4ES8A

Crystal structure of the adhesin domain of epf from streptococcus pyogenes in p212121
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
302
structure length
302
Chain Sequence
b'EELPDDLMNFKGTWEVSADGSSGRFFSKGATDSYVFHLIPAKDVKKPGWREHNEVKDSYIKIDKQSIAARYKTSTTAPYSVAFKVNTKSLIKDHDYKITFEQGQIASGITVDYRIGSAFNKTTDDSFKISDESKYASNVKIEGEEQGFKQREQGDKTISFRTLKEGPMSLVLLSKVEKKPQGDLDVEFKNLKIIDVTNPSQLDKGVAYVGNKNVQLTLKSDDGRTNFEGDEISLFNSRGELLQTVTVTKDQQNPISITLSEDQAKSLKNKEKLKVSIKQKQSKKTSKDFFFEVGIDPKVEAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epf
molecule tags Cell adhesion
source organism Streptococcus pyogenes
publication title The Extracellular Protein Factor Epf from Streptococcus pyogenes Is a Cell Surface Adhesin That Binds to Cells through an N-terminal Domain Containing a Carbohydrate-binding Module.
pubmed doi rcsb
total genus 80
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3580 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4es8A02
2.60.120.1240 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4es8A01
4ES9A 4ES8A
chains in the Genus database with same CATH superfamily
2VLRD 4PSRA 5HGHB 2Z8RA 1EO5A 3E6HA 4TNWF 1R093 1WD3A 2E32A 4UW5A 4LOSA 2DD8H 2PUQT 4NQXB 1JOIA 3GXIA 3HG4A 3TA3D 3GSRB 1DQMH 2NY0D 3IFLL 3HRZB 4LF3A 1WKYA 4ZDHB 4UYBA 2EEBA 2NQCA 3ORJA 3ZDYB 2DEYX 4UF0B 1U2YA 1XL4A 3QPXL 4MS6A 4NUGL 4DGIH 1E3FA 5B39A 2NYZA 1KGIA 3FOMA 5T3NA 3ELQA 4Q27A 2E4FA 1SXZA 3TYJA 3I75A 1GGBL 2AEPH 1G7MA 1EBAA 3CZUB 2FYYB 2J22A 5A1LA 2MEV3 1U8PB 2AC1A 3BPLB 1N8ZA 2I9LA 4DNLA 4XNZC 1SLBA 1LP9A 5FGRA 2PWGA 1JHLH 1OM3L 1BVP1 1J8HB 4JG9A 2W59A 3MFGB 2OUJA 1LESA 3EBHA 2DDQH 3KVPA 3B2VH 3CX5K 4DCQB 1L7IL 3G6JE 1E5BA 4JRYA 3AP6A 3DX7B 2CGNA 1I8UA 1QLRA 2IQ9L 2J5LC 4L8DB 3S37H 3ZO9A 5F9WC 4BSWB 1PMJX 5DHYA 2X53S 1PLCA 1V6NA 1P6AB 2PCPA 5BV7H 1S78C 1XTMA 2WINA 1RUNA 1IGTB 5CKGA 1G1KA 1DVFA 2QQLL 3MNDA 4PLJD 1SOSA 3BGMB 5KUMA 4OZGE 3S8WA 1QJY3 3UKNA 2YMXL 4F2MB 5DG1A 4D7YA 3WQBA 1U4EA 3HI6L 4BHPA 3U36A 1QRND 1DQ6A 4ZZ5A 2KLRA 1T4KA 1TEYA 3ARYA 4EYUA 3DIFB 1MHHB 1YYCA 2HFFB 4TTDC 1AVAA 1C5CH 1R1CA 3A4EA 3RU8H 4L4VA 3L3KA 4P8QA 4WM8C 1FVEA 3PWNB 5JPNC 5D5ME 4G71B 5E89A 3S36H 4JQVC 1I7RA 3CHSA 3VE0B 1FJ1A 4NCDA 3IMNA 3ULUL 4HEPG 1JK8A 5C97A 1AXIB 4ZDHA 2FAUA 4KI5E 5LEJA 4W9HC 2PXYA 5I18H 1VFUA 2DTWA 1IFHL 2N4IA 4K3JL 1V10A 3GMMB 3IB3A 3PIQA 1LDSA 2V4LA 1QBLL 4AQAB 3B9AA 4AEMA 1K6QH 4MXWH 1J1LA 3D25A 1ZA3A 3WFCL 3C9NB 4DO0A 3SGEI 2YD3A 5E2TL 4XMLH 3VM7A 4MFHA 1B6UA 2X2UA 1EHLL 3TJPA 3Q2CA 1S0GA 3P30L 1RUD3 2E9WA 3PWPE 3ARGC 2NY2D 4X7SL 4L29A 2D7NA 4UOQA 1R46A 4QXVA 4LMQE 3VJ6B 2XRAL 5HI5D 3C8HA 4BH7A 4UDUA 2CLZB 3QR0A 4RMQA 2GH8A 1YY8B 3KPSE 3DX7A 3NCJL 4KJPD 4YGVA 3LCPA 4K8FA 4NJ4A 1YAZA 4BQ4A 3LFMA 2Y5TA 3QEQA 2RDSA 3K72B 4PLKC 2QZ3A 5J1TC 4E27A 1SQ4A 4CKQA 2HWD3 4JG1H 1N19A 4YQXL 2FZ2A 4P05A 2ZWLT 3IYLW 1RC6A 4Y5XA 2XA3A 1D7CA 2KQNA 4XN7A 4NUGH 4J1WA 2I9TB 1J8KA 2R59A 2DQUH 4M7JL 4P5TD 3NAAH 2HEVF 1O8PA 4GKOA 4OCTA 2FZ3A 5B38B 1CZ8H 1SEFA 2ARJQ 4XCEB 5LAPA 2MEV2 4LP8A 1QSFD 2V8MA 1MVUA 5F7LB 4E68A 1MW0A 5E8AA 4B3NA 1D5BA 4I9WE 4UTAL 4Q9CA 2HWD2 3O0WA 3WQ7A 1JZ7A 3T08A 4D6SA 3CDGB 4IGBA 4IGQA 2NXYC 4N68A 3GSQB 4OF8A 5C3IA 2D7FA 3P1IA 4YGCA 4HS3B 1NLDH 5EDXA 4Q89A 3B5HA 5KJRL 2D4DA 3MLZL 4L92A 4I30A 4MXWB 1JNHB 1KYUA 1DBBL 5BJTB 4KG0A 3I84A 4Q0QA 3PU7A 3KPSB 4GI8A 2R2CA 1RPQA 3V6OA 3QZWA 3NCBB 4O51B 2IAMB 1KPVB 3NCFB 4CCLA 4A6YB 1BMV1 1V70A 2VBBA 4XFGA 4JVPA 4WI3A 2XDHA 2LTQB 1MCSA 2I07A 1L7TL 3QEHA 4O2FB 2YMXH 4UNVA 1HKLL 4B6ZA 1M2OA 2BGCA 4XBPB 4AJVA 4YDMA 3HLAA 4NZJA 2Y6KA 4QHLA 1BYHA 1TTUA 4L4TE 1KCLA 4OHXA 2EIZA 2HRHA 4N1EA 3NGBC 5KANG 1X5IA 4D7SA 5FP3A 1P5VB 5D7LD 4FSJA 2AANA 5ABJC 4CZSA 4ODVL 3ZE2E 2FDFA 4NRMA 2OA9A 4G8GA 1RIHH 1MVFA 1PSKH 5J6HA 3BI3A 1AS8A 2BRRH 3MJGX 1V6LA 5IGXH 2WZ5A 2BNOA 4RBPK 2GBAA 2X05A 5JHLH 3ZL4L 4N8PA 3MNMA 3BH4A 4EAEA 2BINA 3GBML 4QNPE 4CEYA 1NCGA 2QVKA 3X11A 4GUQA 5CLTA 4AZ8B 1Q8QA 2VW1A 4AFCA 2UWBA 5GSRB 3F95A 5DZNA 2RS31 1WTGT 1T2XA 1F58H 1G9MC 2A77H 3D82A 1E8YA 5A7NA 1D4VB 4ZQTA 4MOAA 1LEGB 4G43A 4GKNB 4Q9BA 4XMAA 1U0QA 5FR3A 4PIXA 5D1IA 2C9SA 4DPRA 3QUZB 3VGHA 3PY9A 1YFXA 4AHZA 4A41A 3H6JA 1P7QA 5L9VA 3QHZH 2VAUA 3KF3A 3OOXA 2YD0A 2A6WA 4CDUA 4TKWA 1RJYB 4L9LA 5DD6B 5F21B 5A7BA 4R8HA 2K6YA 2D03H 1AMXA 4XMIA 1SJMA 3O45A 3QYCA 4HCRH 4DEQA 4JVWA 5GLWA 1ND3A 25C8H 4N90D 3QQ3B 4K94C 4OR1A 4XVTL 1A66A 2E7CA 1B0IA 4GEIA 4R4XA 3FT3A 3LH2L 2OZ4H 3OHXB 1LEMA 1TPXC 3BW9A 2W46A 3P77B 4ABWA 1YYNA 2PPAA 1H3TA 3WT3A 4OJEH 4LEOB 4Z7QE 3UEZA 5KYYB 2K4WA 1BYNA 2VM9A 3ZX1A 3LKJA 1V6MA 1UZVA 4TUUA 5L6YL 3JUUA 4LPUA 5T5OA 3ETTA 4L0ZA 4PJFA 4Y9FA 5FF6B 5D93C 3AVEA 5DHEA 5BNOA 1CFNA 5JW5A 2DZEA 1QQP1 2HWE3 3AK0A 4Y5XC 5IJCC 1OTSC 1RPUA 3H8XA 4CBPA 4QRRA 3WYRA 1I8KB 1OB1A 2UZYB 3A5VA 3GJEA 4LOTA 3BVCA 5FXZA 1AXZA 1YMMB 2L3BA 4HJ1A 4QB1A 5IG7B 4UFKA 5D1QB 5E23A 1KLUA 4AJYV 3WU1A 2Y6JA 4HF5L 2ADEA 1PAZA 3L2MA 4QOKD 4DGVL 5I71C 4WTZA 3QOPA 3J07A 4I18A 3TYFA 4N5EC 4OM0L 4JK0D 4NENA 3ZXJA 3NDZE 3DLQR 5TDPA 1JZ2A 3ETQA 3QEUB 2ZP0T 4C8DA 2DQIH 2NR6C 1PS3A 3N6YA 4MVBC 5D7SH 1PZ5A 4NJ9H 5H94B 1NJ9A 1SDDA 3CC1A 1QDCA 3UBXG 3FTGA 4YZ3A 4LORA 1RUAH 3FULA 2KMWA 2BSSB 4NZTL 1D2QA 2BGOA 2WKLA 1NEZG 1K8IA 2RMU3 2MWCA 4JFTA 1MWAB 4LCYB 4KQ4H 4AFMA 1SMOA 5C0CB 1NCUA 1QSVA 5FYLH 1AC6A 4YLQT 4EOWL 3OAWA 1JL8A 4ETQB 4GY4A 3ZFEC 4WLCA 2XZQL 3JYBA 1JUFA 2J1WA 1QZNA 4FQPA 5HVFB 2AK4E 2EVJA 2GQHA 5D7JA 4OGYL 1JNLL 1SLIA 4IIZA 1XRUA 5JOEA 4QHLB 4HUCA 3TBCA 5C8CB 2FEDD 4A7QA 4BFKA 3RWGB 5KR7A 1FMD1 3PUQA 5FTTC 1KIQB 3P9LB 2EAKA 3QUHA 4MQTB 5I1HL 1H8TA 4IJ3B 1BMV2 4BRJA 3ROLB 4M5ZH 4PRAB 2PYEE 1AG6A 2Y4SA 4JQXA 4LRIC 3GBWA 1LO0L 1WA2X 4IDZA 2JI1A 5K1VA 3GLZA 2C9UA 3OKMA 1YY9D 2VW4A 1QJX2 4KI5C 1W9WA 1H5BA 3MBXL 2OI9C 3EHKA 5FQ0B 4QLRA 3OG6B 1DVXA 5EUOF 3B3QE 3MDPA 4LCWA 5IKCA 2FYYA 3F84A 1KPRA 1OQXA 3D69B 3C60D 3LZNA 4U1GB 4YPJA 5T1KD 2GALA 2PTTB 2VMHA 3DOIA 1S7VB 3MV8B 1BLZA 5B1JC 3REWA 4YSRA 4M0NA 5IAVA 3SCGA 1MRFL 1YFYA 1OLRA 2W0FA 4I88A 5C3QA 4ODXB 1G9HA 1YQVL 2H3XC 3WEBA 1ZPLA 5KJ7E 4A2LA 2WWNA 3HUJA 3RGVC 4GS7B 1E4KA 4AYUA 1MRCL 1XH3A 1MFDL 4XXDB 2XKOA 3KJ6L 3LX9A 1JXFA 1I1AB 4J3OD 4RQQA 5J9PA 4ITCA 4Y1UA 2V7NB 2C9XA 2HLFD 1OAXL 4BQCA 5FW8A 4GQ9L 3HEIB 2CRIA 1MHHA 2CO6A 4K5PA 4ODTL 4RIRA 4UZGA 2DM3A 4NLAA 2VVDA 1MLCB 3TURA 4UTBL 4G6FB 2C9AA 4ZUSA 4PWEA 2BCKA 3MV9B 4HHWA 5ITFB 4ANWA 3O1TA 2VDKL 3UTTB 2DQEH 2XQYG 2X4OA 1GZWB 3Q8EA 4IEFB 3S34H 4U1SB 1WHOA 4CU8A 4YDKL 1BBJA 3D06A 3T8MA 3E0GA 5ILTL 1R3LB 1G7PB 5DMKB 3AG2B 4PLMA 4FQ2H 4XNDA 3CZEA 4QTIL 5F93C 1M56B 3WCYA 3HKZA 5ESAA 2X29A 1ZTXE 4JY4A 1B4JH 1LILA 1SF5A 5A16A 1AKJB 1LWHA 4JM0A 4MCNA 3RTLA 4D9LH 4C0HA 2DLFL 3B8YA 3AFLA 3PGCA 2ENRA 1L9PA 3S5QA 1U41A 2WYZA 2MCMA 5CCGE 3D85B 3O2VH 4I2XE 4MCZB 5L9DH 1E5SA 4X6CB 4AQAA 2I26N 5EIQA 2ZOUA 4XNMB 4ONOA 3DVIA 3FB6B 1JFQL 3MR9B 2XXMB 7FABL 1SPDA 2OMUB 4ZMYA 1QR4A 3WIIL 3LS5L 2ZBJA 4PJ8D 4NXSA 1W0VA 4ZOEA 1SLAA 5A3TA 3KCPA 3GKWH 3FSWA 3W9AA 3BLKA 1TLMA 4R4BA 3PDGA 3ILNA 2IJ0C 2W5FA 1L6PA 3O0XA 3QUKA 2CXGA 4MJIE 3L4TA 2Q1FA 5JDBA 4P9GA 3DO3A 3MRGA 3OVUB 3MGOB 1QSED 2LVEA 3QDGA 4MA3B 1PK6C 1QJU3 1HTYA 1CLOH 1N64H 1PKQA 1NCJA 2GJPA 4U2ZA 1YPZB 3BUIA 1OGAA 2RS52 2VU9A 4XIKA 3OJVC 4QAMB 4ABUA 2WLJA 4I9XA 2YKLL 3NPSC 2E7TA 5T1KA 1QOSA 2CHXA 4PT6A 4JX0A 4QHOA 3WV6A 1GZPA 4PW9A 1GBGA 4OU3A 1KZQA 1CURA 2OZJA 1A3LL 1PCXA 3UG5A 2PTUA 3PABA 4MUVA 3I6LE 1F00I 4J8RA 4GB9A 4AQ1B 3BPSA 3SPGA 1BZEA 4WO4A 2MPAL 4LPTA 3TZVD 4HEPA 3SKJL 1QFHA 1ND2A 4M8QB 2CKBB 5B3NA 4IIQA 5D7LE 1CPMA 2ENYA 1ADQL 3RKDD 1IM3B 4OCWH 4PJIB 2Z0UA 4UOW0 5LDSA 1GP6A 4AYEC 4PN6A 3QIWB 5CN3A 2YFOA 2YEZB 1HNGA 5KVGE 3KBEA 1EAQA 4LOUD 4NHLA 3MLYH 1YCSA 4WBBA 5JUEH 5EB9A 1AGCA 3DX2A 1AAJA 2FX8H 1QI5A 4XXWC 4L2YA 4GG6A 1M4WA 2FNBA 4XVUD 3KH3A 3FQTB 5HHPA 5HI0A 1SFPA 4QX0A 5ERWB 4YHKH 1QQP3 2WD0A 3L4XA 5L19A 2YXVA 3RIFF 3TJEL 1ZBE1 1EXGA 2D0HA 2NY3C 4R2GD 4R8WL 3ACFA 1YYLH 5D7IF 4LSSL 2FDHA 1WGPA 2H1PH 4QMEA 4LARL 5CCKH 1UB6A 4F2EA 1NBYA 4FQLL 1LULA 4P2OB 1HQ4A 4GB32 1PL3A 4LKEA 1B4TA 4F24A 2BLFA 5IJRA 5A2IH 1PZAA 2F8VA 2VDKH 3PWLA 4M1DH 4K5NA 4HGKC 1CGSL 3P2DA 4OLLA 3RQ0A 4BE3A 5DLLA 5AW7B 2W2IA 2H1PL 4HU8A 4PIBA 2RHPA 2RMNA 4XMXA 2NCEA 4L3FA 1BXAA 4LXFA 4P2RD 5IIEA 5IG7A 3SISA 4S1QH 4HIHB 4DN3H 3ATEA 1INEL 1NMCB 2PR4H 3NSDA 3NZHL 4AQSA 1C12A 4D9QD 1CGUA 5H37G 3AFKA 2WCGA 4UFJA 4G83A 1EO7A 4LAJH 4J8RB 3CSTA 4POZD 3V0AA 4Z7OF 4R4ND 1LO2H 2IO5A 3Q13A 4J3OC 4MLOA 2AJSH 4IGBC 3WDXA 4JM2C 2B59A 4R0LC 3N9LA 1X5HA 3PJSB 5IROC 3T3PF 3S5LB 4Y1AE 4NP4H 7CGTA 5FY4A 5A1FA 3G5XB 2Y1VA 4LBJA 2VQAA 1C5DA 4G2AA 5JQIB 4WM7B 4NIDA 3QDJD 1MI5B 4R84A 3GI8H 3DXAB 5CZKA 3S6CA 5CR1A 2YY1A 5DA0B 3QQ3A 3BD4A 4UT9L 1SLUA 4H2AA 3I75B 4B97A 4DT2A 1HZLA 3RKPA 4YWAA 3RZJA 1T2QL 3O45B 5C6TL 4LIVA 5GRUL 3RUGB 2MRYA 3QZLA 4JFOA 3C2AL 4FFVC 4MNHA 1RZGB 2ROYA 2CDEA 4Y5YA 2H6CA 3O4LB 5DRWB 2IFRA 2VUCA 3TO2B 2L7QA 3UYPB 1OBNA 1T1ZB 5FXXA 5IHUL 3RJQB 3H50A 2XXZA 1F90H 4P2CG 1W91A 3D18B 1URZA 3I3MA 4MG2A 4XNQB 4OIAA 4CP9A 1GZQB 4NX0A 3AG1B 3D4KA 3IXTA 4HBCH 5I5JA 3BN9D 1T6WA 4Y7OC 5E24E 1MCPL 2KERA 3EFDH 3GRBA 3S88H 1H5BB 2R29A 3IRPX 5TJWK 2YUZA 3WL9A 2YZ8A 3RPBA 1RZKH 3SKUD 1ULOA 4FN0A 4UW6A 4G42B 1MELA 3I9GL 1M9SA 3EYFB 1Y07A 5SV5A 3NK3A 3N3HA 3BT2H 5HJ3A 3C5XA 4CGUB 3EO0B 2E7LC 3H3UA 5JDSB 5A2KH 2MQ3A 2PW2A 4HALA 3OKLA 1M7DB 5GJSH 1GANA 2JG9A 2ZJSH 5FGCE 2XUEA 1CZSA 3QCWA 4RRPM 3DV4A 3HVDA 3OGCB 4G8GD 4UI2A 4X6DE 1D5XA 1JK9A 4IMKC 4MA1B 1LOEA 2VABA 1TVBA 4HMZA 3ESMA 4Q6IB 3F85A 4JCLA 1KN2H 4KH9A 5FYBA 2A73B 2WTOA 1MREH 4QRQB 4U3CA 2RJ2A 3JD72 4YHLL 2NOYA 3TA4D 3WF0A 5DJAB 5DUBA 4X0KB 3ZFGA 3IRCA 2MEJB 1XU1A 1F8VA 3D9AH 4NUMA 3UZQB 3CSPA 2WLYA 4WY7L 5AWNH 1XEDA 3WP6A 1H15A 4JKNA 3POFA 4NWUH 5IK3B 1ND0A 4Z7UA 1DCLA 1MZFA 3MRLB 3ROOB 1V6OA 5DMGC 4AGQA 1P7KB 1QYGL 1ZAGA 2IC2A 2PO6B 3I6KB 3HOGA 1LNUB 2DQJH 3KGTA 4WKXA 3V10A 2AV7A 4B7LA 1CAUA 2WLQA 3ARSA 3AZWA 4DHLA 3FB8B 4ASMB 4XAWL 1MNNA 3AS3A 3WMQA 1W2UA 1J10A 1NKRA 3FB5A 4UXAA 3MTXA 3CFNA 4M7KL 2IXQB 1LDPL 4JHBA 1J48A 5CIPB 5CZVH 1Q0YH 4NQQA 5H35B 3ZGHA 4TLSA 3QE5A 5DJ0B 1V7NH 3RDIA 4FI6A 1L9SA 1H8TC 1T66D 5AOLA 3X12A 5DN2A 2RALA 4NP9A 4HHGA 1F58L 2XHNA 1OP3K 1P69B 5FY1A 4ZMOA 1OSPL 2Z6FA 3A21A 5KYXA 4KO7A 1N5AA 3RX8A 2Y6SD 3PWVB 4RAVB 2H45A 2VKXA 5IBLC 5BQ7B 3S8GB 4LLVB 4D7PA 1XCTB 3QHZL 5ESVB 5E0FA 5IUCA 4YVSA 4J4PA 4ZYKA 4GMSL 5KYYA 1K85A 4YHIA 4X7DC 4PCSA 5BQ7A 4E36A 4M62L 1NCHA 3QXVA 1KLFA 1XXDC 1LB2A 1G7HB 2QQKA 1Z3GH 3F8UB 2WYTA 1Y7BA 2ZP8A 5IEHA 3I2OA 2NQ3A 4PGJA 1UEMA 5A3MA 2CQVA 3TZVC 5HDQH 2Y5EA 3LKPB 1HDMA 4NNYA 2G60H 5IOKA 5K1NA 2ITFA 2XN9E 5I1LB 5CBEA 1HH9B 1ZS8B 2I27N 1A3LH 1Z66A 4IJTA 4F57H 1W6PB 4QXHA 1SDDB 3TN0C 2WSVA 1HHJB 4XRCB 4RQPC 1TFHA 3IXAA 2WKGA 5A2CA 4XTPA 1R3KA 4BCYA 1JPTL 3C7FA 3FSVA 5GALA 1IQDB 3EJZD 4AUJA 2DQJL 1ULGA 2VDRB 3FBMA 2DW5A 5KOMC 3N91A 1ZEAH 1FGNH 1RMU2 5FK7A 4HZLA 4LMFA 4BINA 1TENA 1UXLA 3ZDWA 2FX7L 4WO0A 5F0JB 2F19H 1A65A 1KV3A 4XBNA 4XR8C 2XKUA 5DUBB 3MSPA 4P9HC 5IB4A 3HI6H 3AY4A 1LE9B 1AIZA 2ENSA 4BRVA 1NXD1 5KS9F 3N3EA 2WB1A 2H1LM 5GRYA 2HT3D 1OAUH 4HGMA 4BUHA 2C7UA 4HOMA 4XPTH 3GSOB 1HV1A 4MNQD 5D7SL 1COV1 4TLUA 2J4WH 1QRNA 6FABH 3OAYK 3KPOA 3BSGA 1UXSA 3JWNG 5DLMH 4JRAA 4NWTL 3HPNA 5GLUA 4PJAA 2ZYHA 3RPQA 1J8SA 4X5PA 2DUQA 1Y0LB 1U3HA 4OCSH 2DWRA 3L7FA 5FKAA 4EIBA 4HCRA 4R5VA 4BFGA 4JFDD 4NRXA 1IBYA 4PRDA 1SVZA 3TNMA 5F8RC 4UDTA 1MUJA 4WVWA 4CEWC 4DP8X 5T5NG 3ZXDA 2D0FA 1JD9A 1UKQA 5DD6A 5IK7A 3UKTA 4Z7QF 3GDCA 3LHPL 4KVNL 1UTDA 4XWGH 1S0DA 1GGCL 1WCBA 2VZSA 2ZIDA 4CADA 3U37A 1ZZ8A 2OT7A 4SLIA 2F5BH 2R8SH 1KXQA 2E9IA 2P48B 3SO3B 5C7GA 2ED6A 3BTYA 1DCEA 4N6RB 3KPPA 4NQDA 4JO2H 4JFOB 4AX3A 5KYUB 4R97C 5DQ9B 4WZCA 1XF3B 5I2IA 4E9QA 2QGCA 2XBZA 2LW8A 1M4KA 5D7JC 1F3JB 2VW7A 4KKRA 1FFRA 5EZOL 2JB5L 3FTZA 2J1AA 2XLAA 3OBAA 4MKTA 4FOQA 2GJZA 1GYCA 4MXVE 4QRPA 3SPIA 3U4AA 4WM7A 4BBWA 3QXUA 2OQ6A 1T0MB 5TPWL 4AT6B 2HG5A 5E2TH 5L2JB 3C09B 4PSPA 3D30A 4UFLA 1RJZA 1U8NB 4KUZL 4Q14A 2BNRD 4X9BA 1GJUA 2VLRA 2OL3L 4XCYA 2X4NA 3P0YH 1FGVH 5IW3A 4NO2B 2BWAA 4LE3A 2EIZB 3Q3GB 4JGJA 4OZHF 4YFLI 4LA2A 3GALA 3D6EA 1IM9D 5F1RA 1KNOA 4FXKC 4Z76B 2UY7A 2WIIB 4F7EA 2V2XB 2WFPA 3BH9A 1ZJAA 4TQEH 4IK7A 4KV5F 2O6PA 3RDTC 4XZUG 4BQBA 2E75C 3R05A 4LUMA 3I2CH 3IU4H 4FTSA 3JTTA 4QRAA 4ZX3A 4ODTH 5C71A 2EEAA 1YUHB 4KHTH 4W9ZA 3KT4A 2WBWB 4KVCH 2X70B 5FYTA 1UXWA 1VRH1 5M94B 2XKNB 3PIQB 1REIA 4JUSA 4RDBA 1PLAA 2OSWA 4OI1A 2P8PB 2I5YL 2EH7L 4D0BA 5IM7A 1GZ9A 1TZGH 2XXFA 4FAAB 1HB1A 1TG8A 1AJ7H 3A67H 4M29A 1IE5A 4UFMA 3WNIA 2R0WL 2WTPA 3SDAD 4OQ8A 4AQ1C 2F58H 4N0YH 2EKJA 2WQWA 3WD5H 3UL2A 3V4PL 4F33B 1GR3A 2J1YA 3I6GB 3N41B 4D3CH 2DICA 1VBB1 2PYED 1UOWA 4FKEA 3ZBMA 1MS8A 3E8UH 5GZDA 2Y6FA 1RUH2 1T20B 1OGTA 4RRPG 1AXSA 3GJBA 3FT0A 3E6CC 1TQCB 5E7FA 1P9MA 2R0ZH 5JZ7D 2P5ED 4MMXB 3I02A 1YPZE 4C56D 1TYRA 4HZAA 3BAEH 3V9FA 1JYTA 4ZX5A 2A6VA 5IVCA 1EGJH 3L45A 4BJ0A 4BIOA 2MTPA 3NFNA 1W0WB 2B14A 1XGRA 2BVPB 3CLEH 1HN0A 5FLJA 4LSPH 1T03L 2IH3A 3C08H 4OGYH 1FV3A 1ULDA 3NACL 2H0VA 4OLZL 3NN8B 1PO13 1JTPA 2FT6A 1U58A 3MRCB 5FLVA 1PO12 1P4LA 2VUOA 1ZT4A 1MVEA 2E0PA 2A6JB 3ALQA 4KHTL 4LSQH 5D2LB 1DEEA 4PJ7E 5EZIH 3WN6A 3UAAA 3MYJB 2AJXL 1ZK9A 3M46A 1C8PA 3PIGA 3D34A 1DZQA 1HIMH 3THCA 2EQDA 2W07A 1MZ5A 1GSLA 1NFDF 4KX8A 1KGYA 2YPLE 2ZJSL 1JN2P 1JF5A 5JXJA 3ZGIA 5KXBA 5I8KL 1CXHA 3PXJA 1QSFB 1PM7A 5GZEA 4BIFA 4PGEB 1R082 4XCNA 2VNOA 3FHQA 3VBRB 5F8QC 4FLQA 1U8HA 5JPNA 1PNCA 5E6IB 3U2SB 3T0WA 4FZEH 1TQCC 3IBEA 4HOXA 2RS32 3V0IA 4TZDA 5HDLA 1DQQA 1YUHA 4XMKH 4YUEH 2O1AA 4HK3J 4Y1AA 4EI5B 4LSRH 5D1XA 1UZWA 3W82A 4FXGC 2YG0A 1LO5B 4IOIB 4PJGE 4U1KB 5G5DA 5FCUH 4NUJB 1RK0A 2FB4L 1CLVA 3Q1SL 3DUSB 4BK8A 4WVMA 4HSCX 1E67A 5HHVH 3PGDA 1OQDA 5CVRA 3BMVA 3S34L 3P69A 1NL0H 3DX0A 1RUML 2AC0A 2YA1A 1E7UA 3APNA 3MIBA 4P57A 1XV8A 3QJHB 4E41B 1LP9B 4G9FD 1DU3D 4JQIA 3JWNC 4N9OB 5F1NA 5F0PB 1SDWA 4WM7C 3L1OH 4KK5C 3UYJA 5D7LB 3DTDA 1JMZA 2XTJE 4J3UA 4ZMQA 1XGYL 4PY8J 3B69A 3OF1A 1FAYA 1R5IA 1F3JA 1FL3A 1QBBA 5D6CA 2YC0A 3B2DC 1NIEA 1X5MA 1YN7A 3BIEA 4MBRA 5C2UB 1DJIA 2AW2A 5E1GA 5T52A 2E7AA 3KXFB 5AVUB 2QLVB 4K9EH 5EBWB 1Y1UA 1WD9A 2DWDB 4LVOC 5JTWA 2W1UA 2ZS6B 4QKDA 3VBRC 1XD1A 4ILDA 3BWAA 5T5FL 2ZYRA 3BGFC 1HCVA 1J8HD 2XBTA 4GKSA 4Z7WE 3GNMH 1N4XH 2Y72A 2D73A 4ZFOA 4QJ3B 3EZ8A 4AI3A 2FH6A 1QBAA 3ACGA 2BY2A 3D0VA 5DJZB 1WAPA 4B9GA 5FDYA 4N2KA 2ZGRA 3Q01A 4J6RL 3SH4A 5JOZA 5KJ4A 5IGXL 5E8OB 3G9AB 4UT7H 4MMZC 4RSUA 5DD5H 3ZTNL 4F8OA 4OQTH 1RVFL 2P43B 5AW2B 2AZAA 4ZMTA 2A73A 4QRQA 4RGAA 2GMPA 4GJTB 4XQ4A 4BQ3A 1U30A 3MV7A 4BUQA 2EE6A 4ZO8A 2CV6A 2YPKB 1Q38A 2OJZL 2QPUA 2H0BA 3CFJA 1UH4A 2CR6A 2SLIA 1AYN2 5JHDE 5DVMA 5F7AA 2RG4A 1YQ8A 4DKFL 1GPOL 4Y5YC 3KZ4C 2YPKA 3DBSA 4TQIA 4CPBD 1WZLA 1PD1A 4ZZFA 1W05A 4BQWA 4JFED 5JDSA 5LDUA 2Y7SA 4XEZA 4MLIA 4XNUH 5C0CA 1S7TB 4LQRA 4N43B 4RFEA 3DVNA 1QIQA 5KVDL 4O2FA 4ENEC 1UX6A 3FCTB 5AZEL 3U14A 4Y1AB 1ZREA 4ELKA 1FMD2 3GRWH 1A3KA 4ATWA 5TGBA 4CDWB 2V17L 1X5XA 1RFDL 1O75A 1YLLA 5CYYA 1NCBH 3BXNA 1SVCP 3P6BA 3T0XA 3FTSA 1T0NA 2CLRA 4GEJA 3WFEL 3ZKND 5HYJB 5EWSA 3BH8A 3MF6A 3L95A 2VAJA 5DHVH 1ZLSH 2RMU2 4FFIA 4CSWA 3AT8A 1H8OA 3VD5A 1DYZA 4WZ9A 1EV2E 5BOJA 1T21A 3JV4A 4WI4A 4YHLH 3RTQD 5BO1H 4MA7H 4JTOA 3WEZA 2XPGB 1A6TA 1RZGA 4FQ1H 4UQIM 3D6GA 3FO2A 3PWUA 1JPGB 2R2HB 2JQZA 3P0VL 3MNZA 1NG0A 3KPRD 5HYSB 5F9OL 3GDBA 4F5CA 5MHSD 2GC7C 4A7SA 2OFQA 1LM8V 3ETBJ 2KT6A 1PNGA 4M8VA 1E5IA 5CG9A 3DX4A 1F5WA 3DK0A 3CVHA 5J57B 4Y5TA 3G5XA 3ZN4A 2OTWB 3JXSA 4NGHL 4OLXL 3U0WL 1VEOA 2EDQA 3HPLA 5EIVA 3K72A 3HW7A 1BJMA 3DJRA 5A32B 1ASJ1 4A6SA 4PWGA 1EA9C 3LS5H 3MJWA 4HIQA 4OW6A 3V5HA 5CGMA 3LEVL 2H9GA 4GH7B 1A3RH 4B7EA 2PXYC 3SPVA 1IO4C 3BW9B 2WY3B 1TO4A 3SBQA 1JNNL 4D3CL 1DHKA 1WLHA 2DF3A 4KU1A 4AEKA 4IDJH 4GQQA 2VZ3A 4BM8A 1I9RL 2VY0A 3MW3A 1UM4H 1CFTA 2HT4C 1DQIA 2WBJD 3ALPA 1BVVA 4FVVA 1T5WA 1U12A 1KCSL 4XFHA 2CDGB 2WN2A 3L4WA 3PJYA 3MKKA 4GPVA 3K6SB 1MHEA 1T20A 4P2QA 1WBXB 3EXLA 2BIPA 4LTAA 4COWA 4YFWA 3MBEC 2Y34A 2F5AL 3QI9A 3WFBH 3ZMNA 1HHHB 3RL2B 1ZRIA 4LESA 5EYYA 2NY6D 1JVOA 2QQMA 1MHCB 2O6CA 2C4FU 4TOYL 1Z7S2 1WUNT 3RMYA 3VBSC 2Z4QA 4LSTL 3Q5TA 4HAGA 4NKOA 4Z2WA 1SJEB 3JUZA 1UWYA 4LHQB 1DBAH 1YEEH 2CDFA 3WTVA 1HJGA 1X4XA 2BXZA 2BSTA 2XY2A 2ADGB 5LUMA 1PFCA 3VXMA 3HS9A 4Z7UB 4H1LH 2VDOL 3M17B 1R4XA 4YE4H 1DL7L 1Y6NR 4PR5A 1E40A 2CG9X 3BP5B 3IN0A 3EDEA 3L1GA 3OAZH 4JFZH 4MJ2A 3FQTA 3GC3A 3H2WA 5AW0B 2G2NA 5HHPB 4AQZA 4B9FA 3L3KB 2YIHA 2H32B 4C90A 3AB0A 3QZPA 5TFSL 3UBGA 2BZ7A 2GHWB 2AXHA 3H42B 4BQ6A 3BZ5A 1JPTH 3EFDL 3S88L 1ZV5A 1QNIA 4PRBA 4I0BA 4LDOB 1WAEA 5F7BA 1RHI1 4RR3A 4JHWL 3FYIB 1FPTH 4YAQB 2B3IA 4A2EA 1UY1A 1BBT3 1W99A 4JFFE 4WFFD 1FN4A 3VBOB 1VEPA 2PCFB 4GS7C 2JKNA 4MQ7A 5AW1B 5BUPA 3CFDB 3SO3C 5TQ2H 2A9MH 1L7IH 4H7LA 5IOPB 3U07A 4XFCA 4ZU7A 3RURA 1NA1C 1JGIA 1OLLA 1FH5H 1GZPB 3MREA 4MDJB 4MMYB 4NI3A 4X8JA 3CSGA 4FXTA 5BUGA 4Y1YA 1J8HA 5AVWB 1VALA 2BVOB 5F3HA 2WP3T 2OSLB 4AI8A 1AYN1 4LKCA 3ABGA 2W8CA 4R4FL 5ESQB 1KFUL 2WABA 3OC5A 4QXCA 3VBFB 4ZPIA 3CGTA 4YHPA 1WZAA 2FJHA 1NCRB 4GFTB 1YECH 4X4MA 5ABJA 3D18A 2GC2A 3KV6A 4AEJA 1KTLB 1GTFA 1J12A 2DWDA 4OI9A 2ZCHH 1W9FA 5EU5B 1D5BB 1S9WA 4D6QA 1IAIM 15C8L 3MLPA 3B9KA 2R69L 2BFGA 4HPYL 2DL2A 4FFYH 5ITBL 3C5ZB 1VA9A 4QHMA 3SD5A 1HEJC 1EV11 1OK0A 4KQ3H 5E4IA 4FQCL 1DGWA 1JXDA 3QFDA 4HJ0D 2DWTA 4JFPB 4PGDA 3EQEA 5JW4R 1RIVL 5HHMD 5F1SA 4D0CA 1N9PA 2BBVA 1KMGA 1P4BH 4PJDA 1G5GA 3LNEA 1Z3RA 4YHNA 1F02I 2E7QA 4GUPB 2K0RA 3QS3A 4XUQA 1OD7A 5CEZH 3W58A 5HGDA 2GEEA 5JOWA 4IRSD 3VBOA 1EAJA 2DU1A 5J98B 1ACXA 4G4FA 4DH2A 4HOWA 3ZN6B 6PCYA 3Q3GA 4XXPA 4YSAA 5FKPB 2JG8B 1P4IL 5FMOL 4L1SA 2BK8A 2L7EA 4AVBA 3ARTA 4ESKA 5I8CB 3TEXA 1DDLA 3FO1A 3UXFA 3AB0B 4GRMA 4JB9H 3QA3A 5FW6A 3WG3A 2HYMA 5ICYA 5A7QA 1XTLA 3BP7A 1T7YA 2BW5A 5K9KA 3LN4B 1H1IA 2HCZX 1FNAA 5EO1B 1ULFA 2P8MA 3EH2A 3MRQB 4GG8A 4OJYA 5LQBL 3NP4A 4KFMA 1GMEA 2AS5M 3G5VA 4PUBH 4FPYA 4Q0UA 2IVIB 4KI5F 4H20H 4ZXBC 2ATKA 1JZ8A 5GJSL 4GO6B 2BNUB 1H3VA 4XMPL 4B95C 5HVHC 3RLSA 1DF0A 3WHTA 1KXTA 2WO2A 4CDGC 1OTUD 5JHDB 4FTVB 1TMCB 3P11H 3TN0A 3SDCB 4RGNC 2PQQA 4K1ZA 5C8JA 5HDWA 2BP8B 3HE6B 3EKCA 2QELA 4F2FA 4F2MA 2XVBA 3JT2A 2FLRT 1OARH 4PGCA 3JV0A 3C87A 3OB0H 1NBZA 1FL6A 3CHRA 4OGQC 1AR73 2R4SH 4YNYA 5AUMB 4RN5A 4G9DA 3BQVA 5DWUH 3WFZA 1UMHA 1N12A 4Z6AT 5CJ5A 5KSBA 1KSRA 3TVMD 2BHZA 3OX8B 5K9JH 2YD5A 4M93C 1FFOB 2YR3A 2ZUVA 3P4NA 3APBA 4WFHE 3HIFA 2WDBA 4P4KD 4MMXA 2F0CA 1DO6A 3E7JA 3ZRSA 4AI2A 1NUFA 1QFUL 4XC9A 2R6QA 1RL1A 4X5QA 3L4CA 4HLEA 3I2HA 1AR61 3ETBF 3C6LD 1NGZB 3Q48A 4FAGA 2B1HL 4Z1PA 4XCCH 5CBAA 5HVWA 3HOBA 4MWFA 4XB8A 4F83A 1JGEA 3D2UA 2MHAB 4YE0A 3LXBA 3NAPA 1J0JA 2W68A 3MBWA 1U8OA 2AJVH 3RNKA 1NCQC 1SLLA 3TOPA 2PR4L 2TAAA 3NZHH 3QDJB 4ODWB 1XR8B 2EDJA 1ZA7A 4MVTA 3OJDB 3QUMH 2HJFB 3FCBA 4CGTA 4GULA 3BAKA 3QUMA 4IU2B 4ISQA 4PLNA 2F8OA 2Y24A 3H1WA 2KDGA 4BYYA 3OAUL 1TKWB 3DUIA 2CDFB 5DJDA 1QBLH 1WS8A 1A02N 2CRYA 5AW9B 3WLBA 3BXNB 4AQTA 5FYJU 5MP6L 1JBCA 5LY1A 3QIUC 5F7NC 4Y7MA 4JGYA 3FZ3A 4PRNB 1VB2A 5F3BA 4YG0A 4COZA 3BUYB 5A7PA 5JMCA 4HV8B 1UXZA 2W5PA 4OLWL 2V5SA 4P2QB 3LSEA 1T5XA 1NGWA 3QJSB 4LOEA 1E4WL 1M3JA 1PJ9A 1IBGL 4RFEB 1H3GA 4H26B 4HIJB 5IQ9B 3AU1B 4YHYB 1N18A 4OI8A 4ZUVA 3QVAA 1W2AX 1DLFH 2W1NA 4K71C 5DQDH 3BYTA 1ROCA 4K15A 2GK0B 4Z0BL 2DF7A 3WTUA 3QC5X 4HK3N 5A80A 1NFIB 4XN4A 5HY9A 2X4NB 2QJDA 4PWJA 4G7QB 2NXYB 2LALA 3QULB 4QRPD 3OGVA 4NKDB 3RWJB 3NSFA 2GIXA 4NJ9L 4MHRA 2IADB 1ZANH 3LKRB 3QPQD 4X5XB 2BVQB 4G5ZL 4B53A 3IAGC 3AKTA 1WCQA 3C3VA 3BAWA 1Q1JL 5I0TA 4IBSA 3KWWB 2PXJA 1SOKA 5HYSA 5DAXA 3IFNL 3HZVA 1VR3A 3PUUA 4GW4B 3QUXD 4ZOBA 1USQA 3R06A 2B4CH 1BVZA 1T89C 1XFPA 2BZDA 3RI8A 4KXZH 2UZXA 4JR9L 3QJFA 3SQOL 3W57A 3BPNC 4BZ1L 2E6VA 5TE6L 1WGOA 3L3GB 2COQA 4X5LA 2AQ2A 3GIZH 3REWB 4EQ3A 2MJWA 5DHVB 3CIQA 2P34A 1KELL 4AEIH 3BGAA 5I6PA 4KI5M 2NMSA 2Y6TE 4Y5YB 4HQQH 5HDBE 1MQKL 1IZKA 4WI0A 3NFSL 2K9FB 5I1AB 4L9LC 3LEXA 3GXDA 1HJCA 1CDUA 1E2VA 2VQ1B 1U8KA 1MZ6A 4J1UB 1RUJ3 2Y0SA 5E8NA 2J7MA 3ISRA 4LK6A 4Z9KB 2YBPA 1EZSA 2ADJB 4MNQA 4D8PA 4HKXA 1J83A 1WAAF 2WO3A 4DVRH 3JWNE 1D7PM 1A4BA 3ZYFA 3L3OA 1G86A 5DQJA 1MIEH 2ITEA 2VABB 4D8OA 6FABL 4UI9L 3ZSEA 1UYWL 3TN91 3QR1A 4I4WA 2J2ZA 3S4SA 1GWLA 1UYXA 5FZGA 4YDJA 1W2OA 2EDMA 2RCSL 3EO0A 3D51A 1VCAA 5JIMA 3H0TA 3SE6A 4XP1L 3WN5B 1RHFA 2VC2B 5KEZA 2I24N 4TSBL 2DBNA 2JI3A 3N5AA 3OY8B 1TEFA 4G7VH 2QTWB 4AEDB 1WMFA 3AJ7A 2V9RA 3K91A 4JZJC 3QFJB 2WXPA 5DDJ1 1YY9C 2COVD 5J5EA 1TLKA 4RSYA 5D7IE 4WTZG 1VB9A 5EC2B 4B5ZA 2W9XA 1GY1A 3U2SA 3WCRA 1N6UA 4KVNH 4KTDL 4NO0A 3T0BA 3HS8A 5EZIL 3VH8B 3QDMB 1HQ4B 5EH1A 5H2BB 1I3RA 3BIAX 2A7AA 5TE7L 1NTDA 2VXRA 3HNMA 4PRIA 2DJSA 5LB1A 2OYZA 3B2VL 1UKRA 2K6ZA 2YXFA 1G9ML 4GRLC 3TCLB 4YVWC 2BJSA 4M6NH 5I6KA 3DX6B 5IBUB 2OP4L 3M4FA 4NSKB 1Q72H 3S5YA 1CLZH 3VFRA 4Q4V3 1QLFB 4XZ4A 3VMNA 3QXAB 4WK0B 4JLRA 3T1WA 3O8XB 2N1TE 3D12B 5IJDC 2DVBA 5A7OA 1PVHA 3STLA 4MB1A 4J4PD 1ED3B 4NIIA 5AVTB 1OTUC 2LLGA 3ECWA 3S5ZA 3QJHA 4J25A 3ZDZF 5I6MA 5I71B 3QQNA 3R4DB 3K8LA 1AXYA 3RI5F 1R19A 4JO4L 1UU4A 2X4SB 1IS3A 1Q8SA 4S1SL 3QFGA 3W39B 5FRAA 1ND2B 15C8H 4LK4A 4PS4L 3ZZSA 3PQYE 5F72S 1D4M1 3VXOA 2ZX7A 2BNRB 4C91A 2VERA 4LR4A 3CFCL 3MRMA 1RUPL 1D0HA 4OIFA 3MDJA 3SKOB 4FLOA 3MBED 3OZ9L 5TF1L 3DGTA 3WD5L 3OD0A 4GH4B 2D0GA 2FJSA 5B2GB 3OGRA 4FTBA 1DVTA 1W72A 3LQAL 3A4DA 4NN7B 1YEJH 4PHXA 3ZL4H 5J12C 3S7IA 3PHOA 4HUUA 3VFVB 2AJZB 2XWTA 3VFPA 1PZ9A 4NWWA 2ESVB 4DK3A 2NZIA 3IDNB 2IFFL 5FYKL 2MPFA 2MNWA 1DJSA 3UEQA 1KGCD 2C9PA 3B7UX 1W8UA 4S2GA 4F37F 4B9CA 3T2QA 4NFBA 1NAML 3BTZA 2PKDA 1KUMA 2QT6A 5L9DL 3OAUH 1UB6B 4XH2B 5DR5H 1AR2A 5DDHB 4BZ4A 3MJ6A 4MASA 5H9SA 1RUAL 3MRJB 3BQUD 4UNTA 4CW1A 4FULA 3WCSA 4J3OH 1YSOA 4JFFA 4M5YL 3O0VA 4CDWA 5J3UA 4FX5A 1HL8A 2UWEF 4Q4X2 2NY2C 4RS5C 5DG2A 2G2PA 4A7YA 5AFEA 3HZMA 4AEEA 3VXRD 3LA3A 4A6YL 3LRKA 4N8CL 1VZHA 2FGZA 4LDLB 4DKAA 4YW6A 2DQCH 1HB2A 2Q5BA 3AG4B 4WSKA 1L0PA 3D3VB 2WZ0A 4L3EB 2RMU1 4QRUB 3LQMA 2RCSH 3U7YH 4WVRA 3I50H 2CO7B 1J8HE 3WJMB 4S1DC 2FQGA 4ICWA 3D07A 2GSGA 2ZP9A 3HE7A 4KJYA 4LPVA 3BTXA 4HS8H 1KZYA 3BPOB 5EF2A 2IH9A 2QPSA 4X4ME 5KSVB 1ZNPA 3H9HB 2IMNA 2GDFA 1AD9A 5ADOH 3KHBA 5L8LB 3VBHC 1F3DJ 1IBHA 4BWTA 3BT2L 5K39A 3W81A 4XJ8A 4Q6YA 3W11C 5DYOB 3BUYA 3DBXA 5T1KB 4QKTA 2B15A 2FD8A 2XU9A 4M00A 4XP4H 1PY0A 2GW5A 5CFCA 1JNHA 1KFAL 5C0JA 3TBVB 4RQQB 1AR92 3BKJL 3VXUD 4MX7A 2YZ1A 1UXMA 3CUPB 4K8RB 1EAPA 5AB1A 1ZEAL 2J1ZA 2NNRA 2R1WB 4E5XG 2H26B 3W37A 1HXYB 5IQ7L 5I1EL 1SJHA 3RPKA 3MQIA 2JQMA 3OWRA 1A14L 5KYUA 2GPZA 3LB6D 3UTSD 2HRPH 5DGRA 2G3ZA 3ARUA 3QDJA 1UC6A 4NRZB 4PJXE 1ZLVK 1T6VN 3IKCB 4JDVB 3II1A 2KQMA 2B9AA 3DXAA 4LXLA 1Q1JH 1DP0A 4X5XA 3KJ4B 5E8EA 3P9MA 2FX9L 3MIGA 1OOWA 2IGTA 2J4WL 2YUXA 5FCCA 1ALYA 5SV3A 4X9IA 4GSDH 5LBVA 1F4XH 3RFZC 5JR1H 2AJ3B 3HZYB 5DHDA 1QEWB 5CGYC 1EFXB 1CJPA 3V52L 2VRKA 2YO3A 2YPLD 1UD2A 3DRTB 3HG1A 2ROXA 2VM3A 1QFWL 4U7KA 1C12B 5IQ9A 1CD3G 4J6IA 4KY1H 2VKWA 2W95A 3Q8BA 4TUJA 5D1ZC 1ODNA 1LO5A 4RR3B 5E5UB 4QGYA 4I5BB 2ZOLA 5ADOL 1ASPA 2HWD1 2HWE2 3NIFE 4PWKA 5IT2L 1ZZ9A 4TLKA 3HB3C 2OW6A 2J6EL 5JUVA 2GJ6A 5MEPB 2HH9A 1OVZA 2KD7A 1GYUA 1MS5A 5EXOA 3PREA 4JS7A 2V7NA 2PWDA 1KXTB 2WO2B 4M9OA 4XCNB 3ECBB 1OQ1A 4FOMA 4KDTA 3TX4A 1UOGA 5E9NA 2WWMC 1NE4A 1FNGB 5DD5L 5DRZA 3PHQA 2HWB2 1JXGA 3BO8A 4DFSA 3TF7C 2VL5B 3TJEH 1FJ1B 4BHUI 3WXVH 2J71A 3ZTDC 4L3ED 1XGUB 4BZ1A 2NYYA 4WHDA 5DO8A 3T0ED 4NMIA 1UHVA 3JTBA 1E9PA 2NX5B 5EU4A 4Z5RA 1B2WH 3MRIB 2XWBB 2CGPA 1RQ5A 2WO4A 4X4YA 2WYSA 2IBZY 1W8ZA 4JHTA 3OKNA 4IL7A 5C0FB 2G3NA 3IDMA 2KHAA 3KLHC 5JUEL 2WXOA 3UAJC 3WO4B 4OUMA 1BMZA 3WMSA 1DGLA 3IMMA 4ZFZB 5DHXB 3TZVA 5KBDA 1BLNA 5T3XD 1S0CA 5DXWA 3VYNA 5K7PA 3T0EE 3GJEB 5KG9A 2P6HA 1NZRA 4L3EE 3V7AE 2VW2A 3N7KA 3WSQL 2YAOA 2VQTA 4O2CB 3NEEA 1W8HA 1II4E 1INEH 3K1DA 4K3DL 1HXS3 3SKJH 3SPVB 4WWOA 1M1SA 3QRGH 1OCRB 4YZFE 4C54A 2JELL 5EMYA 1AE6L 5C0RL 1K5MC 1KS5A 5JAXA 1OQEA 4R9BA 4EZ4A 4YAQA 3F5WA 3ZK0A 1RUI3 3PP4H 1F2NA 3C7GA 2R29L 1OGTB 4G1EA 2WWSA 1FPN1 1GOGA 2EE3A 3FT9A 2ZKYA 3WNLA 2WK2A 4PVMA 4JKPL 4OGXL 1A4AA 5E2VH 3O8XA 2KXLA 1A7QL 4F3FB 3N55A 3D50A 4G80A 4XILA 2IPUK 3MLRL 43CAB 1G7QA 2DWEB 2FVNA 3WKML 1ZXQA 3TJHC 2O26U 2QMKA 5IROD 3MOQA 3V0VA 2BIOA 2XFGB 5FZ0A 4YHYC 3OSVA 4U1MB 3O2WL 4GAYB 4YM3A 1AI1L 3PTRB 3O1SA 3MFFA 1YEFL 1NCRA 3QCTH 4OZXA 2CBTA 1GS7A 3GO1H 4FCHA 4HPOH 4KK9C 4NENB 1VBA2 3JWOC 4ZTPH 3ISWA 4W9GC 5IESH 4HPYH 5DRNB 2F4LA 1IFHH 1PCSA 3WXPA 4CUCA 1MNUL 1QP1A 2JXMB 1I9RA 4IEVA 1BQHA 1HH9A 1NUNB 3MKGA 1W6PA 4MMXC 5FMOS 1Z6JT 2FGWH 3BIKA 3ESPA 3FTWA 4KHXL 4NQTA 5MEOB 2NZ9A 3EMRA 4R96B 2WFF3 4L2NA 3L1FA 5AVSB 4F80A 4LNRB 5CO1A 3TL5A 1EGJA 2A6IA 1GHFH 5E4EB 5E8PA 1F4WH 2XBO1 4OT1L 3PNAA 3G5WA 4AR2A 2R51A 5T3ZH 2X7LB 3AS1A 3PUHA 4I0AA 1VPOL 1XCTA 3HLAB 1A7OL 1A7BA 1D2PA 1RK1A 3FQRB 3HAEB 2Y1YA 3NZ8B 3F7VB 4E9LA 4EQ2A 1G7YA 3E6BA 1QY4A 1TYEB 1I9IL 1F2QA 2AJXH 1CF1A 5HCFA 3P4MB 4K7FA 2XUWA 3EYSL 4K8RH 3ATAA 3NV1A 1HCFX 4Z77B 1OUXA 2Y1ZA 4W4OC 2XN9B 1T3FB 1ASJ2 4EJ1C 3WD5A 3LGRA 4B4QA 1MFDH 5FGBA 5DC2A 5C33A 1E4HA 1RUI1 12E8H 2ZX9A 5FYVA 4C1XA 2HKAA 2KZBA 3K5RA 4NWVA 3C60A 1RERA 1SN2A 4LCWD 2OTUB 5AVQB 4LLQB 4HK0A 1ZLVH 1R3KB 1QUPA 1XSIA 4PY8I 3PL6B 3JT0A 4CSPA 2JJTC 2F7OA 4XCEA 2B5HA 2PPEA 2VOKA 4JQTA 2FX8L 3LKPA 1VBC2 2FO8A 3PV7A 3APCA 1FI8C 4N2NA 2LUWA 2ZF8A 4URAA 4F8PA 1AJ7L 1Q0YL 1WITA 2FT7A 5LXGH 4L4TD 1IMHC 4JR9H 4ONUA 4NAQA 3KHCA 1QJZA 2Y25A 5D7JD 1FQ9C 5I75C 2AK1H 3VO0A 1O5LA 2E7DA 1H6TA 2Y26A 4ZHNA 2B9BA 1SYSA 3B2XA 3C6SB 3LSOA 5GS1B 3ZKSD 3V6BR 4XMWA 5IQLA 4Z78B 3VV1A 1JZIA 1BGXH 3WEAA 4OIIL 5KBKA 4PJ5A 4ZXKA 3FO9A 4XN2A 1HYRC 1ZLWK 4ZW3A 1CGSH 2DWYA 4J2QA 3PAYA 2X3BA 3NCMA 4X9FA 4DXTA 3AXIA 1MFAL 3FN9A 3ARGA 1KIRA 1YXWA 4PRPA 4L97A 2Q7YB 3WF4A 2E76C 5AL8A 5HI4D 1AOZA 3NCYP 1DQVA 4L1DA 5FV2A 2YGLA 4JDNA 2IV8A 4COYA 5FUNA 5BNNB 2P3JA 4FXLA 3H7YA 1DSWA 1H3WM 1JV2A 1J05A 2DL9A 2EZ0D 3Q7JA 3S36L 1QMUA 4PJBE 2LR4A 4QOKA 1WA4A 3SIKA 2GJJA 1P7KA 5IMMB 3TYFB 5K9QI 3DJ9A 1E2WA 1A0QH 3RL1A 4KAQH 3B3IB 4OKDA 3ABZA 5TGBB 1LEDA 3UZVA 1N3PA 3PUAA 1AQKH 3FL7A 1WF5A 2XQXA 1INDL 2UZIL 4B27A 4J4PC 2P5WE 1FNHA 4MMZB 4EO5A 4I18C 1PMHX 1P84K 1X6LA 2VE1A 2IBGA 1AYOA 3PPSA 2CAUA 4TVUA 4H0HB 1J5OL 4QHKJ 1FZOA 4AHWA 3S97C 3WBDA 3BKYH 1OM9A 4G1EB 5GRZA 4PJFB 3WSQH 5FF6A 3ILRA 1VZGA 4IQPA 1NANI 1OH4A 1NEZB 3HG2A 4XMUA 4K6BA 3EB7A 4U33A 3S35L 2OX5B 1V7MH 1S7RB 3NFNB 1N26A 5J11C 5D72H 1ZRDA 2VYRE 3PLYA 4MHUA 5C0BD 5AZ2H 2Q8AL 1AL22 4IRZA 5CKNA 4NO5A 5LRSA 1PMIA 5E8OA 2AGJL 5J0BA 4M4RA 5GRWA 3WL9B 1YJDL 3M8OH 3U0TA 4D0QA 4FXGA 3MUJA 2VT0A 3QB7C 3V8OA 2JB4A 3BCFA 3Q6FA 3WNMA 3CZLA 4K3EH 3KVQA 5EOCL 2VCAA 4CP9B 1OAUL 3ZHDA 1A3ZA 5E9DE 1T0OA 5EBLA 1R1A1 4JDMA 4BQ1A 1TTFA 4JL2A 4Z3EA 4Y8AA 2R69H 1RUJ2 5D8AB 4D0DA 2OTUA 3VFGL 1OE1A 5FZ9A 5BOPA 1LTEA 4FQXB 3GB7A 3UROR 5GZFA 3BSHA 5GGQH 2BTVC 5C3RA 5CADA 1QRNE 2R2BA 3AITA 3D8MA 5C0AE 2XUMA 5LGHL 2AI0H 3BCDA 1VEMA 4QTIH 1ZGLA 5DZOA 2J7LA 1LO2L 2VBDA 1UG9A 1O6UA 1P6WA 5T3ZD 1YJLA 1CFSA 5CP7A 1F5JA 3ARDD 3UC0H 5I1JH 1OAQH 1TXKA 4OZFA 4Y2NA 4YZ5A 4L37A 1U3NA 2OJEA 2VOWA 3HQRA 2JENA 2YKKA 5BZDB 5GS0C 1RZJC 4UM9D 4E4ZA 1R33A 2OS7A 2P3IA 3C7OA 3ZYHA 2JKJA 1H6FA 3MZTA 4EVNA 4QKFA 4L3CB 1RK0B 2EDBA 4J3TA 5DT1L 3VFMA 4A2MA 5C8JB 5L4MA 1OLMA 2W9DL 2J1RA 5KWRA 4F15B 4Q4W2 4QXWA 1Q9KB 5BPPA 3QDHA 3HRPA 3SGDI 4XPGL 4TQEL 1OKOA 4FTDA 3IJEB 4YEFA 3MIDA 1ERNA 4P9WA 1AHWA 1OCZB 1UFGA 3D08A 1XJAA 4B9YA 2B1HH 5IW1B 4JDTL 3TIEB 1AYM3 5FHAL 3K81A 4FHKA 1NDTA 1UD5A 2Q6WA 4ELMA 3N7LA 3AREA 4P9YA 4PP2B 1OGAB 5HGBB 4HBCL 3AM2A 4NDMA 5JR7B 4R7NA 1RMU3 4YG3A 3WNNA 4IKNA 2XHKA 3S98A 3ULVH 4NHMA 1CFMA 5ELIA 3N9GL 1PO21 2NY1B 1W15A 4M62H 4DESA 4F9LA 1A22B 1MIML 2YMTA 3RG1C 1UU6A 4HKOA 1ZJBA 1DQJB 2W07B 5IBLD 5ANQA 3N36A 4RFOL 1CK0H 1RURH 3MBWB 4GWMA 1BVLB 3H6AA 3RTQC 4HA1A 3V0EA 4RWHA 1ZA4A 4NYLB 1ZT4B 1T66C 1U91A 4L5FE 5ESQA 1MCCA 1IGCH 1X7SA 5F88A 5INDA 3QEQD 3VFUB 2CU5A 4K1YA 4CVXB 4KU7A 3WS6A 2G0KA 1E2ZA 2VNVA 1XIWD 2NLJB 4Q4V1 4HVQA 3D05A 1EZUA 2WSKA 3PGFH 3RGVD 1OC1A 1AX0A 2VXQA 1XGRB 2BVPA 3IMRA 4I89A 4F15C 4PWFA 4KKCD 5FW7A 3PDQA 1AIFA 3P40A 5DI8B 3IJHB 1X7QB 5FIEA 2ZAAA 3GJFB 1AG0A 1HXMA 4WGKA 4NZTH 2Q1ZB 1IVTA 4I0PB 1NICA 3O11B 3CFBA 2X4OB 3WKPA 4TSVA 2G4EA 4H44C 1WIPA 4BXSV 3AG3B 2VWEE 4POYA 2BCKB 4XVUC 3ZFEA 4HUKB 4EZKA 4Y1TA 3T4AC 3C9NA 4DEWA 1XXNA 5FP7A 3LEMA 2F8IA 5IB4B 1F4HA 4K5OA 4A44A 2YSTA 4LHUD 2BIQA 5BCAA 1PLGH 2BSSA 1HWWA 1XE0A 3QUKB 2A3WA 1RU9H 3RJ2X 2ZGLA 4ZUTA 3ARQA 1KB3A 2UXGA 3TO4B 3G5VB 5C0BE 2E9JA 4EPSA 4OZHE 1L9QA 1ZIBA 4I3PA 3OJ2C 1CGYA 3KLDA 2P17A 4HWBA 1AR1D 5DD3H 1JRHH 2AERT 3WENA 4PJYA 1L0QA 1WFOA 2CALA 5HHXL 3AXHA 1JWUA 1S2KA 5DEZA 4M6ML 2H7WA 2MMXA 3AZVA 5I15H 4C4KO 4CA9A 1DVFD 3CXFA 1XSRA 1D6EA 1B4RA 2BS71 2HLAB 3OF6A 3OG4B 3JTTB 1MUJB 2XKSA 2Q8OA 3NCJH 4U6HB 4OUOA 4P02B 5AB0A 4XN5A 3DHMA 3HPJA 2E9GA 1LOFC 4MJIB 2VJ8A 2VXVH 3WR0A 4CCKA 2CCLA 2CKBA 1ZVHA 3NABL 3V4VL 1H6YA 1JD7A 1GS6X 1CFNB 1YVLA 4LSPL 4FFWD 1BJ1J 5JW5B 4QPIB 1QLRB 3JZYA 2O5XH 4WV1B 4AC4A 2DVGA 3Q8FA 25C8L 2EILB 4CNIB 1TF4A 1NDMA 4N5ED 4OLVL 4QNPF 4LLVA 5GGSA 3NABH 5AZ2L 1G7JB 3WP4A 4IS6B 3SE9H 1LP9E 4B1MA 5M0TA 5D2AA 4F7PB 3SLIA 5GS2D 4ETQA 3VNZA 2Y8KA 1FNSL 5INDB 5E00A 1AFVL 3T65B 3NJKA 3WUWB 2JE7A 1OD5A 1X9LA 1FGVL 1XH3B 2HT2D 2R0LH 1BFSA 2CMRH 1BXVA 5E6ZA 3AACA 1IBGH 1MI5D 3TA3A 2JD4A 1KPUA 1ES0A 2DQFA 1AE6H 4FG0A 1LO3L 2Z1KA 1UUSA 1U8QB 2E86A 2NUPA 4PG2A 3FFCD 3C5SA 3HRZA 4GLRI 2VLJD 5E4EC 1A6WL 2RM21 1EAPB 2WAHA 5HHME 5SX4H 4YDVB 1TO5A 2NCMA 2VXTH 1KDKA 2CWSA 4YVSC 1N3QA 4IEWA 5F6LB 5IHRA 3EGXB 3CNKA 4Y16C 5D5MA 3UTZA 2OVUA 3L3DB 1K4CB 2NM1A 4L5FL 3W0WB 3OYWA 2Y2TA 2CZNA 2VN5A 4NAJA 1FO0B 3TCTA 2DH3A 4DP0X 5LO7A 4BPZA 1MIEL 1HINH 2K3TA 1ULPA 1WRFA 4F7TB 3HLKA 4GRLD 3MLUL 1RITA 4ZY9A 1F11A 1XL6A 4HKLA 1CFBA 4HFWB 3J7MA 4FEIA 1C28A 4DKDC 1FN4B 2NY7H 1CICA 1XF1A 1PGW2 4XAAA 3BOPA 1HOEA 5ILTH 5AG9A 3GMOB 3M3CA 2FR4A 3CFQA 3J9SA 3E9UA 3MOAH 1L0XA 3TNNB 3OKLB 5AW3B 4G5AA 4DKTA 2Z8SA 3BPCB 5LBFA 4M7LL 3GMLA 5J6GA 3DOHA 3D3VA 1WFJA 5L4FA 1HS6A 2CM5A 3PWPA 5CILL 4MJ4A 4EE2A 2AMGA 3INUL 2A2QT 2ZAIA 5D1QE 1XGQB 3S2CA 2GG1A 3KV4A 4PJHA 5IMKB 4IE0A 2BIIA 5J4MA 4ZMVA 5A2FA 1IGFL 3L5WB 4N9GA 1QWRA 1SXCA 4AENB 4F8NA 2VVFA 5FWJA 3O1UA 3SBWA 1E9OA 2FJFA 3FFDB 3LXAA 3FTVA 2K78A 4HS3A 1AP2A 5I8KH 3FU6A 3GXNA 1HHIB 1WVZA 4QYOA 3ZXKA 1ONQA 1WZXA 1V27A 4AIXA 2FJFB 1S3KH 1FLRL 1S5IL 2ESVA 4HVBA 2ZX2A 2OZ4L 4XTRC 5F9DC 2LV4A 4U4BA 3RUGA 1EEUA 4IBQA 5EZPA 5F89B 1RUKH 3M3QA 5G4MA 1PM4A 1TUPA 2YKLH 3UPRB 5E00B 3U1PA 4WU5A 2IAND 1MWAH 2CK0H 4Z0BH 2HWC3 2P52A 2PWEA 3CXDH 5EU3B 4P4KB 4TYSA 4KNQA 4XDQA 2DTYA 3RI9A 3MJ8B 4IMLA 2X4TA 4LL1A 1OSZB 2FSEB 1P1ZB 2IALA 1A6CA 1MCIA 3IDEA 2A83A 5FS5A 5KBNC 5LWYL 1XNCA 4XF4A 3C5JB 4QRSA 1N10A 2DS4A 1ILUA 2QVIA 5FZBA 4J8QA 1RJLB 3PWVA 3WJLA 3ZSMA 3LQAC 1YY8A 3KLLA 4WI8A 1YEDA 2JXAA 1NGPL 3ARVA 3MMEB 3UTOA 4LBQA 3GJFH 4NQDE 1FC2D 3GS0A 3QXAA 3TOJA 2AQTA 2NQYA 1RUE2 2XMLA 3JSSA 3VKOA 1YUDA 2HG0A 4EI5A 3ARBA 3L3DA 3FFOA 1MCDA 3AJYA 1D6VH 4HDIB 1N5YL 3J4UH 4YK4C 2E9BA 4LLDB 1YJKA 3BSZL 4F5CE 1J9QA 4HONA 1RUG1 1U8HB 4O61A 4EKXA 1NGXB 4PJ9B 4WAFA 2ADYA 3V95A 1JOPA 1IQWL 1KJ3L 5BS0D 3H9ZA 4GKNA 1Y9QA 5F32A 1SYVA 1E9OB 4KRPB 1ZZCA 3LMJH 2VN6A 1J84A 4JPKH 4BMBA 2MPVA 3SYPA 1FNEB 3GGWB 2X5IA 4YLZA 1BD2A 3M2MA 3BWUF 3KPRB 3ZKYA 1J18A 4ZTOL 3MODH 5IWLA 4ODVH 1S3RA 4ORFA 4PJ8B 2DFCA 1HRI3 1J1XH 1AZDA 2BMKA 3VI3F 1U8LB 1N6QH 3VUAA 2ZEZA 3WHE1 1KBKA 4OB5H 1NLSA 2D7OA 3M1CA 3MNWB 4GAJH 1VFOA 3JWOL 3V5DA 1IPSA 2Y36L 1ENRA 4D94A 5CWSB 1RZFL 2E8YA 4F7PA 5L88H 5FY9A 4K5LA 1UZYA 4QKBA 5EU6B 5JPMB 3RHWK 1YHFA 1WZ1H 4E2SA 1Q5OA 5CKMA 4QF1A 1UX7A 1XCWA 2FZ1A 4YVSB 5FZAA 5ICXA 2BOLA 1T22B 3BZDA 5EIIB 2WVVA 4N0CC 2QE3A 2MH4A 4Y4FC 5CN1A 1TOXA 1KTJA 3AKRA 3IWZA 4AGMA 5DS8B 4K21A 1A7NL 4N1HB 1WW5A 1KB5H 1VACB 5CD5C 1WH0A 2AEPL 2Z31C 4FI9A 4K20A 4I02A 2K3HA 2EYTA 2B4KA 1NLDL 2Q86A 3ARFA 1IFRA 1AYN3 2ZG1A 1GCYA 5J6SA 2TBVA 1BPVA 3VXSE 1ULCA 2VQ0A 3NA9H 1AY1H 5C9JA 3L2LA 4OFQA 1PX8A 5F6HI 4GMP0 1Q0XL 1ZOXA 3V9CA 1VAHA 2PHLA 1I5PA 2VXSH 3RZLA 5F6KA 4FMKA 4FQLH 3V55A 2ZX8A 3HIZA 1U8QA 1IKPA 1ZLSL 3O2DL 3S2AA 4JRYE 5PCYA 5LGJB 4YOKA 3LRLA 3MRQA 3NQIA 2JMRA 4CEWA 3DV6B 3LE0A 3TO4A 2VDNB 5KVGL 1VRBA 1AQMA 3M3IA 2P80A 5AWNL 5L9RA 1AXTL 5K33A 2X4PB 2ZWSA 3HZKB 1G6NA 1W8TA 2GN7A 4EWDA 1J1XL 1GL4B 4N3TA 4S1SH 1OA3A 2VDMB 1EJFA 4PB0H 2JJWA 3VNYA 4LBNA 1IGOA 4GIPD 1RZJH 1ZVSA 4LOFA 1RKRA 3EYQD 2FK9A 4YWGL 5FYKU 1KC5H 4E9VA 1SHMA 4ANKA 2X7LA 2Y36H 4L4VE 2X4RB 4ODHL 4HOOA 2FRGP 3VHOA 3T8XB 3KVAA 4QGTA 3DC0A 4XCFL 5IBTL 4XQWA 1SUHA 2XVLA 4MKMA 1S46A 4JG0H 4X6CF 4EVNB 4EV0A 2F1AA 4I3RL 5FB8B 1M53A 1KC5L 3LKQB 1X7TA 4OV6F 5GGRA 3VFWB 2B2XL 4OI2A 4I1PA 3L2HA 1K8DA 1NAKH 2IH1B 3WW1A 2YPDA 4V2BA 4BCUA 3G5ZA 4MD4A 1NM4A 2PO6D 2A0LC 3QZMA 5D5MB 5FUPA 1ZA3B 3FSAA 1KCRH 4QUOA 4DP7X 4V2VA 5EJ3A 5SWSE 1O5PA 3V2AR 1TTRA 1HCZA 2AEQL 2PW1A 4NO3A 1DG6A 5DUJA 2PYFA 2ZUQC 3UABA 3VA2C 4X7CC 3B9DA 3X1GA 2C5DA 3CZUA 2A3YA 4P2OA 3D39A 5IY5B 1E57A 3GSNB 2W9EH 4KUCD 5KBLA 1NCCL 4OJDH 3NJXA 5K0UA 3MAWA 3BKCL 4NS0A 4U6VH 3DV8A 3PS6A 4BFRA 4LE4A 4PJCF 4R4BB 4ODXA 4TSBH 4X0NA 2KS0A 3BAEL 1GKOA 1JDDA 4PJXF 2ZX0A 3WIHA 4HWBL 4ZW5A 4CADB 2DTML 2VSDA 1LO0H 2DQ6A 4JJHA 3RVUC 4L18A 3VHPA 4OHWA 1INQA 2JG8C 3ZTCC 4M7JH 1FUNA 3EOAB 4M5SA 4GT0A 4KZEH 1QUNB 2Q3AA 1OAJA 3KL3A 4K3DH 4GKXA 5C09E 3CFBB 3GINA 4GINA 4PF5A 1WCSA 2PAKA 1O7VA 2GZWA 2HFGL 4HETA 1CX1A 1LK3L 4RX4A 4MVBD 4ONGL 1RZPA 2EIGA 1YPZF 1UYZA 1JHLL 1UJ3B 3IGLA 4Q4Y3 2WVVB 5DMKA 3BODA 5LRRA 1BQUA 1ZMYA 1J5DA 3LQZA 2R043 3L5IA 2C3XA 4R9HA 1JTOA 4QHNA 1IU1A 3MX0A 3ZDYE 3VI4E 2FWUA 2F6BA 5CP3H 3ARFC 4S2DA 2WGXA 2UXFA 3QNZA 1NGQH 4I3RH 3CFMA 4PRHB 3BRGC 4HFUL 4AWDA 1NIBA 3MV8D 3PNWB 1ULEA 1QFPA 1MLCA 1R3JB 3SGDH 2WWKO 3JB8A 1EVUA 1MCOL 1XEUA 3L13A 3N85L 4HLJA 2Y38A 5EZWA 4AFDA 3BALA 2RE9A 1MWAA 2XQBH 4JM4H 4TV3A 3VXSB 4DP6X 1PNFA 1UOJA 2YU2A 2G75B 4PBOA 3W20A 2X41A 2BPA2 5KW9L 4NC0B 3FWEA 1NBYB 1NEUA 1AZBA 3TLRA 5F3GA 4RLDA 2R9HC 3EFFB 2ZG2A 3KBPA 1A7PL 1FG2A 4XAWH 2FCBA 1PZ5B 3VXRB 3IDBB 5DDJ3 4ZBJA 2EE2A 3FQYA 3ZYOA 3FW6A 1TQSA 3VKFC 3SKVA 4LCVA 1A9VA 1W28A 2I2SA 1JF1A 4MRCA 1OF4A 1OAZH 3U46A 2XKNA 4DW2L 2H2PC 3TBSA 1A1OB 1QNZL 3NIGB 5T1LD 2B08A 3K80A 2DRUA 4W9IC 4Z7NF 4Y4KC 5AD0A 1W8NA 4LDEB 4ZFGL 5A40E 1CGTA 4DERA 4OGXH 3SKNA 3ARBB 3ZM8A 3DX9B 2QSVA 5HHOD 1B88A 2F7QA 3ES6A 4N0FA 5J89A 1CFTB 3JXAA 2R56H 2Q86B 3VD2A 2W0PA 4TSCH 1JHNA 1V6IA 1E4WH 6CGTA 1BBT2 1UQSA 1FRGL 1ZHLB 2ARJB 1AKJD 3HMWL 1TJIH 4YDIL 3SZ6A 5IVBA 4WJKB 4B7IA 1VLNA 3QDGE 3BFOA 4IBZA 4G8EB 4IEFA 5CZRA 4LMQI 4MZRA 5JOPE 2AENA 2WT2A 1OGAE 3DDFA 4HUNB 5D7EA 3S6PA 1AHMA 3KGLA 4KQ3L 4QF1B 3T6VA 4HKBB 2WT0A 2D03L 3F7YB 3A4UA 1R092 3OB0K 3QQXA 1VLXA 3J8F7 3SJVD 1LCLA 2BVUA 2ET1A 2DIAA 4N8VB 4X7FC 5FYLL 3S4SG 3EYPA 4UB0L 2DDUA 3STLB 2CBPA 2J8UE 2YSSA 4TVPH 1AR63 4FBFA 3HN1A 3X3FH 5FFOC 4X99A 5LBGA 2VNRA 1I8IB 1WLWA 1CD9B 3LPPA 2W08A 5JI9A 4YQXH 5FPIA 3EOBB 2JH2A 1T7VA 3LHPH 2DCKA 1YC7A 1NANH 2VXJA 4Y16A 1Z9NA 1VJ2A 1R3IH 2ICEB 2GTZB 5K0UC 5TE6H 1MRDL 3DETD 3QEUA 3ZO0A 3IWVA 1LOCA 4UAHA 3QDMA 3L9RB 1NQBA 3O3BA 1NGXA 4PJ9A 4XZUA 1QJX3 4IE6A 4SBVA 3RUGF 2JF1A 2YOCA 4N2CA 3HNVL 2Z5WA 3N7JA 5CFAA 3CN4A 2Z42A 4FPJA 5A3NA 4N2DA 3VCLA 2Q76A 4GSQA 4ZS6D 2ZCWA 4NEHB 4RGNE 4UQ2A 3UZQA 3RVHA 2AGJH 5IOPA 1FIEA 3HC0A 3A47A 1HK6A 1NGQL 3BSZH 3K4AA 2OP4H 4M02A 5KS9E 3N04A 3VH8G 4DOHB 5LA9A 1FH2A 4P2QE 3T4VA 2X0VA 2R0FA 1TCRB 1Q4NX 1HCYA 2EDFA 3N43F 4PUBL 4A2UA 2YUEA 2P8LA 4Y19B 1LU2A 3T8XA 2J2ZB 1JDCA 2NP0A 1JXNA 4LNVA 2K0GA 5HD8C 3T6WA 2DJ4A 2VDQL 3P11L 4PJCE 4JL1A 1M71B 1O6SB 1NCWL 1U8MA 3BEVA 3L3HB 3P3NA 4LNRA 1TNNA 1UVQA 2ADFL 2OYPA 1JXKA 1BSIA 3IDJB 1KD7A 4HJSA 3SBRA 2LU5A 3HZKA 3GSNH 1WEJH 2H6PB 4WFGE 1JAEA 3BP5A 2VVEA 3QZWB 4RNRB 5I73C 2XZQH 2D3LA 4Y20A 5I66A 1CUOA 4LBEB 4LQFL 2H0EA 4CVZA 5A6ZA 1G7IA 3AM8A 1UYWH 4XPBL 1HESA 2W81C 1V05A 4GMTL 3LEYH 1NLQA 3F6LA 5EN2B 5EOQL 4LEBA 3WTWA 3JV5A 1MS9A 5DD1H 4AENA 3MW2A 4EN6B 2J43A 3FU5A 3GIVA 1QKZL 1I6XA 3HNTH 3GXUA 3LJ3A 2ETEA 2PHUA 4FQQA 4Y16D 1OM3H 1G43A 1OB1B 2UZYA 2X3CA 3AW5A 1UKGA 3NSXA 1DVUA 5I76A 4ZU4A 5JYMA 2BVQA 4K7PY 5SWZB 1JZ6A 2IIJA 3KPLB 4HEMA 4MD0B 1EV13 1AR71 1VBB3 5FK8A 3CFUA 1SY6H 4AKPA 3QYMA 5C6TH 3GBFA 1YEGH 2RS33 2UYBA 3HI1A 4QTHB 4EZMA 1OPMA 4URTA 1BLIA 2BSDA 1KJVB 4MB5A 2JIXD 4E2GA 3VRJB 3LKSB 4EUPB 5IW6A 3SJVA 2A4EA 4IEXA 4LBLA 3Q9PA 2VLJE 3WY3A 4V1PA 1YN6A 2V2TB 2X4TB 1TCMA 2Y1AA 3AQXA 4H25A 3ZT5A 1J3QA 5GIRA 4XFBA 2JX9A 4E8CA 4HIIA 5FO9B 2XJQA 1U93B 4PIZA 1M05A 1MS0A 1GNHA 4NHXA 4PS8A 4ZUUB 4WK2B 5MEOA 3G08B 1L0YA 1UOBA 5FZ1A 4BQ2A 4FFTA 1PGW1 1AKPA 3ISYA 4P48A 3IF1B 1QG3A 4AC2A 2HFGH 3H8UA 4KTDH 2IZWA 3BKYL 1NUKA 2JDNA 1Y18A 1Q8PA 5HHOA 4DN3L 3UTTE 5JIQA 4NWUL 2W87A 4K3UA 3QG7L 4RH4A 2R0KH 3DMMC 1U95A 2DJUA 5IT6A 4NO0B 4JHWH 4JKPH 2ZGUA 2B77A 5D8JL 4UTAH 3A0NA 4XUNA 1BEXA 2XQRA 1UF2C 5EORH 2GUYA 2HSIA 4Z23A 2LQRA 4KK9D 4QXTA 1VIWB 1JU4A 2N56A 2H1XA 1IEBB 4PDWC 2UVEA 2GNMA 3NV3A 4TNFA 3N9MA 1XB6A 2YXWA 3CH8A 1PBYA 2E6JA 5FIXA 4HGWB 3EH5B 4L9DA 3O1OA 4K2UL 4XP9H 4YO0B 1FXZA 1I9EA 1U6AH 1YNLH 2BU9A 1ZZBA 3OXRA 5CEYA 4KWUA 4HAKA 5I5MA 2AR6A 1HEHC 3OPWA 1NC4A 3VGFA 4XCCL 1VAKA 3T1MA 2PTVA 1TME3 2OULB 2Q0ZX 4PP1D 1R1ZA 2C3VA 4LEOA 4NC1C 4P99A 4X6BB 2A6ZA 2IXIA 2V37A 1POV3 2V2WA 1Z0NA 5D70H 4FZ8L 5FA3A 1MQKH 3KWXA 5KSBB 3FUIA 1XF2A 2JCWA 1MG2C 3VJ6A 1OB0A 2VCBA 1J87A 1EUTA 3E6FA 3PFQA 3DETC 1D5IL 3JWOH 3FT1A 2X89D 4LEEA 1X5ZA 3ASWA 4MJIA 4PY7A 4X42A 1LEKA 1XBFA 3M70A 1IGJA 1XB9A 1JOJA 1UZGA 2VUJA 2R39A 4ZFOB 2IOIA 2P2KA 2R32A 4PG9A 4YDNA 1AQDB 3PAZA 3Q9QA 1AXKA 4HWZB 3GLEA 4HK0B 1PG7L 4CL7A 3G7DA 1E5HA 1R5WB 1LKNA 4KO5A 1TME1 2YD7A 2H3NA 5TE7H 5D96C 2G0LA 1O91A 3AM8C 1RUE1 4IIQC 1DVZA 4QDQA 1C9SA 3H85A 3L7EB 1CLOL 1N64L 2GN3A 1UWXH 4AZ8A 4Y5Z0 1YA5A 3GNML 4HSQA 5EPAA 2ZGOA 1AZRA 4LGSB 3SOBL 2X42A 2JJVA 5K9KB 1IGYA 4Q4X3 1RZQA 1MEC2 5ETUA 1ZV2A 1CFVL 2FEDC 5J3HC 2YU1A 4IEZA 4IKKA 3OLGA 2VTXJ 5T55A 1MLBB 5I19L 1AJKA 1U8MB 4UWDA 5KVEL 2G5BA 5DAQA 2ZCLH 4FFHA 1PMYA 1K8DB 2B5IB 4TRPL 3PHAA 3O3DA 2D9QB 3A4AA 4IRZH 2IXCA 1KTDA 3FMGH 2P8LB 3VI3B 3VGGA 1PF3A 1DANU 1NLBL 4PLNC 4XMKL 4YUEL 4ZUVB 5SWQA 1UWGL 3X1NA 2XDVA 4DEVA 3Q1EA 4GUPA 1KTDB 2YGQA 1AGEB 1M6OA 1YC61 3G6AB 1O3RA 3DOSB 5J1SC 5JHBA 4HPOL 1RUE3 5KSAA 1RPKA 3I9GH 4NQCD 3VCLB 1AYM2 1K12A 2ZXAA 3NJIA 1PVC3 4MADA 3Q1SH 5AD0B 1LE5B 4OLUH 2X1XR 3M3EA 1UCBL 2QPFA 4C58B 3KJ4C 1HRV3 2D97A 2E5EA 5MEND 3KL0A 4WGWB 3QHFL 5JIHA 5B3JE 2OPKA 1A1NA 1B4JL 1Q9LA 5ISZD 2V17H 5GGQL 4DFHA 2WXLA 3CEWA 3EAKA 1XE7A 4EN3B 4U2AA 4UINH 5EBMA 5GQBA 5JIUA 5DQ9A 4N53B 2BNNA 3FQNB 3B7TA 4YZWA 1A3QA 2NMOA 1R64A 4PF1A 4PIYA 2PLV2 4J3VA 5C8CC 3HG1E 1KTLA 3ZHNA 1BJ8A 2WSUA 4QKXB 2MHAA 2J1VA 5EU7E 3FDWA 3CVBA 5E1HB 5D1ZB 4JPKL 3T4AB 2FJHB 3T0DA 1JU3A 2PPFA 4B4PA 2LFEA 3S5LG 3POGA 3POIA 3AREB 2QZ2A 2X6VA 3W1ZA 3A23A 1Y9MA 4P3DA 2YEZA 3PHOB 1A6VL 1IGJB 4RISL 2G3XA 1HAUA 3PJNA 5FQ0A 5FJHA 4PJIA 2N7GA 4F7MA 5GGSB 1QVOA 1IGTA 2FBRA 2NY6C 2CE6A 1AD0B 1TZOA 1ORSA 3WUDA 5C4WB 4ZUWA 1X7QA 3RSJA 4HLZG 3FUFA 3IS0X 3MCKB 4JBSA 5HHNB 3MV8E 4PTTA 5H8DA 5ENWA 3QT2A 4J6RH 2GI0A 2IDCA 2EH8H 1DQDH 5F96H 3ZYJA 1W6NA 1I3GL 5JOYA 2CO3A 3QRLA 5CJOH 3ULUD 1LOFA 5D9SA 5EZJA 1HQRB 5E9DD 4K23H 1FYTD 1CDGA 1ZZ7A 3H54A 4XVHA 2BP0A 3SMHA 3LB6C 3MCLL 3VL8A 5CHNB 3TV3H 3ZYZA 4OD2B 1SHXA 4HCRL 4Y88A 2OL3B 2FWSA 3JTSB 5FDWA 1V8HA 2DKSA 3IJSB 3GFUA 3RVXD 3D3AA 4W9KC 3GMMA 3FOMB 1RP8A 5BZXA 1IZJA 3N4MA 2NYKA 1OL0A 1MCNA 2ICWB 1A6WH 1LWRA 3I6LD 1EBPA 1FG2B 2J5WA 1VF5C 5DRZB 2BOCA 2LHAA 2C7FA 4OD1L 4H8VA 3V0AC 2EXYC 2ORBL 1HYSD 5FZOB 3VH8A 1BD2D 1Q94B 5EHFA 4UQDA 4V2CB 4TS6A 4F8LA 3RU8L 1ESOA 5HYJD 3EF7A 5BNNA 5DYOA 1JHTB 1RULH 4NKIL 3HMXA 1EHNA 1OGSA 1L3JA 2A74A 1REDA 2F4PA 4L11A 1Q3EA 2VXUL 4HC1A 1BQPA 4YM0A 2C4XA 1QACA 3QCUH 1F5FA 1ETB1 4GH4A 1CS6A 2ED9A 4XVJL 2VITA 1IX2A 2HJLA 4XP6L 3APFA 1HT6A 1KB9J 5DEGB 5IAXA 4EN8B 1NBQA 1OEZW 1OHZA 3H9SD 4ODUA 1PO23 4LBQD 4N22A 1E50A 1QLEL 4FQJH 4GUOA 4NUQA 3VZJA 1C08A 3JBG1 1X7NA 1WT5A 5T54A 4D3WA 2EIMB 5MERB 4ZS7L 4M7KH 4OV5B 3B2UD 2HYXA 2BWDA 3BLPX 4UV4H 5AOKA 2J73A 4XFIA 2V8LA 3ML8A 3VKMA 3MLKA 3OEBA 3PU3A 3POEA 4U6TA 4FQQB 4AYFB 1QA9A 1G0DA 2J72A 1QLFA 1ET8A 5I1AA 4M9PA 3S3SA 2C1PB 3P4OA 3UGXA 2IANA 1E30A 4KUZH 3KPPB 3ME0A 1XH1A 3P3PA 3JV6A 1B0RB 4JO5A 3K6NA 4PVNA 1RIRA 5FP4A 5D8AA 4M3HA 1BM3H 5F1IB 2BEOA 2B3RA 4WUKH 3D39B 3EUDA 4YZ4A 3L3GA 5E6YA 2BOIA 4FTEA 5IVZA 3KD4A 4F58L 4QY8A 1RUC1 3FB7B 1IZ3A 3DN7A 4KRLB 2QADD 2VDMH 1VFMA 2OSLA 4ODSL 5GSRA 3EIFA 2C34A 2NW2B 5C9JB 4FXGB 4NC1E 4J5VA 2WMPA 5ABZA 4H0GA 4FKKA 1KIUA 1AHWC 3N9GH 2KM2A 3CSYB 3I85A 4X0KA 4XWGL 3T09A 1FPTL 2FJGB 4Y19D 2OBGA 4MA8L 3S0PA 2ZACA 3ILFA 1DE4B 3KHQA 2WUHA 5L7OB 3DX1A 3QCUL 3QULA 3ZYIA 4JANB 5T3ZL 3WY6A 2Z91B 3UTPE 3HBZA 4QHPA 2AQQA 1MACA 2IFGA 5CEZL 3BZ4A 4LCCC 3MW4A 3EBIA 2KC0A 4MV2A 1MPAH 3LY6A 4X8PA 1DJGA 1B3JA 1X5JA 3WDIA 5EDSA 2ZD0A 4R7LA 3BVDB 3QFJD 3PVOA 1OOPC 3CH1A 3DMMA 2IPKB 1UZ0A 5FECA 4OLUL 2PHRA 1XZ0B 1SHSA 3AROA 4HKJA 3F01A 1Q72L 2QTEA 2EYSB 2VO5A 2XTJD 3HQXA 1KBBA 2AK1L 3NNGA 3O0LA 4POUB 4U1LA 3KDMA 2F53A 2J8UB 2QFPA 4PB0L 3U0PA 3QSKB 5E6ID 5L7OA 1XNAA 1LXMA 3LKNA 1UWGH 1FYHB 4HXBH 3ATDA 3GSQA 3KYNA 5HGAB 1MY5A 3U25A 2AK4D 2V7HA 1EP0A 1GP5A 5JORB 1CD0A 3OKOA 5MENB 1VGEL 4UIMA