3D0JA

Crystal structure of conserved protein of unknown function ca_c3497 from clostridium acetobutylicum atcc 824
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
AMKPDIYENNREGILCVYKNEKWLVCIKNWKPDNDIEGIAHLEIHHSTDEQFILSAGKAILITAEKENDKFNIELTLMEKGKVYNVPAECWFYSITQKDTKMMYVQDSNCSMDNSDFCDLSKEEIEYIQTNARKLFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein CA_C3497
publication title Crystal Structure of Conserved Protein of Unknown Function CA_C3497 from Clostridium acetobutylicum ATCC 824.
rcsb
source organism Clostridium acetobutylicum atcc 824
total genus 35
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2008-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3d0jA00
1NE6A 2Q0AA 2D5HA 2Y0OA 5J7MA 4KL1A 3LA7A 2D40A 1FT9A 3S7IA 5JSOA 4IEXA 5LEKA 3LA2A 3ETQA 4JTNA 4HVQA 4N9HA 3KGZA 4R52A 1ZVFA 3FJSA 5KBFA 1CAVB 1L3JA 1NE4A 4QX5A 3E97A 2F4PA 2B8MA 1ZZ9A 2GC1A 2UYBA 4RD7A 2HKXA 1ZX5A 4X6QB 2BEOA 5FPXA 1DZTA 3BALA 1YFYA 4QM8A 5I8TA 2EVXA 5I0SA 1EP0A 4Z82A 4IEYA 5C8WA 3PNAA 4XFHA 5FQ0A 3EJKA 1SFNA 2OZJA 4XFAA 1RL3A 2BGCA 1YUDA 3OCPA 4QGMA 3E6CC 1UIKA 1X8MA 1V70A 4XF1A 2KXLA 4HZFA 4I0AA 4I02A 2XHKA 2BYVE 2H0VA 3I59B 5I91A 3H50A 3IBMA 4J1XA 4FT8A 3L2HA 4KWKA 3C3VA 5EFUA 4HSJA 2PHDA 4LA3A 3RYRA 1EY2A 4Z07A 3BB6A 1OFNA 2OYZA 5I0UA 1CAUB 1DGRA 3LAGA 3SXWA 4P9GA 2I45A 2BNOA 1CAXB 3E6DA 4IEUA 4BYYA 4LLOA 1ZRCA 2VECA 1RGSA 4LULA 1O3QA 3NW4A 4KWJA 4E2SA 4Q0UA 1ZZBA 1JUHA 3SHRA 4FAHA 4LA2A 2Q30A 3NVCA 4MUVA 1VP6A 1RUOA 1ZNPA 4MGKE 4YRDA 1U12A 2O8QA 1VR3A 3KGLA 4OLLA 4ZU4A 4XFIA 4IEPA 3LWCA 2C0ZA 4QGNA 3ELNA 3QOPA 2BNMA 4AQ2A 4Q29A 3CO2A 5BY5A 3FE5A 1VJ2A 1UPIA 1LB2A 2CAUA 3LOIA 1RTVA 3U11A 1EYBA 2PAEA 1FXZA 3H1MA 1YFXA 1XRUA 4XF9A 3NSTA 2XL7A 1H1MA 1WLTA 2XKPA 1TQ5A 3CJXA 1ZZ8A 5I0TA 4MX3A 4DINB 4BIFA 3CLPA 5I93A 4JV4A 1NZCA 2O1QA 4L2NA 2XLFA 4BH9A 4META 5F1RA 2XL9A 1GQHA 5JR7B 1O3RA 2P17A 4MH0E 5I8YA 2IXLA 3EHKA 1EPZA 1ZZCA 3MPBA 2XGXA 3H3ZA 1ZREA 3H7YA 1Q3EA 1O7FA 1O5LA 3U10A 3WW4A 4JTOA 2K9ZA 4I0BA 4I01A 4LUMA 4I09A 3PVBB 3G7DA 4IERA 2VQAA 2WC2A 3KCCA 4E2QA 4Q0QA 3OD0A 1H1IA 2PAKA 4L11A 1X8EA 3VHRA 3HT2A 1J3PA 3KSCA 5J48A 4D7TA 3IDCB 3WW1A 2QNKA 4TLFA 4OFGA 3D0SA 5KHKA 3LA3A 2FQPA 5CVRA 1DZRA 2ET7A 5FPZA 2XLGA 3S7EA 1LR5A 4KU8A 5JCTA 2WFPA 3RZZA 4I3PA 2UYAA 2CAVA 5CU1A 1Y9QA 2GU9A 2HJIA 3B02A 4IESA 2QVSB 1I6XA 3PLQA 1I5ZA 2H6CA 3H1YA 3NL1A 3H3UA 1IPKA 3IIAA 4XFGA 4HN1A 5T3NA 1YHFA 1YLLA 3GYDA 3E6BA 1CAWB 1NXMA 2BNNA 2B5HA 3ROUA 5JAXA 2E9QA 2UY8A 5FCCA 1WA4A 2B9UA 1PM7A 5J3UA 1O3TA 3HQXA 5JSRA 1ZRDA 4X6RB 3R6SA 4QM9A 3O14A 4LTAA 3U0ZA 5LRSA 1UW8A 3NJZA 3SCFA 4MZUA 3IWZA 2QJVA 3I7DA 4FBFA 1RC6A 1YWKA 2QDRA 5E16A 4Q0SA 1SQ4A 3MDPA 3SCGA 4F7ZA 3HIFA 4XFBA 1CAVA 4E2GA 4YARA 3N4MA 1J1LA 5KHJA 2MPFA 3M3IA 5FLHA 4KU7A 3UKTA 4HLTA 1CGPA 3SMHA 4ZU7A 5C6CA 2D5FA 4O9GA 3RNSA 4WZCA 3E5UA 5FQ0B 3ES4A 3GBFA 2ATFA 1YFUA 2ZCWA 4LUKA 3S0MA 2PA7A 3E5XA 2GC3A 2XKOA 2Z69A 3CL1A 3ES1A 1DGWA 2K0GA 2PYTA 3MZHA 1UD1A 1ZZ6A 1X7NA 1IPJA 1RUNA 3I59A 4HMZA 3FX3A 5E1RA 2IXKA 5HI0A 2DCTA 2IC1A 1XE8A 4AVBA 1O4TA 3LZZA 5BPXA 3TNQA 4XF4A 2D93A 1PMIA 1X82A 3FFQA 1NYWA 1CAUA 2XLAA 2GAUA 4YSFA 4A2UA 1QWRA 4Q0PA 5JSPA 1CAXA 4IETA 4MGYE 3QACA 3D0JA 4QXKA 1QY4A 3OF1A 5FLJA 4MGZE 2IXIA 4R8HA 3DKWA 4B29A 4GULA 2GC2A 3MYXA 1LKNA 4XFCA 4WBBA 3IDBB 2OPKA 1Q43A 4JVAA 3FHIB 2ZKLA 3D82A 3DL3A 2N7GA 5LEJA 3SCHA 4XETA 3ACLA 4YNIA 5FDBA 5KHIA 3RDIA 2OZ6A 3H9AA 4WVZA 4XEZA 4H7LA 4AVCA 3EBRA 3ZDSA 4AQ6A 3I54A 4EV0A 5BXXA 4D7SA 1CX4A 4HVOA 3RYPA 1QXJA 3UKNA 3CEWA 5BV6A 1J58A 2V09A 1UIJA 2EA7A 5D1IA 2GZWA 1Q5OA 4EWAA 1G6NA 2VPVA 1QXRA 1O3SA 5KHHA 2EAAA 1SEFA 4EROA 2CGPA 2GC0A 3ST7A 4IEOA 4QGLA 3M70A 4IEWA 1FI2A 4HN0A 4O9EA 5EZWA 5FLIA 1OD5A 4EWEA 5CADA 1HW5A 4HBNA 4Q0VA 4I2OA 4IEZA 2MHFA 2UY9A 4BHPA 3DN7A 4YYOA 4LEJA 5K8SA 1ZRRA 4ONUA 3BCWA 1LRHA 2PTMA 3USSA 3EO6A 3E5QA 2PFWA 1O5UA 3FZ3A 4PJYA 3RPQA 2IXCA 3FWEA 3JZVA 2CV6A 4MV2A 3BPZA 1XE7A 4UXAA 4AXOA 4F8AA 2OA2A 2FMYA 5I8SA 4IEVA 4CYDA 3HT1A 1OI6A 4MGIE 4NVPA 1J59A 4PIYA 4EWDA 5LRRA 2MNGA 1UCXA 4FAGA 4XFFA 4XF0A 3OTFA 4UBGA 3TNPB 1ZZ7A 4K8FA 3WW3A 3KMHA 1Y3TA 1YFWA 2ET1A 4AVAA 1J3QA 2ETEA 3UKVA 1J3RA 3EQEA 4IEQA 2QCSB 4ORFA 2GH2A 5I0RA 1OMIA 4XF3A 1WGPA 3RYKA 1GQGA 4UBHA 5BUVA 2PAMA 3H1WA 4HVRA 4QMAA 5AVPA 3OGJA 3CF6E 2Q4SA 2IXJA 2H6BA 2Z2SB 4PIZA 4N9IA 3H8UA 4KWLA 3H7JA 4HSLA 4ZU5A 1CAWA 3WW2A 3NKTA 2IXHA 1ZRFA 2PHLA 2PQQA 4PIXA 4J1WA 2Q1ZB 3DV8A 5KHGA 3BU7A
chains in the Genus database with same CATH superfamily
4AAXA 1NA1C 2ARCA 1XB9A 4EN6B 4ASMB 4NIHA 1H2MA 3ASIA 2D40A 5F5IA 2G1MA 5J1XA 4LO8A 3I3DA 1VLNA 2DUQA 5JSOA 2EICA 4ATEA 3LA2A 3NJXA 3JXSA 4AEDB 1LHOA 5A3MA 1OUXA 3OEBA 1RITA 1QXPA 4XJWA 5A3PA 4UFKA 1OLQA 3KGZA 3ZR6A 1MS9A 1PO23 1FV3A 1VBA1 4GB31 1PO12 2LTNA 2WQ4A 4BJ0A 3AMQA 2AUYA 3T3YA 1NE4A 1RUC2 2TUNA 2YGLA 2F4PA 2ZJCA 1ZZ9A 1AL22 2UYBA 1BVVA 2XVLA 4MSVA 1ULFA 4RD7A 3F2ZA 3OBZA 4KG8A 2HH9A 4DUXA 4BWOA 4D69A 4DRRA 5IFTA 3HWJA 3KF5A 3AP4A 1IG0A 1HN1A 3R05A 5FZ4A 2QQIA 1CZVA 4XBLA 4C90A 1MEC1 5JI9A 4HK9A 1OFSA 4Q8KA 4C8DA 2D43A 4IEYA 4Y1XA 4JRAA 4L97A 1F4HA 1VBD3 4DS0A 1BK0A 4BM8A 4FOQA 2VBDA 2E7TA 3ZKYA 1W04A 1YUDA 3IT8A 1B09A 5DUVA 1UY2A 1VBC2 1VRBA 2ZBJA 3ACHA 4Q4Y3 3E6CC 3HR9A 2EXHA 3RMYA 1V70A 4FFHA 1PIV2 1V9U2 4NOTA 5F6KA 4B7EA 4CEYA 2GMMA 1J1TA 4OMDA 4QX5A 1N3QA 2CWMA 3GGLA 3I59B 4IGOA 3V0AA 1HV1A 1GOGA 1HRV2 2AREA 1BXHA 3RI9A 1DQ4A 1UZYA 3L2HA 1N1SA 4FT8A 2PHXA 4WVWA 3ZIXA 4E8DA 4DUVA 1CZSA 4Y22A 2ZMLA 1WD4A 3MO4A 5FUPA 2LW8A 2VNRA 4LLFA 4AEJA 4OHVA 3JCIA 3MFCA 3MW3A 1HKDA 5EQUA 1LOFA 3LAGA 1ASJ3 1GU3A 2RDQA 1AR83 3OYWA 2ZZQA 4GWJA 1O4ZA 2GN7A 3POSA 4L9BA 1AX0A 3DPRA 1UOFA 4G9SB 1UMIA 1W90A 2RR12 1ZRCA 2VOXA 4LO7A 1QQP3 3C7FA 2C6SA 5F32A 4LULA 1O3QA 1JZ4A 1TMF3 2EIDA 2R49A 2FCTA 4FFFA 1XOYA 4GA9A 2VUDA 2VXRA 4H55A 4H7MA 1ZZBA 2UWAA 3I3EA 4NRPA 5D8AB 3SHRA 4D8MA 1XU1A 2W39A 2XBO2 3O5SA 2Q30A 2ZABA 1RUI1 3KT4A 3ZO0B 2WZR1 4AEDA 3PVEA 5FYBA 5C9AC 2K2SA 3RVHA 4QD2A 4AZZA 1QHDA 1H1AA 4GJYA 1M06G 4LHSA 1RUI3 4ZU4A 4AHZA 5LA0A 2VAUA 2VZ3A 2X5IA 4XFIA 5FMBA 3RZKA 1DQ0A 3P3NA 3LWCA 1JH5A 4XBNA 3VKNA 4DIQA 3POIA 5A70A 2VTFA 1QGLA 4Q29A 3TEXA 4PF1A 1W6NA 3FE5A 1VJ2A 4E4HA 4MGTA 3WQ0A 2VMDA 2BBAA 3VBUA 4OULA 1QH6A 2WWUA 5DZGA 4QQPA 5F5QA 4QX1A 3H1MA 5EP9A 1O3SA 1MQTC 1XRUA 1PO11 1H1MA 3VD4A 3ZYPA 1DQ1A 2EAKA 1RUC1 2EF6A 3AVSA 1AL21 4G3YC 2GNMA 3HN1A 2ADEA 3CLPA 2ZGQA 1RJ7A 5I93A 1G86A 5C8CC 2O1QA 3FN9A 3ZSMA 4PT6A 4MXWA 1W6MB 2XLFA 4L92A 5M0TA 5F1RA 4Y20B 2RMU3 3U78A 4QPGA 5I8YA 3VZNA 4B8EA 1S0IA 1AL23 3EHKA 3VBOC 5C7GA 1K12A 5GZDA 2XH6A 3KLSA 5IVJA 2XJRA 1Q3EA 3NJVA 2OIIA 2VTXA 2DFBA 3NV4A 1IQDC 2GNDA 1JZ6A 1ACCA 4LUMA 5BNOA 3PVBB 3AXEA 1HXS1 1VBC1 2AH2A 3G7DA 2D44A 3ZN6A 3WNNA 2WC2A 3SKJE 2FDIA 4EYUA 4AHYA 1HX6A 1PIV1 1V9U1 4OHZA 1GZCA 2W95A 3VHRA 1HRV1 1VBC3 2VMGA 3HT2A 1CJPA 1W8HA 5J48A 1XYPA 2QNKA 4TLFA 5A3WA 1G9BA 1RB8G 2B7YA 4QQOA 1ULGA 3KT7A 3WCSA 2A7AA 2KR2A 5IATA 4WVMB 2BFUS 3E1F1 4JX0A 4CDQB 2FQPA 3AKPA 5FXWA 1JU4A 2AZ5A 2JG9A 1P8JA 4ZS3A 2AR6A 5HCAA 3U4SA 5FZAA 1R092 3CKHA 3NO8A 2ET7A 4GKXA 4PHZA 2XLGA 1LESA 1NT0A 4A6OA 1WWYA 3N9NA 5FZDA 3HBZA 4KU8A 4K1YA 2GNTA 3RZZA 2RR11 5JCTA 2Y60A 4IE0A 3THPA 3O1VA 5JMCA 3NKGA 4OZXA 4CTEA 4UAPA 2V4VA 5A3UA 4XQDA 1G8WA 5GM0A 1HJGA 3O1RA 3B02A 5JWPA 5JXGA 4JQTA 2XJVA 1I6XA 2G9FA 5FO9B 4E8CA 4B3NA 4FP3A 2RR13 3IIAA 5A6QA 1OLMA 1W8FA 4URTA 1EV12 2CU5A 5T3NA 1GMMA 1NCQA 1YLLA 5CZKA 4K9SA 1NXMA 1FPN2 2Y6KA 2B5HA 1PGW2 5FP4A 4COZA 2DCZA 1TE1B 2JB8A 2XBO3 4WM7B 1O8PA 2UY8A 4CP1A 3NV1A 1ONAA 2JD9A 3GJBA 4M4PA 1WA4A 2B9UA 4OHWA 2VW1A 3MI8A 4A4AA 3SEPA 4QX8A 2Z79A 5FYTA 4DY3A 2D6LX 2RM22 2VZUA 2ID4A 3MF9A 4CXWA 1XNCA 3HNBM 2ZEXA 5A7OA 1UW8A 5KXBA 3AZWA 3SCFA 4MZUA 3VKLA 1AYN2 4UW5A 4JGYB 4WV8A 5FBZA 3WEZA 2ZGPA 2GMPA 2J1AA 2QJVA 3I7DA 4RFT0 3GBGA 5FY9A 3AP6A 1YWKA 3JUUA 5E16A 1FAYA 1WBLA 2X10A 4JDMA 4A7KA 5JLVA 4Q0SA 1ZM1A 1SQ4A 3MDPA 2D6MA 4TWTA 3POWA 4UFHA 3X29B 1G9DA 3GZUC 1DQ6A 4UW6A 3UJOA 1MS5A 5A3LA 3KHCA 4JHZA 3VZLA 2MPFA 3M3IA 4CCDA 3POGA 1L7LA 4KU7A 3RJ2X 3FUOA 2VNGA 3VDDB 3QLQA 5ABJA 2JE8A 5C4WC 1W8WA 3BTYA 2VNVA 1OVPA 4FPJA 1PMHX 5LATA 1XYOA 3CZJA 2V4AA 2NN8A 4ZPIA 1W9TA 4YW6A 1B35B 3GZAA 1KQRA 2HWC1 5FQ0B 5IK7A 3PHMA 2YC0A 4Y24A 5H9SA 5IVFA 4CU9A 4XUTA 4NHKA 5FTTC 3E5XA 3FFZA 4P08A 4GD4A 5JOYA 3SH4A 3CL1A 4A6SA 2HWF3 3S5AA 1S0BA 1YQ5A 2PYTA 3Q8CA 1UD1A 1BBT2 1IS4A 2CTVA 2G9ZA 2GSYA 3AL6A 4GJZA 4YGDA 1BQPA 2TBVA 1RUNA 5E1RA 5D8AC 4BQ4A 4LXLA 2PELA 1I1EA 2RJ2A 1NLRA 5DZEA 4AFDA 4MADA 4H3WA 4QX0A 2D6KA 2TEPA 4GALA 1NY72 5HXMA 1XE8A 3VBFA 4BQWA 5K7PA 1VAKA 4AVSA 3RQ0A 1KJLA 3I3QA 1PMIA 5K4LA 2VUCA 2L9LA 1H4HA 3WF1A 2J7MA 4FSJA 1GOHA 1NXD1 4RS5B 1QDCA 3WQ1A 4A44A 4Y3OA 5L7OB 4Q0PA 4FXGB 3U75A 4IE6A 4P00B 3NV2A 4LJHA 4D94A 1KRIA 1R093 3QACA 3D0JA 3OF1A 1UKRA 1VAMA 3QD6A 4MVTA 4N53A 5FY4A 5A3TA 4Z92B 1CWPA 5A3NA 2O14A 1VBB1 4MGZE 4PDWB 2A70A 3SEEA 3VGIA 3I8TA 2FZ2A 5FZGA 4XBQA 4B29A 1SG3A 1DU3D 3N7KA 2VO5A 3VHOA 1EV11 4BDVB 1BMV2 2CY6A 1F8VA 1LKNA 1UKGA 3BIEA 5FXZA 3VBSB 4FQ4A 4JCKA 1FPN1 3GDBA 1PGW1 1PVXA 4AE2A 2VMIA 3PJQA 1SDDB 4R9CA 4YVWB 2WO7A 1QJY2 2VW0A 2DBIA 2XWJB 1W2TA 1U5IA 2A73B 2N7GA 1GP5A 2WZ8A 3DL3A 1D0HA 2J1EA 2V72A 2VZQA 1FPN3 3DYPA 3K4DA 5FAXA 5FYSA 5EHDA 4ASKA 4C91A 5K9YA 5FDBA 1WW7A 1W9SA 3U37A 2RM21 3UETA 3RDIA 1C1FA 2YPDA 2VZPA 2XQRA 1S1AA 1YQ6A 3UJQA 5AC92 1QJU2 2JKXA 3B7MA 4H7LA 3UGHA 4A7YA 4AVCA 3ZDSA 3M8LA 3NNMA 4D7SA 1UF2C 1V6JA 1AYN1 4HXCA 1CX4A 3ILNA 1TME2 5FO7B 1QXJA 4S2HA 1IS5A 4FP2A 4BQ2A 5HCHA 3V0BB 4Q4V2 3I2JA 4LHKA 2GZWA 2YMZA 1LULA 4DXZA 5E89A 5FYZA 1JHNA 1HQWA 5KHHA 2W3JA 2JXAA 5EYYA 1AYN3 1YRZA 4SLIA 5F3CA 2YU1A 5DABA 1R1A2 1UZWA 4D0QA 2WNVB 2RS12 4QGLA 2JIGA 3Q8BA 3A7QA 3ZFGB 2Q1FA 5EZWA 2C24A 4BIOA 4Z8BA 3A21A 4KG0A 5FLIA 1OD5A 3WSOA 2PHFA 2QQUA 2WNUA 3LE0A 4D6SA 2QQPA 5H9RA 4QX3A 2BBVA 3J9SA 4Q0VA 5GJ6A 4P9XA 4IEZA 4OCTA 4CDQC 1SPPB 4I2OA 2WN2A 3JB4C 3RGBA 2R1DA 5C33A 1Y43B 2P37A 3MFAA 4FOVA 3USUA 1RUE3 1VPHA 1RUD3 1PX3A 3M3OA 4YYOA 5T5LA 5JZGB 3Q8EA 2R30A 1J83A 3JQXA 3NRUA 3CHXA 1A8MA 4B4PA 4CDXB 1AX2A 1H8TB 3EYPA 4LE4A 1LRHA 2PTMA 2ZTNA 3I97A 1BBT1 3UL2A 5L7OA 2Q1MA 2PFWA 3CIHA 3NQHA 4BLJA 1AR62 3T2PA 2CV6A 1W9FA 5FZ1A 1WMFA 2E53A 2ZPXA 1LAJA 2RVAA 1OQEA 3PMSA 4IL7A 2Y6GA 4CDWA 5ISLA 3DXTA 2VCCA 5I8SA 1BBT3 3AP9A 1NY71 1JYIA 4CSWA 4K1ZA 5DMYA 5HV0A 1AR73 4CCNA 3VKFC 1W3VA 4ITCA 2WNEA 1DZQA 4NVPA 5FYIA 2FDHA 3UGGA 4WM7C 1AXZA 3CJIA 3AYCA 3LEGA 2I74A 4D6QA 4F3JA 1PM4A 1URXA 2MNGA 1C8NA 1XC6A 3QH6A 2R043 3OUIA 2DF7A 4XF0A 3OTFA 1MS1A 3NAPB 3LCPA 1H30A 4XDQA 1ZZ7A 4K8FA 4HL0A 1H6XA 2C1FA 2JDHA 2WNOA 2XVKA 4FPGA 1ZRIA 4LBLA 4RHV3 3PUSA 4S2GA 3SH3A 4AI2A 4AVAA 2QQMA 5FRAA 4RL7A 5I0RA 1HB3A 1A8DA 3PU8A 1BMV1 2X29A 1WGPA 2ENRA 4XF3A 5AFBA 2E6VA 1JZ5A 2WWSA 4JGYC 1PK6C 2PAMA 1NQJA 1JYWA 2VTXJ 3OPZA 3ABZA 2FMDA 4NHYA 2Q4SA 2IXJA 4DO0A 3W9AA 3DYOA 3ALQA 2H6BA 4KBBA 2D6NA 4KWLA 2JDNA 4CDUC 1QJY1 3OGRA 4CP9B 1QH7A 1OOPC 3HQRA 1IHMA 4AL9A 1LODA 3POJA 3T0BA 1EAH3 4XDOA 4IV3A 2X53S 4MXVA 4DFSA 3B9IA 1JZ7A 3A4UA 4FPHA 3DV8A 1K3IA 1ULOA 4ET7A 1QJY3 1BHGA 5FZ3A 3VDDC 4QAWA 3ZFGA 5AC91 1JS9A 5KXDA 1OD3A 3BTAA 2D5HA 4XUQA 4WM8C 5F2WA 5B2GB 5KWRA 1GBGA 3P5BA 2YBSA 1B35C 1W6QB 2J1SA 1VBE2 4CPBD 5DAQA 4AFCA 1KJRA 3AP7A 1DQ2A 2FHRA 3J26N 4Q4V1 5A7WB 2WZPP 1DBNA 1YJKA 3ETQA 1QJU3 4FO9A 3RRDA 4HVQA 4XJ8A 3S6PA 2Y34A 1TME3 1UOBA 4JGZA 4CDXA 2VC9A 1R1A1 2JEMA 4Q4V3 1KGYA 1LGNA 3E97A 1YYNA 2GC1A 2RS11 4GWIA 1GWLA 3WP5A 5JXHA 2R063 2RJKA 3R4DB 2J22A 1AF9A 5JOXA 2HKXA 1ZX5A 3AKTA 2BEOA 4CCCA 3V64A 3BALA 1YFYA 3NNJA 3WDVA 4A7ZA 3KV4A 3ZYBA 4DEQA 1XBFA 2QQNA 1NA1A 1LOEA 4HKWA 4Q4X3 4YW5A 4W50A 1CZTA 2LROA 4COUA 1SMVA 1PO22 2P6HA 4YGEA 4FPYA 2NMNA 3I4IA 5C8WA 1C3HA 2EXKA 1MVQA 3PNAA 4FI9A 4NR1A 4LE3A 3TYJA 4YZ1A 1SFNA 4XFAA 1VB2A 4RS5C 2WKKA 4XOGA 1JYXA 4FFIA 3OBTA 4QGMA 4YG0A 3IM0A 5C9AB 3ZYFA 1AR61 3W59A 2R7EB 5A6YA 1R64A 3PVOA 3C2UA 2KXLA 4LBOA 4PDWC 1REEA 1JYNA 2H0VA 4YPJA 2QBXA 4YW3A 3H50A 3IBMA 3AMMA 1GZWB 4M01A 1AR63 3HMYA 3MUY1 4KWKA 2VQ0A 1JBCA 1VBD2 4HSJA 3ZXEA 5LCWL 1LEDA 1EY2A 3VBSC 3N9QA 2XG3A 4ZZ8A 1RXFA 3LSDA 3BB6A 4YVWC 1OFNA 2Y0IA 1OVSA 2YC4A 4Q4Y2 1S2EA 2WZEA 1RUF3 3IPVA 1QNYA 1LOBA 3IZOA 3N7MA 1CAUB 1DGRA 1BJQA 1LOGA 2A6ZA 2PN5A 1ZA4A 3HBKA 4LO4B 4K20A 1V6KA 4IE4A 1BLZA 2I45A 2V73A 1SACA 3C7GA 3OG2A 2BNOA 2QQOA 3E6DA 4IEUA 4KNCA 3D6EA 4BYYA 3WDUA 2WWJA 4LQRA 2VECA 4ZXEA 5C3RA 3APBA 1MACA 4J6GA 3V56A 5C8CB 1Q56A 1VRH2 1XNAA 3NW4A 5E8AA 2VMEA 1UOJA 4ZKTB 1YQCA 1N1TA 5DAPA 2P5BA 5APAA 2X05A 1W6OB 4FAHA 1H2NA 4XIKA 4M3CA 4OZOA 5FWEA 1AR82 5FYHA 4B4QA 4CU7A 3FLRA 5FBJA 3PUHA 4QKBA 5IFPA 4YRDA 3JQWA 4DQAA 1K5MA 2GP5A 1ENXA 1U12A 2XJUA 1Q8PA 3GZEA 1DDLA 2O8QA 1NCRB 4FPOB 3K46A 1VR3A 1GUIA 1QQP2 2WNVC 1LNSA 1E5SA 5ANNA 2CGNA 4M3CF 4W6YA 1YO8A 2WLQA 4XUNA 1NLQA 5F9TA 4IEPA 1GNHA 1JOJA 1ND3C 4TTGA 1NQDA 3ELNA 2BPA2 2IFWA 2DCKA 3AZVA 4NE9A 5LBEA 2BNMA 4AQ2A 2LRPA 3AYDA 2RG4A 4B4RA 3CO2A 1VBE1 1YIPA 2WJSA 2CAUA 3DYMA 3LOIA 3OSDA 1C57A 4OHXA 5SV8A 1W0PA 2RJLA 3U11A 5HV4A 2Y64A 4RGAA 2PAEA 3UGFA 4XZPA 1FXZA 3WUCA 5JZGC 4QHOA 1BEV2 5CFCB 1H8TC 3BKZA 1TQ5A 3CJXA 4BQ3A 1DCSA 3B3QE 4NAMA 3SC7X 4MX3A 4QHZA 4QPYA 3GF6A 4DXSA 2WUHA 5D2AA 5F37A 2BVVA 1LHNA 5BNPC 3AC0A 4META 2YV8A 3N7JA 4MH0E 4IE7A 1GZWA 1APNA 2QQWA 1C5IA 1JUIA 2IXLA 1EPZA 3A0NA 4YVSB 4ARXA 1H6YA 1VB4A 2V5YA 5LA9A 2F17A 5IT6A 1PO21 4Y26A 5FKBA 2XGXA 1W8ZA 3H3ZA 1WW5A 3H7YA 3LD8A 5FOBB 3U10A 1JOPA 1EPWA 4FQZA 3K3NA 4HPKA 2BERA 1DF0A 4XPVA 1XQNA 1PGL2 2ARAA 3CMGA 3KCCA 1MQTA 3NAPC 2B46X 2VR4A 2JG8B 2ZAAA 1GYKA 1E5HA 2RMU2 3KVBA 3L9JT 3OD0A 3JBG3 3MUZ1 4LHLA 1C5HA 4MGQA 2Z42A 5A1LA 4OHYA 3DEMA 1QIQA 4L11A 4NIDA 1W8NA 1V6OA 2A6YA 2ZEZA 1PZ7A 4LO6B 2VZOA 5C8CA 2BOJA 3FUQA 1GZTA 1VBD1 2AGSA 3FC0A 3IDCB 3WG3A 5IWFA 1SLBA 2YU2A 3WW1A 4CP2A 5LBCA 4D7YA 2JIJA 1G7YA 1MVEA 1EUUA 4HETA 3KM5A 4Q4Y1 5KHKA 3VBOA 2JB4A 3WNOA 4GMP3 2V5DA 4AFBA 3W20A 1X33A 5LA1A 4FOWA 2QUOA 1DZRA 2JDYA 1F9KA 3IAPA 2E51A 5CEHA 3MEPA 5KR7A 2EIBA 1HB1A 4RR3B 3MIBA 4XUOA 3NNFA 4CCEA 1VRH1 4O65A 4QPIB 3WV6A 2HJIA 2GU9A 2MEV2 2Y8KA 3O1OA 2QVSB 2CDOA 1F5FA 1I5ZA 3MIGA 5J36A 2W5FA 2I2SA 2VQTA 3LEIA 3NL1A 4PBPA 1XSQA 4XFGA 1ASJ1 1O4YA 2HYKA 1AR81 5C4WB 1Y9MA 1LU2A 1TZOA 1OH4A 1VRH3 2JJ6A 2PQSA 4NHMA 2YBPA 2WA3A 4L0PA 4XMIA 1V00A 2JE7A 1UXXX 3THDA 3ROUA 1QQP1 5DN2A 2WQZC 4XACA 2CNAA 2E9QA 5FY8A 5JAXA 3WR0A 2SLIA 1TMF1 4GQ7A 5FUNA 1KFXL 2W1UA 2XR4A 5FZ6A 1PM7A 4JDNA 1NOVA 1WMDA 1QOOA 1UN1A 2UURA 2WFF3 3GNEA 4H14A 5IYYA 2KM2A 4P9YA 4Y33A 4OI4A 2OVUA 1VALA 4X6RB 2BTVC 4X8PA 1KEXA 3VKMA 2SBAA 3O14A 1W28A 2DTYA 2ZHKA 5FR3A 5LRSA 3KWVA 1PVC2 3ZOIA 3ZSJA 4AVVA 1BEV1 3ILRA 4JQRA 5IW0A 3IWZA 3ACGA 1RC6A 2QDRA 1US3A 3AB0A 2BDRA 2BP6A 4KBZA 4YGCA 4C0HA 4F7ZA 1POV3 1U0AA 3HIFA 4YARA 1BEV3 3N4MA 4LNVA 4KQ7A 5KHJA 4YM3A 3VBHB 4I0WB 4CU8A 5LA2A 2JE9A 3M4FA 4BPZA 1UY1A 3PUIA 3FBYA 1CGPA 3URFA 5DDJ2 1MZ5A 1T6BX 5C6CA 3BTZA 1E57A 3RNSA 4DUWA 4CUAA 1OURA 1SFPA 2R16A 3IB3A 2H0BA 5CNAA 4COYA 1REFA 4CE8A 1MZ6A 2VUAA 2ZGKA 3ES4A 2NYYA 2WRAA 4RQPB 1JTZX 1LHWA 3BYWA 1YFUA 5FK7A 3F95A 3JD73 1D4M3 4LUKA 1FMD3 4KMQA 4WVVA 3S0MA 2RMU1 2PA7A 2XDVA 3P6BA 1W06A 3WINE 2XKOA 1D4VB 2VNOA 2C4XA 4R4XA 2AYHA 1DGWA 3MHZA 2FDFA 4BZ4A 1ZZ6A 3LDBA 1X7NA 2IUWA 3EMRA 4DZGA 3HPNA 5IK8A 3I59A 3TN93 3WCRA 3M2MA 3VDCA 1W39A 4NHLA 4FPCA 2IC1A 1G9AA 2DDUA 4P9IA 4GH4B 4CCOA 3OUJA 2A71A 3LZZA 5C5TA 2HYXA 2IWGB 2A3YA 2ZGUA 1X82A 1NCRC 2C5DA 3I49A 1G9FA 3R4SA 3FFQA 1GNZA 1REDA 2HWF2 2E63A 4MGSA 4XE9A 4ZZ5A 1NYWA 2XLAA 5FY5A 3RJRA 2GAUA 4YSFA 2XXZA 4Q1RA 2YHJA 5EWSA 2QQLA 2JKBA 1AUYA 4IETA 1LU1A 1QJX3 5EIYB 2VMFA 1X9TA 2ZXQA 3DKQA 4QXKA 5FYCA 1MZEA 3ZN4A 3U4XA 1HIXA 3ZSEA 4L8QA 2GH8A 1UOGA 2WSUA 2ZZJA 5DUWA 2IXIA 2R0FA 3DKWA 4FPFA 5DQ0A 4GWNA 2WYFA 3T4HB 5D21A 2ZX3A 5A7SA 2MEV3 4XFCA 5D8AA 5ANQA 5K0UB 3RZHA 1R083 5CFCC 2OPKA 4TYSA 4Y1YA 1LHUA 4XAEA 4H2AA 4PF5A 1ST8A 2VZTA 2ZKLA 3CQOA 5E88A 2Q8CA 5IVBA 2ZGTA 2G4IA 2B9VA 3VL9A 1DFQA 1KS5A 2AEZA 4CPBA 4O7XA 1GFF2 3C7EA 5LEJA 1GNYA 2Y33A 5JXJA 2FCUA 1TNRA 5KHIA 4E4ZA 3SNMA 2ERFA 3FHQA 3KB5A 4YVSC 3TB0A 1FATA 2JD4A 4AI3A 1C1LA 4HKLA 1PVC1 3EBRA 4LORA 5EJZB 4C1XA 1RHI3 3I54A 5BXXA 5BYNA 2XBO1 1RUH3 4RFRB 3AVRA 1MS3A 1AJKA 1H4GA 1YJLA 3GBWA 1J58A 2WN3A 5D1IA 1LGCA 3IMMA 2OS2A 4U36A 5IJRA 1YXWA 1PVC3 2PLV2 4R9DA 2JG8C 2VPVA 4NWWA 3N9LA 1POQA 4HFSA 3A0KA 1OT5A 4YG3A 1GOFA 5GLWA 2NLRA 1UYYA 1NX9A 1L7RA 2GC0A 2XVGA 5EJ1B 5JOZA 2EXIA 5LY2A 4ES8A 4SBVA 4IEWA 1F35A 1W6MA 4MLOA 4DXTA 3WF2A 2DCJA 3WF4A 4O9EA 4Y20A 5DUUA 4AFAA 1N1YA 1ND2C 1WCKA 3OGGA 4CCJA 4CRQA 4BCUA 4EWEA 3O1MA 2B4KA 1SLCA 5A7PA 3OPWA 1K42A 2B39A 5FP9A 4BQ5A 1RVF2 2GN3A 4HBNA 4KGQA 4CZSA 4EN0A 2QFEA 1OKOA 2CHHA 2P1BA 1PX4A 3VD9A 2MHFA 5DDJ3 5LY1A 1OUSA 1ZBA3 5DPNA 1F5JA 1PK6B 1S0GA 4BHPA 1CIYA 4BQYA 2YG0A 1ZRRA 4CDUB 1XXNA 4ONUA 1I5PA 3DXUA 3ZMOA 3BCWA 1DLCA 3BOPA 1OOPB 3MICA 4FPEA 3LPFA 4RR3C 3USSA 3ZMNA 2VOWA 2WO2A 3E5QA 4OMCA 3FZ3A 4QPIC 2IXCA 3FWEA 1HRI3 1HJFA 2VCBA 2DWRA 4Y5Z0 1RUG2 4QU2A 4AAPA 1WW4A 4AXOA 3PTYA 3SKVA 3AZYA 2LALA 4V2WA 4YW1A 4FTEA 3T0DA 2GDFA 4KWUA 3WZ1A 1RUE2 1GWKA 1RUD2 1RYYA 3HT1A 1YI7A 1S0EA 4WM8B 5EPAA 1WUVA 1US2A 3VD7A 4MGIE 4WVMA 3HVDA 1SCSA 3VBRC 2HWF1 4YZ2A 4CDQA 1Z7S3 4JKLA 3OBAA 5ERLA 3M7AA 5DUXA 5J98B 2XOMA 3BTXA 5BNNB 2ZS6B 3O7OA 4XFFA 1F2NA 4UBGA 1Q8SA 1GSLA 1AVBA 5FOJB 3B9CA 4J25A 3BN6A 3CU7A 4LMFA 2ADDA 4QX2A 5DG1A 3TNPB 4BMEA 2R072 2E32A 4OI0A 3INAA 3KMHA 1YFWA 5B4NA 1RUJ3 1AR72 3WXPA 3WHUA 2GH2A 4XHBA 4AOCA 1OMIA 2ZX2A 2LS6A 2VCAA 1LJ7A 2ZHMA 5AVPA 3RWNA 3CF6E 4QQ2A 2HWB3 2R042 3AZZA 4E9KA 1R091 2IXHA 1CPNA 2QKDA 4PLNA 5FMOS 4WM7A 5FZHA 1W03A 1WLWA 4U2AA 3VBHC 4RHV2 4OI2A 2PQQA 4GIQA 1NG0A 4PIXA 4BMBA 3WQBA 3KQ4B 1H0BA 1QOSA 5DXDA 4NPRA 3WUDA 3T4VA 5HXVA 3WD5A 4QKDA 4BK5A 3R4UA 2YDEA 4KL1A 3RZLA 1F15A 2YYOA 1FT9A 4XC9A 3ZN5A 3S7IA 1FYUA 4XCBA 2A6VA 3KCXA 4RQPC 5FV3A 1DYOA 5FY7A 1EAH2 1PK6A 2PLV1 4JGYA 4QXCA 5F3IA 1OF4A 4N9HA 1UY4A 1FOD3 4FFGA 3OGSA 4CUCA 4R52A 4I30A 3OB8A 1ZVFA 5CISA 3ZFFB 3FJSA 4MHUA 5LASA 3WF0A 1CAVB 2XJSA 5FZCA 3WG2A 1OOPA 5FZOB 2Y6HA 2B8MA 2PLV3 3A22A 1R1ZA 2QQJA 5DAVA 3UNPA 4TXWA 1DZTA 5FPXA 3VDDA 4BLIA 1IKPA 1W8OA 1RVF1 4FPKA 4Y5SA 1OKQA 1KITA 2PHWA 4GH4C 3VDAA 1X9PA 5I0SA 3HN3A 4Z82A 1OXCA 3DGTA 1B35A 3BGAA 4XFHA 1CIWA 3KHBA 5FQ0A 1Z78A 1S2KA 2OZJA 1RVF3 5CAZA 2BGCA 2ZKNA 3ILFA 2R062 3OCPA 1SLIA 4BXSV 1W8UA 1UL9A 4QU1A 3OD4A 4JRLA 3T2QA 5FP8A 3K4AA 2HBUA 4LK7A 4FVVA 1RUG1 4TZDA 2VOVA 3I2IA 1PZ8A 2IZWA 2QQKA 2WT1A 4Q4X2 5FZIA 3KV6A 4EN8B 3AFGA 1ND3B 1RUE1 3LSEA 5FZBA 3C3VA 1GANA 1RUD1 2PHDA 4LA3A 5EFUA 3RYRA 5K0UC 5LW9A 2NZ9A 1UWWA 4CCKA 1D7PM 1RUG3 3UK9A 4LIUA 4XW3A 4M0NA 1ULCA 3B5LB 3NNGA 2OYZA 1WLDA 5F3EA 3WLUA 3LPGA 4NIGA 3AYEA 2FBEA 3WDXA 5FZLA 4UF0B 1ENQA 1V6MA 1OA4A 2EALA 4NO4A 4ARYA 5F3GA 4RS5A 5LB6A 2HWD2 1CAXB 4DOUA 2C9AA 5T5OA 2W2IA 1BK1A 2VH9A 4D6RA 1AR71 3J4UH 3BI3A 4CVUA 4Z2WA 4K6BA 4P9WA 1CONA 5BNPB 5L73A 3AJZA 3K75B 5A33B 1CR7A 3MLLA 4NAOA 4PDWA 4MO3M 3ZVXA 3ZR5A 4COWA 4E2SA 4Q0UA 2J1RA 5LK7B 2R073 1JUHA 5CFDC 4CEWC 1RUF2 2XHNA 4C0BA 3GCWA 3WX5A 1DIWA 3NVCA 4I3GA 5A80A 2R041 1RUOA 1ZNPA 3VBSA 3WDWA 4DRVA 3GJAA 4LHNA 2I07B 2NQYA 2QZ3A 2AENA 3ZYIB 4YVWA 4RHV1 2UWCA 2VXJA 1SZBA 5FREA 4EN7B 3N36A 1OQDA 2JDAA 3KGLA 4OLLA 4YW7A 4PLMA 2ZX1A 4DEVA 3J8F3 5IVCA 2VVDA 4E27A 1GWMA 1HLCA 2GMEA 2JDKA 2BOIA 2RS53 3O0WA 3WG1A 1DGLA 3BVCA 4UFMA 2W87A 3VBFC 3VZKA 5KXCA 2HEWF 4XJUA 2DBNA 2ES3A 5JUVA 3WHTA 1ZA7A 3ZYJB 2F4LA 3MLJA 1EAH1 4K8RB 3MIFA 3ZXDA 4UOJA 1MS4A 1UO9A 1YFXA 2W1WA 5JR2A 3V0BA 4XF9A 5CBLA 1T2XA 4P5HA 2YB7A 4YFZA 1YNAA 1CN1A 3OY8B 1RMU2 5I0TA 3IMNA 2Q8EA 4DINB 3GHMA 4TLGA 4N43C 3VZOA 4JV4A 1JW6A 3G6JB 1NZCA 2J42A 3IAQA 4L2NA 4Z2AA 2WNVA 3ZFEB 4Q8LA 4BH9A 1NKGA 2XL9A 2ZGNA 5JR7B 4KH9A 1O3RA 2P17A 4ZS2A 1CPMA 4JDOA 1QJU1 1ND3A 1EUTA 3T0AA 3OPTA 1COV3 5F39A 4EZ4A 2VMHA 1TME1 1ZREA 4MG2A 3T08A 1O7FA 1O5LA 1SPPA 2X09A 4JTOA 1UXZA 1YEWA 4I0BA 2CWSA 2XQXA 1JU3A 4LKEA 5IUQA 3I2DA 2ZGOA 4I01A 3RSJA 4I09A 2R061 3ITQA 1W05A 5BNNC 5JZGA 4IERA 2VQAA 3GM8A 3MV11 1Q8OA 2WQ8A 4NMIA 4A45A 5C3QA 2WA4A 3TAYA 4E2QA 1SHWB 1H8TA 2RHPA 5I0DA 4CXYA 4Q0QA 2QTWB 1H1IA 3LDRA 4JZRA 4Q4X1 1X8EA 1OF3A 5FYVA 5EXOA 3HNYM 1J3PA 1SLTA 3P1IA 5BNPA 5FWJA 4D7TA 1GICA 5A33A 1GKBA 1N3PA 5A7QA 1H9WA 2R0HA 5DG2A 2HWE3 4UI9L 1WCUA 3ECQA 4RSUA 3HEIA 3D0SA 3R0RA 5KC5A 1UPSA 3NV3A 3V65A 1DQ5A 1H2KA 2WL1A 3AXDA 2P6CA 1QKQA 1A6CA 1O91A 4ISQA 4P9JA 2ZMNA 4GKYA 2LM3A 2VVEA 4XURA 4B1LA 1WZXA 1SCRA 3JBG2 3POEA 4LBJA 2IVIB 5CVRA 2WBKA 3W5MA 1OLME 1MZFA 2HWD1 1YCIA 3PUAA 4KI5M 3S7EA 4XTPA 4IE5A 4B7KA 2P3JA 5FYMA 2IVJA 3PDQA 4E4SA 3NAPA 3AMPA 3ZXAC 2R32A 2WNUC 2BU9A 2VW2A 2VZ1A 2CAVA 3M3CA 2E7AA 2RS33 4IGQA 4S2FA 5CU1A 3MPPG 1A78A 2HWD3 3AL5A 3BODA 5JOWA 4EN9B 1W6PB 3AM2A 1RUF1 4DMIA 4YGBA 3RWKX 3I3BA 1XE0A 4HN1A 5I0UA 2YROA 3VZMA 2BJSA 4YM2A 5FY1A 1YHFA 3GYDA 4XAAA 3RZGA 1CAWB 3T1LA 3HOBA 5JIUA 2BNNA 3ZFFC 3BU0A 1LENA 4P9LA 5EYXA 4CP9A 2FDKA 3TEZA 1VBA2 4LBNA 4GB32 5FZ9A 1ZBE3 4AYUA 2WSVA 3C7HA 3RFRA 4ISRA 2E26A 5HCBA 1L7QA 3ZXKA 2Y38A 3HAGA 5J3UA 3KZ4C 1ULDA 3KS7A 1VAVA 3B94A 5JSRA 1ZRDA 4AFMA 2DVBA 3R6SA 2BFUL 5ACA3 4QM9A 4LTAA 3U0ZA 2W9XA 2ZHNA 2D6OX 3ZSKA 1W6QA 3GHNA 4Q4W2 5J37A 3NJZA 2DV9A 2ARBA 4K3UA 5A32B 3CZUA 4CP0A 2BV4A 4BE3A 5J09A 5A7WA 2VVFA 2WYSA 1AR93 2ZOEB 4FBFA 2O0OA 3I3MA 3WNKA 1RMU1 3ZXLA 3K48A 3UESA 1AX1A 2WFF2 2D98A 2WDBA 3SCGA 4XFBA 3K2OA 5FLHA 1JYCA 1RMU3 1S0JA 2YGMA 3UKTA 1SDWA 1ZYBA 2JDPA 1STMA 3L2YA 3LOBA 5T50A 1PGSA 1QNWA 3B01A 4HT1T 1CJDA 1KD7A 4QKNA 4OUMA 1RXGA 2FCVA 2HLEA 2VZVA 3AMHA 4UT5A 5FZ7A 3B00A 4AI8A 1DYKA 2OUJA 3E5UA 5C3OA 3FMGA 4UFLA 4NIAA 1H8VA 4OYUA 3BOWA 3GBFA 4FOYA 2Q8DA 3BPSA 4FCAA 2ZCWA 1LEMA 2A3XA 2ZAHA 3A23A 5T5PA 5EJ3A 2NP0A 1S55A 1AL0G 3Q9OA 3GALA 1OPOA 3AX4A 4IXLA 5IK5A 3H8OA 1XNKA 5C9AA 3ES1A 4YW2A 1SBFA 2K0GA 3D8CA 3POFA 2P34A 5GLZA 3MZHA 1BVP1 4IV1C 3ZLIA 3V0AB 4F83A 5L9BA 4UFJA 1IPJA 5GLTA 4MYEA 3T2OA 4LOTA 3H3LA 3N7LA 5FZMA 3LIGA 2BQPA 1I9RA 4NIIA 1OLRA 1JZ3A 3C7OA 2XUMA 1OPMA 4K21A 4CUBA 3VZJA 1O4TA 1D4M2 2VZRA 1FMD2 3JD72 3O1SA 5T5JA 4IDZA 2WZR2 1UZ0A 3JBG1 4IGPA 1V6IA 2BWAA 3OUHA 3OYWB 3LKJA 3VN4A 1GV9A 1CAUA 2ZEYA 4X8NA 5A6XA 2Q8OA 2WS93 3DPRB 4LBQD 4QDRA 3WP3A 5C5UA 1QWRA 3TN92 2W91A 2ZGRA 1YC61 4AG4A 4AI0A 1QY4A 5FLJA 5FYUA 5CG9A 4GMP1 4R8HA 2A3WA 3MIEA 1F4AA 4FXKB 4GULA 1O59A 1ND2B 3TWIA 4CDXC 5A32A 1W6OA 5FZ0A 5AFEA 3MIDA 4XJZA 1UZVA 3IDBB 1IGOA 5F6LB 1Q43A 4BK4A 3ME2A 5FY0A 4YFWA 3WNPA 2GALA 2VBBA 2W92A 4WZFA 1QJX2 2LUWA 1NCRA 3ZYHA 1UMHA 4INDA 2X5IB 1E5RA 3DCQA 4XETA 3SCHA 3ZFEC 2D7FA 1H9PA 1TEIA 1SBEA 3ZPYA 5FPLA 1VBA3 3ATGA 2W46A 1CQ9A 4GB33 2OZ6A 4WVZA 1X50A 4XEZA 2B42B 3MW2A 5CKQA 1W6NB 2YFUA 3ORJA 4NRMA 1R082 1GP6A 4AI9A 5CKNA 4AQ6A 4Q4W1 1WD3A 2OKXA 3VBUB 5FZEA 4EV0A 3ACIA 1XPWA 5FMOL 1O6UA 4HVOA 1S0CA 5TSWA 3ZX7A 3UKNA 4CU6A 3N9MA 4C1WA 5GZGA 2V09A 1GR3A 4GAZA 1DLLA 1Q5OA 3W5NA 2BWCA 2WFF1 1NLSA 4EWAA 4Q4W3 1MEC3 1QXRA 1HXS2 2C9KA 3VBRB 2VU9A 3AZXA 2WR9A 4LIVA 2JENA 5CFCA 1CESA 4PI2A 4ASLA 5CIRA 5FXXA 3ZIWA 1W0NA 3VKOA 2ZGSA 3ST7A 3MW4A 1AXKA 4OVEA 4MXWB 1JODA 1TVGA 3GCXA 4IEOA 2TNFA 1HQNA 1Z0HA 3M70A 3TEYA 1OA2A 1FI2A 1RHI2 4HN0A 4QPGB 1QOTA 1RUH2 4R9AA 5GLVA 3O12A 4COVA 4HK8A 4YVSA 1W2AX 1J84A 2HEYF 2JX9A 4GMP0 2G19A 1HW5A 3MBWA 1K5MC 2XWBB 5JPNB 4LKSA 3ACFA 2FDJA 5LZ6A 1POV1 5GZCA 3ZYRA 5BNOB 2JDZA 5FJHA 3ZN6B 4LEJA 1RIRA 4QB1A 4QX7A 5K8SA 1CX1A 2YY1A 3AKSA 4XMAA 3TEWA 1ODNA 2W08A 1DGWX 5KXEA 1WW6A 2JG8A 1V6NA 1IZ3A 3POYA 4Y1VA 4PJYA 3DECA 4TN7A 2FZ1A 4BB3A 5GKAC 3SH5A 3WF3A 1UYZA 4MV2A 3BPZA 5JMOA 2G9GA 4UXAA 5FP7A 4R9BA 4F8AA 2FMYA 2DU0A 2ZEWA 2QQVA 3K77A 3Q8FA 1ZBA2 3WNMA 4IEVA 1ND2A 3JD71 1D4M1 1FMD1 5CB7A 3ZXGA 1C28A 1OI6A 4W8JA 3S57A 2VY0A 1J59A 4GXLA 2WO1A 3ZYGA 2JG9B 4LBKA 4Z1VA 4EE2A 2D3PA 3GXUA 1HN0A 1PGL1 3H8RA 5T52A 2D3RA 1UY3A 1UCXA 1WBFA 3AKQA 3BIWE 2VUJA 1HRI2 5DAXA 2OQ6A 4FAGA 1WCQA 3TN91 2WZR3 4JKMA 1OH3A 1UU6A 3AFKA 1C8M2 2E7QA 4AEKA 2BGOA 2JDUA 4RR3A 5FZFA 3PTRB 2ET1A 4QPIA 2ETEA 3DUIA 4IEQA 4ORFA 4Q5OA 2QCSB 3UKVA 4B1MA 1DHKB 4PI0A 1NZIA 3RYKA 3W58A 5BUVA 4NJ4A 1Z7S2 3H1WA 3OBRA 2JECA 3J7NA 4QMAA 4W6WA 3OGJA 5C4WA 1NCQB 4YW4A 5C3PA 1DYPA 4PIZA 1OBNA 4N9IA 3H8UA 3IDEA 4AEMA 4ZU5A 5SV5A 3KV5A 1AYM2 1POV0 2B45X 3WW2A 4Y1UA 1QJX1 3IKWA 3VBRA 1ZRFA 1AXYA 2K46A 1HB2A 4W65A 1DP0A 4Y4YA 4J1WA 1RUJ2 2Q1ZB 4XJAA 5CYYA 1PO13 5JVVA 4Q1PA 3NMBA 3VD5A 2MEV1 1IQAA 1O8SA 1RUC3 2JICA 1R081 4DNYA 1NE6A 1QJEA 1UMZA 2PHTA 2Q0AA 2DCYA 2VD7A 2XJPA 2Y0OA 5JIAA 5J7MA 4PQQA 2HWB2 5JXIA 2CYFA 2Z5WA 3LA7A 4JC1A 1K45A 1LGBA 5J96B 4IEXA 1UYXA 5LEKA 2XUEA 4GZ9A 1XNBA 2A6WA 2HWC2 4JTNA 4FTSA 1GZ9A 3OGVA 4Y5TA 5HPOA 1AHSA 3VUOA 3FLTA 4LO5B 1I3HA 4QB2A 3M3EA 1A3KA 2NM1A 3H8XA 3ETPA 3SQOA 4CEYC 1L3JA 5KBFA 2A6XA 3HD8B 1PMJX 3FHAA 1D0GA 3PUQA 1WCDJ 3EXUA 1RHI1 3VBHA 2VZSA 1HXS3 1KDKA 3S30A 1RUH1 2WIIB 3FLPA 4QDSA 5IAXA 4EZHA 4LPLA 4X6QB 5IK4A 5ABJB 1JZ8A 3PURA 3MV01 4N7IA 1IS6A 4RN5A 4HKOA 1PIV3 1V9U3 5C71A 4QM8A 5I8TA 5GZFA 2EVXA 4CXXA 1M4WA 1FOD2 1HRV3 2W52A 1EP0A 5GZEA 1LOFC 4NRQA 1QEXA 3MF6A 4N8MA 4CEWB 3EJKA 1RL3A 3DPRC 4RQPA 3WP4A 4MOAA 4E4DX 1QU0A 1UIKA 1IG3A 1X8MA 5FP3A 3VLBB 2J1VA 1UQXA 5A1FA 4XF1A 3SITA 4HZFA 4I0AA 4I02A 2BW8A 2XHKA 2PHRA 1W2OA 2BYVE 4UW4A 3WG4A 5IVVA 5I91A 4J1XA 5DDJ1 1E5IA 1ZBA1 3HQUA 5EV7A 1VBB2 3KF3A 4UYBA 4AEDC 4Z07A 2DURA 3VBFB 4XUPA 3QH7A 4M00A 4RGGA 3ZXFA 4QWNA 1LOAA 4GH4A 4CCMA 4PBOA 2CDPA 1JYVA 4YZ4A 4G4FA 3VL8A 4RA0A 1HRI1 2X5IC 4DB5A 3OOXA 3NNLA 3SXWA 4P9GA 4AK3A 3LEKA 4M3CE 1C8M1 1Q8VA 2OXBA 4K40A 2Q5TA 3K3OA 1JZ2A 5GALA 4A3XA 2UU8A 4LLOA 4N53B 5JI7A 4N43B 1RGSA 1WA6X 3JB8A 5IAVA 3LFMA 5AVAA 3VBUC 2XMLA 1C8M3 4DY5A 3CDZB 3U14A 4KWJA 4LBQB 1Z7S1 3AK0A 1W3XA 4QT6A 3C8XA 2BUKA 4LA2A 2YFZA 3O1PA 4MUVA 1W99A 5K0UA 1VP6A 1AYM1 3ZXJA 5FFOC 4HG6B 1UX7A 3NWKA 2DYCA 4LR4A 3P3PA 4MGKE 4D3WA 2YZ4A 3ZDVA 2VM9A 3DF0A 1U5ZA 1D2SA 1XJAA 1RUJ1 5FIXA 2J1TA 3TOJA 1OA3A 1AYM3 3UYJA 1PNFA 2CSGA 2AEYA 4QPGC 5F8PA 3WT3A 2C0ZA 2D97A 4QGNA 3QOPA 3CBNA 3K4ZA 4AQSA 2HWB1 2VQUA 4CA9A 4GWMA 4P14A 4V2VA 1FNYA 4BXFA 5BY5A 1LB2A 1W8TA 1UPIA 1RINA 1RTVA 5BNQA 1EYBA 3RZMA 4PLOA 1LTEA 2DUOA 3WQ7A 5BNOC 1Y9GA 2ZACA 2DVGA 4URAA 4CEWA 2VBPA 4QQLA 1RJ8A 3NSTA 2XL7A 3LB9A 1WLTA 2XKPA 2YC2A 2ZMKA 3J8F2 1QF3A 4UFIA 2XPJA 1ZZ8A 3TBDA 2RS52 1WMEA 2HWC3 5FXVA 4BIFA 5L9VA 3NJYA 1HDKA 4Y1ZA 4NPMA 2VGDA 4OUEA 3W21A 3WNLA 4KGGA 3VD3A 3TRSB 3RZJA 3FL7A 1GQHA 2OT7A 4BU2A 2WNUB 3WDTA 1ZZCA 4K7JA 1FOD1 5IVEA 3MPBA 3POBA 1ULEA 2EIEA 1YQ2A 1LECA 2JG9C 1D2QA 2DVDA 3WW4A 3USUB 2K9ZA 1SLLA 3O0VA 5LWBA 2R6QA 3IDAA 1UX6A 1KS4A 2W68A 4LKFA 5FMDA 4CDUA 4AR2A 1OC1A 4BOWA 2PAKA 1GQPA 5G04L 2W1SA 1DG6A 1COV2 5KC6A 4N43A 1TNFA 2BRTA 3LIHA 4AGGA 3KSCA 4CDWB 4MHRA 5T54A 2HEVF 4AF9A 4LBQA 2AACA 1NCQC 4YZ5A 4LITA 4OFGA 3T09A 1KXGA 5JPMB 4HOOA 1OQ1A 3KVAA 4RGKA 4LK6A 3J7MA 3I2HA 4WM8A 4A3ZA 3LA3A 4AHXA 2WLPA 1VBB3 3CJIB 2F6BA 3N9OA 4N90A 4Q2FA 2DTWA 2BZDA 5GLUA 3ZSLA 1HQLA 1EV13 2XONA 3KT1A 2CL2A 3OEAA 5FPZA 3AKRA 3PU3A 1LR5A 1JXNA 1MS0A 1MS8A 5BNNA 1W2NA 2WFPA 4L99A 3I2GA 4I3PA 4QXHA 5FK8A 2UYAA 2HWE2 4ZHNA 4PQ9A 5L9RA 3T30A 1Y9QA 4IESA 1BCXA 1CD3G 1LOCA 2PXJA 3PLQA 4O61A 4OQ8A 3QBQA 4DPNA 3UT0A 2H6CA 3H1YA 1XU2A 3WDYA 1XYNA 3H3UA 3WVJA 4NHXA 1IPKA 3PMEA 2ZGMA 4M4RA 1G9CA 2RV9A 2RM23 4OUSA 4P5YA 2WABA 3S5QA 1IKQA 1VE0A 5CFDB 3AJYA 3E6BA 4AW7A 5F7UA 4YZ3A 2Z4FA 2W1QA 4AGVA 3RMXA 4NUBA 4YG6A 1WLCA 5A6ZA 4AGRA 4IV3B 5FCCA 4NN0A 4QDQA 3IIIA 4R4ZA 5FUIA 2VMCA 2OW4A 3VHNA 3H0OA 2RS32 2W47A 2VOTA 3N9PA 4M0HA 4BQXA 5C70A 4UWDA 5JDBA 1KDMA 5FPBA 5ABJC 5H9QA 1UYPA 2R071 1O3TA 3EB7A 3HQXA 1ENSA 5CKMA 1W0OA 1Y4WA 1AJOA 4JKKA 4IV1B 4YM1A 1F31A 3PIJA 4FTBA 5FPAA 5FYYA 4P02B 2AC1A 2XJQA 3SLIA 1N1VA 1ODMA 1BZWA 3VHPA 1N3OA 2ZGLA 1ZBE2 3J8F1 4IUGA 5F2SA 2DFCA 3O1UA 2JDMA 4JGZB 2FD8A 3THTA 2RS51 1V0AA 1WMXA 3PL0A 4XXAA 3ZFFA 2DUPA 1VMFA 2OUHA 1JI6A 1CAVA 4E2GA 1J1LA 2WT0A 4YM0A 5FZOA 3KQRA 3T1MA 5ACA2 1N47A 3MLKA 4XDPA 5FZ8A 4HLTA 1FV2A 1PZ9A 5A3OA 5E6HA 2NMOA 3H42B 4JAAA 3SMHA 4ZU7A 1NA1B 2D5FA 4XQ4A 4O9GA 5FPUA 1AR92 3WP6A 1S0FA 3AMNA 1MR5A 1UU4A 2P2KA 4WZCA 5LBFA 3CNAA 3RG0A 3U07A 2WT2A 2YUEA 4HONA 2YBKA 4Y4RA 2ATFA 4IW3A 1WKYA 5L36A 1VIWB 4XTMA 2YXSA 1XNTA 1QMJA 2E33A 2GC3A 3LDKA 1IPSA 3M3QA 2Z69A 4N53C 4QKFA 4S2DA 1COV1 2HBTA 4QHBA 1W2UA 1SFYA 2DVFA 2WO3A 4HMZA 3T2TA 3FX3A 2IXKA 2GP3A 1T6GC 1W9WA 5FO8B 5LBBA 1K5JA 1JHJA 5HI0A 2DCTA 3LF7A 2D3SA 2QDNA 4OQ9A 4AVBA 1TG7A 5CFDA 2E31A 2IFRA 5BPXA 3TNQA 3KV9A 4XF4A 2D93A 1W9YA 3IPVB 4CUGA 5C3SA 3M1HA 2Y6LA 2O8OA 2BGPA 3D3AA 3ZKUA 1FX5A 2QZ2A 3O0XA 1U5YA 4UF0A 2R1BA 5F5CA 1NAEA 2W0XA 4A2UA 2OQ7A 4ZY9A 5JSPA 2ZHLA 1AZDA 2ZX0A 4TSVA 1CAXA 2HWE1 3OJBA 4PCRA 3FBMA 4MGYE 4AI1A 5CG8A 3WY6A 4YLZA 1IS3A 2CGOA 4QQHA 1YQ8A 4LT5A 5HBAA 3SISA 1S4CA 4IV1A 1JOBA 2YPJA 2D6PA 1PNGA 2X8KA 1YI9A 4A42A 4V1PA 5IVYA 4BQ1A 5FJKA 1LHVA 2GC2A 2VL4A 1JN2P 3MYXA 4XZUG 4M3CB 4WBBA 3RS6A 5AC93 2WS92 4XVHA 4JVAA 2A5ZA 1K5MB 3FHIB 4QPWA 5L19A 5CA6A 3JU9A 3D82A 4EJRA 2RS31 2J1UA 4W6XA 1XNDA 1BKZA 3ZPOA 4N7UA 3D4KA 4BA6A 2EIGA 3ACLA 4XABA 4NPLA 3QCWA 4NWVA 4YNIA 2ZA9A 5A1AA 1UAIA 2ORZA 1IOAA 1XSRA 3WNXA 4XILA 2P3KA 3H9AA 2GNBA 4LKDA 1R1A3 5A7NA 2P3IA 3ZM8A 4A41A 3GZTB 5FKCA 5FZKA 4AQTA 3KCYA 2RS13 5DAWA 2XJTA 1LCLA 3B93A 4XXPA 1JYTA 1NUKA 3U1XA 2VULA 1DGRN 3RYPA 3CEWA 1ZBE1 5BV6A 3WOGA 1UIJA 2EA7A 3I2KA 2WAAA 5G05L 1UY0A 2VE1A 3VV1A 3LEMA 1G6NA 5H9PA 5L7OC 2A1XA 1X36A 3ENRA 3OY8A 5T55A 2EAAA 4OI1A 4W4ZA 3MIHA 1SEFA 4EROA 2PHUA 2Y26A 2CGPA 5ACA1 2NPIA 1A34A 4QXBA 2C26A 2DU1A 5DZFA 3HNMA 4CDWC 3ZFEA 3THCA 3J7HA 3Q8AA 1U5XA 5LK5A 4XCAA 1AR91 4ZONA 3KD4A 5CADA 4JHTA 2W94A 3RI8A 3CJIC 4QB6A 1BYHA 2QE3A 3BUCA 2KA3A 1JMUB 1FNZA 1MEC2 1QDOA 2ORXA 3B69A 4AVTA 3LGRA 1QJFA 2UY9A 1S0DA 2ARXA 1PHMA 3D5OA 3IN9A 3DN7A 3N3HA 4HPKB 2P3YA 2XB6C 1QJZA 2Y6FA 1MQTB 1H2LA 5IHRA 4XJ9A 2FDGA 3EO6A 1O5UA 4HANA 3RPQA 3JZVA 1ENRA 2VG9A 2ILMA 3VB9A 3PIGA 1XE7A 1OHFA 1VMJA 2OA2A 1YIFA 2DVAA 1C4RA 4CYDA 2ZX4A 3O1TA 4XYXA 1ASJ2 2VOKA 3VBOB 3LQCA 1SBDA 1Q8QA 3UV9A 5B4XA 1HB4A 4PIYA 3AYAA 4EWDA 1HV0A 1OSGA 4IV3C 4LBMA 5LRRA 4ES9A 2RDSA 2KD7A 3AP5A 3K51A 3PVNA 5FPVA 2RE9A 3MGUA 1GLHA 1TMF2 4IQPA 3HJRA 5F5AA 3ZFGC 4ATFA 4RYDA 1UZZA 4CEYB 3WW3A 1ALYA 4XHXA 4BISA 4UW3A 1VMHA 1Y3TA 1ULPA 2BVBA 3I2OA 1J3QA 2RDNA 1WCSA 1J3RA 2JWPA 3EQEA 4AWDA 2A75A 1Y7BA 2EXJA 1UNBA 1KFUL 1GQGA 1W6PA 3LFIA 4UBHA 4Y22B 3N35A 4HVRA 5HCFA 4Q27A 2UWBA 2VJXA 2WS91 4AHWA 4YWAA 2Z2SB 4JGZC 1S2BA 1RUI2 2OX0A 3H7JA 4HSLA 1VBE3 4NROA 1GP4A 1CAWA 2OPWA 1CVNA 1UU5A 2P4EA 2RDRA 3ON7A 3NKTA 4LOSA 4FPLA 2WAOA 4ZXKA 4EQVA 2PHLA 2WINB 3VDBA 3PJYA 1SLAA 2Y6JA 4CCLA 4DXRA 5KHGA 4XQWA 4Q26A 1MPXA 2VCMA 5FMCA 3J7LA 2PMWB 1V6LA 3BU7A 4XIOA 3I2FA
chains in the Genus database with same CATH topology
1NA1C 4EN6B 4ASMB 1H2MA 3ASIA 2D40A 4LO8A 1VLNA 2DUQA 5JSOA 4ATEA 3LA2A 4AEDB 1LHOA 5A3MA 4XJWA 1RITA 1QXPA 1OLQA 3KGZA 1MS9A 1PO23 1FV3A 1VBA1 4GB31 1PO12 2LTNA 2WQ4A 3AMQA 2AUYA 1NE4A 1RUC2 2TUNA 2YGLA 2F4PA 2ZJCA 1ZZ9A 1AL22 2UYBA 1BVVA 2XVLA 4MSVA 1ULFA 4RD7A 4KG8A 4BWOA 4D69A 4DRRA 3HWJA 3AP4A 3R05A 4XBLA 4C90A 1MEC1 5JI9A 4HK9A 1OFSA 4Q8KA 2D43A 4IEYA 4Y1XA 4JRAA 4L97A 1VBD3 4DS0A 4BM8A 4FOQA 2E7TA 1YUDA 3IT8A 1B09A 5DUVA 1VBC2 2ZBJA 4Q4Y3 3E6CC 3HR9A 2EXHA 3RMYA 1V70A 1PIV2 1V9U2 4NOTA 5F6KA 4B7EA 4CEYA 2GMMA 1J1TA 4QX5A 1N3QA 2CWMA 3I59B 3V0AA 1HV1A 1HRV2 2AREA 1BXHA 3RI9A 1DQ4A 1UZYA 3L2HA 1N1SA 4FT8A 2PHXA 4WVWA 3ZIXA 4Y22A 2ZMLA 1WD4A 2VNRA 4LLFA 4AEJA 4OHVA 3JCIA 3MFCA 3MW3A 1HKDA 1LOFA 3LAGA 1ASJ3 1AR83 3OYWA 2ZZQA 1O4ZA 2GN7A 3POSA 4L9BA 1AX0A 3DPRA 4G9SB 1ZRCA 2RR12 2VOXA 4LO7A 1QQP3 4LULA 1O3QA 1TMF3 2R49A 4GA9A 2VXRA 4H55A 4H7MA 1ZZBA 2UWAA 5D8AB 3SHRA 5GZGA 1XU1A 2W39A 2XBO2 3O5SA 2Q30A 2ZABA 1RUI1 3KT4A 3ZO0B 2WZR1 4AEDA 3PVEA 5C9AC 2K2SA 4QD2A 1QHDA 1H1AA 1M06G 1RUI3 4ZU4A 4AHZA 2X5IA 4XFIA 1DQ0A 3P3NA 3LWCA 1JH5A 4XBNA 3VKNA 1QGLA 4Q29A 1W6NA 3FE5A 1VJ2A 3WQ0A 3VBUA 4OULA 1QH6A 5DZGA 4QQPA 5F5QA 3H1MA 1MQTC 1XRUA 1PO11 1H1MA 3ZYPA 1DQ1A 2EAKA 1RUC1 2EF6A 4G3YC 1AL21 2GNMA 3HN1A 3CLPA 2ZGQA 1RJ7A 5I93A 1G86A 5C8CC 2O1QA 3ZSMA 4MXWA 1W6MB 2XLFA 4L92A 5F1RA 4Y20B 2RMU3 4QPGA 5I8YA 3VZNA 4B8EA 1S0IA 1AL23 3EHKA 3VBOC 5GZDA 2XH6A 3KLSA 2XJRA 1Q3EA 2OIIA 2DFBA 3NV4A 2GNDA 4LUMA 5BNOA 3PVBB 3AXEA 1HXS1 1VBC1 2AH2A 3G7DA 2D44A 3ZN6A 2WC2A 4AHYA 1HX6A 1PIV1 1V9U1 4OHZA 1GZCA 3VHRA 1HRV1 1VBC3 2VMGA 3HT2A 1CJPA 5J48A 1XYPA 2QNKA 4TLFA 1G9BA 1RB8G 2B7YA 4QQOA 1ULGA 3KT7A 3WCSA 2A7AA 4WVMB 2BFUS 4CDQB 2FQPA 3AKPA 2AZ5A 2JG9A 2AR6A 5HCAA 3WP6A 1R092 3NO8A 4GKXA 2ET7A 2XLGA 1LESA 3HBZA 4KU8A 4K1YA 2GNTA 3RZZA 2RR11 5JCTA 3THPA 5JMCA 3NKGA 4OZXA 4CTEA 4XQDA 1G8WA 5GM0A 3B02A 5JWPA 2XJVA 1I6XA 2G9FA 5FO9B 4B3NA 4FP3A 2RR13 3IIAA 4URTA 1EV12 5T3NA 1NCQA 1YLLA 4K9SA 1NXMA 1FPN2 2B5HA 1PGW2 4COZA 2DCZA 1TE1B 2XBO3 4WM7B 2UY8A 4CP1A 3NV1A 1ONAA 1WA4A 2B9UA 4OHWA 2VW1A 3MI8A 2Z79A 4DY3A 2D6LX 2RM22 3MF9A 1XNCA 1UW8A 5KXBA 3AZWA 3SCFA 4MZUA 3VKLA 1AYN2 4UW5A 4JGYB 4WV8A 5FBZA 2ZGPA 2GMPA 2QJVA 3I7DA 4RFT0 3GBGA 3AP6A 1YWKA 3JUUA 5E16A 1FAYA 1WBLA 4JDMA 4A7KA 5JLVA 4Q0SA 1ZM1A 1SQ4A 3MDPA 2D6MA 4TWTA 3POWA 3X29B 1G9DA 3GZUC 1DQ6A 4UW6A 3UJOA 1MS5A 5A3LA 3VZLA 2MPFA 3M3IA 4KU7A 3RJ2X 3FUOA 2VNGA 3VDDB 3QLQA 5ABJA 5C4WC 4FPJA 1XYOA 2NN8A 1B35B 3GZAA 1KQRA 2HWC1 5FQ0B 5IK7A 3PHMA 2YC0A 4Y24A 5H9SA 4NHKA 5FTTC 3E5XA 3FFZA 5JOYA 3SH4A 3CL1A 2HWF3 1S0BA 2PYTA 1UD1A 1BBT2 1IS4A 2CTVA 2GSYA 4YGDA 1BQPA 2TBVA 1RUNA 5E1RA 5D8AC 2PELA 1I1EA 1NLRA 5DZEA 4AFDA 4H3WA 2D6KA 2TEPA 4GALA 1NY72 5K7PA 1XE8A 3VBFA 1VAKA 4AVSA 3RQ0A 1KJLA 1PMIA 1H4HA 4FSJA 1NXD1 4RS5B 1QDCA 3WQ1A 5L7OB 4Q0PA 4FXGB 3NV2A 4D94A 1KRIA 1R093 3QACA 3D0JA 3OF1A 1UKRA 1VAMA 3QD6A 4MVTA 4N53A 4Z92B 2FZ2A 1VBB1 4MGZE 4PDWB 2A70A 3VGIA 3I8TA 4B29A 4XBQA 1DU3D 3N7KA 3VHOA 1BMV2 1EV11 1F8VA 2CY6A 1LKNA 1UKGA 3VBSB 4FQ4A 4JCKA 1FPN1 1PGW1 1PVXA 4AE2A 2VMIA 3PJQA 4R9CA 4YVWB 1QJY2 2VW0A 2XWJB 1U5IA 2A73B 2N7GA 3DL3A 1D0HA 1FPN3 5FAXA 5K9YA 4C91A 5FDBA 1WW7A 2RM21 3RDIA 1C1FA 1S1AA 5AC92 1QJU2 3B7MA 4H7LA 4A7YA 4AVCA 3ZDSA 3M8LA 4D7SA 1UF2C 1V6JA 1AYN1 1CX4A 3ILNA 1TME2 5FO7B 1QXJA 4S2HA 1IS5A 4FP2A 3V0BB 4Q4V2 4LHKA 2GZWA 2YMZA 1LULA 4DXZA 5E89A 1JHNA 1HQWA 5KHHA 2JXAA 5EYYA 1AYN3 1YRZA 4SLIA 1R1A2 2WNVB 2RS12 4QGLA 3ZFGB 5EZWA 4BIOA 4Z8BA 4KG0A 5FLIA 1OD5A 2PHFA 2WNUA 2QQPA 5H9RA 2BBVA 3J9SA 4Q0VA 5GJ6A 4P9XA 4IEZA 4CDQC 4I2OA 3JB4C 5C33A 2R1DA 1Y43B 2P37A 3MFAA 4FOVA 3USUA 1RUE3 1RUD3 5JZGB 3M3OA 4YYOA 5T5LA 2R30A 3JQXA 4B4PA 4CDXB 1A8MA 1AX2A 1H8TB 4LE4A 1LRHA 2PTMA 2ZTNA 1BBT1 3UL2A 5L7OA 2Q1MA 2PFWA 4BLJA 1AR62 2CV6A 1WMFA 2E53A 2ZPXA 1OQEA 3PMSA 4IL7A 4CDWA 5I8SA 1BBT3 3AP9A 1NY71 1JYIA 4K1ZA 1AR73 3VKFC 4ITCA 2WNEA 1DZQA 4NVPA 4WM7C 1AXZA 3CJIA 3AYCA 2I74A 4F3JA 1URXA 2MNGA 1C8NA 3QH6A 2R043 2DF7A 4XF0A 3OTFA 1MS1A 3NAPB 3LCPA 1H30A 4XDQA 1ZZ7A 4K8FA 4HL0A 2XVKA 2C1FA 4LBLA 4FPGA 4RHV3 4S2GA 3SH3A 4AI2A 4AVAA 5FRAA 4RL7A 5I0RA 1A8DA 1BMV1 2X29A 1WGPA 2ENRA 4XF3A 5AFBA 2E6VA 2WWSA 4JGYC 1PK6C 2PAMA 1NQJA 3OPZA 2FMDA 2Q4SA 2IXJA 3W9AA 3ALQA 2H6BA 4KBBA 2D6NA 4KWLA 4CDUC 1QJY1 1QH7A 1OOPC 1IHMA 1LODA 1EAH3 4IV3A 2X53S 4MXVA 4DFSA 3B9IA 3A4UA 4FPHA 3DV8A 1QJY3 3VDDC 3ZFGA 5AC91 5KXDA 3BTAA 2D5HA 4WM8C 5B2GB 5KWRA 1GBGA 1B35C 1W6QB 1VBE2 4AFCA 1KJRA 3AP7A 1DQ2A 2FHRA 3J26N 4Q4V1 2WZPP 1DBNA 1YJKA 3ETQA 1QJU3 4FO9A 3RRDA 4HVQA 4XJ8A 3S6PA 1TME3 4JGZA 4CDXA 1R1A1 2JEMA 4Q4V3 1LGNA 3E97A 1YYNA 2GC1A 2RS11 3WP5A 2R063 2RJKA 3R4DB 1AF9A 5JOXA 2HKXA 1ZX5A 3AKTA 2BEOA 3V64A 3BALA 1YFYA 4A7ZA 3WDVA 1NA1A 1LOEA 4HKWA 4Q4X3 4YW5A 4COUA 1SMVA 1PO22 4YGEA 4FPYA 2NMNA 3I4IA 5C8WA 1C3HA 2EXKA 1MVQA 3PNAA 4NR1A 4YZ1A 4LE3A 3TYJA 1SFNA 4XFAA 1VB2A 4RS5C 2WKKA 4XOGA 3OBTA 4QGMA 4YG0A 3IM0A 5C9AB 1AR61 3W59A 3PVOA 3C2UA 2KXLA 4LBOA 4PDWC 1REEA 2H0VA 4YW3A 3H50A 3IBMA 3AMMA 1GZWB 4M01A 1AR63 3HMYA 4KWKA 2VQ0A 1JBCA 1VBD2 4HSJA 3ZXEA 1LEDA 1EY2A 3VBSC 2XG3A 3LSDA 3BB6A 4YVWC 1OFNA 2Y0IA 4Q4Y2 3N7MA 1RUF3 3IPVA 1QNYA 1LOBA 5I0UA 4LO4B 1CAUB 1DGRA 1LOGA 2PN5A 1BJQA 2A6ZA 1ZA4A 4K20A 1V6KA 2I45A 2V73A 1SACA 2BNOA 3E6DA 4IEUA 4KNCA 3D6EA 4BYYA 3WDUA 2VECA 3APBA 1MACA 4J6GA 3V56A 5C8CB 1Q56A 1VRH2 5E8AA 3NW4A 4ZKTB 1N1TA 4FAHA 1W6OB 1H2NA 4XIKA 4M3CA 1AR82 4B4QA 3FLRA 4YRDA 3JQWA 4DQAA 1K5MA 1ENXA 1U12A 2XJUA 1Q8PA 1DDLA 2O8QA 1NCRB 4FPOB 1VR3A 1QQP2 2WNVC 2CGNA 4M3CF 4W6YA 1YO8A 2WLQA 5F9TA 4IEPA 1GNHA 1JOJA 1ND3C 1NQDA 3ELNA 2BPA2 2IFWA 2DCKA 3AZVA 2BNMA 4AQ2A 3AYDA 4B4RA 3CO2A 1VBE1 1YIPA 2WJSA 2CAUA 3LOIA 1C57A 4OHXA 5SV8A 1W0PA 2RJLA 3U11A 4RGAA 2PAEA 4XZPA 1FXZA 3WUCA 5JZGC 1BEV2 5CFCB 1H8TC 1TQ5A 3CJXA 3B3QE 4MX3A 4QPYA 3GF6A 2BVVA 1LHNA 5BNPC 4META 2YV8A 3N7JA 4MH0E 1GZWA 1APNA 4YVSB 1C5IA 1JUIA 2IXLA 1EPZA 3A0NA 1VB4A 2V5YA 5IT6A 1PO21 4Y26A 2XGXA 3H3ZA 1WW5A 3H7YA 5FOBB 3U10A 1EPWA 4FQZA 4HPKA 1DF0A 4XPVA 1XQNA 1PGL2 3KCCA 1MQTA 3NAPC 2B46X 2ZAAA 2JG8B 1GYKA 2RMU2 3L9JT 3OD0A 3JBG3 4LHLA 4OHYA 1C5HA 2Z42A 4L11A 1V6OA 2A6YA 1PZ7A 4LO6B 5C8CA 3FUQA 1VBD1 2AGSA 3FC0A 3IDCB 3WG3A 3WW1A 1SLBA 4CP2A 4D7YA 1G7YA 1MVEA 4HETA 3KM5A 4Q4Y1 5KHKA 3VBOA 4AFBA 4GMP3 1X33A 4FOWA 2QUOA 1DZRA 1F9KA 2E51A 3MEPA 4RR3B 3MIBA 1VRH1 4QPIB 3WV6A 2HJIA 2GU9A 2MEV2 2QVSB 1F5FA 1I5ZA 3MIGA 5J36A 2I2SA 3NL1A 4PBPA 4XFGA 1ASJ1 1O4YA 2HYKA 1AR81 5C4WB 1LU2A 2JJ6A 1VRH3 4NHMA 2WA3A 4XMIA 1V00A 2JE7A 3ROUA 1QQP1 2WQZC 5JAXA 2CNAA 2E9QA 3WR0A 2SLIA 1TMF1 4GQ7A 1KFXL 1PM7A 4JDNA 1NOVA 1WMDA 1QOOA 1UN1A 2UURA 2WFF3 3GNEA 4H14A 2KM2A 4P9YA 4OI4A 2OVUA 1VALA 4X6RB 2BTVC 4X8PA 3VKMA 2SBAA 3O14A 2DTYA 2ZHKA 5LRSA 1PVC2 3ZSJA 4AVVA 1BEV1 3ILRA 4JQRA 3IWZA 1RC6A 2QDRA 3AB0A 4YGCA 4C0HA 4F7ZA 1POV3 1U0AA 3HIFA 4YARA 1BEV3 3N4MA 4LNVA 4KQ7A 5KHJA 4YM3A 3VBHB 4I0WB 2JE9A 3M4FA 4BPZA 3FBYA 1CGPA 3URFA 5DDJ2 1MZ5A 5C6CA 1E57A 3RNSA 2R16A 2H0BA 5CNAA 4COYA 1REFA 1MZ6A 2VUAA 2ZGKA 3ES4A 2NYYA 4RQPB 1JTZX 1LHWA 1YFUA 3JD73 1D4M3 4LUKA 1FMD3 3S0MA 2RMU1 2PA7A 3WINE 2XKOA 1D4VB 2VNOA 4R4XA 2AYHA 1DGWA 4BZ4A 1ZZ6A 1X7NA 4DZGA 5IK8A 3I59A 3TN93 3WCRA 3M2MA 1W39A 4NHLA 4FPCA 2IC1A 1G9AA 4P9IA 4GH4B 2A71A 3LZZA 2IWGB 2A3YA 2ZGUA 1X82A 1NCRC 2C5DA 1G9FA 3R4SA 3FFQA 1GNZA 1REDA 2HWF2 2E63A 4XE9A 1NYWA 2XLAA 3RJRA 2GAUA 4YSFA 4Q1RA 2YHJA 5EWSA 2JKBA 1AUYA 4IETA 1LU1A 1QJX3 4QXKA 3ZN4A 1MZEA 3U4XA 1HIXA 3ZSEA 4L8QA 2GH8A 2WSUA 2ZZJA 5DUWA 2IXIA 2R0FA 3DKWA 4FPFA 4GWNA 2ZX3A 2MEV3 4XFCA 5D8AA 5K0UB 1R083 5CFCC 2OPKA 4TYSA 4Y1YA 1LHUA 4PF5A 5E88A 2ZKLA 2ZGTA 2G4IA 3VL9A 1DFQA 1KS5A 1GFF2 5LEJA 1TNRA 5KHIA 4E4ZA 3SNMA 2ERFA 3KB5A 4YVSC 3TB0A 1FATA 2JD4A 4AI3A 1C1LA 4HKLA 1PVC1 3EBRA 5BYNA 4C1XA 1RHI3 3I54A 5BXXA 2XBO1 1RUH3 1MS3A 1AJKA 1H4GA 1YJLA 3GBWA 1J58A 5D1IA 1LGCA 4U36A 1YXWA 1PVC3 2PLV2 4R9DA 2JG8C 2VPVA 4NWWA 4HFSA 3A0KA 4YG3A 5GLWA 2NLRA 2GC0A 2XVGA 5JOZA 2EXIA 4ES8A 4SBVA 4IEWA 4MLOA 1W6MA 2DCJA 4O9EA 4Y20A 5DUUA 4AFAA 1N1YA 1ND2C 1WCKA 3OGGA 4CRQA 4BCUA 4EWEA 1SLCA 2B39A 1RVF2 2GN3A 4HBNA 4KGQA 4CZSA 4EN0A 2QFEA 2MHFA 5DDJ3 1ZBA3 4BHPA 1F5JA 1PK6B 1S0GA 1ZRRA 4CDUB 1XXNA 4ONUA 3ZMOA 3BCWA 3BOPA 1OOPB 3MICA 4FPEA 4RR3C 3USSA 3ZMNA 2VOWA 3E5QA 3FZ3A 4QPIC 2IXCA 3FWEA 1HRI3 4Y5Z0 2DWRA 1RUG2 4QU2A 1WW4A 4AXOA 3PTYA 3AZYA 2LALA 4YW1A 4FTEA 2GDFA 3WZ1A 1RUE2 1RUD2 3HT1A 1YI7A 1S0EA 4WM8B 1WUVA 4MGIE 4WVMA 1SCSA 3VBRC 2HWF1 4YZ2A 4CDQA 1Z7S3 3M7AA 5DUXA 5J98B 5BNNB 2ZS6B 3O7OA 4XFFA 1F2NA 4UBGA 1Q8SA 1GSLA 1AVBA 5FOJB 3B9CA 3TNPB 3CU7A 5DG1A 4OI0A 4BMEA 2R072 3INAA 3KMHA 1YFWA 1RUJ3 1AR72 3WXPA 3WHUA 2GH2A 4XHBA 1OMIA 2ZX2A 1LJ7A 2ZHMA 5AVPA 3RWNA 3CF6E 4QQ2A 2HWB3 2R042 3AZZA 4E9KA 1R091 2IXHA 1CPNA 2QKDA 4PLNA 5FMOS 4WM7A 1WLWA 4U2AA 3VBHC 4RHV2 4OI2A 2PQQA 4GIQA 1NG0A 4PIXA 4BMBA 1H0BA 1QOSA 5DXDA 4NPRA 3WUDA 5HXVA 3WD5A 3R4UA 2YDEA 4KL1A 2YYOA 1FT9A 3ZN5A 3S7IA 1FYUA 2A6VA 3KCXA 4RQPC 1EAH2 1PK6A 2PLV1 4JGYA 4N9HA 1FOD3 4R52A 4I30A 1ZVFA 3ZFFB 3FJSA 1CAVB 2XJSA 3WG2A 1OOPA 2B8MA 2PLV3 1R1ZA 5FPXA 1DZTA 3VDDA 4BLIA 1IKPA 1RVF1 4FPKA 1OKQA 1KITA 2PHWA 4GH4C 5I0SA 4Z82A 3DGTA 1B35A 4XFHA 1CIWA 5FQ0A 1Z78A 1S2KA 2OZJA 1RVF3 5CAZA 2BGCA 2ZKNA 3ILFA 2R062 3OCPA 1SLIA 1UL9A 3OD4A 4JRLA 4FVVA 1RUG1 4TZDA 2VOVA 1PZ8A 2IZWA 2WT1A 4Q4X2 4EN8B 3AFGA 1ND3B 1RUE1 3LSEA 3C3VA 1GANA 1RUD1 2PHDA 4LA3A 5EFUA 3RYRA 5K0UC 2NZ9A 1RUG3 3UK9A 4XW3A 4M0NA 1ULCA 3B5LB 2OYZA 1WLDA 3WLUA 3AYEA 2FBEA 3WDXA 1ENQA 1V6MA 1OA4A 2EALA 4NO4A 4RS5A 2HWD2 1CAXB 4DOUA 2C9AA 5T5OA 1BK1A 2VH9A 1AR71 3J4UH 4Z2WA 4K6BA 4P9WA 1CONA 5BNPB 5L73A 3AJZA 5A33B 1CR7A 3MLLA 4PDWA 4COWA 3ZVXA 4E2SA 5LK7B 4Q0UA 2R073 1JUHA 4CEWC 1RUF2 4C0BA 3WX5A 1DIWA 3NVCA 4I3GA 2R041 1RUOA 1ZNPA 3VBSA 3WDWA 4DRVA 4LHNA 2I07B 2NQYA 2QZ3A 2AENA 3ZYIB 4YVWA 4RHV1 2UWCA 5FREA 4EN7B 3N36A 1OQDA 3KGLA 4OLLA 4PLMA 2ZX1A 3J8F3 2VVDA 4E27A 3O0WA 1HLCA 2GMEA 3WG1A 2RS53 1DGLA 3VBFC 3VZKA 5KXCA 2HEWF 4XJUA 2ES3A 3WHTA 3ZYJB 3MLJA 1EAH1 3MIFA 3ZXDA 1MS4A 1YFXA 3V0BA 4XF9A 5CBLA 4P5HA 4YFZA 1YNAA 1CN1A 3OY8B 1RMU2 5I0TA 3IMNA 4DINB 3GHMA 4N43C 3VZOA