5B4NA

Structure analysis of function associated loop mutant of substrate recognition domain of fbs1 ubiquitin ligase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
RNLLRNPCGEEDLEGWSLDVNGGDGWKVEELSRDQRKEFPNDQVKKYFVTSYYTCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRPDCGSKYQLTVRLLSENEDVLAEFQPDPATIQQKSDAKWREISHTFIDYGPGVRFVRFEHGGVDTHYWAGWYGPRVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a function-associated loop mutant of the substrate-recognition domain of Fbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords F-box only protein 2
total genus 38
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5b4nA00
5IYYA 2RVAA 3WF4A 2W1UA 3WNMA 2Y64A 1OF3A 3DECA 2WYSA 3I2FA 2VC9A 2OKXA 2ZEZA 5LA1A 3MUY1 3ACHA 1CIYA 1H6XA 3WEZA 1PMJX 2VTFA 4XURA 2Y6JA 4RYDA 5EJ1B 3CQOA 3OGRA 4KI5M 1SDDB 2YB7A 1ULOA 2X05A 3C8XA 4MGQA 2HYXA 4CUAA 3FHAA 2VQUA 3I3BA 1GMMA 3VDBA 3WF0A 4JX0A 4JHZA 4QDRA 3CZUA 3MUZ1 3IB3A 4W4ZA 3DYOA 3F2ZA 3SEEA 3LEGA 5CYYA 1DLCA 4LHSA 3SKJE 3VD5A 1KGYA 1UYXA 3JXSA 2B4KA 2VZOA 4BDVB 3THCA 4BJ0A 2WABA 1UYZA 3OBAA 3K75B 4DEQA 1PX3A 3MV01 2J1SA 3PUHA 3GGLA 1JYXA 3IDAA 2VZUA 2J1UA 1HN1A 3T2PA 1W8OA 3UNPA 3I2HA 2C9KA 3SKVA 1L7QA 3VD9A 1SHWB 1CZVA 2YFZA 2E32A 2CDOA 3HEIA 2V4VA 2CDPA 2VZSA 3NQHA 1JZ7A 4DXSA 2XONA 3MBWA 4UI9L 4IUGA 3NJXA 1OD3A 2QQIA 2QQOA 3AC0A 2W1QA 2WO3A 4W8JA 2LW8A 1GOHA 3OGVA 3NRUA 1J83A 4QDQA 4A45A 3T0DA 4A4AA 2J7MA 3J7HA 4MADA 2VJXA 2WZEA 4ET7A 4MGSA 3FHQA 4PQQA 4L0PA 4DUXA 2QQNA 2Y6HA 2ORXA 4ZY9A 2E31A 1PMHX 5IHRA 4UOJA 4UAPA 3WSOA 4DEVA 4CUCA 5C70A 3I2JA 2VO5A 1K12A 2ZXQA 2EICA 2WUHA 1P8JA 1XNAA 2Y6GA 1O8PA 3GXUA 3ACFA 5IJRA 4P08A 4P02B 2DDUA 2JDAA 2WQ8A 4BK4A 1UMHA 1WCQA 1PX4A 2WAOA 2ZEXA 4AG4A 2WAAA 4QX2A 2VOTA 1UMIA 5HXMA 1XC6A 2W95A 2W46A 4QPWA 2LS6A 2W87A 1F4HA 1KEXA 4DUWA 1UYYA 4GWJA 1UY4A 2V5DA 2XHNA 2J1AA 4CU6A 1W8NA 2W1WA 4OZOA 4BXSV 1W9WA 5C71A 2VM9A 4BK5A 2Z4FA 4E8CA 2BGOA 4LPLA 3PUIA 3HJRA 3OG2A 3IAPA 1JI6A 2VZPA 2WN3A 4JKLA 2Y8KA 4AAXA 2VMCA 5IFTA 1TVGA 3SEPA 1MPXA 1JZ4A 1ULPA 2J22A 3T0AA 3IAQA 1UY2A 4W50A 2JD9A 3HPNA 2VQTA 4A3ZA 3CMGA 1CZTA 5C7GA 4QB1A 3I2IA 4XUNA 1NKGA 2L9LA 3U37A 4ARYA 4YPJA 1GUIA 3LPFA 2VR4A 1T2XA 5F7UA 2J1EA 1CX1A 2VZVA 4TTGA 2W91A 3P1IA 1UWWA 3VDCA 1DP0A 4A44A 1XNTA 4A41A 3MO4A 5JMOA 4GWIA 4XUQA 5JR2A 5LA0A 2W1SA 1JYNA 2QQMA 3OEBA 4LKSA 1EUUA 3GDBA 5HPOA 1JZ6A 3I2GA 2RV9A 1JU3A 1UXXX 4CU9A 2B9VA 2BBAA 1L7RA 1F4AA 4M4PA 3CIHA 4KWUA 2ID4A 1H6YA 1YQ2A 2VMEA 1OF4A 2VZ1A 4P00B 3VD7A 2QQKA 2QQLA 2VCCA 1NX9A 5JXIA 3LEKA 1XPWA 1O8SA 2JKXA 3T2OA 5J1XA 2EIEA 4ZZ8A 3A23A 2W47A 2WDBA 3ETPA 1EUTA 2Y6LA 2BGPA 3WNLA 5DQ0A 4QX1A 4D0QA 3BGAA 1NUKA 1GOFA 5G05L 3K4ZA 4CVUA 4XUOA 2ORZA 2ZEYA 3T2QA 3A7QA 5JUVA 2VZTA 3C7FA 5IFPA 5JXJA 1W99A 2W9XA 3A21A 1UXZA 4DUVA 2VZ3A 4PF1A 2JE8A 5JXHA 1K45A 4XZUG 5CZKA 4XUTA 3WNPA 2R7EB 3IIIA 2PQSA 4Z2AA 1UY0A 3WF3A 3WNOA 2W92A 2C4XA 3T08A 1GNYA 2YC2A 1W0NA 1JZ5A 4QX0A 2DCKA 1GQPA 1US2A 3VD4A 1K42A 3T09A 3VD3A 2VMFA 3WF2A 3WF1A 3ABZA 2W5FA 4FI9A 3CKHA 2WO1A 1TG7A 3P6BA 1GU3A 1JU4A 2E33A 4MOAA 3CZJA 3WQBA 3OB8A 1UZ0A 2QQJA 4LQRA 5DMYA 2WZ8A 3W5MA 4JKMA 3K4AA 4CU7A 3HNYM 2BZDA 5EJZB 1JHJA 3I97A 4GZ9A 2VZQA 2V72A 3MV11 2W3JA 3ACGA 2YC4A 4RN5A 2YFUA 5FUIA 3NNGA 3WNNA 4CU8A 4OMCA 1US3A 3K4DA 2J1VA 3HN3A 2KD7A 3C7HA 4DXRA 3EB7A 4JKKA 2EIDA 4ARXA 5I0DA 3CDZB 3FN9A 4QB2A 5DN2A 1IQDC 2EIBA 3OGSA 4ZZ5A 2XQXA 2VCAA 1OT5A 3GM8A 3HOBA 1JZ8A 1R64A 1I5PA 3T0BA 1UX7A 5EIYB 1GOGA 3FL7A 3VDAA 2J1RA 5JXGA 2Y6KA 4D8MA 1OH4A 3C7GA 1DYOA 4QB6A 4QX3A 4E8DA 5B4XA 4TXWA 4XVHA 1JZ2A 5LA2A 5A1AA 1O59A 1W9SA 2RJ2A 2XOMA 3THDA 4QAWA 1UY1A 2YG0A 2VZRA 3A22A 3I3EA 5G04L 3UETA 4OYUA 1NAEA 4A42A 1JZ3A 4XUPA 1RYYA 4ZXEA 3LE0A 2J1TA 4P5YA 4CUBA 3LQCA 2VCBA 3OEAA 2C26A 4OUEA 1D7PM 2BERA 4MO3M 2WBKA 1SG3A 4PT6A 3BN6A 2VL4A 3HNBM 2E26A 3EYPA 3K77A 3NJVA 2QBXA 3E1F1 2VMDA 3I2KA 3DYMA 2W94A 1LNSA 2DCJA 2WO2A 3UESA 5B4NA 3C7EA 3I3DA 4HG6B 3ZM8A 5LCWL 4A6OA 2X10A 3ACIA 4KMQA 3ECQA 3DYPA 1BHGA 1UY3A 3D3AA 3HNMA 2ZEWA 1CZSA 4M4RA 3WNKA 3W5NA 2X09A 3C7OA 3K46A 1JYWA 4QDSA 2WN2A 1J84A 1K3IA 4OMDA 3LEIA 4DXTA 3LPGA 2HLEA 1W9TA 1WKYA 5DPNA 1JYVA
chains in the Genus database with same CATH superfamily
5FMOL 5C33A 3AZVA 4LBQD 5IYYA 4GALA 3AZWA 3DXTA 2RVAA 1UCXA 3ZR5A 4CDQA 2BVBA 3DEMA 2IXHA 3VBRC 4OQ8A 3H3UA 3GBWA 1IS4A 4Q8LA 4PLOA 3I2FA 1PK6A 2HWE3 3M70A 3MLKA 4L9BA 4Q4W3 1TME1 2A6ZA 3P3PA 2ET7A 3MUY1 1C5IA 2AYHA 2RJLA 3MIFA 1OOPA 4ZU7A 3QOPA 2VMGA 2HBTA 2V73A 4BOWA 1CIYA 1U12A 3I2DA 5LWBA 3AFGA 1PMJX 2VTFA 2ARXA 3CLPA 4HSJA 4XXAA 5CFDA 2GC0A 4XFBA 5FZOB 3MDPA 4BIFA 1AR73 2BWCA 2XMLA 4KI5M 1SDDB 1UW8A 5D8AC 1LU1A 2H6BA 3ATGA 2X05A 1S55A 2WC2A 1HJGA 1MS8A 1S0CA 2OUJA 4E2SA 4MGQA 4YYOA 1VBA2 5EJ3A 4CUAA 1FAYA 1Q56A 4DMIA 3ILFA 1RUJ3 2RS52 2VQUA 3J4UH 2WWSA 4FXGB 2XQRA 4GA9A 4XJ8A 2ZGNA 4QWNA 1QDOA 2OQ6A 2VBBA 4JHZA 3MUZ1 1UAIA 4EJRA 2CGPA 3NL1A 1IS6A 3WP5A 2PAEA 3F2ZA 4RQPC 4X6QB 3ZVXA 3IMNA 3PURA 3AVRA 1ND2C 4LHSA 2VAUA 2EAKA 4FP2A 4GB32 1YC61 5F5CA 1NCRC 1SLLA 4XDOA 1UNBA 4AYUA 4CXWA 1RXFA 2PHDA 3QACA 2J42A 5FPZA 2XKOA 2PHTA 2ZAAA 4U2AA 2RS11 4F3JA 1S0BA 3PNAA 4DEQA 1RUH1 1PM4A 5GZFA 3PTYA 1R1ZA 3HVDA 4XTPA 1Z7S1 5FPAA 4XQWA 4YVSC 1QMJA 1H4HA 1VBC3 2D40A 3I4IA 1JYXA 4HBNA 1IGOA 1J58A 5BNNB 3UGHA 1RUG3 1HN1A 5E8AA 3RYRA 4A3XA 1HIXA 3UNPA 3USSA 1SBEA 1L7QA 3SKVA 1MQTC 2JE7A 3ACLA 4HK9A 1IZ3A 2VMHA 3KF5A 1SHWB 4QKFA 2YFZA 3WD5A 1MS9A 2E32A 3HEIA 3MIDA 5CA6A 5IK7A 4QPYA 2VZSA 5A6ZA 2DCZA 2O1QA 4BA6A 3NJXA 4LBNA 3BALA 1GZCA 1NA1A 4IEYA 4INDA 3ZFEA 5EXOA 1X8EA 4YW1A 2YDEA 2XBO3 4RFRB 4GKXA 4XCAA 1ZBA1 2FZ1A 3QCWA 1DGWA 4QDQA 5JCTA 3H0OA 4YW7A 4A45A 1UIJA 1JOPA 2OPWA 2WFPA 4EWEA 2PXJA 1ZM1A 1HB4A 3FHQA 4LBOA 3WP3A 2G9GA 3JD72 4KBZA 4PQQA 4L0PA 4KG8A 3Q9OA 2Y6HA 3FFZA 1W9FA 1WCKA 3ES4A 2E31A 5DZGA 5IHRA 5KHIA 4UOJA 5FYBA 4A7YA 4GXLA 3T30A 4G4FA 5SV5A 1VB4A 2ZGTA 2ZXQA 1OQDA 2I07B 2EICA 5BNPC 4U36A 4HN0A 5F6KA 2Y6GA 4B29A 5IWFA 1QHDA 1O8PA 3GXUA 3M8LA 3ACFA 1MS3A 5AFBA 3AM2A 2XKPA 3VB9A 3ZXGA 2RMU2 3VN4A 1O91A 4Y20A 2WWJA 3GZTB 1RMU1 2WT0A 1AYN3 2K0GA 4YW2A 2O14A 5JAXA 4FTBA 3OBTA 5E89A 4IXLA 2ZZJA 2WA3A 4Q1PA 4N43B 4JGZA 1UMIA 3IDCB 4RS5B 1NA1B 4COZA 4KH9A 4URTA 1LOCA 5DUVA 4QPWA 2EAAA 3U78A 2DCYA 2WIIB 2JDHA 2WFF2 3M3OA 2QDRA 4AVTA 2PYTA 4LKEA 2LS6A 2DVFA 2WYFA 1F4HA 3V0AB 2YBSA 1NYWA 1IKPA 3NAPC 1W28A 5EYXA 2HWF1 5BNQA 2FCUA 3MFCA 3AB0A 1FXZA 3O12A 2RM23 4L8QA 4BXSV 1W3VA 4K1YA 5DZFA 4OZXA 4META 4CCCA 3NKTA 1W39A 1BMV1 2RDQA 1DG6A 2A70A 5FQ0A 3GBGA 5A80A 4BK5A 1REFA 2Z4FA 2NMOA 3BVCA 3UJQA 3JBG2 3WDWA 2FZ2A 1J59A 2OQ7A 1VBE1 4MX3A 4JTNA 1DQ2A 5L7OA 2FDIA 3HJRA 3ZXFA 3OG2A 3WNXA 4O9GA 1JI6A 4UFLA 2VULA 2D6LX 2V4AA 4P9XA 1ENQA 2DUQA 3EJKA 1W2TA 1C5HA 2H6CA 3FC0A 4B4QA 3MIHA 4YZ5A 2YU2A 5CEHA 2Y8KA 4CE8A 1ZZ8A 2E7QA 3UL2A 1DGRN 2W0XA 4Q4V2 2JDMA 4AI3A 1S0DA 3W59A 1JZ4A 4JRAA 3SCHA 3UYJA 3JBG3 1VAMA 1EAH3 1HRI1 4M01A 1RVF3 1PVXA 2JD9A 4YVSB 5LBFA 1ZZBA 4CP1A 3LD8A 3M3EA 3R05A 5FBZA 1AR63 5KHGA 1RUOA 3CMGA 4ZONA 5I91A 3CJIB 3DN7A 3VHPA 5C7GA 5FUPA 1N1YA 2K46A 1ASJ2 3I2IA 4EV0A 2CAUA 2JICA 4AL9A 4ARYA 4FPHA 2VR4A 4AVBA 3E97A 4K40A 1CX1A 4Q4X1 4GQ7A 1OUSA 2IZWA 4CCLA 1DU3D 1HRI3 1FX5A 1NCRA 1XXNA 1UWWA 4XJAA 4JQRA 3TYJA 4DZGA 2IXKA 5JMOA 5FPXA 2VVFA 5L9BA 1DYKA 1RUI2 1V6IA 2VQ0A 3D8CA 4MHRA 3RG0A 3SH5A 3F95A 2Y0IA 1POQA 2ZTNA 1VIWB 3WINE 5HPOA 5JOXA 1R082 2WSVA 2X5IB 3I2GA 1JU3A 3JD71 4RR3C 1FOD1 3J26N 1I9RA 2NN8A 5IAXA 2CHHA 4YNIA 4CTEA 3IPVA 1GICA 1RVF2 3NO8A 2AEZA 1L7RA 1ULDA 3G6JB 4KWUA 3WG1A 1SLCA 3MIBA 4IE4A 2VZ1A 2E7AA 3H3LA 4Y4YA 1PGSA 3O1TA 2GN7A 1CONA 4HN1A 1N3PA 5CKMA 4UXAA 4CEYC 1LGCA 3I8TA 1NX9A 4WVMB 5A7WA 5JXIA 3I7DA 4AEKA 5J1XA 4JQTA 4S2DA 2Z42A 1PO12 3FWEA 2RM21 1X8MA 3J7LA 1RUD1 2WDBA 3ETPA 5DDJ1 1EUTA 5ABJC 2A6YA 1KXGA 3NNFA 1AYM1 1RUF2 1ZZ7A 4XF0A 5EZWA 2OUHA 5FY1A 5L36A 2VCMA 3R0RA 1ONAA 1AR93 4B4PA 1MVQA 3OF1A 1LHWA 1YIPA 3A0NA 2XLFA 5FZ0A 4B4RA 2XVGA 4FPYA 3AXDA 4ASKA 2JENA 2DVBA 2ZEYA 1YO8A 3T2QA 2VZTA 2YV8A 1WW5A 3PVOA 2Y38A 5ACA3 3AL6A 1W99A 2WNVC 2AR6A 1EPWA 5FY7A 1SFPA 1LB2A 1XNKA 3TRSB 1AYN1 5EYYA 3ZIXA 2PLV2 5JPNB 4DUVA 4PF1A 2JE8A 1WLDA 2D3RA 5FZ9A 4LNVA 3ZFEB 1QXJA 5CZKA 5FO8B 3ME2A 4XUTA 1SLAA 2E53A 3OBRA 3V64A 3WNPA 2GMEA 2R7EB 2OX0A 3O0VA 3NVCA 5CIRA 4Z2AA 4KWLA 1S0EA 1ZBE3 3WDUA 1Q8PA 2C4XA 2ERFA 3M1HA 2QZ3A 5FZFA 2WLQA 2FQPA 3T08A 1R1A3 3MW3A 1S0GA 4XIKA 3EHKA 3POSA 1QDCA 3TAYA 4Z82A 3VD4A 1AR71 1PVC3 2WWUA 4RGGA 5FZIA 3WF1A 3USUB 4WM7B 1OHFA 3ZXKA 2EXHA 5IVFA 5FWEA 5EV7A 1Y9QA 2HH9A 2WO1A 4QPIA 1W9YA 1GZTA 1JU4A 2E33A 2IXLA 2R0FA 3CZJA 4MOAA 3WQBA 1MS4A 3OB8A 1XE7A 4AFMA 1O5LA 2P6CA 4LQRA 2FDKA 3R4SA 1XSRA 2HJIA 1RITA 4JRLA 1CGPA 4XW3A 4GB33 3K4AA 3E6DA 5IVBA 3HNYM 3RRDA 3JD73 1UX6A 5EJZB 4EQVA 1PVC1 1Q5OA 1W03A 1S2BA 4LJHA 4GH4A 4CEWA 1BYHA 1ZBA2 2V72A 3MV11 2QQWA 2B5HA 5K9YA 1QQP1 4LMFA 3ZPOA 1KITA 3S57A 4M0NA 2R0HA 4MUVA 4XFFA 4RN5A 4Z2WA 5FUIA 2Q1FA 4BPZA 1A8DA 1ND3C 1HQWA 4FAHA 2WS91 3IT8A 4YZ2A 5KR7A 3OUJA 1IKQA 3WX5A 5FXWA 1OUXA 5J37A 1AR72 2EIDA 2WO7A 3HQUA 2E6VA 3GF6A 4W6YA 3WDVA 2O8QA 2VBPA 3AX4A 5FP9A 3IM0A 3VZNA 2W2IA 1DLLA 1RMU3 1DGLA 1TZOA 2Q8OA 3OGSA 4XF9A 4ZZ5A 2XQXA 3MGUA 3THPA 1OLRA 4L99A 1R64A 2DFCA 1RUH2 3LAGA 3DL3A 1J3PA 4SLIA 4XJZA 3T0BA 3N4MA 4EZHA 4AEMA 5HCBA 5FZ3A 4Y33A 4WM8C 3WQ0A 4JCKA 1LODA 4NJ4A 5HCAA 2OXBA 3MEPA 2A71A 2J1RA 1GP4A 2YXSA 3R6SA 1GWLA 1QJY3 2B9UA 2BGCA 3N9OA 3T2TA 4QB6A 3TN91 2P17A 3U4SA 4QX3A 1UF2C 5B4XA 4FTSA 1QEXA 4AVSA 4CCNA 1A6CA 3V65A 2HWF3 1JZ2A 1LESA 4JDNA 1RUJ2 4A7ZA 5DDJ2 2FMYA 3CBNA 3FBYA 3U14A 4E2GA 1O59A 1ULCA 3CU7A 4HMZA 4MXWA 4PDWB 2GMPA 2ZX0A 1W9SA 2RJ2A 3ORJA 3B00A 1W0OA 3NSTA 3SLIA 1OVPA 4H55A 4QXKA 2ADDA 2YG0A 2X53S 3DGTA 1QJZA 4GMP3 1UU4A 2BW8A 2UY9A 3UETA 4Q4Y1 1JTZX 4Z1VA 3KB5A 3LGRA 1Q3EA 4L2NA 4YGCA 4OYUA 4A42A 3WG2A 2HWE1 4QQHA 1VAVA 3ZN4A 4LK7A 4CUBA 1V9U1 1N1SA 3FLRA 4BMEA 4QD2A 3OEAA 3VBHC 4M3CF 3X29B 3UKVA 1W8WA 3B9IA 4H7MA 4FSJA 5EHDA 1H2KA 4Y22A 5LEKA 1GV9A 2GZWA 2NPIA 1H2NA 2E26A 2IFRA 3EYPA 5CADA 5JZGB 2QBXA 3H42B 4NUBA 4XF3A 3GCXA 1OQEA 1PIV2 4YWAA 3SCFA 4Z07A 1CAWB 1LNSA 1V6LA 2WO2A 5LK7B 1RINA 3WP4A 3ZM8A 4JTOA 2ZX1A 4R9DA 5APAA 5CKNA 4FPEA 4R8HA 2DTWA 3ETQA 3LOIA 4KMQA 3DYPA 4XJUA 1AXKA 1VAKA 4RGKA 4D94A 5KHJA 1MS1A 2A3XA 5K7PA 3D3AA 4M4RA 2XJVA 1CZSA 4HZFA 5GLWA 2I2SA 3W5NA 2B45X 2ZBJA 4XBQA 4DB5A 4Z8BA 2BYVE 2CGOA 3A0KA 2C9AA 3WP6A 3ZYGA 2XJUA 4AOCA 3JU9A 5FPUA 2WN2A 1J84A 2EIGA 2HKXA 4K6BA 1G7YA 3KF3A 4XHXA 1W06A 4DXTA 2QQUA 1TMF3 2CWSA 3FLPA 3N9MA 5DPNA 4B7KA 1JYVA 1OSGA 3RWNA 1PVC2 1DF0A 4YGEA 4AEDC 4IE5A 2W08A 2IC1A 3OGJA 5FZMA 3OD4A 1CQ9A 1EPZA 1U5YA 1RUI1 2Y64A 1KDKA 2XHKA 4KWJA 3LSEA 1IPJA 4P9IA 3BOPA 5FBJA 1OF3A 3T1LA 2WYSA 3GHMA 1QJY1 5FZLA 3OY8B 5T3NA 1CVNA 1GR3A 2ZEZA 4LLFA 2RS12 2WS92 4I0BA 2N7GA 1CAVB 5KHHA 3LEMA 4QU1A 3ZXEA 5A32A 5ABJB 1ACCA 3Q8AA 4GWNA 4FOVA 4BISA 1XNBA 5FMCA 1QXPA 2VH9A 3ZPYA 3J8F2 1E5HA 1VB2A 1WWYA 1LCLA 4QPIB 3SISA 3WEZA 1TMF2 4HETA 1MZ6A 4XURA 5FZHA 2VXJA 3SH4A 4Y5TA 5CFCC 2NMNA 4OFGA 2JG8C 4RR3A 2YB7A 1NCQC 2BNNA 3BIEA 3O1MA 5FP7A 4CEYB 4FFGA 1N1VA 1HW5A 2YBPA 2GMMA 3C8XA 1HDKA 3SXWA 2BNMA 1OURA 3VZKA 3WCRA 4AEJA 4CCEA 4CYDA 5K0UB 3VL8A 2WZR3 2YC0A 3AZZA 3FHAA 4JGYC 4C8DA 1GMMA 1OLME 1HLCA 2DBNA 4CCKA 3RNSA 2IXCA 4QDRA 3ZFFC 3CZUA 1CAUA 2W52A 3OCPA 5AC93 3K48A 4W4ZA 4CA9A 3I54A 2OW4A 1U0AA 3KT7A 4LBJA 4BIOA 2F17A 1DLCA 3GALA 5CYYA 5A33A 3HT1A 5F8PA 5T5OA 3ZN6A 4XYXA 3TNPB 4K20A 3O1SA 4AQ2A 1YQ8A 2B4KA 2VZOA 5KXEA 4BDVB 4Q4X2 4DFSA 4IE0A 5CVRA 2HWB2 4OI0A 2GC1A 4FCAA 5JOZA 1QJFA 3KD4A 3IDEA 5I0TA 1NLQA 3AFKA 5T50A 1VJ2A 1WGPA 2J1SA 3RI9A 1YCIA 4NO4A 2Y33A 1FNYA 1W6QA 3D82A 3GGLA 4XQDA 5A6QA 5JOYA 3JUUA 1V00A 3IDAA 2VZUA 3E5XA 3I59B 1UPSA 4AFCA 2RS33 2E51A 4Q0SA 4CXYA 4R4ZA 1K5MC 2D3PA 3TEXA 3URFA 1FV2A 1PZ8A 2V5YA 3W9AA 4EN7B 5C8CB 3VD9A 1CZVA 2CDOA 2ZX3A 3DF0A 4AFAA 3NQHA 1WLCA 1ZBE1 1BZWA 2VGDA 2XONA 3MBWA 4DXSA 2JEMA 1OD3A 1C8M2 4AE2A 1RJ7A 4XJ9A 1VBB1 5GLVA 1WCSA 2QQOA 1BXHA 2LW8A 1AL0G 1GOHA 1J83A 4P5HA 5F39A 5AC91 1V9U3 5FLHA 4P9GA 2A73B 4J25A 4YW3A 4YG0A 3GZUC 1O5UA 4YVWB 2ZGRA 4FPKA 2D6PA 2JDUA 3U07A 3ILNA 3KSCA 3S5QA 4COUA 1DCSA 3NNJA 4CZSA 2HWF2 4Q4W2 4GD4A 1FPN2 2UYAA 4YZ4A 1ZRRA 1IQAA 2PMWB 4UAPA 3RPQA 2B46X 3MFAA 2WNUB 5C70A 3I2JA 4MH0E 3KV6A 1RUG2 1TNFA 1WD4A 2VO5A 3GNEA 5E6HA 2XPJA 5FREA 3HT2A 3W20A 3M3QA 4YGDA 3ZXAC 2GN3A 4CCMA 5BXXA 2DDUA 1BEV3 5BNPA 1STMA 2CV6A 4QX7A 4A6SA 4CPBD 1UMHA 4NHXA 1S1AA 4FFIA 2AGSA 2WAOA 2ZEXA 4BLJA 4NHYA 5LK5A 4QX2A 4N7IA 2VOTA 1RHI2 4MVTA 2D98A 3POWA 4JHTA 4XXPA 3AZXA 2PN5A 5CB7A 3GHNA 5AC92 1CJPA 5KBFA 2W95A 4QQLA 5F5QA 1ZZ6A 2W39A 2W46A 1DZRA 5A1LA 5J96B 5CG8A 1R093 4DS0A 2JDNA 2F4LA 4N90A 1UZVA 1DZTA 2W87A 2VNVA 1BEV1 4AW7A 2GU9A 4DUWA 2C6SA 3N7LA 5C3OA 3POIA 1YFWA 4GWJA 1UY4A 1FPN1 3TN92 4ZKTB 4F8AA 3JCIA 1MEC3 1NCQB 1QOOA 2VOXA 2XHNA 1CAVA 4CU6A 3KHBA 1VBA1 3POJA 4GJYA 5T52A 3H8UA 3VBFB 3FZ3A 1UPIA 1XJAA 1T6GC 3MPPG 1W8ZA 1F8VA 4L92A 1HB3A 1LOFC 3PMSA 1YI7A 5M0TA 2JG9B 1DGWX 3KGLA 2OT7A 2BGOA 4OULA 4FO9A 1GLHA 2JD4A 2W68A 3AKTA 3ZYFA 3PUIA 4XTMA 1UOGA 2VY0A 1IG3A 3D4KA 4WM7A 5FR3A 5CISA 3CHXA 4IE6A 2DU0A 4AAXA 1WW6A 5L7OC 4PBOA 4C91A 4OCTA 4OI1A 3VBUA 4BQ2A 3LDBA 4P14A 1RVF1 2CWMA 2H0BA 5GLTA 1O7FA 2ZJCA 4CDXC 2NLRA 2VNGA 5CFCA 3T0AA 3I3MA 1F5JA 1SFNA 3KV4A 3BU0A 1D0HA 3VBHB 3BUCA 3VUOA 1V0AA 1XYNA 2VQTA 2AH2A 3HQXA 4I30A 3ON7A 4BB3A 3SC7X 1H4GA 2RM22 5F2WA 4AK3A 1AVBA 1L7LA 1CWPA 4JGYA 1FNZA 2AACA 4QGMA 4IV3A 3RZHA 4MGYE 4Y20B 1O3SA 2HWC3 4YPJA 4COWA 1GUIA 4NWWA 5F7UA 1NT0A 1I1EA 4LUMA 3PL0A 1TE1B 4AF9A 3SQOA 3OGGA 2OZJA 1C8M1 2XJTA 3CO2A 3P1IA 5FZGA 2Z69A 5HCHA 1XNTA 4A41A 1EAH2 2PELA 2R063 3WZ1A 2VBDA 3OBZA 4DPNA 3DCQA 5I8SA 5JR2A 1NY71 4URAA 3I2OA 1DQ6A 1N47A 5L73A 1OPMA 3P5BA 5I0RA 1V6MA 3CNAA 5A3WA 3WR0A 1AYN2 1RUF3 1WA6X 1UXXX 4NN0A 4PIYA 4Y24A 4LBKA 2B9VA 2BBAA 4OVEA 5FP4A 2MEV1 3MF9A 4QPIC 4IE7A 3BB6A 5T54A 3ZYJB 3RZLA 1SLTA 4HANA 1BK1A 4Q4Y2 2ID4A 2D3SA 1YQ2A 2VTXA 3FBMA 2WNUC 3POFA 4LORA 1LENA 1MR5A 4MSVA 4BQ1A 3N9NA 5JSOA 5FKCA 1RUC3 2ARCA 4KL1A 3FUOA 2QQKA 1DQ0A 2QQLA 2FCTA 2ZHNA 3AP7A 3HD8B 2EXKA 5GZCA 3GJAA 1O8SA 2JKXA 1V9U2 3T2OA 3QBQA 1ZYBA 1EV12 4W6WA 4UW4A 1MZFA 2EIEA 4TZDA 3E6CC 1RUI3 4P9JA 4YSFA 2ZGUA 3IDBB 5LBCA 3HWJA 3PU3A 1GWMA 4NE9A 4AI2A 5J7MA 1A8MA 3M7AA 5J09A 3WNLA 5DAVA 5LW9A 5IVVA 4XOGA 3OYWB 3BGAA 1NUKA 4LKFA 4FOYA 1O3QA 4N43C 3O5SA 3R4UA 2JG8B 1YYNA 1AYM2 1J3QA 1LEDA 2ARBA 2WNEA 3ZIWA 1BBT3 2JG9A 1ZA7A 4AVAA 5C3RA 3FUQA 1PGW2 2RR12 5FXXA 1EY2A 2ZGPA 4MHUA 2BBVA 4Y5Z0 4MZUA 1GYKA 3ZYRA 1BEV2 2SLIA 3AVSA 1EV13 1QKQA 1L3JA 5GZGA 1NCQA 1UXZA 3LIHA 2CAVA 2D6KA 1SEFA 2BFUS 5CKQA 3VZOA 5A6YA 1RUC2 1VE0A 3JQXA 1K45A 4XZUG 1TME3 2Z79A 5DG1A 5FZEA 4B3NA 4TWTA 1AL23 4Y1YA 2PQSA 4LULA 1JYTA 1K5MB 1Y9MA 3BOWA 4NOTA 2HWB1 2JKBA 3WF3A 3EXUA 1XE8A 5DG2A 5FYUA 3E6BA 1GKBA 1O4ZA 2WR9A 4C0HA 1GQPA 4JZRA 1XRUA 4ORFA 1K42A 3T09A 3WY6A 2RR13 4D6RA 2A6XA 2VMFA 4COVA 2YROA 3L9JT 1OVSA 4TSVA 2GP5A 5L7OB 4BWOA 4UW5A 2FBEA 4V2WA 1GU3A 4XFHA 2OYZA 3EMRA 2B8MA 3ZDSA 1HRI2 1UZ0A 2VW2A 1X9PA 3RI8A 1C4RA 4ZU4A 3BTXA 3TNQA 4JGZC 4OUMA 3J8F1 4PHZA 5K4LA 5LATA 1S4CA 4NR1A 3BTYA 3S7IA 3W5MA 3POGA 1N3QA 2WNUA 3OYWA 2OA2A 4CU7A 1REEA 2PHLA 5J48A 1REDA 4HK8A 1COV1 3I97A 4CCJA 1ASJ1 2GP3A 4GZ9A 1VBB2 1LOFA 3FX3A 4TLGA 4LO8A 3WW3A 3RZGA 4CUGA 1YFYA 4S2FA 5F5AA 3ZSKA 2WLPA 2YC4A 4UYBA 4Q4Y3 2Y26A 4IV1C 5FIXA 2F4PA 1US3A 4HPKA 4UW6A 1H8TA 5FYVA 2BOJA 3KQRA 1G86A 5FZCA 4N43A 2J1VA 1UKRA 3HN3A 3QLQA 3O1PA 2KD7A 1YQ5A 2R32A 1H8VA 1YEWA 3EB7A 4KWKA 2BDRA 4ZXKA 1ENRA 4PLMA 5B2GB 5ISLA 1V6OA 4ARXA 5BYNA 1WMEA 4P9YA 4D6QA 2C5DA 4Q8KA 2HWE2 1PHMA 1NY72 1ENXA 1UU6A 2GNTA 5DN2A 3WUCA 3ITQA 3ZXDA 2EIBA 1IOAA 5A7NA 4OHZA 1OT5A 3W58A 3HOBA 1MZEA 4NIAA 2Q5TA 5FMOS 3MIEA 3I59A 4NHMA 5FY0A 5A6XA 5IVJA 4WZCA 1GQGA 1BQPA 1QWRA 1UN1A 1X50A 3AP5A 4QQOA 4XDPA 3RQ0A 2GC2A 3WUDA 1MVEA 3C2UA 3PVEA 1AR92 2ZHMA 1PNFA 4Q26A 3THTA 2XVLA 4WVVA 4P9WA 3RJ2X 2PLV3 1MACA 1SCSA 1RUF1 2JECA 4QQ2A 2R043 3LDKA 5KHKA 4PIZA 5A3UA 1HV1A 5LBEA 5D8AB 2ZZQA 1XE0A 3KM5A 1POV0 5F3IA 3RS6A 2IVIB 4RSUA 2XOMA 3THDA 1BLZA 5BY5A 4HPKB 1UY1A 4EE2A 1CAUB 3ZMOA 1DYPA 3MLJA 2ZAHA 5L9RA 3D0SA 1YWKA 2VZRA 3A22A 3I3EA 3POYA 5D2AA 3CEWA 2PAMA 4CPBA 3QD6A 1JZ3A 4XUPA 4G3YC 3APBA 1QGLA 1WLWA 4H7LA 5K0UA 5JOWA 2E63A 4ZXEA 1V6NA 1FT9A 3LE0A 2J1TA 5EPAA 2C0ZA 5DAWA 5T55A 3NV3A 1YRZA 3HQRA 3VKOA 1NCRB 4Q2FA 4OUEA 2QDNA 2PFWA 2BERA 1YQCA 4MO3M 2WBKA 2G1MA 1WCDJ 2C24A 2VL4A 3BN6A 3HNBM 4FXKB 4DIQA 1DQ4A 1BBT1 2VPVA 3NJVA 3D0JA 3E1F1 4RGAA 4YZ1A 1SLIA 5D1IA 5E88A 3I49A 3CJIA 3JQWA 3VBFA 2DCJA 3C7EA 5FTTC 4OQ9A 4BQYA 2YPJA 1VPHA 4OHXA 3LDRA 4PI0A 1F2NA 1FMD1 4K3UA 4CDUA 4CDXB 2FDHA 1C1LA 3LZZA 1AF9A 2P37A 4Q1RA 5BNOA 1BHGA 1LGNA 3NWKA 4MG2A 1UY3A 5LRSA 3GZEA 4BZ4A 1CPNA 4QKDA 4IEZA 4NRMA 1ND3B 1HQNA 2UY8A 1A78A 2RDNA 2VG9A 4LXLA 2WQ4A 4OMDA 1K3IA 2ZMLA 1ULEA 4IEUA 3LEIA 2HEVF 2Q8DA 3L2HA 4DY5A 2HLEA 3C3VA 4QXBA 1PO21 1SLBA 1WKYA 2CU5A 2PQQA 2XBO2 2P3IA 4XETA 2GC3A 4PBPA 4WV8A 1OBNA 4CDQC 1LECA 4V1PA 4YM3A 2BUKA 2ZS6B 3VBRA 5A3LA 2WNVA 2XUEA 3GCWA 3O0WA 3WF4A 4AHWA 4R52A 2CTVA 3PVBB 4UFKA 3WDXA 3WNMA 2LRPA 1XYPA 4Q29A 3DECA 5T5JA 4BQ4A 4AQTA 1XNCA 2VC9A 2OKXA 5IAVA 2F6BA 1LRHA 2K2SA 3ZXLA 4E4ZA 1PGL2 2P5BA 1BKZA 2VOWA 3ACHA 4YARA 4QM9A 2YYOA 5FZ8A 5T5PA 4CP9A 3PIJA 1KFUL 1W90A 5FYSA 2ZX2A 5FV3A 2XWJB 2OPKA 4OHWA 1NLRA 5EJ1B 3IWZA 4ASMB 5KC6A 2GALA 1QNYA 1ULOA 4NAOA 2KXLA 1S2KA 4RS5A 1B09A 1WD3A 2P3JA 5CAZA 2JDKA 2ADEA 2P1BA 4Y1ZA 2HYXA 4RHV3 4SBVA 1N3OA 1WMDA 5FRAA 5JR7B 3EO6A 3I3BA 2GNBA 4HFSA 3VDBA 3O1VA 3WF0A 3M4FA 4LEJA 3VGIA 4N8MA 1W6MA 5I8YA 2RHPA 2IXIA 1ZVFA 2XL7A 4JX0A 4ZS2A 1ZRCA 2ZCWA 3H7JA 4I3PA 3QH7A 4JDMA 4AFBA 3SKJE 1OFSA 4CXXA 4MXWB 4PDWA 1XBFA 5IVEA 3JXSA 4XACA 1D2SA 4QX8A 2Q0AA 2A5ZA 3H1YA 4PDWC 4YLZA 1JOBA 5KXCA 4RL7A 1RIRA 1LHVA 3ENRA 2WABA 1MS5A 2BNOA 1VBC1 2HEWF 2IUWA 2ZACA 1PX3A 3MV01 1CESA 1HXS3 5JZGC 5LY2A 4JAAA 2P4EA 4EZ4A 2BRTA 2BVVA 2TBVA 3N9QA 4YRDA 2CL2A 4X8PA 4PF5A 1HN0A 1VRH3 3B94A 2J1UA 3ZKUA 3POBA 3DXUA 1W8OA 3I2HA 2C9KA 5J98B 4ZPIA 2BP6A 4X8NA 1QJX3 1IS3A 2EALA 3MI8A 2Q1MA 4NHKA 2RE9A 4W6XA 3U75A 2O8OA 2V4VA 2ZGLA 5AVPA 2WSUA 5FYTA 1E57A 2R061 2BPA2 2HWB3 3RZZA 4E4HA 1PIV1 2JIGA 2VNRA 4LA2A 2FDFA 3SMHA 1RUD2 3VBUC 3ZSJA 1BBT2 5JLVA 1D0GA 4KQ7A 3AC0A 2HWD3 1VMHA 1HRV1 2WO3A 2QZ2A 3MZHA 4BMBA 2BQPA 3QH6A 1OOPC 2XG3A 4I0WB 3T0DA 3ZOIA 4A4AA 2J7MA 3SITA 2PHWA 3VHRA 2WZEA 2WFF3 2WNOA 2R1BA 4MGSA 2GNMA 1FMD2 1XSQA 1AR83 3AK0A 4BCUA 2PHRA 4Q5OA 4DUXA 5JPMB 2R16A 4DO0A 4GH4B 4ZY9A 1PMHX 4L11A 1POV3 3VKFC 1CAXB 1VRH2 4CUCA 4EN0A 5A32B 2QQPA 2X8KA 1G9CA 3SCGA 1UZYA 1Y3TA 3ST7A 3OUIA 1WUVA 1XNAA 1W2UA 5A3MA 1QJX2 2RS13 2AEYA 5IJRA 3B5LB 3ELNA 3PIGA 4YZ3A 3DPRA 5FYZA 4OI4A 5GZDA 1JYCA 4XILA 3VBSB 1UU5A 2JDAA 1SZBA 4IL7A 2ZA9A 3T3YA 2WQ8A 3VDDB 1WCQA 1GANA 4E4DX 1LGBA 1JUHA 2GSYA 4FBFA 5GALA 2WAAA 1SPPA 2HEYF 5A1FA 3WCSA 1VALA 2AUYA 5GJ6A 3WG4A 5ACA1 3KQ4B 4XABA 3DKWA 3BTAA 3UT0A 5EQUA 1NLSA 4COYA 5HXMA 4XJWA 1CR7A 1AR82 2VW0A 5CFDB 2P2KA 5BV6A 2I45A 2HWC1 2QQVA 1LOEA 3PTRB 5DABA 5LEJA 1KEXA 1ZRIA 4FPCA 4LA3A 2KM2A 4QX5A 5F6LB 1PO13 4ZHNA 1U5IA 4IV1A 3AKSA 1WW7A 3OSDA 5C3PA 4AVCA 3RZKA 1W8NA 1IPKA 4OZOA 4BQ3A 3K2OA 1OH3A 3POEA 4GMP1 1O3RA 1XOYA 2WRAA 3EBRA 1RXGA 5C71A 2VM9A 4J1XA 2JIJA 4Y22B 1RGSA 3CL1A 4LPLA 2VUAA 3VHOA 4A7KA 1Y7BA 4NIHA 3ILRA 4CP2A 5H9RA 1TME2 2VZPA 4JKLA 3OPZA 1RHI3 5FO7B 3S30A 3SHRA 1DGRA 1M4WA 2VMCA 2Q1ZB 4ITCA 4IEPA 4Q27A 2XUMA 4L97A 4XAAA 1RL3A 3LKJA 5FZ6A 4HVQA 5IFTA 3H1WA 5JSPA 5FYIA 3A4UA 3RZJA 4WVWA 2ZGKA 1O6UA 4I09A 1GP5A 4ISRA 4WVMA 5A7WB 3TB0A 1G9FA 2RDSA 5F32A 1MPXA 3SEPA 1ULPA 4IEOA 5C8CA 1X36A 2Z2SB 4N53C 1NZCA 5IVCA 3TWIA 3H1MA 4UBHA 3IIAA 4BQXA 5T5LA 3ZMNA 2QKDA 1F35A 1CPMA 2VTXJ 3HPNA 4A3ZA 4F83A 4QKBA 2BEOA 2QVSB 3B69A 1CZTA 1SQ4A 4GKYA 1HB2A 2WINB 2CNAA 4QB1A 3WLUA 3MLLA 4TN7A 1FPN3 4XF4A 1NKGA 2FMDA 2WA4A 3U1XA 2YBKA 4W65A 3U37A 2GNDA 4PQ9A 3LPFA 1T2XA 1D4M2 1SFYA 2J1EA 4GB31 1AL21 2VZVA 2P34A 1VBB3 4YW5A 5JVVA 1K5JA 2UURA 4QGLA 1RUJ1 4TTGA 3GYDA 2DYCA 2K9ZA 2NYYA 4YM2A 2RS53 3S6PA 2MPFA 2QFEA 3VDCA 3ZN6B 3MO4A 4BXFA 5FP3A 5FCCA 1LHUA 2DURA 2AZ5A 5SV8A 1QQP3 2JE9A 1PGW1 2RR11 4NVPA 4XUQA 2W1SA 4AI9A 2QQMA 3B02A 1AJKA 3OEBA 4LKSA 1EUUA 5BNOC 3H8XA 3GDBA 1JZ6A 1GSLA 1X33A 5FOJB 1R1A2 4CU9A 1OI6A 4ZU5A 5DAXA 4H3WA 2I74A 5E1RA 4CCOA 1SCRA 1ZZ9A 2YGLA 4E4SA 1F4AA 4JV4A 4M4PA 1SDWA 4KU7A 4NPRA 3ALQA 1H6YA 4CEYA 4K9SA 1GNHA 1AX0A 1I3HA 1OF4A 4WVZA 4AI8A 4RR3B 3V0BA 3LOBA 3N9PA 3MW2A 5A7OA 3VBOC 3LEKA 3OUHA 1XPWA 5A3NA 1QXRA 2ES3A 3A23A 5LA9A 3O1OA 4CEWB 2JDPA 1ZX5A 3NAPB 4O61A 3VDDC 2Y6LA 1I6XA 1HB1A 3AYDA 4HKLA 1PZ7A 4FAGA 1HQLA 1F15A 1ENSA 3BIWE 4D0QA 5ABJA 4IEVA 4KU8A 1CAXA 4HVRA 1UMZA 3OY8A 1M06G 1XU2A 2Y60A 3IMMA 5FJKA 1X9TA 2BTVC 2YGMA 4TYSA 5G05L 5FXZA 5IT6A 2GH2A 3FHIB 4J6GA 3HBKA 4YG3A 4CVUA 2D97A 4I02A 3A7QA 2XXZA 3C7FA 5A7PA 1FATA 1CN1A 4AVVA 5CFDC 4QQPA 2DF7A 2EA7A 2W9XA 4PCRA 2HWC2 2YZ4A 3TEYA 5AFEA 4JVAA 3ZYIB 2ENRA 1JXNA 2BOIA 3BCWA 1D2QA 1J1LA 3ZN5A 2VZ3A 4BE3A 5JIUA 4FPLA 4YG6A 3T4VA 3LWCA 3V0AA 1HXS1 3AMQA 3IBMA 2VUCA 2JB8A 4K7JA 5HI0A 1ULGA 1UY0A 3ASIA 5FZ7A 4AGGA 2W92A 1WCUA 3T1MA 1GNYA 2YU1A 4IGPA 5LRRA 4AI1A 4AXOA 2DWRA 1JZ5A 3PDQA 2WJSA 4XEZA 4QX0A 1BJQA 5IK8A 1E5IA 5FUNA 1US2A 3AMPA 3V56A 3UGGA 5D8AA 3WHTA 3WF2A 1W8HA 3AYEA 1XB9A 4IERA 1AHSA 1WZXA 4FQZA 1VBE3 2Z5WA 5C9AB 1OA3A 2W5FA 4AR2A 1KJRA 3KVBA 2WFF1 4BH9A 4KGGA 3KV5A 1TG7A 2ZGOA 3L2YA 4YW4A 3LA7A 1BVP1 4EN9B 2TEPA 2HWD1 2QQJA 5F3EA 2AC1A 3HAGA 1BK0A 5C4WC 4LT5A 1W2OA 2R062 2WZ8A 4I01A 3ZYHA 4AQ6A 1QOSA 3WVJA 4GH4C 2ZHKA 4LTAA 4FVVA 2LTNA 3BODA 4Q0PA 1JHJA 3VZMA 3VLBB 2B7YA 5FXVA 3FFQA 3NKGA 5EP9A 4O7XA 5BUVA 1MQTA 1JH5A 2GDFA 2X5IC 4EROA 2W3JA 4LO4B 1SBFA 3ACGA 1CX4A 1CIWA 1OKOA 3ZFFA 1JS9A 4LLOA 1QIQA 1VBD3 3NNGA 3WNNA 1NQDA 1D4M1 1AXZA 1COV2 3WV6A 3VBSC 3C7HA 5C6CA 4XQ4A 5DAPA 3Q8BA 3B93A 3J7MA 1JBCA 3J9SA 4LHNA 1OC1A 1RUE1 2ZHLA 1VRH1 3FN9A 4QB2A 1UYPA 1YHFA 3AL5A 2Q8EA 1VP6A 4C1WA 5CBLA 2NQYA 2CGNA 2XL9A 4WM8B 5BPXA 1IQDC 4FPGA 3WDYA 1TNRA 5A3OA 2ETEA 1YJLA 4NWVA 3NV2A 1VBC2 4ATFA 4Q0UA 1JZ8A 5JI7A 4IEXA 1I5PA 1POV1 3WHUA 5EIYB 1W6PA 1VBD2 1D4M3 1GOGA 1H0BA 3RFRA 4JDOA 1AXYA 2Y34A 3VDAA 5TSWA 4B7EA 1DQ5A 1W2NA 5L19A 5EFUA 3K3NA 4B1MA 1NQJA 3AP6A 3T4HB 2Y6KA 3ZYBA 2G9FA 1TQ5A 1EV11 2KA3A 5ACA2 3C7GA 4LBQB 4C0BA 1DYOA 1O4YA 5FZAA 3AJZA 2WNVB 4LO7A 3VV1A 2XR4A 2WZR2 3PUSA 4XVHA 1W0PA 4Y5SA 1AR81 4DINB 1C8M3 3UGFA 1DHKB 5A1AA 4GAZA 2AENA 3WDTA 3WOGA 5J36A 3NJZA 4PI2A 4XC9A 2XH6A 3J7NA 4XE9A 4UFHA 5C3QA 1DZQA 4KGQA 4LBMA 4OHVA 1S0IA 5C5TA 4DOUA 2P3KA 2RS32 1UO9A 4P9LA 4XZPA 3AP9A 1NAEA 4MGIE 4CDUB 4QHBA 1VMJA 5FZKA 4M3CA 5FLIA 2XLAA 4AFDA 3AMMA 1AX2A 3AKQA 2PHUA 2BFUL 3R4DB 4HOOA 1HX6A 1RUC1 4AI0A 3RVHA 1RUG1 3O1UA 2DVAA 3MF6A 3SH3A 4HSLA 4IV3C 3INAA 2QCSB 2VUDA 4K8FA 2JX9A 1YNAA 4O65A 4R9CA 3E5QA 3O14A 5JDBA 5F37A 1V6JA 1PGL1 3K77A 4I0AA 2VMDA 3I2KA 1AX1A 1S0JA 2P6HA 3JB8A 1QH7A 3ZSMA 5B4NA 3USUA 3LF7A 3UESA 4BQ5A 1Q8OA 3I3DA 2VXRA 1YLLA 4LO6B 3UJOA 1PK6B 1RHI1 2ZGQA 3PUQA 1KQRA 2OZ6A 3LFMA 1O4TA 1AR61 1H1IA 4M3CE 3AKPA 3N7JA 1AYM3 1WBLA 3RWKX 1H8TC 1ZA4A 3WNKA 3U4XA 1UIKA 3K46A 4LK6A 3U10A 3SNMA 3ZO0B 1ZBA3 5JWPA 1U5XA 5LZ6A 2NM1A 4QDSA 4JGZB 3NV4A 3ROUA 1VMFA 4LIVA 2DVGA 1W9TA 4Y26A 4AEDA 4IEWA 1W8UA 2A75A 1RTVA 4ISQA 3S0MA 3N7KA 1GQHA 5I0UA 3ZKYA 4YVWC 1W04A 3VHNA 4C1XA 3AMNA 1LHOA 3ZR6A 5FK8A 2W1UA 4HONA 5FY4A 4YGBA 5F3CA 5AVAA 5J3UA 4NIGA 3VBOB 4N7UA 1RMU2 1W6OB 1JHNA 1HV0A 1W6NA 5LA1A 1W6OA 4EWAA 3WQ7A 1W3XA 3N3HA 5C3SA 2R071 1H6XA 2D44A 1OQ1A 1YFUA 1MEC2 1KS5A 1EYBA 1ALYA 1VRBA 4IDZA 4Y3OA 3RYPA 2BWAA 2YHJA 5K0UC 2D7FA 5FPVA 2Y6JA 4RYDA 4JGYB 4O9EA 4NRQA 3BYWA 3CQOA 5C9AA 3OGRA 3H3ZA 5A7QA 1PZ9A 4PLNA 2RG4A 2G19A 2R041 4FOQA 3PJYA 3VBHA 2YY1A 3H9AA 5IVYA 1AR91 2DVDA 2VNOA 3IPVB 5CFCB 4J1WA 4B8EA 4CEWC 3FJSA 1Q8SA 4XCBA 2XB6C 1WA4A 2X5IA 2XVKA 5I93A 3WG3A 1IPSA 1QJU1 1T6BX 1S0FA 2TNFA 2ZKLA 3JB4C 1KRIA 1TEIA 2D5HA 3IB3A 4CDWB 3DYOA 4XBNA 3RDIA 3SEEA 3LEGA 2VMIA 4N9HA 4PJYA 3VD5A 1KGYA 2RDRA 3RGBA 4XBLA 1UYXA 1S2EA 5FY8A 1H30A 3PUAA 5BNNA 5H9PA 4XHBA 1AL22 2VE1A 5H9SA 4Z92B 3THCA 2DTYA 4BJ0A 4DXZA 4RQPA 3WT3A 5BNNC 1C3HA 1UYZA 3AZYA 3OBAA 5DXDA 2QJVA 3K75B 4K21A 4AQSA 1C57A 1ZREA 5C5UA 1PIV3 3FMGA 5JMCA 2DFBA 5JI9A 4FPOB 1FYUA 5GZEA 2RS31 5FAXA 3PUHA 5FPBA 3WW1A 2VOVA 1RJ8A 5FZ4A 4CDUC 4E9KA 1QJX1 2PA7A 5HV0A 2MEV2 3ZYPA 2PHFA 3RMYA 4DRRA 1OKQA 1R1A1 3B3QE 1YIFA 4MLOA 2JB4A 3T2PA 5IATA 1GWKA 5FO9B 4YVSA 4AHYA 3NAPA 3UKNA 4ZS3A 1MS0A 1UOJA 3HN1A 4XFAA 5LY1A 2IWGB 5FZBA 4EYUA 1K5MA 1W8FA 2D43A 2DV9A 3PVNA 1DDLA 1E5SA 4MGZE 2CDPA 1JZ7A 1PO23 3VL9A 1A34A 4UI9L 4XFCA 4IUGA 5DUXA 1SACA 3MYXA 5JSRA 3BPZA 4UFMA 4B1LA 4EN8B 1WLTA 3HIFA 4LIUA 4Q0QA 1RB8G 2QQIA 4FTEA 2W1QA 4IQPA 5FOBB 1ASJ3 1ZNPA 1F9KA 4W8JA 3OGVA 3NRUA 4GJZA 4KNCA 4ONUA 5JIAA 3AMHA 1RUNA 2AREA 4QMAA 2WL1A 3J7HA 3Q8EA 4MADA 1B35B 4TLFA 2VJXA 4ET7A 4MYEA 1UQXA 2V09A 2WQZC 3Q8FA 3ZSEA 3ZDVA 3ZXJA 5BNPB 1AR62 1KJLA 5DDJ3 5CNAA 3VZLA 2ZGSA 1APNA 2QQNA 1VR3A 5IUQA 2JG8A 2Q8CA 2ORXA 4UFJA 3LA2A 2QUOA 3PMEA 3PU8A 1OOPB 2B42B 5FQ0B 1LOBA 3WQ1A 2R073 1CJDA 1X7NA 4H2AA 4M00A 3WSOA 5FMBA 2ZOEB 3DPRC 2MEV3 3RJRA 4LE4A 4DEVA 1PO22 2VOKA 1K12A 1W6PB 2WUHA 1P8JA 2R1DA 2GAUA 4Q4V3 4NMIA 1ODNA 3KS7A 3RMXA 4CDWA 2A3WA 4XMIA 5F2SA 1I5ZA 4UWDA 4CDQB 4P08A 1WMFA 4P02B 4RS5C 5IK4A 2NP0A 1ODMA 4BK4A 3KCCA 1PX4A 2ET1A 3N35A 3S5AA 4OLLA 3GBFA 3OD0A 3N7MA 4LR4A 4AG4A 4HXCA 4FQ4A 1COV3 3KWVA 3WXPA 2QE3A 3H8OA 4S2GA 2FD8A 3S7EA 1FOD3 1H2MA 1XC6A 1WMXA 2E9QA 2XJRA 4LE3A 4XF1A 2DUOA 3ZFFB 1ND2A 1OXCA 2UWCA 1JYIA 4UFIA 2CYFA 4KG0A 2XJQA 1NE4A 1OA4A 1QOTA 4Q0VA 5KWRA 4RA0A 1ST8A 4WZFA 5DUWA 4QGNA 5ANNA 2PHXA 1WW4A 1WBFA 1UYYA 5FP8A 1EP0A 5CU1A 2YPDA 2V5DA 3AYCA 1OLMA 1VBE2 3J8F3 3BPSA 1RUE3 1VLNA 1W6NB 1Z0HA 2FDJA 2J1AA 2UU8A 2W1WA 2WZR1 2DUPA 1W9WA 1W6QB 2Y0OA 5GLUA 1V6KA 5FYYA 3OOXA 4HKWA 2B39A 1AZDA 4DNYA 5KC5A 1KDMA 1HJFA 1LOAA 1YXWA 3ZLIA 4HT1T 4E8CA 1RC6A 5GKAC 4QPGC 3U11A 3H7YA 4IV3B 3M3CA 4NAMA 1JOJA 1NZIA 1W8TA 3WW4A 3VBFC 3IAPA 2JWPA 4QPGA 3D5OA 4GMP0 1OD5A 1Q8QA 5DAQA 3PLQA 2D6MA 3NNLA 4AGRA 4CSWA 1YQ6A 2WN3A 3KZ4C 4WM7C 4IESA 4GULA 5C8CC 4MGTA 5DZEA 2XJSA 1LJ7A 1ULFA 3K51A 5E16A 3N9LA 4MV2A 1TVGA 2H0VA 1X82A 3G7DA 3LIGA 4N9IA 2WT2A 1LHNA 3VBUB 2J22A 1W2AX 3IAQA 3O7OA 1Q43A 1UY2A 4QKNA 4W50A 3H8RA 1ZZCA 2KR2A 1JODA 5FMDA 1G9BA 4Y1VA 3LCPA 4XAEA 2ZPXA 5FK7A 4BLIA 4AHXA 3E5UA 1FMD3 1H1MA 1SPPB 4RHV1 2VU9A 2BJSA 5FYCA 3ZSLA 1RUD3 2HBUA 2EF6A 1G9DA 3AP4A 1Y43B 3TEWA 3KT4A 4F7ZA 3RZMA 2HYKA 4XUNA 3KT1A 3Q8CA 4CCDA 1YFXA 3OTFA 2L9LA 3LSDA 2UWAA 2YUEA 3VZJA 3ZFGB 1R092 1XQNA 4K8RB 4ASLA 1IS5A 1PK6C 4AAPA 3CF6E 4LUKA 4NIDA 3OPTA 1JW6A 2Q30A 1KS4A 1OMIA 3HMYA 1N1TA 1C1FA 2W91A 2ZGMA 1DP0A 1H9PA 4A44A 1Q8VA 2ILMA 1PMIA 1FV3A 4M3CB 1XYOA 1LTEA 4GWIA 2LROA 4Y1UA 3U0ZA 5LA0A 1JYNA 4QHOA 4AGVA 4NPLA 1V70A 1GBGA 2Q4SA 1D4VB 3UV9A 4AHZA 2RV9A 2ZMKA 3MPBA 4DQAA 3VKNA 3NW4A 2VVDA 4LO5B 4OUSA 2IFWA 4AZZA 4YM1A 2VECA 3AJYA 3JZVA 3KCYA 4OHYA 3CIHA 3FE5A 2EXJA 2VMEA 2GH8A 5LB6A 2ZMNA 4YFZA 2LALA 1PM7A 4I2OA 1KD7A 4P00B 3VD7A 4FFHA 5H9QA 5FLJA 3NV1A 2VCCA 2WS93 1GZ9A 5FZOA 3NJYA 2DU1A 1JN2P 1ZBE2 2VVEA 4QXCA 5FY5A 4BM8A 4ZZ8A 4D69A 1W05A 2R6QA 3B01A 4LBQA 2W47A 4ATEA 2A1XA 1OPOA 1JUIA 1SMVA 4G9SB 2VUJA 4R4XA 1R091 4LBLA 1R083 1SBDA 4WBBA 2XLGA 5FWJA 1H2LA 2QNKA 3GJBA 2BGPA 4IEQA 5DQ0A 4QX1A 4MGKE 5HBAA 4UW3A 3K3OA 2G4IA 1GOFA 4E27A 3DUIA 1CAWA 5ANQA 5IK5A 2XGXA 1O3TA 3TN93 4LKDA 5L9VA 2JDZA 1OA2A 2JG9C 2YMZA 5KXDA 3DKQA 2R042 3K4ZA 4QU2A 4HL0A 1C8NA 4XUOA 5JZGA 2ORZA 3DV8A 4UT5A 4WM8A 5HCFA 5JUVA 3ZFEC 1ZRDA 4XDQA 5IFPA 1GNZA 3KLSA 5I8TA 1H9WA 5JXJA 2UYBA 4UF0B 1UKGA 4YVWA 5FZDA 2XDVA 3BI3A 1GZWA 3I3QA 5FY9A 4XMAA 3MICA 5CG9A 3A21A 3UK9A 1R081 4BYYA 4XFGA 1QJU2 1QNWA 1U5ZA 3BTZA 2G9ZA 1LKNA 4HLTA 4PIXA 4D6SA 2FHRA 1Z7S2 5JXHA 1G6NA 2XBO1 5IW0A 4CDWC 4N53A 4BQWA 5D21A 3LFIA 4IGOA 1ND2B 3IIIA 4Q4X3 4QHZA 2NZ9A 2FDGA 1XNDA 2ZX4A 1YUDA 4N53B 3WNOA 4DY3A 1MQTB 3EQEA 1LEMA 1RUH3 2YC2A 3P3NA 5FKBA 1W0NA 2BV4A 2WKKA 2XJPA 3O0XA 2DCKA 2DBIA 1PO11 3VD3A 5ERLA 1LOGA 4XFIA 2Y6FA 5LBBA 1QJU3 1F31A 3ABZA 1LU2A 5A7SA 4C90A 4FI9A 2JXAA 4IW3A 3CKHA 2SBAA 4KBBA 4GIQA 1UZZA 2EXIA 3P6BA 4YFWA 2CY6A 4HVOA 1VBD1 5GLZA 4CP9B 1Z7S3 4NRPA 5FJHA 4R9AA 2R072 4NROA 2ATFA 1MEC1 1J1TA 1J3RA 1QQP2 3ES1A 5DMYA 4CP0A 1BMV2 1NG0A 3ZX7A 4JKMA 4MXVA 3AXEA 4IV1B 5FYHA 2BZDA 5A33B 5FDBA 4RHV2 2WT1A 2ZABA 1JMUB 3KV9A 4M0HA 4FPFA 2VZQA 1UOBA 1NXMA 1QJEA 4R9BA 3CJXA 5FYMA 5K8SA 1NXD1 5C4WB 3VBRB 1URXA 5HXVA 4RFT0 1C28A 1B35A 2YFUA 2JDYA 2P3YA 2VQAA 3LA3A 3B9CA 2OIIA 4CU8A 4FFFA 4OMCA 4V2VA 3K4DA 1PNGA 1B35C 3LB9A 3N36A 3TEZA 1CD3G 4Q4V1 1QJY2 4NIIA 4OI2A 3VKLA 4DXRA 4JKKA 3TBDA 2EVXA 5C8WA 5I0DA 1ND3A 4LHLA 4D7TA 3CDZB 5DUUA 2BU9A 3VDDA 1MZ5A 5LASA 1NE6A 1GFF2 2A3YA 3VBSA 4QXHA 3KMHA 3DPRB 1IHMA 5BNOB 2FCVA 4XIOA 1TMF1 2VCAA 2JJ6A 4CDXA 3GM8A 2OVUA 1HRV3 4H14A 3RSJA 2XWBB 5KXBA 2RMU3 1DFQA 3PJQA 1RUE2 1UX7A 4DRVA 3GZAA 3FL7A 5A70A 2RS51 1QY4A 3M3IA 2LM3A 1ZRFA 4UBGA 3MHZA 5JXGA 3ZFGA 4EN6B 4D8MA 1OH4A 4D7YA 2VD7A 4BHPA 3D6EA 4D7SA 1DQ1A 3TOJA 3WW2A 1OFNA 2D93A 4E8DA 3H50A 2R30A 4TXWA 4RQPB 4LOSA 4FPJA 3V0BB 3AYAA 1LR5A 2OS2A 3KCXA 5LA2A 4ES9A 1NA1C 4JC1A 2WZPP 1UD1A 4FT8A 1EAH1 4BU2A 1HKDA 3JBG1 2DCTA 2IXJA 1HRV2 4X6RB 2D6OX 4ES8A 2A7AA 4QAWA 1FOD2 2CSGA 2D6NA 1AUYA 2O0OA 3MW4A 2A6WA 1F5FA 1UZWA 5FPLA 2D5FA 3BKZA 4YM0A 5C4WA 2PAKA 4HKOA 5G04L 1Y9GA 1FI2A 3VKMA 2TUNA 2ZKNA 3W21A 1G8WA 4XPVA 3KHCA 1RYYA 1YJKA 4FP3A 4I3GA 3NNMA 2X29A 4P5YA 5F9TA 1OLQA 5C9AC 3LQCA 1HXS2 3NMBA 2VCBA 3PHMA 4QPGB 1H1AA 2C26A 1BCXA 1D7PM 1XU1A 3RYKA 1IG0A 4NPMA 1SG3A 2QTWB 4K1ZA 4PT6A 5I0SA 1Y4WA 2PTMA 5A3PA 1UOFA 3CJIC 5HV4A 4RD7A 4YW6A 2LUWA 1UL9A 3DYMA 4LOTA 2W94A 4QM8A 4FOWA 3FLTA 4IETA 4CRQA 4HG6B 1G9AA 4LHKA 3UKTA 5FFOC 5F5IA 3IZOA 1LAJA 5LCWL 3AKRA 4IGQA 4A6OA 3VBOA 1QF3A 2C1FA 2X10A 3ACIA 1DIWA 3ECQA 3MIGA 3O1RA 4Y4RA 2E7TA 3IN9A 3HR9A 3HNMA 2ARAA 1GP6A 2ZEWA 3KVAA 1W6MB 4A2UA 4D3WA 5A3TA 5F1RA 1E5RA 4AWDA 2PLV1 2HWD2 2X09A 3C7OA 1Z78A 3OPWA 1BVVA 2R49A 4S2HA 1QH6A 4Y1XA 1JYWA 4AEDB 2MNGA 2VW1A 4GWMA 4Q4W1 4QT6A 3KGZA 1LULA 1NOVA 1A3KA 3BU7A 2RJKA 1AJOA 4NHLA 5EWSA 5F3GA 3LPGA 2UWBA 5GM0A 3B7MA 4E2QA 1H8TB 4EWDA 2MHFA 1YI9A 2IVJA 1DBNA 1VBA3 3HBZA 3IKWA 3M2MA 3OJBA 1QU0A 3ZFGC 1GZWB 1KFXL 4LITA 4UF0A 2RMU1 5FZ1A 2A6VA
chains in the Genus database with same CATH topology
5IYYA 2RVAA 3WF4A 2W1UA 3WNMA 2Y64A 1OF3A 3DECA 2WYSA 3I2FA 2VC9A 2OKXA 2ZEZA 5LA1A 3MUY1 3ACHA 1CIYA 1H6XA 3WEZA 1PMJX 2VTFA 4XURA 2Y6JA 4RYDA 5EJ1B 3CQOA 3OGRA 4KI5M 1SDDB 2YB7A 1ULOA 2X05A 3C8XA 4MGQA 2HYXA 4CUAA 3FHAA 2VQUA 3I3BA 1GMMA 3VDBA 3WF0A 4JX0A 4JHZA 4QDRA 3CZUA 3MUZ1 3IB3A 4W4ZA 3DYOA 3F2ZA 3SEEA 3LEGA 5CYYA 1DLCA 4LHSA 3SKJE 3VD5A 1KGYA 1UYXA 3JXSA 2B4KA 2VZOA 4BDVB 3THCA 4BJ0A 2WABA 1UYZA 3OBAA 3K75B 4DEQA 1PX3A 3MV01 2J1SA 3PUHA 3GGLA 1JYXA 3IDAA 2VZUA 2J1UA 1HN1A 3T2PA 1W8OA 3UNPA 3I2HA 2C9KA 3SKVA 1L7QA 3VD9A 1SHWB 1CZVA 2YFZA 2E32A 2CDOA 3HEIA 2V4VA 2CDPA 2VZSA 3NQHA 1JZ7A 4DXSA 2XONA 3MBWA 4UI9L 4IUGA 3NJXA 1OD3A 2QQIA 2QQOA 3AC0A 2W1QA 2WO3A 4W8JA 2LW8A 1GOHA 3OGVA 3NRUA 1J83A 4QDQA 4A45A 3T0DA 4A4AA 2J7MA 3J7HA 4MADA 2VJXA 2WZEA 4ET7A 4MGSA 3FHQA 4PQQA 4L0PA 4DUXA 2QQNA 2Y6HA 2ORXA 4ZY9A 2E31A 1PMHX 5IHRA 4UOJA 4UAPA 3WSOA 4DEVA 4CUCA 5C70A 3I2JA 2VO5A 1K12A 2ZXQA 2EICA 2WUHA 1P8JA 1XNAA 2Y6GA 1O8PA 3GXUA 3ACFA 5IJRA 4P08A 4P02B 2DDUA 2JDAA 2WQ8A 4BK4A 1UMHA 1WCQA 1PX4A 2WAOA 2ZEXA 4AG4A 2WAAA 4QX2A 2VOTA 1UMIA 5HXMA 1XC6A 2W95A 2W46A 4QPWA 2LS6A 2W87A 1F4HA 1KEXA 4DUWA 1UYYA 4GWJA 1UY4A 2V5DA 2XHNA 2J1AA 4CU6A 1W8NA 2W1WA 4OZOA 4BXSV 1W9WA 5C71A 2VM9A 4BK5A 2Z4FA 4E8CA 2BGOA 4LPLA 3PUIA 3HJRA 3OG2A 3IAPA 1JI6A 2VZPA 2WN3A 4JKLA 2Y8KA 4AAXA 2VMCA 5IFTA 1TVGA 3SEPA 1MPXA 1JZ4A 1ULPA 2J22A 3T0AA 3IAQA 1UY2A 4W50A 2JD9A 3HPNA 2VQTA 4A3ZA 3CMGA 1CZTA 5C7GA 4QB1A 3I2IA 4XUNA 1NKGA 2L9LA 3U37A 4ARYA 4YPJA 1GUIA 3LPFA 2VR4A 1T2XA 5F7UA 2J1EA 1CX1A 2VZVA 4TTGA 2W91A 3P1IA 1UWWA 3VDCA 1DP0A 4A44A 1XNTA 4A41A 3MO4A 5JMOA 4GWIA 4XUQA 5JR2A 5LA0A 2W1SA 1JYNA 2QQMA 3OEBA 4LKSA 1EUUA 3GDBA 5HPOA 1JZ6A 3I2GA 2RV9A 1JU3A 1UXXX 4CU9A 2B9VA 2BBAA 1L7RA 1F4AA 4M4PA 3CIHA 4KWUA 2ID4A 1H6YA 1YQ2A 2VMEA 1OF4A 2VZ1A 4P00B 3VD7A 2QQKA 2QQLA 2VCCA 1NX9A 5JXIA 3LEKA 1XPWA 1O8SA 2JKXA 3T2OA 5J1XA 2EIEA 4ZZ8A 3A23A 2W47A 2WDBA 3ETPA 1EUTA 2Y6LA 2BGPA 3WNLA 5DQ0A 4QX1A 4D0QA 3BGAA 1NUKA 1GOFA 5G05L 3K4ZA 4CVUA 4XUOA 2ORZA 2ZEYA 3T2QA 3A7QA 5JUVA 2VZTA 3C7FA 5IFPA 5JXJA 1W99A 2W9XA 3A21A 1UXZA 4DUVA 2VZ3A 4PF1A 2JE8A 5JXHA 1K45A 4XZUG 5CZKA 4XUTA 3WNPA 2R7EB 3IIIA 2PQSA 4Z2AA 1UY0A 3WF3A 3WNOA 2W92A 2C4XA 3T08A 1GNYA 2YC2A 1W0NA 1JZ5A 4QX0A 2DCKA 1GQPA 1US2A 3VD4A 1K42A 3T09A 3VD3A 2VMFA 3WF2A 3WF1A 3ABZA 2W5FA 4FI9A 3CKHA 2WO1A 1TG7A 3P6BA 1GU3A 1JU4A 2E33A 4MOAA 3CZJA 3WQBA 3OB8A 1UZ0A 2QQJA 4LQRA 5DMYA 2WZ8A 3W5MA 4JKMA 3K4AA 4CU7A 3HNYM 2BZDA 5EJZB 1JHJA 3I97A 4GZ9A 2VZQA 2V72A 3MV11 2W3JA 3ACGA 2YC4A 4RN5A 2YFUA 5FUIA 3NNGA 3WNNA 4CU8A 4OMCA 1US3A 3K4DA 2J1VA 3HN3A 2KD7A 3C7HA 4DXRA 3EB7A 4JKKA 2EIDA 4ARXA 5I0DA 3CDZB 3FN9A 4QB2A 5DN2A 1IQDC 2EIBA 3OGSA 4ZZ5A 2XQXA 2VCAA 1OT5A 3GM8A 3HOBA 1JZ8A 1R64A 1I5PA 3T0BA 1UX7A 5EIYB 1GOGA 3FL7A 3VDAA 2J1RA 5JXGA 2Y6KA 4D8MA 1OH4A 3C7GA 1DYOA 4QB6A 4QX3A 4E8DA 5B4XA 4TXWA 4XVHA 1JZ2A 5LA2A 5A1AA 1O59A 1W9SA 2RJ2A 2XOMA 3THDA 4QAWA 1UY1A 2YG0A 2VZRA 3A22A 3I3EA 5G04L 3UETA 4OYUA 1NAEA 4A42A 1JZ3A 4XUPA 1RYYA 4ZXEA 3LE0A 2J1TA 4P5YA 4CUBA 3LQCA 2VCBA 3OEAA 2C26A 4OUEA 1D7PM 2BERA 4MO3M 2WBKA 1SG3A 4PT6A 3BN6A 2VL4A 3HNBM 2E26A 3EYPA 3K77A 3NJVA 2QBXA 3E1F1 2VMDA 3I2KA 3DYMA 2W94A 1LNSA 2DCJA 2WO2A 3UESA 5B4NA 3C7EA 3I3DA 4HG6B 3ZM8A 5LCWL 4A6OA 2X10A 3ACIA 4KMQA 3ECQA 3DYPA 1BHGA 1UY3A 3D3AA 3HNMA 2ZEWA 1CZSA 4M4RA 3WNKA 3W5NA 2X09A 3C7OA 3K46A 1JYWA 4QDSA 2WN2A 1J84A 1K3IA 4OMDA 3LEIA 4DXTA 3LPGA 2HLEA 1W9TA 1WKYA 5DPNA 1JYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYY A;  2RVA A;  3WF4 A;  2W1U A;  3WNM A;  2Y64 A;  1OF3 A;  3DEC A;  2WYS A;  3I2F A;  2VC9 A;  2OKX A;  2ZEZ A;  5LA1 A;  3MUY 1;  3ACH A;  1CIY A;  1H6X A;  3WEZ A;  1PMJ X;  2VTF A;  4XUR A;  2Y6J A;  4RYD A;  5EJ1 B;  3CQO A;  3OGR A;  4KI5 M;  1SDD B;  2YB7 A;  1ULO A;  2X05 A;  3C8X A;  4MGQ A;  2HYX A;  4CUA A;  3FHA A;  2VQU A;  3I3B A;  1GMM A;  3VDB A;  3WF0 A;  4JX0 A;  4JHZ A;  4QDR A;  3CZU A;  3MUZ 1;  3IB3 A;  4W4Z A;  3DYO A;  3F2Z A;  3SEE A;  3LEG A;  5CYY A;  1DLC A;  4LHS A;  3SKJ E;  3VD5 A;  1KGY A;  1UYX A;  3JXS A;  2B4K A;  2VZO A;  4BDV B;  3THC A;  4BJ0 A;  2WAB A;  1UYZ A;  3OBA A;  3K75 B;  4DEQ A;  1PX3 A;  3MV0 1;  2J1S A;  3PUH A;  3GGL A;  1JYX A;  3IDA A;  2VZU A;  2J1U A;  1HN1 A;  3T2P A;  1W8O A;  3UNP A;  3I2H A;  2C9K A;  3SKV A;  1L7Q A;  3VD9 A;  1SHW B;  1CZV A;  2YFZ A;  2E32 A;  2CDO A;  3HEI A;  2V4V A;  2CDP A;  2VZS A;  3NQH A;  1JZ7 A;  4DXS A;  2XON A;  3MBW A;  4UI9 L;  4IUG A;  3NJX A;  1OD3 A;  2QQI A;  2QQO A;  3AC0 A;  2W1Q A;  2WO3 A;  4W8J A;  2LW8 A;  1GOH A;  3OGV A;  3NRU A;  1J83 A;  4QDQ A;  4A45 A;  3T0D A;  4A4A A;  2J7M A;  3J7H A;  4MAD A;  2VJX A;  2WZE A;  4ET7 A;  4MGS A;  3FHQ A;  4PQQ A;  4L0P A;  4DUX A;  2QQN A;  2Y6H A;  2ORX A;  4ZY9 A;  2E31 A;  1PMH X;  5IHR A;  4UOJ A;  4UAP A;  3WSO A;  4DEV A;  4CUC A;  5C70 A;  3I2J A;  2VO5 A;  1K12 A;  2ZXQ A;  2EIC A;  2WUH A;  1P8J A;  1XNA A;  2Y6G A;  1O8P A;  3GXU A;  3ACF A;  5IJR A;  4P08 A;  4P02 B;  2DDU A;  2JDA A;  2WQ8 A;  4BK4 A;  1UMH A;  1WCQ A;  1PX4 A;  2WAO A;  2ZEX A;  4AG4 A;  2WAA A;  4QX2 A;  2VOT A;  1UMI A;  5HXM A;  1XC6 A;  2W95 A;  2W46 A;  4QPW A;  2LS6 A;  2W87 A;  1F4H A;  1KEX A;  4DUW A;  1UYY A;  4GWJ A;  1UY4 A;  2V5D A;  2XHN A;  2J1A A;  4CU6 A;  1W8N A;  2W1W A;  4OZO A;  4BXS V;  1W9W A;  5C71 A;  2VM9 A;  4BK5 A;  2Z4F A;  4E8C A;  2BGO A;  4LPL A;  3PUI A;  3HJR A;  3OG2 A;  3IAP A;  1JI6 A;  2VZP A;  2WN3 A;  4JKL A;  2Y8K A;  4AAX A;  2VMC A;  5IFT A;  1TVG A;  3SEP A;  1MPX A;  1JZ4 A;  1ULP A;  2J22 A;  3T0A A;  3IAQ A;  1UY2 A;  4W50 A;  2JD9 A;  3HPN A;  2VQT A;  4A3Z A;  3CMG A;  1CZT A;  5C7G A;  4QB1 A;  3I2I A;  4XUN A;  1NKG A;  2L9L A;  3U37 A;  4ARY A;  4YPJ A;  1GUI A;  3LPF A;  2VR4 A;  1T2X A;  5F7U A;  2J1E A;  1CX1 A;  2VZV A;  4TTG A;  2W91 A;  3P1I A;  1UWW A;  3VDC A;  1DP0 A;  4A44 A;  1XNT A;  4A41 A;  3MO4 A;  5JMO A;  4GWI A;  4XUQ A;  5JR2 A;  5LA0 A;  2W1S A;  1JYN A;  2QQM A;  3OEB A;  4LKS A;  1EUU A;  3GDB A;  5HPO A;  1JZ6 A;  3I2G A;  2RV9 A;  1JU3 A;  1UXX X;  4CU9 A;  2B9V A;  2BBA A;  1L7R A;  1F4A A;  4M4P A;  3CIH A;  4KWU A;  2ID4 A;  1H6Y A;  1YQ2 A;  2VME A;  1OF4 A;  2VZ1 A;  4P00 B;  3VD7 A;  2QQK A;  2QQL A;  2VCC A;  1NX9 A;  5JXI A;  3LEK A;  1XPW A;  1O8S A;  2JKX A;  3T2O A;  5J1X A;  2EIE A;  4ZZ8 A;  3A23 A;  2W47 A;  2WDB A;  3ETP A;  1EUT A;  2Y6L A;  2BGP A;  3WNL A;  5DQ0 A;  4QX1 A;  4D0Q A;  3BGA A;  1NUK A;  1GOF A;  5G05 L;  3K4Z A;  4CVU A;  4XUO A;  2ORZ A;  2ZEY A;  3T2Q A;  3A7Q A;  5JUV A;  2VZT A;  3C7F A;  5IFP A;  5JXJ A;  1W99 A;  2W9X A;  3A21 A;  1UXZ A;  4DUV A;  2VZ3 A;  4PF1 A;  2JE8 A;  5JXH A;  1K45 A;  4XZU G;  5CZK A;  4XUT A;  3WNP A;  2R7E B;  3III A;  2PQS A;  4Z2A A;  1UY0 A;  3WF3 A;  3WNO A;  2W92 A;  2C4X A;  3T08 A;  1GNY A;  2YC2 A;  1W0N A;  1JZ5 A;  4QX0 A;  2DCK A;  1GQP A;  1US2 A;  3VD4 A;  1K42 A;  3T09 A;  3VD3 A;  2VMF A;  3WF2 A;  3WF1 A;  3ABZ A;  2W5F A;  4FI9 A;  3CKH A;  2WO1 A;  1TG7 A;  3P6B A;  1GU3 A;  1JU4 A;  2E33 A;  4MOA A;  3CZJ A;  3WQB A;  3OB8 A;  1UZ0 A;  2QQJ A;  4LQR A;  5DMY A;  2WZ8 A;  3W5M A;  4JKM A;  3K4A A;  4CU7 A;  3HNY M;  2BZD A;  5EJZ B;  1JHJ A;  3I97 A;  4GZ9 A;  2VZQ A;  2V72 A;  3MV1 1;  2W3J A;  3ACG A;  2YC4 A;  4RN5 A;  2YFU A;  5FUI A;  3NNG A;  3WNN A;  4CU8 A;  4OMC A;  1US3 A;  3K4D A;  2J1V A;  3HN3 A;  2KD7 A;  3C7H A;  4DXR A;  3EB7 A;  4JKK A;  2EID A;  4ARX A;  5I0D A;  3CDZ B;  3FN9 A;  4QB2 A;  5DN2 A;  1IQD C;  2EIB A;  3OGS A;  4ZZ5 A;  2XQX A;  2VCA A;  1OT5 A;  3GM8 A;  3HOB A;  1JZ8 A;  1R64 A;  1I5P A;  3T0B A;  1UX7 A;  5EIY B;  1GOG A;  3FL7 A;  3VDA A;  2J1R A;  5JXG A;  2Y6K A;  4D8M A;  1OH4 A;  3C7G A;  1DYO A;  4QB6 A;  4QX3 A;  4E8D A;  5B4X A;  4TXW A;  4XVH A;  1JZ2 A;  5LA2 A;  5A1A A;  1O59 A;  1W9S A;  2RJ2 A;  2XOM A;  3THD A;  4QAW A;  1UY1 A;  2YG0 A;  2VZR A;  3A22 A;  3I3E A;  5G04 L;  3UET A;  4OYU A;  1NAE A;  4A42 A;  1JZ3 A;  4XUP A;  1RYY A;  4ZXE A;  3LE0 A;  2J1T A;  4P5Y A;  4CUB A;  3LQC A;  2VCB A;  3OEA A;  2C26 A;  4OUE A;  1D7P M;  2BER A;  4MO3 M;  2WBK A;  1SG3 A;  4PT6 A;  3BN6 A;  2VL4 A;  3HNB M;  2E26 A;  3EYP A;  3K77 A;  3NJV A;  2QBX A;  3E1F 1;  2VMD A;  3I2K A;  3DYM A;  2W94 A;  1LNS A;  2DCJ A;  2WO2 A;  3UES A;  5B4N A;  3C7E A;  3I3D A;  4HG6 B;  3ZM8 A;  5LCW L;  4A6O A;  2X10 A;  3ACI A;  4KMQ A;  3ECQ A;  3DYP A;  1BHG A;  1UY3 A;  3D3A A;  3HNM A;  2ZEW A;  1CZS A;  4M4R A;  3WNK A;  3W5N A;  2X09 A;  3C7O A;  3K46 A;  1JYW A;  4QDS A;  2WN2 A;  1J84 A;  1K3I A;  4OMD A;  3LEI A;  4DXT A;  3LPG A;  2HLE A;  1W9T A;  1WKY A;  5DPN A;  1JYV A; 
#chains in the Genus database with same CATH topology
 5FMO L;  5C33 A;  3AZV A;  4LBQ D;  5IYY A;  4GAL A;  3AZW A;  3DXT A;  2RVA A;  1UCX A;  3ZR5 A;  4CDQ A;  2BVB A;  3DEM A;  2IXH A;  3VBR C;  4OQ8 A;  3H3U A;  3GBW A;  1IS4 A;  4Q8L A;  4PLO A;  3I2F A;  1PK6 A;  2HWE 3;  3M70 A;  3MLK A;  4L9B A;  4Q4W 3;  1TME 1;  2A6Z A;  3P3P A;  2ET7 A;  3MUY 1;  1C5I A;  2AYH A;  2RJL A;  3MIF A;  1OOP A;  4ZU7 A;  3QOP A;  2VMG A;  2HBT A;  2V73 A;  4BOW A;  1CIY A;  1U12 A;  3I2D A;  5LWB A;  3AFG A;  1PMJ X;  2VTF A;  2ARX A;  3CLP A;  4HSJ A;  4XXA A;  5CFD A;  2GC0 A;  4XFB A;  5FZO B;  3MDP A;  4BIF A;  1AR7 3;  2BWC A;  2XML A;  4KI5 M;  1SDD B;  1UW8 A;  5D8A C;  1LU1 A;  2H6B A;  3ATG A;  2X05 A;  1S55 A;  2WC2 A;  1HJG A;  1MS8 A;  1S0C A;  2OUJ A;  4E2S A;  4MGQ A;  4YYO A;  1VBA 2;  5EJ3 A;  4CUA A;  1FAY A;  1Q56 A;  4DMI A;  3ILF A;  1RUJ 3;  2RS5 2;  2VQU A;  3J4U H;  2WWS A;  4FXG B;  2XQR A;  4GA9 A;  4XJ8 A;  2ZGN A;  4QWN A;  1QDO A;  2OQ6 A;  2VBB A;  4JHZ A;  3MUZ 1;  1UAI A;  4EJR A;  2CGP A;  3NL1 A;  1IS6 A;  3WP5 A;  2PAE A;  3F2Z A;  4RQP C;  4X6Q B;  3ZVX A;  3IMN A;  3PUR A;  3AVR A;  1ND2 C;  4LHS A;  2VAU A;  2EAK A;  4FP2 A;  4GB3 2;  1YC6 1;  5F5C A;  1NCR C;  1SLL A;  4XDO A;  1UNB A;  4AYU A;  4CXW A;  1RXF A;  2PHD A;  3QAC A;  2J42 A;  5FPZ A;  2XKO A;  2PHT A;  2ZAA A;  4U2A A;  2RS1 1;  4F3J A;  1S0B A;  3PNA A;  4DEQ A;  1RUH 1;  1PM4 A;  5GZF A;  3PTY A;  1R1Z A;  3HVD A;  4XTP A;  1Z7S 1;  5FPA A;  4XQW A;  4YVS C;  1QMJ A;  1H4H A;  1VBC 3;  2D40 A;  3I4I A;  1JYX A;  4HBN A;  1IGO A;  1J58 A;  5BNN B;  3UGH A;  1RUG 3;  1HN1 A;  5E8A A;  3RYR A;  4A3X A;  1HIX A;  3UNP A;  3USS A;  1SBE A;  1L7Q A;  3SKV A;  1MQT C;  2JE7 A;  3ACL A;  4HK9 A;  1IZ3 A;  2VMH A;  3KF5 A;  1SHW B;  4QKF A;  2YFZ A;  3WD5 A;  1MS9 A;  2E32 A;  3HEI A;  3MID A;  5CA6 A;  5IK7 A;  4QPY A;  2VZS A;  5A6Z A;  2DCZ A;  2O1Q A;  4BA6 A;  3NJX A;  4LBN A;  3BAL A;  1GZC A;  1NA1 A;  4IEY A;  4IND A;  3ZFE A;  5EXO A;  1X8E A;  4YW1 A;  2YDE A;  2XBO 3;  4RFR B;  4GKX A;  4XCA A;  1ZBA 1;  2FZ1 A;  3QCW A;  1DGW A;  4QDQ A;  5JCT A;  3H0O A;  4YW7 A;  4A45 A;  1UIJ A;  1JOP A;  2OPW A;  2WFP A;  4EWE A;  2PXJ A;  1ZM1 A;  1HB4 A;  3FHQ A;  4LBO A;  3WP3 A;  2G9G A;  3JD7 2;  4KBZ A;  4PQQ A;  4L0P A;  4KG8 A;  3Q9O A;  2Y6H A;  3FFZ A;  1W9F A;  1WCK A;  3ES4 A;  2E31 A;  5DZG A;  5IHR A;  5KHI A;  4UOJ A;  5FYB A;  4A7Y A;  4GXL A;  3T30 A;  4G4F A;  5SV5 A;  1VB4 A;  2ZGT A;  2ZXQ A;  1OQD A;  2I07 B;  2EIC A;  5BNP C;  4U36 A;  4HN0 A;  5F6K A;  2Y6G A;  4B29 A;  5IWF A;  1QHD A;  1O8P A;  3GXU A;  3M8L A;  3ACF A;  1MS3 A;  5AFB A;  3AM2 A;  2XKP A;  3VB9 A;  3ZXG A;  2RMU 2;  3VN4 A;  1O91 A;  4Y20 A;  2WWJ A;  3GZT B;  1RMU 1;  2WT0 A;  1AYN 3;  2K0G A;  4YW2 A;  2O14 A;  5JAX A;  4FTB A;  3OBT A;  5E89 A;  4IXL A;  2ZZJ A;  2WA3 A;  4Q1P A;  4N43 B;  4JGZ A;  1UMI A;  3IDC B;  4RS5 B;  1NA1 B;  4COZ A;  4KH9 A;  4URT A;  1LOC A;  5DUV A;  4QPW A;  2EAA A;  3U78 A;  2DCY A;  2WII B;  2JDH A;  2WFF 2;  3M3O A;  2QDR A;  4AVT A;  2PYT A;  4LKE A;  2LS6 A;  2DVF A;  2WYF A;  1F4H A;  3V0A B;  2YBS A;  1NYW A;  1IKP A;  3NAP C;  1W28 A;  5EYX A;  2HWF 1;  5BNQ A;  2FCU A;  3MFC A;  3AB0 A;  1FXZ A;  3O12 A;  2RM2 3;  4L8Q A;  4BXS V;  1W3V A;  4K1Y A;  5DZF A;  4OZX A;  4MET A;  4CCC A;  3NKT A;  1W39 A;  1BMV 1;  2RDQ A;  1DG6 A;  2A70 A;  5FQ0 A;  3GBG A;  5A80 A;  4BK5 A;  1REF A;  2Z4F A;  2NMO A;  3BVC A;  3UJQ A;  3JBG 2;  3WDW A;  2FZ2 A;  1J59 A;  2OQ7 A;  1VBE 1;  4MX3 A;  4JTN A;  1DQ2 A;  5L7O A;  2FDI A;  3HJR A;  3ZXF A;  3OG2 A;  3WNX A;  4O9G A;  1JI6 A;  4UFL A;  2VUL A;  2D6L X;  2V4A A;  4P9X A;  1ENQ A;  2DUQ A;  3EJK A;  1W2T A;  1C5H A;  2H6C A;  3FC0 A;  4B4Q A;  3MIH A;  4YZ5 A;  2YU2 A;  5CEH A;  2Y8K A;  4CE8 A;  1ZZ8 A;  2E7Q A;  3UL2 A;  1DGR N;  2W0X A;  4Q4V 2;  2JDM A;  4AI3 A;  1S0D A;  3W59 A;  1JZ4 A;  4JRA A;  3SCH A;  3UYJ A;  3JBG 3;  1VAM A;  1EAH 3;  1HRI 1;  4M01 A;  1RVF 3;  1PVX A;  2JD9 A;  4YVS B;  5LBF A;  1ZZB A;  4CP1 A;  3LD8 A;  3M3E A;  3R05 A;  5FBZ A;  1AR6 3;  5KHG A;  1RUO A;  3CMG A;  4ZON A;  5I91 A;  3CJI B;  3DN7 A;  3VHP A;  5C7G A;  5FUP A;  1N1Y A;  2K46 A;  1ASJ 2;  3I2I A;  4EV0 A;  2CAU A;  2JIC A;  4AL9 A;  4ARY A;  4FPH A;  2VR4 A;  4AVB A;  3E97 A;  4K40 A;  1CX1 A;  4Q4X 1;  4GQ7 A;  1OUS A;  2IZW A;  4CCL A;  1DU3 D;  1HRI 3;  1FX5 A;  1NCR A;  1XXN A;  1UWW A;  4XJA A;  4JQR A;  3TYJ A;  4DZG A;  2IXK A;  5JMO A;  5FPX A;  2VVF A;  5L9B A;  1DYK A;  1RUI 2;  1V6I A;  2VQ0 A;  3D8C A;  4MHR A;  3RG0 A;  3SH5 A;  3F95 A;  2Y0I A;  1POQ A;  2ZTN A;  1VIW B;  3WIN E;  5HPO A;  5JOX A;  1R08 2;  2WSV A;  2X5I B;  3I2G A;  1JU3 A;  3JD7 1;  4RR3 C;  1FOD 1;  3J26 N;  1I9R A;  2NN8 A;  5IAX A;  2CHH A;  4YNI A;  4CTE A;  3IPV A;  1GIC A;  1RVF 2;  3NO8 A;  2AEZ A;  1L7R A;  1ULD A;  3G6J B;  4KWU A;  3WG1 A;  1SLC A;  3MIB A;  4IE4 A;  2VZ1 A;  2E7A A;  3H3L A;  4Y4Y A;  1PGS A;  3O1T A;  2GN7 A;  1CON A;  4HN1 A;  1N3P A;  5CKM A;  4UXA A;  4CEY C;  1LGC A;  3I8T A;  1NX9 A;  4WVM B;  5A7W A;  5JXI A;  3I7D A;  4AEK A;  5J1X A;  4JQT A;  4S2D A;  2Z42 A;  1PO1 2;  3FWE A;  2RM2 1;  1X8M A;  3J7L A;  1RUD 1;  2WDB A;  3ETP A;  5DDJ 1;  1EUT A;  5ABJ C;  2A6Y A;  1KXG A;  3NNF A;  1AYM 1;  1RUF 2;  1ZZ7 A;  4XF0 A;  5EZW A;  2OUH A;  5FY1 A;  5L36 A;  2VCM A;  3R0R A;  1ONA A;  1AR9 3;  4B4P A;  1MVQ A;  3OF1 A;  1LHW A;  1YIP A;  3A0N A;  2XLF A;  5FZ0 A;  4B4R A;  2XVG A;  4FPY A;  3AXD A;  4ASK A;  2JEN A;  2DVB A;  2ZEY A;  1YO8 A;  3T2Q A;  2VZT A;  2YV8 A;  1WW5 A;  3PVO A;  2Y38 A;  5ACA 3;  3AL6 A;  1W99 A;  2WNV C;  2AR6 A;  1EPW A;  5FY7 A;  1SFP A;  1LB2 A;  1XNK A;  3TRS B;  1AYN 1;  5EYY A;  3ZIX A;  2PLV 2;  5JPN B;  4DUV A;  4PF1 A;  2JE8 A;  1WLD A;  2D3R A;  5FZ9 A;  4LNV A;  3ZFE B;  1QXJ A;  5CZK A;  5FO8 B;  3ME2 A;  4XUT A;  1SLA A;  2E53 A;  3OBR A;  3V64 A;  3WNP A;  2GME A;  2R7E B;  2OX0 A;  3O0V A;  3NVC A;  5CIR A;  4Z2A A;  4KWL A;  1S0E A;  1ZBE 3;  3WDU A;  1Q8P A;  2C4X A;  2ERF A;  3M1H A;  2QZ3 A;  5FZF A;  2WLQ A;  2FQP A;  3T08 A;  1R1A 3;  3MW3 A;  1S0G A;  4XIK A;  3EHK A;  3POS A;  1QDC A;  3TAY A;  4Z82 A;  3VD4 A;  1AR7 1;  1PVC 3;  2WWU A;  4RGG A;  5FZI A;  3WF1 A;  3USU B;  4WM7 B;  1OHF A;  3ZXK A;  2EXH A;  5IVF A;  5FWE A;  5EV7 A;  1Y9Q A;  2HH9 A;  2WO1 A;  4QPI A;  1W9Y A;  1GZT A;  1JU4 A;  2E33 A;  2IXL A;  2R0F A;  3CZJ A;  4MOA A;  3WQB A;  1MS4 A;  3OB8 A;  1XE7 A;  4AFM A;  1O5L A;  2P6C A;  4LQR A;  2FDK A;  3R4S A;  1XSR A;  2HJI A;  1RIT A;  4JRL A;  1CGP A;  4XW3 A;  4GB3 3;  3K4A A;  3E6D A;  5IVB A;  3HNY M;  3RRD A;  3JD7 3;  1UX6 A;  5EJZ B;  4EQV A;  1PVC 1;  1Q5O A;  1W03 A;  1S2B A;  4LJH A;  4GH4 A;  4CEW A;  1BYH A;  1ZBA 2;  2V72 A;  3MV1 1;  2QQW A;  2B5H A;  5K9Y A;  1QQP 1;  4LMF A;  3ZPO A;  1KIT A;  3S57 A;  4M0N A;  2R0H A;  4MUV A;  4XFF A;  4RN5 A;  4Z2W A;  5FUI A;  2Q1F A;  4BPZ A;  1A8D A;  1ND3 C;  1HQW A;  4FAH A;  2WS9 1;  3IT8 A;  4YZ2 A;  5KR7 A;  3OUJ A;  1IKQ A;  3WX5 A;  5FXW A;  1OUX A;  5J37 A;  1AR7 2;  2EID A;  2WO7 A;  3HQU A;  2E6V A;  3GF6 A;  4W6Y A;  3WDV A;  2O8Q A;  2VBP A;  3AX4 A;  5FP9 A;  3IM0 A;  3VZN A;  2W2I A;  1DLL A;  1RMU 3;  1DGL A;  1TZO A;  2Q8O A;  3OGS A;  4XF9 A;  4ZZ5 A;  2XQX A;  3MGU A;  3THP A;  1OLR A;  4L99 A;  1R64 A;  2DFC A;  1RUH 2;  3LAG A;  3DL3 A;  1J3P A;  4SLI A;  4XJZ A;  3T0B A;  3N4M A;  4EZH A;  4AEM A;  5HCB A;  5FZ3 A;  4Y33 A;  4WM8 C;  3WQ0 A;  4JCK A;  1LOD A;  4NJ4 A;  5HCA A;  2OXB A;  3MEP A;  2A71 A;  2J1R A;  1GP4 A;  2YXS A;  3R6S A;  1GWL A;  1QJY 3;  2B9U A;  2BGC A;  3N9O A;  3T2T A;  4QB6 A;  3TN9 1;  2P17 A;  3U4S A;  4QX3 A;  1UF2 C;  5B4X A;  4FTS A;  1QEX A;  4AVS A;  4CCN A;  1A6C A;  3V65 A;  2HWF 3;  1JZ2 A;  1LES A;  4JDN A;  1RUJ 2;  4A7Z A;  5DDJ 2;  2FMY A;  3CBN A;  3FBY A;  3U14 A;  4E2G A;  1O59 A;  1ULC A;  3CU7 A;  4HMZ A;  4MXW A;  4PDW B;  2GMP A;  2ZX0 A;  1W9S A;  2RJ2 A;  3ORJ A;  3B00 A;  1W0O A;  3NST A;  3SLI A;  1OVP A;  4H55 A;  4QXK A;  2ADD A;  2YG0 A;  2X53 S;  3DGT A;  1QJZ A;  4GMP 3;  1UU4 A;  2BW8 A;  2UY9 A;  3UET A;  4Q4Y 1;  1JTZ X;  4Z1V A;  3KB5 A;  3LGR A;  1Q3E A;  4L2N A;  4YGC A;  4OYU A;  4A42 A;  3WG2 A;  2HWE 1;  4QQH A;  1VAV A;  3ZN4 A;  4LK7 A;  4CUB A;  1V9U 1;  1N1S A;  3FLR A;  4BME A;  4QD2 A;  3OEA A;  3VBH C;  4M3C F;  3X29 B;  3UKV A;  1W8W A;  3B9I A;  4H7M A;  4FSJ A;  5EHD A;  1H2K A;  4Y22 A;  5LEK A;  1GV9 A;  2GZW A;  2NPI A;  1H2N A;  2E26 A;  2IFR A;  3EYP A;  5CAD A;  5JZG B;  2QBX A;  3H42 B;  4NUB A;  4XF3 A;  3GCX A;  1OQE A;  1PIV 2;  4YWA A;  3SCF A;  4Z07 A;  1CAW B;  1LNS A;  1V6L A;  2WO2 A;  5LK7 B;  1RIN A;  3WP4 A;  3ZM8 A;  4JTO A;  2ZX1 A;  4R9D A;  5APA A;  5CKN A;  4FPE A;  4R8H A;  2DTW A;  3ETQ A;  3LOI A;  4KMQ A;  3DYP A;  4XJU A;  1AXK A;  1VAK A;  4RGK A;  4D94 A;  5KHJ A;  1MS1 A;  2A3X A;  5K7P A;  3D3A A;  4M4R A;  2XJV A;  1CZS A;  4HZF A;  5GLW A;  2I2S A;  3W5N A;  2B45 X;  2ZBJ A;  4XBQ A;  4DB5 A;  4Z8B A;  2BYV E;  2CGO A;  3A0K A;  2C9A A;  3WP6 A;  3ZYG A;  2XJU A;  4AOC A;  3JU9 A;  5FPU A;  2WN2 A;  1J84 A;  2EIG A;  2HKX A;  4K6B A;  1G7Y A;  3KF3 A;  4XHX A;  1W06 A;  4DXT A;  2QQU A;  1TMF 3;  2CWS A;  3FLP A;  3N9M A;  5DPN A;  4B7K A;  1JYV A;  1OSG A;  3RWN A;  1PVC 2;  1DF0 A;  4YGE A;  4AED C;  4IE5 A;  2W08 A;  2IC1 A;  3OGJ A;  5FZM A;  3OD4 A;  1CQ9 A;  1EPZ A;  1U5Y A;  1RUI 1;  2Y64 A;  1KDK A;  2XHK A;  4KWJ A;  3LSE A;  1IPJ A;  4P9I A;  3BOP A;  5FBJ A;  1OF3 A;  3T1L A;  2WYS A;  3GHM A;  1QJY 1;  5FZL A;  3OY8 B;  5T3N A;  1CVN A;  1GR3 A;  2ZEZ A;  4LLF A;  2RS1 2;  2WS9 2;  4I0B A;  2N7G A;  1CAV B;  5KHH A;  3LEM A;  4QU1 A;  3ZXE A;  5A32 A;  5ABJ B;  1ACC A;  3Q8A A;  4GWN A;  4FOV A;  4BIS A;  1XNB A;  5FMC A;  1QXP A;  2VH9 A;  3ZPY A;  3J8F 2;  1E5H A;  1VB2 A;  1WWY A;  1LCL A;  4QPI B;  3SIS A;  3WEZ A;  1TMF 2;  4HET A;  1MZ6 A;  4XUR A;  5FZH A;  2VXJ A;  3SH4 A;  4Y5T A;  5CFC C;  2NMN A;  4OFG A;  2JG8 C;  4RR3 A;  2YB7 A;  1NCQ C;  2BNN A;  3BIE A;  3O1M A;  5FP7 A;  4CEY B;  4FFG A;  1N1V A;  1HW5 A;  2YBP A;  2GMM A;  3C8X A;  1HDK A;  3SXW A;  2BNM A;  1OUR A;  3VZK A;  3WCR A;  4AEJ A;  4CCE A;  4CYD A;  5K0U B;  3VL8 A;  2WZR 3;  2YC0 A;  3AZZ A;  3FHA A;  4JGY C;  4C8D A;  1GMM A;  1OLM E;  1HLC A;  2DBN A;  4CCK A;  3RNS A;  2IXC A;  4QDR A;  3ZFF C;  3CZU A;  1CAU A;  2W52 A;  3OCP A;  5AC9 3;  3K48 A;  4W4Z A;  4CA9 A;  3I54 A;  2OW4 A;  1U0A A;  3KT7 A;  4LBJ A;  4BIO A;  2F17 A;  1DLC A;  3GAL A;  5CYY A;  5A33 A;  3HT1 A;  5F8P A;  5T5O A;  3ZN6 A;  4XYX A;  3TNP B;  4K20 A;  3O1S A;  4AQ2 A;  1YQ8 A;  2B4K A;  2VZO A;  5KXE A;  4BDV B;  4Q4X 2;  4DFS A;  4IE0 A;  5CVR A;  2HWB 2;  4OI0 A;  2GC1 A;  4FCA A;  5JOZ A;  1QJF A;  3KD4 A;  3IDE A;  5I0T A;  1NLQ A;  3AFK A;  5T50 A;  1VJ2 A;  1WGP A;  2J1S A;  3RI9 A;  1YCI A;  4NO4 A;  2Y33 A;  1FNY A;  1W6Q A;  3D82 A;  3GGL A;  4XQD A;  5A6Q A;  5JOY A;  3JUU A;  1V00 A;  3IDA A;  2VZU A;  3E5X A;  3I59 B;  1UPS A;  4AFC A;  2RS3 3;  2E51 A;  4Q0S A;  4CXY A;  4R4Z A;  1K5M C;  2D3P A;  3TEX A;  3URF A;  1FV2 A;  1PZ8 A;  2V5Y A;  3W9A A;  4EN7 B;  5C8C B;  3VD9 A;  1CZV A;  2CDO A;  2ZX3 A;  3DF0 A;  4AFA A;  3NQH A;  1WLC A;  1ZBE 1;  1BZW A;  2VGD A;  2XON A;  3MBW A;  4DXS A;  2JEM A;  1OD3 A;  1C8M 2;  4AE2 A;  1RJ7 A;  4XJ9 A;  1VBB 1;  5GLV A;  1WCS A;  2QQO A;  1BXH A;  2LW8 A;  1AL0 G;  1GOH A;  1J83 A;  4P5H A;  5F39 A;  5AC9 1;  1V9U 3;  5FLH A;  4P9G A;  2A73 B;  4J25 A;  4YW3 A;  4YG0 A;  3GZU C;  1O5U A;  4YVW B;  2ZGR A;  4FPK A;  2D6P A;  2JDU A;  3U07 A;  3ILN A;  3KSC A;  3S5Q A;  4COU A;  1DCS A;  3NNJ A;  4CZS A;  2HWF 2;  4Q4W 2;  4GD4 A;  1FPN 2;  2UYA A;  4YZ4 A;  1ZRR A;  1IQA A;  2PMW B;  4UAP A;  3RPQ A;  2B46 X;  3MFA A;  2WNU B;  5C70 A;  3I2J A;  4MH0 E;  3KV6 A;  1RUG 2;  1TNF A;  1WD4 A;  2VO5 A;  3GNE A;  5E6H A;  2XPJ A;  5FRE A;  3HT2 A;  3W20 A;  3M3Q A;  4YGD A;  3ZXA C;  2GN3 A;  4CCM A;  5BXX A;  2DDU A;  1BEV 3;  5BNP A;  1STM A;  2CV6 A;  4QX7 A;  4A6S A;  4CPB D;  1UMH A;  4NHX A;  1S1A A;  4FFI A;  2AGS A;  2WAO A;  2ZEX A;  4BLJ A;  4NHY A;  5LK5 A;  4QX2 A;  4N7I A;  2VOT A;  1RHI 2;  4MVT A;  2D98 A;  3POW A;  4JHT A;  4XXP A;  3AZX A;  2PN5 A;  5CB7 A;  3GHN A;  5AC9 2;  1CJP A;  5KBF A;  2W95 A;  4QQL A;  5F5Q A;  1ZZ6 A;  2W39 A;  2W46 A;  1DZR A;  5A1L A;  5J96 B;  5CG8 A;  1R09 3;  4DS0 A;  2JDN A;  2F4L A;  4N90 A;  1UZV A;  1DZT A;  2W87 A;  2VNV A;  1BEV 1;  4AW7 A;  2GU9 A;  4DUW A;  2C6S A;  3N7L A;  5C3O A;  3POI A;  1YFW A;  4GWJ A;  1UY4 A;  1FPN 1;  3TN9 2;  4ZKT B;  4F8A A;  3JCI A;  1MEC 3;  1NCQ B;  1QOO A;  2VOX A;  2XHN A;  1CAV A;  4CU6 A;  3KHB A;  1VBA 1;  3POJ A;  4GJY A;  5T52 A;  3H8U A;  3VBF B;  3FZ3 A;  1UPI A;  1XJA A;  1T6G C;  3MPP G;  1W8Z A;  1F8V A;  4L92 A;  1HB3 A;  1LOF C;  3PMS A;  1YI7 A;  5M0T A;  2JG9 B;  1DGW X;  3KGL A;  2OT7 A;  2BGO A;  4OUL A;  4FO9 A;  1GLH A;  2JD4 A;  2W68 A;  3AKT A;  3ZYF A;  3PUI A;  4XTM A;  1UOG A;  2VY0 A;  1IG3 A;  3D4K A;  4WM7 A;  5FR3 A;  5CIS A;  3CHX A;  4IE6 A;  2DU0 A;  4AAX A;  1WW6 A;  5L7O C;  4PBO A;  4C91 A;  4OCT A;  4OI1 A;  3VBU A;  4BQ2 A;  3LDB A;  4P14 A;  1RVF 1;  2CWM A;  2H0B A;  5GLT A;  1O7F A;  2ZJC A;  4CDX C;  2NLR A;  2VNG A;  5CFC A;  3T0A A;  3I3M A;  1F5J A;  1SFN A;  3KV4 A;  3BU0 A;  1D0H A;  3VBH B;  3BUC A;  3VUO A;  1V0A A;  1XYN A;  2VQT A;  2AH2 A;  3HQX A;  4I30 A;  3ON7 A;  4BB3 A;  3SC7 X;  1H4G A;  2RM2 2;  5F2W A;  4AK3 A;  1AVB A;  1L7L A;  1CWP A;  4JGY A;  1FNZ A;  2AAC A;  4QGM A;  4IV3 A;  3RZH A;  4MGY E;  4Y20 B;  1O3S A;  2HWC 3;  4YPJ A;  4COW A;  1GUI A;  4NWW A;  5F7U A;  1NT0 A;  1I1E A;  4LUM A;  3PL0 A;  1TE1 B;  4AF9 A;  3SQO A;  3OGG A;  2OZJ A;  1C8M 1;  2XJT A;  3CO2 A;  3P1I A;  5FZG A;  2Z69 A;  5HCH A;  1XNT A;  4A41 A;  1EAH 2;  2PEL A;  2R06 3;  3WZ1 A;  2VBD A;  3OBZ A;  4DPN A;  3DCQ A;  5I8S A;  5JR2 A;  1NY7 1;  4URA A;  3I2O A;  1DQ6 A;  1N47 A;  5L73 A;  1OPM A;  3P5B A;  5I0R A;  1V6M A;  3CNA A;  5A3W A;  3WR0 A;  1AYN 2;  1RUF 3;  1WA6 X;  1UXX X;  4NN0 A;  4PIY A;  4Y24 A;  4LBK A;  2B9V A;  2BBA A;  4OVE A;  5FP4 A;  2MEV 1;  3MF9 A;  4QPI C;  4IE7 A;  3BB6 A;  5T54 A;  3ZYJ B;  3RZL A;  1SLT A;  4HAN A;  1BK1 A;  4Q4Y 2;  2ID4 A;  2D3S A;  1YQ2 A;  2VTX A;  3FBM A;  2WNU C;  3POF A;  4LOR A;  1LEN A;  1MR5 A;  4MSV A;  4BQ1 A;  3N9N A;  5JSO A;  5FKC A;  1RUC 3;  2ARC A;  4KL1 A;  3FUO A;  2QQK A;  1DQ0 A;  2QQL A;  2FCT A;  2ZHN A;  3AP7 A;  3HD8 B;  2EXK A;  5GZC A;  3GJA A;  1O8S A;  2JKX A;  1V9U 2;  3T2O A;  3QBQ A;  1ZYB A;  1EV1 2;  4W6W A;  4UW4 A;  1MZF A;  2EIE A;  4TZD A;  3E6C C;  1RUI 3;  4P9J A;  4YSF A;  2ZGU A;  3IDB B;  5LBC A;  3HWJ A;  3PU3 A;  1GWM A;  4NE9 A;  4AI2 A;  5J7M A;  1A8M A;  3M7A A;  5J09 A;  3WNL A;  5DAV A;  5LW9 A;  5IVV A;  4XOG A;  3OYW B;  3BGA A;  1NUK A;  4LKF A;  4FOY A;  1O3Q A;  4N43 C;  3O5S A;  3R4U A;  2JG8 B;  1YYN A;  1AYM 2;  1J3Q A;  1LED A;  2ARB A;  2WNE A;  3ZIW A;  1BBT 3;  2JG9 A;  1ZA7 A;  4AVA A;  5C3R A;  3FUQ A;  1PGW 2;  2RR1 2;  5FXX A;  1EY2 A;  2ZGP A;  4MHU A;  2BBV A;  4Y5Z 0;  4MZU A;  1GYK A;  3ZYR A;  1BEV 2;  2SLI A;  3AVS A;  1EV1 3;  1QKQ A;  1L3J A;  5GZG A;  1NCQ A;  1UXZ A;  3LIH A;  2CAV A;  2D6K A;  1SEF A;  2BFU S;  5CKQ A;  3VZO A;  5A6Y A;  1RUC 2;  1VE0 A;  3JQX A;  1K45 A;  4XZU G;  1TME 3;  2Z79 A;  5DG1 A;  5FZE A;  4B3N A;  4TWT A;  1AL2 3;  4Y1Y A;  2PQS A;  4LUL A;  1JYT A;  1K5M B;  1Y9M A;  3BOW A;  4NOT A;  2HWB 1;  2JKB A;  3WF3 A;  3EXU A;  1XE8 A;  5DG2 A;  5FYU A;  3E6B A;  1GKB A;  1O4Z A;  2WR9 A;  4C0H A;  1GQP A;  4JZR A;  1XRU A;  4ORF A;  1K42 A;  3T09 A;  3WY6 A;  2RR1 3;  4D6R A;  2A6X A;  2VMF A;  4COV A;  2YRO A;  3L9J T;  1OVS A;  4TSV A;  2GP5 A;  5L7O B;  4BWO A;  4UW5 A;  2FBE A;  4V2W A;  1GU3 A;  4XFH A;  2OYZ A;  3EMR A;  2B8M A;  3ZDS A;  1HRI 2;  1UZ0 A;  2VW2 A;  1X9P A;  3RI8 A;  1C4R A;  4ZU4 A;  3BTX A;  3TNQ A;  4JGZ C;  4OUM A;  3J8F 1;  4PHZ A;  5K4L A;  5LAT A;  1S4C A;  4NR1 A;  3BTY A;  3S7I A;  3W5M A;  3POG A;  1N3Q A;  2WNU A;  3OYW A;  2OA2 A;  4CU7 A;  1REE A;  2PHL A;  5J48 A;  1RED A;  4HK8 A;  1COV 1;  3I97 A;  4CCJ A;  1ASJ 1;  2GP3 A;  4GZ9 A;  1VBB 2;  1LOF A;  3FX3 A;  4TLG A;  4LO8 A;  3WW3 A;  3RZG A;  4CUG A;  1YFY A;  4S2F A;  5F5A A;  3ZSK A;  2WLP A;  2YC4 A;  4UYB A;  4Q4Y 3;  2Y26 A;  4IV1 C;  5FIX A;  2F4P A;  1US3 A;  4HPK A;  4UW6 A;  1H8T A;  5FYV A;  2BOJ A;  3KQR A;  1G86 A;  5FZC A;  4N43 A;  2J1V A;  1UKR A;  3HN3 A;  3QLQ A;  3O1P A;  2KD7 A;  1YQ5 A;  2R32 A;  1H8V A;  1YEW A;  3EB7 A;  4KWK A;  2BDR A;  4ZXK A;  1ENR A;  4PLM A;  5B2G B;  5ISL A;  1V6O A;  4ARX A;  5BYN A;  1WME A;  4P9Y A;  4D6Q A;  2C5D A;  4Q8K A;  2HWE 2;  1PHM A;  1NY7 2;  1ENX A;  1UU6 A;  2GNT A;  5DN2 A;  3WUC A;  3ITQ A;  3ZXD A;  2EIB A;  1IOA A;  5A7N A;  4OHZ A;  1OT5 A;  3W58 A;  3HOB A;  1MZE A;  4NIA A;  2Q5T A;  5FMO S;  3MIE A;  3I59 A;  4NHM A;  5FY0 A;  5A6X A;  5IVJ A;  4WZC A;  1GQG A;  1BQP A;  1QWR A;  1UN1 A;  1X50 A;  3AP5 A;  4QQO A;  4XDP A;  3RQ0 A;  2GC2 A;  3WUD A;  1MVE A;  3C2U A;  3PVE A;  1AR9 2;  2ZHM A;  1PNF A;  4Q26 A;  3THT A;  2XVL A;  4WVV A;  4P9W A;  3RJ2 X;  2PLV 3;  1MAC A;  1SCS A;  1RUF 1;  2JEC A;  4QQ2 A;  2R04 3;  3LDK A;  5KHK A;  4PIZ A;  5A3U A;  1HV1 A;  5LBE A;  5D8A B;  2ZZQ A;  1XE0 A;  3KM5 A;  1POV 0;  5F3I A;  3RS6 A;  2IVI B;  4RSU A;  2XOM A;  3THD A;  1BLZ A;  5BY5 A;  4HPK B;  1UY1 A;  4EE2 A;  1CAU B;  3ZMO A;  1DYP A;  3MLJ A;  2ZAH A;  5L9R A;  3D0S A;  1YWK A;  2VZR A;  3A22 A;  3I3E A;  3POY A;  5D2A A;  3CEW A;  2PAM A;  4CPB A;  3QD6 A;  1JZ3 A;  4XUP A;  4G3Y C;  3APB A;  1QGL A;  1WLW A;  4H7L A;  5K0U A;  5JOW A;  2E63 A;  4ZXE A;  1V6N A;  1FT9 A;  3LE0 A;  2J1T A;  5EPA A;  2C0Z A;  5DAW A;  5T55 A;  3NV3 A;  1YRZ A;  3HQR A;  3VKO A;  1NCR B;  4Q2F A;  4OUE A;  2QDN A;  2PFW A;  2BER A;  1YQC A;  4MO3 M;  2WBK A;  2G1M A;  1WCD J;  2C24 A;  2VL4 A;  3BN6 A;  3HNB M;  4FXK B;  4DIQ A;  1DQ4 A;  1BBT 1;  2VPV A;  3NJV A;  3D0J A;  3E1F 1;  4RGA A;  4YZ1 A;  1SLI A;  5D1I A;  5E88 A;  3I49 A;  3CJI A;  3JQW A;  3VBF A;  2DCJ A;  3C7E A;  5FTT C;  4OQ9 A;  4BQY A;  2YPJ A;  1VPH A;  4OHX A;  3LDR A;  4PI0 A;  1F2N A;  1FMD 1;  4K3U A;  4CDU A;  4CDX B;  2FDH A;  1C1L A;  3LZZ A;  1AF9 A;  2P37 A;  4Q1R A;  5BNO A;  1BHG A;  1LGN A;  3NWK A;  4MG2 A;  1UY3 A;  5LRS A;  3GZE A;  4BZ4 A;  1CPN A;  4QKD A;  4IEZ A;  4NRM A;  1ND3 B;  1HQN A;  2UY8 A;  1A78 A;  2RDN A;  2VG9 A;  4LXL A;  2WQ4 A;  4OMD A;  1K3I A;  2ZML A;  1ULE A;  4IEU A;  3LEI A;  2HEV F;  2Q8D A;  3L2H A;  4DY5 A;  2HLE A;  3C3V A;  4QXB A;  1PO2 1;  1SLB A;  1WKY A;  2CU5 A;  2PQQ A;  2XBO 2;  2P3I A;  4XET A;  2GC3 A;  4PBP A;  4WV8 A;  1OBN A;  4CDQ C;  1LEC A;  4V1P A;  4YM3 A;  2BUK A;  2ZS6 B;  3VBR A;  5A3L A;  2WNV A;  2XUE A;  3GCW A;  3O0W A;  3WF4 A;  4AHW A;  4R52 A;  2CTV A;  3PVB B;  4UFK A;  3WDX A;  3WNM A;  2LRP A;  1XYP A;  4Q29 A;  3DEC A;  5T5J A;  4BQ4 A;  4AQT A;  1XNC A;  2VC9 A;  2OKX A;  5IAV A;  2F6B A;  1LRH A;  2K2S A;  3ZXL A;  4E4Z A;  1PGL 2;  2P5B A;  1BKZ A;  2VOW A;  3ACH A;  4YAR A;  4QM9 A;  2YYO A;  5FZ8 A;  5T5P A;  4CP9 A;  3PIJ A;  1KFU L;  1W90 A;  5FYS A;  2ZX2 A;  5FV3 A;  2XWJ B;  2OPK A;  4OHW A;  1NLR A;  5EJ1 B;  3IWZ A;  4ASM B;  5KC6 A;  2GAL A;  1QNY A;  1ULO A;  4NAO A;  2KXL A;  1S2K A;  4RS5 A;  1B09 A;  1WD3 A;  2P3J A;  5CAZ A;  2JDK A;  2ADE A;  2P1B A;  4Y1Z A;  2HYX A;  4RHV 3;  4SBV A;  1N3O A;  1WMD A;  5FRA A;  5JR7 B;  3EO6 A;  3I3B A;  2GNB A;  4HFS A;  3VDB A;  3O1V A;  3WF0 A;  3M4F A;  4LEJ A;  3VGI A;  4N8M A;  1W6M A;  5I8Y A;  2RHP A;  2IXI A;  1ZVF A;  2XL7 A;  4JX0 A;  4ZS2 A;  1ZRC A;  2ZCW A;  3H7J A;  4I3P A;  3QH7 A;  4JDM A;  4AFB A;  3SKJ E;  1OFS A;  4CXX A;  4MXW B;  4PDW A;  1XBF A;  5IVE A;  3JXS A;  4XAC A;  1D2S A;  4QX8 A;  2Q0A A;  2A5Z A;  3H1Y A;  4PDW C;  4YLZ A;  1JOB A;  5KXC A;  4RL7 A;  1RIR A;  1LHV A;  3ENR A;  2WAB A;  1MS5 A;  2BNO A;  1VBC 1;  2HEW F;  2IUW A;  2ZAC A;  1PX3 A;  3MV0 1;  1CES A;  1HXS 3;  5JZG C;  5LY2 A;  4JAA A;  2P4E A;  4EZ4 A;  2BRT A;  2BVV A;  2TBV A;  3N9Q A;  4YRD A;  2CL2 A;  4X8P A;  4PF5 A;  1HN0 A;  1VRH 3;  3B94 A;  2J1U A;  3ZKU A;  3POB A;  3DXU A;  1W8O A;  3I2H A;  2C9K A;  5J98 B;  4ZPI A;  2BP6 A;  4X8N A;  1QJX 3;  1IS3 A;  2EAL A;  3MI8 A;  2Q1M A;  4NHK A;  2RE9 A;  4W6X A;  3U75 A;  2O8O A;  2V4V A;  2ZGL A;  5AVP A;  2WSU A;  5FYT A;  1E57 A;  2R06 1;  2BPA 2;  2HWB 3;  3RZZ A;  4E4H A;  1PIV 1;  2JIG A;  2VNR A;  4LA2 A;  2FDF A;  3SMH A;  1RUD 2;  3VBU C;  3ZSJ A;  1BBT 2;  5JLV A;  1D0G A;  4KQ7 A;  3AC0 A;  2HWD 3;  1VMH A;  1HRV 1;  2WO3 A;  2QZ2 A;  3MZH A;  4BMB A;  2BQP A;  3QH6 A;  1OOP C;  2XG3 A;  4I0W B;  3T0D A;  3ZOI A;  4A4A A;  2J7M A;  3SIT A;  2PHW A;  3VHR A;  2WZE A;  2WFF 3;  2WNO A;  2R1B A;  4MGS A;  2GNM A;  1FMD 2;  1XSQ A;  1AR8 3;  3AK0 A;  4BCU A;  2PHR A;  4Q5O A;  4DUX A;  5JPM B;  2R16 A;  4DO0 A;  4GH4 B;  4ZY9 A;  1PMH X;  4L11 A;  1POV 3;  3VKF C;  1CAX B;  1VRH 2;  4CUC A;  4EN0 A;  5A32 B;  2QQP A;  2X8K A;  1G9C A;  3SCG A;  1UZY A;  1Y3T A;  3ST7 A;  3OUI A;  1WUV A;  1XNA A;  1W2U A;  5A3M A;  1QJX 2;  2RS1 3;  2AEY A;  5IJR A;  3B5L B;  3ELN A;  3PIG A;  4YZ3 A;  3DPR A;  5FYZ A;  4OI4 A;  5GZD A;  1JYC A;  4XIL A;  3VBS B;  1UU5 A;  2JDA A;  1SZB A;  4IL7 A;  2ZA9 A;  3T3Y A;  2WQ8 A;  3VDD B;  1WCQ A;  1GAN A;  4E4D X;  1LGB A;  1JUH A;  2GSY A;  4FBF A;  5GAL A;  2WAA A;  1SPP A;  2HEY F;  5A1F A;  3WCS A;  1VAL A;  2AUY A;  5GJ6 A;  3WG4 A;  5ACA 1;  3KQ4 B;  4XAB A;  3DKW A;  3BTA A;  3UT0 A;  5EQU A;  1NLS A;  4COY A;  5HXM A;  4XJW A;  1CR7 A;  1AR8 2;  2VW0 A;  5CFD B;  2P2K A;  5BV6 A;  2I45 A;  2HWC 1;  2QQV A;  1LOE A;  3PTR B;  5DAB A;  5LEJ A;  1KEX A;  1ZRI A;  4FPC A;  4LA3 A;  2KM2 A;  4QX5 A;  5F6L B;  1PO1 3;  4ZHN A;  1U5I A;  4IV1 A;  3AKS A;  1WW7 A;  3OSD A;  5C3P A;  4AVC A;  3RZK A;  1W8N A;  1IPK A;  4OZO A;  4BQ3 A;  3K2O A;  1OH3 A;  3POE A;  4GMP 1;  1O3R A;  1XOY A;  2WRA A;  3EBR A;  1RXG A;  5C71 A;  2VM9 A;  4J1X A;  2JIJ A;  4Y22 B;  1RGS A;  3CL1 A;  4LPL A;  2VUA A;  3VHO A;  4A7K A;  1Y7B A;  4NIH A;  3ILR A;  4CP2 A;  5H9R A;  1TME 2;  2VZP A;  4JKL A;  3OPZ A;  1RHI 3;  5FO7 B;  3S30 A;  3SHR A;  1DGR A;  1M4W A;  2VMC A;  2Q1Z B;  4ITC A;  4IEP A;  4Q27 A;  2XUM A;  4L97 A;  4XAA A;  1RL3 A;  3LKJ A;  5FZ6 A;  4HVQ A;  5IFT A;  3H1W A;  5JSP A;  5FYI A;  3A4U A;  3RZJ A;  4WVW A;  2ZGK A;  1O6U A;  4I09 A;  1GP5 A;  4ISR A;  4WVM A;  5A7W B;  3TB0 A;  1G9F A;  2RDS A;  5F32 A;  1MPX A;  3SEP A;  1ULP A;  4IEO A;  5C8C A;  1X36 A;  2Z2S B;  4N53 C;  1NZC A;  5IVC A;  3TWI A;  3H1M A;  4UBH A;  3IIA A;  4BQX A;  5T5L A;  3ZMN A;  2QKD A;  1F35 A;  1CPM A;  2VTX J;  3HPN A;  4A3Z A;  4F83 A;  4QKB A;  2BEO A;  2QVS B;  3B69 A;  1CZT A;  1SQ4 A;  4GKY A;  1HB2 A;  2WIN B;  2CNA A;  4QB1 A;  3WLU A;  3MLL A;  4TN7 A;  1FPN 3;  4XF4 A;  1NKG A;  2FMD A;  2WA4 A;  3U1X A;  2YBK A;  4W65 A;  3U37 A;  2GND A;  4PQ9 A;  3LPF A;  1T2X A;  1D4M 2;  1SFY A;  2J1E A;  4GB3 1;  1AL2 1;  2VZV A;  2P34 A;  1VBB 3;  4YW5 A;  5JVV A;  1K5J A;  2UUR A;  4QGL A;  1RUJ 1;  4TTG A;  3GYD A;  2DYC A;  2K9Z A;  2NYY A;  4YM2 A;  2RS5 3;  3S6P A;  2MPF A;  2QFE A;  3VDC A;  3ZN6 B;  3MO4 A;  4BXF A;  5FP3 A;  5FCC A;  1LHU A;  2DUR A;  2AZ5 A;  5SV8 A;  1QQP 3;  2JE9 A;  1PGW 1;  2RR1 1;  4NVP A;  4XUQ A;  2W1S A;  4AI9 A;  2QQM A;  3B02 A;  1AJK A;  3OEB A;  4LKS A;  1EUU A;  5BNO C;  3H8X A;  3GDB A;  1JZ6 A;  1GSL A;  1X33 A;  5FOJ B;  1R1A 2;  4CU9 A;  1OI6 A;  4ZU5 A;  5DAX A;  4H3W A;  2I74 A;  5E1R A;  4CCO A;  1SCR A;  1ZZ9 A;  2YGL A;  4E4S A;  1F4A A;  4JV4 A;  4M4P A;  1SDW A;  4KU7 A;  4NPR A;  3ALQ A;  1H6Y A;  4CEY A;  4K9S A;  1GNH A;  1AX0 A;  1I3H A;  1OF4 A;  4WVZ A;  4AI8 A;  4RR3 B;  3V0B A;  3LOB A;  3N9P A;  3MW2 A;  5A7O A;  3VBO C;  3LEK A;  3OUH A;  1XPW A;  5A3N A;  1QXR A;  2ES3 A;  3A23 A;  5LA9 A;  3O1O A;  4CEW B;  2JDP A;  1ZX5 A;  3NAP B;  4O61 A;  3VDD C;  2Y6L A;  1I6X A;  1HB1 A;  3AYD A;  4HKL A;  1PZ7 A;  4FAG A;  1HQL A;  1F15 A;  1ENS A;  3BIW E;  4D0Q A;  5ABJ A;  4IEV A;  4KU8 A;  1CAX A;  4HVR A;  1UMZ A;  3OY8 A;  1M06 G;  1XU2 A;  2Y60 A;  3IMM A;  5FJK A;  1X9T A;  2BTV C;  2YGM A;  4TYS A;  5G05 L;  5FXZ A;  5IT6 A;  2GH2 A;  3FHI B;  4J6G A;  3HBK A;  4YG3 A;  4CVU A;  2D97 A;  4I02 A;  3A7Q A;  2XXZ A;  3C7F A;  5A7P A;  1FAT A;  1CN1 A;  4AVV A;  5CFD C;  4QQP A;  2DF7 A;  2EA7 A;  2W9X A;  4PCR A;  2HWC 2;  2YZ4 A;  3TEY A;  5AFE A;  4JVA A;  3ZYI B;  2ENR A;  1JXN A;  2BOI A;  3BCW A;  1D2Q A;  1J1L A;  3ZN5 A;  2VZ3 A;  4BE3 A;  5JIU A;  4FPL A;  4YG6 A;  3T4V A;  3LWC A;  3V0A A;  1HXS 1;  3AMQ A;  3IBM A;  2VUC A;  2JB8 A;  4K7J A;  5HI0 A;  1ULG A;  1UY0 A;  3ASI A;  5FZ7 A;  4AGG A;  2W92 A;  1WCU A;  3T1M A;  1GNY A;  2YU1 A;  4IGP A;  5LRR A;  4AI1 A;  4AXO A;  2DWR A;  1JZ5 A;  3PDQ A;  2WJS A;  4XEZ A;  4QX0 A;  1BJQ A;  5IK8 A;  1E5I A;  5FUN A;  1US2 A;  3AMP A;  3V56 A;  3UGG A;  5D8A A;  3WHT A;  3WF2 A;  1W8H A;  3AYE A;  1XB9 A;  4IER A;  1AHS A;  1WZX A;  4FQZ A;  1VBE 3;  2Z5W A;  5C9A B;  1OA3 A;  2W5F A;  4AR2 A;  1KJR A;  3KVB A;  2WFF 1;  4BH9 A;  4KGG A;  3KV5 A;  1TG7 A;  2ZGO A;  3L2Y A;  4YW4 A;  3LA7 A;  1BVP 1;  4EN9 B;  2TEP A;  2HWD 1;  2QQJ A;  5F3E A;  2AC1 A;  3HAG A;  1BK0 A;  5C4W C;  4LT5 A;  1W2O A;  2R06 2;  2WZ8 A;  4I01 A;  3ZYH A;  4AQ6 A;  1QOS A;  3WVJ A;  4GH4 C;  2ZHK A;  4LTA A;  4FVV A;  2LTN A;  3BOD A;  4Q0P A;  1JHJ A;  3VZM A;  3VLB B;  2B7Y A;  5FXV A;  3FFQ A;  3NKG A;  5EP9 A;  4O7X A;  5BUV A;  1MQT A;  1JH5 A;  2GDF A;  2X5I C;  4ERO A;  2W3J A;  4LO4 B;  1SBF A;  3ACG A;  1CX4 A;  1CIW A;  1OKO A;  3ZFF A;  1JS9 A;  4LLO A;  1QIQ A;  1VBD 3;  3NNG A;  3WNN A;  1NQD A;  1D4M 1;  1AXZ A;  1COV 2;  3WV6 A;  3VBS C;  3C7H A;  5C6C A;  4XQ4 A;  5DAP A;  3Q8B A;  3B93 A;  3J7M A;  1JBC A;  3J9S A;  4LHN A;  1OC1 A;  1RUE 1;  2ZHL A;  1VRH 1;  3FN9 A;  4QB2 A;  1UYP A;  1YHF A;  3AL5 A;  2Q8E A;  1VP6 A;  4C1W A;  5CBL A;  2NQY A;  2CGN A;  2XL9 A;  4WM8 B;  5BPX A;  1IQD C;  4FPG A;  3WDY A;  1TNR A;  5A3O A;  2ETE A;  1YJL A;  4NWV A;  3NV2 A;  1VBC 2;  4ATF A;  4Q0U A;  1JZ8 A;  5JI7 A;  4IEX A;  1I5P A;  1POV 1;  3WHU A;  5EIY B;  1W6P A;  1VBD 2;  1D4M 3;  1GOG A;  1H0B A;  3RFR A;  4JDO A;  1AXY A;  2Y34 A;  3VDA A;  5TSW A;  4B7E A;  1DQ5 A;  1W2N A;  5L19 A;  5EFU A;  3K3N A;  4B1M A;  1NQJ A;  3AP6 A;  3T4H B;  2Y6K A;  3ZYB A;  2G9F A;  1TQ5 A;  1EV1 1;  2KA3 A;  5ACA 2;  3C7G A;  4LBQ B;  4C0B A;  1DYO A;  1O4Y A;  5FZA A;  3AJZ A;  2WNV B;  4LO7 A;  3VV1 A;  2XR4 A;  2WZR 2;  3PUS A;  4XVH A;  1W0P A;  4Y5S A;  1AR8 1;  4DIN B;  1C8M 3;  3UGF A;  1DHK B;  5A1A A;  4GAZ A;  2AEN A;  3WDT A;  3WOG A;  5J36 A;  3NJZ A;  4PI2 A;  4XC9 A;  2XH6 A;  3J7N A;  4XE9 A;  4UFH A;  5C3Q A;  1DZQ A;  4KGQ A;  4LBM A;  4OHV A;  1S0I A;  5C5T A;  4DOU A;  2P3K A;  2RS3 2;  1UO9 A;  4P9L A;  4XZP A;  3AP9 A;  1NAE A;  4MGI E;  4CDU B;  4QHB A;  1VMJ A;  5FZK A;  4M3C A;  5FLI A;  2XLA A;  4AFD A;  3AMM A;  1AX2 A;  3AKQ A;  2PHU A;  2BFU L;  3R4D B;  4HOO A;  1HX6 A;  1RUC 1;  4AI0 A;  3RVH A;  1RUG 1;  3O1U A;  2DVA A;  3MF6 A;  3SH3 A;  4HSL A;  4IV3 C;  3INA A;  2QCS B;  2VUD A;  4K8F A;  2JX9 A;  1YNA A;  4O65 A;  4R9C A;  3E5Q A;  3O14 A;  5JDB A;  5F37 A;  1V6J A;  1PGL 1;  3K77 A;  4I0A A;  2VMD A;  3I2K A;  1AX1 A;  1S0J A;  2P6H A;  3JB8 A;  1QH7 A;  3ZSM A;  5B4N A;  3USU A;  3LF7 A;  3UES A;  4BQ5 A;  1Q8O A;  3I3D A;  2VXR A;  1YLL A;  4LO6 B;  3UJO A;  1PK6 B;  1RHI 1;  2ZGQ A;  3PUQ A;  1KQR A;  2OZ6 A;  3LFM A;  1O4T A;  1AR6 1;  1H1I A;  4M3C E;  3AKP A;  3N7J A;  1AYM 3;  1WBL A;  3RWK X;  1H8T C;  1ZA4 A;  3WNK A;  3U4X A;  1UIK A;  3K46 A;  4LK6 A;  3U10 A;  3SNM A;  3ZO0 B;  1ZBA 3;  5JWP A;  1U5X A;  5LZ6 A;  2NM1 A;  4QDS A;  4JGZ B;  3NV4 A;  3ROU A;  1VMF A;  4LIV A;  2DVG A;  1W9T A;  4Y26 A;  4AED A;  4IEW A;  1W8U A;  2A75 A;  1RTV A;  4ISQ A;  3S0M A;  3N7K A;  1GQH A;  5I0U A;  3ZKY A;  4YVW C;  1W04 A;  3VHN A;  4C1X A;  3AMN A;  1LHO A;  3ZR6 A;  5FK8 A;  2W1U A;  4HON A;  5FY4 A;  4YGB A;  5F3C A;  5AVA A;  5J3U A;  4NIG A;  3VBO B;  4N7U A;  1RMU 2;  1W6O B;  1JHN A;  1HV0 A;  1W6N A;  5LA1 A;  1W6O A;  4EWA A;  3WQ7 A;  1W3X A;  3N3H A;  5C3S A;  2R07 1;  1H6X A;  2D44 A;  1OQ1 A;  1YFU A;  1MEC 2;  1KS5 A;  1EYB A;  1ALY A;  1VRB A;  4IDZ A;  4Y3O A;  3RYP A;  2BWA A;  2YHJ A;  5K0U C;  2D7F A;  5FPV A;  2Y6J A;  4RYD A;  4JGY B;  4O9E A;  4NRQ A;  3BYW A;  3CQO A;  5C9A A;  3OGR A;  3H3Z A;  5A7Q A;  1PZ9 A;  4PLN A;  2RG4 A;  2G19 A;  2R04 1;  4FOQ A;  3PJY A;  3VBH A;  2YY1 A;  3H9A A;  5IVY A;  1AR9 1;  2DVD A;  2VNO A;  3IPV B;  5CFC B;  4J1W A;  4B8E A;  4CEW C;  3FJS A;  1Q8S A;  4XCB A;  2XB6 C;  1WA4 A;  2X5I A;  2XVK A;  5I93 A;  3WG3 A;  1IPS A;  1QJU 1;  1T6B X;  1S0F A;  2TNF A;  2ZKL A;  3JB4 C;  1KRI A;  1TEI A;  2D5H A;  3IB3 A;  4CDW B;  3DYO A;  4XBN A;  3RDI A;  3SEE A;  3LEG A;  2VMI A;  4N9H A;  4PJY A;  3VD5 A;  1KGY A;  2RDR A;  3RGB A;  4XBL A;  1UYX A;  1S2E A;  5FY8 A;  1H30 A;  3PUA A;  5BNN A;  5H9P A;  4XHB A;  1AL2 2;  2VE1 A;  5H9S A;  4Z92 B;  3THC A;  2DTY A;  4BJ0 A;  4DXZ A;  4RQP A;  3WT3 A;  5BNN C;  1C3H A;  1UYZ A;  3AZY A;  3OBA A;  5DXD A;  2QJV A;  3K75 B;  4K21 A;  4AQS A;  1C57 A;  1ZRE A;  5C5U A;  1PIV 3;  3FMG A;  5JMC A;  2DFB A;  5JI9 A;  4FPO B;  1FYU A;  5GZE A;  2RS3 1;  5FAX A;  3PUH A;  5FPB A;  3WW1 A;  2VOV A;  1RJ8 A;  5FZ4 A;  4CDU C;  4E9K A;  1QJX 1;  2PA7 A;  5HV0 A;  2MEV 2;  3ZYP A;  2PHF A;  3RMY A;  4DRR A;  1OKQ A;  1R1A 1;  3B3Q E;  1YIF A;  4MLO A;  2JB4 A;  3T2P A;  5IAT A;  1GWK A;  5FO9 B;  4YVS A;  4AHY A;  3NAP A;  3UKN A;  4ZS3 A;  1MS0 A;  1UOJ A;  3HN1 A;  4XFA A;  5LY1 A;  2IWG B;  5FZB A;  4EYU A;  1K5M A;  1W8F A;  2D43 A;  2DV9 A;  3PVN A;  1DDL A;  1E5S A;  4MGZ E;  2CDP A;  1JZ7 A;  1PO2 3;  3VL9 A;  1A34 A;  4UI9 L;  4XFC A;  4IUG A;  5DUX A;  1SAC A;  3MYX A;  5JSR A;  3BPZ A;  4UFM A;  4B1L A;  4EN8 B;  1WLT A;  3HIF A;  4LIU A;  4Q0Q A;  1RB8 G;  2QQI A;  4FTE A;  2W1Q A;  4IQP A;  5FOB B;  1ASJ 3;  1ZNP A;  1F9K A;  4W8J A;  3OGV A;  3NRU A;  4GJZ A;  4KNC A;  4ONU A;  5JIA A;  3AMH A;  1RUN A;  2ARE A;  4QMA A;  2WL1 A;  3J7H A;  3Q8E A;  4MAD A;  1B35 B;  4TLF A;  2VJX A;  4ET7 A;  4MYE A;  1UQX A;  2V09 A;  2WQZ C;  3Q8F A;  3ZSE A;  3ZDV A;  3ZXJ A;  5BNP B;  1AR6 2;  1KJL A;  5DDJ 3;  5CNA A;  3VZL A;  2ZGS A;  1APN A;  2QQN A;  1VR3 A;  5IUQ A;  2JG8 A;  2Q8C A;  2ORX A;  4UFJ A;  3LA2 A;  2QUO A;  3PME A;  3PU8 A;  1OOP B;  2B42 B;  5FQ0 B;  1LOB A;  3WQ1 A;  2R07 3;  1CJD A;  1X7N A;  4H2A A;  4M00 A;  3WSO A;  5FMB A;  2ZOE B;  3DPR C;  2MEV 3;  3RJR A;  4LE4 A;  4DEV A;  1PO2 2;  2VOK A;  1K12 A;  1W6P B;  2WUH A;  1P8J A;  2R1D A;  2GAU A;  4Q4V 3;  4NMI A;  1ODN A;  3KS7 A;  3RMX A;  4CDW A;  2A3W A;  4XMI A;  5F2S A;  1I5Z A;  4UWD A;  4CDQ B;  4P08 A;  1WMF A;  4P02 B;  4RS5 C;  5IK4 A;  2NP0 A;  1ODM A;  4BK4 A;  3KCC A;  1PX4 A;  2ET1 A;  3N35 A;  3S5A A;  4OLL A;  3GBF A;  3OD0 A;  3N7M A;  4LR4 A;  4AG4 A;  4HXC A;  4FQ4 A;  1COV 3;  3KWV A;  3WXP A;  2QE3 A;  3H8O A;  4S2G A;  2FD8 A;  3S7E A;  1FOD 3;  1H2M A;  1XC6 A;  1WMX A;  2E9Q A;  2XJR A;  4LE3 A;  4XF1 A;  2DUO A;  3ZFF B;  1ND2 A;  1OXC A;  2UWC A;  1JYI A;  4UFI A;  2CYF A;  4KG0 A;  2XJQ A;  1NE4 A;  1OA4 A;  1QOT A;  4Q0V A;  5KWR A;  4RA0 A;  1ST8 A;  4WZF A;  5DUW A;  4QGN A;  5ANN A;  2PHX A;  1WW4 A;  1WBF A;  1UYY A;  5FP8 A;  1EP0 A;  5CU1 A;  2YPD A;  2V5D A;  3AYC A;  1OLM A;  1VBE 2;  3J8F 3;  3BPS A;  1RUE 3;  1VLN A;  1W6N B;  1Z0H A;  2FDJ A;  2J1A A;  2UU8 A;  2W1W A;  2WZR 1;  2DUP A;  1W9W A;  1W6Q B;  2Y0O A;  5GLU A;  1V6K A;  5FYY A;  3OOX A;  4HKW A;  2B39 A;  1AZD A;  4DNY A;  5KC5 A;  1KDM A;  1HJF A;  1LOA A;  1YXW A;  3ZLI A;  4HT1 T;  4E8C A;  1RC6 A;  5GKA C;  4QPG C;  3U11 A;  3H7Y A;  4IV3 B;  3M3C A;  4NAM A;  1JOJ A;  1NZI A;  1W8T A;  3WW4 A;  3VBF C;  3IAP A;  2JWP A;  4QPG A;  3D5O A;  4GMP 0;  1OD5 A;  1Q8Q A;  5DAQ A;  3PLQ A;  2D6M A;  3NNL A;  4AGR A;  4CSW A;  1YQ6 A;  2WN3 A;  3KZ4 C;  4WM7 C;  4IES A;  4GUL A;  5C8C C;  4MGT A;  5DZE A;  2XJS A;  1LJ7 A;  1ULF A;  3K51 A;  5E16 A;  3N9L A;  4MV2 A;  1TVG A;  2H0V A;  1X82 A;  3G7D A;  3LIG A;  4N9I A;  2WT2 A;  1LHN A;  3VBU B;  2J22 A;  1W2A X;  3IAQ A;  3O7O A;  1Q43 A;  1UY2 A;  4QKN A;  4W50 A;  3H8R A;  1ZZC A;  2KR2 A;  1JOD A;  5FMD A;  1G9B A;  4Y1V A;  3LCP A;  4XAE A;  2ZPX A;  5FK7 A;  4BLI A;  4AHX A;  3E5U A;  1FMD 3;  1H1M A;  1SPP B;  4RHV 1;  2VU9 A;  2BJS A;  5FYC A;  3ZSL A;  1RUD 3;  2HBU A;  2EF6 A;  1G9D A;  3AP4 A;  1Y43 B;  3TEW A;  3KT4 A;  4F7Z A;  3RZM A;  2HYK A;  4XUN A;  3KT1 A;  3Q8C A;  4CCD A;  1YFX A;  3OTF A;  2L9L A;  3LSD A;  2UWA A;  2YUE A;  3VZJ A;  3ZFG B;  1R09 2;  1XQN A;  4K8R B;  4ASL A;  1IS5 A;  1PK6 C;  4AAP A;  3CF6 E;  4LUK A;  4NID A;  3OPT A;  1JW6 A;  2Q30 A;  1KS4 A;  1OMI A;  3HMY A;  1N1T A;  1C1F A;  2W91 A;  2ZGM A;  1DP0 A;  1H9P A;  4A44 A;  1Q8V A;  2ILM A;  1PMI A;  1FV3 A;  4M3C B;  1XYO A;  1LTE A;  4GWI A;  2LRO A;  4Y1U A;  3U0Z A;  5LA0 A;  1JYN A;  4QHO A;  4AGV A;  4NPL A;  1V70 A;  1GBG A;  2Q4S A;  1D4V B;  3UV9 A;  4AHZ A;  2RV9 A;  2ZMK A;  3MPB A;  4DQA A;  3VKN A;  3NW4 A;  2VVD A;  4LO5 B;  4OUS A;  2IFW A;  4AZZ A;  4YM1 A;  2VEC A;  3AJY A;  3JZV A;  3KCY A;  4OHY A;  3CIH A;  3FE5 A;  2EXJ A;  2VME A;  2GH8 A;  5LB6 A;  2ZMN A;  4YFZ A;  2LAL A;  1PM7 A;  4I2O A;  1KD7 A;  4P00 B;  3VD7 A;  4FFH A;  5H9Q A;  5FLJ A;  3NV1 A;  2VCC A;  2WS9 3;  1GZ9 A;  5FZO A;  3NJY A;  2DU1 A;  1JN2 P;  1ZBE 2;  2VVE A;  4QXC A;  5FY5 A;  4BM8 A;  4ZZ8 A;  4D69 A;  1W05 A;  2R6Q A;  3B01 A;  4LBQ A;  2W47 A;  4ATE A;  2A1X A;  1OPO A;  1JUI A;  1SMV A;  4G9S B;  2VUJ A;  4R4X A;  1R09 1;  4LBL A;  1R08 3;  1SBD A;  4WBB A;  2XLG A;  5FWJ A;  1H2L A;  2QNK A;  3GJB A;  2BGP A;  4IEQ A;  5DQ0 A;  4QX1 A;  4MGK E;  5HBA A;  4UW3 A;  3K3O A;  2G4I A;  1GOF A;  4E27 A;  3DUI A;  1CAW A;  5ANQ A;  5IK5 A;  2XGX A;  1O3T A;  3TN9 3;  4LKD A;  5L9V A;  2JDZ A;  1OA2 A;  2JG9 C;  2YMZ A;  5KXD A;  3DKQ A;  2R04 2;  3K4Z A;  4QU2 A;  4HL0 A;  1C8N A;  4XUO A;  5JZG A;  2ORZ A;  3DV8 A;  4UT5 A;  4WM8 A;  5HCF A;  5JUV A;  3ZFE C;  1ZRD A;  4XDQ A;  5IFP A;  1GNZ A;  3KLS A;  5I8T A;  1H9W A;  5JXJ A;  2UYB A;  4UF0 B;  1UKG A;  4YVW A;  5FZD A;  2XDV A;  3BI3 A;  1GZW A;  3I3Q A;  5FY9 A;  4XMA A;  3MIC A;  5CG9 A;  3A21 A;  3UK9 A;  1R08 1;  4BYY A;  4XFG A;  1QJU 2;  1QNW A;  1U5Z A;  3BTZ A;  2G9Z A;  1LKN A;  4HLT A;  4PIX A;  4D6S A;  2FHR A;  1Z7S 2;  5JXH A;  1G6N A;  2XBO 1;  5IW0 A;  4CDW C;  4N53 A;  4BQW A;  5D21 A;  3LFI A;  4IGO A;  1ND2 B;  3III A;  4Q4X 3;  4QHZ A;  2NZ9 A;  2FDG A;  1XND A;  2ZX4 A;  1YUD A;  4N53 B;  3WNO A;  4DY3 A;  1MQT B;  3EQE A;  1LEM A;  1RUH 3;  2YC2 A;  3P3N A;  5FKB A;  1W0N A;  2BV4 A;  2WKK A;  2XJP A;  3O0X A;  2DCK A;  2DBI A;  1PO1 1;  3VD3 A;  5ERL A;  1LOG A;  4XFI A;  2Y6F A;  5LBB A;  1QJU 3;  1F31 A;  3ABZ A;  1LU2 A;  5A7S A;  4C90 A;  4FI9 A;  2JXA A;  4IW3 A;  3CKH A;  2SBA A;  4KBB A;  4GIQ A;  1UZZ A;  2EXI A;  3P6B A;  4YFW A;  2CY6 A;  4HVO A;  1VBD 1;  5GLZ A;  4CP9 B;  1Z7S 3;  4NRP A;  5FJH A;  4R9A A;  2R07 2;  4NRO A;  2ATF A;  1MEC 1;  1J1T A;  1J3R A;  1QQP 2;  3ES1 A;  5DMY A;  4CP0 A;  1BMV 2;  1NG0 A;  3ZX7 A;  4JKM A;  4MXV A;  3AXE A;  4IV1 B;  5FYH A;  2BZD A;  5A33 B;  5FDB A;  4RHV 2;  2WT1 A;  2ZAB A;  1JMU B;  3KV9 A;  4M0H A;  4FPF A;  2VZQ A;  1UOB A;  1NXM A;  1QJE A;  4R9B A;  3CJX A;  5FYM A;  5K8S A;  1NXD 1;  5C4W B;  3VBR B;  1URX A;  5HXV A;  4RFT 0;  1C28 A;  1B35 A;  2YFU A;  2JDY A;  2P3Y A;  2VQA A;  3LA3 A;  3B9C A;  2OII A;  4CU8 A;  4FFF A;  4OMC A;  4V2V A;  3K4D A;  1PNG A;  1B35 C;  3LB9 A;  3N36 A;  3TEZ A;  1CD3 G;  4Q4V 1;  1QJY 2;  4NII A;  4OI2 A;  3VKL A;  4DXR A;  4JKK A;  3TBD A;  2EVX A;  5C8W A;  5I0D A;  1ND3 A;  4LHL A;  4D7T A;  3CDZ B;  5DUU A;  2BU9 A;  3VDD A;  1MZ5 A;  5LAS A;  1NE6 A;  1GFF 2;  2A3Y A;  3VBS A;  4QXH A;  3KMH A;  3DPR B;  1IHM A;  5BNO B;  2FCV A;  4XIO A;  1TMF 1;  2VCA A;  2JJ6 A;  4CDX A;  3GM8 A;  2OVU A;  1HRV 3;  4H14 A;  3RSJ A;  2XWB B;  5KXB A;  2RMU 3;  1DFQ A;  3PJQ A;  1RUE 2;  1UX7 A;  4DRV A;  3GZA A;  3FL7 A;  5A70 A;  2RS5 1;  1QY4 A;  3M3I A;  2LM3 A;  1ZRF A;  4UBG A;  3MHZ A;  5JXG A;  3ZFG A;  4EN6 B;  4D8M A;  1OH4 A;  4D7Y A;  2VD7 A;  4BHP A;  3D6E A;  4D7S A;  1DQ1 A;  3TOJ A;  3WW2 A;  1OFN A;  2D93 A;  4E8D A;  3H50 A;  2R30 A;  4TXW A;  4RQP B;  4LOS A;  4FPJ A;  3V0B B;  3AYA A;  1LR5 A;  2OS2 A;  3KCX A;  5LA2 A;  4ES9 A;  1NA1 C;  4JC1 A;  2WZP P;  1UD1 A;  4FT8 A;  1EAH 1;  4BU2 A;  1HKD A;  3JBG 1;  2DCT A;  2IXJ A;  1HRV 2;  4X6R B;  2D6O X;  4ES8 A;  2A7A A;  4QAW A;  1FOD 2;  2CSG A;  2D6N A;  1AUY A;  2O0O A;  3MW4 A;  2A6W A;  1F5F A;  1UZW A;  5FPL A;  2D5F A;  3BKZ A;  4YM0 A;  5C4W A;  2PAK A;  4HKO A;  5G04 L;  1Y9G A;  1FI2 A;  3VKM A;  2TUN A;  2ZKN A;  3W21 A;  1G8W A;  4XPV A;  3KHC A;  1RYY A;  1YJK A;  4FP3 A;  4I3G A;  3NNM A;  2X29 A;  4P5Y A;  5F9T A;  1OLQ A;  5C9A C;  3LQC A;  1HXS 2;  3NMB A;  2VCB A;  3PHM A;  4QPG B;  1H1A A;  2C26 A;  1BCX A;  1D7P M;  1XU1 A;  3RYK A;  1IG0 A;  4NPM A;  1SG3 A;  2QTW B;  4K1Z A;  4PT6 A;  5I0S A;  1Y4W A;  2PTM A;  5A3P A;  1UOF A;  3CJI C;  5HV4 A;  4RD7 A;  4YW6 A;  2LUW A;  1UL9 A;  3DYM A;  4LOT A;  2W94 A;  4QM8 A;  4FOW A;  3FLT A;  4IET A;  4CRQ A;  4HG6 B;  1G9A A;  4LHK A;  3UKT A;  5FFO C;  5F5I A;  3IZO A;  1LAJ A;  5LCW L;  3AKR A;  4IGQ A;  4A6O A;  3VBO A;  1QF3 A;  2C1F A;  2X10 A;  3ACI A;  1DIW A;  3ECQ A;  3MIG A;  3O1R A;  4Y4R A;  2E7T A;  3IN9 A;  3HR9 A;  3HNM A;  2ARA A;  1GP6 A;  2ZEW A;  3KVA A;  1W6M B;  4A2U A;  4D3W A;  5A3T A;  5F1R A;  1E5R A;  4AWD A;  2PLV 1;  2HWD 2;  2X09 A;  3C7O A;  1Z78 A;  3OPW A;  1BVV A;  2R49 A;  4S2H A;  1QH6 A;  4Y1X A;  1JYW A;  4AED B;  2MNG A;  2VW1 A;  4GWM A;  4Q4W 1;  4QT6 A;  3KGZ A;  1LUL A;  1NOV A;  1A3K A;  3BU7 A;  2RJK A;  1AJO A;  4NHL A;  5EWS A;  5F3G A;  3LPG A;  2UWB A;  5GM0 A;  3B7M A;  4E2Q A;  1H8T B;  4EWD A;  2MHF A;  1YI9 A;  2IVJ A;  1DBN A;  1VBA 3;  3HBZ A;  3IKW A;  3M2M A;  3OJB A;  1QU0 A;  3ZFG C;  1GZW B;  1KFX L;  4LIT A;  4UF0 A;  2RMU 1;  5FZ1 A;  2A6V A; 
#chains in the Genus database with same CATH homology
 5IYY A;  2RVA A;  3WF4 A;  2W1U A;  3WNM A;  2Y64 A;  1OF3 A;  3DEC A;  2WYS A;  3I2F A;  2VC9 A;  2OKX A;  2ZEZ A;  5LA1 A;  3MUY 1;  3ACH A;  1CIY A;  1H6X A;  3WEZ A;  1PMJ X;  2VTF A;  4XUR A;  2Y6J A;  4RYD A;  5EJ1 B;  3CQO A;  3OGR A;  4KI5 M;  1SDD B;  2YB7 A;  1ULO A;  2X05 A;  3C8X A;  4MGQ A;  2HYX A;  4CUA A;  3FHA A;  2VQU A;  3I3B A;  1GMM A;  3VDB A;  3WF0 A;  4JX0 A;  4JHZ A;  4QDR A;  3CZU A;  3MUZ 1;  3IB3 A;  4W4Z A;  3DYO A;  3F2Z A;  3SEE A;  3LEG A;  5CYY A;  1DLC A;  4LHS A;  3SKJ E;  3VD5 A;  1KGY A;  1UYX A;  3JXS A;  2B4K A;  2VZO A;  4BDV B;  3THC A;  4BJ0 A;  2WAB A;  1UYZ A;  3OBA A;  3K75 B;  4DEQ A;  1PX3 A;  3MV0 1;  2J1S A;  3PUH A;  3GGL A;  1JYX A;  3IDA A;  2VZU A;  2J1U A;  1HN1 A;  3T2P A;  1W8O A;  3UNP A;  3I2H A;  2C9K A;  3SKV A;  1L7Q A;  3VD9 A;  1SHW B;  1CZV A;  2YFZ A;  2E32 A;  2CDO A;  3HEI A;  2V4V A;  2CDP A;  2VZS A;  3NQH A;  1JZ7 A;  4DXS A;  2XON A;  3MBW A;  4UI9 L;  4IUG A;  3NJX A;  1OD3 A;  2QQI A;  2QQO A;  3AC0 A;  2W1Q A;  2WO3 A;  4W8J A;  2LW8 A;  1GOH A;  3OGV A;  3NRU A;  1J83 A;  4QDQ A;  4A45 A;  3T0D A;  4A4A A;  2J7M A;  3J7H A;  4MAD A;  2VJX A;  2WZE A;  4ET7 A;  4MGS A;  3FHQ A;  4PQQ A;  4L0P A;  4DUX A;  2QQN A;  2Y6H A;  2ORX A;  4ZY9 A;  2E31 A;  1PMH X;  5IHR A;  4UOJ A;  4UAP A;  3WSO A;  4DEV A;  4CUC A;  5C70 A;  3I2J A;  2VO5 A;  1K12 A;  2ZXQ A;  2EIC A;  2WUH A;  1P8J A;  1XNA A;  2Y6G A;  1O8P A;  3GXU A;  3ACF A;  5IJR A;  4P08 A;  4P02 B;  2DDU A;  2JDA A;  2WQ8 A;  4BK4 A;  1UMH A;  1WCQ A;  1PX4 A;  2WAO A;  2ZEX A;  4AG4 A;  2WAA A;  4QX2 A;  2VOT A;  1UMI A;  5HXM A;  1XC6 A;  2W95 A;  2W46 A;  4QPW A;  2LS6 A;  2W87 A;  1F4H A;  1KEX A;  4DUW A;  1UYY A;  4GWJ A;  1UY4 A;  2V5D A;  2XHN A;  2J1A A;  4CU6 A;  1W8N A;  2W1W A;  4OZO A;  4BXS V;  1W9W A;  5C71 A;  2VM9 A;  4BK5 A;  2Z4F A;  4E8C A;  2BGO A;  4LPL A;  3PUI A;  3HJR A;  3OG2 A;  3IAP A;  1JI6 A;  2VZP A;  2WN3 A;  4JKL A;  2Y8K A;  4AAX A;  2VMC A;  5IFT A;  1TVG A;  3SEP A;  1MPX A;  1JZ4 A;  1ULP A;  2J22 A;  3T0A A;  3IAQ A;  1UY2 A;  4W50 A;  2JD9 A;  3HPN A;  2VQT A;  4A3Z A;  3CMG A;  1CZT A;  5C7G A;  4QB1 A;  3I2I A;  4XUN A;  1NKG A;  2L9L A;  3U37 A;  4ARY A;  4YPJ A;  1GUI A;  3LPF A;  2VR4 A;  1T2X A;  5F7U A;  2J1E A;  1CX1 A;  2VZV A;  4TTG A;  2W91 A;  3P1I A;  1UWW A;  3VDC A;  1DP0 A;  4A44 A;  1XNT A;  4A41 A;  3MO4 A;  5JMO A;  4GWI A;  4XUQ A;  5JR2 A;  5LA0 A;  2W1S A;  1JYN A;  2QQM A;  3OEB A;  4LKS A;  1EUU A;  3GDB A;  5HPO A;  1JZ6 A;  3I2G A;  2RV9 A;  1JU3 A;  1UXX X;  4CU9 A;  2B9V A;  2BBA A;  1L7R A;  1F4A A;  4M4P A;  3CIH A;  4KWU A;  2ID4 A;  1H6Y A;  1YQ2 A;  2VME A;  1OF4 A;  2VZ1 A;  4P00 B;  3VD7 A;  2QQK A;  2QQL A;  2VCC A;  1NX9 A;  5JXI A;  3LEK A;  1XPW A;  1O8S A;  2JKX A;  3T2O A;  5J1X A;  2EIE A;  4ZZ8 A;  3A23 A;  2W47 A;  2WDB A;  3ETP A;  1EUT A;  2Y6L A;  2BGP A;  3WNL A;  5DQ0 A;  4QX1 A;  4D0Q A;  3BGA A;  1NUK A;  1GOF A;  5G05 L;  3K4Z A;  4CVU A;  4XUO A;  2ORZ A;  2ZEY A;  3T2Q A;  3A7Q A;  5JUV A;  2VZT A;  3C7F A;  5IFP A;  5JXJ A;  1W99 A;  2W9X A;  3A21 A;  1UXZ A;  4DUV A;  2VZ3 A;  4PF1 A;  2JE8 A;  5JXH A;  1K45 A;  4XZU G;  5CZK A;  4XUT A;  3WNP A;  2R7E B;  3III A;  2PQS A;  4Z2A A;  1UY0 A;  3WF3 A;  3WNO A;  2W92 A;  2C4X A;  3T08 A;  1GNY A;  2YC2 A;  1W0N A;  1JZ5 A;  4QX0 A;  2DCK A;  1GQP A;  1US2 A;  3VD4 A;  1K42 A;  3T09 A;  3VD3 A;  2VMF A;  3WF2 A;  3WF1 A;  3ABZ A;  2W5F A;  4FI9 A;  3CKH A;  2WO1 A;  1TG7 A;  3P6B A;  1GU3 A;  1JU4 A;  2E33 A;  4MOA A;  3CZJ A;  3WQB A;  3OB8 A;  1UZ0 A;  2QQJ A;  4LQR A;  5DMY A;  2WZ8 A;  3W5M A;  4JKM A;  3K4A A;  4CU7 A;  3HNY M;  2BZD A;  5EJZ B;  1JHJ A;  3I97 A;  4GZ9 A;  2VZQ A;  2V72 A;  3MV1 1;  2W3J A;  3ACG A;  2YC4 A;  4RN5 A;  2YFU A;  5FUI A;  3NNG A;  3WNN A;  4CU8 A;  4OMC A;  1US3 A;  3K4D A;  2J1V A;  3HN3 A;  2KD7 A;  3C7H A;  4DXR A;  3EB7 A;  4JKK A;  2EID A;  4ARX A;  5I0D A;  3CDZ B;  3FN9 A;  4QB2 A;  5DN2 A;  1IQD C;  2EIB A;  3OGS A;  4ZZ5 A;  2XQX A;  2VCA A;  1OT5 A;  3GM8 A;  3HOB A;  1JZ8 A;  1R64 A;  1I5P A;  3T0B A;  1UX7 A;  5EIY B;  1GOG A;  3FL7 A;  3VDA A;  2J1R A;  5JXG A;  2Y6K A;  4D8M A;  1OH4 A;  3C7G A;  1DYO A;  4QB6 A;  4QX3 A;  4E8D A;  5B4X A;  4TXW A;  4XVH A;  1JZ2 A;  5LA2 A;  5A1A A;  1O59 A;  1W9S A;  2RJ2 A;  2XOM A;  3THD A;  4QAW A;  1UY1 A;  2YG0 A;  2VZR A;  3A22 A;  3I3E A;  5G04 L;  3UET A;  4OYU A;  1NAE A;  4A42 A;  1JZ3 A;  4XUP A;  1RYY A;  4ZXE A;  3LE0 A;  2J1T A;  4P5Y A;  4CUB A;  3LQC A;  2VCB A;  3OEA A;  2C26 A;  4OUE A;  1D7P M;  2BER A;  4MO3 M;  2WBK A;  1SG3 A;  4PT6 A;  3BN6 A;  2VL4 A;  3HNB M;  2E26 A;  3EYP A;  3K77 A;  3NJV A;  2QBX A;  3E1F 1;  2VMD A;  3I2K A;  3DYM A;  2W94 A;  1LNS A;  2DCJ A;  2WO2 A;  3UES A;  5B4N A;  3C7E A;  3I3D A;  4HG6 B;  3ZM8 A;  5LCW L;  4A6O A;  2X10 A;  3ACI A;  4KMQ A;  3ECQ A;  3DYP A;  1BHG A;  1UY3 A;  3D3A A;  3HNM A;  2ZEW A;  1CZS A;  4M4R A;  3WNK A;  3W5N A;  2X09 A;  3C7O A;  3K46 A;  1JYW A;  4QDS A;  2WN2 A;  1J84 A;  1K3I A;  4OMD A;  3LEI A;  4DXT A;  3LPG A;  2HLE A;  1W9T A;  1WKY A;  5DPN A;  1JYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...