4ES8A

Crystal structure of the adhesin domain of epf from streptococcus pyogenes in p212121
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
302
structure length
302
Chain Sequence
EELPDDLMNFKGTWEVSADGSSGRFFSKGATDSYVFHLIPAKDVKKPGWREHNEVKDSYIKIDKQSIAARYKTSTTAPYSVAFKVNTKSLIKDHDYKITFEQGQIASGITVDYRIGSAFNKTTDDSFKISDESKYASNVKIEGEEQGFKQREQGDKTISFRTLKEGPMSLVLLSKVEKKPQGDLDVEFKNLKIIDVTNPSQLDKGVAYVGNKNVQLTLKSDDGRTNFEGDEISLFNSRGELLQTVTVTKDQQNPISITLSEDQAKSLKNKEKLKVSIKQKQSKKTSKDFFFEVGIDPKVEAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Extracellular Protein Factor Epf from Streptococcus pyogenes Is a Cell Surface Adhesin That Binds to Cells through an N-terminal Domain Containing a Carbohydrate-binding Module.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
molecule keywords Epf
total genus 80
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4es8A02
2.60.120.1240 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4es8A01
4ES9A 4ES8A
chains in the Genus database with same CATH superfamily
5DS8B 2XJTA 3U48A 3INOA 4PPTA 1JHKH 4UOZA 4NO4A 1PVC1 1H8OA 1RP8A 2IAMB 3E5XA 3U30B 2WY3B 3UTTB 4RGGA 2PF6A 4UNVA 4PRHD 2XWDA 3SCMD 3L4ZA 3VFVA 4OCNC 4UQEA 4JHAH 2H2PC 4N90E 4G42A 4HEPA 4BA0A 2EUZA 4ODHL 1FORH 4MHHG 1ASJ2 4Q8LA 1MH5B 4ZPVA 5IBTL 1QEWA 1I7RA 1CUOA 5GS1C 2A2QT 1XCXA 5F6IB 3BCFA 3W9EA 4DWHA 3FUKA 2OMVA 2H4EA 4XDOA 3VRJA 4N68A 5BUAA 4QX8A 5F5IA 3QCVH 3IDEA 3MV7B 3ZTEA 1J18A 3KWTA 3GYRA 1T0PB 1P6AB 5EWIL 3QULA 2RS12 3I2FA 3AU1B 1JZDC 3IFLL 3QORA 4PJXE 5DFAA 4RFNB 1YQ6A 1QFUH 4Q8BA 4OJYA 3LDRA 2VH5L 4LL4A 3ULAB 4BQ2A 1UYWH 3BJLA 2BO0A 2D31B 2QBWA 3JQWA 1KCSL 3IGUA 4QLWA 4LDLB 5D8AC 2W9EH 3RUGE 1IAKA 4L1HA 2HT3D 2ERJB 3B7YA 3I8TA 4AQ8A 4L2NA 4PJCA 2VNVA 3GBEA 3GHBH 5KVEH 5BNOB 1RIVH 1I7ZB 2IO5A 4HJ1A 4QF1A 5ITFB 3RA7H 1SMAA 3NPSC 4AT6B 4GXUN 5E94A 4O2FA 2PW1B 4XC3L 1MZEA 3R05A 1QFWM 1XR9A 3KNBB 4QAWA 2WA4A 4JGYC 5IT6A 2PPAA 1UD4A 1NOLA 4TNGA 4YW1A 2VO5A 1JGVH 1ULCA 3WEAA 2YGPA 2X4TA 3QI9A 4IDZA 1MF2L 3WTSA 4PJHE 3V64A 3FFCE 1A3RH 4EN7B 4W9KC 2Y7QB 4MMYB 4UDTA 1QFWL 2OI9B 1ORQA 4QHLB 4ZXBA 1W8WA 3Q9QA 1DIWA 2C1FA 2G9HA 3KPSB 5I5MA 4OV5A 5FQ0B 2AZAA 2B59B 1P0SE 5DFTA 2AH2A 4XJAA 4AE0A 1TMF3 1ZPLA 3EJZC 1VEOA 4HCRH 1A2YB 2AF2A 2DQUL 4HS3A 5DC4B 3VYOA 2N7GA 2VDPH 2XI9A 3OMIB 4FQJH 2CDPA 3CZNA 2YD3A 5E7FA 2MH4A 2YEZB 2YEZA 3P40A 3N5AA 4E2SA 2NSMA 3LS5L 2AKRB 3BKYH 3B56A 4TULL 3MLJA 5E6ZA 1OSYA 5JZGA 2BVUA 3V2AR 2OCCB 5HV0A 2XZCH 1ZANL 4MSWA 1GP4A 1OT1A 4GAYA 1MQ8A 4Y16A 1DYOA 1BD2E 4FA6A 1TPXB 4HZAA 2A6VA 2WUCL 2XN1A 3K4AA 4X7SL 3LFMA 1RUJ1 4NKOA 4JR9L 2R8SH 2BGPA 2NZ9D 4L8DA 1IBGL 5CD3A 2ALAA 1A7QL 3DXUA 1WBZB 4Y22A 3QJSB 2NXYC 4Y22B 3HZMB 5E1RA 3TNNB 2AEIT 2BSEA 2Y7LA 4K07A 5J3UA 3PABB 2F53A 3QQ4A 4ZMLA 1UATA 1D4M2 1QJEA 4XILA 3DPBB 2IPKB 5DRZA 2X10A 4X6CE 5C0AE 1JZ6A 3EJYC 3Q48A 1EPWA 2A7AA 1XBRA 2VH9A 3LPGA 4AYFA 2ZX6A 2D7NA 3JWNE 4XBPB 4ZXKA 3OQ3B 5HI3D 1U42A 2WPGA 3O6LL 3ZHLA 3EF4A 3U4SA 1HV1A 2GSGB 2NZ9A 2GC7C 3HS0A 1KXGA 2VR7A 4J5VA 4DFIA 2WLNA 5ILTL 3RAJL 2DM4A 1CU4L 2DYPB 3NCJH 3NKGA 4OB5L 4I4WA 5DFVD 1IGTA 3APFA 4XO4A 1WWBX 3QEQD 1E27B 4M62H 4WFHD 3L4WA 5A7WB 2JI1A 5E4AA 8CGTA 4MLSA 4ETQB 1CAWA 2JKXA 1F00I 5EULV 5HVHC 4GP8B 3PUCA 3CSTA 3ZL4H 2E6VA 1R17A 2G3XA 3BIBX 3MRQA 3JZVA 2JE8A 1OTUC 3E6HA 5TJWK 2NOYA 2LW3A 2DL9A 4IRJB 3SDCA 2GUOB 4QRRA 4B4PA 5T1LA 3ULVC 2IFGA 1LESA 4RX4D 3T1MA 1UB5B 1U5ZA 1KQRA 1SLIA 3IU3B 3MJ7A 4LSQL 2X09A 4EE2A 4ODUB 5A3IC 3HNBM 4DIXA 1CIUA 1DQ4A 1JF5A 2ZABA 4J8RA 4PU2A 5EIYB 1RUI3 5D7KD 1AHSA 2MCPL 4MD5B 2Y38A 1YMMD 2ZCLH 4QQPA 5J37A 3QRFM 5E08L 1J84A 3IJSA 3MUUA 4AQ1B 1U8CA 2ZGLA 1IM3A 5J5EA 1K85A 1ZM1A 2JDYA 1ZS8A 2HJLA 2ZOLB 4DEWA 1ZS8B 1CGXA 5CXPA 1ET8A 3BB6A 1SLUA 1V6NA 5LXGL 4BWOA 3N85H 1VRH2 4U1MB 3ZUCA 1PD0A 2OJ1A 4NJ9L 3MRHA 2YA1A 3EYVB 5EBMA 4GXVH 4BCZA 2ADGA 3TCTA 1MRDL 2Y7NA 2R2EA 2X2UA 4CW1A 3S6PA 1G7LA 4WVWA 3PFQA 4PBOA 3N04A 4OSUH 3POSA 2Z0BA 4ZW7A 1PDKA 4G9FB 3LSDA 1A3LL 4KXBA 1TME1 1PDKB 2F4PA 4HUKB 5LAXB 1TZIB 3IPVB 4UU9A 1ZA6A 4Q9CA 4YDLC 1OF3A 2QQKA 4PJ6A 3C7FA 1B90A 1GGUA 1QFPA 2C4FT 2CA4A 1OKOA 2DTSA 4N8VB 1NCDH 5E6IB 5IMOB 4FYQA 5LB6A 4AF9A 2B1HL 5EC1A 5T1DH 5B8CC 3IS1X 2Y26A 2ZYIA 5M0TA 2VERA 3GSUA 3QARA 3ZIYA 2QKIB 1VERA 3KPNA 4X99B 1OSEA 4QOKA 3QIWA 5I0SA 3BEWA 4PCYA 5KN5B 4U6VH 1QBBA 3W11C 5CFHA 2W0KA 1RZJL 3SHRA 1E5YA 3PGFH 1ZTMA 4QRTA 3C8XA 5D7IA 3CIQA 2BU9A 3MACL 3BU0A 1JVLA 4P4RA 2EC9U 3QQDA 1T1ZA 2FD8A 3U46B 3KWWA 2FMYA 4CNIB 1EEYA 5CCKL 1HQ4B 5ENWB 3MXWL 3IDIA 5HVHB 3NMBA 2ADDA 2FO4A 2FT7A 3RPQA 1NSNL 3T3MB 1C3HA 2HP4A 1OGPA 5IESL 4LVHB 2B77A 1MEC2 3L6FA 4P9HC 5IG7A 4QOKD 3O0RL 1OAZL 3PF2A 2OS7A 1G1CA 3ARBB 1QVOB 2C26A 1VBD2 1NCQA 5I18L 2DVDA 3AITA 1ML0A 4OTXL 4OUEA 4WHYG 4ZD3L 4HMDA 3GGLA 3K72A 3UBHA 3NSDA 4YN3A 3U4EB 1RK0A 3M8OL 4WU7A 2JTDA 3RWEB 4BGLA 3M2MA 2F8VA 3CZUB 4L29B 4P5TD 2R041 1T6BX 1GCYA 1US2A 4EJRA 2BWCA 1D6VH 2WFPA 5EJ1B 1SJHB 5EZWA 3T0EA 1JWMB 4XTRD 4UINL 4F33B 1BVVA 1FHGA 1NFDF 2R23B 5T33L 1PMJX 3GSNA 5GGVH 4J1XA 2X89A 2ZXAA 3T2QA 2MOQA 3GC3A 2AITA 3GD1C 2OYLA 1G7HB 1MCCA 3VFPB 3VXUE 2WXKA 4ZXBC 4CDQC 4CJ0A 3B9EA 1LU1A 3RWGA 4CE8A 5DG2A 4FZEL 4XTRC 5H37H 3RWGB 2Q3AA 1I8IA 3GEWB 2DQFB 3GIVB 4HN1A 5EZPA 4LK6A 1KLFA 3QRGL 1RVFL 5K1NA 3NFNB 1V3MA 1XXDC 3B5LB 1NIDA 3RL1B 2BSCA 4MNQA 3BAEL 5TTRA 5T3ZE 1JPFA 5BY5A 1W05A 5IREA 2K9ZA 1BZWA 5LAPA 2QVSB 1CVSC 4EWEA 4PGCB 3VYPA 4HDIA 1HL8A 4RH4A 4LHLA 3W39B 3TOJA 3E6FA 3AT8A 2PLV2 1DVFC 1A9EB 4YZWA 3IMBA 2YQBA 4WW2A 4ONOA 2UZPA 5F6HI 4PCTA 2QQWA 3HQXA 2DBLH 1O7DE 1FNZA 1LK2B 1OGAD 1VMFA 5HY9A 5C33A 3CQPA 1SFYA 4JPSA 3ZJAA 3T3YA 1T5KA 4Z5RB 3FZUC 3BPZA 2AEWA 4HCRA 1MWAH 5IKCA 3WMSA 2NR6C 3VXQA 3AUVA 4A7ZA 1NX9A 1ASPA 3N06B 4F33A 4KV5E 1UFUA 3T6XA 5E6ID 3HRZC 4V2BA 4MGIE 4HCIA 2FEDD 1J1PL 1ZV9A 2XBZA 1GHFL 4M5SA 2F08A 1N0LB 1WBXA 1S9KC 1OAKL 3JYBA 3VXUD 4JFUA 1UB6A 3ZDVA 1ZVSA 3ZLIA 4ZFQA 2MIZA 2ZX5A 2GC1A 3T77B 4JN2A 1AOHA 3QUYB 4YZFE 4QRPA 4OCMC 2L7EA 3FUQA 4ZUWA 3NRQA 5EBGA 3L8QA 2JB5H 3B9VA 1F13A 1Z5YD 4JB9H 1FNHA 2I32A 1J59A 1UB5A 5GS2D 3R0RA 1G94A 3GXPA 3ALQA 4UT6A 4NP4H 1NY71 1QKZH 3IBOA 3A0KA 4NHLA 2BOCB 1A47A 4I0AA 1A4CA 4BE6A 3KF3A 4HGWA 4FO9A 2ZYHA 5MI0B 5J4MA 3RB5A 3CVBA 5DJCB 2NMSA 2AGSA 1OAYH 2EDJA 4Y4FD 4I0PB 2R2BA 3DPRA 1DGRA 1CXKA 1ORSA 3N1FC 5J3HC 4ZX3A 1TJIH 2LGNA 2VDML 2I5YH 3QJQB 1UO9A 4N86A 2MCMA 4U1NA 1R3IL 4NENB 4U1NB 3BPSA 2YHJA 4JREB 1A02N 3QORB 2W1WA 2VXQH 6FABH 4LPCA 2DEWX 1MCWW 3DN7A 4ERSL 2PW2A 3PDDA 5E2UL 2ICWA 5EU6A 2FQDA 4A7SA 1N0XH 2PYED 3WXVH 4TSCL 5C0FB 3VW3H 5KJRH 2XTJD 2BNQE 2BY3A 4JZNA 2ZUQC 2GC4C 4HT1H 1GIGL 4AFCA 4WVZA 4LBJA 3U30C 2R061 2XZAH 3N40P 4JG0L 4OLYL 2VY0A 3CAFA 2QVTA 2XA8H 1MRFH 5TE7L 5HGDB 2OZ4A 3KYMA 3ZXDA 1KPUA 3VXTB 4XXCA 1CR9H 2EEFA 2XXZA 1Z9PA 4F3FA 3QLQA 4WIQA 4CN6A 3SY0A 5KG9A 1I3GL 2AJ3A 2HX9A 3WBDA 4MJ5B 4HVRA 3OJ2C 4IRJD 4A6SA 4LVHC 1C12B 1DCLA 5ABJC 3F83A 4PB0L 3S96B 3DHUA 1WFMA 3I2CL 1F4YL 4K3GA 4K21A 4JEGB 5BCAA 1MLCA 4IEQA 2HWF2 3ABKB 4XPAL 4AYMC 2Q1ZB 1RUD2 2XWZA 2W65B 3V6OC 4TOYH 1LDSA 2XL7A 1IAIH 2OQ7A 2R29H 1RVF2 2P43B 2Y6HA 4IOSA 3B3IB 1AR82 1QGLA 3D4KA 5E2VH 3ULUD 3VBUC 1BF2A 5J6SA 5SWSB 3SCFA 4YDVA 5I8OL 4HLZG 1FNEB 2RCSH 5LA1A 2C9AA 1J0YA 1NH6A 1PO22 4Y5YC 3M45A 2D9CA 4P05A 1HH9B 1A1NB 2XVGA 4TVUA 1N9PA 4M9PA 1U8LA 4BWTA 2HRLA 1P7QA 4PJAE 4CADA 1GSKA 2WKOA 2WWKT 3T2OA 2ADJB 4PLJD 1BVZA 2BM3A 3BGFC 3O3BB 4YDLB 2O5ZH 4OI7A 2LROA 1U92A 1SLTA 5GZNA 2ZEYA 2DWSA 4HIJA 3UBXG 1NCBL 2D8KA 1UYWL 5L7XH 4XNXL 5ADOH 1OVZA 4HWEL 3HG5A 4OD1H 1NANI 4YDJA 1HAWA 1O4ZA 4HLJA 3TA3A 5I1DA 5I0WA 1RUH2 4F7PB 3TURA 3BLKA 2IMNA 1EFXB 4LO7A 4IE4A 3LZQA 2RDNA 2TAAA 4MA3A 4ZTPL 4YGVB 1LOEA 4PS4H 3QDMA 4I77L 5DJAB 1CT8A 2VSCA 3GNEA 2V33A 1OSZA 4HFUL 3IAQA 4QHNA 1HHKA 4FKKA 1VJ2A 4RAVB 1WH0A 3S37L 5HBBA 1RUC1 1W8ZA 1JGVL 5KSAA 3PUAA 4JTOA 1MVUA 2CO7B 3P3RA 1AGDA 2EABA 4HISA 3MODL 4N0FB 5FCUH 4LHSA 1QLRB 4G80A 4XP4H 3RDTC 1Y9QA 2IUWA 3HAEB 3IGFA 4GRWB 5C6TH 4DGYL 1O59A 1J05B 2LS6A 4L0PA 5SWSA 4HKZB 1D4VB 4KU7A 2B46X 1K4DB 1QWNA 5C08E 4B9IA 3N43B 2XPGB 4WWID 1C57A 4P3CL 1HXMB 1FI8C 1XEUA 3JSSA 4N2KA 3ZDXE 5F2SA 3SCGA 5C6CA 3OGCA 3RURA 5LN8A 3WEZA 1JS4A 3ARBA 2V4LA 3D9AH 4XN7A 5I76A 3PURA 4EI5B 1A7NL 1OQ1A 3POEA 4AYBA 5HHVH 2AQSA 2OMVB 1UH4A 4JY4A 1YFWA 1U3NA 2BK8A 5ACMA 4D7SA 2GJZB 4LOEA 1UOBA 3AS2A 1G84A 4TL5A 1JGDA 2XWCA 4K71C 5AL8A 1X82A 4CCKA 3QZWG 3PAZA 3H6AA 4NROA 4NIAA 1H5BB 1MCKA 3E80A 4JO2H 2DCJA 1CDHA 5HXMA 1M1XA 1VPOL 4KMTH 3POYA 1H3XA 2D4DA 2P4AB 3NCCB 4XXWC 1UW8A 4LBQD 3PP4H 4UT9H 1G7HA 1NGWA 5FYHA 5HHMB 3WF1A 4KTDH 3NDYE 3CFIC 4P46B 2WANA 4QHNB 3UG5A 3ZKMC 4N24A 4PGEB 3QJRB 3T2LA 3U2SB 4NE9A 4G72B 5DQJB 3SHSA 3TN0C 4OZHE 5GS0L 2X1OA 1QBLH 3REWA 5EOCL 3O45A 4I0PC 1S8DB 2VDRL 3HAGA 5FBJA 1W6NA 1EGJA 3MLUL 4YR6A 4M7LT 3I3QA 5IR1B 3SYCA 1RCYA 3D69A 3SZ6A 1HJCA 4J1WA 4QGTA 4EMZA 5DN2A 1CR7A 1IQWL 5AUMA 3SBWC 4IEUA 1JS9A 3NJGA 3P3TA 4I3SH 3BW9B 5FUIA 5T50A 2ZXQA 4UBGA 5JR2A 1OALA 2W92A 2ADFH 3OKNA 4N25A 1AZBA 3ARTA 4N26A 1UVQB 3M17B 3KPPA 4NRXB 4XPBH 5C0ND 3RVWC 4BV1A 2PTMA 4K9SA 1P7QD 5ILTH 1RV6X 2F7OA 4F20A 5KSUB 5KSUA 5DJCA 3KYKH 2CAKA 2JKJA 3A6OA 1KCWA 1UA7A 3KPMB 3QC6X 5C0CD 3QDGD 1P84K 3I6LD 4E41E 2XBO2 3TO2B 1P2CB 2IZWA 4MNQE 3RYMA 5IUCA 2B1AL 3OLEA 3LEXB 4AGMA 3DETC 3BUPA 4JFPA 3SE4C 2TSAA 5IF0A 1B35C 1JN6B 4ONHA 4ZO7A 2A5ZA 1RZFH 5FZOB 3FH7A 1X50A 1PGL2 5K59F 4MAYB 3VBFC 2G30A 5ALBL 4HIIA 3VFTB 4XMLL 3ZXAC 2E6PA 4IV1A 4CVXB 3Q43A 4HD9A 2E31A 3QXAA 3STLA 4RGNE 2QVKA 3H0TA 1QHOA 3QXAB 1FPTH 2BOBB 4FQ4A 4KL1A 1EEQA 2D3JA 4FG2A 2WNKA 1TOXA 1V7NH 2Q5BA 4A63A 5DVNA 4AK1A 3TOPA 4QWNA 3MOQA 4ALAH 1CFQA 4DGUA 2Q1FA 1DJXA 2UY7A 2LFGA 3C5SA 3QPQD 1R4XA 3QXUA 2UY7B 3C5SB 4F3FB 4IE7A 3U9UB 1Z7S1 5I82A 3U0WH 2XFXA 2L7JA 2I9LA 3NESA 1FYTA 3FO1A 2A3XA 3EHKA 3KVPA 4YVWB 4QHMB 3UKTA 5DSCA 4B9PA 2X4OB 1FMD3 1L0YA 4FJYA 4WK4B 7TAAA 1STMA 3ZDSA 5C5TA 2OR9H 3ZSSA 2FEDC 4YHNB 2VRQA 3DO3A 4E8DA 1YUKB 4PTUB 4LULA 4M7KL 4RSVA 1B2YA 4JHAL 2NR6A 5IQNA 4Z7QB 5ACZA 4QRUB 1Q0XH 2EXWC 2Z5WA 1JRHI 1JAEA 5EC2A 2AMUA 5IF0B 3P1IA 4HF5H 5DHXB 2HWD1 4LBLA 1TVDA 3WFEL 4A2HA 1RQ5A 5I1GL 4XMKL 2AJVH 4WHCA 1HC1A 5L8LB 4PRPE 4I0CC 2HWZL 5ANMB 1RZJC 1OT4A 1WW4A 1ZIAA 1UURA 1R33A 3W11D 2A73B 1E30A 3KS7A 4GT7A 2P2KA 1EDYA 3CIHA 3L3OB 2RB8A 3JZ7A 1HJBC 1J3PA 2V5SA 3JWOL 1TENA 3ZDYF 1O5DT 2R51A 3GHEL 3VFNB 2I2SA 1Z32X 3UFIA 3VD5A 3KPOA 3HD8B 1NAKL 3MA9H 4KQ4L 5LUMA 1E5IA 1OQDA 4Z7IA 4M6ML 5ISZE 2DQDH 3KW8A 4S10A 1ZLWH 4PR5A 4GUCA 1QKZL 2X9XA 3LQAL 4JCLA 5F1RA 2XOMA 5G55A 1AGFB 5F93C 3OUJA 4Y3OA 5LBEA 1N6VA 5CKGA 3MRJA 2H3NA 4K6BA 2KKQA 5IK5A 1CFVL 4ICXA 2ZWKA 1Y9GA 1LGCA 1WIPA 3NCMA 5BZXA 3ARQA 1NG0A 3IDCB 4AQSA 1AAJA 5DJ8B 5LA0A 3MTXA 4YZ1A 4Y1AA 1EERB 4XZPA 1FDLH 1Q8MA 3TYGH 2YC1B 4LFHG 3VXQB 3B3IA 4MJHA 4AL8H 4F37K 1XNCA 2YC0A 5L36A 3DOSB 2ENPA 3NK3A 3TFKD 5AW2B 3B7SA 4PUBL 4CCEA 4CDXC 3OD3A 1CICC 1DSWA 5CGBA 2OIIA 2A83A 3L2LA 4KHTL 4PH8A 3WKMH 4M8RA 2A6JB 2Z91A 2WLIB 2MEV1 2NX5A 1WWAX 2KZKA 4PTTB 2MFNA 5D96B 3U2JA 4PJIB 3GJFA 5C08A 1XYNA 4P9IA 1H9VA 1ZHLB 4NHUB 3W2DH 3RDIA 1IS5A 2HH0L 2VAJA 4PJGF 3CZEA 1SDDA 3VMNA 2HFGL 2GSMB 2JNZA 2Q20A 4M7ZB 2P6CA 4GBXC 4JC1A 5KYNA 5J48A 3TBDA 1RUH1 4NO5B 3L54A 4CUCA 3KLHD 1KB5A 3ZKQD 2APWA 3CC5B 1YUHA 4Y5VB 4HKBB 4OGYH 3W0WE 3M7FB 1U9KA 3F6IA 3ZDZB 1HVXA 3ZSTA 5ESAA 4L5FH 5D7JA 3R06B 3WY1A 5I5RA 1C9SA 3IRPX 2JCCB 3FQXA 3Q9PA 4JGMA 4P06A 4UNTA 4HBCL 5C0BD 4HWBL 5F9JB 3CWGA 4N2OA 4M5TA 1HE8A 4HJ0C 4YHKH 3N40F 1FN4A 1KLGA 3BVCA 2NN8A 3A23A 5F3FA 5DMIL 2Y36H 3H9HA 4QTHB 5CFDB 1AZVA 2HWF1 4RWYL 1LHZA 4FLHA 1IBDA 1G7PB 1KLUB 4EQ3A 4BE5A 1HHIA 3DURA 2ILMA 3QFGA 5CP7A 3CX2A 5AFAA 3LKPA 4ZUVA 2XV0A 3NTCL 2WL1A 2XLLA 2O26U 4ENZA 1U8LB 3I74A 4X6DB 4HYTB 5JW4N 1LULA 2ZGNA 3OBTA 4FFGA 3OAZH 3FN0L 1U8OB 1TEGA 1LEDA 3BUYB 1ND2C 2MRYA 2FD6L 3O1SA 4DRRA 1BVKB 2YUZA 2OYPA 1QG3A 5ADOL 4DKDC 1CTNA 1PMYA 1KJVA 1HU8A 5DFWH 4I0BA 2JB8A 5JXGA 5AW1B 4KFZC 3QVAA 5E03A 3DX0A 4L1BA 5I9QC 4GMP3 4TTDD 3O3UN 1AHWB 5F7DA 4NHXA 4X5XB 4Y8AA 1AF9A 5T5PA 2BBVA 3L3JA 2YBSA 4PP1D 2YJLA 4I77H 2YFNA 4M3KB 2KERA 4U0QB 2HUHA 2YLKA 3T2TA 3NG5A 3BWUC 4D0QA 1CLZH 2VAUA 2CLVB 3F95A 5C07E 1XXFC 4BOWA 1BIHA 2BERA 5KVFL 2YZ8A 1Y18A 4KO6A 3RGVB 3G04B 1HCVA 2YRLA 2J1YA 3SDCC 3T4YA 1MPAH 3VFRB 4EN3D 2EVJA 1QP1A 3MRKA 3MV8E 4S1QL 3T65A 3ZYRA 2CIKA 4IU3B 3OYWA 4NPLA 3AZYA 2JD9A 4ZX4A 3BT2H 5HP5A 2Y33A 4I5BB 4X6CA 2Q8AH 3RSJA 3O9WA 3ZN5A 3NCXA 3FK3A 1BGXH 1DLFL 4KKBC 1H2KA 4WO4C 4LL1A 5T1KA 3L5HA 1RLBA 2FHCA 1LHWA 2C3WA 4RMBA 1UZ6F 4JVWA 3JYCA 1A7NH 4NKDB 4QJ3B 2VLJD 3KHOA 4D0CA 1RUMH 1A4KB 2AXWA 3GDCA 3GLDA 1WAAE 4EN3A 2JX9A 5FPAA 5IW6A 1I7UA 4PJ5D 4YRDA 2FE0A 4YSCA 1ACZA 5I8CA 4AEJA 3Q8CA 4N3UA 3FH8A 3T6QC 2OR8A 4DPNA 1TMF1 5E6UB 1UM5L 2WOYA 4J3OD 3ZKNC 5B1KA 4DN4L 3HBKA 4M8UA 2DTYA 1BHGA 3DEMA 1VHPA 2VC2L 3MJ9L 1D5IL 1Q43A 3ZTJH 2OXHA 4FPFA 2DLIA 5G4MA 3GZOA 3CCHB 2VW0A 4EPSA 4F7KA 2PO6B 4NCC2 4PGEA 4K5NA 4XODA 3UBXI 4JRYD 4MSWB 4E0RA 2VUKA 1UY2A 3RJQB 1KACB 1ZK9A 1KYFA 3CQFA 1A66A 2BX5A 4KK5D 4Q0QA 3R18A 3IDYB 3JV4B 2IH8A 5H35A 5HPOA 3IRCA 3HC3L 3CDZA 5DK0B 3L3KB 3ZRFC 1W6MA 1AC6A 3TJEL 5I1JL 4LDEB 1NCJA 2ICWI 1AHWC 1PX3A 2YAPA 5F8RC 1LHUA 2CBOA 2P9RA 3MACH 5IP4A 4ASKA 1GS7A 3ZN4A 1CF1A 5E8PB 3EJYD 1HXMA 2VUOA 4TUUA 3HFFA 5F7UA 5F37A 1A6ZA 1N18A 1E6JL 4R9CA 2X5IA 1RMFL 3UO8B 1MW0A 2FD6H 1NCQB 5D6DC 5DC0A 1WUVA 4BFEA 2ZWLT 1NIEA 2OA9A 2YEQA 3BGMB 3NCFB 1GYVA 4J3OF 3SBPA 3R7RA 2XUEA 4W9ZA 4DVRL 3TVMB 5ID1B 1FGNH 4P9ML 5ISZA 2OPWA 4XBQA 1KY7A 4YZ5A 2X0WA 2XV6B 1AXYA 1PG7H 4YXHH 3EOTH 3H9AA 4LOTA 4ZAKD 4NRMA 5FZEA 1PYWB 5LEJA 3D34A 1T3FB 1PTZA 1SMVA 1FH5L 4AAPA 3OR6B 4HK9A 4NIHA 2OTPA 4HJGB 2Z8WC 3FAXA 1YN6B 3C6SB 1CO1A 4L92A 2OXHB 1G9ML 1ZHNB 3PP3H 3ARRA 5ANMA 4JVAA 4LCUB 2BVPA 1HSBB 4OMCA 3V6FB 5JHDB 1FL5A 2JIXD 3HG3A 4H25B 5EA0H 1OL0A 1R0AL 3GB7A 1HWWA 3QXDA 3F2LA 5I1EL 3F01A 3EYUH 4IDJL 4PLKD 2YROA 3AFGA 2D5FA 3DX3A 5IK7A 2GVYA 1SFPA 1T7WA 3ULVF 1P1ZA 2GFBA 2VIRA 5BV6A 2F15A 4Y4KB 5F9WB 4CSPA 3P3YA 2QMKA 3D4CA 4KROD 3VG0L 4S2HA 1DQLH 2AXFA 4MA1B 4EIBA 2WS91 5TDPB 3TT3L 3QNZA 4UFLA 4YL4A 5L6YH 1U41A 2PO6C 2Z7ZA 4KAQH 2FH8A 5J6HA 1UZWA 2X89D 5C0JA 3NCEB 5J96B 2DMCA 4URAA 2YGNA 2VITB 4S1RL 1B0GB 1FMD2 1H3WM 3ZO0B 4XAAA 3R4RA 4JQVA 3CZKA 1AJOA 4MFHA 3PVBB 2YWYA 3NIGE 5I1GH 5M95B 4P9GA 2W46A 3DRTB 4ICWA 5FYKE 5L0QB 3EMRA 4DZBA 1TTAA 2YMXH 4NQXB 1GMIA 2AABL 1YYMH 3FB5A 3NW4A 2YD6A 4LR4A 1EO7A 3WN5B 3QCWA 4M3CF 1BFVH 4E4HA 1HSAB 4D8MA 1I8LC 3OKYA 1D4M3 1MWAB 1X7NA 4J8RB 3PUSA 3MCKA 4NHYA 1ZTXL 3EDFA 4NFBA 4AKPA 1LVEA 1U92B 5GZOA 4J23A 4ECNA 1PLBA 4QQOA 3G08A 3MLVH 3WUZA 3SB3A 4ASMB 5BV7L 4QRRB 4UW4A 3K81A 5TD4A 1SJEA 3EO0A 5CU5A 1QDOA 2JDZA 4ZFZB 4U1JA 1DFXA 4OGXL 1YMMB 3IFOB 5EEVA 1PNCA 2XNAB 3O3AB 5A3LA 3ELQA 2OL3H 3DVIA 5CN1A 4HIHA 4RFRB 2DURA 2W59A 4IKIA 1MNNA 4JO5A 2XRAL 3N36A 3ES1A 2ZAAA 4NFDA 1XYPA 4DVRH 3I6KB 4PJ9D 4PIRF 1GRWA 4BK4A 2BQPA 4LEEA 4AY0A 3BX7C 3ML9A 4PQXA 5DD3L 1CGVA 1JI2A 3R0NA 2ZUXA 3N42F 4AZ8A 4X4XB 3I54A 1YRKA 3GSNL 4Q4X3 1CDJA 4FQCL 4QKBA 1FLRL 3OPZL 4Q4Y3 2VDMH 4DZ8A 4BK5C 2H26B 1S2BA 4AI3A 1Y6NR 3SPVA 3QZBA 1NLBH 2FTAA 2ZKXA 1FZMB 5JYLA 1OH4A 3J8F3 3OKOA 4X9FA 4HEPG 1IKOP 2VTFA 1HYRC 4PP1C 4LRNH 4XCYB 3ZXKA 4ONFL 1PO13 1EO8H 4KGGA 4LU5H 2VBDA 1WVZA 2RS32 3FMGA 4IEWA 3APBA 1BD2D 3VJ6B 2JV6A 4PVBA 2NM1A 3EXLA 5FX3A 2HN7B 2RS33 2IFFH 5FY7A 2Z1PA 1HHJA 3IPFA 1CGYA 3N44F 5D2NB 4I7ZC 5IMMA 2VDQL 2YGVA 5FYJU 3H4FA 4PY7A 4Z07A 1MIEL 4IU2A 4P46A 4WY7H 4A7TA 4MXWH 1UZGA 3EFOA 1L9SA 4G8FA 3FUIA 4XXCC 2DAVA 2B9BA 3PUHA 2C9RA 3IEAA 1AZRA 1NGYA 1WAAF 1YN7A 4L4VE 1QFOA 4OD1L 4TS6A 5T5FL 2D7MA 4PLOB 4CEWB 1M05B 3UG4A 4KY1L 5DJXB 3IF1A 1S4CA 1BM3H 3V9EA 2N0KA 4RAHA 4V2WA 1IC0A 4YE4H 4AH2B 3PWPA 3TBVA 4FP2A 2MKWA 1SJHA 4K2UH 2WCSA 4M61B 2DTWA 4RZCB 2ADIA 3DDFA 5T3XL 5DA4A 1S3KH 4YHYB 2WQ4A 1SY6H 1FL3B 3WDXA 3MNZB 3PJNA 5DUML 1QTYT 3OGCB 3FU0A 1XNBA 4JUSA 3HHSB 2CQVA 3S2AA 2XQYG 2XBTA 4L1TA 1UYPA 3WJJC 4RZKA 1MFCL 1UWEH 1UY0A 4D0BB 2ZGKA 4YDJB 3O45B 3DPRC 1W2NA 3PVNA 4DXZA 1HEJC 3VTMA 5JOZA 1FV2A 4LKXA 3W38A 4LITA 2BFGA 5D71L 5IJDC 4JRYE 5J6GA 3WTTA 2XRAH 3T1FA 3OLGA 5C8JA 3B2XA 1C1FA 1RY7B 1K5JA 2OPKA 2DVGA 3U07A 1MVEA 5EP9A 3PJLA 5C8CB 4TTDC 4AVIA 1JZ8A 3Q2LA 3LF7A 5C9AA 1A6AA 4N9GB 3RJDA 3ZMEA 4WGVB 4YSQA 2AK1H 5ICXA 4BINA 1KCKA 1ULFA 1OQOA 1F3JB 4AEHL 1A4JA 1EPZA 4DS0A 4J4PD 3GSQB 1RJLA 5AOKA 1NMBL 4OCSH 1RZKC 4JG9A 4X9YA 1GV9A 1KRIA 5A7EA 4Z92B 5FY9A 1XU1A 3LFIA 2IC1A 2P80D 2KL6A 3HRZA 1RJZB 3HZYA 1GS8A 1V54B 4RHV3 1T4KA 1X4ZA 5IATA 4DIQA 1GMMA 5DJ2B 4FPGA 3C87A 1M3IA 2BPBA 1EXUA 1AD0B 5C9JA 3LIZL 1B6UA 2P42B 1FV1B 3QUXA 4FFZH 1AOZA 4JRYA 4ZW5A 1ZHKA 5K39B 2X29A 2VMGA 2FJFA 3D3VA 2F5BL 1TG7A 4AT6A 2TUNA 3LEYH 1W8EA 3RZJA 3DPDA 5EZJA 3GBNH 5H94B 1FE8H 3F7KA 5I73B 5GGQH 1JXDA 1OEZW 4YLCA 3KPNB 4X99A 4AJWA 3E6DA 2PR4H 1BA9A 3B01A 1YQ2A 4LPUA 1DBJH 3VUOA 2WYTA 1UOFA 4P99A 2CAUA 4DXSA 3RPKA 3OBZA 3U82B 5F44A 3RFRA 4ZG1A 4WVMB 1NJ9A 3VFNA 3BOPA 4FFYL 1P8JA 5HJ3B 4B8EA 4H1LA 4FHKA 3N9LA 2HCZX 1E2VA 2JCCF 2B0SL 3OPUA 3P0VH 1B0RB 4DN3L 2P48B 3UETA 1N5AA 1CD1A 5CZVH 2BMKB 2UY8A 3GBLA 1F18A 3HB3B 4XNZB 2DYPD 2VW1A 3PMEA 4RWYH 3HN5A 1HLCA 1IBYA 2H3KA 2CKNA 3CU7A 1RMFH 1IIIA 3MRHB 1W6OA 1EFQA 4LCCC 1S7TA 2NY6D 2QDVA 1R64A 3INUH 4QRPE 2I74A 5D72L 3UTSB 2GK0B 4P9MH 5F1IB 2EP6A 2J3SA 4BCXA 4CU6A 2X2YA 5IVNA 1WKYA 1AANA 1R5IA 4L4TA 5I6NA 3FCUB 2F7QA 4HXBH 4P9HL 4FZEH 1V70A 4L9LB 3VXRB 3ZPDA 4OUSA 3ELNA 1J1XH 1JRHL 1HAUA 1A7RL 2J56A 5C3RA 4WTZA 3UGHA 4P4KC 5B4NA 4LJHA 5DJ6B 3EF7A 1V0AA 2EDHA 1H3VA 1NT0A 5EZLB 2K6YA 2CUAA 4P59L 3ZDXB 4H20L 1IQDB 5CF3A 4IRSA 4N5UA 5BMFL 3R0MA 5I1EH 4XMLH 3I3EA 4UQ3B 3FX3A 2OXBA 5GJSL 3FAWA 3MLXL 3G08B 1KYOJ 4KRNA 2VXTH 4LNVA 1LE9B 1V6MA 3VKNA 5FF6A 1DBAH 4KNTA 1YECL 3OMZA 1TDQA 3MPCA 5F0LB 3UAAA 1Q9OA 4XI5D 4AYEC 1VESA 3RKPA 2DKMA 4HXCA 5FGSA 2Z93A 3WXWL 4XBNA 4EOWH 3TNNA 1KFGA 3OXSA 4FFZA 3EYOB 1Z0MA 1LNUB 4K3HA 1TCRA 5I26A 3B6SA 5H4YA 3U7YL 2DJ4A 4AIZB 4XETA 4EYUA 3VQ1C 4G6JL 4GMSH 1F4XH 2PW2B 3V5KB 2L8AA 4HAFA 4LLQB 4XBGA 1KBGL 2XG5A 1YQ5A 2WLIA 2Q6WA 3RA7L 4YSUA 3HI1B 4IGBD 5CCKH 3HPLA 3QXWA 3U14A 5CLXA 4AXWA 4N22A 1EV13 2BRRL 2VYRE 2FVNA 4XEZA 5JXHA 2BFVH 1P4BH 2OX5B 3U7AA 5ISZD 1O3RA 2QFEA 2NW2A 1NLRA 3F6LA 3QH3B 3K71B 4GKZA 3V0JA 1BYHA 1SYSA 3MBWB 1GKBA 1P4LA 2FGWL 1F0LA 1ZVYA 4L48A 1I1EA 2DD8H 1K2DB 4PJCF 2NUTA 3HRPA 4YGVA 2BRTA 2HKXA 2VN3A 3AT9A 4QU1A 5FZHA 1DUZA 1PY9A 3EYQD 1P1VA 3HC0B 1QUNA 1S7RB 3ILFA 43C9A 2RDRA 1QH7A 1LOBA 4DK5A 1PIGA 3TT1H 3V4UH 2ZEZA 4P9WA 1RSYA 4KROC 1RIUH 4ZTEA 2WBJB 2YMTA 4P2YA 6TAAA 4RR3C 3TEXA 1OIOA 1MCOL 2EUXA 4FFHA 4AGQA 5BRZE 4OJAA 5T1MA 4YHPA 1XIWB 3ABZA 2JI3A 3QZPA 3T0EE 4HGKC 4XPGH 2W1UA 4CZSA 3MZGB 1QXPA 1OURA 4QYOB 5FHBL 1AGEA 4Y20A 2NYYD 2ZXCA 3KPSE 4NNPH 5TE6H 4XAEA 5A7BA 4NZRH 2WUCH 1RUE3 2ET7A 1IKQA 3Q2CA 2J8UB 1E67A 1GW6A 3URFA 3VWJC 4HHGA 3C5ZD 3MV9B 5DUUA 5FIEA 3QIBC 2ZX2A 1BMGA 2YEVB 5CP3A 4LHQB 4Z23A 4CCNA 1A1OB 4HIXL 4Y9EA 5B1JC 1RJLB 2KYIA 4GXFA 4MMXC 1CQ9A 3GINA 4ELKB 1OLRA 1QRKA 5EOQH 3L3GB 1XGUA 4HJEA 2E53A 3MRMA 1DEEB 4YWAA 4KNQA 1AXTH 3Q1EA 4P59H 1WG3A 3ZE0E 4KZDH 3MNZA 2GEEA 4B4QA 4KWLA 3FFDB 4KJQC 1XH0A 4N8VG 3EGDB 5IBTH 5DUXA 3FO9B 2D40A 1I7UB 4Y4KC 5F9WC 4B95C 3APMA 1QSED 4LEOB 3VSUA 2QGBA 4DK6A 5FMBA 4E9YA 5H2BA 3FT9A 3LA3A 4Q4W1 1UCTA 2BHYA 3I2CH 5GS0C 1UKQA 3U0PA 3MLRL 4UV7L 1QR4A 3TF7C 2CDFB 3BCWA 3UV9A 1RUQL 1YHPA 3H2WA 4JRWA 4XHQA 2IIJA 1AXIB 2P34A 4M1CD 5GQBA 4ZODA 3RI5K 4XB8A 1G9BA 4FZ8L 4IU2B 1CGUA 1YI9A 3L9YA 5IMKB 1THAA 5AENA 2WTRA 2ZTBA 3IKCB 3RZCC 2TBVA 1GCFA 5F7MC 1JERA 2MHAB 2VABA 3BLPX 3VB8A 3MPBA 4KZEH 1U8HA 3BZ5A 3IRZA 1G6VK 1NCOA 1ORSB 4G7YH 4L1LA 4XVTL 5LDSA 1E8YA 1UZ8B 3F64A 2WKOF 4JFPB 4XI5C 3PWPB 5DWUL 4A7GA 2EIDA 3H55A 2QGEA 4ZPIA 4BLIA 4KHXH 1GZHA 1UGKA 1Z7S3 4BKLA 4XAKE 3SOBL 1N3OA 2OW4A 5IG7B 1W9XA 2WXMA 3P2BA 4UM9D 4MD0A 4FP8H 4LMQI 4QRQA 1FRGL 4XGZA 4GG6F 2ZCKH 2H8PB 1NC4A 3OKOB 4ODTH 3BWZA 2EDEA 2YGMA 4JFEB 1RIUL 4ZAKC 2BP5M 1HV0A 1VFAA 3I02B 1F6AA 3QFJE 3VNYA 3I2OA 1J1OL 4P4RB 1OA4A 4OF5A 5HHMD 2V5YA 3RX7A 2WVTA 4WGKA 1LO3L 4A04A 1D2PA 1OD3A 2O8OA 4AEDB 4G1EB 2P44B 3G5VB 4KJPD 4AYDC 2IVJA 3ML8A 3B2VL 3OGJA 2ZUUA 1FP5A 5FMDA 1YAIA 5BV7H 3STLB 1JE6A 4JO1H 5C4WB 3ZXFA 5DZOA 3MGUA 5FC9A 2P8MA 3VDAA 2E7DA 4IUGA 1RUML 3M07A 4NQDB 4OT1H 5DD5L 4JY5L 2BSSB 1CR9L 1NAMH 1S9VB 4MGYE 4NNXA 1RVF3 2WO4A 1XGYL 2VN4A 1GZPB 5BS0E 1UZVA 2QDNA 3WNMA 3HZKA 2W9XA 2V9QA 4L05A 4DRVA 3AG3B 3FO2A 5EO0A 5B7EA 4CDWC 1C5CL 2CR0A 4M01A 4HV8A 5IBLD 4JKLA 4KDVA 2QADB 1WFUA 4YO0A 2HG0A 4AVJA 3E6FB 2KBGA 3TL5A 5F3IA 4DPBX 4ANXA 2J8OA 1QRNE 3OKMB 1E27A 3S30A 2VL5A 2VR3A 3GMPB 1OOPC 3EHBB 2A71A 1D5ZA 4OYUA 1MCNA 4HS6A 4BUQA 1AR91 3O9WC 4P04A 2IQ9H 2WLYA 2CAVA 2WNVB 5C0GA 3WUWG 3G5ZB 3NFPB 3TJEH 4LIQE 3IJYB 5IHLB 3NFNA 2OI9C 2RALA 1VZIA 1Q9LB 4EBQH 5FYUA 4X7FC 4RCAA 4C56B 4C1XA 3DTDA 3ARPA 4PRNA 3OR6A 3SO3C 4CUGA 2ICEC 2VB5A 4XP1H 3HJEA 3T1FB 5C8JB 5GZCA 4WI2A 3LRSA 3MJ7B 2D6LX 2ROXA 3VWKB 1IC5H 3K1DA 3QNZB 4YFEA 5A7QA 1UACH 2OZ4L 2YRPA 1NCNA 4U3SA 4EF3A 3U1XA 3W82A 5EO1B 2KHAA 4RQPB 3VI4A 3MREB 4G8GA 4Z95H 2GFBB 4POZD 4PJHA 4ZT1A 1VLNA 1WIOA 4PUBH 2ZGMA 1K8IA 1GP5A 1DU3D 4NRYB 1JPEA 3TU6A 3PQYA 5G05L 3MMEB 1IKNC 3GPEA 4HBQA 2IPTL 1PKQA 2YXFA 4P9JA 3DKQA 1J7VR 5E23A 4ELMB 5J1TC 4A2MA 2A75A 2O72A 2OCJA 1E40A 1DF0A 3IU4L 1JNNL 2RR12 3PHMA 2V9TA 2H6PB 2Q7NA 2X4RB 1VAKA 1H1AA 2ID4A 5A32A 3UT0A 1G6RH 1FO0H 3OMAB 1TYRA 3P30L 5E2UH 3T0WA 4N0CD 1LJMA 4DP2X 1CG9A 3MIEA 1W0WB 4QKXB 2NCEA 4F91B 3SNMA 1SPDA 2P1YA 5AALA 1Z5HA 3S5YA 1UUNA 3WD5H 1NM9A 3ATGA 2C24A 3N41F 3IFNL 3OBAA 1MRFL 2IADA 3KDPB 1QNZH 3O6ML 4PI0A 3ROOA 1P9MC 1XNDA 4X8GA 3OF6A 5D7JC 1B4RA 1UZ0A 4U0RC 5FYKH 1TQUA 3GB7B 4RA0C 5C3TA 4OFVA 4APQC 5IVCA 4B7EA 3EZ8A 4YGAB 2GG1A 4XC3H 3DLQR 5I17B 1G8WA 2PA7A 1W72B 2VUCA 1XSQA 4LSPH 4C56D 4IGBA 4YGEA 1A6VH 2W5FA 1UEYA 1OWRM 1H8TB 2O1QA 2AV7B 1J1PH 1SVZA 3I2IA 1KCUH 4OM0L 2NYZA 1S7QA 4HIEA 5DUBB 4BBWA 1LEIB 1BYPA 4N2NA 4NZFA 3DSNB 3EHBD 1AXSA 1JNHA 3UZEA 3U0ZA 3OF6D 1S4IA 3VNZA 2P24B 5HGAB 1IMHC 4HCRL 1MIMH 2YA0A 3DXAA 1KUMA 4G7VH 3WNKA 4JFDA 4ARXA 2PMZA 3J27A 5CBEA 4BWWA 2UWBA 1FXZA 2N01B 4CKQA 1AG6A 4OJDH 1DO5A 5JPNC 1H4GA 1AYRA 1MCHA 3CNKA 1E65A 5FKAB 3VZLA 1R083 2VCMA 2Z42A 3NL1A 1QO3B 2G9KA 4Z7UE 4H55A 3OR7B 4OHZA 5E1AA 3WSOA 5HBAA 4PSPA 5I71B 1AHWA 1QBMH 2R7EA 3CXHK 3MW3A 3DV6B 5IB1A 1KZQA 4JFFE 3LEYL 4GWIA 1MR5A 3SH4A 5DZLA 4P3WA 4X7SH 4CMHB 3QUYD 2EH7H 1K5MC 3EXUA 3AY4A 3PL6C 1WW7A 1ASJ3 3NN8A 4YQXH 2R063 3CHPA 4FXKC 4BQCA 3PMSA 3UL2A 2R2HB 3VDDA 4YDKH 4OLUH 4K7JA 1OP5K 1MCOH 2C34A 3J7MA 1OVPA 5DT1H 4MG2A 2UWEA 2WGNB 3JWDC 5JHLL 3R6SA 1MI5B 1H6XA 5HHQA 5IUSA 5DHDA 3EFFB 3JTBA 4MCNA 5I1LB 3WV0A 5FXZA 3E5QA 1JF6A 5HDOA 5FYYA 1UH2A 1SLBA 4LAQL 3S5LB 4R9BA 4JZOA 3CFEB 4GRLB 2XWBA 5JA8B 2E32A 5CG9A 2XWBB 4GFTB 3MGOB 5CBEB 1V10A 3JWDH 5CLYA 4URTA 1BJ8A 4PTUA 3FTGA 4FEIA 2P17A 4CP9B 1Z1WA 2VOXA 4KXZI 4MB3A 1S7UA 4JFFA 4CSZA 1CD3G 3EH2A 1KJVB 3MCLL 3TZVA 2F1AA 5D7SL 4KU1A 5EZOL 4XN2A 4I9XA 5K59E 2B8OT 2VOVA 5APAA 4D7TA 1SLLA 5BNNC 2L4OA 2E9IA 4F57H 1N6QL 3AXLA 2VXVH 3JT2A 4G7SB 1PSKL 4PWKA 5JI7A 2OXGB 3ZQWA 2IH1B 5FA3B 5CFCA 3AUWB 4F7MB 1JZ5A 5EYYA 3N9PA 1U8NB 3FUDA 4IKKA 4MCYA 2Y1YA 5J57B 1RUG1 4GMTL 4C8DA 1DQTA 2R9HD 5HDBB 1AL22 4IXLA 2EEXA 3QEQB 2OMUA 4LCIL 2XUWA 3P4OA 4O4YL 3O7OA 1MELA 1MY5A 3BVUA 1QATA 4HWEH 2DQEL 5D2LA 1EV2E 5J13B 1BWMA 2RFXB 3UX9B 2WC2A 5CB7A 5A16B 4E8CA 1BZ8A 1OPGL 3B2UD 3UACA 1CFTA 2VMJA 3QDJD 3CN2A 4MCZA 5IZ7A 5DEFA 1VA9A 5LA9A 3ZVVA 3NAPC 1U8KA 3M46A 4PP2A 1JDCA 1NCBH 1OB1A 4XMIA 1SFDA 5C8CA 1WRFA 4JQIA 4QTFA 1AYN3 2CKBH 3H9YA 4M1GH 4DFHA 4O02L 5SWSE 2FNWA 2DMHA 4GWNA 4FFTA 4WY7L 5GSRA 3CHXA 4PJ8B 4NQCB 4DY5A 1DBBH 3WN6A 3NMEA 3DURB 4MXWB 1PGRB 3GSQA 2AXFB 3G5WA 4OFYD 2F17A 4AQAA 4P49A 1DEEA 5AVYB 5CZXD 4L0YA 1NFIB 1NFIA 3DO4A 4HA1A 2UYAA 3VWJD 3THTA 1PS3A 3ULSA 4NFCA 4NPJA 4OZFH 4BFIA 3IMUA 2A77H 4IMLA 5I1AA 3K2OA 7PCYA 3Q9OA 1ZLDA 4UFMA 3BSZA 4NZ8A 5DJZB 5CN3A 1BXUA 2X4UA 3PE9A 5D1QC 4I0WB 4HX1A 2QZ3A 3QIWD 2E9BA 1MPXA 2K8QA 5BO1H 1WZ1L 1IBHA 1NCTA 5GISL 3NVCA 5FYZA 4FFIA 3L3DB 2J1WA 4ZMVA 2ZX9A 3O8XA 1IS3A 5FAXA 4MS8D 1UPIA 5GGUB 2VLJE 3BO8A 4TRPH 1CLCA 2MTAA 4RSYA 1C5DB 2PHWA 2Y7MA 1JL8A 2VSDA 4UB0H 4AGNA 4X8CA 1WDAA 4YFLF 5I6XB 5D2LF 5F7WC 1KZYA 4A7GF 4D9QD 2O14A 4QGLA 2ZPKH 1S78C 3CTTA 5LASA 3WW3A 3MGTA 4OIIH 43CAA 5KUMA 2JFCA 5T3NA 3ZSEA 4GQ9H 2G5UA 4J1UB 5B1JA 4OBSA 3SGDH 1C5CH 1CFNB 3ZU8A 1RUH3 1ZHBA 5CBAB 4FA7B 3DJSA 3U6RA 3K51A 2Y6FA 3BDYL 4NNYB 4WI5A 4P5KB 3QIBA 4Z3JA 2ZX0A 5GALA 2PP9A 4LPVA 1N10A 3O3EB 3PCYA 4JBSA 3QUMA 5B3JE 5DHEA 1YEFL 1UX7A 1QFWH 3GWJA 1IJNA 4B60A 5DUWA 3PTRB 4BFRA 4AVSA 3CVHB 3X3GL 4DO0A 1DGWA 1ZKAA 3LVTA 4CW1B 1KIQB 2Y60A 5DZEA 1NMBH 4OCSL 5I6PA 4YVSC 1J3RA 1LQBC 4FQIL 3KEHA 4PB0H 4FFYH 3FTZA 4JZJB 3T2NH 3NV1A 5IQLA 2X4UB 4V1DE 2J8HA 1SF3A 2EDBA 4XF9A 5C0DB 2R0LH 1PEWA 2NNFA 4UTBH 4F7CA 5CCGE 4XHXA 1PQZB 4IDLA 5KSAC 4CEWC 1MW2A 3KAAA 1JK8B 4M8QB 4K8RB 2CJUL 4OJCA 2V2TB 3A47A 3OJDB 1S7XA 1BAFL 4MS6A 5EMYA 3P6BA 3WHTA 3MA9L 3AWFA 4KQ4H 5KG9B 4N2AA 1YEDA 2J4WH 5FPBA 1CBVH 4CP0A 2IVFC 4GWJA 2Q76A 4NQQA 3D6GA 5B22A 3SE3C 1WFOA 4PRAB 2TNFA 4WNQA 2LALA 2YPVL 4NAMA 5ESVA 5TGBA 5K7PA 5EPMA 5KVEE 1HRI2 1P7KB 4WFGE 2BV4A 4IGQA 3BMWA 3DX8B 6PAZA 1Z3GH 4HJJL 1EJ6A 4AC4A 3DX8A 1NAEA 2IBBA 3QIBB 4TVPE 3N9QA 1NCGA 4X4XA 2MPAL 4GO9A 4W81A 5IFHL 3ILRA 1FNLA 4FTSA 1VALA 1NFDE 2X53S 5ABZA 4IBVA 1O7VA 3G7TA 3QEHA 5E9DB 3DO7A 2JXAA 1J12A 3EYVA 4GRLA 1HH6A 2WLJA 4AWDA 1UYYA 1ONQB 3WGVB 4PS4L 3SGEI 4JKWA 4DT2A 5JXED 4LO9A 2J5WA 2D5HA 3LCPA 1TEYA 1QOOA 4NT6A 3UAJD 4NWTL 2WOBA 2N4IA 3V5DA 5D2AA 4PRDA 1AX1A 4O5LH 2FX9H 2Q8BL 1IO4C 4FMKA 1NCIA 3RMXA 1KTLA 5FKAA 3PDGA 2R4SH 3FFOA 5D7LB 3HMXA 4X4MA 1E42A 1ND2B 1MCIA 2AXGA 4O7XA 1INQA 1L9QA 4LLWB 4TUJA 2BNQA 3U36B 5CLWA 2KM2A 4YM3A 1HINH 3OHXB 4E9VA 4PJDF 1OAQH 3DHPA 5JO5B 3UP6A 1O7FA 1OFSA 4ZU7A 5ABJA 5AB0A 1BBT2 4HXBL 4P9HH 3BGAA 1AGBB 3AZVA 4X4ZA 2CBPA 4Q1PA 1J8SA 2Q76B 1CGPA 1U2YA 4OGYL 1FMD1 1QSEB 2DYRB 4P4KA 1JG9A 1W99A 3ULUC 4Q4EA 2OVUA 4XFHA 5CLZA 3MV01 2HLAB 3MYZA 3ECUA 3S3PA 4MVBC 1AXZA 2AJSL 4DAGL 1AYN1 3RTQB 3PIJA 1Z78A 2VC2H 2W0XA 4U1SB 3HKFA 2VKWA 1Z0HA 3OLIA 3X13B 3IMRA 4IKNA 4KI5D 2OSWA 1K4DA 1WD8A 1HHIB 2XVBA 1W90A 4GS7C 4LHJB 3SE4A 3ARGC 3CIAA 2BNRB 4FQLH 2P24A 3LKOA 2RDQA 3ZXJA 4PGZA 3EGSA 5IMKA 1PY4A 3D39A 1HQLA 2J8UA 1IGFH 3EJTA 1CJPA 3LQZB 4HUUB 4Q27A 2DQDL 1DR9A 1GWLA 4Y4HD 3TWCL 1Y1DA 3B9KC 2H9GA 3CFQA 5D2LE 3FLRA 2R1WB 3UCQA 3MGAA 1LEGB 1IBFA 4XRCA 3WAKA 3OG6B 3BC9A 3TP4A 3ZHKA 2OSYA 4WEMB 4KXZH 1F6FB 3US0A 4P5MB 5IQ9A 1NL0L 3N44B 4JO8A 4LSSL 5MP6L 1WBFA 4BHUA 2WIMA 4JDTL 1MWAA 3GJFK 5SWQB 5CLTA 4OGXH 3U1PA 4ADIA 3U2SA 3TN0A 5K4LA 4Y24A 3WDYA 5GGVY 5F8QC 1IIKA 4HKOA 4AUUA 1CLZL 3X11B 1OZUA 4LSVL 1YIFA 3ZQ9A 2Z4FA 1GJWA 3GJEA 2PP7A 1TJIL 2GN7A 3SEEA 1G7QA 2O5YL 3N7JA 4W70A 2RJ2A 3MLTB 3GLZA 4HFWB 1RSFA 2VMIA 4L8SA 4O2CA 1M7UA 4TSAH 5J12B 2GNBA 1NM4A 3PGFL 4E5XB 3FCSA 1S9WB 4OCXH 2WJ7A 1ND0A 4A6YA 3UGGA 1MAKA 4ANKA 3JWDL 4GRWF 2VZ3A 1VFBB 2FZ3B 4YBHA 2XJSA 2M83A 5E8OB 1XH2A 1R75A 2X3AA 5HHXH 2DS4A 4I9WD 3VG0H 2VCOA 2I9TA 3HG2A 1FG2B 2Y6SC 3GSRA 2F53D 4QO1B 4LRIC 5E5RB 2FBEA 1G9DA 4Y1TA 4BZ2H 5EC1B 3UXFA 3WUDA 4K7PY 3POHA 1WMXA 1EY2A 3JU9A 3AM8A 2RM22 1DUYB 4OZGA 4F1SA 3CZLA 4JFYA 2Y36L 3TA3D 3W5MA 3GXUB 5ECGA 4POYA 2RM21 2O1AA 5AOZA 3M3QA 2BNMA 4Z1PA 5CJ5A 3AP7A 3FUMA 3ARUA 3LZFL 1I8IB 4OD2B 4R2GB 1GQPA 4D7YA 3H8XA 3L3OA 2JELH 1MFEH 4G3YL 1SQ4A 1I7ZA 4QF1B 3W0WB 1ZZ9A 5C4WC 5D1QE 5BNOA 5DWUH 2BOLA 1GZPA 3LH2H 1N7MH 2C3VA 3NTCH 4GQRA 5D2LB 2EZ0C 4LLMB 4UM9B 5ANQA 3RJ2X 4UAOC 1T80A 3AACA 4KGJA 5CEZH 4MZ2A 1F9KA 3NJLA 4X7CC 3SD2A 3PWUB 4X8XA 2V17H 4DINB 3ZN6B 5KVGE 3C5JB 3QEUA 5JXAL 4ZY9A 3GLEA 4BZ1L 1IEHA 4XP4L 4P5YA 2CDEB 3Q1SH 4U2AA 3L48A 2JB6A 4OF0A 4H4NA 3RP1A 1TME3 4Z7VA 5FP9A 2P1BA 4NKDA 3FMGH 3BUBA 4K8RD 3I6KA 3NABH 2HWC3 3GHNA 1PLCA 4YPJA 1XL4A 3P0YH 1UXZA 1ID5I 2GY7B 5A6MA 1AX2A 3T0XA 4QPEA 1MZZA 1RL3A 2VZRA 1BYOA 1XTMA 2XJUA 5MENB 2CO6B 2RG4A 1MS4A 3V7AG 2ZT9C 4X5WB 2WQSA 2IXQB 5KYXA 3M8LA 2WQVA 5JOPE 1YQCA 4P9XA 4OQTH 5DR5L 5EZLA 2V3FA 1OBNA 4UFHA 4MLOA 1BJ1H 2BOIA 3VGEA 3L13A 2AEOA 4QD2A 4AENB 3GRGA 3UJTL 1LTEA 1RUI1 3TEWA 3M1BA 1UHVA 4WI3A 3V0AC 1OAJA 5C0DA 3ZUNC 4HW6A 4L9LA 3AMKA 3G6JA 4P3DA 3VXRA 1UKGA 5KYYB 3FFQA 4NSKA 4JFHE 3A6BH 1OUXA 2N7AA 3M70A 4YG0A 4N0UA 4XCBA 2XUMA 1H8TC 2KLRA 5BNPB 3CMOH 5DUPH 4PJXB 3ACFA 3WEOA 4TXWA 3DRQA 2W38A 1R9FA 2W39A 2QVIA 4YHYC 1W6OB 2YRBA 4M6OH 4FCHA 2WZPD 5B8CA 4HKWA 4QXVA 4RNRB 2FWOA 3VYNA 3ZDZE 2R56H 1KN4H 3CHQA 3TV8A 3HZKB 4GQ9L 5FO2A 4F7TA 1OLME 2APFA 5ESVB 2VDQH 2YPLA 2OULB 4MZIA 3EO6A 3N1QC 5EWSA 1DJWA 3VXRD 4GRLD 3IE4A 1KXVA 4G83A 3MBXH 4Z3HA 1KXQE 2FWUA 3O1VA 4JY5H 2YAEA 4XCEB 2BY2A 4ZO6A 2A9ML 1ZGLM 3TNQA 1VEPA 25C8L 1H8SA 1TLMA 1KLUA 3E8UH 3U4BH 5LJYH 1KF9B 5GS1B 3KYKL 1MEC1 4FNQA 5FZMA 1EAH1 4K7PL 5H9SA 4U49A 4OFQA 3C3VA 2IXJA 1MUJA 1PZ3A 3ZFGA 4KZCA 4RDQG 3L3HB 2IXIA 5HTSA 2XPYA 2LTNA 1XF4A 1RUJ2 1N5YH 2GAUA 1FE8L 1I9IH 1NE4A 1KXTA 5GRVL 3LIZA 3UJIL 1HHGA 3DARA 4Q4Y2 4IRSD 4CU8A 3ZFFB 1DBJL 4Q6IC 2ATKA 3SDXF 1SLXA 2WXPA 2HZHA 3DYOA 1RUAH 3H7BB 3ZZLA 3GRWL 3IS0X 2CUIA 4Z1VA 3PDOA 4OZFG 3EUDA 5AAWA 2B5IB 4A6YL 5IVZA 4PJFF 4PRNB 1WBYA 1YUHB 2DQUH 4XQDA 4KUCF 3MYXA 1ZZ8A 3IT8A 1KCLA 3WW4A 4WZFA 2X6AA 3QYCA 5I0VA 4R5XA 3BWAB 3WY4A 1W91A 2YAMA 1AGEB 2MNWA 4JO4L 5TDPA 4Y20B 2WD0A 3HMYA 3OWEA 4P5RA 5FR3A 2DCZA 3WAJA 1DVSA 1U8PA 2X4QB 2LABA 1NEZG 1BQHB 3CZJA 4M4RA 3H2PA 3PV6B 5D5MF 3CFNA 4F2MA 3BT0A 3OVUB 1Z3GL 4HJJH 2PAMA 3DUIA 4WFFD 1HRI1 4JQVC 5LDUA 3NZUA 4H5SB 1Q9KB 1NFAA 1GA2A 4M7ZC 2XH6A 3L9BA 5BRPA 4Q8KA 2WQ8A 4M03A 1UY1A 3HT2A 1DLLA 1S7SB 1QA9B 2PYFA 2VN7A 4FMFA 4HK8A 2CXKA 1HIML 5HD8C 3CGTA 4OLLA 1NC2A 2A9AA 2DI9A 2WN2A 1E4KA 1NOFA 1XCTB 1CDUA 2HTLD 2VTXA 4IEVA 4LP8A 1OCWL 4I85A 2ZCHH 5FM5M 2ATKB 4YZ2A 4FAGA 4WFEE 3HS0C 1GANA 1BXVA 3BN3B 5C86A 2J1ZA 3CZUA 1G9FA 3VWJB 4AVHA 1S0EA 4NO5A 1XNAA 3RGBA 4LBQB 4W8JA 1HKLL 2HN7A 3HI5H 4WKZB 3J8F7 4N8VA 4X7DC 1OW0C 3UTPD 2NXZD 4YHZH 1FNAA 2AJZB 2ZSWB 1FGVH 3F6JA 2FDKA 4XXDA 2Z7UA 2OXGA 4ORFA 4Q4W3 1TQ5A 3RWDB 1H1IA 1U21A 1W6PB 4JFEA 3B9IA 4FP3A 5FZ3A 1L7QA 3G5XA 3QW9A 3OHXC 4FJ6A 4JMNA 4IEOA 1CIDA 4NOFA 2NXYB 1IGML 3HUJF 1CC3A 4PHXA 3C5ZA 4GKYA 3D30A 3ZFEA 5I66A 2DB8A 1CXHA 4I5BA 1WT5A 2WKGA 3D4GA 4OW6A 4ENEC 5ENWA 1ZVFA 2QCSB 4U1MA 2FMDA 3HB3D 3U7WH 1TNRA 1UD6A 5JOYA 3JUZA 1NTDA 3R4DB 2K6WA 1GZCA 1BM3L 2YZ4A 2GQHA 3RGHA 3ILPB 2WV3A 4X4YB 1NBYB 3KYAA 4PEEA 2CZNA 2IH3A 5EF3A 3NSCA 5FQ0A 3V5DB 3FQNB 4C0BA 4IKJA 1N67A 3RL2A 1HIXA 2WZR3 5HYSG 1A4KA 3LIUA 3Q3GA 3TJHC 5E1GA 2H2SC 2XPJA 1CL7L 1KJ2A 2R4RH 1W2AX 1SDAB 1YWKA 4PLKC 2EDDA 5KSVB 3LH8A 3CN3A 3ETBF 1IGCL 5LEKA 1JN6A 2R062 3OPZA 4GQPH 4C91A 1DDHA 2BIMA 2G0LA 1C7SA 2GAZA 2N59A 3EO9L 1JHJA 1HK6A 3SKMA 2J44A 4KO5A 1AP2B 2E8ZA 3SKJL 1POQA 4OLVH 4MOAA 1QUPA 2NY0D 5DRXA 2NY7L 4MB1A 5JHLA 4ZPTA 1UD3A 4XXAA 3KYOA 1JZEA 3CFUA 3IDNA 4KO9A 5AW0B 3BZ4B 3SDAA 2BNUB 2YBRB 4WI7A 4MHRA 2YSSB 3VFRA 4UAOB 4WEEA 3FWEA 5HYSB 3L5XH 5FYKU 2CCWA 2WXFA 3US9A 2W07B 1FGNL 3OPZH 4L3EA 2V37A 2Y5QA 2X6CA 2EDQA 3QUZD 4ZSOE 5ES4B 5FECB 3FCGA 2CIIA 2LW8A 2D7TH 4AVTA 2NY4C 2PYEE 5JR1L 1NUKA 4A6YB 1M6OA 1RL1A 4XN4A 3B7UX 2RAMA 2BVVA 1V3JA 2BS71 2DBJA 3MV9A 1G43A 4QRQB 3L17A 3GF8A 4P2RE 4XGZB 1TQWA 3GSVB 3W9EB 3C7GA 1G9CA 4FTDA 5L4FA 3ZKND 2QADD 4FLSA 3CH1A 4Z5RA 5KTEH 4Q4X1 2DJMA 5EEUA 3QCUH 2WNGA 4O4YH 4LLVA 1LD9B 1IKFH 1YQVH 2CV6A 3AP4A 1BBT1 2NTFA 1K3IA 3SPIA 4XN9A 5I75B 4XJ8A 1UWFA 3I3BA 5I6LA 1JDDA 3O3EA 3UP1A 2V3EA 3IGLA 2DM3A 2ESVA 2QR0A 4O58H 4BFJA 2B42B 3AJYA 5FK8A 4RX4A 2RS31 3CVDA 1A65A 2W88A 4YZFF 3F7RA 4JHVA 4NQDD 3WJMB 1BF5A 1XD1A 4TMPA 3FN9A 5FKCA 4G6KH 2BCKB 3AG2B 3G5YA 3KCPB 4MWFA 5I8SA 1UB6B 4JFDE 4LUKA 1S7RA 2FL5B 4NRQA 3PHQA 3LNGA 4OJFL 1DQQA 1SN5A 3MN8A 3QJXA 4KK8C 4DEUA 3X14B 5LGKA 1WV7T 1KCVH 2FGWH 2V5TA 2PYEA 2QDWA 4BDVA 4MUVA 5FGCB 4NBZB 4XXPA 4NO0B 5DD1H 4LVNB 3SJVB 4KZEL 4AMKH 2VQUA 1IFHH 1R46A 1C08B 3J9SA 2VR4A 3PWPD 1BIIB 3MRDA 4Y7OC 4A2UA 2IGFL 3R06A 4FQXC 1OCCB 2UZYA 4QOKE 3JWNH 2DJUA 2ZG1A 1I3UA 3RY5A 3X3FL 5T54A 1KB5H 1ZLVH 4OHWA 1AR73 4Z7VF 4ONGL 3IGKA 3I2GA 3NEEA 4WO4D 4NPRA 4AEMA 4F5CA 2EVGA 5GRWA 1Q1JL 4PS8A 5DLMH 1G0XA 3ECVA 2RS11 4QRUA 4YSOA 5DQ9A 1T0MB 1T0MA 2WLLB 3LPPA 4BYHA 5CIPH 4KUZL 3RVXD 1WO2A 1A1OA 3OJVC 5ICUA 4FPCA 5EFIB 3UG3A 4G9FD 2WQXA 2I7OA 3KHBA 1RC6A 1IG3A 1WFNA 3DVGB 2J6EH 2A83B 4RFEA 4YK4B 5D1XD 5FKPA 5LQBH 3T08A 3CLEH 4CGUB 3LKSB 1HSBA 4J7RA 4WZ9A 2YAFA 1VFOA 2CO3A 2L3BA 4IRSB 1IAKB 4G8GE 1QLEH 4J2XA 1CICB 3QUXD 4Z9KB 3IJ9A 1UJ3C 5EOQL 3KDMA 1TG8A 1Q72L 3VD4A 2AS5M 1MPAL 3KXFD 3KXFE 4NUJA 1AR81 3WP5A 3PQYE 4X5LA 3HE7C 3R4UA 2WBWB 4PJ5E 5DD3H 3HZMA 4Z8BA 5T5JA 2K46A 1T0OA 1YEFH 2CTVA 4JPWL 2XXMB 4EI6A 1PAZA 2VLRB 4HWNA 4B7IA 2P6HA 3GSUB 3PQYB 2P5EA 4JQRA 4HMCA 4APXA 4M6OL 4XOEA 4LL9A 3KEDA 4LLQA 1S0CA 4J3OG 1G9NL 1DBKH 4G9FE 5E9NA 4W65A 1CN4A 3E2HC 3EH3B 1RUKL 3GTVA 3VRIA 1JPSL 3KB5A 2A0LD 3WS6A 3I2DA 2NCMA 5GSVA 1DVXA 2WIIA 5JOPD 1N8ZB 2X12A 1CIYA 3WTWA 1ITBB 2C0ZA 5FZFA 4PJ7A 3FQTB 2Q9OA 4AYSA 1DQ0A 4GH4A 3OGVA 2IOMA 4RISH 1FAKT 1WF5A 2XZQH 1OFNA 2Q86B 1SPPA 3WOVA 3CDCA 5MEOB 2VNCA 2DRUA 1JOJA 5IEKA 4I3SL 3ACHA 3LKOB 5CEYB 2H26A 3HVNA 3P9LA 1A9BB 1KBBA 5AG8A 1EK3A 1MLBA 4ODSH 3HI1A 3S7GA 3TX4A 4APQD 3T6VA 2D44A 1CS6A 1O7DC 3FTGB 4M0NA 1Y9MA 3PGCA 2ZACA 4AENA 1VZGA 4G11A 1JWUB 3U6XS 4F2ME 3Q3GB 2JLPA 3KZ8A 1OP9A 3TA3B 4M3CB 4J3WA 1HCYA 2J55A 1IRAY 2GIXA 1IFHL 3T3ME 1Q9OB 1FRGH 1G7MB 1O3SA 3IWZA 3MLWH 3C6EA 1M1XB 2FX7L 3HG1A 5FDWB 3NH7L 2IH1A 1AR1C 1XF3A 4X7TA 4P5TB 3T30A 4NZTL 1YEJH 3MRIB 3FFCD 1RP9A 2ZWSA 4N2MA 4RNRA 1GGBH 2R2HA 4HAGA 5F96H 3FBQA 5DLLA 5AG9A 1N1YA 4HN0A 4ZKTB 4AQTA 4YW5A 5HHOD 5FYSA 5SWZB 1IFGA 1U3YA 2UY6B 3KPRB 3L7FA 2YU2A 3ULUF 4TSBH 1SUJA 4F27A 2F54E 4H40A 1MVQA 5A16A 1PK6C 2BFUS 1G6RL 1O9ZA 3P11L 4ABVA 4AZZA 3BW9A 4TVPL 5DA0B 2BNOA 4DCQB 5TK4A 5DRWB 3HG1E 5EV7A 5HHPB 3MFCA 4HMEA 5E8NA 2FCVA 3KT7A 3ILEA 1BAWA 4Q2FA 4KBBA 4R7LA 3P3PA 2RQ8A 3FLPA 3W9DA 4OCYH 4B9JA 2YUXA 4Z76B 4AJYV 1OCOB 4OLZL 1U8MA 3MYJA 3VD1A 2AEZA 4LARL 2JEMA 1V00A 1NEUA 3NNMA 1XZ0B 3QWNA 2MSPA 2LQRA 4EOWL 4JFED 3RVWD 1SJMA 2AW2A 4QAMB 1ACXA 3VQ2C 2DWEB 2O6FA 4UILL 3HNSH 2OP4H 4LK4A 1N1SA 4MLIA 1ODNA 2CBQA 2OS2A 3HE6B 4BU2A 3CC5A 5FGBC 1N3QA 2A6KB 4ZZFA 1KJ3L 4G9SB 3IXTB 4M5ZH 3H3LA 3CHSA 1BYNA 1NCAL 2C9VA 1BEYL 2WO7A 1JI6A 1IU1A 2WXOA 1KCSH 2HWZH 3NJXA 5JOWA 2FIRT 1W72A 4FLRA 2Y8KA 4KDTA 1W72L 2G3MA 3IETA 1ESOA 4CC1A 2AYHA 1J8HE 2BSED 3NIFB 3PV6A 5IYYA 1DDLA 1BQUA 2E47A 2QEJA 4CDWB 1J05A 2WP3T 1F3JA 1DZTA 4JPKL 1FPN3 4ZOBA 2A4EA 2BP6A 2R32A 3GBML 3HBPA 3D0LB 3BRDA 4FD0A 4OQ8A 4QXGL 1T89A 2ZSVA 2K1MA 5FFGA 3GS4A 1NLQA 4CXWA 4JFQB 5EIVA 5EJ3A 1GOFA 2XA3A 3B34A 2QQPA 3UO1L 3IGAA 2NLRA 2HEWF 1K5NB 3PY9A 2Z9TA 4O51B 5I74C 1FNYA 1BFOA 1KGUA 1IC7H 3NNLA 5DJZA 4LEOA 5D7IF 1UMIA 4XH2B 2GMMA 1QFHA 3FU9A 1CI5A 3AMMA 3N50A 4QRPB 3BEVA 3BPNC 3IMVA 2WBKA 3OZKA 3MTRA 4OV6F 3TWCH 2PLV3 1E6OL 5C0BE 1R47A 2D93A 3EH5B 3FB5B 2VBBA 4L9DA 4DZGA 1EO8L 5KWRA 4XDPA 1ZHNA 5E9DE 4H0GA 2NYYA 3EBGA 4JPIA 4P2CG 5F7EL 4JG1H 3HJRA 3PHAA 5CWSA 3MUGB 3REVA 5MEPA 3VXSA 3C60C 1PD6A 1R3KA 3DETD 4JDZA 4UTAH 1DLHB 2NDFA 5E00B 1HCFX 4N2CA 5HDLA 1NUDA 4Q0VA 3Q6FB 4FKHA 2XQBL 1B6DA 1KYAA 4ACTA 1OY3B 5IVXF 5J11C 4LSVH 4A66A 3P54A 3K5RA 5BNPA 5KVMC 1RK1B 1A14H 1IC1A 4GRWE 2VERN 5EB9A 3S96A 4R4FL 5IGXL 2HYKA 1QX1A 4LTAA 4CPBD 2YC4A 4UV7H 3WDUA 5EDXA 3U37A 5GJSH 4OF6A 2QNKA 4Q0XH 3TEZA 3FOMB 4XCEA 4A1RA 1UQSA 3CVHL 4X80H 4EDWL 1EXHA 1MQKL 2EXIA 3MLUH 4MQ7B 3WELA 2CJUH 3VBOB 1QEXA 4DHLA 1RUNA 5F0JB 4GMTH 1QXJA 4V33A 4GSDL 3O8XD 4CGTA 5HYJD 1OP3K 2XN0A 4AKQA 3GXIA 3ZMNA 4PJBB 4JCKA 1CLVA 4Q4V2 4EZKA 4JFXA 5FBZA 2FL5A 1PG7L 4YXHL 4YHZL 4UMGA 2WNVA 4TPRH 3BI9X 2BSSA 3ZFFA 5A6ZA 5TSWA 5ANME 1QBML 3RX9A 1JOBA 3M1BB 4FTEA 1P6WA 2GI7A 5SV3A 1OD9A 2VDOB 5DPNA 1G9MH 3VI3F 1X5KA 4Y2DD 4OI8A 3MPPG 3RY6C 2P5PA 1YY9C 5JUEL 4PJHB 1GY2A 4DKEH 4DTGH 2OMWB 4XPFL 4M48H 3MOAH 2AJ3B 5F1NA 3DBSA 3B6SB 5JPMA 1A7PH 4G6MH 1LNUA 4KC3B 4KJQD 3S97C 3QQXA 4HGWB 3MZHA 1S3KL 2FJUB 1GAFH 1KIPB 1OAYL 2RHEA 4KJPC 4LDOB 5BQ7A 1H3TA 3U78A 3MFFA 2DKSA 1YXWA 5FZBA 5FPVA 1QJX2 3V8CA 3TNPB 3ILQD 4PJ7F 1VBE2 5C0BA 2CU9A 1D2QA 4ZRGA 3VBOA 3BKCH 1FZOA 4XHJC 4YM0A 4KQ3L 4YX2L 1JK8A 4M8QA 5C0FA 4GB32 4HBNA 1WZ1H 4N43C 5CGYC 2EIGA 3BVTA 4Y5XA 2F6BA 3ULUH 2VDMB 3TESA 4ZU4A 4ILDA 1T83C 4Z3TA 4N6RA 1EAH2 4JQTA 5A7OA 3O6MH 1E2WA 1HX0A 3FCTB 2EIEA 4KKAD 4RGNB 1JZ4A 4XBMA 1W0WA 2L04A 2ADYA 2KZBA 1C7TA 2A9MH 4PV9A 2F8XC 4XVHA 5ANNA 4WJG3 1RHI1 1RH8A 1MRCH 4PI2A 2G3ZA 2DVAA 4DO6A 1SOXA 3R1GL 4AQ1C 1GJUA 4FA8A 4DXTA 1JFHA 1U2CA 4N8PA 5KANI 1ZOXA 2MNGA 3FQXB 1TO5A 2EDYA 5A40E 2PHRA 5D7JB 5LNEA 1JPTL 2FIKA 1XF3B 5BUGA 2EVHA 2WNUB 5EPAA 4WI0B 3B7MA 1KIPA 5IVBA 3EYSH 4KK9D 5LY1A 1NINA 4X4ME 3WLWC 3FHIB 3MNVA 3QSKB 5DZPA 2I85A 3GXTA 4IGBB 4NWUH 5L9DH 4U05A 2PUQT 4YE0A 3VBUB 3KJ4C 4QPIC 4U1HA 5IW1B 4ANWA 4V2VA 1RFDL 4Q7DA 2QFPA 3D69B 4Z7WA 4QGNA 4LSUH 2DBIA 3DBXB 2W52A 4HKJB 3SE9L 4AGRA 2ZGRA 2WAAA 3MLZH 3S3SA 2G9FA 3WOGA 1XGUB 2MQCA 4G43A 1IGJA 1ILUA 3HFML 2Z92B 4I8DA 1IKFL 3GBNL 3FCSB 3V6BR 1D0GA 2A99A 3ARED 4Y88A 4X6RB 1D5BA 2VMEA 2H0PA 4OM1H 2ICES 1KIRB 4Y4RA 1NGWB 4U2ZA 1LGBA 4QHBA 1KIRA 2I26N 2QV4A 4KI5E 3D2UD 4OAWA 1XGTA 4Y1ZA 5IW0A 3TBYB 3FO9A 2JE7A 4GP5B 1SLAA 2CGRH 5FY5A 5KEZA 2HLEA 4FT8A 1JGDB 2APBA 4WK2B 4FNUA 4FQ1L 4HUMB 1XIWA 4X98B 1PX4A 2Q0ZX 3KPRD 1ZLWK 2DTMH 2B0SH 2QPUA 4AFMA 2UXTA 5GGVL 2QUOA 1L0PA 1L6ZA 3PWLB 4RD7A 1G9NC 3DI3B 1AZCA 1TTBA 2G3NA 4FF9A 4G9DB 4I48A 2C9KA 3TBCA 3V7MA 2R043 1HN0A 1T6VN 3QDME 1U8PB 2X4QA 4R97B 1NIBA 3ZE2B 5C97A 5TDNB 4XT1C 2JIGA 4ZHNA 2X1PA 1YPZE 4KTEL 3ABLB 3K8MA 1A9VA 4E9QA 2OW6A 1WISA 2IPUG 2GNDA 1V6OA 1EEYB 5EO9A 4F37F 4QPWA 1MCJA 1CONA 3O9WB 1FGVL 2YQGA 2QPSA 5LG6A 1LODA 2DUOA 3WE6B 3ZTDC 2R1XB 3HBGA 1F3DH 1X7QA 4K8RC 5TDOB 5AVXB 3U83A 4CN4A 1H0BA 4AHWA 4JO1L 1MFVA 4BJLA 4BFNA 4KH2A 1WS8A 4I3RH 4TXVB 4NDMA 1VBA2 3EGDA 1DQKA 4MAUH 2HFFA 4JK0D 2R1DA 2PCPA 2XV2A 4COZA 4K5LA 1KTLB 4MCYB 4UI9L 4PW4A 4FX5A 2EDMA 3QO1B 4YUEH 1DFBH 4KKLC 3U0TA 2XXFA 4ZMPA 5E6HA 1S9XB 5F7DB 2K4WA 3HHRB 4LE3A 1JVKA 2Y0SA 2QE3A 1E8WA 3VG9C 5LRRA 4FPHA 1JPTH 4YZ4A 3ISWA 2ARAA 3SC7X 1FZKA 5I0RA 5JWPA 2E59A 1R1ZA 2GTZB 2AENA 4YVWA 3VWKD 3RNSA 3UERA 2B3RA 3EYSL 3K0WA 3OGOE 5I6XC 1T1XA 1KT2A 2PCXA 2VGDA 3OZ9H 4EZ4A 3CMGA 2D97A 4Y4HA 1ZLEA 2A5UA 4Z7WE 5I16B 2WMPB 4FQQB 3RPIA 3SCMB 1M42A 1JNLH 1CJDA 1YN7B 2DQIH 3WFZA 4QRRD 2NY2B 2AQNA 3CVCA 3OSVA 4P48A 4F8TA 4F93B 4X6CB 4NNPL 4HS3B 5TE6L 2ZWZA 4DQAA 4U6XB 5A2BA 2GC2A 3FOLA 1IZKA 2NLJA 4UT5A 3F62A 5FUOL 2CMRL 3RHWK 1VIWB 1W8HA 2X2JA 1IGMH 1VIWA 3FHAA 1L7RA 2ID5A 3UYRL 3A0NA 5ACLA 1A6TB 2IDTA 3VU1A 4PJAA 5E8DL 2CCLA 2XU9A 5C70A 5IVJA 2EA7A 1H3PL 3H9ZA 3RRDA 2J1AA 4F7TB 4KK6D 1RUJ3 2GKIA 5KVDL 3HTLX 4CSTA 4XX1G 3V4LA 1TVHA 2FEEI 3TFKC 3OKEB 2WVVB 1TVHB 4QLRA 4JQXA 3ZT5A 2PHDA 5AL0A 3WIIL 1X5HA 3T04D 5IHHA 2QTEA 1GPOH 3WNXA 4BZYA 4NWTH 2ZGUA 4HZFA 4TUKL 4YC2C 4Z7OB 2A6DB 2BOBA 3ARFA 2V2XB 3OTFA 5JLVA 2YSTA 3UJQA 3VH8A 1NA1A 4LVNC 1BQHG 2QSVA 3P73A 4UINH 1R5VA 5FO9A 2JB6B 5J1SC 3IU4H 4K3JH 5FK9B 3V0IA 2YY1A 2VLJA 5D9SB 4BKTC 4V1PA 2G0KA 3C60A 3F5WB 4TUOA 4U1KB 3DC0A 1QSFB 4NIKB 1OP5H 1VSCA 1CL7I 1EDHA 4U1LA 3FOLB 5ISLA 1VF5C 5TPWH 3KE0A 4MKTA 1DVTA 1IAMA 5F0MB 3VXSD 4LOSA 1JXNA 4KRPC 4BCUA 4ZMZA 1C5DA 3BDXA 4J12A 2R8SL 4HIHB 4MJID 3MBED 4N53B 2O5XL 4PJXF 5IV2B 3GRWA 4Z0BH 4Z8FH 1H30A 1KJLA 3VBFB 4YFZA 3LOWA 3KVAA 4NQVB 3I50L 3VQLA 3TAYA 2PCFA 3GCXA 5E1QA 1MKFA 4AYFB 3M3IA 2OYMA 1EXUB 1EP0A 2YQ3A 4POUB 2QJVA 4ORGB 4J1UA 4NQEB 3LA2A 4LLOA 4CTEA 5D7HA 4A6YH 5FZDA 4Y9CA 5T5FH 3NCYP 4KKLD 4NEHB 2OKMA 4D7PA 3BEVB 32C2A 2B15A 2YK1L 1D5RA 1JF1A 3IDGB 2BIOA 5AAMA 1F1AA 2WLKA 2V2TA 1KBWA 4P5MA 5IQ9B 5CHNB 3MO1A 3WNNA 4FOYA 4IESA 5D1XC 5AVQB 1QPPA 2CG9X 4Q4W2 3ZO9A 2GJ6B 1U2HA 3TTSA 4XFIA 3WLUA 4H8QA 4GKNA 5FYKD 5A1LA 5DZFA 3FF8A 2NY4D 2GY5A 1RHI2 2H1LM 3QUZB 1S0DA 3SITA 2RS53 1S6NA 5HJDA 3VZMA 5GRXG 2IALA 2M26A 1CD1B 5KANG 2F18A 4YHMH 2WNUC 4IE5A 1S5HB 4LFHD 1KWKA 1TTFA 4WTXA 5BNQA 1MRDH 3IDJA 3IN2A 1NGPH 1FYHB 3FQRB 1F31A 5FFOC 3V5KA 2P5BA 3V0VA 1K42A 1U58A 1I1AA 1WQVT 5FGBA 4K71B 4JJOA 5BO1L 5KVDH 1GXEA 5T1LD 1R0AH 1SG3A 3MRBB 3C7HA 4OI4A 5I6MA 4L0PB 5FP3A 4Z7UA 4HIJB 3IB3A 2ZOWA 5CP3H 2DU1A 5HDQL 4UZUA 5L9BA 3L5JA 4LB8A 5EWIH 4UV4H 3MBEB 3LE0A 2WO2B 1A0QL 1FVCB 1KGXA 2GYSA 3ORJA 4C59B 1H0DA 4I13B 3EQEA 3WF4A 2C5DC 4FAHA 5KOMC 3QYNA 1D9KA 2R073 5KBKA 1NDMB 3NP4A 2D6OX 4R83A 1PG7W 5EG6C 1CE1L 3WFCL 3WIHH 4F8PA 1HB3A 1S55A 4W6WB 3A67L 3ESPA 4XC9A 5CJBA 4UZSA 5EUKB 3ZYOA 1ZDSA 4Z3GA 3X12B 4CN1A 3FYIB 4KI5C 4LT7A 4UF0A 3ARSA 4XHBA 5JPNB 1F2XK 3WUWB 5CEHA 5A70A 4BQ8A 3NDZE 5IFJB 1E28A 2DQTH 3L08A 2YYOA 1T1WB 3C8HA 2HT4D 2IQAB 2CHZA 2EEAA 5E6IA 3WDVA 4D7BA 3H56A 2FATL 2P80A 2XZAL 3MJ9A 5D7IE 1OK8A 2DWXA 1BLNA 5B1CA 1TCRB 3VHRA 2F61A 1PW3A 1KULA 3D07A 5DEGA 4E27A 4GKLA 4CVWA 1SCRA 1KWGA 1TZHA 4N0YH 5C9AB 4R7NA 4FSJA 1BQRA 5JHDE 1A14L 4Y4FB 2EXHA 2XR4A 5JCTA 5KHIA 5DS2A 1RXGA 3Q8BA 2WS92