2RG4A

Crystal structure of the uncharacterized protein q2cbj1_9rhob from oceanicola granulosus htcc2516
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
206
Chain Sequence
b'SLAQIKSLFATRLYHAPLSEHGPALDPAEFAASCYSIAEDDDAGQEWCEREGYPGYTSYASLTDLPWRFPIFADLVKSLDAHVAAFAEDLEFELDGKALRLEDIWINILPEGGVHGSHIHPHSVISGTTYVAMPEGTSALKLEDPRLPFMMAAPTRRKGAREELRTFRSVAPKVGDVLLWESWLRHEVPMNMAEEDRISVSFNYAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of the uncharacterized protein Q2CBJ1_9RHOB from Oceanicola granulosus HTCC2516.
rcsb
source organism Oceanicola granulosus
molecule tags Structural genomics, unknown function
total genus 57
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13759 2OG-FeII_Oxy_5 Putative 2OG-Fe(II) oxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2rg4A01
5DAQA 2G1MA 4UWDA 5IATA 5LB6A 3EMRA 3NNLA 3PL0A 5DAPA 3OBZA 3KT4A 3BVCA 5DAWA 4Y5SA 2RDNA 5DAXA 5LBCA 4BQXA 4NHYA 3KT7A 4MHRA 4MHUA 3OUIA 5L9VA 4NHXA 2G19A 5LBFA 3DKQA 4XABA 2OPWA 2HBTA 3W20A 5L9RA 2A1XA 4Y5TA 2Y33A 5IAXA 5M0TA 4XC9A 3GJAA 3HQUA 2RG4A 2FCUA 4XCBA 2RDSA 5HV4A 3ITQA 5LATA 3OUJA 4XCAA 5DAVA 3NNFA 3OUHA 3HQRA 4JZRA 5HV0A 5C5TA 5LASA 3MGUA 4XAAA 4KBZA 2JIJA 2RDQA 5LA9A 4NHKA 4IW3A 4J25A 5L9BA 2HBUA 5IAVA 4BQYA 5C5UA 5EQUA 3GJBA 5ERLA 4NMIA 3W21A 2Y34A 5LBEA 2V4AA 4XACA 4NHMA 5LBBA 5EPAA 4BQWA 4NAOA 3KT1A 2FCVA 4ZPIA 5EP9A 4ZONA 2FCTA 2RDRA 3NNMA 3NNJA 2JIGA 3GZEA 4NHLA 5A3UA 4Q5OA
chains in the Genus database with same CATH superfamily
1HLCA 3SITA 5DZGA 4J6GA 1HB4A 2H6CA 4BQ3A 1Q8SA 2BNMA 1XNCA 2K2SA 3MHZA 2BP6A 3NNLA 3RFRA 5FWJA 5FY5A 3RDIA 3VL8A 1I6XA 2XHKA 3AC0A 3KT4A 3LDBA 4CCJA 3ZPOA 4H7LA 4GXLA 4HKWA 4LKFA 4Q4Y1 5F3IA 4QDSA 3POGA 1LGBA 2Y6KA 4DXTA 4BMEA 1NX9A 1V6LA 1W0NA 4QD2A 1EAH2 1OMIA 2WRAA 4BQ4A 3ZMNA 3BCWA 4R9AA 4EN8B 1SDWA 2J1AA 3T1MA 4CXWA 2GZWA 2GH8A 1QXPA 2WUHA 4DRVA 3OUIA 3O0WA 3ZSLA 1ZZ9A 2VQ0A 4Y5Z0 3PTYA 3MLKA 3QACA 3MW3A 3NSTA 4B4RA 4XVHA 5K9YA 4HOOA 4JKLA 1EYBA 4YW4A 3VZKA 2H0BA 2J22A 2DCZA 4IEYA 1AR62 2VMHA 1AF9A 1VMJA 5FRAA 5JXIA 4LEJA 2P6HA 4QPWA 4DXZA 1NY71 4M4RA 3AJZA 2WZPP 4LQRA 4RR3A 2KR2A 5M0TA 2VMCA 1MS8A 3LA3A 5F2WA 1WBFA 4QQ2A 4RFRB 2A3YA 2ZX3A 2CHHA 5FLHA 3P3NA 3VKFC 5FLJA 1HN1A 3V65A 1O8PA 1W6OB 4HANA 3MLLA 1AXYA 2RS13 3UNPA 2CWMA 2JICA 1YJLA 1SLTA 1NE6A 1MEC3 1QNWA 1RHI1 1YFXA 2ZX1A 1PIV3 3B5LB 4IV1B 1FOD2 4XBNA 4CCCA 3VKLA 1CJPA 1F15A 4IE5A 4CU6A 4UYBA 2HLEA 2FMYA 2D7FA 1GR3A 5FMOL 2ZBJA 1AR73 1VBC3 2CAVA 2DBIA 1OQ1A 1C8M3 1GQGA 1AR81 4RGGA 4ATEA 3ES1A 2Y64A 1CPMA 5D1IA 4AGRA 1LHNA 2Q1ZB 5H9QA 4QX5A 2XKOA 2DCYA 5GLUA 2ILMA 4H3WA 4PDWB 2DU1A 1CONA 1S4CA 5CKMA 2VW2A 5D8AC 3O0XA 3THDA 1YHFA 2XXZA 3M8LA 4XUOA 3CF6E 2OUHA 5IVYA 1H4GA 4META 3NVCA 1K5MC 2YG0A 2VAUA 2B9UA 4OZOA 1PK6A 3VDDA 4IETA 3C7EA 2Z5WA 1ONAA 5LBBA 2G9FA 1XYPA 1JU3A 1RITA 1W8ZA 4B4QA 4COYA 1FAYA 4IGPA 5FYIA 5BXXA 5FY4A 4DINB 3VB9A 2CL2A 2TNFA 1L7RA 2AEZA 3IMNA 2VZOA 4YZ4A 1ENSA 1VR3A 3TBDA 3PVEA 2PAMA 4CPBD 4WZFA 3D0JA 4CDUA 5I0SA 3LIGA 1RUF2 5CFDC 2UYBA 3Q8FA 1S0IA 2DVDA 1QJEA 4UI9L 5FXVA 1ST8A 4PQQA 5TSWA 1QJFA 2VG9A 1OQDA 2OXBA 1UMHA 1OUSA 5FZEA 3N9NA 2BFUL 2MEV3 2VZQA 3I4IA 4AVSA 1LNSA 1VRH2 1V6NA 4DB5A 2WFF3 1SCRA 1DG6A 1W2OA 1ZA7A 2J7MA 3GZAA 3VBUA 5DMYA 2WAAA 2RDNA 2AUYA 4ZY9A 4FVVA 1T2XA 4UFHA 2BNNA 1AJKA 2QDNA 4LIUA 1O3RA 4LTAA 2JDYA 2YGLA 3AKRA 2X53S 3O1TA 2JG8C 1YO8A 3IIAA 5FMDA 5BPXA 4EV0A 4FOYA 3OBTA 2YU1A 1ENRA 1PO13 4HVOA 1CAWA 4QX3A 3AP7A 1RUG1 5L9VA 2DU0A 1CVNA 3KF3A 1YFWA 5FJHA 2RMU2 3AL6A 4AI3A 1PMHX 4GJYA 4FSJA 1TNFA 1MR5A 2AR6A 2I74A 1PMIA 3W20A 1S2EA 1FNZA 5HI0A 5F3EA 4U2AA 4Y5TA 3KVAA 4LO4B 4D3WA 4DZGA 4MX3A 5J98B 1CX1A 5LRRA 2DVBA 4C0HA 3E1F1 2YBSA 3H50A 4IDZA 3POSA 5AFEA 3T2PA 3FHQA 2Z42A 3IDBB 4Y1YA 3LSDA 4NVPA 4EN9B 5JZGB 1ZYBA 3GBGA 4LBQD 1BBT2 1QJU1 4JHTA 5C5TA 1FPN3 4YYOA 1JUHA 3KMHA 4A44A 3FUOA 5D8AB 3NL1A 4R52A 4XFHA 2VUJA 1XBFA 2VE1A 2XLGA 3OEAA 2LTNA 3DPRA 1K5MB 4JDOA 4BIFA 1O4YA 2HYKA 2ZX2A 3B93A 2FHRA 2HWD3 5T5OA 3PTRB 3HN3A 3WP6A 4NO4A 1XE8A 3KCYA 4FQZA 1SPPB 2ZGOA 4M01A 4JGZC 2ZGLA 4UFJA 3FN9A 1FT9A 4LO5B 2GALA 3GBFA 1C3HA 1RINA 4DEQA 1RGSA 1PM7A 1ZRCA 1W6OA 2VBDA 3N4MA 3ZN5A 1DQ5A 3KV4A 1APNA 3VBRC 3BIWE 3R4UA 4AK3A 4D8MA 5CFDB 5GALA 2PHXA 4CSWA 2NYYA 1OA3A 1U5YA 3ZFEA 4B7EA 2Y6FA 4XQWA 1ZZ8A 2WSUA 1RHI2 5ACA1 2GP5A 1D2SA 1FMD1 4RFT0 2PLV3 5JOWA 1I3HA 3H3LA 4QB1A 5C3RA 3IB3A 1UY3A 2ZGTA 2R1DA 4XMIA 4RGKA 2BDRA 5C9AC 1MPXA 4IGQA 2ZA9A 3WW3A 3FUQA 3RGBA 3EB7A 4MGYE 2JE9A 1VP6A 3W9AA 5T5LA 3GZEA 1S0EA 4K1YA 5DG2A 3WD5A 3NAPC 3MIDA 1POV0 2RS53 3MUY1 1BXHA 1XSQA 2AYHA 2EF6A 4JC1A 3C7FA 5DAQA 3PU3A 4NWVA 3UGHA 2BBAA 5HCHA 2JKXA 3QD6A 5CEHA 4HVRA 1XOYA 3WNMA 3M3QA 3ROUA 4CUAA 1ULCA 4M3CE 1MACA 3FWEA 3PL0A 1RTVA 4XJZA 5T3NA 4GKXA 2ZKLA 2JG8B 3I2KA 2DURA 4MSVA 2VVDA 3ON7A 4I2OA 1W6NB 5DAWA 2C9KA 2QQMA 3PJYA 3AYAA 2P6CA 2D97A 1X82A 4UFIA 4EQVA 3O1MA 5I93A 2Y38A 1REEA 3VUOA 3MZHA 4V2VA 4M00A 1YQ8A 2X09A 4B8EA 4ZXEA 3LPFA 5H9PA 1BK0A 1XYNA 1PVXA 1HRV3 2GNMA 3ATGA 4JDMA 2VVFA 4M3CB 3RZGA 4OFGA 3RPQA 3ZSMA 2R063 4IXLA 4X6RB 1DQ6A 1VBB2 3AYCA 3K4ZA 1JH5A 5LEKA 2HWC2 1SFNA 1UF2C 5A3LA 4FFHA 2E51A 5L73A 4B1LA 4QXBA 2WWUA 3MIHA 5KHHA 3OGJA 5APAA 5DUXA 1CGPA 1ODNA 1SBEA 4UOJA 1WBLA 2W92A 4YVSC 2AC1A 1UL9A 1GV9A 2RJLA 4FI9A 1YRZA 4ZS3A 4OI1A 4CCDA 5KXBA 2BRTA 1WW7A 5J09A 3BTAA 1GOFA 3MV01 1AL21 4XMAA 1NOVA 1TMF3 1W6MB 3VZNA 3A0KA 1XE7A 3OGRA 4M3CF 4QAWA 4GB33 3KV5A 2IC1A 2ZKNA 2P3JA 3WDWA 3KSCA 4AI2A 1V6OA 1SFPA 1D4VB 1URXA 2R1BA 4JGZB 1QGLA 4AVTA 2W95A 5T55A 1OA4A 1S1AA 2IUWA 4QQHA 1RUG2 5FYHA 2WJSA 1V6MA 3ZIWA 3S7EA 1LECA 2HWB2 3B94A 1OUXA 3J7NA 5IK8A 3VBRB 3AYDA 1COV2 3BYWA 5FY8A 4LHNA 3TYJA 1GKBA 2B42B 5FYSA 1JYNA 4Z07A 3A7QA 1W2TA 2CDPA 1CAXA 5A33B 2QQKA 4AHWA 5C9AB 4NMIA 4JTNA 1C4RA 3ZYIB 1POV1 4QX2A 2ZGQA 3NV4A 3UJQA 1JYWA 1KDMA 3SEEA 3NAPB 4QWNA 2Q8DA 1JYTA 3THCA 1RUI3 1LEDA 3AJYA 2WQZC 4GA9A 4AGVA 2FCVA 5FKBA 5A3WA 4J1WA 4BDVB 1JZ3A 1J59A 2WYSA 5E1RA 2QVSB 1AXKA 2V5DA 3PU8A 4G9SB 1RXFA 2WSVA 4JX0A 2QQOA 4FCAA 1VBD2 4XILA 2MPFA 1TME2 1P8JA 4CP1A 1SPPA 1ZRIA 3GALA 2W0XA 2O8OA 2XBO1 3I2HA 1S0CA 3EBRA 3OPZA 1UXXX 5BNPC 1LHVA 4TWTA 3NV3A 1ZBE1 3ACGA 3AKQA 4XUTA 4RHV2 5I0UA 5KHKA 1S0BA 3ZXLA 5A32B 4Q26A 4OVEA 4N8MA 3T09A 4Q4W2 4K7JA 1EUTA 2QQJA 4IEZA 4I30A 4LBQB 2F6BA 3TN91 3DL3A 1CZSA 3H0OA 4YW3A 4DO0A 5IYYA 3VBOC 1SZBA 1IS4A 5FZBA 1IG0A 3SH3A 5FZ4A 1ZZCA 2R043 2VL4A 5ACA2 3NJXA 1CR7A 2PQQA 4QKDA 4ASMB 2W39A 5D21A 3R4DB 5FZ9A 4WVMA 1VB4A 3SXWA 4A2UA 4JQTA 5JDBA 3DCQA 1HQWA 1KQRA 1KXGA 2CSGA 2ZHLA 1ZZ6A 2P3YA 4MGKE 1GWLA 4JRLA 4LR4A 4YVSB 4XDQA 4YM0A 5FY1A 4KG0A 2BUKA 4KBBA 3MDPA 5EWSA 3N9QA 5LY2A 5JLVA 3VLBB 1UN1A 3ZSJA 4H14A 1U5ZA 5AC93 3KCXA 2VO5A 4FPCA 1W6NA 1SDDB 5CFCC 4OHZA 5FPZA 3VZMA 2A6ZA 3UGGA 1OLQA 5JI9A 1W8WA 5F32A 4BK5A 1V0AA 2VOXA 2VOTA 1DHKB 1N1SA 1AX2A 3HQUA 5JPMB 3GXUA 5HCAA 1TZOA 4HT1T 3ZOIA 4JAAA 4NRPA 4C90A 1V70A 3OUJA 4GMP0 4YW6A 1ENXA 1GWMA 1UZVA 1IS5A 2C9AA 1CD3G 2QBXA 3TEYA 4Q29A 3H3ZA 3VBFC 3AM2A 4JZRA 3ZM8A 1XPWA 1OF4A 4OZXA 3BTZA 1J1TA 1OSGA 1QJY1 1LENA 5F3CA 5CG9A 1D0HA 1MQTC 4XJWA 5AVPA 3O1UA 1UD1A 1ZRFA 5FYUA 2V72A 4CDQA 2JE7A 3B69A 3SCHA 3ES4A 3LFIA 3I3MA 1QY4A 2B9VA 2JIJA 4JKKA 4XF9A 3AX4A 2B5HA 3T4VA 1VBA1 1BYHA 1OVSA 1RUE3 2AZ5A 4J25A 1C5IA 1D7PM 2VULA 4NHKA 3ZXKA 1A8DA 4Q4X1 3V0AA 4LOTA 1WGPA 3APBA 3BU7A 5EFUA 1JXNA 4CTEA 5K7PA 5JI7A 3PHMA 4QPIC 1US2A 3KLSA 3VZLA 4AVAA 1AL22 2V4AA 4XACA 2D44A 5EJ1B 1TEIA 4JGZA 3SQOA 3PVNA 5KWRA 2VM9A 3JBG3 1QJX2 2AACA 4QPYA 4CYDA 5BNPB 5LCWL 3PDQA 1YQ5A 5FREA 4XURA 3Q8EA 2HWF2 1G9DA 3H1YA 4ZU7A 4ZONA 2DWRA 3AZYA 1RUD1 3VBRA 4P9JA 4MGQA 4YRDA 3LEGA 4AEKA 1ZREA 5F5AA 1W2UA 4CUBA 4S2DA 5HCBA 3MIEA 5EHDA 3FLPA 1GYKA 3SNMA 3VBOB 4MXWB 5FZDA 1GP5A 5FY0A 3JQXA 4HG6B 1ACCA 5C9AA 4Q4V3 4AQSA 1JOBA 2W68A 2UWCA 1NYWA 4KGGA 3UYJA 4BCUA 2WWSA 5BNOC 1O6UA 4AFCA 5JXHA 1W6QB 3ZX7A 3C7HA 3DXTA 3NAPA 4FOQA 3O1PA 1BJQA 1UY0A 2W1WA 4BISA 1UX7A 3OBZA 4P5YA 3WG3A 3WVJA 5K0UC 2GP3A 3PLQA 1LOBA 4MGTA 1JODA 1R1A3 4LNVA 2L9LA 5DPNA 3MF9A 4AVVA 2OQ7A 5F6LB 1ND2C 2EXIA 2I2SA 3PVBB 3WG2A 4AR2A 4TSVA 3J26N 3E6BA 3RYRA 3PIGA 4CVUA 3AB0A 5FZ3A 2J1UA 5CFCB 3M4FA 2OQ6A 2RS33 4O9GA 5C3QA 2XBO2 4XTMA 4LIVA 1FV2A 1DZQA 3LEIA 5IK5A 2RM23 3WNNA 3VV1A 2J1SA 3E5XA 1ZBE2 1AR61 2XL7A 2JENA 3DKQA 3NKGA 4GMP1 5LBFA 4AVCA 4CCNA 3VD7A 3RZLA 5IJRA 5C3SA 4DUXA 1MVEA 2YC4A 3M7AA 4EN0A 5FYBA 2QQLA 5FTTC 5B4NA 1IPJA 3VBFB 2D3RA 3TN92 4Q8KA 5CKQA 2E32A 2WLQA 4W65A 4XFGA 4QGLA 3U10A 1MQTB 2ORZA 2VXRA 2JECA 4Q27A 2E53A 5FO7B 1UZWA 3SH5A 1OLME 3M3CA 2VZPA 3EYPA 3HT1A 1RVF1 1FOD1 1K5JA 4BLJA 4Q0PA 1Z0HA 1F2NA 4COZA 1H2NA 4DUVA 4QU1A 1VALA 3AZXA 1LKNA 3PNAA 2WZR3 3FFQA 4UFKA 2XWJB 4QQLA 3Q8BA 5JSRA 1HRI3 3ACHA 2OA2A 2ARXA 4QPIB 4XW3A 3V56A 5C8CC 1ZNPA 1H2KA 4XUQA 5GM0A 3ZYHA 3D4KA 3FL7A 2Y6GA 1CWPA 1D4M3 5FZKA 4ZKTB 1RUC2 5FZCA 3AVRA 4WM8C 5HCFA 4ARYA 1L3JA 4URAA 3DKWA 1HV1A 1EAH3 1OHFA 1RMU2 3CU7A 4LE3A 5F6KA 2K0GA 5I0RA 1F8VA 1H6YA 2R073 4KGQA 3A22A 3I3QA 5SV5A 3M70A 1RL3A 2R0FA 2W87A 1W90A 2XL9A 2Q30A 3CLPA 3MFCA 3ZN6A 5KXEA 3KT1A 2EIEA 4UFMA 1MS3A 1WCKA 2VR4A 1W8TA 2GC2A 3U07A 4AFDA 4XF0A 5FPUA 3USUB 5BNOB 1RUF1 2IXLA 5KR7A 3GZTB 4EZ4A 5L7OC 2IZWA 2JD9A 3MICA 5B4XA 2ZS6B 5K0UB 1QJZA 2WDBA 4K9SA 4W6WA 2JDKA 1WW4A 3N35A 4OHVA 1SQ4A 1ZVFA 5GZCA 4RL7A 1H2MA 2VW0A 1AUYA 1VBA2 3HPNA 4KU8A 2D6LX 1DGWX 2XWBB 1KJRA 1ND2B 4Q4X2 1VRH1 2E7AA 2ZAAA 4FP3A 5ABJC 1I9RA 4A3XA 3T2OA 3EO6A 1N1TA 2RR12 3ORJA 4AFBA 3N7MA 4R9CA 1W6PB 5BNPA 4U36A 1N1VA 2VU9A 2VCMA 4ASKA 3I3BA 5LK5A 4JGYC 4AF9A 5JWPA 4A7YA 4MUVA 2PHDA 4YW1A 3SKVA 4ZXKA 1WW5A 3CKHA 2WNVA 2SLIA 2RV9A 3LWCA 1L7LA 3DEMA 5H9RA 2Q1FA 5FZ8A 3LIHA 1AYN2 4GZ9A 3FBYA 2P17A 4XIKA 1W28A 5FP4A 4HKOA 1IG3A 4QHOA 2QFEA 4B3NA 1ZZ7A 3VBOA 1YQCA 3GNEA 3PMSA 2D5FA 3WNKA 4AHYA 4IEPA 2JG9C 5FZOB 1UAIA 3J8F2 2C26A 4LUKA 2UWAA 2RMU1 1ND3A 3CHXA 4QB2A 2YBPA 3VGIA 5DABA 2GNTA 5BNQA 4GWJA 4YG3A 2NN8A 4PF5A 4FFIA 1SLLA 1UY4A 2DBNA 1ALYA 1NUKA 3KS7A 1GP6A 3MUZ1 2WQ4A 3NJYA 3AK0A 5IVEA 1Q8QA 3NV2A 4QU2A 3I49A 4UW6A 3M2MA 3A21A 1EPZA 2ATFA 2BNOA 1LCLA 1JZ2A 3L2HA 4WVVA 3BOPA 1MZ5A 1VBE1 3HAGA 2EXJA 4YVWC 3RWNA 3N7LA 3MFAA 4FAGA 1BBT1 5C8CB 3O7OA 1DDLA 1V9U1 3BKZA 2NMOA 4FTSA 3ZVXA 2PHUA 5C3PA 2ZAHA 1JZ5A 2DFBA 4WM8B 1JOJA 1UOGA 1SBFA 1UU6A 4LKSA 2E7TA 1R092 2VQUA 4PHZA 1B09A 4L92A 5JSPA 3RJ2X 2XJVA 3AP5A 4QX7A 5FUPA 1WLDA 4IQPA 1BEV2 3AVSA 2YFUA 4D6QA 3VBFA 1V6IA 1KFUL 3AKPA 1VPHA 3S5AA 1J3QA 5JIAA 5EYXA 4C0BA 1JYVA 4FPOB 1R081 4HVQA 5IVVA 2Q1MA 4E27A 4FBFA 4UFLA 1ULEA 2XB6C 2AGSA 2Y6LA 5CADA 4XUPA 4N53A 1C28A 1WCQA 3GZUC 3OGSA 5JR7B 5FPBA 4LK7A 5BUVA 1OH4A 2DVGA 1Y4WA 2YXSA 3I54A 3MF6A 3EQEA 5L7OB 1QDOA 1QF3A 3EJKA 5FY9A 2JXAA 1RVF2 4RSUA 5FMCA 4BQWA 2D98A 1FATA 1PGW2 1GNHA 1UU4A 1REDA 2B7YA 2W46A 3I59B 3PURA 3H8XA 1HN0A 1Q8VA 4QXHA 4Y3OA 3UL2A 5LA0A 4QPIA 4NRQA 4HSLA 3VN4A 2MHFA 1JBCA 5ABJB 1EV12 5A7PA 1LB2A 3ZXDA 5JZGC 4Y1ZA 3LF7A 4R9BA 2BWAA 2HJIA 4JGYB 1VB2A 4AHZA 2WKKA 5KHIA 4Q4Y3 4IE7A 2UURA 2D40A 2C5DA 2G9ZA 3HNYM 3VHNA 3IPVA 2E31A 1JHNA 1H9PA 4KI5M 4MADA 2ZHKA 5FQ0A 4Y33A 2DDUA 3RZZA 4EWEA 4GD4A 1OVPA 1PO22 4ATFA 3LEMA 4PBOA 5KHJA 1Z7S3 2ORXA 1PVC2 5AVAA 4LHSA 2ZX4A 1Y43B 5CISA 2JG9B 1PNGA 5DUWA 3JD72 4CU9A 1G6NA 1RJ8A 2BERA 4RQPC 5FPAA 3USUA 4WM7A 5BNOA 1Q5OA 1CESA 3S0MA 4BHPA 3MI8A 4QDQA 5FLIA 4LJHA 4WVZA 2ES3A 5CZKA 5K0UA 2E6VA 2JJ6A 2VXJA 3J7LA 1DIWA 2W91A 1VBB1 1JZ4A 3RZKA 4QDRA 1OH3A 2HWC1 2GAUA 3RS6A 3AXDA 2UY9A 3MPBA 1ND2A 3WDVA 1QHDA 2ZX0A 3K4DA 3IM0A 1GANA 5GZEA 5ISLA 5A6ZA 5IT6A 4A6OA 5IHRA 1WLWA 2IFRA 4C1XA 1DGLA 4YVWB 5FUIA 5FZHA 3HT2A 1WMXA 3ETPA 3AMMA 3IZOA 3KD4A 3ZYJB 2EXHA 4GWNA 3WUDA 4FO9A 1H1AA 4I02A 1RHI3 2LROA 3U14A 4D7TA 4QM8A 2VZUA 3GYDA 4AI9A 2TEPA 3WINE 1IZ3A 4BB3A 1VAKA 2W2IA 4FFFA 4YGBA 1D0GA 4AI8A 4HFSA 3C7GA 1OOPC 3FE5A 4GWMA 4QT6A 3V0BB 2DUQA 5A7OA 1NQDA 2ADDA 4CP2A 5FZOA 1AR83 5F7UA 5J7MA 3HWJA 4UXAA 1YFUA 3IBMA 5CKNA 1IKQA 4ORFA 4ZU4A 1YYNA 2HWB1 1XNBA 3NV1A 4P9YA 4ZZ5A 3INAA 1QH6A 2DUPA 3O0VA 1UKGA 1COV1 5A6XA 3AMNA 3KHBA 1YJKA 5AFBA 2WO7A 2BTVC 5KXCA 1JU4A 4PLNA 2JD4A 1H4HA 1G9BA 3NW4A 3ZKYA 3K46A 4Q0SA 5LA9A 3ST7A 4MYEA 4BIOA 3MYXA 4PIXA 4O65A 2IXJA 4IW3A 4PQ9A 1AL0G 4MZUA 1EP0A 3P3PA 3EXUA 2SBAA 3JXSA 2ZOEB 2ZABA 1IPKA 3RI9A 2J1VA 4E4SA 1QIQA 2BYVE 4GIQA 3RMXA 3BB6A 1VBE2 3WF3A 1AR72 1VBC2 1RXGA 3IWZA 4WM8A 1DYPA 1WLCA 4Y4RA 1C8M2 2ADEA 4F8AA 1V9U2 3TNQA 4F83A 1ZRDA 1VRBA 4JTOA 4LBKA 1Q8PA 4Z92B 3NRUA 1FYUA 1XU1A 1DZTA 1VBD1 2QQUA 1TME1 1UZ0A 1Q8OA 2ET7A 3AP4A 3LB9A 3N9MA 2FCTA 3OJBA 5FPLA 1H9WA 1DQ0A 1W9TA 1MZFA 3LD8A 1VLNA 2XG3A 5DZEA 2FDGA 5FCCA 2JIGA 4DY5A 2XVGA 2ZEYA 4B7KA 2Q0AA 1X50A 2WFPA 4RHV1 1NAEA 4ISQA 1HV0A 4Q5OA 4D69A 5K4LA 3WEZA 3CJXA 4FP2A 1JS9A 1RUJ1 1TVGA 1WD3A 4RQPB 3PUSA 3VD4A 5DDJ1 1R082 2OUJA 1UYPA 5CIRA 3AP6A 2G1MA 4Q4W1 5L7OA 4C1WA 5JMOA 4KNCA 4Q2FA 3TAYA 4CXXA 4JKMA 5DAPA 4IV1A 2D43A 4Y26A 2G9GA 3B00A 4URTA 3I59A 3LA7A 3S30A 3WDTA 5C71A 4FPJA 4MVTA 5BNNC 5IVFA 3RRDA 4LHLA 3ZKUA 4XPVA 3HBZA 4GH4C 1O3SA 5DAXA 1W04A 4LA3A 3E97A 1RUG3 4R8HA 1M4WA 2I45A 1RC6A 1YWKA 4AQ6A 2KD7A 4BQXA 1E5IA 5L36A 1NE4A 2PAKA 5FBZA 5C3OA 1Y9GA 1RIRA 3P6BA 4LLFA 3ASIA 3MW4A 1OLRA 4PDWA 1UY2A 1YIFA 3I3EA 2XJUA 4XF4A 4CUGA 1JW6A 4G4FA 5FYVA 1QKQA 4YLZA 1XC6A 3K51A 4A7KA 4BWOA 2VQTA 4E8CA 2VOWA 1OOPB 1XNTA 4TZDA 4L11A 2OPWA 2PXJA 4QHBA 3E5QA 3HEIA 5FZAA 1VMHA 3LDRA 1OKQA 2Q8CA 1XQNA 5L9RA 3ETQA 1A78A 2R49A 1EUUA 5FP7A 1QJU3 3B02A 3FC0A 1PO12 5FJKA 1SCSA 4BLIA 5FIXA 3LFMA 1GQHA 5FYYA 2GC1A 2BPA2 3ITQA 1Z78A 2WNUC 2VZVA 4DS0A 5L19A 1W2NA 1VAMA 4HETA 4NWWA 2GSYA 3CBNA 3ZXAC 1HB2A 1K45A 4YW7A 2FDKA 1ZZBA 1UYXA 3I2GA 5I91A 3LEKA 4J1XA 5CG8A 1W8OA 2QZ2A 1WD4A 4QPGC 1X33A 2A70A 5LASA 1DFQA 3MGUA 2OPKA 1XYOA 2J42A 4YVWA 5ANQA 3NWKA 4XAAA 4EROA 1PGL1 4K40A 1AX1A 4MV2A 3C7OA 3K77A 5T52A 3KCCA 2A3WA 3BPSA 4DQAA 4ET7A 5J96B 2PHWA 5A80A 5CNAA 1R64A 1W9FA 4ES8A 1ASJ1 5FFOC 3WCRA 1XE0A 2KXLA 4ASLA 5ACA3 1FMD3 2WLPA 1PZ9A 4LBOA 3R0RA 5EQUA 1KDKA 3O1VA 1FPN2 1LESA 3IN9A 3OEBA 4BH9A 3HD8B 2WINB 2Q8OA 3W21A 1QJX1 5FZ0A 4Y1XA 4Z2AA 3LCPA 1AX0A 2JKBA 4JHZA 1C8NA 2Q8EA 4P9XA 3SH4A 4FFGA 2HWF1 2F17A 3V64A 1OFSA 3R6SA 4P9LA 5FYMA 2P3KA 1E5HA 1AR91 3OBRA 4K3UA 3WW2A 1QNYA 3PUAA 3HVDA 2ZMNA 1POQA 1XU2A 4LOSA 3NJVA 3UT0A 1S0DA 2CNAA 2K9ZA 1XB9A 4DY3A 3RZMA 5BNNB 4GJZA 2J1EA 4GH4B 1GZCA 4JQRA 1LJ7A 1UOFA 1UZZA 3N36A 1W3XA 1JOPA 3N3HA 2W5FA 3ZSEA 4YM2A 1ULPA 5LB6A 4RA0A 5JZGA 2GN3A 3WW4A 1PMJX 4HPKB 3WF0A 2UU8A 4QGNA 2BZDA 4D7SA 1W0OA 2VZRA 3CJIC 5D8AA 4Y22B 4COUA 3S5QA 4XJ9A 4QB6A 2VTFA 3MLJA 2RS52 2OZJA 3FHAA 1K5MA 4P02B 3T3YA 3AFKA 4QX0A 2H0VA 1W8FA 5ANNA 3ZLIA 4OUEA 5IVCA 5JSOA 4XE9A 1GQPA 4BU2A 2EXKA 4RQPA 3ZSKA 4RD7A 1UY1A 1OPMA 3BOWA 4HKLA 4K20A 2VNOA 2FDFA 2WN2A 3DUIA 4AZZA 1UQXA 1GWKA 4IE6A 4EWDA 2PTMA 1HX6A 1RUJ2 2VH9A 4CP0A 1CJDA 5CFDA 2ZHNA 4OI4A 5DDJ2 1FV3A 5FXZA 3WV6A 4E2GA 4R4XA 2QQIA 4UF0B 4X6QB 4AEDC 3OSDA 1AL23 2WNUB 1GOGA 4K1ZA 4XAEA 3B7MA 2V73A 3ZXJA 3H1MA 5DZFA 1CAUB 4A41A 3HIFA 4YW2A 4Z8BA 1J3RA 2WT2A 2R0HA 3VHOA 3H7JA 1QQP1 1UYYA 1HRV2 2XONA 4GALA 3WNXA 1E5RA 2A71A 4QPGB 2RG4A 4XXAA 2EIGA 1JUIA 2R062 2XLFA 4QGMA 4XCBA 4P00B 3HBKA 4XFCA 1YQ2A 3WCSA 4AVBA 4D94A 2R6QA 4ITCA 5A7WB 3K4AA 3QLQA 4Y20B 1MS4A 4B29A 1QEXA 2Z2SB 4PLMA 3SC7X 1EPWA 3EHKA 1RUH1 2VNRA 2VTXA 2WL1A 4YFWA 4UAPA 2PA7A 3Q9OA 1OOPA 3WDUA 2B45X 2WS91 1W99A 3RZJA 2RJ2A 2JG8A 2WIIB 4CU7A 4AHXA 4YGCA 1WLTA 2YU2A 5GLVA 1WW6A 5LY1A 3UKVA 2AREA 5G04L 5JCTA 1RUC1 4M0HA 1POV3 1T6BX 3ZDSA 1OD5A 4IEVA 3T4HB 1STMA 2P5BA 5KHGA 3ACLA 1TMF2 3W5MA 2FZ2A 3WG1A 3I2JA 3OTFA 4RS5C 2WT0A 3B3QE 4GB32 5FYTA 1RMU1 1VAVA 4XZUG 1OF3A 5GJ6A 4AQ2A 3POBA 4L97A 4W6YA 3E6DA 2AEYA 4PI2A 3VKNA 2A75A 5F39A 4NR1A 5A7QA 4M3CA 2D6OX 2HWE1 2ET1A 5J1XA 1UPSA 4AI0A 1LHWA 1O91A 5LBEA 3I2IA 4RYDA 1MS1A 2XBO3 4LKEA 1YLLA 4DMIA 1UU5A 3H8OA 3T0DA 3WQ0A 4UW5A 4Y1VA 4S2HA 2W9XA 1ZBE3 1NG0A 1BMV2 1YEWA 3UGFA 4P9GA 3AZWA 3GGLA 4UT5A 3NNJA 1YUDA 2D93A 2B8MA 1JHJA 2R32A 2C0ZA 3U75A 1IS3A 3WDXA 3H8RA 1JYIA 5E16A 4A7ZA 4CCOA 3TN93 5A3UA 4XFFA 4CCEA 3CJIB 1YXWA 5FPXA 3KV9A 5C6CA 2XDVA 4ZU5A 4D6RA 1W6MA 5HBAA 1ASJ2 1RUI2 2ZGNA 4N9HA 2RR11 3F2ZA 4XETA 3LDKA 4RR3C 3T0AA 1AYM1 2CYFA 4HL0A 4AEJA 1F5FA 4D7YA 2VJXA 2YYOA 5A6QA 2XJQA 1ZRRA 5EXOA 4CRQA 4DIQA 2CTVA 2X10A 1WA6X 3FLRA 5JOYA 1G8WA 3AZVA 5I8SA 2FD8A 3RNSA 3OG2A 4PI0A 4CEYC 4EN7B 1RB8G 4NRMA 5FZFA 2NZ9A 1AYN1 1N3QA 3A4UA 3AMHA 2WO2A 4M4PA 1BLZA 1HXS1 1AR92 4XF3A 2Y0IA 1CX4A 2EALA 4YM3A 4YNIA 1PNFA 2NQYA 2PFWA 3MIFA 4AEDB 5IFTA 2F4PA 3J8F1 1F4AA 2XQXA 4E4ZA 3O1OA 3E5UA 4LBJA 2DTYA 2DUOA 1ZX5A 2GNDA 3AKTA 4GH4A 4QXCA 2O0OA 1LOFC 1YCIA 5D2AA 5A33A 1IKPA 2HH9A 1UNBA 5CVRA 5A3OA 2ERFA 2QCSB 5SV8A 1OQEA 4OQ8A 1UWWA 4K8RB 4BA6A 5IVBA 1C1FA 3IAPA 1GICA 5FKCA 2Z69A 3WHTA 2JX9A 3P1IA 1HKDA 4QM9A 3OB8A 3OY8B 1H0BA 2FBEA 4HPKA 1ZM1A 2QE3A 4FPFA 2BEOA 1YI7A 4L2NA 4MGIE 4FPHA 4TLGA 5E89A 4Y22A 4NAMA 1SACA 2JDHA 3ZYFA 3G6JB 2A1XA 1WMEA 2NM1A 2Y8KA 3OGGA 1PK6C 3VDDC 2HEWF 4MH0E 4NIIA 1QJY3 5KBFA 2E7QA 4W50A 2QQVA 3MEPA 4IV3C 3LPGA 5CYYA 3WX5A 1PGL2 1LEMA 3LE0A 1XNKA 3I8TA 5LATA 2YC0A 4AWDA 3O12A 1ZBA1 1H6XA 1H2LA 3VHRA 5FWEA 3CO2A 4DRRA 5DAVA 5AC92 4L9BA 4FTBA 3ZDVA 1CZTA 1VBA3 1R091 3HMYA 4RS5B 5A32A 1SBDA 2HEVF 4FPGA 4Q4X3 4OCTA 1BEV1 2RE9A 4YW5A 2WNUA 1W9WA 4LBQA 3C2UA 1CAUA 5IUQA 4RGAA 4YSFA 2XR4A 2RDQA 1W39A 3RZHA 4I3PA 3WQBA 5L9BA 2ZGMA 4XEZA 4CU8A 4AAPA 1MS0A 1QQP2 1AXZA 1OKOA 2FMDA 2N7GA 4HK9A 4N90A 4O7XA 2R16A 4AE2A 4Y20A 1RUD3 2VMEA 3POEA 4IEXA 5DG1A 3WUCA 1XXNA 5G05L 3UK9A 1PGW1 3IDEA 4YVSA 2X5IC 3IIIA 4LO7A 1DYOA 1RUH2 2ZTNA 4I0AA 1GP4A 2WZEA 3O1SA 5T5JA 4HONA 5J48A 1EV11 2A6VA 1PZ8A 3N9PA 1RUE2 1SLAA 4RR3B 4E9KA 4JV4A 2WS92 3BUCA 4DXSA 3LKJA 4R4ZA 2XVLA 1MZEA 2BV4A 5C33A 5GLZA 4NHLA 4FQ4A 4CEYB 1WMDA 1S55A 1LOAA 4Y24A 4QHZA 2OVUA 1PO21 3JBG2 1UX6A 2WC2A 3FJSA 4V1PA 1PVC1 3VBHC 4HMZA 1CPNA 2PHTA 1YIPA 3CDZB 4Q1RA 2HWE2 3JD71 1BVP1 1N3PA 4N9IA 5A1AA 1G9CA 1Y9MA 1J84A 1CZVA 4OHXA 2ZGUA 2WNEA 5T5PA 4YZ1A 4Y5SA 1LRHA 2CDOA 1LR5A 3ACIA 4A42A 2DYCA 1AR63 2XJRA 4GMP3 1S0FA 4XTPA 3VDAA 3R05A 4IEQA 4Q4V2 4BOWA 2NP0A 2ZGKA 5J3UA 1DGRN 2E33A 2FZ1A 2JEMA 3A0NA 3NJZA 4E2SA 1SMVA 3LOBA 2A3XA 2FDIA 1LULA 3DPRC 3GHNA 1DF0A 1PK6B 3VDDB 4PIYA 3D3AA 3RQ0A 2DCTA 4KWLA 4OHWA 5EV7A 3T30A 1ULFA 4IV3B 4YZ5A 5CA6A 5IK4A 5A1FA 3AFGA 4F7ZA 1DGWA 1AYM2 3LA2A 4XABA 1E57A 1QXJA 2CGNA 3POJA 5FO9B 1FOD3 3OCPA 4KH9A 2QNKA 2RVAA 2WO3A 2ZZQA 3PMEA 5GLWA 5IWFA 2X05A 2RS32 2Z79A 4QKNA 4CCMA 1UPIA 3X29B 2UWBA 3ZXEA 4AEDA 4CDXC 3ZFEC 1W8NA 4FAHA 3TOJA 2GMMA 1HQLA 1HXS2 3B9IA 3PUHA 1HIXA 5FZLA 3VDBA 4KU7A 5T54A 3C8XA 4MXWA 1HW5A 2XMLA 4YM1A 3WZ1A 4Z2WA 4H55A 1J3PA 3OUHA 5GZGA 1O5LA 2ETEA 1LGNA 3KV6A 4UW3A 1WMFA 2EAKA 5JPNB 4EWAA 3L9JT 1N3OA 1W6QA 4YZ3A 2VUAA 1JMUB 2CY6A 1KITA 3ENRA 3PUQA 3WF2A 1JZ8A 4P5HA 5FP8A 5A3TA 1DP0A 2XVKA 3MW2A 4XUNA 3HNMA 2RS11 1RJ7A 2B4KA 1WCUA 3G7DA 1MEC1 2X5IB 3I7DA 4MOAA 1AJOA 1H8TC 4FT8A 3RWKX 1PIV1 3THTA 3QH7A 1X36A 4PF1A 3H1WA 2ZEZA 5C5UA 2D6PA 3LZZA 1S2KA 5BY5A 4PLOA 5CFCA 1CAWB 1AR71 1KJLA 1VBC1 1RUF3 3GJBA 4LUMA 1NA1C 2WZR2 3K48A 5FMOS 4ISRA 1C8M1 3SISA 1U12A 1HRI2 1OI6A 4EN6B 2ZGPA 2LS6A 3KF5A 5EIYB 4RS5A 2YHJA 3DYPA 1ZBA2 3GCXA 3JU9A 4NHMA 4L0PA 1WWYA 3AZZA 2VUCA 5C7GA 1D4M2 2PAEA 3OPWA 3BPZA 3OD4A 3SHRA 4AG4A 2QZ3A 1NLSA 1VRH3 1IQDC 3VBHB 4DNYA 2Q5TA 4Y1UA 3OF1A 1G9FA 1G7YA 2JB8A 2ZZJA 3DYOA 3HJRA 4HSJA 3ELNA 5A7NA 1DQ4A 1Z7S1 2IWGB 2J1TA 4XDOA 3ILNA 2XJPA 1GU3A 1MQTA 5BV6A 1NLQA 2R072 4INDA 1WUVA 2ZXQA 4IL7A 1W9SA 3ZFFC 4N43C 2BVVA 1CIWA 2PMWB 2Y6JA 4HK8A 5B2GB 4HN0A 3ZO0B 4E4HA 1JYCA 2I07B 2AH2A 5E6HA 5F2SA 5JVVA 3EMRA 5HXMA 5F5CA 5FZ1A 4ZZ8A 5FMBA 3TB0A 1K42A 5FPVA 3IT8A 2LRPA 2BU9A 3DPRB 4IERA 4I01A 2RMU3 4FXKB 4BQ5A 2WNOA 3LGRA 4GKYA 2GC0A 2XOMA 1OFNA 2UY8A 3ZXGA 2YGMA 3D82A 4EJRA 2MEV1 2PN5A 3M1HA 4IEUA 2XJSA 1OLMA 4X8PA 4ZHNA 2BFUS 4KWKA 2CGOA 1LHOA 2ID4A 5CU1A 4ARXA 4CEYA 2WFF1 2YFZA 5DQ0A 2X8KA 3AL5A 2D6NA 1VE0A 2CU5A 3TEZA 2WZ8A 4I0BA 4YGEA 1W2AX 4CDXB 2VOVA 3ZFEB 2ZGSA 3O5SA 2PHLA 2WO1A 2EAAA 4C91A 1S0JA 2B39A 3QOPA 3H9AA 3FFZA 1VBE3 1X7NA 1LOFA 2HBTA 4X8NA 1BBT3 5C4WC 1V9U3 3H8UA 1W05A 1PO11 1GBGA 2ZCWA 4Q1PA 2CV6A 2Y33A 2JWPA 3SLIA 2VOKA 3UJOA 4DOUA 4LO8A 3IAQA 1UCXA 4KG8A 1XRUA 2ARAA 4AW7A 1GOHA 5KC6A 1RUOA 2VZSA 4YPJA 4IEWA 4QQOA 5FYZA 5DXDA 1ULOA 3CZUA 1W06A 3Q8CA 4G3YC 3DECA 3SCFA 1OPOA 2ZGRA 5GZDA 3H42B 1DQ2A 1H8TB 2PQSA 4AQTA 1UKRA 5CBLA 3IKWA 4E2QA 4IV3A 1R083 1DU3D 2DCKA 4Q0VA 1ULDA 3K2OA 1W6PA 4E4DX 4PBPA 4DUWA 2PYTA 1DLLA 4GQ7A 5CAZA 1NA1B 3BTXA 4BXSV 4KQ7A 2LM3A 3HR9A 5I0TA 1UMZA 1AVBA 3HNBM 3JB8A 4I09A 1NCRC 2IXIA 3W5NA 2WT1A 1FPN1 1T6GC 4OMCA 1V00A 4RN5A 3RYPA 4CDWC 1KRIA 4MG2A 3Q8AA 2FDJA 1L7QA 5JXGA 1QOOA 4S2GA 2HEYF 1M06G 2VCBA 3JZVA 4K21A 2P3IA 5ERLA 2ARBA 1YC61 4LBLA 2QTWB 3ILRA 3JUUA 1KEXA 2HWD1 2JDPA 3VL9A 4MXVA 1GMMA 3OGVA 1YQ6A 2IVJA 3WP4A 4BQ1A 4FPYA 4DFSA 2VNVA 4TYSA 1LODA 2EICA 5I8TA 2A6WA 3ZFFB 1DLCA 4N43B 1BK1A 1W8HA 2PELA 3P5BA 4DPNA 4QX8A 4FPEA 4EYUA 3NQHA 3NNMA 4AAXA 2O1QA 1H30A 3CIHA 2X5IA 3BN6A 1CQ9A 2Z4FA 1GSLA 3H3UA 2AENA 2RS12 2YB7A 2YV8A 2WR9A 2QJVA 3KQRA 2VBBA 1MEC2 2R30A 3WT3A 2DCJA 4NJ4A 2ZEXA 1US3A 2PLV1 1PIV2 4AEMA 3WXPA 2FDHA 1NZIA 1O7FA 1X9PA 3T1LA 4CCKA 5LK7B 5C8CA 2OYZA 3RVHA 2ZPXA 1W9YA 3KQ4B 4W8JA 4H2AA 1JZ7A 3KB5A 1H1MA 4DXRA 3OPTA 2VZ1A 4LLOA 1J58A 1NQJA 1VBB3 2RS51 2WQ8A 4A45A 3KVBA 2DF7A 2HWC3 2VMDA 4OQ9A 4NPLA 4TLFA 4WZCA 1HJFA 3ZYRA 3VBHA 2O14A 3ZR6A 5LBCA 4Q4Y2 3GBWA 4ONUA 4LO6B 3SMHA 4A3ZA 2VMGA 1SG3A 3BIEA 1UO9A 1NXD1 4LPLA 1CAXB 5FK8A 1J83A 1O59A 5C4WB 4JVAA 3FLTA 4CDQC 1Z7S2 1XJAA 2G19A 5FZGA 3TWIA 3MO4A 4QKBA 4KL1A 4XZPA 4D0QA 4B1MA 1O3QA 4I3GA 4LMFA 1HRV1 1PX4A 3T2TA 4GULA 4WV8A 3WNOA 5I8YA 3TNPB 2ARCA 5FOBB 2R061 3S57A 1NT0A 2LALA 5IAXA 4XC9A 3GJAA 1UMIA 1KS4A 5ABJA 1E5SA 3D6EA 1GFF2 2FCUA 1NY72 1NCQC 1BQPA 2HWB3 2Q4SA 3LQCA 2RDSA 2WA3A 2YY1A 3RMYA 4XJAA 1FI2A 1COV3 2MEV2 4JGYA 1YFYA 2VQAA 4XCAA 2VD7A 4M0NA 2XJTA 1YNAA 1LGCA 4XFBA 3ZYPA 3U0ZA 3OYWB 1NCRB 4SBVA 2WFF2 4CDXA 5F1RA 5HV0A 5LW9A 3J4UH 4CDWB 4E8DA 4FTEA 1HB1A 4CEWC 3KGLA 4FOVA 1QH7A 3A23A 1BHGA 1X9TA 3M3OA 4BJ0A 2TUNA 2JG9A 1TMF1 2NMNA 4ZS2A 1MS9A 2VW1A 2NLRA 3I3DA 1KD7A 1GZWB 3BTYA 2BQPA 4GB31 3LSEA 3KGZA 2WAOA 1NZCA 2A5ZA 1O8SA 2VMFA 2XUEA 3WNPA 1SLBA 4WVMB 2IXCA 1AR82 2E9QA 2Y26A 3MBWA 4PCRA 1FXZA 2BGPA 4XXPA 1LU2A 5FUNA 3CMGA 4BQYA 1VBD3 1TME3 4H7MA 3RJRA 3ME2A 3S6PA 3CNAA 3WHUA 4B4PA 3TEWA 5HXVA 2ENRA 2P2KA 1UYZA 2XGXA 5A7SA 3WLUA 2O8QA 4KWUA 1H8TA 3UETA 1A34A 1W03A 2FQPA 2VECA 1DGRA 2YZ4A 2C6SA 2DFCA 1BMV1 4RHV3 1FNYA 2EIBA 1V6JA 2CAUA 1WA4A 2V09A 1RUJ3 1LHUA 1NA1A 4YG0A 5DDJ3 4YWAA 1NLRA 3GCWA 1XSRA 2C24A 4Q4W3 2CWSA 1HQNA 1EY2A 4LK6A 1UXZA 3O1RA 4OYUA 3AP9A 2EVXA 3OOXA 3UKNA 2VNGA 4SLIA 5F3GA 5FYCA 5JXJA 4CZSA 1RUI1 3HQXA 4XJ8A 2YPDA 3V0BA 1I5PA 1B35C 5DUUA 3JB4C 1S2BA 4FXGB 2ZHMA 4LA2A 4NE9A 4XQDA 3RYKA 1A6CA 4BZ4A 4WBBA 4W4ZA 2WYFA 1WKYA 3C3VA 4S2FA 1Q3EA 4PIZA 4R9DA 1ENQA 3WW1A 5LEJA 5FV3A 2P34A 2HWD2 3ZFFA 3ZYGA 4CDQB 4N43A 1U5XA 4YFZA 4NIDA 5KC5A 1PM4A 3U11A 2BWCA 3GDBA 3MIGA 2P37A 1N1YA 5IK7A 1TE1B 3CEWA 2A6XA 3U4SA 4LITA 3UKTA 4HZFA 4IEOA 4LORA 1N47A 4LULA 4AYUA 3V0AB 2VUDA 3VKMA 3CL1A 4XBLA 3FZ3A 1Y9QA 2WWJA 4LE4A 2UYAA 1JZ6A 2QQNA 4MHRA 4L99A 2QQWA 4MHUA 1KFXL 3LOIA 3WNLA 3ZIXA 3WQ1A 1H1IA 1I5ZA 5JOZA 2R041 4NHXA 3ZFGC 1GZ9A 1NCQB 1UIKA 2PLV2 4W6XA 2OKXA 5K8SA 2XH6A 2JDMA 3I2DA 1FX5A 1LOCA 5EZWA 2BOIA 2XHNA 3TEXA 1Y3TA 4XF1A 5C70A 1IHMA 1QDCA 3AKSA 2B46X 3ALQA 3ECQA 1BKZA 4LXLA 5LA1A 1SEFA 4LHKA 3FMGA 1U0AA 2DVAA 2WN3A 2VZ3A 2YUEA 4FPKA 4NN0A 5FZ7A 4CA9A 1UW8A 4CEWB 1QXRA 1KGYA 2QUOA 2VBPA 4O61A 4OULA 4UBGA 5HV4A 1OD3A 3T08A 2W08A 2CGPA 1G86A 5AC91 5F9TA 2YROA 5C4WA 3W58A 3K3OA 4CP9B 3BI3A 4KMQA 1AHSA 4HXCA 2OX0A 1Y7BA 1OXCA 3NNFA 3W59A 4HN1A 2IXHA 1GNZA 4BM8A 1K3IA 4NROA 5DN2A 2IXKA 2Y6HA 3POWA 4K8FA 1S0GA 3SKJE 1HDKA 1ASJ3 1LOGA 3WOGA 2LW8A 2E26A 2C1FA 4UW4A 1A8MA 4TN7A 3PUIA 4YARA 1QJU2 5DUVA 4Z1VA 5EJZB 5FY7A 3U1XA 2PHRA 5JUVA 3KZ4C 3RG0A 4AI1A 1QJX3 3M3IA 3GF6A 2GN7A 1UOBA 1F4HA 2OIIA 1VIWB 1WCDJ 2HWF3 2VTXJ 3IMMA 4BK4A 3N9OA 1VMFA 2HBUA 5JOXA 1AR93 4OI2A 3URFA 1BVVA 4AGGA 4UBHA 1XNDA 5FBJA 5A3NA 1F9KA 5FZMA 4P9WA 2GC3A 2WNVC 1DQ1A 2Y34A 4QQPA 3OYWA 1NCRA 5GKAC 1Q56A 2D5HA 2NPIA 1TQ5A 4MO3M 4CDWA 5JIUA 3F95A 1RUE1 2HKXA 1J1LA 4IE0A 1HB3A 2P1BA 2VVEA 5FZ6A 1B35B 1GUIA 2W1QA 4XBQA 3GHMA 4IESA 5IFPA 4Q0UA 5EP9A 3VBSC 1A3KA 3QCWA 4LBMA 3RSJA 1GZWA 1ND3C 3J7HA 1FMD2 3KWVA 4QMAA 3NO8A 2VC9A 4NUBA 4DEVA 2JE8A 4OHYA 2V5YA 1K12A 4IE4A 1CAVB 2W3JA 3PIJA 2JDAA 2GDFA 3JBG1 1SFYA 3K75B 1LTEA 2BGOA 1W8UA 3ZR5A 2RJKA 3WF1A 1CN1A 4HBNA 5T50A 5FZIA 2TBVA 1ODMA 2D3SA 3IDAA 4UWDA 3WP3A 3T2QA 2GMPA 5J36A 5JR2A 2RHPA 5KXDA 1HJGA 3WP5A 5FOJB 3VD9A 1GLHA 5I0DA 3DV8A 1IOAA 1JI6A 1PZ7A 3SCGA 1MZ6A 3I2OA 4Q4V1 3ZFGB 4GAZA 3BU0A 1UOJA 4NPMA 2XKPA 1DCSA 4BYYA 1XNAA 4EZHA 1ULGA 4F3JA 1IGOA 4NHYA 2EIDA 4CXYA 2J1RA 3OBAA 4QKFA 4KWJA 2BVBA 4CPBA 1C57A 3POYA 2JB4A 1R1A1 1QQP3 5A70A 3DGTA 3ILFA 4I0WB 4AFAA 1H8VA 3ZN6B 1BCXA 2DV9A 2GMEA 3FBMA 3E6CC 4PJYA 3FHIB 4JCKA 4P08A 3THPA 5E8AA 3AYEA 1TG7A 4N53C 2RS31 2BJSA 3QH6A 4NIAA 3RI8A 4A6SA 2A73B 5A3PA 1DYKA 1RUH3 2GNBA 3LAGA 4P14A 4Z82A 3VD3A 4K6BA 4XDPA 4XYXA 2RM21 4BPZA 1R1ZA 2EA7A 3VHPA 2GH2A 1F5JA 1PX3A 2WS93 4AFMA 4OUSA 5BNNA 1C5HA 4MGZE 4GWIA 3VD5A 3WY6A 3OD0A 1RUC3 4QX1A 2IFWA 3DYMA 1UZYA 1NCQA 3I97A 4XFIA 3B01A 3U37A 3UV9A 2W47A 1RMU3 3BODA 3D0SA 4BXFA 4Y4YA 5F5IA 1C1LA 1QWRA 4AL9A 2R042 1OURA 2JDZA 1DZRA 5E88A 1LOEA 1QOSA 1F35A 3ACFA 1CIYA 1SHWB 2HWE3 1VJ2A 3POFA 4FPLA 4QXKA 4KBZA 2WNVB 4P9IA 3U78A 1U5IA 3JQWA 4AOCA 5FO8B 4LT5A 2A7AA 2R7EB 4CEWA 2K46A 2VPVA 2ZACA 3MIBA 4MLOA 1LU1A 2F4LA 4JDNA 5F5QA 2BOJA 4BQ2A 5IAVA 2Y0OA 5LZ6A 2WZR1 3WDYA 1O3TA 1F31A 3VBSB 1O5UA 1HRI1 2LUWA 3DN7A 3NNGA 3U4XA 2BBVA 4CP9A 1ND3B 2KA3A 4IUGA 4HLTA 4C8DA 2VGDA 2XLAA 3KM5A 4WM7C 1OC1A 2WABA 4XJUA 5F8PA 1OBNA 1D4M1 3R4SA 2KM2A 4XHBA 4CDUC 5EPAA 1IPSA 2QDRA 3NKTA 5GZFA 1AZDA 5LRSA 1D2QA 4OMDA 4XOGA 4UF0A 4ZPIA 5EYYA 2OZ6A 2MNGA 3MPPG 5H9SA 5CB7A 1G9AA 5HPOA 1EAH1 2RR13 3CQOA 3PJQA 4OLLA 1AYM3 3ABZA 4NOTA 1REFA 3SEPA 5BYNA 4YGDA 3N7JA 3J7MA 2R071 4NIGA 2ZJCA 2YDEA 3AMQA 1GZTA 4QPGA 3JCIA 2VZTA 4IGOA 1V6KA 5FP3A 1GNYA 3CZJA 3WG4A 3L2YA 3ZXFA 3I2FA 5F37A 5LA2A 5A7WA 4JRAA 2DVFA 1AYN3 4N7IA 5GLTA 4XFAA 3VBUC 3ZMOA 2QQPA 1HXS3 5IATA 1QU0A 1IQAA 2VCCA 1NKGA 3J8F3 4V2WA 2W1UA 1LAJA 4LBNA 1B35A 1X8EA 3BALA 3BVCA 3B9CA 4L8QA 1W3VA 1O4TA 4LKDA 1O4ZA 5EJ3A 3DXUA 4NPRA 2D6KA 2ZEWA 3K3NA 2DTWA 3ZN4A 1TNRA 2Y60A 4Q0QA 2A6YA 1CAVA 1WCSA 2JDNA 1JYXA 1I1EA 5LWBA 2OT7A 2WA4A 3VDCA 3H7YA 3POIA 1JN2P 1NXMA 3KT7A 3MV11 4N53B 3ZYBA 5IVJA 3J9SA 1ZA4A 1Q43A 1KS5A 3DF0A 3D5OA 2OW4A 2HYXA 4XIOA 3USSA 2XUMA 1IS6A 5FXXA 1MS5A 2VY0A 3QBQA 5JAXA 1BZWA 3ZPYA 1ZBA3 2D3PA 4N7UA 3WR0A 4COVA 1UIJA 3N7KA 2YBKA 3VZOA 1OA2A 2W94A 3N9LA 3ZFGA 4BE3A 5C8WA 4ES9A 1R093 2GU9A 2BW8A 5FP9A 3VKOA 3WF4A 5JMCA 1BEV3 1PHMA 4O9EA 4OUMA 3PVOA 1QMJA 2P4EA 2X29A 4EE2A 2YMZA 5A1LA 5FXWA 3CJIA 5FR3A 3IPVB 5FQ0B 2ZMKA 3HQRA 1QOTA 3FX3A 4D6SA 5A6YA 5FAXA 4BMBA 1R1A2 2PHFA 2WBKA 4TTGA 2ZMLA 3BGAA 3D8CA 3AXEA 1JTZX 1QJY2 3GM8A 4WM7B 4YG6A 1RVF3 2VMIA 4COWA 3S7IA 3M3EA 1W0PA 4CDUB 1SLIA 2BGCA 2H6BA 4IV1C 4XHXA 1OT5A 1RYYA 2XQRA 4XQ4A 2E63A 3TRSB 2QKDA 1EV13 3WSOA 1DBNA 2YPJA 2RM22 1SLCA 4Q8LA 5FDBA 3VZJA 5A3MA 3KHCA 4NIHA 3HN1A 3UESA 3WQ7A 2YC2A 4YZ2A 2OS2A 3O14A 4OI0A 2C4XA 4FOWA 4WVWA 4NAOA 4CCLA 5J37A 1X8MA 3OY8A 4AXOA 5IW0A 4PDWC 2JDUA 5FK7A 3VBUB 1RUNA 1PO23 4A4AA 2IVIB 2G4IA 1PVC3 2RDRA 3AMPA 4TXWA 4PT6A 1PGSA 3NMBA 4CUCA 1YI9A 2VCAA 2W1SA 1RUD2 3JD73 4MGSA 3IDCB 3T0BA 1WZXA 2XPJA 4CE8A 1MVQA 2D6MA 3HOBA 3VBSA 2W52A 2V4VA
chains in the Genus database with same CATH topology
5DAQA 2G1MA 4UWDA 5IATA 5LB6A 3EMRA 3NNLA 3PL0A 5DAPA 3OBZA 3KT4A 3BVCA 5DAWA 4Y5SA 2RDNA 5DAXA 5LBCA 4BQXA 4NHYA 3KT7A 4MHRA 4MHUA 3OUIA 5L9VA 4NHXA 2G19A 5LBFA 3DKQA 4XABA 2OPWA 2HBTA 3W20A 5L9RA 2A1XA 4Y5TA 2Y33A 5IAXA 5M0TA 4XC9A 3GJAA 3HQUA 2RG4A 2FCUA 4XCBA 2RDSA 5HV4A 3ITQA 5LATA 3OUJA 4XCAA 5DAVA 3NNFA 3OUHA 3HQRA 4JZRA 5HV0A 5C5TA 5LASA 3MGUA 4XAAA 4KBZA 2JIJA 2RDQA 5LA9A 4NHKA 4IW3A 4J25A 5L9BA 2HBUA 5IAVA 4BQYA 5C5UA 5EQUA 3GJBA 5ERLA 4NMIA 3W21A 2Y34A 5LBEA 2V4AA 4XACA 4NHMA 5LBBA 5EPAA 4BQWA 4NAOA 3KT1A 2FCVA 4ZPIA 5EP9A 4ZONA 2FCTA 2RDRA 3NNMA 3NNJA 2JIGA 3GZEA 4NHLA 5A3UA 4Q5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAQ A;  2G1M A;  4UWD A;  5IAT A;  5LB6 A;  3EMR A;  3NNL A;  3PL0 A;  5DAP A;  3OBZ A;  3KT4 A;  3BVC A;  5DAW A;  4Y5S A;  2RDN A;  5DAX A;  5LBC A;  4BQX A;  4NHY A;  3KT7 A;  4MHR A;  4MHU A;  3OUI A;  5L9V A;  4NHX A;  2G19 A;  5LBF A;  3DKQ A;  4XAB A;  2OPW A;  2HBT A;  3W20 A;  5L9R A;  2A1X A;  4Y5T A;  2Y33 A;  5IAX A;  5M0T A;  4XC9 A;  3GJA A;  3HQU A;  2RG4 A;  2FCU A;  4XCB A;  2RDS A;  5HV4 A;  3ITQ A;  5LAT A;  3OUJ A;  4XCA A;  5DAV A;  3NNF A;  3OUH A;  3HQR A;  4JZR A;  5HV0 A;  5C5T A;  5LAS A;  3MGU A;  4XAA A;  4KBZ A;  2JIJ A;  2RDQ A;  5LA9 A;  4NHK A;  4IW3 A;  4J25 A;  5L9B A;  2HBU A;  5IAV A;  4BQY A;  5C5U A;  5EQU A;  3GJB A;  5ERL A;  4NMI A;  3W21 A;  2Y34 A;  5LBE A;  2V4A A;  4XAC A;  4NHM A;  5LBB A;  5EPA A;  4BQW A;  4NAO A;  3KT1 A;  2FCV A;  4ZPI A;  5EP9 A;  4ZON A;  2FCT A;  2RDR A;  3NNM A;  3NNJ A;  2JIG A;  3GZE A;  4NHL A;  5A3U A;  4Q5O A; 
#chains in the Genus database with same CATH topology
 1HLC A;  3SIT A;  5DZG A;  4J6G A;  1HB4 A;  2H6C A;  4BQ3 A;  1Q8S A;  2BNM A;  1XNC A;  2K2S A;  3MHZ A;  2BP6 A;  3NNL A;  3RFR A;  5FWJ A;  5FY5 A;  3RDI A;  3VL8 A;  1I6X A;  2XHK A;  3AC0 A;  3KT4 A;  3LDB A;  4CCJ A;  3ZPO A;  4H7L A;  4GXL A;  4HKW A;  4LKF A;  4Q4Y 1;  5F3I A;  4QDS A;  3POG A;  1LGB A;  2Y6K A;  4DXT A;  4BME A;  1NX9 A;  1V6L A;  1W0N A;  4QD2 A;  1EAH 2;  1OMI A;  2WRA A;  4BQ4 A;  3ZMN A;  3BCW A;  4R9A A;  4EN8 B;  1SDW A;  2J1A A;  3T1M A;  4CXW A;  2GZW A;  2GH8 A;  1QXP A;  2WUH A;  4DRV A;  3OUI A;  3O0W A;  3ZSL A;  1ZZ9 A;  2VQ0 A;  4Y5Z 0;  3PTY A;  3MLK A;  3QAC A;  3MW3 A;  3NST A;  4B4R A;  4XVH A;  5K9Y A;  4HOO A;  4JKL A;  1EYB A;  4YW4 A;  3VZK A;  2H0B A;  2J22 A;  2DCZ A;  4IEY A;  1AR6 2;  2VMH A;  1AF9 A;  1VMJ A;  5FRA A;  5JXI A;  4LEJ A;  2P6H A;  4QPW A;  4DXZ A;  1NY7 1;  4M4R A;  3AJZ A;  2WZP P;  4LQR A;  4RR3 A;  2KR2 A;  5M0T A;  2VMC A;  1MS8 A;  3LA3 A;  5F2W A;  1WBF A;  4QQ2 A;  4RFR B;  2A3Y A;  2ZX3 A;  2CHH A;  5FLH A;  3P3N A;  3VKF C;  5FLJ A;  1HN1 A;  3V65 A;  1O8P A;  1W6O B;  4HAN A;  3MLL A;  1AXY A;  2RS1 3;  3UNP A;  2CWM A;  2JIC A;  1YJL A;  1SLT A;  1NE6 A;  1MEC 3;  1QNW A;  1RHI 1;  1YFX A;  2ZX1 A;  1PIV 3;  3B5L B;  4IV1 B;  1FOD 2;  4XBN A;  4CCC A;  3VKL A;  1CJP A;  1F15 A;  4IE5 A;  4CU6 A;  4UYB A;  2HLE A;  2FMY A;  2D7F A;  1GR3 A;  5FMO L;  2ZBJ A;  1AR7 3;  1VBC 3;  2CAV A;  2DBI A;  1OQ1 A;  1C8M 3;  1GQG A;  1AR8 1;  4RGG A;  4ATE A;  3ES1 A;  2Y64 A;  1CPM A;  5D1I A;  4AGR A;  1LHN A;  2Q1Z B;  5H9Q A;  4QX5 A;  2XKO A;  2DCY A;  5GLU A;  2ILM A;  4H3W A;  4PDW B;  2DU1 A;  1CON A;  1S4C A;  5CKM A;  2VW2 A;  5D8A C;  3O0X A;  3THD A;  1YHF A;  2XXZ A;  3M8L A;  4XUO A;  3CF6 E;  2OUH A;  5IVY A;  1H4G A;  4MET A;  3NVC A;  1K5M C;  2YG0 A;  2VAU A;  2B9U A;  4OZO A;  1PK6 A;  3VDD A;  4IET A;  3C7E A;  2Z5W A;  1ONA A;  5LBB A;  2G9F A;  1XYP A;  1JU3 A;  1RIT A;  1W8Z A;  4B4Q A;  4COY A;  1FAY A;  4IGP A;  5FYI A;  5BXX A;  5FY4 A;  4DIN B;  3VB9 A;  2CL2 A;  2TNF A;  1L7R A;  2AEZ A;  3IMN A;  2VZO A;  4YZ4 A;  1ENS A;  1VR3 A;  3TBD A;  3PVE A;  2PAM A;  4CPB D;  4WZF A;  3D0J A;  4CDU A;  5I0S A;  3LIG A;  1RUF 2;  5CFD C;  2UYB A;  3Q8F A;  1S0I A;  2DVD A;  1QJE A;  4UI9 L;  5FXV A;  1ST8 A;  4PQQ A;  5TSW A;  1QJF A;  2VG9 A;  1OQD A;  2OXB A;  1UMH A;  1OUS A;  5FZE A;  3N9N A;  2BFU L;  2MEV 3;  2VZQ A;  3I4I A;  4AVS A;  1LNS A;  1VRH 2;  1V6N A;  4DB5 A;  2WFF 3;  1SCR A;  1DG6 A;  1W2O A;  1ZA7 A;  2J7M A;  3GZA A;  3VBU A;  5DMY A;  2WAA A;  2RDN A;  2AUY A;  4ZY9 A;  4FVV A;  1T2X A;  4UFH A;  2BNN A;  1AJK A;  2QDN A;  4LIU A;  1O3R A;  4LTA A;  2JDY A;  2YGL A;  3AKR A;  2X53 S;  3O1T A;  2JG8 C;  1YO8 A;  3IIA A;  5FMD A;  5BPX A;  4EV0 A;  4FOY A;  3OBT A;  2YU1 A;  1ENR A;  1PO1 3;  4HVO A;  1CAW A;  4QX3 A;  3AP7 A;  1RUG 1;  5L9V A;  2DU0 A;  1CVN A;  3KF3 A;  1YFW A;  5FJH A;  2RMU 2;  3AL6 A;  4AI3 A;  1PMH X;  4GJY A;  4FSJ A;  1TNF A;  1MR5 A;  2AR6 A;  2I74 A;  1PMI A;  3W20 A;  1S2E A;  1FNZ A;  5HI0 A;  5F3E A;  4U2A A;  4Y5T A;  3KVA A;  4LO4 B;  4D3W A;  4DZG A;  4MX3 A;  5J98 B;  1CX1 A;  5LRR A;  2DVB A;  4C0H A;  3E1F 1;  2YBS A;  3H50 A;  4IDZ A;  3POS A;  5AFE A;  3T2P A;  3FHQ A;  2Z42 A;  3IDB B;  4Y1Y A;  3LSD A;  4NVP A;  4EN9 B;  5JZG B;  1ZYB A;  3GBG A;  4LBQ D;  1BBT 2;  1QJU 1;  4JHT A;  5C5T A;  1FPN 3;  4YYO A;  1JUH A;  3KMH A;  4A44 A;  3FUO A;  5D8A B;  3NL1 A;  4R52 A;  4XFH A;  2VUJ A;  1XBF A;  2VE1 A;  2XLG A;  3OEA A;  2LTN A;  3DPR A;  1K5M B;  4JDO A;  4BIF A;  1O4Y A;  2HYK A;  2ZX2 A;  3B93 A;  2FHR A;  2HWD 3;  5T5O A;  3PTR B;  3HN3 A;  3WP6 A;  4NO4 A;  1XE8 A;  3KCY A;  4FQZ A;  1SPP B;  2ZGO A;  4M01 A;  4JGZ C;  2ZGL A;  4UFJ A;  3FN9 A;  1FT9 A;  4LO5 B;  2GAL A;  3GBF A;  1C3H A;  1RIN A;  4DEQ A;  1RGS A;  1PM7 A;  1ZRC A;  1W6O A;  2VBD A;  3N4M A;  3ZN5 A;  1DQ5 A;  3KV4 A;  1APN A;  3VBR C;  3BIW E;  3R4U A;  4AK3 A;  4D8M A;  5CFD B;  5GAL A;  2PHX A;  4CSW A;  2NYY A;  1OA3 A;  1U5Y A;  3ZFE A;  4B7E A;  2Y6F A;  4XQW A;  1ZZ8 A;  2WSU A;  1RHI 2;  5ACA 1;  2GP5 A;  1D2S A;  1FMD 1;  4RFT 0;  2PLV 3;  5JOW A;  1I3H A;  3H3L A;  4QB1 A;  5C3R A;  3IB3 A;  1UY3 A;  2ZGT A;  2R1D A;  4XMI A;  4RGK A;  2BDR A;  5C9A C;  1MPX A;  4IGQ A;  2ZA9 A;  3WW3 A;  3FUQ A;  3RGB A;  3EB7 A;  4MGY E;  2JE9 A;  1VP6 A;  3W9A A;  5T5L A;  3GZE A;  1S0E A;  4K1Y A;  5DG2 A;  3WD5 A;  3NAP C;  3MID A;  1POV 0;  2RS5 3;  3MUY 1;  1BXH A;  1XSQ A;  2AYH A;  2EF6 A;  4JC1 A;  3C7F A;  5DAQ A;  3PU3 A;  4NWV A;  3UGH A;  2BBA A;  5HCH A;  2JKX A;  3QD6 A;  5CEH A;  4HVR A;  1XOY A;  3WNM A;  3M3Q A;  3ROU A;  4CUA A;  1ULC A;  4M3C E;  1MAC A;  3FWE A;  3PL0 A;  1RTV A;  4XJZ A;  5T3N A;  4GKX A;  2ZKL A;  2JG8 B;  3I2K A;  2DUR A;  4MSV A;  2VVD A;  3ON7 A;  4I2O A;  1W6N B;  5DAW A;  2C9K A;  2QQM A;  3PJY A;  3AYA A;  2P6C A;  2D97 A;  1X82 A;  4UFI A;  4EQV A;  3O1M A;  5I93 A;  2Y38 A;  1REE A;  3VUO A;  3MZH A;  4V2V A;  4M00 A;  1YQ8 A;  2X09 A;  4B8E A;  4ZXE A;  3LPF A;  5H9P A;  1BK0 A;  1XYN A;  1PVX A;  1HRV 3;  2GNM A;  3ATG A;  4JDM A;  2VVF A;  4M3C B;  3RZG A;  4OFG A;  3RPQ A;  3ZSM A;  2R06 3;  4IXL A;  4X6R B;  1DQ6 A;  1VBB 2;  3AYC A;  3K4Z A;  1JH5 A;  5LEK A;  2HWC 2;  1SFN A;  1UF2 C;  5A3L A;  4FFH A;  2E51 A;  5L73 A;  4B1L A;  4QXB A;  2WWU A;  3MIH A;  5KHH A;  3OGJ A;  5APA A;  5DUX A;  1CGP A;  1ODN A;  1SBE A;  4UOJ A;  1WBL A;  2W92 A;  4YVS C;  2AC1 A;  1UL9 A;  1GV9 A;  2RJL A;  4FI9 A;  1YRZ A;  4ZS3 A;  4OI1 A;  4CCD A;  5KXB A;  2BRT A;  1WW7 A;  5J09 A;  3BTA A;  1GOF A;  3MV0 1;  1AL2 1;  4XMA A;  1NOV A;  1TMF 3;  1W6M B;  3VZN A;  3A0K A;  1XE7 A;  3OGR A;  4M3C F;  4QAW A;  4GB3 3;  3KV5 A;  2IC1 A;  2ZKN A;  2P3J A;  3WDW A;  3KSC A;  4AI2 A;  1V6O A;  1SFP A;  1D4V B;  1URX A;  2R1B A;  4JGZ B;  1QGL A;  4AVT A;  2W95 A;  5T55 A;  1OA4 A;  1S1A A;  2IUW A;  4QQH A;  1RUG 2;  5FYH A;  2WJS A;  1V6M A;  3ZIW A;  3S7E A;  1LEC A;  2HWB 2;  3B94 A;  1OUX A;  3J7N A;  5IK8 A;  3VBR B;  3AYD A;  1COV 2;  3BYW A;  5FY8 A;  4LHN A;  3TYJ A;  1GKB A;  2B42 B;  5FYS A;  1JYN A;  4Z07 A;  3A7Q A;  1W2T A;  2CDP A;  1CAX A;  5A33 B;  2QQK A;  4AHW A;  5C9A B;  4NMI A;  4JTN A;  1C4R A;  3ZYI B;  1POV 1;  4QX2 A;  2ZGQ A;  3NV4 A;  3UJQ A;  1JYW A;  1KDM A;  3SEE A;  3NAP B;  4QWN A;  2Q8D A;  1JYT A;  3THC A;  1RUI 3;  1LED A;  3AJY A;  2WQZ C;  4GA9 A;  4AGV A;  2FCV A;  5FKB A;  5A3W A;  4J1W A;  4BDV B;  1JZ3 A;  1J59 A;  2WYS A;  5E1R A;  2QVS B;  1AXK A;  2V5D A;  3PU8 A;  4G9S B;  1RXF A;  2WSV A;  4JX0 A;  2QQO A;  4FCA A;  1VBD 2;  4XIL A;  2MPF A;  1TME 2;  1P8J A;  4CP1 A;  1SPP A;  1ZRI A;  3GAL A;  2W0X A;  2O8O A;  2XBO 1;  3I2H A;  1S0C A;  3EBR A;  3OPZ A;  1UXX X;  5BNP C;  1LHV A;  4TWT A;  3NV3 A;  1ZBE 1;  3ACG A;  3AKQ A;  4XUT A;  4RHV 2;  5I0U A;  5KHK A;  1S0B A;  3ZXL A;  5A32 B;  4Q26 A;  4OVE A;  4N8M A;  3T09 A;  4Q4W 2;  4K7J A;  1EUT A;  2QQJ A;  4IEZ A;  4I30 A;  4LBQ B;  2F6B A;  3TN9 1;  3DL3 A;  1CZS A;  3H0O A;  4YW3 A;  4DO0 A;  5IYY A;  3VBO C;  1SZB A;  1IS4 A;  5FZB A;  1IG0 A;  3SH3 A;  5FZ4 A;  1ZZC A;  2R04 3;  2VL4 A;  5ACA 2;  3NJX A;  1CR7 A;  2PQQ A;  4QKD A;  4ASM B;  2W39 A;  5D21 A;  3R4D B;  5FZ9 A;  4WVM A;  1VB4 A;  3SXW A;  4A2U A;  4JQT A;  5JDB A;  3DCQ A;  1HQW A;  1KQR A;  1KXG A;  2CSG A;  2ZHL A;  1ZZ6 A;  2P3Y A;  4MGK E;  1GWL A;  4JRL A;  4LR4 A;  4YVS B;  4XDQ A;  4YM0 A;  5FY1 A;  4KG0 A;  2BUK A;  4KBB A;  3MDP A;  5EWS A;  3N9Q A;  5LY2 A;  5JLV A;  3VLB B;  1UN1 A;  3ZSJ A;  4H14 A;  1U5Z A;  5AC9 3;  3KCX A;  2VO5 A;  4FPC A;  1W6N A;  1SDD B;  5CFC C;  4OHZ A;  5FPZ A;  3VZM A;  2A6Z A;  3UGG A;  1OLQ A;  5JI9 A;  1W8W A;  5F32 A;  4BK5 A;  1V0A A;  2VOX A;  2VOT A;  1DHK B;  1N1S A;  1AX2 A;  3HQU A;  5JPM B;  3GXU A;  5HCA A;  1TZO A;  4HT1 T;  3ZOI A;  4JAA A;  4NRP A;  4C90 A;  1V70 A;  3OUJ A;  4GMP 0;  4YW6 A;  1ENX A;  1GWM A;  1UZV A;  1IS5 A;  2C9A A;  1CD3 G;  2QBX A;  3TEY A;  4Q29 A;  3H3Z A;  3VBF C;  3AM2 A;  4JZR A;  3ZM8 A;  1XPW A;  1OF4 A;  4OZX A;  3BTZ A;  1J1T A;  1OSG A;  1QJY 1;  1LEN A;  5F3C A;  5CG9 A;  1D0H A;  1MQT C;  4XJW A;  5AVP A;  3O1U A;  1UD1 A;  1ZRF A;  5FYU A;  2V72 A;  4CDQ A;  2JE7 A;  3B69 A;  3SCH A;  3ES4 A;  3LFI A;  3I3M A;  1QY4 A;  2B9V A;  2JIJ A;  4JKK A;  4XF9 A;  3AX4 A;  2B5H A;  3T4V A;  1VBA 1;  1BYH A;  1OVS A;  1RUE 3;  2AZ5 A;  4J25 A;  1C5I A;  1D7P M;  2VUL A;  4NHK A;  3ZXK A;  1A8D A;  4Q4X 1;  3V0A A;  4LOT A;  1WGP A;  3APB A;  3BU7 A;  5EFU A;  1JXN A;  4CTE A;  5K7P A;  5JI7 A;  3PHM A;  4QPI C;  1US2 A;  3KLS A;  3VZL A;  4AVA A;  1AL2 2;  2V4A A;  4XAC A;  2D44 A;  5EJ1 B;  1TEI A;  4JGZ A;  3SQO A;  3PVN A;  5KWR A;  2VM9 A;  3JBG 3;  1QJX 2;  2AAC A;  4QPY A;  4CYD A;  5BNP B;  5LCW L;  3PDQ A;  1YQ5 A;  5FRE A;  4XUR A;  3Q8E A;  2HWF 2;  1G9D A;  3H1Y A;  4ZU7 A;  4ZON A;  2DWR A;  3AZY A;  1RUD 1;  3VBR A;  4P9J A;  4MGQ A;  4YRD A;  3LEG A;  4AEK A;  1ZRE A;  5F5A A;  1W2U A;  4CUB A;  4S2D A;  5HCB A;  3MIE A;  5EHD A;  3FLP A;  1GYK A;  3SNM A;  3VBO B;  4MXW B;  5FZD A;  1GP5 A;  5FY0 A;  3JQX A;  4HG6 B;  1ACC A;  5C9A A;  4Q4V 3;  4AQS A;  1JOB A;  2W68 A;  2UWC A;  1NYW A;  4KGG A;  3UYJ A;  4BCU A;  2WWS A;  5BNO C;  1O6U A;  4AFC A;  5JXH A;  1W6Q B;  3ZX7 A;  3C7H A;  3DXT A;  3NAP A;  4FOQ A;  3O1P A;  1BJQ A;  1UY0 A;  2W1W A;  4BIS A;  1UX7 A;  3OBZ A;  4P5Y A;  3WG3 A;  3WVJ A;  5K0U C;  2GP3 A;  3PLQ A;  1LOB A;  4MGT A;  1JOD A;  1R1A 3;  4LNV A;  2L9L A;  5DPN A;  3MF9 A;  4AVV A;  2OQ7 A;  5F6L B;  1ND2 C;  2EXI A;  2I2S A;  3PVB B;  3WG2 A;  4AR2 A;  4TSV A;  3J26 N;  3E6B A;  3RYR A;  3PIG A;  4CVU A;  3AB0 A;  5FZ3 A;  2J1U A;  5CFC B;  3M4F A;  2OQ6 A;  2RS3 3;  4O9G A;  5C3Q A;  2XBO 2;  4XTM A;  4LIV A;  1FV2 A;  1DZQ A;  3LEI A;  5IK5 A;  2RM2 3;  3WNN A;  3VV1 A;  2J1S A;  3E5X A;  1ZBE 2;  1AR6 1;  2XL7 A;  2JEN A;  3DKQ A;  3NKG A;  4GMP 1;  5LBF A;  4AVC A;  4CCN A;  3VD7 A;  3RZL A;  5IJR A;  5C3S A;  4DUX A;  1MVE A;  2YC4 A;  3M7A A;  4EN0 A;  5FYB A;  2QQL A;  5FTT C;  5B4N A;  1IPJ A;  3VBF B;  2D3R A;  3TN9 2;  4Q8K A;  5CKQ A;  2E32 A;  2WLQ A;  4W65 A;  4XFG A;  4QGL A;  3U10 A;  1MQT B;  2ORZ A;  2VXR A;  2JEC A;  4Q27 A;  2E53 A;  5FO7 B;  1UZW A;  3SH5 A;  1OLM E;  3M3C A;  2VZP A;  3EYP A;  3HT1 A;  1RVF 1;  1FOD 1;  1K5J A;  4BLJ A;  4Q0P A;  1Z0H A;  1F2N A;  4COZ A;  1H2N A;  4DUV A;  4QU1 A;  1VAL A;  3AZX A;  1LKN A;  3PNA A;  2WZR 3;  3FFQ A;  4UFK A;  2XWJ B;  4QQL A;  3Q8B A;  5JSR A;  1HRI 3;  3ACH A;  2OA2 A;  2ARX A;  4QPI B;  4XW3 A;  3V56 A;  5C8C C;  1ZNP A;  1H2K A;  4XUQ A;  5GM0 A;  3ZYH A;  3D4K A;  3FL7 A;  2Y6G A;  1CWP A;  1D4M 3;  5FZK A;  4ZKT B;  1RUC 2;  5FZC A;  3AVR A;  4WM8 C;  5HCF A;  4ARY A;  1L3J A;  4URA A;  3DKW A;  1HV1 A;  1EAH 3;  1OHF A;  1RMU 2;  3CU7 A;  4LE3 A;  5F6K A;  2K0G A;  5I0R A;  1F8V A;  1H6Y A;  2R07 3;  4KGQ A;  3A22 A;  3I3Q A;  5SV5 A;  3M70 A;  1RL3 A;  2R0F A;  2W87 A;  1W90 A;  2XL9 A;  2Q30 A;  3CLP A;  3MFC A;  3ZN6 A;  5KXE A;  3KT1 A;  2EIE A;  4UFM A;  1MS3 A;  1WCK A;  2VR4 A;  1W8T A;  2GC2 A;  3U07 A;  4AFD A;  4XF0 A;  5FPU A;  3USU B;  5BNO B;  1RUF 1;  2IXL A;  5KR7 A;  3GZT B;  4EZ4 A;  5L7O C;  2IZW A;  2JD9 A;  3MIC A;  5B4X A;  2ZS6 B;  5K0U B;  1QJZ A;  2WDB A;  4K9S A;  4W6W A;  2JDK A;  1WW4 A;  3N35 A;  4OHV A;  1SQ4 A;  1ZVF A;  5GZC A;  4RL7 A;  1H2M A;  2VW0 A;  1AUY A;  1VBA 2;  3HPN A;  4KU8 A;  2D6L X;  1DGW X;  2XWB B;  1KJR A;  1ND2 B;  4Q4X 2;  1VRH 1;  2E7A A;  2ZAA A;  4FP3 A;  5ABJ C;  1I9R A;  4A3X A;  3T2O A;  3EO6 A;  1N1T A;  2RR1 2;  3ORJ A;  4AFB A;  3N7M A;  4R9C A;  1W6P B;  5BNP A;  4U36 A;  1N1V A;  2VU9 A;  2VCM A;  4ASK A;  3I3B A;  5LK5 A;  4JGY C;  4AF9 A;  5JWP A;  4A7Y A;  4MUV A;  2PHD A;  4YW1 A;  3SKV A;  4ZXK A;  1WW5 A;  3CKH A;  2WNV A;  2SLI A;  2RV9 A;  3LWC A;  1L7L A;  3DEM A;  5H9R A;  2Q1F A;  5FZ8 A;  3LIH A;  1AYN 2;  4GZ9 A;  3FBY A;  2P17 A;  4XIK A;  1W28 A;  5FP4 A;  4HKO A;  1IG3 A;  4QHO A;  2QFE A;  4B3N A;  1ZZ7 A;  3VBO A;  1YQC A;  3GNE A;  3PMS A;  2D5F A;  3WNK A;  4AHY A;  4IEP A;  2JG9 C;  5FZO B;  1UAI A;  3J8F 2;  2C26 A;  4LUK A;  2UWA A;  2RMU 1;  1ND3 A;  3CHX A;  4QB2 A;  2YBP A;  3VGI A;  5DAB A;  2GNT A;  5BNQ A;  4GWJ A;  4YG3 A;  2NN8 A;  4PF5 A;  4FFI A;  1SLL A;  1UY4 A;  2DBN A;  1ALY A;  1NUK A;  3KS7 A;  1GP6 A;  3MUZ 1;  2WQ4 A;  3NJY A;  3AK0 A;  5IVE A;  1Q8Q A;  3NV2 A;  4QU2 A;  3I49 A;  4UW6 A;  3M2M A;  3A21 A;  1EPZ A;  2ATF A;  2BNO A;  1LCL A;  1JZ2 A;  3L2H A;  4WVV A;  3BOP A;  1MZ5 A;  1VBE 1;  3HAG A;  2EXJ A;  4YVW C;  3RWN A;  3N7L A;  3MFA A;  4FAG A;  1BBT 1;  5C8C B;  3O7O A;  1DDL A;  1V9U 1;  3BKZ A;  2NMO A;  4FTS A;  3ZVX A;  2PHU A;  5C3P A;  2ZAH A;  1JZ5 A;  2DFB A;  4WM8 B;  1JOJ A;  1UOG A;  1SBF A;  1UU6 A;  4LKS A;  2E7T A;  1R09 2;  2VQU A;  4PHZ A;  1B09 A;  4L92 A;  5JSP A;  3RJ2 X;  2XJV A;  3AP5 A;  4QX7 A;  5FUP A;  1WLD A;  4IQP A;  1BEV 2;  3AVS A;  2YFU A;  4D6Q A;  3VBF A;  1V6I A;  1KFU L;  3AKP A;  1VPH A;  3S5A A;  1J3Q A;  5JIA A;  5EYX A;  4C0B A;  1JYV A;  4FPO B;  1R08 1;  4HVQ A;  5IVV A;  2Q1M A;  4E27 A;  4FBF A;  4UFL A;  1ULE A;  2XB6 C;  2AGS A;  2Y6L A;  5CAD A;  4XUP A;  4N53 A;  1C28 A;  1WCQ A;  3GZU C;  3OGS A;  5JR7 B;  5FPB A;  4LK7 A;  5BUV A;  1OH4 A;  2DVG A;  1Y4W A;  2YXS A;  3I54 A;  3MF6 A;  3EQE A;  5L7O B;  1QDO A;  1QF3 A;  3EJK A;  5FY9 A;  2JXA A;  1RVF 2;  4RSU A;  5FMC A;  4BQW A;  2D98 A;  1FAT A;  1PGW 2;  1GNH A;  1UU4 A;  1RED A;  2B7Y A;  2W46 A;  3I59 B;  3PUR A;  3H8X A;  1HN0 A;  1Q8V A;  4QXH A;  4Y3O A;  3UL2 A;  5LA0 A;  4QPI A;  4NRQ A;  4HSL A;  3VN4 A;  2MHF A;  1JBC A;  5ABJ B;  1EV1 2;  5A7P A;  1LB2 A;  3ZXD A;  5JZG C;  4Y1Z A;  3LF7 A;  4R9B A;  2BWA A;  2HJI A;  4JGY B;  1VB2 A;  4AHZ A;  2WKK A;  5KHI A;  4Q4Y 3;  4IE7 A;  2UUR A;  2D40 A;  2C5D A;  2G9Z A;  3HNY M;  3VHN A;  3IPV A;  2E31 A;  1JHN A;  1H9P A;  4KI5 M;  4MAD A;  2ZHK A;  5FQ0 A;  4Y33 A;  2DDU A;  3RZZ A;  4EWE A;  4GD4 A;  1OVP A;  1PO2 2;  4ATF A;  3LEM A;  4PBO A;  5KHJ A;  1Z7S 3;  2ORX A;  1PVC 2;  5AVA A;  4LHS A;  2ZX4 A;  1Y43 B;  5CIS A;  2JG9 B;  1PNG A;  5DUW A;  3JD7 2;  4CU9 A;  1G6N A;  1RJ8 A;  2BER A;  4RQP C;  5FPA A;  3USU A;  4WM7 A;  5BNO A;  1Q5O A;  1CES A;  3S0M A;  4BHP A;  3MI8 A;  4QDQ A;  5FLI A;  4LJH A;  4WVZ A;  2ES3 A;  5CZK A;  5K0U A;  2E6V A;  2JJ6 A;  2VXJ A;  3J7L A;  1DIW A;  2W91 A;  1VBB 1;  1JZ4 A;  3RZK A;  4QDR A;  1OH3 A;  2HWC 1;  2GAU A;  3RS6 A;  3AXD A;  2UY9 A;  3MPB A;  1ND2 A;  3WDV A;  1QHD A;  2ZX0 A;  3K4D A;  3IM0 A;  1GAN A;  5GZE A;  5ISL A;  5A6Z A;  5IT6 A;  4A6O A;  5IHR A;  1WLW A;  2IFR A;  4C1X A;  1DGL A;  4YVW B;  5FUI A;  5FZH A;  3HT2 A;  1WMX A;  3ETP A;  3AMM A;  3IZO A;  3KD4 A;  3ZYJ B;  2EXH A;  4GWN A;  3WUD A;  4FO9 A;  1H1A A;  4I02 A;  1RHI 3;  2LRO A;  3U14 A;  4D7T A;  4QM8 A;  2VZU A;  3GYD A;  4AI9 A;  2TEP A;  3WIN E;  1IZ3 A;  4BB3 A;  1VAK A;  2W2I A;  4FFF A;  4YGB A;  1D0G A;  4AI8 A;  4HFS A;  3C7G A;  1OOP C;  3FE5 A;  4GWM A;  4QT6 A;  3V0B B;  2DUQ A;  5A7O A;  1NQD A;  2ADD A;  4CP2 A;  5FZO A;  1AR8 3;  5F7U A;  5J7M A;  3HWJ A;  4UXA A;  1YFU A;  3IBM A;  5CKN A;  1IKQ A;  4ORF A;  4ZU4 A;  1YYN A;  2HWB 1;  1XNB A;  3NV1 A;  4P9Y A;  4ZZ5 A;  3INA A;  1QH6 A;  2DUP A;  3O0V A;  1UKG A;  1COV 1;  5A6X A;  3AMN A;  3KHB A;  1YJK A;  5AFB A;  2WO7 A;  2BTV C;  5KXC A;  1JU4 A;  4PLN A;  2JD4 A;  1H4H A;  1G9B A;  3NW4 A;  3ZKY A;  3K46 A;  4Q0S A;  5LA9 A;  3ST7 A;  4MYE A;  4BIO A;  3MYX A;  4PIX A;  4O65 A;  2IXJ A;  4IW3 A;  4PQ9 A;  1AL0 G;  4MZU A;  1EP0 A;  3P3P A;  3EXU A;  2SBA A;  3JXS A;  2ZOE B;  2ZAB A;  1IPK A;  3RI9 A;  2J1V A;  4E4S A;  1QIQ A;  2BYV E;  4GIQ A;  3RMX A;  3BB6 A;  1VBE 2;  3WF3 A;  1AR7 2;  1VBC 2;  1RXG A;  3IWZ A;  4WM8 A;  1DYP A;  1WLC A;  4Y4R A;  1C8M 2;  2ADE A;  4F8A A;  1V9U 2;  3TNQ A;  4F83 A;  1ZRD A;  1VRB A;  4JTO A;  4LBK A;  1Q8P A;  4Z92 B;  3NRU A;  1FYU A;  1XU1 A;  1DZT A;  1VBD 1;  2QQU A;  1TME 1;  1UZ0 A;  1Q8O A;  2ET7 A;  3AP4 A;  3LB9 A;  3N9M A;  2FCT A;  3OJB A;  5FPL A;  1H9W A;  1DQ0 A;  1W9T A;  1MZF A;  3LD8 A;  1VLN A;  2XG3 A;  5DZE A;  2FDG A;  5FCC A;  2JIG A;  4DY5 A;  2XVG A;  2ZEY A;  4B7K A;  2Q0A A;  1X50 A;  2WFP A;  4RHV 1;  1NAE A;  4ISQ A;  1HV0 A;  4Q5O A;  4D69 A;  5K4L A;  3WEZ A;  3CJX A;  4FP2 A;  1JS9 A;  1RUJ 1;  1TVG A;  1WD3 A;  4RQP B;  3PUS A;  3VD4 A;  5DDJ 1;  1R08 2;  2OUJ A;  1UYP A;  5CIR A;  3AP6 A;  2G1M A;  4Q4W 1;  5L7O A;  4C1W A;  5JMO A;  4KNC A;  4Q2F A;  3TAY A;  4CXX A;  4JKM A;  5DAP A;  4IV1 A;  2D43 A;  4Y26 A;  2G9G A;  3B00 A;  4URT A;  3I59 A;  3LA7 A;  3S30 A;  3WDT A;  5C71 A;  4FPJ A;  4MVT A;  5BNN C;  5IVF A;  3RRD A;  4LHL A;  3ZKU A;  4XPV A;  3HBZ A;  4GH4 C;  1O3S A;  5DAX A;  1W04 A;  4LA3 A;  3E97 A;  1RUG 3;  4R8H A;  1M4W A;  2I45 A;  1RC6 A;  1YWK A;  4AQ6 A;  2KD7 A;  4BQX A;  1E5I A;  5L36 A;  1NE4 A;  2PAK A;  5FBZ A;  5C3O A;  1Y9G A;  1RIR A;  3P6B A;  4LLF A;  3ASI A;  3MW4 A;  1OLR A;  4PDW A;  1UY2 A;  1YIF A;  3I3E A;  2XJU A;  4XF4 A;  4CUG A;  1JW6 A;  4G4F A;  5FYV A;  1QKQ A;  4YLZ A;  1XC6 A;  3K51 A;  4A7K A;  4BWO A;  2VQT A;  4E8C A;  2VOW A;  1OOP B;  1XNT A;  4TZD A;  4L11 A;  2OPW A;  2PXJ A;  4QHB A;  3E5Q A;  3HEI A;  5FZA A;  1VMH A;  3LDR A;  1OKQ A;  2Q8C A;  1XQN A;  5L9R A;  3ETQ A;  1A78 A;  2R49 A;  1EUU A;  5FP7 A;  1QJU 3;  3B02 A;  3FC0 A;  1PO1 2;  5FJK A;  1SCS A;  4BLI A;  5FIX A;  3LFM A;  1GQH A;  5FYY A;  2GC1 A;  2BPA 2;  3ITQ A;  1Z78 A;  2WNU C;  2VZV A;  4DS0 A;  5L19 A;  1W2N A;  1VAM A;  4HET A;  4NWW A;  2GSY A;  3CBN A;  3ZXA C;  1HB2 A;  1K45 A;  4YW7 A;  2FDK A;  1ZZB A;  1UYX A;  3I2G A;  5I91 A;  3LEK A;  4J1X A;  5CG8 A;  1W8O A;  2QZ2 A;  1WD4 A;  4QPG C;  1X33 A;  2A70 A;  5LAS A;  1DFQ A;  3MGU A;  2OPK A;  1XYO A;  2J42 A;  4YVW A;  5ANQ A;  3NWK A;  4XAA A;  4ERO A;  1PGL 1;  4K40 A;  1AX1 A;  4MV2 A;  3C7O A;  3K77 A;  5T52 A;  3KCC A;  2A3W A;  3BPS A;  4DQA A;  4ET7 A;  5J96 B;  2PHW A;  5A80 A;  5CNA A;  1R64 A;  1W9F A;  4ES8 A;  1ASJ 1;  5FFO C;  3WCR A;  1XE0 A;  2KXL A;  4ASL A;  5ACA 3;  1FMD 3;  2WLP A;  1PZ9 A;  4LBO A;  3R0R A;  5EQU A;  1KDK A;  3O1V A;  1FPN 2;  1LES A;  3IN9 A;  3OEB A;  4BH9 A;  3HD8 B;  2WIN B;  2Q8O A;  3W21 A;  1QJX 1;  5FZ0 A;  4Y1X A;  4Z2A A;  3LCP A;  1AX0 A;  2JKB A;  4JHZ A;  1C8N A;  2Q8E A;  4P9X A;  3SH4 A;  4FFG A;  2HWF 1;  2F17 A;  3V64 A;  1OFS A;  3R6S A;  4P9L A;  5FYM A;  2P3K A;  1E5H A;  1AR9 1;  3OBR A;  4K3U A;  3WW2 A;  1QNY A;  3PUA A;  3HVD A;  2ZMN A;  1POQ A;  1XU2 A;  4LOS A;  3NJV A;  3UT0 A;  1S0D A;  2CNA A;  2K9Z A;  1XB9 A;  4DY3 A;  3RZM A;  5BNN B;  4GJZ A;  2J1E A;  4GH4 B;  1GZC A;  4JQR A;  1LJ7 A;  1UOF A;  1UZZ A;  3N36 A;  1W3X A;  1JOP A;  3N3H A;  2W5F A;  3ZSE A;  4YM2 A;  1ULP A;  5LB6 A;  4RA0 A;  5JZG A;  2GN3 A;  3WW4 A;  1PMJ X;  4HPK B;  3WF0 A;  2UU8 A;  4QGN A;  2BZD A;  4D7S A;  1W0O A;  2VZR A;  3CJI C;  5D8A A;  4Y22 B;  4COU A;  3S5Q A;  4XJ9 A;  4QB6 A;  2VTF A;  3MLJ A;  2RS5 2;  2OZJ A;  3FHA A;  1K5M A;  4P02 B;  3T3Y A;  3AFK A;  4QX0 A;  2H0V A;  1W8F A;  5ANN A;  3ZLI A;  4OUE A;  5IVC A;  5JSO A;  4XE9 A;  1GQP A;  4BU2 A;  2EXK A;  4RQP A;  3ZSK A;  4RD7 A;  1UY1 A;  1OPM A;  3BOW A;  4HKL A;  4K20 A;  2VNO A;  2FDF A;  2WN2 A;  3DUI A;  4AZZ A;  1UQX A;  1GWK A;  4IE6 A;  4EWD A;  2PTM A;  1HX6 A;  1RUJ 2;  2VH9 A;  4CP0 A;  1CJD A;  5CFD A;  2ZHN A;  4OI4 A;  5DDJ 2;  1FV3 A;  5FXZ A;  3WV6 A;  4E2G A;  4R4X A;  2QQI A;  4UF0 B;  4X6Q B;  4AED C;  3OSD A;  1AL2 3;  2WNU B;  1GOG A;  4K1Z A;  4XAE A;  3B7M A;  2V73 A;  3ZXJ A;  3H1M A;  5DZF A;  1CAU B;  4A41 A;  3HIF A;  4YW2 A;  4Z8B A;  1J3R A;  2WT2 A;  2R0H A;  3VHO A;  3H7J A;  1QQP 1;  1UYY A;  1HRV 2;  2XON A;  4GAL A;  3WNX A;  1E5R A;  2A71 A;  4QPG B;  2RG4 A;  4XXA A;  2EIG A;  1JUI A;  2R06 2;  2XLF A;  4QGM A;  4XCB A;  4P00 B;  3HBK A;  4XFC A;  1YQ2 A;  3WCS A;  4AVB A;  4D94 A;  2R6Q A;  4ITC A;  5A7W B;  3K4A A;  3QLQ A;  4Y20 B;  1MS4 A;  4B29 A;  1QEX A;  2Z2S B;  4PLM A;  3SC7 X;  1EPW A;  3EHK A;  1RUH 1;  2VNR A;  2VTX A;  2WL1 A;  4YFW A;  4UAP A;  2PA7 A;  3Q9O A;  1OOP A;  3WDU A;  2B45 X;  2WS9 1;  1W99 A;  3RZJ A;  2RJ2 A;  2JG8 A;  2WII B;  4CU7 A;  4AHX A;  4YGC A;  1WLT A;  2YU2 A;  5GLV A;  1WW6 A;  5LY1 A;  3UKV A;  2ARE A;  5G04 L;  5JCT A;  1RUC 1;  4M0H A;  1POV 3;  1T6B X;  3ZDS A;  1OD5 A;  4IEV A;  3T4H B;  1STM A;  2P5B A;  5KHG A;  3ACL A;  1TMF 2;  3W5M A;  2FZ2 A;  3WG1 A;  3I2J A;  3OTF A;  4RS5 C;  2WT0 A;  3B3Q E;  4GB3 2;  5FYT A;  1RMU 1;  1VAV A;  4XZU G;  1OF3 A;  5GJ6 A;  4AQ2 A;  3POB A;  4L97 A;  4W6Y A;  3E6D A;  2AEY A;  4PI2 A;  3VKN A;  2A75 A;  5F39 A;  4NR1 A;  5A7Q A;  4M3C A;  2D6O X;  2HWE 1;  2ET1 A;  5J1X A;  1UPS A;  4AI0 A;  1LHW A;  1O91 A;  5LBE A;  3I2I A;  4RYD A;  1MS1 A;  2XBO 3;  4LKE A;  1YLL A;  4DMI A;  1UU5 A;  3H8O A;  3T0D A;  3WQ0 A;  4UW5 A;  4Y1V A;  4S2H A;  2W9X A;  1ZBE 3;  1NG0 A;  1BMV 2;  1YEW A;  3UGF A;  4P9G A;  3AZW A;  3GGL A;  4UT5 A;  3NNJ A;  1YUD A;  2D93 A;  2B8M A;  1JHJ A;  2R32 A;  2C0Z A;  3U75 A;  1IS3 A;  3WDX A;  3H8R A;  1JYI A;  5E16 A;  4A7Z A;  4CCO A;  3TN9 3;  5A3U A;  4XFF A;  4CCE A;  3CJI B;  1YXW A;  5FPX A;  3KV9 A;  5C6C A;  2XDV A;  4ZU5 A;  4D6R A;  1W6M A;  5HBA A;  1ASJ 2;  1RUI 2;  2ZGN A;  4N9H A;  2RR1 1;  3F2Z A;  4XET A;  3LDK A;  4RR3 C;  3T0A A;  1AYM 1;  2CYF A;  4HL0 A;  4AEJ A;  1F5F A;  4D7Y A;  2VJX A;  2YYO A;  5A6Q A;  2XJQ A;  1ZRR A;  5EXO A;  4CRQ A;  4DIQ A;  2CTV A;  2X10 A;  1WA6 X;  3FLR A;  5JOY A;  1G8W A;  3AZV A;  5I8S A;  2FD8 A;  3RNS A;  3OG2 A;  4PI0 A;  4CEY C;  4EN7 B;  1RB8 G;  4NRM A;  5FZF A;  2NZ9 A;  1AYN 1;  1N3Q A;  3A4U A;  3AMH A;  2WO2 A;  4M4P A;  1BLZ A;  1HXS 1;  1AR9 2;  4XF3 A;  2Y0I A;  1CX4 A;  2EAL A;  4YM3 A;  4YNI A;  1PNF A;  2NQY A;  2PFW A;  3MIF A;  4AED B;  5IFT A;  2F4P A;  3J8F 1;  1F4A A;  2XQX A;  4E4Z A;  3O1O A;  3E5U A;  4LBJ A;  2DTY A;  2DUO A;  1ZX5 A;  2GND A;  3AKT A;  4GH4 A;  4QXC A;  2O0O A;  1LOF C;  1YCI A;  5D2A A;  5A33 A;  1IKP A;  2HH9 A;  1UNB A;  5CVR A;  5A3O A;  2ERF A;  2QCS B;  5SV8 A;  1OQE A;  4OQ8 A;  1UWW A;  4K8R B;  4BA6 A;  5IVB A;  1C1F A;  3IAP A;  1GIC A;  5FKC A;  2Z69 A;  3WHT A;  2JX9 A;  3P1I A;  1HKD A;  4QM9 A;  3OB8 A;  3OY8 B;  1H0B A;  2FBE A;  4HPK A;  1ZM1 A;  2QE3 A;  4FPF A;  2BEO A;  1YI7 A;  4L2N A;  4MGI E;  4FPH A;  4TLG A;  5E89 A;  4Y22 A;  4NAM A;  1SAC A;  2JDH A;  3ZYF A;  3G6J B;  2A1X A;  1WME A;  2NM1 A;  2Y8K A;  3OGG A;  1PK6 C;  3VDD C;  2HEW F;  4MH0 E;  4NII A;  1QJY 3;  5KBF A;  2E7Q A;  4W50 A;  2QQV A;  3MEP A;  4IV3 C;  3LPG A;  5CYY A;  3WX5 A;  1PGL 2;  1LEM A;  3LE0 A;  1XNK A;  3I8T A;  5LAT A;  2YC0 A;  4AWD A;  3O12 A;  1ZBA 1;  1H6X A;  1H2L A;  3VHR A;  5FWE A;  3CO2 A;  4DRR A;  5DAV A;  5AC9 2;  4L9B A;  4FTB A;  3ZDV A;  1CZT A;  1VBA 3;  1R09 1;  3HMY A;  4RS5 B;  5A32 A;  1SBD A;  2HEV F;  4FPG A;  4Q4X 3;  4OCT A;  1BEV 1;  2RE9 A;  4YW5 A;  2WNU A;  1W9W A;  4LBQ A;  3C2U A;  1CAU A;  5IUQ A;  4RGA A;  4YSF A;  2XR4 A;  2RDQ A;  1W39 A;  3RZH A;  4I3P A;  3WQB A;  5L9B A;  2ZGM A;  4XEZ A;  4CU8 A;  4AAP A;  1MS0 A;  1QQP 2;  1AXZ A;  1OKO A;  2FMD A;  2N7G A;  4HK9 A;  4N90 A;  4O7X A;  2R16 A;  4AE2 A;  4Y20 A;  1RUD 3;  2VME A;  3POE A;  4IEX A;  5DG1 A;  3WUC A;  1XXN A;  5G05 L;  3UK9 A;  1PGW 1;  3IDE A;  4YVS A;  2X5I C;  3III A;  4LO7 A;  1DYO A;  1RUH 2;  2ZTN A;  4I0A A;  1GP4 A;  2WZE A;  3O1S A;  5T5J A;  4HON A;  5J48 A;  1EV1 1;  2A6V A;  1PZ8 A;  3N9P A;  1RUE 2;  1SLA A;  4RR3 B;  4E9K A;  4JV4 A;  2WS9 2;  3BUC A;  4DXS A;  3LKJ A;  4R4Z A;  2XVL A;  1MZE A;  2BV4 A;  5C33 A;  5GLZ A;  4NHL A;  4FQ4 A;  4CEY B;  1WMD A;  1S55 A;  1LOA A;  4Y24 A;  4QHZ A;  2OVU A;  1PO2 1;  3JBG 2;  1UX6 A;  2WC2 A;  3FJS A;  4V1P A;  1PVC 1;  3VBH C;  4HMZ A;  1CPN A;  2PHT A;  1YIP A;  3CDZ B;  4Q1R A;  2HWE 2;  3JD7 1;  1BVP 1;  1N3P A;  4N9I A;  5A1A A;  1G9C A;  1Y9M A;  1J84 A;  1CZV A;  4OHX A;  2ZGU A;  2WNE A;  5T5P A;  4YZ1 A;  4Y5S A;  1LRH A;  2CDO A;  1LR5 A;  3ACI A;  4A42 A;  2DYC A;  1AR6 3;  2XJR A;  4GMP 3;  1S0F A;  4XTP A;  3VDA A;  3R05 A;  4IEQ A;  4Q4V 2;  4BOW A;  2NP0 A;  2ZGK A;  5J3U A;  1DGR N;  2E33 A;  2FZ1 A;  2JEM A;  3A0N A;  3NJZ A;  4E2S A;  1SMV A;  3LOB A;  2A3X A;  2FDI A;  1LUL A;  3DPR C;  3GHN A;  1DF0 A;  1PK6 B;  3VDD B;  4PIY A;  3D3A A;  3RQ0 A;  2DCT A;  4KWL A;  4OHW A;  5EV7 A;  3T30 A;  1ULF A;  4IV3 B;  4YZ5 A;  5CA6 A;  5IK4 A;  5A1F A;  3AFG A;  4F7Z A;  1DGW A;  1AYM 2;  3LA2 A;  4XAB A;  1E57 A;  1QXJ A;  2CGN A;  3POJ A;  5FO9 B;  1FOD 3;  3OCP A;  4KH9 A;  2QNK A;  2RVA A;  2WO3 A;  2ZZQ A;  3PME A;  5GLW A;  5IWF A;  2X05 A;  2RS3 2;  2Z79 A;  4QKN A;  4CCM A;  1UPI A;  3X29 B;  2UWB A;  3ZXE A;  4AED A;  4CDX C;  3ZFE C;  1W8N A;  4FAH A;  3TOJ A;  2GMM A;  1HQL A;  1HXS 2;  3B9I A;  3PUH A;  1HIX A;  5FZL A;  3VDB A;  4KU7 A;  5T54 A;  3C8X A;  4MXW A;  1HW5 A;  2XML A;  4YM1 A;  3WZ1 A;  4Z2W A;  4H55 A;  1J3P A;  3OUH A;  5GZG A;  1O5L A;  2ETE A;  1LGN A;  3KV6 A;  4UW3 A;  1WMF A;  2EAK A;  5JPN B;  4EWA A;  3L9J T;  1N3O A;  1W6Q A;  4YZ3 A;  2VUA A;  1JMU B;  2CY6 A;  1KIT A;  3ENR A;  3PUQ A;  3WF2 A;  1JZ8 A;  4P5H A;  5FP8 A;  5A3T A;  1DP0 A;  2XVK A;  3MW2 A;  4XUN A;  3HNM A;  2RS1 1;  1RJ7 A;  2B4K A;  1WCU A;  3G7D A;  1MEC 1;  2X5I B;  3I7D A;  4MOA A;  1AJO A;  1H8T C;  4FT8 A;  3RWK X;  1PIV 1;  3THT A;  3QH7 A;  1X36 A;  4PF1 A;  3H1W A;  2ZEZ A;  5C5U A;  2D6P A;  3LZZ A;  1S2K A;  5BY5 A;  4PLO A;  5CFC A;  1CAW B;  1AR7 1;  1KJL A;  1VBC 1;  1RUF 3;  3GJB A;  4LUM A;  1NA1 C;  2WZR 2;  3K48 A;  5FMO S;  4ISR A;  1C8M 1;  3SIS A;  1U12 A;  1HRI 2;  1OI6 A;  4EN6 B;  2ZGP A;  2LS6 A;  3KF5 A;  5EIY B;  4RS5 A;  2YHJ A;  3DYP A;  1ZBA 2;  3GCX A;  3JU9 A;  4NHM A;  4L0P A;  1WWY A;  3AZZ A;  2VUC A;  5C7G A;  1D4M 2;  2PAE A;  3OPW A;  3BPZ A;  3OD4 A;  3SHR A;  4AG4 A;  2QZ3 A;  1NLS A;  1VRH 3;  1IQD C;  3VBH B;  4DNY A;  2Q5T A;  4Y1U A;  3OF1 A;  1G9F A;  1G7Y A;  2JB8 A;  2ZZJ A;  3DYO A;  3HJR A;  4HSJ A;  3ELN A;  5A7N A;  1DQ4 A;  1Z7S 1;  2IWG B;  2J1T A;  4XDO A;  3ILN A;  2XJP A;  1GU3 A;  1MQT A;  5BV6 A;  1NLQ A;  2R07 2;  4IND A;  1WUV A;  2ZXQ A;  4IL7 A;  1W9S A;  3ZFF C;  4N43 C;  2BVV A;  1CIW A;  2PMW B;  2Y6J A;  4HK8 A;  5B2G B;  4HN0 A;  3ZO0 B;  4E4H A;  1JYC A;  2I07 B;  2AH2 A;  5E6H A;  5F2S A;  5JVV A;  3EMR A;  5HXM A;  5F5C A;  5FZ1 A;  4ZZ8 A;  5FMB A;  3TB0 A;  1K42 A;  5FPV A;  3IT8 A;  2LRP A;  2BU9 A;  3DPR B;  4IER A;  4I01 A;  2RMU 3;  4FXK B;  4BQ5 A;  2WNO A;  3LGR A;  4GKY A;  2GC0 A;  2XOM A;  1OFN A;  2UY8 A;  3ZXG A;  2YGM A;  3D82 A;  4EJR A;  2MEV 1;  2PN5 A;  3M1H A;  4IEU A;  2XJS A;  1OLM A;  4X8P A;  4ZHN A;  2BFU S;  4KWK A;  2CGO A;  1LHO A;  2ID4 A;  5CU1 A;  4ARX A;  4CEY A;  2WFF 1;  2YFZ A;  5DQ0 A;  2X8K A;  3AL5 A;  2D6N A;  1VE0 A;  2CU5 A;  3TEZ A;  2WZ8 A;  4I0B A;  4YGE A;  1W2A X;  4CDX B;  2VOV A;  3ZFE B;  2ZGS A;  3O5S A;  2PHL A;  2WO1 A;  2EAA A;  4C91 A;  1S0J A;  2B39 A;  3QOP A;  3H9A A;  3FFZ A;  1VBE 3;  1X7N A;  1LOF A;  2HBT A;  4X8N A;  1BBT 3;  5C4W C;  1V9U 3;  3H8U A;  1W05 A;  1PO1 1;  1GBG A;  2ZCW A;  4Q1P A;  2CV6 A;  2Y33 A;  2JWP A;  3SLI A;  2VOK A;  3UJO A;  4DOU A;  4LO8 A;  3IAQ A;  1UCX A;  4KG8 A;  1XRU A;  2ARA A;  4AW7 A;  1GOH A;  5KC6 A;  1RUO A;  2VZS A;  4YPJ A;  4IEW A;  4QQO A;  5FYZ A;  5DXD A;  1ULO A;  3CZU A;  1W06 A;  3Q8C A;  4G3Y C;  3DEC A;  3SCF A;  1OPO A;  2ZGR A;  5GZD A;  3H42 B;  1DQ2 A;  1H8T B;  2PQS A;  4AQT A;  1UKR A;  5CBL A;  3IKW A;  4E2Q A;  4IV3 A;  1R08 3;  1DU3 D;  2DCK A;  4Q0V A;  1ULD A;  3K2O A;  1W6P A;  4E4D X;  4PBP A;  4DUW A;  2PYT A;  1DLL A;  4GQ7 A;  5CAZ A;  1NA1 B;  3BTX A;  4BXS V;  4KQ7 A;  2LM3 A;  3HR9 A;  5I0T A;  1UMZ A;  1AVB A;  3HNB M;  3JB8 A;  4I09 A;  1NCR C;  2IXI A;  3W5N A;  2WT1 A;  1FPN 1;  1T6G C;  4OMC A;  1V00 A;  4RN5 A;  3RYP A;  4CDW C;  1KRI A;  4MG2 A;  3Q8A A;  2FDJ A;  1L7Q A;  5JXG A;  1QOO A;  4S2G A;  2HEY F;  1M06 G;  2VCB A;  3JZV A;  4K21 A;  2P3I A;  5ERL A;  2ARB A;  1YC6 1;  4LBL A;  2QTW B;  3ILR A;  3JUU A;  1KEX A;  2HWD 1;  2JDP A;  3VL9 A;  4MXV A;  1GMM A;  3OGV A;  1YQ6 A;  2IVJ A;  3WP4 A;  4BQ1 A;  4FPY A;  4DFS A;  2VNV A;  4TYS A;  1LOD A;  2EIC A;  5I8T A;  2A6W A;  3ZFF B;  1DLC A;  4N43 B;  1BK1 A;  1W8H A;  2PEL A;  3P5B A;  4DPN A;  4QX8 A;  4FPE A;  4EYU A;  3NQH A;  3NNM A;  4AAX A;  2O1Q A;  1H30 A;  3CIH A;  2X5I A;  3BN6 A;  1CQ9 A;  2Z4F A;  1GSL A;  3H3U A;  2AEN A;  2RS1 2;  2YB7 A;  2YV8 A;  2WR9 A;  2QJV A;  3KQR A;  2VBB A;  1MEC 2;  2R30 A;  3WT3 A;  2DCJ A;  4NJ4 A;  2ZEX A;  1US3 A;  2PLV 1;  1PIV 2;  4AEM A;  3WXP A;  2FDH A;  1NZI A;  1O7F A;  1X9P A;  3T1L A;  4CCK A;  5LK7 B;  5C8C A;  2OYZ A;  3RVH A;  2ZPX A;  1W9Y A;  3KQ4 B;  4W8J A;  4H2A A;  1JZ7 A;  3KB5 A;  1H1M A;  4DXR A;  3OPT A;  2VZ1 A;  4LLO A;  1J58 A;  1NQJ A;  1VBB 3;  2RS5 1;  2WQ8 A;  4A45 A;  3KVB A;  2DF7 A;  2HWC 3;  2VMD A;  4OQ9 A;  4NPL A;  4TLF A;  4WZC A;  1HJF A;  3ZYR A;  3VBH A;  2O14 A;  3ZR6 A;  5LBC A;  4Q4Y 2;  3GBW A;  4ONU A;  4LO6 B;  3SMH A;  4A3Z A;  2VMG A;  1SG3 A;  3BIE A;  1UO9 A;  1NXD 1;  4LPL A;  1CAX B;  5FK8 A;  1J83 A;  1O59 A;  5C4W B;  4JVA A;  3FLT A;  4CDQ C;  1Z7S 2;  1XJA A;  2G19 A;  5FZG A;  3TWI A;  3MO4 A;  4QKB A;  4KL1 A;  4XZP A;  4D0Q A;  4B1M A;  1O3Q A;  4I3G A;  4LMF A;  1HRV 1;  1PX4 A;  3T2T A;  4GUL A;  4WV8 A;  3WNO A;  5I8Y A;  3TNP B;  2ARC A;  5FOB B;  2R06 1;  3S57 A;  1NT0 A;  2LAL A;  5IAX A;  4XC9 A;  3GJA A;  1UMI A;  1KS4 A;  5ABJ A;  1E5S A;  3D6E A;  1GFF 2;  2FCU A;  1NY7 2;  1NCQ C;  1BQP A;  2HWB 3;  2Q4S A;  3LQC A;  2RDS A;  2WA3 A;  2YY1 A;  3RMY A;  4XJA A;  1FI2 A;  1COV 3;  2MEV 2;  4JGY A;  1YFY A;  2VQA A;  4XCA A;  2VD7 A;  4M0N A;  2XJT A;  1YNA A;  1LGC A;  4XFB A;  3ZYP A;  3U0Z A;  3OYW B;  1NCR B;  4SBV A;  2WFF 2;  4CDX A;  5F1R A;  5HV0 A;  5LW9 A;  3J4U H;  4CDW B;  4E8D A;  4FTE A;  1HB1 A;  4CEW C;  3KGL A;  4FOV A;  1QH7 A;  3A23 A;  1BHG A;  1X9T A;  3M3O A;  4BJ0 A;  2TUN A;  2JG9 A;  1TMF 1;  2NMN A;  4ZS2 A;  1MS9 A;  2VW1 A;  2NLR A;  3I3D A;  1KD7 A;  1GZW B;  3BTY A;  2BQP A;  4GB3 1;  3LSE A;  3KGZ A;  2WAO A;  1NZC A;  2A5Z A;  1O8S A;  2VMF A;  2XUE A;  3WNP A;  1SLB A;  4WVM B;  2IXC A;  1AR8 2;  2E9Q A;  2Y26 A;  3MBW A;  4PCR A;  1FXZ A;  2BGP A;  4XXP A;  1LU2 A;  5FUN A;  3CMG A;  4BQY A;  1VBD 3;  1TME 3;  4H7M A;  3RJR A;  3ME2 A;  3S6P A;  3CNA A;  3WHU A;  4B4P A;  3TEW A;  5HXV A;  2ENR A;  2P2K A;  1UYZ A;  2XGX A;  5A7S A;  3WLU A;  2O8Q A;  4KWU A;  1H8T A;  3UET A;  1A34 A;  1W03 A;  2FQP A;  2VEC A;  1DGR A;  2YZ4 A;  2C6S A;  2DFC A;  1BMV 1;  4RHV 3;  1FNY A;  2EIB A;  1V6J A;  2CAU A;  1WA4 A;  2V09 A;  1RUJ 3;  1LHU A;  1NA1 A;  4YG0 A;  5DDJ 3;  4YWA A;  1NLR A;  3GCW A;  1XSR A;  2C24 A;  4Q4W 3;  2CWS A;  1HQN A;  1EY2 A;  4LK6 A;  1UXZ A;  3O1R A;  4OYU A;  3AP9 A;  2EVX A;  3OOX A;  3UKN A;  2VNG A;  4SLI A;  5F3G A;  5FYC A;  5JXJ A;  4CZS A;  1RUI 1;  3HQX A;  4XJ8 A;  2YPD A;  3V0B A;  1I5P A;  1B35 C;  5DUU A;  3JB4 C;  1S2B A;  4FXG B;  2ZHM A;  4LA2 A;  4NE9 A;  4XQD A;  3RYK A;  1A6C A;  4BZ4 A;  4WBB A;  4W4Z A;  2WYF A;  1WKY A;  3C3V A;  4S2F A;  1Q3E A;  4PIZ A;  4R9D A;  1ENQ A;  3WW1 A;  5LEJ A;  5FV3 A;  2P34 A;  2HWD 2;  3ZFF A;  3ZYG A;  4CDQ B;  4N43 A;  1U5X A;  4YFZ A;  4NID A;  5KC5 A;  1PM4 A;  3U11 A;  2BWC A;  3GDB A;  3MIG A;  2P37 A;  1N1Y A;  5IK7 A;  1TE1 B;  3CEW A;  2A6X A;  3U4S A;  4LIT A;  3UKT A;  4HZF A;  4IEO A;  4LOR A;  1N47 A;  4LUL A;  4AYU A;  3V0A B;  2VUD A;  3VKM A;  3CL1 A;  4XBL A;  3FZ3 A;  1Y9Q A;  2WWJ A;  4LE4 A;  2UYA A;  1JZ6 A;  2QQN A;  4MHR A;  4L99 A;  2QQW A;  4MHU A;  1KFX L;  3LOI A;  3WNL A;  3ZIX A;  3WQ1 A;  1H1I A;  1I5Z A;  5JOZ A;  2R04 1;  4NHX A;  3ZFG C;  1GZ9 A;  1NCQ B;  1UIK A;  2PLV 2;  4W6X A;  2OKX A;  5K8S A;  2XH6 A;  2JDM A;  3I2D A;  1FX5 A;  1LOC A;  5EZW A;  2BOI A;  2XHN A;  3TEX A;  1Y3T A;  4XF1 A;  5C70 A;  1IHM A;  1QDC A;  3AKS A;  2B46 X;  3ALQ A;  3ECQ A;  1BKZ A;  4LXL A;  5LA1 A;  1SEF A;  4LHK A;  3FMG A;  1U0A A;  2DVA A;  2WN3 A;  2VZ3 A;  2YUE A;  4FPK A;  4NN0 A;  5FZ7 A;  4CA9 A;  1UW8 A;  4CEW B;  1QXR A;  1KGY A;  2QUO A;  2VBP A;  4O61 A;  4OUL A;  4UBG A;  5HV4 A;  1OD3 A;  3T08 A;  2W08 A;  2CGP A;  1G86 A;  5AC9 1;  5F9T A;  2YRO A;  5C4W A;  3W58 A;  3K3O A;  4CP9 B;  3BI3 A;  4KMQ A;  1AHS A;  4HXC A;  2OX0 A;  1Y7B A;  1OXC A;  3NNF A;  3W59 A;  4HN1 A;  2IXH A;  1GNZ A;  4BM8 A;  1K3I A;  4NRO A;  5DN2 A;  2IXK A;  2Y6H A;  3POW A;  4K8F A;  1S0G A;  3SKJ E;  1HDK A;  1ASJ 3;  1LOG A;  3WOG A;  2LW8 A;  2E26 A;  2C1F A;  4UW4 A;  1A8M A;  4TN7 A;  3PUI A;  4YAR A;  1QJU 2;  5DUV A;  4Z1V A;  5EJZ B;  5FY7 A;  3U1X A;  2PHR A;  5JUV A;  3KZ4 C;  3RG0 A;  4AI1 A;  1QJX 3;  3M3I A;  3GF6 A;  2GN7 A;  1UOB A;  1F4H A;  2OII A;  1VIW B;  1WCD J;  2HWF 3;  2VTX J;  3IMM A;  4BK4 A;  3N9O A;  1VMF A;  2HBU A;  5JOX A;  1AR9 3;  4OI2 A;  3URF A;  1BVV A;  4AGG A;  4UBH A;  1XND A;  5FBJ A;  5A3N A;  1F9K A;  5FZM A;  4P9W A;  2GC3 A;  2WNV C;  1DQ1 A;  2Y34 A;  4QQP A;  3OYW A;  1NCR A;  5GKA C;  1Q56 A;  2D5H A;  2NPI A;  1TQ5 A;  4MO3 M;  4CDW A;  5JIU A;  3F95 A;  1RUE 1;  2HKX A;  1J1L A;  4IE0 A;  1HB3 A;  2P1B A;  2VVE A;  5FZ6 A;  1B35 B;  1GUI A;  2W1Q A;  4XBQ A;  3GHM A;  4IES A;  5IFP A;  4Q0U A;  5EP9 A;  3VBS C;  1A3K A;  3QCW A;  4LBM A;  3RSJ A;  1GZW A;  1ND3 C;  3J7H A;  1FMD 2;  3KWV A;  4QMA A;  3NO8 A;  2VC9 A;  4NUB A;  4DEV A;  2JE8 A;  4OHY A;  2V5Y A;  1K12 A;  4IE4 A;  1CAV B;  2W3J A;  3PIJ A;  2JDA A;  2GDF A;  3JBG 1;  1SFY A;  3K75 B;  1LTE A;  2BGO A;  1W8U A;  3ZR5 A;  2RJK A;  3WF1 A;  1CN1 A;  4HBN A;  5T50 A;  5FZI A;  2TBV A;  1ODM A;  2D3S A;  3IDA A;  4UWD A;  3WP3 A;  3T2Q A;  2GMP A;  5J36 A;  5JR2 A;  2RHP A;  5KXD A;  1HJG A;  3WP5 A;  5FOJ B;  3VD9 A;  1GLH A;  5I0D A;  3DV8 A;  1IOA A;  1JI6 A;  1PZ7 A;  3SCG A;  1MZ6 A;  3I2O A;  4Q4V 1;  3ZFG B;  4GAZ A;  3BU0 A;  1UOJ A;  4NPM A;  2XKP A;  1DCS A;  4BYY A;  1XNA A;  4EZH A;  1ULG A;  4F3J A;  1IGO A;  4NHY A;  2EID A;  4CXY A;  2J1R A;  3OBA A;  4QKF A;  4KWJ A;  2BVB A;  4CPB A;  1C57 A;  3POY A;  2JB4 A;  1R1A 1;  1QQP 3;  5A70 A;  3DGT A;  3ILF A;  4I0W B;  4AFA A;  1H8V A;  3ZN6 B;  1BCX A;  2DV9 A;  2GME A;  3FBM A;  3E6C C;  4PJY A;  3FHI B;  4JCK A;  4P08 A;  3THP A;  5E8A A;  3AYE A;  1TG7 A;  4N53 C;  2RS3 1;  2BJS A;  3QH6 A;  4NIA A;  3RI8 A;  4A6S A;  2A73 B;  5A3P A;  1DYK A;  1RUH 3;  2GNB A;  3LAG A;  4P14 A;  4Z82 A;  3VD3 A;  4K6B A;  4XDP A;  4XYX A;  2RM2 1;  4BPZ A;  1R1Z A;  2EA7 A;  3VHP A;  2GH2 A;  1F5J A;  1PX3 A;  2WS9 3;  4AFM A;  4OUS A;  5BNN A;  1C5H A;  4MGZ E;  4GWI A;  3VD5 A;  3WY6 A;  3OD0 A;  1RUC 3;  4QX1 A;  2IFW A;  3DYM A;  1UZY A;  1NCQ A;  3I97 A;  4XFI A;  3B01 A;  3U37 A;  3UV9 A;  2W47 A;  1RMU 3;  3BOD A;  3D0S A;  4BXF A;  4Y4Y A;  5F5I A;  1C1L A;  1QWR A;  4AL9 A;  2R04 2;  1OUR A;  2JDZ A;  1DZR A;  5E88 A;  1LOE A;  1QOS A;  1F35 A;  3ACF A;  1CIY A;  1SHW B;  2HWE 3;  1VJ2 A;  3POF A;  4FPL A;  4QXK A;  4KBZ A;  2WNV B;  4P9I A;  3U78 A;  1U5I A;  3JQW A;  4AOC A;  5FO8 B;  4LT5 A;  2A7A A;  2R7E B;  4CEW A;  2K46 A;  2VPV A;  2ZAC A;  3MIB A;  4MLO A;  1LU1 A;  2F4L A;  4JDN A;  5F5Q A;  2BOJ A;  4BQ2 A;  5IAV A;  2Y0O A;  5LZ6 A;  2WZR 1;  3WDY A;  1O3T A;  1F31 A;  3VBS B;  1O5U A;  1HRI 1;  2LUW A;  3DN7 A;  3NNG A;  3U4X A;  2BBV A;  4CP9 A;  1ND3 B;  2KA3 A;  4IUG A;  4HLT A;  4C8D A;  2VGD A;  2XLA A;  3KM5 A;  4WM7 C;  1OC1 A;  2WAB A;  4XJU A;  5F8P A;  1OBN A;  1D4M 1;  3R4S A;  2KM2 A;  4XHB A;  4CDU C;  5EPA A;  1IPS A;  2QDR A;  3NKT A;  5GZF A;  1AZD A;  5LRS A;  1D2Q A;  4OMD A;  4XOG A;  4UF0 A;  4ZPI A;  5EYY A;  2OZ6 A;  2MNG A;  3MPP G;  5H9S A;  5CB7 A;  1G9A A;  5HPO A;  1EAH 1;  2RR1 3;  3CQO A;  3PJQ A;  4OLL A;  1AYM 3;  3ABZ A;  4NOT A;  1REF A;  3SEP A;  5BYN A;  4YGD A;  3N7J A;  3J7M A;  2R07 1;  4NIG A;  2ZJC A;  2YDE A;  3AMQ A;  1GZT A;  4QPG A;  3JCI A;  2VZT A;  4IGO A;  1V6K A;  5FP3 A;  1GNY A;  3CZJ A;  3WG4 A;  3L2Y A;  3ZXF A;  3I2F A;  5F37 A;  5LA2 A;  5A7W A;  4JRA A;  2DVF A;  1AYN 3;  4N7I A;  5GLT A;  4XFA A;  3VBU C;  3ZMO A;  2QQP A;  1HXS 3;  5IAT A;  1QU0 A;  1IQA A;  2VCC A;  1NKG A;  3J8F 3;  4V2W A;  2W1U A;  1LAJ A;  4LBN A;  1B35 A;  1X8E A;  3BAL A;  3BVC A;  3B9C A;  4L8Q A;  1W3V A;  1O4T A;  4LKD A;  1O4Z A;  5EJ3 A;  3DXU A;  4NPR A;  2D6K A;  2ZEW A;  3K3N A;  2DTW A;  3ZN4 A;  1TNR A;  2Y60 A;  4Q0Q A;  2A6Y A;  1CAV A;  1WCS A;  2JDN A;  1JYX A;  1I1E A;  5LWB A;  2OT7 A;  2WA4 A;  3VDC A;  3H7Y A;  3POI A;  1JN2 P;  1NXM A;  3KT7 A;  3MV1 1;  4N53 B;  3ZYB A;  5IVJ A;  3J9S A;  1ZA4 A;  1Q43 A;  1KS5 A;  3DF0 A;  3D5O A;  2OW4 A;  2HYX A;  4XIO A;  3USS A;  2XUM A;  1IS6 A;  5FXX A;  1MS5 A;  2VY0 A;  3QBQ A;  5JAX A;  1BZW A;  3ZPY A;  1ZBA 3;  2D3P A;  4N7U A;  3WR0 A;  4COV A;  1UIJ A;  3N7K A;  2YBK A;  3VZO A;  1OA2 A;  2W94 A;  3N9L A;  3ZFG A;  4BE3 A;  5C8W A;  4ES9 A;  1R09 3;  2GU9 A;  2BW8 A;  5FP9 A;  3VKO A;  3WF4 A;  5JMC A;  1BEV 3;  1PHM A;  4O9E A;  4OUM A;  3PVO A;  1QMJ A;  2P4E A;  2X29 A;  4EE2 A;  2YMZ A;  5A1L A;  5FXW A;  3CJI A;  5FR3 A;  3IPV B;  5FQ0 B;  2ZMK A;  3HQR A;  1QOT A;  3FX3 A;  4D6S A;  5A6Y A;  5FAX A;  4BMB A;  1R1A 2;  2PHF A;  2WBK A;  4TTG A;  2ZML A;  3BGA A;  3D8C A;  3AXE A;  1JTZ X;  1QJY 2;  3GM8 A;  4WM7 B;  4YG6 A;  1RVF 3;  2VMI A;  4COW A;  3S7I A;  3M3E A;  1W0P A;  4CDU B;  1SLI A;  2BGC A;  2H6B A;  4IV1 C;  4XHX A;  1OT5 A;  1RYY A;  2XQR A;  4XQ4 A;  2E63 A;  3TRS B;  2QKD A;  1EV1 3;  3WSO A;  1DBN A;  2YPJ A;  2RM2 2;  1SLC A;  4Q8L A;  5FDB A;  3VZJ A;  5A3M A;  3KHC A;  4NIH A;  3HN1 A;  3UES A;  3WQ7 A;  2YC2 A;  4YZ2 A;  2OS2 A;  3O14 A;  4OI0 A;  2C4X A;  4FOW A;  4WVW A;  4NAO A;  4CCL A;  5J37 A;  1X8M A;  3OY8 A;  4AXO A;  5IW0 A;  4PDW C;  2JDU A;  5FK7 A;  3VBU B;  1RUN A;  1PO2 3;  4A4A A;  2IVI B;  2G4I A;  1PVC 3;  2RDR A;  3AMP A;  4TXW A;  4PT6 A;  1PGS A;  3NMB A;  4CUC A;  1YI9 A;  2VCA A;  2W1S A;  1RUD 2;  3JD7 3;  4MGS A;  3IDC B;  3T0B A;  1WZX A;  2XPJ A;  4CE8 A;  1MVQ A;  2D6M A;  3HOB A;  3VBS A;  2W52 A;  2V4V A; 
#chains in the Genus database with same CATH homology
 5DAQ A;  2G1M A;  4UWD A;  5IAT A;  5LB6 A;  3EMR A;  3NNL A;  3PL0 A;  5DAP A;  3OBZ A;  3KT4 A;  3BVC A;  5DAW A;  4Y5S A;  2RDN A;  5DAX A;  5LBC A;  4BQX A;  4NHY A;  3KT7 A;  4MHR A;  4MHU A;  3OUI A;  5L9V A;  4NHX A;  2G19 A;  5LBF A;  3DKQ A;  4XAB A;  2OPW A;  2HBT A;  3W20 A;  5L9R A;  2A1X A;  4Y5T A;  2Y33 A;  5IAX A;  5M0T A;  4XC9 A;  3GJA A;  3HQU A;  2RG4 A;  2FCU A;  4XCB A;  2RDS A;  5HV4 A;  3ITQ A;  5LAT A;  3OUJ A;  4XCA A;  5DAV A;  3NNF A;  3OUH A;  3HQR A;  4JZR A;  5HV0 A;  5C5T A;  5LAS A;  3MGU A;  4XAA A;  4KBZ A;  2JIJ A;  2RDQ A;  5LA9 A;  4NHK A;  4IW3 A;  4J25 A;  5L9B A;  2HBU A;  5IAV A;  4BQY A;  5C5U A;  5EQU A;  3GJB A;  5ERL A;  4NMI A;  3W21 A;  2Y34 A;  5LBE A;  2V4A A;  4XAC A;  4NHM A;  5LBB A;  5EPA A;  4BQW A;  4NAO A;  3KT1 A;  2FCV A;  4ZPI A;  5EP9 A;  4ZON A;  2FCT A;  2RDR A;  3NNM A;  3NNJ A;  2JIG A;  3GZE A;  4NHL A;  5A3U A;  4Q5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...