5DUWA

Crystal structure of the human galectin-4 n-terminal carbohydrate recognition domain in complex with lactose-3'-sulfate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
b'PTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-4
molecule tags Sugar binding protein
source organism Homo sapiens
publication title Structural characterisation of human galectin-4 N-terminal carbohydrate recognition domain in complex with glycerol, lactose, 3'-sulfo-lactose, and 2'-fucosyllactose.
pubmed doi rcsb
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5duwA00
4JRAA 5EWSA 3A4UA 4BQ1A 2P3JA 2YV8A 2ZGUA 1FNYA 4XJUA 4YGEA 2D44A 3AP9A 4PQ9A 4Q8LA 1UZZA 2EAKA 2UWBA 1S0DA 4Y1XA 2VXRA 4DQAA 2WSVA 3O0VA 1QDOA 5DUUA 1W6NB 5CB7A 4XBNA 3N7KA 1YXWA 4XIOA 1N3OA 2R1DA 4U36A 3UL2A 2GNTA 4FPJA 2JE9A 2XG3A 4ATFA 2VU9A 1BKZA 3B9CA 1GZWA 3INAA 2W39A 5KXCA 1N1SA 5E88A 1SCRA 3B00A 5EYXA 5H9SA 1N3QA 1ULGA 4AGGA 1SBDA 1W0PA 3MPPG 4YFZA 3VV1A 1V6JA 4BM8A 3FLRA 2EXJA 3NV4A 4BMBA 4R9CA 4YW1A 5KXDA 1A3KA 2W52A 3MW2A 1UZYA 2FMDA 2ZAAA 3KM5A 2ZA9A 3AP7A 3POWA 4BOWA 1GZ9A 2GN3A 1DQ6A 1S0EA 2GNDA 2B7YA 2AR6A 1JOJA 2D7FA 1KJRA 1FATA 2ERFA 4UW3A 4YGBA 3WG4A 4AGRA 4YM1A 1AJOA 1JYIA 1VIWB 3M3EA 2JE7A 1DQ0A 3RG0A 5JDBA 3MEPA 2PHFA 3DGTA 1DBNA 2D3PA 2NMNA 3WUDA 4OZXA 2AUYA 4WV8A 2ZMNA 1NLSA 4FOQA 3I4IA 4XZPA 2D3RA 5DUWA 2NZ9A 3RQ0A 3APBA 1UPSA 1IS6A 1AVBA 3U4XA 1N47A 3LCPA 4R9DA 3RMYA 3RRDA 1RITA 5CAZA 2ZGMA 2EXHA 1G86A 1LOAA 2FHRA 5T5JA 3AZXA 2ZHKA 2E7QA 5SV8A 3H0OA 4DRVA 2ZZJA 3AXEA 3MW4A 4XJWA 4AVTA 2WT1A 3V0AB 1DYKA 3TB0A 5DUXA 3WOGA 1QOSA 1WBLA 3FUOA 3ZSKA 1S1AA 2DTYA 1SLCA 1LODA 1WLDA 3AYEA 1UKGA 1FYUA 5CA6A 1Q8VA 1W6QA 1D2SA 1ZA4A 4YGCA 2UU8A 1MZ5A 2ARBA 3ASIA 4DPNA 2EIGA 2AH2A 1QU0A 4XMAA 4HL0A 2CYFA 2YMZA 1HKDA 2ZACA 5LK5A 2JKBA 3IKWA 5HCBA 1DQ5A 2DVBA 3USUB 4TYSA 1FAYA 3M1HA 4ATEA 5JOXA 1LULA 1PZ8A 5GLTA 1MS3A 3WDUA 4XDQA 1HDKA 2NM1A 2UWCA 1JYCA 3AZWA 4FOWA 4XHBA 2DWRA 2WT2A 1MACA 3AJZA 2E7TA 4M01A 5DZFA 3WNXA 1VAMA 1X50A 5GALA 2ENRA 1LGCA 4AYUA 3UJQA 1R1ZA 1S0IA 4FPYA 4GA9A 1ENRA 2DU0A 1Q56A 2ES3A 3VUOA 1FV3A 2CWSA 4ISRA 3LSEA 3N36A 2OUJA 3IPVB 4K20A 4XE9A 5IUQA 3WDWA 1S0CA 3BODA 3ZXLA 2A3WA 2D6OX 1Z78A 1FX5A 1F31A 4XBQA 4YW3A 2CL2A 1Y7BA 2NYYA 1YRZA 3JUUA 2SBAA 4IQPA 2R1BA 3HN1A 1WBFA 3M2MA 3PVEA 2V73A 4YG0A 5DG2A 1MVQA 3IM0A 5IK8A 2DUQA 1A8DA 2WNEA 3JU9A 3BTAA 5L73A 4R9BA 3RS6A 2ZGNA 1YYNA 3WDXA 2ZGLA 3W58A 1V6LA 2P37A 2ZHLA 5CBLA 1LHVA 4YZ1A 5EYYA 5GLZA 1UN1A 2GNMA 2V5YA 5KXEA 2A6XA 1GNZA 4Z8BA 2WQZC 1CJPA 2GDFA 2ZGPA 1YO8A 4XTPA 2VY0A 2A3YA 4FPKA 5AVAA 1MVEA 1C4RA 1S0GA 3OY8B 1D0HA 2SLIA 5T5PA 4FPFA 2DVFA 1CPMA 3T1MA 2A6ZA 4M3CE 4YM0A 5T55A 5IK5A 1CPNA 2WJSA 1SLBA 4BPZA 2A7AA 4JC1A 3FLTA 1LEDA 1URXA 3I8TA 1QDCA 3NWKA 4LBKA 5H9QA 1UX6A 1CONA 5GLUA 4AVSA 3WVJA 2A6WA 2P3KA 2ZGKA 4Q2FA 3M3QA 1WCSA 3SNMA 2G4IA 3B3QE 4YLZA 1WUVA 1CIWA 2YY1A 3WDTA 1AX2A 4TZDA 1MZ6A 3MW3A 3IN9A 4LBMA 2AENA 4M3CF 3QCWA 3SH4A 3DUIA 1ONAA 2R49A 1AJKA 4AGVA 4JCKA 4P14A 4YM3A 1SBEA 1C1FA 1RIRA 3IPVA 1G9CA 2EALA 3R4SA 1JHNA 3AP6A 3POYA 4Y1YA 5HCAA 3WV6A 5T5LA 1YIFA 1LHWA 2UWAA 2YROA 1ENQA 2D43A 3VKFC 3ILRA 3AYCA 1QF3A 5GZGA 4DRRA 4FPCA 4Y22B 1IS4A 2JDZA 2A70A 3ZXJA 1QOOA 1RINA 1KRIA 4Y1ZA 1ZM1A 3A0KA 3N35A 1KQRA 3N3HA 4FVVA 1W0OA 3V64A 1G9FA 4Y24A 5GZCA 3R05A 1V6IA 2JD4A 5DXDA 2PHUA 4K1YA 4LBLA 1JN2P 2GMMA 2VW1A 3RSJA 5H9RA 3ILNA 2DVAA 1AXKA 5DG1A 1LOGA 2A3XA 2ZKNA 3WHTA 4SLIA 3ZXEA 4C1XA 5JOZA 4XJAA 2DURA 2LALA 1W6MB 1HLCA 1S0JA 3ZSMA 4AVVA 1BZWA 1N1TA 2DTWA 4Q1PA 4H55A 2DVDA 5DZEA 1G7YA 1GYKA 1QNWA 5DUVA 5GZDA 3TAYA 1DHKB 1LGNA 2WT0A 4CRQA 1V6OA 4YZ5A 4UW6A 3WCRA 1MS1A 1OQ1A 3VKLA 1DGLA 3AYAA 1J1TA 2I2SA 1UAIA 1LOFA 4Q26A 2EXIA 3R4UA 3ZYPA 1LECA 1WW4A 1LHOA 1SLAA 1W6NA 4PBPA 2A75A 2OUHA 4P9XA 3GNEA 2RHPA 4XJZA 4XBLA 2PHWA 5E8AA 2KM2A 5BYNA 4XXPA 3OYWB 1GKBA 1JUIA 1YI7A 1N1YA 4W65A 3AYDA 1GZCA 2TEPA 2DVGA 3D5OA 3POSA 4L8QA 5E89A 3WG2A 1GZWB 3SH5A 3N7MA 1WW6A 3FUQA 1Q8QA 4Y1UA 1LESA 2GMEA 1MS4A 1TEIA 4FPGA 1CN1A 5GZEA 5F9TA 1APNA 2DUOA 2D3SA 5DZGA 3VKMA 1MS0A 4Y20B 1AXZA 2H0BA 4ZXKA 1UMZA 4FOYA 1DQ1A 1LHUA 1VAVA 1ULEA 3AK0A 3OPZA 4FP2A 4Y20A 1W6OB 1WD3A 3V0BB 4Y22A 2D6KA 1ULCA 2D6PA 1LJ7A 1QOTA 1A78A 1W6OA 2E6VA 3M3OA 4GKXA 4XMIA 2VH9A 3V0BA 3C2UA 1DIWA 4Y1VA 4R9AA 5H9PA 4BMEA 3SITA 5FREA 1OFSA 1JW6A 2OVUA 5GZFA 1O4YA 2W68A 3FFZA 1S0FA 3AZZA 4GWMA 1DYPA 5IK7A 4K1ZA 4YZ4A 5FRAA 3VKNA 1KJLA 5JVVA 4M3CB 1DFQA 3UJOA 1W6QB 1N1VA 3AZVA 1G9BA 1GV9A 3OBRA 1IKPA 1O4ZA 1VLNA 2VW0A 3N7JA 4KBBA 3D4KA 2EF6A 1MS5A 1JXNA 4LBOA 1XQNA 1F9KA 2R0HA 1B09A 2P34A 2DU1A 1DQ2A 2JJ6A 3WDYA 1OKQA 3ZPYA 1GNHA 1LCLA 2AREA 1F5FA 3A0NA 3ATGA 1ULFA 1ENSA 3RMXA 2ZHNA 4YG6A 2A71A 2WLQA 4CZSA 1WLWA 2ZHMA 4XOGA 3UK9A 1G9AA 1IOAA 2NMOA 2Q5TA 4Q27A 1S0BA 2PHXA 3M3CA 1Q8OA 2D6LX 4Q8KA 2D6NA 3OYWA 1MS8A 1SLLA 5IK4A 3BOPA 2ZGOA 4RA0A 4ZKTB 3SH3A 4LBNA 3USUA 3OGGA 2ZABA 1LTEA 2A6YA 3T2TA 3PJQA 3ZSJA 3OJBA 2WKKA 3O0WA 4NOTA 3T1LA 2CY6A 4XJ9A 1SBFA 3ZXKA 2EXKA 3VKOA 4FPEA 1DQ4A 1QGLA 4MYEA 1G8WA 3WDVA 5GLWA 4AWDA 2E51A 2GNBA 2UURA 5T5OA 1G9DA 3QLQA 3WG1A 1I1EA 4ITCA 3WLUA 2DV9A 1LOFC 3B01A 4NO4A 1NXD1 1EPWA 1AX0A 3L2YA 2DYCA 1LEMA 4WZFA 5GM0A 1AZDA 1C1LA 4GWNA 1CESA 1CQ9A 3CNAA 1PZ7A 1QNYA 3PVNA 4P9WA 4PBOA 4RL7A 3ZXFA 5T50A 4C1WA 1FV2A 1GSLA 5JLVA 1QMJA 3PVOA 5GJ6A 3AXDA 3BIWE 4UW5A 1BXHA 2GN7A 3W59A 3OBTA 3O0XA 2A6VA 4M3CA 3V65A 1CR7A 2ZGRA 4BLIA 2E53A 3AX4A 2LTNA 3HR9A 2OW4A 2ZGTA 4LBQA 4U2AA 3SISA 1HQWA 5HCFA 5JOWA 2P3IA 3B69A 4HANA 4GKYA 4LBJA 2DUPA 3AP5A 1ULDA 3FLPA 4FOVA 3WCSA 4Y26A 4YZ3A 2HYKA 2VUAA 1Q8SA 2ZGQA 3V0AA 2NN8A 3AZYA 1DZQA 1QKQA 1WW7A 3NV1A 1V00A 1H9PA 4LBQD 3O5SA 4XIKA 4FQ4A 1Q8PA 3ZYRA 2JECA 2R0FA 4YGDA 4YZ2A 1VALA 4I30A 5JOYA 2PELA 4CTEA 3PMEA 3NV3A 2D6MA 1FNZA 1V6MA 1W6PA 4LBQB 3AFKA 1W6PB 4YM2A 1MR5A 2YXSA 4F83A 3AJYA 1GLHA 1WLCA 2CNAA 2CTVA 1LOCA 3SLIA 5EXOA 2P2KA 1IS3A 1N3PA 1SFYA 2ZMLA 1GANA 3D6EA 2ZMKA 2A5ZA 4Q1RA 3ENRA 3N7LA 4FPHA 1WW5A 2W08A 1HQLA 2YZ4A 4ASMB 5JMCA 4XILA 2BQPA 1UL9A 3FBYA 2C9AA 4FPLA 1H9WA 1I3HA 1W6MA 4XTMA 2PHTA 2ARXA 3Q9OA 4YG3A 5KXBA 4P9YA 2R16A 1KDKA 3GALA 1LU1A 3LSDA 4FPOB 1IS5A 4ISQA 3HMYA 5T52A 4DFSA 3IMNA 4PCRA 1V6KA 1JBCA 2CWMA 3ILFA 4YW4A 4K21A 1V6NA 1AX1A 2Z42A 4WVWA 4YW2A 5IT6A 1LOEA 3WHUA 1WD4A 5F5QA 1GBGA 3ZSLA 1H30A 2PHRA 1U0AA 4XXAA 2GALA 2WSUA 3NV2A 4M00A 3WG3A 1LENA 1LHNA 1LU2A 2XB6C 4GXLA 4DS0A 1SCSA 1LGBA 4YFWA 3OY8A 4YW5A 1SLTA 1GICA 4PF5A 3ZVXA 2ZBJA 4GALA 1SLIA 2C5DA 2GMPA 2AYHA 4D69A 1AF9A 2NP0A 5GLVA 1KDMA 4XHXA 1MS9A 2VW2A 4XYXA 5CNAA 1DLLA 1LOBA 1PZ9A 1C57A 4BLJA 1BYHA 2ZGSA 3WZ1A 3AP4A 3KQRA 5T54A 3O12A 1AXYA 1KITA 1IKQA 4FP3A 4WVVA 1Z0HA 4UW4A 4XJ8A 1CVNA 2AGSA 1BQPA 3WUCA 1SACA 4FQZA 1BJQA
chains in the Genus database with same CATH superfamily
1OXCA 2P4EA 4CU8A 1VB2A 1PO22 2PAKA 2WQ4A 2Q8EA 3K51A 2D44A 1O3TA 4PQ9A 2OA2A 1UZZA 3VBFC 1YFUA 3KVAA 4UOJA 4BDVB 4OHYA 3KWVA 1QDOA 5DUUA 4RR3B 5CB7A 1DZRA 4XBNA 3O1PA 3N7KA 2HWE1 1YXWA 1YQ2A 1N3OA 3OGJA 1WCQA 3IT8A 3UL2A 1KGYA 2GNTA 4HETA 1A8MA 1BBT1 2JE9A 1XNBA 2IC1A 3PUQA 4XF1A 3PIGA 1PK6C 4IETA 5D8AA 1GZWA 3INAA 2W39A 4O7XA 4IDZA 1N1SA 5KXCA 3B00A 4E4DX 1OQDA 4QMAA 5EYXA 1RYYA 1K12A 1QJU3 1N3QA 1IPJA 1ULGA 3E5UA 1SBDA 4IEYA 5FZIA 1VBA3 2W87A 3ZFGA 5F3GA 4R4XA 1JYXA 3ZN6B 2EXJA 3NV4A 1SEFA 2DF7A 3T4VA 4BMBA 2D5FA 1FI2A 3LQCA 5JI7A 2P3YA 3ZYFA 1UY1A 3I49A 3TN91 5KXDA 5F5CA 4BOWA 2Z4FA 1GZ9A 4ZHNA 1S0EA 2YU1A 3CJIA 3AVSA 2IWGB 1W05A 2GZWA 3NNFA 1GU3A 4QGNA 5FYHA 1BEV3 1O59A 1DGWX 4HSLA 1DQ0A 1Z7S1 5JDBA 2F17A 4Y3OA 3OPWA 4WM8B 2FDHA 3JBG3 5IFPA 4WV8A 4COZA 2ZMNA 1CJDA 1NLSA 5FBZA 4FOQA 4MG2A 5FZKA 2E32A 5BNNB 4RYDA 2VMEA 2O8OA 4IL7A 5JR7B 5C6CA 1O3QA 1NCQC 3ZM8A 3APBA 1UPSA 4CCMA 5A7QA 3R4DB 5A3TA 2BDRA 1BLZA 4K7JA 2EXHA 1EAH3 2ZEXA 4CUCA 5AFBA 5T5JA 3I3QA 3AZXA 2E7QA 2BWCA 2I45A 2QDRA 3FMGA 3H0OA 4IEVA 4XJWA 4CU9A 2W9XA 1U5ZA 4SBVA 1EP0A 1YWKA 3MLLA 1WBLA 4TWTA 2BFUL 2GC0A 4MX3A 1S1AA 4CA9A 1SLCA 3FC0A 1LODA 1WLDA 1UKGA 1FYUA 4KWKA 3HT1A 2QQOA 4LR4A 1F5JA 4YGCA 3BKZA 4AEDC 1ZRDA 1QY4A 3JB4C 5D8AB 4P9LA 1PO21 2JB8A 4I02A 4XMAA 2K0GA 4KGGA 2CYFA 2WFPA 2F4PA 1D4M3 2RS12 3IKWA 5F6KA 1CD3G 3USUB 3OEAA 4TYSA 3M1HA 1I6XA 2VZTA 5FZMA 4ATEA 4N9IA 1OUXA 5HV0A 1PZ8A 1X82A 4FFFA 5BNNA 4HONA 4CP9B 3WDUA 1HB3A 3P1IA 1HDKA 4FOWA 4OVEA 1JYCA 1TQ5A 1VBB3 3GZUC 4MHUA 5KWRA 4DO0A 2D93A 2WT2A 3AJZA 2BERA 2KXLA 5F2SA 1X50A 3VD9A 3UJQA 4MZUA 4FPYA 4S2DA 4DIQA 3HNMA 2DU0A 5FY5A 2QQUA 3T08A 4IV3C 1QJX3 5IUQA 2QKDA 4XE9A 1NA1C 1QXPA 3VBHB 2FBEA 1E5SA 1QQP1 1FT9A 3P3PA 1Z78A 1FX5A 2VZ1A 1F31A 3AL5A 4YW3A 5C3SA 4M0HA 1OLMA 1R083 1VRH1 2R062 2QNKA 3JUUA 2SBAA 4QPIB 4LJHA 2R1BA 5A3UA 2V73A 3AKRA 3P5BA 4YG0A 3MDPA 4CDWA 3IM0A 3ACLA 1RUI3 3NNMA 1J3RA 2WNEA 1A8DA 2WR9A 3JU9A 3BTAA 3S6PA 3KLSA 4N9HA 4Q5OA 2C4XA 4S2GA 4RGKA 1XJAA 5A32B 5C8CA 4XDPA 3BI3A 5C4WA 1QWRA 4CU7A 1QJY2 2FZ1A 3THPA 2A6XA 1GNZA 1BCXA 4Z8BA 5FPBA 1ZRCA 3SEPA 2ZGPA 4KG0A 2VNGA 1W8HA 1YEWA 2A3YA 5FMOS 5ACA2 1MVEA 2W0XA 5A1FA 1BEV2 1C4RA 4CEWB 3OY8B 2VZPA 1RUI1 5T5PA 2DVFA 1C8M1 4UAPA 3T1MA 1TE1B 4JRLA 4UWDA 4CCEA 2D97A 2WRAA 1NUKA 4Y33A 5FBJA 4AVAA 4COWA 1RVF1 3I8TA 2AEZA 3GDBA 4AFAA 2Y60A 5KHGA 1C5HA 5LA0A 3EYPA 3C7FA 3AMQA 5CYYA 4AVSA 5J98B 5FYSA 1CWPA 1J3QA 3ZDSA 2WA4A 2ZGKA 3M3QA 4N8MA 1WCSA 4XDOA 3THTA 2RR13 2YY1A 1DZTA 3WDTA 5K4LA 4TZDA 4M3CF 5FYCA 3QCWA 4AG4A 1ZRIA 4CYDA 1VMJA 2WLPA 1R092 3ELNA 1CZVA 2J1AA 1PVC3 1YIFA 5FIXA 2PMWB 4RHV2 4GD4A 2OPKA 2R30A 2EAAA 1K42A 2J1TA 1BMV1 2JICA 1GMMA 4CDWB 3AYCA 5LRSA 3IWZA 5FP8A 5L7OC 1QJX1 4FPCA 3KHCA 1H2LA 3VD7A 2ZEZA 1YNAA 2X05A 3ZXJA 2Y6LA 1RINA 4BH9A 1AL0G 3N35A 4FVVA 2XL9A 3E97A 4B3NA 5GZCA 4ARYA 2BVBA 3R05A 1AYM1 2GP3A 4QGMA 3DYOA 3J9SA 1D7PM 3KSCA 4IE0A 3VBUC 4QX2A 1JN2P 1PM7A 2FDFA 1OF3A 1IQAA 3ILNA 4KNCA 4R4ZA 2NQYA 1CAUA 2VZUA 4XFIA 2VBPA 5EPAA 3U75A 4UBHA 3NRUA 1OLME 4NPLA 3GHNA 1VBC2 5LY2A 2RMU1 5FXZA 1CAXA 4WM7B 2ID4A 1V6OA 3GBFA 2OQ7A 1OH3A 2YC2A 4YZ5A 4UW6A 3WCRA 1Y4WA 1JODA 3VKLA 1XNKA 2Q8OA 4CSWA 3AYAA 1J1TA 5JAXA 2I2SA 2PLV3 3ZFGC 2EXIA 4COVA 1J1LA 1LECA 1OOPB 4CDXC 1XOYA 1RUE1 1I5PA 1US2A 2OUHA 4QHBA 2Y6KA 4R8HA 1ZZ9A 3H3LA 4XJZA 1PK6A 4RGGA 5D8AC 2LM3A 4B7EA 5BYNA 1QIQA 3M4FA 4XXPA 3OYWB 3RYKA 1YI7A 4W65A 3ACGA 4YVWA 3H8UA 3UKVA 3PU3A 3MHZA 2WS92 5FP3A 3HIFA 4MGQA 1MEC3 2YPDA 3GCXA 5C3QA 4IEPA 3TN93 3FUQA 2JG8A 4CXWA 3VHNA 4Y1UA 1LESA 3C7GA 1TEIA 4FPGA 5F9TA 5DPNA 4N7UA 2DUOA 1VBA1 3VKMA 1AR92 1CAUB 2H0BA 1QJY3 3LA3A 1JUHA 2WN3A 4FOYA 1F8VA 1ULEA 1TMF1 4EYUA 1ULCA 4GKXA 1LJ7A 1QOTA 5A6XA 3WT3A 2VCBA 5L36A 3POFA 4AI3A 1QXJA 2BPA2 1UU5A 4R9AA 3DXTA 4QKBA 1W9WA 4WM8A 4BMEA 1UU6A 3GBWA 4MGSA 1OFSA 4P9GA 1BBT2 1OA2A 3VZKA 5L19A 2XJPA 4NIGA 3WD5A 4UBGA 3CKHA 1Y43B 1FPN3 4JQRA 1VJ2A 4UFMA 5FJKA 5BNPB 4NHMA 1KJLA 3I3BA 4M3CB 1GWMA 4GH4A 4OI0A 1YI9A 3VDAA 4QKFA 3OBRA 1HV0A 1O4ZA 2CDOA 4KBBA 4CEYC 1W9YA 5F3IA 1O3RA 3LGRA 2Y6GA 2R0HA 4JX0A 5FY8A 1KD7A 2DU1A 1GOHA 1JYTA 4Z92B 3ZPYA 1H1AA 5AC91 4WM8C 3NKTA 2YB7A 4G4FA 4LLOA 3RYPA 3ZMOA 1LRHA 4Q4Y2 4E27A 1Q3EA 1REFA 1RUH2 1UXZA 3EB7A 2XJTA 3QH6A 4IV3B 1G9AA 2JDNA 3JZVA 4OHZA 1ULPA 3AKSA 4YRDA 1OFNA 3M8LA 4GB32 2RS33 3OYWA 1MS8A 1SLLA 3P6BA 2ZGOA 2VCCA 4Q4V3 4RA0A 3PUHA 3RJRA 2YU2A 4QM8A 5FZDA 3CEWA 2VZQA 3ZIXA 4DY3A 3USUA 1NX9A 4JZRA 1J58A 1LTEA 2OKXA 4AAXA 3DPRB 3T2PA 4YARA 2IZWA 2BOJA 1GQPA 3T1LA 4XQDA 1W90A 4CUGA 1BVVA 4XFCA 3URFA 2WNOA 2RJLA 1OA4A 4FPEA 1DQ4A 1RUE3 4ZU4A 4MYEA 5LB6A 3W20A 1G8WA 5F32A 3WDVA 1LR5A 4AWDA 1DYOA 2E51A 2GNBA 2UURA 3JB8A 3P3NA 4GJYA 4IV1B 5T5OA 3TN92 3TWIA 5KHJA 4XW3A 3K4AA 3MUY1 3WG1A 4TTGA 2Q30A 3LEKA 2GC1A 2VZRA 3HQUA 5DDJ1 5FZAA 5FZGA 1FOD1 5JIAA 4COUA 4EWDA 1EV12 3AC0A 1UY4A 1AR73 1CESA 3NL1A 1H0BA 4P9WA 4PDWB 1EPZA 4MADA 1UOJA 5T50A 3I59A 4AQTA 1DLCA 4HG6B 1U12A 4I0WB 3K4ZA 2PYTA 2ORXA 1RUD2 5GJ6A 3U07A 3VHRA 3WF4A 2GN7A 3W59A 4Z2AA 1S4CA 5LBCA 4AEMA 3OBTA 4M3CA 2J42A 1CR7A 2GC2A 5J96B 1UOFA 3FFQA 2E53A 2QCSB 3AX4A 4U2AA 2ZGTA 4LBQA 3KS7A 2WO7A 3TOJA 3IB3A 3UV9A 3ZDVA 1JZ4A 1UY0A 3PTRB 5HCFA 3RZLA 1CAVB 2IXKA 4HANA 4LA3A 3FLPA 3AP5A 1WWYA 2IXLA 3J7LA 4FOVA 3WF3A 2UYAA 1UWWA 1WCUA 5IVFA 3MI8A 3PUSA 1AR83 3H42B 3ZR6A 2F6BA 2NN8A 3B9IA 2VVFA 1H9PA 2VQUA 2YG0A 4I0BA 3O5SA 4E4ZA 4XIKA 3T0BA 4F3JA 2QQMA 4FQ4A 3ZYRA 4GH4C 2JECA 2R0FA 1HN1A 4QQOA 1VALA 1XU1A 1RUF3 4I30A 1AR81 1K5MA 1C28A 1O5LA 1HJFA 1NYWA 4CEWA 3WNKA 3BCWA 5K7PA 1SDDB 2PAMA 2DCKA 3MYXA 4NPRA 5C8WA 4NROA 2YXSA 5FY7A 3AJYA 4IESA 1HRI2 4JKKA 2QQVA 1SQ4A 2WNVB 4PHZA 1L3JA 3VB9A 4PDWA 2P2KA 4CCNA 4QB2A 1N3PA 4NIIA 3ZYHA 1GANA 2A5ZA 2DCJA 3N7LA 2VOWA 5C9AA 2YZ4A 5JMCA 2HKXA 5FV3A 2Z79A 4XILA 5BUVA 4AHWA 3GGLA 3NAPA 1U5XA 2RS53 2RR12 4KWJA 3WQBA 5KR7A 3SCFA 3S57A 4KWLA 4NRQA 5FUPA 4Q4X2 3Q8EA 4J25A 1RHI2 5DDJ3 2IVJA 4YG3A 3LSDA 4FPOB 2YFZA 3KV6A 4HN1A 1V0AA 3UKNA 4DFSA 4E8DA 1LB2A 4PCRA 2CWMA 4AI0A 1PO13 1IG0A 1CX4A 1V6NA 2W94A 2X10A 4DNYA 5JXGA 3WHUA 1PGL1 5FPXA 1Y9MA 4FBFA 1H30A 2PHRA 3LF7A 4XXAA 3ZFFA 4ONUA 3NV2A 3SKJE 1K5MC 4GXLA 5E1RA 2V4VA 2IXIA 4YFWA 4AHXA 1NZIA 1JZ5A 3H7YA 3NW4A 4OQ8A 3LZZA 4XUPA 2CSGA 4OUSA 1OURA 2ZX3A 3VDCA 2Q1FA 4CPBA 3IDCB 5A33B 2O0OA 2P1BA 2R071 1OBNA 2CV6A 3SMHA 2VOTA 3I2GA 2DCYA 4D7YA 1HIXA 2NP0A 1KDMA 3H7JA 1UOGA 4JVAA 4XYXA 2ILMA 1PHMA 5A7PA 5CFDA 2ORZA 4HOOA 4EN0A 3UNPA 2D5HA 5LASA 5AC93 1QQP3 1H2MA 3KQRA 3O12A 2XBO2 4RHV1 2K9ZA 4HPKB 1Z0HA 3ZYBA 5FY9A 4LNVA 2ZX2A 3IDBB 1BMV2 1SACA 2Y8KA 4Q0PA 2XWBB 2G9GA 1BJQA 2XBO3 3MICA 4JRAA 5D1IA 3A4UA 2B45X 4J6GA 1XU2A 2YV8A 1FNYA 1JZ2A 2VGDA 3CMGA 2EAKA 2UWBA 1FPN1 2O8QA 4Y1XA 3O1TA 1GP6A 4L99A 2WSVA 3FHQA 3NAPB 2B4KA 2VAUA 5C3PA 3MV01 4Q0VA 1VR3A 3PDQA 3TEZA 1NG0A 5IAXA 2VZ3A 5IVVA 1COV3 1E5RA 3GXUA 4LIVA 3E6BA 1J83A 5JR2A 4AEDB 2RDQA 5E88A 1IG3A 4EWEA 1PO23 5H9SA 4AGGA 2Y6HA 1W0PA 4C90A 3RDIA 5FZ7A 1OF4A 4PT6A 3ZMNA 4EV0A 1V6JA 3FLRA 2ARCA 1UYZA 4AFBA 1NXMA 5HXMA 4R9CA 2IXHA 4EE2A 5EIYB 4QKNA 4YW1A 3S30A 1UZYA 3ZO0B 3KM5A 3POWA 2BZDA 3VBRA 2XMLA 3LOBA 4W6YA 5JZGB 5APAA 4CCKA 4AQ2A 1RMU3 1RTVA 1NLQA 2MEV3 3ORJA 3MUZ1 4PDWC 2VOVA 3HBZA 1VIWB 3M3EA 1ND3C 4MGZE 2JD9A 4QX8A 4EQVA 3MEPA 3NVCA 2B9VA 1DBNA 2D3PA 1XE8A 1RUC2 5BNPA 2ET1A 3SCHA 1UCXA 2IXCA 4Q4W3 4XCBA 2PLV1 1AR63 2HEVF 1HXS2 2W91A 5DUWA 4Q4W1 4W4ZA 2NZ9A 3RQ0A 3U4SA 3A7QA 5C3RA 3JBG1 4GB33 4Y4RA 1N47A 4QXCA 1Z7S3 5CAZA 2W1QA 2OQ6A 3K3NA 1UW8A 5EJ1B 1MQTA 5SV8A 4DRVA 2ZZJA 1ACCA 3AXEA 3MW4A 4YVSB 3E1F1 2XUEA 1CZSA 1ZNPA 3SXWA 1W9TA 3DKQA 3FUOA 3BB6A 5CVRA 2Y6JA 1UNBA 1YFYA 4FXGB 4PIZA 4CDUA 5CA6A 1W6QA 1D2SA 3D82A 3ZYJB 1KS5A 4J1WA 3K46A 3PMSA 1MZ5A 2ARBA 2V72A 4FTEA 1UIJA 2AEYA 4BQ2A 1PMJX 2ZEWA 2JG8C 4NUBA 4MOAA 2JG9C 3WF2A 5A3NA 5FZFA 4AVCA 5LK5A 1DQ5A 2DVBA 1FAYA 3VBSB 1YQ8A 5C9AC 5IFTA 1NA1B 2VVDA 1D0GA 1PIV2 5GLTA 3KGLA 5AC92 1H6XA 2J7MA 5FCCA 3POBA 5E6HA 1XYNA 1NT0A 3ZXAC 2XWJB 4XHBA 4B4RA 5C33A 4A6SA 1RUNA 5DZFA 2ENRA 3L9JT 1LGCA 3WNMA 4AYUA 4F8AA 1R1ZA 4DUXA 1QJX2 1ENRA 1VBC3 1IPSA 2OZ6A 2ES3A 5FKBA 5F3EA 4XQ4A 3UETA 2WNUA 3MIDA 3WDWA 3B7MA 3IPVB 4K20A 5F5AA 4EJRA 3W5MA 4DXRA 4FXKB 5C8CC 5K8SA 3VBHA 2DFCA 3JXSA 4I0AA 4OHXA 5D21A 4LE4A 5FZHA 1Y7BA 2F4LA 5DAVA 1TVGA 2BJSA 3AMPA 4IQPA 2VNVA 5FQ0B 2XONA 2CGPA 3J8F1 5I0UA 3BU0A 5LK7B 3MF9A 2R073 2VG9A 4A42A 5EFUA 2QZ2A 4BCUA 2DUQA 2WBKA 5FK8A 5J3UA 1ZVFA 2WZR3 1T6GC 1Y9GA 4UT5A 1SDWA 2W1WA 2ZGLA 3LKJA 4ET7A 1LHVA 1UOBA 4YZ1A 1NY72 1UN1A 1QJU2 1RXGA 3ZKYA 1RJ8A 5BNOC 3T4HB 1RHI1 1RMU2 3JQXA 1CJPA 2ZOEB 3OOXA 1GNYA 1YO8A 2VY0A 4EN9B 4JV4A 4CXYA 4FPKA 4QPIA 4QPYA 4GWIA 1OC1A 2JXAA 1S0GA 4JHTA 1D0HA 2SLIA 3LIGA 4FPFA 1OSGA 1CPMA 1OI6A 2WA3A 4M3CE 4YM0A 3N9QA 5T55A 5IK5A 2B9UA 2XJVA 1IHMA 1CZTA 3NO8A 1DDLA 3OPTA 1VRH3 4JC1A 4JDNA 5CU1A 5FLHA 1PNFA 2WL1A 1HRV3 1ASJ2 2YBKA 5FP4A 2WO2A 4PJYA 2FCTA 2RS51 5LA9A 4YW7A 4MHRA 4JTOA 1ODMA 2BWAA 1ND3B 2WFF1 3WVJA 2FDIA 4XFGA 1HB1A 3ES1A 4Q2FA 5IAVA 4EZHA 3SNMA 2XGXA 4MSVA 3WX5A 4YLZA 1CIWA 3Q8CA 5IJRA 4I3GA 4JKMA 4LOSA 2QQIA 3VD5A 2IUWA 1OKOA 1UY3A 3NNGA 3DYMA 2R49A 2WWJA 1H2NA 1AJKA 2K46A 4AGVA 4P14A 5FY0A 1B35C 1C1FA 3HT2A 3IPVA 1IQDC 2EALA 4NE9A 1JHNA 3UKTA 3TEWA 4Y1YA 5EHDA 5HCAA 2X8KA 5T5LA 3ZXDA 4UF0B 4W6WA 1LHWA 1RUD1 5D2AA 4YGBA 3VDDC 2YROA 2BV4A 5J1XA 3G6JB 1H4GA 2VNOA 3O7OA 4IGQA 5GZGA 4IEZA 3ZKUA 4OFGA 5GKAC 4Y22B 3WF0A 3O1OA 1IS4A 3X29B 4FO9A 5A6QA 3Q8BA 1XRUA 1H8TC 1VE0A 4QB6A 4EN6B 4Y1ZA 1ZM1A 5A1AA 3V64A 2JEMA 4XFBA 3N9LA 3RZZA 3H1WA 2V4AA 5J48A 1G9FA 1VMHA 2HWD2 2QE3A 1AHSA 2XQRA 3ABZA 1V6IA 4Y24A 3E6DA 2PHUA 5CFDB 1FOD2 2VW1A 3MLKA 3RYRA 1W2OA 5DG1A 1ND3A 2A3XA 4Y5SA 5FYVA 2VULA 1W6MB 4NWWA 1STMA 3VD3A 3DF0A 5FTTC 1BZWA 2DTWA 1W04A 5DZEA 5JMOA 1AR71 1RUG1 1ZZ8A 1DHKB 2WT0A 2WNUC 2XJQA 4LULA 4XAAA 4BE3A 1QJFA 5LEJA 4QU2A 1MS1A 1OQ1A 4KG8A 4OI4A 2QQPA 2QQNA 4Q26A 3WP5A 2VMDA 1OVSA 1SLAA 2A75A 3H50A 1OOPA 3WW2A 4P9XA 3GNEA 4KMQA 4ZY9A 1RXFA 2PHWA 1RUI2 4PIXA 2KM2A 1ND2C 4LPLA 3MIFA 1GKBA 4KWUA 4TLFA 1N1YA 4DUWA 1W8ZA 2HWF3 3AYDA 4JTNA 2TEPA 2BBVA 4JGZB 3POSA 1W8FA 5IVCA 1T6BX 4LXLA 3WG2A 1OPMA 4CUAA 3H3UA 3SH5A 2CGOA 3CZUA 4HSJA 1AYN2 2GMEA 4QGLA 1CN1A 2GH2A 2JE8A 3LDRA 1APNA 3KMHA 2ZCWA 4GJZA 1W06A 3S5AA 3CDZB 3THCA 4EROA 4AZZA 3AK0A 4QDQA 2FD8A 3V0BB 1HRI3 2JDKA 2BOIA 4Y22A 1QJZA 2D6KA 2D6PA 1W8OA 1NCRC 1A78A 1BBT3 1RUF2 3M3OA 4XZUG 5CIRA 4N7IA 5HPOA 1JZ3A 4CDWC 2XJUA 1DU3D 1DGRA 1DIWA 3AL6A 4Y1VA 1IZ3A 2IVIB 3TNQA 1ZRFA 3TEYA 5FREA 3U37A 4LO4B 5GZFA 1COV2 2YC4A 4Y5Z0 3I2HA 4RS5B 4L92A 1GP5A 2JB4A 2VQAA 3RJ2X 1AR93 1ZBA3 4K1ZA 4YZ4A 5FRAA 4CP9A 3VKNA 5JVVA 3OF1A 3K3OA 3IIIA 4IEQA 3AZVA 3ST7A 1O3SA 4B1LA 4FAHA 3CU7A 2N7GA 3O14A 1MS5A 4LBOA 1F9KA 2JKXA 2VZVA 5L9BA 1OKQA 5CFCB 2CU5A 3PU8A 2AREA 2TNFA 5F37A 1ZBE2 1NQJA 4CCJA 4YNIA 1TMF3 2ZHNA 4QHZA 4XAEA 4CZSA 1F4AA 5FOBB 4CDUB 4XOGA 1IOAA 4Q27A 5CKMA 5ACA1 4P9JA 1JZ8A 5A6YA 3M3CA 1AR72 5J37A 2D6LX 2D6NA 4CP1A 3BYWA 5FO8B 3I2FA 3BTYA 2YYOA 3BOPA 4Q4W2 2HEWF 3CF6E 1DF0A 3SH3A 1Q43A 5FYIA 1XSRA 3WNLA 2A6YA 4JGYC 4QPGA 1RVF2 3ZSJA 2BGPA 2E63A 1RUE2 2WO3A 3GM8A 4HLTA 3EBRA 2CY6A 2B39A 4NOTA 5I0TA 3ZXKA 4MH0E 1O91A 2HWF2 4HFSA 2PXJA 4HVRA 1QGLA 5JSPA 3OD4A 2CDPA 2HLEA 5LY1A 3GZAA 5I91A 5GLWA 3PL0A 2LUWA 3LIHA 4META 4X8PA 2WYSA 2CHHA 3OTFA 3GF6A 3B01A 2ET7A 4NO4A 1EPWA 2UYBA 2K2SA 1LEMA 1AYN1 1WCKA 4WZFA 5CFCA 1C1LA 4GWNA 4RL7A 3SEEA 3CNAA 4HK8A 1QNYA 3ZXFA 3ZPOA 3DPRA 1F15A 2I07B 1BXHA 1QEXA 3AM2A 3RPQA 1J3PA 2TUNA 1XE0A 4N43C 1GOFA 5KBFA 2WDBA 3RNSA 4NJ4A 1TME1 4BLIA 2LTNA 4JKLA 2OW4A 1Y9QA 2WQ8A 1H8TB 2JWPA 3BPSA 2VNRA 3KT1A 3POEA 4X6RB 5F2WA 4A7KA 5FDBA 1HQWA 4NRMA 1GWKA 4XC9A 2V09A 3RZJA 5JOWA 2P3IA 4LBJA 1MQTC 1ZREA 4H3WA 3VBOC 4Y26A 1UPIA 4N43A 4M4RA 5FYBA 2B8MA 2VUAA 4BQWA 2RS52 2R043 1Q8SA 4V2VA 4QXBA 5A7NA 5LA1A 3AZYA 4NIAA 1DZQA 1WW7A 4QHOA 2VMCA 3NV1A 4LBQD 4KH9A 3A21A 1Q8PA 2OZJA 3N9PA 4E9KA 3W21A 1POV1 4YZ2A 1PVXA 5JOYA 1REEA 3ALQA 3IMMA 1BVP1 2WUHA 2PELA 3RZMA 4QX5A 3S5QA 3CO2A 3NV3A 1W6PA 4LBQB 2WAAA 2X5IC 4C0BA 3AFKA 5FZ3A 2EIEA 1GLHA 1UYYA 1WLCA 2CTVA 1LOCA 2E9QA 5EXOA 3T30A 1Q5OA 2OT7A 3UESA 4PIYA 2Y34A 3ENRA 1C8NA 1PVC2 1WW5A 2W08A 4YWAA 1SHWB 1NCRB 5FMOL 2C0ZA 5IVEA 4M0NA 3FBYA 3LD8A 4QAWA 3I2DA 3PTYA 1W0NA 1POV3 5LZ6A 2YFUA 1SFNA 4IEXA 2JDYA 4K9SA 4O9GA 2FMYA 1RVF3 2JIJA 3Q9OA 5IVBA 5KXBA 2G9ZA 1X7NA 2R16A 1KDKA 1LU1A 3MFAA 4NRPA 1IS5A 4DINB 5T52A 5FZ0A 4XACA 4Q29A 1LOEA 2HWB3 5FMCA 5IT6A 5F5QA 2Z5WA 1PIV3 3KHBA 4QX3A 5F39A 1A6CA 4MVTA 3OUJA 4M00A 3WG3A 3BTXA 4GULA 1H8TA 4DS0A 2X29A 4B29A 4LQRA 4CDXA 2C24A 4QQPA 3IAPA 1ZBE1 3DL3A 5LA2A 4GZ9A 1SLTA 1W8WA 2Y33A 4MGTA 2HYXA 3KCCA 2ZBJA 2OYZA 4UFHA 4RS5C 4EN8B 2R32A 4ZU7A 2VMGA 5IYYA 2WC2A 2WWSA 5FO7B 1SPPB 5GLVA 3CJXA 3IDAA 1UIKA 3OB8A 4S2FA 1J84A 1R091 4KU7A 5CNAA 4TLGA 1C57A 1HQNA 1Y3TA 4WBBA 4BLJA 1XNDA 5J09A 2VM9A 2XUMA 1AXYA 1KITA 1VBE2 3N9MA 3VBUA 4FP3A 1H1MA 4XCAA 4XJ8A 1WCDJ 2MEV1 1BQPA 2YHJA 3WUCA 1V9U3 1VBE3 1NE6A 5EWSA 3AB0A 4GMP0 3U10A 4YGEA 2ZGUA 4QQHA 5DQ0A 1W3VA 1S2KA 2W3JA 3AP9A 4Q8LA 1VPHA 4LA2A 2VXRA 2XOMA 1J59A 4LHNA 3EQEA 3JD73 5FYYA 2E33A 1GZTA 4NR1A 4LLFA 4AI9A 4RFRB 4XIOA 3EO6A 5BNNC 2R1DA 3OBAA 4U36A 4FPJA 4HPKA 1D4M1 2XG3A 1L7RA 5EQUA 1EY2A 3B9CA 4OUMA 1JZ6A 5LBBA 2P17A 4LT5A 4QPGC 2ETEA 1ULOA 1KFXL 2W95A 3MFCA 1QHDA 3VV1A 1SPPA 4MUVA 2XLGA 4BM8A 1NLRA 2VQTA 1ZZ7A 3ZX7A 3WW4A 2EICA 2WZPP 3VBOB 1A3KA 2BP6A 3LOIA 4LKEA 5T3NA 2ZA9A 3AP7A 3DECA 3U1XA 1DQ6A 2HH9A 3WR0A 2ERFA 2RG4A 4AGRA 4YM1A 2LROA 4A2UA 3J8F2 2J1UA 3LEMA 4O61A 3FL7A 4RHV3 3VBSC 3RG0A 4A6OA 4AK3A 1RUH1 4ASKA 4KU8A 3AVRA 2PHFA 3OG2A 4EN7B 3WUDA 2BU9A 1RC6A 2AUYA 4CEWC 2KR2A 1GQGA 3I4IA 1P8JA 3PHMA 2WZEA 3GJAA 1F35A 1AL21 5ABJB 1NCQA 3CBNA 3OGVA 3BN6A 3R0RA 1WA4A 1XYOA 1PMIA 4CE8A 4V1PA 5FUNA 3QACA 1IS6A 5HV4A 4GAZA 1BHGA 4R9DA 3S7IA 3IDEA 1W39A 1GWLA 1QH7A 1ZBE3 5I0RA 1BEV1 1LOAA 2FHRA 2XHKA 3ETPA 5FYMA 2HWB2 4RD7A 2HWF1 3MIHA 2O1QA 2VUJA 2ZXQA 5C7GA 5JPMB 1UU4A 3V0AB 4AVTA 5C5TA 1DYKA 5A70A 1RUJ3 3CJIC 5K9YA 5DUXA 3WOGA 2Q8DA 5FPUA 1US3A 3ON7A 4WVZA 4Z82A 2DTYA 2VTXJ 3AYEA 2ZAHA 4HK9A 1T2XA 3MIBA 2VQ0A 4QT6A 1ZZ6A 3ASIA 4UYBA 1CAVA 2IFWA 3HNYM 1JYWA 4NIHA 1SMVA 2AH2A 1QU0A 5CFCC 4HL0A 3PURA 4QDSA 1GOGA 4RQPA 5FPAA 4BQYA 4Q4V2 1CAWB 2JKBA 1MQTB 2ZS6B 4MXWA 3VZOA 5JOXA 3K4DA 1RUG2 2KA3A 1VBD1 1GFF2 1LULA 3ACFA 2QQWA 3C7OA 4RFT0 4ZXEA 5C3OA 1MS3A 2C6SA 3NJYA 3POJA 4AE2A 2ZPXA 1JU4A 1K5MB 1PO12 4AVBA 2UWCA 2QDNA 2Y26A 5G04L 5FFOC 5I8SA 3PNAA 2L9LA 2DWRA 4ZONA 3TNPB 2E7TA 4KI5M 4AEJA 3U78A 1VAMA 3C7HA 5BV6A 4Z2WA 4GA9A 2WNVA 4UI9L 4AFDA 1Q56A 4O65A 1FV3A 3I7DA 4LMFA 4ISRA 3DN7A 3LSEA 2HJIA 2OUJA 3N36A 5FYZA 1PGL2 3BALA 3BODA 4BXFA 4QXHA 1YFXA 2CL2A 4AAPA 4JAAA 2WN2A 1KS4A 4LUKA 1UYPA 3KF5A 3KT7A 3POGA 2RM23 3IIAA 1EUUA 1HJGA 1WBFA 3HN1A 3M2MA 4QQLA 4RGAA 5DG2A 4FAGA 1RUOA 1PGW1 3ZFEA 3ACIA 3WW1A 3E5QA 3KCYA 1YLLA 2BNNA 2XDVA 1FPN2 4B4QA 4FSJA 5L73A 5BNQA 4NHKA 4C0HA 4R9BA 4P00B 1ZZBA 1YYNA 3W58A 1V6LA 2AC1A 2P37A 2ZHLA 3PVBB 4XUOA 4NIDA 5EYYA 5GLZA 1PX4A 2JDHA 4XQWA 5F5IA 2GNMA 3DPRC 4IV3A 5CKNA 2WIIB 3LDBA 5FZOB 3ROUA 5KXEA 3O1UA 2R6QA 3GBGA 4CCLA 4OHWA 4AEKA 1OMIA 3VDBA 3NNJA 2W1UA 3VDDA 5FZLA 1W8UA 5CEHA 2MEV2 5EJZB 1WZXA 4AHZA 4TN7A 2VBDA 4NPMA 5F7UA 4FT8A 4J1XA 5FY4A 5LW9A 2A6ZA 4IV1C 3W5NA 2E26A 5B4XA 3RWNA 3CZJA 3H3ZA 1NQDA 4CP2A 5A33A 1SLBA 4OQ9A 4BPZA 2A7AA 4BB3A 3POIA 1NCRA 1URXA 2VCAA 1S55A 4DEVA 4LBKA 5H9QA 3ZLIA 2VTFA 5JSRA 1UX6A 5A3PA 5GLUA 4JGYA 1JOPA 3IZOA 2QQKA 1RHI3 1ZA7A 4IXLA 4PI2A 4RR3A 1VBA2 2G4IA 4BQ3A 1Z7S2 3OUIA 1G6NA 1AX2A 1MZ6A 3IN9A 2AENA 4Q4Y3 3DUIA 4RN5A 4LO7A 5FZCA 1ONAA 5DDJ2 4LO5B 1ZX5A 1SBEA 2D98A 4ZPIA 2HWC2 4ES9A 3HNBM 4CDQC 2RM21 4OMCA 1VBD3 5LBFA 4DXSA 4RSUA 5FOJB 2UWAA 1OVPA 2V5DA 4Y4YA 1OOPC 4PLNA 4CDXB 1H2KA 3VKFC 1A34A 4UFLA 4OI2A 5KHKA 3O1RA 4DRRA 4R52A 2QTWB 3FHIB 3CJIB 4IE4A 5L7OA 2JDZA 2HWD3 2A70A 5KC6A 1QOOA 1V9U2 4IERA 4URTA 2J22A 1O4TA 1VB4A 4S2HA 3LFIA 1KQRA 1RUC1 1W0OA 4OLLA 3ZXGA 2YPJA 1YHFA 4PLMA 1KEXA 2PLV2 5FPZA 1RUJ1 4K1YA 4AQSA 2GMMA 4BHPA 2PA7A 4YYOA 4YPJA 3RSJA 3J7MA 4L11A 2DVAA 1AXKA 1LOGA 2ZKNA 5IW0A 3ZXEA 2YGLA 4SLIA 5FWEA 2ZZQA 4XJAA 5HI0A 4A45A 3VBRB 3WQ1A 2PQQA 1HLCA 2HBTA 4ARXA 1S0JA 3ZSMA 1AR82 4AVVA 1N1TA 4Q1PA 2DVDA 2R7EB 3RGBA 3D8CA 5GZDA 3TAYA 4JDMA 2QQJA 4LIUA 2JG9B 2WZR2 1JYVA 4GMP1 3FWEA 3HQXA 1QJY1 2OX0A 2BNOA 2DBIA 5C9AB 1PNGA 2YC0A 5J36A 2CAVA 3ZYPA 3I3MA 5J7MA 1WW4A 1LHOA 2FDGA 2W2IA 1OUSA 2CGNA 1H6YA 2RHPA 2RVAA 4P5HA 4XBLA 5FZ9A 5I8YA 4QPWA 2VXJA 5A3WA 3VD4A 1WKYA 4MGYE 4OCTA 3MIEA 1JUIA 1GZCA 2DVGA 2RV9A 4B4PA 3N4MA 1QQP2 3H1YA 4HT1T 4RQPC 1WW6A 3H1MA 5FKCA 1W3XA 1Q8QA 2R061 1GQHA 2A1XA 4X6QB 3FHAA 1EV11 4I09A 1MS4A 5GZEA 2DCTA 5A1LA 3O1VA 2QJVA 1YQ5A 5DZGA 3G7DA 1L7QA 5FZ4A 4Y20B 3LFMA 4ZXKA 2JX9A 1UMZA 2ZKLA 1LHUA 2LW8A 2H6CA 3OPZA 1XC6A 1W6OB 3D0SA 4WM7C 2E6VA 3V0BA 4BQXA 1OT5A 2VH9A 1RUH3 2W92A 2XKPA 5H9PA 1HRV2 4DY5A 4HVOA 1JW6A 3JD71 1RMU1 3LEIA 4YVSA 4NN0A 1O4YA 2R072 5LRRA 3C7EA 1S0FA 4AFCA 3AZZA 4GWMA 2FDJA 1DYPA 3RI9A 3LDKA 2XLFA 2ZX4A 3QD6A 4RS5A 5LWBA 1AYM3 1W28A 4L2NA 4CU6A 1DFQA 1WMFA 2WNVC 1W6QB 3UJOA 1N1VA 5FLJA 1UMHA 4QX0A 1IKPA 2VW0A 5C4WC 3D4KA 4AXOA 1JXNA 5ERLA 1XQNA 1YQ6A 2WWUA 2GSYA 2P34A 3WDYA 3N9NA 4EWAA 1HW5A 1SG3A 3ME2A 1ODNA 4QX7A 1GNHA 1NKGA 1LCLA 3VN4A 4NWVA 2VC9A 1F5FA 1OPOA 4D6RA 4IEUA 3VBSA 1SZBA 2WNUB 1X36A 4N53A 4Y5TA 4PLOA 1ENSA 3DYPA 3ZIWA 1W9FA 3RMXA 3NJXA 4YG6A 1TNFA 2A71A 4PF1A 3ZN6A 1DGRN 1UYXA 2WLQA 1WLWA 3HBKA 2LS6A 3O1SA 3UK9A 4F7ZA 1PVC1 5FPLA 3WW3A 2Q5TA 1FMD1 2B42B 2QFEA 3PLQA 4FFGA 3I3EA 3GZTB 4DB5A 4Q8KA 2XR4A 3FBMA 1AL22 4ZKTB 5BY5A 2X09A 4AEDA 1MPXA 1HXS3 2W1SA 5JZGC 4Q4X1 5A3OA 4LBNA 5KHIA 1CAWA 1VBE1 4MXWB 4BA6A 2ZABA 3AFGA 2J1EA 3T2TA 1CGPA 2H0VA 4XPVA 3PJQA 3L2HA 3OJBA 3O0WA 1X8EA 5E16A 5IATA 4IGPA 4QD2A 5FXWA 3VKOA 2WYFA 3SCGA 1R093 2X5IB 5BPXA 4BQ5A 4LHKA 3OEBA 4OI1A 2HEYF 4K8FA 4AOCA 3VL9A 3QLQA 4XF0A 1I1EA 1CX1A 4QWNA 3WLUA 1JTZX 1LOFC 2DV9A 1JU3A 4KQ7A 1E57A 1AX0A 2DYCA 1AZDA 3VZNA 2EVXA 4WZCA 3FJSA 3HPNA 5JLVA 3HAGA 3I3DA 2FZ2A 3ITQA 5KC5A 1GSLA 3JCIA 1I9RA 3AXDA 3BIWE 1OQEA 2EA7A 3T0AA 2A6VA 3EXUA 4YVSC 2TBVA 4D6QA 2IFRA 4LKSA 4ZS3A 4DUVA 1PIV1 2ZGRA 1O5UA 5FXVA 3HR9A 2WZR1 3A22A 4D7SA 4QM9A 1RUC3 3M70A 5FJHA 4Q0SA 3WNOA 1K5JA 3B69A 2DUPA 3WCSA 1ULDA 3J8F3 3KD4A 5DABA 1AYM2 2EIBA 2HYKA 3FN9A 3BOWA 2PTMA 3DCQA 1PX3A 1C3HA 1QKQA 1V00A 2YBSA 3MGUA 1MEC2 3NMBA 4TSVA 4XVHA 2ARAA 5IVJA 4OULA 1LNSA 1U5YA 1VBC1 2VTXA 3KV9A 3PMEA 3TBDA 2D6MA 1FNZA 1JZ7A 4W8JA 1VRH2 2ZX0A 3ETQA 1W6PB 4QKDA 3THDA 3WEZA 4COYA 4F83A 4XABA 1TME3 2RM22 4BU2A 4K6BA 4MXVA 1EYBA 3Q8FA 5SV5A 3E6CC 3D6EA 4FPHA 1O6UA 4JGYB 1FMD2 1POV0 2BQPA 2XJSA 4IE6A 1H4HA 1RUF1 2RDSA 4YSFA 4FPLA 3GZEA 3T2OA 1W6MA 1AYN3 1PK6B 4NHLA 5B2GB 1MZFA 1WMXA 2PHTA 2VJXA 3K2OA 3OUHA 4XETA 2ARXA 3I2KA 2OIIA 2XVKA 4P9YA 3ZN4A 4BIFA 3TRSB 2VMFA 3I97A 4MO3M 1YFWA 3RWKX 4C91A 4TXWA 4CCDA 4BWOA 3WSOA 1UX7A 2JDAA 4YW4A 5C8CB 3U0ZA 4KL1A 4K21A 2Z42A 4WVWA 4YW2A 5EP9A 5C4WB 4L0PA 1WD4A 1XB9A 1ND2A 4LO8A 1GBGA 4IGOA 4XF3A 3ZSLA 1AR62 3DXUA 2BVVA 1DGWA 2GALA 2WSUA 1LENA 1LHNA 5BNOB 5L9RA 1SCSA 4Q4X3 1LGBA 1HXS1 1EAH1 4INDA 3MO4A 1L7LA 2Y0IA 3A23A 3DV8A 3OY8A 4YW5A 3MZHA 4IEOA 1LAJA 4JGZA 1DG6A 1TNRA 4PF5A 1VRBA 1FOD3 2P5BA 4I01A 2QUOA 2BRTA 2GMPA 2C5DA 2IXJA 4D69A 3ACHA 1R64A 5DN2A 4AI1A 1UY2A 2XL7A 4XHXA 2VW2A 5HBAA 4BJ0A 1DLLA 1LOBA 1OA3A 2J1VA 1F4HA 3D3AA 1BYHA 4A41A 4AHYA 3I54A 3ZR5A 5CKQA 3OGRA 1IKQA 2AZ5A 4WVVA 3IBMA 4HBNA 3VBUB 1CVNA 1UF2C 2AGSA 3F95A 1HB2A 4ES8A 4FQZA 1JOBA 1IPKA 2Y64A 3KF3A 2P3JA 1XNAA 3OSDA 4XJUA 4BQ1A 1YJLA 1AR91 2VVEA 2E31A 1S0DA 4DQAA 3S0MA 3AMMA 3O0VA 1XXNA 2VPVA 5L9VA 1HX6A 4AR2A 1W6NB 4K40A 1W9SA 3ZFFC 5FR3A 1VBB2 1QJU1 1EUTA 2WABA 4D6SA 3WINE 3WP6A 3VHOA 5DAQA 4ATFA 2VU9A 1BKZA 1COV1 4LKDA 1CAXB 1SCRA 2LRPA 3WQ0A 1JH5A 2DDUA 3VZLA 5FO9B 1YUDA 5JUVA 3C8XA 3MPPG 3NNLA 4YFZA 4GIQA 3LEGA 4UF0A 1W2AX 3HN3A 3ZYGA 2HWC1 4LEJA 2BGOA 1EV13 2C1FA 4JQTA 4RR3C 4XFFA 2R063 2VZOA 3UGHA 1ZBA1 2W52A 3MW2A 1HN0A 2FMDA 2ZAAA 3B94A 1BK0A 3QBQA 3VBOA 1W2TA 2GN3A 4FTBA 2GNDA 3QH7A 2B7YA 1JOJA 2JIGA 2AR6A 1KJRA 1KXGA 1FATA 2D7FA 4PQQA 4UW3A 2XH6A 3WG4A 3WQ7A 3ZFEC 2VMIA 4B1MA 1AJOA 1JYIA 3KVBA 1XE7A 2JE7A 4BQ4A 2EIDA 1PGSA 3J4UH 5CFDC 1ALYA 3HOBA 4BK4A 4Z1VA 4E2SA 3DGTA 2NMNA 2JG8B 4OZXA 5F6LB 5KHHA 4AQ6A 3AMNA 4QPIC 4CEYA 1X9PA 5FP7A 4XZPA 3ZSEA 4XUQA 2WINB 1ZRRA 2D3RA 3Q8AA 4NAOA 1KFUL 1W8TA 4FFIA 5ANQA 3U4XA 1AVBA 1K3IA 1RUG3 2C26A 4YVWB 4DZGA 3LCPA 4DXZA 5BNPC 3RMYA 3RRDA 1RITA 4OZOA 2ZGMA 4NHYA 1G86A 3VL8A 4ASLA 3B93A 2YGMA 2ZHKA 5FZEA 1X8MA 4L97A 3QOPA 4CDQA 1LKNA 1ASJ3 3LA2A 2WT1A 2BGCA 2Q8CA 2VMHA 5IVYA 3TB0A 3UYJA 3ZN5A 3FE5A 3K75B 3PJYA 3U11A 1QOSA 3BIEA 1WMDA 3ZSKA 3HEIA 2HWC3 1XSQA 1NCQB 1Q8VA 4GH4B 1ZA4A 5DAWA 1RB8G 2UU8A 2XLAA 4P02B 4DPNA 1NE4A 2G19A 3LE0A 2EIGA 1NOVA 2PAEA 2WAOA 2BEOA 1K45A 3DKWA 2YMZA 2UY8A 5JIUA 3WNNA 4C8DA 3T3YA 1HKDA 2I74A 2ZACA 5K0UC 5HCBA 1NZCA 1OLRA 3UT0A 2DBNA 1CIYA 1WA6X 1RL3A 3ZOIA 3ECQA 5FZ8A 2HBUA 2HWE2 1EAH2 3RFRA 2RS13 4BYYA 4QQ2A 4XDQA 2NM1A 3AZWA 1UKRA 4HZFA 3WF1A 4AW7A 5C71A 1MACA 4M01A 4H7LA 3WNXA 4L9BA 5GALA 2VECA 4FCAA 3KZ4C 4DEQA 4LHSA 3CL1A 3BTZA 4N43B 1S0IA 4IUGA 3RZGA 1GP4A 2YUEA 1W99A 3VUOA 2CAUA 2CWSA 2J1SA 5DMYA 2GU9A 3BUCA 3OD0A 4LKFA 1S0CA 2RDRA 5BXXA 3JD72 4B7KA 3ZXLA 1WGPA 2PHLA 4A4AA 2A3WA 2D6OX 4XBQA 4O9EA 1WLTA 4QDRA 4HKLA 1D2QA 2XXZA 5ANNA 4ZU5A 2NYYA 5F3CA 1YRZA 1RUD3 1O7FA 5AFEA 4Z07A 3PVEA 2XKOA 2Y0OA 4OUEA 1MVQA 3HD8B 1W2NA 2PQSA 2VUCA 3BPZA 5IK8A 2QVSB 2GP5A 5FY1A 3ZFEB 3M7AA 2JDPA 3RS6A 1OH4A 2ZGNA 2G9FA 3WDXA 5C5UA 4CDQB 4B8EA 1OHFA 5CBLA 2RR11 5LCWL 5FAXA 3NJZA 1W8NA 2V5YA 3T2QA 2WFF3 5G05L 2WQZC 2GDFA 3LWCA 5TSWA 4XTPA 5A3MA 5AVAA 4AL9A 1AUYA 2FDKA 2WZ8A 3VDDB 5A3LA 1U5IA 4YVWC 3SHRA 1ST8A 1TME2 3M3IA 3O1MA 4QXKA 1CPNA 1UMIA 2GH8A 2WJSA 4IE5A 3IAQA 4QPGB 3VZJA 4UFIA 1C8M3 3FLTA 3H9AA 5AVPA 4E2QA 1UZ0A 1LEDA 2WS91 4LK6A 1C5IA 1QDCA 3JQWA 3MIGA 3NWKA 1D4VB 3VBRC 1CONA 1H8VA 2A6WA 2P3KA 4D0QA 1IGOA 3NAPC 1D4M2 3B3QE 1RGSA 1WUVA 4E4SA 2MNGA 3MW3A 4JHZA 4LBMA 4Q4V1 3BGAA 3LPFA 1VP6A 1YC61 3SH4A 4LTAA 2ZEYA 1PMHX 2VO5A 1VBD2 4HN0A 4JCKA 5K0UB 2UY9A 4P5YA 4YM3A 1RIRA 4LOTA 1G9CA 3R4SA 3AP6A 3POYA 5C70A 5F8PA 1XNTA 3WV6A 4A3XA 5A7WA 3AKQA 1R081 5HCHA 5ABJC 1QJEA 5JSOA 3S7EA 1ENQA 2VL4A 2D43A 4CP0A 2RDNA 2YBPA 3ILRA 1QF3A 3KV4A 3OBZA 2Q4SA 4G9SB 5DAPA 1R1A3 4E2GA 4N90A 1UZVA 1E5HA 5FWJA 4XFHA 4D94A 1KRIA 4MLOA 3A0KA 2QQLA 2Z69A 3N3HA 2A73B 4CRQA 1XNCA 4E4HA 2JD4A 5DXDA 3VBFB 5FZ6A 1VBB1 2D40A 4LBLA 3VHPA 5JXJA 3NKGA 5H9RA 3ZYIB 2XVGA 3WHTA 3VLBB 4UXAA 4LHLA 1PGW2 3MPBA 4P9IA 1ZZCA 4C1XA 2DURA 2LALA 2PN5A 5JOZA 2ADEA 2VOKA 4LORA 2R042 1VAKA 1TZOA 4H55A 4E8CA 4WM7A 1G7YA 1GYKA 1QNWA 4HKOA 4NHXA 5DUVA 5FMBA 1LGNA 1QXRA 4G3YC 4GB31 3TEXA 4HXCA 1NY71 5M0TA 3I2IA 4H7MA 1DGLA 1AL23 4ZZ8A 2YDEA 1UAIA 2E7AA 1LOFA 4KGQA 2OXBA 3R4UA 1HV1A 3BU7A 3CHXA 3UGFA 4FTSA 1W6NA 2ATFA 4PBPA 1PM4A 5IWFA 3EJKA 3CLPA 5ABJA 5ISLA 5E8AA 2C9KA 1C8M2 1F2NA 1MEC1 4XUNA 2Y6FA 5JCTA 3T0DA 2VUDA 5I93A 4BISA 1YQCA 2X53S 5CG9A 3D5OA 3R6SA 1YIPA 4L8QA 5FYTA 4URAA 4KBZA 5E89A 3SC7X 5K0UA 1GZWB 3K77A 2JG9A 3N7MA 3J7NA 1REDA 2VZSA 2RJKA 3F2ZA 3VBFA 2WFF2 5F1RA 1FMD3 3MBWA 1ZYBA 1JMUB 5ACA3 1FXZA 2D3SA 3BVCA 4CPBD 1MS0A 4OYUA 1AXZA 1AR61 1OD5A 1DQ1A 4FP2A 1VAVA 2RJ2A 3PUAA 4XEZA 4FFHA 4HMZA 4LO6B 4Y20A 1WD3A 4QU1A 3B02A 4D7TA 1W6OA 4XMIA 4CXXA 2G1MA 2XHNA 2RMU3 4CCOA 3N9OA 3C2UA 3W9AA 3WP3A 1XPWA 3UGGA 2P6HA 3AMHA 1YCIA 3GHMA 3PIJA 3SITA 4EZ4A 4HKWA 4LITA 4GQ7A 2OVUA 4ZZ5A 4PI0A 3FFZA 2W68A 4CEYB 1M06G 1UD1A 4ORFA 4UFJA 5LATA 5HXVA 5IK7A 1E5IA 1JI6A 1M4WA 4D8MA 2XJRA 3K48A 1G9BA 1O8PA 2VCMA 1GV9A 2BBAA 4K8RB 1V9U1 1VLNA 2B5HA 3N7JA 2EF6A 3C3VA 3DEMA 3KGZA 2Z2SB 1B09A 4Q0UA 3LPGA 4A7YA 1R1A1 1DQ2A 2JJ6A 5FYUA 2GC3A 3H8OA 1DP0A 3CIHA 3LB9A 2ADDA 3A0NA 3ATGA 1ULFA 1HRI1 5FUIA 3WNPA 2P6CA 4WVMB 5JWPA 3U14A 3RZHA 4JDOA 1B35A 5JXHA 2ZTNA 4HVQA 2HWE3 3HJRA 3MLJA 3T09A 4AFMA 3I2OA 1UQXA 2ZHMA 5CZKA 2NMOA 2Y38A 3WXPA 1S0BA 4BK5A 4MV2A 4K3UA 1X33A 2PHXA 1Q8OA 5LBEA 1W03A 5JZGA 5A7OA 5IK4A 4XURA 3EHKA 4A44A 1UXXX 2KD7A 3KB5A 1BK1A 2VBBA 4IW3A 2MPFA 3VGIA 2XBO1 5I0DA 2VD7A 1TG7A 3OGGA 2QZ3A 2W5FA 1R082 3I59B 3GCWA 2WKKA 4FI9A 3D0JA 1DCSA 4X8NA 4N53B 2GAUA 4XJ9A 1SBFA 1OLQA 4D3WA 2HWB1 1VMFA 2EXKA 5DAXA 5FZOA 4DXTA 1X9TA 2WS93 1POQA 3J7HA 3RVHA 4IV1A 1XBFA 3HQRA 4IEWA 2JDMA 2X5IA 1G9DA 4W6XA 2OS2A 3LA7A 4GMP3 4ITCA 2BTVC 2PHDA 3H8RA 1NXD1 1HB4A 3L2YA 3GJBA 5GM0A 1CQ9A 1PZ7A 1JS9A 3PVNA 4PBOA 1QH6A 2RS32 4W50A 1OD3A 1FV2A 4XF4A 4C1WA 1QMJA 3PVOA 5B4NA 2Q0AA 4WVMA 3KQ4B 5FK7A 3OGSA 4UW5A 1B35B 4XF9A 3O0XA 2J1RA 3V65A 1O8SA 2FCUA 5FZ1A 2W46A 4LE3A 3USSA 4A7ZA 4XFAA 1I5ZA 4P08A 1V70A 3SISA 1PO11 4QX1A 4CUBA 2BYVE 4GKYA 4LK7A 2HWD1 1H1IA 4YZ3A 3KT4A 3KV5A 2ZGQA 3V0AA 3TYJA 3ES4A 5EV7A 5A32A 1NA1A 3KCXA 2OPWA 4GWJA 2QBXA 4Q0QA 3V56A 4DMIA 2ZJCA 5A80A 4YGDA 5JPNB 4BXSV 2R041 2XPJA 4H2AA 4IE7A 4CTEA 4NMIA 2DCZA 2RMU2 3SQOA 5FQ0A 3H8XA 1V6MA 2O14A 4QB1A 4YM2A 4I2OA 1MR5A 5LEKA 2NLRA 1SFPA 4Q4Y1 2CNAA 4RQPB 1UO9A 3JBG2 5JI9A 3SLIA 1IS3A 1S2BA 1SFYA 2ZMLA 4Q1RA 2ZMKA 2MHFA 2NPIA 4UFKA 2RS11 1HQLA 4LUMA 2BFUS 4I3PA 4ASMB 2VR4A 1UL9A 2BW8A 2XVLA 1W2UA 5FP9A 2H6BA 4MGIE 3B5LB 1NAEA 2C9AA 2Q1MA 3RI8A 1H9WA 1I3HA 1JHJA 4XTMA 4CVUA 2PFWA 1GR3A 2B46X 1HRV1 2RE9A 3WP4A 2FQPA 1UZWA 1ZBA2 4H14A 4AF9A 2XQXA 4BZ4A 4CCCA 5L7OB 5FPVA 3LAGA 3OCPA 4DOUA 3GALA 5CISA 2Q1ZB 4CDUC 3WY6A 2W47A 4ISQA 2VOXA 3HMYA 5EJ3A 5EZWA 1RUJ2 2ZX1A 3IMNA 4MGKE 5FMDA 1V6KA 1JBCA 2BUKA 3ILFA 4NVPA 1AX1A 3NQHA 3FX3A 5A7WB 4N53C 2WO1A 3ZFFB 1MZEA 4V2WA 3I2JA 4ZS2A 1U0AA 3E5XA 3NSTA 1ND2B 3J26N 5JXIA 4AI2A 1ASJ1 1TMF2 2DFBA 5IHRA 1LU2A 1R1A2 2XB6C 3AKTA 5FXXA 3RZKA 4JGZC 3HVDA 5BNOA 3MV11 3FZ3A 5I8TA 4M4PA 2FCVA 2RS31 1GICA 3CQOA 4NAMA 3VZMA 3ZVXA 5A6ZA 1ENXA 4GALA 2BNMA 5I0SA 1SLIA 3NJVA 2AYHA 2AACA 2JENA 1AF9A 3SKVA 1YJKA 3ZFGB 1MS9A 1RJ7A 1JYNA 5FLIA 5FZBA 4A3ZA 5CADA 1XYPA 4YW6A 1PZ9A 1WMEA 3MF6A 4OMDA 2ZGSA 5A7SA 3AP4A 3WZ1A 5T54A 2VE1A 4XUTA 3EMRA 3HWJA 3VBHC 4UW4A 3GYDA 3PUIA 5CG8A 1GUIA 3AKPA 2JDUA 1S2EA 4OHVA 4BIOA 4AI8A
chains in the Genus database with same CATH topology
1VB2A 1PO22 2PAKA 2WQ4A 3K51A 2D44A 1O3TA 4PQ9A 2OA2A 1UZZA 3VBFC 1YFUA 4OHYA 1QDOA 5DUUA 4RR3B 5CB7A 1DZRA 4XBNA 3N7KA 2HWE1 1YXWA 1N3OA 3OGJA 3IT8A 3UL2A 2GNTA 4HETA 1A8MA 1BBT1 2JE9A 1XNBA 2IC1A 4XF1A 4IETA 1PK6C 5D8AA 1GZWA 3INAA 2W39A 5KXCA 1N1SA 3B00A 4E4DX 1OQDA 4QMAA 5EYXA 5EZWA 1QJU3 3S0MA 1N3QA 1IPJA 1ULGA 3E5UA 1SBDA 4IEYA 1VBA3 3ZFGA 4R4XA 3ZN6B 2EXJA 3NV4A 1SEFA 2DF7A 4BMBA 2D5FA 1FI2A 5JI7A 3TN91 5KXDA 4BOWA 1GZ9A 1S0EA 3CJIA 2IWGB 2GZWA 4QGNA 1BEV3 1DGWX 4HSLA 1DQ0A 1Z7S1 5JDBA 4WM8B 3JBG3 4WV8A 4COZA 2ZMNA 1CJDA 1NLSA 5FBZA 4FOQA 5BNNB 2O8OA 4IL7A 5JR7B 5C6CA 1O3QA 1NCQC 3APBA 1UPSA 3R4DB 4K7JA 2EXHA 1EAH3 5AFBA 5T5JA 3AZXA 2E7QA 2BWCA 2I45A 2QDRA 3FMGA 3H0OA 4IEVA 4XJWA 1U5ZA 4SBVA 1EP0A 1YWKA 3MLLA 1WBLA 4TWTA 2BFUL 2GC0A 4MX3A 1S1AA 1SLCA 3FC0A 1LODA 1WLDA 1UKGA 1FYUA 4KWKA 3HT1A 4LR4A 1F5JA 4YGCA 4AEDC 1ZRDA 1QY4A 3JB4C 5D8AB 4P9LA 1PO21 4I02A 4XMAA 2K0GA 4KGGA 2CYFA 2WFPA 2F4PA 1D4M3 2RS12 3IKWA 5F6KA 1CD3G 3USUB 4TYSA 3M1HA 1I6XA 4ATEA 4N9IA 1PZ8A 1X82A 5BNNA 3WDUA 1HDKA 4FOWA 4OVEA 1JYCA 1TQ5A 1VBB3 3GZUC 5KWRA 2D93A 2WT2A 3AJZA 2KXLA 1X50A 3UJQA 4MZUA 4FPYA 4S2DA 2DU0A 4IV3C 1QJX3 5IUQA 2QKDA 4XE9A 1NA1C 1QXPA 3VBHB 2FBEA 1QQP1 1FT9A 3P3PA 1Z78A 1FX5A 1F31A 4YW3A 4M0HA 2R062 1R083 1VRH1 2QNKA 3JUUA 2SBAA 4QPIB 2R1BA 2V73A 3AKRA 4YG0A 4CDWA 3MDPA 3IM0A 3ACLA 1RUI3 1J3RA 2WNEA 1A8DA 3JU9A 3BTAA 3S6PA 3KLSA 4N9HA 4S2GA 5A32B 5C8CA 5C4WA 1QWRA 1QJY2 2FZ1A 3THPA 2A6XA 1GNZA 1BCXA 4Z8BA 1ZRCA 2ZGPA 4KG0A 2VNGA 2A3YA 5FMOS 5ACA2 1MVEA 2W0XA 1BEV2 1C4RA 4CEWB 3OY8B 1RUI1 5T5PA 2DVFA 1C8M1 3T1MA 1TE1B 4JRLA 2D97A 4AVAA 4COWA 1RVF1 3I8TA 4AFAA 5KHGA 1C5HA 3AMQA 4AVSA 5J98B 1J3QA 3ZDSA 2WA4A 2ZGKA 3M3QA 1WCSA 3THTA 2RR13 2YY1A 1DZTA 3WDTA 4TZDA 4M3CF 3QCWA 4AG4A 4CYDA 2WLPA 1R092 3ELNA 1PVC3 1YIFA 4RHV2 2OPKA 2R30A 2EAAA 1BMV1 2JICA 4CDWB 3AYCA 5LRSA 3IWZA 5L7OC 1QJX1 4FPCA 1H2LA 1YNAA 3ZXJA 1RINA 4BH9A 1AL0G 3N35A 4FVVA 2XL9A 3E97A 4B3NA 5GZCA 2BVBA 3R05A 1AYM1 4QGMA 3J9SA 3KSCA 3VBUC 1JN2P 1PM7A 1IQAA 3ILNA 4KNCA 4R4ZA 2NQYA 1CAUA 4XFIA 4UBHA 3GHNA 1VBC2 2RMU1 1CAXA 4WM7B 3GBFA 1V6OA 4YZ5A 4UW6A 3WCRA 3VKLA 1XNKA 2Q8OA 3AYAA 1J1TA 5JAXA 2I2SA 2PLV3 3ZFGC 2EXIA 4COVA 1J1LA 1LECA 1OOPB 4CDXC 1RUE1 2OUHA 4QHBA 4R8HA 1ZZ9A 4XJZA 1PK6A 4RGGA 5D8AC 2LM3A 4B7EA 5BYNA 3M4FA 4XXPA 3OYWB 3RYKA 1YI7A 4W65A 4YVWA 3H8UA 3UKVA 2WS92 3HIFA 1MEC3 4IEPA 3TN93 3FUQA 2JG8A 3VHNA 4Y1UA 1LESA 1TEIA 4FPGA 5F9TA 4N7UA 2DUOA 1VBA1 3VKMA 1AR92 1CAUB 2H0BA 1QJY3 3LA3A 1JUHA 4FOYA 1F8VA 1ULEA 1TMF1 1ULCA 4GKXA 1LJ7A 1QOTA 3WT3A 5L36A 4AI3A 1QXJA 2BPA2 1UU5A 4R9AA 4WM8A 4BMEA 1UU6A 3GBWA 4P9GA 1OFSA 5L19A 1BBT2 1OA2A 3VZKA 2XJPA 3WD5A 4UBGA 1Y43B 1FPN3 4JQRA 1VJ2A 5BNPB 4NHMA 1KJLA 4M3CB 4GH4A 4OI0A 1YI9A 3OBRA 1HV0A 1O4ZA 4KBBA 4CEYC 1O3RA 3LGRA 2R0HA 1KD7A 2DU1A 4Z92B 3ZPYA 1H1AA 5AC91 4WM8C 3NKTA 4G4FA 4LLOA 3RYPA 3ZMOA 1LRHA 4Q4Y2 4E27A 1Q3EA 1REFA 1RUH2 2XJTA 3QH6A 4IV3B 1G9AA 3JZVA 4OHZA 3AKSA 4YRDA 1OFNA 3M8LA 4GB32 2RS33 3OYWA 1MS8A 1SLLA 4RA0A 2ZGOA 4Q4V3 3RJRA 4QM8A 3CEWA 3ZIXA 4DY3A 3USUA 1J58A 1LTEA 3DPRB 4YARA 2IZWA 3T1LA 4XQDA 1BVVA 4XFCA 3URFA 2RJLA 1OA4A 4FPEA 1DQ4A 1RUE3 4ZU4A 4MYEA 1G8WA 3WDVA 1LR5A 4AWDA 2E51A 2GNBA 2UURA 3JB8A 3P3NA 4IV1B 5T5OA 3TN92 3TWIA 5KHJA 4XW3A 3WG1A 2Q30A 2GC1A 5DDJ1 1FOD1 5JIAA 4COUA 4EWDA 1EV12 1AR73 1CESA 3NL1A 1H0BA 4P9WA 4PDWB 1EPZA 5T50A 3I59A 4AQTA 4I0WB 3U07A 1U12A 5GJ6A 2PYTA 3VHRA 1RUD2 2GN7A 3W59A 4AEMA 3OBTA 4M3CA 1CR7A 2GC2A 5J96B 3FFQA 2E53A 2QCSB 3AX4A 4U2AA 2ZGTA 4LBQA 3KS7A 3TOJA 3UV9A 5HCFA 1CAVB 2IXKA 4HANA 4LA3A 3FLPA 3AP5A 4FOVA 2IXLA 2UYAA 3MI8A 1AR83 2F6BA 2NN8A 3B9IA 2VVFA 1H9PA 4I0BA 3O5SA 4E4ZA 4XIKA 4F3JA 4FQ4A 3ZYRA 4GH4C 2JECA 2R0FA 4QQOA 1VALA 1XU1A 1RUF3 4I30A 1AR81 1K5MA 1C28A 1O5LA 1NYWA 4CEWA 3BCWA 5K7PA 2PAMA 2DCKA 3MYXA 4NPRA 5C8WA 2YXSA 3AJYA 4IESA 1HRI2 1SQ4A 2WNVB 1L3JA 4PDWA 2P2KA 1N3PA 1GANA 2A5ZA 2DCJA 3N7LA 2VOWA 5C9AA 2YZ4A 5JMCA 2HKXA 2Z79A 4XILA 5BUVA 4AHWA 3NAPA 1U5XA 2RS53 2RR12 4KWJA 3SCFA 4KWLA 4Q4X2 5DDJ3 1RHI2 4YG3A 3LSDA 4FPOB 4DFSA 4HN1A 3UKNA 1LB2A 4PCRA 2CWMA 4AI0A 1PO13 1CX4A 1V6NA 4DNYA 3WHUA 1PGL1 5FPXA 4FBFA 1H30A 2PHRA 4XXAA 3ZFFA 4ONUA 3NV2A 1K5MC 4GXLA 5E1RA 2IXIA 4YFWA 4AHXA 3H7YA 3NW4A 3LZZA 4OUSA 2ZX3A 3IDCB 5A33B 2O0OA 2R071 2CV6A 3SMHA 2DCYA 4D7YA 1HIXA 2NP0A 1KDMA 3H7JA 4JVAA 4XYXA 2ILMA 1PHMA 5CFDA 4EN0A 2D5HA 5AC93 1QQP3 1H2MA 3KQRA 3O12A 2XBO2 4RHV1 2K9ZA 4HPKB 1Z0HA 4LNVA 2ZX2A 3IDBB 1BMV2 1SACA 4Q0PA 2XWBB 2G9GA 2XBO3 1BJQA 3MICA 4JRAA 5D1IA 3A4UA 2B45X 4J6GA 1XU2A 2YV8A 1FNYA 2VGDA 2EAKA 2UWBA 1FPN1 2O8QA 4Y1XA 4L99A 2WSVA 3NAPB 4Q0VA 1VR3A 1NG0A 1COV3 3E6BA 4AEDB 5E88A 4EWEA 1PO23 5H9SA 4AGGA 1W0PA 4C90A 3RDIA 3ZMNA 4EV0A 1V6JA 3FLRA 4AFBA 1NXMA 4R9CA 2IXHA 4YW1A 3S30A 1UZYA 3ZO0B 3KM5A 3POWA 3VBRA 3LOBA 4W6YA 5JZGB 4AQ2A 1RMU3 1RTVA 2MEV3 4PDWC 2VOVA 3HBZA 1VIWB 3M3EA 1ND3C 4MGZE 3MEPA 3NVCA 1DBNA 2D3PA 1XE8A 1RUC2 5BNPA 2ET1A 3SCHA 1UCXA 2IXCA 4Q4W3 2PLV1 1AR63 2HEVF 1HXS2 5DUWA 4Q4W1 2NZ9A 3RQ0A 3JBG1 4GB33 1N47A 1Z7S3 5CAZA 1UW8A 1MQTA 5SV8A 4DRVA 2ZZJA 3AXEA 3MW4A 4YVSB 1ZNPA 3SXWA 3FUOA 3BB6A 5CVRA 1YFYA 4FXGB 4PIZA 4CDUA 5CA6A 1W6QA 1D2SA 3D82A 3ZYJB 1KS5A 4J1WA 3PMSA 1MZ5A 2ARBA 4FTEA 1UIJA 2JG8C 2JG9C 4AVCA 5LK5A 1DQ5A 2DVBA 1FAYA 3VBSB 5C9AC 1NA1B 2VVDA 1D0GA 1PIV2 5GLTA 3KGLA 5AC92 5FCCA 1XYNA 3ZXAC 2XWJB 4XHBA 4B4RA 5C33A 1RUNA 5DZFA 2ENRA 3L9JT 1LGCA 4AYUA 4F8AA 1R1ZA 1QJX2 1ENRA 1VBC3 2OZ6A 2ES3A 4XQ4A 3WDWA 2WNUA 3MIDA 3B7MA 3IPVB 4K20A 4EJRA 4FXKB 5C8CC 5K8SA 3VBHA 2DFCA 4I0AA 4OHXA 4LE4A 1Y7BA 3AMPA 4IQPA 5FQ0B 2CGPA 3J8F1 5I0UA 5LK7B 3MF9A 2R073 2VG9A 5EFUA 2QZ2A 4BCUA 2DUQA 5J3UA 1ZVFA 2WZR3 1T6GC 1SDWA 2ZGLA 3LKJA 1LHVA 4YZ1A 1NY72 1UN1A 1QJU2 1RJ8A 5BNOC 1RHI1 1RMU2 3JQXA 1CJPA 2ZOEB 1YO8A 2VY0A 4EN9B 4JV4A 4FPKA 4QPIA 4QPYA 2JXAA 1S0GA 1D0HA 2SLIA 4FPFA 1OSGA 1CPMA 1OI6A 2WA3A 4M3CE 4YM0A 5T55A 5IK5A 2B9UA 2XJVA 1IHMA 3NO8A 1DDLA 4JDNA 1VRH3 4JC1A 5CU1A 5FLHA 1PNFA 2WL1A 1HRV3 1ASJ2 4PJYA 2RS51 4JTOA 2BWAA 1ND3B 2WFF1 3WVJA 4XFGA 3ES1A 4Q2FA 3SNMA 2XGXA 4MSVA 3WX5A 4YLZA 1CIWA 4I3GA 2R49A 1H2NA 1AJKA 4AGVA 4P14A 1B35C 1C1FA 3HT2A 3IPVA 3UKTA 2EALA 1JHNA 4Y1YA 5HCAA 2X8KA 5T5LA 3ZXDA 4W6WA 1LHWA 1RUD1 3VDDC 2YROA 3G6JB 1H4GA 2VNOA 3O7OA 5GZGA 4IEZA 4OFGA 5GKAC 4Y22B 1IS4A 3X29B 4FO9A 1XRUA 1H8TC 4EN6B 4Y1ZA 1ZM1A 3V64A 2JEMA 4XFBA 3RZZA 3H1WA 5J48A 1G9FA 2HWD2 2QE3A 4Y24A 1AHSA 1V6IA 3E6DA 2PHUA 5CFDB 1FOD2 2VW1A 3MLKA 3RYRA 5DG1A 1ND3A 2A3XA 2VULA 1W6MB 4NWWA 3DF0A 5FTTC 1BZWA 2DTWA 5DZEA 1AR71 1RUG1 1ZZ8A 1DHKB 2WT0A 2WNUC 2XJQA 4LULA 4BE3A 5LEJA 4QU2A 1MS1A 1OQ1A 4KG8A 4OI4A 2QQPA 4Q26A 3WP5A 1SLAA 2A75A 3H50A 1OOPA 3WW2A 4P9XA 3GNEA 2PHWA 1RUI2 4PIXA 2KM2A 1ND2C 3MIFA 1GKBA 4TLFA 1N1YA 2HWF3 3AYDA 4JTNA 2TEPA 2BBVA 4JGZB 3POSA 3WG2A 1OPMA 3H3UA 3SH5A 2CGOA 4HSJA 1AYN2 2GMEA 4QGLA 1CN1A 2GH2A 1APNA 3KMHA 2ZCWA 4EROA 3AK0A 3V0BB 1HRI3 4Y22A 1QJZA 2D6KA 2D6PA 5CIRA 1NCRC 1A78A 1BBT3 1RUF2 3M3OA 4N7IA 4CDWC 2XJUA 1DU3D 1DGRA 1DIWA 4Y1VA 1IZ3A 3TNQA 1ZRFA 5FREA 4LO4B 5GZFA 1COV2 4Y5Z0 4RS5B 4L92A 2VQAA 3RJ2X 1AR93 1ZBA3 4K1ZA 4YZ4A 5FRAA 3VKNA 5JVVA 3OF1A 4IEQA 3AZVA 3ST7A 1O3SA 4FAHA 3CU7A 2N7GA 3O14A 1MS5A 4LBOA 1F9KA 1OKQA 5CFCB 2AREA 2TNFA 1ZBE2 1NQJA 4YNIA 1TMF3 2ZHNA 5FOBB 4CZSA 4CDUB 4XOGA 1IOAA 4Q27A 5ACA1 4P9JA 3M3CA 1AR72 5J37A 2D6LX 2D6NA 4CP1A 5FO8B 2YYOA 3BOPA 4Q4W2 2HEWF 3CF6E 1DF0A 3SH3A 1Q43A 2A6YA 4JGYC 4QPGA 1RVF2 3ZSJA 2E63A 1RUE2 4NOTA 4HLTA 3EBRA 2CY6A 2B39A 5I0TA 3ZXKA 4MH0E 1O91A 2HWF2 4HFSA 4HVRA 1QGLA 5JSPA 3OD4A 3GZAA 5I91A 5GLWA 2LUWA 4META 4X8PA 3OTFA 3GF6A 3B01A 2ET7A 4NO4A 1EPWA 2UYBA 2K2SA 1LEMA 1AYN1 1WCKA