1QQP2

Foot-and-mouth disease virus/ oligosaccharide receptor complex.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
216
Chain Sequence
b'DKKTTTLLEDRILTTRNGHTTSTTQSSVGVTYGYATAEDFVSGPNTSGLETRVVQAERFFKTHLFDWVTSDSFGRCHLLELPTDHKGVYGSLTDSYAYMRNGWDVEVTAVGNQFNGGCLLVAMVPELCSIQKRELYQLTLFPHQFINPRTNMTAHITVPFVGVNRYDQYKVHKPWTLVVMVVAPLTVNTEGAPQIKVYANIAPTNVHVAGEFPSKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GENOME POLYPROTEIN)
publication title The structure and function of a foot-and-mouth disease virus-oligosaccharide receptor complex.
pubmed doi rcsb
molecule tags Virus
total genus 43
structure length 216
sequence length 218
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qqp200
1NCQC 4CDQB 1F8VA 1EAH1 1RB8G 5DDJ3 1NA1A 1AR73 3J8F2 1TMF3 2ZZQA 1VBC2 1K5MA 2RS32 4N43B 3VBSB 1CJDA 1ASJ1 1MEC2 3JD72 4GB32 1NCRA 4N53A 1RUE1 4YVWA 5C9AC 1RUI2 1POV1 1PIV2 5JZGB 4CEWC 2R042 1HRI3 1NCQA 4Q4X1 1C8M3 3ZFGB 2RR13 1AYN1 2TBVA 5D8AC 1C8NA 3VDDB 1RVF3 1PO12 2RM21 5CFDB 4Q4W3 1EV11 2RS11 2BFUL 4CDQC 1VBD2 5BNOB 3NAPB 1RUG3 2R073 1RUJ2 1RMU2 1ZBE2 5C9AA 4PDWB 1AUYA 4CEWA 4N43C 3VBSC 5BNPB 3J8F1 3ZFEB 1VBB3 4NWWA 5D8AA 4CDWB 4RHV2 4IV1B 1RUH3 2WLPA 1NY71 1PGL1 1V9U3 1AR92 1FOD3 1PO23 2HWC3 5JZGC 4Q4V3 4CDQA 1OPOA 1COV2 1VBE3 1VBA2 2RMU3 4GMP3 3ZFGC 2HWD1 1FMD2 2WZR3 1RUC3 3VDDC 2BBVA 1AL21 3TN93 1RUD2 2BPA2 5ACA1 5CFDC 1RHI3 4N43A 3VBSA 1QJU2 1PO11 5BNOC 1R091 3NAPC 3VBFB 1EAH3 3VBRB 1Z7S2 4NWVA 1QQP2 1R1A1 4PDWC 3ZFFB 5JZGA 3JBG1 4FSJA 2WS91 2RS52 5BNPC 1ASJ3 1TME1 1WCDJ 2HWB2 3ZFGA 1BMV2 1ZBE1 4AEDB 4CDWC 1AR82 3VDDA 4IV1C 1RUE3 2ZTNA 5L7OB 5CFDA 1POV3 1RUH1 1HRV2 4IV3B 5BNOA 4Q4X3 3NAPA 1QJY1 1AYN3 1D4M2 5BNNB 4RQPB 5FMOL 3CJIB 1RUF2 4PDWA 2BFUS 2RM23 2HWE2 1HXS2 1EV13 5BNPA 2RS13 3FBMA 3VBFC 4CDWA 3HAGA 3VBRC 4IV1A 1AR61 2XBO2 1QJX2 3ZFFC 1VRH1 1B35B 1AYM1 5A32B 2WFF2 1Z7S1 2PLV1 3J8F3 4AEDC 4Y4YA 1BBT1 3JD73 4GB33 5L7OC 2QQPA 3ZXAC 1IHMA 4IV3C 5DDJ2 5FOJB 1AR72 1TMF2 3VBFA 5AC91 2IZWA 2HWD3 3VBRA 4RS5B 5BNNC 4RQPC 3CJIC 1AL23 4JGYB 2MEV1 1HX6A 1ND3B 3ZFFA 5ACA3 1FPN1 1PO13 2BUKA 1R093 4AEDA 1PVC1 2HWF1 1HRI2 5L7OA 1C8M2 1R1A3 2RR12 1BEV1 1RUJ1 1B35C 3JBG3 4IV3A 2WS93 1PGW2 1RVF2 1TME3 2DF7A 1ZBE3 1QJX1 5BNNA 4RQPA 3CJIA 1VBC1 4WM8B 2RS31 1R082 1VB2A 1RUG2 1MEC1 3JD71 2R072 4GB31 5FMOS 4GMP0 1QJY3 4RS5C 5C4WB 3LOBA 1RUI1 4JGYC 1ND3C 1PIV1 1OOPB 2R041 1B35A 1VBB2 5A32A 5K0UB 1V9U2 1FOD2 1PO22 2HWC2 4Q4V2 5J96B 4CEYB 1AR63 2ZAHA 1VBE2 2R062 2RMU2 1VRH3 2WZR2 1RUC2 1X33A 1AYM3 1VBD1 1ND2B 1Z7S3 2PLV3 3TN92 4RS5A 1RHI2 1BBT3 3ZFEC 1RMU1 3DPRB 4JGYA 4WM8C 1ND3A 5A33B 1POV0 1EAH2 4YVSB 3S6PA 5AC93 4RHV1 1CD3G 5CFCB 5C4WC 1R081 1ZBA2 4QPIB 2Y26A 1ASJ2 1AR91 1OOPC 2MEV3 1COV1 3JB8A 1VBA1 2GH8A 5K0UC 1FMD1 1FPN3 4Q4Y2 1GFF2 1SMVA 4SBVA 3ZFEA 1PVC3 4CEYC 2HWF3 1RUD1 4WM8A 1OHFA 4Q4X2 1AYN2 1BEV3 1RUJ3 1QJU1 4WM7B 1ND2C 3VBOB 2RM22 1QJX3 5C4WA 1VAKA 1E57A 1EV12 3DPRC 1QQP1 2RS12 1VBC3 1OOPA 2RS33 2RS51 4YVSC 1MEC3 2HWB1 1BMV1 1X36A 5K0UA 1AR81 5CFCC 4CEYA 4QPIC 4CDXB 1RUI3 4RFT0 1PIV3 2FZ1A 1HRV1 2R043 1H8TB 1ND2A 1ZBA1 4GH4B 1NY72 1D4M1 1PGL2 1RUF1 3DPRA 4FTEA 4QPGB 2HWE1 5A33A 4Q4Y1 1HXS1 2HWD2 4YVSA 4FTBA 4WM7C 3VBHB 1VBD3 3VBOC 2FZ2A 1AL22 5CFCA 5ACA2 2VQ0A 2XBO1 4QPIA 1RMU3 3IDEA 1R092 4Q4W2 3VBUB 1F2NA 4RR3B 2WFF1 4EJRA 4LLFA 1R1A2 4RHV3 3JBG2 1MQTB 4CDXC 1R083 2X5IB 2WS92 1AR93 1TME2 5DDJ1 1NOVA 1H8TC 1NG0A 4WM7A 4CDUB 1AR71 1COV3 5ABJB 1TMF1 3VBOA 1VBA3 4GH4C 5LK7B 1FMD3 1M06G 5C8CB 1RUH2 4JGZB 1RUD3 4QPGC 1DDLA 1QJY2 1QJU3 3VBHC 1NA1B 2R063 1K5MB 4CDXA 1HRI1 1C8M1 4BCUA 1NCRB 1QQP3 2RR11 3VBUC 2XPJA 4N53B 1H8TA 1PGW1 1RVF1 2RS53 4RR3C 1AR62 2HWB3 4YVWB 4GH4A 1AR83 4Q4W1 1VRH2 1MQTC 2GSYA 3M8LA 2X5IC 1AYM2 1NCQB 4QPGA 2PLV2 5GKAC 1RUG1 2R071 4CDUC 1HRV3 1BBT2 3VBHA 5ABJC 1ZBA3 1D4M3 5J98B 1RUE2 5C8CC 4JGZC 1A6CA 1RUF3 3VBUA 1VBB1 5AC92 2HWE3 1AL0G 4Q4Y3 1HXS3 4RR3A 1QJZA 1NA1C 1V9U1 1FOD1 5C9AB 1PO21 2HWC1 1HQNA 1VB4A 4Z92B 3JB4C 2MEV2 4Q4V1 1K5MC 1MQTA 4CEWB 2XBO3 1VBE1 2X5IA 2R061 2RMU1 1NCRC 4GMP1 1FPN2 4N53C 2WZR1 4Y5Z0 1RUC1 5D8AB 4CDUA 5ABJA 1PVC2 2WFF3 2HWF2 4YVWC 3TN91 4FTSA 2WWSA 1RHI1 5C8CA 1BEV2 4JGZA 1W39A
chains in the Genus database with same CATH superfamily
1NCQC 2XG3A 1CQ9A 1F8VA 3WF3A 2KA3A 2IXHA 3D5OA 1EAH1 1NXMA 3NNFA 4XFCA 4AQ6A 5CISA 1CAUB 2CL2A 1QH7A 3WCRA 1XBFA 2ORZA 1W06A 4P9WA 4PI0A 2XKPA 1VBC2 5F3GA 1ZX5A 1W0PA 2PHFA 2FDFA 4HKWA 5FYCA 3MW4A 4AYUA 4QXCA 3GDBA 4HXCA 2GC1A 3U07A 3AZZA 4FFIA 3VZNA 5C9AC 4HBNA 3LFIA 5F9TA 2DFCA 1CAXA 3PJQA 4INDA 2JKBA 4NHLA 3U1XA 2ZX0A 2IXCA 3F2ZA 2ATFA 2VUJA 2Y6JA 4YG6A 3FFQA 1UY1A 5JZGB 2A1XA 4EQVA 1W8NA 2ET7A 3LF7A 5FYYA 4YZ4A 2QQIA 2W3JA 2WZEA 3HNYM 3O0XA 3KMHA 4I09A 4QU1A 5FYMA 2Y64A 4MGYE 2EAAA 1OBNA 4WVMB 3ZMOA 5A3LA 3VD7A 4N9IA 4AWDA 5EP9A 3E97A 1CN1A 3OY8A 1LR5A 1SDDB 4XBNA 5HCAA 4UOJA 3ILNA 1VBD2 2E7QA 2VGDA 4S2GA 4GJYA 1SCRA 3WV6A 3N9QA 5BNOB 3A21A 5LA0A 5FY4A 1OQ1A 1LOFC 2R073 4P9JA 5DMYA 5I91A 2A6ZA 4FI9A 1ZBE2 5FYZA 4F83A 3RZJA 5FP9A 1FV2A 5FY9A 3ZXEA 3AKRA 4CEWA 4N43C 5JXHA 3HQRA 1FV3A 3WNPA 1YFWA 5A7WB 3J8F1 2Q30A 2JIJA 3HD8B 4RFRB 4NWWA 3B9IA 1V6LA 3AP4A 5C3SA 2XVLA 2JG8B 1RUH3 1UOFA 2ZHKA 3ZIXA 1NY71 1S2BA 1N3OA 3AP5A 4XIKA 1KDKA 1PO23 1T6BX 3OUJA 1D2QA 1S0EA 2D93A 1C5IA 1VJ2A 2WAOA 3HT2A 3POYA 1OPOA 1COV2 2QQLA 4L2NA 4LXLA 2VMDA 4QHZA 5CIRA 2ZGLA 4AFCA 3PUHA 3AMQA 5F39A 2BV4A 2J7MA 2HWD1 1DFQA 2DCZA 2AEZA 1J1TA 2WZR3 4DPNA 1W0NA 1S0CA 2EXIA 4Q1RA 4CSWA 1IGOA 5JIAA 3CBNA 3W59A 1CWPA 1S0IA 3WDUA 1RUD2 2XWBB 2BPA2 1WMDA 3I2JA 2VZPA 5KWRA 3NNGA 2ETEA 3FLTA 2VVEA 4W6XA 4LO6B 4R52A 5FP3A 3IIAA 1PMIA 1QJU2 4CP9B 5FQ0A 1PO11 2HKXA 1R091 1V6JA 2AENA 4BLJA 4N90A 3MFCA 1Y3TA 2PAEA 2DU1A 3NNJA 3M3IA 5DZEA 5FZDA 4WVZA 4D7YA 5FWJA 4XURA 4A44A 2VQUA 3I2IA 1GYKA 1C1FA 1FT9A 1R1A1 2PYTA 4PDWC 4P14A 4XILA 5JAXA 1GU3A 1L7QA 3JBG1 2TNFA 2D98A 4H2AA 1ZA7A 3AMHA 1NKGA 3RSJA 5HV4A 2ARAA 2XJVA 3WNLA 4Z1VA 3ZFGA 5CKNA 2VW1A 4BLIA 4CDWC 1BK1A 1BQPA 3KCYA 4IGQA 4QGLA 3VDDA 3WQ7A 2XJSA 4IV1C 1RUE3 1LHUA 4DIQA 5L7OB 2XKOA 2JG9C 1RUH1 4KWLA 4O9EA 4YW5A 4P02B 1P8JA 1UIJA 3WVJA 5CBLA 1LCLA 4ASMB 5C8WA 4Q4X3 2W94A 3NAPA 4ASKA 4LO4B 2R16A 1ULGA 1QJY1 4V2VA 4F7ZA 4OFGA 3WW2A 4CP2A 2ZMKA 4KBZA 5LCWL 1H1MA 1F31A 1JBCA 2ZEZA 3HPNA 2E53A 3SH3A 3ZSMA 3UL2A 2RM23 1YFUA 5FPLA 3SCGA 2RJ2A 2HWE2 2WIIB 2WN2A 5DZFA 4LBLA 3FHIB 4AGGA 2XQXA 1EV13 3C7OA 2CSGA 3FBMA 2WZ8A 3VBFC 4FOVA 3HAGA 2XJUA 4RL7A 1X8MA 3IKWA 1OVSA 2P17A 4IEPA 1H2LA 1OUSA 2XBO2 2A6XA 3CQOA 4JVAA 2RDRA 1YNAA 2QQJA 4MZUA 5E1RA 3V0AB 1F5FA 2VNRA 4FBFA 3ZFFC 1Q5OA 1VRH1 1IPKA 3Q8AA 3PJYA 4OZOA 1HW5A 3PU8A 2K46A 5A32B 2Y6GA 4IEZA 2WFF2 1Z7S1 3IMMA 4NIDA 1WMEA 4YSFA 4AEDC 1J83A 4QX8A 2X29A 4I3GA 4CUGA 3ZMNA 2IXKA 1O3TA 2VC9A 1WKYA 5IVYA 1FATA 4K1ZA 2FMYA 4R9CA 4G4FA 1O8SA 1ZZCA 4YZ1A 4IV3C 5FOJB 1AR72 3OPZA 1W04A 3GM8A 3LFMA 5FYIA 5AC91 1YO8A 1PZ9A 2GDFA 3SCHA 2PTMA 3VBRA 2BWAA 4RQPC 3M3QA 5GZDA 2VCAA 4DXZA 3CJIC 1GANA 4K9SA 3SKVA 3ZKUA 3M4FA 4QHOA 3NKGA 3T1MA 3VHRA 4D7TA 3VL8A 3OF1A 2C0ZA 1QXJA 1O4YA 2PHRA 4XUQA 4EWAA 2YHJA 2LRPA 3DXTA 4QB1A 2BUKA 3AMNA 3P3PA 3I2KA 1OI6A 4EYUA 4UBGA 1PVC1 4A3XA 2HWF1 4FOQA 1HRI2 1LOAA 1QOTA 3EB7A 1YXWA 4M3CA 4FOYA 4XF3A 3OGSA 2A75A 1R64A 3MW2A 1QOSA 1Y9MA 1AXYA 2PMWB 2WO2A 3AZXA 3ZSEA 1YQ5A 4Y24A 3WQ1A 4LIUA 4DY5A 5HCHA 1PGW2 1RVF2 3UK9A 2Q0AA 1UZZA 3USUA 1GZTA 1QJX1 2Q8EA 2P4EA 3O0VA 1SLLA 3SC7X 2VBDA 1GQGA 2D5FA 1N1TA 1W6PB 2RS31 5LRSA 4YGBA 1RIRA 2EXHA 4UW6A 5A6QA 1MEC1 3HQUA 1DZRA 4UYBA 1BYHA 1VMHA 4EE2A 2JXAA 5LA1A 3WSOA 4EWDA 1HQWA 3N9PA 4BK5A 3I54A 5FREA 3ZPOA 4RS5C 2EXKA 4K21A 3LOBA 3WDYA 3BYWA 4IGPA 5H9RA 1CGPA 1GOFA 5IK5A 1LHOA 1ND3C 1NX9A 1NZCA 1PIV1 2FCVA 4OYUA 5FIXA 1GOGA 3O14A 5FZGA 3O1PA 2ZHMA 4M01A 3WG4A 3TEWA 1UY0A 3AP7A 4YM1A 2WYFA 1V9U2 1LULA 1FOD2 3ZIWA 4ARYA 3QLQA 4KGQA 4C1XA 4CEYB 1AR63 2ZAHA 4PJYA 1X82A 2VQTA 5CYYA 4CXYA 2NP0A 3K2OA 1YQCA 2QQOA 5DN2A 5FRAA 1HIXA 3ETPA 3FJSA 3ZVXA 1OFNA 1X33A 3LD8A 4OI4A 2X05A 3J26N 3H8OA 1UF2C 1UZWA 2P3YA 2PLV3 2YG0A 3CZJA 1O3SA 4P5YA 5FZ3A 4JKLA 4KNCA 1YCIA 1RMU1 3OPTA 1DG6A 4IEQA 3MYXA 4W6YA 4YW7A 2Q8CA 5T5OA 3V65A 4JGYA 2Y6HA 3LA3A 3MBWA 4A2UA 1POV0 1EAH2 3NNMA 3LEIA 4ZU5A 1WW5A 5FO7B 2ES3A 1KS5A 4NVPA 3I59B 2VMFA 5A1FA 4BHPA 4Q5OA 5SV8A 4RHV1 1CD3G 1HV1A 4SLIA 4C91A 5C4WC 3WP5A 1R081 1ZBA2 4COUA 1C3HA 3LDKA 3KLSA 4M0HA 4I3PA 3T4HB 1AR91 3PU3A 5A3PA 1FYUA 2D3PA 5J37A 5A3WA 3NW4A 4O7XA 2JENA 3E5QA 4QXHA 3PVNA 5JSPA 2WQZC 1VBA1 2DTYA 1LU1A 4Q4Y2 3RZMA 2ZKLA 4YGDA 1SMVA 1U0AA 4SBVA 4XC9A 2XGXA 4BQ3A 1BHGA 1XYNA 4M4PA 2VE1A 1HDKA 5FZ4A 3OSDA 4FPCA 5AVAA 1OURA 4DEVA 4ES9A 4UFHA 1RUJ3 4WM7B 1QIQA 3J9SA 4Q0UA 4XEZA 3VBOB 1W8HA 5H9SA 3RZGA 1UIKA 1SPPA 3AFGA 1V6KA 2A6YA 4YG3A 5GM0A 3UYJA 4KMQA 5F2WA 2DURA 2XDVA 4AFDA 3ZN5A 4OUSA 3QH6A 1VBC3 1OOPA 4CCNA 4UW5A 3M3CA 3T1LA 3N4MA 1JZ5A 2BNMA 1W2UA 2VZTA 5FZBA 5IK4A 5LZ6A 3MLKA 4HN0A 5K0UA 4N8MA 2YBKA 3AZVA 1G9CA 4RA0A 2GH2A 3GF6A 2ZS6B 4CDXB 1KS4A 2D43A 4RSUA 4AK3A 2FDHA 5FZOB 3WG3A 3HR9A 2VH9A 5F6LB 2VULA 2W39A 4FPKA 2ZGUA 2DYCA 3OGVA 1HB1A 2VZ1A 3R0RA 4NO4A 4OMCA 5F6KA 5FV3A 4NAOA 3W5NA 1LENA 1YC61 5IFPA 1N47A 1NY72 1D4M1 4L9BA 5DABA 2BW8A 5TSWA 1NT0A 3VD4A 4J1XA 1OA2A 3DPRA 3WP4A 3N3HA 5JOYA 1NZIA 4MUVA 4QPGB 5IFTA 4GULA 5EIYB 2TEPA 2A6VA 2HWD2 4LIVA 3H3ZA 2NM1A 3I4IA 1MPXA 4MH0E 4YVSA 3ST7A 1AX0A 2QQNA 4Z8BA 1VBD3 2CDPA 4ZU4A 1YRZA 5EYYA 5FPBA 4A42A 4Y5SA 3I3QA 4NHYA 2Y38A 2YROA 3SNMA 4BDVB 3IT8A 5FWEA 5D1IA 3GJAA 5I93A 4B4RA 4QQOA 2JE9A 1R092 2P6HA 3B94A 3H1MA 3M3EA 4LLOA 1KITA 4LPLA 2OA2A 1F35A 4RR3B 5GZEA 5GJ6A 1G9FA 2W0XA 3SITA 3THDA 1GBGA 1PM4A 1GNZA 1SDWA 2J1AA 1JYVA 3BODA 5J7MA 1R1A2 3GCWA 1W3XA 1DU3D 3JBG2 4LBQB 3MUZ1 3M7AA 2A3XA 2LROA 4BQXA 2OX0A 2KXLA 3LQCA 4DUWA 5F5QA 5ERLA 5DDJ1 1NOVA 1H8TC 1DHKB 1COV3 5JXIA 1AHSA 2JDKA 3AKTA 4XAAA 4XJZA 1ENQA 3A7QA 2DUQA 2BYVE 4XCAA 4QMAA 1O4ZA 1RUH2 1JTZX 1Y43B 4MADA 3LSDA 3QACA 1RUD3 3FUOA 4GWIA 4XTPA 1XRUA 2P3KA 3CO2A 1QJY2 2R0HA 2HYXA 1UZYA 3WUDA 1JMUB 2JECA 1QJU3 4QDSA 1S2KA 2PN5A 3PVBB 5F5IA 1D0GA 5FK8A 3VBHC 3ZDSA 4DINB 1JYTA 3PHMA 3BOWA 2GAUA 5JI7A 2QUOA 1JH5A 2C4XA 4NPRA 1K5MB 2F17A 3WY6A 4BA6A 2XHNA 4RN5A 5KBFA 4BCUA 3KVAA 1PK6C 2RR11 5I0TA 1OA4A 1N3PA 5KHIA 3FE5A 4Q8KA 2W5FA 3VB9A 4AHWA 2WNUC 4FPYA 3IIIA 4IEUA 3ZO0B 2K2SA 4UBHA 5E16A 1D4VB 3C2UA 4GH4A 3ZN6B 5FKBA 5KC5A 1UMZA 1VRH2 3SKJE 4DUXA 1S0FA 2BGPA 2GSYA 3VDAA 2GC3A 3Q8CA 5EHDA 1GNYA 1K12A 1A8DA 3GBGA 5LB6A 2YZ4A 4K3UA 1QDCA 2ET1A 5JCTA 2VW2A 3O1UA 3PL0A 2ARXA 1WA4A 1OLRA 1SG3A 2H6BA 4NOTA 2JJ6A 4HVQA 3VKLA 5T55A 1SZBA 2ARCA 3DKQA 3MEPA 1WBFA 1BZWA 3BIWE 1RUE2 2WABA 4IE0A 4JV4A 4YYOA 2VMCA 2G9FA 3VBUA 2WNVB 1VBB1 3AYDA 2HWE3 4GJZA 4MHUA 1UU4A 5FY8A 3BVCA 4YZ2A 3RWKX 3OPWA 2I45A 4Y4RA 1QJZA 3HQXA 4B1MA 1SQ4A 5LY1A 2XXZA 4YG0A 4XQWA 3POEA 2VMEA 2B9UA 2HWC1 2A71A 1H2NA 1JYXA 4P00B 4Z92B 5JOZA 1W8FA 3PIJA 2XBO3 4QQPA 2X5IA 1LTEA 2XHKA 2ZA9A 2R6QA 2RMU1 3WP6A 4XCBA 1W90A 2E33A 3VLBB 4TLFA 5LY2A 5D8AB 3NL1A 4D6SA 1UU5A 1PVC2 2WFF3 2HWF2 1JU3A 3NVCA 3AXDA 3TN91 2PHXA 4CU7A 1BJQA 4FTSA 2G4IA 1XQNA 2FCUA 3NSTA 1RHI1 3UGGA 2UURA 2W46A 2VXRA 3AKSA 1ZZ9A 2WWUA 4JGZA 2IXIA 4CDQB 3J7HA 2CAUA 2OQ6A 5FBJA 2B39A 3MIEA 1B09A 5FYTA 4E9KA 4M3CE 4LITA 1RJ8A 3T0BA 3T2TA 3ZR5A 2FMDA 1AR73 4AF9A 1XNKA 1GNHA 3DN7A 2OYZA 2DCTA 2WJSA 1QHDA 3O12A 4XFAA 4Z82A 3ES1A 2RS32 1OF4A 4XUTA 2F4PA 2UYBA 3MW3A 4BWOA 3VBSB 1CJDA 2OPWA 1KEXA 1ASJ1 1MEC2 4HG6B 5CB7A 1AVBA 2ZGMA 4N53A 4URTA 1UKGA 1J3PA 3O5SA 5FPZA 4E4ZA 2OW4A 2OXBA 4JKKA 4YVWA 2VOTA 3WDTA 3O1RA 2BWCA 4UF0A 2CAVA 1MR5A 1POV1 4NR1A 1YJLA 1PIV2 1YIFA 1X9PA 4CEWC 4Z2AA 1HRI3 3BPSA 2QDRA 5B2GB 3NNLA 2E6VA 1O7FA 1AYN1 4S2HA 2TBVA 4GQ7A 1GP4A 1RVF3 2V4AA 3WW4A 1SBEA 3LOIA 4JDNA 5IK8A 3UV9A 4UFIA 4XXPA 1W2OA 5EJ3A 3ZKYA 2B9VA 3H0OA 5CFDB 3WR0A 3IB3A 2XLAA 2ZHLA 4Q4W3 2ZX2A 2RS11 2BFUL 1SACA 1H30A 3AL6A 1XNTA 2TUNA 2H6CA 1RUJ2 3FUQA 1I9RA 4A4AA 1RMU2 2BOIA 1LECA 4JTNA 4MX3A 5AVPA 2BDRA 3KWVA 3AM2A 1Q8SA 3B00A 1OQDA 5GLUA 4U36A 2WR9A 3C7EA 3T0AA 1N1YA 3WG2A 5GZFA 4KWJA 5BNPB 3ZFEB 3IDBB 2W08A 4BYYA 3ZM8A 4GKXA 4RHV2 3HIFA 4XZPA 5LWBA 2XLGA 3A22A 5T54A 4LHSA 4X6QB 4JAAA 4YW1A 2WLPA 1V9U3 1AR92 1FOD3 1QMJA 3TYJA 2VTFA 1DGWX 5FMCA 2GN7A 1W8TA 1WCQA 3VZMA 4UFLA 4JHTA 4JX0A 5EJZB 1VBA2 1YJKA 4GMP3 5A7OA 3ZFGC 4AVTA 3ZXDA 5FO9B 1CAWB 1UXXX 1QJFA 1CAUA 2DFBA 1TVGA 4R9AA 3VDDC 4CPBA 1UX6A 2VCCA 4QX0A 5A6YA 3WF1A 1AL21 1UWWA 4A7YA 4Y26A 2PELA 1CPMA 3GZEA 5ACA1 3GYDA 4QB6A 1UW8A 3B5LB 3WZ1A 4NUBA 1KQRA 2UWBA 4KG0A 3WDXA 1DLCA 1YQ6A 3NAPC 4XF9A 5DUWA 1EAH3 3O0WA 4QX7A 4XACA 4BIFA 3C7FA 1L7RA 4QD2A 1JXNA 1RXFA 4IL7A 4ZXKA 5JZGA 2VTXA 5AC92 1E5SA 3KHCA 4OHYA 3LE0A 4QX3A 2JDPA 1W0OA 3VUOA 2GC2A 3L2HA 4COVA 1WCDJ 1S55A 3MICA 1V70A 2NLRA 1OMIA 5HV0A 2J1VA 2I07B 5HBAA 2GZWA 3JQXA 3LB9A 5FZ8A 2EXJA 3ZX7A 3VV1A 1ULCA 4B8EA 1WWYA 2EF6A 3CEWA 4YARA 2AZ5A 4WVMA 2ZEWA 3FC0A 2NN8A 2ZPXA 4AHZA 3S0MA 1DYKA 2Y0IA 1WW4A 3GZTB 4XPVA 2BNOA 4HK9A 1SLAA 4WVVA 3I8TA 5BNOA 5KXEA 2LW8A 3UNPA 4PQ9A 5L9RA 5FZAA 1D4M2 5F3EA 3L9JT 5BNNB 4NHKA 5FMOL 3VN4A 1PZ7A 5CNAA 4RYDA 3W20A 1K45A 1UMIA 2WNEA 2DV9A 4XJ8A 5A7WA 3AB0A 3N9MA 3WLUA 2ZKNA 5FZMA 3LIGA 3AL5A 2AREA 2YC4A 5DXDA 1DGRN 1JS9A 3VBRC 4LKFA 3I2FA 1GP5A 4CYDA 2JG8A 5LA9A 2BRTA 1XC6A 4CCOA 1UYZA 1WW7A 3MV11 4Q0VA 3KV6A 1B35B 1AYM1 1DGWA 5EWSA 2W1UA 1BXHA 3RG0A 1LB2A 1TG7A 2IWGB 1VPHA 4Q27A 3J8F3 1EY2A 1IG0A 3NV1A 3BCWA 2R0FA 5CADA 2NMNA 1CPNA 4FXGB 4HVOA 4XF1A 4FPLA 4GB33 4QPYA 1WCSA 3KGZA 5DAQA 3MIGA 4EN7B 1ZYBA 2B46X 2PAKA 1IHMA 4KQ7A 5DDJ2 5E8AA 4CP9A 1C1LA 1YFYA 2IXJA 5A3MA 5FXVA 4PLOA 2IUWA 4WVWA 4HT1T 2C24A 3JXSA 1ENSA 2HWD3 3RI9A 3GBWA 4IDZA 4QKBA 3WW3A 4QDQA 4ZU7A 1BLZA 2BVVA 5T50A 4V2WA 2ZX1A 4AHXA 3TEZA 4MVTA 3ILRA 1RJ7A 1V6MA 2MEV1 2ZGQA 1IPSA 4AQ2A 4IGOA 1QEXA 1ZRRA 5FLHA 4HVRA 3R4DB 1FPN1 1PO13 1Q8OA 3VGIA 1R093 1STMA 1Q43A 2ZMLA 4UWDA 3MF6A 2R1DA 4D0QA 1XNCA 4GZ9A 4Q0QA 1GKBA 5L7OA 1JZ4A 2D6OX 2XLFA 4FP2A 1R1A3 2F6BA 2RR12 3V56A 2XWJB 1REEA 4DEQA 3JBG3 1WD3A 1GMMA 1TEIA 1F5JA 2WA3A 3ACLA 3OYWB 2CHHA 1SFPA 5FYHA 4D94A 3OG2A 4YFZA 1FNZA 2UYAA 5EYXA 1BVP1 4Q29A 3TB0A 3SQOA 3WUCA 1UY3A 3JU9A 4BH9A 3KVBA 1YIPA 2EVXA 3OB8A 4WM8B 1N3QA 3S7IA 1IKPA 4AW7A 4GB31 4Q0PA 4Z07A 3BTXA 3KCCA 1RUOA 1H9PA 1UCXA 2VZSA 2Y34A 4ET7A 5IT6A 4IETA 3BN6A 4KGGA 1QJY3 1GQHA 2ZABA 3V0AA 1RUI1 1LHVA 1A78A 4JGYC 2R1BA 1VBB2 3KD4A 2AYHA 4JKMA 4D6QA 5ISLA 1ZZ6A 5A32A 4KU8A 1MS5A 3WW1A 1EUUA 1LHWA 1KFXL 3CL1A 1APNA 5FUIA 2HWC2 1RYYA 5DZGA 1E5RA 2HYKA 1JYNA 1UXZA 2VOWA 1KJLA 2A3YA 2OZJA 1QWRA 5BXXA 4MXWB 4QQ2A 1YYNA 2RMU2 3RPQA 2JWPA 3D0JA 1VRH3 2VZQA 4HZFA 2QQKA 1FX5A 2VJXA 4TN7A 1ND2B 3D82A 3THPA 1Z7S3 4B7KA 3TN92 3PUSA 3UJOA 3VHNA 3WNOA 5C7GA 3VHOA 2VCMA 1LESA 1RHI2 1TZOA 3WNNA 4E27A 3NO8A 4BQ5A 3DXUA 4HK8A 2V5YA 4EN6B 4QXKA 4Y1ZA 1UZ0A 4HLTA 5A33B 4CCCA 1I3HA 2EIGA 4FPOB 1OKQA 4QDRA 3WD5A 4M4RA 4HN1A 1R1ZA 3S6PA 5AC93 3W58A 5CFCB 2G9GA 3RYKA 1KDMA 5GZGA 4FP3A 4QPIB 2Y26A 5C6CA 3UETA 1ASJ2 1AXZA 2EIBA 1JYIA 5FYBA 3CDZB 3GCXA 1QXRA 1G6NA 1OOPC 4LBJA 3GNEA 4MOAA 1W8OA 1JUHA 4LO5B 1MZ5A 1IS5A 3D4KA 3K3OA 4H3WA 4TSVA 5CVRA 2GH8A 5K0UC 3H1YA 5F7UA 1TQ5A 2W1SA 3I3BA 3KV5A 4KU7A 3KM5A 1PVC3 1H2MA 2HWF3 4CTEA 5C3PA 3N9NA 1ALYA 1W6PA 3TEYA 3I2DA 3OBRA 2J42A 4YW2A 1AYN2 1OKOA 1U5IA 4QX1A 3C7GA 4JZRA 1DQ5A 4XXAA 2J1UA 5T5LA 1QJX3 1LNSA 3H50A 3MPPG 5F5CA 4AVCA 4AVVA 4ZZ5A 4QKFA 3ACGA 1UU6A 2DVDA 3DPRC 3A0KA 1QQP1 2RS12 5EXOA 1Q8QA 3S57A 3KF3A 5GLVA 2JB4A 2V4VA 5APAA 2RS33 3H7YA 5JDBA 4DB5A 4YVSC 3TBDA 5HI0A 5KXBA 1MEC3 3WF2A 1W9YA 4OHZA 1G9BA 5FYSA 2Q8OA 3LDBA 2DUPA 5IUQA 2I2SA 3KV9A 4P9LA 1S0DA 4CEYA 2NQYA 5K8SA 1JZ8A 4O61A 4L92A 4META 4RFT0 5H9QA 4AGVA 1PIV3 2FZ1A 1HRV1 3FMGA 2HH9A 1SEFA 4M3CF 4BXSV 5B4NA 1SFYA 5AFBA 4JDOA 4CUBA 3VDCA 1LJ7A 1OC1A 2GU9A 4XIOA 4F8AA 3IDAA 3TOJA 3TWIA 5CKQA 1EUTA 4GXLA 2VZ3A 1JN2P 2VQAA 3DUIA 4OUMA 1HN1A 5GLTA 1HXS1 2YPDA 4EV0A 1DZTA 5I0UA 1GZWB 5E6HA 3I59A 2QCSB 1UZVA 4YW3A 3P5BA 3N7KA 4YZ5A 2VUCA 2FZ2A 1AL22 1ENXA 5ACA2 5FPUA 2ENRA 3IAPA 1RMU3 3IDEA 1IKQA 3SH5A 4AQTA 4PLMA 1JOPA 4Q4W2 4QU2A 2CGPA 2H0VA 2W1QA 2YY1A 2EALA 3D8CA 3I2GA 4OI0A 3ES4A 3GZAA 2HBUA 4HMZA 4LLFA 4RHV3 1Q8PA 1MQTB 1V6NA 1VR3A 2P6CA 1R083 2WNOA 3RVHA 1ZREA 3AXEA 4Q1PA 5FR3A 1AR93 1LHNA 1C57A 4J25A 4MGSA 2J1SA 3M3OA 3OUHA 3ZFEC 2D3SA 1LRHA 1NG0A 4WM7A 4CDUB 4CE8A 5J1XA 2BZDA 3H7JA 3I97A 5FDBA 5ABJB 1TMF1 3VBOA 1EPWA 1VBA3 4I02A 4GH4C 3PURA 5LEJA 1CR7A 1GWMA 1LGBA 2NPIA 2ZBJA 1LKNA 1S0GA 4IE5A 1W9WA 4IW3A 1M06G 2FBEA 5DUVA 5C8CB 1K3IA 2HLEA 5JXGA 3CMGA 5FZ9A 1W6NB 3JQWA 4E4DX 5IVJA 2P1BA 3E6BA 4JQRA 4D7SA 2CTVA 5IVFA 5KXDA 3W5MA 1UY2A 1ULOA 4YFWA 4A3ZA 3RZHA 1J58A 3R6SA 1GICA 2W92A 1O8PA 1ENRA 1NA1B 4CA9A 1W2NA 3G6JB 4PHZA 3V0BB 1XE8A 3PVEA 3CF6E 1N1SA 2R063 4NHXA 1ZVFA 4XFIA 5DAWA 4CDXA 1LOCA 4C8DA 5FZOA 4NPLA 1C8M1 3HVDA 1NCRB 1SLIA 3IPVB 3RS6A 4GWNA 4FXKB 1UOBA 3JCIA 3VBUC 1PMJX 3ZXJA 2FDIA 3RRDA 2WN3A 3USSA 1Y9GA 3MIDA 2DU0A 5F37A 1O91A 1CVNA 5J48A 2YC2A 5FPXA 2JD9A 3ZR6A 2X8KA 3SXWA 4KBBA 1YFXA 4JTOA 3M8LA 1UYXA 1AYM2 1NCQB 2X5IC 2VNOA 4QPGA 2ZX4A 3ME2A 2D3RA 3PMEA 2P3IA 4AG4A 3EHKA 4IUGA 2MPFA 1RUG1 4LBNA 4CPBD 1NXD1 2UY8A 4LKDA 2VXJA 1VAVA 1W05A 5FAXA 5G04L 1DGLA 4AEJA 4IE7A 5JSRA 4B7EA 4BK4A 3N36A 1D4M3 3L2YA 4KL1A 1GLHA 2KR2A 4UAPA 4JGZC 3ZYIB 4COZA 5FY0A 4DFSA 1A6CA 2AEYA 1WZXA 1QH6A 4BIOA 3OJBA 1LGNA 1QF3A 4RR3A 4LKSA 1X9TA 4M0NA 3OBAA 3GHNA 3AMPA 5C9AB 3H1WA 3H42B 3AYEA 5EZWA 3JB4C 5FZ0A 2MEV2 4Q4V1 4LBQA 1YEWA 1VBE1 3BU7A 2R061 2VUDA 3ASIA 4LE3A 5FY1A 3ZN4A 5DAXA 4FPHA 1FPN2 4N53C 5FCCA 3BIEA 4Y5Z0 4YZ3A 1RUC1 4UFJA 1A34A 1H9WA 1A3KA 1W2AX 2XJRA 4QM8A 2W1WA 4YVWC 5DQ0A 5CG8A 5I0DA 2WWSA 1WBLA 1QXPA 4NRMA 4BQYA 1C4RA 5I0RA 5FXZA 1SLCA 1V6OA 2ERFA 4XJUA 3S5QA 5F1RA 3ITQA 1W39A 4Q2FA 2C1FA 5BNQA 2A3WA 4K20A 2E51A 2DVAA 4AL9A 1H2KA 4LK6A 4DRVA 4HANA 4CCMA 3Q8FA 1LAJA 2J1RA 5DDJ3 4ZKTB 4L8QA 4AE2A 3KZ4C 4EROA 3J8F2 4AAPA 1OLMA 1O3QA 3NV4A 3W9AA 1DF0A 3SMHA 4ORFA 2QQVA 1KFUL 3GBFA 1K5MA 2XUEA 4OHVA 4E4SA 4N43B 1GSLA 4OQ9A 1UO9A 1RUNA 4GB32 5CU1A 2IVIB 5FUPA 4W4ZA 3BGAA 5LBCA 3DYOA 4NJ4A 4DXTA 4ISRA 4CCEA 3FLRA 1SCSA 5A6ZA 1CJPA 1UL9A 2ZGOA 4COYA 1W6OB 1RUI2 4HKOA 1MZEA 4GWMA 3ZN6A 3AC0A 4D69A 3FWEA 4DRRA 1D2SA 2WDBA 4ITCA 4AI1A 4LNVA 4QGNA 3POIA 1U5ZA 3AZWA 4Q26A 4BMBA 1GWKA 3ACIA 1E5HA 2RR13 4NHMA 5FOBB 4R4XA 2CDOA 3UGHA 4H55A 2OUJA 4UW4A 4XHBA 1PO12 4PLNA 4XJWA 3ZOIA 1FI2A 1GR3A 1OSGA 4ZXEA 4B4PA 1CONA 1ZZ8A 2CWSA 1JI6A 2WNVA 3LDRA 1V6IA 3Q9OA 2BJSA 4MLOA 5L9VA 4BQ2A 1WW6A 3MGUA 3P6BA 1H6YA 4PDWB 1AUYA 2E7TA 3BTAA 5JPNB 1ODNA 1W9SA 3ZXKA 1IG3A 3B93A 4YM3A 3VD5A 1IQDC 1YWKA 2A7AA 2VMGA 4XZUG 5E88A 3RQ0A 3UGFA 1VBB3 2IVJA 2BTVC 5D8AA 4CDWB 2AUYA 4GD4A 4ONUA 4IV1B 2XJQA 3RZZA 3SISA 2FDGA 1AJKA 5A1LA 3U37A 3RMXA 1QY4A 2HWC3 2JG9B 5KHKA 5JZGC 1UN1A 3U14A 2PA7A 4CDQA 1QNWA 5LA2A 3KV4A 4CVUA 4AVBA 3X29B 2CY6A 1PX3A 2RMU3 1BK0A 1IQAA 2WA4A 5KHJA 2Q1ZB 4BM8A 5L19A 2P34A 2W68A 3ZDVA 2BNNA 3B9CA 1CZVA 1O5LA 4LHKA 4AI8A 3ZLIA 2VVFA 5C5UA 1OUXA 3TN93 1WA6X 4KWUA 4Y22B 4NRPA 3V64A 4E4HA 1RHI3 4YLZA 3LEGA 3VBSA 3RZLA 5FZLA 2JX9A 1ZZ7A 5BNOC 3VBFB 1S4CA 3LGRA 4N7UA 3SCFA 1F9KA 1QOOA 3I3EA 2ZEXA 1Z7S2 1IPJA 1I5PA 3OBTA 2Q1MA 1QQP2 2LTNA 4QQHA 2F4LA 3LCPA 4BZ4A 5IAXA 3ZFFB 2W9XA 5A3TA 2Y6LA 4X8PA 2WS91 3ZYJB 2DBNA 5I0SA 1ASJ3 1TME1 2NYYA 3ZSKA 2W95A 1ZBE1 3WCSA 1NLSA 4AEDB 4LBOA 3MHZA 1ONAA 1Q3EA 2WYSA 4BQ4A 5LK5A 3WG1A 2JG8C 1GZCA 4GALA 4QX5A 4LK7A 2X10A 2ZTNA 2QE3A 4U2AA 3U4XA 1PMHX 4O9GA 5A7PA 3IN9A 1POV3 4YM0A 5CFDA 4CP1A 1SLBA 1HRV2 4IV3B 5FJKA 1ST8A 4P5HA 4EZ4A 1DBNA 1ZZBA 4I01A 1LGCA 1AYN3 3TNPB 2DVFA 3BUCA 5EV7A 3GHMA 4RQPB 1MVQA 1W8WA 2QDNA 4XOGA 4I30A 4XTMA 3CJIB 4CUAA 3S7EA 1GWLA 2BFUS 3DV8A 3PLQA 4BU2A 3AJZA 1HXS2 4I2OA 3CZUA 1H1AA 4LOSA 2HBTA 2RS13 5BNPA 3I2HA 3TAYA 4XDOA 5KXCA 3JZVA 3R4SA 1XB9A 3K46A 2JE7A 4E8DA 1VP6A 1OD5A 1YHFA 3DCQA 4XUPA 1QJX2 2VZOA 3S30A 1RL3A 3WDWA 4HOOA 4L11A 1H4HA 1DLLA 3INAA 4AFAA 1T2XA 3UJQA 4CCJA 4YRDA 3IMNA 3DL3A 1BBT1 3HNMA 5JOXA 3OCPA 5IVVA 2WSUA 1QJEA 4HL0A 4XDQA 4E2SA 3WXPA 3THCA 3JD73 5L7OC 2QQPA 1W03A 4QGMA 1XNDA 2CYFA 3ZXAC 4Y20B 1VAMA 4EZHA 2XVGA 4PI2A 2DWRA 2VUAA 3AX4A 1OQEA 1TMF2 1W8ZA 2IZWA 4F3JA 3T2QA 2WZPP 3N9LA 4RS5B 4BXFA 4FO9A 4XAEA 1AL23 3ECQA 1PX4A 1ND3B 2BVBA 1WMXA 1DYOA 2ZMNA 1ZM1A 4FFFA 1PVXA 4DO0A 5ACA3 2V5DA 1MS8A 4XW3A 3FFZA 4B4QA 4CCKA 4CU9A 3BTYA 3MUY1 4QPWA 5CKMA 5IATA 1M4WA 5HPOA 3OGRA 3OBZA 2W87A 2RDQA 3EBRA 2WT0A 2LUWA 4QX2A 1IS6A 1ZNPA 1C8M2 4AI0A 1BEV1 4FPJA 2OQ7A 4MGTA 2Z5WA 4QXBA 1RINA 3MIHA 3ZSLA 2RV9A 2UU8A 3ZYFA 1CAVB 1BCXA 4TYSA 4HETA 3VZOA 1WGPA 4K1YA 3K3NA 5BNNA 2OS2A 3VD9A 1GV9A 2RHPA 3DKWA 4QKNA 2GALA 4IEYA 1WMFA 3KS7A 1R082 1VB2A 3KT7A 1RUG2 4XMAA 3JD71 1CESA 1JUIA 4C0HA 3TEXA 3IWZA 1QU0A 1IS4A 5FMOS 5J3UA 2P2KA 2C5DA 2HEWF 1G7YA 2E63A 1O59A 3IBMA 4XE9A 5C4WB 3S5AA 2WO1A 4GIQA 4QQLA 2VNVA 4YGCA 2PHTA 4ZS3A 5IJRA 2YPJA 3UKVA 3RYPA 3LZZA 1CZSA 2R041 4UI9L 1B35A 4S2FA 4PF5A 4K7JA 3WINE 1JZ2A 4N9HA 1ZA4A 3D6EA 4H14A 5EPAA 5JSOA 2ZX3A 3LA2A 3VKNA 1QNYA 5T5JA 2HEVF 4G3YC 2DCKA 3KT4A 2CGOA 1SBFA 4Q4V2 4AAXA 1VBE2 5K4LA 2R062 3KT1A 4ZY9A 1DQ0A 2J22A 1W28A 2XOMA 4NPMA 2VG9A 4OVEA 1RUC2 1XSQA 3OGJA 3B3QE 1AYM3 1GP6A 1BVVA 4KWKA 5DPNA 4AI3A 2Q4SA 3ENRA 3ETQA 5FKCA 4HSLA 1HLCA 3MPBA 3ZXGA 4DY3A 2LM3A 3LKJA 4M00A 4BQWA 2CV6A 2VBBA 5L9BA 1H0BA 3PTYA 5FO8B 2QQMA 3Q8BA 2ILMA 4XVHA 5JXJA 4IXLA 2X53S 4FAGA 3HBKA 4NIGA 2JDAA 2JDUA 2YU1A 4RGAA 2GMEA 1AXKA 4LOTA 2G19A 2OT7A 2NZ9A 3KSCA 4J1WA 1AJOA 1WLDA 3MF9A 4OHWA 1OLME 2MEV3 1OFSA 1MZFA 4XMIA 1UMHA 1W99A 3IAQA 3VZKA 2YC0A 1VIWB 3OYWA 1FXZA 2RG4A 2KD7A 1WCUA 3JB8A 2P37A 4I0BA 1FMD1 1FPN3 3PMSA 1GFF2 5HCFA 1OT5A 2HJIA 2D6NA 4UT5A 5C70A 3WX5A 4CEYC 5ANNA 4WM8A 1OHFA 2D40A 5DUXA 3WNMA 2RDNA 2VPVA 1WLWA 1RGSA 2DVGA 4ZS2A 3DYMA 3BI3A 5FXWA 5FZHA 4BB3A 3H3UA 1NQDA 1IZ3A 1VE0A 4FT8A 1W6QB 3O1SA 1VAKA 2RJLA 4XABA 3CKHA 1E57A 3A23A 4ZZ8A 2EIEA 3A4UA 3NJXA 4W50A 4Y1VA 1HB2A 1JU4A 2P5BA 2QQWA 4HONA 2RS51 4AR2A 2HWB1 2SLIA 1X36A 2J1EA 1BMV1 4OI2A 4GWJA 2K0GA 1I6XA 1AR81 2ARBA 4LBQD 5HXVA 2Y60A 4PIYA 5GALA 5JWPA 3DGTA 1OH3A 3MIBA 3M70A 4MXWA 5A7NA 1QKQA 1RUI3 4I0WB 1W9TA 2J1TA 2OIIA 2E7AA 2QNKA 4XQDA 2PXJA 1H8TB 4NRQA 1ND2A 5FK7A 1ZBA1 5C3RA 1IOAA 4B29A 2L9LA 1PNFA 1RUF1 3N35A 4TXWA 4K40A 3TNQA 4FTEA 2B8MA 2PHWA 3ON7A 1WLTA 2B42B 3LWCA 5A33A 1DQ1A 4Q4Y1 4D8MA 4A6OA 4FTBA 1UD1A 3BOPA 4WM7C 1LEMA 4OCTA 4C1WA 5CG9A 1AF9A 3VBHB 4H7MA 2XONA 3VBOC 2BU9A 3PTRB 3ORJA 2XL7A 4W65A 5CFCA 2ADDA 1LOGA 2D6MA 3PVOA 4DXSA 1DCSA 4QPIA 4UFMA 5FTTC 3NJZA 2Q8DA 1HJFA 1HJGA 3PUQA 1PK6B 2VZRA 2ZCWA 3MIFA 1QDOA 4COWA 3EJKA 3VHPA 2WNUB 3RNSA 4E2GA 2Y6FA 4AOCA 5JMCA 2CGNA 1O3RA 3H9AA 2PHDA 4EJRA 4NE9A 1UPIA 3PDQA 2VMIA 4AGRA 3MLJA 4CDXC 5JR2A 5DAPA 2WS92 3CIHA 5F8PA 2ZEYA 3ATGA 1TME2 1W6MB 4HPKB 3CHXA 1YUDA 3MFAA 4X6RB 2W91A 3KCXA 3WQBA 4TTGA 5LATA 2ZACA 5GZCA 2JDHA 2YB7A 3DF0A 5B4XA 4ISQA 4XYXA 4N7IA 2LS6A 5CAZA 5JIUA 1CIYA 4TZDA 3I2OA 1DQ6A 5LK7B 1OXCA 4A45A 3GXUA 3VKOA 3RYRA 3WNXA 2WINB 4JCKA 2DTWA 4QPGC 2GMPA 3WEZA 1VLNA 2PQSA 2FD8A 1DDLA 1O5UA 5IWFA 2D7FA 1Z0HA 3NJYA 4Y5TA 3THTA 4K8RB 1US3A 3QH7A 3VDBA 1J3RA 4WV8A 2VY0A 3WP3A 5FYUA 3POFA 4H7LA 1VRBA 4FFHA 1WD4A 1QQP3 2JB8A 1Y9QA 4LORA 4PQQA 4AFBA 2XPJA 5LBBA 2VW0A 2FQPA 4RR3C 1VALA 3CU7A 2QVSB 1HKDA 3HWJA 2XR4A 1POQA 1YQ8A 3C7HA 1CAXB 3E6CC 2UY9A 5A3NA 3POGA 2WBKA 3Q8EA 5FZ1A 3B7MA 3NKTA 3ZYPA 4AI2A 2WKKA 2Q1FA 5GKAC 4KG8A 4XFHA 5EJ1B 5LBEA 4AHYA 1GZWA 1H4GA 1HB3A 1HRV3 2R071 1BBT2 4Y33A 4DOUA 5JVVA 5L36A 1UOGA 2YBPA 3HMYA 1GUIA 2XH6A 5A3UA 4UFKA 2QTWB 3OY8B 3AZYA 2XUMA 5GLWA 5JPMB 1OF3A 2AC1A 4ATEA 1PNGA 4PIXA 2QQUA 3AP6A 3U4SA 1HXS3 1V0AA 2W52A 4LE4A 2HEYF 4YGEA 5A7QA 2VL4A 2VZUA 3OTFA 1XXNA 1ULEA 1H1IA 1W8UA 4LKEA 1PO21 2VBPA 1I1EA 5CZKA 1OPMA 3J4UH 1K5MC 2G1MA 1MQTA 4CEWB 3AK0A 3SLIA 1TE1B 5FPAA 4OULA 5IVEA 1JHJA 5EQUA 4AFMA 2WZR1 2ZGTA 4CDUA 2DDUA 3KHBA 5ABJA 4Z2WA 1DQ4A 4IQPA 5JOWA 2VD7A 2FHRA 3NQHA 1NUKA 1HB4A 4R9BA 3M1HA 2KM2A 3NRUA 5C8CA 5FP4A 1BEV2 5M0TA 4MG2A 1W6NA 5AFEA 1AZDA 2VVDA 2AR6A 2NMOA 2ZGNA 2B4KA 3WDVA 1NYWA 1RB8G 5K7PA 1NA1A 4DZGA 1U12A 1TMF3 2GP5A 4ASLA 4Y1XA 2IFWA 3V0BA 4UW3A 2P3JA 2ZZQA 2PQQA 3MO4A 2V73A 4FPGA 4TWTA 2H0BA 3GGLA 3ACFA 1S0JA 3T2PA 3F95A 3JD72 1HN0A 1NCRA 3IPVA 3POBA 4ARXA 4P9XA 1XOYA 2WNVC 3JUUA 2AH2A 1W9FA 3MLLA 5FQ0B 2PHUA 5FYVA 4OLLA 4P08A 3N7LA 1S0BA 5F5AA 1RUE1 3FN9A 1MS4A 4KH9A 1D7PM 5DG1A 3CJXA 3WOGA 3NWKA 5JLVA 2R042 1L3JA 1ODMA 3IM0A 2OKXA 1NCQA 4IEWA 4Q4X1 1C8M3 3ZFGB 4WZFA 3SEEA 4A6SA 4DMIA 2K9ZA 1VMFA 1Z78A 2RDSA 2VM9A 5D8AC 1C8NA 2DCYA 2MNGA 2O14A 3T08A 3VDDB 5I8SA 2JEMA 4LR4A 4R4ZA 1KRIA 4XJAA 3KGLA 2RM21 4NROA 1F4HA 5FPVA 4RGGA 4LHLA 2DVBA 4ATFA 5BUVA 1EV11 2GC0A 4BE3A 4CDQC 4K8FA 2WRAA 4YW6A 4DUVA 2YDEA 2YGMA 2YYOA 3NAPB 4URAA 2C9KA 4W6WA 1RUG3 1YLLA 2WAAA 2ZGRA 3K4ZA 5BPXA 3J7NA 4Y1YA 2QFEA 5GLZA 4XUNA 5C9AA 4X8NA 3BPZA 4LT5A 1W3VA 4YNIA 3C8XA 4PF1A 1REDA 1RTVA 4MO3M 3SH4A 3VBSC 1F15A 1MZ6A 4IE4A 2GNMA 1PM7A 3UKTA 4OMDA 2WL1A 4IEXA 3U75A 3O1TA 5LBFA 3OD4A 3OEBA 3WT3A 5D21A 2YUEA 2WFPA 5ANQA 3LSEA 3R05A 4OZXA 4HKLA 3LAGA 5BYNA 1PGL1 4XHXA 2YMZA 2CWMA 3URFA 1Q8VA 4Q4V3 3NV3A 2VOVA 2JDNA 2OVUA 2QBXA 4XETA 5F2SA 1VBE3 2VNGA 1UYYA 3FHQA 3MZHA 1T6GC 4RGKA 4IE6A 4LA3A 4R9DA 1FMD2 1LOFA 4YM2A 3AMMA 3ROUA 1RUC3 1ULPA 5LASA 1XPWA 5FY7A 4DQAA 3ELNA 3U11A 2BBVA 1UOJA 3T0DA 2N7GA 5A3OA 5CEHA 5CFDC 1J59A 4N43A 3BTZA 4B1LA 1KD7A 2WO7A 3UESA 3K75B 4UXAA 4FFGA 4QM9A 3ABZA 2EAKA 1ULFA 3NV2A 4IEVA 3LEKA 3NMBA 3TRSB 3VBRB 3WNKA 1LU2A 1MS3A 1G8WA 3K4AA 5IK7A 4Y1UA 4NWVA 1W6OA 4CU6A 4CCDA 1J3QA 4LUMA 2JDYA 5C3QA 4O65A 1UAIA 5FMBA 4FSJA 3OUIA 2VAUA 3RDIA 5JMOA 2RS52 3K4DA 1NLRA 3T09A 1AX2A 5BNPC 2FDKA 2HWB2 1BMV2 3I49A 5G05L 5JUVA 5C3OA 1AR82 1O4TA 3T4VA 2RJKA 2A73B 2BP6A 3DYPA 3VZLA 4XF4A 1C28A 2C9AA 4M3CB 3CLPA 1C5HA 2XJPA 2WWJA 5CA6A 5F3CA 5A7SA 2UWAA 1SHWB 2YFUA 1XU1A 3N7JA 1JOBA 3SHRA 1A8MA 1JHNA 3USUB 2A5ZA 4FOWA 5IVCA 3LA7A 5I8YA 4NIIA 4XJ9A 4BMEA 4CP0A 3AFKA 3U0ZA 1ZRDA 3KB5A 4DNYA 5FZIA 1NE6A 1S1AA 3B02A 1RUF2 1H6XA 4A7KA 3AJYA 4PDWA 2I74A 1CX1A 4LMFA 4HFSA 1X8EA 4XDPA 5FBZA 3FHAA 2WUHA 4CDWA 5FMDA 2GP3A 1CZTA 4P9YA 1OA3A 4FPFA 4IV1A 1AR61 4MGZE 1YI7A 2PFWA 4YWAA 3GJBA 4RD7A 5FLJA 3ZSJA 5FLIA 2JG9A 1IS3A 1PHMA 3DEMA 3WHUA 4ZONA 1ZRIA 5IVBA 1RITA 1G9DA 3O1VA 1URXA 2PLV1 4BISA 5FZCA 4EN8B 2AACA 3H8XA 4Y4YA 2YFZA 3PUAA 4TLGA 5KR7A 4KI5M 3VL9A 4FCAA 2PHLA 3EO6A 4R8HA 1XU2A 3HN1A 4Y22A 4BPZA 4AEKA 1NQJA 2ID4A 5FZEA 2WT2A 4L99A 2QZ2A 4B3NA 1US2A 3P3NA 5IHRA 4C90A 3VBFA 2WQ4A 3HJRA 2JDMA 2YBSA 3VKMA 5FXXA 2FCTA 3FLPA 2RE9A 3BB6A 4EN9B 5BNNC 1LODA 1JZ6A 1KJRA 2Z79A 4JGYB 3ZFFA 1HX6A 3IZOA 3VKFC 2JE8A 1I5ZA 2VECA 1HQLA 2D44A 4QT6A 4AEDA 4Q0SA 4D3WA 3I3DA 4FPEA 2OPKA 3MI8A 4LO7A 1LEDA 2YXSA 3N9OA 4Y3OA 4BOWA 4J6GA 5C5TA 1RUJ1 1B35C 3BALA 4IV3A 4W8JA 2YV8A 2WS93 4LO8A 4XUOA 1TME3 2DF7A 3HBZA 1ZBE3 4LEJA 4QHBA 5HXMA 3ZYGA 1U5XA 1WLCA 5FFOC 5C71A 4RQPA 3M2MA 3CJIA 3C3VA 3T3YA 5FZ6A 2ZAAA 1VBC1 4ZHNA 2E32A 1MS1A 4LULA 4EWEA 4QKDA 2R072 4BQ1A 4BJ0A 3MDPA 4PCRA 3RJRA 3ACHA 1REFA 2D97A 4GMP0 4IEOA 3VZJA 1AX1A 2D6PA 3HT1A 1XYOA 1SPPB 2O0OA 2WSVA 1UQXA 4P9GA 2QZ3A 3ILFA 3E1F1 2Y0OA 3KQ4B 5SV5A 1OOPB 1J1LA 1K42A 1UPSA 3AP9A 4HSJA 5DUUA 3O1MA 1YQ2A 3H3LA 1NAEA 1V00A 2ORXA 1UX7A 5K0UB 4JRAA 1PO22 3EXUA 4MV2A 5KC6A 2XMLA 3U10A 1H8VA 4OUEA 5J96B 3KQRA 3E5UA 2Z4FA 3O1OA 1SLTA 2WO3A 2G9ZA 2YGLA 3NJVA 3O7OA 4JC1A 4LBKA 3ZYRA 5D2AA 4L97A 3HNBM 1D0HA 3AYAA 4Y20A 5JR7B 1ULDA 2WZR2 4CU8A 1CX4A 2R49A 3WHTA 1OVPA 1VBD1 5KHGA 2Z69A 4NN0A 3B01A 4MGKE 2GMMA 4RS5A 4YW4A 5T5PA 2C6SA 4XFBA 1BBT3 4GA9A 4XQ4A 3T2OA 3DPRB 3I7DA 2LALA 4WM8C 1ND3A 2VR4A 2VOXA 2PAMA 3BU0A 1SBDA 4YVSB 5EFUA 1S2EA 2R32A 1GOHA 4MSVA 4PIZA 1EP0A 1Y4WA 3POSA 5T3NA 4FAHA 3POJA 5J09A 3SEPA 1JYWA 3H8RA 3K51A 2R7EB 3OOXA 3W21A 2Z42A 2V09A 2VTXJ 2YU2A 2ZZJA 2JICA 5A80A 1G9AA 1RXGA 3PNAA 1COV1 1X50A 2VOKA 1L7LA 2ZGSA 3A0NA 5F3IA 1CAVA 2IXLA 5KHHA 1MVEA 3J7MA 4I0AA 2D6LX 4NIHA 2BGOA 2VZVA 2BOJA 2XJTA 3T30A 3ZYHA 4GKYA 4WBBA 2AGSA 4OHXA 2WQ8A 4JHZA 2WC2A 3CNAA 3ZFEA 5LEKA 5A6XA 5FJHA 1RUD1 2BERA 2ZJCA 3LEMA 3VD3A 4Q4X2 1WUVA 2Q5TA 1K5JA 1E5IA 1BEV3 1J84A 3EYPA 1QJU1 5F32A 4NIAA 4DXRA 2CNAA 3FX3A 1ND2C 4G9SB 2OZ6A 2RM22 5IAVA 4EN0A 1F4AA 2DUOA 5C4WA 3RMYA 2FDJA 1CAWA 2ZOEB 1EV12 1N1VA 2BBAA 2JIGA 4AVSA 2RVAA 2SBAA 5J36A 2JD4A 1NLQA 1XJAA 5FZFA 4AVAA 1YI9A 2EIDA 3MV01 4MGQA 5LRRA 3HOBA 1XE7A 3H8UA 1OD3A 3PIGA 4CXWA 2IFRA 2VMHA 2GNDA 3B69A 5CFCC 1BKZA 4AI9A 1WCKA 2VCBA 5FZKA 4MXVA 4QPIC 4LBMA 1DYPA 3QD6A 2CU5A 4LTAA 2R043 1HV0A 3I3MA 2Z2SB 4YPJA 1DP0A 1JODA 3LPGA 4QWNA 4PBOA 1FNYA 2DBIA 4AZZA 2BEOA 4GH4B 5IW0A 2QJVA 5T52A 5A70A 1PGL2 3RJ2X 2GNTA 2WLQA 1PZ8A 1XE0A 3HEIA 5K9YA 5DAVA 2EICA 2HWE1 3RZKA 2ZGKA 2B45X 4PBPA 4CZSA 1W2TA 2D5HA 1PGSA 1UYPA 3D3AA 2VO5A 4MGIE 3IDCB 4IERA 3G7DA 4CXXA 1OH4A 1U5YA 5LW9A 1LOEA 1UNBA 2VQ0A 2XBO1 4IESA 4NMIA 4PT6A 4WZCA 3QBQA 4LQRA 3VBUB 4S2DA 1XNAA 4DS0A 1F2NA 2W2IA 2WT1A 4JDMA 2D6KA 2WFF1 4MHRA 4D6RA 2Y6KA 1ACCA 1UKRA 4NAMA 3J7LA 1KGYA 1MS0A 4C0BA 4A41A 2XQRA 3AVRA 4GAZA 5BY5A 2IC1A 2X5IB 4FQ4A 3AYCA 3BKZA 3K77A 4V1PA 4XF0A 4P9IA 3E6DA 2O1QA 4AQSA 5IYYA 5A1AA 1AR71 2C26A 3AKPA 3WF0A 3LPFA 3ZXFA 1DGRA 2BQPA 5E89A 1FMD3 1JZ3A 1W6QA 2O8OA 3QOPA 1OLQA 3OGGA 2ZHNA 2E31A 3QCWA 4JGZB 1NE4A 1XYPA 2OUHA 5JI9A 4LJHA 2X09A 4ZPIA 4E8CA 3RGBA 1TNRA 2A70A 3LIHA 3UT0A 3FZ3A 2ZGPA 3N7MA 3HN3A 4CRQA 1JW6A 3D0SA 3OD0A 1ZRFA 1HRI1 4XFGA 4XBLA 2VU9A 1GZ9A 3RFRA 5FZ7A 2MHFA 3DECA 2DCJA 4N53B 4QB2A 1H8TA 2JKXA 5HCBA 4XBQA 1SFNA 1PGW1 1RVF1 2RS53 3EQEA 3K48A 4Q8LA 1DZQA 1LOBA 2XL9A 3KF5A 2HWB3 4YVWB 1AR62 4UF0B 2Y8KA 1XNBA 2E9QA 4XFFA 1AR83 1GQPA 4Q4W1 1JYCA 2XB6C 1MQTC 3FL7A 1JOJA 1CIWA 1Q56A 3GALA 2GNBA 5FP8A 3APBA 4LHNA 2PLV2 2A6WA 2JDZA 2QKDA 4CDUC 2UWCA 4FQZA 4LA2A 4OI1A 3VBHA 5ABJC 1Y7BA 4JQTA 3RWNA 4LUKA 1ZBA3 2BGCA 2XVKA 3ZYBA 3GZUC 3R4UA 1EPZA 2ADEA 1DQ2A 4AEMA 5J98B 3ZXLA 2ZXQA 5C8CC 1RC6A 1JZ7A 4E2QA 3PUIA 1RUF3 1G86A 2EA7A 1PK6A 4L0PA 2V72A 3P1IA 1QGLA 2O8QA 4QAWA 5L73A 4FVVA 1AL0G 3FBYA 1FAYA 4Q4Y3 5DG2A 2WNUA 1X7NA 4K6BA 3WF4A 1XSRA 5FY5A 3ALQA 5H9PA 1NA1C 3U78A 1MACA 1V9U1 1FOD1 3ZPYA 5FP7A 5BV6A 1HQNA 1VB4A 1ZRCA 4OQ8A 2Y33A 2W47A 1DIWA 1KXGA 2R30A 4JRLA 2GN3A 3AKQA 3WQ0A 4MYEA 1NCRC 1W6MA 4GMP1 2B7YA 1VMJA 2B5HA 4HPKA 5FUNA 3RI8A 3OEAA 4CCLA 1MS9A 5C33A 3EMRA 1O6UA 3E5XA 3UKNA 3AVSA 4A7ZA 4ES8A 4AXOA 3POWA 5I8TA 1TNFA 1EYBA 4CUCA 2E26A 1UY4A
chains in the Genus database with same CATH topology
1NCQC 2XG3A 1CQ9A 1F8VA 2KA3A 2IXHA 3D5OA 1EAH1 1NXMA 4XFCA 4AQ6A 1CAUB 2CL2A 1QH7A 3WCRA 4P9WA 2XKPA 1VBC2 1ZX5A 1W0PA 2PHFA 4HKWA 4AYUA 3MW4A 2GC1A 3U07A 3AZZA 3VZNA 5C9AC 4HBNA 5F9TA 2DFCA 1CAXA 3PJQA 4INDA 2JKBA 4NHLA 2ZX0A 2IXCA 5JZGB 2ATFA 2VUJA 4YG6A 3FFQA 2ET7A 4YZ4A 3O0XA 3KMHA 4I09A 4MGYE 2EAAA 4WVMB 3ZMOA 5A3LA 4N9IA 4AWDA 3E97A 1CN1A 3OY8A 1LR5A 4XBNA 5HCAA 3ILNA 1VBD2 2E7QA 2VGDA 4S2GA 3WV6A 1SCRA 5BNOB 1OQ1A 1LOFC 2R073 4P9JA 5I91A 2A6ZA 1ZBE2 4F83A 1FV2A 3ZXEA 3AKRA 4CEWA 4N43C 1FV3A 1YFWA 3J8F1 2Q30A 3HD8B 4NWWA 3B9IA 1V6LA 3AP4A 2XVLA 2JG8B 1RUH3 2ZHKA 3ZIXA 1NY71 1S2BA 1N3OA 3AP5A 4XIKA 1KDKA 1PO23 1D2QA 1S0EA 2D93A 1C5IA 1VJ2A 3HT2A 3POYA 5CIRA 1OPOA 1COV2 4L2NA 4AFCA 4B4PA 2ZGLA 3AMQA 2HWD1 1DFQA 2DCZA 1J1TA 2WZR3 4DPNA 1S0CA 2EXIA 4Q1RA 1IGOA 5JIAA 3W59A 1S0IA 3WDUA 1RUD2 2XWBB 2BPA2 1WMDA 5KWRA 2ETEA 3FLTA 2VVEA 4W6XA 4LO6B 4R52A 3IIAA 1PMIA 1QJU2 5FQ0A 1PO11 2HKXA 1R091 1V6JA 2AENA 4BLJA 4N90A 3MFCA 1Y3TA 2PAEA 2DU1A 5DZEA 3M3IA 4D7YA 4WVZA 1GYKA 1C1FA 1FT9A 1R1A1 2PYTA 4PDWC 4P14A 4XILA 5JAXA 3JBG1 2TNFA 2D98A 3AMHA 3RSJA 2XJVA 4Z1VA 3ZFGA 2VW1A 4BLIA 4CDWC 1BK1A 1BQPA 3KCYA 4QGLA 3VDDA 3WQ7A 2XJSA 4IV1C 1RUE3 1LHUA 5L7OB 2XKOA 2JG9C 1RUH1 4KWLA 4O9EA 4YW5A 1UIJA 3WVJA 5CBLA 1LCLA 4ASMB 5C8WA 4Q4X3 3NAPA 4LO4B 2R16A 1ULGA 1QJY1 4F7ZA 4OFGA 3WW2A 4CP2A 2ZMKA 1H1MA 1F31A 1JBCA 2E53A 3SH3A 3ZSMA 3UL2A 2RM23 1YFUA 3SCGA 2HWE2 2WIIB 5DZFA 4LBLA 3FHIB 4AGGA 1EV13 3FBMA 3VBFC 4FOVA 3HAGA 2XJUA 4RL7A 1X8MA 3IKWA 4IEPA 2P17A 1H2LA 2XBO2 2A6XA 4JVAA 1YNAA 4MZUA 5E1RA 3V0AB 1F5FA 2VNRA 4FBFA 3ZFFC 1Q5OA 1VRH1 1IPKA 3PJYA 1HW5A 5A32B 4IEZA 2WFF2 1Z7S1 1WMEA 4YSFA 4AEDC 2X29A 4I3GA 3ZMNA 2IXKA 1O3TA 1FATA 4K1ZA 2FMYA 4R9CA 4G4FA 1ZZCA 4YZ1A 4IV3C 5FOJB 1AR72 3OPZA 5AC91 1YO8A 1PZ9A 2GDFA 3SCHA 2PTMA 3VBRA 2BWAA 4RQPC 3M3QA 5GZDA 4DXZA 3CJIC 1GANA 4K9SA 3M4FA 3NKGA 3T1MA 3VHRA 4D7TA 3VL8A 3OF1A 2C0ZA 1QXJA 1O4YA 2PHRA 4EWAA 2YHJA 2BUKA 3AMNA 3P3PA 1OI6A 4UBGA 1PVC1 4A3XA 2HWF1 4FOQA 1HRI2 1LOAA 1QOTA 4XF3A 1YXWA 4M3CA 4FOYA 2A75A 3MW2A 1QOSA 3AZXA 1AXYA 3ZSEA 4Y24A 3WQ1A 4DY5A 1PGW2 1RVF2 3UK9A 2Q0AA 1UZZA 3USUA 1QJX1 3O0VA 1SLLA 1GQGA 2D5FA 1N1TA 1W6PB 2RS31 5LRSA 4YGBA 1RIRA 2EXHA 4UW6A 1MEC1 1DZRA 1BYHA 2JXAA 4EWDA 1HQWA 3I54A 5FREA 4RS5C 2EXKA 4K21A 3LOBA 3WDYA 5H9RA 1CGPA 5IK5A 1LHOA 1ND3C 1PIV1 1NZCA 3O14A 2ZHMA 4M01A 3WG4A 3AP7A 4YM1A 1V9U2 1LULA 1FOD2 3ZIWA 3QLQA 4KGQA 4C1XA 4CEYB 1AR63 2ZAHA 4PJYA 1X82A 2NP0A 5FRAA 1HIXA 3FJSA 3ZVXA 1OFNA 1X33A 4OI4A 3J26N 1UF2C 2PLV3 1O3SA 4KNCA 1YCIA 1RMU1 4IEQA 1DG6A 4W6YA 3MYXA 3V65A 3ZFEC 5T5OA 4JGYA 3LA3A 4A2UA 1POV0 1EAH2 4ZU5A 1WW5A 5FO7B 2ES3A 1KS5A 4NVPA 3I59B 4BHPA 5SV8A 4RHV1 1CD3G 1HV1A 4SLIA 4C91A 5C4WC 3WP5A 1R081 1ZBA2 4COUA 1C3HA 3KLSA 4M0HA 4I3PA 1AR91 1FYUA 2D3PA 5J37A 3NW4A 2JENA 3E5QA 3PVNA 5JSPA 2WQZC 1VBA1 2DTYA 1LU1A 4Q4Y2 2ZKLA 4YGDA 1SMVA 1U0AA 4SBVA 2XGXA 1XYNA 1HDKA 4FPCA 5AVAA 4ES9A 1RUJ3 4WM7B 3J9SA 4Q0UA 4XEZA 3VBOB 5H9SA 1UIKA 3AFGA 5GM0A 1V6KA 2A6YA 4YG3A 2DURA 4AFDA 3ZN5A 4OUSA 3QH6A 1VBC3 1OOPA 4UW5A 3M3CA 3T1LA 3N4MA 2BNMA 1W2UA 5IK4A 3MLKA 4HN0A 5K0UA 3AZVA 1G9CA 4RA0A 2GH2A 3GF6A 2ZS6B 4CDXB 1KS4A 2D43A 4RSUA 4AK3A 3WG3A 3HR9A 2VH9A 5F6LB 2VULA 2W39A 4FPKA 2ZGUA 2DYCA 4NO4A 3R0RA 5F6KA 1LENA 1N47A 1NY72 1D4M1 4L9BA 2BW8A 5TSWA 4J1XA 1OA2A 3DPRA 3WP4A 3N3HA 5JOYA 4MUVA 4QPGB 4GULA 2TEPA 2A6VA 2HWD2 4YVSA 3H3ZA 2NM1A 3I4IA 4MH0E 3ST7A 1AX0A 4Z8BA 1VBD3 4ZU4A 1YRZA 5EYYA 2Y38A 2YROA 3SNMA 3IT8A 5D1IA 5I93A 4B4RA 4QQOA 2JE9A 1R092 3M3EA 3B94A 3H1MA 4LLOA 1KITA 2OA2A 4RR3B 5GZEA 5GJ6A 1G9FA 2W0XA 3SITA 1GBGA 1GNZA 1SDWA 3BODA 5J7MA 1R1A2 1DU3D 3JBG2 4LBQB 3M7AA 2A3XA 2KXLA 5F5QA 5DDJ1 1NOVA 1H8TC 1DHKB 1COV3 1AHSA 3AKTA 4XJZA 1ENQA 2DUQA 2BYVE 4QMAA 1O4ZA 1RUH2 1JTZX 1Y43B 3LSDA 3QACA 1RUD3 3FUOA 4XTPA 1XRUA 2P3KA 3CO2A 1QJY2 2R0HA 1UZYA 3WUDA 2JECA 1QJU3 1S2KA 2PN5A 3PVBB 3VBHC 1D0GA 3ZDSA 4DINB 3PHMA 3BOWA 2GAUA 5JI7A 2QUOA 1JH5A 3WY6A 4NPRA 1K5MB 4BA6A 5KBFA 4BCUA 1PK6C 2RR11 5I0TA 1OA4A 1N3PA 5KHIA 3FE5A 4Q8KA 4AHWA 2WNUC 4FPYA 4IEUA 3ZO0B 2K2SA 4UBHA 5E16A 1D4VB 3C2UA 4GH4A 3ZN6B 5KC5A 1UMZA 1VRH2 1S0FA 2GSYA 2GC3A 1A8DA 3GBGA 5JCTA 2YZ4A 4K3UA 1QDCA 2ET1A 2VW2A 2ARXA 1WA4A 1OLRA 2H6BA 4NOTA 2JJ6A 4HVQA 3VKLA 5T55A 3MEPA 1WBFA 1BZWA 3BIWE 1RUE2 4JV4A 4YYOA 2G9FA 3VBUA 2WNVB 1VBB1 3AYDA 2HWE3 4YZ2A 5AC92 1UU4A 2I45A 1QJZA 3HQXA 1SQ4A 4YG0A 4XQWA 2B9UA 2HWC1 2A71A 1H2NA 4Z92B 5JOZA 2XBO3 4QQPA 2X5IA 1LTEA 2XHKA 2ZA9A 2R6QA 2RMU1 3WP6A 3VLBB 4TLFA 5D8AB 3NL1A 1UU5A 1PVC2 2WFF3 2HWF2 3NVCA 3AXDA 3TN91 2PHXA 4FTSA 1BJQA 2G4IA 1XQNA 3NSTA 1RHI1 2UURA 2VXRA 3AKSA 1ZZ9A 4JGZA 2IXIA 4CDQB 2CAUA 2B39A 3MIEA 1B09A 4E9KA 4M3CE 1RJ8A 3T2TA 2FMDA 1AR73 4AF9A 1XNKA 1GNHA 3DN7A 2OYZA 2DCTA 2WJSA 1QHDA 3O12A 4XFAA 4Z82A 3ES1A 2RS32 2F4PA 2UYBA 3MW3A 4BWOA 3VBSB 1CJDA 1ASJ1 1MEC2 5CB7A 1AVBA 2ZGMA 4N53A 4URTA 1UKGA 1J3PA 3O5SA 5FPZA 4E4ZA 2OW4A 4YVWA 3WDTA 2BWCA 2CAVA 1MR5A 1POV1 4NR1A 1YJLA 1PIV2 1YIFA 4CEWC 1HRI3 2QDRA 5B2GB 2E6VA 1O7FA 1AYN1 4S2HA 2TBVA 4GQ7A 1RVF3 3WW4A 1SBEA 3LOIA 4JDNA 5IK8A 3UV9A 4XXPA 5EJ3A 3H0OA 5CFDB 3WR0A 4Q4W3 2XLAA 2ZHLA 2ZX2A 2RS11 2BFUL 1SACA 1H30A 2TUNA 2H6CA 3FUQA 1I9RA 1RMU2 4JTNA 1LECA 4MX3A 5AVPA 3AM2A 1Q8SA 3B00A 1OQDA 5GLUA 4U36A 1N1YA 3WG2A 5GZFA 4KWJA 5BNPB 3ZFEB 3IDBB 2W08A 4BYYA 4GKXA 4RHV2 3HIFA 4XZPA 2XLGA 5T54A 4X6QB 4JAAA 4YW1A 2WLPA 1V9U3 1AR92 1FOD3 1QMJA 3TYJA 1DGWX 2GN7A 3VZMA 4AVTA 1VBA2 1YJKA 4GMP3 3ZFGC 5FO9B 3ZXDA 1CAWB 1CAUA 2DFBA 4R9AA 3VDDC 1UX6A 1AL21 4A7YA 4Y26A 2PELA 1CPMA 5ACA1 3GYDA 1UW8A 3B5LB 3WZ1A 1KQRA 2UWBA 4KG0A 3WDXA 3NAPC 4XF9A 5DUWA 1EAH3 3O0WA 4BIFA 4QD2A 1JXNA 4IL7A 4ZXKA 5JZGA 4OHYA 1W0OA 3VUOA 2GC2A 3L2HA 4COVA 1WCDJ 1S55A 3MICA 1V70A 2NLRA 1OMIA 2I07B 5HBAA 2GZWA 3JQXA 3LB9A 2EXJA 3ZX7A 3VV1A 1ULCA 4B8EA 2EF6A 3CEWA 4YARA 2AZ5A 4WVMA 3FC0A 2NN8A 2ZPXA 4AHZA 3S0MA 1DYKA 2Y0IA 1WW4A 3GZTB 4XPVA 2BNOA 4HK9A 1SLAA 4WVVA 3I8TA 5BNOA 5KXEA 4PQ9A 1D4M2 3L9JT 5BNNB 4NHKA 5FMOL 3VN4A 1PZ7A 5CNAA 2WNEA 2DV9A 4XJ8A 3AB0A 3WLUA 2ZKNA 2AREA 5DXDA 1DGRN 3VBRC 4CYDA 2JG8A 1WW7A 4Q0VA 1B35B 1AYM1 1DGWA 5EWSA 1BXHA 3RG0A 1LB2A 2IWGB 4Q27A 3J8F3 1EY2A 3NV1A 3BCWA 2R0FA 5CADA 2NMNA 1CPNA 4FXGB 4HVOA 4XF1A 4FPLA 4GB33 4QPYA 1WCSA 3KGZA 3MIGA 4EN7B 1ZYBA 2B46X 2PAKA 1IHMA 4KQ7A 5DDJ2 5E8AA 1C1LA 1YFYA 2IXJA 5A3MA 4PLOA 4WVWA 4HT1T 1ENSA 2HWD3 3RI9A 3GBWA 3WW3A 4ZU7A 2BVVA 5T50A 2ZX1A 4AHXA 4MVTA 3ILRA 1RJ7A 1V6MA 2MEV1 2ZGQA 4AQ2A 1ZRRA 5FLHA 4HVRA 3R4DB 1FPN1 1PO13 1Q8OA 3VGIA 1R093 1Q43A 2ZMLA 3MF6A 2R1DA 1XNCA 4Q0QA 1GKBA 5L7OA 2D6OX 2XLFA 4FP2A 1R1A3 2F6BA 2RR12 3V56A 2XWJB 1REEA 3JBG3 1WD3A 1TEIA 2WA3A 1F5JA 3ACLA 3OYWB 4D94A 4YFZA 1FNZA 2UYAA 5EYXA 1BVP1 4Q29A 3TB0A 3WUCA 3JU9A 4BH9A 1YIPA 2EVXA 4WM8B 1N3QA 3S7IA 1IKPA 4AW7A 4GB31 4Q0PA 4Z07A 3KCCA 1RUOA 1H9PA 1UCXA 5IT6A 4IETA 4KGGA 1QJY3 1GQHA 2ZABA 3V0AA 1RUI1 1LHVA 1A78A 4JGYC 2R1BA 1VBB2 3KD4A 2AYHA 1ZZ6A 5A32A 4KU8A 1MS5A 3WW1A 1LHWA 1KFXL 3CL1A 1APNA 2HWC2 5DZGA 2HYKA 2VOWA 1KJLA 2A3YA 2OZJA 1QWRA 5BXXA 4MXWB 4QQ2A 1YYNA 2RMU2 3RPQA 3D0JA 1VRH3 4HZFA 1FX5A 1ND2B 3D82A 3THPA 1Z7S3 4B7KA 3TN92 3UJOA 3VHNA 3VHOA 1LESA 1RHI2 4E27A 3NO8A 4HK8A 2V5YA 4EN6B 4QXKA 4Y1ZA 4HLTA 5A33B 1I3HA 2EIGA 4FPOB 1OKQA 3WD5A 4HN1A 1R1ZA 3S6PA 5AC93 3W58A 5CFCB 2G9GA 3RYKA 1KDMA 5GZGA 4FP3A 4QPIB 2Y26A 5C6CA 1ASJ2 1AXZA 1JYIA 1QXRA 1G6NA 1OOPC 4LBJA 3GNEA 1JUHA 4LO5B 1MZ5A 1IS5A 3D4KA 4H3WA 4TSVA 5CVRA 2GH8A 5K0UC 3H1YA 1TQ5A 4KU7A 3KM5A 1PVC3 1H2MA 2HWF3 4CTEA 1ALYA 1W6PA 3I2DA 3OBRA 4YW2A 1AYN2 1U5IA 1DQ5A 4XXAA 5T5LA 1QJX3 3MPPG 3H50A 4AVCA 4AVVA 1UU6A 2DVDA 3DPRC 3A0KA 1QQP1 2RS12 5EXOA 1Q8QA 5GLVA 2RS33 3H7YA 5JDBA 4DB5A 4YVSC 3TBDA 5HI0A 5KXBA 1MEC3 4OHZA 1G9BA 2Q8OA 2DUPA 5IUQA 2I2SA 4P9LA 1S0DA 4CEYA 2NQYA 5K8SA 5H9QA 4L92A 4META 4RFT0 4AGVA 1PIV3 2FZ1A 1HRV1 3FMGA 1SEFA 4M3CF 1SFYA 5AFBA 4JDOA 1LJ7A 4XIOA 2GU9A 4F8AA 3TWIA 3TOJA 4GXLA 1JN2P 2VQAA 3DUIA 4OUMA 5GLTA 1HXS1 4EV0A 1DZTA 5I0UA 1GZWB 3I59A 2QCSB 4YW3A 4YZ5A 2FZ2A 3N7KA 1AL22 1ENXA 5ACA2 2ENRA 1RMU3 3IDEA 1IKQA 3SH5A 4AQTA 4PLMA 4Q4W2 4QU2A 2CGPA 2H0VA 2YY1A 2EALA 3D8CA 4OI0A 3ES4A 3GZAA 4HMZA 4LLFA 4RHV3 1Q8PA 1MQTB 1V6NA 1VR3A 1ZREA 1R083 3AXEA 4Q1PA 1AR93 1LHNA 1C57A 3M3OA 2D3SA 1LRHA 1NG0A 4WM7A 4CDUB 3H7JA 5FDBA 5ABJB 1TMF1 3VBOA 1EPWA 1VBA3 4I02A 4GH4C 5LEJA 1CR7A 2NPIA 1LGBA 2ZBJA 1LKNA 1S0GA 1M06G 2FBEA 5DUVA 5C8CB 1W6NB 3JQWA 4E4DX 3E6BA 4JQRA 5KXDA 4D7SA 2CTVA 4YFWA 1J58A 3R6SA 1GICA 1ENRA 1NA1B 3G6JB 3V0BB 1XE8A 3PVEA 3CF6E 1N1SA 2R063 4XFIA 1ZVFA 4CDXA 1LOCA 1C8M1 1NCRB 1SLIA 3IPVB 3RS6A 4GWNA 4FXKB 3JCIA 3VBUC 3ZXJA 3RRDA 3USSA 3MIDA 2DU0A 1O91A 1CVNA 5J48A 5FPXA 2X8KA 3SXWA 4KBBA 1YFXA 4JTOA 3M8LA 2X5IC 1AYM2 1NCQB 2VNOA 4QPGA 2ZX4A 3ME2A 2D3RA 3PMEA 2P3IA 4AG4A 3EHKA 2MPFA 1RUG1 4LBNA 1NXD1 2UY8A 1VAVA 5FAXA 4AEJA 1DGLA 5JSRA 4B7EA 3N36A 1D4M3 3L2YA 4KL1A 1GLHA 4JGZC 3ZYIB 4COZA 4DFSA 1A6CA 1QH6A 4BIOA 3OJBA 1LGNA 1QF3A 4RR3A 4M0NA 3GHNA 3AMPA 5C9AB 3H1WA 5EZWA 3AYEA 3JB4C 2MEV2 4Q4V1 4LBQA 1VBE1 3BU7A 2R061 3ASIA 4LE3A 3ZN4A 4FPHA 1FPN2 4N53C 5FCCA 4Y5Z0 4YZ3A 1RUC1 1H9WA 1A3KA 4QM8A 2XJRA 4YVWC 5CG8A 2WWSA 1WBLA 1QXPA 5I0RA 1C4RA 1SLCA 1V6OA 2ERFA 4XJUA 5F1RA 1W39A 4Q2FA 2C1FA 5BNQA 2A3WA 4K20A 2E51A 2DVAA 1H2KA 4DRVA 4HANA 4ZKTB 5DDJ3 4L8QA 4AE2A 3KZ4C 4EROA 3J8F2 1O3QA 3NV4A 3W9AA 1DF0A 3SMHA 4ORFA 1KFUL 3GBFA 1K5MA 4OHVA 4E4SA 4N43B 1GSLA 1RUNA 4GB32 5CU1A 4ISRA 3FLRA 1SCSA 1CJPA 1UL9A 2ZGOA 4COYA 1W6OB 1RUI2 4HKOA 1MZEA 4GWMA 3ZN6A 4D69A 4DRRA 3FWEA 1D2SA 4ITCA 4AI1A 4LNVA 4QGNA 1U5ZA 3AZWA 4Q26A 4BMBA 4NHMA 2RR13 5FOBB 4R4XA 4H55A 2OUJA 4UW4A 4XHBA 1PO12 4PLNA 4XJWA 1FI2A 1GR3A 1OSGA 1CONA 1ZZ8A 2CWSA 2WNVA 1V6IA 3Q9OA 4MLOA 1WW6A 3MGUA 4PDWB 1AUYA 2E7TA 3BTAA 5JPNB 3ZXKA 3B93A 4YM3A 1YWKA 2A7AA 2VMGA 3RQ0A 5E88A 1VBB3 5D8AA 2BTVC 4CDWB 2AUYA 4ONUA 4IV1B 2XJQA 3RZZA 3SISA 1AJKA 3RMXA 1QY4A 2HWC3 2JG9B 5KHKA 5JZGC 1UN1A 2PA7A 4CDQA 1QNWA 4AVBA 3X29B 2CY6A 2RMU3 1IQAA 2WA4A 5KHJA 2Q1ZB 4BM8A 5L19A 2P34A 2W68A 2BNNA 3B9CA 1O5LA 4LHKA 4AI8A 2VVFA 3TN93 4Y22B 3V64A 1RHI3 4YLZA 3VBSA 2JX9A 1ZZ7A 5BNOC 3VBFB 3LGRA 4N7UA 3SCFA 1F9KA 1QOOA 1Z7S2 1IPJA 3OBTA 2Q1MA 1QQP2 2LTNA 4QQHA 3LCPA 4BZ4A 3ZFFB 4X8PA 2WS91 3ZYJB 5I0SA 1ASJ3 1TME1 2NYYA 3ZSKA 3WCSA 1ZBE1 1NLSA 4AEDB 4LBOA 1ONAA 1Q3EA 5LK5A 3WG1A 2JG8C 1GZCA 4GALA 4QX5A 4U