1W8FA

Pseudomonas aeruginosa lectin ii (pa-iil)complexed with lacto-n-neo- fucopentaose v(lnpfv)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOMONAS AERUGINOSA LECTIN II
publication title Structural Basis for the Interaction between Human Milk Oligosaccharides and the Bacterial Lectin Pa-Iil of Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 23
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 1w8fA00
2WR9A 5D2AA 2WRAA 5HCHA 2JDHA 4UT5A 4CE8A 5A70A 2XR4A 1GZTA 2BP6A 2VUDA 2JDPA 5A6ZA 1OUXA 1OXCA 3ZDVA 5A3OA 2JDUA 4AOCA 2CHHA 5A6XA 1OVSA 2JDKA 1OURA 1OVPA 5A6YA 2JDNA 2BOJA 2BV4A 2JDMA 1W8FA 2BOIA 5A6QA 1W8HA 3DCQA 2VNVA 2VUCA 1OUSA 1UQXA 2JDYA 1UZVA
chains in the Genus database with same CATH superfamily
2NMNA 1N3OA 1NXMA 3OPTA 4FPCA 5D2AA 1W2AX 3HJRA 4KG8A 2NZ9A 5L73A 3W20A 4JDOA 5GLTA 1Z7S3 1NAEA 4BQXA 1JYWA 3WEZA 2UYAA 4U36A 1LHUA 2BP6A 4JGYA 1HB1A 3H7JA 4ITCA 2AEYA 3J7LA 2C4XA 1YIFA 1PGL2 2BBVA 4K1YA 4FVVA 2CNAA 5GM0A 1OXCA 2YC0A 4Y20B 2DCJA 3MIDA 1RJ8A 2VMHA 4P14A 3DUIA 3O0VA 4H7MA 3WG3A 4W65A 4DXSA 2BOIA 5FZOB 2UWBA 4MOAA 2Y8KA 3RRDA 3HD8B 3MF9A 5DZFA 3VD9A 5CB7A 5I8TA 1AL23 1OPMA 2A6ZA 2PLV2 3IN9A 3K46A 2ZTNA 1FOD2 2JD9A 1RMU2 2JE7A 4Q0VA 1LR5A 4R4ZA 2K0GA 2VQ0A 3MO4A 5DN2A 3NL1A 2VNRA 3NAPC 3CZUA 3OG2A 4DQAA 4PLNA 1UMHA 2R071 1A8DA 1H8VA 1JTZX 3ZDVA 5T55A 3LCPA 1BMV2 1FMD3 4L8QA 2LRPA 4L92A 4DZGA 4XMIA 2WS93 1FPN1 4GMP0 2AENA 1LCLA 1R1A2 1R093 1ZZCA 1MZ5A 1YWKA 2J1TA 4XFGA 1JN2P 5EFUA 2FQPA 1UOFA 3A23A 3WG4A 2BWCA 3LQCA 1ZYBA 1LU1A 4HL0A 1HRV2 5IATA 3UV9A 1G9AA 2YYOA 1MS3A 1O4ZA 2ZX2A 4GH4B 3KLSA 4LEJA 2Z2SB 4MHRA 4QKBA 1B35B 2BYVE 2X5IC 5A32B 2R6QA 2VBBA 3MV11 1U0AA 2FMYA 2WNOA 3PHMA 2B45X 3NV1A 2PLV1 4OMDA 1FOD1 3MZHA 3NW4A 3T2TA 5HCAA 3FFZA 3I4IA 5J36A 4YVWA 5JZGB 3ZFEB 4LHSA 2R0FA 4QU2A 5T54A 3KV6A 1NCRC 2OUJA 3KQ4B 3HAGA 5HV4A 1U12A 5JUVA 3ZXKA 4AW7A 2XONA 2FDGA 2Z42A 4CPBA 1TE1B 5FPVA 1GQPA 3DYPA 3PUIA 4LOSA 5CNAA 2BFUS 1Y9QA 1R1A1 3LOIA 3OCPA 3POFA 3OYWB 4IE0A 5LASA 4EE2A 2GMPA 3GBGA 1GFF2 1QKQA 3SC7X 2CDOA 2PN5A 4LITA 3WG2A 1CD3G 3OY8A 2EIBA 2BBAA 3HT1A 5F6LB 2V4AA 4ISQA 2VOVA 4XMAA 2WZPP 1NA1C 1QNWA 4ZS2A 3ZKUA 5L7OB 1LU2A 1O91A 5KR7A 4CDXC 2ZGPA 1CAVB 3KS7A 4YVSA 1H1IA 3WP3A 1PMIA 4CDQA 5A1FA 5FREA 1YFUA 2IXKA 1P8JA 1GR3A 2W47A 1W0PA 5F9TA 5JPNB 4WM8C 4OQ8A 2Q0AA 3EB7A 4FOWA 1WCDJ 4BDVB 2ZEWA 1OKQA 2GN7A 4YW4A 4IE7A 3ST7A 3WP5A 3ZLIA 4BQYA 5BNNC 4IEWA 4AEKA 2E51A 1LKNA 5I8SA 4NN0A 5ABJA 2HWE2 4XDQA 2JG8C 5J3UA 2A3WA 5FYUA 3VDDA 5ISLA 2TBVA 1X36A 5C3RA 1MS5A 1DLCA 2E7AA 2WNVB 3AMQA 3AZXA 1GZCA 3U1XA 4HONA 5A3NA 4YZ3A 4SLIA 4BMEA 4Q5OA 2NN8A 3ZX7A 4QGNA 1SBDA 1SDDB 3FX3A 3U75A 2JKXA 1AHSA 5GLVA 2KA3A 2OS2A 3C7HA 4OZXA 3I54A 2J1EA 5FZ7A 3MICA 4ZU7A 2OVUA 1UIKA 5KHJA 5FP3A 2VCCA 3T3YA 1MQTC 3WF2A 4CCEA 4BA6A 4IEXA 4XJUA 2MEV1 3AZZA 1NKGA 1NLSA 1AR73 3IT8A 3MBWA 3TNPB 4JDNA 3H8XA 4XF1A 5JPMB 4LBQB 3M8LA 1ZM1A 3IKWA 4IEYA 1NY71 1XBFA 2B8MA 3T0BA 2YB7A 2D43A 4FPYA 1YQ5A 3S30A 1JMUB 1Q8PA 3KD4A 3MPBA 3A7QA 5CFDA 3WDXA 1ASJ2 1C8M2 4IEOA 1RVF3 1W8NA 1WD4A 3K3OA 1JYXA 2WO7A 3QH7A 2VOXA 4N43A 2WN2A 4I02A 1HDKA 1SFYA 4Q4Y1 4QKNA 1CIWA 2YMZA 4QX7A 3VBHA 5BNPC 2HWF2 4H55A 2WAAA 4K21A 3HBKA 1JHNA 1SLLA 4BZ4A 4UXAA 1FI2A 1LOAA 1X8EA 3DYMA 4CA9A 5C9AB 4EN7B 1CONA 2Y38A 1H8TA 1D7PM 4LO4B 3DPRA 1XNKA 2CAUA 1AJKA 4CDWA 4GH4A 4QDSA 2ADDA 4NAMA 4C8DA 3Q8BA 2Y6LA 1EUUA 3CMGA 3NKTA 4CU9A 2JECA 1OVSA 3B01A 3J9SA 4G9SB 5F5CA 1QOTA 2F4PA 2DFBA 4UF0A 4FXKB 4IE4A 1V00A 1WW5A 1ZZ7A 3N7MA 4XJZA 4AGVA 5A7WA 4I2OA 2VCBA 4DFSA 3O1UA 1POV0 3JBG2 4RL7A 1ULGA 4XZUG 1ASJ1 1EAH1 1HW5A 3J8F2 3EMRA 1UZVA 1NX9A 3H3ZA 1POQA 1OC1A 2Y6KA 4K8RB 4R9DA 4NUBA 4Y33A 3VHOA 2D40A 1GWLA 3LFIA 1S4CA 1JOPA 2AUYA 4I09A 2LUWA 3ZVXA 1MS9A 4CCDA 1DZTA 1EUTA 3BALA 2HWF1 4RGGA 1H4GA 1NXD1 3AJZA 3F95A 1RUG3 4AEJA 2G4IA 4FPJA 1OA3A 3G6JB 4URAA 3KF3A 1EYBA 1RUOA 1O3RA 2ZX1A 4BHPA 3VDAA 3NAPB 4FAGA 3AB0A 1ODMA 3H7YA 2VMDA 4XJ9A 4CDUA 3RYPA 2ETEA 2W2IA 4LBKA 1N1TA 2VZ1A 4CZSA 4MGTA 1SMVA 4MO3M 4LBQD 3OBZA 3ZYHA 3ES4A 4RYDA 3DEMA 3H1WA 3T2QA 1RIRA 4QQPA 4AI0A 4DY5A 4COUA 1WCSA 3JBG1 2DYCA 5A7QA 4JTNA 3J8F1 1QJY1 5F8PA 5BPXA 5LBEA 1JH5A 1YQ8A 1YFYA 3NNLA 5FAXA 5T50A 2BU9A 2X10A 1WMEA 4XFIA 3ECQA 1MVEA 5IWFA 3M3CA 2X5IB 3TN92 5LRSA 3MIEA 5GKAC 2J1VA 3LF7A 4V2WA 5CISA 3IMNA 2FCVA 1AL0G 2VW0A 3GDBA 4FFGA 4W8JA 2P2KA 1RXGA 3AMPA 2CGNA 1HRI2 2GP3A 3NJVA 1NCRB 2CV6A 3DKWA 4QQHA 3I3QA 2CGOA 4LJHA 1RUF2 5FYTA 4RS5A 4XF4A 3VV1A 1YFXA 2XJUA 3I59B 2A6YA 4LO6B 4P00B 2DVAA 2D5FA 5GZFA 1K45A 2LW8A 3QACA 4HBNA 2RR13 1XJAA 1BK0A 1DGRA 1S0IA 3DXUA 5DDJ3 3ZIWA 1UD1A 2HWD3 4NE9A 5FXXA 2WINB 5C4WC 4XE9A 4IEUA 3GHMA 1OQEA 1TME2 2RE9A 5JSRA 1Y4WA 4PIYA 2VXJA 2XBO3 4XJAA 4I0WB 3DECA 4AI1A 1ND3A 4W50A 1NA1B 4LPLA 4KNCA 4CDXB 1LGBA 5LEKA 1QJU2 3VD4A 2OW4A 5CFCA 1GZWA 4MGZE 4YM0A 5I0SA 1GP6A 4WM8B 1JW6A 1JYCA 1RHI3 1G7YA 1RYYA 3ENRA 3VHRA 5BNNB 4MHUA 3BGAA 4CTEA 3P1IA 5FZAA 1TNRA 2D98A 3GJAA 1MZ6A 4H7LA 4A41A 5CZKA 4E2QA 4BYYA 4JGYC 1BCXA 4FPGA 4QB2A 5EJ1B 3ITQA 4XURA 2VD7A 2ADEA 1NE6A 3O1TA 5F3GA 3KV5A 5FIXA 4DY3A 2AC1A 1Q8OA 1QXPA 1S0EA 4AVSA 5C71A 1TME1 2WFF1 4AVCA 1W2UA 2OT7A 4N9HA 3PIJA 3ACFA 1C3HA 4W6YA 4CU6A 5FLHA 1WLTA 2R32A 4AAXA 2OPKA 3HQUA 1ULOA 1H6YA 4RSUA 1W90A 2CWSA 1MQTB 4QAWA 1QJU1 2J7MA 3KT7A 4GWIA 3ZXEA 1GOHA 5GLZA 4XQ4A 4UI9L 1NQDA 1RUE2 4DEQA 3VB9A 5ACA2 2NMOA 5CG8A 1OOPC 4XBQA 1TQ5A 4NR1A 4XDOA 1I1EA 4BXFA 3B93A 2VNOA 3TEXA 5JMCA 4GKXA 1U5IA 1VBE3 4B8EA 1UXXX 3MLKA 4M4PA 3N4MA 2V5YA 2PYTA 1GANA 1QJEA 4NIDA 2QQNA 2WA4A 4OMCA 5H9SA 1E5RA 2ZOEB 3IDEA 4QX2A 4MXWB 1H2MA 2YBSA 4NROA 4GD4A 4QKFA 5FPBA 4JRAA 1RTVA 4EQVA 5BNPB 2GH2A 1DDLA 1W6NA 2RS33 2XJSA 2R16A 4LORA 3RWKX 2A3YA 5J48A 2YFUA 4GWJA 3UETA 5F3CA 1N1SA 1U5ZA 3FL7A 3NV4A 4YSFA 3MI8A 4AL9A 1OUXA 3S0MA 2H6BA 5TSWA 1W3XA 1IZ3A 1SCSA 2GNDA 3OOXA 2DUQA 1QXRA 4Q4W2 3ZPYA 5JSPA 1AR62 4BE3A 2VZQA 3LSDA 4QDQA 3IBMA 2PAMA 4AHZA 4FQ4A 1CX4A 1SEFA 4PI2A 3OF1A 1DU3D 1I9RA 4QB6A 1ZNPA 1CAXA 5GLUA 4D7YA 5FP4A 1ZBA2 4XQWA 1J59A 1RUE1 1COV3 5FYVA 4PT6A 1DZRA 1NYWA 4OHVA 3P3PA 1F4AA 2XJPA 3WP4A 2BPA2 3J7HA 4XTPA 1CAWB 1RUH2 1TMF2 4HKWA 2HBTA 2HWC2 4NHLA 3UL2A 3LFMA 3VBOA 2VU9A 1S55A 1F5FA 2V5DA 1IHMA 5J98B 1UU5A 4N7UA 2B7YA 1UO9A 2P5BA 2Y6HA 4C0HA 1OQDA 1RL3A 4D7SA 3VBFA 3MW2A 2L9LA 3HMYA 1YYNA 2B46X 1LHNA 2VO5A 2I2SA 1W6MB 4YWAA 5EHDA 5GALA 2LS6A 2PELA 4CP2A 2XVLA 5L9BA 1HQNA 5EJZB 2Y26A 4Y4YA 4ES9A 1LOCA 4XEZA 1FXZA 1WLDA 4YVSC 3RZHA 1CAUA 1Q8QA 4Q4W1 2KD7A 1R081 3RZGA 3GCWA 4ARYA 1TNFA 5IFPA 3ETQA 3NSTA 5JR2A 2J1UA 4P08A 4AHWA 3OD0A 2FDHA 2FDKA 4LHLA 2UWCA 1JZ3A 2C6SA 2VGDA 5FZGA 2WZR3 4RGAA 2D93A 4Y1YA 3WHUA 5C6CA 5IJRA 5GZGA 3S7IA 5ABJC 5IVCA 3IIIA 1PIV2 4DRRA 2Y33A 3WDVA 1VJ2A 3D3AA 1A78A 1RUI3 3D6EA 5CBLA 3VDDC 2DWRA 1K5MA 5EPAA 2D3SA 1SFNA 2W1QA 2ZX4A 1IKQA 1IG3A 3J26N 3IZOA 1AX0A 2ZPXA 3GHNA 2ZGKA 2V72A 3CBNA 5FXVA 4DS0A 3SITA 3RJ2X 1PVC2 3ZSJA 4ATEA 1J83A 1H0BA 4IV1A 2FBEA 3V65A 4GXLA 4XZPA 1A3KA 4Y3OA 1G9BA 1LOFA 3BOPA 2VL4A 3OSDA 1XE7A 2YROA 4Z92B 2C26A 5LATA 4N7IA 1VP6A 1J3QA 4XIOA 4KU8A 3E6BA 2E53A 3M1HA 2BGCA 5HI0A 4UYBA 5GZEA 3ZFFB 2WT1A 3V0AB 3W5MA 4XIKA 4UFMA 5A6XA 1BEV3 2C1FA 4LIVA 3WNKA 2BGOA 2VPVA 3AYAA 3LD8A 1ZREA 5FXWA 2JDNA 4BQWA 5IAXA 1O4YA 3T08A 3RZJA 1BBT2 1DYPA 4XCBA 4JC1A 5LY1A 4HFSA 1SPPB 1O7FA 4FFHA 4N43C 1YHFA 4OUMA 3PVBB 5C4WB 2P17A 1Q5OA 3T1LA 2IZWA 4B1LA 2R49A 2ZHMA 4TLFA 2XL7A 1UNBA 3VBHC 4BLIA 3ORJA 1ZZ6A 1GSLA 3S5AA 1AF9A 4ZONA 3S7EA 3C7EA 2BZDA 2XJRA 4O7XA 4LBMA 4TYSA 3E97A 3AP4A 4RN5A 1UY3A 2HKXA 4ZKTB 4JGZB 1WUVA 3I49A 1V6OA 3EHKA 1H8TC 1JXNA 4NPMA 3VLBB 4DMIA 4EYUA 3DPRC 2HWB3 1OURA 2WZEA 1VBB3 5F2WA 3ROUA 3ZMOA 2BQPA 3FHIB 4GH4C 4CDWC 5IHRA 4A4AA 5LCWL 1G9DA 4QWNA 1ZRDA 3ES1A 2DTYA 2R061 1B35C 1QQP3 5BXXA 2A71A 1CESA 3GCXA 3M2MA 1UZZA 4HETA 1NCQA 1V6JA 2XLFA 3AMNA 4W6XA 4F8AA 1RUD2 3PL0A 4JGYB 5IK7A 2VUAA 4JQRA 5FQ0A 4M00A 1QXJA 1PO23 3I3BA 2GAUA 5M0TA 1UYZA 4GB33 4HPKA 3POWA 3OPWA 2JDHA 3AFKA 4LHNA 3ZXJA 5JZGC 4OCTA 5FBZA 3TWIA 2RS12 2OUHA 2QQMA 3T0AA 2W0XA 1AR81 4I0AA 4NWWA 5FZEA 1UL9A 1ZBE3 2DDUA 4QM9A 1W8WA 2RMU2 1SHWB 1N1VA 2X29A 4ORFA 1HIXA 4FBFA 4BJ0A 5F3IA 4NIIA 2W46A 1D0GA 2WWJA 5A7PA 1AR93 3LDRA 3NO8A 1CX1A 3V0BA 4QMAA 3PIGA 1W9TA 1H2KA 2HEYF 3I7DA 2H0BA 4YLZA 4CDUC 1ZRCA 1PM7A 1SACA 4LBNA 2W95A 4E8DA 5I0DA 1REFA 3BTZA 2VOTA 2VECA 3MF6A 5HCHA 4FPEA 4XC9A 1VPHA 1YEWA 1V6MA 4L0PA 4Y1ZA 2AYHA 1KJRA 1Z7S1 2G1MA 5FP9A 5IVBA 1ALYA 2BVBA 4FP3A 4NRMA 2ORXA 4YGDA 2DCKA 1VRH3 5C3PA 2ZEZA 4YW3A 5F5QA 2ES3A 3BKZA 4I30A 2JG9A 1ZA7A 2XWJB 3WX5A 1KGYA 4ASLA 4P9IA 4D8MA 3SH4A 3ZYIB 1GOFA 4XPVA 5A7SA 2BTVC 3ZXGA 4YZ4A 2VY0A 1GV9A 1XYNA 1OT5A 3CJIA 1XNCA 5K7PA 1AL21 3MPPG 4DRVA 2LALA 1OMIA 1F31A 4YVWB 4NIHA 4BQ5A 1V6LA 2D3PA 2QBXA 3OPZA 1XPWA 4XHBA 3IWZA 4A7YA 2ZAHA 3NNFA 3VHPA 1WMDA 1EV13 2JDKA 1VBD2 1W0OA 3MIBA 5K9YA 4XF0A 3ZO0B 1FMD1 3T0DA 3POBA 1X9PA 1UN1A 1RC6A 1PX3A 2PQQA 4MYEA 2RJLA 2WS91 1VMJA 1HJFA 3FWEA 1UYXA 1R091 2V73A 4UBHA 5FP7A 3M3OA 1H6XA 4UW5A 3P5BA 4A3XA 2EA7A 3OY8B 4AZZA 4Q4X3 4I01A 4XFFA 2QDRA 3WQ7A 1I5ZA 1ND3C 3D8CA 1J1TA 1WZXA 2J1RA 3I3EA 3PVEA 3QBQA 1V70A 2YC2A 3BIWE 2R043 5LK7B 4CE8A 1SLBA 3MFCA 4ET7A 4YVSB 4GAZA 4Y5SA 3W5NA 3WQBA 4XBNA 4AWDA 4CDQB 5C5TA 4GIQA 3LIHA 3I3DA 4TN7A 4JKKA 1PO13 2G19A 5H9PA 4Q4V3 2OZJA 4YNIA 4PF1A 5LEJA 3THTA 4YYOA 3H8RA 2JIJA 5I0TA 1W2OA 5SV5A 1LOBA 4BU2A 1GBGA 5IVFA 4A42A 5FK8A 1ZA4A 5FLJA 5T5OA 3RWNA 3THPA 5ABJB 1DQ4A 2ZX0A 5FR3A 2GC1A 3VDDB 3N35A 2R0HA 4Q0UA 4YARA 2MPFA 5FO7B 2VULA 4KWKA 1W6QA 1DZQA 1KQRA 1R1ZA 4QKDA 2XLGA 4J1XA 2XVGA 3JD73 3Q8CA 4IESA 5JIAA 5A3TA 5JOWA 2R072 5JI7A 3NKGA 4WVZA 4AE2A 3B7MA 2LROA 4HVOA 3B9CA 5B4XA 3QH6A 1YUDA 3FJSA 3MDPA 5F1RA 4CEYA 4Y22A 3ZSLA 2A75A 2PAEA 1FPN2 1N3QA 2B42B 4URTA 3O1SA 5E88A 3IDCB 2AH2A 3AK0A 1AXYA 4QGMA 4YGEA 1JZ8A 4LE3A 3ZFGA 3I2GA 4CP9A 3OGGA 3H0OA 4LIUA 3POJA 3R0RA 4TZDA 1G8WA 2ZMKA 3GGLA 4I0BA 3VKOA 4EWAA 3Q8EA 1QOOA 2Z5WA 2C9AA 1US3A 5FZHA 3VBUA 3P6BA 4DEVA 3L2YA 4QXCA 5CFDB 2ZHNA 1A6CA 3O5SA 3HWJA 3I2HA 3O1MA 4I3GA 5FUPA 1QWRA 4N43B 4CPBD 1WMXA 3C7GA 1O3SA 4SBVA 1OA4A 2H6CA 1WLWA 2KM2A 3C3VA 3VBHB 2ARAA 2JDUA 5BYNA 1HJGA 4KG0A 2NP0A 1O6UA 3WDYA 4YG6A 3K51A 4B29A 1NLRA 4LO8A 3WF0A 4AG4A 1DLLA 2DTWA 3OBRA 1DQ2A 2O8QA 2QQUA 2RHPA 3POGA 4XABA 5DUVA 3IB3A 1H8TB 4FQZA 3DPRB 4CDWB 1QHDA 3BPZA 4LO7A 5FPUA 1S2KA 1GOGA 1REDA 3AXDA 4D6SA 1AR71 5F39A 4XHXA 3KQRA 3MLLA 1AYM3 4LBOA 4UF0B 2OQ6A 4XXPA 3DN7A 3NJXA 3U14A 5A7WB 3VZNA 5CG9A 1LEMA 5FZBA 5HXMA 1D4M3 4AOCA 3VBOC 1ZZ9A 4OLLA 1UMIA 5LA1A 2DU1A 3LAGA 3AKQA 4HG6B 1RVF1 4IV3A 4GJZA 4B4PA 3VBFC 3R4DB 1RUC3 2Y34A 4TWTA 4XQDA 2UURA 3LEKA 1YI9A 1YQCA 2GMMA 1M4WA 2W08A 3PURA 3Q8AA 4NPRA 3VGIA 1UYYA 5FZCA 2V09A 3OGVA 4AQSA 1W9WA 2D44A 2VG9A 4MADA 1RUG2 1PHMA 2X53S 3UK9A 3C7FA 3B69A 1UOBA 3U11A 1V9U3 4BMBA 4KI5M 3V56A 2VW2A 1ULCA 1GNZA 4LA3A 3KF5A 1LHOA 4CDUB 4HVQA 2RS53 4J25A 2IUWA 3DV8A 2JEMA 3UKTA 1E5SA 5FYHA 2DFCA 1QJZA 1DQ0A 5H9QA 4DIQA 1JYNA 4ZU4A 2QCSB 4OHXA 5A3UA 4FI9A 1WBLA 2QQPA 2JE8A 3TEYA 2GMEA 3T09A 1MZFA 2RM23 4FPOB 3PJYA 3SH5A 3FZ3A 1K5MC 2MEV2 4CCLA 4Z8BA 3WDTA 1RB8G 3KSCA 4B4QA 2HYKA 4XJ8A 5C3SA 2Z69A 3FFQA 1NY72 2ZGUA 2XMLA 4M3CE 3WLUA 2NPIA 2YHJA 4LLOA 5D1IA 5T5LA 3RZZA 5DAWA 4IV1C 5FMOS 1X9TA 3KGLA 3ZXLA 3HIFA 2EIEA 3ZDSA 2E33A 2GZWA 1MEC3 1LOFC 1RUG1 5A3PA 3M3QA 3K3NA 4Q4Y2 5FK7A 3THDA 4K6BA 4FCAA 1QH7A 2XKPA 1VLNA 1SLCA 1NUKA 3KCXA 5LB6A 2ZS6B 4IE5A 4KL1A 1JS9A 3K77A 3MYXA 3AXEA 1REEA 4OULA 1LHWA 3WCRA 1AJOA 2WWSA 4XFCA 5FYZA 3W59A 3RGBA 5IK5A 1CQ9A 2XUEA 4WM7A 1AX2A 1DGWA 1YRZA 2JKBA 1UU6A 1QNYA 2JD4A 3FBYA 3J7MA 3KMHA 3NRUA 5CADA 4Q1PA 1ENQA 3H3UA 1ND3B 4XJWA 2OA2A 4QPGA 5FWEA 2ILMA 1EAH2 4DNYA 1KS4A 1QJFA 3ZYFA 4B4RA 4BIFA 3O1RA 1W8FA 4CU8A 1H1MA 3RS6A 2RDNA 3OUIA 5CA6A 5CFCB 1S0BA 1YCIA 2ET1A 1GZWB 4XF9A 3APBA 4S2DA 3MGUA 2ID4A 1LHVA 3HOBA 4FT8A 4BB3A 3LA2A 3MHZA 4XUOA 3OGSA 5DPNA 3VD5A 4XACA 1DHKB 4IEVA 2ZGNA 4MGIE 1UCXA 2VUJA 1LJ7A 4O61A 3UKVA 2ZKLA 1E5HA 1NCQC 1RMU3 2UY9A 1YIPA 2W68A 4HZFA 4CCKA 1H9WA 1PK6A 1WMFA 3LIGA 5FY8A 1OFSA 1Y3TA 2JDPA 1VB2A 2RR11 3CL1A 3I97A 3POEA 2GSYA 3OB8A 5E16A 3VBRA 4UOJA 5DDJ1 4QQOA 3WW2A 2EF6A 1W9SA 1OF3A 2HWD1 4L11A 3PNAA 1CIYA 4QHBA 3KV4A 4KQ7A 1IGOA 1KXGA 1YFWA 2W92A 1KDKA 5F5IA 2XBO1 1X50A 3CHXA 1OLRA 4QX3A 4AR2A 3ZXAC 1QJY2 5CAZA 1OH3A 2EICA 3AFGA 4IXLA 2OX0A 4RR3A 4LKDA 3LB9A 2JJ6A 1HRV3 2PHUA 3CNAA 3QD6A 5CKNA 1BVP1 1J58A 2GH8A 4XAEA 2A6WA 3SQOA 1UOJA 1EPWA 3I2DA 2R1BA 1PGW1 4UW4A 3PTRB 2AACA 1H1AA 1RHI1 4C1WA 1MPXA 1XU2A 1Y43B 5AFBA 1HX6A 1GQHA 3O1PA 1W6OA 2JWPA 2ZGLA 2A6XA 1TVGA 5IVYA 1N1YA 3RYRA 2WWUA 3ZXFA 1ULPA 4Q1RA 3WG1A 4AFBA 1AUYA 2JG9C 1W6NB 3IIAA 4K20A 4AXOA 4CXYA 1A34A 2BDRA 5KC5A 4CVUA 1BHGA 3JZVA 4CCNA 4Y5Z0 3W9AA 4TTGA 4A6OA 2Z4FA 4CRQA 3CJIC 4NMIA 3IPVA 4AHXA 3N7LA 2ZA9A 3MFAA 3BCWA 4QPYA 1PM4A 2JE9A 4FPKA 1F2NA 1UMZA 5EYYA 3WY6A 5LZ6A 1CAXB 3WUCA 4A44A 1RUJ3 3TB0A 4FTSA 2IXCA 3CQOA 4ZZ5A 2JXAA 3GF6A 5CYYA 4ZY9A 4ONUA 4XUNA 2A73B 4QPIA 3UJQA 1H9PA 1MS8A 1NT0A 4DXTA 4NPLA 1WWYA 2PA7A 3T2OA 2DBIA 2P34A 3KT1A 5IUQA 1DP0A 1DCSA 4YW2A 3VBOB 1VBE1 1WCQA 1XYOA 4FPFA 3WF3A 4PIZA 2J42A 4AI3A 4AK3A 1OD3A 4Q0SA 3ZFFC 5JXGA 4N8MA 1G86A 3VBFB 1VR3A 2YY1A 2XQXA 3SEEA 4R9CA 2XR4A 4FP2A 3GALA 2HWE3 4W4ZA 4UW6A 1YQ2A 3BUCA 3ATGA 3LDBA 3RYKA 4RS5C 1LEDA 2RS31 2VOWA 4IERA 5FUIA 3SCFA 1VBA2 4K40A 2UY8A 3A4UA 5FPLA 1CAUB 3AKSA 2VJXA 4AVAA 4BIOA 2WFF2 3WF1A 2PHXA 2WSUA 3K4DA 1JZ7A 1OLME 1Y7BA 2YV8A 3T4VA 3N9QA 3DF0A 1APNA 4GZ9A 4MV2A 1GU3A 5I0UA 4WVMA 1HLCA 4K9SA 3CJXA 3N9MA 3IAPA 3Q9OA 4GQ7A 5LK5A 3KZ4C 1QU0A 4JGZC 3VKNA 2WZR2 1COV1 3SH3A 5FY9A 3WNPA 4ASMB 5AFEA 2A70A 3PUAA 1K5MB 3IMMA 3WDWA 1IKPA 3P3NA 5K0UA 1K5JA 5GZCA 1CPMA 3WNLA 2YU1A 2Y0OA 5DABA 5FZIA 1YJKA 1TZOA 3A22A 4K8FA 2W1SA 4AGRA 4PQ9A 4U2AA 4BK5A 3M3EA 4HN0A 3W58A 4CEYC 4IV1B 4PDWA 4KGQA 1C8M3 5F7UA 1DQ1A 1VBA1 3GZEA 4R52A 5FZ3A 4W6WA 3U4SA 3ZSMA 2Q8DA 3T4HB 1UF2C 5FPZA 2R1DA 3ZFGC 5BNOA 2C24A 5FKBA 1V6KA 1HB3A 4MX3A 2YXSA 4IW3A 3RFRA 5T52A 1JZ2A 4EN8B 3OJBA 1OFNA 5FZ9A 3FUOA 3O7OA 4YW5A 1UOGA 2DCTA 4YPJA 1JODA 3JU9A 1O59A 3VBUC 5KWRA 4LLFA 3TEZA 1SZBA 1UZYA 2I45A 2WZR1 5D8AA 3WXPA 1RUNA 1W6PA 3NQHA 2PAKA 5E6HA 3ZSKA 4Z82A 2CGPA 1GYKA 1RUI1 1W8ZA 1DGLA 2W91A 2BWAA 4HN1A 2UYBA 4NWVA 3N9NA 5IK8A 2D7FA 3ZN6A 3N9PA 2CYFA 3E1F1 2JB4A 2CSGA 2EXKA 1C1LA 3O1VA 3BN6A 1C1FA 2P3KA 3J8F3 4PLMA 1BQPA 1UU4A 1FX5A 2WAOA 4B7EA 4GKYA 5FLIA 3RVHA 1XSRA 2CDPA 1PMHX 4NHXA 4QXHA 1VBB2 2OKXA 4Y1VA 1YI7A 1W9YA 2WBKA 3D0JA 3A21A 4JKLA 4CSWA 1VBC3 2XOMA 5F3EA 1NCQB 4AEDA 2VVEA 1BEV1 2GALA 3MIGA 4EN0A 1R082 4N90A 5FQ0B 3AM2A 1PNGA 3GXUA 3NMBA 4L99A 2RG4A 4EN9B 4HPKB 4YVWC 2XUMA 1B09A 4O9GA 4MGYE 1WA6X 1G9CA 3M4FA 3VKMA 4CYDA 4LUKA 4GB32 4IV3C 4ZPIA 4KU7A 3NV2A 3MV01 2WO2A 3A0KA 3EYPA 4NVPA 2DBNA 2WSVA 2ZJCA 4NJ4A 3U10A 1W9FA 2OXBA 4PF5A 2DVFA 3FLPA 4BISA 4E4DX 4EZHA 1LULA 2VXRA 1I5PA 3KV9A 3N36A 4HSJA 4S2HA 1PVXA 2VR4A 1K3IA 2IXJA 4P9YA 5KXEA 3VZLA 2XH6A 2KXLA 2B39A 4PI0A 5CIRA 3WD5A 1W8OA 2Q1MA 4S2GA 1KFXL 2X09A 2P37A 4BOWA 2DCZA 5LW9A 4QU1A 3WW3A 3V0BB 2WJSA 2BFUL 1TEIA 3AKRA 1XRUA 2ARXA 1H2LA 4INDA 3DL3A 1L3JA 3U07A 3VDCA 5A7NA 4HOOA 4F83A 5C33A 1KS5A 1XNTA 2HWB1 4G3YC 1VAVA 1VBB1 1UX7A 3CDZB 4V1PA 3TN93 4YGCA 5JOXA 1Q56A 4AI8A 2A3XA 3PVNA 3AZVA 4BLJA 2GDFA 1QQP1 4LTAA 4AQ2A 2D6PA 3H42B 4CDQC 1XU1A 4BQ2A 3PUQA 5HV0A 2NLRA 4QDRA 4LOTA 1C28A 4EWDA 3E5QA 3EJKA 1YJLA 3ZR6A 2D6LX 1KRIA 1HRI3 1F15A 1UPIA 1PO21 3I2OA 4GB31 4CEWA 2VMCA 2W1WA 1L7QA 3LKJA 1RUF3 3LDKA 2JG9B 3BTAA 3CU7A 4UFLA 3TBDA 1DGRN 1IG0A 3B9IA 5G05L 1CPNA 4FOVA 4Y26A 5A6ZA 2WL1A 1ZBE1 5BNQA 5G04L 4RQPA 4CUCA 2BVVA 3CJIB 5A1AA 1IS3A 4KBZA 1W04A 2E32A 1JHJA 2JDMA 3IDAA 2W9XA 4Q8LA 5ANQA 5C8CA 2VNVA 4LBLA 1AR91 2VCMA 2Y6GA 5FZKA 3OUHA 1JYIA 4DO0A 2QQWA 4FFFA 3H8UA 2P3YA 4PIXA 3RDIA 1S0DA 3B3QE 5L9VA 2VW1A 3N3HA 1RJ7A 4XUQA 1STMA 2WN3A 1EP0A 4HXCA 3VBSA 2ET7A 2JDAA 3AP6A 4CCCA 3UYJA 1WGPA 2VZRA 5BUVA 4HANA 4CCOA 5JDBA 3UJOA 2R062 5CU1A 1VALA 4Z1VA 2I07B 4AGGA 3ABZA 4EN6B 4XUPA 1VRH1 2ZGMA 4IE6A 1V6NA 2ZX3A 3RI9A 3F2ZA 4E2GA 1OA2A 1HXS3 4QPGC 4RS5B 1BKZA 3PU8A 5DAXA 1UX6A 4Q4X2 5CFDC 2BJSA 2JG8A 2JIGA 3MIHA 1SBFA 4IEQA 4N53A 4OHZA 4AVBA 4V2VA 2R30A 5JOYA 1W2TA 1ZRRA 1VAMA 1D0HA 1AR82 1J3PA 3J7NA 3SLIA 3FUQA 4DXRA 3WF4A 5DMYA 3C2UA 4P9GA 2RVAA 2XGXA 3S6PA 2BEOA 1JOBA 3JB4C 4JV4A 1WW7A 5L9RA 5JMOA 1PK6C 4YG3A 3ACIA 4YZ2A 3WSOA 4QX0A 4LT5A 1T2XA 1EV11 3AYEA 1GMMA 2TEPA 4YW7A 1W6QB 2UWAA 1YXWA 4D69A 4YZ5A 4RGKA 4NHYA 5ACA3 4NRQA 3WW1A 4YM2A 4X6QB 2UU8A 3RPQA 2Q5TA 1O5LA 1XXNA 4MG2A 3WOGA 4CEYB 4Y22B 1Z7S2 1PZ9A 1FNZA 4HK9A 5FV3A 3VZMA 4AAPA 2YC4A 2WZ8A 2YBKA 2YZ4A 2FHRA 3SCGA 4Q4X1 4GULA 1KFUL 3K4ZA 4X6RB 5T5PA 1CJDA 5LY2A 1SG3A 2R041 4RR3C 3I2KA 4I3PA 1KEXA 3ZFGB 4A3ZA 4CCJA 3HN1A 2Q8CA 5DUUA 4CP9B 5AC93 4ISRA 5A3LA 4XF3A 3VD3A 5FYCA 3M3IA 4IGPA 2DU0A 2GNBA 3M7AA 4OI1A 5JWPA 1PO11 1W03A 1YC61 4Q4V1 3SMHA 3RZLA 2HBUA 2GC3A 2DV9A 3VBUB 2ATFA 1AL22 1AR63 4JZRA 5EYXA 1LECA 1OI6A 4KH9A 3QLQA 5F6KA 4UWDA 2KR2A 3KWVA 3UGFA 1FV2A 2OPWA 3VN4A 2WDBA 2WKKA 2WFPA 1ZBA3 1QDCA 1W06A 3PMEA 3JD71 4MLOA 4GMP3 2K9ZA 4M3CF 2ZGTA 2SBAA 4MVTA 4FTBA 1RUH3 1FMD2 1TMF3 4JKMA 2VZSA 2HWC3 2O14A 2WS92 4IL7A 5DZGA 1MS0A 1IS5A 2W3JA 3CZJA 4UFJA 1R092 2B5HA 3AC0A 4XILA 3VKLA 3ZMNA 4R9AA 5FZMA 4LULA 2WO1A 2MNGA 1C8NA 2IVJA 3B5LB 4OHYA 5EP9A 3ZM8A 5KC6A 1OH4A 3CLPA 2XJTA 5KHKA 3V64A 1ENRA 4DINB 3LGRA 1ULFA 4Q0QA 5C70A 4D94A 4QPIC 4EROA 3NWKA 4A2UA 3AMHA 4N9IA 1SLIA 1UKRA 2GU9A 2ZEYA 3OGRA 1W3VA 2AEZA 4KGGA 3X29B 4Q29A 3USUA 4BQ4A 5KBFA 4BXSV 4IV3B 5L19A 2VUDA 5J96B 5FZ0A 3D82A 5A3MA 2RDRA 4META 4Y4RA 4FSJA 2ENRA 1O5UA 1PIV3 3ACHA 5J1XA 3OEAA 5FYYA 3I2JA 5A1LA 1IPSA 4WVWA 3H3LA 3NJYA 5DAPA 3U37A 3NNJA 4HKLA 1UY0A 4HSLA 5FMDA 3FHQA 1RGSA 3Q8FA 4GWNA 2Q30A 4Q2FA 2P6HA 2X05A 1PVC3 5K8SA 1AVBA 5A80A 1HB4A 1ZVFA 5FY5A 2C9KA 2NYYA 1GZ9A 3VD7A 4QGLA 1GZTA 3W21A 3WHTA 4COYA 5SV8A 3E5XA 1LOGA 3VHNA 3MUY1 4XDPA 1AYM1 2GN3A 2ZXQA 5CFCC 5K0UC 1ENSA 2P3JA 5I91A 1VMHA 5J37A 5KXCA 1D4M1 4P9JA 5F32A 1DG6A 1C5IA 2VOKA 4OUEA 3AYCA 3R05A 4RFRB 5JI9A 1DFQA 2DVBA 2VE1A 2FZ1A 1DQ5A 3NNMA 4PDWC 3SKVA 1RUC1 3LPFA 1BBT3 3N9OA 4WBBA 2VAUA 5FJKA 3WCSA 2WLQA 3ETPA 3G7DA 4HK8A 3FLTA 1S1AA 2WC2A 1NOVA 1MEC2 2HLEA 3HQXA 4O9EA 2O1QA 1Q8VA 1UW8A 2ERFA 5BNOC 5IVVA 1V9U1 1GQGA 4RD7A 1SLAA 4XBLA 1XNBA 1LOEA 1W05A 4FO9A 2FDFA 5FP8A 2RS51 3ZIXA 1ST8A 1S0CA 5C8WA 1HB2A 3IDBB 3POIA 2IFRA 4C90A 3OBTA 4JTOA 5D8AC 2QQKA 1S2EA 1Q3EA 3ZYGA 5IVJA 2RM21 2CTVA 1RXFA 4UFIA 1JYVA 1WKYA 2EVXA 4WM7B 3HEIA 4LA2A 4Q27A 5JSOA 4DUXA 2QUOA 4X8PA 4IDZA 1AR72 4RHV3 2YUEA 3R6SA 2OZ6A 2F17A 4QHOA 5FUNA 1GNHA 2IC1A 4E9KA 5FYMA 2WABA 1RUD3 4QPGB 5IVEA 4COZA 1ZZBA 2IXLA 2N7GA 3C8XA 1QJX3 2A7AA 2OQ7A 3AZYA 4YW6A 3I3MA 1W8UA 3ON7A 1RVF2 3NJZA 4XW3A 5I8YA 2RS13 4MGSA 1IQAA 2WQ8A 3LE0A 3LEIA 5FPAA 4ZXEA 1MEC1 1W99A 4A7KA 2W52A 1YNAA 3VL8A 3VL9A 1ND2A 1CGPA 5L36A 2RMU3 5DG2A 1OPOA 3HR9A 4Z2AA 4UFKA 3ZXDA 3OEBA 3S5QA 4UFHA 3E6CC 3AP7A 3B94A 3WNOA 1AYN3 4MGKE 3PUHA 2OYZA 3ZSEA 1IS6A 4AEDC 4QX5A 4PBOA 4XFAA 3KT4A 1PK6B 3O0WA 4TXWA 1LGNA 1W28A 3AMMA 1KDMA 3VBRB 1CZTA 2HH9A 3QCWA 5GJ6A 1CZVA 1DIWA 4UAPA 1LB2A 2D97A 4QXBA 5D21A 3DKQA 1LGCA 2EXHA 5JCTA 4LBJA 2ORZA 3EBRA 1POV3 1OOPA 1KJLA 4Y24A 3HNYM 4ARXA 1F9KA 3WNNA 1NZCA 2FDIA 4JHTA 5CKQA 2J22A 2QDNA 4NHMA 4XAAA 1AXZA 2DVDA 1OF4A 2QFEA 2ZKNA 4RR3B 4A45A 3WNXA 4CP1A 3FC0A 2K2SA 4JCKA 3BI3A 2VTFA 1MACA 1OKOA 1ULDA 2VZOA 3MW4A 2JICA 4F7ZA 4LNVA 1JU4A 1UXZA 1W0NA 3J4UH 3ALQA 1W6OB 3NVCA 4Q26A 1CR7A 2FZ2A 1X33A 2D6KA 1LENA 1RMU1 3FHAA 2Y64A 5FMBA 3TNQA 4D0QA 3D4KA 1XSQA 4G4FA 2BNOA 4L97A 4CEWC 1SCRA 1FT9A 2VZPA 4AFAA 1C5HA 4JDMA 2Q8OA 3SHRA 2O0OA 1JZ6A 4Z07A 4S2FA 2IVIB 4C1XA 1VBD3 2WIIB 1WW6A 3TEWA 4NIGA 1V6IA 4XOGA 2LTNA 1XNDA 4PQQA 3FE5A 4RQPC 3RJRA 1BMV1 3AKTA 4Q8KA 2VVFA 2GC2A 3IPVB 4MH0E 1O3TA 3KVBA 2ZMLA 1HN1A 5F2SA 5C8CC 2XJQA 2K46A 5FYIA 5I93A 5JOZA 5HXVA 4K1ZA 4AI2A 1QDOA 3GBFA 1XE0A 2Q8EA 2SLIA 5A3WA 4CXXA 4EJRA 3ZOIA 3RMYA 1HRV1 1OBNA 4D7TA 3DGTA 2Q4SA 3AVSA 3CO2A 4LKFA 2X8KA 4IETA 1RUJ2 5FZFA 5FFOC 2FDJA 4QPIB 5H9RA 2FCUA 3VBSC 4BQ3A 3KHCA 1BK1A 3QOPA 2WNUA 3U0ZA 3PMSA 1HN0A 5LRRA 2AREA 1Q43A 3KB5A 1VRBA 5FYSA 3UGGA 4JHZA 1G6NA 3AX4A 2XWBB 3MLJA 4YRDA 1FYUA 2BGPA 5IAVA 2ZEXA 2F6BA 1S0GA 4AQ6A 1LRHA 3ZR5A 3NV3A 4KBBA 2YG0A 4M3CA 1F5JA 3K48A 1UYPA 3VZKA 4DXZA 3KGZA 5A33A 3A0NA 1A8MA 3WR0A 4N53C 1ODNA 2RR12 4LQRA 2WRAA 3TAYA 1C57A 4ZHNA 5DDJ2 3TYJA 4J1WA 2P4EA 2WQZC 4HKOA 1URXA 2R073 2HWD2 1HQWA 1MS1A 3SKJE 5JLVA 3LOBA 3JUUA 1NQJA 2XKOA 4L9BA 3WINE 2XPJA 1O8PA 3KHBA 4LKEA 1I3HA 4WVMB 1FPN3 3IAQA 2XBO2 2B9VA 3VZOA 3HPNA 3ASIA 1RUJ1 4KMQA 1VIWB 4YFWA 3AVRA 5EIYB 1W2NA 4Q0PA 1OLQA 2Y0IA 4P9LA 4M0HA 3INAA 3H9AA 5DAVA 4Y20A 1NE4A 3B00A 5K0UB 5FWJA 3PLQA 1UY4A 1PX4A 1PGW2 2XLAA 1VE0A 3AJYA 2OIIA 3GBWA 3ZYBA 4XFHA 1K42A 5FZOA 2QQLA 3ZN4A 2A1XA 4C91A 1RHI2 2QTWB 2PLV3 1CWPA 2DF7A 1FNYA 1FOD3 3MEPA 4L2NA 4AYUA 3FMGA 3BU0A 3SISA 2NQYA 4PDWB 2HJIA 1ULEA 5J7MA 2HWE1 3USSA 5IK4A 4AF9A 3ELNA 2ZBJA 5FOBB 3H50A 3KCYA 1DYOA 1D4VB 5AVAA 5BNOB 3GJBA 1KD7A 1CJPA 4GJYA 1PGL1 3C7OA 1WD3A 4YZ1A 3DYOA 4FOYA 4TLGA 5FRAA 5FO9B 4PCRA 1O8SA 5GLWA 1QH6A 3WUDA 3U4XA 1R1A3 4QHZA 4AFCA 5FY4A 2MHFA 3ZYJB 4R9BA 2I74A 2VM9A 5D8AB 1W6PB 2ARCA 4QQLA 3ILNA 2E7QA 2IXIA 3RI8A 5JIUA 3MIFA 2VZ3A 4HMZA 5APAA 4QX1A 1XOYA 1H4HA 3ZN6B 2CY6A 5FXZA 4OQ9A 1WA4A 4LKSA 1B35A 2Y6FA 5A32A 5HPOA 2DUPA 2PMWB 1Y9MA 3GM8A 4BQ1A 1Z78A 5A6YA 4M0NA 1O4TA 4WZCA 1VBE2 5FZ8A 2D6OX 4Y1UA 5A6QA 1UWWA 2ZHKA 1F8VA 3LZZA 1C8M1 2JB8A 1DQ6A 3WDUA 4YW1A 2YDEA 3WP6A 5JZGA 1JUIA 3R4SA 3ZFEA 4OHWA 4AEMA 4XUTA 3O14A 1M06G 3B02A 3AP9A 5LBFA 1JZ5A 5FYBA 2ZZJA 2XHNA 4KWJA 3LSEA 1AX1A 3GZTB 2RS32 3ZYRA 5KXDA 5EZWA 1FAYA 1QIQA 1ZZ8A 3ZPOA 4AEDB 1SBEA 1VBC2 4LMFA 3AL5A 5B2GB 2NM1A 1Y9GA 3OYWA 2ZZQA 1CN1A 5C3QA 2WLPA 4IGOA 1V0AA 4LXLA 3UKNA 2JENA 1CVNA 2QZ3A 1QY4A 1COV2 3WNMA 1BJQA 1FV3A 2HEVF 3MUZ1 4DPNA 5L7OA 4DB5A 2CAVA 4OI4A 1CAVA 2MEV3 1UAIA 4QPWA 3E5UA 4P5HA 5DAQA 5ANNA 5FJHA 3LA3A 3L2HA 1N47A 3LEGA 5JXIA 5EWSA 4IEPA 4XFBA 4Y1XA 4K7JA 2XL9A 2JDZA 4NAOA 4ES8A 1OQ1A 2QQJA 1H30A 2J1SA 4IQPA 3HQRA 3MW3A 4BWOA 2G9FA 4CUAA 1ONAA 1MVQA 2C0ZA 1VBC1 2PHRA 5T5JA 2D6NA 4Q4Y3 2VQAA 2WNVA 4EWEA 3PJQA 2VTXJ 1F4HA 2IWGB 1G9FA 2WNEA 5AVPA 4ZU5A 4BPZA 5IT6A 3T2PA 1S0FA 4CEWB 4E4ZA 4D6QA 2YPDA 5JXHA 1RINA 2FCTA 3KVAA 2RV9A 1PGSA 1QEXA 2YU2A 4RQPB 1RUI2 1PZ8A 3K4AA 1GP5A 4HT1T 5KHHA 4LO5B 3LPGA 4D6RA 5B4NA 5C8CB 4XETA 4KWUA 1DYKA 4NHKA 1MZEA 4FXGB 4H3WA 4PHZA 5HCFA 3SNMA 4LBQA 2ZABA 2AZ5A 4FOQA 4MXVA 1OLMA 3RQ0A 2BOJA 3EO6A 1ASJ3 1EAH3 2YBPA 3BPSA 2JX9A 2VBDA 3CKHA 2EAKA 3TN91 2ZMNA 3VBSB 2TNFA 1D2SA 2ZCWA 2XQRA 3ACLA 3OBAA 4B7KA 4BH9A 1OD5A 2XB6C 2VMGA 2E6VA 4JRLA 2HWF3 5C5UA 2DVGA 1HRI1 5FCCA 4WV8A 3JQWA 4P9WA 1BEV2 4CP0A 4F3JA 1RUF1 2EIDA 2AR6A 2DUOA 2JG8B 5C3OA 4N53B 5C9AA 1HXS2 1L7LA 5LA2A 5FY7A 1BVVA 1XE8A 2VZTA 3N7KA 4FAHA 1RITA 4PJYA 1UKGA 3FBMA 2F4LA 2IXHA 2BUKA 2ZAAA 4YG0A 2VVDA 4BCUA 1ND2C 3E6DA 2W5FA 1JOJA 2BNMA 3JBG3 2IFWA 4LK6A 4PLOA 1QJY3 5A7OA 4EV0A 1UPSA 3TRSB 4UT5A 1GICA 2VQTA 3KCCA 4A7ZA 4CXWA 4GWMA 4YFZA 5IFTA 1W39A 2PHFA 3I2IA 5JXJA 2HWB2 1WLCA 1LNSA 4H14A 2QQVA 5FBJA 1H2NA 5FZLA 5J09A 1QQP2 4FFIA 1HQLA 1BZWA 1YQ6A 2BW8A 3GZUC 5FTTC 1OUSA 2J1AA 3N9LA 4COVA 1HXS1 5FZDA 4CU7A 1PO22 3NAPA 3OTFA 1HKDA 1XQNA 1E57A 1ZRIA 3BU7A 3THCA 4PBPA 4YM3A 5C7GA 3HN3A 2WT2A 4NO4A 3JB8A 4BK4A 2AGSA 2XDVA 2W1UA 2QZ2A 3BOWA 1ZBE2 1QGLA 1LTEA 3K75B 4Y5TA 5AC92 2GNMA 1K12A 4COWA 4OYUA 2E63A 5EQUA 1IOAA 1SQ4A 5E1RA 1U5XA 1U5YA 4X8NA 5T3NA 4QM8A 4P9XA 1AR92 2CWMA 2VBPA 3L9JT 1NZIA 5HCBA 3ZN5A 4DOUA 1XC6A 3WQ0A 3O12A 4E2SA 5HBAA 4GA9A 2YGMA 1UY1A 4RA0A 5DUWA 2E31A 5DXDA 3JXSA 3VKFC 1QOSA 1MS4A 2X5IA 2ZGRA 4AFMA 5FKCA 5ACA1 3SCHA 1WCUA 4D3WA 3S57A 4H2AA 4AVVA 4OI0A 2W39A 4QT6A 2ZGOA 4MZUA 3URFA 5FY0A 4UW3A 5F5AA 2CU5A 3PVOA 3U78A 4CCMA 3VZJA 4ZZ8A 2ZGQA 1VRH2 2G9GA 1NCRA 4LHKA 3HT2A 2YPJA 1AZDA 3RMXA 2H0VA 3I59A 2HYXA 5AC91 1VBA3 4HVRA 5JVVA 3RNSA 3H8OA 1ZX5A 2WO3A 4ASKA 5FMOL 3ILFA 1X7NA 1W8HA 2WNUC 5DQ0A 4AVTA 3O1OA 5EV7A 1AR61 1TME3 2WFF3 2PHTA 4JAAA 2PHWA 4FPLA 1T6GC 1FATA 3LEMA 4YGBA 5LA9A 2A6VA 1ENXA 2Q1FA 2WR9A 2G9ZA 1PNFA 4CUBA 1HV0A 1ZBA1 1NA1A 2EXJA 1QJU3 3FLRA 2HEWF 4NOTA 3SEPA 2FD8A 2Y6JA 4CDXA 3JCIA 1EV12 2WYSA 4GMP1 4OZOA 1US2A 4QXKA 1O3QA 1VMFA 1WW4A 1RUH1 4OI2A 1TMF1 4WM7C 1VB4A 2HWC1 2A5ZA 3I2FA 3BB6A 4WM8A 4DUVA 4LUMA 4K3UA 3TOJA 2WQ4A 4JQTA 4FTEA 2D3RA 1GUIA 4IGQA 4P5YA 1F35A 1N3PA 5FZ1A 4AHYA 5BNNA 1JBCA 3EXUA 1EPZA 1XYPA 1EY2A 2XXZA 3ACGA 2PHDA 5KXBA 4XXAA 2VZUA 1JYTA 2JDYA 4R4XA 1Q8SA 2BNNA 5KHGA 3OUJA 5ERLA 2R042 5EJ3A 1J1LA 3HVDA 2WYFA 3WZ1A 3ME2A 5DZEA 3WV6A 5FZ4A 2WUHA 1NG0A 2VC9A 3USUB 3VDBA 2VCAA 1PO12 2E26A 4Q4V2 5IW0A 1WBFA 3CIHA 3DXTA 2VZVA 2VH9A 5A3OA 3WVJA 1JUHA 3OGJA 2P6CA 2YGLA 1R64A 3POSA 1GKBA 1PIV1 2V4VA 5BY5A 3SXWA 1I6XA 1MQTA 2Z79A 1X82A 2XHKA 3VBRC 2O8OA 3JQXA 3M70A 5KHIA 3ZYPA 1C4RA 1RUE3 1YO8A 2Q1ZB 3GYDA 3POYA 2ARBA 1BYHA 1UQXA 2EIGA 3JD72 2B9UA 2TUNA 4C0BA 4JVAA 2QKDA 1YLLA 4RFT0 1IQDC 2XVKA 1E5IA 1PVC1 2ZHLA 3R4UA 4Z2WA 1JI6A 3LWCA 3AP5A 3IM0A 2FMDA 3PU3A 4AI9A 2VMEA 4MXWA 1JU3A 1ACCA 2B4KA 5EXOA 1OVPA 3RSJA 2QNKA 2WA3A 2GNTA 4KWLA 4ZXKA 5LBBA 5BNPA 1L7RA 2XG3A 3PTYA 3EQEA 5I0RA 4HLTA 4RHV2 2PXJA 4Q4W3 4WVVA 2VUCA 1XNAA 2D6MA 1R083 2EALA 4O65A 3FN9A 4TSVA 4LR4A 3UT0A 2VQUA 3CEWA 3OD4A 4OVEA 2DURA 4LE4A 1QJX2 1BBT1 4QQ2A 5CEHA 2WT0A 3CF6E 1WCKA 3ZKYA 4E4SA 3ZFEC 1W8TA 5E89A 1OHFA 1LESA 3UGHA 4IEZA 1ND2B 3HNMA 5LA0A 3RZMA 1DGWX 2GC0A 5FPXA 1IPJA 1X8MA 2QJVA 1GWMA 1QF3A 3H1YA 3BIEA 2P3IA 1CAWA 4DUWA 1BLZA 3I8TA 1AYN2 1S2BA 1S0JA 3HNBM 3PDQA 3WT3A 3AL6A 5LBCA 2YFZA 3D0SA 2DCYA 1W6MA 2VTXA 2C5DA 4AFDA 1JZ4A 4NIAA 3D5OA 1OOPB 1UY2A 4MUVA 4RHV1 5L7OC 1AXKA 1GWKA 1AYM2 2RDQA 5A70A 1RUD1 1GP4A 4MGQA 3AKPA 2W87A 4NRPA 2W94A 1D4M2 2E9QA 1QJX1 4QD2A 4XTMA 2PFWA 4ZS3A 1SFPA 2E7TA 5FMCA 2RDSA 5FY1A 3VUOA 2RS11 2QQIA 4JX0A 5FO8B 1RUC2 4GALA 2P1BA 4UBGA 5GZDA 2RMU1 3BYWA 3K2OA 5E8AA 5DUXA 4R8HA 3BVCA 1IPKA 4OFGA 2WNVC 1IS4A 3PUSA 1AYN1 3WW4A 5FOJB 1V9U2 4E27A 1PZ7A 4E8CA 2QE3A 5BV6A 2RJKA 1KITA 4XVHA 3T1MA 4QB1A 2RS52 2QVSB 2XJVA 3RZKA 3WQ1A 3ILRA 4M01A 3HBZA 3UESA 1UZWA 4ATFA 1SLTA 1POV1 3UNPA 1J84A 2RM22 4XYXA 5CVRA 1CZSA 5K4LA 4AQTA 2PTMA 1HV1A 2R063 1QMJA 3RG0A 2BV4A 1BXHA 3GZAA 3NNGA 4P02B 1UZ0A 3V0AA 3ZFFA 1TG7A 4YM1A 2PHLA 2ZACA 1ZRFA 3LA7A 5FZ6A 1LODA 4EZ4A 4XCAA 3O0XA 5DG1A 1LAJA 2GP5A 2CL2A 2VNGA 2RJ2A 4LK7A 5JR7B 3KM5A 4MSVA 2LM3A 4QX8A 1XB9A 2PQSA 2EAAA 1AR83 2WNUB 3AYDA 1SPPA 5JAXA 5IYYA 2EXIA 4IUGA 5C4WA 1GNYA 1DF0A 2D5HA 2R7EB 2VMIA 4FPHA 4M4RA 3T30A 5LWBA 1OSGA 1SDWA 5F37A 1J3RA 2CHHA 4BM8A 4CUGA 1T6BX 4J6GA 3H1MA 2ZGSA 4M3CB 4B1MA 3N7JA 5FDBA 3AZWA 4E4HA 2Y60A 2BRTA 3GNEA 5A33B 4B3NA 4OUSA 4JGZA 3BTXA 5C9AC 3BTYA 1MR5A 1D2QA 3DCQA 4A6SA 1NLQA 1VBD1 2VMFA 4WZFA 1DBNA 1UIJA 1GLHA 2BERA 2QQOA 1PMJX 5CKMA 1VAKA 1Z0HA 3BODA
chains in the Genus database with same CATH topology
2WR9A 5D2AA 2WRAA 5HCHA 2JDHA 4UT5A 4CE8A 5A70A 2XR4A 1GZTA 2BP6A 2VUDA 2JDPA 5A6ZA 1OUXA 1OXCA 3ZDVA 5A3OA 2JDUA 4AOCA 2CHHA 5A6XA 1OVSA 2JDKA 1OURA 1OVPA 5A6YA 2JDNA 2BOJA 2BV4A 2JDMA 1W8FA 2BOIA 5A6QA 1W8HA 3DCQA 2VNVA 2VUCA 1OUSA 1UQXA 2JDYA 1UZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WR9 A;  5D2A A;  2WRA A;  5HCH A;  2JDH A;  4UT5 A;  4CE8 A;  5A70 A;  2XR4 A;  1GZT A;  2BP6 A;  2VUD A;  2JDP A;  5A6Z A;  1OUX A;  1OXC A;  3ZDV A;  5A3O A;  2JDU A;  4AOC A;  2CHH A;  5A6X A;  1OVS A;  2JDK A;  1OUR A;  1OVP A;  5A6Y A;  2JDN A;  2BOJ A;  2BV4 A;  2JDM A;  1W8F A;  2BOI A;  5A6Q A;  1W8H A;  3DCQ A;  2VNV A;  2VUC A;  1OUS A;  1UQX A;  2JDY A;  1UZV A; 
#chains in the Genus database with same CATH topology
 2NMN A;  1N3O A;  1NXM A;  3OPT A;  4FPC A;  5D2A A;  1W2A X;  3HJR A;  4KG8 A;  2NZ9 A;  5L73 A;  3W20 A;  4JDO A;  5GLT A;  1Z7S 3;  1NAE A;  4BQX A;  1JYW A;  3WEZ A;  2UYA A;  4U36 A;  1LHU A;  2BP6 A;  4JGY A;  1HB1 A;  3H7J A;  4ITC A;  2AEY A;  3J7L A;  2C4X A;  1YIF A;  1PGL 2;  2BBV A;  4K1Y A;  4FVV A;  2CNA A;  5GM0 A;  1OXC A;  2YC0 A;  4Y20 B;  2DCJ A;  3MID A;  1RJ8 A;  2VMH A;  4P14 A;  3DUI A;  3O0V A;  4H7M A;  3WG3 A;  4W65 A;  4DXS A;  2BOI A;  5FZO B;  2UWB A;  4MOA A;  2Y8K A;  3RRD A;  3HD8 B;  3MF9 A;  5DZF A;  3VD9 A;  5CB7 A;  5I8T A;  1AL2 3;  1OPM A;  2A6Z A;  2PLV 2;  3IN9 A;  3K46 A;  2ZTN A;  1FOD 2;  2JD9 A;  1RMU 2;  2JE7 A;  4Q0V A;  1LR5 A;  4R4Z A;  2K0G A;  2VQ0 A;  3MO4 A;  5DN2 A;  3NL1 A;  2VNR A;  3NAP C;  3CZU A;  3OG2 A;  4DQA A;  4PLN A;  1UMH A;  2R07 1;  1A8D A;  1H8V A;  1JTZ X;  3ZDV A;  5T55 A;  3LCP A;  1BMV 2;  1FMD 3;  4L8Q A;  2LRP A;  4L92 A;  4DZG A;  4XMI A;  2WS9 3;  1FPN 1;  4GMP 0;  2AEN A;  1LCL A;  1R1A 2;  1R09 3;  1ZZC A;  1MZ5 A;  1YWK A;  2J1T A;  4XFG A;  1JN2 P;  5EFU A;  2FQP A;  1UOF A;  3A23 A;  3WG4 A;  2BWC A;  3LQC A;  1ZYB A;  1LU1 A;  4HL0 A;  1HRV 2;  5IAT A;  3UV9 A;  1G9A A;  2YYO A;  1MS3 A;  1O4Z A;  2ZX2 A;  4GH4 B;  3KLS A;  4LEJ A;  2Z2S B;  4MHR A;  4QKB A;  1B35 B;  2BYV E;  2X5I C;  5A32 B;  2R6Q A;  2VBB A;  3MV1 1;  1U0A A;  2FMY A;  2WNO A;  3PHM A;  2B45 X;  3NV1 A;  2PLV 1;  4OMD A;  1FOD 1;  3MZH A;  3NW4 A;  3T2T A;  5HCA A;  3FFZ A;  3I4I A;  5J36 A;  4YVW A;  5JZG B;  3ZFE B;  4LHS A;  2R0F A;  4QU2 A;  5T54 A;  3KV6 A;  1NCR C;  2OUJ A;  3KQ4 B;  3HAG A;  5HV4 A;  1U12 A;  5JUV A;  3ZXK A;  4AW7 A;  2XON A;  2FDG A;  2Z42 A;  4CPB A;  1TE1 B;  5FPV A;  1GQP A;  3DYP A;  3PUI A;  4LOS A;  5CNA A;  2BFU S;  1Y9Q A;  1R1A 1;  3LOI A;  3OCP A;  3POF A;  3OYW B;  4IE0 A;  5LAS A;  4EE2 A;  2GMP A;  3GBG A;  1GFF 2;  1QKQ A;  3SC7 X;  2CDO A;  2PN5 A;  4LIT A;  3WG2 A;  1CD3 G;  3OY8 A;  2EIB A;  2BBA A;  3HT1 A;  5F6L B;  2V4A A;  4ISQ A;  2VOV A;  4XMA A;  2WZP P;  1NA1 C;  1QNW A;  4ZS2 A;  3ZKU A;  5L7O B;  1LU2 A;  1O91 A;  5KR7 A;  4CDX C;  2ZGP A;  1CAV B;  3KS7 A;  4YVS A;  1H1I A;  3WP3 A;  1PMI A;  4CDQ A;  5A1F A;  5FRE A;  1YFU A;  2IXK A;  1P8J A;  1GR3 A;  2W47 A;  1W0P A;  5F9T A;  5JPN B;  4WM8 C;  4OQ8 A;  2Q0A A;  3EB7 A;  4FOW A;  1WCD J;  4BDV B;  2ZEW A;  1OKQ A;  2GN7 A;  4YW4 A;  4IE7 A;  3ST7 A;  3WP5 A;  3ZLI A;  4BQY A;  5BNN C;  4IEW A;  4AEK A;  2E51 A;  1LKN A;  5I8S A;  4NN0 A;  5ABJ A;  2HWE 2;  4XDQ A;  2JG8 C;  5J3U A;  2A3W A;  5FYU A;  3VDD A;  5ISL A;  2TBV A;  1X36 A;  5C3R A;  1MS5 A;  1DLC A;  2E7A A;  2WNV B;  3AMQ A;  3AZX A;  1GZC A;  3U1X A;  4HON A;  5A3N A;  4YZ3 A;  4SLI A;  4BME A;  4Q5O A;  2NN8 A;  3ZX7 A;  4QGN A;  1SBD A;  1SDD B;  3FX3 A;  3U75 A;  2JKX A;  1AHS A;  5GLV A;  2KA3 A;  2OS2 A;  3C7H A;  4OZX A;  3I54 A;  2J1E A;  5FZ7 A;  3MIC A;  4ZU7 A;  2OVU A;  1UIK A;  5KHJ A;  5FP3 A;  2VCC A;  3T3Y A;  1MQT C;  3WF2 A;  4CCE A;  4BA6 A;  4IEX A;  4XJU A;  2MEV 1;  3AZZ A;  1NKG A;  1NLS A;  1AR7 3;  3IT8 A;  3MBW A;  3TNP B;  4JDN A;  3H8X A;  4XF1 A;  5JPM B;  4LBQ B;  3M8L A;  1ZM1 A;  3IKW A;  4IEY A;  1NY7 1;  1XBF A;  2B8M A;  3T0B A;  2YB7 A;  2D43 A;  4FPY A;  1YQ5 A;  3S30 A;  1JMU B;  1Q8P A;  3KD4 A;  3MPB A;  3A7Q A;  5CFD A;  3WDX A;  1ASJ 2;  1C8M 2;  4IEO A;  1RVF 3;  1W8N A;  1WD4 A;  3K3O A;  1JYX A;  2WO7 A;  3QH7 A;  2VOX A;  4N43 A;  2WN2 A;  4I02 A;  1HDK A;  1SFY A;  4Q4Y 1;  4QKN A;  1CIW A;  2YMZ A;  4QX7 A;  3VBH A;  5BNP C;  2HWF 2;  4H55 A;  2WAA A;  4K21 A;  3HBK A;  1JHN A;  1SLL A;  4BZ4 A;  4UXA A;  1FI2 A;  1LOA A;  1X8E A;  3DYM A;  4CA9 A;  5C9A B;  4EN7 B;  1CON A;  2Y38 A;  1H8T A;  1D7P M;  4LO4 B;  3DPR A;  1XNK A;  2CAU A;  1AJK A;  4CDW A;  4GH4 A;  4QDS A;  2ADD A;  4NAM A;  4C8D A;  3Q8B A;  2Y6L A;  1EUU A;  3CMG A;  3NKT A;  4CU9 A;  2JEC A;  1OVS A;  3B01 A;  3J9S A;  4G9S B;  5F5C A;  1QOT A;  2F4P A;  2DFB A;  4UF0 A;  4FXK B;  4IE4 A;  1V00 A;  1WW5 A;  1ZZ7 A;  3N7M A;  4XJZ A;  4AGV A;  5A7W A;  4I2O A;  2VCB A;  4DFS A;  3O1U A;  1POV 0;  3JBG 2;  4RL7 A;  1ULG A;  4XZU G;  1ASJ 1;  1EAH 1;  1HW5 A;  3J8F 2;  3EMR A;  1UZV A;  1NX9 A;  3H3Z A;  1POQ A;  1OC1 A;  2Y6K A;  4K8R B;  4R9D A;  4NUB A;  4Y33 A;  3VHO A;  2D40 A;  1GWL A;  3LFI A;  1S4C A;  1JOP A;  2AUY A;  4I09 A;  2LUW A;  3ZVX A;  1MS9 A;  4CCD A;  1DZT A;  1EUT A;  3BAL A;  2HWF 1;  4RGG A;  1H4G A;  1NXD 1;  3AJZ A;  3F95 A;  1RUG 3;  4AEJ A;  2G4I A;  4FPJ A;  1OA3 A;  3G6J B;  4URA A;  3KF3 A;  1EYB A;  1RUO A;  1O3R A;  2ZX1 A;  4BHP A;  3VDA A;  3NAP B;  4FAG A;  3AB0 A;  1ODM A;  3H7Y A;  2VMD A;  4XJ9 A;  4CDU A;  3RYP A;  2ETE A;  2W2I A;  4LBK A;  1N1T A;  2VZ1 A;  4CZS A;  4MGT A;  1SMV A;  4MO3 M;  4LBQ D;  3OBZ A;  3ZYH A;  3ES4 A;  4RYD A;  3DEM A;  3H1W A;  3T2Q A;  1RIR A;  4QQP A;  4AI0 A;  4DY5 A;  4COU A;  1WCS A;  3JBG 1;  2DYC A;  5A7Q A;  4JTN A;  3J8F 1;  1QJY 1;  5F8P A;  5BPX A;  5LBE A;  1JH5 A;  1YQ8 A;  1YFY A;  3NNL A;  5FAX A;  5T50 A;  2BU9 A;  2X10 A;  1WME A;  4XFI A;  3ECQ A;  1MVE A;  5IWF A;  3M3C A;  2X5I B;  3TN9 2;  5LRS A;  3MIE A;  5GKA C;  2J1V A;  3LF7 A;  4V2W A;  5CIS A;  3IMN A;  2FCV A;  1AL0 G;  2VW0 A;  3GDB A;  4FFG A;  4W8J A;  2P2K A;  1RXG A;  3AMP A;  2CGN A;  1HRI 2;  2GP3 A;  3NJV A;  1NCR B;  2CV6 A;  3DKW A;  4QQH A;  3I3Q A;  2CGO A;  4LJH A;  1RUF 2;  5FYT A;  4RS5 A;  4XF4 A;  3VV1 A;  1YFX A;  2XJU A;  3I59 B;  2A6Y A;  4LO6 B;  4P00 B;  2DVA A;  2D5F A;  5GZF A;  1K45 A;  2LW8 A;  3QAC A;  4HBN A;  2RR1 3;  1XJA A;  1BK0 A;  1DGR A;  1S0I A;  3DXU A;  5DDJ 3;  3ZIW A;  1UD1 A;  2HWD 3;  4NE9 A;  5FXX A;  2WIN B;  5C4W C;  4XE9 A;  4IEU A;  3GHM A;  1OQE A;  1TME 2;  2RE9 A;  5JSR A;  1Y4W A;  4PIY A;  2VXJ A;  2XBO 3;  4XJA A;  4I0W B;  3DEC A;  4AI1 A;  1ND3 A;  4W50 A;  1NA1 B;  4LPL A;  4KNC A;  4CDX B;  1LGB A;  5LEK A;  1QJU 2;  3VD4 A;  2OW4 A;  5CFC A;  1GZW A;  4MGZ E;  4YM0 A;  5I0S A;  1GP6 A;  4WM8 B;  1JW6 A;  1JYC A;  1RHI 3;  1G7Y A;  1RYY A;  3ENR A;  3VHR A;  5BNN B;  4MHU A;  3BGA A;  4CTE A;  3P1I A;  5FZA A;  1TNR A;  2D98 A;  3GJA A;  1MZ6 A;  4H7L A;  4A41 A;  5CZK A;  4E2Q A;  4BYY A;  4JGY C;  1BCX A;  4FPG A;  4QB2 A;  5EJ1 B;  3ITQ A;  4XUR A;  2VD7 A;  2ADE A;  1NE6 A;  3O1T A;  5F3G A;  3KV5 A;  5FIX A;  4DY3 A;  2AC1 A;  1Q8O A;  1QXP A;  1S0E A;  4AVS A;  5C71 A;  1TME 1;  2WFF 1;  4AVC A;  1W2U A;  2OT7 A;  4N9H A;  3PIJ A;  3ACF A;  1C3H A;  4W6Y A;  4CU6 A;  5FLH A;  1WLT A;  2R32 A;  4AAX A;  2OPK A;  3HQU A;  1ULO A;  1H6Y A;  4RSU A;  1W90 A;  2CWS A;  1MQT B;  4QAW A;  1QJU 1;  2J7M A;  3KT7 A;  4GWI A;  3ZXE A;  1GOH A;  5GLZ A;  4XQ4 A;  4UI9 L;  1NQD A;  1RUE 2;  4DEQ A;  3VB9 A;  5ACA 2;  2NMO A;  5CG8 A;  1OOP C;  4XBQ A;  1TQ5 A;  4NR1 A;  4XDO A;  1I1E A;  4BXF A;  3B93 A;  2VNO A;  3TEX A;  5JMC A;  4GKX A;  1U5I A;  1VBE 3;  4B8E A;  1UXX X;  3MLK A;  4M4P A;  3N4M A;  2V5Y A;  2PYT A;  1GAN A;  1QJE A;  4NID A;  2QQN A;  2WA4 A;  4OMC A;  5H9S A;  1E5R A;  2ZOE B;  3IDE A;  4QX2 A;  4MXW B;  1H2M A;  2YBS A;  4NRO A;  4GD4 A;  4QKF A;  5FPB A;  4JRA A;  1RTV A;  4EQV A;  5BNP B;  2GH2 A;  1DDL A;  1W6N A;  2RS3 3;  2XJS A;  2R16 A;  4LOR A;  3RWK X;  2A3Y A;  5J48 A;  2YFU A;  4GWJ A;  3UET A;  5F3C A;  1N1S A;  1U5Z A;  3FL7 A;  3NV4 A;  4YSF A;  3MI8 A;  4AL9 A;  1OUX A;  3S0M A;  2H6B A;  5TSW A;  1W3X A;  1IZ3 A;  1SCS A;  2GND A;  3OOX A;  2DUQ A;  1QXR A;  4Q4W 2;  3ZPY A;  5JSP A;  1AR6 2;  4BE3 A;  2VZQ A;  3LSD A;  4QDQ A;  3IBM A;  2PAM A;  4AHZ A;  4FQ4 A;  1CX4 A;  1SEF A;  4PI2 A;  3OF1 A;  1DU3 D;  1I9R A;  4QB6 A;  1ZNP A;  1CAX A;  5GLU A;  4D7Y A;  5FP4 A;  1ZBA 2;  4XQW A;  1J59 A;  1RUE 1;  1COV 3;  5FYV A;  4PT6 A;  1DZR A;  1NYW A;  4OHV A;  3P3P A;  1F4A A;  2XJP A;  3WP4 A;  2BPA 2;  3J7H A;  4XTP A;  1CAW B;  1RUH 2;  1TMF 2;  4HKW A;  2HBT A;  2HWC 2;  4NHL A;  3UL2 A;  3LFM A;  3VBO A;  2VU9 A;  1S55 A;  1F5F A;  2V5D A;  1IHM A;  5J98 B;  1UU5 A;  4N7U A;  2B7Y A;  1UO9 A;  2P5B A;  2Y6H A;  4C0H A;  1OQD A;  1RL3 A;  4D7S A;  3VBF A;  3MW2 A;  2L9L A;  3HMY A;  1YYN A;  2B46 X;  1LHN A;  2VO5 A;  2I2S A;  1W6M B;  4YWA A;  5EHD A;  5GAL A;  2LS6 A;  2PEL A;  4CP2 A;  2XVL A;  5L9B A;  1HQN A;  5EJZ B;  2Y26 A;  4Y4Y A;  4ES9 A;  1LOC A;  4XEZ A;  1FXZ A;  1WLD A;  4YVS C;  3RZH A;  1CAU A;  1Q8Q A;  4Q4W 1;  2KD7 A;  1R08 1;  3RZG A;  3GCW A;  4ARY A;  1TNF A;  5IFP A;  3ETQ A;  3NST A;  5JR2 A;  2J1U A;  4P08 A;  4AHW A;  3OD0 A;  2FDH A;  2FDK A;  4LHL A;  2UWC A;  1JZ3 A;  2C6S A;  2VGD A;  5FZG A;  2WZR 3;  4RGA A;  2D93 A;  4Y1Y A;  3WHU A;  5C6C A;  5IJR A;  5GZG A;  3S7I A;  5ABJ C;  5IVC A;  3III A;  1PIV 2;  4DRR A;  2Y33 A;  3WDV A;  1VJ2 A;  3D3A A;  1A78 A;  1RUI 3;  3D6E A;  5CBL A;  3VDD C;  2DWR A;  1K5M A;  5EPA A;  2D3S A;  1SFN A;  2W1Q A;  2ZX4 A;  1IKQ A;  1IG3 A;  3J26 N;  3IZO A;  1AX0 A;  2ZPX A;  3GHN A;  2ZGK A;  2V72 A;  3CBN A;  5FXV A;  4DS0 A;  3SIT A;  3RJ2 X;  1PVC 2;  3ZSJ A;  4ATE A;  1J83 A;  1H0B A;  4IV1 A;  2FBE A;  3V65 A;  4GXL A;  4XZP A;  1A3K A;  4Y3O A;  1G9B A;  1LOF A;  3BOP A;  2VL4 A;  3OSD A;  1XE7 A;  2YRO A;  4Z92 B;  2C26 A;  5LAT A;  4N7I A;  1VP6 A;  1J3Q A;  4XIO A;  4KU8 A;  3E6B A;  2E53 A;  3M1H A;  2BGC A;  5HI0 A;  4UYB A;  5GZE A;  3ZFF B;  2WT1 A;  3V0A B;  3W5M A;  4XIK A;  4UFM A;  5A6X A;  1BEV 3;  2C1F A;  4LIV A;  3WNK A;  2BGO A;  2VPV A;  3AYA A;  3LD8 A;  1ZRE A;  5FXW A;  2JDN A;  4BQW A;  5IAX A;  1O4Y A;  3T08 A;  3RZJ A;  1BBT 2;  1DYP A;  4XCB A;  4JC1 A;  5LY1 A;  4HFS A;  1SPP B;  1O7F A;  4FFH A;  4N43 C;  1YHF A;  4OUM A;  3PVB B;  5C4W B;  2P17 A;  1Q5O A;  3T1L A;  2IZW A;  4B1L A;  2R49 A;  2ZHM A;  4TLF A;  2XL7 A;  1UNB A;  3VBH C;  4BLI A;  3ORJ A;  1ZZ6 A;  1GSL A;  3S5A A;  1AF9 A;  4ZON A;  3S7E A;  3C7E A;  2BZD A;  2XJR A;  4O7X A;  4LBM A;  4TYS A;  3E97 A;  3AP4 A;  4RN5 A;  1UY3 A;  2HKX A;  4ZKT B;  4JGZ B;  1WUV A;  3I49 A;  1V6O A;  3EHK A;  1H8T C;  1JXN A;  4NPM A;  3VLB B;  4DMI A;  4EYU A;  3DPR C;  2HWB 3;  1OUR A;  2WZE A;  1VBB 3;  5F2W A;  3ROU A;  3ZMO A;  2BQP A;  3FHI B;  4GH4 C;  4CDW C;  5IHR A;  4A4A A;  5LCW L;  1G9D A;  4QWN A;  1ZRD A;  3ES1 A;  2DTY A;  2R06 1;  1B35 C;  1QQP 3;  5BXX A;  2A71 A;  1CES A;  3GCX A;  3M2M A;  1UZZ A;  4HET A;  1NCQ A;  1V6J A;  2XLF A;  3AMN A;  4W6X A;  4F8A A;  1RUD 2;  3PL0 A;  4JGY B;  5IK7 A;  2VUA A;  4JQR A;  5FQ0 A;  4M00 A;  1QXJ A;  1PO2 3;  3I3B A;  2GAU A;  5M0T A;  1UYZ A;  4GB3 3;  4HPK A;  3POW A;  3OPW A;  2JDH A;  3AFK A;  4LHN A;  3ZXJ A;  5JZG C;  4OCT A;  5FBZ A;  3TWI A;  2RS1 2;  2OUH A;  2QQM A;  3T0A A;  2W0X A;  1AR8 1;  4I0A A;  4NWW A;  5FZE A;  1UL9 A;  1ZBE 3;  2DDU A;  4QM9 A;  1W8W A;  2RMU 2;  1SHW B;  1N1V A;  2X29 A;  4ORF A;  1HIX A;  4FBF A;  4BJ0 A;  5F3I A;  4NII A;  2W46 A;  1D0G A;  2WWJ A;  5A7P A;  1AR9 3;  3LDR A;  3NO8 A;  1CX1 A;  3V0B A;  4QMA A;  3PIG A;  1W9T A;  1H2K A;  2HEY F;  3I7D A;  2H0B A;  4YLZ A;  4CDU C;  1ZRC A;  1PM7 A;  1SAC A;  4LBN A;  2W95 A;  4E8D A;  5I0D A;  1REF A;  3BTZ A;  2VOT A;  2VEC A;  3MF6 A;  5HCH A;  4FPE A;  4XC9 A;  1VPH A;  1YEW A;  1V6M A;  4L0P A;  4Y1Z A;  2AYH A;  1KJR A;  1Z7S 1;  2G1M A;  5FP9 A;  5IVB A;  1ALY A;  2BVB A;  4FP3 A;  4NRM A;  2ORX A;  4YGD A;  2DCK A;  1VRH 3;  5C3P A;  2ZEZ A;  4YW3 A;  5F5Q A;  2ES3 A;  3BKZ A;  4I30 A;  2JG9 A;  1ZA7 A;  2XWJ B;  3WX5 A;  1KGY A;  4ASL A;  4P9I A;  4D8M A;  3SH4 A;  3ZYI B;  1GOF A;  4XPV A;  5A7S A;  2BTV C;  3ZXG A;  4YZ4 A;  2VY0 A;  1GV9 A;  1XYN A;  1OT5 A;  3CJI A;  1XNC A;  5K7P A;  1AL2 1;  3MPP G;  4DRV A;  2LAL A;  1OMI A;  1F31 A;  4YVW B;  4NIH A;  4BQ5 A;  1V6L A;  2D3P A;  2QBX A;  3OPZ A;  1XPW A;  4XHB A;  3IWZ A;  4A7Y A;  2ZAH A;  3NNF A;  3VHP A;  1WMD A;  1EV1 3;  2JDK A;  1VBD 2;  1W0O A;  3MIB A;  5K9Y A;  4XF0 A;  3ZO0 B;  1FMD 1;  3T0D A;  3POB A;  1X9P A;  1UN1 A;  1RC6 A;  1PX3 A;  2PQQ A;  4MYE A;  2RJL A;  2WS9 1;  1VMJ A;  1HJF A;  3FWE A;  1UYX A;  1R09 1;  2V73 A;  4UBH A;  5FP7 A;  3M3O A;  1H6X A;  4UW5 A;  3P5B A;  4A3X A;  2EA7 A;  3OY8 B;  4AZZ A;  4Q4X 3;  4I01 A;  4XFF A;  2QDR A;  3WQ7 A;  1I5Z A;  1ND3 C;  3D8C A;  1J1T A;  1WZX A;  2J1R A;  3I3E A;  3PVE A;  3QBQ A;  1V70 A;  2YC2 A;  3BIW E;  2R04 3;  5LK7 B;  4CE8 A;  1SLB A;  3MFC A;  4ET7 A;  4YVS B;  4GAZ A;  4Y5S A;  3W5N A;  3WQB A;  4XBN A;  4AWD A;  4CDQ B;  5C5T A;  4GIQ A;  3LIH A;  3I3D A;  4TN7 A;  4JKK A;  1PO1 3;  2G19 A;  5H9P A;  4Q4V 3;  2OZJ A;  4YNI A;  4PF1 A;  5LEJ A;  3THT A;  4YYO A;  3H8R A;  2JIJ A;  5I0T A;  1W2O A;  5SV5 A;  1LOB A;  4BU2 A;  1GBG A;  5IVF A;  4A42 A;  5FK8 A;  1ZA4 A;  5FLJ A;  5T5O A;  3RWN A;  3THP A;  5ABJ B;  1DQ4 A;  2ZX0 A;  5FR3 A;  2GC1 A;  3VDD B;  3N35 A;  2R0H A;  4Q0U A;  4YAR A;  2MPF A;  5FO7 B;  2VUL A;  4KWK A;  1W6Q A;  1DZQ A;  1KQR A;  1R1Z A;  4QKD A;  2XLG A;  4J1X A;  2XVG A;  3JD7 3;  3Q8C A;  4IES A;  5JIA A;  5A3T A;  5JOW A;  2R07 2;  5JI7 A;  3NKG A;  4WVZ A;  4AE2 A;  3B7M A;  2LRO A;  4HVO A;  3B9C A;  5B4X A;  3QH6 A;  1YUD A;  3FJS A;  3MDP A;  5F1R A;  4CEY A;  4Y22 A;  3ZSL A;  2A75 A;  2PAE A;  1FPN 2;  1N3Q A;  2B42 B;  4URT A;  3O1S A;  5E88 A;  3IDC B;  2AH2 A;  3AK0 A;  1AXY A;  4QGM A;  4YGE A;  1JZ8 A;  4LE3 A;  3ZFG A;  3I2G A;  4CP9 A;  3OGG A;  3H0O A;  4LIU A;  3POJ A;  3R0R A;  4TZD A;  1G8W A;  2ZMK A;  3GGL A;  4I0B A;  3VKO A;  4EWA A;  3Q8E A;  1QOO A;  2Z5W A;  2C9A A;  1US3 A;  5FZH A;  3VBU A;  3P6B A;  4DEV A;  3L2Y A;  4QXC A;  5CFD B;  2ZHN A;  1A6C A;  3O5S A;  3HWJ A;  3I2H A;  3O1M A;  4I3G A;  5FUP A;  1QWR A;  4N43 B;  4CPB D;  1WMX A;  3C7G A;  1O3S A;  4SBV A;  1OA4 A;  2H6C A;  1WLW A;  2KM2 A;  3C3V A;  3VBH B;  2ARA A;  2JDU A;  5BYN A;  1HJG A;  4KG0 A;  2NP0 A;  1O6U A;  3WDY A;  4YG6 A;  3K51 A;  4B29 A;  1NLR A;  4LO8 A;  3WF0 A;  4AG4 A;  1DLL A;  2DTW A;  3OBR A;  1DQ2 A;  2O8Q A;  2QQU A;  2RHP A;  3POG A;  4XAB A;  5DUV A;  3IB3 A;  1H8T B;  4FQZ A;  3DPR B;  4CDW B;  1QHD A;  3BPZ A;  4LO7 A;  5FPU A;  1S2K A;  1GOG A;  1RED A;  3AXD A;  4D6S A;  1AR7 1;  5F39 A;  4XHX A;  3KQR A;  3MLL A;  1AYM 3;  4LBO A;  4UF0 B;  2OQ6 A;  4XXP A;  3DN7 A;  3NJX A;  3U14 A;  5A7W B;  3VZN A;  5CG9 A;  1LEM A;  5FZB A;  5HXM A;  1D4M 3;  4AOC A;  3VBO C;  1ZZ9 A;  4OLL A;  1UMI A;  5LA1 A;  2DU1 A;  3LAG A;  3AKQ A;  4HG6 B;  1RVF 1;  4IV3 A;  4GJZ A;  4B4P A;  3VBF C;  3R4D B;  1RUC 3;  2Y34 A;  4TWT A;  4XQD A;  2UUR A;  3LEK A;  1YI9 A;  1YQC A;  2GMM A;  1M4W A;  2W08 A;  3PUR A;  3Q8A A;  4NPR A;  3VGI A;  1UYY A;  5FZC A;  2V09 A;  3OGV A;  4AQS A;  1W9W A;  2D44 A;  2VG9 A;  4MAD A;  1RUG 2;  1PHM A;  2X53 S;  3UK9 A;  3C7F A;  3B69 A;  1UOB A;  3U11 A;  1V9U 3;  4BMB A;  4KI5 M;  3V56 A;  2VW2 A;  1ULC A;  1GNZ A;  4LA3 A;  3KF5 A;  1LHO A;  4CDU B;  4HVQ A;  2RS5 3;  4J25 A;  2IUW A;  3DV8 A;  2JEM A;  3UKT A;  1E5S A;  5FYH A;  2DFC A;  1QJZ A;  1DQ0 A;  5H9Q A;  4DIQ A;  1JYN A;  4ZU4 A;  2QCS B;  4OHX A;  5A3U A;  4FI9 A;  1WBL A;  2QQP A;  2JE8 A;  3TEY A;  2GME A;  3T09 A;  1MZF A;  2RM2 3;  4FPO B;  3PJY A;  3SH5 A;  3FZ3 A;  1K5M C;  2MEV 2;  4CCL A;  4Z8B A;  3WDT A;  1RB8 G;  3KSC A;  4B4Q A;  2HYK A;  4XJ8 A;  5C3S A;  2Z69 A;  3FFQ A;  1NY7 2;  2ZGU A;  2XML A;  4M3C E;  3WLU A;  2NPI A;  2YHJ A;  4LLO A;  5D1I A;  5T5L A;  3RZZ A;  5DAW A;  4IV1 C;  5FMO S;  1X9T A;  3KGL A;  3ZXL A;  3HIF A;  2EIE A;  3ZDS A;  2E33 A;  2GZW A;  1MEC 3;  1LOF C;  1RUG 1;  5A3P A;  3M3Q A;  3K3N A;  4Q4Y 2;  5FK7 A;  3THD A;  4K6B A;  4FCA A;  1QH7 A;  2XKP A;  1VLN A;  1SLC A;  1NUK A;  3KCX A;  5LB6 A;  2ZS6 B;  4IE5 A;  4KL1 A;  1JS9 A;  3K77 A;  3MYX A;  3AXE A;  1REE A;  4OUL A;  1LHW A;  3WCR A;  1AJO A;  2WWS A;  4XFC A;  5FYZ A;  3W59 A;  3RGB A;  5IK5 A;  1CQ9 A;  2XUE A;  4WM7 A;  1AX2 A;  1DGW A;  1YRZ A;  2JKB A;  1UU6 A;  1QNY A;  2JD4 A;  3FBY A;  3J7M A;  3KMH A;  3NRU A;  5CAD A;  4Q1P A;  1ENQ A;  3H3U A;  1ND3 B;  4XJW A;  2OA2 A;  4QPG A;  5FWE A;  2ILM A;  1EAH 2;  4DNY A;  1KS4 A;  1QJF A;  3ZYF A;  4B4R A;  4BIF A;  3O1R A;  1W8F A;  4CU8 A;  1H1M A;  3RS6 A;  2RDN A;  3OUI A;  5CA6 A;  5CFC B;  1S0B A;  1YCI A;  2ET1 A;  1GZW B;  4XF9 A;  3APB A;  4S2D A;  3MGU A;  2ID4 A;  1LHV A;  3HOB A;  4FT8 A;  4BB3 A;  3LA2 A;  3MHZ A;  4XUO A;  3OGS A;  5DPN A;  3VD5 A;  4XAC A;  1DHK B;  4IEV A;  2ZGN A;  4MGI E;  1UCX A;  2VUJ A;  1LJ7 A;  4O61 A;  3UKV A;  2ZKL A;  1E5H A;  1NCQ C;  1RMU 3;  2UY9 A;  1YIP A;  2W68 A;  4HZF A;  4CCK A;  1H9W A;  1PK6 A;  1WMF A;  3LIG A;  5FY8 A;  1OFS A;  1Y3T A;  2JDP A;  1VB2 A;  2RR1 1;  3CL1 A;  3I97 A;  3POE A;  2GSY A;  3OB8 A;  5E16 A;  3VBR A;  4UOJ A;  5DDJ 1;  4QQO A;  3WW2 A;  2EF6 A;  1W9S A;  1OF3 A;  2HWD 1;  4L11 A;  3PNA A;  1CIY A;  4QHB A;  3KV4 A;  4KQ7 A;  1IGO A;  1KXG A;  1YFW A;  2W92 A;  1KDK A;  5F5I A;  2XBO 1;  1X50 A;  3CHX A;  1OLR A;  4QX3 A;  4AR2 A;  3ZXA C;  1QJY 2;  5CAZ A;  1OH3 A;  2EIC A;  3AFG A;  4IXL A;  2OX0 A;  4RR3 A;  4LKD A;  3LB9 A;  2JJ6 A;  1HRV 3;  2PHU A;  3CNA A;  3QD6 A;  5CKN A;  1BVP 1;  1J58 A;  2GH8 A;  4XAE A;  2A6W A;  3SQO A;  1UOJ A;  1EPW A;  3I2D A;  2R1B A;  1PGW 1;  4UW4 A;  3PTR B;  2AAC A;  1H1A A;  1RHI 1;  4C1W A;  1MPX A;  1XU2 A;  1Y43 B;  5AFB A;  1HX6 A;  1GQH A;  3O1P A;  1W6O A;  2JWP A;  2ZGL A;  2A6X A;  1TVG A;  5IVY A;  1N1Y A;  3RYR A;  2WWU A;  3ZXF A;  1ULP A;  4Q1R A;  3WG1 A;  4AFB A;  1AUY A;  2JG9 C;  1W6N B;  3IIA A;  4K20 A;  4AXO A;  4CXY A;  1A34 A;  2BDR A;  5KC5 A;  4CVU A;  1BHG A;  3JZV A;  4CCN A;  4Y5Z 0;  3W9A A;  4TTG A;  4A6O A;  2Z4F A;  4CRQ A;  3CJI C;  4NMI A;  3IPV A;  4AHX A;  3N7L A;  2ZA9 A;  3MFA A;  3BCW A;  4QPY A;  1PM4 A;  2JE9 A;  4FPK A;  1F2N A;  1UMZ A;  5EYY A;  3WY6 A;  5LZ6 A;  1CAX B;  3WUC A;  4A44 A;  1RUJ 3;  3TB0 A;  4FTS A;  2IXC A;  3CQO A;  4ZZ5 A;  2JXA A;  3GF6 A;  5CYY A;  4ZY9 A;  4ONU A;  4XUN A;  2A73 B;  4QPI A;  3UJQ A;  1H9P A;  1MS8 A;  1NT0 A;  4DXT A;  4NPL A;  1WWY A;  2PA7 A;  3T2O A;  2DBI A;  2P34 A;  3KT1 A;  5IUQ A;  1DP0 A;  1DCS A;  4YW2 A;  3VBO B;  1VBE 1;  1WCQ A;  1XYO A;  4FPF A;  3WF3 A;  4PIZ A;  2J42 A;  4AI3 A;  4AK3 A;  1OD3 A;  4Q0S A;  3ZFF C;  5JXG A;  4N8M A;  1G86 A;  3VBF B;  1VR3 A;  2YY1 A;  2XQX A;  3SEE A;  4R9C A;  2XR4 A;  4FP2 A;  3GAL A;  2HWE 3;  4W4Z A;  4UW6 A;  1YQ2 A;  3BUC A;  3ATG A;  3LDB A;  3RYK A;  4RS5 C;  1LED A;  2RS3 1;  2VOW A;  4IER A;  5FUI A;  3SCF A;  1VBA 2;  4K40 A;  2UY8 A;  3A4U A;  5FPL A;  1CAU B;  3AKS A;  2VJX A;  4AVA A;  4BIO A;  2WFF 2;  3WF1 A;  2PHX A;  2WSU A;  3K4D A;  1JZ7 A;  1OLM E;  1Y7B A;  2YV8 A;  3T4V A;  3N9Q A;  3DF0 A;  1APN A;  4GZ9 A;  4MV2 A;  1GU3 A;  5I0U A;  4WVM A;  1HLC A;  4K9S A;  3CJX A;  3N9M A;  3IAP A;  3Q9O A;  4GQ7 A;  5LK5 A;  3KZ4 C;  1QU0 A;  4JGZ C;  3VKN A;  2WZR 2;  1COV 1;  3SH3 A;  5FY9 A;  3WNP A;  4ASM B;  5AFE A;  2A70 A;  3PUA A;  1K5M B;  3IMM A;  3WDW A;  1IKP A;  3P3N A;  5K0U A;  1K5J A;  5GZC A;  1CPM A;  3WNL A;  2YU1 A;  2Y0O A;  5DAB A;  5FZI A;  1YJK A;  1TZO A;  3A22 A;  4K8F A;  2W1S A;  4AGR A;  4PQ9 A;  4U2A A;  4BK5 A;  3M3E A;  4HN0 A;  3W58 A;  4CEY C;  4IV1 B;  4PDW A;  4KGQ A;  1C8M 3;  5F7U A;  1DQ1 A;  1VBA 1;  3GZE A;  4R52 A;  5FZ3 A;  4W6W A;  3U4S A;  3ZSM A;  2Q8D A;  3T4H B;  1UF2 C;  5FPZ A;  2R1D A;  3ZFG C;  5BNO A;  2C24 A;  5FKB A;  1V6K A;  1HB3 A;  4MX3 A;  2YXS A;  4IW3 A;  3RFR A;  5T52 A;  1JZ2 A;  4EN8 B;  3OJB A;  1OFN A;  5FZ9 A;  3FUO A;  3O7O A;  4YW5 A;  1UOG A;  2DCT A;  4YPJ A;  1JOD A;  3JU9 A;  1O59 A;  3VBU C;  5KWR A;  4LLF A;  3TEZ A;  1SZB A;  1UZY A;  2I45 A;  2WZR 1;  5D8A A;  3WXP A;  1RUN A;  1W6P A;  3NQH A;  2PAK A;  5E6H A;  3ZSK A;  4Z82 A;  2CGP A;  1GYK A;  1RUI 1;  1W8Z A;  1DGL A;  2W91 A;  2BWA A;  4HN1 A;  2UYB A;  4NWV A;  3N9N A;  5IK8 A;  2D7F A;  3ZN6 A;  3N9P A;  2CYF A;  3E1F 1;  2JB4 A;  2CSG A;  2EXK A;  1C1L A;  3O1V A;  3BN6 A;  1C1F A;  2P3K A;  3J8F 3;  4PLM A;  1BQP A;  1UU4 A;  1FX5 A;  2WAO A;  4B7E A;  4GKY A;  5FLI A;  3RVH A;  1XSR A;  2CDP A;  1PMH X;  4NHX A;  4QXH A;  1VBB 2;  2OKX A;  4Y1V A;  1YI7 A;  1W9Y A;  2WBK A;  3D0J A;  3A21 A;  4JKL A;  4CSW A;  1VBC 3;  2XOM A;  5F3E A;  1NCQ B;  4AED A;  2VVE A;  1BEV 1;  2GAL A;  3MIG A;  4EN0 A;  1R08 2;  4N90 A;  5FQ0 B;  3AM2 A;  1PNG A;  3GXU A;  3NMB A;  4L99 A;  2RG4 A;  4EN9 B;  4HPK B;  4YVW C;  2XUM A;  1B09 A;  4O9G A;  4MGY E;  1WA6 X;  1G9C A;  3M4F A;  3VKM A;  4CYD A;  4LUK A;  4GB3 2;  4IV3 C;  4ZPI A;  4KU7 A;  3NV2 A;  3MV0 1;  2WO2 A;  3A0K A;  3EYP A;  4NVP A;  2DBN A;  2WSV A;  2ZJC A;  4NJ4 A;  3U10 A;  1W9F A;  2OXB A;  4PF5 A;  2DVF A;  3FLP A;  4BIS A;  4E4D X;  4EZH A;  1LUL A;  2VXR A;  1I5P A;  3KV9 A;  3N36 A;  4HSJ A;  4S2H A;  1PVX A;  2VR4 A;  1K3I A;  2IXJ A;  4P9Y A;  5KXE A;  3VZL A;  2XH6 A;  2KXL A;  2B39 A;  4PI0 A;  5CIR A;  3WD5 A;  1W8O A;  2Q1M A;  4S2G A;  1KFX L;  2X09 A;  2P37 A;  4BOW A;  2DCZ A;  5LW9 A;  4QU1 A;  3WW3 A;  3V0B B;  2WJS A;  2BFU L;  1TEI A;  3AKR A;  1XRU A;  2ARX A;  1H2L A;  4IND A;  3DL3 A;  1L3J A;  3U07 A;  3VDC A;  5A7N A;  4HOO A;  4F83 A;  5C33 A;  1KS5 A;  1XNT A;  2HWB 1;  4G3Y C;  1VAV A;  1VBB 1;  1UX7 A;  3CDZ B;  4V1P A;  3TN9 3;  4YGC A;  5JOX A;  1Q56 A;  4AI8 A;  2A3X A;  3PVN A;  3AZV A;  4BLJ A;  2GDF A;  1QQP 1;  4LTA A;  4AQ2 A;  2D6P A;  3H42 B;  4CDQ C;  1XU1 A;  4BQ2 A;  3PUQ A;  5HV0 A;  2NLR A;  4QDR A;  4LOT A;  1C28 A;  4EWD A;  3E5Q A;  3EJK A;  1YJL A;  3ZR6 A;  2D6L X;  1KRI A;  1HRI 3;  1F15 A;  1UPI A;  1PO2 1;  3I2O A;  4GB3 1;  4CEW A;  2VMC A;  2W1W A;  1L7Q A;  3LKJ A;  1RUF 3;  3LDK A;  2JG9 B;  3BTA A;  3CU7 A;  4UFL A;  3TBD A;  1DGR N;  1IG0 A;  3B9I A;  5G05 L;  1CPN A;  4FOV A;  4Y26 A;  5A6Z A;  2WL1 A;  1ZBE 1;  5BNQ A;  5G04 L;  4RQP A;  4CUC A;  2BVV A;  3CJI B;  5A1A A;  1IS3 A;  4KBZ A;  1W04 A;  2E32 A;  1JHJ A;  2JDM A;  3IDA A;  2W9X A;  4Q8L A;  5ANQ A;  5C8C A;  2VNV A;  4LBL A;  1AR9 1;  2VCM A;  2Y6G A;  5FZK A;  3OUH A;  1JYI A;  4DO0 A;  2QQW A;  4FFF A;  3H8U A;  2P3Y A;  4PIX A;  3RDI A;  1S0D A;  3B3Q E;  5L9V A;  2VW1 A;  3N3H A;  1RJ7 A;  4XUQ A;  1STM A;  2WN3 A;  1EP0 A;  4HXC A;  3VBS A;  2ET7 A;  2JDA A;  3AP6 A;  4CCC A;  3UYJ A;  1WGP A;  2VZR A;  5BUV A;  4HAN A;  4CCO A;  5JDB A;  3UJO A;  2R06 2;  5CU1 A;  1VAL A;  4Z1V A;  2I07 B;  4AGG A;  3ABZ A;  4EN6 B;  4XUP A;  1VRH 1;  2ZGM A;  4IE6 A;  1V6N A;  2ZX3 A;  3RI9 A;  3F2Z A;  4E2G A;  1OA2 A;  1HXS 3;  4QPG C;  4RS5 B;  1BKZ A;  3PU8 A;  5DAX A;  1UX6 A;  4Q4X 2;  5CFD C;  2BJS A;  2JG8 A;  2JIG A;  3MIH A;  1SBF A;  4IEQ A;  4N53 A;  4OHZ A;  4AVB A;  4V2V A;  2R30 A;  5JOY A;  1W2T A;  1ZRR A;  1VAM A;  1D0H A;  1AR8 2;  1J3P A;  3J7N A;  3SLI A;  3FUQ A;  4DXR A;  3WF4 A;  5DMY A;  3C2U A;  4P9G A;  2RVA A;  2XGX A;  3S6P A;  2BEO A;  1JOB A;  3JB4 C;  4JV4 A;  1WW7 A;  5L9R A;  5JMO A;  1PK6 C;  4YG3 A;  3ACI A;  4YZ2 A;  3WSO A;  4QX0 A;  4LT5 A;  1T2X A;  1EV1 1;  3AYE A;  1GMM A;  2TEP A;  4YW7 A;  1W6Q B;  2UWA A;  1YXW A;  4D69 A;  4YZ5 A;  4RGK A;  4NHY A;  5ACA 3;  4NRQ A;  3WW1 A;  4YM2 A;  4X6Q B;  2UU8 A;  3RPQ A;  2Q5T A;  1O5L A;  1XXN A;  4MG2 A;  3WOG A;  4CEY B;  4Y22 B;  1Z7S 2;  1PZ9 A;  1FNZ A;  4HK9 A;  5FV3 A;  3VZM A;  4AAP A;  2YC4 A;  2WZ8 A;  2YBK A;  2YZ4 A;  2FHR A;  3SCG A;  4Q4X 1;  4GUL A;  1KFU L;  3K4Z A;  4X6R B;  5T5P A;  1CJD A;  5LY2 A;  1SG3 A;  2R04 1;  4RR3 C;  3I2K A;  4I3P A;  1KEX A;  3ZFG B;  4A3Z A;  4CCJ A;  3HN1 A;  2Q8C A;  5DUU A;  4CP9 B;  5AC9 3;  4ISR A;  5A3L A;  4XF3 A;  3VD3 A;  5FYC A;  3M3I A;  4IGP A;  2DU0 A;  2GNB A;  3M7A A;  4OI1 A;  5JWP A;  1PO1 1;  1W03 A;  1YC6 1;  4Q4V 1;  3SMH A;  3RZL A;  2HBU A;  2GC3 A;  2DV9 A;  3VBU B;  2ATF A;  1AL2 2;  1AR6 3;  4JZR A;  5EYX A;  1LEC A;  1OI6 A;  4KH9 A;  3QLQ A;  5F6K A;  4UWD A;  2KR2 A;  3KWV A;  3UGF A;  1FV2 A;  2OPW A;  3VN4 A;  2WDB A;  2WKK A;  2WFP A;  1ZBA 3;  1QDC A;  1W06 A;  3PME A;  3JD7 1;  4MLO A;  4GMP 3;  2K9Z A;  4M3C F;  2ZGT A;  2SBA A;  4MVT A;  4FTB A;  1RUH 3;  1FMD 2;  1TMF 3;  4JKM A;  2VZS A;  2HWC 3;  2O14 A;  2WS9 2;  4IL7 A;  5DZG A;  1MS0 A;  1IS5 A;  2W3J A;  3CZJ A;  4UFJ A;  1R09 2;  2B5H A;  3AC0 A;  4XIL A;  3VKL A;  3ZMN A;  4R9A A;  5FZM A;  4LUL A;  2WO1 A;  2MNG A;  1C8N A;  2IVJ A;  3B5L B;  4OHY A;  5EP9 A;  3ZM8 A;  5KC6 A;  1OH4 A;  3CLP A;  2XJT A;  5KHK A;  3V64 A;  1ENR A;  4DIN B;  3LGR A;  1ULF A;  4Q0Q A;  5C70 A;  4D94 A;  4QPI C;  4ERO A;  3NWK A;  4A2U A;  3AMH A;  4N9I A;  1SLI A;  1UKR A;  2GU9 A;  2ZEY A;  3OGR A;  1W3V A;  2AEZ A;  4KGG A;  3X29 B;  4Q29 A;  3USU A;  4BQ4 A;  5KBF A;  4BXS V;  4IV3 B;  5L19 A;  2VUD A;  5J96 B;  5FZ0 A;  3D82 A;  5A3M A;  2RDR A;  4MET A;  4Y4R A;  4FSJ A;  2ENR A;  1O5U A;  1PIV 3;  3ACH A;  5J1X A;  3OEA A;  5FYY A;  3I2J A;  5A1L A;  1IPS A;  4WVW A;  3H3L A;  3NJY A;  5DAP A;  3U37 A;  3NNJ A;  4HKL A;  1UY0 A;  4HSL A;  5FMD A;  3FHQ A;  1RGS A;  3Q8F A;  4GWN A;  2Q30 A;  4Q2F A;  2P6H A;  2X05 A;  1PVC 3;  5K8S A;  1AVB A;  5A80 A;  1HB4 A;  1ZVF A;  5FY5 A;  2C9K A;  2NYY A;  1GZ9 A;  3VD7 A;  4QGL A;  1GZT A;  3W21 A;  3WHT A;  4COY A;  5SV8 A;  3E5X A;  1LOG A;  3VHN A;  3MUY 1;  4XDP A;  1AYM 1;  2GN3 A;  2ZXQ A;  5CFC C;  5K0U C;  1ENS A;  2P3J A;  5I91 A;  1VMH A;  5J37 A;  5KXC A;  1D4M 1;  4P9J A;  5F32 A;  1DG6 A;  1C5I A;  2VOK A;  4OUE A;  3AYC A;  3R05 A;  4RFR B;  5JI9 A;  1DFQ A;  2DVB A;  2VE1 A;  2FZ1 A;  1DQ5 A;  3NNM A;  4PDW C;  3SKV A;  1RUC 1;  3LPF A;  1BBT 3;  3N9O A;  4WBB A;  2VAU A;  5FJK A;  3WCS A;  2WLQ A;  3ETP A;  3G7D A;  4HK8 A;  3FLT A;  1S1A A;  2WC2 A;  1NOV A;  1MEC 2;  2HLE A;  3HQX A;  4O9E A;  2O1Q A;  1Q8V A;  1UW8 A;  2ERF A;  5BNO C;  5IVV A;  1V9U 1;  1GQG A;  4RD7 A;  1SLA A;  4XBL A;  1XNB A;  1LOE A;  1W05 A;  4FO9 A;  2FDF A;  5FP8 A;  2RS5 1;  3ZIX A;  1ST8 A;  1S0C A;  5C8W A;  1HB2 A;  3IDB B;  3POI A;  2IFR A;  4C90 A;  3OBT A;  4JTO A;  5D8A C;  2QQK A;  1S2E A;  1Q3E A;  3ZYG A;  5IVJ A;  2RM2 1;  2CTV A;  1RXF A;  4UFI A;  1JYV A;  1WKY A;  2EVX A;  4WM7 B;  3HEI A;  4LA2 A;  4Q27 A;  5JSO A;  4DUX A;  2QUO A;  4X8P A;  4IDZ A;  1AR7 2;  4RHV 3;  2YUE A;  3R6S A;  2OZ6 A;  2F17 A;  4QHO A;  5FUN A;  1GNH A;  2IC1 A;  4E9K A;  5FYM A;  2WAB A;  1RUD 3;  4QPG B;  5IVE A;  4COZ A;  1ZZB A;  2IXL A;  2N7G A;  3C8X A;  1QJX 3;  2A7A A;  2OQ7 A;  3AZY A;  4YW6 A;  3I3M A;  1W8U A;  3ON7 A;  1RVF 2;  3NJZ A;  4XW3 A;  5I8Y A;  2RS1 3;  4MGS A;  1IQA A;  2WQ8 A;  3LE0 A;  3LEI A;  5FPA A;  4ZXE A;  1MEC 1;  1W99 A;  4A7K A;  2W52 A;  1YNA A;  3VL8 A;  3VL9 A;  1ND2 A;  1CGP A;  5L36 A;  2RMU 3;  5DG2 A;  1OPO A;  3HR9 A;  4Z2A A;  4UFK A;  3ZXD A;  3OEB A;  3S5Q A;  4UFH A;  3E6C C;  3AP7 A;  3B94 A;  3WNO A;  1AYN 3;  4MGK E;  3PUH A;  2OYZ A;  3ZSE A;  1IS6 A;  4AED C;  4QX5 A;  4PBO A;  4XFA A;  3KT4 A;  1PK6 B;  3O0W A;  4TXW A;  1LGN A;  1W28 A;  3AMM A;  1KDM A;  3VBR B;  1CZT A;  2HH9 A;  3QCW A;  5GJ6 A;  1CZV A;  1DIW A;  4UAP A;  1LB2 A;  2D97 A;  4QXB A;  5D21 A;  3DKQ A;  1LGC A;  2EXH A;  5JCT A;  4LBJ A;  2ORZ A;  3EBR A;  1POV 3;  1OOP A;  1KJL A;  4Y24 A;  3HNY M;  4ARX A;  1F9K A;  3WNN A;  1NZC A;  2FDI A;  4JHT A;  5CKQ A;  2J22 A;  2QDN A;  4NHM A;  4XAA A;  1AXZ A;  2DVD A;  1OF4 A;  2QFE A;  2ZKN A;  4RR3 B;  4A45 A;  3WNX A;  4CP1 A;  3FC0 A;  2K2S A;  4JCK A;  3BI3 A;  2VTF A;  1MAC A;  1OKO A;  1ULD A;  2VZO A;  3MW4 A;  2JIC A;  4F7Z A;  4LNV A;  1JU4 A;  1UXZ A;  1W0N A;  3J4U H;  3ALQ A;  1W6O B;  3NVC A;  4Q26 A;  1CR7 A;  2FZ2 A;  1X33 A;  2D6K A;  1LEN A;  1RMU 1;  3FHA A;  2Y64 A;  5FMB A;  3TNQ A;  4D0Q A;  3D4K A;  1XSQ A;  4G4F A;  2BNO A;  4L97 A;  4CEW C;  1SCR A;  1FT9 A;  2VZP A;  4AFA A;  1C5H A;  4JDM A;  2Q8O A;  3SHR A;  2O0O A;  1JZ6 A;  4Z07 A;  4S2F A;  2IVI B;  4C1X A;  1VBD 3;  2WII B;  1WW6 A;  3TEW A;  4NIG A;  1V6I A;  4XOG A;  2LTN A;  1XND A;  4PQQ A;  3FE5 A;  4RQP C;  3RJR A;  1BMV 1;  3AKT A;  4Q8K A;  2VVF A;  2GC2 A;  3IPV B;  4MH0 E;  1O3T A;  3KVB A;  2ZML A;  1HN1 A;  5F2S A;  5C8C C;  2XJQ A;  2K46 A;  5FYI A;  5I93 A;  5JOZ A;  5HXV A;  4K1Z A;  4AI2 A;  1QDO A;  3GBF A;  1XE0 A;  2Q8E A;  2SLI A;  5A3W A;  4CXX A;  4EJR A;  3ZOI A;  3RMY A;  1HRV 1;  1OBN A;  4D7T A;  3DGT A;  2Q4S A;  3AVS A;  3CO2 A;  4LKF A;  2X8K A;  4IET A;  1RUJ 2;  5FZF A;  5FFO C;  2FDJ A;  4QPI B;  5H9R A;  2FCU A;  3VBS C;  4BQ3 A;  3KHC A;  1BK1 A;  3QOP A;  2WNU A;  3U0Z A;  3PMS A;  1HN0 A;  5LRR A;  2ARE A;  1Q43 A;  3KB5 A;  1VRB A;  5FYS A;  3UGG A;  4JHZ A;  1G6N A;  3AX4 A;  2XWB B;  3MLJ A;  4YRD A;  1FYU A;  2BGP A;  5IAV A;  2ZEX A;  2F6B A;  1S0G A;  4AQ6 A;  1LRH A;  3ZR5 A;  3NV3 A;  4KBB A;  2YG0 A;  4M3C A;  1F5J A;  3K48 A;  1UYP A;  3VZK A;  4DXZ A;  3KGZ A;  5A33 A;  3A0N A;  1A8M A;  3WR0 A;  4N53 C;  1ODN A;  2RR1 2;  4LQR A;  2WRA A;  3TAY A;  1C57 A;  4ZHN A;  5DDJ 2;  3TYJ A;  4J1W A;  2P4E A;  2WQZ C;  4HKO A;  1URX A;  2R07 3;  2HWD 2;  1HQW A;  1MS1 A;  3SKJ E;  5JLV A;  3LOB A;  3JUU A;  1NQJ A;  2XKO A;  4L9B A;  3WIN E;  2XPJ A;  1O8P A;  3KHB A;  4LKE A;  1I3H A;  4WVM B;  1FPN 3;  3IAQ A;  2XBO 2;  2B9V A;  3VZO A;  3HPN A;  3ASI A;  1RUJ 1;  4KMQ A;  1VIW B;  4YFW A;  3AVR A;  5EIY B;  1W2N A;  4Q0P A;  1OLQ A;  2Y0I A;  4P9L A;  4M0H A;  3INA A;  3H9A A;  5DAV A;  4Y20 A;  1NE4 A;  3B00 A;  5K0U B;  5FWJ A;  3PLQ A;  1UY4 A;  1PX4 A;  1PGW 2;  2XLA A;  1VE0 A;  3AJY A;  2OII A;  3GBW A;  3ZYB A;  4XFH A;  1K42 A;  5FZO A;  2QQL A;  3ZN4 A;  2A1X A;  4C91 A;  1RHI 2;  2QTW B;  2PLV 3;  1CWP A;  2DF7 A;  1FNY A;  1FOD 3;  3MEP A;  4L2N A;  4AYU A;  3FMG A;  3BU0 A;  3SIS A;  2NQY A;  4PDW B;  2HJI A;  1ULE A;  5J7M A;  2HWE 1;  3USS A;  5IK4 A;  4AF9 A;  3ELN A;  2ZBJ A;  5FOB B;  3H50 A;  3KCY A;  1DYO A;  1D4V B;  5AVA A;  5BNO B;  3GJB A;  1KD7 A;  1CJP A;  4GJY A;  1PGL 1;  3C7O A;  1WD3 A;  4YZ1 A;  3DYO A;  4FOY A;  4TLG A;  5FRA A;  5FO9 B;  4PCR A;  1O8S A;  5GLW A;  1QH6 A;  3WUD A;  3U4X A;  1R1A 3;  4QHZ A;  4AFC A;  5FY4 A;  2MHF A;  3ZYJ B;  4R9B A;  2I74 A;  2VM9 A;  5D8A B;  1W6P B;  2ARC A;  4QQL A;  3ILN A;  2E7Q A;  2IXI A;  3RI8 A;  5JIU A;  3MIF A;  2VZ3 A;  4HMZ A;  5APA A;  4QX1 A;  1XOY A;  1H4H A;  3ZN6 B;  2CY6 A;  5FXZ A;  4OQ9 A;  1WA4 A;  4LKS A;  1B35 A;  2Y6F A;  5A32 A;  5HPO A;  2DUP A;  2PMW B;  1Y9M A;  3GM8 A;  4BQ1 A;  1Z78 A;  5A6Y A;  4M0N A;  1O4T A;  4WZC A;  1VBE 2;  5FZ8 A;  2D6O X;  4Y1U A;  5A6Q A;  1UWW A;  2ZHK A;  1F8V A;  3LZZ A;  1C8M 1;  2JB8 A;  1DQ6 A;  3WDU A;  4YW1 A;  2YDE A;  3WP6 A;  5JZG A;  1JUI A;  3R4S A;  3ZFE A;  4OHW A;  4AEM A;  4XUT A;  3O14 A;  1M06 G;  3B02 A;  3AP9 A;  5LBF A;  1JZ5 A;  5FYB A;  2ZZJ A;  2XHN A;  4KWJ A;  3LSE A;  1AX1 A;  3GZT B;  2RS3 2;  3ZYR A;  5KXD A;  5EZW A;  1FAY A;  1QIQ A;  1ZZ8 A;  3ZPO A;  4AED B;  1SBE A;  1VBC 2;  4LMF A;  3AL5 A;  5B2G B;  2NM1 A;  1Y9G A;  3OYW A;  2ZZQ A;  1CN1 A;  5C3Q A;  2WLP A;  4IGO A;  1V0A A;  4LXL A;  3UKN A;  2JEN A;  1CVN A;  2QZ3 A;  1QY4 A;  1COV 2;  3WNM A;  1BJQ A;  1FV3 A;  2HEV F;  3MUZ 1;  4DPN A;  5L7O A;  4DB5 A;  2CAV A;  4OI4 A;  1CAV A;  2MEV 3;  1UAI A;  4QPW A;  3E5U A;  4P5H A;  5DAQ A;  5ANN A;  5FJH A;  3LA3 A;  3L2H A;  1N47 A;  3LEG A;  5JXI A;  5EWS A;  4IEP A;  4XFB A;  4Y1X A;  4K7J A;  2XL9 A;  2JDZ A;  4NAO A;  4ES8 A;  1OQ1 A;  2QQJ A;  1H30 A;  2J1S A;  4IQP A;  3HQR A;  3MW3 A;  4BWO A;  2G9F A;  4CUA A;  1ONA A;  1MVQ A;  2C0Z A;  1VBC 1;  2PHR A;  5T5J A;  2D6N A;  4Q4Y 3;  2VQA A;  2WNV A;  4EWE A;  3PJQ A;  2VTX J;  1F4H A;  2IWG B;  1G9F A;  2WNE A;  5AVP A;  4ZU5 A;  4BPZ A;  5IT6 A;  3T2P A;  1S0F A;  4CEW B;  4E4Z A;  4D6Q A;  2YPD A;  5JXH A;  1RIN A;  2FCT A;  3KVA A;  2RV9 A;  1PGS A;  1QEX A;  2YU2 A;  4RQP B;  1RUI 2;  1PZ8 A;  3K4A A;  1GP5 A;  4HT1 T;  5KHH A;  4LO5 B;  3LPG A;  4D6R A;  5B4N A;  5C8C B;  4XET A;  4KWU A;  1DYK A;  4NHK A;  1MZE A;  4FXG B;  4H3W A;  4PHZ A;  5HCF A;  3SNM A;  4LBQ A;  2ZAB A;  2AZ5 A;  4FOQ A;  4MXV A;  1OLM A;  3RQ0 A;  2BOJ A;  3EO6 A;  1ASJ 3;  1EAH 3;  2YBP A;  3BPS A;  2JX9 A;  2VBD A;  3CKH A;  2EAK A;  3TN9 1;  2ZMN A;  3VBS B;  2TNF A;  1D2S A;  2ZCW A;  2XQR A;  3ACL A;  3OBA A;  4B7K A;  4BH9 A;  1OD5 A;  2XB6 C;  2VMG A;  2E6V A;  4JRL A;  2HWF 3;  5C5U A;  2DVG A;  1HRI 1;  5FCC A;  4WV8 A;  3JQW A;  4P9W A;  1BEV 2;  4CP0 A;  4F3J A;  1RUF 1;  2EID A;  2AR6 A;  2DUO A;  2JG8 B;  5C3O A;  4N53 B;  5C9A A;  1HXS 2;  1L7L A;  5LA2 A;  5FY7 A;  1BVV A;  1XE8 A;  2VZT A;  3N7K A;  4FAH A;  1RIT A;  4PJY A;  1UKG A;  3FBM A;  2F4L A;  2IXH A;  2BUK A;  2ZAA A;  4YG0 A;  2VVD A;  4BCU A;  1ND2 C;  3E6D A;  2W5F A;  1JOJ A;  2BNM A;  3JBG 3;  2IFW A;  4LK6 A;  4PLO A;  1QJY 3;  5A7O A;  4EV0 A;  1UPS A;  3TRS B;  4UT5 A;  1GIC A;  2VQT A;  3KCC A;  4A7Z A;  4CXW A;  4GWM A;  4YFZ A;  5IFT A;  1W39 A;  2PHF A;  3I2I A;  5JXJ A;  2HWB 2;  1WLC A;  1LNS A;  4H14 A;  2QQV A;  5FBJ A;  1H2N A;  5FZL A;  5J09 A;  1QQP 2;  4FFI A;  1HQL A;  1BZW A;  1YQ6 A;  2BW8 A;  3GZU C;  5FTT C;  1OUS A;  2J1A A;  3N9L A;  4COV A;  1HXS 1;  5FZD A;  4CU7 A;  1PO2 2;  3NAP A;  3OTF A;  1HKD A;  1XQN A;  1E57 A;  1ZRI A;  3BU7 A;  3THC A;  4PBP A;  4YM3 A;  5C7G A;  3HN3 A;  2WT2 A;  4NO4 A;  3JB8 A;  4BK4 A;  2AGS A;  2XDV A;  2W1U A;  2QZ2 A;  3BOW A;  1ZBE 2;  1QGL A;  1LTE A;  3K75 B;  4Y5T A;  5AC9 2;  2GNM A;  1K12 A;  4COW A;  4OYU A;  2E63 A;  5EQU A;  1IOA A;  1SQ4 A;  5E1R A;  1U5X A;  1U5Y A;  4X8N A;  5T3N A;  4QM8 A;  4P9X A;  1AR9 2;  2CWM A;  2VBP A;  3L9J T;  1NZI A;  5HCB A;  3ZN5 A;  4DOU A;  1XC6 A;  3WQ0 A;  3O12 A;  4E2S A;  5HBA A;  4GA9 A;  2YGM A;  1UY1 A;  4RA0 A;  5DUW A;  2E31 A;  5DXD A;  3JXS A;  3VKF C;  1QOS A;  1MS4 A;  2X5I A;  2ZGR A;  4AFM A;  5FKC A;  5ACA 1;  3SCH A;  1WCU A;  4D3W A;  3S57 A;  4H2A A;  4AVV A;  4OI0 A;  2W39 A;  4QT6 A;  2ZGO A;  4MZU A;  3URF A;  5FY0 A;  4UW3 A;  5F5A A;  2CU5 A;  3PVO A;  3U78 A;  4CCM A;  3VZJ A;  4ZZ8 A;  2ZGQ A;  1VRH 2;  2G9G A;  1NCR A;  4LHK A;  3HT2 A;  2YPJ A;  1AZD A;  3RMX A;  2H0V A;  3I59 A;  2HYX A;  5AC9 1;  1VBA 3;  4HVR A;  5JVV A;  3RNS A;  3H8O A;  1ZX5 A;  2WO3 A;  4ASK A;  5FMO L;  3ILF A;  1X7N A;  1W8H A;  2WNU C;  5DQ0 A;  4AVT A;  3O1O A;  5EV7 A;  1AR6 1;  1TME 3;  2WFF 3;  2PHT A;  4JAA A;  2PHW A;  4FPL A;  1T6G C;  1FAT A;  3LEM A;  4YGB A;  5LA9 A;  2A6V A;  1ENX A;  2Q1F A;  2WR9 A;  2G9Z A;  1PNF A;  4CUB A;  1HV0 A;  1ZBA 1;  1NA1 A;  2EXJ A;  1QJU 3;  3FLR A;  2HEW F;  4NOT A;  3SEP A;  2FD8 A;  2Y6J A;  4CDX A;  3JCI A;  1EV1 2;  2WYS A;  4GMP 1;  4OZO A;  1US2 A;  4QXK A;  1O3Q A;  1VMF A;  1WW4 A;  1RUH 1;  4OI2 A;  1TMF 1;  4WM7 C;  1VB4 A;  2HWC 1;  2A5Z A;  3I2F A;  3BB6 A;  4WM8 A;  4DUV A;  4LUM A;  4K3U A;  3TOJ A;  2WQ4 A;  4JQT A;  4FTE A;  2D3R A;  1GUI A;  4IGQ A;  4P5Y A;  1F35 A;  1N3P A;  5FZ1 A;  4AHY A;  5BNN A;  1JBC A;  3EXU A;  1EPZ A;  1XYP A;  1EY2 A;  2XXZ A;  3ACG A;  2PHD A;  5KXB A;  4XXA A;  2VZU A;  1JYT A;  2JDY A;  4R4X A;  1Q8S A;  2BNN A;  5KHG A;  3OUJ A;  5ERL A;  2R04 2;  5EJ3 A;  1J1L A;  3HVD A;  2WYF A;  3WZ1 A;  3ME2 A;  5DZE A;  3WV6 A;  5FZ4 A;  2WUH A;  1NG0 A;  2VC9 A;  3USU B;  3VDB A;  2VCA A;  1PO1 2;  2E26 A;  4Q4V 2;  5IW0 A;  1WBF A;  3CIH A;  3DXT A;  2VZV A;  2VH9 A;  5A3O A;  3WVJ A;  1JUH A;  3OGJ A;  2P6C A;  2YGL A;  1R64 A;  3POS A;  1GKB A;  1PIV 1;  2V4V A;  5BY5 A;  3SXW A;  1I6X A;  1MQT A;  2Z79 A;  1X82 A;  2XHK A;  3VBR C;  2O8O A;  3JQX A;  3M70 A;  5KHI A;  3ZYP A;  1C4R A;  1RUE 3;  1YO8 A;  2Q1Z B;  3GYD A;  3POY A;  2ARB A;  1BYH A;  1UQX A;  2EIG A;  3JD7 2;  2B9U A;  2TUN A;  4C0B A;  4JVA A;  2QKD A;  1YLL A;  4RFT 0;  1IQD C;  2XVK A;  1E5I A;  1PVC 1;  2ZHL A;  3R4U A;  4Z2W A;  1JI6 A;  3LWC A;  3AP5 A;  3IM0 A;  2FMD A;  3PU3 A;  4AI9 A;  2VME A;  4MXW A;  1JU3 A;  1ACC A;  2B4K A;  5EXO A;  1OVP A;  3RSJ A;  2QNK A;  2WA3 A;  2GNT A;  4KWL A;  4ZXK A;  5LBB A;  5BNP A;  1L7R A;  2XG3 A;  3PTY A;  3EQE A;  5I0R A;  4HLT A;  4RHV 2;  2PXJ A;  4Q4W 3;  4WVV A;  2VUC A;  1XNA A;  2D6M A;  1R08 3;  2EAL A;  4O65 A;  3FN9 A;  4TSV A;  4LR4 A;  3UT0 A;  2VQU A;  3CEW A;  3OD4 A;  4OVE A;  2DUR A;  4LE4 A;  1QJX 2;  1BBT 1;  4QQ2 A;  5CEH A;  2WT0 A;  3CF6 E;  1WCK A;  3ZKY A;  4E4S A;  3ZFE C;  1W8T A;  5E89 A;  1OHF A;  1LES A;  3UGH A;  4IEZ A;  1ND2 B;  3HNM A;  5LA0 A;  3RZM A;  1DGW X;  2GC0 A;  5FPX A;  1IPJ A;  1X8M A;  2QJV A;  1GWM A;  1QF3 A;  3H1Y A;  3BIE A;  2P3I A;  1CAW A;  4DUW A;  1BLZ A;  3I8T A;  1AYN 2;  1S2B A;  1S0J A;  3HNB M;  3PDQ A;  3WT3 A;  3AL6 A;  5LBC A;  2YFZ A;  3D0S A;  2DCY A;  1W6M A;  2VTX A;  2C5D A;  4AFD A;  1JZ4 A;  4NIA A;  3D5O A;  1OOP B;  1UY2 A;  4MUV A;  4RHV 1;  5L7O C;  1AXK A;  1GWK A;  1AYM 2;  2RDQ A;  5A70 A;  1RUD 1;  1GP4 A;  4MGQ A;  3AKP A;  2W87 A;  4NRP A;  2W94 A;  1D4M 2;  2E9Q A;  1QJX 1;  4QD2 A;  4XTM A;  2PFW A;  4ZS3 A;  1SFP A;  2E7T A;  5FMC A;  2RDS A;  5FY1 A;  3VUO A;  2RS1 1;  2QQI A;  4JX0 A;  5FO8 B;  1RUC 2;  4GAL A;  2P1B A;  4UBG A;  5GZD A;  2RMU 1;  3BYW A;  3K2O A;  5E8A A;  5DUX A;  4R8H A;  3BVC A;  1IPK A;  4OFG A;  2WNV C;  1IS4 A;  3PUS A;  1AYN 1;  3WW4 A;  5FOJ B;  1V9U 2;  4E27 A;  1PZ7 A;  4E8C A;  2QE3 A;  5BV6 A;  2RJK A;  1KIT A;  4XVH A;  3T1M A;  4QB1 A;  2RS5 2;  2QVS B;  2XJV A;  3RZK A;  3WQ1 A;  3ILR A;  4M01 A;  3HBZ A;  3UES A;  1UZW A;  4ATF A;  1SLT A;  1POV 1;  3UNP A;  1J84 A;  2RM2 2;  4XYX A;  5CVR A;  1CZS A;  5K4L A;  4AQT A;  2PTM A;  1HV1 A;  2R06 3;  1QMJ A;  3RG0 A;  2BV4 A;  1BXH A;  3GZA A;  3NNG A;  4P02 B;  1UZ0 A;  3V0A A;  3ZFF A;  1TG7 A;  4YM1 A;  2PHL A;  2ZAC A;  1ZRF A;  3LA7 A;  5FZ6 A;  1LOD A;  4EZ4 A;  4XCA A;  3O0X A;  5DG1 A;  1LAJ A;  2GP5 A;  2CL2 A;  2VNG A;  2RJ2 A;  4LK7 A;  5JR7 B;  3KM5 A;  4MSV A;  2LM3 A;  4QX8 A;  1XB9 A;  2PQS A;  2EAA A;  1AR8 3;  2WNU B;  3AYD A;  1SPP A;  5JAX A;  5IYY A;  2EXI A;  4IUG A;  5C4W A;  1GNY A;  1DF0 A;  2D5H A;  2R7E B;  2VMI A;  4FPH A;  4M4R A;  3T30 A;  5LWB A;  1OSG A;  1SDW A;  5F37 A;  1J3R A;  2CHH A;  4BM8 A;  4CUG A;  1T6B X;  4J6G A;  3H1M A;  2ZGS A;  4M3C B;  4B1M A;  3N7J A;  5FDB A;  3AZW A;  4E4H A;  2Y60 A;  2BRT A;  3GNE A;  5A33 B;  4B3N A;  4OUS A;  4JGZ A;  3BTX A;  5C9A C;  3BTY A;  1MR5 A;  1D2Q A;  3DCQ A;  4A6S A;  1NLQ A;  1VBD 1;  2VMF A;  4WZF A;  1DBN A;  1UIJ A;  1GLH A;  2BER A;  2QQO A;  1PMJ X;  5CKM A;  1VAK A;  1Z0H A;  3BOD A; 
#chains in the Genus database with same CATH homology
 2WR9 A;  5D2A A;  2WRA A;  5HCH A;  2JDH A;  4UT5 A;  4CE8 A;  5A70 A;  2XR4 A;  1GZT A;  2BP6 A;  2VUD A;  2JDP A;  5A6Z A;  1OUX A;  1OXC A;  3ZDV A;  5A3O A;  2JDU A;  4AOC A;  2CHH A;  5A6X A;  1OVS A;  2JDK A;  1OUR A;  1OVP A;  5A6Y A;  2JDN A;  2BOJ A;  2BV4 A;  2JDM A;  1W8F A;  2BOI A;  5A6Q A;  1W8H A;  3DCQ A;  2VNV A;  2VUC A;  1OUS A;  1UQX A;  2JDY A;  1UZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...