4ES8A

Crystal structure of the adhesin domain of epf from streptococcus pyogenes in p212121
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
302
structure length
302
Chain Sequence
EELPDDLMNFKGTWEVSADGSSGRFFSKGATDSYVFHLIPAKDVKKPGWREHNEVKDSYIKIDKQSIAARYKTSTTAPYSVAFKVNTKSLIKDHDYKITFEQGQIASGITVDYRIGSAFNKTTDDSFKISDESKYASNVKIEGEEQGFKQREQGDKTISFRTLKEGPMSLVLLSKVEKKPQGDLDVEFKNLKIIDVTNPSQLDKGVAYVGNKNVQLTLKSDDGRTNFEGDEISLFNSRGELLQTVTVTKDQQNPISITLSEDQAKSLKNKEKLKVSIKQKQSKKTSKDFFFEVGIDPKVEAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Epf
publication title The Extracellular Protein Factor Epf from Streptococcus pyogenes Is a Cell Surface Adhesin That Binds to Cells through an N-terminal Domain Containing a Carbohydrate-binding Module.
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 80
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4es8A02
2.60.120.1240 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4es8A01
4ES8A 4ES9A
chains in the Genus database with same CATH superfamily
4N8CL 1EV11 1DBML 3EKCA 1ECZA 1KIUB 3D2UD 4LPXA 4HZLB 5HI3D 4A2EA 2VGDA 2GSIA 2DIEA 1TEYA 3HS0A 3L5WA 1G5GA 4IJ3B 4QGMA 4JPQA 4C0HA 4HULB 2H1PL 3H8RA 1I7TB 1G4RA 4M4RA 2VLRB 1RZFL 1P2CA 3VHRA 5CA6A 2R9HD 2XFGB 1UYYA 4KZEH 5JR2A 5JR1H 1L9NA 4EDXA 1PNGA 4E4HA 1UD6A 2OL3B 3AG1B 4TULH 1WS8A 4XNUL 4YHIA 3RZCD 2WO3A 3BQUA 1EAPB 1G43A 4HJGA 5J36A 2FDHA 2RQ8A 5CXPA 3HUJB 4MCZA 4YVSC 3T4AA 4P9XA 3NEEA 3FSZA 3ZL4L 4ZXEA 4XWGL 2Z4QB 1K72A 4RR3A 2UUDK 4Z7QE 3LN4A 1CLOL 3NFNB 5FYKE 1ZGLB 2NY5H 3I6GA 3V0DA 3UK9A 2H6BA 3VDAA 3SDYH 1ASJ3 1AJOA 5IVEA 3L1FA 4H20H 3FFCD 5ID0B 3LDKA 1XB8A 1HH9B 5KVEL 2Y36L 4P4KB 3SQBB 4HIQA 1XJAA 2WXRA 2GC4C 1G9FA 5FC9A 5E6SB 4I0BA 4PAZA 1MVYA 4K7PL 3ZUCA 4TLGA 3SYOA 3TN91 2R56H 4J23A 3MREA 3QDJD 2ENSA 3QARA 4XNDA 5KC5A 4COUA 5L4MA 3O8XD 3HZMA 3QUHA 4JRWA 3WE1A 2NXZC 5FKBA 3CPLB 1PDKA 4NXSA 1NAMH 3D69A 1OK0A 1SRDA 3MNMA 4GXVH 2EVHA 4HXAL 4N0FB 3W2DH 4CDQC 4CCLA 4I9XA 2EE0A 4LVHC 2BERA 4QXWA 2XV3A 3CLEL 4P5KA 2CWSA 4P00B 2P44B 2P80D 5HHOE 3NV4A 3O9WA 1NQBA 1WUZA 2ITDA 4S1RH 2AEIT 3VXUB 4PR5A 8CGTA 3BZDA 1SDYA 4O00A 4RDQG 4WENB 1ND0A 5CS7A 4LSUL 4EXKA 4UI9L 4RIRA 1WWBX 4G3YL 4YLQT 2ZGRA 1QJU2 4KFMA 4B9CA 4ONUA 3QWNA 4LOVA 4M7KH 3WNMA 4P9GA 1WD8A 2WCSA 5DT1H 1OLLA 1PEZA 1VFMA 3NSYA 5JHBA 3Q48A 1N1SA 2BV4A 1RUAH 3AZXA 4LBOA 3SQOL 4U1HA 2JXAA 2WFF1 2XBO2 4LLMA 2BBAA 1KCVH 1AZDA 3O1VA 3HC0B 3WKQA 2IVIB 2WZR3 5IY5B 4HV8A 4XNZC 2X6VA 1F1AA 3RQ0A 2DQCH 3C8HA 3O3UN 2C3VA 5E7BA 4WKZB 1BBT1 3EFOA 4K71B 3LB6D 4ASKA 1X9UA 2VQTA 3FKUS 4XPHH 1IBGH 4XMUA 2CYFA 4AKPA 1OLME 5C0AD 2IXLA 3U0TB 3PYCA 5LW9A 1O7VA 1JUIA 2Y2TA 3F7PC 1ZANL 1WITA 3FONB 2VCBA 4HIIB 5K9YA 3E6FA 4MFHA 5C7XH 4ZMZA 1R3KA 1SDDB 4FNRA 2UYLA 2YMZA 4OF0A 5LBSL 2VECA 4U1NA 3SE8H 1W72L 1CDBA 4DUWA 4YJZL 4Z7UA 1SXAA 2P48B 5JW5B 4JPIA 3BUIA 1I5ZA 3WXVH 2ZE0A 4GG6F 2CK0H 1L5GA 3PL6A 4I4WB 1RZJL 2VLKE 2ADGB 4BFOA 1ED3A 4IGQA 4NN5B 1T7VA 2C7UB 4LEJA 4M0NA 1EEUA 4L4TA 4U2AA 4MMZA 3KPNA 3ARTA 3HG0A 1MCRA 5I66A 4OF7A 4UB0H 4EZ4A 2XX0A 1ZBA3 1T80A 2AXFB 4I09A 4JHUA 4CDXB 1AOZA 4EN2A 1DJHA 2HT2C 5K5YA 1BBJA 3U9WA 2ORZA 4FFFA 5CGTA 1KIQB 2WWMC 4X6FA 4QX7A 3OV6A 5E2VL 3RWDA 2NNRA 4OJEH 3WHXA 1C7SA 1J8HE 4LQFH 3FRPG 5JW4R 5DD3L 4F33A 5J7CC 3ZKMC 2VZVA 4KDVA 4JJ5B 5JIHA 5SWZB 3ALXA 2CJSA 1V6KA 3QI9A 4FTVB 5FZFA 1MELA 1CGSH 1TPXC 3PQYB 2VM9A 2Q87A 1GWMA 1NC4D 5DFVC 3BH9A 3SDCB 2K8QA 4NZJA 2CCWA 5C07A 3IJ8A 4LFHD 1JN2P 2HJFA 2YGQA 4HXCA 4WHTB 3SODB 4DGVL 1COV2 1R082 2J1YA 4OCYL 4AW4A 5IQMA 3HIZA 2KS0A 3QWQB 3GSOA 5EC1B 3B5TA 4L1SA 3OAUH 4KGJA 4GWJA 4CEWA 2JCCA 1U8PA 3VV1A 1AXSA 2R1XB 4HMDA 4N0UE 3KT1A 5GGRB 4AYGA 3ILPB 4YE4L 2GJ6B 1REIA 4PGEB 1FFNA 1JHJA 4A55A 4I3PA 3FH7A 43C9B 1FO0H 1Y4WA 3TFKC 5CWSB 3THCA 1MCWW 3PHOB 4K20A 4CCEA 2N56A 2ARJQ 1NFDB 1JRHL 3MJGX 4PGBB 1MFDL 2P5EA 1SCRA 1T4WA 4DSYA 3S4SG 1T5KA 2CJ3A 4OLVL 1R6VA 4E5XG 1RUNA 4RNRB 3VWJD 1DYKA 3IKKA 1DQLH 4PJ5E 1O6TA 2ARXA 4CXYA 2R0WL 3CGTA 1HAUA 3W82A 5HYSG 5EPMA 3E2HC 4DN3L 5GS1A 4BQ3A 1L9PA 3OPZH 4PCTA 2DCTA 2ZKHH 3BGFC 5HHVH 4GRMA 4TN9A 2VDPL 3L3KA 2I85A 1RD6A 2VL5A 5E9DB 3WEMA 1RZ8A 2VLRD 3JD71 3U1QA 1QBLH 2YKLH 5I93A 2AK1L 3FTXA 3FRUA 2BNRE 3V4VA 3MGOB 1J48A 1DJIA 2HVJA 4XMIA 1R5WB 2WLJA 1MZEA 3FB7A 2D0HA 2Y6KA 1XGPB 2YXWA 1OV8A 5DRZA 4QU2A 4W8JA 4WTXA 2RA1A 3WJMB 1C5IA 2F17A 3SCHA 1AQMA 2AGJH 5DVMA 3MRIB 4JHVA 4QHNA 1RUQH 1U8QA 4NPYA 5LGKA 4GFTB 4HCRH 3T2LA 2HWF2 3LNHA 1ITCA 1VA9A 3BUYA 2DFCA 3VBFA 4AQ6A 3IF1B 2Y5QA 3CZEA 4MLSA 1IGIL 2XWBA 2FEEI 5DQDL 4K9EC 1RUG3 2KZKA 4P4KD 1E4KC 2W87A 3D82A 2PYEA 1T1ZB 1PX3A 3FT4A 5ESVA 4EUPA 2B5IC 3PJSB 1JP5A 3H1YA 3SKVA 3ZPDA 4MQSB 5DHMC 1FP5A 3IAGC 2BDRA 5SWQB 3PHQB 1N26A 2Y7SA 3O6FB 4XMVA 1RL1A 4TVPL 3TASA 2PKDA 4XX1E 3VJ6A 3JWNH 1X44A 3F83A 3I2CH 1HH6B 3ML9A 3TBCA 4Z76B 2VE6A 3BVNA 1MZ5A 1B0IA 3DIFB 4HPKB 1RP8A 3O0RL 4YFWA 3EH2A 4JM0A 3S35X 3EJZC 3AZUA 2XL7A 4GWIA 4JFPA 1OURA 5FP9A 4RFRB 4KG0A 4LBJA 2BVQA 4L29B 1PKQE 1THAA 4GAYB 1FMD3 4UBHA 1RUMH 4F92B 2IPTL 2QV4A 2X4QB 3FOMA 2GU9A 5KSAB 3CO2A 2CO3A 4JX0A 5IHWA 3VXUD 3C2AL 2XY1A 3TO4D 1DVFC 1DE4B 2EDWA 4GKLA 3LDBB 2QQVA 2HZHA 4M9OA 2WP3O 5GS3A 3GK8H 3S3CB 5AL8A 4C83B 1XCWA 4J28A 2BSBA 4PY8J 4ELMB 1MWAA 1BHGA 2WBKA 3M8OL 1RZ7H 2I9LB 4OI7A 4HGWA 4NO2B 1IGFH 4AYEC 1PGW1 4KK8C 2XPZA 4HLJA 5F5IA 4Z3HA 1UZZA 1F31A 1FRGL 4BH8A 4WW2F 2BHFA 1DUYA 5JIKA 4JM2F 4QPIC 2VERN 3ABLB 2NY3B 4CU7A 5B3SB 4JGZC 5TDNB 3IT8A 1FDLL 3JTSA 5G5DA 4GS7C 2KLTA 3VI3F 1AGCA 1DDHA 5DD5H 4MAUL 3G9AB 5F37A 1KY6A 3ZMOA 4PJ8B 1F2NA 4M5ZL 3MJ9H 3F58H 1MS3A 3QCUH 4NZUL 5DJXA 4PJEA 4UW3A 1AO7A 4HMCA 3I75A 3JU9A 5FYIA 4PWHA 1JZ2A 5T1LA 1NGPH 4N6RB 3SOBL 1HWHB 4BQ2A 3MNZA 4PRPD 1ZIAA 3D85B 5LEJA 1W8ZA 1JMXA 5AW5B 1C1FA 3ECVA 1SFHA 2GCYB 5TPWL 5EPAA 3KEDA 2IDSA 2B4CL 4J1UB 4ZI8A 2A77H 2AAAA 2YPLA 2EIKB 3RVTD 3RTLA 2UURA 3VBOC 2C24A 2ZWKA 1C57A 5D4HA 1RYYA 1CJPA 4GP4B 1X9LA 5EO0B 1PQZA 1XB6A 4Z3EA 2R1DA 1WWWX 1H6YA 3MLTA 4NUMA 4OZIE 4HPOH 4QPYA 4OT1L 3RB7A 1EVTC 1KS5A 4NWTH 1KC5L 4LKXA 3N40P 4F5CA 2IGLA 3NZ8B 1KENH 3ATFA 2W52A 3MIFA 5FK8A 2Q76B 3QUMH 3QZLA 3OTTA 1UTDA 3HHMA 2ZSVA 3CVHB 5ACA1 1WCBB 3DX9B 3MPCA 3NAAL 1UIJA 4R4FH 5ESQA 4DP0X 4W9DC 5IBLC 4RZCA 5SWZD 3WP4A 4FTVD 1FYHB 1LNUB 3PDOA 3PQYD 1S8DA 3DX6B 4MGYE 3SDCD 4V2CB 1RUD1 2EO7A 3QCVH 5IM7B 2NQ3A 2Q0ZX 1ZLWH 1S5HA 2E6QA 3UTPE 5FB8A 1R3HA 3L7FA 3WMSA 3SDAC 3MRFA 4OJYA 3V0AC 1IVTA 1P69B 4DJMA 2WQUA 2P3IA 5IKCB 5ITFA 4YDMA 1NGYA 4RS5A 2GJ6D 2XG5A 4YHZH 4NBYB 2PHFA 3E9UA 2X89D 5KJ4A 2OTPA 1FE8H 2YMXH 3K8KA 5J57B 2FIRT 2JKLA 4IK7A 5HHQB 3ZIYA 4G6ML 1O4ZA 2YQBA 3WUWG 2H3XC 4MNGB 4AOCA 3C5XA 2JIGA 5DAXA 4Z1VA 1CLVA 3T0VA 4FFVD 1T04B 3MRPA 3TIDA 4F7EB 3IBEA 3LEVL 1BGXH 4CCNA 5EU6A 4RBPK 3WKMH 2VITA 1IEBA 1J3RA 5G55A 4P14A 2NP0A 2NY1B 5T5FH 1XR8B 2V17L 1FNZA 4QYOA 3GGLA 2ARJA 1W72A 1QXPA 5DQ9A 1SOKA 2XXCB 3IN2A 3E6HB 4LCWA 1DO6A 5E9DD 1LEKA 2WZR2 1MHHA 2MCMA 1S3RA 4XOAA 2J2ZB 1ES0B 1WFTA 4FDWA 2P37A 4W6WA 3JWOC 3T8XB 1MKFA 1SJHA 1J8RA 1I9JL 1P6FA 4GMP0 2OPCA 2A6WA 1DZTA 4HQQH 2C26A 3I9AA 3ARWA 1PCSA 3BD4A 3BFQG 3LY6A 4F9LC 1OF2B 3I6SA 3WDWA 4QKBA 2TAAA 4HS3B 5E9NA 1LP9F 3QW9A 5GSVB 2EXHA 4PRNA 1GNYA 2DUOA 1UYPA 1EQWA 3CJIC 3R19A 4CDWA 1CE6B 3KYMB 2L8AA 4PV8A 4AJYV 1J58A 3Q44A 3WGUB 3WL9B 1K5MC 2BGOA 3WTSA 1LEMA 2AQ1A 2LR4A 4OFDA 1YECH 3NA4A 4U1JB 3K3QA 2YLKA 2RGSA 3MO1B 4GQZA 32C2B 3O6FD 4FNLL 4PP2B 2XWZA 1MFUA 4OLZH 3TNNB 3TPUA 3KNBA 3ZE0B 4Y5SA 2DW5A 3J4UH 3HE6C 5C9KA 4M3CA 1UOGA 1SBFA 3IMSA 3W9DB 1QNZL 1YAZA 1VEOA 5IHZB 3E9TA 1UXZA 2BGPA 2PWGA 3IXTA 1MHEB 5IW1A 3JUUA 3FN3A 5I76B 1P7KB 3F7YA 4Y9FA 5KUMA 4L3AA 1M2OA 5KSAD 4B1MA 1P6AB 4YGVB 5A7EA 3C5JB 3VVWA 4YW6A 1MS5A 2IUWA 5F6HI 2ZCLH 1AGBB 4HS6A 4FQXB 3CLFL 3VKOA 2G4GA 4NRXA 3WFZA 1NUNB 3NIGB 1OP5K 5CFHA 2NZIA 2VL4A 2DMGA 4UOW1 4YDJA 3SKUD 4ICXA 4JZJA 3K6SB 4F3FA 4J3OH 1IAKB 5E2UH 3M2MA 1OT5A 5GRUH 1NLQA 3TFBA 3VUOA 3EJSA 1NYWA 2Y0SA 4KJWC 4XB7A 4F2EA 2NY3D 2WWNA 1CAVB 2XPGA 3OWRA 1K2DA 3N42F 2O5YL 2EEAA 4N0CC 5EEVA 4EAEA 4KNQA 3QDME 5EU4B 3QUZB 4XUNA 4YDVA 4PJ8D 2B5HA 5AC93 3K0YA 4JJHA 3KQRA 2YRPA 2ZT9C 4JFHD 2XIDA 1TZGH 3Q5TA 1QPPA 3QZOA 4UNUA 1S46A 1E28B 2JB6A 5DMGC 2B1AH 2HJKA 4NKDB 2AJUL 1JZ6A 2WKOF 3DXAE 5FPZA 1HSBA 3MFCA 2HKHH 2QQPA 1FL3B 1ACCA 1EX0A 2VMFA 3D85D 4N25A 3WN5B 4UIKH 5E1HB 4L3CB 4R90H 1MFEH 2M1KA 2V73A 2WLKA 5CR8A 1J5OH 4FLOA 3RY4A 4XJ9A 5KYXA 5KYWA 4PM1A 2F7IA 4M6OL 3T3PE 3GMQB 4BA6A 3BUTA 4IMLB 1E90A 4QCIA 4WEUD 2C9QA 2OUJA 2WWOA 3S34L 2WNUA 2R29L 2Z5WA 2JV6A 2OTUB 1CYXA 4QHKJ 5AB0A 5E8DH 4CE8A 5C9AC 2H3NA 1HRV3 1QLFB 4G9FA 5I9QC 1WD9A 4BE6A 1P5UA 5C8JB 3ATAA 3AYEA 1Y9GA 4EN3C 5FBZA 4OJFH 1M05A 2VMIA 4QHLB 3RWEB 3J26N 2JTDA 1XGRA 5AVXB 5GZOA 3OHXC 1LJ7A 3S5QA 3FZ3A 2NZ1A 4H5SA 1OTSD 3KYNB 3VRIA 3HLAA 3PWPA 4R26H 3NDZE 5I74C 1UVQA 4N2FA 4ZXBB 2BEOA 3QC5X 1IAIL 3N1FC 3KF3A 2F5AH 1GOHA 1LO0H 4MCMA 3LGRA 2X4SB 4HBNA 4XPTL 4IBUA 2NY0C 4G1MA 3JBG3 1PL3A 4WEMB 1CF8H 2W46A 1CAXA 5CBLA 2E75C 1KPVA 2ED7A 3HS9A 3K81A 1BDYA 4UT6L 4QYAA 5JPNC 1FSKB 1MS4A 3H1WA 4IK6A 5CFDC 3B7SA 3I6LE 4G8FB 4JO8A 5HI3C 4XCFH 3FO9B 1CLZL 4IESA 1KLUA 4TNGA 3BT0A 1OOPC 4Y1AB 4HGMA 1YJLA 4XXCA 4NPLA 2P17A 1PD0A 1VRSA 4C4UA 4D9QE 1XSKA 1KPRA 2PW2B 3Q2VA 3EJRA 5D5ME 5EUOF 5F9OH 1HILB 2H0BA 4QDRA 3RGVA 5DR5L 3K4AA 1W0PA 4KJPC 2FGWH 5D96B 3FNKA 2J44A 4D0CB 4XCCH 3R8QA 4JKPH 4PG2C 1ZVYA 4HF5H 2G3XA 2CO6A 4TTDC 5IB3A 5F7EH 3KS7A 2WQRA 4QXTB 4X6CF 4KQ0A 4YSCA 1MXDA 3E80A 4MGSA 4YM3A 5MEOB 4HPYL 4PJHE 4QPGC 4BH9A 5DRNA 3OAZK 4PJ7F 4O2FA 1GLHA 4OHYA 4UI2A 2FO8A 1G4MA 4KJQD 3PP4L 4LLYA 4AWDA 3CHXA 2NY1D 3DKWA 3BWAB 5DJZB 4N9OB 4YNYA 4P46B 4NIKB 2PP7A 2FYYB 1KN2H 1XGTA 4URAA 4FZ8L 4PCSA 2X8KA 4BJ0A 1BOYA 3LXCA 3SO5A 1KBWA 2WXOA 5H2BB 4GUQA 1OKQA 4QOKA 1LHWA 4PJDB 4BQ8A 3W1ZA 2OYPA 1MI5E 4WWPA 1CFTA 3GSXA 3QQ4A 3CDZA 3S48A 2WNEA 3HEIB 1YEKL 3O8XC 3MPBA 1TQBB 1NPNA 1UAIA 3SJVB 3QJUB 3POYA 4MA3B 3MLXH 2A70A 4KBBA 4L8QA 3DPBA 5EZJA 4EQ3A 2AQSA 3KLHD 1X50A 2P7TA 3RPKA 4NN7B 1ZE3H 5GJTL 3AU1B 3FB6B 1P1ZB 2CSGA 1PG7H 1BZ7B 1ROWA 2P1BA 4YXHH 2VXUL 3ECUA 2GBAA 4JJOA 5DC2A 1RVF1 1FIGL 3LNIA 4CKQA 2Y6FA 3MOBH 4AK1A 5ADOH 4O02A 1F13A 3KYOA 3ZTEA 4DEWA 1EO5A 4PGCB 4W68A 1K4DB 2W1NA 3OX8B 4U6XB 3MC0A 4LK4A 3VFNB 1OAYH 5T3ZH 3FE5A 1CXFA 4G6KL 3V7AE 1CICA 2B2XL 5HXVA 1E4XH 3ZYZA 2HVKA 5L2KB 5G05L 4CSWA 4YSQA 4JRXB 3RA7L 3SE3C 1ST8A 4BCYA 2W1UA 2YK1L 4WGKA 1A6ZB 3VH8A 3CFMA 1MJ8L 5F7UA 4HHAB 2J6EH 2B3RA 1ZAGA 4P59L 2D73A 1SHMA 4OLXH 1XRUA 4NQCA 3S9DB 2Z93A 3JVFC 5CJXA 1P7QB 4UV4L 5C0EB 3ALQA 5FPLA 1NEZB 3ZE2B 4CU8A 5IFHL 4FQXD 4KDTC 2A3TA 5TF0A 1WHOA 2Q1MA 4KU7A 1EHNA 3FL7A 1TTBA 3UP6A 3VD2A 3HZKB 1XGQA 3KWWA 2WO7A 2Z4TA 3TVMA 5J11C 4I1PA 2V8LA 4UCFA 1F58H 4KVNH 3BGMA 1NCRA 4P9YA 1F1DA 1HHGB 2DQJH 4XVTH 4FHKA 3FQUA 2ITFA 5T1KB 2YGOA 1ZOXA 4IEUA 2NM1A 2X70A 3PU3A 4Y5YC 1G0XA 2Y06L 2QDWA 4V2BA 1AHSA 2A9ML 4AEHL 2H0FA 3DHJA 2FBEA 3AMMA 2C5DA 5E1AB 1XQ4A 5KSVB 1JZHA 4FQPA 1W06A 1LYQA 2J22A 3FTGB 3C5ZC 5K39B 5IWLA 1OLQA 3LE0A 1X5JA 5FP8A 5GLZA 4ZYKA 2XQRA 4XXDA 2YBKA 2ZWYA 1XYOA 4ODWB 1HL4A 2MPVA 4ZSOB 1IZKA 2UU8A 4E9TA 1OK8A 5JXED 3QUZD 3KPQA 4CADA 2BFUS 1AI1H 2ERJB 4XPBL 4QKXB 5KYUB 1IM3B 2MFNA 2XY2A 3O11B 4DZ8A 4UZSA 5C0DA 1I3RB 5JW4M 1RKRA 3NWKA 1AS8A 3G5WA 3MGTA 3ZKUA 4EROA 4OZFB 1HZHL 2C0ZA 2NOYA 1H3UA 4IE7A 4J5VA 2N3JA 3HKFA 1DQ2A 2WQWA 4JDOA 2WUCH 2DM2A 3AWGA 4KHTL 4HJUA 5FK9A 3RWKX 1BBDL 1OD7A 3M88A 3P4OA 1IG0A 2JDKA 4AKOA 2EA7A 4DCQB 5JHAA 1GP5A 3NW4A 3C7HA 3O3BB 1JYIA 4MS8C 4X98B 4XR8C 2BNUB 4GMSH 1YYMH 1BFSA 1MAML 3HC4H 3EFFB 4FQZA 1NLRA 3VRLF 3H7BA 3ZSJA 5IYYA 1B6UA 4QQOA 1FWXA 4WU5B 2ZOLB 5CINH 1UACH 3CFIC 1CDIA 2I9TA 4NQXA 3N9MA 3ENRA 3WFBL 2F7RA 4OCMC 2OIIA 2A6DB 2XT1B 4X6DF 2NT1A 1GCYA 3M1CA 2HWD3 3VGDA 3AABA 4P5MA 1OTUD 4LSSL 5FZ0A 1QSEB 1W8OA 2D31A 1A6TB 4MJIA 1YNLL 4RRPA 4ZXBD 3N7LA 4Z7UE 2DMHA 3T04D 1KDJA 4GBXC 3B1UA 4L4VB 1IFHH 2PPCA 4X5WA 5JPMB 5FWRA 1KCKA 4NXKA 1QFWH 5EBMB 4HEMA 4P9LA 2HPOA 3AT8A 1CC3A 2JJTC 2YGVA 3PP3H 2ZMNA 2CNYA 4LLQB 3VBSA 4K7JA 4RGMC 2V7HA 1GOGA 2ETWA 1AR61 2H6CA 4Y1AD 1XCQA 3ES1A 3GMPB 4JM2A 2YBRB 1G7QB 2CUIA 1MFMA 2BS9A 3FUEA 1LMKA 4JFVA 4WWKA 1Q5OA 4ENED 1HXYB 3EO1B 3N43F 1Q3EA 2J42A 2PYFA 1FYTB 4PJFB 1NFIA 3MRRB 4WNJA 1I3VA 1C1EH 2IOIA 2N7SA 2YARA 3TLRA 3GNMH 4KWLA 3EDEA 1QH6A 4ODHH 4GNKB 3EDJA 1MHCA 4HUUB 3ZRCC 2WLQA 2BVOB 3AP5A 2H41A 1FVEA 4TUOB 4XDOA 1T66D 4JAMA 4KNTA 4A44A 5C07E 1GAFH 3HZ3A 3ZZ1A 1MEC3 3CVDA 4BFIA 1A7OL 2FJHA 2MNGA 4A3XA 4O9EA 5FP7A 1T2QH 3AW5A 4TNFA 5FW6A 5JORA 2GN3A 5CF3A 4BZ1L 1KTBA 5GGRY 2X7LB 1COV1 1R081 3F65A 2R073 2XJTA 4LGSB 2AJSH 4XODA 1IEAB 2PO6B 4P46D 3EJCA 5I19L 1EAH2 1MCSA 1H30A 5FFLA 4LOSA 1QX1A 1ORQB 4SLIA 4Y22A 2VN5A 3RWNA 3N9NA 4META 2FECL 4Y33A 4NE9A 1KFGA 2KDGA 3DVNB 1WFNA 2DTYA 3NZHL 3S88H 3GDBA 1AD9A 3CSPA 2IG2L 2GSYA 1NZRA 4IGOA 3UTOA 4Q9RH 2F8VA 1JPSH 1XZ0A 2R29A 3ZKQD 4NX0A 3SJVD 1E3XA 2XKSA 3JV0A 1F5WA 4XNMB 5ICZA 2P5EE 3DVGB 3PDDA 5HPOA 2WWKT 2W1WA 4OVEA 1Q0XL 2F58L 5F9JA 1MJ7H 4KKNA 3SGKC 5DUUA 5F7FA 5AKTA 2X6UA 4IEWA 3MN8A 4CEYA 4KGQA 3T1WA 1FBIH 2Y4SA 3BN6A 2N4IA 4R84A 4CC0A 3RZHA 1GPOH 2VLLB 4MGKE 1WWAX 4FG4A 3TO4C 5IB2B 2APFA 5E6UB 1NGZA 3PVNA 4Q29A 4WI6A 4PMEA 3ECBA 3H3LA 2Q1ZB 1J9SA 3WINE 5CKGA 3ISYA 2PCFA 5DLLA 4I9WE 1HOCA 4OD2A 5BRPA 2EIZA 5HJ3B 1HYSC 1TJHL 2XETA 4QWWD 4LCCB 5MEPB 5F89B 1FI2A 2V2WA 4R4ND 5F1IB 2BSSA 1WW4A 3I97A 3X11A 3QIUB 1HRV2 5L2KD 3W57A 4N9HA 4JRXD 1N7MH 4ES8A 1LWJA 2ZD0A 4YHNB 1H3PH 2ED9A 3E6DA 4F7MA 3LD8A 5K9JL 2I24N 3N7JA 3OKEB 3JV6B 4URTB 5I28A 4PJ9C 1C8PA 5L7XH 2DH3A 2K4WA 2HWF1 5T5LA 1P7QD 1U4EA 3U0PB 1KLGB 1NZIA 2Q30A 1RZQA 3HNVL 2OA2A 5IV2A 2PR4L 1JTTA 1ZHKA 2PYEE 4XC3L 1VGEL 1UM6L 1JBCA 4AGPA 3LEIA 2JMRA 3MKKA 4KWUA 7CGTA 4OUSA 2V7NB 2PWHA 2NSMA 1D2QA 4PMFA 3BAXA 5FZ4A 3A6CL 5T1KD 3U1SL 3RZLA 4KXAA 1ICTA 5AW2B 4YXKH 5D2AA 1O3QA 1L7QA 1WC7B 3VGIA 1XH3A 3X29B 2YC1A 3GBWA 3RVTC 5A3TA 4PJBF 2J12B 4HWBH 1SN0A 3T4AB 3HFMH 5C6PB 1SF3A 1I7RA 1H3WM 2CDGB 2D7MA 4B9JA 5B3NA 2A9BA 3DSNA 3P54A 4IDJL 5GRVL 3E97A 5FYBA 1QW9A 3LN4B 1US2A 1IM3D 5ISZA 2PXJA 3WSOA 1ZTMA 4PH8A 1ZLVK 2WO2A 2XACC 3NK4A 5DA4A 4XP9H 4CKVX 4AGGA 3QNXB 1A7QL 2R4SH 3ZTNH 4PIYA 2BWCA 2RH0A 5E70A 3SEEA 2YUXA 4LGRB 2QTVA 3JUYA 4NUPA 1VBB2 2OV0A 1MRFL 3BEVB 3SPVA 2ZA9A 5KHKA 3RUGA 3WY6A 3F85A 3T0AA 2NX5E 4FFZH 2CR3A 3U9UB 4NVPA 4J12A 4AEDB 3SDCC 1E5HA 2HFEB 4GG8B 4TNWF 1F4XH 2CPUA 1I8MB 3AZWA 3HBKA 1GYUA 3ZYHA 1O5PA 2VABB 5FPUA 4ODBD 1J0ZA 1QLEL 5T3ZE 1B3IA 5J5EA 1CFNA 2V9QA 3BP6A 1H8SA 1CL7I 4LCYA 5DUBA 4G42B 4I48B 3AVEA 5IVXF 4DPAX 4YAQA 1QEWA 3L3OC 4GAJL 5CZKA 2DZEA 3WEAA 1BLZA 1RUF2 2DYCA 2DYSB 2EC9U 4DAGL 4PJEE 1SMVA 1AO7E 4RVBA 4X8CA 5IMKB 4DRRA 1J0JA 2V33A 4NFBA 1RUH1 1U3HA 2RDRA 3I2DA 4RIRB 4LFHG 3TP4A 1EA9C 6PAZA 2D3NA 4HKXB 1U9KA 4LTAA 1QSED 3ZTJG 4AQOA 1UY1A 1QOKA 4P5YA 3QNZA 1CZTA 2YPLE 1GH7A 4OIIH 4ZY9A 3BTXA 2NQCA 4Q1RA 4NAJA 5EU3A 4UW4A 2R69L 4DW2L 3OKDA 3MODH 4XMPL 3T3MF 5KVFL 4LLMB 5FLVA 3L3DB 4PJGB 1AYRA 3CSTA 4WRLA 4GRWF 3RVVD 2VH9A 5DMIH 3IMTA 2O5ZL 3KH3A 2WWSA 3G3LA 3GYDA 4WY7L 3VBRB 3ZFEB 1CWVA 4GQ9L 3HMYA 2YJLA 3LFMA 1X7QB 3I02B 1Z0HA 4XNXH 1CIYA 1L0XA 4F5CE 4AENA 4FLQA 1FZMB 3AITA 5A2LH 2FJFA 5DC4B 4BFKA 4CXWA 3ZIMA 3ULUF 1FYTD 3GJFA 5HDBB 1RIRA 5CUSL 3O2WL 2F7PA 1QDCA 3F5WB 1CESA 2X0UA 4I5BB 4L99A 1T7WA 5I26A 2GSGA 3WKPA 3TZVC 2F0CA 3Q1SH 1ASJ1 1F90H 5E5MB 2W38A 4UNVA 5FM5M 2H6UA 1HHIB 2ESVB 4XCBA 2O6DA 3PWVB 4J27A 4ANXA 1G7YA 1ONAA 1R093 4PN6A 2AEOA 4KWJA 3ABZA 1G9BA 4TSBH 3D50A 4QX3A 4ONOA 3WMQA 4L0PA 3QEHA 2TEPA 1E67A 2XTJB 3DOSA 4L4TB 2VDQB 1JPST 2OXGB 2BS71 4NWUL 3O6FC 4WGWB 4XMWA 4M93C 3KPRA 4UTBL 2D6PA 4RH4A 1HTYA 1UXXX 1TU2B 1NFAA 1F02I 2E9BA 3II1A 1BX2A 1QR1A 2YDEA 4S2FA 2JB8A 1ZA6B 2EP6A 2DQEH 4X6FB 2NY7H 4HIXL 1PK6C 4XQWA 2CO7B 2WOYA 3AQDA 4JHAL 3POIA 1BMV2 3KG5A 3UTSB 3JQWA 1XIWC 4G7YL 1GGIL 1K8IA 1P4UA 1IC7H 1R5VA 2I5YH 2WGNB 4JN1L 1CO1A 1KYDA 5EU6E 1YEWA 2CDPA 1LO4L 2FH6A 4P5SA 1CG9A 1J87A 3BOVA 3G5ZB 3VFGL 5L7OC 2AAVA 4KXCA 3IFOB 4CMHB 1C3HA 1HX0A 3ILQD 1BVNT 4JCMA 4LL1A 3EGXA 4HVQA 1D9KC 2EILB 1MCOH 1ZDQA 1U8PB 5FYLD 1AXSB 2VTXA 5BXFB 2WZR1 4OV6F 4QXUL 4LHNA 3B9KA 2DN7A 2JB5L 2WYTA 3IETB 4L0YA 4PW4A 3H2QA 1DQDL 2OP4L 3MX0B 3QIUD 4RDQF 2TRYA 2Y9RT 5DZPA 2EQDA 3STLA 4OCXH 2EUXA 4F7TB 4YW5A 3DX1A 4S0SD 4S10A 5D7LB 1WBXA 2NY3C 2J7MA 2YS4A 3DF0A 4HSCX 5FDBA 5EJZB 1DQJA 1HL5A 4S2HA 5FHAL 3JSSA 1AQHA 2DYPA 3RDTA 3N9PA 4JFYB 3OPTA 1Z2KA 4N20A 2R15A 4PJ8C 2HVBA 2PHXA 1GKOA 3T30A 4JC1A 2AEQL 2BOBB 3U2SA 3GZTB 5JIAA 3SCMA 1R3LA 1M2VA 3BYYA 3CHRA 3MLSL 4LO5B 4IMKA 2EIBA 3VB8A 3AX4A 1NCCL 4XVUC 1U33A 1RZ8B 5GZND 3RL1B 3VG0L 3OKNA 2Q5TA 1VMJA 3LOBA 5D4QA 3AFKA 4BZ1A 3V79C 2QELA 4M3CE 1GW6A 3FX3A 1MCLA 2XG3A 4C57C 1OA3A 1AY1L 3CN0A 3OG4B 2PPAA 5F0LB 4NQEB 2WJ7A 3A6BL 1E42A 3S36X 1ZBA1 4JO2H 4LVOB 4EIZC 4CILA 4QHNB 3LH8A 1IOAA 1NCDL 4A7TA 4YN3A 1OA2A 1W8EA 3D48R 1ZRUA 4H0IA 4ZO7A 5IQOA 5F8RC 4RYDA 3WMPA 1WLTA 1XMEB 5D7JC 1A4JA 3WJLC 3L2LA 2VXSH 2YAQA 2EIEA 2K9UA 4MX3A 4FO9A 2FUTA 4M8VA 5IK3A 1A6CA 5L9RA 5JUVA 1SEBB 1TMQA 3FT4B 5MENA 4EUPB 3QJTB 1OTSC 3BPOC 3PVOA 2OMYA 4WTQA 1IZJA 2BNQA 2QZQA 1FF5A 4LLVA 1PAZA 2CDFB 2AEPL 1RJLB 1NLDL 4GOSA 4LEXH 4Y9GA 1D5RA 5AYUL 1TE1B 2VE6B 3B94A 4RQPC 4OB5H 4BIKA 3LF7A 2YEZA 4JGYB 1UNBA 3INOA 3AT0A 3CVHH 3ZYGA 1JNLL 4IEFB 1N5YH 4J39A 1NOVA 2A83A 5EIIB 5DG2A 3GXPA 2AJZA 1W2UA 2YWYA 5E6ZA 1LECA 5FZLA 2G3NA 3QUYA 1N10A 2HKFH 1VKXB 5E99L 1RH8A 2UZXA 2ZOKA 1NCQA 3O9WD 2EDKA 4KI5D 4OI0A 1CJYA 3GIVB 3VGBA 4XAWH 4Q9QH 2A6JA 2ZAIA 4JFEA 4JQXA 2C9RA 3BKML 1AJ7H 2EXYD 3OR6B 3EGSB 1GP4A 1QTSA 2RB8A 3INUL 3IVKB 2ZUWA 4RGNE 1FH5H 2XBTA 1N67A 3AYDA 4X7CC 5FYJU 3TNMB 4Q89A 5JSRA 4XUOA 1EEZB 2F54A 2Z91B 3BB6A 4CGUB 1G9NH 4KJQC 4TUUA 1DUYB 2A1XA 1DQ5A 3FAXA 3ZL1A 4C4KT 3BP4A 3NJXA 4XAKD 4G9FE 2VXQH 2WUBH 2VH5H 5G5DB 2NW3B 2AZ5A 1JF1B 4I1RA 4UF7C 3CMOH 3C7OA 3NFSH 5ES4B 2JKTM 1BZQK 5FP4A 2FWSA 4KKCC 4ACPA 4M7ZB 3TWCH 3V5HA 4QIRA 3GJFK 4EBQL 2QKDA 4FZEH 5C7GA 3SXWA 2DEYX 4UDTA 3MRHB 4AVCA 4B0MM 5E8OB 4MG2A 3PWPE 2BHZA 1KJ2L 3HR5A 3I75B 5JXHA 4CN1A 1NGWB 4JO5A 5B7MA 1JGEA 3EOAA 3MNZB 5L4JA 4KRLB 3KLHC 2HWZH 5GPRA 4IM8A 3KXFE 2ESVD 1RUG1 4ODSL 1UOBA 4V2WA 3FFDA 4XIOA 1BV8A 1BQPA 1JFHA 2BRQA 3X3GH 4CSPA 2JH2A 2MPAH 1FFPA 2EKSB 2XJSA 4IRSA 2Q8OA 1CD1B 1MJUL 3PS6A 4UTCA 3PL6D 4FPLA 3MRKB 3IMBA 2YEQA 2PHUA 2X1WL 1TEFA 5T1MB 2XTJD 4F58H 3MXVH 4L4TD 2C7FA 5CGBA 1PVXA 5LBGA 2RR12 1T7YA 2ZKXA 1DO5A 1A0QL 3WF0A 1PHMA 1AR72 2XVLA 3BAJA 1YEHL 1S7VB 5HD8C 1C8M2 3SY6A 3EXUA 1FUNA 2FNWA 1FMD1 2VMGA 1OY3B 3UADA 2GNTA 4W81A 1J3QA 4W4OC 1Q0YL 4YVWC 3L3HA 1OPMA 2NY4B 2X4PA 3L4TA 2ZX2A 4POZD 3IXAB 5EMYA 3K71A 1SM3L 4OR1A 4M1DL 2DWSA 5D7IF 4D9LH 3GIZH 2WC7A 5E2TL 4HK9A 3T4HB 3P4NB 4NFCA 3M45A 4TQEL 4N86A 2Y7QB 4FADA 1EAOA 2VM4A 3L7FB 4XH2A 5FB8B 1MS8A 3MRFB 5ALBL 3HAEA 1Q38A 4NO5A 2DUPA 3SEPA 1N47A 5BVPH 1BVLB 2VDLB 4N8MA 3MO4A 4X5QA 4QOKE 3MICA 1A7PL 3FFZA 1S7RB 2R69A 4TXVB 5EZLB 5BQ7A 3BZ4A 1IQDB 4NS0A 4ZX5A 3B7YA 5I30H 3MNWB 1SEQL 2P34A 1HE8A 4UOJA 1YQ6A 4FQ2L 2ZBJA 1TT6A 1USZA 3HNMA 2P46B 2Z3FA 5B38B 3PDQA 5IK8A 1UZ8A 4HIHB 4E42A 2PFWA 1T20B 2Y0OA 3W9EA 8FABA 5D7LD 5A6ZA 2JI1A 3QUXA 4IOIB 1FAIL 4WEBL 3S35L 5LB1A 3OKMB 4YX2H 1L7LA 4WM8B 3EDFA 2E27H 3OPUA 1HQ4A 1VFBB 3F7RA 2BZCA 5IEKB 5JXEC 3QUZC 4BHUI 4E9LA 3NJHA 1NA8A 1ZWIB 1NL0L 3LH2H 4BGLA 1J05A 2F19L 2VITB 3HR6A 4AK2A 4XTMA 2WNOA 4BIFA 2VW0A 2ATAA 3UCQA 2BMKB 1U5IA 1HN0A 2XQYA 1BEXA 2ZX5A 3RMYA 3WZ1A 2V72A 3VKFC 4ZNEA 2ZXQA 1E3ZA 4XN8A 4H40A 3K6OA 5B8CA 1R5IB 2WV3A 5DQ9B 2JDMA 4GB9A 4G7VH 4NM8H 4AZ8A 4F27A 4N43A 4OCRL 1BF2A 4UQEA 3NCMA 4TNEA 3P6BA 5D93B 3PXHA 4BRVA 1HS6A 4OIBA 4CCMA 3QG6B 1V5JA 1ZJBA 1A6AB 1ADWA 3QDGA 3QRLA 4LHUG 4QO1A 1I5PA 1ZREA 3ESOA 4NQED 3SDXF 1AGEB 1T21A 3RNKA 2VLJA 1MRCH 4LGPB 3QWRA 2A38A 4ANUA 5LN8A 2R1WB 4NQCE 3RKDD 4KTGA 1RPUA 2OS7A 4UTBA 4GZ9A 1BQUA 1SXCA 3OGGA 1DYOA 2NUTA 3E7JA 2KHAA 1QJEA 1OAUL 2ZCHL 4NP9A 4HWEL 2CAVA 4Q4X2 3MR9A 1OCOB 3CHOA 3N44B 4KKZA 4N90A 3OKOB 1I3GH 3RU8H 3RY5A 5LA1A 5GIRA 1IG3A 2VR4A 2QQQA 2GMPA 5D9SA 5EFIA 5ADPH 1R092 1V00A 1ZHLA 5A40E 4MB1A 2EEFA 5E0QA 5ALCL 3Q1EA 4U1IB 4ZXBC 4QKDA 1NX9A 4S1QL 5DDHA 3O2VL 2VWEE 5JXAH 2Y6GA 3KNBB 4I2XB 3L2NA 3U9PH 4HVOA 4R9BA 2KUTA 4JVAA 3VDDB 2WN3A 1L9QA 1D6VH 2DQIH 1U5ZA 4Z3TA 1MIEH 3VFPB 1Z78A 4GYBA 1M6UA 5F7NC 2N7GA 4Z78A 4GD4A 2R4RL 1OGAA 1P4IL 3KCPB 4WI7A 3ZX7A 1A9EA 1Z66A 3SZ6A 3F7YB 4XO8A 4PJCA 5I1HL 1W2TA 4HD9A 3AVSA 5A2JH 1PVC2 2WLZA 2WWUA 3KPOB 2F4LA 4ENEC 4X9HA 4IOSD 5K9OA 1YFWA 2ERFA 1WAAF 4AIXA 5DRXA 1UWEL 4DP9X 3OZKA 3U4XA 4ELME 4ISRA 1KJVB 2E5EA 2F4PA 3VBUB 3NCWA 1CF1A 5DUJA 1GZHC 3M3CA 2GABA 2LTQC 4P9MH 1T66C 2I32A 2J8HA 3BDYH 2WLIB 4KC3B 3MRDA 4PLKD 5C3TA 1BK1A 2BOJA 3HPJB 1H8TA 3KB5A 4R96A 2V2XB 1GSMA 1BIIB 2P6HA 1ETA1 5E1RA 3T6QC 2IPKB 3C08H 3VI4F 5BNQA 3U30B 2Z31A 3D0VA 3DKQA 1N70A 3TJPA 2WXNA 1H8OA 4K8RC 5CIRA 2NXYB 1A7RH 3H3PL 1SUJA 4P46C 2ORBL 3TYFA 1MLCA 1IVLA 2FCBA 1EO8L 1O9VA 2ZWNA 3MFFA 4JDVB 2OMUB 3MSPA 4ZHNA 2PTMA 1AS6A 5E5UB 1JI1A 1TME2 3BXNB 1BMZA 4IYKA 3OAYH 4QQPA 3D2TA 3MRNB 3N7MA 4Q8LA 1IBZA 4PRBB 4ZPVA 5GLWA 2B8OT 2A4EA 1MXGA 1NBCA 2HJKB 2YPJA 3V8CA 4GKNB 1TQBC 4MJIE 2P3YA 1UXWA 1I6XA 2X4RB 5CHNB 3L95B 2VW6A 2R2HB 3IYLW 3KM1A 5IB1B 2DFBA 1N9PA 3MRJA 2NQDA 2IH3B 1F11B 5JOPD 1MCJA 5D6DA 4NN7C 3MNVA 4ADIA 3CDYA 5I1EL 2IXCA 3A22A 4PVLA 1O9WA 1G9MH 5DI8A 3UJJL 3EBRA 4F9PC 4G5AA 2A3XA 4ITCA 1YJDH 1A65A 4UQ2B 1DDTA 2GSMB 2WBJB 1XH2A 4Y2DB 1RC6A 2R0FA 1JERA 2JNZA 2TSAA 3BOWA 3GZUC 4XFCA 2B46X 3IPEA 4AYFA 2IBGA 4JQIH 1WLWA 1F0LA 3WFEL 4AGMA 1JNHB 4OGZA 1X6NA 4FFYL 4O7XA 3L3IB 4X6EA 4NSKB 4QWWC 4FL4B 1FIEA 3FLTA 3NCEB 1T2XA 3WIAA 1ZHBB 2P2KA 2NUPB 4R4NC 4J2XA 5IK7A 3H3BC 1XGRB 3CZUA 2WRAA 4DRVA 1V7ML 2JKJA 2MHAB 1IPSA 4MDJB 4FERA 4WUUB 2NY4D 3WIHL 5L9DL 4FPYA 3ZVVA 4L1DA 3GBNH 5ECGA 4HETA 5DUML 2XWJA 2NMNA 4OMCA 2WXFA 3OLGA 4D8MA 3GSQB 4XBMA 2W9LA 4N0YL 3TF4A 2ZJSH 3V5DB 2VTXJ 3MLRL 5IP4A 1XNCA 3LIGA 1Y9MA 3BH8A 3UIZA 1YI9A 2ARCA 3D0SA 5C8CC 1EDYA 2E76C 5KAQF 4WV1A 4S0TD 4HLTA 3L2MA 2FX9H 4MKTA 1A1NA 4BA8A 2O1QA 1U93B 3D09A 4EJRA 3ZBMA 3ACFA 3FULA 1OCZB 1IS4A 2W95A 3F64A 2P8PB 4Y19A 1A8JH 1CK0L 1F8TH 2ITCA 1RP9A 4MNGE 4ODUB 4QXVA 3SGEI 1AHWC 4AYSA 1GNHA 2Z4FA 3TB0A 4N7UA 2PA7A 5AC91 2EF6A 5EBLB 1ETZA 3BVXA 2FO4A 4UINH 4FAHA 2E6VA 3E6CC 4GMP3 1KNOA 3FPXA 2OJZL 1F5FA 3J8F7 5IUSA 2NLJA 4GJTB 1AVBA 1JV5B 3S98A 3WNJA 1FZJB 3H9SB 1KJ2A 2ICEC 1IQWH 3QQDA 3H9AA 5IVJA 1IGTB 2X05A 4JGUA 3THDA 4R4XA 2I45A 1N59B 1LGBA 4PJXE 3ROOB 5EOCH 4CP1A 1CBJA 4GG6B 4LCWD 5TE4H 5HV0A 2OYMA 3CBJB 4P9HH 4GQQA 1KEGL 3RWIA 4N2BA 2W9EH 5DJDA 4CCOA 4YDNA 4C56A 1Y1DA 2UUDH 5D2LF 4LNRA 3GKWL 3CDZB 4EQ2A 1HRV1 4LCIH 3RZZA 4NQSB 4K23H 5BMFL 4KAQH 2F9BT 1J7VR 2C6SA 5BNNC 4ZTOL 4PRDA 5I1DB 2W1QA 1CUOA 4OZFH 1U8HA 2P4EA 2EXSA 4MAYB 2CLVB 4ONHA 1X5GA 3QHZL 1TDQA 1WZMA 4YR6A 4Q26A 2HFTA 1BJ8A 1YUHA 1RZKC 5EZPA 3REVB 2SBAA 3ARYA 5DJ6A 1ULFA 1HWGB 1IL1B 4EZKA 1OMIA 2JVUA 1OXYA 1HV1A 4AI7A 5IVCA 5DWPA 2ZMLA 5DUWA 4Z0BL 2YGNA 1S7TB 4WI8A 3U1XA 3JBG1 5LN4A 3VX1A 3GLZA 2JG9C 3LQAH 2XIBA 4AKQA 3KCXA 4M6ML 3OJVC 4LP8A 1A6VL 2DQGL 4J4PA 3WAJA 1MG2C 4PJAA 1UX6A 1AC0A 1FCGA 3ZN6A 5JPMC 1J9RA 3AXLA 5DZEA 1CWPA 2QKIB 5HGDA 3DTXA 4K1ZA 3INAA 3Q9OA 1VIWA 5IBTL 5JR7B 3B9EA 4PY8I 4M5SA 4GAGL 3N85L 4ZUUB 3RKPA 3HI5L 1QBBA 4WK2B 1NAEA 5ISZE 3LIZL 5AVTB 1O0VA 5CZRA 2NPLX 4PVMA 2Z93B 3WDUA 2VR7A 3ZXDA 3IFLH 2E4TA 1IGYA 1V6OA 1SDAB 5DVNA 1LE9A 1RXLA 4JO1L 1Y0LA 1KN4L 5DSCA 5HI0A 3BTZA 1QABA 2RTTA 4RWYL 4WAFA 5CM1A 1LRHA 3GWJA 4TSAH 4IEOA 4MD5A 5A7WA 4XPGH 2BFVH 3RUGE 1C5HA 4LKCB 1DVXA 3ZM8A 2Y5EA 4LRNL 4HHWA 3FQUB 1TJIL 1JUFA 4HJTA 4JDEB 3UZQB 4C1WA 1A34A 1GWLA 2BJML 4QX8A 5C6CA 4K5OA 2VVDA 3HE7A 4PLNC 3ZE1F 2A1WH 2QJVA 4N4YB 1BCXA 2SODB 1H5BC 3TAYA 4EWAA 3P1IA 3IKCB 4XBPA 3QCTH 3UZEA 1FXZA 2G9ZA 1XMWA 1G9HA 4IU3B 1WUVA 4XXDB 2WSUA 5D1IA 2I25N 1ETJA 5A6QA 1JXKA 2EO9A 4Q2ZA 3RFZB 4Z8FH 1L4IA 1M1XB 2X3AA 3GS4A 5A2FA 5ITBL 4AGLA 1RUF1 4BFRA 2FDJA 4B60A 5GS0C 4DZ8B 5FY1A 3MPPG 2PLV2 1EUTA 3EJUA 5HDWA 1HQNA 5I8SA 4XIKA 1CIUA 1YQ2A 4N3TA 1WBFA 2OMZB 2JECA 4H8QA 3GTTA 4Y16B 3QH3A 4OFVA 4KY2A 1IC5L 4XMZA 1U5YA 4LMFA 4XCEA 4FPCA 5BS0B 2DB8A 4HJ0C 1G7JA 3JUZA 4KG8A 1XYNA 2EXJA 3QDHA 2LABA 5JHLL 4K6BA 3DRQB 1NT0A 3PGCA 4BK5A 5E08H 3M7OA 5D2NC 3MIHA 3KZ8A 1X5KA 1OE1A 2GQHA 1I8UA 3GXIA 4G5ZH 1RTVA 1BG9A 4TNWK 4WI2A 2WBJD 2XCMC 4Y2DD 3ESNA 3JQOB 3B1TA 2QHLA 3W3BA 2BCKA 1OI6A 2MEV2 3ILQC 2VZSA 5FZMA 1J0HA 4TVPD 3VXMA 3P1VA 3VW3L 2YPVH 2HLAB 2QR0A 1SOSA 3QFJB 2BZDA 4Z92B 5TGBA 3L3GA 3IE9A 2DI8A 1MVEA 2JIJA 5JYMA 1Q72L 4QAWA 5CKQA 2WSVA 4GUCA 4WCYL 5C08A 5SX4H 1RUKL 3EYVB 3W11C 1KTKE 3WOVA 1E6JH 3P0VL 3AZYA 3NG5A 3MXWL 2FEEL 3FB8B 5FYLH 2DCYA 2HFGH 4LR4A 3ZDSA 1YMMA 3QHTC 5LY1A 1AQDA 4PU2A 4OFQA 2ZX3A 2R83A 5JLZB 4X5WB 2HB0A 3NFPA 1KZQA 2XRAL 3VMPA 2FATH 3LS5L 3HRZB 4XNYL 3WY3A 2IVFC 3R06B 4X8JA 3BE1L 3H55A 1EY2A 1LHOA 3HS0C 3M1BA 2Q20A 4WW2B 1PZSA 1MQKH 4N1EA 5IQ9A 4NJ4A 4JM2B 1JWMA 1J0IA 1V6IA 3OJ2C 1XF1A 4KV5E 1YQVL 4CAGA 1YC61 5F7BA 1ULEA 3VI3B 1XOYA 5DZGA 5D4IA 1Q4NX 5FYKU 2YD4A 1IS5A 1ZM1A 1L0PA 2PYFB 2EXIA 4I77H 1NFKA 1AR2A 5CEYA 1DVYA 3RGVD 2CSPA 1NEZG 3L4XA 4Z3FA 5I0TA 3T4AC 2XKOA 3UGGA 4HCGA 1UB6B 3KVDD 1IILE 3L8QA 4RR3C 1YY8B 3T2NL 3VD9A 1RUI2 2X1OA 2XH6A 3G5VB 4BFIB 1I1AA 2B0SL 3TBBA 3N4MA 2IXQA 4WSKA 1CN1A 4E8DA 3H9SD 1G9AA 1DQVA 1OGSA 3GZKA 1W8TA 2E8ZA 4P2QB 5AD0B 2D7NA 2AMUA 3AP4A 3IS1X 4UNIA 3H0TB 4EXPX 5C3QA 4DUVA 5IJCC 1MVUB 5GM0A 3L5JA 3K1KC 3I8TA 2HXAA 4OH2A 4Y22B 4PJDE 3CZLA 5IB5B 3HG4A 4FQJL 1NDMB 4LO8A 2FHFA 4Q52A 4AEDC 2CAKA 3IMVA 5I23A 2DWEB 4NP4H 4OD1H 1RHI2 1E4HA 2O14A 3T8VA 3DJSA 5J6SA 3U0WL 3FQXB 2RMU2 1JHLL 5EU5A 4F8QA 1CVNA 1PLBA 4A66A 5FF6B 1CXIA 1IKNA 1JGVL 1I8KA 1U8KA 4FULA 1NC2A 4HJ1A 2D6LX 2HWD1 5BY5A 1SHXA 3BX7C 3O9WC 1NTDA 2YA1A 3I85A 4G8GE 4QRBA 4IDLA 4HA1A 5E9AA 5HHMB 3OKLB 3HNYM 1JYTA 1W8UA 3FCTA 3CUPB 4WWOA 5D7IA 3WIHA 1NGZB 1OA4A 3MUGB 4O2CA 3X13B 2RJLA 1IAOA 1QFWM 2YKKA 3PWUB 3QJXA 4UM8A 1GCFA 1H2MA 1RUOA 2AJYL 5CAZA 1BA9A 3KPPA 1INQB 3TT3L 2ZX1A 2BHUA 3WLBB 1PU0A 1MUJA 1TG8A 1ND2B 4PF5A 4HCIA 1XL4A 4I3SH 4LLUA 1DGLA 1JS9A 2Z1KA 2ZXGA 1POV0 1QF3A 5T54A 2UWEF 3LRKA 4K5NA 1P7HL 3X11B 5IQ7H 3A21A 3K72A 5F7LB 2W5FA 1G9CA 5EWIL 2X4NA 4LU5L 2ZKYA 2WOBA 2HH9A 1LQBC 3LKQA 2IGTA 3LD8B 4C59B 2W9DH 3BC9A 1EJOL 2ZUQB 2AQQA 3X2QB 3TF7C 4FX5A 4LAQH 2A9AA 3EUUA 5GRJL 4O9HL 4AT6A 1EZLA 4WI4A 2H2PD 2HBTA 1ZV9A 3CVIL 3LKRB 5JOZA 1JZEA 1N0LA 2H8PB 4KQ3L 4WGVB 3OGOE 1UCBL 5JIPA 3DROB 1U8JB 2BNQE 4RMRA 4Z7VE 5I6OA 4FOYA 4GULA 1KCUH 2QHRL 2R071 1RZGA 2N1TE 5EN2B 2IBBA 5A32A 3NABH 4XB3A 4YDIH 1I9RL 4UM9B 4Y1XA 3W59A 5A33B 3AAZA 3QPXL 3IDGA 3Q9PA 2Q5BA 1I7ZA 2W9XA 1W6PA 1HJCA 3D05A 2JWPA 3KR3H 3J7LA 2G30A 3TA3B 2YA2A 1XNDA 4XAAA 5F1OB 1OUXA 1MFCL 3PL6C 2VCCA 1AXTL 3MCG1 1WT5C 1GHFL 2OZ4L 3PV7A 4FBFA 5CB7A 4MMZC 1YYLH 2YAOA 1ACZA 2B59A 5A43C 2R8SH 5A6IA 2QPSA 4JFEE 4Z0XA 3V56A 1OAXH 3EOTH 4YDKH 5FUCC 1JV2B 5T33H 5LGYA 1LP9B 3ZHDA 4DZBA 4Z77A 4Y5Z0 1CTMA 3KHCA 4Y16D 3U46A 3DC0A 3NACH 5C0ND 5MERB 3WY2A 3HS8A 5FFGA 4QTIL 4Y4HA 1OSZA 3X17A 1LGNA 4QHKI 2WYSA 3KLAA 2QADD 4POZC 2E51A 3IDBB 2VDQH 3SPVB 2GJPA 1FZKA 2NNAB 5HDRA 4ZMTA 3CN4A 3L9EA 2DWDB 1ONQB 3H9HB 1AGDB 2GEQA 1DJSA 5IJBC 3B5LB 4OQTL 3ZT5A 4CMHC 2F1AA 4LLFA 1JWUB 4HFUH 3PLQA 1E27B 4B1LA 2Y8KA 4LBEA 4LCYB 5AB1A 1AR83 1J0KA 2VQAA 4KWKA 2HG0A 4YAQB 4AI1A 3UKVA 3QFJD 4LARH 1QEWB 1JXGA 4HBCH 5DEFA 3HMWH 2WSDA 3JZ7A 2KD7A 4BQCA 1HXS2 5CISA 4RFOL 2X4TA 2X44D 5DAQA 1U8OB 5FA4B 4I3RH 2XIIA 4GW1B 1UZ6E 3JVGC 2NQYA 1RIUL 2ZXBA 3KPLA 1FV3A 1W90A 2HMIC 4TNVF 5TF1L 3KJ4B 5AW4B 2OKXA 5JUEL 4L4VE 1Y18B 3B2UC 4FPGA 3QNZB 4JY4B 1E5BA 3RVWD 3MVSA 3O2DH 5CU9A 3ESMA 3B8SA 1NG0A 5FUOH 3G6JF 3O4LA 2G19A 4QM9A 3RZKA 1A1MB 1QZ1A 5DQJA 5D8AA 5GS1C 2VM3A 4LSTH 4OKVB 3VI4A 2O6PA 3GO1H 2ZG1A 1BYNA 4JZRA 5FECB 4J3SA 5IW6A 4AEKA 4JM2D 2A6YA 2RR11 2F8IA 2Q10A 2DUQA 2FTAA 3CAFA 4PJFE 3F7VA 4FMFA 1OM3H 5FUPA 2BK8A 3N42B 2YZ4A 5FOBA 4IHOA 3OYWB 2DLFL 1MAKA 3GMRA 3GJFB 1QRNE 5DD0H 1NKOA 5C0FB 3UL4A 3IPVB 5TQ0L 15C8L 4RBPH 2AXGB 4YH6A 2RS52 2R043 3CHPA 4LVOC 2CCVA 4I0WB 1AR1B 4UT7H 4ONFL 1JU4A 1TENA 2VCOA 4AUUA 5I6XC 5EIYB 2CO2A 1MF2L 5I6PA 3T1FA 4FT8A 3WNPA 3DRTB 3VDCA 1XF3A 4HJIA 4LEOA 3H7JA 3VBFC 5B4XA 1QACA 5GSRB 4LUMA 1BMWA 3H50A 4H8VA 4P2QD 2F61A 1N6UA 1DF0A 2GG1A 5D7SL 5FREA 3P4LA 3DO4A 4N85A 3U6RA 1H6XA 3RWCA 1A22B 4RHV2 5JHLA 2FBRA 5MI0B 4DGIH 2Z92A 5E89A 1RIVL 4UT9L 4Z95L 5KVFE 4ZXKA 3F00A 1G7LA 1HKLL 2WJ5A 4JVPA 3WG2A 2BC4A 2M26A 2HWE3 1YNTF 5LNDA 5F5AA 1BQHA 4JGYC 4FP8L 4AX3A 3EYFB 4K2UL 4BZYA 1MW3A 1OSPH 4X6BB 3G5XA 1BYPA 3CFKB 4QRPA 5F88A 3TCTA 1PGL2 5I1CH 5HCFA 2PHTA 4X4XA 5DAVA 4I0KA 4RISL 3U7WH 4DTGL 1TUPA 1HX6A 4D6QA 3KYKL 3BSZH 5IESH 1F3RB 5IQLA 1CG9B 1KG0A 3MCLH 5HHMD 4HMEA 1HHJB 3NSTA 4B27A 1VB2A 4OQ1A 4Q0PA 1RK1B 1MFBL 4ZNEE 2GK0A 4ZUWA 4HH9A 5HDLA 2E7MA 3VXRA 3DTDA 4D7PA 3U4EB 2X5IA 1LEGB 1BZWA 4ETYA 3KMHA 2FIKB 1ZT1B 2LLLA 4V33A 3SBWA 1XSJA 4JY5L 1XSRA 3QDGE 4BDVB 3L4VA 1B88A 1L0YA 4OU3A 1AUYA 2IGFH 2JXMA 2VLJE 1Y07A 5AVQB 3CZGA 2BY2A 5J8OA 1EANA 4IU2A 4G6JH 1J1OL 1HDMA 1UM4H 4U1SB 5EUOB 1T22B 3V7MA 3UJOA 3LWCA 1SACA 4M1GH 2ZCKH 1DQQB 4OF6A 4KZDL 4IRZL 4COVA 1Z3GH 5FYJL 1OP5H 3RPQA 3LV3A 3NV1A 4BWTA 1BZ8A 4M7ZC 1KB9K 2OJEB 5I1GH 1UOWA 3IN9A 2W0FA 3LNDA 4KO6A 1AQKL 4X6CB 4Y1UA 4MJJA 5A3PA 3DBXA 3DXTA 1UWWA 1DFXA 1EJ8A 2VOWA 4ZFOL 4PDWB 1E4XI 5T52A 3L45A 4CPBA 4PJ7B 4PS7A 4LOTA 4YGEA 2VW7A 5HYJB 2H1PH 2ZKNA 1R091 5CYYA 1RZFH 3VU2A 1SXSA 5KYYB 4LLDA 2AQTA 1LD9A 3GTVA 3UAJA 1BQRA 3IJYA 3OKNB 4UM9D 4ENZA 2O8QA 5I1IL 2JX9A 1LOCA 2UXTA 1BD2A 2BVVA 4M61A 4C90A 3H4FA 4Y5VB 2QQKH 1GFF2 4XVHA 3BCDA 3ZYJB 1HQRB 3PWJA 1YPZA 3FDWA 5DK0B 1OGAE 2ZUTA 1CFQB 1JK9B 3MV7B 3QO0A 5BUPA 3I2HA 5FZOA 1CGTA 4KTEH 5D2LA 1CAUA 1CFVL 1P53A 2EYTA 3QJFA 4XI5D 5I8TA 4PJCE 3ILDA 4B50A 4LSRH 1CLOH 1IZ3A 4U1GC 2IALA 3WDHA 5SWSB 4ZUTB 3UP1A 1AYM3 5FZBA 2WS92 1GS6X 4K94L 2PTTB 3F6JA 3MRCA 1JGLL 1FPN3 4P2OB 1QVOB 2Y2YA 1J1TA 5IK3B 2EIDA 4EDWL 2A7AA 2QE3A 5FMOS 2PHLA 5MENB 1CJDA 3QXTA 4HSQA 1G6RL 1HCYA 1O6SA 1CDGA 2OXHA 4L3FA 2RVAA 1MY5A 2L04A 5TQ2H 4X4MA 1CE1L 5HGHB 4I1NB 2EH8L 2RHPA 1H8VA 1BAWA 3LPOA 5CEXA 2AEYA 1OAZL 3N3HA 4G3YC 4IV1A 5EOQH 1ZZ9A 1QUPA 3MZHA 1WUNT 2EDHA 1OSEA 4N5EC 4JREC 3DV8A 1GC1L 4MHUA 1DN2A 3MKGA 1H2NA 2F8OA 3QUYB 3SMHA 4LLOA 1UA7A 2X42A 2UZXB 3VFSB 4AQ1B 4CMMA 4RS5C 1ASPA 1IQDC 3KYAA 5C9JA 5KZCB 3OGCB 4UMGA 4R52A 1UG9A 5HI4D 3T4YB 1HJBC 4KQ7A 2VO8A 5JXIA 1SNRA 4AGQA 2H0JA 2CL2A 4DQOH 1NANH 1T6BX 2HH0L 2QVMA 3UYPA 2Z35B 2VDLH 1YQCA 4N26A 1DBAL 2QGDA 4FLRA 3F7LA 4QQHA 3HC3L 2DPKA 4WM8C 4CCDA 5K0UB 1ZEAL 5G04L 2ZPXA 4COYA 2D3LA 4KJYA 1HEZB 1ZXKA 2VR6A 3NT0A 4NAQA 4LK7A 5KHIA 2UY6A 4ARXA 2J4WL 1EFXA 3RJOA 4J6GA 4P9WA 4XCNB 5IMMB 1CXLA 1XXFC 2ZQKA 1QA9B 4MNQB 1I9RA 4EN7B 3KDPB 3BKJH 2YD6A 3AQZA 3GXMA 5TH2A 1AP2A 7FABL 1CTNA 4FPEA 1XGYL 4AQSA 1F6AA 3GBMH 3ZDWA 4M43L 2WTPA 4RRPM 3IDIA 2VSMB 4Y4KB 1RZJC 5FFOA 2R1YA 4XNQB 5JO5B 3QEQB 4BOWA 5BO0D 2OZ4A 4B53A 1BREA 3OAZH 4NC0B 3UMNA 2CDEB 4H4NA 1GZPB 1JGEB 1AR1D 1KLFA 5LBSH 4NO4A 3WD5A 3GMNB 1EEYA 4H1LA 1WFJA 3N6YA 1OUSA 4PP1D 3AKRA 2UZIH 1FHGA 4P2YA 3O1RA 4CDWC 1S6NA 3M70A 1I82A 3QEGH 2UYAA 5FUZH 1Z3RA 2WIIB 1D5XA 2J73A 2X09A 3BAEH 4PRHA 2PCPB 1LDPH 4FLSA 3SBRA 1L3WA 4ODXA 3KPRD 2APXA 4Y19E 4PLJD 4B9FA 1NBYB 5J3UA 1VLNA 5IROD 4BQWA 3BUQA 5FZ1A 3UTSE 4CA9A 3DWTA 1QLEB 4HOWA 3VDDC 1OCWH 4C91A 3D25B 2NRDA 3EYSH 3BALA 1E9OB 3OM3B 3ROUA 4BH7A 2CO1A 4RFEB 2GFBA 4YL4A 4RA3A 1KEMH 1KXVA 2A0LD 2XN9A 3D39A 4X6DB 3S36L 3U07A 4EUPG 2EUWA 1ULVA 3WXWL 5JA8B 3T0DA 3HNTL 1MFAL 1BVKA 4TLUA 2GTWA 3KBHE 3CC5A 3MCYA 3GSWA 1W6QB 4Q8BA 2Y22A 4NO5B 3VVVA 1TETH 4TOYL 2VMCA 3V9FA 3VBUC 4Y89A 2X1XR 1NPUA 1MCPL 5CIPA 1KFAH 5TE6H 4E41A 4YE4H 4QRRA 4C56E 4URKA 4O2EA 4YWGL 3B9KD 1WWYA 1K4CA 2P5BA 2P42B 1ZRCA 4OIAA 1DBJL 1L9OA 1NCWL 5T3XE 5FO7A 3U30C 4MXQD 4XMXA 2GDFA 8FABB 3PUAA 3N43B 4PVNA 5CBEA 3QUXB 4JGJA 3WDTA 3WE6B 3VQLA 4LBLA 3NJFA 2K3TA 4BCZA 4ZZKA 4Q1PA 3SIKA 4POYA 5J89A 4AH2B 5GGUB 5EHDA 4KTYA 1EMTL 1AGFB 4ZTPH 5IFAL 1XX9C 4FFWD 3UBXB 1IM9A 1TEGA 4OZGA 3AREB 3ROLA 1EXUA 3WIFA 4BQ9A 2QZ2A 5KXDA 43CAB 2XV0A 5HYJD 2R0KL 5B8CB 1VBC2 4OCWL 1A14H 1SJXA 2V4VA 4PJAE 3PGFH 1UOVA 2JE7A 3BO8A 3NRQA 5D1ZB 1A64A 1B4LA 4K73A 5E16A 2JFCA 1PS3A 4RGNC 4X7EC 1OFNA 4E0RA 5FKAA 1L6ZA 3NCJL 3R05A 1E5YA 3ARGB 3VBHB 4UYBA 3GEWB 1Q9WB 3MV7D 4LT7A 4GY4A 3EADA 2VR8A 3L9RA 3B5GA 3IMUA 1JHTA 1UJ3A 2WNUC 5E6HA 3UAFA 3WO4C 4KO9A 4X80L 2UWAA 3ALPA 2XR4A 1AR93 4FOWA 5SWSD 1E8ZA 3GRBA 4KROB 3KVQA 4NBXB 3D06A 1QLRA 1GV9A 3ZQXA 1DBKL 3ZDZF 1QUNA 1IGIH 1QJY2 5DQDH 5K9KB 4MMXB 4FQHA 4LPVA 3KPSB 4P2OD 3TA3D 3WYRA 1V0AA 4S1SH 3S57A 1EPFA 4G7QB 5EO9A 1MR5A 1DLHB 3V0BA 2BINA 5MEND 3J2PA 3GLAA 4QNPE 4M1CC 5B1CA 1ACYL 4TVPH 3O81A 1YUKB 1NMAH 3GSUA 4QX0A 4N8PA 3LVEA 5DDHB 3VA6A 3SKJL 3ARSA 1A02N 2DI9A 5ACMA 3K2MC 4UILH 1QI3A 1VE0A 3QPQD 4FQQB 2ZAGA 3O3DA 4FXKA 4POUB 4ZAKA 5B1AB 1NA1A 1SLTA 2ZX4A 1VR3A 3VB9A 4Y88A 2UWEA 4NO3A 4TLKA 3O6LL 3IGAA 3L9YA 5E88A 1SHWA 3LRHA 5JZGB 3QUYD 2FSEB 5KSBF 4XXCC 4WVMA 1I8IA 1GR7A 5KZCD 1D5MB 3C2AH 3G08A 2Q9OA 2JKWA 4GI8A 1CGPA 1T7XA 1POQA 1P9MA 4JHWL 2IO5A 3V6OC 4ABUA 3PWNA 1UIKA 4LLWA 2Y7NA 3RGVC 3S96B 3VFWA 3QZPA 4IRZA 4XZUA 3ZJAA 1FL5A 3QQ9D 3UG5A 4FABH 2DJ4A 1I7UA 3QB7C 4ODTL 1JDCA 4GW5A 4P3DA 4HT1T 2F54D 5JTWA 4Z7QF 1PIV3 2ZGKA 2P49B 1BQSA 3VXME 3JT0A 1LE5B 5FLHA 1DBBH 1HCFX 1AJKA 5BPPA 2XJVA 3TU6A 1BFVH 4PJBB 4FOMA 1F2QA 4GKZA 1NLSA 2DEXX 1AXZA 1C5CL 4UBGA 5A7NA 5BNPA 3LKNB 1TNRA 1YEEL 4IE0A 4JO4H 2XQBH 4IGBB 3BEWB 4G6FB 5C08E 4DGUA 4ELKB 4Q9CA 4Y4KD 5IHUL 3NPSC 2W1SA 1IKOP 4GRLA 3IZOA 4HLEA 3QEQD 1U95B 5FYHA 1D7DA 3JTTA 1PM4A 3IU3A 4LE8A 3LS4L 2D9CA 2BWDA 4H0LC 1ZLEA 4HS8L 3MJ7B 4KMTL 1H9DA 4DKEL 3WP3A 2L7QA 4WNQA 2B4CH 3OF1A 1HIML 1GY2A 2VXVH 4JPVL 4OCSL 5F70A 4AYBA 2CG9X 3FO1A 3KE0A 5MP6H 5DI8B 2YOAA 2EYRA 3D12B 5B7FA 5I5MA 4HIPA 3MLPA 3GD1C 3H6AA 4V2VA 1A25A 4PI0A 2BRTA 4Q56A 3P0YH 1K85A 1UYWH 2CLZA 1VSCA 1WCDJ 3KVPA 2JJSA 1G6RA 3EJTA 4TWTA 5AVZB 4TYSA 2YPKA 2F74A 4XBEL 3VCLA 1FNEA 4NENA 4AYFB 4X6QB 2JWYA 1GSLA 4AHXA 2AVFA 5C0RL 1YHPA 2X9XA 2YGPA 3C6EA 2EVFA 4Y4FA 3PMEA 3NIDE 3VX0A 2V9UA 3LB9A 4DP2X 1FNSL 5F7YC 3GSRA 5IVXB 4MSWB 3GI8L 4Q4Y2 1CICC 5A3NA 3MLWL 1AYM2 2ROYA 3JXSA 5GRXG 1AQ8A 5IMLB 1OF3A 4E9XA 2PW1B 1IIIA 3LHPH 5DEGB 3CDFA 3EH4B 2IPUK 1DQ6A 4NNYB 1OARH 2D03H 3FHQA 4N87A 3QNYB 4X7TB 5CJXC 1S9XB 1YQ8A 1DSWA 5H9PA 3QO1A 2ZKLA 1MNNA 2BP5M 1PG7X 3P3YA 2XZAL 2CWRA 3BP5A 3T3MB 1FPTH 4BKSC 2VNOA 3CFQA 2ZYHA 1QOTA 4WV1B 1EZSA 1NCRC 2ICWB 4GRWB 2F68X 1SYSB 4L1LA 3ARBA 4D8OA 5JOEA 3DJ9A 3FPYA 3K3OA 2JTYA 5CLWA 4S2GA 3DK0A 5LDSA 1VEMA 2XMLA 2AV1A 1E30A 4W9LC 2VWEC 3SDDA 4M3JA 2C5DC 4K5LA 3D8MA 3LN5B 1RFDL 4JKMA 1ZLUK 5DUXA 1P4LB 3QUXD 5IWLC 1EBAA 1ZHNB 4U6YA 5C92A 3KV9A 4R4BA 3GJBA 5GLTA 3RPIA 3DYPA 4NJAL 3VXPB 5IR1A 5CFCB 2C9UA 1KNOB 3CNKA 4NUJA 3X3FL 4J8RA 2VO5A 1KJ2B 3UH8A 3ARED 4X7SL 1OOAA 5FKCA 3GUFA 2V17H 3CSBA 5DK2A 2OYZA 4Z2AA 3DJTA 5C0NC 3ULVH 2OS2A 1LO2L 3LRLA 4IIQB 5FZ7A 2QADC 3HVDA 2ATFA 1FFQA 3LEMA 5BJTB 5D1ZD 5LAXA 2A71A 1J11A 5CLTA 5BW7A 4WWNA 3MV11 4J3WA 4FKHA 1HRI2 1YVLA 2VVFA 3ARGD 4MDIA 5E4EC 1RUJ3 4ZFGH 2C3WA 1XBDA 3FTVA 2WAHA 1ADQL 1SXZA 3HZYB 3RAJH 4CDUA 1ZLVH 4U1LB 4WK0B 1BCIA 1EIBA 1QJX3 3H42L 1G1OA 2VXJA 3SNMA 5DGRA 4NRZA 5GRYA 3TX4A 3O3EA 4KROD 3MLZH 4XFIA 4HSLA 1E5RA 4IJTA 4KQ4H 1TLKA 2QGBA 2R2EB 4Z3GA 3FBKA 4FXLA 1W6OA 2Y6SD 3KPSD 5C4WB 2YXVA 1OE2A 3A4EA 4N90D 4FHJA 4XVSL 2XYCA 2CK2A 1C08A 2XZQH 3QAZB 5JNYA 1H4HA 2OLDA 5F3BA 5F1NB 4GB32 3VKNA 5BRZE 3HZVA 5F0JB 4KVPA 2VBDA 1Q90A 1QSFB 5I6LA 2HWB3 5FYCA 3RVWC 5FGCE 2X87A 3FXIC 4DOHB 2R0LL 3WFCL 3HRZC 2XKNA 2Z0UA 1LK3L 3DTXB 1GUIA 5J7MA 3VBSC 4EVNA 1SZNA 2DTMH 3FT9A 1DCSA 1XFPA 2MKWA 3T2PA 2ZP0T 4JM2C 3TBSA 3BKYL 1E4JA 2B16A 3WD5H 3JV4A 4WWKC 5F32A 3ZK0A 4W9IC 1T1WA 2VW4A 4PBWD 3V2AR 5AL0A 5F71A 1PMHX 1MHPL 3VYOA 4IEPA 5DSCB 2AITA 4NO0B 4E2OA 5D71L 4GMP1 2JLLA 3OKKA 4K3EL 1R64A 1X5FA 1X9RA 1PFCA 4WM7B 4UQIM 4BKLA 5EZOL 4AEFA 2YGMA 2P52A 4W9HC 5HP5A 2AHIA 5L73A 2EXWC 4MBOA 3QQ3B 5ABJB 3MUZ1 3G6DL 3MRGA 3QORB 3QIBA 4AL8H 5FYKL 3QYNA 4Y8AA 4AHWA 2XNAA 1JNJA 1GVIA 4HKZB 4NWVA 2JDHA 2XJQA 3AQYA 4JS7A 4XBPB 2D7FA 3CL1A 4LJHA 1OPOA 1IHMA 4HIJB 1O4YA 1R33A 2AF2A 4GKOA 2PHRA 2K7PA 4UF0B 5KVDH 2W68A 1NINA 4HLZG 1A4BA 3DMMA 2YD1A 2CGOA 3O41A 4IGBD 4G6FD 2ZG2A 4Z7OE 3BMWA 1CAWB 4A3ZA 5IIEB 3B8YA 3EDKA 4I85A 4BFGA 5LXGL 3S37H 4I18B 3KDMA 3Q3GB 3M17A 4D9RD 4DMIA 2DMCA 3DUSB 3BIAX 3H6JA 1QRKA 4XGZB 3AM2A 1SZBA 2WXMA 1R17A 3NN8B 3IMMA 1VACA 1NGQH 4EI5A 4JDMA 2X6MA 5AAPA 4M6OH 3DK2A 1LO5B 4UW5A 1D0HA 1Z6JT 1IFRA 1L3NA 4GIOA 4QF1B 5IVZB 4CVXA 3FBQA 1JFQH 2BXZA 3GGWB 1LTEA 4XMKL 5F8PA 4WHYG 3CX2A 2OYKA 4S2DA 2YFOA 5C0IA 1OHFA 5FCCA 5FO9A 2C9KA 4QX2A 4I88A 5LA9A 2XFXB 4BBWA 1J59A 5DS1A 4L23A 2K7QA 1SVCP 4DY5A 3L3GB 3N55A 1A3KA 4ZKTB 1R24A 1R3IL 2AJ3A 4ISVA 2Q6WB 1B35B 3B9CA 3MBXL 4WUUE 2IJ0C 4PLMA 3MROA 4QD2A 1YY9D 4FRWA 4AVSA 3D9AL 1O59A 4LASL 4TNVK 4GLRH 4Y4YA 4UDUB 3LD8C 3KJ6L 3HLKA 2DU1A 5E1IA 1IAIH 2XOTA 4H44C 2IQAA 3N9GL 4K21A 3TWIA 2ZHMA 1YMMB 3QFDA 2W81C 3CN3A 2Y5TA 1BOGA 1S7UA 1UGNA 4HIEA 4OBRA 1WW5A 3B93A 2K0RA 3FTYA 3NUKA 5AVAA 1SYVB 3G04B 3NA9L 1KY7A 1NAKH 5JW4Q 1DG6A 5LNGA 1R1ZA 4PBDA 3O6KL 4FNQA 4R4ZA 2MTAA 5HCBA 3BAYA 3UTTA 1CLZH 4KPHL 3GB7B 3AROA 2NCMA 1EGJH 3KF5A 3WXPA 4HEPG 1J8SA 3LEXB 4UQ3A 4PPTA 2HFFB 5DJ8A 4BHPA 2OMTB 4KY1H 3VH8G 3NEXA 1ZZ7A 2O8OA 2W2IA 4ZS7L 4OHXA 3AJZA 2PTVA 1KSRA 4WJG3 5GGTL 4E5XB 1SXBA 2MMXA 2OW6A 1GJWA 1UXSA 4QRPE 3DX8A 4DVBB 5HYSB 4FTEA 3ES6A 1U30A 2FX8L 3L9BA 3ULUD 2NYYA 1PGL1 5JHDB 2JCWA 4XI5C 2K6YA 1GGBL 4MAZA 3KS0J 3RYKA 3NSJA 1INDH 4BK4A 3GUTA 2BVPA 3OXSB 1JF6A 4A2HA 2C1PB 2D0FA 3N9LA 4LBQA 1FN4B 5J4MA 4OZIF 1YMHA 1MPAH 1PY0A 4FPOB 4QHMA 1PYWA 1JDAA 4FYQA 2QTEA 4LDCA 5DEZA 4A2MA 3CVCA 1F6LL 2VDOH 4M7JL 1Z7S2 1KPUA 4ASLA 2BP0B 4O5LL 4YIQA 5A7QA 2BHYA 1WW7A 2BP3A 2ADJA 4TLSA 1ZKAA 3OZ9L 4GIAA 1FFTB 1GZTA 4QQLA 4YFDB 5FZAA 2J8UA 1TQ5A 1G1YA 5GHWL 4PWGA 2ZGNA 3QZWA 2X6CA 1YC7A 2GJZB 5AOKA 2CBTA 1JXDA 4ZO9A 3OG2A 3C8KA 3WN6A 3AKTA 4AMKH 1HKFA 1VFAB 4PWEA 4YHLH 1MLBB 5EFUA 2DTSA 3RWGB 1U8KB 2NY6C 1NC2B 4YVSB 3VZOA 2RHEA 2FHBA 4JFFA 2VJ0A 3F95A 1S0EA 5GALA 4QXGH 1QMUA 2AW2A 2BRRL 4NNPL 2WZEA 5D7IB 5HI4C 1U3HC 2G5RA 3M07A 1LILA 1ORSA 1SXNA 5ERWB 3TT1H 2VQ1A 1PY4A 3S5LB 3C2SA 1YDPA 3N91A 3GF6A 4K55A 4NKIH 1HE7A 1FVCA 1WV7T 1MIMH 3KPPB 1BD2E 2COQA 2F1BA 3NDYE 1QSFD 4F57L 2D44A 2QQOA 4L9DA 1WBZA 4U49A 3OSKA 1OQXA 3DX2A 1U2HA 4LLUB 4OSUL 1YPZE 5EA0H 3RILA 3I7DA 5JDJA 3QLQA 1MCEA 1R1A3 3VE0B 2AC0A 3B3QE 3ON7A 4L8CA 1XTMA 1S7XB 3STZA 3SY0A 3DV6B 4P59H 3NSCA 1CBVH 4DS0A 4K0OA 1TCRB 2IWGA 3M7AA 2NXZB 1MFVA 3MYJA 5FIEA 4BQ1A 1I3HA 3WS3A 2O1AA 4RGOL 5D70L 4F8NA 1L9MA 1OVPA 2WB7A 2PCXA 2UY7A 2W94A 4NO0D 3ETBF 3U7YL 4AJ0A 5CNHA 3GQFA 1JYVA 3K2OA 2Y24A 4X4ME 1AR1C 1UATA 1JTPA 4A04A 1H6TA 3K6DA 4X5PA 3QORD 5A32B 2FX7L 2ZGTA 1ECYA 1L6XA 1YYCA 3BP7A 1VALA 3BVCA 1R0AH 4JBSA 3NJJA 2ET7A 1F35A 3GCXA 4OLYL 5DHEA 3ULVE 4RAUA 4HX1B 1INEH 2JSFA 1VHPA 4XBGA 5KN5B 1AD0B 1H6UA 1I4FB 1SLXA 2G2PA 4OV5A 1E5CA 2DVGA 1ZT7A 3WG4A 2OQJB 5C3IA 3WEXA 1A2YB 2W91A 5DLML 2VZ1A 1R3JB 4LF3A 1H8LA 4XP1H 3SDXB 5K93A 1CI5A 1T1XA 1D4M2 3JCIA 1RVFL 5CILH 3PJLA 2VW2A 2Y07L 1XU1A 4IEQA 4XNZB 4ZW5A 4HUXB 5MEQB 3FWEA 4W6XA 3RZJA 1ADQA 4DZBB 4KRPB 1KELL 4O4YL 4AUJA 1D7PM 1VGKA 4PQXA 4NAOA 3EB7A 2IFFH 4IE4A 4UWDA 3ZXLA 1OSZB 2CV6A 2YU2A 3FFQA 3KLAB 1MZYA 3Q13A 5GJSL 3LJ3A 3WIIH 3DPRA 4HWNA 1VBA2 4XCYA 5AAWC 3R1GL 1PIGA 2A5UA 1U8CA 2ZOWA 3KGRA 5F96H 1G1KA 5KG9B 2R0HA 3X14B 3KCWA 3NJMA 2L9LA 1OB0A 2X10A 2QGEA 3EYOB 3P9LA 2ZZQA 1NMCB 2AABL 4P5TB 4TN7A 5DRWB 4KI5M 4BIOA 3ARDB 2EZ0C 1F3JB 2XWTA 4P4RA 5IK4A 1VRH3 4J3XA 4LBEB 3GHEL 2IBZY 3CSFA 3GZOA 4GUPA 5LAPA 4MCYB 4ECNA 1ALYA 3IJHA 5DEFB 1S78D 5AUMB 2H32H 2YSSB 3IWVA 3B9KC 1SY6A 4G9DB 2WTRA 1ZSHA 4TM9A 3CJJA 3X12A 4YZ4A 1GZWA 5JOYA 1A6UH 4KZEL 1Q43A 4XF9A 2M2DA 5JR1L 4V1DE 1F97A 5KC6A 3H54A 4P06A 1YMMD 3DO7A 3WQ1A 1P6WA 3CK0H 3VZKA 1W3XA 3RDTC 4OUUB 2G75B 1NIBA 1WH0A 3OLEA 3GRWA 1IS3A 3O4LB 5D8AB 2AVGA 2VC2H 1D5IH 4PRHE 4X9GA 4AYDC 1JPGA 2FL5B 3IE4A 4XN4A 3SCMC 4KUZH 5L4IA 1TLMA 4B97A 4BGDA 3AXEA 4IXLA 1EUUA 3VI4B 1H19A 2H2SD 4UU9A 4CUGA 5IW6B 3SDYL 1M4KA 3HJRA 5JOWA 3VFRB 3TTYA 4H20L 4LSQH 3WUWB 1MREH 1S0GA 4GQ7A 4PBOA 4ZMPA 4CSTA 2UY9A 4WLCA 2VZQA 3WKNA 1XBRA 5F9TA 1Q1PA 1O5UA 1JNNH 1LL1A 2CZNA 3W0WB 3DA0A 2R56L 2DDQH 3LMJH 4N53A 3L7EA 1C4RA 3D39E 2XN9E 3FHIB 4H3WA 5JHDD 2XTLA 4HVBA 2XWRA 5LY2A 1B4TA 3MUHL 1Z1WA 4NQVB 4GEJA 3FQTA 2RFXB 3I2GA 1KBVA 5HHPA 3CFDA 1NAML 3PY9A 5IB4B 3MJ8B 3V52H 4GXVL 2R062 2RS13 3W2DL 1CX4A 3MMEA 2OXBA 2CBPA 3MBEA 4P2OC 4SBVA 4TQPA 5I19H 3UJQA 5GLVA 2AK4B 2VDMB 4E41E 4QRRE 3PUUA 3CFEA 4JPKH 5HHOA 4S1RL 3ZRSA 5BZWA 1LLAA 2FHCA 4IS6A 3E2HB 3HOGA 2X2UA 1N12A 3OJBA 3DXUA 3FUOA 4JFTA 3PUSA 2WINB 1UKQA 4M7KL 3WNNA 1GJUA 1Z9PA 2VN6A 3QPQC 5DT1L 1LVEA 3BWSA 4DEQA 3BDXA 1OVZA 4WDIB 4Z7WF 1QWRA 1VAVA 1RUAL 1G0DA 3VFTB 5F88B 3WO3B 4A7GF 4CNIB 3BIKA 4DP6X 2KMWA 1PF3A 1WLHA 4FQIH 5BNOA 2X4OB 4B4RA 1A8DA 3GHBH