5DUWA

Crystal structure of the human galectin-4 n-terminal carbohydrate recognition domain in complex with lactose-3'-sulfate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
PTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-4
publication title Structural characterisation of human galectin-4 N-terminal carbohydrate recognition domain in complex with glycerol, lactose, 3'-sulfo-lactose, and 2'-fucosyllactose.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5duwA00
5H9PA 3AXEA 1MVQA 3GNEA 3AP6A 1V6LA 4JCKA 2NZ9A 4ITCA 3AZZA 4GWNA 3R4UA 2EF6A 3WG1A 4FOWA 5GLZA 3ZYPA 1WD4A 1S0CA 4BLJA 1LTEA 5IK7A 1WD3A 1C4RA 1DFQA 2EXJA 1JW6A 2A6ZA 4YM0A 5DUVA 1UKGA 2A3WA 1DGLA 3WUDA 3M3QA 1DLLA 2ZHMA 4UW3A 1CIWA 3B00A 1MS8A 3ILNA 2D6KA 2ZMLA 3N7MA 3OJBA 3LSEA 4YM1A 1LHNA 1A78A 1YRZA 2PHXA 4Q1PA 1V6NA 3LCPA 2A6XA 4Q8KA 3SITA 2RHPA 1SCRA 2VW0A 1QF3A 1WCSA 4PQ9A 4XTMA 4JRAA 4M3CF 2DVGA 5GZDA 2E6VA 1ULFA 3ZXKA 3M3CA 2GN7A 1A3KA 4FPGA 5IK8A 3BTAA 3SISA 2UURA 2WKKA 3TB0A 1SBEA 4XJ9A 2PHFA 1DBNA 1IS5A 1ULCA 5KXDA 1SFYA 1KDMA 1W6MB 1FNZA 2WQZC 3AZWA 3IMNA 4YZ2A 3U4XA 4CZSA 2V5YA 2VU9A 2AH2A 2OUJA 4XE9A 3MW4A 2AREA 1AVBA 1CPMA 1NXD1 5DG2A 1UAIA 2JE9A 1DQ4A 1QMJA 1URXA 3RQ0A 2JE7A 3A0KA 4Y26A 1W6MA 2LTNA 1JBCA 1MS1A 4FPKA 3N3HA 1QDCA 1V00A 3WCRA 3PVEA 3ENRA 4SLIA 5GALA 5IT6A 1Q8QA 4IQPA 1IS6A 1MS5A 1N1YA 1JYIA 2GNTA 4YG6A 2ZA9A 1LU1A 2ZAAA 3AK0A 4JC1A 4M3CE 4XTPA 1CJPA 4XZPA 1N3OA 1C57A 4DRVA 1QNYA 5HCAA 5T54A 2UU8A 3N7KA 1UZYA 2AYHA 4FPCA 4LBNA 5CB7A 3WUCA 1GANA 1IKPA 1S0JA 2ZGSA 1PZ8A 4F83A 5JOWA 1ULEA 1MZ6A 3M3OA 4UW5A 5HCBA 2JJ6A 1QU0A 1OKQA 4XJ8A 3OGGA 5BYNA 2NMNA 4XDQA 2WJSA 2GNMA 4LBKA 3WDYA 2EAKA 2GNDA 5EYXA 1KJLA 3R4SA 1S0IA 1OQ1A 2VH9A 3IN9A 4YZ4A 2A7AA 3PVNA 4Y1VA 3B3QE 3W59A 2AUYA 2WT1A 2A5ZA 2YMZA 3WNXA 4FPFA 1UN1A 3N7JA 4XIOA 4Y1UA 3ZXEA 4XXAA 4FVVA 4XJAA 1CPNA 3BODA 1QDOA 1S0EA 4C1WA 2NYYA 2ZKNA 1Q8VA 2DTYA 3APBA 2A6VA 2CY6A 2VXRA 3NV4A 1V6KA 4H55A 4YGEA 1KRIA 2B7YA 3FLRA 4Y22B 4Y24A 1XQNA 5FREA 3N7LA 2OUHA 1GLHA 4OZXA 1GZWB 2XB6C 3WHUA 2HYKA 3N36A 3WVJA 1LHWA 4YG3A 3V0AB 2JDZA 3WDXA 1LULA 4Y22A 2D6LX 1ULDA 3OY8A 2ZGNA 1FNYA 4XBNA 1DYKA 1LOFC 2ZHNA 2CNAA 2D3RA 4HANA 4LBMA 1GZWA 4YW5A 2SBAA 2D3PA 2D7FA 2ZMKA 1SBFA 2D6PA 5E88A 4FPEA 3D6EA 1VIWB 4AGRA 3MEPA 2A71A 1RIRA 2DU0A 2YY1A 4WZFA 1YIFA 3AYEA 3O0WA 4RL7A 2A75A 2C5DA 2XG3A 3VKOA 3ZPYA 1EPWA 2GDFA 3L2YA 3PMEA 1V6OA 4WVWA 5DG1A 4P9WA 4LBQD 4YZ1A 2VUAA 4PF5A 3B9CA 1AF9A 5T52A 3KQRA 1SLIA 5EYYA 1WBLA 1YXWA 4M3CB 1PZ7A 3VKLA 2DYCA 5LK5A 1HDKA 1DYPA 3O5SA 4LBLA 2PHTA 2W68A 3VKMA 1GV9A 4XHXA 2ZGOA 4XHBA 4BOWA 1G9CA 1FX5A 1AXYA 1KITA 1LHOA 1J1TA 3FUOA 2H0BA 5AVAA 4M3CA 4BMBA 3A4UA 2DVFA 4XMAA 4XJUA 1G9DA 4ZXKA 5KXBA 1KJRA 1SLLA 2GMEA 1DIWA 2D44A 3WCSA 4BQ1A 1LCLA 2E53A 5T5OA 4CRQA 4R9BA 4YW4A 1UZZA 4FP2A 4NOTA 4DPNA 1MZ5A 5T50A 4Q1RA 2WT0A 4RA0A 1MS4A 4YGCA 4Z8BA 5JMCA 4Y20B 2D43A 1UPSA 4GA9A 1AX2A 4FOQA 2D6OX 2DUOA 2FMDA 1SBDA 4LBJA 4AGGA 5F9TA 4YZ3A 4BLIA 3PJQA 4ISRA 2P3IA 3OBTA 1SLBA 2JD4A 2G4IA 1W0PA 4Y20A 3ATGA 3ILRA 4FQZA 3POSA 2ZGLA 3ZSMA 1GYKA 1MS3A 2ZBJA 3SNMA 1N47A 4Q26A 3SH4A 1JUIA 1FYUA 1W6NB 3DUIA 3WG3A 1HQWA 1MS9A 3B69A 1MR5A 5GZGA 1C1FA 2A70A 4PBPA 3IKWA 1HQLA 1TEIA 5GZEA 1VALA 1FAYA 2YV8A 2E7TA 4K21A 1ZM1A 2JKBA 1W6NA 3INAA 1DQ1A 1W6PB 5GZFA 3SH3A 3WG2A 4U36A 1LHUA 2W08A 1ENSA 2D6NA 3VUOA 3ZXJA 1W6QB 3MW2A 4HL0A 5JLVA 5GM0A 1BQPA 1IKQA 4WVVA 1H9WA 1V6IA 3WV6A 1G9FA 2OVUA 4XOGA 3NV3A 2GALA 1LOCA 4YFWA 3MW3A 2NN8A 1LU2A 4XILA 4YFZA 3USUB 4Y1ZA 2Z42A 1G7YA 3V0BB 4XYXA 1F9KA 5GLUA 2ZHLA 1LGCA 1Z78A 3OBRA 2DUPA 1FV2A 2ZMNA 5JOXA 3V64A 3AP5A 3HN1A 3USUA 1DQ0A 4WV8A 5HCFA 1I3HA 1LGNA 3MPPG 4Q8LA 4R9DA 3W58A 3ZVXA 4Y1XA 1JOJA 4XIKA 1DQ6A 5T5PA 3IPVB 4AVSA 5H9RA 3SLIA 2GMMA 3BOPA 4FOYA 2EALA 1H9PA 4FOVA 5T55A 1FV3A 3AJYA 2ZACA 3AXDA 4XXPA 5CNAA 1R1ZA 1I1EA 1WUVA 1UMZA 5JOZA 4AVVA 2WLQA 2P37A 3GALA 4W65A 2WSVA 4XMIA 1JN2P 1KDKA 1VLNA 2R49A 3FLPA 3WDUA 5DUXA 5CAZA 1FATA 5H9SA 1GZCA 1AJKA 1MACA 2DU1A 2ZZJA 3RG0A 1LEDA 1SLTA 2WT2A 1LECA 2WNEA 3AZXA 5F5QA 3V0AA 3WG4A 2P3JA 4CTEA 4KBBA 1WLDA 1JYCA 5SV8A 2V73A 1O4YA 1G9BA 4FPOB 4BM8A 5E8AA 1WW6A 2UWCA 2EXKA 3FUQA 1DQ5A 3BIWE 4LBOA 4YW2A 4MYEA 4DQAA 4FQ4A 4ZKTB 2E51A 5H9QA 1BYHA 3RRDA 4AGVA 2E7QA 4K20A 4R9AA 1W0OA 1Q56A 3OYWB 2AR6A 5GZCA 1G8WA 2R0HA 4K1YA 4L8QA 3POYA 1BZWA 1DZQA 2CL2A 2VW2A 3LSDA 4UW4A 1APNA 3AX4A 2GNBA 3R05A 2FHRA 1LODA 3RMYA 1D2SA 3A0NA 4YG0A 2A6WA 1S0GA 1ONAA 1QOSA 2ZGUA 3B01A 3ZXLA 2R1DA 3TAYA 1RITA 3AP7A 1QOTA 1PZ9A 1WW7A 1LOAA 1YO8A 2ZHKA 3AJZA 5KXEA 1YI7A 4YGBA 1JXNA 3WDVA 1AZDA 3UJQA 1LOEA 2W39A 1SLCA 5GLVA 1QNWA 4DS0A 3QLQA 4FPLA 1LOGA 1IS4A 1U0AA 2TEPA 3AP9A 1DHKB 4M00A 3ZSKA 2OW4A 1VAVA 2Q5TA 3SH5A 3WDWA 4P14A 3O0XA 2BQPA 1ENQA 1GNHA 2P3KA 3AFKA 4UW6A 4GKYA 1CVNA 4BPZA 2P2KA 1AX1A 3NWKA 1WW4A 3ZSLA 3AZVA 4P9XA 4YM3A 1C1LA 1GKBA 1SLAA 1WW5A 2CTVA 1GZ9A 4TZDA 4LBQB 1MVEA 1BKZA 3HMYA 3T1MA 2ZGQA 4U2AA 2DUQA 1LESA 3UJOA 3ZXFA 2CWMA 4BMEA 3D4KA 4YW3A 2ARBA 5JDBA 5JOYA 2LALA 4FPJA 2EXHA 5JVVA 2GN3A 4LBQA 3WOGA 4Q27A 2D3SA 2YROA 1V6MA 3M1HA 5GJ6A 4AWDA 4DRRA 1ENRA 3POWA 3Q9OA 1HLCA 4FP3A 3ZYRA 1JHNA 2A3YA 3M2MA 1X50A 3OPZA 3O0VA 1SCSA 2EXIA 3VKFC 1LJ7A 3M3EA 1LOBA 1N1VA 1W6PA 5CA6A 4GKXA 1ULGA 1DQ2A 4Q2FA 1CQ9A 2ENRA 3T1LA 2D6MA 1GNZA 5FRAA 1Z0HA 1GSLA 1W6QA 2JECA 2R1BA 3FBYA 3QCWA 3H0OA 1CN1A 3WHTA 1AXKA 1N1SA 3AP4A 1HKDA 2PHWA 1H30A 3NV1A 5EXOA 4YW1A 4C1XA 1G86A 1A8DA 2EIGA 1IS3A 2PHRA 3AZYA 2CWSA 4ATEA 4FPHA 1KQRA 1LOFA 2W52A 1LEMA 3N35A 1BXHA 1S0DA 1WLCA 4TYSA 1CR7A 1N1TA 1QKQA 3ILFA 3V0BA 1ZA4A 5GLWA 3UK9A 4PCRA 4ATFA 5IK5A 4GALA 1AXZA 2PELA 4GXLA 3UL2A 3VKNA 5EWSA 3KM5A 1GBGA 1CESA 3JUUA 1AX0A 1UL9A 4XJZA 1S0BA 4Y1YA 4AVTA 4PBOA 3IM0A 2DTWA 1QGLA 3FFZA 1Q8PA 2A6YA 1SACA 2DVAA 1QOOA 1WBFA 4YM2A 2NMOA 2R0FA 2ZGKA 1B09A 1Q8OA 3IPVA 1LENA 2ZABA 3HR9A 5T5LA 2P34A 1IOAA 3PVOA 4XJWA 1YYNA 5DZFA 1S1AA 3I4IA 2DV9A 1CONA 5GLTA 2DWRA 3V65A 5DUWA 2R16A 3D5OA 5DUUA 4YGDA 3RS6A 4YZ5A 2UWBA 3AYAA 2WSUA 4ISQA 3WLUA 1AJOA 2GMPA 1RINA 3AYCA 2UWAA 2AGSA 1BJQA 3OY8B 4K1ZA 5DZEA 2NP0A 3C2UA 2SLIA 4ASMB 1D0HA 4M01A 2A3XA 1F31A 4NO4A 4XBLA 3RSJA 5DXDA 3RMXA 5E89A 2ES3A 3DGTA 4GWMA 2YZ4A 3T2TA 2DVBA 3VV1A 3I8TA 2VW1A 4I30A 1LHVA 4DFSA 5IK4A 3O12A 2ZGTA 1N3QA 3WDTA 2DURA 4AYUA 1LGBA 1O4ZA 3NV2A 1W6OB 2I2SA 3ASIA 2VY0A 3CNAA 1G9AA 2AENA 2PHUA 2ZGRA 4FPYA 4YLZA 5IUQA 4D69A 1OFSA 1GICA 1Q8SA 3OYWA 3JU9A 5T5JA 1W6OA 3WZ1A 5DZGA 2YXSA 1F5FA 5KXCA 2KM2A 1Y7BA 4P9YA 1UX6A 4R9CA 1MS0A 1S0FA 3AYDA 1NLSA 1N3PA 1V6JA 1VAMA 2ARXA 2CYFA 2DVDA 2ZGMA 3FLTA 4XBQA 2C9AA 5CBLA 5L73A 2ZGPA 2NM1A 3ZSJA 1WLWA 2ERFA
chains in the Genus database with same CATH superfamily
1ULPA 2JDAA 2DCKA 1ZA7A 2VVFA 3FN9A 3AXEA 2RDQA 1K5MA 2RMU1 1V6LA 1W9WA 2X53S 3VHNA 3R0RA 1OUSA 2EF6A 4AI9A 1XSRA 2OX0A 3GM8A 3MDPA 5LZ6A 1LB2A 3NNLA 1LTEA 2KR2A 4IE0A 4DXTA 4XETA 4YM0A 3UT0A 1RUOA 5JZGC 2R071 4FFHA 1RUE3 1SZBA 3I2GA 3SQOA 2VZOA 1CIWA 3HQUA 2D6KA 3IDBB 1G6NA 2RJKA 4BK5A 5L7OB 3SEPA 4Q1PA 3J7NA 4RR3A 5FYVA 1VBC2 3LCPA 1O3TA 4GB32 3HNBM 5KHIA 3LEKA 3PUQA 3VDBA 4QPIB 1ULFA 1W03A 2XVLA 3VBFB 3ITQA 3E5XA 4GWIA 3DECA 4FPGA 5A6ZA 2JDPA 5IATA 5IK8A 1QJU2 5FZIA 5HPOA 1RUC1 2VOWA 1W2OA 2X29A 3CJIB 2XQRA 1NYWA 1IS5A 1BBT1 4BE3A 1SFYA 3IMNA 4I01A 5FYHA 4COWA 4UFLA 5FZFA 1A6CA 3WQ0A 4A44A 2AH2A 4CXWA 1J1LA 1HB2A 2YBPA 4UBGA 4DUXA 4XQ4A 3RJ2X 3K4DA 4CUAA 5DG2A 2JE9A 3I59A 3RQ0A 1WMEA 1R1A1 4KWLA 3TRSB 1W6MA 2HWB3 2LTNA 4C91A 2E9QA 1MS1A 4Q4X1 3N3HA 5FZ1A 5LK7B 1EUUA 3KT7A 3PVEA 4LKEA 3ENRA 4X8NA 5GALA 4B4RA 4COVA 5CISA 1MS5A 4A41A 4ZXEA 1CAXA 4YG6A 1W2TA 2BPA2 1DCSA 2ZAAA 1UIJA 1VBD3 2RM22 2EIDA 3AK0A 4JC1A 5LB6A 2IC1A 1N3OA 2JG9C 4DRVA 1A8MA 1QQP2 3BALA 3N7KA 4LBNA 4L92A 2Y8KA 3GDBA 2P6CA 3N9NA 3KLSA 2Y26A 3KMHA 5LCWL 3A7QA 1NZCA 2FDKA 2AEZA 4UW5A 2VR4A 2L9LA 2ZCWA 4Z2WA 1O6UA 2XDVA 1JYVA 3DV8A 1KD7A 2GNMA 4LBKA 1HRV1 4O7XA 4I3PA 4TLFA 5BNPB 2RVAA 4OUMA 1NY72 3JBG1 3W59A 1FXZA 2WT1A 1UZ0A 2K2SA 2CAUA 2LS6A 3ZXEA 4FVVA 4XJAA 4DY5A 3BODA 1W9FA 3I54A 5JSRA 2DCYA 2VXRA 4HMZA 1V6KA 3ACHA 5FJHA 4UWDA 3KZ4C 1O3QA 4F3JA 4XF9A 5BV6A 2J1RA 4LO5B 5FREA 5FWJA 3N7LA 3VBUC 3VBSC 4NAMA 4P9GA 5IVBA 4MVTA 3KCXA 3MPBA 5A7WA 3N36A 3KT4A 4YG3A 4CDQB 1UY0A 2WIIB 3EB7A 1PX4A 2D6LX 3QD6A 4N7UA 2I07B 2QDNA 5FUPA 4IGOA 4HANA 3PTRB 2D3PA 2XVKA 4QDRA 3UGHA 1OQEA 4AGRA 3MEPA 3U11A 4A7YA 4WZFA 4ONUA 3KF3A 4RL7A 2ZX3A 2XG3A 5A7PA 3ZPYA 4PLNA 3U10A 1BK0A 3PUHA 1V6OA 5BNOC 4K6BA 2Z5WA 1RUE2 4KWKA 4P9WA 3GJBA 4LBQD 3B9CA 3MGUA 4RS5A 1W8NA 3KQRA 3MV11 5EYYA 1WBLA 4M3CB 5G05L 5C6CA 3N9OA 2W9XA 1VBB3 3HT1A 4LKSA 2YU2A 4HK9A 2QDRA 1C8NA 3VKMA 4UFKA 4XDPA 1GV9A 2QQOA 1GP4A 2VNRA 2ZGOA 4XHBA 4XHXA 2FZ1A 3ORJA 4MGKE 4A6OA 5C70A 5IAVA 2ET1A 1KITA 1LHOA 2WNVC 3FUOA 4BMBA 2VPVA 2XOMA 3K51A 1NCQC 2Y33A 5EPAA 4AEDB 1TMF3 3KS7A 1ZBA1 4GMP1 2Z69A 1DIWA 2ZJCA 4JGYB 1JYNA 1LCLA 3ABZA 4CRQA 4OFGA 3P3NA 1UZZA 4NOTA 4Q4Y3 4XURA 3VN4A 4Q1RA 4YGCA 1MS4A 2FQPA 2RDRA 3RZZA 1HV1A 2D43A 4K3UA 4TWTA 4S2GA 1UPSA 3LGRA 4FOQA 3VZJA 2D6OX 2DUOA 2JX9A 2HWB2 1H2LA 5J36A 2P5BA 4DXSA 4AI1A 5LBFA 1B35B 3CIHA 4L0PA 4LR4A 4XFIA 5ISLA 3ZYHA 1SLBA 4XFGA 1RXFA 1VBD2 2ZEWA 1PO11 2QQJA 4FO9A 2MEV3 3ZSMA 4C0HA 5HI0A 4W6XA 1ZVFA 5FUIA 1FYUA 3PDQA 3H7JA 3SEEA 3VBHC 1MR5A 1ZYBA 3J8F3 1YIPA 2A70A 1TEIA 4AI2A 4D6RA 3A22A 3VDDA 4D7TA 2YV8A 3B7MA 4NIHA 1MQTB 1ZM1A 2IFRA 2JKBA 3KF5A 4BQ3A 5C3SA 1VBA3 1W6PB 1UY1A 4KL1A 1GWKA 2JENA 4PLOA 3RYKA 3ZXDA 5IYYA 4U36A 3T0DA 3IIAA 4XCAA 4E27A 3VUOA 1CZSA 1W6QB 3MW2A 3BI3A 5JLVA 4Z07A 3F95A 2YFUA 3JQWA 4PJYA 2ZX4A 1JZ5A 4RGAA 5C3RA 5CG8A 1V6IA 4GH4C 4C8DA 4A3XA 5C8WA 2OVUA 5FZGA 1U5ZA 2GALA 3J7LA 4ASLA 5JXHA 4QPGA 4YFWA 4LNVA 2NN8A 4XQWA 3T4VA 1C28A 3WXPA 2J22A 4YVWB 3GF6A 4Y1ZA 3USUB 3CBNA 1O3RA 1BEV1 2VGDA 4M0NA 3V0BB 3DXTA 1WKYA 3C7HA 5FXXA 2ZHLA 5FYSA 3ZFEC 1Z78A 4RQPA 4FAGA 3GHMA 5KC6A 1XE8A 4XQDA 4XUQA 3WF1A 3O1RA 4A3ZA 4CU9A 5JR2A 1JZ2A 5A7QA 5A6YA 3W58A 3VD5A 2P1BA 3CZUA 4QPIC 3D0SA 3VD9A 2BW8A 1DQ6A 1ZBE3 5T5PA 2FDHA 1NT0A 2W91A 1YFXA 4AVSA 2WA4A 4GAZA 2PHLA 4D8MA 2J1VA 4P02B 4FOVA 4RHV1 5FFOC 3CHXA 2OQ6A 2WO1A 2K46A 3WNPA 2YPDA 3CJIC 2WR9A 5HCHA 1UIKA 1WCDJ 3WW1A 1US2A 3U37A 4FXGB 2JG8B 1VBB2 5LW9A 2OT7A 4AVVA 1PGW2 2WLQA 5A3TA 2WO7A 2WSVA 1LKNA 1NE4A 4I2OA 1BMV1 3WDUA 2J1SA 1FATA 1GZCA 1MACA 3RG0A 2VAUA 2RR11 1F2NA 4JV4A 5F5QA 2P3JA 2H0VA 2EICA 4JQRA 1JYCA 3BGAA 5SV8A 1NCRB 1TMF2 2V73A 2QFEA 5DDJ3 3SKJE 4COZA 1ZRDA 4P5YA 3FUQA 1DQ5A 3MLKA 4LOTA 3IIIA 4BCUA 5JZGA 1CWPA 2VO5A 4MYEA 5FYUA 1YNAA 3I3MA 2E51A 2P4EA 1CGPA 1EY2A 1QH6A 4Q4Y2 1BK1A 4IDZA 1RUF3 2XVGA 3VHOA 1PHMA 4JTNA 1EYBA 5BNNB 1W2AX 2AR6A 3MI8A 4TN7A 5A7OA 4L8QA 2XJSA 3FHAA 1RUI3 4QGNA 4H3WA 3T2OA 5FXVA 3R05A 2GNBA 4ZU4A 1D2SA 2E31A 5ANQA 4YG0A 4JAAA 1JYWA 4DUVA 2MEV2 4QT6A 4HVOA 3WNLA 1ONAA 2ZGUA 1TME2 2R1DA 5FDBA 2BERA 2RS53 3ETQA 1VBC1 1H8TC 1QOTA 2W0XA 3MFAA 3AJZA 1JZ4A 1RHI3 3D8CA 4M4RA 1AR63 3BN6A 4GB31 3J8F2 1AZDA 2W1WA 1LOEA 3PU8A 5GLVA 2PA7A 1SHWB 1LOGA 4LKDA 4AI3A 1DHKB 5FOJB 1QJU1 2YDEA 3NL1A 4NPRA 1VBA2 2OW4A 3WDWA 2Q5TA 3HQRA 2IXIA 3HNYM 3MYXA 3O0XA 5I0SA 2BJSA 4YW6A 5I91A 2B45X 1WA6X 4QKFA 1DZRA 2J42A 1M4WA 1UY2A 4GKYA 5ABJC 5D2AA 1F15A 4BPZA 1CAUB 3ZSLA 1DZTA 3OBZA 4FTSA 1WW5A 2OYZA 2JG9A 3EXUA 1HRI3 4TZDA 1GWMA 5LA1A 3KVAA 3RWNA 1MEC1 3DKWA 4WM8C 5FZ7A 5FWEA 4L2NA 5JCTA 2YC0A 1ND2C 4U2AA 2DUQA 1LESA 5L9BA 3RNSA 3ZXFA 4H14A 1HN0A 3S7EA 1FPN3 2EVXA 2PAEA 5JOYA 4HVRA 1RUG1 2BU9A 1OFNA 1OSGA 1YQ5A 4YVSA 4QX1A 2XLGA 1OKOA 4JDOA 1K5MC 2D3SA 2RM21 5F2WA 4AWDA 4XUTA 4CEWB 1QQP1 3KHBA 4CCOA 3KCCA 2W47A 3VKFC 2EXIA 2VMCA 4XAAA 3KSCA 5FIXA 3MIBA 1ZBE2 3AFGA 4CE8A 4N9HA 2GH2A 4XACA 3LPGA 3VZNA 1HN1A 4Y5TA 3T1LA 3ME2A 2D6MA 5FZDA 3VBSA 3CEWA 4AVCA 4FCAA 3QCWA 1GSLA 1XYNA 2R1BA 4BQWA 1W9TA 4IE7A 5I0RA 3LE0A 1NY71 2GP5A 2VE1A 4OZOA 2Q4SA 2VQTA 3AP4A 2PHWA 3MLJA 5J7MA 1G86A 4J1XA 1C5HA 4MXVA 1XNDA 2BWAA 2CWSA 5JUVA 4E4ZA 4FPHA 3KV6A 1LEMA 3N35A 2XKPA 1S0DA 1EUTA 2BGPA 4E9KA 1N1TA 3D82A 2ZEZA 4O9EA 4PCRA 5K0UC 4EWEA 4GALA 1AXZA 4ZHNA 5DDJ2 5A33A 4MGSA 4CA9A 3NAPB 1JZ3A 3POIA 1YFWA 4QX5A 2DTWA 1Q8PA 4BQ4A 2QQIA 2JDMA 1RUF2 2Y0IA 1QOOA 4YM2A 5IVFA 2R0FA 4W4ZA 1Q8OA 2Q0AA 2JICA 2ZABA 5EP9A 1W06A 2PTMA 4IEVA 3TN92 4BXFA 1S1AA 1RUI2 5C9AB 1MQTC 2WNVA 1GOFA 2F17A 2WZR3 4XC9A 3OUJA 2UWBA 2IXCA 2WSUA 1RUE1 1CAWA 2W46A 5APAA 1Q3EA 1RINA 3AYCA 1NCQA 1BJQA 1DLCA 3OY8B 5FP8A 2SLIA 2RS52 2VD7A 4UT5A 4CCEA 3J9SA 2WNUC 4AK3A 1RHI2 4XBLA 1XNAA 2B9VA 2WLPA 2OZJA 2VUJA 2VMDA 4LHSA 1AR62 4LOSA 4JZRA 4ORFA 4OHWA 2BDRA 3DGTA 3S57A 1UQXA 3VV1A 5FOBB 4I30A 4QAWA 3WNNA 3O12A 4S2HA 1N3QA 3GYDA 2ID4A 2N7GA 3NV2A 1O4ZA 4V1PA 4AVBA 5FYIA 2MHFA 3ASIA 2VY0A 3CNAA 1G9AA 4L11A 1QJY1 2QQLA 3ZIWA 3L2HA 4BQXA 2PFWA 1OXCA 4D69A 5A3LA 1XBFA 3OYWA 2Y0OA 5T5JA 3BCWA 5EQUA 5LA0A 5EFUA 3QACA 1UYZA 4IW3A 1HRI2 2Y6JA 3MFCA 4QB1A 3AMPA 4QX2A 3LEGA 4Y5Z0 2YXSA 3BYWA 3LDBA 4ARYA 4A45A 4CUCA 2WDBA 2HWB1 3VBHA 4R9CA 3TBDA 1VAMA 1V6JA 2ARXA 3W9AA 3G6JB 5CBLA 1FPN2 3FLTA 4XBQA 5KHJA 5L73A 4CVUA 2NM1A 3ZSJA 1PX3A 5F3IA 2R6QA 1YCIA 1VBD1 5IFTA 3OG2A 1MVQA 2HWF3 1QIQA 2NLRA 4XF1A 2NZ9A 5A6QA 3AZZA 3T08A 5TSWA 3WP4A 2X09A 4NMIA 3ZYPA 2MPFA 1S0CA 1JMUB 1UX7A 3RZGA 1H0BA 1WD3A 1IG3A 1DFQA 2V4VA 2VOTA 2A6ZA 4INDA 2A3WA 3W5NA 2J1TA 1YQ8A 2W92A 2R7EB 2ZHMA 3B00A 1RMU3 4GH4A 4RS5C 4UW3A 5C71A 3OJBA 3LSEA 5J09A 1LHNA 1YRZA 5J37A 3VZLA 4Q8KA 2A6XA 1ST8A 1W2NA 1XNCA 3IB3A 2JDNA 3J7HA 5FZOB 5F39A 2VW0A 3NJYA 1QF3A 2ADEA 4XTMA 2BYVE 5A1AA 3VL9A 5GZDA 5FQ0B 1K5JA 1ACCA 1XC6A 3M3CA 2GN7A 3MICA 5FZKA 4EE2A 5FP9A 3POJA 4MLOA 3BTAA 4PIYA 3SISA 1RB8G 2YGLA 2WKKA 3ON7A 3PL0A 3ZR6A 1XB9A 3PTYA 4IEOA 4XJ9A 3WNMA 3BKZA 4TXWA 4QPIA 2VOVA 4J1WA 1ULCA 2FBEA 4D6QA 4CU8A 5KXDA 1AL23 1KDMA 3UESA 4F8AA 3I2DA 4YZ2A 3U4XA 4CZSA 1J59A 2V5YA 1HB1A 1W9SA 2PAMA 3DN7A 2AREA 3MW4A 4AFBA 1WLTA 3CJIA 1NXD1 5DAXA 2JE7A 4Y26A 3THDA 5LY2A 1JBCA 1AR83 3AKQA 1QDCA 3WCRA 4K9SA 4IQPA 3H8OA 1N1YA 4ZZ8A 1JYIA 3HBKA 4BQ2A 1LU1A 2WZR2 1HJGA 1O5LA 1UY3A 4M3CE 1TZOA 1V70A 1UOJA 1C57A 1D4M3 1QNYA 2W87A 4Q4V1 3KV4A 2G1MA 3WUCA 2J1AA 5CB7A 3ACGA 2RV9A 4QB2A 5CU1A 1S0JA 2HH9A 2ZGSA 5JSOA 5LATA 4F83A 2OXBA 2UY9A 1VBB1 4ET7A 4LO4B 1PGW1 2JJ6A 1QU0A 4XJ8A 1JHJA 4LO8A 5CFCC 1WZXA 4KI5M 4XDQA 3Q8AA 2Q8OA 3LEMA 4CDWC 4MGZE 2GNDA 1PM7A 3OB8A 3R4SA 2VH9A 3DEMA 5IVCA 4CDXB 1QY4A 2A7AA 3OEAA 5FP4A 1L7QA 4KGQA 2FDGA 4AFAA 2VECA 4Y1UA 1TMF1 1DGWA 1QHDA 1X7NA 2B5HA 4RD7A 1UKRA 3APBA 2CY6A 3NV4A 2ETEA 4CEWC 4EN7B 2B7YA 3FLRA 4Y22B 1OC1A 1XQNA 4NROA 1W99A 4Q4Y1 4QDSA 3ZSEA 2XJTA 4ASKA 4OI4A 1PGSA 1ODNA 1QXPA 1H8TA 4LO7A 4OZXA 3WF2A 1KFUL 4NHYA 2HYKA 4LK6A 3WQBA 4EV0A 3WVJA 3H1WA 2XLAA 3V0AB 2JDZA 2ZZQA 1IQDC 3OD4A 1DGRN 3LPFA 3DPRB 4RQPC 3PJYA 2ZGNA 4XBNA 1RC6A 4LK7A 1DYKA 4XF3A 2ZHNA 1IZ3A 1OA4A 1CX4A 2CNAA 2VZVA 4LBMA 4YW5A 2MEV1 2VZ3A 2D7FA 2HWF2 1ZX5A 2ZMKA 5C8CC 3J4UH 3VBOC 5E88A 4FPEA 2PAKA 1D7PM 1H1AA 4MH0E 2E33A 3BTZA 5KWRA 1WMDA 3O0WA 1J84A 3J7MA 3VKOA 3K4AA 1XE0A 1EPWA 1O4TA 3RI9A 4ZU7A 3J8F1 2VZSA 3PMEA 4NJ4A 4S2FA 4WVWA 5K4LA 2PHDA 1X36A 4XFHA 5DG1A 4OI0A 4IV3B 2VUAA 4PF5A 1RMU2 4NE9A 3W21A 1SLIA 3NKGA 4WM8A 2VCMA 1ASJ3 1VBA1 1ND2A 2B4KA 1WCUA 4QDQA 3HWJA 4TLGA 5LK5A 1WMFA 3O5SA 5EJ3A 1YFYA 2W68A 2Y6KA 3DF0A 4DXZA 1OVSA 4BOWA 2Y6GA 1FX5A 3TNPB 3VDCA 3ZFFB 3LZZA 3GGLA 4N53B 4D94A 1LNSA 2H0BA 4M3CA 3A4UA 2XLFA 1PK6C 4IXLA 3BPSA 4M0HA 2VC9A 5JR7B 3UETA 3CU7A 5F6KA 3GCWA 3WEZA 4IE4A 3JXSA 5KXBA 1SLLA 2WZEA 3WD5A 1AL22 1K12A 1NG0A 3LA7A 3MF6A 5T5OA 4BJ0A 4R9BA 1I5PA 1LR5A 4FP2A 3W20A 4DPNA 1CAVB 1MZ5A 4NN0A 1NOVA 4UF0A 2ZTNA 4AEDA 5JMCA 2J1UA 2KXLA 1LRHA 3AVRA 4GA9A 1SBDA 4LUKA 5A32B 1I6XA 2XL9A 3VZMA 1AR82 2V5DA 1Y3TA 4OUSA 1ZBE1 2P3IA 2JD4A 1US3A 5I0DA 1W0PA 3I3EA 1UW8A 2JB4A 3ATGA 3ILRA 4Y3OA 1J58A 3AMQA 1H6XA 4CCLA 1GYKA 1RUJ3 4UAPA 3SNMA 2XWBB 2A1XA 1D4M2 2XJVA 3E5QA 3FHIB 3T2PA 4WVMB 1SFPA 4QQ2A 3SH4A 5K0UA 1W6NB 5JIAA 3WG3A 5A7SA 4UFIA 1DU3D 1MS9A 3E6BA 1OVPA 3LFMA 1O8SA 1J3RA 5KBFA 3RYPA 3IKWA 1HQLA 1XPWA 2WO3A 4A2UA 3ECQA 1AUYA 4EYUA 1EAH3 1FAYA 3ZN6B 2C24A 4AAPA 1W3XA 4Z82A 1H6YA 1DQ1A 3UKVA 3SH3A 3WG2A 3F2ZA 3K46A 3KT1A 1AYM1 3PHMA 5LEKA 2W08A 4QPWA 4WM7C 1F4HA 4MGTA 2BP6A 5DDJ1 4CCKA 4HL0A 5FJKA 2O0OA 2E7AA 2YYOA 1MQTA 5JXGA 1IKQA 4LA2A 1PNGA 4WVVA 4AVAA 4QXBA 1G9FA 3BU0A 2JKXA 4UBHA 1RUF1 3H42B 3CL1A 3IMMA 4N43C 3WF4A 3A21A 1LU2A 1PNFA 2WNUA 2RE9A 3S7IA 4QD2A 1G7YA 2ATFA 1UYXA 4YVSC 1RUI1 5GLUA 1LGCA 1UXXX 3OBRA 2P17A 1YWKA 2DUPA 5EJ1B 2XMLA 4Q4W3 3AP5A 3HN1A 3N9QA 3HD8B 3TOJA 1DQ0A 3USUA 2O1QA 3T2QA 1F4AA 5HCFA 3DYMA 4Q8LA 4R9DA 1ODMA 1WA4A 4FI9A 4DUWA 2RS51 3ZVXA 3TEYA 4Y1XA 2HWE3 3GCXA 2WO2A 3IPVB 1AR61 4NVPA 1OOPC 1GU3A 3ZLIA 3MIDA 1FV3A 4ZONA 3KWVA 4MZUA 1NZIA 1HX6A 2ZACA 1ASJ2 1HB4A 1R1ZA 1I1EA 1TVGA 4MXWB 2P37A 5IW0A 4NPLA 5F3CA 2X05A 1JTZX 1KDKA 3BB6A 1VLNA 3FLPA 4CDUB 5DUXA 3KCYA 3TYJA 3IT8A 2ZZJA 3I7DA 4BQ5A 2WABA 2J7MA 2XQXA 4LE3A 1LECA 2WNEA 2VTFA 2HWC3 2RG4A 5LA2A 3WG4A 3ZOIA 1HRI1 3DL3A 3POFA 5CIRA 1Q5OA 1WLDA 4L9BA 3BPZA 4QHOA 3IDAA 4IETA 4Z92B 4BM8A 3B5LB 2UWCA 5A1FA 1FPN1 2C0ZA 1PO23 5I8SA 4DQAA 1OH3A 2DF7A 5B4XA 4CUGA 4BWOA 1UOBA 4RFRB 3C7GA 5H9QA 1QWRA 2VTXJ 1HJFA 1NCRA 1R083 3U4SA 4K20A 2GSYA 4R9AA 1Q56A 1WGPA 1FMD3 1TQ5A 1X9TA 2BWCA 4K1YA 4CP9A 4N8MA 4EN6B 1DZQA 2CL2A 2VW2A 1I9RA 1RTVA 3VL8A 1APNA 2WQ8A 2DCTA 1LODA 2FHRA 4XCBA 4CDXC 2CGNA 3ZM8A 1S0GA 1W05A 4NIGA 1RUJ2 1QOSA 4W50A 1TNRA 3HAGA 4MGQA 1RITA 2TBVA 4IEYA 4LITA 3N9PA 3ZXAC 4AL9A 4WVZA 2O14A 1OH4A 1AYN3 3PVBB 5AC93 4A6SA 5D1IA 2JD9A 3WDVA 4UFJA 3FX3A 1QNWA 1IPSA 2ORZA 3KGZA 1W3VA 3EYPA 3WR0A 4DIQA 1EAH2 4C0BA 2YC4A 3AP9A 4M00A 4BZ4A 1VAVA 5FY0A 4P14A 2BNOA 5F5AA 4OUEA 5JAXA 1CZVA 1GNHA 2P3KA 3AMMA 3POBA 5DAPA 3S5AA 1GP6A 4HXCA 4RR3B 1OUXA 1V0AA 3ZFGC 1WW4A 2BFUL 4EQVA 4P9XA 4AHYA 1SLAA 2CTVA 1TME3 1COV1 5A80A 3UGGA 4HPKA 3W5MA 1S55A 1QEXA 1ZNPA 1AR73 2ZGQA 3H9AA 4MOAA 5ANNA 3UJOA 4JVAA 3ZKUA 4AI8A 2XBO1 4JGZB 4BMEA 1XYPA 4DINB 3PU3A 4AF9A 5FMDA 2LALA 5CFCA 1QXRA 4DEQA 4P5HA 5JVVA 3LB9A 4CDWA 5HV4A 2VZRA 2WZR1 1F8VA 2YROA 5C4WB 2XUEA 1DDLA 4Q4W2 3POWA 3Q9OA 2XGXA 1X50A 3IWZA 3M2MA 3OPZA 4AXOA 4W6YA 5BUVA 3N9LA 1SCSA 3AL6A 3M3EA 2XHKA 4CSWA 2HWE2 5BXXA 1MZEA 4AZZA 2GH8A 1ULGA 2OA2A 1D4VB 2VOKA 4CEWA 1PGL2 4CP2A 5FRAA 2W1QA 2QBXA 1Y43B 2JECA 2QUOA 3FBYA 3DYOA 1CAXB 5FPZA 1X33A 4XVHA 2ARAA 4Y4RA 4UFMA 1N1SA 1HKDA 5F5IA 1H30A 3NKTA 3PUAA 3WQ7A 3NMBA 4MX3A 4C1XA 2XL7A 2EIGA 4JDNA 2PHRA 4KG8A 5L7OC 3AVSA 1KQRA 3WP6A 1CD3G 3RZMA 1BXHA 1ZZ6A 4B7EA 2HWC2 1L7LA 1OA2A 3ES4A 3ILFA 4IEWA 5GLWA 5C8CA 2VUDA 3UK9A 3VBOA 1UY4A 2GAUA 4MADA 4Q5OA 3MIFA 2I74A 1U12A 3VBFC 3MUZ1 4XFCA 4GXLA 3UL2A 3RFRA 2ORXA 5EWSA 4XF0A 2D5HA 4NHLA 1AX0A 3LFIA 1PO22 4Y1YA 4XUNA 4AVTA 1UZWA 3IM0A 3FFZA 2A6YA 4BYYA 2NQYA 1WBFA 2NMOA 1ND3B 3E6DA 2ZGKA 1R082 4RYDA 3ZDVA 3FWEA 1W04A 3QOPA 1FMD2 1QJX3 1KFXL 2P34A 2QKDA 1YYNA 4EWDA 4HSJA 2DV9A 2YU1A 1ZZ8A 5GLTA 5IFPA 1OBNA 5FYMA 5FZ3A 3V65A 3D5OA 5DUUA 1R64A 5ERLA 4ISQA 1PK6A 5CADA 4PIXA 1AJOA 3OEBA 3FFQA 1RVF3 1RMU1 1C3HA 1ZRRA 3OUHA 2IZWA 3ZYGA 3C2UA 5FZMA 1D0HA 3SCGA 5HXMA 1F31A 3SXWA 1BBT3 1W2UA 3H3UA 4DNYA 2VZPA 1GWLA 4MV2A 1AYN2 1VBE1 1XU1A 2QQKA 5FLIA 1O5UA 5A3NA 5AC92 3LKJA 3T2TA 4BXSV 3NNJA 1BLZA 1LHVA 4DFSA 1DGRA 2FCUA 3HBZA 2VJXA 1RUH3 2YUEA 3WDTA 4AYUA 4AQTA 4HZFA 3RZJA 3AMHA 2PYTA 5FO7B 3TN93 5F7UA 1SPPA 2YG0A 3MLLA 2VCBA 2PHUA 5FMBA 1AL21 4FPYA 3ZYFA 5BNPC 5KHGA 5IUQA 4BH9A 1O7FA 1Q8SA 4GWJA 5LA9A 4NUBA 4JKMA 3N4MA 3WF0A 3JB8A 5DZGA 1W28A 1T2XA 2RJ2A 1AR72 2QE3A 5SV5A 5IHRA 2KM2A 2WN2A 4P9YA 1MS0A 5C3OA 3AYDA 5IJRA 5JIUA 1HV0A 2ZGMA 1AR81 4AG4A 2W2IA 2C9AA 2D93A 4ZZ5A 2WWSA 3Q8EA 3OUIA 3TEZA 4QMAA 4BDVB 2HEWF 1H2MA 4IESA 1XRUA 1DYOA 1XNKA 4FSJA 1DG6A 1OF4A 3UNPA 3P5BA 3KVBA 4AR2A 3GNEA 4D7YA 4CDQC 1D4M1 3CMGA 2R32A 3R4UA 4QGLA 5F1RA 3FMGA 4JHTA 4WM7A 4CDUC 5GLZA 4CCNA 1PMJX 3L9JT 2WWJA 4LO6B 4AQ2A 5IK7A 2P6HA 1C4RA 1S4CA 3E5UA 1JW6A 4BIOA 5J48A 1UKGA 1DGLA 1R093 3WUDA 2BOJA 3CDZB 3M3QA 3EHKA 4CU7A 5FZLA 1FOD3 1MS8A 2WRAA 3ILNA 3N7MA 5FMCA 4N43A 1WCKA 1HXS3 4YPJA 2PHXA 3LWCA 2XONA 1FT9A 1V6NA 3AKTA 2GC1A 2WYSA 4MGYE 3MF9A 4KMQA 4Q0PA 3SITA 2IUWA 3OD0A 4D7SA 1SCRA 3VD4A 4RGKA 4CEYB 3RZKA 4PQ9A 1WCSA 4Y33A 2R043 3WW4A 2E6VA 4HSLA 3ZXKA 5IVJA 4P08A 1A3KA 2XJPA 2Y6LA 4NPMA 4I0BA 3I2HA 1JZ6A 3JD73 1MZFA 1E5RA 2FDFA 1H4GA 4G9SB 5FZOA 3TB0A 4C90A 1DGWX 1SEFA 4OI1A 3WNKA 1SBEA 3K77A 2G9FA 2HYXA 1DBNA 4IGQA 1HW5A 3VDDB 4D3WA 5FQ0A 4OHZA 4LIUA 1FNZA 1D0GA 2WQZC 2WUHA 3AKSA 3AZWA 4UOJA 2QQPA 1M06G 2VU9A 1E5IA 2VVEA 1OOPA 2BUKA 2B46X 2H6BA 3I3QA 4XE9A 4AHWA 4BA6A 5A3OA 1CPMA 4Z2AA 4AEDC 2QZ2A 1UAIA 5KHHA 1QMJA 4E8DA 2CDPA 4JGYC 2OS2A 4IUGA 5JSPA 4G4FA 5DPNA 5L9VA 3B9IA 2P3YA 2DBNA 2WYFA 1QJX2 5FO8B 1V00A 5FO9B 3UGFA 4SLIA 3T0AA 1CJDA 2HLEA 2VZTA 1IS6A 2JWPA 4QXKA 2PN5A 4W8JA 2ZA9A 1ZZCA 1CJPA 1IG0A 3SMHA 5T54A 1B35C 3FE5A 1RVF2 4IEPA 4AW7A 2AYHA 2R30A 5FZ9A 2F4LA 3POGA 4OLLA 5A3MA 2D5FA 1MZ6A 1ZBA3 2W3JA 5FZHA 1BBT2 1P8JA 5BYNA 3OGGA 1REFA 2NMNA 2VZUA 4NHXA 2WJSA 3WDYA 2BEOA 3NNMA 4SBVA 5EYXA 4LHKA 1S0IA 4YZ4A 4X6RB 4JGZC 1NE6A 3PNAA 4Y1VA 2RS33 1C8M3 1RUH2 3B3QE 2AUYA 1AHSA 2A5ZA 4IEQA 3SKVA 3WNXA 1W8OA 4NWWA 3B94A 4GJYA 4IV1B 1CPNA 4QU1A 1S0EA 3NNGA 2DTYA 2A6VA 5C4WC 4NR1A 4YWAA 4H55A 4YGEA 3GHNA 1KRIA 4CDXA 3NJXA 5A3PA 3NSTA 4Y24A 4L97A 2K9ZA 3H1MA 2J1EA 3I2OA 2FDJA 1ZZ7A 5CZKA 3OF1A 3GZUC 5K7PA 3NO8A 4ARXA 4EJRA 1OPMA 2IVJA 2ZAHA 1GZWB 4HOOA 1LHWA 2E32A 5JI7A 1OPOA 3I97A 4V2VA 1VB2A 3WDXA 4Y22A 1ULDA 2BFUS 4CPBA 3I3BA 4ES8A 4GMP0 1Y4WA 4PI2A 3ZMOA 1LOFC 2D3RA 4YVWC 4UXAA 4HN0A 3U78A 1RUJ1 5JZGB 2OIIA 4FTBA 1SBFA 1AR93 2D6PA 3DYPA 3D6EA 1VIWB 3HJRA 3DPRA 1W90A 1JUHA 1RIRA 1VMFA 2A71A 2YY1A 3DXUA 3AYEA 3K4ZA 3MV01 4OI2A 2A75A 2C5DA 5F32A 3MIHA 3ZFGA 3L2YA 4URAA 1R092 2HKXA 1W8UA 5F37A 4HKLA 5F6LB 1FOD2 2I45A 2ZPXA 1ZRIA 5T52A 2JXAA 2ZS6B 4AEMA 1HXS2 2VG9A 4JX0A 2BRTA 3R6SA 1H1IA 2QZ3A 4LBLA 2PHTA 3P6BA 5F8PA 3J26N 1G9CA 4IV3A 4QKDA 1AXYA 1T6BX 2R042 3LIGA 4MHRA 1OLME 1J1TA 3CQOA 3AC0A 4EN8B 3BTXA 1ND3C 1SQ4A 2JG8C 3JD72 4CCJA 4XJUA 1VMJA 2XWJB 4BIFA 1OMIA 1G9DA 4AHXA 5C5UA 4KNCA 1KEXA 1KJRA 2GMEA 1EPZA 3WCSA 2D44A 5DAQA 3KQ4B 5FP3A 4GQ7A 5HBAA 2RDSA 2WFF3 4YW4A 1XU2A 2ZX1A 1W9YA 3H7YA 1UNBA 4QQLA 5T50A 4Z8BA 1NCRC 4LLOA 4ZY9A 1FI2A 2Y6FA 1AL0G 4X6QB 4HT1T 4Y20B 4HVQA 3H1YA 4Q4W1 1AX2A 5DQ0A 2CV6A 3VB9A 3P3PA 1T6GC 4F7ZA 4LBJA 2QTWB 4AGGA 3SCHA 5F9TA 4YZ3A 4BLIA 3PJQA 2CU5A 1CAVA 3IDCB 5FY8A 4QWNA 5LBCA 5L7OA 2HWE1 5K9YA 4Q0QA 5BNNC 2GC3A 4FQZA 4EZ4A 3POSA 1PGL1 3KV9A 5L9RA 4E8CA 2WAOA 5HXVA 4LKFA 2RR13 2VZ1A 4FFFA 3RPQA 1XOYA 4Q26A 3BOWA 1JUIA 3VBFA 5C33A 3A23A 3O1OA 2A73B 5E16A 1HQWA 1ZBA2 3HN3A 4XUOA 2V09A 2ZXQA 4KGGA 3LA2A 5FZCA 1O91A 2VUCA 4D6SA 1YQCA 3NNFA 3THPA 4NIAA 3O1SA 4WVMA 3Q8FA 4MHUA 2VCAA 2E7TA 3INAA 1W6NA 5GZFA 2HWC1 1TE1B 4FTEA 3PUIA 3M4FA 2RS32 1C8M2 1KS5A 1ENSA 3LEIA 3VBUB 3ZXJA 1C5IA 2V4AA 3ZN6A 2TUNA 5GM0A 5A70A 3IZOA 3KD4A 1PO21 3P1IA 5FY5A 5I0UA 1F35A 4AEKA 4WBBA 2WINB 1H9WA 3WV6A 4DZGA 3LDKA 3EO6A 4XOGA 3NV3A 2Q1ZB 5BY5A 1LOCA 1R081 5FYZA 1RUD3 1GOHA 1FMD1 2C9KA 5CFDB 5K8SA 4AAXA 4B1LA 4KH9A 4YRDA 4I0AA 4YNIA 1FV2A 1WCQA 1K3IA 1RYYA 3V64A 5IWFA 3GJAA 4BHPA 4WV8A 5AFBA 5FP7A 3D0JA 1I3HA 5BNOB 1LGNA 3MPPG 4CEYC 4OMCA 1PMIA 1WWYA 1AR92 1VJ2A 1OT5A 1UXZA 3AKRA 3CLPA 5BNPA 2D98A 2WS93 1YQ6A 1AYN1 5CYYA 4ZS3A 4AEJA 1V9U3 2GMMA 2QQMA 5AC91 4ZS2A 3H8XA 4BU2A 3JB4C 3AJYA 4N7IA 3LF7A 3AXDA 1MEC3 3M7AA 4DEVA 5FYCA 1WUVA 1UMZA 5JOZA 4J6GA 3VHRA 2LUWA 4W65A 1EP0A 1UO9A 1XYOA 1NCQB 2YBKA 3EBRA 4XMIA 3LA3A 4QM8A 3K3NA 2DU1A 1SLTA 3RZLA 4JTOA 3ZR5A 2WT2A 3EQEA 1GQGA 2WBKA 1TME1 5FK8A 4CDQA 4IERA 5EHDA 3ZIXA 2W1SA 4DY3A 3OOXA 3GBFA 1GUIA 2Y64A 4KBBA 3G7DA 2Y6HA 4CDUA 4PI0A 3WX5A 2XUMA 4O65A 1O4YA 3POEA 4A7KA 3BIWE 1POV3 1UU5A 2JIJA 4LBOA 2WFF2 3C3VA 3FZ3A 4YW2A 4FQ4A 3ZKYA 5F5CA 1IHMA 4AGVA 1POQA 3NAPC 5CEHA 2RS13 3H3ZA 1RUNA 3OYWB 4B8EA 3EMRA 5FBJA 2VMGA 1RXGA 5GZCA 2VQAA 4A7ZA 2Z4FA 4XFAA 1GNYA 4B3NA 1A34A 2DCZA 3LSDA 2XJUA 4BISA 4UW4A 3E6CC 4NRPA 3AX4A 3CJXA 5FYTA 3RDIA 2QQNA 2WQ4A 3S0MA 3NRUA 3ZO0B 3Q8BA 1JZ8A 2RR12 3KV5A 4P9JA 3ZXLA 5ACA3 5C9AC 4IV1C 4JKKA 3AP7A 5IVVA 1PZ9A 1WW7A 1LOAA 2ZHKA 3H3LA 4HKWA 4A4AA 4CP1A 3HPNA 1D2QA 1S2EA 1YI7A 3X29B 4YGBA 2AC1A 2VULA 2V72A 1SLCA 3I2IA 3PURA 4DS0A 1UMHA 4FPLA 3VGIA 3ACLA 3CF6E 3GZAA 1POV0 3QH6A 2R063 5FPLA 4Q0SA 4JGYA 4HBNA 3ZYIB 2W5FA 3SH5A 3BVCA 2X5IB 3ALQA 4GH4B 4META 3T0BA 2G9ZA 4GJZA 4QB6A 4UW6A 2CGPA 1CVNA 1H4HA 2P2KA 3NWKA 1YQ2A 4YM3A 1C1LA 5FZ6A 1YFUA 2PXJA 1GZ9A 1B35A 4LBQB 4E2SA 1JS9A 2VM9A 3HMYA 2WA3A 2IXKA 4L99A 3ZFEB 1OF3A 1RUD2 5BPXA 3WSOA 4YW3A 1QJX1 2ARBA 2BNMA 4EWAA 1JI6A 4FPJA 1GQPA 3SCFA 1PIV3 2GN3A 3OCPA 1IQAA 4Q27A 3M1HA 1UZVA 1V6MA 4DRRA 2XH6A 4KG0A 4UFHA 4CU6A 3LAGA 1HLCA 4JGZA 4X8PA 1JHNA 4LTAA 1RVF1 3ZYRA 2OKXA 3O0VA 1ZZBA 1PVC3 1XNTA 1LJ7A 3MBWA 1LOBA 4EZHA 1N1VA 5IAXA 1UOGA 2ET7A 1CZTA 1QJY3 1W6PA 2K0GA 2WS92 5CKMA 5C4WA 5CA6A 4E2GA 1V9U2 1CQ9A 4CPBD 1X9PA 3ST7A 1W6QA 2X10A 2FCVA 1MEC2 3RWKX 3H0OA 4EN9B 3ZN5A 1CN1A 1RUH1 5LRRA 1CIYA 4YW1A 3TN91 5EXOA 3K75B 2IXJA 1JYXA 3MHZA 4GD4A 1A8DA 1RUG2 1IS3A 1W39A 1GMMA 5FPUA 1Y9MA 1YC61 2VMEA 3AZYA 1LOFA 1PVXA 1EV13 2ADDA 2EA7A 1L7RA 4YVWA 2AACA 5AVPA 2W94A 5FZBA 5F3EA 3V0BA 1ZA4A 2BBAA 5FLHA 1K45A 3T09A 5IK5A 1SDDB 1RHI1 3O1PA 2PELA 5FXWA 3VKNA 5KHKA 1H2KA 1ZZ9A 3C7OA 4PDWB 5I93A 1UU6A 4IL7A 5EJZB 4XJZA 1UF2C 1S0BA 5FY1A 4PBOA 2VXJA 4QXHA 3ZN4A 1QGLA 5J98B 2BV4A 3JCIA 2CSGA 1B09A 2EIBA 4G3YC 5E6HA 1YHFA 1JU3A 2RS12 4AQ6A 1U5IA 3HR9A 5T5LA 5I8YA 4EN0A 1OLQA 3O1UA 5FK7A 2G19A 5CG9A 2JEMA 4OYUA 3I4IA 1VRH3 1CONA 2DWRA 1H8TB 2OPKA 3PIJA 3D3AA 3KB5A 1ND3A 2JG8A 4YGDA 1VB4A 3T3YA 3AYAA 1R091 3SHRA 4YZ5A 3QBQA 2GMPA 3C7FA 4CUBA 3TWIA 1FOD1 1UOFA 2UWAA 5CVRA 2AGSA 2BNNA 4W6WA 4JQTA 1X82A 1VPHA 5ACA2 1HXS1 3QH7A 2GC0A 2QCSB 2A3XA 5A6XA 1YJKA 3ELNA 5DXDA 2JDUA 3AB0A 2ARCA 3FC0A 2R041 5D8AB 2VOXA 2DVBA 4PT6A 4ZU5A 3I8TA 3VZOA 5ABJB 2YB7A 3VBRB 5IK4A 4QQPA 2R062 2ZGTA 3JD71 4QPYA 2X8KA 3RJRA 3TEXA 5CFDC 2Q1FA 1LGBA 3RVHA 1GP5A 1W6OB 1XE7A 3H50A 3USSA 4XAEA 2XJQA 2CHHA 4WM8B 2AENA 1OLRA 2PLV3 2ZGRA 5DN2A 5FBZA 4LT5A 1E5HA 1NA1B 1ND2B 2H6CA 4LHLA 4UYBA 2YPJA 3I49A 5BNNA 3K3OA 3JU9A 3O1VA 1J3PA 1E5SA 5C5TA 3WZ1A 1GQHA 4QQOA 4Q4V3 2OZ6A 4LJHA 4Q29A 5KXCA 1K5MB 4NHMA 5FYYA 1NQJA 1OQDA 1UX6A 1S0FA 4Q0VA 3WW2A 5H9RA 1N3PA 5JWPA 2DVDA 4TSVA 3VHPA 2ZGPA 2W1UA 3I2FA 1WLWA 1PIV2 1MPXA 2ERFA 5H9PA 2UYBA 5IVYA 5FKBA 4COYA 3BIEA 5FV3A 3AP6A 3NQHA 4XEZA 4B29A 4JCKA 4ITCA 5KR7A 1Y9GA 4GWNA 2VMFA 4P00B 4O61A 3WG1A 3DPRC 2B9UA 4FOWA 5FY9A 1WD4A 1PVC2 1XJAA 4FT8A 4UF0B 4BLJA 2F6BA 2EXJA 3MO4A 3NW4A 1QJY2 2GP3A 5DUVA 4RFT0 3WW3A 1Z7S3 2Y60A 1DLLA 2IXLA 2HWD3 3HQXA 1YJLA 2ZMLA 1BVVA 4GULA 3WT3A 3WY6A 2FCTA 4YM1A 1A78A 4QHZA 1SDWA 4ES9A 1CAUA 2W95A 2O8OA 2RHPA 2RS31 1C8M1 2TNFA 4IV3C 1VAKA 4JRAA 4M3CF 2DVGA 2IXHA 4PLMA 5FMOS 3TNQA 4B4PA 5K0UB 4IE6A 4KWJA 1KGYA 4R4XA 5A3WA 2ZKLA 5GKAC 4E2QA 2BBVA 1EV12 1UPIA 3U0ZA 2ZEXA 3RYRA 1H1MA 2UURA 3FJSA 5AFEA 1DP0A 4CEYA 1W0NA 1IPJA 2PHFA 3I59B 3ZFFC 4N53C 4BQYA 1O8PA 2YGMA 3UV9A 4CP0A 1TG7A 2UY8A 2CAVA 3LOBA 2MNGA 1W6MB 4H7LA 2JDHA 4CCMA 2DCJA 1RL3A 1QJFA 2OUJA 3K2OA 1AVBA 2AZ5A 4LQRA 1DQ4A 1URXA 1UCXA 3A0KA 5A3UA 4QKBA 1BHGA 1ZRFA 1NUKA 4FPKA 4NRQA 1AR91 4HN1A 1GOGA 3HOBA 5IT6A 1Q8QA 4XZUG 1VRH2 4JDMA 2GNTA 2Z2SB 4QQHA 2WNUB 2DFBA 3ZPOA 4XTPA 5EV7A 4XZPA 2RMU3 4PQQA 2ZX0A 3B93A 5HCAA 2X5IC 2XJRA 1NXMA 2UU8A 2WWUA 3IDEA 1UZYA 4DB5A 4FPCA 4QGMA 1GANA 1IKPA 1PZ8A 5JOWA 1ULEA 3M3OA 3I2KA 4E4HA 5J3UA 5HCBA 1PMHX 1L3JA 3OPTA 1OKQA 4CXYA 2R073 3B02A 5L19A 4IE5A 5DAVA 2EAKA 3H8UA 5FZAA 1VE0A 4CYDA 1KJLA 3ZXGA 3U1XA 1OQ1A 2HWF1 3IN9A 3LQCA 4LULA 3HNMA 4OMDA 3NAPA 3PVNA 5JXJA 2EIEA 4LXLA 3THTA 5FUNA 2YMZA 1JU4A 2HEVF 1UN1A 2VCCA 3N7JA 4FPFA 4XIOA 4XXAA 3MUY1 2Q1MA 4DMIA 4QX0A 1QDOA 5FZ8A 4C1WA 2NYYA 2ZKNA 2PLV2 4P9IA 1Q8VA 5FY4A 5LBBA 5A7WB 2BOIA 4CCDA 2WFF1 2GZWA 3NJZA 4XPVA 3CKHA 1HB3A 1RUC3 4DOUA 5B2GB 2OUHA 1REEA 4Q4V2 5C9AA 4IV1A 1GLHA 3R4DB 2XB6C 3WHUA 3ETPA 4MSVA 1X8EA 3BTYA 1LULA 2O8QA 3BUCA 3OY8A 1FNYA 4B1MA 3ROUA 4KWUA 4QM9A 4TTGA 1GZTA 1R1A3 2VQUA 2LROA 1GZWA 4MGIE 4P9LA 2SBAA 4JHZA 2VBPA 4KU8A 4Q4X3 1AYM3 3C7EA 4RS5B 1RJ8A 2DU0A 3Q8CA 4NAOA 1YIFA 1W8ZA 5J1XA 2GDFA 2LRPA 4DO0A 4QKNA 1Z7S2 2IWGB 4CP9B 4AHZA 4YZ1A 2HWD2 3AMNA 1AF9A 1YXWA 4LE4A 1PZ7A 3VKLA 2DYCA 2JIGA 4PDWC 1RGSA 5G04L 2OQ7A 1HDKA 2HBTA 4XUPA 1DYPA 1JODA 4XABA 3I3DA 4E4DX 5DMYA 3GZTB 3OPWA 3E97A 2DDUA 4FFGA 1HRV3 4EROA 4BB3A 5AVAA 2JB8A 2DVFA 2FZ2A 4N9IA 3DKQA 4XMAA 3WINE 4NIIA 3JBG3 2QVSB 2LW8A 3M3IA 4RSUA 5I0TA 2ZEYA 4Z1VA 1JOBA 4ZXKA 2RDNA 1RUD1 1BVP1 1LAJA 4H7MA 4BQ1A 2E53A 1YLLA 2VNGA 4QX7A 2BZDA 3O7OA 4HFSA 3N9MA 4HETA 2WT0A 4RA0A 2WZPP 3VLBB 1YI9A 4HLTA 1J83A 2FMDA 4FFIA 1HQNA 3IAPA 1F5JA 3PIGA 3GXUA 4Y4YA 4HPKB 5D8AC 1QJEA 4ISRA 3OBTA 4Y5SA 5FZ0A 3THCA 5IVEA 1QH7A 2G4IA 2WS91 3VBRC 4Y20A 1OHFA 5FY7A 1V9U1 5CKQA 3S30A 3TEWA 2ZGLA 3ZDSA 1MS3A 1E57A 2RMU2 2ZBJA 1N47A 2VTXA 3NJVA 4UI9L 4QU2A 5CFCB 4KQ7A 1SFNA 4CDWB 3WQ1A 4QHBA 3DUIA 5FZ4A 1NA1C 5F3GA 4MUVA 3B69A 5GZGA 1C1FA 1I5ZA 2IFWA 4PBPA 2R072 5GZEA 1VALA 2QQUA 3AKPA 4GZ9A 1REDA 3IBMA 4K21A 4LHNA 5BNQA 4YARA 1LHUA 2D6NA 3SC7X 4DXRA 1K42A 4Q0UA 2VVDA 4QPGB 5C3PA 1JYTA 2QQWA 4OHYA 1BQPA 1OURA 1POV1 1W8HA 3U14A 4XF4A 2VNOA 1O59A 1VR3A 4WZCA 4V2WA 3O14A 1ULOA 2WN3A 3OSDA 5LASA 1RUC2 4RQPB 1ASJ1 3VBUA 1O3SA 4RR3C 3ZMNA 3MW3A 2GU9A 4GMP3 2JDKA 2RS11 4XILA 4YFZA 2ZX2A 2YFZA 2Z42A 5JXIA 4AQSA 3EJKA 2VMHA 3ES1A 5C8CB 3VBOB 4XYXA 1F9KA 2XHNA 3LIHA 1CX1A 3RGBA 2C1FA 1Y9QA 5FYBA 2ZMNA 5J96B 5JOXA 1R1A2 1W8TA 4OCTA 4IEXA 2HEYF 1UWWA 2DFCA 5CFDA 4HKOA 3GBGA 4K8RB 4Q4X2 4R4ZA 1AYM2 5ACA1 1STMA 2Q8EA 1JOJA 4XIKA 1YEWA 5L36A 1DF0A 3HVDA 1KXGA 1WMXA 4URTA 3NVCA 3SLIA 1PO13 3BOPA 1QXJA 4FOYA 2EALA 1H9PA 1NLQA 3MIGA 5T55A 3MZHA 5BNOA 4AOCA 2Q8CA 1COV3 4I0WB 4YW7A 5LRSA 2JE8A 3UKNA 2R061 4XXPA 5CNAA 5B4NA 1UMIA 1QJZA 5FPXA 1NKGA 1PK6B 5FAXA 2XBO3 1UYPA 5A1LA 3GALA 4OQ9A 3ZX7A 2KA3A 1JN2P 2R49A 3KGLA 5CAZA 2LM3A 2XKOA 5H9SA 1HRV2 1AJKA 4HK8A 1PM4A 4JRLA 5FXZA 1LEDA 5DAWA 3VD3A 3AZXA 3V0AA 1S2BA 3JBG2 2FDIA 4LMFA 4CTEA 1TNFA 4MO3M 4LIVA 3UYJA 3OGJA 2BGOA 4AFCA 5JMOA 3H8RA 3CZJA 1G9BA 4FPOB 1H2NA 2VBBA 5E8AA 4AI0A 1IPKA 1WW6A 3OGSA 2EXKA 4JKLA 4NWVA 2BTVC 2VNVA 3LD8A 4I3GA 4ZKTB 3JQXA 2Q8DA 3WP3A 1EAH1 1PIV1 4MG2A 1SPPB 5F2SA 4B7KA 1BYHA 3RRDA 3VZKA 2E7QA 4ZPIA 4XDOA 1U5XA 1W0OA 1ZRCA 2D97A 3OTFA 1BEV3 1G8WA 2R0HA 2YBSA 1ALYA 1PVC1 3POYA 1BZWA 5FLJA 4AFDA 3RMYA 4I02A 2JDYA 3A0NA 2BGCA 2VQ0A 4KU7A 2B42B 2A6WA 4K8FA 1YUDA 3LOIA 3M70A 5JPMB 3B01A 4S2DA 5A7NA 3TAYA 3ZFFA 4N53A 3K48A 1YO8A 1OD3A 5C3QA 5KXEA 4LORA 3O1TA 2E63A 2Y34A 3AL5A 1JXNA 1OD5A 3C8XA 3UJQA 2W39A 4RHV3 4WM7B 3QLQA 4YSFA 2F4PA 5FCCA 1IS4A 1U0AA 2TEPA 1EV11 2BVBA 2HJIA 3ZSKA 2KD7A 1NAEA 2JG9B 2BQPA 4XFBA 1ENQA 2C26A 3AFKA 4N43B 2QNKA 2EAAA 5LEJA 1AX1A 3BU7A 1UU4A 2WFPA 1ENXA 3AZVA 3OGRA 3WF3A 1GKBA 1HIXA 1VRBA 5JPNB 4IEUA 5A32A 4YVSB 2X5IA 1MVEA 1BKZA 3ACIA 3T1MA 2CWMA 3UKTA 3D4KA 1NQDA 5JDBA 4R8HA 4LLFA 1VBE3 2EXHA 5FKCA 4LA3A 1VRH1 4LBQA 1KS4A 3ZFEA 3WOGA 3IAQA 5CKNA 4IGPA 5GJ6A 5I8TA 1ENRA 2VBDA 4FP3A 1OOPB 2A3YA 2Q30A 1J3QA 3VBSB 4R52A 2PMWB 5FPAA 3T30A 3PUSA 3MIEA 1SMVA 2RJLA 4OHVA 4QX3A 2QQVA 3HEIA 3RZHA 2Y38A 4GKXA 2YC2A 2B39A 1DQ2A 2ZOEB 4RN5A 5EIYB 1PO12 2YHJA 2ENRA 2GC2A 2CGOA 4Q2FA 1Q43A 1GNZA 5FPVA 3S5QA 3URFA 1GFF2 1OA3A 4HG6B 1JZ7A 1COV2 1Z0HA 1OI6A 1VBC3 4NRMA 4COUA 3WNOA 5LY1A 1XXNA 3HIFA 3HT2A 2XXZA 1AXKA 4GB33 5D21A 5EZWA 3WHTA 5HV0A 5M0TA 2XBO2 3NV1A 4LEJA 4PF1A 2WC2A 4PHZA 1OLMA 2PLV1 4A42A 3PLQA 3V56A 5A33B 4ATEA 5C7GA 3OBAA 2W52A 4HONA 1QJU3 3M8LA 4CXXA 1WLCA 2FMYA 4TYSA 1CR7A 1QKQA 4N90A 3KHCA 3DCQA 4KBZA 3RI8A 4QX8A 4ATFA 1VP6A 2XPJA 4B4QA 4CCCA 5KC5A 3FL7A 5FMOL 4BK4A 1JH5A 4XFFA 2CDOA 3JZVA 3KM5A 3PMSA 1GBGA 1CESA 1IGOA 3JUUA 1UL9A 1VMHA 5FR3A 1UYYA 2HBUA 3VDDC 1SACA 4FXKB 5LWBA 2DVAA 2WNVB 3ZYBA 4RGGA 5T3NA 1W8FA 3IPVA 4PDWA 1CAWB 1LENA 1SG3A 3E1F1 4IEZA 3PVOA 1IOAA 1BEV2 1RUG3 4NHKA 4OULA 4QXCA 4XJWA 5DZFA 1U5YA 3U07A 2C4XA 4YYOA 2XR4A 3FHQA 5DUWA 1GR3A 2R16A 2RM23 3RS6A 5JI9A 4K7JA 1Z7S1 4MXWA 2PQQA 2B8MA 4PIZA 1QQP3 2UYAA 2AEYA 3T4HB 3WLUA 2HWD1 2D40A 1H8VA 3GZEA 2NPIA 1X8MA 2WNOA 4K1ZA 1AR71 4AE2A 2OPWA 2G9GA 5DZEA 4QPGC 2NP0A 4ASMB 4M01A 4E4SA 4I09A 4NO4A 1BCXA 3CO2A 3ZYJB 2WL1A 3RSJA 4OHXA 4D0QA 2IVIB 2BVVA 4K40A 3RMXA 5E89A 2ES3A 4GWMA 2YZ4A 4RHV2 4XW3A 2VMIA 2VW1A 3U75A 3ZFGB 2QJVA 5FPBA 2DURA 4NIDA 1NLRA 2WZ8A 3FBMA 3OGVA 5DABA 2DBIA 2I2SA 4J25A 2Z79A 4OVEA 5FZEA 3S6PA 1RJ7A 5D8AA 4O9GA 1BMV2 4M4PA 4YLZA 3VBHB 4FBFA 4LUMA 2PQSA 3VBRA 5ABJA 1ZREA 1S2KA 1NX9A 1OFSA 1GICA 2WAAA 3ACFA 3LDRA 4LPLA 3WP5A 3VD7A 2ILMA 3VDAA 4OQ8A 3GBWA 5LBEA 1W6OA 5FTTC 2C6SA 4H2AA 1JOPA 5E1RA 4AFMA 2VZQA 3I2JA 1F5FA 2E26A 1Y7BA 2VL4A 2FD8A 1NA1A 1W8WA 1XSQA 3O1MA 1NLSA 1UD1A 2CYFA 1XNBA 3AM2A 1VBE2 4GIQA 4FAHA
chains in the Genus database with same CATH topology
2VVFA 2DCKA 3AXEA 1K5MA 2RMU1 1V6LA 2X53S 3VHNA 3R0RA 2EF6A 3MDPA 1LB2A 1LTEA 4XETA 4YM0A 1RUOA 5JZGC 2R071 1RUE3 1CIWA 2D6KA 3IDBB 1G6NA 2RJKA 5L7OB 4Q1PA 4RR3A 1VBC2 3LCPA 1O3TA 4GB32 5KHIA 4QPIB 1ULFA 2XVLA 3VBFB 3E5XA 4FPGA 5IK8A 1QJU2 1RUC1 2VOWA 3CJIB 2X29A 1NYWA 1IS5A 1BBT1 4BE3A 1SFYA 3IMNA 4I01A 4COWA 1A6CA 3WQ0A 2AH2A 1J1LA 4UBGA 4XQ4A 3RJ2X 5DG2A 2JE9A 3I59A 3RQ0A 1WMEA 1R1A1 4KWLA 3TRSB 1W6MA 2HWB3 2LTNA 4C91A 2E9QA 1MS1A 4Q4X1 3N3HA 5LK7B 3KT7A 4X8NA 3PVEA 4COVA 3ENRA 4B4RA 5GALA 1MS5A 1CAXA 4YG6A 2BPA2 2ZAAA 3AK0A 1UIJA 1VBD3 2RM22 4JC1A 2IC1A 1N3OA 2JG9C 4DRVA 1A8MA 1QQP2 3BALA 3N7KA 4LBNA 4L92A 3KLSA 2Y26A 3KMHA 1NZCA 4UW5A 2ZCWA 4Z2WA 3DV8A 1KD7A 2GNMA 4LBKA 1HRV1 4I3PA 4TLFA 5BNPB 4OUMA 1NY72 3JBG1 3W59A 1FXZA 2WT1A 2K2SA 2CAUA 3ZXEA 4FVVA 4XJAA 4DY5A 3BODA 3I54A 5JSRA 2DCYA 2VXRA 4HMZA 1V6KA 1O3QA 3KZ4C 4F3JA 4XF9A 5BV6A 4LO5B 5FREA 3N7LA 3VBUC 3VBSC 4P9GA 4MVTA 3KCXA 3MPBA 3N36A 3KT4A 4YG3A 4CDQB 2WIIB 2D6LX 3QD6A 4N7UA 2I07B 2QDNA 4HANA 2D3PA 2XVKA 1OQEA 4AGRA 3MEPA 3U11A 4A7YA 4WZFA 4ONUA 4RL7A 2ZX3A 2XG3A 3ZPYA 4PLNA 3U10A 1V6OA 5BNOC 4K6BA 2Z5WA 1RUE2 4KWKA 4P9WA 4LBQD 3B9CA 3MGUA 4RS5A 3KQRA 5EYYA 1WBLA 4M3CB 5C6CA 1VBB3 3HT1A 4HK9A 2QDRA 1C8NA 3VKMA 1GV9A 2VNRA 2ZGOA 4XHBA 4XHXA 2FZ1A 4MGKE 2ET1A 1KITA 1LHOA 2WNVC 3FUOA 4BMBA 2VPVA 3K51A 1NCQC 4AEDB 1TMF3 3KS7A 1ZBA1 4GMP1 2Z69A 1DIWA 2ZJCA 4JGYB 1LCLA 4CRQA 4OFGA 3P3NA 1UZZA 4NOTA 4Q4Y3 3VN4A 4Q1RA 4YGCA 1MS4A 2FQPA 3RZZA 1HV1A 2D43A 4K3UA 4TWTA 4S2GA 1UPSA 3LGRA 4FOQA 3VZJA 2D6OX 2DUOA 2JX9A 2HWB2 1H2LA 5J36A 4AI1A 1B35B 4LR4A 4XFIA 1SLBA 4XFGA 1VBD2 1PO11 4FO9A 2MEV3 3ZSMA 4C0HA 5HI0A 4W6XA 1ZVFA 1FYUA 3VBHC 3H7JA 1MR5A 1ZYBA 3J8F3 1YIPA 2A70A 1TEIA 4AI2A 4D7TA 3VDDA 2YV8A 3B7MA 1MQTB 1ZM1A 2IFRA 2JKBA 4I2OA 1VBA3 1W6PB 4KL1A 2JENA 3ZXDA 4PLOA 3RYKA 4U36A 3IIAA 3VUOA 4E27A 1W6QB 3MW2A 5JLVA 4Z07A 3JQWA 4PJYA 5CG8A 2ZX4A 4RGAA 1V6IA 4GH4C 4A3XA 5C8WA 2OVUA 1U5ZA 2GALA 4ASLA 4QPGA 4YFWA 4LNVA 2NN8A 4XQWA 3WXPA 1C28A 4YVWB 3USUB 3GF6A 4Y1ZA 1O3RA 1BEV1 2VGDA 4M0NA 3V0BB 2ZHLA 3ZFEC 1Z78A 4RQPA 4FAGA 3GHMA 5KC6A 1XE8A 4XQDA 3W58A 4QPIC 3D0SA 2BW8A 1DQ6A 1ZBE3 5T5PA 4AVSA 1YFXA 2WA4A 2PHLA 4FOVA 4RHV1 5FFOC 3CJIC 1UIKA 1WCDJ 3WW1A 4FXGB 2JG8B 1VBB2 4AVVA 1PGW2 2WLQA 2WSVA 1LKNA 1NE4A 1BMV1 3WDUA 1FATA 1GZCA 1MACA 3RG0A 2RR11 1F2NA 4JV4A 5F5QA 2P3JA 2H0VA 4JQRA 1JYCA 5SV8A 1NCRB 1TMF2 2V73A 2QFEA 5DDJ3 4COZA 1ZRDA 3FUQA 1DQ5A 3MLKA 4BCUA 5JZGA 4MYEA 1YNAA 2E51A 1CGPA 1EY2A 1QH6A 4Q4Y2 1BK1A 1RUF3 2XVGA 3VHOA 1PHMA 4JTNA 1EYBA 5BNNB 2AR6A 3MI8A 4L8QA 2XJSA 1RUI3 4QGNA 4H3WA 3R05A 2GNBA 4ZU4A 1D2SA 4YG0A 4JAAA 2MEV2 4QT6A 4HVOA 1ONAA 2ZGUA 1TME2 2R1DA 5FDBA 3ETQA 2RS53 3MFAA 1VBC1 1H8TC 1QOTA 2W0XA 3AJZA 1RHI3 3D8CA 1AR63 4GB31 3J8F2 1AZDA 1LOEA 5GLVA 2PA7A 1LOGA 4AI3A 1DHKB 5FOJB 1QJU1 2YDEA 3NL1A 4NPRA 1VBA2 2OW4A 3WDWA 2Q5TA 3MYXA 2IXIA 3O0XA 5I0SA 5I91A 2B45X 1DZRA 1M4WA 4GKYA 5ABJC 4BPZA 1CAUB 3ZSLA 1DZTA 4FTSA 1WW5A 2OYZA 2JG9A 3EXUA 1HRI3 4TZDA 3RWNA 1MEC1 3DKWA 4WM8C 4L2NA 5JCTA 2YC0A 1ND2C 4U2AA 2DUQA 1LESA 3RNSA 3ZXFA 4H14A 3S7EA 1FPN3 2EVXA 2PAEA 5JOYA 4HVRA 1RUG1 1OFNA 1OSGA 4YVSA 2XLGA 4JDOA 1K5MC 2D3SA 2RM21 4AWDA 4CEWB 1QQP1 3KCCA 3VKFC 2EXIA 3KSCA 3MIBA 1ZBE2 3AFGA 4N9HA 2GH2A 3VZNA 3T1LA 3ME2A 2D6MA 3VBSA 3CEWA 4AVCA 4FCAA 3QCWA 1GSLA 1XYNA 2R1BA 5I0RA 1NY71 2Q4SA 3AP4A 2PHWA 3MLJA 5J7MA 1G86A 4J1XA 1C5HA 4MXVA 1XNDA 2BWAA 2CWSA 4E4ZA 4FPHA 1LEMA 3N35A 2XKPA 1S0DA 4E9KA 1N1TA 3D82A 4O9EA 4PCRA 5K0UC 4EWEA 4GALA 1AXZA 5DDJ2 5A33A 3NAPB 1YFWA 4QX5A 2DTWA 1Q8PA 1RUF2 2Y0IA 1QOOA 4YM2A 2R0FA 1Q8OA 2Q0AA 2JICA 2ZABA 2PTMA 4IEVA 3TN92 1S1AA 1RUI2 5C9AB 1MQTC 2WNVA 2WZR3 2UWBA 2IXCA 2WSUA 1RUE1 1CAWA 1Q3EA 1RINA 3AYCA 1NCQA 1BJQA 3OY8B 2SLIA 2RS52 3J9SA 2WNUC 4AK3A 1RHI2 4XBLA 2WLPA 2OZJA 2VUJA 1AR62 4ORFA 4OHWA 3DGTA 3VV1A 5FOBB 4I30A 3O12A 4S2HA 1N3QA 3GYDA 2N7GA 3NV2A 1O4ZA 4V1PA 4AVBA 2MHFA 3ASIA 2VY0A 3CNAA 1G9AA 4L11A 1QJY1 3ZIWA 3L2HA 2PFWA 4D69A 5A3LA 3OYWA 2Y0OA 5T5JA 3BCWA 5EFUA 3QACA 1HRI2 3MFCA 3AMPA 4Y5Z0 2YXSA 2HWB1 3VBHA 4R9CA 3TBDA 1VAMA 1V6JA 2ARXA 3W9AA 3G6JB 5CBLA 1FPN2 3FLTA 4XBQA 5KHJA 5L73A 2NM1A 3ZSJA 2R6QA 1YCIA 1VBD1 1MVQA 2HWF3 2NLRA 4XF1A 2NZ9A 3AZZA 5TSWA 3WP4A 3ZYPA 2MPFA 1S0CA 1H0BA 1WD3A 4INDA 1DFQA 2A6ZA 2A3WA 2ZHMA 4GH4A 3B00A 4RS5C 4UW3A 1RMU3 3OJBA 3LSEA 5J09A 1LHNA 1YRZA 5J37A 3VZLA 4Q8KA 2A6XA 1XNCA 2VW0A 1QF3A 4XTMA 2BYVE 3VL9A 5GZDA 5FQ0B 3M3CA 2GN7A 3MICA 4MLOA 3BTAA 4PIYA 3SISA 1RB8G 2YGLA 2WKKA 3PTYA 4IEOA 4XJ9A 4QPIA 2VOVA 4J1WA 1ULCA 2FBEA 5KXDA 1AL23 1KDMA 4F8AA 3I2DA 4YZ2A 3U4XA 4CZSA 1J59A 2V5YA 2PAMA 3DN7A 2AREA 3MW4A 4AFBA 1WLTA 3CJIA 1NXD1 2JE7A 4Y26A 1JBCA 1AR83 3AKQA 1QDCA 3WCRA 4K9SA 4IQPA 1N1YA 1JYIA 1LU1A 2WZR2 1O5LA 4M3CE 1V70A 1C57A 1D4M3 1QNYA 4Q4V1 3WUCA 5CB7A 5CU1A 1S0JA 2ZGSA 5JSOA 4F83A 2UY9A 1VBB1 4LO4B 1PGW1 2JJ6A 1QU0A 4XJ8A 4LO8A 5CFCC 4XDQA 2Q8OA 4CDWC 4MGZE 2GNDA 1PM7A 3R4SA 2VH9A 4CDXB 1QY4A 2A7AA 4KGQA 4AFAA 2VECA 4Y1UA 1TMF1 1DGWA 1QHDA 1X7NA 2B5HA 4RD7A 1UKRA 3APBA 2CY6A 3NV4A 2ETEA 4CEWC 4EN7B 2B7YA 3FLRA 4Y22B 1XQNA 4Q4Y1 3ZSEA 2XJTA 4OI4A 1PGSA 1QXPA 1H8TA 4LO7A 4OZXA 1KFUL 2HYKA 4EV0A 3WVJA 3H1WA 2XLAA 3V0AB 2JDZA 2ZZQA 3OD4A 1DGRN 3DPRB 4RQPC 3PJYA 2ZGNA 4XBNA 1RC6A 1DYKA 4XF3A 2ZHNA 1IZ3A 1OA4A 1CX4A 2CNAA 4LBMA 4YW5A 2MEV1 2D7FA 2HWF2 1ZX5A 2ZMKA 5C8CC 3J4UH 3VBOC 5E88A 4FPEA 2PAKA 1H1AA 4MH0E 5KWRA 1WMDA 3O0WA 3VKOA 4COUA 4ZU7A 1EPWA 1O4TA 3RI9A 3J8F1 3PMEA 4S2FA 4WVWA 2PHDA 1X36A 4XFHA 5DG1A 4OI0A 4IV3B 2VUAA 4PF5A 1RMU2 1SLIA 3NKGA 4WM8A 1ASJ3 1VBA1 1ND2A 3HWJA 5LK5A 1WMFA 3O5SA 5EJ3A 1YFYA 2W68A 3DF0A 4DXZA 4BOWA 1FX5A 3TNPB 3ZFFB 3LZZA 4N53B 4D94A 2H0BA 4M3CA 3A4UA 2XLFA 1PK6C 4IXLA 4M0HA 5JR7B 3CU7A 5F6KA 5KXBA 1SLLA 3WD5A 1AL22 1NG0A 3LA7A 3MF6A 5T5OA 4R9BA 1LR5A 4FP2A 4DPNA 1CAVB 1MZ5A 4NN0A 1NOVA 2ZTNA 4AEDA 5JMCA 2KXLA 1LRHA 4GA9A 1SBDA 4LUKA 5A32B 1I6XA 2XL9A 3VZMA 1AR82 1Y3TA 4OUSA 1ZBE1 2P3IA 2JD4A 1W0PA 1UW8A 3ATGA 3ILRA 1J58A 3AMQA 1GYKA 1RUJ3 3SNMA 2XWBB 3E5QA 1D4M2 2XJVA 3FHIB 4WVMB 4QQ2A 3SH4A 5K0UA 1W6NB 5JIAA 3WG3A 1DU3D 1MS9A 3E6BA 1J3RA 5KBFA 3RYPA 3IKWA 1HQLA 4A2UA 3ECQA 1AUYA 1EAH3 1FAYA 3ZN6B 4Z82A 1DQ1A 3UKVA 3SH3A 3WG2A 3KT1A 1AYM1 3PHMA 5LEKA 2W08A 4WM7C 5DDJ1 4HL0A 2O0OA 2E7AA 2YYOA 1MQTA 1IKQA 4LA2A 1PNGA 4WVVA 4AVAA 1G9FA 4UBHA 1RUF1 4N43C 3CL1A 1LU2A 1PNFA 2WNUA 2RE9A 3S7IA 4QD2A 1G7YA 2ATFA 4YVSC 1RUI1 5GLUA 1LGCA 3OBRA 2P17A 1YWKA 2DUPA 4Q4W3 3AP5A 3HN1A 3HD8B 3TOJA 1DQ0A 3USUA 2O1QA 5HCFA 4Q8LA 4R9DA 1WA4A 2RS51 3ZVXA 4Y1XA 2HWE3 3IPVB 1AR61 4NVPA 1OOPC 3MIDA 1FV3A 4MZUA 1HX6A 2ZACA 1ASJ2 1R1ZA 1I1EA 4MXWB 2P37A 1JTZX 1KDKA 3BB6A 1VLNA 3FLPA 4CDUB 5DUXA 3KCYA 3TYJA 3IT8A 2ZZJA 3I7DA 4LE3A 1LECA 2WNEA 2HWC3 3WG4A 1HRI1 3DL3A 5CIRA 1Q5OA 1WLDA 4L9BA 3BPZA 4Z92B 4IETA 4BM8A 3B5LB 2UWCA 1FPN1 2C0ZA 1PO23 5I8SA 4DQAA 2DF7A 4BWOA 5H9QA 1QWRA 1NCRA 1R083 4K20A 2GSYA 4R9AA 1Q56A 1WGPA 1FMD3 1TQ5A 2BWCA 4K1YA 4EN6B 1DZQA 2CL2A 2VW2A 1I9RA 1RTVA 3VL8A 1APNA 2DCTA 1LODA 2FHRA 4CDXC 2CGNA 1S0GA 1RUJ2 1QOSA 1TNRA 3HAGA 1RITA 2TBVA 4IEYA 3ZXAC 4WVZA 1AYN3 3PVBB 5AC93 5D1IA 3WDVA 3FX3A 1QNWA 3KGZA 3WR0A 1EAH2 4C0BA 3AP9A 4M00A 4BZ4A 1VAVA 4P14A 2BNOA 5JAXA 1GNHA 2P3KA 3AMMA 4RR3B 3ZFGC 1WW4A 2BFUL 4P9XA 4AHYA 1SLAA 2CTVA 1TME3 1COV1 4HPKA 1S55A 1ZNPA 1AR73 2ZGQA 3H9AA 3UJOA 4JVAA 4AI8A 2XBO1 4JGZB 4BMEA 1XYPA 4DINB 4AF9A 2LALA 5CFCA 1QXRA 4P5HA 5JVVA 3LB9A 4CDWA 2WZR1 1F8VA 2YROA 5C4WB 1DDLA 4Q4W2 3POWA 3Q9OA 2XGXA 1X50A 3IWZA 3M2MA 3OPZA 4AXOA 4W6YA 5BUVA 1SCSA 3M3EA 2XHKA 2HWE2 5BXXA 1MZEA 2GH8A 1ULGA 2OA2A 1D4VB 2VOKA 4CEWA 1PGL2 4CP2A 5FRAA 1Y43B 2JECA 2QUOA 3FBYA 1CAXB 5FPZA 1X33A