5DUWA

Crystal structure of the human galectin-4 n-terminal carbohydrate recognition domain in complex with lactose-3'-sulfate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
PTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-4
publication title Structural characterisation of human galectin-4 N-terminal carbohydrate recognition domain in complex with glycerol, lactose, 3'-sulfo-lactose, and 2'-fucosyllactose.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5duwA00
5JMCA 2NM1A 3M3QA 1O4YA 4IQPA 2ZGLA 5GLZA 1V6LA 2CNAA 3D4KA 2UURA 3H0OA 4Y20A 4RA0A 1Q8OA 1LOFA 1LENA 4DQAA 1QNYA 1AF9A 1QDCA 2P3KA 2WQZC 5GZCA 2DYCA 2WKKA 1V6NA 2A3YA 1QF3A 2P34A 2ZMNA 4PCRA 2PHXA 4YG0A 4XJZA 3BTAA 1YXWA 1SLBA 1BYHA 1DQ5A 1IS6A 1CONA 1DYKA 1SACA 3N3HA 4C1WA 1IKQA 5DZFA 3AP6A 1W6PB 5H9SA 1AZDA 4XDQA 3M3CA 5E88A 1V00A 4BPZA 1FNYA 2V73A 3M2MA 3N7LA 1AXYA 3HN1A 2A5ZA 1C4RA 1SLCA 2EF6A 2A6ZA 5JOXA 1WW7A 1I3HA 2ZGSA 4XBNA 2PHTA 1UAIA 3T2TA 5T5LA 2JD4A 1JYIA 3APBA 2ZHMA 5DUUA 1MS5A 1CPMA 1VALA 3ATGA 4P9YA 4XJ9A 5EYYA 4DFSA 3VKOA 2C5DA 2DWRA 2NMNA 1WD3A 5JLVA 1W6QB 5L73A 1S0CA 1CQ9A 2WJSA 4R9CA 1SLLA 4NOTA 3WOGA 4R9AA 1N1YA 1DLLA 4LBNA 2C9AA 1DQ6A 2E51A 1HDKA 2ZMLA 5IK4A 1AX0A 4XIKA 1G8WA 1QDOA 4Y1XA 3ZXLA 1QOOA 3WV6A 5EYXA 4YZ4A 3IMNA 3WHUA 2XG3A 1AX2A 3OGGA 2UWBA 1CJPA 3FUOA 3GALA 3N36A 3FUQA 1WUVA 5HCFA 1C1LA 1XQNA 4K1YA 5IUQA 1QNWA 4YW4A 1A3KA 1JW6A 2RHPA 4Y24A 1UZZA 4WZFA 2DVFA 1PZ7A 3ZXFA 3TB0A 1V6KA 1ULEA 2NZ9A 1IOAA 4K21A 4F83A 4ASMB 2D43A 5DZEA 5CAZA 1C57A 2NP0A 2ZGTA 1KITA 3FLTA 2ZGMA 4Y20B 1LTEA 1IS3A 2D7FA 1ULDA 1PZ9A 2CTVA 1N3QA 1LHNA 1LOEA 3RMXA 4AVVA 4HL0A 1RITA 4ZXKA 5JDBA 2ZBJA 2YZ4A 4GXLA 1PZ8A 2G4IA 3V65A 1DQ0A 2GN7A 1JN2P 2Q5TA 3ZSMA 3ZSKA 4YZ1A 1UPSA 4YZ3A 2A75A 3AFKA 4XJAA 1MS0A 1BQPA 3UK9A 1LGCA 2CL2A 2A3XA 4RL7A 1WLWA 5DG1A 4XILA 4YM0A 1N1VA 3ZSJA 1LGNA 1S0GA 4XMAA 3WHTA 1JHNA 3AZWA 2EXKA 3JU9A 2B7YA 2WSUA 3N7KA 1W6QA 3IPVA 5GLVA 2HYKA 4YW3A 1YIFA 1ONAA 2A7AA 2DTYA 2LTNA 1AXKA 2DUPA 4XHXA 1SCRA 2DUOA 4Q1RA 1D0HA 1H9PA 1WLDA 1LOGA 1R1ZA 2YV8A 4YGBA 1BKZA 2UU8A 2YMZA 3AX4A 3M1HA 5T5JA 3UL2A 1Q56A 1V6JA 5T5PA 4H55A 1KDKA 3UJOA 4YM3A 2VXRA 1ENRA 5JOYA 3SNMA 1UN1A 3HMYA 5KXEA 1IS5A 4FVVA 1Q8SA 2ZGUA 3NV3A 1CESA 1G9FA 4Q27A 4U2AA 3USUA 1ENQA 1QOSA 1AJKA 5FRAA 2D6OX 2JE7A 3Q9OA 3U4XA 1MVQA 2YXSA 2OUHA 5CNAA 1BZWA 1Q8QA 1UZYA 1N1TA 2JJ6A 4YW2A 5IK5A 4Y1VA 1G7YA 3OBTA 2CWSA 1MZ5A 2E53A 4BM8A 1KJRA 2W68A 5BYNA 3A0KA 2D44A 1W6OA 2GNMA 3AK0A 1B09A 4YLZA 4ATFA 3M3EA 1D2SA 4D69A 3FLRA 5GLTA 2ZGNA 5GZGA 2R0HA 1MS4A 4CTEA 2EXJA 4JC1A 2D6NA 1A78A 2A6YA 2ZHKA 2ERFA 1Y7BA 1LODA 3RMYA 4LBQB 1QGLA 3AYCA 2A6VA 4WVVA 5EXOA 1UX6A 4YZ5A 2A70A 2R1DA 2W08A 1GZCA 1G86A 3AYDA 3AZZA 4TZDA 5HCAA 1N3PA 3FFZA 2ZGRA 1GSLA 2ZGPA 3HR9A 3VV1A 1GICA 2D6PA 2BQPA 4UW6A 4FPGA 4Y1ZA 1DQ1A 1JXNA 1KJLA 1LHWA 2AUYA 2OW4A 3AYAA 1CIWA 3B9CA 3V0AA 4FOWA 2D3SA 1ULFA 4BLIA 4XYXA 1WBFA 1SBDA 3A0NA 3WG2A 5H9RA 1BJQA 3ZYPA 5JOWA 2GMEA 3IPVB 5T50A 2GALA 1LOAA 2VH9A 1G9AA 5GLUA 4FP2A 1S0IA 4U36A 5DZGA 1VAVA 3NV4A 1F5FA 1CVNA 4LBMA 5GM0A 5GALA 3INAA 4ISRA 4FPYA 1ZM1A 2OUJA 3FBYA 3B00A 1DQ2A 1GNZA 3NV2A 3O0XA 1V6IA 3R4UA 3D5OA 3PJQA 1LHOA 5F5QA 1AXZA 4UW4A 3SH5A 1FV3A 3WDUA 4BQ1A 4XXPA 2DUQA 1LGBA 4CZSA 3I4IA 5E89A 2XB6C 4R9BA 3AP7A 3O12A 3O0VA 3USUB 1LEDA 3ASIA 4K20A 4M3CF 1G9BA 1S0FA 1YYNA 3AYEA 2ZAAA 1W0PA 4GALA 4Y1YA 4BOWA 3AZXA 1VIWB 5DUXA 2DVAA 4XJUA 4YGEA 1SBEA 5DUWA 3MPPG 4AYUA 1ULGA 1MS9A 3B69A 4JCKA 3BODA 3N7MA 4Z8BA 2DVBA 4YFWA 1YI7A 4LBLA 4AGVA 4ATEA 3ILRA 2DVGA 2WLQA 3I8TA 3ENRA 4P14A 3FLPA 2VW0A 1W6OB 3AXEA 4C1XA 1KRIA 1QOTA 4LBQA 2ZHLA 4Y26A 4YM2A 4FPCA 1IKPA 4Y22B 2ZGQA 1FNZA 2VW1A 3V0BB 4P9XA 1MS1A 4YG6A 1LJ7A 2JKBA 1VAMA 2D3RA 4YW5A 5GJ6A 3SISA 1MACA 1G9DA 2CYFA 4PF5A 2GNTA 3B3QE 1KDMA 5DUVA 3O0WA 4YM1A 5AVAA 3OJBA 3PVEA 4Q26A 4XTMA 1JYCA 1SCSA 1DZQA 2DU1A 5T52A 3ILFA 3W58A 2D6KA 2GMMA 2WT2A 3WG1A 2PHRA 1JUIA 2ZGOA 3VKNA 1GBGA 1LESA 2JECA 4OZXA 1QKQA 4XJWA 4AGGA 3AP9A 4GKYA 1SFYA 1S0JA 3V0AB 4FPJA 3WDXA 5GZEA 4WV8A 2PHFA 3OBRA 2GDFA 2V5YA 5KXBA 5LK5A 4LBQD 2AH2A 3NWKA 2PHUA 3RG0A 2ARBA 1N1SA 1W6NA 3AZYA 4AGRA 2VU9A 1WW4A 2GN3A 3POYA 1GV9A 1OFSA 4SLIA 1ZA4A 3OYWB 3C2UA 4FQ4A 4GWMA 4LBKA 4DS0A 4ISQA 3SH4A 1GLHA 1LHUA 1YRZA 3R4SA 2TEPA 4DPNA 1Q8VA 2SBAA 1SBFA 5EWSA 4FPFA 4I30A 3VKMA 3SLIA 2DTWA 2WSVA 2UWCA 2JDZA 1F31A 1H30A 4FQZA 2E7TA 4CRQA 2DU0A 2EAKA 3BIWE 1DQ4A 1MZ6A 3ZXJA 5F9TA 4ITCA 3KM5A 4BMBA 2E6VA 4M01A 1WW6A 3WUCA 1J1TA 1LECA 5JOZA 3LSDA 1MVEA 1FAYA 2SLIA 4XOGA 3AZVA 3ZVXA 1FX5A 1OQ1A 2ZACA 1DIWA 2CY6A 1WW5A 3PVNA 5T55A 3MW3A 5FREA 4AWDA 2ZMKA 2EALA 1LOFC 1HLCA 4BMEA 2OVUA 4Y22A 1W6MA 2ZKNA 3V0BA 3WUDA 5H9PA 1RINA 2LALA 4R9DA 1LULA 2PELA 4M00A 2DURA 3WDTA 4AVSA 2EIGA 4Q8LA 3VUOA 1H9WA 3ILNA 2ZGKA 4KBBA 4FPLA 1G9CA 1S0EA 4DRVA 4FPEA 4YZ2A 4FPHA 3M3OA 5GZFA 2EXIA 3KQRA 4NO4A 1FATA 1Z78A 2CWMA 4GKXA 1MS3A 2AGSA 2YY1A 1AX1A 1HKDA 4M3CA 3RRDA 5GZDA 4LBJA 3V64A 1IS4A 1ENSA 5IK7A 4GA9A 5HCBA 2ARXA 1AVBA 3WDVA 2UWAA 3OYWA 4W65A 4L8QA 1ULCA 1CPNA 1WBLA 1HQLA 3IN9A 2WNEA 3POSA 3PVOA 3AP4A 1W6NB 1UKGA 1U0AA 1KQRA 5KXCA 5IT6A 2AREA 3MW4A 3ZSLA 3MW2A 2GNBA 1BXHA 1RIRA 2AYHA 1Z0HA 4YGCA 3RQ0A 1LOCA 4PBOA 1JBCA 4LBOA 1HQWA 3WVJA 1WD4A 3IKWA 3WCRA 1MR5A 5DG2A 3AJYA 2W52A 3NV1A 2R1BA 1GZWB 3D6EA 3R05A 3UJQA 1GANA 5SV8A 3W59A 4MYEA 4P9WA 2A71A 3A4UA 1LU2A 3N35A 2P3IA 1S0BA 4TYSA 1DFQA 4Q1PA 4AVTA 2ES3A 1GYKA 5CBLA 3RS6A 3T1MA 1Q8PA 4YG3A 1A8DA 3AXDA 3OY8B 3WDWA 3PMEA 5KXDA 2NMOA 4UW3A 1NLSA 1GNHA 1V6MA 1W6MB 1UMZA 1X50A 4FOYA 4FPOB 1WLCA 1URXA 5CB7A 4FOQA 3LCPA 4XZPA 1W0OA 2KM2A 2I2SA 4Y1UA 1GZ9A 2Z42A 3CNAA 2PHWA 1APNA 1QMJA 2H0BA 3SH3A 2ZZJA 2VUAA 1EPWA 2ENRA 3VKLA 4YGDA 5H9QA 2AENA 5GLWA 4YFZA 5T54A 2VW2A 1QU0A 1O4ZA 1S0DA 3WZ1A 1FYUA 1W6PA 1LOBA 3TAYA 5DXDA 5T5OA 3WNXA 3O5SA 4Q2FA 4XTPA 2ZA9A 2WT1A 1DYPA 3WG4A 2JE9A 4XIOA 1LU1A 2NN8A 4DRRA 2DVDA 3QCWA 4FOVA 4XJ8A 1SLAA 3ZXKA 4PBPA 4XXAA 1SLIA 2GNDA 2ZHNA 3L2YA 4HANA 1LCLA 2D3PA 4M3CE 2P37A 1N3OA 4M3CB 4XBLA 4XE9A 3ZPYA 4Q8KA 1SLTA 4K1ZA 4PQ9A 2A3WA 1CR7A 3AJZA 3DUIA 1C1FA 4BLJA 3OPZA 1MS8A 5IK8A 3QLQA 2AR6A 2D6MA 1AJOA 2ZABA 3WG3A 2EXHA 1DHKB 2WT0A 1CN1A 1UL9A 2VY0A 2YROA 3ZXEA 2P3JA 1YO8A 4ZKTB 2P2KA 2DV9A 4JRAA 3WDYA 1VLNA 3VKFC 1OKQA 1LEMA 1GZWA 1S1AA 1F9KA 4UW5A 2W39A 2A6WA 1GKBA 2FMDA 2E7QA 4YW1A 1JOJA 1I1EA 3ZYRA 3B01A 3BOPA 2A6XA 4XBQA 4XMIA 3SITA 1DGLA 5CA6A 2R49A 3N7JA 5JVVA 3T1LA 3GNEA 3IM0A 4FPKA 3POWA 1NXD1 2R16A 3DGTA 3JUUA 3WCSA 3OY8A 3RSJA 1N47A 2R0FA 1FV2A 2NYYA 1TEIA 1WCSA 1V6OA 1LHVA 3WLUA 3AP5A 3LSEA 4FP3A 2GMPA 1DBNA 3MEPA 4GWNA 5E8AA 2D6LX 2FHRA 4XHBA 4WVWA
chains in the Genus database with same CATH superfamily
5FZ7A 2NM1A 5ACA1 1O4YA 4IQPA 3ZR6A 2BNOA 5GLZA 2HWE3 1PHMA 2CNAA 3D4KA 4HT1T 4UF0B 3JCIA 4KWUA 1LENA 3OGVA 1AF9A 2WZR2 3WQ1A 4QWNA 4QGLA 3PU8A 4FCAA 5FYZA 4HSLA 4LPLA 5FP9A 3JQWA 2QNKA 1TVGA 2WINB 4YG0A 3H1YA 4CDXA 5ACA2 2QZ2A 3FHAA 4XJZA 4AK3A 2X5IC 3UV9A 3ZN6B 4OUSA 1IKQA 3E1F1 3T3YA 3ACIA 3I2IA 3N9LA 5FY9A 5H9SA 5HXMA 1OC1A 4HONA 2Y8KA 4XDQA 4IEUA 4O9GA 3ROUA 4BPZA 5LA0A 5FMOL 3ZYGA 4DMIA 3M2MA 3N7LA 1AXYA 4CVUA 1MEC1 3CF6E 1SLCA 2MEV3 2A6ZA 4RQPA 1WW7A 3A7QA 4NAMA 4XBNA 3NL1A 2LW8A 3BYWA 2OS2A 1Y3TA 2JD4A 4LO6B 2J1AA 3APBA 5EQUA 5A7OA 3WP4A 1VMFA 1JYIA 1RUNA 2Z4FA 1CPMA 3ATGA 4UBHA 4W6XA 4RFT0 1HB3A 4XJ9A 5EYYA 4LEJA 2VOXA 3VKOA 2DWRA 2TBVA 1ASJ1 4AVAA 2NMNA 3F95A 2HWD3 5L73A 3UESA 5JSRA 2ZCWA 3S30A 2QQWA 4NIDA 2JIJA 4RD7A 4NOTA 3I2HA 5FMBA 3VBHB 1N1YA 1YQ2A 4COYA 5FY0A 1HDKA 4TXWA 3QH7A 1AX0A 4N53B 1L7QA 2WZEA 1G8WA 4PJYA 4Y1XA 2B8MA 1ASJ2 2RM21 2MNGA 2V4AA 2XBO2 3WV6A 3BGAA 5EYXA 4AI8A 5A3TA 2PQSA 1BEV1 3MDPA 4UT5A 3TEXA 2BOIA 5ABJA 1QQP1 1OXCA 1C1LA 1XQNA 4D8MA 4H3WA 5IUQA 1QNWA 2JDHA 5C8CB 4C0HA 3W9AA 4IEOA 4AEDC 5LBFA 2RM22 3OB8A 4Q4Y3 4XCAA 1O8PA 1JYVA 1WLTA 5FZLA 2NZ9A 4DXZA 3WNNA 4D6SA 2C4XA 4ASMB 3GBGA 1QQP2 4IV3C 2NP0A 2RS11 4TLFA 2XJTA 1UYZA 1LTEA 3EMRA 4IE4A 2ATFA 4OI2A 1N3QA 3CZJA 3WINE 1LOEA 4HL0A 4Q4V3 5G05L 5L9RA 2YZ4A 2YGMA 1MZEA 2V72A 4E9KA 3BPZA 4LT5A 1GQPA 2Q5TA 3WQ7A 3ZSMA 4C8DA 3UKNA 4YZ1A 3HD8B 1TNRA 2LM3A 3CIHA 1Y43B 1QJZA 4XDPA 5FYHA 4E2SA 3SQOA 2O8OA 1DGWA 1X7NA 5CKNA 2A3XA 3HT1A 4RL7A 5CIRA 4B4QA 1D4M1 1CWPA 1D7PM 2R061 4RQPB 4AVBA 2WIIB 2X5IB 4MUVA 4TLGA 1WGPA 1LGNA 1S0GA 4XMAA 1A8MA 1PK6C 1UMIA 3JU9A 5DDJ3 4GMP3 2WSUA 3T0BA 4EYUA 2FDGA 4GH4A 4HFSA 4RYDA 2DCJA 1BK0A 4YW3A 1OBNA 1YFXA 2B9VA 2DTYA 1OH4A 2FCTA 2GAUA 2JDYA 3C7GA 1QJU1 1CAVA 3LD8A 1D4M2 4A41A 5J36A 5F8PA 1XXNA 1H9PA 2G9GA 4BE3A 4YGBA 2F6BA 1BKZA 3EXUA 3UL2A 3AX4A 5FR3A 1ZRDA 5FKCA 4LO7A 3OUHA 1ZVFA 3ACFA 1PMIA 4YM3A 2VXRA 3FHQA 5JOYA 3ZFFC 3VD4A 5IVVA 3T0AA 5KXEA 2Q1FA 1QJU2 4HVQA 1OA2A 1XNCA 1L7RA 4Q5OA 4WM7C 4BQ2A 1RUG3 2I07B 1HJFA 2W47A 5A7NA 1VBA1 2J7MA 4EN6B 1ENQA 1QOSA 3K2OA 2PN5A 3N9NA 5BNPB 4I3GA 4ARXA 5FOBB 5I91A 3E5UA 5ABJB 1QH6A 3CLPA 3M70A 2ZJCA 2OKXA 2D5HA 3OD0A 4Q0QA 1RUJ3 1REFA 2BVBA 4Y4RA 1UIKA 5FPLA 4FFFA 3RZGA 1VBA2 4Y1VA 2CGNA 3OBTA 4EJRA 1OFNA 4Q0SA 1W90A 2E53A 2RDSA 5JSOA 3KB5A 3PUSA 4GB31 5BYNA 1MQTA 2D44A 3A0KA 5FFOC 1S2KA 3WF3A 2ET1A 2XJRA 2VCAA 2VOKA 3WP5A 1RVF1 5GZGA 3IT8A 1R091 4CTEA 3KV6A 4D0QA 4L99A 3UGFA 2VUJA 2CHHA 3VD5A 2ERFA 2VPVA 5E6HA 1W06A 4NJ4A 1LODA 4GB32 4IV3B 4DUVA 3AYCA 1Y9QA 2A6VA 2RJLA 1UX6A 3RVHA 2RR11 2W08A 1RVF2 1T6GC 3AMNA 5HCAA 3FFZA 4QX0A 1OLMA 1R092 3GZUC 1PO23 2XOMA 3K4DA 2Q1ZB 2ZEYA 3KVBA 3KV9A 5C3OA 4FPGA 1CD3G 1DQ1A 4AVCA 4DXSA 4KWKA 3DEMA 3AYAA 2WO7A 2RR12 1KEXA 1ULFA 2J1TA 3HBKA 4A7KA 4BLIA 2XVKA 4DY3A 1SBDA 2XKPA 3ZYPA 1BLZA 1X8EA 2VH9A 4QHBA 4M4PA 1GFF2 1YQ5A 2JDNA 2W0XA 5BNOA 1CAVB 1S0IA 1NAEA 3BCWA 3NV4A 3QH6A 2EA7A 1WCKA 2W87A 3J7LA 2HWF3 3UT0A 1PK6B 4CUCA 2VCCA 2IFRA 3FBYA 1O8SA 1DQ2A 1NT0A 3NV2A 3R4UA 4HKLA 5DXDA 3D5OA 3FE5A 1LHOA 5ERLA 4FXGB 4Y5SA 3S7EA 1FV3A 3NNGA 4EV0A 1NX9A 3D0SA 3HQXA 1Z7S1 4FFGA 1RUC1 5IVEA 2Y26A 3ZYJB 5FLIA 1IHMA 1YYNA 2HWC3 3AYEA 2XH6A 1DU3D 2ZAAA 3MIHA 4JX0A 1NLQA 4MSVA 2YFUA 5DUXA 4Q0UA 4C1WA 5DUWA 5IYYA 4AYUA 1GOFA 2VMFA 1Z7S2 2NLRA 3B69A 3BODA 4WM7B 1RUC2 4NPRA 1EAH3 2DVBA 4YFWA 1GQHA 3P1IA 4LBLA 3ILRA 2P6CA 4EN7B 4TWTA 2RDRA 2YU1A 4MLOA 2R32A 4CP9B 5C3PA 4AEKA 3OPTA 1MQTB 1OVPA 1ZRCA 4HN0A 3L9JT 2P5BA 4URAA 1RUI3 1IQDC 1GP5A 1PVC3 4Y22B 1QHDA 1FNZA 3ZXDA 3V0BB 4H2AA 5DAPA 1LNSA 2XPJA 2H6BA 5K0UC 2XJPA 3B5LB 1YCIA 3CJXA 3KF3A 3V56A 2WZPP 1PIV1 2BJSA 4PF5A 4OUEA 5JXGA 3KT1A 4LE4A 3TNQA 3OJBA 4XQDA 2VNOA 4YVWB 1CAUA 1SCSA 4Y4YA 4W4ZA 4EWEA 2XLGA 3BB6A 4XFGA 2XDVA 2ZGOA 1FI2A 4XJWA 3CJIB 3SC7X 4CU6A 3M8LA 3OG2A 1CJDA 4B4RA 1JODA 3DKWA 5JI9A 4DINB 3AKQA 4ES9A 1OA3A 4Y33A 5KXBA 3JBG3 4LBQD 3RG0A 3M7AA 1N1SA 5KBFA 2D40A 3ZFGC 4AI3A 4LMFA 2RS31 5BNOB 3LWCA 1MPXA 4QHZA 5FJKA 1CX1A 3OYWB 4BIOA 3PUIA 3HBZA 4A6OA 3L2HA 3GJBA 4A42A 1UOBA 5IVBA 1TMF2 5EWSA 4FPFA 5CADA 5K8SA 3O1RA 2JB4A 5GKAC 1QH7A 2RS32 3NJZA 1F31A 2QFEA 4CRQA 3POBA 3NKTA 3O1SA 1MZ6A 4JHZA 4N43C 5D21A 4G4FA 5FZHA 2VMEA 3KM5A 4CXWA 4M01A 1WW6A 3WUCA 2WNOA 5JOZA 3LSDA 4FAGA 2SLIA 1FAYA 3AZVA 4PDWC 3HNMA 3WP3A 1DIWA 2YB7A 3PVNA 5I8TA 1POV3 3P6BA 4P5YA 1HB2A 1HIXA 2J1RA 4I3PA 3ETPA 4LHNA 2OVUA 3BU7A 4W8JA 3RWNA 2O0OA 1W03A 1RINA 2LALA 4R9DA 3IDCB 3VD7A 4P08A 4M00A 2DURA 3ZIXA 2GH8A 4KWLA 2WFF1 1H9WA 4OYUA 2YC4A 1VBC1 4XF3A 2VZOA 2VZ1A 5FKBA 1E57A 5FXXA 5FK8A 1AR61 2CGOA 1YHFA 1S0EA 4MXWA 4FPEA 4IE7A 4YZ2A 2EVXA 4EE2A 2BFUS 2W92A 3BUCA 2R041 1JS9A 1STMA 3GCWA 4QX1A 1HV1A 1RUE2 1PGSA 1VBC2 1Z78A 1HRI3 2CWMA 3RGBA 2WLPA 3THPA 4GKXA 1AR62 5C9AB 2AGSA 3PJYA 4R52A 2G9ZA 4X6RB 2VZUA 4UBGA 3ZMNA 4JHTA 5FZ0A 4GWJA 1FXZA 4GA9A 1AVBA 4FXKB 1VBB3 3K3NA 5A7PA 1NQDA 5KHKA 5FV3A 1ULCA 1CPNA 3LDBA 1WBLA 3LAGA 3WW1A 1KQRA 1AR93 1XOYA 1C3HA 4D94A 5KXCA 2JENA 2FD8A 1NA1B 3Q8EA 4PHZA 4FTBA 4C91A 2GNBA 1ND3C 2J1SA 4Q0PA 1S2EA 3RQ0A 3NVCA 4PBOA 1K45A 4LBOA 5KR7A 4HSJA 3JB8A 4AR2A 4HK9A 3ZFGB 1JOPA 1C8M3 2W52A 3PU3A 3D6EA 1UZ0A 4GMP0 3TEYA 5E1RA 3TRSB 5SV8A 4CDWC 2VNGA 2JDAA 2C1FA 4MYEA 4P9WA 2FMYA 4G9SB 4NHYA 1XRUA 2ES3A 3LIGA 4CXXA 3RS6A 2BBVA 4MGKE 3IIIA 3OY8B 2Y64A 4QPIC 3ZFEC 1J3PA 1Y4WA 3CKHA 3GCXA 5CKQA 5AFEA 1X36A 4URTA 4KMQA 1V6MA 2LRPA 4RHV1 4AI0A 4AQSA 1EP0A 5A32A 1W04A 1JYXA 2VBBA 5M0TA 1VAKA 1QXJA 2CV6A 3F2ZA 1W0OA 4PDWB 3CNAA 1XYNA 2Z42A 3GM8A 3PIJA 3BTXA 1O3SA 2BOJA 4IXLA 1D4VB 2CDOA 1YFWA 1PX3A 1W3XA 2Q1MA 5DN2A 3WP6A 5H9QA 4OCTA 4BQ5A 3IBMA 3J8F3 5T54A 4DB5A 3DPRA 3I2KA 3GHNA 1EUUA 1O4ZA 1YJKA 1NG0A 3TAYA 4QB1A 3WNXA 4Q2FA 4QX7A 4ZU7A 4KGQA 3NRUA 3BVCA 2NPIA 4IEXA 3H3UA 2WT1A 1DYPA 3C3VA 2VNRA 1LU1A 2NN8A 4XIOA 2Q8OA 4X8NA 2I45A 4LOSA 4XXAA 3OOXA 3UKVA 4IERA 4RS5A 4M3CE 5C7GA 2P37A 1N3OA 3ZPYA 4YSFA 4QU1A 4K1ZA 4AI9A 2A3WA 2JE8A 3AJZA 1XYPA 5IK8A 1YFYA 2Y38A 2BU9A 1OPMA 2ZABA 1AJOA 4KNCA 5LK7B 5JXJA 1CZTA 1PM7A 3C7HA 4ZKTB 1ND2B 3OGSA 3PL0A 1E5SA 3WDYA 2W1QA 4M0NA 4P00B 1OKQA 2AEYA 4K8RB 2RJ2A 1YUDA 1F9KA 4QHOA 3VBFA 3ZX7A 1GKBA 2B46X 2E7QA 2VBPA 4AVSA 4D6RA 2JG9C 4CCMA 3B01A 3BOPA 3U07A 5LRSA 4XBQA 1OHFA 3K4AA 4CCDA 4BXFA 2R49A 5LY2A 3N7JA 3T1LA 3K4ZA 5EPAA 3IM0A 4RR3C 3GF6A 3POWA 2OPWA 1RUF2 2QQIA 1ND3B 3JXSA 4HVRA 3VBRA 1IG3A 3D82A 3OBZA 2NYYA 2B9UA 2Y0OA 4MOAA 1LHVA 4W6WA 2CDPA 3W5MA 2F4PA 1M4WA 3U4SA 3WF0A 2JX9A 4E4DX 3U78A 2X09A 1W99A 2GMPA 2VTFA 1H8VA 3G6JB 2VAUA 3MEPA 3VHPA 2D6LX 1AR73 3TOJA 4JZRA 1B35C 2PFWA 5JMCA 3M3QA 2ZOEB 4Q4X3 1V6LA 2DF7A 3UETA 3K3OA 4Y20A 1LOFA 2AZ5A 3VZKA 4DQAA 4HETA 1QDCA 2VZQA 4GULA 5AFBA 5FOJB 5GZCA 4CEYA 2IXHA 3MIDA 4M0HA 5A6QA 1V6NA 4G3YC 5JI7A 2A3YA 3VBUA 5KC6A 2ZMNA 2PHXA 4LHLA 1UYPA 3LPGA 1SLBA 2VG9A 1BYHA 4UFMA 1IS6A 3DPRB 5IVFA 1VBD1 1C5HA 4QX2A 1KFXL 3N9OA 4Z2WA 2ZTNA 5FZIA 1KXGA 4LE3A 4CEWA 5K9YA 2I74A 5E88A 2B45X 5IVCA 1JOBA 4QQ2A 1WZXA 5IFTA 4HZFA 2A5ZA 2F17A 2Z2SB 1W8NA 3HAGA 5A3UA 1JI6A 5JOXA 2ZGSA 2QQLA 4RS5B 1UAIA 4MGTA 5FYTA 1QXRA 5D1IA 4QKBA 2ZHMA 3HN3A 3POFA 5FZAA 1COV3 4NN0A 1MS5A 4P9YA 1GOGA 4BISA 3O1OA 4DFSA 4F7ZA 2WO2A 4AI1A 1AL23 4COUA 2HH9A 4QPGB 1W6QB 1AR81 2UYAA 1E5HA 1S0CA 4MXVA 3GHMA 1L7LA 2XBO3 1SLLA 2RMU2 5ANNA 3ECQA 4R9AA 3WOGA 3WW3A 1DQ6A 2ZMLA 4QMAA 3S7IA 4CU9A 4P02B 1PO11 1HRV1 1QDOA 2VUCA 3PLQA 1QOOA 4HXCA 4BJ0A 1W8OA 5DAWA 2VZRA 3WHUA 4OHVA 2XG3A 1FT9A 3OGGA 1KS5A 4J1WA 5FO7B 2UWBA 5JCTA 2XLAA 3IB3A 2WNUC 1WUVA 3FUQA 3VBRB 3K46A 2HBUA 2GC3A 1JW6A 1QQP3 3HWJA 1PO12 1HRV2 1UZZA 2DCTA 3VBSC 4AW7A 2WAOA 1F4HA 1ULEA 3ES1A 2BVVA 3KHCA 1QJY3 1REEA 3ZDVA 2DCZA 4RR3B 5DZEA 5EIYB 1C57A 4NHKA 3LA2A 2XHKA 4Y20B 2D7FA 3DYPA 2BNMA 1PNGA 3NAPC 2WR9A 1J58A 3H1MA 4EZ4A 2KD7A 1LHNA 2WA4A 3RMXA 4CEYB 2JG8B 1RITA 4AXOA 1V9U1 3VBUB 1IPSA 1B35B 4GXLA 2ETEA 1PZ8A 2G4IA 1S4CA 3V65A 1DQ0A 2F4LA 2GN7A 2QZ3A 1AYN3 1XU2A 1NCQC 5KC5A 3AVRA 4D3WA 3VHOA 4CEWB 4YZ3A 1DP0A 1YQ8A 4XJAA 5C33A 1QJX2 2CL2A 2PLV3 5DG1A 1ODNA 5A3PA 5L7OC 4XFBA 4YM0A 5FZ6A 1N1VA 3ZSJA 3EO6A 3AFGA 4XW3A 3WHTA 1JHNA 2B5HA 1OUXA 3ME2A 2B7YA 2ID4A 1W9YA 2XGXA 2Z5WA 5GLVA 2HYKA 2JXAA 1AYM1 2A7AA 3DF0A 1AXKA 1O5LA 2DUPA 1OOPC 1OUSA 1LOGA 1R1ZA 4N53A 2YDEA 4Z1VA 1OI6A 2B39A 2YMZA 4ZPIA 5T5JA 4ZU4A 4JGZC 3VBOA 1V6JA 4QDQA 3D3AA 1KDKA 2WNVA 4H55A 3E97A 1WMFA 4CCJA 3SNMA 1UN1A 1AYM2 1R082 4IEWA 1IS5A 1GP4A 1NOVA 3Q8CA 4LORA 2D5FA 3AL6A 4UFLA 3TN91 1ZYBA 3MLKA 2HJIA 2C0ZA 4BQYA 1AJKA 1OPOA 3OSDA 5FYYA 2JE7A 3AB0A 4OMCA 4D7SA 4QX5A 3S57A 5CNAA 3O1UA 4ZS2A 3ES4A 3H1WA 3TN92 3N4MA 1XNBA 5A7WB 2JJ6A 4LUKA 2WL1A 1G7YA 5L9VA 2CWSA 3K75B 2KA3A 1HJGA 1SHWB 2W68A 3JD71 3HQRA 1FPN3 4QM9A 3KCYA 5FYBA 3KLSA 1ZRFA 4GB33 1VR3A 5GLTA 4B8EA 2ZGNA 5T3NA 2R0HA 2PHDA 1H2LA 1T6BX 4JC1A 2ORZA 4CDQC 1A78A 1H1AA 3I2FA 3MZHA 1FMD1 1Y7BA 3RMYA 3JD72 5EXOA 3RI8A 4XURA 4SBVA 3EJKA 1OA4A 4I09A 1G86A 2O8QA 2X5IA 5L9BA 2ZGRA 1JTZX 5J1XA 3OBAA 2ZGPA 1EY2A 3VV1A 2R071 2B42B 1GICA 2BQPA 2LROA 1KJLA 3E5XA 3NNJA 1LHWA 1Y9MA 3CDZB 4UYBA 1WKYA 3B9CA 4CE8A 2D3SA 4XFHA 1ZZ9A 1BCXA 1MEC2 3MI8A 4AQ2A 4DEQA 2BYVE 4E2QA 3WG2A 2HWB3 1BJQA 2LS6A 5H9RA 5T50A 1R1A1 2QQJA 2R072 2VNVA 4BQXA 2DCYA 1UO9A 4FP2A 4B29A 3HJRA 3OGJA 2ZEXA 4AL9A 5C5UA 2EIEA 1WA6X 1I5ZA 4L0PA 5GM0A 3W21A 4ISRA 1O3TA 1RJ7A 1ZM1A 3VBOB 2VL4A 3E6BA 3B00A 1SPPB 2WNVB 4OI1A 1V6IA 3MHZA 1UOJA 3PJQA 1GWLA 1R1A2 4B1MA 3LEMA 3SH5A 2K46A 2KXLA 4I0AA 4GZ9A 3PUQA 3ZN4A 1JU3A 1FOD1 2R7EB 2XB6C 3O12A 4OHWA 4CPBA 3RJRA 3ASIA 4FSJA 4TN7A 4WVZA 3VDDC 4PIYA 4E8CA 5A7SA 3A23A 1BEV2 1W9WA 1RYYA 1DGRA 1UXZA 3WW2A 2Y6FA 4JQRA 4J1XA 1TME1 4ATEA 5LA2A 1XJAA 4AEDA 3T2OA 4META 2DVGA 4PI2A 2BNNA 4D7TA 4PIZA 4RN5A 4TTGA 3ZYFA 4Y5TA 1JU4A 1DZRA 2OQ6A 2RS51 4XETA 4C1XA 1BVVA 3LQCA 3K51A 2UY8A 1ZBE1 1O5UA 4IV3A 2RS12 4Y26A 4YM2A 3I49A 3WSOA 3VDBA 1VRH3 4GIQA 4XFFA 4P9XA 1TME2 3MUY1 3OCPA 5CYYA 3I3BA 1VAMA 3SISA 1MACA 2QJVA 2GNTA 5FY5A 3O0WA 5AVAA 1EV11 3KHBA 2Q8CA 5CG9A 2ZX3A 3ZYIB 4FTSA 3PMSA 1ZBE2 4LQRA 4MGQA 2DU1A 4CDUC 5BNPA 2YU2A 3DKQA 2WS91 1K5JA 3ILFA 3W58A 4HN1A 1QEXA 4QXBA 3WQBA 4C0BA 3NO8A 1NZCA 2WT2A 4M4RA 2PHRA 4CDQB 3NSTA 4DOUA 2P6HA 4AGGA 2JECA 2Z69A 1QKQA 3MUZ1 4UAPA 1SFYA 1S0JA 3AVSA 5C4WC 3ALQA 2PHFA 1YFUA 2R062 2P4EA 4MH0E 3ZSEA 2GDFA 2V5YA 2WS92 3MYXA 2B4KA 5LK5A 2AH2A 3NWKA 5TSWA 1PK6A 2YGLA 1W6NA 3KVAA 1WW4A 1TMF3 5BXXA 1I6XA 3LF7A 4XUNA 3C7OA 2QUOA 2OA2A 4FQ4A 4GWMA 2RS33 2WRAA 1OLQA 4ISQA 3SH4A 1YRZA 2DFCA 1Q8VA 3RPQA 1UYYA 4CCLA 2Z79A 4I30A 4NRPA 4YARA 2DTWA 4JDNA 1YLLA 3KT7A 2DU0A 4DIQA 1DQ4A 3BIEA 3J4UH 5F9TA 3HNYM 2XL9A 4WM7A 4BMBA 1HXS1 4WVMA 1J1TA 2BGPA 1LECA 4XPVA 3DECA 3NNFA 2ZEZA 2E7AA 4MVTA 1O59A 2X53S 5CFDB 4CP9A 1FX5A 2CY6A 5JMOA 2RDNA 3MIFA 3VZLA 2G19A 2Y0IA 5FQ0A 4Y22A 4AEDB 1W6MA 1HXS2 1C5IA 2WWSA 5JZGC 3V0BA 2QQPA 5H9PA 3ORJA 2HWE1 2XLFA 1XE7A 3IDAA 1WCDJ 3IAPA 3MF9A 2ZEWA 4Q4W3 5DQ0A 2EIGA 3WDTA 5CU1A 3U14A 4QKNA 1ZRIA 5CZKA 2VR4A 2HLEA 4PI0A 3MBWA 4MGSA 4IE0A 1HB1A 4R4ZA 4YVWA 2D98A 2GC0A 5A70A 5A6XA 5C8WA 5FPAA 1RUE3 4DRVA 5LA9A 2HWE2 3T2QA 1RMU3 5BPXA 3M3OA 5FZ3A 3ZKYA 3CJIA 4FO9A 5EZWA 2K0GA 2XUMA 2JB8A 4JRLA 4LIUA 3CHXA 1XBFA 3KSCA 2J1UA 1WMXA 3V64A 4OI4A 2MEV1 1D0GA 5IK7A 4KL1A 3WY6A 3I59A 3WDVA 2W91A 2XJUA 3RYKA 4OVEA 2P1BA 3KD4A 3OYWA 5BUVA 2OIIA 5BNNC 4BA6A 2D93A 3MF6A 5SV5A 1W6NB 1UKGA 2CAUA 4YW7A 5JIUA 2G1MA 2MEV2 3VD9A 1VRBA 3ZSLA 3PHMA 1BBT3 2HWD1 2DBIA 5FXVA 1BXHA 1RIRA 4JGYC 1UIJA 5A1FA 4B3NA 1HQWA 1US2A 1WD4A 3IKWA 1LRHA 4S2DA 5L19A 3WCRA 2VO5A 5BNNA 2W2IA 3ZFFB 4JAAA 1GZWB 3R05A 1NQJA 5FZEA 1GANA 4ZXEA 4ZY9A 3UJQA 4E2GA 5CFDC 5IAXA 3ZKUA 3W59A 5CG8A 1UX7A 4BXSV 2A71A 4WVMB 1LU2A 2IVJA 2P3IA 3JB4C 1NE6A 3MFCA 1IG0A 3T1MA 4YG3A 4MG2A 5LB6A 5A3LA 4Q4Y1 4QX8A 5FBJA 5FQ0B 5FP8A 4UW3A 1NLSA 1W6MB 1UMZA 1W0NA 1X50A 3MGUA 1UY2A 2Y60A 4XZPA 3LCPA 5CB7A 1CAWB 3J26N 4JV4A 3JZVA 4LOTA 1W28A 1YIPA 1APNA 2FDHA 1UD1A 4QM8A 2VUAA 4UFIA 2ENRA 2JWPA 4Q4Y2 4AEMA 4Q4V1 3W5NA 2QQKA 3KV5A 4YFZA 2WQ4A 4MGIE 5JZGB 2WBKA 5DAQA 2O1QA 1PMHX 5C9AA 5K0UA 3WZ1A 1W6PA 4QXHA 5JR7B 4BK5A 5FMOS 1PIV2 1JHJA 4MGYE 4XTPA 1RUD3 5EP9A 3WG4A 2VD7A 2BRTA 2WUHA 4IDZA 4AI2A 4XJ8A 5CFCC 1I9RA 5LW9A 1SLAA 3OF1A 1K5MC 4NAOA 4PBPA 3ZN5A 3L2YA 1RXFA 4LK7A 2D3PA 1SQ4A 4XBLA 3CMGA 4Q8KA 2XQRA 2GC1A 3I59B 4HG6B 1NA1A 4DXRA 1E5RA 1HN1A 1MS8A 2PQQA 4QPWA 2AR6A 3SXWA 2EXHA 2WT0A 3EHKA 1UL9A 4RGKA 5FMDA 2P3JA 1DGWX 1GQGA 2IXIA 1YQ6A 2VECA 3OEBA 2JDPA 3ZFGA 4BYYA 3Q8BA 2VZ3A 1BK1A 1S1AA 5L36A 3OGRA 4OQ9A 1LKNA 4YW1A 4IEPA 3B02A 5IWFA 4LO5B 2ARCA 1RHI3 1RUF3 3AL5A 4LK6A 3UGGA 3SITA 4XMIA 1DGLA 2VTXJ 4N7UA 4NRMA 3ZR5A 5BNNB 3PVBB 5C5TA 3ZLIA 2XWBB 1RUG1 1TQ5A 2E26A 4RFRB 4FPKA 5FZDA 3RWKX 3DGTA 3JUUA 3WCSA 5APAA 3OY8A 2R0FA 1PX4A 3Q8FA 1ACCA 3NNMA 3WXPA 4N43A 1V6OA 4CUBA 3WLUA 4CP2A 2Y34A 2QDRA 2P3YA 4XF9A 1RUJ1 1XB9A 4PDWA 1VPHA 4WVWA 4AQ6A 3S0MA 1IGOA 1QWRA 3BKZA 3LOBA 2WC2A 3MO4A 2UURA 2UYBA 2VVFA 4RA0A 1Q8OA 2ZX1A 4IGOA 4B7EA 5K7PA 1QNYA 4XAEA 2P3KA 2WQZC 3LDKA 2WKKA 4D6QA 2X10A 4MX3A 2ZX0A 3VGIA 2XVLA 1QF3A 1UU4A 2P34A 4NVPA 2WFF2 2A1XA 4KU7A 3BTAA 1TZOA 2GP5A 2JICA 3FJSA 1YI9A 1CONA 2IFWA 3I7DA 1TG7A 1X33A 5FYVA 5A80A 5EJZB 1QIQA 1DF0A 3AP6A 3FN9A 1W6PB 3N9PA 5K0UB 2VQTA 3M3CA 1IZ3A 3QBQA 4AQTA 5B4NA 2V73A 3KQ4B 4KQ7A 2R042 4COZA 3HN1A 3LGRA 1PO21 2GH2A 4FI9A 4BZ4A 2QKDA 3VDCA 2Y6GA 4UFKA 3NJYA 2PHTA 3T2TA 5T5LA 2X05A 3ZXGA 3MV11 1OQDA 4XACA 1ND2A 4BQWA 5DUUA 1XE0A 3PIGA 1VALA 5KHJA 2O14A 5FPBA 4E27A 2RMU3 5CFCB 4JVAA 5A6YA 2C5DA 1YEWA 2YBKA 1JH5A 3PUAA 4XUTA 1DGRN 1PMJX 4B7KA 4RSUA 4AZZA 3KCXA 3ACLA 4R9CA 2HWF1 2H0VA 1JUHA 1ZZ8A 1NE4A 4H7MA 2VVDA 5FTTC 1ND3A 2BBAA 4DUXA 1QXPA 4XIKA 4Z07A 3ZXLA 2VZPA 1L3JA 5F1RA 3T0DA 1KFUL 4PT6A 5J3UA 4YZ4A 3IMNA 1PO13 1ZBA1 1CJPA 3FUOA 4E4SA 3U0ZA 4I0BA 2HWF2 5HCFA 3H8RA 2Q8DA 4KU8A 5KHHA 1EUTA 4K1YA 2E31A 4CDWA 4N43B 4Z2AA 4L9BA 4Y24A 2DVFA 1PZ7A 5D8AC 5JXIA 1JYNA 3R4DB 1V6KA 3TEWA 4PIXA 1IOAA 4K21A 1EAH1 1ZBA2 3D8CA 2D43A 1DZTA 4YRDA 5LRRA 5CAZA 1DDLA 2VOTA 1KITA 3I2DA 3FLTA 4N7IA 4QPIA 3ZFEA 4ASKA 4XABA 2XHNA 1UW8A 1ULDA 1PZ9A 2CTVA 4RHV2 1RUH3 4KWJA 4MHUA 3RI9A 4F8AA 3ZO0B 1GMMA 1XNAA 4AVVA 3VLBB 1GU3A 1RUI1 2IUWA 4QDSA 3GYDA 1PVC1 1U5YA 2VQAA 2ZBJA 1YNAA 4ZXKA 5AC93 4GQ7A 3HNBM 1LAJA 1XNDA 1QJX3 1JN2P 4BB3A 1XU1A 2ORXA 4LHKA 3C8XA 3EB7A 1WCUA 3H3ZA 2PA7A 3VZMA 5IFPA 2YPJA 1MS0A 3UK9A 4LJHA 3R6SA 2FBEA 5LWBA 4XILA 5FZ1A 2PMWB 1ZA7A 1BHGA 5F32A 1HV0A 3J7MA 2EXKA 4X8PA 4QPGA 3N7KA 1W6QA 3IPVA 2IXJA 1YIFA 2VE1A 2VMHA 4XZUG 3JBG1 4Q1RA 3C7EA 1R083 5I0SA 2UU8A 4NIIA 1VBE3 2XVGA 1Q56A 2ADEA 3WF2A 4BH9A 3UJOA 4ASLA 1Q3EA 3E5QA 2HBTA 1ENRA 3LEKA 5LASA 2VTXA 2VXJA 3O14A 1F2NA 5FZBA 3TNPB 3T08A 4UI9L 5JSPA 1U5XA 3KMHA 1RUOA 3NV3A 3NW4A 1UCXA 1G9FA 1NCRC 2JG9A 4Q27A 4U2AA 4XDOA 3SEEA 3USUA 2QQUA 4S2FA 2QQMA 2D6OX 3Q9OA 2D97A 2MPFA 3MLJA 1UZWA 1D2QA 1MVQA 2J1EA 2BV4A 2IVIB 2WZR3 4RR3A 4OHYA 4NE9A 4CDWB 5A1AA 3K77A 5FYIA 1N1TA 4H7LA 3RYRA 4PLNA 3EBRA 1K42A 3AMQA 3RJ2X 5ACA3 4YW2A 4JTOA 2FCUA 5IK5A 2BWAA 1POV1 3POJA 5LBCA 4LXLA 4BM8A 3VZOA 2JG8A 1KJRA 3DV8A 3I3QA 3AK0A 4L2NA 4IE6A 1B35A 1B09A 4QPIB 3ZFEB 1H2MA 1W2OA 3M3EA 1D2SA 3W20A 4PLMA 1J3RA 1UY0A 4QQHA 4L11A 5FZMA 2OX0A 4E4ZA 3UYJA 4FAHA 2D6NA 5F5AA 4YNIA 5IATA 4KGGA 1OMIA 2A6YA 5FP4A 2QE3A 2WYFA 3LFMA 3RZZA 4DY5A 4LBQB 1QGLA 1CX4A 4NHLA 4WVVA 1S2BA 2ZKLA 3QOPA 4QPYA 4IV1C 4NROA 4CCOA 4L97A 1GZCA 2Q0AA 3AYDA 3AZZA 1Y9GA 4QD2A 1W8TA 5HV4A 4BDVB 3BALA 4HKWA 1VBD2 4QKDA 4IETA 5C3SA 1MEC3 4YVSC 3HR9A 4HMZA 3SCHA 2BZDA 1HRI1 5A33A 5DAVA 4UW6A 2JDUA 3LOIA 4LIVA 3ZYHA 5A6ZA 2XUEA 1SG3A 2AUYA 3MV01 5CVRA 1CIWA 5EFUA 3V0AA 4FOWA 3RZHA 3DYOA 1XE8A 1ZZCA 1WCQA 4XYXA 3HVDA 3A0NA 3VZNA 5K4LA 5JOWA 1OQEA 1VBB1 3IPVB 2GALA 1LOAA 1ASJ3 4XEZA 1HRI2 1G9AA 4DEVA 3ST7A 5FO9B 1VAVA 3FWEA 2AACA 1F5FA 4LBMA 3I2JA 1H8TC 5GALA 1SMVA 1AR91 2WYSA 3INAA 4X6QB 4JKKA 4FPYA 5I0TA 2OUJA 1JYWA 2DBNA 1AR82 2HKXA 1POQA 4OLLA 5A3NA 2WAAA 1AXZA 2RM23 4PF1A 5FZ9A 3WDUA 4LLOA 3WEZA 4BQ1A 4IE5A 2DUQA 4LA3A 3WQ0A 1OURA 1BEV3 4LTAA 5E89A 4ZONA 1AR92 2JG9B 1C8M1 3USUB 1LEDA 4K20A 5FY8A 5A7WA 1S0FA 1JZ5A 1W0PA 4Y1YA 1O3RA 2VULA 4XJUA 3MPPG 4A2UA 1ULGA 1MS9A 4JCKA 2BERA 4N9IA 4Z8BA 3FFQA 4C90A 1YI7A 4ZZ5A 3PNAA 2RS13 1VMHA 4RGGA 3VBSA 4BWOA 3I8TA 3MICA 3ENRA 4NHMA 4AFMA 3O7OA 2VW0A 1GNYA 5CKMA 1QOTA 4UWDA 3CBNA 4O65A 4EQVA 2ZGQA 1BMV1 1MS1A 4YG6A 1LJ7A 2JKBA 3FMGA 2D3RA 3NAPA 1H1MA 4OUMA 1KD7A 3P3NA 4I02A 4DXTA 2CYFA 1XSRA 1VE0A 1ZZ7A 3B3QE 1KDMA 4LO8A 5DUVA 3J8F1 4YM1A 1V9U2 5F5CA 1M06G 2WA3A 4XTMA 4NIGA 1H4GA 1DZQA 2QQVA 5FCCA 3N9MA 3G7DA 3AM2A 3GZAA 1BMV2 1OF4A 2ADDA 1NCQA 1OLME 1D4M3 2D6KA 3AMPA 4IEZA 2R063 2GMMA 1HQNA 3MLLA 5A33B 1GBGA 1LESA 1UU5A 3GBWA 4OZXA 3ZM8A 1UF2C 4GKYA 3J8F2 4V2VA 3SCGA 3V0AB 3WDXA 4IV1B 4J6GA 4WV8A 3OBRA 5L7OA 5ISLA 5CEHA 5DMYA 1QJU3 2OZ6A 4CXYA 4IGPA 2VCBA 3VHRA 1SPPA 3POYA 1YQCA 1I5PA 3UKTA 3VBHC 3KZ4C 5DPNA 1CGPA 3C2UA 4FFIA 4LBKA 4MZUA 4WM8C 4DS0A 3O1PA 4HPKB 1OOPA 3ELNA 3R4SA 4DPNA 4Z92B 3T4HB 3FHIB 4K9SA 5A3OA 4NIHA 3VKMA 3E6DA 3B7MA 2J42A 2WSVA 2UWCA 4A45A 2JDZA 1H30A 1VBA3 4FQZA 3SMHA 5FZ8A 1VB2A 3ZXJA 3RNSA 2QDNA 5C8CC 4ITCA 4O61A 4QXCA 2E6VA 4D7YA 2VMCA 1O7FA 1U5ZA 4XF4A 3K48A 1MVEA 4QGNA 4CU7A 1HXS3 1OQ1A 2PTMA 5HCHA 2RV9A 4XF0A 1W2UA 1TE1B 1WW5A 2WNUB 3CU7A 4ZU5A 5FREA 3HOBA 4MADA 1Q43A 5T55A 4AWDA 5F3CA 1W39A 1X82A 1HLCA 1W9TA 4BMEA 1AR71 3ZIWA 4N9HA 3VBSB 3B93A 4NMIA 3NJXA 1ZRRA 4Q4X1 1LULA 1RVF3 2PELA 2WWJA 2EICA 3IWZA 3AKSA 1R093 4BU2A 4MV2A 4CDXC 3LPFA 3VUOA 3ILNA 5LCWL 4KBBA 5FWJA 2RG4A 5B4XA 3WNLA 4LKDA 1G9CA 2PXJA 1AR72 2XJSA 3NAPB 2RR13 5FYMA 4Q4X2 3I3MA 4QAWA 4CDQA 3LA7A 3DN7A 4P5HA 5GZFA 1FMD2 1XC6A 2Y33A 2EXIA 3KQRA 4GAZA 4NWVA 4RQPC 1DLCA 4A3XA 3MIEA 5F37A 1JZ2A 4ORFA 5DAXA 5C3QA 1NCQB 5KHGA 2WO1A 4AE2A 2YY1A 4EROA 4KI5M 3IIAA 4M3CA 5FP3A 1ULOA 3IDBB 4LBJA 1JZ4A 4WZCA 1IS4A 3SKJE 1ENSA 1XNKA 4INDA 4LNVA 5HCBA 2ARXA 5FLJA 4K6BA 1CAXB 4R4XA 2LUWA 2AC1A 2OZJA 2OXBA 2UWAA 3ON7A 4W65A 5L7OB 3VB9A 1COV1 3POSA 1NKGA 3U1XA 5B2GB 2YBPA 1W2TA 3AP4A 5F3IA 2TUNA 4YYOA 3TYJA 3UGHA 3RZKA 1XPWA 5JPNB 3GXUA 3MW4A 1AL21 4NPMA 2IZWA 3MW2A 1SDWA 1OOPB 1REDA 2AYHA 1Z0HA 2XL7A 4CA9A 4JKLA 1JBCA 2XBO1 2CGPA 1COV2 1Z7S3 4WBBA 3WVJA 5BNPC 1DYOA 1RUC3 4JGZB 5JPMB 1ZZ6A 2EAAA 1MR5A 2W5FA 4Q29A 5DG2A 5ABJC 5HXVA 5CFDA 5FUNA 2R1BA 4JTNA 1AUYA 1O91A 2XJQA 1AL22 2WZ8A 4WM8B 2YHJA 5JUVA 1FOD2 3A4UA 3N35A 2GU9A 2ZXQA 3S6PA 3AMHA 1S0BA 4BQ3A 5J09A 4FFHA 1H4HA 1DFQA 4Q1PA 3VDDA 1GYKA 5J48A 2FZ1A 1Q8PA 1A8DA 2IXCA 3WDWA 3PMEA 2V5DA 5KXDA 2NMOA 1YJLA 3SEPA 4A3ZA 4DNYA 2FZ2A 1GNHA 3HEIA 3LFIA 1QJY1 4LKFA 5IVYA 4NIAA 1OD3A 1BVP1 1URXA 1WLCA 3H8XA 4FOQA 2IC1A 2I2SA 1GZ9A 4V2WA 1QMJA 2VGDA 3SH3A 2RS52 2EIDA 1EPWA 5FPVA 1PIV3 1S55A 4YGDA 4QQOA 2AENA 4UXAA 2GP3A 1QJY2 1QU0A 2ZX2A 3POGA 1RC6A 1JYTA 1S0DA 5F5IA 1AYN1 3O5SA 4BIFA 1EPZA 4LA2A 4CDXB 2BFUL 2BPA2 4AHXA 2ZA9A 1EV12 2JE9A 4PQQA 4OQ8A 3GBFA 3QCWA 4FOVA 4AEJA 4CDUA 5A1LA 5IAVA 1JZ3A 5G04L 1WWYA 2GNDA 2PLV1 2R30A 2VQUA 2ZHNA 1E5IA 4GH4C 4M3CB 4LR4A 4XE9A 4ZS3A 1AYN2 4PQ9A 3WX5A 3U11A 3DUIA 3WNPA 1C1FA 4BLJA 3OPZA 2D6MA 1J83A 4NWWA 5FZ4A 1DHKB 5C4WA 1CN1A 3WF4A 3ZXEA 4EN0A 4FT8A 2E63A 3AMMA 1US3A 2YC0A 2P2KA 2PLV2 2WN2A 2DV9A 1W3VA 3C7FA 3KGZA 4NRQA 4QB6A 3VHNA 5BNQA 1ZZBA 5ANQA 1IPKA 3ZFFA 1GZWA 2W39A 2A6WA 2FMDA 4W6YA 5IW0A 3QD6A 4CYDA 3OTFA 1SZBA 4N90A 4NR1A 2A6XA 2BGOA 5FZOA 1GZTA 1R64A 5FZFA 2GSYA 1NXD1 3H3LA 2YC2A 3TEZA 1WA4A 3MIGA 3RSJA 1FV2A 5HI0A 1TEIA 1WCSA 2OYZA 4COWA 2IXKA 1RL3A 4K7JA 2ZX4A 3LSEA 1KS4A 1UY1A 3EYPA 3NNLA 1P8JA 3VDDB 3UNPA 1DBNA 2ZZQA 4GWNA 3WD5A 1GR3A 1CAWA 3T2PA 1MQTC 2FHRA 1VJ2A 4XHBA 3WF1A 2EIBA 1UY3A 2FDJA 2ZGLA 5LBBA 3H0OA 5FZGA 1J1LA 2WFF3 1FPN1 1VBC3 1JMUB 5FK7A 1UYXA 2DDUA 5JZGA 2DYCA 4JKMA 1AR63 3E6CC 1ALYA 1WMDA 4XAAA 1W8WA 1F35A 3OPWA 4PCRA 1UXXX 2ET7A 4YVWC 1YXWA 1DQ5A 1DYKA 1SACA 2R043 4ARYA 3HPNA 3N3HA 5DZFA 1J3QA 2VQ0A 3LB9A 1FPN2 1AZDA 4XUPA 3LKJA 3U75A 5FPXA 1V00A 1FNYA 3CJIC 4YPJA 4RGAA 1PM4A 1C4RA 2EF6A 4CDUB 3PUHA 3IZOA 1I3HA 3J7NA 3BI3A 2N7GA 4KG0A 5BNOC 3R0RA 4HBNA 4GWIA 2HWB1 3B94A 3LE0A 5C4WB 1IQAA 1UY4A 2W94A 5J98B 1H2KA 2PAEA 1WD3A 1OKOA 4GH4B 4ONUA 5JLVA 3PTYA 4IUGA 1CQ9A 2WJSA 4BQ4A 3WNMA 5J96B 5I0DA 2YFZA 4OULA 1W8FA 2XQXA 1DLLA 4LBNA 2C9AA 2E51A 2RDQA 3B9IA 3KWVA 2HWB2 2HWD2 5IK4A 4JGYA 1KGYA 5FZOB 1NY71 1X8MA 4UFJA 1SEFA 4LLFA 1A34A 1AX2A 2V09A 1A6CA 3ZXAC 3GALA 4Y3OA 3N36A 4NUBA 4OFGA 2CSGA 4O9EA 2VC9A 1ZBA3 4YW4A 2BGCA 1A3KA 3NJVA 1UOFA 1OVSA 2RHPA 4WZFA 3ZXFA 3TB0A 1NY72 4DO0A 4OHXA 1ZREA 4LKSA 4LO4B 4DUWA 4RHV3 4IESA 4JQTA 5FYSA 4F83A 3FBMA 4I2OA 5F3EA 3AC0A 2ZGTA 2ZGMA 4JDMA 5AVPA 4H14A 4AHWA 1IS3A 4N8MA 5I0RA 3LZZA 5BY5A 2PAMA 2ZPXA 1ZNPA 4JDOA 3H8UA 4A4AA 3THTA 5LEKA 5JDBA 3VDAA 1VRH1 3ZDSA 2FDKA 3PTRB 5C71A 3VN4A 1AHSA 4QQLA 1V70A 3WT3A 4OHZA 4OI0A 4Q4V2 3SCFA 3OUJA 3ZSKA 3OD4A 4EZHA 5C9AC 4QU2A 4AHYA 1G6NA 2OPKA 1UPSA 2WO3A 2A75A 1ST8A 3AFKA 1T2XA 3AKRA 4Z82A 1BQPA 2VBDA 4XFCA 1LGCA 1VRH2 2XWJB 3GGLA 5LEJA 1WLWA 1VB4A 5DDJ1 5LATA 4GMP1 2WFPA 3I2GA 3PURA 5FJHA 5CFCA 1AL0G 1K5MA 2JDMA 3AZWA 3AKPA 5FZKA 4CUGA 1UQXA 2HEVF 1RGSA 2FDFA 1NA1C 1O3QA 1ONAA 2LTNA 4HLTA 3USSA 4QKFA 4XHXA 1SCRA 2DUOA 5DDJ2 1SFNA 1D0HA 1WLDA 3JQXA 4KG8A 1TMF1 2YV8A 3FZ3A 3M1HA 5EV7A 1WMEA 5FY4A 1U5IA 4P9GA 1PGW1 3AKTA 5T5PA 5FXWA 4QGMA 5FAXA 4AFCA 4CCCA 3HMYA 4P9IA 5KWRA 1H2NA 1UNBA 4FVVA 1Q8SA 2ZGUA 2YPDA 4JGYB 3U10A 4BHPA 1F15A 1CESA 3KV4A 2RJKA 4XFAA 3IAQA 1PGW2 3GJAA 5FRAA 4K3UA 3U37A 5IJRA 3A22A 3U4XA 2A73B 1RUG2 2YXSA 2OUHA 4AFDA 1BZWA 2W95A 4B1LA 1Q8QA 3HT2A 3S5QA 1UZYA 4AFAA 5EJ1B 4EWDA 1TNFA 5JAXA 1GUIA 1CZSA 1OSGA 1F5JA 5FPUA 1MZ5A 3ZMOA 3VD3A 2Q8EA 3BTYA 1RUJ2 1GOHA 2GNMA 1W6OA 4YLZA 4ATFA 2PYTA 4D69A 3FLRA 4Q4W1 5I8YA 1MS4A 1UMHA 1X9PA 2EXJA 4J25A 4MO3M 2ZHKA 1H1IA 1VBD3 1W2AX 3DXTA 3ETQA 1GWMA 1RUE1 4UOJA 3X29B 5C70A 1ZX5A 4YZ5A 2A70A 2R1DA 4TZDA 3J9SA 1RMU1 3DYMA 2W3JA 3LEGA 1N3PA 4Q4W2 2Q4SA 2MHFA 1GSLA 4QB2A 2JDKA 2BEOA 2D6PA 1ODMA 4Y1ZA 1F8VA 1JXNA 1CAUB 2OW4A 3T30A 4XFIA 5I8SA 5CISA 1PO22 4NPLA 3THCA 1RXGA 1K5MB 1PNFA 1RMU2 2W1WA 2WABA 4CU8A 1WBFA 1CZVA 1W8UA 1UZVA 1ND2C 2WN3A 2GMEA 3BN6A 1SDDB 5F39A 4LUMA 5F2WA 2JIGA 5GLUA 2WDBA 4CCNA 2YYOA 1H6XA 2BP6A 1AR83 3CL1A 3DCQA 4U36A 5DZGA 1NUKA 5FYCA 4AAXA 2VCMA 2VUDA 1CVNA 4I01A 3VZJA 1HX6A 2XMLA 1XSQA 1RB8G 4AF9A 2K9ZA 5F5QA 1BBT1 1GNZA 3O0XA 3OUIA 1HRV3 5FBZA 2E33A 2RVAA 2C9KA 4UW4A 4XXPA 2Q30A 5F2SA 1LGBA 4CZSA 3RZJA 1W8HA 3I4IA 2HWC1 2QVSB 3RYPA 4R9BA 3AP7A 2CAVA 1O6UA 3O0VA 2VMIA 4M3CF 1G9BA 2XR4A 3VL8A 3LA3A 5FPZA 2VMGA 1BBT2 4GALA 4O7XA 1CIYA 1VIWB 3AZXA 2DVAA 2VJXA 4QT6A 1SBEA 4YGEA 4BOWA 4COVA 2GZWA 3P3PA 4Q0VA 5FLHA 5FY7A 3CQOA 3N7MA 2HWC2 1C28A 2JD9A 4AGVA 3NQHA 5D8AA 2WLQA 3H7YA 2H6CA 4KH9A 4P14A 3FLPA 4ZHNA 4MHRA 1K12A 3AXEA 1W6OB 1EAH2 4IEVA 4IGQA 4S2HA 4V1PA 5EHDA 5FY1A 1YC61 4EWAA 4LBQA 1F4AA 2ZHLA 5FUIA 2ILMA 3M4FA 1IKPA 4FPCA 4QX3A 1V9U3 2VW1A 5FO8B 3DPRC 5HPOA 4S2GA 4XCBA 5BV6A 5LBEA 3DXUA 1C8NA 4YW5A 5GJ6A 4A44A 1G9DA 2HEWF 5FXZA 3WNKA 5A3MA 3J7HA 3BTZA 5FDBA 1RUI2 3N9QA 2BUKA 1PVC2 2QQNA 1PGL1 4OZOA 3PVEA 4Q26A 4FTEA 4GJYA 1JYCA 1OH3A 1QJFA 1H6YA 3IMMA 2W46A 5T52A 4MXWB 1HB4A 2OT7A 2XJVA 4RS5C 1RUD1 3HQUA 3MIBA 4QQPA 3RFRA 1NLRA 3WG1A 4BK4A 1UOGA 1JUIA 3VKNA 3OEAA 4XUOA 3H9AA 5FYUA 3AP9A 5HV0A 3NMBA 1PGL2 1LR5A 4FPJA 3LDRA 5GZEA 3FL7A 3I3DA 2YUEA 1AYM3 1GWKA 3TWIA 4QPGC 1HW5A 1RUD2 1YWKA 2PHUA 4IEQA 1EYBA 2ARBA 3AZYA 4AGRA 2KR2A 2VU9A 5HBAA 2GN3A 1NXMA 1GV9A 1JZ7A 2C6SA 4PLOA 1OFSA 2L9LA 4SLIA 4A7ZA 1V0AA 1ZA4A 2VOWA 3VBFC 4AFBA 3RZMA 3JBG2 4GD4A 1GLHA 1LHUA 2DCKA 2TEPA 3CO2A 2SBAA 2VZSA 1SBFA 3H42B 1HN0A 1UPIA 2VM9A 2QBXA 5C6CA 4HK8A 3SLIA 4BCUA 3TN93 3H8OA 2Y6KA 5FMCA 1RHI1 1RUF1 2E7TA 3HIFA 3VBRC 3RZLA 2EAKA 3BIWE 4XVHA 1Q5OA 3WR0A 2C26A 1U12A 4LITA 1UU6A 2WWUA 4AG4A 2XXZA 2ZS6B 2FQPA 4NHXA 1NCRA 4IL7A 2VVEA 4QDRA 4XOGA 3ZYBA 3RDIA 3ZVXA 4ZZ8A 3TBDA 2W1UA 3LEIA 2ZACA 3ACGA 1DG6A 1RHI2 1GP6A 3MW3A 3O1TA 1RJ8A 2ZMKA 2EALA 1LOFC 4XQ4A 3JD73 3URFA 2ZKNA 2J22A 2Y6JA 4K8FA 5D8AB 3WUDA 4CEYC 2IWGB 1UWWA 2JG8C 2VZVA 5F6LB 3VBUC 4ET7A 4Q8LA 1W9FA 4QXKA 2ZGKA 1ENXA 3KCCA 3MPBA 3A21A 5A32B 1W2NA 1FMD3 4FPLA 2YG0A 1OLRA 3I3EA 4IW3A 3M3IA 2BTVC 4CEWC 2VMDA 3KT4A 4FPHA 4F3JA 1K3IA 3D0JA 4NO4A 1FATA 2QCSB 2R073 5DABA 3DL3A 5FZCA 5LY1A 4IV1A 3FX3A 4CSWA 2NQYA 5J37A 2IXLA 1MS3A 1AX1A 3FC0A 5LZ6A 1HKDA 4R8HA 4YWAA 4XQWA 3RRDA 3ZPOA 5GZDA 4YVSA 3WNOA 4ES8A 2QQOA 2G9FA 4XF1A 1R1A3 3MFAA 2CU5A 3CEWA 4I0WB 4L8QA 4HPKA 3IN9A 1HQLA 3P5BA 2WNEA 3LIHA 3PVOA 4L92A 5FP7A 4HOOA 2X8KA 1W8ZA 4TSVA 2YBSA 1U0AA 4CP0A 5IT6A 1VBB2 4KBZA 2RMU1 5KHIA 2AREA 4A7YA 3KS7A 2Y6HA 3POEA 3ABZA 4CUAA 2E32A 5J7MA 2E9QA 2DFBA 4YGCA 1LOCA 1OD5A 2XONA 1H8TA 2R6QA 2PHLA 2JEMA 3SKVA 3I97A 1FOD3 5F3GA 3I2OA 3AJYA 3GZTB 4CP1A 1SFPA 4FBFA 4AOCA 4B4PA 1DCSA 3NV1A 1XNTA 2TNFA 3ITQA 3KF5A 3VBFB 3SHRA 2WNUA 5EJ3A 2HYXA 1VMJA 2FCVA 3S5AA 1C8M2 1NCRB 4TYSA 2K2SA 4W50A 4AVTA 3GZEA 1NZIA 5I93A 2HEYF 5A3WA 5CBLA 5JIAA 1TME3 4XC9A 3BPSA 3PDQA 3AXDA 1JZ8A 5LA1A 1J59A 5D2AA 1UKRA 2WQ8A 4YW6A 2RS53 3O1VA 5I0UA 3O1MA 4FOYA 4FPOB 3ACHA 1VP6A 1W05A 4UF0A 1ZBE3 2V4VA 4IEYA 4UFHA 4Y1UA 2KM2A 3I54A 4HKOA 2PHWA 2JKXA 5A7QA 2H0BA 4CPBD 2RE9A 2ZZJA 1RUH1 3VKLA 4GJZA 4CCEA 4CCKA 5GLWA 1ULPA 4A6SA 1EV13 2VW2A 2W9XA 3ZN6A 1O4TA 1PVXA 2VOVA 5AC91 4AHZA 1FYUA 5JXHA 4E8DA 1QJX1 1LOBA 1IPJA 2WS93 2X29A 5T5OA 3ZOIA 5F7UA 2FDIA 4P9LA 5JWPA 1RUH2 3NKGA 4DRRA 4EN9B 2DVDA 2QTWB 1CAXA 2OQ7A 3ZXKA 1POV0 1JZ6A 1SLIA 3EQEA 2J1VA 4HANA 2BDRA 1LCLA 5AC92 4Y5Z0 5IVJA 4YVSB 1KRIA 1RTVA 3BU0A 1SLTA 1X9TA 5F6KA 1CR7A 2AEZA 3KGLA 3QLQA 3WG3A 4N53C 3THDA 1MZFA 3BOWA 5C3RA 4LKEA 2VY0A 2YROA 2ZAHA 1YO8A 3VBOC 3QACA 2WNVC 4XUQA 3Q8AA 3T09A 2UY9A 4JGZA 2W1SA 4P9JA 3POIA 1R081 4JRAA 4LULA 1VLNA 3VKFC 3T4VA 1LB2A 4K40A 1QJEA 1VBE1 1LEMA 3WW4A 3VBHA 5JR2A 1QY4A 4UW5A 1I1EA 4WM8A 2XKOA 1H8TB 1JOJA 3ZYRA 4LHSA 4MGZE 1H0BA 5CA6A 3H7JA 4E4HA 4HVOA 5JVVA 2BWCA 2C24A 4OMDA 3GNEA 2PAKA 2R16A 1OF3A 1VBE2 1N47A 3CZUA 2P17A 2BW8A 3IDEA 5FUPA 4DZGA 2GC2A 2Y6LA 1XYOA 1OT5A 5C8CA 5FWEA 1J84A 1NYWA 3AP5A 2VZTA 5FIXA 4EN8B 3H50A 2WZR1 2ARAA 1W9SA 5E16A 4FP3A 3GDBA 3VL9A 4AAPA 5IHRA 5E8AA
chains in the Genus database with same CATH topology
2NM1A 5ACA1 1O4YA 4IQPA 2BNOA 5GLZA 2HWE3 1PHMA 2CNAA 3D4KA 4HT1T 3JCIA 1LENA 1AF9A 2WZR2 3WQ1A 4QGLA 4FCAA 4HSLA 3JQWA 2QNKA 2WINB 4YG0A 3H1YA 4CDXA 5ACA2 2QZ2A 4XJZA 4AK3A 2X5IC 3UV9A 3ZN6B 4OUSA 1IKQA 5H9SA 4XDQA 4IEUA 4O9GA 3ROUA 4BPZA 5FMOL 3ZYGA 4DMIA 3M2MA 3N7LA 1AXYA 1MEC1 3CF6E 1SLCA 2MEV3 2A6ZA 4RQPA 1WW7A 4XBNA 3NL1A 1Y3TA 2JD4A 4LO6B 3APBA 3WP4A 1JYIA 1RUNA 1CPMA 3ATGA 4UBHA 4W6XA 4RFT0 4XJ9A 5EYYA 4LEJA 2VOXA 3VKOA 2DWRA 2TBVA 1ASJ1 4AVAA 2NMNA 2HWD3 5L73A 5JSRA 2ZCWA 3S30A 4RD7A 4NOTA 3VBHB 1N1YA 4COYA 1HDKA 3QH7A 1AX0A 4N53B 1G8WA 4PJYA 4Y1XA 2B8MA 1ASJ2 2RM21 2MNGA 2XBO2 3WV6A 5EYXA 4AI8A 1BEV1 3MDPA 5ABJA 1QQP1 1C1LA 1XQNA 4H3WA 5IUQA 1QNWA 5C8CB 4C0HA 3W9AA 4IEOA 4AEDC 2RM22 4Q4Y3 1WLTA 2NZ9A 4DXZA 4ASMB 3GBGA 1QQP2 4IV3C 2NP0A 2RS11 4TLFA 2XJTA 1LTEA 2ATFA 4OI2A 1N3QA 3WINE 1LOEA 4HL0A 4Q4V3 2YZ4A 2YGMA 1MZEA 4E9KA 3BPZA 4LT5A 2Q5TA 3WQ7A 3ZSMA 3UKNA 4YZ1A 3HD8B 1TNRA 2LM3A 4E2SA 1Y43B 1QJZA 2O8OA 1DGWA 1X7NA 2A3XA 3HT1A 4RL7A 5CIRA 4B4QA 1D4M1 2R061 4AVBA 4RQPB 2WIIB 2X5IB 4MUVA 1WGPA 1LGNA 1S0GA 4XMAA 1A8MA 1PK6C 3JU9A 5DDJ3 4GMP3 2WSUA 4GH4A 4HFSA 2DCJA 4YW3A 2DTYA 1YFXA 2GAUA 5J36A 1QJU1 1CAVA 1D4M2 1XXNA 1H9PA 2G9GA 4BE3A 4YGBA 2F6BA 1BKZA 3EXUA 3UL2A 3AX4A 1ZRDA 4LO7A 1ZVFA 1PMIA 4YM3A 2VXRA 5JOYA 3ZFFC 5KXEA 1QJU2 4HVQA 1OA2A 1XNCA 4WM7C 1RUG3 2I07B 1VBA1 4EN6B 1ENQA 1QOSA 5BNPB 2PN5A 5I91A 4I3GA 5FOBB 3E5UA 5ABJB 1QH6A 3CLPA 3M70A 2ZJCA 2D5HA 3OD0A 4Q0QA 1RUJ3 1REFA 2BVBA 1UIKA 1VBA2 4Y1VA 2CGNA 3OBTA 4EJRA 1OFNA 4Q0SA 2E53A 5JSOA 3KB5A 4GB31 5BYNA 1MQTA 2D44A 3A0KA 5FFOC 1S2KA 2ET1A 2XJRA 2VOKA 3WP5A 1RVF1 5GZGA 3IT8A 1R091 4CTEA 4L99A 2VUJA 2ERFA 2VPVA 1LODA 4GB32 4IV3B 3AYCA 1Y9QA 2A6VA 2RJLA 1UX6A 2RR11 2W08A 1RVF2 1T6GC 3AMNA 5HCAA 3FFZA 1R092 3GZUC 1PO23 2Q1ZB 4FPGA 1CD3G 1DQ1A 4AVCA 4KWKA 3AYAA 2RR12 1ULFA 4A7KA 4BLIA 2XVKA 4DY3A 1SBDA 2XKPA 3ZYPA 1X8EA 2VH9A 4QHBA 1GFF2 2W0XA 5BNOA 1CAVB 1S0IA 3BCWA 3NV4A 3QH6A 2EA7A 1WCKA 2HWF3 1PK6B 2IFRA 3FBYA 3R4UA 1DQ2A 5DXDA 3NV2A 4HKLA 5BNNC 3D5OA 3FE5A 1LHOA 4EV0A 4FXGB 3S7EA 1FV3A 3D0SA 3HQXA 1Z7S1 1RUC1 2Y26A 3ZYJB 5FLIA 1IHMA 1YYNA 2HWC3 3AYEA 2XH6A 1DU3D 2ZAAA 3MIHA 4MSVA 4C1WA 5DUXA 4Q0UA 5DUWA 4AYUA 1Z7S2 2NLRA 3B69A 3BODA 4WM7B 1RUC2 4NPRA 1EAH3 2DVBA 4YFWA 1GQHA 4LBLA 3ILRA 4EN7B 4TWTA 4MLOA 2R32A 4AEKA 1MQTB 1ZRCA 4HN0A 3L9JT 1RUI3 4Y22B 1PVC3 3ZXDA 1QHDA 1FNZA 3V0BB 2XPJA 2H6BA 5K0UC 2XJPA 3B5LB 1YCIA 3CJXA 3V56A 2WZPP 1PIV1 4PF5A 3KT1A 4LE4A 3TNQA 3OJBA 4XQDA 2VNOA 4YVWB 1CAUA 1SCSA 4Y4YA 4EWEA 2XLGA 3BB6A 4XFGA 2ZGOA 1FI2A 4XJWA 3CJIB 3M8LA 1CJDA 4B4RA 3DKWA 5JI9A 4DINB 3AKQA 4ES9A 1OA3A 5KXBA 3JBG3 4LBQD 3RG0A 3M7AA 1N1SA 5KBFA 2D40A 3ZFGC 4AI3A 2RS31 5BNOB 3LWCA 3OYWB 4BIOA 3HBZA 3L2HA 1TMF2 5EWSA 4FPFA 5CADA 5K8SA 5GKAC 1QH7A 2RS32 3NJZA 1F31A 2QFEA 4CRQA 3NKTA 1MZ6A 4N43C 4G4FA 3KM5A 4M01A 1WW6A 3WUCA 5JOZA 3LSDA 4FAGA 2SLIA 1FAYA 3AZVA 4PDWC 3WP3A 1DIWA 3PVNA 5I8TA 1POV3 1HIXA 4I3PA 4LHNA 2OVUA 3BU7A 3RWNA 2O0OA 1RINA 2LALA 4R9DA 3IDCB 4M00A 2DURA 3ZIXA 2GH8A 4KWLA 2WFF1 1H9WA 4XF3A 1VBC1 1E57A 1AR61 2CGOA 1YHFA 1S0EA 4MXWA 4FPEA 4YZ2A 2EVXA 2BFUS 2R041 1HV1A 1RUE2 1PGSA 1VBC2 1Z78A 1HRI3 2CWMA 2WLPA 3THPA 4GKXA 1AR62 5C9AB 2AGSA 3PJYA 4R52A 4X6RB 4UBGA 3ZMNA 1FXZA 4GA9A 1AVBA 4FXKB 1VBB3 1NQDA 5KHKA 1ULCA 1CPNA 1WBLA 3LAGA 3WW1A 1KQRA 1AR93 4D94A 1C3HA 5KXCA 2JENA 1NA1B 4FTBA 4C91A 1ND3C 2GNBA 4Q0PA 3RQ0A 3NVCA 4PBOA 4LBOA 4HSJA 3JB8A 4HK9A 3ZFGB 1C8M3 2W52A 3D6EA 4GMP0 5E1RA 3TRSB 5SV8A 4CDWC 2VNGA 2C1FA 4MYEA 4P9WA 2FMYA 4G9SB 1XRUA 2ES3A 3RS6A 2BBVA 4MGKE 3OY8B 4QPIC 3ZFEC 1J3PA 5AFEA 1X36A 4URTA 1V6MA 4RHV1 4AI0A 4AQSA 5A32A 1EP0A 1VAKA 1QXJA 2CV6A 1W0OA 4PDWB 3CNAA 1XYNA 2Z42A 1O3SA 4IXLA 1D4VB 1YFWA 2Q1MA 3WP6A 5H9QA 3IBMA 3J8F3 5T54A 4DB5A 3DPRA 3GHNA 1O4ZA 1YJKA 1NG0A 3TAYA 3WNXA 4Q2FA 4ZU7A 4KGQA 2NPIA 4IEXA 3H3UA 2WT1A 1DYPA 3C3VA 2VNRA 1LU1A 2NN8A 4XIOA 2Q8OA 4X8NA 2I45A 4XXAA 3UKVA 4IERA 4RS5A 4M3CE 2P37A 1N3OA 3ZPYA 4YSFA 4K1ZA 2A3WA 3AJZA 1XYPA 5IK8A 1YFYA 2Y38A 1OPMA 2ZABA 1AJOA 4KNCA 5LK7B 1PM7A 4ZKTB 1ND2B 3WDYA 4M0NA 1OKQA 1YUDA 1F9KA 3ZX7A 3VBFA 1GKBA 2B46X 2E7QA 2JG9C 3B01A 3BOPA 3U07A 5LRSA 4XBQA 1OHFA 2R49A 3N7JA 3T1LA 3IM0A 4RR3C 3GF6A 3POWA 1RUF2 4HVRA 1ND3B 3VBRA 3D82A 2NYYA 2Y0OA 2B9UA 1LHVA 4W6WA 2F4PA 1M4WA 4E4DX 2JX9A 2GMPA 1H8VA 3G6JB 3MEPA 3VHPA 2D6LX 1AR73 3TOJA 1B35C 2PFWA 5JMCA 3M3QA 2ZOEB 4Q4X3 1V6LA 2DF7A 4Y20A 1LOFA 2AZ5A 3VZKA 4DQAA 4HETA 1QDCA 4GULA 5AFBA 5FOJB 5GZCA 4CEYA 2IXHA 3MIDA 4M0HA 1V6NA 4G3YC 5JI7A 2A3YA 3VBUA 5KC6A 2ZMNA 2PHXA 4LHLA 1SLBA 2VG9A 1BYHA 1IS6A 3DPRB 1VBD1 1C5HA 1KFXL 4Z2WA 2ZTNA 1KXGA 4LE3A 4CEWA 5K9YA 2I74A 5E88A 2B45X 4QQ2A 4HZFA 2A5ZA 2Z2SB 3HAGA 5JOXA 2ZGSA 4RS5B 1UAIA 1QXRA 5D1IA 2ZHMA 1COV3 4NN0A 1MS5A 4P9YA 4DFSA 4F7ZA 4AI1A 1AL23 4COUA 4QPGB 1W6QB 1AR81 2UYAA 1S0CA 4MXVA 3GHMA 2XBO3 1SLLA 2RMU2 3WOGA 3ECQA 4R9AA 3WW3A 1DQ6A 2ZMLA 4QMAA 3S7IA 1PO11 1HRV1 1QDOA 3PLQA 1QOOA 3WHUA 4OHVA 2XG3A 1FT9A 3OGGA 1KS5A 4J1WA 5FO7B 2UWBA 5JCTA 2XLAA 2WNUC 1WUVA 3FUQA 3VBRB 2GC3A 1JW6A 1QQP3 3HWJA 1PO12 1HRV2 1UZZA 2DCTA 3VBSC 4AW7A 1ULEA 3ES1A 2BVVA 1QJY3 1REEA 2DCZA 4RR3B 5DZEA 1C57A 4NHKA 3LA2A 2XHKA 4Y20B 2D7FA 2BNMA 1PNGA 3NAPC 1J58A 3H1MA 1LHNA 2WA4A 3RMXA 4CEYB 2JG8B 1RITA 4AXOA 1V9U1 3VBUB 1B35B 4GXLA 2ETEA 1PZ8A 2G4IA 3V65A 1DQ0A 2GN7A 2QZ3A 1AYN3 1XU2A 1NCQC 5KC5A 4D3WA 3VHOA 4CEWB 4YZ3A 4XJAA 5C33A 1QJX2 2CL2A 2PLV3 5DG1A 5L7OC 4XFBA 4YM0A 1N1VA 3ZSJA 3EO6A 3AFGA 4XW3A 3WHTA 1JHNA 2B5HA 3ME2A 2B7YA 2XGXA 2Z5WA 5GLVA 2HYKA 2JXAA 1AYM1 2A7AA 3DF0A 1AXKA 1O5LA 2DUPA 1OOPC 1LOGA 1R1ZA 4N53A 2YDEA 4Z1VA 1OI6A 2B39A 2YMZA 5T5JA 4ZU4A 4JGZC 3VBOA 1V6JA 4H55A 1KDKA 2WNVA 3E97A 1WMFA 3SNMA 1UN1A 1AYM2 1R082 4IEWA 1IS5A 1NOVA 2D5FA 3TN91 1ZYBA 3MLKA 2HJIA 2C0ZA 1AJKA 1OPOA 2JE7A 3AB0A 4D7SA 4QX5A 5CNAA 3ES4A 3H1WA 3TN92 3N4MA 1XNBA 2JJ6A 4LUKA 2WL1A 1G7YA 2CWSA 2KA3A 2W68A 3JD71 1FPN3 4QM9A 3KCYA 3KLSA 1ZRFA 4GB33 1VR3A 5GLTA 4B8EA 2ZGNA 5T3NA 2R0HA 2PHDA 1H2LA 4JC1A 4CDQC 1A78A 1H1AA 3MZHA 1FMD1 1Y7BA 3RMYA 3JD72 5EXOA 3RI8A 4SBVA 3EJKA 1OA4A 4I09A 1G86A 2O8QA 2X5IA 2ZGRA 1JTZX 2ZGPA 1EY2A 3VV1A 2R071 2B42B 1GICA 2BQPA 1KJLA 3E5XA 1LHWA 3B9CA 2D3SA 4XFHA 1ZZ9A 1BCXA 1MEC2 3MI8A 4AQ2A 2BYVE 4E2QA 3WG2A 2HWB3 1BJQA 5H9RA 5T50A 1R1A1 2R072 2DCYA 4FP2A 4B29A 3OGJA 1I5ZA 5GM0A 4ISRA 1O3TA 1RJ7A 1ZM1A 3VBOB 3E6BA 3B00A 2WNVB 4OI1A 1V6IA 5BNPA 3PJQA 5CFDC 1R1A2 3SH5A 2KXLA 4I0AA 3ZN4A 1FOD1 2XB6C 3O12A 4OHWA 4FSJA 3RJRA 3ASIA 4WVZA 3VDDC 4PIYA 1BEV2 1DGRA 3WW2A 4JQRA 4J1XA 1TME1 4ATEA 4AEDA 4META 2DVGA 4D7TA 2BNNA 4PIZA 2RS51 1DZRA 4XETA 4C1XA 1BVVA 3K51A 2UY8A 1ZBE1 1O5UA 4IV3A 2RS12 4Y26A 4YM2A 1VRH3 4GIQA 4XFFA 4P9XA 1TME2 3OCPA 1VAMA 3SISA 1MACA 2QJVA 2GNTA 3O0WA 5AVAA 1EV11 5CG9A 4FTSA 2ZX3A 3ZYIB 3PMSA 1ZBE2 2DU1A 4CDUC 2WS91 3ILFA 3W58A 4HN1A 4C0BA 3NO8A 1NZCA 2WT2A 2PHRA 4CDQB 3NSTA 4DOUA 4AGGA 2JECA 2Z69A 1QKQA 1SFYA 1S0JA 5C4WC 3ALQA 2PHFA 1YFUA 2R062 4MH0E 3ZSEA 2GDFA 2V5YA 2WS92 3MYXA 5LK5A 2AH2A 3NWKA 5TSWA 1PK6A 2YGLA 1W6NA 1WW4A 1TMF3 5BXXA 1I6XA 2QUOA 2OA2A 4FQ4A 4GWMA 2RS33 1OLQA 4ISQA 3SH4A 1YRZA 2DFCA 1Q8VA 3RPQA 2Z79A 4I30A 4YARA 2DTWA 4JDNA 1YLLA 3KT7A 2DU0A 1DQ4A 3J4UH 5F9TA 2XL9A 4WM7A 4BMBA 1HXS1 4WVMA 1J1TA 4XPVA 1LECA 2E7AA 4MVTA 5CFDB 2X53S 1FX5A 2CY6A 3MIFA 3VZLA 2Y0IA 5FQ0A 4Y22A 4AEDB 1W6MA 1HXS2 1C5IA 2WWSA 5JZGC 3V0BA 2QQPA 5H9PA 2HWE1 2XLFA 1XE7A 4Q4W3 1WCDJ 3MF9A 3WDTA 4AVSA 2EIGA 5CU1A 4R4ZA 4YVWA 2D98A 2GC0A 5C8WA 1RUE3 4DRVA 2HWE2 1RMU3 5BPXA 3M3OA 3CJIA 4FO9A 5EZWA 2K0GA 2XUMA 4JRLA 3KSCA 3V64A 4OI4A 2MEV1 1D0GA 5IK7A 4KL1A 3WY6A 3I59A 3WDVA 2XJUA 3RYKA 4OVEA 3OYWA 3KD4A 5BUVA 2OIIA