1QQP2

Foot-and-mouth disease virus/ oligosaccharide receptor complex.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
216
Chain Sequence
DKKTTTLLEDRILTTRNGHTTSTTQSSVGVTYGYATAEDFVSGPNTSGLETRVVQAERFFKTHLFDWVTSDSFGRCHLLELPTDHKGVYGSLTDSYAYMRNGWDVEVTAVGNQFNGGCLLVAMVPELCSIQKRELYQLTLFPHQFINPRTNMTAHITVPFVGVNRYDQYKVHKPWTLVVMVVAPLTVNTEGAPQIKVYANIAPTNVHVAGEFPSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GENOME POLYPROTEIN)
publication title The structure and function of a foot-and-mouth disease virus-oligosaccharide receptor complex.
pubmed doi rcsb
molecule tags Virus
total genus 43
structure length 216
sequence length 218
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qqp200
1R092 4RHV3 1RUJ1 4CEYB 5DDJ1 1AYN3 2FZ2A 1QJY3 4JGZA 4WM7A 4GMP0 1GFF2 4CDUC 1V9U1 5D8AA 2RMU1 3VBUC 1VRH1 5BNPB 2Y26A 2HWD2 2IZWA 1POV3 3ZFFA 5L7OC 1RUJ2 1RB8G 5AC92 1NY71 2R042 5DDJ2 2RS51 4GB32 4Q4W3 2WFF2 4QPIA 1EV12 1FPN3 1ND2C 1DDLA 1FMD1 1VBC1 3JBG3 1FOD1 4N43A 4AEDC 4QPGB 3VBSA 3ZFGC 4CDQA 5K0UB 5C8CA 1MQTB 5J98B 4WM8B 1VBB1 1BEV1 5C9AB 1QJU3 5FOJB 1A6CA 4RS5B 4CEYC 1AR91 1FMD2 1VBC2 2RM22 1HRI1 1HRV3 1ZBE1 1PVC3 3CJIB 4IV1B 5BNPC 4Q4X3 1ZBA3 1Z7S2 2PLV1 2BFUL 5CFDB 1EAH1 1VBB2 4RQPB 1OOPB 2R061 2WZR2 1RUG3 4CDWB 1AYM1 4IV3A 3ZFEA 3VBOB 1RMU2 2RS12 2XBO3 1W39A 2RR11 5FMOS 3VBHA 1HRI2 4PDWB 4CEWA 1D4M3 4GMP1 4CDXB 3IDEA 4RFT0 2WS91 1RUI3 4Y4YA 1EAH2 1PO11 3TN92 1AR83 2R062 4QPGC 1PO23 5K0UC 2X5IA 4Q4Y1 1MQTC 1AL21 4WM8C 1RUD3 2RS31 4Q4V1 5C9AC 1H8TA 4JGYB 1RVF3 1R082 4RS5C 1RUH1 2R071 1TMF1 1AR71 2HWF3 2HWC2 1PO12 1TME2 3CJIC 1PIV3 4IV1C 3VBRA 1SMVA 1R091 5CFDC 1ND2A 4RQPC 1OOPC 2RS32 4CDWC 3VBOC 5GKAC 1COV2 1IHMA 1NG0A 1V9U3 1VB2A 3J8F3 2WWSA 2RMU3 1VAKA 1PGW1 1VRH3 3VDDB 1BMV2 1K5MB 4PDWC 1QQP1 1POV0 4Z92B 1C8M1 4RR3B 1QJZA 4CDXC 5JZGB 2HWD1 5BNNA 1RUF1 3JB4C 3VBFB 1MEC3 2RS53 5AC91 1BBT3 2R041 5C4WA 1R1A3 2HWE2 4N53A 4GB31 2WFF1 1EV11 4YVWB 3DPRB 4JGYC 1PGW2 5BNOB 1QJX2 1QQP2 1HXS3 1FOD3 1NCRA 1OPOA 1C8M2 5CFCB 1PGL1 3HAGA 4GH4A 5ACA1 5ABJB 1RUF2 3JD72 2MEV2 1B35B 1VBD3 1BEV3 3M8LA 1NA1A 1AR93 4Y5Z0 2HWB3 1VBA1 1PGL2 4JGZB 2RM21 4WM7B 1ZBE3 5ACA2 1VBE1 1NCQA 3VDDC 1K5MC 1RUE3 4RR3C 1E57A 1ASJ2 2PLV3 5JZGC 1Z7S1 1AYM3 3ZFFB 1AR63 3NAPA 2WZR1 3VBFC 1ND3A 2RR13 1AYN1 4YVSA 1QJY1 1RMU1 2RS11 1AL0G 1VBA2 4QPIB 4YVWC 3DPRC 5BNOC 1VBE2 2WS93 5CFCC 1RUC3 1PO13 5ABJC 5FMOL 5A33A 2VQ0A 4RHV2 4N43B 3TN91 4Q4Y3 1B35C 1AL23 3VBSB 4CDQB 1RHI3 4Q4V3 5C8CB 1AYN2 1QJY2 1RUH3 2R073 1R081 1TMF3 1X33A 1CJDA 1AR73 5A32A 4JGZC 4WM7C 2HWC1 1HX6A 1TME1 1R093 4CDUA 2DF7A 3ZFFC 3VBUA 1QJU1 4Q4W2 2ZTNA 4IV3B 1FPN2 3ZFEB 3FBMA 1NOVA 1COV1 5L7OA 3JBG2 4QPIC 3VBHB 1BMV1 1HRV1 4CEWB 1PVC1 2HWD3 4Q4X1 1RUJ3 4N43C 5AC93 1QJU2 2R043 3VBSC 5DDJ3 4FTBA 2XPJA 4CDQC 4GB33 2WFF3 2X5IB 1EV13 5C8CC 2HWE1 2XBO1 2TBVA 4AEDA 3ZXAC 3ZFGA 1H8TB 1QJX1 1D4M1 1HRV2 1PVC2 1RUI1 4Q4X2 1ZBA2 1F8VA 1M06G 3JD71 4CEYA 2BBVA 2MEV1 1RUG2 3VBRB 1ND2B 2XBO2 1RVF1 4IV3C 3ZFEC 5BNPA 4FSJA 1D4M2 1FMD3 1VBC3 2RM23 1VB4A 1RUI2 2HWF1 4BCUA 4CEWC 1AR82 1ASJ1 1PIV1 1Z7S3 1VBB3 1PO22 2WZR3 2WLPA 5BNNB 1RUD2 1RMU3 1RVF2 2RS13 1WCDJ 2X5IC 3J8F1 4NWVA 5C4WB 1HRI3 4N53B 3S6PA 4QPGA 2HWF2 1H8TC 5D8AB 5K0UA 1OHFA 1MQTA 1NCRB 4WM8A 1PIV2 4EJRA 1EAH3 4GH4B 3TN93 5C9AA 2R063 4RHV1 4RS5A 1MEC1 2ZZQA 3VBRC 1BBT1 5LK7B 1R1A1 3J8F2 1V9U2 1R083 2RMU2 1NA1B 3CJIA 1VRH2 4IV1A 4GMP3 1HXS1 4FTEA 5CFDA 2HWC3 4RQPA 1OOPA 1TME3 4CDWA 1POV1 1NCQB 3VBOA 1MEC2 1NY72 1VBD1 2BUKA 2RS33 2RS52 1BBT2 4PDWA 1R1A2 5BNNC 3NAPB 4Q4W1 4SBVA 1COV3 1FPN1 4CDXA 2HWB1 1HXS2 1FOD2 1ND3B 4YVSB 5C4WC 3JBG1 4N53C 1RUE1 5D8AC 2ZAHA 2BPA2 1NCRC 1VBD2 1BEV2 4GH4C 4JGYA 1AR61 5A33B 1HQNA 4FTSA 4NWWA 1CD3G 1AR92 2HWE3 2HWB2 2BFUS 1QJX3 1QQP3 1ZBE2 1C8M3 1NA1C 1AUYA 1RUE2 1RUC1 2PLV2 1RUF3 5A32B 3JD73 1ZBA1 2MEV3 1AYM2 1NCQC 1AR62 2QQPA 1RUG1 1RHI1 1X36A 4LLFA 3JB8A 4CDUB 2RR12 3VDDA 1K5MA 3NAPC 3VBUB 4RR3A 5J96B 5JZGA 2WS92 1ND3C 5ACA3 4YVSC 1RUC2 5L7OB 3VBFA 1ASJ3 2GH8A 1AR81 4Q4Y2 1AL22 1PO21 1RHI2 4Q4V2 4YVWA 3DPRA 5BNOA 1RUD1 3LOBA 1RUH2 5CFCA 2R072 1VBA3 1TMF2 5ABJA 2FZ1A 1AR72 1VBE3 1C8NA 2GSYA 1B35A 4AEDB 3VBHC 1F2NA 3ZFGB
chains in the Genus database with same CATH superfamily
1VRBA 2JICA 4RHV3 2FDIA 3O1OA 4EN6B 3IZOA 4IGQA 4XXAA 1H2LA 1UY4A 2GNBA 4BQXA 4ZU5A 3PDQA 2FZ2A 3T0AA 3WLUA 5CU1A 1ST8A 3AYEA 5C5UA 2QBXA 3KV5A 1ZA7A 3W21A 2A70A 2Z5WA 3ZN5A 2RMU1 3PTRB 1V70A 3MFAA 3HN3A 3O12A 1JOBA 3KCYA 3KF5A 1YYNA 3AJZA 2HWD2 3H3UA 1ZREA 2IC1A 1UKGA 4NVPA 1EPZA 1RUJ2 1UOBA 2Z79A 3RJ2X 3C2UA 3EXUA 1UYXA 1G6NA 4DB5A 4OHWA 3NV2A 1NY71 2ZHMA 3BI3A 3MLJA 1DLLA 4Q4W3 2WFF2 5DUVA 4UFLA 4ARYA 5JXGA 5GLWA 4NIDA 1FPN3 4NIGA 3RGBA 3RS6A 1SDDB 3I59B 4PLOA 5B4XA 3QH7A 3AM2A 1NUKA 3P3PA 4OUEA 5JMOA 1HB3A 1RC6A 3WNLA 5KHIA 4LBKA 4QXKA 4W6XA 1W8WA 2NQYA 4TN7A 1DQ5A 5FY9A 3ZFGC 4DUWA 2NN8A 5J98B 5HV0A 3HNYM 1BEV1 3U1XA 1JN2P 1MVQA 1QJU3 2WNVB 2EICA 2K2SA 3KS7A 1NQJA 2WWUA 4AQTA 1A6CA 4YWAA 4COUA 3H8UA 4IEQA 1NE4A 1T2XA 3PUIA 4YM0A 1CWPA 1H6YA 3UV9A 4XFIA 2OUHA 2RM22 3MLKA 4YGBA 1HRI1 1DZRA 5EZWA 5A3OA 1HRV3 3PU3A 2GC3A 3K4DA 3WDUA 3ME2A 2PHUA 3CJIB 5SV8A 5FO7B 4LT5A 3GZEA 4IUGA 1Q8SA 4CCKA 1IS4A 1ZBA3 5IVYA 5F1RA 4G4FA 5I0SA 2JIGA 1VBB2 2GP5A 4B1MA 1KD7A 1CQ9A 4BLIA 3WDXA 4BQ3A 1AYM1 4IV3A 3MF6A 3M1HA 4IDZA 3ZFEA 1RUOA 1KRIA 2WSUA 2XLAA 1AJKA 2XJPA 5JXIA 3N7MA 3J7HA 4XAEA 5FMOS 4XZUG 4K20A 3Q8CA 2Y0IA 4Q0PA 4KMQA 1N3OA 3ZIXA 4PI0A 2NPIA 2HYKA 2VUDA 2Y64A 3PL0A 1WCQA 5IK7A 4A3ZA 5FZIA 4RFT0 2J1VA 2C0ZA 2WS91 1RUI3 1FYUA 3AZXA 1SCRA 4YZ3A 1PO11 2R062 2PHFA 4UOJA 3LAGA 2VECA 3VZOA 2E6VA 4LO5B 1CIYA 2K46A 1G86A 2OW4A 2E53A 2HLEA 3QH6A 4AVVA 5EIYB 4IETA 1TQ5A 2EF6A 3VL8A 2WNVC 4KH9A 4L97A 4JGYB 1RVF3 3RYPA 2VUJA 2BYVE 1XU1A 1B09A 3KD4A 3ITQA 1KFXL 5E89A 4OHXA 3CJXA 2EIBA 2XQXA 3OUHA 4LKSA 3MZHA 3LD8A 3WW4A 3VKLA 2DU1A 4BJ0A 2XLFA 3W59A 2ZHLA 2VD7A 1PIV3 3CJIC 4FFFA 3SH5A 1WCSA 2BRTA 4KGGA 4AK3A 2ARBA 1XPWA 5DZGA 4XC9A 4NIHA 4CCDA 1HIXA 3HVDA 5GKAC 5F3IA 1IHMA 1NG0A 3J8F3 4R4XA 2BOIA 3DECA 2ADDA 1OC1A 2RMU3 1JZ3A 1C57A 2CAUA 4XF9A 1K5MB 3ASIA 3KF3A 1BMV2 3T2OA 2JD4A 5FZDA 4Z92B 3QBQA 1DIWA 5DAVA 5JLVA 1ZNPA 5FO8B 3OB8A 4LA2A 4JV4A 4RFRB 2ZPXA 2B45X 3K51A 2EIDA 1W0OA 1DG6A 4CP9A 1W3VA 3NRUA 4NHLA 5T5JA 4RGGA 4UI9L 5C70A 1R1A3 1JUHA 2E51A 2HWE2 3BGAA 1REEA 3QACA 1LOEA 3WT3A 4YVWB 5HPOA 2Y60A 3DPRB 4JGYC 4U36A 1DF0A 1G9CA 1URXA 5L9BA 1JS9A 2GDFA 3B9IA 3J7MA 3ZMNA 5JAXA 4D7YA 4IE6A 4MGIE 1IKPA 1G9FA 3I54A 2VMCA 3IDAA 3KGZA 3LDBA 5DAQA 5KHGA 2Q0AA 4RGAA 3R4DB 1ZRCA 1B35B 1GQGA 1BEV3 2XJSA 2K9ZA 3UJQA 1GLHA 1YI7A 4Q0VA 4C1WA 1U0AA 1XXNA 4N7IA 1APNA 1NLRA 1F4AA 1AHSA 2VQAA 5HXVA 4XETA 2XKOA 5FMDA 3K2OA 5B4NA 5LK5A 4GWJA 2W92A 4B7EA 1GNHA 1PHMA 3ETPA 1BCXA 1K5MC 3HIFA 3R05A 1HN0A 3ZXEA 2YUEA 2HEYF 2UYBA 3PTYA 3U10A 1TE1B 4F7ZA 3JCIA 1E57A 5FZ1A 3DV8A 3N9OA 4A3XA 3I2KA 3OYWA 1P8JA 3PJQA 1Z7S1 1AYM3 5C7GA 4UT5A 3NAPA 1M4WA 3O0VA 3F95A 4M01A 2VG9A 4MHUA 5JSPA 3FLPA 1CN1A 1QY4A 4HN0A 4A45A 1PNGA 3KCXA 5JIAA 2QJVA 2ID4A 5JOYA 1G9AA 3LSDA 4JZRA 4K6BA 2RS11 1VBA2 2FHRA 4JTNA 5L9RA 4B4PA 4BQWA 3AZWA 4QPIB 4YVWC 3DPRC 2O8QA 4M3CA 1UX7A 1QH7A 2WS93 2BNOA 3AYAA 1C1LA 1RUC3 3IWZA 5BPXA 4XZPA 1GP6A 2VUAA 1GZTA 3AX4A 1PO13 1UZVA 4QX2A 5IK5A 4DXZA 5DAPA 1F5FA 5FMOL 2VMDA 3MV11 3ACFA 1C4RA 5EYXA 1B35C 2HKXA 1O4YA 2JJ6A 1TEIA 2VJXA 4N90A 3UJOA 4AEMA 4CDQB 2VZRA 1KGYA 1AYN2 4KU8A 2A5ZA 1QJY2 2VULA 3AYDA 1W6OA 3BALA 3DXUA 4LNVA 4HZFA 4FAHA 2A7AA 1UYPA 2R6QA 2ZXQA 5LEJA 1R081 2E33A 4LBQB 3N36A 3POYA 3NV3A 5FXXA 5C3RA 1CJDA 3HBZA 3WP5A 4LE3A 1E5IA 5JSOA 3KLSA 3IB3A 1CR7A 2Q5TA 5HCAA 2BOJA 2QQOA 4PIXA 4LKEA 1JOPA 1GZCA 2BERA 3DYMA 1N1SA 4M00A 4QXHA 3TB0A 1LHNA 1VE0A 1OA4A 2VCBA 3BB6A 3Q8BA 3FMGA 2GALA 3PLQA 5C3OA 2DF7A 3MYXA 3D5OA 1Y4WA 1ULOA 2YGMA 1OT5A 3ENRA 4QQPA 2JG9B 3ZXJA 1S0DA 4COVA 4E9KA 1JODA 1LECA 3AXDA 3NNLA 3NJVA 1BHGA 3FBMA 3ES1A 4YW2A 3GJBA 3VL9A 4BH9A 1OH3A 4M0HA 3JBG2 3KV9A 2WL1A 1LEMA 4E4ZA 4QPIC 2JENA 3VZJA 4EWEA 3VHNA 5IVVA 2VMHA 1W6PB 1F4HA 3WHTA 1CZVA 2W3JA 4FP2A 4HPKA 4P9JA 3SEEA 1JYCA 3GDBA 1UY2A 3WQ7A 4QM8A 1OA2A 2A3WA 2ARAA 5EJZB 4R9BA 3T2QA 3HD8B 1XQNA 2B39A 3OBRA 5DDJ3 4CDQC 2XPJA 2JXAA 1W2NA 3CLPA 3W5MA 2WYSA 5KBFA 2QQWA 4GKYA 2ZX1A 4LHKA 3ZFGA 4NHMA 4CCMA 1QJX1 5FR3A 1D4M1 2FMYA 2FQPA 4HKOA 2QQIA 1PVC2 4OQ8A 2DVGA 5EYYA 3WD5A 2BBVA 2MEV1 4HL0A 1LOFC 1J3RA 2NZ9A 3POFA 4YG6A 1JH5A 5D1IA 4EN7B 2QQMA 4CUBA 4LBQD 1LR5A 5GZGA 1W8HA 4JX0A 5LY1A 2XBO2 2JG9C 1JI6A 4XMAA 2C24A 4HONA 4FSJA 1Y3TA 3ILFA 1RL3A 1N47A 4D94A 3DF0A 4Z82A 3MGUA 4AI3A 3B00A 3RDIA 1QEXA 1AZDA 3NVCA 4BCUA 5IAXA 2D43A 4J25A 1VLNA 1ULCA 2RDRA 2VY0A 2D44A 1Z7S3 4D6SA 3PURA 5FK8A 3ZYBA 4ZKTB 4KBZA 3J7NA 3NJYA 5BNNB 1RUD2 3I59A 1LJ7A 1O91A 5I8SA 3LZZA 5FFOC 3TNPB 2RS13 5FPZA 1UMHA 4OUSA 4HSJA 4IEPA 3IMNA 4NWVA 5C4WB 1W2OA 5FZ9A 3C3VA 4N53B 2Z2SB 3DYOA 3LEMA 1ZRDA 5JUVA 2HWF2 1SCSA 1ENRA 3CDZB 1H1MA 4LKFA 3LEKA 1YIFA 2J7MA 4EQVA 2DWRA 2UU8A 1EAH3 3ZM8A 2WNVA 4I01A 1WMXA 5F6LB 5F8PA 5FZKA 4QX3A 5A6ZA 3ZMOA 2CTVA 1AX1A 1W9WA 5CG8A 4Z07A 2QDNA 5H9QA 1LOCA 1XE8A 4W6WA 2BQPA 1R64A 1D2SA 1HV1A 3M70A 3N9NA 4H2AA 4JDNA 3W9AA 1V9U2 1R083 2IFWA 2WSVA 4JAAA 4W8JA 4YG0A 1WUVA 4OULA 1W8ZA 3SQOA 4HBNA 1NA1B 3EO6A 2O8OA 1O5LA 3CJIA 5A7PA 2QVSB 4GMP3 2GMMA 2QFEA 5FUIA 4E2SA 2VCCA 3H3ZA 4QGLA 1UWWA 4HSLA 1X8EA 5C3SA 3LDRA 2XVLA 1YFUA 2YC2A 1POV1 1NCQB 2VXJA 3PIJA 4BM8A 1HQLA 5K4LA 5IT6A 1JTZX 1MEC2 4FPEA 4HOOA 4LITA 5GM0A 5CISA 3O1PA 1LODA 1WMFA 2GC1A 5FYVA 2RS52 3J9SA 2Y8KA 3ZSLA 1BBT2 5ISLA 1OPMA 5BNNC 4GQ7A 2IUWA 4SBVA 3MPPG 3RVHA 2OKXA 1CPNA 1HXS2 1OMIA 1TNRA 4YVSB 5C4WC 5LW9A 2WZPP 2DUQA 4N53C 3WG2A 1SEFA 4XUTA 1RUE1 1OBNA 2WO1A 2AACA 2BPA2 2NP0A 3T4VA 1XSRA 2VVDA 1DQ2A 1RIRA 4IEZA 3K77A 2VO5A 3VN4A 4JGYA 4GKXA 4FTSA 3WCSA 5EP9A 2WR9A 2WUHA 1UMZA 4Q0SA 4COYA 3PUQA 4XOGA 3LFMA 2WO7A 1O3RA 3JU9A 4RYDA 1QJX3 2PHLA 3B94A 1QQP3 3GHNA 4CSWA 2CAVA 1C8M3 1GWLA 1AUYA 1NA1C 1PK6B 2KD7A 4TZDA 4W65A 3USUB 4E4HA 3GCWA 4EZHA 2WZ8A 1O6UA 1J3QA 1RJ7A 2W9XA 4OHZA 2MEV3 4YLZA 1W8TA 1NCQC 3N7LA 2AUYA 4JC1A 4PJYA 1OQDA 5FZLA 1RUG1 2DCZA 1GBGA 1RHI1 1X36A 3U07A 3ZR5A 2EXJA 2EAAA 1K5MA 2CGNA 5CB7A 4ATFA 4QHOA 3AK0A 4EZ4A 2PN5A 3WP3A 1W90A 1LOGA 2ZHNA 2GAUA 4C0HA 2DCTA 5HV4A 3PUAA 4AFAA 4YVSC 3TAYA 4ATEA 3HNMA 3RPQA 1YIPA 2G9FA 4S2FA 1SLBA 1LHOA 1X8MA 2JB4A 2PAKA 3POWA 4INDA 2ZGNA 1AR81 3EQEA 4UFKA 4DRVA 4LEJA 3H50A 4Q4Y2 3ZR6A 2ET7A 1PO21 3FBYA 2FD8A 4YVWA 1SFYA 3DPRA 5FYBA 3WW1A 2D40A 4CCJA 2ZABA 4AWDA 4FPFA 3LOBA 4K8RB 1RUH2 1US2A 2QNKA 1NE6A 2R072 2YZ4A 4K3UA 1T6BX 1TMF2 4O7XA 1SQ4A 5FZFA 1LKNA 1AR72 3APBA 5IHRA 2DFBA 1VBE3 3CF6E 4MHRA 2VXRA 3URFA 1B35A 1S2KA 3BIEA 2JDPA 1G9DA 1F2NA 1Q3EA 1PK6C 2LALA 5F3GA 4CP2A 1FV2A 4AQ2A 5CKNA 3EHKA 2V73A 4AE2A 2D6LX 4S2GA 2WQ8A 1RUJ1 1OLME 2LROA 2VTXJ 2CGOA 1SBEA 2EXIA 1OF3A 1GR3A 1H4GA 4PLNA 4Q2FA 4YZ4A 5T52A 4Q8KA 5DZFA 4HXCA 1XE7A 5GALA 1S0JA 2YGLA 4GMP0 1E5RA 4Y20B 2VQTA 1PVXA 2ZGQA 4MGZE 3BTYA 1HQWA 1VRH1 2XUEA 2DYCA 3MW2A 4COZA 5KHJA 2HBUA 1NT0A 3CBNA 3BKZA 2IZWA 2VTXA 1POV3 4CP0A 5FZ4A 4XE9A 3OSDA 3RQ0A 4PF1A 1RB8G 4MXWB 3C7GA 3UKVA 2H0VA 4XTPA 5DABA 4AI2A 5AC92 3AP5A 2R042 2KR2A 5JOXA 3CZJA 3I2OA 5CYYA 4GB32 4QPIA 4WVMB 1EV12 2VNOA 1DZTA 1JHJA 4LIVA 4BQ5A 3N4MA 4TSVA 5LA1A 1DDLA 4XJZA 1OQEA 4LBJA 2A6WA 1MS3A 1A3KA 1BVVA 2JE9A 5DG1A 2W1UA 3KQ4B 1CAWB 1W2UA 2DUOA 2JDNA 2WIIB 5KC5A 4QPGB 1JU4A 3THCA 5JVVA 3ZXDA 4CDQA 4QX1A 5FYMA 2JD9A 4MVTA 5K0UB 5JI9A 5JPNB 1MQTB 2A3XA 3OUJA 4ONUA 4WM8B 1VBB1 3OF1A 2X05A 2VOVA 3ZXKA 2GMPA 3V0BB 4QM9A 2NM1A 4LBQA 4FOWA 4RS5B 2JEMA 4QHBA 2AENA 1RTVA 4A42A 4YNIA 2W1WA 1FMD2 1WBFA 1VBC2 2GMEA 5IJRA 3CEWA 3WSOA 4NIIA 4XXPA 3ZXLA 1LOFA 4AFBA 3ZKYA 2YHJA 2E26A 4Q4X3 2QQKA 4JKLA 3P3NA 4LXLA 5FYSA 4RQPB 1OOPB 2R061 4DS0A 2JG9A 1RUG3 2JDUA 2A73B 1UU5A 1W6QB 3NNMA 5FYIA 3OEBA 1N3QA 2B42B 4YM1A 5EPAA 4BXFA 2RDQA 4IL7A 2D5HA 1UL9A 1D4VB 4AHYA 1SBDA 4X6RB 5FYZA 1Q8QA 1W6PA 4CDXB 3K48A 4AHZA 4CCLA 2RG4A 4PQ9A 4Y4YA 4LKDA 4M4PA 5FYYA 1UOFA 2W0XA 2YY1A 1ZZ7A 1NAEA 1AR83 2QE3A 3DKQA 3TN92 4QPGC 5I8YA 2VVFA 4XCAA 3WP4A 2GU9A 4O9EA 4DMIA 1PO23 1RGSA 1POQA 4OLLA 5K0UC 1MQTC 4PLMA 1AL21 3BOWA 2VMEA 4WM8C 1O3QA 4Q4V1 1QGLA 5DQ0A 5JXHA 3LIHA 5JIUA 4I09A 4BYYA 2CU5A 1H9PA 4RS5C 2YC4A 5AVAA 5JOWA 1F9KA 4QXBA 1C3HA 1IG3A 1SLCA 5FUNA 4N8MA 3MIFA 2HWC2 1YQ2A 4OMCA 2O14A 1TME2 1UCXA 2JE8A 4GALA 2RV9A 5GLUA 3U75A 5FY8A 4IW3A 2PYTA 2MNGA 5FYHA 3Q9OA 1R091 3GHMA 4GULA 1H0BA 5IATA 4IEXA 4Q8LA 1UZ0A 4IEYA 4RQPC 1OOPC 1KQRA 2RS32 4ZY9A 3WQBA 4A2UA 2YXSA 5HCFA 2ZCWA 4HPKB 1DYPA 2PHXA 2PXJA 4Q1RA 3VHRA 2P3YA 4ET7A 1XOYA 1VB2A 1K3IA 3WUCA 4IEUA 2OXBA 1VRH3 2XLGA 3UGFA 4E2GA 1IPJA 2D5FA 1POV0 4JHTA 2VZQA 4HT1T 1L7QA 5IVFA 4RR3B 3NSTA 1J83A 3K3OA 2GNMA 2VZTA 3AKQA 2X53S 4CDXC 4H3WA 1GNYA 5BNNA 2CSGA 1SFNA 1JZ5A 1S4CA 1AXKA 2EXHA 4FP3A 1FV3A 1AXYA 2P3JA 3LA3A 4QDSA 3ZFFB 2DBNA 5DDJ1 1Q5OA 2Y33A 5C4WA 1XRUA 3VZLA 2IXHA 4N53A 5FJHA 1D2QA 2J42A 3IDBB 4NPRA 1RXGA 1N1VA 2V5YA 5BNOB 1Q8OA 1YQ8A 2PQSA 4UYBA 3FLRA 4YGDA 3VB9A 4XQDA 4XJ8A 4CCOA 2Q1FA 1K42A 1BVP1 2XL9A 3DEMA 3GJAA 2H6CA 4LPLA 1RUF2 2JDAA 1GMMA 1A8MA 2BWAA 5I91A 1VBD3 1L3JA 2D6MA 5LCWL 3PU8A 3GNEA 3BU7A 1GICA 1VALA 2JKBA 2XG3A 3R0RA 2BDRA 1NA1A 2D6PA 4QDRA 3WDWA 4UW6A 2HWB3 3ZVXA 2E31A 1W8FA 3UT0A 1VBA1 3BVCA 1PGL2 1PZ9A 3M2MA 4AVCA 2ILMA 5ACA2 1NCQA 1AVBA 2ZOEB 5CIRA 4S2DA 1H2NA 4W4ZA 4HFSA 4RR3C 3GYDA 3IT8A 5FZMA 1ASJ2 1HJFA 3LDKA 4AVSA 4DUXA 2VZ1A 3Q8FA 3NL1A 2PQQA 1AR63 2W2IA 1BLZA 5EWSA 1S2EA 5IWFA 2E63A 2C26A 2P6HA 2WFPA 2WZR1 2LS6A 3LA7A 4GXLA 5D21A 3T0BA 1JZ6A 3NW4A 4YVSA 1AYN1 5FPXA 3O1VA 1QJY1 2A6YA 1RMU1 2ZEXA 4I0BA 2WYFA 2R49A 3MIDA 4LBOA 5EXOA 3UL2A 3WP6A 5FP8A 2F4PA 4ZZ8A 2VZVA 2VBDA 5BNOC 3W20A 2UYAA 4HKWA 5GLZA 2BU9A 4HMZA 2C1FA 3KT1A 2VZSA 4HK9A 1WW7A 4RHV2 4N43B 3SEPA 2ENRA 3PVEA 4KGQA 4AG4A 1AL23 3VBSB 2R32A 1HB4A 2XR4A 3ZYIB 4Q4V3 3ZYPA 1W6NB 3WINE 1V6OA 3HN1A 5C8CB 3QLQA 3OD4A 3AP9A 1QKQA 2Q8CA 1OFNA 4YZ5A 1H2KA 2ZJCA 5IK4A 2WQ4A 1PK6A 3POSA 2PTMA 1X33A 1A34A 3USUA 4BQ2A 1H8VA 2DFCA 4H7MA 1BQPA 3RI9A 5FP4A 5GZEA 1W9FA 1MS0A 3LGRA 1FNYA 1W9SA 3R6SA 5FLHA 3UYJA 1MS8A 4K1YA 5JMCA 1R093 3DUIA 4NN0A 4XDPA 5BYNA 5BV6A 3A4UA 4CXWA 3ZFFC 4A6OA 2WA4A 4DXTA 4Q4W2 5LEKA 4ZS3A 1FPN2 2VC9A 4QPYA 4CUAA 1JXNA 1PMHX 4OUMA 1COV1 5AFEA 2I07B 4M4RA 2WT1A 2BVBA 3IAPA 5A1LA 1YCIA 2OT7A 4QB1A 3M3CA 5JOZA 1YO8A 4CEWB 5A80A 1PVC1 1WLWA 2TNFA 2Q4SA 3D4KA 4P9WA 4EE2A 2LTNA 3AFKA 4N43C 3NJZA 1QJU2 1H30A 3VBSC 4P5YA 4XILA 3AKSA 3C8XA 4META 2CV6A 5FJKA 5GZFA 2FDKA 5C8CC 2AEZA 3I2IA 1DQ1A 5CEHA 2ZGTA 2XBO1 5A1FA 2YC0A 4JKMA 3T2TA 3UESA 1H8TB 4NMIA 3NWKA 1JMUB 1HRV2 4M3CF 2G9ZA 4HK8A 2BWCA 3DCQA 2L9LA 2YBSA 3J4UH 4I0AA 4ITCA 2ZMNA 4N7UA 3GZUC 4Q1PA 1CAXB 5ERLA 5A7WB 2B9UA 2A3YA 4PI2A 2D3SA 1CESA 1ZBA2 1REDA 3BYWA 2Q8OA 3U0ZA 4FOYA 3JD71 1PMJX 3WX5A 4DUVA 2QDRA 4XJWA 4UF0B 1K12A 3BOPA 3ON7A 2B9VA 4FT8A 4FPCA 4E8CA 4Y20A 1GV9A 3OEAA 2CY6A 1YFWA 2NMOA 2YROA 5AFBA 1ND2B 4KBBA 4LOSA 4H14A 5FOBB 1KS5A 5G04L 4ZONA 3OD0A 1LRHA 1N1TA 3VDAA 1H1IA 1MACA 4HLTA 4UFJA 3ZO0B 1RUI2 2HWF1 3MUZ1 1Z78A 4MXWA 1WMEA 2QZ3A 1OUXA 2IXIA 1DQ4A 4YM2A 4CEWC 3WW3A 4BA6A 2EIEA 4EN0A 2NMNA 3N9QA 4OMDA 2WZR3 4WVMA 2W95A 5E8AA 2XUMA 1V6JA 1ZRRA 4WV8A 1RMU3 1RVF2 1DGRA 4S2HA 5FZBA 3WDVA 5APAA 1WCDJ 1YUDA 2OX0A 4FQZA 5I8TA 2I45A 1CAWA 1IKQA 1HRI3 1VR3A 5FPUA 4XQWA 1O7FA 4RGKA 2J22A 4QPGA 1O59A 4CU9A 1H8TC 5C33A 2AZ5A 5K0UA 5CBLA 1MQTA 2WDBA 2WRAA 4WM8A 4IGOA 5CA6A 2GN3A 1PIV2 1I6XA 3J26N 1OURA 2DCJA 4GH4B 4Q0UA 4QPWA 4QT6A 3HPNA 5FZAA 4ASLA 3V0BA 5FYCA 4AVBA 1SLTA 1SLLA 2JG8A 2HBTA 1VMFA 4MLOA 2CWSA 4Q26A 4RS5A 1U12A 1MEC1 3TEZA 4ES9A 1NLQA 1NXMA 4MG2A 2BP6A 2GP3A 1TNFA 4HKLA 1BBT1 1QXRA 1U5XA 3J8F2 3I2DA 4BMBA 3RI8A 2RMU2 2VZPA 4LO7A 2RE9A 4XBNA 3T3YA 3P5BA 1OD3A 1HXS1 1S0GA 5CAZA 3DXTA 2VAUA 4CU6A 5FY4A 5LA9A 4I3PA 4RQPA 1OOPA 2DTWA 4JTOA 3ACGA 3AC0A 1CVNA 4XPVA 3VV1A 5A3TA 1MVEA 5FTTC 3ZSJA 1W6QA 1KJLA 2ZZJA 1NY72 2HEWF 5LBCA 1DGWX 2BUKA 5LRSA 4FFGA 2DVAA 2ERFA 3KGLA 5CG9A 1R1A2 1QOOA 4NUBA 4YGEA 5DUWA 2QUOA 2ZX0A 4L99A 2GC2A 5FBJA 5LBBA 1COV3 4CDXA 1SPPB 4QKDA 2WINB 3H1WA 3KV6A 3NV1A 2AR6A 2A71A 5FZ7A 2A6VA 4RSUA 2VMIA 4XF4A 4FXGB 4V2WA 4CTEA 2J1AA 5LA0A 1IS5A 3MICA 3T08A 2P37A 4QDQA 4AHXA 3POBA 3C7FA 1BEV2 3FHIB 4GH4C 1SDWA 1S1AA 2ZGSA 5HI0A 1OI6A 3VGIA 2R16A 5A33B 1HQNA 2RDNA 2ATFA 1GUIA 1S0IA 1ZYBA 2YMZA 3SCGA 4B8EA 1EUTA 2E9QA 1YNAA 4JRAA 1GP4A 1UYYA 2O0OA 3OGJA 1F15A 4U2AA 3VHOA 4A6SA 5FPVA 2XKPA 2ZS6B 1NKGA 2ORXA 3WF3A 1DLCA 1SFPA 4LIUA 2VNRA 4Y1UA 2VOXA 4Q29A 4QB2A 3ACLA 3RWKX 3POIA 1GSLA 1JZ4A 3JD73 4WZFA 1LGCA 1UQXA 1AYM2 3HOBA 4JRLA 1OVPA 4ZPIA 2YYOA 4L0PA 2DTYA 3HMYA 1REFA 3R4SA 1HW5A 1MPXA 2QTWB 4XMIA 4AR2A 5I0UA 4P00B 2VBPA 4AGGA 3I2HA 2FCUA 1CJPA 1MZ6A 4QU2A 4RR3A 3KVAA 1IOAA 4LMFA 5FZHA 4C91A 2WS92 1RUC2 4GA9A 4KWUA 1UF2C 1S0CA 4YW1A 3BUCA 4HANA 4MUVA 4R8HA 2CDPA 4XF3A 3T2PA 3FHAA 4NRPA 3SLIA 4ZZ5A 1KEXA 3A0KA 3RRDA 1ZM1A 4YSFA 3KMHA 5BNOA 1O3TA 1V6IA 5CVRA 4FPOB 4PBPA 3HEIA 4RL7A 3AMMA 1ZX5A 3EMRA 2FZ1A 4IEVA 1AXZA 4LK6A 3NMBA 4L9BA 1XBFA 4AEDB 1JZ8A 4XFHA 4P9GA 1HV0A 4XACA 4QX5A 1FATA 2E7TA 2UY8A 4YM3A 3Q8AA 1PMIA 2B4KA 1OH4A 2PAMA 3C7OA 2C9KA 2OIIA 2A6XA 5E6HA 2W94A 1OKOA 2IWGB 4CEYB 2VCMA 4X8NA 3AXEA 4I2OA 5JWPA 4P9YA 5KHKA 4XHXA 2V4VA 5D8AA 2DU0A 3ZXFA 4MH0E 4XFGA 3WQ1A 1EYBA 4B29A 3D3AA 4I02A 3GF6A 4JHZA 4XBQA 3SISA 5BNPB 4QGMA 3W58A 3WNXA 2Y26A 1SLAA 3ZFFA 5CZKA 3ABZA 1LHVA 1JW6A 3ZX7A 1O5UA 5FZCA 3WDTA 3VZNA 3A0NA 3FJSA 2UWAA 2ZHKA 5FY0A 3E5XA 2JB8A 5LY2A 3DL3A 3ECQA 1LHWA 3M3OA 3S57A 4XW3A 3SXWA 5DDJ2 5EV7A 1WW6A 2VZ3A 1OKQA 2B8MA 3WG1A 4URTA 4YGCA 3HQUA 4ZHNA 4QQOA 2JDMA 1KXGA 2BEOA 2PA7A 5A7NA 4QX8A 1FMD1 1BXHA 1VBC1 2X10A 3PIGA 4CP1A 1FOD1 5IK8A 2KXLA 3RZZA 1IGOA 4N43A 3WZ1A 3RZKA 4IEWA 1QJEA 1O4ZA 1SZBA 4Y33A 4AEDC 1ULEA 3I3DA 1UNBA 5SV5A 4KI5M 3VBSA 5C5TA 1W6NA 2VR4A 4XCBA 4PT6A 5C8CA 3WCRA 5C9AB 1PZ8A 2DDUA 5FV3A 2VNVA 1K5JA 3MIEA 1QXJA 4Z1VA 3OGGA 5FOJB 3N7KA 3EJKA 3MF9A 4UWDA 5HCBA 1UX6A 5F6KA 2RJ2A 4IE4A 4CEYC 3RZLA 1AR91 2V09A 4ZS2A 2AGSA 3I3EA 3H42B 3ZSEA 2QQVA 4ORFA 5CKQA 3MBWA 2D3RA 3TOJA 1NYWA 5FP3A 3RMYA 5F5QA 4AEJA 1ZBE1 1UPSA 5L36A 2J1SA 4XIOA 4ASMB 1CAUB 2SLIA 4Z2AA 2WNOA 3OGRA 2KA3A 5BNPC 5L9VA 5IYYA 1N3PA 1Z7S2 2PLV1 3OBZA 4XUPA 3PMSA 2XJTA 5FLIA 5T50A 4A44A 3BTZA 4K7JA 3BCWA 2VVEA 4CDWB 5KXDA 3S0MA 1GKBA 3VBOB 4BOWA 3OPWA 3VKNA 2WAAA 3GBGA 2C5DA 2RS12 1MS1A 4GJYA 4GJZA 1FNZA 1W39A 2RR11 3A23A 3H1YA 1W04A 2IXJA 3DKWA 3ILNA 4PDWB 3ZDSA 4CEWA 1DCSA 5KC6A 1D4M3 4Y1YA 3ACIA 5F39A 1TG7A 1WD3A 1CGPA 2Q1ZB 1J58A 3C7EA 2BGPA 1QMJA 3N9LA 1EAH2 1QHDA 1QNYA 2VZOA 3ETQA 4JDOA 4LO6B 4R9CA 4A7KA 5A6YA 1DGWA 3UKNA 3N9MA 5EFUA 4AQ6A 4CCCA 4KQ7A 1L7RA 3WUDA 2RS31 3ZLIA 4H55A 2HEVF 3POGA 5C9AC 1H8TA 1XU2A 4K21A 1DGRN 1R082 3KVBA 1CIWA 2D7FA 3OCPA 1IQAA 1CAXA 5A7WA 1DFQA 5J1XA 1XYOA 1V0AA 2JECA 2RHPA 1OQ1A 3HBKA 4LJHA 5FP7A 4AW7A 1R1ZA 3AKTA 4EWDA 2XHNA 2CYFA 3OUIA 2XB6C 4JQRA 4E2QA 1WW5A 3MIGA 4UF0A 4D0QA 4FOVA 4UW5A 2YFZA 2JKXA 5FPLA 2GNDA 2ZEYA 5F2SA 5KXBA 4BU2A 4IE7A 1ND2A 2Y6LA 1EUUA 3E1F1 2R1DA 4MX3A 5IVBA 4CDWC 4LO4B 3HQRA 2XOMA 4UFIA 1W0PA 3VBOC 4AI1A 2FDGA 5F5AA 1ZVFA 3MDPA 1JU3A 4BZ4A 1W03A 3I3BA 1WKYA 5H9SA 2WWSA 3VDCA 2D6NA 3RZMA 5LZ6A 1ZZBA 4PDWC 1L7LA 4QAWA 4ZXKA 4YZ1A 1ULPA 1ZRIA 2VL4A 1N1YA 2R30A 1I5PA 2ZBJA 4Y22B 4AQSA 1QJZA 3TEWA 4PHZA 2FDJA 2J1EA 5FPAA 5C6CA 5JZGB 1JZ2A 2LRPA 2HWD1 1WA6X 2FMDA 1RUF1 4Q5OA 4LQRA 3MW3A 4TXWA 5LATA 1D7PM 5LB6A 2XWBB 1XYPA 2W08A 4OQ9A 2W5FA 3IN9A 1H2MA 3WY6A 2WFF1 2Y6HA 1YQCA 1UW8A 2QZ2A 1AF9A 4XDQA 2WO2A 1PGW2 4C1XA 4OHYA 1QJX2 5DZEA 1QQP2 4BISA 4HETA 2P2KA 1FOD3 1OPOA 4Y4RA 1C8M2 2Q30A 3GZTB 4K1ZA 3KWVA 4MXVA 2R7EB 3ZIWA 3O1MA 2BBAA 4GH4A 1PGL1 5ACA1 2B7YA 3S7IA 2D6KA 4P9XA 1QNWA 2MEV2 3NNFA 3WXPA 1EPWA 3OOXA 4LOTA 1KJRA 1JBCA 2DBIA 2VM9A 5F5IA 4CE8A 4TWTA 2WJSA 1UY1A 2UURA 3AJYA 5F7UA 2Y0OA 2P34A 3ST7A 1AR93 3GM8A 4Y5Z0 1BYHA 4YW5A 4E27A 5C3PA 3LIGA 5BUVA 5H9RA 3MFCA 3RYKA 4QMAA 1UYZA 3AB0A 4JGZB 3B93A 3H1MA 2RM21 5JCTA 4WM7B 1ZBE3 2VPVA 1WCUA 3H3LA 4O61A 3GGLA 4FO9A 1RUE3 3MPBA 4LUKA 4P5HA 1UPIA 2PLV3 4AXOA 1ULFA 2X09A 4GIQA 5IFTA 5JZGC 3GALA 4NJ4A 4XVHA 3HR9A 3OPZA 4R9AA 2VW1A 4QX0A 4XFBA 5GLTA 2XQRA 1SPPA 3B9CA 4MYEA 4V1PA 4FVVA 2JG8B 4PQQA 1JYWA 4X8PA 2RR13 1ENXA 4LULA 2OZJA 4B4RA 1AL0G 2V72A 3UETA 5GZCA 2VNGA 4R52A 4A7ZA 1VBE2 1LCLA 4MGSA 4MO3M 1HLCA 4CUGA 2W39A 3E5QA 5FAXA 2Q8DA 1IQDC 4B7KA 4CCNA 4C0BA 1LAJA 5A33A 2VQ0A 3ZPYA 4DZGA 1IS6A 4XUQA 4KWJA 1YQ6A 2ARXA 3I4IA 1W8UA 1RHI3 5FY5A 3ELNA 3VD7A 1PGSA 2DV9A 4AFDA 5FIXA 4PBOA 3VZMA 4OFGA 4M3CE 4XFCA 3BODA 4JGZC 1TVGA 5LRRA 1RINA 3KM5A 4W50A 4WM7C 2XL7A 5C8WA 5F3CA 3GBFA 3UKTA 3SH4A 3U78A 1JYXA 2IXKA 4AGRA 1RJ8A 1YFXA 2LW8A 1UXXX 4I3GA 2XXZA 3UGGA 1T6GC 2I74A 2X8KA 4TTGA 5EHDA 1HB1A 1QJU1 2ORZA 4COWA 4X6QB 4DY3A 2G4IA 3FHQA 3SKJE 5HXMA 1FI2A 2JG8C 4NRMA 2FCTA 3LKJA 4LE4A 2ETEA 2Y6JA 3LSEA 4UBHA 2JIJA 3QCWA 4EWAA 4V2VA 4QQLA 5FKCA 3SHRA 4BIFA 5LBEA 4ZU4A 3VBHB 1BMV1 3ORJA 5JR7B 1HRV1 1F31A 1ULGA 5JXJA 3LA2A 3GZAA 1AJOA 3KT4A 4P9IA 2JDHA 1KDMA 2HWD3 3UGHA 1S55A 2ES3A 1PX4A 3WQ0A 3WVJA 1WMDA 1LHUA 1QU0A 2R0HA 4LBNA 3GXUA 1RUJ3 2VU9A 4XAAA 2ZGRA 5CKMA 2XJVA 2YG0A 2YU2A 4FPGA 1OVSA 4CUCA 1W2TA 4SLIA 2PHTA 4Z8BA 3BTXA 3KQRA 4FTBA 5DUUA 2ZX2A 2WFF3 2X5IB 3TEXA 4DEQA 2HWE1 2GH2A 2D3PA 4AEDA 1VIWB 2F6BA 1GZ9A 3CNAA 1GU3A 1YRZA 4GAZA 5A3UA 2W87A 3IIIA 1J1LA 4KG8A 2BJSA 4F3JA 3LPGA 2C6SA 3LWCA 2R1BA 4IE5A 1RUI1 4Q4X2 1SHWB 5IVCA 3BN6A 1F8VA 1LEDA 1M06G 3T09A 5FYTA 4BDVB 3VZKA 2OS2A 4CEYA 4J1XA 1CZTA 3SITA 3WNMA 1RUG2 5F37A 5FMBA 2BGCA 1OUSA 3VBRB 1LGBA 5J37A 1W8OA 4AAPA 3VKMA 1PX3A 2RJLA 3RSJA 2TUNA 2FBEA 1JOJA 4QKNA 2RJKA 4CA9A 1RVF1 2VMFA 5BNPA 4N9HA 2QKDA 2RM23 4EROA 1VMJA 1VJ2A 1LENA 2PAEA 4C90A 3H8XA 1JYVA 1AR82 3P6BA 1CZSA 1FAYA 1PIV1 2OZ6A 4NPLA 3WW2A 4DINB 1VBB3 3O1SA 2VOWA 1GWKA 1PO22 1RXFA 2W46A 3MUY1 5CADA 4NHXA 1J59A 4XJUA 1W8NA 5FMCA 4CRQA 4URAA 2A75A 1NQDA 3VD9A 1XNBA 1FXZA 1ZZ6A 4KWLA 4QB6A 5FY7A 5FWEA 4BMEA 2X5IC 3J8F1 1V6NA 4XEZA 4A41A 1K45A 3S6PA 4MGQA 1FT9A 2NYYA 1V6MA 3ALQA 1H9WA 4D3WA 4K8FA 5D8AB 2GC0A 1OHFA 4TYSA 1MS9A 1NCRB 2WQZC 3X29B 4AI0A 4D6RA 2VOKA 1FX5A 2W52A 3FN9A 4EJRA 3SCFA 2DCYA 5C9AA 2R063 4RA0A 3LB9A 3OY8B 3AYCA 4DRRA 3EYPA 4UFHA 5FPBA 5T5OA 2IXCA 1D0GA 4LHSA 4DQAA 4EN9B 5FP9A 4QQHA 1LTEA 3OGVA 3VBRC 2ZX3A 3LEIA 5LK7B 2Y34A 2BV4A 1R1A1 2SBAA 3T4HB 4PIYA 2DCKA 2WNEA 1LESA 2WNUB 3QOPA 4IQPA 1VRH2 1S0EA 1CAUA 1OA3A 3WDYA 2W47A 2H6BA 2ZGMA 3I8TA 4IERA 4P14A 4FTEA 5KHHA 2WA3A 3B3QE 5FUPA 4CVUA 5BXXA 3DGTA 2XONA 4CDWA 4BQ4A 3KV4A 1F35A 5H9PA 3VBOA 4AOCA 4L8QA 1XSQA 2MPFA 2E32A 2PHDA 4DOUA 4D7TA 4ISRA 2ZGPA 4NR1A 5DAWA 4BQ1A 4PDWA 4Y26A 2XJUA 1OXCA 2XVKA 3K4AA 4UAPA 1DU3D 5J3UA 3G6JB 1ND3B 5E88A 4CCEA 5FZOB 4UFMA 1ODNA 2ZAAA 3JBG1 4CYDA 1XNAA 2DVBA 1UKRA 4UW3A 3O0XA 2CGPA 1ACCA 5D8AC 2WAOA 2ZAHA 1NCRC 1D0HA 5A3MA 2QQUA 1VBD2 3LE0A 3RNSA 4GD4A 1JHNA 2KM2A 1VMHA 4RN5A 3ZN6B 3CU7A 2QQJA 5FZGA 4F8AA 1W05A 4YW3A 1CD3G 4MGYE 2HWE3 4HVRA 5A3PA 3CO2A 2HWB2 2LUWA 3AZVA 3ROUA 2BFUS 1IPSA 3AL5A 1STMA 5T54A 1UY3A 2WNUC 1QXPA 1WBLA 4LHNA 1G7YA 3MLLA 1JYTA 5I93A 1HDKA 3W5NA 1RUC1 3OTFA 5E16A 1ZRFA 4XF1A 3U4SA 5A3WA 5I0TA 4FPLA 5A32B 5J7MA 3MI8A 2GN7A 4AFCA 1RUNA 5IAVA 5GJ6A 1W0NA 1AR62 1G9BA 2J1RA 2OQ6A 3I3MA 2F4LA 2QQPA 5JPMB 2ZMKA 3KT7A 4FPHA 5FXZA 1BZWA 3AMNA 2Q1MA 5J48A 4LLFA 3JB8A 5EJ1B 4OI1A 4BPZA 1J3PA 4CDUB 1MZEA 4KL1A 5KXEA 4HVQA 3VLBB 5DN2A 2V4AA 3FC0A 3VBUB 4Y22A 2WN3A 3L2YA 4L11A 4O9GA 2W1QA 3ZYRA 4MZUA 5A1AA 3N3HA 3I49A 2TEPA 5F2WA 3NJXA 5JZGA 3U11A 4JKKA 4AVAA 1ND3C 2R0FA 2XWJB 3THDA 5L7OB 5JDBA 3UK9A 2C4XA 2ZEZA 2D93A 3H9AA 3NNGA 3TWIA 4LHLA 1C5HA 1ZZ9A 2AH2A 4UXAA 2GH8A 1OLMA 3M3IA 2WN2A 4WZCA 4GWNA 1AL22 1KFUL 3AMQA 4Q4V2 1NXD1 3IMMA 2UY9A 3FLTA 3RG0A 1RUD1 1YC61 4K9SA 5L73A 3ZPOA 1H4HA 4AVTA 4CU7A 4YPJA 1UOJA 3AFGA 3MEPA 2J1TA 4AF9A 1QIQA 5M0TA 1VBA3 1UIKA 4FQ4A 3O0WA 3WHUA 5EJ3A 4QU1A 4CU8A 5GLVA 4YFZA 3BU0A 1F5JA 3T30A 2YBPA 1HB2A 3VUOA 3TRSB 1R092 1O8SA 2YU1A 1YEWA 2Z42A 5CNAA 4FFHA 1WLCA 1XE0A 5T5PA 2OPKA 3OJBA 2JDYA 1JYNA 1ONAA 1AYN3 1PM7A 1XB9A 1QJY3 2HH9A 2HYXA 2OUJA 2PHRA 3EB7A 4JGZA 3LPFA 4K40A 2UWBA 1GFF2 4MV2A 4OHVA 4WM7A 4CDUC 5K7PA 1V9U1 3T0DA 4DNYA 4ZU7A 3U4XA 3RZGA 1OF4A 5K9YA 3FUOA 4PF5A 4Y3OA 3VBUC 5A3LA 4OI0A 1KITA 4YYOA 3V64A 1Q8PA 5DAXA 1S0FA 4ASKA 4FCAA 3CHXA 3M3QA 5L7OC 2C9AA 3O1UA 1W9TA 5A70A 1CAVB 2WBKA 2YV8A 2VQUA 5FZ6A 5FZEA 5DXDA 3D0JA 1UMIA 2RS51 3CIHA 4D69A 4BLJA 5A6XA 2YB7A 5ANQA 5FRAA 1H1AA 1QF3A 1OFSA 3H7JA 4QXCA 3MO4A 3ZXGA 1ND2C 1I3HA 3ZSKA 3FUQA 1UZYA 2H0BA 1XC6A 3JBG3 3QD6A 4C8DA 1LOAA 1OLRA 2GZWA 4IESA 3SH3A 5FXVA 2OVUA 3HT2A 4P02B 4XQ4A 4YW4A 5FXWA 3ZKUA 3UNPA 3FZ3A 2MHFA 3J7LA 1DGLA 3VKFC 1E5SA 2WT0A 3VD3A 1CPMA 3VD4A 4KNCA 4XURA 1NLSA 4JDMA 2BW8A 4LK7A 4IE0A 1GZWB 4BK5A 4DEVA 2XH6A 3HNBM 4QKFA 4NAMA 3A22A 2EIGA 2A6ZA 1YJLA 2VOTA 1UU4A 3A21A 1U5YA 4WVWA 2FDFA 1NZCA 3CKHA 2ZKLA 3HWJA 3V65A 5C3QA 4LTAA 2WABA 1IZ3A 1PVC3 1Q8VA 4KWKA 4IV1B 2VH9A 1QDCA 3ZOIA 2XHKA 2BVVA 1LU1A 1BKZA 5CFDB 2BFUL 1EAH1 1XNTA 2WZR2 1E5HA 3NV4A 5T55A 1WGPA 2IXLA 1GNZA 3ATGA 4BK4A 4TLGA 2VCAA 1UN1A 2NLRA 1SLIA 4XFAA 2B5HA 1RMU2 1DZQA 2XBO3 4CXYA 3VBHA 5FYUA 2AEYA 4QD2A 4DXRA 3VDBA 2JWPA 1HRI2 1ENSA 3POEA 3PUSA 1WD4A 2ZMLA 1QH6A 1W06A 1WLDA 2VW0A 3HQXA 4Y5TA 5EQUA 3CMGA 4ZXEA 4BB3A 4GMP1 3IDEA 1DYOA 1HN1A 3BPZA 3FL7A 3V56A 2IVJA 2Y38A 1QOSA 3KCCA 3USSA 4AI9A 4DIQA 2EALA 5BY5A 5KXCA 3FFZA 4OVEA 4M0NA 1J84A 4XTMA 3LEGA 5A7QA 1SACA 1ALYA 2X5IA 4Q4Y1 3JXSA 1RUD3 2DVFA 3SC7X 1DP0A 2AYHA 3S5QA 4DY5A 4YG3A 1WLTA 2CDOA 1UIJA 4OZXA 1X50A 1RUH1 2LM3A 2HJIA 2R071 2CNAA 5A6QA 1TMF1 1W6MB 4JCKA 1O3SA 1AR71 4HN1A 3IPVB 4Y24A 2HWF3 1ZZCA 1W3XA 2ZGUA 3H7YA 2G1MA 4AHWA 3B5LB 4YZ2A 3O1RA 1JYIA 3ILRA 1PO12 1UY0A 4XBLA 1XNCA 4MADA 3SCHA 5IFPA 3OBTA 4IV1C 1A78A 3VBRA 3VD5A 3WNKA 1SMVA 2XJQA 3IAQA 1WA4A 3BPSA 5CFDC 1XYNA 5K8SA 3AZYA 3ZDVA 3LFIA 4I30A 2RDSA 4AYUA 2VBBA 2W1SA 1ZZ8A 5I0RA 1MS4A 2FCVA 1COV2 1V9U3 2QQNA 3I2FA 5DPNA 3M4FA 3LCPA 1VAKA 4BWOA 1PGW1 1ZA4A 2P3KA 1CONA 3VDDB 1QQP1 1YFYA 1C8M1 1J1TA 2JE7A 2ZGOA 3OBAA 3O14A 1WWYA 1Y9GA 3S7EA 2J1UA 3JB4C 3DYPA 5FDBA 3VBFB 1YQ5A 1MEC3 1H6XA 1W9YA 4PCRA 4FFIA 3WG3A 2RS53 3LF7A 4XFFA 5AC91 2ZKNA 1BBT3 2R041 1UU6A 5FQ0B 4JVAA 1EP0A 5T5LA 3WV6A 1BK0A 1GP5A 4GB31 1EV11 1WW4A 2BTVC 1XNKA 1HXS3 1NX9A 4UBGA 1NCRA 2E7AA 2QCSB 2BGOA 5CFCB 3V0AB 3HAGA 1O4TA 2WZEA 2G19A 4MSVA 2VW2A 4CPBD 1S2BA 5ABJB 3OY8A 4A4AA 3NQHA 3WF1A 2PHWA 4XABA 3AP6A 4OYUA 3I97A 2Z4FA 3AZZA 3JD72 1S0BA 3CL1A 5T3NA 3K75B 3TNQA 4Q0QA 2W91A 4Y1ZA 2B46X 4O65A 3M8LA 4ARXA 2WNUA 3RMXA 5F9TA 3AP4A 2P4EA 3B69A 1I5ZA 4LBMA 3K3NA 1MS5A 3H0OA 3F2ZA 3ZYFA 3G7DA 5FKBA 2UWCA 3D0SA 5FZ8A 1VBE1 1LGNA 3VDDC 4L2NA 2O1QA 2AC1A 2WKKA 3RZHA 4LO8A 4YRDA 3AMHA 4P9LA 4B3NA 2XVGA 3O1TA 3E6DA 4YW6A 3KB5A 2DURA 1GOFA 3SMHA 2EVXA 1PM4A 3RJRA 3POJA 3GBWA 3VBFC 1OLQA 3I7DA 4LLOA 4LR4A 4QHZA 4PIZA 3RWNA 1ND3A 5FZOA 2OQ7A 3PMEA 4NRQA 4R9DA 4XJAA 2DVDA 4Y1VA 4OI4A 3THPA 4GZ9A 3U37A 4D6QA 4QKBA 3VKOA 1RITA 1LNSA 4BE3A 3JUUA 1LULA 5KR7A 1MZ5A 5CFCC 3DN7A 2ARCA 3MIBA 4HG6B 1X9PA 5A7OA 5ABJC 5GZDA 1YI9A 2JX9A 3MV01 3OG2A 5D2AA 3ZN6A 3TN91 3PJYA 5G05L 5FZ3A 5DG2A 4LORA 2YPJA 4Q4Y3 4FAGA 3ZYHA 4XIKA 1RUH3 2K0GA 2OA2A 3T1LA 4AL9A 3WOGA 3I2GA 2R073 3L2HA 2YPDA 1TMF3 5B2GB 1VAMA 2CL2A 2ET1A 1AR73 4QWNA 4AEKA 4ES8A 2PELA 5LWBA 5A32A 1GOHA 4MOAA 3WNNA 2HWC1 3AMPA 2GNTA 2FDHA 1HX6A 4KG0A 1I9RA 1TME1 4OI2A 4YARA 4CZSA 1YWKA 1LOBA 3TBDA 4FPJA 4NIAA 4CDUA 3N7JA 1QOTA 2P5BA 3FE5A 1U5IA 3ACHA 2P1BA 3VBUA 4FBFA 5BNQA 2ZTNA 2CWMA 1OSGA 4IV3B 3ZFEB 1DYKA 2IFRA 1NOVA 1Y7BA 1Z0HA 3AKPA 5L7OA 3PUHA 4AAXA 3ZYJB 1PNFA 1SBFA 4P08A 2RVAA 1IS3A 3RYRA 1YHFA 2YFUA 3JQWA 1UOGA 1KS4A 5IW0A 3T1MA 4AI8A 4XYXA 4BXSV 3H8OA 3JZVA 1ULDA 3E6CC 4HVOA 2YDEA 4Q4X1 4YFWA 5F3EA 1W99A 3N9PA 3NKTA 3KHCA 2P3IA 2XMLA 4NE9A 3KHBA 3RZJA 5AC93 2R043 1GANA 5I0DA 3PNAA 4GB33 1EV13 1X7NA 1ENQA 1ODMA 3NO8A 4NO4A 3THTA 2D98A 4BQYA 1VAVA 2TBVA 1GWMA 1JZ7A 3K46A 3ZXAC 5F5CA 3TEYA 1AX0A 2ZEWA 4KU7A 4WBBA 3PVBB 1VPHA 3P1IA 3B02A 2PFWA 1OD5A 1IG0A 4J1WA 5FO9B 2F17A 2E7QA 3WF0A 1Q56A 2D97A 1LU2A 4QX7A 3S30A 3LOIA 1HJGA 3FX3A 1RYYA 4RD7A 1DHKB 4DO0A 1LB2A 3M3EA 1BK1A 3AVSA 4GWMA 5LBFA 1V6LA 1EY2A 1QDOA 5FK7A 5J36A 5AVPA 4IV3C 4LUMA 3ZFEC 5E1RA 1D4M2 1FMD3 1VBC3 2WT2A 3IKWA 4FI9A 5FZ0A 2OPWA 4N9IA 5IVEA 1VP6A 1GOGA 4BHPA 2X29A 3ZYGA 1QJFA 3OGSA 1VB4A 5IUQA 4BIOA 1XNDA 2ZA9A 1CAVA 3TYJA 1DQ6A 2ADEA 3WNOA 3OPTA 1SG3A 5J09A 3VHPA 2W68A 1ASJ1 3FWEA 1IPKA 1PZ7A 1DBNA 2WLPA 3S5AA 3JQXA 4W6YA 4XJ9A 3BIWE 1BJQA 2VUCA 4TLFA 1Q43A 3IM0A 1UD1A 4CP9B 3INAA 3AL6A 3O5SA 3PHMA 2P6CA 2ZACA 3RFRA 2Y6FA 1U5ZA 2V5DA 2WWJA 1Y9QA 1UZZA 4Y1XA 1YLLA 3MHZA 1W28A 4E8DA 1UXZA 4EV0A 1MZFA 3BTAA 3TN93 1GZWA 2WC2A 4JQTA 1YJKA 4RHV1 4DXSA 4FXKB 3PVNA 4NPMA 2BNMA 3GCXA 3K4ZA 4D7SA 2XGXA 5A3NA 2ZZQA 1X82A 4NHYA 3H8RA 4I0WB 3HJRA 4XHBA 3U14A 5LASA 4IGPA 2OYZA 1HKDA 1O8PA 4NOTA 2P17A 4XDOA 4R4ZA 2VGDA 4IV1A 5HCHA 1MR5A 1US3A 3WG4A 1G8WA 4QGNA 1Y43B 3E6BA 5CFDA 3D8CA 2HWC3 2AREA 3CZUA 1TME3 1X9TA 1NZIA 4LBLA 4DPNA 3I2JA 3NNJA 4UW4A 4MGKE 3IDCB 3D6EA 1GYKA 5FBZA 5JR2A 1VBD1 2RS33 3ES4A 4CXXA 3OYWB 3E97A 4IEOA 4FPYA 3B01A 1A8DA 4B4QA 2VTFA 3NAPB 3IIAA 4Q4W1 3R4UA 1GQHA 1UZWA 4L92A 1GQPA 1FPN1 1WCKA 3HT1A 2HWB1 4DFSA 2D6OX 4Q27A 1FOD2 3B7MA 1W2AX 3CQOA 2Y6GA 5HBAA 2VE1A 2N7GA 5JI7A 4A7YA 4CPBA 4Y5SA 2JDKA 4M3CB 5IVJA 2PMWB 4NROA 4XF0A 2BNNA 1V00A 3KZ4C 3WF2A 3WEZA 4E4DX 1CX4A 1Y9MA 4GWIA 4AGVA 2BZDA 1AR61 2XDVA 4EN8B 5C71A 4EYUA 2Z69A 4NWWA 2G9GA 2YBKA 2WLQA 1AR92 1W6MA 2WO3A 3IPVA 5FLJA 4E4SA 1W6OB 5DUXA 2A1XA 1ZBE2 1XJAA 2QQLA 3LQCA 1C28A 4B1LA 2EAKA 5DMYA 4OZOA 3C7HA 1RUE2 3MW4A 3PVOA 2PLV2 1RUF3 2ZGKA 3ZN4A 4H7LA 1C5IA 1ZBA1 5JSRA 2IVIB 3WNPA 2JDZA 2DUPA 2ZGLA 4Z2WA 1JUIA 4YW7A 5L19A 2RR12 3M7AA 3VDDA 3KSCA 4WVVA 3WR0A 4NHKA 3NAPC 1V6KA 2Q8EA 5J96B 3AP7A 3I3QA 5FCCA 2ZX4A 2EXKA 3WF4A 4ISQA 4WVZA 4G3YC 5ANNA 3NKGA 5ACA3 4FOQA 5F32A 3AKRA 3ZSMA 4F83A 5KWRA 2XJRA 3N35A 2CHHA 3VBFA 5FWJA 5A7SA 3L9JT 2EA7A 1I1EA 4XUNA 1ASJ3 5FREA 3SNMA 4J6GA 5FY1A 3E5UA 3Q8EA 4MGTA 4OCTA 5FQ0A 1KDKA 3FFQA 1TZOA 4AFMA 1RHI2 2VZUA 3IBMA 4NAOA 4G9SB 2I2SA 1UAIA 1C1FA 3MIHA 4XUOA 5CFCA 3V0AA 1AX2A 1QWRA 3EBRA 3D82A 4QQ2A 1UO9A 3A7QA 5ABJA 1YXWA 4AZZA 5LA2A 2VMGA 4FPKA 4IXLA 3O7OA 2Y6KA 1CX1A 1C8NA 4D8MA 2GSYA 4LA3A 1DQ0A 5TSWA 3SKVA 3VBHC 3AVRA 3ZFGB 1WZXA
chains in the Genus database with same CATH topology
2JICA 4RHV3 4EN6B 4XXAA 1H2LA 2GNBA 4ZU5A 2FZ2A 3WLUA 5CU1A 3AYEA 2A70A 2Z5WA 3ZN5A 2RMU1 1V70A 3MFAA 3O12A 3KCYA 1YYNA 3AJZA 2HWD2 3H3UA 1ZREA 2IC1A 1UKGA 4NVPA 1EPZA 1RUJ2 2Z79A 3RJ2X 3C2UA 3EXUA 1G6NA 4DB5A 4OHWA 3NV2A 1NY71 2ZHMA 3MLJA 1DLLA 4Q4W3 2WFF2 5DUVA 5GLWA 1FPN3 3RS6A 3I59B 4PLOA 3QH7A 3AM2A 3P3PA 1RC6A 5KHIA 4LBKA 4QXKA 4W6XA 2NQYA 1DQ5A 3ZFGC 2NN8A 5J98B 1BEV1 1JN2P 1MVQA 1QJU3 2WNVB 3KS7A 2K2SA 1NQJA 4AQTA 1A6CA 4COUA 3H8UA 4IEQA 1NE4A 4YM0A 3UV9A 4XFIA 2OUHA 2RM22 3MLKA 4YGBA 1HRI1 1DZRA 5EZWA 1HRV3 2GC3A 3WDUA 3ME2A 2PHUA 3CJIB 5SV8A 5FO7B 4LT5A 1Q8SA 1IS4A 1ZBA3 5F1RA 4G4FA 5I0SA 1VBB2 1KD7A 1CQ9A 4BLIA 3WDXA 1RUOA 1AYM1 4IV3A 3MF6A 3M1HA 3ZFEA 1KRIA 2WSUA 2XLAA 1AJKA 2XJPA 3N7MA 5FMOS 4K20A 2Y0IA 4Q0PA 1N3OA 3ZIXA 2NPIA 2HYKA 5IK7A 4RFT0 2WS91 2C0ZA 1RUI3 1FYUA 3AZXA 1SCRA 4YZ3A 1PO11 2R062 2PHFA 3LAGA 2VECA 3VZOA 2E6VA 4LO5B 1G86A 2OW4A 2E53A 3QH6A 4AVVA 4IETA 1TQ5A 2EF6A 3VL8A 2WNVC 4KH9A 4L97A 4JGYB 1RVF3 3RYPA 2VUJA 2BYVE 1XU1A 1B09A 3KD4A 1KFXL 5E89A 4OHXA 3CJXA 3MZHA 3WW4A 3VKLA 2DU1A 2XLFA 3W59A 2ZHLA 3CJIC 1PIV3 3SH5A 1WCSA 4KGGA 4AK3A 2ARBA 5DZGA 1HIXA 5GKAC 1IHMA 1NG0A 3J8F3 4R4XA 2RMU3 1C57A 2CAUA 4XF9A 1K5MB 3ASIA 1BMV2 2JD4A 4Z92B 3QBQA 1DIWA 5JLVA 1ZNPA 5FO8B 4LA2A 4JV4A 2ZPXA 2B45X 3K51A 1W0OA 1DG6A 4NHLA 5T5JA 4RGGA 1R1A3 1JUHA 2E51A 2HWE2 3QACA 1REEA 1LOEA 3WT3A 4YVWB 3DPRB 4U36A 4JGYC 1DF0A 1G9CA 1URXA 2GDFA 3B9IA 5JAXA 3ZMNA 4D7YA 4MGIE 1IKPA 1G9FA 3I54A 3KGZA 5KHGA 2Q0AA 4RGAA 3R4DB 1ZRCA 1B35B 1GQGA 1BEV3 2XJSA 2K9ZA 3UJQA 1GLHA 1YI7A 4Q0VA 4C1WA 1U0AA 1XXNA 4N7IA 1APNA 1NLRA 1AHSA 2VQAA 5HXVA 4XETA 2XKOA 5LK5A 4B7EA 1GNHA 1PHMA 1BCXA 1K5MC 3HIFA 3R05A 3ZXEA 2YUEA 2HEYF 2UYBA 3PTYA 3U10A 1TE1B 4F7ZA 3JCIA 1E57A 3DV8A 4A3XA 3OYWA 3PJQA 1Z7S1 1AYM3 3NAPA 1M4WA 3O0VA 4M01A 2VG9A 5JSPA 3FLPA 1CN1A 1QY4A 4HN0A 1PNGA 3KCXA 5JIAA 2QJVA 1G9AA 5JOYA 3LSDA 4K6BA 2RS11 1VBA2 2FHRA 4JTNA 4B4PA 3AZWA 4QPIB 4YVWC 3DPRC 2O8QA 4M3CA 1QH7A 2WS93 2BNOA 3AYAA 1C1LA 1RUC3 3IWZA 5BPXA 4XZPA 2VUAA 3AX4A 1PO13 5IK5A 4DXZA 1F5FA 5FMOL 1C4RA 5EYXA 1B35C 2HKXA 1O4YA 2JJ6A 1TEIA 3UJOA 4N90A 4AEMA 4CDQB 1AYN2 4KU8A 2A5ZA 1QJY2 2VULA 3AYDA 1W6OA 3BALA 4LNVA 4HZFA 4FAHA 2A7AA 2R6QA 5LEJA 1R081 4LBQB 3N36A 3POYA 3NV3A 1CJDA 3HBZA 3WP5A 4LE3A 5JSOA 3KLSA 1CR7A 2Q5TA 5HCAA 4PIXA 1GZCA 1N1SA 4M00A 3TB0A 1LHNA 1OA4A 3BB6A 3FMGA 2GALA 3PLQA 2DF7A 3MYXA 3D5OA 3ENRA 2YGMA 4QQPA 2JG9B 3ZXJA 1S0DA 4COVA 4E9KA 1LECA 3AXDA 3FBMA 3ES1A 4YW2A 3VL9A 4BH9A 4M0HA 3JBG2 4E4ZA 2WL1A 1LEMA 4QPIC 2JENA 3VZJA 4EWEA 3VHNA 2VMHA 1W6PB 3WHTA 4HPKA 3WQ7A 4FP2A 4P9JA 1JYCA 4QM8A 1OA2A 2A3WA 4R9BA 3HD8B 1XQNA 2B39A 3OBRA 5DDJ3 4CDQC 2XPJA 2JXAA 3CLPA 5KBFA 4GKYA 2ZX1A 4LHKA 3ZFGA 4NHMA 1QJX1 1D4M1 2FMYA 2FQPA 4HKOA 1PVC2 2DVGA 5EYYA 3WD5A 2BBVA 2MEV1 4HL0A 1LOFC 1J3RA 2NZ9A 4YG6A 1JH5A 5D1IA 4EN7B 4LBQD 1LR5A 5GZGA 2XBO2 2JG9C 4XMAA 4FSJA 1Y3TA 3ILFA 1RL3A 1N47A 4D94A 3DF0A 4Z82A 3MGUA 4AI3A 3B00A 3RDIA 1AZDA 3NVCA 4BCUA 2D43A 1VLNA 1ULCA 2VY0A 2D44A 1Z7S3 4ZKTB 5BNNB 1RUD2 3I59A 1LJ7A 1O91A 5I8SA 3LZZA 5FFOC 3TNPB 2RS13 5FPZA 4OUSA 4HSJA 4IEPA 3IMNA 4NWVA 5C4WB 3C3VA 4N53B 2Z2SB 1ZRDA 2HWF2 1SCSA 1ENRA 1H1MA 1YIFA 2DWRA 2UU8A 1EAH3 2WNVA 4I01A 5F6LB 3ZMOA 2CTVA 1AX1A 5CG8A 4Z07A 2QDNA 5H9QA 1LOCA 1XE8A 4W6WA 2BQPA 1D2SA 1HV1A 3M70A 4JDNA 3W9AA 1V9U2 1R083 2IFWA 2WSVA 4JAAA 4YG0A 1WUVA 4OULA 4HBNA 1NA1B 3EO6A 2O8OA 1O5LA 3CJIA 2QVSB 4GMP3 2GMMA 2QFEA 4E2SA 3H3ZA 4QGLA 4HSLA 1X8EA 2XVLA 1YFUA 1POV1 1NCQB 4BM8A 1HQLA 5IT6A 1JTZX 1MEC2 4FPEA 5GM0A 1LODA 1WMFA 2GC1A 2RS52 3J9SA 3ZSLA 1BBT2 1OPMA 5BNNC 4GQ7A 4SBVA 3MPPG 1CPNA 1HXS2 1OMIA 1TNRA 4YVSB 5C4WC 2WZPP 2DUQA 4N53C 3WG2A 1SEFA 1RUE1 2BPA2 2NP0A 2VVDA 1DQ2A 1RIRA 4IEZA 3VN4A 4JGYA 4GKXA 4FTSA 3WCSA 4Q0SA 4COYA 1UMZA 4XOGA 1O3RA 3JU9A 1QJX3 2PHLA 3B94A 1QQP3 3GHNA 2CAVA 1C8M3 1NA1C 1AUYA 1PK6B 4TZDA 4W65A 3USUB 1RJ7A 1J3QA 4OHZA 2MEV3 4YLZA 1NCQC 3N7LA 2AUYA 4JC1A 4PJYA 1OQDA 1RUG1 2DCZA 1GBGA 1RHI1 1X36A 3U07A 2EXJA 2EAAA 1K5MA 2CGNA 5CB7A 4ATFA 3AK0A 2PN5A 3WP3A 1LOGA 2ZHNA 2GAUA 4C0HA 2DCTA 4AFAA 4YVSC 3TAYA 4ATEA 3RPQA 1YIPA 2G9FA 4S2FA 1SLBA 1LHOA 1X8MA 2PAKA 4INDA 3POWA 2ZGNA 1AR81 3EQEA 4DRVA 4LEJA 3H50A 4Q4Y2 2ET7A 1PO21 3FBYA 4YVWA 1SFYA 3DPRA 3WW1A 2D40A 2ZABA 4AWDA 4FPFA 3LOBA 1RUH2 2QNKA 1NE6A 2R072 2YZ4A 4K3UA 1TMF2 1SQ4A 1LKNA 1AR72 3APBA 2DFBA 1VBE3 3CF6E 2VXRA 3URFA 1B35A 1S2KA 1G9DA 1F2NA 1Q3EA 1PK6C 2LALA 4CP2A 1FV2A 4AQ2A 3EHKA 2V73A 4AE2A 2D6LX 4S2GA 1RUJ1 2CGOA 1SBEA 2EXIA 4PLNA 1GR3A 1H4GA 4Q2FA 4YZ4A 5T52A 4Q8KA 5DZFA 5GALA 1XE7A 1S0JA 2YGLA 4GMP0 4Y20B 1PVXA 2ZGQA 4MGZE 1HQWA 1VRH1 2DYCA 3MW2A 4COZA 5KHJA 2IZWA 1POV3 4CP0A 4XE9A 3RQ0A 1RB8G 4MXWB 3UKVA 2H0VA 4XTPA 4AI2A 5AC92 3AP5A 2R042 5JOXA 4GB32 4QPIA 4WVMB 1EV12 2VNOA 1DZTA 3N4MA 4TSVA 1DDLA 4XJZA 1OQEA 4LBJA 2A6WA 1MS3A 1A3KA 1BVVA 2JE9A 5DG1A 1CAWB 1W2UA 2DUOA 2WIIB 5KC5A 4QPGB 5JVVA 3ZXDA 4CDQA 4MVTA 5K0UB 5JI9A 5JPNB 1MQTB 2A3XA 4ONUA 4WM8B 1VBB1 3OF1A 3ZXKA 2VOVA 2GMPA 3V0BB 4QM9A 2NM1A 4LBQA 4FOWA 4RS5B 2JEMA 4QHBA 2AENA 1RTVA 4YNIA 1FMD2 1WBFA 1VBC2 2GMEA 3CEWA 4XXPA 3ZXLA 1LOFA 4AFBA 2YHJA 4Q4X3 4DS0A 3P3NA 4RQPB 1OOPB 2R061 2JG9A 1RUG3 2A73B 1UU5A 1W6QB 1N3QA 2B42B 4YM1A 4IL7A 2D5HA 1UL9A 1D4VB 4AHYA 1SBDA 4X6RB 1Q8QA 1W6PA 4CDXB 3K48A 4AHZA 4PQ9A 4Y4YA 2W0XA 2YY1A 1ZZ7A 3TN92 1AR83 2QE3A 5I8YA 4QPGC 2VVFA 3WP4A 2GU9A 4O9EA 4DMIA 1PO23 1RGSA 4OLLA 5K0UC 1MQTC 4PLMA 1AL21 3BOWA 4WM8C 1O3QA 4Q4V1 1QGLA 5JIUA 4I09A 4BYYA 4RS5C 1H9PA 5AVAA 5JOWA 1F9KA 1C3HA 1SLCA 3MIFA 2HWC2 5GLUA 1TME2 1UCXA 4GALA 2PYTA 2MNGA 3Q9OA 1R091 3GHMA 4GULA 1H0BA 4IEXA 4Q8LA 4IEYA 4RQPC 1OOPC 1KQRA 2RS32 4A2UA 2YXSA 5HCFA 2ZCWA 4HPKB 1DYPA 2PHXA 4Q1RA 3VHRA 1VB2A 3WUCA 4IEUA 1VRH3 2XLGA 4E2GA 1IPJA 2D5FA 1POV0 4HT1T 4RR3B 3NSTA 2GNMA 3AKQA 4CDXC 2X53S 4H3WA 5BNNA 1SFNA 1AXKA 2EXHA 4FP3A 1FV3A 1AXYA 2P3JA 3LA3A 5C4WA 1Q5OA 1XRUA 3VZLA 2IXHA 4N53A 1D2QA 3IDBB 4NPRA 1N1VA 2V5YA 5BNOB 1Q8OA 3FLRA 4YGDA 4XQDA 4XJ8A 1BVP1 2XL9A 2H6CA 1RUF2 1A8MA 2BWAA 5I91A 1VBD3 1L3JA 2D6MA 3GNEA 3BU7A 1GICA 1VALA 2JKBA 2XG3A 3R0RA 1NA1A 2D6PA 3WDWA 4UW6A 2HWB3 3ZVXA 1VBA1 1PGL2 1PZ9A 3M2MA 4AVCA 2ILMA 5ACA2 1NCQA 1AVBA 2ZOEB 5CIRA 4S2DA 1H2NA 4HFSA 4RR3C 3GYDA 3IT8A 1ASJ2 4AVSA 3NL1A 2PQQA 1AR63 3ZFFB 5EWSA 2E63A 2WZR1 2WFPA 3LA7A 4GXLA 3NW4A 4YVSA 1AYN1 5FPXA 1QJY1 2A6YA 1RMU1 4I0BA 2R49A 3MIDA 4LBOA 5EXOA 3UL2A 3WP6A 2F4PA 5BNOC 2UYAA 4HKWA 5GLZA 4HMZA 2C1FA 3KT1A 4HK9A 1WW7A 4RHV2 4N43B 2ENRA 3PVEA 4KGQA 4AG4A 1AL23 3VBSB 2R32A 3ZYIB 3ZYPA 4Q4V3 1W6NB 3WINE 1V6OA 3HN1A 5C8CB 3QLQA 3OD4A 3AP9A 1QKQA 4YZ5A 1OFNA 1H2KA 2ZJCA 5IK4A 2WQ4A 1PK6A 3POSA 2PTMA 1X33A 3USUA 1H8VA 2DFCA 4H7MA 1BQPA 3RI9A 5GZEA 3LGRA 1MS0A 1FNYA 3R6SA 5FLHA 1MS8A 4K1YA 5JMCA 1R093 3DUIA 4NN0A 5BYNA 3A4UA 3ZFFC 2WA4A 4Q4W2 5LEKA 1FPN2 4QPYA 1JXNA 4OUMA 1COV1 5AFEA 2I07B 2WT1A 2BVBA 1YCIA 3M3CA 5JOZA 1YO8A 4CEWB 1PVC1 1WLWA 2TNFA 2Q4SA 3D4KA 4P9WA 2LTNA 3AFKA 4N43C 3NJZA 1QJU2 1H30A 3VBSC 4XILA 3AKSA 4META 2CV6A 5GZFA 5C8CC 1DQ1A 2ZGTA 2XBO1 2YC0A 3T2TA 1H8TB 3NWKA 1HRV2 4M3CF 5BV6A 4HK8A 2BWCA 4I0AA 4ITCA 4N7UA 3J4UH 2ZMNA 4Q1PA 3GZUC 1CAXB 2B9UA 2A3YA 2D3SA 1CESA 1ZBA2 1REDA 2Q8OA 3U0ZA 4FOYA 3JD71 3WX5A 2QDRA 4XJWA 3BOPA 4FT8A 4FPCA 4Y20A 1GV9A 2CY6A 1YFWA 2NMOA 2YROA 5AFBA 1ND2B 4KBBA 4H14A 5FOBB 1KS5A 3OD0A 1LRHA 1N1TA 1H1IA 1MACA 4HLTA 3ZO0B 1RUI2 2HWF1 1Z78A 4MXWA 1WMEA 2QZ3A 4CEWC 2IXIA 1DQ4A 4YM2A 3WW3A 4BA6A 4EN0A 2NMNA 2WZR3 4WVMA 5E8AA 2XUMA 1V6JA 1ZRRA 4WV8A 1RMU3 1RVF2 1DGRA 4S2HA 3WDVA 1WCDJ 1YUDA 4FQZA 5I8TA 2I45A 1CAWA 1IKQA 1HRI3 1VR3A 4XQWA 1O7FA 4QPGA 1H8TC 5C33A 2AZ5A 5K0UA 5CBLA 1MQTA 4WM8A 5CA6A 2GN3A 1PIV2 1I6XA 3J26N 2DCJA 4GH4B 4Q0UA 4ASLA 3V0BA 4QT6A 4AVBA 1SLTA 1SLLA 2JG8A 4MLOA 4Q26A 4RS5A 2CWSA 1U12A 1MEC1 4ES9A 1NXMA 4HKLA 1TNFA 1BBT1 1QXRA 1U5XA 3J8F2 3I2DA 4BMBA 3RI8A 2RMU2 4LO7A 2RE9A 4XBNA 1HXS1 1S0GA 5CAZA 4I3PA 4RQPA 1OOPA 2DTWA 4JTOA 1CVNA 4XPVA 3VV1A 1MVEA 5FTTC 3ZSJA 1W6QA 1KJLA 2ZZJA 1NY72 2HEWF 1DGWX 2BUKA 5LRSA 2DVAA 2ERFA 3KGLA 5CG9A 1R1A2 1QOOA 4YGEA 5DUWA 2QUOA 2ZX0A 4L99A 2GC2A 1COV3 4CDXA 2WINB 3H1WA 3NV1A 2AR6A 2A71A 2A6VA 4RSUA 2VMIA 4XF4A 4FXGB 4CTEA 1IS5A 3MICA 4AHXA 2P37A 1BEV2 3FHIB 4GH4C 1SDWA 1S1AA 2ZGSA 5HI0A 1OI6A 3VGIA 2R16A 5A33B 1HQNA 2ATFA 1ZYBA 1S0IA 2YMZA 3SCGA 4B8EA 2E9QA 1YNAA 4JRAA 2O0OA 4U2AA 3OGJA 3VHOA 2XKPA 2ZS6B 2VNRA 4Y1UA 2VOXA 4Q29A 3ACLA 1GSLA 3JD73 4WZFA 1LGCA 1AYM2 4JRLA 2YYOA 2DTYA 3HMYA 1REFA 3R4SA 1HW5A 4XMIA 5I0UA 4AGGA 1CJPA 1MZ6A 4QU2A 4RR3A 1IOAA 4C91A 2WS92 1RUC2 4GA9A 1UF2C 1S0CA 4YW1A 4HANA 4MUVA 4R8HA 4XF3A 3SLIA 3A0KA 3RRDA 1ZM1A 4YSFA 3KMHA 5BNOA 1O3TA 1V6IA 5CVRA 4FPOB 4PBPA 4RL7A 3AMMA 1ZX5A 2FZ1A 4IEVA 1AXZA 4L9BA 4AEDB 4XFHA 4P9GA 1HV0A 4QX5A 1FATA 2E7TA 2UY8A 4YM3A 1PMIA 2PAMA 2OIIA 2A6XA 2IWGB 4CEYB 4X8NA 3AXEA 4I2OA 5JWPA 4P9YA 5KHKA 4XHXA 5D8AA 2DU0A 3ZXFA 4MH0E 4XFGA 3WQ1A 1EYBA 4B29A 4I02A 3GF6A 4XBQA 3SISA 5BNPB 4QGMA 3W58A 3WNXA 2Y26A 1SLAA 3ZFFA 1LHVA 1JW6A 3ZX7A 1O5UA 3WDTA 3VZNA 3A0NA 3FJSA 2UWAA 2ZHKA 3E5XA 3DL3A 3ECQA 1LHWA 3M3OA 4XW3A 3SXWA 5DDJ2 5EV7A 1WW6A 1OKQA 2B8MA 3WG1A 4URTA 4YGCA 4QQOA 1KXGA 2BEOA 2PA7A 1FMD1 1BXHA 1VBC1 4CP1A 1FOD1 5IK8A 2KXLA 3RZZA 1IGOA 4N43A 3WZ1A 4IEWA 1O4ZA 4AEDC 1ULEA 3VBSA 5SV5A 1W6NA 5C8CA 3WCRA 5C9AB 1PZ8A 4Z1VA 3MIEA 1QXJA 5FOJB 3OGGA 3N7KA 3EJKA 3MF9A 5HCBA 1UX6A 5F6KA 4CEYC 1AR91 2V09A 2AGSA 3ZSEA 4ORFA 2D3RA 3TOJA 1NYWA 3RMYA 5F5QA 4AEJA 1ZBE1 1UPSA 5L36A 4XIOA 4ASMB 1CAUB 2SLIA 5BNPC 2KA3A 1N3PA 1Z7S2 2PLV1 3PMSA 2XJTA 5FLIA 5T50A 4K7JA 3BCWA 2VVEA 4CDWB 5KXDA 3S0MA 1GKBA 3VBOB 4BOWA 3VKNA 3GBGA 2C5DA 2RS12 1MS1A 1FNZA 1W39A 2RR11 3H1YA 5KC6A 2IXJA 3DKWA 3ILNA 4PDWB 3ZDSA 4CEWA 1D4M3 4Y1YA 1WD3A 1CGPA 2Q1ZB 1J58A 1QMJA 1EAH2 1QHDA 1QNYA 3ETQA 4JDOA 4LO6B 4R9CA 4A7KA 1DGWA 3UKNA 4AQ6A 5EFUA 4KQ7A 3WUDA 2RS31 4H55A 2HEVF 5C9AC 1H8TA 1XU2A 4K21A 1DGRN 1R082 1CIWA 2D7FA 3OCPA 1IQAA 1CAXA 1DFQA 1XYOA 2JECA 2RHPA 1OQ1A 4AW7A 1R1ZA 3AKTA 4EWDA 2CYFA 2XB6C 4JQRA 4E2QA 1WW5A 3MIGA 4FOVA 4UW5A 2GNDA 5KXBA 1ND2A 4MX3A 2R1DA 4CDWC 4LO4B 3VBOC 1W0PA 4AI1A 1ZVFA 3MDPA 4BZ4A 5H9SA 2WWSA 2D6NA 1ZZBA 4PDWC 4YZ1A 4ZXKA 2ZBJA 1N1YA 2R30A 4Y22B 4AQSA 1QJZA 5C6CA 5JZGB 2HWD1 2FMDA 1RUF1 3MW3A 2XWBB 1XYPA 2W08A 3IN9A 1H2MA 3WY6A 2WFF1 2QZ2A 1UW8A 4OHYA 1AF9A 4XDQA 1PGW2 4C1XA 1QJX2 5DZEA 1QQP2 4HETA 2P2KA<