5B4NA

Structure analysis of function associated loop mutant of substrate recognition domain of fbs1 ubiquitin ligase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
RNLLRNPCGEEDLEGWSLDVNGGDGWKVEELSRDQRKEFPNDQVKKYFVTSYYTCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRPDCGSKYQLTVRLLSENEDVLAEFQPDPATIQQKSDAKWREISHTFIDYGPGVRFVRFEHGGVDTHYWAGWYGPRVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box only protein 2
publication title Structural analysis of a function-associated loop mutant of the substrate-recognition domain of Fbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 38
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5b4nA00
2E33A 5B4XA 3FN9A 4CU9A 3LE0A 4MGSA 5EIYB 1L7QA 2VC9A 4QDSA 2YFUA 5IYYA 3C7GA 4TTGA 4LKSA 4XVHA 4XUQA 4BK4A 3W5NA 2BZDA 2EICA 2XONA 1ULOA 4L0PA 1YQ2A 2XOMA 2J1TA 2V4VA 3GDBA 3THDA 2WO3A 4A3ZA 4A44A 2WZEA 2W1UA 3CQOA 2EIBA 2VTFA 2JD9A 4ARXA 2Z4FA 1JZ2A 4A4AA 3WF2A 3K75B 4OUEA 3OBAA 3LEKA 2CDOA 5LCWL 3ECQA 4QX0A 4DXSA 2E26A 5C70A 2Y64A 1W0NA 1UYZA 2LS6A 3OEBA 4MGQA 4MOAA 2LW8A 3ETPA 1JU3A 3HPNA 2C26A 2WN2A 1DLCA 2VZSA 3E1F1 4QPWA 3FL7A 1SG3A 2E31A 5JUVA 3WF3A 3T2OA 3UETA 3MBWA 2QQLA 4P02B 3NJXA 2X05A 5C7GA 1JZ5A 3IB3A 1JYNA 3SKJE 3I3BA 4LPLA 1KEXA 3BGAA 1I5PA 1K45A 5C71A 1TG7A 3CZJA 3FHAA 2VL4A 1GOGA 3EB7A 1JHJA 5DMYA 3VD4A 2VZTA 3K4AA 2W87A 3MUZ1 3I2KA 4P00B 3ABZA 1W8NA 2BERA 1EUUA 2BBAA 4CUAA 4A45A 4QDRA 3WNLA 2C4XA 5EJZB 3SKVA 3WF4A 1RYYA 1US2A 2VCAA 4QDQA 2YB7A 1T2XA 1GUIA 1XNAA 1P8JA 4CU7A 3HOBA 2WBKA 3I3DA 1ULPA 3LEIA 4BXSV 1UX7A 5JXIA 1GOHA 4JKMA 2J1SA 1CIYA 3DYMA 2XQXA 1SDDB 3DYOA 2XHNA 1J83A 1OT5A 2J22A 4GWIA 1O8PA 3WNOA 5JXJA 2VMFA 1SHWB 3IIIA 2VZVA 4OMCA 2ORXA 3C7OA 2Y8KA 2B9VA 4P08A 1XPWA 2Y6HA 4UOJA 4JHZA 2WABA 2JDAA 2EIEA 3I2JA 4W8JA 2W1QA 5F7UA 2CDPA 3GGLA 3PUIA 4P5YA 4ZZ5A 4JX0A 2PQSA 5HXMA 3HNBM 3MV01 1UY1A 2HLEA 2KD7A 4JKLA 4BJ0A 4FI9A 4Z2AA 1GNYA 3I97A 3NQHA 3C7EA 2YFZA 3NJVA 4DUWA 2QQOA 4DEQA 3A23A 4KI5M 4RN5A 5JXHA 2WZ8A 4QAWA 3P6BA 1JZ3A 3UESA 2VQTA 2W92A 4A42A 2L9LA 4XUPA 3WF0A 3I3EA 4XUNA 2VZ1A 3ACGA 1UWWA 4CU8A 1JI6A 2ID4A 2B4KA 4KWUA 2ZEWA 4JKKA 2J1UA 1PX4A 1OD3A 2VZOA 5DN2A 5FUIA 5G04L 5DPNA 1PMHX 2JE8A 1CZSA 4DUXA 2WDBA 2W1SA 2VOTA 2VZQA 4D0QA 3EYPA 3W5MA 3I2GA 2WO1A 3OGVA 2QQNA 2VZRA 3IAPA 3OEAA 4CVUA 1UXXX 3C7HA 3GM8A 4DXRA 2OKXA 1H6YA 3VDCA 2VMCA 4PT6A 2Y6KA 1JYWA 2QQMA 2VZPA 4TXWA 3I2IA 4UAPA 4UI9L 3CZUA 1NAEA 3GXUA 4LHSA 4W4ZA 4XZUG 3C7FA 3MV11 2ZEZA 3T2QA 4BK5A 5IFTA 3I2HA 4IUGA 2W9XA 3HNMA 1D7PM 3T0BA 3WNKA 4M4RA 3C8XA 1J84A 3WSOA 1K12A 5B4NA 2WYSA 2EIDA 5EJ1B 2ZXQA 3MUY1 4ET7A 4MO3M 3T08A 5LA1A 2QQJA 2W47A 4ZZ8A 2WO2A 4PF1A 1O59A 5I0DA 2X09A 1NUKA 3BN6A 4CUBA 1US3A 2WAAA 4BDVB 1JU4A 1L7RA 2J1AA 2VJXA 3NRUA 3VD7A 4LQRA 2R7EB 2W46A 2JKXA 1UY3A 3ACFA 2Y6JA 1W8OA 3VD5A 2VCBA 2WQ8A 1LNSA 1CX1A 1JZ4A 3VDAA 5JMOA 2WUHA 3OB8A 3IAQA 3FHQA 1GOFA 2DCKA 2W94A 1NX9A 3AC0A 3T0DA 3OGRA 1UY0A 3PUHA 1PMJX 1UMIA 4A41A 3CDZB 3ACIA 2RJ2A 3K4DA 4ZY9A 2VZUA 1MPXA 4ZXEA 3SEEA 1JYXA 2YC4A 3WNMA 4CU6A 3F2ZA 2W91A 1JZ6A 1GMMA 1WKYA 3WF1A 3VD9A 4AAXA 3CMGA 4OZOA 5IJRA 5CZKA 1K3IA 5CYYA 3WNPA 5HPOA 1OF3A 1W9WA 3JXSA 1UY2A 2BGPA 1HN1A 3D3AA 3J7HA 2W95A 5JR2A 3UNPA 2VM9A 2J7MA 1UYXA 3WNNA 3THCA 2RV9A 4XUOA 3T0AA 4E8DA 1OH4A 1W9TA 4AG4A 4ARYA 5JXGA 5DQ0A 3LQCA 3A7QA 3DECA 3MO4A 2WN3A 1CZTA 5IFPA 3A22A 3I2FA 3K4ZA 3CIHA 4QX3A 4QX1A 4XURA 2YG0A 2VQUA 5A1AA 3IDAA 1GU3A 1UZ0A 4D8MA 1DYOA 3VD3A 3A21A 4QB6A 2BGOA 5LA0A 2W1WA 2X10A 3P1IA 1F4AA 1EUTA 1JZ8A 4XUTA 3T2PA 1WCQA 1F4HA 3HEIA 3OG2A 1UYYA 1TVGA 4A6OA 4DUVA 4KMQA 1UXZA 2E32A 2ZEXA 1OF4A 4YPJA 2V72A 4CUCA 4MADA 3T09A 2HYXA 1XC6A 5LA2A 4DEVA 4DXTA 5G05L 2DCJA 2QQIA 4W50A 1DP0A 1UY4A 2VR4A 3LPGA 4M4PA 2Y6LA 3ZM8A 2VMDA 3HNYM 4QB2A 5J1XA 1IQDC 3HJRA 2W5FA 1W99A 2J1VA 3LPFA 2RVAA 1K42A 4OMDA 4GZ9A 2J1RA 2W3JA 1JZ7A 1NKGA 3NNGA 4QB1A 3VDBA 1GQPA 2VCCA 2QQKA 2V5DA 2VO5A 3HN3A 3OGSA 1W9SA 4RYDA 2WAOA 2VMEA 3SEPA 3DYPA 2Y6GA 3WQBA 2ZEYA 3U37A 1R64A 4PQQA 1XNTA 2YC2A 3K46A 1BHGA 3ACHA 1UMHA 3K77A 1KGYA 1JYVA 4HG6B 4GWJA 4OYUA 4QX2A 2ORZA 3LEGA 4E8CA 5IHRA 2J1EA 1O8SA 3CKHA 1PX3A 2VZ3A 1CZVA 2C9KA 1H6XA 2QBXA 2DDUA 3WEZA
chains in the Genus database with same CATH superfamily
4D3WA 4V2WA 2A6VA 2G9GA 1V0AA 3ORJA 3BVCA 3M4FA 4XCBA 3RI8A 2WFPA 2FMDA 2ZKLA 3G7DA 1NA1C 5IVJA 4IE6A 1DQ6A 5IYYA 4RHV2 5KXDA 1GANA 2BGCA 4RR3C 5GLWA 1MVEA 2R063 3USUA 3PHMA 4HETA 5E6HA 4AGVA 1VRBA 4QPGB 1UZZA 1W8WA 3VBRA 1IQAA 3T2TA 3ZPOA 4JZRA 5FMDA 2WS92 3VKFC 3LCPA 3KB5A 2WO3A 2JB8A 1CAVA 4LHNA 2PAKA 3AZXA 4A44A 3RZJA 4LLOA 4XQDA 1AX2A 2WWUA 3VBSB 1XYNA 2WNVC 1BK1A 3GZTB 3J8F3 1PNGA 1D4M1 2VTFA 1VBA1 1D4M3 3UGHA 3OY8B 2MPFA 5F2SA 1JZ2A 2XXZA 3K75B 3FLTA 4N53A 4L97A 2PAEA 4FBFA 5LEJA 2CDOA 4QKNA 1ZREA 3QH6A 4NIDA 1GBGA 4LBKA 3LKJA 1LAJA 3ECQA 3FC0A 1QKQA 3KQ4B 3O1TA 4DXSA 2PHRA 5FPAA 3NWKA 4XBQA 2Y64A 3M8LA 3U10A 3WR0A 3SC7X 4H2AA 3ZKUA 3ZKYA 1UYZA 5A1LA 4D6SA 4RFT0 2B8MA 2NYYA 2LW8A 4D6RA 3QOPA 1ULDA 1B35B 4QPGA 3R4DB 3O14A 4K40A 2RM22 3AZWA 5FPVA 3UJQA 2DVDA 1DLCA 1RUG1 4GWMA 4HSLA 4BZ4A 2NPIA 1DHKB 2JB4A 1GQGA 1KFUL 1QMJA 4YW7A 3ZXKA 5JUVA 4Q8KA 3WP4A 1OLMA 3FBMA 3AJZA 1KS5A 1WW5A 2ZX2A 2IC1A 4FCAA 3UKTA 4E4DX 4S2HA 1W05A 5FLHA 1JXNA 1OVSA 2WR9A 4IEOA 1H8TA 2VAUA 4P02B 4OUMA 1XNBA 4BHPA 1H0BA 2DUPA 2VD7A 5H9PA 4M01A 4ATFA 1VE0A 4O61A 5IK7A 1W6NA 5HCAA 1H2NA 2Y0IA 2P4EA 3KVBA 4WM7B 5M0TA 3RDIA 1DZTA 5DG2A 5JZGC 3ZSJA 4NAOA 3PTRB 4CE8A 2ARCA 3POBA 4GMP1 5C71A 5LK5A 4CP1A 1GP4A 3CZJA 4UFHA 2BPA2 1AR82 3FWEA 1OLRA 2YPJA 1NE6A 5ABJB 4R9CA 3B00A 4TZDA 2P6HA 4XFGA 4FPHA 1O7FA 3VD4A 4EWDA 1F2NA 3WG2A 3B69A 3K4AA 3TEZA 4AR2A 3H3UA 1H2MA 2IXLA 2Q4SA 3FHIB 2W87A 4H14A 1AL0G 3MUZ1 4MV2A 4QPYA 4X8PA 3TNPB 3VKNA 3AL5A 4QGNA 1WLTA 4XZPA 2KR2A 5L9BA 2HH9A 4BCUA 2Q0AA 5LBBA 2E6VA 4MXVA 1R1A2 2ZS6B 2C4XA 2PYTA 3I59A 5AVAA 5EJZB 5FYVA 1HB3A 1RHI3 3H0OA 4GMP0 4KG8A 3RMXA 2YB7A 1T2XA 1Q8PA 4K3UA 5FUPA 2ZMKA 2VW1A 3VBUB 5FWJA 1NY72 4NHYA 1STMA 3T1MA 4CU7A 2OUHA 1ULPA 3LEIA 3VV1A 3OPTA 3S7IA 1QJY3 3D6EA 3PL0A 5JXIA 2BYVE 1YNAA 1HB2A 1Y9GA 2J1SA 4AFCA 2XDVA 3VBOA 1KS4A 1GWKA 1PK6B 1XSQA 2QQWA 5A33B 3DYMA 4V1PA 3DYOA 3KWVA 1ALYA 3IWZA 3S5AA 3OCPA 3VBFB 4BU2A 4OLLA 1BBT1 1SHWB 3CBNA 4RGKA 1UL9A 2ORXA 2Y8KA 3C7OA 3LSEA 3W9AA 3CHXA 1BBT3 4COYA 5GKAC 2WABA 4L2NA 2FCUA 2JDAA 2EIEA 3JD73 3ZDSA 1C1FA 1DFQA 2OX0A 2WNOA 4LIVA 1REDA 5CFCA 1CGPA 4BWOA 2RS52 1SLTA 1FYUA 3TYJA 2CDPA 3ZSMA 5HXMA 4NAMA 3RJ2X 2QNKA 3MV01 4Q4Y2 4XF9A 1UY1A 2HLEA 3AZZA 5CADA 1FAYA 1ONAA 2ERFA 2YMZA 3LZZA 4Z8BA 3THTA 4YZ3A 4K8RB 1OPOA 2HWC1 4E4SA 1ZRRA 3C7EA 1FMD2 4GKYA 4Y22A 5F5QA 3EMRA 1FPN2 3PMSA 1RMU1 3PURA 2JG8A 3LOBA 2XJRA 2CGOA 3OBTA 4F83A 5FZAA 2W92A 1TNRA 2Y38A 3RG0A 2PLV2 1Q8QA 3DCQA 1LOBA 3GBGA 3HBKA 3ZFFB 1XBFA 1FOD1 4Y5SA 2XVGA 2D3PA 1GYKA 1TZOA 2WZR1 4MSVA 3ZXDA 3OTFA 1S0GA 3KV5A 5TSWA 2VZ1A 2KM2A 3ACGA 5IK4A 5KBFA 2KA3A 3VHPA 3BTXA 4CDWB 2B4KA 5DZEA 1QEXA 2ZEWA 3HVDA 4JKKA 3S7EA 1PX4A 1YRZA 2WL1A 1RUJ1 3OBZA 3EXUA 5DN2A 3ZR5A 4AFBA 4Z92B 2D93A 1AYN3 4O9GA 4FAHA 4QPIB 4NPRA 4QHZA 4Y1VA 4X6RB 2A6WA 2IXCA 1OXCA 1QQP3 2HBUA 1CZSA 2RJKA 4DUXA 2WDBA 5FJHA 2W1SA 4IE5A 1HIXA 2EXJA 4XOGA 1BEV2 1REFA 4XABA 1ZZ8A 4D0QA 2GP5A 3AXEA 1WMDA 3QD6A 2CY6A 1WW6A 1YCIA 4M3CE 4XDQA 3WHUA 5JOWA 2UYAA 4A7YA 4DRRA 2B7YA 1R091 5BNNC 2EALA 2XUMA 2QQNA 2Z42A 2ETEA 3OD4A 4FFHA 4GA9A 3OEAA 4PF5A 1TQ5A 4CVUA 2XJTA 4YVWB 4CA9A 2PELA 4ZU5A 3NNMA 4XILA 4CEWA 3EO6A 2P37A 3E6BA 4JDMA 3CJXA 1QJZA 5D8AC 3WUCA 3ZXEA 1ULCA 2WA4A 3NV4A 1H6YA 2OKXA 5FP4A 2VMCA 3ZFFA 4PT6A 1WBFA 3INAA 3NV3A 2AACA 2X5IA 3NAPC 2CWMA 1S0CA 4UAPA 3CZUA 4LKFA 4XJZA 3GXUA 5FZFA 1KRIA 4CDWA 4KWLA 4XZUG 1RUH1 3C7FA 1ZX5A 3MV11 1NA1B 4XQ4A 1VAVA 3NJZA 5FZEA 1UZYA 5T5OA 4YZ5A 2B46X 1A78A 4EZHA 4I0WB 2WSVA 3Q8BA 4JDOA 3D0JA 1D7PM 1UKRA 2ZGOA 2ZZQA 3RVHA 3WNKA 4ASMB 1OOPB 1UZVA 2CSGA 1J84A 4PI0A 4BA6A 5IUQA 3JCIA 1ZZCA 3HQXA 2PFWA 3VZOA 2A6ZA 2WYSA 1RGSA 1G9CA 1OKQA 2WFF1 5FO8B 2XL9A 1RUG2 1W6PB 1QJX1 3E5UA 5FZOA 4ASLA 1ND3C 4PIXA 2WO2A 1BCXA 5KXEA 4BE3A 5A7OA 1O59A 4L11A 5KR7A 3AZYA 5DDJ1 5FYIA 2XGXA 2ZAHA 2WNVB 3POSA 2GN7A 4CUBA 2HWE2 4RS5A 5LK7B 4I09A 2WAAA 1YI7A 1CAUA 4FQZA 2VJXA 1PHMA 1AHSA 4R9AA 2WT2A 3SH4A 1AJOA 1HV0A 1QXPA 4KBBA 5GJ6A 1GR3A 3V56A 2DVGA 3B5LB 4QD2A 1PVC1 1H2LA 5EYYA 4CCKA 2W46A 3MPPG 1REEA 4QXHA 4BQ1A 2R071 5J3UA 2JDHA 1GNZA 1PVC3 2BFUL 1W8OA 2WQ8A 3TN93 2XVLA 1CX1A 3GHMA 1YI9A 2PHFA 1UU6A 4JDNA 4CRQA 5FY1A 1WCSA 1YC61 2JICA 2ZGRA 4AFDA 4MH0E 1OOPA 3AM2A 2Y0OA 3H50A 3GCXA 1GOFA 1SLAA 3AC0A 3GNEA 1WA6X 1OBNA 2P1BA 3OGRA 1A8MA 4LBLA 4A41A 5J48A 3B93A 1D4VB 3AJYA 3BALA 4PBPA 4DRVA 2DUOA 4JGZC 3K4DA 1UIKA 4CXWA 5KHJA 4XTMA 1YWKA 2VZUA 1QJU2 3Q9OA 2YC4A 2R30A 1GLHA 3RWKX 4P9XA 2W91A 1RUD1 4D7TA 4E4ZA 1JZ6A 5LASA 5CB7A 1GMMA 4GULA 4XC9A 2NM1A 1LOFC 1F5JA 3KMHA 5DABA 1RUD3 4C1WA 1BXHA 4CDQC 5LZ6A 4CSWA 4M3CA 4OZOA 1ASJ2 1EPWA 4PLNA 5GZGA 5JSOA 2F4LA 2GNMA 3M3OA 2R0HA 3PU8A 3WD5A 2GC0A 4S2DA 5CYYA 4M0NA 3CJIB 3WNPA 4AQSA 4DY5A 1OSGA 2ZKNA 4OUSA 2ILMA 4QU1A 4XIKA 4CEYA 5HV4A 2BGPA 4JGYB 2HBTA 3WDWA 1HN1A 4PDWB 4LHKA 2RE9A 3J7HA 2RMU3 3M2MA 3UNPA 2Q1FA 4OQ9A 2RS12 3DUIA 2JD4A 1NCRA 3KCCA 5LY1A 4E9KA 3H42B 1SBDA 4Q4X1 3T0AA 4E8DA 1H9PA 4UF0B 1D0GA 4K21A 4MGYE 4AG4A 1DDLA 3LQCA 4GIQA 4CZSA 4P9WA 1YYNA 2G9ZA 5T5LA 3A4UA 1WW7A 4J1XA 5FXVA 4AVCA 3A22A 1AR71 3K4ZA 4LXLA 4YGEA 1AF9A 4NIIA 3WW2A 2BV4A 4QX3A 2BFUS 1PO11 3WP5A 1IS4A 1DU3D 4LOTA 1NE4A 2EXIA 3HT1A 4TYSA 5A1AA 4OHYA 4MGIE 2A6YA 5GM0A 1GU3A 2VQ0A 3ZXAC 3TEWA 5FFOC 3A21A 2AYHA 2HWC2 2JDPA 2BNNA 3KV6A 5FZ0A 5F5IA 3AKPA 1ENSA 3P1IA 3VZJA 1F4AA 1EUTA 3N7JA 4LIUA 1IPKA 3CJIA 4LO4B 3ES1A 5D1IA 4JGYA 4NHLA 3LSDA 1RUF3 1XXNA 4YW6A 4QPGC 5FXWA 4Y4RA 2OZJA 4XMIA 4DUVA 3ZYPA 1ZBE1 2ZEXA 4C0BA 1Y3TA 1PO23 1RUE3 1FOD2 2V72A 3V64A 3BIWE 3RS6A 3VHNA 2PAMA 3FFQA 4UBGA 5LA2A 1RITA 4NPMA 5F5AA 1CONA 3LOIA 5JOZA 2P2KA 1VRH3 2Q8DA 5G05L 4XJUA 3PVNA 4ASKA 2X8KA 1J1LA 4KWKA 3V65A 4W50A 2AGSA 3LFMA 1H8TC 2D5HA 4E2GA 1HRI3 2IUWA 4LLFA 1WBLA 3POYA 2G4IA 4QXCA 4RQPB 3DXUA 4MVTA 4QB2A 4Q0PA 1LR5A 2JENA 3CF6E 2W5FA 4AYUA 4CXXA 2RVAA 1RUI3 3WG1A 1MZ5A 4OULA 1VBB2 4BISA 1K42A 2J1RA 3WXPA 2ATFA 2UY9A 1PGL2 4YFZA 1W2OA 1JYCA 1XU1A 5IVBA 4K7JA 4LUMA 4NIGA 2QQKA 3HN3A 1R092 3O0VA 2CTVA 4RYDA 1YQCA 4R52A 2GH8A 2ZGPA 1I5ZA 5I8SA 3SH5A 3T30A 3SEPA 3GBWA 2VNGA 4AI9A 1OFSA 5BNOA 4Y5TA 2YXSA 1CAXA 2JKBA 2RDRA 4WVZA 4KU7A 4IV3A 5JCTA 5CKQA 3JB4C 3U07A 5I0SA 4AVSA 1V6NA 1GWMA 2IXIA 3ACHA 1UMHA 2EIGA 5FYMA 1VMFA 4MGKE 4Y26A 4GWJA 2XR4A 1PGW2 3DN7A 3LEGA 4P5HA 3P3NA 5T54A 1ACCA 1RUH2 3KSCA 3M1HA 5JPMB 1UU4A 1EP0A 4WM8B 4ZS2A 1CJDA 3HIFA 5IHRA 3E6CC 4W6WA 3KS7A 5I0UA 5DAXA 2YUEA 1CQ9A 2PA7A 3DL3A 3R6SA 4YYOA 1NQJA 4NR1A 4MXWA 1IS3A 3R4UA 4FFIA 5A7QA 1SPPB 1I1EA 3POEA 1HJGA 4EV0A 1ZVFA 2QBXA 1L3JA 5EHDA 1AVBA 5DUVA 3RGBA 2VUCA 2AENA 5A1FA 2ES3A 2WT1A 1NQDA 2PTMA 2WS93 2XWJB 4IV1A 4CU9A 2W08A 5BNNB 4MGSA 1L7QA 2BVVA 1COV1 5JVVA 4QDSA 1QNWA 1WMEA 1G8WA 1OA4A 1OA2A 2AC1A 2WKKA 2YFUA 5D8AB 3BTYA 4Z1VA 4TTGA 4CP9A 5C5UA 4XUQA 5HXVA 3R4SA 5CFCC 2Z69A 3VBHA 4OI0A 1ULOA 4Q4W1 1AYM3 5ANQA 1YHFA 4AVBA 3JBG2 3V0AB 3DF0A 1MEC1 4QWNA 5L7OB 3M3EA 4MZUA 3L2HA 1NZIA 4WM8A 1RUC3 1Q43A 2IZWA 2ZX4A 4URAA 3RNSA 5J09A 2JD9A 4GB32 2YBKA 3K3NA 4IEZA 2JG8C 3POFA 1QIQA 1ND3B 3LEKA 2NQYA 1M06G 1YIFA 2XJUA 5LCWL 4XXPA 1NZCA 3GALA 2QZ3A 3MF6A 2HWF2 2XKOA 1OD5A 3PLQA 3KF5A 2GAUA 2DVFA 4BQ2A 5C70A 5FZIA 4GJYA 1W0NA 1PIV2 3WQBA 3KQRA 1RIRA 3LGRA 3AYAA 4FPGA 4LKEA 4MOAA 1EV12 1UOFA 4FP2A 4GAZA 4IEXA 5BPXA 2ET1A 5K0UB 3WQ1A 2C26A 4YG3A 4SBVA 2W39A 2DYCA 2WN2A 4DO0A 3PUAA 3O0WA 5LW9A 4YM2A 1W6QB 2VZSA 5C3SA 1LHNA 3N7KA 4YARA 2CNAA 5L7OA 5APAA 4GXLA 3WF3A 1O3RA 2VCMA 2A75A 2E51A 3T2OA 2XJQA 5FREA 1AR83 2XL7A 3IPVA 3UETA 4CEWC 1E5RA 1ULFA 5FIXA 4EZ4A 1O5UA 1NLRA 2OXBA 3AP6A 3D4KA 4Y4YA 4Q8LA 1AL21 4GJZA 3DPRA 3JZVA 1JYNA 1LRHA 2K9ZA 1ULGA 1LGBA 4CCJA 2WIIB 4RGGA 4B7EA 2JDUA 3ZLIA 1BZWA 1KJRA 1J3PA 1KEXA 1AR72 2MEV1 3LWCA 3N3HA 4G9SB 4DZGA 3BGAA 1UPSA 1V9U1 1PZ7A 1R1A3 1V6MA 2PHLA 4XFFA 2Y6FA 3MW3A 2MEV3 1TG7A 1DGRA 1RJ8A 5D2AA 3ZFFC 2GZWA 2TBVA 4CDQB 3FHAA 3BUCA 2X5IC 2VL4A 3SH3A 5FCCA 3EB7A 3ZXFA 1JHJA 3MIHA 1XNCA 1F8VA 2VZTA 1RINA 2IFWA 3BPZA 4LJHA 3O1RA 4LE3A 4CDWC 5AC93 4RGAA 4XCAA 1MZEA 4YM0A 5K0UA 3WDTA 3DKWA 3ZSLA 3I2KA 5F3GA 5JIUA 1J3RA 2XMLA 1F9KA 5I93A 4ZKTB 2RR11 1EUUA 3NO8A 3USUB 2PHXA 4I02A 5K4LA 4NVPA 2A71A 3WNLA 2RR13 3SNMA 5A3MA 4LBQA 3PIJA 1QOTA 1YIPA 3VBRB 5ACA2 1B09A 5IATA 1US2A 2ZGTA 1LGCA 1DZRA 1OKOA 3ME2A 2UWCA 4ZS3A 3S6PA 1XNAA 4YGBA 1W2TA 3AMMA 3Q8AA 3NV1A 1AR91 4KL1A 3RZZA 4B29A 4DS0A 4HXCA 1CAVB 3HOBA 2WBKA 4RA0A 1AR93 1OI6A 4BXSV 2PN5A 2FZ1A 1UX7A 3D82A 1GOHA 1O4TA 1QDCA 2RS53 4RS5C 4AF9A 2VMGA 4BMEA 1DGRN 2BTVC 3AYDA 1LJ7A 5AVPA 1W8ZA 5H9SA 5C6CA 3KGZA 4RSUA 2XQXA 1POV1 4KU8A 4XJAA 1E5HA 3H8RA 3LDRA 1J83A 1HW5A 2J22A 1YEWA 4N53B 1POV3 3W58A 2D5FA 1UYPA 3WNOA 2VMFA 1UOJA 1RTVA 2D6NA 3IIIA 2VZVA 5FZ1A 4P08A 1AX1A 4Q5OA 1XPWA 5IVYA 2Y6HA 3W21A 1Z78A 1Y9QA 2ZBJA 1O4YA 2F17A 2EXHA 2R061 3BODA 5T3NA 1FPN3 2RS32 2VW0A 2F4PA 3S57A 1SQ4A 3TB0A 4W8JA 1I6XA 2W1QA 3ITQA 3PUIA 1OOPC 4ZZ5A 4XIOA 4AI8A 5KHIA 1OQEA 5EWSA 5GZCA 1AR63 1LKNA 1W06A 1POQA 1POV0 5KHGA 1A8DA 5JAXA 4BJ0A 2QJVA 2ZAAA 4FI9A 4Z2AA 3GBFA 3AVSA 4NOTA 1UN1A 3GJBA 4ZHNA 2HWB2 5CVRA 2D40A 4FXGB 3NQHA 3TBDA 2BBVA 4P9IA 1XQNA 3J8F1 2UU8A 4IDZA 1LTEA 4P9JA 2IWGB 1VB4A 2Y60A 1H9WA 4FO9A 4R4XA 4DEQA 1H8TB 3RZHA 4RN5A 1Z7S3 1J3QA 2WZ8A 5FP9A 2ZZJA 3AMNA 4JV4A 2R49A 1VBD3 2VQTA 1X8EA 4HPKA 4IEQA 2OS2A 1W6NB 1XU2A 3C3VA 4IXLA 4YSFA 1N3QA 3MF9A 3NL1A 3LA2A 2BOIA 1JS9A 2QCSB 2L9LA 4LA3A 1AXZA 4XUPA 4AWDA 4CEYC 4CCMA 4EN7B 2XBO2 3I3EA 3SCHA 1UWWA 5FQ0A 3WP3A 4EJRA 1NCRC 2HYKA 4HONA 4XDPA 5LEKA 2NLRA 4YZ4A 3PTYA 3SITA 3S0MA 1PMHX 4H3WA 4GQ7A 3BI3A 5A80A 2JE8A 4CUGA 4FOWA 1VBC3 3CL1A 2VOTA 1GKBA 1FI2A 3MIBA 4I0BA 4CCEA 5FDBA 1JUHA 2VZQA 3WZ1A 1UOBA 3I59B 3W5MA 1MEC2 1R083 4OI4A 4H7LA 3OYWA 4LR4A 3J9SA 1MZ6A 1HX6A 5EXOA 3WUDA 1UIJA 4LBQD 1ZM1A 2C6SA 1JHNA 2GU9A 4XTPA 1DCSA 3VZLA 1H4GA 1O5LA 1UXXX 2OZ6A 3B9IA 3PDQA 1N47A 2D6KA 3GM8A 2BEOA 5I8TA 2E63A 2GMMA 2I07B 2ZHNA 4DXRA 1BMV2 5DAWA 5ERLA 3CJIC 3PVOA 2DBNA 3Q8CA 2Y6KA 1DQ0A 3AMQA 3VBOB 1X36A 3ZX7A 4IGPA 1V00A 2AH2A 2P34A 1JYWA 4JGYC 4TXWA 1G9FA 4PDWC 3R05A 1CWPA 4OHVA 4BLIA 1C8M3 4COWA 4OVEA 2OIIA 3O5SA 4W4ZA 1QJEA 2XB6C 1JODA 3FZ3A 3TNQA 4GALA 3O12A 2HWE3 1ZRIA 3HNMA 5A7PA 4IE4A 1UF2C 4M4RA 5LATA 1APNA 1LECA 4FXKB 4FTBA 3AFGA 2IVIB 4C90A 5CFCB 1ZBA2 4Q1PA 2EIDA 4MHRA 4BQWA 1BJQA 4AQ6A 1IOAA 1RHI1 1TMF2 2E7AA 4LMFA 4IGOA 3U4XA 1ND2A 2K46A 2QQJA 4KG0A 4ZZ8A 1IPSA 2D6OX 1X50A 4LTAA 4PF1A 3WQ0A 2XHKA 1YO8A 4IEUA 3URFA 4ES8A 2X09A 5FUNA 1HXS3 2Q8EA 3BN6A 2ZABA 3ELNA 4BQ4A 1JTZX 1LEDA 3CLPA 3JU9A 5EPAA 3VKMA 1ZRDA 3POIA 1QJY1 4BPZA 4Y22B 2QDRA 1PVXA 1QXRA 1OH3A 1ZZBA 3ZN4A 1Q8SA 2F6BA 2JG8B 5L9RA 3ZN6A 5F3CA 3H7YA 2AR6A 5T55A 3BU7A 1UQXA 1VLNA 2OT7A 2VNVA 4XBNA 4A7ZA 5BNOC 1ENXA 3AL6A 3P5BA 2VCBA 4IV3C 3N9NA 3WG3A 3FBYA 2JDYA 3AB0A 2WUHA 4Q0SA 4XPVA 4BQXA 3JQXA 4OQ8A 1VJ2A 3JD71 2BDRA 4BQYA 4EN0A 4YZ2A 4LT5A 3VDDA 3FHQA 1W8TA 5CEHA 1C8NA 2R32A 2XUEA 4AFMA 3RYRA 1PMJX 4PCRA 2AREA 1S0FA 2G19A 4CP2A 2RHPA 3CDZB 5L36A 3ACIA 1EAH2 2ADDA 2RJ2A 2WNUA 1H1AA 4WVWA 4ZY9A 4DY3A 1A34A 1M4WA 2NMNA 4RQPC 1E5IA 1T6GC 3PVEA 1G86A 4ZXEA 3U75A 4Q0VA 5KWRA 5IVVA 5F3EA 2ZOEB 4UT5A 5BNQA 1H1MA 3T3YA 4AFAA 2RS13 2IFRA 2O14A 3AKRA 5CBLA 1QHDA 3CMGA 1RVF3 4IV1C 2RDSA 1S0JA 5HBAA 3N4MA 3PJYA 4FQ4A 5CZKA 5FPXA 1K3IA 1F5FA 5DG1A 5JPNB 2R042 4GD4A 1OF3A 3AYEA 3PIGA 4XFHA 4O7XA 3SHRA 4CEWB 5E1RA 5L9VA 2QTWB 1XSRA 2CAUA 3KD4A 2A5ZA 3D3AA 1HV1A 4XE9A 3A0KA 5BY5A 3IDCB 1DBNA 5GLZA 2X5IB 1W39A 2DV9A 1GP6A 2VM9A 5EQUA 5FTTC 4KGGA 3DEMA 1QH6A 3VBHC 1LHOA 4XXAA 4XUOA 4YWAA 4C8DA 4CTEA 4JRLA 3I49A 2OW4A 5JXGA 4JQRA 1HRV1 2ZACA 1SCRA 2E7QA 1AYN1 2R062 3A7QA 4WM8C 3MO4A 3DXTA 2WN3A 1CZTA 4FTEA 1HRV3 2LTNA 1QQP1 3CNAA 4PQ9A 1E57A 1URXA 3VN4A 2BRTA 3I2FA 4CPBA 3CIHA 3ZOIA 3H1MA 4JTNA 3ST7A 5DAVA 5IWFA 4AOCA 4AK3A 4CYDA 3IDAA 1QWRA 1W3XA 3JQWA 3LFIA 2V4AA 5FZOB 4EWAA 1DYOA 3VD3A 4QB6A 4LOSA 1RUNA 4HVQA 3UK9A 5L19A 5CKNA 5LA0A 2R1BA 3RRDA 5E89A 1W0PA 4RS5B 3E6DA 1D4M2 2O8QA 2VNOA 3IDBB 1CAUB 1DQ2A 1FX5A 5CAZA 1VBA2 3IMMA 4TWTA 5GZFA 4COUA 3ZYIB 2Q8CA 1G9BA 1HDKA 1GFF2 3MDPA 1GZCA 2WT0A 5JR7B 4AL9A 3I2OA 1E5SA 1U5IA 1ZNPA 3LIHA 4IEWA 4CCCA 1OF4A 3KHCA 4YPJA 4MADA 1VBB3 2HYXA 1XC6A 4MYEA 2QKDA 4PLOA 1YUDA 3B3QE 5L7OC 2P6CA 4L8QA 3I54A 4UW4A 2OYZA 1VMJA 1Y9MA 1Q5OA 4DXTA 4YLZA 4IW3A 5FZMA 5FZ3A 4URTA 4RD7A 4E4HA 3MGUA 1PZ8A 1DP0A 1UY4A 5JI9A 4S2GA 3J7MA 1VBE3 4QQHA 5CG9A 1J58A 2QUOA 2Y6LA 3J4UH 4BM8A 3DPRC 3MICA 5J1XA 2ARXA 2ZGKA 3HJRA 4QKFA 2GC3A 2J1VA 3KVAA 4I01A 3ZVXA 2XH6A 3AKQA 1GP5A 1W6MA 2GC1A 2HJIA 1NKGA 1F31A 3NNGA 5AFEA 5C8CA 2Q1MA 3BTAA 4QB1A 5I0TA 5BNPA 4M0HA 4AEDA 2E53A 4FOYA 2V5DA 1VAKA 3O1UA 1DYKA 2QVSB 2BQPA 1GZWA 3VLBB 1W8FA 1W9SA 3OJBA 3RZLA 4M3CB 4C91A 4DB5A 5J7MA 2ZEYA 1K5MA 4OHWA 1OQ1A 4PQQA 1CD3G 1XNTA 1WCUA 4D7SA 1FXZA 2YC2A 5K0UC 3TN91 1UX6A 4WVVA 2VUDA 2JDKA 1BKZA 4KGQA 4CEYB 2VNRA 3VKLA 2AZ5A 3NNLA 2AEZA 3GF6A 5GLVA 4AI1A 2VBBA 4QX2A 3ENRA 3NKGA 1NCRB 4UFLA 5CFDA 3UKVA 4FOVA 5L73A 2AEYA 4BLJA 3NNFA 3OUIA 1C1LA 1HB1A 5EYXA 5JI7A 3CKHA 5T5PA 4EROA 4OHXA 1WMXA 5FYCA 5A6QA 2DF7A 3TOJA 3ZFEB 2JDMA 1CZVA 3OPWA 4GWNA 4INDA 1J1TA 2ZHKA 2WZPP 4B4QA 4BYYA 1SBFA 5BV6A 2DDUA 5IFTA 1JOJA 2D6PA 3EBRA 3JBG3 2E33A 3ZIWA 3KHBA 1IS5A 3LE0A 5C8WA 5EIYB 3AP5A 3J7LA 4RR3A 2VC9A 4CPBD 1MS1A 1VAMA 3OD0A 3THPA 3OUJA 3X29B 3FUQA 5BYNA 4ITCA 5HI0A 1HQNA 1XE7A 1QJY2 5A3NA 2LROA 4META 5FJKA 2WO7A 4Y5Z0 1H2KA 4XVHA 1FATA 2JE9A 5FZ9A 1XNDA 2BZDA 2EICA 1BMV1 3AK0A 3CEWA 1MZFA 2RMU1 1SBEA 2XONA 4L0PA 3U78A 2PXJA 4M00A 1IKPA 4AGGA 3VZMA 1LOAA 4JC1A 3VBRC 3I2DA 2XPJA 1QOSA 2OVUA 3GDBA 4ONUA 4RFRB 5GLUA 4Q4V1 1BBT2 4P9GA 2RDNA 2B5HA 4Q4V3 1PIV3 3ZMOA 4Y1UA 4G4FA 1GNHA 2A70A 2W0XA 2K2SA 2W1UA 2WZEA 3I8TA 1EV13 4FPFA 2YYOA 5FMBA 4ZU4A 5A3TA 3ZDVA 4ARXA 4AZZA 4NWVA 4PI2A 3ZFEA 5FBJA 3SCFA 2Z4FA 1AX0A 3PVBB 4A4AA 4BQ3A 5DUXA 3WF2A 4OUEA 3H8XA 3OBAA 2DU1A 2BP6A 4LEJA 2FDHA 5FYZA 3VL9A 4W65A 5A32A 3LIGA 4Q27A 4QHBA 3ETQA 3JUUA 4N53C 3RYPA 1TEIA 3SISA 4AHWA 1G9DA 1UMZA 3NVCA 1GV9A 2VG9A 2YZ4A 1V6IA 1UPIA 2DURA 5T50A 1NT0A 2R0FA 3D8CA 4MGQA 2XG3A 1JU3A 1RMU2 4CDUA 4NWWA 2D6MA 1RUF1 1W2NA 3J7NA 5FY9A 4N8MA 2D43A 3KGLA 3MIEA 3OBRA 4R9BA 4XW3A 1DG6A 5BNOB 5C3OA 3IZOA 1CAXB 3OUHA 1PO21 1RUE1 5LB6A 2DVBA 3E1F1 4IV3B 3FL7A 4Z07A 1CN1A 2E31A 2V5YA 2B9UA 3AYCA 3AZVA 5K7PA 3OGGA 4TN7A 1MQTA 5FYHA 5FZGA 1OUSA 2OQ7A 2WZR2 4OHZA 2V09A 3ZSKA 1VRH1 3MBWA 3UJOA 4YFWA 3ATGA 3JB8A 4QQ2A 4E27A 5IT6A 2X05A 5C7GA 1U5XA 2QQUA 1HRI1 3IB3A 1SACA 1RUJ2 2KXLA 4P9YA 1JZ5A 4MG2A 5FPZA 3KV9A 4N7IA 1QQP2 2Y33A 4XDOA 5I0RA 1MS5A 1RUI1 4NRMA 3ZYJB 3H1WA 5LBFA 4MXWB 4B1MA 1V6LA 1I5PA 1K45A 5F37A 3G6JB 5ACA3 5IVFA 4QX5A 1TME3 3WW4A 1QDOA 5CG8A 3IMNA 5AFBA 1GOGA 3KCYA 1DZQA 5FRAA 4IV1B 2GNTA 4NUBA 2O0OA 1TNFA 3ZYRA 1GICA 4FT8A 4I3PA 1NLQA 2HWD3 4P00B 4U2AA 5FY8A 4P14A 5EV7A 2BERA 1JMUB 2OQ6A 3SCGA 4J6GA 5C4WA 5FYUA 5IK5A 4QM8A 3WHTA 1CR7A 1KITA 2B45X 4QDRA 4CP9B 3WCSA 4L92A 4QKBA 4H7MA 1W6OA 1RYYA 2VCAA 3SKVA 5FZDA 3VBHB 3WF4A 3HQUA 2ZHLA 1ND2C 2CU5A 4LBMA 5FZ6A 1AXKA 2ET7A 3I3DA 4RHV1 1EYBA 4UFIA 5JIAA 3L2YA 1JOPA 1V6OA 4Q2FA 1FT9A 4RHV3 2FZ2A 3N9MA 3HBZA 4IE7A 4MGZE 5LWBA 1WCDJ 3VUOA 2CV6A 2DVAA 1CIYA 2WLPA 2GC2A 1SDDB 2WFF2 1QJX2 2WLQA 2WS91 1OT5A 1QU0A 4GWIA 2C0ZA 3VBOC 4AI0A 4COZA 1GQHA 2VECA 1XB9A 4IE0A 1WCKA 2H6BA 3MYXA 1HQLA 1S0EA 4CCLA 5DDJ2 2B9VA 3WW1A 1UD1A 1U12A 4UOJA 5FYTA 1NCQA 4O9EA 5JSPA 3KV4A 1N3PA 3LAGA 4BOWA 3KCXA 5FOBB 3HWJA 3I2JA 3MFCA 3ZYBA 4AAPA 2GMEA 4FPEA 4XETA 5F7UA 3GGLA 4ORFA 3VDDC 4JX0A 5KC5A 1AYM1 1PVC2 1SFYA 3HNBM 2A7AA 2VH9A 5DAQA 1IG0A 3AP9A 2R072 2EVXA 1AUYA 2RJLA 4DPNA 3R0RA 2WNUC 2UWAA 5LBCA 4EN9B 1N1VA 1GNYA 1RUC1 3I97A 1O3TA 1IGOA 3B01A 2XBO3 3FE5A 2YFZA 3SLIA 4DUWA 3IPVB 3S30A 4HMZA 3LB9A 4NHXA 1VALA 4XAAA 3SQOA 1X7NA 3HN1A 1XYOA 1JBCA 1JW6A 2XLGA 3F95A 2ZHMA 4QAWA 1S2KA 3DPRB 5F5CA 2Q5TA 3P6BA 5F8PA 4D69A 1BVP1 1ZZ6A 1JZ3A 5KXCA 5A6XA 1WUVA 2RM23 3AKTA 4AVTA 3UGFA 2SLIA 4OCTA 4LHLA 4LO8A 3NKTA 1WWYA 2JG9A 4HANA 4XYXA 3VB9A 2ZX3A 1W3VA 3WF0A 2O8OA 1O4ZA 1RUD2 4XUNA 4R4ZA 2VUJA 1JI6A 2D6LX 5KHHA 1MS0A 5JXHA 3KT7A 2WC2A 5LBEA 4KWUA 5HV0A 4QMAA 3VHOA 2W68A 2NP0A 2D97A 3RI9A 1OD3A 2VZOA 3PUSA 2B42B 3ROUA 5G04L 2I45A 2CYFA 2WA3A 5I91A 3O1PA 3UV9A 4HT1T 4UYBA 2VTXJ 5FZHA 1BQPA 2RMU2 5SV8A 1AR81 1VB2A 4IQPA 2VXRA 4LBQB 3MZHA 1IZ3A 3MLJA 1X9TA 5JWPA 3EYPA 3IM0A 4WBBA 1SDWA 4K9SA 3WQ7A 4XACA 2DCTA 4Q4X2 1L7LA 4EYUA 3O1SA 4YRDA 2VZRA 4D94A 3IAPA 3Q8FA 5FV3A 3NSTA 1QNYA 3RFRA 2P17A 4YVSA 3P3PA 4XJWA 2ZTNA 2VBDA 1N3OA 2XJPA 4NRPA 4B1LA 1R1A1 1ZBA3 4LBJA 4PLMA 4WVMA 2EXKA 4QX8A 2QQMA 2HEVF 2D3SA 2PHWA 1TMF3 4ZU7A 1PO12 4UI9L 4Y24A 3GHNA 1NAEA 1W04A 2PHTA 1NY71 2QFEA 5CNAA 4Y1YA 2E9QA 3U14A 2QDNA 1XE0A 2ZEZA 3NJYA 4HK8A 5AC91 4UFMA 3I2HA 1LENA 2WYFA 4IERA 2DFCA 2W9XA 4IUGA 3VGIA 1HLCA 3EJKA 4LK6A 3T0BA 3C8XA 4AEMA 2VQAA 3MIFA 5FXXA 2YBSA 2PHUA 4Q0UA 5FAXA 1W03A 1K12A 1RUF2 3WSOA 3HD8B 1BLZA 3Q8EA 5B4NA 4QHOA 4HN0A 5FZ8A 3NMBA 3WX5A 3HR9A 3RZGA 3MUY1 1CX4A 5FBZA 3T08A 1ZBE2 4KNCA 2ZGNA 3L9JT 1Q8OA 1EPZA 5I0DA 2EAKA 3FFZA 1NUKA 3UT0A 3N9PA 1US3A 1ULEA 5FLIA 2ZA9A 1X9PA 2ZGLA 4BDVB 5C8CC 2OPWA 2RS51 5BNPC 1O3QA 1ZZ9A 4AEDC 2J1AA 5IAXA 1YLLA 1LHWA 4H55A 1X82A 3VD7A 3N9QA 1ZA4A 4LQRA 3O0XA 2JKXA 1UNBA 1EAH3 1EY2A 1UY3A 1RUI2 2G1MA 4CP0A 1UO9A 4Q4Y3 2YU2A 1W8HA 2I74A 2VXJA 4HPKB 3VD5A 1K5MC 1LNSA 1NXD1 1W2AX 4FVVA 4LO5B 2FDJA 3BYWA 1AZDA 1JZ4A 4N43A 3VDAA 4B7KA 5E88A 5A7WA 1FPN1 1OMIA 5ISLA 3OB8A 4IGQA 1FMD3 3IKWA 4LK7A 5FQ0B 4AE2A 1RXGA 1NX9A 1U5YA 4IETA 3T0DA 1G6NA 3PUHA 1UMIA 1WLWA 1SLLA 1AR61 2CGNA 1IS6A 5FP8A 2R043 4N7UA 2IXJA 2PLV1 1LEMA 2RG4A 2FDGA 1MPXA 4D6QA 1LOFA 2PLV3 3SEEA 5SV5A 3RSJA 3WNMA 4DFSA 1JYXA 4CU6A 3F2ZA 1RC6A 1QY4A 2J42A 4JQTA 1WKYA 1Y4WA 1YQ5A 3VD9A 4AAXA 3BB6A 2VE1A 3OYWB 3C2UA 4Y20A 1CAWA 1Z7S1 2BNOA 2HKXA 3MLKA 4DINB 5FZCA 3H3ZA 5DZFA 3ZSEA 4SLIA 2FD8A 2XWBB 1VBD1 3AMHA 2YDEA 5FPLA 1G9AA 3V0BA 1WMFA 3AXDA 1A6CA 2LRPA 1GZTA 1W9WA 3JXSA 1UY2A 3WG4A 4NJ4A 3WVJA 4RL7A 1BEV1 4HL0A 3NNJA 2W95A 3ILNA 3SXWA 1XOYA 1HJFA 4KH9A 1BEV3 5A3UA 5C9AA 4FPJA 2C1FA 3THCA 2FQPA 2RV9A 3WDVA 3WNNA 1GZ9A 3M7AA 4XFCA 1F35A 1V70A 1KXGA 1W9TA 4FFFA 3ZFGA 4QX7A 2YV8A 5FXZA 3AP4A 3CU7A 1COV2 4ARYA 4K20A 3EHKA 2JEMA 2FCVA 3POWA 1UAIA 1VBC1 4F7ZA 3K51A 3PUQA 3E5QA 1VBA3 3GZAA 2DWRA 1MVQA 1AYM2 4XJ9A 4YGDA 2YG0A 5EP9A 5FKCA 4QXBA 3ZFEC 4Q4W2 1LGNA 4LITA 5C3RA 1R081 4W6YA 3TEXA 5KC6A 1ND2B 2VOWA 1RUC2 4AQTA 3NW4A 5DZGA 2BGOA 4X6QB 4E2QA 2VGDA 1YXWA 5IVEA 1O91A 4OI2A 4LBOA 2X10A 4TSVA 2X53S 1MR5A 1VIWB 4NIAA 4CCDA 3H1YA 2IVJA 3OPZA 5I8YA 4XUTA 3T2PA 1C5HA 4YW3A 3WT3A 1WCQA 1RL3A 3OG2A 4WZFA 1ENQA 1UYYA 4LUKA 3ZN6B 4CDUC 3D0SA 4KMQA 4L99A 1UU5A 1RUG3 2ARAA 1C8M1 2TUNA 4CUCA 3VBSA 4LORA 1KDKA 2HWE1 4NO4A 4YW1A 5DUWA 4N9HA 3TWIA 1MQTC 4MUVA 4CXYA 1LOEA 4AQ2A 3OY8A 3VDDB 1LESA 1X8MA 4DOUA 4LO7A 3LPGA 4M4PA 4PIYA 2XJVA 1SEFA 5LY2A 5CU1A 3H3LA 3WNXA 5FZLA 1LULA 3N9OA 1HB4A 3EQEA 2WNUB 2PQQA 2GMPA 3I3MA 3NV2A 1QXJA 4KQ7A 4QQLA 4FOQA 4OMDA 4I2OA 1HXS1 4LULA 1ZA7A 4YW5A 2W3JA 4DXZA 4GMP3 1DLLA 3TRSB 5JOYA 1HN0A 3MI8A 4EE2A 2VCCA 4LNVA 3UKNA 2VO5A 4A6SA 2C9AA 2JJ6A 1B35A 1A3KA 1VPHA 2BWAA 1DQ1A 4HOOA 4UXAA 1AL22 2WAOA 3N7MA 4FPKA 2VMIA 1ODMA 1YFUA 1XJAA 1WGPA 2IXKA 1QJU1 3ZYHA 4NE9A 1I3HA 1BHGA 1Y7BA 2MEV2 2HEYF 2ZGMA 3IT8A 1V9U2 3K77A 1JYIA 1H30A 1QJU3 5C4WC 5IAVA 4HG6B 2WRAA 3K2OA 2LUWA 4YG6A 4BB3A 1XNKA 3B02A 3M3IA 1ASJ1 3WW3A 4E8CA 5KXBA 5JLVA 3BCWA 2QE3A 5AC92 1WA4A 2CGPA 4UBHA 1ASJ3 3ZPYA 3AKSA 4WM7A 1YJLA 2J1EA 4HZFA 1LU1A 1O8SA 1JOBA 2RR12 3VL8A 2VZ3A 2XJSA 4C1XA 4FPLA 3GCWA 3WEZA 2DCZA 2GDFA 3KZ4C 2RS11 1WLDA 5H9RA 3ZO0B 5ABJA 4FPCA 5J37A 1WLCA 5B4XA 1C3HA 3FN9A 5F1RA 5JDBA 5EJ3A 3A0NA 2BJSA 1RVF1 1WZXA 1MS3A 3VKOA 1ZYBA 4FFGA 3FLPA 3WY6A 1AR92 3BTZA 4TLGA 5C5TA 2E7TA 3WOGA 1DGWA 2UYBA 3C7GA 1F15A 2X29A 3O1VA 4LKSA 2XKPA 1D2QA 1NCQC 3QACA 4BK4A 3W5NA 5FK7A 3OGJA 1PM7A 3ZM8A 1OQDA 3VHRA 4JTOA 1KD7A 5LRRA 5A6YA 5A7NA 4FP3A 4ISQA 5A3OA 4ES9A 3BKZA 3K48A 1XRUA 3VBUA 1YQ2A 4XEZA 5FMOL 2XOMA 2J1TA 1T6BX 2V4VA 3N7LA 3THDA 2Y34A 4QXKA 3ZYFA 4A3ZA 2QQVA 4X8NA 2HEWF 2W2IA 2HWC3 3N9LA 1C5IA 1KQRA 4B3NA 1RUOA 2W52A 3RPQA 2ZCWA 4HLTA 3TAYA 3CQOA 1MS9A 2EIBA 1G7YA 2CAVA 1PK6A 1RMU3 4HFSA 5A33A 3H8OA 3MEPA 4HVOA 1AR62 1S0IA 1V6JA 4CDXB 3VBFA 4HBNA 5BXXA 1U0AA 2YU1A 2YY1A 3GYDA 3ZXLA 4QX0A 4Y1ZA 1FOD3 2E26A 1VR3A 1SFNA 1W6MB 2ADEA 2EF6A 2WZR3 2Y26A 2P5BA 3APBA 3ASIA 4MHUA 4FAGA 3ZXGA 2JG9C 2LS6A 3OEBA 5C8CB 3J8F2 5BNPB 4AEDB 4AEJA 3ETPA 1NXMA 1Z7S2 4IEVA 1GZWB 3HPNA 4GKXA 4U36A 2TEPA 1RUJ3 1XYPA 4XHBA 4DIQA 1VBD2 3QBQA 5A6ZA 2D3RA 3B9CA 3ILRA 4XFBA 5JSRA 2GNDA 4XMAA 5F3IA 3ACLA 5FZBA 4F8AA 1K5MB 3M3QA 4JRAA 1VBB1 4QPWA 4AEKA 3E5XA 1O6UA 1SG3A 2PHDA 2BNMA 1PGL1 5A70A 4LA2A 3J26N 1W9FA 4GH4B 1MS8A 2XVKA 2Q8OA 2QQLA 5FP7A 2VTXA 5CA6A 1R093 5FPUA 3NJXA 1VBE1 4KWJA 4QU2A 5FWEA 5FYBA 5CFDB 3HAGA 2DUQA 3RMYA 5K9YA 3SKJE 3O1OA 1YFYA 3I3BA 4ZXKA 4M3CF 5C3QA 1IKQA 1QH7A 1S2BA 1VBC2 4NN0A 4Q26A 4YVSC 3VZKA 4LPLA 4CDXA 1PMIA 5K8SA 4QT6A 3MHZA 5FLJA 2DBIA 4HKLA 4MX3A 5FMOS 2Z2SB 4A2UA 5FY0A 4LKDA 3RZMA 4YM3A 3RZKA 1NOVA 1PGW1 1R082 3WCRA 1OA3A 4COVA 4YGCA 4BIFA 3U11A 4AI3A 5DMYA 4OZXA 2YGLA 1Q56A 4EN6B 2ZGUA 1W8UA 1RUH3 4RR3B 1SMVA 1PM4A 3H8UA 1MS4A 3LA7A 3ZIXA 1LB2A 4QPIA 4NHMA 4AHYA 5LRSA 4UW5A 2EAAA 1S55A 1W0OA 2ZMLA 3ABZA 1CJPA 1W8NA 2VMHA 4JAAA 2BBAA 4Y1XA 5CISA 3BOWA 1IG3A 4CUAA 4A45A 1Q8VA 3RYKA 1V6KA 4NHKA 5E8AA 1SCSA 1N1YA 2WFF3 4GH4A 5GZDA 2ZJCA 1QJX3 1RJ7A 4QDQA 1C8M2 2GP3A 3MIGA 1GUIA 3FJSA 2FDIA 3ON7A 1HKDA 5DXDA 1N1TA 4NPLA 1GWLA 1P8JA 1WD3A 1JH5A 3AVRA 5DDJ3 4YVWA 5F32A 2YROA 1YFXA 5HCHA 2B39A 2NMOA 2ENRA 4XJ8A 1UW8A 2VULA 3N36A 4AHXA 1ZRCA 3LF7A 4JKMA 4CCNA 5H9QA 3T4VA 3O7OA 1OFNA 1FV3A 1QGLA 2N7GA 2VOKA 2XHNA 1RHI2 3JBG1 2LALA 1JYTA 4ZPIA 2R073 3QLQA 4R8HA 1O8PA 1CPNA 5A32B 1HXS2 1NA1A 2VOXA 3ES4A 5JXJA 4AHZA 4OMCA 1WW4A 3LA3A 5FO9B 4DMIA 1NG0A 3GZEA 3MLLA 4JHZA 2UWBA 2VBPA 4QM9A 3I4IA 2P3JA 1SZBA 4N43C 3BIEA 1CVNA 1KDMA 2R6QA 1BK0A 2OUJA 4GB31 4AVVA 1YJKA 3BU0A 2SBAA 4W6XA 2Z5WA 1C28A 4P5YA 4B8EA 4CDUB 4GB33 1W6PA 2DCYA 1XE8A 2PQSA 2ZX1A 2GNBA 4NIHA 2KD7A 4JKLA 5EFUA 1AXYA 3E97A 2ZPXA 2HWF1 4TLFA 4YW2A 2YC0A 4C0HA 2WNVA 1OC1A 2HWF3 3SMHA 1PIV1 1Z0HA 4A7KA 2LM3A 1MQTB 4ATEA 3NJVA 4QQOA 4P9LA 1WD4A 2JECA 1EV11 3JD72 5D21A 1NLSA 4K1YA 1LODA 3ALQA 3AMPA 1S2EA 2QQOA 2VPVA 4UW6A 4XF3A 1SLCA 3A23A 4HN1A 2GALA 4KI5M 3FMGA 5JZGB 2MNGA 2WNEA 3UESA 4G3YC 3IDEA 5KHKA 4A42A 1SLBA 4S2FA 3O1MA 3ZXJA 2CHHA 3VZNA 2JDZA 1ZRFA 5J36A 3OSDA 1LHUA 4BQ5A 2I2SA 5CIRA 3RWNA 3U4SA 4CU8A 3WINE 2ID4A 1RVF2 4LO6B 1OURA 4Q4X3 5F6LB 3M70A 3IIAA 4XBLA 5C9AC 3KF3A 4Q0QA 1VMHA 2J1UA 1N1SA 5FY5A 2JXAA 1OPMA 2R16A 4K6BA 5FUIA 4O65A 5DPNA 5FY7A 3ZFGC 5F2WA 1W28A 5T5JA 3DKQA 2Z79A 2JWPA 1HQWA 1IHMA 5C4WB 2A3YA 1AR73 2YHJA 1CIWA 3HT2A 1PO13 1TE1B 1QF3A 5A3WA 1W6OB 3I2GA 4AW7A 5ANNA 3HQRA 4EQVA 2WO1A 4Q29A 3OGVA 2VOVA 4R9DA 2V73A 1K5JA 2K0GA 1SLIA 4I30A 4I0AA 4J25A 1HRV2 3C7HA 5JZGA 1UCXA 1AYN2 2RDQA 4UW3A 3POJA 4ZONA 1DF0A 2A1XA 4EWEA 2DU0A 2OA2A 3I3QA 4PDWA 3VDCA 4EN8B 5EZWA 4Q1RA 5ACA1 1TME1 2VZPA 2WSUA 3BOPA 3I2IA 4OI1A 4L9BA 1ZBE3 3USSA 3FLRA 4YNIA 4UF0A 2BWCA 2DFBA 1UOGA 4LHSA 3WDYA 2QQPA 1BYHA 3T2QA 2P3YA 5IW0A 2JIJA 4BK5A 5BUVA 2BOJA 4HK9A 4IEPA 2HWD1 3VBSC 5C3PA 4MLOA 5FOJB 3H9AA 1NCQB 1ENRA 1FNZA 3GZUC 4XF4A 1J59A 2AUYA 3GJAA 3PU3A 1O3SA 4HSJA 2D7FA 1C4RA 2D98A 5EJ1B 4IEYA 2ZXQA 4JVAA 1QOOA 2VUAA 4ET7A 5FZKA 4MO3M 3U1XA 4FTSA 5GLTA 5LA1A 4AXOA 2W47A 4PIZA 4CCOA 1D2SA 1OUXA 4F3JA 2Q30A 3WLUA 3U0ZA 3HMYA 2A6XA 2A73B 2WINB 3UYJA 1QJFA 2VVEA 3KT1A 2RS31 5FP3A 3IBMA 1JU4A 1L7RA 1VBE2 2RS33 2ARBA 4LE4A 3ZN5A 5B2GB 4E2SA 3LDKA 2R1DA 1B35C 3NRUA 4QKDA 4V2VA 2GH2A 3S5QA 2R7EB 4BH9A 2OPKA 4WV8A 3ACFA 2Y6JA 5GALA 2JE7A 1YQ6A 3FX3A 4XF1A 2XLAA 2FDKA 2HWB1 4XQWA 2JG9B 5JMOA 1UKGA 4XFIA 2HWB3 5F6KA 2Q1ZB 3IAQA 1KFXL 4PBOA 2DCKA 2W94A 5IK8A 2VY0A 1UY0A 4RQPA 2WQ4A 4IL7A 4JHTA 4AVAA 3LEMA 3QH7A 4WM7C 3OOXA 5FY4A 3TN92 2FDFA 3FUOA 3WP6A 2UY8A 1MACA 4XAEA 2XBO1 2EA7A 3M3CA 3RQ0A 3UGGA 1RB8G 3KM5A 1ST8A 4FPYA 1GSLA 2VU9A 4Z82A 3WF1A 1DIWA 5ABJC 4D7YA 3PJQA 4QGLA 4LBNA 1DGLA 2TNFA 5IJRA 1AJKA 4QGMA 1COV3 4UFKA 1S0BA 4Z2WA 1DQ5A 4BMBA 1H4HA 1S4CA 2BVBA 3WDUA 2RM21 3MIDA 4YVSB 1OHFA 3POGA 2A3XA 3RJRA 5HPOA 1KJLA 1Y43B 1CPMA 3NAPB 5F9TA 4HKWA 3MFAA 1BVVA 1I9RA 4K8FA 5A7SA 2JIGA 3D5OA 4WVMB 1X33A 5JR2A 1LU2A 3CO2A 2VVFA 5CKMA 3WDXA 2JX9A 2IXHA 2J7MA 1UYXA 4Q4W3 1OVPA 2WJSA 3LDBA 3N35A 4B4RA 2CWSA 2H0VA 4N90A 1MEC3 2BW8A 3VBUC 4IESA 1OH4A 2FHRA 4AGRA 1UZWA 5DQ0A 2ZGSA 3WV6A 4KBZA 4UWDA 5E16A 3DECA 3ILFA 1SPPA 1YQ8A 2BU9A 5J96B 4NROA 2BUKA 5FZ7A 2DTWA 2YBPA 5IFPA 3ZMNA 3AFKA 3AP7A 4K1ZA 4UFJA 3B94A 4QX1A 4XURA 5DUUA 3ZYGA 1PK6C 4FSJA 4Y3OA 2FCTA 2VQUA 4DNYA 5BNNA 2VVDA 4J1WA 3H7JA 4YG0A 3TEYA 1LHVA 1W90A 1UZ0A 4D8MA 2O1QA 2XLFA 3VBFC 4NRQA 1U5ZA 4Q4V2 1RXFA 3OF1A 2W1WA 5LA9A 5D8AA 4WZCA 3PNAA 2WQZC 3LD8A 1JZ8A 1YFWA 3NAPA 1ZBA1 1F4HA 1DQ4A 3KLSA 4HVRA 3HEIA 1TMF1 4NMIA 1ODNA 1TVGA 2PMWB 2C24A 4A6OA 1UXZA 2E32A 3V0AA 2FBEA 1JUIA 4MGTA 1R1ZA 4A3XA 3T09A 2ZMNA 2YPDA 4XF0A 2P3IA 3BPSA 4N43B 5A3LA 2GSYA 3T1LA 4DEVA 2YGMA 2WWSA 2P3KA 5A7WB 1ZZ7A 3QCWA 3T4HB 2DCJA 2A3WA 2QQIA 2NN8A 5C33A 1JN2P 1AL23 2D44A 3I7DA 2JDNA 4YM1A 4JGZB 1DYPA 2VR4A 1ND3A 5IVCA 2VMDA 1S1AA 3HNYM 4BXFA 4HKOA 3MW2A 5J98B 4I3GA 1IQDC 1H8VA 4QQPA 3AX4A 1W99A 1DGWX 2FMYA 3LPFA 1FV2A 1PO22 1RUE2 2GN3A 5GZEA 3DV8A 5F39A 4GZ9A 4CDXC 1V9U3 5FR3A 2QZ2A 1JZ7A 1OLQA 2ZGQA 4Y33A 3VDBA 1GQPA 2C5DA 5FKBA 3OGSA 1VRH2 1LOCA 2NZ9A 5DAPA 3MPBA 1PZ9A 4YW4A 3MW4A 2VMEA 5FZ4A 5T52A 2VW2A 3DGTA 4Y20B 3DYPA 1CAWB 2Y6GA 3UL2A 2CL2A 3U37A 1HRI2 1S0DA 3W59A 1EAH1 1R64A 3K3OA 1CESA 4FPOB 5JMCA 1Q3EA 1W6QA 5FK8A 4Q4Y1 3V0BB 4QPIC 4PJYA 2MHFA 1OLME 3K46A 5FYYA 1D0HA 3W20A 1KGYA 1TME2 3ZR6A 4OFGA 1JYVA 1FNYA 5A3PA 4BIOA 4OYUA 1W2UA 1FMD1 1PNFA 2ORZA 3B7MA 5C9AB 4GH4C 1LOGA 4PHZA 4XHXA 4YZ1A 1LCLA 2H0BA 2UURA 4JCKA 1VP6A 3PMEA 1PGSA 4JGZA 4XFAA 2XQRA 5FO7B 1C57A 1NYWA 2HWD2 3ZFGB 4AI2A 5JOXA 2R041 2WWJA 3KT4A 1IPJA 4YVWC 2ZX0A 5FYSA 4DQAA 5CFDC 5HCBA 1SFPA 1H1IA 2H6CA 1PX3A 5FMCA 4ISRA 2G9FA 2DTYA 2C9KA 5FPBA 1H6XA 3IN9A 4CDQA 5HCFA 4B4PA 4N9IA 1W9YA
chains in the Genus database with same CATH topology
2E33A 5B4XA 3FN9A 4CU9A 3LE0A 4MGSA 5EIYB 1L7QA 2VC9A 4QDSA 2YFUA 5IYYA 3C7GA 4TTGA 4LKSA 4XVHA 4XUQA 4BK4A 3W5NA 2BZDA 2EICA 2XONA 1ULOA 4L0PA 1YQ2A 2XOMA 2J1TA 2V4VA 3GDBA 3THDA 2WO3A 4A3ZA 4A44A 2WZEA 2W1UA 3CQOA 2EIBA 2VTFA 2JD9A 4ARXA 2Z4FA 1JZ2A 4A4AA 3WF2A 3K75B 4OUEA 3OBAA 3LEKA 2CDOA 5LCWL 3ECQA 4QX0A 4DXSA 2E26A 5C70A 2Y64A 1W0NA 1UYZA 2LS6A 3OEBA 4MGQA 4MOAA 2LW8A 3ETPA 1JU3A 3HPNA 2C26A 2WN2A 1DLCA 2VZSA 3E1F1 4QPWA 3FL7A 1SG3A 2E31A 5JUVA 3WF3A 3T2OA 3UETA 3MBWA 2QQLA 4P02B 3NJXA 2X05A 5C7GA 1JZ5A 3IB3A 1JYNA 3SKJE 3I3BA 4LPLA 1KEXA 3BGAA 1I5PA 1K45A 5C71A 1TG7A 3CZJA 3FHAA 2VL4A 1GOGA 3EB7A 1JHJA 5DMYA 3VD4A 2VZTA 3K4AA 2W87A 3MUZ1 3I2KA 4P00B 3ABZA 1W8NA 2BERA 1EUUA 2BBAA 4CUAA 4A45A 4QDRA 3WNLA 2C4XA 5EJZB 3SKVA 3WF4A 1RYYA 1US2A 2VCAA 4QDQA 2YB7A 1T2XA 1GUIA 1XNAA 1P8JA 4CU7A 3HOBA 2WBKA 3I3DA 1ULPA 3LEIA 4BXSV 1UX7A 5JXIA 1GOHA 4JKMA 2J1SA 1CIYA 3DYMA 2XQXA 1SDDB 3DYOA 2XHNA 1J83A 1OT5A 2J22A 4GWIA 1O8PA 3WNOA 5JXJA 2VMFA 1SHWB 3IIIA 2VZVA 4OMCA 2ORXA 3C7OA 2Y8KA 2B9VA 4P08A 1XPWA 2Y6HA 4UOJA 4JHZA 2WABA 2JDAA 2EIEA 3I2JA 4W8JA 2W1QA 5F7UA 2CDPA 3GGLA 3PUIA 4P5YA 4ZZ5A 4JX0A 2PQSA 5HXMA 3HNBM 3MV01 1UY1A 2HLEA 2KD7A 4JKLA 4BJ0A 4FI9A 4Z2AA 1GNYA 3I97A 3NQHA 3C7EA 2YFZA 3NJVA 4DUWA 2QQOA 4DEQA 3A23A 4KI5M 4RN5A 5JXHA 2WZ8A 4QAWA 3P6BA 1JZ3A 3UESA 2VQTA 2W92A 4A42A 2L9LA 4XUPA 3WF0A 3I3EA 4XUNA 2VZ1A 3ACGA 1UWWA 4CU8A 1JI6A 2ID4A 2B4KA 4KWUA 2ZEWA 4JKKA 2J1UA 1PX4A 1OD3A 2VZOA 5DN2A 5FUIA 5G04L 5DPNA 1PMHX 2JE8A 1CZSA 4DUXA 2WDBA 2W1SA 2VOTA 2VZQA 4D0QA 3EYPA 3W5MA 3I2GA 2WO1A 3OGVA 2QQNA 2VZRA 3IAPA 3OEAA 4CVUA 1UXXX 3C7HA 3GM8A 4DXRA 2OKXA 1H6YA 3VDCA 2VMCA 4PT6A 2Y6KA 1JYWA 2QQMA 2VZPA 4TXWA 3I2IA 4UAPA 4UI9L 3CZUA 1NAEA 3GXUA 4LHSA 4W4ZA 4XZUG 3C7FA 3MV11 2ZEZA 3T2QA 4BK5A 5IFTA 3I2HA 4IUGA 2W9XA 3HNMA 1D7PM 3T0BA 3WNKA 4M4RA 3C8XA 1J84A 3WSOA 1K12A 5B4NA 2WYSA 2EIDA 5EJ1B 2ZXQA 3MUY1 4ET7A 4MO3M 3T08A 5LA1A 2QQJA 2W47A 4ZZ8A 2WO2A 4PF1A 1O59A 5I0DA 2X09A 1NUKA 3BN6A 4CUBA 1US3A 2WAAA 4BDVB 1JU4A 1L7RA 2J1AA 2VJXA 3NRUA 3VD7A 4LQRA 2R7EB 2W46A 2JKXA 1UY3A 3ACFA 2Y6JA 1W8OA 3VD5A 2VCBA 2WQ8A 1LNSA 1CX1A 1JZ4A 3VDAA 5JMOA 2WUHA 3OB8A 3IAQA 3FHQA 1GOFA 2DCKA 2W94A 1NX9A 3AC0A 3T0DA 3OGRA 1UY0A 3PUHA 1PMJX 1UMIA 4A41A 3CDZB 3ACIA 2RJ2A 3K4DA 4ZY9A 2VZUA 1MPXA 4ZXEA 3SEEA 1JYXA 2YC4A 3WNMA 4CU6A 3F2ZA 2W91A 1JZ6A 1GMMA 1WKYA 3WF1A 3VD9A 4AAXA 3CMGA 4OZOA 5IJRA 5CZKA 1K3IA 5CYYA 3WNPA 5HPOA 1OF3A 1W9WA 3JXSA 1UY2A 2BGPA 1HN1A 3D3AA 3J7HA 2W95A 5JR2A 3UNPA 2VM9A 2J7MA 1UYXA 3WNNA 3THCA 2RV9A 4XUOA 3T0AA 4E8DA 1OH4A 1W9TA 4AG4A 4ARYA 5JXGA 5DQ0A 3LQCA 3A7QA 3DECA 3MO4A 2WN3A 1CZTA 5IFPA 3A22A 3I2FA 3K4ZA 3CIHA 4QX3A 4QX1A 4XURA 2YG0A 2VQUA 5A1AA 3IDAA 1GU3A 1UZ0A 4D8MA 1DYOA 3VD3A 3A21A 4QB6A 2BGOA 5LA0A 2W1WA 2X10A 3P1IA 1F4AA 1EUTA 1JZ8A 4XUTA 3T2PA 1WCQA 1F4HA 3HEIA 3OG2A 1UYYA 1TVGA 4A6OA 4DUVA 4KMQA 1UXZA 2E32A 2ZEXA 1OF4A 4YPJA 2V72A 4CUCA 4MADA 3T09A 2HYXA 1XC6A 5LA2A 4DEVA 4DXTA 5G05L 2DCJA 2QQIA 4W50A 1DP0A 1UY4A 2VR4A 3LPGA 4M4PA 2Y6LA 3ZM8A 2VMDA 3HNYM 4QB2A 5J1XA 1IQDC 3HJRA 2W5FA 1W99A 2J1VA 3LPFA 2RVAA 1K42A 4OMDA 4GZ9A 2J1RA 2W3JA 1JZ7A 1NKGA 3NNGA 4QB1A 3VDBA 1GQPA 2VCCA 2QQKA 2V5DA 2VO5A 3HN3A 3OGSA 1W9SA 4RYDA 2WAOA 2VMEA 3SEPA 3DYPA 2Y6GA 3WQBA 2ZEYA 3U37A 1R64A 4PQQA 1XNTA 2YC2A 3K46A 1BHGA 3ACHA 1UMHA 3K77A 1KGYA 1JYVA 4HG6B 4GWJA 4OYUA 4QX2A 2ORZA 3LEGA 4E8CA 5IHRA 2J1EA 1O8SA 3CKHA 1PX3A 2VZ3A 1CZVA 2C9KA 1H6XA 2QBXA 2DDUA 3WEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E33 A;  5B4X A;  3FN9 A;  4CU9 A;  3LE0 A;  4MGS A;  5EIY B;  1L7Q A;  2VC9 A;  4QDS A;  2YFU A;  5IYY A;  3C7G A;  4TTG A;  4LKS A;  4XVH A;  4XUQ A;  4BK4 A;  3W5N A;  2BZD A;  2EIC A;  2XON A;  1ULO A;  4L0P A;  1YQ2 A;  2XOM A;  2J1T A;  2V4V A;  3GDB A;  3THD A;  2WO3 A;  4A3Z A;  4A44 A;  2WZE A;  2W1U A;  3CQO A;  2EIB A;  2VTF A;  2JD9 A;  4ARX A;  2Z4F A;  1JZ2 A;  4A4A A;  3WF2 A;  3K75 B;  4OUE A;  3OBA A;  3LEK A;  2CDO A;  5LCW L;  3ECQ A;  4QX0 A;  4DXS A;  2E26 A;  5C70 A;  2Y64 A;  1W0N A;  1UYZ A;  2LS6 A;  3OEB A;  4MGQ A;  4MOA A;  2LW8 A;  3ETP A;  1JU3 A;  3HPN A;  2C26 A;  2WN2 A;  1DLC A;  2VZS A;  3E1F 1;  4QPW A;  3FL7 A;  1SG3 A;  2E31 A;  5JUV A;  3WF3 A;  3T2O A;  3UET A;  3MBW A;  2QQL A;  4P02 B;  3NJX A;  2X05 A;  5C7G A;  1JZ5 A;  3IB3 A;  1JYN A;  3SKJ E;  3I3B A;  4LPL A;  1KEX A;  3BGA A;  1I5P A;  1K45 A;  5C71 A;  1TG7 A;  3CZJ A;  3FHA A;  2VL4 A;  1GOG A;  3EB7 A;  1JHJ A;  5DMY A;  3VD4 A;  2VZT A;  3K4A A;  2W87 A;  3MUZ 1;  3I2K A;  4P00 B;  3ABZ A;  1W8N A;  2BER A;  1EUU A;  2BBA A;  4CUA A;  4A45 A;  4QDR A;  3WNL A;  2C4X A;  5EJZ B;  3SKV A;  3WF4 A;  1RYY A;  1US2 A;  2VCA A;  4QDQ A;  2YB7 A;  1T2X A;  1GUI A;  1XNA A;  1P8J A;  4CU7 A;  3HOB A;  2WBK A;  3I3D A;  1ULP A;  3LEI A;  4BXS V;  1UX7 A;  5JXI A;  1GOH A;  4JKM A;  2J1S A;  1CIY A;  3DYM A;  2XQX A;  1SDD B;  3DYO A;  2XHN A;  1J83 A;  1OT5 A;  2J22 A;  4GWI A;  1O8P A;  3WNO A;  5JXJ A;  2VMF A;  1SHW B;  3III A;  2VZV A;  4OMC A;  2ORX A;  3C7O A;  2Y8K A;  2B9V A;  4P08 A;  1XPW A;  2Y6H A;  4UOJ A;  4JHZ A;  2WAB A;  2JDA A;  2EIE A;  3I2J A;  4W8J A;  2W1Q A;  5F7U A;  2CDP A;  3GGL A;  3PUI A;  4P5Y A;  4ZZ5 A;  4JX0 A;  2PQS A;  5HXM A;  3HNB M;  3MV0 1;  1UY1 A;  2HLE A;  2KD7 A;  4JKL A;  4BJ0 A;  4FI9 A;  4Z2A A;  1GNY A;  3I97 A;  3NQH A;  3C7E A;  2YFZ A;  3NJV A;  4DUW A;  2QQO A;  4DEQ A;  3A23 A;  4KI5 M;  4RN5 A;  5JXH A;  2WZ8 A;  4QAW A;  3P6B A;  1JZ3 A;  3UES A;  2VQT A;  2W92 A;  4A42 A;  2L9L A;  4XUP A;  3WF0 A;  3I3E A;  4XUN A;  2VZ1 A;  3ACG A;  1UWW A;  4CU8 A;  1JI6 A;  2ID4 A;  2B4K A;  4KWU A;  2ZEW A;  4JKK A;  2J1U A;  1PX4 A;  1OD3 A;  2VZO A;  5DN2 A;  5FUI A;  5G04 L;  5DPN A;  1PMH X;  2JE8 A;  1CZS A;  4DUX A;  2WDB A;  2W1S A;  2VOT A;  2VZQ A;  4D0Q A;  3EYP A;  3W5M A;  3I2G A;  2WO1 A;  3OGV A;  2QQN A;  2VZR A;  3IAP A;  3OEA A;  4CVU A;  1UXX X;  3C7H A;  3GM8 A;  4DXR A;  2OKX A;  1H6Y A;  3VDC A;  2VMC A;  4PT6 A;  2Y6K A;  1JYW A;  2QQM A;  2VZP A;  4TXW A;  3I2I A;  4UAP A;  4UI9 L;  3CZU A;  1NAE A;  3GXU A;  4LHS A;  4W4Z A;  4XZU G;  3C7F A;  3MV1 1;  2ZEZ A;  3T2Q A;  4BK5 A;  5IFT A;  3I2H A;  4IUG A;  2W9X A;  3HNM A;  1D7P M;  3T0B A;  3WNK A;  4M4R A;  3C8X A;  1J84 A;  3WSO A;  1K12 A;  5B4N A;  2WYS A;  2EID A;  5EJ1 B;  2ZXQ A;  3MUY 1;  4ET7 A;  4MO3 M;  3T08 A;  5LA1 A;  2QQJ A;  2W47 A;  4ZZ8 A;  2WO2 A;  4PF1 A;  1O59 A;  5I0D A;  2X09 A;  1NUK A;  3BN6 A;  4CUB A;  1US3 A;  2WAA A;  4BDV B;  1JU4 A;  1L7R A;  2J1A A;  2VJX A;  3NRU A;  3VD7 A;  4LQR A;  2R7E B;  2W46 A;  2JKX A;  1UY3 A;  3ACF A;  2Y6J A;  1W8O A;  3VD5 A;  2VCB A;  2WQ8 A;  1LNS A;  1CX1 A;  1JZ4 A;  3VDA A;  5JMO A;  2WUH A;  3OB8 A;  3IAQ A;  3FHQ A;  1GOF A;  2DCK A;  2W94 A;  1NX9 A;  3AC0 A;  3T0D A;  3OGR A;  1UY0 A;  3PUH A;  1PMJ X;  1UMI A;  4A41 A;  3CDZ B;  3ACI A;  2RJ2 A;  3K4D A;  4ZY9 A;  2VZU A;  1MPX A;  4ZXE A;  3SEE A;  1JYX A;  2YC4 A;  3WNM A;  4CU6 A;  3F2Z A;  2W91 A;  1JZ6 A;  1GMM A;  1WKY A;  3WF1 A;  3VD9 A;  4AAX A;  3CMG A;  4OZO A;  5IJR A;  5CZK A;  1K3I A;  5CYY A;  3WNP A;  5HPO A;  1OF3 A;  1W9W A;  3JXS A;  1UY2 A;  2BGP A;  1HN1 A;  3D3A A;  3J7H A;  2W95 A;  5JR2 A;  3UNP A;  2VM9 A;  2J7M A;  1UYX A;  3WNN A;  3THC A;  2RV9 A;  4XUO A;  3T0A A;  4E8D A;  1OH4 A;  1W9T A;  4AG4 A;  4ARY A;  5JXG A;  5DQ0 A;  3LQC A;  3A7Q A;  3DEC A;  3MO4 A;  2WN3 A;  1CZT A;  5IFP A;  3A22 A;  3I2F A;  3K4Z A;  3CIH A;  4QX3 A;  4QX1 A;  4XUR A;  2YG0 A;  2VQU A;  5A1A A;  3IDA A;  1GU3 A;  1UZ0 A;  4D8M A;  1DYO A;  3VD3 A;  3A21 A;  4QB6 A;  2BGO A;  5LA0 A;  2W1W A;  2X10 A;  3P1I A;  1F4A A;  1EUT A;  1JZ8 A;  4XUT A;  3T2P A;  1WCQ A;  1F4H A;  3HEI A;  3OG2 A;  1UYY A;  1TVG A;  4A6O A;  4DUV A;  4KMQ A;  1UXZ A;  2E32 A;  2ZEX A;  1OF4 A;  4YPJ A;  2V72 A;  4CUC A;  4MAD A;  3T09 A;  2HYX A;  1XC6 A;  5LA2 A;  4DEV A;  4DXT A;  5G05 L;  2DCJ A;  2QQI A;  4W50 A;  1DP0 A;  1UY4 A;  2VR4 A;  3LPG A;  4M4P A;  2Y6L A;  3ZM8 A;  2VMD A;  3HNY M;  4QB2 A;  5J1X A;  1IQD C;  3HJR A;  2W5F A;  1W99 A;  2J1V A;  3LPF A;  2RVA A;  1K42 A;  4OMD A;  4GZ9 A;  2J1R A;  2W3J A;  1JZ7 A;  1NKG A;  3NNG A;  4QB1 A;  3VDB A;  1GQP A;  2VCC A;  2QQK A;  2V5D A;  2VO5 A;  3HN3 A;  3OGS A;  1W9S A;  4RYD A;  2WAO A;  2VME A;  3SEP A;  3DYP A;  2Y6G A;  3WQB A;  2ZEY A;  3U37 A;  1R64 A;  4PQQ A;  1XNT A;  2YC2 A;  3K46 A;  1BHG A;  3ACH A;  1UMH A;  3K77 A;  1KGY A;  1JYV A;  4HG6 B;  4GWJ A;  4OYU A;  4QX2 A;  2ORZ A;  3LEG A;  4E8C A;  5IHR A;  2J1E A;  1O8S A;  3CKH A;  1PX3 A;  2VZ3 A;  1CZV A;  2C9K A;  1H6X A;  2QBX A;  2DDU A;  3WEZ A; 
#chains in the Genus database with same CATH topology
 4D3W A;  4V2W A;  2A6V A;  2G9G A;  1V0A A;  3ORJ A;  3BVC A;  3M4F A;  4XCB A;  3RI8 A;  2WFP A;  2FMD A;  2ZKL A;  3G7D A;  1NA1 C;  5IVJ A;  4IE6 A;  1DQ6 A;  5IYY A;  4RHV 2;  5KXD A;  1GAN A;  2BGC A;  4RR3 C;  5GLW A;  1MVE A;  2R06 3;  3USU A;  3PHM A;  4HET A;  5E6H A;  4AGV A;  1VRB A;  4QPG B;  1UZZ A;  1W8W A;  3VBR A;  1IQA A;  3T2T A;  3ZPO A;  4JZR A;  5FMD A;  2WS9 2;  3VKF C;  3LCP A;  3KB5 A;  2WO3 A;  2JB8 A;  1CAV A;  4LHN A;  2PAK A;  3AZX A;  4A44 A;  3RZJ A;  4LLO A;  4XQD A;  1AX2 A;  2WWU A;  3VBS B;  1XYN A;  2WNV C;  1BK1 A;  3GZT B;  3J8F 3;  1PNG A;  1D4M 1;  2VTF A;  1VBA 1;  1D4M 3;  3UGH A;  3OY8 B;  2MPF A;  5F2S A;  1JZ2 A;  2XXZ A;  3K75 B;  3FLT A;  4N53 A;  4L97 A;  2PAE A;  4FBF A;  5LEJ A;  2CDO A;  4QKN A;  1ZRE A;  3QH6 A;  4NID A;  1GBG A;  4LBK A;  3LKJ A;  1LAJ A;  3ECQ A;  3FC0 A;  1QKQ A;  3KQ4 B;  3O1T A;  4DXS A;  2PHR A;  5FPA A;  3NWK A;  4XBQ A;  2Y64 A;  3M8L A;  3U10 A;  3WR0 A;  3SC7 X;  4H2A A;  3ZKU A;  3ZKY A;  1UYZ A;  5A1L A;  4D6S A;  4RFT 0;  2B8M A;  2NYY A;  2LW8 A;  4D6R A;  3QOP A;  1ULD A;  1B35 B;  4QPG A;  3R4D B;  3O14 A;  4K40 A;  2RM2 2;  3AZW A;  5FPV A;  3UJQ A;  2DVD A;  1DLC A;  1RUG 1;  4GWM A;  4HSL A;  4BZ4 A;  2NPI A;  1DHK B;  2JB4 A;  1GQG A;  1KFU L;  1QMJ A;  4YW7 A;  3ZXK A;  5JUV A;  4Q8K A;  3WP4 A;  1OLM A;  3FBM A;  3AJZ A;  1KS5 A;  1WW5 A;  2ZX2 A;  2IC1 A;  4FCA A;  3UKT A;  4E4D X;  4S2H A;  1W05 A;  5FLH A;  1JXN A;  1OVS A;  2WR9 A;  4IEO A;  1H8T A;  2VAU A;  4P02 B;  4OUM A;  1XNB A;  4BHP A;  1H0B A;  2DUP A;  2VD7 A;  5H9P A;  4M01 A;  4ATF A;  1VE0 A;  4O61 A;  5IK7 A;  1W6N A;  5HCA A;  1H2N A;  2Y0I A;  2P4E A;  3KVB A;  4WM7 B;  5M0T A;  3RDI A;  1DZT A;  5DG2 A;  5JZG C;  3ZSJ A;  4NAO A;  3PTR B;  4CE8 A;  2ARC A;  3POB A;  4GMP 1;  5C71 A;  5LK5 A;  4CP1 A;  1GP4 A;  3CZJ A;  4UFH A;  2BPA 2;  1AR8 2;  3FWE A;  1OLR A;  2YPJ A;  1NE6 A;  5ABJ B;  4R9C A;  3B00 A;  4TZD A;  2P6H A;  4XFG A;  4FPH A;  1O7F A;  3VD4 A;  4EWD A;  1F2N A;  3WG2 A;  3B69 A;  3K4A A;  3TEZ A;  4AR2 A;  3H3U A;  1H2M A;  2IXL A;  2Q4S A;  3FHI B;  2W87 A;  4H14 A;  1AL0 G;  3MUZ 1;  4MV2 A;  4QPY A;  4X8P A;  3TNP B;  3VKN A;  3AL5 A;  4QGN A;  1WLT A;  4XZP A;  2KR2 A;  5L9B A;  2HH9 A;  4BCU A;  2Q0A A;  5LBB A;  2E6V A;  4MXV A;  1R1A 2;  2ZS6 B;  2C4X A;  2PYT A;  3I59 A;  5AVA A;  5EJZ B;  5FYV A;  1HB3 A;  1RHI 3;  3H0O A;  4GMP 0;  4KG8 A;  3RMX A;  2YB7 A;  1T2X A;  1Q8P A;  4K3U A;  5FUP A;  2ZMK A;  2VW1 A;  3VBU B;  5FWJ A;  1NY7 2;  4NHY A;  1STM A;  3T1M A;  4CU7 A;  2OUH A;  1ULP A;  3LEI A;  3VV1 A;  3OPT A;  3S7I A;  1QJY 3;  3D6E A;  3PL0 A;  5JXI A;  2BYV E;  1YNA A;  1HB2 A;  1Y9G A;  2J1S A;  4AFC A;  2XDV A;  3VBO A;  1KS4 A;  1GWK A;  1PK6 B;  1XSQ A;  2QQW A;  5A33 B;  3DYM A;  4V1P A;  3DYO A;  3KWV A;  1ALY A;  3IWZ A;  3S5A A;  3OCP A;  3VBF B;  4BU2 A;  4OLL A;  1BBT 1;  1SHW B;  3CBN A;  4RGK A;  1UL9 A;  2ORX A;  2Y8K A;  3C7O A;  3LSE A;  3W9A A;  3CHX A;  1BBT 3;  4COY A;  5GKA C;  2WAB A;  4L2N A;  2FCU A;  2JDA A;  2EIE A;  3JD7 3;  3ZDS A;  1C1F A;  1DFQ A;  2OX0 A;  2WNO A;  4LIV A;  1RED A;  5CFC A;  1CGP A;  4BWO A;  2RS5 2;  1SLT A;  1FYU A;  3TYJ A;  2CDP A;  3ZSM A;  5HXM A;  4NAM A;  3RJ2 X;  2QNK A;  3MV0 1;  4Q4Y 2;  4XF9 A;  1UY1 A;  2HLE A;  3AZZ A;  5CAD A;  1FAY A;  1ONA A;  2ERF A;  2YMZ A;  3LZZ A;  4Z8B A;  3THT A;  4YZ3 A;  4K8R B;  1OPO A;  2HWC 1;  4E4S A;  1ZRR A;  3C7E A;  1FMD 2;  4GKY A;  4Y22 A;  5F5Q A;  3EMR A;  1FPN 2;  3PMS A;  1RMU 1;  3PUR A;  2JG8 A;  3LOB A;  2XJR A;  2CGO A;  3OBT A;  4F83 A;  5FZA A;  2W92 A;  1TNR A;  2Y38 A;  3RG0 A;  2PLV 2;  1Q8Q A;  3DCQ A;  1LOB A;  3GBG A;  3HBK A;  3ZFF B;  1XBF A;  1FOD 1;  4Y5S A;  2XVG A;  2D3P A;  1GYK A;  1TZO A;  2WZR 1;  4MSV A;  3ZXD A;  3OTF A;  1S0G A;  3KV5 A;  5TSW A;  2VZ1 A;  2KM2 A;  3ACG A;  5IK4 A;  5KBF A;  2KA3 A;  3VHP A;  3BTX A;  4CDW B;  2B4K A;  5DZE A;  1QEX A;  2ZEW A;  3HVD A;  4JKK A;  3S7E A;  1PX4 A;  1YRZ A;  2WL1 A;  1RUJ 1;  3OBZ A;  3EXU A;  5DN2 A;  3ZR5 A;  4AFB A;  4Z92 B;  2D93 A;  1AYN 3;  4O9G A;  4FAH A;  4QPI B;  4NPR A;  4QHZ A;  4Y1V A;  4X6R B;  2A6W A;  2IXC A;  1OXC A;  1QQP 3;  2HBU A;  1CZS A;  2RJK A;  4DUX A;  2WDB A;  5FJH A;  2W1S A;  4IE5 A;  1HIX A;  2EXJ A;  4XOG A;  1BEV 2;  1REF A;  4XAB A;  1ZZ8 A;  4D0Q A;  2GP5 A;  3AXE A;  1WMD A;  3QD6 A;  2CY6 A;  1WW6 A;  1YCI A;  4M3C E;  4XDQ A;  3WHU A;  5JOW A;  2UYA A;  4A7Y A;  4DRR A;  2B7Y A;  1R09 1;  5BNN C;  2EAL A;  2XUM A;  2QQN A;  2Z42 A;  2ETE A;  3OD4 A;  4FFH A;  4GA9 A;  3OEA A;  4PF5 A;  1TQ5 A;  4CVU A;  2XJT A;  4YVW B;  4CA9 A;  2PEL A;  4ZU5 A;  3NNM A;  4XIL A;  4CEW A;  3EO6 A;  2P37 A;  3E6B A;  4JDM A;  3CJX A;  1QJZ A;  5D8A C;  3WUC A;  3ZXE A;  1ULC A;  2WA4 A;  3NV4 A;  1H6Y A;  2OKX A;  5FP4 A;  2VMC A;  3ZFF A;  4PT6 A;  1WBF A;  3INA A;  3NV3 A;  2AAC A;  2X5I A;  3NAP C;  2CWM A;  1S0C A;  4UAP A;  3CZU A;  4LKF A;  4XJZ A;  3GXU A;  5FZF A;  1KRI A;  4CDW A;  4KWL A;  4XZU G;  1RUH 1;  3C7F A;  1ZX5 A;  3MV1 1;  1NA1 B;  4XQ4 A;  1VAV A;  3NJZ A;  5FZE A;  1UZY A;  5T5O A;  4YZ5 A;  2B46 X;  1A78 A;  4EZH A;  4I0W B;  2WSV A;  3Q8B A;  4JDO A;  3D0J A;  1D7P M;  1UKR A;  2ZGO A;  2ZZQ A;  3RVH A;  3WNK A;  4ASM B;  1OOP B;  1UZV A;  2CSG A;  1J84 A;  4PI0 A;  4BA6 A;  5IUQ A;  3JCI A;  1ZZC A;  3HQX A;  2PFW A;  3VZO A;  2A6Z A;  2WYS A;  1RGS A;  1G9C A;  1OKQ A;  2WFF 1;  5FO8 B;  2XL9 A;  1RUG 2;  1W6P B;  1QJX 1;  3E5U A;  5FZO A;  4ASL A;  1ND3 C;  4PIX A;  2WO2 A;  1BCX A;  5KXE A;  4BE3 A;  5A7O A;  1O59 A;  4L11 A;  5KR7 A;  3AZY A;  5DDJ 1;  5FYI A;  2XGX A;  2ZAH A;  2WNV B;  3POS A;  2GN7 A;  4CUB A;  2HWE 2;  4RS5 A;  5LK7 B;  4I09 A;  2WAA A;  1YI7 A;  1CAU A;  4FQZ A;  2VJX A;  1PHM A;  1AHS A;  4R9A A;  2WT2 A;  3SH4 A;  1AJO A;  1HV0 A;  1QXP A;  4KBB A;  5GJ6 A;  1GR3 A;  3V56 A;  2DVG A;  3B5L B;  4QD2 A;  1PVC 1;  1H2L A;  5EYY A;  4CCK A;  2W46 A;  3MPP G;  1REE A;  4QXH A;  4BQ1 A;  2R07 1;  5J3U A;  2JDH A;  1GNZ A;  1PVC 3;  2BFU L;  1W8O A;  2WQ8 A;  3TN9 3;  2XVL A;  1CX1 A;  3GHM A;  1YI9 A;  2PHF A;  1UU6 A;  4JDN A;  4CRQ A;  5FY1 A;  1WCS A;  1YC6 1;  2JIC A;  2ZGR A;  4AFD A;  4MH0 E;  1OOP A;  3AM2 A;  2Y0O A;  3H50 A;  3GCX A;  1GOF A;  1SLA A;  3AC0 A;  3GNE A;  1WA6 X;  1OBN A;  2P1B A;  3OGR A;  1A8M A;  4LBL A;  4A41 A;  5J48 A;  3B93 A;  1D4V B;  3AJY A;  3BAL A;  4PBP A;  4DRV A;  2DUO A;  4JGZ C;  3K4D A;  1UIK A;  4CXW A;  5KHJ A;  4XTM A;  1YWK A;  2VZU A;  1QJU 2;  3Q9O A;  2YC4 A;  2R30 A;  1GLH A;  3RWK X;  4P9X A;  2W91 A;  1RUD 1;  4D7T A;  4E4Z A;  1JZ6 A;  5LAS A;  5CB7 A;  1GMM A;  4GUL A;  4XC9 A;  2NM1 A;  1LOF C;  1F5J A;  3KMH A;  5DAB A;  1RUD 3;  4C1W A;  1BXH A;  4CDQ C;  5LZ6 A;  4CSW A;  4M3C A;  4OZO A;  1ASJ 2;  1EPW A;  4PLN A;  5GZG A;  5JSO A;  2F4L A;  2GNM A;  3M3O A;  2R0H A;  3PU8 A;  3WD5 A;  2GC0 A;  4S2D A;  5CYY A;  4M0N A;  3CJI B;  3WNP A;  4AQS A;  4DY5 A;  1OSG A;  2ZKN A;  4OUS A;  2ILM A;  4QU1 A;  4XIK A;  4CEY A;  5HV4 A;  2BGP A;  4JGY B;  2HBT A;  3WDW A;  1HN1 A;  4PDW B;  4LHK A;  2RE9 A;  3J7H A;  2RMU 3;  3M2M A;  3UNP A;  2Q1F A;  4OQ9 A;  2RS1 2;  3DUI A;  2JD4 A;  1NCR A;  3KCC A;  5LY1 A;  4E9K A;  3H42 B;  1SBD A;  4Q4X 1;  3T0A A;  4E8D A;  1H9P A;  4UF0 B;  1D0G A;  4K21 A;  4MGY E;  4AG4 A;  1DDL A;  3LQC A;  4GIQ A;  4CZS A;  4P9W A;  1YYN A;  2G9Z A;  5T5L A;  3A4U A;  1WW7 A;  4J1X A;  5FXV A;  4AVC A;  3A22 A;  1AR7 1;  3K4Z A;  4LXL A;  4YGE A;  1AF9 A;  4NII A;  3WW2 A;  2BV4 A;  4QX3 A;  2BFU S;  1PO1 1;  3WP5 A;  1IS4 A;  1DU3 D;  4LOT A;  1NE4 A;  2EXI A;  3HT1 A;  4TYS A;  5A1A A;  4OHY A;  4MGI E;  2A6Y A;  5GM0 A;  1GU3 A;  2VQ0 A;  3ZXA C;  3TEW A;  5FFO C;  3A21 A;  2AYH A;  2HWC 2;  2JDP A;  2BNN A;  3KV6 A;  5FZ0 A;  5F5I A;  3AKP A;  1ENS A;  3P1I A;  3VZJ A;  1F4A A;  1EUT A;  3N7J A;  4LIU A;  1IPK A;  3CJI A;  4LO4 B;  3ES1 A;  5D1I A;  4JGY A;  4NHL A;  3LSD A;  1RUF 3;  1XXN A;  4YW6 A;  4QPG C;  5FXW A;  4Y4R A;  2OZJ A;  4XMI A;  4DUV A;  3ZYP A;  1ZBE 1;  2ZEX A;  4C0B A;  1Y3T A;  1PO2 3;  1RUE 3;  1FOD 2;  2V72 A;  3V64 A;  3BIW E;  3RS6 A;  3VHN A;  2PAM A;  3FFQ A;  4UBG A;  5LA2 A;  1RIT A;  4NPM A;  5F5A A;  1CON A;  3LOI A;  5JOZ A;  2P2K A;  1VRH 3;  2Q8D A;  5G05 L;  4XJU A;  3PVN A;  4ASK A;  2X8K A;  1J1L A;  4KWK A;  3V65 A;  4W50 A;  2AGS A;  3LFM A;  1H8T C;  2D5H A;  4E2G A;  1HRI 3;  2IUW A;  4LLF A;  1WBL A;  3POY A;  2G4I A;  4QXC A;  4RQP B;  3DXU A;  4MVT A;  4QB2 A;  4Q0P A;  1LR5 A;  2JEN A;  3CF6 E;  2W5F A;  4AYU A;  4CXX A;  2RVA A;  1RUI 3;  3WG1 A;  1MZ5 A;  4OUL A;  1VBB 2;  4BIS A;  1K42 A;  2J1R A;  3WXP A;  2ATF A;  2UY9 A;  1PGL 2;  4YFZ A;  1W2O A;  1JYC A;  1XU1 A;  5IVB A;  4K7J A;  4LUM A;  4NIG A;  2QQK A;  3HN3 A;  1R09 2;  3O0V A;  2CTV A;  4RYD A;  1YQC A;  4R52 A;  2GH8 A;  2ZGP A;  1I5Z A;  5I8S A;  3SH5 A;  3T30 A;  3SEP A;  3GBW A;  2VNG A;  4AI9 A;  1OFS A;  5BNO A;  4Y5T A;  2YXS A;  1CAX A;  2JKB A;  2RDR A;  4WVZ A;  4KU7 A;  4IV3 A;  5JCT A;  5CKQ A;  3JB4 C;  3U07 A;  5I0S A;  4AVS A;  1V6N A;  1GWM A;  2IXI A;  3ACH A;  1UMH A;  2EIG A;  5FYM A;  1VMF A;  4MGK E;  4Y26 A;  4GWJ A;  2XR4 A;  1PGW 2;  3DN7 A;  3LEG A;  4P5H A;  3P3N A;  5T54 A;  1ACC A;  1RUH 2;  3KSC A;  3M1H A;  5JPM B;  1UU4 A;  1EP0 A;  4WM8 B;  4ZS2 A;  1CJD A;  3HIF A;  5IHR A;  3E6C C;  4W6W A;  3KS7 A;  5I0U A;  5DAX A;  2YUE A;  1CQ9 A;  2PA7 A;  3DL3 A;  3R6S A;  4YYO A;  1NQJ A;  4NR1 A;  4MXW A;  1IS3 A;  3R4U A;  4FFI A;  5A7Q A;  1SPP B;  1I1E A;  3POE A;  1HJG A;  4EV0 A;  1ZVF A;  2QBX A;  1L3J A;  5EHD A;  1AVB A;  5DUV A;  3RGB A;  2VUC A;  2AEN A;  5A1F A;  2ES3 A;  2WT1 A;  1NQD A;  2PTM A;  2WS9 3;  2XWJ B;  4IV1 A;  4CU9 A;  2W08 A;  5BNN B;  4MGS A;  1L7Q A;  2BVV A;  1COV 1;  5JVV A;  4QDS A;  1QNW A;  1WME A;  1G8W A;  1OA4 A;  1OA2 A;  2AC1 A;  2WKK A;  2YFU A;  5D8A B;  3BTY A;  4Z1V A;  4TTG A;  4CP9 A;  5C5U A;  4XUQ A;  5HXV A;  3R4S A;  5CFC C;  2Z69 A;  3VBH A;  4OI0 A;  1ULO A;  4Q4W 1;  1AYM 3;  5ANQ A;  1YHF A;  4AVB A;  3JBG 2;  3V0A B;  3DF0 A;  1MEC 1;  4QWN A;  5L7O B;  3M3E A;  4MZU A;  3L2H A;  1NZI A;  4WM8 A;  1RUC 3;  1Q43 A;  2IZW A;  2ZX4 A;  4URA A;  3RNS A;  5J09 A;  2JD9 A;  4GB3 2;  2YBK A;  3K3N A;  4IEZ A;  2JG8 C;  3POF A;  1QIQ A;  1ND3 B;  3LEK A;  2NQY A;  1M06 G;  1YIF A;  2XJU A;  5LCW L;  4XXP A;  1NZC A;  3GAL A;  2QZ3 A;  3MF6 A;  2HWF 2;  2XKO A;  1OD5 A;  3PLQ A;  3KF5 A;  2GAU A;  2DVF A;  4BQ2 A;  5C70 A;  5FZI A;  4GJY A;  1W0N A;  1PIV 2;  3WQB A;  3KQR A;  1RIR A;  3LGR A;  3AYA A;  4FPG A;  4LKE A;  4MOA A;  1EV1 2;  1UOF A;  4FP2 A;  4GAZ A;  4IEX A;  5BPX A;  2ET1 A;  5K0U B;  3WQ1 A;  2C26 A;  4YG3 A;  4SBV A;  2W39 A;  2DYC A;  2WN2 A;  4DO0 A;  3PUA A;  3O0W A;  5LW9 A;  4YM2 A;  1W6Q B;  2VZS A;  5C3S A;  1LHN A;  3N7K A;  4YAR A;  2CNA A;  5L7O A;  5APA A;  4GXL A;  3WF3 A;  1O3R A;  2VCM A;  2A75 A;  2E51 A;  3T2O A;  2XJQ A;  5FRE A;  1AR8 3;  2XL7 A;  3IPV A;  3UET A;  4CEW C;  1E5R A;  1ULF A;  5FIX A;  4EZ4 A;  1O5U A;  1NLR A;  2OXB A;  3AP6 A;  3D4K A;  4Y4Y A;  4Q8L A;  1AL2 1;  4GJZ A;  3DPR A;  3JZV A;  1JYN A;  1LRH A;  2K9Z A;  1ULG A;  1LGB A;  4CCJ A;  2WII B;  4RGG A;  4B7E A;  2JDU A;  3ZLI A;  1BZW A;  1KJR A;  1J3P A;  1KEX A;  1AR7 2;  2MEV 1;  3LWC A;  3N3H A;  4G9S B;  4DZG A;  3BGA A;  1UPS A;  1V9U 1;  1PZ7 A;  1R1A 3;  1V6M A;  2PHL A;  4XFF A;  2Y6F A;  3MW3 A;  2MEV 3;  1TG7 A;  1DGR A;  1RJ8 A;  5D2A A;  3ZFF C;  2GZW A;  2TBV A;  4CDQ B;  3FHA A;  3BUC A;  2X5I C;  2VL4 A;  3SH3 A;  5FCC A;  3EB7 A;  3ZXF A;  1JHJ A;  3MIH A;  1XNC A;  1F8V A;  2VZT A;  1RIN A;  2IFW A;  3BPZ A;  4LJH A;  3O1R A;  4LE3 A;  4CDW C;  5AC9 3;  4RGA A;  4XCA A;  1MZE A;  4YM0 A;  5K0U A;  3WDT A;  3DKW A;  3ZSL A;  3I2K A;  5F3G A;  5JIU A;  1J3R A;  2XML A;  1F9K A;  5I93 A;  4ZKT B;  2RR1 1;  1EUU A;  3NO8 A;  3USU B;  2PHX A;  4I02 A;  5K4L A;  4NVP A;  2A71 A;  3WNL A;  2RR1 3;  3SNM A;  5A3M A;  4LBQ A;  3PIJ A;  1QOT A;  1YIP A;  3VBR B;  5ACA 2;  1B09 A;  5IAT A;  1US2 A;  2ZGT A;  1LGC A;  1DZR A;  1OKO A;  3ME2 A;  2UWC A;  4ZS3 A;  3S6P A;  1XNA A;  4YGB A;  1W2T A;  3AMM A;  3Q8A A;  3NV1 A;  1AR9 1;  4KL1 A;  3RZZ A;  4B29 A;  4DS0 A;  4HXC A;  1CAV B;  3HOB A;  2WBK A;  4RA0 A;  1AR9 3;  1OI6 A;  4BXS V;  2PN5 A;  2FZ1 A;  1UX7 A;  3D82 A;  1GOH A;  1O4T A;  1QDC A;  2RS5 3;  4RS5 C;  4AF9 A;  2VMG A;  4BME A;  1DGR N;  2BTV C;  3AYD A;  1LJ7 A;  5AVP A;  1W8Z A;  5H9S A;  5C6C A;  3KGZ A;  4RSU A;  2XQX A;  1POV 1;  4KU8 A;  4XJA A;  1E5H A;  3H8R A;  3LDR A;  1J83 A;  1HW5 A;  2J22 A;  1YEW A;  4N53 B;  1POV 3;  3W58 A;  2D5F A;  1UYP A;  3WNO A;  2VMF A;  1UOJ A;  1RTV A;  2D6N A;  3III A;  2VZV A;  5FZ1 A;  4P08 A;  1AX1 A;  4Q5O A;  1XPW A;  5IVY A;  2Y6H A;  3W21 A;  1Z78 A;  1Y9Q A;  2ZBJ A;  1O4Y A;  2F17 A;  2EXH A;  2R06 1;  3BOD A;  5T3N A;  1FPN 3;  2RS3 2;  2VW0 A;  2F4P A;  3S57 A;  1SQ4 A;  3TB0 A;  4W8J A;  1I6X A;  2W1Q A;  3ITQ A;  3PUI A;  1OOP C;  4ZZ5 A;  4XIO A;  4AI8 A;  5KHI A;  1OQE A;  5EWS A;  5GZC A;  1AR6 3;  1LKN A;  1W06 A;  1POQ A;  1POV 0;  5KHG A;  1A8D A;  5JAX A;  4BJ0 A;  2QJV A;  2ZAA A;  4FI9 A;  4Z2A A;  3GBF A;  3AVS A;  4NOT A;  1UN1 A;  3GJB A;  4ZHN A;  2HWB 2;  5CVR A;  2D40 A;  4FXG B;  3NQH A;  3TBD A;  2BBV A;  4P9I A;  1XQN A;  3J8F 1;  2UU8 A;  4IDZ A;  1LTE A;  4P9J A;  2IWG B;  1VB4 A;  2Y60 A;  1H9W A;  4FO9 A;  4R4X A;  4DEQ A;  1H8T B;  3RZH A;  4RN5 A;  1Z7S 3;  1J3Q A;  2WZ8 A;  5FP9 A;  2ZZJ A;  3AMN A;  4JV4 A;  2R49 A;  1VBD 3;  2VQT A;  1X8E A;  4HPK A;  4IEQ A;  2OS2 A;  1W6N B;  1XU2 A;  3C3V A;  4IXL A;  4YSF A;  1N3Q A;  3MF9 A;  3NL1 A;  3LA2 A;  2BOI A;  1JS9 A;  2QCS B;  2L9L A;  4LA3 A;  1AXZ A;  4XUP A;  4AWD A;  4CEY C;  4CCM A;  4EN7 B;  2XBO 2;  3I3E A;  3SCH A;  1UWW A;  5FQ0 A;  3WP3 A;  4EJR A;  1NCR C;  2HYK A;  4HON A;  4XDP A;  5LEK A;  2NLR A;  4YZ4 A;  3PTY A;  3SIT A;  3S0M A;  1PMH X;  4H3W A;  4GQ7 A;  3BI3 A;  5A80 A;  2JE8 A;  4CUG A;  4FOW A;  1VBC 3;  3CL1 A;  2VOT A;  1GKB A;  1FI2 A;  3MIB A;  4I0B A;  4CCE A;  5FDB A;  1JUH A;  2VZQ A;  3WZ1 A;  1UOB A;  3I59 B;  3W5M A;  1MEC 2;  1R08 3;  4OI4 A;  4H7L A;  3OYW A;  4LR4 A;  3J9S A;  1MZ6 A;  1HX6 A;  5EXO A;  3WUD A;  1UIJ A;  4LBQ D;  1ZM1 A;  2C6S A;  1JHN A;  2GU9 A;  4XTP A;  1DCS A;  3VZL A;  1H4G A;  1O5L A;  1UXX X;  2OZ6 A;  3B9I A;  3PDQ A;  1N47 A;  2D6K A;  3GM8 A;  2BEO A;  5I8T A;  2E63 A;  2GMM A;  2I07 B;  2ZHN A;  4DXR A;  1BMV 2;  5DAW A;  5ERL A;  3CJI C;  3PVO A;  2DBN A;  3Q8C A;  2Y6K A;  1DQ0 A;  3AMQ A;  3VBO B;  1X36 A;  3ZX7 A;  4IGP A;  1V00 A;  2AH2 A;  2P34 A;  1JYW A;  4JGY C;  4TXW A;  1G9F A;  4PDW C;  3R05 A;  1CWP A;  4OHV A;  4BLI A;  1C8M 3;  4COW A;  4OVE A;  2OII A;  3O5S A;  4W4Z A;  1QJE A;  2XB6 C;  1JOD A;  3FZ3 A;  3TNQ A;  4GAL A;  3O12 A;  2HWE 3;  1ZRI A;  3HNM A;  5A7P A;  4IE4 A;  1UF2 C;  4M4R A;  5LAT A;  1APN A;  1LEC A;  4FXK B;  4FTB A;  3AFG A;  2IVI B;  4C90 A;  5CFC B;  1ZBA 2;  4Q1P A;  2EID A;  4MHR A;  4BQW A;  1BJQ A;  4AQ6 A;  1IOA A;  1RHI 1;  1TMF 2;  2E7A A;  4LMF A;  4IGO A;  3U4X A;  1ND2 A;  2K46 A;  2QQJ A;  4KG0 A;  4ZZ8 A;  1IPS A;  2D6O X;  1X50 A;  4LTA A;  4PF1 A;  3WQ0 A;  2XHK A;  1YO8 A;  4IEU A;  3URF A;  4ES8 A;  2X09 A;  5FUN A;  1HXS 3;  2Q8E A;  3BN6 A;  2ZAB A;  3ELN A;  4BQ4 A;  1JTZ X;  1LED A;  3CLP A;  3JU9 A;  5EPA A;  3VKM A;  1ZRD A;  3POI A;  1QJY 1;  4BPZ A;  4Y22 B;  2QDR A;  1PVX A;  1QXR A;  1OH3 A;  1ZZB A;  3ZN4 A;  1Q8S A;  2F6B A;  2JG8 B;  5L9R A;  3ZN6 A;  5F3C A;  3H7Y A;  2AR6 A;  5T55 A;  3BU7 A;  1UQX A;  1VLN A;  2OT7 A;  2VNV A;  4XBN A;  4A7Z A;  5BNO C;  1ENX A;  3AL6 A;  3P5B A;  2VCB A;  4IV3 C;  3N9N A;  3WG3 A;  3FBY A;  2JDY A;  3AB0 A;  2WUH A;  4Q0S A;  4XPV A;  4BQX A;  3JQX A;  4OQ8 A;  1VJ2 A;  3JD7 1;  2BDR A;  4BQY A;  4EN0 A;  4YZ2 A;  4LT5 A;  3VDD A;  3FHQ A;  1W8T A;  5CEH A;  1C8N A;  2R32 A;  2XUE A;  4AFM A;  3RYR A;  1PMJ X;  4PCR A;  2ARE A;  1S0F A;  2G19 A;  4CP2 A;  2RHP A;  3CDZ B;  5L36 A;  3ACI A;  1EAH 2;  2ADD A;  2RJ2 A;  2WNU A;  1H1A A;  4WVW A;  4ZY9 A;  4DY3 A;  1A34 A;  1M4W A;  2NMN A;  4RQP C;  1E5I A;  1T6G C;  3PVE A;  1G86 A;  4ZXE A;  3U75 A;  4Q0V A;  5KWR A;  5IVV A;  5F3E A;  2ZOE B;  4UT5 A;  5BNQ A;  1H1M A;  3T3Y A;  4AFA A;  2RS1 3;  2IFR A;  2O14 A;  3AKR A;  5CBL A;  1QHD A;  3CMG A;  1RVF 3;  4IV1 C;  2RDS A;  1S0J A;  5HBA A;  3N4M A;  3PJY A;  4FQ4 A;  5CZK A;  5FPX A;  1K3I A;  1F5F A;  5DG1 A;  5JPN B;  2R04 2;  4GD4 A;  1OF3 A;  3AYE A;  3PIG A;  4XFH A;  4O7X A;  3SHR A;  4CEW B;  5E1R A;  5L9V A;  2QTW B;  1XSR A;  2CAU A;  3KD4 A;  2A5Z A;  3D3A A;  1HV1 A;  4XE9 A;  3A0K A;  5BY5 A;  3IDC B;  1DBN A;  5GLZ A;  2X5I B;  1W39 A;  2DV9 A;  1GP6 A;  2VM9 A;  5EQU A;  5FTT C;  4KGG A;  3DEM A;  1QH6 A;  3VBH C;  1LHO A;  4XXA A;  4XUO A;  4YWA A;  4C8D A;  4CTE A;  4JRL A;  3I49 A;  2OW4 A;  5JXG A;  4JQR A;  1HRV 1;  2ZAC A;  1SCR A;  2E7Q A;  1AYN 1;  2R06 2;  3A7Q A;  4WM8 C;  3MO4 A;  3DXT A;  2WN3 A;  1CZT A;  4FTE A;  1HRV 3;  2LTN A;  1QQP 1;  3CNA A;  4PQ9 A;  1E57 A;  1URX A;  3VN4 A;  2BRT A;  3I2F A;  4CPB A;  3CIH A;  3ZOI A;  3H1M A;  4JTN A;  3ST7 A;  5DAV A;  5IWF A;  4AOC A;  4AK3 A;  4CYD A;  3IDA A;  1QWR A;  1W3X A;  3JQW A;  3LFI A;  2V4A A;  5FZO B;  4EWA A;  1DYO A;  3VD3 A;  4QB6 A;  4LOS A;  1RUN A;  4HVQ A;  3UK9 A;  5L19 A;  5CKN A;  5LA0 A;  2R1B A;  3RRD A;  5E89 A;  1W0P A;  4RS5 B;  3E6D A;  1D4M 2;  2O8Q A;  2VNO A;  3IDB B;  1CAU B;  1DQ2 A;  1FX5 A;  5CAZ A;  1VBA 2;  3IMM A;  4TWT A;  5GZF A;  4COU A;  3ZYI B;  2Q8C A;  1G9B A;  1HDK A;  1GFF 2;  3MDP A;  1GZC A;  2WT0 A;  5JR7 B;  4AL9 A;  3I2O A;  1E5S A;  1U5I A;  1ZNP A;  3LIH A;  4IEW A;  4CCC A;  1OF4 A;  3KHC A;  4YPJ A;  4MAD A;  1VBB 3;  2HYX A;  1XC6 A;  4MYE A;  2QKD A;  4PLO A;  1YUD A;  3B3Q E;  5L7O C;  2P6C A;  4L8Q A;  3I54 A;  4UW4 A;  2OYZ A;  1VMJ A;  1Y9M A;  1Q5O A;  4DXT A;  4YLZ A;  4IW3 A;  5FZM A;  5FZ3 A;  4URT A;  4RD7 A;  4E4H A;  3MGU A;  1PZ8 A;  1DP0 A;  1UY4 A;  5JI9 A;  4S2G A;  3J7M A;  1VBE 3;  4QQH A;  5CG9 A;  1J58 A;  2QUO A;  2Y6L A;  3J4U H;  4BM8 A;  3DPR C;  3MIC A;  5J1X A;  2ARX A;  2ZGK A;  3HJR A;  4QKF A;  2GC3 A;  2J1V A;  3KVA A;  4I01 A;  3ZVX A;  2XH6 A;  3AKQ A;  1GP5 A;  1W6M A;  2GC1 A;  2HJI A;  1NKG A;  1F31 A;  3NNG A;  5AFE A;  5C8C A;  2Q1M A;  3BTA A;  4QB1 A;  5I0T A;  5BNP A;  4M0H A;  4AED A;  2E53 A;  4FOY A;  2V5D A;  1VAK A;  3O1U A;  1DYK A;  2QVS B;  2BQP A;  1GZW A;  3VLB B;  1W8F A;  1W9S A;  3OJB A;  3RZL A;  4M3C B;  4C91 A;  4DB5 A;  5J7M A;  2ZEY A;  1K5M A;  4OHW A;  1OQ1 A;  4PQQ A;  1CD3 G;  1XNT A;  1WCU A;  4D7S A;  1FXZ A;  2YC2 A;  5K0U C;  3TN9 1;  1UX6 A;  4WVV A;  2VUD A;  2JDK A;  1BKZ A;  4KGQ A;  4CEY B;  2VNR A;  3VKL A;  2AZ5 A;  3NNL A;  2AEZ A;  3GF6 A;  5GLV A;  4AI1 A;  2VBB A;  4QX2 A;  3ENR A;  3NKG A;  1NCR B;  4UFL A;  5CFD A;  3UKV A;  4FOV A;  5L73 A;  2AEY A;  4BLJ A;  3NNF A;  3OUI A;  1C1L A;  1HB1 A;  5EYX A;  5JI7 A;  3CKH A;  5T5P A;  4ERO A;  4OHX A;  1WMX A;  5FYC A;  5A6Q A;  2DF7 A;  3TOJ A;  3ZFE B;  2JDM A;  1CZV A;  3OPW A;  4GWN A;  4IND A;  1J1T A;  2ZHK A;  2WZP P;  4B4Q A;  4BYY A;  1SBF A;  5BV6 A;  2DDU A;  5IFT A;  1JOJ A;  2D6P A;  3EBR A;  3JBG 3;  2E33 A;  3ZIW A;  3KHB A;  1IS5 A;  3LE0 A;  5C8W A;  5EIY B;  3AP5 A;  3J7L A;  4RR3 A;  2VC9 A;  4CPB D;  1MS1 A;  1VAM A;  3OD0 A;  3THP A;  3OUJ A;  3X29 B;  3FUQ A;  5BYN A;  4ITC A;  5HI0 A;  1HQN A;  1XE7 A;  1QJY 2;  5A3N A;  2LRO A;  4MET A;  5FJK A;  2WO7 A;  4Y5Z 0;  1H2K A;  4XVH A;  1FAT A;  2JE9 A;  5FZ9 A;  1XND A;  2BZD A;  2EIC A;  1BMV 1;  3AK0 A;  3CEW A;  1MZF A;  2RMU 1;  1SBE A;  2XON A;  4L0P A;  3U78 A;  2PXJ A;  4M00 A;  1IKP A;  4AGG A;  3VZM A;  1LOA A;  4JC1 A;  3VBR C;  3I2D A;  2XPJ A;  1QOS A;  2OVU A;  3GDB A;  4ONU A;  4RFR B;  5GLU A;  4Q4V 1;  1BBT 2;  4P9G A;  2RDN A;  2B5H A;  4Q4V 3;  1PIV 3;  3ZMO A;  4Y1U A;  4G4F A;  1GNH A;  2A70 A;  2W0X A;  2K2S A;  2W1U A;  2WZE A;  3I8T A;  1EV1 3;  4FPF A;  2YYO A;  5FMB A;  4ZU4 A;  5A3T A;  3ZDV A;  4ARX A;  4AZZ A;  4NWV A;  4PI2 A;  3ZFE A;  5FBJ A;  3SCF A;  2Z4F A;  1AX0 A;  3PVB B;  4A4A A;  4BQ3 A;  5DUX A;  3WF2 A;  4OUE A;  3H8X A;  3OBA A;  2DU1 A;  2BP6 A;  4LEJ A;  2FDH A;  5FYZ A;  3VL9 A;  4W65 A;  5A32 A;  3LIG A;  4Q27 A;  4QHB A;  3ETQ A;  3JUU A;  4N53 C;  3RYP A;  1TEI A;  3SIS A;  4AHW A;  1G9D A;  1UMZ A;  3NVC A;  1GV9 A;  2VG9 A;  2YZ4 A;  1V6I A;  1UPI A;  2DUR A;  5T50 A;  1NT0 A;  2R0F A;  3D8C A;  4MGQ A;  2XG3 A;  1JU3 A;  1RMU 2;  4CDU A;  4NWW A;  2D6M A;  1RUF 1;  1W2N A;  3J7N A;  5FY9 A;  4N8M A;  2D43 A;  3KGL A;  3MIE A;  3OBR A;  4R9B A;  4XW3 A;  1DG6 A;  5BNO B;  5C3O A;  3IZO A;  1CAX B;  3OUH A;  1PO2 1;  1RUE 1;  5LB6 A;  2DVB A;  3E1F 1;  4IV3 B;  3FL7 A;  4Z07 A;  1CN1 A;  2E31 A;  2V5Y A;  2B9U A;  3AYC A;  3AZV A;  5K7P A;  3OGG A;  4TN7 A;  1MQT A;  5FYH A;  5FZG A;  1OUS A;  2OQ7 A;  2WZR 2;  4OHZ A;  2V09 A;  3ZSK A;  1VRH 1;  3MBW A;  3UJO A;  4YFW A;  3ATG A;  3JB8 A;  4QQ2 A;  4E27 A;  5IT6 A;  2X05 A;  5C7G A;  1U5X A;  2QQU A;  1HRI 1;  3IB3 A;  1SAC A;  1RUJ 2;  2KXL A;  4P9Y A;  1JZ5 A;  4MG2 A;  5FPZ A;  3KV9 A;  4N7I A;  1QQP 2;  2Y33 A;  4XDO A;  5I0R A;  1MS5 A;  1RUI 1;  4NRM A;  3ZYJ B;  3H1W A;  5LBF A;  4MXW B;  4B1M A;  1V6L A;  1I5P A;  1K45 A;  5F37 A;  3G6J B;  5ACA 3;  5IVF A;  4QX5 A;  1TME 3;  3WW4 A;  1QDO A;  5CG8 A;  3IMN A;  5AFB A;  1GOG A;  3KCY A;  1DZQ A;  5FRA A;  4IV1 B;  2GNT A;  4NUB A;  2O0O A;  1TNF A;  3ZYR A;  1GIC A;  4FT8 A;  4I3P A;  1NLQ A;  2HWD 3;  4P00 B;  4U2A A;  5FY8 A;  4P14 A;  5EV7 A;  2BER A;  1JMU B;  2OQ6 A;  3SCG A;  4J6G A;  5C4W A;  5FYU A;  5IK5 A;  4QM8 A;  3WHT A;  1CR7 A;  1KIT A;  2B45 X;  4QDR A;  4CP9 B;  3WCS A;  4L92 A;  4QKB A;  4H7M A;  1W6O A;  1RYY A;  2VCA A;  3SKV A;  5FZD A;  3VBH B;  3WF4 A;  3HQU A;  2ZHL A;  1ND2 C;  2CU5 A;  4LBM A;  5FZ6 A;  1AXK A;  2ET7 A;  3I3D A;  4RHV 1;  1EYB A;  4UFI A;  5JIA A;  3L2Y A;  1JOP A;  1V6O A;  4Q2F A;  1FT9 A;  4RHV 3;  2FZ2 A;  3N9M A;  3HBZ A;  4IE7 A;  4MGZ E;  5LWB A;  1WCD J;  3VUO A;  2CV6 A;  2DVA A;  1CIY A;  2WLP A;  2GC2 A;  1SDD B;  2WFF 2;  1QJX 2;  2WLQ A;  2WS9 1;  1OT5 A;  1QU0 A;  4GWI A;  2C0Z A;  3VBO C;  4AI0 A;  4COZ A;  1GQH A;  2VEC A;  1XB9 A;  4IE0 A;  1WCK A;  2H6B A;  3MYX A;  1HQL A;  1S0E A;  4CCL A;  5DDJ 2;  2B9V A;  3WW1 A;  1UD1 A;  1U12 A;  4UOJ A;  5FYT A;  1NCQ A;  4O9E A;  5JSP A;  3KV4 A;  1N3P A;  3LAG A;  4BOW A;  3KCX A;  5FOB B;  3HWJ A;  3I2J A;  3MFC A;  3ZYB A;  4AAP A;  2GME A;  4FPE A;  4XET A;  5F7U A;  3GGL A;  4ORF A;  3VDD C;  4JX0 A;  5KC5 A;  1AYM 1;  1PVC 2;  1SFY A;  3HNB M;  2A7A A;  2VH9 A;  5DAQ A;  1IG0 A;  3AP9 A;  2R07 2;  2EVX A;  1AUY A;  2RJL A;  4DPN A;  3R0R A;  2WNU C;  2UWA A;  5LBC A;  4EN9 B;  1N1V A;  1GNY A;  1RUC 1;  3I97 A;  1O3T A;  1IGO A;  3B01 A;  2XBO 3;  3FE5 A;  2YFZ A;  3SLI A;  4DUW A;  3IPV B;  3S30 A;  4HMZ A;  3LB9 A;  4NHX A;  1VAL A;  4XAA A;  3SQO A;  1X7N A;  3HN1 A;  1XYO A;  1JBC A;  1JW6 A;  2XLG A;  3F95 A;  2ZHM A;  4QAW A;  1S2K A;  3DPR B;  5F5C A;  2Q5T A;  3P6B A;  5F8P A;  4D69 A;  1BVP 1;  1ZZ6 A;  1JZ3 A;  5KXC A;  5A6X A;  1WUV A;  2RM2 3;  3AKT A;  4AVT A;  3UGF A;  2SLI A;  4OCT A;  4LHL A;  4LO8 A;  3NKT A;  1WWY A;  2JG9 A;  4HAN A;  4XYX A;  3VB9 A;  2ZX3 A;  1W3V A;  3WF0 A;  2O8O A;  1O4Z A;  1RUD 2;  4XUN A;  4R4Z A;  2VUJ A;  1JI6 A;  2D6L X;  5KHH A;  1MS0 A;  5JXH A;  3KT7 A;  2WC2 A;  5LBE A;  4KWU A;  5HV0 A;  4QMA A;  3VHO A;  2W68 A;  2NP0 A;  2D97 A;  3RI9 A;  1OD3 A;  2VZO A;  3PUS A;  2B42 B;  3ROU A;  5G04 L;  2I45 A;  2CYF A;  2WA3 A;  5I91 A;  3O1P A;  3UV9 A;  4HT1 T;  4UYB A;  2VTX J;  5FZH A;  1BQP A;  2RMU 2;  5SV8 A;  1AR8 1;  1VB2 A;  4IQP A;  2VXR A;  4LBQ B;  3MZH A;  1IZ3 A;  3MLJ A;  1X9T A;  5JWP A;  3EYP A;  3IM0 A;  4WBB A;  1SDW A;  4K9S A;  3WQ7 A;  4XAC A;  2DCT A;  4Q4X 2;  1L7L A;  4EYU A;  3O1S A;  4YRD A;  2VZR A;  4D94 A;  3IAP A;  3Q8F A;  5FV3 A;  3NST A;  1QNY A;  3RFR A;  2P17 A;  4YVS A;  3P3P A;  4XJW A;  2ZTN A;  2VBD A;  1N3O A;  2XJP A;  4NRP A;  4B1L A;  1R1A 1;  1ZBA 3;  4LBJ A;  4PLM A;  4WVM A;  2EXK A;  4QX8 A;  2QQM A;  2HEV F;  2D3S A;  2PHW A;  1TMF 3;  4ZU7 A;  1PO1 2;  4UI9 L;  4Y24 A;  3GHN A;  1NAE A;  1W04 A;  2PHT A;  1NY7 1;  2QFE A;  5CNA A;  4Y1Y A;  2E9Q A;  3U14 A;  2QDN A;  1XE0 A;  2ZEZ A;  3NJY A;  4HK8 A;  5AC9 1;  4UFM A;  3I2H A;  1LEN A;  2WYF A;  4IER A;  2DFC A;  2W9X A;  4IUG A;  3VGI A;  1HLC A;  3EJK A;  4LK6 A;  3T0B A;  3C8X A;  4AEM A;  2VQA A;  3MIF A;  5FXX A;  2YBS A;  2PHU A;  4Q0U A;  5FAX A;  1W03 A;  1K12 A;  1RUF 2;  3WSO A;  3HD8 B;  1BLZ A;  3Q8E A;  5B4N A;  4QHO A;  4HN0 A;  5FZ8 A;  3NMB A;  3WX5 A;  3HR9 A;  3RZG A;  3MUY 1;  1CX4 A;  5FBZ A;  3T08 A;  1ZBE 2;  4KNC A;  2ZGN A;  3L9J T;  1Q8O A;  1EPZ A;  5I0D A;  2EAK A;  3FFZ A;  1NUK A;  3UT0 A;  3N9P A;  1US3 A;  1ULE A;  5FLI A;  2ZA9 A;  1X9P A;  2ZGL A;  4BDV B;  5C8C C;  2OPW A;  2RS5 1;  5BNP C;  1O3Q A;  1ZZ9 A;  4AED C;  2J1A A;  5IAX A;  1YLL A;  1LHW A;  4H55 A;  1X82 A;  3VD7 A;  3N9Q A;  1ZA4 A;  4LQR A;  3O0X A;  2JKX A;  1UNB A;  1EAH 3;  1EY2 A;  1UY3 A;  1RUI 2;  2G1M A;  4CP0 A;  1UO9 A;  4Q4Y 3;  2YU2 A;  1W8H A;  2I74 A;  2VXJ A;  4HPK B;  3VD5 A;  1K5M C;  1LNS A;  1NXD 1;  1W2A X;  4FVV A;  4LO5 B;  2FDJ A;  3BYW A;  1AZD A;  1JZ4 A;  4N43 A;  3VDA A;  4B7K A;  5E88 A;  5A7W A;  1FPN 1;  1OMI A;  5ISL A;  3OB8 A;  4IGQ A;  1FMD 3;  3IKW A;  4LK7 A;  5FQ0 B;  4AE2 A;  1RXG A;  1NX9 A;  1U5Y A;  4IET A;  3T0D A;  1G6N A;  3PUH A;  1UMI A;  1WLW A;  1SLL A;  1AR6 1;  2CGN A;  1IS6 A;  5FP8 A;  2R04 3;  4N7U A;  2IXJ A;  2PLV 1;  1LEM A;  2RG4 A;  2FDG A;  1MPX A;  4D6Q A;  1LOF A;  2PLV 3;  3SEE A;  5SV5 A;  3RSJ A;  3WNM A;  4DFS A;  1JYX A;  4CU6 A;  3F2Z A;  1RC6 A;  1QY4 A;  2J42 A;  4JQT A;  1WKY A;  1Y4W A;  1YQ5 A;  3VD9 A;  4AAX A;  3BB6 A;  2VE1 A;  3OYW B;  3C2U A;  4Y20 A;  1CAW A;  1Z7S 1;  2BNO A;  2HKX A;  3MLK A;  4DIN B;  5FZC A;  3H3Z A;  5DZF A;  3ZSE A;  4SLI A;  2FD8 A;  2XWB B;  1VBD 1;  3AMH A;  2YDE A;  5FPL A;  1G9A A;  3V0B A;  1WMF A;  3AXD A;  1A6C A;  2LRP A;  1GZT A;  1W9W A;  3JXS A;  1UY2 A;  3WG4 A;  4NJ4 A;  3WVJ A;  4RL7 A;  1BEV 1;  4HL0 A;  3NNJ A;  2W95 A;  3ILN A;  3SXW A;  1XOY A;  1HJF A;  4KH9 A;  1BEV 3;  5A3U A;  5C9A A;  4FPJ A;  2C1F A;  3THC A;  2FQP A;  2RV9 A;  3WDV A;  3WNN A;  1GZ9 A;  3M7A A;  4XFC A;  1F35 A;  1V70 A;  1KXG A;  1W9T A;  4FFF A;  3ZFG A;  4QX7 A;  2YV8 A;  5FXZ A;  3AP4 A;  3CU7 A;  1COV 2;  4ARY A;  4K20 A;  3EHK A;  2JEM A;  2FCV A;  3POW A;  1UAI A;  1VBC 1;  4F7Z A;  3K51 A;  3PUQ A;  3E5Q A;  1VBA 3;  3GZA A;  2DWR A;  1MVQ A;  1AYM 2;  4XJ9 A;  4YGD A;  2YG0 A;  5EP9 A;  5FKC A;  4QXB A;  3ZFE C;  4Q4W 2;  1LGN A;  4LIT A;  5C3R A;  1R08 1;  4W6Y A;  3TEX A;  5KC6 A;  1ND2 B;  2VOW A;  1RUC 2;  4AQT A;  3NW4 A;  5DZG A;  2BGO A;  4X6Q B;  4E2Q A;  2VGD A;  1YXW A;  5IVE A;  1O91 A;  4OI2 A;  4LBO A;  2X10 A;  4TSV A;  2X53 S;  1MR5 A;  1VIW B;  4NIA A;  4CCD A;  3H1Y A;  2IVJ A;  3OPZ A;  5I8Y A;  4XUT A;  3T2P A;  1C5H A;  4YW3 A;  3WT3 A;  1WCQ A;  1RL3 A;  3OG2 A;  4WZF A;  1ENQ A;  1UYY A;  4LUK A;  3ZN6 B;  4CDU C;  3D0S A;  4KMQ A;  4L99 A;  1UU5 A;  1RUG 3;  2ARA A;  1C8M 1;  2TUN A;  4CUC A;  3VBS A;  4LOR A;  1KDK A;  2HWE 1;  4NO4 A;  4YW1 A;  5DUW A;  4N9H A;  3TWI A;  1MQT C;  4MUV A;  4CXY A;  1LOE A;  4AQ2 A;  3OY8 A;  3VDD B;  1LES A;  1X8M A;  4DOU A;  4LO7 A;  3LPG A;  4M4P A;  4PIY A;  2XJV A;  1SEF A;  5LY2 A;  5CU1 A;  3H3L A;  3WNX A;  5FZL A;  1LUL A;  3N9O A;  1HB4 A;  3EQE A;  2WNU B;  2PQQ A;  2GMP A;  3I3M A;  3NV2 A;  1QXJ A;  4KQ7 A;  4QQL A;  4FOQ A;  4OMD A;  4I2O A;  1HXS 1;  4LUL A;  1ZA7 A;  4YW5 A;  2W3J A;  4DXZ A;  4GMP 3;  1DLL A;  3TRS B;  5JOY A;  1HN0 A;  3MI8 A;  4EE2 A;  2VCC A;  4LNV A;  3UKN A;  2VO5 A;  4A6S A;  2C9A A;  2JJ6 A;  1B35 A;  1A3K A;  1VPH A;  2BWA A;  1DQ1 A;  4HOO A;  4UXA A;  1AL2 2;  2WAO A;  3N7M A;  4FPK A;  2VMI A;  1ODM A;  1YFU A;  1XJA A;  1WGP A;  2IXK A;  1QJU 1;  3ZYH A;  4NE9 A;  1I3H A;  1BHG A;  1Y7B A;  2MEV 2;  2HEY F;  2ZGM A;  3IT8 A;  1V9U 2;  3K77 A;  1JYI A;  1H30 A;  1QJU 3;  5C4W C;  5IAV A;  4HG6 B;  2WRA A;  3K2O A;  2LUW A;  4YG6 A;  4BB3 A;  1XNK A;  3B02 A;  3M3I A;  1ASJ 1;  3WW3 A;  4E8C A;  5KXB A;  5JLV A;  3BCW A;  2QE3 A;  5AC9 2;  1WA4 A;  2CGP A;  4UBH A;  1ASJ 3;  3ZPY A;  3AKS A;  4WM7 A;  1YJL A;  2J1E A;  4HZF A;  1LU1 A;  1O8S A;  1JOB A;  2RR1 2;  3VL8 A;  2VZ3 A;  2XJS A;  4C1X A;  4FPL A;  3GCW A;  3WEZ A;  2DCZ A;  2GDF A;  3KZ4 C;  2RS1 1;  1WLD A;  5H9R A;  3ZO0 B;  5ABJ A;  4FPC A;  5J37 A;  1WLC A;  5B4X A;  1C3H A;  3FN9 A;  5F1R A;  5JDB A;  5EJ3 A;  3A0N A;  2BJS A;  1RVF 1;  1WZX A;  1MS3 A;  3VKO A;  1ZYB A;  4FFG A;  3FLP A;  3WY6 A;  1AR9 2;  3BTZ A;  4TLG A;  5C5T A;  2E7T A;  3WOG A;  1DGW A;  2UYB A;  3C7G A;  1F15 A;  2X29 A;  3O1V A;  4LKS A;  2XKP A;  1D2Q A;  1NCQ C;  3QAC A;  4BK4 A;  3W5N A;  5FK7 A;  3OGJ A;  1PM7 A;  3ZM8 A;  1OQD A;  3VHR A;  4JTO A;  1KD7 A;  5LRR A;  5A6Y A;  5A7N A;  4FP3 A;  4ISQ A;  5A3O A;  4ES9 A;  3BKZ A;  3K48 A;  1XRU A;  3VBU A;  1YQ2 A;  4XEZ A;  5FMO L;  2XOM A;  2J1T A;  1T6B X;  2V4V A;  3N7L A;  3THD A;  2Y34 A;  4QXK A;  3ZYF A;  4A3Z A;  2QQV A;  4X8N A;  2HEW F;  2W2I A;  2HWC 3;  3N9L A;  1C5I A;  1KQR A;  4B3N A;  1RUO A;  2W52 A;  3RPQ A;  2ZCW A;  4HLT A;  3TAY A;  3CQO A;  1MS9 A;  2EIB A;  1G7Y A;  2CAV A;  1PK6 A;  1RMU 3;  4HFS A;  5A33 A;  3H8O A;  3MEP A;  4HVO A;  1AR6 2;  1S0I A;  1V6J A;  4CDX B;  3VBF A;  4HBN A;  5BXX A;  1U0A A;  2YU1 A;  2YY1 A;  3GYD A;  3ZXL A;  4QX0 A;  4Y1Z A;  1FOD 3;  2E26 A;  1VR3 A;  1SFN A;  1W6M B;  2ADE A;  2EF6 A;  2WZR 3;  2Y26 A;  2P5B A;  3APB A;  3ASI A;  4MHU A;  4FAG A;  3ZXG A;  2JG9 C;  2LS6 A;  3OEB A;  5C8C B;  3J8F 2;  5BNP B;  4AED B;  4AEJ A;  3ETP A;  1NXM A;  1Z7S 2;  4IEV A;  1GZW B;  3HPN A;  4GKX A;  4U36 A;  2TEP A;  1RUJ 3;  1XYP A;  4XHB A;  4DIQ A;  1VBD 2;  3QBQ A;  5A6Z A;  2D3R A;  3B9C A;  3ILR A;  4XFB A;  5JSR A;  2GND A;  4XMA A;  5F3I A;  3ACL A;  5FZB A;  4F8A A;  1K5M B;  3M3Q A;  4JRA A;  1VBB 1;  4QPW A;  4AEK A;  3E5X A;  1O6U A;  1SG3 A;  2PHD A;  2BNM A;  1PGL 1;  5A70 A;  4LA2 A;  3J26 N;  1W9F A;  4GH4 B;  1MS8 A;  2XVK A;  2Q8O A;  2QQL A;  5FP7 A;  2VTX A;  5CA6 A;  1R09 3;  5FPU A;  3NJX A;  1VBE 1;  4KWJ A;  4QU2 A;  5FWE A;  5FYB A;  5CFD B;  3HAG A;  2DUQ A;  3RMY A;  5K9Y A;  3SKJ E;  3O1O A;  1YFY A;  3I3B A;  4ZXK A;  4M3C F;  5C3Q A;  1IKQ A;  1QH7 A;  1S2B A;  1VBC 2;  4NN0 A;  4Q26 A;  4YVS C;  3VZK A;  4LPL A;  4CDX A;  1PMI A;  5K8S A;  4QT6 A;  3MHZ A;  5FLJ A;  2DBI A;  4HKL A;  4MX3 A;  5FMO S;  2Z2S B;  4A2U A;  5FY0 A;  4LKD A;  3RZM A;  4YM3 A;  3RZK A;  1NOV A;  1PGW 1;  1R08 2;  3WCR A;  1OA3 A;  4COV A;  4YGC A;  4BIF A;  3U11 A;  4AI3 A;  5DMY A;  4OZX A;  2YGL A;  1Q56 A;  4EN6 B;  2ZGU A;  1W8U A;  1RUH 3;  4RR3 B;  1SMV A;  1PM4 A;  3H8U A;  1MS4 A;  3LA7 A;  3ZIX A;  1LB2 A;  4QPI A;  4NHM A;  4AHY A;  5LRS A;  4UW5 A;  2EAA A;  1S55 A;  1W0O A;  2ZML A;  3ABZ A;  1CJP A;  1W8N A;  2VMH A;  4JAA A;  2BBA A;  4Y1X A;  5CIS A;  3BOW A;  1IG3 A;  4CUA A;  4A45 A;  1Q8V A;  3RYK A;  1V6K A;  4NHK A;  5E8A A;  1SCS A;  1N1Y A;  2WFF 3;  4GH4 A;  5GZD A;  2ZJC A;  1QJX 3;  1RJ7 A;  4QDQ A;  1C8M 2;  2GP3 A;  3MIG A;  1GUI A;  3FJS A;  2FDI A;  3ON7 A;  1HKD A;  5DXD A;  1N1T A;  4NPL A;  1GWL A;  1P8J A;  1WD3 A;  1JH5 A;  3AVR A;  5DDJ 3;  4YVW A;  5F32 A;  2YRO A;  1YFX A;  5HCH A;  2B39 A;  2NMO A;  2ENR A;  4XJ8 A;  1UW8 A;  2VUL A;  3N36 A;  4AHX A;  1ZRC A;  3LF7 A;  4JKM A;  4CCN A;  5H9Q A;  3T4V A;  3O7O A;  1OFN A;  1FV3 A;  1QGL A;  2N7G A;  2VOK A;  2XHN A;  1RHI 2;  3JBG 1;  2LAL A;  1JYT A;  4ZPI A;  2R07 3;  3QLQ A;  4R8H A;  1O8P A;  1CPN A;  5A32 B;  1HXS 2;  1NA1 A;  2VOX A;  3ES4 A;  5JXJ A;  4AHZ A;  4OMC A;  1WW4 A;  3LA3 A;  5FO9 B;  4DMI A;  1NG0 A;  3GZE A;  3MLL A;  4JHZ A;  2UWB A;  2VBP A;  4QM9 A;  3I4I A;  2P3J A;  1SZB A;  4N43 C;  3BIE A;  1CVN A;  1KDM A;  2R6Q A;  1BK0 A;  2OUJ A;  4GB3 1;  4AVV A;  1YJK A;  3BU0 A;  2SBA A;  4W6X A;  2Z5W A;  1C28 A;  4P5Y A;  4B8E A;  4CDU B;  4GB3 3;  1W6P A;  2DCY A;  1XE8 A;  2PQS A;  2ZX1 A;  2GNB A;  4NIH A;  2KD7 A;  4JKL A;  5EFU A;  1AXY A;  3E97 A;  2ZPX A;  2HWF 1;  4TLF A;  4YW2 A;  2YC0 A;  4C0H A;  2WNV A;  1OC1 A;  2HWF 3;  3SMH A;  1PIV 1;  1Z0H A;  4A7K A;  2LM3 A;  1MQT B;  4ATE A;  3NJV A;  4QQO A;  4P9L A;  1WD4 A;  2JEC A;  1EV1 1;  3JD7 2;  5D21 A;  1NLS A;  4K1Y A;  1LOD A;  3ALQ A;  3AMP A;  1S2E A;  2QQO A;  2VPV A;  4UW6 A;  4XF3 A;  1SLC A;  3A23 A;  4HN1 A;  2GAL A;  4KI5 M;  3FMG A;  5JZG B;  2MNG A;  2WNE A;  3UES A;  4G3Y C;  3IDE A;  5KHK A;  4A42 A;  1SLB A;  4S2F A;  3O1M A;  3ZXJ A;  2CHH A;  3VZN A;  2JDZ A;  1ZRF A;  5J36 A;  3OSD A;  1LHU A;  4BQ5 A;  2I2S A;  5CIR A;  3RWN A;  3U4S A;  4CU8 A;  3WIN E;  2ID4 A;  1RVF 2;  4LO6 B;  1OUR A;  4Q4X 3;  5F6L B;  3M70 A;  3IIA A;  4XBL A;  5C9A C;  3KF3 A;  4Q0Q A;  1VMH A;  2J1U A;  1N1S A;  5FY5 A;  2JXA A;  1OPM A;  2R16 A;  4K6B A;  5FUI A;  4O65 A;  5DPN A;  5FY7 A;  3ZFG C;  5F2W A;  1W28 A;  5T5J A;  3DKQ A;  2Z79 A;  2JWP A;  1HQW A;  1IHM A;  5C4W B;  2A3Y A;  1AR7 3;  2YHJ A;  1CIW A;  3HT2 A;  1PO1 3;  1TE1 B;  1QF3 A;  5A3W A;  1W6O B;  3I2G A;  4AW7 A;  5ANN A;  3HQR A;  4EQV A;  2WO1 A;  4Q29 A;  3OGV A;  2VOV A;  4R9D A;  2V73 A;  1K5J A;  2K0G A;  1SLI A;  4I30 A;  4I0A A;  4J25 A;  1HRV 2;  3C7H A;  5JZG A;  1UCX A;  1AYN 2;  2RDQ A;  4UW3 A;  3POJ A;  4ZON A;  1DF0 A;  2A1X A;  4EWE A;  2DU0 A;  2OA2 A;  3I3Q A;  4PDW A;  3VDC A;  4EN8 B;  5EZW A;  4Q1R A;  5ACA 1;  1TME 1;  2VZP A;  2WSU A;  3BOP A;  3I2I A;  4OI1 A;  4L9B A;  1ZBE 3;  3USS A;  3FLR A;  4YNI A;  4UF0 A;  2BWC A;  2DFB A;  1UOG A;  4LHS A;  3WDY A;  2QQP A;  1BYH A;  3T2Q A;  2P3Y A;  5IW0 A;  2JIJ A;  4BK5 A;  5BUV A;  2BOJ A;  4HK9 A;  4IEP A;  2HWD 1;  3VBS C;  5C3P A;  4MLO A;  5FOJ B;  3H9A A;  1NCQ B;  1ENR A;  1FNZ A;  3GZU C;  4XF4 A;  1J59 A;  2AUY A;  3GJA A;  3PU3 A;  1O3S A;  4HSJ A;  2D7F A;  1C4R A;  2D98 A;  5EJ1 B;  4IEY A;  2ZXQ A;  4JVA A;  1QOO A;  2VUA A;  4ET7 A;  5FZK A;  4MO3 M;  3U1X A;  4FTS A;  5GLT A;  5LA1 A;  4AXO A;  2W47 A;  4PIZ A;  4CCO A;  1D2S A;  1OUX A;  4F3J A;  2Q30 A;  3WLU A;  3U0Z A;  3HMY A;  2A6X A;  2A73 B;  2WIN B;  3UYJ A;  1QJF A;  2VVE A;  3KT1 A;  2RS3 1;  5FP3 A;  3IBM A;  1JU4 A;  1L7R A;  1VBE 2;  2RS3 3;  2ARB A;  4LE4 A;  3ZN5 A;  5B2G B;  4E2S A;  3LDK A;  2R1D A;  1B35 C;  3NRU A;  4QKD A;  4V2V A;  2GH2 A;  3S5Q A;  2R7E B;  4BH9 A;  2OPK A;  4WV8 A;  3ACF A;  2Y6J A;  5GAL A;  2JE7 A;  1YQ6 A;  3FX3 A;  4XF1 A;  2XLA A;  2FDK A;  2HWB 1;  4XQW A;  2JG9 B;  5JMO A;  1UKG A;  4XFI A;  2HWB 3;  5F6K A;  2Q1Z B;  3IAQ A;  1KFX L;  4PBO A;  2DCK A;  2W94 A;  5IK8 A;  2VY0 A;  1UY0 A;  4RQP A;  2WQ4 A;  4IL7 A;  4JHT A;  4AVA A;  3LEM A;  3QH7 A;  4WM7 C;  3OOX A;  5FY4 A;  3TN9 2;  2FDF A;  3FUO A;  3WP6 A;  2UY8 A;  1MAC A;  4XAE A;  2XBO 1;  2EA7 A;  3M3C A;  3RQ0 A;  3UGG A;  1RB8 G;  3KM5 A;  1ST8 A;  4FPY A;  1GSL A;  2VU9 A;  4Z82 A;  3WF1 A;  1DIW A;  5ABJ C;  4D7Y A;  3PJQ A;  4QGL A;  4LBN A;  1DGL A;  2TNF A;  5IJR A;  1AJK A;  4QGM A;  1COV 3;  4UFK A;  1S0B A;  4Z2W A;  1DQ5 A;  4BMB A;  1H4H A;  1S4C A;  2BVB A;  3WDU A;  2RM2 1;  3MID A;  4YVS B;  1OHF A;  3POG A;  2A3X A;  3RJR A;  5HPO A;  1KJL A;  1Y43 B;  1CPM A;  3NAP B;  5F9T A;  4HKW A;  3MFA A;  1BVV A;  1I9R A;  4K8F A;  5A7S A;  2JIG A;  3D5O A;  4WVM B;  1X33 A;  5JR2 A;  1LU2 A;  3CO2 A;  2VVF A;  5CKM A;  3WDX A;  2JX9 A;  2IXH A;  2J7M A;  1UYX A;  4Q4W 3;  1OVP A;  2WJS A;  3LDB A;  3N35 A;  4B4R A;  2CWS A;  2H0V A;  4N90 A;  1MEC 3;  2BW8 A;  3VBU C;  4IES A;  1OH4 A;  2FHR A;  4AGR A;  1UZW A;  5DQ0 A;  2ZGS A;  3WV6 A;  4KBZ A;  4UWD A;  5E16 A;  3DEC A;  3ILF A;  1SPP A;  1YQ8 A;  2BU9 A;  5J96 B;  4NRO A;  2BUK A;  5FZ7 A;  2DTW A;  2YBP A;  5IFP A;  3ZMN A;  3AFK A;  3AP7 A;  4K1Z A;  4UFJ A;  3B94 A;  4QX1 A;  4XUR A;  5DUU A;  3ZYG A;  1PK6 C;  4FSJ A;  4Y3O A;  2FCT A;  2VQU A;  4DNY A;  5BNN A;  2VVD A;  4J1W A;  3H7J A;  4YG0 A;  3TEY A;  1LHV A;  1W90 A;  1UZ0 A;  4D8M A;  2O1Q A;  2XLF A;  3VBF C;  4NRQ A;  1U5Z A;  4Q4V 2;  1RXF A;  3OF1 A;  2W1W A;  5LA9 A;  5D8A A;  4WZC A;  3PNA A;  2WQZ C;  3LD8 A;  1JZ8 A;  1YFW A;  3NAP A;  1ZBA 1;  1F4H A;  1DQ4 A;  3KLS A;  4HVR A;  3HEI A;  1TMF 1;  4NMI A;  1ODN A;  1TVG A;  2PMW B;  2C24 A;  4A6O A;  1UXZ A;  2E32 A;  3V0A A;  2FBE A;  1JUI A;  4MGT A;  1R1Z A;  4A3X A;  3T09 A;  2ZMN A;  2YPD A;  4XF0 A;  2P3I A;  3BPS A;  4N43 B;  5A3L A;  2GSY A;  3T1L A;  4DEV A;  2YGM A;  2WWS A;  2P3K A;  5A7W B;  1ZZ7 A;  3QCW A;  3T4H B;  2DCJ A;  2A3W A;  2QQI A;  2NN8 A;  5C33 A;  1JN2 P;  1AL2 3;  2D44 A;  3I7D A;  2JDN A;  4YM1 A;  4JGZ B;  1DYP A;  2VR4 A;  1ND3 A;  5IVC A;  2VMD A;  1S1A A;  3HNY M;  4BXF A;  4HKO A;  3MW2 A;  5J98 B;  4I3G A;  1IQD C;  1H8V A;  4QQP A;  3AX4 A;  1W99 A;  1DGW X;  2FMY A;  3LPF A;  1FV2 A;  1PO2 2;  1RUE 2;  2GN3 A;  5GZE A;  3DV8 A;  5F39 A;  4GZ9 A;  4CDX C;  1V9U 3;  5FR3 A;  2QZ2 A;  1JZ7 A;  1OLQ A;  2ZGQ A;  4Y33 A;  3VDB A;  1GQP A;  2C5D A;  5FKB A;  3OGS A;  1VRH 2;  1LOC A;  2NZ9 A;  5DAP A;  3MPB A;  1PZ9 A;  4YW4 A;  3MW4 A;  2VME A;  5FZ4 A;  5T52 A;  2VW2 A;  3DGT A;  4Y20 B;  3DYP A;  1CAW B;  2Y6G A;  3UL2 A;  2CL2 A;  3U37 A;  1HRI 2;  1S0D A;  3W59 A;  1EAH 1;  1R64 A;  3K3O A;  1CES A;  4FPO B;  5JMC A;  1Q3E A;  1W6Q A;  5FK8 A;  4Q4Y 1;  3V0B B;  4QPI C;  4PJY A;  2MHF A;  1OLM E;  3K46 A;  5FYY A;  1D0H A;  3W20 A;  1KGY A;  1TME 2;  3ZR6 A;  4OFG A;  1JYV A;  1FNY A;  5A3P A;  4BIO A;  4OYU A;  1W2U A;  1FMD 1;  1PNF A;  2ORZ A;  3B7M A;  5C9A B;  4GH4 C;  1LOG A;  4PHZ A;  4XHX A;  4YZ1 A;  1LCL A;  2H0B A;  2UUR A;  4JCK A;  1VP6 A;  3PME A;  1PGS A;  4JGZ A;  4XFA A;  2XQR A;  5FO7 B;  1C57 A;  1NYW A;  2HWD 2;  3ZFG B;  4AI2 A;  5JOX A;  2R04 1;  2WWJ A;  3KT4 A;  1IPJ A;  4YVW C;  2ZX0 A;  5FYS A;  4DQA A;  5CFD C;  5HCB A;  1SFP A;  1H1I A;  2H6C A;  1PX3 A;  5FMC A;  4ISR A;  2G9F A;  2DTY A;  2C9K A;  5FPB A;  1H6X A;  3IN9 A;  4CDQ A;  5HCF A;  4B4P A;  4N9I A;  1W9Y A; 
#chains in the Genus database with same CATH homology
 2E33 A;  5B4X A;  3FN9 A;  4CU9 A;  3LE0 A;  4MGS A;  5EIY B;  1L7Q A;  2VC9 A;  4QDS A;  2YFU A;  5IYY A;  3C7G A;  4TTG A;  4LKS A;  4XVH A;  4XUQ A;  4BK4 A;  3W5N A;  2BZD A;  2EIC A;  2XON A;  1ULO A;  4L0P A;  1YQ2 A;  2XOM A;  2J1T A;  2V4V A;  3GDB A;  3THD A;  2WO3 A;  4A3Z A;  4A44 A;  2WZE A;  2W1U A;  3CQO A;  2EIB A;  2VTF A;  2JD9 A;  4ARX A;  2Z4F A;  1JZ2 A;  4A4A A;  3WF2 A;  3K75 B;  4OUE A;  3OBA A;  3LEK A;  2CDO A;  5LCW L;  3ECQ A;  4QX0 A;  4DXS A;  2E26 A;  5C70 A;  2Y64 A;  1W0N A;  1UYZ A;  2LS6 A;  3OEB A;  4MGQ A;  4MOA A;  2LW8 A;  3ETP A;  1JU3 A;  3HPN A;  2C26 A;  2WN2 A;  1DLC A;  2VZS A;  3E1F 1;  4QPW A;  3FL7 A;  1SG3 A;  2E31 A;  5JUV A;  3WF3 A;  3T2O A;  3UET A;  3MBW A;  2QQL A;  4P02 B;  3NJX A;  2X05 A;  5C7G A;  1JZ5 A;  3IB3 A;  1JYN A;  3SKJ E;  3I3B A;  4LPL A;  1KEX A;  3BGA A;  1I5P A;  1K45 A;  5C71 A;  1TG7 A;  3CZJ A;  3FHA A;  2VL4 A;  1GOG A;  3EB7 A;  1JHJ A;  5DMY A;  3VD4 A;  2VZT A;  3K4A A;  2W87 A;  3MUZ 1;  3I2K A;  4P00 B;  3ABZ A;  1W8N A;  2BER A;  1EUU A;  2BBA A;  4CUA A;  4A45 A;  4QDR A;  3WNL A;  2C4X A;  5EJZ B;  3SKV A;  3WF4 A;  1RYY A;  1US2 A;  2VCA A;  4QDQ A;  2YB7 A;  1T2X A;  1GUI A;  1XNA A;  1P8J A;  4CU7 A;  3HOB A;  2WBK A;  3I3D A;  1ULP A;  3LEI A;  4BXS V;  1UX7 A;  5JXI A;  1GOH A;  4JKM A;  2J1S A;  1CIY A;  3DYM A;  2XQX A;  1SDD B;  3DYO A;  2XHN A;  1J83 A;  1OT5 A;  2J22 A;  4GWI A;  1O8P A;  3WNO A;  5JXJ A;  2VMF A;  1SHW B;  3III A;  2VZV A;  4OMC A;  2ORX A;  3C7O A;  2Y8K A;  2B9V A;  4P08 A;  1XPW A;  2Y6H A;  4UOJ A;  4JHZ A;  2WAB A;  2JDA A;  2EIE A;  3I2J A;  4W8J A;  2W1Q A;  5F7U A;  2CDP A;  3GGL A;  3PUI A;  4P5Y A;  4ZZ5 A;  4JX0 A;  2PQS A;  5HXM A;  3HNB M;  3MV0 1;  1UY1 A;  2HLE A;  2KD7 A;  4JKL A;  4BJ0 A;  4FI9 A;  4Z2A A;  1GNY A;  3I97 A;  3NQH A;  3C7E A;  2YFZ A;  3NJV A;  4DUW A;  2QQO A;  4DEQ A;  3A23 A;  4KI5 M;  4RN5 A;  5JXH A;  2WZ8 A;  4QAW A;  3P6B A;  1JZ3 A;  3UES A;  2VQT A;  2W92 A;  4A42 A;  2L9L A;  4XUP A;  3WF0 A;  3I3E A;  4XUN A;  2VZ1 A;  3ACG A;  1UWW A;  4CU8 A;  1JI6 A;  2ID4 A;  2B4K A;  4KWU A;  2ZEW A;  4JKK A;  2J1U A;  1PX4 A;  1OD3 A;  2VZO A;  5DN2 A;  5FUI A;  5G04 L;  5DPN A;  1PMH X;  2JE8 A;  1CZS A;  4DUX A;  2WDB A;  2W1S A;  2VOT A;  2VZQ A;  4D0Q A;  3EYP A;  3W5M A;  3I2G A;  2WO1 A;  3OGV A;  2QQN A;  2VZR A;  3IAP A;  3OEA A;  4CVU A;  1UXX X;  3C7H A;  3GM8 A;  4DXR A;  2OKX A;  1H6Y A;  3VDC A;  2VMC A;  4PT6 A;  2Y6K A;  1JYW A;  2QQM A;  2VZP A;  4TXW A;  3I2I A;  4UAP A;  4UI9 L;  3CZU A;  1NAE A;  3GXU A;  4LHS A;  4W4Z A;  4XZU G;  3C7F A;  3MV1 1;  2ZEZ A;  3T2Q A;  4BK5 A;  5IFT A;  3I2H A;  4IUG A;  2W9X A;  3HNM A;  1D7P M;  3T0B A;  3WNK A;  4M4R A;  3C8X A;  1J84 A;  3WSO A;  1K12 A;  5B4N A;  2WYS A;  2EID A;  5EJ1 B;  2ZXQ A;  3MUY 1;  4ET7 A;  4MO3 M;  3T08 A;  5LA1 A;  2QQJ A;  2W47 A;  4ZZ8 A;  2WO2 A;  4PF1 A;  1O59 A;  5I0D A;  2X09 A;  1NUK A;  3BN6 A;  4CUB A;  1US3 A;  2WAA A;  4BDV B;  1JU4 A;  1L7R A;  2J1A A;  2VJX A;  3NRU A;  3VD7 A;  4LQR A;  2R7E B;  2W46 A;  2JKX A;  1UY3 A;  3ACF A;  2Y6J A;  1W8O A;  3VD5 A;  2VCB A;  2WQ8 A;  1LNS A;  1CX1 A;  1JZ4 A;  3VDA A;  5JMO A;  2WUH A;  3OB8 A;  3IAQ A;  3FHQ A;  1GOF A;  2DCK A;  2W94 A;  1NX9 A;  3AC0 A;  3T0D A;  3OGR A;  1UY0 A;  3PUH A;  1PMJ X;  1UMI A;  4A41 A;  3CDZ B;  3ACI A;  2RJ2 A;  3K4D A;  4ZY9 A;  2VZU A;  1MPX A;  4ZXE A;  3SEE A;  1JYX A;  2YC4 A;  3WNM A;  4CU6 A;  3F2Z A;  2W91 A;  1JZ6 A;  1GMM A;  1WKY A;  3WF1 A;  3VD9 A;  4AAX A;  3CMG A;  4OZO A;  5IJR A;  5CZK A;  1K3I A;  5CYY A;  3WNP A;  5HPO A;  1OF3 A;  1W9W A;  3JXS A;  1UY2 A;  2BGP A;  1HN1 A;  3D3A A;  3J7H A;  2W95 A;  5JR2 A;  3UNP A;  2VM9 A;  2J7M A;  1UYX A;  3WNN A;  3THC A;  2RV9 A;  4XUO A;  3T0A A;  4E8D A;  1OH4 A;  1W9T A;  4AG4 A;  4ARY A;  5JXG A;  5DQ0 A;  3LQC A;  3A7Q A;  3DEC A;  3MO4 A;  2WN3 A;  1CZT A;  5IFP A;  3A22 A;  3I2F A;  3K4Z A;  3CIH A;  4QX3 A;  4QX1 A;  4XUR A;  2YG0 A;  2VQU A;  5A1A A;  3IDA A;  1GU3 A;  1UZ0 A;  4D8M A;  1DYO A;  3VD3 A;  3A21 A;  4QB6 A;  2BGO A;  5LA0 A;  2W1W A;  2X10 A;  3P1I A;  1F4A A;  1EUT A;  1JZ8 A;  4XUT A;  3T2P A;  1WCQ A;  1F4H A;  3HEI A;  3OG2 A;  1UYY A;  1TVG A;  4A6O A;  4DUV A;  4KMQ A;  1UXZ A;  2E32 A;  2ZEX A;  1OF4 A;  4YPJ A;  2V72 A;  4CUC A;  4MAD A;  3T09 A;  2HYX A;  1XC6 A;  5LA2 A;  4DEV A;  4DXT A;  5G05 L;  2DCJ A;  2QQI A;  4W50 A;  1DP0 A;  1UY4 A;  2VR4 A;  3LPG A;  4M4P A;  2Y6L A;  3ZM8 A;  2VMD A;  3HNY M;  4QB2 A;  5J1X A;  1IQD C;  3HJR A;  2W5F A;  1W99 A;  2J1V A;  3LPF A;  2RVA A;  1K42 A;  4OMD A;  4GZ9 A;  2J1R A;  2W3J A;  1JZ7 A;  1NKG A;  3NNG A;  4QB1 A;  3VDB A;  1GQP A;  2VCC A;  2QQK A;  2V5D A;  2VO5 A;  3HN3 A;  3OGS A;  1W9S A;  4RYD A;  2WAO A;  2VME A;  3SEP A;  3DYP A;  2Y6G A;  3WQB A;  2ZEY A;  3U37 A;  1R64 A;  4PQQ A;  1XNT A;  2YC2 A;  3K46 A;  1BHG A;  3ACH A;  1UMH A;  3K77 A;  1KGY A;  1JYV A;  4HG6 B;  4GWJ A;  4OYU A;  4QX2 A;  2ORZ A;  3LEG A;  4E8C A;  5IHR A;  2J1E A;  1O8S A;  3CKH A;  1PX3 A;  2VZ3 A;  1CZV A;  2C9K A;  1H6X A;  2QBX A;  2DDU A;  3WEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...