1QQP2

Foot-and-mouth disease virus/ oligosaccharide receptor complex.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
216
Chain Sequence
DKKTTTLLEDRILTTRNGHTTSTTQSSVGVTYGYATAEDFVSGPNTSGLETRVVQAERFFKTHLFDWVTSDSFGRCHLLELPTDHKGVYGSLTDSYAYMRNGWDVEVTAVGNQFNGGCLLVAMVPELCSIQKRELYQLTLFPHQFINPRTNMTAHITVPFVGVNRYDQYKVHKPWTLVVMVVAPLTVNTEGAPQIKVYANIAPTNVHVAGEFPSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords PROTEIN (GENOME POLYPROTEIN)
publication title The structure and function of a foot-and-mouth disease virus-oligosaccharide receptor complex.
pubmed doi rcsb
total genus 43
structure length 216
sequence length 218
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qqp200
1M06G 1VAKA 5L7OC 5BNOB 1MQTA 1V9U2 1VBA1 4Q4W3 1H8TB 5LK7B 5L7OA 3TN92 1RMU2 1VBB2 2RS51 1C8M1 1AR92 1AR83 1OHFA 2PLV1 4RHV2 2RMU2 1HRV3 4QPIB 1EV12 1BEV3 2GH8A 1CJDA 1QQP3 4Q4X3 1W39A 1AR63 4RR3A 1FMD2 4CEWC 4N53C 1PO11 3JBG2 2WZR1 1BMV2 4CEWA 2WFF2 1PGL1 4RQPC 1ND2B 3HAGA 1ZBE3 2VQ0A 4QPGB 1EAH1 4WM7C 4RR3B 1QJY1 4RQPA 5CFDB 4SBVA 1COV2 1BBT1 1RUI3 4WM7A 1TMF2 5ACA1 1AR72 4CEWB 1ASJ1 4CDUB 5BNNC 1RHI3 2BBVA 1RVF3 2HWC1 4RS5B 5A32A 1MEC2 4RQPB 5BNNA 1VBD2 1AL0G 4WM7B 1VBC2 2HWE1 2XBO1 1NCQC 2DF7A 5BNPC 2WLPA 2R063 1V9U3 1OPOA 5C4WB 1NCQA 5A33A 3ZFEB 3TN93 1R1A3 5BNPA 1VBB3 3VBRC 2MEV1 4FSJA 1AR93 1TME1 1PIV2 1AYN1 3VBRA 1RUJ2 1HRI1 1PO22 4Q4W2 1QJX2 2HWD3 1FOD2 2HWF3 1F2NA 2RS32 1CD3G 1Z7S3 1R091 3VBSC 1VBE1 1K5MC 1B35B 1ZBA3 4GMP0 1R082 1BEV2 1C8NA 3VBSA 1K5MA 1QQP2 4Q4X2 5DDJ3 1A6CA 1AR62 4CDQC 5AC91 5K0UC 1FPN1 1AR73 1PVC2 1RUF3 4CDQA 2ZZQA 3VBFC 5K0UA 3VBSB 1NY72 4AEDB 1VBD3 3VBFA 4Y5Z0 5BNOC 2PLV3 2BFUL 1RUE1 1RUI2 1H8TC 4CDQB 1RUD1 5BNOA 4Y4YA 1RHI2 4Q4Y1 1RVF2 1NG0A 1H8TA 1RUG1 1QJU1 4GMP3 4QPIC 1ND3B 1RUH2 3ZFGB 4QPIA 2WS93 2ZAHA 1RUJ3 1FMD1 2R062 1PO23 3VBHA 2RM22 2WWSA 3JBG1 4CDXB 1QJX3 4N43B 1R1A2 1AYM1 1FOD3 1VRH2 2R041 2RS33 5ACA3 1ND2C 1HXS1 3VBUA 4QPGC 1D4M2 4RR3C 1R083 4BCUA 1ND2A 3VBHB 5CFDC 4CDWC 1NCRC 4EJRA 4QPGA 1COV1 1POV1 3J8F1 4CDUC 2RS12 3ZXAC 5CFDA 2HWD2 2HWF2 1NCRA 4CDWA 5C8CC 1Z7S2 1PVC3 3VBUB 5J98B 4CDUA 1PGW1 1ZBA2 4RS5C 5GKAC 2HWB1 5C8CA 4Q4V1 4IV1B 1OOPB 5DDJ2 4RS5A 3VBOB 2R073 1AYN3 4CDWB 1NCRB 3M8LA 5D8AB 3NAPC 4IV3B 5C4WC 3ZFEC 1NOVA 5CFCC 1RUF2 5C8CB 1GFF2 4WM8B 3NAPA 5C4WA 3ZFEA 1C8M2 5CFCA 1RUH3 1AL23 2PLV2 1HX6A 4JGYB 4Q4W1 2Y26A 2RR11 2FZ2A 3NAPB 2RM23 5CFCB 1AR81 4RFT0 1VRH3 1PO12 1B35C 1RUC3 1HRV1 3FBMA 5C9AC 2BFUS 1X36A 1D4M3 1PGL2 1QQP1 1B35A 1AUYA 2WS92 4YVSB 5C9AA 1HQNA 3IDEA 2RS13 1RUE3 1BBT2 4NWVA 5FMOL 5ACA2 4JGZC 1ASJ2 1ZBE1 4PDWC 2IZWA 4AEDC 5C9AB 3CJIB 4JGZA 1RUG3 4GB31 4PDWA 4AEDA 2HWE2 2XBO2 3JD71 1RVF1 1VBA3 4JGZB 1ND3C 3ZFGC 2RS53 4PDWB 1C8M3 2R043 2BPA2 1HXS3 2R072 1AYN2 1ND3A 3ZFGA 1IHMA 2R061 3LOBA 1V9U1 4CDXC 4N43C 1HRI2 3TN91 1RMU1 1R1A1 1VBB1 1POV3 1AR91 4CDXA 4N43A 1PO13 4GH4C 4YVWC 2WZR3 4RHV1 2RMU1 1R092 1AL22 3JB8A 1EV11 3VBHC 4GH4A 2HWB3 4YVWA 2BUKA 1EAH3 1WCDJ 1QJY3 4NWWA 1Z7S1 2GSYA 3VBUC 1F8VA 1BMV1 1BBT3 1RUC2 1ZBA1 2WFF1 1ASJ3 1SMVA 2FZ1A 4GH4B 4IV1C 4YVWB 1OOPC 5DDJ1 3VBOC 2TBVA 2HWC3 5D8AC 4IV1A 1OOPA 3DPRB 1TMF1 1QJZA 4IV3C 1RB8G 2HWE3 1AR71 3VBOA 2XBO3 1RUE2 1RUF1 5D8AA 4WM8C 4IV3A 1RUD2 2RR13 1MEC1 4Q4Y2 4WM8A 1VBD1 1VB2A 1RUG2 1VBC1 1QJU2 2MEV3 4JGYC 1TME3 5FMOS 1MQTB 4JGYA 1VB4A 5L7OB 1HRI3 1VBA2 4GMP1 1PIV1 4FTBA 1AYM2 2RS52 2R042 2X5IC 4N53A 1R093 1VBE3 1HXS2 4YVSC 2WS91 1RUJ1 4LLFA 1PO21 2X5IA 1QJX1 3JB4C 4GB33 4YVSA 5ABJC 1FOD1 2RS31 3J8F2 3JD73 5AC93 4N53B 2WZR2 1FPN3 5ABJA 3CJIC 1R081 1BEV1 1PGW2 2X5IB 5J96B 2HWB2 4Q4X1 4Q4V2 1AR61 1EAH2 3CJIA 5FOJB 5JZGC 3ZFFC 1QJY2 1PVC1 5ABJB 5JZGA 3ZFFA 1POV0 1RUD3 1RMU3 5A32B 1NY71 4Q4Y3 5BNNB 2XPJA 3VDDC 2R071 2ZTNA 2HWC2 1QJU3 4RHV3 2RMU3 1RUI1 1EV13 5JZGB 3VDDA 3ZFFB 1NCQB 5A33B 1NA1C 5BNPB 1RHI1 1FMD3 1E57A 2RR12 3JBG3 1NA1A 1AYM3 1AR82 1RUH1 1AL21 3VBRB 2MEV2 2WFF3 1TME2 1HRV2 2QQPA 3VDDB 3S6PA 4CEYC 2RM21 4CEYA 1COV3 1NA1B 1TMF3 1VRH1 1RUC1 3J8F3 1D4M1 1VBE2 1ZBE2 1K5MB 1MEC3 1DDLA 3DPRC 4Q4V3 4CEYB 1VBC3 4GB32 2RS11 2HWD1 2HWF1 3DPRA 3JD72 5AC92 4Z92B 1FPN2 5K0UB 1X33A 4FTSA 4FTEA 3VBFB 1PIV3 1MQTC
chains in the Genus database with same CATH superfamily
3CMGA 5A7OA 2BOJA 4D7SA 5BNOB 1Z78A 1F9KA 1MQTA 2QBXA 1I9RA 2QDNA 3KF5A 3VZJA 3ACIA 3KWVA 5FRAA 1RMU2 3U1XA 1JZ8A 2EALA 2ZEWA 2FMDA 2XQRA 4ARYA 3HPNA 4HSJA 1JHJA 3P3PA 1OHFA 5LBCA 3SH5A 5JUVA 3NV2A 1K45A 1UYYA 4QQHA 5EPAA 5FO7B 4AHWA 1BEV3 3WHUA 2HEVF 4Q4X3 5FDBA 2IXKA 2V72A 4BXFA 1PM7A 1XSRA 4XJWA 3ALQA 3I2JA 4JAAA 4N53C 4WBBA 4CU9A 4CU8A 4LKDA 2WZR1 4JC1A 2XOMA 2VD7A 2P3YA 2YUEA 1WW4A 1TQ5A 5F6LB 3NJYA 4TTGA 1PGL1 3OGGA 5F9TA 2RDSA 1L7RA 1ZBE3 3H7YA 4PBOA 2VQ0A 1ODNA 4QPGB 4UFJA 1Y7BA 3FLTA 5KC6A 3C7HA 2P37A 3WW2A 1PHMA 4RR3B 4Y20B 2PHRA 5A3WA 5CAZA 3F95A 3POIA 5CFDB 4XIKA 1COV2 4XAAA 1TMF2 1QGLA 3RZHA 2BOIA 4CEWB 1ASJ1 2QVSB 3FHAA 4ZS2A 4CU7A 4Z2AA 1ULGA 3VD4A 1CZTA 3LA7A 4MHUA 5A7NA 5BNNC 3PUIA 2DUOA 5JXJA 1RVF3 1X50A 2FDIA 2VQTA 3I3QA 5IVCA 2W95A 3FX3A 4QU1A 4AGRA 1X82A 2QQUA 1AXZA 4QPYA 1J1LA 5LEKA 4TSVA 4L92A 3WEZA 1OVSA 5KWRA 2E26A 3POBA 4LXLA 4CCCA 4X8PA 2VPVA 3R05A 2BBAA 2DF7A 2ZX3A 3I3BA 4FPCA 1DYPA 1S55A 1SFYA 4AI2A 1RUOA 1RIRA 1CONA 1ZA4A 1NCQA 2WT1A 4L0PA 5A33A 1UYPA 1OH3A 4GWNA 2VZOA 1R1A3 4M0HA 2Y38A 4M0NA 4HL0A 1VMFA 3WX5A 3I2DA 4B4RA 4FSJA 1YI9A 2ZHLA 4B3NA 4DUXA 2VMFA 1W9WA 4QXCA 3RJRA 4QGLA 2VCAA 3VBRA 4NR1A 4UBGA 1AZDA 2CGPA 1TNRA 3QACA 4AVVA 4RSUA 1ZZ9A 4AQ6A 2K46A 4AE2A 3HNMA 1J58A 3FHQA 4Q4W2 1WMFA 3M3EA 1Y4WA 1QXRA 1F2NA 4GKXA 3WSOA 1QOTA 1AX2A 1I3HA 1R091 3VZNA 4CPBD 5LA9A 4YM1A 1W3XA 4CP1A 5F3CA 1ZBA3 1GU3A 4ZPIA 4BM8A 1DZQA 5DAQA 5J36A 5I0UA 2W92A 2QZ3A 3HQUA 1GZWB 1UO9A 4KBZA 5FPAA 2UYBA 2ZGOA 1JODA 3PU3A 5K0UC 2Y6KA 4TYSA 3TB0A 3S57A 2A6ZA 2GNMA 3AZXA 3VBFC 3MIFA 3VBSB 1ZRRA 5DZGA 2H6BA 4COVA 1JYVA 1V00A 3UGFA 1HV1A 2JJ6A 3POSA 1V6LA 2W5FA 3RZGA 4AAPA 1I6XA 3BPZA 2YXSA 1LU2A 1UY1A 4HT1T 4PLNA 2WKKA 4Q0SA 3WV6A 4AHYA 1H8TC 4CDQB 4V2VA 3CJXA 4UT5A 1QOSA 2P1BA 2DCJA 1TE1B 3OD4A 2ADDA 1W9FA 3BN6A 5AVPA 2JDAA 1WMEA 1IS5A 1YLLA 3WP4A 1QJU1 1J84A 5KXEA 4YW5A 2V5DA 3ATGA 4TXWA 4N90A 5BXXA 3ENRA 1C4RA 3KV9A 3ZFGB 1HB2A 4XFFA 2J1TA 3U4SA 2Q0AA 5HV0A 2ZAHA 1CAUB 1QDOA 4EN0A 1FMD1 2R062 1PO23 2QCSB 5CIRA 2ERFA 3NJVA 3ETQA 5A6YA 4AOCA 1MZEA 2AENA 4UFMA 2VXJA 2W46A 5EZWA 1OFSA 1FOD3 2BNOA 2E31A 2AZ5A 2DUQA 4OCTA 2ZEXA 3UETA 3GCXA 1ND2C 2MPFA 3M3OA 4HKOA 1MS5A 4NHMA 4XILA 5JXHA 2W2IA 1R083 4BWOA 4ZZ8A 1UIJA 4JV4A 5IFTA 4W6XA 3T4VA 4PHZA 3T1MA 2XL7A 3J8F1 1ZRDA 3AC0A 4J6GA 3AL5A 3CZJA 3OPZA 1Z7S2 4EWEA 3WP5A 1LULA 2R7EB 1S0BA 2QQIA 4JKKA 3UJQA 4CDUA 1I5ZA 4RS5C 2Y34A 5IUQA 4HBNA 2NM1A 3OOXA 1LOCA 4Q4V1 2ZX1A 3AZZA 4NRMA 1OOPB 4XTPA 3ZXJA 3JCIA 4COWA 2VZ3A 3DYMA 5DDJ2 5EYXA 5LCWL 1SBFA 1N1YA 1WW5A 2R073 2R1BA 2J22A 1DQ4A 2I2SA 2V5YA 4QX5A 4MXWB 1JYNA 4FQZA 4A42A 1DQ6A 2X53S 3NAPC 4JDOA 1OURA 1H4GA 3NJZA 2VUCA 5HCAA 1GKBA 5FMCA 1SZBA 4D6QA 5C8CB 1GFF2 3THPA 4S2GA 4YW7A 2D3SA 2O8QA 3HN1A 4ZKTB 2JKXA 3ZFEA 1GP6A 2JG9B 4MGZE 2DCZA 5FZ7A 3I2KA 5CVRA 1PZ8A 2WFPA 2Y6HA 5A7PA 3RFRA 1UKGA 1Q8PA 4LK6A 4C90A 1HX6A 4ZS3A 3AP5A 4QDRA 5IAXA 4JRAA 4L11A 4E4HA 4QHOA 4W6WA 1A3KA 2Y26A 2CSGA 4JDMA 2E7TA 3OY8B 2FZ2A 3LZZA 2XUMA 3ZR6A 4GALA 1F4HA 3RNSA 3ZYPA 1RUC3 4ORFA 2ZEZA 3AXDA 1KDKA 1G9CA 2YMZA 3FBMA 5C9AC 2D97A 3PTRB 4LPLA 2PAKA 3TAYA 2K2SA 1DF0A 1D4M3 1TEIA 4LBLA 4I3PA 5A7WA 1PGL2 4UF0B 1NAEA 2WL1A 5FZIA 1NLQA 2WS92 1QDCA 3ACFA 4FPKA 4FO9A 4I0BA 5EWSA 1HQNA 3AMHA 2GNBA 2E53A 5FPZA 1OVPA 5FJKA 1XBFA 4E4SA 1OA2A 1PGSA 2FD8A 4NWVA 2CL2A 1CAVB 4EZHA 5I93A 1ASJ2 3GF6A 2WBKA 1ZBE1 2VW1A 2WLQA 4HFSA 3IKWA 4PDWC 1ULFA 2LROA 2WT0A 3PIGA 2XG3A 2CDPA 1ALYA 2XH6A 5GLWA 5FJHA 1FI2A 1ENXA 3ITQA 5IFPA 4BQXA 2VTXA 2Z2SB 3UESA 5IW0A 2VMEA 1DGRN 5EJZB 3IDCB 1RTVA 4B4QA 2ET7A 5GJ6A 4MSVA 4W8JA 4AEKA 1RVF1 4AL9A 4CCEA 5IHRA 2ZGTA 1OPMA 3SCFA 4DNYA 4D6RA 2FDFA 4NRQA 5T5JA 2ZJCA 4Z8BA 3BOPA 3VHRA 4FP2A 2OXBA 3H3ZA 1WMXA 3P1IA 5DAXA 2D93A 4ZU4A 5GZDA 4XF3A 2DVBA 1W2TA 3DV8A 4EROA 3T0DA 3GXUA 1PNGA 1HQLA 4YNIA 3USUB 2FCUA 3BALA 2ZGQA 4QM9A 4XF9A 3EBRA 2ARBA 1R1A1 2VBBA 4PQ9A 3ZYFA 1POV3 3RYPA 4JCKA 4CPBA 3PJQA 1YHFA 3W58A 4AVTA 1PO13 2TUNA 3SC7X 3UGGA 4XACA 2RMU1 4HN1A 3HBKA 2AC1A 1R092 1MACA 1CIYA 1O4TA 2WNVA 3JB8A 4XCBA 3QD6A 3BTAA 1XC6A 2D6PA 5FZOB 3VBHC 1V6OA 2KM2A 4GH4A 4HVQA 3RMXA 1W8ZA 1OLME 2HBUA 5FR3A 4GZ9A 1B09A 2E32A 3AZVA 3BB6A 4NWWA 2GSYA 3VBUC 4ZXEA 3O1SA 3BTZA 1MPXA 3N9MA 1XNDA 4AI9A 1ZBA1 3N9QA 1WD4A 4YZ2A 1LB2A 5FZAA 1ULPA 1X8EA 1RJ7A 3N9NA 2FZ1A 1FV3A 4YVWB 4FOQA 1SLCA 3JXSA 4QKFA 3MFCA 1ZX5A 2X29A 3N9PA 3VBOC 2V09A 2WO3A 5D8AC 1PX3A 4COYA 1S0FA 3DCQA 1OT5A 1V6MA 1QJZA 4RGKA 5FKCA 3H8RA 1OD3A 2VXRA 2XBO3 4BQYA 1XXNA 2WABA 4M3CE 2G19A 1SDWA 2XDVA 3RZKA 1Q5OA 2D98A 2RR13 4IV3A 3ZOIA 3BKZA 2O1QA 1QWRA 3WP6A 1VIWB 3ZYGA 2ZX0A 2WZPP 3TEXA 1JZ5A 5IATA 2J42A 1VB2A 4RN5A 1D2QA 1EP0A 2PQSA 1QJU2 3PVBB 1LECA 3K46A 1UPIA 4P9GA 1V6KA 3RYRA 3NQHA 5EFUA 2Q1MA 2DVFA 4QX3A 4ATFA 4JGYA 5FZ8A 1UYXA 4XZUG 1HRI3 2DTWA 5F5IA 4MVTA 5FQ0B 4BJ0A 5ISLA 5JOZA 1S2BA 1GWMA 4IE6A 3H42B 1LJ7A 1W6QA 3POGA 5DQ0A 1YRZA 1LGBA 4QXBA 4CZSA 4MUVA 4D69A 3GCWA 4KH9A 2E7QA 1VBE3 3A21A 3K4AA 3T30A 5FK7A 1BZWA 4AFAA 5EJ1B 2VTFA 4MGIE 2I45A 1PO21 3DL3A 3K48A 1IOAA 2IWGB 3Q8BA 4FP3A 3ABZA 4CUCA 4FPHA 4IW3A 4KWJA 3C7GA 3LA2A 4Y1YA 2JG8A 1FOD1 3PNAA 5FBZA 3J8F2 1DQ2A 3H1WA 5AC93 1NXMA 2W91A 4N53B 4NN0A 1FPN3 3VD5A 5I0RA 2GC2A 5DABA 3CJIC 2EXIA 1R081 5F5QA 4IE4A 1KITA 2X5IB 2JDYA 5J96B 3B5LB 3ZSJA 4Y5TA 3G7DA 3B7MA 4XMIA 4CXWA 1O7FA 4Q4V2 1AR61 1C5HA 1EAH2 2UWBA 3WDVA 5E16A 1QJY2 5FXVA 1C5IA 4FXKB 2GN3A 4DEVA 3LEMA 5J7MA 3RWKX 4WVZA 4AK3A 5ABJB 4KWKA 3VZMA 3TEWA 1CQ9A 5A32B 1NY71 3HEIA 4AI3A 1SLTA 4CU6A 3HR9A 3NNLA 2DCKA 4AVCA 5BNNB 2XJUA 3VDDC 2R071 2ZTNA 2HYXA 1S0GA 3PUAA 3WZ1A 5FO8B 2EAAA 3U0ZA 3O1RA 1EV13 3UKNA 3TRSB 5JZGB 2W68A 5FZBA 4CCMA 4PLMA 1NA1C 1KGYA 4COZA 1CZVA 5C6CA 2WINB 2PHUA 4ZU7A 1E57A 3Q8CA 1TNFA 3PHMA 3OUJA 4R9DA 3JBG3 5C3QA 2HJIA 4HVOA 2I74A 4LIUA 5LEJA 1W6PA 3MIHA 3I3MA 3LCPA 4WVMB 1IS4A 2MEV2 2RG4A 1IKPA 1XNCA 1TME2 1RYYA 2ZGSA 2ZMNA 3IZOA 2YBKA 2QQPA 1FV2A 1D7PM 3D82A 1QHDA 1O8SA 3VUOA 1UYZA 3V0AA 2OKXA 4QWNA 4XJAA 3A4UA 2VZRA 4WV8A 1CGPA 3MIGA 4UFLA 5A7QA 2QQVA 2CWMA 1WLTA 1RUC1 2GH2A 5FWEA 5HCFA 1N3OA 2A75A 2OW4A 4I0WB 1S4CA 1D4M1 2KR2A 4TLFA 5FP9A 2P34A 1H4HA 1ZBE2 2N7GA 3NJXA 1GV9A 5E1RA 4LHNA 4UWDA 4NHKA 5GLUA 1DHKB 1XNKA 3WNXA 4I02A 3DPRC 2YFUA 2MHFA 1VRBA 5B4XA 5IVFA 1AXYA 1YC61 4LT5A 1W9TA 4A45A 1BQPA 2HWF1 3S5AA 1UU4A 4OZOA 2GC0A 3A7QA 1ZZ8A 1S0IA 2ZGMA 4DPNA 3OUIA 3VDAA 5K0UB 4OQ8A 2JB4A 4OMCA 2CAUA 1CJPA 2NPIA 4FTEA 1OA3A 2IC1A 3VBFB 1PIV3 2ZS6B 2ZHMA 4K1ZA 1MQTC 3KSCA 2ETEA 5IK7A 2A7AA 2TNFA 4MGSA 4QXKA 1VAKA 1WBFA 4W6YA 1V6NA 1H8VA 3DKWA 5F3GA 1W6MB 3QBQA 3ZMOA 3PVOA 1DFQA 5FY4A 5HI0A 5JIAA 1H8TB 5LK7B 4CCNA 4QB2A 2IFRA 4B7EA 1OQDA 3QCWA 4XDPA 2CY6A 4KU7A 3VHOA 4CXYA 5FPVA 3T2QA 1PZ9A 2RMU2 1W6OA 3HOBA 5FZ3A 2NP0A 1LTEA 3NNMA 4AR2A 4KWLA 1CIWA 1W8TA 2VW2A 2R6QA 4QMAA 4HKLA 1QQP3 1WW6A 4Q5OA 2Y0IA 4YZ5A 5LZ6A 1W39A 4RR3A 4HOOA 4LIVA 4X6RB 4OI4A 2NLRA 1PO11 3K4DA 2OIIA 1LRHA 5KR7A 3O1TA 3NKGA 4N9HA 2ZKNA 4LO8A 3FFZA 1SEFA 2PHXA 3H7JA 4CEWA 4EN9B 4XHXA 4OQ9A 1XSQA 4NHYA 1ND2B 1DZTA 4LO6B 1REEA 3GBWA 3HQXA 5FZ4A 4XMAA 2ZXQA 3KS7A 3KZ4C 4QHZA 5F39A 2JB8A 3GZUC 1F4AA 4OMDA 5JPMB 1ENQA 3M1HA 4W50A 3LSEA 3P6BA 1UZWA 3V56A 4SBVA 1RUI3 4XF0A 3A23A 2RHPA 2XWBB 4YG3A 5F3IA 5L19A 5IVVA 1SDDB 4UFHA 3ACGA 1UX7A 5FV3A 1GNHA 3NV4A 2YB7A 2XL9A 3PLQA 4BQ5A 4R4XA 4AVAA 1RHI3 2ARXA 2QFEA 2ZCWA 3RPQA 4F8AA 4OUMA 2IXIA 3E5XA 3RZZA 2K9ZA 2DDUA 4RS5B 3ZYIB 4RQPB 5J37A 3VKMA 4Q1PA 2ZEYA 4WM7B 4DS0A 5CBLA 2XBO1 1NCQC 2E7AA 5J1XA 5FKBA 2QQJA 5DPNA 3QOPA 1NXD1 1WZXA 1KQRA 3WP3A 2IXHA 3CL1A 5BNPA 3VBRC 2GMPA 4OVEA 1BLZA 5ANNA 4JX0A 1JZ2A 3AKQA 1VAVA 5GALA 1AYN1 4L8QA 5A3UA 1ZRCA 5GLTA 1AVBA 3OF1A 1HDKA 2VZVA 1R1ZA 4PJYA 4KGQA 1JMUB 1HRI1 4QDSA 3WDUA 3ZM8A 1PO22 4BHPA 4BZ4A 5A6XA 1TVGA 3AFKA 4EV0A 5B4NA 2WNUB 5FBJA 3GYDA 2GNTA 3LPGA 4B1LA 2ZA9A 2HWD3 1FOD2 4QD2A 3SEPA 2WUHA 3POEA 1GZCA 2EIGA 3KD4A 1DZRA 1VBE1 2RDQA 2BQPA 1OMIA 3PJYA 5IK8A 1BYHA 2D6OX 3C8XA 1R082 3D5OA 3H50A 5FTTC 4LK7A 1C8NA 3VBSA 4BLIA 4NMIA 1K5MA 4CCKA 3I3EA 4GD4A 1A6CA 2NMOA 2EXJA 4BDVB 1AR62 4GIQA 1G9DA 4BH9A 1O3QA 5JXIA 5AC91 2G1MA 2YC2A 3CEWA 3IBMA 1XU1A 3I97A 4QKDA 1FPN1 1SPPB 1AR73 4AGGA 4BB3A 4U36A 1SQ4A 1RUF3 4QKNA 1DCSA 1DYKA 1L3JA 1O59A 4CDQA 2Z4FA 4TWTA 5FPBA 5T54A 4CUGA 1JUIA 2ZGLA 2C4XA 2AEZA 1NY72 3VL9A 4K9SA 1J83A 2D3RA 4WZFA 5A7SA 1VBD3 3OEBA 1SCSA 4NHLA 1CN1A 5FYSA 3WQ0A 2UURA 2PLV3 2BFUL 1RUE1 4AF9A 3CKHA 2CNAA 3JU9A 1N3QA 4RGGA 3VZOA 2OPKA 1H2NA 1PM4A 1WMDA 4P9WA 5CA6A 4LMFA 3ZDSA 4ZZ5A 1V0AA 2WAOA 4CVUA 4P9YA 3WHTA 1FNZA 1W2NA 3AKRA 2CDOA 2NMNA 4LHKA 2RJ2A 4FPOB 3ROUA 4KBBA 2A73B 2JXAA 3KVBA 4QPIA 1J3RA 3W20A 3ZX7A 1RUJ3 2DURA 3URFA 5DZEA 3DKQA 1G9FA 4IETA 3JBG1 3MW2A 2YFZA 4DY5A 1QJX3 4DOUA 1CZSA 1JUHA 2CV6A 3VL8A 1I1EA 2PHFA 2R041 2RS33 5ACA3 4XF4A 4AI8A 1HXS1 3DEMA 3LAGA 1D4M2 4MH0E 4RYDA 4Q0QA 3KT4A 2C6SA 3N7KA 1DLLA 4LO5B 5E6HA 3VBHB 2AR6A 3AVRA 4IQPA 1XQNA 2DVGA 5ANQA 1OI6A 4DUVA 1W9SA 1JYCA 3MF9A 5FYBA 4AI0A 3AMNA 4OHXA 2VH9A 2VQAA 4CDUC 3HIFA 4H7MA 3WDXA 2HWF2 4RFRB 2XJQA 2QQMA 3C2UA 4PIZA 1N1TA 1PVC3 3VBUB 4K40A 5J98B 1YEWA 2VBDA 3AZYA 5CISA 4PIYA 2DBNA 4D7YA 3N4MA 5GKAC 3C7FA 3DUIA 1OFNA 2G9FA 5C8CA 1T2XA 3TEYA 5H9PA 4BA6A 4M3CF 1SLBA 4CSWA 4CUAA 4UFKA 3MLKA 2JG9A 3VBOB 5BNQA 3MUY1 4MOAA 1KFUL 1NCRB 1UD1A 1H6YA 4Y5SA 5D8AB 4CDWB 3BU7A 1Q8VA 2Q5TA 4ZY9A 3ZFEC 2LM3A 5C3RA 1DBNA 1LEMA 4JKLA 4Q8LA 4AAXA 4DRRA 5CADA 2E9QA 4JQRA 4OUEA 3MF6A 4NIIA 2QDRA 2X8KA 3FWEA 3PIJA 5C4WA 3D0JA 4YM0A 2OS2A 4XJZA 3J7NA 5JMCA 1RUH3 3VD9A 1AL23 4GWMA 1QNWA 3ZN6B 3WW1A 1PK6B 2A1XA 2W87A 5BPXA 3WY6A 2VZTA 4LR4A 2GP5A 1W8FA 2QJVA 4XDQA 3WNNA 2IXJA 3J7HA 5CYYA 1JH5A 1XJAA 3ZLIA 4QX7A 4S2HA 4RFT0 1X8MA 3OYWA 1VRH3 1PO12 4IGPA 5DN2A 5CFCB 2VOKA 4BYYA 5JR2A 1CAVA 2WN3A 2VZQA 2BFUS 1UMHA 1CESA 1LR5A 1X36A 4XUTA 4H3WA 3WUCA 1LENA 2GC3A 5FZ9A 4QGNA 4XF1A 1EY2A 1FXZA 1B35A 1AUYA 1QQP1 2QNKA 1U5ZA 3LF7A 4K7JA 4WVWA 5KBFA 4FCAA 3WDYA 4AVBA 4YPJA 2Q8OA 1AJKA 1YQ8A 2VGDA 5KXBA 3IDEA 2RS13 1A78A 2UU8A 3ZO0B 5C3SA 1BVP1 3SITA 1ULDA 5IWFA 2ATFA 3IMMA 5JOYA 4MG2A 3CJIB 1GZ9A 5FZ1A 1W04A 4OYUA 1RUG3 3ZYJB 5L9RA 2ZMLA 4Y3OA 5CKNA 3B01A 4C0BA 2XKOA 4AEDA 2D6KA 1O3RA 2VUJA 3SISA 2EXKA 4KG0A 2XBO2 1UMZA 2A3WA 3JD71 5FAXA 4CTEA 3LGRA 4XJ9A 2YV8A 2R32A 3AMPA 3M2MA 1SBEA 4Q2FA 4RGAA 1WBLA 3USUA 4YARA 2WYFA 2WWUA 3VLBB 1VBA3 2JDHA 4JGZB 3CBNA 1H30A 1WW7A 4IL7A 2RS53 3KLSA 1JW6A 2GU9A 3GZEA 2XJTA 2R1DA 5DZFA 2DWRA 1AYN2 1ND3A 3KMHA 2VVDA 5JSRA 3E1F1 1GQPA 5FMBA 5FZOA 4V1PA 3ZFEB 4DY3A 2IVIB 2YY1A 3S7IA 4N9IA 2A6YA 2XQXA 1HRI2 4ES8A 1CAWB 2D43A 2BNNA 3E5UA 4YM3A 1O91A 1S2EA 2Y0OA 5I8TA 2WNVC 1W90A 5LATA 4CDXA 2C9AA 1YFYA 3J7MA 4N43A 4GH4C 1GICA 2ES3A 4MGQA 2Y6JA 4RHV1 1SLIA 2G9GA 2ZX4A 4MX3A 1Y43B 1JZ7A 1PX4A 2DYCA 4YSFA 3WG3A 2VULA 2HWB3 4YVWA 4NIAA 3SH3A 1L7QA 2BDRA 4I01A 2Q1ZB 3Q8AA 3M4FA 4X6QB 5F32A 3WNKA 5CG9A 2DCTA 5JLVA 1N3PA 3MBWA 4Y22B 1ZYBA 1BBT3 1MS9A 3WXPA 3LFIA 1X9PA 1O4YA 2WFF1 2ZABA 1W9YA 2J1UA 1PMHX 3AYEA 3J7LA 3LFMA 4ATEA 5SV5A 5KHKA 1S0EA 3IWZA 3PUHA 4A3XA 1ZZCA 2TBVA 4RL7A 3CF6E 2HWC3 3GNEA 4HSLA 3AJZA 5EV7A 4IV1A 1JU4A 2Y60A 3DPRB 1LNSA 5FZHA 4IV3C 4XCAA 2GMMA 2P3KA 4O9EA 4E2SA 1AR71 1VMHA 1E5IA 1RUE2 4Q0PA 1W0NA 1RUF1 1UU6A 3T2OA 3OD0A 4OLLA 4CCLA 2UY8A 4YRDA 1MEC1 2WNEA 1IG0A 1UY3A 4WM8A 5B2GB 1VBD1 3I54A 4HXCA 4XQ4A 1EUTA 1VBC1 2PN5A 4JGYC 3VKFC 4LNVA 4MYEA 5FZGA 2Q4SA 1MQTB 5FXZA 3BPSA 4MGYE 5FK8A 1FATA 1O5UA 4PT6A 5D2AA 3K51A 4Q26A 2O14A 2BGCA 4AFBA 4CUBA 2VNVA 3T3YA 4QX8A 4UAPA 1RJ8A 2LW8A 1OKQA 1MZFA 4FTBA 5FYZA 2ZPXA 3A0NA 3ES4A 2R042 3LE0A 1EYBA 4N53A 1JZ3A 3OBZA 3O7OA 3VN4A 3S7EA 1HXS2 2DUPA 1SLLA 2JG8C 1RUJ1 1WA6X 2VCCA 3C3VA 4LLFA 5FPXA 5FYYA 2GAUA 2X5IA 3T08A 3LD8A 4FPLA 2XXZA 4Y1XA 1NUKA 1QJX1 4GB33 4FOWA 3ORJA 4YVSA 2R49A 3SQOA 3ZIWA 2VUDA 4NPLA 3ZXLA 3TNPB 2RS31 2RVAA 3G6JB 4IEOA 4BMEA 1OH4A 3WQ1A 2Y6FA 4GJZA 3TOJA 1ZZ7A 1KXGA 2OUJA 1IPJA 2WZR2 2Z42A 4V2WA 5LK5A 4BLJA 5ABJA 3I2OA 1GMMA 2PMWB 1YQ6A 3OEAA 1BEV1 2HBTA 3IPVA 1UOFA 3KT1A 1LOFC 5GZEA 1YIPA 1RXFA 2D44A 4Q4X1 4EYUA 1REFA 3ZN5A 3EHKA 1US2A 1JZ4A 1C28A 3AP9A 4GQ7A 1XRUA 3M7AA 1PVC1 4H7LA 5FYUA 3WR0A 3RZMA 5JZGA 1CVNA 1POV0 1MS3A 3D0SA 3AM2A 5K4LA 2QKDA 1RMU3 2RDRA 5J48A 4LITA 1QJFA 3AX4A 4MO3M 4LBNA 1W6NB 1LEDA 3GJAA 3OGRA 3R0RA 5JAXA 1LU1A 5KXDA 3H8XA 1OA4A 2SBAA 5JXGA 1W8HA 4PQQA 4KU8A 1G7YA 3W59A 3OGSA 4HONA 4NO4A 3ZFFB 4E8CA 3ZSMA 2PFWA 1NCQB 5A33B 4FOYA 3D4KA 1PZ7A 1VAMA 3EB7A 3VKNA 2WYSA 3FN9A 1NE4A 4AWDA 2A71A 4UYBA 3CNAA 2VQUA 2OQ7A 3AFGA 4X8NA 3O0VA 1K5JA 1LOGA 1XNBA 1RUH1 3NV1A 1AL21 1UY2A 3B94A 3VBRB 1J3QA 5A1AA 1H2MA 3WG4A 2H0VA 4PF1A 3S6PA 3T0BA 2EA7A 3ZXGA 1G86A 1O4ZA 4DINB 4ET7A 4IEXA 2B8MA 4XABA 1COV3 4XBQA 1VRH1 1TMF3 2WO1A 5C5UA 1IQAA 5GLZA 2AREA 5A3MA 2X05A 5FZ6A 5D21A 4XW3A 1JOBA 3GHNA 4QT6A 4M4PA 4HPKA 5CZKA 1SBDA 4LKEA 1RXGA 3WT3A 5I0DA 4Y24A 3AKTA 1V6JA 3EJKA 1DQ5A 2HEWF 1W8NA 1CAXA 2ZGRA 1LGCA 1VP6A 4CEYB 5JPNB 3ZXFA 4O65A 3A22A 2RS11 4XEZA 2YDEA 3TEZA 4KL1A 4HETA 3V0BB 5FUPA 2VR4A 4B1MA 3LA3A 3JD72 4IEUA 4K21A 4Z92B 2YZ4A 5FPLA 4LJHA 3CZUA 5DUXA 5IAVA 2QQNA 3T0AA 1V70A 3FLPA 3DXTA 3MEPA 2W47A 4I30A 2BW8A 3IAPA 1YIFA 1HJGA 5APAA 2PHLA 1CPMA 4B8EA 1M06G 4AW7A 4IEVA 4NPRA 5JOXA 2DCYA 3IB3A 2D6LX 4FPGA 3UV9A 2O0OA 4DQAA 1VBA1 2ADEA 4Q4W3 4A7YA 5L7OA 3K4ZA 2GN7A 4YGDA 3ILRA 4OULA 2RS51 2W1QA 5FLIA 4NOTA 4QU2A 3BIWE 5FY0A 1QKQA 1POQA 4YFWA 1AR83 5ERLA 4NVPA 2JDKA 3WNLA 4AVSA 4XC9A 3I49A 4Y4RA 4RHV2 2OA2A 1HRV3 3MIBA 1UZYA 1FYUA 2YPJA 5JDBA 4XE9A 3T2PA 1ONAA 1DGWX 3ST7A 1OLMA 4CE8A 4OFGA 3AMMA 1DU3D 3RJ2X 1PVXA 1QEXA 3RI8A 3ZMNA 5DAVA 1FMD2 4ZHNA 4CEWC 2LRPA 3U11A 4D7TA 1MZ5A 5CKQA 5F3EA 5JR7B 1XYPA 2GALA 1GZTA 1Q8SA 2A6WA 5SV8A 2WDBA 4E2GA 1UX6A 2PTMA 3ZYBA 4R9CA 2WFF2 4ZU5A 4E8DA 1OQEA 4IERA 1TG7A 1YO8A 4C8DA 3D3AA 4GXLA 4RQPA 5LY2A 2AYHA 3D8CA 4R9AA 3U37A 1QU0A 4KQ7A 3T1LA 3BGAA 1BBT1 4WM7A 3POYA 2YPDA 4ITCA 3K3NA 4FFHA 1UL9A 4XFGA 1AR72 4M3CA 4CDUB 5I0SA 3AYCA 3NL1A 3UKVA 2YYOA 3H9AA 3QH7A 5CNAA 3EQEA 2XHNA 3KGLA 1X9TA 2YHJA 2X09A 4KG8A 1C1FA 2WR9A 2HWC1 1OF3A 4JDNA 4JTNA 1MEC2 1U12A 1VBD2 1IPSA 1DGWA 2BGOA 3O0XA 1VBC2 1YFUA 3AYDA 3I8TA 4YYOA 4DB5A 3H8UA 2GMEA 3PURA 1YUDA 3D6EA 3MHZA 4PCRA 1MS8A 1L7LA 4K8RB 4D0QA 5BNPC 2R063 5DG2A 2A3XA 1V9U3 1OPOA 3R4UA 4HMZA 3NNFA 1S0DA 3MYXA 4RA0A 3HT2A 3NRUA 2XR4A 4XURA 5H9SA 3TN93 1CX4A 4DXSA 2ZMKA 3BIEA 1VBB3 2WNUA 2FDHA 4BQ3A 4AEJA 5CB7A 2YGMA 1AR93 1GUIA 3B02A 1DG6A 4O7XA 4W4ZA 3VHPA 3IN9A 4M4RA 3U14A 4DIQA 3RDIA 1YQ2A 5H9QA 4ASKA 5FMDA 2G4IA 2XUEA 1HB3A 3EMRA 2WZ8A 3IT8A 3WCRA 4RD7A 1RUJ2 3BYWA 1WLCA 3V65A 2A6VA 2XVKA 4NJ4A 4XETA 5FO9B 1QJX2 2EAKA 4QQOA 4XBNA 2WO2A 5DAWA 1NQDA 1K3IA 2RS32 3MIEA 1CD3G 1D0HA 1Z7S3 1JYTA 1XE7A 3VBSC 1SPPA 1K5MC 3ZXEA 5A7WB 3E6DA 4GMP0 4YW4A 3UK9A 1JS9A 1BEV2 1JOJA 1UY4A 3THTA 4G3YC 5IVBA 3ASIA 2W39A 3BU0A 4Q4X2 5DDJ3 5FZCA 2R30A 2E51A 2DV9A 3IM0A 4CDQC 5LRSA 2J7MA 5FZ0A 4UFIA 5FZMA 3MW3A 2BU9A 2WAAA 2JDUA 1PVC2 1BVVA 1MVEA 1RGSA 4YW1A 1KJLA 1BCXA 3HMYA 3ETPA 3L2YA 3MLJA 3OPTA 2VOWA 1E5HA 2YG0A 2VL4A 4URAA 1Q43A 4KI5M 4Y5Z0 3KV6A 2WNOA 2W94A 2GNDA 4IEPA 4XAEA 5GLVA 2ZZJA 5BNOA 1C57A 3LPFA 3OGVA 4R9BA 3WVJA 1KFXL 2ZHKA 2YU2A 4XFAA 1KRIA 1YCIA 3B9IA 1AXKA 1RVF2 3NNGA 1QH7A 2VCBA 5JIUA 3JQXA 4GMP3 1A8MA 2WO7A 4QPIC 1RUH2 2R16A 5KHIA 1ZREA 5HPOA 4BOWA 1ZM1A 3IDBB 2PHWA 4D8MA 1MS4A 1Y9QA 2PXJA 2WS93 4INDA 2VO5A 1HB1A 3B69A 4FPFA 3VBHA 5BV6A 4UW4A 4EN6B 5EYYA 2WWSA 4P14A 4BQ2A 2A5ZA 2Z79A 1R1A2 1VRH2 1DQ1A 1DGRA 2WNVB 2B46X 3ZDVA 4JZRA 3NKTA 3VBUA 3O1MA 3VDCA 1XNAA 4BXSV 2ARAA 4XDOA 4XXAA 2D5HA 2ZAAA 3O5SA 1W0OA 3DYOA 5G04L 4QPGA 4EJRA 1COV1 3KHCA 2HYKA 1H2KA 5JSPA 1POV1 4XPVA 3SXWA 4Y20A 3S5QA 1NYWA 2RS12 2XB6C 3ZXAC 3HJRA 3LIGA 5CFDA 1NCRA 4CDWA 2IXLA 5C8CC 3VD3A 4FFIA 3VHNA 1W2UA 1GWLA 2VY0A 2WJSA 3ACLA 3HT1A 4JHTA 4XYXA 1GQGA 4QHBA 1ZBA2 3BODA 5FZEA 2FDGA 3VGIA 2C24A 4YZ4A 2XJVA 1YFWA 2ORZA 2XLFA 2RJKA 3LEKA 1IZ3A 1H9WA 4A4AA 4EWDA 1I5PA 2P3IA 4C1WA 3BCWA 2C0ZA 3N9LA 4IV3B 3WG1A 3ZN6A 5C4WC 1PK6A 3M3CA 2O8OA 2DTYA 2W1WA 4JVAA 4J1WA 1UAIA 4LBKA 2PAEA 5EXOA 2OPWA 1VJ2A 5CFCA 4O61A 2BWAA 5K7PA 4WZCA 4JGYB 4XQWA 5FZFA 3K3OA 2Q8CA 5EIYB 5FP8A 4IE5A 1JOPA 3OBAA 4QPWA 4LKSA 4Q4W1 4QB1A 2RR11 2VMHA 3MV01 3NAPB 2RM23 3MV11 5FYMA 1AR81 1B35C 1WCKA 1GP5A 3RSJA 1HRV1 3F2ZA 1G6NA 2RDNA 3ACHA 3LEIA 4URTA 3WUDA 4DXZA 1GOHA 1V6IA 5FWJA 4A2UA 1UCXA 5I0TA 1LAJA 2BZDA 1OXCA 3ILNA 3KVAA 4LEJA 1Y9GA 5LBEA 2ZKLA 5FY9A 3V64A 1GZWA 3WNMA 1LKNA 1BBT2 2B9VA 4Z07A 1OBNA 3R4DB 3KQRA 4IXLA 4QQLA 1HLCA 5FP3A 2JD4A 2DBIA 3KF3A 5FYCA 3N7MA 1F35A 2B5HA 5HV4A 1O3TA 3M3IA 2WSVA 3USSA 3VZLA 4AEDC 2OVUA 1HV0A 2WC2A 4R52A 5EHDA 5C9AB 4JGZA 2P5BA 2VCMA 4CXXA 5I8SA 1SLAA 1HB4A 1US3A 2BP6A 5E88A 5FXWA 3AKPA 1J59A 3O12A 1IG3A 1LODA 1JYWA 1MR5A 3BOWA 2KXLA 3OTFA 4NIDA 1OD5A 3KM5A 4CP9B 5HBAA 4BK4A 2WQ4A 4H55A 4F83A 3RWNA 1E5RA 3NVCA 2FMYA 1ND3C 3ZKUA 1BJQA 2YBSA 4QGMA 4PDWB 1C8M3 1RUNA 2BPA2 4ASLA 3HD8B 3RRDA 2R072 3BUCA 4UW3A 2K0GA 1RINA 1A8DA 1IHMA 2R061 5LBBA 3ZFGA 1RITA 3ZXKA 1V9U1 2V73A 5LA2A 4CDXC 5KHGA 2J1EA 4N43C 2XJRA 5L9VA 1W8OA 3TN91 1CAUA 1VBB1 1W06A 5FCCA 4BISA 5CU1A 1W6PB 4P9XA 1AR91 1ODMA 1S0CA 2G9ZA 4Y22A 2VUAA 4CCJA 3RGBA 4YVWC 1YQCA 3O0WA 5F2SA 1OLQA 5C70A 2V4AA 4XFIA 1EV11 3KCXA 4FQ4A 3SCHA 1UU5A 5JWPA 3B3QE 1H1AA 3LDBA 5KHJA 2BUKA 3CDZB 1EAH3 2B7YA 1WCDJ 4H2AA 3EYPA 1HQWA 1QJY3 3B9CA 5DUUA 3WW4A 1Z7S1 1XYOA 3DECA 3PMEA 3HNBM 1BMV1 1C1LA 1MS1A 2XVGA 4YGEA 5FYTA 1RUC2 1F5FA 2ZX2A 2P6CA 3FHIB 4FPJA 4OI2A 1URXA 4IV1C 1U5XA 3WLUA 4NRPA 4AFDA 5T5OA 1DGLA 5DDJ1 2XLAA 2JE7A 3MW4A 4DO0A 2GC1A 1C3HA 2DVDA 5GZFA 4YW3A 4R4ZA 3GZTB 1OOPA 4ES9A 1CPNA 1LHVA 1BKZA 2HWE3 4LO7A 1IQDC 1GOGA 1S1AA 3T4HB 1NT0A 2OZ6A 4MXWA 1LHNA 4WM8C 2PQQA 2ZGKA 3U10A 1UZZA 3O1PA 3JUUA 5FP7A 2B39A 1H0BA 5E89A 1IKQA 3I59B 1O3SA 2D5FA 4QX0A 4Q29A 4CCOA 3B93A 2MEV3 4OHWA 1W2OA 1TME3 1JTZX 2WWJA 1UW8A 4TLGA 4L2NA 1UXXX 2JE8A 2ZGPA 2BRTA 4MZUA 5IJRA 2ARCA 3NW4A 5IK4A 1UQXA 1MZ6A 1Q56A 3ZSLA 4BIOA 3FUOA 3OG2A 5T3NA 1UPSA 2VOVA 3UJOA 3EXUA 3GHMA 2CHHA 5L9BA 5KXCA 3OY8A 4GMP1 4PF5A 1PIV1 2A6XA 1W6OB 3THCA 4E27A 2X5IC 3LQCA 5C7GA 1N1SA 5A70A 2YGLA 4MV2A 5JOWA 3UT0A 3LDKA 1LOBA 2WS91 4LO4B 4W65A 4YVSC 3RVHA 4A3ZA 1XNTA 3OCPA 1K42A 4LBJA 2LUWA 3AYAA 2UWAA 1EPZA 3IAQA 3J26N 4NE9A 4UF0A 4D6SA 1QIQA 1S2KA 3AL6A 4XFBA 4LA2A 4Q27A 5T55A 4JTOA 4OI1A 5A6ZA 5ABJC 1LHOA 3ZIXA 3J9SA 5LRRA 2VZUA 4FAGA 1Y9MA 2FCVA 3PUQA 2VNGA 4P5YA 4MGKE 3KV4A 4LUMA 3IIAA 4Y1UA 2XWJB 4AYUA 1H6XA 5FUIA 1SCRA 3B00A 2OT7A 4B4PA 2DU1A 3U4XA 2VC9A 1W6NA 4KGGA 2BWCA 1DIWA 1ZRIA 2JDNA 5JZGC 1XE0A 2WN2A 3N7JA 1UIKA 2VG9A 4BQ1A 2W1UA 2FQPA 2Z5WA 1F15A 3GGLA 1D2SA 2OZJA 3ZFFA 1Q8OA 4HN0A 1RUD3 3EO6A 4PI2A 1XYNA 3PVEA 4Q4Y3 2P2KA 2XPJA 4P9JA 2B9UA 2LTNA 3E97A 3PU8A 2XJSA 4LKFA 2RMU3 5FZLA 1RUI1 5CEHA 4Z1VA 4JQTA 3J4UH 1QNYA 4J25A 5FY5A 1IS6A 3N7LA 4HANA 4YFZA 4XQDA 1NLSA 5BNPB 3VB9A 1RHI1 4B29A 3BI3A 2RR12 2J1VA 2XVLA 4UW6A 1GNYA 4QKBA 4FVVA 1CWPA 1KD7A 4L97A 1YNAA 2VNOA 2VU9A 3NO8A 1AYM3 1AR82 4HVRA 1ULEA 5M0TA 1NE6A 2BV4A 1W8UA 2YC4A 3TWIA 2B42B 4KMQA 5HCBA 1HRV2 3POJA 1F31A 3VDDB 1AJOA 5C33A 3H8OA 5FP4A 3I7DA 1NLRA 4SLIA 2WA4A 2RM21 3AMQA 1UOBA 1XPWA 4CEYA 4LHSA 1NA1B 3SH4A 1WKYA 3KQ4B 1J3PA 5A3PA 2DVAA 3WINE 3V0BA 1CR7A 1YWKA 4A41A 2EVXA 2QUOA 1TZOA 1F5JA 1K12A 1VBE2 3O14A 1K5MB 1QOOA 3DF0A 1DDLA 3E6BA 2BYVE 2H6CA 4EZ4A 4FBFA 4Z2WA 1M4WA 1QH6A 2FHRA 1DP0A 2HWD1 4HK8A 3WQBA 4IGOA 5A1LA 4XUPA 1EUUA 1YYNA 5T50A 5AC92 1MVQA 2JENA 5T5LA 1GP4A 1FPN2 2W08A 1X33A 2BTVC 4LLOA 4FTSA 3E5QA 3AP4A 1GBGA 3PDQA 2WRAA 2B45X 5T5PA 3ES1A 5FY7A 4YGBA 5F5AA 4HK9A 3W5MA 4LOTA 3WDWA 5LA0A 2W0XA 2XGXA 1AX1A 5FIXA 4QDQA 4QAWA 5L7OC 1G9AA 5JI7A 3OB8A 4GAZA 1UMIA 4NIGA 1V9U2 4QX2A 4IE7A 4LBOA 2KD7A 3TN92 1APNA 4EE2A 1H2LA 1VBB2 2J1AA 3WOGA 4AFMA 4LBQB 1C8M1 3SLIA 4A6OA 4Q8KA 4JRLA 5FQ0A 1AR92 4NUBA 1Y3TA 2ZHNA 1VPHA 2PLV1 3PVNA 2JEMA 2P4EA 2AGSA 4K6BA 4QPIB 2XJPA 1EV12 2GH8A 5I8YA 4NIHA 1RL3A 2WQ8A 1CJDA 3ECQA 3AJYA 4S2FA 1AR63 2JX9A 3K75B 3N36A 3S30A 3M70A 3IMNA 3FE5A 5F8PA 3O1OA 3JBG2 5H9RA 5DG1A 2UWCA 1BMV2 4HLTA 2Y6LA 3R4SA 1P8JA 4Q0UA 1J1TA 2P6HA 4IEYA 4RQPC 4WVVA 3L9JT 3HAGA 1DYOA 4BIFA 4PLOA 1UOGA 3N9OA 1EAH1 4WM7C 3GDBA 4XUNA 1OUXA 3CLPA 4R8HA 1SACA 2EICA 4YG6A 1QJY1 5IVJA 4FPEA 1GQHA 2C5DA 4LBMA 3AKSA 4UOJA 2ENRA 4IUGA 2VVFA 1HN1A 1OUSA 3UGHA 2NZ9A 5ACA1 3FZ3A 5C3OA 1BXHA 2ZBJA 1WLDA 4XZPA 3W21A 2Q8DA 3WD5A 2SLIA 4L99A 4NROA 2BBVA 2I07B 3C7EA 2CAVA 5FYIA 1W2AX 5A32A 1UZ0A 3BTXA 5BNNA 2KA3A 1AL0G 3H3LA 4DXRA 4AG4A 3MICA 1UKRA 2DFBA 2HWE1 3X29B 3FC0A 3GBFA 4DMIA 2IFWA 4M00A 2WLPA 2WNUC 1NKGA 3HQRA 2FDKA 2VZSA 3N3HA 2VMIA 4DZGA 2ZGNA 1NZIA 2AEYA 5C4WB 3MZHA 4JKMA 1YJKA 1WLWA 2ZACA 5LW9A 1W99A 1ULOA 1JXNA 2MEV1 2W3JA 1TME1 1PIV2 4C91A 3M3QA 3ZR5A 4CP0A 4BQWA 5FOBB 3AK0A 3CHXA 5FY1A 5EP9A 3C7OA 4WVMA 1ZRFA 1JN2P 2GZWA 2GP3A 4BMBA 2VE1A 2VMCA 3I3DA 4GULA 3I2IA 4HKWA 3LWCA 3SMHA 1PNFA 1UOJA 2JWPA 3OYWB 5EJ3A 1FAYA 2HWF3 2OQ6A 1ENRA 1OF4A 3SKVA 4FXGB 2YBPA 4K3UA 1HKDA 5TSWA 3PMSA 2QTWB 2QQKA 2BVVA 2ILMA 1B35B 3DXUA 1YJLA 1NX9A 1YFXA 1BK0A 4YW2A 3GBGA 1OC1A 1QQP2 1U5YA 3WCSA 1HN0A 4XVHA 4GWJA 4K20A 2J1RA 3RMYA 2F4PA 5LY1A 3I4IA 1Q3EA 3KT7A 5EQUA 3FJSA 2ZZQA 4UW5A 2PA7A 5L73A 5DUWA 5K0UA 3H1YA 2HH9A 2QQLA 3APBA 2RE9A 4Q0VA 5DXDA 1AHSA 2IVJA 3CU7A 4I09A 4AEDB 1RC6A 4QB6A 3VBFA 1GSLA 2JE9A 5BNOC 4IDZA 5GM0A 3ON7A 1RUI2 3ZSEA 4XJUA 3ZSKA 2BNMA 1HJFA 3WNPA 1RUD1 4YWAA 5A3OA 3KCYA 1W6MA 5C5TA 4HG6B 1CX1A 4Y4YA 3AB0A 3OJBA 1RHI2 2AUYA 4Q4Y1 1SG3A 5I91A 1NG0A 1H8TA 2H0BA 3LDRA 2VVEA 1RUG1 3PL0A 2Q8EA 4OUSA 2JIGA 1ND3B 1SFPA 2EXHA 2PYTA 1PMIA 3NWKA 3P3NA 5CG8A 1KJRA 2W1SA 3ELNA 2B4KA 2E6VA 1XU2A 2WT2A 3MIDA 5F2WA 3KCCA 5K9YA 1UN1A 4MHRA 2OUHA 4OZXA 4IGQA 3AP6A 4DXTA 3OPWA 2RM22 4Y26A 4CDXB 1UZVA 4N43B 3VKOA 1AYM1 2VOTA 2QQOA 2L9LA 4BK5A 5FLJA 3FFQA 3WW3A 1GR3A 3HBZA 1T6BX 5A80A 4EQVA 4QPGC 4Y33A 2PHDA 1EPWA 2WA3A 5DAPA 4RR3C 3N35A 4LE3A 5DMYA 4BCUA 3MUZ1 4DRVA 1ND2A 2CTVA 2D7FA 4FFFA 4IEZA 1Z0HA 1NCRC 4XTMA 4ASMB 4CDWC 5C3PA 5CFDC 1ZNPA 2BERA 3GZAA 1A34A 4NHXA 4P00B 3NNJA 3OSDA 5IVYA 3ZVXA 2HWD2 2VAUA 1SFNA 2Z69A 3AVSA 1QMJA 1NQJA 3DN7A 5FY8A 1ZA7A 5KC5A 5LB6A 4B7KA 3JZVA 1PGW1 2J1SA 2JIJA 2FBEA 2HWB1 5GZCA 1IGOA 4IV1B 3TNQA 5AFBA 1DLCA 2QQWA 2EF6A 1LHWA 2Y64A 1PK6C 1WCUA 2CGOA 2E63A 4PIXA 4RS5A 5BUVA 5JVVA 1AYN3 3K77A 3M8LA 2Q30A 4OHYA 4CRQA 4LULA 4ISRA 1UNBA 1GOFA 2XLGA 4U2AA 1NOVA 3IDAA 4XIOA 5CFCC 1RUF2 2VTXJ 1R64A 2IXCA 3NMBA 4Z82A 5JSOA 4WM8B 4ZXKA 4PBPA 3NAPA 3WF2A 4TZDA 1D4VB 1KDMA 3H3UA 4LUKA 5FFOC 3BTYA 3O1UA 1C8M2 2E33A 4A7KA 1GWKA 3VV1A 3FMGA 4AQSA 3SCGA 2VOXA 3LSDA 4XHBA 4GWIA 2PLV2 3WNOA 1W0PA 5K8SA 2DFCA 3KV5A 5IK5A 5E8AA 4UBHA 1GYKA 5BY5A 3MLLA 2P17A 2JDZA 1JYIA 3SKJE 3SNMA 5FPUA 2QZ2A 3MFAA 4LE4A 1W03A 2D6MA 4XUQA 5A3LA 4C1XA 3QLQA 3OGJA 2WSUA 3VD7A 2F17A 1H1IA 1DQ0A 2XHKA 3TBDA 4DFSA 2WZEA 4JHZA 4XUOA 4YVSB 3MDPA 2NQYA 4AI1A 3TYJA 5C9AA 2C9KA 4XFHA 1WA4A 1LESA 1LOFA 2AACA 2GDFA 3S0MA 2NYYA 1G9BA 3LOIA 2LS6A 1PMJX 4ONUA 1RUE3 1JI6A 2ZGUA 5FMOL 3RQ0A 3AXEA 4XFCA 1UY0A 4K8FA 5ACA2 2C1FA 1VR3A 4JGZC 4K1YA 3IPVB 3INAA 2VW0A 4CP9A 2IZWA 2RJLA 3OUHA 4N7UA 3VDBA 2R0FA 1JU3A 5F6KA 1FNYA 4YZ1A 3NV3A 4GB31 2VNRA 2W9XA 2XKPA 2A70A 4PDWA 5A3NA 3P5BA 3CIHA 3WF4A 4D94A 3HWJA 1KS5A 3UYJA 2HWE2 4BE3A 2R0HA 4NAOA 4LOSA 4AHZA 4UI9L 4OHZA 1REDA 4I0AA 4F3JA 4AHXA 4J1XA 3HNYM 4Y1ZA 1LOEA 2VECA 1HIXA 1XOYA 2W52A 5LASA 2DU0A 3I2FA 4CCDA 5A3TA 4NPMA 2HEYF 5LA1A 4IE0A 4NAMA 3UL2A 2MNGA 3H0OA 2VZ1A 2EIDA 2EIBA 3ZFGC 3T2TA 2R043 4E4DX 3SHRA 3DGTA 1OLRA 3KGZA 4P02B 4MXVA 5F5CA 5JCTA 1HXS3 4LBQD 4AFCA 4YW6A 2BEOA 1UF2C 2Y8KA 4GA9A 3LOBA 3LB9A 4XBLA 2HKXA 4Q1RA 5KHHA 1JBCA 1RMU1 3I2HA 3LIHA 1NZCA 2JKBA 3PTYA 4GKYA 5T52A 5A6QA 1O5LA 3K2OA 3RZJA 2WZR3 4P9LA 1X7NA 2JECA 1AL22 4S2DA 2BVBA 3WF3A 4KWUA 4CP2A 2IUWA 3WDTA 3MPPG 4IEWA 4DEQA 1U5IA 2FCTA 4P9IA 4I2OA 1H9PA 2JDMA 2NN8A 4EN8B 1AF9A 1IS3A 3Q8FA 2F6BA 2OX0A 1F8VA 2ET1A 2CGNA 4HPKB 4YG0A 1ASJ3 1LCLA 1SMVA 2HLEA 4META 4OI0A 4YGCA 4GH4B 1XB9A 1OOPC 1QXPA 3BVCA 3GJBA 4C0HA 5AFEA 1CAXB 2Q1FA 4G9SB 4CA9A 3KB5A 4AEMA 3I59A 5C71A 1E5SA 3DYPA 1HW5A 1TMF1 4A6SA 1RB8G 1O6UA 1Q8QA 3VBOA 1VALA 2D6NA 2YC0A 4ZONA 4COUA 3LEGA 1JHNA 5D8AA 4AGVA 5DUVA 2JDPA 1RUD2 2X10A 3AZWA 1YI7A 3L2HA 4O9GA 5BYNA 3R6SA 4AXOA 2JG9C 4ARXA 4Q4Y2 1UXZA 4ISQA 1U0AA 2LALA 4QQPA 1UWWA 1WCSA 5FREA 1RUG2 2XONA 4D3WA 3RG0A 1QJEA 4AQTA 3FBYA 5FMOS 1N47A 2ID4A 1KEXA 3LKJA 4BPZA 2WIIB 3ZN4A 1VB4A 5L7OB 5J3UA 4QXHA 3ZPYA 4E9KA 2F4LA 1VBA2 4FFGA 1SHWB 4Y1VA 5HXVA 4E2QA 1AYM2 5L36A 2RS52 2VZPA 4MADA 4LORA 3MO4A 2JD9A 1D0GA 5FZDA 1R093 3WF0A 2UYAA 2PAMA 3Q9OA 3ZYRA 5IVEA 3HN3A 1YXWA 3IIIA 4XXPA 3H1MA 3KHBA 5HXMA 1GANA 4I3GA 3JB4C 3U07A 1FT9A 2PHTA 4LTAA 4H14A 1BHGA 1W6QB 5GZGA 2CU5A 3UKTA 3JD73 3AP7A 2VMGA 1STMA 3CO2A 3FLRA 3ME2A 2BGPA 5IT6A 5CKMA 1OSGA 3WG2A 3E6CC 4AZZA 1PGW2 2CWSA 4YZ3A 5FYHA 4FAHA 4MLOA 2HWB2 3SEEA 2TEPA 4QM8A 1W8WA 4XJ8A 2JG8B 3CJIA 5G05L 3WF1A 3ZFFC 5FOJB 2AH2A 1VLNA 3OBTA 4YM2A 3RYKA 4F7ZA 3HVDA 4M3CB 4A7ZA 3JQWA 4P5HA 4FI9A 1VE0A 1WD3A 2ZOEB 5FZKA 2WQZC 4FPYA 3RI9A 5FUNA 3RS6A 3ZYHA 2BJSA 5C8WA 2CYFA 4QQ2A 1QF3A 4FOVA 4G4FA 2C26A 1ZZBA 3PUSA 2HWC2 1QJU3 4UXAA 4RHV3 1WCQA 4MGTA 1VMJA 1JYXA 1YQ5A 1OKOA 3POWA 5FXXA 4E4ZA 4KNCA 3VDDA 1JZ6A 1T6GC 2VBPA 4P08A 3W5NA 4GJYA 4M01A 1XE8A 4AQ2A 5J09A 1FMD3 3ILFA 2PELA 1FX5A 4TN7A 1AX0A 1CAWA 1ULCA 1S0JA 3I2GA 2V4VA 1NA1A 4IESA 4L9BA 3VZKA 4CYDA 1WWYA 1KS4A 4IEQA 4BQ4A 2RV9A 5F37A 1QY4A 2VM9A 2WFF3 3A0KA 3MI8A 4FT8A 3U75A 1W28A 5HCHA 2EIEA 1GLHA 1MS0A 2UY9A 4HZFA 4CEYC 2VJXA 3MPBA 1GNZA 4XOGA 5A1FA 1IPKA 1ZZ6A 1N1VA 2QE3A 4BU2A 1BK1A 5JMOA 3O1VA 3CQOA 5IYYA 4EN7B 3VKLA 1LOAA 5F1RA 3ZKYA 3J8F3 1W3VA 1OQ1A 2ORXA 1WGPA 4N7IA 3THDA 1G8WA 5D1IA 4N8MA 2D40A 1LGNA 1ENSA 3QH6A 3GM8A 4LHLA 2VMDA 3Q8EA 4PI0A 4EWAA 3UNPA 3OBRA 4LQRA 3V0AB 1ZVFA 1MEC3 3U78A 2P3JA 3POFA 2YROA 4QX1A 5F7UA 1O8PA 2JICA 2YU1A 4Q4V3 4DUWA 3T09A 2Y33A 1VBC3 4GB32 4OHVA 1H1MA 4YLZA 2OYZA 2Y6GA 3MGUA 2D3PA 4A44A 1ACCA 3FUQA 5LBFA 3WQ7A 5JI9A 3DPRA 4LA3A 5FYVA 1QXJA 1W05A 5FLHA 3GALA 2A3YA 2FDJA 3ZXDA 3ZPOA 2XMLA 3RZLA 1LHUA 5AVAA 5LWBA 4LBQA 3W9AA 1WUVA 3NSTA 1ST8A 3FL7A
chains in the Genus database with same CATH topology
4D7SA 5BNOB 1Z78A 1F9KA 1MQTA 1I9RA 2QDNA 3VZJA 5FRAA 1RMU2 2EALA 2FMDA 4HSJA 3P3PA 1OHFA 3SH5A 3NV2A 4QQHA 4AHWA 5FO7B 1BEV3 3WHUA 2HEVF 4Q4X3 5FDBA 2IXKA 1PM7A 4XJWA 3ALQA 4JAAA 4N53C 4WBBA 2WZR1 4JC1A 2YUEA 1WW4A 1TQ5A 5F6LB 1PGL1 3OGGA 5F9TA 3H7YA 4PBOA 1ZBE3 2VQ0A 4QPGB 1Y7BA 3FLTA 5KC6A 2P37A 3WW2A 1PHMA 4RR3B 4Y20B 2PHRA 5CAZA 5CFDB 4XIKA 1COV2 1TMF2 1QGLA 4CEWB 1ASJ1 2QVSB 1ULGA 3LA7A 5BNNC 2DUOA 1RVF3 1X50A 4AGRA 3FX3A 1X82A 4QPYA 1AXZA 1J1LA 5LEKA 4TSVA 4L92A 5KWRA 4X8PA 2VPVA 3R05A 4FPCA 2DF7A 2ZX3A 1DYPA 1S55A 1SFYA 4AI2A 1RUOA 1RIRA 1CONA 1ZA4A 1NCQA 2WT1A 5A33A 4GWNA 1R1A3 4M0HA 2Y38A 4M0NA 4HL0A 3WX5A 3I2DA 4B4RA 4FSJA 1YI9A 2ZHLA 4B3NA 3RJRA 3VBRA 4QGLA 4NR1A 4UBGA 1AZDA 2CGPA 1TNRA 3QACA 4AVVA 4RSUA 1ZZ9A 4AQ6A 4AE2A 1J58A 4Q4W2 1WMFA 3M3EA 1QXRA 1F2NA 4GKXA 1QOTA 1AX2A 1I3HA 1R091 3VZNA 4YM1A 4CP1A 1ZBA3 4BM8A 1DZQA 5J36A 5I0UA 2QZ3A 1GZWB 2UYBA 2ZGOA 5K0UC 4TYSA 3TB0A 2A6ZA 2GNMA 3AZXA 3VBFC 3MIFA 3VBSB 1ZRRA 5DZGA 2H6BA 4COVA 1V00A 1HV1A 2JJ6A 3POSA 1V6LA 1I6XA 3BPZA 2YXSA 1LU2A 4HT1T 4PLNA 4Q0SA 2WKKA 3WV6A 4AHYA 1H8TC 4CDQB 3CJXA 1QOSA 3OD4A 2DCJA 1TE1B 5AVPA 1WMEA 1IS5A 1YLLA 3WP4A 1QJU1 5KXEA 4YW5A 3ATGA 4N90A 5BXXA 3ENRA 1C4RA 3ZFGB 4XFFA 2Q0AA 2ZAHA 1CAUB 1QDOA 4EN0A 1FMD1 2R062 1PO23 2QCSB 5CIRA 2ERFA 3ETQA 1MZEA 2AENA 5EZWA 1OFSA 1FOD3 2BNOA 2AZ5A 2DUQA 1ND2C 2MPFA 3M3OA 4HKOA 1MS5A 4NHMA 4XILA 1R083 4BWOA 1UIJA 4JV4A 4W6XA 3T1MA 2XL7A 3J8F1 1ZRDA 4J6GA 3OPZA 1Z7S2 4EWEA 3WP5A 1LULA 1S0BA 3UJQA 4CDUA 1I5ZA 4RS5C 5IUQA 4HBNA 2NM1A 1LOCA 4Q4V1 2ZX1A 3AZZA 3ZXJA 1OOPB 4XTPA 3JCIA 4COWA 5DDJ2 5EYXA 1SBFA 1N1YA 1WW5A 2R073 2R1BA 1DQ4A 2I2SA 2V5YA 4QX5A 4MXWB 4FQZA 1DQ6A 2X53S 3NAPC 4JDOA 1H4GA 3NJZA 5HCAA 1GKBA 5C8CB 1GFF2 3THPA 4S2GA 2D3SA 2O8QA 3HN1A 4ZKTB 3ZFEA 2JG9B 4MGZE 2DCZA 5CVRA 1PZ8A 2WFPA 1UKGA 1Q8PA 4C90A 1HX6A 3AP5A 4JRAA 4L11A 4W6WA 1A3KA 2Y26A 4JDMA 2E7TA 3OY8B 2FZ2A 3LZZA 2XUMA 4GALA 3RNSA 3ZYPA 1RUC3 4ORFA 3AXDA 1KDKA 1G9CA 2YMZA 3FBMA 5C9AC 2D97A 3TAYA 2PAKA 2K2SA 1DF0A 1D4M3 1TEIA 4LBLA 1PGL2 2WL1A 2WS92 1QDCA 4FPKA 4FO9A 4I0BA 5EWSA 1HQNA 3AMHA 2GNBA 2E53A 5FPZA 4E4SA 1OA2A 1PGSA 4NWVA 2CL2A 1CAVB 5I93A 1ASJ2 3GF6A 4HFSA 1ZBE1 2VW1A 2WLQA 3IKWA 4PDWC 1ULFA 2WT0A 2XG3A 1ALYA 2XH6A 5GLWA 1FI2A 1ENXA 2Z2SB 1DGRN 4B4QA 3IDCB 1RTVA 2ET7A 5GJ6A 4MSVA 4AEKA 1RVF1 2ZGTA 1OPMA 3SCFA 4DNYA 5T5JA 2ZJCA 4Z8BA 3BOPA 3VHRA 4FP2A 3H3ZA 4ZU4A 2D93A 5GZDA 4XF3A 2DVBA 3DV8A 4EROA 1PNGA 1HQLA 4YNIA 3USUB 3BALA 2ZGQA 4QM9A 4XF9A 3EBRA 2ARBA 1R1A1 4PQ9A 1POV3 3RYPA 4JCKA 3PJQA 1YHFA 3W58A 4AVTA 1PO13 2TUNA 2RMU1 4HN1A 1R092 1MACA 1O4TA 2WNVA 3JB8A 3QD6A 3BTAA 2D6PA 3VBHC 1V6OA 2KM2A 4GH4A 4HVQA 3RMXA 1B09A 3AZVA 3BB6A 4NWWA 2GSYA 3VBUC 1XNDA 1ZBA1 1LB2A 1WD4A 4YZ2A 1X8EA 1RJ7A 2FZ1A 1FV3A 4YVWB 4FOQA 1SLCA 3MFCA 1ZX5A 2X29A 3VBOC 2V09A 5D8AC 4COYA 1S0FA 1V6MA 1QJZA 2VXRA 2XBO3 1XXNA 4M3CE 1SDWA 1Q5OA 2D98A 2RR13 4IV3A 2O1QA 1QWRA 3WP6A 1VIWB 3ZYGA 2ZX0A 2WZPP 1VB2A 1D2QA 1EP0A 3PVBB 1QJU2 1LECA 1UPIA 4P9GA 1V6KA 3RYRA 5EFUA 2Q1MA 2DVFA 4ATFA 4JGYA 1HRI3 2DTWA 5FQ0B 4MVTA 5JOZA 1S2BA 1LJ7A 1W6QA 1YRZA 1LGBA 4CZSA 4MUVA 4D69A 4KH9A 2E7QA 1VBE3 4AFAA 1BZWA 4MGIE 2I45A 1PO21 3DL3A 3K48A 1IOAA 2IWGB 4FP3A 4FPHA 4KWJA 3LA2A 4Y1YA 2JG8A 1FOD1 3PNAA 5FBZA 3J8F2 1DQ2A 3H1WA 5AC93 1NXMA 4N53B 4NN0A 1FPN3 5I0RA 2GC2A 3CJIC 2EXIA 1R081 5F5QA 1KITA 2X5IB 5J96B 3B5LB 3ZSJA 3G7DA 3B7MA 4XMIA 1O7FA 4Q4V2 1AR61 1C5HA 1EAH2 2UWBA 3WDVA 5E16A 1QJY2 1C5IA 4FXKB 2GN3A 5J7MA 4WVZA 4AK3A 5ABJB 4KWKA 3VZMA 1CQ9A 5A32B 1NY71 4AI3A 1SLTA 3HR9A 4AVCA 2DCKA 5BNNB 2XJUA 3VDDC 2R071 2ZTNA 1S0GA 3WZ1A 5FO8B 2EAAA 3U0ZA 1EV13 3UKNA 3TRSB 5JZGB 2W68A 4PLMA 1NA1C 4COZA 5C6CA 2WINB 2PHUA 4ZU7A 1E57A 1TNFA 3PHMA 4R9DA 3JBG3 2HJIA 4HVOA 2I74A 5LEJA 1W6PA 3MIHA 3LCPA 4WVMB 1IS4A 2MEV2 1IKPA 1XNCA 1TME2 2ZGSA 2ZMNA 2QQPA 1FV2A 3D82A 1QHDA 3VUOA 3V0AA 4XJAA 3A4UA 1CGPA 4WV8A 3MIGA 2CWMA 1WLTA 1RUC1 2GH2A 5HCFA 1N3OA 2A75A 2OW4A 4I0WB 1D4M1 4TLFA 2P34A 1H4HA 1ZBE2 2N7GA 5E1RA 1GV9A 4LHNA 5GLUA 4NHKA 3WNXA 1DHKB 1XNKA 4I02A 3DPRC 2MHFA 1AXYA 4LT5A 1BQPA 2HWF1 1UU4A 2GC0A 1ZZ8A 1S0IA 2ZGMA 4DPNA 5K0UB 2CAUA 1CJPA 2NPIA 4FTEA 1OA3A 2IC1A 3VBFB 1PIV3 2ZS6B 2ZHMA 4K1ZA 1MQTC 3KSCA 2ETEA 5IK7A 2TNFA 2A7AA 4QXKA 1VAKA 1WBFA 4W6YA 1V6NA 1H8VA 3DKWA 1W6MB 3QBQA 3ZMOA 3PVOA 1DFQA 5HI0A 5JIAA 1H8TB 5LK7B 4B7EA 2IFRA 1OQDA 3QCWA 2CY6A 4KU7A 3VHOA 1PZ9A 2RMU2 1W6OA 2NP0A 1LTEA 4KWLA 1CIWA 2VW2A 2R6QA 4QMAA 4HKLA 1QQP3 1WW6A 2Y0IA 4YZ5A 1W39A 4RR3A 4X6RB 4OI4A 2NLRA 1PO11 2OIIA 1LRHA 3NKGA 4N9HA 2ZKNA 4LO8A 3FFZA 1SEFA 2PHXA 3H7JA 4CEWA 4EN9B 4XHXA 1ND2B 1DZTA 4LO6B 1REEA 3GBWA 3HQXA 4XMAA 3KS7A 3KZ4C 5JPMB 3GZUC 1ENQA 3M1HA 3LSEA 3V56A 4SBVA 1RUI3 4XF0A 4YG3A 2RHPA 2XWBB 5L19A 1GNHA 3NV4A 2XL9A 3PLQA 4R4XA 4AVAA 1RHI3 2ARXA 2QFEA 2ZCWA 3RPQA 4F8AA 4OUMA 2IXIA 3E5XA 3RZZA 2K9ZA 4RS5B 3ZYIB 4RQPB 5J37A 3VKMA 4Q1PA 4WM7B 4DS0A 5CBLA 2XBO1 1NCQC 2E7AA 3QOPA 1NXD1 1KQRA 3WP3A 2IXHA 3CL1A 5BNPA 3VBRC 2GMPA 4OVEA 3AKQA 1VAVA 5GALA 1AYN1 4L8QA 1ZRCA 5GLTA 1AVBA 3OF1A 1HDKA 1R1ZA 4PJYA 4KGQA 1HRI1 4BZ4A 3WDUA 1PO22 4BHPA 4EV0A 3AFKA 2WNUB 3GYDA 2GNTA 2ZA9A 2HWD3 1FOD2 4QD2A 1GZCA 2EIGA 3KD4A 1DZRA 1VBE1 3PJYA 2BQPA 1OMIA 5IK8A 1BYHA 2D6OX 1R082 3D5OA 3H50A 5FTTC 1C8NA 3VBSA 4BLIA 1K5MA 1A6CA 2NMOA 2EXJA 1AR62 4GIQA 1G9DA 4BH9A 1O3QA 5AC91 3CEWA 3IBMA 1XU1A 1FPN1 4AGGA 1AR73 4U36A 1SQ4A 1RUF3 4CDQA 1DYKA 1L3JA 5T54A 4TWTA 1JUIA 2ZGLA 1NY72 3VL9A 4K9SA 2D3RA 4WZFA 1VBD3 4NHLA 1SCSA 1CN1A 3WQ0A 2UURA 2PLV3 2BFUL 1RUE1 4AF9A 3JU9A 2CNAA 4RGGA 1N3QA 3VZOA 2OPKA 1H2NA 1WMDA 4P9WA 5CA6A 3ZDSA 4P9YA 3WHTA 1FNZA 3AKRA 2NMNA 4LHKA 4FPOB 3ROUA 4KBBA 2A73B 2JXAA 4QPIA 1J3RA 3ZX7A 1RUJ3 2DURA 3URFA 5DZEA 1G9FA 4IETA 3JBG1 3MW2A 4DY5A 1QJX3 4DOUA 1JUHA 2CV6A 3VL8A 1I1EA 2PHFA 2R041 2RS33 5ACA3 4XF4A 4AI8A 1HXS1 3LAGA 1D4M2 4MH0E 4Q0QA 3KT4A 3N7KA 1DLLA 4LO5B 3VBHB 2AR6A 4IQPA 1XQNA 2DVGA 1OI6A 1JYCA 3MF9A 4AI0A 3AMNA 4OHXA 2VH9A 2VQAA 4CDUC 3HIFA 4H7MA 3WDXA 2HWF2 2XJQA 3C2UA 4PIZA 1N1TA 1PVC3 3VBUB 4K40A 5J98B 3AZYA 4PIYA 3N4MA 4D7YA 5GKAC 3DUIA 1OFNA 2G9FA 5C8CA 5H9PA 4BA6A 4M3CF 1SLBA 3MLKA 2JG9A 3VBOB 5BNQA 1KFUL 1NCRB 1UD1A 4CDWB 5D8AB 3BU7A 1Q8VA 2Q5TA 3ZFEC 2LM3A 1DBNA 1LEMA 4Q8LA 5CADA 4DRRA 2E9QA 4JQRA 3MF6A 2QDRA 2X8KA 3FWEA 5C4WA 3D0JA 4YM0A 4XJZA 5JMCA 1RUH3 1AL23 4GWMA 1QNWA 3ZN6B 3WW1A 1PK6B 3WY6A 5BPXA 4LR4A 2QJVA 4XDQA 2IXJA 1JH5A 4S2HA 4RFT0 1X8MA 3OYWA 1VRH3 1PO12 5CFCB 2VOKA 4BYYA 1CAVA 2BFUS 1CESA 1LR5A 1X36A 3WUCA 4H3WA 1LENA 2GC3A 4QGNA 4XF1A 1EY2A 1FXZA 1B35A 1AUYA 1QQP1 2QNKA 1U5ZA 4K7JA 4WVWA 5KBFA 4FCAA 3WDYA 4AVBA 2Q8OA 1AJKA 2VGDA 5KXBA 3IDEA 2RS13 1A78A 2UU8A 3ZO0B 1BVP1 3SITA 1ULDA 2ATFA 5JOYA 3CJIB 1GZ9A 1RUG3 3ZYJB 2ZMLA 3B01A 4C0BA 2XKOA 4AEDA 2D6KA 1O3RA 2VUJA 3SISA 2EXKA 4KG0A 2XBO2 1UMZA 2A3WA 3JD71 5FAXA 4CTEA 3LGRA 4XJ9A 2YV8A 2R32A 3AMPA 3M2MA 1SBEA 4Q2FA 4RGAA 1WBLA 3USUA 4YARA 3VLBB 1VBA3 4JGZB 1H30A 1WW7A 4IL7A 2RS53 3KLSA 1JW6A 2GU9A 2XJTA 2R1DA 5DZFA 2DWRA 1AYN2 1ND3A 3KMHA 2VVDA 5JSRA 4V1PA 4DY3A 2YY1A 3S7IA 4N9IA 2A6YA 1HRI2 4ES8A 1CAWB 2D43A 2BNNA 3E5UA 4YM3A 1O91A 2Y0OA 5I8TA 2WNVC 4CDXA 2C9AA 1YFYA 4N43A 4GH4C 1GICA 2ES3A 4RHV1 1SLIA 2G9GA 2ZX4A 4MX3A 1Y43B 2DYCA 4YSFA 3WG3A 2VULA 2HWB3 4YVWA 3SH3A 4I01A 2Q1ZB 5CG9A 3M4FA 4X6QB 2DCTA 5JLVA 1N3PA 4Y22B 1ZYBA 1BBT3 1MS9A 3WXPA 1O4YA 2WFF1 2ZABA 3AYEA 4ATEA 5SV5A 5KHKA 1S0EA 3IWZA 4A3XA 1ZZCA 2TBVA 4RL7A 3CF6E 2HWC3 3GNEA 4HSLA 3AJZA 5EV7A 4IV1A 3DPRB 4IV3C 2GMMA 2P3KA 4O9EA 4E2SA 1AR71 1RUE2 4Q0PA 1RUF1 1UU6A 3OD0A 4OLLA 2UY8A 4YRDA 1MEC1 2WNEA 4WM8A 5B2GB 1VBD1 3I54A 4XQ4A 2PN5A 1VBC1 4JGYC 3VKFC 4LNVA 4MYEA 2Q4SA 1MQTB 4MGYE 1FATA 1O5UA 3K51A 4Q26A 2BGCA 4AFBA 1RJ8A 1OKQA 1MZFA 4FTBA 2ZPXA 3A0NA 3ES4A 2R042 1EYBA 4N53A 3VN4A 3O7OA 3S7EA 1HXS2 2DUPA 1SLLA 2JG8C 1RUJ1 3C3VA 4LLFA 5FPXA 2GAUA 2X5IA 4FPLA 4Y1XA 1QJX1 4GB33 4FOWA 4YVSA 2R49A 3ZIWA 3ZXLA 3TNPB 2RS31 3G6JB 4IEOA 4BMEA 3WQ1A 3TOJA 1ZZ7A 1KXGA 2OUJA 1IPJA 2WZR2 2Z42A 5LK5A 4BLJA 5ABJA 5I8YA 5GZEA 1BEV1 3IPVA 3KT1A 1LOFC 1YIPA 2D44A 4Q4X1 1REFA 3ZN5A 3EHKA 1C28A 3AP9A 4GQ7A 1XRUA 3M7AA 1PVC1 4H7LA 3WR0A 5JZGA 1CVNA 1POV0 1MS3A 3D0SA 3AM2A 2QKDA 1RMU3 5J48A 3AX4A 4LBNA 1W6NB 1LEDA 3R0RA 5JAXA 1LU1A 5KXDA 1OA4A 2SBAA 4KU8A 1G7YA 3W59A 4NO4A 3ZFFB 3ZSMA 2PFWA 1NCQB 5A33B 4FOYA 3D4KA 1PZ7A 1VAMA 3VKNA 4AWDA 1NE4A 2A71A 3CNAA 3AFGA 4X8NA 3O0VA 1LOGA 1XNBA 1RUH1 3NV1A 1AL21 3B94A 3VBRB 1J3QA 1H2MA 3WG4A 2H0VA 3S6PA 2EA7A 3ZXGA 1G86A 1O4ZA 4DINB 4IEXA 2B8MA 1COV3 4XBQA 1VRH1 1TMF3 1IQAA 5GLZA 2AREA 5A3MA 4XW3A 3GHNA 4QT6A 4HPKA 1SBDA 3WT3A 4Y24A 3AKTA 1V6JA 3EJKA 1DQ5A 2HEWF 1CAXA 2ZGRA 1LGCA 1VP6A 4CEYB 5JPNB 3ZXFA 2RS11 4XEZA 2YDEA 4KL1A 4HETA 3V0BB 3LA3A 3JD72 4IEUA 4K21A 4Z92B 2YZ4A 5DUXA 1V70A 3FLPA 3MEPA 4I30A 2BW8A 1YIFA 2PHLA 1CPMA 4B8EA 1M06G 4AW7A 4IEVA 4NPRA 5JOXA 2DCYA 2D6LX 4FPGA 3UV9A 2O0OA 4DQAA 1VBA1 4Q4W3 4A7YA 5L7OA 2GN7A 4YGDA 3ILRA 4OULA 2RS51 5FLIA 4NOTA 4QU2A 3BIWE 1QKQA 4YFWA 1AR83 4NVPA 4AVSA 4RHV2 2OA2A 1HRV3 3MIBA 1UZYA 1FYUA 2YPJA 5JDBA 4XE9A 1ONAA 1DGWX 3ST7A 4OFGA 3AMMA 1DU3D 3RJ2X 1PVXA 3RI8A 3ZMNA 1FMD2 4CEWC 3U11A 4D7TA 1MZ5A 5JR7B 1XYPA 2GALA 1Q8SA 2A6WA 5SV8A 4E2GA 1UX6A 2PTMA 4R9CA 2WFF2 4ZU5A 1OQEA 4IERA 1YO8A 4GXLA 4RQPA 2AYHA 3D8CA 4R9AA 1QU0A 4KQ7A 3T1LA 1BBT1 4WM7A 3POYA 4ITCA 1UL9A 4XFGA 1AR72 4M3CA 4CDUB 5I0SA 3AYCA 3NL1A 3UKVA 2YYOA 3H9AA 3QH7A 5CNAA 3EQEA 3KGLA 2YHJA 4KG8A 1C1FA 4JTNA 2HWC1 4JDNA 1MEC2 1U12A 1VBD2 1DGWA 3O0XA 1VBC2 1YFUA 3AYDA 3I8TA 4YYOA 4DB5A 3H8UA 2GMEA 1YUDA 3D6EA 5BNPC 4PCRA 1MS8A 2R063 5DG2A 2A3XA 1V9U3 1OPOA 3R4UA 4HMZA 4RA0A 1S0DA 3MYXA 5H9SA 3HT2A 3ZFEB 5JI9A 3TN93 1CX4A 2ZMKA 1VBB3 2WNUA 4AEJA 5CB7A 2YGMA 1AR93 3B02A 1DG6A 3VHPA 3IN9A 3RDIA 5H9QA 2G4IA 3IT8A 3WCRA 4RD7A 1RUJ2 1WLCA 3V65A 2A6VA 2XVKA 4XETA 5FO9B 1QJX2 2EAKA 4QQOA 4XBNA 1NQDA 2RS32 3MIEA 1CD3G 1D0HA 1Z7S3 1XE7A 3VBSC 1K5MC 3ZXEA 3E6DA 4GMP0 4YW4A 3UK9A 1BEV2 1JOJA 3THTA 4G3YC 3ASIA 2W39A 4Q4X2 5DDJ3 2R30A 2E51A 2DV9A 3IM0A 4CDQC 5LRSA 3MW3A 1PVC2 1BVVA 1MVEA 1RGSA 4YW1A 1KJLA 1BCXA 3HMYA 3L2YA 3MLJA 2VOWA 1Q43A 4Y5Z0 2GNDA 4IEPA 5GLVA 2ZZJA 5BNOA 1C57A 4R9BA 3WVJA 1KFXL 2ZHKA 4XFAA 1KRIA 1YCIA 3B9IA 1AXKA 1RVF2 1QH7A 5JIUA 3JQXA 4GMP3 1A8MA 4QPIC 1RUH2 2R16A 5KHIA 1ZREA 4BOWA 1ZM1A 3IDBB 2PHWA 1MS4A 1Y9QA 4INDA 2WS93 3B69A 4FPFA 3VBHA 5BV6A <