1AX1A

Erythrina corallodendron lectin in complex with lactose
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
239
structure length
239
Chain Sequence
VETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNNSKQDNSYQTLGVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
publication title Structures of the Erythrina corallodendron lectin and of its complexes with mono- and disaccharides.
pubmed doi rcsb
molecule tags Lectin
total genus 52
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1997-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ax1A00
2NN8A 1YXWA 3RS6A 3WCSA 5EWSA 5IK4A 5KXBA 3R4SA 4AGRA 1IS5A 1C1FA 5GALA 1Z78A 2ZHKA 4Q1RA 4Y1ZA 2EXIA 2DTYA 2A7AA 1CPNA 2WQZC 3AYAA 3RMXA 3AYEA 4FPJA 2HYKA 2XB6C 3PVNA 4XBQA 1V6JA 4XDQA 2D6OX 2YY1A 1QU0A 1W0OA 4LBMA 3QLQA 3R4UA 2AYHA 3B9CA 2EAKA 3AYDA 4AGVA 2VW0A 4YGEA 2TEPA 4CRQA 3MW2A 3FLPA 4UW4A 5T5JA 1AXYA 3B69A 2JDZA 2D44A 2H0BA 2AH2A 2GNMA 3N7LA 1WW4A 2ZAAA 3V64A 2KM2A 4M3CE 3WHTA 1W6OB 3POSA 2CWSA 4GKXA 4YW2A 1VAMA 1AJKA 2D6KA 2E7QA 3IKWA 5T52A 5GLZA 4R9CA 4GALA 5DZEA 2ARXA 1O4ZA 2R0FA 2ZGKA 1GKBA 5IT6A 5GLWA 2PHRA 1LCLA 5KXDA 2W39A 3N7KA 3O5SA 1JXNA 1KITA 1HLCA 1LHVA 1W6NA 4PBPA 5E88A 1FV3A 1BZWA 3FLTA 3ZSJA 1GSLA 2NP0A 1W6PA 3ATGA 3UK9A 5IK5A 4NO4A 1N3QA 4XTPA 1SBFA 1SACA 1UX6A 1QKQA 1H30A 3MW3A 3ZVXA 1SFYA 2ZHMA 2CYFA 1LOEA 1QF3A 1UKGA 3DUIA 2D3PA 4PCRA 3ZPYA 2YROA 1APNA 5AVAA 2P3IA 1LOFC 3Q9OA 2DUOA 1LESA 2D6PA 2WKKA 3ZSLA 1D0HA 2NYYA 5CB7A 4XILA 2GNTA 5GLTA 3WLUA 1BQPA 4GXLA 4WZFA 3WV6A 1DYKA 4K21A 4F83A 5IK7A 3IN9A 1QGLA 4M3CF 2A6VA 5E8AA 3POYA 5GLVA 4AVTA 4FPKA 1X50A 2A5ZA 5GZFA 1G9CA 3WNXA 3WUDA 1W0PA 3PJQA 1VAVA 1W6NB 1Y7BA 2YXSA 2Z42A 3WDVA 3AP5A 3WDTA 4UW5A 3N7MA 1CIWA 3IMNA 4DQAA 3M3CA 3I4IA 2GNDA 1DBNA 1W6PB 2A6XA 1FNZA 1AXZA 2OVUA 1MS5A 1CONA 2WSVA 1HQWA 2PELA 1S0DA 2ZGTA 3I8TA 1MVQA 2AR6A 4BMEA 1C57A 3RG0A 1BXHA 2WT2A 1ENRA 1GANA 1SLIA 2CWMA 5BYNA 1V6LA 4FPCA 1ZA4A 1CQ9A 2W68A 3RMYA 4YG6A 4FOYA 4H55A 1AVBA 1YRZA 1A3KA 2E53A 4ISQA 1SBEA 2D43A 2DU1A 3BIWE 4P9XA 5F5QA 5IK8A 5GJ6A 3BOPA 5CAZA 1GLHA 2W52A 4XJZA 3AK0A 4FP3A 2UU8A 2ZMLA 3MW4A 3AZZA 1LU2A 3WVJA 5FRAA 5CA6A 1MR5A 2P3KA 2SBAA 3MEPA 1WBLA 1IS6A 1DQ0A 3A4UA 3ENRA 3OBTA 1UZZA 4LBQD 2A3WA 4SLIA 4Y1XA 1F9KA 1ZM1A 2JE7A 5GZCA 4XMAA 1BKZA 1OQ1A 1FNYA 3FBYA 4ISRA 4YZ1A 1V6IA 3GNEA 4JRAA 1TEIA 4Y1VA 1FYUA 4MYEA 5HCFA 1ULDA 2D6NA 4D69A 5GZGA 3MPPG 3M2MA 2CNAA 1N1VA 1F31A 1AX2A 3IPVA 1Q8VA 1LULA 2FMDA 2VY0A 4HANA 1KRIA 3ZXKA 3T1LA 1PZ8A 2D6LX 4DS0A 4RA0A 4GWNA 1N3OA 1GZ9A 3BTAA 4C1WA 4XIOA 1BJQA 2GN3A 3SH5A 4XJ8A 3CNAA 3VKMA 3AP7A 2G4IA 3WDYA 4M3CA 1WD4A 1V6KA 4LBLA 3AP6A 4LBNA 1U0AA 1QOSA 5EXOA 4FPGA 1EPWA 1LGNA 4M00A 2ZGQA 3APBA 5DG1A 1CPMA 3AYCA 2UWBA 2ZMKA 1R1ZA 3AJZA 1LTEA 4IQPA 4YW3A 2EXJA 2P34A 1DQ2A 4HL0A 5T54A 1O4YA 3A0NA 4XJWA 1LGCA 1V6NA 4Y26A 5CNAA 2VUAA 1JOJA 4YG0A 3WHUA 1ENSA 1SLTA 4U36A 4W65A 5DZGA 3SH4A 2AUYA 1WUVA 3D6EA 3V65A 3C2UA 2AENA 4WVVA 2ZBJA 1ULGA 4JC1A 2A75A 1QNYA 4YGBA 2W08A 1S0CA 3WG1A 2CL2A 1WW5A 1V00A 1S0BA 1W6MA 2UWAA 4K20A 2ZGRA 1GNZA 1LECA 4YM0A 1G8WA 4ZXKA 1C4RA 5IUQA 2D3RA 3B01A 4TYSA 2PHTA 5JDBA 2A3XA 2ERFA 3AP4A 4Q1PA 4I30A 2E7TA 4YZ3A 2UWCA 4R9BA 4M3CB 5H9RA 3O0VA 1G9AA 4Q27A 4R9DA 1J1TA 2DUPA 3N35A 1WBFA 2D7FA 2SLIA 1B09A 2R16A 1MS3A 4PBOA 3B3QE 1V6MA 4ATFA 1QDOA 2EXKA 1Q56A 1MS8A 4YW5A 1BYHA 4TZDA 4XZPA 1MVEA 3JU9A 1WW6A 4FQZA 1JYCA 2DUQA 3T1MA 3HMYA 5GLUA 1IOAA 2WNEA 4Y1UA 3SITA 1LOCA 1QOOA 1OFSA 1QNWA 1LHOA 1KDKA 4YZ2A 4ZKTB 2ZGSA 3D5OA 1MS0A 4XJAA 3SH3A 1IKPA 2R1DA 1GV9A 5JOWA 1LOGA 4XJUA 1LOBA 3LCPA 1ONAA 1UN1A 5H9QA 3O0XA 3OY8A 2DVBA 2P3JA 4GKYA 3ZYPA 4FOQA 1MS9A 1MZ6A 2JECA 4DRVA 1GNHA 2CTVA 2YMZA 1Q8OA 3OYWA 1DQ6A 3WG4A 3AFKA 5JVVA 5L73A 3WDUA 1UL9A 3WCRA 3ZXEA 5T5OA 4BPZA 4Y22A 3WUCA 4FOWA 4LBQA 3M3EA 4XMIA 1LEDA 2E6VA 4ITCA 4LBJA 4YZ4A 2ZGUA 4XOGA 4DFSA 2A70A 2NMOA 3INAA 1HKDA 3M3QA 5EYYA 1JYIA 5DUXA 3W58A 2ENRA 4Q8KA 1Q8QA 2YV8A 2C5DA 2EALA 1S0FA 2NMNA 4YFZA 2DTWA 1CR7A 2VW2A 5T50A 4BOWA 3NV3A 1GICA 1H9PA 1A8DA 4XBLA 2A71A 4AWDA 2DU0A 3SNMA 3R05A 1KDMA 2OUJA 4XXPA 1PZ9A 3RRDA 3ZSKA 1DLLA 1GYKA 2ZMNA 3OJBA 4YW1A 2DWRA 1LHNA 2ZA9A 2ZABA 2OW4A 1LHWA 3NWKA 2ZHLA 3OY8B 3VUOA 1ULCA 3VKLA 1CESA 1HDKA 3VKFC 3WG3A 1ULEA 2JE9A 2EF6A 3OYWB 1YI7A 2I2SA 2FHRA 2WLQA 3FUOA 4FPOB 4GA9A 4P9YA 4XJ9A 1GZWA 3FUQA 3KQRA 4Y22B 3LSDA 3GALA 4LBQB 1JHNA 2LALA 3NV4A 4YGCA 1JW6A 3ZXLA 1FV2A 3V0BA 1QDCA 1WLWA 3USUA 5JMCA 2ZGLA 3AZWA 1IKQA 4YZ5A 1UAIA 5DZFA 5GM0A 3V0AA 3LSEA 1URXA 3HN1A 3OBRA 2DVGA 1PZ7A 1CJPA 1Q8SA 3OPZA 4JCKA 2A6YA 5KXEA 3NV2A 1RINA 2EIGA 1MS4A 3AXEA 4FVVA 1JUIA 4XHBA 1LGBA 4P14A 5H9PA 3RSJA 4YM3A 3D4KA 1DQ5A 3AX4A 1H9WA 4XTMA 1WD3A 2WSUA 1SLCA 4RL7A 2VW1A 4YM1A 1N1SA 1KQRA 1LU1A 1MZ5A 1I1EA 3AJYA 5HCAA 4U2AA 1VIWB 1MACA 4C1XA 2ZGNA 3M1HA 1AJOA 4Y1YA 3UJQA 4BLJA 3U4XA 1V6OA 2CY6A 1DYPA 1LODA 4R9AA 5EYXA 4WV8A 1GZWB 2JD4A 5T5PA 3AZXA 3WOGA 2VU9A 4YM2A 1Q8PA 4XYXA 3H0OA 4FP2A 4Q26A 3V0BB 4M01A 2BQPA 1Z0HA 2RHPA 1LOAA 2A6WA 3USUB 2Q5TA 3TAYA 1ENQA 2GMEA 3IPVB 1LOFA 4PF5A 4WVWA 4AVSA 3V0AB 3AZVA 3ZXJA 2R0HA 1W6QA 1N47A 1MS1A 1AXKA 1DZQA 1OKQA 1IS3A 3RQ0A 5T5LA 3O0WA 4Q2FA 1DQ1A 2DVFA 4XXAA 3UJOA 2PHXA 1S0IA 2NM1A 3DGTA 3N3HA 1SCSA 1QOTA 3B00A 4FPYA 3HR9A 3M3OA 2R49A 1AX0A 1SCRA 2ZKNA 3AP9A 4Y20A 3SLIA 5DXDA 4BM8A 1G9DA 1S1AA 4FPFA 1G9FA 5DUVA 4PQ9A 2R1BA 4UW3A 2PHFA 2AGSA 1KJLA 3ILRA 4Z8BA 1FX5A 2PHUA 1XQNA 4FPEA 3OGGA 3ASIA 1DHKB 4K1YA 4Q8LA 3PMEA 1HQLA 4AGGA 3VKOA 1UZYA 4XE9A 2ZHNA 3PVOA 4FPLA 1N1TA 2GN7A 1NLSA 4P9WA 5JOXA 3L2YA 1UPSA 3BODA 3ZYRA 2VH9A 5DG2A 1W6QB 5F9TA 1W6MB 5SV8A 3N7JA 3FLRA 1FAYA 2P2KA 2VXRA 5DUUA 1AX1A 3ZXFA 4GWMA 1DIWA 2ZZJA 1N1YA 3ILNA 4ASMB 5H9SA 4YGDA 4KBBA 5CBLA 4YG3A 5GZDA 1WW7A 1C1LA 2ZGMA 1VLNA 2ZGOA 1UMZA 3FFZA 1AF9A 4Y20B 2GNBA 1CN1A 2P37A 3ZSMA 1YIFA 2OUHA 1S0JA 5JOYA 2DVDA 5E89A 4AVVA 1WLCA 1RITA 1NXD1 1LHUA 2C9AA 2JJ6A 2JKBA 1SLLA 1DFQA 3T2TA 3UL2A 2D3SA 3VKNA 3JUUA 1GZCA 4CTEA 3POWA 1I3HA 1WCSA 4XIKA 4YW4A 1SBDA 4FQ4A 1G86A 2LTNA 3WG2A 1ULFA 2E51A 1G9BA 4BMBA 1VALA 4DRRA 1RIRA 2XG3A 1A78A 1DGLA 3N36A 3WDWA 1DQ4A 1S0EA 2V73A 1IS4A 1S0GA 2DURA 4Y24A 3WZ1A 4L8QA 3AXDA 2ZACA 3AZYA 1SLAA 3KM5A 4FPHA 5GZEA 2ARBA 2PHWA 3TB0A 3O12A 4BLIA 4K1ZA 1KJRA 3A0KA 4ATEA 1FATA 1G7YA 4YLZA 4DPNA 4XBNA 1JN2P 1SLBA 2GMPA 5KXCA 1GBGA 2ZGPA 1YO8A 4LBKA 3WDXA 1D2SA 2WT0A 2GALA 3SISA 2B7YA 1CVNA 2WJSA 4UW6A 1F5FA 4OZXA 4XHXA 5FREA 5T55A 3VV1A 3W59A 5JLVA 2D6MA 5DUWA 1AZDA 1N3PA 4FOVA 1LEMA 1WLDA 1LENA 5JOZA 2V5YA 2GDFA 4NOTA 2NZ9A 2DYCA 4CZSA 2A6ZA 1LJ7A 5HCBA 2DVAA 1YYNA 2EXHA 3IM0A 2GMMA 2UURA 3QCWA 1W6OA 2WT1A 4LBOA 5LK5A 1QMJA 2A3YA 3PVEA 1JBCA 2YZ4A 3NV1A 2ES3A 4AYUA 2AREA 4YFWA 3ILFA 4BQ1A 2DV9A
chains in the Genus database with same CATH superfamily
1YXWA 3C7OA 5DAQA 3WP5A 2Y6HA 1GOFA 3UESA 4AGRA 5HCHA 3B02A 1QY4A 4IXLA 4Y1ZA 5F3EA 1QJFA 2A7AA 1XXNA 2DTYA 2WQZC 4EWDA 3H8UA 3HQXA 2JG8B 3AYEA 2WNUA 2HYKA 4WVMB 4XDQA 4MZUA 1UIJA 2D6OX 5F6LB 4S2HA 1V9U1 1QU0A 2YY1A 3ZFFA 3LDRA 5J7MA 4KWLA 5C70A 3QLQA 4CP9B 2VZUA 2UY9A 1VE0A 4HPKB 5A7PA 1QWRA 4AGVA 5KC5A 3TWIA 4F8AA 1HRV3 2PLV3 3FLPA 3H3ZA 3WXPA 4UW4A 3ZMOA 3I49A 4BQ2A 3VBOA 1AXYA 3B69A 3THDA 3TN91 1S4CA 2H0BA 3D0SA 1OOPC 4LO4B 4ASLA 3VDBA 2EAAA 1AHSA 5FWJA 1VMFA 1QJX2 4UAPA 4CEWC 5DPNA 1W6OB 3IIIA 3POSA 1JZ4A 1W8FA 4XFHA 4DXSA 4CUBA 3IKWA 1OH3A 4UT5A 4R9CA 4GALA 5A6QA 2MNGA 2R0FA 2XJPA 1VB4A 3WQBA 4KG8A 3RFRA 1LCLA 5DQ0A 2W39A 4CEYC 1JXNA 1UYZA 4PIZA 1DP0A 4PF1A 5J09A 1BZWA 4EV0A 1C8NA 1J58A 4UI9L 1PO12 4IL7A 1XNCA 4RR3A 2OX0A 1VBA3 2NP0A 1W6PA 2BOJA 3QD6A 1STMA 1W8UA 1SBFA 3U14A 5JR2A 3Q8AA 4QPGB 1NCQB 2KA3A 2R061 1R092 5LRRA 3ZPYA 3GCWA 1JYXA 3LE0A 3HEIA 2QQJA 2P3IA 3ZR6A 1TE1B 1LESA 3OBZA 1ND2B 3ZSLA 4BJ0A 3MZHA 3KCYA 2QZ3A 2ORZA 2D40A 3H1MA 1W2OA 5F3IA 3UGGA 5FXVA 3WLUA 3CEWA 1RXGA 3WV6A 2RMU3 2VBDA 1QJZA 4J6GA 2OPKA 4M3CF 3FC0A 1H8TB 1QH6A 3POYA 1O3SA 4ES9A 3BPSA 3PJQA 5JCTA 3NJVA 4XF1A 3VD3A 2B9UA 2JE8A 3WQ0A 5L7OA 2XJUA 4XZUG 4FTSA 2G9FA 4Q4V2 1VAVA 1W6NB 5FYZA 4RN5A 1VP6A 3WDTA 2HWC1 1NG0A 1RVF2 2Q1ZB 2YPDA 3JD72 4I3GA 4LA2A 4RS5C 1CIWA 4QXHA 2VOTA 4DQAA 2I45A 5A3OA 1JU4A 1UMIA 5FIXA 4B7EA 5CG9A 4BIOA 4P9LA 4OYUA 4XFBA 3ZPOA 2A6XA 1RXFA 1AXZA 3RZGA 1MS5A 3JQWA 4UFKA 4Q29A 1MEC1 2PELA 4AEKA 1F35A 2JIJA 1VRH1 1PMJX 4BMEA 1KXGA 2WT2A 5A3MA 1IPKA 1SLIA 4PDWB 3ZFGA 4IGPA 4QM8A 2W68A 5FY5A 5FZHA 5A7OA 3M4FA 1QJU1 4JGZB 4FOYA 4YG6A 1QJY1 1JYNA 2C0ZA 1POQA 4Q0VA 4MXWB 4CDUC 4K8RB 1D4VB 1ST8A 2MPFA 3BIWE 4P9XA 5F5QA 2BDRA 5CZKA 3ZLIA 5CAZA 3BIEA 5F5CA 3AK0A 3MW4A 2B9VA 2QQMA 4QD2A 2HKXA 5E16A 4E9KA 2HWD3 3WT3A 2JG9B 1R081 4HOOA 1US2A 1JMUB 2UYBA 3VZJA 4FFGA 3OBTA 1LAJA 1W2TA 4Q4W1 4QPIA 3VLBB 2R7EB 2CU5A 3PURA 1K5MC 4JX0A 2K2SA 2ZEZA 4Y1VA 5LASA 4BCUA 5FPXA 1WA6X 2HWE3 1DZTA 1PNGA 1R1A2 3NNJA 5HCFA 4D69A 5GZGA 1WMEA 2ATFA 3M2MA 2HWF2 3N4MA 1ZRIA 1VBD2 3T4HB 1F31A 3ZFEB 5F32A 1AX2A 2YBKA 4FAGA 5JIUA 4CP0A 2Y26A 4DY3A 2D6LX 3LIGA 4DS0A 2RDRA 4XIOA 4OI1A 2J22A 1BJQA 4QDRA 3SXWA 1ZRRA 2VCBA 3AP7A 1D4M2 2PXJA 4LE3A 4M3CA 5FOBB 5CKMA 4LBLA 3LEMA 3KV4A 1AUYA 5CYYA 3RJ2X 4LBNA 3FZ3A 5HXVA 3I2OA 5EXOA 1H1IA 4FPGA 5LA2A 1C8M1 1W9SA 4H7LA 4M00A 3WY6A 5J98B 1CGPA 1OLMA 4NIDA 4QGLA 3JD71 2UWBA 2ZMKA 4CU7A 5J37A 3AJZA 2FCUA 1YJKA 3BN6A 3BTXA 2ETEA 2VMCA 4LO8A 3VBUC 3HVDA 4QX5A 3WW1A 4XJWA 1PVC3 1R64A 1V6NA 2ZX4A 3EO6A 1ENSA 2TUNA 4EZ4A 1HRV1 3SH4A 3LEIA 3VHPA 3V65A 3I97A 4W6XA 3S6PA 4Y4YA 5FTTC 1IGOA 4BQYA 3PNAA 1E57A 4JKMA 1PVXA 4LXLA 5FK8A 3RVHA 3T2PA 5AFBA 5A3WA 1SQ4A 3KCXA 3VZMA 4K20A 3JXSA 4CDXC 4ET7A 1GNZA 1KS5A 2WNUB 4OHXA 4ZXKA 1O8SA 2D3RA 3C7EA 3LA2A 2WNVA 3S7EA 2PHTA 3T08A 3DYPA 2E7TA 1UW8A 1YLLA 1AL22 4R4XA 1J1TA 4HVQA 5C5UA 3CJIA 3MLJA 3NAPC 3KV6A 3WD5A 4ZHNA 2XBO3 2QQLA 3VBOB 4Q0SA 2XPJA 5FPUA 4FSJA 1V6MA 1VBA1 3NO8A 4N53B 4DXRA 3WNOA 1MS8A 1JZ5A 4MUVA 5BXXA 4FQZA 2DCTA 1JYCA 5IWFA 2IVJA 3CBNA 2DUQA 2IFWA 2XJQA 3T1MA 5GLUA 2E31A 2WNEA 4Y1UA 1KEXA 4MGZE 4BQ5A 1UOGA 3PUSA 4KG0A 3D5OA 3LEKA 2VNRA 4R8HA 4D94A 4JKKA 3USSA 4Y33A 4D6SA 3VDDC 2RMU1 1ONAA 3OY8A 2IXIA 4HLTA 4NWWA 4DRVA 2YMZA 3M3IA 5I91A 4QGNA 1HN0A 4OQ8A 1Q8OA 1B35C 4EE2A 5I0DA 1UL9A 3ZXEA 3ZXGA 3FHIB 3FFQA 5F39A 5T5OA 4OMDA 4D3WA 5CEHA 3AVRA 4FOWA 1LEDA 2E6VA 2WAAA 3J4UH 2ZCWA 1QXPA 1RUD3 3NNMA 1RTVA 2VR4A 2XUMA 5D1IA 5F1RA 1AR72 2WFF2 4N43C 4XUPA 1JYIA 2XDVA 1GP5A 2WC2A 4XQ4A 1Q8QA 2YV8A 2HWB2 2C5DA 4PDWC 1QEXA 5FYTA 3VGIA 4ES8A 1ASJ3 5FP8A 1CR7A 2OQ6A 2RM23 4BOWA 3NV3A 4AHWA 2JDUA 2A71A 4N7IA 3K3NA 4QXCA 3SNMA 5A33B 1OH4A 1YEWA 5FPVA 3ZSKA 1NLRA 1OF4A 1YQ8A 1CX4A 2BUKA 2RS11 2ZMNA 3H3UA 2RE9A 3ACIA 4IEXA 4MHRA 4UFLA 1VMHA 1BBT1 3S7IA 2OW4A 1LHWA 4PLNA 1HV1A 4N90A 2WABA 2QQVA 4RHV3 2ZJCA 1HDKA 3H1YA 5A6YA 1JZ8A 2JG9C 1BEV2 2EF6A 3BU0A 1NY71 1WGPA 3NVCA 4CCKA 3FUOA 4XJ9A 4GA9A 1H4HA 1GZWA 2P17A 3KQRA 4OVEA 4Y22B 2Q8OA 4AQSA 4E2GA 5CG8A 1JHNA 2CDOA 3NRUA 1VB2A 3USUA 4BXFA 5JMCA 4HSJA 3V0AA 1IKQA 5CFDB 1UAIA 3LSEA 3O1OA 2VTFA 1OOPA 3HN1A 2IXKA 3KVBA 1NKGA 4AVAA 2Z5WA 2HWE1 1RINA 2VQ0A 3AXEA 4UWDA 4FVVA 2MEV2 4XHBA 3HT1A 4QHZA 3ETPA 1YQ5A 4R52A 4XURA 3RSJA 4YM3A 3D4KA 2GC1A 2Y0OA 5JXIA 1UNBA 4BISA 1KQRA 1UOFA 5FO8B 3HT2A 4MOAA 4I0AA 1MACA 1T6GC 1IG3A 3I3EA 1OQDA 5FQ0A 4IE4A 4C1XA 2C26A 2ZGNA 4XUQA 2ZOEB 3J7NA 5FYCA 1ZZCA 2W0XA 4IEZA 3U4XA 1DDLA 2VMGA 5EYXA 1VBE2 3WOGA 2QVSB 2VU9A 5IFTA 2CGNA 4FP2A 5B4XA 2W92A 1YC61 4HMZA 4O65A 1Z0HA 4BH9A 1LOAA 2A6WA 1VBB3 4XF4A 4PF5A 3AZVA 2C4XA 1AYN2 2JDHA 1GU3A 1PVC1 1I9RA 1NA1C 3AKQA 3J8F2 3LF7A 4EJRA 5ABJC 2WZPP 3B7MA 1RUNA 4LE4A 3PDQA 1DQ1A 4XXAA 3UJOA 2WA3A 4AL9A 1JYTA 1JZ7A 3HR9A 3M3OA 5C8CC 5HPOA 3OBAA 5KHJA 3BALA 1YFYA 4PLMA 5DXDA 1RUF2 2XJRA 3A22A 1E5SA 4HT1T 3DL3A 3BTYA 1XE8A 2R1BA 2VTXA 1XYNA 4INDA 3QOPA 2AGSA 5FZIA 1PMHX 1XQNA 1VBC2 5FPAA 4NHLA 2Z79A 1ZA7A 4K1YA 1J84A 4MGTA 1H2MA 3FX3A 1UXZA 3PVOA 1N1TA 3T2OA 4GJYA 3ZYRA 2JDNA 5DG2A 2QUOA 2RJLA 2WQ4A 1J3PA 1UY1A 3N7JA 3FLRA 4AEDB 1JZ2A 2VUCA 2VXRA 3KF3A 5FYMA 2DFCA 2XQXA 4GWMA 4P9IA 3ZXFA 3W21A 1DIWA 2ZZJA 3N9OA 5FYUA 1SPPA 4ASMB 4YGDA 4YWAA 3WF3A 3POIA 4SBVA 1NX9A 1YQCA 4IE5A 5CBLA 4AFCA 4D7TA 2XWBB 4GB32 1VLNA 4W4ZA 5FY4A 1NUKA 1AF9A 4LHSA 2GNBA 1RUE2 1CZVA 2XR4A 1YIFA 3UKNA 3PL0A 4BA6A 1RUJ1 2DVDA 3M70A 4GH4B 5L9BA 5LA1A 3VKNA 2JKBA 1POV3 2B5HA 3UL2A 4EN8B 4MH0E 3GBFA 4XFGA 1GZCA 3BCWA 4CDQB 1W8ZA 4FXKB 3IDBB 4P5YA 5A1FA 1K5MA 4LKFA 3OF1A 1SBDA 2WO2A 4FQ4A 4UYBA 4URAA 2LW8A 2ADDA 3WG2A 1ULFA 4JDOA 3DPRC 4FTEA 1M4WA 2ILMA 3E1F1 1RIRA 2WA4A 1DGLA 1HW5A 1W8TA 1BK0A 1DQ4A 3CHXA 4QQ2A 3TNQA 3WDWA 1S0EA 2ZEXA 2VO5A 1AYN1 2NPIA 1ASJ1 1S2EA 4G9SB 5FXXA 4AW7A 3AXDA 2VMIA 2WZR2 3F2ZA 3SC7X 5K7PA 2JG8A 3O12A 4HK8A 1OUSA 4EN7B 5F3GA 1CAXA 1KJRA 4DPNA 1FATA 1NOVA 3JB4C 4J1XA 5C8WA 1XNDA 3Q8EA 1F4HA 3GJBA 4HVOA 4JTOA 1LB2A 1RUH3 1RUF1 1D2SA 1K45A 2X29A 4RHV1 2GALA 1PIV2 4L92A 4HPKA 3VBRC 1CVNA 3H8RA 2WJSA 4B3NA 4XHXA 1F5FA 4LORA 4QT6A 3PUIA 1C3HA 5EJ3A 5JI7A 5T55A 2JB4A 2W47A 1ACCA 2VNGA 2WO7A 1UY4A 3WQ7A 5IVVA 1E5HA 1N3PA 3E6BA 1LEMA 1ND3B 4KU8A 5CFDC 1LENA 1H1AA 1AR93 1PGSA 4NOTA 4YRDA 1LJ7A 1XB9A 2JX9A 3KS7A 1YYNA 5HCBA 3SCFA 3WW4A 3CIHA 1Z7S3 1W6OA 5LK5A 3WNLA 1HRI3 2A3YA 5EJZB 4FXGB 1A34A 2ES3A 1UX7A 1COV3 5I0UA 3ILFA 2GH8A 4COWA 1V9U3 3IAQA 2DV9A 4CVUA 2B45X 4OI0A 4XETA 5KXBA 5ERLA 3O14A 3R4SA 4XFAA 2D5HA 4OHZA 3U1XA 1C1FA 4LO5B 4QX2A 3AC0A 4Q1RA 5KHKA 3VD5A 1CPNA 2BYVE 2QBXA 4QKNA 4YNIA 2WNOA 3MIFA 5DAPA 4ZONA 1HB1A 2XB6C 3WQ1A 4XBQA 2J1VA 4GB31 3ZM8A 3TN93 4TLFA 4JV4A 3UV9A 3WNPA 2ZX2A 3MUZ1 5FLHA 4L2NA 4JVAA 2EAKA 2VOVA 1NCQA 3AYDA 4QPGA 2VW0A 5CFCC 2WO3A 1DU3D 1GP6A 4CPBA 1YIPA 4DUXA 1U5YA 1OOPB 2W95A 2J1AA 2OXBA 3GM8A 4PLOA 4DUWA 1TMF2 2JDZA 5LB6A 3P5BA 4CEWB 2AH2A 5C3SA 1AYM2 5TSWA 1WW4A 3V64A 2C9KA 1Y4WA 4K8FA 4MGSA 4YW2A 3VD7A 2XHNA 3VZKA 1H8TA 4PI0A 4Z2WA 3KCCA 4CEYB 3ZYJB 3AMMA 5FY1A 2ARXA 3TOJA 3Q8CA 3VDDA 1GKBA 3CKHA 3T2QA 5GLWA 2D98A 2PHRA 5IT6A 2WL1A 1UU5A 1LHVA 1W6NA 1AR61 2VQUA 1FV3A 1U5ZA 3GXUA 2XKOA 3FLTA 3DKWA 3RNSA 5FMOS 1AR82 1GMMA 4LOSA 1GUIA 2ARCA 2VGDA 3AKSA 3ATGA 4HKOA 3UK9A 1N3QA 4YARA 1QKQA 1IQDC 1H30A 1RUG3 3OEBA 1NAEA 3S57A 2CYFA 1QF3A 3DUIA 4KWJA 3VZLA 1W03A 4N43A 3P3NA 1APNA 5AVAA 2D6PA 2WKKA 3FE5A 3RI9A 1D0HA 2NYYA 4PDWA 4BQ4A 2HJIA 1XJAA 5DDJ1 1NE4A 4WBBA 3RWNA 3AM2A 2GNTA 4O9GA 1JU3A 1MPXA 4KI5M 1BQPA 1MZFA 4WZFA 3POGA 4MXWA 1JZ6A 4L99A 4K21A 3U37A 4F83A 5IK7A 1GWKA 3IN9A 3PUHA 4NMIA 1CWPA 5A70A 1VAKA 1W8HA 2V4AA 4AVTA 2C1FA 5GZFA 3WNXA 4AI8A 2PN5A 3WUDA 1RUC2 3ITQA 4RS5B 4Z1VA 1W99A 5IYYA 5LRSA 3WDVA 1Y7BA 2YXSA 2Z42A 5A3TA 2DBNA 2JG9A 3TYJA 3ZKUA 1A8MA 3VBFC 1XNBA 2G9ZA 1W3XA 4DEVA 4CDQC 5F7UA 3I4IA 3OUHA 4I09A 3T0DA 1FNZA 1POV1 4BQXA 1CONA 2PA7A 5FOJB 4K3UA 4XUTA 1QJX3 2JEMA 5IVBA 3LPGA 1OD3A 3I8TA 2AR6A 4BDVB 4LITA 1KGYA 5FZMA 3RZZA 1ENRA 3N9MA 3QBQA 4AI3A 4GWJA 2CWMA 1V6LA 4CDUB 1CQ9A 2P4EA 2VVDA 4NWVA 5FZCA 1PM4A 1ZBA2 2VZVA 4XVHA 3WP3A 2D43A 3ALQA 1HB2A 1UU6A 2G19A 2YFZA 1MQTB 1PO13 3AL5A 4XJZA 1L3JA 4Q4W3 4FP3A 5BNPC 3AZZA 1LU2A 4EWEA 3DV8A 4Z82A 1T2XA 2WZ8A 3WNNA 1WBLA 1R093 4CDWC 1K5MB 4Y1XA 1UZZA 4AHZA 2A3WA 5ACA2 4KNCA 1ZM1A 1RUH1 2JE7A 2XQRA 1EUTA 4CCLA 4W6WA 1BKZA 3M7AA 4YSFA 3FBYA 4QKDA 4DNYA 1S55A 1RUI2 2V5DA 3K51A 4UFHA 3I2IA 4BZ4A 3MPPG 2CNAA 5FBZA 3ZIWA 1AR91 4A41A 2CDPA 4TXWA 2Y38A 3IPVA 1BHGA 4NUBA 1LULA 5ABJA 4HANA 2YU1A 5FZ6A 4MG2A 1XU2A 2OQ7A 3ZXKA 1UF2C 4AQ6A 5FO7B 3T1LA 1OA3A 1Z7S1 1HRI1 4Q4V3 1C8M3 1N3OA 4LUMA 4C8DA 1CAXB 1GZ9A 1UKRA 3GCXA 3EJKA 1COV1 1RVF3 3T09A 3JD73 2PQQA 4LMFA 3SH5A 3RZLA 1XOYA 3CNAA 3EQEA 5F8PA 2G4IA 2FDKA 3VL8A 1WD4A 3MFAA 4CCNA 5HBAA 1RUC1 5B4NA 1U0AA 1QOSA 4WM8C 1EPWA 4NHYA 3SKVA 2ZGQA 1EV12 3APBA 5DG1A 3VBUB 4AI0A 2ID4A 1R1ZA 1ULPA 1FOD2 1LTEA 1UYPA 1XU1A 4IQPA 2EXJA 2XL7A 3GBWA 4N53A 1XE0A 2RDNA 4YW3A 5FR3A 1DQ2A 2VNOA 1UWWA 4P9GA 4IE7A 5DMYA 2C6SA 1W04A 1O3TA 1HB4A 2L9LA 2VUAA 5BV6A 2W1QA 2O8OA 4GMP0 3TRSB 4IV1B 3ZOIA 4D7YA 2AUYA 3D6EA 4ZZ8A 4NE9A 3EHKA 2W91A 4AFBA 5FO9B 1ULGA 2O14A 5GKAC 4UFMA 2FQPA 3ZX7A 3WG1A 2W08A 1S0CA 2RG4A 2XGXA 1JH5A 2XVGA 4CDXB 3RZHA 2GP5A 1WW5A 4XF9A 4E27A 1GQGA 3VHNA 4H3WA 3WEZA 1ZBA1 4L9BA 4QX8A 4TLGA 4YM0A 1C4RA 2VZOA 4D0QA 1O5UA 2ZX1A 4LHNA 1Y9MA 1W9FA 4NIGA 4BB3A 1OVSA 3NJYA 3HBKA 1HJGA 2ERFA 3KT7A 3NAPB 4Q1PA 3ORJA 2UWCA 4R9BA 4YW6A 1JZ3A 4V2WA 4Q27A 1WBFA 2BEOA 4B7KA 1B09A 2QQOA 5APAA 4EYUA 5L19A 4O61A 4IE6A 4XFIA 2HWF3 5FY9A 4NPRA 2BNNA 1QDOA 2EXKA 3VD9A 4A6OA 1HB3A 1YCIA 3N9LA 4QDSA 5FZBA 2ADEA 4TZDA 4QX7A 1A6CA 1MVEA 1PMIA 1RUG1 3JU9A 1JHJA 4Z07A 5B2GB 1XNTA 1J59A 3WX5A 1IOAA 3A7QA 4DZGA 3OOXA 2QQNA 1GWLA 1QNWA 1YUDA 1JI6A 2BV4A 3OGJA 1OHFA 1V0AA 4JRLA 5A33A 2ZGSA 3VDDB 3OTFA 4ZKTB 1ZNPA 1MS0A 1D4M3 4BK5A 2O8QA 2VZ1A 5JZGC 4H2AA 5FZAA 1GV9A 1LOGA 1W2UA 4XJUA 1LOBA 2XJSA 3LCPA 1UN1A 2WR9A 5H9QA 3RI8A 1B35B 2DVBA 4GKYA 1WCUA 5FP7A 3ZYPA 5BY5A 4E4ZA 1GNHA 4X8NA 2LRPA 2CAVA 1XNAA 2OT7A 2QJVA 3BYWA 4HETA 4IEWA 5BNOC 1QQP2 1ZZBA 3KHBA 3U75A 3AFKA 4NIIA 2FDIA 3WDUA 3HNYM 3ACGA 4EN6B 4Y22A 5ISLA 3VBRA 3WUCA 4XMIA 3M3EA 4NIAA 4DFSA 2CGPA 4ZY9A 2A70A 4N43B 2XLFA 3P1IA 4B1MA 2J42A 3CZJA 3KMHA 5CFDA 3W5NA 2JKXA 2RS13 3K75B 5DUXA 3LOBA 4IGOA 4Q8KA 1UY3A 1BBT3 2PAEA 4A2UA 1GFF2 1QJX1 3I2GA 4MGYE 1XRUA 4XUNA 5FLIA 1CAWB 1TVGA 2VW2A 4JQRA 4OI2A 3RYPA 1U5IA 1GICA 1H9PA 1TQ5A 2WS92 1SFPA 2K9ZA 2DU0A 4AWDA 3PU3A 3A23A 3SHRA 3QH6A 1PZ9A 4NHXA 1DLLA 1GYKA 3K77A 4XACA 5LZ6A 1MQTC 1ZYBA 3S30A 5JSRA 2ZABA 3GZAA 3QACA 3NWKA 5G05L 2ZHLA 3ETQA 2AACA 3VBHC 5JPMB 1P8JA 3VUOA 4LEJA 3MFCA 1CESA 3VKLA 2GH2A 1PO11 4QXBA 1ULEA 5KC6A 2Y6JA 3OYWB 2XJTA 1FMD2 1Q3EA 2WLQA 1OF3A 4LLFA 3ZN4A 3FUQA 2W94A 3BOWA 2XLGA 4LBQB 3CZUA 3NV4A 4YGCA 5CFCA 2XKPA 1JW6A 4FO9A 4HSLA 4IEUA 1R091 1OBNA 5FYYA 1WLWA 3VB9A 5JAXA 4IW3A 2ZGLA 3CQOA 1RB8G 4YZ5A 2D93A 3PHMA 2R042 2VC9A 5K0UC 1URXA 4HFSA 3OBRA 4DOUA 1Q8SA 5JWPA 1XC6A 5KXEA 2WWJA 3S0MA 3NV2A 3JBG2 2EIGA 1MS4A 3VZOA 3KLSA 4CXXA 5J3UA 3D8CA 4G4FA 2WAOA 1O59A 3IAPA 4P14A 3E5UA 5CU1A 3LKJA 2DBIA 4XPVA 1H9WA 2WSUA 1PM7A 2C24A 1EP0A 2VW1A 4Q4V1 1LU1A 4YM1A 4OLLA 1I1EA 3H7JA 3RGBA 4U2AA 3U10A 1RVF1 1NE6A 1WMDA 1C5HA 1H4GA 4Y5SA 1NYWA 3ZYGA 2W2IA 1AJOA 4E4DX 1AR73 2WFF3 1QQP1 1CX1A 1HJFA 1J83A 2CY6A 1DYPA 2ZS6B 4NJ4A 4I0BA 2Y6GA 4YPJA 4WV8A 2HWB3 1Q8PA 1JYWA 3POEA 3VDCA 4H14A 3V0BB 1CZSA 2XUEA 4IV1C 1NA1B 3IPVB 3WP6A 5A7SA 1X8EA 5EHDA 5ABJB 4AVSA 4JDMA 3ZXJA 2R0HA 2BNMA 3MBWA 1MS1A 1AXKA 3KV9A 4AEDA 3TEWA 1IS3A 3RQ0A 3AL6A 1F4AA 2ZXQA 3O0WA 5T5LA 5A3LA 5LEJA 1X7NA 1SCSA 4C90A 4FPYA 3THTA 2YC0A 5BPXA 2ZKNA 5BUVA 5C4WB 4BM8A 4DO0A 2B4KA 4UFIA 1GR3A 3HWJA 4GH4A 4FPFA 4FFFA 3ST7A 4WM7C 5FUIA 4PQ9A 5F2WA 2E26A 2IWGB 2D97A 2VNVA 3NKGA 4KL1A 4QU1A 1K12A 2XJVA 4UW3A 3GZTB 5HV4A 2HEVF 1WA4A 3ILRA 4Z8BA 4CDQA 2QCSB 1IHMA 4AZZA 1TME2 4FPEA 2YPJA 3OPWA 4Q4Y2 3ASIA 3MO4A 4CPBD 4DY5A 1TG7A 1R1A1 3P3PA 3BU7A 1HQLA 2J1TA 2MEV3 4IETA 1UZYA 2FCVA 2ZHNA 2HWF1 4XE9A 4AGGA 1VBD1 3H7YA 2GN7A 1NLSA 4FPLA 5AC92 5JOXA 1OPMA 3THPA 1UO9A 2Z4FA 2VH9A 1W05A 4GULA 2R041 1US3A 5FP3A 3MGUA 5SV8A 1FAYA 4S2DA 5DUUA 1RUJ3 3PJYA 1WMXA 2IXHA 2YUEA 2RR12 3B5LB 1OKOA 2JB8A 2PQSA 2QTWB 3J9SA 3JBG1 5FZGA 4XABA 5H9SA 3GYDA 2DCKA 3LDKA 5CKNA 3PIJA 1D4M1 1NT0A 1WCDJ 1L7QA 4DXZA 1GQPA 1WW7A 2BBAA 1KFUL 4Y20B 5BNPA 1VBE3 5JOYA 3LA7A 3ZSMA 3KQ4B 5F2SA 2YU2A 4AVVA 3MLKA 1YQ2A 2X5IC 3FN9A 5GZCA 1RITA 4Z92B 2JJ6A 1LHUA 2C9AA 3GGLA 1SLLA 1DFQA 1TNRA 3OGRA 4DIQA 4O7XA 4AVBA 3JUUA 5FPBA 4CTEA 3POWA 1I3HA 3U0ZA 1WCSA 4CCDA 1AYN3 1OMIA 3C8XA 1ND3A 1NZIA 3UT0A 4QWNA 3DPRB 2LM3A 1DGRN 2IXCA 1G86A 3RZJA 2E63A 3PMSA 3HBZA 2DFBA 1G9BA 2WYFA 4BMBA 5FY7A 4O9EA 4ZU4A 1IS4A 4IV3C 5T3NA 1S0GA 1W8NA 2F6BA 4Y24A 1RUF3 1UD1A 4XUOA 2ZACA 1SLAA 3ELNA 1HV0A 3KM5A 1PGW2 3PUQA 4FPHA 3LAGA 2PHWA 3VHOA 3E6CC 1QXRA 2BTVC 4K1ZA 4BLIA 4AHYA 4EN0A 4QKFA 2BVBA 3DYOA 4P5HA 2VE1A 2Q8DA 3VBRB 3ZSEA 1AL21 1VBC3 2W87A 2R072 2ZGPA 1YO8A 4WM8A 2RVAA 3SISA 2YC2A 2B7YA 4LQRA 5I0SA 5LBEA 1PO22 1RYYA 4UF0A 4IE0A 1H1MA 5EPAA 4OQ9A 3VV1A 3O7OA 5IVFA 2D6MA 3ROUA 5JSPA 3O1SA 1AZDA 4KWKA 4NRMA 1TME1 4CEWA 2V5YA 2DYCA 3CL1A 3CJXA 1FT9A 1H6YA 2WRAA 3IM0A 2UURA 2VQAA 3QCWA 4EQVA 5AC91 2WDBA 3PVEA 4UBHA 1JBCA 2O0OA 5FY8A 5HV0A 4AYUA 4Q5OA 1UY2A 2XBO2 1OFNA 4CEYA 4GB33 5IHRA 3WCSA 3KF5A 5EWSA 4AEJA 4I01A 3DF0A 2YGLA 1IS5A 2RDQA 2XOMA 2ZHKA 5D8AC 2QE3A 4NIHA 4OMCA 1T6BX 1NQJA 4J1WA 3RMXA 2AEZA 3SMHA 1C5IA 3PVNA 1V6JA 2Q1MA 1BMV2 2PFWA 1TNFA 2VAUA 4FT8A 1RJ8A 2PHLA 1H0BA 4I0WB 4KU7A 4LBMA 4V1PA 5CFCB 1O5LA 5FZEA 3B94A 1JTZX 4BWOA 2AYHA 3B9CA 4XCBA 5I8SA 1OURA 1AR71 2TEPA 2WFF1 4RFRB 5A3NA 5T5JA 3IB3A 3C7GA 2HWB1 2OIIA 2D44A 4JDNA 5C7GA 5FDBA 2WZR3 3AFGA 3OUJA 4Q4X2 5K8SA 2GNMA 2ZAAA 2KM2A 4OZOA 1WWYA 3GHMA 1AR63 1H2LA 2CWSA 2N7GA 3POFA 2ZX0A 4GKXA 1VAMA 1RUD2 2D6KA 5T52A 1FPN2 2OYZA 4CCMA 5JZGA 1PGL2 1EAH2 4K9SA 1UMHA 2ZGKA 1O4ZA 2VBBA 4Q0UA 4RS5A 5A3PA 1JODA 5C4WC 1PIV3 5KXDA 2BERA 5E88A 4MGIE 1KITA 1HLCA 2V72A 2VQTA 1BEV1 5A7NA 5BNOA 4QB2A 1RHI2 2RM22 3OG2A 4PIYA 1RMU2 1XYPA 3H1WA 2QQWA 4QX1A 5DDJ3 4ARYA 4NO4A 3U07A 1SZBA 2ZPXA 1UX6A 1SACA 4LOTA 4B4QA 1F2NA 3JB8A 1DGRA 3ZFFC 3MW3A 1SEFA 3WF1A 5LCWL 2XWJB 1LOEA 1PNFA 1UKGA 4M0HA 1OPOA 4M4RA 1WCKA 5FZ7A 1YNAA 3HD8B 2YROA 1JYVA 3Q9OA 2O1QA 1QIQA 1XE7A 1YWKA 2BJSA 3IDEA 4OFGA 3LFMA 2MEV1 3T30A 1ULOA 4CDUA 2XVKA 1ZREA 3POBA 2Q8CA 1HN1A 1Q5OA 5BNQA 1ZRCA 2P6CA 4ZZ5A 3R4DB 3UKTA 1DYKA 3T0BA 2XL9A 1W3VA 1QGLA 3H8OA 5F5IA 4XAEA 3IDCB 2A6VA 3K2OA 5DAWA 1MQTA 5E8AA 4URTA 4FPKA 1I6XA 2A5ZA 2PHDA 3MIEA 3RJRA 1G9CA 1W0PA 2JWPA 3VBFB 3CU7A 3MIHA 3NNGA 2X05A 5FKBA 2W3JA 3AP5A 3P6BA 1REFA 3RZMA 2RS52 4UW5A 4AFMA 2FDGA 3N7MA 3IIAA 4IEPA 1D0GA 5FYIA 2HLEA 1VBE1 1TMF3 3IMNA 2Y64A 2EA7A 3DEMA 3L2HA 3M3CA 4KQ7A 2GNDA 5JSOA 3LFIA 2CV6A 2OVUA 1CJDA 2RJ2A 5LWBA 4RR3C 4CXWA 1ZRDA 1HQWA 3W9AA 4NHMA 2IFRA 1MVQA 1C57A 1GOHA 1OSGA 3J8F1 2AZ5A 2GC3A 5BYNA 3MUY1 4DEQA 4FPCA 1ZA4A 2DCYA 3RMYA 4LKSA 3ZN6B 2BGPA 4LK7A 2DDUA 1S2BA 1YRZA 4E4SA 1A3KA 2E53A 2DU1A 5IK8A 5GJ6A 5BNPB 3BOPA 1VBB2 3BB6A 1UPIA 5FYBA 5A7QA 1GLHA 2W52A 2X53S 1AR83 2UU8A 2RDSA 2ZMLA 5LA0A 2YDEA 2UYAA 4CDWB 3WVJA 5C33A 1RL3A 4QQOA 5FRAA 2RS32 1MR5A 4LPLA 4XDOA 3VBUA 2P3KA 2AC1A 2VCMA 2JDKA 2HBUA 2VCCA 4KBZA 3Q8FA 5FV3A 1VBC1 1RHI1 5L7OC 3A4UA 5A7WA 3EMRA 4XW3A 1LRHA 4XMAA 1OQ1A 4HN0A 1FNYA 4HONA 4YZ1A 3GNEA 5FMCA 4IEOA 1EUUA 4IV1A 4EN9B 1FYUA 5JMOA 1EYBA 4A6SA 2CHHA 3MIBA 4CDXA 4D7SA 5LY1A 2FMDA 2VY0A 4Y4RA 2JDYA 1YI9A 2GC0A 1RUC3 5BNNC 1WKYA 1Y43B 3BI3A 4GWNA 4Y5Z0 2Y34A 3NJXA 5C3QA 3FJSA 3ZFGC 2E7AA 2WLPA 1OA2A 4IDZA 1RUE1 3NAPA 4WM8B 4XF0A 3VKMA 1ODMA 3WDYA 4MXVA 2BU9A 1J3RA 1V6KA 3R6SA 3AP6A 5IVCA 4UF0B 1LGNA 3EBRA 4LUKA 2VVEA 2ET7A 1UOJA 3KSCA 3CMGA 4B8EA 3K4AA 1YQ6A 1ODNA 1OQEA 4COUA 1H2KA 1O3RA 4JAAA 5T54A 1O4YA 3A0NA 2H6BA 1LGCA 4L97A 4Y26A 4YG0A 5JIAA 4AE2A 2BWAA 5IATA 4U36A 1ZBA3 4W65A 1GP4A 1SDDB 4QPIC 2DCZA 3DYMA 1OT5A 5FZOA 1EY2A 4WVVA 5LA9A 2WWUA 4AAXA 2ZBJA 3ES1A 1JOPA 2A75A 2GU9A 4LT5A 2WZR1 2CL2A 2GSYA 3I2HA 5FMDA 1W9TA 3HOBA 1W6MA 3U78A 2UWAA 4RSUA 4S2GA 4AAPA 1B35A 1LECA 1DLCA 4UFJA 2JD9A 4BU2A 3B01A 2XLAA 3K48A 4JTNA 5FYVA 5JDBA 2VZ3A 4YZ3A 3ZDVA 1PIV1 3O0VA 1W2AX 1G9AA 4R9DA 1ZBE2 1HXS2 3N35A 2SLIA 4WVZA 2RS31 2R16A 1MS3A 3O1PA 3FHAA 3B3QE 4P02B 4QX3A 3AMNA 1Q56A 2VXJA 3AMQA 2J1EA 1RGSA 1RUOA 3TEXA 2ORXA 1KD7A 2ZX3A 2BBVA 2B42B 5C8CB 1HIXA 1CAWA 4E2QA 5IVJA 1LOCA 1VMJA 4HXCA 5JZGB 1OFSA 5J48A 1KDKA 4Q0QA 4YZ2A 2JDAA 2QQPA 4XJAA 4HVRA 2R1DA 1OVPA 3OCPA 2QDNA 4BK4A 4CA9A 3WF4A 5JOWA 4YVSC 5BNOB 1NLQA 4OUMA 5FLJA 1L7RA 2VMDA 2P3JA 3FMGA 5LBFA 4FOQA 1MS9A 1EV13 4ZS3A 1I5ZA 2FBEA 2VZSA 2CTVA 4NAOA 3R0RA 4DINB 3MV01 2XXZA 1FOD3 5DAXA 3OYWA 1DQ6A 3UETA 3WG4A 5C3RA 3LEGA 4HK9A 3WCRA 1XPWA 3EYPA 5JI9A 3W5MA 1NCRC 4LBQA 1PX4A 4LBJA 2ZGUA 4XOGA 1W28A 1YFXA 2NMOA 3WR0A 1TMF1 4H7MA 5IJRA 1OA4A 3LQCA 3SKJE 1HKDA 4E4HA 1ZRFA 3E97A 2JDPA 5AVPA 5IVYA 4C91A 1AYM1 4ZU7A 3W58A 1HX6A 1OLQA 2ENRA 1ZZ7A 4CU9A 4L0PA 3TN92 2EALA 1S0FA 4YFZA 3LA3A 3NL1A 3IBMA 4OULA 3WW3A 2QQUA 3GJAA 5I0TA 3TBDA 1A8DA 5FUPA 3NJZA 4W50A 4XBLA 4NRPA 2G9GA 3VBHB 2EIEA 3OJBA 5C3OA 2VECA 2DWRA 4BHPA 2YFUA 4BXSV 2ZTNA 2P5BA 3FL7A 3IWZA 2YC4A 3S5AA 2JE9A 1AR81 4CUGA 1CZTA 3IT8A 2I2SA 1X9PA 2Q30A 2IUWA 2Y6LA 3VN4A 3LSDA 4ORFA 5FKCA 3BKZA 2LALA 1ZBE1 2R6QA 1FV2A 3V0BA 4X8PA 1QDCA 4LNVA 3ZYIB 5K0UB 3J7LA 1GOGA 1NA1A 4CCEA 3WINE 2VJXA 3OD4A 3G6JB 5DZFA 2OPWA 2X09A 2R062 5I8TA 4D6RA 4AXOA 4LHLA 2DVGA 1PZ7A 5CKQA 2A6YA 4LJHA 4UBGA 3HN3A 1JUIA 4B4PA 1LGBA 1H2NA 4AQ2A 3AMHA 3KB5A 5H9PA 1YJLA 2W1WA 1WZXA 4B29A 5FYHA 4BYYA 1QQP3 3A21A 3ON7A 1DQ5A 1E5RA 4XTMA 1WD3A 1O6UA 1SLCA 4RL7A 5C4WA 5I8YA 1UU4A 2BOIA 3MYXA 3B9IA 5HCAA 1BVVA 4N9IA 2WN2A 2OS2A 4GIQA 5JR7B 4EZHA 1UOBA 4ZPIA 1L7LA 3W20A 4Y1YA 3UJQA 3HNMA 3ZXDA 2HWC2 1UQXA 3BPZA 4ZS2A 3NQHA 5T5PA 3AZXA 4YM2A 4XYXA 3H0OA 4CXYA 4OHWA 1SFNA 4M01A 2RHPA 2WS93 2Q5TA 1RJ7A 1ENQA 1U5XA 1MEC2 2GMEA 3TAYA 3NW4A 4AHXA 1VRH2 2AEYA 2Y8KA 3JZVA 3HNBM 4DUVA 2VM9A 1N47A 3G7DA 1NZCA 1WLTA 3UNPA 2JXAA 2YBSA 3I3BA 4FFHA 2QZ2A 2VTXJ 4LULA 4AVCA 3AB0A 2VZQA 4QHBA 2PTMA 5EIYB 2PHXA 1S0IA 2NM1A 2EIDA 4YVWC 3S5QA 1QJU2 4MGKE 3MIDA 1QJY2 4RQPC 1QOTA 3GZEA 5L9VA 4JZRA 5C9AC 4WM7B 1FMD3 2R32A 4Y20A 1SCRA 2F4PA 3AP9A 3SLIA 5FK7A 1W90A 1S1AA 4J25A 1LKNA 1ENXA 1R1A3 3CF6E 5DUVA 5IAXA 4CUCA 2F17A 1VBD3 3UGFA 5ACA1 4AG4A 1VJ2A 3KT4A 5FWEA 5DN2A 1FX5A 1R082 2PHUA 2R043 5JXGA 4TTGA 3DPRA 2IZWA 2Z69A 3BGAA 1DHKB 1DGWA 1RUI1 1XNKA 3JBG3 4Q4W2 5FZOB 2VZTA 5KHHA 4BIFA 3VKOA 4DMIA 2PYTA 4IERA 3ZYFA 5A3UA 4NN0A 2QFEA 4P9WA 3L2YA 5JXJA 4XDPA 5LK7B 1ZZ8A 3IZOA 1W6QB 5F9TA 2KD7A 4IGQA 1W6MB 1O4TA 5I93A 2P1BA 2J7MA 1AX1A 3LD8A 3OSDA 3OGVA 1CAVB 4OCTA 3AKTA 1W06A 3ILNA 4A7KA 2QQKA 5FP9A 2GP3A 1W8WA 1JS9A 1LNSA 4C0HA 5IVEA 4YG3A 4NAMA 5GZDA 1PK6C 2OKXA 4LKEA 1C1LA 2X5IB 2HEYF 2MHFA 2E9QA 1CN1A 1S0JA 3GBGA 2B39A 1XYOA 1EV11 4GJZA 2CGOA 1J3QA 3MICA 3NSTA 1NXD1 4QM9A 4E8CA 1FOD1 2JENA 2YGMA 4MX3A 3T2TA 1C8M2 1JUHA 4JGYC 5ANQA 5FCCA 1UIKA 4AI9A 4RYDA 3LGRA 1W9YA 4YW4A 4PHZA 3I3QA 2LTNA 4N9HA 2E51A 4QPYA 4IV3B 1REEA 1VALA 4QQHA 1F5JA 3VDAA 4RGAA 1POV0 1HRV2 1TZOA 2PLV2 2XG3A 3N36A 5FZDA 3E6DA 1QJEA 1BVP1 3D0JA 2V73A 1UYXA 2WYSA 1AL23 4D6QA 2PAMA 5BNNA 2DURA 2WQ8A 2IXJA 2VUDA 3AZYA 1OI6A 3MF9A 3TB0A 2BRTA 3U4SA 1BK1A 2CAUA 1CD3G 2VVFA 4BE3A 4XBNA 1JN2P 5A32B 1TME3 5J1XA 4Q4Y3 1OD5A 4B1LA 3WDXA 5FZ9A 3O1VA 1KFXL 2WT0A 3CLPA 5DABA 3I3MA 3T0AA 1ALYA 2W9XA 3LB9A 5AC93 4LO6B 3TEYA 4NROA 5JLVA 5FMOL 2P6HA 5DUWA 4ARXA 2Q4SA 5E6HA 3I2FA 2BVVA 4ZXEA 3J26N 1V70A 1VBA2 5JOZA 2VOKA 4CZSA 2RR13 3HQRA 3MF6A 4K7JA 4GD4A 1W9WA 2B46X 3THCA 2EXHA 2GMMA 2BWCA 4K40A 4LBOA 3ME2A 3MV11 4DRRA 2W5FA 3NV1A 3N9PA 4TSVA 3VBSC 5D8AB 4A42A 5FY0A 2NN8A 3RS6A 5IK4A 4RGKA 4PJYA 1U12A 4C0BA 4MHUA 2YG0A 2X10A 1W39A 1Z78A 5GALA 3RDIA 2VMHA 2EXIA 4RD7A 1EPZA 1O7FA 2VOXA 4MV2A 5F6KA 1DYOA 3AYAA 2RMU2 5A6ZA 1UYYA 3WNMA 3UKVA 5KR7A 3N9QA 4FPJA 3KD4A 1X82A 5I0RA 3KGLA 4EWAA 2G1MA 2JG8C 1W0OA 1KS4A 2WN3A 5FUNA 3PU8A 1M06G 3MIGA 3R4UA 1G6NA 4LA3A 2VD7A 2VBPA 2XMLA 2EVXA 4GQ7A 3VZNA 2HH9A 4YGEA 5FZ8A 4FTBA 4CRQA 3MW2A 1Q43A 5CVRA 1QH7A 3ABZA 1OLRA 1O8PA 2WFPA 4HG6B 1GQHA 4Q0PA 1O91A 2BNOA 2EIBA 4FI9A 3N7LA 2WS91 5FZFA 4F3JA 5FZ3A 1BEV3 1W2NA 4M3CE 3WHTA 4XF3A 2PLV1 2WWSA 4AFDA 4FFIA 1AJKA 5L9RA 2E7QA 5A1AA 5GLZA 1GNYA 3ACHA 5DZEA 3T4VA 4YVSA 2R073 1OLME 4QKBA 4HN1A 2RS12 3KHCA 3LDBA 3URFA 3VBFA 1C28A 3N7KA 3O5SA 1BBT2 4PBPA 5F3CA 2OZ6A 1PO23 3KWVA 3DECA 4W8JA 1FMD1 1UY0A 1YHFA 2A73B 3FBMA 4NPLA 3ZSJA 1GSLA 3ZYHA 1IPSA 3ZFFB 5L36A 1NCRA 1NY72 3K3OA 2FDJA 5IK5A 3T3YA 1GZTA 3H3LA 3I59A 4XTPA 2HWD2 3ZVXA 1SFYA 2ZHMA 2J1RA 4PCRA 2D3PA 1H8VA 4P00B 5FZ4A 4QPGC 1LOFC 1NCQC 2DUOA 5LATA 3FWEA 1X36A 4I02A 4LLOA 5FYSA 5CB7A 1BLZA 3PLQA 5HXMA 4XILA 3ZDSA 5GLTA 3ZN6A 1ND2C 4GXLA 2HWE2 2DCJA 1QXJA 5FFOC 5GLVA 2EICA 2I74A 1X50A 3I2JA 5C3PA 4CDWA 1H8TC 4Z2AA 1Y9GA 4TN7A 4CYDA 5SV5A 2BZDA 4QB1A 4CP2A 4LK6A 4COYA 2W1UA 1Y9QA 2KXLA 4CU6A 2XONA 1PHMA 3J8F3 1QHDA 4BQWA 2W1SA 4G3YC 4K6BA 4RR3B 4X6RB 4D8MA 2FCTA 4EROA 5F37A 1DBNA 1W6PB 1VRBA 3C7FA 4Q4X3 2WSVA 5A80A 4A7ZA 2Q8EA 1S0DA 4S2FA 2ZGTA 4LR4A 1MZEA 5IAVA 4IESA 2OZJA 3RG0A 1BXHA 1X33A 2HEWF 1FPN3 1GANA 1UXXX 1EAH3 1NXMA 1WMFA 3DXTA 1PVC2 5A1LA 1W0NA 1K3IA 4H55A 1AVBA 2LROA 4OHYA 4ISQA 1SBEA 3OUIA 4QX0A 4OUEA 2F4LA 1RHI3 2LUWA 2Q0AA 4JGZC 2D5FA 5EQUA 3HAGA 2ZEWA 1RMU3 4M0NA 1FI2A 4E2SA 4QQPA 2HYXA 1CAUA 5L7OB 1AL0G 1Y3TA 3H50A 5CA6A 4AF9A 2SBAA 3MEPA 2VL4A 2WIIB 4RGGA 4LHKA 3KGZA 1IS6A 1DQ0A 3ENRA 4LBQD 4Q4Y1 4SLIA 5E1RA 5GZEA 1D2QA 1F9KA 2ARAA 3LWCA 4N7UA 3EB7A 2PMWB 4P08A 3V56A 2E32A 3POJA 4ISRA 4JKLA 1V6IA 3JQXA 2GZWA 2HWD1 1TEIA 4JRAA 4QPWA 4MYEA 2TBVA 1ULDA 2D6NA 3N9NA 1ZX5A 1N1VA 5BNNB 3ES4A 1RUE3 1DF0A 1Q8VA 3HIFA 5KBFA 3D3AA 2RR11 1KRIA 3ZFGB 1ZZ6A 4GZ9A 1PZ8A 4META 1HQNA 4WZCA 2K0GA 4YVWA 4RA0A 4XFFA 3ZFEC 4COZA 3ACFA 3BTAA 4RQPA 5FZ1A 4C1WA 4CCOA 2RS53 2HBTA 5C9AA 4NPMA 4MSVA 2GN3A 3H9AA 3E5XA 2UY8A 4XJ8A 1WCQA 2WINB 3GZUC 4GMP3 2YHJA 1DZRA 2QQIA 2NQYA 1RUJ2 3CDZB 5G04L 2Y33A 1CPMA 1SDWA 3AYCA 3RYRA 3AMPA 4ONUA 2P34A 2Q1FA 2TNFA 3DN7A 4MO3M 4HL0A 4QPIB 4CE8A 3KV5A 5CNAA 3WHUA 1JOJA 2WZEA 3OEAA 1SLTA 5C8CA 5DZGA 4XC9A 1WUVA 4MVTA 3C2UA 2AENA 4CU8A 4A44A 4JC1A 4QDQA 5K4LA 1QNYA 2BGCA 4YGBA 2FMYA 3UGHA 4A3XA 5LBBA 2H6CA 1PGW1 4PIXA 1V00A 1S0BA 5KWRA 2WO1A 1ASJ2 2ZGRA 4KH9A 3E5QA 3ZO0B 2RS33 5IUQA 1G8WA 2Y0IA 1PK6A 4TYSA 4ASKA 2WNUC 3ZKYA 2R071 2A3XA 3AP4A 3CO2A 4QU2A 4I30A 5FZLA 4M3CB 5H9RA 4CP1A 1W8OA 3C7HA 2VG9A 2DUPA 2BFUS 3ZMNA 1PO21 1IZ3A 2D7FA 4RHV2 4JGYA 4FAHA 1X8MA 4MLOA 1OXCA 4PBOA 3GDBA 5FPLA 5J96B 2BP6A 3Q8BA 3QH7A 4ATFA 4CUAA 2CSGA 3VBOC 4YW5A 1BYHA 3L9JT 4XZPA 1WW6A 4N53C 4LTAA 2BGOA 3ACLA 3HMYA 4NR1A 3SITA 2XBO1 4A4AA 1QOOA 4QGMA 4QHOA 1LHOA 3WF2A 4YVSB 5EV7A 2YBPA 3EXUA 3PTRB 3VBHA 3WP4A 5CISA 3SH3A 1IKPA 3ECQA 1NQDA 1SHWB 3OB8A 5JPNB 5FXWA 3C3VA 3O0XA 2GC2A 3WSOA 1MZ6A 3FHQA 2JECA 1BMV1 5FXZA 3M8LA 2WNVB 1NCRB 2VZPA 5EJ1B 4JHTA 2FD8A 1AYM3 5JVVA 5L73A 4XQWA 4BPZA 3I59B 3DCQA 4JHZA 1J1LA 4A45A 4KMQA 3JCIA 4ITCA 3CJIB 2IC1A 3MI8A 4YZ4A 1OC1A 3RYKA 3H8XA 5K0UA 3WNKA 3HQUA 3RWKX 3O1TA 3F95A 3INAA 3M3QA 1YFUA 5EYYA 4CCJA 4Q4X1 1LR5A 3PIGA 2NMNA 4E8DA 1SG3A 1XSRA 2DTWA 4X6QB 4Y3OA 2RJKA 5T50A 1RUD1 2FDFA 3RZKA 1FPN1 5EP9A 2X8KA 3MHZA 3VBSA 5FJKA 1PGL1 1EAH1 2VMEA 3K46A 3R05A 1KDMA 2JDMA 2OUJA 2QKDA 4XXPA 3RRDA 3ZN5A 5M0TA 4YW1A 4I3PA 1LHNA 2ZA9A 3MLLA 2VOWA 3K4DA 1ZBE3 1HXS3 1ZVFA 3IMMA 3PTYA 3OY8B 2VZRA 3PVBB 4AI1A 1ULCA 2RM21 4IEYA 3WG3A 4FCAA 3VKFC 1RMU1 1SMVA 1AR62 1YI7A 4FPOB 1ZZ9A 2FHRA 4WVMA 4P9YA 4V2VA 4A7YA 2KR2A 1BCXA 3GALA 3TEZA 4M4PA 4GWIA 1S2KA 5D2AA 5FP4A 3ZXLA 4CP9A 4I2OA 2FZ1A 2ZZQA 4LO7A 3AZWA 3O1MA 5GM0A 4XCAA 3I3DA 1OUXA 4KGQA 5LBCA 4JCKA 1CJPA 3LOIA 3OPZA 3OGSA 2YB7A 5FBJA 4AR2A 3B93A 2FZ2A 4LKDA 5DDJ2 3TNPB 5KHIA 3HPNA 4AEMA 2Y6FA 4KWUA 2YYOA 2ZKLA 4QQLA 1D7PM 4WM7A 3AX4A 1CAUB 2QDRA 2VCAA 4N8MA 5FZ0A 3NNFA 1N1SA 2V09A 1MZ5A 1UCXA 3AJYA 3NMBA 1VIWB 3PUAA 2RS51 4HKWA 4LIUA 2A1XA 5JXHA 4PI2A 3M1HA 1UZVA 3VL9A 4F7ZA 5LW9A 5C71A 4BQ3A 3O1RA 4BLJA 1V6OA 3U11A 1LODA 2VPVA 4GMP1 4R9AA 3H42B 5FPZA 3SQOA 1GZWB 2JD4A 3SEPA 2Y60A 2I07B 5LEKA 4IEVA 4Q26A 4PQQA 2BQPA 3USUB 1XBFA 3AVSA 3SEEA 1LOFA 4WVWA 1UZWA 5AFEA 5C6CA 3V0AB 2VUJA 1W6QA 2ZEYA 2VMFA 1X9TA 4KGGA 4YVWB 1DZQA 3MDPA 4B4RA 2BPA2 1OKQA 1ND2A 1CAVA 4Q2FA 4RQPB 3HJRA 5ANNA 3RPQA 1VR3A 2DVFA 2H0VA 5C9AB 5IFPA 3I2KA 3DGTA 3N3HA 1VBB1 4QAWA 5ACA3 3B00A 2K46A 2R49A 2X5IA 4R4ZA 5CIRA 1AX0A 3I7DA 4XAAA 1G9DA 2JICA 3BUCA 1RUI3 4QB6A 2PAKA 1G9FA 2XHKA 4NVPA 5K9YA 3BTZA 4GAZA 1VPHA 5FQ0B 3J7MA 4XQDA 4W6YA 5FJHA 3WW2A 4XEZA 2PHFA 1KJLA 5HI0A 2R063 4NRQA 3OGGA 1FXZA 1RUH2 4Q8LA 2WUHA 3PMEA 5A7WB 4A3ZA 1K5JA 4IV3A 3UYJA 4COVA 5J36A 1REDA 1CIYA 4Y5TA 3IDAA 3SCHA 1UPSA 5IW0A 3BODA 3GHNA 3NKTA 4HKLA 3O1UA 2QNKA 2XVLA 1E5IA 1AR92 2P2KA 4P9JA 5D21A 4UOJA 3I2DA 4OUSA 1PK6B 2WBKA 1N1YA 5F5AA 1Z7S2 4AEDC 1HRI2 4JGZA 4KBBA 3ZR5A 1K42A 2DF7A 2HWC3 1IG0A 4XFCA 4AQTA 4OHVA 1COV2 4L11A 2WNVC 1JOBA 3VHRA 1V9U2 2J1UA 2V4VA 2ZGMA 2ZGOA 4CCCA 1UMZA 3FFZA 5A32A 1O3QA 2P37A 3GF6A 2OUHA 4AK3A 5E89A 3ZIXA 4JGYB 2XH6A 1PX3A 2E33A 4DB5A 1WLCA 2Z2SB 3CJIC 3ZYBA 4TWTA 2D3SA 2R30A 3D82A 1MEC3 4GH4C 3SCGA 2Y6KA 1VRH3 5DAVA 3LZZA 4OI4A 2OA2A 4XIKA 3AKPA 5EZWA 5LY2A 1UZ0A 4CSWA 4MADA 1DG6A 4AOCA 5KHGA 4IUGA 4AI2A 3KZ4C 2NLRA 1F15A 1QJU3 3NNLA 5A6XA 1F8VA 1A78A 1QJY3 4HBNA 4YW7A 3KT1A 5JUVA 4HZFA 5D8AA 4AFAA 3WZ1A 3ZFEA 1RC6A 4L8QA 4NHKA 2J1SA 3BVCA 3OD0A 1H6XA 2FDHA 4ZU5A 1I5PA 1YFWA 2ARBA 2VULA 3J7HA 2JIGA 1SPPB 2GAUA 3LPFA 5FMBA 5EFUA 2ZAHA 2P3YA 4FBFA 5FZKA 3X29B 3LIHA 3A0KA 4ATEA 1G7YA 1R083 4YLZA 1XSQA 2LS6A 1SLBA 2GMPA 5KXCA 1GBGA 5CADA 3VD4A 1HXS1 3DKQA 4LBKA 3AKRA 3K4ZA 2RV9A 4YYOA 2IXLA 4UW6A 4OZXA 5FREA 1GWMA 4LIVA 1DGWX 3W59A 5C5TA 4QXKA 2IVIB 3KVAA 2BW8A 4FOVA 1WLDA 5FAXA 2B8MA 2ET1A 1IQAA 1IPJA 1DCSA 3WF0A 2GDFA 3DXUA 4IEQA 2NZ9A 2BFUL 2A6ZA 3OPTA 4UXAA 2DVAA 1ND3C 1RUG2 3VBSB 4JQTA 2WT1A 3ZXAC 1QMJA 4PT6A 4QMAA 2YZ4A 3MPBA 4MGQA 4RFT0 2AREA 3I54A 4YFWA 4DXTA 2W46A 4BQ1A
chains in the Genus database with same CATH topology
1YXWA 3WP5A 4AGRA 3B02A 1QY4A 4IXLA 4Y1ZA 2DTYA 2A7AA 1XXNA 2WQZC 4EWDA 3H8UA 3HQXA 2JG8B 3AYEA 2WNUA 2HYKA 4WVMB 4XDQA 4MZUA 1UIJA 2D6OX 5F6LB 4S2HA 1V9U1 1QU0A 2YY1A 3ZFFA 5J7MA 4KWLA 3QLQA 2UY9A 4HPKB 1QWRA 4AGVA 5KC5A 3TWIA 4F8AA 1HRV3 2PLV3 3FLPA 3H3ZA 3WXPA 4UW4A 3ZMOA 3VBOA 1AXYA 3B69A 3TN91 2H0BA 3D0SA 1OOPC 4LO4B 4ASLA 2EAAA 1AHSA 1QJX2 4CEWC 1W6OB 3POSA 4XFHA 3IKWA 4R9CA 4GALA 2MNGA 2R0FA 2XJPA 1VB4A 4KG8A 1LCLA 4CEYC 2W39A 1JXNA 4PIZA 5J09A 1BZWA 4EV0A 1C8NA 1J58A 1PO12 4IL7A 1XNCA 4RR3A 1VBA3 2NP0A 1W6PA 3QD6A 1SBFA 4QPGB 1NCQB 2KA3A 2R061 1R092 5LRRA 3ZPYA 2P3IA 1TE1B 1LESA 1ND2B 3ZSLA 3MZHA 3KCYA 2QZ3A 2D40A 3H1MA 3WLUA 3CEWA 3WV6A 2RMU3 1QJZA 4J6GA 2OPKA 4M3CF 3FC0A 1H8TB 1QH6A 3POYA 1O3SA 4ES9A 3PJQA 5JCTA 4XF1A 5L7OA 2B9UA 3WQ0A 4FTSA 2XJUA 2G9FA 4Q4V2 1VAVA 1W6NB 3WDTA 1VP6A 2HWC1 1NG0A 1RVF2 2Q1ZB 3JD72 4I3GA 4LA2A 4RS5C 1CIWA 4DQAA 2I45A 4B7EA 5CG9A 4BIOA 4P9LA 4XFBA 2A6XA 1AXZA 1MS5A 3JQWA 4Q29A 1MEC1 2PELA 4AEKA 1VRH1 4BMEA 1KXGA 2WT2A 5A3MA 1IPKA 1SLIA 4PDWB 3ZFGA 4QM8A 2W68A 3M4FA 1QJU1 4JGZB 4FOYA 4YG6A 1QJY1 2C0ZA 4Q0VA 4MXWB 4CDUC 1D4VB 2MPFA 3BIWE 4P9XA 5F5QA 5CAZA 3AK0A 3MW4A 4QD2A 2HKXA 5E16A 4E9KA 2HWD3 3WT3A 2JG9B 1R081 3VZJA 2UYBA 3OBTA 4Q4W1 4QPIA 3VLBB 1K5MC 2K2SA 4Y1VA 4BCUA 5FPXA 2HWE3 1DZTA 1PNGA 1R1A2 5HCFA 4D69A 5GZGA 1WMEA 2ATFA 3M2MA 2HWF2 3N4MA 1VBD2 1F31A 3ZFEB 1AX2A 4FAGA 5JIUA 4CP0A 2Y26A 4DY3A 2D6LX 4DS0A 4XIOA 4OI1A 1BJQA 3SXWA 1ZRRA 3AP7A 1D4M2 4M3CA 4LE3A 5FOBB 4LBLA 3RJ2X 1AUYA 4LBNA 3FZ3A 5HXVA 5EXOA 1H1IA 4FPGA 1C8M1 4H7LA 1CGPA 4M00A 3WY6A 5J98B 4QGLA 3JD71 2UWBA 2ZMKA 5J37A 3AJZA 1YJKA 2ETEA 4LO8A 3VBUC 4QX5A 3WW1A 4XJWA 1PVC3 1V6NA 2ZX4A 3EO6A 1ENSA 2TUNA 1HRV1 3SH4A 3VHPA 3V65A 4W6XA 3S6PA 4Y4YA 5FTTC 1IGOA 3PNAA 1E57A 1PVXA 5AFBA 1SQ4A 3KCXA 3VZMA 4K20A 4CDXC 1GNZA 1KS5A 2WNUB 4OHXA 4ZXKA 2D3RA 3LA2A 2WNVA 3S7EA 2PHTA 2E7TA 1UW8A 1YLLA 1AL22 4R4XA 1J1TA 4HVQA 3CJIA 3MLJA 3NAPC 3WD5A 2XBO3 3VBOB 4Q0SA 2XPJA 4FSJA 1V6MA 1VBA1 3NO8A 4N53B 1MS8A 4MUVA 5BXXA 4FQZA 2DCTA 1JYCA 2DUQA 2IFWA 2XJQA 3T1MA 5GLUA 2WNEA 4Y1UA 4MGZE 4KG0A 3D5OA 2VNRA 4R8HA 4D94A 3USSA 3VDDC 2RMU1 1ONAA 3OY8A 2IXIA 4HLTA 4NWWA 4DRVA 2YMZA 3M3IA 5I91A 4QGNA 1Q8OA 1B35C 1UL9A 3ZXEA 3ZXGA 3FHIB 3FFQA 5T5OA 4D3WA 4FOWA 1LEDA 2E6VA 3J4UH 2ZCWA 1QXPA 1RUD3 1RTVA 2XUMA 5D1IA 5F1RA 1AR72 2WFF2 4N43C 1JYIA 4XQ4A 2WC2A 1Q8QA 2YV8A 2HWB2 2C5DA 4PDWC 3VGIA 4ES8A 1ASJ3 1CR7A 2RM23 4BOWA 3NV3A 4AHWA 2A71A 4N7IA 3SNMA 5A33B 3ZSKA 1NLRA 2BUKA 2ZMNA 1CX4A 2RS11 3H3UA 4IEXA 2RE9A 3S7IA 1BBT1 2OW4A 1LHWA 4PLNA 1HV1A 4N90A 4RHV3 2ZJCA 1HDKA 3H1YA 2JG9C 1BEV2 2EF6A 1NY71 1WGPA 3NVCA 3FUOA 4XJ9A 4GA9A 1H4HA 1GZWA 2P17A 3KQRA 4OVEA 4Y22B 2Q8OA 4AQSA 4E2GA 5CG8A 1JHNA 1VB2A 3USUA 5JMCA 4HSJA 3V0AA 1IKQA 5CFDB 1UAIA 3LSEA 3HN1A 1OOPA 2IXKA 4AVAA 2Z5WA 2HWE1 1RINA 2VQ0A 3AXEA 4XHBA 4FVVA 2MEV2 3HT1A 4R52A 3RSJA 4YM3A 3D4KA 2GC1A 2Y0OA 5FO8B 1KQRA 3HT2A 4I0AA 1MACA 1T6GC 5FQ0A 1OQDA 4C1XA 2ZGNA 2ZOEB 1ZZCA 2W0XA 4IEZA 3U4XA 1DDLA 2VMGA 5EYXA 1VBE2 3WOGA 2QVSB 2VU9A 2CGNA 4FP2A 4HMZA 1Z0HA 4BH9A 1LOAA 2A6WA 1VBB3 4XF4A 4PF5A 3AZVA 1AYN2 1PVC1 1I9RA 1NA1C 3AKQA 3J8F2 4EJRA 5ABJC 2WZPP 3B7MA 1RUNA 4LE4A 1DQ1A 4XXAA 3UJOA 2WA3A 3HR9A 3M3OA 5KHJA 3BALA 1YFYA 4PLMA 5DXDA 1RUF2 2XJRA 4HT1T 3DL3A 1XE8A 2R1BA 1XYNA 4INDA 3QOPA 2AGSA 1XQNA 1VBC2 4NHLA 2Z79A 4K1YA 1H2MA 3FX3A 3PVOA 1N1TA 3ZYRA 5DG2A 2QUOA 2RJLA 2WQ4A 1J3PA 3N7JA 3FLRA 4AEDB 2VXRA 3ZXFA 2DFCA 4GWMA 4P9IA 1DIWA 2ZZJA 4ASMB 4YGDA 4SBVA 5CBLA 4AFCA 4D7TA 2XWBB 4GB32 1VLNA 1AF9A 4BA6A 2GNBA 1RUE2 3UKNA 1YIFA 1RUJ1 2DVDA 3M70A 4GH4B 3VKNA 2JKBA 1POV3 2B5HA 3UL2A 4EN8B 4MH0E 3GBFA 4XFGA 1GZCA 3BCWA 4CDQB 4FXKB 3IDBB 1K5MA 3OF1A 1SBDA 4FQ4A 3WG2A 1ULFA 4JDOA 3DPRC 4FTEA 2ILMA 1M4WA 1RIRA 2WA4A 1DGLA 1HW5A 3WDWA 1DQ4A 4QQ2A 3TNQA 1S0EA 1AYN1 2NPIA 1ASJ1 4G9SB 4AW7A 3AXDA 2VMIA 2WZR2 5K7PA 2JG8A 3O12A 4HK8A 4EN7B 1CAXA 1KJRA 4DPNA 1FATA 1NOVA 3JB4C 4J1XA 5C8WA 1XNDA 4HVOA 4JTOA 1LB2A 1RUH3 1RUF1 1D2SA 2X29A 4RHV1 2GALA 1PIV2 4L92A 4HPKA 3VBRC 1CVNA 2WJSA 4B3NA 4XHXA 1F5FA 4QT6A 5EJ3A 5JI7A 1C3HA 5T55A 2VNGA 3WQ7A 1N3PA 3E6BA 1LEMA 1ND3B 4KU8A 5CFDC 1LENA 1H1AA 1AR93 1PGSA 4NOTA 4YRDA 1LJ7A 5HCBA 2JX9A 3KS7A 1YYNA 3SCFA 3WW4A 1Z7S3 1W6OA 5LK5A 1HRI3 2A3YA 4FXGB 2ES3A 5I0UA 1COV3 3ILFA 2GH8A 4COWA 1V9U3 4OI0A 2DV9A 2B45X 4XETA 5KXBA 3O14A 3R4SA 4XFAA 2D5HA 4OHZA 5KHKA 1C1FA 4LO5B 4Q1RA 1CPNA 2BYVE 4YNIA 3MIFA 3WQ1A 2XB6C 4XBQA 4GB31 3TN93 4TLFA 4JV4A 3UV9A 2ZX2A 5FLHA 4L2NA 4JVAA 2EAKA 2VOVA 1NCQA 3AYDA 4QPGA 2VW0A 5CFCC 1DU3D 1YIPA 1U5YA 1OOPB 4PLOA 1TMF2 2JDZA 4CEWB 2AH2A 1AYM2 5TSWA 1WW4A 3V64A 4K8FA 4YW2A 3VZKA 1H8TA 4Z2WA 3KCCA 4CEYB 3ZYJB 3AMMA 3TOJA 2ARXA 3VDDA 1GKBA 5IT6A 5GLWA 2D98A 2PHRA 2WL1A 1UU5A 1LHVA 1W6NA 1AR61 1FV3A 1U5ZA 2XKOA 3FLTA 3DKWA 3RNSA 5FMOS 1AR82 3UK9A 3ATGA 2VGDA 3AKSA 4HKOA 1N3QA 4YARA 1QKQA 1H30A 1RUG3 2CYFA 1QF3A 3DUIA 4KWJA 3VZLA 4N43A 3P3NA 1APNA 5AVAA 2D6PA 2WKKA 3FE5A 3RI9A 1D0HA 2NYYA 4PDWA 2HJIA 5DDJ1 1NE4A 4WBBA 3RWNA 3AM2A 2GNTA 4O9GA 1BQPA 1MZFA 4WZFA 4MXWA 4L99A 4K21A 4F83A 5IK7A 3IN9A 1VAKA 4AVTA 2C1FA 5GZFA 3WNXA 4AI8A 2PN5A 3WUDA 1RUC2 4RS5B 4Z1VA 5LRSA 3WDVA 1Y7BA 2YXSA 2Z42A 2JG9A 3TYJA 1A8MA 3VBFC 1XNBA 4CDQC 3I4IA 4I09A 1FNZA 1POV1 5FOJB 1CONA 2PA7A 4K3UA 1QJX3 2JEMA 3I8TA 2AR6A 3RZZA 1ENRA 4AI3A 3QBQA 2CWMA 1V6LA 4CDUB 1CQ9A 2VVDA 4NWVA 1ZBA2 3WP3A 2D43A 3ALQA 1UU6A 1MQTB 1PO13 4XJZA 1L3JA 4Q4W3 4FP3A 5BNPC 3AZZA 1LU2A 4EWEA 3DV8A 4Z82A 1WBLA 1R093 4CDWC 1K5MB 4Y1XA 1UZZA 4AHZA 2A3WA 5ACA2 4KNCA 1ZM1A 1RUH1 2JE7A 5GZCA 4W6WA 1BKZA 3M7AA 4YSFA 3FBYA 1S55A 1RUI2 3K51A 4BZ4A 3MPPG 2CNAA 5FBZA 3ZIWA 1AR91 2Y38A 3IPVA 1LULA 5ABJA 4HANA 1XU2A 3ZXKA 1UF2C 4AQ6A 5FO7B 3T1LA 1OA3A 1Z7S1 1HRI1 4Q4V3 1C8M3 1N3OA 4LUMA 1CAXB 1GZ9A 1UKRA 3EJKA 1COV1 1RVF3 3JD73 2PQQA 3SH5A 3CNAA 3EQEA 2G4IA 3VL8A 1WD4A 3MFAA 5HBAA 1RUC1 1U0AA 1QOSA 4WM8C 1EPWA 2ZGQA 1EV12 3APBA 5DG1A 3VBUB 4AI0A 1R1ZA 1FOD2 1LTEA 4IQPA 1XU1A 4YW3A 2EXJA 2XL7A 3GBWA 4N53A 4DNYA 1DQ2A 2VNOA 4P9GA 1O3TA 2VUAA 5BV6A 2O8OA 4GMP0 3TRSB 4IV1B 4D7YA 2AUYA 3D6EA 3EHKA 4AFBA 5FO9B 1ULGA 5GKAC 2FQPA 3ZX7A 3WG1A 2W08A 1S0CA 2XGXA 2XVGA 1JH5A 4CDXB 1WW5A 4XF9A 4E27A 1GQGA 3VHNA 4H3WA 1ZBA1 4L9BA 4YM0A 1C4RA 1O5UA 2ZX1A 4LHNA 2ERFA 3KT7A 3NAPB 4Q1PA 2UWCA 4R9BA 4Q27A 1WBFA 2BEOA 4B7KA 1B09A 5L19A 4XFIA 2HWF3 4NPRA 2BNNA 1QDOA 2EXKA 1YCIA 4TZDA 1A6CA 1MVEA 1PMIA 1RUG1 3JU9A 4Z07A 5B2GB 1J59A 3WX5A 1IOAA 4DZGA 1YUDA 1QNWA 3OGJA 5C8CC 4JRLA 1OHFA 5A33A 3VDDB 4ZKTB 2ZGSA 3OTFA 1ZNPA 1MS0A 1D4M3 2O8QA 5JZGC 1GV9A 1LOGA 1W2UA 4XJUA 1LOBA 2XJSA 3LCPA 1UN1A 5H9QA 3RI8A 1B35B 2DVBA 4GKYA 3ZYPA 5BY5A 4E4ZA 1GNHA 4X8NA 4HETA 2CAVA 4IEWA 5BNOC 2QJVA 1QQP2 1ZZBA 3AFKA 3WDUA 4EN6B 4Y22A 3VBRA 3WUCA 4XMIA 3M3EA 2CGPA 4DFSA 2A70A 4N43B 2XLFA 3KMHA 5CFDA 2RS13 5DUXA 3LOBA 4Q8KA 1BBT3 2PAEA 4A2UA 1GFF2 1QJX1 4MGYE 1XRUA 5FLIA 1CAWB 2VW2A 4JQRA 4OI2A 3RYPA 1U5IA 1GICA 1H9PA 1TQ5A 2WS92 2K9ZA 2DU0A 4AWDA 3SHRA 3QH6A 1PZ9A 1DLLA 1GYKA 1MQTC 1ZYBA 3S30A 5JSRA 2ZABA 3GZAA 3QACA 3NWKA 2ZHLA 3ETQA 3VBHC 5JPMB 3VUOA 4LEJA 3MFCA 1CESA 3VKLA 2GH2A 1PO11 5KC6A 1ULEA 3OYWB 2XJTA 1FMD2 1Q3EA 2WLQA 4LLFA 3ZN4A 3FUQA 3BOWA 2XLGA 4LBQB 3NV4A 4YGCA 5CFCA 2XKPA 1JW6A 4FO9A 4HSLA 4IEUA 1R091 1WLWA 5JAXA 2ZGLA 1RB8G 4YZ5A 2D93A 3PHMA 2R042 5K0UC 1URXA 4HFSA 3OBRA 4DOUA 1Q8SA 5JWPA 5KXEA 3S0MA 3NV2A 3JBG2 2EIGA 1MS4A 3VZOA 3KLSA 5J3UA 3D8CA 4G4FA 4P14A 3E5UA 5CU1A 3LKJA 4XPVA 1H9WA 2WSUA 1PM7A 2VW1A 1EP0A 4Q4V1 4YM1A 1LU1A 1I1EA 4OLLA 3H7JA 4U2AA 3U10A 1RVF1 1NE6A 1WMDA 1C5HA 1H4GA 1NYWA 3ZYGA 1AJOA 4E4DX 1AR73 2WFF3 1QQP1 2CY6A 1DYPA 2ZS6B 4I0BA 4WV8A 2HWB3 1Q8PA 4H14A 3V0BB 4IV1C 1NA1B 3IPVB 3WP6A 1X8EA 5ABJB 4AVSA 4JDMA 3ZXJA 2R