3D0JA

Crystal structure of conserved protein of unknown function ca_c3497 from clostridium acetobutylicum atcc 824
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
AMKPDIYENNREGILCVYKNEKWLVCIKNWKPDNDIEGIAHLEIHHSTDEQFILSAGKAILITAEKENDKFNIELTLMEKGKVYNVPAECWFYSITQKDTKMMYVQDSNCSMDNSDFCDLSKEEIEYIQTNARKLFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein CA_C3497
publication title Crystal Structure of Conserved Protein of Unknown Function CA_C3497 from Clostridium acetobutylicum ATCC 824.
rcsb
source organism Clostridium acetobutylicum atcc 824
molecule tags Structural genomics, unknown function
total genus 35
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2008-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3d0jA00
2OYZA 4IETA 3MZHA 2H0VA 1VJ2A 4WBBA 3KGLA 5EZWA 2C0ZA 4QGNA 1EY2A 4PJYA 3ROUA 1FXZA 2VECA 1RL3A 2OZJA 2XLAA 4HMZA 4HVRA 5EFUA 1XE8A 2Z2SB 4QX5A 4XFBA 3IDBB 2XLGA 2GU9A 5BXXA 2GC2A 2PYTA 3E6BA 3DN7A 5BV6A 3CO2A 4IEWA 4MZUA 3S0MA 3D82A 1YFXA 2MNGA 1FI2A 3WW1A 3BPZA 3WW4A 4FBFA 5LRRA 4MV2A 3SCFA 2OZ6A 3GYDA 1YWKA 3PLQA 5LRSA 5FPXA 3QACA 4IEVA 1CGPA 5FPZA 3DV8A 4JTOA 4Q29A 3KCCA 4EWEA 4R8HA 3SHRA 3UKVA 4E2QA 4QMAA 1WLTA 1EYBA 4HN0A 4N9HA 3E6CC 2Q4SA 4IERA 2ATFA 2PFWA 4EROA 4XFIA 4BH9A 4EWDA 5FDBA 5FQ0B 5KHJA 1YUDA 3NVCA 3OTFA 4YSFA 2MPFA 4XF9A 3RYRA 1NXMA 4PIXA 1QWRA 1ZNPA 5I0TA 1JUHA 5JR7B 1X82A 3L2HA 4LEJA 3LZZA 1J58A 3H8UA 1X8MA 2H6BA 3FHIB 1UW8A 5LEJA 2ET1A 5FQ0A 4Q0SA 5JSPA 1ZZCA 2H6CA 3KMHA 4KU7A 2IXIA 5KHKA 1J3RA 4I02A 3RZZA 1ZZ6A 2IXJA 4I09A 1EPZA 4EWAA 5KHIA 1TQ5A 4Q0UA 4YRDA 4I2OA 3E97A 2O8QA 1O5LA 4LULA 4R52A 2B5HA 4DINB 3LAGA 5FLJA 3OD0A 3RYKA 4AVAA 4FAGA 4KWLA 5KHHA 5T3NA 5LEKA 1J3PA 2CAVA 1O3SA 4META 4XF0A 3MYXA 2GC3A 3I7DA 1WA4A 4BYYA 3LA7A 4HBNA 2XL9A 3BU7A 3O14A 1CAWB 4UBHA 4JV4A 3CL1A 3ETQA 3RDIA 1Y3TA 3PVBB 2HJIA 4J1WA 4AXOA 1EP0A 1ZX5A 4HVOA 1ZZBA 2B8MA 4Q0PA 5E16A 1X7NA 3FZ3A 3NJZA 3OCPA 3CF6E 5FCCA 4QGLA 3S7IA 4Q0VA 1DGRA 1CAUA 2Q30A 4AQ6A 4XFGA 3FX3A 3R6SA 4D7TA 1G6NA 5J7MA 4ORFA 4LUMA 1ZRCA 1O5UA 4AVBA 1VR3A 2EVXA 2BNOA 1XRUA 4K8FA 4YNIA 1J1LA 1CAWA 1CX4A 1NYWA 3E5UA 1SQ4A 1X8EA 3RNSA 3E5QA 2E9QA 4QGMA 4KU8A 4UXAA 4HVQA 1LR5A 2HKXA 3B02A 4JTNA 2ETEA 3ELNA 3CLPA 4ONUA 2VPVA 1ZZ7A 3D0JA 3NW4A 4A2UA 2XHKA 5BPXA 1HW5A 2GC0A 2XL7A 3FWEA 4L2NA 1NE6A 5JSOA 1ZRFA 3IDCB 3KGZA 1I5ZA 2UYAA 4B29A 3WW3A 3BALA 3LA2A 3DL3A 3HT2A 1UCXA 2P17A 4XF3A 5F1RA 2EA7A 1J3QA 2ET7A 1L3JA 4NVPA 3IWZA 3G7DA 3H3UA 4AQ2A 1SFNA 1H1IA 4X6RB 4IEZA 1I6XA 1QXRA 2KXLA 2QNKA 4XETA 1SEFA 3OF1A 2IXLA 5D1IA 1PM7A 3EBRA 5I8TA 3VHRA 5C6CA 3OGJA 4CYDA 3BCWA 2XKOA 4Q0QA 1UIKA 1LKNA 3NSTA 4O9EA 2OA2A 1UD1A 3HT1A 1QXJA 5I8YA 2K0GA 2Q0AA 3ST7A 4LA2A 2D5FA 3ES1A 1IPJA 2PHLA 3EHKA 3U10A 2WC2A 4IESA 4P9GA 1DZTA 2PTMA 4O9GA 5JAXA 1IPKA 1CAUB 1FT9A 3NKTA 2Q1ZB 1O4TA 3H3ZA 3SCGA 1O3RA 4HLTA 4OLLA 3SXWA 3FFQA 5FLHA 3IIAA 3E6DA 4IEOA 4LTAA 4F7ZA 5J3UA 5I0UA 1CAXA 3USSA 1NE4A 1UIJA 3RYPA 3M70A 3DKWA 2K9ZA 1H1MA 2WFPA 3H50A 2GH2A 4WZCA 3S7EA 3BB6A 5KBFA 2CGPA 1ZZ9A 4QM9A 4E2SA 4IEPA 4HN1A 2V09A 3EO6A 4Z07A 3D0SA 2IC1A 1RGSA 4N9IA 4XFAA 5J48A 4ZU5A 1YLLA 5I93A 2UY9A 3UKTA 2ZCWA 4XF1A 5KHGA 4L11A 4FAHA 2EAAA 2O1QA 3FE5A 1OFNA 2GAUA 3M3IA 2PAKA 3C3VA 4BHPA 2F4PA 2MHFA 3H7JA 2OPKA 2BYVE 4I0BA 4XFHA 1OMIA 4YYOA 4LA3A 2D93A 3MDPA 1OI6A 3UKNA 2QDRA 2XKPA 2IXHA 4H7LA 2QVSB 2BNMA 2PAMA 3FJSA 4J1XA 4IEYA 1YHFA 4F8AA 1O7FA 3U0ZA 4WVZA 4ZU7A 2FQPA 4XFFA 1RC6A 2BNNA 2VQAA 3ES4A 5AVPA 3IBMA 3HQXA 1U12A 4XFCA 1RUNA 4D7SA 1XE7A 1GQHA 3ZDSA 1ZRDA 1YFUA 4HSJA 1LRHA 4FT8A 1OD5A 4MGZE 1LB2A 2BEOA 1Y9QA 1O3QA 4MUVA 4HZFA 4JVAA 3EQEA 2XGXA 3LWCA 1RTVA 5HI0A 1O3TA 4IEXA 3MPBA 4ZU4A 3H9AA 1ZRRA 1UPIA 4I0AA 3CJXA 1VP6A 2PA7A 1CAVB 4PIZA 2DCTA 3I54A 4MH0E 4BIFA 4YARA 3N4MA 4OFGA 1DZRA 3GBFA 5CU1A 3TNQA 2N7GA 2IXKA 2Y0OA 5FLIA 1NZCA 3JZVA 4TLFA 3RPQA 3H7YA 1YFYA 3EJKA 1V70A 4QXKA 4QM8A 2QCSB 2IXCA 3NL1A 3ACLA 1ZVFA 2ZKLA 1CAXB 2D5HA 3PNAA 1WGPA 1Q3EA 5BUVA 4PIYA 2BGCA 5K8SA 3I59B 2XLFA 4AVCA 1CAVA 5BY5A 1ZZ8A 4Z82A 4I3PA 4MGIE 3LA3A 2PQQA 5JCTA 2QJVA 5I91A 3KSCA 1RUOA 4MGKE 5CADA 1YFWA 4XF4A 5CVRA 4LLOA 3SCHA 2UYBA 4GULA 2CV6A 2GZWA 2I45A 5I8SA 3E5XA 4XEZA 1ZREA 4HSLA 2PHDA 1Q5OA 3U11A 4KWKA 3SMHA 3WW2A 4MX3A 1GQGA 4UBGA 3LOIA 4I01A 1PMIA 2CAUA 4E2GA 4LUKA 3TNPB 4IEQA 1DGWA 3QOPA 4KWJA 3HIFA 1QY4A 3I59A 4KL1A 1Q43A 4RD7A 4IEUA 2D40A 4EV0A 3CEWA 4X6QB 5I0SA 2PAEA 5JSRA 1J59A 3H1WA 4MGYE 3H1YA 2FMYA 5C8WA 5I0RA 2Z69A 2GC1A 3H1MA 2UY8A 5E1RA 2B9UA
chains in the Genus database with same CATH superfamily
1SACA 2VVEA 4IETA 3MZHA 2H0VA 5FZ9A 5GZCA 5IVFA 3V0BA 4KGQA 2VMIA 1JOBA 4E8DA 3POWA 2Q8CA 1M4WA 3KF3A 4FFFA 4UW5A 3IDAA 2ZHKA 1PZ7A 1HRI1 1RL3A 1W0PA 3AFGA 3AZWA 2FZ2A 4XJ9A 1LOEA 4XC9A 5A3PA 1OHFA 5EFUA 2WN2A 3AYAA 3S30A 3PMSA 5J98B 3C2UA 2GC2A 4C8DA 3E6BA 2B39A 5BV6A 1KFXL 3B9CA 3CO2A 4IEWA 2OX0A 2DUQA 1NXD1 1KRIA 5ACA3 3OD4A 1RUH2 2XONA 4JRLA 3BPZA 2HYXA 4MV2A 3T0BA 3ACFA 3SCFA 4BQ5A 1Y4WA 3W5MA 1R1A1 2XJRA 1COV2 2HWD2 4YVWB 3ZKUA 2RDRA 4C91A 5FWJA 5FPXA 3WLUA 5JUVA 3ZXAC 1AJOA 2WLQA 3DV8A 4JTOA 1KJLA 3CHXA 4Q29A 3KCCA 2VM9A 2HWB3 2AENA 2ZGTA 3TYJA 2VZOA 4YW5A 1S1AA 4QMAA 1PGL1 2NPIA 1EYBA 4HN0A 2X8KA 2Q4SA 4EROA 2PFWA 5LY1A 4LK7A 3PUAA 4V2VA 1YUDA 2QDNA 1TNFA 2Q8OA 1O8PA 3N9MA 2MPFA 4W50A 4FPLA 4XF9A 1VRBA 1OUSA 5GZDA 4KMQA 1B09A 1QWRA 4YGEA 4BQ3A 1JUHA 1HIXA 4LBMA 4AFCA 1VAMA 4YVWA 5FYIA 5LA1A 3T1LA 1H4HA 3AZVA 1JYWA 1T6GC 4LEJA 4LO5B 1AL22 4AR2A 4C1XA 2ZAHA 2W5FA 5CNAA 3ZIXA 2E53A 3FLPA 3VBFC 4CCCA 4DEQA 4LMFA 4JCKA 4A3ZA 2DBNA 1D4M3 3W5NA 3H8UA 2FDFA 1GP5A 4D94A 2H6BA 2LM3A 4CEWB 1E5RA 3WNNA 4DB5A 1SLBA 3DPRC 4FOWA 3ZFFC 4EN8B 1ZRDA 3NKGA 3J26N 1DQ1A 2QBXA 2RS32 3T0DA 3J8F1 4CDXB 2IUWA 4PBPA 4AVTA 4AVVA 2D6KA 3UJOA 4JHZA 4DIQA 4CP1A 4I02A 2JG8C 3RZZA 4RGGA 2P2KA 2YFUA 1BCXA 1BYHA 2G4IA 2RS51 1JZ3A 2C9AA 1PZ9A 4I09A 1QJY3 3B9IA 5KHIA 4Q0UA 2EXIA 4Q8LA 4ITCA 5IVYA 3WP6A 5GM0A 3POJA 1IQAA 2O8QA 4LULA 3ILFA 2B5HA 4R52A 4BOWA 4DINB 4ATFA 1OA4A 1R092 2VMFA 1A8MA 1OKOA 4D3WA 4LBQD 5DDJ2 3RYKA 4OZOA 2EXKA 4LE3A 1C28A 4KWLA 5T3NA 3DEMA 5FBJA 2CAVA 3M3OA 4M01A 2J22A 2E7QA 4F83A 1GZ9A 4META 4CDQA 1Y7BA 1VBB3 4CDXA 2GSYA 3MYXA 2ARAA 2ZA9A 2QZ3A 4XUOA 1C1LA 1PIV1 1WA4A 2HWE3 1TMF1 3MIDA 1FNZA 2PN5A 3LA7A 3ZXEA 3OEAA 3HPNA 4LE4A 5IVJA 2D3SA 1CAWB 3RS6A 2VTXA 5A1LA 1RUI3 4JV4A 2VNGA 3ETQA 2VCAA 3IPVB 1N1SA 3TBDA 1LAJA 3PVBB 1BBT1 1GV9A 4J1WA 4MLOA 1DLCA 4AXOA 1EP0A 5JZGB 5DUVA 4HVOA 4CP9B 3T4HB 5E16A 3A23A 5IYYA 2YC0A 5FZ0A 5CKNA 1NG0A 1SFPA 3FZ3A 3NJZA 1R082 5FCCA 5BNOB 4GH4A 4QGLA 4Q0VA 2VXRA 1DGRA 2Q30A 2VY0A 2Y38A 4LO6B 2FBEA 4AQ6A 4XBQA 1IG3A 4NUBA 4ATEA 1OPMA 4FXGB 2ZEYA 1UOJA 5IUQA 1ULGA 5A7PA 3LEGA 4C90A 5ACA1 1GZWB 5IHRA 1ZBA2 4Q4W3 3VUOA 3LQCA 2VUDA 2P3JA 2VOKA 2WINB 5HCAA 1HXS2 4MXWA 1J1LA 2BU9A 2XH6A 2PLV2 1CAWA 1NYWA 4QKBA 1ZA7A 1N3QA 1X8EA 3PJYA 3U1XA 3HN3A 2AR6A 2V5YA 3IM0A 2Y26A 1JHNA 3PUSA 4C0BA 5JZGA 3J4UH 4AK3A 2HWB1 2C24A 2E9QA 4KU8A 4UXAA 3VZKA 5BNOA 1ODNA 1TME3 2P3IA 3KHCA 2XB6C 1V6IA 2V4VA 2W1QA 3H0OA 4Y4YA 3KM5A 5EQUA 3KT1A 2ZGLA 2IWGB 2ZGNA 3NW4A 5DXDA 1VBC2 1WW7A 4CEYA 1UKGA 1CPMA 5FPBA 4A2UA 1GZWA 1IZ3A 2XHKA 4WVVA 4FFGA 5CAZA 1HW5A 3LE0A 2E63A 5A7WB 2V4AA 2Y64A 1NE6A 3O7OA 5CIRA 3HWJA 5JSOA 1ZRFA 1ZYBA 3KGZA 1OLMA 1FATA 1W6OA 3BALA 3J7NA 4LHLA 1JHJA 3LA2A 3RG0A 1SLAA 1RUJ3 5FZDA 5A3NA 5F1RA 2XJTA 3K3OA 2F6BA 3T2TA 4YGBA 5ERLA 1Q8QA 2VO5A 3ZKYA 1MS1A 2HLEA 3POEA 1D4M1 2BJSA 5FXWA 4HOOA 2RM22 3K51A 2VUCA 2FDIA 1FOD2 1AVBA 2VU9A 2CY6A 3LFIA 3PU8A 1L7RA 4GKXA 5FYUA 2KXLA 4N43A 3OUIA 5CADA 3OF1A 5D1IA 5T52A 3N9LA 5A3TA 1QEXA 3EBRA 1KDMA 3WNKA 2GH8A 3I2JA 3K77A 5A7WA 3TN92 2VVFA 4ASKA 2WSVA 3SNMA 2ZS6B 4ZKTB 1QF3A 2ZMNA 4CYDA 4H7MA 1FV2A 4BQXA 5DZEA 1PO22 2X5IB 5F3IA 5LATA 3W20A 2QQPA 4TLGA 5T55A 2WKKA 1QJU2 5F6KA 2XKOA 5C71A 1S0DA 3MV11 4Q0QA 4IV3B 2DFBA 2VW0A 3MLLA 3WDXA 3VHOA 5FIXA 3ZYFA 2JDHA 2XDVA 5JOZA 1RIRA 1NUKA 5JOWA 2RR12 4P9LA 3KV6A 1UYZA 4X8NA 1OURA 2QQKA 2ZZJA 2OPWA 5ANNA 2JE9A 4E27A 1RMU2 1YNAA 5DAPA 4Q4V2 3USUB 4DXTA 5ISLA 3RZGA 3LDRA 1DZTA 2A6WA 3WCRA 3I3QA 4RYDA 3GCXA 1WMXA 2HWE1 3NKTA 3CJIB 1S0FA 5C3PA 2A3WA 1ZBE3 4A42A 3VBOB 2QKDA 2W68A 1C3HA 4CPBA 2X5IA 4LO8A 1O3RA 4OLLA 1UPSA 4C0HA 3LSDA 4ASLA 3U4SA 1AR63 4LKFA 3WF2A 4AEDB 1S2KA 2WNVB 2YU2A 4IV3A 3FFQA 3H1MA 4FPEA 1LGNA 3IIAA 2P6CA 4CU9A 3E6DA 4P00B 4XVHA 1A34A 3GBGA 4IEOA 1J83A 5DUXA 3BI3A 3DGTA 4LTAA 4F7ZA 2UWCA 4MGSA 5I0UA 1CAXA 3RWNA 3USSA 3H8XA 1N47A 1F9KA 2WSUA 1YQ2A 3INAA 2W39A 3R4DB 5K9YA 1K12A 4HKWA 3MLJA 4LOTA 5L7OC 1Y9GA 1QHDA 4FP2A 3S7EA 3MICA 5FK8A 5KBFA 2A7AA 2RJKA 1GWLA 4YW3A 3WUCA 5FXXA 4IEPA 5M0TA 4HN1A 3CJIA 1LHUA 4KBZA 3A0NA 1JZ6A 1TVGA 3ZFEB 2G9GA 1GANA 1LEMA 2IC1A 1XB9A 3D0SA 1QJX1 4COUA 1MZ6A 2A1XA 5FAXA 2XJSA 2XVLA 4ZU5A 2WNOA 2WNVA 1AHSA 4A41A 3LSEA 4AOCA 4LT5A 2QQNA 2ZGSA 5FBZA 2D6NA 2EAAA 3I8TA 1REFA 5T5PA 4QDRA 5LBFA 3GNEA 4M00A 2G9ZA 4Q4W2 1TME1 1NY72 1KEXA 3VZNA 3M3IA 3ZM8A 3GJBA 1D2QA 3UV9A 4BHPA 1NQDA 1Q8VA 2WNUA 3B7MA 1JZ5A 2F4PA 4COYA 3S57A 1W99A 1LOCA 2IVJA 3H7JA 1AR72 3UYJA 2BYVE 2J1TA 2VOXA 4I0BA 5CZKA 3AL6A 4YYOA 4W4ZA 4LA3A 3MIBA 5HCHA 2AEYA 4XCBA 2VMEA 2XKPA 2IXHA 4LHKA 4IE4A 3O1SA 5C3OA 3CZUA 4B4PA 4NPRA 3ZFEA 3PMEA 3NNGA 2BNMA 1C8M3 1RUE2 1V9U3 4J1XA 3P3PA 1H2NA 1PK6C 4FFIA 5D8AB 1O7FA 1RUJ1 3U0ZA 5FKBA 3KWVA 1G86A 1A3KA 1W2NA 4KGGA 4AZZA 4OZXA 2XPJA 3SLIA 1JW6A 3ES4A 1GZTA 3IBMA 3HQXA 1U12A 2MEV3 1RUNA 3NAPA 4CCKA 1XE7A 4YWAA 4EYUA 3HJRA 5BNNB 5FO8B 2VG9A 2BRTA 3HOBA 5FREA 4AEKA 1LRHA 2X10A 1PHMA 4LOSA 4DMIA 2NMOA 5HBAA 1OD5A 2ZMKA 3VBSC 5CKQA 2BVBA 3UK9A 1UY0A 3WNMA 4DFSA 4FPGA 2BEOA 2JG9B 1Y9QA 3POYA 2QQIA 3N7JA 1O3QA 1G9FA 2YPDA 4QQ2A 2WAOA 3O1PA 3RZLA 2FD8A 1MPXA 3EQEA 4XUNA 4HG6B 4BWOA 3VV1A 1LECA 5HI0A 3BIEA 1POV0 1AL0G 1HB1A 3JU9A 3MPBA 4INDA 4JKMA 1L7LA 1NLQA 2R16A 1AUYA 1XNDA 4I0AA 4NHXA 1QKQA 3VL9A 4PIZA 4BQ2A 4YVSB 5TSWA 1GFF2 1SCSA 1H2KA 1G9BA 4YARA 5BNQA 5JPNB 1RUD3 1DZRA 1WW6A 5CU1A 4QDSA 4LJHA 4BQYA 2EXJA 4LIUA 2OKXA 1H0BA 5EXOA 3BTYA 5FLIA 5BNNA 2DVAA 5IATA 2ADDA 4XXPA 3T4VA 3H7YA 3FLTA 2RDNA 3VBRC 5LK7B 1V70A 5A80A 3VHNA 1VMJA 1AXKA 2IVIB 3A0KA 1OLME 2JG9A 2R32A 3MF6A 3NL1A 1QDOA 4UYBA 5A7SA 4BMEA 1DDLA 1NLRA 4FPHA 2W0XA 1ZBE1 5G05L 3VDDB 1ZA4A 1Q3EA 2JDNA 5BUVA 2AEZA 4B8EA 1RHI2 1SBEA 2JDUA 2XLFA 3MLKA 2BBVA 2D6PA 3ZLIA 1AR61 4YVSA 5F39A 5FYZA 1JOJA 5IVVA 3AP5A 1UYXA 1UO9A 3WDUA 2YHJA 1UQXA 2P3KA 4LBNA 5IAVA 2ZHLA 2O8OA 1YFWA 4DS0A 2VE1A 1ENXA 3M7AA 4XF4A 5FYTA 1GQPA 1NCQC 4B3NA 4R9AA 4AG4A 5FPUA 5FMOL 2I45A 5ABJB 2UURA 4NAOA 2Y8KA 1MACA 4XEZA 1ZREA 1HJFA 3RVHA 4DZGA 3E1F1 1Q5OA 1DQ5A 2BGPA 5CFDC 4KWKA 4XBNA 1SPPB 3ZXFA 4UBGA 2GNDA 1BK0A 1VBA2 4HKOA 1PMIA 2B46X 3SITA 4XYXA 4D0QA 2JX9A 4WM8B 2KR2A 4QX7A 4IDZA 5IW0A 3VDDA 2DCKA 2WS93 1AR92 2YROA 1QY4A 2XBO2 1H8TB 3VD4A 5F5IA 3ZSEA 1H30A 2E31A 4XQDA 3VHPA 3O1UA 2Y6JA 3NNLA 2HH9A 2C1FA 5E6HA 2JDKA 2BVVA 3AMQA 2PAEA 2OW4A 1XE0A 3KT4A 4CCDA 1YQ8A 3GZUC 1S55A 1Z7S2 1X50A 3RJRA 1LOFA 3WF0A 5I0RA 2D3PA 4RR3B 3RMYA 5A70A 5E1RA 4AI3A 1CIWA 2B9UA 4UOJA 1UN1A 4OVEA 1BHGA 2OYZA 3ZN6B 3ILNA 2BP6A 2JB8A 5FR3A 1C1FA 1ODMA 2XJPA 5GLUA 1OKQA 2RJLA 4WM8A 3HNMA 5FUPA 2C0ZA 3JB4C 1EY2A 4TWTA 3NNFA 2VW1A 5C9AB 2FCUA 5IK7A 2PELA 4PLOA 5GZEA 5A6YA 4OULA 3DCQA 4MXVA 2NP0A 1APNA 2PHUA 5FY9A 1AJKA 2XLAA 3N3HA 4HMZA 3R4UA 4HVRA 4S2GA 4B1LA 4QX5A 2D43A 3Q8AA 4M3CF 2MEV1 3BTXA 1K42A 3DN7A 3MUZ1 1FPN3 2VBDA 4AQTA 4PQ9A 1X9TA 2AYHA 4F3JA 2MNGA 4NMIA 3WW1A 2J1UA 3WW4A 1XXNA 5CFCB 3GYDA 3DECA 5KC5A 3VKOA 4LHNA 1UZYA 4CPBD 2JDZA 4IGOA 3N9OA 3ZN6A 1CQ9A 3I4IA 2VR4A 3QACA 4IEVA 2HWC3 3I2FA 4N7IA 4BMBA 4JGYB 4OQ8A 5FPLA 3OGVA 4W6YA 5AC91 4SLIA 4NPMA 2V72A 1O8SA 4R8HA 3SHRA 2ZPXA 3B5LB 2WJSA 2ILMA 5JIAA 2R071 3ACGA 3UKVA 1DGRN 1ULCA 2CU5A 4IW3A 1KFUL 1SLIA 1PO13 1WD4A 4LBJA 3MGUA 4IGQA 5E8AA 4XFIA 4EWDA 5FDBA 2OS2A 5FQ0B 3URFA 2K46A 1RUD1 3JD72 3NVCA 3OTFA 4HK8A 3VKMA 1F4AA 2R062 3BVCA 5FYHA 4E4ZA 4JKLA 4PCRA 4PIXA 1JZ8A 2DCYA 3NO8A 4XTPA 2GP3A 3LOBA 4CVUA 2QQWA 1JZ2A 5CFCA 3BOWA 5IVCA 3U37A 2PHFA 2FDHA 4Z2WA 2EXHA 4CEWC 1NZIA 2VZPA 4R4ZA 5GALA 1BK1A 2ZX4A 1CIYA 1H2LA 5HCBA 3TOJA 1ENQA 3TB0A 1JYCA 5CYYA 2E6VA 2VZVA 1WMEA 1GMMA 1KGYA 3LZZA 3UGHA 3WEZA 1PX3A 1WMDA 3W21A 1GU3A 4CDXC 1X8MA 3PIJA 4CCLA 3OYWB 5JIUA 3ZYHA 2ARBA 2WRAA 4NO4A 2ET1A 5FQ0A 2WA3A 4N8MA 3LDKA 4Q0SA 3WHTA 4D69A 4HANA 5JSPA 2B42B 2P6HA 2AACA 3MO4A 4UFLA 4UFJA 1D7PM 1ZZCA 4NN0A 4UAPA 5FXZA 3GGLA 4KU7A 2XQRA 3ZYIB 4NHYA 1OD3A 2AGSA 2FCVA 3SC7X 3GALA 5KHKA 2LROA 2KD7A 3TEWA 1O6UA 1UU4A 2ZGQA 4AE2A 4W8JA 2WT0A 2XVGA 2BOJA 5H9PA 5IJRA 1W9YA 1QJEA 3PURA 4UW4A 3I3EA 3N35A 1TQ5A 1EAH3 3NJYA 3I2OA 4FI9A 3EMRA 1CX1A 5F3CA 2ZXQA 1W3VA 5A3MA 2ARXA 3OYWA 4LORA 3PVOA 1W2UA 5FLJA 1W28A 4Y24A 4XDQA 1W9WA 4JDOA 1XYNA 4OUEA 1W6NB 5LEKA 4ZXKA 4PDWA 3D8CA 1HJGA 3JBG3 2OXBA 1D4VB 1XNAA 1IS5A 4QB1A 4TXWA 3AP6A 4K3UA 1SBFA 5FV3A 3I7DA 4YGCA 3K75B 4GAZA 4DPNA 5JZGC 1GP4A 3LCPA 1UY3A 4HBNA 2XL9A 4ZY9A 4GZ9A 4DOUA 4Y33A 3AZXA 1QH6A 1GSLA 4Q4Y2 3DXUA 4LKDA 3VZJA 1ND2B 3GCWA 4MGQA 2DVBA 4Q2FA 4TZDA 5FO7B 1HQWA 4CCEA 4JQTA 1ONAA 1UWWA 2BTVC 4K1YA 1RUF2 1UZZA 4XXAA 5AC92 5C3RA 5A32B 3CF6E 4RS5B 1W6NA 5FUNA 3TAYA 1HV0A 1BBT3 1NT0A 4NIGA 2VUJA 2ARCA 4BISA 1UZWA 5FZIA 4A7ZA 5FZ7A 1DLLA 2R042 3R6SA 1FPN1 1G6NA 3KV9A 4AFDA 5KXCA 1ZRCA 3RWKX 1G9DA 4AVBA 1UKRA 1QXPA 2BNOA 5DG1A 5FK7A 1XRUA 4K8FA 4AHWA 2WO7A 4HPKB 5IK5A 1UU5A 4A7YA 1ASJ3 3U75A 3E5UA 3VBUB 1ND2A 2B4KA 2HWC1 1YI7A 2ZACA 4FPKA 4Q1PA 3SH3A 2QQMA 2WO2A 5K0UC 4J6GA 5T54A 2WZPP 1HRI2 1NA1A 1P8JA 3VKFC 1E5IA 1LR5A 2HKXA 2SBAA 5A32A 4O65A 3ELNA 4O7XA 2CNAA 1PO11 2DUOA 1LGBA 4RS5A 2VPVA 1UZVA 5FPVA 4E4HA 5L36A 3TWIA 4FOQA 5CB7A 4D7YA 5DQ0A 5KXDA 4PF5A 5DABA 2LALA 1UXXX 5FZAA 3AXDA 2VTFA 2GC0A 3ZFGC 4XDPA 3WX5A 1R1A2 2VGDA 3AFKA 3MW4A 4ZXEA 4HPKA 3I3DA 3RZMA 2J1EA 1WWYA 2UYAA 5LY2A 1C8NA 3VBUA 1VE0A 1UCXA 2P17A 3HBKA 3HT2A 4XF3A 2ZHMA 2Z5WA 2EA7A 5IWFA 2ET7A 4NRPA 5LCWL 2BFUL 4LO4B 1DGWX 1L3JA 1PGL2 3IWZA 4DXRA 4QDQA 3H3UA 4AQ2A 1XU2A 1H1IA 4CTEA 1WCQA 5GLTA 4IEZA 2EIBA 3ALQA 4BZ4A 1MS8A 1AL21 3O1RA 4PQQA 1O4YA 3OPZA 2G19A 2F4LA 3WDVA 2R1DA 4JDNA 4L92A 4XETA 2WO1A 2IXLA 2QQLA 3MW3A 3ZYBA 2X5IC 1XSRA 3UJQA 4NROA 1DP0A 2LUWA 3DYOA 1QQP3 2DTWA 2ZGKA 2ZEXA 4PLNA 2A3XA 4IV3C 2AH2A 2W92A 2W91A 3C8XA 4RFRB 3EYPA 2GNMA 1FMD3 1MS3A 2GNTA 3TEXA 4DXSA 1S0BA 4CDQB 4AI9A 1EAH1 1QU0A 1DZQA 5I0DA 1EPWA 5IT6A 3MUY1 4G9SB 3V65A 1AR83 1K3IA 5FY7A 4KNCA 1W03A 3JUUA 3I97A 1RUG3 3RI9A 2VH9A 1DQ2A 5C70A 4XJWA 1WD3A 5DG2A 1CWPA 4YPJA 5GLWA 3ZSJA 5FOBB 3JBG1 3VBOC 4BJ0A 2P37A 3IB3A 3J8F2 1IPJA 4GB33 5D2AA 4QKDA 1CJDA 1HQNA 5A33B 2X09A 3U10A 4IESA 1KS4A 4HK9A 4UI9L 4AEDC 4GH4B 4I0WB 5IVEA 2WNVC 4Y1VA 3ZOIA 4XUPA 4H3WA 5A1AA 1V0AA 2RS52 1FT9A 4YZ2A 2VULA 5L9BA 1OLRA 3WQ1A 1J1TA 1K5MB 4K21A 1EUUA 3IT8A 4CU6A 4HLTA 5HV4A 4N53A 5L73A 5HXVA 1HRV3 1DHKB 2YC4A 3SXWA 5EWSA 3MBWA 1SLTA 5FLHA 3DF0A 4MXWB 3NJVA 1S0EA 4A6OA 1F2NA 1Q8OA 5J1XA 3WG3A 2CYFA 1JU3A 3VZMA 1RYYA 5J3UA 4NIHA 5SV5A 4PT6A 3VL8A 1NE4A 4ZZ5A 5FZ1A 3VLBB 2RJ2A 4Q5OA 4XHBA 4FPOB 4NE9A 4E4SA 1VBD3 1LODA 5A33A 3TEYA 2ZGRA 4OI2A 3BB6A 2CGPA 4LKSA 1PIV2 1W8FA 4NHLA 2C5DA 1TMF2 2EIEA 4E2SA 2DBIA 5KXEA 1R081 1WCSA 3EO6A 2J1AA 3AM2A 4Z07A 1G9AA 5FZGA 5C5UA 1K5MA 1AX2A 2WUHA 5FFOC 1ASJ1 3ASIA 3GF6A 2BGOA 4N9IA 3FL7A 4XFAA 4CEYB 5J48A 3AKSA 4ZHNA 1YXWA 1NX9A 1S0IA 5CBLA 2JIGA 2QQOA 4QX3A 1DQ0A 5CA6A 5KHGA 4KQ7A 3WOGA 3KVAA 4QB2A 1QJX3 1W6OB 3FE5A 2GAUA 1KQRA 3ZYGA 1GNHA 2PAKA 3MW2A 2V73A 5HCFA 5GZGA 5JXJA 5B4NA 4QQPA 3OBTA 3VGIA 4Q4X3 5C3SA 2OPKA 1RVF3 5FTTC 5A7QA 5ACA2 2RG4A 5D8AC 1OMIA 2ZX0A 5T5LA 2D93A 3R05A 4TYSA 2OUJA 1UOFA 4XURA 2QDRA 5DUWA 2VZTA 2TEPA 2QVSB 1XOYA 4RHV3 4N43B 5FMOS 2YYOA 1ZRIA 5JOYA 5BNPB 1ULPA 2HWF3 2I2SA 3N9PA 5LBEA 5BNNC 3O1VA 4NRMA 2AREA 2HWB2 2BNNA 2VQAA 4IE5A 2JKBA 5AVAA 3P5BA 1L7QA 1UY2A 4XFCA 2JG9C 1W2OA 1ZM1A 2VMGA 1ULEA 4RFT0 1UMIA 5C3QA 5DMYA 1OXCA 3N9NA 4YW7A 1HQLA 3B69A 2EALA 3BKZA 4DEVA 2PXJA 2QE3A 2DV9A 5FY4A 4BPZA 2BW8A 4XQWA 1LB2A 3THDA 2CDOA 2I74A 3AP7A 1QQP1 3P3NA 4YVSC 4D6SA 3C7EA 2B7YA 4MUVA 2YY1A 4HZFA 4JVAA 3UNPA 3ZR5A 1H9PA 2XGXA 3LWCA 1RTVA 4L0PA 4AEMA 1FMD1 3SKJE 4B1MA 1O3TA 4IEXA 1W0NA 5BNPA 5HPOA 3J7HA 1JZ7A 1UPIA 1REDA 2VUAA 2WFF3 4YW4A 4B7KA 2E26A 2DCTA 3I54A 1T6BX 1QIQA 2XJUA 1D4M2 3HN1A 4CSWA 4BIFA 4FTBA 2Z42A 4OFGA 1AR81 2RS13 3WD5A 1W6QA 3MIHA 2CGNA 5FY8A 3FBMA 2IXKA 3ZX7A 3R4SA 1RUG1 4LLFA 3ZVXA 1V6OA 4XMIA 5DAVA 1UF2C 1PO21 3RPQA 4K20A 4G3YC 3O0WA 4GMP0 4GB31 3VDDC 3ZPOA 2XMLA 1XU1A 4QM8A 2WA4A 3NV4A 4GJYA 1U5ZA 5SV8A 2EAKA 3M8LA 4UW6A 3S5AA 1QOTA 1E57A 3GHMA 4A7KA 1CAXB 2PHTA 1GOHA 1QJY2 4OHXA 1LGCA 4Y20B 1W05A 4GALA 5K8SA 1HRV1 5JOXA 3AMMA 3LGRA 5BY5A 2VNRA 2ZBJA 1ZZ8A 3K48A 5DAWA 3O1MA 4OHVA 4K8RB 3K2OA 5ABJC 2PQQA 1LOFC 3IDEA 2PQSA 1F35A 2YFZA 3PDQA 4LK6A 3KSCA 3DPRB 4FQ4A 1S0JA 1W06A 5H9SA 3WUDA 1GOFA 5CVRA 4LLOA 5FKCA 5B2GB 3LF7A 2IZWA 1TEIA 4WM8C 1QJFA 1W3XA 2UYBA 3BN6A 4UFKA 5IFTA 1MQTC 1DIWA 1VBB2 2VZ3A 2YU1A 3CKHA 4QXBA 1JYTA 3F95A 1VBD1 1H8TC 4GWNA 1A6CA 1US3A 4MO3M 4OMCA 3NRUA 2ZABA 3WW2A 4QXHA 5EIYB 2HWE2 3LOIA 2JIJA 4I01A 4MG2A 4IUGA 1X36A 1Z0HA 2HBUA 2WNUB 4E2GA 4LUKA 2X29A 4IE7A 4UT5A 3TNPB 3OY8A 3UESA 1UZ0A 2VQTA 2Y33A 1OQDA 1RUI2 4PLMA 4Y20A 3PUHA 3HIFA 5APAA 4URAA 4OMDA 4AGVA 3ZYRA 5JLVA 4V2WA 4A44A 1OH4A 2E7TA 1SZBA 5LA9A 4Q1RA 3MFCA 4RR3C 2FDGA 1JS9A 2ZAAA 4EV0A 1YQCA 1WA6X 3DPRA 3ZFFA 1D0GA 3BTAA 1BKZA 5FYYA 3WP5A 4QQLA 1VIWB 1I3HA 4NRQA 5FYCA 1GICA 4QX0A 2H0BA 3GBWA 3A4UA 1VRH3 3AKQA 3H1WA 5T5JA 5JSRA 1V6KA 4ET7A 5C9AC 4Q4X1 4L9BA 1RUC3 2Z69A 1AYN3 4H55A 1RVF1 4LO7A 3CDZB 1H9WA 5FPAA 1KITA 2JWPA 3NAPB 3V64A 4JHTA 4QX1A 5LBBA 5JXHA 5FP3A 3IAQA 2LRPA 4Y5SA 1POV3 2TNFA 1OBNA 5EZWA 3ECQA 4QGNA 4PJYA 2Z79A 4RHV1 1Q8SA 1HB2A 2CSGA 2VTXJ 1BMV1 1LHOA 2HBTA 2VECA 3KS7A 2HWF1 1RINA 1CZSA 4S2DA 4LKEA 3HQUA 3WT3A 4WVWA 1PVC3 1GWKA 2D7FA 3RGBA 1W90A 5CFCC 1SHWB 2NMNA 2Z2SB 3V56A 4HFSA 2JICA 3IDBB 2XLGA 4RN5A 3I3MA 1TME2 2ZEWA 1BEV3 2BPA2 5FZHA 3QH6A 4FPYA 4FPFA 4Z1VA 2OT7A 5JMCA 4RQPC 4MZUA 2Y0IA 5JXIA 4JGYC 2HEWF 3D4KA 2ID4A 1WW4A 1H6XA 1ULDA 2WLPA 1FI2A 5FRAA 4LHSA 3JCIA 3IAPA 4MADA 2CHHA 3EXUA 4L99A 1IOAA 1O59A 1YWKA 4OHZA 5LZ6A 2RV9A 1E5SA 3PLQA 1JODA 4DUXA 1YQ6A 2BBAA 1US2A 3JQXA 3L9JT 1PNGA 2XXZA 4XHXA 4MSVA 2LW8A 4E2QA 1RUJ2 1PX4A 3OG2A 5LW9A 1OH3A 3K4DA 1WLTA 2WFF1 4N9HA 3WG4A 3E6CC 4PHZA 4UWDA 3LPGA 4BH9A 2VCCA 3OB8A 4Y4RA 1JYVA 1EV13 4L8QA 3VB9A 5KHJA 4NHMA 5AC93 1LJ7A 2VQUA 2RS11 2YPJA 3FMGA 3MV01 1Z78A 2R073 5FXVA 5FZ6A 1OOPB 3RYRA 2DF7A 3T2OA 5DUUA 1IKPA 1IS3A 2VW2A 1PMJX 4NIIA 4CUCA 1WBFA 1ZNPA 1G7YA 5I0TA 5JR7B 4AHZA 4B4RA 3ITQA 3ZSLA 4DUVA 3L2HA 5IK8A 4K9SA 3SQOA 1OQ1A 2J1RA 4ARYA 5A6QA 3TRSB 1LNSA 3MEPA 4CDUC 2XQXA 3AKRA 1J58A 2ZX3A 3VD5A 5KC6A 3BU0A 3WF1A 4YLZA 2JE7A 2W1WA 1UW8A 3FHAA 5LEJA 4DO0A 1CPNA 4QPWA 3C7GA 3NV1A 4BK5A 1RB8G 3ZR6A 5F9TA 1HV1A 2XJVA 3PU3A 1CESA 1U5YA 4XUQA 3VBHB 3I2GA 4QXCA 4LR4A 2YG0A 3KMHA 5JVVA 2JE8A 1OOPA 5A7OA 2XVKA 4ZS2A 4OQ9A 3HEIA 3AMHA 1QGLA 1REEA 2CWSA 2QZ2A 3T1MA 1F15A 3AKTA 2E7AA 2QQUA 2IFWA 2ZHNA 1XBFA 1JXNA 1PMHX 2IXJA 4BM8A 2TUNA 2WYFA 1VBE1 2WWUA 4EWAA 1LOBA 1OVPA 3KF5A 4QU2A 4B4QA 2NN8A 4JAAA 4YRDA 1ZBE2 5FUIA 1MEC3 1GLHA 4NWWA 1W8NA 5FZ8A 4I2OA 1O5LA 4BQ1A 1X9PA 4OUSA 3MIGA 2BOIA 3ZO0B 2KM2A 3LAGA 3GJAA 5GKAC 2QFEA 3V0AB 2YC2A 4AF9A 5JMOA 1AR62 4YG3A 5A6ZA 1SLCA 1X33A 1WLCA 5IK4A 1UAIA 2ERFA 4Y22B 1J3PA 4QPGB 2BZDA 1VBA1 3B94A 5G04L 3AXEA 4M3CB 3VBHA 2RMU3 1TNRA 3K46A 1W9SA 2BFUS 5IFPA 3RZHA 4XF0A 1YJKA 1VRH1 1W2AX 4HETA 5L9RA 3A21A 5JR2A 1RXFA 1RUC1 1AYN1 4BYYA 3HR9A 1GZCA 1ULOA 3N7MA 4JKKA 3BU7A 4RS5C 4UBHA 1XNCA 3CL1A 4TSVA 2EIGA 1POV1 1PGW1 1YI9A 2JXAA 3J7MA 2HJIA 3M3QA 2UWBA 1DU3D 2XWJB 2Y6HA 4BXSV 4XAEA 1ZZBA 1GOGA 2B8MA 3JXSA 4Q0PA 2JD9A 1S2EA 4P14A 4YW1A 5FMDA 1C5IA 5GLVA 3VD3A 5J96B 3V0AA 1X7NA 3BUCA 1GNYA 2YGMA 4BQWA 1W6PB 1PVC1 4Y22A 4CXYA 4QPGA 2WZR3 5T50A 3J7LA 1CAUA 2A71A 3I2IA 1K5JA 1LOAA 4M3CA 4XFGA 3FX3A 4AFAA 3EB7A 1NOVA 1BEV1 3KV4A 5ANQA 4NWVA 3SEEA 1ND3B 4XACA 4D7TA 1UYPA 5J7MA 2YDEA 1O5UA 2P3YA 5FZOB 3DYPA 1VR3A 5LA0A 2RDQA 3AP4A 1OLQA 5FYBA 2VOVA 3OBAA 4YNIA 4YVWC 1UX6A 1AXZA 3T08A 5K7PA 3GHNA 2A5ZA 4ASMB 1Y43B 1ENRA 3RNSA 1F5FA 2OQ7A 1C8M2 2RE9A 3AZZA 1V9U2 1C5HA 3HD8B 4LBLA 5F2WA 3E5QA 2A6XA 3KD4A 3S5QA 2G1MA 2Q1MA 3M4FA 4QGMA 4HVQA 1LU1A 1W8OA 2ETEA 3OUHA 1W6PA 3CLPA 4Q27A 1N1YA 1ZZ7A 5F5QA 1EV11 3AVSA 2MEV2 3ZYPA 4JGZB 1RUH3 1ND3A 3K4AA 1JZ4A 3ZIWA 3WG1A 5J36A 1W2TA 5BPXA 4ES8A 4CUGA 1E5HA 1LU2A 1COV3 2HWD3 3B00A 5FZOA 1DGLA 2XL7A 4L2NA 4XDOA 4NIDA 2FDJA 2SLIA 3IDCB 4JZRA 1I5ZA 1MS9A 4B29A 3POIA 3WW3A 4AW7A 1XC6A 2K2SA 2W94A 3DL3A 5C8CB 4BLJA 3ACIA 2R061 1RITA 4P5YA 5EYXA 1J3QA 4WVMA 5BYNA 1UYYA 4CXWA 3THTA 1O91A 3RZJA 1JBCA 5CKMA 3G7DA 2JENA 1S2BA 1B35B 1XSQA 4X6RB 1RUD2 3X29B 5CEHA 2DTYA 2OUHA 1IPSA 1QXRA 4AGGA 1N3OA 4JGZA 4CDWB 2QNKA 1W8UA 4CDQC 1AYM1 3ZXDA 2GDFA 3HVDA 3VBSB 3ZYJB 1PM7A 4Q8KA 2A6YA 2YMZA 5I8TA 4KG0A 1G9CA 4W65A 1AL23 4PDWB 3VHRA 4CU8A 5C6CA 2ADEA 4XJZA 4A4AA 3OGJA 5JI9A 3ACHA 3AL5A 3POGA 1PK6A 3BCWA 5F8PA 2VC9A 3ZMOA 5C8CA 3AYDA 2JDYA 5L19A 1MEC1 1GBGA 4QHZA 3WNPA 4P9XA 4HT1T 4UF0A 1FAYA 4JC1A 2DURA 1LKNA 1OT5A 2W46A 1B35A 2WZEA 1F5JA 5C33A 4NPLA 4QPIB 4AAPA 1QMJA 1OSGA 4GH4C 1GWMA 3ME2A 4NIAA 1BVP1 2RS33 1DYPA 1UD1A 3HT1A 2WT2A 1QXJA 3OGSA 5I8YA 2K0GA 4CDWA 1AX1A 2Q0AA 2WN3A 3ST7A 1K5MC 5F32A 2EIDA 1EUTA 2RMU1 3ES1A 3IZOA 3M2MA 4CP2A 1D2SA 5C4WB 2PHLA 3EHKA 3VBSA 2WC2A 5AFBA 2BDRA 2Y6LA 1OF3A 2ENRA 2PTMA 3PTRB 4O9GA 1CONA 3HBZA 3NMBA 3NQHA 5JAXA 5JWPA 1VPHA 4A6SA 3FC0A 3APBA 3SCGA 5C5TA 3GXUA 4FVVA 4DUWA 1LULA 3I3BA 4M4PA 3NJXA 1R093 4AVSA 4XAAA 5J37A 1IG0A 1YC61 2ORXA 2VAUA 4ZONA 1VB2A 1GYKA 5DDJ3 2VNOA 4FSJA 2WS92 4XBLA 4EN6B 4XW3A 4FPCA 1JTZX 1W9TA 1RJ8A 4QPIA 5BNOC 2A3YA 3L2YA 1ENSA 1OVSA 3O0VA 1PNFA 3OOXA 3GDBA 5LB6A 2WZR1 1C4RA 3KT7A 4MHRA 5LASA 3PTYA 4Z92B 3AMNA 4AWDA 3Q9OA 1DYOA 1UIJA 5C4WA 3RYPA 4YFZA 3AYCA 3DKWA 2YXSA 2K9ZA 1NA1B 3H50A 1DQ6A 4UW3A 5FJHA 1YRZA 2GH2A 2EICA 4CEYC 1A78A 2WR9A 4BCUA 3FUQA 2WNEA 2YV8A 4MYEA 4QM9A 5A7NA 1PZ8A 2HEVF 2X05A 2WBKA 2VZUA 2VJXA 1MVQA 2WYSA 5J09A 3F2ZA 1YQ5A 1RGSA 3OUJA 4XZUG 1U5XA 4D6RA 2W9XA 1YLLA 5I93A 1MR5A 2D98A 2UY9A 1AX0A 1WUVA 1R083 2VD7A 3UKTA 4BXFA 2ZCWA 4XF1A 1OA3A 1BQPA 4YGDA 4FAHA 3T30A 2O1QA 1OFNA 4CUBA 1WMFA 1VAVA 4MHUA 5FY1A 2DDUA 1T2XA 1NCQA 4GKYA 1SFYA 2MHFA 4P08A 1ZBA3 4N43C 1RUH1 2JDMA 1WW5A 3AJZA 4E9KA 5A1FA 4XIKA 1FPN2 1OF4A 5BNPC 4HONA 2C26A 1HXS3 3B01A 2VVDA 4NAMA 3MDPA 4QQOA 5F6LB 5CFDA 1COV1 2HWD1 4QU1A 2PLV3 3M1HA 3N9QA 5F3EA 2E33A 3WINE 2DYCA 2YB7A 5FWEA 1IGOA 4IGPA 3H8RA 2PAMA 3FJSA 3T2PA 1HB4A 2HWC2 4KG8A 3W59A 2AZ5A 4F8AA 1KXGA 3ON7A 5D21A 4AFBA 4BE3A 3DXTA 2YGLA 3FHQA 3ORJA 1K45A 5FO9B 4M3CE 1XQNA 2O0OA 1LHVA 1PO12 4D7SA 3GZAA 4OI1A 1GP6A 2GNBA 4QHBA 1MZ5A 4NJ4A 4Z2AA 1VBC3 1DYKA 2BQPA 4GIQA 4D8MA 4JDMA 4HSJA 4JX0A 3PJQA 4YW6A 4BDVB 3T2QA 4MGZE 4KI5M 2Y6FA 4IV1B 3N7LA 1FYUA 2PHXA 5F7UA 2BUKA 2OQ6A 4N90A 4XIOA 4NHKA 1TG7A 5DAXA 1VLNA 1TE1B 4JQRA 2WQ4A 3LIGA 1N1TA 2ZEZA 3S6PA 3OBRA 4WM7B 4ZU4A 1ZRRA 4A45A 2PA7A 3WG2A 1CAVB 2NYYA 2QQVA 3PUQA 2IFRA 1VMHA 2RM23 3FFZA 4EN9B 3ZSKA 1F31A 1FV3A 1FOD3 3NV3A 2WO3A 2P4EA 4OHWA 3POSA 3TNQA 4FOYA 2N7GA 3KZ4C 3MIFA 3OEBA 2RS31 4N53B 4GJZA 3JZVA 4H14A 3DYMA 5KXBA 1OFSA 2GN3A 2BWAA 1CR7A 1S0CA 2A73B 4P5HA 1YFYA 3EJKA 3IMNA 4N7UA 4QXKA 4BU2A 3TN93 3RJ2X 3KHBA 4ISQA 4CU7A 3M3EA 4IV1A 5C7GA 2Y34A 1QJZA 3ACLA 1ZVFA 4U36A 5FP7A 1H8VA 4CZSA 3CJIC 1PO23 2ZKLA 3NV2A 4LNVA 4XABA 2D5HA 1UMZA 1QJU3 2Q8EA 4EN0A 4FQZA 5T5OA 1NKGA 4RGKA 4WM7A 2WAAA 3MPPG 4PIYA 5LK5A 1EAH2 3FUOA 1R091 3ZMNA 2PHWA 2E32A 1CAVA 2YUEA 5DDJ1 4MGIE 5FZCA 2E51A 4GQ7A 4FTEA 1VB4A 2JECA 2RR13 1IQDC 2QJVA 1RUOA 5F37A 1CZTA 2NQYA 3AZYA 2J1VA 4MGKE 1UX7A 4OUMA 4QX2A 4S2FA 4XTMA 5F5CA 5FYVA 5CISA 1KJRA 3JBG2 1RMU3 3SCHA 2WNUC 3CU7A 4Q4V3 4WZFA 5A3OA 4AI2A 2GZWA 1YJLA 1AXYA 2P1BA 4V1PA 1DFQA 2D6OX 1Q8PA 3HQRA 3RSJA 1H4GA 3PUIA 2PHDA 2VCMA 4OI4A 4KWUA 1A8DA 3SMHA 3I2HA 1GQGA 3VZOA 1LTEA 4CEWA 3OGGA 1HDKA 1CN1A 2CAUA 4K1ZA 1N1VA 4GD4A 4Y5Z0 3ZFEC 4IEQA 4COZA 2JB4A 1XPWA 3N7KA 3QOPA 1GR3A 3ZN4A 1XYPA 3SH5A 1Q43A 4RD7A 4IEUA 3WNXA 4AQSA 2XR4A 4Y5TA 2L9LA 1NLSA 1RJ7A 2D40A 3M3CA 5FZEA 1QNWA 4X6QB 2CGOA 2ZJCA 5I0SA 4FCAA 3WHUA 3NAPC 3WNOA 1SDDB 4OYUA 2XUEA 2DCJA 1BBT2 2DWRA 1J59A 1YEWA 3CBNA 2GALA 1ZBA1 5C8WA 2GC1A 4R9BA 2UY8A 4AL9A 1POQA 1HXS1 1G8WA 5EJ1B 4MGTA 1VJ2A 5IAXA 2PLV1 1NCRB 4CA9A 5FY0A 3KCYA 2O14A 1I9RA 3KGLA 4WBBA 3NNMA 4UFMA 4YZ1A 1ASJ2 5FMBA 3ROUA 1FXZA 1SMVA 4TTGA 2JJ6A 2R7EB 3FN9A 4XPVA 3I49A 1UOGA 1XYOA 2W47A 3QCWA 3U14A 2OZJA 3AVRA 4LITA 5FZ3A 2A75A 3RRDA 1XE8A 5JI7A 4IL7A 4XFBA 4YFWA 1GKBA 2GU9A 2QUOA 5BXXA 2PYTA 1W9FA 1JU4A 2YZ4A 3G6JB 3O1OA 1DQ4A 4GMP3 1AR73 2DVFA 3S0MA 1VBC1 3IPVA 3D82A 1HLCA 3POBA 3WVJA 1YFXA 3WP4A 4FBFA 5LRRA 2RVAA 2C4XA 5FZMA 4CP9A 2OZ6A 3D5OA 1QOOA 1J84A 4UFIA 1W6QB 3CQOA 3UGGA 4AEJA 5LRSA 1V6NA 1NCRA 1RUE3 3U07A 1CGPA 2HEYF 5FPZA 3TEZA 5A3LA 5K0UB 4EWEA 3WQ0A 5DZGA 2BV4A 5JXGA 1LHNA 1OOPC 4FO9A 1KD7A 2OIIA 3OSDA 2XHNA 2WZ8A 3LDBA 2ZGOA 2F17A 1ALYA 2ATFA 4IERA 4CE8A 2RM21 4EZHA 1DBNA 1FOD1 3SISA 5HXMA 5EJ3A 3KVBA 4P9WA 3W9AA 3CNAA 4YSFA 3VD9A 1AF9A 2VOTA 3J9SA 1NXMA 2W1SA 3B93A 2FDKA 1HN1A 5DPNA 3MFAA 4EQVA 3QD6A 3ZFGB 1X82A 3TN91 1KDKA 1QQP2 3QH7A 4HXCA 4XZPA 3OBZA 4IE6A 2Q5TA 4NR1A 4K40A 5K0UA 1M06G 3MI8A 3VZLA 4ZZ8A 1FMD2 1QJU1 5H9QA 4ZPIA 3VBHC 4BQ4A 2HYKA 5EYYA 5FP8A 4E8CA 1UU6A 4GWJA 3WDTA 1HB3A 1UL9A 3FHIB 2WWJA 3LPFA 1W6MB 3Q8EA 4AAXA 4ISRA 1WLDA 2WQZC 3PL0A 1AR82 2ORZA 1U5IA 2RR11 4OI0A 3VBFB 2WT1A 3OY8B 1F4HA 2H6CA 1RUG2 4QB6A 2ZX2A 4FXKB 5FP4A 2IXIA 4O61A 1QJY1 1BZWA 1DG6A 3THCA 1J3RA 1RMU1 4Q4V1 4XILA 4GB32 2J42A 3T3YA 4D6QA 3ZFGA 4B7EA 5JDBA 1ZZ6A 3UL2A 3RI8A 2ZMLA 1SCRA 3ZFFB 4SBVA 4FPJA 4E4DX 3ILRA 4IE0A 2VZQA 4FFHA 3WZ1A 1EPZA 3IKWA 4QAWA 1SLLA 3Q8FA 4QPGC 1RHI3 3LEMA 3PVNA 2VNVA 2Y6KA 3E97A 2Q8DA 2JG8B 3H8OA 2FHRA 3MHZA 3BTZA 4AI8A 1HRV2 1MVEA 1V6LA 1I5PA 4P9IA 1VBB1 3OD0A 4LBOA 1VBE3 1W6MA 5GZFA 1JYXA 1WKYA 4QPYA 5FZBA 1JI6A 4LBKA 4UFHA 2RDSA 4AVAA 4FAGA 3I2KA 5KHHA 3LEIA 2UU8A 1O3SA 1WCUA 3VBFA 4BA6A 2Z4FA 1BLZA 4CCMA 1BVVA 5E89A 1XNTA 3MIEA 4BK4A 2BWCA 1CD3G 2DCZA 2FCTA 1RUI1 4R9DA 2GC3A 3W58A 4IQPA 4Y1ZA 3WQ7A 5CG8A 3KB5A 5FOJB 3UT0A 2VBBA 1IKQA 1VBD2 5KR7A 1VBA3 2EF6A 4Z8BA 2GMPA 1NQJA 4A3XA 4XCAA 1H2MA 5LWBA 3O14A 2XWBB 4RL7A 5H9RA 1AR93 2XBO3 3RDIA 1Y3TA 1VAKA 2J1SA 2JG8A 2LTNA 1MS5A 1PM4A 4BLIA 4EN7B 1ZX5A 4AHXA 1ND3C 4P02B 5DN2A 5DZFA 3C7FA 2XJQA 3USUA 3OCPA 3QBQA 4OHYA 1LCLA 4Q4W1 3S7IA 1NY71 4XMAA 1Z7S3 1QJX2 3ENRA 3OPTA 3BIWE 3VBOA 5EP9A 4YZ5A 1N3PA 4AI1A 3IMMA 4GMP1 1AR71 3OPWA 4TN7A 4Q4X2 4YW2A 4ORFA 4LUMA 1LENA 3O1TA 4AEDA 1MS4A 1RVF2 2EVXA 3AMPA 4ZS3A 4I30A 4QKNA 4YM2A 3JB8A 1CX4A 3WNLA 2GP5A 1RUE1 1SQ4A 4FOVA 2LS6A 2NLRA 4LQRA 4RHV2 5FYSA 1RXGA 3P1IA 5A6XA 1BMV2 5E88A 4JGZC 1S0GA 4CCJA 5B4XA 2Q1FA 2HWF2 2Y60A 3ABZA 3B02A 3UETA 4JTNA 4ONUA 3ZDVA 2ZGPA 1HX6A 2VBPA 3D0JA 4RSUA 2D3RA 4PI0A 4AYUA 4P9YA 4CCOA 2D97A 3WDYA 1FX5A 4COVA 5JCTA 3LFMA 5C8CC 3LB9A 4XQ4A 2VXJA 1LESA 1STMA 2C6SA 1NAEA 4X8PA 3FWEA 4QQHA 3PVEA 3WSOA 4QWNA 2DFCA 3ZSMA 1B35C 2B45X 2VCBA 4IXLA 3PHMA 2YBKA 2DUPA 4CDWC 1IHMA 5A3WA 3FLRA 4NVPA 3AX4A 1W0OA 3AK0A 2WFF2 2VZRA 1SFNA 2A6ZA 3JD73 1XNKA 5A3UA 1JN2P 2X53S 1Q56A 2ZX1A 2R063 4LXLA 3CZJA 1I6XA 4PDWC 2RS12 3BODA 1JYNA 2DVGA 2NM1A 2TBVA 1SEFA 3WR0A 5D8AA 3WDWA 4DRRA 1R64A 4ES9A 1LOGA 2W08A 1MS0A 4GA9A 3WP3A 1DF0A 3Q8BA 4CCNA 5IVBA 3AKPA 4COWA 3VKLA 4QPIC 1UOBA 1AYM3 3HMYA 1ULFA 4QD2A 2VMHA 1LHWA 2OVUA 4EJRA 4L97A 3VDAA 3NNJA 1RHI1 2JEMA 1XNBA 1KS5A 2YBSA 4CP0A 5GLZA 4Q26A 3A22A 4R9CA 4URTA 4Y1XA 4FTSA 1UIKA 1WCDJ 5C4WC 2Y6GA 3NSTA 4W6XA 2W1UA 4O9EA 4QT6A 2OA2A 4HKLA 4G4FA 2ZOEB 1BXHA 2ZTNA 1YIFA 3T09A 4EE2A 4M0HA 1HN0A 2JDPA 4LA2A 2D5FA 2DU0A 3WF3A 2W87A 3R0RA 2VZ1A 5FY5A 2R1BA 3C7OA 1UXZA 3AJYA 3LD8A 1W8HA 4M4RA 2D44A 4P9GA 4DRVA 1AZDA 1W8TA 4MOAA 1JMUB 4KBBA 1DCSA 1IPKA 1CAUB 2Q1ZB 5FZKA 1W04A 1VBE2 1O4TA 3H3ZA 2WDBA 1JH5A 1SBDA 1ND2C 3WXPA 2R30A 3ZPYA 4PBOA 3LIHA 1AR91 3N36A 5EV7A 2XBO1 3ZXKA 3QLQA 2VZSA 2G9FA 1WLWA 4HL0A 1F8VA 3VD7A 3DUIA 5K4LA 4DY5A 3B3QE 1NA1C 2W2IA 4PF1A 2YBPA 1VALA 5AFEA 2W52A 2VMDA 5FZ4A 1JOPA 1PVXA 2PHRA 3KQ4B 5JPMB 3WV6A 1BJQA 3RMXA 1H1AA 1HKDA 1Z7S1 1OC1A 1MZEA 2R49A 3RZKA 3M70A 1MQTB 2BERA 1H1MA 1VRH2 2W3JA 2GN7A 2WFPA 2RHPA 2WWSA 2A70A 4BB3A 4WZCA 3VDBA 4H2AA 4XE9A 1ZZ9A 2I07B 1RUC2 4YZ3A 1AYN2 1YO8A 2JD4A 4Q4Y3 2V09A 4BIOA 3VBUC 4Y1YA 4R4XA 1C57A 5L7OB 1PGW2 1LEDA 1RUF3 2DU1A 4W6WA 5ABJA 4KH9A 4L11A 3WY6A 4I3GA 3AYEA 2UWAA 1UY1A 4DXZA 3K3NA 2A6VA 2XG3A 2VL4A 3ETPA 3OJBA 1PVC2 1SPPA 4YZ4A 3POFA 1CZVA 3C3VA 4CXXA 4Y3OA 4LBQB 2R043 5FMCA 3LEKA 1OQEA 1BEV2 4WVMB 5FZLA 3AB0A 2J7MA 1MQTA 1C8M1 2QTWB 5F2SA 1V9U1 1R1ZA 4GWIA 4XFHA 1OUXA 1H8TA 2P34A 3KV5A 2XUMA 1OI6A 3UKNA 5LBCA 3T0AA 2WL1A 2V5DA 4H7LA 5F5AA 2WIIB 2ZZQA 2C9KA 2R0FA 2NZ9A 4IEYA 4CRQA 2ZGMA 4XJ8A 5L7OA 1HRI3 1YHFA 2D6LX 4WV8A 1O4ZA 4WVZA 4JRAA 4ZU7A 2FQPA 1YCIA 4YM0A 4XUTA 4XFFA 1RC6A 2GMEA 3BYWA 4RR3A 4DNYA 5AVPA 3AC0A 5KWRA 1IS6A 3JD71 4IV1C 1EV12 1GQHA 1PK6B 4LBQA 3AP9A 4MVTA 3MF9A 4RQPB 4U2AA 3ZDSA 3VN4A 1YFUA 4DQAA 1PGSA 1YYNA 3H3LA 2GMMA 3K4ZA 4QKFA 3O12A 5C9AA 2R072 4FT8A 4UF0B 2AUYA 1V6JA 3H42B 4WM7C 5DAQA 1OA2A 1R1A3 1JUIA 4Y26A 3RQ0A 1GNZA 2XOMA 2CL2A 4AI0A 2R6QA 5F3GA 4XJUA 3LKJA 4CUAA 3CIHA 3ZN5A 5FJKA 2W95A 5L9VA 1SG3A 4FP3A 4RA0A 2FZ1A 3H9AA 3VKNA 4N53C 3PIGA 3CJXA 1VP6A 4K6BA 2B9VA 4MH0E 2AC1A 3UGFA 3HNBM 4Y1UA 3GZEA 4OCTA 3N4MA 5CG9A 3A7QA 3GBFA 3VDCA 1OPOA 1W8WA 2Y0OA 1ACCA 3ZXLA 2JDAA 1CVNA 4RQPA 5FP9A 1NZCA 4JGYA 1V00A 1W39A 4TLFA 3RFRA 2JKXA 2QQJA 1AYM2 3NWKA 3FBYA 4C1WA 1V6MA 2QCSB 2ZKNA 3HAGA 2IXCA 1TZOA 4P9JA 4ARXA 4YM3A 3HNYM 4RGAA 3BGAA 3IN9A 3SEPA 2DVDA 3PNAA 3O5SA 1QDCA 1UMHA 1H6YA 1WGPA 1WZXA 1Y9MA 3GZTB 3O0XA 1U0AA 5FYMA 3VBRB 3WCSA 4CDUB 1GUIA 1W8ZA 2BGCA 2CTVA 2WQ8A 1MEC2 1UNBA 3BOPA 3I59B 4J25A 4PI2A 4AVCA 2ES3A 4QHOA 4Z82A 1UY4A 4I3PA 4LIVA 3LA3A 3I2DA 3IIIA 4XJAA 5FZFA 1S4CA 2WABA 3C7HA 3WF4A 5I91A 2ZGUA 3J8F3 1QNYA 3P6BA 2CDPA 3THPA 1I1EA 3KCXA 4NOTA 4DY3A 1URXA 2RMU2 2CV6A 4GULA 2D6MA 5EPAA 4LPLA 2CWMA 5I8SA 3E5XA 4XOGA 3U78A 1MZFA 5GJ6A 4HSLA 2RS53 2WS91 4QX8A 5LA2A 1WBLA 3SH4A 3SKVA 1WCKA 3GM8A 5EHDA 1CJPA 3U11A 5EJZB 4MX3A 3DKQA 3ZXJA 4Q4Y1 1D0HA 3Q8CA 3V0BB 1JYIA 1IS4A 1NCQB 1QH7A 5HV0A 1YIPA 3BPSA 1DGWA 3D3AA 3VBRA 4CDUA 4KWJA 2PMWB 4GXLA 4AHYA 3I59A 1SDWA 4KL1A 2VMCA 1ST8A 3KLSA 4AFMA 5CFDB 3OGRA 1RUF1 4YM1A 1FNYA 4EZ4A 2P5BA 2FMDA 3WQBA 4K7JA 2VOWA 3CEWA 3KQRA 2VQ0A 3ZXGA 2KA3A 1XJAA 1NCRC 2WZR2 4M0NA 4AGRA 4GWMA 2R0HA 4YG0A 4YG6A 2R041 4S2HA 3U4XA 4MGYE 3H1YA 1QOSA 1PIV3 2FMYA 3JQWA 1TMF3 3ATGA 3CMGA 1VMFA 3D6EA
chains in the Genus database with same CATH topology
1SACA 2VVEA 4IETA 3MZHA 2H0VA 5GZCA 3V0BA 4KGQA 2VMIA 3POWA 1M4WA 4UW5A 2ZHKA 1PZ7A 1HRI1 1RL3A 1W0PA 3AFGA 3AZWA 2FZ2A 4XJ9A 1LOEA 1OHFA 5EFUA 3AYAA 3S30A 3PMSA 5J98B 3C2UA 2GC2A 3E6BA 2B39A 5BV6A 1KFXL 3B9CA 3CO2A 4IEWA 1KRIA 2DUQA 1NXD1 5ACA3 3OD4A 1RUH2 4JRLA 3BPZA 4MV2A 3SCFA 1R1A1 2XJRA 1COV2 2HWD2 4YVWB 4C91A 5FPXA 3WLUA 3ZXAC 1AJOA 2WLQA 3DV8A 4JTOA 1KJLA 4Q29A 3KCCA 2HWB3 2AENA 2ZGTA 3TYJA 4YW5A 1S1AA 4QMAA 1PGL1 2NPIA 1EYBA 4HN0A 2X8KA 2Q4SA 4EROA 2PFWA 1YUDA 2QDNA 1TNFA 2Q8OA 2MPFA 4FPLA 4XF9A 5GZDA 1B09A 1QWRA 4YGEA 1JUHA 1HIXA 4LBMA 4AFCA 1VAMA 4YVWA 3T1LA 1H4HA 3AZVA 1T6GC 4LEJA 4LO5B 1AL22 4C1XA 2ZAHA 5CNAA 3ZIXA 2E53A 3FLPA 3VBFC 4JCKA 1D4M3 3H8UA 4D94A 2H6BA 2LM3A 4CEWB 4DB5A 1SLBA 3DPRC 4FOWA 3ZFFC 4EN8B 1ZRDA 3NKGA 3J26N 1DQ1A 2RS32 3J8F1 4CDXB 4PBPA 4AVTA 4AVVA 2D6KA 3UJOA 4CP1A 4I02A 2JG8C 3RZZA 4RGGA 2P2KA 1BCXA 1BYHA 2G4IA 2RS51 2C9AA 1PZ9A 4I09A 1QJY3 3B9IA 5KHIA 4Q0UA 2EXIA 4Q8LA 4ITCA 3WP6A 5GM0A 1IQAA 2O8QA 4LULA 3ILFA 2B5HA 4R52A 4BOWA 4DINB 4ATFA 1OA4A 1R092 1A8MA 4D3WA 4LBQD 5DDJ2 3RYKA 2EXKA 4LE3A 1C28A 4KWLA 5T3NA 2CAVA 3M3OA 4M01A 2E7QA 4F83A 1GZ9A 4META 4CDQA 1Y7BA 1VBB3 4CDXA 2GSYA 3MYXA 2ZA9A 2QZ3A 1C1LA 1PIV1 1WA4A 2HWE3 1TMF1 3MIDA 1FNZA 2PN5A 3LA7A 3ZXEA 4LE4A 2D3SA 1CAWB 3RS6A 1RUI3 4JV4A 2VNGA 3ETQA 3IPVB 1N1SA 3TBDA 3PVBB 1BBT1 1GV9A 4J1WA 4MLOA 4AXOA 1EP0A 5JZGB 5DUVA 4HVOA 5E16A 2YC0A 1NG0A 3FZ3A 3NJZA 1R082 5FCCA 5BNOB 4GH4A 4QGLA 4Q0VA 2VXRA 1DGRA 2Q30A 2VY0A 2Y38A 4LO6B 2FBEA 4AQ6A 4XBQA 4ATEA 1OPMA 4FXGB 5IUQA 1ULGA 4C90A 5ACA1 1GZWB 1ZBA2 4Q4W3 3VUOA 2P3JA 2VOKA 2WINB 5HCAA 1HXS2 4MXWA 1J1LA 2XH6A 2PLV2 1CAWA 1NYWA 1N3QA 1X8EA 3PJYA 2AR6A 2V5YA 3IM0A 2Y26A 1JHNA 4C0BA 5JZGA 3J4UH 4AK3A 2HWB1 2E9QA 4KU8A 4UXAA 3VZKA 5BNOA 1TME3 2P3IA 2XB6C 1V6IA 3H0OA 4Y4YA 3KM5A 3KT1A 2ZGLA 2IWGB 2ZGNA 3NW4A 5DXDA 1VBC2 1WW7A 4CEYA 1UKGA 1CPMA 4A2UA 1GZWA 1IZ3A 2XHKA 4WVVA 5CAZA 1HW5A 2E63A 1NE6A 3O7OA 5CIRA 3HWJA 5JSOA 1ZRFA 1ZYBA 3KGZA 1FATA 1W6OA 3BALA 4LHLA 3LA2A 3RG0A 1SLAA 1RUJ3 5F1RA 2XJTA 3T2TA 2F6BA 4YGBA 1Q8QA 1MS1A 1D4M1 2RM22 3K51A 1FOD2 1AVBA 2VU9A 2CY6A 4GKXA 2KXLA 4N43A 3OF1A 5D1IA 5T52A 3EBRA 1KDMA 2GH8A 3TN92 2VVFA 2WSVA 3SNMA 2ZS6B 4ZKTB 1QF3A 2ZMNA 4CYDA 4H7MA 1FV2A 5DZEA 1PO22 2X5IB 2QQPA 5T55A 2WKKA 1QJU2 5F6KA 2XKOA 1S0DA 4Q0QA 4IV3B 2DFBA 2VW0A 3MLLA 3WDXA 3VHOA 5JOZA 1RIRA 5JOWA 2RR12 4P9LA 4X8NA 2ZZJA 2JE9A 4E27A 1RMU2 1YNAA 4Q4V2 3USUB 1DZTA 2A6WA 3WCRA 2HWE1 3NKTA 3CJIB 1S0FA 2A3WA 1ZBE3 3VBOB 2QKDA 2W68A 1C3HA 2X5IA 4LO8A 1O3RA 4OLLA 1UPSA 4C0HA 3LSDA 4ASLA 4AEDB 1AR63 1S2KA 2WNVB 4IV3A 3FFQA 3H1MA 4FPEA 1LGNA 3IIAA 3E6DA 3GBGA 4IEOA 5DUXA 3DGTA 4LTAA 4F7ZA 2UWCA 5I0UA 1CAXA 3RWNA 3USSA 1N47A 1F9KA 2WSUA 3INAA 2W39A 3R4DB 5K9YA 4HKWA 5L7OC 3MLJA 1QHDA 4FP2A 3S7EA 3MICA 5KBFA 2A7AA 2RJKA 4YW3A 3WUCA 4IEPA 4HN1A 3CJIA 1LHUA 3A0NA 3ZFEB 2G9GA 1GANA 1LEMA 2IC1A 3D0SA 4COUA 1QJX1 1MZ6A 5FAXA 2XJSA 2XVLA 4ZU5A 2WNVA 1AHSA 3LSEA 4LT5A 2ZGSA 5FBZA 2D6NA 2EAAA 3I8TA 1REFA 5T5PA 3GNEA 4M00A 4Q4W2 1TME1 1NY72 3VZNA 3M3IA 1D2QA 3UV9A 4BHPA 1NQDA 1Q8VA 2WNUA 3B7MA 2F4PA 4COYA 3H7JA 1LOCA 1AR72 2BYVE 2VOXA 4I0BA 4YYOA 4LA3A 3MIBA 2XKPA 4LHKA 2IXHA 4B4PA 4NPRA 3ZFEA 3PMEA 2BNMA 1C8M3 1RUE2 1V9U3 4J1XA 3P3PA 1H2NA 1PK6C 5D8AB 1O7FA 1RUJ1 3U0ZA 1G86A 1A3KA 4KGGA 4OZXA 2XPJA 3SLIA 1JW6A 3ES4A 3IBMA 3HQXA 1U12A 2MEV3 1RUNA 3NAPA 1XE7A 5BNNB 5FO8B 2VG9A 5FREA 4AEKA 1LRHA 1PHMA 4DMIA 2NMOA 5HBAA 1OD5A 2ZMKA 3VBSC 2BVBA 3UK9A 4DFSA 4FPGA 2BEOA 2JG9B 1Y9QA 3POYA 3N7JA 1O3QA 1G9FA 4QQ2A 3EQEA 4BWOA 3VV1A 1LECA 5HI0A 1POV0 1AL0G 3JU9A 3MPBA 4INDA 2R16A 1AUYA 1XNDA 4I0AA 3VL9A 1QKQA 4PIZA 4YVSB 5TSWA 1GFF2 1SCSA 1H2KA 1G9BA 4YARA 5BNQA 5JPNB 1RUD3 1DZRA 1WW6A 5CU1A 2EXJA 1H0BA 5EXOA 5FLIA 5BNNA 2DVAA 4XXPA 3H7YA 3FLTA 3VBRC 5LK7B 1V70A 3VHNA 1AXKA 3A0KA 2JG9A 2R32A 3MF6A 3NL1A 1QDOA 4BMEA 1DDLA 1NLRA 4FPHA 2W0XA 1ZBE1 3VDDB 1ZA4A 1Q3EA 5BUVA 4B8EA 1RHI2 1SBEA 2XLFA 2BBVA 3MLKA 2D6PA 1AR61 4YVSA 1JOJA 3AP5A 3WDUA 2YHJA 2P3KA 4LBNA 2ZHLA 2O8OA 1YFWA 4DS0A 4XF4A 1ENXA 3M7AA 1NCQC 4B3NA 4R9AA 4AG4A 5FMOL 2I45A 5ABJB 2UURA 4XEZA 1MACA 1ZREA 4DZGA 1Q5OA 1DQ5A 5CFDC 4KWKA 4XBNA 3ZXFA 4UBGA 2GNDA 1VBA2 4HKOA 1PMIA 2B46X 3SITA 4XYXA 2JX9A 4WM8B 3VDDA 2DCKA 2WS93 1AR92 2YROA 1QY4A 2XBO2 1H8TB 3ZSEA 1H30A 4XQDA 3VHPA 2C1FA 2BVVA 3AMQA 2PAEA 2OW4A 3KT4A 3GZUC 1S55A 1Z7S2 1X50A 3RJRA 1LOFA 5I0RA 2D3PA 4RR3B 3RMYA 5E1RA 4AI3A 1CIWA 2B9UA 1UN1A 4OVEA 2OYZA 3ZN6B 3ILNA 1C1FA 2XJPA 5GLUA 1OKQA 2RJLA 4WM8A 5C9AB 2C0ZA 3JB4C 1EY2A 4TWTA 5IK7A 2VW1A 2PELA 4PLOA 5GZEA 4OULA 4MXVA 2NP0A 1APNA 2PHUA 1AJKA 2XLAA 3N3HA 4HMZA 3R4UA 4HVRA 4S2GA 4QX5A 2D43A 4M3CF 2MEV1 3DN7A 1FPN3 4AQTA 4PQ9A 2AYHA 4F3JA 2MNGA 3WW1A 3WW4A 1XXNA 5CFCB 3GYDA 5KC5A 3VKOA 4LHNA 1UZYA 2JDZA 3ZN6A 1CQ9A 3I4IA 3QACA 4IEVA 2HWC3 4N7IA 4BMBA 4JGYB 4W6YA 5AC91 4SLIA 4R8HA 3SHRA 3UKVA 2ZPXA 3B5LB 2WJSA 2ILMA 5JIAA 2R071 1DGRN 1ULCA 1KFUL 1SLIA 1PO13 1WD4A 4LBJA 3MGUA 5E8AA 4XFIA 4EWDA 5FDBA 5FQ0B 3URFA 1RUD1 3JD72 3NVCA 3OTFA 4HK8A 3VKMA 2R062 4PCRA 4PIXA 2DCYA 3NO8A 4XTPA 3LOBA 5CFCA 3BOWA 2PHFA 4Z2WA 2EXHA 4CEWC 4R4ZA 5GALA 5HCBA 1BK1A 2ZX4A 1H2LA 3TOJA 1ENQA 3TB0A 1JYCA 2E6VA 1WMEA 3LZZA 4CDXC 1WMDA 5JIUA 1X8MA 3OYWB 2ARBA 4NO4A 2ET1A 5FQ0A 2WA3A 4Q0SA 3WHTA 4D69A 4HANA 5JSPA 2B42B 1ZZCA 4NN0A 4KU7A 3ZYIB 2AGSA 3GALA 5KHKA 1UU4A 2ZGQA 4AE2A 2WT0A 2XVGA 5H9PA 4UW4A 3N35A 1TQ5A 1EAH3 5A3MA 2ARXA 3OYWA 5FLJA 3PVOA 1W2UA 4Y24A 4XDQA 4JDOA 1XYNA 1W6NB 5LEKA 4ZXKA 4PDWA 3D8CA 3JBG3 1D4VB 1IS5A 3AP6A 4K3UA 1SBFA 3I7DA 4YGCA 4DPNA 5JZGC 3LCPA 4HBNA 2XL9A 4DOUA 3AZXA 1QH6A 1GSLA 4Q4Y2 3VZJA 1ND2B 2DVBA 4Q2FA 4TZDA 5FO7B 1HQWA 1ONAA 2BTVC 4K1YA 1RUF2 1UZZA 4XXAA 5A32B 3CF6E 4RS5B 1W6NA 3TAYA 1HV0A 1BBT3 2VUJA 4A7ZA 1DLLA 2R042 3R6SA 1FPN1 1G6NA 4AFDA 5KXCA 1ZRCA 1G9DA 4AVBA 1UKRA 1QXPA 2BNOA 5DG1A 1XRUA 4K8FA 4AHWA 4HPKB 5IK5A 1UU5A 4A7YA 1ASJ3 3E5UA 3VBUB 1ND2A 2HWC1 2ZACA 1YI7A 4FPKA 4Q1PA 3SH3A 5K0UC 4J6GA 5T54A 2WZPP 1HRI2 1NA1A 3VKFC 1LR5A 2HKXA 2SBAA 5A32A 3ELNA 4RS5A 2CNAA 1PO11 2DUOA 1LGBA 2VPVA 5L36A 3TWIA 4FOQA 5CB7A 4D7YA 5KXDA 4PF5A 2LALA 3AXDA 2GC0A 3ZFGC 3WX5A 1R1A2 2VGDA 3AFKA 3MW4A 4HPKA 2UYAA 1C8NA 3VBUA 3HT2A 1UCXA 2P17A 4XF3A 2ZHMA 2Z5WA 2EA7A 2ET7A 2BFUL 4LO4B 1DGWX 1L3JA 1PGL2 3IWZA 3H3UA 4AQ2A 1XU2A 1H1IA 4CTEA 5GLTA 4IEZA 3ALQA 4BZ4A 1MS8A 1AL21 1O4YA 3OPZA 3WDVA 2R1DA 4JDNA 4L92A 4XETA 3MW3A 2IXLA 2X5IC 3UJQA 2LUWA 1QQP3 2DTWA 2ZGKA 4PLNA 2A3XA 4IV3C 2AH2A 2GNMA 1FMD3 1MS3A 2GNTA 1S0BA 4CDQB 1EAH1 1QU0A 1DZQA 1EPWA 5IT6A 4G9SB 3V65A 1AR83 4KNCA 3JUUA 1RUG3 3RI9A 2VH9A 1DQ2A 4XJWA 1WD3A 5DG2A 5GLWA 3ZSJA 5FOBB 3JBG1 3VBOC 2P37A 3J8F2 4GB33 1IPJA 1CJDA 1HQNA 5A33B 3U10A 4IESA 1KS4A 4HK9A 4AEDC 4GH4B 4I0WB 2WNVC 4Y1VA 4H3WA 2RS52 1FT9A 4YZ2A 2VULA 1OLRA 3WQ1A 1J1TA 1K5MB 4K21A 3IT8A 4HLTA 4N53A 5L73A 5HXVA 1HRV3 1DHKB 3SXWA 5EWSA 1SLTA 5FLHA 3DF0A 4MXWB 1S0EA 1F2NA 1Q8OA 3WG3A 2CYFA 3VZMA 5J3UA 5SV5A 3VL8A 1NE4A 3VLBB 4XHBA 4FPOB 4E4SA 1VBD3 1LODA 5A33A 2ZGRA 4OI2A 3BB6A 2CGPA 1PIV2 4NHLA 2C5DA 1TMF2 4E2SA 5KXEA 1R081 1WCSA 3EO6A 3AM2A 1G9AA 4Z07A 1K5MA 1AX2A 5FFOC 1ASJ1 3ASIA 3GF6A 4N9IA 4XFAA 4CEYB 5J48A 3AKSA 1YXWA 1S0IA 5CBLA 5CA6A 1DQ0A 5KHGA 4KQ7A 3WOGA 1QJX3 1W6OB 3FE5A 2GAUA 1KQRA 3ZYGA 1GNHA 2PAKA 3MW2A 2V73A 5HCFA 5GZGA 4QQPA 3OBTA 3VGIA 4Q4X3 2OPKA 1RVF3 5FTTC 5ACA2 5D8AC 1OMIA 2ZX0A 5T5LA 2D93A 3R05A 4TYSA 2OUJA 2QDRA 5DUWA 2TEPA 2QVSB 4RHV3 4N43B 5FMOS 2YYOA 5JOYA 5BNPB 2HWF3 2I2SA 5BNNC 2AREA 2HWB2 2BNNA 2VQAA 2JKBA 5AVAA 4XFCA 2JG9C 1ZM1A 2VMGA 1ULEA 4RFT0 1HQLA 3B69A 2EALA 2QE3A 2DV9A 4BPZA 2BW8A 4XQWA 1LB2A 2I74A 3AP7A 1QQP1 3P3NA 4YVSC 2B7YA 4MUVA 2YY1A 4HZFA 4JVAA 1H9PA 2XGXA 3LWCA 1RTVA 4AEMA 1FMD1 1O3TA 4IEXA 5BNPA 1UPIA 1REDA 2VUAA 2WFF3 4YW4A 4B7KA 2DCTA 3I54A 2XJUA 1D4M2 3HN1A 4BIFA 4FTBA 2Z42A 4OFGA 1AR81 2RS13 3WD5A 1W6QA 3MIHA 2CGNA 3FBMA 2IXKA 3ZX7A 3R4SA 1RUG1 4LLFA 3ZVXA 1V6OA 4XMIA 1UF2C 1PO21 3RPQA 4K20A 4G3YC 3O0WA 4GMP0 4GB31 3VDDC 1XU1A 4QM8A 2WA4A 3NV4A 1U5ZA 5SV8A 2EAKA 3M8LA 4UW6A 1QOTA 1E57A 3GHMA 4A7KA 1CAXB 2PHTA 1QJY2 4OHXA 1LGCA 4Y20B 4GALA 5K8SA 1HRV1 5JOXA 3AMMA 3LGRA 5BY5A 2VNRA 2ZBJA 1ZZ8A 3K48A 4OHVA 5ABJC 2PQQA 1LOFC 3IDEA 5JCTA 3KSCA 3DPRB 4FQ4A 1S0JA 5H9SA 3WUDA 5CVRA 4LLOA 5B2GB 2IZWA 1TEIA 4WM8C 2UYBA 1MQTC 1DIWA 1VBB2 1VBD1 1H8TC 4GWNA 1A6CA 2ZABA 3WW2A 2HWE2 3LOIA 4I01A 1X36A 1Z0HA 2WNUB 4E2GA 4LUKA 2X29A 3TNPB 3OY8A 1OQDA 1RUI2 4PLMA 4Y20A 3HIFA 4AGVA 3ZYRA 5JLVA 2E7TA 4Q1RA 3MFCA 4RR3C 2ZAAA 4EV0A 3DPRA 3ZFFA 1D0GA 3BTAA 1BKZA 3WP5A 4QQLA 1VIWB 1I3HA 1GICA 2H0BA 3GBWA 3A4UA 1VRH3 3AKQA 3H1WA 5T5JA 5JSRA 1V6KA 5C9AC 4Q4X1 4L9BA 1RUC3 2Z69A 1AYN3 4H55A 1RVF1 4LO7A 1H9WA 1KITA 3NAPB 3V64A 1POV3 2TNFA 5EZWA 3ECQA 4QGNA 4PJYA 2Z79A 4RHV1 1Q8SA 1BMV1 1LHOA 2VECA 3KS7A 2HWF1 1RINA 4S2DA 3WT3A 4WVWA 1PVC3 2D7FA 5CFCC 2NMNA 2Z2SB 3V56A 4HFSA 2JICA 3IDBB 2XLGA 2BPA2 1TME2 1BEV3 3QH6A 4FPYA 4FPFA 4Z1VA 5JMCA 4RQPC 4MZUA 2Y0IA 4JGYC 2HEWF 3D4KA 1WW4A 5FRAA 1ULDA 2WLPA 1FI2A 3JCIA 3EXUA 4L99A 1IOAA 1YWKA 4OHZA 3PLQA 3JQXA 3L9JT 1PNGA 4XHXA 4MSVA 4E2QA 1RUJ2 1WLTA 2WFF1 4N9HA 3WG4A 3E6CC 4BH9A 1EV13 4L8QA 5KHJA 4NHMA 5AC93 1LJ7A 2RS11 2YPJA 3FMGA 1Z78A 2R073 1OOPB 3RYRA 2DF7A 5DUUA 1IKPA 1IS3A 2VW2A 1WBFA 1ZNPA 1G7YA 5I0TA 5JR7B 4AHZA 4B4RA 3ZSLA 3L2HA 5IK8A 4K9SA 1OQ1A 3TRSB 3MEPA 4CDUC 3AKRA 1J58A 2ZX3A 5KC6A 4YLZA 2JE7A 5LEJA 1UW8A 1CPNA 3NV1A 1RB8G 5F9TA 1HV1A 2XJVA 1CESA 1U5YA 3VBHB 4LR4A 3KMHA 5JVVA 1OOPA 2XVKA 3AMHA 1QGLA 1REEA 2CWSA 2QZ2A 3T1MA 3AKTA 2E7AA 2IFWA 2ZHNA 1JXNA 2IXJA 4BM8A 2TUNA 1VBE1 4EWAA 1LOBA 4QU2A 4B4QA 2NN8A 4JAAA 4YRDA 1ZBE2 1MEC3 1GLHA 4NWWA 4I2OA 1O5LA 4BQ1A 4OUSA 3MIGA 3ZO0B 2KM2A 3LAGA 5GKAC 2QFEA 3V0AB 4AF9A 1AR62 4YG3A 1SLCA 1X33A 1WLCA 5IK4A 1UAIA 2ERFA 4Y22B 1J3PA 4QPGB 1VBA1 3B94A 3AXEA 4M3CB 3VBHA 2RMU3 1TNRA 2BFUS 4XF0A 1YJKA 1VRH1 4HETA 1RUC1 1AYN1 4BYYA 3HR9A 1GZCA 3N7MA 3BU7A 4RS5C 4UBHA 1XNCA 3CL1A 4TSVA 2EIGA 1POV1 1PGW1 1YI9A 2JXAA 2HJIA 3M3QA 2UWBA 1DU3D 2XWJB 1ZZBA 2B8MA 4YW1A 4Q0PA 5GLVA 4P14A 5J96B 3V0AA 1C5IA 1X7NA 2YGMA 1W6PB 1PVC1 4Y22A 4QPGA 2WZR3 5T50A 1CAUA 2A71A 4M3CA