5DUWA

Crystal structure of the human galectin-4 n-terminal carbohydrate recognition domain in complex with lactose-3'-sulfate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
PTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-4
publication title Structural characterisation of human galectin-4 N-terminal carbohydrate recognition domain in complex with glycerol, lactose, 3'-sulfo-lactose, and 2'-fucosyllactose.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5duwA00
3VV1A 1S0GA 3DGTA 4OZXA 3VKMA 5HCAA 3OJBA 4YZ4A 3VKOA 1Q8VA 3ILFA 1AVBA 1OFSA 2D3PA 1KDMA 1V6OA 4BMEA 1MZ6A 1LOBA 2A6ZA 1G86A 1RIRA 4XIKA 2WJSA 2B7YA 3M1HA 3ATGA 2CNAA 2DTWA 4XMIA 4JRAA 1HLCA 2A6YA 1HQLA 2GNBA 3IN9A 1Q8QA 4Q2FA 3ASIA 4YM2A 2ZA9A 1CPNA 3O12A 1PZ7A 1RINA 2C9AA 2NM1A 4FPEA 1S0BA 1H30A 2WT2A 3FLRA 3OBTA 2YXSA 3MW4A 3R4SA 4XE9A 1I1EA 4GKXA 4JC1A 1GYKA 3AJZA 1RITA 2VW2A 3JUUA 1WUVA 3OGGA 1G9AA 5IK8A 4F83A 1NLSA 4XHBA 1N1YA 1W6MA 3IPVA 1F9KA 2D44A 2ZGOA 3NV3A 1TEIA 4L8QA 4UW6A 5EYXA 2E53A 4GWMA 1Z0HA 3M3OA 4YM3A 2ZGKA 1AF9A 2DTYA 3INAA 3LCPA 4P14A 5T5OA 1O4ZA 1BXHA 1BZWA 3UL2A 4XJ8A 5DUVA 5IUQA 4TZDA 3BIWE 1UPSA 2W39A 3POYA 4LBQD 5CNAA 5T50A 4YM0A 1D0HA 3PVEA 2V5YA 1MS9A 2DYCA 2ZGNA 3M2MA 4JCKA 2H0BA 1QOTA 2ZACA 2WQZC 1QOOA 1JBCA 2CTVA 2DVAA 3SLIA 1W6NA 4PBOA 3WLUA 1QDOA 1JYCA 2DUOA 3I8TA 1LHNA 3L2YA 1LHWA 1V6NA 3SH3A 2JECA 3AFKA 1DGLA 5IK4A 5IK7A 1DQ2A 3RQ0A 1LODA 1ONAA 3AP4A 2WT1A 1WLWA 2GNTA 1MS1A 2ZHKA 3N7KA 1G8WA 4U36A 1KDKA 1KQRA 5KXDA 1YO8A 1GSLA 3APBA 3AXEA 1S1AA 5EYYA 1DQ0A 1GZWB 3NV2A 3WDXA 1SBFA 3MW2A 4DS0A 2GNMA 3WNXA 2JDZA 3WUDA 4TYSA 4FPCA 1WBLA 2FHRA 3MW3A 1W6PA 4ISRA 2P37A 5F9TA 2VXRA 1JXNA 1H9PA 3V0AA 2PHXA 1JOJA 3ZYRA 1GNZA 2A71A 4P9XA 4FOWA 4XXAA 3OY8A 4XJZA 3V64A 2A6XA 4M00A 5F5QA 5LK5A 1Y7BA 1IKPA 1VLNA 2DV9A 1GICA 4Q8LA 2DU0A 4BM8A 3O0XA 1WW4A 3RMYA 1JHNA 2TEPA 3O0VA 4UW4A 2ES3A 4YM1A 2EXKA 4ATFA 4HANA 4YGBA 1DYPA 2ERFA 4YW5A 3AZZA 3UJQA 3IPVB 1W6MB 5GLTA 4YG3A 1W6QB 4XTPA 1GZCA 1GANA 2WNEA 1OQ1A 3WZ1A 1H9WA 5T5JA 5HCBA 3POWA 1R1ZA 3BOPA 2A6VA 2VW1A 4PQ9A 3VKNA 1ENSA 3HMYA 2YROA 4XBLA 4XZPA 3B3QE 1V00A 2WSUA 1LGBA 5T55A 2GMEA 2A3WA 3WG1A 1S0JA 4BOWA 4LBNA 1C57A 3B9CA 3OPZA 2R16A 1JN2P 2R1DA 3FLPA 4FPOB 3KM5A 3RS6A 1W0OA 1V6JA 2ARBA 2W68A 5JOYA 5L73A 4LBOA 1A3KA 5GLUA 1W6NB 3PVNA 5E89A 2ZGUA 1LECA 3A4UA 4FOQA 1AJOA 4FPHA 1S0DA 4XYXA 3N7LA 1FYUA 1LTEA 4R9CA 5H9QA 3WUCA 2UWCA 2OVUA 3SISA 3M3EA 2RHPA 5KXEA 5IT6A 1LEDA 2JJ6A 4LBLA 1FAYA 2W52A 4GWNA 2CL2A 1UL9A 2D6NA 1BJQA 4LBQA 4AVSA 4DQAA 1F5FA 3LSDA 3ZPYA 2OW4A 4Q1PA 3AX4A 1ZA4A 1LGNA 3IKWA 2ZHNA 1VALA 4Z8BA 1FNYA 2A6WA 1IS5A 5KXCA 1LHUA 2E6VA 1I3HA 2GNDA 1GV9A 2VU9A 2AREA 2EIGA 4FPKA 1MZ5A 2WSVA 2AENA 4YW3A 4MYEA 4BLJA 3OY8B 4LBMA 3N3HA 5GZDA 4AGVA 4AWDA 4Y1YA 4ITCA 1AXYA 1C1LA 3AZWA 2JKBA 4ISQA 3N36A 4FP2A 3WG4A 1APNA 2CYFA 3AYCA 1LOAA 1S0FA 1N3QA 4CZSA 3TB0A 1ULFA 1V6MA 1S0CA 4FQZA 3POSA 2OUHA 1QF3A 4WVVA 5GM0A 4YZ1A 3U4XA 1URXA 2G4IA 4BLIA 1JW6A 2AUYA 2ARXA 2EALA 4K20A 1Q8OA 2ZZJA 3KQRA 5AVAA 1CVNA 2P3KA 3QCWA 4FOVA 4W65A 4R9AA 3R05A 4FOYA 3ENRA 1AZDA 1DHKB 3WDYA 2NYYA 5DZFA 1VIWB 1WW5A 4AYUA 3USUA 1D2SA 2Q5TA 4P9WA 1DIWA 5DG2A 2BQPA 1MS0A 3D4KA 1LU2A 1DQ5A 4FP3A 2A7AA 3CNAA 5JMCA 1CQ9A 4YG6A 1FNZA 3T2TA 1WW6A 1DQ4A 1SLCA 1JUIA 1VAVA 3V0BA 4K1YA 1DYKA 1MS5A 2EXHA 3OBRA 4NOTA 3SNMA 4R9DA 3N7MA 3T1MA 2PELA 1QU0A 1LOFA 2AYHA 3AJYA 1FV3A 3O5SA 2NN8A 4XDQA 2P3IA 4K1ZA 1YIFA 2LALA 3OYWA 1V6KA 4LBQB 4Y22A 1WD4A 2DVDA 2DVFA 1AX0A 2A5ZA 4AVTA 4K21A 1N47A 4XIOA 4BPZA 5GLWA 2W08A 1GZ9A 3FLTA 4PF5A 4XJWA 4ZKTB 1ULEA 1AX2A 5CAZA 1V6IA 3B01A 1IS6A 3A0NA 3ZSJA 1DLLA 1PZ8A 2E51A 2JE7A 4XOGA 4UW5A 1CJPA 2ZMLA 1LOGA 1LJ7A 1LULA 3WG2A 4Q1RA 2ZHMA 4YGDA 2YZ4A 4GXLA 5KXBA 1LU1A 4YZ3A 2ZMKA 4FPFA 4WZFA 3O0WA 1WD3A 4I30A 5DUXA 3WOGA 2DVBA 1KJRA 3N35A 5GZEA 2A70A 1N1SA 2R0FA 4M3CA 1QNYA 4SLIA 4XTMA 3WG3A 1B09A 1SACA 5HCFA 2PHWA 2SLIA 2ZHLA 3D5OA 1NXD1 2XG3A 4HL0A 1HKDA 2YV8A 1WBFA 4XJAA 4Y1ZA 1WCSA 2Z42A 3DUIA 3AYEA 1U0AA 2JE9A 2EF6A 3MEPA 1QMJA 5EXOA 2UWBA 2D3SA 2UWAA 2PHUA 3W58A 3UJOA 1IS3A 4XHXA 3USUB 2DWRA 3M3CA 3TAYA 4ATEA 1BQPA 2PHFA 1W6OA 1S0EA 1LHOA 2A3YA 1N3OA 4DFSA 1HQWA 4FQ4A 2DUPA 1IOAA 5CBLA 4NO4A 4UW3A 5GLZA 5JLVA 3D6EA 1J1TA 1MR5A 1GKBA 3WV6A 2GMMA 3AP6A 3SH4A 5CB7A 1WLDA 3JU9A 4GALA 2D6PA 1GNHA 1V6LA 2C5DA 5T5LA 1FX5A 5EWSA 3W59A 1JYIA 1IKQA 2ZMNA 3ZVXA 3AK0A 1OKQA 5DXDA 1G9BA 4YFWA 3IM0A 1G9CA 1BKZA 3B00A 3WCRA 3ZXEA 2CWSA 2CWMA 4M01A 4BMBA 1KRIA 1ULDA 2R49A 4ASMB 1CIWA 2DURA 3RRDA 2D6KA 1G9FA 3ILRA 1SLBA 1CESA 4FPGA 3GNEA 5DZGA 4BQ1A 1N3PA 4Q27A 1N1TA 1YYNA 1DFQA 5E8AA 1W6PB 3ZXKA 3V0AB 2A3XA 2EXIA 1ULGA 3AYDA 3IMNA 3QLQA 3RMXA 3WHUA 1XQNA 4XJUA 2DUQA 2LTNA 5DZEA 3ZSLA 2VY0A 2UU8A 3M3QA 4XJ9A 1PZ9A 3SH5A 1SBDA 3UK9A 2ENRA 1KITA 3RSJA 4RL7A 4LBKA 2EAKA 4XXPA 5DG1A 4C1WA 4XBQA 1VAMA 1GLHA 1YI7A 3ZXLA 1ENRA 4FPLA 1LENA 2ZGSA 5JVVA 3Q9OA 5GZCA 3FBYA 1GZWA 5JDBA 2I2SA 4IQPA 5CA6A 4YGEA 1A8DA 1GBGA 1UKGA 1CONA 2YY1A 2ZGLA 1UAIA 1LOFC 5T5PA 3LSEA 5BYNA 1W6OB 2OUJA 1IS4A 1CR7A 4XILA 4Y20A 5GLVA 4AGRA 2ZGRA 4U2AA 5SV8A 4P9YA 3WDUA 3WDVA 2VH9A 1MS8A 2EXJA 2YMZA 3WHTA 3AYAA 1X50A 4AVVA 1SCSA 1SLTA 2VUAA 1AJKA 4RA0A 3PMEA 1SFYA 1ENQA 1EPWA 3BTAA 2V73A 3AZXA 3HN1A 3HR9A 4DRRA 4YLZA 1LGCA 5FRAA 2E7TA 2ZBJA 2D7FA 5GJ6A 1DQ6A 2GALA 2ZGPA 2NZ9A 2CY6A 4DPNA 1W6QA 2WLQA 4CRQA 3NWKA 3AP5A 3AZVA 1MVEA 1YRZA 3A0KA 1G9DA 5DUWA 3WCSA 1G7YA 2R1BA 1F31A 5JOZA 1ULCA 1C1FA 4FPYA 4YFZA 4PBPA 3NV4A 3I4IA 2NMOA 2ZAAA 3C2UA 2D6LX 2ZGMA 2AGSA 4WV8A 4KBBA 1AXKA 2ZGTA 4Q8KA 1Q56A 1HDKA 1SCRA 4YW1A 1KJLA 2PHTA 3R4UA 4YW4A 3SITA 1QOSA 1N1VA 3ZYPA 1Q8SA 2JD4A 4LBJA 4FVVA 2D6OX 3WVJA 1QGLA 1QKQA 1UMZA 3FUOA 3PJQA 2UURA 3AP9A 4Y26A 2P34A 3GALA 2AH2A 2D6MA 4YG0A 1MS4A 3V65A 1AX1A 3VKLA 5GALA 3BODA 4XMAA 4H55A 1AXZA 2PHRA 5FREA 4YW2A 5H9PA 4ZXKA 1LHVA 3ZSMA 3MPPG 2HYKA 4Y20B 5JOXA 1SLIA 2FMDA 5H9RA 1UX6A 3ZXJA 5E88A 1CN1A 2NP0A 4Y1UA 4Q26A 2KM2A 3ZXFA 1DBNA 2E7QA 1WLCA 1DZQA 1Q8PA 5H9SA 1WW7A 4YZ5A 2WKKA 4R9BA 4YZ2A 3V0BB 1LCLA 1S0IA 1BYHA 1W0PA 1DQ1A 2NMNA 4FPJA 4D69A 2GN7A 2DU1A 5T54A 3WDWA 3ILNA 1UN1A 1MVQA 2GDFA 5GZFA 1Z78A 5GZGA 1MS3A 4WVWA 3NV1A 5DUUA 2DVGA 3PVOA 2ZKNA 2ZABA 1MACA 3OYWB 4M3CF 4AGGA 4Y22B 1LOEA 1C4RA 1LOCA 1SLLA 1ZM1A 3AP7A 4Y1XA 2GN3A 4Y24A 1O4YA 2R0HA 1LESA 1YXWA 3WDTA 3FUQA 1CPMA 1LEMA 2VW0A 4GA9A 5JOWA 5IK5A 4XBNA 3B69A 3VUOA 1A78A 3ZSKA 3H0OA 2ZGQA 2AR6A 4M3CE 3T1LA 1QDCA 2P3JA 3VKFC 1QNWA 3AXDA 3AZYA 4Y1VA 5T52A 4CTEA 1UZZA 2A75A 4C1XA 3FFZA 2D43A 3RG0A 4DRVA 1FATA 4YGCA 2WT0A 3N7JA 1SLAA 2XB6C 4M3CB 1FV2A 2SBAA 4PCRA 2GMPA 2D3RA 4GKYA 1SBEA 2P2KA 1UZYA
chains in the Genus database with same CATH superfamily
2VQUA 4D6QA 3KF3A 5LBEA 3TYJA 5I0SA 2E32A 3HBZA 3HT1A 2WUHA 4XDPA 3VZKA 2B4KA 4AHZA 4UWDA 1C8M1 3ZR5A 4OULA 4E4DX 3T4VA 1Q8VA 3ILFA 2BOJA 3ZDSA 5FWEA 2D3PA 5FPXA 1LOBA 1HJFA 3PUIA 4LXLA 3M4FA 3VDDB 3PDQA 4QPIA 2WJSA 4ZZ5A 2XONA 3ZYBA 2CNAA 2DTWA 5FO7B 3T09A 4BA6A 3T0DA 3L2HA 1ALYA 4NIAA 1HLCA 1MQTB 1W99A 1Q8QA 4Q2FA 4UF0B 1XRUA 3URFA 1AR81 5C71A 3ACFA 1PM4A 1W8WA 2VQAA 1PZ7A 1RINA 2G9FA 1X9PA 1EY2A 4XE9A 5F32A 3HBKA 1OPMA 1POV1 4JC1A 3QOPA 4KQ7A 1RITA 3OGGA 2XBO1 1HJGA 3JB8A 3IPVA 5FMDA 5JUVA 2D44A 2JIGA 2ZGOA 4GZ9A 4AFCA 1W06A 5C70A 5AC92 2CGNA 1AR73 4QHBA 1HB2A 3LDKA 4QQPA 3VBOA 3INAA 3LCPA 2Q4SA 4EZHA 1O4ZA 4NIDA 1H2KA 5FYIA 2ETEA 3EB7A 3POYA 2W39A 4IGPA 5K4LA 5FJKA 1KD7A 4AI1A 3CL1A 5LA9A 3PVEA 1U5YA 1MS9A 3MLLA 3JD73 5CFDA 1W39A 3RZHA 4GWJA 5LBFA 1NUKA 3HIFA 2WQZC 5FTTC 1QOOA 5J48A 2DCYA 2X8KA 2CTVA 2DVAA 2HWD1 3SLIA 2D40A 2RS51 2Q8DA 3POBA 4LKSA 1LHWA 3SH3A 2QVSB 4WM7C 3DXTA 3K4DA 5IK7A 3W5MA 5HPOA 1IPSA 1DQ2A 1LODA 1AR62 1BEV3 2GNTA 1SQ4A 1MS1A 2ZTNA 4U36A 1PHMA 3WP3A 2VCBA 2HJIA 4AI8A 1KQRA 5KXDA 3WDXA 2WZ8A 3AXEA 3NV2A 3R4DB 4OMDA 3JBG1 4N9IA 1H1MA 3NSTA 4HK9A 3WW1A 2VMFA 3WNXA 3EJKA 4JKLA 1W9TA 1POQA 4FPCA 4TYSA 4CP2A 2WAOA 4DXTA 5F9TA 4NIIA 1FMD3 1H9PA 1ZZ6A 3KV6A 2PAEA 5IVVA 2PHXA 4XPVA 2P6HA 5D2AA 4ZS3A 1GNZA 2A71A 3ZYRA 4ES8A 5F6LB 3V64A 4PF1A 3WF0A 3Q8AA 1UW8A 2A6XA 1Q3EA 2B9VA 5A1FA 3VHNA 1VLNA 2DU0A 4YVWA 5IFPA 3OGVA 3RMYA 4AHXA 1X7NA 1UF2C 1SPPA 4AVBA 2ES3A 3ST7A 2EXKA 3ZFEB 3DKQA 1ZBA2 1JODA 4HANA 1XXNA 2DFBA 2UYAA 3CHXA 3KV5A 4RYDA 1XNDA 1YFXA 2FDIA 4YG3A 5G05L 1GANA 2WNEA 1K5JA 1R091 5T5JA 4B7KA 1T2XA 1CAUB 3OEBA 5LRRA 3VKNA 2VZPA 3RJ2X 3HMYA 4OHVA 4D7SA 2VZSA 2JG8C 1BVVA 4QPGA 4UAPA 4A42A 3B3QE 1LGBA 3ZSEA 4N43B 5FY5A 3VBSA 3OPZA 4CPBD 5BNOA 2QDRA 2R16A 4FPOB 3NJVA 1DGRA 1VB4A 1RUNA 3VHRA 4X8NA 3V56A 4MADA 2HWE2 4R8HA 1DG6A 4XAEA 1W6NB 1ND2B 1XE8A 4BE3A 2BFUS 1LECA 3A4UA 4UFJA 5FO9B 1AJOA 1B35B 4D6SA 4XYXA 1LTEA 4PJYA 4QPIC 2X09A 2WS92 2X29A 4I3GA 2CV6A 3M3EA 4DNYA 5IVFA 3OTFA 2D5FA 1PO22 1GNYA 5IT6A 4DXZA 1RUJ3 2D6NA 2QQVA 3NNJA 1Q5OA 1EAH3 1UY2A 2JXAA 2WABA 3RYRA 3CJIC 3VBHB 3ZPYA 1PK6A 1VMJA 4Q1PA 5FBJA 3IKWA 1AUYA 1XNKA 4GULA 2Y64A 4MO3M 3E6DA 1ZREA 2ZHNA 5JIAA 4Z8BA 1FNYA 5KXCA 3I2IA 4PIYA 5F5CA 5KHIA 3GZAA 2VU9A 4QQHA 1XNTA 2E31A 4FPKA 3S5QA 3PTRB 4MHRA 4SBVA 3P6BA 4C90A 5FZKA 1JZ2A 1HRV3 5FYVA 5LRSA 3IIAA 2RE9A 5GZDA 2X5IB 2OZJA 1C1LA 3PNAA 3VBOC 1J3QA 3ZKYA 5FYHA 1PGW1 1XSQA 4RGGA 4JGZB 4B8EA 5IATA 4Q4W2 1CAVB 1V6MA 2B39A 1H1IA 5CFDC 2OUHA 1QF3A 4YZ1A 3TEZA 3MIGA 4BLIA 4UYBA 4OHWA 1JW6A 2FZ1A 1PMJX 2ARXA 3O1MA 3LIHA 1TMF1 1RUH1 2VR4A 4NN0A 4W65A 2PHDA 5A3WA 3WDYA 4AYUA 1R082 5FZ3A 2V4VA 4LO7A 4MUVA 1WMXA 1YNAA 5DDJ2 1HXS3 5JXGA 2BQPA 4MGZE 1DQ5A 3C7EA 2K9ZA 2A7AA 3CNAA 3ELNA 4EROA 2LM3A 1FNZA 1O7FA 1WW6A 1BLZA 4EE2A 1QXJA 3PTYA 4CDXB 1VAVA 3KCCA 4LULA 4NOTA 3GYDA 5CZKA 4JVAA 3A7QA 3T1MA 2XL7A 1LOFA 2AYHA 4PT6A 4IL7A 1FV3A 2PQSA 4NRQA 3RI9A 5JSPA 4QDQA 4K1ZA 3KF5A 2EVXA 1KFUL 3H1WA 3OYWA 4XQDA 3WQ0A 3FWEA 3J7NA 2A5ZA 3GCXA 4MG2A 4YVWC 4IETA 5FZOB 1GZ9A 4GB33 1HW5A 4N9HA 4I0WB 4QU1A 3ES4A 5FLIA 1L3JA 3A0NA 4BQ4A 2XDVA 2YGLA 1DLLA 2W91A 4XETA 2JE7A 3UNPA 1H8TA 1LULA 3LEGA 2LW8A 2Y60A 4HXCA 4BU2A 2E26A 2QQJA 1CAXA 2ZMKA 3LEIA 1CZVA 1K12A 4EZ4A 4QPGC 5FJHA 1KJRA 2XXZA 3N35A 2J7MA 1N1SA 2R0FA 4GJZA 4M3CA 5JSOA 5EJ3A 3VBSC 5BNOC 1QJX3 1B09A 2SLIA 1NXD1 1Z7S3 4RN5A 4XDOA 2DCZA 3BN6A 4XJAA 1ND3B 4AEJA 1PO13 2R7EB 1C8M2 5KHHA 3MEPA 1QMJA 2CAVA 3Q8EA 1GR3A 2WO3A 4FTSA 5C9AB 1GOGA 3W58A 4A45A 4GJYA 4IEYA 2JG9B 2R043 3PLQA 4EWDA 3TAYA 1QIQA 1Y3TA 1BQPA 2PHFA 1TQ5A 5A80A 2R6QA 1S0EA 1LHOA 2XHKA 4XUOA 2G9ZA 3WSOA 4DXRA 1HQWA 2B45X 3QH7A 3THCA 1OUXA 3LDBA 5CBLA 1PK6C 4NO4A 4AL9A 1AR82 1FOD3 2PMWB 5JLVA 2Q1MA 4LO4B 2VZTA 4QB6A 5K8SA 4KGQA 3AP6A 1WMDA 1JHJA 4E2GA 2RS31 2WWUA 3BOWA 1E57A 2W1SA 3AL6A 2WNVA 3JU9A 5A6QA 1C28A 2W94A 2VMDA 2XBO2 1EV13 1NCQA 2KA3A 5EWSA 2ZMNA 1JYIA 1TNFA 1OMIA 3J7MA 4XFHA 1OKQA 3LFIA 5DXDA 1S55A 4COUA 1MEC1 2WZR2 3UETA 1NZCA 2KD7A 3PUSA 4QXKA 1DGWX 2R49A 5HV0A 3ZLIA 5J09A 1CGPA 2FCTA 3ILRA 3NVCA 1Y4WA 4CCOA 1W2TA 1HIXA 4GMP1 2OX0A 1N1TA 3L9JT 3ACLA 4XAAA 3ZXKA 3V0AB 1AR91 2A3XA 2EXIA 3AYDA 4QX8A 4XF1A 2MEV2 2VVEA 1F15A 3OGSA 5TSWA 1XQNA 1RYYA 2R061 4FXKB 2HWD2 1JZ4A 2VY0A 3IZOA 1H4HA 5J1XA 5ERLA 3R0RA 3SH5A 4LIUA 2AEYA 1E5RA 5FLJA 3UK9A 2ENRA 3RSJA 4OI0A 4NVPA 1GP5A 3LDRA 2EICA 3WW4A 1W8NA 1R1A3 5HI0A 2FCVA 4W6XA 5BNPB 5A3UA 1VAMA 1O3TA 5KHJA 1RUF1 1EP0A 4CU7A 1UMIA 2ZGSA 3Q9OA 5LBBA 4FAHA 3VZLA 3JBG2 2PXJA 2VBPA 3FFQA 3MLJA 4YGEA 4OHYA 1GBGA 1CZSA 1CONA 1HRI3 3MICA 4CP9B 2O0OA 1UAIA 1ULOA 2ZGLA 4RS5B 1LOFC 5I8YA 5BYNA 3VBFB 4IEUA 3OUHA 4Y20A 1IS4A 3AVSA 4AGRA 1GOHA 1O91A 1KGYA 5A33A 2ET1A 2AZ5A 4NPRA 2XL9A 3NNFA 3GCWA 3HAGA 4UT5A 4AVVA 4RA0A 1XPWA 1HV0A 2YPDA 3LB9A 3TBDA 1F4AA 3MF9A 3HN1A 2JDYA 4NMIA 4YLZA 4QQLA 4PDWA 5I0DA 4DINB 2GALA 1H8TC 1W6QA 2UY9A 2VECA 1NE4A 1K3IA 4ONUA 1R092 4YYOA 5DUWA 3RVHA 4YARA 4GH4A 3NKGA 1ULCA 1C1FA 4B1LA 2V09A 1KS4A 3G6JB 3WNPA 1UNBA 3NV4A 3DN7A 2C4XA 2G19A 1PGSA 4LKEA 3I2GA 1U5ZA 4L97A 4ASKA 3JQXA 1J59A 1R64A 1HDKA 1RVF1 4YW1A 4BQ3A 4F7ZA 3OD4A 1YLLA 4B4QA 4NHYA 1WKYA 1V9U1 4WM8A 1QOSA 1N1VA 4OLLA 1EPZA 4W6YA 4E4ZA 5IVJA 1YEWA 3DPRA 3RNSA 5FV3A 2LRPA 4QX7A 2BPA2 5JSRA 4PLNA 2ZKLA 4EJRA 4OI2A 1K5MB 3PJQA 5FP7A 4Y26A 2V5DA 2ZX3A 2P34A 3GALA 4D0QA 4DOUA 3LD8A 5FPUA 2VOXA 3V65A 1S4CA 2X10A 5GALA 1GWLA 2YG0A 4IEPA 4DEQA 4QX1A 5CEHA 4XACA 3O1PA 4CCKA 5FBZA 3ZSMA 2WNVC 2HYKA 4IE4A 5JOXA 3EXUA 2WAAA 5D21A 2YBPA 1NCQC 4MVTA 5JI7A 3E5UA 5H9RA 1UX6A 4LLFA 4IEOA 1J83A 1CN1A 1AR63 2IFWA 2NP0A 4IE7A 2CAUA 3PURA 3ZYHA 4XFAA 1W2UA 4Y4RA 3ZXFA 5CFCA 3IMMA 2OPKA 1PGW2 5EQUA 4N7UA 4YZ5A 5FMOL 1ZNPA 5FKBA 3BCWA 5B4XA 4D69A 4KGGA 2GN7A 1OVPA 2LUWA 5GZFA 1D2QA 3TN91 1MS3A 4KU7A 1UYYA 2CDPA 1TMF2 2DVGA 4XF4A 1RUH2 2BGOA 4IGQA 3CBNA 4M3CF 2FQPA 1LOEA 1RUI1 2EIEA 2XVKA 1SZBA 2GP3A 4HVQA 3K3NA 4Y1XA 1UU4A 2D5HA 5A1LA 3WDTA 5CIRA 3HVDA 4QPWA 5KHKA 2NQYA 1LEMA 2VW0A 5ANNA 1ZBA3 5IK5A 4W8JA 5AFEA 1A78A 2AR6A 3FHIB 4M3CE 1QDCA 2P3JA 1AYM1 5FZLA 4IV1A 2XJQA 4QMAA 1QNWA 3AXDA 4CTEA 3SCHA 2WNUB 1UZZA 2A75A 3FFZA 2D43A 5FXWA 3JXSA 1OXCA 4LT5A 2VVFA 3RWNA 3N7JA 1IPKA 1SLAA 2JB8A 3ZIWA 5A7OA 3IDEA 2RJKA 4JDMA 1L7LA 3U10A 2GMPA 4AEMA 2D3RA 4YSFA 4GKYA 2BGPA 1UZYA 4H7LA 4I0BA 4MXVA 3DGTA 4C8DA 2HWE3 3MUZ1 3OJBA 1A34A 1ODMA 4YZ4A 3H3ZA 1ENXA 1UU6A 3NAPC 4PDWC 2YUEA 1V6OA 4BMEA 2F6BA 4WM7B 1MZ6A 4UFHA 1G86A 2WS93 2RDRA 1O3SA 4N53A 4RHV1 4WVZA 3ATGA 1PO23 3BI3A 5HXMA 2JICA 4OZOA 4GH4C 3IN9A 4OI1A 4N8MA 1NA1A 2ZA9A 2ZEXA 4ARYA 1CPNA 3KVAA 4QXCA 4BWOA 1GU3A 1S0BA 1H30A 2WT2A 2YU1A 3FLRA 5DABA 3OBTA 2YXSA 1E5HA 4DO0A 1LB2A 2P3YA 2C0ZA 1VBB1 1SMVA 5IK8A 2Y8KA 1XJAA 2XWJB 2VZOA 3GBFA 2DCJA 4LOSA 4WM8C 1TEIA 2FDJA 2GSYA 1JZ8A 3MV11 4GWMA 4MZUA 1P8JA 4LHKA 3M3OA 2BW8A 5C8CA 2JDNA 2ZGKA 3ITQA 3LAGA 3T0BA 4AFMA 3DPRC 5IVYA 1F4HA 3K77A 2DTYA 4DUVA 1PMIA 5A3NA 4QXBA 4QKDA 5T5OA 1NZIA 1BZWA 4FI9A 3UL2A 2XJPA 3BIWE 3POFA 1LNSA 4Q4W3 5CNAA 4YM0A 4QU2A 1T6GC 4OUEA 2ZX1A 2V5YA 2ZGNA 5LA1A 3RFRA 1I5PA 2YFUA 2VL4A 4CXYA 1GQHA 3WLUA 1QDOA 2DUOA 4CXXA 1LHNA 3J8F1 1V6NA 3B93A 2P5BA 3T0AA 2HWF1 1R083 1VBE1 5FLHA 4ZPIA 2JE8A 4BZ4A 5DDJ3 1OBNA 1RUG1 1YHFA 2DF7A 1KFXL 2RM21 3AP4A 4V2WA 2WT1A 2ZHKA 3B5LB 5CFCC 1KDKA 1YO8A 4I02A 5JR7B 1DQ0A 2DBIA 3DECA 1COV1 3MW2A 5LA0A 5FZMA 3I2FA 1QJY1 2JDZA 3H8UA 4EQVA 3WUDA 1SFNA 2B8MA 2FHRA 4QPIB 1W6PA 1JZ5A 1JYXA 2VXRA 4DY5A 1JOJA 1OD3A 2QZ2A 4P9XA 5CADA 2R062 4FOWA 1JU4A 2ZS6B 4M00A 5F5QA 1Y7BA 3K46A 1WWYA 2WWSA 1WW4A 2RDQA 1JHNA 5BV6A 2TEPA 3O0VA 1I5ZA 1DDLA 4EYUA 4LHNA 4MH0E 1DYPA 3I2HA 4YGBA 5J36A 2AC1A 5EHDA 3OSDA 1DGWA 3DV8A 1RUF2 3MF6A 4H2AA 3IPVB 3UJQA 2HWC1 2WFPA 3FBMA 3BIEA 5A32B 4XTPA 1GZCA 5L9BA 4IXLA 3CJXA 5FMBA 1OQ1A 3BUCA 2WFF1 4H3WA 3POWA 4KWJA 1ENSA 3GZEA 2L9LA 2YROA 4KWUA 4XZPA 4PHZA 4BOWA 4BQ2A 2GMEA 4Z1VA 1S0JA 1SG3A 5F3GA 3AKSA 3UKNA 1REEA 4CP1A 3CO2A 1JN2P 2R1DA 4N90A 2CGPA 3KM5A 3RS6A 1W0OA 3OPTA 2W68A 5L73A 4A6OA 1C8M3 4IGOA 2FMYA 4QDSA 3PVNA 5KC5A 4FAGA 3CKHA 2ZGUA 2BGCA 2RR11 3NQHA 1S0DA 2VD7A 3N7LA 3SC7X 1BBT1 1U12A 2JB4A 2OVUA 4OHXA 4IERA 2VOWA 2RHPA 4Q0PA 4AK3A 2GZWA 3OF1A 5A7NA 3LF7A 4LBLA 2W52A 4GWNA 1ZZ9A 1UL9A 3I59B 1F5FA 3LSDA 3MHZA 1AR83 2OW4A 4GQ7A 4AW7A 3M70A 1OURA 4WBBA 3T2OA 2BEOA 2E6VA 1I3HA 4NE9A 5C4WB 2WSVA 1PVXA 4M0HA 1VB2A 4CEYA 5B2GB 3C7OA 4MYEA 5ANQA 5JXJA 1UMHA 2WZPP 2HBTA 4E2QA 3ZXGA 3ES1A 4AGVA 5C8CC 1AXYA 2J1SA 2WZR3 3MBWA 5K7PA 3H8XA 2RMU2 1O5LA 1SPPB 2CYFA 2VZUA 2WRAA 3AYCA 4NUBA 1S0FA 3WNMA 3CJIA 1N3QA 2ZEYA 3PIGA 2WQ4A 2WWJA 4C91A 2ZXQA 4CDUB 4I01A 4FCAA 3KT7A 2H0VA 1OD5A 1YQ5A 4FQZA 3I3BA 3POSA 5FPLA 5GM0A 4WVVA 3NL1A 3ZN5A 5FQ0A 2G4IA 3AMNA 3OBAA 1VBD2 5LBCA 2MEV3 1OFNA 1UD1A 3KQRA 2HWD3 3OCPA 3QCWA 3HNYM 1XYPA 3R05A 5FZCA 1H8VA 2B9UA 3ENRA 1AZDA 1JOBA 3THTA 4GAZA 4QPGB 5LY1A 3GXUA 4RR3B 3A22A 1QJFA 5DAVA 3USUA 1D2SA 2BBAA 2Q5TA 2Y6LA 3ZFFA 4ES9A 1DIWA 5BNOB 1AL21 3D4KA 2YHJA 3BU0A 1NG0A 2WN3A 4QM9A 5JMCA 3UYJA 3T2TA 2UY8A 1DQ4A 3D0SA 3OUIA 4JGYB 3AKRA 1O3RA 2RG4A 3JBG3 1JUIA 2IFRA 3V0BA 4K1YA 1OQDA 1PIV2 4RQPA 5IVBA 1NCRB 3SNMA 4HN0A 1CWPA 5I91A 2BFUL 2PELA 3IT8A 4E27A 3KLSA 1UYZA 1HB3A 3AJYA 3TN92 3THDA 2NN8A 4FFHA 2P3IA 4DEVA 3VBRB 2WN2A 1OLRA 1PK6B 1GP4A 4UOJA 2H6BA 3D8CA 1XU1A 3PL0A 3U4SA 3ZYFA 4CCEA 4KL1A 4K21A 3T30A 4BPZA 5CKNA 3RZMA 5GLWA 2GAUA 3PJYA 3FLTA 4XJWA 3H1MA 5A3OA 1BVP1 4ZKTB 1V6IA 2XJVA 1TZOA 2XHNA 3OB8A 2BNNA 4B29A 4XOGA 1FPN3 4UW5A 5IW0A 2ZMLA 2IUWA 1AYM2 4JQRA 2VOTA 2QQLA 5CISA 3AC0A 1O8SA 1AR71 2ZHMA 1C8NA 1R093 2YZ4A 4GXLA 4Q1RA 4QKBA 2QQPA 4YZ3A 3RWKX 1WD3A 2ADEA 4LQRA 2HKXA 2DVBA 2BNMA 1YQ8A 5GZEA 4K7JA 2A70A 4O7XA 1J58A 4IE0A 4XTMA 1RUD3 5F6KA 4EN6B 4CUGA 5L7OA 3MLKA 3MFCA 5ISLA 4META 2PHWA 4A7YA 4HL0A 5ACA2 2XUMA 4EWAA 3USSA 3LOIA 2LROA 5FP9A 1ZBE1 2Z42A 5FCCA 4KH9A 2ILMA 3AYEA 4LHSA 5EXOA 4EN9B 5EJZB 5A6ZA 3VDBA 5JZGC 3NJZA 3H42B 5I93A 1ZRRA 2PHUA 3ZYGA 3UJOA 2K0GA 2Z79A 4XHXA 3M3CA 3K51A 1PVC1 2BRTA 2Q8OA 5JXHA 4ASLA 4RHV2 1W6OA 4CYDA 5FZ9A 2A3YA 4AXOA 3KD4A 3JB4C 1VRBA 4FQ4A 3AL5A 2DUPA 4CDQA 2BU9A 4UW3A 4P08A 1J1TA 3ZN6B 1MR5A 1UY0A 4NROA 3EBRA 4MGIE 4CCLA 3POIA 2GMMA 1C5IA 4XABA 4AI0A 3KV9A 4XUNA 5CB7A 3SEEA 1FMD1 4MOAA 3DKWA 4CEYC 1GNHA 1VBB2 1V6LA 1WCKA 2C5DA 2VBDA 3WW3A 3W59A 1QJU1 1IKQA 3E1F1 2ZX4A 3DEMA 5LCWL 1G9BA 4NRPA 3MO4A 3B00A 3O1RA 2FDKA 2CWSA 2CWMA 3CF6E 3IWZA 1ULDA 1U5XA 4COWA 1MPXA 4ASMB 4YNIA 4AR2A 1F8VA 1W2AX 1VE0A 2XR4A 4XQWA 1W05A 1CESA 2VQ0A 3TNQA 3GNEA 3RYPA 4MV2A 3WF1A 4BQ1A 4Q27A 5G04L 1Y43B 5E8AA 3S7IA 1YFUA 1W9WA 3U78A 4V2VA 4KWKA 4LTAA 1OH4A 4HSJA 1UOFA 1TMF3 3RMXA 1RUH3 1CAXB 4PI0A 3CU7A 2XPJA 2LTNA 2BDRA 2VOVA 3I2DA 1BK1A 3ZSLA 3M3QA 4XJ9A 3J8F2 1W3VA 3ACGA 1SBDA 4CEWB 3C8XA 4BHPA 2HWF2 4AZZA 3ZFFC 1QXRA 2EAKA 2MPFA 4XXPA 1RUG2 4TXWA 4TSVA 2RM22 5JIUA 5FYYA 1LENA 4OFGA 2A73B 4JTNA 4QQ2A 2I2SA 1COV2 3ZMNA 2J1RA 1BHGA 2GH8A 5BY5A 2XVLA 4IQPA 4RQPC 1A8DA 1Q43A 2PYTA 1LRHA 5A7WB 5CA6A 3KWVA 3FE5A 3KCXA 2HWB2 3LSEA 5T5PA 4JZRA 3TEWA 4HSLA 2OUJA 2WIIB 4E2SA 5FOBB 4U2AA 5SV8A 4FT8A 3KHBA 5IFTA 4P9YA 2EXJA 1EAH1 4AEDC 4AE2A 4GD4A 1H2NA 1DLCA 2W5FA 1D4VB 1SCSA 3SCGA 5FZ1A 4CE8A 1AJKA 4ZU7A 1AL0G 2VUJA 1SFYA 2ZZQA 4DUXA 5CKQA 4OHZA 4L92A 2WNVB 2ID4A 3N9LA 4LJHA 4NJ4A 1LGCA 2E7TA 2YDEA 2D7FA 5GJ6A 1DQ6A 1HRV1 2G1MA 2HWC2 2CY6A 2NZ9A 2OKXA 2JD9A 4G9SB 2WLQA 2IXJA 3AZVA 3VZOA 1MVEA 3A0KA 4YVSC 3RZJA 4XUPA 1NY71 4GMP0 2XKPA 4Q4X1 1DCSA 1F31A 1WCDJ 4XQ4A 5JOZA 3I2KA 4JHZA 5L7OC 5LATA 2W47A 3K3OA 5FY1A 4J1XA 2ZAAA 5HCHA 3E6BA 2D6LX 4JDNA 2Y6FA 4CXWA 2PLV2 2VZ3A 1J3PA 1Q56A 1RXFA 4QKFA 2XH6A 4M0NA 3WNNA 3K75B 4Q8KA 3ORJA 5KWRA 3CIHA 4Q4Y1 2RR12 3D3AA 3UGFA 1ZZCA 2VZVA 3GHNA 1TG7A 3VDDC 1BBT2 4KG8A 3HWJA 1HXS1 3WVJA 2UYBA 3GF6A 4PQQA 1QKQA 2VBBA 4QX5A 5ABJB 1PNGA 4QHZA 4H7MA 2X53S 2UURA 3AP9A 4CDQC 1VMFA 1MS4A 4IEQA 2E33A 2HEWF 4PLMA 4J1WA 1W04A 3VKLA 4LOTA 4AAXA 3WW2A 4BK4A 1AXZA 5FREA 1ZA7A 5H9PA 4Y20B 1NT0A 2XMLA 4LUMA 5E88A 2OPWA 2W95A 1NLRA 5FMCA 1QJEA 1RUE1 3R6SA 5C3QA 4UFIA 2X5IA 1ZYBA 1D7PM 3WQ1A 2KM2A 1DBNA 4D8MA 1DZQA 1Q8PA 5H9SA 1WW7A 3RZGA 1BYHA 2AACA 5FY8A 4GMP3 1W3XA 1NKGA 2F4PA 4UBGA 4A3XA 1JYTA 1WGPA 4XUQA 5L36A 5T54A 2DU1A 4KBZA 1OA4A 2VQTA 1VRH1 5EFUA 1MVQA 1DYOA 1YQ6A 1AHSA 1Z78A 5E1RA 5GZGA 1AYN1 3AMHA 5DUUA 3I54A 4CSWA 4NHXA 2R063 1YQ2A 2ZABA 2ZKNA 3MPBA 2QQWA 4AGGA 4Y22B 2J1EA 2ARCA 1ZM1A 1SLLA 4ARXA 4Z82A 3AP7A 1OKOA 2OT7A 4Q0QA 3KGLA 1XYNA 2GN3A 1ODNA 3VHOA 1PM7A 3TEXA 1O4YA 2R0HA 1W9YA 3NMBA 2X05A 5JOWA 5JXIA 1RMU1 1Z7S1 2RDNA 1RUF3 3WINE 5K9YA 4P5HA 2KR2A 4WM8B 2Z4FA 4B4RA 1WA6X 4CDXA 1JUHA 1TE1B 3VKFC 2QFEA 2P17A 4FO9A 3LA2A 3W21A 1NE6A 1E5SA 4AAPA 4QWNA 3RG0A 3DPRB 4BJ0A 2RS52 1O4TA 5J37A 5FUIA 4EN8B 1F2NA 4IV3B 1ST8A 1FV2A 3FMGA 1OA2A 4LO5B 5A3MA 3FHAA 5F39A 3NW4A 3VV1A 4BXSV 1S0GA 1RUOA 2IWGB 2IVIB 1VR3A 5HCAA 5FZOA 4MGYE 5CU1A 1IHMA 3ETQA 3ZFEC 2VCMA 1YFYA 3J9SA 2PFWA 2QJVA 3KHCA 4Y3OA 1W2NA 5A70A 2VUCA 1EV11 2A6ZA 3N9PA 1RIRA 4FTBA 5A3LA 1CAWB 3S30A 1UX7A 1W8FA 4QX2A 4XMIA 5CFCB 3T3YA 4JRAA 2I74A 1S2KA 1RTVA 1DU3D 3ZXDA 4AEKA 3ASIA 1W8OA 4LITA 4LIVA 2NM1A 2C9AA 3BGAA 2VTFA 4TWTA 1VJ2A 3EYPA 5A1AA 1UXXX 5FZ7A 1VP6A 1WMFA 3MW4A 3R4SA 4QGNA 1I1EA 1A8MA 3MFAA 3AJZA 5FZFA 3NAPA 2VW2A 1WUVA 3ZM8A 1G9AA 4L99A 1ZBE2 1ND3A 3DL3A 1NLSA 1JOPA 1N1YA 1W6MA 3A21A 3ETPA 3GBGA 2QKDA 4IEWA 4XHBA 5EYXA 2VMGA 1HN1A 2Y38A 3LFMA 1Z0HA 1Y9GA 1B35C 4Q0UA 4YM3A 1AF9A 3C7FA 2RMU3 2HLEA 1PVC2 4P14A 4BQ5A 2QQMA 4TZDA 5DUVA 4LEJA 5T50A 4Y5Z0 5DN2A 2R30A 1UOJA 4HK8A 1D0HA 2HEYF 3DYPA 4ZXEA 3X29B 4JCKA 1W0NA 2DYCA 3M2MA 4IV1B 4P00B 4EV0A 4YW7A 1VBD3 5BUVA 1QOTA 4A4AA 2ZACA 5K0UA 1HRI1 1JBCA 3PHMA 5EZWA 1QQP1 1DF0A 1XSRA 1VBA1 2ZEZA 3I8TA 3OD0A 4J25A 4DZGA 3L2YA 5AC93 1OQEA 4COZA 1UZWA 2Y0OA 2JECA 1QJU2 3WEZA 4HLTA 2YYOA 4NAMA 3RQ0A 1XE7A 2WL1A 2XUEA 2X5IC 5FPAA 4LNVA 1WLWA 4A7ZA 3N7KA 4RFRB 4E4SA 4QGLA 1GSLA 2BVBA 4CCNA 5EYYA 1GZWB 2VTXA 1SBFA 4JGZC 4DS0A 2BERA 1PIV3 5FDBA 4QM8A 1WBLA 1OC1A 3VBUA 3QD6A 4ISRA 2P37A 2PQQA 4N53B 5F3EA 1JXNA 2BV4A 3TN93 5KC6A 3GBWA 1ASJ1 2JWPA 3V0AA 4P9JA 1IGOA 4XXAA 3OY8A 3BTYA 4QQOA 3LZZA 1NA1B 3H9AA 4X6RB 1OOPA 1IKPA 4XURA 3O1TA 4Q8LA 5L9VA 1XNAA 3K2OA 4Z2WA 2XJUA 4UW4A 4YM1A 5BNPA 4ATFA 3THPA 4F8AA 4YW5A 3C7HA 4QXHA 5GLTA 3O14A 4CDXC 1AYM3 2BYVE 4UFKA 3U75A 5I8TA 3WZ1A 1H9WA 5C3RA 5HCBA 1J1LA 4YRDA 1J3RA 1M4WA 1R1ZA 2VW1A 3BOPA 1HX6A 4PQ9A 4RS5A 4E9KA 5FK8A 4D7TA 2VCAA 1LR5A 5C3SA 4I09A 4XBLA 1V00A 3NJXA 5T55A 2OYZA 3VDCA 4TTGA 2EAAA 5I0UA 3MGUA 1C57A 4LBNA 2VMCA 5ACA3 3ZIXA 1GUIA 4AI9A 5FZDA 5JOYA 4LBOA 4ORFA 5EJ1B 3TRSB 3KT1A 2P1BA 3UESA 2VNRA 3EHKA 2R071 4FPHA 5JCTA 3RYKA 4Q0SA 3B02A 5H9QA 2UWCA 2I45A 3H50A 2JKXA 2YB7A 1TME1 2MNGA 2PTMA 3OEAA 4NPMA 3HQRA 4RHV3 4IESA 5KXEA 1RJ8A 2OIIA 2RS11 4PIZA 2CL2A 4LBQA 4HKWA 1NY72 2O1QA 4Q4X2 1ZRCA 4CA9A 1ZA4A 3I97A 4AQTA 1W9SA 4JX0A 2QDNA 2A6WA 2GNDA 5DAWA 1GV9A 2AREA 5FFOC 1VBB3 1PX4A 3WR0A 2QQUA 1ND3C 4BLJA 1BMV1 4LBMA 5FZGA 4Q4Y2 3KMHA 4R52A 4Y1YA 3UKTA 2JG9C 4KU8A 3N36A 3WG4A 2C6SA 3WXPA 3H1YA 3W5NA 4AI2A 1LOAA 2W9XA 4BQYA 1NQJA 2YC2A 1ZBA1 3KGZA 3S7EA 4CZSA 5A7PA 4L0PA 5BPXA 1UIJA 1ULFA 2D98A 4DIQA 1S0CA 4CDWA 1PX3A 3ACIA 4P9IA 3N9NA 5K0UC 2AUYA 1NX9A 2EALA 1Q8OA 1JYNA 4AVAA 4TLFA 2P3KA 1YCIA 4FOVA 4WVMB 3CMGA 3J8F3 3VGIA 1OVSA 2QQNA 1DHKB 5FZBA 1UYPA 2HWF3 3VD3A 4DXSA 3DF0A 2ATFA 3KS7A 4HPKB 3SQOA 2P4EA 1RUG3 5DG2A 1C5HA 1MS0A 2WO1A 1RUE2 2RM23 4MGTA 1D4M1 1LAJA 3N9MA 4FP3A 1JU3A 1CQ9A 3LPGA 2HWE1 4W50A 3OOXA 4HOOA 4XCBA 3OPWA 1SDDB 1COV3 3S0MA 1SLCA 5FR3A 1ZRFA 3OBRA 2JX9A 5SV5A 4AQ6A 3MIFA 4R9DA 4LO6B 3VBUC 2HWB3 2RS32 1VRH2 2YC0A 3GDBA 3IAQA 4HG6B 4MXWB 4NPLA 5GKAC 2JG8B 1W28A 4LORA 4BDVB 4XDQA 1AYN2 1QEXA 4L2NA 2CDOA 3BALA 1X82A 2LALA 4IDZA 3CLPA 4JAAA 4AQSA 1OOPC 3LA7A 2F17A 1MEC2 5FPZA 4AVTA 4NIGA 4X8PA 1N47A 3VZMA 3FN9A 4PF5A 5BNPC 1ULEA 1AX2A 3P1IA 1XB9A 1RMU2 3ACHA 4F3JA 5JR2A 2VNOA 4Q4V1 2HWC3 1CZTA 1FI2A 1SEFA 1OHFA 5L19A 1AR92 5D8AA 3WG2A 2XQRA 2Q8EA 4YGDA 2WNUA 3FL7A 3HQXA 4FTEA 3AMPA 4FPFA 4RS5C 1RUC1 2XLGA 4WZFA 1HB1A 3T4HB 3VBFC 3CJIB 4Y33A 3WOGA 2FBEA 1QWRA 4XFGA 1IQAA 1POV0 4JKMA 1XBFA 4HMZA 1M06G 1IG3A 4KG0A 2W46A 5HCFA 2ZHLA 3SEPA 4UBHA 1NLQA 1XNBA 1ZX5A 2PLV3 2XG3A 5FQ0B 1WBFA 3I3DA 4LK6A 4LKDA 2IXIA 1BCXA 3FJSA 1WCSA 3FZ3A 3P3PA 4Y1ZA 1U0AA 5CG8A 1JI6A 1S2BA 2EF6A 2XWBB 3CEWA 2UWBA 2RR13 5JPMB 3N4MA 4K3UA 2D3SA 1IS3A 1R081 2EA7A 3VBOB 3USUB 1BBT3 2DWRA 3J4UH 3ZFFB 4O9EA 3ZPOA 4AFAA 4ATEA 5EIYB 1VBC1 3OUJA 4G3YC 3VL9A 5IAXA 5IHRA 3KV4A 1QY4A 1GMMA 4DFSA 5DAPA 1HN0A 3LWCA 4Z2AA 2DDUA 1OH3A 2RVAA 3BPZA 1OI6A 5FZAA 3WNKA 5C33A 5CFDB 4HVRA 3RZLA 1OA3A 3MZHA 1YI9A 1QXPA 1OLQA 1GKBA 3I3EA 3WV6A 4QB2A 4CUAA 3SH4A 3KSCA 2C24A 5KR7A 5JZGA 4GALA 2Y33A 5L9RA 1SHWB 5F2WA 5JMOA 4LPLA 4JRLA 2ZOEB 1YWKA 3ZR6A 2G9GA 2BBVA 3BKZA 3WY6A 2J1TA 2HEVF 3IM0A 3IBMA 3RI8A 3WCRA 5F7UA 1KEXA 4M01A 1KRIA 3UV9A 2W3JA 1JZ3A 4MSVA 4Q0VA 2DURA 1UZ0A 2O8QA 3BPSA 1RHI1 3AM2A 1SLBA 3LQCA 4FPGA 3BTZA 1K5MC 4CUBA 3EQEA 1N3PA 2XJRA 3OBZA 1V70A 1YYNA 1DFQA 4CDWC 3VD5A 2TBVA 1POV3 2I07B 3U37A 3QLQA 1ULGA 3IMNA 2XBO3 1RVF2 3VD9A 5BNNA 1QQP2 1UPIA 2BWCA 4KNCA 4XJUA 2DUQA 1VBA2 1I6XA 2QE3A 5DZEA 2UU8A 1V9U2 4FBFA 5F37A 1PZ9A 4J6GA 5FP3A 5CYYA 4K8RB 1KITA 3MI8A 2AEZA 3ZXAC 1UCXA 2ZEWA 4LR4A 4YVWB 3T08A 1H4GA 3AVRA 3MIEA 4LBKA 4MGKE 4RFT0 4Y5TA 5DG1A 4E8DA 4C1WA 2FZ2A 1XU2A 3WNOA 1NXMA 2PN5A 4RGAA 1GLHA 4XW3A 5KBFA 4OUMA 4FPLA 4AFBA 3P5BA 4FFFA 3WT3A 4HFSA 5GZCA 3FBYA 3U11A 5JDBA 4GIQA 3U1XA 2GC1A 5FY9A 2BP6A 2YY1A 2RS53 3GJBA 2IXHA 4CUCA 4JKKA 1W6OB 5GLVA 1CR7A 5FXZA 4XILA 1ASJ2 4A7KA 2IZWA 2IC1A 1UO9A 2OA2A 1ZZBA 4AFDA 2DFCA 3H7YA 3WDUA 5FZHA 1F35A 1MS8A 3NNLA 4YPJA 3VBSB 4CDQB 3WHTA 4QX3A 2GC0A 3AYAA 2YPJA 2ZJCA 2ZPXA 5FP8A 4JQTA 2V4AA 2VZRA 3PMEA 4LO8A 1JYWA 4K8FA 1EPWA 3ZFGA 5DAXA 3BTAA 1LKNA 2J22A 2ORXA 5A3PA 2V73A 4DRRA 3LIGA 4E4HA 5FRAA 1O59A 1SFPA 1H2LA 1X33A 2B42B 2C26A 2ZGPA 3HOBA 5D8AC 5FZ0A 3O1SA 5A32A 4CRQA 3NWKA 2BJSA 1WCUA 4L9BA 3LPFA 2WNUC 2WZR1 4Y5SA 3WCSA 1QH6A 1G7YA 1RUI2 4XZUG 4AEDA 5LEKA 2P6CA 4PIXA 4YFZA 3UT0A 3FHQA 3I4IA 2BOIA 2KXLA 2NMOA 2GC3A 4QDRA 1US2A 3H7JA 5FZEA 3C2UA 5J98B 2ZGMA 3SHRA 3NJYA 2VE1A 3GM8A 4WV8A 2ZGTA 2MEV1 1ZBE3 5JWPA 2JDMA 1KJLA 2PHTA 3HD8B 1US3A 4YW4A 3SITA 4COYA 2VNVA 2TUNA 3RZKA 1VAKA 2WO7A 2H6CA 2R072 2YFZA 2WO2A 3ZYJB 1Q8SA 2JD4A 4LBJA 3VHPA 2Q1ZB 4YVSA 1PVC3 2XGXA 1TME2 3N9OA 1WA4A 4CCJA 1QGLA 4KI5M 5FYTA 4CP0A 1UWWA 2RS12 2WQ8A 3FUOA 1XOYA 5FPVA 4AHWA 4YG0A 3E6CC 2D6MA 3I59A 3U0ZA 4ZZ8A 3JD71 2WR9A 2WZEA 2FCUA 2LS6A 2HBUA 4ZONA 5C5UA 4H55A 4HKLA 3RPQA 5A7QA 4YW2A 5FUPA 4ZXKA 1LHVA 3E5XA 3O7OA 3ZO0B 5C4WA 4IEXA 1SLIA 3CZUA 3M7AA 2Q8CA 1QJU3 2FMDA 3VDDA 4QX0A 3ZXJA 2GP5A 2WLPA 5C5TA 1BMV2 3POJA 3HQUA 2YBKA 3U14A 1BEV1 1YJLA 2FDGA 3LEMA 3ZMOA 1MQTA 2E7QA 1WLCA 3VDAA 4UF0A 3QACA 4YZ2A 2WKKA 4R9BA 1LCLA 3BU7A 1ZRDA 4CDUA 5A3TA 1W0PA 2NMNA 4FPJA 3WD5A 3C7GA 3DYMA 2ZX0A 5APAA 1FPN1 2J1UA 4W4ZA 2GDFA 1UQXA 3W20A 4UFMA 3NV1A 2ZCWA 5BNNC 3VL8A 3PVOA 4NRMA 3OYWB 1MACA 3M8LA 4B1MA 2IXKA 1O5UA 5LB6A 4HETA 3LA3A 4RR3A 1NOVA 4Y24A 1YIPA 1RUD1 5FZ6A 3TNPB 4AG4A 4ZU4A 1CPMA 1O6UA 2CHHA 3S6PA 1D4M2 5IWFA 1E5IA 1GQPA 4BH9A 3VD4A 1Y9MA 3VUOA 1XE0A 3AKTA 2ZGQA 1CIYA 1H8TB 4JGYA 4XF9A 4Y4YA 2Y6JA 3T1LA 3T2PA 1X8EA 4I3PA 3AZYA 4Y1VA 4D6RA 2DBNA 4AHYA 1PMHX 2Y26A 1NCRA 3N9QA 3JZVA 1JH5A 4DRVA 4ZHNA 1FATA 4XFBA 4DB5A 3I2JA 5E6HA 2XB6C 5FZIA 4D7YA 3H8RA 2D97A 2CGOA 1K45A 1VBE2 4M3CB 3HNBM 4PCRA 3VBRA 2CU5A 3G7DA 1W8HA 1RGSA 3O0XA 1YJKA 2P2KA 3PVBB 4QPYA 3LKJA 1RJ7A 3AFGA 4XFFA 2VXJA 4BQWA 4OZXA 3VKMA 4G4FA 5B4NA 4LHLA 4WZCA 3ZFGC 3CQOA 5J96B 3VKOA 1UOBA 4A44A 1OSGA 1AVBA 1OFSA 2WINB 1DZRA 1JS9A 1QJY2 1KDMA 5FP4A 4MHUA 5FWJA 4Q4V2 4XIKA 4BB3A 3F2ZA 3DCQA 3PU8A 5FYCA 1EYBA 2B7YA 3M1HA 5A6YA 4FFGA 5IVEA 1SDWA 3AMQA 2ORZA 2WYSA 5EP9A 2A6YA 5DAQA 1HQLA 1RUJ1 1YC61 1RUC2 2GNBA 3DXUA 3MV01 4FFIA 4LE4A 4Q4X3 4A6SA 4YM2A 2EIDA 3POGA 3WF3A 2MHFA 2B46X 3O12A 4FPEA 4UXAA 3RJRA 1REDA 4GKXA 3ZFEA 3ZYIB 1GYKA 3JUUA 4CCDA 4OQ9A 2Q0AA 4F83A 5LZ6A 1NCQB 4KMQA 4L8QA 1F9KA 4UW6A 3NV3A 2VC9A 4K40A 2E53A 4Q4Y3 5E16A 4X6QB 1HB4A 2WFF2 4QB1A 3VN4A 4DUWA 1CAUA 2N7GA 2VVDA 3H3UA 4PLOA 2QQKA 3CDZB 4P9GA 1V0AA 1BXHA 1VBC2 4XJ8A 2D93A 5IUQA 4NHMA 5FYMA 1UPSA 3ROUA 4LBQD 3ZKUA 2YGMA 3ZN4A 2VG9A 3Q8CA 4N43A 1W9FA 3WQBA 2R32A 3SKJE 4YWAA 2H0BA 3ZN6A 2Y6HA 3ECQA 4ZY9A 1W6NA 4PBOA 1ND2A 1JYCA 4M4RA 5C4WC 3T2QA 4BQXA 1B35A 3AFKA 1OF3A 2NPIA 3D0JA 1DGLA 4S2FA 5IK4A 1W2OA 3MIDA 5FZ8A 4K9SA 1C3HA 1RUE3 1KXGA 1ONAA 2JEMA 2VJXA 2C9KA 1OPOA 3KQ4B 1G8WA 3Q8FA 1OLMA 1MQTC 5LASA 3APBA 3HN3A 1PGL1 1S1AA 3VBHA 1UIKA 3WNLA 5LA2A 1RHI2 3LE0A 1UOGA 4CDUC 2GNMA 4P9LA 1MZEA 4HBNA 4URTA 5BNQA 3IB3A 2RS33 1VRH3 3MW3A 4A3ZA 1A6CA 2VPVA 1AYN3 3WP5A 4ZU5A 3ZX7A 2VUDA 4XJZA 2BZDA 5A33B 2GU9A 3TWIA 3PUHA 4V1PA 5LK5A 1UYXA 4XC9A 5FUNA 3ZDVA 1MEC3 5FZ4A 4RR3C 4CEWA 1F5JA 2DV9A 1GICA 4BM8A 2WA3A 4GB31 4XVHA 2TNFA 3HJRA 4JGZA 1RMU3 2IXLA 3NAPB 1I9RA 4PDWB 1CAVA 2ERFA 1OT5A 2VM9A 3AZZA 3RZZA 5FY4A 4IE6A 4JGYC 1W6MB 4KWLA 2W87A 1W6QB 1AR93 1JTZX 4PI2A 3C3VA 4HN1A 4TLGA 5A7WA 1NCRC 1CD3G 4E8CA 3F95A 2A6VA 2Y6KA 1W03A 4CU6A 1FXZA 4GH4B 5HXVA 5HBAA 2J1VA 4R4XA 3WX5A 1U5IA 3UKVA 1OUSA 1O3QA 3VBRC 2QCSB 2W1UA 2WSUA 3WG1A 2A3WA 1QJX1 1AL22 3B9CA 2YC4A 4UI9L 3WF2A 3O1OA 4NR1A 3FLPA 2W1WA 1GFF2 1V6JA 4XEZA 4O9GA 2ARBA 5K0UB 3H8OA 1PO11 2VNGA 1A3KA 3NNMA 5GLUA 5E89A 4LUKA 1GP6A 2VMHA 4FOQA 2JDAA 5I0TA 1GWKA 5LW9A 3PU3A 2RV9A 4R9CA 1FYUA 3BTXA 4CU9A 2R041 3VLBB 3WUCA 3M3IA 2XJSA 4I0AA 3SISA 2VZ1A 5FO8B 3O1UA 2Y0IA 4RSUA 1LEDA 1ZZ7A 1JZ7A 2JJ6A 4OVEA 1FAYA 1GOFA 2WC2A 1BJQA 4DQAA 4AVSA 1Y9QA 1NYWA 3O1VA 1FOD1 4S2DA 1GZTA 3AX4A 1T6BX 1LGNA 3J7LA 5FXXA 3WP4A 2ZX2A 5JI9A 3KZ4C 4B3NA 2PHLA 1TNRA 1H1AA 1VALA 3VBUB 3I2OA 1IS5A 1LHUA 5I0RA 4B4PA 5C6CA 2EIGA 3MUY1 1MZ5A 4OUSA 3RDIA 4URAA 2AENA 1JMUB 2BWAA 4RGKA 1IPJA 4YW3A 1NQDA 5FYBA 5A6XA 3OY8B 4O65A 4QAWA 3N3HA 1OOPB 5F5IA 4LE3A 4AWDA 4ITCA 1AR72 4NAOA 3AZWA 2JKBA 4ISQA 2JENA 4FP2A 1APNA 3BVCA 3UGHA 3WQ7A 2WDBA 1S2EA 1KS5A 3B7MA 4HT1T 5DQ0A 5ABJA 3NO8A 3TB0A 1L7RA 4N43C 3FC0A 1NAEA 3JD72 3U4XA 2VAUA 2BNOA 1URXA 2VZQA 1RVF3 4K20A 2ZZJA 1ACCA 1QQP3 3IIIA 5AVAA 1CVNA 3W9AA 1ND2C 1VBA3 4C0HA 3IAPA 1V9U3 4R9AA 5LK7B 4P5YA 4FOYA 4Z07A 4DY3A 4HONA 2NYYA 5DZFA 5C9AA 1HQNA 1VIWB 1WW5A 2ADDA 2JG9A 2OS2A 2QZ3A 1DP0A 4P9WA 1UU5A 3P3NA 1R1A1 3E5QA 4N7IA 1LU2A 1BEV2 3PIJA 4YG6A 2Q30A 4W6WA 5FIXA 3VBHC 4MLOA 5J3UA 3OGJA 3I3QA 1X9TA 3GZUC 4QT6A 3ON7A 2W92A 1DYKA 1MS5A 2EXHA 4MGSA 2PAMA 3N7MA 3GJAA 5IVCA 1FPN2 1QU0A 3WF4A 2VMEA 1QJZA 1FMD2 4OMCA 3J26N 1ASJ3 3O5SA 2IVJA 4L11A 4MX3A 4BISA 1YIFA 3HPNA 2Q1FA 4COVA 4XF0A 5JAXA 2ZAHA 1UY3A 1V6KA 4LBQB 3UGGA 4Y22A 4OI4A 1WD4A 2DVDA 2DCTA 1AX0A 2DVFA 3SKVA 4CEWC 4CPBA 4XIOA 4LK7A 5FY7A 1RUD2 2W08A 4B7EA 4CCCA 2J42A 4BIFA 3CZJA 5CAZA 4HZFA 4OQ8A 3B01A 1IS6A 3ZSJA 2W2IA 3EMRA 1PZ8A 1RC6A 2E51A 2QQIA 5LWBA 3K48A 1CJPA 1UXZA 1LOGA 5HV4A 1LJ7A 4IEVA 1UZVA 3SXWA 5KXBA 2NLRA 1LU1A 2O8OA 2RMU1 1RUI3 3O0WA 4AI3A 1G6NA 2VTXJ 3EO6A 5C7GA 4I30A 5DUXA 4XFCA 2HH9A 4IV3A 2WA4A 5CVRA 4SLIA 1QNYA 4AF9A 1K42A 4DMIA 3WG3A 2Y6GA 4BCUA 1SACA 4CDWB 3D5OA 1CJDA 1HKDA 2YV8A 4NHKA 1VBD1 2RJ2A 3PUAA 4FSJA 2Z5WA 1WCQA 3DUIA 2JDKA 4ZS2A 2BUKA 2JE9A 2JIJA 5C8WA 5A7SA 2DCKA 5EPAA 5AC91 2UWAA 2WYFA 5C8CB 2R073 2K46A 4CP9A 3I49A 1TME3 1CAWA 3VBFA 1MZFA 4C0BA 3E97A 4JV4A 5DPNA 1N3OA 2RS13 3TEYA 1RUJ2 5CKMA 4D94A 1IOAA 1EAH2 3J7HA 3LEKA 2OXBA 3NNGA 4JTOA 5FPBA 1JYVA 2FD8A 5GLZA 3D6EA 1PIV1 5DMYA 2E63A 1OLME 1XYOA 2K2SA 4Q5OA 5J7MA 1PNFA 1WLDA 3TOJA 2D6PA 4XF3A 5T5LA 3NKTA 1FX5A 1HRV2 1RXGA 3ZVXA 3AK0A 1WZXA 3JQWA 3QBQA 4INDA 4XFIA 5IJRA 4YFWA 5AFBA 1AR61 1BKZA 3ZXEA 1G9CA 3D82A 4BMBA 1TVGA 3VZJA 4LMFA 1CIWA 3RRDA 1EUUA 2D6KA 1HV1A 2YBSA 1G9FA 3ALQA 5ABJC 1GWMA 2GH2A 3H3LA 5DZGA 3K4ZA 4ET7A 5FYSA 1QH7A 2W0XA 1W6PB 4IE5A 5D8AB 1UY4A 4NWVA 5EV7A 4Z92B 3PUQA 3WHUA 3MIBA 2RDSA 5FKCA 3VZNA 3Q8BA 5C9AC 4S2GA 2PA7A 2WNOA 4IEZA 4D3WA 2J1AA 4RL7A 4LLOA 1STMA 2FDHA 3ZOIA 1HXS2 4LA2A 1D4M3 2XOMA 4XBQA 5ACA1 2XKOA 4HKOA 1UKRA 5F5AA 1K5MA 1YI7A 3KT4A 4NWWA 1ENRA 3ME2A 3ZXLA 1PGL2 5JVVA 1GZWA 5I8SA 1O8PA 1W90A 2CSGA 2OQ7A 2BTVC 3A23A 3GZTB 3KVBA 1UKGA 5M0TA 3JCIA 2VMIA 4EN7B 5FY0A 1H6YA 3AKPA 3QH6A 5LEJA 2FDFA 2OZ6A 4HVOA 1VBE3 2ZGRA 3KB5A 3AB0A 3WDVA 3LOBA 4QHOA 2VH9A 5FYZA 4I2OA 5JPNB 1UY1A 1WMEA 2VOKA 2YMZA 3DYOA 1XC6A 4JDOA 4CVUA 5F8PA 2JDHA 3MIHA 3HEIA 1X50A 5D1IA 4CU8A 3OGRA 1SLTA 2VUAA 5FMOS 1JZ6A 4IUGA 1ENQA 3MDPA 1VMHA 4GB32 2WBKA 1W8TA 4GWIA 3B94A 3GHMA 2VGDA 3AZXA 3HR9A 4R4ZA 1YUDA 1QJY3 5JZGB 3VB9A 4Q4V3 3LGRA 2ZBJA 3FX3A 2WS91 4RD7A 3I7DA 4QGMA 4DPNA 3SMHA 3AP5A 1YQCA 4FXGB 1PO21 4AOCA 2A1XA 1YRZA 1G9DA 1W8ZA 1DGRN 4OCTA 1RUC3 2BVVA 2R1BA 3RGBA 1W8UA 4FPYA 4IV3C 4PBPA 5FXVA 4S2HA 3HT2A 4UFLA 2QUOA 1QJX2 5F2SA 1X8MA 2Z69A 1Z7S2 2AGSA 4KBBA 1AXKA 3NRUA 4CEYB 1SCRA 5FK7A 5BNNB 4O61A 1PO12 4LA3A 1CX4A 1XNCA 3R4UA 1RB8G 4A2UA 1VPHA 2O14A 2F4LA 3IDBB 5FAXA 2WFF3 1BK0A 1D0GA 3ZYPA 1IZ3A 2R042 1L7QA 2QNKA 2VCCA 1RL3A 4FVVA 1X36A 5F3CA 1VBC3 2D6OX 1QHDA 1UMZA 4XCAA 4NHLA 4Q4W1 2JDPA 3GGLA 1J84A 3S57A 3U07A 1ULPA 2XJTA 3KCYA 2AH2A 4EWEA 5FOJB 1YFWA 1FOD2 4QKNA 1AX1A 3BYWA 3BODA 4YW6A 1ZZ8A 4XMAA 4BIOA 2PHRA 4K6BA 1CX1A 2HWB1 3HNMA 3BB6A 3MPPG 4H14A 2ARAA 2QQOA 4IW3A 4AQ2A 2V72A 2W1QA 4WM7A 1EV12 3MYXA 2VULA 5DDJ1 2JDUA 2XQXA 2E9QA 4AVCA 4M4PA 2HYXA 4JHTA 4QD2A 2QTWB 4Y1UA 1H2MA 1IQDC 1WLTA 2YU2A 2XVGA 4Q26A 5T3NA 3S5AA 3ZFGB 1RHI3 4BK5A 3V0BB 5IAVA 1S0IA 4OYUA 4Q29A 2ET7A 4RQPB 4XUTA 5CG9A 4NIHA 3IDAA 3K4AA 5F3IA 1DQ1A 1DZTA 2Y34A 5F1RA 5FYUA 5C3PA 3WDWA 3ILNA 1UN1A 4IV1C 4A41A 4WVWA 2XLAA 2EIBA 3AKQA 2QBXA 3I3MA 2XLFA 3POEA 5KHGA 2C1FA 1C4RA 1LOCA 4LKFA 4WVMA 4AEDB 5C3OA 5AVPA 2RJLA 1ZRIA 2Z2SB 1REFA 1GQGA 2E7AA 3ABZA 1LESA 1YXWA 3IDCB 4HPKA 4P02B 3B9IA 3FUQA 5BXXA 4GA9A 1R1A2 3SCFA 2PLV1 4XBNA 4BXFA 4EN0A 3B69A 4TN7A 2VO5A 5LY2A 3ZSKA 3H0OA 1FT9A 4MGQA 1EUTA 4BYYA 3AMMA 5T52A 3WP6A 1HRI2 4C1XA 2OQ6A 4YVSB 1H6XA 3VD7A 4N53C 4YGCA 2WT0A 4MXWA 3PMSA 5IYYA 2JG8A 1OF4A 2B5HA 4CCMA 2SBAA 1ZVFA 2PAKA 1IG0A 2IXCA 3OG2A 5L7OB 1H0BA 1AL23 1NA1C 1SBEA 2GC2A
chains in the Genus database with same CATH topology
3TYJA 5I0SA 3HBZA 3VZKA 3HT1A 4AHZA 1C8M1 4OULA 4E4DX 1Q8VA 3ILFA 3ZDSA 2D3PA 5FPXA 1LOBA 3VDDB 3M4FA 4QPIA 2WJSA 2CNAA 2DTWA 5FO7B 4BA6A 3L2HA 1ALYA 1HLCA 1MQTB 1Q8QA 4Q2FA 3URFA 1XRUA 1AR81 2VQAA 1PZ7A 1RINA 2G9FA 1EY2A 4XE9A 1OPMA 1POV1 4JC1A 3QOPA 4KQ7A 1RITA 3OGGA 2XBO1 3JB8A 3IPVA 2D44A 2ZGOA 4AFCA 5AC92 2CGNA 1AR73 4QHBA 4QQPA 3VBOA 3INAA 3LCPA 2Q4SA 1O4ZA 1H2KA 2ETEA 3POYA 2W39A 1KD7A 4AI1A 3CL1A 3PVEA 1U5YA 1MS9A 3MLLA 3JD73 5CFDA 1W39A 3HIFA 2WQZC 5FTTC 1QOOA 5J48A 2DCYA 2X8KA 2CTVA 2DVAA 2HWD1 3SLIA 2D40A 2RS51 1LHWA 3SH3A 2QVSB 4WM7C 5IK7A 1DQ2A 1LODA 1AR62 1BEV3 2GNTA 1SQ4A 1MS1A 2ZTNA 4U36A 1PHMA 3WP3A 4AI8A 2HJIA 1KQRA 5KXDA 3WDXA 3AXEA 3NV2A 3R4DB 3JBG1 4N9IA 1H1MA 3NSTA 4HK9A 3WW1A 3WNXA 3EJKA 4TYSA 4FPCA 4CP2A 5F9TA 1FMD3 1H9PA 1ZZ6A 2PAEA 2PHXA 4XPVA 3ZYRA 4ES8A 1GNZA 2A71A 5F6LB 3V64A 1UW8A 2A6XA 1Q3EA 3VHNA 1VLNA 2DU0A 4YVWA 4AHXA 3RMYA 1X7NA 1UF2C 4AVBA 2ES3A 3ST7A 2EXKA 3ZFEB 1ZBA2 4HANA 1XXNA 2DFBA 2UYAA 1XNDA 1YFXA 4YG3A 1GANA 2WNEA 1R091 5T5JA 4B7KA 5LRRA 1CAUB 3VKNA 3RJ2X 3HMYA 4OHVA 4D7SA 2JG8C 1BVVA 4QPGA 3B3QE 1LGBA 3ZSEA 4N43B 3VBSA 3OPZA 5BNOA 2QDRA 2R16A 4FPOB 1DGRA 1VB4A 1RUNA 3VHRA 4X8NA 3V56A 2HWE2 4R8HA 1DG6A 1W6NB 1ND2B 1XE8A 4BE3A 2BFUS 1LECA 3A4UA 5FO9B 1AJOA 1B35B 4XYXA 1LTEA 4PJYA 4QPIC 2WS92 2X29A 4I3GA 2CV6A 3M3EA 4DNYA 3OTFA 2D5FA 1PO22 5IT6A 4DXZA 1RUJ3 2D6NA 3RYRA 1Q5OA 1EAH3 2JXAA 3VBHB 3CJIC 3ZPYA 1PK6A 4Q1PA 3IKWA 1AUYA 1XNKA 4GULA 3E6DA 1ZREA 2ZHNA 5JIAA 4Z8BA 1FNYA 5KXCA 4PIYA 5KHIA 3GZAA 2VU9A 4QQHA 4FPKA 4SBVA 4C90A 5LRSA 1HRV3 3IIAA 2RE9A 5GZDA 2X5IB 2OZJA 1C1LA 3PNAA 3VBOC 1J3QA 1PGW1 4RGGA 4JGZB 4B8EA 4Q4W2 1CAVB 1V6MA 2B39A 1H1IA 5CFDC 2OUHA 1QF3A 4YZ1A 3MIGA 4BLIA 4OHWA 1JW6A 2FZ1A 2ARXA 1TMF1 1RUH1 4NN0A 4W65A 2PHDA 3WDYA 4AYUA 1R082 4LO7A 4MUVA 1YNAA 5DDJ2 1HXS3 2BQPA 4MGZE 1DQ5A 2K9ZA 2A7AA 3CNAA 3ELNA 4EROA 2LM3A 1FNZA 1O7FA 1WW6A 1QXJA 3PTYA 4CDXB 1VAVA 3KCCA 4LULA 4NOTA 3GYDA 4JVAA 3T1MA 2XL7A 1LOFA 2AYHA 4IL7A 1FV3A 3RI9A 5JSPA 4K1ZA 2EVXA 1KFUL 3H1WA 3OYWA 4XQDA 3WQ0A 3FWEA 2A5ZA 4YVWC 4IETA 1GZ9A 4GB33 1HW5A 4N9HA 4I0WB 3ES4A 5FLIA 1L3JA 3A0NA 2YGLA 1DLLA 4XETA 2JE7A 1H8TA 1LULA 1CAXA 2ZMKA 4QPGC 1KJRA 3N35A 4M3CA 1N1SA 2R0FA 5JSOA 5EJ3A 3VBSC 5BNOC 1QJX3 1B09A 2SLIA 1NXD1 1Z7S3 2DCZA 4XJAA 1ND3B 4AEJA 1PO13 1C8M2 5KHHA 3MEPA 1QMJA 2CAVA 1GR3A 4FTSA 5C9AB 3W58A 4IEYA 2JG9B 2R043 3PLQA 4EWDA 3TAYA 1Y3TA 1BQPA 2PHFA 1TQ5A 2R6QA 1S0EA 1LHOA 2XHKA 1HQWA 2B45X 3QH7A 5CBLA 1PK6C 4NO4A 1AR82 1FOD3 5JLVA 2Q1MA 4LO4B 5K8SA 4KGQA 3AP6A 1WMDA 4E2GA 2RS31 3BOWA 1E57A 3JU9A 2WNVA 1C28A 2XBO2 1EV13 1NCQA 2KA3A 5EWSA 2ZMNA 1JYIA 1TNFA 1OMIA 4XFHA 1OKQA 5DXDA 1S55A 4COUA 1MEC1 2WZR2 1NZCA 4QXKA 1DGWX 2R49A 5J09A 1CGPA 3ILRA 3NVCA 4GMP1 1HIXA 1N1TA 3L9JT 3ACLA 3ZXKA 3V0AB 1AR91 2A3XA 2EXIA 3AYDA 4XF1A 2MEV2 2VVEA 5TSWA 1XQNA 2R061 4FXKB 2HWD2 2VY0A 1H4HA 3R0RA 3SH5A 5FLJA 3UK9A 2ENRA 3RSJA 4OI0A 4NVPA 3WW4A 1R1A3 5HI0A 4W6XA 5BNPB 1VAMA 1O3TA 5KHJA 1RUF1 1EP0A 2ZGSA 3Q9OA 4FAHA 3VZLA 3JBG2 3FFQA 3MLJA 4YGEA 4OHYA 1GBGA 3MICA 1CONA 1HRI3 2O0OA 1UAIA 2ZGLA 4RS5B 1LOFC 5I8YA 5BYNA 3VBFB 4IEUA 4Y20A 1IS4A 4AGRA 1O91A 5A33A 2ET1A 2AZ5A 4NPRA 2XL9A 4AVVA 3HAGA 4RA0A 1HV0A 3LB9A 3TBDA 3MF9A 3HN1A 4YLZA 4QQLA 4PDWA 4DINB 2GALA 1H8TC 1W6QA 2UY9A 2VECA 1NE4A 4ONUA 1R092 4YYOA 5DUWA 4YARA 4GH4A 3NKGA 1ULCA 1C1FA 2V09A 1KS4A 3G6JB 3NV4A 3DN7A 1PGSA 1U5ZA 4L97A 3JQXA 1J59A 1HDKA 1RVF1 4YW1A 4F7ZA 3OD4A 1YLLA 4B4QA 4WM8A 1V9U1 1QOSA 1N1VA 4OLLA 1EPZA 4W6YA 4E4ZA 3DPRA 3RNSA 2BPA2 5JSRA 4PLNA 2ZKLA 4EJRA 4OI2A 1K5MB 3PJQA 4Y26A 2ZX3A 2P34A 3GALA 4DOUA 2VOXA 3V65A 5GALA 4IEPA 5FBZA 3ZSMA 2WNVC 2HYKA 5JOXA 3EXUA 1NCQC 4MVTA 5JI7A 3E5UA 5H9RA 1UX6A 4LLFA 4IEOA 1CN1A 1AR63 2IFWA 2NP0A 2CAUA 5CFCA 4XFAA 1W2UA 3ZXFA 2OPKA 1PGW2 4N7UA 4YZ5A 5FMOL 1ZNPA 3BCWA 4D69A 4KGGA 2GN7A 2LUWA 5GZFA 1D2QA 3TN91 1MS3A 4KU7A 2DVGA 1TMF2 4XF4A 1RUH2 4M3CF 1LOEA 1RUI1 2FQPA 2XVKA 4HVQA 4Y1XA 1UU4A 2D5HA 3WDTA 5CIRA 5KHKA 2NQYA 1LEMA 2VW0A 1ZBA3 5IK5A 5AFEA 1A78A 2AR6A 3FHIB 4M3CE 1QDCA 2P3JA 1AYM1 4IV1A 2XJQA 4QMAA 1QNWA 3AXDA 4CTEA 3SCHA 2WNUB 1UZZA 2A75A 3FFZA 2D43A 4LT5A 2VVFA 3RWNA 3N7JA 1IPKA 1SLAA 3ZIWA 3IDEA 2RJKA 4JDMA 3U10A 2GMPA 4AEMA 2D3RA 4YSFA 4GKYA 1UZYA 4H7LA 4I0BA 4MXVA 3DGTA 2HWE3 3OJBA 4YZ4A 3H3ZA 1ENXA 1UU6A 3NAPC 4PDWC 2YUEA 1V6OA 4BMEA 2F6BA 4WM7B 1MZ6A 1G86A 2WS93 1O3SA 4N53A 4RHV1 4WVZA 3ATGA 1PO23 2JICA 4GH4C 3IN9A 4OI1A 1NA1A 2ZA9A 1CPNA 4BWOA 1S0BA 1H30A 2WT2A 3FLRA 3OBTA 2YXSA 1LB2A 2C0ZA 1VBB1 1SMVA 5IK8A 2XWJB 3GBFA 2DCJA 4WM8C 1TEIA 2GSYA 4MZUA 4GWMA 4LHKA 3M3OA 2BW8A 5C8CA 3LAGA 2ZGKA 4AFMA 3DPRC 2DTYA 1PMIA 5T5OA 1BZWA 3UL2A 2XJPA 3BIWE 5CNAA 4Q4W3 4YM0A 4QU2A 1T6GC 2ZX1A 2V5YA 2ZGNA 1GQHA 3WLUA 1QDOA 2DUOA 1LHNA 3J8F1 1V6NA 3B93A 2HWF1 1R083 1VBE1 5FLHA 4BZ4A 5DDJ3 1YHFA 1RUG1 2DF7A 1KFXL 2RM21 3AP4A 2WT1A 2ZHKA 3B5LB 5CFCC 1KDKA 1YO8A 4I02A 5JR7B 1DQ0A 1COV1 3MW2A 1QJY1 2JDZA 3H8UA 3WUDA 1SFNA 2B8MA 2FHRA 4QPIB 1W6PA 2VXRA 4DY5A 1JOJA 2QZ2A 4P9XA 5CADA 2R062 4FOWA 2ZS6B 4M00A 5F5QA 1Y7BA 2WWSA 1WW4A 1JHNA 5BV6A 2TEPA 3O0VA 1I5ZA 1DDLA 4LHNA 4MH0E 1DYPA 4YGBA 5J36A 1DGWA 3DV8A 1RUF2 3MF6A 3UJQA 3IPVB 2HWC1 2WFPA 3FBMA 5A32B 4XTPA 1GZCA 4IXLA 3CJXA 1OQ1A 2WFF1 4H3WA 3POWA 4KWJA 1ENSA 2YROA 4XZPA 4BOWA 2GMEA 4Z1VA 1S0JA 3AKSA 3UKNA 1REEA 4CP1A 3CO2A 1JN2P 2R1DA 4N90A 2CGPA 3KM5A 3RS6A 1W0OA 2W68A 5L73A 1C8M3 2FMYA 3PVNA 5KC5A 4FAGA 2ZGUA 2BGCA 2RR11 1S0DA 3N7LA 1BBT1 1U12A 2OVUA 4OHXA 4IERA 2VOWA 2RHPA 4Q0PA 4AK3A 2GZWA 3OF1A 4LBLA 2W52A 4GWNA 1ZZ9A 1UL9A 3I59B 1F5FA 3LSDA 1AR83 2OW4A 4GQ7A 4AW7A 3M70A 4WBBA 2BEOA 2E6VA 1I3HA 5C4WB 2WSVA 1PVXA 4M0HA 1VB2A 4CEYA 5B2GB 4MYEA 2WZPP 4E2QA 3ZXGA 3ES1A 4AGVA 5C8CC 1AXYA 2WZR3 5K7PA 2RMU2 1O5LA 2CYFA 3AYCA 1S0FA 3CJIA 1N3QA 2WQ4A 4C91A 4CDUB 4I01A 4FCAA 3KT7A 2H0VA 1OD5A 4FQZA 3POSA 5GM0A 4WVVA 3NL1A 3ZN5A 5FQ0A 2G4IA 3AMNA 1VBD2 2MEV3 1OFNA 1UD1A 3KQRA 2HWD3 3OCPA 3QCWA 1XYPA 3R05A 1H8VA 2B9UA 3ENRA 1AZDA 3THTA 4QPGB 4RR3B 3USUA 1D2SA 4ES9A 2Q5TA 3ZFFA 1DIWA 5BNOB 1AL21 3D4KA 2YHJA 1NG0A 4QM9A 5JMCA 3T2TA 2UY8A 1DQ4A 3D0SA 1O3RA 4JGYB 3AKRA 3JBG3 1JUIA 2IFRA 3V0BA 4K1YA 1OQDA 1PIV2 4RQPA 1NCRB 3SNMA 4HN0A 5I91A 2BFUL 2PELA 3IT8A 4E27A 3KLSA 3AJYA 3TN92 2NN8A 2P3IA 3VBRB 1OLRA 1PK6B 2H6BA 3D8CA 1XU1A 4KL1A 4K21A 4BPZA 5GLWA 2GAUA 3PJYA 3FLTA 4XJWA 3H1MA 4ZKTB 1BVP1 1V6IA 2XJVA 2BNNA 4B29A 4XOGA 1FPN3 4UW5A 2ZMLA 1AYM2 4JQRA 4Q1RA 2ZHMA 1AR71 1C8NA 1R093 2YZ4A 4GXLA 2QQPA 4YZ3A 1WD3A 2HKXA 2DVBA 2BNMA 5GZEA 4K7JA 2A70A 1J58A 4XTMA 5F6KA 1RUD3 4EN6B 5L7OA 3MLKA 3MFCA 4META 2PHWA 4A7YA 4HL0A 5ACA2 2XUMA 4EWAA 3USSA 3LOIA 1ZBE1 2Z42A 5FCCA 4KH9A 2ILMA 3AYEA 5EXOA 4EN9B 5JZGC 3NJZA 5I93A 1ZRRA 2PHUA 3ZYGA 3UJOA 2K0GA 2Z79A 4XHXA 3M3CA 3K51A 1PVC1 2Q8OA 4RHV2 1W6OA 4CYDA 2A3YA 4AXOA 3KD4A 3JB4C 4FQ4A 2DUPA 4CDQA 4UW3A 1J1TA 3ZN6B 1MR5A 3EBRA 4MGIE 2GMMA 1C5IA 4AI0A 5CB7A 1FMD1 4CEYC 3DKWA 1GNHA 1VBB2 1V6LA 1WCKA 2C5DA 3WW3A 3W59A 1QJU1 1IKQA 2ZX4A 1G9BA 3B00A 2CWSA 2CWMA 3CF6E 3IWZA 1ULDA 1U5XA 4COWA 4ASMB 4YNIA 1F8VA 4XQWA 1CESA 2VQ0A 3TNQA 3GNEA 3RYPA 4MV2A 4BQ1A 4Q27A 1Y43B 5E8AA 3S7IA 1YFUA 4KWKA 4LTAA 4HSJA 1TMF3 3RMXA 1RUH3 1CAXB 2XPJA 3CU7A 2LTNA 2VOVA 3I2DA 3ZSLA 1BK1A 3M3QA 4XJ9A 3J8F2 1SBDA 4CEWB 4BHPA 2HWF2 3ZFFC 1QXRA 2EAKA 2MPFA 4XXPA 1RUG2 4TSVA 2RM22 5JIUA 1LENA 4OFGA 2A73B 4JTNA 4QQ2A 2I2SA 1COV2 3ZMNA 2GH8A 5BY5A 2XVLA 4IQPA 4RQPC 1A8DA 1Q43A 2PYTA 1LRHA 5CA6A 3FE5A 3KCXA 2HWB2 3LSEA 5T5PA 4HSLA 2OUJA 2WIIB 4E2SA 5FOBB 4U2AA 5SV8A 4FT8A 4P9YA 2EXJA 1EAH1 4AEDC 4AE2A 1H2NA 4ZU7A 3SCGA 1D4VB 1SCSA 1AJKA 1AL0G 2VUJA 1SFYA 2ZZQA 4OHZA 4L92A 2WNVB 1LGCA 2E7TA 2YDEA 2D7FA<