2RG4A

Crystal structure of the uncharacterized protein q2cbj1_9rhob from oceanicola granulosus htcc2516
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
206
Chain Sequence
SLAQIKSLFATRLYHAPLSEHGPALDPAEFAASCYSIAEDDDAGQEWCEREGYPGYTSYASLTDLPWRFPIFADLVKSLDAHVAAFAEDLEFELDGKALRLEDIWINILPEGGVHGSHIHPHSVISGTTYVAMPEGTSALKLEDPRLPFMMAAPTRRKGAREELRTFRSVAPKVGDVLLWESWLRHEVPMNMAEEDRISVSFNYAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of the uncharacterized protein Q2CBJ1_9RHOB from Oceanicola granulosus HTCC2516.
rcsb
source organism Oceanicola granulosus
molecule tags Structural genomics, unknown function
total genus 57
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13759 2OG-FeII_Oxy_5 Putative 2OG-Fe(II) oxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2rg4A01
4XACA 5EPAA 4NHXA 4Y5TA 5LA9A 2Y33A 3HQUA 4XCAA 3KT7A 5LATA 2V4AA 4J25A 5HV4A 5L9BA 5L9VA 5LBEA 4XABA 5DAQA 3KT4A 4NAOA 5DAVA 5C5UA 2OPWA 2Y34A 2FCTA 4JZRA 2RDQA 4NHYA 4BQXA 3PL0A 2JIGA 4ZPIA 2FCVA 3NNMA 5DAWA 2RDNA 3W21A 3OUHA 5A3UA 4NHKA 2HBUA 4XAAA 5LBBA 2RG4A 5IAXA 4BQWA 3KT1A 5ERLA 2FCUA 5M0TA 5L9RA 2JIJA 4IW3A 4MHRA 3OBZA 3NNFA 3MGUA 3NNLA 4KBZA 4UWDA 3GJBA 3OUIA 3EMRA 5DAPA 2RDRA 4NMIA 2A1XA 4XCBA 5LB6A 5IAVA 5LASA 3GJAA 5LBCA 3DKQA 3BVCA 3GZEA 4NHMA 3NNJA 5EP9A 4XC9A 4BQYA 5EQUA 5C5TA 3ITQA 2HBTA 5LBFA 4Y5SA 3W20A 3OUJA 5HV0A 4ZONA 4Q5OA 5DAXA 3HQRA 2G1MA 2RDSA 5IATA 4MHUA 2G19A 4NHLA
chains in the Genus database with same CATH superfamily
3OPTA 1BMV1 4RN5A 1SLIA 5I91A 3OF1A 1NE4A 1ULDA 3SXWA 1POV0 4KMQA 4QPGC 5ABJC 3EQEA 3POSA 4IEVA 4MGZE 1SFPA 3H42B 4QGNA 1O5LA 2QQOA 1J3PA 4QX5A 3U11A 3UESA 4CU8A 2WL1A 4AGGA 1EPZA 1O7FA 3RFRA 5FZKA 1KXGA 3K2OA 1AXZA 4N53C 4PDWB 5DDJ3 4E4ZA 2PTMA 4OMCA 1W28A 3H1MA 3S30A 1T2XA 2QQLA 3V64A 2K0GA 1S0EA 2OXBA 3CBNA 3E5XA 3SNMA 2RS52 2VNGA 1XE8A 2P6CA 1S2BA 3MV01 4Q4V1 2CGOA 2HEWF 3USUA 4AWDA 3N7MA 1V6MA 5F32A 5F2SA 1DYOA 5FZEA 5A32B 5DMYA 1RUNA 3UGFA 4AEJA 4TN7A 3O12A 1OHFA 5BNNB 3T2TA 3P3NA 5CBLA 3RZMA 4P5HA 4AVCA 1JXNA 4ATEA 1S0FA 5A6YA 1LOGA 2HJIA 4CPBD 4PLMA 1MEC3 4E4SA 2QQVA 2VTXJ 5LBBA 3B7MA 5FK7A 4E2GA 3BODA 1UMZA 3RI8A 1OOPB 2WRAA 1GICA 4WVWA 2W87A 3BPZA 1WD4A 3ZYFA 2WZ8A 1RUJ3 1U5ZA 1ZBE2 3LDRA 4IW3A 1VBB2 4YVWC 4ZS2A 1FX5A 4E4DX 1RMU1 1OA2A 1NCRC 2RM23 2VBDA 3HEIA 1EPWA 4QDSA 2WA4A 3MW2A 4LBQD 1DZRA 1PGL2 4ZHNA 2VUDA 4KU8A 1SBDA 3O1RA 3OPWA 4Z92B 2CNAA 3TRSB 5C9AB 4AK3A 4PIXA 5FIXA 5FPZA 2R49A 1CX1A 2IXJA 4H7LA 5H9PA 1F5FA 2RMU2 1QKQA 1VMJA 1NAEA 2XL9A 3B5LB 1A34A 5CFDA 4GXLA 3ZOIA 4GZ9A 1K45A 3GDBA 4UFIA 3WG4A 3GZEA 4E9KA 3OGJA 2BYVE 1OLQA 5FZDA 5JSPA 1OXCA 2VULA 4CDWC 3ON7A 2D5FA 3OY8A 5CB7A 4PI2A 3ZMNA 4CP1A 3AYDA 4NRPA 2WAAA 3GZUC 5CNAA 1ENXA 3CL1A 1I3HA 2YC4A 2ZAAA 4CTEA 3RVHA 2JDUA 1D0HA 5JAXA 2ZS6B 4C91A 1F35A 1RB8G 2LRPA 2WNVB 5HV0A 1W6OA 4FT8A 4QAWA 4BQ4A 1UOBA 1UOJA 5FZOA 3CJIC 4AI9A 2D3SA 1DGRA 4LIUA 1CAXA 1F4AA 4YM3A 1QJFA 2WT1A 5SV5A 1Z7S1 4AVTA 1QGLA 2WO1A 4M4PA 4Q4X3 3A0KA 4X6QB 2QQUA 2QCSB 1BBT2 5JIAA 1VMHA 2QJVA 5F2WA 2J1UA 3M2MA 5A70A 4ZU5A 4D7YA 2CHHA 3GCWA 5FPAA 5L7OB 4MGQA 4UBGA 1UZVA 5F6KA 1G6NA 3FLTA 1C1FA 3PNAA 4RHV2 1H6YA 2WT0A 3B9IA 1FPN2 2ZGKA 3QCWA 3R05A 3M3CA 4YG6A 4KGQA 4YZ1A 1WGPA 3WNXA 3IB3A 4AE2A 3A21A 1NUKA 1QJU2 3C7FA 3I59B 4PQ9A 2XLFA 2NPIA 1UD1A 2ILMA 1J3RA 1ULGA 4RQPB 2VH9A 3SEEA 2VVDA 3ZX7A 1AYM1 4A42A 2VO5A 3A22A 5T3NA 4BXSV 5L19A 1ULCA 4YW2A 1I5PA 1V6JA 3C7GA 1CQ9A 5I8YA 3GBGA 1B35A 2IFRA 2DWRA 4QXKA 2IVIB 5DAVA 1W06A 2VNVA 4IE7A 5FZ9A 5BNQA 5I0RA 1BMV2 1PO22 1V9U3 5CISA 4F8AA 3RYPA 2ZEYA 3LSDA 2W94A 1OQ1A 1W04A 2WAOA 3FBMA 4CP0A 1G7YA 5L36A 1YI7A 5AFEA 2B5HA 4FPLA 4XMIA 1JYCA 3CNAA 3VDDB 4CCKA 1QJY3 4UF0B 5FJHA 2VZQA 4JKKA 3DYPA 4OQ9A 3RGBA 4Q8KA 4CUCA 2W46A 1A8MA 3T0DA 4Q4Y2 1XU1A 1MR5A 3NO8A 5FUNA 4CEYA 3ZN6A 4FTEA 2WLQA 2XONA 4XFCA 3ZSEA 4BK5A 5ERLA 5JSRA 3TEZA 4QPYA 4JCKA 1FAYA 1LESA 2UURA 1COV3 2HWF3 1GOGA 4Q4V2 3WCSA 4DO0A 3QH6A 4B4RA 4BIOA 4COVA 1JHJA 3JB4C 2ZX3A 1KS5A 3ZYPA 2YZ4A 2XH6A 1W9FA 3NNFA 1GZWB 4DS0A 4FPCA 1UL9A 4KH9A 3FUQA 1APNA 4LA2A 5BNNA 3I7DA 2ZGMA 2EXKA 2UWAA 3N9OA 4UWDA 1RGSA 5LRSA 1LECA 2JDYA 1ZRDA 4R9BA 1CAVB 2FBEA 2EICA 1HB1A 1OUSA 3RMXA 4BDVB 2MNGA 4XJZA 4D7SA 4EN7B 1J58A 2D43A 2BNMA 2JXAA 5DQ0A 4P9IA 1OOPA 3WUDA 3CHXA 3LFIA 2WA3A 3WDXA 4M3CF 3ACHA 5IVVA 2J42A 3O1TA 2HWB1 5D8AB 2VW2A 5CADA 3T0AA 5F39A 3VKOA 2CGNA 1UPIA 1RMU2 5F1RA 1FMD2 1CD3G 2FDKA 4NWVA 4RGKA 5F5QA 5T5LA 3WINE 5HI0A 4BPZA 5KXCA 1JZ3A 5C70A 1XNKA 2HBTA 4GQ7A 4S2DA 5FZ7A 5FLIA 5C9AA 1OH3A 1KITA 2QQKA 1TME2 4LOTA 3WUCA 3HVDA 1G9CA 1YQ8A 5FYBA 2JICA 2WJSA 3TN93 1W2TA 5DAXA 3R6SA 1C8M2 1OF4A 3WNMA 3ZO0B 1N3OA 4UW5A 4UI9L 2VC9A 4DUVA 1CJPA 1MZEA 3ACLA 4MHUA 5F5AA 5C8CA 5AVPA 5K8SA 4KG0A 2QQPA 2NM1A 1WW6A 1LHUA 1PNGA 5C3PA 2PLV3 4NRQA 3IDEA 5ANQA 5FXWA 1JZ6A 2EF6A 4Y1XA 1QQP3 4QX3A 3RPQA 5C6CA 1X8EA 2DCYA 3LGRA 1VRH3 1LU2A 4K40A 3JD71 4RL7A 1UXXX 1IOAA 1UKRA 3DL3A 3IPVA 1V6KA 3LEKA 4XF3A 3WX5A 5JXGA 1QH7A 5FYSA 1VAKA 2VZSA 4GH4B 5A1LA 3RZGA 3NL1A 3LEGA 5JPNB 4K7JA 4D6QA 1JZ4A 2WS91 4J25A 2FMDA 4O65A 4B3NA 4OULA 1Z7S2 1HQLA 2ADEA 4R52A 1ZZ6A 2KR2A 5DAQA 2RS11 4O61A 5C3QA 3AX4A 4I2OA 4Z82A 3R4UA 4QKNA 4QX2A 2A6ZA 4YZ4A 4CU7A 3AJZA 1CIWA 5CFCC 1AVBA 5LZ6A 4BQ2A 1NQDA 3VHRA 4V1PA 3QH7A 4Y4RA 4O9EA 4P9LA 1Y9MA 2P17A 1LHWA 3I59A 4M00A 4AHXA 2ZX2A 2FCVA 3FE5A 3BI3A 2LTNA 3DYMA 3NNMA 4RQPA 2MEV1 4ISQA 5DAWA 5J98B 4CDXA 2JG9C 4GMP3 4Y4YA 3KCCA 4XILA 1W3VA 2QNKA 4K20A 1IS3A 2F17A 3LKJA 4AVSA 4AQSA 5GLWA 4SLIA 1QU0A 2FDGA 3GXUA 3AC0A 4Q0SA 2VUAA 4KQ7A 4JQTA 2CDOA 4MHRA 5DG2A 3AFGA 1W6MA 1ND2C 4G3YC 4H7MA 1HB3A 1OD5A 1IKPA 2GN3A 1FT9A 5JZGB 4XETA 4A3ZA 5DABA 1UQXA 5T5JA 1IGOA 2E7AA 5IWFA 5FZMA 4LE3A 4A41A 3WF3A 3HNYM 4QT6A 2VZUA 5DZEA 4A45A 3MZHA 1ASJ1 3NAPA 2VZOA 3LA3A 1DHKB 5FQ0A 2YHJA 1OF3A 3I3BA 3AYCA 5FY7A 5LASA 4YVSC 1QJX2 1F8VA 1HN0A 3KCXA 2HWD1 1AX2A 1GZWA 3MF6A 3ZR6A 1LHNA 2X5IA 3WXPA 5GKAC 1O5UA 3ZSJA 3KZ4C 2J1AA 4RGGA 4L0PA 3AVRA 1H1MA 1VP6A 2AUYA 2FDJA 1KQRA 3IZOA 4XEZA 1WCKA 4ES8A 4BB3A 1SCRA 2ARXA 2F4PA 2AC1A 3WDVA 5FYYA 3LFMA 2D3PA 5C4WC 4Y22A 4AI8A 4CYDA 4F3JA 5FYCA 2P2KA 1NA1A 2R0FA 4LEJA 3VBFB 1WMEA 1SLBA 1VBD1 4COZA 1YQ2A 3KV6A 2HWB2 2OUHA 4FAHA 1ZM1A 4UW6A 1EAH3 3LPFA 1RUH1 3KVAA 3GCXA 3UJOA 2UYBA 4AGRA 4JX0A 5IVBA 3ZYRA 5FO8B 2NMNA 5IFTA 3OJBA 4Z07A 3MPBA 3OBAA 3ZN5A 4TLFA 4B4PA 2BW8A 3UETA 1NXD1 1ZA7A 3GZAA 4E27A 4BK4A 3PDQA 1WCQA 3J8F3 1PZ8A 1HQWA 5GLTA 2VMIA 3L2HA 4L92A 1LAJA 2PYTA 4XJ8A 5J09A 1VBC3 2R073 4NIHA 2ZGTA 2EXIA 5FRAA 1F2NA 1UW8A 2O14A 1W8FA 4IEUA 1PO11 1PMIA 2GC2A 4HPKB 5AC92 4CEWA 3CQOA 1H8TA 1ULEA 1VIWB 2PHRA 4M0NA 1PIV1 4XBNA 1ZBA3 4OLLA 5DG1A 1XYPA 4XZPA 1ZZBA 3IDCB 4WM7B 3VGIA 4A7ZA 1JMUB 1ULFA 1H1IA 1HRI2 5F37A 4DB5A 4N9IA 3JB8A 3WQBA 1C1LA 4D94A 2OKXA 5FKCA 3T2QA 4HFSA 4OI0A 1BJQA 4QU1A 2RDNA 3I2IA 3CEWA 3MEPA 3ZMOA 3MV11 5IK7A 1PM7A 4CP2A 1NCQB 5DUXA 4AFAA 3VBUB 1MQTC 4BU2A 1WLCA 1ZRRA 3OGRA 2DVDA 2TNFA 3KT1A 2RS12 3HMYA 3ZKUA 5BNOC 1DF0A 1IG3A 3ZFEB 2JIJA 2P4EA 1X9PA 2D3RA 1W03A 2C24A 5B2GB 3MIFA 4GWJA 4OHYA 5GLUA 3CMGA 3ABZA 1Q3EA 2VVFA 3LEMA 1EV13 1BEV1 3DPRA 4Q0VA 1GZCA 4NR1A 4BLIA 3M4FA 2IXHA 3ATGA 3FLRA 2MEV2 3PJYA 1YYNA 2R16A 3VBHC 1PNFA 1IS5A 2A1XA 1DP0A 2BUKA 4K9SA 4B7EA 1RUE3 2BGOA 3AB0A 4XCBA 4P9XA 4XZUG 4YZ2A 4LUKA 4FPJA 2CAVA 2SLIA 4GB33 4XUNA 4CDUC 4NAMA 4R9CA 1R083 5FDBA 5D21A 1C28A 2YFUA 1XSRA 1NLSA 4Y1VA 1A78A 4CUBA 2RJKA 4IE4A 1N47A 3AP4A 1LOCA 2XBO1 1YQ5A 1AJKA 4QGMA 4ZXEA 2NN8A 1RC6A 1WA6X 3BCWA 4LIVA 2AENA 4A44A 1FV3A 3I3QA 4URTA 2PHXA 3RMYA 4AOCA 1ASJ2 3E97A 1AL21 4LO4B 2DU1A 2Q0AA 1XJAA 4MUVA 2VZVA 3HWJA 4IV3B 3V0BB 2B45X 1N1SA 1WW7A 4FFGA 2OPKA 4FPYA 1F5JA 2OT7A 3ZXGA 1W3XA 4FQZA 3ZXKA 3M7AA 1B09A 3TNQA 1D0GA 3O0VA 1VAVA 4W6WA 5HCBA 1ZREA 3CJXA 2CAUA 2C26A 2WZPP 3DV8A 3BGAA 1J1LA 2OS2A 3KQRA 2PFWA 4ARXA 5FZLA 3SCGA 5LA0A 1RIRA 3J7HA 4MGYE 3UK9A 2R1BA 3TBDA 4RS5C 2A3XA 2J7MA 3H3UA 1MZFA 5IVJA 5A3PA 1YJLA 1PK6C 1W6PA 3Q8EA 2W1WA 2V4AA 3P1IA 4DNYA 4OCTA 5KBFA 1RUH2 3E6DA 1DGWX 2VGDA 3VUOA 4OHXA 4BA6A 3UV9A 3WSOA 1HRV2 1UY1A 5CFDC 4NO4A 3QD6A 2DCZA 2ES3A 3MO4A 4XIKA 5KHHA 5LY1A 2XPJA 2ET7A 2DVAA 4YLZA 2H6BA 3EB7A 3VB9A 5HBAA 4XFGA 1RVF3 2DDUA 2DUOA 2RDQA 3IAPA 3LOIA 2GALA 4LUMA 4AEDC 4C1WA 4OQ8A 1GSLA 2R041 4KWKA 3BUCA 1SLCA 2VU9A 1MS1A 2W1SA 1I9RA 1WLTA 5A1FA 1OFNA 5FZ3A 2VUCA 4QWNA 3NSTA 5E16A 5EYYA 3W5MA 3ES4A 4HPKA 3M3OA 4EV0A 1SZBA 1UY4A 3OUHA 2Y64A 1WMDA 2PELA 5B4XA 2WQ4A 1Z78A 1LOEA 4K21A 1YXWA 1W2NA 4IV1A 3LPGA 2EALA 4N9HA 1PIV2 4MVTA 3VD9A 4ZKTB 1AR91 1BYHA 2GNDA 3PUQA 4HKOA 4XJ9A 4QX1A 4WM7A 2G9GA 1IHMA 3H7JA 4FI9A 2OUJA 1SFYA 2VQAA 4FPEA 5C3OA 3NVCA 4OHZA 3VZKA 5JIUA 4NVPA 4XJWA 2EA7A 4FBFA 1W8UA 3H0OA 4TSVA 3QBQA 1VBB1 1VBA1 4XUOA 1KRIA 1O91A 1UPSA 1JUHA 1AJOA 5DZGA 5JDBA 1W2UA 4QPIA 4YGEA 2HWC2 3HJRA 3D8CA 3OUIA 2WNUA 3USSA 5DDJ1 3LB9A 1PGW1 4GJYA 1RUF3 4Q4W2 4RYDA 2XJVA 5F8PA 5HCHA 1PGL1 3O0WA 5FJKA 4LLOA 2DBNA 3HPNA 4YW5A 4Y33A 2ORXA 2RJLA 2E6VA 2WFF3 4QKBA 1OQEA 3ZFEA 1X33A 3OBTA 4YGDA 4MYEA 3VKLA 1U5YA 2Z4FA 3H50A 3KHBA 3IMNA 3ZDVA 2LROA 3D3AA 2YC0A 3AXEA 3RNSA 2X53S 1CONA 2XJRA 5EQUA 3CKHA 3ITQA 3N7KA 3VZNA 3OGVA 2JB8A 2VQUA 5FXZA 2VMDA 1XYOA 2XLAA 1X82A 4K1YA 1LNSA 2YBSA 3C7HA 2VQTA 4AFCA 1XB9A 2A7AA 2WKKA 2ZJCA 3NQHA 4GA9A 3T3YA 1GANA 1LULA 1W6NA 1PGSA 3N3HA 2AEZA 3MUY1 3O0XA 5LEJA 5JXJA 4PDWC 2OQ6A 1AR62 3AP7A 3ELNA 1RUI2 1URXA 4YYOA 5LEKA 1YO8A 3UNPA 4ZXKA 2G19A 2RM21 3OEBA 1Y4WA 5BY5A 5JOWA 4KL1A 3T2OA 1SDDB 1LOBA 2BV4A 2XBO2 1CAXB 2PQSA 1DZQA 4AFMA 4DXRA 5KC6A 1Z0HA 3VBSA 2A73B 2VMFA 3RWKX 4AHYA 1PMJX 1BBT1 1VBE3 1S1AA 4Y24A 1TG7A 2N7GA 1ZA4A 3E6CC 2XR4A 2UU8A 5FYTA 2GMEA 2XUMA 3U0ZA 5BNNC 1AL22 4MX3A 1L7RA 3MBWA 1DU3D 4FPKA 4LOSA 1FNYA 2JDPA 2D93A 1FPN1 4LNVA 3V0BA 1CR7A 4Q2FA 1DLLA 1H2MA 2CV6A 1HB2A 3I2HA 3K77A 3WF4A 2P34A 3BKZA 3WG1A 5FLHA 4K3UA 1TNRA 4MO3M 4UT5A 2XJUA 1RUD1 1OOPC 1TMF1 3V0AA 1LR5A 1XE0A 2W9XA 3I2KA 2RS33 1C5IA 2WQ8A 1B35B 4B1MA 1NLQA 4IXLA 4N43B 1PO21 2J22A 2AR6A 1F31A 2J1SA 2YU1A 4Z2WA 3OGGA 5FBZA 2RS53 4Z1VA 5A33B 1NOVA 2JG8A 1XYNA 5F3GA 1SBEA 1OT5A 1VAMA 2YPJA 2ZKLA 4H3WA 1EUTA 1HDKA 2VZTA 1RUG3 5T5OA 3ZFFB 5C9AC 2HEVF 3A7QA 5FP9A 4XTPA 1KD7A 1SHWB 4Q4Y1 2J1EA 4CDQA 1E5RA 4NUBA 5A7PA 4CEYB 5CKNA 3ZN6B 4B7KA 2A3YA 4S2HA 4IGPA 2LW8A 3GM8A 1GWLA 4JDOA 5FYMA 3WNOA 2V4VA 4YRDA 4MGTA 3POYA 3KHCA 2R042 4D6RA 1VALA 4IETA 3CLPA 2ADDA 2JWPA 4MH0E 1BXHA 1ZBE3 1MACA 3GJBA 2V5YA 4R9DA 5A7QA 2QFEA 3LOBA 2HYXA 1D4M1 4PF1A 1DQ5A 1VMFA 1OA3A 2OZ6A 1SCSA 2WNVC 2YFZA 3I54A 1PM4A 2RDRA 4JDNA 3VKFC 1DLCA 3AYAA 4FPFA 4QB1A 3WG2A 1JZ2A 5FAXA 3I3MA 1DIWA 4OYUA 3CDZB 1AR92 1BZWA 3WQ7A 4BQ3A 2Z79A 2SBAA 2VL4A 2K2SA 3BVCA 1AX1A 4NHMA 3NNJA 3P3PA 3CZJA 3DUIA 1AR83 4W65A 1NY71 1NZIA 3UKTA 2Y6FA 4SBVA 1VBA2 3WDTA 3AZWA 5LK5A 2GC3A 2FDFA 1KDMA 2C1FA 1W0OA 3ZLIA 1UY0A 1QHDA 1FMD1 1XRUA 1Y3TA 2IFWA 4UBHA 4QHOA 1PGW2 5DDJ2 1LOFC 5GJ6A 5L7OC 5JUVA 4UXAA 3VBOA 1MS9A 4OZXA 2GC1A 3WZ1A 1W9WA 1TME1 2BWAA 1BK1A 3AZVA 4RQPC 3O1SA 3J4UH 2JDZA 4A7YA 1IPKA 2Y38A 1RYYA 5LY2A 2B42B 4AG4A 5T55A 1C8M1 4IEQA 3PVOA 4J1XA 4F7ZA 1LODA 3NJXA 3I2FA 4NHLA 5FPLA 3V56A 4Z2AA 3MICA 4EN8B 5C8CB 4HANA 2LS6A 3WNNA 1ZRIA 2HLEA 4EWEA 3ZYIB 1MEC2 4QXBA 4LHNA 5I0SA 1XXNA 1ULOA 3O1PA 2G9ZA 4Y5TA 5I8SA 2XWBB 4CE8A 1YLLA 1CAUA 1SFNA 2BZDA 1WWYA 3FHAA 4YG3A 1FOD3 5DZFA 5FXVA 3VDDC 3LQCA 4H2AA 3VD7A 2R063 5FZAA 2BTVC 3KT7A 4I30A 1H9WA 1RUJ2 4IGQA 3VDCA 2X8KA 3IPVB 2VMCA 4RHV3 1S4CA 2Q8EA 3O1OA 5C7GA 1FV2A 2R30A 2ZGNA 5IVCA 3K4ZA 4UFKA 2RM22 4PIYA 4LTAA 4W8JA 3O14A 3D82A 1QJU3 3AP5A 2YU2A 3BTAA 2ID4A 4ARYA 5EYXA 2X09A 3ME2A 4JGZA 4KG8A 1QIQA 3VHPA 2DCKA 2JENA 3ZPOA 1AYN3 4G9SB 1AXKA 2Z2SB 4GWNA 4XAEA 2JKXA 3SISA 1CZVA 2OIIA 4V2WA 4B1LA 4DINB 5H9RA 5JMCA 4ATFA 5AFBA 2RR13 2HYKA 1JOJA 4FP3A 1OI6A 3NJZA 4GKYA 2D6PA 4Q1PA 3VDAA 4FXKB 4AVBA 4NIGA 1RUD2 1UAIA 5APAA 1TMF2 4CDXB 1D4VB 1YFUA 2WZR3 3P6BA 1C8NA 4PLOA 5L9RA 4DXZA 2PLV1 3AKRA 5FY1A 5D8AC 5BNPB 4FFIA 4N43A 1Q8OA 3N7JA 2W47A 3OB8A 3AKPA 2XWJB 3O7OA 1Q8PA 1CGPA 1S0BA 4OI4A 4LHLA 5A33A 4JGYB 4ES9A 1NE6A 2KM2A 4Q4V3 1W6MB 3TAYA 1QXPA 1RJ8A 4PJYA 2C9KA 5FPBA 3ZFFA 5FZ1A 3ILNA 4QDQA 4XF9A 4XUPA 4LO6B 1WBLA 1C3HA 4MXVA 5JR7B 3RJ2X 3RZHA 1XNDA 1W8OA 5BUVA 3PUHA 4CXYA 2UWCA 1VB2A 3WEZA 2ZHLA 1O6UA 2FZ2A 3NAPB 2GH8A 2EIGA 5LBCA 3MYXA 1P8JA 2BERA 2E7TA 3DKQA 5FMCA 3B02A 5EP9A 1ALYA 5FQ0B 4ASLA 4D0QA 5KWRA 4B29A 3WW1A 1OLRA 2W52A 2QZ3A 3E6BA 5FXXA 1N1YA 1QJX1 1OQDA 3AXDA 4Y1UA 5CU1A 3VZMA 3B01A 2IZWA 3MFAA 3OOXA 4MGSA 5J3UA 5IW0A 2X10A 2Q1ZB 2E63A 1XBFA 4XBLA 1GLHA 2IC1A 1QMJA 1D4M2 2X5IB 4IEYA 1KFUL 3NV2A 4QD2A 1RMU3 2VOXA 4W50A 1AR71 4W4ZA 1GP4A 2I07B 3TNPB 4GH4C 4Q5OA 3QACA 4LJHA 2D6OX 1YFYA 2VJXA 3SKJE 1HN1A 4Y22B 2EIEA 1JHNA 2BDRA 2HEYF 2GN7A 3VHOA 1NA1B 5FYUA 2PHWA 3RDIA 1XQNA 3WT3A 4EE2A 1NY72 1QOSA 2UYAA 3OYWA 4YFWA 2TEPA 4NROA 3ZXDA 3O1VA 2E31A 1H4HA 1PVC1 4YM1A 3KS7A 4Y20B 3ZXAC 3IM0A 4UW3A 5KXEA 3NRUA 3K46A 2WYFA 2ZPXA 3JUUA 1K42A 4LO7A 4Q0QA 3IN9A 3Q8AA 4P9WA 2W91A 4JC1A 4XOGA 1W8NA 1QOOA 2HWF2 1COV2 2D7FA 1DFQA 2DUQA 1W9SA 5EZWA 1HXS3 2W0XA 4P9GA 5LATA 4BH9A 5FYHA 3T1LA 1WLWA 2BOIA 2HWE3 3OBRA 5FPVA 5HV4A 1UYPA 5L9BA 2AGSA 5FZFA 1WCDJ 2D40A 5LBEA 5IK4A 4NOTA 1ENRA 1Y9QA 4YWAA 3FJSA 5CYYA 5ABJA 5AC91 2VXJA 4GAZA 4CEWB 5BV6A 4UFJA 1H8TB 1Z7S3 2AYHA 5J48A 4MXWA 3D6EA 4GWMA 5FMOS 2CY6A 2WSVA 3KLSA 2BOJA 5T54A 1OVPA 5A7SA 1DQ0A 3F95A 3I4IA 5JZGC 4FOQA 4IESA 4N7IA 4XQWA 3UJQA 4IEXA 1DYPA 1HRI1 1E5SA 5J37A 1TQ5A 2QTWB 2XKPA 4QQPA 1YFWA 2ERFA 1GOFA 2VCCA 3AMMA 3SLIA 1ND3B 4YSFA 3MIGA 2YBKA 1UIJA 2VZ3A 4GIQA 3S57A 2RE9A 5GZGA 1AYM3 1KJRA 2DTWA 4PBPA 4RR3B 1W9YA 3HR9A 3H3ZA 1W9TA 1MVEA 2W95A 4IEWA 4Y5Z0 4YW6A 2ZAHA 3WHTA 2BPA2 1N1TA 2Y0OA 3ZFGB 4LK7A 1LTEA 1QOTA 4X6RB 5CZKA 2DUPA 3TEWA 3J7LA 3NJVA 4UYBA 5GZCA 1IG0A 4O7XA 1STMA 1HJGA 3DPRB 4CA9A 3KV5A 1FATA 1JBCA 3SKVA 2JKBA 1CIYA 1GP5A 3JBG1 2WFPA 4NMIA 4ASKA 4BOWA 3UKVA 3WW3A 1QNYA 1X50A 2E51A 3KB5A 3LIHA 2IXCA 3OD0A 3U37A 3VBFC 2LALA 2PLV2 4LKEA 3VBRB 5BNPA 1LB2A 1LGBA 3EYPA 1QQP2 3AZXA 2XQRA 5HXMA 1NCRA 4LHKA 5JXHA 1BQPA 3MF9A 3AJYA 4JGYA 3GZTB 1E57A 2R6QA 3LSEA 1OD3A 1SPPA 2WNOA 3M8LA 4AI2A 4DQAA 3H8XA 3WDUA 1QXRA 5J1XA 1O3QA 3POBA 4UW4A 3ZSLA 5F7UA 5FK8A 1OURA 2E26A 4M3CA 1POV1 3FLPA 1NKGA 1H9PA 2AH2A 4AXOA 4K1ZA 2I45A 1YC61 2XVGA 3RZKA 3N4MA 4L2NA 3MLLA 5F6LB 3OSDA 3R4SA 1RTVA 5IFPA 3DKWA 1HV1A 4HK8A 3MI8A 3KCYA 3IIAA 4XFHA 2ZGQA 4Q8LA 2KXLA 1OSGA 2Y6HA 4BISA 2B7YA 5GZEA 2WSUA 2YYOA 1I6XA 1EV11 2ZHMA 1I1EA 4PF5A 4LKFA 2YPDA 4LBNA 2HWB3 4PHZA 4BQ5A 1YQCA 4COUA 4WM7C 4LA3A 5JPMB 2BVVA 4S2GA 1WW5A 5F5IA 1L7LA 5ACA1 1JZ5A 3THTA 1AR72 4XHXA 1JYNA 3IDBB 3HQUA 1AF9A 4C0BA 2IXIA 1FNZA 2QQIA 5EWSA 5H9QA 1WD3A 2QE3A 4E8DA 2IXKA 1TZOA 1XNCA 1NCQC 2WO7A 2B8MA 1ZNPA 2CYFA 3VBUC 3LAGA 3PU8A 4ORFA 4EJRA 1W6PB 5JR2A 1CZTA 4YFZA 3ZFEC 2QDRA 4XDOA 3IIIA 3ZIWA 2Q8CA 5DUWA 1PVC2 1CZSA 4TXWA 4Y20A 5EJ1B 3V65A 5FOBB 4TWTA 1WCSA 2DU0A 5JXIA 2RHPA 1X9TA 4H55A 1HRV1 3BYWA 1MS5A 4PCRA 1CPMA 1YFXA 2ZGUA 4MADA 4U2AA 3NV4A 3U10A 4BQXA 3PLQA 3I3DA 5A7WA 3MDPA 2D6NA 4HMZA 4LK6A 3VDBA 2JJ6A 2VPVA 4K8FA 1LENA 2LM3A 3ZIXA 3M3QA 4HVOA 5FY4A 4CUGA 3JD73 3S7EA 3LD8A 1YNAA 2P1BA 4XXPA 5FMOL 1W0PA 2ZEXA 3VD3A 5LK7B 3MIHA 1QWRA 1AHSA 2FCUA 1SDWA 4QPWA 1GOHA 2WS93 4INDA 4QKFA 1K5MB 4IV1B 2YC2A 5FUIA 1RITA 1IPJA 2WWJA 2VCMA 5AVAA 4LO5B 1ODMA 3C3VA 4HKWA 1W8TA 1WCUA 2JX9A 4P08A 4I0WB 3IDAA 1ND3A 5I8TA 3ES1A 4FAGA 2WN3A 4QPIB 4NIIA 1OH4A 2HWC1 4NPRA 1K3IA 1N3PA 1W8ZA 3MIDA 4HXCA 2WNUB 4Q4W1 4DRRA 1HIXA 1SLLA 2MEV3 4IV3C 2CWSA 1XOYA 1ZYBA 2DURA 2XVKA 4BE3A 5IAVA 4RR3A 3UT0A 2XKOA 5A7NA 4CXWA 1RVF1 5L9VA 3ZFGA 1DCSA 3W59A 3WQ1A 3J8F2 4D3WA 3S0MA 4AI1A 1HKDA 1OFSA 2PQQA 3X29B 3C2UA 3HIFA 2GNTA 1CESA 5FPUA 1VBC2 2UY9A 2BJSA 1JN2P 3HD8B 3VN4A 3WP5A 5L73A 4ET7A 4EYUA 2VE1A 5IVFA 1GV9A 1NX9A 4OHVA 3VD5A 1SEFA 4YW7A 2Y26A 3H1YA 3H7YA 1HB4A 3JBG2 1OLMA 3JU9A 4L8QA 4R4ZA 2HH9A 2YROA 3TYJA 4BWOA 4PIZA 3VBRA 1ZBA2 2GSYA 3C7EA 3ASIA 1SACA 4ITCA 3IWZA 1ASJ3 1SQ4A 1W6NB 2XHKA 4YG0A 3TB0A 2VOWA 2VXRA 5JOZA 4IEPA 1AR61 3HOBA 4IEZA 1RUI1 5FZBA 2P37A 3O5SA 4QX7A 3RSJA 1R091 2P3YA 2XDVA 3FWEA 3VV1A 5CAZA 4CCNA 4AL9A 2BWCA 1WW4A 2HWD3 3FFZA 4S2FA 3T1MA 2EVXA 4I3GA 2C9AA 3PUAA 3VBSB 5JLVA 5JCTA 4B8EA 1OMIA 3ACGA 3PUSA 5FREA 5A6ZA 1S2EA 2BNNA 4LBQA 1DG6A 5A3WA 2VM9A 4A6SA 1JH5A 4JKMA 1YUDA 2DVBA 1R1ZA 3KSCA 4LBJA 3NJYA 5KXBA 1TE1B 4FQ4A 4KWUA 1OPMA 1LKNA 2Q8DA 2OVUA 1GU3A 1EV12 4FO9A 4HLTA 4XABA 1RHI1 1RUC3 1VBD3 4LE4A 5FZ8A 5DPNA 4I3PA 2H6CA 3ZYJB 1W39A 5CG9A 4FCAA 1RUH3 5ACA2 5FP7A 3PIGA 5CKMA 3V0AB 2NP0A 3MLJA 1DYKA 4HETA 2XLGA 4WZCA 2XUEA 1YQ6A 3E1F1 4META 1RUE2 2EIBA 4XXAA 1O4ZA 3T30A 2JIGA 4X8PA 4QXHA 3ZYHA 3BIEA 5K4LA 4GB32 2W2IA 5F3IA 1UU4A 3KQ4B 3THDA 1E5HA 4DY5A 1R082 4JQRA 3FZ3A 4XTMA 4UOJA 2JG8B 3FBYA 3E5UA 3LA7A 2VMEA 3QLQA 4X8NA 2ZMLA 2D6KA 4JHZA 4XFFA 5FZ4A 3W9AA 4DEVA 3BIWE 3PURA 3PTYA 4P5YA 5D2AA 3UGHA 5M0TA 5SV8A 3RZZA 4DRVA 1LJ7A 4WM8B 5DUVA 3U1XA 1M06G 2X29A 5CFCA 1PO13 2O8OA 3N35A 4I09A 2A75A 4AI0A 4CDQB 1JYXA 2BNOA 3B00A 3OBZA 4XE9A 2VUJA 4AEMA 4QDRA 2E33A 1SLAA 2B9UA 3NV3A 4HSLA 2JB4A 4LMFA 1UXZA 2ZBJA 2JG9A 4NIAA 3UL2A 5HCFA 1RUOA 3PUIA 4YZ3A 2WZEA 2WR9A 3H1WA 4MZUA 2R1DA 3A0NA 4AYUA 4IE6A 2YDEA 3G7DA 1D2QA 4GD4A 4CUAA 1A6CA 1MVQA 2B46X 4W6YA 2RS31 5FOJB 2P3KA 2IXLA 4NJ4A 1K5MA 2QVSB 4OFGA 1DBNA 3SITA 4JRLA 2NYYA 2YUEA 2WIIB 3WP6A 1ND2A 2DFCA 3KM5A 5E1RA 4AR2A 1LGNA 3G6JB 3AVSA 1EP0A 2VG9A 3WHUA 3ZYBA 2FD8A 1DDLA 2RJ2A 3U14A 2K46A 2EAAA 4WVMA 3M70A 2BU9A 3IBMA 2W68A 2D6LX 3AFKA 3FC0A 3POEA 3B9CA 3W20A 4KU7A 3OUJA 1W0NA 1BEV3 1QDOA 1SMVA 1XC6A 1ST8A 4GWIA 5CKQA 5D1IA 2QKDA 5FY0A 1OKOA 2WO3A 3UGGA 4AW7A 3VBOB 1E5IA 1VJ2A 3B93A 3PJQA 4XUTA 4ASMB 1RVF2 5JI9A 1FYUA 4BZ4A 4PBOA 2JDAA 3T4VA 2BVBA 4QX0A 1W05A 4LR4A 2WN2A 1GNYA 2BGCA 2B39A 1ONAA 2HKXA 4EWDA 3O1MA 5HCAA 2W39A 3IMMA 1B35C 4GKXA 1DGLA 3GYDA 4XW3A 4N43C 5FCCA 1R1A3 1REEA 5A6XA 1Q43A 4AFDA 5DN2A 5C4WA 4XQDA 1Q5OA 4TTGA 2PXJA 2VMHA 1GKBA 2VW0A 1QJZA 2XVLA 1MEC1 4DPNA 5C8WA 1XNBA 3H8RA 3GBFA 1BVVA 3K3OA 3LDKA 3BTYA 2DCJA 3JZVA 2UWBA 2VY0A 1LOAA 3NWKA 1CAUB 1UIKA 4Y26A 5DXDA 3ZFFC 1GZTA 1UMHA 4N8MA 1AR81 4M3CE 3SHRA 1UX6A 1RUJ1 4OI1A 1AL23 4AAXA 4QB2A 1IKQA 3J7MA 3LWCA 4CEYC 4NAOA 3B3QE 1A8DA 3HT1A 3S7IA 1ZZ8A 1R092 5K0UB 5C5UA 1DZTA 3CU7A 1F4HA 4KWLA 4XHBA 2FCTA 3OPZA 2D44A 4WZFA 4DUWA 2J1VA 4JGZB 4D7TA 1CVNA 4HOOA 1RJ7A 2VCBA 3ZM8A 3POGA 4BQ1A 1Q8QA 4FPHA 3WP4A 1SLTA 2Q5TA 3POWA 1CAWB 1G9FA 4BYYA 5A3UA 1JTZX 4NHKA 3F2ZA 2ARAA 3D4KA 4YGBA 3U75A 4QB6A 4DFSA 4EN9B 4J6GA 1RHI2 4R9AA 2LUWA 5KXDA 2A70A 3K51A 1H6XA 2W08A 1AUYA 2B9VA 4HL0A 3DN7A 4BJ0A 5FZHA 5LWBA 1XU2A 4CCJA 4HKLA 3SEPA 2Z42A 4LBLA 3I2GA 5A1AA 3NV1A 2XL7A 2YGLA 3I2JA 1FOD1 4OI2A 2DVFA 3BN6A 4KNCA 5BPXA 4LO8A 4XFIA 1O3SA 1Q8SA 2XOMA 4D8MA 1RXFA 5FLJA 4CZSA 1PVXA 2R043 3I2OA 1J1TA 3AP6A 5BNOA 5KHGA 1MS3A 1YWKA 4IUGA 5EJ3A 4AQ2A 2PAMA 4CXXA 4DUXA 2XQXA 4HN1A 3VZLA 4COYA 3AMQA 2PHUA 2PHLA 2W1QA 3AZZA 4WM8A 2XJSA 4Q4X1 5FMDA 5LW9A 2ZXQA 5FYZA 3ZSKA 2GNBA 1VBE2 4QHBA 1YJKA 2VCAA 2NZ9A 4YPJA 3RYKA 1GP6A 3W21A 3AMNA 4CVUA 1GUIA 1AYN1 1H1AA 1WA4A 1GNZA 1N1VA 4TZDA 1OC1A 4BQYA 1AR93 1CPNA 4Q29A 4UAPA 2WDBA 3ETPA 5F5CA 5C8CC 1HLCA 4NPMA 1UO9A 3VBHA 1TEIA 4EN0A 5A3LA 4LKSA 4XURA 1D2SA 1ACCA 3ST7A 4URAA 2RR11 2AEYA 4NN0A 2OQ7A 3KWVA 1VRBA 1V6NA 4Y5SA 4DXTA 1VBB3 1VBA3 4YW3A 4ZONA 2WZR1 2AREA 2ARBA 2XMLA 5IJRA 5DUUA 4CDUA 2RS32 3R4DB 4FTBA 4QXCA 3SH4A 2QQWA 2G1MA 1KGYA 5IUQA 3ZVXA 3RZJA 2ZEZA 1JU4A 1V9U1 3S5AA 3ZSMA 1WLDA 1GR3A 1O4YA 1YCIA 2FHRA 2Q4SA 2GU9A 2FDHA 2RMU3 2XHNA 1SBFA 4XJUA 1J83A 3OYWB 4AGVA 4A4AA 4BLJA 1QJY1 1RUG2 1ENQA 5I0DA 3J26N 2BBVA 4XCAA 3JQXA 1MZ5A 5FPXA 2VOVA 2PAKA 4IE5A 3ZYGA 3CF6E 4P14A 3VLBB 3DCQA 2CL2A 4ZS3A 2I2SA 5FWEA 1COV1 2DFBA 2HWF1 4ZZ8A 1W6QA 3ROUA 4ZU4A 4QQOA 4CDXC 4JTNA 5T5PA 2A5ZA 1OLME 4YARA 2PMWB 4GALA 3A23A 4YW1A 2O8QA 3GGLA 3KT4A 1RINA 4Y3OA 1GFF2 4MGIE 1NXMA 5BNPC 1G9DA 4C0HA 2WUHA 4XF1A 3WNLA 4IL7A 3LA2A 3FUOA 1NT0A 1QDCA 4RS5A 4QPGB 5ABJB 3AYEA 4JGYC 3VZOA 4COWA 2ET1A 3SC7X 4RGAA 3Q8BA 1LRHA 1PK6A 2C6SA 3RI9A 2JDHA 1WMFA 1S0JA 4MXWB 3BTZA 5FP4A 3WLUA 1BBT3 1CN1A 1XPWA 4Q26A 4ZU7A 2NQYA 1YIFA 2DV9A 1RL3A 2YB7A 4WBBA 1AR82 1AXYA 1DQ1A 2C0ZA 4N53B 4XF0A 2J1RA 2JD4A 2MHFA 4N90A 2WWSA 1FPN3 1DGRN 3K75B 3NAPC 5K0UA 4OUEA 1O8PA 2GC0A 4QQLA 2EXHA 4AEDA 4QMAA 4QX8A 5JI7A 4C8DA 4EROA 2OZJA 1D7PM 3WNKA 4HVRA 3EJKA 1H8VA 1RUD3 3LE0A 1OVSA 1TMF3 4AHWA 3CZUA 1DQ6A 3MGUA 3HN1A 3K4AA 4MG2A 4EQVA 2BBAA 4J1WA 2D5HA 4KBZA 2DTYA 4TYSA 4CU6A 1HXS1 1F15A 2X5IC 5JSOA 3BTXA 3VD4A 3TN91 3WVJA 1PO23 3WY6A 5FY8A 1CAWA 2HWE1 3RS6A 3N36A 1TVGA 4CCMA 3LCPA 5GLVA 1KFXL 3AP9A 2WT2A 4HK9A 2ZGSA 3WR0A 4CCLA 4BCUA 4L9BA 4QQ2A 1K12A 1NA1C 2JE7A 3AKTA 4XFBA 2O1QA 4Q4Y3 5A6QA 4YW4A 3KV4A 4YVWB 1QQP1 1FOD2 1N3QA 1YHFA 2R062 2VZ1A 3WCRA 1VRH1 1NCRB 1V70A 3PVBB 4YNIA 5CA6A 5EIYB 2WABA 3AZYA 5I93A 5FO7B 4A6OA 1IQDC 1SPPB 3I8TA 1H4GA 3PVNA 3AL6A 3PMEA 2MPFA 3FHQA 3GBWA 3MHZA 5FP3A 4XIOA 4AZZA 2JDKA 3MIBA 3J7NA 2PA7A 3R0RA 4LULA 3RG0A 2YG0A 2ZOEB 4Q4X2 5FY5A 3K4DA 1DQ2A 1BVP1 1D4M3 4M3CB 1VPHA 5IK5A 1LGCA 2OX0A 3KD4A 4LBMA 5BYNA 1K5JA 2BEOA 3NKTA 1AYN2 2BRTA 4V2VA 4XUQA 3T09A 4CDWB 1IZ3A 4FOWA 3WD5A 4CEWC 1H2KA 2VOTA 3DXUA 4XACA 3BU0A 1H8TC 2RR12 4AQTA 4HBNA 4Q0PA 4PI0A 5T52A 5FYVA 4DY3A 3RQ0A 2F6BA 5FTTC 4GMP1 3DXTA 2WZR2 2TBVA 2P6HA 1FMD3 4PDWA 3POIA 1G9BA 4HN0A 3APBA 2GDFA 1VLNA 1GQGA 1ND3C 2ATFA 1PHMA 1V9U2 4LXLA 2BP6A 3CJIB 2AACA 4A3XA 4E2SA 1OA4A 3KF3A 3LEIA 5GM0A 4E2QA 5IT6A 1H2LA 4MOAA 1TME3 3VL9A 1S0GA 3ACIA 4AVAA 1V6OA 1JUIA 5A32A 4JAAA 4RR3C 3THCA 1C8M3 2Q8OA 4E4HA 2A6WA 1QJY2 3GALA 2VNRA 3HT2A 3ILRA 3ZFGC 1ZZCA 2XJPA 2VW1A 2Y6GA 3MIEA 2EIDA 3BB6A 2CU5A 2C5DA 3PL0A 3HNBM 4OZOA 4R4XA 4DXSA 1UWWA 5JWPA 2PN5A 2QDNA 3FHIB 2VBBA 1LEDA 4BHPA 4KI5M 3OG2A 3DPRC 4MLOA 4JKLA 5A7WB 2Q1FA 1LHOA 1KEXA 1QNWA 1QH6A 3ACFA 2JE8A 2VQ0A 3T08A 1NYWA 4UFLA 5CEHA 3VBRC 1S2KA 1QY4A 2E9QA 2R7EB 2WINB 2PHTA 3C8XA 1EYBA 1NQJA 4P00B 4JDMA 4QPGA 4QM8A 4RSUA 1Q8VA 1H0BA 5FBJA 2G4IA 3AK0A 3K48A 4LKDA 1JS9A 1A3KA 1MZ6A 5FFOC 4YZ5A 2J1TA 5EHDA 3VZJA 2VTXA 3EXUA 3I2DA 2ZA9A 3D5OA 4RFRB 3WQ0A 1SG3A 2QQNA 4RA0A 2WWUA 4N53A 5LRRA 5KR7A 5BXXA 3KMHA 1EAH1 2W92A 1QJEA 2WLPA 1KS4A 2Y60A 2K9ZA 1U5IA 2FMYA 4HG6B 2YMZA 3LIGA 4FTSA 1F9KA 1QXJA 1UZYA 2Z5WA 3GJAA 2P5BA 5JVVA 1S0DA 1UMIA 3MFCA 1EUUA 1UU6A 3POJA 3N9MA 3MUZ1 1BK0A 5C5TA 2VR4A 2RV9A 1JW6A 2PHFA 1HXS2 3J8F1 2WNVA 3TN92 4EN6B 4OUMA 4AQ6A 1VBC1 2HWE2 2R071 5GLZA 1BCXA 1VB4A 5FZ6A 5LCWL 4G4FA 3NKGA 4IEOA 5IVEA 2DF7A 2OYZA 2D6MA 4F83A 4FSJA 5CG8A 1U0AA 1S0CA 4HSJA 5GZDA 1R64A 2XG3A 5KHIA 2F4LA 2RDSA 1DGWA 4QQHA 2QUOA 1ZBA1 2YV8A 2ZX4A 3L9JT 4YVWA 1J3QA 3CIHA 2ENRA 5IHRA 1JYTA 1W2AX 1W2OA 2FDIA 1VRH2 5L7OA 4L97A 3Q8CA 2CDPA 1ZRCA 1LOFA 4M01A 3RJRA 1W90A 5FZGA 5T50A 4PLNA 3WDWA 3WF1A 3VKNA 4WV8A 1XNAA 1UNBA 5IVYA 4ZZ5A 1QJX3 3GHNA 4LORA 5C71A 2R0HA 2WQZC 5IYYA 3AKSA 2Y33A 1T6GC 4KBBA 3AL5A 4MSVA 1AYM2 1J59A 4UFHA 1V00A 3DEMA 4P02B 1AR73 2A6XA 1GZ9A 4LBQB 3TEXA 5HPOA 1MS0A 3VHNA 2VTFA 5A3OA 1AL0G 5A3TA 4CDWA 2DCTA 2E32A 1X7NA 4HONA 2CWMA 1UCXA 1K5MC 2Q1MA 4XVHA 5GALA 4IV1C 2OPWA 4CP9B 4DZGA 1G9AA 1S0IA 3OEAA 1I5ZA 2Y34A 3PU3A 3CO2A 2IVJA 4XFAA 3VDDA 4Y1YA 1V6IA 1WZXA 4UF0A 1UOFA 2Y0IA 1WKYA 1CJDA 5EV7A 2G9FA 1PVC3 2FQPA 2GP3A 1UZ0A 4JV4A 2VBPA 1M4WA 2W5FA 3TWIA 2QQJA 4K8RB 1RUE1 3KGZA 1HQNA 2GH2A 3CJIA 2WO2A 1W99A 4M0HA 4Q0UA 4QPIC 2VAUA 4Y1ZA 5FY9A 2ZMKA 4GB31 4QKDA 2WNUC 5EXOA 5CVRA 4AEKA 4XAAA 1R081 3MW3A 4BQWA 3ZPYA 2ZEWA 3GF6A 3NMBA 3H9AA 4GULA 3THPA 1BLZA 1REFA 3SQOA 1G86A 4L99A 2XB6C 3N9NA 4TLGA 1ODNA 3DECA 3ETQA 3U78A 3INAA 4DMIA 2ZMNA 4DIQA 4I01A 2NLRA 3EHKA 1KDKA 2YGMA 5CFCB 2EAKA 2IUWA 1QEXA 1PZ7A 5AC93 3KV9A 5I0TA 4I0BA 2DBIA 3O1UA 1CAVA 1PX3A 1VR3A 2R32A 3PHMA 5KHJA 1GWMA 4JHTA 4FPOB 2YBPA 2ZHNA 1PZ9A 1Y43B 1YEWA 2JG9B 3WW2A 3W5NA 4XYXA 1HX6A 4K6BA 4DOUA 1RUC1 5C3SA 2PHDA 1HRI3 4LBOA 5D8AA 4AAPA 4L11A 3IKWA 3VL8A 1MS4A 1W8HA 2V72A 2W1UA 3PVEA 3FX3A 4UFMA 3SCHA 5CIRA 5IK8A 2ZTNA 2ZABA 2XXZA 1UZWA 2ZACA 2VZPA 5I0UA 4XC9A 4MGKE 3PTRB 2ZCWA 2H0BA 3N9LA 1OUXA 5FV3A 1G8WA 1ND2B 2DVGA 2RS13 2ZZJA 1GBGA 1UKGA 2A3WA 3BALA 3DYOA 1HV0A 1CX4A 3VBSC 1JOPA 2V73A 4CSWA 4EZ4A 4BM8A 2P3IA 1FXZA 3N9QA 4WVMB 4MV2A 2BGPA 2XGXA 3D0JA 1EAH2 1C5HA 2W3JA 3EO6A 1GQHA 4FPGA 4YM2A 1BHGA 4XBQA 3IAQA 5FWJA 1OBNA 1UF2C 1JOBA 5KC5A 3HQRA 4ISRA 3VKMA 3JQWA 4LHSA 3OTFA 3ZR5A 1IS4A 3JBG3 3E5QA 5IATA 4YVSB 3N7LA 5TSWA 2XJQA 3WF0A 2ETEA 1X8MA 3I49A 4HZFA 5ISLA 1V0AA 4AVVA 1GMMA 4NE9A 1JZ8A 3KVBA 2R072 3JD72 4OMDA 1ZVFA 4Z8BA 3MPPG 1YRZA 4NWWA 4GH4A 4CCCA 1O3RA 4I02A 1TNFA 4QM9A 1US2A 2KD7A 2EXJA 3HQXA 3Q8FA 5C4WB 1JYIA 2WS92 4D69A 3RZLA 3WV6A 2L9LA 4CCEA 1JI6A 2JG8C 4CCOA 1POV3 2JDNA 2ZGOA 3M1HA 4AI3A 1UY3A 2CGPA 3AMPA 4CPBA 2ZGRA 4PT6A 4WM8C 2NMOA 1O4TA 5JMOA 4CDQC 2RVAA 2JE9A 1QF3A 1RUF1 1O3TA 4NHYA 4R8HA 3RRDA 4C90A 4FFHA 4ZPIA 5ACA3 2WFF1 5F9TA 3PMSA 1REDA 2UY8A 3M3EA 3WG3A 2ZGPA 5B4NA 3JXSA 4LLFA 3P5BA 2YXSA 2HBUA 1O59A 2BFUS 2FZ1A 4CCDA 4CRQA 1AX0A 5FZ0A 1S55A 1ZX5A 4CU9A 3PIJA 5E6HA 3URFA 1R1A1 1X36A 3T4HB 3ENRA 3B69A 3KF5A 5FKBA 4AF9A 4NRMA 1YIPA 3QOPA 3RYRA 5JZGA 3BOWA 2OW4A 2WBKA 3ZXJA 4LT5A 5LA2A 4YM0A 3NNLA 1XSQA 1IPSA 4OHWA 1Y9GA 5FZIA 4FP2A 1HRV3 2V5DA 2GMPA 5FUPA 4W6XA 3ZXLA 1UYXA 1JZ7A 1UY2A 4QGLA 1PX4A 1UZZA 3FFQA 4FOYA 5EFUA 3UKNA 3D0SA 3ORJA 1Y7BA 1RXGA 3B94A 4P9JA 3VBOC 1DQ4A 1LU1A 4KWJA 1MQTB 2D98A 1WBFA 2GZWA 2Y6KA 3J9SA 5LB6A 5BNOB 2HWD2 3WW4A 5LA1A 4OVEA 5G05L 2VOKA 3POFA 2VD7A 5FR3A 1ZRFA 2JD9A 1C4RA 3WP3A 4IQPA 1VBE1 1ZZ9A 4XPVA 1NLRA 3GNEA 3TOJA 3I97A 3ILFA 3AMHA 2WYSA 5J96B 4P9YA 1FI2A 1HJFA 5K7PA 3H3LA 2XJTA 2AZ5A 3KGLA 1PIV3 3S6PA 1YI9A 3HN3A 4FVVA 2QZ2A 3M3IA 5J36A 3VBHB 2P3JA 3AM2A 1XNTA 4IGOA 3OCPA 3VBFA 1RUC2 1VBD2 2VECA 2A6YA 1H30A 1LHVA 1ULPA 1U5XA 1UX7A 4YGCA 4BMEA 4HVQA 1GNHA 2VMGA 2HWC3 3H8UA 3LF7A 4FOVA 4CDUB 4IERA 2ZZQA 4Q4W3 2GMMA 2A6VA 1GQPA 5K0UC 4GMP0 1VE0A 5GZFA 2RS51 1GYKA 1PMHX 1L3JA 1JYWA 2D97A 3SCFA 3A4UA 5E88A 1Q56A 1O8SA 4FFFA 5EPAA 1XE7A 2KA3A 4NHXA 4LQRA 2E7QA 3USUB 4JGZC 3WNPA 4QHZA 2VVEA 4CP9A 5LA9A 1RUG1 4RFT0 4NIDA 1POQA 4JVAA 5FZCA 2WC2A 2BQPA 1ENSA 1PO12 1UOGA 5HXVA 2CTVA 5A80A 3ZXEA 3JCIA 1L7QA 1U12A 1ZZ7A 4YVSA 5A3NA 2GNMA 4Q27A 3U4SA 4A2UA 3SH5A 2Y6JA 4BMBA 3TEYA 3FMGA 1WUVA 3U07A 4XDQA 4C1XA 1IS6A 1MPXA 4IDZA 1WMXA 1JODA 2ZHKA 2GAUA 3C7OA 2Q30A 4LBKA 3WDYA 3ZN4A 1W6QB 3ZDSA 1BKZA 1H2NA 2VZRA 4XJAA 2ORZA 3ECQA 4AFBA 3U4XA 1MS8A 1ZBE1 2JECA 1AR63 3AKQA 3OGSA 4JZRA 4WVVA 3T2PA 1RUI3 4IE0A 5J7MA 4RD7A 1UYZA 2Z69A 1US3A 2C4XA 4XF4A 1R093 2X05A 4EZHA 3OD4A 5A3MA 4RS5B 4N7UA 3UYJA 4DEQA 2XBO3 1NCQA 1UU5A 2TUNA 2GP5A 1OKQA 2ZX1A 3VBUA 2OA2A 1PK6B 3GHMA 3T0BA 2O0OA 4GJZA 4E8CA 3DGTA 5A7OA 3EBRA 2RG4A 5IAXA 1W8WA 1LCLA 1V6LA 3HBKA 2H0VA 2RMU1 3BU7A 3ZKYA 2QBXA 1CWPA 1HW5A 2JEMA 3BPSA 5CFDB 2ZX0A 2VNOA 4KGGA 3S5QA 1BEV2 3HAGA 5JOXA 1GWKA 1RHI3 5H9SA 1RUF2 5FYIA 2PAEA 3HNMA 4WVZA 4AEDB 3IT8A 1LEMA 3NW4A 2BFUL 4OUSA 3OY8B 1JYVA 2ARCA 4BXFA 1OPOA 2WFF2 1AZDA 2E53A 4LITA 3LZZA 3H8OA 2A71A 3L2YA 3WOGA 4LPLA 3EMRA 5DAPA 4A7KA 5JOYA 4D6SA 4PQQA 1W6OB 2YY1A 4XDPA 4M4RA 2I74A 4NPLA 1KJLA 4QU2A 5F3EA 4EWAA 2Y6LA 5EJZB 3LDBA 4ZY9A 1R1A2 3WF2A 3BOPA 5ANNA 5FZOB 5K9YA 4HT1T 1UN1A 1UYYA 4I0AA 2ZKNA 3RWNA 5G04L 2ZGLA 1JU3A 3I3EA 3K3NA 3FN9A 4XQ4A 2CSGA 3Q9OA 2DYCA 5E8AA 5FP8A 3ZXFA 4Q1RA 3SMHA 2B4KA 5LBFA 2R061 3FL7A 4O9GA 3ALQA 5FO9B 4B4QA 4XMAA 5E89A 3MLKA 3N9PA 4U36A 2Y8KA 2WNEA 4RHV1 1IQAA 4IV3A 1MQTA 5C3RA 3DF0A 5C33A 1C57A 2JDMA 3SH3A 1NG0A 2QQMA 1QJU1 4H14A 4JRAA 5KHKA 1T6BX 2IWGB 4JTOA 3NNGA 2V09A 4FXGB 5FMBA 5F3CA 4ONUA 4BIFA 1EY2A 1J84A 1NZCA 3HBZA 4AHZA 3W58A 3MW4A
chains in the Genus database with same CATH topology
4XACA 5EPAA 4NHXA 4Y5TA 5LA9A 2Y33A 3HQUA 4XCAA 3KT7A 5LATA 2V4AA 4J25A 5HV4A 5L9BA 5L9VA 5LBEA 4XABA 5DAQA 3KT4A 4NAOA 5DAVA 5C5UA 2OPWA 2Y34A 2FCTA 4JZRA 2RDQA 4NHYA 4BQXA 3PL0A 2JIGA 4ZPIA 2FCVA 3NNMA 5DAWA 2RDNA 3W21A 3OUHA 5A3UA 4NHKA 2HBUA 4XAAA 5LBBA 2RG4A 5IAXA 4BQWA 3KT1A 5ERLA 2FCUA 5M0TA 5L9RA 2JIJA 4IW3A 4MHRA 3OBZA 3NNFA 3MGUA 3NNLA 4KBZA 4UWDA 3GJBA 3OUIA 3EMRA 5DAPA 2RDRA 4NMIA 2A1XA 4XCBA 5LB6A 5IAVA 5LASA 3GJAA 5LBCA 3DKQA 3BVCA 3GZEA 4NHMA 3NNJA 5EP9A 4XC9A 4BQYA 5EQUA 5C5TA 3ITQA 2HBTA 5LBFA 4Y5SA 3W20A 3OUJA 5HV0A 4ZONA 4Q5OA 5DAXA 3HQRA 2G1MA 2RDSA 5IATA 4MHUA 2G19A 4NHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XAC A;  5EPA A;  4NHX A;  4Y5T A;  5LA9 A;  2Y33 A;  3HQU A;  4XCA A;  3KT7 A;  5LAT A;  2V4A A;  4J25 A;  5HV4 A;  5L9B A;  5L9V A;  5LBE A;  4XAB A;  5DAQ A;  3KT4 A;  4NAO A;  5DAV A;  5C5U A;  2OPW A;  2Y34 A;  2FCT A;  4JZR A;  2RDQ A;  4NHY A;  4BQX A;  3PL0 A;  2JIG A;  4ZPI A;  2FCV A;  3NNM A;  5DAW A;  2RDN A;  3W21 A;  3OUH A;  5A3U A;  4NHK A;  2HBU A;  4XAA A;  5LBB A;  2RG4 A;  5IAX A;  4BQW A;  3KT1 A;  5ERL A;  2FCU A;  5M0T A;  5L9R A;  2JIJ A;  4IW3 A;  4MHR A;  3OBZ A;  3NNF A;  3MGU A;  3NNL A;  4KBZ A;  4UWD A;  3GJB A;  3OUI A;  3EMR A;  5DAP A;  2RDR A;  4NMI A;  2A1X A;  4XCB A;  5LB6 A;  5IAV A;  5LAS A;  3GJA A;  5LBC A;  3DKQ A;  3BVC A;  3GZE A;  4NHM A;  3NNJ A;  5EP9 A;  4XC9 A;  4BQY A;  5EQU A;  5C5T A;  3ITQ A;  2HBT A;  5LBF A;  4Y5S A;  3W20 A;  3OUJ A;  5HV0 A;  4ZON A;  4Q5O A;  5DAX A;  3HQR A;  2G1M A;  2RDS A;  5IAT A;  4MHU A;  2G19 A;  4NHL A; 
#chains in the Genus database with same CATH topology
 3OPT A;  1BMV 1;  4RN5 A;  1SLI A;  5I91 A;  3OF1 A;  1NE4 A;  1ULD A;  3SXW A;  1POV 0;  4KMQ A;  4QPG C;  5ABJ C;  3EQE A;  3POS A;  4IEV A;  4MGZ E;  1SFP A;  3H42 B;  4QGN A;  1O5L A;  2QQO A;  1J3P A;  4QX5 A;  3U11 A;  3UES A;  4CU8 A;  2WL1 A;  4AGG A;  1EPZ A;  1O7F A;  3RFR A;  5FZK A;  1KXG A;  3K2O A;  1AXZ A;  4N53 C;  4PDW B;  5DDJ 3;  4E4Z A;  2PTM A;  4OMC A;  1W28 A;  3H1M A;  3S30 A;  1T2X A;  2QQL A;  3V64 A;  2K0G A;  1S0E A;  2OXB A;  3CBN A;  3E5X A;  3SNM A;  2RS5 2;  2VNG A;  1XE8 A;  2P6C A;  1S2B A;  3MV0 1;  4Q4V 1;  2CGO A;  2HEW F;  3USU A;  4AWD A;  3N7M A;  1V6M A;  5F32 A;  5F2S A;  1DYO A;  5FZE A;  5A32 B;  5DMY A;  1RUN A;  3UGF A;  4AEJ A;  4TN7 A;  3O12 A;  1OHF A;  5BNN B;  3T2T A;  3P3N A;  5CBL A;  3RZM A;  4P5H A;  4AVC A;  1JXN A;  4ATE A;  1S0F A;  5A6Y A;  1LOG A;  2HJI A;  4CPB D;  4PLM A;  1MEC 3;  4E4S A;  2QQV A;  2VTX J;  5LBB A;  3B7M A;  5FK7 A;  4E2G A;  3BOD A;  1UMZ A;  3RI8 A;  1OOP B;  2WRA A;  1GIC A;  4WVW A;  2W87 A;  3BPZ A;  1WD4 A;  3ZYF A;  2WZ8 A;  1RUJ 3;  1U5Z A;  1ZBE 2;  3LDR A;  4IW3 A;  1VBB 2;  4YVW C;  4ZS2 A;  1FX5 A;  4E4D X;  1RMU 1;  1OA2 A;  1NCR C;  2RM2 3;  2VBD A;  3HEI A;  1EPW A;  4QDS A;  2WA4 A;  3MW2 A;  4LBQ D;  1DZR A;  1PGL 2;  4ZHN A;  2VUD A;  4KU8 A;  1SBD A;  3O1R A;  3OPW A;  4Z92 B;  2CNA A;  3TRS B;  5C9A B;  4AK3 A;  4PIX A;  5FIX A;  5FPZ A;  2R49 A;  1CX1 A;  2IXJ A;  4H7L A;  5H9P A;  1F5F A;  2RMU 2;  1QKQ A;  1VMJ A;  1NAE A;  2XL9 A;  3B5L B;  1A34 A;  5CFD A;  4GXL A;  3ZOI A;  4GZ9 A;  1K45 A;  3GDB A;  4UFI A;  3WG4 A;  3GZE A;  4E9K A;  3OGJ A;  2BYV E;  1OLQ A;  5FZD A;  5JSP A;  1OXC A;  2VUL A;  4CDW C;  3ON7 A;  2D5F A;  3OY8 A;  5CB7 A;  4PI2 A;  3ZMN A;  4CP1 A;  3AYD A;  4NRP A;  2WAA A;  3GZU C;  5CNA A;  1ENX A;  3CL1 A;  1I3H A;  2YC4 A;  2ZAA A;  4CTE A;  3RVH A;  2JDU A;  1D0H A;  5JAX A;  2ZS6 B;  4C91 A;  1F35 A;  1RB8 G;  2LRP A;  2WNV B;  5HV0 A;  1W6O A;  4FT8 A;  4QAW A;  4BQ4 A;  1UOB A;  1UOJ A;  5FZO A;  3CJI C;  4AI9 A;  2D3S A;  1DGR A;  4LIU A;  1CAX A;  1F4A A;  4YM3 A;  1QJF A;  2WT1 A;  5SV5 A;  1Z7S 1;  4AVT A;  1QGL A;  2WO1 A;  4M4P A;  4Q4X 3;  3A0K A;  4X6Q B;  2QQU A;  2QCS B;  1BBT 2;  5JIA A;  1VMH A;  2QJV A;  5F2W A;  2J1U A;  3M2M A;  5A70 A;  4ZU5 A;  4D7Y A;  2CHH A;  3GCW A;  5FPA A;  5L7O B;  4MGQ A;  4UBG A;  1UZV A;  5F6K A;  1G6N A;  3FLT A;  1C1F A;  3PNA A;  4RHV 2;  1H6Y A;  2WT0 A;  3B9I A;  1FPN 2;  2ZGK A;  3QCW A;  3R05 A;  3M3C A;  4YG6 A;  4KGQ A;  4YZ1 A;  1WGP A;  3WNX A;  3IB3 A;  4AE2 A;  3A21 A;  1NUK A;  1QJU 2;  3C7F A;  3I59 B;  4PQ9 A;  2XLF A;  2NPI A;  1UD1 A;  2ILM A;  1J3R A;  1ULG A;  4RQP B;  2VH9 A;  3SEE A;  2VVD A;  3ZX7 A;  1AYM 1;  4A42 A;  2VO5 A;  3A22 A;  5T3N A;  4BXS V;  5L19 A;  1ULC A;  4YW2 A;  1I5P A;  1V6J A;  3C7G A;  1CQ9 A;  5I8Y A;  3GBG A;  1B35 A;  2IFR A;  2DWR A;  4QXK A;  2IVI B;  5DAV A;  1W06 A;  2VNV A;  4IE7 A;  5FZ9 A;  5BNQ A;  5I0R A;  1BMV 2;  1PO2 2;  1V9U 3;  5CIS A;  4F8A A;  3RYP A;  2ZEY A;  3LSD A;  2W94 A;  1OQ1 A;  1W04 A;  2WAO A;  3FBM A;  4CP0 A;  1G7Y A;  5L36 A;  1YI7 A;  5AFE A;  2B5H A;  4FPL A;  4XMI A;  1JYC A;  3CNA A;  3VDD B;  4CCK A;  1QJY 3;  4UF0 B;  5FJH A;  2VZQ A;  4JKK A;  3DYP A;  4OQ9 A;  3RGB A;  4Q8K A;  4CUC A;  2W46 A;  1A8M A;  3T0D A;  4Q4Y 2;  1XU1 A;  1MR5 A;  3NO8 A;  5FUN A;  4CEY A;  3ZN6 A;  4FTE A;  2WLQ A;  2XON A;  4XFC A;  3ZSE A;  4BK5 A;  5ERL A;  5JSR A;  3TEZ A;  4QPY A;  4JCK A;  1FAY A;  1LES A;  2UUR A;  1COV 3;  2HWF 3;  1GOG A;  4Q4V 2;  3WCS A;  4DO0 A;  3QH6 A;  4B4R A;  4BIO A;  4COV A;  1JHJ A;  3JB4 C;  2ZX3 A;  1KS5 A;  3ZYP A;  2YZ4 A;  2XH6 A;  1W9F A;  3NNF A;  1GZW B;  4DS0 A;  4FPC A;  1UL9 A;  4KH9 A;  3FUQ A;  1APN A;  4LA2 A;  5BNN A;  3I7D A;  2ZGM A;  2EXK A;  2UWA A;  3N9O A;  4UWD A;  1RGS A;  5LRS A;  1LEC A;  2JDY A;  1ZRD A;  4R9B A;  1CAV B;  2FBE A;  2EIC A;  1HB1 A;  1OUS A;  3RMX A;  4BDV B;  2MNG A;  4XJZ A;  4D7S A;  4EN7 B;  1J58 A;  2D43 A;  2BNM A;  2JXA A;  5DQ0 A;  4P9I A;  1OOP A;  3WUD A;  3CHX A;  3LFI A;  2WA3 A;  3WDX A;  4M3C F;  3ACH A;  5IVV A;  2J42 A;  3O1T A;  2HWB 1;  5D8A B;  2VW2 A;  5CAD A;  3T0A A;  5F39 A;  3VKO A;  2CGN A;  1UPI A;  1RMU 2;  5F1R A;  1FMD 2;  1CD3 G;  2FDK A;  4NWV A;  4RGK A;  5F5Q A;  5T5L A;  3WIN E;  5HI0 A;  4BPZ A;  5KXC A;  1JZ3 A;  5C70 A;  1XNK A;  2HBT A;  4GQ7 A;  4S2D A;  5FZ7 A;  5FLI A;  5C9A A;  1OH3 A;  1KIT A;  2QQK A;  1TME 2;  4LOT A;  3WUC A;  3HVD A;  1G9C A;  1YQ8 A;  5FYB A;  2JIC A;  2WJS A;  3TN9 3;  1W2T A;  5DAX A;  3R6S A;  1C8M 2;  1OF4 A;  3WNM A;  3ZO0 B;  1N3O A;  4UW5 A;  4UI9 L;  2VC9 A;  4DUV A;  1CJP A;  1MZE A;  3ACL A;  4MHU A;  5F5A A;  5C8C A;  5AVP A;  5K8S A;  4KG0 A;  2QQP A;  2NM1 A;  1WW6 A;  1LHU A;  1PNG A;  5C3P A;  2PLV 3;  4NRQ A;  3IDE A;  5ANQ A;  5FXW A;  1JZ6 A;  2EF6 A;  4Y1X A;  1QQP 3;  4QX3 A;  3RPQ A;  5C6C A;  1X8E A;  2DCY A;  3LGR A;  1VRH 3;  1LU2 A;  4K40 A;  3JD7 1;  4RL7 A;  1UXX X;  1IOA A;  1UKR A;  3DL3 A;  3IPV A;  1V6K A;  3LEK A;  4XF3 A;  3WX5 A;  5JXG A;  1QH7 A;  5FYS A;  1VAK A;  2VZS A;  4GH4 B;  5A1L A;  3RZG A;  3NL1 A;  3LEG A;  5JPN B;  4K7J A;  4D6Q A;  1JZ4 A;  2WS9 1;  4J25 A;  2FMD A;  4O65 A;  4B3N A;  4OUL A;  1Z7S 2;  1HQL A;  2ADE A;  4R52 A;  1ZZ6 A;  2KR2 A;  5DAQ A;  2RS1 1;  4O61 A;  5C3Q A;  3AX4 A;  4I2O A;  4Z82 A;  3R4U A;  4QKN A;  4QX2 A;  2A6Z A;  4YZ4 A;  4CU7 A;  3AJZ A;  1CIW A;  5CFC C;  1AVB A;  5LZ6 A;  4BQ2 A;  1NQD A;  3VHR A;  4V1P A;  3QH7 A;  4Y4R A;  4O9E A;  4P9L A;  1Y9M A;  2P17 A;  1LHW A;  3I59 A;  4M00 A;  4AHX A;  2ZX2 A;  2FCV A;  3FE5 A;  3BI3 A;  2LTN A;  3DYM A;  3NNM A;  4RQP A;  2MEV 1;  4ISQ A;  5DAW A;  5J98 B;  4CDX A;  2JG9 C;  4GMP 3;  4Y4Y A;  3KCC A;  4XIL A;  1W3V A;  2QNK A;  4K20 A;  1IS3 A;  2F17 A;  3LKJ A;  4AVS A;  4AQS A;  5GLW A;  4SLI A;  1QU0 A;  2FDG A;  3GXU A;  3AC0 A;  4Q0S A;  2VUA A;  4KQ7 A;  4JQT A;  2CDO A;  4MHR A;  5DG2 A;  3AFG A;  1W6M A;  1ND2 C;  4G3Y C;  4H7M A;  1HB3 A;  1OD5 A;  1IKP A;  2GN3 A;  1FT9 A;  5JZG B;  4XET A;  4A3Z A;  5DAB A;  1UQX A;  5T5J A;  1IGO A;  2E7A A;  5IWF A;  5FZM A;  4LE3 A;  4A41 A;  3WF3 A;  3HNY M;  4QT6 A;  2VZU A;  5DZE A;  4A45 A;  3MZH A;  1ASJ 1;  3NAP A;  2VZO A;  3LA3 A;  1DHK B;  5FQ0 A;  2YHJ A;  1OF3 A;  3I3B A;  3AYC A;  5FY7 A;  5LAS A;  4YVS C;  1QJX 2;  1F8V A;  1HN0 A;  3KCX A;  2HWD 1;  1AX2 A;  1GZW A;  3MF6 A;  3ZR6 A;  1LHN A;  2X5I A;  3WXP A;  5GKA C;  1O5U A;  3ZSJ A;  3KZ4 C;  2J1A A;  4RGG A;  4L0P A;  3AVR A;  1H1M A;  1VP6 A;  2AUY A;  2FDJ A;  1KQR A;  3IZO A;  4XEZ A;  1WCK A;  4ES8 A;  4BB3 A;  1SCR A;  2ARX A;  2F4P A;  2AC1 A;  3WDV A;  5FYY A;  3LFM A;  2D3P A;  5C4W C;  4Y22 A;  4AI8 A;  4CYD A;  4F3J A;  5FYC A;  2P2K A;  1NA1 A;  2R0F A;  4LEJ A;  3VBF B;  1WME A;  1SLB A;  1VBD 1;  4COZ A;  1YQ2 A;  3KV6 A;  2HWB 2;  2OUH A;  4FAH A;  1ZM1 A;  4UW6 A;  1EAH 3;  3LPF A;  1RUH 1;  3KVA A;  3GCX A;  3UJO A;  2UYB A;  4AGR A;  4JX0 A;  5IVB A;  3ZYR A;  5FO8 B;  2NMN A;  5IFT A;  3OJB A;  4Z07 A;  3MPB A;  3OBA A;  3ZN5 A;  4TLF A;  4B4P A;  2BW8 A;  3UET A;  1NXD 1;  1ZA7 A;  3GZA A;  4E27 A;  4BK4 A;  3PDQ A;  1WCQ A;  3J8F 3;  1PZ8 A;  1HQW A;  5GLT A;  2VMI A;  3L2H A;  4L92 A;  1LAJ A;  2PYT A;  4XJ8 A;  5J09 A;  1VBC 3;  2R07 3;  4NIH A;  2ZGT A;  2EXI A;  5FRA A;  1F2N A;  1UW8 A;  2O14 A;  1W8F A;  4IEU A;  1PO1 1;  1PMI A;  2GC2 A;  4HPK B;  5AC9 2;  4CEW A;  3CQO A;  1H8T A;  1ULE A;  1VIW B;  2PHR A;  4M0N A;  1PIV 1;  4XBN A;  1ZBA 3;  4OLL A;  5DG1 A;  1XYP A;  4XZP A;  1ZZB A;  3IDC B;  4WM7 B;  3VGI A;  4A7Z A;  1JMU B;  1ULF A;  1H1I A;  1HRI 2;  5F37 A;  4DB5 A;  4N9I A;  3JB8 A;  3WQB A;  1C1L A;  4D94 A;  2OKX A;  5FKC A;  3T2Q A;  4HFS A;  4OI0 A;  1BJQ A;  4QU1 A;  2RDN A;  3I2I A;  3CEW A;  3MEP A;  3ZMO A;  3MV1 1;  5IK7 A;  1PM7 A;  4CP2 A;  1NCQ B;  5DUX A;  4AFA A;  3VBU B;  1MQT C;  4BU2 A;  1WLC A;  1ZRR A;  3OGR A;  2DVD A;  2TNF A;  3KT1 A;  2RS1 2;  3HMY A;  3ZKU A;  5BNO C;  1DF0 A;  1IG3 A;  3ZFE B;  2JIJ A;  2P4E A;  1X9P A;  2D3R A;  1W03 A;  2C24 A;  5B2G B;  3MIF A;  4GWJ A;  4OHY A;  5GLU A;  3CMG A;  3ABZ A;  1Q3E A;  2VVF A;  3LEM A;  1EV1 3;  1BEV 1;  3DPR A;  4Q0V A;  1GZC A;  4NR1 A;  4BLI A;  3M4F A;  2IXH A;  3ATG A;  3FLR A;  2MEV 2;  3PJY A;  1YYN A;  2R16 A;  3VBH C;  1PNF A;  1IS5 A;  2A1X A;  1DP0 A;  2BUK A;  4K9S A;  4B7E A;  1RUE 3;  2BGO A;  3AB0 A;  4XCB A;  4P9X A;  4XZU G;  4YZ2 A;  4LUK A;  4FPJ A;  2CAV A;  2SLI A;  4GB3 3;  4XUN A;  4CDU C;  4NAM A;  4R9C A;  1R08 3;  5FDB A;  5D21 A;  1C28 A;  2YFU A;  1XSR A;  1NLS A;  4Y1V A;  1A78 A;  4CUB A;  2RJK A;  4IE4 A;  1N47 A;  3AP4 A;  1LOC A;  2XBO 1;  1YQ5 A;  1AJK A;  4QGM A;  4ZXE A;  2NN8 A;  1RC6 A;  1WA6 X;  3BCW A;  4LIV A;  2AEN A;  4A44 A;  1FV3 A;  3I3Q A;  4URT A;  2PHX A;  3RMY A;  4AOC A;  1ASJ 2;  3E97 A;  1AL2 1;  4LO4 B;  2DU1 A;  2Q0A A;  1XJA A;  4MUV A;  2VZV A;  3HWJ A;  4IV3 B;  3V0B B;  2B45 X;  1N1S A;  1WW7 A;  4FFG A;  2OPK A;  4FPY A;  1F5J A;  2OT7 A;  3ZXG A;  1W3X A;  4FQZ A;  3ZXK A;  3M7A A;  1B09 A;  3TNQ A;  1D0G A;  3O0V A;  1VAV A;  4W6W A;  5HCB A;  1ZRE A;  3CJX A;  2CAU A;  2C26 A;  2WZP P;  3DV8 A;  3BGA A;  1J1L A;  2OS2 A;  3KQR A;  2PFW A;  4ARX A;  5FZL A;  3SCG A;  5LA0 A;  1RIR A;  3J7H A;  4MGY E;  3UK9 A;  2R1B A;  3TBD A;  4RS5 C;  2A3X A;  2J7M A;  3H3U A;  1MZF A;  5IVJ A;  5A3P A;  1YJL A;  1PK6 C;  1W6P A;  3Q8E A;  2W1W A;  2V4A A;  3P1I A;  4DNY A;  4OCT A;  5KBF A;  1RUH 2;  3E6D A;  1DGW X;  2VGD A;  3VUO A;  4OHX A;  4BA6 A;  3UV9 A;  3WSO A;  1HRV 2;  1UY1 A;  5CFD C;  4NO4 A;  3QD6 A;  2DCZ A;  2ES3 A;  3MO4 A;  4XIK A;  5KHH A;  5LY1 A;  2XPJ A;  2ET7 A;  2DVA A;  4YLZ A;  2H6B A;  3EB7 A;  3VB9 A;  5HBA A;  4XFG A;  1RVF 3;  2DDU A;  2DUO A;  2RDQ A;  3IAP A;  3LOI A;  2GAL A;  4LUM A;  4AED C;  4C1W A;  4OQ8 A;  1GSL A;  2R04 1;  4KWK A;  3BUC A;  1SLC A;  2VU9 A;  1MS1 A;  2W1S A;  1I9R A;  1WLT A;  5A1F A;  1OFN A;  5FZ3 A;  2VUC A;  4QWN A;  3NST A;  5E16 A;  5EYY A;  3W5M A;  3ES4 A;  4HPK A;  3M3O A;  4EV0 A;  1SZB A;  1UY4 A;  3OUH A;  2Y64 A;  1WMD A;  2PEL A;  5B4X A;  2WQ4 A;  1Z78 A;  1LOE A;  4K21 A;  1YXW A;  1W2N A;  4IV1 A;  3LPG A;  2EAL A;  4N9H A;  1PIV 2;  4MVT A;  3VD9 A;  4ZKT B;  1AR9 1;  1BYH A;  2GND A;  3PUQ A;  4HKO A;  4XJ9 A;  4QX1 A;  4WM7 A;  2G9G A;  1IHM A;  3H7J A;  4FI9 A;  2OUJ A;  1SFY A;  2VQA A;  4FPE A;  5C3O A;  3NVC A;  4OHZ A;  3VZK A;  5JIU A;  4NVP A;  4XJW A;  2EA7 A;  4FBF A;  1W8U A;  3H0O A;  4TSV A;  3QBQ A;  1VBB 1;  1VBA 1;  4XUO A;  1KRI A;  1O91 A;  1UPS A;  1JUH A;  1AJO A;  5DZG A;  5JDB A;  1W2U A;  4QPI A;  4YGE A;  2HWC 2;  3HJR A;  3D8C A;  3OUI A;  2WNU A;  3USS A;  5DDJ 1;  3LB9 A;  1PGW 1;  4GJY A;  1RUF 3;  4Q4W 2;  4RYD A;  2XJV A;  5F8P A;  5HCH A;  1PGL 1;  3O0W A;  5FJK A;  4LLO A;  2DBN A;  3HPN A;  4YW5 A;  4Y33 A;  2ORX A;  2RJL A;  2E6V A;  2WFF 3;  4QKB A;  1OQE A;  3ZFE A;  1X33 A;  3OBT A;  4YGD A;  4MYE A;  3VKL A;  1U5Y A;  2Z4F A;  3H50 A;  3KHB A;  3IMN A;  3ZDV A;  2LRO A;  3D3A A;  2YC0 A;  3AXE A;  3RNS A;  2X53 S;  1CON A;  2XJR A;  5EQU A;  3CKH A;  3ITQ A;  3N7K A;  3VZN A;  3OGV A;  2JB8 A;  2VQU A;  5FXZ A;  2VMD A;  1XYO A;  2XLA A;  1X82 A;  4K1Y A;  1LNS A;  2YBS A;  3C7H A;  2VQT A;  4AFC A;  1XB9 A;  2A7A A;  2WKK A;  2ZJC A;  3NQH A;  4GA9 A;  3T3Y A;  1GAN A;  1LUL A;  1W6N A;  1PGS A;  3N3H A;  2AEZ A;  3MUY 1;  3O0X A;  5LEJ A;  5JXJ A;  4PDW C;  2OQ6 A;  1AR6 2;  3AP7 A;  3ELN A;  1RUI 2;  1URX A;  4YYO A;  5LEK A;  1YO8 A;  3UNP A;  4ZXK A;  2G19 A;  2RM2 1;  3OEB A;  1Y4W A;  5BY5 A;  5JOW A;  4KL1 A;  3T2O A;  1SDD B;  1LOB A;  2BV4 A;  2XBO 2;  1CAX B;  2PQS A;  1DZQ A;  4AFM A;  4DXR A;  5KC6 A;  1Z0H A;  3VBS A;  2A73 B;  2VMF A;  3RWK X;  4AHY A;  1PMJ X;  1BBT 1;  1VBE 3;  1S1A A;  4Y24 A;  1TG7 A;  2N7G A;  1ZA4 A;  3E6C C;  2XR4 A;  2UU8 A;  5FYT A;  2GME A;  2XUM A;  3U0Z A;  5BNN C;  1AL2 2;  4MX3 A;  1L7R A;  3MBW A;  1DU3 D;  4FPK A;  4LOS A;  1FNY A;  2JDP A;  2D93 A;  1FPN 1;  4LNV A;  3V0B A;  1CR7 A;  4Q2F A;  1DLL A;  1H2M A;  2CV6 A;  1HB2 A;  3I2H A;  3K77 A;  3WF4 A;  2P34 A;  3BKZ A;  3WG1 A;  5FLH A;  4K3U A;  1TNR A;  4MO3 M;  4UT5 A;  2XJU A;  1RUD 1;  1OOP C;  1TMF 1;  3V0A A;  1LR5 A;  1XE0 A;  2W9X A;  3I2K A;  2RS3 3;  1C5I A;  2WQ8 A;  1B35 B;  4B1M A;  1NLQ A;  4IXL A;  4N43 B;  1PO2 1;  2J22 A;  2AR6 A;  1F31 A;  2J1S A;  2YU1 A;  4Z2W A;  3OGG A;  5FBZ A;  2RS5 3;  4Z1V A;  5A33 B;  1NOV A;  2JG8 A;  1XYN A;  5F3G A;  1SBE A;  1OT5 A;  1VAM A;  2YPJ A;  2ZKL A;  4H3W A;  1EUT A;  1HDK A;  2VZT A;  1RUG 3;  5T5O A;  3ZFF B;  5C9A C;  2HEV F;  3A7Q A;  5FP9 A;  4XTP A;  1KD7 A;  1SHW B;  4Q4Y 1;  2J1E A;  4CDQ A;  1E5R A;  4NUB A;  5A7P A;  4CEY B;  5CKN A;  3ZN6 B;  4B7K A;  2A3Y A;  4S2H A;  4IGP A;  2LW8 A;  3GM8 A;  1GWL A;  4JDO A;  5FYM A;  3WNO A;  2V4V A;  4YRD A;  4MGT A;  3POY A;  3KHC A;  2R04 2;  4D6R A;  1VAL A;  4IET A;  3CLP A;  2ADD A;  2JWP A;  4MH0 E;  1BXH A;  1ZBE 3;  1MAC A;  3GJB A;  2V5Y A;  4R9D A;  5A7Q A;  2QFE A;  3LOB A;  2HYX A;  1D4M 1;  4PF1 A;  1DQ5 A;  1VMF A;  1OA3 A;  2OZ6 A;  1SCS A;  2WNV C;  2YFZ A;  3I54 A;  1PM4 A;  2RDR A;  4JDN A;  3VKF C;  1DLC A;  3AYA A;  4FPF A;  4QB1 A;  3WG2 A;  1JZ2 A;  5FAX A;  3I3M A;  1DIW A;  4OYU A;  3CDZ B;  1AR9 2;  1BZW A;  3WQ7 A;  4BQ3 A;  2Z79 A;  2SBA A;  2VL4 A;  2K2S A;  3BVC A;  1AX1 A;  4NHM A;  3NNJ A;  3P3P A;  3CZJ A;  3DUI A;  1AR8 3;  4W65 A;  1NY7 1;  1NZI A;  3UKT A;  2Y6F A;  4SBV A;  1VBA 2;  3WDT A;  3AZW A;  5LK5 A;  2GC3 A;  2FDF A;  1KDM A;  2C1F A;  1W0O A;  3ZLI A;  1UY0 A;  1QHD A;  1FMD 1;  1XRU A;  1Y3T A;  2IFW A;  4UBH A;  4QHO A;  1PGW 2;  5DDJ 2;  1LOF C;  5GJ6 A;  5L7O C;  5JUV A;  4UXA A;  3VBO A;  1MS9 A;  4OZX A;  2GC1 A;  3WZ1 A;  1W9W A;  1TME 1;  2BWA A;  1BK1 A;  3AZV A;  4RQP C;  3O1S A;  3J4U H;  2JDZ A;  4A7Y A;  1IPK A;  2Y38 A;  1RYY A;  5LY2 A;  2B42 B;  4AG4 A;  5T55 A;  1C8M 1;  4IEQ A;  3PVO A;  4J1X A;  4F7Z A;  1LOD A;  3NJX A;  3I2F A;  4NHL A;  5FPL A;  3V56 A;  4Z2A A;  3MIC A;  4EN8 B;  5C8C B;  4HAN A;  2LS6 A;  3WNN A;  1ZRI A;  2HLE A;  4EWE A;  3ZYI B;  1MEC 2;  4QXB A;  4LHN A;  5I0S A;  1XXN A;  1ULO A;  3O1P A;  2G9Z A;  4Y5T A;  5I8S A;  2XWB B;  4CE8 A;  1YLL A;  1CAU A;  1SFN A;  2BZD A;  1WWY A;  3FHA A;  4YG3 A;  1FOD 3;  5DZF A;  5FXV A;  3VDD C;  3LQC A;  4H2A A;  3VD7 A;  2R06 3;  5FZA A;  2BTV C;  3KT7 A;  4I30 A;  1H9W A;  1RUJ 2;  4IGQ A;  3VDC A;  2X8K A;  3IPV B;  2VMC A;  4RHV 3;  1S4C A;  2Q8E A;  3O1O A;  5C7G A;  1FV2 A;  2R30 A;  2ZGN A;  5IVC A;  3K4Z A;  4UFK A;  2RM2 2;  4PIY A;  4LTA A;  4W8J A;  3O14 A;  3D82 A;  1QJU 3;  3AP5 A;  2YU2 A;  3BTA A;  2ID4 A;  4ARY A;  5EYX A;  2X09 A;  3ME2 A;  4JGZ A;  4KG8 A;  1QIQ A;  3VHP A;  2DCK A;  2JEN A;  3ZPO A;  1AYN 3;  4G9S B;  1AXK A;  2Z2S B;  4GWN A;  4XAE A;  2JKX A;  3SIS A;  1CZV A;  2OII A;  4V2W A;  4B1L A;  4DIN B;  5H9R A;  5JMC A;  4ATF A;  5AFB A;  2RR1 3;  2HYK A;  1JOJ A;  4FP3 A;  1OI6 A;  3NJZ A;  4GKY A;  2D6P A;  4Q1P A;  3VDA A;  4FXK B;  4AVB A;  4NIG A;  1RUD 2;  1UAI A;  5APA A;  1TMF 2;  4CDX B;  1D4V B;  1YFU A;  2WZR 3;  3P6B A;  1C8N A;  4PLO A;  5L9R A;  4DXZ A;  2PLV 1;  3AKR A;  5FY1 A;  5D8A C;  5BNP B;  4FFI A;  4N43 A;  1Q8O A;  3N7J A;  2W47 A;  3OB8 A;  3AKP A;  2XWJ B;  3O7O A;  1Q8P A;  1CGP A;  1S0B A;  4OI4 A;  4LHL A;  5A33 A;  4JGY B;  4ES9 A;  1NE6 A;  2KM2 A;  4Q4V 3;  1W6M B;  3TAY A;  1QXP A;  1RJ8 A;  4PJY A;  2C9K A;  5FPB A;  3ZFF A;  5FZ1 A;  3ILN A;  4QDQ A;  4XF9 A;  4XUP A;  4LO6 B;  1WBL A;  1C3H A;  4MXV A;  5JR7 B;  3RJ2 X;  3RZH A;  1XND A;  1W8O A;  5BUV A;  3PUH A;  4CXY A;  2UWC A;  1VB2 A;  3WEZ A;  2ZHL A;  1O6U A;  2FZ2 A;  3NAP B;  2GH8 A;  2EIG A;  5LBC A;  3MYX A;  1P8J A;  2BER A;  2E7T A;  3DKQ A;  5FMC A;  3B02 A;  5EP9 A;  1ALY A;  5FQ0 B;  4ASL A;  4D0Q A;  5KWR A;  4B29 A;  3WW1 A;  1OLR A;  2W52 A;  2QZ3 A;  3E6B A;  5FXX A;  1N1Y A;  1QJX 1;  1OQD A;  3AXD A;  4Y1U A;  5CU1 A;  3VZM A;  3B01 A;  2IZW A;  3MFA A;  3OOX A;  4MGS A;  5J3U A;  5IW0 A;  2X10 A;  2Q1Z B;  2E63 A;  1XBF A;  4XBL A;  1GLH A;  2IC1 A;  1QMJ A;  1D4M 2;  2X5I B;  4IEY A;  1KFU L;  3NV2 A;  4QD2 A;  1RMU 3;  2VOX A;  4W50 A;  1AR7 1;  4W4Z A;  1GP4 A;  2I07 B;  3TNP B;  4GH4 C;  4Q5O A;  3QAC A;  4LJH A;  2D6O X;  1YFY A;  2VJX A;  3SKJ E;  1HN1 A;  4Y22 B;  2EIE A;  1JHN A;  2BDR A;  2HEY F;  2GN7 A;  3VHO A;  1NA1 B;  5FYU A;  2PHW A;  3RDI A;  1XQN A;  3WT3 A;  4EE2 A;  1NY7 2;  1QOS A;  2UYA A;  3OYW A;  4YFW A;  2TEP A;  4NRO A;  3ZXD A;  3O1V A;  2E31 A;  1H4H A;  1PVC 1;  4YM1 A;  3KS7 A;  4Y20 B;  3ZXA C;  3IM0 A;  4UW3 A;  5KXE A;  3NRU A;  3K46 A;  2WYF A;  2ZPX A;  3JUU A;  1K42 A;  4LO7 A;  4Q0Q A;  3IN9 A;  3Q8A A;  4P9W A;  2W91 A;  4JC1 A;  4XOG A;  1W8N A;  1QOO A;  2HWF 2;  1COV 2;  2D7F A;  1DFQ A;  2DUQ A;  1W9S A;  5EZW A;  1HXS 3;  2W0X A;  4P9G A;  5LAT A;  4BH9 A;  5FYH A;  3T1L A;  1WLW A;  2BOI A;  2HWE 3;  3OBR A;  5FPV A;  5HV4 A;  1UYP A;  5L9B A;  2AGS A;  5FZF A;  1WCD J;  2D40 A;  5LBE A;  5IK4 A;  4NOT A;  1ENR A;  1Y9Q A;  4YWA A;  3FJS A;  5CYY A;  5ABJ A;  5AC9 1;  2VXJ A;  4GAZ A;  4CEW B;  5BV6 A;  4UFJ A;  1H8T B;  1Z7S 3;  2AYH A;  5J48 A;  4MXW A;  3D6E A;  4GWM A;  5FMO S;  2CY6 A;  2WSV A;  3KLS A;  2BOJ A;  5T54 A;  1OVP A;  5A7S A;  1DQ0 A;  3F95 A;  3I4I A;  5JZG C;  4FOQ A;  4IES A;  4N7I A;  4XQW A;  3UJQ A;  4IEX A;  1DYP A;  1HRI 1;  1E5S A;  5J37 A;  1TQ5 A;  2QTW B;  2XKP A;  4QQP A;  1YFW A;  2ERF A;  1GOF A;  2VCC A;  3AMM A;  3SLI A;  1ND3 B;  4YSF A;  3MIG A;  2YBK A;  1UIJ A;  2VZ3 A;  4GIQ A;  3S57 A;  2RE9 A;  5GZG A;  1AYM 3;  1KJR A;  2DTW A;  4PBP A;  4RR3 B;  1W9Y A;  3HR9 A;  3H3Z A;  1W9T A;  1MVE A;  2W95 A;  4IEW A;  4Y5Z 0;  4YW6 A;  2ZAH A;  3WHT A;  2BPA 2;  1N1T A;  2Y0O A;  3ZFG B;  4LK7 A;  1LTE A;  1QOT A;  4X6R B;  5CZK A;  2DUP A;  3TEW A;  3J7L A;  3NJV A;  4UYB A;  5GZC A;  1IG0 A;  4O7X A;  1STM A;  1HJG A;  3DPR B;  4CA9 A;  3KV5 A;  1FAT A;  1JBC A;  3SKV A;  2JKB A;  1CIY A;  1GP5 A;  3JBG 1;  2WFP A;  4NMI A;  4ASK A;  4BOW A;  3UKV A;  3WW3 A;  1QNY A;  1X50 A;  2E51 A;  3KB5 A;  3LIH A;  2IXC A;  3OD0 A;  3U37 A;  3VBF C;  2LAL A;  2PLV 2;  4LKE A;  3VBR B;  5BNP A;  1LB2 A;  1LGB A;  3EYP A;  1QQP 2;  3AZX A;  2XQR A;  5HXM A;  1NCR A;  4LHK A;  5JXH A;  1BQP A;  3MF9 A;  3AJY A;  4JGY A;  3GZT B;  1E57 A;  2R6Q A;  3LSE A;  1OD3 A;  1SPP A;  2WNO A;  3M8L A;  4AI2 A;  4DQA A;  3H8X A;  3WDU A;  1QXR A;  5J1X A;  1O3Q A;  3POB A;  4UW4 A;  3ZSL A;  5F7U A;  5FK8 A;  1OUR A;  2E26 A;  4M3C A;  1POV 1;  3FLP A;  1NKG A;  1H9P A;  2AH2 A;  4AXO A;  4K1Z A;  2I45 A;  1YC6 1;  2XVG A;  3RZK A;  3N4M A;  4L2N A;  3MLL A;  5F6L B;  3OSD A;  3R4S A;  1RTV A;  5IFP A;  3DKW A;  1HV1 A;  4HK8 A;  3MI8 A;  3KCY A;  3IIA A;  4XFH A;  2ZGQ A;  4Q8L A;  2KXL A;  1OSG A;  2Y6H A;  4BIS A;  2B7Y A;  5GZE A;  2WSU A;  2YYO A;  1I6X A;  1EV1 1;  2ZHM A;  1I1E A;  4PF5 A;  4LKF A;  2YPD A;  4LBN A;  2HWB 3;  4PHZ A;  4BQ5 A;  1YQC A;  4COU A;  4WM7 C;  4LA3 A;  5JPM B;  2BVV A;  4S2G A;  1WW5 A;  5F5I A;  1L7L A;  5ACA 1;  1JZ5 A;  3THT A;  1AR7 2;  4XHX A;  1JYN A;  3IDB B;  3HQU A;  1AF9 A;  4C0B A;  2IXI A;  1FNZ A;  2QQI A;  5EWS A;  5H9Q A;  1WD3 A;  2QE3 A;  4E8D A;  2IXK A;  1TZO A;  1XNC A;  1NCQ C;  2WO7 A;  2B8M A;  1ZNP A;  2CYF A;  3VBU C;  3LAG A;  3PU8 A;  4ORF A;  4EJR A;  1W6P B;  5JR2 A;  1CZT A;  4YFZ A;  3ZFE C;  2QDR A;  4XDO A;  3III A;  3ZIW A;  2Q8C A;  5DUW A;  1PVC 2;  1CZS A;  4TXW A;  4Y20 A;  5EJ1 B;  3V65 A;  5FOB B;  4TWT A;  1WCS A;  2DU0 A;  5JXI A;  2RHP A;  1X9T A;  4H55 A;  1HRV 1;  3BYW A;  1MS5 A;  4PCR A;  1CPM A;  1YFX A;  2ZGU A;  4MAD A;  4U2A A;  3NV4 A;  3U10 A;  4BQX A;  3PLQ A;  3I3D A;  5A7W A;  3MDP A;  2D6N A;  4HMZ A;  4LK6 A;  3VDB A;  2JJ6 A;  2VPV A;  4K8F A;  1LEN A;  2LM3 A;  3ZIX A;  3M3Q A;  4HVO A;  5FY4 A;  4CUG A;  3JD7 3;  3S7E A;  3LD8 A;  1YNA A;  2P1B A;  4XXP A;  5FMO L;  1W0P A;  2ZEX A;  3VD3 A;  5LK7 B;  3MIH A;  1QWR A;  1AHS A;  2FCU A;  1SDW A;  4QPW A;  1GOH A;  2WS9 3;  4IND A;  4QKF A;  1K5M B;  4IV1 B;  2YC2 A;  5FUI A;  1RIT A;  1IPJ A;  2WWJ A;  2VCM A;  5AVA A;  4LO5 B;  1ODM A;  3C3V A;  4HKW A;  1W8T A;  1WCU A;  2JX9 A;  4P08 A;  4I0W B;  3IDA A;  1ND3 A;  5I8T A;  3ES1 A;  4FAG A;  2WN3 A;  4QPI B;  4NII A;  1OH4 A;  2HWC 1;  4NPR A;  1K3I A;  1N3P A;  1W8Z A;  3MID A;  4HXC A;  2WNU B;  4Q4W 1;  4DRR A;  1HIX A;  1SLL A;  2MEV 3;  4IV3 C;  2CWS A;  1XOY A;  1ZYB A;  2DUR A;  2XVK A;  4BE3 A;  5IAV A;  4RR3 A;  3UT0 A;  2XKO A;  5A7N A;  4CXW A;  1RVF 1;  5L9V A;  3ZFG A;  1DCS A;  3W59 A;  3WQ1 A;  3J8F 2;  4D3W A;  3S0M A;  4AI1 A;  1HKD A;  1OFS A;  2PQQ A;  3X29 B;  3C2U A;  3HIF A;  2GNT A;  1CES A;  5FPU A;  1VBC 2;  2UY9 A;  2BJS A;  1JN2 P;  3HD8 B;  3VN4 A;  3WP5 A;  5L73 A;  4ET7 A;  4EYU A;  2VE1 A;  5IVF A;  1GV9 A;  1NX9 A;  4OHV A;  3VD5 A;  1SEF A;  4YW7 A;  2Y26 A;  3H1Y A;  3H7Y A;  1HB4 A;  3JBG 2;  1OLM A;  3JU9 A;  4L8Q A;  4R4Z A;  2HH9 A;  2YRO A;  3TYJ A;  4BWO A;  4PIZ A;  3VBR A;  1ZBA 2;  2GSY A;  3C7E A;  3ASI A;  1SAC A;  4ITC A;  3IWZ A;  1ASJ 3;  1SQ4 A;  1W6N B;  2XHK A;  4YG0 A;  3TB0 A;  2VOW A;  2VXR A;  5JOZ A;  4IEP A;  1AR6 1;  3HOB A;  4IEZ A;  1RUI 1;  5FZB A;  2P37 A;  3O5S A;  4QX7 A;  3RSJ A;  1R09 1;  2P3Y A;  2XDV A;  3FWE A;  3VV1 A;  5CAZ A;  4CCN A;  4AL9 A;  2BWC A;  1WW4 A;  2HWD 3;  3FFZ A;  4S2F A;  3T1M A;  2EVX A;  4I3G A;  2C9A A;  3PUA A;  3VBS B;  5JLV A;  5JCT A;  4B8E A;  1OMI A;  3ACG A;  3PUS A;  5FRE A;  5A6Z A;  1S2E A;  2BNN A;  4LBQ A;  1DG6 A;  5A3W A;  2VM9 A;  4A6S A;  1JH5 A;  4JKM A;  1YUD A;  2DVB A;  1R1Z A;  3KSC A;  4LBJ A;  3NJY A;  5KXB A;  1TE1 B;  4FQ4 A;  4KWU A;  1OPM A;  1LKN A;  2Q8D A;  2OVU A;  1GU3 A;  1EV1 2;  4FO9 A;  4HLT A;  4XAB A;  1RHI 1;  1RUC 3;  1VBD 3;  4LE4 A;  5FZ8 A;  5DPN A;  4I3P A;  2H6C A;  3ZYJ B;  1W39 A;  5CG9 A;  4FCA A;  1RUH 3;  5ACA 2;  5FP7 A;  3PIG A;  5CKM A;  3V0A B;  2NP0 A;  3MLJ A;  1DYK A;  4HET A;  2XLG A;  4WZC A;  2XUE A;  1YQ6 A;  3E1F 1;  4MET A;  1RUE 2;  2EIB A;  4XXA A;  1O4Z A;  3T30 A;  2JIG A;  4X8P A;  4QXH A;  3ZYH A;  3BIE A;  5K4L A;  4GB3 2;  2W2I A;  5F3I A;  1UU4 A;  3KQ4 B;  3THD A;  1E5H A;  4DY5 A;  1R08 2;  4JQR A;  3FZ3 A;  4XTM A;  4UOJ A;  2JG8 B;  3FBY A;  3E5U A;  3LA7 A;  2VME A;  3QLQ A;  4X8N A;  2ZML A;  2D6K A;  4JHZ A;  4XFF A;  5FZ4 A;  3W9A A;  4DEV A;  3BIW E;  3PUR A;  3PTY A;  4P5Y A;  5D2A A;  3UGH A;  5M0T A;  5SV8 A;  3RZZ A;  4DRV A;  1LJ7 A;  4WM8 B;  5DUV A;  3U1X A;  1M06 G;  2X29 A;  5CFC A;  1PO1 3;  2O8O A;  3N35 A;  4I09 A;  2A75 A;  4AI0 A;  4CDQ B;  1JYX A;  2BNO A;  3B00 A;  3OBZ A;  4XE9 A;  2VUJ A;  4AEM A;  4QDR A;  2E33 A;  1SLA A;  2B9U A;  3NV3 A;  4HSL A;  2JB4 A;  4LMF A;  1UXZ A;  2ZBJ A;  2JG9 A;  4NIA A;  3UL2 A;  5HCF A;  1RUO A;  3PUI A;  4YZ3 A;  2WZE A;  2WR9 A;  3H1W A;  4MZU A;  2R1D A;  3A0N A;  4AYU A;  4IE6 A;  2YDE A;  3G7D A;  1D2Q A;  4GD4 A;  4CUA A;  1A6C A;  1MVQ A;  2B46 X;  4W6Y A;  2RS3 1;  5FOJ B;  2P3K A;  2IXL A;  4NJ4 A;  1K5M A;  2QVS B;  4OFG A;  1DBN A;  3SIT A;  4JRL A;  2NYY A;  2YUE A;  2WII B;  3WP6 A;  1ND2 A;  2DFC A;  3KM5 A;  5E1R A;  4AR2 A;  1LGN A;  3G6J B;  3AVS A;  1EP0 A;  2VG9 A;  3WHU A;  3ZYB A;  2FD8 A;  1DDL A;  2RJ2 A;  3U14 A;  2K46 A;  2EAA A;  4WVM A;  3M70 A;  2BU9 A;  3IBM A;  2W68 A;  2D6L X;  3AFK A;  3FC0 A;  3POE A;  3B9C A;  3W20 A;  4KU7 A;  3OUJ A;  1W0N A;  1BEV 3;  1QDO A;  1SMV A;  1XC6 A;  1ST8 A;  4GWI A;  5CKQ A;  5D1I A;  2QKD A;  5FY0 A;  1OKO A;  2WO3 A;  3UGG A;  4AW7 A;  3VBO B;  1E5I A;  1VJ2 A;  3B93 A;  3PJQ A;  4XUT A;  4ASM B;  1RVF 2;  5JI9 A;  1FYU A;  4BZ4 A;  4PBO A;  2JDA A;  3T4V A;  2BVB A;  4QX0 A;  1W05 A;  4LR4 A;  2WN2 A;  1GNY A;  2BGC A;  2B39 A;  1ONA A;  2HKX A;  4EWD A;  3O1M A;  5HCA A;  2W39 A;  3IMM A;  1B35 C;  4GKX A;  1DGL A;  3GYD A;  4XW3 A;  4N43 C;  5FCC A;  1R1A 3;  1REE A;  5A6X A;  1Q43 A;  4AFD A;  5DN2 A;  5C4W A;  4XQD A;  1Q5O A;  4TTG A;  2PXJ A;  2VMH A;  1GKB A;  2VW0 A;  1QJZ A;  2XVL A;  1MEC 1;  4DPN A;  5C8W A;  1XNB A;  3H8R A;  3GBF A;  1BVV A;  3K3O A;  3LDK A;  3BTY A;  2DCJ A;  3JZV A;  2UWB A;  2VY0 A;  1LOA A;  3NWK A;  1CAU B;  1UIK A;  4Y26 A;  5DXD A;  3ZFF C;  1GZT A;  1UMH A;  4N8M A;  1AR8 1;  4M3C E;  3SHR A;  1UX6 A;  1RUJ 1;  4OI1 A;  1AL2 3;  4AAX A;  4QB2 A;  1IKQ A;  3J7M A;  3LWC A;  4CEY C;  4NAO A;  3B3Q E;  1A8D A;  3HT1 A;  3S7I A;  1ZZ8 A;  1R09 2;  5K0U B;  5C5U A;  1DZT A;  3CU7 A;  1F4H A;  4KWL A;  4XHB A;  2FCT A;  3OPZ A;  2D44 A;  4WZF A;  4DUW A;  2J1V A;  4JGZ B;  4D7T A;  1CVN A;  4HOO A;  1RJ7 A;  2VCB A;  3ZM8 A;  3POG A;  4BQ1 A;  1Q8Q A;  4FPH A;  3WP4 A;  1SLT A;  2Q5T A;  3POW A;  1CAW B;  1G9F A;  4BYY A;  5A3U A;  1JTZ X;  4NHK A;  3F2Z A;  2ARA A;  3D4K A;  4YGB A;  3U75 A;  4QB6 A;  4DFS A;  4EN9 B;  4J6G A;  1RHI 2;  4R9A A;  2LUW A;  5KXD A;  2A70 A;  3K51 A;  1H6X A;  2W08 A;  1AUY A;  2B9V A;  4HL0 A;  3DN7 A;  4BJ0 A;  5FZH A;  5LWB A;  1XU2 A;  4CCJ A;  4HKL A;  3SEP A;  2Z42 A;  4LBL A;  3I2G A;  5A1A A;  3NV1 A;  2XL7 A;  2YGL A;  3I2J A;  1FOD 1;  4OI2 A;  2DVF A;  3BN6 A;  4KNC A;  5BPX A;  4LO8 A;  4XFI A;  1O3S A;  1Q8S A;  2XOM A;  4D8M A;  1RXF A;  5FLJ A;  4CZS A;  1PVX A;  2R04 3;  3I2O A;  1J1T A;  3AP6 A;  5BNO A;  5KHG A;  1MS3 A;  1YWK A;  4IUG A;  5EJ3 A;  4AQ2 A;  2PAM A;  4CXX A;  4DUX A;  2XQX A;  4HN1 A;  3VZL A;  4COY A;  3AMQ A;  2PHU A;  2PHL A;  2W1Q A;  3AZZ A;  4WM8 A;  2XJS A;  4Q4X 1;  5FMD A;  5LW9 A;  2ZXQ A;  5FYZ A;  3ZSK A;  2GNB A;  1VBE 2;  4QHB A;  1YJK A;  2VCA A;  2NZ9 A;  4YPJ A;  3RYK A;  1GP6 A;  3W21 A;  3AMN A;  4CVU A;  1GUI A;  1AYN 1;  1H1A A;  1WA4 A;  1GNZ A;  1N1V A;  4TZD A;  1OC1 A;  4BQY A;  1AR9 3;  1CPN A;  4Q29 A;  4UAP A;  2WDB A;  3ETP A;  5F5C A;  5C8C C;  1HLC A;  4NPM A;  1UO9 A;  3VBH A;  1TEI A;  4EN0 A;  5A3L A;  4LKS A;  4XUR A;  1D2S A;  1ACC A;  3ST7 A;  4URA A;  2RR1 1;  2AEY A;  4NN0 A;  2OQ7 A;  3KWV A;  1VRB A;  1V6N A;  4Y5S A;  4DXT A;  1VBB 3;  1VBA 3;  4YW3 A;  4ZON A;  2WZR 1;  2ARE A;  2ARB A;  2XML A;  5IJR A;  5DUU A;  4CDU A;  2RS3 2;  3R4D B;  4FTB A;  4QXC A;  3SH4 A;  2QQW A;  2G1M A;  1KGY A;  5IUQ A;  3ZVX A;  3RZJ A;  2ZEZ A;  1JU4 A;  1V9U 1;  3S5A A;  3ZSM A;  1WLD A;  1GR3 A;  1O4Y A;  1YCI A;  2FHR A;  2Q4S A;  2GU9 A;  2FDH A;  2RMU 3;  2XHN A;  1SBF A;  4XJU A;  1J83 A;  3OYW B;  4AGV A;  4A4A A;  4BLJ A;  1QJY 1;  1RUG 2;  1ENQ A;  5I0D A;  3J26 N;  2BBV A;  4XCA A;  3JQX A;  1MZ5 A;  5FPX A;  2VOV A;  2PAK A;  4IE5 A;  3ZYG A;  3CF6 E;  4P14 A;  3VLB B;  3DCQ A;  2CL2 A;  4ZS3 A;  2I2S A;  5FWE A;  1COV 1;  2DFB A;  2HWF 1;  4ZZ8 A;  1W6Q A;  3ROU A;  4ZU4 A;  4QQO A;  4CDX C;  4JTN A;  5T5P A;  2A5Z A;  1OLM E;  4YAR A;  2PMW B;  4GAL A;  3A23 A;  4YW1 A;  2O8Q A;  3GGL A;  3KT4 A;  1RIN A;  4Y3O A;  1GFF 2;  4MGI E;  1NXM A;  5BNP C;  1G9D A;  4C0H A;  2WUH A;  4XF1 A;  3WNL A;  4IL7 A;  3LA2 A;  3FUO A;  1NT0 A;  1QDC A;  4RS5 A;  4QPG B;  5ABJ B;  3AYE A;  4JGY C;  3VZO A;  4COW A;  2ET1 A;  3SC7 X;  4RGA A;  3Q8B A;  1LRH A;  1PK6 A;  2C6S A;  3RI9 A;  2JDH A;  1WMF A;  1S0J A;  4MXW B;  3BTZ A;  5FP4 A;  3WLU A;  1BBT 3;  1CN1 A;  1XPW A;  4Q26 A;  4ZU7 A;  2NQY A;  1YIF A;  2DV9 A;  1RL3 A;  2YB7 A;  4WBB A;  1AR8 2;  1AXY A;  1DQ1 A;  2C0Z A;  4N53 B;  4XF0 A;  2J1R A;  2JD4 A;  2MHF A;  4N90 A;  2WWS A;  1FPN 3;  1DGR N;  3K75 B;  3NAP C;  5K0U A;  4OUE A;  1O8P A;  2GC0 A;  4QQL A;  2EXH A;  4AED A;  4QMA A;  4QX8 A;  5JI7 A;  4C8D A;  4ERO A;  2OZJ A;  1D7P M;  3WNK A;  4HVR A;  3EJK A;  1H8V A;  1RUD 3;  3LE0 A;  1OVS A;  1TMF 3;  4AHW A;  3CZU A;  1DQ6 A;  3MGU A;  3HN1 A;  3K4A A;  4MG2 A;  4EQV A;  2BBA A;  4J1W A;  2D5H A;  4KBZ A;  2DTY A;  4TYS A;  4CU6 A;  1HXS 1;  1F15 A;  2X5I C;  5JSO A;  3BTX A;  3VD4 A;  3TN9 1;  3WVJ A;  1PO2 3;  3WY6 A;  5FY8 A;  1CAW A;  2HWE 1;  3RS6 A;  3N36 A;  1TVG A;  4CCM A;  3LCP A;  5GLV A;  1KFX L;  3AP9 A;  2WT2 A;  4HK9 A;  2ZGS A;  3WR0 A;  4CCL A;  4BCU A;  4L9B A;  4QQ2 A;  1K12 A;  1NA1 C;  2JE7 A;  3AKT A;  4XFB A;  2O1Q A;  4Q4Y 3;  5A6Q A;  4YW4 A;  3KV4 A;  4YVW B;  1QQP 1;  1FOD 2;  1N3Q A;  1YHF A;  2R06 2;  2VZ1 A;  3WCR A;  1VRH 1;  1NCR B;  1V70 A;  3PVB B;  4YNI A;  5CA6 A;  5EIY B;  2WAB A;  3AZY A;  5I93 A;  5FO7 B;  4A6O A;  1IQD C;  1SPP B;  3I8T A;  1H4G A;  3PVN A;  3AL6 A;  3PME A;  2MPF A;  3FHQ A;  3GBW A;  3MHZ A;  5FP3 A;  4XIO A;  4AZZ A;  2JDK A;  3MIB A;  3J7N A;  2PA7 A;  3R0R A;  4LUL A;  3RG0 A;  2YG0 A;  2ZOE B;  4Q4X 2;  5FY5 A;  3K4D A;  1DQ2 A;  1BVP 1;  1D4M 3;  4M3C B;  1VPH A;  5IK5 A;  1LGC A;  2OX0 A;  3KD4 A;  4LBM A;  5BYN A;  1K5J A;  2BEO A;  3NKT A;  1AYN 2;  2BRT A;  4V2V A;  4XUQ A;  3T09 A;  4CDW B;  1IZ3 A;  4FOW A;  3WD5 A;  4CEW C;  1H2K A;  2VOT A;  3DXU A;  4XAC A;  3BU0 A;  1H8T C;  2RR1 2;  4AQT A;  4HBN A;  4Q0P A;  4PI0 A;  5T52 A;  5FYV A;  4DY3 A;  3RQ0 A;  2F6B A;  5FTT C;  4GMP 1;  3DXT A;  2WZR 2;  2TBV A;  2P6H A;  1FMD 3;  4PDW A;  3POI A;  1G9B A;  4HN0 A;  3APB A;  2GDF A;  1VLN A;  1GQG A;  1ND3 C;  2ATF A;  1PHM A;  1V9U 2;  4LXL A;  2BP6 A;  3CJI B;  2AAC A;  4A3X A;  4E2S A;  1OA4 A;  3KF3 A;  3LEI A;  5GM0 A;  4E2Q A;  5IT6 A;  1H2L A;  4MOA A;  1TME 3;  3VL9 A;  1S0G A;  3ACI A;  4AVA A;  1V6O A;  1JUI A;  5A32 A;  4JAA A;  4RR3 C;  3THC A;  1C8M 3;  2Q8O A;  4E4H A;  2A6W A;  1QJY 2;  3GAL A;  2VNR A;  3HT2 A;  3ILR A;  3ZFG C;  1ZZC A;  2XJP A;  2VW1 A;  2Y6G A;  3MIE A;  2EID A;  3BB6 A;  2CU5 A;  2C5D A;  3PL0 A;  3HNB M;  4OZO A;  4R4X A;  4DXS A;  1UWW A;  5JWP A;  2PN5 A;  2QDN A;  3FHI B;  2VBB A;  1LED A;  4BHP A;  4KI5 M;  3OG2 A;  3DPR C;  4MLO A;  4JKL A;  5A7W B;  2Q1F A;  1LHO A;  1KEX A;  1QNW A;  1QH6 A;  3ACF A;  2JE8 A;  2VQ0 A;  3T08 A;  1NYW A;  4UFL A;  5CEH A;  3VBR C;  1S2K A;  1QY4 A;  2E9Q A;  2R7E B;  2WIN B;  2PHT A;  3C8X A;  1EYB A;  1NQJ A;  4P00 B;  4JDM A;  4QPG A;  4QM8 A;  4RSU A;  1Q8V A;  1H0B A;  5FBJ A;  2G4I A;  3AK0 A;  3K48 A;  4LKD A;  1JS9 A;  1A3K A;  1MZ6 A;  5FFO C;  4YZ5 A;  2J1T A;  5EHD A;  3VZJ A;  2VTX A;  3EXU A;  3I2D A;  2ZA9 A;  3D5O A;  4RFR B;  3WQ0 A;  1SG3 A;  2QQN A;  4RA0 A;  2WWU A;  4N53 A;  5LRR A;  5KR7 A;  5BXX A;  3KMH A;  1EAH 1;  2W92 A;  1QJE A;  2WLP A;  1KS4 A;  2Y60 A;  2K9Z A;  1U5I A;  2FMY A;  4HG6 B;  2YMZ A;  3LIG A;  4FTS A;  1F9K A;  1QXJ A;  1UZY A;  2Z5W A;  3GJA A;  2P5B A;  5JVV A;  1S0D A;  1UMI A;  3MFC A;  1EUU A;  1UU6 A;  3POJ A;  3N9M A;  3MUZ 1;  1BK0 A;  5C5T A;  2VR4 A;  2RV9 A;  1JW6 A;  2PHF A;  1HXS 2;  3J8F 1;  2WNV A;  3TN9 2;  4EN6 B;  4OUM A;  4AQ6 A;  1VBC 1;  2HWE 2;  2R07 1;  5GLZ A;  1BCX A;  1VB4 A;  5FZ6 A;  5LCW L;  4G4F A;  3NKG A;  4IEO A;  5IVE A;  2DF7 A;  2OYZ A;  2D6M A;  4F83 A;  4FSJ A;  5CG8 A;  1U0A A;  1S0C A;  4HSJ A;  5GZD A;  1R64 A;  2XG3 A;  5KHI A;  2F4L A;  2RDS A;  1DGW A;  4QQH A;  2QUO A;  1ZBA 1;  2YV8 A;  2ZX4 A;  3L9J T;  4YVW A;  1J3Q A;  3CIH A;  2ENR A;  5IHR A;  1JYT A;  1W2A X;  1W2O A;  2FDI A;  1VRH 2;  5L7O A;  4L97 A;  3Q8C A;  2CDP A;  1ZRC A;  1LOF A;  4M01 A;  3RJR A;  1W90 A;  5FZG A;  5T50 A;  4PLN A;  3WDW A;  3WF1 A;  3VKN A;  4WV8 A;  1XNA A;  1UNB A;  5IVY A;  4ZZ5 A;  1QJX 3;  3GHN A;  4LOR A;  5C71 A;  2R0H A;  2WQZ C;  5IYY A;  3AKS A;  2Y33 A;  1T6G C;  4KBB A;  3AL5 A;  4MSV A;  1AYM 2;  1J59 A;  4UFH A;  1V00 A;  3DEM A;  4P02 B;  1AR7 3;  2A6X A;  1GZ9 A;  4LBQ B;  3TEX A;  5HPO A;  1MS0 A;  3VHN A;  2VTF A;  5A3O A;  1AL0 G;  5A3T A;  4CDW A;  2DCT A;  2E32 A;  1X7N A;  4HON A;  2CWM A;  1UCX A;  1K5M C;  2Q1M A;  4XVH A;  5GAL A;  4IV1 C;  2OPW A;  4CP9 B;  4DZG A;  1G9A A;  1S0I A;  3OEA A;  1I5Z A;  2Y34 A;  3PU3 A;  3CO2 A;  2IVJ A;  4XFA A;  3VDD A;  4Y1Y A;  1V6I A;  1WZX A;  4UF0 A;  1UOF A;  2Y0I A;  1WKY A;  1CJD A;  5EV7 A;  2G9F A;  1PVC 3;  2FQP A;  2GP3 A;  1UZ0 A;  4JV4 A;  2VBP A;  1M4W A;  2W5F A;  3TWI A;  2QQJ A;  4K8R B;  1RUE 1;  3KGZ A;  1HQN A;  2GH2 A;  3CJI A;  2WO2 A;  1W99 A;  4M0H A;  4Q0U A;  4QPI C;  2VAU A;  4Y1Z A;  5FY9 A;  2ZMK A;  4GB3 1;  4QKD A;  2WNU C;  5EXO A;  5CVR A;  4AEK A;  4XAA A;  1R08 1;  3MW3 A;  4BQW A;  3ZPY A;  2ZEW A;  3GF6 A;  3NMB A;  3H9A A;  4GUL A;  3THP A;  1BLZ A;  1REF A;  3SQO A;  1G86 A;  4L99 A;  2XB6 C;  3N9N A;  4TLG A;  1ODN A;  3DEC A;  3ETQ A;  3U78 A;  3INA A;  4DMI A;  2ZMN A;  4DIQ A;  4I01 A;  2NLR A;  3EHK A;  1KDK A;  2YGM A;  5CFC B;  2EAK A;  2IUW A;  1QEX A;  1PZ7 A;  5AC9 3;  3KV9 A;  5I0T A;  4I0B A;  2DBI A;  3O1U A;  1CAV A;  1PX3 A;  1VR3 A;  2R32 A;  3PHM A;  5KHJ A;  1GWM A;  4JHT A;  4FPO B;  2YBP A;  2ZHN A;  1PZ9 A;  1Y43 B;  1YEW A;  2JG9 B;  3WW2 A;  3W5N A;  4XYX A;  1HX6 A;  4K6B A;  4DOU A;  1RUC 1;  5C3S A;  2PHD A;  1HRI 3;  4LBO A;  5D8A A;  4AAP A;  4L11 A;  3IKW A;  3VL8 A;  1MS4 A;  1W8H A;  2V72 A;  2W1U A;  3PVE A;  3FX3 A;  4UFM A;  3SCH A;  5CIR A;  5IK8 A;  2ZTN A;  2ZAB A;  2XXZ A;  1UZW A;  2ZAC A;  2VZP A;  5I0U A;  4XC9 A;  4MGK E;  3PTR B;  2ZCW A;  2H0B A;  3N9L A;  1OUX A;  5FV3 A;  1G8W A;  1ND2 B;  2DVG A;  2RS1 3;  2ZZJ A;  1GBG A;  1UKG A;  2A3W A;  3BAL A;  3DYO A;  1HV0 A;  1CX4 A;  3VBS C;  1JOP A;  2V73 A;  4CSW A;  4EZ4 A;  4BM8 A;  2P3I A;  1FXZ A;  3N9Q A;  4WVM B;  4MV2 A;  2BGP A;  2XGX A;  3D0J A;  1EAH 2;  1C5H A;  2W3J A;  3EO6 A;  1GQH A;  4FPG A;  4YM2 A;  1BHG A;  4XBQ A;  3IAQ A;  5FWJ A;  1OBN A;  1UF2 C;  1JOB A;  5KC5 A;  3HQR A;  4ISR A;  3VKM A;  3JQW A;  4LHS A;  3OTF A;  3ZR5 A;  1IS4 A;  3JBG 3;  3E5Q A;  5IAT A;  4YVS B;  3N7L A;  5TSW A;  2XJQ A;  3WF0 A;  2ETE A;  1X8M A;  3I49 A;  4HZF A;  5ISL A;  1V0A A;  4AVV A;  1GMM A;  4NE9 A;  1JZ8 A;  3KVB A;  2R07 2;  3JD7 2;  4OMD A;  1ZVF A;  4Z8B A;  3MPP G;  1YRZ A;  4NWW A;  4GH4 A;  4CCC A;  1O3R A;  4I02 A;  1TNF A;  4QM9 A;  1US2 A;  2KD7 A;  2EXJ A;  3HQX A;  3Q8F A;  5C4W B;  1JYI A;  2WS9 2;  4D69 A;  3RZL A;  3WV6 A;  2L9L A;  4CCE A;  1JI6 A;  2JG8 C;  4CCO A;  1POV 3;  2JDN A;  2ZGO A;  3M1H A;  4AI3 A;  1UY3 A;  2CGP A;  3AMP A;  4CPB A;  2ZGR A;  4PT6 A;  4WM8 C;  2NMO A;  1O4T A;  5JMO A;  4CDQ C;  2RVA A;  2JE9 A;  1QF3 A;  1RUF 1;  1O3T A;  4NHY A;  4R8H A;  3RRD A;  4C90 A;  4FFH A;  4ZPI A;  5ACA 3;  2WFF 1;  5F9T A;  3PMS A;  1RED A;  2UY8 A;  3M3E A;  3WG3 A;  2ZGP A;  5B4N A;  3JXS A;  4LLF A;  3P5B A;  2YXS A;  2HBU A;  1O59 A;  2BFU S;  2FZ1 A;  4CCD A;  4CRQ A;  1AX0 A;  5FZ0 A;  1S55 A;  1ZX5 A;  4CU9 A;  3PIJ A;  5E6H A;  3URF A;  1R1A 1;  1X36 A;  3T4H B;  3ENR A;  3B69 A;  3KF5 A;  5FKB A;  4AF9 A;  4NRM A;  1YIP A;  3QOP A;  3RYR A;  5JZG A;  3BOW A;  2OW4 A;  2WBK A;  3ZXJ A;  4LT5 A;  5LA2 A;  4YM0 A;  3NNL A;  1XSQ A;  1IPS A;  4OHW A;  1Y9G A;  5FZI A;  4FP2 A;  1HRV 3;  2V5D A;  2GMP A;  5FUP A;  4W6X A;  3ZXL A;  1UYX A;  1JZ7 A;  1UY2 A;  4QGL A;  1PX4 A;  1UZZ A;  3FFQ A;  4FOY A;  5EFU A;  3UKN A;  3D0S A;  3ORJ A;  1Y7B A;  1RXG A;  3B94 A;  4P9J A;  3VBO C;  1DQ4 A;  1LU1 A;  4KWJ A;  1MQT B;  2D98 A;  1WBF A;  2GZW A;  2Y6K A;  3J9S A;  5LB6 A;  5BNO B;  2HWD 2;  3WW4 A;  5LA1 A;  4OVE A;  5G05 L;  2VOK A;  3POF A;  2VD7 A;  5FR3 A;  1ZRF A;  2JD9 A;  1C4R A;  3WP3 A;  4IQP A;  1VBE 1;  1ZZ9 A;  4XPV A;  1NLR A;  3GNE A;  3TOJ A;  3I97 A;  3ILF A;  3AMH A;  2WYS A;  5J96 B;  4P9Y A;  1FI2 A;  1HJF A;  5K7P A;  3H3L A;  2XJT A;  2AZ5 A;  3KGL A;  1PIV 3;  3S6P A;  1YI9 A;  3HN3 A;  4FVV A;  2QZ2 A;  3M3I A;  5J36 A;  3VBH B;  2P3J A;  3AM2 A;  1XNT A;  4IGO A;  3OCP A;  3VBF A;  1RUC 2;  1VBD 2;  2VEC A;  2A6Y A;  1H30 A;  1LHV A;  1ULP A;  1U5X A;  1UX7 A;  4YGC A;  4BME A;  4HVQ A;  1GNH A;  2VMG A;  2HWC 3;  3H8U A;  3LF7 A;  4FOV A;  4CDU B;  4IER A;  2ZZQ A;  4Q4W 3;  2GMM A;  2A6V A;  1GQP A;  5K0U C;  4GMP 0;  1VE0 A;  5GZF A;  2RS5 1;  1GYK A;  1PMH X;  1L3J A;  1JYW A;  2D97 A;  3SCF A;  3A4U A;  5E88 A;  1Q56 A;  1O8S A;  4FFF A;  5EPA A;  1XE7 A;  2KA3 A;  4NHX A;  4LQR A;  2E7Q A;  3USU B;  4JGZ C;  3WNP A;  4QHZ A;  2VVE A;  4CP9 A;  5LA9 A;  1RUG 1;  4RFT 0;  4NID A;  1POQ A;  4JVA A;  5FZC A;  2WC2 A;  2BQP A;  1ENS A;  1PO1 2;  1UOG A;  5HXV A;  2CTV A;  5A80 A;  3ZXE A;  3JCI A;  1L7Q A;  1U12 A;  1ZZ7 A;  4YVS A;  5A3N A;  2GNM A;  4Q27 A;  3U4S A;  4A2U A;  3SH5 A;  2Y6J A;  4BMB A;  3TEY A;  3FMG A;  1WUV A;  3U07 A;  4XDQ A;  4C1X A;  1IS6 A;  1MPX A;  4IDZ A;  1WMX A;  1JOD A;  2ZHK A;  2GAU A;  3C7O A;  2Q30 A;  4LBK A;  3WDY A;  3ZN4 A;  1W6Q B;  3ZDS A;  1BKZ A;  1H2N A;  2VZR A;  4XJA A;  2ORZ A;  3ECQ A;  4AFB A;  3U4X A;  1MS8 A;  1ZBE 1;  2JEC A;  1AR6 3;  3AKQ A;  3OGS A;  4JZR A;  4WVV A;  3T2P A;  1RUI 3;  4IE0 A;  5J7M A;  4RD7 A;  1UYZ A;  2Z69 A;  1US3 A;  2C4X A;  4XF4 A;  1R09 3;  2X05 A;  4EZH A;  3OD4 A;  5A3M A;  4RS5 B;  4N7U A;  3UYJ A;  4DEQ A;  2XBO 3;  1NCQ A;  1UU5 A;  2TUN A;  2GP5 A;  1OKQ A;  2ZX1 A;  3VBU A;  2OA2 A;  1PK6 B;  3GHM A;  3T0B A;  2O0O A;  4GJZ A;  4E8C A;  3DGT A;  5A7O A;  3EBR A;  2RG4 A;  5IAX A;  1W8W A;  1LCL A;  1V6L A;  3HBK A;  2H0V A;  2RMU 1;  3BU7 A;  3ZKY A;  2QBX A;  1CWP A;  1HW5 A;  2JEM A;  3BPS A;  5CFD B;  2ZX0 A;  2VNO A;  4KGG A;  3S5Q A;  1BEV 2;  3HAG A;  5JOX A;  1GWK A;  1RHI 3;  5H9S A;  1RUF 2;  5FYI A;  2PAE A;  3HNM A;  4WVZ A;  4AED B;  3IT8 A;  1LEM A;  3NW4 A;  2BFU L;  4OUS A;  3OY8 B;  1JYV A;  2ARC A;  4BXF A;  1OPO A;  2WFF 2;  1AZD A;  2E53 A;  4LIT A;  3LZZ A;  3H8O A;  2A71 A;  3L2Y A;  3WOG A;  4LPL A;  3EMR A;  5DAP A;  4A7K A;  5JOY A;  4D6S A;  4PQQ A;  1W6O B;  2YY1 A;  4XDP A;  4M4R A;  2I74 A;  4NPL A;  1KJL A;  4QU2 A;  5F3E A;  4EWA A;  2Y6L A;  5EJZ B;  3LDB A;  4ZY9 A;  1R1A 2;  3WF2 A;  3BOP A;  5ANN A;  5FZO B;  5K9Y A;  4HT1 T;  1UN1 A;  1UYY A;  4I0A A;  2ZKN A;  3RWN A;  5G04 L;  2ZGL A;  1JU3 A;  3I3E A;  3K3N A;  3FN9 A;  4XQ4 A;  2CSG A;  3Q9O A;  2DYC A;  5E8A A;  5FP8 A;  3ZXF A;  4Q1R A;  3SMH A;  2B4K A;  5LBF A;  2R06 1;  3FL7 A;  4O9G A;  3ALQ A;  5FO9 B;  4B4Q A;  4XMA A;  5E89 A;  3MLK A;  3N9P A;  4U36 A;  2Y8K A;  2WNE A;  4RHV 1;  1IQA A;  4IV3 A;  1MQT A;  5C3R A;  3DF0 A;  5C33 A;  1C57 A;  2JDM A;  3SH3 A;  1NG0 A;  2QQM A;  1QJU 1;  4H14 A;  4JRA A;  5KHK A;  1T6B X;  2IWG B;  4JTO A;  3NNG A;  2V09 A;  4FXG B;  5FMB A;  5F3C A;  4ONU A;  4BIF A;  1EY2 A;  1J84 A;  1NZC A;  3HBZ A;  4AHZ A;  3W58 A;  3MW4 A; 
#chains in the Genus database with same CATH homology
 4XAC A;  5EPA A;  4NHX A;  4Y5T A;  5LA9 A;  2Y33 A;  3HQU A;  4XCA A;  3KT7 A;  5LAT A;  2V4A A;  4J25 A;  5HV4 A;  5L9B A;  5L9V A;  5LBE A;  4XAB A;  5DAQ A;  3KT4 A;  4NAO A;  5DAV A;  5C5U A;  2OPW A;  2Y34 A;  2FCT A;  4JZR A;  2RDQ A;  4NHY A;  4BQX A;  3PL0 A;  2JIG A;  4ZPI A;  2FCV A;  3NNM A;  5DAW A;  2RDN A;  3W21 A;  3OUH A;  5A3U A;  4NHK A;  2HBU A;  4XAA A;  5LBB A;  2RG4 A;  5IAX A;  4BQW A;  3KT1 A;  5ERL A;  2FCU A;  5M0T A;  5L9R A;  2JIJ A;  4IW3 A;  4MHR A;  3OBZ A;  3NNF A;  3MGU A;  3NNL A;  4KBZ A;  4UWD A;  3GJB A;  3OUI A;  3EMR A;  5DAP A;  2RDR A;  4NMI A;  2A1X A;  4XCB A;  5LB6 A;  5IAV A;  5LAS A;  3GJA A;  5LBC A;  3DKQ A;  3BVC A;  3GZE A;  4NHM A;  3NNJ A;  5EP9 A;  4XC9 A;  4BQY A;  5EQU A;  5C5T A;  3ITQ A;  2HBT A;  5LBF A;  4Y5S A;  3W20 A;  3OUJ A;  5HV0 A;  4ZON A;  4Q5O A;  5DAX A;  3HQR A;  2G1M A;  2RDS A;  5IAT A;  4MHU A;  2G19 A;  4NHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...