5B4NA

Structure analysis of function associated loop mutant of substrate recognition domain of fbs1 ubiquitin ligase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
b'RNLLRNPCGEEDLEGWSLDVNGGDGWKVEELSRDQRKEFPNDQVKKYFVTSYYTCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRPDCGSKYQLTVRLLSENEDVLAEFQPDPATIQQKSDAKWREISHTFIDYGPGVRFVRFEHGGVDTHYWAGWYGPRVTNSSVWVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box only protein 2
publication title Structural analysis of a function-associated loop mutant of the substrate-recognition domain of Fbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 38
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5b4nA00
2J1SA 1HN1A 1W9SA 1K3IA 4LQRA 4BXSV 1LNSA 5JXJA 4A3ZA 4DUXA 1SHWB 4IUGA 2YG0A 1R64A 1UXZA 4BJ0A 4ARYA 3GM8A 3LQCA 3C7HA 2JKXA 4RN5A 4QB2A 2E31A 2E26A 3FL7A 3OGSA 4XUTA 1OT5A 3C8XA 3WNPA 2J22A 1IQDC 1W8OA 2ID4A 3A7QA 3I3EA 1GU3A 5IJRA 4P08A 5JUVA 4DEQA 4MO3M 1JYVA 5EJ1B 3K4DA 1UY2A 3DYPA 2ORZA 3OEAA 3NNGA 4YPJA 3WQBA 4CU6A 1EUTA 1UMHA 2Y64A 3GXUA 4OUEA 5JXIA 3D3AA 3T0BA 2XQXA 2WN3A 3LEGA 3THCA 4D8MA 1JZ6A 4AG4A 4DXSA 3OG2A 2W1QA 4OYUA 1UY0A 1GUIA 1H6XA 3MBWA 3NRUA 3SKVA 2QQNA 3I2GA 4JKMA 3VDCA 5C7GA 1OF3A 4QB1A 1W0NA 4QX0A 2BGOA 2QBXA 1DLCA 2X09A 2HLEA 2YFUA 3NJXA 4GZ9A 2Y6LA 4QAWA 3WF1A 3UETA 1JHJA 5CYYA 2VQUA 3VD4A 2QQMA 4JKLA 3ZM8A 2EICA 2WZEA 1J84A 5I0DA 3K46A 1TG7A 5IYYA 1W9WA 5LCWL 1JYNA 1JZ7A 5F7UA 5JR2A 3NJVA 2R7EB 1GMMA 3T09A 4CUAA 3I3DA 2XOMA 4AAXA 3SEEA 1EUUA 4QX1A 1CZVA 1L7QA 3ETPA 2Z4FA 3F2ZA 3T08A 2W3JA 1CZTA 4XUOA 2BZDA 1T2XA 3I2IA 4FI9A 3FHAA 3T0AA 4A45A 1ULPA 3CZUA 2RV9A 4L0PA 3GGLA 3W5MA 3THDA 3WF2A 1TVGA 5B4XA 1UYZA 3MO4A 4DEVA 3LPFA 4OZOA 1PX3A 2W1UA 4A42A 3CIHA 1K42A 1JYXA 1PMHX 2RVAA 4GWIA 2J1EA 3C7OA 2WUHA 3K4ZA 1WCQA 3ACFA 3HEIA 3FHQA 5HXMA 4A41A 1O8PA 4XUNA 5J1XA 2ZEXA 3MV01 3HN3A 2PQSA 2J1UA 3ABZA 3WSOA 5DN2A 4A4AA 4UI9L 3LPGA 3DYOA 2VZTA 1PMJX 1NKGA 1D7PM 3HNMA 4UAPA 1F4AA 4ZZ8A 5DPNA 2WO2A 4QDSA 2W47A 4JHZA 3MV11 2YB7A 4DXRA 1JU4A 3ACGA 4XVHA 2VZSA 2JDAA 2Y8KA 3E1F1 4MADA 2LW8A 2WN2A 4E8DA 1ULOA 4MGSA 1W9TA 2QQJA 3HNYM 5CZKA 2J1TA 3T2OA 3OEBA 4ARXA 4KI5M 2VM9A 2J1RA 1CX1A 2ZEYA 2VR4A 1I5PA 3ECQA 2J7MA 2VZOA 3LE0A 4OMCA 3A23A 1F4HA 3C7EA 3VD5A 1UYYA 2VZ3A 3OBAA 3WF4A 3A22A 4TXWA 2VZUA 1UWWA 2VZRA 2YC4A 4P02B 3CDZB 4BDVB 1GOHA 2Y6JA 4ZZ5A 1JZ4A 1OF4A 2VMCA 3AC0A 3MUZ1 1XNTA 2VO5A 4CUBA 4DUWA 2XONA 1PX4A 3I97A 2C26A 3CKHA 4CVUA 3IAQA 1J83A 3T2QA 4XUPA 1CIYA 2B4KA 3EYPA 2ORXA 2WAOA 2JD9A 4LKSA 3VD9A 2WBKA 2J1VA 2WDBA 3WF3A 1L7RA 5IFPA 1KGYA 5DMYA 3WEZA 3HNBM 4CUCA 4E8CA 2VMEA 1XC6A 1UXXX 4PT6A 2XHNA 2V4VA 4ET7A 2Y6GA 2YFZA 2VMFA 4LPLA 3HPNA 4PF1A 1XPWA 1GOFA 3IIIA 1JYWA 1UY3A 3WNKA 2V5DA 4GWJA 2VZVA 3W5NA 4QX3A 1YQ2A 3I2HA 3OGVA 3P6BA 1GQPA 2EIBA 5EIYB 2VMDA 5A1AA 2W1WA 3DYMA 4A44A 1W8NA 2JE8A 4XUQA 3CMGA 1JI6A 1UZ0A 1US2A 1SDDB 4HG6B 2X05A 4P5YA 4W4ZA 2DCJA 2WAAA 2W46A 3VDAA 4JX0A 2VTFA 1P8JA 2WZ8A 2RJ2A 2L9LA 3SKJE 2DDUA 3K4AA 2E33A 1OD3A 4RYDA 4CU8A 2X10A 3NQHA 1OH4A 3I3BA 2VJXA 3JXSA 2C9KA 5JXGA 5EJZB 3UESA 1JZ5A 1UY4A 1DYOA 2Y6KA 3C7FA 1WKYA 1H6YA 1UYXA 2E32A 2ZEZA 3CQOA 5LA2A 2V72A 2VC9A 3WNNA 3WNMA 2BERA 2VCCA 4PQQA 5DQ0A 5HPOA 2ZXQA 3K77A 4TTGA 2HYXA 2KD7A 2W91A 4UOJA 5G04L 2QQOA 4KWUA 2VZPA 2WO1A 1GNYA 4ZY9A 4Z2AA 2YC2A 2OKXA 5G05L 3CZJA 3VD7A 3WNLA 2W92A 5FUIA 2QQIA 2ZEWA 1W99A 4BK5A 2W1SA 4LHSA 4ZXEA 3IB3A 2W95A 1NX9A 3VD3A 1JZ3A 1GOGA 3T0DA 3VDBA 4XURA 3HJRA 3IAPA 2C4XA 3ACIA 1JZ2A 2VCAA 1XNAA 2QQKA 4OMDA 3U37A 5C70A 3PUIA 1JZ8A 1DP0A 3UNPA 3EB7A 1KEXA 1UY1A 1US3A 4MGQA 2DCKA 1UMIA 3J7HA 5JXHA 5LA1A 2VL4A 3MUY1 3OGRA 1NAEA 2CDOA 3OB8A 4M4PA 3FN9A 4JKKA 4QX2A 5IFTA 4M4RA 3LEKA 3K75B 1BHGA 5C71A 2VOTA 1O8SA 4W8JA 3BGAA 3HOBA 2WABA 1O59A 4QDRA 3IDAA 2BBAA 1SG3A 2B9VA 2VZQA 2Y6HA 2W5FA 1RYYA 3PUHA 3LEIA 3I2JA 3T2PA 4D0QA 2J1AA 4W50A 1JU3A 4DXTA 2WQ8A 4CU7A 4XZUG 3A21A 2WYSA 4QB6A 3ACHA 4DUVA 2VQTA 4A6OA 2VZ1A 5LA0A 3I2KA 5B4NA 3WNOA 3SEPA 4QPWA 2W94A 3P1IA 1MPXA 4BK4A 4P00B 1CZSA 2W87A 1K45A 3C7GA 2LS6A 3I2FA 4QDQA 2QQLA 2W9XA 2CDPA 5JMOA 4KMQA 5IHRA 2EIDA 2WO3A 4CU9A 3GDBA 3BN6A 2VCBA 3WF0A 1UX7A 1NUKA 1K12A 2EIEA 3DECA 4MOAA 2BGPA
chains in the Genus database with same CATH superfamily
1I1EA 3E5QA 4CCKA 4JGZA 1HN1A 5FP8A 4PIYA 4EROA 5FO9B 3NVCA 4BXSV 4XCAA 4BU2A 4JQTA 4GAZA 1W04A 3NNJA 1BBT1 2EVXA 2XKOA 3QACA 1RVF3 2OX0A 2WJSA 4S2GA 2QVSB 3GM8A 4HSLA 4ARYA 4D7SA 3LEMA 3GBFA 3LQCA 3BALA 5KHHA 2IXIA 1RUD2 3WR0A 1ZZ8A 1RUD3 3W59A 2E31A 2E26A 4MH0E 2D6KA 2BBVA 1GZCA 2MHFA 1ACCA 2ZZJA 1E57A 5J96B 2YMZA 1HV1A 1FAYA 3GZUC 2J22A 1YFUA 5JSRA 3G6JB 4NPMA 3FBYA 1LKNA 4NAMA 1VBB1 2YGLA 3PVNA 1Q56A 1ZZ6A 4BH9A 1CGPA 3V0AB 1VMJA 3CL1A 4BISA 2A70A 2ZJCA 5FXWA 5A3TA 1JYTA 2WZPP 1YQ6A 3FE5A 4FPGA 1YI7A 3AP4A 4F8AA 5F37A 1F35A 3POWA 3DF0A 4LOTA 5F3GA 5T3NA 3TRSB 3NAPA 4MO3M 1Q8SA 3EMRA 5KBFA 4TZDA 5DG2A 3O1OA 3K4DA 1TEIA 2NPIA 1PZ9A 3KS7A 1VBE1 2A6ZA 4IV1C 1KDMA 3T2TA 3NNGA 2JDUA 3VZOA 2G9ZA 2G1MA 4RS5A 1EUTA 4LBQD 3D8CA 1PGL1 5DZGA 1RINA 2Y64A 4PIZA 3KV9A 3GXUA 4H55A 4OUEA 1U5YA 2HEWF 1PIV2 4IERA 3QBQA 4L2NA 3T0BA 1WCUA 1FMD2 1PIV3 4FFIA 4NRMA 2WKKA 4YARA 4OUSA 4AG4A 1SBFA 4LNVA 5JZGC 3VN4A 5A3WA 1H6XA 3MBWA 2FZ2A 2ZX4A 2A3WA 3UKVA 4RGGA 3NW4A 2QQNA 5D8AA 3I2GA 1UN1A 2N7GA 5EWSA 4JKMA 2R1BA 1KS4A 1O4TA 3O12A 1JYCA 5C7GA 3RYKA 4MLOA 5FZ4A 5LK7B 3O5SA 3U0ZA 2PLV2 2FDHA 2ZBJA 3OUHA 3Q8EA 1Z7S3 2YZ4A 4JDNA 3AL6A 2VY0A 4CYDA 4IV1B 4BQ3A 2XJUA 3GNEA 3KV4A 1DIWA 5F39A 2QBXA 4XZPA 2H0VA 1YQ8A 2VUCA 1CJPA 1LESA 3M3QA 3MF6A 4PHZA 4Q4W1 5FZEA 2ENRA 1OOPC 5JZGB 4I0AA 1BLZA 1H9WA 3AMHA 3C3VA 2VD7A 4CTEA 5JOYA 4D7TA 5FJKA 1RUC3 5FIXA 3E5XA 4F83A 5FMCA 5IK7A 2B7YA 5T54A 1JW6A 4YGDA 2RS51 2IC1A 2JKBA 2B5HA 1V6MA 2EICA 2XL7A 2V4AA 5FY7A 4BWOA 2R061 2WZEA 1W2NA 1ENSA 1VRH3 3AK0A 3RWKX 1LECA 4UFKA 1PK6A 2P17A 3WW1A 2YV8A 1PVC2 3MIBA 3NJVA 1ZBA2 1GMMA 4Y5TA 1I3HA 2OW4A 3HT1A 3GHMA 3I3DA 1LODA 4NIAA 2HEYF 4J1XA 2XVKA 4CEWA 1OOPB 1WD4A 1OA3A 3AZVA 5FYHA 1HN0A 3JD71 4WVMA 4A7KA 3HN1A 5FYUA 5JOWA 3D0SA 1BBT2 1RUF1 3ETPA 1BBT3 3H50A 3H8UA 3WUCA 3T08A 3BU0A 2BVBA 3VBOA 4P14A 2BZDA 1T2XA 4FI9A 4N53A 1CAUB 1WBLA 1ZZ9A 2GZWA 4P9YA 4IE4A 1H4GA 1WW6A 1VBB2 2LM3A 5FZOA 3LPFA 1XBFA 2WWSA 4LK7A 1YYNA 4CEYA 3CIHA 1GANA 4LMFA 4OCTA 4X6RB 2FDJA 1K42A 1PO23 2CNAA 4LKFA 3E6DA 4WV8A 4YGBA 2P5BA 4ZS3A 4AVCA 1IKQA 4UT5A 4R9CA 3KSCA 1AR61 2VMHA 2GALA 2EAKA 1REEA 3HEIA 1MS4A 4UFIA 3J4UH 2DUQA 1A8DA 2GC0A 2ZGMA 3NAPC 4AI1A 4Q0UA 3D82A 1HJGA 5EYYA 3SCHA 1DYPA 3HN3A 3WT3A 1GLHA 4AGVA 3B02A 3S0MA 1VBE2 1W2OA 5CKMA 3VGIA 2J1UA 4AGGA 3IM0A 2VCMA 2P3JA 1PGL2 4A4AA 4RS5C 3IPVA 2Y0IA 3LPGA 4CCDA 4XW3A 1S2EA 1NKGA 2ADDA 4DRRA 4J25A 5FK8A 4OHZA 1HRI1 1RC6A 5ISLA 1W6PA 1F4AA 1W8WA 2WT1A 4L8QA 2XLAA 3KF5A 1H2MA 1YFWA 2FMYA 1C57A 2QKDA 4QD2A 4LHLA 1TNRA 5EP9A 2QTWB 2R071 1RUG2 2YB7A 4Q4X3 2BNOA 1KJLA 2HWF3 3LCPA 3LSDA 3NAPB 5D8AC 4DZGA 1FI2A 2ATFA 2Y8KA 3CEWA 3RPQA 3UJQA 2B8MA 4KG0A 4L97A 2XB6C 3APBA 1JUIA 1WCKA 1ULOA 2PTMA 1PNFA 1W9TA 2JG8A 4MGSA 4XE9A 4YGEA 5FK7A 1LOGA 4B1MA 4NUBA 2J1TA 4RS5B 2WL1A 4HONA 3M8LA 4JRLA 1LULA 4HK9A 5F8PA 1BZWA 4AHXA 2ET7A 1QOTA 2CGNA 5GLZA 3WOGA 4Q4W2 1I5PA 1FX5A 1XE0A 4AL9A 4BPZA 2D6PA 1DQ6A 1AR83 5T5PA 3A23A 1GBGA 5D8AB 3W20A 5HCBA 1T6BX 2RS52 2PAKA 1ZA7A 1MS9A 4Y22B 3SMHA 4CCJA 3GCWA 3K51A 1G9AA 2R062 2AGSA 1ULEA 1UL9A 2VW2A 1SLLA 4CCNA 1N1VA 1SFNA 1OPOA 2R063 3A22A 4TXWA 2AZ5A 5FZLA 1UWWA 2VZRA 4XYXA 3TBDA 3CDZB 3VBFC 1ZZ7A 2NMNA 2XH6A 2Y6JA 2O0OA 1K5MA 3ASIA 3ES4A 1JZ4A 4EYUA 2GP3A 2BFUL 2YC0A 5E16A 4CCCA 2VXJA 3FFZA 4BZ4A 3RNSA 1LHNA 4ZS2A 2R043 3O1PA 5F5AA 5HXVA 2CY6A 5L9VA 1XU1A 2DVGA 2XDVA 3BVCA 3I97A 3JD72 4CEWC 4LA3A 4HANA 3IAQA 3NNMA 1RUF2 1ZRDA 1N3OA 4V1PA 2Y33A 1RUF3 2WNOA 1D2QA 3A0NA 4BOWA 4EE2A 2FD8A 3I2OA 1EAH1 1HKDA 1H2KA 3OTFA 2ORXA 5BNQA 2WAOA 3VKNA 3JCIA 5IW0A 3VBOC 2JD9A 1IPJA 5C9AC 2OIIA 4KBZA 3VBFB 1IG0A 4MGYE 4N53C 2WZR3 1L7RA 1YLLA 3ZSJA 4HKOA 4G9SB 5CU1A 5SV8A 4QKFA 3LDKA 3SH4A 2PXJA 1XC6A 5JCTA 4Y1YA 1UXXX 4WM7A 1NE6A 4CEWB 1ZRCA 4DMIA 1DU3D 2PELA 2V4VA 3T4VA 2BTVC 1JOBA 4CEYC 2YFZA 4WVMB 5EXOA 5A6YA 4LPLA 3HPNA 3BPSA 1GOFA 4QQPA 4GKXA 1JYWA 1UY3A 5HBAA 1PO11 3VZKA 1AR63 3AKQA 3VBOB 2UWAA 1S55A 2G9FA 4FPJA 4GWNA 1PNGA 4CDUA 5C9AB 2E7QA 1MZ5A 4N53B 1LEMA 1I9RA 3E6BA 2IXHA 5FY8A 5GZEA 3RRDA 5F6LB 3HBKA 2EIBA 3P6BA 2BJSA 5C8WA 4JDMA 5A1AA 4K8FA 5KC5A 5JIAA 5LBBA 3ZX7A 2Q1ZB 4RFRB 4HVQA 2D5FA 3ZMOA 3DKQA 3CMGA 1ENXA 5FZOB 2JG9A 4FPEA 3HIFA 2X05A 2FCVA 4CEYB 2XGXA 4E4HA 1HRI2 4FBFA 2PHTA 3BCWA 1TME1 2QJVA 5C5UA 1LGBA 3BIWE 1AYM3 2BOJA 5FRAA 4AHWA 2WC2A 4PJYA 3PVBB 4AXOA 2BRTA 2NP0A 1ND2A 2RJ2A 3EHKA 1JHNA 1RUH3 2R6QA 1DDLA 1LR5A 1VJ2A 2R073 3POEA 2VH9A 3EJKA 1W6OA 2OZ6A 3K4AA 4LBNA 1D2SA 3VBHA 3WINE 3TWIA 1WLTA 4C90A 4E4ZA 3IDCB 3R4UA 1QXJA 4CU8A 2YPDA 4HL0A 3ZFFA 4UXAA 5FLJA 5HV0A 1NZIA 1MS1A 2JG8C 1ST8A 2D3SA 1V00A 2FZ1A 2Y0OA 3OY8A 4JGYA 1Y9MA 2AREA 3ZXFA 3IPVB 1YC61 2JE9A 5H9SA 1WKYA 2VNOA 3FZ3A 4P9GA 1UYXA 3BYWA 1MZ6A 4JVAA 4WVZA 1RUE1 3RS6A 5EJ3A 4BQXA 1W6PB 4K8RB 5FMOS 4CP1A 1VAMA 5LA2A 2V72A 3O1TA 2P1BA 1ND3A 2BERA 3PU3A 4DPNA 5DQ0A 2D6LX 4NMIA 1W3VA 1OURA 3K77A 5EHDA 3MIFA 4R9DA 4O9EA 2HYXA 2D3PA 2QQOA 2WT0A 2H0BA 2JG8B 3TOJA 4RL7A 2JWPA 3FUQA 3I8TA 1DQ1A 2EA7A 5FYSA 3VBSA 1K5MC 4XPVA 1V9U1 1SBDA 1XXNA 3F95A 1RUJ2 1C4RA 5G05L 3WDVA 4IGOA 1UOJA 2CHHA 3JUUA 2PHDA 4Q4V3 4QGLA 4QX8A 2W92A 4N8MA 3CJIA 5FUIA 2NYYA 3D5OA 2QQIA 1FNYA 1OUSA 2ZEWA 2ES3A 2WRAA 5I8SA 4X8NA 3O0VA 1OFSA 3ZFEA 2V09A 1EAH2 1EPZA 1CWPA 4QU2A 2ZGPA 3B7MA 4MGIE 4M01A 4HN0A 3IB3A 1HJFA 1OLME 5AVAA 3OSDA 4IESA 1OVPA 1YCIA 4CDWC 2DVBA 4AVAA 4XFBA 3VDBA 3HJRA 2JXAA 3IAPA 1ENRA 1K5MB 3VV1A 3PU8A 1S1AA 5FYVA 4B7EA 4KH9A 1JZ2A 3BIEA 4KU7A 1BK0A 3SQOA 1JUHA 3UGGA 1EPWA 4LIVA 5C70A 4EN9B 1WW4A 4D6SA 4WM7C 3ILNA 1KEXA 2VG9A 2Q30A 4OVEA 3V64A 2WSUA 3GJBA 1QDOA 3DN7A 5JXHA 2XWJB 2B45X 2VTXA 4XTPA 5CVRA 3OPTA 2YBKA 4HZFA 1PO12 2ZHMA 4IE7A 5FZ9A 4XBLA 3GALA 5F1RA 2YU1A 1REDA 3M70A 2DFCA 3ZXDA 4CDWB 4H14A 4CDUC 1RTVA 1W6MA 1AR71 2JB8A 1PMIA 4CPBA 4XJZA 1FOD1 3VB9A 1G86A 2VOTA 2BGCA 4W8JA 2PHRA 4LBMA 3BGAA 3HOBA 2G9GA 2WABA 2AUYA 4LK6A 2P3YA 4RGAA 4CUGA 2W5FA 2YBSA 1RHI3 2Y26A 4WM7B 3Q9OA 3ATGA 4IEXA 1TME2 1O3TA 4NIDA 1TME3 1U5IA 4IEUA 1IS4A 3T2PA 2IUWA 4M3CF 1JU3A 1MEC1 4H2AA 2O14A 3ZMNA 1HDKA 5L9RA 1C8M3 3B93A 4CDUB 3DKWA 4NIGA 2JDHA 1HXS1 3ACHA 1GWMA 5GALA 3VBHC 5J09A 2HH9A 5JI7A 3VKFC 4IEWA 3AZWA 4DRVA 2WYFA 3HQUA 5LA0A 1LOFC 3ZFFC 4LOSA 5FZHA 1OKQA 4IE6A 1SPPA 2TUNA 3KHBA 3MLJA 4RQPA 1NY71 4KBBA 3SEPA 5C3OA 4C1XA 3P1IA 4CP9A 4EZ4A 3BTAA 1RUE2 1TQ5A 2UYBA 4V2WA 2W87A 1RUE3 4FAHA 2D6NA 2ARCA 2LS6A 4OUMA 2VBBA 3JZVA 1BCXA 4N43A 3H3LA 1ND3C 5DAXA 1J3PA 5EYXA 1UKRA 2D7FA 1QJX1 3VBHB 4CU9A 3GDBA 4CP0A 3BN6A 4GKYA 1UX7A 5FYCA 1NUKA 2EIEA 4GIQA 1WLCA 4MGKE 2A75A 2BGPA 4QKDA 3ZFFB 3H0OA 1W8TA 1RJ8A 4YZ4A 3TN91 4DINB 4ISRA 3KZ4C 4I30A 1SFPA 3KGLA 1UX6A 1V9U3 2BVVA 2ZX1A 4AF9A 2Q5TA 1D4VB 1QEXA 2YG0A 4Q5OA 1R64A 1HX6A 5A80A 2JX9A 1XNBA 3CJIC 5FJHA 3MIEA 1ND3B 3C7HA 2CYFA 1O3QA 5KC6A 2DUPA 4QB2A 3AMNA 3UKTA 3ZFEC 2BNNA 3I59B 1H2NA 1Q8PA 5I8TA 1AHSA 3KLSA 5L73A 3V0AA 3CNAA 4UW3A 1ODMA 4JTNA 4Y5Z0 1BQPA 4U2AA 2BWCA 1R093 1DGWX 2BWAA 2ZACA 3BU7A 1O91A 5F5QA 5FZAA 5IJRA 5C6CA 4P08A 4PLNA 1W8UA 1HLCA 2D6OX 4OQ9A 1YQCA 4G3YC 1OHFA 4GXLA 1J3QA 3CJIB 1RIRA 3GCXA 3D0JA 5A7PA 1W9FA 4LO4B 3O1MA 1YHFA 2EXJA 1G8WA 2D6MA 4YM1A 1CX4A 3N9OA 5A7QA 4A2UA 5GZCA 1F2NA 1RUOA 2C5DA 3E5UA 4OHWA 5IATA 4LLFA 4Y3OA 1GP6A 3EO6A 4NRQA 4CU6A 1AR72 1VBA1 2D3RA 1QJZA 1AYN1 4C91A 2I45A 4XBQA 1FOD2 1O5LA 1OLRA 1FOD3 1HQWA 2XQXA 3M3IA 4QGMA 3RZZA 5HCFA 2EALA 4XC9A 4DXSA 4EZHA 3OG2A 2W1QA 2DU1A 5A3NA 3W9AA 3N7JA 1U12A 4FPCA 5LRRA 4YW3A 3HT2A 3M1HA 1IZ3A 2A6WA 3NMBA 3VDDA 2W2IA 1UU5A 3PUQA 1O5UA 1MEC3 1Y3TA 1NLSA 4FOWA 1OF3A 3ILFA 5FZCA 1W0NA 3OCPA 3T1MA 2LUWA 4CDXC 1HXS2 2BGOA 2ERFA 4IEZA 2Q1MA 3AZZA 5C3SA 1Q5OA 1HXS3 1W6MB 3LIGA 3UV9A 3VHPA 1H4HA 3GYDA 1QIQA 2ZOEB 1LB2A 5JWPA 5C5TA 3NJXA 3KV6A 1Q43A 5FLIA 2TNFA 3M2MA 1ZZBA 1NY72 2VOXA 1X8EA 3POYA 1KJRA 1UF2C 4QAWA 1X9TA 2WNVA 1SACA 5FOJB 1SBEA 3K3NA 4LTAA 3MEPA 1SDWA 2FMDA 3S7EA 4HXCA 1JHJA 1KS5A 4OULA 3ZM8A 1GP4A 2XBO3 1ZM1A 5FTTC 1VBD1 4CA9A 2FBEA 4AK3A 1R1A1 1FNZA 4N43C 2IWGB 3M3EA 4CDXB 5A33A 5I0DA 5I0RA 4JAAA 1TG7A 5L9BA 5IYYA 1W9WA 2CAVA 1JN2P 1QJX2 4AQ6A 1F9KA 3PDQA 4H3WA 1QJX3 3OGJA 2R7EB 4ZU4A 1DZTA 3T09A 5FZDA 4BMBA 1O3RA 3TN92 2BEOA 1VLNA 2XG3A 1OVSA 1UIJA 3TN93 4XHBA 1SPPB 5A3UA 1GYKA 2HJIA 3VZLA 1SFYA 4B1LA 4CP9B 1U5XA 3BKZA 2XR4A 2RE9A 2HWB1 2ZX3A 2R49A 4WVVA 5DAWA 3QOPA 4ZONA 1FT9A 3I2IA 2QDRA 4N43B 1RUNA 3RJ2X 1UZYA 4ASKA 5T52A 3WP3A 3VBRA 1H9PA 3WDTA 3AP9A 2YROA 1VMHA 3THDA 4XXAA 2PQQA 5B4XA 1UYZA 1F8VA 3WHUA 1OLMA 4I0BA 1V6LA 2RG4A 1PX3A 4HOOA 1JOJA 1OQEA 4Q8KA 1W8HA 1QH6A 2DYCA 3C7OA 2WUHA 1WCQA 4D69A 3ZOIA 4Z2WA 1GWKA 1D4M1 4YW7A 5LW9A 1E5RA 4A41A 5JVVA 4IW3A 1COV1 3MV01 2AR6A 4RGKA 1D0HA 1VBA2 1GSLA 1C5HA 4XMIA 1AYN2 3CO2A 4GMP0 1VBA3 1W6NB 4LXLA 3S7IA 4WZFA 4XDOA 1SEFA 3DYOA 2VZTA 1QU0A 2DBNA 1PMJX 1IOAA 3Q8AA 1D7PM 3KCXA 4URAA 4M0NA 4UAPA 4WBBA 5DPNA 1BMV1 4QDSA 1Y43B 3TNQA 2P3IA 3MV11 4UFHA 1JU4A 4FFHA 1MS5A 4FFFA 4HKWA 4XDQA 3JBG2 4LEJA 4MADA 2OPKA 2LW8A 4QQHA 5KXDA 3VDDC 3WLUA 1QOSA 5KHKA 4E8DA 2MEV1 1FPN1 2D5HA 1PZ7A 2QQJA 1R081 3QLQA 4E2GA 2HWD1 4O61A 4IGPA 5EPAA 3N35A 2E51A 2VNGA 1HW5A 1ULFA 3L2YA 5CISA 2WSVA 2PHWA 5TSWA 4ARXA 3O1VA 3ZYBA 2JD4A 4KI5M 2VM9A 2J1RA 1CX1A 1D0GA 2AACA 2VR4A 2ZEYA 3OPZA 1QQP1 4PIXA 1KQRA 3GZTB 1E5HA 1FMD3 4UW4A 4Q1RA 5LATA 4E9KA 1IPSA 3AYDA 4LBOA 3LE0A 4AVBA 3DL3A 1VP6A 2PHLA 2WNVC 2ZZQA 2BUKA 4RHV1 2YGMA 3C7EA 1RUG1 3VD5A 4AHYA 4Y22A 4CRQA 5BNPC 1V6NA 1VBD2 3VDDB 3WDXA 1DGLA 1VBD3 1R1A2 2YDEA 2GC2A 2VZUA 2RDQA 2O8QA 5APAA 3TEWA 2PLV3 5LWBA 1IS6A 2GMMA 2LRPA 2YC4A 4P02B 4D7YA 3H9AA 1OF4A 2VMCA 3POFA 1HQNA 5HCHA 4Z8BA 2RR11 4CUBA 2CV6A 1DZQA 3R0RA 2XONA 3RI9A 3FUOA 5E8AA 5CKQA 4B4PA 1W8ZA 3OD4A 5A6ZA 1HRV1 2A1XA 2P6HA 2P6CA 2FHRA 4BQWA 2C26A 1DGRN 2E7AA 4QGNA 5IK5A 2PMWB 2WNVB 4L9BA 2PAMA 2R16A 1NCQA 3ZYFA 5A1FA 2KM2A 4XUPA 2P34A 2YY1A 4KGGA 5BNPB 3SC7X 1NQDA 2HWB2 3WZ1A 2HWB3 3L2HA 4KWLA 1VRBA 1XRUA 2VNVA 1EYBA 3VBFA 3ZSKA 1LOEA 1J1LA 2WBKA 3VD9A 1NA1A 1POV0 2OUJA 4IQPA 2QE3A 5A33B 3WF3A 3K48A 4QPYA 1JTZX 4XFGA 1NG0A 4YGCA 3ZSLA 2Q8DA 1PVC3 1NXMA 1BJQA 3VBRC 2R0HA 1ZBA3 4D6RA 2JJ6A 5JPNB 1KFUL 1H1MA 5CNAA 2WLQA 3KCCA 2RMU1 1C1FA 1NE4A 4BLJA 2FDIA 5AVPA 3WUDA 5FKCA 2Y6GA 5FPZA 3HR9A 5BV6A 1ZNPA 2VMFA 4EN7B 3E97A 1RITA 3WQ0A 4PF1A 4K3UA 3LF7A 2ZPXA 3AVRA 4LBQA 4QKBA 5FXVA 4EJRA 4PBPA 2CL2A 3NL1A 4AQTA 2GMPA 1D4M2 4KQ7A 5C9AA 2VZVA 1COV2 2W39A 3AXEA 4QXKA 1COV3 5J36A 5JPMB 5EIYB 4IEQA 5AFBA 3JQWA 1WA4A 1DBNA 4HBNA 3VBRB 4UF0A 5JI9A 1DHKB 3RJRA 4A44A 3ENRA 2JE8A 4EWDA 1VBB3 1JI6A 2NLRA 1C28A 3OPWA 4OI0A 2VUJA 4S2FA 4P5YA 4AQ2A 2DCJA 2WAAA 4R52A 4XJ8A 1HB2A 1XNCA 4CP2A 2XJQA 3PJQA 5FZMA 1BMV2 1KXGA 2W46A 3VDAA 5FXXA 4Q0SA 2FDKA 4JX0A 5K8SA 1V0AA 4NOTA 1X33A 2JE7A 1CAVB 2DVFA 3SKJE 3OD0A 3LSEA 4RFT0 5E88A 3MLKA 2VTXJ 1RJ7A 1O3SA 2E33A 2MEV2 1ENQA 1FPN2 2MEV3 1R082 1ULDA 1FPN3 1X8MA 3W21A 2HWD2 1BEV1 1YNAA 1R083 3JXSA 1VBE3 5JXGA 3U75A 2ZX0A 3PMEA 1WGPA 1C3HA 2VUAA 1JOPA 1XYNA 3VHNA 2Y6KA 3PURA 5LRSA 2CWSA 1QQP2 4UBHA 4AI3A 4FTBA 1QQP3 2ZEZA 3KV5A 4W6WA 2R32A 2TBVA 3CHXA 3WNNA 3WNMA 3U4XA 5J48A 4RHV2 2EF6A 4PQQA 3Q8CA 5GJ6A 2QDNA 4NN0A 1RUG3 4JQRA 1VAKA 4LBJA 4LR4A 1URXA 2VQ0A 4O9GA 2F17A 2CAUA 4AOCA 5FYMA 1GNYA 2WO1A 4ZY9A 5F9TA 3IN9A 1UW8A 3ACLA 2RR12 3I3QA 1AL21 3NNLA 1X9PA 2RR13 1OQ1A 3IKWA 1VR3A 4JHTA 5FOBB 1HRV2 2PA7A 4KWJA 4Q4W3 1HRV3 5E89A 2XJPA 5ABJC 4P5HA 2D43A 3NWKA 1W99A 1AX1A 4BK5A 5GLUA 5DAVA 4H7MA 3OBTA 2VOWA 4A6SA 1YIPA 1NCQC 1YEWA 4XACA 2DVDA 1XU2A 3RSJA 1UOFA 2RS53 3KF3A 5CAZA 4FXKB 1DQ5A 3IIAA 2W95A 1NX9A 4GD4A 4SLIA 1SLBA 1OSGA 4P9LA 4FFGA 1GOGA 2SLIA 2O8OA 4UWDA 5DG1A 4ZU5A 3D4KA 2Q4SA 5A7WB 2WO7A 3VZMA 1NA1C 2XKPA 3B5LB 3PL0A 3WQ1A 2C4XA 5C33A 1Y7BA 2A5ZA 4D6QA 3POSA 4Y1ZA 2QZ2A 2VCAA 3ITQA 2AYHA 2UY8A 1RUJ1 4JC1A 4ZKTB 2Z2SB 1UYPA 3PUIA 1SLAA 2RMU2 4LA2A 3WG2A 1O7FA 5ABJB 5IVCA 2RMU3 3PUAA 4XOGA 2AH2A 1UY1A 3EB7A 3K2OA 2VE1A 4Y24A 3JD73 1UNBA 1G9CA 2DCKA 4IEPA 2RM21 3BTZA 1CONA 1NCQB 1AZDA 3PNAA 2VL4A 3MUY1 3OGRA 3HQXA 3GBWA 1V6OA 1VPHA 3FN9A 4QX2A 3U10A 4DOUA 5A7NA 5JDBA 4CDWA 4NHXA 5F3EA 1QXRA 1NA1B 5FZ3A 4X6QB 4BQ5A 4Q2FA 3K75B 4AWDA 3VL9A 5KHIA 5CFCA 5C71A 2DWRA 3OYWA 5CBLA 4YWAA 1HIXA 2ZGOA 5LASA 4NIIA 2CSGA 4QDRA 4XFFA 4Q8LA 5I91A 2GMEA 5KHGA 4R9BA 3NSTA 3I2JA 4FCAA 3WG4A 4AVTA 1LOBA 2WQZC 1AVBA 2VAUA 4LBQB 3IT8A 4Q29A 3ZPYA 4LHKA 4DXTA 2XXZA 1MS0A 1OI6A 3I4IA 3BOPA 4Z1VA 4COVA 1NYWA 4CU7A 4XZUG 2C1FA 4QB6A 4DUVA 4O7XA 2IVIB 5IK8A 3WCSA 1BEV2 1YXWA 1F15A 1O6UA 2GDFA 2W52A 4GMP1 4LIUA 3I2KA 4OI4A 4UF0B 4C8DA 3WXPA 1NXD1 3AP6A 2HWC1 3WNOA 4HVRA 5B4NA 4QPWA 1UZWA 2Y38A 4QT6A 3ZYPA 4FT8A 3AMMA 4XJAA 4MUVA 1ZZCA 1CIWA 1OLQA 1CZSA 3DEMA 1ZREA 1HRI3 1FXZA 5JOXA 2WFPA 3RFRA 2OZJA 3I2FA 3SH3A 3TEZA 2PAEA 2QQLA 3AB0A 2W9XA 3H3ZA 1YI9A 1JODA 1W0PA 4KMQA 4ASMB 5IHRA 2VVDA 2I74A 2WO3A 4LUMA 2V5YA 4UFMA 3WF0A 4GQ7A 3WVJA 3MPBA 1LOFA 2Y60A 3CF6E 1WMXA 3DECA 5H9QA 5I93A 5D21A 3A4UA 4YG0A 3FLTA 3R05A 3WD5A 1WMDA 3B9IA 1GNHA 4CCOA 5FY0A 5T5JA 4YZ5A 1AL22 1CN1A 1W9SA 1LOAA 3MW2A 1TMF1 2GNMA 1AL23 3R6SA 4QHZA 1GZTA 4R8HA 5JXJA 2PYTA 2RHPA 1W2TA 4DUXA 2AENA 2KA3A 3H1YA 1UXZA 4Q0QA 4BJ0A 5DZEA 1QKQA 2DUOA 2B42B 2DCYA 5DAPA 2B9UA 2EXIA 4AI0A 4AQSA 2Z42A 1RUI1 3RWNA 2VGDA 3BB6A 3A0KA 2JKXA 4RN5A 2AC1A 1G9DA 2RDRA 4NWVA 5KXEA 3B69A 4QQ2A 2WWUA 2P4EA 3J7NA 1MS8A 2VW1A 3I59A 2QQUA 3O14A 4XUTA 3WNPA 2FCUA 1M4WA 3LD8A 3ZYJB 1TE1B 1IQDC 4Y26A 3RZLA 3ZN6A 1S0GA 2E9QA 2YYOA 1GQHA 5DXDA 2ZS6B 1OXCA 1DCSA 3ZR6A 2VXRA 4UW6A 4AFDA 3FBMA 1W0OA 1S0CA 1XE8A 1GU3A 4YYOA 5JUVA 1RUJ3 4DEQA 5JAXA 2VW0A 4M0HA 5J37A 3S30A 5CADA 4BA6A 5A3MA 5E1RA 4YW1A 2ARAA 2RM22 5IVEA 4XBNA 5EJ1B 1KD7A 3CU7A 2C0ZA 2HKXA 3PUSA 4YRDA 4AGRA 2VOVA 4ZU7A 3ETQA 3H8OA 1EAH3 4C1WA 5FV3A 4CDQA 5IVVA 4Q4Y1 4G4FA 2A73B 1MS3A 3WQBA 3OBRA 5IWFA 1FYUA 2OT7A 2RJLA 4FQ4A 2WINB 2ZX2A 3D3AA 4DIQA 4XXPA 1APNA 1SLIA 3AVSA 3PHMA 4D8MA 5CFCC 2B46X 4YW5A 4LJHA 2XUMA 4OYUA 1UY0A 3ES1A 5CIRA 3NRUA 3SKVA 1ODNA 3MFAA 4FPOB 2G19A 2A3YA 5CG8A 2JDNA 5K4LA 3POIA 4Y20A 3VDCA 2EAAA 2K2SA 2QNKA 1Y9GA 1PO13 4DQAA 4QX0A 3AZYA 1QY4A 4CE8A 4YM3A 4HN1A 5I8YA 2E63A 4MZUA 5GZFA 1QJEA 1MQTA 4CXYA 2VOKA 2YPJA 5CFCB 3OYWB 2SBAA 3WW3A 2HWC2 2X5IA 2JEMA 3LA7A 2OPWA 1NOVA 3J8F1 3LIHA 3PTRB 5LY1A 1CVNA 1UD1A 4DY5A 4YZ2A 1JXNA 3O1SA 1X36A 1IKPA 4Y4YA 5CB7A 3USSA 4COYA 4YW6A 3WF1A 3KT4A 4IEOA 5CYYA 1EV11 2VQUA 5DABA 1CAWA 1CQ9A 1YFYA 1VB2A 1WD3A 4HPKA 5IVJA 2JIGA 3ZFGA 1W03A 4CDXA 5FBZA 4EWAA 4E2SA 3KB5A 2Z69A 4XJWA 4MHRA 1JYNA 5LCWL 3WG3A 2NM1A 2QZ3A 4NRPA 5JR2A 4BM8A 3IBMA 2W68A 4CUAA 5FYZA 4EQVA 2VUDA 4AR2A 4AAXA 1AX2A 1LHVA 1QMJA 1A78A 1TMF2 2VULA 3SEEA 2XJTA 1AXZA 4QX1A 2XVLA 2FCTA 3B3QE 2D98A 2BDRA 1CZVA 1C8NA 5FZ7A 2OXBA 3HAGA 4JV4A 3F2ZA 4TN7A 5FBJA 2ZGKA 4KG8A 1J3RA 4NE9A 1GR3A 4NPRA 1SMVA 4OHXA 4PLMA 4XUOA 3VKOA 3AFGA 3FHAA 1RUI2 5LY2A 3FJSA 3N9LA 3KGZA 5F5IA 1RUI3 1F5JA 2RV9A 2ZGNA 4IDZA 2OQ6A 4B8EA 3GGLA 1PM4A 2WA4A 3W5MA 1TVGA 2JDZA 5EFUA 2DURA 1UPIA 1V6IA 4DEVA 1AXYA 1QHDA 4N7UA 4AVVA 4A42A 2WS91 2LALA 3SHRA 4NWWA 4AEMA 1JYXA 3M3CA 1DLLA 2A6VA 4XAEA 1TNFA 4FTSA 4GWIA 3ZVXA 2IZWA 3K4ZA 4XHXA 5GZGA 3NV2A 5FYBA 1MR5A 3U07A 1BKZA 5GKAC 3ACFA 5AFEA 1W05A 5FPAA 3MIDA 1T6GC 4RSUA 1RGSA 4P9IA 5CG9A 2CTVA 3FHQA 5A6XA 5HXMA 3S5QA 3AYEA 1LHUA 3T3YA 1AR91 1WZXA 3AP5A 1AF9A 1I5ZA 2ZAAA 4IV3A 3WP6A 1GWLA 2K46A 4Q4Y2 1S0DA 2K9ZA 3EQEA 2ARXA 2VQAA 3ABZA 3WSOA 4CDQC 4XFCA 1W9YA 1QF3A 4YLZA 3H3UA 1W6NA 5DN2A 4NHLA 4YZ1A 3I49A 2BP6A 3ZN6B 1SCRA 5KHJA 3BI3A 5IVFA 3HNMA 5FWJA 3VHOA 2ET1A 3N4MA 5FY1A 2F4PA 2DBIA 5A1LA 1H0BA 1Y4WA 3QH7A 2Z79A 5FZ8A 2WO2A 4NAOA 2AEZA 4XF9A 3EXUA 4BCUA 3VKLA 3ACGA 5A6QA 3O0XA 2R1DA 2VZSA 4BIFA 2JDAA 3ROUA 1UO9A 1X82A 3ZXEA 2YUEA 1WMFA 4QPGC 4XABA 3TB0A 1LU2A 4CDQB 4AEKA 5CZKA 3VL8A 2UY9A 3NJZA 1ASJ1 3T2OA 3ZPOA 4D94A 1WCSA 3I3MA 1NT0A 1XQNA 3TEYA 1AR73 3OEBA 4HT1T 4FPKA 2P2KA 3RYPA 4SBVA 1KRIA 3ZXKA 2WA3A 4ASLA 2BNMA 3WW2A 5C3RA 1MQTC 2R0FA 1RVF1 2XJSA 3ECQA 3J8F2 2GC3A 2X5IC 2KXLA 2VZOA 1YFXA 1RXFA 3J8F3 4BIOA 2VVEA 2C9AA 1N47A 1EV12 4LO5B 5FPBA 4NHMA 5LA9A 1DFQA 1UYYA 1BYHA 3H7YA 4H7LA 4QPGB 4Y20B 3OBAA 3JBG1 4MYEA 4Q0PA 5JOZA 4D3WA 1W2UA 1WMEA 4XIOA 3MICA 4N7IA 4XFHA 3OJBA 4I02A 4NHYA 2DVAA 4AAPA 5CKNA 3ZFGC 1YUDA 4FOQA 2BFUS 2JDPA 2BOIA 4BDVB 4ZZ5A 4FTEA 3AC0A 4FQZA 2XJVA 3AM2A 4XFAA 4E2QA 3ALQA 2QCSB 2UU8A 3HMYA 4PI0A 4XF1A 4B4RA 5FFOC 1MQTB 1VALA 4DUWA 2DCTA 3R4SA 2IXLA 3BODA 5A32A 5J3UA 1PX4A 2X5IB 1RXGA 4AI2A 2WWJA 4DB5A 3FX3A 3T30A 3O0WA 1J83A 1YO8A 3T2QA 5FZ0A 5BNNC 2KR2A 5BNPA 2TEPA 1DZRA 4PQ9A 3RDIA 3EYPA 1CAWB 4HPKB 1W06A 3SNMA 3LZZA 3H42B 3LFMA 3GZAA 4LBKA 4QQOA 3RG0A 2J1VA 3GZEA 5CFDA 3ZFGB 1W90A 1ZYBA 3AYCA 4Y1UA 2WDBA 3ST7A 3I2DA 1JH5A 5IFPA 4B7KA 1KGYA 3J7LA 1V70A 3WEZA 3HNBM 4CUCA 4E8CA 5C8CC 3AMPA 2VMEA 2WS92 3KQRA 4PT6A 2WS93 1ULGA 2RJKA 1XNKA 4I09A 5LBFA 1QJY1 2ZGUA 3L9JT 2P3KA 4O65A 5K0UA 5BNNB 5JLVA 1ZRRA 4IGQA 5LEKA 1DQ2A 5A3LA 1Z7S1 2R30A 2D93A 2I07B 1LOCA 4K1ZA 3SISA 4XAAA 3BTXA 3ZSMA 4LULA 3AXDA 4GWJA 1PGW1 1AR92 1AR93 3OGVA 3OUJA 1E5IA 2DTYA 2VMDA 4IV3C 2HYKA 4XJUA 3DYMA 2BW8A 4M3CE 1W8NA 5C8CB 1UOBA 3PIGA 4TLFA 1DQ4A 2DTWA 2WR9A 4HG6B 5BNOA 1RUC1 1LU1A 3GHNA 1UZZA 4F7ZA 4F3JA 2XJRA 1CPNA 4XQDA 4QXBA 5GZDA 2WZ8A 1CAVA 1S2KA 1VRH1 4L11A 5FYYA 2DDUA 3GF6A 4WM8A 2JECA 2XMLA 1LRHA 1SQ4A 4K21A 4BQ2A 1OD3A 2V73A 2ZMLA 5T5LA 2VMIA 3D6EA 4IV3B 3NKGA 4JZRA 2C6SA 1MZFA 1H30A 3I3BA 4AEDC 1ASJ2 4TSVA 1QWRA 2H6BA 1ASJ3 1R1ZA 3IDBB 2WT2A 1OH3A 4YW2A 3S57A 2GH2A 1AYN3 1W3XA 3T1LA 5EJZB 1JZ5A 4FPHA 1JS9A 1DYOA 3C7FA 2ZGRA 2ZHNA 4P9XA 2E53A 1RVF2 3M7AA 4ZHNA 1WA6X 1X7NA 2ZA9A 5FP9A 3CQOA 1ZBE1 2VU9A 4R9AA 4XILA 4OFGA 3ZXLA 5FMOL 1XOYA 4LO7A 4FPFA 1XYOA 2OS2A 5HPOA 2GU9A 2Y6FA 2ZXQA 4MX3A 4MSVA 1NCRA 1N3PA 2GC1A 4TTGA 1QXPA 2KD7A 3JBG3 3N9PA 4AEDB 1XNDA 2W91A 5G04L 5F32A 3URFA 4KWUA 2VZPA 3WDWA 3FFQA 2B39A 1FATA 2ZKNA 5F5CA 4DY3A 3HWJA 1B35A 3LDRA 4IXLA 1PO21 2OKXA 4FP2A 1W28A 1S2BA 1XSQA 3AJYA 3VD7A 2O1QA 5FZIA 5L36A 5SV5A 4E27A 1KFXL 1E5SA 2G4IA 4JDOA 5A3PA 2DCZA 4I2OA 3PLQA 2W1SA 1OA2A 3NKTA 4LHSA 4ZPIA 4LORA 1U5ZA 4ZXEA 4A7ZA 4K9SA 4BYYA 4ITCA 4Y33A 3THPA 1IQAA 2W08A 4YVWA 2D97A 3VD3A 1BVP1 4ISQA 1JZ3A 4N90A 2Q1FA 1R1A3 2OQ7A 5IAVA 1OBNA 5A7WA 5FZGA 1OQDA 2ZGSA 3ELNA 4XURA 4XQWA 1HV0A 1S0FA 5H9RA 3U1XA 5CFDC 2A3XA 4ONUA 1OKOA 2XLGA 4W65A 2JICA 4N9IA 4MGZE 1XNAA 4OMDA 3U37A 4R4ZA 3H1WA 1AJKA 5ABJA 5A32B 1W6QB 1DP0A 2GSYA 3UKNA 3NV3A 4EN8B 3UNPA 4Q4X1 1M06G 1US3A 5BXXA 4HK8A 2HWF1 5LBCA 1QJY2 1W2AX 4CZSA 1QJY3 1PM7A 4ZXKA 2BV4A 5K0UC 2PHXA 1Z7S2 2ZGLA 4I01A 4UBGA 4V2VA 3ZDVA 3AKPA 3S5AA 3OB8A 4M4PA 1IGOA 4GULA 3VBUA 5LZ6A 3ZLIA 2RS11 1PGW2 2Q0AA 4AFBA 1IG3A 4FVVA 4FAGA 1Y9QA 3POGA 5IFTA 3V65A 5CFDB 4NIHA 5FMBA 4MXWA 2QQVA 3SCGA 3ZDSA 5DUUA 1LAJA 1BHGA 5BYNA 1GZWA 3HVDA 1O8SA 4JRAA 4AFMA 3KD4A 2GH8A 2BBAA 3IDAA 3FLPA 1SG3A 1VE0A 5FKBA 1AR81 2AEYA 2B9VA 2VZQA 4AYUA 4FOYA 1RUC2 4IEVA 4QPIA 3PUHA 5GLVA 3WW4A 5BNOC 3LEIA 3LB9A 1LENA 3LFIA 1X50A 5A3OA 5K0UB 4Z82A 5D1IA 1LHWA 3WDUA 5JR7B 1VRH2 4KL1A 3USUB 1UOGA 3AMQA 1K5JA 2IVJA 5LBEA 1D4M3 3WP5A 5FPXA 2GAUA 5DAQA 5K9YA 5JIUA 4WM8C 5FQ0A 4ORFA 1ZX5A 3ZKUA 4A6OA 1IHMA 2R041 3RZMA 1S4CA 2VZ1A 3INAA 3LWCA 2CGOA 3MW4A 1CAXA 1IS5A 3WP4A 2ZMNA 3UYJA 4JGZC 2JDYA 2ILMA 3AKSA 3N7MA 1LGNA 1MPXA 5BNOB 4P00B 2FDFA 1U0AA 2WQ4A 1FV2A 1HB3A 4QXHA 4QX5A 1GZ9A 1ZBE2 2JDKA 3CLPA 5FUPA 4FSJA 1EP0A 4LE3A 3LGRA 1ZBE3 2Q8OA 1J59A 5FY4A 2D40A 4Y5SA 2CDPA 3I54A 3J9SA 3RVHA 3ZSEA 2WZR1 3Q8FA 4GA9A 4QHOA 2BQPA 4IE5A 4PF5A 4WM8B 2EIDA 1YJKA 3KQ4B 3KVBA 3FMGA 4BLIA 5CEHA 1NCRC 4IEYA 3OBZA 5GM0A 1K12A 2VNRA 4MOAA 4PI2A 1RB8G 5F6KA 2HWD3 2J1SA 3DGTA 5A70A 1AJOA 4QU1A 2HBUA 4C0BA 1AX0A 1I6XA 1PVXA 3ME2A 1PO22 4JGZB 4K6BA 1K3IA 3LAGA 4LQRA 4Y4RA 4CXWA 4I3GA 1B35C 1LNSA 4BQYA 4A3ZA 4AFCA 5DUWA 1SHWB 4IUGA 3ZR5A 5KXCA 4XEZA 1UU6A 2DV9A 2A71A 3OF1A 2ZHKA 4YNIA 4RHV3 1UQXA 2YXSA 4YG3A 3FL7A 1XSRA 3OGSA 1NCRB 4HKLA 3VKMA 2E7TA 1ZRIA 1OT5A 1RMU1 1UCXA 3C8XA 4YVWC 1OFNA 3NNFA 2XVGA 3IWZA 4DS0A 4HVOA 1WLDA 1QGLA 1W8OA 2ID4A 2GP5A 3DPRA 3A7QA 3PTYA 1KITA 1B35B 3I3EA 4BHPA 5EZWA 5I0TA 5C4WA 1AYM1 4AI8A 5FZBA 4XF4A 4KWKA 1CJDA 2QFEA 4Q4X2 1RUH1 4TWTA 2HWF2 2UURA 2X29A 2XQRA 3PJYA 1JYVA 2IXCA 5J7MA 3B00A 1UY2A 2NQYA 3DYPA 2ORZA 3AYAA 2IXJA 4LO6B 3OEAA 3UK9A 2RDSA 4BB3A 2RS12 4YVWB 5F2SA 1HB1A 2H6CA 1VIWB 3VBUC 3H8RA 2RS13 3GBGA 4INDA 4YPJA 4GJYA 3ZXGA 1UMHA 3MHZA 5JXIA 1W8FA 2FQPA 5LEJA 5IK4A 2WN3A 3LEGA 3THCA 3UL2A 3RZHA 1JZ6A 3MZHA 4LHNA 1AR82 2WFF1 1GUIA 1PGSA 3N7LA 4M3CA 3HQRA 3MGUA 1AUYA 1STMA 4QPIC 1POQA 4K20A 4N9HA 1O4ZA 5F3IA 3LOIA 1LTEA 1H8TA 4BQ4A 4UW5A 5FZKA 3FHIB 5FYTA 1DGRA 2IFRA 2DF7A 3AP7A 2VECA 4CCEA 4COUA 5ACA1 2JB4A 5FO7B 1A34A 4QB1A 3VBUB 1PHMA 1YQ5A 1UMZA 1YRZA 2W0XA 1PK6C 1LJ7A 3MIGA 3AX4A 1DLCA 1G9BA 4LUKA 1MACA 2R042 1G7YA 2HLEA 2NMOA 2X09A 4MXWB 3TNPB 5HV4A 2XWBB 2YFUA 5A7OA 1GZWB 4ES9A 4S2HA 4Q4V1 5AC91 3JB8A 3RGBA 4E4DX 3G7DA 5FR3A 4GZ9A 1ZA4A 1QDCA 2Y6LA 5IUQA 3TEXA 3SLIA 4QPIB 3UETA 4NPLA 1TZOA 2YHJA 3BTYA 4DFSA 2GN7A 1OUXA 3VD4A 2QQMA 4JKLA 4MG2A 1LGCA 3MF9A 4OI1A 4B29A 4B3NA 2VBDA 3WCRA 3VZJA 1QOOA 3E6CC 1H1IA 3KM5A 1J84A 2WZR2 4U36A 3K46A 4AFAA 4NVPA 2BU9A 1PK6B 1GQGA 3LKJA 3MFCA 4FXGB 2LTNA 3KT1A 4YFZA 1JZ7A 5FQ0B 3KWVA 4L92A 4I3PA 4GWMA 3HD8B 3B94A 3DXUA 1BEV3 1F5FA 1EY2A 2D44A 3DXTA 1Z0HA 4YSFA 5L19A 1CAXB 2XOMA 1A3KA 2HEVF 3BOWA 4E4SA 5JMCA 3AFKA 1EUUA 5IT6A 4PCRA 3LA3A 1L7QA 2Z4FA 5DDJ1 5H9PA 1AR62 4UFJA 1H1AA 4ATFA 4YG6A 2W3JA 4IE0A 1CZTA 2QQWA 2ARBA 3H1MA 3HBZA 3T0AA 4A45A 1ULPA 3DV8A 3CZUA 1NLQA 4LO8A 1N1YA 2XLFA 1C1LA 3V0BA 4L0PA 1QJFA 1RMU2 5KWRA 4LITA 3WF2A 1RMU3 4OZXA 1XYPA 2HBTA 5FLHA 3MO4A 3UGFA 3UGHA 4OZOA 1H8VA 1RHI1 2I2SA 2EXKA 2W1UA 4QMAA 4Z07A 3T4HB 2YBPA 3POJA 3DPRC 5KR7A 2VVFA 4GB31 1AYM2 3O1RA 3U4SA 3R4DB 1PMHX 2RVAA 2J1EA 1S0IA 2ZHLA 1ZRFA 3THTA 1DG6A 5C4WC 2ZKLA 4LKDA 1AL0G 1RUH2 3N9QA 3P5BA 4UYBA 2R072 3LOBA 1C8M1 3RZJA 5B2GB 3WV6A 5I0SA 1O8PA 4GH4A 4EN6B 2ADEA 1N3QA 1S0JA 2OUHA 2ZEXA 4XUNA 5J1XA 2YU2A 3AKRA 3IMNA 1L7LA 1MZEA 1YJLA 2PQSA 1F31A 5C3PA 1QJU1 4NHKA 3S6PA 2JENA 2VPVA 4XF0A 3VHRA 1OD5A 4LKEA 5FPUA 1SLTA 1ULCA 5IVYA 5GLTA 4UI9L 1GNZA 1OA4A 3ZKYA 3DPRB 1V6JA 4KNCA 2WNUA 4AZZA 2NN8A 4ATEA 5HI0A 2JIJA 3N36A 5JSPA 4XTMA 2WFF2 4W6XA 4ZZ8A 5C4WB 1C5IA 4Q0VA 2WFF3 4CPBD 5BUVA 3ZIXA 2W47A 3M4FA 3Q8BA 4JHZA 4DXRA 2GNBA 4KU8A 3O1UA 4XVHA 3PMSA 4JCKA 3WDYA 4LT5A 2RM23 5FYIA 3E1F1 2P37A 5ANNA 5FDBA 4Y1VA 2WN2A 3NV4A 3ZXJA 1H8TC 1BK1A 5ACA2 1CR7A 4TYSA 3MDPA 5ACA3 1POV1 3OGGA 4FP3A 3HNYM 5FY5A 5I0UA 1LCLA 3NJYA 5F2WA 3VZNA 3MPPG 1GP5A 3IDEA 4HSJA 5GLWA 5L7OA 3NO8A 5BY5A 4Q4V2 1YWKA 5AC92 1Z78A 2X53S 5FZFA 3P3PA 3V56A 5AC93 2J7MA 2WNEA 3POBA 3KVAA 2EIGA 5A7SA 4X8PA 1H2LA 5M0TA 4BQ1A 1IPKA 4OQ8A 3JB4C 4M3CB 2VBPA 2PHFA 4OMCA 5DUXA 3N7KA 4P9JA 5IAXA 3AZXA 1F4HA 2UWBA 4PLOA 4OLLA 2VZ3A 2CU5A 3PIJA 4QPGA 1G9FA 1SCSA 1H8TB 3WF4A 1Q8VA 2WLPA 2ZABA 4QXCA 3CBNA 2RDNA 3WHTA 3ZN5A 1GOHA 3QH6A 3MUZ1 1SZBA 1XNTA 3RMYA 2VO5A 4KGQA 4XQ4A 3ZO0B 1R091 4K7JA 4UFLA 3U11A 5FCCA 4GMP3 3RZKA 1XB9A 1JBCA 3KT7A 4K1YA 1S0BA 1L3JA 2MPFA 2ZGQA 1A6CA 1BXHA 2HWC3 4LE4A 4OHVA 4Q27A 4COWA 3ZYIB 1A8MA 3CKHA 4CVUA 4I0WB 4BE3A 2WIIB 1VAVA 5DDJ2 4QX7A 1VB4A 3WNXA 5T50A 1CIYA 2B4KA 3ILRA 1YIFA 5DDJ3 2CGPA 4DO0A 3FLRA 4C0HA 4HMZA 1UKGA 2UYAA 2RS31 4LKSA 1ONAA 4NO4A 2IFWA 3DCQA 1SLCA 2X8KA 5E6HA 1GV9A 3U14A 3I7DA 4YVSA 2ZGTA 1CESA 1Q8OA 2LROA 5DMYA 3WG1A 1UZVA 4JTOA 1RHI2 3RYRA 3N9MA 1NQJA 2XHNA 5FY9A 1GICA 1UU4A 2GNDA 2J42A 2JG9C 4GB32 4S2DA 1UAIA 1TMF3 4GB33 4ET7A 5BNNA 3WY6A 1W39A 5EV7A 1XPWA 3MIHA 1XJAA 4PBOA 5DZFA 3IIIA 5LK5A 4OI2A 2IXKA 3JU9A 2QUOA 3WNKA 1C8M2 5KXBA 2V5DA 4META 4NJ4A 4XDPA 1ND2C 4L99A 3SITA 3RZGA 3W5NA 3PVOA 4QX3A 5J98B 1YQ2A 3I2HA 4GH4C 1ALYA 2JDMA 4DXZA 1GQPA 4MVTA 4QM8A 4OHYA 3V0BB 1QJU2 1JMUB 2W1WA 1HB4A 1QJU3 5C8CA 1GFF2 4XUQA 4FPYA 5C3QA 3ORJA 4W6YA 1UZ0A 4JGYC 4QHBA 1O4YA 1US2A 4PDWA 3ZIWA 2JG9B 1JYIA 1SDDB 3IMMA 4W4ZA 5FP7A 1QH7A 4A3XA 4AI9A 2WNUC 4RD7A 3QD6A 2FDGA 5FPLA 2HWE1 2XBO1 3SCFA 3TYJA 1B09A 4YW4A 1WCDJ 2ZAHA 4AVSA 4XCBA 2PFWA 2A6YA 1P8JA 2VTFA 5FMDA 4EN0A 2L9LA 1ND2B 2E6VA 4COZA 1WWYA 3MW3A 4URTA 4A7YA 4RR3A 1W6OB 4GH4B 2Q8CA 4AE2A 2VMGA 4HFSA 4RYDA 4WZCA 5JSOA 2X10A 3NQHA 4QM9A 1OH4A 2VJXA 1POV3 2C9KA 3JQXA 3ON7A 3OUIA 4IL7A 4Q4Y3 3WQ7A 1VBC1 2DFBA 4XETA 3OY8B 1V9U2 2CWMA 4JGYB 4TLGA 3VBSC 3FC0A 4FO9A 3UESA 5HCAA 1UY4A 2OA2A 1KDKA 1RL3A 2A7AA 3U78A 1XE7A 1H6YA 2E32A 2WNUB 4P9WA 5L7OC 3ZN4A 3B01A 3LDBA 3DUIA 4M00A 1S0EA 2VC9A 3ZYGA 2VCCA 4QKNA 2ZTNA 3H8XA 3J7MA 3GJAA 1FV3A 4LBLA 4XFIA 5D2AA 3ZYRA 2PN5A 2Y34A 4QQLA 4XMAA 2XL9A 4AEDA 2ZCWA 4UOJA 4Q26A 3AL5A 4MHUA 1IS3A 2F6BA 5F3CA 1Q8QA 3B9CA 1QNWA 3SXWA 1N1TA 4YM0A 1GKBA 1AXKA 1R092 2YC2A 3VBSB 3C2UA 4J6GA 4RA0A 3WX5A 4Z2AA 3OOXA 4GJZA 1CD3G 5FZ1A 1OC1A 1UPSA 3CZJA 3ZYHA 5L7OB 3WNLA 2C24A 3KHCA 1UIKA 3N3HA 4XF3A 4EWEA 3RQ0A 4CSWA 2ZMKA 4DNYA 1RUD1 1V6KA 2BYVE 5FUNA 4YFWA 2NZ9A 4NR1A 4BMEA 3SH5A 4ES8A 2QQPA 1EV13 3ZFEB 2XHKA 2RS32 4Q1PA 2PHUA 2RS33 5FWEA 4FPLA 4YZ3A 5IVBA 3T0DA 4YM2A 2Z5WA 4AEJA 3ACIA 4YVSC 3AKTA 4Y1XA 4NROA 2QQKA 5FAXA 3X29B 1DGWA 5FO8B 1J58A 1W6QA 4LLOA 1JZ8A 3RI8A 1DQ0A 1MVEA 4GALA 2XUEA 4MGQA 1WLWA 2A6XA 1UMIA 1WW7A 3J7HA 2GN3A 5LA1A 2OYZA 1MEC2 5FPVA 1NAEA 3MI8A 5BPXA 2CDOA 5FREA 5FXZA 4IV1A 1WBFA 4B4QA 4JKKA 2UWCA 3N9NA 1BVVA 4QWNA 5FP4A 1OMIA 4MV2A 5FZ6A 5T5OA 3W58A 4MGTA 3FWEA 3QCWA 4M4RA 4HETA 1HQLA 2ETEA 1NZCA 3EBRA 3CJXA 3VLBB 3LEKA 2MNGA 3NV1A 2GNTA 4YVSB 1OPMA 1PIV1 3BPZA 5FP3A 1LHOA 1FMD1 1O59A 2DU0A 1LEDA 2EXHA 3O7OA 3KMHA 5ANQA 5JZGA 2Y6HA 4FOVA 1REFA 4RQPC 3UJOA 4AHZA 4CXXA 1RYYA 3K3OA 4CCMA 4PDWC 3P3NA 2HWE2 2XBO2 4D0QA 2HWE3 3ZXAC 4IETA 2J1AA 2K0GA 4W50A 5LB6A 3USUA 2PLV1 3PVEA 2WQ8A 4EV0A 4Z92B 3A21A 1J1TA 2WYSA 1WUVA 1WW5A 4RR3C 1Q3EA 2VQTA 3UT0A 3VUOA 1PZ8A 1DF0A 1QNYA 4XJ9A 4BXFA 4K40A 2XPJA 1VBC2 1OOPA 3TAYA 1VBC3 5DUVA 1MVQA 3MYXA 1DYKA 2W94A 3H7JA 4RQPB 5T55A 5EQUA 3RMXA 5CA6A 4PDWB 3BUCA 4BK4A 2F4LA 1NLRA 4AW7A 3KCYA 1G6NA 1K45A 3C7GA 1CPMA 3AJZA 1N1SA 3J26N 4J1WA 5ERLA 4R4XA 4QDQA 4WVWA 5K7PA 1CAUA 1VMFA 3IZOA 5JMOA 4MXVA 2Q8EA 3LA2A 2OVUA 4RR3B 1PVC1 4HLTA 2VCBA 2BPA2 3M3OA 1ZBA1 3MLLA 4XIKA 4CCLA 1ZVFA 5F7UA
chains in the Genus database with same CATH topology
2J1SA 1HN1A 1W9SA 1K3IA 4LQRA 4BXSV 1LNSA 5JXJA 4A3ZA 4DUXA 1SHWB 4IUGA 2YG0A 1R64A 1UXZA 4BJ0A 4ARYA 3GM8A 3LQCA 3C7HA 2JKXA 4RN5A 4QB2A 2E31A 2E26A 3FL7A 3OGSA 4XUTA 1OT5A 3C8XA 3WNPA 2J22A 1IQDC 1W8OA 2ID4A 3A7QA 3I3EA 1GU3A 5IJRA 4P08A 5JUVA 4DEQA 4MO3M 1JYVA 5EJ1B 3K4DA 1UY2A 3DYPA 2ORZA 3OEAA 3NNGA 4YPJA 3WQBA 4CU6A 1EUTA 1UMHA 2Y64A 3GXUA 4OUEA 5JXIA 3D3AA 3T0BA 2XQXA 2WN3A 3LEGA 3THCA 4D8MA 1JZ6A 4AG4A 4DXSA 3OG2A 2W1QA 4OYUA 1UY0A 1GUIA 1H6XA 3MBWA 3NRUA 3SKVA 2QQNA 3I2GA 4JKMA 3VDCA 5C7GA 1OF3A 4QB1A 1W0NA 4QX0A 2BGOA 2QBXA 1DLCA 2X09A 2HLEA 2YFUA 3NJXA 4GZ9A 2Y6LA 4QAWA 3WF1A 3UETA 1JHJA 5CYYA 2VQUA 3VD4A 2QQMA 4JKLA 3ZM8A 2EICA 2WZEA 1J84A 5I0DA 3K46A 1TG7A 5IYYA 1W9WA 5LCWL 1JYNA 1JZ7A 5F7UA 5JR2A 3NJVA 2R7EB 1GMMA 3T09A 4CUAA 3I3DA 2XOMA 4AAXA 3SEEA 1EUUA 4QX1A 1CZVA 1L7QA 3ETPA 2Z4FA 3F2ZA 3T08A 2W3JA 1CZTA 4XUOA 2BZDA 1T2XA 3I2IA 4FI9A 3FHAA 3T0AA 4A45A 1ULPA 3CZUA 2RV9A 4L0PA 3GGLA 3W5MA 3THDA 3WF2A 1TVGA 5B4XA 1UYZA 3MO4A 4DEVA 3LPFA 4OZOA 1PX3A 2W1UA 4A42A 3CIHA 1K42A 1JYXA 1PMHX 2RVAA 4GWIA 2J1EA 3C7OA 2WUHA 3K4ZA 1WCQA 3ACFA 3HEIA 3FHQA 5HXMA 4A41A 1O8PA 4XUNA 5J1XA 2ZEXA 3MV01 3HN3A 2PQSA 2J1UA 3ABZA 3WSOA 5DN2A 4A4AA 4UI9L 3LPGA 3DYOA 2VZTA 1PMJX 1NKGA 1D7PM 3HNMA 4UAPA 1F4AA 4ZZ8A 5DPNA 2WO2A 4QDSA 2W47A 4JHZA 3MV11 2YB7A 4DXRA 1JU4A 3ACGA 4XVHA 2VZSA 2JDAA 2Y8KA 3E1F1 4MADA 2LW8A 2WN2A 4E8DA 1ULOA 4MGSA 1W9TA 2QQJA 3HNYM 5CZKA 2J1TA 3T2OA 3OEBA 4ARXA 4KI5M 2VM9A 2J1RA 1CX1A 2ZEYA 2VR4A 1I5PA 3ECQA 2J7MA 2VZOA 3LE0A 4OMCA 3A23A 1F4HA 3C7EA 3VD5A 1UYYA 2VZ3A 3OBAA 3WF4A 3A22A 4TXWA 2VZUA 1UWWA 2VZRA 2YC4A 4P02B 3CDZB 4BDVB 1GOHA 2Y6JA 4ZZ5A 1JZ4A 1OF4A 2VMCA 3AC0A 3MUZ1 1XNTA 2VO5A 4CUBA 4DUWA 2XONA 1PX4A 3I97A 2C26A 3CKHA 4CVUA 3IAQA 1J83A 3T2QA 4XUPA 1CIYA 2B4KA 3EYPA 2ORXA 2WAOA 2JD9A 4LKSA 3VD9A 2WBKA 2J1VA 2WDBA 3WF3A 1L7RA 5IFPA 1KGYA 5DMYA 3WEZA 3HNBM 4CUCA 4E8CA 2VMEA 1XC6A 1UXXX 4PT6A 2XHNA 2V4VA 4ET7A 2Y6GA 2YFZA 2VMFA 4LPLA 3HPNA 4PF1A 1XPWA 1GOFA 3IIIA 1JYWA 1UY3A 3WNKA 2V5DA 4GWJA 2VZVA 3W5NA 4QX3A 1YQ2A 3I2HA 3OGVA 3P6BA 1GQPA 2EIBA 5EIYB 2VMDA 5A1AA 2W1WA 3DYMA 4A44A 1W8NA 2JE8A 4XUQA 3CMGA 1JI6A 1UZ0A 1US2A 1SDDB 4HG6B 2X05A 4P5YA 4W4ZA 2DCJA 2WAAA 2W46A 3VDAA 4JX0A 2VTFA 1P8JA 2WZ8A 2RJ2A 2L9LA 3SKJE 2DDUA 3K4AA 2E33A 1OD3A 4RYDA 4CU8A 2X10A 3NQHA 1OH4A 3I3BA 2VJXA 3JXSA 2C9KA 5JXGA 5EJZB 3UESA 1JZ5A 1UY4A 1DYOA 2Y6KA 3C7FA 1WKYA 1H6YA 1UYXA 2E32A 2ZEZA 3CQOA 5LA2A 2V72A 2VC9A 3WNNA 3WNMA 2BERA 2VCCA 4PQQA 5DQ0A 5HPOA 2ZXQA 3K77A 4TTGA 2HYXA 2KD7A 2W91A 4UOJA 5G04L 2QQOA 4KWUA 2VZPA 2WO1A 1GNYA 4ZY9A 4Z2AA 2YC2A 2OKXA 5G05L 3CZJA 3VD7A 3WNLA 2W92A 5FUIA 2QQIA 2ZEWA 1W99A 4BK5A 2W1SA 4LHSA 4ZXEA 3IB3A 2W95A 1NX9A 3VD3A 1JZ3A 1GOGA 3T0DA 3VDBA 4XURA 3HJRA 3IAPA 2C4XA 3ACIA 1JZ2A 2VCAA 1XNAA 2QQKA 4OMDA 3U37A 5C70A 3PUIA 1JZ8A 1DP0A 3UNPA 3EB7A 1KEXA 1UY1A 1US3A 4MGQA 2DCKA 1UMIA 3J7HA 5JXHA 5LA1A 2VL4A 3MUY1 3OGRA 1NAEA 2CDOA 3OB8A 4M4PA 3FN9A 4JKKA 4QX2A 5IFTA 4M4RA 3LEKA 3K75B 1BHGA 5C71A 2VOTA 1O8SA 4W8JA 3BGAA 3HOBA 2WABA 1O59A 4QDRA 3IDAA 2BBAA 1SG3A 2B9VA 2VZQA 2Y6HA 2W5FA 1RYYA 3PUHA 3LEIA 3I2JA 3T2PA 4D0QA 2J1AA 4W50A 1JU3A 4DXTA 2WQ8A 4CU7A 4XZUG 3A21A 2WYSA 4QB6A 3ACHA 4DUVA 2VQTA 4A6OA 2VZ1A 5LA0A 3I2KA 5B4NA 3WNOA 3SEPA 4QPWA 2W94A 3P1IA 1MPXA 4BK4A 4P00B 1CZSA 2W87A 1K45A 3C7GA 2LS6A 3I2FA 4QDQA 2QQLA 2W9XA 2CDPA 5JMOA 4KMQA 5IHRA 2EIDA 2WO3A 4CU9A 3GDBA 3BN6A 2VCBA 3WF0A 1UX7A 1NUKA 1K12A 2EIEA 3DECA 4MOAA 2BGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J1S A;  1HN1 A;  1W9S A;  1K3I A;  4LQR A;  4BXS V;  1LNS A;  5JXJ A;  4A3Z A;  4DUX A;  1SHW B;  4IUG A;  2YG0 A;  1R64 A;  1UXZ A;  4BJ0 A;  4ARY A;  3GM8 A;  3LQC A;  3C7H A;  2JKX A;  4RN5 A;  4QB2 A;  2E31 A;  2E26 A;  3FL7 A;  3OGS A;  4XUT A;  1OT5 A;  3C8X A;  3WNP A;  2J22 A;  1IQD C;  1W8O A;  2ID4 A;  3A7Q A;  3I3E A;  1GU3 A;  5IJR A;  4P08 A;  5JUV A;  4DEQ A;  4MO3 M;  1JYV A;  5EJ1 B;  3K4D A;  1UY2 A;  3DYP A;  2ORZ A;  3OEA A;  3NNG A;  4YPJ A;  3WQB A;  4CU6 A;  1EUT A;  1UMH A;  2Y64 A;  3GXU A;  4OUE A;  5JXI A;  3D3A A;  3T0B A;  2XQX A;  2WN3 A;  3LEG A;  3THC A;  4D8M A;  1JZ6 A;  4AG4 A;  4DXS A;  3OG2 A;  2W1Q A;  4OYU A;  1UY0 A;  1GUI A;  1H6X A;  3MBW A;  3NRU A;  3SKV A;  2QQN A;  3I2G A;  4JKM A;  3VDC A;  5C7G A;  1OF3 A;  4QB1 A;  1W0N A;  4QX0 A;  2BGO A;  2QBX A;  1DLC A;  2X09 A;  2HLE A;  2YFU A;  3NJX A;  4GZ9 A;  2Y6L A;  4QAW A;  3WF1 A;  3UET A;  1JHJ A;  5CYY A;  2VQU A;  3VD4 A;  2QQM A;  4JKL A;  3ZM8 A;  2EIC A;  2WZE A;  1J84 A;  5I0D A;  3K46 A;  1TG7 A;  5IYY A;  1W9W A;  5LCW L;  1JYN A;  1JZ7 A;  5F7U A;  5JR2 A;  3NJV A;  2R7E B;  1GMM A;  3T09 A;  4CUA A;  3I3D A;  2XOM A;  4AAX A;  3SEE A;  1EUU A;  4QX1 A;  1CZV A;  1L7Q A;  3ETP A;  2Z4F A;  3F2Z A;  3T08 A;  2W3J A;  1CZT A;  4XUO A;  2BZD A;  1T2X A;  3I2I A;  4FI9 A;  3FHA A;  3T0A A;  4A45 A;  1ULP A;  3CZU A;  2RV9 A;  4L0P A;  3GGL A;  3W5M A;  3THD A;  3WF2 A;  1TVG A;  5B4X A;  1UYZ A;  3MO4 A;  4DEV A;  3LPF A;  4OZO A;  1PX3 A;  2W1U A;  4A42 A;  3CIH A;  1K42 A;  1JYX A;  1PMH X;  2RVA A;  4GWI A;  2J1E A;  3C7O A;  2WUH A;  3K4Z A;  1WCQ A;  3ACF A;  3HEI A;  3FHQ A;  5HXM A;  4A41 A;  1O8P A;  4XUN A;  5J1X A;  2ZEX A;  3MV0 1;  3HN3 A;  2PQS A;  2J1U A;  3ABZ A;  3WSO A;  5DN2 A;  4A4A A;  4UI9 L;  3LPG A;  3DYO A;  2VZT A;  1PMJ X;  1NKG A;  1D7P M;  3HNM A;  4UAP A;  1F4A A;  4ZZ8 A;  5DPN A;  2WO2 A;  4QDS A;  2W47 A;  4JHZ A;  3MV1 1;  2YB7 A;  4DXR A;  1JU4 A;  3ACG A;  4XVH A;  2VZS A;  2JDA A;  2Y8K A;  3E1F 1;  4MAD A;  2LW8 A;  2WN2 A;  4E8D A;  1ULO A;  4MGS A;  1W9T A;  2QQJ A;  3HNY M;  5CZK A;  2J1T A;  3T2O A;  3OEB A;  4ARX A;  4KI5 M;  2VM9 A;  2J1R A;  1CX1 A;  2ZEY A;  2VR4 A;  1I5P A;  3ECQ A;  2J7M A;  2VZO A;  3LE0 A;  4OMC A;  3A23 A;  1F4H A;  3C7E A;  3VD5 A;  1UYY A;  2VZ3 A;  3OBA A;  3WF4 A;  3A22 A;  4TXW A;  2VZU A;  1UWW A;  2VZR A;  2YC4 A;  4P02 B;  3CDZ B;  4BDV B;  1GOH A;  2Y6J A;  4ZZ5 A;  1JZ4 A;  1OF4 A;  2VMC A;  3AC0 A;  3MUZ 1;  1XNT A;  2VO5 A;  4CUB A;  4DUW A;  2XON A;  1PX4 A;  3I97 A;  2C26 A;  3CKH A;  4CVU A;  3IAQ A;  1J83 A;  3T2Q A;  4XUP A;  1CIY A;  2B4K A;  3EYP A;  2ORX A;  2WAO A;  2JD9 A;  4LKS A;  3VD9 A;  2WBK A;  2J1V A;  2WDB A;  3WF3 A;  1L7R A;  5IFP A;  1KGY A;  5DMY A;  3WEZ A;  3HNB M;  4CUC A;  4E8C A;  2VME A;  1XC6 A;  1UXX X;  4PT6 A;  2XHN A;  2V4V A;  4ET7 A;  2Y6G A;  2YFZ A;  2VMF A;  4LPL A;  3HPN A;  4PF1 A;  1XPW A;  1GOF A;  3III A;  1JYW A;  1UY3 A;  3WNK A;  2V5D A;  4GWJ A;  2VZV A;  3W5N A;  4QX3 A;  1YQ2 A;  3I2H A;  3OGV A;  3P6B A;  1GQP A;  2EIB A;  5EIY B;  2VMD A;  5A1A A;  2W1W A;  3DYM A;  4A44 A;  1W8N A;  2JE8 A;  4XUQ A;  3CMG A;  1JI6 A;  1UZ0 A;  1US2 A;  1SDD B;  4HG6 B;  2X05 A;  4P5Y A;  4W4Z A;  2DCJ A;  2WAA A;  2W46 A;  3VDA A;  4JX0 A;  2VTF A;  1P8J A;  2WZ8 A;  2RJ2 A;  2L9L A;  3SKJ E;  2DDU A;  3K4A A;  2E33 A;  1OD3 A;  4RYD A;  4CU8 A;  2X10 A;  3NQH A;  1OH4 A;  3I3B A;  2VJX A;  3JXS A;  2C9K A;  5JXG A;  5EJZ B;  3UES A;  1JZ5 A;  1UY4 A;  1DYO A;  2Y6K A;  3C7F A;  1WKY A;  1H6Y A;  1UYX A;  2E32 A;  2ZEZ A;  3CQO A;  5LA2 A;  2V72 A;  2VC9 A;  3WNN A;  3WNM A;  2BER A;  2VCC A;  4PQQ A;  5DQ0 A;  5HPO A;  2ZXQ A;  3K77 A;  4TTG A;  2HYX A;  2KD7 A;  2W91 A;  4UOJ A;  5G04 L;  2QQO A;  4KWU A;  2VZP A;  2WO1 A;  1GNY A;  4ZY9 A;  4Z2A A;  2YC2 A;  2OKX A;  5G05 L;  3CZJ A;  3VD7 A;  3WNL A;  2W92 A;  5FUI A;  2QQI A;  2ZEW A;  1W99 A;  4BK5 A;  2W1S A;  4LHS A;  4ZXE A;  3IB3 A;  2W95 A;  1NX9 A;  3VD3 A;  1JZ3 A;  1GOG A;  3T0D A;  3VDB A;  4XUR A;  3HJR A;  3IAP A;  2C4X A;  3ACI A;  1JZ2 A;  2VCA A;  1XNA A;  2QQK A;  4OMD A;  3U37 A;  5C70 A;  3PUI A;  1JZ8 A;  1DP0 A;  3UNP A;  3EB7 A;  1KEX A;  1UY1 A;  1US3 A;  4MGQ A;  2DCK A;  1UMI A;  3J7H A;  5JXH A;  5LA1 A;  2VL4 A;  3MUY 1;  3OGR A;  1NAE A;  2CDO A;  3OB8 A;  4M4P A;  3FN9 A;  4JKK A;  4QX2 A;  5IFT A;  4M4R A;  3LEK A;  3K75 B;  1BHG A;  5C71 A;  2VOT A;  1O8S A;  4W8J A;  3BGA A;  3HOB A;  2WAB A;  1O59 A;  4QDR A;  3IDA A;  2BBA A;  1SG3 A;  2B9V A;  2VZQ A;  2Y6H A;  2W5F A;  1RYY A;  3PUH A;  3LEI A;  3I2J A;  3T2P A;  4D0Q A;  2J1A A;  4W50 A;  1JU3 A;  4DXT A;  2WQ8 A;  4CU7 A;  4XZU G;  3A21 A;  2WYS A;  4QB6 A;  3ACH A;  4DUV A;  2VQT A;  4A6O A;  2VZ1 A;  5LA0 A;  3I2K A;  5B4N A;  3WNO A;  3SEP A;  4QPW A;  2W94 A;  3P1I A;  1MPX A;  4BK4 A;  4P00 B;  1CZS A;  2W87 A;  1K45 A;  3C7G A;  2LS6 A;  3I2F A;  4QDQ A;  2QQL A;  2W9X A;  2CDP A;  5JMO A;  4KMQ A;  5IHR A;  2EID A;  2WO3 A;  4CU9 A;  3GDB A;  3BN6 A;  2VCB A;  3WF0 A;  1UX7 A;  1NUK A;  1K12 A;  2EIE A;  3DEC A;  4MOA A;  2BGP A; 
#chains in the Genus database with same CATH topology
 1I1E A;  3E5Q A;  4CCK A;  4JGZ A;  1HN1 A;  5FP8 A;  4PIY A;  4ERO A;  5FO9 B;  3NVC A;  4BXS V;  4XCA A;  4BU2 A;  4JQT A;  4GAZ A;  1W04 A;  3NNJ A;  1BBT 1;  2EVX A;  2XKO A;  3QAC A;  1RVF 3;  2OX0 A;  2WJS A;  4S2G A;  2QVS B;  3GM8 A;  4HSL A;  4ARY A;  4D7S A;  3LEM A;  3GBF A;  3LQC A;  3BAL A;  5KHH A;  2IXI A;  1RUD 2;  3WR0 A;  1ZZ8 A;  1RUD 3;  3W59 A;  2E31 A;  2E26 A;  4MH0 E;  2D6K A;  2BBV A;  1GZC A;  2MHF A;  1ACC A;  2ZZJ A;  1E57 A;  5J96 B;  2YMZ A;  1HV1 A;  1FAY A;  3GZU C;  2J22 A;  1YFU A;  5JSR A;  3G6J B;  4NPM A;  3FBY A;  1LKN A;  4NAM A;  1VBB 1;  2YGL A;  3PVN A;  1Q56 A;  1ZZ6 A;  4BH9 A;  1CGP A;  3V0A B;  1VMJ A;  3CL1 A;  4BIS A;  2A70 A;  2ZJC A;  5FXW A;  5A3T A;  1JYT A;  2WZP P;  1YQ6 A;  3FE5 A;  4FPG A;  1YI7 A;  3AP4 A;  4F8A A;  5F37 A;  1F35 A;  3POW A;  3DF0 A;  4LOT A;  5F3G A;  5T3N A;  3TRS B;  3NAP A;  4MO3 M;  1Q8S A;  3EMR A;  5KBF A;  4TZD A;  5DG2 A;  3O1O A;  3K4D A;  1TEI A;  2NPI A;  1PZ9 A;  3KS7 A;  1VBE 1;  2A6Z A;  4IV1 C;  1KDM A;  3T2T A;  3NNG A;  2JDU A;  3VZO A;  2G9Z A;  2G1M A;  4RS5 A;  1EUT A;  4LBQ D;  3D8C A;  1PGL 1;  5DZG A;  1RIN A;  2Y64 A;  4PIZ A;  3KV9 A;  3GXU A;  4H55 A;  4OUE A;  1U5Y A;  2HEW F;  1PIV 2;  4IER A;  3QBQ A;  4L2N A;  3T0B A;  1WCU A;  1FMD 2;  1PIV 3;  4FFI A;  4NRM A;  2WKK A;  4YAR A;  4OUS A;  4AG4 A;  1SBF A;  4LNV A;  5JZG C;  3VN4 A;  5A3W A;  1H6X A;  3MBW A;  2FZ2 A;  2ZX4 A;  2A3W A;  3UKV A;  4RGG A;  3NW4 A;  2QQN A;  5D8A A;  3I2G A;  1UN1 A;  2N7G A;  5EWS A;  4JKM A;  2R1B A;  1KS4 A;  1O4T A;  3O12 A;  1JYC A;  5C7G A;  3RYK A;  4MLO A;  5FZ4 A;  5LK7 B;  3O5S A;  3U0Z A;  2PLV 2;  2FDH A;  2ZBJ A;  3OUH A;  3Q8E A;  1Z7S 3;  2YZ4 A;  4JDN A;  3AL6 A;  2VY0 A;  4CYD A;  4IV1 B;  4BQ3 A;  2XJU A;  3GNE A;  3KV4 A;  1DIW A;  5F39 A;  2QBX A;  4XZP A;  2H0V A;  1YQ8 A;  2VUC A;  1CJP A;  1LES A;  3M3Q A;  3MF6 A;  4PHZ A;  4Q4W 1;  5FZE A;  2ENR A;  1OOP C;  5JZG B;  4I0A A;  1BLZ A;  1H9W A;  3AMH A;  3C3V A;  2VD7 A;  4CTE A;  5JOY A;  4D7T A;  5FJK A;  1RUC 3;  5FIX A;  3E5X A;  4F83 A;  5FMC A;  5IK7 A;  2B7Y A;  5T54 A;  1JW6 A;  4YGD A;  2RS5 1;  2IC1 A;  2JKB A;  2B5H A;  1V6M A;  2EIC A;  2XL7 A;  2V4A A;  5FY7 A;  4BWO A;  2R06 1;  2WZE A;  1W2N A;  1ENS A;  1VRH 3;  3AK0 A;  3RWK X;  1LEC A;  4UFK A;  1PK6 A;  2P17 A;  3WW1 A;  2YV8 A;  1PVC 2;  3MIB A;  3NJV A;  1ZBA 2;  1GMM A;  4Y5T A;  1I3H A;  2OW4 A;  3HT1 A;  3GHM A;  3I3D A;  1LOD A;  4NIA A;  2HEY F;  4J1X A;  2XVK A;  4CEW A;  1OOP B;  1WD4 A;  1OA3 A;  3AZV A;  5FYH A;  1HN0 A;  3JD7 1;  4WVM A;  4A7K A;  3HN1 A;  5FYU A;  5JOW A;  3D0S A;  1BBT 2;  1RUF 1;  3ETP A;  1BBT 3;  3H50 A;  3H8U A;  3WUC A;  3T08 A;  3BU0 A;  2BVB A;  3VBO A;  4P14 A;  2BZD A;  1T2X A;  4FI9 A;  4N53 A;  1CAU B;  1WBL A;  1ZZ9 A;  2GZW A;  4P9Y A;  4IE4 A;  1H4G A;  1WW6 A;  1VBB 2;  2LM3 A;  5FZO A;  3LPF A;  1XBF A;  2WWS A;  4LK7 A;  1YYN A;  4CEY A;  3CIH A;  1GAN A;  4LMF A;  4OCT A;  4X6R B;  2FDJ A;  1K42 A;  1PO2 3;  2CNA A;  4LKF A;  3E6D A;  4WV8 A;  4YGB A;  2P5B A;  4ZS3 A;  4AVC A;  1IKQ A;  4UT5 A;  4R9C A;  3KSC A;  1AR6 1;  2VMH A;  2GAL A;  2EAK A;  1REE A;  3HEI A;  1MS4 A;  4UFI A;  3J4U H;  2DUQ A;  1A8D A;  2GC0 A;  2ZGM A;  3NAP C;  4AI1 A;  4Q0U A;  3D82 A;  1HJG A;  5EYY A;  3SCH A;  1DYP A;  3HN3 A;  3WT3 A;  1GLH A;  4AGV A;  3B02 A;  3S0M A;  1VBE 2;  1W2O A;  5CKM A;  3VGI A;  2J1U A;  4AGG A;  3IM0 A;  2VCM A;  2P3J A;  1PGL 2;  4A4A A;  4RS5 C;  3IPV A;  2Y0I A;  3LPG A;  4CCD A;  4XW3 A;  1S2E A;  1NKG A;  2ADD A;  4DRR A;  4J25 A;  5FK8 A;  4OHZ A;  1HRI 1;  1RC6 A;  5ISL A;  1W6P A;  1F4A A;  1W8W A;  2WT1 A;  4L8Q A;  2XLA A;  3KF5 A;  1H2M A;  1YFW A;  2FMY A;  1C57 A;  2QKD A;  4QD2 A;  4LHL A;  1TNR A;  5EP9 A;  2QTW B;  2R07 1;  1RUG 2;  2YB7 A;  4Q4X 3;  2BNO A;  1KJL A;  2HWF 3;  3LCP A;  3LSD A;  3NAP B;  5D8A C;  4DZG A;  1FI2 A;  2ATF A;  2Y8K A;  3CEW A;  3RPQ A;  3UJQ A;  2B8M A;  4KG0 A;  4L97 A;  2XB6 C;  3APB A;  1JUI A;  1WCK A;  1ULO A;  2PTM A;  1PNF A;  1W9T A;  2JG8 A;  4MGS A;  4XE9 A;  4YGE A;  5FK7 A;  1LOG A;  4B1M A;  4NUB A;  2J1T A;  4RS5 B;  2WL1 A;  4HON A;  3M8L A;  4JRL A;  1LUL A;  4HK9 A;  5F8P A;  1BZW A;  4AHX A;  2ET7 A;  1QOT A;  2CGN A;  5GLZ A;  3WOG A;  4Q4W 2;  1I5P A;  1FX5 A;  1XE0 A;  4AL9 A;  4BPZ A;  2D6P A;  1DQ6 A;  1AR8 3;  5T5P A;  3A23 A;  1GBG A;  5D8A B;  3W20 A;  5HCB A;  1T6B X;  2RS5 2;  2PAK A;  1ZA7 A;  1MS9 A;  4Y22 B;  3SMH A;  4CCJ A;  3GCW A;  3K51 A;  1G9A A;  2R06 2;  2AGS A;  1ULE A;  1UL9 A;  2VW2 A;  1SLL A;  4CCN A;  1N1V A;  1SFN A;  1OPO A;  2R06 3;  3A22 A;  4TXW A;  2AZ5 A;  5FZL A;  1UWW A;  2VZR A;  4XYX A;  3TBD A;  3CDZ B;  3VBF C;  1ZZ7 A;  2NMN A;  2XH6 A;  2Y6J A;  2O0O A;  1K5M A;  3ASI A;  3ES4 A;  1JZ4 A;  4EYU A;  2GP3 A;  2BFU L;  2YC0 A;  5E16 A;  4CCC A;  2VXJ A;  3FFZ A;  4BZ4 A;  3RNS A;  1LHN A;  4ZS2 A;  2R04 3;  3O1P A;  5F5A A;  5HXV A;  2CY6 A;  5L9V A;  1XU1 A;  2DVG A;  2XDV A;  3BVC A;  3I97 A;  3JD7 2;  4CEW C;  4LA3 A;  4HAN A;  3IAQ A;  3NNM A;  1RUF 2;  1ZRD A;  1N3O A;  4V1P A;  2Y33 A;  1RUF 3;  2WNO A;  1D2Q A;  3A0N A;  4BOW A;  4EE2 A;  2FD8 A;  3I2O A;  1EAH 1;  1HKD A;  1H2K A;  3OTF A;  2ORX A;  5BNQ A;  2WAO A;  3VKN A;  3JCI A;  5IW0 A;  3VBO C;  2JD9 A;  1IPJ A;  5C9A C;  2OII A;  4KBZ A;  3VBF B;  1IG0 A;  4MGY E;  4N53 C;  2WZR 3;  1L7R A;  1YLL A;  3ZSJ A;  4HKO A;  4G9S B;  5CU1 A;  5SV8 A;  4QKF A;  3LDK A;  3SH4 A;  2PXJ A;  1XC6 A;  5JCT A;  4Y1Y A;  1UXX X;  4WM7 A;  1NE6 A;  4CEW B;  1ZRC A;  4DMI A;  1DU3 D;  2PEL A;  2V4V A;  3T4V A;  2BTV C;  1JOB A;  4CEY C;  2YFZ A;  4WVM B;  5EXO A;  5A6Y A;  4LPL A;  3HPN A;  3BPS A;  1GOF A;  4QQP A;  4GKX A;  1JYW A;  1UY3 A;  5HBA A;  1PO1 1;  3VZK A;  1AR6 3;  3AKQ A;  3VBO B;  2UWA A;  1S55 A;  2G9F A;  4FPJ A;  4GWN A;  1PNG A;  4CDU A;  5C9A B;  2E7Q A;  1MZ5 A;  4N53 B;  1LEM A;  1I9R A;  3E6B A;  2IXH A;  5FY8 A;  5GZE A;  3RRD A;  5F6L B;  3HBK A;  2EIB A;  3P6B A;  2BJS A;  5C8W A;  4JDM A;  5A1A A;  4K8F A;  5KC5 A;  5JIA A;  5LBB A;  3ZX7 A;  2Q1Z B;  4RFR B;  4HVQ A;  2D5F A;  3ZMO A;  3DKQ A;  3CMG A;  1ENX A;  5FZO B;  2JG9 A;  4FPE A;  3HIF A;  2X05 A;  2FCV A;  4CEY B;  2XGX A;  4E4H A;  1HRI 2;  4FBF A;  2PHT A;  3BCW A;  1TME 1;  2QJV A;  5C5U A;  1LGB A;  3BIW E;  1AYM 3;  2BOJ A;  5FRA A;  4AHW A;  2WC2 A;  4PJY A;  3PVB B;  4AXO A;  2BRT A;  2NP0 A;  1ND2 A;  2RJ2 A;  3EHK A;  1JHN A;  1RUH 3;  2R6Q A;  1DDL A;  1LR5 A;  1VJ2 A;  2R07 3;  3POE A;  2VH9 A;  3EJK A;  1W6O A;  2OZ6 A;  3K4A A;  4LBN A;  1D2S A;  3VBH A;  3WIN E;  3TWI A;  1WLT A;  4C90 A;  4E4Z A;  3IDC B;  3R4U A;  1QXJ A;  4CU8 A;  2YPD A;  4HL0 A;  3ZFF A;  4UXA A;  5FLJ A;  5HV0 A;  1NZI A;  1MS1 A;  2JG8 C;  1ST8 A;  2D3S A;  1V00 A;  2FZ1 A;  2Y0O A;  3OY8 A;  4JGY A;  1Y9M A;  2ARE A;  3ZXF A;  3IPV B;  1YC6 1;  2JE9 A;  5H9S A;  1WKY A;  2VNO A;  3FZ3 A;  4P9G A;  1UYX A;  3BYW A;  1MZ6 A;  4JVA A;  4WVZ A;  1RUE 1;  3RS6 A;  5EJ3 A;  4BQX A;  1W6P B;  4K8R B;  5FMO S;  4CP1 A;  1VAM A;  5LA2 A;  2V72 A;  3O1T A;  2P1B A;  1ND3 A;  2BER A;  3PU3 A;  4DPN A;  5DQ0 A;  2D6L X;  4NMI A;  1W3V A;  1OUR A;  3K77 A;  5EHD A;  3MIF A;  4R9D A;  4O9E A;  2HYX A;  2D3P A;  2QQO A;  2WT0 A;  2H0B A;  2JG8 B;  3TOJ A;  4RL7 A;  2JWP A;  3FUQ A;  3I8T A;  1DQ1 A;  2EA7 A;  5FYS A;  3VBS A;  1K5M C;  4XPV A;  1V9U 1;  1SBD A;  1XXN A;  3F95 A;  1RUJ 2;  1C4R A;  5G05 L;  3WDV A;  4IGO A;  1UOJ A;  2CHH A;  3JUU A;  2PHD A;  4Q4V 3;  4QGL A;  4QX8 A;  2W92 A;  4N8M A;  3CJI A;  5FUI A;  2NYY A;  3D5O A;  2QQI A;  1FNY A;  1OUS A;  2ZEW A;  2ES3 A;  2WRA A;  5I8S A;  4X8N A;  3O0V A;  1OFS A;  3ZFE A;  2V09 A;  1EAH 2;  1EPZ A;  1CWP A;  4QU2 A;  2ZGP A;  3B7M A;  4MGI E;  4M01 A;  4HN0 A;  3IB3 A;  1HJF A;  1OLM E;  5AVA A;  3OSD A;  4IES A;  1OVP A;  1YCI A;  4CDW C;  2DVB A;  4AVA A;  4XFB A;  3VDB A;  3HJR A;  2JXA A;  3IAP A;  1ENR A;  1K5M B;  3VV1 A;  3PU8 A;  1S1A A;  5FYV A;  4B7E A;  4KH9 A;  1JZ2 A;  3BIE A;  4KU7 A;  1BK0 A;  3SQO A;  1JUH A;  3UGG A;  1EPW A;  4LIV A;  5C70 A;  4EN9 B;  1WW4 A;  4D6S A;  4WM7 C;  3ILN A;  1KEX A;  2VG9 A;  2Q30 A;  4OVE A;  3V64 A;  2WSU A;  3GJB A;  1QDO A;  3DN7 A;  5JXH A;  2XWJ B;  2B45 X;  2VTX A;  4XTP A;  5CVR A;  3OPT A;  2YBK A;  4HZF A;  1PO1 2;  2ZHM A;  4IE7 A;  5FZ9 A;  4XBL A;  3GAL A;  5F1R A;  2YU1 A;  1RED A;  3M70 A;  2DFC A;  3ZXD A;  4CDW B;  4H14 A;  4CDU C;  1RTV A;  1W6M A;  1AR7 1;  2JB8 A;  1PMI A;  4CPB A;  4XJZ A;  1FOD 1;  3VB9 A;  1G86 A;  2VOT A;  2BGC A;  4W8J A;  2PHR A;  4LBM A;  3BGA A;  3HOB A;  2G9G A;  2WAB A;  2AUY A;  4LK6 A;  2P3Y A;  4RGA A;  4CUG A;  2W5F A;  2YBS A;  1RHI 3;  2Y26 A;  4WM7 B;  3Q9O A;  3ATG A;  4IEX A;  1TME 2;  1O3T A;  4NID A;  1TME 3;  1U5I A;  4IEU A;  1IS4 A;  3T2P A;  2IUW A;  4M3C F;  1JU3 A;  1MEC 1;  4H2A A;  2O14 A;  3ZMN A;  1HDK A;  5L9R A;  1C8M 3;  3B93 A;  4CDU B;  3DKW A;  4NIG A;  2JDH A;  1HXS 1;  3ACH A;  1GWM A;  5GAL A;  3VBH C;  5J09 A;  2HH9 A;  5JI7 A;  3VKF C;  4IEW A;  3AZW A;  4DRV A;  2WYF A;  3HQU A;  5LA0 A;  1LOF C;  3ZFF C;  4LOS A;  5FZH A;  1OKQ A;  4IE6 A;  1SPP A;  2TUN A;  3KHB A;  3MLJ A;  4RQP A;  1NY7 1;  4KBB A;  3SEP A;  5C3O A;  4C1X A;  3P1I A;  4CP9 A;  4EZ4 A;  3BTA A;  1RUE 2;  1TQ5 A;  2UYB A;  4V2W A;  2W87 A;  1RUE 3;  4FAH A;  2D6N A;  2ARC A;  2LS6 A;  4OUM A;  2VBB A;  3JZV A;  1BCX A;  4N43 A;  3H3L A;  1ND3 C;  5DAX A;  1J3P A;  5EYX A;  1UKR A;  2D7F A;  1QJX 1;  3VBH B;  4CU9 A;  3GDB A;  4CP0 A;  3BN6 A;  4GKY A;  1UX7 A;  5FYC A;  1NUK A;  2EIE A;  4GIQ A;  1WLC A;  4MGK E;  2A75 A;  2BGP A;  4QKD A;  3ZFF B;  3H0O A;  1W8T A;  1RJ8 A;  4YZ4 A;  3TN9 1;  4DIN B;  4ISR A;  3KZ4 C;  4I30 A;  1SFP A;  3KGL A;  1UX6 A;  1V9U 3;  2BVV A;  2ZX1 A;  4AF9 A;  2Q5T A;  1D4V B;  1QEX A;  2YG0 A;  4Q5O A;  1R64 A;  1HX6 A;  5A80 A;  2JX9 A;  1XNB A;  3CJI C;  5FJH A;  3MIE A;  1ND3 B;  3C7H A;  2CYF A;  1O3Q A;  5KC6 A;  2DUP A;  4QB2 A;  3AMN A;  3UKT A;  3ZFE C;  2BNN A;  3I59 B;  1H2N A;  1Q8P A;  5I8T A;  1AHS A;  3KLS A;  5L73 A;  3V0A A;  3CNA A;  4UW3 A;  1ODM A;  4JTN A;  4Y5Z 0;  1BQP A;  4U2A A;  2BWC A;  1R09 3;  1DGW X;  2BWA A;  2ZAC A;  3BU7 A;  1O91 A;  5F5Q A;  5FZA A;  5IJR A;  5C6C A;  4P08 A;  4PLN A;  1W8U A;  1HLC A;  2D6O X;  4OQ9 A;  1YQC A;  4G3Y C;  1OHF A;  4GXL A;  1J3Q A;  3CJI B;  1RIR A;  3GCX A;  3D0J A;  5A7P A;  1W9F A;  4LO4 B;  3O1M A;  1YHF A;  2EXJ A;  1G8W A;  2D6M A;  4YM1 A;  1CX4 A;  3N9O A;  5A7Q A;  4A2U A;  5GZC A;  1F2N A;  1RUO A;  2C5D A;  3E5U A;  4OHW A;  5IAT A;  4LLF A;  4Y3O A;  1GP6 A;  3EO6 A;  4NRQ A;  4CU6 A;  1AR7 2;  1VBA 1;  2D3R A;  1QJZ A;  1AYN 1;  4C91 A;  2I45 A;  4XBQ A;  1FOD 2;  1O5L A;  1OLR A;  1FOD 3;  1HQW A;  2XQX A;  3M3I A;  4QGM A;  3RZZ A;  5HCF A;  2EAL A;  4XC9 A;  4DXS A;  4EZH A;  3OG2 A;  2W1Q A;  2DU1 A;  5A3N A;  3W9A A;  3N7J A;  1U12 A;  4FPC A;  5LRR A;  4YW3 A;  3HT2 A;  3M1H A;  1IZ3 A;  2A6W A;  3NMB A;  3VDD A;  2W2I A;  1UU5 A;  3PUQ A;  1O5U A;  1MEC 3;  1Y3T A;  1NLS A;  4FOW A;  1OF3 A;  3ILF A;  5FZC A;  1W0N A;  3OCP A;  3T1M A;  2LUW A;  4CDX C;  1HXS 2;  2BGO A;  2ERF A;  4IEZ A;  2Q1M A;  3AZZ A;  5C3S A;  1Q5O A;  1HXS 3;  1W6M B;  3LIG A;  3UV9 A;  3VHP A;  1H4H A;  3GYD A;  1QIQ A;  2ZOE B;  1LB2 A;  5JWP A;  5C5T A;  3NJX A;  3KV6 A;  1Q43 A;  5FLI A;  2TNF A;  3M2M A;  1ZZB A;  1NY7 2;  2VOX A;  1X8E A;  3POY A;  1KJR A;  1UF2 C;  4QAW A;  1X9T A;  2WNV A;  1SAC A;  5FOJ B;  1SBE A;  3K3N A;  4LTA A;  3MEP A;  1SDW A;  2FMD A;  3S7E A;  4HXC A;  1JHJ A;  1KS5 A;  4OUL A;  3ZM8 A;  1GP4 A;  2XBO 3;  1ZM1 A;  5FTT C;  1VBD 1;  4CA9 A;  2FBE A;  4AK3 A;  1R1A 1;  1FNZ A;  4N43 C;  2IWG B;  3M3E A;  4CDX B;  5A33 A;  5I0D A;  5I0R A;  4JAA A;  1TG7 A;  5L9B A;  5IYY A;  1W9W A;  2CAV A;  1JN2 P;  1QJX 2;  4AQ6 A;  1F9K A;  3PDQ A;  4H3W A;  1QJX 3;  3OGJ A;  2R7E B;  4ZU4 A;  1DZT A;  3T09 A;  5FZD A;  4BMB A;  1O3R A;  3TN9 2;  2BEO A;  1VLN A;  2XG3 A;  1OVS A;  1UIJ A;  3TN9 3;  4XHB A;  1SPP B;  5A3U A;  1GYK A;  2HJI A;  3VZL A;  1SFY A;  4B1L A;  4CP9 B;  1U5X A;  3BKZ A;  2XR4 A;  2RE9 A;  2HWB 1;  2ZX3 A;  2R49 A;  4WVV A;  5DAW A;  3QOP A;  4ZON A;  1FT9 A;  3I2I A;  2QDR A;  4N43 B;  1RUN A;  3RJ2 X;  1UZY A;  4ASK A;  5T52 A;  3WP3 A;  3VBR A;  1H9P A;  3WDT A;  3AP9 A;  2YRO A;  1VMH A;  3THD A;  4XXA A;  2PQQ A;  5B4X A;  1UYZ A;  1F8V A;  3WHU A;  1OLM A;  4I0B A;  1V6L A;  2RG4 A;  1PX3 A;  4HOO A;  1JOJ A;  1OQE A;  4Q8K A;  1W8H A;  1QH6 A;  2DYC A;  3C7O A;  2WUH A;  1WCQ A;  4D69 A;  3ZOI A;  4Z2W A;  1GWK A;  1D4M 1;  4YW7 A;  5LW9 A;  1E5R A;  4A41 A;  5JVV A;  4IW3 A;  1COV 1;  3MV0 1;  2AR6 A;  4RGK A;  1D0H A;  1VBA 2;  1GSL A;  1C5H A;  4XMI A;  1AYN 2;  3CO2 A;  4GMP 0;  1VBA 3;  1W6N B;  4LXL A;  3S7I A;  4WZF A;  4XDO A;  1SEF A;  3DYO A;  2VZT A;  1QU0 A;  2DBN A;  1PMJ X;  1IOA A;  3Q8A A;  1D7P M;  3KCX A;  4URA A;  4M0N A;  4UAP A;  4WBB A;  5DPN A;  1BMV 1;  4QDS A;  1Y43 B;  3TNQ A;  2P3I A;  3MV1 1;  4UFH A;  1JU4 A;  4FFH A;  1MS5 A;  4FFF A;  4HKW A;  4XDQ A;  3JBG 2;  4LEJ A;  4MAD A;  2OPK A;  2LW8 A;  4QQH A;  5KXD A;  3VDD C;  3WLU A;  1QOS A;  5KHK A;  4E8D A;  2MEV 1;  1FPN 1;  2D5H A;  1PZ7 A;  2QQJ A;  1R08 1;  3QLQ A;  4E2G A;  2HWD 1;  4O61 A;  4IGP A;  5EPA A;  3N35 A;  2E51 A;  2VNG A;  1HW5 A;  1ULF A;  3L2Y A;  5CIS A;  2WSV A;  2PHW A;  5TSW A;  4ARX A;  3O1V A;  3ZYB A;  2JD4 A;  4KI5 M;  2VM9 A;  2J1R A;  1CX1 A;  1D0G A;  2AAC A;  2VR4 A;  2ZEY A;  3OPZ A;  1QQP 1;  4PIX A;  1KQR A;  3GZT B;  1E5H A;  1FMD 3;  4UW4 A;  4Q1R A;  5LAT A;  4E9K A;  1IPS A;  3AYD A;  4LBO A;  3LE0 A;  4AVB A;  3DL3 A;  1VP6 A;  2PHL A;  2WNV C;  2ZZQ A;  2BUK A;  4RHV 1;  2YGM A;  3C7E A;  1RUG 1;  3VD5 A;  4AHY A;  4Y22 A;  4CRQ A;  5BNP C;  1V6N A;  1VBD 2;  3VDD B;  3WDX A;  1DGL A;  1VBD 3;  1R1A 2;  2YDE A;  2GC2 A;  2VZU A;  2RDQ A;  2O8Q A;  5APA A;  3TEW A;  2PLV 3;  5LWB A;  1IS6 A;  2GMM A;  2LRP A;  2YC4 A;  4P02 B;  4D7Y A;  3H9A A;  1OF4 A;  2VMC A;  3POF A;  1HQN A;  5HCH A;  4Z8B A;  2RR1 1;  4CUB A;  2CV6 A;  1DZQ A;  3R0R A;  2XON A;  3RI9 A;  3FUO A;  5E8A A;  5CKQ A;  4B4P A;  1W8Z A;  3OD4 A;  5A6Z A;  1HRV 1;  2A1X A;  2P6H A;  2P6C A;  2FHR A;  4BQW A;  2C26 A;  1DGR N;  2E7A A;  4QGN A;  5IK5 A;  2PMW B;  2WNV B;  4L9B A;  2PAM A;  2R16 A;  1NCQ A;  3ZYF A;  5A1F A;  2KM2 A;  4XUP A;  2P34 A;  2YY1 A;  4KGG A;  5BNP B;  3SC7 X;  1NQD A;  2HWB 2;  3WZ1 A;  2HWB 3;  3L2H A;  4KWL A;  1VRB A;  1XRU A;  2VNV A;  1EYB A;  3VBF A;  3ZSK A;  1LOE A;  1J1L A;  2WBK A;  3VD9 A;  1NA1 A;  1POV 0;  2OUJ A;  4IQP A;  2QE3 A;  5A33 B;  3WF3 A;  3K48 A;  4QPY A;  1JTZ X;  4XFG A;  1NG0 A;  4YGC A;  3ZSL A;  2Q8D A;  1PVC 3;  1NXM A;  1BJQ A;  3VBR C;  2R0H A;  1ZBA 3;  4D6R A;  2JJ6 A;  5JPN B;  1KFU L;  1H1M A;  5CNA A;  2WLQ A;  3KCC A;  2RMU 1;  1C1F A;  1NE4 A;  4BLJ A;  2FDI A;  5AVP A;  3WUD A;  5FKC A;  2Y6G A;  5FPZ A;  3HR9 A;  5BV6 A;  1ZNP A;  2VMF A;  4EN7 B;  3E97 A;  1RIT A;  3WQ0 A;  4PF1 A;  4K3U A;  3LF7 A;  2ZPX A;  3AVR A;  4LBQ A;  4QKB A;  5FXV A;  4EJR A;  4PBP A;  2CL2 A;  3NL1 A;  4AQT A;  2GMP A;  1D4M 2;  4KQ7 A;  5C9A A;  2VZV A;  1COV 2;  2W39 A;  3AXE A;  4QXK A;  1COV 3;  5J36 A;  5JPM B;  5EIY B;  4IEQ A;  5AFB A;  3JQW A;  1WA4 A;  1DBN A;  4HBN A;  3VBR B;  4UF0 A;  5JI9 A;  1DHK B;  3RJR A;  4A44 A;  3ENR A;  2JE8 A;  4EWD A;  1VBB 3;  1JI6 A;  2NLR A;  1C28 A;  3OPW A;  4OI0 A;  2VUJ A;  4S2F A;  4P5Y A;  4AQ2 A;  2DCJ A;  2WAA A;  4R52 A;  4XJ8 A;  1HB2 A;  1XNC A;  4CP2 A;  2XJQ A;  3PJQ A;  5FZM A;  1BMV 2;  1KXG A;  2W46 A;  3VDA A;  5FXX A;  4Q0S A;  2FDK A;  4JX0 A;  5K8S A;  1V0A A;  4NOT A;  1X33 A;  2JE7 A;  1CAV B;  2DVF A;  3SKJ E;  3OD0 A;  3LSE A;  4RFT 0;  5E88 A;  3MLK A;  2VTX J;  1RJ7 A;  1O3S A;  2E33 A;  2MEV 2;  1ENQ A;  1FPN 2;  2MEV 3;  1R08 2;  1ULD A;  1FPN 3;  1X8M A;  3W21 A;  2HWD 2;  1BEV 1;  1YNA A;  1R08 3;  3JXS A;  1VBE 3;  5JXG A;  3U75 A;  2ZX0 A;  3PME A;  1WGP A;  1C3H A;  2VUA A;  1JOP A;  1XYN A;  3VHN A;  2Y6K A;  3PUR A;  5LRS A;  2CWS A;  1QQP 2;  4UBH A;  4AI3 A;  4FTB A;  1QQP 3;  2ZEZ A;  3KV5 A;  4W6W A;  2R32 A;  2TBV A;  3CHX A;  3WNN A;  3WNM A;  3U4X A;  5J48 A;  4RHV 2;  2EF6 A;  4PQQ A;  3Q8C A;  5GJ6 A;  2QDN A;  4NN0 A;  1RUG 3;  4JQR A;  1VAK A;  4LBJ A;  4LR4 A;  1URX A;  2VQ0 A;  4O9G A;  2F17 A;  2CAU A;  4AOC A;  5FYM A;  1GNY A;  2WO1 A;  4ZY9 A;  5F9T A;  3IN9 A;  1UW8 A;  3ACL A;  2RR1 2;  3I3Q A;  1AL2 1;  3NNL A;  1X9P A;  2RR1 3;  1OQ1 A;  3IKW A;  1VR3 A;  4JHT A;  5FOB B;  1HRV 2;  2PA7 A;  4KWJ A;  4Q4W 3;  1HRV 3;  5E89 A;  2XJP A;  5ABJ C;  4P5H A;  2D43 A;  3NWK A;  1W99 A;  1AX1 A;  4BK5 A;  5GLU A;  5DAV A;  4H7M A;  3OBT A;  2VOW A;  4A6S A;  1YIP A;  1NCQ C;  1YEW A;  4XAC A;  2DVD A;  1XU2 A;  3RSJ A;  1UOF A;  2RS5 3;  3KF3 A;  5CAZ A;  4FXK B;  1DQ5 A;  3IIA A;  2W95 A;  1NX9 A;  4GD4 A;  4SLI A;  1SLB A;  1OSG A;  4P9L A;  4FFG A;  1GOG A;  2SLI A;  2O8O A;  4UWD A;  5DG1 A;  4ZU5 A;  3D4K A;  2Q4S A;  5A7W B;  2WO7 A;  3VZM A;  1NA1 C;  2XKP A;  3B5L B;  3PL0 A;  3WQ1 A;  2C4X A;  5C33 A;  1Y7B A;  2A5Z A;  4D6Q A;  3POS A;  4Y1Z A;  2QZ2 A;  2VCA A;  3ITQ A;  2AYH A;  2UY8 A;  1RUJ 1;  4JC1 A;  4ZKT B;  2Z2S B;  1UYP A;  3PUI A;  1SLA A;  2RMU 2;  4LA2 A;  3WG2 A;  1O7F A;  5ABJ B;  5IVC A;  2RMU 3;  3PUA A;  4XOG A;  2AH2 A;  1UY1 A;  3EB7 A;  3K2O A;  2VE1 A;  4Y24 A;  3JD7 3;  1UNB A;  1G9C A;  2DCK A;  4IEP A;  2RM2 1;  3BTZ A;  1CON A;  1NCQ B;  1AZD A;  3PNA A;  2VL4 A;  3MUY 1;  3OGR A;  3HQX A;  3GBW A;  1V6O A;  1VPH A;  3FN9 A;  4QX2 A;  3U10 A;  4DOU A;  5A7N A;  5JDB A;  4CDW A;  4NHX A;  5F3E A;  1QXR A;  1NA1 B;  5FZ3 A;  4X6Q B;  4BQ5 A;  4Q2F A;  3K75 B;  4AWD A;  3VL9 A;  5KHI A;  5CFC A;  5C71 A;  2DWR A;  3OYW A;  5CBL A;  4YWA A;  1HIX A;  2ZGO A;  5LAS A;  4NII A;  2CSG A;  4QDR A;  4XFF A;  4Q8L A;  5I91 A;  2GME A;  5KHG A;  4R9B A;  3NST A;  3I2J A;  4FCA A;  3WG4 A;  4AVT A;  1LOB A;  2WQZ C;  1AVB A;  2VAU A;  4LBQ B;  3IT8 A;  4Q29 A;  3ZPY A;  4LHK A;  4DXT A;  2XXZ A;  1MS0 A;  1OI6 A;  3I4I A;  3BOP A;  4Z1V A;  4COV A;  1NYW A;  4CU7 A;  4XZU G;  2C1F A;  4QB6 A;  4DUV A;  4O7X A;  2IVI B;  5IK8 A;  3WCS A;  1BEV 2;  1YXW A;  1F15 A;  1O6U A;  2GDF A;  2W52 A;  4GMP 1;  4LIU A;  3I2K A;  4OI4 A;  4UF0 B;  4C8D A;  3WXP A;  1NXD 1;  3AP6 A;  2HWC 1;  3WNO A;  4HVR A;  5B4N A;  4QPW A;  1UZW A;  2Y38 A;  4QT6 A;  3ZYP A;  4FT8 A;  3AMM A;  4XJA A;  4MUV A;  1ZZC A;  1CIW A;  1OLQ A;  1CZS A;  3DEM A;  1ZRE A;  1HRI 3;  1FXZ A;  5JOX A;  2WFP A;  3RFR A;  2OZJ A;  3I2F A;  3SH3 A;  3TEZ A;  2PAE A;  2QQL A;  3AB0 A;  2W9X A;  3H3Z A;  1YI9 A;  1JOD A;  1W0P A;  4KMQ A;  4ASM B;  5IHR A;  2VVD A;  2I74 A;  2WO3 A;  4LUM A;  2V5Y A;  4UFM A;  3WF0 A;  4GQ7 A;  3WVJ A;  3MPB A;  1LOF A;  2Y60 A;  3CF6 E;  1WMX A;  3DEC A;  5H9Q A;  5I93 A;  5D21 A;  3A4U A;  4YG0 A;  3FLT A;  3R05 A;  3WD5 A;  1WMD A;  3B9I A;  1GNH A;  4CCO A;  5FY0 A;  5T5J A;  4YZ5 A;  1AL2 2;  1CN1 A;  1W9S A;  1LOA A;  3MW2 A;  1TMF 1;  2GNM A;  1AL2 3;  3R6S A;  4QHZ A;  1GZT A;  4R8H A;  5JXJ A;  2PYT A;  2RHP A;  1W2T A;  4DUX A;  2AEN A;  2KA3 A;  3H1Y A;  1UXZ A;  4Q0Q A;  4BJ0 A;  5DZE A;  1QKQ A;  2DUO A;  2B42 B;  2DCY A;  5DAP A;  2B9U A;  2EXI A;  4AI0 A;  4AQS A;  2Z42 A;  1RUI 1;  3RWN A;  2VGD A;  3BB6 A;  3A0K A;  2JKX A;  4RN5 A;  2AC1 A;  1G9D A;  2RDR A;  4NWV A;  5KXE A;  3B69 A;  4QQ2 A;  2WWU A;  2P4E A;  3J7N A;  1MS8 A;  2VW1 A;  3I59 A;  2QQU A;  3O14 A;  4XUT A;  3WNP A;  2FCU A;  1M4W A;  3LD8 A;  3ZYJ B;  1TE1 B;  1IQD C;  4Y26 A;  3RZL A;  3ZN6 A;  1S0G A;  2E9Q A;  2YYO A;  1GQH A;  5DXD A;  2ZS6 B;  1OXC A;  1DCS A;  3ZR6 A;  2VXR A;  4UW6 A;  4AFD A;  3FBM A;  1W0O A;  1S0C A;  1XE8 A;  1GU3 A;  4YYO A;  5JUV A;  1RUJ 3;  4DEQ A;  5JAX A;  2VW0 A;  4M0H A;  5J37 A;  3S30 A;  5CAD A;  4BA6 A;  5A3M A;  5E1R A;  4YW1 A;  2ARA A;  2RM2 2;  5IVE A;  4XBN A;  5EJ1 B;  1KD7 A;  3CU7 A;  2C0Z A;  2HKX A;  3PUS A;  4YRD A;  4AGR A;  2VOV A;  4ZU7 A;  3ETQ A;  3H8O A;  1EAH 3;  4C1W A;  5FV3 A;  4CDQ A;  5IVV A;  4Q4Y 1;  4G4F A;  2A73 B;  1MS3 A;  3WQB A;  3OBR A;  5IWF A;  1FYU A;  2OT7 A;  2RJL A;  4FQ4 A;  2WIN B;  2ZX2 A;  3D3A A;  4DIQ A;  4XXP A;  1APN A;  1SLI A;  3AVS A;  3PHM A;  4D8M A;  5CFC C;  2B46 X;  4YW5 A;  4LJH A;  2XUM A;  4OYU A;  1UY0 A;  3ES1 A;  5CIR A;  3NRU A;  3SKV A;  1ODN A;  3MFA A;  4FPO B;  2G19 A;  2A3Y A;  5CG8 A;  2JDN A;  5K4L A;  3POI A;  4Y20 A;  3VDC A;  2EAA A;  2K2S A;  2QNK A;  1Y9G A;  1PO1 3;  4DQA A;  4QX0 A;  3AZY A;  1QY4 A;  4CE8 A;  4YM3 A;  4HN1 A;  5I8Y A;  2E63 A;  4MZU A;  5GZF A;  1QJE A;  1MQT A;  4CXY A;  2VOK A;  2YPJ A;  5CFC B;  3OYW B;  2SBA A;  3WW3 A;  2HWC 2;  2X5I A;  2JEM A;  3LA7 A;  2OPW A;  1NOV A;  3J8F 1;  3LIH A;  3PTR B;  5LY1 A;  1CVN A;  1UD1 A;  4DY5 A;  4YZ2 A;  1JXN A;  3O1S A;  1X36 A;  1IKP A;  4Y4Y A;  5CB7 A;  3USS A;  4COY A;  4YW6 A;  3WF1 A;  3KT4 A;  4IEO A;  5CYY A;  1EV1 1;  2VQU A;  5DAB A;  1CAW A;  1CQ9 A;  1YFY A;  1VB2 A;  1WD3 A;  4HPK A;  5IVJ A;  2JIG A;  3ZFG A;  1W03 A;  4CDX A;  5FBZ A;  4EWA A;  4E2S A;  3KB5 A;  2Z69 A;  4XJW A;  4MHR A;  1JYN A;  5LCW L;  3WG3 A;  2NM1 A;  2QZ3 A;  4NRP A;  5JR2 A;  4BM8 A;  3IBM A;  2W68 A;  4CUA A;  5FYZ A;  4EQV A;  2VUD A;  4AR2 A;  4AAX A;  1AX2 A;  1LHV A;  1QMJ A;  1A78 A;  1TMF 2;  2VUL A;  3SEE A;  2XJT A;  1AXZ A;  4QX1 A;  2XVL A;  2FCT A;  3B3Q E;  2D98 A;  2BDR A;  1CZV A;  1C8N A;  5FZ7 A;  2OXB A;  3HAG A;  4JV4 A;  3F2Z A;  4TN7 A;  5FBJ A;  2ZGK A;  4KG8 A;  1J3R A;  4NE9 A;  1GR3 A;  4NPR A;  1SMV A;  4OHX A;  4PLM A;  4XUO A;  3VKO A;  3AFG A;  3FHA A;  1RUI 2;  5LY2 A;  3FJS A;  3N9L A;  3KGZ A;  5F5I A;  1RUI 3;  1F5J A;  2RV9 A;  2ZGN A;  4IDZ A;  2OQ6 A;  4B8E A;  3GGL A;  1PM4 A;  2WA4 A;  3W5M A;  1TVG A;  2JDZ A;  5EFU A;  2DUR A;  1UPI A;  1V6I A;  4DEV A;  1AXY A;  1QHD A;  4N7U A;  4AVV A;  4A42 A;  2WS9 1;  2LAL A;  3SHR A;  4NWW A;  4AEM A;  1JYX A;  3M3C A;  1DLL A;  2A6V A;  4XAE A;  1TNF A;  4FTS A;  4GWI A;  3ZVX A;  2IZW A;  3K4Z A;  4XHX A;  5GZG A;  3NV2 A;  5FYB A;  1MR5 A;  3U07 A;  1BKZ A;  5GKA C;  3ACF A;  5AFE A;  1W05 A;  5FPA A;  3MID A;  1T6G C;  4RSU A;  1RGS A;  4P9I A;  5CG9 A;  2CTV A;  3FHQ A;  5A6X A;  5HXM A;  3S5Q A;  3AYE A;  1LHU A;  3T3Y A;  1AR9 1;  1WZX A;  3AP5 A;  1AF9 A;  1I5Z A;  2ZAA A;  4IV3 A;  3WP6 A;  1GWL A;  2K46 A;  4Q4Y 2;  1S0D A;  2K9Z A;  3EQE A;  2ARX A;  2VQA A;  3ABZ A;  3WSO A;  4CDQ C;  4XFC A;  1W9Y A;  1QF3 A;  4YLZ A;  3H3U A;  1W6N A;  5DN2 A;  4NHL A;  4YZ1 A;  3I49 A;  2BP6 A;  3ZN6 B;  1SCR A;  5KHJ A;  3BI3 A;  5IVF A;  3HNM A;  5FWJ A;  3VHO A;  2ET1 A;  3N4M A;  5FY1 A;  2F4P A;  2DBI A;  5A1L A;  1H0B A;  1Y4W A;  3QH7 A;  2Z79 A;  5FZ8 A;  2WO2 A;  4NAO A;  2AEZ A;  4XF9 A;  3EXU A;  4BCU A;  3VKL A;  3ACG A;  5A6Q A;  3O0X A;  2R1D A;  2VZS A;  4BIF A;  2JDA A;  3ROU A;  1UO9 A;  1X82 A;  3ZXE A;  2YUE A;  1WMF A;  4QPG C;  4XAB A;  3TB0 A;  1LU2 A;  4CDQ B;  4AEK A;  5CZK A;  3VL8 A;  2UY9 A;  3NJZ A;  1ASJ 1;  3T2O A;  3ZPO A;  4D94 A;  1WCS A;  3I3M A;  1NT0 A;  1XQN A;  3TEY A;  1AR7 3;  3OEB A;  4HT1 T;  4FPK A;  2P2K A;  3RYP A;  4SBV A;  1KRI A;  3ZXK A;  2WA3 A;  4ASL A;  2BNM A;  3WW2 A;  5C3R A;  1MQT C;  2R0F A;  1RVF 1;  2XJS A;  3ECQ A;  3J8F 2;  2GC3 A;  2X5I C;  2KXL A;  2VZO A;  1YFX A;  1RXF A;  3J8F 3;  4BIO A;  2VVE A;  2C9A A;  1N47 A;  1EV1 2;  4LO5 B;  5FPB A;  4NHM A;  5LA9 A;  1DFQ A;  1UYY A;  1BYH A;  3H7Y A;  4H7L A;  4QPG B;  4Y20 B;  3OBA A;  3JBG 1;  4MYE A;  4Q0P A;  5JOZ A;  4D3W A;  1W2U A;  1WME A;  4XIO A;  3MIC A;  4N7I A;  4XFH A;  3OJB A;  4I02 A;  4NHY A;  2DVA A;  4AAP A;  5CKN A;  3ZFG C;  1YUD A;  4FOQ A;  2BFU S;  2JDP A;  2BOI A;  4BDV B;  4ZZ5 A;  4FTE A;  3AC0 A;  4FQZ A;  2XJV A;  3AM2 A;  4XFA A;  4E2Q A;  3ALQ A;  2QCS B;  2UU8 A;  3HMY A;  4PI0 A;  4XF1 A;  4B4R A;  5FFO C;  1MQT B;  1VAL A;  4DUW A;  2DCT A;  3R4S A;  2IXL A;  3BOD A;  5A32 A;  5J3U A;  1PX4 A;  2X5I B;  1RXG A;  4AI2 A;  2WWJ A;  4DB5 A;  3FX3 A;  3T30 A;  3O0W A;  1J83 A;  1YO8 A;  3T2Q A;  5FZ0 A;  5BNN C;  2KR2 A;  5BNP A;  2TEP A;  1DZR A;  4PQ9 A;  3RDI A;  3EYP A;  1CAW B;  4HPK B;  1W06 A;  3SNM A;  3LZZ A;  3H42 B;  3LFM A;  3GZA A;  4LBK A;  4QQO A;  3RG0 A;  2J1V A;  3GZE A;  5CFD A;  3ZFG B;  1W90 A;  1ZYB A;  3AYC A;  4Y1U A;  2WDB A;  3ST7 A;  3I2D A;  1JH5 A;  5IFP A;  4B7K A;  1KGY A;  3J7L A;  1V70 A;  3WEZ A;  3HNB M;  4CUC A;  4E8C A;  5C8C C;  3AMP A;  2VME A;  2WS9 2;  3KQR A;  4PT6 A;  2WS9 3;  1ULG A;  2RJK A;  1XNK A;  4I09 A;  5LBF A;  1QJY 1;  2ZGU A;  3L9J T;  2P3K A;  4O65 A;  5K0U A;  5BNN B;  5JLV A;  1ZRR A;  4IGQ A;  5LEK A;  1DQ2 A;  5A3L A;  1Z7S 1;  2R30 A;  2D93 A;  2I07 B;  1LOC A;  4K1Z A;  3SIS A;  4XAA A;  3BTX A;  3ZSM A;  4LUL A;  3AXD A;  4GWJ A;  1PGW 1;  1AR9 2;  1AR9 3;  3OGV A;  3OUJ A;  1E5I A;  2DTY A;  2VMD A;  4IV3 C;  2HYK A;  4XJU A;  3DYM A;  2BW8 A;  4M3C E;  1W8N A;  5C8C B;  1UOB A;  3PIG A;  4TLF A;  1DQ4 A;  2DTW A;  2WR9 A;  4HG6 B;  5BNO A;  1RUC 1;  1LU1 A;  3GHN A;  1UZZ A;  4F7Z A;  4F3J A;  2XJR A;  1CPN A;  4XQD A;  4QXB A;  5GZD A;  2WZ8 A;  1CAV A;  1S2K A;  1VRH 1;  4L11 A;  5FYY A;  2DDU A;  3GF6 A;  4WM8 A;  2JEC A;  2XML A;  1LRH A;  1SQ4 A;  4K21 A;  4BQ2 A;  1OD3 A;  2V73 A;  2ZML A;  5T5L A;  2VMI A;  3D6E A;  4IV3 B;  3NKG A;  4JZR A;  2C6S A;  1MZF A;  1H30 A;  3I3B A;  4AED C;  1ASJ 2;  4TSV A;  1QWR A;  2H6B A;  1ASJ 3;  1R1Z A;  3IDB B;  2WT2 A;  1OH3 A;  4YW2 A;  3S57 A;  2GH2 A;  1AYN 3;  1W3X A;  3T1L A;  5EJZ B;  1JZ5 A;  4FPH A;  1JS9 A;  1DYO A;  3C7F A;  2ZGR A;  2ZHN A;  4P9X A;  2E53 A;  1RVF 2;  3M7A A;  4ZHN A;  1WA6 X;  1X7N A;  2ZA9 A;  5FP9 A;  3CQO A;  1ZBE 1;  2VU9 A;  4R9A A;  4XIL A;  4OFG A;  3ZXL A;  5FMO L;  1XOY A;  4LO7 A;  4FPF A;  1XYO A;  2OS2 A;  5HPO A;  2GU9 A;  2Y6F A;  2ZXQ A;  4MX3 A;  4MSV A;  1NCR A;  1N3P A;  2GC1 A;  4TTG A;  1QXP A;  2KD7 A;  3JBG 3;  3N9P A;  4AED B;  1XND A;  2W91 A;  5G04 L;  5F32 A;  3URF A;  4KWU A;  2VZP A;  3WDW A;  3FFQ A;  2B39 A;  1FAT A;  2ZKN A;  5F5C A;  4DY3 A;  3HWJ A;  1B35 A;  3LDR A;  4IXL A;  1PO2 1;  2OKX A;  4FP2 A;  1W28 A;  1S2B A;  1XSQ A;  3AJY A;  3VD7 A;  2O1Q A;  5FZI A;  5L36 A;  5SV5 A;  4E27 A;  1KFX L;  1E5S A;  2G4I A;  4JDO A;  5A3P A;  2DCZ A;  4I2O A;  3PLQ A;  2W1S A;  1OA2 A;  3NKT A;  4LHS A;  4ZPI A;  4LOR A;  1U5Z A;  4ZXE A;  4A7Z A;  4K9S A;  4BYY A;  4ITC A;  4Y33 A;  3THP A;  1IQA A;  2W08 A;  4YVW A;  2D97 A;  3VD3 A;  1BVP 1;  4ISQ A;  1JZ3 A;  4N90 A;  2Q1F A;  1R1A 3;  2OQ7 A;  5IAV A;  1OBN A;  5A7W A;  5FZG A;  1OQD A;  2ZGS A;  3ELN A;  4XUR A;  4XQW A;  1HV0 A;  1S0F A;  5H9R A;  3U1X A;  5CFD C;  2A3X A;  4ONU A;  1OKO A;  2XLG A;  4W65 A;  2JIC A;  4N9I A;  4MGZ E;  1XNA A;  4OMD A;  3U37 A;  4R4Z A;  3H1W A;  1AJK A;  5ABJ A;  5A32 B;  1W6Q B;  1DP0 A;  2GSY A;  3UKN A;  3NV3 A;  4EN8 B;  3UNP A;  4Q4X 1;  1M06 G;  1US3 A;  5BXX A;  4HK8 A;  2HWF 1;  5LBC A;  1QJY 2;  1W2A X;  4CZS A;  1QJY 3;  1PM7 A;  4ZXK A;  2BV4 A;  5K0U C;  2PHX A;  1Z7S 2;  2ZGL A;  4I01 A;  4UBG A;  4V2V A;  3ZDV A;  3AKP A;  3S5A A;  3OB8 A;  4M4P A;  1IGO A;  4GUL A;  3VBU A;  5LZ6 A;  3ZLI A;  2RS1 1;  1PGW 2;  2Q0A A;  4AFB A;  1IG3 A;  4FVV A;  4FAG A;  1Y9Q A;  3POG A;  5IFT A;  3V65 A;  5CFD B;  4NIH A;  5FMB A;  4MXW A;  2QQV A;  3SCG A;  3ZDS A;  5DUU A;  1LAJ A;  1BHG A;  5BYN A;  1GZW A;  3HVD A;  1O8S A;  4JRA A;  4AFM A;  3KD4 A;  2GH8 A;  2BBA A;  3IDA A;  3FLP A;  1SG3 A;  1VE0 A;  5FKB A;  1AR8 1;  2AEY A;  2B9V A;  2VZQ A;  4AYU A;  4FOY A;  1RUC 2;  4IEV A;  4QPI A;  3PUH A;  5GLV A;  3WW4 A;  5BNO C;  3LEI A;  3LB9 A;  1LEN A;  3LFI A;  1X50 A;  5A3O A;  5K0U B;  4Z82 A;  5D1I A;  1LHW A;  3WDU A;  5JR7 B;  1VRH 2;  4KL1 A;  3USU B;  1UOG A;  3AMQ A;  1K5J A;  2IVJ A;  5LBE A;  1D4M 3;  3WP5 A;  5FPX A;  2GAU A;  5DAQ A;  5K9Y A;  5JIU A;  4WM8 C;  5FQ0 A;  4ORF A;  1ZX5 A;  3ZKU A;  4A6O A;  1IHM A;  2R04 1;  3RZM A;  1S4C A;  2VZ1 A;  3INA A;  3LWC A;  2CGO A;  3MW4 A;  1CAX A;  1IS5 A;  3WP4 A;  2ZMN A;  3UYJ A;  4JGZ C;  2JDY A;  2ILM A;  3AKS A;  3N7M A;  1LGN A;  1MPX A;  5BNO B;  4P00 B;  2FDF A;  1U0A A;  2WQ4 A;  1FV2 A;  1HB3 A;  4QXH A;  4QX5 A;  1GZ9 A;  1ZBE 2;  2JDK A;  3CLP A;  5FUP A;  4FSJ A;  1EP0 A;  4LE3 A;  3LGR A;  1ZBE 3;  2Q8O A;  1J59 A;  5FY4 A;  2D40 A;  4Y5S A;  2CDP A;  3I54 A;  3J9S A;  3RVH A;  3ZSE A;  2WZR 1;  3Q8F A;  4GA9 A;  4QHO A;  2BQP A;  4IE5 A;  4PF5 A;  4WM8 B;  2EID A;  1YJK A;  3KQ4 B;  3KVB A;  3FMG A;  4BLI A;  5CEH A;  1NCR C;  4IEY A;  3OBZ A;  5GM0 A;  1K12 A;  2VNR A;  4MOA A;  4PI2 A;  1RB8 G;  5F6K A;  2HWD 3;  2J1S A;  3DGT A;  5A70 A;  1AJO A;  4QU1 A;  2HBU A;  4C0B A;  1AX0 A;  1I6X A;  1PVX A;  3ME2 A;  1PO2 2;  4JGZ B;  4K6B A;  1K3I A;  3LAG A;  4LQR A;  4Y4R A;  4CXW A;  4I3G A;  1B35 C;  1LNS A;  4BQY A;  4A3Z A;  4AFC A;  5DUW A;  1SHW B;  4IUG A;  3ZR5 A;  5KXC A;  4XEZ A;  1UU6 A;  2DV9 A;  2A71 A;  3OF1 A;  2ZHK A;  4YNI A;  4RHV 3;  1UQX A;  2YXS A;  4YG3 A;  3FL7 A;  1XSR A;  3OGS A;  1NCR B;  4HKL A;  3VKM A;  2E7T A;  1ZRI A;  1OT5 A;  1RMU 1;  1UCX A;  3C8X A;  4YVW C;  1OFN A;  3NNF A;  2XVG A;  3IWZ A;  4DS0 A;  4HVO A;  1WLD A;  1QGL A;  1W8O A;  2ID4 A;  2GP5 A;  3DPR A;  3A7Q A;  3PTY A;  1KIT A;  1B35 B;  3I3E A;  4BHP A;  5EZW A;  5I0T A;  5C4W A;  1AYM 1;  4AI8 A;  5FZB A;  4XF4 A;  4KWK A;  1CJD A;  2QFE A;  4Q4X 2;  1RUH 1;  4TWT A;  2HWF 2;  2UUR A;  2X29 A;  2XQR A;  3PJY A;  1JYV A;  2IXC A;  5J7M A;  3B00 A;  1UY2 A;  2NQY A;  3DYP A;  2ORZ A;  3AYA A;  2IXJ A;  4LO6 B;  3OEA A;  3UK9 A;  2RDS A;  4BB3 A;  2RS1 2;  4YVW B;  5F2S A;  1HB1 A;  2H6C A;  1VIW B;  3VBU C;  3H8R A;  2RS1 3;  3GBG A;  4IND A;  4YPJ A;  4GJY A;  3ZXG A;  1UMH A;  3MHZ A;  5JXI A;  1W8F A;  2FQP A;  5LEJ A;  5IK4 A;  2WN3 A;  3LEG A;  3THC A;  3UL2 A;  3RZH A;  1JZ6 A;  3MZH A;  4LHN A;  1AR8 2;  2WFF 1;  1GUI A;  1PGS A;  3N7L A;  4M3C A;  3HQR A;  3MGU A;  1AUY A;  1STM A;  4QPI C;  1POQ A;  4K20 A;  4N9H A;  1O4Z A;  5F3I A;  3LOI A;  1LTE A;  1H8T A;  4BQ4 A;  4UW5 A;  5FZK A;  3FHI B;  5FYT A;  1DGR A;  2IFR A;  2DF7 A;  3AP7 A;  2VEC A;  4CCE A;  4COU A;  5ACA 1;  2JB4 A;  5FO7 B;  1A34 A;  4QB1 A;  3VBU B;  1PHM A;  1YQ5 A;  1UMZ A;  1YRZ A;  2W0X A;  1PK6 C;  1LJ7 A;  3MIG A;  3AX4 A;  1DLC A;  1G9B A;  4LUK A;  1MAC A;  2R04 2;  1G7Y A;  2HLE A;  2NMO A;  2X09 A;  4MXW B;  3TNP B;  5HV4 A;  2XWB B;  2YFU A;  5A7O A;  1GZW B;  4ES9 A;  4S2H A;  4Q4V 1;  5AC9 1;  3JB8 A;  3RGB A;  4E4D X;  3G7D A;  5FR3 A;  4GZ9 A;  1ZA4 A;  1QDC A;  2Y6L A;  5IUQ A;  3TEX A;  3SLI A;  4QPI B;  3UET A;  4NPL A;  1TZO A;  2YHJ A;  3BTY A;  4DFS A;  2GN7 A;  1OUX A;  3VD4 A;  2QQM A;  4JKL A;  4MG2 A;  1LGC A;  3MF9 A;  4OI1 A;  4B29 A;  4B3N A;  2VBD A;  3WCR A;  3VZJ A;  1QOO A;  3E6C C;  1H1I A;  3KM5 A;  1J84 A;  2WZR 2;  4U36 A;  3K46 A;  4AFA A;  4NVP A;  2BU9 A;  1PK6 B;  1GQG A;  3LKJ A;  3MFC A;  4FXG B;  2LTN A;  3KT1 A;  4YFZ A;  1JZ7 A;  5FQ0 B;  3KWV A;  4L92 A;  4I3P A;  4GWM A;  3HD8 B;  3B94 A;  3DXU A;  1BEV 3;  1F5F A;  1EY2 A;  2D44 A;  3DXT A;  1Z0H A;  4YSF A;  5L19 A;  1CAX B;  2XOM A;  1A3K A;  2HEV F;  3BOW A;  4E4S A;  5JMC A;  3AFK A;  1EUU A;  5IT6 A;  4PCR A;  3LA3 A;  1L7Q A;  2Z4F A;  5DDJ 1;  5H9P A;  1AR6 2;  4UFJ A;  1H1A A;  4ATF A;  4YG6 A;  2W3J A;  4IE0 A;  1CZT A;  2QQW A;  2ARB A;  3H1M A;  3HBZ A;  3T0A A;  4A45 A;  1ULP A;  3DV8 A;  3CZU A;  1NLQ A;  4LO8 A;  1N1Y A;  2XLF A;  1C1L A;  3V0B A;  4L0P A;  1QJF A;  1RMU 2;  5KWR A;  4LIT A;  3WF2 A;  1RMU 3;  4OZX A;  1XYP A;  2HBT A;  5FLH A;  3MO4 A;  3UGF A;  3UGH A;  4OZO A;  1H8V A;  1RHI 1;  2I2S A;  2EXK A;  2W1U A;  4QMA A;  4Z07 A;  3T4H B;  2YBP A;  3POJ A;  3DPR C;  5KR7 A;  2VVF A;  4GB3 1;  1AYM 2;  3O1R A;  3U4S A;  3R4D B;  1PMH X;  2RVA A;  2J1E A;  1S0I A;  2ZHL A;  1ZRF A;  3THT A;  1DG6 A;  5C4W C;  2ZKL A;  4LKD A;  1AL0 G;  1RUH 2;  3N9Q A;  3P5B A;  4UYB A;  2R07 2;  3LOB A;  1C8M 1;  3RZJ A;  5B2G B;  3WV6 A;  5I0S A;  1O8P A;  4GH4 A;  4EN6 B;  2ADE A;  1N3Q A;  1S0J A;  2OUH A;  2ZEX A;  4XUN A;  5J1X A;  2YU2 A;  3AKR A;  3IMN A;  1L7L A;  1MZE A;  1YJL A;  2PQS A;  1F31 A;  5C3P A;  1QJU 1;  4NHK A;  3S6P A;  2JEN A;  2VPV A;  4XF0 A;  3VHR A;  1OD5 A;  4LKE A;  5FPU A;  1SLT A;  1ULC A;  5IVY A;  5GLT A;  4UI9 L;  1GNZ A;  1OA4 A;  3ZKY A;  3DPR B;  1V6J A;  4KNC A;  2WNU A;  4AZZ A;  2NN8 A;  4ATE A;  5HI0 A;  2JIJ A;  3N36 A;  5JSP A;  4XTM A;  2WFF 2;  4W6X A;  4ZZ8 A;  5C4W B;  1C5I A;  4Q0V A;  2WFF 3;  4CPB D;  5BUV A;  3ZIX A;  2W47 A;  3M4F A;  3Q8B A;  4JHZ A;  4DXR A;  2GNB A;  4KU8 A;  3O1U A;  4XVH A;  3PMS A;  4JCK A;  3WDY A;  4LT5 A;  2RM2 3;  5FYI A;  3E1F 1;  2P37 A;  5ANN A;  5FDB A;  4Y1V A;  2WN2 A;  3NV4 A;  3ZXJ A;  1H8T C;  1BK1 A;  5ACA 2;  1CR7 A;  4TYS A;  3MDP A;  5ACA 3;  1POV 1;  3OGG A;  4FP3 A;  3HNY M;  5FY5 A;  5I0U A;  1LCL A;  3NJY A;  5F2W A;  3VZN A;  3MPP G;  1GP5 A;  3IDE A;  4HSJ A;  5GLW A;  5L7O A;  3NO8 A;  5BY5 A;  4Q4V 2;  1YWK A;  5AC9 2;  1Z78 A;  2X53 S;  5FZF A;  3P3P A;  3V56 A;  5AC9 3;  2J7M A;  2WNE A;  3POB A;  3KVA A;  2EIG A;  5A7S A;  4X8P A;  1H2L A;  5M0T A;  4BQ1 A;  1IPK A;  4OQ8 A;  3JB4 C;  4M3C B;  2VBP A;  2PHF A;  4OMC A;  5DUX A;  3N7K A;  4P9J A;  5IAX A;  3AZX A;  1F4H A;  2UWB A;  4PLO A;  4OLL A;  2VZ3 A;  2CU5 A;  3PIJ A;  4QPG A;  1G9F A;  1SCS A;  1H8T B;  3WF4 A;  1Q8V A;  2WLP A;  2ZAB A;  4QXC A;  3CBN A;  2RDN A;  3WHT A;  3ZN5 A;  1GOH A;  3QH6 A;  3MUZ 1;  1SZB A;  1XNT A;  3RMY A;  2VO5 A;  4KGQ A;  4XQ4 A;  3ZO0 B;  1R09 1;  4K7J A;  4UFL A;  3U11 A;  5FCC A;  4GMP 3;  3RZK A;  1XB9 A;  1JBC A;  3KT7 A;  4K1Y A;  1S0B A;  1L3J A;  2MPF A;  2ZGQ A;  1A6C A;  1BXH A;  2HWC 3;  4LE4 A;  4OHV A;  4Q27 A;  4COW A;  3ZYI B;  1A8M A;  3CKH A;  4CVU A;  4I0W B;  4BE3 A;  2WII B;  1VAV A;  5DDJ 2;  4QX7 A;  1VB4 A;  3WNX A;  5T50 A;  1CIY A;  2B4K A;  3ILR A;  1YIF A;  5DDJ 3;  2CGP A;  4DO0 A;  3FLR A;  4C0H A;  4HMZ A;  1UKG A;  2UYA A;  2RS3 1;  4LKS A;  1ONA A;  4NO4 A;  2IFW A;  3DCQ A;  1SLC A;  2X8K A;  5E6H A;  1GV9 A;  3U14 A;  3I7D A;  4YVS A;  2ZGT A;  1CES A;  1Q8O A;  2LRO A;  5DMY A;  3WG1 A;  1UZV A;  4JTO A;  1RHI 2;  3RYR A;  3N9M A;  1NQJ A;  2XHN A;  5FY9 A;  1GIC A;  1UU4 A;  2GND A;  2J42 A;  2JG9 C;  4GB3 2;  4S2D A;  1UAI A;  1TMF 3;  4GB3 3;  4ET7 A;  5BNN A;  3WY6 A;  1W39 A;  5EV7 A;  1XPW A;  3MIH A;  1XJA A;  4PBO A;  5DZF A;  3III A;  5LK5 A;  4OI2 A;  2IXK A;  3JU9 A;  2QUO A;  3WNK A;  1C8M 2;  5KXB A;  2V5D A;  4MET A;  4NJ4 A;  4XDP A;  1ND2 C;  4L99 A;  3SIT A;  3RZG A;  3W5N A;  3PVO A;  4QX3 A;  5J98 B;  1YQ2 A;  3I2H A;  4GH4 C;  1ALY A;  2JDM A;  4DXZ A;  1GQP A;  4MVT A;  4QM8 A;  4OHY A;  3V0B B;  1QJU 2;  1JMU B;  2W1W A;  1HB4 A;  1QJU 3;  5C8C A;  1GFF 2;  4XUQ A;  4FPY A;  5C3Q A;  3ORJ A;  4W6Y A;  1UZ0 A;  4JGY C;  4QHB A;  1O4Y A;  1US2 A;  4PDW A;  3ZIW A;  2JG9 B;  1JYI A;  1SDD B;  3IMM A;  4W4Z A;  5FP7 A;  1QH7 A;  4A3X A;  4AI9 A;  2WNU C;  4RD7 A;  3QD6 A;  2FDG A;  5FPL A;  2HWE 1;  2XBO 1;  3SCF A;  3TYJ A;  1B09 A;  4YW4 A;  1WCD J;  2ZAH A;  4AVS A;  4XCB A;  2PFW A;  2A6Y A;  1P8J A;  2VTF A;  5FMD A;  4EN0 A;  2L9L A;  1ND2 B;  2E6V A;  4COZ A;  1WWY A;  3MW3 A;  4URT A;  4A7Y A;  4RR3 A;  1W6O B;  4GH4 B;  2Q8C A;  4AE2 A;  2VMG A;  4HFS A;  4RYD A;  4WZC A;  5JSO A;  2X10 A;  3NQH A;  4QM9 A;  1OH4 A;  2VJX A;  1POV 3;  2C9K A;  3JQX A;  3ON7 A;  3OUI A;  4IL7 A;  4Q4Y 3;  3WQ7 A;  1VBC 1;  2DFB A;  4XET A;  3OY8 B;  1V9U 2;  2CWM A;  4JGY B;  4TLG A;  3VBS C;  3FC0 A;  4FO9 A;  3UES A;  5HCA A;  1UY4 A;  2OA2 A;  1KDK A;  1RL3 A;  2A7A A;  3U78 A;  1XE7 A;  1H6Y A;  2E32 A;  2WNU B;  4P9W A;  5L7O C;  3ZN4 A;  3B01 A;  3LDB A;  3DUI A;  4M00 A;  1S0E A;  2VC9 A;  3ZYG A;  2VCC A;  4QKN A;  2ZTN A;  3H8X A;  3J7M A;  3GJA A;  1FV3 A;  4LBL A;  4XFI A;  5D2A A;  3ZYR A;  2PN5 A;  2Y34 A;  4QQL A;  4XMA A;  2XL9 A;  4AED A;  2ZCW A;  4UOJ A;  4Q26 A;  3AL5 A;  4MHU A;  1IS3 A;  2F6B A;  5F3C A;  1Q8Q A;  3B9C A;  1QNW A;  3SXW A;  1N1T A;  4YM0 A;  1GKB A;  1AXK A;  1R09 2;  2YC2 A;  3VBS B;  3C2U A;  4J6G A;  4RA0 A;  3WX5 A;  4Z2A A;  3OOX A;  4GJZ A;  1CD3 G;  5FZ1 A;  1OC1 A;  1UPS A;  3CZJ A;  3ZYH A;  5L7O B;  3WNL A;  2C24 A;  3KHC A;  1UIK A;  3N3H A;  4XF3 A;  4EWE A;  3RQ0 A;  4CSW A;  2ZMK A;  4DNY A;  1RUD 1;  1V6K A;  2BYV E;  5FUN A;  4YFW A;  2NZ9 A;  4NR1 A;  4BME A;  3SH5 A;  4ES8 A;  2QQP A;  1EV1 3;  3ZFE B;  2XHK A;  2RS3 2;  4Q1P A;  2PHU A;  2RS3 3;  5FWE A;  4FPL A;  4YZ3 A;  5IVB A;  3T0D A;  4YM2 A;  2Z5W A;  4AEJ A;  3ACI A;  4YVS C;  3AKT A;  4Y1X A;  4NRO A;  2QQK A;  5FAX A;  3X29 B;  1DGW A;  5FO8 B;  1J58 A;  1W6Q A;  4LLO A;  1JZ8 A;  3RI8 A;  1DQ0 A;  1MVE A;  4GAL A;  2XUE A;  4MGQ A;  1WLW A;  2A6X A;  1UMI A;  1WW7 A;  3J7H A;  2GN3 A;  5LA1 A;  2OYZ A;  1MEC 2;  5FPV A;  1NAE A;  3MI8 A;  5BPX A;  2CDO A;  5FRE A;  5FXZ A;  4IV1 A;  1WBF A;  4B4Q A;  4JKK A;  2UWC A;  3N9N A;  1BVV A;  4QWN A;  5FP4 A;  1OMI A;  4MV2 A;  5FZ6 A;  5T5O A;  3W58 A;  4MGT A;  3FWE A;  3QCW A;  4M4R A;  4HET A;  1HQL A;  2ETE A;  1NZC A;  3EBR A;  3CJX A;  3VLB B;  3LEK A;  2MNG A;  3NV1 A;  2GNT A;  4YVS B;  1OPM A;  1PIV 1;  3BPZ A;  5FP3 A;  1LHO A;  1FMD 1;  1O59 A;  2DU0 A;  1LED A;  2EXH A;  3O7O A;  3KMH A;  5ANQ A;  5JZG A;  2Y6H A;  4FOV A;  1REF A;  4RQP C;  3UJO A;  4AHZ A;  4CXX A;  1RYY A;  3K3O A;  4CCM A;  4PDW C;  3P3N A;  2HWE 2;  2XBO 2;  4D0Q A;  2HWE 3;  3ZXA C;  4IET A;  2J1A A;  2K0G A;  4W50 A;  5LB6 A;  3USU A;  2PLV 1;  3PVE A;  2WQ8 A;  4EV0 A;  4Z92 B;  3A21 A;  1J1T A;  2WYS A;  1WUV A;  1WW5 A;  4RR3 C;  1Q3E A;  2VQT A;  3UT0 A;  3VUO A;  1PZ8 A;  1DF0 A;  1QNY A;  4XJ9 A;  4BXF A;  4K40 A;  2XPJ A;  1VBC 2;  1OOP A;  3TAY A;  1VBC 3;  5DUV A;  1MVQ A;  3MYX A;  1DYK A;  2W94 A;  3H7J A;  4RQP B;  5T55 A;  5EQU A;  3RMX A;  5CA6 A;  4PDW B;  3BUC A;  4BK4 A;  2F4L A;  1NLR A;  4AW7 A;  3KCY A;  1G6N A;  1K45 A;  3C7G A;  1CPM A;  3AJZ A;  1N1S A;  3J26 N;  4J1W A;  5ERL A;  4R4X A;  4QDQ A;  4WVW A;  5K7P A;  1CAU A;  1VMF A;  3IZO A;  5JMO A;  4MXV A;  2Q8E A;  3LA2 A;  2OVU A;  4RR3 B;  1PVC 1;  4HLT A;  2VCB A;  2BPA 2;  3M3O A;  1ZBA 1;  3MLL A;  4XIK A;  4CCL A;  1ZVF A;  5F7U A; 
#chains in the Genus database with same CATH homology
 2J1S A;  1HN1 A;  1W9S A;  1K3I A;  4LQR A;  4BXS V;  1LNS A;  5JXJ A;  4A3Z A;  4DUX A;  1SHW B;  4IUG A;  2YG0 A;  1R64 A;  1UXZ A;  4BJ0 A;  4ARY A;  3GM8 A;  3LQC A;  3C7H A;  2JKX A;  4RN5 A;  4QB2 A;  2E31 A;  2E26 A;  3FL7 A;  3OGS A;  4XUT A;  1OT5 A;  3C8X A;  3WNP A;  2J22 A;  1IQD C;  1W8O A;  2ID4 A;  3A7Q A;  3I3E A;  1GU3 A;  5IJR A;  4P08 A;  5JUV A;  4DEQ A;  4MO3 M;  1JYV A;  5EJ1 B;  3K4D A;  1UY2 A;  3DYP A;  2ORZ A;  3OEA A;  3NNG A;  4YPJ A;  3WQB A;  4CU6 A;  1EUT A;  1UMH A;  2Y64 A;  3GXU A;  4OUE A;  5JXI A;  3D3A A;  3T0B A;  2XQX A;  2WN3 A;  3LEG A;  3THC A;  4D8M A;  1JZ6 A;  4AG4 A;  4DXS A;  3OG2 A;  2W1Q A;  4OYU A;  1UY0 A;  1GUI A;  1H6X A;  3MBW A;  3NRU A;  3SKV A;  2QQN A;  3I2G A;  4JKM A;  3VDC A;  5C7G A;  1OF3 A;  4QB1 A;  1W0N A;  4QX0 A;  2BGO A;  2QBX A;  1DLC A;  2X09 A;  2HLE A;  2YFU A;  3NJX A;  4GZ9 A;  2Y6L A;  4QAW A;  3WF1 A;  3UET A;  1JHJ A;  5CYY A;  2VQU A;  3VD4 A;  2QQM A;  4JKL A;  3ZM8 A;  2EIC A;  2WZE A;  1J84 A;  5I0D A;  3K46 A;  1TG7 A;  5IYY A;  1W9W A;  5LCW L;  1JYN A;  1JZ7 A;  5F7U A;  5JR2 A;  3NJV A;  2R7E B;  1GMM A;  3T09 A;  4CUA A;  3I3D A;  2XOM A;  4AAX A;  3SEE A;  1EUU A;  4QX1 A;  1CZV A;  1L7Q A;  3ETP A;  2Z4F A;  3F2Z A;  3T08 A;  2W3J A;  1CZT A;  4XUO A;  2BZD A;  1T2X A;  3I2I A;  4FI9 A;  3FHA A;  3T0A A;  4A45 A;  1ULP A;  3CZU A;  2RV9 A;  4L0P A;  3GGL A;  3W5M A;  3THD A;  3WF2 A;  1TVG A;  5B4X A;  1UYZ A;  3MO4 A;  4DEV A;  3LPF A;  4OZO A;  1PX3 A;  2W1U A;  4A42 A;  3CIH A;  1K42 A;  1JYX A;  1PMH X;  2RVA A;  4GWI A;  2J1E A;  3C7O A;  2WUH A;  3K4Z A;  1WCQ A;  3ACF A;  3HEI A;  3FHQ A;  5HXM A;  4A41 A;  1O8P A;  4XUN A;  5J1X A;  2ZEX A;  3MV0 1;  3HN3 A;  2PQS A;  2J1U A;  3ABZ A;  3WSO A;  5DN2 A;  4A4A A;  4UI9 L;  3LPG A;  3DYO A;  2VZT A;  1PMJ X;  1NKG A;  1D7P M;  3HNM A;  4UAP A;  1F4A A;  4ZZ8 A;  5DPN A;  2WO2 A;  4QDS A;  2W47 A;  4JHZ A;  3MV1 1;  2YB7 A;  4DXR A;  1JU4 A;  3ACG A;  4XVH A;  2VZS A;  2JDA A;  2Y8K A;  3E1F 1;  4MAD A;  2LW8 A;  2WN2 A;  4E8D A;  1ULO A;  4MGS A;  1W9T A;  2QQJ A;  3HNY M;  5CZK A;  2J1T A;  3T2O A;  3OEB A;  4ARX A;  4KI5 M;  2VM9 A;  2J1R A;  1CX1 A;  2ZEY A;  2VR4 A;  1I5P A;  3ECQ A;  2J7M A;  2VZO A;  3LE0 A;  4OMC A;  3A23 A;  1F4H A;  3C7E A;  3VD5 A;  1UYY A;  2VZ3 A;  3OBA A;  3WF4 A;  3A22 A;  4TXW A;  2VZU A;  1UWW A;  2VZR A;  2YC4 A;  4P02 B;  3CDZ B;  4BDV B;  1GOH A;  2Y6J A;  4ZZ5 A;  1JZ4 A;  1OF4 A;  2VMC A;  3AC0 A;  3MUZ 1;  1XNT A;  2VO5 A;  4CUB A;  4DUW A;  2XON A;  1PX4 A;  3I97 A;  2C26 A;  3CKH A;  4CVU A;  3IAQ A;  1J83 A;  3T2Q A;  4XUP A;  1CIY A;  2B4K A;  3EYP A;  2ORX A;  2WAO A;  2JD9 A;  4LKS A;  3VD9 A;  2WBK A;  2J1V A;  2WDB A;  3WF3 A;  1L7R A;  5IFP A;  1KGY A;  5DMY A;  3WEZ A;  3HNB M;  4CUC A;  4E8C A;  2VME A;  1XC6 A;  1UXX X;  4PT6 A;  2XHN A;  2V4V A;  4ET7 A;  2Y6G A;  2YFZ A;  2VMF A;  4LPL A;  3HPN A;  4PF1 A;  1XPW A;  1GOF A;  3III A;  1JYW A;  1UY3 A;  3WNK A;  2V5D A;  4GWJ A;  2VZV A;  3W5N A;  4QX3 A;  1YQ2 A;  3I2H A;  3OGV A;  3P6B A;  1GQP A;  2EIB A;  5EIY B;  2VMD A;  5A1A A;  2W1W A;  3DYM A;  4A44 A;  1W8N A;  2JE8 A;  4XUQ A;  3CMG A;  1JI6 A;  1UZ0 A;  1US2 A;  1SDD B;  4HG6 B;  2X05 A;  4P5Y A;  4W4Z A;  2DCJ A;  2WAA A;  2W46 A;  3VDA A;  4JX0 A;  2VTF A;  1P8J A;  2WZ8 A;  2RJ2 A;  2L9L A;  3SKJ E;  2DDU A;  3K4A A;  2E33 A;  1OD3 A;  4RYD A;  4CU8 A;  2X10 A;  3NQH A;  1OH4 A;  3I3B A;  2VJX A;  3JXS A;  2C9K A;  5JXG A;  5EJZ B;  3UES A;  1JZ5 A;  1UY4 A;  1DYO A;  2Y6K A;  3C7F A;  1WKY A;  1H6Y A;  1UYX A;  2E32 A;  2ZEZ A;  3CQO A;  5LA2 A;  2V72 A;  2VC9 A;  3WNN A;  3WNM A;  2BER A;  2VCC A;  4PQQ A;  5DQ0 A;  5HPO A;  2ZXQ A;  3K77 A;  4TTG A;  2HYX A;  2KD7 A;  2W91 A;  4UOJ A;  5G04 L;  2QQO A;  4KWU A;  2VZP A;  2WO1 A;  1GNY A;  4ZY9 A;  4Z2A A;  2YC2 A;  2OKX A;  5G05 L;  3CZJ A;  3VD7 A;  3WNL A;  2W92 A;  5FUI A;  2QQI A;  2ZEW A;  1W99 A;  4BK5 A;  2W1S A;  4LHS A;  4ZXE A;  3IB3 A;  2W95 A;  1NX9 A;  3VD3 A;  1JZ3 A;  1GOG A;  3T0D A;  3VDB A;  4XUR A;  3HJR A;  3IAP A;  2C4X A;  3ACI A;  1JZ2 A;  2VCA A;  1XNA A;  2QQK A;  4OMD A;  3U37 A;  5C70 A;  3PUI A;  1JZ8 A;  1DP0 A;  3UNP A;  3EB7 A;  1KEX A;  1UY1 A;  1US3 A;  4MGQ A;  2DCK A;  1UMI A;  3J7H A;  5JXH A;  5LA1 A;  2VL4 A;  3MUY 1;  3OGR A;  1NAE A;  2CDO A;  3OB8 A;  4M4P A;  3FN9 A;  4JKK A;  4QX2 A;  5IFT A;  4M4R A;  3LEK A;  3K75 B;  1BHG A;  5C71 A;  2VOT A;  1O8S A;  4W8J A;  3BGA A;  3HOB A;  2WAB A;  1O59 A;  4QDR A;  3IDA A;  2BBA A;  1SG3 A;  2B9V A;  2VZQ A;  2Y6H A;  2W5F A;  1RYY A;  3PUH A;  3LEI A;  3I2J A;  3T2P A;  4D0Q A;  2J1A A;  4W50 A;  1JU3 A;  4DXT A;  2WQ8 A;  4CU7 A;  4XZU G;  3A21 A;  2WYS A;  4QB6 A;  3ACH A;  4DUV A;  2VQT A;  4A6O A;  2VZ1 A;  5LA0 A;  3I2K A;  5B4N A;  3WNO A;  3SEP A;  4QPW A;  2W94 A;  3P1I A;  1MPX A;  4BK4 A;  4P00 B;  1CZS A;  2W87 A;  1K45 A;  3C7G A;  2LS6 A;  3I2F A;  4QDQ A;  2QQL A;  2W9X A;  2CDP A;  5JMO A;  4KMQ A;  5IHR A;  2EID A;  2WO3 A;  4CU9 A;  3GDB A;  3BN6 A;  2VCB A;  3WF0 A;  1UX7 A;  1NUK A;  1K12 A;  2EIE A;  3DEC A;  4MOA A;  2BGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...