4ES8A

Crystal structure of the adhesin domain of epf from streptococcus pyogenes in p212121
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
302
structure length
302
Chain Sequence
EELPDDLMNFKGTWEVSADGSSGRFFSKGATDSYVFHLIPAKDVKKPGWREHNEVKDSYIKIDKQSIAARYKTSTTAPYSVAFKVNTKSLIKDHDYKITFEQGQIASGITVDYRIGSAFNKTTDDSFKISDESKYASNVKIEGEEQGFKQREQGDKTISFRTLKEGPMSLVLLSKVEKKPQGDLDVEFKNLKIIDVTNPSQLDKGVAYVGNKNVQLTLKSDDGRTNFEGDEISLFNSRGELLQTVTVTKDQQNPISITLSEDQAKSLKNKEKLKVSIKQKQSKKTSKDFFFEVGIDPKVEAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epf
publication title The Extracellular Protein Factor Epf from Streptococcus pyogenes Is a Cell Surface Adhesin That Binds to Cells through an N-terminal Domain Containing a Carbohydrate-binding Module.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
total genus 80
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4es8A02
2.60.120.1240 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4es8A01
4ES9A 4ES8A
chains in the Genus database with same CATH superfamily
5FZOA 3ZUNC 2AV7A 3T0EA 3BEVB 4WTQA 3E5XA 3S4SB 2APSA 3HRZB 3N5AA 3QEGL 2AGSA 4A3ZA 3RB5A 2ENYA 1L9TA 3QNXB 5HI3D 1XNTA 1OGTB 3POYA 2WGNB 3H55A 4JFPB 1H1MA 4Q27A 5FYJU 1PZCA 5C7ZA 1Z9SA 5DD5H 3L7EA 5CFDC 4XI5C 2RR11 4YYOA 1NFKA 3U2JA 1WCUA 1JWMB 3FO2B 1MQTA 2JKWA 4CP9A 4FJZA 2MFNA 3L5WA 3KPOA 4PJGB 2JH2A 4XCEB 1BEV1 1GRWA 1UOGA 1RJYA 4CSWA 4KMTL 2YZ4A 3NQIA 5FA3A 4IMKA 4NHCL 5GGUB 5LGHL 3OAUL 4FQLH 1X5ZA 3TN0D 1S9WB 1SBSL 4Y5VB 3E38A 5EQUA 1VRSA 1S2BA 1E4XI 4PLKD 3NSFA 4QAWA 3FYEB 3RWDA 3TEXA 1UEYA 3L3IA 4JFED 1YQ5A 3UESA 2WKLA 3VL9A 1XF5A 3WF4A 1C12A 3AS0A 3CFQA 3HG1D 2V7NB 3KLSA 3NAPC 3N7KA 2OSXA 5AYUH 5KVEL 4R97B 3SE8H 4MYWB 3Q44A 3H1MA 4N2BA 3L08A 1O5UA 2W1QA 2PF6A 3DJTA 2X6BA 4FG2A 3UP6A 1H5BC 1QNWA 3FPYA 1KIPA 1DBKL 3GMLB 3X17A 1RVFH 1G7IA 2CU9A 2AZUA 1D5ZA 2NW3A 4EVNB 4OLEA 5CJXA 3OD0A 2XT1B 3D9AL 4DZ8B 4Y4KB 5T3ZH 4G80B 2C1FA 2G4GA 2AKRB 4U1JB 5ANQA 4PH8A 1W9SA 5T1DH 1G7PB 5LY2A 1OSZA 4ELME 5EOTB 1C8NA 1OY3B 1URIA 4GQZA 5T3XE 1J5OL 1NE4A 4A2HA 3K3NA 3FUIA 1RUAL 3LRSA 1N5AB 5CEZD 4MAYC 5I71C 3EGXB 3N43B 2GITB 4PR5B 4JO1L 3GMOB 1E5SA 3IB3A 1QG3A 4YM2A 1FMD2 1T1ZB 1TZGH 5KVFH 2PYFA 1WA1X 2CHWA 5ALCL 5DWUL 4K40A 5FAXA 2EDFA 4KK6D 1C1FA 1PD1A 3C60D 3FUEA 3U10A 4PGEB 4JO2H 1FVCA 4YG0A 3O4OB 3FSOA 3P0VL 1HJFA 3UL4A 4XTRD 1NE6A 1RJZB 1WD3A 4OZGF 5IWLC 1AR72 2B9UA 3MPPG 5L8JB 3ACLA 2OZ6A 3ZQWA 4HPKA 4DGWC 4AYGA 2H0JA 3O45A 2BCKA 1QBML 5KBPA 1X50A 2FZ2A 2NPIA 4HIHB 2V2XB 1P4UA 2YEZB 3OCPA 4BQ2A 3FSWA 4WQOA 1TMF3 4HS3A 4XXCA 4K3GA 3RY6A 1G9AA 4YHZL 1ED3B 2OX5B 4QRSA 2V9RA 3CFKA 4UTAH 3NJXA 4MSWB 2P2KA 4MZUA 2Z8SA 1U4EA 4RMTA 5EZPA 1DQ2A 1E27A 4CUBA 4ZU7A 4LSRL 4XPHL 4OQ9A 1JGEB 3QULA 3K71A 5HJDA 4LKCB 1SLLA 2CGYA 2ZUQB 3L6FB 3UEZA 4MMYA 4AZ8B 3T5WA 5I76A 1G0YR 5HHVL 4RBPH 3TA3A 4WUUA 4YEFA 3O3UN 4OFKA 2GFBB 1OP5K 3EGDB 5C0IA 1LEDA 1QGLA 4QRFA 4R7XA 4MHUA 3PDOB 2XXGA 1LAJA 5JOEA 2Z2SB 1ONQB 5GIRA 5EU4A 3MICA 3IMNA 5CNAA 2CLVA 4K23L 4TZDA 1V6LA 1NX9A 3UACA 3ES4A 4XEZA 1HVXA 3SGJC 4WK2B 5T5LA 5JORB 1KPRB 5FYKD 3VBRB 1ZLDA 4X8PA 2V2TB 3UYPA 4Z3JA 3NJKA 4BFKA 2Z4QB 5D4IA 3MLRH 4FOMA 4RGNB 2C9VA 4UAOB 4C8XA 3AM2A 3BX7C 4URTA 4CEWC 1TCMA 3MROA 1KFUL 4G8EB 4OCRH 1BZ9B 1PLGH 5D1XA 1M05A 3HQXA 4CKQA 4KDTC 3EJPA 3ZPYA 2XOTA 5FKAB 3ZQXA 4XFGA 5AW3B 5ALBL 2AHIA 2HWF3 4HZAA 4EO5A 2YA0A 3QDGB 5CCKL 2A6IB 3S7IA 1HT6A 1N6QH 5DYOB 2BNRE 3I3MA 4XHXA 5A3WA 1NLBL 2UY7B 2ZNWA 1CDJA 1N8OE 1I8IB 2Z8RA 4UFLA 1KYOJ 4LHUG 1KDJA 4ZT1A 4FP2A 4A6YL 2DCYA 4Q9CA 2Y7NA 2AUYA 4QJ4B 3WHXA 5F7DA 1XNCA 2XG4A 4XXWA 4W1TA 3H56A 5E2UH 1E9PA 4QRTB 4R8WL 5E00B 5AZEH 2W9DL 4AL9A 2C34A 3KNBA 3G5VB 3DX9A 4LSVH 3G04B 4PV8A 2R32A 4XFIA 4ZO8A 4ZAKD 1RZ7H 4JQIA 5DYFA 5IV2A 2AW2A 4L3AA 1PQZB 3CXHK 4R3SB 4ONFL 2IG2H 2I9LB 2BHZA 4A6SA 4Z5RA 4UFJA 2UUDK 2F4PA 3TPUB 4EDXB 3BAWA 4MD0B 4JM4L 2CO7A 4X4ME 1P84J 5I8CA 3RTQB 1LULA 2RMU1 5FY5A 3O0XA 2GT9B 1Y18A 3OHXC 5DZAA 3NT0A 1X5MA 4Q4IA 5KVGH 1W6PA 2O5XL 4E4SA 4WNQB 5GRVL 1QSFE 3FULA 3O3DA 4OF3A 4QRQA 3U1SH 1AFVL 4DP6X 2CWSA 1I9IH 5C08A 4NQDE 4V33A 4CW1B 2CBMA 3LNDA 3RA7H 1IPSA 4QPGA 3BVCA 2FEJA 1NZIA 4UZGA 4IGBD 3VCLB 3VU1A 3BUCA 4Q9QL 1R75A 3CK0L 5CKMA 3VFRB 3VBSA 2BP8B 1QFWI 3H0TA 4BZ2H 1AYM1 2GSYA 5AAWC 3CVHB 3RWCB 1QO3A 3U48A 3UJTL 4P57A 3KVPA 5C0CB 1JK8A 12E8L 1NEZB 1RCYA 3AY2A 4FKHA 3KJ4C 3IPFA 4L4TE 2XSKA 5CIPA 2YR3A 1JNLH 3LKOA 2ZHMA 4Y1XA 4FSJA 3JTTA 3KYNA 3QPXH 4XPFH 1AY1L 2Q10A 3ZXJA 3IWZA 3C8XA 5A32A 3B9KA 3EDJA 3LSOA 3VXUD 5J12C 2AGJL 1HB4A 2D40A 1IKNA 1U2CA 2OTPA 2P8PA 1FORH 1VE0A 4IIQB 3VXTA 1DQ6A 3KPRD 2Y3AA 1PO13 1NUDA 4I18A 4N8PA 2EZ0D 3APNA 4P4KB 5DHMC 5E1QA 43C9A 4UM9B 4MJ2A 4OLWL 3S4SA 4XMLL 3VFTA 1OKQA 1ANUA 4DUWA 2J55A 4MNQD 3GI9H 5A2KH 1ZGLB 3PVOA 4R9DA 5IVJA 5D1QC 5BXXA 2BNMA 4DO4A 3PQYA 1TETH 3AFLA 4YZ3A 4BH9A 1LJ7A 1OAXH 4AQTA 1ZLWK 3TN93 1CLZH 4PCSA 5IGXH 1Q0YL 1PMIA 1JWMA 2FDIA 4OGXH 3NZHH 1JYCA 4HK0B 3WV0A 4ZW3A 2QQNL 4UTBA 2D6MA 2W87A 2VCCA 3V0VB 5CA6A 1VBA3 4LDCA 1TQCB 4XMWA 3NVCA 5FGBA 3DOHA 3S34L 4JFYA 1O9ZA 2A99A 3ZKMC 1P1VA 3GJFK 4KROD 3EQEA 4KKBD 4ABUA 4NWUL 3QJOA 1A7OH 5EEYA 1EO8H 5DJ8B 4XWGH 3KLKA 4PVLA 3QHTC 5DFTA 2NNFA 5DJDA 3MYJB 4NYLA 5J37A 2F19L 3O2WH 4PGCB 4RHV1 1PX8A 2MQ0A 2E74C 3CBKB 2ORZA 4NE9A 2J3SA 1KDIA 2WK2A 2XZAH 5LA0A 5KSBB 2HJFA 3K72B 4K4KA 4R7LA 5HJGA 4PUBL 1U91B 2GSGB 2VDKH 2OK0H 5HGDB 3JCIA 1F4WH 1JOBA 4NOBA 2IQ9L 3IMVA 5F88B 4DZ8A 3EXJA 1QQP3 1E4XH 2DL2A 4Y4KA 1HZLA 2AYHA 3HN5A 4G80A 5BQ7B 2PTMA 5C3OA 1RL1A 2AKRA 4JTNA 4JGZC 2WKKA 3O11B 2ED9A 4U1JA 1COV1 2XYCA 4OI2A 4G9FB 2NCEA 1MRCH 3VRIB 4JHTA 1CFTB 5IM7A 2JSFA 4F58H 4JPQA 3TH2T 1T03L 4HN0A 1M4KA 3UIYA 5IW0A 4AMKH 5EN2B 3BDBA 4K8RC 5IHHA 2Y6KA 1SFYA 1VBC3 1U8PA 4AG4A 2PHFA 4NIHA 3EGXA 2GITA 3H9SB 1JF5A 1EAH2 3VBUC 1U0QA 3RSJA 3WF1A 1F11A 2BOJA 5TFSH 4NB7A 5CJOL 4IBSA 1TMCB 2Y25A 4KTEL 4DKFH 4GRLA 1HX6A 1AGFA 2V9QA 1NA1A 3QIUC 2IC2A 4IU2B 4RH4A 1RHI3 5EEWA 1A64A 1AHMA 2N4IA 3PV7A 3GJAA 3BP5A 2C9XA 3ARDB 3LXBA 3KPQB 4X6EB 5IW6B 1WVZA 2C1PB 1Q5OA 2B8MA 4HIHA 4LTAA 2X1WL 4WV8A 4GG6F 3CLEH 1K85A 2YPVH 4WY7L 3LZLA 1IM9B 2NLRA 5CJQH 1M7IB 1RUNA 1ED3A 4Y1AB 1ZVNA 2CXKA 2VERN 2DQFA 4MSWA 1HB3A 2FJHA 3ESPA 3LQZB 1MS9A 2FL5B 4QDGA 4YQXH 4BSJA 1QRNE 2ZMKA 2YD8A 3OR6A 3D18A 3TNMA 2BSDA 1W8WA 3WS6A 3ZFFA 4QRRB 2A74B 3LSEA 1VALA 3BIEA 2EAKA 4AXOA 1GJUA 4ZW6A 2GFBA 4KFZC 5FM5O 3AKQA 4RFNC 2OX0A 3QQ4B 4C91A 3DV8A 4HVRA 3UAJD 1TME3 4QWNA 5A6YA 1ONQA 2DQDH 3WG7B 2XG3A 3GGLA 3X29B 1CIWA 1B2WL 3FFCA 2WKOA 2BP3A 3BKCH 3ZO0A 1KGXA 1VACA 1DZBA 4ODTL 1WW5A 4YO0A 3ZVVA 3OB0K 2WSKA 2CK2A 1Z9PA 4P0DA 3HZKB 3UBGA 3OL2A 4PDWC 1HV0A 3FZ3A 4MJIA 4OGQC 2OMZB 3K5SA 5TGBA 4E9KA 4COWA 2QZ2A 4F9PC 3EYOA 4M1CC 3RZJA 4LT7A 5E8NB 4QNPF 5FKAA 1QR4A 4K3JH 4NC0B 3WQBA 3FUMA 2Z0BA 1OT1A 3WIHL 3QDGA 2FZ1A 5C6TH 4JL2A 2PQSA 1MCOL 4GMP0 1OGAA 4GAYA 3ZDSA 2BOLA 4JM2A 1OWWA 4WWNA 4XAWH 2UY7A 3RI9A 3TZVA 3GSQB 2OV0A 2FX8H 4ANXA 1I8IA 3L7FB 5IFJA 2DI8A 3NN8B 1ND0A 1DVYA 5C92A 1UB6B 4YVWA 3TYFA 1AGDB 4OD3H 1YEIH 2FVNA 4HPOH 2ZX1A 3R06B 3LMJH 1H3XA 2FJFA 4HWEH 4IRSB 1JTZX 2VNCA 3ZDWA 1F3DJ 2UZIL 3U4BL 1LO4L 3FO0L 3TV3L 2W47A 1F4AA 1KTJA 3Q6FB 5J6HA 5D72L 3RB7A 1PQZA 3P9LB 4R3SA 5CEZH 2I9LA 2PHRA 1NANI 3TWCH 3B3BA 3VQ2C 4JG0L 3UT0A 1QDCA 2JB8A 1OTSC 2VXTL 4QHKJ 2ED6A 1D0HA 4XBMA 3KL5A 3RTQA 3HPLB 3MGAA 1T4KA 3ILPA 4XNMB 2CUHA 3PWUB 2RB8A 1DQ0A 1LDSA 2WNEA 5H37A 3S3PA 4BSVB 1AR83 2Q8DA 5BO1L 4ZG1A 1UT2A 2BMKB 2CRMA 3KZ4C 1PMHX 4PD4K 2F7IA 5IHWA 5DLLA 4FQCH 3BN6A 4GRWE 4LLDB 3VD7A 2D44A 3AK0A 1J5IA 5F3FA 1NM9A 1NGPH 2VLJA 3RX8A 3JWDC 1MSPA 2UXVA 4EN3A 3MRJB 4NIIA 2N59A 4ADGA 4Q0VA 3QUZB 2DBLL 4PP1D 1PLAA 1KBKA 2V8MA 4XCNB 2Q2EB 4D0CB 1Z9NA 4HPYH 3VFRA 4IEFA 4IEVA 3CV5A 4X7DC 4J3OG 4PJ7B 1JUIA 5C0CA 3CZUA 3JV5A 4Q9RL 1MI5A 1JNHB 4B9CA 4YX2L 4ODVL 1AZRA 4ZJ9A 4N90E 3RYMA 1WCQA 1RUF3 1YEHH 1QBLL 4ZFOL 1W8UA 5FPAA 2GSMB 4UI2A 4GSQA 4YWGL 4Y24A 1JZJA 2ICWI 3HMWH 1D9KD 4NM4L 2ZF8A 1XGUA 4IIQA 4MSVA 1NL0H 5ITFB 5F2SA 3U9UA 2F54B 3MV8A 4WSJA 4Q52A 4K1YA 1QFWH 3AFKA 3VGAC 5FYKH 1U8OB 1FOD3 2R043 3WSOA 5ECJE 4XP5H 3CX2A 3AMQA 1OM3L 5LGYA 1E7UA 5PAZA 2SBAA 3NDYE 3RX9A 1KWKA 3B7TA 4KO5A 3II3A 4LCCA 4AQ2A 2QSVA 4BU2A 4YARA 4QPIB 4R5TA 1H4HA 4WKZA 3ULAB 2WQ4A 3DPRC 2PHDA 4IJ3C 2XWJB 4HK0A 4YBLC 4CUCA 3NCFB 5CYYA 2J1AA 3NSXA 3FQUB 4FX5A 1E4WH 3BIAX 3PV6A 3DSNB 5JQHC 4G6ML 1T4WA 1AX2A 5E5MB 4I2OA 1JYXA 3B7RL 3MCLH 4YW2A 2BRTA 2NY1D 5CNHA 5AD0A 4FPGA 1IGYA 3K3OA 4PJIB 1VCBC 2EDTA 1FC2D 1ZIAA 3BKJH 3HG3A 3IDGB 3LN4A 3TT3L 5TF1L 1N0XL 5GGVL 3MYJA 3W57A 4WM8A 4RLDA 2Z31A 1YJDH 2OKXA 1R3IH 3BDYH 4WI2A 5IF0B 5HPOA 1FAYA 1J84A 4Y4HD 2Y6FA 4ZS3A 4ILDA 4AV4A 1SMOA 4W4OA 4ZXEA 1HOCB 4WVWA 2AQ3A 3GXTA 4P2OB 2I5YH 2X5IA 5HGDA 4N2DA 3M3EA 4TUKH 5F88A 1CQYA 3MX0A 4JFHD 3WD5L 4RDQF 1I1CA 1NOLA 5BQ7A 2IQAA 4NPMA 3JBG3 4WHYG 3O11A 2XY1A 2O61A 1IARB 2O26U 5FGCE 2PTTB 3FU3A 4M9OA 5I0SA 3KYKH 4UT7L 1C5CH 3II1A 4OFYA 1HRV3 2AJUL 1T80A 4HWNA 4Q58C 2HTLD 2C1OB 1OA2A 4GI9A 3ZKSD 1QJX2 3WJMA 4O7XA 3FU6A 4J8QA 5EN2A 3WJJA 3NTCH 1SCSA 1LEGA 3H9SA 4ANUA 3VAEA 25C8H 3THCA 4A6YA 3DHPA 4AYFA 5EZIL 2EUWA 5HHOE 4LARL 1U95B 2A1XA 4IU2A 2EIJB 1HAUA 3DYOA 1Q90A 2F2HA 1ZY9A 5KUMA 1X5GA 1JNNL 2Y7SA 1S9KC 3D6EA 3L48A 2R4SL 2DOCA 1RMU3 2ZMLA 4G3YL 3MJ9H 4R4NC 4EBQL 3X1FA 1BZ7B 3PVEA 2J1YA 1R34A 3KPQA 4NQEB 4PJCF 5I18H 2D98A 2C1PA 4FFWD 4OU3A 3SBWC 3LD8C 2Y5TA 3FAXA 4PRNB 4U3HA 3ZHDA 2FJSA 4F8LA 1V0AA 3AYAA 3HHSA 1IM9A 3HHRB 3O8XC 3O3AB 4E9XA 1M7IA 5DDHA 1GW6A 5HP5A 5IOPA 5FV3A 3T0XA 3OJDB 1TPXC 1BGXH 3HW7A 4L9DA 2P5BA 4PJXF 2FL5A 2VDPB 5IMMA 3UTZB 5ABZA 3T1WA 4ZO7A 3D69B 4QRRA 3QW9A 1YY8B 2A74A 2DIBA 5FW8A 4DPCX 1WBLA 3WY6A 3S5LB 3LH9A 2WZAA 1ID2A 4F93B 1B09A 1RZJH 3RU8L 4LL4A 2PXYB 4IRZL 1WFJA 2KLSA 2H8PB 4LU5L 4L8QA 1BVNP 4B7LA 2EXIA 2NT1A 3IBOA 1AKJB 1G6RB 2VE6A 1QSEE 5CZXC 5D7SH 5AKTA 3LQMA 2UYBA 3DCQA 2AVGA 2WQRA 3BGAA 1LECA 4KKLD 3OGCB 1BLNA 1TTGA 4CNIA 3OAZK 2YXSA 4DRRA 4LSUL 3TYJA 4U0RB 1HAWA 1C16A 2MCPH 3FJTA 3GHEL 5FZMA 3IKWA 1URZA 3V5KA 2VW4A 2NTSP 2OMZA 4HG4J 2QGDA 4I0PA 4M61B 5F97E 1NCDL 2PO6D 4CGUB 4TVPL 4BJ0A 3QDAA 4IBLT 3UABA 2VDRB 2VKWA 2CBQA 3U14A 3MLPA 4APQB 3MUZ1 1KJ3H 3GMQB 2AANA 4LBOA 3OPZL 4S0TD 2WCSA 4IKKA 2EA7A 3QXAB 3VFGH 3RGBA 3BAEH 5CGYD 5KYUA 1AC0A 1QNYA 3NVQA 5IB5B 5B3JE 1NGZA 4CDUC 1W2KT 1EZVY 1RUQH 3HC4L 4PBOA 2AERT 4YVSB 5JOFA 4XVUD 5I74B 3VMOA 2W3JA 3VBOA 2Y07H 5JSOA 2QQNA 4NKQB 2ES3A 1AX1A 1GWLA 4NUQA 2FUQA 2VDNL 2O5ZH 3BP4B 4B9JA 1QQDB 1PZ5A 2DCKA 3Q6FA 4MJHA 2XXZA 4N0YL 2FDGA 2A6KB 3P9LA 1HXKA 4OB5L 2ZOTA 5TQ2H 3VXRD 1OANA 4AW4A 4HT1L 4M5SA 4MA8H 1RZFH 1MCPL 1FCCA 2X2IA 4BIOA 1S7UB 3FN3A 3ZKXC 5ADPH 3HPLA 4XNMA 5AW0B 1D6EB 5TF0A 5GRVK 2NDGA 3NL1A 3IDXL 1JOPA 3ZYZA 3GGWA 3VI3E 3PWLB 1W28A 1LGVA 1NCUA 4NNYB 4P4RA 2VW0A 2Z0UA 1U30A 3SPGA 4PLNA 5IQ9B 3ZE1E 4F1SA 2DV9A 4JFZH 4DSYA 1ASJ1 1IGIH 3KYMB 1S3KL 5CP3H 5F9WB 2P45B 4ITCA 5D2NC 3OEBA 4LRIA 4O4YL 4IBVA 4OI9A 3MREB 1NAKL 2WAQA 1CG9B 5FOJB 1NANH 1BFVH 5K9OB 2EABA 2WYIA 1A7PH 1IFHL 2DMBA 4P5TB 4X80H 2VLKB 5JXAL 4AM0Q 4S1DC 5G4MA 4CMHC 5A2JH 1NXMA 3FHIB 2O30A 1CTOA 4GMSL 3CH8A 3V7MA 5HYQA 1CAXA 2HH0H 3ELQA 5LBEA 4RSYA 1QTPA 1W72H 5E51A 4J1UB 4DW2H 3ATGA 1LP9E 3A3YB 3DMMB 3FL7A 5DTFB 5ISZB 3MJGX 2XUEA 2VL5A 3IJEB 1F02I 1KMGA 2ENPA 4QDRA 3VBHC 2J1XA 2DMKA 1PO23 5D7HA 2XWTB 4WU5A 4GJZA 5TDNB 3NJFA 5I8EA 2JB5L 1BVP1 4XCBA 2V73A 4ZXKA 1MFDL 1FH5H 2ZSWB 4PS8A 4XVHA 1B4JL 5EOCH 4Y2DB 3HI5L 4AEDC 4OQ8A 5E8EA 3A47A 3JQWA 3WUWB 3IDYB 4J4PD 4ARXA 1FPTL 1FYUA 5LK5A 4FEMA 5B4XA 4XUTA 4TS6A 3ABKB 3RG0A 4DXTA 5CAZA 3Q6GH 3LH2L 2YC0A 3FQ1A 4XX1E 1XHHA 2N1KA 3DX6B 5K1NA 2RMU2 3NA9L 1DQML 4LEOB 2RS31 2HWZL 4UQEA 5E5MA 4PBVC 4YZFF 1C8QA 1R6VA 5IVEA 3S4SG 1ZEAL 2KXLA 5KW9L 2G5BB 1KELH 2PUQT 2EUXA 4PJIA 4UUJB 2H9GA 4JFDA 4WFEE 2R83A 5FYJD 1AQKH 3IDGA 2G2RA 3RQ3A 3ULVL 1JN2P 4XNQB 5DPNA 1FVEB 3GS4A 1R3HB 3OSVA 4XMKL 1TJHH 1HKLH 1X4YA 4YHYC 2VUJA 4NN6C 4ZRGA 3N9GL 5FHBH 3TCTA 1JDDA 4Y2OB 4C56B 4GAGH 4U49A 1VKXB 3AQYA 4U6VH 4ORFA 3UG4A 1Q0XH 1OOPC 1QJU1 2R2BB 4G7QB 4M03A 5DUXA 3C87A 2E9BA 4OZ4A 1OTUC 4X4XB 3P30H 4JRXE 4XMXA 5E8DL 1AGEB 2V17L 5T5PA 5IHZA 2PTTA 3LEGA 4N9GB 4FQ1H 1J8KA 3POEA 1Q72H 2R0FA 5F0JB 4LCUB 1VBB3 1AACA 1DFQA 3BPCA 1J8HD 1OQOA 4AV5A 3EUUA 2B59A 3WIHA 4R8HA 3LQAH 2BGCA 3I54A 2NUPA 3MRKA 4AZZA 2R2CA 5JA9A 2WQAA 2P8MA 2Y23A 2R071 1M71A 4L0YA 4CEYC 5BQDA 4FYSA 5HY9A 3MW2A 4OT1L 3VDCA 3EGSB 4D9LH 4FXKB 1U95A 1KENL 2ZWKA 5E94A 4B4QA 4JQTA 1KCBA 4H0GA 1GYKA 3RPIB 4G9SB 5FP4A 2OXGB 3DVGB 1NICA 4WRLA 4BQ4A 3QEGH 4FXTA 4R2GD 3KR3H 5TDPB 2GIYA 1RUG1 2IMMA 4UNIA 4OJFH 5KBDA 2AK4E 3TVMC 3IN2A 5GXBB 4P48A 1FP5A 3WDWA 4HH9A 2B42B 5TE7L 2GN7A 3TNPB 3IAQA 2VMGA 3FC8A 1IQAA 1TVDA 3FN0L 4RMRA 3ISRA 5SWSE 4DP7X 5CCGE 3GXIA 3WHUA 4FTVA 3OJDA 4HZLB 2DMHA 2I24N 1F1DA 5I82A 4KMTH 4LVOB 3QUXA 1EAJA 3LPWA 4NP4H 3UTZA 2ZXQA 1R5WB 3X1NA 5LDUA 2HWF2 1MCDA 4CADB 5LGHH 1USZA 4FQHA 2LGNA 4D69A 2Q5TA 1N3OA 4LAJH 4XOEA 4E9TA 2BOBB 4ODSL 5FO7B 1AUYA 4Q5OA 3BZ4B 4N0UE 3ZFGB 1UUNA 3T4VA 2ADJB 3DHUA 5HDBB 3PWPA 3AB0C 3D4KA 1IIIA 3FXIC 4OUOA 2YGPA 1GS7A 2XZZA 3EZ8A 3A24A 3B7MA 2H8PA 3BSZA 1FNZA 5C0AB 3PXLA 1COV2 3OGCA 4CN4A 3MUUA 4BUHA 5DG2A 3GSWB 3IDAA 1MIEL 4A2DA 3EOYG 5KSUA 3N9OA 1FWXA 3VHPA 2NY0D 2HBTA 2J73A 1FG2B 1RC6A 1VMFA 2PFWA 1SN0A 5TE4H 3CGTA 3O0VA 2ESVA 1RV6X 4M61A 3CSYB 4QXCA 3KPSD 4HONA 4E4ZA 3ENRA 4XBNA 2Z65C 4AFAA 2VC2H 1NKRA 2HKFH 4KWUA 2BSTB 4X83A 2YBPA 3MTXA 3PWVB 4APQA 4FP8L 3GMPB 1ULOA 4DRVA 1SBDA 3O1TA 3FCTB 5BJTB 1NCRC 4D9RD 1MWOA 1KGWA 4PT6A 4POZD 1W8HA 2QBXA 5I1LA 3HJRA 3EYSH 4IOSA 1IT9L 2Y6TE 4FHKA 1UG9A 1DE4B 1ZRIA 3D51A 5F5CA 4UNVA 1ZVSB 4NHUB 4DTGL 4YVSA 5JXED 1J83A 3L81A 4LSSH 5E95B 3OJBA 5FPUA 4IKLA 5D7JC 1RUD1 4W9IC 1GCYA 2BRQA 2C9PA 4X8JA 5I1KL 3BP4A 4ZX4A 2ADIA 1QQDA 1CYWA 1DVXA 1Y0LB 4LCWA 4YLBA 5DWUH 3ROUA 1OIOA 4YHPB 2GPZA 3TNNB 1J9CT 1H3GA 2OTUB 1M9SA 3C8DA 1TJMA 3DTXA 3F2LA 4TSCL 5B4MD 3TO4B 2JDKA 2V4VA 5GPRA 1L9RA 2J5LB 1CGPA 1PM7A 3V7AG 1W05A 2YV8A 1QBMH 1AR62 1UCXA 5C9AB 1RIHL 5KG9A 5C3RA 4NNYA 4YHIB 3QJFA 1UA6L 5IQ9A 3MRBA 3V79C 1UZ6E 3K2MC 2WD0A 1A22B 2CAUA 3QFJE 2AJ3A 2IADB 2WYHA 4LSRH 4YSRA 4P23C 1IS3A 3NO8A 4I9WE 3VTAA 3FBQA 4MNGE 4X9GA 5FOJA 1AHWC 1CG9A 3FPXA 3IETA 4O02L 4Q2ZB 5HHVH 4ZX6A 5K9OA 3NJIA 5TDOB 4XHQA 3WD5A 4Q56A 1UH3A 3VD0A 3L3JB 1UD8A 2B7YA 5DUUA 3VI4E 1A65A 2VLKA 3ECBA 1JXDA 2JIXA 3G9AB 2VDKB 3KCPB 5H37G 3UC0L 1VBA2 2W08A 4RSUA 1IE4A 3RWHB 2BP6A 1ZHNA 1T1XA 4K23H 4RS5A 1ZLVH 1NGXA 3HZVA 1NGYB 3HOBA 3DMMA 4J6RL 4XB3A 1MF2L 5ISZA 2OMNA 4XN9A 3WEBA 1GP6A 4H25B 2CJ3A 5AOMA 3TT1L 2VE1A 2J22A 1X6NA 3D39D 3U1XA 3PTYA 3FT1A 4FMFA 3VFNB 1EHNA 5EUKA 3TASA 4D3WA 5JIUA 3VX1A 4XNZB 1UD1A 4P9LA 1VFUA 2IVJA 4JDVB 3EFOB 3T3PF 2BSRA 1XGRB 2RM21 2ZSWA 3VWKB 2ZICA 5ID1B 4XDOA 4GSUA 1DANU 4QTHB 4LO5B 4XBLA 2FECL 3O41B 1PEWA 4OLVL 2WANA 4F8QA 2W0FA 3QXDA 3DYPA 4XCCL 1QQP2 1I3RA 1NLBH 2QVMA 3CFMA 1BVKA 4PBWD 5FUCE 4OFVA 5GLUA 1S4CA 1SOXA 4KFMA 4LSQH 4YUEH 3DX6A 4MXWL 3WUDA 2VL4A 4NKIH 2P5ED 2R4RL 4AKOA 2DQJH 4UT6L 5A3OA 4KRLB 3FCBA 4HXAH 4QKBA 4E8CA 2XWCA 3DGCR 2F9BT 4J2XA 2X4SB 3HUJB 1GZPA 1W9XA 2W9DH 1RUC3 3MRQB 1PW3A 4TPRL 5G2NA 3LCYA 3NNJA 4HHAB 2G5BA 4EF3A 4F57L 1HE8A 3IPEA 4UUJA 2W0KA 4CN6A 1W2AX 4F83A 2CGPA 5BV7L 2GUOB 5AZ2L 5EF3A 2G1MA 3KV5A 2P5WE 5FCUH 4NC1E 3ZKQD 2IGLA 1R3HA 1RJ8A 3OD4A 1NIFA 1SGKA 4OI7A 5F96H 4FFFA 4A7ZA 1KCLA 1T2JA 4RGMC 3NZSA 4F3FA 1YQVH 3ZDYB 3FF8A 4EI5D 5JOPE 1RHI2 4HZFA 3RS6A 1I7UA 2I2SA 5DO2D 4MXVF 1AFVH 3MUY1 1CFQA 3ORJA 4Z0BL 3ZYOA 2FHFA 4N24A 4ANKA 3AY4A 1UJ3C 1CYGA 3B2MA 3NBNA 1CCZA 3HE7D 2CIIA 3SJVB 2A6DA 5L4JA 4Q9QH 2FNBA 3CK0H 1YPZE 4N5UA 1CIYA 2LW3A 2FRGP 4JFEB 3NPSB 1JDCA 1RIUH 3MOAL 4Z0XA 3UJTH 4LCUA 1A8DA 2VISA 3HG1B 1SZNA 2G30A 4Z7AA 3B9IA 5HD8C 2VR6A 2CDOA 1YQ6A 5E2VH 3CSBA 1WDAA 5EZWA 2DDQL 3G3LA 4Z6AT 1MELA 4O9EA 1OSPL 3PPSA 3ZE0B 4CDQC 3SY0B 1QBAA 2YBRB 1POV0 2FYVA 3ARGC 1SHSA 3H0OA 5FRAA 1PKQE 1TME2 3LDRA 3EGSA 2WUCL 3FN9A 4FXKA 2YSTA 2OQJA 1O59A 1PZ8A 2E75C 3BGMA 3DSFL 2CO1A 4FQXA 1CLYL 2Y6JA 4R90H 2OXGA 4OMDA 3W20A 1ZHBB 5E6ID 5JPMC 4MMXA 4PJDA 3BEWB 1JV5B 2MHAA 4FCAA 5A43C 2GAUA 1JSYA 2BFUL 2IGFL 4HJJH 3BOPA 2R8SH 3B9VA 3UYOD 1AAJA 4I85A 1V6MA 1I1AC 3F00A 1XF1A 3STBA 2HFGH 4A63A 3MIDA 1Q0YH 2M26A 3SH3A 2FD6H 1F8VA 2RGSA 2R0KL 4NRXB 4W9HC 2E6QA 4MAUH 3QIWB 1FNEB 2HMID 5BZWB 2J7MA 1H6XA 2VDOL 4YDJB 4CADA 5J48A 4K2UL 3BP6B 1TNMA 3S34H 2HRPL 4OI8A 4XC1H 3ZBMA 3WQ0A 2ADJA 1YNTF 5B8CB 3J07A 4ODBD 4NWUH 3JWNG 3SPIA 2ZX8A 1PK6B 5BOZG 2GH2A 3T2TA 1GZCA 1L3NA 4KHTL 4JL1A 5I1EL 4L4VE 3NIFB 5AB9A 1RB8G 2UURA 3ZYIA 3H8UA 4AYMC 2VMDA 5FUZH 3BB6A 2VW6A 1MUJA 5L8KB 4N2FA 3BSHA 4X6CF 1MEXL 5FYJH 2OCJA 5EUOF 4L11A 4K8RL 1WAAA 1FG2A 2MOVA 2KHAA 4CDXB 1XCQB 4PUBH 1ND2C 1NIAA 1TIUA 2H0BA 4S1RL 3AU0A 5C3SA 3D0VA 2XHKA 4QHUB 5F3EA 2NSQA 1WFIA 3IMSA 1R1CA 2ZUUA 2BY1A 2YOCA 5TE6L 2BY2A 5CGTA 2LVCA 5FZ7A 2BSTA 3OZ9L 2JG8B 2E0PA 2ZX6A 1HU8A 3PWVA 4L29A 2VR4A 3OXSB 1RZKL 3ROOB 3N44B 2ZUXA 4N7UA 3W2DL 5D5MF 4YBHA 1T03H 1OE3A 5BUPA 2UXTA 3QOPA 3RYPA 4TSBH 1TYEB 32C2B 5IBUG 4HLTA 2R2HB 2NY5H 3KG5A 2XRAH 3SDDD 2XQ0A 5KSAC 3LEMA 2Q8OA 1JXFA 1MVFA 5H4YA 3ZO9A 2EEFA 1CAWB 5KJ7E 3TBDA 1UU4A 2BFGA 4H1LG 5CSZA 3BQUC 5CJOH 1Y0LA 2F74B 5CFHA 4KTEH 4F7TB 5D6CB 5MERA 3IKCA 3L1FA 3TNNA 5IR1A 1K5MC 2Q8BH 3SB3A 2OTUA 2WWNA 3POCA 1VPOH 3WEXB 5B7MA 3TJEH 4EXPX 2MQCA 3ASNB 4PEEA 1VB2A 2Q30A 1QNZH 3FFOA 3I59B 1XEUA 1N1YA 5F3HB 3QDJB 2ZOKA 1VBD1 4FPLA 2F7PA 1TENA 5A3PA 2Q20A 3LPGA 2GYSA 5AW7B 4I77H 4CU7A 3FLPA 1R082 4YXHL 3EOTL 1WJ3A 2IADA 5IEKB 2GNMA 1RPQA 1F8TL 1T1WA 3WTYA 3QORC 2DYPA 1FG9C 3JZVA 2NX5A 5CG8A 3R0RA 4OZOA 5DD1L 1G7MA 3ZXLA 1NCBL 2KBGA 2YXMA 4J3WA 3RL1B 4F7CB 2PLV1 2CDEB 1L9NA 2DQUL 1C8M1 5JOWA 4NRPA 3OGOE 3LZRA 3CTTA 4E41B 3QDHA 3BFWA 3QI9B 3V0AC 1ZRFA 1W9TA 4JCKA 5GGTA 1OPOA 2Y1YA 5DZ9A 4B3EA 2FBOJ 3EH4B 3BOWA 1E67A 1YEGL 4GJTB 3EG9B 3X14B 3IFLL 4KOBA 3OKOB 5HHPB 5F7KC 3MGTA 1T6VN 1BEV3 1JWUB 3U7AA 1DN2A 5MP6L 3VFNA 4N9IA 2V5MA 1E5BA 1RQ5A 2CIKB 3I3QA 2X6UA 3NSJA 5IMLB 3NIGF 4QRPD 3MV7E 3V6FB 5JW5A 2C9RA 4NAMA 2VQ0A 3VXNB 4RQPC 1IAOB 2DWSA 3U7WH 2X9XA 3QCUL 4KY1L 5LXVA 4F37F 2R69H 3IGKA 1NCCL 1I1FA 1EHLL 5ID1A 2GTZA 3LS5H 3RDTD 3L9JT 5IJBC 2ORXA 3O41A 5GS1B 2VNVA 2WBJC 1K5JA 3V4VB 2ISDA 4H2AA 4JVPA 4XN5A 1GKOA 2RALA 3AT9A 2ICCA 4JPKL 3ILDA 5GRUL 3VXUB 4ADIA 1E40A 1ZSDA 1SEQH 2VLRE 3LZFH 2YUEA 4WEMB 1KFXL 1E6OL 3JBG2 1E5UI 1AYOA 2ZKHH 3KPRB 3CXFA 3PABA 4BQCA 3LKQB 1WH0A 3EHBC 3HUJA 1HRV2 5AKVA 1T7XA 1K72A 5G5DB 3MRQA 1DL7L 1MAML 3VU2A 4A6OA 4HHAA 2UZIH 4ZHNA 3SCMC 3FO0H 3WXWL 1UXSB 2R9HC 2F5AL 2ZIDA 5D2LE 3DROA 4H7VA 3QAQA 5D72H 1ASJ2 4AMWA 1GU3A 3JBG7 1P0SE 2UWEA 3O0LA 5BRPA 4IV1B 2WWUA 3G6DL 1JHTA 2VXTH 3ZDXB 1LO0L 2WLLA 5FZKA 3P11L 5F9JB 3WDUA 5TTRA 3ZMNA 1Z0HA 3T0EE 1SVBA 3QDMD 4M6OH 5BO1H 2NR6A 4DGIH 6FABH 5I1CL 5GLWA 2ITDB 1O9WA 4M5YL 2QE3A 1A7RH 1PCSA 4Z7VA 1QWNA 1Y7BA 3AREB 4IU3B 4JM0A 4F8PA 1E5ZA 2DYSB 3KHOA 2P46B 1KJLA 4NPYB 2DBLH 2AQSA 1V7ML 4KROB 5G55A 1B2YA 4V1DD 3SJVA 4UOZA 4PV1C 5B21A 2B1HL 3HR5A 2XJVA 4JKLA 1JZIA 3PVNA 1BIHA 3BZFB 1REIA 5AVRB 4LPUA 4Q9RH 4IGPA 4WEEA 3MEPA 4JDEA 4PRIA 1DVFC 3LN5A 4X7EC 4Y16A 2G5RA 2WKGA 4YX2H 2JCCF 1DVSA 1RZ8B 4N9OB 3IT8D 4DOHE 2ZAGA 4M6NL 4ICWA 2QQKL 3TJPA 4AX3A 1CBJA 5CF3A 5AWNH 1JYWA 2VXSL 2YC1A 8FABB 1H9WA 2ATAA 5FZEA 3VFWB 3MLSH 1T1YA 2ZCKL 1QMUA 1TNFA 4CP1A 4XQ4A 3J7NA 5SV5A 1PGW1 2PWHA 3VYPA 2BS8A 1G9ML 5CN1A 3PL6C 4LKFA 1XGQA 1ZHBA 2PMZA 3OUIA 4L0PA 5CISA 3RZGA 2XKNB 3W3BA 1NDTA 3BEWA 4XN1A 1WFNA 3H3BC 1OF0A 4AJVA 2HWD3 2ADGB 4IEQA 2GI0A 3WYRA 4E2OA 5C1MB 5JNYA 1SXNA 5ERLA 3GHMA 3KEHA 2J8UB 5JYMA 1W8OA 3N7JA 1IGCL 1OK0A 2DIJA 1OMIA 1L9SA 3LSDA 2FT6A 2VSKB 2HG5B 1YMHB 4PJBA 5EFUA 2GJ6D 4ZS6C 3QIWA 1QYGL 2C0ZA 1FNEA 4HUVA 3UK9A 5FA4A 5BZWA 4M5TA 3T3MB 1WGVA 3IJSA 3KYOA 1KT2A 4YSAA 1FI2A 1ZANH 2YUZA 4BH8A 3C2UA 3N35A 4MG2A 2DY2A 3IU4L 4R96B 4QXTA 2J4WH 3RDJA 5HTSA 2BS71 2ETEA 3D82A 1TJIL 1ACCA 4F8NA 3MRFA 4YSPA 5B8CA 1DYPA 3BCWA 5FZGA 3C2SA 4O02A 4FTSA 1CD1B 2WINB 1HB1A 4FAAB 4R26L 5I0YA 3MBWB 2W68A 3TT3H 3UG5A 4FAHA 4Q6IA 5TF1H 5GGVH 4RAVB 5A3MA 1JCKA 5L7OB 3HC3L 4MAYD 2KQNA 4XE5B 3DIFA 1VENA 3AACA 3HVDA 3LY6A 3IXTB 4P2QD 5A6MA 5TSWA 3CQOA 5IWFA 2IC1A 4KH9A 2E27H 4UT9H 4A67A 1IJNA 4PRID 5L36A 1X6LA 4QHUA 4E9YA 2R15A 4XBEH 2APBA 3CFCH 2D6OX 4RYDA 4U6YA 1JVOA 1OLQA 2V4AA 3OTFA 5KWRA 2WB7A 4RZKA 2PP9A 3NH7L 5I66A 1W72B 1T0MB 2Y64A 3OXSA 3IGLA 3OZKA 2C8NA 5DJZB 3RTLA 1BVLA 1J05A 1WHPA 4HGWB 3ROOA 3HQRA 4UT7H 4N2EA 1LO3L 5HHXH 1G7QB 4R0LB 5AG8A 5KBMA 1H2NA 2KPNA 3HZYA 3QIBB 3LKRA 2YG0A 2VAAB 4FFVC 4ODHL 2IDSA 2WN3A 2X2HA 3K91A 3V6ZB 2Y7OA 4K94C 4LHLA 1V10A 4PJ9C 1MZ5A 2R2HA 2VLMD 4QJ3B 3SBRA 3G7DA 3GBWA 3MIFA 3WKMH 5GZCA 5L4MA 4Y4FC 1CAWA 2H1XA 1QWUA 4MXWA 2IPTL 4AFMA 2YK1H 4OJDH 2F74A 4LHKA 3DX2A 5AW8B 5DD3L 3WO4C 4F7TA 2XN9E 1KDKA 4JGYB 4UT5A 3GS7A 2Y1VA 3KJ6L 4XMZA 3AL5A 1RPKA 1JNNH 1TJXA 1BBDL 3I74A 1OF2B 2QTEA 4IS6B 3IDMA 1FJ1A 1SFHA 3BIKB 4LB8A 5I28A 2JMRA 1KGJA 4EBQH 2X4QB 4RFT0 1F31A 4GMTH 2AJSH 3T2NH 2EALA 3I6KA 3I59A 1VRH3 4FZ8L 2NQCA 3MZTA 3QDJA 1H3UA 4EUPH 5FUOL 1IS6A 3AQZA 1PO22 1TQ5A 3ETQA 1YCSA 1X4XA 2F53E 2ZOLB 4PRPE 3UJJL 5JW4N 3AVEA 3G6JE 1G9BA 5A2AA 2CL2A 2HT4C 4AYUA 2P17A 4LUKA 3RMXA 4WFGD 2AC1A 4F91B 4E0RA 2DIEA 4UQAA 3U46A 3SE4A 2PHWA 3RL1A 2CUIA 1OT5A 4F7CA 3HPJB 2R29L 5TK2A 5CMAB 1QU0A 1X9TA 4NZJA 4BH7B 2I60H 2J8OA 3PLQA 4IRZH 1SDDB 4QD2E 2HJIA 4E41A 4LU5H 2LLNA 3QI9A 4X6DB 1B9ZA 1P5UB 2Q87A 2K70A 2VZPA 3D4GA 1WC7A 4RR3A 5CINH 4AFBA 1DGRA 4UBHA 4BWTA 3Q06A 3KXFB 3FRUB 1RKRA 2W60B 5HHPA 4OVVA 3PG2A 3QYNA 4LSUH 3F7QA 1HS6A 2BH0A 3B8YA 1BWWA 3GHEH 1W6LA 2IH8A 4XVJH 1UY1A 2CIKA 3RYRA 5IREA 5IMLA 3UKNA 3V5DB 4OLZH 4H55A 3V6FA 4CSZA 4OZIF 4AJ0A 4IKIA 2P6CA 4G6FD 4ZPIA 1IAOA 4DY5A 2P49B 2OMTB 4AGMA 1HRI3 4ZMAT 1MCNA 2XPGB 3WIAA 5ANHA 3AJ7A 1XF2A 3L8QA 3OPZH 5GS1A 4BMEA 2BU9A 5K0UC 1NLQA 3V4VA 3RVTC 4F9LA 2F8IA 1FZOA 3ZSKA 3AKTA 3A6CL 4JO3L 5C4WA 4P2RD 3APDA 3F84A 3HC4H 3F85A 1D9KB 2GC3A 1HINL 4JFSA 5ESVA 4NQVB 4RMVA 2NYYA 3LKQA 3WG3A 3WG4A 2Y26A 5EXOA 4DVRL 3ALXA 2QDNA 2L4OA 2XBZA 1U58B 3FH5A 4QRAA 5L73A 5AENA 2LAAA 1CGVA 2AJXL 4N0YH 3O1UA 4HAGA 4CXXA 2YN3A 5IJKA 3I4IA 2OMXB 3APFA 4QHZA 1IC7H 3VGDA 2DS4A 1DZRA 2J1UA 1SLWA 2MTAA 1MW0A 4CC4A 4JB9L 5M7QA 3TEYA 4UOJA 5HYSB 1S0GA 3EBRA 1W0YT 2H2SC 4Y9FA 3IDXH 4N1CA 4I2XA 4YHOL 4BK5A 4EUPG 4M3CB 1NIDA 2DUOA 5F8RC 3DPDA 3R18A 4YHLL 2ITDA 1TU2B 5ICXA 2VERA 2ZONA 1NCAH 1KBPA 2AS5M 1ES0B 2XNAA 3AREA 4XMVA 4YNYB 2B3IA 2IFRA 4YM0A 1THAA 1NOAA 5G4OA 1CX1A 2NY1B 5D1QD 4O4YH 5LNGA 2BX5A 4YPGA 1NAKH 3QJSB 2ZAAA 3D85A 3I02B 4IE5A 4Y8DC 4PJGE 4RFEA 3UAEA 2WWKT 5J06A 4BE3A 3D3VD 5T1KD 4F8OA 2P80A 1LK2B 4AFDA 3F6JA 5E4AA 4J3OF 4M1GH 3IPBA 1NJ9A 3NJYA 4MMZB 1RZ8A 1XGYL 4GWMA 4Y4HB 1W6OB 2G9HB 1WLCA 5LW9A 4YDNA 2VC2B 1RVF3 1IC4H 3M3IA 3K2KA 3RUGB 3QUGA 8FABA 1LILA 4ZMOA 3KLAB 5KXBA 5HGAB 3VFWA 3ZKMD 5IB2B 5DJ0A 2R1DA 2PLTA 4QOKA 3TGXA 5EZJB 3LOWA 3IFOB 2J44A 1FPN1 4KXZI 1NFDA 5DS1A 2XKNA 2YQBA 3OJVC 4HD9A 4NQSB 5F7NC 1XH1A 5KZCB 2ADGA 3DX7A 1SQMA 4GKNB 3HI5H 4GMP1 1X7SA 4JRFA 3TH3T 1D5BA 2ZWNA 4ZOBA 1FPTH 3FUQA 2Z7ZA 4QHLB 4ZTPL 2IPKB 5FHAL 4AVJA 4ET7A 3G5ZB 2HG5A 3CQPA 4KI5F 4Z7UA 3WDHA 4UYBA 3IM1A 2A6JB 4ACTA 4KWJA 4G8FA 3W9EB 3O2DA 3QXTA 3SDYL 1KZQA 4QX8A 4R96A 3HB3C 1ZEAH 1ZVHA 3ZIMA 4Y1VA 4UDTB 3W0WE 4DEPC 1U8MA 4NO3A 2VVDA 3S6PA 3VZJA 1YMMA 1DBMH 4A7SA 1Q1PA 2QEJA 1CBVL 4HSJA 5FREA 3UTTD 2X53S 4K8RD 4RAVA 2N7BA 3GJEA 1A6ZA 2R0LL 4KU1A 1Z2KA 4OLXH 4WTXA 5FDWA 1J1OL 1PVXA 1UKSA 4HPHA 3RNQA 1KGIA 1BEYH 2HLFC 1BD2D 3N9GH 3TV8A 3WIFA 2UU8A 3VG0L 4YC2B 4OHXA 1TVHB 3B43A 5BNOC 1IBGL 3DGGB 3QIUD 5A2LH 2XXCB 2FJUB 3CFBB 4YXKL 3U36A 3LHPL 1ORSA 1VFMA 2OS7A 3HZ3A 4LPVA 2RS51 2DJMA 3LX9A 2IVIB 2L9LA 3PTRB 1RI8A 1P8JA 4UANA 4HZ1A 2YD3A 5DT1L 2YOAA 1VAMA 1T0MA 2JFCA 2W9LA 3OMNB 5E8DH 4OH2A 2KS0A 5CILL 4MZRA 4BM7A 1ZT1B 1R091 1JI1A 3QC6X 4HGWA 3SKJH 2BNQE 1MQKL 1G7QA 1EAPB 2HKXA 3GK8H 1VAKA 1E6JL 4HUCA 3L13A 3QIBA 4P5MA 4Z7WA 3NFNB 1CVRA 4ZO6A 1A8MA 4FOYA 2B3RA 1AP2B 2V9UA 4UFIA 3IN9A 3WNXA 3WMSA 3KT4A 2G2NA 3POIA 2ADFH 1HCYA 1ICTA 2C4FU 5F32A 5AUMA 3JWOC 1MNUH 3E0GA 2Q7YA 3N42B 1I5PA 1RURL 1WITA 3QQ3A 5DK2B 5EBLB 3INAA 5JPNC 1VR3A 3MV9A 4OT1H 4KL1A 1TG7A 2PO6B 3MRIA 1KENH 4BZ1L 4FZEL 4Z7QF 1SY6H 5B1BB 1H6UA 5DU7A 2D6KA 1Z5YD 3OR7B 4Z1VA 1N68A 2X4OB 2NY6C 3RNKA 5FYUA 3G08B 3WDYA 1OTTC 5E1IA 2ZZJA 4JRAA 2X3AA 2QQLL 3GRBA 4JRLA 2P24A 5TE7H 1BYOA 5DXWA 3WTSA 3NNFA 2J42A 3FN0H 2VB5A 3PGFL 2VR7A 5K9JL 4FCHA 4G6KH 3VMPA 1JPSL 1BHGA 3QDGE 4M1CD 3EO9L 2JENA 3JXAA 1F18A 4QUOA 2VBDA 2BWIA 1QVOA 3K8LA 4HKXA 4UTCA 5DVKA 3GXDA 5C09D 3WKPA 4Z8FH 1ZBE1 1U92B 2W88A 1RFDH 3HPJA 4TNVK 2APFA 3VXRB 4PJ8B 4I88A 2XN0A 5AOJA 5DQ9B 3REWA 4X5XB 2MNWA 3K4DA 3T08A 1BAFH 1UXLA 2ZKMX 1HL5A 1SDDA 1RSYA 1WS8A 3FUKA 5LDSA 2JWPA 2I7SA 4B9PA 4X6DA 3Q43A 5E2TL 5FFOA 1P5UA 3L4XA 4G71B 5BXFB 3CHSA 6CGTA 5K59E 3IVKA 1ENXA 2IVFC 1RUC2 3KXFA 4LLMA 2QR0B 3FRUA 2MCG1 1CE6A 4HK9A 2W60A 3I2FA 1GKEA 1B0IA 3ABZA 3QR1A 1VRBA 4AMXA 3O9WC 5BS0D 2JDNA 1N0LA 1MS0A 4BQYA 2AJYL 4XYXA 3V5DA 4R9CA 4H26B 4I3SL 5E5LA 3OPZA 3NGBB 1OTSD 5DCCA 4N68A 1SHWA 2OMTA 3BDXA 4IXLA 3FTZA 4XOAA 1MFNA 5D7IB 2DQGH 1QIQA 5E24E 3MRMB 3PWJB 1QEWA 3QQDA 4FQJH 1UOWA 1WP6A 1GC1C 4PI2A 4FFGA 1DU3D 4M0NA 3ARUA 3T6WA 2PAEA 2ZWZA 4KUCF 5DQJA 4UW3A 4PGDB 3OF1A 4DTGH 1NKGA 5LA1A 4KK5C 3DI2B 2UXFA 2ZMNA 4YGDA 3MA9H 5A3TA 2BIMA 1FL3B 1DN0A 3LKPA 4IK6A 2HVJA 5I1KH 1E9QB 4G59C 1DYOA 4WUKH 3IB4A 3QUMH 4RFOH 3I6GA 2P4EA 1MCEA 1C7SA 1ETZB 5DSCB 3SLIA 2OMXA 1EAQA 3S5QA 1IE5A 4HWBL 2YROA 4X8XA 4JE4B 4PG9B 1ZZ7A 2Q6WB 1XFPA 4GINA 2PLV2 2R2EB 3UZEA 5E9DE 3CZFB 5EWIH 1LHVA 4DQOH 3DUSB 3J26N 4PBDA 2R56H 3S88H 4E42B 5FZFA 3ZXEA 1UENA 1TU2A 1UA6H 3SO3C 1STMA 4DNYA 4ETYA 5JW4M 4CPBD 1ES0A 1BMWA 3EDDA 5T3XL 1X8MA 4PP2B 1MJJA 3ARSA 1RHHA 5DEJA 3MXWL 2BVQB 2C3XA 3BU0A 3OGJA 2ZUWA 1ZRDA 1WS7A 2DQIL 5IROC 1R5VB 3RIAK 1X7QA 3ENEA 2WO1A 5FLJA 2CBOA 5CKGA 3VDAA 1RZIA 3UC0H 3WNPA 5JMOA 4XPBL 4FD0A 1KY7A 3N41B 4LKEA 1Q3EA 2G9HA 4QXKA 3KHCA 4Z77A 1V3JA 1H6EA 4NQCA 1X3DA 4WM7B 3B5GA 1O6SB 2XVKA 2ZACA 3A0KA 2E7BA 3RZHA 1VF5C 4J6RH 3PUIA 5J96B 1MF2H 1FYHB 4Q1PA 1EBPA 2Y2YA 1O3TA 2PTVA 4BISA 4S1SL 4YSCA 5IB2A 4L8SC 1VIWB 4YFDB 2OW6A 3INOA 1MHEB 2IV9A 1RUPL 1R19A 5D55A 5IK8A 5AOLA 4OZHA 4RIRB 4JZJC 5KSBE 5E8OB 1LEKB 4JAMA 2WLIA 3LH8A 5A1LA 2LABA 4GKNA 2ZAHA 5B3NA 5D7KE 1J8HB 1KFGA 5KYXB 4BSWB 1QLRB 1N67A 3CDFA 2VUAA 2IPKA 1Z6JT 3G5ZA 2ERJC 3DC0A 3F7YA 3WNNA 2WM0A 3NV3A 2ZXEB 4OGYH 4R4BB 3SGKC 3V0DA 4G9FE 3ES6B 4DEWA 4F2MB 5GGRB 4P9JA 2RHPA 1NMCB 1PY9A 2BP0A 2DM2A 4UT6H 2FATL 4ZSOB 4ZXBB 1RJLA 2WTRB 3UBXI 2JDZA 5T5JA 2IDCA 1MFMA 2O4EA 5D1ZC 5B1CA 4HOOA 1T83C 1PLBA 4UNTA 1ERNA 3H3LA 5JVVA 3OQRA 1LEIB 4UDTA 3JVGC 2IAND 3AADB 3PREA 4R2GB 4WK4B 5E7BA 2MEV3 4DP9X 2XY2A 2WLYA 3ZXKA 3STLA 3BZEB 1BK0A 3H9SE 4YGBA 4W81A 3K2IA 3VZKA 4DEQA 2R29A 1WV7T 1JK9A 3KS0J 4OUUA 4PY8I 5EZLA 1X9RA 5FAAA 4IBZA 1GP4A 3L2NA 2WC2A 1ASPA 2PYTA 2VR8A 1BCXA 2YAQA 2YQ3A 2CR3A 4K7PX 3WOGA 1QA9A 2UV3A 1RGSA 4XUQA 2PYEA 1LU2A 1WA2X 4E9WA 1R0AL 1TVHA 5GS0C 3CFBA 1B35C 2DYCA 2E8ZA 2BWQA 2R23B 5E1RA 4L5FE 1RUJ3 1DSFL 1PM4A 4R4ND 5FYMA 1KB5H 4U1GB 2LU3A 3AGVA 4GS7C 2EYSB 1D2OA 2FAUA 4QX3A 4Z7NB 4Y1AE 3T0BA 3SITA 5EU6A 1UD2A 1GZQB 4OLUH 3I7DA 4P9GA 3OKDA 4QM9A 1BMZA 4E68A 1EQWA 1BG9A 1S4IA 2HUEA 1E28B 1SDYA 1TFHA 1EAPA 2O5YH 2YD4A 3DA0A 3MOAH 3MRDB 3O8XD 3FHQA 2WZR1 3NFNA 1N47A 5A40E 5L2KD 3WF3A 3D30A 1UY0A 4C1WA 1OQDA 3EAKA 1H4GA 4XHBA 2DDQH 5ITBH 5KVDE 3DXAA 5B38A 1T7WA 2VZ1A 5FK9A 4PRHD 4X5QA 1L0YA 3PY9A 5EBLA 5DVOA 3S3SA 1MWAB 4EYUA 3KPSB 2VQ4A 1OSYA 2FWOB 2IAAC 2NZ9C 3ARQA 1AL23 3DSFH 3ECUA 4JFOA 3WVJA 2CR0A 1CLYH 2N3JA 4ZFQA 5F7EL 1I9RL 2JJVA 4O2FA 2NRDA 4LPWA 2A9CA 2YMTA 5CZXD 1YA5A 3K7UA 4WI6A 4XP4H 1EO5A 1BM3H 3K77A 4XFHA 1GS8A 2YD1A 3UTSD 2X28A 5B22A 3HG5A 4ZD3L 4Y4YA 2V2WB 2IXLA 4MTMA 4PCKA 2DWYA 5HCHA 5AKRA 3QCTL 3H1WA 5KYWB 5DHEA 5HHMD 3SZKC 2E33A 5CD5C 1OCCB 2B45X 2V09A 4P9WA 3ARFA 1BQLH 4FNRA 3JYCA 4LKSA 1QATA 1AJ7L 2R51A 4K2UH 1G94A 2GEEA 1U9KA 4DGYL 2LTQB 3FX3A 4ZFFB 3VDDA 4PJ8A 3CBNA 5DQ9A 3H3UA 1K5NB 5CLWA 5FP3A 2B9AA 1W8EA 2RFXB 4AIOA 1MCIA 1AS7A 4FNSA 4OI1A 2VQTA 2FBJL 5BXFA 5JQ6L 3V8CA 2JJUA 1D5XB 5MEND 3TFBA 3NMBA 1CT8A 3C6EA 5HYJE 2QR0A 2X4UA 3NEOA 4HUUA 1S0IA 4ZK8A 3J8F3 4ABQA 3WGUB 4KV5F 4K8RH 4G1MB 4K07A 4MXQC 5KWYC 3HBQA 3HS0B 5HBBA 1G9HA 3ZHLA 1UCBL 4UINH 3FQWB 1PAZA 2J88L 4RA0C 5TE6H 1R1A3 3M1OA 5JXIA 1GANA 1T3FB 1ZA7A 5ABJB 3RZLA 1XO8A 4JZNA 3SKNB 2WYTA 4L23A 2Y9RT 4OLYH 3L3OA 3NNMA 3S8FB 3US0A 3T4AA 1WMDA 3FT0A 4XO9A 5IFAH 1I3VA 1KB9J 3RPKA 1P4LA 4M1DL 3AG2B 2WKOF 3ALWA 4LVHB 3AU1A 4RRPM 3PDGA 3M3CA 4PGDA 4A7YA 4PJ7E 5IW3A 5JZGC 3D39B 3BPOB 3AGWA 2N0KA 1FL3A 4JMNA 4KAQL 3G5XB 2VZUA 1PPIA 1IEAA 2BHFA 1E9QA 2EVIA 4UQ9A 4W9EC 4KHXH 3CZLA 1KYOK 3GSRB 4YSOA 4YIQB 2WO3B 2APVA 3T3YA 1UU6A 1FSKC 4FI9A 1JU3A 1V7NL 1Z0MA 4MD5B 4S1DD 5BZZA 1KS5A 5DSCA 2IBZX 5TJWK 1ZM1A 1LVEA 2WUHA 2UYLB 4AQEB 2OS2A 1T7ZA 1XMEB 4LBAA 4WTZA 3GLZA 4QHNB 1JERA 4HX1B 5GISH 2BIHA 4BK4A 2F54E 3D5OA 4OD1L 3O6MH 4WIQA 5I15L 1AF9A 2E53A 4A2UA 2QVTA 2R2EA 1FFPA 1B88A 1E3FA 4JM2F 4A45A 4WZ9A 3DUSA 4GG8B 3C5JA 3UGEA 1UY3A 2D7FA 3M1BB 3SE9L 1AD0B 2P5EB 3CX5J 1NY71 1ZA3A 5GLVA 3ZIWA 4NENB 1BJQA 3GXFA 1P84K 4IHOA 2VMFA 5EDSA 3SHRA 4U1LB 2HWD2 2D7MA 2R073 3RWGB 2A4CA 1UAIA 3VKOA 1JGVL 5EC1B 3FT4A 4ISVB 2BVQA 2EDQA 2OIIA 2BNRB 5IEHB 1MS3A 1ZHLB 4B9KC 4M4RB 2JDPA 1R5VA 4OKDA 2JTDA 2DQUH 5AC93 3R8QA 3QZMA 2KKQA 2X10A 3ROLA 5F1RA 1K4DB 5LAPA 2FT7A 3ZPDA 1ID5I 4GIOA 1RUG3 2DVAA 3BHBB 3WUCA 4A55A 3WFBH 3NEEA 4EI5B 4WM7A 2W46A 1O6SA 5INDA 4AKPA 1W0NA 4GWJA 2YDEA 1YEGH 3IFLH 3MTRA 5HHQB 3JD73 3J27A 1VIWA 3D25B 4XMPH 5MP6H 4GUPA 3CH1B 2FTAA 4XRCB 1MHEA 3V0WL 4CVXB 5FYVA 3HE7B 1WD4A 3LJ3A 3WDJA 5EC2A 1LEKA 4G43A 2F7OA 3EHKA 2HLAB 4JE0A 2MNUA 2DQTH 2OSLB 1EHLH 1NCCH 3RZWA 1ZBA3 5F8PA 3SNMA 3RP1A 1EYBA 2XONA 4JN1H 5KYXA 1UXMA 4IKJA 4NQDB 1DGLA 5J11B 4M93B 2QPUA 2FJGB 4N0CC 1YCIA 2QQLA 2XWBB 1PZ7A 2YZ1A 1CJDA 2NN8A 3T0AA 4OD2A 1OLME 3BRFA 1OTUD 4RNRA 1SVCP 1W6MB 4XNYL 4H20L 4UV7H 1LQBC 1O7SA 4AT6A 4X4KA 4ZXBA 5E08L 2WTRA 5ETUA 4GD4A 3BI3A 2QJDA 2Y24A 4F8TA 5E6YA 2PPAA 1AVAA 1DL7H 4L4TB 4N8CL 3JWDH 2X05A 1SBBA 1LEIA 1TEIA 3VFMA 1D5IL 2F5AH 2DI9A 2M1KA 3SBQA 4GBXC 2IZWA 5GQBA 4KVCL 2UX6A 4RQQA 4P2CG 3G6DH 4QO1A 3LGRA 2X0UA 2YPLA 1J3PA 5F5QA 1BQHB 2XV2A 1LO0H 3HBGA 2LFGA 4N8VB 5BRZB 2D0HA 1J88A 1INQA 4G8IB 2BSSB 1UKRA 3EFDH 2CBTA 5LWYL 1LHZA 1GMIA 5HGGS 5H9RA 2W91A 3DKQA 4FPCA 4YSEA 4FJYA 4NQEE 3UJQA 4NT6B 2H0VA 4G8GE 1KJVA 2LFEA 4RWYL 2AENA 1J0YA 4FXLA 5C5TA 2G3ZA 1VRH2 3EO0A 1S7WB 4LASL 1V7MH 3HVNA 3MRRB 4J3OC 2IFWA 3TVMD 2B1HH 2AQNA 2XQYA 3IDJB 1W0WB 3TS8A 1JGLH 3P3UA 4XFCA 2IFGA 4AI9A 1BBT1 1E28A 1WWWX 3GLAA 5HXVA 5KANG 4A38A 1FPN2 3NACH 4NZRL 1FNGB 3CKHA 5HBAA 2P44B 4Z3IA 1QY4A 1JFHA 4M56A 1A6WH 2QKIB 3BLKA 5IBLC 3HNSH 4M6NH 1DFBL 2QQKH 5DC4B 3TBWA 4L8DB 2AQPA 2VXSH 3CPLA 3MACH 3P1IA 3WP3A 4PBPA 3JUYA 4BQWA 4LLQA 4G5ZL 1SN5A 1MWAA 1YN7A 5F7LB 2D8KA 5AZUA 4HCIA 4NRZB 2YPDA 2AJZB 4KK9C 4GKOA 1D7BA 4F3JA 3AXHA 4QQHA 4JKPL 1P7QD 3UV9A 1AGCB 5D7LD 2LW8A 2Z7UA 3WCSA 3HCVA 4HDIB 4KI5C 2P3JA 1KLUB 1YYLH 4V2BA 4L9LB 4XWOC 4U1NA 1E5CA 1A1MB 4HWBA 3C2AL 1IGCH 2MWCA 4TWTA 3SDDB 4HUWA 5DJ2B 2FMYA 1KXQE 5F7MC 2C5DA 2L0DA 3ZT6A 1KEML 1QYGH 2QHLA 3QWRA 1Q8OA 1AANA 3T0EC 5FV2A 2K8MA 4KXAA 1UOBA 3AKRA 1KV7A 2O72A 3WTTA 3NJJA 3U30C 4ELMA 3K3QA 2YO3A 4EQVA 4G42B 4NCC2 3GB7B 5J1SC 2VRQA 5IAVA 3PXJA 2YGOA 1FF5A 1HL9A 1K8IB 4O5LL 2PA7A 3IIAA 5GZDA 1MQTC 2QV2A 2ARCA 3D4ZA 2R063 2W59A 4Z3EA 2X89D 4YGVA 1D2SA 2JEMA 4TUJB 4NP9A 4ZUSA 3ZXDA 2V8LA 4IMKC 1DVQA 5D7JD 5C0BD 5I6XC 3SGEI 4Y1YA 1QHOA 2XJUA 5GM0A 1A7QH 3FFZA 3RZMA 1KXTB 3QUYA 5FZ0A 4ZPTB 4XDPA 2XQYK 3V6BR 1FX5A 3SPHA 1QUNA 3RJ2X 4X6FB 2Z1KA 4AEJA 1Q8QA 2WAHA 5F72S 1FBIL 1GSMA 2YD0A 5T1LD 1AR91 3MZGB 1E3ZA 4Q0QA 4WFFE 5ABJA 4BQ3A 3SKNA 2J1TA 4HALA 1Y6NR 2A5ZA 4QGNA 1A7NL 1GOHA 3QFGA 2XZCH 4Y4RA 1J0ZA 1K5WA 3JV0A 2YU1A 1LO3H 1TTRA 2AZAA 1QRNB 3H42B 1ETB1 2ZKXA 1B0GA 2OPCA 4N0FB 5JHDD 2ZEXA 1IGFH 1UCTA 4ODHH 3VRLE 1L7QA 4YVNA 1PNCA 4P23D 4Z7OF 2R1XB 5CJXC 1NPJA 3O0RH 4JHUA 2DWEB 4E2QA 5EO1A 3G5XA 2V7HB 4WI7A 4AL8C 1S7RB 3GSNL 2GABA 4GY4A 5JR7B 2FX9L 1C5BH 3N9PA 3GSRA 4YIQA 5T3ZE 1KTKE 2WNKA 5IG7A 2VN6A 1QBBA 2WO3A 3U4EB 1E5AA 4GLRI 3KJ6H 4RZCB 3RDTB 1BBDH 2UYLA 4AQEA 5C0EA 3HWJA 1T5XB 4HX1A 1LEMA 2EIMB 1F41A 2ADDA 2CDFA 1VCAA 5CLZA 1Q0EA 4BZYA 1CPNA 5MI0B 2A9AA 3L3HB 1XNDA 4L0ZA 1MHHB 3NSDA 4FZ8H 4J8RA 5T3XD 3RZCB 1DJHA 5C7XL 3P0GB 4YHML 1KJMA 3V55A 5CFCB 5C86A 4UI9L 5LGKA 1VB9A 4KRMB 5FUOH 1HHHB 4QRUA 2EKSB 3CJIB 4CRQA 4NENA 4LE3A 1V27A 3GZKA 1X5KA 1XB3A 1XSOA 1K8DB 4K5MA 3UJJH 4KZDH 5J89A 3WG2A 4LXFA 3RWGA 2VNGA 2A3XA 5EC1A 1CB4A 5KVFE 1BIIA 3QG6A 3WO3B 2NP0A 2PW2A 5L9DL 2BNRA 2YKKA 4FFTA 1ZHKB 5I1AB 4PV9B 3A6BH 2YUVA 3BPNB 1XGZA 3VVVA 4ONGL 1H0DA 1K4DA 1JS4A 2ZT9C 1JYNA 4UZSA 2YMOA 4JREC 4XXCC 3RY6C 1XAUA 1TQTA 4M6ML 4ABWA 4AQAB 1HXS3 2P3YA 3GIVA 3I9IA 3QDMB 4WNSA 3ZDZB 2DM4A 5HI5C 2WA4A 2IOIA 1KNOB 3HT1A 4D8PB 3CO2A 1KPUA 3MYZA 1ZK5A 2H32A 4LKXB 2GTQA 3TA3C 1G7LB 4DFIA 3BKML 3OZLA 1W03A 2RCSH 4TVSa 4X4MA 5T33H 1LGBA 2NW2B 3QCWA 4V1DB 2ZKNA 3GPEA 4L3EE 1AHKA 1MVYA 3ASIA 2HLAA 4C56E 2YGMA 2A4EA 1Y7VA 4YDIH 3BPSA 4JQRA 1I9RA 1X33A 3BVVA 3R8BB 4NQDA 1S7TA 3FCSA 5CS7A 2XDVA 2DQEL 1CXEA 4OFIA 1PU0A 3FQNB 5IJVB 3A6CH 4JO3H 3AZYA 4L4JA 1KXGA 1PZUB 4W9ZA 2XWBA 4NOFA 1EFXD 4P5SA 4L92A 3V4UL 4LCIL 2YSSB 2VM3A 1I8MB 3FWEA 1JXJA 3V52H 1SQ4A 5D1XC 3JT2A 5CHNB 5F7FA 3MF6A 3BMWA 3U7YH 1BQSA 3GTNA 4L4TA 1AS8A 1NPUA 3FDWA 5FCSH 4DVRH 2PWEA 2I27N 3OKKB 2A9NL 3DV6B 3GBML 1L6PA 2RIKA 4NCDA 5DEZA 5HD8D 3NAPB 3F3HA 4X98B 2Q8AL 4I0CC 3FTXA 2ZE0A 2XTJB 1SJXA 3ETBF 1UVQB 3RWEB 4JB9H 1H5BB 1EEZB 1K12A 1LOAA 5LBGA 1S3RA 2PWDA 5BRZA 3QJUB 3ARGD 4XXWC 2BSSA 3FS9A 5JO5B 2FQGA 4CCDA 1YEJL 5LEJA 4PSPA 1U3HB 1HQWA 3WXVL 3T4YB 2CU5A 4BQBA 4M7LH 3AQDA 2J71A 4X9IA 3RFZB 4DP8X 3MV01 2YUWA 1S7WA 5B39G 2OYMA 2BTVC 3FQRA 1OAUH 3MRRA 4HCRL 3VYOA 2CGOA 4R9AA 1I1AD 4H8UA 1OE2A 4PJIF 2R27A 1TTFA 2VCAA 5IVFA 3I49A 4PMFA 2V6HA 4MDJB 2W52A 2VN5A 4OZXA 3F95A 4MAYB 1FNGA 5I71B 4PG2A 1PGSA 4HAKA 5DC0A 1XIWA 3HMXA 4PN6A 5KVGE 3Q2WA 2WZPA 8CGTA 2Z4TA 3BISA 4PHXA 3TXAA 1UMZA 5HDBE 4QPGC 1QSFD 4L8DA 5C6PB 1HK6A 2FSDA 3VBSC 3A5VA 5L6YH 1ETA1 3A0NA 4M8UA 1SNRA 2UVEA 2AJZA 5C0AE 2IXQA 2DLTA 4I4WA 3F12B 4N43B 1P53A 2AXWA 1WFMA 3C08H 1GICA 4NDMB 3E97A 3D0LA 4HDIA 4QCIB 4XC3L 2Z9TA 4LLYB 1U8HA 1Y1UA 3BN3B 1KTDB 2DWDA 3B9KC 3E3QC 4L9LA 4HBCL 4Y2LA 5LCVH 4MGSA 2HJLB 2DEWX 1IKNC 2IF7A 3N04A 3RJRA 1BP3B 3CSTA 3QUMB 5DJ2A 5FHAH 5B38G 2EE6A 3KCXA 1RLBA 5FECA 2IFFL 2CXGA 4I18C 1L5GA 2F68X 5LRRA 4FPKA 4YFZA 3LOIA 1RXLA 3SDYH 1BZOA 3DOSA 3QA3A 5LG6A 1H3TA 1AYRA 1ZA4A 3MLTB 2VD7A 3ZIXA 2EDRA 2WWOA 1FV1B 2Q3AA 3SPJA 1WLTA 1J1XH 5D93B 1JH5A 3VWJA 1DUZB 2XV3A 5JOXA 1WZAA 1JMXA 2ZPKH 2J6EH 3ULUF 2BZ7A 5JHBA 3U83A 3L45A 4PWFA 1PYWA 1HLCA 4GKZB 4ZQKB 1HL8A 4QXWA 5KSAD 1J1OH 1XBFA 4LQRA 4TUJA 5FFLA 1SLCA 1PVC3 3AL6A 1REFA 3UTQB 4HS6A 4CEWB 1VAHA 5FGBC 1W2UA 2F6BA 5FWRA 1W3VA 2XCMC 3BQUD 4X0KA 3VG0H 4EZMA 4ZPTA 1H2KA 1MS8A 4OIIL 1XTLA 2YLHA 1SPPA 4YXKH 4X6FA 5J13B 3JWOL 5DHVA 3LHPH 3KQRA 2EXWC 4LLOA 1UU5A 5FZ9A 4U3SB 2IXCA 5E23A 2AABL 2YGQA 4HMDA 3MFCA 4PF5A 2OVUA 4I1PA 4S0HA 2VULA 5JHLA 5CILH 1A7BA 3CU7A 1KYFA 5JDJA 4LP5A 4F20A 1OV8A 1QRNA 1E6JH 4HWZB 3T6VA 2RTTA 1P7BA 2ZP0T 4J6IA 3SGEH 2WQUA 1IGJB 4FEIA 4N86A 4FPHA 3PP4L 1JUFB 1SJEB 2DMCA 4FFZH 3QORD 4K8FA 1OVPA 2DWEA 4Y4KC 5EU5B 4UFHA 3MIEA 3T30A 1LK3L 1HSBB 2WLNA 5F7UA 3ZN5A 1OD5A 2WDBA 1UWYA 2HTKC 1RURH 4HW6A 4ZBJA 1OZTG 4X7TB 4JFVA 3RVXC 4AK1A 1PFCA 4HFWB 3C09B 4JY6B 3U4EA 4UF0B 1KG0B 4Y9EA 4C54A 1QJFA 3VFUA 2BYVE 4JGUA 3UCQA 5E6RB 4OCMC 1A4CA 2QQOA 1T5XA 2Z8VC 1I8AA 1YEDA 4FS0A 4XP6L 2ET1A 1NLSA 3FMGA 1S5IH 1MLBA 3QQNA 2C7FA 1MHHA 2F61A 2V37A 3RZCA 3DJ9A 2H0FA 3QZNA 4ZMZA 1D2QA 2FHRA 5ILTH 3MXVL 5LQBH 1ZS8A 1J9TA 3REVA 2QSQA 5T55A 2EKSA 2IEPA 3CJIA 3FTUA 3PGFH 4GRLC 1NA1C 1NC2D 2ALWA 3F04A 3PP3H 2B8OT 1JPSH 2MOQA 3EO9H 1SYVB 2KZBA 3RI5K 3OBTA 4GLRH 4JDMA 2HG0A 3B6SB 2HN7A 4JQXA 1DTUA 4N25A 1ZHKA 5I1AA 4OJEH 2CNZA 3KJ4B 5K5YA 4WTZG 4JPVL 1KIQB 5D7EA 2WBJD 1FFOA 3LXAA 3NWKA 3FOLA 1MFVA 4F5CE 1JWSA 2CAKA 3KDMB 4PJHB 3TM6A 3HUJE 4JKMA 5EORL 4ENZA 4LA2A 2XN2A 4FYRA 4F1ZA 4JFWA 1KB5B 2MRYA 4HETA 3ZFFC 3OUJA 3EHBD 2CJSA 2IPUK 1CTNA 5DS8A 3MNMA 3WS6C 3ZHKA 3ML9A 4LKXA 4HC1L 5BO0D 2IWGB 2MEV2 3SCMD 2R9HD 1O6UA 1N8ZA 2ZSVB 1A4BA 2NW2A 5D1QB 5DGQA 2AJYH 2WLHA 5F1IA 5T5FH 3QXWA 5J1AB 1J3QA 2B15A 3ZDYE 1MY7A 2BW5A 1YUKB 1CL7L 3MJ7B 4EDWH 2D7TH 3AWGA 3D3VB 5BNQA 2B14A 2Z35B 5T1KB 5JZ7C 1BOGA 4AENA 5I6KA 1NSNL 2UY9A 4XCYA 2ARAA 4ZW7A 3IJHA 2ZXAA 4BBWA 4GXVL 3POFA 2KC0A 1U36A 4K6BA 1XF3B 4RGNC 3SJVE 4UAOC 1RUJ2 1KTLA 1G9EA 4N53C 2AP2A 1QXPA 3LIUA 3MRHB 4F7EA 2YSSA 2HX7A 4JFEE 5F3BA 1I8MA 1O4YA 5HJBA 3KF5A 1IKFL 4XFAA 1M1XA 3ZN6B 3HG1E 3TO2A 2IH1B 3QP3A 4HJ0C 1AKPA 2YJLA 5KS9E 1MCWW 2W38A 5B3SB 3IN0A 1S46A 2BDNL 2JKTM 5C3TA 4N90A 3QT2A 2H3KA 3AS2A 2WLZA 1GBGA 2CHHA 2FEDC 4JM2C 4A7VA 1DVFD 3GSVA 3TZVC 1XR9B 4X98A 3ILQC 1UXWA 5DDJ3 1LP9B 3QZWB 4NBZB 5D4JA 5SX4I 4XMUA 3PJLA 3QZOA 4YVWC 4LOFA 3A22A 3LHAA 3ZK0A 5KHHA 3WLWD 4IEPA 5T50A 1F3DH 3NCJL 4PWJA 4F24A 3DLQR 2PP7A 1U3HA 2VDMB 4S1QH 4B0MB 4PBXA 3PL6D 3NW4A 5K9YA 2BSBA 1D4M1 5AFAA 3ZW3A 3RFZA 5I6OA 1CC3A 3MXWH 3G6AB 3NZ8A 1ZDSA 3PS6A 4FLRA 1T04B 3PJSB 4KJYB 1KJ2B 4CU9A 5CEZE 3BE1L 3RTQC 2AEPL 3CDGA 5D1IA 4FF9A 1URXA 3UTTB 2AMGA 2ARWA 2Y6LA 1ODMA 4PCRA 4JPIB 1KGUA 2ATKA 3C6LB 2JX9A 3W5NA 1DBJL 1IGML 4ZS6D 3VBUB 2D03L 5FGSA 5J6GB 5BNNA 4H88L 1YNKH 3NIDB 2A9DA 4F27A 1BD2B 2MSPA 2X42A 4ZU5A 4EN3C 2YKLH 1GMEA 4WW2A 4QQOA 1Z1WA 3B5HA 2E9IA 2QGEA 5KHGA 4OY9A 3THML 4U7SA 3U2SB 3DTUB 4XXDB 5JXGA 4YHKH 3J7LA 3NIFE 1X36A 2ET7A 5E1AB 3LTVA 1MW1A 1L6ZA 1MDAA 1ZJBA 2XQYG 2HFTA 3MRGB 4N43A 5D8AB 4C8DA 1UURA 4JV4A 3SXWA 1WBZA 3SYQA 4FNPA 4K71C 4NDMA 1HN1A 1E4HA 3L9RB 3J8F2 4LLYA 1QAWA 2DLFL 3LKSB 1GZTA 3H1YA 1T2XA 2MJWA 4HJTA 2C3HA 2HJLA 5CSBA 4TL5A 5KEZA 5FXXA 1JPTL 3HTLX 4IIQC 4QIRA 1R3LB 3UBHA 5ACZB 1SACA 2XETA 1HHKB 1R1A2 3PIJA 2EXSA 3ACIA 1AJKA 4AYDC 2HWC3 5FS5A 3J8F7 4MJ6A 4BK8A 2CSGA 1BYHA 1BX2A 2ZOEB 1AR1C 5FPLA 4BIFA 3E5UA 5GS0L 4BZ4A 1XXFC 4DIXA 2Q1ZB 3ZTNH 4ZW5A 3DK2A 4DO0A 5FYKE 4LCCC 3MLTA 2VXRA 3S97C 1CWPA 1FV1A 4NN0A 3NCXA 1JOIA 1SM3H 4RGOL 3RJQB 1UB5B 5I0VA 1G9NL 4JKKA 4J3VA 4PJDF 5AFBA 2AJVL 4FFVD 3I9AA 3IU3A 3NCYP 1U42A 2CQVA 5CGBA 2ZHNA 1OB1A 3WX5A 4KKQA 4PJ9D 5I5IA 1YYML 5MHSD 4PDWB 3M7FB 3C7FA 1TQCC 4YLCA 4KNQA 4Y4FD 1UKGA 3IDNB 4UW4A 3PHQA 5ESQB 5E6HA 4OCSL 3FZUC 2KZWA 4HKBB 1YEEL 2UY6A 3K6SB 1R0AH 4XILA 3EMRA 2ZWLT 2AREA 2NOYA 1JMUB 5AG9A 4Y5XB 5C09B 2ZJSL 3MGOB 1GGYA 2AK4B 3STZB 3SKVA 1CZSA 1DSFH 5I5MA 1FL6B 4WM8C 4LMQI 5IJDC 1AXTH 2JKBA 1YRZA 2CA4A 2Z31C 3P4NB 4NN7C 1KIUA 2GK2A 3KLHC 1QLEH 1L9OA 2EIDA 2ALAA 4EXKA 5M0TA 4ZOCA 4W4OC 4D3CH 1UZWA 1S5HA 3OF6D 4JY4A 4HWZA 3MDPA 2D31B 3VE0B 2W5PA 2X5IC 2XBO3 2E31A 4PJYA 1JCVA 3FT2A 5ESAB 5ACA3 1JUFA 2HT4D 3ZGIA 3PPEA 3VXSD 1UN1A 5EU5A 2HUHA 1N1VA 4IEWA 5BS0B 1A9EA 5KJRH 5AC92 3UPRB 1WAAF 1U3NA 3HE6A 4WZFA 3VHNA 3ULSB 4E41E 5JIPA 2XL9A 1A6TB 1VFAA 3FO1A 4QLWA 3CF6E 1HTYA 1RK1B 1UYWL 4JY6A 4UF0A 3I2KA 2BVBA 3BXNB 3K8KA 3O4LD 1QHDA 1PZBA 5AAMA 1XMWA 4UCFA 1FNSH 3QEUB 3BPLC 4APXB 1CICA 1EIBA 3VFSB 3PWNB 3R0NA 3E8UH 3WJJC 3T09A 1AQHA 5IHUH 1L7RA 5IQOA 3QEQD 2AEWA 4Q0PA 3NCWA 1DEEB 4WI0B 4W6YB 4LQ1A 1HKFA 5EA0L 1FVDA 1Q8VA 3D09A 1LNUA 4OVUA 3QCTH 3RVVC 3ARZA 1Z7S1 1UX6A 5C0RL 1SYVA 2AAVA 4TNWK 5DVNA 1P6FA 4DN4L 1ZNPA 1V3KA 3MNDA 5BW7A 5HHOD 1B6DA 1QPXA 3GKWL 5AB0A 5FY4A 3DO4A 3VXUE 3JWNC 4CSTA 4DGYH 1QWRA 4FN0A 5A7SA 3OQ3B 1ZT7B 3WAKA 4XPGL 2H1LM 4LPCA 1ZLSL 3RVTD 3UBXB 3KPRE 4HCRA 5ERWB 3WN6A 2Y8KA 5FO8B 2GEQA 2VJ0A 3KDMA 1AR92 1HHJA 5EF0A 3O6KH 1FA4A 2FBJH 3ARBA 4AYID 4GMP3 2LVEA 5LAXA 1BPVA 3B3IB 1OSGA 2WFF1 5KOMC 2FQPA 3CL1A 4MNQE 4P14A 3N1PC 3ULVF 3TBSB 1G4RA 1JU4A 2A74C 2BJML 4PTUA 4LIUA 1GP5A 2V0AA 1VGEL 3M17B 3ZDXE 5FPIA 2Z7YA 35C8L 1QNIA 3OLGA 4PS3A 5GSVB 1UCBH 3VN4A 1S7SA 2IXHA 1PG7X 4AEIH 1C9SA 3GRWH 1N3NA 3TF7C 2Z1PA 2J57A 3OM3B 2CM5A 4ZS7L 1A9BA 3SQBB 3AMMA 2OULB 2H2SD 3MNWB 4IJ3B 3DPRB 1FZMB 1GWMA 4YBLB 2JQMA 3I75A 4P46A 3QO0A 3GZQA 2A77L 1EBAA 1WZ1L 3FU7B 3N1QC 5MEPB 1QSED 3U9PL 3KHBA 1A1NB 4FNQA 4MNGB 5IVZB 2PXJA 2GG1A 3MRHA 5A7BA 1QKZH 1CICD 3IJYA 4I0PC 4Y2NA 2J43A 3MBXH 3ZN6A 5DMKB 4KAQH 3HLAA 4B60A 4BFRA 4O58L 1HL4A 4M7ZC 5C8CA 2LT9A 4DY3A 3LXUX 2EO1A 3GSXA 5FKPB 5EO0A 1U21A 4YM3A 1LOFA 5GSRB 1WBFA 4NUMA 1G9DA 4AIZB 1XR9A 1LP9A 2H2PC 4ZI8A 1OFSA 1PS3A 2HRGA 3K51A 2F17A 3K2OA 4AVAA 3VBOC 3MNVB 3DGTA 1EHXA 1BBJA 4QX0A 3MHZA 3N1MC 4YZ4A 4KX9A 2DI7A 3SE9H 1FAIH 1QPPA 1UOJA 4TLFA 5F6KA 3VXMD 5D21A 1H8OA 1I4FB 1OCOB 4LIQH 1EZLA 1YI7A 4D7YA 5JMCA 2J8UE 5BPXA 1JGVH 1HN0A 4D7PA 1NFIB 1T04A 3PJSA 1KJ2A 4TQHA 3WL9A 4AWJC 5EWSA 4GXUM 4NGHL 1IS4A 1X7NA 4ZMNA 1OP3H 1T66C 1XYOA 4P5KB 2X09A 5SX4H 1EX0A 1NH6A 2CHNA 3FB6B 2UWEF 3T3ME 2EXYC 3VHRA 4NAJA 4A39A 3ZYBA 1PX3A 3ZX7A 2V5TA 3RRQA 4JPIA 4I0WB 3C6LA