4ES8A

Crystal structure of the adhesin domain of epf from streptococcus pyogenes in p212121
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
302
structure length
302
Chain Sequence
EELPDDLMNFKGTWEVSADGSSGRFFSKGATDSYVFHLIPAKDVKKPGWREHNEVKDSYIKIDKQSIAARYKTSTTAPYSVAFKVNTKSLIKDHDYKITFEQGQIASGITVDYRIGSAFNKTTDDSFKISDESKYASNVKIEGEEQGFKQREQGDKTISFRTLKEGPMSLVLLSKVEKKPQGDLDVEFKNLKIIDVTNPSQLDKGVAYVGNKNVQLTLKSDDGRTNFEGDEISLFNSRGELLQTVTVTKDQQNPISITLSEDQAKSLKNKEKLKVSIKQKQSKKTSKDFFFEVGIDPKVEAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Extracellular Protein Factor Epf from Streptococcus pyogenes Is a Cell Surface Adhesin That Binds to Cells through an N-terminal Domain Containing a Carbohydrate-binding Module.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
molecule keywords Epf
total genus 80
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4es8A02
2.60.120.1240 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4es8A01
4ES9A 4ES8A
chains in the Genus database with same CATH superfamily
4AK3A 5KVEE 2NR6C 1ZS8B 5ID1A 3RZCA 4MJ4A 5A2FA 6TAAA 5LK5A 4EIZC 4EN3C 1HHHA 3VMPA 3D1MC 1D6EA 2HA1A 4ZUUB 4YPGA 4ZPTB 1KYOK 1LHZA 4MAYB 5I24A 2XJVA 3STZB 1RUNA 2OM5A 1OAUL 1AL22 3IWUA 2XG3A 3U9UB 2D3PA 3VI4F 1PFOA 4MGSA 3CHRA 3AG1B 5FYJL 4JNXA 1X5YA 5K9KB 4N7UA 4POYA 2ENJA 4HIHA 4YIQB 4PGBB 2Q8OA 4XNBA 3UC2A 2IV9A 3RKPA 5J7MA 4YSPA 3BVNB 3KPRB 4WW2F 3CDGB 4FFTA 3UADA 5EDSA 1HX6A 1F1GA 2APTA 3ULUF 3KL0A 2RJMA 3ZDYF 3MRJB 3Q01A 3FT2B 4JW3A 4NQXA 4JO2L 3UTQB 1GWMA 3T1MA 4COZA 2NY3C 3CK0H 5FK7A 4NQUA 2VDPL 1QHQA 2VYRE 3IWZA 4OGAC 3EH2A 4HCGA 3NSFA 1WMXA 1BECA 1DSYA 1SCSA 4KNCA 2R56L 4WWKB 1G9BA 1S6NA 5K9YA 3MLUH 5FM8A 1JBJA 1DUYB 1WBXA 4LSQL 4X5WB 2CYFA 2XL7A 3MREB 1WCQA 2CM6A 3NAPC 1I8UA 3VXSE 4G7RB 2BC4B 2YD3A 3O2VH 2EADA 4NKMB 4K7PL 4XP1H 3QZBA 2CPCA 5EBMA 5GZNC 4YM1A 1EJOL 1NOAA 2G4GA 3OG2A 4PTUA 4R8HA 1RJZA 4A6OA 3K6DA 5DSCA 5D7LD 4H8WL 2VNVA 4I2XB 3BPOC 3BYTA 2Q20A 1GLHA 1R083 4IOFD 1CGPA 1YEGL 1NC2B 1SJXA 3LZRA 2VN7A 2B4CC 2OCFD 2YAHA 1ADQH 3NCFB 4YFLF 4ATTA 5JQ6L 2QMJA 3DJSA 5JZ7C 2Z5WA 4DP8X 1HKLH 4WI4A 3THMH 4GBXB 3W9EA 3H6JA 1EY2A 4XJAA 3HRZC 3ZR6A 4UNTA 5DEZA 1DDTA 1ND0A 5D7JD 2EUVA 1MVQA 4OLWL 5D2LF 1JYNA 4XC1L 3VRIB 1IILE 5DHVA 3SD5A 5I6LA 2HWF1 2J5LC 4OJYA 3OXRA 2NY5L 1RUI3 3LIZA 5JHLH 1OAJA 1BJ8A 3KD4A 5AZEH 4BFIB 4ZFGL 2YFNA 5EIIA 4FG0A 4L8SA 4PRBA 4X83A 3LA7A 3DVGB 2IALA 4ET7A 2EEBA 4UFJA 3QUZD 5C08D 5IWLA 3BTAA 1FNFA 1FL5B 3EDEA 3T3PF 5HHQB 2NZ9A 5DD3L 3ARYA 1YQ6A 4UAOC 5I19H 4Z7UF 3CDZB 4Q56A 3T3MF 3D82A 1CX4A 4A1RA 1UGKA 1QFUL 1JZ5A 2P5WE 1SDYA 4YDLC 4OZIE 3QDAA 1CGUA 3AUVA 1MPAL 1P0SE 2GIMA 5DWUL 3ULSA 4CC4C 5C0CD 4AVTA 1VADA 4S0TD 2VXVL 2BRQA 3PNWB 1NLDL 1S5IL 2FWOB 2MQCA 1Q8MA 4ZUWA 4KKRA 5KJ4A 2NLJA 2BGOA 1A14L 1SUHA 2BHFA 3CMGA 1YEFL 4HC1H 3A4AA 4OCRH 1N0LA 1EFXA 3MROA 4YFDB 2WSVA 2Y64A 5IVYA 2APVA 3O3AA 3Q13A 2HSIA 5DEGB 2NYYC 4RLDA 2EINB 5I1KL 4C57C 2PP7A 1HDMA 5HYEA 3QQ9D 3ZE1F 1JYVA 5ECGA 2MTPA 1IL1A 2FD6H 2GFBA 1MQTA 1I6XA 3VFMA 3S2CA 3ABGA 2BS71 4ABVA 2VLRA 4PRID 3U2SB 3ZKUA 2QDNA 1J1LA 1HDKA 3WGVB 1FT9A 4W9DC 3QJHA 4E8CA 3P11L 5CXPA 3PAZA 4DN4L 1IQAA 1QXJA 5LK7B 1IS6A 2VDRH 4HZAA 3I02A 2BLFA 1G7QA 4F7MA 5AAMA 3OPZL 1SBFA 1Y43B 1YCIA 3PLQA 1XEUA 2WLZA 1LE5B 1NTDA 3IDYB 3OJDA 4LITA 4L8SC 2YLKA 2FD8A 1ED3A 3TJEH 3IFPB 4KI5E 1RZIA 1YECL 2VCOA 4JZOA 5DMIH 5A3UA 5FHBL 4AL9A 1FN4A 4BHUI 3UIZA 4JS7A 2C3XA 4HK0B 3H6AA 1CZTA 2V5DA 3BWZA 1U8MB 4P2OC 1R17A 1A02N 3NFPB 3DIFB 2IC2A 4MRCA 4RQPA 1YECH 3D0LA 3KM5A 5DXWA 4ZY9A 2LQRA 2RALA 3HNVH 4GRLD 4KBPA 5F9WC 5B39G 2MMXA 3RA7L 5BNNB 2V2TA 1BEV1 2JDYA 1OM9A 3AJ7A 1LB2A 1DVYA 3FSAA 5I1JH 1EYBA 4K9SA 2D0GA 3CSGA 3D85B 1IM9A 4K7PY 4K5OA 4KJPC 1EHKB 2DDQH 4O2EA 5I8CA 1LMKA 2QZ2A 5C8CC 2ZSWA 1T0NA 1UQSA 3EJZD 2Q30A 1HZHH 1GKEA 4OJEH 4HFSA 4NI3A 4Z3IA 4FZ8H 1V9U3 4WTXA 4F7PA 3E9TA 3EDJA 3HOGA 5GLTA 2JSFA 3F04A 1YQVL 3PMSA 4TQIA 2DM7A 4N9IA 2ZGOA 2O6DA 3QUHA 3GZEA 1AKJD 1S7VA 3QG6A 2FX9H 3L9RA 3ESPA 4QRPB 3DUUB 3LQAL 4P02B 4XUQA 2OZNA 2OMVB 1KLUA 3CU7A 1I3GL 1JODA 2W38A 1YJLA 4OZFH 3WDVA 3F6IA 4XPFL 4JRYA 3BOVA 4KRLB 1M57B 1FG2A 1MAMH 1TJGH 1RFDH 3URFA 4NBZB 1UYWL 3IDIA 3RB5A 2VXTL 4H0HB 2C9XA 4DW2L 4IDJL 3HNMA 2FLRT 2HJKB 3QR0A 2ENQA 4GSUA 1KTDA 1CI3M 3NO8A 1HFUA 1TJGL 4WJG3 5CJBA 5ICYB 4Z3GA 3NCMA 4PJFE 2NX5B 3FNKA 3WTSA 2AGJH 4KRPD 5E5MB 5E1HB 3CWGA 5IM7B 1B4RA 2K7PA 3BWUF 4PJ7B 1JOJA 1K72A 1DQDL 3IN9A 3PL6C 2ZYSA 3QUYB 3AQXA 3PWJA 2D7PA 4FPKA 4OZ4B 2WZR1 1G7QB 5T1DH 3CDZA 2BVTA 2ZNXA 2DMKA 4HIQA 1MLBB 1MCSA 4UQEA 5CEZD 2F54A 3KPSD 5A3ID 1KD7A 1R3IL 1HRV1 4JGZC 2IXKA 4XE0A 4CU7A 5SWQB 1IGMH 1TLKA 5HCAA 4MZIA 4X6FA 1FV1A 3RVWC 1DBMH 4QRRE 4WVMB 1P4LB 5IT6A 3WNIA 4APXA 3LYRA 4HULB 4LKFA 2XA3A 2PYEB 3I6GA 1OOPB 2PYED 2O6FA 4ADIA 3FW6A 2Y0OA 1O8PA 2XB6C 1WD8A 1H5BA 1RVF1 4BQ6A 1E5SA 1R1A2 1B2WL 4AEFA 1Q8PA 1LNUA 2Y6SC 5HJBA 3WKNA 5E5RB 1XGPB 5I26A 4WKXA 4GQ7A 3ZMOA 1G9NH 4HX1A 4LBNA 3IVKB 3WS3B 1B35C 2D4DA 4CCJA 1E7VA 1BYOA 4AQ8A 1QLRB 4R4FH 2XXGA 1B2WH 1J5HA 2X70B 4XQWA 3WFEH 5L9BA 4M1CC 4N0FA 1DBBL 4BFFA 2C3VB 5CCKH 3N7KA 4DPRA 4ZQTA 2RDNA 4U1MB 3MFFA 3S5LA 5LGKA 1FCCA 1FVEA 3QC5X 4ZS7L 5BO1H 4HKXA 3BOPA 4FABL 1MS8A 3O6LH 1EXUB 5CILH 2WMPB 1BQLL 2E86A 1PJWA 2K70A 2D7TL 2Q7YA 4KUZH 1TIUA 4PJ8C 3WY2A 4I5BB 1YEWA 4BH8A 5I71B 2D73A 4PRPE 3BUIA 5D4QA 2G3MA 4E9LA 4NNXA 4L2LA 2D7TH 5I16A 4YW6A 3KLAB 4GQ9H 3KGZA 1RUQL 1A3RH 1S9XA 3V4UL 1U8CB 4P23D 5G4MA 1DJWA 5JR1L 5ACA3 2YAPA 5HJ3A 3V0WL 1P4LA 3OKOA 5D7KD 1YDPA 4CGTA 5DR5L 3PGCA 1VEPA 4WVWA 2A6YA 1N59B 2VZVA 2OLDA 2E27H 3VFOA 2D4FA 4WTWA 3ACGA 1PPIA 3HR5A 3UDWA 2C0ZA 4IIQC 4LB8A 4PJGB 2GY7B 4HIEA 5ENWB 2Y6TE 3WELA 3JZVA 5CKGA 2OJ1A 2J4WL 4Z23A 4JQRA 3OKYA 4XZUG 1SJMA 4YDJB 5EU6A 1RUG1 1X6LA 2ADIA 4ZW7A 5D1XD 2OX5B 4UW4A 3FB7B 2BQPA 1H5BC 3CSYA 1UO9A 3CZJA 1QDOA 4Y2DB 4M1DH 1MWAA 1LMIA 2ICWJ 3DDGA 4GRLB 3TNMA 1VZHA 2DQHH 2A2QT 2C34A 4BJLA 2YQBA 3D2UB 1DQ1A 4BZ4A 4WEBH 2VLJD 1BXHA 1IJ9A 1H3PL 1N8OE 3QWOA 3LEVL 3JTBA 2IANB 4UOJA 2W1QA 3TTYA 3GMRB 5DVKA 3CSYB 1ZZBA 3ZVXA 4QPEA 1DQKA 4OV5A 4NIGA 5G5DA 2XPGA 2CXGA 2JD4A 4D7SA 4LL4A 1OTTD 4HOZA 3LZFL 4F7EA 1JOBA 3FQTA 1SJVA 5DJAB 4FNLL 2ODIA 3QJQB 4DP7X 4JY5L 1NE4A 3KPRA 1E43A 4FNRA 2DQTL 1JZJA 5LBEA 2A83B 4PSPA 1DP0A 1S7VB 3QG6B 1W05A 3ROOA 3ZDWA 5F6IC 4NMIA 2JB5L 3PVBB 1SMDA 4WI3A 2MCG1 1D5BA 3JV6B 5D1ZC 3UETA 1RUE1 4OU3A 2PTTA 3PIQA 4JY5H 4RFNB 1YRZA 1PGL2 1ZDQA 1A47A 2G5RA 1Z5LB 1O7SA 1JMZA 1TNFA 1QUNB 3ZFGC 3T0WA 4PRNB 3H0TA 4X6BA 4Y1AA 2ZEYA 2BP5M 1ICTA 2AFNA 1M53A 3CQQA 3QFDA 2X1XR 1XE8A 2PCPA 3GIZH 3R18A 4HLTA 4G71B 3USSA 3FUHA 4ZZFA 3N36A 2G2NA 3BW9B 4WWID 3SE4C 1H4HA 1NZIA 5J36A 3IPEA 4PP1C 2EIZA 3RSJA 3LAFA 1W90A 2AK4B 2Z35A 1UKRA 3W39B 5GIRA 2BX5A 2YD8A 4GAJH 4H7VA 3GCXA 1C08A 3S88L 5FLVA 2Y25A 4TVPL 2E6PA 3D3AA 1OTSD 3NFNA 4JR9L 4PJ7A 3WOVA 3RWDA 2AXJA 2DCZA 5A7WA 4G7VH 2OP4L 4TSAL 4OJAA 3GRWA 3TO4D 3OLIA 3MRBA 4WK2B 4GP5B 5K59F 3NCYS 4N0FB 4RESB 4Q74A 5KBKA 1DSWA 2EXIA 2ZMNA 4OFVA 4QDRA 3V5KB 1UZYA 2ET1A 1IAKA 3G5YB 2IAMD 4TTDC 3ZTJG 3VXOB 5F1IA 1BK0A 3Q2LA 1DVFC 5MHSE 4KDWA 4RNRA 4OLEA 1QR1B 1OB0A 5FV1L 4MCZA 2AJZB 3HE6D 3GNEA 2GIYA 2WWJA 1CR9L 1JYXA 5KJRH 4Y4HA 1G86A 4E41A 5L6YH 1R5IA 1KIQA 4BIKA 2PR4H 5GJSH 1EAOA 1RHHA 4KV5E 3MX0A 1DR9A 2HG0A 3RI8A 2DQUH 2DV6A 5IAVA 2L4OA 5ABJA 4I3RH 1F0LA 3PHOB 1CAUA 3ZFFA 4FJYA 4FPOB 3TS8A 3TJHC 2Q8BH 2OX0A 2TRHA 5MENE 3MO4A 1E6OL 1TLMA 3BT2L 4QKNA 1A8MA 4R83A 4UDUB 1XVSA 4G3YH 1ZK5A 4MYWB 1AY1H 5KANG 4I3RL 4BKLB 2I24N 2OXGA 1OP5H 4KK9D 1W9TA 4CVXA 3ZYRA 3FOMB 3P77B 1KCUH 5JHBA 3I97A 3OC5A 4EAEA 5AFAA 1JPGA 5GS1B 2OJZH 3EGSA 4WBBA 4YNIA 2XNAB 3M7OA 3IMSA 1L0QA 2BS9A 2OR9H 3D8MA 3QORD 4WW2C 1VEOA 2EYTA 3P11H 2V2TB 2X5IB 3D33A 3IAQA 1AZRA 2ITFA 4U6HB 4UTBH 2Q10A 2NNXA 1QU0A 1QUPA 5JXJA 4RGKA 1JPGB 2AXGB 1FFQA 2B1HL 3NESA 4MMZC 3LH2L 4FQIL 3FO9B 4WIQA 2GMEA 1W8HA 4L8BB 2R23B 3LRSB 3W9DA 5JMOA 2I7SA 3TZVB 4B60A 5LG6A 3LKOA 1ND2A 5MEPA 5BV6A 1DG6A 4UANA 4MCYA 1AYN3 3AZYA 1I9EA 3IFPA 1I1RA 1M2OA 3ZKND 2ZHMA 1CXLA 3K6NA 4HWNA 3BE1H 4XBGB 3GIVA 4LKCA 4PWEA 3UBXA 4IEOA 4O65A 4Q4V2 3EJTA 4NLHA 4M62H 1K8IA 1X8MA 4QF1B 3KHBA 2VXSL 1HYSD 3V0IA 1UYXA 4XTRC 2BFGA 4XMKL 4NIKB 1G7PA 4N0YL 3US9A 2DBLL 3TPUB 1M7DA 4CN1A 5IJKC 4KU7A 3RI9A 2BU9A 3KDPB 3ARFA 3IRCA 3P4OB 4X5LA 1RUC2 2WFF3 2N7SA 4QGNA 2YO3A 2FO1A 5IROD 3IEAA 4G80B 1EVTC 1D5MB 3EDFA 1Q8VA 1JNLH 2ZXEB 5BNNA 1HXYA 3WQBA 3OKEA 4RRPG 3K6SB 2VXJA 5B8CB 4I3PA 2V33A 1KXTB 3NCWA 4TUOB 4N6RA 1J5OH 4OHXA 2B4KA 2QQJA 5C8JB 3FS9A 2DYPB 1K4CA 4Q4V3 1T89A 4GRLA 4OCXH 1TETH 1W72A 3S4SB 3WIAA 2BO0A 2VSMB 4MB1A 2B0SH 3GBLA 1JGVH 4UQ2B 5C0AE 1AR71 3WCSA 1TYEB 4MA7L 2EIMB 1G7HA 2J8UB 4FOMA 4EMZA 5CGYC 4YZFF 2AJ3A 2IADA 2NUPB 1OPGH 2QZ3A 1NCNA 3R8BB 1NA8A 5I17A 2BH0A 3KYKL 2RGSA 4D94A 4AVSA 5GS0D 4MDIA 4UM9B 4PIXA 3GB7B 3D4ZA 4BFRA 2X9XA 1TME1 3F3HA 3UTTA 2H6UA 2C5DC 2OSWA 3U2SA 3HCVB 4U1HA 3U0TA 5I8KL 3T0ED 1U5ZA 2GC4C 4X8JB 1D2PA 3U07A 2G5BB 4YDKL 3W58A 1F90L 2FDFA 2EXKA 3VKFC 3B34A 5DC0A 5CSZB 2ZKMX 3ARED 3FXIC 4M3KB 5D9SA 4FQCL 4WU7B 2I5YL 2UWEA 2XN2A 2JQAA 3CPLA 5IGXH 2HKXA 4H88H 5IB5A 5EO9B 3GXPA 5IBTH 3SH4A 4AFBA 2R32A 2EH8H 4TSVA 1KOAA 4JFYB 3WNLA 3WHTA 2Z7UA 1OC1A 3KR3H 4U1SA 4PT6A 5GKAC 1S7RA 2HWC2 1IEHA 3Q5OA 4V1DA 4GS7B 3ABKB 4L3ED 3WTUA 4H8WC 2BVEA 2HLAA 2ZG3A 4A42A 1BVKB 2MEV2 2W5FA 3FHQA 2XJTA 3OKDA 3RMYA 4XAWL 2F8XC 1ETA1 2HKHH 2KS0A 2QFPA 4JQVA 3WDJA 2QTWB 5GLVA 1YMHA 3RRQA 3VFVA 1CAWB 1W9FA 3T1FB 1CDBA 3ES1A 3PUUA 4YH6A 1N67A 2LR4A 5DUML 3BAWA 3BZFA 4WKZA 4AVKA 3CHPA 2BVOA 4LOEA 2MNUA 2VULA 5JXGA 1Y7VA 1AI1H 5FYJE 1AR91 3RQ0A 1I7ZA 3SGDI 5FXWA 3QBQA 3WNPA 3ZR5A 1XE0A 1IKFL 2Y6KA 4ZS7H 2P17A 4K7FA 3BSGA 5E7FA 4PJIB 4W4ZA 3K8KA 1SJHA 4KO5A 4YO0A 1VPOH 2WLNA 2RDRA 1TQCB 5FFGA 1JZ2A 4BGLA 1BJ1H 3RIAF 4UW3A 4AEIL 4AVIA 5SV5A 4LBLA 5TE4L 3DPBA 3GQFA 2UURA 1W8ZA 4Y24A 1XJAA 4K7FB 1JK8A 2ZOOA 4K6BA 2CTVA 4PS7A 4DCQA 1R64A 1DJSA 4JC1A 4ZFFA 4G9FA 4DESA 3BKYL 1NM9A 2QDVA 2Y8KA 2LGNA 3DBXB 3OY8A 4XDPA 2ZWSA 1TENA 3N85L 2V2XB 3QHZH 1A4JA 5D7LA 2P42B 3GEFA 2D40A 1E3XA 1T04A 2AEQH 2VL5A 4QR7A 3SSGA 2XG4B 1QZ1A 5D21A 4FQHB 1CE1L 3RIFF 3S3PA 3UEQA 2WYIA 5GQBA 3BP7B 4GINA 4YHOH 4NZDA 1JSYA 1X5XA 1MWOA 1DHKA 3AY4A 5T5FA 5DMJB 4JL1A 4XJWA 1YEDB 5E6UB 5CM1A 3BESR 1PY0A 2H0FA 2XN9B 3V6FB 4HT1H 4IHBA 1XE7A 1UY0A 3DKHA 3GZOA 1N4XH 2GHZA 1G9AA 1A8JH 4FDWA 4GP8B 2J57A 5GS0C 3RZHA 4NO2A 1ZVFA 2Y33A 3SQOA 1NAML 2CKBA 5AFEA 3DF0A 3UZVA 4J8QA 3CFBA 1JGUH 4M1DL 3DI3B 2ZACA 3AZZA 5FZ0A 5DQJA 4FI6A 5F89A 2VZRA 1N4XL 3CXFA 3WINE 2PTVA 1SPPA 3MUZ1 4OZHF 4APQC 3GF8A 3C5JA 3LEVH 3BGMA 3PQYA 5F9DC 5FYLD 4ZQKA 2V72A 1E57A 2R072 4QCIA 5ICXA 2VR3A 4MJIE 5AW2B 5EEWA 1Q9WA 3GBMH 2IEPA 5BXFA 2NY6C 1KN4H 1KSRA 3WFBH 3WS6C 3MUY1 5TH2B 4AW7A 2VOXA 4JO5A 2SEBB 1A5FH 1GIGL 1MIML 4E9VA 2WZ0A 1PZBA 4P00B 3SH3A 1QSFB 3OQRA 5EUOB 2F53D 3B2VL 1TJHH 4TLSA 4PDWB 3D09A 4A3ZA 4HS8L 4ZFOA 3KEHA 5EO1B 4WFEE 1J8SA 2ZXBA 2FIKB 2C3WA 4HSLA 1G9MH 3IF1A 3VQMA 1AHSA 2FQEA 1FAIH 3IB3A 1REDA 4AE1A 4PIZA 1DANU 2YXWA 1ASPA 1L5GA 2BW4A 2QELA 1I75A 5I1IH 2BVPA 3RZCD 4MDRA 1HWGB 2LM3A 4F2EA 1K4CB 4HJ1A 3DPRC 5DK0A 2ZPKH 1BCXA 3BAXA 3LS5L 1CD0A 1ROCA 1HH9A 2N56A 5DS8A 2HTLD 3QDJB 4NQSB 3HC3H 1SY6L 4QRRA 1TJIL 2Y2WA 3DV6B 4NUJA 4ZAKB 3SPVA 4E41E 3E6FA 3QE5A 1WA4A 4BB3A 4MVBC 4KU8A 3JD73 4OD2B 1BD2E 2AMGA 4MQTB 3D25A 3EH1A 4BYHA 4KWKA 1RK1A 1I9RL 5BZWA 4BSWA 2VN3A 4PRHB 1J3PA 4NOTA 3SE8L 4GAJL 3MCKB 1B3IA 5EJZB 3T4AA 1QJX1 3H9AA 3SGJA 3BZ4A 4FTVB 4HMEA 3UTOA 4UWQB 5EBWA 4GKXA 3BDBA 5IEHA 3WUWB 2ZX5A 4U1GC 4WUUD 3QJUB 4AMKH 2GJJA 2H6OA 3VFTB 3VU2A 1MCOH 3ACHA 5AOZA 4Z18A 1VBA1 2ZCLH 3TBTA 2OPWA 2FHRA 3MRMA 4XMIA 1S8DA 5FGCB 3UTPE 1S7UA 2ZS6B 3PP4L 3R0MA 2J25A 1UCXA 3ELNA 4A7ZA 1TYJA 1IM9B 4I9WD 4D9LL 4RYDA 4HV8B 2HT4D 4F7CB 5L6YL 2OSLB 1B0RB 4AK1A 1O6TA 1O9WA 4MSWB 3B43A 2Q7NA 5F71A 2YKLL 1KCWA 1HB4A 3PJQA 1BBT1 2A0LC 2G3XA 4HXBH 1KPUA 5H37H 2HT4C 1KJLA 2NY2B 4JFTA 5KW9H 4N8PA 5ACMA 5EN3A 2YFZA 1HIML 3VFRA 2ZX6A 2Q2LA 5DRZB 4P9YA 3FO1B 4YGCA 2DMHA 2M8XA 3WI9A 3CJJA 1HI6B 1FNZA 1IAII 4LEXH 3ROOB 3ZMEA 5M0TA 3C60C 3KQ4B 3QO0A 2XHKA 2H1LM 4X99A 3P30L 4QQLA 3DUSB 1NEZA 3C9NA 1PDKB 3E6HB 5E99L 1FZKA 5B1KA 3KV5A 4UW6A 4MXWH 2HWB1 2CHHA 5DJYA 4AZUA 2AKRB 4UFKA 5DD6A 2XKNA 4HBCL 2G3NA 1QDCA 2CAUA 3VGGA 1U3HC 2FB4L 3G5ZA 3O3AB 4J3BA 1MQ8A 3FQXA 1KLGA 1M2VA 3BSZA 4FXGA 4G9DB 4PJ5D 3ARWA 4X4XA 1H4GA 4C90A 3JWOL 2GH8A 2FUQA 4QXCA 3Q44A 4BK8A 4J4PC 3UK9A 4PLJC 3O4OB 4OCMC 4OT1L 1QJX2 1BDYA 2Q6WB 2IFRA 1PMJX 1HL9A 4Z7VA 3MRFB 4MD4B 4JM4H 5KSAA 3EMRA 3GS0A 2DL9A 4FG6D 3H2QA 3QISA 4NXSA 3DXAE 1NM4A 1VFAA 1XF5B 5F6HI 3KJ4B 3EG9B 5HI5C 1PLGH 4XMPL 1IQWH 1N6QL 3FJSA 2BK8A 3JVGC 3E6DA 1KJVA 1QG3A 4XFIA 1DEEA 1JXKA 2EC8A 3FT2A 1E5BA 4Z1PA 4D9RD 2FBJH 4A39A 3W20A 4J2QA 1CAXA 1PF3A 1FQ9C 2NY6D 1RUF3 4Y5YB 4DOHE 2Y0IA 4EQVA 4MJHA 3CDCA 2KC0A 4PRDB 3HI6H 5T3XD 4Z7QF 1GTFA 2R062 1GY2A 2F18A 2EICA 3AB0B 4XBPB 4OZGF 4G9FE 5T3ZD 1N0XL 4ANXA 1HL8A 1VMHA 1G1KA 5BPPA 1NG0A 1RINA 1EEYB 1OSPL 1TVHB 4XQ4A 2G1MA 4GUCA 5DRXA 4I77L 4YLCA 1JNJA 4JZNA 3VO0A 3MUJA 4XNZC 3EOBB 3UCQA 3NW4A 3WW2A 5IJCC 1J1OL 5MENB 3U75A 2E7CA 1TQCC 2ADEA 4PW9A 4HUXB 2JKJA 2C9VA 5CZVH 1HIXA 3WUCA 4NO5B 4R97B 1KDMA 4Z8BA 3FQUB 3OL2A 4JCKA 4GKNA 1BVKA 2LTQC 3DDFA 1MZ5A 4P4KB 2AMUA 1YJDH 1T3FB 3NJMA 3FU5A 5CADA 3V6ZA 5EC1B 2OL3H 1ZLSL 5H94B 1SVBA 1G84A 3ZLQC 4IRSD 2A77L 2BVBA 1SOSA 1TZHA 2WQSA 1BM3H 4JRAA 2W1SA 3CFTA 4TL4A 3O8XD 3LFIA 3WP6A 1A4KA 3LNEA 3NGBC 4LAJH 4PRHD 3GUFA 3BXNB 2DTYA 1YXWA 1P6FA 1OAKH 5DD6B 4OI2A 3QEGH 1OPOA 4LCIH 2A77H 4EIUA 3ZLIA 3PU3A 3IMVA 4HJUA 5BZDA 1LOGA 1MZ6A 4APXB 4Q4Y1 1S7TB 2L7QA 2CHZA 3TYFA 1II4E 1L9QA 3RYMA 1KBVA 4WVMA 4H8VA 1QW8A 4UINH 3SBWC 1JI6A 3HZVA 1GNHA 3LOIA 4JRLA 5B7MA 4JDMA 4KQ3L 2CBMA 1VRH3 4PJ8D 1ULOA 4Y2DC 4IE7A 4L48A 3BAIA 4XWGL 1W2AX 4C58B 1CD3G 4UINL 3HRZB 1YY9D 1FG9C 1QVOA 3PHQA 4L1SA 4IIZA 4L1BA 4BQ9A 5B4MC 1NEUA 4MMXC 1ACCA 4PU2A 3WHXA 4BZ1L 4NO0D 2BFUS 3UOAB 1NDTA 4U3HA 1UXSB 4DVBB 4LP4A 3I4IA 3LKOB 5J6GA 5DJCB 4HS6A 3KYAA 1JCKA 4XF9A 1SVCP 2EIGA 4NJ9H 3CNAA 3UYJA 5CJQH 1OZUA 4LBAA 5B8CA 3ARQA 2E7MA 2VOVA 3U6RA 4O58H 3FRPA 3AS1A 1ZV2A 1DLHB 5DVOA 5TE4H 1AR92 4XYXA 1LENA 3H8XA 1CD1A 1J5DA 3BPZA 4BDVB 3U0WH 3AG3B 3ZE2F 4GP4B 3P77A 5FM4A 3BP6B 2MOGA 1AGDA 3H53A 3ZE0F 1L7TH 4IEFB 4EDXA 5L8KB 1KY7A 3QPQD 3RNKA 1BW8A 5IKCB 1CIWA 4DERA 4MHHI 5ANQA 4YBLC 4AVCA 3P6BA 3AWEA 3Q8CA 4JFDD 5TE6H 4CJ0A 2IXCA 2D03H 4G6AD 4FXTA 2YGLA 3R6SA 2KUTA 4RAUB 4PWGA 3KYOB 3RBSA 4IBVA 2CRZA 3FHAA 3N9OA 3SE4A 4JTOA 1YVLA 1S55A 5JW3L 5IHLB 2XQBL 3TZVA 2PQQA 2WIIA 1Y3TA 5KYWB 5AKSA 2X9YA 1LEIB 2BWCA 3VBUA 5A3NA 1PLCA 1WITA 2ZXGA 1S0GA 4NQVA 3PUAA 2ITDB 3CFIC 3K7UA 5E2VL 4X5RA 2EIJB 1HKLL 3GXDA 1S0IA 4FFZH 3B37A 4EIGB 2V5TA 4U31A 1PNCA 1RGSA 2J1RA 2OYPA 4UW5A 1ULVA 1JWMA 3OZ9H 5FPVA 3IGKA 1C1EH 4JZOB 2EIBA 1COBA 3QZNA 1RZ8B 4HU2A 5ALCH 1HXS1 1UOFA 1PGW2 1G7LA 1DLHA 4JR9H 3O3EB 1XGUB 5L2KB 1BQHA 4KPHH 4WFGE 4Z7OE 1AR81 4Z7VE 1VE0A 4IL7A 4RFT0 5DK2B 5BNPB 1G9NC 5EU7E 5C0IB 4META 2RJLA 5C0BB 1WSST 5HVWA 3FB6B 3MUHL 4CP2A 1EZVY 1XGYH 2NY1C 3EFFB 1KV7A 4RA0A 1G5AA 5IF0B 1K5NA 2WLJA 3AZUA 4A44A 2OS7A 2WNUB 1YNLL 1UM5H 4FQJH 2YU2A 4YXLH 1AMXA 5GGQH 3BUQA 5C3IA 2BHUA 4ZONA 4JHBA 2X89D 1ZBE3 4NQED 2L7EA 4NQTA 4KK6D 1UZ6E 3VZNA 1IBGL 4DTGH 3ZKYA 5CGMA 2J22A 3V4PB 2ATFA 4HZLB 3K1DA 1RUC1 1MUJB 25C8H 3TCTA 3KH4A 3MV11 3SDXF 5CKAA 5I1KH 1S7XA 1U8NB 1D3CA 2CALA 2DM2A 4XPBH 3QPXH 2ZGUA 2X5PA 4FFYL 3MV7B 2BRRL 4EUPB 4LBMA 2AEOA 3AS0A 5F9AC 5DYOB 4IEVA 3MNWB 2IQAA 3W39A 5D5MB 4X6EA 1SYSA 4BKTC 3RJ2X 4FFYH 4HD5A 3IMMA 1JWSB 5JXAL 1ZLWK 1ZS2A 5J06A 3OPZH 1IGIH 4WI6A 4LSVL 3BP5A 5DJCA 4WUUE 5IB1B 1MWAB 2APBA 3TNMB 2X4UB 3LEYL 4XPGL 2UVEA 1EK3A 1W0VB 3BISA 4U1GB 4F7KA 2NYYD 3QR1A 1HJCA 2FL5A 4Y7OC 4Q4EA 4FAAB 3OJDB 5C09E 2W81C 2WTPA 2OK0H 2O8QA 4GBXA 3W9EB 5T1MA 3F62A 3UKNA 4FQ4A 3EOAA 1B88A 2QQUA 4P2RA 1RJYA 2LLLA 3UTSA 4DQAA 3O14A 5EOCL 3VXSD 4YE0A 3SBQA 4FXLA 3PTYA 2NMNA 3ETQA 5F2SA 3H85A 3MA7A 3TBYB 3WHUA 4WFHD 4NRYA 1CL7I 2IWKA 1RJZB 5FYMA 2BOIA 1RIVL 4BZYA 1FIEA 1GJWA 5IQLA 1IAIH 2D7QA 1PZ5B 4N68A 4TTDD 5LEJA 4QHZA 4N0YH 4QXVA 2LS6A 5T5FH 4NKOB 2JKIS 4WI0B 2CO7A 1SMVA 2Q9OA 3US0A 3LMJL 3RGVB 1X5KA 3EIFA 4ZUVA 1JZ7A 2JG9B 4OJCA 3V6OA 5BZZA 4FKEA 2ZE0A 5I8EB 2V37A 4G8GB 1YN7B 4QX3A 4XJUA 4YAQB 3ZK0A 4AT6B 4GKLA 1US3A 1KYFA 4BINA 3O3UN 1ZVYA 4G8GE 4JCMA 4M6NH 1UUSA 5HGAB 4PTTA 4CW1B 3LEMA 3P1IA 1NBVH 3FCBA 4S1SH 5FXVA 2HN7A 3RG0A 2V5YA 5ETUA 3WKQA 2FWLB 4LDLB 4ODWA 1TZOA 1YUKB 2X6UA 3GMPA 5D1XE 4WI2A 4Z78A 3POGA 4Z07A 1ST8A 3CFMA 2XN0A 4JFVA 4X7EC 5C8JA 2B0SL 3PAVA 2DI7A 4P49A 4PJGA 2ZHKA 4EOWH 2FB4H 4JB9L 1Z66A 1H8TB 3QD6A 5HYJB 5LBBA 1PVC1 4AQZA 2BXYA 5ESQB 2AF2A 5I0VA 1CQKA 2VXQL 2X6AA 4YIQA 4C54A 1U8JB 2DM4A 2C7FA 1RAMA 3F58H 3MJGX 3QI9A 3PU7A 4AWJC 4B95C 2WXNA 1NCRA 4YDLB 2BZ7A 5C0RL 3WN5C 1S9XB 3AC0A 4PJDB 4M5TA 2F6AA 4PGEB 5C09B 1O9ZA 4XE5B 4YGVA 4YHMH 3SEEA 5LDUA 1VFUA 3T0BA 3F58L 2OCCB 1PD1A 5H9SA 2D98A 1U8PB 3DRTA 2VY0A 2NTSP 1YI9A 3T4YA 4FLRA 1AYN2 3QORB 4LRNL 3KBHE 4CADB 2MHAB 1BZEA 3H7LA 3GALA 5HGDA 5DEFA 5AW1B 1H1MA 1QPPA 3IFLH 3RL1A 2VDNL 3J07A 4BGDA 2JIGA 4Q2FA 4XFHA 3H8UA 1FNHA 4UXAA 2OQ6A 4UI2A 4DZBB 1RZKL 3HRPA 3VGFA 2PAMA 4F92B 5BPXA 4DKFL 1C7SA 4PCYA 3I49A 5IHZB 4HG6B 5K33A 5GRJH 5SWZA 1P4UA 2XT1B 1TVBA 2HRPL 5T33H 3JWNE 2Z31C 4R90L 3WL9B 2ICWB 2ESVA 4O7XA 4ZUSA 4ZSOA 5FYTA 2F74B 5JOZA 1G9NL 2XWJA 3JTSB 4DEPC 2V9TA 1ENQA 2EQDA 4QMEA 5H9QA 2AZ5A 4IDZA 1U0QA 1QH7A 3U4XA 2HKHL 4KTGA 2YAFA 4JQIA 2JKXA 2YSTA 1R4XA 3MAWA 3HJRA 1J48A 2HRPH 2ZJCA 2XNAA 3ZTEA 1R0AH 3GLEA 1DN2A 3WEAA 3N2JA 2YC1B 1JAEA 3BKMH 4Y26A 5FMDA 4L5FL 4Q1PA 3L2MA 1M7DB 1UWXH 3GMNA 4B3NA 1AD9B 3EJPA 2QQIA 4MNHB 3ILFA 3ZSJA 1QLFA 1TUPA 1P7QD 4BK5A 4UILL 1OA2A 5CILL 3ARVA 3LSDA 4U6VH 3IJYB 2BVUA 1QBAA 5G55A 2OL3L 2QVTA 3ARFD 4QJ3B 1N5AB 2W80C 2IWEA 4FFFA 5HJGA 4DUWA 5KYNA 5HI4C 3NCJL 3KVBA 4LEEA 4PJAA 2IF7A 5HY9A 4N2BA 4WUKL 5FREA 5HDOA 1QJY3 2CRIA 1YWKA 2ZX1A 1MREL 2AK4D 4ZG1A 1SHWB 3BPLC 4N5UA 2C5DA 3NL1A 4XFGA 4HUCA 2AJUH 2AEZA 4S1QL 1T0MB 3BKYH 2DFBA 4L8QA 1C9SA 2N01B 5D1QB 3IMUA 5IK3B 5BV7L 3QDMB 4KQ3H 4JQXC 3TWIA 2QZ5A 4N2DA 3HPJA 4P05A 1O6VA 3QDJA 3ZHDA 3OHXA 5TFSL 4ODBD 5HVHB 1UMZA 5F8RC 3EBIA 1CT8B 4JPKH 2AQTA 5FYBA 1AC6A 1JXJA 1AFVL 3RWDB 2DYSB 4M1CD 3CQOA 2ZKYA 3ZUNC 3QEHA 3TOJA 1CGSL 1MHCA 1PNGA 4XNMB 2H26B 3BCWA 4AI1A 4HC1L 3Q1EA 2WVTA 3FAWA 3GSRA 5D6CA 1VBD2 2XBO2 2TSBA 1C12B 1F02I 1O7DC 1AP2B 1TTCA 2CO6A 2MEV3 5E8PA 4ZX3A 2K4WA 2Y6SD 1VKXA 4ZXKA 4TYUA 2H0PA 1A9EA 3H50A 5B4XA 1FFNB 2P80A 2D6LX 4M00A 5AENA 1NIBA 2W07A 5JNYB 3N9MA 5AALA 4UBHA 4Y4HB 5A1AA 4TN7A 2BHZA 5JMCA 4HWZB 4AGMA 1F5JA 5HI0A 2R29A 2X4QB 4AYSA 4NWTH 5DJDB 4B9YA 3JT0A 2EUXA 2EE3A 1VESA 4FYSA 1J1TA 1AXSA 4D0QA 3BPNC 4Z7WE 1H15B 5JA9A 3M6DA 4AIZA 3GBFA 3MCLL 3TV8A 3B7RL 1YO8A 1HH9B 3BVWA 2A70A 3DIFA 3UMTA 4HF5L 3MFGB 2IVFC 3HPLB 2E9WA 1LE9A 1BZ9B 5GPRA 4OGXL 4BDVA 2VQUA 3PURA 4OLUH 5A7WB 4IK7A 2LTQB 3EH4B 4ODWB 3ZN4A 3KEDA 2CJUH 2COQA 1F6FB 4EKXA 3UTZB 4FNPA 3WLWD 3L7FA 1CN1A 2UXVA 2FBRA 2YBPA 3QEQA 4OZXA 1KTKE 4XUPA 3V0HA 1AQDA 4Y16B 4GH4C 3NT0A 1Q5OA 2DLFL 2VUCA 3VBOC 3F2ZA 1S4CA 2I25N 2P47B 4TNWK 3CSFA 4WJ5B 2NNFA 3GSWA 4DJMA 2B39A 4UWDA 3QFDB 1TJXA 1K12A 3MRCA 3B5TA 3G04B 4PWIA 5I8OL 4PJCE 1OLQA 3KL3A 4FL4C 1WA1X 2B2XH 5D7LB 2XOMA 4AEKA 3GGWA 1D0HA 4ZS3A 1AS7A 1MCJA 1XSKA 3FFZA 3LRKA 3T5WA 4FCHA 4EKJA 2BERA 1IX2A 1MG2C 2WZEA 4D0BA 5DS1A 2YFUA 4YJZL 5SX5K 5DT1L 3AMPA 4KGQA 2VECA 4IW4C 4BMBA 4S0SD 3WKYA 3TU6A 1SQ4A 2A9ML 5KSUA 1O5PA 1D5RA 3L4VA 3N44F 4D7BA 5CZXD 7CGTA 4MJ5B 2A6WA 3IPVB 4N86A 3UPCA 1IIIA 4LLWB 1Q1JH 2AI0L 3GWJA 5I5IA 2RS53 5FP3A 4MQXD 4MNHA 2R0KL 2EVIA 1V3LA 1F4WH 3I6KB 1M42A 2WNWA 1AQKL 4RFEB 3FQWB 2X4OB 4GRLC 3HD8B 3ZYHA 4RCAA 5IP4A 2R073 1I7RA 4U1IA 5C9AB 2P5WD 1KS5A 1AD0A 4YXLL 2WVVB 2Y3NA 5TSWA 5FUCE 1JGDB 1TU2A 1E6OH 5DFVC 4TV3A 1HYRC 1AIFB 1NKOA 4ODHL 4HW6A 3QJFB 3FH7A 5F6LB 3H9SE 4AJWA 5CP7B 3TNNB 1VBC2 1JNHB 4FYQA 4IRJB 4P5TD 2RE9A 3LDRA 3TBVB 5LGHL 5EN2A 4RFRB 5TPWH 3BPNB 2MWCA 2XPYA 3RVVC 1QIQA 2DUQA 5F37A 1ADWA 4MA1C 4U6XA 4MNQB 3BD3A 5L9DL 1OA4A 2VITA 3AXHA 1ZD6A 2PPAA 4GLRH 4LHJB 4LBJA 1E5HA 1LEKB 1BOYA 1M7UA 2JCCE 3IXAA 4PJ9C 5DRXB 5JXAH 2WNGA 4HX1B 3K71A 2BDNH 3OD0A 5IB2A 3U2JA 1MQKL 4FEMA 4S1RH 2MPVA 2ERFA 4FYTA 3U4BH 1QA9B 1HHKB 3NGBB 1DYOA 2WNUA 1GJUA 3EF4A 2E51A 2HWB3 3SDCC 1N7ML 1BAFL 1QFOA 3HC4L 5IW1B 5HV0A 1FNGA 4QNPF 3CHQA 4FQ2L 3STZA 5KOVC 1LEMA 4NN5B 1BJQA 2YPVL 2XQXA 3N9PA 1X3DA 4YPGB 4ZPTA 1Q38A 3HEIB 5GGSY 5ISZA 5IIEA 3IDMA 1OLRA 1J7VR 1A7QL 1T1ZA 3GSWB 1XSOA 1N1VA 1G4MA 4RD7A 2P5WB 4N2EA 2X2JA 4WW2A 3MLRL 5D7IA 3WN6A 2G9ZA 4P3WA 3UKTA 3BWAB 1CFTA 2DWTA 1RZ7L 4PD4K 3EKCA 1J18A 4ONGH 2HVKA 4PJFB 3E6CC 4J2XA 2F2HA 5DZVA 2HLAB 1G7HB 2J8UA 4KWJA 3LZLA 1YPZF 5CEZH 5E6IB 3RWIB 3IKWA 1QQDB 4Y4FD 1D7DA 5TF1H 3NACH 5ADPH 4FFWD 2Q6WA 2RQEA 3OUIA 1S7RB 2RS51 3UMNA 5HYSA 3K51A 2PA7A 3BVXA 1HAUA 3QUZC 2SODB 3PHSA 1MFAH 2RQ8A 1R6VA 3BP4B 4HLJA 2GSYA 2OMZA 3BRFA 4N87A 2ITDA 1K2DB 1V05A 1AE6L 1GHFH 1L3WA 1VFOA 2GK2A 4MZ3A 4NZTL 4I88A 4XCEB 5IB4B 3PQYD 2OSLA 4YBHA 1MRCH 5CSZA 5DD1L 2B8MA 4FPEA 4LT5A 5EZLB 4YVNA 3SBRA 5D7JC 1XNCA 1IM3B 4X7SH 3AAZB 5C0JA 4QHOA 1SEBA 2IXQB 2QFRA 4OCSH 2Y6JA 1ZTXH 2ITCB 3FULA 1W28A 2NTFB 5AAPA 4BLJA 1NCGA 4RHV3 4TNVF 3VRLF 4MO3M 1XXFC 1AYM2 3W0WB 4Z3FA 2DCJA 3LKQB 4FQXD 3AACA 2APFA 2IH3B 3SB3A 1RVFH 3BZ4B 2NUPA 5DJXB 4GY4A 1FO0B 4ZMVA 1L6XA 1JYWA 3CZLA 4NRZB 4IGBA 4D0DA 4XNMA 1NJ9B 2IBBA 1NUNB 3LNHA 4CP9A 1KJ2A 1B4JH 2JKNA 4JO2H 1EZVX 2BIOA 4U1LB 1AXIB 4GG8A 2O5XH 3H9HB 4GIOA 2TUNA 2F8VA 3K6SA 1NGQL 1RZFH 1R46A 5HHOA 3QIBB 4Y2OA 1KN2H 3SO3B 1VB4A 4QKBA 2P3YA 4YC2B 3NFPA 4UT9A 4WM8A 4LVHC 5FHAL 3ARZA 3FUJA 3B7TA 3WEZA 2NY3D 3L54A 3HBZA 1QJU2 3LPFA 5DJ8A 4WFED 3MJ6A 4QRQA 4PB0L 1I7TA 1QFWH 2NCEA 2P3KA 5FQ0B 3EDKA 4B7KA 4IHOB 5D2NA 3WIIL 4BA0A 4CEWA 2LU5A 4BFNA 3B2MA 1LE5A 2DRUA 3T2QA 4NQCB 4ZMLA 1ACZA 5BMFH 1A8DA 4MBOA 4KX7A 3HFFA 3C75A 2ED9A 5BNOB 2HJLB 2UV3A 3M17B 4L3CB 1SLIA 4IGQA 2VNRA 2IBZX 3EYVA 4AM0Q 1UPIA 1F6LL 4NC1E 5CU5A 5BMFL 4R4ZA 1BQHG 1VF5C 2R1WA 4EN3D 4FAHA 4MXVE 3IU4L 3ZZQA 3ULUH 4JY4B 1IL1B 2AV1B 1FI8C 5KSAD 1RIHH 2BW8A 3HZYB 2Q0AA 2QQQA 1P9MA 1XTMA 4AVHA 3FZ3A 2WOBA 2BNRB 4ZFGH 5AZEL 2G5UA 2VDOL 2X4SB 4RMQA 5T1KB 5FYKH 1ZRDA 2ZG1A 3NZHH 5I30H 2RH0A 5E51A 5BRQA 3VH8A 4CP9B 2TEPA 4OF0A 3WG4A 2OTUA 1RIHL 3JTTA 2V5SA 3TBWA 1AYOA 1OP4A 2W5PA 2W92A 2Q1MA 4HG4K 3PREA 4D0CA 4OZFA 3TVMB 3WXWH 5IHZA 1HQRA 5GZEA 1YPZE 2WXHA 3BUCA 4XBLA 1HHGB 3OMZA 4AQ1C 2QSCL 1G0YR 1CLOH 4QOKB 5CUSH 3OF1A 1QFUH 3WSOA 2AJUL 1EDQA 2JI2A 5F7UA 1WCSA 1D9KA 1PMYA 4X5XA 1KT2A 2XI9A 4I9XA 4QTIH 1L9NA 5C6CA 3T3MB 5FOBA 2VQTA 4TRPH 3MCYA 1LECA 4F37F 1DFBH 1LODA 1AR1C 4RX4D 1KBBA 3DVGA 1S9VB 1COV3 2VDPB 3ES4A 3A6CL 4JFOA 2VQ4A 4XTPA 1JZ3A 1ZSDA 4LOUD 5FO8A 4ENEC 2CIIA 4YSOA 1PGL1 2E7BA 2FO8A 3FSZA 2ARXA 2XU9A 1HLCA 1INDH 2KXLA 1AFVH 3VH8G 3TBDA 4XVSL 4YW1A 2JDUA 3WQ7A 3WX5A 1JYTA 3QIBC 2HPTA 4HUWA 5G4NA 1DN0A 1G9HA 1MXGA 4GULA 2MHFA 2VR6A 5CIPB 2JMRA 2DQEL 4PJXF 4WWKD 1WZ1L 4JKPH 4G4FA 5I0RA 2VMFA 3ZMNA 2DVFA 2PTUA 1F35A 1VBE1 4O4YH 2N4IA 3I3DA 5ESQA 4BHUA 4BUHA 3FUQA 1SXCA 3FO0H 1WDAA 1CJDA 1H2KA 3GZTB 3VI3A 1JXGA 3NKGA 1JTTA 3TBVA 4B5ZA 5EWIL 3WN5B 3NJKA 1I1YB 3TLRA 4CVZA 2HEWF 4AQSA 1VIWB 4K1ZA 1JHKH 2EDRA 4HJIA 1LESA 1XV8A 1AGFA 5E6RB 5KAQF 4UTBL 1DZRA 1IGCH 1E5UI 2UYLB 3HG0A 2EIZB 5F21B 4R2GB 5F0PB 4HCRA 4JDOA 5KYUA 4E2OA 4J6RH 5FHBH 2Y4SA 3V8CA 4HUVA 4CDQA 5EFUA 5DRWB 4PRBB 3LWCA 4BEIA 4BUGA 4EF3A 2AH2A 1VMFA 2XLGA 1VAKA 3PU8A 3T08A 3TA3D 3PWNA 5TTRA 4R0LB 4IK6A 1FIGL 3MCG1 1W2UA 5EF3A 4UFLA 3BKZA 3BE1L 3P4NA 5DWPA 1AGEB 1PG7L 3B9KA 5DJ6B 3L7EB 1V7NL 1YY8A 4LMQI 2VMGA 2CHDA 2VW1A 2DDQL 2EO9A 3HAEB 1OAZH 4ELME 4CJ1A 3GHPA 4E5XG 3VD9A 3U37A 2Y1VA 3P73A 5FUNA 4EN3B 3PHAA 4B4RA 4ODVH 4TPRL 3DKQA 4HPOL 3GKWL 2PXYA 4FFWC 5K39A 4RFOH 4LDOB 5BJTA 1N59A 4XN5A 1U91A 3RU8L 3VFOB 3AKQA 1HHJA 2ZP8A 1MW3A 2YUVA 3QEUA 1FNSH 2HLFD 1CICA 2R7EB 3WNNA 4ZMQA 3KXFE 1E4HA 2V09A 1ZGLA 2F5BL 3CZKA 1ZANH 4NPKA 3UGGA 1E5AA 3FSOA 4P2RE 4WTZG 3RB7A 4WWOA 1PZDA 3ACFA 3S98A 2ZIDA 3BKCL 1J05B 2C1PB 3KPTA 3SY6A 4EUPG 5FZLA 4WJ5A 3II1A 3UX9B 1IE5A 1ZHBB 4G8GD 2C9PA 1NXD1 1UB5A 2PW1B 4L1HA 2NY3B 2VZSA 2MCPH 5MERB 1GNYA 4AVVA 4DINB 4KU1A 3NFSL 3V52H 5FYYA 2N3JA 2A1WH 1KEMH 3TH4T 4U7KA 1RUJ2 2GN7A 2HVBA 4NNYA 3SPIA 5GSRB 3H42L 3ATBA 5CD5D 3T3YA 4KI5M 4I87A 3IMRA 5AVVB 2LU4A 4XPGH 2XETA 3TBTB 3TN0C 4AUJA 5IBLC 1XH3B 3NBNA 1GGUA 2QQLL 2ORXA 3NAPB 1UZ6F 4N9OB 4M9PA 1TZAA 3ZE0B 4WU7A 4PI0A 5EZWA 5FO2A 1XDTT 2ERJB 3RTQD 3RVVD 3RNQB 1OTUC 1ZBA3 3EQEA 3BN3B 1UD3A 2F8IA 4KQ0A 2QKIC 4YS4A 3AYDA 4FTBA 4NN6C 1MEXH 2CY6A 3Q2WA 1XF3B 4RWYL 3CVDA 4TVUA 3MLTB 4ELMA 3JQWA 4Q1RA 3L1OL 1IKNC 3ARTA 4H5SA 4ZD3H 3Q3GB 2XX0A 5I17B 1GS6X 4LP8A 1FV3A 2D7MA 1HRI2 2BJMH 4RQPC 1AP2A 3DOIA 2OMXB 1R3HB 2H0EA 5JA8B 4N0UE 1XHHA 3VXNB 2AQ1A 4DN3H 1ZZ9A 2VNOA 3ASNB 4QGMA 1QTPA 1Z9LA 2XUWA 5JLZA 1VAVA 1DZQA 1F2XK 2E32A 3EG9A 4ZJ9A 1C4RA 1N12A 4WI7A 5DJZA 4FERA 4MJID 5IB1A 4XPTL 2NY6B 2CA3A 1UWGL 3MFFB 1A1MA 3S5LB 2WCGA 3NABH 3AKRA 2HWF2 3ETSA 4E8DA 3OYWA 1T2JA 1WH0A 3C7HA 5T5JA 4YSAA 3S8FB 1USZA 3VWKB 5I73B 4HVQA 2C6SA 1JERA 1N1SA 1QSFA 3U0PA 5BO1L 2XZCL 2ZCHH 2A6XA 1QHOA 3BQUC 3C7EA 4LL9A 3MNWA 3H8RA 3FQXB 4KI5C 3RWHA 1LNUB 1QBML 2HVJB 1GGCH 1JPFA 1M1XA 1E8YA 4GO8A 4JDZB 2YKKA 5FKBA 5FP7A 1TTBA 1U8NA 2ZAHA 5F70A 2ZCHL 2YBRB 5JOPE 2G60L 1PLGL 4XMPH 2B8OT 2XRAH 3ZYBA 3DI2B 5AKRA 3SGEI 3EOTL 1IAOA 1NOFA 4AE0A 4MGTA 2VKWA 3N55A 3NOIA 1BVP1 2FGZA 4F1SA 5IJVA 3ZL2A 1BOGA 4KWUA 5DAPA 1AHWA 1SM3L 3AMLA 3A67L 2JVUA 3B3IA 5GGVL 2X6CA 3CHXA 3SE3C 2IWGB 3ZFEB 2EXWD 3MKGA 3QR2A 4IBWA 5FZOA 2ZG2A 5EU4B 1TFPA 4K3GA 3WEBA 1EGJL 4I1PA 3QNFA 3WY6A 3P3UA 3RNKB 2WXOA 1T66C 2K46A 5LY1A 3L95A 3X3GH 1CXFA 4IKJA 5AVTB 1AX1A 1RUE3 3ZDZE 3CZUA 1G7JA 3LQZA 4U4BA 1NBZB 4GSRA 1G0XA 4GJZA 3F83A 4QPGA 2BP0A 3LPWA 4MMYA 5F1IB 5ICYA 4C0HA 2IQ9L 2CIKB 3R4SA 1UEYA 2NXYD 3RYRA 4LIQH 2ZGTA 5BNXD 1Q72L 4V1PA 3LD8C 3CBKB 1PYWA 3GJEA 4PJEF 4KVNH 4OTXH 1TVBB 2B46X 4AI9A 5DHDA 1B35B 4ZX6A 1T1YB 5E1QA 1LP9A 2JDAA 3POFA 5HY9B 1JF1A 5C3PA 4A7TA 4PY8J 4OZOA 4NRZA 5F5QA 2XQYG 2AK4A 3DUUA 1OCWH 1F4XH 3QUKB 1UOWA 3A3YB 1GOGA 3BQVA 3DRQB 2YS4A 3HRZA 3O4LE 3PDOB 2BDRA 1DQ2A 3FSVA 1D7PM 1COV1 4CKQA 2NY2C 1F86A 1FZOB 3JBG2 4GWMA 1T5XB 2KH2B 3MLWL 3LN5B 3A6BH 3ML9A 2CLVB 3MCKA 2B1AH 3K4AA 2Z31A 1SBEA 1SEBB 5LY2A 3QEQD 1OCZB 4B1LA 1P69B 3NCEB 3VXPB 1KFAH 3ZZ1A 4WUKH 3ETBJ 4A7GF 1PVHA 1KIUA 2PETA 3B2VH 4K3DH 4G7SB 1K5MC 4WM8B 2B1AL 1NGPL 4J1UA 3ZL4L 4ZSOB 3UTTD 2F15A 4DPAX 1RZKC 4HKJA 4W4OC 5SWZB 1SF5A 3GJFA 5T3NA 1PLBA 1E65A 3G5XA 2LRPA 4LOVA 2RDQA 3PNWA 3NH7L 1EO7A 4J3VA 4ZUWB 1U3HA 1RULL 5F3BB 4P08A 4E27A 4NNYB 1S3RA 3VXUB 3AL5A 1T0OA 4BZ1H 2YUXA 4G6JL 4ZX5A 3U46A 2ZSVB 1SXBA 3JWNH 2VABA 3QFJB 2PLV3 2XL9A 3CUPA 3RVUC 4ABQA 2WQUA 2BIPA 3KPNB 3MGOB 4NM8H 4PV8B 3NSYA 1OD7A 4L8CA 1OQEA 4K15A 4LKXA 3V0AC 1BBDH 1PCXA 2NZ1A 3C60A 3KYNA 3QA3B 4AQ1A 3KXFA 4MX3A 5D4IA 3ACLA 1IS3A 1NANI 2QMKA 1EEYA 3POSA 4E4ZA 5F1SA 1A7OL 4YVSC 5JOWA 4NZRH 3TASA 1UW8A 1M7XA 2VXRA 4KJQD 1VMJA 5KVDH 3ILEA 2OQJB 3WCRA 4A7KA 2ZOKB 5EBLB 3WYRA 1BF2A 2MOQA 5E0FA 1HB2A 2YMTA 1DBNA 3BODA 5DC9B 4L4TA 1EFXB 3MROB 4WHTA 5ADOL 3I2KA 4HJ0C 2QVKA 4UIKL 3WF2A 1V27A 3AU1B 4J8RA 3GBNL 4YLQT 1NFKA 1OUXA 3WJJA 1D7BA 1QEWB 4Z0XA 1YUHA 2AJ3B 2IADB 1AG0A 1NCWL 2YMZA 1WTLA 4JFEE 4JN2A 6FABH 4UQBA 5IVNA 3KS0J 1OWRM 1ZRFA 2Q76A 1Z9PA 4UQ2A 5AVYB 1TKWA 2NNAA 2OMYA 2R39A 3IE4A 3TNNA 3X11A 2IANA 4AQAB 2O26U 1RXLA 4GW1A 5HP5A 1P5UC 5C3SA 2PWHA 5IJDC 1TVGA 4FC3E 3P0YH 1DGLA 4FQQA 3DX8B 4M56A 3FLPA 5A3TA 1GGTA 3TCLA 1FH2A 5HD8C 3GXTA 1QJZA 2WUCL 5FM5O 2YDEA 1KXHA 3BTYA 2CKBL 3GNMH 1H6EA 3N6YA 2WS92 1OHZA 5DZFA 3T4AC 2CXKA 4A68A 2YJLA 1ODNA 5JUEH 2BY0A 5JZGA 1MW2A 4PS4L 3MTRA 2P44B 5E8DL 3INOA 5DJYB 4UT9H 4JMXA 4A55A 4ASKA 1OLZA 1W8NA 1LGNA 3EOAB 2XJKA 2Y6HA 1K5MB 4WM8C 4DGVL 3KDMA 4Q4X3 2D2OA 3TXAA 2BNQE 4MX7A 3HUJE 5IMKA 3HMXL 1IU1A 1AL21 3H9ZA 2EIDA 4DGIH 1A6TB 1YMME 4HANA 4FTEA 1SXSA 4R2GC 1I9RA 5LWBA 1FLTX 1SLCA 5CP7A 2O14A 5SWZD 1UN1A 3MRGB 3VW3H 4IKIA 2ENRA 4OZHA 3FB6A 4JRXA 1I8IA 2N7GA 2AXGA 3ZOAA 4RL7A 3ARDD 2EABA 4OT1H 3KGRA 1HSBB 2YZ1A 3BUPA 1PEZA 4NC0B 1NGYA 4V33A 2J1KA 2YGOA 3C60B 1URXA 1QNWA 3PXHA 2Z0UA 1U8KB 1U92B 4HFUL 3N7MA 4AQ8C 3LCYA 4XXCC 4X6DE 2F8OA 4GW1B 4JUSA 5KSBE 2YUEA 2BFVH 2QZQA 4M5SA 5L88L 4YDVB 2LU7A 1I1YA 4IBYA 4OZFG 3SCMC 5IT2L 3P5BA 1OCCB 3IFOB 5FMBA 4ANKA 3HPNA 2CGYA 3FU8A 3QO1B 3ZFGB 4YVSB 4GMSH 4NR1A 1IGML 3RWEB 2A3TA 3MRLA 2W8CA 5CBEA 4K3JH 4ZMOA 4WNQA 2AABH 3VFWA 2FO4A 2NW2B 1BZ9A 5A70A 1Y6KR 1ASQA 3WS3A 3CDGA 1GGBH 3OAUL 2VL4A 3MRPB 4MYPA 4DIXA 4DP2X 2E7LA 2D6OX 4IV3A 4AQ2A 4UOQA 4AIZB 5DQ9A 1Y6NR 4IGBD 4D2NA 3VXUE 1GXEA 4P5MA 5I9QC 5A3LA 1G1OA 4UT5A 1G4RA 3HKFA 2JJVA 3I3QA 1FZKB 2WUBH 3VRJB 3ECBA 1OF0A 2PYFA 5K1JA 5K0UA 3KYNB 3QA3A 3PS6A 4AQ1B 3WD5H 1OQXA 4ALAL 3V0VA 3UJOA 2F54B 2P2KA 3DKWA 5I9QB 3WJMB 5T5NF 4FPHA 2OCJA 5DHYA 1QJEA 4LJHA 2IDTA 1KCVH 3NJVA 1MZYA 1BVLB 4JUTA 1RUPL 2HCZX 4K23H 5C07A 1KB5A 1V9U2 4J3OD 1AIZA 1JD7A 4H88L 3VYOA 3I84A 1CFVL 1PMIA 1BFOB 3CDYA 4M61B 2QQKA 1R082 5D7SH 4BZ1A 1MEXL 1GZTA 2A6DB 2FATH 5D1ZI 1UX6A 1NSNH 4WFFD 1UZZA 5DJ8B 2VZUA 2ZCZA 3EJYD 2VRAA 3G5XB 2QSTA 5E1AA 5EOQH 3VB8A 3KXFD 5C2BH 3ZYJB 2Y9RT 3FB8B 5BW7A 2FLBT 4M1GL 5BRZD 1GKBA 2WKKA 5K5YA 3CIAA 2ZEXA 2ED8A 3OKKB 2VMIA 4NPJA 3VFGL 4Y9BA 5TGBB 4A2FA 1RUI2 4BISA 1RL1A 2V5MA 3L1EA 1F8TH 4DMIA 1WUNT 4YWGH 1N9PA 4ZO6A 5TH2A 4HVRA 4Q4W1 4CCEA 1OAYL 1VR3A 1TSRA 1V5JA 3ILDA 5BRPA 2W0LA 3VFGH 5EEXA 1VAHA 4NDMA 5EA0H 1WBZB 3JD71 3WG2A 1NAKH 4DZ8B 1CLZH 1HH6A 3EJRA 3JB8A 2IWGA 2WJ5A 4QPGC 5IFJB 3W2DL 1AYRA 4QTHB 1KGIA 1PIV1 4HBNA 1VPOL 2F5AL 1W6NB 5LKNA 2YD2A 1QH6A 4L1DA 2GAUA 4HN1A 3D34A 3VFUB 2VLJE 5CLXA 2DQFA 1MCIA 1EV12 4ODUA 2RMU3 3BVDB 4CILA 5F9JB 5IJBC 3JU9A 4K4KA 1Z7JA 2VDPH 2VSDA 4ISRA 3NCBB 2ILLA 2PWEA 4TOYH 3H7BB 4AKQA 1N0LB 5FYJH 4CZSA 5HTSA 4AEHL 2QKIA 5D1QC 1SM3H 3BFQG 3COOA 3CJIA 3RQ3A 1RP9A 3DXTA 3TEWA 2PCYA 5EMYA 4HPHA 1TXKA 4IJTA 2EEXA 5C6TL 5IBLD 2BGPA 3TN0D 3BEVB 1SBSH 5ITFA 3KGLA 1EMTL 1A1MB 3GHNA 5EO1A 3MLKA 1D4M1 3LKRA 4XMUA 4K9EH 2Z7WA 1FHGA 2E31A 1JK8B 3I02B 5I1EH 4FADA 2PLTA 4XIKA 1NPUA 3QPQC 5SV3A 1NDMB 4GAYB 3VBHA 4LPWA 3DMMD 4FMVA 4CDUC 5AFBA 5F3HB 1CR7A 4WFGD 3GBGA 3GSVA 4KZDL 5CA6A 3C09C 4M43H 1KIQB 3BKML 2YBRA 5FIEA 1F3RB 1S0DA 2G3ZA 2ILMA 1SBBA 2Y3AA 3KG5A 5M7QA 4ZFQA 4DO6A 3SPHA 4K94H 1X9RA 4H8WH 3MRPA 3CLEH 4G6MH 1XC6A 2PHDA 4P2OB 4I0PB 3VGAC 4B9KC 2TSAA 4MLIA 1FRGH 2CGPA 2BBAA 4MJ6A 5LHDA 4J28A 4CMMA 3KVQA 4P9HH 5HHXL 3MLYL 3O9WD 1G9CA 2PXYC 4RFNC 3D4YA 1D2QA 3WAKA 2JB6A 2X4PA 5IWLC 2Z2SB 1CWVA 4ORZC 4G8AC 4CDWB 5B4MD 5I1CH 4Y9FA 1MREH 5FKAB 3B5LB 5A43C 12E8H 1NC4A 1PAMA 1X7QA 2IGFL 2OMBA 5IQOA 1UYYA 4KO6A 3WUDA 3GYRA 1D5XA 2GUOA 1J8HB 1U8OA 4YSEA 1KWKA 2CAVA 1LU1A 4J27A 3O8XB 4YAQA 4LESA 2R9HC 1O5UA 3WO4B 3CZFA 5GGSB 1J12A 3BVTA 4HIIB 1DQ4A 4LBQA 5AC93 3MV8B 2XPJA 4QRRD 4HPKA 3G5ZB 2NXZD 2YA1A 3HC3L 4QTIL 5JOYA 3TT1H 1GVIA 5F44A 5GGQL 2FR4B 1UWWA 1VSCA 4L8DA 5LW9A 5LAXB 2ZGQA 3MLVH 2A5UA 3F7QA 3NVQA 3TT3H 2DWEA 5D1ZA 5C0GA 4JK0D 1FBIL 4IEZA 4Y5Z0 4NPLA 3KLKA 5JW4M 1F18A 1E2ZA 4GW5B 4IBZA 2ZHNA 3NAPA 2J1SA 4L8CB 3LX9A 1IS5A 1E50A 1HI6A 4KQ4L 3ZKMC 4YDZA 2X4RA 1QP1A 4O2FB 5GSVB 1NIFA 3E38A 4XAKD 3ROLA 5ABAA 2BSRA 3DXAA 2D2CC 3LB6D 3U1QA 3QDGD 4MNQE 3E5XA 4P9LA 3LNFA 4WHDA 2P5ED 3GSNB 5H9PA 2CE6A 3TCLB 1B0WA 4P59H 1JHKL 4S10A 1JN6A 3POEA 2YC0A 2AXFA 5C2UB 3MLZL 4WCYL 3C09B 2IGLA 4Q0SA 3QPKA 3IDIB 4J1UB 1WA0X 1D4M3 1FGNL 3CZSA 1YEIH 5JDBA 2X41A 5FO9A 3VE0A 1LGBA 4L3EA 2ADIB 1I3VA 1A65A 1P6AB 2GTWB 4PJCF 2H2PD 3F7PC 3VXRD 4AGPA 4JAAA 1YUHB 4KMTH 3UTQA 4FT8A 1IMHC 5HDWA 2CLRB 2FLMA 2VMJA 2WLMA 3O6FC 1UXXX 3IETA 3HPLA 4PVLA 4O00A 3CCHA 3IPVA 3F12B 4JQTA 1AO7A 3VL9A 4IOIB 3HI1B 3K8LA 3OG4B 1HNGA 4B9IA 1CYGA 1LTXA 3UAJD 2DLFH 2DQ6A 2WAQA 4I2XE 1H8OA 4ONFL 1RUD3 1VGEL 1WC7A 3B9KD 3IM1A 2F58L 3DL3A 1WBZA 2DCKA 1I3RB 1ZDSA 1WA2X 1EPFA 3NUKA 4Y5XB 2PLV1 5KSAC 3N3EA 5E6HA 2OPCA 4NHKA 5DDHB 2C26A 1HINH 1EH9A 1NCAH 2V17L 2YJQA 3HG2A 4KH2A 4LBEB 4CNIA 2K8QA 4NKIL 3VGBA 3M8OL 1MAML 3M3EA 4W6XA 1AACA 4KMLB 5FK9B 5GRZA 3CFDA 3FOLA 4PJEA 1NAEA 1FOD3 3D2UD 3EFOB 4LLVA 4MHRA 2WNVC 2E9JA 2WPGA 2WD0A 2BINA 3LQAH 4NKQB 3APNA 3BU7A 3N06B 1ULCA 3CAFA 5HI3C 4Y4KA 5T5PA 3AWGA 4ELMF 3BWUC 3IDAA 1SQ2N 3C60D 3MKKA 2OYMA 3SJVB 4IOSA 2VJ8A 1CQ9A 3DUIA 4GAFB 3SN6N 3Q9QA 3SKJH 1AHWB 1DYKA 3IDXH 3OOXA 2FZ2A 3FT1A 1NPNA 3M88A 1Q9LB 3QH3B 2XKPA 3G7DA 1VJ2A 3X14A 1WGOA 1AGBA 3HNTH 1XCQB 2IAAC 2ZXQA 2CBQA 2D31B 3P9MA 2DM3A 3RDJA 3RGVD 3AL6A 5CKMA 1F45A 4MDJA 3B8SA 4PP2A 2J56A 5F3HA 5DUBB 1QRNA 3GSNH 2A0LD 1XRUA 1TTRA 2C9AA 4YUEH 4GXUN 1YZZA 1ID2A 2ZUWA 1ET7A 2EACA 2E7LC 2D3LA 2UZIH 3BSHA 4FS0A 3V6OC 3O11B 4LLAA 3ZY7A 3ZZLA 3IIAA 2KQMA 4IMKC 4NNPL 3L3DA 2DQCL 2FQGA 4BCYA 3QH6A 5FPZA 1LKNA 1ML0A 1I85A 2R2EA 3FMGH 2GN3A 4XPVA 4IEFA 4M6OL 3OXSA 4FTVD 4M8UA 5LJYH 4YVSA 3O1UA 4KY2A 3SCMA 3RWNA 1M6OA 3MV9B 4ZO8A 4UQAA 1MEC1 3QHFH 4FQ2H 4ZTOL 1MNNA 5E70A 2QGBA 1Y1DA 2XZQL 4QU1A 5AYQA 1CFQA 4GLRI 4Y88A 1LOFC 1IC5L 1KC5L 3BIBX 3D4CA 3FUIA 5IJRA 1PKQB 5D2NC 4OCYL 5HHQA 2RS13 1OSZA 4RX4A 3WDIA 2QLYA 5GRUH 4PLNA 4GA9A 1LEIA 5TDOB 3VBUB 4NERA 4UQCA 3ZFEC 3TIDA 4Y5XC 2WCSA 4G9FB 1QEXA 5AKVA 1VALA 3BX7C 1W6MA 4G82A 2ZKNA 4PREB 3K2UH 4XFFA 5B1BB 2VCMA 4XGZA 4EUPH 4YGEA 3I9PA 1ND0B 2XTLA 1A7BA 1EVUA 1QPKA 3RE0A 4FABH 2ZP9A 3MNDA 3UNPA 1O59A 2Q3XA 3NRFA 4XCFH 3CVHL 5L8LB 3M1BA 3VUAA 1A21A 4R7DB 2YRLA 4FRWA 5INCA 1AGDB 4XP6L 1HE8A 3A67H 4ZO7A 4YGVB 2XN9A 3SKUD 1JHNA 1F8TL 4LLUA 2CLRA 1ITBB 1F11B 1HAWA 1NCHA 2CU9A 3P3TA 3LPPA 3PIJA 1KIPB 4O2EB 2VO8A 1W6QA 2VAAB 3WDUA 2Y1YA 1FO0L 3FFCD 5EORH 3J7MA 3BKJH 5DD5L 3V5KA 3KQRA 2W9EL 4URAA 2WXRA 2F0CA 3OJMB 3VXSA 4DY3A 1H6YA 3UT0A 2CCLA 1YQ5A 2HWE2 2FEDC 3ZDXE 2ICWA 3DHPA 3ETTA 5TDNA 3HE6B 4PJ9D 3WKMH 3MPBA 4YW4A 3LHPL 3W2DH 1Q8QA 1NAMH 4HZFA 4U0QB 3DX9A 1ESOA 3O41B 1FZJB 1KELH 1QQDA 1D7CA 4FJ6A 4HJSA 4JAMB 1MKFA 5E2WL 4H1LA 1QHPA 3QWNA 1JCVA 2OMUB 3DOSA 4P5TC 2OMXA 4YDJA 3HE7B 1KTRL 3TOPA 1OSGA 4B3VA 1LK3L 4FFHA 4EN7B 3Q6FB 4ATEA 3BVNA 5BNQA 3DRTB 3POJA 2L8AA 3RPIA 5CGBA 2PPEA 1BVNT 4WEBL 1VZIA 2XICA 1MDAA 3CCHB 4FMFA 4JKKA 5LB6A 2DAVA 4H20L 4H40A 4UMGA 2H6BA 4PCRA 1QO3B 4WY7H 1IM3A 2EYSA 1TNRA 3FHIB 4PB0H 5G4OA 3I2HA 4NE9A 1B9ZA 5LO7A 4EPSA 1AF9A 2QQKL 2VZOA 1A4KB 3MCLH 3FRUA 4WO0A 1ZV9A 4XXWA 4MCNA 4WTZA 4ZUTA 5TQ0H 3N0AA 1F3DJ 3T1FA 1WFTA 3MW4A 4D6SA 3V8OA 1H3XA 5HHMB 5AZUA 4PRIB 4CDUA 4JV4A 1ASOA 5AOKA 5CZXC 1ZA7A 3SDCA 1LEGA 5F3IA 4NIAA 2FECL 3DSNB 4UOW0 3R0NA 4NRXB 5JOFA 3MRRB 2VOWA 3UTSD 5J09A 1KJVB 2JKRM 3DA0A 3K4ZA 3VBUC 4XBMA 2RDSA 1QJFA 4WUUA 5CN1A 3GMLA 1NC4B 2XIIA 3LNDA 4KZDH 2XY2A 1RUKL 2E76C 2MKLC 1OLMA 1W72B 3S4SA 1O7VA 4GIPD 4LVNB 2GSIA 3T2PA 2C7UB 5I93A 3CQPA 4RRPA 2HRHA 3EJQA 2CLZB 3VI3B 4DP6X 5FZHA 2FGWH 3MF9A 5LGYA 4ES9A 3VA6A 2BPBA 2BNMA 3ILQD 4MQ7A 1SYSB 4G43B 5FFOA 5ACLA 3EBHA 2OUHA 3IVKA 1EZUA 3I2JA 3SHRA 5EU5B 4Y19D 3PUSA 4L0ZA 1XGPA 4HUWB 3II3A 2YGPA 3ARRA 2ATKB 2RD0A 1UATA 4WJKB 5SWSD 5KEZA 1D4VB 4N85A 1XOYA 1CXIA 4AWDA 3OKNB 3P02A 4N8VG 3ZZSA 3N7LA 3IU3B 4BYYA 4NFBA 1ZVHA 4K8FA 3THPA 5IVVA 2E6JA 3HR5B 4NHXA 3X1GA 2EDEA 2ARAA 3IMNA 4LLDA 5FDYA 3F00A 2WXPA 2WZ8A 2UU8A 1MCPL 1GW6A 5HBBA 1XF1A 2UZYA 4OM0L 3AVSA 3VKLA 1NEZB 4XNYL 4GPVA 1QPXA 2AEWA 3D39A 4JFDE 5L9RA 3CVCA 1ZNPA 3GTNA 3L7EA 1B9KA 2V6HA 4TRPL 2B08A 2WQXA 4XGZB 1ECZA 4JM0A 1PNFA 4HK8A 4JM2B 1QRNE 4BV1A 4AK2A 4G3YL 2GC2A 1KFUL 2W3JA 5I16B 2LTNA 3BD4A 1M05A 5FUOH 2WZ5A 4ARYA 2KPNA 3VBHC 1OH4A 4LQ1A 2F53B 3LD8A 1UJ3B 3FUNA 2DQEH 2KR2A 1HIMH 1IGJB 4KGLA 1UYPA 3KWWA 3V7MA 3EAKA 3ZDXF 2KZBA 4IIQB 2EC9U 2VAAA 4L23A 4PJAF 4PWKA 4Y16A 1BBJB 4GXUM 3TN0A 4C59B 5FPIA 5FZ7A 5A3MA 2DJUA 1GL4B 3C7OA 5BY5A 3I2OA 1E42A 2CO1A 5D7LE 4X8CA 3SYAA 4NSKB 2OTWA 4AQTA 3AT0A 2XKNB 5FYJD 3IPFA 4HV8A 5MI0B 1TQBB 4CU6A 1NLRA 1I1EA 2XH6A 2IUWA 3P30H 3U4KA 4HZLA 1JWMB 4LXLA 1MRFH 5LQBL 4GH4A 2WLYA 5EOTA 4H8QA 5JMOC 3MV01 3EDDA 1TEGA 4L3CA 4JFSA 1CURA 4Z76B 5A2IH 4J6RL 4YSRA 4U1KB 2H3NA 3T2NH 1H15A 3F65A 3MLZH 2RTTA 4WCYH 2ZBJA 2BOLA 4XPHH 2GP3A 1GZPB 4N5EC 2DLGA 3WW1A 4OQ9A 1O6SA 3T0AA 3K6FA 4NENA 2PYEE 4YGAB 3WU1A 5FQ0A 4GMP1 5EOCH 3FO9A 1IC0A 3MBEB 1GYUA 4WK0B 5I0SA 4QPYA 5D96B 4EZHA 3VXRE 4N1HB 4XPHL 1AR73 4ZTEA 1VRH1 1ES0A 4RHV1 3IMTA 3SKNB 1YPZA 1BGXH 1JYIA 3C08L 4MASA 1RZ7H 4XVJH 2YPLE 1AQDB 4HJEA 3OQ3B 4GW4A 1G6RH 3MACH 1E9PB 3MRBB 1GV9A 3TVMA 4G5ZL 3KPMB 3AX4A 3KB5A 3ZXFA 1V3JA 3NACL 4LCYA 5ADPL 5BS0B 2WWMC 3RDTD 3KLHD 4GXLA 5CVRA 1IT9L 1GOFA 5APAA 2ZXCA 3T9WA 4FBFA 2DBLH 3DJRA 1PLAA 3SCGA 4HEPA 3IF1B 1TMCB 4YG0A 4XC3H 1IRAY 1W91A 35C8H 1RITA 3QFJE 4XO4A 1NZCA 4LO4B 2Q86B 5AVZB 3MIHA 4NWVA 3BN9D 5CAZA 1W0WB 1N0XH 2EE2A 3NJGA 2E33A 3KPRD 3CEWA 4KY1L 5I0TA 4P5SA 1LAJA 3MX0B 1HNYA 1E4JA 2PCPB 3C6LA 2BVQB 2N7BA 3QIWB 4P2QD 4PB9L 3RIFK 3VCLA 5LRRA 1F2QA 2A1WL 3FU7B 3UZQB 1E8XA 4U05A 5I18L 3NV3A 2XTSA 5JDSB 1DQLH 1FJ1B 1Q9WB 1MHHB 3GK8H 2ICEA 2YAOA 4ZU7A 3PMEA 5AD0A 3WMQA 5DVNA 1NH6A 2CA4A 2W95A 1MZZA 1EZSA 2GSMB 3KS0H 4PJGF 3ZE2B 4P5MB 5D2NE 3FQYA 3IN0A 1W8TA 3QORC 2Z93A 4JDTL 1K2DA 2E3VA 2IBZY 1GA2A 3FB8A 5JIAA 2JCCA 1AR1B 1Z9OA 5DFTA 2H26A 1GRWA 1SXAA 4RN5A 1UZ8A 1T0NB 4WAFA 2P24B 3PJLA 4EE2A 3LF7A 3ZDYB 1EJFA 3NSJA 4Q7DA 1YC61 4JN1L 4WLCA 1N70A 2ADGB 3O4LB 1CTMA 5GRYA 2QR0B 4GW4B 2P6CA 3IZOA 4IV3C 1YJDC 3GMRA 3TJHD 1L7LA 4IU2B 4DP0X 2YPLA 3R4UA 3HVNA 3QIWD 4PIBA 3UROR 4P9HC 5C0BE 1A4AA 5D7IB 3MV7D 2ATPA 3GMQA 1DBML 1T0MA 5D7IF 3V6OE 3KMDA 2ARCA 1YG9A 2XG4A 4NXKA 1C1FA 3E8VA 3WTTA 1VFBB 3IJ7A 4HKBA 2DW5A 1I8IB 2AEPL 1QAWA 2ZOWA 3WHXB 4P4KC 3HE6C 4G5AA 1I1CA 2FSEA 3B7SA 3T0EB 1DVFD 3AROA 4N2AA 4W50A 3J4UH 2IOMA 5GSVA 3M3IA 3NABL 5DRNA 2E4TA 1R0AL 2V4AA 1OAYH 2ZJSL 4PJDF 3VD7A 1MCNA 5FZOB 5F1NB 4BWOA 3PF2A 2H8PB 2MPAL 4FO9A 1RJ7A 5K39B 2WXJA 1JFQL 5CJ5A 4GSQA 4KKQA 1Y1UA 4TKWA 2FHFA 5FYLE 2AC1A 3P3PA 3LVTA 3K72B 3GSXB 4LLDB 4Y1UA 4AEIH 4KOCA 1UG9A 4JG0H 5ANHA 3VX0A 4DP1X 5AUMB 2F6BA 2FDBP 2BW5A 1A8ZA 1W8WA 2OL3A 4P5YA 3VE0B 3EBAA 5FO9B 3X2QB 3AM2A 3ULVC 1OAUH 4E68A 4FXKC 1BQLH 1R5VA 2JTYA 4KUZL 4W6WA 4NC2B 2EXSA 3CLPA 1XF2A 1D5ZB 2I2SA 3DVFA 3GDCA 2FWSA 2QADB 3KWWB 5DS2A 4YHLL 3B9CA 5HYSB 3MREA 1P7KA 3TZVD 1BZ7B 1NCBL 2F1AA 5TQ2H 4QHKI 3AS2A 2WMPA 1D5IL 3C7FA 4XHJD 2OXHA 3Q2VA 1OK8A 1OAQL 4OKDA 5CEYA 3BLKA 4LPTA 4AV4A 4X4YB 4C47A 4K7PX 5D7KE 5FCCA 1OB1B 1U3JA 1LD9A 2EE9A 2XWDA 3PABB 4P3CL 1V0AA 2W9XA 1JL8A 3BSZL 2FYYB 3WP3A 4EYUA 2X70A 4Z0XB 5GLWA 2K78A 3D39B 5CN3A 3THCA 3IRZA 1THCA 4LCUB 1BMGA 1CGSH 2DWEB 4TSCL 1Y6MR 3MW2A 2J8OA 1SFPA 5JHAA 1JGUL 2B59B 1EDHA 2V7HB 4JFPA 4LE8A 3OB8A 5CSGA 5KSUB 4GUQA 1MEC2 3PJNA 3QDGA 5D9SB 4Y4FA 4M7LL 3WD5A 3TC9A 4R0LC 2XLAA 4NO0B 3UYPB 4NAQA 1G6RA 4WZ9A 1MS5A 1OM3L 2CZNA 3VD2A 5FYKD 1JZEA 4NRMA 1CC3A 3IK2A 1M7IA 1YEGH 5EYYA 4ZMYA 4N2NA 3BRGC 15C8L 1MCQA 3NJYA 4O02A 4OQTH 4R4BA 3AS3A 5DQDH 3LH8A 3LEGA 4EIBA 4L4VA 1HWHB 4K94L 5FOJA 2G0KA 3II2A 4URTB 4YSDA 4A2LA 3B3QE 4PJBE 3NPSB 2I07B 4LT7A 3SGDH 3TA4D 3BN9C 5JHDD 4HT1T 2PR9A 1URIA 2IXLA 1T1XA 5HHME 1VFAB 3KJ6L 4AL8H 1IZ3A 3IDEA 2OMUA 2Q76B 3VQ1C 5D5MF 4BQYA 4C4UA 4LDCA 2H32B 2NY5H 4WY7L 1KCRH 3ASOB 5KVEL 1XNDA 1T7ZA 5E7BA 1I85C 5C8WA 1QEWA 2OT7A 4IMLA 2DYPA 3G5WA 4K3UA 1XX9C 5TQ0L 2E8ZA 5C9AA 4PYHA 1FZMA 5LATA 4LCWE 1MIMH 2X4OA 2XTJC 4CA4A 2QR0A 1EQWA 2Y5QA 2E9QA 4HIXH 5FYUA 1WLDA 1IFHL 1T4KB 2YD7A 3L3OB 3O3BB 1V6LA 3GHEL 2B7YA 1Z0NA 3VFUA 1XYNA 2R7EA 4G6JH 2E63A 5CKQA 1AG6A 4OIIL 1LTEA 5IHRA 1IC4H 4ZOEA 4HBQA 4ODVL 4QRUA 4UM9A 4Q27A 3SY0B 2ADFL 2JE9A 4ZDHA 1AXZA 1HNFA 3UTSB 4N5ED 2WLLB 3A21A 1L9OA 4KHXL 4IU3B 4QMAA 3HLKA 3TBCA 2HFFB 3L3IB 4G83A 3OD4A 4W68A 5DRNB 4L3AA 3C2AL 3LKRB 1NQDA 1NPJA 3CUPB 1HZKA 5A33B 2VR8A 1R75A 3CFCL 4GQQA 5E5MA 4PG9A 4EV0A 1S7SA 5IK5A 4MSVA 5G05L 2P6HA 4AITA 3BKCH 1OEZW 4ZUUA 1WZMA 4XH2A 2UZPA 3D25B 1JZDC 3HN8A 4ODXB 3VD3A 1MVYA 1T1WB 2HFEB 3BP5B 1U33A 3VG9B 1AYM1 4MTMA 4OLYH 1MI5A 2CDOA 3I3EA 3SLIA 2QTVA 1TEFA 4MSWA 2X6VA 1SXZA 3UERA 3GO1L 2XKUA 2ZX2A 1FPN3 3O4LA 5B3NA 4PGDA 5F9JA 3THDA 3MU3A 2DF3A 4DRVA 4ZNEA 1T1WA 1DGWA 1OOPC 1UZVA 3S37X 2D9CA 3F7VA 4Q8KA 4DKTA 5IEKA 1BFSA 3O1OA 4A6YH 4JHZA 3V0EA 4M3CE 3PUHA 4LQRA 4DEPB 4NYLB 1KB5B 2YPKB 5A3IC 2D3NA 3HNSH 5CNAA 3LPOA 4FYRA 4BQXA 3SJVD 5T3XE 2VQ0A 5ANMB 1HSAA 2YHJA 4HCRL 5CIPA 2OS2A 2DV9A 1XMWA 3C5ZD 4A6YB 1WISA 4FHJA 3T3ME 4MV2A 1REIA 2CBPA 1XSIA 2A73B 3NZ8A 2CBTA 2FBOJ 4D8OA 5JMRA 5KJ7E 4KI1A 2YEZB 2VZ1A 2QDRA 4KVCH 4Q0PA 3ZXDA 5E99H 1TZGH 1B90A 1E30A 5TDPB 2BWIA 1FATA 1ZZ7A 1LO0L 2GFBB 5GS0H 1O7DE 1MQKH 2VDNB 2FIRT 4KXZH 4W9EC 5D2LB 3PWLB 1NAMA 1IC1A 1I7UA 3QQDB 5IB4A 3U79A 3KNBA 4WV8A 2VXQA 2YUZA 5HVHC 4QRPD 3IT8A 3O3DA 1RMFH 4I2OA 1HINL 1N7MH 1NCAL 2A9CA 2V17H 3QB7C 3QUZA 2PO6C 3IGUA 3QUXB 4G42B 3CFBB 5C08A 4XAEA 1NFDB 2IOIA 2KKQA 2ERJC 3N1GC 1EHAA 5E4AA 2ZOUA 2BVPB 4Y2DD 1ASJ2 1POV1 4PD4J 2DYRB 3PAUA 4PJBF 3VDDA 3B9EA 3ZTJH 3LIZL 3MUUA 5FYKE 3RFRA 3QO1A 4H0IA 4DGIL 4JFZL 1ZBE2 1N5YH 1MY7A 3BOWA 4AAPA 4HJJL