1W8FA

Pseudomonas aeruginosa lectin ii (pa-iil)complexed with lacto-n-neo- fucopentaose v(lnpfv)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Interaction between Human Milk Oligosaccharides and the Bacterial Lectin Pa-Iil of Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
molecule keywords PSEUDOMONAS AERUGINOSA LECTIN II
total genus 23
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 1w8fA00
2XR4A 2JDUA 2JDHA 2WR9A 5A6QA 5A6XA 5A6YA 4AOCA 1W8FA 2BOJA 5HCHA 1W8HA 2JDKA 1GZTA 2VNVA 2JDNA 1OURA 5D2AA 1OVPA 2BV4A 2CHHA 2JDYA 2JDMA 1OXCA 4CE8A 2VUDA 1OUXA 5A70A 2JDPA 3ZDVA 5A3OA 2BP6A 3DCQA 1OUSA 2VUCA 1OVSA 2WRAA 1UQXA 2BOIA 1UZVA 5A6ZA 4UT5A
chains in the Genus database with same CATH superfamily
3MI8A 1W2OA 1HRV3 4GJZA 1FMD3 4DINB 5ACA1 1CAUA 3DL3A 2GH2A 1UD1A 1DLCA 1DYPA 1AJKA 4OUEA 4YW3A 2WFF2 2R063 1WCDJ 1NCQC 2R062 1OBNA 2GH8A 4CUCA 2X8KA 4LBKA 4XBQA 2VNVA 1DG6A 1SLCA 3VZNA 4MXWB 3ZXGA 1SPPB 3NV4A 4A7ZA 1ZRFA 3BALA 2C5DA 3PTYA 3VGIA 2QQVA 4YVWA 2WLPA 3VL9A 2ZGNA 4YARA 5FR3A 4FPCA 2CAUA 3ATGA 3M3IA 5JMOA 3N35A 4PBOA 2ZPXA 5A7QA 1JXNA 5JOYA 3T09A 1XYPA 4JAAA 3RZGA 1W28A 1MVEA 1PNFA 1NT0A 3CL1A 1UF2C 3M8LA 4I09A 4IV1C 1OOPA 4XUNA 3ZFEC 5FK8A 4A42A 2OUHA 4AEMA 5FYZA 2AENA 5C9AA 3Q8EA 4LO6B 2JENA 2ORXA 1S0DA 3T2PA 2W1SA 3W5NA 2D98A 1S0IA 1VBB1 2RS33 4K40A 4EE2A 1CAWB 3A0NA 4Q8KA 4S2DA 5FXZA 5E8AA 2ZKLA 1H8TB 3N9LA 1HDKA 1W8WA 4XJWA 2DUPA 4Q0QA 4DPNA 1GANA 4BM8A 2XONA 5EPAA 3T0BA 2Q0AA 3LA3A 3M1HA 3TOJA 5FZAA 5BY5A 5J36A 2A75A 2WAOA 2V72A 2ETEA 3ECQA 1X82A 4IEXA 5EJ3A 1D2SA 3FL7A 1LU1A 2P2KA 2R042 4FI9A 5FKBA 3UGHA 2BYVE 3RNSA 2EF6A 4UF0B 4Q5OA 3SKJE 1RUG1 2D40A 4NMIA 4AGRA 1W8UA 3URFA 4D69A 1V6LA 3FN9A 3ZXAC 2WWUA 5F5CA 3GCWA 1Y7BA 3MEPA 3SCFA 2YFUA 1O8SA 4Q1PA 1V70A 1W39A 1XE0A 3HIFA 3ZFFA 4DQAA 1GNHA 5F32A 4OZXA 3H3LA 3OB8A 3LF7A 4RD7A 4DOUA 3NNGA 4CEWB 5FLHA 1TG7A 4CE8A 1EAH3 2A5ZA 3D5OA 2YYOA 1PO11 3M3OA 3OPZA 3IT8A 1W2UA 2HWF2 4QQPA 1W9FA 5ANNA 4FTEA 1UYXA 4AI9A 1O3QA 4W6YA 5GKAC 1OOPB 3OGJA 4HL0A 1DZRA 2PAEA 2A7AA 3AP4A 1VBB3 2RS31 4EN0A 4YW2A 5FO8B 1YQ5A 3JD72 4FPKA 5T52A 4MHRA 1XNKA 1SEFA 5C70A 3NSTA 2PQQA 4N53A 5DXDA 4RS5C 1Y9MA 4Q4W3 4AVBA 4CRQA 2DBIA 4MXVA 1VB4A 5L19A 1ULGA 4DUWA 2VTXA 4AFDA 1XYOA 4YVWB 1HB4A 3LEKA 2XLAA 1Z0HA 1DIWA 1H1IA 3HBKA 4IEVA 1RUG3 2ZABA 3B01A 3SISA 3HNBM 4BPZA 1GP6A 4YG0A 1RUD1 5FZMA 4CU6A 2QQMA 3WT3A 5BNOC 5KHHA 1ZZCA 5D1IA 3RI8A 4MSVA 2BJSA 1T6BX 2RV9A 3NAPA 4AI2A 1GQPA 1W6OA 3NO8A 1CAUB 4B4QA 5BNPA 5C3OA 3VDBA 2O8QA 2VG9A 5L7OB 3LE0A 1WLCA 2WFF1 3I8TA 5FMOL 1FI2A 3E5QA 2CDOA 1XNDA 3AMQA 1PO13 1VBC3 2DV9A 4M0NA 1YJLA 2OS2A 3I2FA 3LZZA 3WW4A 5I0RA 5A70A 3W5MA 4F3JA 3BUCA 1VBD3 1RINA 1KQRA 4A41A 1RUNA 4LKEA 3T0AA 2Z42A 1DGRA 2E6VA 4NWWA 5GLZA 5FTTC 1BK1A 4BQ1A 5A3PA 3SLIA 2XKPA 1UX6A 1YFWA 2P3KA 4UT5A 5FZDA 4HT1T 3WDXA 1DZQA 2HEYF 3SCHA 3ZR6A 4RR3B 3KT1A 4KNCA 5G04L 2NYYA 4A4AA 3RZMA 2Y6GA 2CGPA 4QAWA 3L9JT 3RZHA 2HWE3 2Y6JA 2W46A 2SBAA 2RJKA 1HN0A 2VOWA 4EZ4A 2PHDA 5J48A 3OUHA 2VPVA 3MUY1 1YLLA 1ONAA 3H3ZA 4OHVA 3FZ3A 1UNBA 3HQUA 5A7PA 2E7QA 1BKZA 1NOVA 1YXWA 2A6WA 3RG0A 4BZ4A 1IPKA 4XTPA 3LPGA 2BNOA 5GZEA 1WUVA 3BOWA 3JB4C 4EZHA 1PK6A 1ENSA 4WZCA 3WQ0A 3B5LB 5FZLA 2C4XA 1CONA 1RUD3 1X8EA 4HVQA 4EQVA 3CQOA 5FY8A 3A22A 4LHSA 4FXGB 3RYKA 1D0HA 4IERA 3I2HA 1SACA 2RS32 4AEDB 5DZEA 2Y6FA 2VMGA 2WFF3 2C6SA 1AYN3 5FPAA 2RDRA 3NVCA 1CIWA 1VBC1 5ABJA 4ZKTB 3OYWA 4M3CB 4BLIA 1R091 2HBTA 1QJU2 3POJA 2N7GA 3VZKA 2BV4A 2W95A 3OD0A 1PZ9A 4HG6B 2IXIA 2GC2A 5DABA 3EO6A 2D97A 2AYHA 3OG2A 5CB7A 2J1UA 5CG8A 1TMF3 2CWMA 4IV1A 3ZFEA 1H4HA 3IDAA 4RQPC 2VZ3A 5A32B 1X33A 2BUKA 4IDZA 5FOJB 3ZPOA 1W6NA 1W6PA 4X8PA 5CU1A 4QDSA 1RJ8A 4AAXA 2JDHA 1RUJ2 1XB9A 5E16A 4RQPA 3FE5A 4A7KA 1G9FA 2PLV1 1CAXB 2WNVA 5H9RA 5KXBA 1W8TA 2X29A 4BK4A 3WV6A 2KM2A 2DDUA 5GLVA 4DO0A 4W6XA 1WMFA 3FLTA 4LBQA 4L99A 1MQTC 2QQNA 2RM22 3ZSLA 4AI8A 5F3CA 1EUUA 3VV1A 2ZGTA 3WF4A 1K5MA 1MZEA 4EN8B 5FUNA 3EJKA 3S6PA 1AR81 1OD3A 3K77A 2BVVA 4KMQA 3D4KA 3J7LA 2D6LX 3JUUA 4PIYA 5IVJA 1CX1A 1DBNA 1Z7S3 3KD4A 3MPPG 2ZX0A 2D5HA 3NJVA 4B3NA 3VHPA 4XBNA 4L2NA 3AZWA 1V6OA 2R043 1N1VA 1OSGA 4RFT0 4E2SA 3UETA 3LDRA 4BE3A 2TBVA 2BVBA 3KGZA 2VCBA 4OHWA 2UY9A 4AOCA 4YZ3A 1ND3B 2BNMA 2BRTA 2Q1MA 5JXHA 3S30A 2Q8DA 1O5UA 1Q8VA 4KI5M 3T30A 1GZWA 4UOJA 1O3SA 5I91A 4N9HA 2QQOA 4XQ4A 2EVXA 2RJLA 5LZ6A 4ZPIA 4ZU5A 2D3SA 2IUWA 2P34A 3AK0A 4X6QB 1SLIA 3VKLA 4MV2A 1EAH2 4WM7A 1XE8A 3POIA 5FUIA 1POV0 5TSWA 3TNQA 3RGBA 4MGIE 3IIAA 1QJX3 1UMHA 2H0VA 1W05A 4G9SB 4YWAA 4XC9A 3GM8A 4EN7B 2ZJCA 3ILFA 5F5AA 2PLV3 2J1TA 4PDWC 1JZ2A 2RDQA 3GJAA 3U4XA 3ZYGA 1YC61 3SITA 3W20A 1K42A 3SCGA 1STMA 1RUH3 4SLIA 3BN6A 1R092 3CJIB 5FO7B 2ZXQA 1RJ7A 5EYYA 5LBEA 5FWEA 1SFNA 4MHUA 2JICA 1H0BA 4QWNA 2RS12 1MS9A 2DFCA 3AKQA 3ZDVA 5C71A 1XXNA 3H50A 1ZZ8A 2RR12 1UKGA 1ZA4A 4TLGA 1MS3A 2I07B 2QVSB 3ES1A 4JGZC 4LIUA 4UW3A 4LTAA 1T6GC 1YFUA 2J1VA 4LKDA 5BXXA 5FZIA 5T5PA 2EIGA 1UXXX 3VBFC 1EPWA 4RS5A 5A32A 2QZ2A 3OUIA 4XUOA 5JR2A 4HONA 1MZ5A 1QXPA 4XFGA 2PHLA 3S57A 1JW6A 3KF3A 2JDKA 1VRH3 1LOCA 4FFIA 4LBLA 3MLKA 3U11A 2D7FA 1A34A 1C4RA 4WVMB 2Y8KA 5JXIA 4Q4Y1 2CYFA 4Y3OA 1JZ6A 1GQGA 3E5UA 2YXSA 5EZWA 1DDLA 1JHNA 4Y5SA 5FP7A 4CCKA 4W8JA 5D8AA 2PXJA 1DQ0A 2OQ7A 4OMCA 4M3CF 4HMZA 4XUTA 2ZBJA 2ADDA 3WZ1A 3ZM8A 5IHRA 1PGW2 2BFUL 2Y38A 4QKDA 1LNSA 2W1UA 4E8DA 3HVDA 2FDGA 5CFDA 4CXYA 2C9AA 2CNAA 1UMZA 2JG9A 4YM1A 4WM7C 1PHMA 4LORA 1FPN2 3WG4A 4K1ZA 4Q4V3 4IV3A 4XF0A 4CCMA 5LATA 4R52A 5LBBA 1UU5A 4ZS3A 5A1FA 4B1LA 4D8MA 5F37A 2D44A 1TNRA 2ZHKA 3F95A 1PVXA 2ZTNA 3UYJA 5BNNC 3H0OA 2W91A 1ACCA 1RUG2 3PMEA 4URTA 4XQWA 1MS1A 1CIYA 1S1AA 2VNOA 3K4DA 3G7DA 3VBOB 3IB3A 3AM2A 1OXCA 1EUTA 2JG8A 3FHQA 3H42B 4B4PA 2AH2A 4GZ9A 2GP3A 3N9OA 4QX0A 5FYVA 4YM2A 1AR82 4QPIB 4CDXA 1JZ8A 1CR7A 1XSRA 1Y43B 4NWVA 5DUWA 2VOVA 2GAUA 4IGPA 1BQPA 4IW3A 2AZ5A 4QU2A 2OA2A 2RMU3 4NE9A 4XZUG 3UL2A 4QX1A 3WW1A 4CZSA 4WBBA 1ZZ7A 1N3OA 1CPMA 2NMNA 1VLNA 2J42A 3TN92 2WS93 5IVFA 2XH6A 1LHWA 2YBSA 3LOIA 3SHRA 3NKGA 3I7DA 3JBG2 4PF1A 3FHAA 4K20A 4PBPA 1JYVA 2DYCA 1VJ2A 5I93A 4GH4C 3TYJA 4CCOA 1YQ6A 3OBTA 2BGCA 3IZOA 4RHV2 4ZHNA 2P3YA 4QXBA 3AFGA 4YM3A 2W3JA 1DQ4A 5LEKA 1UU4A 2VCAA 4F8AA 3DCQA 3KS7A 4L9BA 4GWIA 1WCKA 4JRLA 4CDUA 5F1RA 1W6PB 5JZGB 1AR61 4BQWA 2QQPA 3AVRA 2LRPA 4SBVA 2HWC1 3ILRA 3J8F3 4KBBA 4AHWA 1A3KA 2H0BA 1RUE1 3TWIA 4AK3A 1OI6A 1Q8PA 5BNPC 1EV12 4IEPA 1RTVA 4H7MA 2D43A 1PVC1 1W04A 1GU3A 4MVTA 1XNAA 3OGRA 2JDMA 1BHGA 1RUH1 2UWCA 3BCWA 1JOBA 1QIQA 1ZRIA 2WA4A 3KF5A 1BMV1 1AXYA 5AVAA 2B4KA 5KHIA 2DVFA 4ES8A 5T50A 4UW4A 4IE0A 3ZXDA 3DN7A 5JCTA 2Z69A 5IJRA 4KU7A 4BK5A 1OQDA 4QGNA 1OA4A 2XDVA 4AI0A 1NQJA 1D4M2 2WS91 3BGAA 4HFSA 3SH3A 3O1OA 1JZ3A 1O8PA 2HBUA 2R6QA 2GN7A 2YBKA 5CFCB 5DDJ3 3O1MA 1UIKA 3DXTA 1APNA 3K2OA 4XVHA 1QKQA 1LAJA 3AMNA 1JBCA 3OTFA 4XHBA 1L7QA 3ZIXA 2XJSA 2Y33A 1NX9A 1H6XA 3OYWB 3VD4A 4QT6A 2XUMA 3AYEA 4Y24A 2RDSA 2YC2A 4CEWA 2AC1A 1UL9A 4BIOA 3NNMA 1HQLA 5CKNA 3P1IA 1RMU1 5IVVA 1UKRA 3ZDSA 2C1FA 2HWC3 4QHOA 4Y1VA 3RMYA 4CCDA 2RG4A 1PMJX 3ETQA 3MIEA 2O14A 3FX3A 4LO4B 1LTEA 2VVFA 2QDRA 5A6QA 2WYFA 3KMHA 3VZJA 5GZDA 4CEWC 1UW8A 4CXXA 2HWD3 4DMIA 4COZA 1IPJA 1RHI1 4Q4V1 5AFBA 1UCXA 2IXLA 2XQXA 4IL7A 5LY1A 2WL1A 5K4LA 5KR7A 5SV8A 1J83A 4FTBA 4JKLA 3ZYBA 4C1WA 1C1LA 2UY8A 4MG2A 3SMHA 3GHMA 1HKDA 3LWCA 5L7OA 3THCA 4O7XA 1ZVFA 4CP1A 1V6IA 2BGOA 3B69A 3ZN6A 4E27A 1B35C 1RUF1 2NMOA 3ST7A 5CEHA 3VD5A 2G19A 4XFIA 1QEXA 4N8MA 3TNPB 3F2ZA 3L2YA 3OBAA 4FP3A 4XF4A 2P3IA 2WO3A 3OBZA 4FFHA 1AR62 3O0WA 4CU7A 5DZFA 5K0UC 1MS0A 3T4VA 3ZXLA 3J4UH 2RMU1 2XWJB 3VBRC 3PHMA 5C9AB 3DGTA 5K8SA 3PUIA 3IDCB 1FOD1 3ACGA 4NHLA 3K3NA 5CFDC 1KXGA 4Q29A 4AVVA 4AQTA 3VZOA 5CADA 1LGBA 2FCUA 3CF6E 2YMZA 1ST8A 2VUDA 4N43A 1RC6A 4N43B 3I3DA 4YVSB 4ARXA 2QQIA 1CAXA 2WNVB 3OBRA 2BEOA 3PVEA 5ACA3 5IK7A 4D7YA 2ZZQA 3RJRA 2HLEA 1BYHA 3GXUA 1AF9A 2VQUA 1GYKA 1MPXA 2UYAA 2VTXJ 2ZGOA 1J84A 4AG4A 4CDWB 4LIVA 5JAXA 1RYYA 5C7GA 4BDVB 1RIRA 5F7UA 3N9QA 3KHCA 4LPLA 3ZFFC 4EWAA 1HV1A 5JDBA 2NN8A 4CDXB 1PIV3 4QDRA 4M00A 2OZ6A 2CHHA 3KVAA 3VZLA 1RXGA 4GB31 4QPGC 1KS5A 5DAQA 4TSVA 5GLTA 2CU5A 1XNTA 1RUF3 3D6EA 4Y1YA 4AI1A 5DUVA 3ZSJA 5AC93 4DEVA 1OC1A 2BPA2 3I59B 1BMV2 4INDA 2DVAA 3AC0A 1AL21 2JG8C 1JZ5A 1V9U3 4CA9A 4FOQA 3GNEA 4IXLA 1DU3D 2DCYA 5IT6A 4P9WA 4COVA 5C5UA 4QQHA 1NLSA 4U36A 1VBD2 1GOHA 1WLTA 2ARCA 3JCIA 1LEMA 3B9IA 3POYA 2QQUA 4NAMA 4PIXA 5DDJ1 4R9AA 5FZGA 1IS3A 1QDOA 2CGNA 4A2UA 4WM8C 5IAVA 1Y9GA 4XAEA 2EIEA 5FLJA 1R1A1 3RYPA 1RGSA 5C8CA 1HJGA 2Q4SA 1BJQA 5FYUA 3T1MA 5C3RA 2XHNA 1NLQA 4DNYA 4JKMA 2VMCA 3B3QE 3NNFA 2A6VA 1PZ7A 4KWKA 1JI6A 3KV4A 3ZKUA 4NHXA 4NOTA 3POEA 1ENRA 3BTAA 1XJAA 3J8F2 3NV3A 1CPNA 5J37A 4LT5A 3OEAA 2HYKA 1RITA 4QB1A 2OZJA 5HXMA 3TEYA 5IAXA 4YVSA 5C5TA 2HWB3 2ZGRA 3VBSB 4GB33 4LXLA 5F5QA 5E6HA 2ZAAA 2NQYA 4UAPA 1OVPA 4TLFA 1ZYBA 1HRI3 1KFUL 2JIGA 3EQEA 2VD7A 1DQ2A 3J26N 4E4DX 1VBE1 4ES9A 2Y64A 3H1YA 4O9GA 3WOGA 4NROA 1C5HA 3FUQA 3LEGA 1E5IA 4K21A 4LBQD 5LBFA 2RS53 1MS8A 4V2VA 3W21A 3ZYFA 1V9U1 4F83A 4LUKA 4YYOA 2YBPA 3UK9A 2ARBA 3VBFA 3TEZA 1PNGA 3MPBA 1UZ0A 4GMP1 3MF6A 4J6GA 3ZIWA 2XR4A 1NKGA 1O7FA 3WDUA 5FLIA 5FK7A 2D6KA 3RS6A 1RVF1 1XOYA 4JDNA 4HETA 2CL2A 1YEWA 1SFYA 2E9QA 4L92A 1GBGA 4XIOA 2LTNA 1OH3A 5F3GA 4YW5A 3VHRA 1FPN1 3D82A 3CHXA 2ZX1A 1ZX5A 3S0MA 3POFA 5FY0A 5J1XA 1HRI2 4YW4A 2G4IA 3WLUA 4QQOA 1EYBA 4LA3A 5A3LA 5CAZA 3N9NA 1ND3C 3WUDA 5JOZA 4BJ0A 2R49A 2VOKA 1BEV3 1Q8OA 1AXKA 2QJVA 2YU1A 3IM0A 2ORZA 2RVAA 3DPRC 4FQZA 1DGRN 3WXPA 4KWUA 2VW0A 1AR73 2XVLA 1AZDA 4YZ4A 3ZN6B 3AL6A 4Q0UA 4QPWA 4B29A 2XXZA 3MF9A 1U5ZA 4XIKA 5LRSA 2VO5A 2TEPA 1VR3A 1H9WA 1LODA 5FKCA 3U37A 3VBHC 4FBFA 2XOMA 1ZBA3 5FDBA 1PK6C 2RS51 3K75B 4CP9A 4YW1A 2BU9A 5IYYA 5FMDA 3JD73 4NHMA 3AP9A 4IEQA 5FZFA 3C7GA 5T5LA 2JKXA 1UX7A 3CDZB 2FMYA 2JX9A 1ULOA 4HK8A 3VDDB 2VR4A 2OKXA 3DECA 1WA6X 1QQP3 1UOJA 2ADEA 1AHSA 3MUZ1 2VNRA 4C1XA 4PQQA 1H1AA 1NXMA 1AR72 3U14A 1JYWA 1N1TA 2UYBA 5LK7B 2Y6KA 3LEIA 1AUYA 2TNFA 4Y5Z0 1I6XA 1RUC3 4M01A 4WVMA 4NIAA 3LDKA 1SDWA 1SFPA 1B09A 3IPVA 2JB4A 1R1A3 5BPXA 2BP6A 5FYCA 1OFSA 2EICA 1GSLA 1UPSA 3N7JA 4COUA 2GC1A 4DXZA 1JYIA 1ZRCA 4JGYC 1J1TA 1V6JA 1FMD1 1PZ8A 3OGVA 4LHNA 5HV4A 3U0ZA 2PHWA 3HT2A 1QJU1 1V00A 5HCBA 3SEPA 2A6ZA 1HB3A 2D6MA 4PI2A 4LBOA 1N3PA 2PA7A 1MACA 1RVF2 1RUOA 3GBWA 3M7AA 3V64A 5JI7A 4D0QA 5CISA 1VPHA 5FOBB 5J09A 1ALYA 5K7PA 4JTNA 2KD7A 4XQDA 5FY5A 3OUJA 4YW7A 3GDBA 4NIIA 3NQHA 2BWCA 1XNCA 2GNBA 3MIFA 4WM7B 1RB8G 1GOGA 1UYPA 2Q1FA 1LU2A 2B9VA 2WNUA 1F8VA 4Q1RA 1E5RA 5I8SA 4CTEA 3W9AA 4AHXA 4Q4X1 5A3NA 4CCJA 1NUKA 3MZHA 4NAOA 1QQP1 1B35A 2PQSA 2V09A 5I0UA 1R64A 5BNQA 3P5BA 5E89A 3WF2A 1ZRDA 4LA2A 1WCUA 4RFRB 1YI7A 3R05A 4XF9A 3OD4A 2PHFA 2VCMA 4JVAA 3UKVA 4ATFA 1G8WA 3MIBA 1W9TA 2VZQA 4ZXEA 1RUC1 2H6CA 4GXLA 4E2QA 1GNYA 3GALA 1ZRRA 4XHXA 1ND2A 1OT5A 3R0RA 5DQ0A 2ZAHA 4EJRA 3DPRA 3N7LA 3P3PA 5KHGA 1ZZ6A 4A3XA 2XUEA 4H55A 2VXJA 3KHBA 4QGLA 1A6CA 1YRZA 2XB6C 5FPLA 3UESA 4AZZA 1ND2B 4RGAA 3WNLA 2YHJA 4UWDA 1QOOA 1PX4A 1ULCA 3AVSA 1UPIA 4EROA 4HVRA 5IVEA 2AR6A 1FNZA 3UKNA 2JWPA 5FWJA 1WD4A 5F3EA 1E57A 2FCTA 1J58A 5A7NA 5F5IA 3NMBA 5FMCA 2VBBA 3CKHA 4RL7A 3NAPC 5T5JA 3AL5A 5D2AA 1XBFA 5FZCA 4H7LA 3VBUA 3A4UA 5FJKA 3AP6A 4E4ZA 3EBRA 1OA3A 4Y33A 2A6YA 4Y1ZA 1O3TA 2MEV2 3PJQA 1WA4A 2MEV3 1N3QA 3O0VA 1CAVB 2F6BA 2CAVA 3CJXA 1PO21 2LUWA 3R6SA 3JD71 2OPWA 4UFKA 1UQXA 1LCLA 4GWNA 4RS5B 3USSA 4JHTA 1QXJA 4PCRA 1UOFA 4LOTA 4CDQA 3K46A 5FUPA 2MNGA 5A6YA 4BCUA 4XJ8A 5T54A 2VW1A 1CAVA 1YQCA 2WABA 2DCZA 3IPVB 1QJY2 2BOJA 1DF0A 4UFMA 1JUIA 4UBHA 4Z07A 5GALA 3P6BA 5A3WA 3I49A 2ZEWA 4E9KA 4B1MA 4IE7A 2ZEXA 4DFSA 2OVUA 3UJOA 2WO7A 4O9EA 5BNOB 5JXJA 4A6OA 1BLZA 1O4ZA 1Y9QA 3K51A 1HN1A 4DS0A 5JMCA 4P9IA 2GMEA 2Y26A 5JIUA 4GQ7A 1DYKA 2ZMNA 5FP3A 3ZO0B 4P9YA 4GMP0 4CPBA 2O0OA 1MZ6A 5JPNB 1PM7A 1UAIA 3MGUA 4KWJA 1Q8QA 3I2OA 1LECA 4LNVA 1BXHA 2E32A 4OLLA 1WMDA 2I2SA 3DEMA 5EQUA 3AP7A 5B4NA 3HWJA 4Z1VA 4Q0SA 4IEYA 4AR2A 4CVUA 1W8HA 4IETA 2P6HA 5FYTA 1C8M3 3RYRA 4XBLA 4YZ5A 2IZWA 3MLJA 1RUC2 1X7NA 5FO9B 2LROA 1ENXA 4RR3C 4XURA 5JWPA 3WW3A 3IKWA 1ZBA2 3TN91 5T3NA 1COV2 1OUXA 4Y1XA 5DDJ2 5H9QA 3TB0A 1JOPA 2LW8A 3GGLA 2AUYA 2LS6A 2FDIA 4XDQA 4NPMA 1CZTA 2VUCA 1HW5A 4NO4A 5IWFA 4A3ZA 4A7YA 4XF3A 3J7HA 5EYXA 4DXSA 1CJDA 1BK0A 1V6MA 2WSUA 3AP5A 3KQ4B 1CJPA 1S0CA 2OXBA 3GYDA 4K8RB 4ZU4A 3SH5A 4BQ3A 5A1AA 4QB6A 4MOAA 2SLIA 2LM3A 2VBPA 4JDOA 4EWEA 2HWE1 3U4SA 2XMLA 1GZ9A 2WZR2 1W6MA 3MO4A 3VKOA 2VQ0A 4UBGA 5FP4A 5J3UA 5KC6A 5T55A 2X09A 2JDNA 3PUHA 1MEC3 4M4PA 5FAXA 4P9LA 5CZKA 1Q56A 4KQ7A 3ES4A 4AEDC 3MFCA 3ZSEA 3JQXA 1W2TA 2HWF3 2HEVF 4BA6A 1YHFA 2O8OA 3EHKA 2D5FA 5IVBA 4LHLA 1NY71 3MW4A 3ZXJA 2WDBA 5FYSA 5FPZA 2FQPA 3V56A 1IKQA 5CFDB 1VBB2 2VJXA 1V6NA 1XC6A 3O7OA 1CGPA 2ZGSA 3Q8BA 5F6KA 5HCFA 1Y3TA 2E63A 3T2TA 3UJQA 4N43C 3I4IA 3AXDA 3ALQA 2X5IB 4QM9A 5JXGA 1SLLA 3DXUA 4YG3A 3ZYPA 1F5FA 2X05A 3I97A 3WY6A 4KG0A 3USUA 2PMWB 3TEXA 2DU0A 3BTZA 1J3PA 4AAPA 5JR7B 4FFFA 3UGFA 4DY3A 5FMOS 4ZZ8A 1LEDA 3AFKA 5FCCA 3N3HA 4BIFA 4YZ2A 5C4WC 2ZCWA 4N9IA 2PN5A 2LALA 4L97A 2PYTA 4Q8LA 2MEV1 3WDWA 1PM4A 4NN0A 1DLLA 3ZFFB 1K5JA 4G4FA 5CIRA 1ENQA 3WF0A 1LRHA 4CDXC 2K0GA 4N53C 3ZX7A 4DZGA 1SBDA 3KV6A 5FZKA 1ASJ2 4LITA 3NJYA 4COWA 1ASJ3 1GUIA 3FLPA 2QZ3A 1GOFA 4AQ2A 3VD3A 4OYUA 4HLTA 1F35A 2ZX4A 3PL0A 1IG0A 2XVKA 4Y22B 5A3TA 4OHYA 1URXA 1F5JA 2HWF1 5L73A 4ASLA 1QH7A 2VECA 1QJFA 4Q4V2 3ZXEA 5F2WA 2VQAA 1POV3 1GP5A 2VULA 4TYSA 1YI9A 5LA9A 4Y22A 2R041 1L7LA 1PIV2 2IVJA 3HQRA 2VZOA 2G1MA 1H1MA 1AL0G 4JHZA 2VL4A 1RL3A 4IE5A 5FYYA 2J1RA 2XVGA 5D21A 2OQ6A 2JB8A 2FDJA 3C2UA 3BVCA 1F31A 2YROA 5AVPA 1IS5A 4DRRA 4IE4A 3V0BB 4XDOA 4GWJA 2WBKA 4Z92B 4A45A 2WLQA 4JZRA 3WNKA 4JKKA 3C7OA 5DUXA 3ZYRA 2A73B 1C8M1 1OLMA 1TME1 1XU2A 4H3WA 2NP0A 5DG2A 1H9PA 1UY2A 1ZBE2 2R0HA 3GJBA 1GZCA 2RE9A 3CZUA 4AQ6A 2JKBA 4AW7A 5A33A 1NA1C 4D7SA 1W6OB 1Q8SA 2BTVC 2P17A 4XJAA 4XMAA 5SV5A 2JXAA 1JHJA 4HVOA 1IOAA 4YPJA 2ZHNA 1K5MC 1KITA 3ZSKA 2CY6A 2WQ4A 3J7NA 5EWSA 5JSPA 3VBSC 2IC1A 3H3UA 4Y20B 3BPSA 3KGLA 4COYA 2PHUA 5FZ3A 3LOBA 1W3VA 4HKWA 5BNNA 1SCSA 2R072 1DGWA 2ZA9A 2W1WA 1YQ8A 3VKNA 2VZVA 1C28A 3EMRA 1M4WA 3LPFA 5FZ0A 2WZ8A 1A78A 3IN9A 3I2DA 2HWE2 4Q4W1 5I0DA 5KXEA 4XW3A 1H2MA 1WW5A 2QKDA 1DYOA 3VBFB 1LOFA 3NNLA 2Y0IA 1DQ6A 4K9SA 5DZGA 4AHZA 4TTGA 2E31A 3BU0A 2BERA 3KZ4C 2XJTA 4QGMA 5A3UA 3CIHA 4JGYA 5IK8A 4WVVA 3M70A 1OH4A 5LA2A 1NYWA 4CDUC 1MVQA 5C3QA 3S7EA 2IXKA 1RUJ3 2ZGPA 1IGOA 1TQ5A 4Q4Y2 1AR91 1H30A 3SKVA 1WGPA 3JZVA 1YJKA 3LIGA 1W8FA 2F4PA 3AJZA 2ZGKA 4LK6A 3AYDA 3WF3A 1F9KA 1AL22 1GZTA 1DGLA 3JXSA 4IE6A 4META 5KHJA 1S2EA 1US2A 3PIGA 1UZYA 3POWA 3M4FA 3Q8AA 1CWPA 5AFEA 2DCTA 3JU9A 1W0NA 1VBD1 4NVPA 2YC4A 3ENRA 4KWLA 2FZ2A 1NZCA 5BV6A 2VVDA 3PUAA 2GZWA 2WQ8A 1XNBA 5FZOB 3PDQA 4CCEA 2C24A 3EB7A 3GBFA 1REDA 3RWKX 3PLQA 4W50A 3PU3A 3VBOC 1UYYA 4B4RA 4MGTA 3I3EA 3M3CA 4WVZA 4XTMA 1K12A 1RUI2 3ACLA 4L0PA 5FZOA 2HYXA 2PELA 1JYTA 5FQ0A 2QQKA 5B2GB 5HCHA 1S0BA 3HJRA 1S4CA 2FDKA 4LE3A 5C8CB 3U78A 2PFWA 2J7MA 1PGSA 2YY1A 3WUCA 4XABA 3O1UA 1CVNA 1DQ1A 4LKFA 3VDDC 3O14A 3VL8A 2FZ1A 2P1BA 5FZEA 4D94A 4OI4A 4ZS2A 3MHZA 2ET7A 4PF5A 1BVP1 2I74A 3QACA 2CGOA 2WRAA 2ZGQA 1H8TA 1RUJ1 4GH4B 3H8XA 3HPNA 4OUSA 5D8AC 4HBNA 1POV1 5KXCA 3K48A 5ACA2 3JBG1 3MFAA 2ZACA 2ZMLA 4I01A 1PO22 2K2SA 3NRUA 1R1A2 3PU8A 1AYN1 4XJZA 1SLAA 4RHV1 1IS6A 1F15A 2ZZJA 4LHKA 1X36A 4CSWA 3ITQA 5G05L 4R9BA 4UFLA 5F2SA 1AYM2 5IUQA 2WWJA 4Q4W2 2K46A 3H7YA 3KCYA 5FBJA 3USUB 4JGYB 4FPYA 3NJZA 4EYUA 2OW4A 4FAGA 5FY9A 2VQTA 2V5DA 4GALA 5F9TA 5JOXA 5BNPB 5CA6A 1TMF1 1TME3 3KCXA 1TME2 2YB7A 1J59A 5I0TA 3VD9A 4ARYA 1UYZA 3HR9A 1WW4A 2DTWA 1JYNA 4UFJA 3BB6A 3U10A 3KVBA 2AEYA 1EV11 1OHFA 1NXD1 1KDKA 1KEXA 2ZKNA 3B93A 3QD6A 5DAVA 5HXVA 3TEWA 3CNAA 1H2KA 2H6BA 3C7FA 2W52A 1SHWB 4HSJA 2MHFA 1H2LA 5FXXA 1DP0A 1YYNA 2R071 4KU8A 1PVC3 3RJ2X 4OI2A 3WP6A 1UXZA 4XFCA 3MBWA 4YSFA 2ZMKA 3E6CC 3O12A 3HNYM 1WLWA 1QJZA 4BQ2A 4LBJA 4LLOA 2W39A 1R1ZA 1LENA 1Z78A 3AYCA 3GZTB 3KT7A 1JYCA 2V4AA 3E1F1 3CU7A 2CV6A 4R9CA 3K4ZA 2WT0A 1HRV2 2RHPA 4PQ9A 1TZOA 4QKNA 3ROUA 5KBFA 1VBA3 4QU1A 1EY2A 1IQAA 1GZWB 5HV0A 2EIDA 2Q8CA 4NHKA 3SXWA 1HB2A 1GNZA 4HK9A 3KV9A 1FV2A 3ZFGA 3P3NA 3NKTA 3WQ1A 5LK5A 3ZLIA 4GD4A 4N90A 4AI3A 1AR93 4OMDA 3WP3A 4OHXA 1AR92 4OVEA 4XXAA 4ONUA 2GSYA 2QCSB 2BFUS 2GC3A 4BXSV 3BTXA 1GWKA 4IESA 2DCJA 3ELNA 2GU9A 4LK7A 3UNPA 4M0HA 1Q3EA 3V0BA 3I2JA 4XF1A 3KM5A 1WMEA 3N9MA 1QJX1 1US3A 5BYNA 4IV3B 5BNOA 2PHTA 3SNMA 1T2XA 3WNXA 1WW6A 2XG3A 4LBQB 4FTSA 1ULPA 2AGSA 2BBAA 4I3GA 5LW9A 1K3IA 5JUVA 3Q9OA 3S5QA 1KD7A 5A3MA 4IEOA 2RS52 2HWD1 1VP6A 1G86A 4NRMA 5T5OA 1CD3G 3T08A 2YG0A 2Z5WA 3MIDA 3B9CA 5FY4A 2QQJA 2FD8A 2JG9B 5C3SA 1UOGA 4L8QA 1AYM1 2XJQA 4J1XA 3B94A 4XETA 4LE4A 4XFAA 5E88A 1CAWA 3ZXFA 3FJSA 1BVVA 2KA3A 2HJIA 5FY7A 4Q27A 5C9AC 1AX2A 1VALA 1V0AA 2B8MA 3HD8B 4AFCA 1QXRA 3VDAA 4CDQB 3GBGA 3NL1A 3PIJA 4M3CE 5FYMA 1UOBA 3WD5A 5DAXA 5L9VA 1FAYA 2QBXA 5GLWA 4QX7A 4OFGA 3BKZA 2XBO2 4YLZA 3T0DA 4NIHA 1DCSA 2JE8A 3ZVXA 3WHTA 2AACA 4BU2A 1AXZA 4E8CA 5C8WA 1BEV2 2PHXA 5LA0A 1ZZ9A 4HPKB 3E97A 3GZUC 3WP5A 2CTVA 2DURA 4GKYA 4XJ9A 4CDWC 1HJFA 3GZAA 5K0UA 4UFHA 2X5IA 4QX5A 5FJHA 1H2NA 3WQ7A 2VMFA 1X8MA 1LOGA 4XFFA 4Z82A 4BOWA 3DF0A 4CP9B 3VKFC 4UW5A 4MGSA 3T2QA 3CMGA 3NNJA 1Z7S2 3FMGA 4V1PA 3WG2A 4JQRA 1REEA 5DUUA 5F39A 4AL9A 1NCRC 1YIFA 1WW7A 2WT1A 5FY1A 1LOEA 2R16A 3HT1A 4BMEA 2E7AA 4CUGA 4TWTA 3OY8A 5GZGA 1AYM3 1JZ4A 4NUBA 5A33B 3ASIA 2JG8B 2WUHA 1W0PA 2VBDA 5JVVA 5K9YA 2A70A 4I02A 4AVTA 2XJRA 3UT0A 1H8VA 3RZZA 1QQP2 5DN2A 5AC91 2A3WA 4HZFA 4YRDA 4LKSA 4X6RB 5FYIA 5GLUA 2X53S 1GLHA 1QJX2 4AYUA 1ND3A 4AEJA 4NIDA 2WO2A 1C8M2 1FATA 1C8NA 3LA7A 2BQPA 4WM8B 2WZEA 1S0EA 4HN1A 1S0FA 1VMJA 3L2HA 3MLLA 1W9WA 1TE1B 1HRV1 1IHMA 1IQDC 1VBA1 2NLRA 2VUJA 3OF1A 4J1WA 3VN4A 3WCRA 5H9PA 5LRRA 5C3PA 4DUVA 3WP4A 1G9BA 2Q8OA 2ZGMA 1AX1A 2V4VA 2R1BA 1FNYA 2W68A 1UIJA 2Q5TA 1VBC2 1LOBA 1WKYA 2FCVA 3LB9A 1R093 3QH6A 4QPYA 4Z2AA 5A7WA 3NJXA 4AFMA 1JTZX 5FIXA 5HBAA 4JCKA 1QNWA 1XQNA 3LD8A 3RMXA 1POQA 2OUJA 3WINE 1ZA7A 2UU8A 4BYYA 2VXRA 1XYNA 3AZYA 2VE1A 3RSJA 4QXKA 2P3JA 2W87A 3PMSA 4DEQA 1KRIA 3CO2A 4QX8A 1HX6A 2ZOEB 5HPOA 4ET7A 3WVJA 4W6WA 5ERLA 1D4VB 1OKQA 1VBE2 4KH9A 4P5YA 2WNEA 1KJLA 5DG1A 1GMMA 4LBNA 5C4WB 3H7JA 3OCPA 5CG9A 1H4GA 1W6QB 2RM21 1V9U2 4Z2WA 4CEYA 4CEYB 3IBMA 2R30A 1U5XA 4IV1B 3ZFEB 5IFPA 4YFWA 4XAAA 1RMU2 3ZSMA 5L9RA 2Z79A 1ULDA 4E4HA 4P08A 1AR83 4XILA 4GAZA 3AZVA 4QHBA 2IFWA 5FBZA 2UWAA 1Z7S1 4ZZ5A 5JSRA 5ABJB 1N47A 2DUQA 1NLRA 3BU7A 1H8TC 1Y4WA 1R083 2WC2A 3ZKYA 2E7TA 1VB2A 1W8OA 3NWKA 4PLMA 4FCAA 3VKMA 3OEBA 3ZMNA 3CBNA 4GKXA 4MUVA 5JPMB 2WFPA 1G9DA 3I3QA 5M0TA 1LHVA 1OF3A 3DPRB 4RSUA 4CPBD 3LKJA 1S0GA 3M2MA 2J22A 1RUF2 5JI9A 2AEZA 5JLVA 1QOTA 2DBNA 2QDNA 1NCRA 1EAH1 1RMU3 1X50A 1XSQA 3H1MA 3X29B 3ZFGB 5KC5A 4ASMB 2IXCA 1KJRA 3VBHB 3DYMA 2YPDA 3A0KA 1S2KA 3CEWA 4FPLA 1MZFA 5LBCA 2WNUC 2WINB 4MYEA 4XDPA 1RHI3 1R082 2D3RA 2RM23 1MS5A 1YFXA 3AKSA 3PNAA 4JTOA 5CYYA 3VZMA 5I8YA 1K5MB 1OPMA 3B02A 4KBZA 1SDDB 1W06A 5B4XA 4QMAA 3ZYJB 5ISLA 3DYPA 4V2WA 4BHPA 1QY4A 1UY4A 1CQ9A 2RS11 2YUEA 2VZUA 1OQ1A 1W0OA 4UXAA 1YFYA 4HN0A 3SQOA 4K1YA 3LQCA 2RDNA 5ANQA 1O5LA 2ERFA 4I0BA 3M3QA 4JRAA 4FFGA 4P14A 1LHUA 4IQPA 2ATFA 4FOVA 4MZUA 4QX2A 4RN5A 5I8TA 4KG8A 3S7IA 1HB1A 2YZ4A 4KL1A 4DIQA 2FDFA 3KSCA 3VB9A 2DTYA 4B7KA 3ABZA 4FXKB 3O1TA 4XOGA 3H8UA 2QE3A 2ZS6B 1NCQA 4K7JA 1FOD3 2EAAA 4YVWC 4OCTA 5FREA 2R1DA 1RUD2 2W47A 3ON7A 4Q4Y3 5J7MA 1TVGA 4O61A 3AMMA 5CNAA 1FMD2 3KB5A 5C4WA 2A3XA 1GICA 2XLFA 3D0SA 4UI9L 3BODA 1A8MA 2D93A 2W1QA 5HCAA 3KV5A 3FWEA 2V5YA 1HQNA 2WYSA 2DF7A 4FPEA 2OIIA 2GNTA 2WT2A 4M3CA 5HI0A 5L7OC 3VBSA 4FVVA 2PAKA 3AMPA 4Z8BA 1NE4A 1PMHX 4ITCA 1D4M3 1OFNA 2DVGA 4PI0A 2XPJA 4EV0A 4JC1A 4MLOA 4QKBA 4Y5TA 2WKKA 4EN9B 1YQ2A 4K3UA 3HN1A 2BW8A 3SH4A 3VBUC 4XCBA 4EWDA 3O1RA 2D6PA 1IS4A 4BQYA 1PIV1 1X9TA 3RVHA 1O59A 2NPIA 3JQWA 1F4AA 4F7ZA 1XE7A 4GB32 1JUHA 4GA9A 2RS13 1NAEA 4QHZA 4XFHA 3WNPA 2E51A 3HBZA 3R4DB 2VUAA 3NV1A 4TZDA 3DKWA 2GP5A 5CKMA 5FQ0B 4Q4X3 3I3MA 1I9RA 4NRQA 3VD7A 4XE9A 4WVWA 1AL23 1OVSA 4P5HA 4QQ2A 4AVAA 3O1SA 2DU1A 4I30A 4CXWA 1YCIA 3ZXKA 5C8CC 2A71A 3HNMA 1GQHA 1VAMA 4RGKA 2WR9A 2QFEA 2XGXA 2GNMA 2DFBA 2J1EA 3AJYA 1U0AA 4QKFA 1R081 1ND2C 1PGL2 4R9DA 1BCXA 1E5SA 1WZXA 1GWLA 1ODMA 1J3RA 5CVRA 2EXHA 2JDYA 3I2IA 2NZ9A 3MICA 5FV3A 1MS4A 3INAA 3ZYHA 1JMUB 5DMYA 2ARAA 2JDZA 3QOPA 3NAPB 3OSDA 4QM8A 3WDYA 1VAVA 4WV8A 5EHDA 4RR3A 1BBT1 3MV01 1NQDA 2OT7A 3DKQA 5EJ1B 1QWRA 4LLFA 1M06G 2VH9A 3QH7A 1AR63 2WAAA 4PT6A 3RPQA 1U5IA 4XACA 1D0GA 2UWBA 3HEIA 3IWZA 1XPWA 1X9PA 1RUE3 4CDWA 1AJOA 4DUXA 3S5AA 1ULEA 1VRH2 1GR3A 2P6CA 1KDMA 1HRI1 4DXTA 2VMIA 3LA2A 1DFQA 4LO7A 3ACIA 4W4ZA 3PJYA 2DVBA 2HH9A 4B8EA 4NPRA 1HLCA 5DPNA 3V0AB 1YUDA 2L9LA 4RYDA 2ZX3A 4QB2A 1VRBA 2XLGA 4GMP3 5FP9A 1QMJA 2OX0A 4LULA 3RZKA 3ETPA 1A8DA 2P5BA 1DHKB 3JB8A 3TRSB 3HQXA 3RI9A 1ZREA 3N7KA 1IKPA 4GH4A 3APBA 4W65A 1JU3A 5FZ8A 2JJ6A 3T3YA 2XJUA 4MGQA 4TN7A 4XEZA 1E5HA 4JGZA 1VAKA 2BGPA 2QTWB 1CN1A 1FYUA 2R7EB 1OA2A 1QU0A 2ZEYA 3RQ0A 3E6DA 3LIHA 1WCQA 5FP8A 3I3BA 4DY5A 1JU4A 3Q8FA 2VY0A 4FP2A 3J9SA 2EAKA 1K45A 3E6BA 3MV11 5GM0A 4ISRA 1SQ4A 2ZHMA 2WZPP 5FMBA 4FPFA 1G9CA 4ISQA 4PLNA 2VAUA 1W3XA 1UWWA 2JDUA 3RDIA 1AR71 1ZZBA 3UV9A 4Q26A 5FZ9A 4QPGA 3GHNA 1LOAA 5CFCA 1OD5A 4PDWA 1D4M1 1TEIA 4OHZA 3ZOIA 1OURA 3QBQA 2D6NA 4UFIA 1VBA2 5KXDA 3AMHA 3N7MA 1D7PM 3I59A 2XWBB 3U1XA 2JD9A 4NPLA 2B7YA 4NIGA 2XHKA 2IWGB 4Q0VA 2BDRA 2EALA 1W90A 2W08A 2VOTA 2WSVA 3O5SA 4HANA 4PDWB 1RUI1 5J96B 4S2HA 4BISA 1YO8A 4CYDA 1KS4A 1OQEA 2VM9A 1UY0A 2VTFA 2W92A 2Z2SB 1W8ZA 5FRAA 2JE7A 2BOIA 2EXKA 4Y4RA 4A44A 1JYXA 3QCWA 2MPFA 4XPVA 4LBMA 4UYBA 4C0BA 2VZTA 4YZ1A 3TBDA 4MADA 4AHYA 4Q0PA 1W9YA 3SC7X 2HWB2 1VRH1 3BPZA 1UU6A 4ZU7A 4JGZB 2BWAA 3LEMA 3WQBA 5L36A 2YC0A 1NY72 2YPJA 1C3HA 5FYHA 5FZHA 4AE2A 4Q4X2 3THTA 1NCQB 4DB5A 2VW2A 2Z4FA 2AREA 2X5IC 4XUQA 3ZPYA 4A6SA 5A7WB 2B45X 4LUMA 4CCNA 2NM1A 2VMHA 3LSEA 1DQ5A 1QJU3 2BZDA 5IK4A 4P9XA 1JZ7A 1QHDA 1FXZA 3BIEA 3A23A 3ACFA 1BBT3 1W99A 4FPOB 1OF4A 4XJUA 1BBT2 4IGQA 3POGA 1W8NA 1N1YA 3C7EA 4QXCA 3NW4A 5F6LB 2JE9A 5FXWA 1HXS2 5APAA 1Q43A 3WHUA 1XU1A 3MIGA 3WDTA 4DXRA 4IEZA 1LGNA 3N36A 4GIQA 4I0WB 4HKOA 3FBMA 1RUI3 4N53B 4XYXA 4CP2A 2P37A 1NCRB 1UZZA 5LEJA 1S55A 4JQTA 4MH0E 1W6MB 1W2AX 2DCKA 4KGGA 1I5ZA 3AXEA 3GZEA 4YG6A 4XXPA 1HIXA 2BBVA 2O1QA 1VMFA 1GV9A 5BNNB 5LA1A 3IAQA 1QGLA 1O3RA 4EN6B 4C8DA 4R8HA 2B42B 2FDHA 4GJYA 3LAGA 3ILNA 2QQLA 4YGCA 4ZY9A 1OPOA 1QH6A 3WNOA 2Y0OA 2EXIA 3C8XA 4FOWA 4GWMA 2VZPA 1G6NA 4QPIC 3AZZA 3HAGA 3BTYA 4ASKA 1ODNA 4OZOA 4K8FA 1VMHA 3CZJA 4YFZA 1EPZA 2JDPA 4HKLA 3LFMA 3KQRA 3MDPA 1GWMA 2J1AA 2ZHLA 3AKTA 2Q8EA 3QLQA 4BH9A 3FBYA 4LMFA 2KR2A 4AF9A 4H2AA 3KWVA 3PURA 3H8OA 3IMMA 3T2OA 3D3AA 1C1FA 3GCXA 4AVSA 1IG3A 5EJZB 1NA1B 2V73A 3I54A 4IEWA 3J8F1 4PHZA 3V65A 2HEWF 2JD4A 1NE6A 3PVBB 4O65A 4C0HA 1I5PA 1KFXL 2ZEZA 2Y34A 1V6KA 3ME2A 2HWB1 1OOPC 3D8CA 1Q5OA 2HKXA 3PUSA 1MQTA 2ENRA 2WNOA 2XBO1 3KT4A 2VOXA 2IVIB 5JZGC 4IGOA 2PLV2 2B5HA 4I0AA 2QUOA 1PO23 2YU2A 3RRDA 3GF6A 3T4HB 3ZN5A 1LB2A 1SZBA 1WWYA 3FUOA 4FPGA 4AWDA 1U5YA 3WCSA 5DAPA 4D6SA 1W6QA 2PHRA 4QX3A 4URAA 5IATA 2CSGA 2OPKA 5A80A 4CEYC 4P02B 4CCCA 3U07A 3VBRA 1WBFA 3VHOA 1LKNA 1O91A 1QJY1 3MW2A 2GC0A 5FYBA 4MGKE 3R4UA 3ZR5A 4AEDA 3BYWA 3V0AA 4G3YC 3J7MA 5EIYB 5FPUA 2RR13 2GN3A 3FFZA 3PUQA 4MO3M 3VDDA 4CDUB 3BI3A 3N4MA 4OI1A 3RZLA 1LESA 5LWBA 3FLRA 1FV3A 1FPN3 4MGZE 4OI0A 5ABJC 2Y6LA 4FPHA 4HOOA 3IMNA 2CWSA 3W59A 3O1PA 5CFCC 5A3OA 2JDAA 2WO1A 3AKRA 4P00B 1BEV1 3Q8CA 1IPSA 1DGWX 4Y20A 5DAWA 1OLQA 3LFIA 3MIHA 3VBHA 4ATEA 5FZBA 1CX4A 2YGLA 2F17A 3B00A 4I3PA 1C5IA 1SG3A 2VZSA 3AB0A 3N9PA 2WJSA 3IDEA 2A6XA 5C6CA 2G9FA 4OULA 3SEEA 3ZFGC 2GALA 4CCLA 4FO9A 3R4SA 3MW3A 3NV2A 4MX3A 1HXS1 2IXHA 4LJHA 1CZVA 1AX0A 1JODA 1RHI2 1LHNA 2WNUB 1PGL1 4FPJA 3HOBA 1L7RA 2QNKA 4LR4A 4XZPA 1HQWA 1NG0A 4BWOA 5FZ6A 3WDVA 4M4RA 3ZN4A 1JH5A 2Q30A 1CZSA 1YIPA 4Y1UA 4R4XA 4FT8A 2VMDA 1S2BA 1PMIA 2F4LA 4JV4A 4L11A 1QF3A 1LJ7A 2WQZC 2G9ZA 1JS9A 2RR11 4Y4YA 5AC92 2Y6HA 3IDBB 4S2GA 5FPBA 3KLSA 5A7OA 5FPXA 3ZMOA 4AFAA 4LO8A 5D8AB 2DUOA 2E26A 1B35B 3VBOA 2A3YA 1ZNPA 2DWRA 3DUIA 2GMPA 3TAYA 3C7HA 4C91A 2IFRA 1ZBE3 1VIWB 3O0XA 3WG1A 2A1XA 3B7MA 4J25A 3WG3A 4NR1A 2TUNA 2ARXA 3VHNA 4NJ4A 1QOSA 5K0UB 4FOYA 4H14A 3A21A 1KGYA 3VBRB 1AYN2 5FXVA 2VZ1A 4QXHA 3VUOA 1W03A 3JBG3 3T1LA 4MGYE 1G9AA 1UY1A 1JOJA 2E53A 2W0XA 4DRVA 4RHV3 4Q2FA 3G6JB 5FPVA 2W5FA 3PVNA 4LOSA 4RQPB 1F4HA 4YVSC 4BB3A 2ET1A 3ZYIB 1OMIA 3ACHA 3DYOA 2WNVC 1TMF2 1HXS3 1N1SA 4U2AA 2ID4A 3CJIA 3OPWA 3H9AA 4AXOA 5FFOC 1OKOA 1W9SA 1O4TA 1VE0A 1SMVA 2GMMA 4XMIA 4C90A 2PAMA 4WZFA 1UN1A 1RXFA 4LQRA 2ZX2A 1FX5A 1PX3A 5F8PA 2XBO3 4XCAA 1MQTB 2W9XA 3W58A 1SCRA 3I2GA 1LOFC 1IZ3A 2GDFA 1EV13 1ULFA 1DZTA 2CDPA 3VBUB 4AEKA 2WIIB 5JZGA 1YNAA 3IAPA 5FZ4A 4P9JA 4WM8A 5GZFA 4CUAA 2YGMA 1UY3A 1UZWA 2XJPA 1L3JA 2WZR3 1SLTA 3FFQA 4QPGB 1FT9A 1ASJ1 4QQLA 1SBEA 3POSA 1W2NA 2D3PA 5LASA 2P4EA 1F2NA 4BQXA 2R073 1MEC2 4XUPA 1PGW1 2WN3A 5C33A 1ZBE1 1QJY3 2WWSA 3THDA 4CUBA 3EYPA 3LDBA 3O1VA 2C26A 4UW6A 3WEZA 5EXOA 2R32A 1P8JA 2I45A 1J1LA 5FZ7A 5JSOA 2J1SA 1LR5A 4YM0A 3AZXA 3BIWE 4R4ZA 1COV3 2DVDA 1U12A 4IEUA 3KCCA 4PJYA 4B7EA 5A7SA 2VZRA 2JIJA 2ZGUA 3D0JA 3ORJA 4AVCA 3H8RA 3OGGA 2C0ZA 2XQRA 4HSLA 2R061 2B9UA 4YGEA 1GKBA 3AYAA 4QPIA 2EIBA 4TXWA 5A6XA 5F3IA 4I2OA 4BQ5A 4D6RA 4FQ4A 4IV3C 1NZIA 4QD2A 2IXJA 3LCPA 2E33A 3A7QA 3EXUA 3K3OA 2WA3A 5A1LA 1HV0A 2OYZA 2Y60A 4X8NA 5FZ1A 3WW2A 1UO9A 2HWC2 2VCCA 3I2KA 4CP0A 5BUVA 2D6OX 4Y26A 4LO5B 4CU8A 3WR0A 3WNMA 1VBE3 2B39A 3RFRA 3C3VA 4YW6A 2XL7A 3OY8B 3OPTA 2JG9C 1PVC2 2HWD2 3CJIC 4P9GA 1SPPA 1UZVA 5A6ZA 2W2IA 2YV8A 1QJEA 4HPKA 5LY2A 1RUH2 5KHKA 3H1WA 5E1RA 5EV7A 2FBEA 4BMBA 4BXFA 1TNFA 5JOWA 4NHYA 5EP9A 2JECA 3UKTA 4OQ8A 1WD3A 5IVCA 1RVF3 4OUMA 3OJBA 2ES3A 4YGDA 4AFBA 4KGQA 4RGGA 3THPA 4CDQC 4IUGA 4D6QA 3WF1A 1I3HA 4FSJA 1UMIA 1W6NB 2GNDA 2KXLA 3LSDA 5EFUA 2YDEA 3PVOA 3WSOA 2WN2A 1AVBA 1WLDA 2R0FA 4E2GA 1GP4A 1O4YA 4YGBA 1RUE2 1SLBA 4BQ4A 4BLJA 4ORFA 1O6UA 3OOXA 4QDQA 4OQ9A 2B46X 1CESA 2ZGLA 4K6BA 3E5XA 5GJ6A 3VDCA 3FC0A 5IK5A 5JIAA 2K9ZA 3UGGA 1I1EA 1WBLA 3AX4A 3VLBB 1LHOA 1J3QA 2C9KA 2EXJA 4AGVA 1YWKA 1C57A 3RWNA 5L9BA 2XJVA 1G7YA 3OGSA 4D3WA 5CBLA 1NA1A 3IIIA 4N7IA 5CKQA 2RJ2A 3K4AA 5LB6A 2JEMA 3U75A 4JDMA 1S0JA 1LGCA 4ZONA 2W94A 1REFA 1WCSA 4NRPA 1GFF2 2VVEA 2G9GA 3AKPA 4CU9A 3HN3A 3POBA 4XFBA 2VGDA 1BZWA 2BNNA 1ZBA1 1EP0A 1SBFA 2Q1ZB 2WS92 2XKOA 3TN93 5IFTA 3DV8A 4HXCA 5J98B 1XRUA 2QQWA 3WX5A 4AGGA 1QNYA 3MYXA 4YNIA 3LGRA 1OLME 3HMYA 4LEJA 2FMDA 4GULA 4RA0A 1WMXA 3WNNA 5IW0A 4PLOA 2XL9A 5H9SA 1PK6B 2ILMA 2PTMA 2UURA 2VNGA 4UF0A 2WZR1 4D7TA 5IVYA 4ZXKA 5LCWL 1OLRA 4E4SA 1MEC1 3CLPA 1LULA 1H6YA 3M3EA 5I0SA 5KWRA 2VU9A 3RZJA 4AQSA 1ZM1A 2RMU2 3FHIB 1PO12 2X10A 2VMEA 4FAHA 2VC9A 4N7UA 3BOPA 4PIZA 2FHRA 1OUSA 3PTRB 1JN2P 2YFZA 4S2FA 1FOD2 1D2QA 1COV1 1QDCA 5GZCA 1MR5A 4JX0A 4MXWA 2EA7A
chains in the Genus database with same CATH topology
2XR4A 2JDUA 2JDHA 2WR9A 5A6QA 5A6XA 5A6YA 4AOCA 1W8FA 2BOJA 5HCHA 1W8HA 2JDKA 1GZTA 2VNVA 2JDNA 1OURA 5D2AA 1OVPA 2BV4A 2CHHA 2JDYA 2JDMA 1OXCA 4CE8A 2VUDA 1OUXA 5A70A 2JDPA 3ZDVA 5A3OA 2BP6A 3DCQA 1OUSA 2VUCA 1OVSA 2WRAA 1UQXA 2BOIA 1UZVA 5A6ZA 4UT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XR4 A;  2JDU A;  2JDH A;  2WR9 A;  5A6Q A;  5A6X A;  5A6Y A;  4AOC A;  1W8F A;  2BOJ A;  5HCH A;  1W8H A;  2JDK A;  1GZT A;  2VNV A;  2JDN A;  1OUR A;  5D2A A;  1OVP A;  2BV4 A;  2CHH A;  2JDY A;  2JDM A;  1OXC A;  4CE8 A;  2VUD A;  1OUX A;  5A70 A;  2JDP A;  3ZDV A;  5A3O A;  2BP6 A;  3DCQ A;  1OUS A;  2VUC A;  1OVS A;  2WRA A;  1UQX A;  2BOI A;  1UZV A;  5A6Z A;  4UT5 A; 
#chains in the Genus database with same CATH topology
 3MI8 A;  1W2O A;  1HRV 3;  4GJZ A;  1FMD 3;  4DIN B;  5ACA 1;  1CAU A;  3DL3 A;  2GH2 A;  1UD1 A;  1DLC A;  1DYP A;  1AJK A;  4OUE A;  4YW3 A;  2WFF 2;  2R06 3;  1WCD J;  1NCQ C;  2R06 2;  1OBN A;  2GH8 A;  4CUC A;  2X8K A;  4LBK A;  4XBQ A;  2VNV A;  1DG6 A;  1SLC A;  3VZN A;  4MXW B;  3ZXG A;  1SPP B;  3NV4 A;  4A7Z A;  1ZRF A;  3BAL A;  2C5D A;  3PTY A;  3VGI A;  2QQV A;  4YVW A;  2WLP A;  3VL9 A;  2ZGN A;  4YAR A;  5FR3 A;  4FPC A;  2CAU A;  3ATG A;  3M3I A;  5JMO A;  3N35 A;  4PBO A;  2ZPX A;  5A7Q A;  1JXN A;  5JOY A;  3T09 A;  1XYP A;  4JAA A;  3RZG A;  1W28 A;  1MVE A;  1PNF A;  1NT0 A;  3CL1 A;  1UF2 C;  3M8L A;  4I09 A;  4IV1 C;  1OOP A;  4XUN A;  3ZFE C;  5FK8 A;  4A42 A;  2OUH A;  4AEM A;  5FYZ A;  2AEN A;  5C9A A;  3Q8E A;  4LO6 B;  2JEN A;  2ORX A;  1S0D A;  3T2P A;  2W1S A;  3W5N A;  2D98 A;  1S0I A;  1VBB 1;  2RS3 3;  4K40 A;  4EE2 A;  1CAW B;  3A0N A;  4Q8K A;  4S2D A;  5FXZ A;  5E8A A;  2ZKL A;  1H8T B;  3N9L A;  1HDK A;  1W8W A;  4XJW A;  2DUP A;  4Q0Q A;  4DPN A;  1GAN A;  4BM8 A;  2XON A;  5EPA A;  3T0B A;  2Q0A A;  3LA3 A;  3M1H A;  3TOJ A;  5FZA A;  5BY5 A;  5J36 A;  2A75 A;  2WAO A;  2V72 A;  2ETE A;  3ECQ A;  1X82 A;  4IEX A;  5EJ3 A;  1D2S A;  3FL7 A;  1LU1 A;  2P2K A;  2R04 2;  4FI9 A;  5FKB A;  3UGH A;  2BYV E;  3RNS A;  2EF6 A;  4UF0 B;  4Q5O A;  3SKJ E;  1RUG 1;  2D40 A;  4NMI A;  4AGR A;  1W8U A;  3URF A;  4D69 A;  1V6L A;  3FN9 A;  3ZXA C;  2WWU A;  5F5C A;  3GCW A;  1Y7B A;  3MEP A;  3SCF A;  2YFU A;  1O8S A;  4Q1P A;  1V70 A;  1W39 A;  1XE0 A;  3HIF A;  3ZFF A;  4DQA A;  1GNH A;  5F32 A;  4OZX A;  3H3L A;  3OB8 A;  3LF7 A;  4RD7 A;  4DOU A;  3NNG A;  4CEW B;  5FLH A;  1TG7 A;  4CE8 A;  1EAH 3;  2A5Z A;  3D5O A;  2YYO A;  1PO1 1;  3M3O A;  3OPZ A;  3IT8 A;  1W2U A;  2HWF 2;  4QQP A;  1W9F A;  5ANN A;  4FTE A;  1UYX A;  4AI9 A;  1O3Q A;  4W6Y A;  5GKA C;  1OOP B;  3OGJ A;  4HL0 A;  1DZR A;  2PAE A;  2A7A A;  3AP4 A;  1VBB 3;  2RS3 1;  4EN0 A;  4YW2 A;  5FO8 B;  1YQ5 A;  3JD7 2;  4FPK A;  5T52 A;  4MHR A;  1XNK A;  1SEF A;  5C70 A;  3NST A;  2PQQ A;  4N53 A;  5DXD A;  4RS5 C;  1Y9M A;  4Q4W 3;  4AVB A;  4CRQ A;  2DBI A;  4MXV A;  1VB4 A;  5L19 A;  1ULG A;  4DUW A;  2VTX A;  4AFD A;  1XYO A;  4YVW B;  1HB4 A;  3LEK A;  2XLA A;  1Z0H A;  1DIW A;  1H1I A;  3HBK A;  4IEV A;  1RUG 3;  2ZAB A;  3B01 A;  3SIS A;  3HNB M;  4BPZ A;  1GP6 A;  4YG0 A;  1RUD 1;  5FZM A;  4CU6 A;  2QQM A;  3WT3 A;  5BNO C;  5KHH A;  1ZZC A;  5D1I A;  3RI8 A;  4MSV A;  2BJS A;  1T6B X;  2RV9 A;  3NAP A;  4AI2 A;  1GQP A;  1W6O A;  3NO8 A;  1CAU B;  4B4Q A;  5BNP A;  5C3O A;  3VDB A;  2O8Q A;  2VG9 A;  5L7O B;  3LE0 A;  1WLC A;  2WFF 1;  3I8T A;  5FMO L;  1FI2 A;  3E5Q A;  2CDO A;  1XND A;  3AMQ A;  1PO1 3;  1VBC 3;  2DV9 A;  4M0N A;  1YJL A;  2OS2 A;  3I2F A;  3LZZ A;  3WW4 A;  5I0R A;  5A70 A;  3W5M A;  4F3J A;  3BUC A;  1VBD 3;  1RIN A;  1KQR A;  4A41 A;  1RUN A;  4LKE A;  3T0A A;  2Z42 A;  1DGR A;  2E6V A;  4NWW A;  5GLZ A;  5FTT C;  1BK1 A;  4BQ1 A;  5A3P A;  3SLI A;  2XKP A;  1UX6 A;  1YFW A;  2P3K A;  4UT5 A;  5FZD A;  4HT1 T;  3WDX A;  1DZQ A;  2HEY F;  3SCH A;  3ZR6 A;  4RR3 B;  3KT1 A;  4KNC A;  5G04 L;  2NYY A;  4A4A A;  3RZM A;  2Y6G A;  2CGP A;  4QAW A;  3L9J T;  3RZH A;  2HWE 3;  2Y6J A;  2W46 A;  2SBA A;  2RJK A;  1HN0 A;  2VOW A;  4EZ4 A;  2PHD A;  5J48 A;  3OUH A;  2VPV A;  3MUY 1;  1YLL A;  1ONA A;  3H3Z A;  4OHV A;  3FZ3 A;  1UNB A;  3HQU A;  5A7P A;  2E7Q A;  1BKZ A;  1NOV A;  1YXW A;  2A6W A;  3RG0 A;  4BZ4 A;  1IPK A;  4XTP A;  3LPG A;  2BNO A;  5GZE A;  1WUV A;  3BOW A;  3JB4 C;  4EZH A;  1PK6 A;  1ENS A;  4WZC A;  3WQ0 A;  3B5L B;  5FZL A;  2C4X A;  1CON A;  1RUD 3;  1X8E A;  4HVQ A;  4EQV A;  3CQO A;  5FY8 A;  3A22 A;  4LHS A;  4FXG B;  3RYK A;  1D0H A;  4IER A;  3I2H A;  1SAC A;  2RS3 2;  4AED B;  5DZE A;  2Y6F A;  2VMG A;  2WFF 3;  2C6S A;  1AYN 3;  5FPA A;  2RDR A;  3NVC A;  1CIW A;  1VBC 1;  5ABJ A;  4ZKT B;  3OYW A;  4M3C B;  4BLI A;  1R09 1;  2HBT A;  1QJU 2;  3POJ A;  2N7G A;  3VZK A;  2BV4 A;  2W95 A;  3OD0 A;  1PZ9 A;  4HG6 B;  2IXI A;  2GC2 A;  5DAB A;  3EO6 A;  2D97 A;  2AYH A;  3OG2 A;  5CB7 A;  2J1U A;  5CG8 A;  1TMF 3;  2CWM A;  4IV1 A;  3ZFE A;  1H4H A;  3IDA A;  4RQP C;  2VZ3 A;  5A32 B;  1X33 A;  2BUK A;  4IDZ A;  5FOJ B;  3ZPO A;  1W6N A;  1W6P A;  4X8P A;  5CU1 A;  4QDS A;  1RJ8 A;  4AAX A;  2JDH A;  1RUJ 2;  1XB9 A;  5E16 A;  4RQP A;  3FE5 A;  4A7K A;  1G9F A;  2PLV 1;  1CAX B;  2WNV A;  5H9R A;  5KXB A;  1W8T A;  2X29 A;  4BK4 A;  3WV6 A;  2KM2 A;  2DDU A;  5GLV A;  4DO0 A;  4W6X A;  1WMF A;  3FLT A;  4LBQ A;  4L99 A;  1MQT C;  2QQN A;  2RM2 2;  3ZSL A;  4AI8 A;  5F3C A;  1EUU A;  3VV1 A;  2ZGT A;  3WF4 A;  1K5M A;  1MZE A;  4EN8 B;  5FUN A;  3EJK A;  3S6P A;  1AR8 1;  1OD3 A;  3K77 A;  2BVV A;  4KMQ A;  3D4K A;  3J7L A;  2D6L X;  3JUU A;  4PIY A;  5IVJ A;  1CX1 A;  1DBN A;  1Z7S 3;  3KD4 A;  3MPP G;  2ZX0 A;  2D5H A;  3NJV A;  4B3N A;  3VHP A;  4XBN A;  4L2N A;  3AZW A;  1V6O A;  2R04 3;  1N1V A;  1OSG A;  4RFT 0;  4E2S A;  3UET A;  3LDR A;  4BE3 A;  2TBV A;  2BVB A;  3KGZ A;  2VCB A;  4OHW A;  2UY9 A;  4AOC A;  4YZ3 A;  1ND3 B;  2BNM A;  2BRT A;  2Q1M A;  5JXH A;  3S30 A;  2Q8D A;  1O5U A;  1Q8V A;  4KI5 M;  3T30 A;  1GZW A;  4UOJ A;  1O3S A;  5I91 A;  4N9H A;  2QQO A;  4XQ4 A;  2EVX A;  2RJL A;  5LZ6 A;  4ZPI A;  4ZU5 A;  2D3S A;  2IUW A;  2P34 A;  3AK0 A;  4X6Q B;  1SLI A;  3VKL A;  4MV2 A;  1EAH 2;  4WM7 A;  1XE8 A;  3POI A;  5FUI A;  1POV 0;  5TSW A;  3TNQ A;  3RGB A;  4MGI E;  3IIA A;  1QJX 3;  1UMH A;  2H0V A;  1W05 A;  4G9S B;  4YWA A;  4XC9 A;  3GM8 A;  4EN7 B;  2ZJC A;  3ILF A;  5F5A A;  2PLV 3;  2J1T A;  4PDW C;  1JZ2 A;  2RDQ A;  3GJA A;  3U4X A;  3ZYG A;  1YC6 1;  3SIT A;  3W20 A;  1K42 A;  3SCG A;  1STM A;  1RUH 3;  4SLI A;  3BN6 A;  1R09 2;  3CJI B;  5FO7 B;  2ZXQ A;  1RJ7 A;  5EYY A;  5LBE A;  5FWE A;  1SFN A;  4MHU A;  2JIC A;  1H0B A;  4QWN A;  2RS1 2;  1MS9 A;  2DFC A;  3AKQ A;  3ZDV A;  5C71 A;  1XXN A;  3H50 A;  1ZZ8 A;  2RR1 2;  1UKG A;  1ZA4 A;  4TLG A;  1MS3 A;  2I07 B;  2QVS B;  3ES1 A;  4JGZ C;  4LIU A;  4UW3 A;  4LTA A;  1T6G C;  1YFU A;  2J1V A;  4LKD A;  5BXX A;  5FZI A;  5T5P A;  2EIG A;  1UXX X;  3VBF C;  1EPW A;  4RS5 A;  5A32 A;  2QZ2 A;  3OUI A;  4XUO A;  5JR2 A;  4HON A;  1MZ5 A;  1QXP A;  4XFG A;  2PHL A;  3S57 A;  1JW6 A;  3KF3 A;  2JDK A;  1VRH 3;  1LOC A;  4FFI A;  4LBL A;  3MLK A;  3U11 A;  2D7F A;  1A34 A;  1C4R A;  4WVM B;  2Y8K A;  5JXI A;  4Q4Y 1;  2CYF A;  4Y3O A;  1JZ6 A;  1GQG A;  3E5U A;  2YXS A;  5EZW A;  1DDL A;  1JHN A;  4Y5S A;  5FP7 A;  4CCK A;  4W8J A;  5D8A A;  2PXJ A;  1DQ0 A;  2OQ7 A;  4OMC A;  4M3C F;  4HMZ A;  4XUT A;  2ZBJ A;  2ADD A;  3WZ1 A;  3ZM8 A;  5IHR A;  1PGW 2;  2BFU L;  2Y38 A;  4QKD A;  1LNS A;  2W1U A;  4E8D A;  3HVD A;  2FDG A;  5CFD A;  4CXY A;  2C9A A;  2CNA A;  1UMZ A;  2JG9 A;  4YM1 A;  4WM7 C;  1PHM A;  4LOR A;  1FPN 2;  3WG4 A;  4K1Z A;  4Q4V 3;  4IV3 A;  4XF0 A;  4CCM A;  5LAT A;  4R52 A;  5LBB A;  1UU5 A;  4ZS3 A;  5A1F A;  4B1L A;  4D8M A;  5F37 A;  2D44 A;  1TNR A;  2ZHK A;  3F95 A;  1PVX A;  2ZTN A;  3UYJ A;  5BNN C;  3H0O A;  2W91 A;  1ACC A;  1RUG 2;  3PME A;  4URT A;  4XQW A;  1MS1 A;  1CIY A;  1S1A A;  2VNO A;  3K4D A;  3G7D A;  3VBO B;  3IB3 A;  3AM2 A;  1OXC A;  1EUT A;  2JG8 A;  3FHQ A;  3H42 B;  4B4P A;  2AH2 A;  4GZ9 A;  2GP3 A;  3N9O A;  4QX0 A;  5FYV A;  4YM2 A;  1AR8 2;  4QPI B;  4CDX A;  1JZ8 A;  1CR7 A;  1XSR A;  1Y43 B;  4NWV A;  5DUW A;  2VOV A;  2GAU A;  4IGP A;  1BQP A;  4IW3 A;  2AZ5 A;  4QU2 A;  2OA2 A;  2RMU 3;  4NE9 A;  4XZU G;  3UL2 A;  4QX1 A;  3WW1 A;  4CZS A;  4WBB A;  1ZZ7 A;  1N3O A;  1CPM A;  2NMN A;  1VLN A;  2J42 A;  3TN9 2;  2WS9 3;  5IVF A;  2XH6 A;  1LHW A;  2YBS A;  3LOI A;  3SHR A;  3NKG A;  3I7D A;  3JBG 2;  4PF1 A;  3FHA A;  4K20 A;  4PBP A;  1JYV A;  2DYC A;  1VJ2 A;  5I93 A;  4GH4 C;  3TYJ A;  4CCO A;  1YQ6 A;  3OBT A;  2BGC A;  3IZO A;  4RHV 2;  4ZHN A;  2P3Y A;  4QXB A;  3AFG A;  4YM3 A;  2W3J A;  1DQ4 A;  5LEK A;  1UU4 A;  2VCA A;  4F8A A;  3DCQ A;  3KS7 A;  4L9B A;  4GWI A;  1WCK A;  4JRL A;  4CDU A;  5F1R A;  1W6P B;  5JZG B;  1AR6 1;  4BQW A;  2QQP A;  3AVR A;  2LRP A;  4SBV A;  2HWC 1;  3ILR A;  3J8F 3;  4KBB A;  4AHW A;  1A3K A;  2H0B A;  1RUE 1;  3TWI A;  4AK3 A;  1OI6 A;  1Q8P A;  5BNP C;  1EV1 2;  4IEP A;  1RTV A;  4H7M A;  2D43 A;  1PVC 1;  1W04 A;  1GU3 A;  4MVT A;  1XNA A;  3OGR A;  2JDM A;  1BHG A;  1RUH 1;  2UWC A;  3BCW A;  1JOB A;  1QIQ A;  1ZRI A;  2WA4 A;  3KF5 A;  1BMV 1;  1AXY A;  5AVA A;  2B4K A;  5KHI A;  2DVF A;  4ES8 A;  5T50 A;  4UW4 A;  4IE0 A;  3ZXD A;  3DN7 A;  5JCT A;  2Z69 A;  5IJR A;  4KU7 A;  4BK5 A;  1OQD A;  4QGN A;  1OA4 A;  2XDV A;  4AI0 A;  1NQJ A;  1D4M 2;  2WS9 1;  3BGA A;  4HFS A;  3SH3 A;  3O1O A;  1JZ3 A;  1O8P A;  2HBU A;  2R6Q A;  2GN7 A;  2YBK A;  5CFC B;  5DDJ 3;  3O1M A;  1UIK A;  3DXT A;  1APN A;  3K2O A;  4XVH A;  1QKQ A;  1LAJ A;  3AMN A;  1JBC A;  3OTF A;  4XHB A;  1L7Q A;  3ZIX A;  2XJS A;  2Y33 A;  1NX9 A;  1H6X A;  3OYW B;  3VD4 A;  4QT6 A;  2XUM A;  3AYE A;  4Y24 A;  2RDS A;  2YC2 A;  4CEW A;  2AC1 A;  1UL9 A;  4BIO A;  3NNM A;  1HQL A;  5CKN A;  3P1I A;  1RMU 1;  5IVV A;  1UKR A;  3ZDS A;  2C1F A;  2HWC 3;  4QHO A;  4Y1V A;  3RMY A;  4CCD A;  2RG4 A;  1PMJ X;  3ETQ A;  3MIE A;  2O14 A;  3FX3 A;  4LO4 B;  1LTE A;  2VVF A;  2QDR A;  5A6Q A;  2WYF A;  3KMH A;  3VZJ A;  5GZD A;  4CEW C;  1UW8 A;  4CXX A;  2HWD 3;  4DMI A;  4COZ A;  1IPJ A;  1RHI 1;  4Q4V 1;  5AFB A;  1UCX A;  2IXL A;  2XQX A;  4IL7 A;  5LY1 A;  2WL1 A;  5K4L A;  5KR7 A;  5SV8 A;  1J83 A;  4FTB A;  4JKL A;  3ZYB A;  4C1W A;  1C1L A;  2UY8 A;  4MG2 A;  3SMH A;  3GHM A;  1HKD A;  3LWC A;  5L7O A;  3THC A;  4O7X A;  1ZVF A;  4CP1 A;  1V6I A;  2BGO A;  3B69 A;  3ZN6 A;  4E27 A;  1B35 C;  1RUF 1;  2NMO A;  3ST7 A;  5CEH A;  3VD5 A;  2G19 A;  4XFI A;  1QEX A;  4N8M A;  3TNP B;  3F2Z A;  3L2Y A;  3OBA A;  4FP3 A;  4XF4 A;  2P3I A;  2WO3 A;  3OBZ A;  4FFH A;  1AR6 2;  3O0W A;  4CU7 A;  5DZF A;  5K0U C;  1MS0 A;  3T4V A;  3ZXL A;  3J4U H;  2RMU 1;  2XWJ B;  3VBR C;  3PHM A;  5C9A B;  3DGT A;  5K8S A;  3PUI A;  3IDC B;  1FOD 1;  3ACG A;  4NHL A;  3K3N A;  5CFD C;  1KXG A;  4Q29 A;  4AVV A;  4AQT A;  3VZO A;  5CAD A;  1LGB A;  2FCU A;  3CF6 E;  2YMZ A;  1ST8 A;  2VUD A;  4N43 A;  1RC6 A;  4N43 B;  3I3D A;  4YVS B;  4ARX A;  2QQI A;  1CAX A;  2WNV B;  3OBR A;  2BEO A;  3PVE A;  5ACA 3;  5IK7 A;  4D7Y A;  2ZZQ A;  3RJR A;  2HLE A;  1BYH A;  3GXU A;  1AF9 A;  2VQU A;  1GYK A;  1MPX A;  2UYA A;  2VTX J;  2ZGO A;  1J84 A;  4AG4 A;  4CDW B;  4LIV A;  5JAX A;  1RYY A;  5C7G A;  4BDV B;  1RIR A;  5F7U A;  3N9Q A;  3KHC A;  4LPL A;  3ZFF C;  4EWA A;  1HV1 A;  5JDB A;  2NN8 A;  4CDX B;  1PIV 3;  4QDR A;  4M00 A;  2OZ6 A;  2CHH A;  3KVA A;  3VZL A;  1RXG A;  4GB3 1;  4QPG C;  1KS5 A;  5DAQ A;  4TSV A;  5GLT A;  2CU5 A;  1XNT A;  1RUF 3;  3D6E A;  4Y1Y A;  4AI1 A;  5DUV A;  3ZSJ A;  5AC9 3;  4DEV A;  1OC1 A;  2BPA 2;  3I59 B;  1BMV 2;  4IND A;  2DVA A;  3AC0 A;  1AL2 1;  2JG8 C;  1JZ5 A;  1V9U 3;  4CA9 A;  4FOQ A;  3GNE A;  4IXL A;  1DU3 D;  2DCY A;  5IT6 A;  4P9W A;  4COV A;  5C5U A;  4QQH A;  1NLS A;  4U36 A;  1VBD 2;  1GOH A;  1WLT A;  2ARC A;  3JCI A;  1LEM A;  3B9I A;  3POY A;  2QQU A;  4NAM A;  4PIX A;  5DDJ 1;  4R9A A;  5FZG A;  1IS3 A;  1QDO A;  2CGN A;  4A2U A;  4WM8 C;  5IAV A;  1Y9G A;  4XAE A;  2EIE A;  5FLJ A;  1R1A 1;  3RYP A;  1RGS A;  5C8C A;  1HJG A;  2Q4S A;  1BJQ A;  5FYU A;  3T1M A;  5C3R A;  2XHN A;  1NLQ A;  4DNY A;  4JKM A;  2VMC A;  3B3Q E;  3NNF A;  2A6V A;  1PZ7 A;  4KWK A;  1JI6 A;  3KV4 A;  3ZKU A;  4NHX A;  4NOT A;  3POE A;  1ENR A;  3BTA A;  1XJA A;  3J8F 2;  3NV3 A;  1CPN A;  5J37 A;  4LT5 A;  3OEA A;  2HYK A;  1RIT A;  4QB1 A;  2OZJ A;  5HXM A;  3TEY A;  5IAX A;  4YVS A;  5C5T A;  2HWB 3;  2ZGR A;  3VBS B;  4GB3 3;  4LXL A;  5F5Q A;  5E6H A;  2ZAA A;  2NQY A;  4UAP A;  1OVP A;  4TLF A;  1ZYB A;  1HRI 3;  1KFU L;  2JIG A;  3EQE A;  2VD7 A;  1DQ2 A;  3J26 N;  4E4D X;  1VBE 1;  4ES9 A;  2Y64 A;  3H1Y A;  4O9G A;  3WOG A;  4NRO A;  1C5H A;  3FUQ A;  3LEG A;  1E5I A;  4K21 A;  4LBQ D;  5LBF A;  2RS5 3;  1MS8 A;  4V2V A;  3W21 A;  3ZYF A;  1V9U 1;  4F83 A;  4LUK A;  4YYO A;  2YBP A;  3UK9 A;  2ARB A;  3VBF A;  3TEZ A;  1PNG A;  3MPB A;  1UZ0 A;  4GMP 1;  3MF6 A;  4J6G A;  3ZIW A;  2XR4 A;  1NKG A;  1O7F A;  3WDU A;  5FLI A;  5FK7 A;  2D6K A;  3RS6 A;  1RVF 1;  1XOY A;  4JDN A;  4HET A;  2CL2 A;  1YEW A;  1SFY A;  2E9Q A;  4L92 A;  1GBG A;  4XIO A;  2LTN A;  1OH3 A;  5F3G A;  4YW5 A;  3VHR A;  1FPN 1;  3D82 A;  3CHX A;  2ZX1 A;  1ZX5 A;  3S0M A;  3POF A;  5FY0 A;  5J1X A;  1HRI 2;  4YW4 A;  2G4I A;  3WLU A;  4QQO A;  1EYB A;  4LA3 A;  5A3L A;  5CAZ A;  3N9N A;  1ND3 C;  3WUD A;  5JOZ A;  4BJ0 A;  2R49 A;  2VOK A;  1BEV 3;  1Q8O A;  1AXK A;  2QJV A;  2YU1 A;  3IM0 A;  2ORZ A;  2RVA A;  3DPR C;  4FQZ A;  1DGR N;  3WXP A;  4KWU A;  2VW0 A;  1AR7 3;  2XVL A;  1AZD A;  4YZ4 A;  3ZN6 B;  3AL6 A;  4Q0U A;  4QPW A;  4B29 A;  2XXZ A;  3MF9 A;  1U5Z A;  4XIK A;  5LRS A;  2VO5 A;  2TEP A;  1VR3 A;  1H9W A;  1LOD A;  5FKC A;  3U37 A;  3VBH C;  4FBF A;  2XOM A;  1ZBA 3;  5FDB A;  1PK6 C;  2RS5 1;  3K75 B;  4CP9 A;  4YW1 A;  2BU9 A;  5IYY A;  5FMD A;  3JD7 3;  4NHM A;  3AP9 A;  4IEQ A;  5FZF A;  3C7G A;  5T5L A;  2JKX A;  1UX7 A;  3CDZ B;  2FMY A;  2JX9 A;  1ULO A;  4HK8 A;  3VDD B;  2VR4 A;  2OKX A;  3DEC A;  1WA6 X;  1QQP 3;  1UOJ A;  2ADE A;  1AHS A;  3MUZ 1;  2VNR A;  4C1X A;  4PQQ A;  1H1A A;  1NXM A;  1AR7 2;  3U14 A;  1JYW A;  1N1T A;  2UYB A;  5LK7 B;  2Y6K A;  3LEI A;  1AUY A;  2TNF A;  4Y5Z 0;  1I6X A;  1RUC 3;  4M01 A;  4WVM A;  4NIA A;  3LDK A;  1SDW A;  1SFP A;  1B09 A;  3IPV A;  2JB4 A;  1R1A 3;  5BPX A;  2BP6 A;  5FYC A;  1OFS A;  2EIC A;  1GSL A;  1UPS A;  3N7J A;  4COU A;  2GC1 A;  4DXZ A;  1JYI A;  1ZRC A;  4JGY C;  1J1T A;  1V6J A;  1FMD 1;  1PZ8 A;  3OGV A;  4LHN A;  5HV4 A;  3U0Z A;  2PHW A;  3HT2 A;  1QJU 1;  1V00 A;  5HCB A;  3SEP A;  2A6Z A;  1HB3 A;  2D6M A;  4PI2 A;  4LBO A;  1N3P A;  2PA7 A;  1MAC A;  1RVF 2;  1RUO A;  3GBW A;  3M7A A;  3V64 A;  5JI7 A;  4D0Q A;  5CIS A;  1VPH A;  5FOB B;  5J09 A;  1ALY A;  5K7P A;  4JTN A;  2KD7 A;  4XQD A;  5FY5 A;  3OUJ A;  4YW7 A;  3GDB A;  4NII A;  3NQH A;  2BWC A;  1XNC A;  2GNB A;  3MIF A;  4WM7 B;  1RB8 G;  1GOG A;  1UYP A;  2Q1F A;  1LU2 A;  2B9V A;  2WNU A;  1F8V A;  4Q1R A;  1E5R A;  5I8S A;  4CTE A;  3W9A A;  4AHX A;  4Q4X 1;  5A3N A;  4CCJ A;  1NUK A;  3MZH A;  4NAO A;  1QQP 1;  1B35 A;  2PQS A;  2V09 A;  5I0U A;  1R64 A;  5BNQ A;  3P5B A;  5E89 A;  3WF2 A;  1ZRD A;  4LA2 A;  1WCU A;  4RFR B;  1YI7 A;  3R05 A;  4XF9 A;  3OD4 A;  2PHF A;  2VCM A;  4JVA A;  3UKV A;  4ATF A;  1G8W A;  3MIB A;  1W9T A;  2VZQ A;  4ZXE A;  1RUC 1;  2H6C A;  4GXL A;  4E2Q A;  1GNY A;  3GAL A;  1ZRR A;  4XHX A;  1ND2 A;  1OT5 A;  3R0R A;  5DQ0 A;  2ZAH A;  4EJR A;  3DPR A;  3N7L A;  3P3P A;  5KHG A;  1ZZ6 A;  4A3X A;  2XUE A;  4H55 A;  2VXJ A;  3KHB A;  4QGL A;  1A6C A;  1YRZ A;  2XB6 C;  5FPL A;  3UES A;  4AZZ A;  1ND2 B;  4RGA A;  3WNL A;  2YHJ A;  4UWD A;  1QOO A;  1PX4 A;  1ULC A;  3AVS A;  1UPI A;  4ERO A;  4HVR A;  5IVE A;  2AR6 A;  1FNZ A;  3UKN A;  2JWP A;  5FWJ A;  1WD4 A;  5F3E A;  1E57 A;  2FCT A;  1J58 A;  5A7N A;  5F5I A;  3NMB A;  5FMC A;  2VBB A;  3CKH A;  4RL7 A;  3NAP C;  5T5J A;  3AL5 A;  5D2A A;  1XBF A;  5FZC A;  4H7L A;  3VBU A;  3A4U A;  5FJK A;  3AP6 A;  4E4Z A;  3EBR A;  1OA3 A;  4Y33 A;  2A6Y A;  4Y1Z A;  1O3T A;  2MEV 2;  3PJQ A;  1WA4 A;  2MEV 3;  1N3Q A;  3O0V A;  1CAV B;  2F6B A;  2CAV A;  3CJX A;  1PO2 1;  2LUW A;  3R6S A;  3JD7 1;  2OPW A;  4UFK A;  1UQX A;  1LCL A;  4GWN A;  4RS5 B;  3USS A;  4JHT A;  1QXJ A;  4PCR A;  1UOF A;  4LOT A;  4CDQ A;  3K46 A;  5FUP A;  2MNG A;  5A6Y A;  4BCU A;  4XJ8 A;  5T54 A;  2VW1 A;  1CAV A;  1YQC A;  2WAB A;  2DCZ A;  3IPV B;  1QJY 2;  2BOJ A;  1DF0 A;  4UFM A;  1JUI A;  4UBH A;  4Z07 A;  5GAL A;  3P6B A;  5A3W A;  3I49 A;  2ZEW A;  4E9K A;  4B1M A;  4IE7 A;  2ZEX A;  4DFS A;  2OVU A;  3UJO A;  2WO7 A;  4O9E A;  5BNO B;  5JXJ A;  4A6O A;  1BLZ A;  1O4Z A;  1Y9Q A;  3K51 A;  1HN1 A;  4DS0 A;  5JMC A;  4P9I A;  2GME A;  2Y26 A;  5JIU A;  4GQ7 A;  1DYK A;  2ZMN A;  5FP3 A;  3ZO0 B;  4P9Y A;  4GMP 0;  4CPB A;  2O0O A;  1MZ6 A;  5JPN B;  1PM7 A;  1UAI A;  3MGU A;  4KWJ A;  1Q8Q A;  3I2O A;  1LEC A;  4LNV A;  1BXH A;  2E32 A;  4OLL A;  1WMD A;  2I2S A;  3DEM A;  5EQU A;  3AP7 A;  5B4N A;  3HWJ A;  4Z1V A;  4Q0S A;  4IEY A;  4AR2 A;  4CVU A;  1W8H A;  4IET A;  2P6H A;  5FYT A;  1C8M 3;  3RYR A;  4XBL A;  4YZ5 A;  2IZW A;  3MLJ A;  1RUC 2;  1X7N A;  5FO9 B;  2LRO A;  1ENX A;  4RR3 C;  4XUR A;  5JWP A;  3WW3 A;  3IKW A;  1ZBA 2;  3TN9 1;  5T3N A;  1COV 2;  1OUX A;  4Y1X A;  5DDJ 2;  5H9Q A;  3TB0 A;  1JOP A;  2LW8 A;  3GGL A;  2AUY A;  2LS6 A;  2FDI A;  4XDQ A;  4NPM A;  1CZT A;  2VUC A;  1HW5 A;  4NO4 A;  5IWF A;  4A3Z A;  4A7Y A;  4XF3 A;  3J7H A;  5EYX A;  4DXS A;  1CJD A;  1BK0 A;  1V6M A;  2WSU A;  3AP5 A;  3KQ4 B;  1CJP A;  1S0C A;  2OXB A;  3GYD A;  4K8R B;  4ZU4 A;  3SH5 A;  4BQ3 A;  5A1A A;  4QB6 A;  4MOA A;  2SLI A;  2LM3 A;  2VBP A;  4JDO A;  4EWE A;  2HWE 1;  3U4S A;  2XML A;  1GZ9 A;  2WZR 2;  1W6M A;  3MO4 A;  3VKO A;  2VQ0 A;  4UBG A;  5FP4 A;  5J3U A;  5KC6 A;  5T55 A;  2X09 A;  2JDN A;  3PUH A;  1MEC 3;  4M4P A;  5FAX A;  4P9L A;  5CZK A;  1Q56 A;  4KQ7 A;  3ES4 A;  4AED C;  3MFC A;  3ZSE A;  3JQX A;  1W2T A;  2HWF 3;  2HEV F;  4BA6 A;  1YHF A;  2O8O A;  3EHK A;  2D5F A;  5IVB A;  4LHL A;  1NY7 1;  3MW4 A;  3ZXJ A;  2WDB A;  5FYS A;  5FPZ A;  2FQP A;  3V56 A;  1IKQ A;  5CFD B;  1VBB 2;  2VJX A;  1V6N A;  1XC6 A;  3O7O A;  1CGP A;  2ZGS A;  3Q8B A;  5F6K A;  5HCF A;  1Y3T A;  2E63 A;  3T2T A;  3UJQ A;  4N43 C;  3I4I A;  3AXD A;  3ALQ A;  2X5I B;  4QM9 A;  5JXG A;  1SLL A;  3DXU A;  4YG3 A;  3ZYP A;  1F5F A;  2X05 A;  3I97 A;  3WY6 A;  4KG0 A;  3USU A;  2PMW B;  3TEX A;  2DU0 A;  3BTZ A;  1J3P A;  4AAP A;  5JR7 B;  4FFF A;  3UGF A;  4DY3 A;  5FMO S;  4ZZ8 A;  1LED A;  3AFK A;  5FCC A;  3N3H A;  4BIF A;  4YZ2 A;  5C4W C;  2ZCW A;  4N9I A;  2PN5 A;  2LAL A;  4L97 A;  2PYT A;  4Q8L A;  2MEV 1;  3WDW A;  1PM4 A;  4NN0 A;  1DLL A;  3ZFF B;  1K5J A;  4G4F A;  5CIR A;  1ENQ A;  3WF0 A;  1LRH A;  4CDX C;  2K0G A;  4N53 C;  3ZX7 A;  4DZG A;  1SBD A;  3KV6 A;  5FZK A;  1ASJ 2;  4LIT A;  3NJY A;  4COW A;  1ASJ 3;  1GUI A;  3FLP A;  2QZ3 A;  1GOF A;  4AQ2 A;  3VD3 A;  4OYU A;  4HLT A;  1F35 A;  2ZX4 A;  3PL0 A;  1IG0 A;  2XVK A;  4Y22 B;  5A3T A;  4OHY A;  1URX A;  1F5J A;  2HWF 1;  5L73 A;  4ASL A;  1QH7 A;  2VEC A;  1QJF A;  4Q4V 2;  3ZXE A;  5F2W A;  2VQA A;  1POV 3;  1GP5 A;  2VUL A;  4TYS A;  1YI9 A;  5LA9 A;  4Y22 A;  2R04 1;  1L7L A;  1PIV 2;  2IVJ A;  3HQR A;  2VZO A;  2G1M A;  1H1M A;  1AL0 G;  4JHZ A;  2VL4 A;  1RL3 A;  4IE5 A;  5FYY A;  2J1R A;  2XVG A;  5D21 A;  2OQ6 A;  2JB8 A;  2FDJ A;  3C2U A;  3BVC A;  1F31 A;  2YRO A;  5AVP A;  1IS5 A;  4DRR A;  4IE4 A;  3V0B B;  4XDO A;  4GWJ A;  2WBK A;  4Z92 B;  4A45 A;  2WLQ A;  4JZR A;  3WNK A;  4JKK A;  3C7O A;  5DUX A;  3ZYR A;  2A73 B;  1C8M 1;  1OLM A;  1TME 1;  1XU2 A;  4H3W A;  2NP0 A;  5DG2 A;  1H9P A;  1UY2 A;  1ZBE 2;  2R0H A;  3GJB A;  1GZC A;  2RE9 A;  3CZU A;  4AQ6 A;  2JKB A;  4AW7 A;  5A33 A;  1NA1 C;  4D7S A;  1W6O B;  1Q8S A;  2BTV C;  2P17 A;  4XJA A;  4XMA A;  5SV5 A;  2JXA A;  1JHJ A;  4HVO A;  1IOA A;  4YPJ A;  2ZHN A;  1K5M C;  1KIT A;  3ZSK A;  2CY6 A;  2WQ4 A;  3J7N A;  5EWS A;  5JSP A;  3VBS C;  2IC1 A;  3H3U A;  4Y20 B;  3BPS A;  3KGL A;  4COY A;  2PHU A;  5FZ3 A;  3LOB A;  1W3V A;  4HKW A;  5BNN A;  1SCS A;  2R07 2;  1DGW A;  2ZA9 A;  2W1W A;  1YQ8 A;  3VKN A;  2VZV A;  1C28 A;  3EMR A;  1M4W A;  3LPF A;  5FZ0 A;  2WZ8 A;  1A78 A;  3IN9 A;  3I2D A;  2HWE 2;  4Q4W 1;  5I0D A;  5KXE A;  4XW3 A;  1H2M A;  1WW5 A;  2QKD A;  1DYO A;  3VBF B;  1LOF A;  3NNL A;  2Y0I A;  1DQ6 A;  4K9S A;  5DZG A;  4AHZ A;  4TTG A;  2E31 A;  3BU0 A;  2BER A;  3KZ4 C;  2XJT A;  4QGM A;  5A3U A;  3CIH A;  4JGY A;  5IK8 A;  4WVV A;  3M70 A;  1OH4 A;  5LA2 A;  1NYW A;  4CDU C;  1MVQ A;  5C3Q A;  3S7E A;  2IXK A;  1RUJ 3;  2ZGP A;  1IGO A;  1TQ5 A;  4Q4Y 2;  1AR9 1;  1H30 A;  3SKV A;  1WGP A;  3JZV A;  1YJK A;  3LIG A;  1W8F A;  2F4P A;  3AJZ A;  2ZGK A;  4LK6 A;  3AYD A;  3WF3 A;  1F9K A;  1AL2 2;  1GZT A;  1DGL A;  3JXS A;  4IE6 A;  4MET A;  5KHJ A;  1S2E A;  1US2 A;  3PIG A;  1UZY A;  3POW A;  3M4F A;  3Q8A A;  1CWP A;  5AFE A;  2DCT A;  3JU9 A;  1W0N A;  1VBD 1;  4NVP A;  2YC4 A;  3ENR A;  4KWL A;  2FZ2 A;  1NZC A;  5BV6 A;  2VVD A;  3PUA A;  2GZW A;  2WQ8 A;  1XNB A;  5FZO B;  3PDQ A;  4CCE A;  2C24 A;  3EB7 A;  3GBF A;  1RED A;  3RWK X;  3PLQ A;  4W50 A;  3PU3 A;  3VBO C;  1UYY A;  4B4R A;  4MGT A;  3I3E A;  3M3C A;  4WVZ A;  4XTM A;  1K12 A;  1RUI 2;  3ACL A;  4L0P A;  5FZO A;  2HYX A;  2PEL A;  1JYT A;  5FQ0 A;  2QQK A;  5B2G B;  5HCH A;  1S0B A;  3HJR A;  1S4C A;  2FDK A;  4LE3 A;  5C8C B;  3U78 A;  2PFW A;  2J7M A;  1PGS A;  2YY1 A;  3WUC A;  4XAB A;  3O1U A;  1CVN A;  1DQ1 A;  4LKF A;  3VDD C;  3O14 A;  3VL8 A;  2FZ1 A;  2P1B A;  5FZE A;  4D94 A;  4OI4 A;  4ZS2 A;  3MHZ A;  2ET7 A;  4PF5 A;  1BVP 1;  2I74 A;  3QAC A;  2CGO A;  2WRA A;  2ZGQ A;  1H8T A;  1RUJ 1;  4GH4 B;  3H8X A;  3HPN A;  4OUS A;  5D8A C;  4HBN A;  1POV 1;  5KXC A;  3K48 A;  5ACA 2;  3JBG 1;  3MFA A;  2ZAC A;  2ZML A;  4I01 A;  1PO2 2;  2K2S A;  3NRU A;  1R1A 2;  3PU8 A;  1AYN 1;  4XJZ A;  1SLA A;  4RHV 1;  1IS6 A;  1F15 A;  2ZZJ A;  4LHK A;  1X36 A;  4CSW A;  3ITQ A;  5G05 L;  4R9B A;  4UFL A;  5F2S A;  1AYM 2;  5IUQ A;  2WWJ A;  4Q4W 2;  2K46 A;  3H7Y A;  3KCY A;  5FBJ A;  3USU B;  4JGY B;  4FPY A;  3NJZ A;  4EYU A;  2OW4 A;  4FAG A;  5FY9 A;  2VQT A;  2V5D A;  4GAL A;  5F9T A;  5JOX A;  5BNP B;  5CA6 A;  1TMF 1;  1TME 3;  3KCX A;  1TME 2;  2YB7 A;  1J59 A;  5I0T A;  3VD9 A;  4ARY A;  1UYZ A;  3HR9 A;  1WW4 A;  2DTW A;  1JYN A;  4UFJ A;  3BB6 A;  3U10 A;  3KVB A;  2AEY A;  1EV1 1;  1OHF A;  1NXD 1;  1KDK A;  1KEX A;  2ZKN A;  3B93 A;  3QD6 A;  5DAV A;  5HXV A;  3TEW A;  3CNA A;  1H2K A;  2H6B A;  3C7F A;  2W52 A;  1SHW B;  4HSJ A;  2MHF A;  1H2L A;  5FXX A;  1DP0 A;  1YYN A;  2R07 1;  4KU8 A;  1PVC 3;  3RJ2 X;  4OI2 A;  3WP6 A;  1UXZ A;  4XFC A;  3MBW A;  4YSF A;  2ZMK A;  3E6C C;  3O12 A;  3HNY M;  1WLW A;  1QJZ A;  4BQ2 A;  4LBJ A;  4LLO A;  2W39 A;  1R1Z A;  1LEN A;  1Z78 A;  3AYC A;  3GZT B;  3KT7 A;  1JYC A;  2V4A A;  3E1F 1;  3CU7 A;  2CV6 A;  4R9C A;  3K4Z A;  2WT0 A;  1HRV 2;  2RHP A;  4PQ9 A;  1TZO A;  4QKN A;  3ROU A;  5KBF A;  1VBA 3;  4QU1 A;  1EY2 A;  1IQA A;  1GZW B;  5HV0 A;  2EID A;  2Q8C A;  4NHK A;  3SXW A;  1HB2 A;  1GNZ A;  4HK9 A;  3KV9 A;  1FV2 A;  3ZFG A;  3P3N A;  3NKT A;  3WQ1 A;  5LK5 A;  3ZLI A;  4GD4 A;  4N90 A;  4AI3 A;  1AR9 3;  4OMD A;  3WP3 A;  4OHX A;  1AR9 2;  4OVE A;  4XXA A;  4ONU A;  2GSY A;  2QCS B;  2BFU S;  2GC3 A;  4BXS V;  3BTX A;  1GWK A;  4IES A;  2DCJ A;  3ELN A;  2GU9 A;  4LK7 A;  3UNP A;  4M0H A;  1Q3E A;  3V0B A;  3I2J A;  4XF1 A;  3KM5 A;  1WME A;  3N9M A;  1QJX 1;  1US3 A;  5BYN A;  4IV3 B;  5BNO A;  2PHT A;  3SNM A;  1T2X A;  3WNX A;  1WW6 A;  2XG3 A;  4LBQ B;  4FTS A;  1ULP A;  2AGS A;  2BBA A;  4I3G A;  5LW9 A;  1K3I A;  5JUV A;  3Q9O A;  3S5Q A;  1KD7 A;  5A3M A;  4IEO A;  2RS5 2;  2HWD 1;  1VP6 A;  1G86 A;  4NRM A;  5T5O A;  1CD3 G;  3T08 A;  2YG0 A;  2Z5W A;  3MID A;  3B9C A;  5FY4 A;  2QQJ A;  2FD8 A;  2JG9 B;  5C3S A;  1UOG A;  4L8Q A;  1AYM 1;  2XJQ A;  4J1X A;  3B94 A;  4XET A;  4LE4 A;  4XFA A;  5E88 A;  1CAW A;  3ZXF A;  3FJS A;  1BVV A;  2KA3 A;  2HJI A;  5FY7 A;  4Q27 A;  5C9A C;  1AX2 A;  1VAL A;  1V0A A;  2B8M A;  3HD8 B;  4AFC A;  1QXR A;  3VDA A;  4CDQ B;  3GBG A;  3NL1 A;  3PIJ A;  4M3C E;  5FYM A;  1UOB A;  3WD5 A;  5DAX A;  5L9V A;  1FAY A;  2QBX A;  5GLW A;  4QX7 A;  4OFG A;  3BKZ A;  2XBO 2;  4YLZ A;  3T0D A;  4NIH A;  1DCS A;  2JE8 A;  3ZVX A;  3WHT A;  2AAC A;  4BU2 A;  1AXZ A;  4E8C A;  5C8W A;  1BEV 2;  2PHX A;  5LA0 A;  1ZZ9 A;  4HPK B;  3E97 A;  3GZU C;  3WP5 A;  2CTV A;  2DUR A;  4GKY A;  4XJ9 A;  4CDW C;  1HJF A;  3GZA A;  5K0U A;  4UFH A;  2X5I A;  4QX5 A;  5FJH A;  1H2N A;  3WQ7 A;  2VMF A;  1X8M A;  1LOG A;  4XFF A;  4Z82 A;  4BOW A;  3DF0 A;  4CP9 B;  3VKF C;  4UW5 A;  4MGS A;  3T2Q A;  3CMG A;  3NNJ A;  1Z7S 2;  3FMG A;  4V1P A;  3WG2 A;  4JQR A;  1REE A;  5DUU A;  5F39 A;  4AL9 A;  1NCR C;  1YIF A;  1WW7 A;  2WT1 A;  5FY1 A;  1LOE A;  2R16 A;  3HT1 A;  4BME A;  2E7A A;  4CUG A;  4TWT A;  3OY8 A;  5GZG A;  1AYM 3;  1JZ4 A;  4NUB A;  5A33 B;  3ASI A;  2JG8 B;  2WUH A;  1W0P A;  2VBD A;  5JVV A;  5K9Y A;  2A70 A;  4I02 A;  4AVT A;  2XJR A;  3UT0 A;  1H8V A;  3RZZ A;  1QQP 2;  5DN2 A;  5AC9 1;  2A3W A;  4HZF A;  4YRD A;  4LKS A;  4X6R B;  5FYI A;  5GLU A;  2X53 S;  1GLH A;  1QJX 2;  4AYU A;  1ND3 A;  4AEJ A;  4NID A;  2WO2 A;  1C8M 2;  1FAT A;  1C8N A;  3LA7 A;  2BQP A;  4WM8 B;  2WZE A;  1S0E A;  4HN1 A;  1S0F A;  1VMJ A;  3L2H A;  3MLL A;  1W9W A;  1TE1 B;  1HRV 1;  1IHM A;  1IQD C;  1VBA 1;  2NLR A;  2VUJ A;  3OF1 A;  4J1W A;  3VN4 A;  3WCR A;  5H9P A;  5LRR A;  5C3P A;  4DUV A;  3WP4 A;  1G9B A;  2Q8O A;  2ZGM A;  1AX1 A;  2V4V A;  2R1B A;  1FNY A;  2W68 A;  1UIJ A;  2Q5T A;  1VBC 2;  1LOB A;  1WKY A;  2FCV A;  3LB9 A;  1R09 3;  3QH6 A;  4QPY A;  4Z2A A;  5A7W A;  3NJX A;  4AFM A;  1JTZ X;  5FIX A;  5HBA A;  4JCK A;  1QNW A;  1XQN A;  3LD8 A;  3RMX A;  1POQ A;  2OUJ A;  3WIN E;  1ZA7 A;  2UU8 A;  4BYY A;  2VXR A;  1XYN A;  3AZY A;  2VE1 A;  3RSJ A;  4QXK A;  2P3J A;  2W87 A;  3PMS A;  4DEQ A;  1KRI A;  3CO2 A;  4QX8 A;  1HX6 A;  2ZOE B;  5HPO A;  4ET7 A;  3WVJ A;  4W6W A;  5ERL A;  1D4V B;  1OKQ A;  1VBE 2;  4KH9 A;  4P5Y A;  2WNE A;  1KJL A;  5DG1 A;  1GMM A;  4LBN A;  5C4W B;  3H7J A;  3OCP A;  5CG9 A;  1H4G A;  1W6Q B;  2RM2 1;  1V9U 2;  4Z2W A;  4CEY A;  4CEY B;  3IBM A;  2R30 A;  1U5X A;  4IV1 B;  3ZFE B;  5IFP A;  4YFW A;  4XAA A;  1RMU 2;  3ZSM A;  5L9R A;  2Z79 A;  1ULD A;  4E4H A;  4P08 A;  1AR8 3;  4XIL A;  4GAZ A;  3AZV A;  4QHB A;  2IFW A;  5FBZ A;  2UWA A;  1Z7S 1;  4ZZ5 A;  5JSR A;  5ABJ B;  1N47 A;  2DUQ A;  1NLR A;  3BU7 A;  1H8T C;  1Y4W A;  1R08 3;  2WC2 A;  3ZKY A;  2E7T A;  1VB2 A;  1W8O A;  3NWK A;  4PLM A;  4FCA A;  3VKM A;  3OEB A;  3ZMN A;  3CBN A;  4GKX A;  4MUV A;  5JPM B;  2WFP A;  1G9D A;  3I3Q A;  5M0T A;  1LHV A;  1OF3 A;  3DPR B;  4RSU A;  4CPB D;  3LKJ A;  1S0G A;  3M2M A;  2J22 A;  1RUF 2;  5JI9 A;  2AEZ A;  5JLV A;  1QOT A;  2DBN A;  2QDN A;  1NCR A;  1EAH 1;  1RMU 3;  1X50 A;  1XSQ A;  3H1M A;  3X29 B;  3ZFG B;  5KC5 A;  4ASM B;  2IXC A;  1KJR A;  3VBH B;  3DYM A;  2YPD A;  3A0K A;  1S2K A;  3CEW A;  4FPL A;  1MZF A;  5LBC A;  2WNU C;  2WIN B;  4MYE A;  4XDP A;  1RHI 3;  1R08 2;  2D3R A;  2RM2 3;  1MS5 A;  1YFX A;  3AKS A;  3PNA A;  4JTO A;  5CYY A;  3VZM A;  5I8Y A;  1K5M B;  1OPM A;  3B02 A;  4KBZ A;  1SDD B;  1W06 A;  5B4X A;  4QMA A;  3ZYJ B;  5ISL A;  3DYP A;  4V2W A;  4BHP A;  1QY4 A;  1UY4 A;  1CQ9 A;  2RS1 1;  2YUE A;  2VZU A;  1OQ1 A;  1W0O A;  4UXA A;  1YFY A;  4HN0 A;  3SQO A;  4K1Y A;  3LQC A;  2RDN A;  5ANQ A;  1O5L A;  2ERF A;  4I0B A;  3M3Q A;  4JRA A;  4FFG A;  4P14 A;  1LHU A;  4IQP A;  2ATF A;  4FOV A;  4MZU A;  4QX2 A;  4RN5 A;  5I8T A;  4KG8 A;  3S7I A;  1HB1 A;  2YZ4 A;  4KL1 A;  4DIQ A;  2FDF A;  3KSC A;  3VB9 A;  2DTY A;  4B7K A;  3ABZ A;  4FXK B;  3O1T A;  4XOG A;  3H8U A;  2QE3 A;  2ZS6 B;  1NCQ A;  4K7J A;  1FOD 3;  2EAA A;  4YVW C;  4OCT A;  5FRE A;  2R1D A;  1RUD 2;  2W47 A;  3ON7 A;  4Q4Y 3;  5J7M A;  1TVG A;  4O61 A;  3AMM A;  5CNA A;  1FMD 2;  3KB5 A;  5C4W A;  2A3X A;  1GIC A;  2XLF A;  3D0S A;  4UI9 L;  3BOD A;  1A8M A;  2D93 A;  2W1Q A;  5HCA A;  3KV5 A;  3FWE A;  2V5Y A;  1HQN A;  2WYS A;  2DF7 A;  4FPE A;  2OII A;  2GNT A;  2WT2 A;  4M3C A;  5HI0 A;  5L7O C;  3VBS A;  4FVV A;  2PAK A;  3AMP A;  4Z8B A;  1NE4 A;  1PMH X;  4ITC A;  1D4M 3;  1OFN A;  2DVG A;  4PI0 A;  2XPJ A;  4EV0 A;  4JC1 A;  4MLO A;  4QKB A;  4Y5T A;  2WKK A;  4EN9 B;  1YQ2 A;  4K3U A;  3HN1 A;  2BW8 A;  3SH4 A;  3VBU C;  4XCB A;  4EWD A;  3O1R A;  2D6P A;  1IS4 A;  4BQY A;  1PIV 1;  1X9T A;  3RVH A;  1O59 A;  2NPI A;  3JQW A;  1F4A A;  4F7Z A;  1XE7 A;  4GB3 2;  1JUH A;  4GA9 A;  2RS1 3;  1NAE A;  4QHZ A;  4XFH A;  3WNP A;  2E51 A;  3HBZ A;  3R4D B;  2VUA A;  3NV1 A;  4TZD A;  3DKW A;  2GP5 A;  5CKM A;  5FQ0 B;  4Q4X 3;  3I3M A;  1I9R A;  4NRQ A;  3VD7 A;  4XE9 A;  4WVW A;  1AL2 3;  1OVS A;  4P5H A;  4QQ2 A;  4AVA A;  3O1S A;  2DU1 A;  4I30 A;  4CXW A;  1YCI A;  3ZXK A;  5C8C C;  2A71 A;  3HNM A;  1GQH A;  1VAM A;  4RGK A;  2WR9 A;  2QFE A;  2XGX A;  2GNM A;  2DFB A;  2J1E A;  3AJY A;  1U0A A;  4QKF A;  1R08 1;  1ND2 C;  1PGL 2;  4R9D A;  1BCX A;  1E5S A;  1WZX A;  1GWL A;  1ODM A;  1J3R A;  5CVR A;  2EXH A;  2JDY A;  3I2I A;  2NZ9 A;  3MIC A;  5FV3 A;  1MS4 A;  3INA A;  3ZYH A;  1JMU B;  5DMY A;  2ARA A;  2JDZ A;  3QOP A;  3NAP B;  3OSD A;  4QM8 A;  3WDY A;  1VAV A;  4WV8 A;  5EHD A;  4RR3 A;  1BBT 1;  3MV0 1;  1NQD A;  2OT7 A;  3DKQ A;  5EJ1 B;  1QWR A;  4LLF A;  1M06 G;  2VH9 A;  3QH7 A;  1AR6 3;  2WAA A;  4PT6 A;  3RPQ A;  1U5I A;  4XAC A;  1D0G A;  2UWB A;  3HEI A;  3IWZ A;  1XPW A;  1X9P A;  1RUE 3;  4CDW A;  1AJO A;  4DUX A;  3S5A A;  1ULE A;  1VRH 2;  1GR3 A;  2P6C A;  1KDM A;  1HRI 1;  4DXT A;  2VMI A;  3LA2 A;  1DFQ A;  4LO7 A;  3ACI A;  4W4Z A;  3PJY A;  2DVB A;  2HH9 A;  4B8E A;  4NPR A;  1HLC A;  5DPN A;  3V0A B;  1YUD A;  2L9L A;  4RYD A;  2ZX3 A;  4QB2 A;  1VRB A;  2XLG A;  4GMP 3;  5FP9 A;  1QMJ A;  2OX0 A;  4LUL A;  3RZK A;  3ETP A;  1A8D A;  2P5B A;  1DHK B;  3JB8 A;  3TRS B;  3HQX A;  3RI9 A;  1ZRE A;  3N7K A;  1IKP A;  4GH4 A;  3APB A;  4W65 A;  1JU3 A;  5FZ8 A;  2JJ6 A;  3T3Y A;  2XJU A;  4MGQ A;  4TN7 A;  4XEZ A;  1E5H A;  4JGZ A;  1VAK A;  2BGP A;  2QTW B;  1CN1 A;  1FYU A;  2R7E B;  1OA2 A;  1QU0 A;  2ZEY A;  3RQ0 A;  3E6D A;  3LIH A;  1WCQ A;  5FP8 A;  3I3B A;  4DY5 A;  1JU4 A;  3Q8F A;  2VY0 A;  4FP2 A;  3J9S A;  2EAK A;  1K45 A;  3E6B A;  3MV1 1;  5GM0 A;  4ISR A;  1SQ4 A;  2ZHM A;  2WZP P;  5FMB A;  4FPF A;  1G9C A;  4ISQ A;  4PLN A;  2VAU A;  1W3X A;  1UWW A;  2JDU A;  3RDI A;  1AR7 1;  1ZZB A;  3UV9 A;  4Q26 A;  5FZ9 A;  4QPG A;  3GHN A;  1LOA A;  5CFC A;  1OD5 A;  4PDW A;  1D4M 1;  1TEI A;  4OHZ A;  3ZOI A;  1OUR A;  3QBQ A;  2D6N A;  4UFI A;  1VBA 2;  5KXD A;  3AMH A;  3N7M A;  1D7P M;  3I59 A;  2XWB B;  3U1X A;  2JD9 A;  4NPL A;  2B7Y A;  4NIG A;  2XHK A;  2IWG B;  4Q0V A;  2BDR A;  2EAL A;  1W90 A;  2W08 A;  2VOT A;  2WSV A;  3O5S A;  4HAN A;  4PDW B;  1RUI 1;  5J96 B;  4S2H A;  4BIS A;  1YO8 A;  4CYD A;  1KS4 A;  1OQE A;  2VM9 A;  1UY0 A;  2VTF A;  2W92 A;  2Z2S B;  1W8Z A;  5FRA A;  2JE7 A;  2BOI A;  2EXK A;  4Y4R A;  4A44 A;  1JYX A;  3QCW A;  2MPF A;  4XPV A;  4LBM A;  4UYB A;  4C0B A;  2VZT A;  4YZ1 A;  3TBD A;  4MAD A;  4AHY A;  4Q0P A;  1W9Y A;  3SC7 X;  2HWB 2;  1VRH 1;  3BPZ A;  1UU6 A;  4ZU7 A;  4JGZ B;  2BWA A;  3LEM A;  3WQB A;  5L36 A;  2YC0 A;  1NY7 2;  2YPJ A;  1C3H A;  5FYH A;  5FZH A;  4AE2 A;  4Q4X 2;  3THT A;  1NCQ B;  4DB5 A;  2VW2 A;  2Z4F A;  2ARE A;  2X5I C;  4XUQ A;  3ZPY A;  4A6S A;  5A7W B;  2B45 X;  4LUM A;  4CCN A;  2NM1 A;  2VMH A;  3LSE A;  1DQ5 A;  1QJU 3;  2BZD A;  5IK4 A;  4P9X A;  1JZ7 A;  1QHD A;  1FXZ A;  3BIE A;  3A23 A;  3ACF A;  1BBT 3;  1W99 A;  4FPO B;  1OF4 A;  4XJU A;  1BBT 2;  4IGQ A;  3POG A;  1W8N A;  1N1Y A;  3C7E A;  4QXC A;  3NW4 A;  5F6L B;  2JE9 A;  5FXW A;  1HXS 2;  5APA A;  1Q43 A;  3WHU A;  1XU1 A;  3MIG A;  3WDT A;  4DXR A;  4IEZ A;  1LGN A;  3N36 A;  4GIQ A;  4I0W B;  4HKO A;  3FBM A;  1RUI 3;  4N53 B;  4XYX A;  4CP2 A;  2P37 A;  1NCR B;  1UZZ A;  5LEJ A;  1S55 A;  4JQT A;  4MH0 E;  1W6M B;  1W2A X;  2DCK A;  4KGG A;  1I5Z A;  3AXE A;  3GZE A;  4YG6 A;  4XXP A;  1HIX A;  2BBV A;  2O1Q A;  1VMF A;  1GV9 A;  5BNN B;  5LA1 A;  3IAQ A;  1QGL A;  1O3R A;  4EN6 B;  4C8D A;  4R8H A;  2B42 B;  2FDH A;  4GJY A;  3LAG A;  3ILN A;  2QQL A;  4YGC A;  4ZY9 A;  1OPO A;  1QH6 A;  3WNO A;  2Y0O A;  2EXI A;  3C8X A;  4FOW A;  4GWM A;  2VZP A;  1G6N A;  4QPI C;  3AZZ A;  3HAG A;  3BTY A;  4ASK A;  1ODN A;  4OZO A;  4K8F A;  1VMH A;  3CZJ A;  4YFZ A;  1EPZ A;  2JDP A;  4HKL A;  3LFM A;  3KQR A;  3MDP A;  1GWM A;  2J1A A;  2ZHL A;  3AKT A;  2Q8E A;  3QLQ A;  4BH9 A;  3FBY A;  4LMF A;  2KR2 A;  4AF9 A;  4H2A A;  3KWV A;  3PUR A;  3H8O A;  3IMM A;  3T2O A;  3D3A A;  1C1F A;  3GCX A;  4AVS A;  1IG3 A;  5EJZ B;  1NA1 B;  2V73 A;  3I54 A;  4IEW A;  3J8F 1;  4PHZ A;  3V65 A;  2HEW F;  2JD4 A;  1NE6 A;  3PVB B;  4O65 A;  4C0H A;  1I5P A;  1KFX L;  2ZEZ A;  2Y34 A;  1V6K A;  3ME2 A;  2HWB 1;  1OOP C;  3D8C A;  1Q5O A;  2HKX A;  3PUS A;  1MQT A;  2ENR A;  2WNO A;  2XBO 1;  3KT4 A;  2VOX A;  2IVI B;  5JZG C;  4IGO A;  2PLV 2;  2B5H A;  4I0A A;  2QUO A;  1PO2 3;  2YU2 A;  3RRD A;  3GF6 A;  3T4H B;  3ZN5 A;  1LB2 A;  1SZB A;  1WWY A;  3FUO A;  4FPG A;  4AWD A;  1U5Y A;  3WCS A;  5DAP A;  4D6S A;  1W6Q A;  2PHR A;  4QX3 A;  4URA A;  5IAT A;  2CSG A;  2OPK A;  5A80 A;  4CEY C;  4P02 B;  4CCC A;  3U07 A;  3VBR A;  1WBF A;  3VHO A;  1LKN A;  1O91 A;  1QJY 1;  3MW2 A;  2GC0 A;  5FYB A;  4MGK E;  3R4U A;  3ZR5 A;  4AED A;  3BYW A;  3V0A A;  4G3Y C;  3J7M A;  5EIY B;  5FPU A;  2RR1 3;  2GN3 A;  3FFZ A;  3PUQ A;  4MO3 M;  3VDD A;  4CDU B;  3BI3 A;  3N4M A;  4OI1 A;  3RZL A;  1LES A;  5LWB A;  3FLR A;  1FV3 A;  1FPN 3;  4MGZ E;  4OI0 A;  5ABJ C;  2Y6L A;  4FPH A;  4HOO A;  3IMN A;  2CWS A;  3W59 A;  3O1P A;  5CFC C;  5A3O A;  2JDA A;  2WO1 A;  3AKR A;  4P00 B;  1BEV 1;  3Q8C A;  1IPS A;  1DGW X;  4Y20 A;  5DAW A;  1OLQ A;  3LFI A;  3MIH A;  3VBH A;  4ATE A;  5FZB A;  1CX4 A;  2YGL A;  2F17 A;  3B00 A;  4I3P A;  1C5I A;  1SG3 A;  2VZS A;  3AB0 A;  3N9P A;  2WJS A;  3IDE A;  2A6X A;  5C6C A;  2G9F A;  4OUL A;  3SEE A;  3ZFG C;  2GAL A;  4CCL A;  4FO9 A;  3R4S A;  3MW3 A;  3NV2 A;  4MX3 A;  1HXS 1;  2IXH A;  4LJH A;  1CZV A;  1AX0 A;  1JOD A;  1RHI 2;  1LHN A;  2WNU B;  1PGL 1;  4FPJ A;  3HOB A;  1L7R A;  2QNK A;  4LR4 A;  4XZP A;  1HQW A;  1NG0 A;  4BWO A;  5FZ6 A;  3WDV A;  4M4R A;  3ZN4 A;  1JH5 A;  2Q30 A;  1CZS A;  1YIP A;  4Y1U A;  4R4X A;  4FT8 A;  2VMD A;  1S2B A;  1PMI A;  2F4L A;  4JV4 A;  4L11 A;  1QF3 A;  1LJ7 A;  2WQZ C;  2G9Z A;  1JS9 A;  2RR1 1;  4Y4Y A;  5AC9 2;  2Y6H A;  3IDB B;  4S2G A;  5FPB A;  3KLS A;  5A7O A;  5FPX A;  3ZMO A;  4AFA A;  4LO8 A;  5D8A B;  2DUO A;  2E26 A;  1B35 B;  3VBO A;  2A3Y A;  1ZNP A;  2DWR A;  3DUI A;  2GMP A;  3TAY A;  3C7H A;  4C91 A;  2IFR A;  1ZBE 3;  1VIW B;  3O0X A;  3WG1 A;  2A1X A;  3B7M A;  4J25 A;  3WG3 A;  4NR1 A;  2TUN A;  2ARX A;  3VHN A;  4NJ4 A;  1QOS A;  5K0U B;  4FOY A;  4H14 A;  3A21 A;  1KGY A;  3VBR B;  1AYN 2;  5FXV A;  2VZ1 A;  4QXH A;  3VUO A;  1W03 A;  3JBG 3;  3T1L A;  4MGY E;  1G9A A;  1UY1 A;  1JOJ A;  2E53 A;  2W0X A;  4DRV A;  4RHV 3;  4Q2F A;  3G6J B;  5FPV A;  2W5F A;  3PVN A;  4LOS A;  4RQP B;  1F4H A;  4YVS C;  4BB3 A;  2ET1 A;  3ZYI B;  1OMI A;  3ACH A;  3DYO A;  2WNV C;  1TMF 2;  1HXS 3;  1N1S A;  4U2A A;  2ID4 A;  3CJI A;  3OPW A;  3H9A A;  4AXO A;  5FFO C;  1OKO A;  1W9S A;  1O4T A;  1VE0 A;  1SMV A;  2GMM A;  4XMI A;  4C90 A;  2PAM A;  4WZF A;  1UN1 A;  1RXF A;  4LQR A;  2ZX2 A;  1FX5 A;  1PX3 A;  5F8P A;  2XBO 3;  4XCA A;  1MQT B;  2W9X A;  3W58 A;  1SCR A;  3I2G A;  1LOF C;  1IZ3 A;  2GDF A;  1EV1 3;  1ULF A;  1DZT A;  2CDP A;  3VBU B;  4AEK A;  2WII B;  5JZG A;  1YNA A;  3IAP A;  5FZ4 A;  4P9J A;  4WM8 A;  5GZF A;  4CUA A;  2YGM A;  1UY3 A;  1UZW A;  2XJP A;  1L3J A;  2WZR 3;  1SLT A;  3FFQ A;  4QPG B;  1FT9 A;  1ASJ 1;  4QQL A;  1SBE A;  3POS A;  1W2N A;  2D3P A;  5LAS A;  2P4E A;  1F2N A;  4BQX A;  2R07 3;  1MEC 2;  4XUP A;  1PGW 1;  2WN3 A;  5C33 A;  1ZBE 1;  1QJY 3;  2WWS A;  3THD A;  4CUB A;  3EYP A;  3LDB A;  3O1V A;  2C26 A;  4UW6 A;  3WEZ A;  5EXO A;  2R32 A;  1P8J A;  2I45 A;  1J1L A;  5FZ7 A;  5JSO A;  2J1S A;  1LR5 A;  4YM0 A;  3AZX A;  3BIW E;  4R4Z A;  1COV 3;  2DVD A;  1U12 A;  4IEU A;  3KCC A;  4PJY A;  4B7E A;  5A7S A;  2VZR A;  2JIJ A;  2ZGU A;  3D0J A;  3ORJ A;  4AVC A;  3H8R A;  3OGG A;  2C0Z A;  2XQR A;  4HSL A;  2R06 1;  2B9U A;  4YGE A;  1GKB A;  3AYA A;  4QPI A;  2EIB A;  4TXW A;  5A6X A;  5F3I A;  4I2O A;  4BQ5 A;  4D6R A;  4FQ4 A;  4IV3 C;  1NZI A;  4QD2 A;  2IXJ A;  3LCP A;  2E33 A;  3A7Q A;  3EXU A;  3K3O A;  2WA3 A;  5A1L A;  1HV0 A;  2OYZ A;  2Y60 A;  4X8N A;  5FZ1 A;  3WW2 A;  1UO9 A;  2HWC 2;  2VCC A;  3I2K A;  4CP0 A;  5BUV A;  2D6O X;  4Y26 A;  4LO5 B;  4CU8 A;  3WR0 A;  3WNM A;  1VBE 3;  2B39 A;  3RFR A;  3C3V A;  4YW6 A;  2XL7 A;  3OY8 B;  3OPT A;  2JG9 C;  1PVC 2;  2HWD 2;  3CJI C;  4P9G A;  1SPP A;  1UZV A;  5A6Z A;  2W2I A;  2YV8 A;  1QJE A;  4HPK A;  5LY2 A;  1RUH 2;  5KHK A;  3H1W A;  5E1R A;  5EV7 A;  2FBE A;  4BMB A;  4BXF A;  1TNF A;  5JOW A;  4NHY A;  5EP9 A;  2JEC A;  3UKT A;  4OQ8 A;  1WD3 A;  5IVC A;  1RVF 3;  4OUM A;  3OJB A;  2ES3 A;  4YGD A;  4AFB A;  4KGQ A;  4RGG A;  3THP A;  4CDQ C;  4IUG A;  4D6Q A;  3WF1 A;  1I3H A;  4FSJ A;  1UMI A;  1W6N B;  2GND A;  2KXL A;  3LSD A;  5EFU A;  2YDE A;  3PVO A;  3WSO A;  2WN2 A;  1AVB A;  1WLD A;  2R0F A;  4E2G A;  1GP4 A;  1O4Y A;  4YGB A;  1RUE 2;  1SLB A;  4BQ4 A;  4BLJ A;  4ORF A;  1O6U A;  3OOX A;  4QDQ A;  4OQ9 A;  2B46 X;  1CES A;  2ZGL A;  4K6B A;  3E5X A;  5GJ6 A;  3VDC A;  3FC0 A;  5IK5 A;  5JIA A;  2K9Z A;  3UGG A;  1I1E A;  1WBL A;  3AX4 A;  3VLB B;  1LHO A;  1J3Q A;  2C9K A;  2EXJ A;  4AGV A;  1YWK A;  1C57 A;  3RWN A;  5L9B A;  2XJV A;  1G7Y A;  3OGS A;  4D3W A;  5CBL A;  1NA1 A;  3III A;  4N7I A;  5CKQ A;  2RJ2 A;  3K4A A;  5LB6 A;  2JEM A;  3U75 A;  4JDM A;  1S0J A;  1LGC A;  4ZON A;  2W94 A;  1REF A;  1WCS A;  4NRP A;  1GFF 2;  2VVE A;  2G9G A;  3AKP A;  4CU9 A;  3HN3 A;  3POB A;  4XFB A;  2VGD A;  1BZW A;  2BNN A;  1ZBA 1;  1EP0 A;  1SBF A;  2Q1Z B;  2WS9 2;  2XKO A;  3TN9 3;  5IFT A;  3DV8 A;  4HXC A;  5J98 B;  1XRU A;  2QQW A;  3WX5 A;  4AGG A;  1QNY A;  3MYX A;  4YNI A;  3LGR A;  1OLM E;  3HMY A;  4LEJ A;  2FMD A;  4GUL A;  4RA0 A;  1WMX A;  3WNN A;  5IW0 A;  4PLO A;  2XL9 A;  5H9S A;  1PK6 B;  2ILM A;  2PTM A;  2UUR A;  2VNG A;  4UF0 A;  2WZR 1;  4D7T A;  5IVY A;  4ZXK A;  5LCW L;  1OLR A;  4E4S A;  1MEC 1;  3CLP A;  1LUL A;  1H6Y A;  3M3E A;  5I0S A;  5KWR A;  2VU9 A;  3RZJ A;  4AQS A;  1ZM1 A;  2RMU 2;  3FHI B;  1PO1 2;  2X10 A;  2VME A;  4FAH A;  2VC9 A;  4N7U A;  3BOP A;  4PIZ A;  2FHR A;  1OUS A;  3PTR B;  1JN2 P;  2YFZ A;  4S2F A;  1FOD 2;  1D2Q A;  1COV 1;  1QDC A;  5GZC A;  1MR5 A;  4JX0 A;  4MXW A;  2EA7 A; 
#chains in the Genus database with same CATH homology
 2XR4 A;  2JDU A;  2JDH A;  2WR9 A;  5A6Q A;  5A6X A;  5A6Y A;  4AOC A;  1W8F A;  2BOJ A;  5HCH A;  1W8H A;  2JDK A;  1GZT A;  2VNV A;  2JDN A;  1OUR A;  5D2A A;  1OVP A;  2BV4 A;  2CHH A;  2JDY A;  2JDM A;  1OXC A;  4CE8 A;  2VUD A;  1OUX A;  5A70 A;  2JDP A;  3ZDV A;  5A3O A;  2BP6 A;  3DCQ A;  1OUS A;  2VUC A;  1OVS A;  2WRA A;  1UQX A;  2BOI A;  1UZV A;  5A6Z A;  4UT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...