5B4NA

Structure analysis of function associated loop mutant of substrate recognition domain of fbs1 ubiquitin ligase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
RNLLRNPCGEEDLEGWSLDVNGGDGWKVEELSRDQRKEFPNDQVKKYFVTSYYTCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRPDCGSKYQLTVRLLSENEDVLAEFQPDPATIQQKSDAKWREISHTFIDYGPGVRFVRFEHGGVDTHYWAGWYGPRVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box only protein 2
publication title Structural analysis of a function-associated loop mutant of the substrate-recognition domain of Fbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 38
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5b4nA00
1UZ0A 3SEEA 4DUVA 2VZOA 3I3EA 4CU9A 1JZ2A 4BK4A 2E31A 2BGPA 2J1TA 3C7FA 1OH4A 4QX1A 4DXTA 3ACIA 3A22A 2XOMA 1W0NA 2VZ3A 4BK5A 1PX4A 3DECA 3ACGA 4MGQA 2WUHA 1XPWA 4P5YA 1JZ3A 2PQSA 1UXZA 4LHSA 3NNGA 1JZ4A 3FN9A 3HN3A 5JXJA 1J84A 4LQRA 2ID4A 2DDUA 5DQ0A 2W46A 4RN5A 4GWJA 3I2FA 4IUGA 3FHAA 1K42A 4A41A 1JHJA 1OF3A 4Z2AA 2E26A 5F7UA 2YFZA 1NUKA 1WCQA 4CU8A 5IFTA 1PMJX 4ARYA 2W87A 2JD9A 3A23A 3HNBM 4LKSA 1OT5A 2RVAA 2VTFA 2X05A 3CQOA 3LEGA 5JXHA 2JKXA 4OUEA 1W9TA 2J1RA 3OEBA 3VDAA 4ZY9A 3OGRA 4XUTA 4UAPA 1O8SA 4W4ZA 4JKKA 3VD9A 3AC0A 2WDBA 3BGAA 3NRUA 1EUTA 3HOBA 3SKVA 3K77A 5IHRA 1JYWA 5IYYA 2VR4A 1UWWA 4QX3A 2QBXA 2VMDA 5HXMA 3GDBA 4OYUA 1T2XA 3T0BA 5CZKA 3I3BA 2J1UA 5JXGA 4QDSA 4UI9L 3ACHA 4CUCA 1US3A 1SDDB 1O59A 4QB2A 2WN2A 4XUQA 1UX7A 4KI5M 3VD7A 4ARXA 3LPGA 4TXWA 3W5MA 4DUWA 2VCCA 1D7PM 3T09A 1KEXA 3PUHA 5A1AA 4YPJA 4XVHA 2BERA 2Y64A 2ZEXA 3OG2A 3VD4A 2VZQA 3IB3A 2YB7A 2XQXA 1US2A 2C26A 2Y8KA 5G04L 3WF3A 2VMEA 1H6XA 2WZ8A 3HJRA 4RYDA 2WQ8A 4DUXA 3I2GA 1CZVA 2WO2A 4A3ZA 1CX1A 4LPLA 4ET7A 3CKHA 2VZVA 3A21A 4A44A 4BXSV 1HN1A 2VZTA 2C4XA 3WNOA 2QQNA 1UYYA 2W91A 4A42A 2BBAA 3I2HA 2W47A 5C70A 2DCJA 3C8XA 2VCAA 1GOFA 2L9LA 3GGLA 3K4AA 4A4AA 5DPNA 2OKXA 2VZ1A 3OBAA 2Y6HA 3GM8A 1DLCA 4MOAA 1W99A 3D3AA 3PUIA 4OMCA 1UY1A 2WN3A 3T08A 1UY4A 2QQIA 3WF2A 3WF0A 4JX0A 5HPOA 4A45A 5JMOA 2KD7A 4CUAA 2Y6LA 3IAPA 3MUY1 2BZDA 1EUUA 3ETPA 4XUNA 3UESA 2DCKA 5EJZB 5IJRA 1L7RA 3I3DA 1UY2A 5LCWL 5B4XA 1SHWB 3EB7A 2W1WA 4PF1A 2J7MA 5DMYA 3UETA 2X09A 4MGSA 1JZ5A 2V4VA 4MO3M 3HPNA 3DYMA 4JHZA 1GU3A 2EIEA 3IDAA 2J1SA 1RYYA 4BDVB 3WEZA 4JKLA 3I2JA 1XNAA 4XUOA 3WQBA 2W5FA 3LEIA 5C71A 4AAXA 3E1F1 3LPFA 4M4RA 3WSOA 1JU3A 5FUIA 2J1VA 4CVUA 3ECQA 3NQHA 3C7GA 4CU6A 4QX2A 1O8PA 3WNLA 1UY3A 3WNMA 3WF4A 4CUBA 3HNYM 4TTGA 3P6BA 2X10A 2B4KA 3NJVA 3VDBA 5EJ1B 1W8NA 4XUPA 2YFUA 2WZEA 4XURA 1JYNA 3IIIA 1W8OA 1F4HA 2B9VA 5CYYA 3THCA 2W95A 1R64A 2RJ2A 3OGSA 2ZEZA 3LE0A 3T2QA 4DEQA 3I2KA 4W8JA 4P08A 1XNTA 2EICA 5JUVA 2C9KA 5IFPA 1GOGA 2E32A 3K4DA 1TG7A 4CU7A 2QQJA 5LA2A 1GNYA 2VCBA 3BN6A 4FI9A 4PT6A 2VMFA 1W9SA 2W1UA 4ZZ8A 5I0DA 3C7OA 1L7QA 4HG6B 4KWUA 3SEPA 1GQPA 1UMHA 3I97A 4QX0A 5JXIA 2W9XA 4L0PA 4UOJA 3T0AA 4GWIA 1GMMA 2WAOA 2VC9A 3THDA 1JYVA 3C7EA 1JU4A 2CDPA 2ORZA 1JZ6A 3ACFA 3UNPA 2E33A 3J7HA 3VD3A 3CZUA 1XC6A 4QDQA 4OMDA 1NAEA 4GZ9A 1H6YA 1TVGA 4QB1A 2YG0A 3T2PA 2WBKA 3K4ZA 3GXUA 3HNMA 2ZEYA 3P1IA 2J1EA 3OEAA 2JE8A 2WO1A 2VJXA 3I2IA 1BHGA 4JKMA 1UYXA 4OZOA 2LS6A 3VD5A 1UMIA 2VMCA 2VL4A 3W5NA 3EYPA 2Y6GA 2Y6JA 4P00B 4DXRA 4BJ0A 2VM9A 3LEKA 3SKJE 1J83A 2VZSA 1JYXA 1UYZA 4PQQA 2YC2A 3K75B 4D0QA 3T2OA 5LA1A 3OB8A 3NJXA 3CDZB 3CIHA 2J22A 1F4AA 2V5DA 1ULOA 1K3IA 2J1AA 4ZXEA 4AG4A 2W92A 2WAAA 3U37A 3A7QA 1NKGA 3F2ZA 1GOHA 3K46A 2R7EB 2HLEA 5J1XA 3C7HA 1PX3A 2W94A 2ZXQA 3CMGA 3WNNA 2QQKA 2VZRA 2HYXA 3WF1A 4ZZ5A 4QB6A 1CZTA 4M4PA 4QDRA 1DP0A 2VO5A 1PMHX 1OD3A 2XHNA 1NX9A 3VDCA 2VQUA 1MPXA 1CIYA 1OF4A 1JI6A 2LW8A 1WKYA 2W1QA 2WABA 2XONA 1CZSA 1IQDC 3IAQA 1UY0A 2WYSA 3JXSA 3HEIA 1W9WA 4D8MA 1P8JA 1JZ8A 4E8CA 2RV9A 3OGVA 2ORXA 2W1SA 2WO3A 4XZUG 5EIYB 1JZ7A 3MBWA 2EIBA 3DYOA 1I5PA 2YC4A 3WNPA 3MV01 4QAWA 4A6OA 5B4NA 2JDAA 5LA0A 4QPWA 2Y6KA 4KMQA 3FHQA 3FL7A 1SG3A 2ZEWA 5C7GA 2VOTA 1DYOA 1YQ2A 3T0DA 1LNSA 2W3JA 2BGOA 4MADA 3ZM8A 1K45A 3DYPA 5DN2A 1GUIA 3WNKA 4DXSA 5G05L 5JR2A 2EIDA 3MV11 2VZPA 3MUZ1 2Z4FA 1ULPA 2VZUA 2VQTA 2QQLA 4DEVA 2QQOA 4E8DA 1UXXX 3LQCA 1KGYA 2CDOA 2QQMA 4W50A 1K12A 2V72A 3ABZA 3CZJA 3MO4A 4P02B
chains in the Genus database with same CATH superfamily
4WM8B 5GZDA 2QQWA 3GZEA 1ZZ9A 5DDJ2 4CU9A 1G9BA 5LBCA 2WJSA 2J1TA 3GALA 1CJDA 1MS8A 4AEDB 5JI7A 3O5SA 3N4MA 5A3OA 3ZVXA 2BOJA 2OT7A 4GALA 1T6GC 1Q8VA 4UT5A 5KXEA 4NN0A 2VOVA 3E5UA 3OUHA 5JVVA 2ZACA 3I7DA 2WIIB 5BNNB 3BTZA 2WZR3 2WKKA 2VZ3A 3WDVA 3T1MA 5LATA 1QQP1 4FTBA 2CY6A 3DECA 1K5MA 5I0SA 1RUG1 2AUYA 3AVSA 3R4UA 4ITCA 4WVMB 1SLBA 4NRQA 2YPJA 3ROUA 4AVAA 4LHSA 2EVXA 4IGPA 3KQ4B 1TMF3 3NWKA 5EHDA 5FMOS 1JZ4A 2HWC2 4OHWA 2AR6A 3PUSA 3KCYA 1AL21 2YUEA 5JXJA 1G86A 2CAVA 2P37A 2ZS6B 4DRVA 2VNOA 1HRI2 2UWCA 4GWJA 3I2FA 3VBUA 3FHAA 1JHJA 4UFJA 4PLOA 1RMU3 1Z7S2 1RB8G 1JUHA 1NCRA 4RGGA 3VBFC 1H2LA 2YFZA 3N3HA 2OYZA 1SBFA 1WCQA 3H3ZA 5FZ1A 1F2NA 1XNBA 2WWJA 1LGCA 1ZRCA 1XYPA 1UZWA 1AZDA 1REDA 3H3UA 2ARAA 2JD9A 1BJQA 3EXUA 4Q1PA 1JH5A 1DZTA 5JR7B 5T54A 3A23A 4WZFA 3ZN6B 5A32A 1H2NA 2XGXA 3UK9A 3KGLA 2A73B 2Q8OA 2RVAA 3APBA 1W6QB 2VTFA 4NHMA 2HWB3 3VL9A 3RZMA 4HN1A 1KQRA 5DXDA 5KHKA 3MIEA 5EWSA 4XF9A 1W2TA 2DCZA 2JKXA 1W39A 1YNAA 4JGZB 3RI9A 4F3JA 1HIXA 1A8DA 4QM9A 5H9PA 3OEBA 5EYYA 3ZYJB 5DAPA 1CIWA 3OGRA 1QQP2 4K1YA 5GZEA 1O8SA 4QWNA 1LODA 4W4ZA 3AM2A 5FKCA 1RUG2 3JBG1 3AL6A 3QD6A 3TYJA 4DNYA 1W6OB 3F95A 3NKTA 4BHPA 4AFAA 5EPAA 2EXKA 3ILRA 1NCQB 4YARA 2EAAA 2YC0A 5IHRA 3EQEA 1SLIA 1QDOA 4JGYA 3BTXA 3SITA 2JDNA 2XB6C 5FY1A 4D6QA 4AHYA 1AL22 3MW4A 4BA6A 3KT4A 3AMQA 5KHJA 3LIHA 3UGFA 1DHKB 2BBVA 2WA3A 4LA2A 4LR4A 3ZR5A 3GDBA 3N7MA 1V00A 4LO5B 1UU4A 4META 2K46A 4UW4A 5JIUA 4SLIA 2I07B 2GAUA 4H3WA 5B2GB 1YFYA 3POJA 5HCFA 1HB2A 2J1UA 5JXGA 1RUJ3 3G7DA 1EV11 3H1WA 3ZFEB 1WLTA 4UI9L 4Q4V1 3ACHA 4XACA 4AEDC 4BPZA 5KC5A 4E2SA 1NQJA 4XPVA 1GNHA 1ULFA 2Q8EA 3RG0A 4JCKA 4M3CE 1KXGA 4FOQA 1Z0HA 1CAXB 3LPGA 2XR4A 2ENRA 5FYCA 2FMDA 1SEFA 3U4SA 4AVCA 5BNNC 3PUHA 4ZXKA 2DFCA 3LDBA 1W6PB 5FYVA 4YPJA 2OUHA 1YJKA 2YHJA 4XVHA 1O5UA 2BERA 1X82A 2UWAA 2UYAA 2Y64A 3AJYA 5CVRA 1UKRA 1KS5A 2DVGA 1QWRA 2R043 4WM7C 4IE5A 4X6RB 4BQ2A 4UFIA 1CAWB 1D4M1 4PBPA 3JBG2 4PLNA 2XQXA 2C26A 3BU7A 3WF3A 1BVVA 2RS11 1H6XA 3HJRA 2WQ8A 5GZGA 3I2OA 5IW0A 4CP9A 2D5FA 1CX1A 2G19A 2EIGA 2D40A 4MV2A 4ET7A 1GKBA 2VVEA 3CKHA 5FXXA 2FDIA 3AJZA 1PNFA 3N7KA 5F5AA 3GCWA 1OOPC 4RS5C 3U14A 1ZX5A 2YGLA 1RC6A 3I49A 2FDGA 5A7QA 2QQNA 1QNYA 3WQ1A 2GP5A 2R063 4UW6A 3O1TA 2W47A 2QUOA 1Y43B 2NM1A 4D7TA 5C70A 3VZMA 3PIGA 1GOFA 4GD4A 1EV12 2UY9A 4QX7A 3NAPA 3S30A 1VBE1 3S6PA 2RM21 4Q4V2 3VDDA 1BCXA 1JTZX 5DPNA 5FV3A 2ERFA 4CPBA 2QZ3A 3WW2A 3GM8A 1WBFA 2W2IA 5IVJA 2YV8A 3SXWA 3RZJA 2ZGTA 1VB4A 1W99A 5GLUA 5C3PA 1CWPA 1WGPA 2CWSA 4K21A 4P9JA 5FY9A 1RUF1 5EYXA 1QNWA 2DBNA 1POQA 4AQTA 2OX0A 3WF0A 5JZGC 4S2GA 1RUE1 1RJ8A 3TAYA 2XUMA 5HV0A 1HRV2 1LGBA 5JMOA 2JX9A 4IEUA 4E2GA 2Y6LA 3UT0A 1IS4A 3AMNA 1BQPA 4NPMA 4YW2A 1YQCA 1XYNA 2WS91 1D4M2 1EUUA 3UESA 3ZXFA 4HVRA 2WNVB 5CG9A 2JIJA 2RS12 1W8WA 4RQPC 3IWZA 5IJRA 3RRDA 1LOFC 4YGEA 1S1AA 4BXFA 3GNEA 2HH9A 2GMPA 5GJ6A 5B4XA 1H4HA 2I45A 1LR5A 4AZZA 1PZ8A 1OVSA 4EZ4A 2J7MA 1GZWB 3K3OA 2VQ0A 1IG0A 4LT5A 3FLTA 3SNMA 2D98A 4E9KA 1XYOA 1JZ5A 1DBNA 1ZREA 1W90A 1XNCA 4JHZA 3WUCA 4R4ZA 2MEV3 1DQ6A 2EIEA 3IDAA 4AOCA 4YW4A 3KF3A 3WEZA 5A6YA 1VBE2 3I2JA 3QOPA 2RM22 1VE0A 3WQBA 5C71A 1PK6A 4HK9A 2JDYA 5F37A 3IT8A 1CONA 4LTAA 4IL7A 1CAXA 4M4RA 1H1AA 3PMSA 3WSOA 2PAKA 5FZ8A 4ZKTB 4LKDA 4MGYE 5FUIA 4CVUA 2DCTA 2FHRA 5CFDB 3E5QA 2CU5A 1MS9A 1RUF2 2WFF3 1O8PA 4HZFA 2DVDA 3WNLA 3I59A 4Z8BA 3WNMA 2DF7A 1RUE2 1WD3A 4QPGA 2CYFA 1W05A 1YI7A 3JU9A 2X10A 1CESA 3NJVA 4KU7A 4LE4A 1UN1A 2YYOA 5EJ1B 4XUPA 1ENSA 1CQ9A 2WS92 4H55A 1POV0 4ZONA 2HJIA 2WZEA 1Q8QA 2WWUA 4Q4X1 1DDLA 1S55A 1YJLA 2XL7A 4HVQA 4K20A 1PM7A 5C5TA 1X33A 2ZABA 5IVVA 1F4HA 2B9VA 4I30A 1VAVA 2RR13 4AQSA 3W9AA 1BYHA 3KF5A 1ZZ8A 4AGGA 3OGSA 4AHZA 3B93A 2UU8A 2ZEZA 4FOWA 5C3OA 2XVLA 5C4WB 5FMBA 4C0BA 1J1LA 4W8JA 2IC1A 1XNTA 5JUVA 1WLCA 1GOGA 3K4DA 4MVTA 2ZCWA 4KWKA 1FAYA 5A6QA 3RQ0A 3BN6A 4PQ9A 1U12A 3KV9A 4B7EA 4FOYA 4GB31 4PT6A 4Q2FA 5FPBA 3O1SA 2XLFA 2CTVA 3C7OA 4UBHA 2ZMLA 3CLPA 4NOTA 3POGA 4XJAA 1WCDJ 1L7LA 5GALA 1UMHA 3KM5A 5C5UA 2ATFA 4I0AA 2NMNA 4AHXA 1ULEA 3FMGA 3EO6A 1A8MA 1WMFA 3J9SA 1LHWA 3T0AA 4GWIA 4HPKB 4MXWA 5L19A 1CX4A 3KHBA 2RJKA 2WAOA 2BVVA 1JU4A 4P9YA 5C8CC 1OA2A 5FO9B 4KL1A 2ORZA 4YW5A 4Q4Y3 3AVRA 2GNTA 3K2OA 3AYDA 1UU5A 4MYEA 5FY4A 3VD3A 1VRH1 2VG9A 4Q4X2 4DY5A 4QDQA 1MR5A 3M7AA 5C9AB 2NMOA 2D6KA 3GZUC 1VBB1 1UCXA 3G6JB 3U11A 1LULA 2WBKA 4GH4C 2DBIA 4PI0A 1Q8SA 2JB4A 3WQ7A 4JV4A 1W06A 3MHZA 2GALA 1JYTA 3DN7A 4BM8A 5D8AB 1LKNA 3WY6A 2A75A 1QJX3 2G1MA 2D3SA 4IE6A 4KGGA 4PDWA 4RGKA 3RYPA 5LB6A 2LUWA 3I2IA 3WP6A 1AF9A 5JOXA 4NIDA 3IIAA 1OPMA 1UYXA 2C6SA 2LS6A 5C3RA 4S2HA 4AEJA 4FAHA 1QHDA 4MGTA 1B35C 2D3RA 4GB32 1ZZ7A 2VL4A 3EYPA 3SCGA 3THPA 3RWKX 2Y6GA 3O0XA 3FLPA 3VBHB 4D7YA 1H4GA 5T5PA 4RD7A 4QXKA 1RJ7A 1G9AA 4UF0A 3WW1A 5A6ZA 3HMYA 4YVWB 1UYZA 5FZ4A 1E57A 5I8SA 4D3WA 2YC2A 4ZU7A 5IVFA 4AI0A 4Q8KA 1RTVA 1F5FA 3CIHA 1T6BX 4XF1A 2V5DA 2J1AA 3BCWA 4ZXEA 5F5QA 4O9EA 3IMNA 4BH9A 1VRH2 1OLME 4FBFA 1BBT1 3POYA 3U37A 3WP3A 4XDPA 4ATEA 1LOEA 2ZAHA 1GBGA 3TEWA 3GHMA 1VBB2 1VMFA 2VUCA 3OTFA 4AFDA 1PO21 5K0UB 1GOHA 2O0OA 3AKTA 4AE2A 4NPLA 1MS0A 1YUDA 2W94A 4PCRA 4X6QB 2ZXQA 4HSJA 4XJ8A 2JDHA 2XL9A 3FFQA 4IV1A 2D7FA 2X5IC 4XCAA 2XVKA 4XMAA 5HBAA 5J98B 1HXS1 2IFWA 3M2MA 4LKEA 3RMYA 4CP1A 4Y4RA 5DZEA 1VBC3 4QDRA 4RFT0 2SLIA 1S0FA 4DZGA 1UMZA 1BVP1 5K7PA 1MVEA 3BYWA 1NX9A 1XNKA 3DPRC 4Y1VA 4GKXA 3VDCA 3VBSA 1VALA 1MPXA 1O7FA 4GJYA 3FFZA 2RDNA 2ZGOA 3H1MA 2YBKA 2BEOA 1X8EA 1V6KA 3DXTA 2LW8A 1H9PA 2WABA 5DAVA 2A7AA 3J7NA 1IQDC 2VMHA 3IAQA 3KT7A 4KWJA 4B3NA 4NHLA 4DMIA 5CG8A 2G9GA 3AXEA 3OGJA 3HEIA 2IXLA 3ZFFB 1OBNA 4CDWC 1HJGA 3POIA 1Q56A 3VBOC 4EWDA 4BQWA 2AREA 1GZTA 1BEV3 2Q1MA 5I93A 2Q1FA 3OGVA 3O7OA 1BBT2 5C9AA 1YFXA 2C5DA 1XB9A 1QEXA 4DB5A 3BODA 3AXDA 2Y26A 3CBNA 5BNOB 1RITA 3BTAA 1PO22 2VNRA 3LZZA 1LECA 5ABJC 4EYUA 4OI0A 1I5PA 3W58A 5KWRA 2K0GA 5B4NA 1NXMA 5D8AA 5LA0A 4QQLA 2Y6KA 4Y26A 3NV3A 4Y1UA 1HXS2 3IDCB 4I0WB 4ISRA 1SG3A 1TEIA 3OPTA 1AR73 4I3PA 3QACA 1O6UA 1TNFA 3LA2A 3VBHC 4DY3A 2WR9A 1DYOA 1YQ2A 4CXXA 3T0DA 2BTVC 4H2AA 4MADA 4L92A 1K45A 1UOGA 1SBDA 1YWKA 1V0AA 4CDUC 5A1FA 1CGPA 3ILNA 2YMZA 5JR2A 1GP5A 1V9U3 3ETQA 2VZPA 1OLRA 4YVSC 4YVWA 1V6MA 3H9AA 5CBLA 4N53B 5EJ3A 1DYPA 1UPIA 2JG9B 4C90A 3BIEA 3MIFA 2VQTA 1ULDA 4NMIA 4N43A 4LBMA 5CADA 5LRRA 4IEPA 3O1UA 4E2QA 1LESA 1TME1 4IEXA 1AXYA 4W50A 1AYM1 1XE0A 1LOGA 3ABZA 3BIWE 1WW6A 3WHTA 3SEEA 4DUVA 2VZOA 3I3EA 1UF2C 2BP6A 4BK4A 4B8EA 4D7SA 2E31A 4RR3B 1QY4A 1QJU3 4CDQB 1YQ5A 1OH4A 4AVSA 4QGLA 1IGOA 5A7NA 4I0BA 5F2WA 4QX1A 4NR1A 2WNOA 4B1MA 4HETA 2Q8DA 3ACIA 5KHGA 3A22A 2RDQA 2XOMA 1RUH1 2XXZA 4LHKA 1W3XA 4BK5A 4Y4YA 3GBWA 5C33A 2YBSA 4HOOA 5FBJA 5CFCB 5L9VA 4DRRA 3OY8A 3PU3A 4IV3C 5FZ9A 4LOSA 1NA1A 1HDKA 1Y9QA 1U5YA 4EJRA 4P9XA 4I2OA 1WMXA 3NNGA 3X29B 4QM8A 3FN9A 4CXYA 2DWRA 2P6CA 3NV2A 1MQTA 4RHV1 4S2FA 5F2SA 1DGWX 2WNUB 5I8YA 1CPMA 3PURA 4XF3A 4A2UA 3H7JA 1UKGA 2W46A 2VXJA 1AR93 2IXHA 4EN0A 2ZKNA 2PLV3 4IUGA 4A41A 1D0GA 1OF3A 4IE7A 1F9KA 4IETA 5GLVA 2LROA 2O8QA 1I9RA 5F5IA 1TME2 3KZ4C 3DKQA 4LEJA 4LXLA 1EAH3 1VRBA 2R49A 2ZAAA 2FZ1A 4AFBA 5IFTA 1AYM2 1PMIA 1VBD1 1SFNA 3RI8A 3R4DB 2IXCA 3Q8EA 2VUDA 3N36A 4BZ4A 5FPVA 5ACA3 1SQ4A 3UYJA 1DZRA 4G4FA 1OT5A 1HB1A 1K5MB 2CGOA 3UKVA 1LB2A 1FPN1 4B29A 2DU1A 2ZHLA 1OQ1A 1UAIA 3HBKA 4GMP0 1XBFA 4YW7A 3LEGA 3IN9A 1QXRA 3EMRA 3O1PA 4OUEA 4YZ2A 4YFWA 3H8OA 3M3OA 2J1RA 4QKBA 2WZPP 1RUH2 4YZ3A 3WP4A 1COV3 1PIV1 2PN5A 2W39A 4UAPA 2V73A 1CVNA 5FDBA 2EA7A 4QT6A 3VD9A 1O4YA 1O5LA 1LU1A 2D6OX 4Y22A 4YW3A 3VBUB 4FPCA 3BGAA 1QOTA 2WYFA 4R9DA 1NCRB 3ZYIB 4H7LA 4N53C 4UWDA 2IXIA 4FFIA 1JYWA 4ZS2A 2JG9C 4IXLA 4Q29A 1GWLA 2O1QA 2VR4A 4HXCA 3SQOA 1OLQA 5IVCA 4RHV2 1GP6A 1PM4A 4Q5OA 4QQ2A 2P3YA 4GQ7A 2P34A 1ZZBA 2VMDA 5DG2A 3E6CC 3ILFA 4W6XA 5BNQA 3ZOIA 3RZKA 2FD8A 2YU1A 3OBZA 4OYUA 1RUC3 3T0BA 3VZKA 3UGHA 5A32B 3AK0A 1ODNA 1FMD3 5FZBA 3VKFC 4NIAA 4AL9A 2CGPA 2BVBA 2GP3A 4AEMA 4LNVA 4QDSA 4XDOA 1ND3A 1VBD2 3ZIWA 5IATA 5BNPC 1US3A 1UW8A 1ZBA3 3IKWA 4GXLA 1QMJA 3MIHA 4PIYA 3WP5A 1SPPA 4N9IA 4LITA 1R093 4KI5M 4D69A 4ARXA 3J8F3 1DCSA 1J59A 5ANNA 1R1A1 3T4HB 3S0MA 1FPN2 4TXWA 2Q0AA 2OS2A 4AR2A 4DUWA 3PJQA 1X8MA 1PGW1 1OHFA 1KS4A 2HWE3 2VECA 3HQXA 5A1AA 5LZ6A 5FWJA 1ZBE1 3NJYA 3POEA 4JGYB 1HQLA 3D5OA 4IW3A 3ZYHA 4BQXA 1PIV2 4K6BA 1BXHA 5FMDA 4NAOA 3QBQA 4UYBA 3IB3A 5A3MA 3HT1A 4TLGA 3VGIA 3CU7A 4OUSA 4A3ZA 4O9GA 3FUOA 5FXVA 3D6EA 4LPLA 1ND2A 4Q26A 5IVEA 4KBZA 4LKFA 4RL7A 4CYDA 1RHI1 3A21A 4A44A 4MGKE 2VZTA 2WA4A 1C8NA 1W2AX 3EHKA 2RS53 4W6WA 4YG6A 3POSA 1FT9A 3LD8A 2K9ZA 1YEWA 1H8VA 4A42A 2BBAA 4BB3A 4F8AA 2DCJA 5F39A 4JQTA 4RGAA 1X50A 2A6YA 2D5HA 3GGLA 2VVDA 3KGZA 1DQ0A 5APAA 3ZXEA 2GNDA 3K4AA 2R30A 1EP0A 4A4AA 1MS1A 2DVBA 2JXAA 3UGGA 3VBRC 1H8TA 3P5BA 2VZ1A 2Y6HA 3B9CA 3B3QE 2Z2SB 3JB4C 3I54A 3OGGA 3OPZA 1R1A2 1U5XA 1ONAA 3PUIA 1RUI3 2WWSA 5K9YA 1IPKA 4R52A 1LOCA 1DZQA 1PGW2 3WF2A 4FP3A 4CP9B 1ZBE2 2XLAA 1A3KA 5FYIA 5HPOA 5D21A 4FVVA 2EALA 2KD7A 4CUAA 2JENA 1MS4A 4LA3A 1Q3EA 3HT2A 2HBUA 1RVF3 3MUY1 1OMIA 2BZDA 3GJAA 5FLIA 4XUNA 1RL3A 1GQGA 3ON7A 5F1RA 5EJZB 2PMWB 4IESA 4QXHA 5FZMA 4UFKA 4DIQA 1L7RA 1LU2A 3I3DA 5F9TA 2C0ZA 3J4UH 4CEWB 3O1RA 1G9CA 2FCTA 5IK5A 1AXKA 2W1WA 1RHI2 3MYXA 3NAPB 2ZX3A 3U75A 4MHRA 4WV8A 3C2UA 3VDDB 1JOJA 1EYBA 2OUJA 1VMJA 2P5BA 2ARXA 4MO3M 1J1TA 4FFFA 1J3PA 3B94A 3MICA 2WSUA 1GU3A 4Q0VA 5KXCA 3SISA 1QIQA 4HMZA 4LBQD 1KDKA 1NG0A 1OUXA 2XJPA 4FT8A 4BQYA 2W5FA 3LEIA 3WCRA 4AAXA 5E88A 2YGMA 1AXZA 3PUQA 1DF0A 4FPLA 1QU0A 2PHTA 4OHVA 1JBCA 1AVBA 1IZ3A 1JU3A 5FYBA 2V5YA 1PGSA 3RVHA 1ENRA 2WL1A 1NLSA 1XU2A 2ILMA 4HKOA 3ALQA 4URAA 4YM2A 1C8M1 3ZFGB 1HB3A 4CU6A 3B00A 5FQ0A 4HONA 4COZA 4YM3A 2XUEA 4TTGA 4QPYA 3UKNA 2B4KA 5FP7A 3PTYA 5KR7A 1W28A 1YRZA 1JYNA 3IIIA 1CAUA 4D6RA 1XOYA 1WUVA 2XPJA 3THCA 2UY8A 2W95A 5A70A 1UO9A 1GFF2 1NYWA 4WM8C 4YFZA 4Z1VA 1LAJA 1R64A 3GZAA 2Q30A 1GNZA 1HV1A 3M70A 1N1VA 1OFNA 3I2KA 1PK6B 2JICA 4XTPA 4BWOA 4P08A 3TWIA 2JDKA 2C9KA 2CGNA 3ST7A 5IFPA 3NL1A 2E32A 3WG1A 2LM3A 1TG7A 5IWFA 4CU7A 2QQJA 3CJIA 2RJLA 1J3RA 1GNYA 3AZYA 5LA2A 4COWA 2VCBA 4Y20A 5CKNA 5LEJA 1X9PA 5JDBA 2RS33 5CA6A 3OUIA 3I59B 2PXJA 1OQDA 2VMFA 4CCLA 5FXWA 4QPGB 1W9SA 1ENXA 1HRV1 2W1UA 4OFGA 4CCOA 5I0DA 1L7QA 3AKQA 2Q5TA 3U1XA 3FUQA 3RZHA 4HG6B 4KWUA 4BLJA 2I74A 1ZZ6A 4OVEA 2KM2A 2R071 3I97A 4M01A 5JXIA 5T55A 2W9XA 3AZXA 2O14A 4L0PA 5CNAA 3ZSLA 1JN2P 1C8M2 2KR2A 3OSDA 1CR7A 1QF3A 1FOD3 1C1LA 4KWLA 4FCAA 4LO7A 4Q4W1 5A3PA 2VC9A 1TNRA 4ORFA 4QX8A 3SH4A 3C7EA 1JYVA 1OVPA 5I0TA 1DU3D 1A78A 1CJPA 3H8RA 1Q8PA 2E33A 2EXJA 4NWWA 5JIAA 3B9IA 3VZNA 4OI4A 1N1SA 4UW3A 2GSYA 3LFIA 5BXXA 4W65A 2VPVA 3AYCA 2HWD1 3KHCA 4H14A 2P3JA 1R081 4EN9B 4CEWA 1H6YA 4NHYA 3WDXA 1TVGA 2A5ZA 2YG0A 5FZFA 3T2PA 4WM7A 4F7ZA 1V6IA 2IVIB 3GXUA 3P1IA 3HQUA 5IAVA 1S2KA 2R32A 5FOJB 2IUWA 3OEAA 4QHBA 4CDXA 3S5AA 2AC1A 4CTEA 1S0EA 4JGZC 1G6NA 3FWEA 3K3NA 2Z79A 3CNAA 4OZOA 1S0GA 5JCTA 3VHNA 1PVXA 1OOPA 3KCCA 1W2UA 4P9LA 4RS5A 4OI1A 1UMIA 4MXWB 5FYMA 4CCMA 1IKQA 1UIKA 3FJSA 3GZTB 4MLOA 1OFSA 4EZHA 4YGCA 1JOBA 3LOIA 2AZ5A 4XHXA 3RWNA 4P00B 5FYUA 2QKDA 5EZWA 2ZGLA 2R072 1NCQC 4QHZA 4DXRA 1E5HA 1S2BA 2JB8A 1YLLA 2VZSA 3JD71 4Q8LA 4TLFA 2Y0IA 1ACCA 4LJHA 4CCCA 4J1XA 4XBLA 1MEC3 4Z82A 5IVYA 3ZFGA 4AYUA 3K75B 3QLQA 1RUOA 5LA1A 1RUD1 4Q4W2 3NJXA 2JDZA 5FY5A 5AFEA 5EQUA 2BOIA 4P5HA 5EFUA 1M06G 3DF0A 1YIFA 4FPEA 4NRMA 3M1HA 1POV3 4MG2A 3ZPOA 3NNMA 5HI0A 2HWC3 4XF0A 2R0HA 1JHNA 4JVAA 2HWD2 5FP9A 3ZFEC 5JZGA 5LY1A 4PDWB 3BTYA 1KFUL 3H3LA 1R082 5FYYA 3ZN5A 3R4SA 1LRHA 3F2ZA 5LASA 5TSWA 1PK6C 4A3XA 3O0VA 5FO8B 3A4UA 2GC2A 1NE6A 1MVQA 2R7EB 1H0BA 2HLEA 2PA7A 4A6SA 3C7HA 1YFWA 2XBO1 4AI1A 1JYCA 4LUKA 4GWMA 1Q5OA 1Z7S3 1GICA 3CMGA 3WNNA 4RQPA 1LOFA 3TB0A 1YIPA 1VMHA 4QXBA 5CISA 3U0ZA 1OH3A 4UF0B 2GN3A 4NIHA 4EWAA 2ZJCA 4PIXA 2UURA 5FZOA 1CZTA 3LWCA 4M4PA 1IQAA 1DP0A 2BQPA 2VO5A 4YWAA 1AUYA 1H9WA 1VLNA 2MHFA 3PJYA 5GLWA 3VLBB 2HEWF 2R16A 1YC61 1TE1B 5FK7A 2GU9A 4HSLA 4OHYA 1A6CA 5FP8A 1PVC3 3JD72 3ACLA 1S4CA 2XONA 2W1QA 5JSOA 2W52A 3ORJA 3ZKYA 1OI6A 4GA9A 4NWVA 4COVA 1QQP3 1KRIA 1RUD2 4L97A 1BMV1 3E97A 3JXSA 2XQRA 4PIZA 4XCBA 4YM0A 3T4VA 1RUG3 1S2EA 1WCKA 1QJFA 2DVAA 1GWKA 4LMFA 4GIQA 4HN0A 1JZ8A 3HR9A 2RV9A 2X53S 4IEVA 4I02A 2LRPA 4IV1B 3A0NA 4QU1A 5DAWA 2ZOEB 2G9ZA 3S7EA 3O0WA 1JZ7A 4A7YA 3KQRA 2EIBA 3AP4A 1QJU1 5ERLA 3SMHA 3DYOA 3VUOA 1SLAA 1GANA 1VBA3 2ZZQA 1HX6A 3LAGA 2F17A 5A7WA 3CJXA 4AAPA 2XBO2 1AR63 1NZIA 2BNMA 2BW8A 3Q9OA 1C4RA 4QAWA 3GHNA 4R9BA 4CCDA 2JDAA 2B42B 2Q4SA 3M3IA 4JTOA 1QH7A 3CHXA 4QPWA 4XILA 5HXVA 3VBSB 4KMQA 3VHPA 3H42B 3FL7A 3DKWA 5C7GA 5A6XA 4QPIA 4LBLA 4LLFA 1EY2A 2VH9A 4DINB 4QQHA 1E5RA 2XLGA 2BGOA 5F8PA 1Q8OA 4NRPA 4OCTA 4Q0PA 4Q27A 3ZM8A 1UOBA 4AGVA 2WNVC 4CA9A 2E51A 1GUIA 5G05L 3MFAA 3MV11 1Y3TA 3MUZ1 1KFXL 1LTEA 2Z4FA 2WC2A 4HK8A 3WT3A 4UXAA 4CCNA 1E5SA 4CXWA 2QQLA 4KGQA 2UYBA 4GWNA 1FX5A 3BB6A 1BMV2 3SHRA 2NZ9A 3JBG3 3OOXA 4E8DA 4D6SA 1UXXX 2JDUA 2OPWA 1EAH1 1DIWA 2JECA 3JB8A 4PDWC 3ZIXA 1GZCA 1B09A 2ZGMA 2CDOA 4NHXA 3LFMA 1K12A 3MI8A 2GH2A 4J1WA 5ACA1 5FPXA 2G9FA 3TNQA 4QB6A 4PF1A 1QJY1 3MIDA 3D4KA 3N9OA 5IK7A 3NVCA 1PZ9A 1QJU2 2P3KA 1JZ2A 5BV6A 5C8CA 1NXD1 2EXIA 2QQVA 3C7FA 5M0TA 4KG0A 4UFLA 2QNKA 2P1BA 5CFDC 1URXA 4QGNA 4YNIA 1DLLA 2ZBJA 2ZGUA 1OKOA 1OUSA 4NJ4A 4XFFA 1A34A 4DXTA 1EV13 3MIBA 3KMHA 5J7MA 5FKBA 4Y1XA 4YM1A 1W0NA 2VQAA 3N9QA 1PX4A 5FRAA 4YZ5A 5A3TA 1OXCA 1S0IA 1FNZA 4QQPA 5LEKA 3ACGA 3FX3A 2JJ6A 1W3VA 4P5YA 4HKWA 3W21A 3P3PA 1JZ3A 4XAEA 4MZUA 4QKNA 4N43B 3URFA 4AQ2A 3N7LA 2OQ6A 2JD4A 1D4VB 1OA3A 2I2SA 4LO4B 3VN4A 2DV9A 2VBDA 1J84A 1B35A 2ID4A 2TNFA 5L73A 5C4WC 4RN5A 2MNGA 1DG6A 5IK8A 3RJ2X 4L8QA 2VBBA 3I8TA 1K42A 4JHTA 4XFGA 2E26A 4AK3A 1EAH2 2FDJA 1AR81 4J25A 1RXFA 3C3VA 4XMIA 1HQWA 1PMJX 1LCLA 5T3NA 2YU2A 1ZBA1 2W87A 3W59A 3NNJA 3DCQA 2VNGA 4ARYA 5AC91 1DGRN 5GLTA 5ACA2 1PGL1 1R091 1QJY2 3NO8A 1ALYA 1V6JA 4QU2A 1YXWA 5IK4A 2DVFA 1BKZA 5FP4A 2VD7A 3N7JA 1MACA 2A3WA 1OD5A 3OY8B 4M3CF 4OLLA 5DUVA 1QJEA 2HWE1 2HBTA 2W68A 2X05A 1LEMA 1NA1B 4XDQA 3BKZA 3FZ3A 3POBA 4FTSA 3CQOA 3SCHA 1NOVA 2GC0A 1W9TA 1JYIA 5K8SA 1IG3A 4COYA 1VBE3 4WVVA 5LBFA 2RM23 3KV6A 1MQTB 3BALA 4JDOA 4XUTA 1YFUA 4FXGB 4ZY9A 3VDAA 5I8TA 1W03A 3W20A 5FY0A 1QDCA 3AC0A 2WDBA 2X5IA 3ZO0B 2NN8A 3SKVA 3K77A 3V0BA 5C9AC 3E6DA 1I1EA 3MLJA 3RYKA 5AVAA 5IYYA 1UWWA 1RUE3 3FBMA 2OA2A 4H7MA 1IS5A 5HXMA 3MGUA 1RUNA 1FXZA 3DPRA 4ATFA 2ZMKA 4FP2A 3WZ1A 2WS93 5D8AC 1UNBA 4HLTA 4PBOA 4N90A 4QKFA 4YRDA 1AR82 5CZKA 5DAQA 4DFSA 5JSPA 4N8MA 3I3BA 5A7PA 2QDRA 2ZKLA 3K48A 1NQDA 3WHUA 4OUMA 1ZBA2 2WZR1 1FV3A 2ADDA 4LBJA 5AC92 5FP3A 4XYXA 4LK6A 1R092 5L7OB 1PGL2 5FLJA 1O59A 4JDNA 4QB2A 5FZDA 2WN2A 4XUQA 4CDWA 3GF6A 1W8TA 4XFBA 1RUI1 5FREA 3VBOA 2ZGRA 2VUAA 1O3QA 1J3QA 5FPZA 3W5MA 3GJBA 1H2MA 2HWE2 2WNEA 4Y22B 1S0JA 4BQ3A 3VL8A 1TMF1 1D7PM 4CEYB 5FMCA 2RG4A 4BIOA 4YVWC 5FBZA 1UD1A 1MS3A 4C0HA 2WT2A 1JUIA 3LGRA 3OG2A 4Q0SA 5KHIA 3LF7A 4P14A 4DOUA 3VD4A 2YDEA 2VZQA 2FDKA 3T30A 1RMU1 4IE0A 4N7UA 3I4IA 2CWMA 1US2A 2Y8KA 4K1ZA 5H9SA 1ASJ3 1W0OA 2VMEA 5A7OA 4B4PA 2WZ8A 4RYDA 4DUXA 2D6NA 4UW5A 5T5LA 2EAKA 3N9PA 1G8WA 3H7YA 3UJQA 1ULCA 5GKAC 2XWJB 1DQ1A 4XEZA 2VZVA 2RS52 1PNGA 5K0UC 5K4LA 1ND3B 2VMGA 1HN1A 2RHPA 1CAVA 1Y7BA 4IGQA 3GBFA 4AI8A 4LHNA 1SPPB 1UX6A 4CDUA 4BE3A 2W91A 2HWB1 1UIJA 2B5HA 3IDEA 1VPHA 2CAUA 4Q4X3 2XKPA 3JUUA 4BU2A 3C8XA 5FFOC 4MUVA 2WZR2 3U07A 4XIKA 3ENRA 1FATA 2ZX4A 2OKXA 3D8CA 5FTTC 3O1OA 2C1FA 1REFA 5J48A 3OBAA 1NA1C 2ZTNA 1LOBA 5F3EA 4IDZA 1DLCA 1RUI2 2P6HA 2BFUL 2VUJA 2BDRA 4JC1A 3OBRA 3D3AA 4GMP3 5FLHA 1EPZA 3WINE 1TMF2 2WN3A 5FZIA 1UY4A 1WLWA 1SCRA 4AGRA 5KXBA 3NMBA 1IPSA 1SLTA 5JAXA 3USSA 5FZ0A 5SV5A 1ND2B 4FPHA 3ZPYA 4MX3A 1NZCA 1X36A 4A45A 5D2AA 2OXBA 3MF9A 3MFCA 4LBOA 3IAPA 3ZFFC 1Y4WA 3WDUA 1RMU2 5KHHA 1Q43A 2AENA 1BK1A 2Z42A 3B01A 3DEMA 3TOJA 1UOFA 2GMMA 4Q1RA 1RUJ1 4GULA 5LCWL 1KD7A 1WA4A 1SHWB 2ZHKA 2NQYA 2VE1A 5BNOC 2BPA2 1DGRA 1LHNA 1NLQA 2B7YA 4IV3A 4B4RA 4N9HA 5DMYA 3PNAA 1VIWB 2ES3A 1H8TB 2BWCA 3RZLA 1OA4A 3SH3A 3OJBA 5GZCA 4WVZA 2HWB2 4MH0E 3LKJA 1VRH3 2AYHA 3JQWA 4OQ9A 4QKDA 2J1SA 1UU6A 3ZYPA 4FFHA 4JKLA 5FZCA 1VBB3 3PLQA 3H8XA 1FV2A 2W08A 5L7OA 2R041 1O4ZA 2PHUA 1Y9MA 2E7QA 1NE4A 1NT0A 4M0NA 1XXNA 5ISLA 3AMHA 4LOTA 3ZXAC 3ZXKA 4AXOA 3DL3A 1DQ5A 2KA3A 4EQVA 2JIGA 4A7KA 4CEYA 5BPXA 4AI9A 4C1WA 2A3XA 2A70A 2GDFA 4OQ8A 5FK8A 4V1PA 4C91A 4QX2A 4JRAA 1JW6A 1UY3A 2ET1A 2WRAA 3WF4A 2Z69A 2ET7A 2GN7A 2DFBA 1SBEA 2OZJA 3B7MA 5A1LA 1IKPA 2DCYA 3WCSA 2ETEA 3N9MA 5FPLA 3O1MA 2R061 4NE9A 2PTMA 1XE7A 2B46X 2YFUA 4LBKA 5FIXA 5FYZA 4XOGA 3NSTA 3RGBA 2ZGNA 1F8VA 4ZU5A 2JG8A 3POFA 1RUJ2 2B45X 1REEA 1ND3C 3ZX7A 4NVPA 5CYYA 1GV9A 1OSGA 5AFBA 3R0RA 4KH9A 3ATGA 2XG3A 3MZHA 2RJ2A 2ZGPA 4MGIE 4RR3C 4CP0A 3T2QA 4NPRA 2A6VA 2C24A 1S0BA 3PIJA 4CDQC 1XSRA 2PFWA 3VBFB 1ODMA 4YYOA 4IGOA 4I01A 4JDMA 4LORA 5JPMB 1I6XA 1I3HA 3N9LA 4AI3A 5LWBA 4I3GA 1AX0A 2TUNA 4ZU4A 1UZYA 2BGCA 1APNA 4RFRB 5CFCC 3LA7A 4FI9A 5FQ0B 1PO23 2R042 5CIRA 3RJRA 1BLZA 2YY1A 3KB5A 4Q0UA 1NY71 3OYWA 3UL2A 1MEC1 3AMMA 1UQXA 3JCIA 4W6YA 4P9GA 3R05A 1CAUB 4K8RB 2WT0A 5F3IA 5FPAA 4MXVA 4XTMA 3PVOA 2PAMA 2WNUC 3D0SA 1HN0A 2G4IA 3L2HA 3LIGA 1GMMA 5LY2A 3RZGA 1RXGA 1POV1 4XBQA 1CPNA 1W9YA 4LBQA 4CCKA 2CDPA 4UFMA 4WZCA 4XZPA 1JZ6A 2XHKA 3RNSA 4M3CA 2A3YA 2R062 4OHXA 3VB9A 3IDBB 2HKXA 5F6KA 3CZUA 2MEV1 1W0PA 1KDMA 1NAEA 1QH6A 1O91A 3CJIB 2CL2A 3A0KA 4FPJA 3BOWA 5A3NA 4QHOA 3K4ZA 4Y20B 5JWPA 4IE4A 5FYHA 3ZSEA 2BYVE 2E7AA 2ZEYA 1K5MC 3IZOA 3TN93 4L11A 3ZMNA 4YSFA 5C3QA 1W8UA 2FCVA 2ZGKA 4KBBA 2V4AA 3PVBB 2J1EA 1LEDA 2Y0OA 4E27A 2JE8A 2WO1A 3J26N 2FDFA 1HW5A 1ENQA 1ZM1A 2XJTA 1IS3A 2PHFA 1F31A 2E9QA 4JZRA 4FAGA 2WFF1 5T52A 4AVBA 1BHGA 3BU0A 3VD5A 2HEVF 2RDRA 4YG3A 2XJRA 2TBVA 4OI2A 1UPSA 2VMCA 4R9CA 4DO0A 4SBVA 3W5NA 2XJSA 3USUA 3VBUC 3LEMA 2F4LA 5IUQA 2VW0A 3Q8BA 5FZEA 5GM0A 3E6BA 4XQ4A 1PVC1 1NCRC 1NY72 1MEC2 1S0DA 3SKJE 1JYXA 1YQ8A 4PQQA 5DZGA 2ADEA 2LALA 3OF1A 3ZN4A 4NAMA 3VBRA 3VKNA 2RR11 1KJRA 2ZHNA 1AYN3 1W6NB 4ZHNA 1HQNA 5A33A 4U2AA 1GSLA 3CDZB 4WM7B 2VY0A 3EBRA 4GJZA 2J22A 1F4AA 3I3QA 1ULOA 4AG4A 1U5IA 1WW7A 4G9SB 3HD8B 2VMIA 4IEQA 4CDXB 3AYAA 2MEV2 2OIIA 2ZX1A 4K3UA 5I0RA 4EN6B 1W6MA 3EJKA 1VBA1 2JKBA 3A7QA 3T3YA 5F6LB 1OQEA 2EF6A 2IZWA 2NLRA 1AR61 3K46A 4YG0A 3WG2A 1OOPB 4RS5B 3TNPB 5C3SA 1SFPA 1PX3A 3ZXLA 2RMU3 1N3OA 3WXPA 4XIOA 1GQHA 3VBFA 1TME3 2QQKA 2A1XA 2VZRA 3L2YA 3NNFA 4YGDA 4L2NA 1W2NA 4Y3OA 3SC7X 4DS0A 3WD5A 3BOPA 4CCEA 2WFF2 5AVPA 1AYM3 5KBFA 3NKGA 3NW4A 4JGYC 3MLLA 5LK7B 3PDQA 3AZZA 1TZOA 3PTRB 5CB7A 1OD3A 2CNAA 5JOWA 1K5JA 4Z2WA 2VCMA 4XXPA 4Q4Y1 2VQUA 2WT1A 1LHUA 4Y24A 1ZA7A 4OULA 2H6BA 1V6LA 3OUJA 1PVC2 4GKYA 5A7SA 4CZSA 3O12A 2BU9A 4RA0A 5LBEA 1XE8A 2ZHMA 3ZSMA 5JZGB 1CZSA 2CV6A 2VVFA 1RUH3 4K9SA 2RR12 2X8KA 3WNXA 5IT6A 1UY0A 2WYSA 5E1RA 2QVSB 5FPUA 5KXDA 3WW3A 1P8JA 5FY7A 2YPDA 1QJX1 4XQWA 3ZXGA 4RQPB 1C1FA 2B39A 3BVCA 3CJIC 4BYYA 4FTEA 4TSVA 2WO3A 1E5IA 4XZUG 1O3SA 4NIGA 1VB2A 3LCPA 3ZSKA 4RHV3 1VBA2 5FCCA 5FZOB 1AR62 3D0JA 2Y6FA 4XW3A 2VOWA 1UOJA 2YC4A 2ZGQA 3MV01 3WNPA 3JZVA 4Z92B 1N1YA 4LUMA 2W0XA 3M4FA 3PVNA 5FZHA 1WMDA 4ES8A 3FHQA 1F5JA 2HWF3 4TYSA 5F3CA 4WM8A 1VBD3 2Q1ZB 2QE3A 4IEWA 2A6ZA 5FJHA 3AKPA 2VOTA 4AEDA 3VHRA 2R1BA 1LNSA 2DUQA 1FPN3 4Q4Y2 3DYPA 1RIRA 2RE9A 4DXSA 5BNNA 1PO13 2DTWA 3AP5A 1V70A 4ISQA 4CEWC 3M3EA 3ZLIA 5HV4A 1G9FA 1WWYA 2AACA 3NAPC 2VZUA 3VDDC 1W6NA 1PIV3 4WVMA 4BCUA 4DEVA 2H6CA 2O8OA 4FPGA 1YI9A 3L9JT 5I0UA 2QQOA 4CDXC 5A7WB 3PVEA 2NPIA 2PHRA 4LBNA 2QQUA 1QJX2 1SLCA 3IMMA 2N7GA 1U5ZA 4P02B 1H30A 2DUOA 2QQMA 2V72A 2OZ6A 3CZJA 4EROA 2YROA 4HANA 1VBC1 3ME2A 1UZ0A 1ZRDA 3KV5A 5J36A 4ONUA 5DUUA 3WW4A 4LO8A 1J58A 4QPIB 1DGLA 3HWJA 2BGPA 5A3UA 3WQ0A 2PHDA 3HN1A 2TEPA 1XJAA 5DDJ3 5FYTA 2R1DA 3IPVB 5LW9A 2E7TA 1KITA 4PJYA 4L99A 3ZFGC 1W2OA 2JE9A 2FZ2A 3LDRA 2P2KA 1LOAA 4GAZA 2HEYF 2BFUS 2GZWA 2AEYA 3AP9A 3HVDA 2QJVA 3ZN6A 3MDPA 1M4WA 3O14A 2WUHA 2VTXJ 2IXKA 1XPWA 3KS7A 1W6QA 4MGQA 1JXNA 3OCPA 4Y5TA 1YO8A 4ASKA 1C57A 3KLSA 1R1A3 1DFQA 3ZXDA 2PQSA 1UXZA 5L36A 4EN7B 1BEV1 3KD4A 1HJFA 2Y34A 3B5LB 3OBTA 4JGZA 2LTNA 1AL0G 5T5JA 2D93A 1ZBE3 2RDSA 3HN3A 3Q8CA 4XXAA 4LQRA 2DDUA 3UJOA 5DQ0A 5H9RA 1ULGA 3VZLA 3MF6A 1W6OA 5A3WA 1AJOA 5C8CB 1OC1A 4Z2AA 1HRI3 1OURA 1F35A 5F7UA 3HBZA 1NCQA 4Q0QA 1WBLA 3ZYFA 1NUKA 3LSDA 4XJUA 4CU8A 4LULA 3Q8AA 3MW3A 3WG3A 1AR71 3BPZA 2WLPA 3SH5A 1GP4A 1RHI3 1VBC2 4EE2A 4DPNA 1XU1A 4GH4B 4LKSA 3HNBM 4QPGC 4U36A 3VHOA 2VGDA 3IBMA 4J6GA 3M3CA 3AZWA 3WUDA 2XJUA 4IERA 1TQ5A 4IEYA 2XJQA 3Q8FA 3VKMA 3RSJA 4XC9A 1V9U1 1AJKA 3ZFEA 5GZFA 5JXHA 1FYUA 3ZYGA 5LK5A 4G3YC 3CF6E 4LLOA 1OLMA 2GC3A 4NROA 3O1VA 3KV4A 3ASIA 1QXJA 3FE5A 1H2KA 5GLZA 5EP9A 4XAAA 4M00A 3ZXJA 2QDNA 4BQ4A 5FZAA 5DAXA 1B35B 4CRQA 1ASJ1 2PHWA 2JWPA 4JKKA 1X9TA 1ZRRA 1LJ7A 1QOOA 2VOKA 3FC0A 4KNCA 4KG8A 4LK7A 4R4XA 5FYSA 3RPQA 3SLIA 3NRUA 5JMCA 4JTNA 1BEV2 1W6PA 1EUTA 3HOBA 4X8NA 4XFCA 1N47A 1O3RA 4CPBD 1YCIA 4IEOA 1WA6X 4QX3A 2QBXA 2E53A 3AP7A 1IS6A 1AL23 1GZ9A 1CAWA 2R0FA 5J09A 2GMEA 5FJKA 1ZRFA 4L9BA 1VAKA 3RYRA 1T2XA 4XE9A 1W9FA 5FWEA 3PUAA 2XMLA 3AKSA 4FSJA 2E63A 4XETA 4AWDA 1AR72 4QPIC 2H0VA 2VBPA 4CUCA 1SDDB 4LIUA 4MHUA 4C8DA 1UX7A 4YLZA 1D0HA 1SZBA 2BWAA 2K2SA 3LA3A 2WQ4A 4GMP1 3VD7A 1AHSA 2PQQA 4DQAA 4BQ5A 1BK0A 4HVOA 2IWGB 2VCCA 4NO4A 5LBBA 1KEXA 3GCXA 3IPVA 3T09A 1V9U2 2X5IB 4PHZA 4FFGA 5E6HA 2ZMNA 1F15A 3V0BB 2D6LX 1R1ZA 1MZFA 2ZEXA 3CEWA 4S2DA 5BNPA 4K40A 4NUBA 1W8FA 5BY5A 4AFMA 2FDHA 1AR91 2PLV1 1ASJ2 5E89A 1SFYA 4K7JA 5HCHA 3DPRB 2YB7A 3T2TA 5G04L 5FZ3A 3M3QA 4EV0A 3UKTA 1Y9GA 5L9BA 3I2GA 1CZVA 2WO2A 1LHOA 3WDWA 4E4ZA 1C8M3 3NV4A 5FUPA 2DYCA 1FI2A 1W8ZA 3WV6A 4BXSV 1GWMA 1SMVA 1WMEA 2C4XA 4Y1YA 4MSVA 3WNOA 2WNVA 4CDWB 1UYYA 1GYKA 4NIIA 1XQNA 3VBOB 3CL1A 3I2HA 3ZSJA 2Y38A 4ASMB 3INAA 2VCAA 3DXUA 2L9LA 2EXHA 4P9WA 2R6QA 5LRSA 5HCBA 1GZWA 5E16A 3TBDA 1L3JA 3ZKUA 1COV1 2WFPA 3P3NA 4BMEA 3ZYBA 4B4QA 3OD0A 1Z78A 4GH4A 4Q4V3 1VR3A 1DGWA 3OD4A 2VXRA 5JLVA 4MOAA 4CSWA 2FBEA 3RDIA 3V65A 3NNLA 5ABJB 4ZPIA 2HYKA 3K51A 4MGZE 1HKDA 1OKQA 2XJVA 1H1MA 4OMCA 3PHMA 1UY1A 4XF4A 3T08A 2QQIA 3KCXA 2PAEA 3DV8A 1JOPA 5CEHA 4JX0A 5D1IA 4ES9A 3QH7A 2A6XA 5FMOL 2Q8CA 1SCSA 1O4TA 4Y5SA 4O61A 1O3TA 1WLDA 1AR92 1BZWA 3GYDA 2GC1A 2PLV2 4PF5A 1HRV3 2XWBB 4KU8A 4EWEA 1RUC1 1CAVB 5C6CA 3ETPA 2IXJA 3TEYA 3U4XA 5BUVA 2DCKA 4FPYA 5CFDA 4FQZA 1FMD1 1MS5A 2R073 1D4M3 4CDUB 4BLIA 4OHZA 2GH8A 2VU9A 4IV1C 4YZ1A 1UY2A 2RS13 4CCJA 4YVSB 3QCWA 3EB7A 4ZS3A 3QH6A 2A71A 1QJZA 3PU8A 5J37A 3H0OA 4Q4W3 1DYKA 1CD3G 2BV4A 3J8F1 3UETA 5FZ7A 2X09A 2PYTA 4MGSA 2FCUA 4BMBA 2BNNA 2V4VA 3VBSC 3TEZA 5F32A 3HPNA 1YQ6A 3DYMA 2VULA 1KJLA 4CE8A 1LHVA 2D43A 2HWD3 5FAXA 4LIVA 4FQ4A 4QQOA 4BISA 1R083 1RYYA 4HL0A 1DQ4A 4BDVB 2SBAA 4I09A 1N3QA 2YXSA 1XNAA 4XUOA 5C4WA 4DXZA 1COV2 1WCUA 3ZR6A 1STMA 4FXKB 4IEZA 2VAUA 3E1F1 3LPFA 1GLHA 1V6NA 3AX4A 4HKLA 4M0HA 4P9IA 3S7IA 3ZDSA 3B69A 2XH6A 3D82A 2J1VA 4N7IA 2D97A 3BI3A 1RGSA 5FR3A 5FUNA 3ECQA 3U10A 3NQHA 3C7GA 4CP2A 5A80A 4Z07A 4EN8B 2CSGA 1JMUB 2D3PA 4FPKA 1RUF3 4CUBA 2ARBA 3FBYA 2JDPA 3LB9A 2RS51 3HNYM 4UBGA 3P6BA 3BUCA 4IV3B 3VDBA 1W8NA 1RUC2 4A7ZA 5JI9A 5JPNB 4AFCA 4TZDA 1UZVA 4XURA 1FMD2 2Y33A 2D6MA 4FPOB 4AHWA 2BUKA 2ZX2A 5T5OA 1W8OA 3JD73 4HPKA 4KQ7A 2DU0A 4PLMA 5L9RA 2Z5WA 5LA9A 3AYEA 3TN91 1RUD3 4BIFA 4FOVA 1N3PA 3LE0A 1V6OA 5DG1A 4Y1ZA 4DEQA 2UWBA 2IVJA 3AB0A 3J8F2 4RSUA 4TWTA 1MZ6A 3R6SA 4URTA 5C8WA 1SLLA 1XRUA 2EICA 4QXCA 4AEKA 3JQXA 4AW7A 5CAZA 2JEMA 1QKQA 3AZVA 5HCAA 1HB4A 3BPSA 5BYNA 3KT1A 1C28A 2WQZC 2P4EA 3WVJA 2PHLA 3ITQA 2QZ2A 5FOBB 4E4SA 1MZEA 1RVF1 4ZZ8A 2VW1A 5FZ6A 2BJSA 2XBO3 4N43C 4YW6A 4XBNA 1VAMA 5F3GA 1QXPA 3SEPA 1GQPA 5ABJA 2E6VA 4QGMA 1QOSA 3LDKA 4QX0A 1D2SA 4V2WA 1HV0A 3AL5A 2DURA 3NJZA 5A3LA 1AYN1 1WW4A 2JG8B 2QTWB 3HQRA 2GNBA 4UOJA 4AF9A 2Y60A 4XABA 1ZYBA 4YZ4A 2KXLA 5JOYA 3RMXA 2DTYA 3THDA 3VBHA 1DQ2A 3AFGA 4LO6B 3V56A 2ZA9A 3PMEA 2DUPA 5FO7B 3ACFA 3UNPA 5DZFA 3MPPG 4E4DX 3J7HA 2ZZJA 3H50A 4AVVA 1XC6A 3RFRA 4X8PA 3WR0A 2WO7A 4PI2A 1AX2A 3V0AB 1VP6A 4OMDA 5FZKA 4YVSA 4GZ9A 3GBGA 4XHBA 3T1LA 5IVBA 3TRSB 4QB1A 4XJZA 1WZXA 1AX1A 3MIGA 3TN92 2RMU1 4WBBA 2QFEA 3HNMA 4QX5A 2XVGA 4JRLA 2D44A 3NV1A 5E8AA 3IM0A 2OVUA 3H8UA 1GR3A 2JDMA 1LENA 1QGLA 2VTXA 3MPBA 2VJXA 3V64A 3HIFA 3OYWB 4YGBA 1XSQA 4JKMA 4INDA 4YW1A 3VV1A 5K0UA 4D94A 2NYYA 1MQTC 1LGNA 3MEPA 3WDTA 5BNPB 2ARCA 3DUIA 1RVF2 1G7YA 4GB33 4AQ6A 3DGTA 1JODA 2Y6JA 1PZ7A 4LBQB 3KVAA 4K8FA 1WCSA 4M3CB 4BJ0A 1SACA 2VM9A 1MZ5A 3LEKA 1J83A 1JS9A 4AI2A 1WD4A 4C1XA 1AYN2 4D0QA 3LOBA 3T2OA 1HLCA 1OPOA 4XJ9A 4B1LA 3OB8A 2C9AA 1PHMA 3KSCA 1N1TA 4O65A 1K3IA 4UFHA 3THTA 2W92A 2MPFA 3J7MA 3LSEA 4JQRA 4O7XA 2BRTA 3I3MA 4F83A 2WAAA 5FXZA 1UZZA 1ZA4A 1FNYA 2VOXA 1W8HA 5T50A 1NKGA 1VJ2A 1C5IA 2RS31 5L7OC 2AEZA 1YYNA 3UV9A 2A6WA 2RMU2 5CKQA 5FZGA 3ZFFA 2V09A 5J1XA 2QCSB 3USUB 4CEYC 1IOAA 2HWF1 3SCFA 3WF1A 2HYXA 4CUGA 4QMAA 4AVTA 4ZZ5A 2NP0A 4Y5Z0 1H1IA 5DUXA 3HAGA 5BNOA 3N9NA 1FOD1 5IAXA 1ZRIA 1QJY3 2P3IA 1I5ZA 3VBRB 1PMHX 2WSVA 5EXOA 3VKOA 5A33B 2XHNA 4NHKA 1PO11 1EPWA 2YBPA 2WLQA 1CIYA 2JG8C 4B7KA 1ST8A 4E4HA 1OF4A 1JI6A 3VZJA 3VZOA 5FZLA 1ZVFA 1WKYA 4R9AA 2P17A 5CKMA 3RZZA 3J7LA 1W6MB 1XNDA 2IFRA 2YZ4A 3ES4A 3VKLA 3I2DA 4HFSA 5DABA 2F4PA 2ZX0A 1S0CA 3AFKA 1ZZCA 1CN1A 1W9WA 1YHFA 2X29A 4D8MA 1UL9A 2GNMA 2OW4A 2FMYA 3B02A 5DUWA 4E8CA 5CU1A 1UYPA 3FHIB 3TEXA 3S57A 1C5HA 2ORXA 1D2QA 1SDWA 2PELA 2W1SA 4N53A 3WLUA 3V0AA 2JG9A 5EIYB 3MBWA 1BBT3 4BQ1A 2ZGSA 3ZDVA 2RS32 3N35A 5DDJ1 1IPJA 4FO9A 5J96B 4V2VA 5F5CA 5ANQA 4JAAA 2XKOA 2VW2A 2B8MA 2B9UA 5I91A 4A6OA 4R8HA 4XFHA 4XJWA 5H9QA 1AR83 2HWF2 4XFAA 3KVBA 2J42A 2QQPA 2ZEWA 5JSRA 3ZMOA 5AC93 1ND2C 1HXS3 3WDYA 2CHHA 1FOD2 4ASLA 4RR3A 2D6PA 2XDVA 3ELNA 4FPFA 3AP6A 3MW2A 3E5XA 3WOGA 3U78A 4XQDA 2W3JA 4CDQA 1W04A 4Y33A 1RINA 1ZNPA 1PO12 5DN2A 5EV7A 3S5QA 1X7NA 2F6BA 2JE7A 3WNKA 4OZXA 2HWC1 3POWA 2EIDA 4WVWA 1IHMA 4LE3A 3WX5A 1WW5A 4COUA 4BOWA 3AMPA 2AH2A 3H1YA 5CFCA 1ULPA 2WINB 2VNVA 1G9DA 5J3UA 4XFIA 3CO2A 1HRI1 2OPKA 5JOZA 1H8TC 2PHXA 5FY8A 4HBNA 1Z7S1 3WG4A 1U0AA 1C3HA 2ZPXA 2OQ7A 3KWVA 3AKRA 3LQCA 4IQPA 4HT1T 4LHLA 3RS6A 1KGYA 2BNOA 5KC6A 4TN7A 3M8LA 3FLRA 4QD2A 2H0BA 1NLRA 5SV8A 2WNUA 3OPWA 2AGSA 3PL0A 3MLKA 3ZYRA 3MO4A 3ES1A 2FQPA
chains in the Genus database with same CATH topology
1UZ0A 3SEEA 4DUVA 2VZOA 3I3EA 4CU9A 1JZ2A 4BK4A 2E31A 2BGPA 2J1TA 3C7FA 1OH4A 4QX1A 4DXTA 3ACIA 3A22A 2XOMA 1W0NA 2VZ3A 4BK5A 1PX4A 3DECA 3ACGA 4MGQA 2WUHA 1XPWA 4P5YA 1JZ3A 2PQSA 1UXZA 4LHSA 3NNGA 1JZ4A 3FN9A 3HN3A 5JXJA 1J84A 4LQRA 2ID4A 2DDUA 5DQ0A 2W46A 4RN5A 4GWJA 3I2FA 4IUGA 3FHAA 1K42A 4A41A 1JHJA 1OF3A 4Z2AA 2E26A 5F7UA 2YFZA 1NUKA 1WCQA 4CU8A 5IFTA 1PMJX 4ARYA 2W87A 2JD9A 3A23A 3HNBM 4LKSA 1OT5A 2RVAA 2VTFA 2X05A 3CQOA 3LEGA 5JXHA 2JKXA 4OUEA 1W9TA 2J1RA 3OEBA 3VDAA 4ZY9A 3OGRA 4XUTA 4UAPA 1O8SA 4W4ZA 4JKKA 3VD9A 3AC0A 2WDBA 3BGAA 3NRUA 1EUTA 3HOBA 3SKVA 3K77A 5IHRA 1JYWA 5IYYA 2VR4A 1UWWA 4QX3A 2QBXA 2VMDA 5HXMA 3GDBA 4OYUA 1T2XA 3T0BA 5CZKA 3I3BA 2J1UA 5JXGA 4QDSA 4UI9L 3ACHA 4CUCA 1US3A 1SDDB 1O59A 4QB2A 2WN2A 4XUQA 1UX7A 4KI5M 3VD7A 4ARXA 3LPGA 4TXWA 3W5MA 4DUWA 2VCCA 1D7PM 3T09A 1KEXA 3PUHA 5A1AA 4YPJA 4XVHA 2BERA 2Y64A 2ZEXA 3OG2A 3VD4A 2VZQA 3IB3A 2YB7A 2XQXA 1US2A 2C26A 2Y8KA 5G04L 3WF3A 2VMEA 1H6XA 2WZ8A 3HJRA 4RYDA 2WQ8A 4DUXA 3I2GA 1CZVA 2WO2A 4A3ZA 1CX1A 4LPLA 4ET7A 3CKHA 2VZVA 3A21A 4A44A 4BXSV 1HN1A 2VZTA 2C4XA 3WNOA 2QQNA 1UYYA 2W91A 4A42A 2BBAA 3I2HA 2W47A 5C70A 2DCJA 3C8XA 2VCAA 1GOFA 2L9LA 3GGLA 3K4AA 4A4AA 5DPNA 2OKXA 2VZ1A 3OBAA 2Y6HA 3GM8A 1DLCA 4MOAA 1W99A 3D3AA 3PUIA 4OMCA 1UY1A 2WN3A 3T08A 1UY4A 2QQIA 3WF2A 3WF0A 4JX0A 5HPOA 4A45A 5JMOA 2KD7A 4CUAA 2Y6LA 3IAPA 3MUY1 2BZDA 1EUUA 3ETPA 4XUNA 3UESA 2DCKA 5EJZB 5IJRA 1L7RA 3I3DA 1UY2A 5LCWL 5B4XA 1SHWB 3EB7A 2W1WA 4PF1A 2J7MA 5DMYA 3UETA 2X09A 4MGSA 1JZ5A 2V4VA 4MO3M 3HPNA 3DYMA 4JHZA 1GU3A 2EIEA 3IDAA 2J1SA 1RYYA 4BDVB 3WEZA 4JKLA 3I2JA 1XNAA 4XUOA 3WQBA 2W5FA 3LEIA 5C71A 4AAXA 3E1F1 3LPFA 4M4RA 3WSOA 1JU3A 5FUIA 2J1VA 4CVUA 3ECQA 3NQHA 3C7GA 4CU6A 4QX2A 1O8PA 3WNLA 1UY3A 3WNMA 3WF4A 4CUBA 3HNYM 4TTGA 3P6BA 2X10A 2B4KA 3NJVA 3VDBA 5EJ1B 1W8NA 4XUPA 2YFUA 2WZEA 4XURA 1JYNA 3IIIA 1W8OA 1F4HA 2B9VA 5CYYA 3THCA 2W95A 1R64A 2RJ2A 3OGSA 2ZEZA 3LE0A 3T2QA 4DEQA 3I2KA 4W8JA 4P08A 1XNTA 2EICA 5JUVA 2C9KA 5IFPA 1GOGA 2E32A 3K4DA 1TG7A 4CU7A 2QQJA 5LA2A 1GNYA 2VCBA 3BN6A 4FI9A 4PT6A 2VMFA 1W9SA 2W1UA 4ZZ8A 5I0DA 3C7OA 1L7QA 4HG6B 4KWUA 3SEPA 1GQPA 1UMHA 3I97A 4QX0A 5JXIA 2W9XA 4L0PA 4UOJA 3T0AA 4GWIA 1GMMA 2WAOA 2VC9A 3THDA 1JYVA 3C7EA 1JU4A 2CDPA 2ORZA 1JZ6A 3ACFA 3UNPA 2E33A 3J7HA 3VD3A 3CZUA 1XC6A 4QDQA 4OMDA 1NAEA 4GZ9A 1H6YA 1TVGA 4QB1A 2YG0A 3T2PA 2WBKA 3K4ZA 3GXUA 3HNMA 2ZEYA 3P1IA 2J1EA 3OEAA 2JE8A 2WO1A 2VJXA 3I2IA 1BHGA 4JKMA 1UYXA 4OZOA 2LS6A 3VD5A 1UMIA 2VMCA 2VL4A 3W5NA 3EYPA 2Y6GA 2Y6JA 4P00B 4DXRA 4BJ0A 2VM9A 3LEKA 3SKJE 1J83A 2VZSA 1JYXA 1UYZA 4PQQA 2YC2A 3K75B 4D0QA 3T2OA 5LA1A 3OB8A 3NJXA 3CDZB 3CIHA 2J22A 1F4AA 2V5DA 1ULOA 1K3IA 2J1AA 4ZXEA 4AG4A 2W92A 2WAAA 3U37A 3A7QA 1NKGA 3F2ZA 1GOHA 3K46A 2R7EB 2HLEA 5J1XA 3C7HA 1PX3A 2W94A 2ZXQA 3CMGA 3WNNA 2QQKA 2VZRA 2HYXA 3WF1A 4ZZ5A 4QB6A 1CZTA 4M4PA 4QDRA 1DP0A 2VO5A 1PMHX 1OD3A 2XHNA 1NX9A 3VDCA 2VQUA 1MPXA 1CIYA 1OF4A 1JI6A 2LW8A 1WKYA 2W1QA 2WABA 2XONA 1CZSA 1IQDC 3IAQA 1UY0A 2WYSA 3JXSA 3HEIA 1W9WA 4D8MA 1P8JA 1JZ8A 4E8CA 2RV9A 3OGVA 2ORXA 2W1SA 2WO3A 4XZUG 5EIYB 1JZ7A 3MBWA 2EIBA 3DYOA 1I5PA 2YC4A 3WNPA 3MV01 4QAWA 4A6OA 5B4NA 2JDAA 5LA0A 4QPWA 2Y6KA 4KMQA 3FHQA 3FL7A 1SG3A 2ZEWA 5C7GA 2VOTA 1DYOA 1YQ2A 3T0DA 1LNSA 2W3JA 2BGOA 4MADA 3ZM8A 1K45A 3DYPA 5DN2A 1GUIA 3WNKA 4DXSA 5G05L 5JR2A 2EIDA 3MV11 2VZPA 3MUZ1 2Z4FA 1ULPA 2VZUA 2VQTA 2QQLA 4DEVA 2QQOA 4E8DA 1UXXX 3LQCA 1KGYA 2CDOA 2QQMA 4W50A 1K12A 2V72A 3ABZA 3CZJA 3MO4A 4P02B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UZ0 A;  3SEE A;  4DUV A;  2VZO A;  3I3E A;  4CU9 A;  1JZ2 A;  4BK4 A;  2E31 A;  2BGP A;  2J1T A;  3C7F A;  1OH4 A;  4QX1 A;  4DXT A;  3ACI A;  3A22 A;  2XOM A;  1W0N A;  2VZ3 A;  4BK5 A;  1PX4 A;  3DEC A;  3ACG A;  4MGQ A;  2WUH A;  1XPW A;  4P5Y A;  1JZ3 A;  2PQS A;  1UXZ A;  4LHS A;  3NNG A;  1JZ4 A;  3FN9 A;  3HN3 A;  5JXJ A;  1J84 A;  4LQR A;  2ID4 A;  2DDU A;  5DQ0 A;  2W46 A;  4RN5 A;  4GWJ A;  3I2F A;  4IUG A;  3FHA A;  1K42 A;  4A41 A;  1JHJ A;  1OF3 A;  4Z2A A;  2E26 A;  5F7U A;  2YFZ A;  1NUK A;  1WCQ A;  4CU8 A;  5IFT A;  1PMJ X;  4ARY A;  2W87 A;  2JD9 A;  3A23 A;  3HNB M;  4LKS A;  1OT5 A;  2RVA A;  2VTF A;  2X05 A;  3CQO A;  3LEG A;  5JXH A;  2JKX A;  4OUE A;  1W9T A;  2J1R A;  3OEB A;  3VDA A;  4ZY9 A;  3OGR A;  4XUT A;  4UAP A;  1O8S A;  4W4Z A;  4JKK A;  3VD9 A;  3AC0 A;  2WDB A;  3BGA A;  3NRU A;  1EUT A;  3HOB A;  3SKV A;  3K77 A;  5IHR A;  1JYW A;  5IYY A;  2VR4 A;  1UWW A;  4QX3 A;  2QBX A;  2VMD A;  5HXM A;  3GDB A;  4OYU A;  1T2X A;  3T0B A;  5CZK A;  3I3B A;  2J1U A;  5JXG A;  4QDS A;  4UI9 L;  3ACH A;  4CUC A;  1US3 A;  1SDD B;  1O59 A;  4QB2 A;  2WN2 A;  4XUQ A;  1UX7 A;  4KI5 M;  3VD7 A;  4ARX A;  3LPG A;  4TXW A;  3W5M A;  4DUW A;  2VCC A;  1D7P M;  3T09 A;  1KEX A;  3PUH A;  5A1A A;  4YPJ A;  4XVH A;  2BER A;  2Y64 A;  2ZEX A;  3OG2 A;  3VD4 A;  2VZQ A;  3IB3 A;  2YB7 A;  2XQX A;  1US2 A;  2C26 A;  2Y8K A;  5G04 L;  3WF3 A;  2VME A;  1H6X A;  2WZ8 A;  3HJR A;  4RYD A;  2WQ8 A;  4DUX A;  3I2G A;  1CZV A;  2WO2 A;  4A3Z A;  1CX1 A;  4LPL A;  4ET7 A;  3CKH A;  2VZV A;  3A21 A;  4A44 A;  4BXS V;  1HN1 A;  2VZT A;  2C4X A;  3WNO A;  2QQN A;  1UYY A;  2W91 A;  4A42 A;  2BBA A;  3I2H A;  2W47 A;  5C70 A;  2DCJ A;  3C8X A;  2VCA A;  1GOF A;  2L9L A;  3GGL A;  3K4A A;  4A4A A;  5DPN A;  2OKX A;  2VZ1 A;  3OBA A;  2Y6H A;  3GM8 A;  1DLC A;  4MOA A;  1W99 A;  3D3A A;  3PUI A;  4OMC A;  1UY1 A;  2WN3 A;  3T08 A;  1UY4 A;  2QQI A;  3WF2 A;  3WF0 A;  4JX0 A;  5HPO A;  4A45 A;  5JMO A;  2KD7 A;  4CUA A;  2Y6L A;  3IAP A;  3MUY 1;  2BZD A;  1EUU A;  3ETP A;  4XUN A;  3UES A;  2DCK A;  5EJZ B;  5IJR A;  1L7R A;  3I3D A;  1UY2 A;  5LCW L;  5B4X A;  1SHW B;  3EB7 A;  2W1W A;  4PF1 A;  2J7M A;  5DMY A;  3UET A;  2X09 A;  4MGS A;  1JZ5 A;  2V4V A;  4MO3 M;  3HPN A;  3DYM A;  4JHZ A;  1GU3 A;  2EIE A;  3IDA A;  2J1S A;  1RYY A;  4BDV B;  3WEZ A;  4JKL A;  3I2J A;  1XNA A;  4XUO A;  3WQB A;  2W5F A;  3LEI A;  5C71 A;  4AAX A;  3E1F 1;  3LPF A;  4M4R A;  3WSO A;  1JU3 A;  5FUI A;  2J1V A;  4CVU A;  3ECQ A;  3NQH A;  3C7G A;  4CU6 A;  4QX2 A;  1O8P A;  3WNL A;  1UY3 A;  3WNM A;  3WF4 A;  4CUB A;  3HNY M;  4TTG A;  3P6B A;  2X10 A;  2B4K A;  3NJV A;  3VDB A;  5EJ1 B;  1W8N A;  4XUP A;  2YFU A;  2WZE A;  4XUR A;  1JYN A;  3III A;  1W8O A;  1F4H A;  2B9V A;  5CYY A;  3THC A;  2W95 A;  1R64 A;  2RJ2 A;  3OGS A;  2ZEZ A;  3LE0 A;  3T2Q A;  4DEQ A;  3I2K A;  4W8J A;  4P08 A;  1XNT A;  2EIC A;  5JUV A;  2C9K A;  5IFP A;  1GOG A;  2E32 A;  3K4D A;  1TG7 A;  4CU7 A;  2QQJ A;  5LA2 A;  1GNY A;  2VCB A;  3BN6 A;  4FI9 A;  4PT6 A;  2VMF A;  1W9S A;  2W1U A;  4ZZ8 A;  5I0D A;  3C7O A;  1L7Q A;  4HG6 B;  4KWU A;  3SEP A;  1GQP A;  1UMH A;  3I97 A;  4QX0 A;  5JXI A;  2W9X A;  4L0P A;  4UOJ A;  3T0A A;  4GWI A;  1GMM A;  2WAO A;  2VC9 A;  3THD A;  1JYV A;  3C7E A;  1JU4 A;  2CDP A;  2ORZ A;  1JZ6 A;  3ACF A;  3UNP A;  2E33 A;  3J7H A;  3VD3 A;  3CZU A;  1XC6 A;  4QDQ A;  4OMD A;  1NAE A;  4GZ9 A;  1H6Y A;  1TVG A;  4QB1 A;  2YG0 A;  3T2P A;  2WBK A;  3K4Z A;  3GXU A;  3HNM A;  2ZEY A;  3P1I A;  2J1E A;  3OEA A;  2JE8 A;  2WO1 A;  2VJX A;  3I2I A;  1BHG A;  4JKM A;  1UYX A;  4OZO A;  2LS6 A;  3VD5 A;  1UMI A;  2VMC A;  2VL4 A;  3W5N A;  3EYP A;  2Y6G A;  2Y6J A;  4P00 B;  4DXR A;  4BJ0 A;  2VM9 A;  3LEK A;  3SKJ E;  1J83 A;  2VZS A;  1JYX A;  1UYZ A;  4PQQ A;  2YC2 A;  3K75 B;  4D0Q A;  3T2O A;  5LA1 A;  3OB8 A;  3NJX A;  3CDZ B;  3CIH A;  2J22 A;  1F4A A;  2V5D A;  1ULO A;  1K3I A;  2J1A A;  4ZXE A;  4AG4 A;  2W92 A;  2WAA A;  3U37 A;  3A7Q A;  1NKG A;  3F2Z A;  1GOH A;  3K46 A;  2R7E B;  2HLE A;  5J1X A;  3C7H A;  1PX3 A;  2W94 A;  2ZXQ A;  3CMG A;  3WNN A;  2QQK A;  2VZR A;  2HYX A;  3WF1 A;  4ZZ5 A;  4QB6 A;  1CZT A;  4M4P A;  4QDR A;  1DP0 A;  2VO5 A;  1PMH X;  1OD3 A;  2XHN A;  1NX9 A;  3VDC A;  2VQU A;  1MPX A;  1CIY A;  1OF4 A;  1JI6 A;  2LW8 A;  1WKY A;  2W1Q A;  2WAB A;  2XON A;  1CZS A;  1IQD C;  3IAQ A;  1UY0 A;  2WYS A;  3JXS A;  3HEI A;  1W9W A;  4D8M A;  1P8J A;  1JZ8 A;  4E8C A;  2RV9 A;  3OGV A;  2ORX A;  2W1S A;  2WO3 A;  4XZU G;  5EIY B;  1JZ7 A;  3MBW A;  2EIB A;  3DYO A;  1I5P A;  2YC4 A;  3WNP A;  3MV0 1;  4QAW A;  4A6O A;  5B4N A;  2JDA A;  5LA0 A;  4QPW A;  2Y6K A;  4KMQ A;  3FHQ A;  3FL7 A;  1SG3 A;  2ZEW A;  5C7G A;  2VOT A;  1DYO A;  1YQ2 A;  3T0D A;  1LNS A;  2W3J A;  2BGO A;  4MAD A;  3ZM8 A;  1K45 A;  3DYP A;  5DN2 A;  1GUI A;  3WNK A;  4DXS A;  5G05 L;  5JR2 A;  2EID A;  3MV1 1;  2VZP A;  3MUZ 1;  2Z4F A;  1ULP A;  2VZU A;  2VQT A;  2QQL A;  4DEV A;  2QQO A;  4E8D A;  1UXX X;  3LQC A;  1KGY A;  2CDO A;  2QQM A;  4W50 A;  1K12 A;  2V72 A;  3ABZ A;  3CZJ A;  3MO4 A;  4P02 B; 
#chains in the Genus database with same CATH topology
 4WM8 B;  5GZD A;  2QQW A;  3GZE A;  1ZZ9 A;  5DDJ 2;  4CU9 A;  1G9B A;  5LBC A;  2WJS A;  2J1T A;  3GAL A;  1CJD A;  1MS8 A;  4AED B;  5JI7 A;  3O5S A;  3N4M A;  5A3O A;  3ZVX A;  2BOJ A;  2OT7 A;  4GAL A;  1T6G C;  1Q8V A;  4UT5 A;  5KXE A;  4NN0 A;  2VOV A;  3E5U A;  3OUH A;  5JVV A;  2ZAC A;  3I7D A;  2WII B;  5BNN B;  3BTZ A;  2WZR 3;  2WKK A;  2VZ3 A;  3WDV A;  3T1M A;  5LAT A;  1QQP 1;  4FTB A;  2CY6 A;  3DEC A;  1K5M A;  5I0S A;  1RUG 1;  2AUY A;  3AVS A;  3R4U A;  4ITC A;  4WVM B;  1SLB A;  4NRQ A;  2YPJ A;  3ROU A;  4AVA A;  4LHS A;  2EVX A;  4IGP A;  3KQ4 B;  1TMF 3;  3NWK A;  5EHD A;  5FMO S;  1JZ4 A;  2HWC 2;  4OHW A;  2AR6 A;  3PUS A;  3KCY A;  1AL2 1;  2YUE A;  5JXJ A;  1G86 A;  2CAV A;  2P37 A;  2ZS6 B;  4DRV A;  2VNO A;  1HRI 2;  2UWC A;  4GWJ A;  3I2F A;  3VBU A;  3FHA A;  1JHJ A;  4UFJ A;  4PLO A;  1RMU 3;  1Z7S 2;  1RB8 G;  1JUH A;  1NCR A;  4RGG A;  3VBF C;  1H2L A;  2YFZ A;  3N3H A;  2OYZ A;  1SBF A;  1WCQ A;  3H3Z A;  5FZ1 A;  1F2N A;  1XNB A;  2WWJ A;  1LGC A;  1ZRC A;  1XYP A;  1UZW A;  1AZD A;  1RED A;  3H3U A;  2ARA A;  2JD9 A;  1BJQ A;  3EXU A;  4Q1P A;  1JH5 A;  1DZT A;  5JR7 B;  5T54 A;  3A23 A;  4WZF A;  3ZN6 B;  5A32 A;  1H2N A;  2XGX A;  3UK9 A;  3KGL A;  2A73 B;  2Q8O A;  2RVA A;  3APB A;  1W6Q B;  2VTF A;  4NHM A;  2HWB 3;  3VL9 A;  3RZM A;  4HN1 A;  1KQR A;  5DXD A;  5KHK A;  3MIE A;  5EWS A;  4XF9 A;  1W2T A;  2DCZ A;  2JKX A;  1W39 A;  1YNA A;  4JGZ B;  3RI9 A;  4F3J A;  1HIX A;  1A8D A;  4QM9 A;  5H9P A;  3OEB A;  5EYY A;  3ZYJ B;  5DAP A;  1CIW A;  3OGR A;  1QQP 2;  4K1Y A;  5GZE A;  1O8S A;  4QWN A;  1LOD A;  4W4Z A;  3AM2 A;  5FKC A;  1RUG 2;  3JBG 1;  3AL6 A;  3QD6 A;  3TYJ A;  4DNY A;  1W6O B;  3F95 A;  3NKT A;  4BHP A;  4AFA A;  5EPA A;  2EXK A;  3ILR A;  1NCQ B;  4YAR A;  2EAA A;  2YC0 A;  5IHR A;  3EQE A;  1SLI A;  1QDO A;  4JGY A;  3BTX A;  3SIT A;  2JDN A;  2XB6 C;  5FY1 A;  4D6Q A;  4AHY A;  1AL2 2;  3MW4 A;  4BA6 A;  3KT4 A;  3AMQ A;  5KHJ A;  3LIH A;  3UGF A;  1DHK B;  2BBV A;  2WA3 A;  4LA2 A;  4LR4 A;  3ZR5 A;  3GDB A;  3N7M A;  1V00 A;  4LO5 B;  1UU4 A;  4MET A;  2K46 A;  4UW4 A;  5JIU A;  4SLI A;  2I07 B;  2GAU A;  4H3W A;  5B2G B;  1YFY A;  3POJ A;  5HCF A;  1HB2 A;  2J1U A;  5JXG A;  1RUJ 3;  3G7D A;  1EV1 1;  3H1W A;  3ZFE B;  1WLT A;  4UI9 L;  4Q4V 1;  3ACH A;  4XAC A;  4AED C;  4BPZ A;  5KC5 A;  4E2S A;  1NQJ A;  4XPV A;  1GNH A;  1ULF A;  2Q8E A;  3RG0 A;  4JCK A;  4M3C E;  1KXG A;  4FOQ A;  1Z0H A;  1CAX B;  3LPG A;  2XR4 A;  2ENR A;  5FYC A;  2FMD A;  1SEF A;  3U4S A;  4AVC A;  5BNN C;  3PUH A;  4ZXK A;  2DFC A;  3LDB A;  1W6P B;  5FYV A;  4YPJ A;  2OUH A;  1YJK A;  2YHJ A;  4XVH A;  1O5U A;  2BER A;  1X82 A;  2UWA A;  2UYA A;  2Y64 A;  3AJY A;  5CVR A;  1UKR A;  1KS5 A;  2DVG A;  1QWR A;  2R04 3;  4WM7 C;  4IE5 A;  4X6R B;  4BQ2 A;  4UFI A;  1CAW B;  1D4M 1;  4PBP A;  3JBG 2;  4PLN A;  2XQX A;  2C26 A;  3BU7 A;  3WF3 A;  1BVV A;  2RS1 1;  1H6X A;  3HJR A;  2WQ8 A;  5GZG A;  3I2O A;  5IW0 A;  4CP9 A;  2D5F A;  1CX1 A;  2G19 A;  2EIG A;  2D40 A;  4MV2 A;  4ET7 A;  1GKB A;  2VVE A;  3CKH A;  5FXX A;  2FDI A;  3AJZ A;  1PNF A;  3N7K A;  5F5A A;  3GCW A;  1OOP C;  4RS5 C;  3U14 A;  1ZX5 A;  2YGL A;  1RC6 A;  3I49 A;  2FDG A;  5A7Q A;  2QQN A;  1QNY A;  3WQ1 A;  2GP5 A;  2R06 3;  4UW6 A;  3O1T A;  2W47 A;  2QUO A;  1Y43 B;  2NM1 A;  4D7T A;  5C70 A;  3VZM A;  3PIG A;  1GOF A;  4GD4 A;  1EV1 2;  2UY9 A;  4QX7 A;  3NAP A;  3S30 A;  1VBE 1;  3S6P A;  2RM2 1;  4Q4V 2;  3VDD A;  1BCX A;  1JTZ X;  5DPN A;  5FV3 A;  2ERF A;  4CPB A;  2QZ3 A;  3WW2 A;  3GM8 A;  1WBF A;  2W2I A;  5IVJ A;  2YV8 A;  3SXW A;  3RZJ A;  2ZGT A;  1VB4 A;  1W99 A;  5GLU A;  5C3P A;  1CWP A;  1WGP A;  2CWS A;  4K21 A;  4P9J A;  5FY9 A;  1RUF 1;  5EYX A;  1QNW A;  2DBN A;  1POQ A;  4AQT A;  2OX0 A;  3WF0 A;  5JZG C;  4S2G A;  1RUE 1;  1RJ8 A;  3TAY A;  2XUM A;  5HV0 A;  1HRV 2;  1LGB A;  5JMO A;  2JX9 A;  4IEU A;  4E2G A;  2Y6L A;  3UT0 A;  1IS4 A;  3AMN A;  1BQP A;  4NPM A;  4YW2 A;  1YQC A;  1XYN A;  2WS9 1;  1D4M 2;  1EUU A;  3UES A;  3ZXF A;  4HVR A;  2WNV B;  5CG9 A;  2JIJ A;  2RS1 2;  1W8W A;  4RQP C;  3IWZ A;  5IJR A;  3RRD A;  1LOF C;  4YGE A;  1S1A A;  4BXF A;  3GNE A;  2HH9 A;  2GMP A;  5GJ6 A;  5B4X A;  1H4H A;  2I45 A;  1LR5 A;  4AZZ A;  1PZ8 A;  1OVS A;  4EZ4 A;  2J7M A;  1GZW B;  3K3O A;  2VQ0 A;  1IG0 A;  4LT5 A;  3FLT A;  3SNM A;  2D98 A;  4E9K A;  1XYO A;  1JZ5 A;  1DBN A;  1ZRE A;  1W90 A;  1XNC A;  4JHZ A;  3WUC A;  4R4Z A;  2MEV 3;  1DQ6 A;  2EIE A;  3IDA A;  4AOC A;  4YW4 A;  3KF3 A;  3WEZ A;  5A6Y A;  1VBE 2;  3I2J A;  3QOP A;  2RM2 2;  1VE0 A;  3WQB A;  5C71 A;  1PK6 A;  4HK9 A;  2JDY A;  5F37 A;  3IT8 A;  1CON A;  4LTA A;  4IL7 A;  1CAX A;  4M4R A;  1H1A A;  3PMS A;  3WSO A;  2PAK A;  5FZ8 A;  4ZKT B;  4LKD A;  4MGY E;  5FUI A;  4CVU A;  2DCT A;  2FHR A;  5CFD B;  3E5Q A;  2CU5 A;  1MS9 A;  1RUF 2;  2WFF 3;  1O8P A;  4HZF A;  2DVD A;  3WNL A;  3I59 A;  4Z8B A;  3WNM A;  2DF7 A;  1RUE 2;  1WD3 A;  4QPG A;  2CYF A;  1W05 A;  1YI7 A;  3JU9 A;  2X10 A;  1CES A;  3NJV A;  4KU7 A;  4LE4 A;  1UN1 A;  2YYO A;  5EJ1 B;  4XUP A;  1ENS A;  1CQ9 A;  2WS9 2;  4H55 A;  1POV 0;  4ZON A;  2HJI A;  2WZE A;  1Q8Q A;  2WWU A;  4Q4X 1;  1DDL A;  1S55 A;  1YJL A;  2XL7 A;  4HVQ A;  4K20 A;  1PM7 A;  5C5T A;  1X33 A;  2ZAB A;  5IVV A;  1F4H A;  2B9V A;  4I30 A;  1VAV A;  2RR1 3;  4AQS A;  3W9A A;  1BYH A;  3KF5 A;  1ZZ8 A;  4AGG A;  3OGS A;  4AHZ A;  3B93 A;  2UU8 A;  2ZEZ A;  4FOW A;  5C3O A;  2XVL A;  5C4W B;  5FMB A;  4C0B A;  1J1L A;  4W8J A;  2IC1 A;  1XNT A;  5JUV A;  1WLC A;  1GOG A;  3K4D A;  4MVT A;  2ZCW A;  4KWK A;  1FAY A;  5A6Q A;  3RQ0 A;  3BN6 A;  4PQ9 A;  1U12 A;  3KV9 A;  4B7E A;  4FOY A;  4GB3 1;  4PT6 A;  4Q2F A;  5FPB A;  3O1S A;  2XLF A;  2CTV A;  3C7O A;  4UBH A;  2ZML A;  3CLP A;  4NOT A;  3POG A;  4XJA A;  1WCD J;  1L7L A;  5GAL A;  1UMH A;  3KM5 A;  5C5U A;  2ATF A;  4I0A A;  2NMN A;  4AHX A;  1ULE A;  3FMG A;  3EO6 A;  1A8M A;  1WMF A;  3J9S A;  1LHW A;  3T0A A;  4GWI A;  4HPK B;  4MXW A;  5L19 A;  1CX4 A;  3KHB A;  2RJK A;  2WAO A;  2BVV A;  1JU4 A;  4P9Y A;  5C8C C;  1OA2 A;  5FO9 B;  4KL1 A;  2ORZ A;  4YW5 A;  4Q4Y 3;  3AVR A;  2GNT A;  3K2O A;  3AYD A;  1UU5 A;  4MYE A;  5FY4 A;  3VD3 A;  1VRH 1;  2VG9 A;  4Q4X 2;  4DY5 A;  4QDQ A;  1MR5 A;  3M7A A;  5C9A B;  2NMO A;  2D6K A;  3GZU C;  1VBB 1;  1UCX A;  3G6J B;  3U11 A;  1LUL A;  2WBK A;  4GH4 C;  2DBI A;  4PI0 A;  1Q8S A;  2JB4 A;  3WQ7 A;  4JV4 A;  1W06 A;  3MHZ A;  2GAL A;  1JYT A;  3DN7 A;  4BM8 A;  5D8A B;  1LKN A;  3WY6 A;  2A75 A;  1QJX 3;  2G1M A;  2D3S A;  4IE6 A;  4KGG A;  4PDW A;  4RGK A;  3RYP A;  5LB6 A;  2LUW A;  3I2I A;  3WP6 A;  1AF9 A;  5JOX A;  4NID A;  3IIA A;  1OPM A;  1UYX A;  2C6S A;  2LS6 A;  5C3R A;  4S2H A;  4AEJ A;  4FAH A;  1QHD A;  4MGT A;  1B35 C;  2D3R A;  4GB3 2;  1ZZ7 A;  2VL4 A;  3EYP A;  3SCG A;  3THP A;  3RWK X;  2Y6G A;  3O0X A;  3FLP A;  3VBH B;  4D7Y A;  1H4G A;  5T5P A;  4RD7 A;  4QXK A;  1RJ7 A;  1G9A A;  4UF0 A;  3WW1 A;  5A6Z A;  3HMY A;  4YVW B;  1UYZ A;  5FZ4 A;  1E57 A;  5I8S A;  4D3W A;  2YC2 A;  4ZU7 A;  5IVF A;  4AI0 A;  4Q8K A;  1RTV A;  1F5F A;  3CIH A;  1T6B X;  4XF1 A;  2V5D A;  2J1A A;  3BCW A;  4ZXE A;  5F5Q A;  4O9E A;  3IMN A;  4BH9 A;  1VRH 2;  1OLM E;  4FBF A;  1BBT 1;  3POY A;  3U37 A;  3WP3 A;  4XDP A;  4ATE A;  1LOE A;  2ZAH A;  1GBG A;  3TEW A;  3GHM A;  1VBB 2;  1VMF A;  2VUC A;  3OTF A;  4AFD A;  1PO2 1;  5K0U B;  1GOH A;  2O0O A;  3AKT A;  4AE2 A;  4NPL A;  1MS0 A;  1YUD A;  2W94 A;  4PCR A;  4X6Q B;  2ZXQ A;  4HSJ A;  4XJ8 A;  2JDH A;  2XL9 A;  3FFQ A;  4IV1 A;  2D7F A;  2X5I C;  4XCA A;  2XVK A;  4XMA A;  5HBA A;  5J98 B;  1HXS 1;  2IFW A;  3M2M A;  4LKE A;  3RMY A;  4CP1 A;  4Y4R A;  5DZE A;  1VBC 3;  4QDR A;  4RFT 0;  2SLI A;  1S0F A;  4DZG A;  1UMZ A;  1BVP 1;  5K7P A;  1MVE A;  3BYW A;  1NX9 A;  1XNK A;  3DPR C;  4Y1V A;  4GKX A;  3VDC A;  3VBS A;  1VAL A;  1MPX A;  1O7F A;  4GJY A;  3FFZ A;  2RDN A;  2ZGO A;  3H1M A;  2YBK A;  2BEO A;  1X8E A;  1V6K A;  3DXT A;  2LW8 A;  1H9P A;  2WAB A;  5DAV A;  2A7A A;  3J7N A;  1IQD C;  2VMH A;  3IAQ A;  3KT7 A;  4KWJ A;  4B3N A;  4NHL A;  4DMI A;  5CG8 A;  2G9G A;  3AXE A;  3OGJ A;  3HEI A;  2IXL A;  3ZFF B;  1OBN A;  4CDW C;  1HJG A;  3POI A;  1Q56 A;  3VBO C;  4EWD A;  4BQW A;  2ARE A;  1GZT A;  1BEV 3;  2Q1M A;  5I93 A;  2Q1F A;  3OGV A;  3O7O A;  1BBT 2;  5C9A A;  1YFX A;  2C5D A;  1XB9 A;  1QEX A;  4DB5 A;  3BOD A;  3AXD A;  2Y26 A;  3CBN A;  5BNO B;  1RIT A;  3BTA A;  1PO2 2;  2VNR A;  3LZZ A;  1LEC A;  5ABJ C;  4EYU A;  4OI0 A;  1I5P A;  3W58 A;  5KWR A;  2K0G A;  5B4N A;  1NXM A;  5D8A A;  5LA0 A;  4QQL A;  2Y6K A;  4Y26 A;  3NV3 A;  4Y1U A;  1HXS 2;  3IDC B;  4I0W B;  4ISR A;  1SG3 A;  1TEI A;  3OPT A;  1AR7 3;  4I3P A;  3QAC A;  1O6U A;  1TNF A;  3LA2 A;  3VBH C;  4DY3 A;  2WR9 A;  1DYO A;  1YQ2 A;  4CXX A;  3T0D A;  2BTV C;  4H2A A;  4MAD A;  4L92 A;  1K45 A;  1UOG A;  1SBD A;  1YWK A;  1V0A A;  4CDU C;  5A1F A;  1CGP A;  3ILN A;  2YMZ A;  5JR2 A;  1GP5 A;  1V9U 3;  3ETQ A;  2VZP A;  1OLR A;  4YVS C;  4YVW A;  1V6M A;  3H9A A;  5CBL A;  4N53 B;  5EJ3 A;  1DYP A;  1UPI A;  2JG9 B;  4C90 A;  3BIE A;  3MIF A;  2VQT A;  1ULD A;  4NMI A;  4N43 A;  4LBM A;  5CAD A;  5LRR A;  4IEP A;  3O1U A;  4E2Q A;  1LES A;  1TME 1;  4IEX A;  1AXY A;  4W50 A;  1AYM 1;  1XE0 A;  1LOG A;  3ABZ A;  3BIW E;  1WW6 A;  3WHT A;  3SEE A;  4DUV A;  2VZO A;  3I3E A;  1UF2 C;  2BP6 A;  4BK4 A;  4B8E A;  4D7S A;  2E31 A;  4RR3 B;  1QY4 A;  1QJU 3;  4CDQ B;  1YQ5 A;  1OH4 A;  4AVS A;  4QGL A;  1IGO A;  5A7N A;  4I0B A;  5F2W A;  4QX1 A;  4NR1 A;  2WNO A;  4B1M A;  4HET A;  2Q8D A;  3ACI A;  5KHG A;  3A22 A;  2RDQ A;  2XOM A;  1RUH 1;  2XXZ A;  4LHK A;  1W3X A;  4BK5 A;  4Y4Y A;  3GBW A;  5C33 A;  2YBS A;  4HOO A;  5FBJ A;  5CFC B;  5L9V A;  4DRR A;  3OY8 A;  3PU3 A;  4IV3 C;  5FZ9 A;  4LOS A;  1NA1 A;  1HDK A;  1Y9Q A;  1U5Y A;  4EJR A;  4P9X A;  4I2O A;  1WMX A;  3NNG A;  3X29 B;  4QM8 A;  3FN9 A;  4CXY A;  2DWR A;  2P6C A;  3NV2 A;  1MQT A;  4RHV 1;  4S2F A;  5F2S A;  1DGW X;  2WNU B;  5I8Y A;  1CPM A;  3PUR A;  4XF3 A;  4A2U A;  3H7J A;  1UKG A;  2W46 A;  2VXJ A;  1AR9 3;  2IXH A;  4EN0 A;  2ZKN A;  2PLV 3;  4IUG A;  4A41 A;  1D0G A;  1OF3 A;  4IE7 A;  1F9K A;  4IET A;  5GLV A;  2LRO A;  2O8Q A;  1I9R A;  5F5I A;  1TME 2;  3KZ4 C;  3DKQ A;  4LEJ A;  4LXL A;  1EAH 3;  1VRB A;  2R49 A;  2ZAA A;  2FZ1 A;  4AFB A;  5IFT A;  1AYM 2;  1PMI A;  1VBD 1;  1SFN A;  3RI8 A;  3R4D B;  2IXC A;  3Q8E A;  2VUD A;  3N36 A;  4BZ4 A;  5FPV A;  5ACA 3;  1SQ4 A;  3UYJ A;  1DZR A;  4G4F A;  1OT5 A;  1HB1 A;  1K5M B;  2CGO A;  3UKV A;  1LB2 A;  1FPN 1;  4B29 A;  2DU1 A;  2ZHL A;  1OQ1 A;  1UAI A;  3HBK A;  4GMP 0;  1XBF A;  4YW7 A;  3LEG A;  3IN9 A;  1QXR A;  3EMR A;  3O1P A;  4OUE A;  4YZ2 A;  4YFW A;  3H8O A;  3M3O A;  2J1R A;  4QKB A;  2WZP P;  1RUH 2;  4YZ3 A;  3WP4 A;  1COV 3;  1PIV 1;  2PN5 A;  2W39 A;  4UAP A;  2V73 A;  1CVN A;  5FDB A;  2EA7 A;  4QT6 A;  3VD9 A;  1O4Y A;  1O5L A;  1LU1 A;  2D6O X;  4Y22 A;  4YW3 A;  3VBU B;  4FPC A;  3BGA A;  1QOT A;  2WYF A;  4R9D A;  1NCR B;  3ZYI B;  4H7L A;  4N53 C;  4UWD A;  2IXI A;  4FFI A;  1JYW A;  4ZS2 A;  2JG9 C;  4IXL A;  4Q29 A;  1GWL A;  2O1Q A;  2VR4 A;  4HXC A;  3SQO A;  1OLQ A;  5IVC A;  4RHV 2;  1GP6 A;  1PM4 A;  4Q5O A;  4QQ2 A;  2P3Y A;  4GQ7 A;  2P34 A;  1ZZB A;  2VMD A;  5DG2 A;  3E6C C;  3ILF A;  4W6X A;  5BNQ A;  3ZOI A;  3RZK A;  2FD8 A;  2YU1 A;  3OBZ A;  4OYU A;  1RUC 3;  3T0B A;  3VZK A;  3UGH A;  5A32 B;  3AK0 A;  1ODN A;  1FMD 3;  5FZB A;  3VKF C;  4NIA A;  4AL9 A;  2CGP A;  2BVB A;  2GP3 A;  4AEM A;  4LNV A;  4QDS A;  4XDO A;  1ND3 A;  1VBD 2;  3ZIW A;  5IAT A;  5BNP C;  1US3 A;  1UW8 A;  1ZBA 3;  3IKW A;  4GXL A;  1QMJ A;  3MIH A;  4PIY A;  3WP5 A;  1SPP A;  4N9I A;  4LIT A;  1R09 3;  4KI5 M;  4D69 A;  4ARX A;  3J8F 3;  1DCS A;  1J59 A;  5ANN A;  1R1A 1;  3T4H B;  3S0M A;  1FPN 2;  4TXW A;  2Q0A A;  2OS2 A;  4AR2 A;  4DUW A;  3PJQ A;  1X8M A;  1PGW 1;  1OHF A;  1KS4 A;  2HWE 3;  2VEC A;  3HQX A;  5A1A A;  5LZ6 A;  5FWJ A;  1ZBE 1;  3NJY A;  3POE A;  4JGY B;  1HQL A;  3D5O A;  4IW3 A;  3ZYH A;  4BQX A;  1PIV 2;  4K6B A;  1BXH A;  5FMD A;  4NAO A;  3QBQ A;  4UYB A;  3IB3 A;  5A3M A;  3HT1 A;  4TLG A;  3VGI A;  3CU7 A;  4OUS A;  4A3Z A;  4O9G A;  3FUO A;  5FXV A;  3D6E A;  4LPL A;  1ND2 A;  4Q26 A;  5IVE A;  4KBZ A;  4LKF A;  4RL7 A;  4CYD A;  1RHI 1;  3A21 A;  4A44 A;  4MGK E;  2VZT A;  2WA4 A;  1C8N A;  1W2A X;  3EHK A;  2RS5 3;  4W6W A;  4YG6 A;  3POS A;  1FT9 A;  3LD8 A;  2K9Z A;  1YEW A;  1H8V A;  4A42 A;  2BBA A;  4BB3 A;  4F8A A;  2DCJ A;  5F39 A;  4JQT A;  4RGA A;  1X50 A;  2A6Y A;  2D5H A;  3GGL A;  2VVD A;  3KGZ A;  1DQ0 A;  5APA A;  3ZXE A;  2GND A;  3K4A A;  2R30 A;  1EP0 A;  4A4A A;  1MS1 A;  2DVB A;  2JXA A;  3UGG A;  3VBR C;  1H8T A;  3P5B A;  2VZ1 A;  2Y6H A;  3B9C A;  3B3Q E;  2Z2S B;  3JB4 C;  3I54 A;  3OGG A;  3OPZ A;  1R1A 2;  1U5X A;  1ONA A;  3PUI A;  1RUI 3;  2WWS A;  5K9Y A;  1IPK A;  4R52 A;  1LOC A;  1DZQ A;  1PGW 2;  3WF2 A;  4FP3 A;  4CP9 B;  1ZBE 2;  2XLA A;  1A3K A;  5FYI A;  5HPO A;  5D21 A;  4FVV A;  2EAL A;  2KD7 A;  4CUA A;  2JEN A;  1MS4 A;  4LA3 A;  1Q3E A;  3HT2 A;  2HBU A;  1RVF 3;  3MUY 1;  1OMI A;  2BZD A;  3GJA A;  5FLI A;  4XUN A;  1RL3 A;  1GQG A;  3ON7 A;  5F1R A;  5EJZ B;  2PMW B;  4IES A;  4QXH A;  5FZM A;  4UFK A;  4DIQ A;  1L7R A;  1LU2 A;  3I3D A;  5F9T A;  2C0Z A;  3J4U H;  4CEW B;  3O1R A;  1G9C A;  2FCT A;  5IK5 A;  1AXK A;  2W1W A;  1RHI 2;  3MYX A;  3NAP B;  2ZX3 A;  3U75 A;  4MHR A;  4WV8 A;  3C2U A;  3VDD B;  1JOJ A;  1EYB A;  2OUJ A;  1VMJ A;  2P5B A;  2ARX A;  4MO3 M;  1J1T A;  4FFF A;  1J3P A;  3B94 A;  3MIC A;  2WSU A;  1GU3 A;  4Q0V A;  5KXC A;  3SIS A;  1QIQ A;  4HMZ A;  4LBQ D;  1KDK A;  1NG0 A;  1OUX A;  2XJP A;  4FT8 A;  4BQY A;  2W5F A;  3LEI A;  3WCR A;  4AAX A;  5E88 A;  2YGM A;  1AXZ A;  3PUQ A;  1DF0 A;  4FPL A;  1QU0 A;  2PHT A;  4OHV A;  1JBC A;  1AVB A;  1IZ3 A;  1JU3 A;  5FYB A;  2V5Y A;  1PGS A;  3RVH A;  1ENR A;  2WL1 A;  1NLS A;  1XU2 A;  2ILM A;  4HKO A;  3ALQ A;  4URA A;  4YM2 A;  1C8M 1;  3ZFG B;  1HB3 A;  4CU6 A;  3B00 A;  5FQ0 A;  4HON A;  4COZ A;  4YM3 A;  2XUE A;  4TTG A;  4QPY A;  3UKN A;  2B4K A;  5FP7 A;  3PTY A;  5KR7 A;  1W28 A;  1YRZ A;  1JYN A;  3III A;  1CAU A;  4D6R A;  1XOY A;  1WUV A;  2XPJ A;  3THC A;  2UY8 A;  2W95 A;  5A70 A;  1UO9 A;  1GFF 2;  1NYW A;  4WM8 C;  4YFZ A;  4Z1V A;  1LAJ A;  1R64 A;  3GZA A;  2Q30 A;  1GNZ A;  1HV1 A;  3M70 A;  1N1V A;  1OFN A;  3I2K A;  1PK6 B;  2JIC A;  4XTP A;  4BWO A;  4P08 A;  3TWI A;  2JDK A;  2C9K A;  2CGN A;  3ST7 A;  5IFP A;  3NL1 A;  2E32 A;  3WG1 A;  2LM3 A;  1TG7 A;  5IWF A;  4CU7 A;  2QQJ A;  3CJI A;  2RJL A;  1J3R A;  1GNY A;  3AZY A;  5LA2 A;  4COW A;  2VCB A;  4Y20 A;  5CKN A;  5LEJ A;  1X9P A;  5JDB A;  2RS3 3;  5CA6 A;  3OUI A;  3I59 B;  2PXJ A;  1OQD A;  2VMF A;  4CCL A;  5FXW A;  4QPG B;  1W9S A;  1ENX A;  1HRV 1;  2W1U A;  4OFG A;  4CCO A;  5I0D A;  1L7Q A;  3AKQ A;  2Q5T A;  3U1X A;  3FUQ A;  3RZH A;  4HG6 B;  4KWU A;  4BLJ A;  2I74 A;  1ZZ6 A;  4OVE A;  2KM2 A;  2R07 1;  3I97 A;  4M01 A;  5JXI A;  5T55 A;  2W9X A;  3AZX A;  2O14 A;  4L0P A;  5CNA A;  3ZSL A;  1JN2 P;  1C8M 2;  2KR2 A;  3OSD A;  1CR7 A;  1QF3 A;  1FOD 3;  1C1L A;  4KWL A;  4FCA A;  4LO7 A;  4Q4W 1;  5A3P A;  2VC9 A;  1TNR A;  4ORF A;  4QX8 A;  3SH4 A;  3C7E A;  1JYV A;  1OVP A;  5I0T A;  1DU3 D;  1A78 A;  1CJP A;  3H8R A;  1Q8P A;  2E33 A;  2EXJ A;  4NWW A;  5JIA A;  3B9I A;  3VZN A;  4OI4 A;  1N1S A;  4UW3 A;  2GSY A;  3LFI A;  5BXX A;  4W65 A;  2VPV A;  3AYC A;  2HWD 1;  3KHC A;  4H14 A;  2P3J A;  1R08 1;  4EN9 B;  4CEW A;  1H6Y A;  4NHY A;  3WDX A;  1TVG A;  2A5Z A;  2YG0 A;  5FZF A;  3T2P A;  4WM7 A;  4F7Z A;  1V6I A;  2IVI B;  3GXU A;  3P1I A;  3HQU A;  5IAV A;  1S2K A;  2R32 A;  5FOJ B;  2IUW A;  3OEA A;  4QHB A;  4CDX A;  3S5A A;  2AC1 A;  4CTE A;  1S0E A;  4JGZ C;  1G6N A;  3FWE A;  3K3N A;  2Z79 A;  3CNA A;  4OZO A;  1S0G A;  5JCT A;  3VHN A;  1PVX A;  1OOP A;  3KCC A;  1W2U A;  4P9L A;  4RS5 A;  4OI1 A;  1UMI A;  4MXW B;  5FYM A;  4CCM A;  1IKQ A;  1UIK A;  3FJS A;  3GZT B;  4MLO A;  1OFS A;  4EZH A;  4YGC A;  1JOB A;  3LOI A;  2AZ5 A;  4XHX A;  3RWN A;  4P00 B;  5FYU A;  2QKD A;  5EZW A;  2ZGL A;  2R07 2;  1NCQ C;  4QHZ A;  4DXR A;  1E5H A;  1S2B A;  2JB8 A;  1YLL A;  2VZS A;  3JD7 1;  4Q8L A;  4TLF A;  2Y0I A;  1ACC A;  4LJH A;  4CCC A;  4J1X A;  4XBL A;  1MEC 3;  4Z82 A;  5IVY A;  3ZFG A;  4AYU A;  3K75 B;  3QLQ A;  1RUO A;  5LA1 A;  1RUD 1;  4Q4W 2;  3NJX A;  2JDZ A;  5FY5 A;  5AFE A;  5EQU A;  2BOI A;  4P5H A;  5EFU A;  1M06 G;  3DF0 A;  1YIF A;  4FPE A;  4NRM A;  3M1H A;  1POV 3;  4MG2 A;  3ZPO A;  3NNM A;  5HI0 A;  2HWC 3;  4XF0 A;  2R0H A;  1JHN A;  4JVA A;  2HWD 2;  5FP9 A;  3ZFE C;  5JZG A;  5LY1 A;  4PDW B;  3BTY A;  1KFU L;  3H3L A;  1R08 2;  5FYY A;  3ZN5 A;  3R4S A;  1LRH A;  3F2Z A;  5LAS A;  5TSW A;  1PK6 C;  4A3X A;  3O0V A;  5FO8 B;  3A4U A;  2GC2 A;  1NE6 A;  1MVQ A;  2R7E B;  1H0B A;  2HLE A;  2PA7 A;  4A6S A;  3C7H A;  1YFW A;  2XBO 1;  4AI1 A;  1JYC A;  4LUK A;  4GWM A;  1Q5O A;  1Z7S 3;  1GIC A;  3CMG A;  3WNN A;  4RQP A;  1LOF A;  3TB0 A;  1YIP A;  1VMH A;  4QXB A;  5CIS A;  3U0Z A;  1OH3 A;  4UF0 B;  2GN3 A;  4NIH A;  4EWA A;  2ZJC A;  4PIX A;  2UUR A;  5FZO A;  1CZT A;  3LWC A;  4M4P A;  1IQA A;  1DP0 A;  2BQP A;  2VO5 A;  4YWA A;  1AUY A;  1H9W A;  1VLN A;  2MHF A;  3PJY A;  5GLW A;  3VLB B;  2HEW F;  2R16 A;  1YC6 1;  1TE1 B;  5FK7 A;  2GU9 A;  4HSL A;  4OHY A;  1A6C A;  5FP8 A;  1PVC 3;  3JD7 2;  3ACL A;  1S4C A;  2XON A;  2W1Q A;  5JSO A;  2W52 A;  3ORJ A;  3ZKY A;  1OI6 A;  4GA9 A;  4NWV A;  4COV A;  1QQP 3;  1KRI A;  1RUD 2;  4L97 A;  1BMV 1;  3E97 A;  3JXS A;  2XQR A;  4PIZ A;  4XCB A;  4YM0 A;  3T4V A;  1RUG 3;  1S2E A;  1WCK A;  1QJF A;  2DVA A;  1GWK A;  4LMF A;  4GIQ A;  4HN0 A;  1JZ8 A;  3HR9 A;  2RV9 A;  2X53 S;  4IEV A;  4I02 A;  2LRP A;  4IV1 B;  3A0N A;  4QU1 A;  5DAW A;  2ZOE B;  2G9Z A;  3S7E A;  3O0W A;  1JZ7 A;  4A7Y A;  3KQR A;  2EIB A;  3AP4 A;  1QJU 1;  5ERL A;  3SMH A;  3DYO A;  3VUO A;  1SLA A;  1GAN A;  1VBA 3;  2ZZQ A;  1HX6 A;  3LAG A;  2F17 A;  5A7W A;  3CJX A;  4AAP A;  2XBO 2;  1AR6 3;  1NZI A;  2BNM A;  2BW8 A;  3Q9O A;  1C4R A;  4QAW A;  3GHN A;  4R9B A;  4CCD A;  2JDA A;  2B42 B;  2Q4S A;  3M3I A;  4JTO A;  1QH7 A;  3CHX A;  4QPW A;  4XIL A;  5HXV A;  3VBS B;  4KMQ A;  3VHP A;  3H42 B;  3FL7 A;  3DKW A;  5C7G A;  5A6X A;  4QPI A;  4LBL A;  4LLF A;  1EY2 A;  2VH9 A;  4DIN B;  4QQH A;  1E5R A;  2XLG A;  2BGO A;  5F8P A;  1Q8O A;  4NRP A;  4OCT A;  4Q0P A;  4Q27 A;  3ZM8 A;  1UOB A;  4AGV A;  2WNV C;  4CA9 A;  2E51 A;  1GUI A;  5G05 L;  3MFA A;  3MV1 1;  1Y3T A;  3MUZ 1;  1KFX L;  1LTE A;  2Z4F A;  2WC2 A;  4HK8 A;  3WT3 A;  4UXA A;  4CCN A;  1E5S A;  4CXW A;  2QQL A;  4KGQ A;  2UYB A;  4GWN A;  1FX5 A;  3BB6 A;  1BMV 2;  3SHR A;  2NZ9 A;  3JBG 3;  3OOX A;  4E8D A;  4D6S A;  1UXX X;  2JDU A;  2OPW A;  1EAH 1;  1DIW A;  2JEC A;  3JB8 A;  4PDW C;  3ZIX A;  1GZC A;  1B09 A;  2ZGM A;  2CDO A;  4NHX A;  3LFM A;  1K12 A;  3MI8 A;  2GH2 A;  4J1W A;  5ACA 1;  5FPX A;  2G9F A;  3TNQ A;  4QB6 A;  4PF1 A;  1QJY 1;  3MID A;  3D4K A;  3N9O A;  5IK7 A;  3NVC A;  1PZ9 A;  1QJU 2;  2P3K A;  1JZ2 A;  5BV6 A;  5C8C A;  1NXD 1;  2EXI A;  2QQV A;  3C7F A;  5M0T A;  4KG0 A;  4UFL A;  2QNK A;  2P1B A;  5CFD C;  1URX A;  4QGN A;  4YNI A;  1DLL A;  2ZBJ A;  2ZGU A;  1OKO A;  1OUS A;  4NJ4 A;  4XFF A;  1A34 A;  4DXT A;  1EV1 3;  3MIB A;  3KMH A;  5J7M A;  5FKB A;  4Y1X A;  4YM1 A;  1W0N A;  2VQA A;  3N9Q A;  1PX4 A;  5FRA A;  4YZ5 A;  5A3T A;  1OXC A;  1S0I A;  1FNZ A;  4QQP A;  5LEK A;  3ACG A;  3FX3 A;  2JJ6 A;  1W3V A;  4P5Y A;  4HKW A;  3W21 A;  3P3P A;  1JZ3 A;  4XAE A;  4MZU A;  4QKN A;  4N43 B;  3URF A;  4AQ2 A;  3N7L A;  2OQ6 A;  2JD4 A;  1D4V B;  1OA3 A;  2I2S A;  4LO4 B;  3VN4 A;  2DV9 A;  2VBD A;  1J84 A;  1B35 A;  2ID4 A;  2TNF A;  5L73 A;  5C4W C;  4RN5 A;  2MNG A;  1DG6 A;  5IK8 A;  3RJ2 X;  4L8Q A;  2VBB A;  3I8T A;  1K42 A;  4JHT A;  4XFG A;  2E26 A;  4AK3 A;  1EAH 2;  2FDJ A;  1AR8 1;  4J25 A;  1RXF A;  3C3V A;  4XMI A;  1HQW A;  1PMJ X;  1LCL A;  5T3N A;  2YU2 A;  1ZBA 1;  2W87 A;  3W59 A;  3NNJ A;  3DCQ A;  2VNG A;  4ARY A;  5AC9 1;  1DGR N;  5GLT A;  5ACA 2;  1PGL 1;  1R09 1;  1QJY 2;  3NO8 A;  1ALY A;  1V6J A;  4QU2 A;  1YXW A;  5IK4 A;  2DVF A;  1BKZ A;  5FP4 A;  2VD7 A;  3N7J A;  1MAC A;  2A3W A;  1OD5 A;  3OY8 B;  4M3C F;  4OLL A;  5DUV A;  1QJE A;  2HWE 1;  2HBT A;  2W68 A;  2X05 A;  1LEM A;  1NA1 B;  4XDQ A;  3BKZ A;  3FZ3 A;  3POB A;  4FTS A;  3CQO A;  3SCH A;  1NOV A;  2GC0 A;  1W9T A;  1JYI A;  5K8S A;  1IG3 A;  4COY A;  1VBE 3;  4WVV A;  5LBF A;  2RM2 3;  3KV6 A;  1MQT B;  3BAL A;  4JDO A;  4XUT A;  1YFU A;  4FXG B;  4ZY9 A;  3VDA A;  5I8T A;  1W03 A;  3W20 A;  5FY0 A;  1QDC A;  3AC0 A;  2WDB A;  2X5I A;  3ZO0 B;  2NN8 A;  3SKV A;  3K77 A;  3V0B A;  5C9A C;  3E6D A;  1I1E A;  3MLJ A;  3RYK A;  5AVA A;  5IYY A;  1UWW A;  1RUE 3;  3FBM A;  2OA2 A;  4H7M A;  1IS5 A;  5HXM A;  3MGU A;  1RUN A;  1FXZ A;  3DPR A;  4ATF A;  2ZMK A;  4FP2 A;  3WZ1 A;  2WS9 3;  5D8A C;  1UNB A;  4HLT A;  4PBO A;  4N90 A;  4QKF A;  4YRD A;  1AR8 2;  5CZK A;  5DAQ A;  4DFS A;  5JSP A;  4N8M A;  3I3B A;  5A7P A;  2QDR A;  2ZKL A;  3K48 A;  1NQD A;  3WHU A;  4OUM A;  1ZBA 2;  2WZR 1;  1FV3 A;  2ADD A;  4LBJ A;  5AC9 2;  5FP3 A;  4XYX A;  4LK6 A;  1R09 2;  5L7O B;  1PGL 2;  5FLJ A;  1O59 A;  4JDN A;  4QB2 A;  5FZD A;  2WN2 A;  4XUQ A;  4CDW A;  3GF6 A;  1W8T A;  4XFB A;  1RUI 1;  5FRE A;  3VBO A;  2ZGR A;  2VUA A;  1O3Q A;  1J3Q A;  5FPZ A;  3W5M A;  3GJB A;  1H2M A;  2HWE 2;  2WNE A;  4Y22 B;  1S0J A;  4BQ3 A;  3VL8 A;  1TMF 1;  1D7P M;  4CEY B;  5FMC A;  2RG4 A;  4BIO A;  4YVW C;  5FBZ A;  1UD1 A;  1MS3 A;  4C0H A;  2WT2 A;  1JUI A;  3LGR A;  3OG2 A;  4Q0S A;  5KHI A;  3LF7 A;  4P14 A;  4DOU A;  3VD4 A;  2YDE A;  2VZQ A;  2FDK A;  3T30 A;  1RMU 1;  4IE0 A;  4N7U A;  3I4I A;  2CWM A;  1US2 A;  2Y8K A;  4K1Z A;  5H9S A;  1ASJ 3;  1W0O A;  2VME A;  5A7O A;  4B4P A;  2WZ8 A;  4RYD A;  4DUX A;  2D6N A;  4UW5 A;  5T5L A;  2EAK A;  3N9P A;  1G8W A;  3H7Y A;  3UJQ A;  1ULC A;  5GKA C;  2XWJ B;  1DQ1 A;  4XEZ A;  2VZV A;  2RS5 2;  1PNG A;  5K0U C;  5K4L A;  1ND3 B;  2VMG A;  1HN1 A;  2RHP A;  1CAV A;  1Y7B A;  4IGQ A;  3GBF A;  4AI8 A;  4LHN A;  1SPP B;  1UX6 A;  4CDU A;  4BE3 A;  2W91 A;  2HWB 1;  1UIJ A;  2B5H A;  3IDE A;  1VPH A;  2CAU A;  4Q4X 3;  2XKP A;  3JUU A;  4BU2 A;  3C8X A;  5FFO C;  4MUV A;  2WZR 2;  3U07 A;  4XIK A;  3ENR A;  1FAT A;  2ZX4 A;  2OKX A;  3D8C A;  5FTT C;  3O1O A;  2C1F A;  1REF A;  5J48 A;  3OBA A;  1NA1 C;  2ZTN A;  1LOB A;  5F3E A;  4IDZ A;  1DLC A;  1RUI 2;  2P6H A;  2BFU L;  2VUJ A;  2BDR A;  4JC1 A;  3OBR A;  3D3A A;  4GMP 3;  5FLH A;  1EPZ A;  3WIN E;  1TMF 2;  2WN3 A;  5FZI A;  1UY4 A;  1WLW A;  1SCR A;  4AGR A;  5KXB A;  3NMB A;  1IPS A;  1SLT A;  5JAX A;  3USS A;  5FZ0 A;  5SV5 A;  1ND2 B;  4FPH A;  3ZPY A;  4MX3 A;  1NZC A;  1X36 A;  4A45 A;  5D2A A;  2OXB A;  3MF9 A;  3MFC A;  4LBO A;  3IAP A;  3ZFF C;  1Y4W A;  3WDU A;  1RMU 2;  5KHH A;  1Q43 A;  2AEN A;  1BK1 A;  2Z42 A;  3B01 A;  3DEM A;  3TOJ A;  1UOF A;  2GMM A;  4Q1R A;  1RUJ 1;  4GUL A;  5LCW L;  1KD7 A;  1WA4 A;  1SHW B;  2ZHK A;  2NQY A;  2VE1 A;  5BNO C;  2BPA 2;  1DGR A;  1LHN A;  1NLQ A;  2B7Y A;  4IV3 A;  4B4R A;  4N9H A;  5DMY A;  3PNA A;  1VIW B;  2ES3 A;  1H8T B;  2BWC A;  3RZL A;  1OA4 A;  3SH3 A;  3OJB A;  5GZC A;  4WVZ A;  2HWB 2;  4MH0 E;  3LKJ A;  1VRH 3;  2AYH A;  3JQW A;  4OQ9 A;  4QKD A;  2J1S A;  1UU6 A;  3ZYP A;  4FFH A;  4JKL A;  5FZC A;  1VBB 3;  3PLQ A;  3H8X A;  1FV2 A;  2W08 A;  5L7O A;  2R04 1;  1O4Z A;  2PHU A;  1Y9M A;  2E7Q A;  1NE4 A;  1NT0 A;  4M0N A;  1XXN A;  5ISL A;  3AMH A;  4LOT A;  3ZXA C;  3ZXK A;  4AXO A;  3DL3 A;  1DQ5 A;  2KA3 A;  4EQV A;  2JIG A;  4A7K A;  4CEY A;  5BPX A;  4AI9 A;  4C1W A;  2A3X A;  2A70 A;  2GDF A;  4OQ8 A;  5FK8 A;  4V1P A;  4C91 A;  4QX2 A;  4JRA A;  1JW6 A;  1UY3 A;  2ET1 A;  2WRA A;  3WF4 A;  2Z69 A;  2ET7 A;  2GN7 A;  2DFB A;  1SBE A;  2OZJ A;  3B7M A;  5A1L A;  1IKP A;  2DCY A;  3WCS A;  2ETE A;  3N9M A;  5FPL A;  3O1M A;  2R06 1;  4NE9 A;  2PTM A;  1XE7 A;  2B46 X;  2YFU A;  4LBK A;  5FIX A;  5FYZ A;  4XOG A;  3NST A;  3RGB A;  2ZGN A;  1F8V A;  4ZU5 A;  2JG8 A;  3POF A;  1RUJ 2;  2B45 X;  1REE A;  1ND3 C;  3ZX7 A;  4NVP A;  5CYY A;  1GV9 A;  1OSG A;  5AFB A;  3R0R A;  4KH9 A;  3ATG A;  2XG3 A;  3MZH A;  2RJ2 A;  2ZGP A;  4MGI E;  4RR3 C;  4CP0 A;  3T2Q A;  4NPR A;  2A6V A;  2C24 A;  1S0B A;  3PIJ A;  4CDQ C;  1XSR A;  2PFW A;  3VBF B;  1ODM A;  4YYO A;  4IGO A;  4I01 A;  4JDM A;  4LOR A;  5JPM B;  1I6X A;  1I3H A;  3N9L A;  4AI3 A;  5LWB A;  4I3G A;  1AX0 A;  2TUN A;  4ZU4 A;  1UZY A;  2BGC A;  1APN A;  4RFR B;  5CFC C;  3LA7 A;  4FI9 A;  5FQ0 B;  1PO2 3;  2R04 2;  5CIR A;  3RJR A;  1BLZ A;  2YY1 A;  3KB5 A;  4Q0U A;  1NY7 1;  3OYW A;  3UL2 A;  1MEC 1;  3AMM A;  1UQX A;  3JCI A;  4W6Y A;  4P9G A;  3R05 A;  1CAU B;  4K8R B;  2WT0 A;  5F3I A;  5FPA A;  4MXV A;  4XTM A;  3PVO A;  2PAM A;  2WNU C;  3D0S A;  1HN0 A;  2G4I A;  3L2H A;  3LIG A;  1GMM A;  5LY2 A;  3RZG A;  1RXG A;  1POV 1;  4XBQ A;  1CPN A;  1W9Y A;  4LBQ A;  4CCK A;  2CDP A;  4UFM A;  4WZC A;  4XZP A;  1JZ6 A;  2XHK A;  3RNS A;  4M3C A;  2A3Y A;  2R06 2;  4OHX A;  3VB9 A;  3IDB B;  2HKX A;  5F6K A;  3CZU A;  2MEV 1;  1W0P A;  1KDM A;  1NAE A;  1QH6 A;  1O91 A;  3CJI B;  2CL2 A;  3A0K A;  4FPJ A;  3BOW A;  5A3N A;  4QHO A;  3K4Z A;  4Y20 B;  5JWP A;  4IE4 A;  5FYH A;  3ZSE A;  2BYV E;  2E7A A;  2ZEY A;  1K5M C;  3IZO A;  3TN9 3;  4L11 A;  3ZMN A;  4YSF A;  5C3Q A;  1W8U A;  2FCV A;  2ZGK A;  4KBB A;  2V4A A;  3PVB B;  2J1E A;  1LED A;  2Y0O A;  4E27 A;  2JE8 A;  2WO1 A;  3J26 N;  2FDF A;  1HW5 A;  1ENQ A;  1ZM1 A;  2XJT A;  1IS3 A;  2PHF A;  1F31 A;  2E9Q A;  4JZR A;  4FAG A;  2WFF 1;  5T52 A;  4AVB A;  1BHG A;  3BU0 A;  3VD5 A;  2HEV F;  2RDR A;  4YG3 A;  2XJR A;  2TBV A;  4OI2 A;  1UPS A;  2VMC A;  4R9C A;  4DO0 A;  4SBV A;  3W5N A;  2XJS A;  3USU A;  3VBU C;  3LEM A;  2F4L A;  5IUQ A;  2VW0 A;  3Q8B A;  5FZE A;  5GM0 A;  3E6B A;  4XQ4 A;  1PVC 1;  1NCR C;  1NY7 2;  1MEC 2;  1S0D A;  3SKJ E;  1JYX A;  1YQ8 A;  4PQQ A;  5DZG A;  2ADE A;  2LAL A;  3OF1 A;  3ZN4 A;  4NAM A;  3VBR A;  3VKN A;  2RR1 1;  1KJR A;  2ZHN A;  1AYN 3;  1W6N B;  4ZHN A;  1HQN A;  5A33 A;  4U2A A;  1GSL A;  3CDZ B;  4WM7 B;  2VY0 A;  3EBR A;  4GJZ A;  2J22 A;  1F4A A;  3I3Q A;  1ULO A;  4AG4 A;  1U5I A;  1WW7 A;  4G9S B;  3HD8 B;  2VMI A;  4IEQ A;  4CDX B;  3AYA A;  2MEV 2;  2OII A;  2ZX1 A;  4K3U A;  5I0R A;  4EN6 B;  1W6M A;  3EJK A;  1VBA 1;  2JKB A;  3A7Q A;  3T3Y A;  5F6L B;  1OQE A;  2EF6 A;  2IZW A;  2NLR A;  1AR6 1;  3K46 A;  4YG0 A;  3WG2 A;  1OOP B;  4RS5 B;  3TNP B;  5C3S A;  1SFP A;  1PX3 A;  3ZXL A;  2RMU 3;  1N3O A;  3WXP A;  4XIO A;  1GQH A;  3VBF A;  1TME 3;  2QQK A;  2A1X A;  2VZR A;  3L2Y A;  3NNF A;  4YGD A;  4L2N A;  1W2N A;  4Y3O A;  3SC7 X;  4DS0 A;  3WD5 A;  3BOP A;  4CCE A;  2WFF 2;  5AVP A;  1AYM 3;  5KBF A;  3NKG A;  3NW4 A;  4JGY C;  3MLL A;  5LK7 B;  3PDQ A;  3AZZ A;  1TZO A;  3PTR B;  5CB7 A;  1OD3 A;  2CNA A;  5JOW A;  1K5J A;  4Z2W A;  2VCM A;  4XXP A;  4Q4Y 1;  2VQU A;  2WT1 A;  1LHU A;  4Y24 A;  1ZA7 A;  4OUL A;  2H6B A;  1V6L A;  3OUJ A;  1PVC 2;  4GKY A;  5A7S A;  4CZS A;  3O12 A;  2BU9 A;  4RA0 A;  5LBE A;  1XE8 A;  2ZHM A;  3ZSM A;  5JZG B;  1CZS A;  2CV6 A;  2VVF A;  1RUH 3;  4K9S A;  2RR1 2;  2X8K A;  3WNX A;  5IT6 A;  1UY0 A;  2WYS A;  5E1R A;  2QVS B;  5FPU A;  5KXD A;  3WW3 A;  1P8J A;  5FY7 A;  2YPD A;  1QJX 1;  4XQW A;  3ZXG A;  4RQP B;  1C1F A;  2B39 A;  3BVC A;  3CJI C;  4BYY A;  4FTE A;  4TSV A;  2WO3 A;  1E5I A;  4XZU G;  1O3S A;  4NIG A;  1VB2 A;  3LCP A;  3ZSK A;  4RHV 3;  1VBA 2;  5FCC A;  5FZO B;  1AR6 2;  3D0J A;  2Y6F A;  4XW3 A;  2VOW A;  1UOJ A;  2YC4 A;  2ZGQ A;  3MV0 1;  3WNP A;  3JZV A;  4Z92 B;  1N1Y A;  4LUM A;  2W0X A;  3M4F A;  3PVN A;  5FZH A;  1WMD A;  4ES8 A;  3FHQ A;  1F5J A;  2HWF 3;  4TYS A;  5F3C A;  4WM8 A;  1VBD 3;  2Q1Z B;  2QE3 A;  4IEW A;  2A6Z A;  5FJH A;  3AKP A;  2VOT A;  4AED A;  3VHR A;  2R1B A;  1LNS A;  2DUQ A;  1FPN 3;  4Q4Y 2;  3DYP A;  1RIR A;  2RE9 A;  4DXS A;  5BNN A;  1PO1 3;  2DTW A;  3AP5 A;  1V70 A;  4ISQ A;  4CEW C;  3M3E A;  3ZLI A;  5HV4 A;  1G9F A;  1WWY A;  2AAC A;  3NAP C;  2VZU A;  3VDD C;  1W6N A;  1PIV 3;  4WVM A;  4BCU A;  4DEV A;  2H6C A;  2O8O A;  4FPG A;  1YI9 A;  3L9J T;  5I0U A;  2QQO A;  4CDX C;  5A7W B;  3PVE A;  2NPI A;  2PHR A;  4LBN A;  2QQU A;  1QJX 2;  1SLC A;  3IMM A;  2N7G A;  1U5Z A;  4P02 B;  1H30 A;  2DUO A;  2QQM A;  2V72 A;  2OZ6 A;  3CZJ A;  4ERO A;  2YRO A;  4HAN A;  1VBC 1;  3ME2 A;  1UZ0 A;  1ZRD A;  3KV5 A;  5J36 A;  4ONU A;  5DUU A;  3WW4 A;  4LO8 A;  1J58 A;  4QPI B;  1DGL A;  3HWJ A;  2BGP A;  5A3U A;  3WQ0 A;  2PHD A;  3HN1 A;  2TEP A;  1XJA A;  5DDJ 3;  5FYT A;  2R1D A;  3IPV B;  5LW9 A;  2E7T A;  1KIT A;  4PJY A;  4L99 A;  3ZFG C;  1W2O A;  2JE9 A;  2FZ2 A;  3LDR A;  2P2K A;  1LOA A;  4GAZ A;  2HEY F;  2BFU S;  2GZW A;  2AEY A;  3AP9 A;  3HVD A;  2QJV A;  3ZN6 A;  3MDP A;  1M4W A;  3O14 A;  2WUH A;  2VTX J;  2IXK A;  1XPW A;  3KS7 A;  1W6Q A;  4MGQ A;  1JXN A;  3OCP A;  4Y5T A;  1YO8 A;  4ASK A;  1C57 A;  3KLS A;  1R1A 3;  1DFQ A;  3ZXD A;  2PQS A;  1UXZ A;  5L36 A;  4EN7 B;  1BEV 1;  3KD4 A;  1HJF A;  2Y34 A;  3B5L B;  3OBT A;  4JGZ A;  2LTN A;  1AL0 G;  5T5J A;  2D93 A;  1ZBE 3;  2RDS A;  3HN3 A;  3Q8C A;  4XXA A;  4LQR A;  2DDU A;  3UJO A;  5DQ0 A;  5H9R A;  1ULG A;  3VZL A;  3MF6 A;  1W6O A;  5A3W A;  1AJO A;  5C8C B;  1OC1 A;  4Z2A A;  1HRI 3;  1OUR A;  1F35 A;  5F7U A;  3HBZ A;  1NCQ A;  4Q0Q A;  1WBL A;  3ZYF A;  1NUK A;  3LSD A;  4XJU A;  4CU8 A;  4LUL A;  3Q8A A;  3MW3 A;  3WG3 A;  1AR7 1;  3BPZ A;  2WLP A;  3SH5 A;  1GP4 A;  1RHI 3;  1VBC 2;  4EE2 A;  4DPN A;  1XU1 A;  4GH4 B;  4LKS A;  3HNB M;  4QPG C;  4U36 A;  3VHO A;  2VGD A;  3IBM A;  4J6G A;  3M3C A;  3AZW A;  3WUD A;  2XJU A;  4IER A;  1TQ5 A;  4IEY A;  2XJQ A;  3Q8F A;  3VKM A;  3RSJ A;  4XC9 A;  1V9U 1;  1AJK A;  3ZFE A;  5GZF A;  5JXH A;  1FYU A;  3ZYG A;  5LK5 A;  4G3Y C;  3CF6 E;  4LLO A;  1OLM A;  2GC3 A;  4NRO A;  3O1V A;  3KV4 A;  3ASI A;  1QXJ A;  3FE5 A;  1H2K A;  5GLZ A;  5EP9 A;  4XAA A;  4M00 A;  3ZXJ A;  2QDN A;  4BQ4 A;  5FZA A;  5DAX A;  1B35 B;  4CRQ A;  1ASJ 1;  2PHW A;  2JWP A;  4JKK A;  1X9T A;  1ZRR A;  1LJ7 A;  1QOO A;  2VOK A;  3FC0 A;  4KNC A;  4KG8 A;  4LK7 A;  4R4X A;  5FYS A;  3RPQ A;  3SLI A;  3NRU A;  5JMC A;  4JTN A;  1BEV 2;  1W6P A;  1EUT A;  3HOB A;  4X8N A;  4XFC A;  1N47 A;  1O3R A;  4CPB D;  1YCI A;  4IEO A;  1WA6 X;  4QX3 A;  2QBX A;  2E53 A;  3AP7 A;  1IS6 A;  1AL2 3;  1GZ9 A;  1CAW A;  2R0F A;  5J09 A;  2GME A;  5FJK A;  1ZRF A;  4L9B A;  1VAK A;  3RYR A;  1T2X A;  4XE9 A;  1W9F A;  5FWE A;  3PUA A;  2XML A;  3AKS A;  4FSJ A;  2E63 A;  4XET A;  4AWD A;  1AR7 2;  4QPI C;  2H0V A;  2VBP A;  4CUC A;  1SDD B;  4LIU A;  4MHU A;  4C8D A;  1UX7 A;  4YLZ A;  1D0H A;  1SZB A;  2BWA A;  2K2S A;  3LA3 A;  2WQ4 A;  4GMP 1;  3VD7 A;  1AHS A;  2PQQ A;  4DQA A;  4BQ5 A;  1BK0 A;  4HVO A;  2IWG B;  2VCC A;  4NO4 A;  5LBB A;  1KEX A;  3GCX A;  3IPV A;  3T09 A;  1V9U 2;  2X5I B;  4PHZ A;  4FFG A;  5E6H A;  2ZMN A;  1F15 A;  3V0B B;  2D6L X;  1R1Z A;  1MZF A;  2ZEX A;  3CEW A;  4S2D A;  5BNP A;  4K40 A;  4NUB A;  1W8F A;  5BY5 A;  4AFM A;  2FDH A;  1AR9 1;  2PLV 1;  1ASJ 2;  5E89 A;  1SFY A;  4K7J A;  5HCH A;  3DPR B;  2YB7 A;  3T2T A;  5G04 L;  5FZ3 A;  3M3Q A;  4EV0 A;  3UKT A;  1Y9G A;  5L9B A;  3I2G A;  1CZV A;  2WO2 A;  1LHO A;  3WDW A;  4E4Z A;  1C8M 3;  3NV4 A;  5FUP A;  2DYC A;  1FI2 A;  1W8Z A;  3WV6 A;  4BXS V;  1GWM A;  1SMV A;  1WME A;  2C4X A;  4Y1Y A;  4MSV A;  3WNO A;  2WNV A;  4CDW B;  1UYY A;  1GYK A;  4NII A;  1XQN A;  3VBO B;  3CL1 A;  3I2H A;  3ZSJ A;  2Y38 A;  4ASM B;  3INA A;  2VCA A;  3DXU A;  2L9L A;  2EXH A;  4P9W A;  2R6Q A;  5LRS A;  5HCB A;  1GZW A;  5E16 A;  3TBD A;  1L3J A;  3ZKU A;  1COV 1;  2WFP A;  3P3N A;  4BME A;  3ZYB A;  4B4Q A;  3OD0 A;  1Z78 A;  4GH4 A;  4Q4V 3;  1VR3 A;  1DGW A;  3OD4 A;  2VXR A;  5JLV A;  4MOA A;  4CSW A;  2FBE A;  3RDI A;  3V65 A;  3NNL A;  5ABJ B;  4ZPI A;  2HYK A;  3K51 A;  4MGZ E;  1HKD A;  1OKQ A;  2XJV A;  1H1M A;  4OMC A;  3PHM A;  1UY1 A;  4XF4 A;  3T08 A;  2QQI A;  3KCX A;  2PAE A;  3DV8 A;  1JOP A;  5CEH A;  4JX0 A;  5D1I A;  4ES9 A;  3QH7 A;  2A6X A;  5FMO L;  2Q8C A;  1SCS A;  1O4T A;  4Y5S A;  4O61 A;  1O3T A;  1WLD A;  1AR9 2;  1BZW A;  3GYD A;  2GC1 A;  2PLV 2;  4PF5 A;  1HRV 3;  2XWB B;  4KU8 A;  4EWE A;  1RUC 1;  1CAV B;  5C6C A;  3ETP A;  2IXJ A;  3TEY A;  3U4X A;  5BUV A;  2DCK A;  4FPY A;  5CFD A;  4FQZ A;  1FMD 1;  1MS5 A;  2R07 3;  1D4M 3;  4CDU B;  4BLI A;  4OHZ A;  2GH8 A;  2VU9 A;  4IV1 C;  4YZ1 A;  1UY2 A;  2RS1 3;  4CCJ A;  4YVS B;  3QCW A;  3EB7 A;  4ZS3 A;  3QH6 A;  2A71 A;  1QJZ A;  3PU8 A;  5J37 A;  3H0O A;  4Q4W 3;  1DYK A;  1CD3 G;  2BV4 A;  3J8F 1;  3UET A;  5FZ7 A;  2X09 A;  2PYT A;  4MGS A;  2FCU A;  4BMB A;  2BNN A;  2V4V A;  3VBS C;  3TEZ A;  5F32 A;  3HPN A;  1YQ6 A;  3DYM A;  2VUL A;  1KJL A;  4CE8 A;  1LHV A;  2D43 A;  2HWD 3;  5FAX A;  4LIV A;  4FQ4 A;  4QQO A;  4BIS A;  1R08 3;  1RYY A;  4HL0 A;  1DQ4 A;  4BDV B;  2SBA A;  4I09 A;  1N3Q A;  2YXS A;  1XNA A;  4XUO A;  5C4W A;  4DXZ A;  1COV 2;  1WCU A;  3ZR6 A;  1STM A;  4FXK B;  4IEZ A;  2VAU A;  3E1F 1;  3LPF A;  1GLH A;  1V6N A;  3AX4 A;  4HKL A;  4M0H A;  4P9I A;  3S7I A;  3ZDS A;  3B69 A;  2XH6 A;  3D82 A;  2J1V A;  4N7I A;  2D97 A;  3BI3 A;  1RGS A;  5FR3 A;  5FUN A;  3ECQ A;  3U10 A;  3NQH A;  3C7G A;  4CP2 A;  5A80 A;  4Z07 A;  4EN8 B;  2CSG A;  1JMU B;  2D3P A;  4FPK A;  1RUF 3;  4CUB A;  2ARB A;  3FBY A;  2JDP A;  3LB9 A;  2RS5 1;  3HNY M;  4UBG A;  3P6B A;  3BUC A;  4IV3 B;  3VDB A;  1W8N A;  1RUC 2;  4A7Z A;  5JI9 A;  5JPN B;  4AFC A;  4TZD A;  1UZV A;  4XUR A;  1FMD 2;  2Y33 A;  2D6M A;  4FPO B;  4AHW A;  2BUK A;  2ZX2 A;  5T5O A;  1W8O A;  3JD7 3;  4HPK A;  4KQ7 A;  2DU0 A;  4PLM A;  5L9R A;  2Z5W A;  5LA9 A;  3AYE A;  3TN9 1;  1RUD 3;  4BIF A;  4FOV A;  1N3P A;  3LE0 A;  1V6O A;  5DG1 A;  4Y1Z A;  4DEQ A;  2UWB A;  2IVJ A;  3AB0 A;  3J8F 2;  4RSU A;  4TWT A;  1MZ6 A;  3R6S A;  4URT A;  5C8W A;  1SLL A;  1XRU A;  2EIC A;  4QXC A;  4AEK A;  3JQX A;  4AW7 A;  5CAZ A;  2JEM A;  1QKQ A;  3AZV A;  5HCA A;  1HB4 A;  3BPS A;  5BYN A;  3KT1 A;  1C28 A;  2WQZ C;  2P4E A;  3WVJ A;  2PHL A;  3ITQ A;  2QZ2 A;  5FOB B;  4E4S A;  1MZE A;  1RVF 1;  4ZZ8 A;  2VW1 A;  5FZ6 A;  2BJS A;  2XBO 3;  4N43 C;  4YW6 A;  4XBN A;  1VAM A;  5F3G A;  1QXP A;  3SEP A;  1GQP A;  5ABJ A;  2E6V A;  4QGM A;  1QOS A;  3LDK A;  4QX0 A;  1D2S A;  4V2W A;  1HV0 A;  3AL5 A;  2DUR A;  3NJZ A;  5A3L A;  1AYN 1;  1WW4 A;  2JG8 B;  2QTW B;  3HQR A;  2GNB A;  4UOJ A;  4AF9 A;  2Y60 A;  4XAB A;  1ZYB A;  4YZ4 A;  2KXL A;  5JOY A;  3RMX A;  2DTY A;  3THD A;  3VBH A;  1DQ2 A;  3AFG A;  4LO6 B;  3V56 A;  2ZA9 A;  3PME A;  2DUP A;  5FO7 B;  3ACF A;  3UNP A;  5DZF A;  3MPP G;  4E4D X;  3J7H A;  2ZZJ A;  3H50 A;  4AVV A;  1XC6 A;  3RFR A;  4X8P A;  3WR0 A;  2WO7 A;  4PI2 A;  1AX2 A;  3V0A B;  1VP6 A;  4OMD A;  5FZK A;  4YVS A;  4GZ9 A;  3GBG A;  4XHB A;  3T1L A;  5IVB A;  3TRS B;  4QB1 A;  4XJZ A;  1WZX A;  1AX1 A;  3MIG A;  3TN9 2;  2RMU 1;  4WBB A;  2QFE A;  3HNM A;  4QX5 A;  2XVG A;  4JRL A;  2D44 A;  3NV1 A;  5E8A A;  3IM0 A;  2OVU A;  3H8U A;  1GR3 A;  2JDM A;  1LEN A;  1QGL A;  2VTX A;  3MPB A;  2VJX A;  3V64 A;  3HIF A;  3OYW B;  4YGB A;  1XSQ A;  4JKM A;  4IND A;  4YW1 A;  3VV1 A;  5K0U A;  4D94 A;  2NYY A;  1MQT C;  1LGN A;  3MEP A;  3WDT A;  5BNP B;  2ARC A;  3DUI A;  1RVF 2;  1G7Y A;  4GB3 3;  4AQ6 A;  3DGT A;  1JOD A;  2Y6J A;  1PZ7 A;  4LBQ B;  3KVA A;  4K8F A;  1WCS A;  4M3C B;  4BJ0 A;  1SAC A;  2VM9 A;  1MZ5 A;  3LEK A;  1J83 A;  1JS9 A;  4AI2 A;  1WD4 A;  4C1X A;  1AYN 2;  4D0Q A;  3LOB A;  3T2O A;  1HLC A;  1OPO A;  4XJ9 A;  4B1L A;  3OB8 A;  2C9A A;  1PHM A;  3KSC A;  1N1T A;  4O65 A;  1K3I A;  4UFH A;  3THT A;  2W92 A;  2MPF A;  3J7M A;  3LSE A;  4JQR A;  4O7X A;  2BRT A;  3I3M A;  4F83 A;  2WAA A;  5FXZ A;  1UZZ A;  1ZA4 A;  1FNY A;  2VOX A;  1W8H A;  5T50 A;  1NKG A;  1VJ2 A;  1C5I A;  2RS3 1;  5L7O C;  2AEZ A;  1YYN A;  3UV9 A;  2A6W A;  2RMU 2;  5CKQ A;  5FZG A;  3ZFF A;  2V09 A;  5J1X A;  2QCS B;  3USU B;  4CEY C;  1IOA A;  2HWF 1;  3SCF A;  3WF1 A;  2HYX A;  4CUG A;  4QMA A;  4AVT A;  4ZZ5 A;  2NP0 A;  4Y5Z 0;  1H1I A;  5DUX A;  3HAG A;  5BNO A;  3N9N A;  1FOD 1;  5IAX A;  1ZRI A;  1QJY 3;  2P3I A;  1I5Z A;  3VBR B;  1PMH X;  2WSV A;  5EXO A;  3VKO A;  5A33 B;  2XHN A;  4NHK A;  1PO1 1;  1EPW A;  2YBP A;  2WLQ A;  1CIY A;  2JG8 C;  4B7K A;  1ST8 A;  4E4H A;  1OF4 A;  1JI6 A;  3VZJ A;  3VZO A;  5FZL A;  1ZVF A;  1WKY A;  4R9A A;  2P17 A;  5CKM A;  3RZZ A;  3J7L A;  1W6M B;  1XND A;  2IFR A;  2YZ4 A;  3ES4 A;  3VKL A;  3I2D A;  4HFS A;  5DAB A;  2F4P A;  2ZX0 A;  1S0C A;  3AFK A;  1ZZC A;  1CN1 A;  1W9W A;  1YHF A;  2X29 A;  4D8M A;  1UL9 A;  2GNM A;  2OW4 A;  2FMY A;  3B02 A;  5DUW A;  4E8C A;  5CU1 A;  1UYP A;  3FHI B;  3TEX A;  3S57 A;  1C5H A;  2ORX A;  1D2Q A;  1SDW A;  2PEL A;  2W1S A;  4N53 A;  3WLU A;  3V0A A;  2JG9 A;  5EIY B;  3MBW A;  1BBT 3;  4BQ1 A;  2ZGS A;  3ZDV A;  2RS3 2;  3N35 A;  5DDJ 1;  1IPJ A;  4FO9 A;  5J96 B;  4V2V A;  5F5C A;  5ANQ A;  4JAA A;  2XKO A;  2VW2 A;  2B8M A;  2B9U A;  5I91 A;  4A6O A;  4R8H A;  4XFH A;  4XJW A;  5H9Q A;  1AR8 3;  2HWF 2;  4XFA A;  3KVB A;  2J42 A;  2QQP A;  2ZEW A;  5JSR A;  3ZMO A;  5AC9 3;  1ND2 C;  1HXS 3;  3WDY A;  2CHH A;  1FOD 2;  4ASL A;  4RR3 A;  2D6P A;  2XDV A;  3ELN A;  4FPF A;  3AP6 A;  3MW2 A;  3E5X A;  3WOG A;  3U78 A;  4XQD A;  2W3J A;  4CDQ A;  1W04 A;  4Y33 A;  1RIN A;  1ZNP A;  1PO1 2;  5DN2 A;  5EV7 A;  3S5Q A;  1X7N A;  2F6B A;  2JE7 A;  3WNK A;  4OZX A;  2HWC 1;  3POW A;  2EID A;  4WVW A;  1IHM A;  4LE3 A;  3WX5 A;  1WW5 A;  4COU A;  4BOW A;  3AMP A;  2AH2 A;  3H1Y A;  5CFC A;  1ULP A;  2WIN B;  2VNV A;  1G9D A;  5J3U A;  4XFI A;  3CO2 A;  1HRI 1;  2OPK A;  5JOZ A;  1H8T C;  2PHX A;  5FY8 A;  4HBN A;  1Z7S 1;  3WG4 A;  1U0A A;  1C3H A;  2ZPX A;  2OQ7 A;  3KWV A;  3AKR A;  3LQC A;  4IQP A;  4HT1 T;  4LHL A;  3RS6 A;  1KGY A;  2BNO A;  5KC6 A;  4TN7 A;  3M8L A;  3FLR A;  4QD2 A;  2H0B A;  1NLR A;  5SV8 A;  2WNU A;  3OPW A;  2AGS A;  3PL0 A;  3MLK A;  3ZYR A;  3MO4 A;  3ES1 A;  2FQP A; 
#chains in the Genus database with same CATH homology
 1UZ0 A;  3SEE A;  4DUV A;  2VZO A;  3I3E A;  4CU9 A;  1JZ2 A;  4BK4 A;  2E31 A;  2BGP A;  2J1T A;  3C7F A;  1OH4 A;  4QX1 A;  4DXT A;  3ACI A;  3A22 A;  2XOM A;  1W0N A;  2VZ3 A;  4BK5 A;  1PX4 A;  3DEC A;  3ACG A;  4MGQ A;  2WUH A;  1XPW A;  4P5Y A;  1JZ3 A;  2PQS A;  1UXZ A;  4LHS A;  3NNG A;  1JZ4 A;  3FN9 A;  3HN3 A;  5JXJ A;  1J84 A;  4LQR A;  2ID4 A;  2DDU A;  5DQ0 A;  2W46 A;  4RN5 A;  4GWJ A;  3I2F A;  4IUG A;  3FHA A;  1K42 A;  4A41 A;  1JHJ A;  1OF3 A;  4Z2A A;  2E26 A;  5F7U A;  2YFZ A;  1NUK A;  1WCQ A;  4CU8 A;  5IFT A;  1PMJ X;  4ARY A;  2W87 A;  2JD9 A;  3A23 A;  3HNB M;  4LKS A;  1OT5 A;  2RVA A;  2VTF A;  2X05 A;  3CQO A;  3LEG A;  5JXH A;  2JKX A;  4OUE A;  1W9T A;  2J1R A;  3OEB A;  3VDA A;  4ZY9 A;  3OGR A;  4XUT A;  4UAP A;  1O8S A;  4W4Z A;  4JKK A;  3VD9 A;  3AC0 A;  2WDB A;  3BGA A;  3NRU A;  1EUT A;  3HOB A;  3SKV A;  3K77 A;  5IHR A;  1JYW A;  5IYY A;  2VR4 A;  1UWW A;  4QX3 A;  2QBX A;  2VMD A;  5HXM A;  3GDB A;  4OYU A;  1T2X A;  3T0B A;  5CZK A;  3I3B A;  2J1U A;  5JXG A;  4QDS A;  4UI9 L;  3ACH A;  4CUC A;  1US3 A;  1SDD B;  1O59 A;  4QB2 A;  2WN2 A;  4XUQ A;  1UX7 A;  4KI5 M;  3VD7 A;  4ARX A;  3LPG A;  4TXW A;  3W5M A;  4DUW A;  2VCC A;  1D7P M;  3T09 A;  1KEX A;  3PUH A;  5A1A A;  4YPJ A;  4XVH A;  2BER A;  2Y64 A;  2ZEX A;  3OG2 A;  3VD4 A;  2VZQ A;  3IB3 A;  2YB7 A;  2XQX A;  1US2 A;  2C26 A;  2Y8K A;  5G04 L;  3WF3 A;  2VME A;  1H6X A;  2WZ8 A;  3HJR A;  4RYD A;  2WQ8 A;  4DUX A;  3I2G A;  1CZV A;  2WO2 A;  4A3Z A;  1CX1 A;  4LPL A;  4ET7 A;  3CKH A;  2VZV A;  3A21 A;  4A44 A;  4BXS V;  1HN1 A;  2VZT A;  2C4X A;  3WNO A;  2QQN A;  1UYY A;  2W91 A;  4A42 A;  2BBA A;  3I2H A;  2W47 A;  5C70 A;  2DCJ A;  3C8X A;  2VCA A;  1GOF A;  2L9L A;  3GGL A;  3K4A A;  4A4A A;  5DPN A;  2OKX A;  2VZ1 A;  3OBA A;  2Y6H A;  3GM8 A;  1DLC A;  4MOA A;  1W99 A;  3D3A A;  3PUI A;  4OMC A;  1UY1 A;  2WN3 A;  3T08 A;  1UY4 A;  2QQI A;  3WF2 A;  3WF0 A;  4JX0 A;  5HPO A;  4A45 A;  5JMO A;  2KD7 A;  4CUA A;  2Y6L A;  3IAP A;  3MUY 1;  2BZD A;  1EUU A;  3ETP A;  4XUN A;  3UES A;  2DCK A;  5EJZ B;  5IJR A;  1L7R A;  3I3D A;  1UY2 A;  5LCW L;  5B4X A;  1SHW B;  3EB7 A;  2W1W A;  4PF1 A;  2J7M A;  5DMY A;  3UET A;  2X09 A;  4MGS A;  1JZ5 A;  2V4V A;  4MO3 M;  3HPN A;  3DYM A;  4JHZ A;  1GU3 A;  2EIE A;  3IDA A;  2J1S A;  1RYY A;  4BDV B;  3WEZ A;  4JKL A;  3I2J A;  1XNA A;  4XUO A;  3WQB A;  2W5F A;  3LEI A;  5C71 A;  4AAX A;  3E1F 1;  3LPF A;  4M4R A;  3WSO A;  1JU3 A;  5FUI A;  2J1V A;  4CVU A;  3ECQ A;  3NQH A;  3C7G A;  4CU6 A;  4QX2 A;  1O8P A;  3WNL A;  1UY3 A;  3WNM A;  3WF4 A;  4CUB A;  3HNY M;  4TTG A;  3P6B A;  2X10 A;  2B4K A;  3NJV A;  3VDB A;  5EJ1 B;  1W8N A;  4XUP A;  2YFU A;  2WZE A;  4XUR A;  1JYN A;  3III A;  1W8O A;  1F4H A;  2B9V A;  5CYY A;  3THC A;  2W95 A;  1R64 A;  2RJ2 A;  3OGS A;  2ZEZ A;  3LE0 A;  3T2Q A;  4DEQ A;  3I2K A;  4W8J A;  4P08 A;  1XNT A;  2EIC A;  5JUV A;  2C9K A;  5IFP A;  1GOG A;  2E32 A;  3K4D A;  1TG7 A;  4CU7 A;  2QQJ A;  5LA2 A;  1GNY A;  2VCB A;  3BN6 A;  4FI9 A;  4PT6 A;  2VMF A;  1W9S A;  2W1U A;  4ZZ8 A;  5I0D A;  3C7O A;  1L7Q A;  4HG6 B;  4KWU A;  3SEP A;  1GQP A;  1UMH A;  3I97 A;  4QX0 A;  5JXI A;  2W9X A;  4L0P A;  4UOJ A;  3T0A A;  4GWI A;  1GMM A;  2WAO A;  2VC9 A;  3THD A;  1JYV A;  3C7E A;  1JU4 A;  2CDP A;  2ORZ A;  1JZ6 A;  3ACF A;  3UNP A;  2E33 A;  3J7H A;  3VD3 A;  3CZU A;  1XC6 A;  4QDQ A;  4OMD A;  1NAE A;  4GZ9 A;  1H6Y A;  1TVG A;  4QB1 A;  2YG0 A;  3T2P A;  2WBK A;  3K4Z A;  3GXU A;  3HNM A;  2ZEY A;  3P1I A;  2J1E A;  3OEA A;  2JE8 A;  2WO1 A;  2VJX A;  3I2I A;  1BHG A;  4JKM A;  1UYX A;  4OZO A;  2LS6 A;  3VD5 A;  1UMI A;  2VMC A;  2VL4 A;  3W5N A;  3EYP A;  2Y6G A;  2Y6J A;  4P00 B;  4DXR A;  4BJ0 A;  2VM9 A;  3LEK A;  3SKJ E;  1J83 A;  2VZS A;  1JYX A;  1UYZ A;  4PQQ A;  2YC2 A;  3K75 B;  4D0Q A;  3T2O A;  5LA1 A;  3OB8 A;  3NJX A;  3CDZ B;  3CIH A;  2J22 A;  1F4A A;  2V5D A;  1ULO A;  1K3I A;  2J1A A;  4ZXE A;  4AG4 A;  2W92 A;  2WAA A;  3U37 A;  3A7Q A;  1NKG A;  3F2Z A;  1GOH A;  3K46 A;  2R7E B;  2HLE A;  5J1X A;  3C7H A;  1PX3 A;  2W94 A;  2ZXQ A;  3CMG A;  3WNN A;  2QQK A;  2VZR A;  2HYX A;  3WF1 A;  4ZZ5 A;  4QB6 A;  1CZT A;  4M4P A;  4QDR A;  1DP0 A;  2VO5 A;  1PMH X;  1OD3 A;  2XHN A;  1NX9 A;  3VDC A;  2VQU A;  1MPX A;  1CIY A;  1OF4 A;  1JI6 A;  2LW8 A;  1WKY A;  2W1Q A;  2WAB A;  2XON A;  1CZS A;  1IQD C;  3IAQ A;  1UY0 A;  2WYS A;  3JXS A;  3HEI A;  1W9W A;  4D8M A;  1P8J A;  1JZ8 A;  4E8C A;  2RV9 A;  3OGV A;  2ORX A;  2W1S A;  2WO3 A;  4XZU G;  5EIY B;  1JZ7 A;  3MBW A;  2EIB A;  3DYO A;  1I5P A;  2YC4 A;  3WNP A;  3MV0 1;  4QAW A;  4A6O A;  5B4N A;  2JDA A;  5LA0 A;  4QPW A;  2Y6K A;  4KMQ A;  3FHQ A;  3FL7 A;  1SG3 A;  2ZEW A;  5C7G A;  2VOT A;  1DYO A;  1YQ2 A;  3T0D A;  1LNS A;  2W3J A;  2BGO A;  4MAD A;  3ZM8 A;  1K45 A;  3DYP A;  5DN2 A;  1GUI A;  3WNK A;  4DXS A;  5G05 L;  5JR2 A;  2EID A;  3MV1 1;  2VZP A;  3MUZ 1;  2Z4F A;  1ULP A;  2VZU A;  2VQT A;  2QQL A;  4DEV A;  2QQO A;  4E8D A;  1UXX X;  3LQC A;  1KGY A;  2CDO A;  2QQM A;  4W50 A;  1K12 A;  2V72 A;  3ABZ A;  3CZJ A;  3MO4 A;  4P02 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...