPYA 3MUZ1 5L7OB 4AHZA 1R64A 1AL22 4OI0A 3UKTA 2YU2A 4BIOA 3ES4A 1AZDA 2WSVA 2WQ4A 2ZEWA 2CDPA 3VHRA 1OD5A 4AVCA 2A6ZA 2YY1A 1OLME 4NIGA 2XBO2 4HFSA 4WM7C 5IK4A 1RUH2 4GWJA 1QDCA 1TME1 1PZ7A 1V6JA 3D82A 2AC1A 3HBKA 1MZ6A 4OZOA 3RGBA 1QQP3 4AGGA 3T09A 4XDQA 3MIHA 2J1SA 1UOGA 5GZDA 2VMIA 1U5YA 3USSA 1BHGA 4Y1VA 3T0AA 2X53S 1X82A 4I3PA 3WY6A 3PVBB 2IXCA 2HEYF 1A78A 1K5JA 3CIHA 4XUOA 1XYOA 2OQ6A 3D6EA 1LHOA 4URTA 2Z69A 3H7JA 5C3OA 3I3DA 1NYWA 2JG9B 2VZVA 2IFRA 1J83A 5F2SA 3ACLA 5D8AA 5KXEA 4NRPA 5CFDA 2A6XA 2IC1A 3IZOA 3NAPB 3QLQA 3ZFEA 1FMD3 5DUVA 5J3UA 3UT0A 2GH8A 1XSQA 5FPAA 4B8EA 2QQUA 3AZWA 1JUHA 3S0MA 3WF0A 3FLTA 1PHMA 1RUG3 3M3QA 4H55A 5EXOA 4N43A 1UZWA 3RDIA 2WWSA 5FYMA 1E5IA 3AVSA 4IEQA 4RYDA 1SDWA 4BWOA 1S0CA 3KF3A 3PHMA 3SMHA 1DQ5A 1DP0A 4XHXA 2NP0A 2AEZA 3C7GA 3O7OA 1PVC3 1UO9A 1ZA4A 2HJIA 2Z4FA 2OPWA 4Q27A 3RS6A 3VBFA 1XU2A 3RZJA 3AYCA 4YZ1A 3OGJA 1Z7S1 3WF1A 5FYHA 5GZGA 4A7ZA 4YM2A 3KQRA 2QQPA 2TNFA 3VD4A 1VBE2 2OYZA 3RPQA 4QKDA 3VL8A 5CBLA 1FOD2 4RSUA 2EVXA 3ZXLA 2R1DA 2BU9A 3M8LA 4QPGB 5L36A 3F2ZA 3T3YA 1L7QA 1W9FA 5HI0A 4PJYA 3ATGA 4JRLA 2QDRA 2GP3A 1DGRN 1JU4A 5IUQA 3K4DA 2VY0A 3LDKA 2JDMA 2WFF2 2YBKA 5BNPB 3GZEA 1JH5A 3APBA 1LHNA 2Q8DA 3OGRA 4X8NA 4L97A 1DIWA 4HETA 3AMNA 3ZFFB 2ID4A 1NE6A 1C1LA 1BBT3 3MV11 2MHFA 2FCUA 4FQZA 4DMIA 5B2GB 5H9SA 1ND3C 1S0GA 4XUPA 4COUA 2K2SA 2RJKA 4RHV3 3PUQA 5ANNA 1VBC1 1UMHA 2NM1A 5EFUA 4MHRA 5LY1A 4B4QA 3H8RA 5J37A 4F7ZA 3DPRC 1JHNA 2QVSB 3H3LA 1RMU1 1RXGA 1V6LA 3LGRA 4NHYA 3I4IA 3AJZA 3RZMA 5DPNA 5LY2A 1EAH1 2IVJA 4XYXA 3ZSEA 3H50A 4A3XA 4UT5A 3M3EA 3VD7A 5FO9B 4M3CB 4JGYA 4IEZA 4NOTA 5DN2A 2ZGSA 4N7UA 5FZIA 3ZXEA 4L99A 1PK6B 3GBFA 3ASIA 4ATEA 5A3NA 3HEIA 3K46A 1ULEA 1J3QA 4RS5C 1UZYA 1LHUA 4XDPA 1MS8A 1QXPA 1UZZA 1W04A 5DAWA 4E4DX 4GH4C 1N1VA 4XUNA 2Q0AA 3FHIB 3B9IA 4PF5A 5DMYA 4W50A 3P6BA 1UY2A 2OPKA 4EN8B 1O4TA 2JD4A 4DUWA 5CNAA 4XQWA 4J6GA 1AL23 1IS3A 2YFZA 3E5XA 3SKJE 3VDDC 2YGMA 5H9QA 3POYA 3T1LA 3QBQA 1WMDA 2AENA 5DZFA 2EAAA 4GWNA 3PTYA 4IEYA 4CU8A 5F9TA 5HV4A 3ACGA 4FXGB 1V9U1 2WA4A 3AJYA 2RV9A 3S6PA 3RSJA 4AVTA 4YW1A 2UWAA 5FYVA 5K8SA 2XJTA 3KLSA 4AHYA 2ZXQA 4LK6A 2AH2A 2WO3A 3TYJA 3FMGA 1CPNA 4NIDA 4MGSA 5IFTA 1NA1C 4AVAA 5FMOS 3BPSA 2ZX4A 4PIYA 2ZPXA 4PBOA 5EJ3A 3A23A 4LOSA 2A1XA 2WRAA 4A42A 4CCCA 2DTYA 4IV1B 3DYPA 2B4KA 3S5AA 1H9PA 2A71A 3I59B 3L9JT 1LGCA 1V6IA 1W8WA 1Z7S2 4GIQA 3KM5A 4K7JA 3CEWA 3IAPA 1MACA 3P3NA 4UFIA 4CDQC 3U75A 2FDJA 1R1ZA 1NCRC 5FXZA 1A8DA 2Q30A 2P4EA 4FPCA 4Q1PA 4FPHA 4CXWA 4MO3M 2ZCWA 4G3YC 4X6RB 1W2OA 3WHTA 3OYWB 4COZA 2BVVA 1YHFA 4P02B 5EV7A 2I74A 4N53A 2R0HA 3AZYA 3SISA 2ADDA 1COV1 1CAWA 1AX1A 1VBE3 4LHKA 3KV5A 3VV1A 2Y38A 4IDZA 4Q8LA 1R1A1 5AC91 1H2MA 5CU1A 3WQ0A 3C7EA 4CCDA 3ACHA 4MHUA 4XILA 2PELA 2Q4SA 1VBC2 5E16A 5FBJA 3WW3A 2VUCA 4XOGA 2BJSA 3NJXA 1DDLA 1CAXB 1LRHA 2VR4A 1AX2A 1B35A 3SQOA 3V0BB 4D7TA 5LATA 1K45A 2VOTA 1RHI1 3GALA 1RMU2 2VG9A 3NL1A 3O1UA 1OQEA 3FBYA 1RUE3 3ZSKA 3ZVXA 1EAH2 1WLDA 2Y6GA 5FZ9A 2ZGTA 2OVUA 4PIXA 3B01A 1TMF1 4AQ6A 2BUKA 5K0UB 5JSPA 2ZKLA 1RXFA 2VZOA 4COYA 1UX7A 3H8OA 2A7AA 2J7MA 4JDMA 4QXCA 5KR7A 3KCXA 1ENSA 1ULPA 1UXZA 1ZM1A 2XQRA 1GWKA 3MICA 1CAUB 4H14A 4KQ7A 4NAMA 5I0TA 5LWBA 3O1OA 4FTSA 2D6OX 3WF4A 3TN92 5FMDA 2RMU1 3MGUA 3NMBA 3VBHB 1ENQA 2BOIA 4MLOA 3MFAA 4NPMA 5I0RA 1KXGA 2Q1ZB 5JSRA 2VTXA 2AACA 3PURA 2E32A 1XJAA 4RFRB 4ZONA 3W20A 1XNKA 3HPNA 3WW4A 5IVVA 3ZSLA 1IOAA 5FMOL 1WCQA 3EYPA 1ZVFA 1WCKA 2ZAAA 1CJPA 2Y6LA 3HQXA 2PAKA 4HT1T 1LHWA 4XFBA 3O1TA 2WT0A 3I2FA 2YC2A 4LT5A 4WM8C 1XQNA 4IE6A 3A4UA 2VCCA 3IM0A 2JG9A 4INDA 2P6HA 1GYKA 2W52A 1JOPA 4FFIA 1KDKA 2Q5TA 2VM9A 1ZBA1 3PJYA 4LORA 1MQTC 3WCSA 5I8TA 3NAPA 2VOVA 4XIKA 2J22A 2NQYA 1UNBA 1XNTA 2ZA9A 2PA7A 5FZLA 3RVHA 4MV2A 1CX4A 4QX1A 3AP6A 5FP4A 3ES1A 3ZR5A 5KHIA 1SG3A 5HXVA 2W1UA 2WBKA 1X33A 5F6KA 1DYOA 5BNOB 4JDOA 1JMUB 3AXEA 1ZZCA 4IETA 5FCCA 5FY9A 1GZCA 5IWFA 1LOAA 2BGPA 3WR0A 1CX1A 1YQ6A 4XBNA 4UW5A 1AR92 4DUXA 2OZ6A 1SFPA 3AMHA 4HBNA 4A6SA 3JBG3 3NNGA 2RS13 4UI9L 5EWSA 2RM21 3D3AA 2RJ2A 5H9PA 3VHNA 1BVVA 5FAXA 1HW5A 2DVBA 5IHRA 4ISRA 1AX0A 1UOBA 3OGVA 5IVEA 3ZYHA 1OH4A 4PI2A 4GKXA 4QPGA 4XBLA 5I91A 3GJBA 1QJY3 1BLZA 3AZXA 2P3YA 2QQMA 2V09A 2W95A 4I0WB 4OUSA 4EJRA 3VKNA 1ULGA 1S0FA 2C6SA 2ZEXA 4LBQD 1G8WA 2EAKA 2XJUA 3GHNA 3HMYA 3TBDA 3UNPA 1EUUA 3ILFA 1COV2 1EV11 4IEUA 4MGQA 3FL7A 3MW2A 1O6UA 2PQQA 4LKSA 5BNPA 3S30A 1C8M1 2VW0A 1R1A2 4CE8A 1PVXA 5IT6A 1X50A 5IJRA 3LSEA 3J8F3 3C7HA 4QHBA 1M06G 2ET7A 2XGXA 2PLV1 1UIJA 1ZBE3 3ITQA 1PMJX 1WLWA 1AR82 4GMP3 5HPOA 1DGWX 4DIQA 3MW4A 1GU3A 1RHI2 3WG3A 2YFUA 1XPWA 4G4FA 5GZCA 1ZRFA 2C24A 2OX0A 3WNNA 3KV4A 1YQCA 2UU8A 4WM7B 1BQPA 2XVKA 3PVEA 4P00B 1F35A 3MIFA 2AREA 4P5HA 5FP7A 5LA1A 5EHDA 4K8RB 4PQQA 1WKYA 4GWMA 1SLTA 4UFLA 5DG2A 3OB8A 3JXSA 3SXWA 1W8ZA 4DRRA 1ZZBA 3MPPG 4XJ8A 3RMYA 1S0JA 1AXYA 4Q4Y1 2Z42A 2OUJA 5FBZA 4QM8A 4LOTA 1H1AA 1SLAA 2CGNA 2W9XA 2YROA 2XG3A 3D0SA 3E97A 4M3CA 4MADA 1CN1A 3PJQA 3W58A 4ES9A 3IKWA 1XC6A 1YI7A 1G6NA 4AVSA 1AYN3 4NRQA 3KS7A 3IBMA 2WLQA 3N35A 1PK6A 1S0DA 4RQPC 1RMU3 2ZABA 4JTNA 3VN4A 5FK7A 2Z79A 1QQP1 1H8TC 4IE5A 5F7UA 3H1YA 2EALA 3HVDA 4AEDC 1XXNA 4BQ4A 3O1VA 1PM7A 4K1YA 3CDZB 4Y4YA 5C8CA 1AJOA 5H9RA 1MR5A 1RUNA 4L2NA 1BVP1 2DURA 1NOVA 2JG8C 4YVWC 5JZGC 4R4ZA 1MVEA 4LKFA 4PT6A 5F1RA 4XZUG 4DUVA 3MI8A 3N3HA 1HDKA 1ZA7A 4A6OA 2ZBJA 1QOTA 3VL9A 2ZGOA 1BZWA 3TN93 4NHMA 3JUUA 1ZBA2 1LCLA 1FMD1 3BTZA 2R073 1Q8PA 1DFQA 5K4LA 1V6OA 4C0HA 1S2EA 1NQJA 4EWEA 2CGPA 2UY9A 2VVDA 1FYUA 4TLFA 4IE0A 5FZFA 1PZ8A 4BQ2A 1VJ2A 2ZKNA 3JB8A 2WSUA 5F3EA 3KGZA 4RFT0 5FZHA 3AL6A 3ZMOA 4DXRA 4XC9A 5FMCA 2BV4A 2ATFA 1PVC1 4IV1A 5EZWA 2YPJA 4NPRA 2PYTA 4YVSA 3DCQA 4BK5A 2P37A 2RR13 2GALA 2ZS6B 2YYOA 5E6HA 2WYFA 2JICA 2GMPA 4LA3A 2RM22 4Y1YA 1W2AX 2OQ7A 2VCAA 4TN7A 1SBFA 3MIEA 3W59A 3ZN6B 1YIPA 3A0NA 3DYOA 3BI3A 3FLPA 3MIGA 3WOGA 4HVRA 1ODMA 3AKPA 1W8HA 3FC0A 1WMXA 1HQNA 4MH0E 4QQPA 4A41A 1MS4A 3OYWA 3LF7A 2RDRA 2WC2A 5A3WA 2B5HA 1QEXA 3MLJA 1GR3A 2VCBA 5LRSA 1F4HA 4XTMA 1AR93 1C3HA 1EV12 1KFUL 1ND3B 1PX3A 2I07B 2J1TA 2V5DA 2VULA 2XJPA 3PVNA 2HWC3 1ZRCA 2D3RA 1EUTA 3LFMA 1QJU3 1C8M2 4D0QA 4Z2AA 5BYNA 3PL0A 3DPRB 1KS4A 1QDOA 1US3A 3WD5A 2WUHA 4CRQA 2RS53 3JD73 3GYDA 1OVPA 4OHWA 1REEA 3DXTA 4CA9A 3GJAA 2PLV2 5F5IA 1BBT1 3WXPA 4E2QA 4IUGA 2X5IA 5GLTA 3SLIA 1F2NA 5LBBA 3SNMA 4D6SA 2WNVC 2W39A 3OD0A 4XFGA 2I45A 4DB5A 5JUVA 4BQ1A 4AHXA 2BNMA 4RHV1 4WVWA 4CXXA 1JZ3A 4NHLA 2XMLA 3V56A 2GP5A 1E5SA 4AAPA 4B1LA 1LOGA 4L11A 1CAXA 5J98B 4RS5B 5EPAA 1LNSA 2CGOA 1W39A 2ZHKA 1H8VA 4YZ4A 4GH4B 5IVBA 2Q1FA 3U4SA 3NJVA 1S1AA 4N9IA 2R6QA 1S0BA 1WCDJ 4Q4Y2 5T50A 3I3QA 1CD3G 5FRAA 1X7NA 2CAVA 5K0UA 1NT0A 1VR3A 3VZMA 3IT8A 4PCRA 5DG1A 3T2QA 2FZ2A 1AR83 3VDDB 1YUDA 4D69A 3S57A 1NQDA 5AFBA 3ECQA 2YC4A 1QQP2 2GNBA 3FHAA 1RL3A 1CAUA 2KR2A 4BB3A 2VECA 3MFCA 2F17A 2XLFA 1LEDA 5FKCA 4D7SA 1LODA 1O5LA 4FFHA 1IPSA 4N8MA 1KITA 2HWB3 5FY4A 1MVQA 1NY72 4SLIA 4L0PA 1K5MC 1AL21 3U14A 4E4ZA 2Y64A 3PUSA 4QDRA 5KHJA 5EP9A 1UX6A 3AFGA 3Q8BA 3BOWA 1NA1B 2ZGMA 3HNYM 3R4DB 2O1QA 3OF1A 4R52A 5FZ7A 1PO23 1FMD2 4BXSV 1UYZA 2D6NA 5JOYA 1FPN3 1ZRIA 4LLFA 3WT3A 3U0ZA 1R083 2W87A 4O9GA 4V1PA 3TAYA 2LUWA 3KV6A 2IFWA 4H7LA 3ILRA 4LIVA 4NRMA 5KHGA 5FK8A 1RTVA 4CDQB 4UF0B 2RDQA 4NPLA 4DXSA 4KWJA 4CP1A 1NCRB 4EZ4A 3ZSJA 3EBRA 3O14A 4HG6B 2DVFA 2G9FA 4I09A 4KL1A 1OFSA 3CZJA 3NJYA 4AQSA 4CCLA 1N1TA 1PVC2 3VBHC 5EJ1B 4QT6A 1DYKA 4CEYC 4DOUA 1NXD1 3FE5A 1W0PA 4XFCA 3UV9A 3LB9A 1Y4WA 4YZ3A 1CAVA 1DQ6A 1HIXA 2XLGA 3OUIA 4LO8A 4LE3A 4COVA 5FLIA 4JVAA 4YM3A 4NIHA 2OS2A 1D0GA 4Q0SA 5BNNA 1IHMA 2VW2A 4KGGA 4XE9A 2WL1A 2XQXA 2VL4A 4UBGA 4BDVB 3NV1A 4URAA 2FMDA 1WCUA 3ZDVA 2L9LA 3DGTA 1U12A 4JAAA 3HN1A 4IESA 4Q4X3 1G9AA 3X29B 3GCXA 2IXLA 4J1WA 1VBE1 1MS1A 1ONAA 1W05A 5JIAA 3O1RA 3BTYA 3U10A 2J1RA 2QFEA 5F5CA 1JODA 5JWPA 1D2QA 1OMIA 1OPOA 5FR3A 5J1XA 1BBT2 1OC1A 3O1PA 2RHPA 1NZIA 4S2GA 3ELNA 5DDJ2 1EYBA 5APAA 4C1WA 5FQ0B 4RHV2 5K9YA 1GZTA 2E31A 1W2NA 1IS6A 2WKKA 2QKDA 3N36A 4RGKA 4C91A 2WLPA 3WQ1A 4EYUA 3DUIA 4OQ9A 1I9RA 3T1MA 4MSVA 4WVMA 1RUE1 3TEWA 3LDRA 4K21A 5GLUA 1QF3A 2ZZJA 3BVCA 4WM7A 1AXZA 3CBNA 1QH6A 5C9AB 2PHRA 3HNMA 1X9PA 4HXCA 1T6GC 2A6WA 3CHXA 4XJWA 4Y22B 1YQ2A 3PNAA 3SHRA 3WDXA 3ZXJA 3AKRA 4O65A 1QNYA 5E1RA 5IAVA 2HWD2 1TNFA 4XPVA 4LKDA 2P1BA 1GP5A 4LBOA 3VDCA 5A7WA 3C7FA 2EF6A 4M0HA 4LO4B 3AKSA 4WM8B 3ZYBA 4BPZA 5A1AA 1UYPA 4Y20B 4Q4Y3 3POJA 4FPEA 4QQHA 1MQTB 3DKQA 3KGLA 4LUMA 1Q56A 4FOYA 1OA2A 3TOJA 1HJFA 2EXHA 1Y7BA 4SBVA 4I2OA 1JHJA 1GQPA 3ZN4A 1VRH3 5D21A 1WCSA 3VB9A 4FAHA 4CDXC 4PQ9A 3U4XA 3S7IA 1OOPA 5EYXA 2WZPP 3Q8EA 4FI9A 4E8DA 5FY8A 3IIIA 4XJZA 4QU2A 1AJKA 2D5HA 3QD6A 1F5FA 2BVBA 4L8QA 4C90A 3IIAA 3LEGA 1V6KA 2W0XA 5FYTA 4XFFA 3VKOA 4K8FA 4DQAA 1URXA 3JB4C 4EWDA 4AYUA 4UXAA 4YW2A 3FWEA 4CU9A 1HQLA 2ZMNA 3OY8A 2W1SA 5LA2A 2B46X 4CP0A 2UY8A 1JZ7A 3B9CA 1ALYA 4XAAA 3ZYIB 2DF7A 1OI6A 2ORXA 2AGSA 3ZFGC 5IK5A 2FHRA 3T2OA 1TQ5A 4QHOA 2UYBA 5FDBA 1CR7A 2W1QA 3BTAA 3KVAA 3LA3A 1QJZA 1GICA 2BYVE 2E51A 2RS11 3JBG1 3WCRA 3CLPA 4UFHA 3ZXDA 4CPBD 5IVCA 1JS9A 3WG1A 4AVVA 3I3MA 4HL0A 1RUJ3 5IAXA 4MVTA 3H8UA 1WW5A 4RR3B 1VAMA 4KU8A 4A7YA 1RJ7A 1UD1A 1UPIA 1D0HA 1H9WA 1QJY1 1OXCA 2VVFA 2XKOA 3OPZA 4JGZA 4Q29A 4XF9A 4B1MA 5A6QA 3N9OA 4P9JA 1REDA 2IZWA 2VMEA 2B42B 3FX3A 1ULFA 3KB5A 4Z07A 4Z2WA 3ZYPA 3J7HA 5FPZA 4DO0A 2C26A 3BUCA 4YW4A 1ND3A 3CJXA 4HVQA 1OUSA 2XJRA 4J1XA 4BH9A 1ULDA 4D6QA 1QXRA 1FAYA 3T0DA 1WZXA 3DPRA 2WZEA 1W6OB 5FY1A 1EY2A 3J8F1 1I6XA 4BYYA 2Y6JA 3V64A 1ZBE1 5CISA 2Y6FA 3AP4A 4FBFA 4GMP1 3SITA 1DG6A 1SFYA 1TNRA 2RDSA 5I0UA 2ZEYA 2XHKA 4NO4A 1RUE2 3K3OA 2XL7A 4FFGA 5EJZB 2R043 4RQPB 3P3PA 4FP2A 4E27A 1H8TB 1NE4A 1WW4A 1YIFA 2JDHA 2IVIB 5FZMA 3ZFEC 4HPKA 4GA9A 4AEDB 1OF3A 1AYM3 2EIEA 5DDJ3 5LB6A 5T54A 5FP3A 4AQ2A 3QCWA 4BLJA 4TZDA 3AYAA 3RFRA 1UCXA 4AE2A 2D43A 2BRTA 2QCSB 3JQXA 4MOAA 2JG8B 1AYN1 4YVWB 3HOBA 5IVYA 3SEPA 5JZGB 2WQ8A 3TRSB 1JUIA 5CKMA 5FYYA 5T3NA 3OJBA 4YW3A 3VHOA 1DLLA 1ZZ8A 1LU1A 2YBSA 3LA7A 2Y0OA 4E4SA 4LLOA 2X29A 1PMIA 4WVVA 1KGYA 1R092 1U0AA 4IQPA 5LBFA 1O8PA 2WN3A 4I30A 2H0VA 3VBFC 3LAGA 3T2PA 3ZSMA 4TTGA 3HIFA 2OIIA 3HBZA 1FXZA 4GKYA 2MNGA 2A6VA 4PLMA 4XF3A 5A7PA 2YUEA 5FYSA 4JV4A 2W3JA 5FY5A 3VZNA 2HWD3 3VDBA 1UY3A 3U11A 4HOOA 4KBZA 1NA1A 3AL5A 2AUYA 4ZU7A 1W6MB 4LPLA 4NIAA 3TN91 4COWA 5C8WA 1U5IA 3USUB 4A45A 4ASLA 3IMNA 5LK7B 1PZ9A 2JDPA 3LPGA 5KBFA 2R071 4XETA 1H6YA 1HQWA 3ZLIA 3ZXFA 1CPMA 3OEBA 2E9QA 4KG0A 5CA6A 4ZHNA 3AP5A 3WLUA 2XONA 3NSTA 1OKQA 2ZGUA 4XVHA 3WX5A 3K75B 1FX5A 4UF0A 5KHKA 2XVLA 3T08A 2R063 1REFA 3VZJA 2WINB 2DYCA 1DHKB 4FSJA 3OBAA 3UK9A 4CDUC 5M0TA 3THCA 2CTVA 2Y34A 3POWA 3GBWA 1WD4A 4GB32 1K42A 5JDBA 5FO7B 3AB0A 4KMQA 1MS9A 2VTFA 2YU1A 3WDVA 1UU5A 4O9EA 2RR11 5IVFA 3MDPA 3JBG2 4UAPA 2RS12 3SCGA 3VBRC 2ZX0A 1CIWA 1J59A 2J1VA 1JI6A 3VGIA 1HV1A 5L19A 2E63A 4ZPIA 3AMMA 2CV6A 3SH4A 1UU4A 3IDBB 4B7KA 4EE2A 4R9DA 2VOXA 4LKEA 3CZUA 3URFA 2E7TA 4B7EA 1QJY2 3WZ1A 2YGLA 1WA4A 2DFBA 1KJRA 1ND2C 5FXWA 4AF9A 4RL7A 1VBA3 1NLRA 2A5ZA 3H3UA 4JGYC 3TB0A 2WNVB 1AR91 3RZHA 2ZX2A 2LRPA 1UMZA 2GNDA 2HWC1 2QQNA 3W5NA 4Q1RA 5FZDA 1T6BX 5KHHA 1QJU1 1W8OA 3BYWA 4LBLA 4QXKA 4P9WA 3B5LB 4BISA 2RS51 4KNCA 3JD71 4OI2A 1Z0HA 4XIOA 3J8F2 3AZVA 4I0BA 4AEKA 5FYZA 5KXDA 3T2TA 1UXXX 2QNKA 1ZBE2 4LQRA 4OVEA 3I7DA 3Q9OA 1RITA 3O0VA 5FZ8A 4XQ4A 3GCWA 3WNXA 1SACA 2JDZA 4Z1VA 3T30A 1FATA 4FPOB 2HKXA 4B4RA 4UFMA 4OMDA 1PM4A 1WW7A 5CAZA 1DQ1A 5KWRA 4K20A 3HR9A 2HYKA 5FZOA 5A3TA 5A3LA 1OBNA 1Q3EA 3ACIA 4XABA 1YFWA 5DAPA 2D6KA 4MGKE 1K5MB 4ISQA 5FOBB 1C1FA 1AYN2 1AR81 1GZWA 2NZ9A 4WVZA 5C6CA 3RZGA 4R9BA 3H42B 2FDKA 4AI8A 2FQPA 4QX5A 4ASMB 3UESA 4Y3OA 3VBUA 1JN2P 1GUIA 3UGFA 1OUXA 3POFA 2V5YA 3I3BA 5IK8A 5JR2A 2WWUA 3RNSA 2CHHA 2HWB1 4BLIA 3V0AB 1HN0A 1GOFA 5L7OA 4CVUA 1JOBA 1H2LA 2JE8A 2XB6C 4LBNA 3MPBA 1CZVA 3L2HA 5IFPA 2VOKA 2XKPA 4MXWB 2PN5A 1KS5A 4QU1A 5C9AC 5IATA 3AKQA 1PO21 5F32A 2R072 1FPN1 1OFNA 1GNZA 1Y43B 3N7LA 1R081 1R093 2P34A 4CEYB 2ES3A 3Q8CA 1W6QB 4XURA 5L73A 3WUDA 4NE9A 1YYNA 3ZO0B 3LWCA 2FBEA 1OPMA 2D44A 3M3OA 4LO7A 1YI9A 2ETEA 2GN7A 1H1IA 4JZRA 4BZ4A 4LHLA 5A32B 1AR63 3WW1A 1HB2A 2ZMLA 3PUIA 4XQDA 3T4HB 1B09A 4A44A 1Y9MA 2VQ0A 1O5UA 1AL0G 5EIYB 1JYNA 2HEWF 1SLBA 2ET1A 1OQDA 4C1XA 2RR12 4HANA 1VB2A 2NPIA 4PIZA 4W65A 3RYRA 1YFYA 2G1MA 4GMP0 3E6BA 5CYYA 4NWVA 3NNMA 4MGYE 4M3CF 4XUQA 2WA3A 2WAAA 3D0JA 4JX0A 4M4RA 5L9VA 3FBMA 1P8JA 2BNOA 1Q8QA 2PHTA 5CIRA 4AXOA 3AK0A 4ATFA 1JBCA 1L7RA 5FUPA 1HXS3 3AFKA 1TEIA 5E8AA 1PIV3 1PX4A 1UYYA 3I97A 1IG3A 2Q8EA 4AI1A 4BE3A 4GB33 4Q4X1 2RG4A 2HWC2 5ANQA 2DVGA 1QJU2 2CWSA 3IPVB 4JQRA 2RS52 3JD72 4YGEA 4QGNA 3GXUA 3ILNA 3PUAA 4QB2A 4F83A 5JXHA 2VW1A 1I5ZA 4IXLA 4UOJA 3KHBA 4BXFA 1W9WA 1W6OA 4K9SA 3RMXA 5HCHA 2E7AA 3I2GA 2Q1MA 3O0WA 3OTFA 1CQ9A 3I54A 1N3QA 1J3RA 2X8KA 4I0AA 2BFUS 3PU3A 5T5LA 5ACA2 2PHFA 2VOWA 3NNFA 2VZ1A 3ETPA 3BTXA 1LEMA 3N9QA 5IW0A 4AGVA 4F8AA 4PHZA 3WG2A 4RR3C 1NCQC 4IGOA 3TEYA 4YFWA 2WNUC 1JOJA 3CQOA 1Q8VA 4RQPA 3SCFA 1XNDA 4BMEA 1N3OA 1H8TA 3ZFFA 3U07A 1UKGA 2O0OA 3I49A 1POV3 5J7MA 3NV3A 5T52A 3ALQA 4S2DA 1SCRA 5FTTC 3QOPA 1RJ8A 2P3KA 3Q8AA 2R0FA 1TVGA 5BY5A 2FDFA 2JG8A 1NXMA 4CDXB 1F9KA 2WYSA 1W8TA 1XNCA 5GZEA 2YG0A 2HWB2 4HN0A 2XWBB 4FAGA 4FVVA 5GJ6A 1O3QA 5GM0A 3KSCA 2HBTA 3LOBA 4S2HA 3U37A 4QPYA 4QAWA 4AGRA 4HK8A 1JZ6A 3IAQA 3WNLA 4XJAA 5FY0A 3AMPA 5FPUA 3N7MA 3CJIC 4DNYA 1S55A 1O91A 2QQOA 3K77A 4NAOA 1ZZ9A 2D5FA 1VRH1 1HJGA 3ZYRA 5JPNB 1RC6A 2H6BA 5DAQA 4ZXKA 1PO22 5A7OA 3RJ2X 4YWAA 1FPN2 3RRDA 1R082 2P17A 3ACFA 2Y6HA 4JQTA 3MLLA 2FCTA 5CB7A 2WZR3 3E1F1 3J7NA 5F8PA 2H0BA 5HCAA 4CCJA 1GKBA 2PAEA 5A3OA 4G9SB 4OFGA 3ZFGB 1NY71 4ARXA 1ODNA 3M3IA 1NAEA 1NLSA 3ZYGA 2YZ4A 4JTOA 3LKJA 2P5BA 4GD4A 2W68A 1W9YA 1XYPA 1VMFA 3M7AA 4LIUA 4LXLA 5FIXA 4YSFA 1A8MA 4LBMA 4Q4V3 4LBKA 2ZGNA 1OVSA 3OOXA 3WINE 1E5HA 1BXHA 1GWLA 1ZRRA 2DWRA 2ZZQA 3HD8B 1ZX5A 4YYOA 1J1TA 1O8SA 4BK4A 4P9XA 1UZ0A 4YZ5A 2D3PA 1VALA 5TSWA 2J1AA 2JKXA 2ZX1A 3DEMA 4FPJA 2CU5A 3MHZA 3EB7A 3KF5A 2WS93 2QBXA 3N9MA 4XFAA 5A7QA 3H1MA 2DV9A 1RUJ1 2ZMKA 4YLZA 3UKVA 1UIKA 1OLMA 4K6BA 2CDOA 2A73B 3KV9A 3T0BA 1VMJA 3PIGA 4Q4X2 1ZYBA 2PFWA 2J1EA 3I59A 2BFUL 4PI0A 3WEZA 5I8YA 2FD8A 1W2TA 5A3PA 2JIJA 2A3YA 3I2HA 4M0NA 4AR2A 2VBDA 3J7LA 4NWWA 4XXAA 5JR7B 2GSYA 5F37A 2LALA 3DV8A 4E4HA 2YB7A 4DINB 5C5UA 1RVF2 2Z5WA 5D8AB 5LEJA 2WAOA 1UN1A 2ARCA 2XL9A 5FZ6A 4FP3A 4LO6B 4ZY9A 3KQ4B 4RGAA 5FREA 1ULCA 4Q2FA 4H2AA 3WNKA 5C8CC 4O61A 1C5HA 1C4RA 4KWLA 3K51A 3GNEA 3K48A 1Y9GA 1E57A 2JB8A 4Q26A 3LOIA 2J1UA 2DCJA 1UPSA 2RS33 3ZPOA 4HK9A 2ZTNA 4LUKA 3SC7X 3EJKA 1ZRDA 2BTVC 4XFIA 4J25A 2R041 2ARAA 3O1MA 2HWF3 2EIDA 3JZVA 2ARBA 5F6LB 5LASA 3POEA 2FDIA 5GLWA 1DQ2A 2GC1A 1YC61 3IDEA 4AI0A 3AC0A 5JPMB 4F3JA 1RUD2 2QDNA 2C9AA 3HN3A 1AYM1 3VBFB 5DDJ1 3LEIA 2DVAA 2MEV3 2ILMA 1H1MA 1BKZA 2X10A 4Y5TA 1HN1A 2NMNA 3N9PA 5FXVA 3NKGA 5ACA3 1ZNPA 4X6QB 3OEAA 2QQLA 3VBOC 4NROA 4Y5Z0 3SEEA 3V0BA 3MV01 2HBUA 2WFPA 4CCMA 2XJQA 2XJSA 4NVPA 4FPLA 4QWNA 3LA2A 1F8VA 3NO8A 2A6YA 3R4SA 2P3IA 5F2WA 1SCSA 5CG8A 2W91A 4YVSC 4CDWC 1DLCA 2VAUA 5T55A 4C0BA 1W99A 4WZCA 5AFEA 3BU7A 1G86A 5I0DA 2JX9A 1BYHA 1OA3A 3AM2A 4QX3A 1VRH2 2DVDA 3AMQA 4LEJA 5J36A 4JKMA 2HWD1 2OXBA 4A7KA 3NV4A 1RUF3 3MIDA 3N7KA 4IE4A 5BV6A 3BU0A 2ZHLA 4D8MA 1RUI3 3E6CC 2HWE2 3Q8FA 4MXWA 3TNPB 4CCKA 1JTZX 4CDUB 1W28A 1J84A 1OHFA 4MUVA 3H7YA 5CZKA 4XMIA 1VPHA 3VBHA 5KC6A 5DQ0A 4QXHA 5A33B 3PLQA 1GOHA 1W6QA 4UFKA 1W9TA 5A7NA 4AOCA 2D6LX 3VBRB 1Y3TA 3OGSA 5F5QA 1QNWA 2R061 1OURA 1GSLA 1H4HA 4JKKA 4I3GA 1RB8G 3KVBA 1Q5OA 5A32A 5JOXA 2JEMA 2GC2A 4IW3A 2X5IC 1JYVA 2D97A 3E6DA 3O12A 1ND2B 3LIGA 1ASJ3 3POGA 4JGYB 3KMHA 4BMBA 1W6NB 1VAKA 1VRBA 1WW6A 2PAMA 1RUC2 4LK7A 2LTNA 1ZREA 2UYAA 1RUJ2 4XACA 2V4AA 3S5QA 2JXAA 1X9TA 4YFZA 5BNOA 2R30A 3LE0A 2XUMA 1IQAA 4AWDA 1VBA1 5I8SA 2G9GA 4PLOA 2AEYA 3CO2A 3GZUC 1CZSA 2F4LA 1VBB3 2EIBA 1XB9A 2OUHA 4D6RA 1D2SA 4QDSA 1F4AA 2WO2A 1O4ZA 1NLQA 1S2KA 2WABA 3IDCB 3VLBB 4AFBA 3FN9A 5B4NA 4Z92B 3N4MA 4NHXA 1PNGA 5FV3A 4Z82A 1WA6X 2PQSA 4QDQA 3ZKYA 2DDUA 2LROA 4PDWC 1MZFA 3EXUA 5KXCA 3UYJA 2WNEA 3NRUA 5FKBA 3UJOA 4D7YA 3M3CA 2GC0A 4QPIC 1HRV3 2R042 1H30A 2SBAA 3VZLA 1NG0A 1IKPA 4GWIA 4FTBA 1GNYA 3OUHA 1LTEA 4QX7A 5DUUA 1DGLA 5G04L 2VQAA 2K0GA 1OSGA 3CF6E 4FT8A 1DZRA 1RVF3 1AYM2 2BOJA 5C3QA 3ZOIA 5LA9A 4A3ZA 2RE9A 5D1IA 4DRVA 3KT4A 1YXWA 2BWCA 3LIHA 1HRI3 4WV8A 3VBSC 3ZDSA 3KD4A 3GZTB 2DU0A 1QJX3 1PO13 3QH6A 1G7YA 2VUAA 4HN1A 5JLVA 3ORJA 3LQCA 4AAXA 3ZIXA 1C8NA 2LS6A 2WR9A 3BOPA 4JRAA 3R4UA 1GQHA 2QZ2A 2CSGA 1HKDA 1UY4A 3M4FA 4CDXA 4UW6A 4FFFA 5FFOC 1UKRA 2GC3A 5J48A 2BW8A 4YNIA 1QHDA 1UF2C 3U1XA 1IPJA 1DZQA 2VC9A 1RUD3 3F95A 3MO4A 5SV5A 5A70A 3QACA 4IEVA 5JVVA 5FZAA 2EICA 4NIIA 1GV9A 4Q0UA 4DS0A 1CAWB 5BNNC 2IXKA 3C7OA 3I2DA 1SLIA 5ABJC 4HKOA 3VD5A 2VMHA 4PLNA 2JWPA 4DZGA 1R091 3T4VA 3WHUA 1ACCA 3BODA 1LU2A 5L9BA 4Q0PA 1S0IA 2HLEA 5F5AA 5FMBA 1MS3A 4Q4W3 4XUTA 4ARYA 1WWYA 1LOFC 1I1EA 1V6MA 1JYTA 3ZFGA 1IS5A 3GM8A 2R062 4OHVA 3LCPA 1KEXA 3PUHA 5FYIA 4CEWC 1SBDA 5HCFA 1VBD1 3MF6A 1AR61 2I2SA 1YLLA 3HT2A 3JU9A 3LEMA 4P9LA 5CFCC 5FPVA 2HWE3 5LBEA 1OF4A 4GZ9A 3I2KA 5JXIA 3E5QA 1W8NA 3HNBM 1PGL1 2VMGA 4ZKTB 4HSLA 2GMEA 3WP3A 4CYDA 3VZOA 1POQA 1LECA 4OUMA 1IGOA 1YO8A 4LBQB 3LZZA 2IXJA 1FT9A 1BCXA 2O8QA 3MIBA 4IERA 5LK5A 2PHWA 3FFQA 1MS5A 3LD8A 3PIJA 4IV3C 3ZM8A 5CKQA 1V6NA 4MG2A 1KRIA 4AI3A 1HXS1 1OQ1A 4DXZA 1PIV1 1VBA2 1VMHA 1BEV3 4DFSA 1UOFA 1XE7A 5C4WC 3R05A 4GB31 4K1ZA 1CONA 1XBFA 1BJQA 4B4PA 3MYXA 1UL9A 3TNQA 3WUCA 1HB1A 2JJ6A 4OHYA 2R49A 4RGGA 2BQPA 1RUC3 1MS0A 1G9BA 3CMGA 4R8HA 3RWKX 3OD4A 1QY4A 4I02A 4P08A 4KWUA 3ZN6A 1YRZA 1UAIA 5C71A 3M1HA 2BDRA 5A1LA 2IXHA 2WT1A 4CP2A 3PDQA 1NCQB 3ETQA 5C3PA 3KT1A 2WNUB 2DUOA 2JIGA 2VVEA 1ULOA 4EV0A 4CSWA 3ZXKA 1JU3A 4Y33A 1DQ0A 3OBZA 1VE0A 3WW2A 2VZ3A 2VQTA 2VZTA 1SQ4A 4XJ9A 2VNVA 2WT2A 4ZZ5A 1V70A 4NUBA 1YQ8A 1IG0A 1OOPC 2HH9A 2PHXA 4HKWA 4YRDA 2R16A 4P9GA 1M4WA 2FCVA 2QJVA 3GHMA 4V2WA 5FZGA 1JYCA 1D4M3 1UY1A 4XMAA 2JDAA 1S2BA 4QKFA 4XBQA 4IL7A 1POV1 2GNTA 4IEWA 3ZYFA 5CVRA 3CJIB 3OBRA 3ON7A 1NZCA 4OZXA 3ZFEB 1JYWA 3RZZA 1QJEA 3PMSA 4YGCA 3BIEA 4AL9A 3NJZA 1BMV1 5D8AC 4RS5A 3RI8A 4BQ3A 2DU1A 4AG4A 4E8CA 5CFDC 4U2AA 5BPXA 4GH4A 1LOCA 1ST8A 1W8UA 3WQBA 4W4ZA 3LEKA 4XFHA 5A6YA 3BALA 4QMAA 4N43C 4N7IA 4TLGA 1MEC2 3BPZA 4ZU4A 4JHZA 4XF0A 4CUAA 2DCKA 5BXXA 3ZXAC 4UYBA 3VDDA 3VD3A 2XLAA 3AP7A 4OQ8A 2P6CA 4ONUA 1W3XA 3KHCA 1RIRA 1DGWA 3O5SA 1UWWA 1CVNA 2WNOA 5A6XA 2LM3A 2WZR1 4JGZC 1OKOA 4CDUA 4LO5B 5I0SA 5DUXA 4C8DA 1UY0A 1SEFA 1SFNA 1TG7A 2GN3A 4M00A 2RJLA 1LENA 1WD3A 2GNMA 5A33A 4XAEA 3VKLA 1VBD2 4XHBA 1AR62 1G9FA 2EIGA 4Q4V1 3VBRA 5FUIA 3D8CA 1K12A 1RYYA 1US2A 3MZHA 1W2UA 2KA3A 1AR73 2QQKA 3A21A 4ORFA 4OUEA 4CP9B 2GZWA 1WBLA 1PGL2 1OH3A 3MF9A 1IKQA 4QD2A 2WQZC 5J96B 4GULA 2VMDA 2YXSA 3IN9A 4L92A 1ND2A 2H6CA 2R32A 4AZZA 2XR4A 3A7QA 5FZEA 1W6NA 2C0ZA 2VMFA 4IEOA 3RI9A 4CDQA 2WS91 2RDNA 1CZTA 3VDAA 2W46A 1NCRA 1LKNA 4ET7A 1VIWB 3RJRA 1WGPA 2Y8KA 2C4XA 1TME2 1HXS2 5FXXA 1O4YA 1PIV2 2NN8A 2NLRA 4MYEA 5FLJA 4ZS3A 2VNGA 4LA2A 1Q8SA 1UZVA 4NN0A 5C8CB 5JI7A 2JDNA 2CY6A 4QQOA 4QX0A 4DEVA 1IS4A 4KWKA 5J09A 4ITCA 4BQXA 5JMOA 3PVOA 4UW3A 3K2OA 3J4UH 3WNPA 3I2OA 4LITA 3P5BA 1Q8OA 1GQGA 4EQVA 3B7MA 3BIWE 4UW4A 2DUPA 1XOYA 4EN0A 1MZEA 1QMJA 2XBO3 2YV8A 3VKFC 4IGQA 2VNOA 1RUH3 2NMOA 3J7MA 1ENRA 3WVJA 2CWMA 4E9KA 2A70A 2Q8CA 2RS31 1D4VB 4QKBA 1AVBA 5A1FA 3VKMA 2FZ1A 4AI9A 1SPPB 3VBOB 4BQYA 1U5XA 1HLCA 4EN6B 2FDGA 4BHPA 2XPJA 3CL1A 2HWF1 5DUWA 3THDA 5LCWL 4TWTA 2BERA 5JCTA 3FLRA 4Z8BA 3OPWA 2ZGKA 1LB2A 4DPNA 4HONA 2JECA 1G9DA 1STMA 4QXBA 3K3NA 2GMMA 4KBBA 4YVSB 4CDWB 2MEV1 3B93A 5FQ0A 3KWVA 4YG6A 1F5JA 5FPLA 5FOJB 3PU8A 5ACA1 1A6CA 4QQ2A 2KM2A 2VPVA 1EPZA 1CJDA 1GOGA 1DZTA 4MGZE 1BMV2 5IK7A 2Z2SB 1DF0A 2WO7A 2W5FA 4YG3A 3U78A 1QOSA 2BWAA 3OUJA 4AI2A 5DZGA 3ST7A 2D40A 5C9AA 5B4XA 1AUYA 3N7JA 2Y6KA 4META 3H8XA 1W6PB 3THTA 4MGTA 4ES8A 5E88A 3ME2A 4Y22A 5FUNA 3W9AA 3O1SA 2TUNA 4KGQA 1V0AA 5JOZA 1YNAA 1H0BA 1RUF1 2E33A 5GLZA 1RUI1 2F4PA 3ZN5A 2IXIA 4HMZA 1JYXA 2E7QA 2WZR2 5FPBA 5JSOA 1QKQA 2DCYA 4RD7A 5FJKA 2AZ5A 1FOD3 2VZSA 4FPKA 1C57A 3EQEA 2X5IB 4WM8A 4Q0VA 5FY7A 1PMHX 5JXJA 2D3SA 1H2KA 3VD9A 1IPKA 3AKTA 1SLLA 4Y20A 4CZSA 2JKBA 1MQTA 4ZU5A 4BCUA 5F39A 4OYUA 5HXMA 3KT7A 1QXJA 4Q4V2 1GANA 1MEC3 4R9AA 4W6XA 5HBAA 3K4ZA 5C70A 3UL2A 2WFF3 1MZ5A 4OLLA 2DCZA 4UFJA 1FNZA 5HV0A 1ZZ6A 4XXPA 3HWJA 2DUQA 4E2GA 2W08A 4FCAA 1X8EA 1SZBA 4BM8A 3B94A 1LULA 4FOQA 1ASJ1 3LSDA
chains in the Genus database with same CATH topology
4N53C 1N1YA 5A3MA 2WS92 4D3WA 4FQ4A 3M70A 2CL2A 1VBD3 1YFXA 2EA7A 4LBQA 4LBJA 3J9SA 3RQ0A 1FV3A 4KG8A 4EWAA 3J26N 1POV0 4PDWB 1YCIA 1V00A 4OHZA 1QH7A 1B35C 1VBB1 1S0EA 2ZGRA 2D6MA 4QPIB 3VBUC 4RA0A 5KXBA 2GDFA 1X36A 3NV2A 2QE3A 1N47A 4FO9A 1V9U2 1TME3 4S2FA 1LGBA 2C1FA 4RR3A 5EYYA 1FV2A 1OA4A 1C5IA 1NCQA 1WLCA 5L7OC 3KZ4C 2WNUA 2XJVA 4FPGA 1YWKA 2RS32 3VBSB 4X8PA 4JDNA 3FZ3A 1BK1A 3WDUA 4DY5A 1HRV1 5AVAA 1HX6A 2HWF2 4YW5A 1WBFA 2B7YA 5JI9A 2Q8OA 1JW6A 5LEKA 5E89A 3GZAA 1RVF1 4KU7A 4A2UA 3MLKA 2MEV2 4LR4A 1QOOA 4QM9A 1CAVB 1HRI1 4BA6A 2WIIB 1DGRA 1X8MA 3MW3A 1QJX1 1PO11 5SV8A 1SBEA 1SLCA 2YDEA 4AQTA 3B69A 2JE9A 1C28A 3CJIA 3H3ZA 5FLHA 3ROUA 5BNNB 3VUOA 1DU3D 3INAA 4W6WA 2JG9C 4TSVA 5ABJB 1OLRA 4M01A 2VXRA 2VNRA 3ZIWA 3AX4A 4D94A 3NAPC 4AEDA 4AVBA 1RUD1 3THPA 4AK3A 1GNHA 1RUF2 1Z7S3 1RUI2 3KCCA 4BOWA 1TE1B 4L9BA 3AXDA 4CEWB 3DL3A 4EWDA 1WMEA 4YVWA 2HEVF 3AP9A 5JZGA 2PHLA 4QQLA 3WDWA 2ARXA 4CTEA 5I91A 5CFCB 5BUVA 4FPYA 5AC92 2XVGA 1I3HA 3S7EA 1Y9QA 4Q4W1 5BNQA 1KD7A 1VAVA 2C5DA 3CNAA 2QUOA 3BB6A 4TYSA 2BBVA 3NKTA 2D93A 5LRRA 3VZKA 5AVPA 1XYNA 5LEJA 2UWBA 1APNA 4AEMA 4WVMB 1KFXL 3WP5A 4EN9B 1GBGA 2E6VA 4IV3B 1JYIA 4K3UA 2HWE1 1AF9A 4Y1XA 1J1LA 4QPGC 1ASJ2 1W6MA 1TMF2 2PHUA 3SH3A 4H3WA 4HSJA 3USUA 5C4WB 1EP0A 1O7FA 4P9YA 2B39A 3ENRA 1RINA 2EXIA 4R4XA 2AYHA 1L3JA 4AFAA 1YFUA 1J3PA 1AHSA 2PHDA 5BNPC 3GBGA 2JENA 1VBC3 1A3KA 3VHPA 2RMU2 3M2MA 1N1SA 2D7FA 4K40A 4LHNA 1BEV1 3ZFFC 1U5ZA 4YM0A 1QWRA 2ZGQA 1EAH3 1HV0A 3RWNA 4LULA 2F6BA 4HKLA 4QGMA 4GQ7A 4XTPA 2VUJA 1VBB2 4FOVA 1YJKA 4AFMA 2BNNA 3ZMNA 1RUC1 5DXDA 4XF4A 4B3NA 2ZGPA 3DF0A 3B02A 3QH7A 2D98A 1WMFA 5KC5A 2ZJCA 1OOPB 2GAUA 4WZFA 3JCIA 1LR5A 3RG0A 1ENXA 1DYPA 5CADA 4OULA 4PBPA 3GF6A 2BEOA 4HVOA 1HRV2 2WNVA 5C33A 1RUG1 1PK6C 3FUQA 3OY8B 2ZX3A 1GFF2 3VBOA 4N9HA 2E53A 5CFDB 4GXLA 2TEPA 1D4M1 2AR6A 4YM1A 3IWZA 1V9U3 4AW7A 1HRI2 3HAGA 2B9UA 3AYDA 4W6YA 1QJX2 1PO12 4CDWA 4N43B 4JCKA 1LESA 1H2NA 2A75A 2ZACA 3ZX7A 2V73A 4YGDA 3WDYA 3CU7A 3PMEA 2BPA2 4JGZB 3EO6A 1RGSA 4XF1A 2R1BA 3E5UA 2D6PA 2PTMA 5K7PA 1JXNA 4JC1A 2YC0A 1W6PA 3UJQA 1K5MA 1QU0A 3TWIA 2B8MA 1KQRA 1O3TA 1CESA 4Y1ZA 2FMYA 5JOWA 2EXKA 4IV1C 3WP6A 1LGNA 4H7MA 4IEPA 1SMVA 4Q0QA 4FTEA 4MZUA 5HCBA 3NVCA 1J58A 4Q4W2 1RUOA 2MPFA 4I01A 4KH9A 3V0AA 1VP6A 1UU6A 2OW4A 3ZXGA 2P3JA 4EROA 2G4IA 3L2YA 2YHJA 4XEZA 4UBHA 2GH2A 5GLVA 3WDTA 2A3XA 1COV3 2N7GA 2QZ3A 4GALA 1AR71 1DBNA 4LTAA 1PGW1 3C2UA 4HPKB 4AEJA 4MXVA 3R0RA 1R1A3 3FUOA 2ENRA 4FXKB 5AC93 1Q43A 4XZPA 4CEYA 2Y0IA 3AZZA 4LNVA 1LHVA 1IZ3A 5T5OA 4WBBA 4HLTA 4MGIE 1LOEA 3G7DA 2CYFA 1W0OA 1RHI3 1BEV2 2WJSA 2DCTA 3DN7A 2P2KA 1TMF3 4AFDA 5GALA 3ZYJB 2ZGLA 4LE4A 4PDWA 3NWKA 3SH5A 4B29A 3OGGA 5T5PA 1VB4A 4QPIA 2DTWA 3WV6A 4N90A 2XBO1 2A3WA 2RMU3 1RUH1 4Y24A 2XH6A 3KCYA 5K0UC 2IWGB 4AHWA 2ZHMA 5I93A 5JAXA 1LOBA 2ERFA 4OI1A 4FPFA 3R6SA 1RUG2 3OCPA 3V65A 1GLHA 1PGSA 3VBSA 1N3PA 1GZ9A 1QGLA 3IPVA 2UURA 1XRUA 2KXLA 3RYKA 1D4M2 2TBVA 1XE8A 3WQ7A 4E2SA 4EN7B 1O3RA 4NR1A 1OLQA 4BIFA 2VGDA 1Z78A 4YARA 2DFCA 1XU1A 1ZBA3 4AFCA 3B3QE 5CG9A 4Q8KA 1WLTA 2ZAHA 4YGBA 1EPWA 3D4KA 4QGLA 1ZZ7A 2K9ZA 4Y1UA 1F31A 2EXJA 3I8TA 3SCHA 1KDMA 5ABJA 2Y26A 3RYPA 3D5OA 3DKWA 3OBTA 3JQWA 4DY3A 2GU9A 2ZOEB 2JE7A 4YG0A 4OI4A 1YJLA 3O0XA 1LOFA 4P14A 2VH9A 5JIUA 4MX3A 4CEWA 3A0KA 5BNOC 1FI2A 5FPXA 1FNYA 3MEPA 2RM23 1DQ4A 3WG4A 4R9CA 1FOD1 1WUVA 3FFZA 5CFCA 2VU9A 1H4GA 4M3CE 4N53B 4P9IA 1KJLA 4XW3A 1UW8A 3BCWA 5GKAC 3FJSA 1PNFA 1AXKA 2O8OA 2OA2A 3EHKA 2CAUA 1MEC1 5JMCA 1O3SA 3AYEA 3POSA 4FOWA 1EV13 5T5JA 1AR72 2WFF1 4IEXA 1PGW2 3H9AA 1C8M3 1XNBA 3B00A 4IV3A 3UKNA 3HT1A 4U36A 2NYYA 2CNAA 3C3VA 1VLNA 2PLV3 4HZFA 5C4WA 2YMZA 3NW4A 4OHXA 1GZWB 1B35B 2UWCA 2OZJA 3G6JB 2XWJB 1CGPA 4XJUA 3H1WA 2SLIA 5GZFA 3VBUB 4NHKA 3WP4A 4YZ2A 5DZEA 2ZHNA 4Y26A 2BGCA 1G9CA 1LJ7A 5FO8B 3H0OA 2B45X 3ZPYA 5L7OB 4AHZA 1AL22 4OI0A 3UKTA 4BIOA 3ES4A 2WSVA 1AZDA 2WQ4A 3VHRA 4AVCA 1OD5A 2A6ZA 2YY1A 2XBO2 4HFSA 4WM7C 5IK4A 1RUH2 5F6LB 1QDCA 1TME1 1PZ7A 1V6JA 3D82A 5FDBA 4AGGA 1MZ6A 1QQP3 4XDQA 3MIHA 5GZDA 2VMIA 1U5YA 3USSA 4Y1VA 2X53S 1X82A 4I3PA 3WY6A 3PVBB 2IXCA 2HEYF 1A78A 1XYOA 3D6EA 1LHOA 4URTA 2Z69A 3H7JA 1NYWA 2JG9B 2IFRA 3ACLA 5D8AA 5KXEA 5CFDA 2A6XA 2IC1A 3NAPB 3QLQA 3ZFEA 1FMD3 5DUVA 5J3UA 2GH8A 4B8EA 3AZWA 1JUHA 3S0MA 3FLTA 1PHMA 1RUG3 3M3QA 4H55A 5EXOA 4N43A 3RDIA 2WWSA 4IEQA 1SDWA 4BWOA 1S0CA 3PHMA 3SMHA 1DQ5A 4XHXA 3O7OA 1PVC3 1ZA4A 2HJIA 4Q27A 3RS6A 3VBFA 1XU2A 3AYCA 4YZ1A 3OGJA 1Z7S1 5GZGA 2QQPA 4A7ZA 4YM2A 3KQRA 2TNFA 1VBE2 2OYZA 3RPQA 3VL8A 5CBLA 1FOD2 4RSUA 2EVXA 3ZXLA 2R1DA 4QPGB 3M8LA 5L36A 5HI0A 4PJYA 3ATGA 4JRLA 2QDRA 1DGRN 5IUQA 2VY0A 2WFF2 5BNPB 1JH5A 3APBA 1LHNA 4X8NA 4L97A 1DIWA 4HETA 3AMNA 3ZFFB 1NE6A 1C1LA 1BBT3 2MHFA 4FQZA 4DMIA 5B2GB 5H9SA 1ND3C 1S0GA 4COUA 2K2SA 2RJKA 4RHV3 1VBC1 2NM1A 5EFUA 4B4QA 5J37A 4F7ZA 3DPRC 1JHNA 2QVSB 1RMU1 1V6LA 3LGRA 3I4IA 3AJZA 1EAH1 4XYXA 3ZSEA 3H50A 4A3XA 3M3EA 5FO9B 4M3CB 4JGYA 4IEZA 4NOTA 2ZGSA 4N7UA 4ATEA 3ZXEA 4L99A 1PK6B 3GBFA 3ASIA 1ULEA 1J3QA 4RS5C 1UZYA 1LHUA 1MS8A 1QXPA 1UZZA 4E4DX 4GH4C 1N1VA 2Q0AA 3FHIB 3B9IA 4PF5A 2OPKA 4EN8B 1O4TA 2JD4A 5CNAA 4XQWA 4J6GA 1AL23 1IS3A 3E5XA 3VDDC 2YGMA 5H9QA 3POYA 3T1LA 3QBQA 1WMDA 2AENA 5DZFA 2EAAA 4GWNA 3PTYA 4IEYA 5F9TA 4FXGB 1V9U1 2WA4A 3AJYA 3S6PA 3RSJA 4AVTA 4YW1A 2UWAA 5K8SA 2XJTA 3KLSA 4AHYA 2AH2A 3TYJA 3FMGA 1CPNA 1NA1C 4AVAA 5FMOS 4PIYA 2ZX4A 2ZPXA 4PBOA 5EJ3A 2DTYA 4IV1B 1H9PA 2A71A 3I59B 3L9JT 1LGCA 1V6IA 1Z7S2 4GIQA 3KM5A 4K7JA 3CEWA 1MACA 3P3NA 4CDQC 1R1ZA 1NCRC 1A8DA 2Q30A 4FPCA 4Q1PA 4FPHA 2ZCWA 4G3YC 4X6RB 3WHTA 3OYWB 4COZA 2BVVA 1YHFA 5EV7A 2I74A 4N53A 2R0HA 3AZYA 3SISA 1COV1 1CAWA 1AX1A 1VBE3 4LHKA 3VV1A 2Y38A 4Q8LA 1R1A1 5AC91 1H2MA 5CU1A 3WQ0A 4XILA 2PELA 2Q4SA 1VBC2 5E16A 3WW3A 4XOGA 1DDLA 1CAXB 1LRHA 1AX2A 1B35A 3V0BB 4D7TA 1RHI1 3GALA 1RMU2 2VG9A 3NL1A 1OQEA 3FBYA 1RUE3 3ZSKA 3ZVXA 1EAH2 1WLDA 2ZGTA 2OVUA 4PIXA 3B01A 1TMF1 4AQ6A 2BUKA 5K0UB 5JSPA 2ZKLA 4COYA 2A7AA 4JDMA 3KCXA 1ENSA 1ZM1A 4H14A 4KQ7A 3MICA 1CAUB 5I0TA 4FTSA 2D6OX 3TN92 2RMU1 3MGUA 3VBHB 1ENQA 4MLOA 3MFAA 5I0RA 1KXGA 2Q1ZB 5JSRA 3WW4A 1XNKA 3ZSLA 1IOAA 5FMOL 1ZVFA 1WCKA 2ZAAA 1CJPA 3HQXA 4HT1T 2PAKA 4XFBA 1LHWA 2WT0A 4LT5A 4WM8C 1XQNA 3A4UA 3IM0A 2JG9A 4INDA 1GYKA 2W52A 1KDKA 2Q5TA 3WCSA 1ZBA1 3PJYA 5I8TA 1MQTC 3NAPA 2VOVA 4XIKA 2NQYA 2ZA9A 2PA7A 4MV2A 1CX4A 3AP6A 3ES1A 5HXVA 5BNOB 5F6KA 1X33A 4JDOA 3AXEA 1ZZCA 4IETA 5FCCA 1GZCA 1LOAA 3WR0A 4XBNA 4UW5A 1AR92 2OZ6A 3AMHA 4HBNA 3JBG3 2RS13 5EWSA 2RM21 5H9PA 3VHNA 1BVVA 5FAXA 1HW5A 2DVBA 4ISRA 1AX0A 4GKXA 4QPGA 4XBLA 1QJY3 3AZXA 2V09A 4OUSA 4I0WB 4EJRA 3VKNA 1ULGA 1S0FA 4LBQD 1G8WA 2EAKA 2XJUA 3GHNA 3HMYA 3TBDA 3ILFA 1COV2 1EV11 4IEUA 3MW2A 2PQQA 5BNPA 3S30A 1C8M1 2VW0A 1R1A2 1PVXA 5IT6A 1X50A 3LSEA 3J8F3 1M06G 4QHBA 2ET7A 2XGXA 2PLV1 1UIJA 1ZBE3 1WLWA 1AR82 4GMP3 1DGWX 3MW4A 1RHI2 3WG3A 4G4FA 5GZCA 1ZRFA 2UU8A 4WM7B 1BQPA 2XVKA 3PVEA 3MIFA 2AREA 4P5HA 4GWMA 1SLTA 5DG2A 3SXWA 4DRRA 1ZZBA 3MPPG 4XJ8A 3RMYA 1S0JA 1AXYA 4Q4Y1 2Z42A 2OUJA 5FBZA 4QM8A 1H1AA 1SLAA 2CGNA 2YROA 2XG3A 3D0SA 3E97A 4M3CA 3W58A 1CN1A 3PJQA 4ES9A 3IKWA 1YI7A 1G6NA 4AVSA 1AYN3 3KS7A 3IBMA 2WLQA 3N35A 1PK6A 1S0DA 4RQPC 1RMU3 2ZABA 4JTNA 3VN4A 2Z79A 1QQP1 1H8TC 3H1YA 2EALA 4AEDC 1XXNA 1PM7A 4K1YA 4Y4YA 5C8CA 1AJOA 5H9RA 1MR5A 1RUNA 4L2NA 1BVP1 2DURA 1NOVA 2JG8C 4YVWC 5JZGC 4R4ZA 1MVEA 5F1RA 3MI8A 3N3HA 1HDKA 2ZBJA 1QOTA 3VL9A 2ZGOA 1BZWA 3TN93 4NHMA 3JUUA 1ZBA2 1LCLA 1FMD1 2R073 1Q8PA 1DFQA 4C0HA 1V6OA 4EWEA 1NQJA 2CGPA 2UY9A 2VVDA 1FYUA 4TLFA 1PZ8A 1VJ2A 2ZKNA 3JB8A 2WSUA 3KGZA 4RFT0 3ZMOA 2ATFA 1PVC1 4IV1A 5EZWA 2YPJA 4NPRA 2PYTA 4YVSA 2P37A 2RR13 2GALA 2ZS6B 2YYOA 2JICA 2GMPA 4LA3A 2RM22 4Y1YA 3ZN6B 5KHIA 1SBFA 3MIEA 3W59A 2NP0A 1YIPA 3A0NA 3FLPA 3MIGA 3WOGA 4HVRA 3AKPA 3FC0A 4MH0E 1HQNA 4QQPA 1MS4A 3OYWA 2WC2A 2B5HA 3MLJA 1GR3A 5LRSA 4XTMA 1AR93 1C3HA 2XJPA 1EV12 1KFUL 1ND3B 2I07B 2VULA 3PVNA 3ZXJA 1ZRCA 2HWC3 2D3RA 1QJU3 1C8M2 5BYNA 3DPRB 1KS4A 1QDOA 4CRQA 3WD5A 2RS53 3JD73 3GYDA 4OHWA 1REEA 2PLV2 3WXPA 1BBT1 4E2QA 2X5IA 5GLTA 3SLIA 1F2NA 3SNMA 2WNVC 2W39A 3OD0A 4XFGA 2I45A 4DB5A 4BQ1A 4AHXA 2BNMA 4RHV1 4WVWA 4NHLA 3V56A 1LOGA 4L11A 1CAXA 5J98B 4RS5B 2CGOA 1W39A 2ZHKA 1H8VA 4YZ4A 4GH4B 1S1AA 4N9IA 2R6QA 1S0BA 1WCDJ 4Q4Y2 5T50A 1CD3G 5FRAA 1X7NA 2CAVA 5K0UA 1VR3A 3VZMA 3IT8A 4PCRA 5DG1A 2FZ2A 1AR83 3VDDB 1YUDA 4D69A 1NQDA 5AFBA 3ECQA 1QQP2 2GNBA 1RL3A 1CAUA 2VECA 3MFCA 2XLFA 1LEDA 4D7SA 1LODA 1O5LA 1KITA 2HWB3 1MVQA 1NY72 4SLIA 1K5MC 1AL21 4E4ZA 5KHJA 1UX6A 3AFGA 3BOWA 1NA1B 2ZGMA 3R4DB 2O1QA 3OF1A 4R52A 1PO23 1FMD2 2D6NA 5JOYA 1FPN3 4LLFA 3WT3A 3U0ZA 1R083 4O9GA 4V1PA 3TAYA 2LUWA 2IFWA 4H7LA 3ILRA 5KHGA 1RTVA 4CDQB 4KWJA 4CP1A 1NCRB 3ZSJA 3EBRA 3O14A 2DVFA 2G9FA 4I09A 4KL1A 1OFSA 4AQSA 1N1TA 1PVC2 3VBHC 4QT6A 1DYKA 4CEYC 4DOUA 1NXD1 3FE5A 1W0PA 4XFCA 3UV9A 3LB9A 4YZ3A 1CAVA 1DQ6A 1HIXA 2XLGA 4LO8A 4LE3A 4COVA 5FLIA 4JVAA 4YM3A 1D0GA 4Q0SA 5BNNA 1IHMA 2VW2A 4KGGA 4XE9A 2WL1A 4UBGA 3NV1A 2FMDA 3DGTA 1U12A 4JAAA 3HN1A 4IESA 4Q4X3 1G9AA 3X29B 2IXLA 4J1WA 1VBE1 1MS1A 1ONAA 5JIAA 3U10A 2QFEA 5JWPA 1D2QA 1OMIA 1OPOA 1BBT2 2RHPA 4S2GA 3ELNA 5DDJ2 1EYBA 4C1WA 5FQ0B 4RHV2 5K9YA 1IS6A 2WKKA 2QKDA 3N36A 4C91A 2WLPA 3WQ1A 3DUIA 1I9RA 3T1MA 4MSVA 4WVMA 1RUE1 4K21A 5GLUA 1QF3A 2ZZJA 4WM7A 5C9AB 1AXZA 1QH6A 2PHRA 1T6GC 2A6WA 4XJWA 4Y22B 3PNAA 3SHRA 3WDXA 3AKRA 1QNYA 5E1RA 2HWD2 1TNFA 4XPVA 4LBOA 4M0HA 2EF6A 4BPZA 4LO4B 3AKSA 4WM8B 4Y20B 4Q4Y3 4FPEA 4QQHA 1MQTB 3KGLA 4LUMA 1Q56A 4FOYA 1OA2A 3TOJA 2EXHA 1Y7BA 4SBVA 4I2OA 3ZN4A 1VRH3 1WCSA 4FAHA 4CDXC 4PQ9A 3U4XA 3S7IA 1OOPA 5EYXA 2WZPP 4XJZA 4QU2A 1AJKA 2D5HA 3QD6A 1F5FA 2BVBA 4L8QA 4C90A 3IIAA 1V6KA 2W0XA 3VKOA 4XFFA 4K8FA 4DQAA 1URXA 3JB4C 4AYUA 4UXAA 4YW2A 3FWEA 1HQLA 2ZMNA 3OY8A 2B46X 4CP0A 2UY8A 3B9CA 1ALYA 3ZYIB 2DF7A 1OI6A 3ZFGC 2AGSA 5IK5A 2FHRA 1TQ5A 2UYBA 1CR7A 3BTAA 3LA3A 1QJZA 1GICA 2BYVE 2E51A 2RS11 3JBG1 3WCRA 3CLPA 3ZXDA 4AVVA 3WG1A 4HL0A 1RUJ3 4MVTA 3H8UA 1WW5A 4RR3B 1VAMA 4KU8A 4A7YA 1RJ7A 1UD1A 1UPIA 1D0HA 1H9WA 1QJY1 3OPZA 2VVFA 2XKOA 4JGZA 4Q29A 4XF9A 4P9JA 1REDA 2IZWA 2B42B 3FX3A 1ULFA 3KB5A 4Z07A 4Z2WA 3ZYPA 5FPZA 4YW4A 1ND3A 3CJXA 4HVQA 2XJRA 4J1XA 4BH9A 1ULDA 1QXRA 1FAYA 3DPRA 1W6OB 1EY2A 3J8F1 1I6XA 4BYYA 3V64A 1ZBE1 3AP4A 4FBFA 4GMP1 3SITA 1DG6A 1SFYA 1TNRA 5I0UA 2XHKA 4NO4A 1RUE2 2XL7A 2R043 4RQPB 3P3PA 4FP2A