4ES8A

Crystal structure of the adhesin domain of epf from streptococcus pyogenes in p212121
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
302
structure length
302
Chain Sequence
EELPDDLMNFKGTWEVSADGSSGRFFSKGATDSYVFHLIPAKDVKKPGWREHNEVKDSYIKIDKQSIAARYKTSTTAPYSVAFKVNTKSLIKDHDYKITFEQGQIASGITVDYRIGSAFNKTTDDSFKISDESKYASNVKIEGEEQGFKQREQGDKTISFRTLKEGPMSLVLLSKVEKKPQGDLDVEFKNLKIIDVTNPSQLDKGVAYVGNKNVQLTLKSDDGRTNFEGDEISLFNSRGELLQTVTVTKDQQNPISITLSEDQAKSLKNKEKLKVSIKQKQSKKTSKDFFFEVGIDPKVEAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epf
publication title The Extracellular Protein Factor Epf from Streptococcus pyogenes Is a Cell Surface Adhesin That Binds to Cells through an N-terminal Domain Containing a Carbohydrate-binding Module.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
total genus 80
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4es8A02
2.60.120.1240 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4es8A01
4ES9A 4ES8A
chains in the Genus database with same CATH superfamily
4K3DH 1ZWIA 3H85A 5DJDB 3TH3T 1Z66A 2AGSA 4G9FE 2C4XA 1RJ7A 2R062 4MA3B 3UK9A 1FYUA 2W65B 4HGWA 1NCNA 3QJFA 1M7DB 4YSQA 1A47A 3ZXEA 1PFOA 1OPGL 2RR3A 1NC4D 4BWWA 4DGYH 2PWGA 2FH8A 1RUKH 2XQYA 3LFIA 3ZKXC 4D9QE 1SJEA 2ZF8A 1FP5A 3P0VH 4DVRL 4IS6B 3Q3GB 4Z78A 5HHOB 2ROYA 2E3VA 4YH6A 2JWYA 5D8AC 3G5WA 5DZEA 1CR9H 4YW5A 3HIZA 3PNWA 5C8WA 4EZKA 3QH3A 1XVSA 4TOYL 1Q8VA 4S2GA 5CN3A 3SYPA 1ZGLB 2AJXL 2UWEA 4WVWA 3ARZA 1OANA 2X8KA 3HFFA 1O6SB 4NKMB 4OZIA 1DBJL 5ABZA 4NQVB 3FU7B 3ULUC 3NN8A 3QDMA 4BYYA 5C6PB 2OMWA 1ASQA 4OZGB 1QX1A 1CJYA 4XCEB 3EH2A 4C4KO 3AXLA 5FZ8A 3S0MA 2X3CA 2WBJB 3L3OA 2R51A 5CIPH 1NBYA 4FP8H 4OT1H 3UTPE 2WWOA 2CO3A 1OSEA 2MCAA 2DU1A 4LVHB 2QVKA 2RH0A 4H8QA 4XDPA 2JKRM 2APFA 2IZWA 1LHZA 4X9HA 4IU2B 4LQFH 5EZJB 3WUZA 1VGEH 2DUQA 1UYYA 3KPSD 2ORBH 1T03H 2BSEA 1H8OA 2VDOB 4HJSA 4EVNB 1R6VA 2YPKB 3P0GB 2VLLB 3RE0A 5LWYL 1CURA 3O3EB 2IUWA 3S5LA 3ZKNC 2YRLA 4DOHE 5E2VL 5ICXA 2G75B 5EZLA 1WMDA 2FO8A 1QBMH 2NXZD 1G9MC 4ONFH 4ZX5A 4QJ5B 3ZOIA 4IDJH 4HMCA 4JM2C 5JNYA 1WIOA 2FEDC 1WA4A 4KJYB 1GZPB 5JOPE 5LNDA 4EDXB 2C1OA 1A6ZA 4Z0BL 2XQBL 3D3VA 1JPGB 3DUIA 2CK0L 2VLRD 4NZTL 5KW9L 3KDPB 4DESA 2J8OA 4YDKH 3AKRA 1EPWA 3N9PA 5KR7A 4H7LA 5J37A 1MJ7L 4MB4A 2EEXA 3RL2A 4YE4L 5FM8A 4Q74A 3OYWA 3U0PB 4MD4A 2AS5M 3V6OE 3FFOA 1UO9A 3IMRA 4Q97A 1Q8QA 3OKOB 2RDRA 1CGVA 3RA7L 3JWNH 5AKTA 3FB6A 4QJ4B 1G9DA 1RSYA 2Z7UA 2ITDB 4XWGH 4M3JA 2QTEA 1T2JA 5LDSA 3MRLA 2YD9A 2IXLA 5D8JH 2PCFB 4K7PL 3VBOA 2ED8A 8FABA 1M3IA 2VR7A 3BIWE 5FIXA 4ZUVA 3UGXA 4JAAA 1FNEA 4NCC2 1UG9A 2B5IC 4PRIB 5FW7A 2JKLA 1BAFH 1MPAL 3AT8A 4LE4A 4BLJA 3GZQA 3N50A 4YHYC 2D4DA 2V4AA 5AVPA 1IT9H 1KJ3H 1STMA 3VFSB 1M06G 5E2TH 3BTAA 5BV7B 3D52A 5L6YH 1HE7A 3WUCA 1HYSD 1TETL 1ZBE2 2O8OA 3ZDXB 1WAPA 3ZO9A 2CGOA 3KS0J 1A3QA 4NQUA 1NUDA 4M6ML 1IPKA 5FYLD 1CFQA 2KDGA 1QJY3 3IDIB 4AK1A 3ARPA 4BYHA 5DRXB 4P23C 1NLSA 2BFGA 1IIIA 4DZGA 3U1PA 2BOIA 4F15B 5IMMB 3AP6A 4JG1L 1XL6A 4HSAC 5E6ID 1E5UI 4Y2LA 3PTRB 2MPAL 3OWEA 1DDHB 5BJTB 4RA0A 5A6XA 2X5IB 1FWXA 4QLRA 4B29A 2PLV1 3U1SL 1NFDF 4HISA 12E8H 2FMDA 1YRKA 4YX2L 2OXGB 3I3MA 4G7QB 1MCEA 5JIMA 4NHYA 2DKUA 5DSCB 4AKQA 3NOIA 4O5LL 4UTAH 4MMXB 2OMVA 2FT8A 5IK4A 4DOUA 4JFYB 4ZPVA 4E41B 2HWC2 4BRVA 2CO1A 2VAAB 1ET7A 3HG1A 5GGUB 1RFDH 5A7BA 4NWUH 4CGUB 4RLDA 3ECUA 4ZQKB 3AZWA 4MS6A 4M5YL 4JKLA 1MPXA 3L4VA 3KPNB 3HT1A 4IBSA 3NV4A 2RJ2A 3FSWA 5F7WC 2R061 4OLZH 1C5CH 5ALBL 4KKQA 4FQ2L 5C0RL 5IUQA 1GQPA 2EQDA 3NIFE 1F1DA 1Z3RA 1DVXA 1WTGT 3DX6B 2ZHMA 4FJZA 5FHBL 4GG6F 5FZEA 1GJWA 5KBMA 2I7SA 1QFUH 2FL5B 3ZT5A 3AP5A 5KYUB 2VAJA 2OPWA 3QFJD 4LVOB 4DN3H 1KY6A 2CM6A 1NCAL 1WSST 2W0XA 1YEFL 4NZFA 4XUOA 1UD2A 4UCFA 5FBJA 3BT2L 2WBJC 4TSCL 2P24B 3MCYA 1OP3K 1IRAY 3GI8L 1BQHA 3HAEH 3QRLA 2V8MA 1DBMH 4ATWA 2J1UA 1CD9B 2GKIA 4MD0A 4DTGL 1FVEB 1O6VA 3BZEB 2XQRA 2CRYA 4LVHC 1MCSA 1SBSH 3AKSA 4KTEL 4OGZA 3GUTB 1EXHA 2E8ZA 2VE6B 2IV9A 4HUNB 3BZ4B 4XWOC 3NJLA 2UVFA 1NJ9A 2X88A 2F5AL 2JQMA 4FNPA 4ZRGA 2GSGB 4YVWB 5FFOC 4Q8KA 3CDYA 4XP6L 1S5HA 3KYKL 2Z69A 5KSAA 2L7UA 3L5WB 1ND0B 5JI7A 1P5VB 3A6BL 2X53S 5KXCA 2VDKH 5D1XD 2WR9A 1ND2A 4GULA 3AS0A 3FTXA 4WUUD 4F83A 5T3XE 4Y26A 2GIYA 3CSGA 1D5ZA 2FJFA 5K33A 5DJ6B 1W6OB 4OJFL 4UUJB 3NNGA 4IYKA 3O6FB 3GJBA 4RMUA 1XGQA 3JBG3 3MJGX 5E1AA 1I7UA 4DO6A 2W9EL 1ZRUA 1OP3H 2HJIA 3OPUA 1S9VB 1MFEL 5JW3L 4DERA 3KL3A 5KVEH 2BINA 2RFXA 2BYVE 4YW6A 2ZOLB 4ZS7H 1A7PH 1JGLH 1F45A 1RCYA 2XI9A 4FFVC 4JQTA 2CDEB 2OYKA 5IROD 2GCYA 2C9KA 4R4ZA 3O6MH 1G86A 4X5RA 1VJSA 4H1LH 1WFJA 3NEOA 2NX5B 3EYVA 4U1JA 5DDHB 1LQSR 2VZUA 2P5WB 4PJIB 5ANME 4I2XA 3THML 4B9FA 1FX5A 1VFAA 1WW5A 2J42A 1UXSB 2NY3C 3EADA 3RX8A 2HTLC 2IG2L 2YRZA 3CFCH 1A4AA 5LBVA 1RUG1 5LEJA 2ZYSA 5DUWA 1H0DA 1A7BA 1FFNA 3FQRB 5AFAA 4NCDA 3UOAB 5A6YA 4TL4A 2F19L 2ARWA 1U3HB 1ZIAA 3EJYD 2BX5A 4DPRA 5F96L 1QSED 2EVFA 3JYCA 3S3PA 3SBWC 1FFQA 1JDDA 2NYYC 4NQDD 1QXJA 1DBBL 2X4UB 5CN1A 3EZJB 1HXMA 1ZK5A 5JSRA 3UDWC 1PIGA 4JLRB 4KQ3L 1XNCA 4WFED 5E1QA 1JPTH 3IPEA 4AQEA 1BBT1 5IJBC 1X82A 3EB7A 1ZV9A 4NCC1 1H3GA 4PB9L 1VBE1 4UOW0 1F6AA 3VWKA 2QADD 4XC1L 3D2UD 5GZEA 1DLFL 4CP2A 2FGZA 1M71A 5EOCJ 3H9SA 1RU9L 4MZ2A 5BW7A 4HC1H 3QQDB 1SHMA 1DYPA 3L1OH 2H0JA 4ZMPA 2HJKA 2VBDA 2QKDA 2DYCA 4ONUA 4G80B 1VFBA 3TBWB 3QYMA 3HJEA 5FP8A 1ZBE1 3VKFC 5L88H 1O5DT 4F15C 4ZYKA 4AJVA 1R34A 5DI8A 1JGDB 4AXWB 4HJJL 1BVKB 3L7EB 2BWCA 4M43L 1KIUB 1UCTA 2NR6C 4HQQL 1NCCL 3TBSB 4ZX6A 3HN1A 3FUQA 4B27A 2X5IC 1NCDH 1BVNP 2BLFA 3VXMB 3US9A 2GPZA 4I1RA 1N26A 1KLGB 3NRPA 3VYNA 1WQVT 3TJHC 1N8OE 4FFIA 3VJ6B 4EMZA 4NWTH 4XHXA 4WY7H 1JUFA 4XPAL 4ZDHA 1AD9A 1AXIB 5A2IH 1RZFL 5D70H 3VU2A 2B59A 3O0RH 3CZGA 4JJHA 4LPWA 3PREA 1AC6A 4ORGA 4DY5A 4NM4H 2QQLL 4QYAA 1E28B 3ZXAC 3BAEL 2O1QA 3KPSE 2IADB 3A47A 3SDAB 1SXBA 4NP4H 1X50A 2VG9A 1CD1B 2Y2WA 3BVNA 3NYKA 4YO0A 1HXYB 3WFZA 4CVWA 5I1DB 5J98B 6FABL 3WNNA 2HWC1 3QT2A 1XNBA 4IEFB 2DLFL 1ADQH 4G9SB 1EQWA 2EDOA 3V5HA 1D0GA 1DFBH 3ARDA 2AABL 4EWAA 4RMQA 3WDVA 5E8EB 2W0PA 3VGIA 2IDUA 2XJVA 2GIMA 1TTFA 4TN9A 5IB5A 2VUCA 5GSRA 2K6ZA 4N2HA 1VAVA 5C3SA 4NNYB 2HKHL 4MV2A 3O8XB 4KK9D 2Z1KA 5SV5A 1NFDA 1MHHA 4BXSV 3HOBA 3VZNA 2VLRE 3LIHA 4F2EA 3EF7A 5C0AA 3K75B 2YN5A 4L8CB 1DU3D 3DGGA 1R24A 1JOPA 1NLBH 2YMXH 1YEJH 2DV9A 2DIJA 3GXIA 3PJSA 5F89A 2WNVC 1Z9MA 3PGCA 3G5ZB 4ELME 3F5WA 3O2WL 1UAIA 5FPXA 1QATA 3UTSB 2HWZH 3HI1B 3N55A 2D6KA 2X4RA 4BH8A 2E7DA 2VW1A 4YVWC 4IGQA 3IXAB 3JVGC 4XN4A 3ZSSA 1TJIL 1AJKA 4ZHNA 3STZB 4JQIL 4K9SA 4JM4H 3ZTEA 1CGXA 4GG6A 4NWVA 1MHCA 3FH5A 5GRUL 4CXWA 2DDQH 2D3JA 1BBDH 1Z9NA 1KCVH 3D4CA 4JB9H 4JFZH 4TVPH 2VMIA 1PU0A 5F2WA 3E6CC 3DJTA 3FFCB 4A67A 3FJTA 2VSMB 3LQZB 4XOBA 3O6FC 3QA3B 4RYDA 2OMTA 4KK6C 4HKOA 5HV0A 3VXSB 4MA8L 2MKWA 3ZKSD 5I19L 3GF6A 4K1ZA 1X4YA 5I1JH 3F05A 1C5BL 3EBIA 5DHDA 3VMNA 5JXEA 5LA1A 3MXVH 1OAZH 2B14A 5FYLE 5L2JA 3CN1A 3AG4B 5EF1A 1KFXL 1JNLL 1ZTXH 2WXRA 2D03L 2RCSH 4EZMA 4UF0B 5K9QI 4UW3A 3AB0B 5JZGA 1ZZCA 1LE9B 2Y69B 4Z95L 1HW5A 3MMEA 2NT1A 4X98B 4PD4J 3PXJA 5DJ0B 1RZ7L 1WEJH 1DQQB 2KZWA 1N47A 3EG9A 1AI1H 3O2DA 2BVOB 3AFLA 1AXZA 3WXPA 4L2NA 5CIPB 3TJPA 1FZMA 1U3HC 5C0JB 4Z0XB 2DVDA 3IPFA 1ZT1A 1E3XA 2Q1EA 4KY1H 4OD2A 3K48A 2G60H 3LNFA 3DOSB 4CC1A 1UKRA 2WSUA 4XPTL 3VFWB 1XSKA 5CD5D 3GBML 1XF2A 1E5ZA 1JHLL 3MBWA 4B1LA 2XONA 4QPIB 1KPVA 1ND3A 5CVRA 2K3HA 1H1MA 3RBGA 1HHJA 4A55A 4IEXA 4ERSH 4QX8A 5CGMA 2XJPA 2JV6A 3CFEB 2HUEA 5CSZB 1OCCB 3GO1L 1TEIA 2DCKA 4BJ0A 4ZZ5A 1INEL 3AFGA 1VENA 2WFF2 2K7QA 2X2JA 1I8KB 5IFHL 1GP4A 1ACYH 4NYLB 4JR9H 2CSGA 4BE3A 3I6SA 1LLAA 2MTAA 5FCSH 4B7EA 2P3JA 2XT1B 3UFIA 2FAUA 4E9SA 3GDBA 4Z77B 1U58B 5C0IA 3R6SA 5C8CA 1XIWA 2KBGA 2R0ZL 3C60A 3DVIA 2R30A 2DJUA 1MY5A 3QFJE 3T0ED 4AX3A 1NOFA 2GSIA 2VQ0A 2RQEA 2GJZA 1WISA 1VZGA 5ACA3 1FPTL 3IDGA 3HEIA 4Z1VA 2OIIA 2P44B 1XR8A 1C08A 2PR4H 3KNBA 5BPPA 3GYDA 1Q90A 3BD5A 1MRDL 1YEIH 4X42A 4TUUA 2WZEA 5FUZL 4E2OA 1PO12 4UM9D 4LRIC 4HIXL 5BNPB 2QUOA 1Y6NR 3MOBL 2A70A 1UYWL 2EALA 4Z7NB 2GMPA 4TSVA 3EYSL 4HFUL 3WU1A 3VD9A 2P8MA 5CEYA 2XU9A 2W0KA 5DRZA 1OLMA 3OBZA 1OAUH 1RVFL 2R2HA 1A3ZA 3LNGA 3QJZA 2NSXA 3ZYBA 2Z34A 4MMYB 2SEBB 1UJ3B 1TJGH 3MJ7B 5D1XE 3NAPB 1UJTA 2FTAA 4WUUE 2F6BA 4ZMLA 3O2DL 1MW1A 1I1FB 1D6VH 3TO4A 5A16A 4N3UA 2FCVA 4CCLA 2D6MA 4HETA 4IXLA 5SWZB 4JDNA 3LZPA 1P4BH 1ZHKA 1XYNA 5ETUA 4K9EC 1OTTD 4MQ7B 1AZBA 4S2SA 1KLFA 3O8XC 3FYEB 1FIGH 2JELL 3ILFA 5FY7A 4HKJB 1OMIA 1JCKA 5GLVA 2XJKA 4ZFOB 1KT2B 2BP8A 1EZVY 4B3VA 3QIWA 4LDLB 1UMIA 2W5PA 2OUJA 2RDNA 4X8PA 2WWNA 4UNTA 1X5JA 4AZ8A 4ZO6A 3WDXA 4H40A 3VGDA 1SOKA 4UDUB 2Q0ZX 4QPGB 3E1ZA 1T3FA 2VDRB 3M88A 5FXZA 1DL7L 3MW3A 4L8QA 1ZLSL 3KHCA 2B0SL 1QFHA 3MCLH 4Q2ZB 3TT3L 4L8SB 3KL0A 4U6VL 4UOZA 1LNSA 2Y36H 1HFUA 4KFZC 2PXYA 2Q4SA 3Q48A 3TPUA 3Q6GH 1FNAA 1A6VH 1Q8MA 4K20A 1XB6A 4K3JL 4J3TA 5AB2A 2J12B 1ZYBA 2X9YA 4JG0L 1QSEE 1E9PA 3IU4L 4QGTA 4LPYA 2P34A 3LGRA 1HL8A 5DAXA 3K91A 4N0FA 4NQDE 1P4IH 3MRJB 4IGBB 4NQQA 5F7KC 5LQBH 1BVVA 2O30A 1ZVSB 4WFEE 3QEHA 5J1SC 2YB7A 4IKKA 1TMCB 2F74A 1CFNB 4DGUA 1I8MA 5H37A 1R092 3RFRA 1U93B 2IH9A 4FEIA 1OPGH 3ETTA 3DRQB 4WWPA 1ODUA 3CBRA 4DVRH 3WIIL 1A6AA 2FO4A 2P8LB 1WW7A 2AC0A 4LITA 1U9KA 3LPOA 2VABB 5K93A 3J4UH 2X4TA 1TTAA 1OGTB 2WYZA 1K2DA 3GBNL 2CDFA 3TASA 4TOYH 1FL3B 5F1KC 3V0FA 1HWHB 2AJXH 1XH3A 2VR8A 1SHWB 4I85A 3AAZA 1CLVA 5T1JA 2ALAA 4GXFA 1RUJ1 1DBJH 2N7AA 3FFQA 3N40F 2XZZA 2BZDA 5HI4C 1YC7A 1ZXKA 3W38A 5K7PA 2BSTA 4G6ML 1J86A 3DK2A 4JRXB 4JY4B 1KSRA 4ATEA 3HAEB 5MEPB 4AQ1B 1XH0A 2FYVA 5ALCL 5F9JB 2JG9B 1TENA 4JCKA 3SKMB 2DMHA 4QPIC 1ITCA 1RGSA 2W39A 3MHZA 1B6DA 1P6AB 5IJRA 1QPXA 4DP9X 4AQTA 2IPTL 1I8IA 2YD2A 4GIPD 2XQYK 1OP5K 2NNAB 1MS1A 1LXMA 4HZFA 2R0KL 4A3ZA 4L1HA 3QZLA 2WSDA 4PRBA 1BF8A 1H4GA 1COBA 3KYOB 4MMZA 1ULEA 2EUWA 3ARSA 4AIZA 5B7EA 1NE6A 4S1RH 5LWYH 1PZ7A 1X6NA 5EU7C 3USUA 4CEWB 1G7JA 3OF1A 3B00A 3PUIA 2YN3A 4GNKB 5E2VH 3LRMA 4MQXD 2EO1A 3OLEA 4JREB 1H3VA 4NSKA 4ZNCD 1V5JA 5FC9A 4NC1C 5IWLA 3BXNB 4EZLA 1RYYA 2ICWB 3P5BA 4C83A 4EQ3A 4L92A 1RI8A 3CQQA 3ZYIA 4PCTA 1PCSA 4AUUA 4Z0BH 2XQBH 3ALQA 3D4ZA 3NESA 2CK0H 4H1LB 4LCWB 4NZTH 5KW9H 4ZU5A 4M7KL 2P45B 3L9RB 2JCCF 3D69A 2B9UA 4IL7A 4XNDA 1MJ7H 1ZSDA 1TFPA 3FSVA 4YE4H 1WZMA 1NAKL 3IEAA 4K15A 2RS32 3FUNA 5BNPC 3JWNC 3TO2B 3GC3A 1CQKA 2ZOTA 4RGND 1XRUA 1LEIA 2GJJA 1U8JA 1PNGA 2ZX2A 3RA7H 2VM3A 3JWNG 1UWYA 5GLUA 2VOTA 1OZUA 4X9YA 4PGCB 3PUQA 5LDUA 4Z7VB 4Z3GA 3Q5OA 5AKSA 2G0LA 2LU4A 1UJ3C 3QWQB 5CU9A 3NAPC 4GIAA 1RUPL 3PUHA 1FL5B 1GFF2 3FN0L 1H8NA 1NICA 5JIHA 2GJ6B 3H1MA 1W2TA 1DGLA 5I1CL 3B2PA 4R7DA 5CP7B 1E4WL 4XGZA 2Q8AH 2JD4A 3HCVA 4KI5C 4OZ4B 4XB7A 3SDCD 5JZ7C 2FEEI 5DC0A 1MPAH 2B16A 3SKNA 1NANI 3N43B 4D9LL 1G4MA 2LVEA 1RUE2 1HX6A 3SBPA 3O4LA 4EXPX 4XNQB 1P8JA 2D6LX 1F11B 2ARJB 3MRMA 4JFVA 2D7FA 3H3UA 3KYMA 2FZ3A 2NYZA 4PBXA 1E5IA 2WO2B 1TETH 4OUMA 1SM3L 1PKQA 2XG3A 1AGCB 4LE3A 2M1KA 5MERA 2ZWKA 4M6MH 3ZYZA 1BFOB 2E7CA 1AL23 3JZ7A 2EKSA 4QPGC 2VTXA 1MQ8A 5D4HA 3NNLA 3HZMA 3T0AA 4HIIA 3ARFA 4BXFA 4DFHA 4KNCA 4L8SC 5I75C 4JG1H 1UZ0A 2X9WA 1E4KA 2AQRA 5LCWL 2MPAH 4KQ7A 3BLBA 4I0WB 4GB31 4XCBA 2BSBA 2PW1A 1RVF3 2W2IA 1KBKA 4R5TA 3U1SH 1MLBB 4FPLA 1L4IA 2HFFA 5F0LB 3BB6A 1AQDA 4CCEA 4YX2H 3AKQA 2YK1H 4JQVA 4WK0B 3KBPA 5IB1B 1D4M3 1A6CA 1FLRL 1YHPA 2EXIA 3V0BA 4FQXD 1EUUA 5I16B 2WNUA 2O93L 4RIRA 3VBHA 4ZOCA 4XQDA 1QABA 3KGTA 3IVKA 1EXUA 1MN4A 4BGDA 5I6LA 4P4KC 3SKVA 3LD8B 4M5YH 5IR1B 5E24E 3ZFFB 3LN5B 3B9AA 4POYA 3VGBA 4XIOA 1ST8A 5DF0A 4IV3B 3DA0A 1SPPB 4MNGE 5ALBH 2BOLA 5FPBA 5C0RH 2PKDA 4FQ2H 1WBXA 1R091 4F7EB 4RSVA 1MH5B 3L45A 3T0EE 3IMBA 3JSSA 5DJYA 5FHBH 3W59A 2HH0L 3OXRB 4DGWC 3MLWL 1GVIA 3NA4A 4N26A 1ZMYA 2P1YA 2KQNA 3P9LA 5A6LA 4DO0A 1T7ZA 4OLLA 4G6KL 3CFJB 1JHJA 1NCAH 3BMWA 3F04A 4XVOA 2OKXA 1IGYB 1OW0C 4N86A 1QNIA 1GZHC 1R9FA 3MRIA 1IGJB 3BT2H 1KGJA 3EO0B 1JVKA 2CE6A 4G7VL 4AQ1C 2JG9C 2R56L 3M1BA 5DJ8B 3J2PA 4GOSA 3HAEG 1A14L 3FN3A 4G7RB 3DJRA 4U6YB 4FPOB 4RS5A 5BZWB 7TAAA 3E38A 4DTGH 3H8UA 5GS2D 3CZLA 1D5BB 4KTEH 2E4FA 1MCDA 1BF5A 3G5XA 1VFUA 5G55A 1XTLA 1W16A 4PRNB 4G8EA 4Z7UE 3ARBB 2F5AH 3U36B 4NAJA 1C16B 3V4PA 5C0ND 4XP6H 4Y5VA 3KYKH 4RS5B 4IW3A 3NQIA 1ZHLB 2ENQA 1IC1A 1XEUA 2H1LM 3P3TA 4RFEB 1ZNPA 3MIDA 3I9AA 2VH9A 4CEWC 5JXJA 5T3NA 3VFVB 2BZCA 5E89A 1V7ML 3VXRB 1YNAA 2HYXA 5I8TA 2QPUA 2KERA 2NOYA 2YGQA 3MV11 4KNTA 4O4YH 4AYFB 4F92B 4WM7A 1NCHA 4JREC 5TSWA 2KI6A 2EKJA 3BP6A 4NN7B 4AYUA 2HT2D 1DEEA 2PTUA 2W9EH 1FJ1A 4QHLB 1MFEH 5EPAA 2H41A 5JW3H 5IHBA 2R1BA 5F0MB 3RWHA 4F93B 4TUOA 2P49B 4NQTA 2RB8A 1EHXA 3IPVA 1OURA 2D6OX 1NOVA 4AYDC 5HYSB 3R0NA 2FIKA 3EYUL 4CSSA 4BFKA 3KPQB 1U8KA 5EC1A 4PM1A 5I1AB 1U91A 1UT1A 5DRWA 3FHIB 2MCG1 1DLCA 1H30A 1LVEA 4M5TA 2WQRA 3IU3B 2LLNA 5F39A 3ZM8A 1TEFA 1FHNA 3INAA 3JV6A 4OFGA 1DSYA 1I8LC 1TJHL 2IG2H 1KLUA 1NDMA 2RS31 3RGVA 5FWEA 3DURA 4G72B 1HDMA 3I85A 4JFPA 3LIZA 1K8DA 1NCGA 4PJGF 1HNYA 4JGYA 1QHPA 2F19H 4X7DC 4N8UA 4HOWA 1IAII 1B4TA 4FMVA 1A7OL 4N0UA 5F96H 5A80A 4CP0A 3F95A 2M8XA 2ZGLA 3IE4A 4QKTA 2SODB 2ZD0A 1RXLA 4QTHB 3SJVA 2CY6A 1DBBH 3U0TA 1CAWB 3AP7A 5C7GA 4YHKL 4GUQA 3U7AA 1ML0A 4DMIA 5DQJB 2DFBA 4XMPH 2GYSA 3ME0A 4PB9H 3LRLA 2JCCA 5I8OL 2C3VB 2VXSL 4XC1H 2VQ1A 1DLFH 1RUE1 1RU9H 2PPCA 2ATAA 2Y1VA 4M1CD 1E6JL 2XVBA 2BM3A 4HHAA 3BQVA 4IOIA 3U4EB 3VGAB 4FADA 4AT6B 4RETB 4AH2B 2EDLA 3TF4A 1UB5A 4GQQA 4LMFA 4H26A 1RULH 3E5UA 5B39A 4M01A 3LHAA 1PX3A 1D2QA 1VRH3 2R9HC 3N3HA 4E4ZA 4PJ7F 1AR72 2ZX0A 4BKTC 1OAKL 4HJJH 5KBDA 4M43H 5D5ME 5IHZA 3O14A 2MQGA 1NCCH 2KA3A 1XTMA 2DL9A 4YDLB 2A6IB 4P2YA 3WKYA 5F7EL 4A38A 1YMMB 1VLNA 1ULFA 4R7NB 5GGRY 2O6DA 2QQQA 5FIEA 1WC7B 1FI2A 5DEJA 4AOCA 4XPAH 4LCYB 1RZFH 4DK5A 2F7QA 5DRNA 2A75A 2YAOA 4DPAX 4CXYA 1JHTA 2Q1MA 1WFMA 2PPFA 4L05A 2B3IA 5GRVK 4KKAD 4GLRI 2HT4C 2QQLH 2VZ3A 4IRJD 3BAEH 2FQEA 2XWCA 3V8CA 4XODA 3ZFFC 3LD8C 1DQ1A 6FABH 2ZX8A 4J3SA 1IM3A 4NO2B 3UTTA 1ZLVK 5IY5B 4ZTEA 1HINL 2DLFH 3CUPA 2P4EA 5LK7B 4RSUA 2KS0A 1CIUA 3O45B 2AABH 1XF3B 3QIUC 1PGL2 1PNDA 3NABL 3LH2L 3G04A 5JAXA 4M61A 4HEMA 2C5DC 1UIJA 2HKHH 3FAWA 1QRNA 3X12A 3SE9L 1AR1D 3BD3A 4IV1A 4QRRD 4AE0A 3NMBA 4X0KA 3OGSA 2J5WA 1GPOL 1PW3A 3ZXGA 1IGCL 4HK0B 2K0GA 5DG1A 3GZKA 4JDZA 2ZGOA 1R4XA 5IP4A 2Q10A 3P3PA 4NQXB 4ISVA 5C7ZA 4Z7QB 4W6YA 4RGNE 4FOVA 1JXKA 5GZOC 4KKLD 3DPBB 3O2WH 1OVZA 1P0SE 1I75A 2XA3A 3OD3A 3SKUD 2ESVA 4MAYB 2FUQA 3LOBA 4XAKD 3UEZA 2I60L 1WHPA 4X7EC 2YD3A 3KS7A 3ARBC 1ZS8A 3CTTA 5IJDC 1A4KA 5ES4B 1TJIH 4RS5C 4BCZA 4JQIH 1NFIB 4N53B 4YFLI 3BW9A 4I3GA 1PVXA 4H0LC 5GRUH 4GRWB 4F5CA 4OLYL 1UVQB 3LXUX 1LP9B 3I3EA 2XICA 3T65B 1UKGA 4BQ5A 2H47C 1MG3C 2RTTA 4NN7C 1IS6A 3D39A 3IKCA 5I17B 3BWZA 4YPGB 1EEZA 1ZA6B 4MA8H 5I19H 4B97A 1T6BX 3BH8B 3VXTB 1K8IB 1FFTB 2CK2A 1C5BH 5M95B 5IJCC 3D34A 3FB5B 3Q5YA 2UY7A 1N59B 2NUTB 3GZEA 4GH4A 3BU0A 4UQCA 1C3HA 3FO9B 1GMIA 3PMEA 1JNLH 5CEXB 1G9CA 5C3RA 5HYSG 1Z7S3 3OQ3B 1INDL 3B8SA 5GSVA 4LO4B 5F2SA 3R1GL 1LEKA 4R4ND 3PGFH 5HVWA 4Z95H 5LW9A 1S9WA 2GNMA 4XDQA 3WSOA 4G6FB 2XTJB 1HQ4B 2FEEL 2QGBA 1GYVA 1RZ7H 5DHYB 2EDMA 2FQDA 5BVPL 1KRIA 3RTQA 2AQQA 3IAPA 5C3OA 4OFDA 1CICB 1P2CA 4KJPC 4ZW5A 5FECA 4YAQA 2Y6TE 1QP1A 3N9MA 2HYMA 4XPTH 3GBMH 5EUOF 1JHLH 4B9ZA 4W4NA 3AYDA 3F62A 5DMYA 4FDWA 3GIVB 4HF5L 5FLHA 5IEHA 3BRFA 2QEJA 2WZAA 2HWD2 3PWPD 3V95A 3EYQC 3VGHA 3CHOA 1BD2B 4MCMA 4KXAA 2AZAA 4M8QA 4XP4L 4Y2NA 3T3PF 3WFCL 4KZEL 3H9AA 4Y1VA 4KRNA 4CADB 4LHUA 5IFHH 4N9GB 2Y07L 3FUOA 4D0QA 3C6LB 3M3IA 3MLVL 2BNQD 5E00A 4B3NA 5I1GL 3W20A 4XRCB 4K7FB 5CLWA 1AIZA 4J6IA 1VACA 2GG1A 1V54B 2WBXA 4GW1A 4PG9A 2D73A 3SOTA 2ILLA 1ZWIB 4W65A 5I24A 1F8TL 5KSBF 1GWKA 4E68A 3RUGF 2H0FA 1HT6A 4LOFA 4PJGA 4ZS3A 3M46A 3WEOA 3L3KA 1FYHB 1FPTH 3APDA 4N2AA 1Q9OA 5AOJA 3QJFB 3OD4A 4S1QL 4QRPA 5B4MD 1AR71 2XJSA 3GMNA 4MDJA 4NPRA 5E88A 4WO4B 1SJEB 2YO3A 3N9QA 4WHDA 1BZ7A 1MRDH 3QORA 4Z78B 4QHKJ 4OKDA 1IIKA 3HKZA 2KD7A 2EDXA 5FUZH 3BOVA 3PNWB 4Q6IA 2MEV3 4OHZA 3PAUA 3QH3B 4HIXH 1K5MC 4A39A 5I74B 2UWEB 3MOBH 1UYWH 3Q9PA 5CBEB 3PV6A 1W6MB 3ESMA 3EYSH 4HFUH 4I0CC 4OZIB 1SLTA 3G6JF 1T1YA 5CSGA 2DWXA 2VXVL 2AAVA 1RVFH 3LYRA 3NN8B 3QDMB 5ABAA 4Z76A 5JOZA 3NV2A 4OCTA 4OM1L 2AQ1A 4KJWC 2VOVA 3AXLB 3O2DH 4Y1SA 5I9QC 3L3OB 3ESOA 2VUKA 2Y72A 4DKFL 1NBYB 1Z0NA 4PJ7A 3I75A 4Y1AA 4YBHA 3VFOA 1F31A 2JB4A 1U12A 2TUNA 1UZWA 4NLAA 2WAOA 5B38A 3BWUC 3VTMA 3DRTA 3PXLA 5IQMA 3M2MA 4ZXBB 5IQLA 4R5VA 2QZQA 1F5JA 2FCUA 4OLVL 2X2HA 4K8RL 3O3DA 1DO5A 3SKJE 4L37B 1MSPA 4MZRA 1JK8A 1RPQA 2QMKA 1WS7A 1CVRA 2WBKA 5A3ID 3RZCA 1WUNT 1TU2A 3S5LB 3RDTD 2QPDB 4QDSA 1RUH3 4DZ8A 3FB8B 1KTRL 5EZLB 5ICXB 2NQYA 1DL7H 5BY5A 1WAAF 1BX2A 1ZLSH 4DW2L 1A1OA 1YG9A 3TT3H 5JNYB 4U6VH 1M3JA 2YAQA 1CI3M 2I69A 3IRZA 3L16A 2C1OB 2CA4A 1A6ZB 1MI5A 2HP4A 3QNZB 4K3JH 4AL8L 1VBB2 4N53C 3OCPA 4PJ8D 3S6PA 4JG0H 3LH8A 4U1HB 4AYMC 1KTKE 1CCZA 2YPLD 4IBYA 1O8PA 2EYRA 2FR4A 2PTTA 3MFGB 2E26A 3RL2B 2UWAA 1MFMA 2HG5A 2FX9L 3OYWB 4K55A 4MD4B 4YW4A 3O0WA 1T5WA 2WKOF 1KCWA 5IG7B 3KD4A 2GC0A 5CZKA 5EBLB 5F93C 2TEPA 3FB6B 3SCMB 2FRGP 2PYEA 1JD7A 1T1WA 3GHMA 4QXUL 3MRLB 2DUPA 4OUEA 4NOTA 2VLKA 5T1KA 3WIIH 8FABB 3HHSA 5D1QC 1BDYA 3DVNA 1Q72L 2XWTA 3E7JA 4ZUVB 5GGVH 1EP0A 1WD8A 1DVFA 1H2KA 4YZ5A 5CEZD 2ERJB 5DJCA 4XI5D 1PDKA 1AO7A 1FNEB 2E76C 1UHVA 2QVFB 1IAIL 3V0AA 2JDPA 1JDCA 4NI6A 3F7RA 5KBLA 1H8LA 2XMLA 3L1EA 4P04A 2XTJC 3MA7A 3MQIA 2P1BA 5DVKA 3ETQA 5HJGA 2P5ED 4NQCA 3DX1A 1CICC 1OL0A 2Q7YA 4G8FA 3QEQA 2VN5A 4X7CC 3JU9A 1TQCB 5ALCH 3HB3D 3EXLA 3QS2A 1CFQB 3STLA 2E7HA 1UOBA 3DXAD 4HLZH 5FXCH 3CBNA 1JWSA 2K78A 4IRSB 2PHXA 5F37A 4FQQA 4JVPA 3MV9A 3SZ6A 2YAMA 2Y3NA 4Q9BA 2IXHA 4ZAKD 2IPTH 3S88L 3SPVB 1J8RA 2R0KH 4NIAA 1Q8PA 1YQ5A 1GXEA 2X4PA 1XAKA 3L4TA 2GC3A 1YEKL 2GTWB 3C6LC 1IKNC 3HE6C 2BGOA 4AUJA 4JEGB 4LOUC 4MADA 3I3QA 1MZ6A 4XJUA 5C09D 3BDYL 1ZRRA 1J48A 1PVC2 2OMVB 3LVEA 1NQDA 1TQTA 4AR2A 4YBLB 2WLYA 3HG1B 1MF2H 3LEIA 4U7SA 5T5NG 4QRRE 1FMD3 3LEXA 1LOCA 1AKJA 3NNFA 1KD7A 1G6VK 3BOWA 1VLXA 3QRFM 1EHAA 2PHLA 4NROA 5JSOA 4TLTA 5GGTL 5H37H 5EUOA 5L9VA 4JM0A 1LK3L 4WO4C 3BKML 2O72A 1IKFH 5KWYC 1E2VA 1F15A 2VOKA 3UPAA 2BPBA 4RAUA 2XQYG 3Q8AA 5CS7A 4DSYA 4WU5A 4ELKA 3T5WA 1NAKH 3T6QC 4I3PA 1YNLL 5KS9E 3PWLA 5F7LB 4XAKE 4M03A 4TZDA 4HCFA 1QBBA 1ZLDA 5I74C 5AZUA 4E9TA 2WYSA 2XN0A 3QUZA 1Z3GL 3FU0A 4YXLL 5FPZA 4PCRA 4IK6A 1LEMA 1WWYA 5HI3D 4AC4A 5DZJA 2XGXA 3E3QC 4TTDD 1RUPH 4JZOA 2EICA 3FN0H 3L3OC 2IANA 1QA9A 5I1CH 5KSBA 3M3EA 1EEUA 3RUGA 3WAKA 1D3CA 1E4WH 1KPUA 3VSTA 4Y0GA 4LO8A 4RESB 4LVEA 1X5KA 4MD0B 4WM7C 5CD3A 5F3GA 4URTB 4M29A 4M93B 1DVYA 4D9LH 4ZXBC 4N24A 3X11A 1LYQA 2W07A 3JBG1 5IUSA 3TONA 5LA0A 1CQ9A 4DO4A 4WNSA 2VZOA 1KUMA 1NG0A 3X3GL 1L9NA 1S5HB 1XWVA 2EINB 4FJ6A 5KSAB 3U37A 5K9KA 1SM3H 1U0AA 1JOBA 5AD0A 2ZXEB 3OEBA 3FHQA 1ND2B 2JH2A 1ZV5A 2WXHA 2FJFB 3S5LG 5KBPA 5EBGA 4JE4B 1UB6A 3G6JA 4JQXC 4BFNA 4Z7AA 3LAGA 2MNWA 2QV2A 1BREA 4G6JL 1XGQB 2UZPA 4JDOA 1I1EA 5E1AB 1I7UB 4AEEA 1TQUA 1O7VA 3S48A 1N18A 3N7KA 3HC0A 1Q8OA 1JXNA 2RFXB 3H53A 4IMLA 3QYCA 4U05A 3HBQA 4U3XA 1Z32X 1PNCA 1HIXA 5B1BB 1JNHA 5JOFA 2PAMA 4I0PB 1FA4A 2AEZA 1FLRH 1WHOA 3EYVB 4U1JB 3HW7A 1VBB1 3GT6A 1UFGA 3PWPE 4HBNA 5HVFB 4I2XB 3N9OA 4OZHB 1VFAB 3SCMC 4M1DL 4ZY9A 4LMQI 3HBKA 4XIKA 1EWHA 4UFKA 5TQ0L 5CZXD 1FFNB 3BOPA 2BNQE 2B9BA 4GRLA 3BLKA 4RNRA 1JGEA 1WAAA 1PD6A 5TDNA 1H9WA 2DVGA 3GBEA 5L36A 2HH0H 5L4IA 3MLWH 4Q0VA 3VKOA 1OT2A 1HXMB 4OQTA 2E53A 4FOYA 1X5XA 4G6KH 1M1SA 1IAKA 4AQEB 2XXZA 3QJOA 3D0SA 4GKXA 4A44A 4CUBA 3FUKA 3PNRB 4YVSA 1JNJA 3DKQA 2IOIA 2CUHA 1F6AB 1CT8A 3E1F1 2E86A 3F8UB 3L1FA 4JO8A 1AS8A 1OCWL 3VWKB 1KFUL 1P84K 3H9SB 4UQ9A 1TQCC 5KSVA 2R56H 1I1YA 4CDUA 4KWUA 2WKOA 4DRVA 2HJKB 1VFBB 4IRSC 4OFQA 2YAEA 3R7RA 1EFQA 2DCZA 4N1EA 3AY4A 3EF4A 4NAQA 3TBVA 2WZR3 4ZYKB 3HS8A 1TG8A 5DI8B 4LO7A 1J8HA 5HHVL 5CA6A 2VXQA 4I13B 3UIYA 1QFWM 4RA0C 4APQD 3PWJA 4JFDA 3D3VD 1Y1DA 4P4RA 2AR6A 3MLLA 4X99A 1XFPA 1NYWA 4B95C 2G4IA 1QUNB 5FYJU 5B3SB 5IATA 1HDKA 1JUFB 3BQUC 4ZDHB 2EXHA 3QDGD 1I1CA 5DLLA 5L8KB 1U8OA 1EJ6A 2B59B 2VCCA 5K0UA 1C8M2 3WNXA 4YBLC 4ORGB 1A8MA 3PIGA 3QUKA 5SV8A 3OGGA 1VPOL 1YNKL 2WLLA 3SGKC 4PBDA 4TYUA 1OK0A 4NUGL 4G7SB 4EDWL 3OWRA 4YO0B 3BVNB 1REFA 1LEDA 3C6EA 4HN0A 2DBLL 3GSWA 3GMPA 5SV4A 5CISA 5EU3A 1N0XL 3ARED 4FOMA 2FDKA 3PF2A 4Y4HD 4LXLA 1E8WA 1FVDA 2FECI 1OM9A 2OR8A 3ARDB 1RC6A 2CJ3A 1E5HA 4H7VA 4KITB 1AJOA 4HUWA 1TSRA 3NP4A 3NVQA 3SDXF 3PL0A 2BIMA 5IB5B 1G9NL 5GSRB 1Y07A 3U7WL 1TJHH 1AL0G 5D7JD 1L0QA 4GXVL 1YCIA 4G9DA 1NFDB 1MHHB 3FK3A 4J6RL 4HUXA 5AVTB 4B5EA 5D2LE 4X4XA 1USZA 4ODBD 3VWJA 1OI6A 3CN3A 5I8KL 1XNTA 2YPLE 1P9MA 4C1XA 1R24B 3R18A 1U4EA 3KCPA 1A7OH 4LLYA 3PJSB 5F89B 5F7YC 2HAZA 2ZXAA 3PGCB 1LD9A 1ZVYA 1QOTA 4NHXA 3RFZA 3F5WB 4YHKH 5DZLA 2J1ZA 4U1MA 3ILEA 1BQHG 5MI0C 4M93C 1QIQA 3OMZA 5BUVA 2X4RB 4BH8B 1W6QB 2EIJB 2D3LA 4ANXA 1WBZA 5GGSA 5I8OH 4C59B 4RQPA 1SOXA 2FGWL 2NW2A 2VXSH 4FFZA 3TYJA 2VXQL 4ET7A 2IWEA 3AMQA 3V4PH 2PAEA 5CEZE 1E6JH 1MHCB 3O12A 2XIIA 1ND2C 4LB8A 3HMXA 4DETA 2OS7A 2D5HA 1BF2A 3QNYA 4PIXA 1NL0H 1W8OA 4AI9A 3MRRA 1D9KA 4PS8A 1BVNT 2XTSA 1DQ6A 5J48A 1A0QL 1KBVA 4EF3A 2R29A 3Q06A 1OAKH 1Y9MA 2JIGA 2P5EE 3L2NA 4DIXA 3T04D 3FDWA 1I1AA 5F7EH 2VNVA 2WABA 4ZZFA 1PGW2 4PWEA 3ISYA 5GJTL 4EV0A 1W72L 4B96A 1TFHA 5L2JB 3PVOA 3DXAE 4FLSA 4AFMA 2W1WA 3FTUA 3KGRA 4I0PC 3DBXA 1OLQA 3HKFA 4PG2A 2JB8A 1TZ8A 2H3NA 2MNUA 2AITA 3BO8A 5D6CA 5GS3A 3MMEB 2JKWA 2ZAIA 3BAYA 3EO1A 4CN1A 5B2GB 4JFED 1QHQA 4PJFF 1D7DA 1OV8A 4P5HA 2R15A 4BFEA 2XR4A 2PR9A 4Y88A 1LP9E 4HAKA 4B60A 2DBNA 1HINH 4YFWA 3GSNA 1FZMB 4N0CD 5C09E 2DCTA 1ZT1B 4F7PB 5A40E 4P5RA 4Y5SA 3NABH 4U6TA 3KVDD 4BFOA 1OE3A 4AQ8A 3LH2H 1KJMA 1KPVB 1ND3B 5CZRA 3QDJA 5AKVA 4MH0E 1HHJB 4MJIA 1Y0LA 2YS4A 4M62L 4GJYA 3O1RA 3TXAA 3ZIXA 3SE9H 2ZCZA 5ACA1 4FKEA 1FG2B 4OCRL 2CWRA 1PEZA 3O0LA 3KYAA 3VWKC 3ZHLA 1H2LA 1QWRA 3E8UL 1GPOH 3OMNB 1ZEAL 3GINA 1IGCH 5BW7C 1LU2A 3C9NB 4PI0A 1X44A 5M7QA 1VCAA 3MIGA 5H8DA 1MZYA 5DQ9A 5BNNB 1S0JA 4MS8D 4LHSA 5A1LA 2AQPA 1JI6A 1XIWB 2YEQA 3C60B 3MR9A 3CZNA 3RX7A 5C8CB 3FU9A 4FFWC 3LKSB 3HMXL 2GSIB 1XQ4A 4S2FA 2I60H 2OK0L 3X3FL 2YGVA 3DPRA 5E6ZA 2JNZA 1U2HA 2YD1A 3FTVA 3IDGB 5KN5B 3CVCA 4YGDA 3ZT6A 4LQRA 3HEIB 4KG0A 5I6XB 3QYNA 3CE1A 5ICZB 3BX7C 3WYRA 2VC9A 3QXVA 2HMIC 4OLYH 4CBPA 5F71A 1QQDA 4Q4W3 3GD1C 2ZKLA 4WM8C 1JPSL 4EQVA 1XL4A 1Z9PA 4OI2A 2CHZA 1CDJA 4NHLA 1JU3A 1GR3A 2AW2A 4MTMA 2VZRA 4HSLA 4FXGA 1FQ9C 1HRV3 4KDTA 2P8MB 5CEYB 5DRZB 4YL4A 3DO4A 3O3AA 5AVZB 1QI5A 5DAQA 1KV7A 2A6KA 5IVJA 4IEYA 4EEEA 3MLUL 3PHSA 1B4JL 3SYOA 4ALAL 5FEBA 4I7ZC 3TO4B 3ETSA 5A16B 1R5IB 3IDCB 3ARDC 1BMV2 4JFFB 5DURB 1ZLEA 2Z0BA 1FDLH 5LAXA 1INDH 5CINL 1DGRN 1RUI3 2QQPA 4MCNA 4I88A 4R9DA 1KBGL 1ROCA 5ETUB 5E8DL 5ISZA 2AJYL 4S2SB 5FOBA 1KLFB 5FZLA 3RRQA 1YFUA 5BVPH 3H56A 1NANH 3V5KA 4CCCA 3ECBA 3OTFA 2LFGA 3OGRA 2BP8B 4NS0A 4YN3A 3AQXA 3EH4B 3QIWB 4FTVD 4UQDA 2X89A 1QSFA 4XN1A 1V05A 4L1TA 3F7VB 1S7VA 1YPZF 4PP2A 2VYRE 4RVBA 2B1HH 4K3GA 4JPSA 2QHLA 1ULVA 1KB5A 1T3FB 3WNKA 2CCWA 1H3WM 4HF5H 4PWGA 1EFXD 1NUKA 2P7TA 4UYPA 3BC9A 5DD0L 3VQMA 2XBTA 2B15A 2PXYB 4HD9A 1J9TA 1PLGL 4XP4H 4KZEH 3WFCH 2X6AA 4CUAA 1W8FA 1KB9K 2Y07H 4HWZA 3KHBA 1PD1A 2VLJD 1E9PB 2C4FU 3D18A 5I0VA 3MLVH 4LEJA 5I1GH 4N0FB 1IFGA 5F3BB 1EEYA 3WGUB 3C6SA 3FT2A 3MA9L 1HV0A 3D0JA 1NCQC 3R0MA 3QEHB 2EXSA 2DLHA 1MJ8L 3OKDA 4LIUA 4NPLA 2F4LA 2F74B 1HQWA 3A22A 1I8MB 4RMSA 5TDPB 2XN9A 1TE1B 3SDDA 3ULVL 2I2SA 5JXEC 4GO8A 2YPVL 2YUWA 4PWJA 4S1QH 3LVTA 4C57C 3VXNB 2QDRA 2J55A 3U4AA 1K5JA 1AFVL 4MXVF 2XX0A 3QXWA 1A6AB 1GCYA 2FO4B 3ZIMA 3VLBB 2GNDA 3WLWD 5LBFA 1CIDA 4BQ3A 1NMBL 4JQRA 1UA3A 2X4TB 1PGW1 1K2DB 4AGMA 2VSKB 3IN0A 2WLPA 1XH3B 4KJQC 5FJHA 1NBZB 3AAZB 1F5WA 3D3VE 3V5DA 5DUXA 4DIQA 1N9PA 1T80A 5LJYH 3IDUA 1EV12 3GTTA 4JZRA 4LFHG 2VXVH 2AJUL 5C0AD 5IVBA 5JXAL 1M6UA 1MZFA 1NEUA 4NIHA 3LS5H 4OM1H 1NPNA 2ZICA 2AQ2A 3LNIA 3ARTA 4M5SA 4IOSA 2HA1A 3QDGE 2X0WA 3FW6A 3SISA 4EYUA 3NJYA 1I4FA 1FVCA 3BSZA 5I0ZA 1EBAA 3VH8A 4FI9A 5K59E 3A6CL 5DZNA 5DFWH 3VBFA 5GRYA 1UC6A 2I32A 3HOGA 1CXEA 1KB5L 2RV9A 5K1JA 3ZKQD 3QDAA 2NT0A 5CLXA 3GRBA 4OLVH 5ANHA 3NKGA 4K8RH 3JQXA 2Q9OA 1UMHA 4MO3M 5IB2A 3DV4A 4LSVL 2W38A 4YGEA 3DX0A 2OV0A 4AIZB 5DMGD 3USUB 4XFCA 4NOBA 1G7JB 3VA2C 3AXEA 4DGVL 2NY3D 5J3HC 3EHBD 1ZPUA 2HTLD 4DKEL 4OGQC 4R83A 1XIWC 2E7LC 3C60C 4KQ0A 5C8CC 4Z3EA 2JDMA 1NINA 2BW8A 3MLSL 4DW2H 1QHOA 3CHQA 4NSKB 4PJFA 1YYLL 2YAFA 4H8WL 3MBEA 5FO8B 4NMIA 4C83B 1U8QA 2C7FA 2G30A 3AG2B 3BN9D 3LTVA 2OXBA 5D1ZD 2RA1A 3EFFA 4FNUA 5E8PA 4AL8H 4G42A 2F0CA 5I6XC 2FHBA 5HHQA 4MHHI 1EAH2 4S10A 1I9IL 4YZ4A 4R97B 4OV6F 1QYGL 4F9PC 1ZSDB 5B1JA 4ZPTA 2FX9H 4A68A 3T6XA 3LXBA 5IB4A 2FECL 4Q9CA 4MLOA 1LEIB 1U8JB 2YIHA 1YMHA 2QQUA 3B8YA 4AMXA 2K46A 4K3UA 2CJTA 1CLCA 2A0LD 2CLRB 2WXOA 2QZ5A 1DVZA 3AC0A 3JT0A 5I1KL 1I1RA 4QXUH 1F13A 1SOQA 2DWEA 2WJ7A 5FB8A 1JYNA 1BAWA 1CMOA 1DDTA 3HI5L 3QJRB 3PNAA 4AI8A 4WNJA 4R84A 1Q72H 3TO4C 2PXJA 2XH6A 3NVCA 1T89A 2AJZA 5SX4H 4R7DB 2RHPA 5KC6A 4XGZB 1IAIH 3RDJA 2C1PA 4IE0A 4Y4RA 3QG7L 3BSZL 3U46A 1PX4A 3RI8A 4TUJA 3TVMD 5CCKL 1MCOH 1LTEA 1AQKL 1MIEL 1T7WA 2DMBA 3O4LB 4PP1D 3MRMB 3IWZA 2F53D 2F8VA 5FFGA 2HG0A 2NN8A 3KYMB 2FZ3B 3QIWC 4JDVA 4NIYE 5FAAA 3RVUD 3U6XS 3OJMB 4BCUA 1UWXK 1PKQB 4G8GD 4LNRB 1S9YB 2GI7A 4G59C 4P9HL 5F6HJ 5MERB 5J36A 1E27A 1VBC3 1KDKA 4ZFGL 4HG6B 3NIGF 3OKNA 4HIIB 4KX9A 3CC5A 2H26B 2WTRA 3QBTB 5L7XL 2OT7A 2J1KA 1CFSA 1OAJA 2FWUA 2OMXA 2WCPA 4JFEE 3RKPA 4F57H 3S88H 1QJEA 4B7IA 4AFCA 3MIFA 1SMVA 4G43B 2OZNA 1A6UL 1AJ7L 2X10A 1YEKH 4LKDA 3K8LA 2X9XA 5EJ1B 2PW1B 4D6QA 4NAOA 1KENL 5F7DA 1HJGA 2ZJSL 2HFFB 3BGFB 2YBGA 1AQDB 3EO9L 5I0DA 4L29A 3BDYH 1WUZA 2H6PA 3GLDA 5C08D 1LWRA 4OJYA 5TH2A 2QLYA 3V0BB 3O1SA 2OSXA 3ZQWA 1WA6X 5DHXB 1J3QA 2WNUB 3LRHA 3A7QA 1HQRA 4KKNA 4YDZA 4PLNA 4Q8BA 4AFAA 3GZUC 4RIRB 2AXFA 2NZ1A 2XLAA 5I5MA 3VBHB 1BQKA 1NWOA 3GHPA 4HCIA 2ZCWA 1W9TA 3TZVC 1EXUB 5FGCE 4GIQA 1JYTA 1W0NA 2WQVA 2LW8A 3CFDA 2FEJA 2CGNA 3MEPA 1Z5YD 5GGTH 1YPZA 5H37G 4EIZC 1ZRIA 4PGDB 3D5OA 1LK3H 1Q4NX 1ZIBA 2P43B 3BKMH 3KPRA 1QI3A 3RPKA 3RWDB 5HHXL 2R0HA 2NY5L 2K8MA 1WBXB 3HN8A 1KFAL 3ZFGB 1CE1L 2F8OA 2YAHA 1SG3A 4JHUA 1YNLH 5DTFA 5ABDE 4ILDA 3ZTNL 4JHVA 5FLVA 4WNQA 3B43A 2IVFC 3P9LB 3GQFA 2PWFA 4HKZA 4YXLH 4BQ1A 1DQKA 4PY8J 5LGYA 5AVXB 3K1DA 4JGZC 2W87A 4ODWA 1TTRA 4WVMA 1UXWA 2Z92A 3MRIB 1EHLL 1DJYA 1NKRA 4BWUA 5HI5C 3LZNA 2QFRA 1N64L 1FE8L 5INCB 5LG6A 3VACA 3TEZA 3V4LA 3M1BB 1EV11 3ZTCC 3OMIB 2AJ3A 1L7RA 1J5OL 4W68A 4V1DA 1GZCA 1P7HL 2NXYB 3G5XB 3OQRA 2IXKA 4ZX3A 3NIFF 2Q3XA 4G8EB 3FHAA 2WLJA 1F42A 1RUAL 2F1BA 4HIPA 5AVVB 3X3GH 3V4PB 1QJU2 4MXVA 4Y5VB 4H3WA 1IQWL 4M4PA 3Q6FA 2G4GA 4ODTL 3GKWL 2VB5A 3IYLW 2DYPD 1UEYA 1WFIA 3DKWA 1CN1A 1BAGA 4TPRL 3R8QA 4WM7B 1CK0L 3ZXFA 3UC2A 3QJUB 4HHGA 4DHLA 4CL7A 4Y5XA 3WG7B 1RUC3 3BP6B 4G6JH 2Q2LA 5T1LD 2XY1A 1DEEB 5IWLC 3UBHA 1A02N 3C5JB 1G87A 4G9FA 1FJ1B 2BOJA 2Z35A 2YA1A 3EFDL 4OMCA 1OKEA 4FTVE 5ANNA 5ITFA 2Z31A 3RWHB 3ENRA 4WV8A 4TUOB 4CMMA 3K46A 3IPVB 2ICES 2FIKB 1H3UA 4KO9A 1CWVA 1U8KB 3DJ9A 4R97C 1U91B 2ICEC 4JRYA 5DRWB 5EC1B 5FUCE 3REWA 4OZOA 5G04L 5FY5A 2C9PA 1EAH1 2BSCA 2VITA 3OF6A 1V3JA 3GXTA 3FUMA 3HBGA 5D55A 4QOKD 1A7QL 5K9QG 1J1XL 3DO7A 2ZX3A 2DTML 3JV6B 1VPHA 1ENXA 4KXDA 2R4RH 4EKJA 4NIIA 1KLUB 1NDMB 3DTXB 1FH5L 3RGVB 5A3LA 3CSTA 3DURB 2VLJE 5TQ0H 4JFPB 1K8DB 2AK4A 4OZFH 2CDGB 1I9JL 1VEPA 3ZFEC 1JCVA 1OSZA 4N0UB 4ZTPL 4CN6A 1R3IH 2O5ZL 1KTBA 2FLBT 3FUFA 4X7TA 5DJ2A 4IDZA 3SJVB 1P53A 4DPBX 3T1MA 3SPHA 3U0TB 4CC4C 1OWRM 4PJEE 5AL0A 2KZ1B 4BFBD 3B9VA 2CL2A 3P77B 4Y1XA 4BCXA 4DO5A 3ME0B 2YQ3A 2QT6A 2JCCB 2V8LA 1OCWH 3W57A 4ZU4A 2MEV2 2RR12 2VQ1B 4FULA 3UT0A 1AQ8A 2IOOA 3TBTA 4WHCA 1ZPLA 4IOIB 1BW8A 1QFPA 1BQSA 4WO0A 3Q8CA 3C09B 1UB5B 4KRLB 5A2KH 1J1LA 3H3LA 4H26B 4LESA 4Z2WA 5B39B 1RHI2 4JGJA 1NFDE 1P7QA 2VW6A 2I27N 5JR2A 5HHVH 3VA6A 5C0AE 4R7LA 4PV8A 2MNGA 4OTXL 1E4KC 1WA1X 2WD0A 2FSDA 4AOFA 5B8CA 1CUOA 5DHMC 3ILNA 2BY0A 5L9BA 1GMEA 2BRRL 3GSUA 5B1AB 5CG9A 3BGFC 1HL4A 3DECA 1UTDA 5KOVC 4M3CE 4Q4Y2 4JHTA 2A6JA 3GZPA 1TZOA 1M7IA 3S8GB 1JOIA 5DRNB 3ACHA 5FYYA 4IEZA 1JHTB 4L23A 2JJUA 1U3ZA 1JTPA 4Y9CA 2Z4QA 4XOAA 3VBHC 1YNKH 4XHBA 1H5BC 3U48A 2WA4A 1ZRFA 1A9BA 2EDQA 4NUGH 4EDWH 4GG6E 1KWGA 3FQNA 2DBLH 4Y19B 1IM3B 2WQSA 3MRCA 3UTTB 2R6QA 4N5ED 3CUPB 1N0XH 4AJ0A 5GZND 3ZFGC 1CJDA 1NCRA 5ECGA 4S1DC 4HKLA 3WDUA 2ZHNA 5KVGE 1IBGL 2G3NA 3RQ3A 4M61B 1G9NH 1GZ9A 3U7WH 5FF6A 1X36A 4UOQA 4GXVH 1QRNB 4Q0XL 4JRLA 3X12B 5GGQL 2Q7NA 4QX3A 1G6RA 2VAUA 2WVVA 4IV1B 3LB9A 2ZNWA 3O3BA 2R2EA 1F4WL 4HAGA 4YLBA 5AW4B 3SZKC 4AJWA 1S4IA 3O0XA 3Q43A 4URAA 4JDZB 1TQSA 2SLIA 2GY7B 3ZSTA 2ITEA 5F3HB 5J57B 4ISVB 1US3A 4W6YB 4EUPA 6TAAA 3ARFD 1AZDA 1KIRA 4NQSA 2ESVB 4RAVA 5F7BA 4NUJA 2NXYC 3RWFA 4YG0A 1YWKA 1KN2H 1UZ6E 3N41B 2AENA 4CA9A 1ZS8B 2IXQA 2X2YA 3RY6A 2YPJA 4FG6D 5FPAA 1A4KB 1T0MA 2F9BT 4Y5VC 2FGWH 5KHHA 2VXQH 3QNXA 5CEHA 4HFWB 1BMZA 3BW9B 1O9VA 5CKGA 5IMLA 5KVFE 2IF7A 3O1VA 2G9FA 2J1EA 2DM3A 5DHVH 1H19A 2YXVA 1QJU1 1F3JB 3MNDA 5T50A 1WFNA 2ZYRA 2WWSA 4AGGA 3GBLA 5F8QC 1OM3H 1A0QH 3D39B 3IKCB 1OZTG 3HZ3A 3V4VL 4J3OD 1EEZB 1JF1A 1AGBA 1BMV1 1U8LA 1YECH 3C2SA 1SBEA 2AQNA 1LECA 4N9HA 4WW2F 4ELMF 2K9FB 4GW5A 2ZF9A 2UY7B 4AVVA 5GJTH 1W72H 2HVJA 4GH4B 3U1XA 1NBVL 4XO5A 2ATKA 1URIA 4UTBA 4LEEA 2EECA 4LLUA 4BELD 3IMVA 2WVTA 4OLUL 3CFMA 4PRHD 2A38A 5GSVB 4AUYA 2VVEA 1AR93 4XZUA 4H14A 1LEKB 3QE5A 1A9VA 1S9WB 4OW6A 2WAAA 1IS5A 1YIFA 3RTQB 3RWJA 5FV1L 2WVSA 4AGNA 1P2CB 5FECB 4YAQB 2HT3C 3BWSA 3GUFA 4JY6A 4OIIL 5C08E 4HFSA 4MZ3A 3UP1A 1MOEA 2RALA 5K9YA 1ADWA 1RHFA 1DYOA 2X4NA 2CIIB 2WXGA 1GJIA 1KXVA 1C1FA 3V0EA 1SYSA 4FGMA 3JD73 3MPPG 4I48B 4FQ1L 1UIKA 3WKMH 1HJBC 2GMMA 5IEHB 4K8RB 5DAVA 1U33A 5FV3A 2QR0A 4W9ZA 4PWKA 2WQZC 4W50A 4M62H 4YZ2A 2QHRL 3EJQA 5HYJA 1PZAA 3HN5A 3NA9L 1F1GA 4OCRH 4HUUA 2V9UA 4M8QB 2BVQB 1JZDC 3I2OA 5SWQA 5FGRA 3B83A 5JQHC 1ZEAH 4AGOA 4LHUB 5B7MA 1S3KH 4Q8LA 4NM8L 1XSRA 3IDJA 4MHRA 1T6GC 2W88A 1FUNA 5E00B 3S5ZA 1TZHA 2X4OA 3C09C 1CDYA 2V37A 1VACB 5KYXA 4PG9B 4GW1B 2JJ6A 1VIWA 2YBRB 2MEV1 2RR11 1I3UA 4XAWL 1BQUA 2VZTA 3HMXH 1EA9C 5CR8A 1RXFA 4CVZA 2QQMA 4UBHA 2VMEA 5HJDA 5B39G 1IJNA 4PJGB 3X3FH 2OK0H 4X8NA 4XF0A 3MPCA 3L3KB 4L5FE 1BLIA 1Q9OB 2VMDA 4PBVC 2FMYA 3E6DA 1GW6A 1I9RA 1MUJA 2WY3B 4QRPB 4BE6A 5H4YA 5FTTC 1L3WA 1HXS2 3EDDA 3AQDA 3GMNB 4MDJB 3CFIC 4PGZA 3KGUA 4QRQA 4W93A 3V0WL 3BVCA 1BZ7B 3N4MA 5IEKA 3OM3B 4XXCA 1KCUL 1JPSH 3KJ6L 4Q6IB 2DF7A 2DURA 5T55A 2BS8A 4AQ2A 2ZX7A 5LBGA 4Q4Y1 2BY2A 3PV6B 5ANMA 5DZGA 1FHGA 3RGVD 4FTSA 2NPLX 3T4YA 3NRFA 3CLEL 1UD8A 3UZQA 2H2SD 3RZZA 1T1YB 1VCBC 3J8F3 4ZUWA 4BJLA 1US2A 2D6NA 2ZXGA 5K1NA 4A2FA 4ES8A 3LXAA 1ORSA 3MLUH 3OZKA 4A37A 1B4JH 5H2BA 3GJFH 1D7CA 2Z7ZA 4L3CA 1MAML 4ALAH 1V9U3 3WTWA 3K3NA 4U3HA 3SMHA 5KUMA 4UFHA 2CCLA 5CINH 3I75B 4Y1AB 1CIYA 4CSZA 2VDQL 3VFOB 4YJZL 1HTYA 4JO2L 4DP1X 1BWWA 5J11B 4UYBA 2YJQA 3DRTB 2KUTA 3B9IA 5E8DH 2AJYH 3P2DA 3Q2CA 1T1ZA 3HLAA 2ZOKA 5FKPA 3DX3A 1MCHA 5BRZD 4J1WA 1O91A 2JDAA 4XMWA 2RS53 5EIYB 2P80A 3PWNA 3GHBL 1JK8B 4XB8A 1ODMA 3UJQA 3ULSA 3BTXA 1T0NA 4P5SA 1A7RL 1TU2B 1YAIA 4KKBD 1JZHA 1U4FA 1UADC 4QOKE 4MZUA 4P4KD 3HZVA 1U36A 2MQ0A 1BX2B 5EXOA 3VHNA 4COYA 2LR4A 5DMKA 5FS5A 1CD3G 3LZLA 5LCVL 2ZS6B 1WUVA 5IV2B 2LABA 2FLMA 1PLGH 2H4EA 4LP4A 4GW4A 3IB3A 3KEDA 5I23A 4CN4A 3E5QA 1SEBA 3ZIYA 1I9RL 1J87A 2EYRB 2FR4B 4XF3A 2PTTB 1HKFA 2YEVB 4WFFD 3L1GA 3CBKB 3MA9H 2ZZJA 4FPFA 2CUMA 2HG5B 3ZSKA 2C7UB 1T5WB 1MJ8H 5BO0D 1IHMA 2WBWB 3EJSA 3DROA 1F58L 2PYEB 3ULVH 3LIUA 2D44A 2YPVH 1WWAX 1T1WB 3KPSA 1AMYA 1AFVH 2F1AA 5T1KB 3HHSB 1LODA 4NJAL 3DVNB 2XWTB 1DVFB 4KXZH 1GGTA 5DJCB 5C07D 3RG0A 1PDKB 1AO7B 2DQIL 4LIQE 2AGJH 3V0AB 3OXSA 3W37A 1UOKA 5T5FA 4H8PA 2B5HA 3I9IA 2XVGA 2WRAA 2GFBB 1E8XA 1J12A 5DVOA 1PCXA 3MA7B 5IKCA 3G6DL 3I50L 3SYAA 3RTQC 3GXDA 4PBPA 2AJUH 5JXAH 4NQCB 4MA7L 3EXJA 4NO3A 4R2GB 3WO4C 2Q7YB 3MGUA 3QEQB 1XE0A 5AAWC 2VLRA 4TNWF 4CJ1A 3STLB 3AITA 3P4MA 3LKPA 1JWSB 3CX2A 3DCQA 3MV9B 4K8RC 3T4AA 1ZHBA 4WW2A 4ELMA 1KB5H 1G7PA 2JTYA 1JF5A 2HBUA 1S7TB 3QUMA 4N4YB 4XE9A 2X4PB 2Q87A 4LSVH 3GSXA 3HR9A 3TIDA 4CVXA 1XE7A 1U8MB 4JY5L 5AZ2L 1LHOA 2CTVA 4X6CE 2EADA 4OD3L 1OA4A 4DGVH 4LHUG 5ECJE 3MLSH 4QTIL 4Z7OF 5I8CB 1RTVA 1YYLH 4RGMB 5CADA 4H8WH 4RGOL 4AL8C 1T4WA 3LEXB 4K94L 4EZ4A 1UWEH 1AKJB 1PKQE 3D30A 3NCMA 4J3XA 4DK3A 3NIDE 3QSKB 1ZGLM 2J7MA 3FBMA 2XFGB 4YZ3A 4ORZC 2D3SA 1MJJA 2WZ0A 1FAIL 3FT1A 1B09A 3GDCA 3V6ZA 4DT2A 3C7GA 1I9IH 3E6HA 4RAUB 2ED9A 4W9FC 5EIVA 4YOKA 1SF5A 1LKNA 2ET7A 4NRPA 3WW1A 4WU5B 1OPMA 4ELKB 3C5ZC 4Q6IC 1EX0A 4FN0A 3PL6D 2XN1A 3PWLB 6CGTA 1HXS1 1H1IA 3D07A 1X4XA 3PABA 3T3PB 2L9LA 3L2LA 1JWUA 3QUZB 1MIMH 3ZL1A 5FXWA 4OZFB 2BH0A 3EJJX 4XPBL 5T5FL 4HW6A 4XHQA 3TT1L 2PUQT 3WEAA 3KCXA 4GWMA 1EEQA 1JS4A 3A24A 2P5BA 5DZ9A 5GS0D 5I1KH 2W9XA 1O4TA 2Y6LA 3HS0A 3HI5H 4JZOB 1TME3 3E0GA 1F8VA 4IM8A 1SXSA 5E0FA 3S37X 4EN3B 5IOKA 9PCYA 1JXFA 2PYFA 1QA9B 3TGXA 5KSBB 5KYNA 3RUGB 1B9ZA 1KPUB 1J5DA 1D5XA 3QIBC 5J11C 3HNTL 1A64A 1MJUL 2WNWA 3BSZH 5CD3B 1R1CA 4AKOA 5DQ0A 4CRPA 1FNGA 3M7FB 3HZYA 3X11B 4ZQTA 2W07B 5CCKH 5B38G 1MIEH 4NAMA 1IKPA 3KJ4B 2RJKA 5EB9A 2W92A 1ZZ6A 3QUML 3FF7A 1T4KA 5K9KB 4PRHE 3PDDA 5IVOA 4P9HH 5AD0B 5JIPA 3FH8A 1MXDA 1S1AA 3MDPA 3F7QA 4LLFA 4F7CA 4ZFGH 2GBUA 5L7XH 1W8NA 1UB6B 2DD8L 3G6JB 3KBFA 5H35B 3AS1A 5FYKU 3VBUA 3QFJA 3NCJH 1FNZA 3R05A 2YAPA 2KDYA 3D0LA 2Y5QA 3RSJA 2DI8A 1DVUA 1A6UH 1AJ7H 1Y6MR 3HC0B 1BHGA 3HA0A 2EO9A 4UQ3A 3VQLA 1KENH 1MLCA 2HB0A 3LMJL 3QORD 3EO9H 4A2MA 5TPWL 2MEJB 1L3NA 5KYYA 1JNHB 3QZBA 2HN7A 3BUDA 3APNA 4I18A 5A70A 1S7WA 3NCYS 5C9JB 1OQXA 2C4FT 4UZGA 5FYLL 4X50A 1RK1A 2V9RA 4UT7H 1SY6A 1EK3A 2JJSA 1AXSA 3L54A 4JPIA 5IK3A 2WOBA 1NMAL 5DU7A 5FCUH 4PQQA 1Y43B 1AYOA 3BUIA 3V52L 3JV5A 2FSEA 1XCQA 2D3VA 2K1MA 5HHXH 2NY5H 2DM2A 4AEMA 4RNRB 1KFAH 1CE1H 1DVFC 5D1XA 4X5XA 3VG0L 2JIXD 3LKJA 3LF7A 1IKQA 4SBVA 1H3XA 3LQAL 2H3XC 3LPPA 4NQED 5AVYB 3ROLB 3ZTNH 3V0AC 2FQPA 4PIYA 3RGBA 4OUUB 5AUMB 3PV7A 1R3JA 5CGYD 1RV6X 4AV0A 4PSRA 1KEXA 4OI7A 1NKOA 1G1KA 2HWF3 4P9XA 4WWKD 1RSFA 3MCG1 4Y5Z0 1HKLL 2QGCA 4YVSB 2HLFD 5L7OA 1CT8B 1BZOA 2CAKA 4R2GC 2R39A 5TF1L 4CU7A 3BP7A 3S2AA 4OI8A 1W28A 5DO2C 3JVFC 3I6KA 3VRLE 1N64H 3RZCD 1UOFA 1IFHL 1FE8H 1HJCA 2RMU2 5KZCD 3AVRA 2Q3AA 5KSVB 4PJ5D 4BKLB 3UKNA 1I1YB 1OC1A 1YY9C 4CDUB 3QS3A 3HFML 3LRSA 3IK2A 1YJDL 1TMF3 1J5OH 2ISDA 4XO3A 1J9CT 1OPOA 1HEJC 4OM0L 5EJ3A 3TBVB 1L6PA 3CSFA 4LCVA 1L3JA 3DSFL 1XGTA 3RS6A 1U8CA 1RUAH 1X5ZA 1MI5D 3PWJB 4JFDB 3GM0A 1YEGL 4P4RB 1RUI2 2J8HA 2KT6A 3HVDA 4PN6A 4YW2A 1KTLA 4ODTH 3GKWH 4XBGB 3ZTJG 3AJ7A 3LIGA 4YMPA 1Q56A 4XF1A 1AZZC 1OAXL 4HCRA 4L18A 4KBBA 1QSEA 4ZMNA 1CJPA 5BZXA 4TPRH 1DJZA 5F7NC 4NQDA 4LK4A 4CU9A 5IFJA 3IS1X 5K0UB 3Q1EA 4RGMC 5BRZE 4X4ME 3QUKB 3GGWA 1TO4A 1JTZX 1DN2A 2WLLB 3VI4E 5A3UA 1XF1A 1CLYL 1TYEB 5KVDE 1NFKA 5FWJA 1W72B 3EFDH 3GNML 1SY6L 4KQ4L 4OH2A 5E16A 1LNUA 2R16A 2VLKD 3GMPB 3D2UA 3KCWA 1N7ML 1GMMA 4A6OA 1SLBA 1AR2A 1ED3A 1X3DA 3UG3A 2ARCA 1ZDSA 4Z7UF 1FVDB 1QI4A 4TQ8A 5KBNC 1AQHA 1J9RA 2YD8A 2D7TL 4HUWB 2HEYF 1PM4A 1A7QH 1J1XH 2DWYA 3L3GA 4WHTA 2DTMH 3U9WA 4EO5A 4I3RL 2KR2A 4RGKA 3LA3A 4K5PA 3ULAB 4G9DB 2OVUA 1FH5H 2A5ZA 1GZQA 1CQYA 3FUJA 3VWJB 1GZWA 2CO7A 2PPDA 4FTDA 4GD4A 5D96B 4HIHB 1AD0A 1I9JH 2W8CA 3ACIA 2ZZUT 3FZUC 4WFFE 3WFEL 2EE3A 4EN3C 3R8BB 3KCPB 4ZTPH 4LLYB 2P42B 1DQML 2O5ZH 1G5AA 4YWAA 1LD9B 1AXTL 5HYEA 5LWBA 3RFZB 3VKLA 4GSRA 1FAYA 4U1MB 2DU0A 1GQHA 1O3QA 2XY2A 2FWSA 2YU1A 3CNAA 4OHWA 3KJ4C 5KXBA 1BFVL 1WBZB 5DVLA 5GGSB 3S4SA 3WLBA 4RQPB 3DARA 2NW2B 4ZMXA 1OOPA 3NACL 2VQUA 5IT6A 5C07E 1MFVA 2BEOA 3WQ7A 2VW2A 1QH7A 1JG9A 3RB7A 2Z42A 4U1GB 3CH1A 3QNYB 4LF3A 1SDAB 1UM6L 2WZPA 2X09A 2WAQA 2WB1A 3K2MC 3MRRB 1PD0A 3DI2B 3LN4A 3WCSA 1LWJA 5AYUL 2ICWJ 3CIQA 2B9AA 3EUDA 1SN2A 2V6HA 4OTXH 5E2UL 3U10A 2HVBA 1DGWX 4WV1A 1I1AB 1XCWA 1L9RA 2E9IA 5F9OL 3PUUA 3AACA 5C0DA 4UXAA 4ODHL 2P5PA 2VDOL 4JZNA 2HFGL 1G7HA 1G9BA 4BKSC 4FFYL 3RVXC 4ABVA 2H3NB 3O41A 2ZAAA 4X0NA 3BO8B 2R2BA 4MLIA 4PREB 5D6CB 3DV8A 4K21A 3EO1B 3QPQC 1K5NA 1HN0A 3PP4L 4F5CE 3QOPA 1X9UA 1NFAA 2PELA 1U3NA 4IU3A 3UBGA 3GSNB 3JUYA 2IAND 2D3RA 5BNOC 1MEC2 3OG6B 5D5MF 3ZVVA 4BZ1A 2XACC 5TE7L 1G9NC 1UNBA 1DBNA 3PURA 2VDML 1KJMB 4CJ0A 4XTRC 1IBGH 4V2VA 3VDDA 3ESUF 3O6LL 3QDJB 2C6SA 4XN5A 4YZFF 1TDQA 4MJIB 1ERNA 1Y0LB 2LU7A 4Q0XH 5GGQH 3ZXLA 4YVSC 1A5FL 3ELAT 4QDGA 1H8VA 1RZ8B 2PLV3 5I0RA 1ZRCA 1DVSA 1F4WH 2VE1A 2COQA 4DUVA 1C1LA 2ZUXA 1PL3A 4CDUC 1R082 4LA3A 4Q4W1 2JLPA 3DDFA 4F2ME 3MIBA 1MVUB 1OB1A 3MR9B 1NZRA 3IGFA 3S37L 1OQDA 2B4CL 2XOMA 2UYLB 3AY4C 3W56A 4MSVA 2RMU1 2UZIL 1HK6A 3BFQG 1JHNA 5DQDH 3H3KA 5D1QD 3DPRB 1HLCA 2QVMA 4CP1A 3AS3A 2JDZA 1V10A 2X2IA 1QRKA 1XGYH 2DQHL 2CHXA 1PY9A 5JXIA 4U1LA 5BV7L 1T6WA 3B9KD 4O9HL 3TA4D 1OQEA 4P14A 1QQDB 3QDHA 2NMNA 2OULB 1RUI1 4IEPA 3FFDA 3ZRCC 5JA8B 2ICCA 2ZTNA 3G9AB 5K0UC 1W2AX 4LEOA 2Q76A 3V4VH 3RVTD 4HV8A 5E1IA 3M6DA 1KIPA 1XB9A 2J20A 2AV1B 4G2AA 5IBTH 4XO9A 5A7EA 4CPBA 5EEWA 1ZZBA 2ZWZA 3O1MA 5A33B 1YEEL 3O3AB 3DX9B 4L1BA 4GRLD 3UYOD 4ELDA 3MNWA 3R0RA 1NBVH 3REVA 3V0GA 3HPLA 2ZHLA 4IBLT 4WK4B 4OLUH 4MNGA 3IMSA 5KHJA 5LAXB 1NCWL 3QULA 5LVEA 1WLCA 4HOXA 1J0KA 4BZ1L 2EVIA 2W52A 3UGFA 3AGVA 4MBRA 4TSBL 1MDAA 1M57B 5BNXD 5FOBB 5ISZB 1OA2A 3NDYE 4HU8A 5D1IA 3MV8A 4CP9A 1HESA 5JA9A 2V7HA 3RWEA 3SE3A 3VWJC 4MB1A 3P4NA 3ECBB 5FUNA 4A7QA 1FYTD 5D96C 4OIIH 1PZ9A 1QSFB 4LOVA 1EAPB 4XO8A 2EC9U 2C24A 3MIEA 1S7VB 4PP2B 1T2XA 3FCSA 1NQBA 3WTUA 2MNJB 3K5SA 3RFZC 4QXGL 1KB5B 5DMIL 4UM9A 2H6OA 5DJZA 4IRZL 3ELNA 2VNGA 2P7TB 3VXUD 3II1A 1AYN2 1B2YA 1J8HD 2CWSA 1KZQA 2QHRH 2YGNA 3INOA 1PMIA 1UD3A 1BSIA 1T04B 1RPKA 2BWAA 3EJKA 3D0VA 4Z7UA 5T1MB 2UX7A 1ZRDA 4HWZB 4NM8H 4PJ7E 2VCAA 3PWVA 1IS4A 4TLKA 1DHKB 3VXQA 4NQEE 3OMAB 3SDXB 4RA3A 4JJ5A 4U1GC 2DI9A 4OFIA 3C6SB 4N9IA 4LTAA 1WW4A 4XAWH 1QNZL 2WNKA 1E9QA 1DANU 2XNAA 2GJRA 3OKDB 3P11L 4ODUB 3BVWA 3KPLA 1AHWC 2EDHA 2PN5A 3BPOB 4UMSA 1JS9A 5EEXA 1I1AC 3QWNA 4BU2A 4LO9A 4UT6A 3G5YA 2Y0IA 4AV5A 4X6QB 5DCCA 2C9QA 4P2CG 1W9YA 4PJ5E 3V0WH 2Y1YA 4NO5A 5EEZA 1JUIA 1KCUH 3KJ6H 2G2RA 2V17H 2XXMB 4PG2C 4AENA 1U6AL 3LJ3A 3NP3A 3AGWA 3EH5B 2CNAA 3TWCL 2GH8A 4XP5L 1DJHA 1E67A 32C2A 1ZLWH 1MI5E 2VZSA 2E8YA 3LNDA 3QCWA 1H9DA 3V5DB 4GEJA 4Z3TA 3CLEH 4O9GA 5FJKA 1MCLA 1E8YA 1DGWA 4COZA 4ALAC 3MFCA 2RAMA 1DJIA 1QOKA 5DYFA 1JVOA 1MAMH 3JTSA 3ZX1A 3W21A 4AQSA 4K71C 1YQCA 1I4FB 2WW8A 1FVCB 1BLNA 1NWPA 1S8DA 4P3WA 1JU4A 3VH8B 1VRBA 4QM9A 2FE0A 4AQ8C 1MQKL 3APCA 4XH2A 5E4AA 6PCYA 1ACZA 4JO2H 1Y9GA 1GJUA 1ZBE3 2PHTA 1T22B 4KK8D 2Y23A 2A7BA 1SFNA 3SY6A 1MEC1 2VULA 4MVBC 2NY1D 5A3PA 3RMXA 1WGOA 4W6WA 2VLKE 3SD5A 2IV8A 3U07A 1T1XA 5DK0A 3DV4B 4KRPC 1BIHA 5G2NA 5IB2B 4LULA 3GHBH 2FO1A 1PQZA 4PS3A 3ZXDA 2J6EA 1A66A 1PZSA 4YK4B 4Y2OA 1A7RH 3VHOA 2HZHA 2B3RA 4QPWA 3FYIB 3H9YA 4KO7A 5C1MB 1D9KD 2JKTM 3B01A 3IB4A 3RL1A 3C5SA 4PJFB 1MWAA 3DMMD 1OT4A 2N1KA 1QR4A 5EOTA 3MBEB 5LCVH 3GBDA 1U8QB 4OVEA 4C4BA 4GINA 5D5MA 2HWC3 1CYXA 2CXKA 3Q5TA 5E8PB 4G42B 4WSGA 3SDYL 1PS3A 4N8PA 4BFFA 3VMPA 3CQFA 5HHQB 4L9LA 1P69B 2DKSA 3KM5A 1I9RH 2OI9B 3OB8A 4UT6L 1RQ5A 1H8TA 2XDVA 2QKIA 2AH2A 2PHDA 4PIBA 4FFGA 5C33A 4OHYA 1GSMA 2DN7A 4PJ9D 4ZPTB 3EDJA 4UANA 3NCWA 3GSOA 4PWHA 2WYIA 2BV4A 3OZLA 3ULVC 5ACLA 1TNFA 4FQZA 2GB2A 1YMHB 3ZR6A 3MLZL 3P30L 2C3GA 3FU6A 4KDTC 1F58H 4D0BA 4KI5M 1R46A 1NIDA 3Q0HA 4ZT1A 4Y9EA 1N6UA 5F8PA 3AG1B 2DWEB 1F02I 4AG4L 5FB8B 3TBBA 2UVEA 3ARXA 1NLRA 1NGPL 2IQ9L 4NJAH 1N0LA 1T7YA 3QO0B 3MKGA 5LY2A 4UAHA 5JTWA 2AJZB 1WCDJ 3G08A 1UEMA 2DQIH 4CAGA 1VBC1 5CKMA 3PGDA 2C1PB 3CDGA 4LT7A 4HJIA 2EDYA 3U46B 3FL7A 4TUJB 2EDRA 5KAQF 3ZN6A 1BVLA 3H4FA 3G6DH 5EUOE 2NY2B 4MOAA 3BQUD 4QPEA 2E9BA 4GALA 2FCBA 4JDVB 4Z3JA 3VW3L 2NQCA 1ULCA 1UQXA 2N3JA 3HUJE 1UU5A 1RH8A 4J2XA 1UOWA 1XO8A 4R7VA 3VFTA 2Q8OA 1E27B 3U25A 5FK7A 4J25A 3G7DA 1I5ZA 2NSMA 2WTRB 3CC5B 3F64A 4BSVB 4TNVF 5JW4M 1CFSB 2FLRT 2OMXB 2WXJA 4KROD 5C0CD 1UU4A 2DIEA 4UBDD 4N1HB 4H8HA 3WINE 3OUIA 3TH2T 3LKOA 4KKPA 5AG9A 2OPCA 2IANE 2C3XA 1MWOA 2KYIA 5AZ2H 1GY2A 3IXTA 2OMYA 5F7DB 4BEIA 4F1ZA 4OD3H 1KYOJ 4L29B 3P3NA 4D7SA 2H6PB 2ZKHL 4H8WC 4KO6A 5DUVA 3IAGC 5TH2B 3ACFA 2AXGA 4JPQA 4QTIH 4GQZA 3MGOA 4WFHD 5I71B 3VZMA 1G7IA 4RGOH 3BI9X 4DNYA 3LV3A 2XWJA 2W91A 4K94H 3BPOC 3HC2A 2IBZY 4HPKA 3CFDB 4U31A 4YM0A 4DH2A 1AR82 3F65A 3FTYA 4GBXD 4P2RB 4DF9A 1YPZB 1PYWA 2OQ7A 4HK8A 1UQSB 3H7BA 4E5XA 2WZPP 1FAIH 3KPRB 2OXHA 4GWIA 4A7UA 5HY9A 3EKCA 4NPMA 1A8ZA 4PJXB 4U1KA 5A6MA 2XSKA 5DTFB 4ZW8A 3UYPA 4WNQB 1YN7A 4QMAA 5LZ6A 4WKXA 5D4QA 4P5TA 5D1QE 4KU1A 3ABKB 4HKZB 4KY2A 5AW5B 3B94A 3TOJA 5T5FH 4XPBH 3TT1H 2YMOA 3PCYA 2DCYA 1ROWA 4BV1A 1UXWB 3N9LA 4WVMB 2JKNA 3QUXD 2VR5A 1J11A 2OTUA 1RZJL 4GUCA 5L2KD 3WV6A 4E8DA 4LHLA 2DQUL 2F7PA 1D4VB 2XQXA 4ZOBA 3LX9A 3U2IA 4YS4A 2AJ3B 5IB3A 3AMHA 5F3CA 1TO5A 3HNTH 1MJUH 2UZYB 2NNXA 2BHUA 2VL5B 3HE7D 3VH8G 5A2FA 1RUC1 4QKNA 1QNYA 5HCHA 3OR6A 1R1ZA 2BTVC 4I9XA 4F3JA 1P1VA 1MW2A 1ICTA 5KS9F 4P9HC 3GLZA 3QUMH 3OGOE 3Q6FB 2BWIA 4YK4C 4TULL 5DD3L 4N6QA 2VQTA 5EN2A 2IMMA 4GT0A 2VPVA 4JKKA 1OTSC 3WNOA 4AC2A 3WP6A 2YBKA 4BRJA 3H42L 3LKNA 4MNQD 5H9SA 2DD8H 4Y5XB 4Y3OA 4HK9A 4XHJD 1YYNA 5IJVA 3MBEC 2XN9D 3SDDD 1RIVL 3PPSA 1FYTE 4G9FB 2Z35B 4ZOAA 3W11C 4BHUI 3OAZH 4XN7A 4CDGC 5EDSA 4NBYB 2Z31B 5ITFB 2WO7A 2QSCL 2Z0UA 2ZGPA 2E46A 4PD4K 4CMMB 1U5IA 5FYUA 1O3TA 3H6AA 3ZX7A 3LMJH 1EJOL 2OI9C 4RH4A 5TPWH 2IALA