5B4NA

Structure analysis of function associated loop mutant of substrate recognition domain of fbs1 ubiquitin ligase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
RNLLRNPCGEEDLEGWSLDVNGGDGWKVEELSRDQRKEFPNDQVKKYFVTSYYTCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRPDCGSKYQLTVRLLSENEDVLAEFQPDPATIQQKSDAKWREISHTFIDYGPGVRFVRFEHGGVDTHYWAGWYGPRVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords F-box only protein 2
publication title Structural analysis of a function-associated loop mutant of the substrate-recognition domain of Fbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
total genus 38
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5b4nA00
4TTGA 3J7HA 1K42A 4A41A 1T2XA 2RJ2A 3W5NA 1OF4A 2ZEWA 3I3BA 5EJZB 1GQPA 2VMCA 4QX1A 1YQ2A 4XUOA 2C26A 3HPNA 3C7GA 2WBKA 1GMMA 3I2HA 5C70A 3SEPA 5DMYA 2VTFA 1WKYA 3UETA 4LQRA 2VM9A 3OGRA 4JKKA 4HG6B 3T09A 1W9WA 1GOGA 1KEXA 5CYYA 2LS6A 3WNOA 3VDAA 2ID4A 2VMEA 1DLCA 3DECA 2EIEA 4QDRA 3T0DA 4E8CA 4DUVA 5C71A 1GUIA 3I2FA 3SKJE 2V5DA 3T2QA 4XUNA 1OD3A 4XUQA 5LCWL 4KWUA 3THCA 1NKGA 4LHSA 5IFPA 4MO3M 1JI6A 1K12A 4QX3A 2VZOA 2CDPA 2VZRA 3T08A 2DCJA 4CUCA 4ZY9A 4DXSA 3K75B 1K45A 4M4RA 2VCCA 2VL4A 4GZ9A 3WF4A 1UZ0A 2BERA 1L7RA 2WAAA 2XONA 4W50A 4TXWA 1UY0A 1GU3A 1W9TA 1W99A 2V4VA 2Y6HA 3LQCA 1CX1A 5JXIA 2XQXA 1R64A 1W9SA 5JUVA 1PMJX 1L7QA 3VD7A 2J1UA 1UY4A 3WF1A 4A42A 3I2GA 1JZ5A 1JU4A 4A45A 1O59A 5HXMA 2QBXA 2DCKA 1SDDB 2E31A 1UXXX 1PX4A 2DDUA 3K4DA 2E32A 2BZDA 3LE0A 3C7OA 3DYOA 4P00B 4QDSA 2BGPA 2Y8KA 1W0NA 2JKXA 2W95A 1KGYA 5LA1A 3ECQA 2VZVA 3EB7A 2VO5A 2Z4FA 1UYYA 4A44A 3CDZB 4DXTA 1GOHA 1XPWA 3I3DA 3T2PA 4ET7A 2VCBA 3K4AA 4IUGA 4QDQA 4W8JA 2EIBA 5B4NA 2EICA 1PMHX 1CIYA 2VQUA 3CZJA 2QQKA 1OH4A 2WDBA 4YPJA 1O8SA 1LNSA 3OB8A 4XVHA 1SHWB 1US3A 4ZZ8A 4QAWA 2J7MA 2X05A 1CZSA 1OT5A 3FHQA 4QB2A 5B4XA 1O8PA 2WZ8A 3WNNA 3A21A 4W4ZA 1J84A 3LEKA 3OGVA 4QPWA 3K46A 4XURA 4MADA 4KI5M 4CUBA 4MGQA 2WAOA 3I2KA 5DN2A 1H6YA 3LEIA 2JDAA 2VR4A 3CZUA 3PUIA 3ABZA 2PQSA 3IAQA 3IIIA 4BK5A 3HNYM 2YC2A 3C7FA 1EUUA 2Y6KA 3HJRA 3F2ZA 2E26A 4A3ZA 2BBAA 5A1AA 2Y6GA 2V72A 2B9VA 3ACIA 2J1SA 2VQTA 2ZEZA 3UNPA 2J1AA 2W94A 3OEAA 3I2IA 5JXGA 2W91A 3P6BA 1JU3A 4LKSA 3D3AA 1UY2A 2ZEYA 3OG2A 3P1IA 3ZM8A 3JXSA 2VZTA 2W1SA 3HN3A 3I97A 1JYXA 3EYPA 3CMGA 4DEQA 2VZSA 2VOTA 2WN2A 4ARYA 3CKHA 3NRUA 2J1VA 4UAPA 3NNGA 4UOJA 2QQIA 3WNKA 2W1UA 1JZ7A 3MV11 2X09A 5LA2A 1UMHA 3MUZ1 1NAEA 3NJXA 3HNMA 3MUY1 2J1TA 4OYUA 3HNBM 1JYVA 2QQLA 1D7PM 3IAPA 5IYYA 2R7EB 4BDVB 1WCQA 1W8OA 3GXUA 1BHGA 4DUWA 4QX2A 1UX7A 4CUAA 3NQHA 1TG7A 4P08A 2RVAA 3IB3A 3MBWA 5EIYB 4DEVA 2W5FA 2Y6JA 2E33A 4L0PA 3NJVA 3THDA 3WEZA 3WF0A 1JZ2A 3HOBA 4KMQA 2LW8A 2Y64A 1US2A 3DYMA 1NX9A 2VZ3A 2WUHA 5C7GA 1XNAA 1I5PA 2YFUA 2WO3A 3I3EA 4OMDA 1RYYA 2JD9A 2BGOA 3VD3A 2QQMA 3LPFA 1UY3A 5G04L 2W9XA 5F7UA 2HYXA 2YFZA 2ZEXA 1GNYA 2XOMA 2W92A 3A7QA 3GM8A 2WO1A 2W1QA 4ARXA 5EJ1B 3GDBA 2EIDA 4BXSV 3FN9A 3VDCA 3UESA 1UYZA 2B4KA 4JX0A 2ORZA 5I0DA 1JZ6A 5JXHA 4CU7A 3W5MA 5IJRA 3IDAA 2WO2A 3C7EA 3U37A 3WNPA 5LA0A 3ACGA 2VZQA 1JZ3A 4OMCA 4BK4A 5CZKA 3WSOA 2VZ1A 2WN3A 5IFTA 2WYSA 4BJ0A 3VD4A 3OBAA 2Y6LA 3BN6A 3CQOA 1ULPA 4M4PA 1CZVA 3MO4A 5J1XA 3OEBA 1IQDC 2C4XA 2KD7A 2VJXA 3GGLA 2YC4A 2VZPA 2QQJA 1F4AA 1HN1A 3A22A 3OGSA 1UY1A 3CIHA 2VCAA 4OZOA 4CU8A 2VZUA 4JKMA 2X10A 3ACHA 4FI9A 4D0QA 4XZUG 4GWIA 3SKVA 3FHAA 4PF1A 5JR2A 2HLEA 3LPGA 3WF2A 4LPLA 3DYPA 5HPOA 5JXJA 3E1F1 4PQQA 4ZZ5A 2J1RA 3BGAA 3K77A 2J22A 1DYOA 2VMFA 1UWWA 4JKLA 4UI9L 1XC6A 3K4ZA 4QB6A 4QX0A 4P5YA 5FUIA 3C7HA 4ZXEA 4GWJA 3I2JA 1J83A 1TVGA 5DQ0A 2VC9A 4MOAA 2RV9A 4RN5A 2WQ8A 1DP0A 5JMOA 1JYNA 3SEEA 3A23A 3MV01 1OF3A 2VMDA 5G05L 4PT6A 3C8XA 4CU6A 5DPNA 1ULOA 1F4HA 1SG3A 4P02B 3VD5A 1JHJA 4XUTA 2W47A 2W1WA 3HEIA 2W87A 1MPXA 4MGSA 1H6XA 1UYXA 4OUEA 1CZTA 3ETPA 3AC0A 2XHNA 3WNMA 2W3JA 1PX3A 3T0BA 1JZ4A 2J1EA 2ZXQA 2L9LA 4QB1A 3PUHA 1W8NA 1NUKA 3LEGA 3VD9A 3ACFA 2QQOA 4AAXA 3WQBA 4AG4A 2C9KA 3T0AA 4XUPA 2CDOA 1JYWA 3FL7A 4CU9A 2ORXA 2QQNA 4Z2AA 5IHRA 3WF3A 3T2OA 1K3IA 4RYDA 2OKXA 4A6OA 4DXRA 2W46A 2JE8A 1UMIA 1UXZA 4JHZA 1XNTA 4E8DA 1P8JA 1EUTA 1GOFA 2WABA 2YB7A 3VDBA 2WZEA 4CVUA 3WNLA 4DUXA 2YG0A 4A4AA 4D8MA 1JZ8A
chains in the Genus database with same CATH superfamily
2FMYA 5EP9A 5L9VA 3VBUA 1K42A 4KL1A 4B4QA 5EZWA 4AE2A 1FX5A 4W6WA 5I91A 1AR61 5KR7A 3RZGA 4PBPA 5EXOA 1S2BA 1DGWX 1HRI3 4PQ9A 4FAGA 4FCAA 3MI8A 1GQPA 1C57A 2PHTA 1NLRA 4YG0A 5BNOB 1HRV2 1BKZA 4IEWA 3BTXA 3AJZA 1ZBA1 3FMGA 4QWNA 4BH9A 1GQHA 4YVWA 4Q4X3 3KVBA 5F3CA 3J8F1 3AVSA 2P3JA 4OI0A 4PIZA 4WVWA 4AI9A 3MHZA 3JUUA 1H1MA 4Q4Y2 1W6NB 1FNZA 2WFF1 1RHI1 4F8AA 1IPJA 1FPN1 1CAUA 1W9WA 1W90A 3OF1A 5DAQA 1FOD1 1RUE3 4YVSB 5DAWA 5F5CA 3U07A 3LDBA 2WNUA 2ID4A 3GZTB 2DFCA 1F2NA 4B8EA 3WNXA 4CEYC 1LULA 5CIRA 1DQ2A 1RMU3 3AYAA 4QDRA 4E8CA 5CFDC 5FRAA 2BYVE 4ASLA 2A5ZA 1VBD3 2CU5A 5LBFA 1WCUA 2EXKA 4RS5C 1JYVA 3MZHA 1EV13 3MF6A 1PM4A 5A3NA 5ACA3 2X5IA 1OMIA 4XUNA 4I0BA 4XIKA 5I0UA 1V0AA 2E51A 1W8ZA 3MIDA 2YY1A 4LHSA 4NUBA 3THCA 4Q0VA 3RZLA 1RTVA 3PTYA 2XVLA 1ZBE3 4OUSA 2DCJA 4IETA 4DXSA 3PUQA 2XJPA 5FZFA 3JU9A 1YQ8A 4N53C 2WNVA 4RQPB 2VL4A 2GC0A 1WA4A 4GZ9A 4V2VA 3T30A 2ZGOA 4AGGA 4AVAA 4NOTA 4OHZA 1VRBA 4CEWC 4M01A 1NA1A 1IS4A 3FE5A 4CP9B 1Y7BA 2PMWB 4MV2A 4AF9A 3DN7A 1W99A 2ZMNA 4IEPA 3Q8AA 3RS6A 3VBUB 1GANA 4OQ8A 4AVCA 2WNOA 1WCDJ 5EQUA 2OT7A 1X9PA 4E4HA 5F32A 3D6EA 2FHRA 5A1LA 1LESA 3VKNA 1NZIA 3SLIA 1MEC1 4LHKA 1L7QA 1OA3A 1BLZA 1W6OB 1ZRRA 2A71A 4XFHA 3VD7A 3CJXA 5A7WA 4CA9A 3IBMA 4KNCA 4AQSA 3ZSKA 3WF1A 4A42A 4YVWB 3ZKYA 3OUJA 1O59A 2R062 2CHHA 3ROUA 2CWSA 2PLV2 1NCQC 3ZOIA 2QBXA 2OYZA 1AYN3 3PUSA 4GULA 5C8CA 5IT6A 3J26N 1NLSA 2PELA 2DDUA 4RL7A 3S0MA 1LEMA 2JE7A 3K4DA 3H8OA 2BZDA 2WZPP 2BDRA 1CAUB 4P00B 2C9AA 2IFRA 4YM3A 5IVJA 3ZR5A 1W0NA 2VTXA 3I49A 2WNUB 2QZ2A 1BMV2 1KGYA 5FZEA 2VNOA 3BPZA 1M06G 2KA3A 4UT5A 1O3RA 1DBNA 3TN91 1XYPA 4QXBA 2OZJA 4W6YA 4QQOA 2ZMKA 1JOBA 3M7AA 1GOHA 3I3DA 3T2PA 4ET7A 3LKJA 3AZVA 3PMSA 2VCBA 3ZDSA 3L9JT 1S0JA 1ASJ2 3VDDA 1QJFA 3W20A 5FZIA 1ND3C 5DDJ1 2EIBA 5B4NA 1TME3 4EROA 1LKNA 1VAMA 1HB4A 4AFDA 1HXS1 4EQVA 1FYUA 1CIYA 1ODNA 4BLJA 1AXKA 3ALQA 4BISA 3CZJA 2QQKA 4DMIA 2RJKA 3IMNA 4GKXA 4JAAA 4WVMA 3TEXA 1OH4A 2WDBA 3B9IA 4BHPA 1G9FA 3JQXA 1WMDA 2CYFA 2WNVB 3H9AA 3WVJA 3ZPYA 2BBVA 5FMCA 2BFUL 5FMDA 3PVNA 1MR5A 1PO21 1QGLA 2VCMA 4XJAA 5FZ3A 3WQ7A 4CDXA 4RD7A 5DUUA 1NA1B 4AEDA 4Y26A 1CZSA 2ZGKA 4XDOA 3VBFC 1V9U2 5KXCA 3ZO0B 3KMHA 2ZHMA 1O3SA 2FCUA 1CWPA 2CAUA 1OOPC 3HQRA 3IN9A 3OGVA 1DU3D 1PIV2 2D7FA 4AL9A 5LRSA 2GH8A 1UO9A 1UAIA 1Q3EA 5DN2A 2VD7A 5A7WB 3SITA 4IL7A 4NIDA 1BVP1 2WT1A 1DQ0A 4PF5A 4XIOA 3AYEA 1GWLA 4LBMA 4XDPA 4BK5A 2JJ6A 1BBT2 1OQDA 3ASIA 5GALA 4K8RB 3HNYM 4NIAA 1DHKB 3ZFGA 3PU3A 1KS5A 1FAYA 4Z92B 3C7FA 4JDNA 5C9AB 2Y6KA 4MXVA 3HJRA 5FYTA 4YZ1A 5A3PA 2AEZA 2P6CA 4RR3C 2BBAA 4NPRA 2HWC2 1WMFA 4AVTA 3ZX7A 2V72A 4AVVA 4DFSA 1EPZA 2CY6A 2QE3A 3PJYA 5FXWA 3N9NA 3ZKUA 3ACIA 2J1SA 3MYXA 1G9BA 2GZWA 3J7LA 3UNPA 1FV2A 2W94A 3RYPA 4LE4A 4GD4A 1SEFA 2R072 3M70A 5JXGA 5C5TA 4QU1A 1AL23 2DTWA 3P6BA 2VECA 1C8M1 5FZGA 3D3AA 3VBSA 1ENXA 2D97A 3P1IA 3JXSA 3QD6A 1VP6A 1RUC2 4GMP3 4WZCA 3I97A 4Y22A 3GJAA 5FZ4A 5H9RA 3VDDB 4KH9A 5LWBA 3EYPA 1O3TA 3ATGA 2WL1A 1DCSA 4L99A 4QGNA 1LODA 1DZQA 2NLRA 1R082 2ZX3A 4FPOB 3RI8A 4WVMB 5A6XA 5KWRA 2XQRA 4QXCA 3O1RA 1X50A 4LMFA 3VL8A 2LTNA 3H1WA 3U75A 2P5BA 3NNGA 1W2TA 1YFYA 1UF2C 4FQZA 5A3LA 2YPDA 1JBCA 2Q1FA 5A3WA 4ASKA 2SBAA 4CXXA 3MV11 4I01A 3RQ0A 1UMHA 2VW2A 1NCRC 4RQPC 2JICA 1NAEA 4AEDB 2WS92 4R9CA 1ULGA 4NROA 5LY1A 1GSLA 1N3PA 1QEXA 1W9YA 5JR7B 3HNMA 4HLTA 1KDMA 4Y5SA 4LOTA 3MUY1 2J42A 4OYUA 2QQWA 1JXNA 1RITA 1D7PM 1VBC1 3KCXA 3KSCA 3NNFA 2JDMA 4IQPA 4PIYA 3VBUC 2R7EB 1X8MA 5IYYA 4K3UA 2PAMA 3JBG1 2HWF1 4A7KA 1LHWA 4BDVB 1R1A1 4Q1RA 2ZKLA 1WWYA 1A78A 3LAGA 1NG0A 1W3VA 3K3OA 1GFF2 1DQ1A 2HWB1 4CUAA 1UZZA 2Y0OA 4HZFA 1OLRA 2IZWA 4Q29A 4P08A 1Q56A 2RVAA 3IB3A 3MBWA 1I6XA 3LGRA 2W5FA 3ZFGB 5F2SA 1WLDA 4FPYA 4CXYA 2R1DA 4FFHA 3WR0A 1RMU1 1RUG2 4QXHA 4XYXA 4MGZE 2EVXA 1S55A 1BXHA 1VR3A 3D5OA 4LORA 3VHOA 4XAAA 2YC0A 3MIHA 1YI7A 5FMOL 1UCXA 5FZ0A 4XAEA 5FOBB 5ACA1 5BV6A 4KMQA 2Y64A 4JGZC 4JRLA 3DYMA 1U5IA 4Y4RA 4YW6A 3WDUA 5C33A 1QIQA 1NX9A 2FMDA 2VZ3A 2WNUC 1SLIA 2WUHA 4COZA 2RS33 4IV1A 2A3YA 2NMNA 2ZMLA 4BXFA 4JRAA 1N1YA 2MNGA 3I3EA 3WX5A 5CBLA 2DURA 2PTMA 4CPBA 2JDKA 1RYYA 2RS13 1SPPA 3PDQA 4PHZA 1H9PA 3V64A 4MSVA 5CU1A 4CTEA 3WXPA 3LA7A 3KB5A 1Z7S2 3NNJA 3BOWA 1OD5A 3AL5A 5GKAC 4DNYA 3ILNA 1CR7A 2HYXA 4ISRA 4QHZA 2XOMA 5FZAA 2VH9A 1RUF3 2VUAA 2W92A 3DV8A 5BPXA 1UU5A 5FLHA 1AHSA 3OGJA 2DVDA 4UBGA 1GZCA 2FZ1A 4ARXA 2VTXJ 4EN7B 4AI2A 2XJTA 1LOAA 4LA2A 1QJX3 2WFPA 1VMFA 1GNHA 3FN9A 4Q26A 3VZMA 3ZSJA 2HWE1 3UESA 4MG2A 2B4KA 2R0HA 1NA1C 3POSA 2ZACA 2YU1A 3VLBB 3PL0A 1CVNA 4X8NA 2LUWA 4QXKA 4P14A 5HCHA 3KV6A 2PQQA 1LOFC 5KXDA 2WO2A 5C8WA 4OQ9A 4DY5A 1G9AA 1Q8SA 1IQAA 1H8TB 3RZKA 3B69A 2VZQA 1REDA 5BXXA 1ZZBA 5FYVA 1DQ6A 1ZRDA 4BK4A 5LBCA 5C6CA 1C3HA 3W9AA 1IPKA 2D6LX 3E5XA 3VD4A 3JD71 4HBNA 3NJYA 1O4TA 4YGDA 4D7SA 3OBAA 4AOCA 2R0FA 3OGGA 1OBNA 5C9AC 1FI2A 3P5BA 1DIWA 1I9RA 2DUQA 4P5HA 1R092 1XNDA 3MEPA 4SBVA 4IEVA 1JN2P 1W06A 1K5JA 1QJU3 1IQDC 3CEWA 4IV1B 2BWAA 4KWKA 2IXIA 2P4EA 2KD7A 3OD0A 5F6KA 5FJKA 3S5QA 2I45A 4BIFA 2VOXA 1LRHA 1YYNA 2ZGPA 3U10A 1JH5A 1SPPB 3V0BA 1J3PA 2IVIB 4LA3A 1UY1A 1JW6A 3DPRC 3VDDC 2IVJA 3AZYA 2D93A 3BVCA 4RFRB 4BQ2A 4CU8A 3O1SA 2QNKA 2VZUA 3LOBA 2X10A 4D0QA 2D6PA 4HFSA 3ST7A 4GWIA 2QQVA 2D3PA 3S30A 3HR9A 2B7YA 2BVBA 4FOYA 4AFCA 1C4RA 1STMA 1PM7A 2QJVA 2BUKA 1H0BA 4UW5A 3H8XA 3WUCA 5J09A 4ZZ5A 1D0GA 1HW5A 1BZWA 2ZJCA 4UI9L 2VXJA 4EV0A 1W6QA 1S0BA 2Y33A 1LGCA 4M3CA 4ZXEA 4GWJA 3H7JA 1O6UA 2QQUA 1J83A 5JI7A 2VNRA 4QPYA 1D4M1 2VC9A 4MXWB 4E4ZA 4KGGA 4AI8A 4XF9A 2HWD3 2GC2A 4RFT0 3TEWA 1APNA 2OZ6A 4K6BA 2PHLA 3R05A 2UYBA 4RHV2 1XE0A 3D82A 1B35B 3MDPA 1UU6A 4CDUC 1OF3A 3H8RA 4UFIA 4KQ7A 5G05L 1QJEA 2VQ0A 2R16A 2UU8A 4CU6A 1R1ZA 1TE1B 4H2AA 4G4FA 3L2HA 1F4HA 1ZBA3 5L73A 1RUJ2 2WINB 4TLFA 4Q4X2 2W1WA 4XBLA 3J8F3 4ZU4A 4XHBA 1H6XA 1L3JA 2C5DA 1UYXA 1CJPA 1UU4A 1YCIA 5FZHA 1TMF2 1COV1 4OI4A 2YZ4A 3AC0A 3SC7X 1ZYBA 1AR81 1PX3A 5E8AA 1RHI3 1GP5A 1PGW2 2QVSB 3ZFEA 5BUVA 5I0RA 3V0BB 1QXJA 1FPN3 2FDIA 5DAXA 5IUQA 1YQ5A 1FOD3 1RUE2 4N90A 5T50A 4AAXA 3WINE 4HKWA 1WW5A 2C9KA 3E6BA 2ZKNA 4FPCA 2Q30A 5DUVA 3PIGA 4AFBA 1G9CA 3FL7A 1VBD2 3T2TA 3D8CA 3N7LA 1EV12 3T2OA 1IG0A 5FPXA 1K3IA 3DXUA 2W46A 1QDCA 1UMIA 4EN6B 1YJLA 1X36A 4JHZA 2RDNA 4META 4AQTA 4IXLA 4XTPA 1EUTA 3ZN6A 3M4FA 2Q0AA 1X8EA 1ZBE2 5DAVA 1SLCA 2YU2A 4I30A 2WZEA 3VKOA 1OLME 5A3MA 2NN8A 2YG0A 3O1TA 1W6QB 1OA4A 1SLAA 3HIFA 4Z2WA 1JZ8A 1RUNA 2VAUA 3AXDA 3POGA 1AYM3 1F9KA 4M3CB 5F3EA 5DZFA 3RMXA 4A41A 5EJ3A 2P2KA 1CAWA 3AZXA 3GHMA 1H8TC 3APBA 3W5NA 2XJQA 5IK4A 4QX1A 2VMCA 3C3VA 4XUOA 3T1MA 1YRZA 5FZ7A 2C26A 4HXCA 1ZX5A 5HXVA 3AJYA 3C7GA 3NWKA 2Q8CA 4BA6A 2VE1A 3RWKX 4Z8BA 5KHJA 4IW3A 4FVVA 5DUWA 3SEPA 3VKLA 3NAPC 3PVBB 1MEC3 3POJA 4WBBA 3O1VA 4XQ4A 2FZ2A 4DB5A 2YXSA 2Y6FA 2VM9A 4LQRA 4KBBA 1SLTA 5FO8B 1F5FA 4AVBA 1AYN2 4ZXKA 1QOOA 1KEXA 1MACA 2HYKA 5CYYA 1JYIA 2YBKA 3ZFEB 4L92A 2LRPA 1RUF1 1HJGA 1DZRA 1CPMA 3I54A 3VKFC 3KT1A 4QPIC 3DGTA 1H2KA 5F3GA 2QDNA 1FMD2 4MGIE 2RM22 3BPSA 4URAA 3TEZA 1MZEA 2E7QA 4XJ8A 3N4MA 3M1HA 5CADA 3SKJE 2V5DA 4F3JA 1A8MA 3ZXEA 4UFLA 3TN93 1OD3A 1SCRA 4XE9A 4KWUA 1NKGA 1RUH1 3AP7A 2CTVA 4MGYE 5DUXA 5IFPA 5FP7A 2UY9A 5GZCA 1POV0 1OURA 2CDPA 1OVSA 2MHFA 5FUPA 4NJ4A 2A1XA 4CUCA 4WM7A 5FP4A 3O1UA 2ES3A 3K75B 5DDJ3 1OA2A 3ZN6B 1TME2 1AXYA 1QU0A 2VCCA 4CCDA 1HXS3 4EE2A 1MS0A 2BRTA 2X53S 3B7MA 1KFXL 2Q8DA 4P9GA 1VAKA 1UZ0A 2BERA 2TNFA 2W39A 2K0GA 4R52A 1L7RA 2JKBA 2VULA 1ZZ6A 2XONA 4W50A 1UY0A 4TYSA 3NL1A 2IXLA 1OLQA 3EXUA 5BNQA 2V4VA 1VBA1 1XU2A 3JB4C 3LQCA 1CX1A 5JXIA 1PO23 2XQXA 1CAWB 4GB31 5DZEA 1R64A 4Y1ZA 1A34A 5GM0A 1ACCA 3W58A 5B2GB 1PMJX 1ZNPA 2J1UA 3LDKA 1UY4A 1YI9A 2BNNA 1AR91 3J7NA 5FYIA 2LALA 2YGMA 2HEVF 4A45A 4GKYA 4FFIA 5FPAA 5HXMA 4GWMA 5J98B 2DCKA 3VGIA 1B35C 2O8OA 4BQYA 4E2SA 2WWJA 1N47A 1UKRA 2ZA9A 3RNSA 1ZREA 2R042 1UXXX 3KF5A 4TZDA 3BODA 2WLPA 1MVEA 2ARBA 2HKXA 1UPIA 3POWA 4CDWC 4YFWA 2UWCA 3I3MA 1X82A 2Y8KA 1XJAA 4YW1A 3WV6A 5KHHA 2ARCA 2VZVA 2VO5A 3FX3A 4XACA 1ASJ1 1H1AA 2G1MA 5FREA 1UYYA 3ZFFA 3KVAA 4LHLA 4ZS3A 4BMEA 2RG4A 1CONA 2JECA 5IVYA 2XPJA 2AC1A 3PVOA 4NHXA 1XPWA 2NPIA 1W04A 3RZJA 5CB7A 1UOJA 2YROA 3K4AA 3NJZA 4BQWA 4IV3A 2DCZA 2XMLA 3OOXA 2GMPA 2OW4A 1C8M3 3WDWA 3VHPA 5FY1A 5FXXA 1V9U1 4GH4A 4YW5A 3TEYA 4WM7B 4LT5A 1WMXA 5K7PA 2ZOEB 1NT0A 1RUD3 3AMPA 1XU1A 3FBMA 3FUQA 4ZS2A 3WHTA 4CPBD 4XVHA 1SHWB 1US3A 4ZZ8A 1PIV1 2JENA 4M0NA 4YSFA 2RE9A 2J7MA 2WNEA 4CCNA 4J25A 4IGQA 4AZZA 2WZR2 4LLOA 3RRDA 2BOIA 4AGRA 3M3QA 5K0UA 5IVVA 3ZR6A 4Q5OA 1NXMA 4CSWA 2JG8C 2EXJA 2BU9A 3GALA 1IPSA 1NY71 2LROA 4Q4V1 5EYXA 4CUBA 2WAOA 1LOCA 3HT1A 1OQ1A 5T5LA 4AEMA 2JDAA 2VR4A 1AR71 1GZTA 1VBC3 3W59A 3EMRA 1W28A 1J1TA 3JBG3 2HWF3 3J4UH 3IAQA 2UURA 1R1A3 1XB9A 5CEHA 5F2WA 1N1TA 5DABA 1PK6A 4LULA 4MGKE 2HWB3 4FFGA 1EUUA 3POEA 1XBFA 1LU2A 3OUHA 3F2ZA 2AGSA 3B02A 2A73B 2VUJA 2JE9A 1ENQA 3ITQA 2Y6GA 1IS6A 4IEYA 5J37A 2B9VA 2GDFA 4P9JA 2VQTA 1Q43A 2ZEZA 2ZHKA 3VBOB 2J1AA 4D6SA 3DKWA 3ZFEC 3ZFFB 3POIA 2B5HA 5JVVA 1CQ9A 2RS52 2OIIA 5L7OA 2WLQA 1UY2A 3VL9A 3TWIA 4C90A 1WZXA 2W1SA 1JMUB 3I3QA 2GNDA 2RS32 3WDYA 4IV3B 5CISA 2XH6A 4YZ5A 3FLRA 3CMGA 3GCWA 4PLOA 2DVFA 2VZSA 5BYNA 1URXA 2RS12 1MS8A 4H7MA 1VRH2 4LTAA 1DQ4A 4LBKA 4GH4B 1UKGA 5L9RA 4C0BA 1LB2A 1QMJA 5EPAA 2FDFA 3NO8A 1AYM1 3N9LA 3TAYA 3H8UA 4YGBA 3HWJA 2QQIA 3R4UA 4CDQB 2IXCA 3MLLA 3ZYPA 3W21A 5LK7B 1OUSA 4NAOA 3LFIA 4N43A 3DUIA 4UF0A 3UKNA 3WDVA 1EAH1 1NZCA 2DV9A 2GU9A 3MUZ1 1IG3A 3O0XA 3FFQA 1HKDA 3KLSA 1RXGA 4Y1YA 3S6PA 1W3XA 3AP9A 3AMHA 2VNGA 3TBDA 1XNCA 4Y20A 5CKMA 3PNAA 3WG1A 3HN1A 5FWJA 5K0UB 1XYOA 5CFCA 1UIKA 3IAPA 1QJX2 5LASA 3AMQA 2A3WA 4QPGC 2HWE3 2JIJA 4U2AA 1W8OA 5SV5A 3M2MA 4IDZA 1BHGA 3A0KA 2QUOA 3CF6E 3FC0A 1LGBA 5EV7A 2WA3A 2D6NA 4L8QA 4XHXA 4K1ZA 5IVCA 3CJIA 3RZMA 1PVXA 4AI3A 2XHKA 1GWMA 4LXLA 1Z78A 1PK6B 1IOAA 4LHNA 3GZUC 2BOJA 4HSLA 1GKBA 1XRUA 1E5SA 2AREA 5E16A 3J9SA 3WEZA 2TUNA 3WF0A 1NQJA 5FPVA 2IC1A 1JZ2A 5JAXA 3VN4A 4Q2FA 4J1WA 3INAA 4S2GA 2FD8A 1BYHA 4XJWA 1H8VA 1AX0A 3K51A 3SMHA 1QOTA 3JD73 3ME2A 5C7GA 1JHNA 1SFPA 3VBRC 2E63A 1V6KA 1TEIA 2GN7A 4PIXA 5C4WA 1ND2A 2X5IB 3N35A 5L7OB 4AHZA 2JD4A 2B39A 4OMDA 5T5OA 2VOKA 3UKVA 5AC91 5JSPA 3WD5A 1UZWA 1NYWA 3VD3A 1FV3A 1QJU2 1VPHA 2R49A 1LHOA 3MW2A 3U14A 4NAMA 4NR1A 3EO6A 4IE5A 4XCAA 2XBO1 2W9XA 2OXBA 1YJKA 5LATA 1ZZCA 3SH3A 1DYPA 2YFZA 4W6XA 1EYBA 3ZMNA 3R4DB 1OC1A 3ZPOA 3A7QA 4DZGA 2I74A 3T1LA 5A6ZA 4NVPA 4FPFA 1HJFA 4WM7C 3GM8A 4D69A 2B46X 2RMU1 4N43B 4UF0B 5H9PA 4HKOA 4UW3A 5T55A 2AACA 2I07B 1BEV3 5EJ1B 4BXSV 1O4ZA 1IKPA 2ZGTA 1SQ4A 4QT6A 3AK0A 4XFAA 2A6XA 3JQWA 4JX0A 1OI6A 2ORZA 4K20A 4I3GA 4PI2A 4Y20B 3SCGA 3OD4A 4Q8LA 2BNOA 2P3YA 3W5MA 1ZZ8A 5F8PA 3IDAA 3RWNA 1LAJA 5BNOC 3C7EA 4AYUA 3WW3A 5C8CB 2IUWA 1NOVA 4OMCA 1DGWA 3CJIB 4E4DX 2ILMA 3FJSA 5CZKA 5IATA 4TN7A 2C6SA 2K2SA 2WN3A 2JG9A 2WYSA 4AHWA 5LA9A 1YFWA 2GMEA 3OCPA 1D4M3 5FO7B 4BIOA 2XLAA 4NE9A 2HWD2 3BCWA 4JGYA 4BB3A 1C5IA 3IDCB 4LBNA 3MLJA 3K3NA 4DRRA 4YVSC 5C3RA 1K5MA 2IWGB 3LD8A 2PHUA 2Y6LA 1XOYA 3HT2A 4FFFA 3CQOA 1AR62 1D2QA 3TNQA 2PHRA 2VGDA 2ZZQA 3OEBA 5C4WB 1ND2B 2P6HA 3PUAA 3VBOC 5JPMB 3WP6A 5J3UA 2VMGA 1RUD1 3J8F2 3Q8FA 2Q1ZB 1Y43B 2D6MA 1C1FA 1AL0G 3ZYRA 1COV3 3FHIB 2VCAA 3VZJA 4CP1A 4IE4A 3HBKA 5FYHA 1UOFA 1V70A 1AR83 2WFF2 1RHI2 3IWZA 4WV8A 5D8AA 1FPN2 1FXZA 3J7MA 1QF3A 1FOD2 3ZYHA 1QNWA 4JKMA 4KWJA 4R9AA 3ACHA 4CDXB 2OQ6A 3Q8CA 4XZUG 4ES8A 5CKQA 2KM2A 4PF1A 1ZRIA 3KF3A 4LJHA 5JR2A 5JPNB 5HV4A 3BKZA 3NSTA 4CDQC 5C3SA 2DUPA 3OBRA 4LPLA 4YW4A 4FO9A 1S0EA 2A6ZA 5JXJA 2QDRA 3E1F1 3AP6A 3EBRA 2G9ZA 2ZX2A 2ZPXA 2J22A 1DYOA 2CGPA 1UWWA 1VBE2 4QX0A 3K4ZA 4XXAA 3ZXLA 4HMZA 5FBZA 4NIGA 1Q5OA 1W2OA 2C1FA 4R9BA 3BTAA 4XABA 1RUI1 3ORJA 2D98A 2VVDA 3WQ1A 3I2JA 3KV5A 2E53A 2ERFA 4YVWC 4HL0A 1OKOA 1J58A 1MZ6A 1YO8A 4MOAA 1KS4A 3EQEA 4O7XA 4YWAA 4AR2A 2A6YA 4YFZA 4GXLA 4RN5A 1RUJ1 2WQ8A 5KXBA 2JG9B 5E6HA 1LTEA 1SFYA 2DVBA 3A23A 3MV01 1EPWA 4JGYB 1PK6C 5GZGA 1U12A 1REFA 4NHMA 3UV9A 1K5MB 3RPQA 5DPNA 4LUMA 1VLNA 2GH2A 3AXEA 5JSRA 1JHJA 2VMHA 2YV8A 4I3PA 5EFUA 5FYUA 1MPXA 2GP3A 1MEC2 3Q9OA 1Q8OA 4Z82A 3BIEA 2VBPA 1ZM1A 2O14A 1JUIA 2MPFA 4YW3A 3VBSB 3WNMA 4Y22B 2RDQA 1T6BX 1H2NA 2J1EA 2L9LA 5LEJA 2A75A 2X5IC 3AVRA 4I0AA 3PUHA 1F31A 5ANQA 5L7OC 5FZMA 4B4RA 3UGHA 3ACFA 2C0ZA 1DYKA 5D8AB 3SCHA 4P9LA 4AG4A 1N3QA 3IPVA 1KJRA 4BPZA 3ZDVA 2Q8OA 4XUPA 2CDOA 3FZ3A 2XLFA 4QX5A 2WYFA 2NZ9A 5C3OA 1JOPA 1D0HA 1WD4A 2GC1A 2XVKA 4JDOA 4QX8A 2QQNA 4WZFA 3SHRA 3VBHA 4Z2AA 1MQTA 3KM5A 2WNVC 1LHVA 2A6VA 1L7LA 1WBFA 2GNTA 4V1PA 5LBBA 3VV1A 2ZAAA 1V6MA 4CCEA 3QH7A 3TN92 1SZBA 3SCFA 1RVF1 1XNTA 3AKSA 4YM1A 1RUH3 3I7DA 1GOFA 1WCKA 3LA3A 3RYRA 2WABA 2YB7A 4AQ2A 2RR11 3VDBA 4A7YA 1MS4A 1YFXA 2YHJA 3THTA 4MVTA 2XJRA 1QQP1 2H0VA 4DUXA 2VU9A 5DDJ2 2BJSA 3SISA 1PGL1 2C24A 3AX4A 2ARAA 3AM2A 1HXS2 4KWLA 4TTGA 3J7HA 4BQXA 4HONA 1T2XA 4RGGA 1GWKA 4C91A 2RJ2A 5FCCA 1Y9MA 2WA4A 1UMZA 3B94A 4IEOA 4XETA 3RG0A 2WT2A 3UJOA 1OF4A 2ZEWA 3MPPG 5C8CC 4ZHNA 1DZTA 1VBA3 5EJZB 4LBJA 1PO22 1UOGA 2K9ZA 5EYYA 4GB33 3HPNA 2NP0A 4FAHA 2H6BA 5DMYA 2XJSA 5HCBA 1AR93 2JDUA 1O91A 1PNFA 4CXWA 1F15A 3NV4A 3U11A 4GMP0 1RC6A 2HJIA 4X8PA 1FMD1 4F83A 3T09A 1PZ7A 1SDWA 4HT1T 2LS6A 1RJ8A 4LOSA 3S7IA 1JUHA 2R1BA 4ITCA 3UK9A 4NPMA 3VDAA 3WNOA 4AEKA 5IVBA 3U4XA 2A3XA 1ND2C 2O1QA 1DLCA 3DECA 1ZZ9A 2EIEA 3I4IA 1GP6A 3RYKA 1Y9QA 4AAPA 3BUCA 3MPBA 3BTYA 5GLVA 3SXWA 4Q4W1 4DUVA 4E2GA 3V65A 1YQCA 4Z1VA 3X29B 5JZGA 3IPVB 3WLUA 2EALA 1BEV1 1ASJ3 3I2FA 3IMMA 4EZHA 1SMVA 1WW6A 3V56A 2BP6A 4XUQA 3VBHB 5LW9A 3E5UA 1MQTB 1W2NA 3UYJA 4MO3M 1JI6A 5T3NA 4QX3A 1DFQA 4XOGA 3M3OA 2VZOA 5A7SA 2VZRA 3T08A 2JB4A 4QM9A 4IGOA 1C8NA 4CDXC 1EP0A 5FXZA 4AEDC 3RVHA 2VQAA 4OHYA 4F7ZA 2D6OX 2VNVA 1C8M2 1OQEA 4K8FA 4QGLA 3H1MA 4URTA 4YM0A 2P34A 3WHUA 3VUOA 1UW8A 1VBB1 5ABJA 3T4VA 4RSUA 3U1XA 1V9U3 5J7MA 3U78A 1LCLA 2HBTA 3ILRA 3H1YA 2YBSA 4A7ZA 2ET1A 4HVQA 4BQ3A 1W9TA 2Y6HA 3B5LB 1PIV3 1S0FA 3N9QA 5DZGA 1W9SA 5BNPA 2G9FA 4BZ4A 2WWUA 1VE0A 2XJVA 5F5AA 3VZKA 2R041 5JUVA 3N7MA 1FNYA 3VHNA 1IZ3A 4UW4A 1W8TA 3ZFGC 2W68A 1W39A 1HRI2 1QJY1 1YQ6A 1BBT3 1HIXA 2Y60A 3DL3A 2JG9C 2WRAA 1WW4A 3GHNA 5LY2A 2MEV1 4MYEA 4Q4V3 1HB3A 1ULCA 3R6SA 2E31A 5LK5A 1IS3A 2ETEA 1PX4A 3FLTA 2FDGA 4CCLA 1AR73 3AP4A 1U5YA 1VBC2 2ADEA 3NNMA 2E32A 3LE0A 4PI0A 1AXZA 2QZ3A 5F3IA 5FY5A 3JBG2 2HWF2 3AMMA 1LECA 1B09A 1HB2A 1R1A2 1W2AX 1HV1A 1S2EA 5TSWA 4BMBA 2JKXA 5LRRA 1T6GC 2CGOA 2JX9A 5LA1A 5FZKA 4B29A 4KGQA 3H50A 3VHRA 3OJBA 1PO11 3VBSC 1PZ9A 1H4GA 4JCKA 1J1LA 1PVC1 3K48A 3O14A 1PGSA 3ZYGA 3CDZB 2OUHA 5D21A 2DU1A 1RMU2 3PHMA 2KR2A 1WUVA 2UWAA 3QCWA 4BQ1A 4DQAA 4DXTA 2ZBJA 1S0IA 4CEYA 3NNLA 4YM2A 5BY5A 5FP9A 1AX2A 4MX3A 1OHFA 2PHWA 3D0JA 5ACA2 3S5AA 4W8JA 1YIPA 3LCPA 4RS5A 2EICA 3RJRA 3MLKA 2VQUA 4XILA 1MZFA 2WZR1 2A6WA 3AB0A 5DG1A 4YPJA 3N9PA 3WDXA 4FTSA 1W6MA 2BW8A 3OB8A 4O9EA 5LZ6A 5T52A 4QAWA 1N1SA 3OUIA 1HRV1 1GQGA 4XF3A 4B7KA 4C0HA 5I8YA 5J48A 1E5HA 1OT5A 2R32A 4YW7A 3FHQA 4QB2A 2JWPA 2W0XA 3MGUA 4BQ4A 4EWEA 4N53A 4LITA 2UWBA 2R30A 3WNNA 5FK8A 3HAGA 2PA7A 5BNPB 1EAH3 1J84A 4M00A 4Q4Y1 5A32A 2XKPA 4QPWA 5FZ8A 4CEWA 3K46A 4XURA 4A6SA 4AXOA 1KFUL 4C8DA 1KXGA 4KI5M 5FV3A 3LIGA 4K1YA 3LEIA 3LDRA 1DGRA 2YBPA 5F5IA 3CZUA 2F6BA 2DTYA 2XL9A 1Y9GA 4G9SB 4K9SA 4AEJA 4BWOA 2PQSA 4LBQA 3DXTA 3PLQA 4OULA 2HWE2 4JZRA 2VMIA 3IIIA 4OFGA 3Q8BA 3KV4A 4NRQA 5FZBA 3TRSB 1O5UA 1POQA 3GBFA 5I8SA 1XQNA 1IGOA 4Z07A 1LU1A 2E7AA 4BOWA 2EIGA 3MF9A 3N7JA 2RS51 4FBFA 3GF6A 3WW1A 5LB6A 4IV1C 3WCSA 5LEKA 3WQ0A 1KQRA 4PDWA 4UFJA 1CAXA 4E2QA 5A7PA 4ZU5A 4HN0A 3ZXJA 1OSGA 1BK1A 2CWMA 5JIAA 4ASMB 4JV4A 3U0ZA 2Q8EA 3GZAA 2XVGA 1YLLA 3IZOA 3OEAA 3I2IA 3R0RA 5FFOC 4X6RB 1VRH1 2W91A 5E1RA 1DDLA 1W05A 1JU3A 4LKSA 4CP0A 3ZSEA 4W65A 3JD72 4CEYB 2V09A 1VMJA 2ZEYA 3OG2A 1YUDA 4P9YA 2VZTA 4DS0A 3ZVXA 4OHWA 4JDMA 1N3OA 3LB9A 1O5LA 1LJ7A 3CU7A 1ZZ7A 1SBEA 2D40A 3GNEA 4RS5B 2VOTA 5FXVA 5AC93 4AK3A 3NRUA 1QH6A 2GN3A 1MQTC 2VW0A 5HCFA 3N36A 4ZONA 3NVCA 4HSJA 4YW2A 2XGXA 4XZPA 4AVSA 4D6RA 4Q27A 5IWFA 2XBO3 2P1BA 3ILFA 2G19A 2Z69A 3AKPA 1U0AA 2W1UA 4YGCA 3A4UA 2NQYA 3OYWA 4B1LA 1PHMA 2X09A 3ZLIA 5LA2A 3WY6A 4IE0A 2R061 4QX7A 3NJXA 1ST8A 2PLV1 3WG2A 3N9MA 3KCCA 2RMU3 5BNNA 3AFGA 1PNGA 4YZ4A 2GSYA 5A32B 4EZ4A 5K4LA 1XSRA 4QKNA 2XXZA 1F35A 4I09A 4MZUA 4M3CF 3O0VA 1BMV1 2ZHNA 1WLCA 3AP5A 4LBQB 4QX2A 4DUWA 5FQ0A 3ZYFA 1H1IA 4CE8A 2Q1MA 5EIYB 4DEVA 4Q0SA 4LO8A 3LF7A 2VOVA 3E6DA 3KS7A 1GZ9A 2JB8A 3THDA 3WOGA 3VZLA 3K2OA 4GQ7A 5FLJA 2P17A 3RI9A 4PDWB 3HOBA 3MIBA 1CAXB 2LW8A 2O0OA 4Q0PA 1HQLA 1D4M2 2F17A 1YXWA 3JB8A 4RA0A 3VZOA 1F5JA 5IW0A 1XNAA 2AR6A 3THPA 4AQ6A 1I5PA 2I2SA 4ORFA 4RR3A 4CZSA 2YFUA 3E5QA 2HH9A 3PMEA 4E9KA 5FZOA 1QY4A 4V2WA 5KHKA 1AL22 3E97A 3KGZA 4FOQA 4XBQA 3N3HA 4S2DA 1D2SA 1SLLA 2BGOA 4UFKA 5FBJA 5CG8A 4C1WA 1A6CA 4IEUA 1OVPA 1UY3A 1UD1A 3G7DA 4IEQA 5F7UA 3NKGA 2DYCA 2ZGUA 5F37A 3HMYA 4QHBA 2D3RA 1GNYA 2D3SA 2D5FA 2DBIA 3NW4A 4KBZA 1COV2 4LEJA 1DF0A 4QD2A 4XFFA 4XMIA 2EA7A 3FFZA 4QU2A 3SH4A 3WUDA 1AR82 5AVPA 4LKFA 1VJ2A 2WO1A 3OYWB 2W1QA 2A70A 1OUXA 3ZMOA 2EIDA 4O61A 2JDYA 5A33A 3H42B 5AFBA 2Q5TA 2Y34A 2ENRA 4PLNA 4R9DA 5JOWA 4XJZA 1UYZA 1BBT1 5BNNB 5SV8A 4O9GA 5JXHA 1BCXA 4FPJA 4P9XA 5A3OA 1QOSA 3RGBA 3RMYA 1NCRA 4RQPA 3H0OA 5IJRA 3O1OA 1MS5A 1Z0HA 5BNPC 1LOEA 2YYOA 4L9BA 1WMEA 2HWC1 2OVUA 3B00A 4CCJA 3WNPA 3G6JB 4NRPA 4O65A 2D44A 5L36A 5FQ0B 1JZ3A 3U4SA 3T4HB 1WA6X 1W8FA 2RHPA 3A0NA 1XSQA 1OPMA 2OPWA 2VPVA 4RHV3 1RUI3 2D6KA 3AZWA 2R071 3WSOA 2VZ1A 4XF4A 3ACLA 5IFTA 1MVQA 1Q8QA 2ZX4A 3MICA 4INDA 4XJUA 1W6OA 3H3ZA 1QHDA 1G6NA 1BQPA 1RUC1 1EY2A 1RUJ3 1YC61 1YFUA 1DGRN 4GJYA 4IE6A 4N9IA 4R4XA 1HQNA 4RGAA 4BLIA 1OFSA 3BU7A 5FYCA 3BN6A 1ULPA 4M4PA 1TMF3 3QOPA 3QH6A 1ZA7A 3EJKA 1R081 1XNBA 3MO4A 1WD3A 4I02A 3ZXGA 1CGPA 3M3EA 4RR3B 5K9YA 4QQ2A 4H3WA 3B93A 1E57A 2EXHA 2GC3A 3GYDA 3I2DA 3CBNA 2VZPA 2YC4A 5FIXA 5FZOB 2IFWA 2WR9A 4JGZA 2BWCA 2B8MA 2VVFA 3RFRA 4AGVA 1BK0A 1JS9A 4Q1PA 1RJ7A 2WS91 3CIHA 4N7UA 2D43A 1AX1A 5IK7A 3DKQA 5F6LB 2DBNA 4BU2A 1SFNA 5D2AA 1QNYA 5KHGA 1M4WA 4Y1VA 2FDKA 1SACA 3CNAA 4WM8A 2ZGRA 5FMBA 4XPVA 1IKQA 4D94A 4Q0UA 3SKVA 3S57A 1LR5A 2GAUA 2ZTNA 2QQPA 1RUF2 1VBE1 5FYBA 3URFA 5GLZA 3LPGA 4KU8A 1WLTA 4FQ4A 5A33B 3WF2A 3HQXA 3DYPA 2XWBB 5F1RA 5LBEA 2GNMA 2DUOA 1GR3A 5FUNA 3D0SA 3B01A 5FK7A 1UZYA 3QACA 2J1RA 5CAZA 2VY0A 1NCRB 5FLIA 1RUG1 2VMFA 4LKDA 1RVF3 2FDHA 1RUH2 1TNFA 2W08A 3IDEA 2WQZC 3WW2A 5L19A 5FUIA 1XE8A 5JCTA 3IKWA 2RR13 1GP4A 2Z2SB 3LSDA 4LO4B 1HX6A 1I3HA 1LGNA 2CV6A 1QQP3 2AEYA 4LUKA 4COVA 4ATFA 3F95A 4EWDA 2RV9A 4QQHA 1HV0A 1HB1A 3ES4A 1C1LA 1LOFA 2B9UA 3DCQA 5JMOA 4WVZA 1RINA 3M8LA 1Y4WA 3SEEA 4I0WB 2HEYF 1SCSA 1UX6A 2BPA2 4LIVA 3ETQA 5CG9A 1VBA2 3ZIXA 5IK8A 3O1MA 4PT6A 3LOIA 4GB32 3USUA 1D4VB 1Z7S1 2WIIB 5FKCA 2AUYA 2XB6C 2W47A 2PAEA 4PDWC 3AMNA 5CKNA 5M0TA 1O7FA 1WW7A 3AYCA 4XFCA 1AR92 5C9AA 4COYA 4IERA 2XHNA 1CX4A 1JYCA 4JGZB 3OTFA 3SH5A 4XTMA 1S0CA 1FMD3 4QB1A 2RM23 1UPSA 4YNIA 1QH7A 2E7TA 2FCTA 1C28A 2FCVA 5A6YA 2QQOA 3WQBA 2ZHLA 1UIJA 4K7JA 4QMAA 1IHMA 4XF1A 2G9GA 2W2IA 4WM8B 1RUOA 4HK8A 5FPLA 1BJQA 5ANNA 4Q4W3 5IHRA 4HETA 3DPRA 4NIHA 3H3LA 1W2UA 3POYA 4LK7A 2OKXA 4A6OA 3O7OA 3AKTA 3PTRB 3PURA 2JE8A 5KC5A 2QFEA 1UXZA 4HOOA 4H7LA 4E8DA 1P8JA 1V6OA 1VB4A 3ZSLA 5CFCB 1ALYA 3FWEA 4JVAA 1REEA 3ZIWA 5IVEA 3PIJA 2HBUA 4ISQA 3WNLA 4ONUA 1E5IA 4FOWA 2VW1A 5GZEA 4A4AA 2DWRA 1SLBA 3VB9A 1VBB3 1VIWB 1W9FA 4UBHA 1ZRCA 5IAVA 5FAXA 4NMIA 1LOBA 1KJLA 1JYTA 3IIAA 1ZA4A 1R091 4D3WA 1PZ8A 3KGLA 2CAVA 4GWNA 3I3BA 3ZXDA 2W52A 3NMBA 1YQ2A 2YDEA 5ERLA 2UY8A 3KHBA 1UNBA 2XUEA 2BV4A 3OSDA 4CRQA 4MGTA 2WBKA 5IK5A 1GMMA 3I2HA 3POBA 5C70A 2R043 4EJRA 3KV9A 3MW4A 1GV9A 3NKTA 4LO6B 4ATEA 4B3NA 1LOGA 4HPKA 2VTFA 3LFMA 1S0GA 3USUB 5J96B 1WKYA 5F9TA 3UETA 1U5XA 1QJY3 1QDOA 3OGRA 4CDUA 5I8TA 4JKKA 4HG6B 3WG4A 4IEXA 2V5YA 1NY72 1ONAA 2PXJA 1ZBA2 2MEV3 4Q4V2 2OPKA 3ZFFC 5H9SA 1GOGA 4R8HA 1X9TA 1A3KA 2CNAA 4ES9A 1AR72 2XG3A 2LM3A 4FPLA 1I1EA 4LBQD 2VMEA 3NV2A 4PCRA 5FWEA 1AJOA 1V6NA 3T0DA 3WP3A 4XXPA 5ISLA 2BTVC 4IV3C 5DXDA 3PU8A 4Y1UA 1J3RA 2KXLA 5C71A 1S4CA 1GUIA 1W8UA 4OUMA 2Y26A 1PO13 2VOWA 4KG8A 3T2QA 5K8SA 4GH4C 1PVC3 4P9WA 1S2KA 5HBAA 5LCWL 4FTEA 3DPRB 4OZXA 2ZGNA 4LBOA 1G8WA 1K12A 5FYSA 2B45X 1YHFA 2UYAA 3PJQA 5FKBA 5FY7A 4ZY9A 1K45A 3UL2A 3TB0A 4ZKTB 4M4RA 1KITA 1RXFA 5CA6A 5FY8A 3WF4A 4RHV1 4S2FA 2WZR3 4GJZA 5K0UC 1WGPA 2ZGSA 2WAAA 3BB6A 4L2NA 5GLWA 4TXWA 5H9QA 3MFAA 3OBZA 3GCXA 1GU3A 5EHDA 5FDBA 1HRI1 1H2MA 3FUOA 2V73A 5BNNC 4K40A 4P9IA 5FPBA 1HRV3 2IXHA 1AYM2 1N1VA 2VG9A 4QM8A 1XXNA 4Q4X1 3AZZA 1J59A 2YMZA 1V6IA 1G86A 4FPKA 1TMF1 1QJZA 2DF7A 1EAH2 2CL2A 3I2GA 2JDPA 1DLLA 1JU4A 4Q4Y3 5FZCA 3ZXKA 3ZXAC 1JZ5A 1H4HA 1W8HA 5C3QA 1PGW1 4B7EA 1H8TA 5DAPA 4HPKB 1SDDB 1RUE1 4UXAA 4CDUB 3C7OA 4HVOA 3DYOA 4UFHA 2Q4SA 2QCSB 3NAPA 4KU7A 4QDSA 2BGPA 2NMOA 4NO4A 5FYZA 4E4SA 4RGKA 2Z5WA 2BNMA 2W95A 5FYMA 1RL3A 1VBD1 3ECQA 4KG0A 3EB7A 1EV11 5AVAA 4X6QB 2Z4FA 1V6JA 1UQXA 4XW3A 2RS53 3KQRA 2O8QA 1GBGA 4HANA 1MZ5A 2GP5A 4A44A 2TEPA 3VKMA 5FZ6A 2ZZJA 3BALA 4NPLA 3TOJA 4HK9A 4LNVA 2PHFA 4HKLA 1W0OA 4Y33A 2B42B 1ZBE1 4EN9B 3OPWA 2G4IA 3M3IA 4YLZA 4IUGA 4QPIA 1VRH3 4NHKA 4XQWA 5JLVA 3DEMA 3CHXA 1VMHA 4QDQA 2OX0A 4WM8C 4PLMA 4AHYA 1G9DA 5GLTA 4Y24A 4L97A 1PMHX 3WT3A 4N43C 4M3CE 4FP2A 4XQDA 1WLWA 2XWJB 2CGNA 2BQPA 3RSJA 2WQ4A 4LO5B 1CD3G 5JDBA 1O3QA 3N9OA 1O8SA 1LNSA 4FOVA 5AC92 1O4YA 1F8VA 2Z79A 4MHUA 3R4SA 5FTTC 3MIGA 3ZYBA 2WO7A 3L2YA 1MS3A 5CFCC 1GYKA 1I5ZA 2FDJA 1QWRA 1WBLA 2JEMA 3SQOA 2X05A 3IM0A 2XBO2 2RDSA 5B4XA 3USSA 1O8PA 5CNAA 4XFBA 2WZ8A 4CUGA 5J36A 3V0AA 1DG6A 3A21A 4W4ZA 4IESA 3LEKA 4CCKA 4D6QA 1CAVA 3WCRA 2R063 3HQUA 2PLV3 4FT8A 3CJIC 4MADA 4QKFA 3ZXFA 4B4PA 4MGQA 1AYN1 4EN0A 3I2KA 1AVBA 1H6YA 2RMU2 3OPTA 3O1PA 5JIUA 3RZZA 3PUIA 4YG6A 3OBTA 3ABZA 2AH2A 3UJQA 2RDRA 4Q0QA 3M3CA 3GZEA 4MH0E 4DXZA 3IDBB 3BYWA 1U5ZA 2JDHA 4MXWA 4CCOA 2BVVA 2RJLA 2YC2A 2RM21 5GZFA 5KHIA 3AKRA 4XC9A 3EHKA 5KBFA 3NAPB 3FLPA 4AI0A 2E26A 2IXJA 4WVVA 2NM1A 3H3UA 4A3ZA 1B35A 4Y5TA 5C4WC 2ZX0A 5A1AA 1RIRA 1S0DA 3WP5A 5IVFA 3MIEA 3Q8EA 4Y1XA 1X7NA 1AUYA 2GALA 3RDIA 4TSVA 5I0TA 1MS1A 4CDWA 1ZRFA 1NE4A 4AHXA 5A6QA 4XDQA 4DRVA 3TNPB 5JOXA 2GMMA 4S2HA 1TME1 4FPHA 4M0HA 5AFEA 2AENA 2VUCA 4COWA 4YGEA 4IE7A 3ZM8A 3QLQA 4CYDA 4QPIB 2PHXA 3HN3A 5FP3A 1JYXA 2DCYA 2BFUS 3HBZA 4OI1A 1LEDA 2WC2A 3I8TA 4DEQA 5FR3A 1ZVFA 4MHRA 3KT4A 3E6CC 2WN2A 3CL1A 4ARYA 3CKHA 1H2LA 3ZYJB 5L9BA 1XE7A 3BU0A 2J1VA 2JIGA 4YZ3A 4E27A 5HI0A 1TZOA 4NHYA 4UAPA 5FY4A 4UOJA 2VUDA 4JQRA 5T5JA 2GNBA 3LSEA 1Q8PA 2ET7A 5FZ1A 4BYYA 2XL7A 3WNKA 1RUD2 3HD8B 5FZ9A 1NXD1 3IT8A 3TYJA 1JZ7A 1YIFA 4R4ZA 4DIQA 2YGLA 4PBOA 1FATA 2VBBA 3V0AB 1KRIA 5JSOA 2J1TA 3HNBM 4NRMA 3HVDA 1POV3 2PAKA 3SNMA 1YEWA 2QQLA 1ENRA 1CAVB 4TWTA 2ZCWA 3UKTA 3WZ1A 5HV0A 5KC6A 4YZ2A 2CSGA 3RJ2X 5A7OA 5DG2A 4DOUA 2Y0IA 1WCQA 1V00A 5KXEA 1CPNA 1H30A 3GBWA 3GXUA 3QBQA 2ZGMA 2H0BA 4XJ9A 4BCUA 5C3PA 1UX7A 2Z42A 3NQHA 2JG8A 4JGYC 1TG7A 4A2UA 1BVVA 4QGMA 1K5MC 2HWC3 3O5SA 1VALA 2Y6JA 2DFBA 3AYDA 3FBYA 4IGPA 2E33A 4L0PA 2F4LA 1AZDA 2XLGA 3NJVA 4Y4YA 1RUI2 2XKOA 2HWB2 2R073 5FPZA 1AR63 1AL21 2QTWB 4XFGA 1US2A 3BTZA 1W8WA 1XYNA 5FZDA 4CDWB 4COUA 5JMCA 5JZGB 4GMP1 2SLIA 1RUC3 3NV1A 2P3IA 2WO3A 1AF9A 1DGLA 1TNRA 2VXRA 5FZLA 3OY8A 5D8AC 1JODA 3KQ4B 1CESA 3BI3A 5CFDA 4N9HA 4UW6A 2EXIA 1A8DA 4UFMA 4C1XA 1R083 2JD9A 3B3QE 2DVGA 2YUEA 2BEOA 2VBDA 2EAAA 2QQMA 2WFF3 1JTZX 1W6PA 4BQ5A 2ZS6B 2WT0A 3LPFA 4FP3A 4ZPIA 4OLLA 4IEZA 5G04L 3H7YA 4NWWA 3WP4A 1OKQA 3POFA 4MUVA 1GICA 2ZEXA 5ABJB 2YPJA 1LENA 5E88A 2WS93 5CVRA 1PMIA 1XNKA 2WSUA 4CCMA 4OVEA 1ODMA 2JDNA 3JCIA 2QKDA 4AW7A 4FPEA 3GDBA 4LBLA 4BE3A 2AZ5A 3DF0A 2OUJA 4EWAA 2ZABA 1Q8VA 3VDCA 4J1XA 4NWVA 2ZAHA 3C2UA 5I0DA 1VBE3 1JZ6A 4LLFA 1AJKA 4XCBA 2ZX1A 4CU7A 3KHCA 4JTOA 1Y3TA 2A7AA 5FYYA 3ELNA 3O0WA 1CIWA 1FT9A 1OXCA 2PN5A 4NIIA 3U37A 4AWDA 4LIUA 2H6CA 5LA0A 1QXRA 3ACGA 4H55A 4PJYA 1RUG3 1RVF2 3UGFA 3WDTA 2ATFA 4AFAA 2JG8B 4JHTA 5FMOS 4OI2A 5I0SA 4QPGA 4MLOA 4DY3A 2PHDA 2RR12 2OS2A 4N8MA 5T5PA 4YARA 1NCQA 1UYPA 1QQP2 4XEZA 4EN8B 2ZGQA 2XR4A 1PGL2 1LHNA 4BJ0A 2JDZA 3P3NA 1GNZA 3T3YA 2ZGLA 5F5QA 5A1FA 4DINB 3BOPA 3LEMA 4N7IA 1G7YA 2RS31 1J3QA 1KDKA 3AL6A 1X33A 5F39A 4FXKB 5JOYA 2RS11 5FOJB 2E6VA 1CZVA 1GZWA 2PYTA 5A7NA 4LE3A 1OPOA 2VVEA 2XJUA 5J1XA 4FSJA 2C4XA 3GBGA 1GLHA 2EAKA 2ADDA 3D4KA 2VJXA 3GGLA 2QQJA 1Z7S3 3OY8B 1MS9A 5FY0A 5CFDB 1F4AA 1VAVA 4CCCA 3I2OA 1KD7A 1ULDA 3VBRA 1ULFA 1HN1A 1W6PB 2WKKA 3N7KA 2XUMA 3A22A 3AKQA 3OGSA 3RZHA 3VBHC 1UL9A 4D7TA 1CN1A 1UOBA 4GA9A 2P37A 4OZOA 4QQLA 4OHVA 4FPGA 2OQ7A 3ENRA 1NLQA 4JC1A 4QHOA 4XBNA 1ND3A 1W6MB 4HVRA 2DVAA 4QQPA 1E5RA 2K46A 1RB8G 5FO9B 4FI9A 1QJX1 1UZVA 4BM8A 1NE6A 2WWSA 4G3YC 5GZDA 3AFKA 3FHAA 4UWDA 2AYHA 3BIWE 2HLEA 4FXGB 4N53B 4DPNA 3KWVA 4OCTA 5GJ6A 2WJSA 2FQPA 2DU0A 4Q4W2 5D1IA 5FP8A 1HDKA 3UT0A 1BEV2 1CJDA 4DO0A 5HPOA 2TBVA 4CP2A 4CEWB 4LR4A 3I59A 4GAZA 3MIFA 4PQQA 3BGAA 2Y38A 3K77A 3VBFA 5APAA 1DQ5A 5A3UA 2OA2A 3JZVA 4JKLA 1H9WA 1XC6A 2ARXA 4QB6A 1HN0A 5I93A 4ZU7A 4P5YA 1OOPA 3GJBA 4LKEA 2X8KA 3C7HA 4QKDA 3CLPA 3LWCA 2XDVA 1TVGA 5DQ0A 3KCYA 2D5HA 4L11A 1HQWA 2E9QA 3ZSMA 4QPGB 2WSVA 1QXPA 1OLMA 1UN1A 4YRDA 2X29A 1VBB2 1DP0A 5BNOA 1JYNA 1NCQB 5A70A 4EYUA 5JI9A 4H14A 1TQ5A 2N7GA 1R093 2HEWF 4I2OA 5A7QA 2VMDA 2JXAA 1OFNA 3P3PA 1QJU1 4OHXA 3C8XA 4K21A 2P3KA 1YWKA 1SBDA 2EF6A 1ULOA 4JTNA 3B9CA 3ZYIB 1SG3A 1W6NA 4P02B 4Y3OA 3O12A 1GZWB 1QKQA 4XUTA 3HEIA 3VD5A 3ZN4A 2W87A 4MGSA 5T54A 4A3XA 5EWSA 5JOZA 4OUEA 5HCAA 1CZTA 3ZN5A 4YVSA 3ETPA 3KZ4C 1V6LA 1QJY2 5JZGC 2W3JA 1JOJA 1LHUA 4J6GA 4Y5Z0 1W03A 4JQTA 3T0BA 4YYOA 1JZ4A 4TLGA 2ZXQA 5A80A 3VBRB 3PVEA 2MEV2 1W8NA 1NUKA 3LEGA 5JWPA 2FBEA 4HN1A 4LK6A 2V4AA 4GIQA 3VD9A 3WG3A 1NQDA 5E89A 4GALA 4XFIA 2DCTA 4D7YA 3VBOA 1VB2A 5FPUA 2PFWA 4XF0A 4AFMA 1ND3B 1ENSA 5FJHA 3T0AA 3S7EA 4AI1A 5FY9A 2NYYA 1JYWA 1WCSA 4CU9A 3LA2A 2ORXA 3KT7A 3WF3A 3LZZA 3NV3A 1POV1 3KD4A 4SLIA 1PO12 4Q8KA 5ABJC 5GLUA 5A3TA 4RYDA 4DXRA 1PVC2 3VZNA 1RGSA 1W0PA 1YNAA 5IAXA 4B1MA 2BGCA 3LIHA 1ULEA 3MFCA 4UYBA 4XMAA 3WW4A 3ES1A 1S1AA 4LO7A 4FTBA 3I59B 2IXKA 3UGGA 3VBFB 2F4PA 3OPZA 1OH3A 1SBFA 4U36A 4NN0A 1IS5A 3MW3A 4CVUA 4CDQA 3CO2A 3ON7A 1C5HA 1HLCA 4QKBA 4D8MA 4CP9A 5C5UA 2HWD1 1OOPB 4NHLA 2R6QA 4YG3A
chains in the Genus database with same CATH topology
4TTGA 3J7HA 1K42A 4A41A 1T2XA 2RJ2A 3W5NA 1OF4A 2ZEWA 3I3BA 5EJZB 1GQPA 2VMCA 4QX1A 1YQ2A 4XUOA 2C26A 3HPNA 3C7GA 2WBKA 1GMMA 3I2HA 5C70A 3SEPA 5DMYA 2VTFA 1WKYA 3UETA 4LQRA 2VM9A 3OGRA 4JKKA 4HG6B 3T09A 1W9WA 1GOGA 1KEXA 5CYYA 2LS6A 3WNOA 3VDAA 2ID4A 2VMEA 1DLCA 3DECA 2EIEA 4QDRA 3T0DA 4E8CA 4DUVA 5C71A 1GUIA 3I2FA 3SKJE 2V5DA 3T2QA 4XUNA 1OD3A 4XUQA 5LCWL 4KWUA 3THCA 1NKGA 4LHSA 5IFPA 4MO3M 1JI6A 1K12A 4QX3A 2VZOA 2CDPA 2VZRA 3T08A 2DCJA 4CUCA 4ZY9A 4DXSA 3K75B 1K45A 4M4RA 2VCCA 2VL4A 4GZ9A 3WF4A 1UZ0A 2BERA 1L7RA 2WAAA 2XONA 4W50A 4TXWA 1UY0A 1GU3A 1W9TA 1W99A 2V4VA 2Y6HA 3LQCA 1CX1A 5JXIA 2XQXA 1R64A 1W9SA 5JUVA 1PMJX 1L7QA 3VD7A 2J1UA 1UY4A 3WF1A 4A42A 3I2GA 1JZ5A 1JU4A 4A45A 1O59A 5HXMA 2QBXA 2DCKA 1SDDB 2E31A 1UXXX 1PX4A 2DDUA 3K4DA 2E32A 2BZDA 3LE0A 3C7OA 3DYOA 4P00B 4QDSA 2BGPA 2Y8KA 1W0NA 2JKXA 2W95A 1KGYA 5LA1A 3ECQA 2VZVA 3EB7A 2VO5A 2Z4FA 1UYYA 4A44A 3CDZB 4DXTA 1GOHA 1XPWA 3I3DA 3T2PA 4ET7A 2VCBA 3K4AA 4IUGA 4QDQA 4W8JA 2EIBA 5B4NA 2EICA 1PMHX 1CIYA 2VQUA 3CZJA 2QQKA 1OH4A 2WDBA 4YPJA 1O8SA 1LNSA 3OB8A 4XVHA 1SHWB 1US3A 4ZZ8A 4QAWA 2J7MA 2X05A 1CZSA 1OT5A 3FHQA 4QB2A 5B4XA 1O8PA 2WZ8A 3WNNA 3A21A 4W4ZA 1J84A 3LEKA 3OGVA 4QPWA 3K46A 4XURA 4MADA 4KI5M 4CUBA 4MGQA 2WAOA 3I2KA 5DN2A 1H6YA 3LEIA 2JDAA 2VR4A 3CZUA 3PUIA 3ABZA 2PQSA 3IAQA 3IIIA 4BK5A 3HNYM 2YC2A 3C7FA 1EUUA 2Y6KA 3HJRA 3F2ZA 2E26A 4A3ZA 2BBAA 5A1AA 2Y6GA 2V72A 2B9VA 3ACIA 2J1SA 2VQTA 2ZEZA 3UNPA 2J1AA 2W94A 3OEAA 3I2IA 5JXGA 2W91A 3P6BA 1JU3A 4LKSA 3D3AA 1UY2A 2ZEYA 3OG2A 3P1IA 3ZM8A 3JXSA 2VZTA 2W1SA 3HN3A 3I97A 1JYXA 3EYPA 3CMGA 4DEQA 2VZSA 2VOTA 2WN2A 4ARYA 3CKHA 3NRUA 2J1VA 4UAPA 3NNGA 4UOJA 2QQIA 3WNKA 2W1UA 1JZ7A 3MV11 2X09A 5LA2A 1UMHA 3MUZ1 1NAEA 3NJXA 3HNMA 3MUY1 2J1TA 4OYUA 3HNBM 1JYVA 2QQLA 1D7PM 3IAPA 5IYYA 2R7EB 4BDVB 1WCQA 1W8OA 3GXUA 1BHGA 4DUWA 4QX2A 1UX7A 4CUAA 3NQHA 1TG7A 4P08A 2RVAA 3IB3A 3MBWA 5EIYB 4DEVA 2W5FA 2Y6JA 2E33A 4L0PA 3NJVA 3THDA 3WEZA 3WF0A 1JZ2A 3HOBA 4KMQA 2LW8A 2Y64A 1US2A 3DYMA 1NX9A 2VZ3A 2WUHA 5C7GA 1XNAA 1I5PA 2YFUA 2WO3A 3I3EA 4OMDA 1RYYA 2JD9A 2BGOA 3VD3A 2QQMA 3LPFA 1UY3A 5G04L 2W9XA 5F7UA 2HYXA 2YFZA 2ZEXA 1GNYA 2XOMA 2W92A 3A7QA 3GM8A 2WO1A 2W1QA 4ARXA 5EJ1B 3GDBA 2EIDA 4BXSV 3FN9A 3VDCA 3UESA 1UYZA 2B4KA 4JX0A 2ORZA 5I0DA 1JZ6A 5JXHA 4CU7A 3W5MA 5IJRA 3IDAA 2WO2A 3C7EA 3U37A 3WNPA 5LA0A 3ACGA 2VZQA 1JZ3A 4OMCA 4BK4A 5CZKA 3WSOA 2VZ1A 2WN3A 5IFTA 2WYSA 4BJ0A 3VD4A 3OBAA 2Y6LA 3BN6A 3CQOA 1ULPA 4M4PA 1CZVA 3MO4A 5J1XA 3OEBA 1IQDC 2C4XA 2KD7A 2VJXA 3GGLA 2YC4A 2VZPA 2QQJA 1F4AA 1HN1A 3A22A 3OGSA 1UY1A 3CIHA 2VCAA 4OZOA 4CU8A 2VZUA 4JKMA 2X10A 3ACHA 4FI9A 4D0QA 4XZUG 4GWIA 3SKVA 3FHAA 4PF1A 5JR2A 2HLEA 3LPGA 3WF2A 4LPLA 3DYPA 5HPOA 5JXJA 3E1F1 4PQQA 4ZZ5A 2J1RA 3BGAA 3K77A 2J22A 1DYOA 2VMFA 1UWWA 4JKLA 4UI9L 1XC6A 3K4ZA 4QB6A 4QX0A 4P5YA 5FUIA 3C7HA 4ZXEA 4GWJA 3I2JA 1J83A 1TVGA 5DQ0A 2VC9A 4MOAA 2RV9A 4RN5A 2WQ8A 1DP0A 5JMOA 1JYNA 3SEEA 3A23A 3MV01 1OF3A 2VMDA 5G05L 4PT6A 3C8XA 4CU6A 5DPNA 1ULOA 1F4HA 1SG3A 4P02B 3VD5A 1JHJA 4XUTA 2W47A 2W1WA 3HEIA 2W87A 1MPXA 4MGSA 1H6XA 1UYXA 4OUEA 1CZTA 3ETPA 3AC0A 2XHNA 3WNMA 2W3JA 1PX3A 3T0BA 1JZ4A 2J1EA 2ZXQA 2L9LA 4QB1A 3PUHA 1W8NA 1NUKA 3LEGA 3VD9A 3ACFA 2QQOA 4AAXA 3WQBA 4AG4A 2C9KA 3T0AA 4XUPA 2CDOA 1JYWA 3FL7A 4CU9A 2ORXA 2QQNA 4Z2AA 5IHRA 3WF3A 3T2OA 1K3IA 4RYDA 2OKXA 4A6OA 4DXRA 2W46A 2JE8A 1UMIA 1UXZA 4JHZA 1XNTA 4E8DA 1P8JA 1EUTA 1GOFA 2WABA 2YB7A 3VDBA 2WZEA 4CVUA 3WNLA 4DUXA 2YG0A 4A4AA 4D8MA 1JZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TTG A;  3J7H A;  1K42 A;  4A41 A;  1T2X A;  2RJ2 A;  3W5N A;  1OF4 A;  2ZEW A;  3I3B A;  5EJZ B;  1GQP A;  2VMC A;  4QX1 A;  1YQ2 A;  4XUO A;  2C26 A;  3HPN A;  3C7G A;  2WBK A;  1GMM A;  3I2H A;  5C70 A;  3SEP A;  5DMY A;  2VTF A;  1WKY A;  3UET A;  4LQR A;  2VM9 A;  3OGR A;  4JKK A;  4HG6 B;  3T09 A;  1W9W A;  1GOG A;  1KEX A;  5CYY A;  2LS6 A;  3WNO A;  3VDA A;  2ID4 A;  2VME A;  1DLC A;  3DEC A;  2EIE A;  4QDR A;  3T0D A;  4E8C A;  4DUV A;  5C71 A;  1GUI A;  3I2F A;  3SKJ E;  2V5D A;  3T2Q A;  4XUN A;  1OD3 A;  4XUQ A;  5LCW L;  4KWU A;  3THC A;  1NKG A;  4LHS A;  5IFP A;  4MO3 M;  1JI6 A;  1K12 A;  4QX3 A;  2VZO A;  2CDP A;  2VZR A;  3T08 A;  2DCJ A;  4CUC A;  4ZY9 A;  4DXS A;  3K75 B;  1K45 A;  4M4R A;  2VCC A;  2VL4 A;  4GZ9 A;  3WF4 A;  1UZ0 A;  2BER A;  1L7R A;  2WAA A;  2XON A;  4W50 A;  4TXW A;  1UY0 A;  1GU3 A;  1W9T A;  1W99 A;  2V4V A;  2Y6H A;  3LQC A;  1CX1 A;  5JXI A;  2XQX A;  1R64 A;  1W9S A;  5JUV A;  1PMJ X;  1L7Q A;  3VD7 A;  2J1U A;  1UY4 A;  3WF1 A;  4A42 A;  3I2G A;  1JZ5 A;  1JU4 A;  4A45 A;  1O59 A;  5HXM A;  2QBX A;  2DCK A;  1SDD B;  2E31 A;  1UXX X;  1PX4 A;  2DDU A;  3K4D A;  2E32 A;  2BZD A;  3LE0 A;  3C7O A;  3DYO A;  4P00 B;  4QDS A;  2BGP A;  2Y8K A;  1W0N A;  2JKX A;  2W95 A;  1KGY A;  5LA1 A;  3ECQ A;  2VZV A;  3EB7 A;  2VO5 A;  2Z4F A;  1UYY A;  4A44 A;  3CDZ B;  4DXT A;  1GOH A;  1XPW A;  3I3D A;  3T2P A;  4ET7 A;  2VCB A;  3K4A A;  4IUG A;  4QDQ A;  4W8J A;  2EIB A;  5B4N A;  2EIC A;  1PMH X;  1CIY A;  2VQU A;  3CZJ A;  2QQK A;  1OH4 A;  2WDB A;  4YPJ A;  1O8S A;  1LNS A;  3OB8 A;  4XVH A;  1SHW B;  1US3 A;  4ZZ8 A;  4QAW A;  2J7M A;  2X05 A;  1CZS A;  1OT5 A;  3FHQ A;  4QB2 A;  5B4X A;  1O8P A;  2WZ8 A;  3WNN A;  3A21 A;  4W4Z A;  1J84 A;  3LEK A;  3OGV A;  4QPW A;  3K46 A;  4XUR A;  4MAD A;  4KI5 M;  4CUB A;  4MGQ A;  2WAO A;  3I2K A;  5DN2 A;  1H6Y A;  3LEI A;  2JDA A;  2VR4 A;  3CZU A;  3PUI A;  3ABZ A;  2PQS A;  3IAQ A;  3III A;  4BK5 A;  3HNY M;  2YC2 A;  3C7F A;  1EUU A;  2Y6K A;  3HJR A;  3F2Z A;  2E26 A;  4A3Z A;  2BBA A;  5A1A A;  2Y6G A;  2V72 A;  2B9V A;  3ACI A;  2J1S A;  2VQT A;  2ZEZ A;  3UNP A;  2J1A A;  2W94 A;  3OEA A;  3I2I A;  5JXG A;  2W91 A;  3P6B A;  1JU3 A;  4LKS A;  3D3A A;  1UY2 A;  2ZEY A;  3OG2 A;  3P1I A;  3ZM8 A;  3JXS A;  2VZT A;  2W1S A;  3HN3 A;  3I97 A;  1JYX A;  3EYP A;  3CMG A;  4DEQ A;  2VZS A;  2VOT A;  2WN2 A;  4ARY A;  3CKH A;  3NRU A;  2J1V A;  4UAP A;  3NNG A;  4UOJ A;  2QQI A;  3WNK A;  2W1U A;  1JZ7 A;  3MV1 1;  2X09 A;  5LA2 A;  1UMH A;  3MUZ 1;  1NAE A;  3NJX A;  3HNM A;  3MUY 1;  2J1T A;  4OYU A;  3HNB M;  1JYV A;  2QQL A;  1D7P M;  3IAP A;  5IYY A;  2R7E B;  4BDV B;  1WCQ A;  1W8O A;  3GXU A;  1BHG A;  4DUW A;  4QX2 A;  1UX7 A;  4CUA A;  3NQH A;  1TG7 A;  4P08 A;  2RVA A;  3IB3 A;  3MBW A;  5EIY B;  4DEV A;  2W5F A;  2Y6J A;  2E33 A;  4L0P A;  3NJV A;  3THD A;  3WEZ A;  3WF0 A;  1JZ2 A;  3HOB A;  4KMQ A;  2LW8 A;  2Y64 A;  1US2 A;  3DYM A;  1NX9 A;  2VZ3 A;  2WUH A;  5C7G A;  1XNA A;  1I5P A;  2YFU A;  2WO3 A;  3I3E A;  4OMD A;  1RYY A;  2JD9 A;  2BGO A;  3VD3 A;  2QQM A;  3LPF A;  1UY3 A;  5G04 L;  2W9X A;  5F7U A;  2HYX A;  2YFZ A;  2ZEX A;  1GNY A;  2XOM A;  2W92 A;  3A7Q A;  3GM8 A;  2WO1 A;  2W1Q A;  4ARX A;  5EJ1 B;  3GDB A;  2EID A;  4BXS V;  3FN9 A;  3VDC A;  3UES A;  1UYZ A;  2B4K A;  4JX0 A;  2ORZ A;  5I0D A;  1JZ6 A;  5JXH A;  4CU7 A;  3W5M A;  5IJR A;  3IDA A;  2WO2 A;  3C7E A;  3U37 A;  3WNP A;  5LA0 A;  3ACG A;  2VZQ A;  1JZ3 A;  4OMC A;  4BK4 A;  5CZK A;  3WSO A;  2VZ1 A;  2WN3 A;  5IFT A;  2WYS A;  4BJ0 A;  3VD4 A;  3OBA A;  2Y6L A;  3BN6 A;  3CQO A;  1ULP A;  4M4P A;  1CZV A;  3MO4 A;  5J1X A;  3OEB A;  1IQD C;  2C4X A;  2KD7 A;  2VJX A;  3GGL A;  2YC4 A;  2VZP A;  2QQJ A;  1F4A A;  1HN1 A;  3A22 A;  3OGS A;  1UY1 A;  3CIH A;  2VCA A;  4OZO A;  4CU8 A;  2VZU A;  4JKM A;  2X10 A;  3ACH A;  4FI9 A;  4D0Q A;  4XZU G;  4GWI A;  3SKV A;  3FHA A;  4PF1 A;  5JR2 A;  2HLE A;  3LPG A;  3WF2 A;  4LPL A;  3DYP A;  5HPO A;  5JXJ A;  3E1F 1;  4PQQ A;  4ZZ5 A;  2J1R A;  3BGA A;  3K77 A;  2J22 A;  1DYO A;  2VMF A;  1UWW A;  4JKL A;  4UI9 L;  1XC6 A;  3K4Z A;  4QB6 A;  4QX0 A;  4P5Y A;  5FUI A;  3C7H A;  4ZXE A;  4GWJ A;  3I2J A;  1J83 A;  1TVG A;  5DQ0 A;  2VC9 A;  4MOA A;  2RV9 A;  4RN5 A;  2WQ8 A;  1DP0 A;  5JMO A;  1JYN A;  3SEE A;  3A23 A;  3MV0 1;  1OF3 A;  2VMD A;  5G05 L;  4PT6 A;  3C8X A;  4CU6 A;  5DPN A;  1ULO A;  1F4H A;  1SG3 A;  4P02 B;  3VD5 A;  1JHJ A;  4XUT A;  2W47 A;  2W1W A;  3HEI A;  2W87 A;  1MPX A;  4MGS A;  1H6X A;  1UYX A;  4OUE A;  1CZT A;  3ETP A;  3AC0 A;  2XHN A;  3WNM A;  2W3J A;  1PX3 A;  3T0B A;  1JZ4 A;  2J1E A;  2ZXQ A;  2L9L A;  4QB1 A;  3PUH A;  1W8N A;  1NUK A;  3LEG A;  3VD9 A;  3ACF A;  2QQO A;  4AAX A;  3WQB A;  4AG4 A;  2C9K A;  3T0A A;  4XUP A;  2CDO A;  1JYW A;  3FL7 A;  4CU9 A;  2ORX A;  2QQN A;  4Z2A A;  5IHR A;  3WF3 A;  3T2O A;  1K3I A;  4RYD A;  2OKX A;  4A6O A;  4DXR A;  2W46 A;  2JE8 A;  1UMI A;  1UXZ A;  4JHZ A;  1XNT A;  4E8D A;  1P8J A;  1EUT A;  1GOF A;  2WAB A;  2YB7 A;  3VDB A;  2WZE A;  4CVU A;  3WNL A;  4DUX A;  2YG0 A;  4A4A A;  4D8M A;  1JZ8 A; 
#chains in the Genus database with same CATH topology
 2FMY A;  5EP9 A;  5L9V A;  3VBU A;  1K42 A;  4KL1 A;  4B4Q A;  5EZW A;  4AE2 A;  1FX5 A;  4W6W A;  5I91 A;  1AR6 1;  5KR7 A;  3RZG A;  4PBP A;  5EXO A;  1S2B A;  1DGW X;  1HRI 3;  4PQ9 A;  4FAG A;  4FCA A;  3MI8 A;  1GQP A;  1C57 A;  2PHT A;  1NLR A;  4YG0 A;  5BNO B;  1HRV 2;  1BKZ A;  4IEW A;  3BTX A;  3AJZ A;  1ZBA 1;  3FMG A;  4QWN A;  4BH9 A;  1GQH A;  4YVW A;  4Q4X 3;  3KVB A;  5F3C A;  3J8F 1;  3AVS A;  2P3J A;  4OI0 A;  4PIZ A;  4WVW A;  4AI9 A;  3MHZ A;  3JUU A;  1H1M A;  4Q4Y 2;  1W6N B;  1FNZ A;  2WFF 1;  1RHI 1;  4F8A A;  1IPJ A;  1FPN 1;  1CAU A;  1W9W A;  1W90 A;  3OF1 A;  5DAQ A;  1FOD 1;  1RUE 3;  4YVS B;  5DAW A;  5F5C A;  3U07 A;  3LDB A;  2WNU A;  2ID4 A;  3GZT B;  2DFC A;  1F2N A;  4B8E A;  3WNX A;  4CEY C;  1LUL A;  5CIR A;  1DQ2 A;  1RMU 3;  3AYA A;  4QDR A;  4E8C A;  5CFD C;  5FRA A;  2BYV E;  4ASL A;  2A5Z A;  1VBD 3;  2CU5 A;  5LBF A;  1WCU A;  2EXK A;  4RS5 C;  1JYV A;  3MZH A;  1EV1 3;  3MF6 A;  1PM4 A;  5A3N A;  5ACA 3;  2X5I A;  1OMI A;  4XUN A;  4I0B A;  4XIK A;  5I0U A;  1V0A A;  2E51 A;  1W8Z A;  3MID A;  2YY1 A;  4LHS A;  4NUB A;  3THC A;  4Q0V A;  3RZL A;  1RTV A;  3PTY A;  2XVL A;  1ZBE 3;  4OUS A;  2DCJ A;  4IET A;  4DXS A;  3PUQ A;  2XJP A;  5FZF A;  3JU9 A;  1YQ8 A;  4N53 C;  2WNV A;  4RQP B;  2VL4 A;  2GC0 A;  1WA4 A;  4GZ9 A;  4V2V A;  3T30 A;  2ZGO A;  4AGG A;  4AVA A;  4NOT A;  4OHZ A;  1VRB A;  4CEW C;  4M01 A;  1NA1 A;  1IS4 A;  3FE5 A;  4CP9 B;  1Y7B A;  2PMW B;  4MV2 A;  4AF9 A;  3DN7 A;  1W99 A;  2ZMN A;  4IEP A;  3Q8A A;  3RS6 A;  3VBU B;  1GAN A;  4OQ8 A;  4AVC A;  2WNO A;  1WCD J;  5EQU A;  2OT7 A;  1X9P A;  4E4H A;  5F32 A;  3D6E A;  2FHR A;  5A1L A;  1LES A;  3VKN A;  1NZI A;  3SLI A;  1MEC 1;  4LHK A;  1L7Q A;  1OA3 A;  1BLZ A;  1W6O B;  1ZRR A;  2A71 A;  4XFH A;  3VD7 A;  3CJX A;  5A7W A;  4CA9 A;  3IBM A;  4KNC A;  4AQS A;  3ZSK A;  3WF1 A;  4A42 A;  4YVW B;  3ZKY A;  3OUJ A;  1O59 A;  2R06 2;  2CHH A;  3ROU A;  2CWS A;  2PLV 2;  1NCQ C;  3ZOI A;  2QBX A;  2OYZ A;  1AYN 3;  3PUS A;  4GUL A;  5C8C A;  5IT6 A;  3J26 N;  1NLS A;  2PEL A;  2DDU A;  4RL7 A;  3S0M A;  1LEM A;  2JE7 A;  3K4D A;  3H8O A;  2BZD A;  2WZP P;  2BDR A;  1CAU B;  4P00 B;  2C9A A;  2IFR A;  4YM3 A;  5IVJ A;  3ZR5 A;  1W0N A;  2VTX A;  3I49 A;  2WNU B;  2QZ2 A;  1BMV 2;  1KGY A;  5FZE A;  2VNO A;  3BPZ A;  1M06 G;  2KA3 A;  4UT5 A;  1O3R A;  1DBN A;  3TN9 1;  1XYP A;  4QXB A;  2OZJ A;  4W6Y A;  4QQO A;  2ZMK A;  1JOB A;  3M7A A;  1GOH A;  3I3D A;  3T2P A;  4ET7 A;  3LKJ A;  3AZV A;  3PMS A;  2VCB A;  3ZDS A;  3L9J T;  1S0J A;  1ASJ 2;  3VDD A;  1QJF A;  3W20 A;  5FZI A;  1ND3 C;  5DDJ 1;  2EIB A;  5B4N A;  1TME 3;  4ERO A;  1LKN A;  1VAM A;  1HB4 A;  4AFD A;  1HXS 1;  4EQV A;  1FYU A;  1CIY A;  1ODN A;  4BLJ A;  1AXK A;  3ALQ A;  4BIS A;  3CZJ A;  2QQK A;  4DMI A;  2RJK A;  3IMN A;  4GKX A;  4JAA A;  4WVM A;  3TEX A;  1OH4 A;  2WDB A;  3B9I A;  4BHP A;  1G9F A;  3JQX A;  1WMD A;  2CYF A;  2WNV B;  3H9A A;  3WVJ A;  3ZPY A;  2BBV A;  5FMC A;  2BFU L;  5FMD A;  3PVN A;  1MR5 A;  1PO2 1;  1QGL A;  2VCM A;  4XJA A;  5FZ3 A;  3WQ7 A;  4CDX A;  4RD7 A;  5DUU A;  1NA1 B;  4AED A;  4Y26 A;  1CZS A;  2ZGK A;  4XDO A;  3VBF C;  1V9U 2;  5KXC A;  3ZO0 B;  3KMH A;  2ZHM A;  1O3S A;  2FCU A;  1CWP A;  2CAU A;  1OOP C;  3HQR A;  3IN9 A;  3OGV A;  1DU3 D;  1PIV 2;  2D7F A;  4AL9 A;  5LRS A;  2GH8 A;  1UO9 A;  1UAI A;  1Q3E A;  5DN2 A;  2VD7 A;  5A7W B;  3SIT A;  4IL7 A;  4NID A;  1BVP 1;  2WT1 A;  1DQ0 A;  4PF5 A;  4XIO A;  3AYE A;  1GWL A;  4LBM A;  4XDP A;  4BK5 A;  2JJ6 A;  1BBT 2;  1OQD A;  3ASI A;  5GAL A;  4K8R B;  3HNY M;  4NIA A;  1DHK B;  3ZFG A;  3PU3 A;  1KS5 A;  1FAY A;  4Z92 B;  3C7F A;  4JDN A;  5C9A B;  2Y6K A;  4MXV A;  3HJR A;  5FYT A;  4YZ1 A;  5A3P A;  2AEZ A;  2P6C A;  4RR3 C;  2BBA A;  4NPR A;  2HWC 2;  1WMF A;  4AVT A;  3ZX7 A;  2V72 A;  4AVV A;  4DFS A;  1EPZ A;  2CY6 A;  2QE3 A;  3PJY A;  5FXW A;  3N9N A;  3ZKU A;  3ACI A;  2J1S A;  3MYX A;  1G9B A;  2GZW A;  3J7L A;  3UNP A;  1FV2 A;  2W94 A;  3RYP A;  4LE4 A;  4GD4 A;  1SEF A;  2R07 2;  3M70 A;  5JXG A;  5C5T A;  4QU1 A;  1AL2 3;  2DTW A;  3P6B A;  2VEC A;  1C8M 1;  5FZG A;  3D3A A;  3VBS A;  1ENX A;  2D97 A;  3P1I A;  3JXS A;  3QD6 A;  1VP6 A;  1RUC 2;  4GMP 3;  4WZC A;  3I97 A;  4Y22 A;  3GJA A;  5FZ4 A;  5H9R A;  3VDD B;  4KH9 A;  5LWB A;  3EYP A;  1O3T A;  3ATG A;  2WL1 A;  1DCS A;  4L99 A;  4QGN A;  1LOD A;  1DZQ A;  2NLR A;  1R08 2;  2ZX3 A;  4FPO B;  3RI8 A;  4WVM B;  5A6X A;  5KWR A;  2XQR A;  4QXC A;  3O1R A;  1X50 A;  4LMF A;  3VL8 A;  2LTN A;  3H1W A;  3U75 A;  2P5B A;  3NNG A;  1W2T A;  1YFY A;  1UF2 C;  4FQZ A;  5A3L A;  2YPD A;  1JBC A;  2Q1F A;  5A3W A;  4ASK A;  2SBA A;  4CXX A;  3MV1 1;  4I01 A;  3RQ0 A;  1UMH A;  2VW2 A;  1NCR C;  4RQP C;  2JIC A;  1NAE A;  4AED B;  2WS9 2;  4R9C A;  1ULG A;  4NRO A;  5LY1 A;  1GSL A;  1N3P A;  1QEX A;  1W9Y A;  5JR7 B;  3HNM A;  4HLT A;  1KDM A;  4Y5S A;  4LOT A;  3MUY 1;  2J42 A;  4OYU A;  2QQW A;  1JXN A;  1RIT A;  1D7P M;  1VBC 1;  3KCX A;  3KSC A;  3NNF A;  2JDM A;  4IQP A;  4PIY A;  3VBU C;  2R7E B;  1X8M A;  5IYY A;  4K3U A;  2PAM A;  3JBG 1;  2HWF 1;  4A7K A;  1LHW A;  4BDV B;  1R1A 1;  4Q1R A;  2ZKL A;  1WWY A;  1A78 A;  3LAG A;  1NG0 A;  1W3V A;  3K3O A;  1GFF 2;  1DQ1 A;  2HWB 1;  4CUA A;  1UZZ A;  2Y0O A;  4HZF A;  1OLR A;  2IZW A;  4Q29 A;  4P08 A;  1Q56 A;  2RVA A;  3IB3 A;  3MBW A;  1I6X A;  3LGR A;  2W5F A;  3ZFG B;  5F2S A;  1WLD A;  4FPY A;  4CXY A;  2R1D A;  4FFH A;  3WR0 A;  1RMU 1;  1RUG 2;  4QXH A;  4XYX A;  4MGZ E;  2EVX A;  1S55 A;  1BXH A;  1VR3 A;  3D5O A;  4LOR A;  3VHO A;  4XAA A;  2YC0 A;  3MIH A;  1YI7 A;  5FMO L;  1UCX A;  5FZ0 A;  4XAE A;  5FOB B;  5ACA 1;  5BV6 A;  4KMQ A;  2Y64 A;  4JGZ C;  4JRL A;  3DYM A;  1U5I A;  4Y4R A;  4YW6 A;  3WDU A;  5C33 A;  1QIQ A;  1NX9 A;  2FMD A;  2VZ3 A;  2WNU C;  1SLI A;  2WUH A;  4COZ A;  2RS3 3;  4IV1 A;  2A3Y A;  2NMN A;  2ZML A;  4BXF A;  4JRA A;  1N1Y A;  2MNG A;  3I3E A;  3WX5 A;  5CBL A;  2DUR A;  2PTM A;  4CPB A;  2JDK A;  1RYY A;  2RS1 3;  1SPP A;  3PDQ A;  4PHZ A;  1H9P A;  3V64 A;  4MSV A;  5CU1 A;  4CTE A;  3WXP A;  3LA7 A;  3KB5 A;  1Z7S 2;  3NNJ A;  3BOW A;  1OD5 A;  3AL5 A;  5GKA C;  4DNY A;  3ILN A;  1CR7 A;  2HYX A;  4ISR A;  4QHZ A;  2XOM A;  5FZA A;  2VH9 A;  1RUF 3;  2VUA A;  2W92 A;  3DV8 A;  5BPX A;  1UU5 A;  5FLH A;  1AHS A;  3OGJ A;  2DVD A;  4UBG A;  1GZC A;  2FZ1 A;  4ARX A;  2VTX J;  4EN7 B;  4AI2 A;  2XJT A;  1LOA A;  4LA2 A;  1QJX 3;  2WFP A;  1VMF A;  1GNH A;  3FN9 A;  4Q26 A;  3VZM A;  3ZSJ A;  2HWE 1;  3UES A;  4MG2 A;  2B4K A;  2R0H A;  1NA1 C;  3POS A;  2ZAC A;  2YU1 A;  3VLB B;  3PL0 A;  1CVN A;  4X8N A;  2LUW A;  4QXK A;  4P14 A;  5HCH A;  3KV6 A;  2PQQ A;  1LOF C;  5KXD A;  2WO2 A;  5C8W A;  4OQ9 A;  4DY5 A;  1G9A A;  1Q8S A;  1IQA A;  1H8T B;  3RZK A;  3B69 A;  2VZQ A;  1RED A;  5BXX A;  1ZZB A;  5FYV A;  1DQ6 A;  1ZRD A;  4BK4 A;  5LBC A;  5C6C A;  1C3H A;  3W9A A;  1IPK A;  2D6L X;  3E5X A;  3VD4 A;  3JD7 1;  4HBN A;  3NJY A;  1O4T A;  4YGD A;  4D7S A;  3OBA A;  4AOC A;  2R0F A;  3OGG A;  1OBN A;  5C9A C;  1FI2 A;  3P5B A;  1DIW A;  1I9R A;  2DUQ A;  4P5H A;  1R09 2;  1XND A;  3MEP A;  4SBV A;  4IEV A;  1JN2 P;  1W06 A;  1K5J A;  1QJU 3;  1IQD C;  3CEW A;  4IV1 B;  2BWA A;  4KWK A;  2IXI A;  2P4E A;  2KD7 A;  3OD0 A;  5F6K A;  5FJK A;  3S5Q A;  2I45 A;  4BIF A;  2VOX A;  1LRH A;  1YYN A;  2ZGP A;  3U10 A;  1JH5 A;  1SPP B;  3V0B A;  1J3P A;  2IVI B;  4LA3 A;  1UY1 A;  1JW6 A;  3DPR C;  3VDD C;  2IVJ A;  3AZY A;  2D93 A;  3BVC A;  4RFR B;  4BQ2 A;  4CU8 A;  3O1S A;  2QNK A;  2VZU A;  3LOB A;  2X10 A;  4D0Q A;  2D6P A;  4HFS A;  3ST7 A;  4GWI A;  2QQV A;  2D3P A;  3S30 A;  3HR9 A;  2B7Y A;  2BVB A;  4FOY A;  4AFC A;  1C4R A;  1STM A;  1PM7 A;  2QJV A;  2BUK A;  1H0B A;  4UW5 A;  3H8X A;  3WUC A;  5J09 A;  4ZZ5 A;  1D0G A;  1HW5 A;  1BZW A;  2ZJC A;  4UI9 L;  2VXJ A;  4EV0 A;  1W6Q A;  1S0B A;  2Y33 A;  1LGC A;  4M3C A;  4ZXE A;  4GWJ A;  3H7J A;  1O6U A;  2QQU A;  1J83 A;  5JI7 A;  2VNR A;  4QPY A;  1D4M 1;  2VC9 A;  4MXW B;  4E4Z A;  4KGG A;  4AI8 A;  4XF9 A;  2HWD 3;  2GC2 A;  4RFT 0;  3TEW A;  1APN A;  2OZ6 A;  4K6B A;  2PHL A;  3R05 A;  2UYB A;  4RHV 2;  1XE0 A;  3D82 A;  1B35 B;  3MDP A;  1UU6 A;  4CDU C;  1OF3 A;  3H8R A;  4UFI A;  4KQ7 A;  5G05 L;  1QJE A;  2VQ0 A;  2R16 A;  2UU8 A;  4CU6 A;  1R1Z A;  1TE1 B;  4H2A A;  4G4F A;  3L2H A;  1F4H A;  1ZBA 3;  5L73 A;  1RUJ 2;  2WIN B;  4TLF A;  4Q4X 2;  2W1W A;  4XBL A;  3J8F 3;  4ZU4 A;  4XHB A;  1H6X A;  1L3J A;  2C5D A;  1UYX A;  1CJP A;  1UU4 A;  1YCI A;  5FZH A;  1TMF 2;  1COV 1;  4OI4 A;  2YZ4 A;  3AC0 A;  3SC7 X;  1ZYB A;  1AR8 1;  1PX3 A;  5E8A A;  1RHI 3;  1GP5 A;  1PGW 2;  2QVS B;  3ZFE A;  5BUV A;  5I0R A;  3V0B B;  1QXJ A;  1FPN 3;  2FDI A;  5DAX A;  5IUQ A;  1YQ5 A;  1FOD 3;  1RUE 2;  4N90 A;  5T50 A;  4AAX A;  3WIN E;  4HKW A;  1WW5 A;  2C9K A;  3E6B A;  2ZKN A;  4FPC A;  2Q30 A;  5DUV A;  3PIG A;  4AFB A;  1G9C A;  3FL7 A;  1VBD 2;  3T2T A;  3D8C A;  3N7L A;  1EV1 2;  3T2O A;  1IG0 A;  5FPX A;  1K3I A;  3DXU A;  2W46 A;  1QDC A;  1UMI A;  4EN6 B;  1YJL A;  1X36 A;  4JHZ A;  2RDN A;  4MET A;  4AQT A;  4IXL A;  4XTP A;  1EUT A;  3ZN6 A;  3M4F A;  2Q0A A;  1X8E A;  1ZBE 2;  5DAV A;  1SLC A;  2YU2 A;  4I30 A;  2WZE A;  3VKO A;  1OLM E;  5A3M A;  2NN8 A;  2YG0 A;  3O1T A;  1W6Q B;  1OA4 A;  1SLA A;  3HIF A;  4Z2W A;  1JZ8 A;  1RUN A;  2VAU A;  3AXD A;  3POG A;  1AYM 3;  1F9K A;  4M3C B;  5F3E A;  5DZF A;  3RMX A;  4A41 A;  5EJ3 A;  2P2K A;  1CAW A;  3AZX A;  3GHM A;  1H8T C;  3APB A;  3W5N A;  2XJQ A;  5IK4 A;  4QX1 A;  2VMC A;  3C3V A;  4XUO A;  3T1M A;  1YRZ A;  5FZ7 A;  2C26 A;  4HXC A;  1ZX5 A;  5HXV A;  3AJY A;  3C7G A;  3NWK A;  2Q8C A;  4BA6 A;  2VE1 A;  3RWK X;  4Z8B A;  5KHJ A;  4IW3 A;  4FVV A;  5DUW A;  3SEP A;  3VKL A;  3NAP C;  3PVB B;  1MEC 3;  3POJ A;  4WBB A;  3O1V A;  4XQ4 A;  2FZ2 A;  4DB5 A;  2YXS A;  2Y6F A;  2VM9 A;  4LQR A;  4KBB A;  1SLT A;  5FO8 B;  1F5F A;  4AVB A;  1AYN 2;  4ZXK A;  1QOO A;  1KEX A;  1MAC A;  2HYK A;  5CYY A;  1JYI A;  2YBK A;  3ZFE B;  4L92 A;  2LRP A;  1RUF 1;  1HJG A;  1DZR A;  1CPM A;  3I54 A;  3VKF C;  3KT1 A;  4QPI C;  3DGT A;  1H2K A;  5F3G A;  2QDN A;  1FMD 2;  4MGI E;  2RM2 2;  3BPS A;  4URA A;  3TEZ A;  1MZE A;  2E7Q A;  4XJ8 A;  3N4M A;  3M1H A;  5CAD A;  3SKJ E;  2V5D A;  4F3J A;  1A8M A;  3ZXE A;  4UFL A;  3TN9 3;  1OD3 A;  1SCR A;  4XE9 A;  4KWU A;  1NKG A;  1RUH 1;  3AP7 A;  2CTV A;  4MGY E;  5DUX A;  5IFP A;  5FP7 A;  2UY9 A;  5GZC A;  1POV 0;  1OUR A;  2CDP A;  1OVS A;  2MHF A;  5FUP A;  4NJ4 A;  2A1X A;  4CUC A;  4WM7 A;  5FP4 A;  3O1U A;  2ES3 A;  3K75 B;  5DDJ 3;  1OA2 A;  3ZN6 B;  1TME 2;  1AXY A;  1QU0 A;  2VCC A;  4CCD A;  1HXS 3;  4EE2 A;  1MS0 A;  2BRT A;  2X53 S;  3B7M A;  1KFX L;  2Q8D A;  4P9G A;  1VAK A;  1UZ0 A;  2BER A;  2TNF A;  2W39 A;  2K0G A;  4R52 A;  1L7R A;  2JKB A;  2VUL A;  1ZZ6 A;  2XON A;  4W50 A;  1UY0 A;  4TYS A;  3NL1 A;  2IXL A;  1OLQ A;  3EXU A;  5BNQ A;  2V4V A;  1VBA 1;  1XU2 A;  3JB4 C;  3LQC A;  1CX1 A;  5JXI A;  1PO2 3;  2XQX A;  1CAW B;  4GB3 1;  5DZE A;  1R64 A;  4Y1Z A;  1A34 A;  5GM0 A;  1ACC A;  3W58 A;  5B2G B;  1PMJ X;  1ZNP A;  2J1U A;  3LDK A;  1UY4 A;  1YI9 A;  2BNN A;  1AR9 1;  3J7N A;  5FYI A;  2LAL A;  2YGM A;  2HEV F;  4A45 A;  4GKY A;  4FFI A;  5FPA A;  5HXM A;  4GWM A;  5J98 B;  2DCK A;  3VGI A;  1B35 C;  2O8O A;  4BQY A;  4E2S A;  2WWJ A;  1N47 A;  1UKR A;  2ZA9 A;  3RNS A;  1ZRE A;  2R04 2;  1UXX X;  3KF5 A;  4TZD A;  3BOD A;  2WLP A;  1MVE A;  2ARB A;  2HKX A;  1UPI A;  3POW A;  4CDW C;  4YFW A;  2UWC A;  3I3M A;  1X82 A;  2Y8K A;  1XJA A;  4YW1 A;  3WV6 A;  5KHH A;  2ARC A;  2VZV A;  2VO5 A;  3FX3 A;  4XAC A;  1ASJ 1;  1H1A A;  2G1M A;  5FRE A;  1UYY A;  3ZFF A;  3KVA A;  4LHL A;  4ZS3 A;  4BME A;  2RG4 A;  1CON A;  2JEC A;  5IVY A;  2XPJ A;  2AC1 A;  3PVO A;  4NHX A;  1XPW A;  2NPI A;  1W04 A;  3RZJ A;  5CB7 A;  1UOJ A;  2YRO A;  3K4A A;  3NJZ A;  4BQW A;  4IV3 A;  2DCZ A;  2XML A;  3OOX A;  2GMP A;  2OW4 A;  1C8M 3;  3WDW A;  3VHP A;  5FY1 A;  5FXX A;  1V9U 1;  4GH4 A;  4YW5 A;  3TEY A;  4WM7 B;  4LT5 A;  1WMX A;  5K7P A;  2ZOE B;  1NT0 A;  1RUD 3;  3AMP A;  1XU1 A;  3FBM A;  3FUQ A;  4ZS2 A;  3WHT A;  4CPB D;  4XVH A;  1SHW B;  1US3 A;  4ZZ8 A;  1PIV 1;  2JEN A;  4M0N A;  4YSF A;  2RE9 A;  2J7M A;  2WNE A;  4CCN A;  4J25 A;  4IGQ A;  4AZZ A;  2WZR 2;  4LLO A;  3RRD A;  2BOI A;  4AGR A;  3M3Q A;  5K0U A;  5IVV A;  3ZR6 A;  4Q5O A;  1NXM A;  4CSW A;  2JG8 C;  2EXJ A;  2BU9 A;  3GAL A;  1IPS A;  1NY7 1;  2LRO A;  4Q4V 1;  5EYX A;  4CUB A;  2WAO A;  1LOC A;  3HT1 A;  1OQ1 A;  5T5L A;  4AEM A;  2JDA A;  2VR4 A;  1AR7 1;  1GZT A;  1VBC 3;  3W59 A;  3EMR A;  1W28 A;  1J1T A;  3JBG 3;  2HWF 3;  3J4U H;  3IAQ A;  2UUR A;  1R1A 3;  1XB9 A;  5CEH A;  5F2W A;  1N1T A;  5DAB A;  1PK6 A;  4LUL A;  4MGK E;  2HWB 3;  4FFG A;  1EUU A;  3POE A;  1XBF A;  1LU2 A;  3OUH A;  3F2Z A;  2AGS A;  3B02 A;  2A73 B;  2VUJ A;  2JE9 A;  1ENQ A;  3ITQ A;  2Y6G A;  1IS6 A;  4IEY A;  5J37 A;  2B9V A;  2GDF A;  4P9J A;  2VQT A;  1Q43 A;  2ZEZ A;  2ZHK A;  3VBO B;  2J1A A;  4D6S A;  3DKW A;  3ZFE C;  3ZFF B;  3POI A;  2B5H A;  5JVV A;  1CQ9 A;  2RS5 2;  2OII A;  5L7O A;  2WLQ A;  1UY2 A;  3VL9 A;  3TWI A;  4C90 A;  1WZX A;  2W1S A;  1JMU B;  3I3Q A;  2GND A;  2RS3 2;  3WDY A;  4IV3 B;  5CIS A;  2XH6 A;  4YZ5 A;  3FLR A;  3CMG A;  3GCW A;  4PLO A;  2DVF A;  2VZS A;  5BYN A;  1URX A;  2RS1 2;  1MS8 A;  4H7M A;  1VRH 2;  4LTA A;  1DQ4 A;  4LBK A;  4GH4 B;  1UKG A;  5L9R A;  4C0B A;  1LB2 A;  1QMJ A;  5EPA A;  2FDF A;  3NO8 A;  1AYM 1;  3N9L A;  3TAY A;  3H8U A;  4YGB A;  3HWJ A;  2QQI A;  3R4U A;  4CDQ B;  2IXC A;  3MLL A;  3ZYP A;  3W21 A;  5LK7 B;  1OUS A;  4NAO A;  3LFI A;  4N43 A;  3DUI A;  4UF0 A;  3UKN A;  3WDV A;  1EAH 1;  1NZC A;  2DV9 A;  2GU9 A;  3MUZ 1;  1IG3 A;  3O0X A;  3FFQ A;  1HKD A;  3KLS A;  1RXG A;  4Y1Y A;  3S6P A;  1W3X A;  3AP9 A;  3AMH A;  2VNG A;  3TBD A;  1XNC A;  4Y20 A;  5CKM A;  3PNA A;  3WG1 A;  3HN1 A;  5FWJ A;  5K0U B;  1XYO A;  5CFC A;  1UIK A;  3IAP A;  1QJX 2;  5LAS A;  3AMQ A;  2A3W A;  4QPG C;  2HWE 3;  2JIJ A;  4U2A A;  1W8O A;  5SV5 A;  3M2M A;  4IDZ A;  1BHG A;  3A0K A;  2QUO A;  3CF6 E;  3FC0 A;  1LGB A;  5EV7 A;  2WA3 A;  2D6N A;  4L8Q A;  4XHX A;  4K1Z A;  5IVC A;  3CJI A;  3RZM A;  1PVX A;  4AI3 A;  2XHK A;  1GWM A;  4LXL A;  1Z78 A;  1PK6 B;  1IOA A;  4LHN A;  3GZU C;  2BOJ A;  4HSL A;  1GKB A;  1XRU A;  1E5S A;  2ARE A;  5E16 A;  3J9S A;  3WEZ A;  2TUN A;  3WF0 A;  1NQJ A;  5FPV A;  2IC1 A;  1JZ2 A;  5JAX A;  3VN4 A;  4Q2F A;  4J1W A;  3INA A;  4S2G A;  2FD8 A;  1BYH A;  4XJW A;  1H8V A;  1AX0 A;  3K51 A;  3SMH A;  1QOT A;  3JD7 3;  3ME2 A;  5C7G A;  1JHN A;  1SFP A;  3VBR C;  2E63 A;  1V6K A;  1TEI A;  2GN7 A;  4PIX A;  5C4W A;  1ND2 A;  2X5I B;  3N35 A;  5L7O B;  4AHZ A;  2JD4 A;  2B39 A;  4OMD A;  5T5O A;  2VOK A;  3UKV A;  5AC9 1;  5JSP A;  3WD5 A;  1UZW A;  1NYW A;  3VD3 A;  1FV3 A;  1QJU 2;  1VPH A;  2R49 A;  1LHO A;  3MW2 A;  3U14 A;  4NAM A;  4NR1 A;  3EO6 A;  4IE5 A;  4XCA A;  2XBO 1;  2W9X A;  2OXB A;  1YJK A;  5LAT A;  1ZZC A;  3SH3 A;  1DYP A;  2YFZ A;  4W6X A;  1EYB A;  3ZMN A;  3R4D B;  1OC1 A;  3ZPO A;  3A7Q A;  4DZG A;  2I74 A;  3T1L A;  5A6Z A;  4NVP A;  4FPF A;  1HJF A;  4WM7 C;  3GM8 A;  4D69 A;  2B46 X;  2RMU 1;  4N43 B;  4UF0 B;  5H9P A;  4HKO A;  4UW3 A;  5T55 A;  2AAC A;  2I07 B;  1BEV 3;  5EJ1 B;  4BXS V;  1O4Z A;  1IKP A;  2ZGT A;  1SQ4 A;  4QT6 A;  3AK0 A;  4XFA A;  2A6X A;  3JQW A;  4JX0 A;  1OI6 A;  2ORZ A;  4K20 A;  4I3G A;  4PI2 A;  4Y20 B;  3SCG A;  3OD4 A;  4Q8L A;  2BNO A;  2P3Y A;  3W5M A;  1ZZ8 A;  5F8P A;  3IDA A;  3RWN A;  1LAJ A;  5BNO C;  3C7E A;  4AYU A;  3WW3 A;  5C8C B;  2IUW A;  1NOV A;  4OMC A;  1DGW A;  3CJI B;  4E4D X;  2ILM A;  3FJS A;  5CZK A;  5IAT A;  4TN7 A;  2C6S A;  2K2S A;  2WN3 A;  2JG9 A;  2WYS A;  4AHW A;  5LA9 A;  1YFW A;  2GME A;  3OCP A;  1D4M 3;  5FO7 B;  4BIO A;  2XLA A;  4NE9 A;  2HWD 2;  3BCW A;  4JGY A;  4BB3 A;  1C5I A;  3IDC B;  4LBN A;  3MLJ A;  3K3N A;  4DRR A;  4YVS C;  5C3R A;  1K5M A;  2IWG B;  3LD8 A;  2PHU A;  2Y6L A;  1XOY A;  3HT2 A;  4FFF A;  3CQO A;  1AR6 2;  1D2Q A;  3TNQ A;  2PHR A;  2VGD A;  2ZZQ A;  3OEB A;  5C4W B;  1ND2 B;  2P6H A;  3PUA A;  3VBO C;  5JPM B;  3WP6 A;  5J3U A;  2VMG A;  1RUD 1;  3J8F 2;  3Q8F A;  2Q1Z B;  1Y43 B;  2D6M A;  1C1F A;  1AL0 G;  3ZYR A;  1COV 3;  3FHI B;  2VCA A;  3VZJ A;  4CP1 A;  4IE4 A;  3HBK A;  5FYH A;  1UOF A;  1V70 A;  1AR8 3;  2WFF 2;  1RHI 2;  3IWZ A;  4WV8 A;  5D8A A;  1FPN 2;  1FXZ A;  3J7M A;  1QF3 A;  1FOD 2;  3ZYH A;  1QNW A;  4JKM A;  4KWJ A;  4R9A A;  3ACH A;  4CDX B;  2OQ6 A;  3Q8C A;  4XZU G;  4ES8 A;  5CKQ A;  2KM2 A;  4PF1 A;  1ZRI A;  3KF3 A;  4LJH A;  5JR2 A;  5JPN B;  5HV4 A;  3BKZ A;  3NST A;  4CDQ C;  5C3S A;  2DUP A;  3OBR A;  4LPL A;  4YW4 A;  4FO9 A;  1S0E A;  2A6Z A;  5JXJ A;  2QDR A;  3E1F 1;  3AP6 A;  3EBR A;  2G9Z A;  2ZX2 A;  2ZPX A;  2J22 A;  1DYO A;  2CGP A;  1UWW A;  1VBE 2;  4QX0 A;  3K4Z A;  4XXA A;  3ZXL A;  4HMZ A;  5FBZ A;  4NIG A;  1Q5O A;  1W2O A;  2C1F A;  4R9B A;  3BTA A;  4XAB A;  1RUI 1;  3ORJ A;  2D98 A;  2VVD A;  3WQ1 A;  3I2J A;  3KV5 A;  2E53 A;  2ERF A;  4YVW C;  4HL0 A;  1OKO A;  1J58 A;  1MZ6 A;  1YO8 A;  4MOA A;  1KS4 A;  3EQE A;  4O7X A;  4YWA A;  4AR2 A;  2A6Y A;  4YFZ A;  4GXL A;  4RN5 A;  1RUJ 1;  2WQ8 A;  5KXB A;  2JG9 B;  5E6H A;  1LTE A;  1SFY A;  2DVB A;  3A23 A;  3MV0 1;  1EPW A;  4JGY B;  1PK6 C;  5GZG A;  1U12 A;  1REF A;  4NHM A;  3UV9 A;  1K5M B;  3RPQ A;  5DPN A;  4LUM A;  1VLN A;  2GH2 A;  3AXE A;  5JSR A;  1JHJ A;  2VMH A;  2YV8 A;  4I3P A;  5EFU A;  5FYU A;  1MPX A;  2GP3 A;  1MEC 2;  3Q9O A;  1Q8O A;  4Z82 A;  3BIE A;  2VBP A;  1ZM1 A;  2O14 A;  1JUI A;  2MPF A;  4YW3 A;  3VBS B;  3WNM A;  4Y22 B;  2RDQ A;  1T6B X;  1H2N A;  2J1E A;  2L9L A;  5LEJ A;  2A75 A;  2X5I C;  3AVR A;  4I0A A;  3PUH A;  1F31 A;  5ANQ A;  5L7O C;  5FZM A;  4B4R A;  3UGH A;  3ACF A;  2C0Z A;  1DYK A;  5D8A B;  3SCH A;  4P9L A;  4AG4 A;  1N3Q A;  3IPV A;  1KJR A;  4BPZ A;  3ZDV A;  2Q8O A;  4XUP A;  2CDO A;  3FZ3 A;  2XLF A;  4QX5 A;  2WYF A;  2NZ9 A;  5C3O A;  1JOP A;  1D0H A;  1WD4 A;  2GC1 A;  2XVK A;  4JDO A;  4QX8 A;  2QQN A;  4WZF A;  3SHR A;  3VBH A;  4Z2A A;  1MQT A;  3KM5 A;  2WNV C;  1LHV A;  2A6V A;  1L7L A;  1WBF A;  2GNT A;  4V1P A;  5LBB A;  3VV1 A;  2ZAA A;  1V6M A;  4CCE A;  3QH7 A;  3TN9 2;  1SZB A;  3SCF A;  1RVF 1;  1XNT A;  3AKS A;  4YM1 A;  1RUH 3;  3I7D A;  1GOF A;  1WCK A;  3LA3 A;  3RYR A;  2WAB A;  2YB7 A;  4AQ2 A;  2RR1 1;  3VDB A;  4A7Y A;  1MS4 A;  1YFX A;  2YHJ A;  3THT A;  4MVT A;  2XJR A;  1QQP 1;  2H0V A;  4DUX A;  2VU9 A;  5DDJ 2;  2BJS A;  3SIS A;  1PGL 1;  2C24 A;  3AX4 A;  2ARA A;  3AM2 A;  1HXS 2;  4KWL A;  4TTG A;  3J7H A;  4BQX A;  4HON A;  1T2X A;  4RGG A;  1GWK A;  4C91 A;  2RJ2 A;  5FCC A;  1Y9M A;  2WA4 A;  1UMZ A;  3B94 A;  4IEO A;  4XET A;  3RG0 A;  2WT2 A;  3UJO A;  1OF4 A;  2ZEW A;  3MPP G;  5C8C C;  4ZHN A;  1DZT A;  1VBA 3;  5EJZ B;  4LBJ A;  1PO2 2;  1UOG A;  2K9Z A;  5EYY A;  4GB3 3;  3HPN A;  2NP0 A;  4FAH A;  2H6B A;  5DMY A;  2XJS A;  5HCB A;  1AR9 3;  2JDU A;  1O91 A;  1PNF A;  4CXW A;  1F15 A;  3NV4 A;  3U11 A;  4GMP 0;  1RC6 A;  2HJI A;  4X8P A;  1FMD 1;  4F83 A;  3T09 A;  1PZ7 A;  1SDW A;  4HT1 T;  2LS6 A;  1RJ8 A;  4LOS A;  3S7I A;  1JUH A;  2R1B A;  4ITC A;  3UK9 A;  4NPM A;  3VDA A;  3WNO A;  4AEK A;  5IVB A;  3U4X A;  2A3X A;  1ND2 C;  2O1Q A;  1DLC A;  3DEC A;  1ZZ9 A;  2EIE A;  3I4I A;  1GP6 A;  3RYK A;  1Y9Q A;  4AAP A;  3BUC A;  3MPB A;  3BTY A;  5GLV A;  3SXW A;  4Q4W 1;  4DUV A;  4E2G A;  3V65 A;  1YQC A;  4Z1V A;  3X29 B;  5JZG A;  3IPV B;  3WLU A;  2EAL A;  1BEV 1;  1ASJ 3;  3I2F A;  3IMM A;  4EZH A;  1SMV A;  1WW6 A;  3V56 A;  2BP6 A;  4XUQ A;  3VBH B;  5LW9 A;  3E5U A;  1MQT B;  1W2N A;  3UYJ A;  4MO3 M;  1JI6 A;  5T3N A;  4QX3 A;  1DFQ A;  4XOG A;  3M3O A;  2VZO A;  5A7S A;  2VZR A;  3T08 A;  2JB4 A;  4QM9 A;  4IGO A;  1C8N A;  4CDX C;  1EP0 A;  5FXZ A;  4AED C;  3RVH A;  2VQA A;  4OHY A;  4F7Z A;  2D6O X;  2VNV A;  1C8M 2;  1OQE A;  4K8F A;  4QGL A;  3H1M A;  4URT A;  4YM0 A;  2P34 A;  3WHU A;  3VUO A;  1UW8 A;  1VBB 1;  5ABJ A;  3T4V A;  4RSU A;  3U1X A;  1V9U 3;  5J7M A;  3U78 A;  1LCL A;  2HBT A;  3ILR A;  3H1Y A;  2YBS A;  4A7Z A;  2ET1 A;  4HVQ A;  4BQ3 A;  1W9T A;  2Y6H A;  3B5L B;  1PIV 3;  1S0F A;  3N9Q A;  5DZG A;  1W9S A;  5BNP A;  2G9F A;  4BZ4 A;  2WWU A;  1VE0 A;  2XJV A;  5F5A A;  3VZK A;  2R04 1;  5JUV A;  3N7M A;  1FNY A;  3VHN A;  1IZ3 A;  4UW4 A;  1W8T A;  3ZFG C;  2W68 A;  1W39 A;  1HRI 2;  1QJY 1;  1YQ6 A;  1BBT 3;  1HIX A;  2Y60 A;  3DL3 A;  2JG9 C;  2WRA A;  1WW4 A;  3GHN A;  5LY2 A;  2MEV 1;  4MYE A;  4Q4V 3;  1HB3 A;  1ULC A;  3R6S A;  2E31 A;  5LK5 A;  1IS3 A;  2ETE A;  1PX4 A;  3FLT A;  2FDG A;  4CCL A;  1AR7 3;  3AP4 A;  1U5Y A;  1VBC 2;  2ADE A;  3NNM A;  2E32 A;  3LE0 A;  4PI0 A;  1AXZ A;  2QZ3 A;  5F3I A;  5FY5 A;  3JBG 2;  2HWF 2;  3AMM A;  1LEC A;  1B09 A;  1HB2 A;  1R1A 2;  1W2A X;  1HV1 A;  1S2E A;  5TSW A;  4BMB A;  2JKX A;  5LRR A;  1T6G C;  2CGO A;  2JX9 A;  5LA1 A;  5FZK A;  4B29 A;  4KGQ A;  3H50 A;  3VHR A;  3OJB A;  1PO1 1;  3VBS C;  1PZ9 A;  1H4G A;  4JCK A;  1J1L A;  1PVC 1;  3K48 A;  3O14 A;  1PGS A;  3ZYG A;  3CDZ B;  2OUH A;  5D21 A;  2DU1 A;  1RMU 2;  3PHM A;  2KR2 A;  1WUV A;  2UWA A;  3QCW A;  4BQ1 A;  4DQA A;  4DXT A;  2ZBJ A;  1S0I A;  4CEY A;  3NNL A;  4YM2 A;  5BY5 A;  5FP9 A;  1AX2 A;  4MX3 A;  1OHF A;  2PHW A;  3D0J A;  5ACA 2;  3S5A A;  4W8J A;  1YIP A;  3LCP A;  4RS5 A;  2EIC A;  3RJR A;  3MLK A;  2VQU A;  4XIL A;  1MZF A;  2WZR 1;  2A6W A;  3AB0 A;  5DG1 A;  4YPJ A;  3N9P A;  3WDX A;  4FTS A;  1W6M A;  2BW8 A;  3OB8 A;  4O9E A;  5LZ6 A;  5T52 A;  4QAW A;  1N1S A;  3OUI A;  1HRV 1;  1GQG A;  4XF3 A;  4B7K A;  4C0H A;  5I8Y A;  5J48 A;  1E5H A;  1OT5 A;  2R32 A;  4YW7 A;  3FHQ A;  4QB2 A;  2JWP A;  2W0X A;  3MGU A;  4BQ4 A;  4EWE A;  4N53 A;  4LIT A;  2UWB A;  2R30 A;  3WNN A;  5FK8 A;  3HAG A;  2PA7 A;  5BNP B;  1EAH 3;  1J84 A;  4M00 A;  4Q4Y 1;  5A32 A;  2XKP A;  4QPW A;  5FZ8 A;  4CEW A;  3K46 A;  4XUR A;  4A6S A;  4AXO A;  1KFU L;  4C8D A;  1KXG A;  4KI5 M;  5FV3 A;  3LIG A;  4K1Y A;  3LEI A;  3LDR A;  1DGR A;  2YBP A;  5F5I A;  3CZU A;  2F6B A;  2DTY A;  2XL9 A;  1Y9G A;  4G9S B;  4K9S A;  4AEJ A;  4BWO A;  2PQS A;  4LBQ A;  3DXT A;  3PLQ A;  4OUL A;  2HWE 2;  4JZR A;  2VMI A;  3III A;  4OFG A;  3Q8B A;  3KV4 A;  4NRQ A;  5FZB A;  3TRS B;  1O5U A;  1POQ A;  3GBF A;  5I8S A;  1XQN A;  1IGO A;  4Z07 A;  1LU1 A;  2E7A A;  4BOW A;  2EIG A;  3MF9 A;  3N7J A;  2RS5 1;  4FBF A;  3GF6 A;  3WW1 A;  5LB6 A;  4IV1 C;  3WCS A;  5LEK A;  3WQ0 A;  1KQR A;  4PDW A;  4UFJ A;  1CAX A;  4E2Q A;  5A7P A;  4ZU5 A;  4HN0 A;  3ZXJ A;  1OSG A;  1BK1 A;  2CWM A;  5JIA A;  4ASM B;  4JV4 A;  3U0Z A;  2Q8E A;  3GZA A;  2XVG A;  1YLL A;  3IZO A;  3OEA A;  3I2I A;  3R0R A;  5FFO C;  4X6R B;  1VRH 1;  2W91 A;  5E1R A;  1DDL A;  1W05 A;  1JU3 A;  4LKS A;  4CP0 A;  3ZSE A;  4W65 A;  3JD7 2;  4CEY B;  2V09 A;  1VMJ A;  2ZEY A;  3OG2 A;  1YUD A;  4P9Y A;  2VZT A;  4DS0 A;  3ZVX A;  4OHW A;  4JDM A;  1N3O A;  3LB9 A;  1O5L A;  1LJ7 A;  3CU7 A;  1ZZ7 A;  1SBE A;  2D40 A;  3GNE A;  4RS5 B;  2VOT A;  5FXV A;  5AC9 3;  4AK3 A;  3NRU A;  1QH6 A;  2GN3 A;  1MQT C;  2VW0 A;  5HCF A;  3N36 A;  4ZON A;  3NVC A;  4HSJ A;  4YW2 A;  2XGX A;  4XZP A;  4AVS A;  4D6R A;  4Q27 A;  5IWF A;  2XBO 3;  2P1B A;  3ILF A;  2G19 A;  2Z69 A;  3AKP A;  1U0A A;  2W1U A;  4YGC A;  3A4U A;  2NQY A;  3OYW A;  4B1L A;  1PHM A;  2X09 A;  3ZLI A;  5LA2 A;  3WY6 A;  4IE0 A;  2R06 1;  4QX7 A;  3NJX A;  1ST8 A;  2PLV 1;  3WG2 A;  3N9M A;  3KCC A;  2RMU 3;  5BNN A;  3AFG A;  1PNG A;  4YZ4 A;  2GSY A;  5A32 B;  4EZ4 A;  5K4L A;  1XSR A;  4QKN A;  2XXZ A;  1F35 A;  4I09 A;  4MZU A;  4M3C F;  3O0V A;  1BMV 1;  2ZHN A;  1WLC A;  3AP5 A;  4LBQ B;  4QX2 A;  4DUW A;  5FQ0 A;  3ZYF A;  1H1I A;  4CE8 A;  2Q1M A;  5EIY B;  4DEV A;  4Q0S A;  4LO8 A;  3LF7 A;  2VOV A;  3E6D A;  3KS7 A;  1GZ9 A;  2JB8 A;  3THD A;  3WOG A;  3VZL A;  3K2O A;  4GQ7 A;  5FLJ A;  2P17 A;  3RI9 A;  4PDW B;  3HOB A;  3MIB A;  1CAX B;  2LW8 A;  2O0O A;  4Q0P A;  1HQL A;  1D4M 2;  2F17 A;  1YXW A;  3JB8 A;  4RA0 A;  3VZO A;  1F5J A;  5IW0 A;  1XNA A;  2AR6 A;  3THP A;  4AQ6 A;  1I5P A;  2I2S A;  4ORF A;  4RR3 A;  4CZS A;  2YFU A;  3E5Q A;  2HH9 A;  3PME A;  4E9K A;  5FZO A;  1QY4 A;  4V2W A;  5KHK A;  1AL2 2;  3E97 A;  3KGZ A;  4FOQ A;  4XBQ A;  3N3H A;  4S2D A;  1D2S A;  1SLL A;  2BGO A;  4UFK A;  5FBJ A;  5CG8 A;  4C1W A;  1A6C A;  4IEU A;  1OVP A;  1UY3 A;  1UD1 A;  3G7D A;  4IEQ A;  5F7U A;  3NKG A;  2DYC A;  2ZGU A;  5F37 A;  3HMY A;  4QHB A;  2D3R A;  1GNY A;  2D3S A;  2D5F A;  2DBI A;  3NW4 A;  4KBZ A;  1COV 2;  4LEJ A;  1DF0 A;  4QD2 A;  4XFF A;  4XMI A;  2EA7 A;  3FFZ A;  4QU2 A;  3SH4 A;  3WUD A;  1AR8 2;  5AVP A;  4LKF A;  1VJ2 A;  2WO1 A;  3OYW B;  2W1Q A;  2A70 A;  1OUX A;  3ZMO A;  2EID A;  4O61 A;  2JDY A;  5A33 A;  3H42 B;  5AFB A;  2Q5T A;  2Y34 A;  2ENR A;  4PLN A;  4R9D A;  5JOW A;  4XJZ A;  1UYZ A;  1BBT 1;  5BNN B;  5SV8 A;  4O9G A;  5JXH A;  1BCX A;  4FPJ A;  4P9X A;  5A3O A;  1QOS A;  3RGB A;  3RMY A;  1NCR A;  4RQP A;  3H0O A;  5IJR A;  3O1O A;  1MS5 A;  1Z0H A;  5BNP C;  1LOE A;  2YYO A;  4L9B A;  1WME A;  2HWC 1;  2OVU A;  3B00 A;  4CCJ A;  3WNP A;  3G6J B;  4NRP A;  4O65 A;  2D44 A;  5L36 A;  5FQ0 B;  1JZ3 A;  3U4S A;  3T4H B;  1WA6 X;  1W8F A;  2RHP A;  3A0N A;  1XSQ A;  1OPM A;  2OPW A;  2VPV A;  4RHV 3;  1RUI 3;  2D6K A;  3AZW A;  2R07 1;  3WSO A;  2VZ1 A;  4XF4 A;  3ACL A;  5IFT A;  1MVQ A;  1Q8Q A;  2ZX4 A;  3MIC A;  4IND A;  4XJU A;  1W6O A;  3H3Z A;  1QHD A;  1G6N A;  1BQP A;  1RUC 1;  1EY2 A;  1RUJ 3;  1YC6 1;  1YFU A;  1DGR N;  4GJY A;  4IE6 A;  4N9I A;  4R4X A;  1HQN A;  4RGA A;  4BLI A;  1OFS A;  3BU7 A;  5FYC A;  3BN6 A;  1ULP A;  4M4P A;  1TMF 3;  3QOP A;  3QH6 A;  1ZA7 A;  3EJK A;  1R08 1;  1XNB A;  3MO4 A;  1WD3 A;  4I02 A;  3ZXG A;  1CGP A;  3M3E A;  4RR3 B;  5K9Y A;  4QQ2 A;  4H3W A;  3B93 A;  1E57 A;  2EXH A;  2GC3 A;  3GYD A;  3I2D A;  3CBN A;  2VZP A;  2YC4 A;  5FIX A;  5FZO B;  2IFW A;  2WR9 A;  4JGZ A;  2BWC A;  2B8M A;  2VVF A;  3RFR A;  4AGV A;  1BK0 A;  1JS9 A;  4Q1P A;  1RJ7 A;  2WS9 1;  3CIH A;  4N7U A;  2D43 A;  1AX1 A;  5IK7 A;  3DKQ A;  5F6L B;  2DBN A;  4BU2 A;  1SFN A;  5D2A A;  1QNY A;  5KHG A;  1M4W A;  4Y1V A;  2FDK A;  1SAC A;  3CNA A;  4WM8 A;  2ZGR A;  5FMB A;  4XPV A;  1IKQ A;  4D94 A;  4Q0U A;  3SKV A;  3S57 A;  1LR5 A;  2GAU A;  2ZTN A;  2QQP A;  1RUF 2;  1VBE 1;  5FYB A;  3URF A;  5GLZ A;  3LPG A;  4KU8 A;  1WLT A;  4FQ4 A;  5A33 B;  3WF2 A;  3HQX A;  3DYP A;  2XWB B;  5F1R A;  5LBE A;  2GNM A;  2DUO A;  1GR3 A;  5FUN A;  3D0S A;  3B01 A;  5FK7 A;  1UZY A;  3QAC A;  2J1R A;  5CAZ A;  2VY0 A;  1NCR B;  5FLI A;  1RUG 1;  2VMF A;  4LKD A;  1RVF 3;  2FDH A;  1RUH 2;  1TNF A;  2W08 A;  3IDE A;  2WQZ C;  3WW2 A;  5L19 A;  5FUI A;  1XE8 A;  5JCT A;  3IKW A;  2RR1 3;  1GP4 A;  2Z2S B;  3LSD A;  4LO4 B;  1HX6 A;  1I3H A;  1LGN A;  2CV6 A;  1QQP 3;  2AEY A;  4LUK A;  4COV A;  4ATF A;  3F95 A;  4EWD A;  2RV9 A;  4QQH A;  1HV0 A;  1HB1 A;  3ES4 A;  1C1L A;  1LOF A;  2B9U A;  3DCQ A;  5JMO A;  4WVZ A;  1RIN A;  3M8L A;  1Y4W A;  3SEE A;  4I0W B;  2HEY F;  1SCS A;  1UX6 A;  2BPA 2;  4LIV A;  3ETQ A;  5CG9 A;  1VBA 2;  3ZIX A;  5IK8 A;  3O1M A;  4PT6 A;  3LOI A;  4GB3 2;  3USU A;  1D4V B;  1Z7S 1;  2WII B;  5FKC A;  2AUY A;  2XB6 C;  2W47 A;  2PAE A;  4PDW C;  3AMN A;  5CKN A;  5M0T A;  1O7F A;  1WW7 A;  3AYC A;  4XFC A;  1AR9 2;  5C9A A;  4COY A;  4IER A;  2XHN A;  1CX4 A;  1JYC A;  4JGZ B;  3OTF A;  3SH5 A;  4XTM A;  1S0C A;  1FMD 3;  4QB1 A;  2RM2 3;  1UPS A;  4YNI A;  1QH7 A;  2E7T A;  2FCT A;  1C28 A;  2FCV A;  5A6Y A;  2QQO A;  3WQB A;  2ZHL A;  1UIJ A;  4K7J A;  4QMA A;  1IHM A;  4XF1 A;  2G9G A;  2W2I A;  4WM8 B;  1RUO A;  4HK8 A;  5FPL A;  1BJQ A;  5ANN A;  4Q4W 3;  5IHR A;  4HET A;  3DPR A;  4NIH A;  3H3L A;  1W2U A;  3POY A;  4LK7 A;  2OKX A;  4A6O A;  3O7O A;  3AKT A;  3PTR B;  3PUR A;  2JE8 A;  5KC5 A;  2QFE A;  1UXZ A;  4HOO A;  4H7L A;  4E8D A;  1P8J A;  1V6O A;  1VB4 A;  3ZSL A;  5CFC B;  1ALY A;  3FWE A;  4JVA A;  1REE A;  3ZIW A;  5IVE A;  3PIJ A;  2HBU A;  4ISQ A;  3WNL A;  4ONU A;  1E5I A;  4FOW A;  2VW1 A;  5GZE A;  4A4A A;  2DWR A;  1SLB A;  3VB9 A;  1VBB 3;  1VIW B;  1W9F A;  4UBH A;  1ZRC A;  5IAV A;  5FAX A;  4NMI A;  1LOB A;  1KJL A;  1JYT A;  3IIA A;  1ZA4 A;  1R09 1;  4D3W A;  1PZ8 A;  3KGL A;  2CAV A;  4GWN A;  3I3B A;  3ZXD A;  2W52 A;  3NMB A;  1YQ2 A;  2YDE A;  5ERL A;  2UY8 A;  3KHB A;  1UNB A;  2XUE A;  2BV4 A;  3OSD A;  4CRQ A;  4MGT A;  2WBK A;  5IK5 A;  1GMM A;  3I2H A;  3POB A;  5C70 A;  2R04 3;  4EJR A;  3KV9 A;  3MW4 A;  1GV9 A;  3NKT A;  4LO6 B;  4ATE A;  4B3N A;  1LOG A;  4HPK A;  2VTF A;  3LFM A;  1S0G A;  3USU B;  5J96 B;  1WKY A;  5F9T A;  3UET A;  1U5X A;  1QJY 3;  1QDO A;  3OGR A;  4CDU A;  5I8T A;  4JKK A;  4HG6 B;  3WG4 A;  4IEX A;  2V5Y A;  1NY7 2;  1ONA A;  2PXJ A;  1ZBA 2;  2MEV 3;  4Q4V 2;  2OPK A;  3ZFF C;  5H9S A;  1GOG A;  4R8H A;  1X9T A;  1A3K A;  2CNA A;  4ES9 A;  1AR7 2;  2XG3 A;  2LM3 A;  4FPL A;  1I1E A;  4LBQ D;  2VME A;  3NV2 A;  4PCR A;  5FWE A;  1AJO A;  1V6N A;  3T0D A;  3WP3 A;  4XXP A;  5ISL A;  2BTV C;  4IV3 C;  5DXD A;  3PU8 A;  4Y1U A;  1J3R A;  2KXL A;  5C71 A;  1S4C A;  1GUI A;  1W8U A;  4OUM A;  2Y26 A;  1PO1 3;  2VOW A;  4KG8 A;  3T2Q A;  5K8S A;  4GH4 C;  1PVC 3;  4P9W A;  1S2K A;  5HBA A;  5LCW L;  4FTE A;  3DPR B;  4OZX A;  2ZGN A;  4LBO A;  1G8W A;  1K12 A;  5FYS A;  2B45 X;  1YHF A;  2UYA A;  3PJQ A;  5FKB A;  5FY7 A;  4ZY9 A;  1K45 A;  3UL2 A;  3TB0 A;  4ZKT B;  4M4R A;  1KIT A;  1RXF A;  5CA6 A;  5FY8 A;  3WF4 A;  4RHV 1;  4S2F A;  2WZR 3;  4GJZ A;  5K0U C;  1WGP A;  2ZGS A;  2WAA A;  3BB6 A;  4L2N A;  5GLW A;  4TXW A;  5H9Q A;  3MFA A;  3OBZ A;  3GCX A;  1GU3 A;  5EHD A;  5FDB A;  1HRI 1;  1H2M A;  3FUO A;  2V73 A;  5BNN C;  4K40 A;  4P9I A;  5FPB A;  1HRV 3;  2IXH A;  1AYM 2;  1N1V A;  2VG9 A;  4QM8 A;  1XXN A;  4Q4X 1;  3AZZ A;  1J59 A;  2YMZ A;  1V6I A;  1G86 A;  4FPK A;  1TMF 1;  1QJZ A;  2DF7 A;  1EAH 2;  2CL2 A;  3I2G A;  2JDP A;  1DLL A;  1JU4 A;  4Q4Y 3;  5FZC A;  3ZXK A;  3ZXA C;  1JZ5 A;  1H4H A;  1W8H A;  5C3Q A;  1PGW 1;  4B7E A;  1H8T A;  5DAP A;  4HPK B;  1SDD B;  1RUE 1;  4UXA A;  4CDU B;  3C7O A;  4HVO A;  3DYO A;  4UFH A;  2Q4S A;  2QCS B;  3NAP A;  4KU7 A;  4QDS A;  2BGP A;  2NMO A;  4NO4 A;  5FYZ A;  4E4S A;  4RGK A;  2Z5W A;  2BNM A;  2W95 A;  5FYM A;  1RL3 A;  1VBD 1;  3ECQ A;  4KG0 A;  3EB7 A;  1EV1 1;  5AVA A;  4X6Q B;  2Z4F A;  1V6J A;  1UQX A;  4XW3 A;  2RS5 3;  3KQR A;  2O8Q A;  1GBG A;  4HAN A;  1MZ5 A;  2GP5 A;  4A44 A;  2TEP A;  3VKM A;  5FZ6 A;  2ZZJ A;  3BAL A;  4NPL A;  3TOJ A;  4HK9 A;  4LNV A;  2PHF A;  4HKL A;  1W0O A;  4Y33 A;  2B42 B;  1ZBE 1;  4EN9 B;  3OPW A;  2G4I A;  3M3I A;  4YLZ A;  4IUG A;  4QPI A;  1VRH 3;  4NHK A;  4XQW A;  5JLV A;  3DEM A;  3CHX A;  1VMH A;  4QDQ A;  2OX0 A;  4WM8 C;  4PLM A;  4AHY A;  1G9D A;  5GLT A;  4Y24 A;  4L97 A;  1PMH X;  3WT3 A;  4N43 C;  4M3C E;  4FP2 A;  4XQD A;  1WLW A;  2XWJ B;  2CGN A;  2BQP A;  3RSJ A;  2WQ4 A;  4LO5 B;  1CD3 G;  5JDB A;  1O3Q A;  3N9O A;  1O8S A;  1LNS A;  4FOV A;  5AC9 2;  1O4Y A;  1F8V A;  2Z79 A;  4MHU A;  3R4S A;  5FTT C;  3MIG A;  3ZYB A;  2WO7 A;  3L2Y A;  1MS3 A;  5CFC C;  1GYK A;  1I5Z A;  2FDJ A;  1QWR A;  1WBL A;  2JEM A;  3SQO A;  2X05 A;  3IM0 A;  2XBO 2;  2RDS A;  5B4X A;  3USS A;  1O8P A;  5CNA A;  4XFB A;  2WZ8 A;  4CUG A;  5J36 A;  3V0A A;  1DG6 A;  3A21 A;  4W4Z A;  4IES A;  3LEK A;  4CCK A;  4D6Q A;  1CAV A;  3WCR A;  2R06 3;  3HQU A;  2PLV 3;  4FT8 A;  3CJI C;  4MAD A;  4QKF A;  3ZXF A;  4B4P A;  4MGQ A;  1AYN 1;  4EN0 A;  3I2K A;  1AVB A;  1H6Y A;  2RMU 2;  3OPT A;  3O1P A;  5JIU A;  3RZZ A;  3PUI A;  4YG6 A;  3OBT A;  3ABZ A;  2AH2 A;  3UJQ A;  2RDR A;  4Q0Q A;  3M3C A;  3GZE A;  4MH0 E;  4DXZ A;  3IDB B;  3BYW A;  1U5Z A;  2JDH A;  4MXW A;  4CCO A;  2BVV A;  2RJL A;  2YC2 A;  2RM2 1;  5GZF A;  5KHI A;  3AKR A;  4XC9 A;  3EHK A;  5KBF A;  3NAP B;  3FLP A;  4AI0 A;  2E26 A;  2IXJ A;  4WVV A;  2NM1 A;  3H3U A;  4A3Z A;  1B35 A;  4Y5T A;  5C4W C;  2ZX0 A;  5A1A A;  1RIR A;  1S0D A;  3WP5 A;  5IVF A;  3MIE A;  3Q8E A;  4Y1X A;  1X7N A;  1AUY A;  2GAL A;  3RDI A;  4TSV A;  5I0T A;  1MS1 A;  4CDW A;  1ZRF A;  1NE4 A;  4AHX A;  5A6Q A;  4XDQ A;  4DRV A;  3TNP B;  5JOX A;  2GMM A;  4S2H A;  1TME 1;  4FPH A;  4M0H A;  5AFE A;  2AEN A;  2VUC A;  4COW A;  4YGE A;  4IE7 A;  3ZM8 A;  3QLQ A;  4CYD A;  4QPI B;  2PHX A;  3HN3 A;  5FP3 A;  1JYX A;  2DCY A;  2BFU S;  3HBZ A;  4OI1 A;  1LED A;  2WC2 A;  3I8T A;  4DEQ A;  5FR3 A;  1ZVF A;  4MHR A;  3KT4 A;  3E6C C;  2WN2 A;  3CL1 A;  4ARY A;  3CKH A;  1H2L A;  3ZYJ B;  5L9B A;  1XE7 A;  3BU0 A;  2J1V A;  2JIG A;  4YZ3 A;  4E27 A;  5HI0 A;  1TZO A;  4NHY A;  4UAP A;  5FY4 A;  4UOJ A;  2VUD A;  4JQR A;  5T5J A;  2GNB A;  3LSE A;  1Q8P A;  2ET7 A;  5FZ1 A;  4BYY A;  2XL7 A;  3WNK A;  1RUD 2;  3HD8 B;  5FZ9 A;  1NXD 1;  3IT8 A;  3TYJ A;  1JZ7 A;  1YIF A;  4R4Z A;  4DIQ A;  2YGL A;  4PBO A;  1FAT A;  2VBB A;  3V0A B;  1KRI A;  5JSO A;  2J1T A;  3HNB M;  4NRM A;  3HVD A;  1POV 3;  2PAK A;  3SNM A;  1YEW A;  2QQL A;  1ENR A;  1CAV B;  4TWT A;  2ZCW A;  3UKT A;  3WZ1 A;  5HV0 A;  5KC6 A;  4YZ2 A;  2CSG A;  3RJ2 X;  5A7O A;  5DG2 A;  4DOU A;  2Y0I A;  1WCQ A;  1V00 A;  5KXE A;  1CPN A;  1H30 A;  3GBW A;  3GXU A;  3QBQ A;  2ZGM A;  2H0B A;  4XJ9 A;  4BCU A;  5C3P A;  1UX7 A;  2Z42 A;  3NQH A;  2JG8 A;  4JGY C;  1TG7 A;  4A2U A;  1BVV A;  4QGM A;  1K5M C;  2HWC 3;  3O5S A;  1VAL A;  2Y6J A;  2DFB A;  3AYD A;  3FBY A;  4IGP A;  2E33 A;  4L0P A;  2F4L A;  1AZD A;  2XLG A;  3NJV A;  4Y4Y A;  1RUI 2;  2XKO A;  2HWB 2;  2R07 3;  5FPZ A;  1AR6 3;  1AL2 1;  2QTW B;  4XFG A;  1US2 A;  3BTZ A;  1W8W A;  1XYN A;  5FZD A;  4CDW B;  4COU A;  5JMC A;  5JZG B;  4GMP 1;  2SLI A;  1RUC 3;  3NV1 A;  2P3I A;  2WO3 A;  1AF9 A;  1DGL A;  1TNR A;  2VXR A;  5FZL A;  3OY8 A;  5D8A C;  1JOD A;  3KQ4 B;  1CES A;  3BI3 A;  5CFD A;  4N9H A;  4UW6 A;  2EXI A;  1A8D A;  4UFM A;  4C1X A;  1R08 3;  2JD9 A;  3B3Q E;  2DVG A;  2YUE A;  2BEO A;  2VBD A;  2EAA A;  2QQM A;  2WFF 3;  1JTZ X;  1W6P A;  4BQ5 A;  2ZS6 B;  2WT0 A;  3LPF A;  4FP3 A;  4ZPI A;  4OLL A;  4IEZ A;  5G04 L;  3H7Y A;  4NWW A;  3WP4 A;  1OKQ A;  3POF A;  4MUV A;  1GIC A;  2ZEX A;  5ABJ B;  2YPJ A;  1LEN A;  5E88 A;  2WS9 3;  5CVR A;  1PMI A;  1XNK A;  2WSU A;  4CCM A;  4OVE A;  1ODM A;  2JDN A;  3JCI A;  2QKD A;  4AW7 A;  4FPE A;  3GDB A;  4LBL A;  4BE3 A;  2AZ5 A;  3DF0 A;  2OUJ A;  4EWA A;  2ZAB A;  1Q8V A;  3VDC A;  4J1X A;  4NWV A;  2ZAH A;  3C2U A;  5I0D A;  1VBE 3;  1JZ6 A;  4LLF A;  1AJK A;  4XCB A;  2ZX1 A;  4CU7 A;  3KHC A;  4JTO A;  1Y3T A;  2A7A A;  5FYY A;  3ELN A;  3O0W A;  1CIW A;  1FT9 A;  1OXC A;  2PN5 A;  4NII A;  3U37 A;  4AWD A;  4LIU A;  2H6C A;  5LA0 A;  1QXR A;  3ACG A;  4H55 A;  4PJY A;  1RUG 3;  1RVF 2;  3UGF A;  3WDT A;  2ATF A;  4AFA A;  2JG8 B;  4JHT A;  5FMO S;  4OI2 A;  5I0S A;  4QPG A;  4MLO A;  4DY3 A;  2PHD A;  2RR1 2;  2OS2 A;  4N8M A;  5T5P A;  4YAR A;  1NCQ A;  1UYP A;  1QQP 2;  4XEZ A;  4EN8 B;  2ZGQ A;  2XR4 A;  1PGL 2;  1LHN A;  4BJ0 A;  2JDZ A;  3P3N A;  1GNZ A;  3T3Y A;  2ZGL A;  5F5Q A;  5A1F A;  4DIN B;  3BOP A;  3LEM A;  4N7I A;  1G7Y A;  2RS3 1;  1J3Q A;  1KDK A;  3AL6 A;  1X33 A;  5F39 A;  4FXK B;  5JOY A;  2RS1 1;  5FOJ B;  2E6V A;  1CZV A;  1GZW A;  2PYT A;  5A7N A;  4LE3 A;  1OPO A;  2VVE A;  2XJU A;  5J1X A;  4FSJ A;  2C4X A;  3GBG A;  1GLH A;  2EAK A;  2ADD A;  3D4K A;  2VJX A;  3GGL A;  2QQJ A;  1Z7S 3;  3OY8 B;  1MS9 A;  5FY0 A;  5CFD B;  1F4A A;  1VAV A;  4CCC A;  3I2O A;  1KD7 A;  1ULD A;  3VBR A;  1ULF A;  1HN1 A;  1W6P B;  2WKK A;  3N7K A;  2XUM A;  3A22 A;  3AKQ A;  3OGS A;  3RZH A;  3VBH C;  1UL9 A;  4D7T A;  1CN1 A;  1UOB A;  4GA9 A;  2P37 A;  4OZO A;  4QQL A;  4OHV A;  4FPG A;  2OQ7 A;  3ENR A;  1NLQ A;  4JC1 A;  4QHO A;  4XBN A;  1ND3 A;  1W6M B;  4HVR A;  2DVA A;  4QQP A;  1E5R A;  2K46 A;  1RB8 G;  5FO9 B;  4FI9 A;  1QJX 1;  1UZV A;  4BM8 A;  1NE6 A;  2WWS A;  4G3Y C;  5GZD A;  3AFK A;  3FHA A;  4UWD A;  2AYH A;  3BIW E;  2HLE A;  4FXG B;  4N53 B;  4DPN A;  3KWV A;  4OCT A;  5GJ6 A;  2WJS A;  2FQP A;  2DU0 A;  4Q4W 2;  5D1I A;  5FP8 A;  1HDK A;  3UT0 A;  1BEV 2;  1CJD A;  4DO0 A;  5HPO A;  2TBV A;  4CP2 A;  4CEW B;  4LR4 A;  3I59 A;  4GAZ A;  3MIF A;  4PQQ A;  3BGA A;  2Y38 A;  3K77 A;  3VBF A;  5APA A;  1DQ5 A;  5A3U A;  2OA2 A;  3JZV A;  4JKL A;  1H9W A;  1XC6 A;  2ARX A;  4QB6 A;  1HN0 A;  5I93 A;  4ZU7 A;  4P5Y A;  1OOP A;  3GJB A;  4LKE A;  2X8K A;  3C7H A;  4QKD A;  3CLP A;  3LWC A;  2XDV A;  1TVG A;  5DQ0 A;  3KCY A;  2D5H A;  4L11 A;  1HQW A;  2E9Q A;  3ZSM A;  4QPG B;  2WSV A;  1QXP A;  1OLM A;  1UN1 A;  4YRD A;  2X29 A;  1VBB 2;  1DP0 A;  5BNO A;  1JYN A;  1NCQ B;  5A70 A;  4EYU A;  5JI9 A;  4H14 A;  1TQ5 A;  2N7G A;  1R09 3;  2HEW F;  4I2O A;  5A7Q A;  2VMD A;  2JXA A;  1OFN A;  3P3P A;  1QJU 1;  4OHX A;  3C8X A;  4K21 A;  2P3K A;  1YWK A;  1SBD A;  2EF6 A;  1ULO A;  4JTN A;  3B9C A;  3ZYI B;  1SG3 A;  1W6N A;  4P02 B;  4Y3O A;  3O12 A;  1GZW B;  1QKQ A;  4XUT A;  3HEI A;  3VD5 A;  3ZN4 A;  2W87 A;  4MGS A;  5T54 A;  4A3X A;  5EWS A;  5JOZ A;  4OUE A;  5HCA A;  1CZT A;  3ZN5 A;  4YVS A;  3ETP A;  3KZ4 C;  1V6L A;  1QJY 2;  5JZG C;  2W3J A;  1JOJ A;  1LHU A;  4J6G A;  4Y5Z 0;  1W03 A;  4JQT A;  3T0B A;  4YYO A;  1JZ4 A;  4TLG A;  2ZXQ A;  5A80 A;  3VBR B;  3PVE A;  2MEV 2;  1W8N A;  1NUK A;  3LEG A;  5JWP A;  2FBE A;  4HN1 A;  4LK6 A;  2V4A A;  4GIQ A;  3VD9 A;  3WG3 A;  1NQD A;  5E89 A;  4GAL A;  4XFI A;  2DCT A;  4D7Y A;  3VBO A;  1VB2 A;  5FPU A;  2PFW A;  4XF0 A;  4AFM A;  1ND3 B;  1ENS A;  5FJH A;  3T0A A;  3S7E A;  4AI1 A;  5FY9 A;  2NYY A;  1JYW A;  1WCS A;  4CU9 A;  3LA2 A;  2ORX A;  3KT7 A;  3WF3 A;  3LZZ A;  3NV3 A;  1POV 1;  3KD4 A;  4SLI A;  1PO1 2;  4Q8K A;  5ABJ C;  5GLU A;  5A3T A;  4RYD A;  4DXR A;  1PVC 2;  3VZN A;  1RGS A;  1W0P A;  1YNA A;  5IAX A;  4B1M A;  2BGC A;  3LIH A;  1ULE A;  3MFC A;  4UYB A;  4XMA A;  3WW4 A;  3ES1 A;  1S1A A;  4LO7 A;  4FTB A;  3I59 B;  2IXK A;  3UGG A;  3VBF B;  2F4P A;  3OPZ A;  1OH3 A;  1SBF A;  4U36 A;  4NN0 A;  1IS5 A;  3MW3 A;  4CVU A;  4CDQ A;  3CO2 A;  3ON7 A;  1C5H A;  1HLC A;  4QKB A;  4D8M A;  4CP9 A;  5C5U A;  2HWD 1;  1OOP B;  4NHL A;  2R6Q A;  4YG3 A; 
#chains in the Genus database with same CATH homology
 4TTG A;  3J7H A;  1K42 A;  4A41 A;  1T2X A;  2RJ2 A;  3W5N A;  1OF4 A;  2ZEW A;  3I3B A;  5EJZ B;  1GQP A;  2VMC A;  4QX1 A;  1YQ2 A;  4XUO A;  2C26 A;  3HPN A;  3C7G A;  2WBK A;  1GMM A;  3I2H A;  5C70 A;  3SEP A;  5DMY A;  2VTF A;  1WKY A;  3UET A;  4LQR A;  2VM9 A;  3OGR A;  4JKK A;  4HG6 B;  3T09 A;  1W9W A;  1GOG A;  1KEX A;  5CYY A;  2LS6 A;  3WNO A;  3VDA A;  2ID4 A;  2VME A;  1DLC A;  3DEC A;  2EIE A;  4QDR A;  3T0D A;  4E8C A;  4DUV A;  5C71 A;  1GUI A;  3I2F A;  3SKJ E;  2V5D A;  3T2Q A;  4XUN A;  1OD3 A;  4XUQ A;  5LCW L;  4KWU A;  3THC A;  1NKG A;  4LHS A;  5IFP A;  4MO3 M;  1JI6 A;  1K12 A;  4QX3 A;  2VZO A;  2CDP A;  2VZR A;  3T08 A;  2DCJ A;  4CUC A;  4ZY9 A;  4DXS A;  3K75 B;  1K45 A;  4M4R A;  2VCC A;  2VL4 A;  4GZ9 A;  3WF4 A;  1UZ0 A;  2BER A;  1L7R A;  2WAA A;  2XON A;  4W50 A;  4TXW A;  1UY0 A;  1GU3 A;  1W9T A;  1W99 A;  2V4V A;  2Y6H A;  3LQC A;  1CX1 A;  5JXI A;  2XQX A;  1R64 A;  1W9S A;  5JUV A;  1PMJ X;  1L7Q A;  3VD7 A;  2J1U A;  1UY4 A;  3WF1 A;  4A42 A;  3I2G A;  1JZ5 A;  1JU4 A;  4A45 A;  1O59 A;  5HXM A;  2QBX A;  2DCK A;  1SDD B;  2E31 A;  1UXX X;  1PX4 A;  2DDU A;  3K4D A;  2E32 A;  2BZD A;  3LE0 A;  3C7O A;  3DYO A;  4P00 B;  4QDS A;  2BGP A;  2Y8K A;  1W0N A;  2JKX A;  2W95 A;  1KGY A;  5LA1 A;  3ECQ A;  2VZV A;  3EB7 A;  2VO5 A;  2Z4F A;  1UYY A;  4A44 A;  3CDZ B;  4DXT A;  1GOH A;  1XPW A;  3I3D A;  3T2P A;  4ET7 A;  2VCB A;  3K4A A;  4IUG A;  4QDQ A;  4W8J A;  2EIB A;  5B4N A;  2EIC A;  1PMH X;  1CIY A;  2VQU A;  3CZJ A;  2QQK A;  1OH4 A;  2WDB A;  4YPJ A;  1O8S A;  1LNS A;  3OB8 A;  4XVH A;  1SHW B;  1US3 A;  4ZZ8 A;  4QAW A;  2J7M A;  2X05 A;  1CZS A;  1OT5 A;  3FHQ A;  4QB2 A;  5B4X A;  1O8P A;  2WZ8 A;  3WNN A;  3A21 A;  4W4Z A;  1J84 A;  3LEK A;  3OGV A;  4QPW A;  3K46 A;  4XUR A;  4MAD A;  4KI5 M;  4CUB A;  4MGQ A;  2WAO A;  3I2K A;  5DN2 A;  1H6Y A;  3LEI A;  2JDA A;  2VR4 A;  3CZU A;  3PUI A;  3ABZ A;  2PQS A;  3IAQ A;  3III A;  4BK5 A;  3HNY M;  2YC2 A;  3C7F A;  1EUU A;  2Y6K A;  3HJR A;  3F2Z A;  2E26 A;  4A3Z A;  2BBA A;  5A1A A;  2Y6G A;  2V72 A;  2B9V A;  3ACI A;  2J1S A;  2VQT A;  2ZEZ A;  3UNP A;  2J1A A;  2W94 A;  3OEA A;  3I2I A;  5JXG A;  2W91 A;  3P6B A;  1JU3 A;  4LKS A;  3D3A A;  1UY2 A;  2ZEY A;  3OG2 A;  3P1I A;  3ZM8 A;  3JXS A;  2VZT A;  2W1S A;  3HN3 A;  3I97 A;  1JYX A;  3EYP A;  3CMG A;  4DEQ A;  2VZS A;  2VOT A;  2WN2 A;  4ARY A;  3CKH A;  3NRU A;  2J1V A;  4UAP A;  3NNG A;  4UOJ A;  2QQI A;  3WNK A;  2W1U A;  1JZ7 A;  3MV1 1;  2X09 A;  5LA2 A;  1UMH A;  3MUZ 1;  1NAE A;  3NJX A;  3HNM A;  3MUY 1;  2J1T A;  4OYU A;  3HNB M;  1JYV A;  2QQL A;  1D7P M;  3IAP A;  5IYY A;  2R7E B;  4BDV B;  1WCQ A;  1W8O A;  3GXU A;  1BHG A;  4DUW A;  4QX2 A;  1UX7 A;  4CUA A;  3NQH A;  1TG7 A;  4P08 A;  2RVA A;  3IB3 A;  3MBW A;  5EIY B;  4DEV A;  2W5F A;  2Y6J A;  2E33 A;  4L0P A;  3NJV A;  3THD A;  3WEZ A;  3WF0 A;  1JZ2 A;  3HOB A;  4KMQ A;  2LW8 A;  2Y64 A;  1US2 A;  3DYM A;  1NX9 A;  2VZ3 A;  2WUH A;  5C7G A;  1XNA A;  1I5P A;  2YFU A;  2WO3 A;  3I3E A;  4OMD A;  1RYY A;  2JD9 A;  2BGO A;  3VD3 A;  2QQM A;  3LPF A;  1UY3 A;  5G04 L;  2W9X A;  5F7U A;  2HYX A;  2YFZ A;  2ZEX A;  1GNY A;  2XOM A;  2W92 A;  3A7Q A;  3GM8 A;  2WO1 A;  2W1Q A;  4ARX A;  5EJ1 B;  3GDB A;  2EID A;  4BXS V;  3FN9 A;  3VDC A;  3UES A;  1UYZ A;  2B4K A;  4JX0 A;  2ORZ A;  5I0D A;  1JZ6 A;  5JXH A;  4CU7 A;  3W5M A;  5IJR A;  3IDA A;  2WO2 A;  3C7E A;  3U37 A;  3WNP A;  5LA0 A;  3ACG A;  2VZQ A;  1JZ3 A;  4OMC A;  4BK4 A;  5CZK A;  3WSO A;  2VZ1 A;  2WN3 A;  5IFT A;  2WYS A;  4BJ0 A;  3VD4 A;  3OBA A;  2Y6L A;  3BN6 A;  3CQO A;  1ULP A;  4M4P A;  1CZV A;  3MO4 A;  5J1X A;  3OEB A;  1IQD C;  2C4X A;  2KD7 A;  2VJX A;  3GGL A;  2YC4 A;  2VZP A;  2QQJ A;  1F4A A;  1HN1 A;  3A22 A;  3OGS A;  1UY1 A;  3CIH A;  2VCA A;  4OZO A;  4CU8 A;  2VZU A;  4JKM A;  2X10 A;  3ACH A;  4FI9 A;  4D0Q A;  4XZU G;  4GWI A;  3SKV A;  3FHA A;  4PF1 A;  5JR2 A;  2HLE A;  3LPG A;  3WF2 A;  4LPL A;  3DYP A;  5HPO A;  5JXJ A;  3E1F 1;  4PQQ A;  4ZZ5 A;  2J1R A;  3BGA A;  3K77 A;  2J22 A;  1DYO A;  2VMF A;  1UWW A;  4JKL A;  4UI9 L;  1XC6 A;  3K4Z A;  4QB6 A;  4QX0 A;  4P5Y A;  5FUI A;  3C7H A;  4ZXE A;  4GWJ A;  3I2J A;  1J83 A;  1TVG A;  5DQ0 A;  2VC9 A;  4MOA A;  2RV9 A;  4RN5 A;  2WQ8 A;  1DP0 A;  5JMO A;  1JYN A;  3SEE A;  3A23 A;  3MV0 1;  1OF3 A;  2VMD A;  5G05 L;  4PT6 A;  3C8X A;  4CU6 A;  5DPN A;  1ULO A;  1F4H A;  1SG3 A;  4P02 B;  3VD5 A;  1JHJ A;  4XUT A;  2W47 A;  2W1W A;  3HEI A;  2W87 A;  1MPX A;  4MGS A;  1H6X A;  1UYX A;  4OUE A;  1CZT A;  3ETP A;  3AC0 A;  2XHN A;  3WNM A;  2W3J A;  1PX3 A;  3T0B A;  1JZ4 A;  2J1E A;  2ZXQ A;  2L9L A;  4QB1 A;  3PUH A;  1W8N A;  1NUK A;  3LEG A;  3VD9 A;  3ACF A;  2QQO A;  4AAX A;  3WQB A;  4AG4 A;  2C9K A;  3T0A A;  4XUP A;  2CDO A;  1JYW A;  3FL7 A;  4CU9 A;  2ORX A;  2QQN A;  4Z2A A;  5IHR A;  3WF3 A;  3T2O A;  1K3I A;  4RYD A;  2OKX A;  4A6O A;  4DXR A;  2W46 A;  2JE8 A;  1UMI A;  1UXZ A;  4JHZ A;  1XNT A;  4E8D A;  1P8J A;  1EUT A;  1GOF A;  2WAB A;  2YB7 A;  3VDB A;  2WZE A;  4CVU A;  3WNL A;  4DUX A;  2YG0 A;  4A4A A;  4D8M A;  1JZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...