2BOIA

1.1a structure of chromobacterium violaceum lectin cv2l in complex with alpha-methyl-fucoside
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
AQQGVFTLPARINFGVTVLVNSAATQHVEIFVDNEPRAAFSGVGTGDNNLGTKVINSGSGNVRVQITANGRQSDLVSSQLVLANKLNLAVVGSEDGTDMDYNDSIVILNWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CV-IIL LECTIN
publication title Unusual Entropy Driven Affinity of Chromobacter Violaceum Lectin Cv-Iil Towards Fucose and Mannose
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Lectin
total genus 24
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2boiA00
5HCHA 2WRAA 2VUDA 1OXCA 2VUCA 3DCQA 2BP6A 2WR9A 2VNVA 2JDNA 2JDUA 1W8HA 2JDHA 2BV4A 4AOCA 2JDMA 2JDYA 5A6ZA 5D2AA 2BOIA 2XR4A 2JDKA 1UQXA 1OURA 5A6YA 5A6QA 1OUSA 1OUXA 2BOJA 5A3OA 1OVSA 1OVPA 4UT5A 3ZDVA 2CHHA 5A6XA 5A70A 1GZTA 2JDPA 1W8FA 1UZVA 4CE8A
chains in the Genus database with same CATH superfamily
4LA3A 4YZ5A 1YFWA 2ET7A 3OBTA 1X50A 3PUHA 4LQRA 4BOWA 2DVDA 2VMGA 2JE8A 1TQ5A 2X5IC 4GAZA 2DCTA 3S7EA 3BODA 3MV01 1CAUA 4PQQA 4W65A 4DEQA 5IFTA 3O0WA 1PGW1 2UURA 4LBKA 4ZS3A 2WWSA 3ZYFA 3RDIA 1NQDA 5C3PA 4IESA 2ARBA 5FZ7A 1M4WA 2HEYF 1LHNA 4YGDA 3NAPB 3B9CA 3ZXFA 1RUI3 3IM0A 1LGNA 3U07A 4JGZC 2UYBA 3DKWA 2GAUA 2RS51 1S1AA 2JDAA 4SLIA 1R64A 4BQ1A 5L7OB 2BPA2 3PIJA 1X8MA 3OD4A 3C3VA 4QPYA 4QKDA 1RC6A 4YNIA 3H3UA 1H30A 2XONA 1ND2A 3BOPA 4IEOA 5CNAA 5D1IA 2VBBA 1LU1A 2PLV2 3A23A 3KCXA 1ZVFA 2FZ2A 3NNMA 2C24A 3MIFA 1REFA 3IWZA 3B93A 2ZEYA 3TOJA 4CU7A 4LBNA 4Q0UA 3E1F1 3TNPB 3V65A 3K3NA 3TWIA 3SITA 1W6MB 2WNUA 1MVQA 3N9NA 4LTAA 2GZWA 2EIDA 1UPSA 1W90A 1YC61 5DZEA 5FREA 1W6QA 3W21A 2HWF3 1X33A 1UO9A 2C6SA 1X8EA 4FOWA 3ZIXA 2XKPA 3CMGA 4ZHNA 4BMEA 1HX6A 2ZPXA 4FPKA 4UW3A 1GV9A 3LFIA 4FFFA 4I0WB 1O4ZA 2ZZQA 2WZEA 4Q1PA 4XC9A 3BTAA 4KL1A 4E2GA 4QXBA 3SHRA 3C7EA 3R4SA 4UFMA 2HWD1 1RUH2 2K2SA 2XVKA 1WLTA 1G8WA 1VBB1 3OPTA 4DY3A 3ZSMA 2Y0OA 1O8SA 2PMWB 1HRV1 2P2KA 3M3OA 1AL22 4Q5OA 4TZDA 4DO0A 2BZDA 3ZFGB 2QZ2A 1RJ8A 4RQPA 3U14A 4IE6A 4Q4X3 4BPZA 4C1XA 2JECA 4NRQA 1H6YA 5EQUA 2GP5A 3H1MA 1DBNA 1QU0A 4YW2A 4D8MA 2ZGOA 3H7YA 4XBNA 4G3YC 5FZEA 4IW3A 3OOXA 3P6BA 3OYWA 5FWJA 4LBQD 1GANA 4EV0A 3KV9A 1URXA 1AUYA 4HN1A 3THTA 2BWCA 1HLCA 2D98A 4CE8A 4XUNA 5JR2A 3FUQA 4HT1T 3ILRA 5A3WA 3ZYPA 2GMEA 1C1LA 4JGYB 3DYOA 2AENA 2AC1A 1O5LA 3IAPA 4BIFA 3MUZ1 3BIEA 4LBOA 5ANNA 1UOGA 1H8TC 4GH4C 1CPMA 1ZZ7A 3UL2A 2WQ4A 3WG4A 1DQ4A 1S0FA 1Z7S2 2ARAA 5DG2A 4LLFA 2WN3A 4PLOA 4HETA 3NJXA 5FPBA 5JI7A 4QD2A 5TSWA 3AP7A 2O8OA 4LT5A 4XUQA 5I93A 2A5ZA 4YRDA 1NCQA 1O3SA 1DGRA 1DIWA 2Y33A 1OQDA 4PBPA 5T50A 5ABJC 1QWRA 4YGBA 1RINA 4M3CB 4HVRA 4GB31 5F1RA 2DVAA 1HB2A 3ZSEA 3AK0A 1KDMA 3B69A 3N9OA 4CCKA 1AR61 1RUI2 4JAAA 1H9WA 3JBG1 3VZOA 1JU3A 3NJVA 3NNLA 1ZRDA 2ES3A 1ZZ9A 5GALA 2E7TA 3HBZA 4QT6A 5FK7A 3SLIA 4AEDC 4F8AA 1OUSA 1YQ2A 4FQ4A 4MGYE 1OA3A 5F39A 4M4RA 1OKQA 2OYZA 1VBC3 4QQPA 2JIJA 2R063 2FDGA 1T6BX 2EIEA 2CV6A 1L7RA 3E97A 2FMYA 3DECA 3I2GA 5FR3A 3KHBA 2A6ZA 1H2KA 2EVXA 5E1RA 4C0HA 3FN9A 2R043 4FTBA 3H3LA 1OMIA 1OD5A 4N43B 2VG9A 3RI8A 3CNAA 1OFSA 2ET1A 4Q0SA 4RL7A 2ZMLA 2RMU3 2VZ1A 5JI9A 3WG3A 1NCRC 4K3UA 4MH0E 4EWEA 1COV3 3SMHA 1OQ1A 3SEEA 2HWF2 3GJAA 4A7YA 1V6KA 1VAVA 4DIQA 2HEVF 1VBD3 3KF3A 4N53A 4RR3B 3OCPA 4I0BA 4UT5A 5T5PA 4DEVA 4NHKA 4CU9A 2VOTA 1GOGA 3RMXA 3TYJA 1EPWA 2AREA 1VR3A 5F6LB 1NG0A 4C1WA 3LA7A 1YCIA 2UWCA 4UBHA 3WDYA 3LWCA 3C7OA 2HKXA 3I3QA 1DYPA 4CSWA 1HDKA 1C3HA 2ZX2A 4CCEA 4MGTA 4HMZA 4AEJA 5KHKA 1W9TA 5FYIA 2R1BA 1FMD1 2WZR1 4FSJA 1Z78A 1EUTA 1BBT1 2OPKA 2VMIA 4Q4X2 5J98B 1ZZBA 3URFA 2XR4A 2DDUA 2V5DA 2D43A 2DUPA 2D3SA 2QDNA 2WNVA 3J26N 3RGBA 1MS0A 4I3PA 3FBYA 4META 5F2WA 3WX5A 2ZGKA 1ZRCA 4GULA 3D5OA 1WMXA 4O65A 4CCOA 3I8TA 3TN91 2RVAA 1QY4A 5A7QA 4AAPA 4ZU4A 1TMF3 4YW6A 2VL4A 4A7KA 2F6BA 3A0NA 3ACFA 5DAVA 4I30A 3RYKA 4CDQA 2W94A 3AMPA 4L8QA 4P00B 1SQ4A 1ASJ3 2BGPA 1C8M3 2VJXA 3M3CA 3ABZA 1Q56A 1NXMA 5DXDA 1HB3A 2IFWA 1UY1A 2JG8B 3OBAA 1CAWA 4RHV3 5GZEA 4Y5TA 1VJ2A 1APNA 2YUEA 1NE6A 1WLDA 4ZS2A 2I45A 2LW8A 3DF0A 3OGVA 5C9AB 2BFUS 3LPGA 2WJSA 4UFHA 5FPAA 1P8JA 4OQ8A 1FNYA 4PCRA 4B29A 1H2LA 2B7YA 4ES9A 3VD9A 4MGZE 5KWRA 1O3RA 4COZA 1JZ7A 2HWC2 2VXJA 3B00A 5IVCA 2NMOA 4QXCA 2FCTA 3THDA 5IHRA 2HEWF 1CESA 1FATA 2RHPA 3WDUA 2ZX3A 5FZIA 1JOJA 3U0ZA 5I8SA 3OUJA 1H6XA 3N3HA 5AFEA 1WMFA 4X6QB 1UKGA 4P9XA 2WNUB 3FMGA 4YM2A 1OOPA 1UKRA 3ZXAC 3N35A 1NXD1 3VHOA 1R1ZA 1GOHA 3M3QA 5T52A 1W6QB 2QCSB 4HPKB 1N3PA 3NV1A 1T2XA 4AVVA 5CYYA 2ETEA 4XHBA 5GJ6A 3TEXA 4AFMA 1MZ5A 1VBC2 2BBAA 2D6OX 1LAJA 1ULOA 3M8LA 2V73A 2R062 3M4FA 1WBLA 3I2KA 1RYYA 4PDWA 5GLWA 3ZYHA 1AYM3 4UW6A 1SPPA 3T4HB 4P9YA 1EUUA 4F7ZA 3KM5A 1LEMA 4WM7A 1B35B 1HB1A 2R042 4OI4A 4Q4Y1 4DQAA 5FUNA 5FIXA 4AQ6A 3AC0A 3GBFA 3M1HA 4G9SB 5K4LA 1W28A 2RMU2 2HYXA 3X29B 2IZWA 2QQWA 5EYXA 1COV2 1PX4A 1BZWA 1GLHA 4IEZA 5IYYA 3E6DA 2V4AA 4CCJA 5F6KA 5EWSA 3VD4A 4NWVA 3JXSA 4IV1A 3VKNA 1LHVA 4BK5A 1VBD2 3OYWB 2BOIA 2E53A 1W8ZA 3NVCA 3FWEA 1NZCA 1REEA 2UYAA 4IEPA 1DHKB 1PMIA 4E8DA 3AJZA 4PJYA 3ZFFC 3HNMA 3I59B 2V09A 3SXWA 1ZRFA 3OD0A 5CG9A 2EF6A 1QOOA 4LMFA 5FZ6A 2FDFA 1JHJA 2JWPA 4HSLA 4XIOA 4D6SA 4ISQA 1HW5A 2W68A 4AF9A 2ENRA 1Q8VA 4AR2A 5FO9B 4M00A 2VMHA 1PK6C 1GBGA 1J59A 5K0UC 1R093 2F17A 3ALQA 1NLSA 4BXSV 4C91A 3AB0A 1HQNA 2VCAA 4J25A 2CYFA 3OEBA 2ZX0A 3VN4A 1YIPA 1UQXA 2A70A 3HJRA 4MV2A 4RN5A 1AJOA 2I74A 4Z2WA 2OA2A 3FHQA 1TMF2 1W0OA 2Y6HA 3KT4A 3N36A 4MSVA 2WLPA 3DN7A 1LENA 3WF1A 4TLFA 3DYMA 1ASJ2 4WM8A 1RUF3 3FHIB 3PUAA 1VBA1 1C8M2 4XAAA 4QB1A 4BQ4A 4F3JA 3UT0A 4RHV2 3NAPC 2D5FA 3KQ4B 1RUD3 3I54A 1GQHA 4ZZ8A 4AI3A 4HK9A 5GKAC 4YW1A 3THCA 4FT8A 1G9FA 1AXKA 1VRBA 3FUOA 5L7OC 2Y60A 3PHMA 4DUXA 3POEA 3NWKA 4OUMA 1DYKA 2HWB1 3WSOA 1OBNA 3WDXA 2G9ZA 4Q0PA 4A42A 2AEZA 2NN8A 4LO5B 1FI2A 3J7LA 3VGIA 2NM1A 2FDJA 5C8CA 1HXS3 2JB8A 2KXLA 3IDCB 2JDPA 4XXPA 3TEWA 1ZREA 1IZ3A 2FCVA 4BQ5A 3LKJA 4V2WA 3SKJE 1G9BA 4W6XA 3B01A 5KHIA 3MGUA 2I07B 2DVBA 1DQ1A 4LOTA 4P9JA 1VB2A 4AI8A 2BDRA 2VUJA 4CVUA 1UOFA 3CIHA 4QDQA 2RDRA 1W9SA 3J7MA 1LOFA 1QIQA 2D3RA 2IXJA 3PURA 4KQ7A 4N53B 4R8HA 5DAXA 4D6RA 4WVZA 4KH9A 4MGIE 3DKQA 2Q1MA 5F3IA 5D2AA 3KT1A 4DRRA 1AYM2 3VUOA 1LCLA 3HWJA 3GNEA 2EXHA 1HN0A 4K9SA 5A3OA 1A34A 1E5HA 1DYOA 1GR3A 3BUCA 2Z69A 3ZFGC 1W39A 3PVEA 1DGLA 1DFQA 3SQOA 3RFRA 3IIAA 2BRTA 3O7OA 3IZOA 5IW0A 1RVF1 3FE5A 1W2OA 1S0BA 2JE9A 2WNVB 3NMBA 1NT0A 3K3OA 3NV3A 4JQRA 2JDNA 4K1ZA 4H2AA 4M0HA 2ZGLA 2IWGB 3JB4C 5FZBA 1YHFA 3QOPA 4AHXA 3VBOA 1SLAA 4EQVA 1IG3A 3JQXA 1C28A 1FV3A 1JH5A 1OD3A 1BMV1 5FJHA 3UGHA 1VMFA 4CDQB 1F4AA 2JENA 2LROA 4JGYC 4ZONA 5J1XA 1EP0A 2OVUA 2D7FA 2JD4A 4CDXA 5GZGA 4YW3A 5LA2A 1JYWA 1CAWB 2C4XA 4CCNA 3HPNA 4XF4A 1SLBA 1V9U1 3V0AA 4XXAA 2MEV3 5FZ9A 4NIAA 4BQWA 1UNBA 4LNVA 4QQHA 2VCCA 4GWIA 3RZLA 4K7JA 1R092 2VUDA 3DCQA 4NJ4A 2CGNA 5DUUA 5HCHA 1U12A 5HCFA 2AR6A 4E2SA 1IS5A 1UIJA 4TTGA 4HL0A 5CU1A 4YG3A 3RZJA 3W58A 1RIRA 1S2BA 2VZQA 4Z82A 4XF9A 5FYHA 1AYN3 2FMDA 4GMP0 3V64A 5JOXA 3LDRA 4CP1A 3BYWA 2W92A 1PGL1 3H1YA 4AVCA 1O5UA 1QDOA 3AFKA 3OJBA 1RUF2 5EZWA 2EAAA 5KXDA 5KXCA 3RZHA 3IDAA 1G9CA 1QNWA 3ENRA 4R9BA 3MLJA 3UKVA 1ZRRA 1BK0A 4FPEA 3GZEA 5K7PA 1RUD2 5CEHA 1CZSA 4XVHA 4GKXA 4ZU5A 5FXVA 1A78A 5IVYA 4A45A 3OGGA 2HLEA 3DYPA 2G19A 1F31A 4OUSA 5IVJA 1DG6A 5EP9A 2DBNA 5L19A 3WINE 1SDWA 4I2OA 1DGWX 4MGQA 1UPIA 4QX2A 4PDWB 1C57A 3LGRA 1SPPB 3U78A 1ZBE1 1WLCA 5DPNA 1RUG3 1X36A 3H0OA 4WM7B 4AXOA 4OFGA 3IN9A 4RGAA 2WO1A 1HXS2 3SCFA 2W0XA 4DFSA 2GMMA 3T2PA 3THPA 2KR2A 1JZ4A 3GDBA 1OSGA 3LEKA 3M3IA 4CUCA 3WT3A 5H9SA 3SH3A 3WUDA 2W47A 4EWDA 3KVBA 4IV1B 4Q4W1 1MS8A 2D97A 2P3JA 4RR3C 3I3EA 2SBAA 4RFRB 1LOAA 1W3XA 4I0AA 2A6WA 2E31A 3ST7A 3N9QA 1K5MA 3N7MA 5JMCA 1NA1C 1J3PA 2C9AA 4BWOA 5LA1A 4XIKA 1VAKA 2XMLA 4N7UA 5JWPA 5LRSA 2NZ9A 3ETPA 1EAH3 3LA2A 5FMOL 3WG1A 2A73B 2VVDA 2YY1A 2FCUA 1GNYA 4V1PA 3VBFA 4Q8LA 1KITA 1SLLA 4XPVA 2ZKLA 3PUSA 4DUWA 1CGPA 1EV11 1CZVA 1OC1A 1PO23 2PFWA 2RS33 2PAMA 3F2ZA 3LA3A 4K20A 1GSLA 5FWEA 2YYOA 4IV3A 4XDOA 1O3TA 3FX3A 4YGEA 1PIV1 1ENRA 1QQP3 1Y43B 1FNZA 2Y64A 3Q8BA 4EWAA 5IVEA 1JUHA 1SZBA 2BV4A 2P17A 4QXKA 3EMRA 2RDSA 3BPSA 4JDNA 2CU5A 1RHI3 3CBNA 1A8MA 2YC0A 3D3AA 4XMIA 4WM8B 5FZAA 5C3SA 4ZZ5A 4OZOA 1XBFA 1LTEA 3FLRA 2YGLA 3MFAA 4OHWA 2YFZA 3VBUA 2EAKA 2QDRA 1VLNA 2JG8C 3ZVXA 4D7YA 5JXIA 4X6RB 3GHMA 1R1A1 5L9BA 1PVXA 4ZPIA 1RUC1 2XOMA 4ZU7A 2MEV2 4N8MA 3SISA 3V56A 5C9AC 3SH5A 3W20A 1XU2A 5A70A 2GN7A 2OS2A 4N7IA 1A3KA 4NHLA 1HRI1 1H2MA 4RGKA 1VALA 3I7DA 3C2UA 5LRRA 2VCMA 5BNNA 4Y22A 2WO2A 2AYHA 4H55A 2PN5A 1SHWB 2JG9A 1NLQA 4EN8B 4AYUA 3JU9A 2BP6A 4XUPA 5HBAA 3LB9A 1AYN2 1BLZA 4FP2A 4BHPA 3VBRB 4W8JA 2VOXA 4CDUA 2JDMA 4CEYA 2VU9A 3LOBA 3LQCA 1UX6A 2D93A 3UKTA 1PVC1 2YBSA 3RI9A 2NPIA 1PNFA 2WNUC 2RS11 2A7AA 1Q3EA 4URAA 1UYPA 2TUNA 2VD7A 4HANA 1JW6A 3I2DA 1UOJA 4NWWA 5I91A 4BQ2A 2W1WA 2C0ZA 4PIZA 3ATGA 2Z42A 3ZPOA 3WZ1A 5A1LA 1I1EA 1QXRA 2BNMA 5G04L 1RUJ3 4RS5C 1PM4A 2XHKA 1B35C 1QJX1 1RUG2 4QU1A 3TEZA 1WW6A 5KHHA 3KS7A 4BZ4A 3ACLA 5FZ1A 2ZEZA 3KV5A 3GZUC 1F35A 4SBVA 5JOWA 1J1TA 1DLCA 1G9DA 3L2HA 2OUJA 3AMMA 2CDPA 3EB7A 5FZOB 2MPFA 5CKQA 3CEWA 2XQRA 2XBO2 1FX5A 1ND3A 4WV8A 4AGGA 3VBOB 3U4XA 2AZ5A 5C4WC 2IXIA 4AVSA 3WF4A 2WL1A 4QPIA 3AZWA 4HFSA 3G7DA 4LBQA 1UY0A 3HAGA 4KG0A 4CP9A 5FZKA 4KWLA 5BNOB 2XL9A 3ZIWA 1EAH2 3JBG3 3ZYGA 3BKZA 4ASKA 3N9LA 4CDXB 3IBMA 5BUVA 1ULFA 2ATFA 5JLVA 1PGSA 1PO22 2RS32 4XJZA 3FHAA 1ZZ8A 3SKVA 3TB0A 3V0AB 1WW7A 5JZGB 1TG7A 1YYNA 2PHUA 1S2EA 4FPLA 4XDQA 1U0AA 3FLPA 2YU2A 4YYOA 1ULGA 5L73A 4L0PA 1SACA 4NIIA 3T3YA 3WNOA 1UW8A 5CISA 1LOBA 1QQP2 5B4XA 1PZ9A 2D6MA 2Q8DA 5LBBA 2DYCA 2FQPA 3MEPA 4DOUA 1R081 2DTYA 2HJIA 4IE4A 2JD9A 1QJY3 1RHI2 2O1QA 3ZFEB 4BJ0A 3E6CC 2GC0A 3PU8A 2F4PA 1CPNA 4CU6A 4E4ZA 1JOBA 4YM0A 1MVEA 1LKNA 4LKDA 1Z0HA 1GNZA 3A7QA 4BQYA 1F4HA 1U5XA 4LPLA 4LBMA 2A3WA 1W9YA 4B4PA 5LK7B 1W8UA 1N3OA 4Y1YA 4R9CA 3JCIA 5KC5A 1GWLA 1CAXB 4NPMA 3USSA 2ZGRA 5C7GA 1KS4A 1UCXA 5DDJ3 2EXIA 5FKBA 4FQZA 1FMD3 1G6NA 1BEV3 2WZR3 3I3MA 5J09A 2QQOA 3VHRA 3T1LA 1CAVA 2B39A 3VD3A 3OPWA 2RG4A 4B7EA 2GP3A 4NHXA 2WUHA 1AL0G 4CDWC 5EJ1B 1TME3 4L97A 2ARCA 3RPQA 3OG2A 4F83A 4XBQA 5C6CA 3OPZA 4PIYA 2OXBA 5A7NA 3RMYA 3VZNA 3OY8A 2GDFA 2UWBA 4LE3A 1C4RA 4N53C 4OHYA 4WVMA 3NNFA 2VZOA 2ZCWA 4URTA 1K5MB 1XNAA 1RUJ2 3HN1A 3ZXGA 4CEWA 2C1FA 3RZKA 5LZ6A 1OLQA 2X8KA 1FOD1 1QOSA 5DUVA 2DBIA 1C5IA 2ARXA 3GBWA 4IEWA 3EYPA 4LHKA 1ODMA 1WZXA 1XNTA 1UIKA 3FFQA 4COWA 3MI8A 5FLHA 2BGCA 2DVGA 3L9JT 3NV2A 1JZ2A 4OMDA 4QX3A 4XFIA 4GJZA 4IE5A 1O4TA 2WNVC 4E4DX 2DCJA 4EJRA 1KFXL 3BI3A 3P3NA 4CCDA 2J1AA 4IV3B 2J1EA 2WT2A 4D3WA 3VDBA 2JE7A 5FKCA 4COYA 5LA0A 1UYYA 3AXDA 4A2UA 4ASMB 3O1RA 1JZ8A 1GFF2 5LATA 2ZMNA 1MQTB 1GU3A 2BFUL 3NW4A 5F5IA 4AI0A 4CDQC 3JBG2 4CCLA 1QJEA 2WQ8A 4R9DA 3VBUB 4XACA 2WZ8A 5T55A 1UD1A 2GC3A 4AFCA 3ES4A 5A80A 1STMA 2CWMA 3QD6A 2XJSA 1BVVA 3BU7A 2C9KA 3ETQA 5F32A 3T0BA 1K45A 1PO13 2PLV1 2WFF3 3K4DA 5GLUA 4WVWA 5LBCA 1G9AA 4LE4A 1VB4A 5BNNB 4Y22B 1WCUA 1W6PA 5FRAA 3OGRA 2JG9B 4EROA 3WF2A 1S0IA 2DCYA 5FY0A 1O91A 1D4M1 5IVVA 3FLTA 2Z79A 2WYFA 2YC4A 5I0UA 1XC6A 1E5SA 3AX4A 1QJY2 4CDUB 2W3JA 3SCHA 3K2OA 5LA9A 4AL9A 2EXJA 1F2NA 2QBXA 4XFGA 4CEYB 1X9TA 5FPUA 2A6XA 5CFCC 5J3UA 2ZGTA 4GQ7A 1UU6A 3LZZA 3ZSJA 4IETA 5LB6A 4JC1A 5JUVA 4DZGA 4L92A 4Y3OA 3VB9A 4QHBA 1REDA 4XF0A 1EY2A 1GP4A 5FBZA 1I9RA 1AL21 4PDWC 4CYDA 1VPHA 2RR11 5HCAA 1WWYA 4FAHA 3K48A 3KCYA 4AGVA 1LOCA 3POGA 4ET7A 3HNBM 3UESA 5DDJ2 2YV8A 2B46X 3CJIA 3NNGA 4WM7C 3R6SA 4AZZA 1BEV2 1H1MA 1WUVA 2WZR2 3KT7A 5FUPA 4IDZA 2VOVA 5FXWA 1CJPA 2ZBJA 2VZTA 1UZWA 1S0JA 3PL0A 4YG6A 5FP8A 5LY2A 4S2GA 2YBPA 4DNYA 1D2SA 2A6YA 4Z8BA 3KVAA 1TME2 1GUIA 1J3QA 2EIGA 2NLRA 4U36A 3HN3A 4Y5SA 5KXEA 2HWE1 4U2AA 1Y3TA 4NIGA 5FQ0A 5JSOA 4IV1C 1Q5OA 1ND3B 1JZ6A 3OSDA 3IDEA 4CP2A 4KNCA 4PLMA 4R52A 4QHOA 2CGOA 1LNSA 5GLZA 3QLQA 4QPIB 1CN1A 1M06G 1S2KA 4Y24A 1V6JA 4LBQB 2ZACA 4OUEA 1VBA3 2DV9A 3E6BA 2WC2A 5IAVA 1ALYA 4MGKE 2RM23 3S5AA 3WF0A 3WW1A 2B4KA 1MS4A 2WYSA 3GALA 5E16A 3B5LB 5FO8B 1GQPA 2CDOA 2RJKA 4CRQA 1ONAA 3T2OA 3UGGA 3POFA 1XQNA 4JHZA 4Y5Z0 2Q1ZB 5LEKA 3AZZA 2VZPA 4CUGA 5JXHA 1TE1B 2BERA 4OHVA 2IVJA 2YC2A 3AYCA 5JCTA 4FPGA 2ADDA 4LJHA 1AR93 4IGOA 4UOJA 5EXOA 5BPXA 4YZ4A 3U75A 4BQXA 2W52A 5IATA 4EN7B 1U5IA 2Y6JA 1VIWB 4I01A 3VKLA 1RUI1 1B09A 2D40A 2LUWA 5CA6A 1IOAA 4DXRA 3WNMA 5I0RA 1WBFA 2NYYA 4KWUA 3ZO0B 4WM8C 4A6SA 4HVQA 1CAUB 1MZ6A 2K9ZA 2VNRA 3AL6A 4D7SA 4NROA 4MX3A 1DU3D 1J83A 1QJU3 3DEMA 1SMVA 3AZVA 3LSEA 2P34A 2XDVA 1PO12 5EPAA 2QQUA 3HEIA 4YFZA 2D5HA 2PAEA 2WFF2 1KDKA 3ME2A 4GKYA 4NO4A 4P9GA 1YI9A 1H8VA 3BOWA 4UFIA 5I0SA 4NE9A 4O7XA 3OUIA 4AHZA 5A3PA 3LD8A 3TAYA 5FYUA 5D8AA 2E33A 2QQKA 2UY8A 3AXEA 3WNLA 4B1MA 3VBRC 2HWF1 1YFYA 1C8NA 3MO4A 1ND2B 3H9AA 4HOOA 2EALA 1CAVB 1BJQA 1W3VA 3HVDA 1RVF3 4UW4A 5ERLA 1X7NA 5KC6A 1CR7A 3L2YA 1UL9A 4JTNA 1NUKA 2WRAA 5FXZA 2VBDA 4X8NA 4B4RA 2V4VA 4H3WA 3J7HA 4MVTA 2VMDA 3UJOA 1OF4A 4IXLA 1SCSA 4LKSA 4QGMA 3I2OA 1NY72 3M7AA 1JUIA 3OY8B 4HKWA 1Y4WA 4RD7A 5A3TA 1LOFC 1WMEA 4B8EA 4WVMB 1GNHA 1NKGA 4RFT0 2RJ2A 1LHOA 2XVLA 3LCPA 4BA6A 1VRH3 1G86A 4LEJA 1DQ2A 3N7LA 2BGOA 5FV3A 3JB8A 3AKPA 2ZS6B 4Q4X1 4XAEA 2R16A 2WS91 5C3QA 1XU1A 3NL1A 1W99A 5G05L 4AGRA 1AXZA 4FFGA 1MACA 4JV4A 2BUKA 2VTXJ 4AQSA 1HKDA 3POBA 1WW4A 2VZRA 3OTFA 5F5AA 2Y26A 3VKMA 2VR4A 1PX3A 2CTVA 2SLIA 1AR73 2HH9A 4YZ2A 4GXLA 5JIUA 4RQPB 3O1TA 1OLME 4QGLA 1DQ6A 1DQ0A 4YVWA 4JKKA 4YGCA 2OIIA 2DF7A 3EHKA 4XFAA 5FY4A 3WHTA 3KSCA 3VBOC 5EJ3A 4Z2AA 2VBPA 2QQPA 4NIDA 1MS3A 3NO8A 4ZY9A 3OEAA 2ZGMA 2WAOA 1UMZA 1VBA2 3J9SA 1J84A 4FPFA 1LGCA 1MEC1 4IEYA 4Q4V3 4LORA 3SH4A 5C5TA 2RM22 5BNOC 3RZMA 2ZAAA 4NN0A 4HSJA 1QJFA 1CX4A 1PZ8A 4UWDA 3T30A 4AI2A 4E8CA 3ZDVA 4E9KA 1MS9A 1KQRA 1IS4A 1VE0A 3AL5A 3D0SA 3GHNA 4CP0A 1S0DA 3A22A 4UF0A 1W0PA 4KBZA 3T4VA 4P9WA 2HWC1 5CZKA 3LFMA 2J1UA 5ACA3 1GICA 3D8CA 1BXHA 4BCUA 5LWBA 1YIFA 4TSVA 5FYSA 3PVOA 5JZGC 4XQDA 2B42B 4MGSA 3TEYA 2NP0A 1AR92 2VNVA 5JPNB 5JXJA 1ZBE3 3ZDSA 2AACA 1W6PB 2WIIB 2EA7A 3HQUA 5FK8A 2YXSA 2R1DA 2CAUA 3LSDA 4H14A 5IAXA 5A7WA 3MYXA 3ACGA 3PU3A 2QVSB 4XJUA 5A7SA 5DZGA 1NCQB 2CNAA 3C8XA 5AC93 1J1LA 1ULCA 1QF3A 3Q8AA 3T2QA 1LHUA 1U5ZA 3ZFEC 5A33A 1VBC1 2HBTA 2D6KA 4HLTA 1Q8SA 2K0GA 3ZYJB 2ZGNA 1QJU2 4Q4W3 1RUE3 2ORZA 1S0GA 4XW3A 2B9UA 1UZZA 2R071 1FPN1 3RRDA 2XPJA 1LR5A 3RQ0A 2L9LA 2VUCA 2R041 2TEPA 2W91A 1W2NA 4MUVA 1GWMA 2VUAA 3RNSA 5IK4A 3KV4A 4FOYA 4QDRA 5FAXA 4H7LA 3WQ7A 3MW3A 2W1QA 2VECA 4XJWA 2VO5A 3AMQA 4AOCA 4MG2A 2RMU1 4JRLA 5DMYA 1EPZA 2TNFA 3KMHA 3WDVA 4G4FA 3VBSA 3AMHA 4UXAA 3ELNA 5FZ3A 5DG1A 1EV13 1WCDJ 4RSUA 2AH2A 4LUMA 3AKTA 4BE3A 2E63A 3WQ0A 1ZM1A 1QHDA 5K9YA 1DZTA 1JHNA 2NMNA 3AVRA 3C7FA 3CLPA 4WBBA 2IC1A 1U5YA 3KF5A 1PIV3 3IT8A 5A3NA 3MIGA 5CKNA 4E2QA 1SLIA 5FQ0B 4XQWA 1BHGA 3E5UA 4KG8A 3RVHA 1RUNA 5FBJA 4BLIA 4I09A 5FZ0A 1VRH2 2Q5TA 3U11A 2EIBA 4CCMA 4FAGA 1K5MC 2BW8A 3C7GA 2AEYA 2BNOA 3CDZB 5FP9A 5K8SA 5APAA 3H1WA 3P3PA 4DUVA 2ZAHA 3GXUA 1WA4A 1O4YA 4HG6B 5GLVA 2Y6KA 1NYWA 4O9GA 5L9VA 4CXYA 3PUQA 3GCWA 5JR7B 1HRI3 3WD5A 3WP4A 2JKXA 4XDPA 4B1LA 2XB6C 2ZA9A 3WDWA 2UY9A 1AR72 1YNAA 3UYJA 2FDHA 1QGLA 4R9AA 1UZ0A 2JB4A 2PHFA 1W8FA 2VQAA 2W39A 4IV3C 4D69A 1I5PA 3BB6A 1H4GA 1VBE1 5F8PA 1PGL2 3O5SA 4RHV1 1SCRA 4UFKA 4R4XA 1RMU3 1MQTC 4Q4V2 1NQJA 3VL8A 4FBFA 4AW7A 2XQXA 4LR4A 4JX0A 4DXSA 5JSRA 2O14A 2PHDA 3WUCA 3WV6A 4LXLA 5FXXA 2N7GA 3LIHA 4FPCA 5FZCA 2PA7A 3ILNA 4M4PA 3GYDA 4DY5A 3MF6A 3UK9A 5ACA2 1LU2A 4GMP3 1Y9GA 4XETA 4WVVA 4I02A 1V0AA 1HQWA 2R6QA 3I49A 1K42A 1FYUA 2RDNA 1Y7BA 3LIGA 1AHSA 4C0BA 5BNNC 5FOJB 4B4QA 1GKBA 3ZPYA 1AVBA 2VW1A 3S7IA 1QJX3 1QXJA 2X10A 4PHZA 3KB5A 4IEXA 1ST8A 1W8NA 5D8AB 1PNGA 5DAQA 1UX7A 3APBA 1RB8G 3R4DB 3JZVA 5AC92 4CDUC 4CEYC 3A4UA 3ZFFA 3AKQA 4QX8A 3RYRA 1ENXA 4A6OA 5E8AA 2ZABA 3K46A 3LF7A 4OI0A 4Q4W2 1RUE2 1W6NA 1AYM1 1NLRA 1OOPB 1TNFA 2WDBA 2WINB 1I6XA 3GZTB 4K40A 1ULDA 4DXZA 1F8VA 1PK6A 5BNQA 4XYXA 5EV7A 4JZRA 5K0UA 1CIWA 1ZBA1 1YFXA 3CF6E 3CQOA 1AX1A 4XJAA 1KS5A 4C90A 1NX9A 4XMAA 1SEFA 4FPYA 5JVVA 2GNDA 3AYDA 3I3DA 3J7NA 5C3OA 4BXFA 2VTFA 1AF9A 3EJKA 4HKOA 1LJ7A 1D2QA 4MOAA 1US2A 2VOWA 2WSUA 4O61A 3BTYA 4MHUA 4N43C 3MIHA 2DU1A 1UZYA 5CFDA 4QAWA 1UOBA 3MLLA 4Y4RA 4QQOA 1PIV2 5CBLA 4LK6A 1ZZ6A 2EICA 2WWUA 4YVWB 3J8F3 1ND3C 2VZ3A 2W9XA 3ES1A 3WW4A 3BTXA 4FOQA 3ACIA 1O8PA 3I4IA 2WR9A 3ACHA 1F15A 4FVVA 4QPIC 2QTWB 3P5BA 4AHYA 4EZ4A 3EBRA 4QXHA 1N1VA 3RWKX 2WLQA 1R091 3ASIA 4L9BA 4LO7A 3U10A 2DVFA 4FPJA 3WOGA 1POV1 1DGRN 4OHXA 4UF0B 3CHXA 4HXCA 2IXCA 4QDSA 1HRI2 2ZZJA 2BVBA 3HQXA 3ZMNA 3BALA 3O1OA 1DCSA 2RS53 1XPWA 4XBLA 2B45X 4QKFA 1XE7A 1HJFA 2Q8CA 5J37A 1ACCA 1RUF1 4XCBA 1VMJA 4FPHA 5I8TA 1XNDA 2Y6FA 2LALA 4LO4B 1XNBA 3IMNA 5E6HA 2Y0IA 3AKRA 5A7WB 1RMU2 3N9PA 3PDQA 3WLUA 4OI2A 1W9WA 1N3QA 1YUDA 2W08A 1W2UA 1WW5A 4LKFA 3JUUA 5FZLA 5A33B 4UW5A 3VD5A 1YI7A 1OH4A 2VZVA 3W5NA 5LEJA 5L9RA 3S0MA 2QQNA 4W6WA 2W1SA 2VM9A 2XJUA 3ZFGA 2MHFA 2ZGPA 1OI6A 5BV6A 2CHHA 3AZYA 5CB7A 3VZLA 4Q8KA 4WZCA 1DZQA 5LK5A 1QJX2 1HXS1 3SNMA 1WD3A 2HWD3 3Q8CA 4NRMA 4LO8A 3MIDA 1GP5A 1VBB3 1OH3A 5T5OA 2WSVA 3VBSB 3CU7A 4M3CF 1UMIA 2RJLA 1BQPA 1HRV3 1LOGA 2ZEWA 4ZXEA 1ND2C 1ODNA 5J7MA 4GIQA 4P14A 2ZGUA 4W4ZA 1HV0A 3NRUA 3KV6A 2Y38A 4MO3M 3PTRB 1ULEA 3FBMA 3ZXKA 4LULA 5C8CB 4JGYA 5A6QA 4A44A 2IVIB 2LTNA 1RTVA 4CXWA 3AM2A 5T54A 1YRZA 4CCCA 3I97A 4V2VA 5FFOC 2E7AA 3AJYA 5A6XA 1LRHA 4ITCA 1BCXA 1S0CA 3K77A 4JDMA 1ENQA 4UAPA 1TNRA 3AZXA 4ASLA 2W46A 2VMEA 4NHMA 4AQ2A 5DZFA 4AEKA 4COUA 1POQA 2A75A 5F7UA 3QH7A 3WY6A 4QPGA 5CADA 4JKMA 4A41A 3B9IA 5HI0A 2XJVA 2PQQA 3O0XA 1JOPA 1CD3G 3VZKA 1V00A 2JDKA 4KWKA 1H1AA 2G9GA 3H42B 3OGJA 4H7MA 4ONUA 4P08A 4Y4YA 3S5QA 4RQPC 3K4AA 2BU9A 2WA4A 2WAAA 2WNOA 3J8F2 1D4M3 2O8QA 1NOVA 3BIWE 3ZKUA 3DPRA 4HKLA 5DAPA 3WEZA 1G7YA 3FJSA 4Q27A 5IJRA 1Q8OA 2PAKA 2VW2A 5AVPA 5FJKA 4OQ9A 4OCTA 3WW3A 3WNKA 3ZXJA 1UN1A 2FHRA 2P37A 3UKNA 3GZAA 3VDCA 1PGW2 3K51A 2P3YA 2CWSA 2MEV1 2HBUA 5EYYA 4GB33 2YG0A 3KZ4C 5DQ0A 4XURA 1ZX5A 2XLFA 3Q8EA 4NAMA 1SBEA 1AR63 3CJXA 2R7EB 2JICA 2J1TA 4YM3A 2GMPA 3H7JA 1K3IA 2RS52 2WO3A 2RR13 1AYN1 2YGMA 3I2HA 2R30A 3CO2A 5H9RA 2W5FA 2R32A 1GWKA 1QDCA 3AVSA 1RXGA 3QCWA 4OHZA 3WNPA 1L3JA 2WO7A 4BM8A 3RZGA 3MPBA 5A3LA 2WZPP 3RS6A 1NCQC 4RR3A 1AX0A 5AFBA 5LW9A 2RDQA 2ZX1A 4YSFA 4HN0A 4YW5A 2PHXA 2VC9A 3H50A 2DFBA 4IERA 3KHCA 1NA1A 2OT7A 4PQ9A 3NQHA 1YJKA 2HWE3 4PI0A 3VLBB 2VAUA 2ZTNA 5CAZA 4BH9A 1BKZA 3M70A 4XF1A 4BISA 1W6NB 1A8DA 3ZYBA 4Y1ZA 4ZKTB 5HXMA 1GZWA 4M0NA 3DV8A 5D21A 4IEQA 3RSJA 1RUG1 5E89A 4DS0A 4X8PA 1WGPA 1QH6A 4QQ2A 3UJQA 4LITA 2ORXA 2XGXA 3O0VA 5FMOS 4TXWA 5F3CA 2HWD2 4EN0A 5M0TA 3NJZA 1YFUA 1VBB2 4UFJA 1H1IA 1AX2A 3AYAA 3O12A 5BXXA 1HRV2 2DUOA 3MBWA 3WP6A 1O6UA 2VW0A 4ORFA 5FO7B 3R05A 1IQDC 2XBO1 3WCRA 2A3XA 4QM9A 1SFNA 3OBZA 3ZXLA 1BBT3 4AVAA 5JIAA 1UY3A 4CUAA 2JDHA 5BYNA 5CFDB 5I8YA 3O1MA 2VMFA 2WQZC 2JDYA 3MLKA 3VHPA 4KGGA 2JG8A 1AR81 3NJYA 5JDBA 1EAH1 4K8RB 4D94A 4P9LA 3TN93 2WNEA 4LHSA 4KMQA 5C9AA 4KBBA 5I0DA 3ROUA 2H0BA 2J1VA 2UU8A 5FZOA 4LK7A 2OQ6A 2DURA 1PO21 2RS31 5JPMB 2Z2SB 1TVGA 2O0OA 2QUOA 1GYKA 4DRVA 3AP9A 5FMBA 1OHFA 3VL9A 3JD71 2K46A 1N1TA 2PHWA 2I2SA 1W8HA 5F2SA 3VBFB 3WNXA 1QQP1 4S2DA 2PQSA 1XOYA 4QHZA 3PMEA 4KU8A 2PHTA 4OI1A 4L2NA 2ZJCA 1PM7A 4JQTA 4QU2A 4QQLA 4CU8A 5F3GA 3MF9A 4P5YA 1RHI1 1D4M2 3VBHA 4A4AA 3VDDA 5JOZA 3S57A 1VMHA 4HPKA 3LE0A 3VZJA 3N4MA 1XYNA 4CPBD 3EQEA 3KCCA 1S55A 5L36A 3ZLIA 4AFDA 2TBVA 3BVCA 2CY6A 1CIYA 4NMIA 4BYYA 4I3GA 2F4LA 4FTEA 2P6CA 4A3ZA 2GC1A 4A3XA 4GB32 5FMCA 1IQAA 2QJVA 2B5HA 2XG3A 1PZ7A 3LDKA 4YPJA 2QQIA 1BVP1 5GZCA 3AMNA 5HV0A 1AR62 1GZCA 4RS5A 2CAVA 1B35A 4PI2A 2VMCA 3FL7A 5A3MA 5J48A 4YW7A 1JMUB 4HBNA 3ITQA 5EFUA 2ID4A 4ARYA 2E26A 4AHWA 2RR12 1D4VB 3T09A 1LODA 4MLOA 4YVSA 2JEMA 4CZSA 1WKYA 4ARXA 5KHJA 1A6CA 4Q26A 2WS93 3LOIA 1XYPA 4XJ8A 1E5IA 3RJ2X 3ZR6A 4JRAA 3ZN4A 3MICA 3ON7A 3I2FA 5D8AC 3BTZA 4Q4Y3 1CVNA 5LASA 2ZHMA 4NOTA 5E88A 2WA3A 4Y20A 5C4WA 3N7JA 3AFGA 3I59A 3LEMA 3OF1A 3FFZA 4AFBA 2HWE2 2DCKA 2VTXA 4QGNA 4YZ3A 1WMDA 2XLAA 1HB4A 1OOPC 4NUBA 2DCZA 5H9PA 1RUJ1 2RV9A 3F95A 3T0AA 1IS3A 4FO9A 1V70A 1IPJA 1VAMA 2XH6A 5DABA 1UXZA 4JKLA 3BN6A 3T2TA 1MEC3 4UYBA 1RUH1 1OURA 3INAA 2WFPA 4NVPA 5KHGA 2H0VA 1F5FA 2VNGA 2CSGA 3FZ3A 2LM3A 5HPOA 5BNPA 4LUKA 3GGLA 2HWC3 3DUIA 2VGDA 2Q0AA 3I3BA 4PT6A 4XTPA 5FLJA 4QPGB 2W2IA 4GD4A 5FY5A 4D0QA 4OULA 3Q8FA 2E32A 1FMD2 4DPNA 1YQ5A 1JYXA 2JDZA 4HVOA 2PTMA 1BBT2 1DDLA 1S0EA 5A32A 2X5IA 3K4ZA 1WLWA 5FLIA 3WVJA 4AE2A 1LOEA 5IK8A 4Y26A 4YVWC 3TBDA 1AJKA 3QBQA 1MS5A 3UETA 1UF2C 4FPOB 2VVFA 4KWJA 3DPRB 4PLNA 3NSTA 2KM2A 3TN92 1AXYA 5A6ZA 4XF3A 1IG0A 3POJA 4AVBA 4NPLA 2LS6A 1DQ5A 3R4UA 4JGZA 1SDDB 1HJGA 1LEDA 3DXUA 2B9VA 2VZUA 2Q8OA 1QEXA 4LHLA 1JN2P 5C8WA 2R073 1FPN3 1YQ8A 1W8OA 4CP9B 2XHNA 5FZ8A 1Z7S1 2D6NA 2QQJA 4HZFA 4RGGA 3S30A 5GZDA 1SFPA 1YEWA 4LO6B 2GU9A 1W2TA 3LDBA 4MYEA 5J36A 2HYKA 5EJZB 2DWRA 4ATFA 2HWB3 1QJY1 4CDWA 2OZJA 4OLLA 5FZFA 2ADEA 5FYZA 1SBDA 5FP3A 4OZXA 3OBRA 4R4ZA 2RE9A 4LIUA 4L99A 2BOJA 5KBFA 4COVA 1XXNA 2BQPA 1OVPA 1WCQA 1DLLA 4AG4A 1IGOA 3H8OA 4YM1A 4YWAA 3S6PA 1NA1B 2FZ1A 2QE3A 3CL1A 1TEIA 3IAQA 1X9PA 3KGLA 4P5HA 4QX1A 4GZ9A 4UI9L 4XJ9A 2YBKA 3IIIA 3ZMOA 1GZWB 1KFUL 1SG3A 4UBGA 5DDJ1 1XNCA 1UXXX 2FDIA 1BEV1 5DUWA 3VKFC 2WS92 1E5RA 2R0FA 3A21A 3TRSB 5C5UA 5FOBB 5IT6A 4EN9B 3OB8A 5FPXA 1W04A 1WCSA 4Q2FA 1TME1 2YROA 1WA6X 4Q4Y2 3HT2A 3VBSC 5T5LA 4Q0VA 1FT9A 1E57A 1KD7A 4B7KA 1XYOA 4XABA 1OQEA 3N9MA 5I0TA 3KD4A 2DTWA 2BEOA 5C8CC 1C5HA 1YJLA 3HBKA 3IDBB 1JI6A 2ILMA 4FOVA 1VBE3 4GWNA 1XSRA 5C70A 1MEC2 2ZKNA 4EZHA 2R49A 2Q4SA 3SC7X 2XLGA 2DU0A 2YMZA 4LIVA 4NAOA 1OPMA 3Q9OA 1H8TA 1I5ZA 4GH4A 5FZ4A 4BB3A 5H9QA 2OUHA 4N90A 2JKBA 1LHWA 2P4EA 5A6YA 1UU5A 4N9IA 5IUQA 1KJRA 1D7PM 4QB2A 2CGPA 3NKGA 4W6YA 1UYZA 2XWBB 4YARA 1LECA 4XFHA 4CEWB 3VD7A 2Y34A 3M3EA 1UY2A 1ENSA 1V9U3 4XEZA 3RWNA 1JBCA 2P6HA 5FYYA 3UNPA 1JS9A 1W0NA 2DFCA 2G9FA 2J7MA 4GJYA 3WCSA 4YFWA 5ABJA 5CFCA 4FP3A 2VH9A 3M2MA 4TN7A 3CKHA 3ZN6A 1XSQA 2GH2A 2WKKA 4J1XA 5A3UA 3VBHB 4JHTA 5FY7A 1VP6A 3VDDB 3ZKYA 3D6EA 3LAGA 4BU2A 4HONA 4K21A 3VDAA 1H4HA 4E27A 4LBLA 4QX0A 4IUGA 2GC2A 2ZGSA 4AEDA 1KJLA 4K6BA 3AKSA 4NR1A 5FP7A 2X29A 1PO11 2R072 1SLTA 2WFF1 2C26A 1FPN2 3KLSA 3RJRA 3SCGA 2G4IA 4AFAA 4RS5B 3G6JB 1SBFA 3NV4A 4XFFA 4NHYA 3CZUA 4CDXC 1V6NA 4FFIA 4QMAA 4XUOA 3HT1A 2OZ6A 2PHRA 3USUA 1ZBA3 5F5CA 3U1XA 1S4CA 4YVSB 2BWAA 2HWB2 3U4SA 1YLLA 3MPPG 1W06A 2Z5WA 4MXWA 1DP0A 3WNNA 2XKOA 1NCRA 5FY9A 1HIXA 4S2FA 4EE2A 1IHMA 1JU4A 1UY4A 3HOBA 4OMCA 5T5JA 1FXZA 1W03A 5FPLA 2WT1A 4Y20B 5C4WB 1JYTA 1NY71 2AUYA 2WBKA 4QKBA 2XUEA 4Y1VA 5FDBA 3SEPA 2VPVA 2E6VA 1CX1A 2WABA 3VZMA 2Y6GA 3IMMA 4P02B 2GNMA 1FAYA 4LKEA 1DF0A 2YFUA 3H8UA 4LHNA 3LPFA 2R061 1DZRA 3KQRA 3ORJA 1YQCA 3PUIA 1TZOA 5AVAA 5T3NA 1OF3A 2D6PA 1V6OA 5A7OA 4AI1A 1ZNPA 5CIRA 4PIXA 3B3QE 4O9EA 5C33A 2VULA 3ECQA 1IKQA 5J96B 1YXWA 3K75B 5FCCA 1N47A 1POV3 2X05A 5BY5A 1BYHA 1XB9A 2YZ4A 5BNPB 3GCXA 4QPWA 2Q1FA 1COV1 3CJIB 3OGSA 1JYCA 3JQWA 3MUY1 1JYIA 4AEMA 5CFDC 1LB2A 2QQLA 5A32B 1HV1A 4JTOA 2X5IB 5FYVA 5F9TA 4UFLA 5IFPA 1RVF2 1PHMA 1VBD1 2QQMA 3R0RA 2BJSA 1VBE2 3HR9A 4HK8A 3ZN5A 1AZDA 2RM21 2ZHNA 1D0GA 2QFEA 2W95A 5JMOA 1L7LA 1UMHA 1POV0 4QX5A 2VNOA 3ILFA 1ZRIA 4Y1UA 5FPVA 3NKTA 3ZR5A 1O7FA 2VCBA 4JGZB 1BMV2 5F5QA 1W8TA 2AGSA 3P1IA 4TLGA 2XUMA 2P3KA 4MZUA 4ZXKA 3MV11 4XFBA 5FYMA 1CZTA 2GNTA 2VVEA 4JCKA 1AR91 1W6OA 3PTYA 2ZGQA 2PXJA 4ATEA 1CQ9A 1J3RA 3IPVA 4NRPA 3E5XA 1R1A3 4DINB 5CG8A 1XE0A 3KGZA 1RUC3 1V9U2 1WD4A 2YB7A 2ZHKA 3VBRA 2ZOEB 3VBFC 5JSPA 5LBFA 4QM8A 3PJYA 3WXPA 1GMMA 4S2HA 3O1SA 4FI9A 5SV8A 5FZHA 4CDWB 4EYUA 5B4NA 5KXBA 1T6GC 1TMF1 1IS6A 4XCAA 4LLOA 1K5JA 2Q8EA 3WG2A 2YDEA 4IEVA 1IPSA 3PMSA 5FUIA 4IE0A 1KXGA 2OX0A 1ASJ1 1QJU1 3HQRA 1C8M1 1HN1A 1YWKA 2XJTA 4KGQA 5FY8A 1OKOA 3ZX7A 3MW2A 1JXNA 1OLMA 1PVC3 3GBGA 1K12A 1OA4A 2RS13 4XILA 1RXFA 4K8FA 2ZEXA 2A3YA 3MW4A 1SFYA 2D3PA 3AP4A 1UAIA 2WWJA 1JYVA 4TWTA 3VBUC 5GM0A 5LY1A 4Z92B 2VXRA 3MHZA 1XJAA 4GWJA 1ZBA2 1QMJA 2Y8KA 4FXKB 1QOTA 1KEXA 3WP3A 2G1MA 4IQPA 2D44A 1OXCA 3WDTA 1MPXA 1ZBE2 2ZHLA 3MIBA 2QZ3A 4MADA 4YLZA 2JG9C 5FZMA 3ZYRA 3T08A 1MZEA 2E51A 4FXGB 3ZSKA 3V0BA 3O1VA 4A7ZA 3B7MA 3BGAA 3POIA 2Q30A 1OPOA 3GM8A 3QACA 2E9QA 3IB3A 3AYEA 1MR5A 2ZMKA 4XE9A 5BNOA 1OA2A 2BYVE 5LCWL 2FD8A 1VRH1 5LBEA 5IK7A 2XXZA 4BQ3A 3ZM8A 5FTTC 4JVAA 4YW4A 3POWA 4Q0QA 1IPKA 5EHDA 4J1WA 2E7QA 2Y6LA 2XJPA 3PIGA 1H8TB 4GH4B 5JZGA 4TYSA 3AP5A 4AAXA 5IVFA 5HV4A 1AR71 3WR0A 2XVGA 1O3QA 4OYUA 2GNBA 2WN2A 2UWAA 1Y9MA 4NPRA 4QPGC 4CTEA 4YG0A 3POSA 4M3CE 5JOYA 4AWDA 1EV12 4PF5A 3U37A 2GN3A 2IXHA 1XRUA 3PLQA 5A1AA 5IVBA 3D82A 2VQTA 3CZJA 3ZFEA 3QH6A 4KU7A 1Q8QA 5ABJB 3A0KA 3BCWA 1UU4A 1BK1A 4Q4V1 3RG0A 2J22A 5CFCB 3ZN6B 1H9PA 5KR7A 3W59A 2GSYA 3TNQA 4XTMA 1FV2A 1X82A 3DPRC 4QX7A 4CA9A 3ZOIA 1CJDA 3NAPA 1ZYBA 3GF6A 1R083 4ISRA 3LEGA 2OPWA 5ACA1 2KD7A 4AEDB 2H6BA 1V6MA 5L7OA 3T0DA 5F3EA 1OFNA 1CAXA 1ZA7A 4QKNA 1CWPA 2BNNA 1O59A 2H6CA 2GH8A 2MNGA 4N9HA 2FDKA 1R1A2 1RITA 1RUC2 4IGPA 4GALA 4JDOA 2NQYA 4AI9A 3BU0A 3USUB 4DMIA 4Z1VA 1QKQA 3W9AA 3H3ZA 1IKPA 1KGYA 1ULPA 2WT0A 3LEIA 1QXPA 5AC91 2J1RA 2C5DA 2QQVA 4DB5A 4MXWB 1W6MA 2VQ0A 1GZTA 5CKMA 5EIYB 2YU1A 3BPZA 1NCRB 1GZ9A 2B8MA 2XBO3 3H8RA 1RUE1 2J42A 2QNKA 4Q29A 4GWMA 1PVC2 2BVVA 2JXAA 3J4UH 3MDPA 1RUD1 1V6LA 1ZZCA 4IEUA 5JAXA 1D0HA 2RS12 4Q1RA 2PELA 1H0BA 1AR83 3O1PA 4EN6B 1DGWA 4XUTA 1XNKA 2X53S 3ZXEA 3RYPA 3DGTA 2P5BA 2XJRA 3C7HA 4PF1A 4FCAA 5CVRA 2XWJB 1LGBA 1HQLA 3WW2A 5DUXA 1OVSA 2D6LX 3HD8B 3DL3A 2VOKA 4IE7A 5JXGA 3ZYIB 3D0JA 3ZXDA 1GP6A 1L7QA 1LULA 1XE8A 1N1YA 4D6QA 2Z4FA 1UWWA 2LRPA 2IUWA 5A1FA 3JD73 3HIFA 2IFRA 1FOD3 5DN2A 4FTSA 1QNYA 3WP5A 1NZIA 1LESA 5C3RA 1MQTA 1QJZA 2QKDA 3EO6A 4QB6A 1Q43A 2P1BA 5GZFA 4P9IA 4XOGA 3MIEA 1F5JA 1N1SA 4CXXA 2GALA 1W8WA 2DUQA 1JZ5A 4KI5M 2IXKA 1RUOA 5FYCA 3DXTA 4ES8A 1KRIA 3VKOA 1OUXA 1SLCA 3WQBA 5HCBA 2X09A 5IK5A 2PYTA 4BDVB 3RZZA 4FFHA 1F9KA 1OT5A 1Q8PA 4AK3A 2XL7A 5C71A 3I2JA 2P3IA 3OUHA 3AP6A 1YO8A 4M01A 4MXVA 4Y33A 3B94A 5SV5A 5GLTA 5B2GB 3EXUA 4PBOA 1W6OB 3MFCA 4LBJA 2R0HA 3UV9A 3IPVB 1QH7A 4CEWC 2YPDA 4L11A 4BLJA 2JDUA 4IL7A 5FZDA 1JYNA 3N7KA 3HMYA 3UGFA 4AVTA 1EYBA 4RYDA 3VV1A 2FBEA 2PLV3 1RMU1 4J6GA 3PJQA 2A71A 5DAWA 4CPBA 4M3CA 1OLRA 4C8DA 3POYA 3NNJA 3VBHC 4LOSA 3VDDC 2J1SA 1GOFA 3KWVA 1JZ3A 3O14A 4XHXA 3W5MA 4RA0A 1US3A 1R082 1H2NA 5A7PA 4CUBA 4WZFA 2XJQA 3O1UA 4AQTA 4XZPA 1WCKA 4GMP1 2W87A 5FMDA 3WQ1A 1CONA 2OW4A 4W50A 1UYXA 3PVNA 4BK4A 5FYTA 2BBVA 1UZVA 2V72A 1NE4A 3FC0A 2CL2A 4XZUG 4QWNA 4E4SA 2A6VA 5F37A 1NAEA 4Y1XA 1PMJX 3H8XA 1MS1A 4YZ1A 4BIOA 3HNYM 1J58A 2JIGA 1GQGA 2IXLA 1RUH3 1JTZX 4XFCA 2OKXA 1W9FA 1I3HA 1YQ6A 4NIHA 2ZX4A 4N43A 4YVSC 3IKWA 4B3NA 5HXVA 1AL23 3PNAA 4E4HA 2V5YA 4Z07A 3MZHA 3PVBB 4INDA 4XQ4A 1RGSA 5FY1A 4GA9A 4LA2A 5FP4A 3V0BB 4MHRA 2W1UA 4BMBA 3E5QA 1ZA4A 4K1YA 5FYBA 2VE1A 1PMHX 3T1MA 3B02A 2A1XA 5IWFA 1AR82 3ZFFB 2KA3A 1Y9QA 3I2IA 3ZSLA 3D4KA 3GJBA 2OQ7A 5ANQA 1W2AX 2VQUA 1RL3A 1JODA 2PHLA 2EXKA 1W05A 5FPZA 3WHUA 2VY0A 1RJ7A 2ZXQA 4DXTA 2VZSA 2BTVC 5FZGA 1PK6B 2YPJA 5BNPC 1C1FA 1Z7S3 5K0UB 4D7TA 3JD72 4OVEA 5ISLA 4IGQA 2ERFA 1FOD2 2JJ6A 3WF3A 1V6IA 2JX9A 3VHNA 2YHJA 3CJIC 3J8F1 1MZFA
chains in the Genus database with same CATH topology
5HCHA 2WRAA 2VUDA 1OXCA 2VUCA 3DCQA 2BP6A 2WR9A 2VNVA 2JDNA 2JDUA 1W8HA 2JDHA 2BV4A 4AOCA 2JDMA 2JDYA 5A6ZA 5D2AA 2BOIA 2XR4A 2JDKA 1UQXA 1OURA 5A6YA 5A6QA 1OUSA 1OUXA 2BOJA 5A3OA 1OVSA 1OVPA 4UT5A 3ZDVA 2CHHA 5A6XA 5A70A 1GZTA 2JDPA 1W8FA 1UZVA 4CE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HCH A;  2WRA A;  2VUD A;  1OXC A;  2VUC A;  3DCQ A;  2BP6 A;  2WR9 A;  2VNV A;  2JDN A;  2JDU A;  1W8H A;  2JDH A;  2BV4 A;  4AOC A;  2JDM A;  2JDY A;  5A6Z A;  5D2A A;  2BOI A;  2XR4 A;  2JDK A;  1UQX A;  1OUR A;  5A6Y A;  5A6Q A;  1OUS A;  1OUX A;  2BOJ A;  5A3O A;  1OVS A;  1OVP A;  4UT5 A;  3ZDV A;  2CHH A;  5A6X A;  5A70 A;  1GZT A;  2JDP A;  1W8F A;  1UZV A;  4CE8 A; 
#chains in the Genus database with same CATH topology
 4LA3 A;  4YZ5 A;  1YFW A;  2ET7 A;  3OBT A;  1X50 A;  3PUH A;  4LQR A;  4BOW A;  2DVD A;  2VMG A;  2JE8 A;  1TQ5 A;  2X5I C;  4GAZ A;  2DCT A;  3S7E A;  3BOD A;  3MV0 1;  1CAU A;  4PQQ A;  4W65 A;  4DEQ A;  5IFT A;  3O0W A;  1PGW 1;  2UUR A;  4LBK A;  4ZS3 A;  2WWS A;  3ZYF A;  3RDI A;  1NQD A;  5C3P A;  4IES A;  2ARB A;  5FZ7 A;  1M4W A;  2HEY F;  1LHN A;  4YGD A;  3NAP B;  3B9C A;  3ZXF A;  1RUI 3;  3IM0 A;  1LGN A;  3U07 A;  4JGZ C;  2UYB A;  3DKW A;  2GAU A;  2RS5 1;  1S1A A;  2JDA A;  4SLI A;  1R64 A;  4BQ1 A;  5L7O B;  2BPA 2;  3PIJ A;  1X8M A;  3OD4 A;  3C3V A;  4QPY A;  4QKD A;  1RC6 A;  4YNI A;  3H3U A;  1H30 A;  2XON A;  1ND2 A;  3BOP A;  4IEO A;  5CNA A;  5D1I A;  2VBB A;  1LU1 A;  2PLV 2;  3A23 A;  3KCX A;  1ZVF A;  2FZ2 A;  3NNM A;  2C24 A;  3MIF A;  1REF A;  3IWZ A;  3B93 A;  2ZEY A;  3TOJ A;  4CU7 A;  4LBN A;  4Q0U A;  3E1F 1;  3TNP B;  3V65 A;  3K3N A;  3TWI A;  3SIT A;  1W6M B;  2WNU A;  1MVQ A;  3N9N A;  4LTA A;  2GZW A;  2EID A;  1UPS A;  1W90 A;  1YC6 1;  5DZE A;  5FRE A;  1W6Q A;  3W21 A;  2HWF 3;  1X33 A;  1UO9 A;  2C6S A;  1X8E A;  4FOW A;  3ZIX A;  2XKP A;  3CMG A;  4ZHN A;  4BME A;  1HX6 A;  2ZPX A;  4FPK A;  4UW3 A;  1GV9 A;  3LFI A;  4FFF A;  4I0W B;  1O4Z A;  2ZZQ A;  2WZE A;  4Q1P A;  4XC9 A;  3BTA A;  4KL1 A;  4E2G A;  4QXB A;  3SHR A;  3C7E A;  3R4S A;  4UFM A;  2HWD 1;  1RUH 2;  2K2S A;  2XVK A;  1WLT A;  1G8W A;  1VBB 1;  3OPT A;  4DY3 A;  3ZSM A;  2Y0O A;  1O8S A;  2PMW B;  1HRV 1;  2P2K A;  3M3O A;  1AL2 2;  4Q5O A;  4TZD A;  4DO0 A;  2BZD A;  3ZFG B;  2QZ2 A;  1RJ8 A;  4RQP A;  3U14 A;  4IE6 A;  4Q4X 3;  4BPZ A;  4C1X A;  2JEC A;  4NRQ A;  1H6Y A;  5EQU A;  2GP5 A;  3H1M A;  1DBN A;  1QU0 A;  4YW2 A;  4D8M A;  2ZGO A;  3H7Y A;  4XBN A;  4G3Y C;  5FZE A;  4IW3 A;  3OOX A;  3P6B A;  3OYW A;  5FWJ A;  4LBQ D;  1GAN A;  4EV0 A;  3KV9 A;  1URX A;  1AUY A;  4HN1 A;  3THT A;  2BWC A;  1HLC A;  2D98 A;  4CE8 A;  4XUN A;  5JR2 A;  3FUQ A;  4HT1 T;  3ILR A;  5A3W A;  3ZYP A;  2GME A;  1C1L A;  4JGY B;  3DYO A;  2AEN A;  2AC1 A;  1O5L A;  3IAP A;  4BIF A;  3MUZ 1;  3BIE A;  4LBO A;  5ANN A;  1UOG A;  1H8T C;  4GH4 C;  1CPM A;  1ZZ7 A;  3UL2 A;  2WQ4 A;  3WG4 A;  1DQ4 A;  1S0F A;  1Z7S 2;  2ARA A;  5DG2 A;  4LLF A;  2WN3 A;  4PLO A;  4HET A;  3NJX A;  5FPB A;  5JI7 A;  4QD2 A;  5TSW A;  3AP7 A;  2O8O A;  4LT5 A;  4XUQ A;  5I93 A;  2A5Z A;  4YRD A;  1NCQ A;  1O3S A;  1DGR A;  1DIW A;  2Y33 A;  1OQD A;  4PBP A;  5T50 A;  5ABJ C;  1QWR A;  4YGB A;  1RIN A;  4M3C B;  4HVR A;  4GB3 1;  5F1R A;  2DVA A;  1HB2 A;  3ZSE A;  3AK0 A;  1KDM A;  3B69 A;  3N9O A;  4CCK A;  1AR6 1;  1RUI 2;  4JAA A;  1H9W A;  3JBG 1;  3VZO A;  1JU3 A;  3NJV A;  3NNL A;  1ZRD A;  2ES3 A;  1ZZ9 A;  5GAL A;  2E7T A;  3HBZ A;  4QT6 A;  5FK7 A;  3SLI A;  4AED C;  4F8A A;  1OUS A;  1YQ2 A;  4FQ4 A;  4MGY E;  1OA3 A;  5F39 A;  4M4R A;  1OKQ A;  2OYZ A;  1VBC 3;  4QQP A;  2JIJ A;  2R06 3;  2FDG A;  1T6B X;  2EIE A;  2CV6 A;  1L7R A;  3E97 A;  2FMY A;  3DEC A;  3I2G A;  5FR3 A;  3KHB A;  2A6Z A;  1H2K A;  2EVX A;  5E1R A;  4C0H A;  3FN9 A;  2R04 3;  4FTB A;  3H3L A;  1OMI A;  1OD5 A;  4N43 B;  2VG9 A;  3RI8 A;  3CNA A;  1OFS A;  2ET1 A;  4Q0S A;  4RL7 A;  2ZML A;  2RMU 3;  2VZ1 A;  5JI9 A;  3WG3 A;  1NCR C;  4K3U A;  4MH0 E;  4EWE A;  1COV 3;  3SMH A;  1OQ1 A;  3SEE A;  2HWF 2;  3GJA A;  4A7Y A;  1V6K A;  1VAV A;  4DIQ A;  2HEV F;  1VBD 3;  3KF3 A;  4N53 A;  4RR3 B;  3OCP A;  4I0B A;  4UT5 A;  5T5P A;  4DEV A;  4NHK A;  4CU9 A;  2VOT A;  1GOG A;  3RMX A;  3TYJ A;  1EPW A;  2ARE A;  1VR3 A;  5F6L B;  1NG0 A;  4C1W A;  3LA7 A;  1YCI A;  2UWC A;  4UBH A;  3WDY A;  3LWC A;  3C7O A;  2HKX A;  3I3Q A;  1DYP A;  4CSW A;  1HDK A;  1C3H A;  2ZX2 A;  4CCE A;  4MGT A;  4HMZ A;  4AEJ A;  5KHK A;  1W9T A;  5FYI A;  2R1B A;  1FMD 1;  2WZR 1;  4FSJ A;  1Z78 A;  1EUT A;  1BBT 1;  2OPK A;  2VMI A;  4Q4X 2;  5J98 B;  1ZZB A;  3URF A;  2XR4 A;  2DDU A;  2V5D A;  2D43 A;  2DUP A;  2D3S A;  2QDN A;  2WNV A;  3J26 N;  3RGB A;  1MS0 A;  4I3P A;  3FBY A;  4MET A;  5F2W A;  3WX5 A;  2ZGK A;  1ZRC A;  4GUL A;  3D5O A;  1WMX A;  4O65 A;  4CCO A;  3I8T A;  3TN9 1;  2RVA A;  1QY4 A;  5A7Q A;  4AAP A;  4ZU4 A;  1TMF 3;  4YW6 A;  2VL4 A;  4A7K A;  2F6B A;  3A0N A;  3ACF A;  5DAV A;  4I30 A;  3RYK A;  4CDQ A;  2W94 A;  3AMP A;  4L8Q A;  4P00 B;  1SQ4 A;  1ASJ 3;  2BGP A;  1C8M 3;  2VJX A;  3M3C A;  3ABZ A;  1Q56 A;  1NXM A;  5DXD A;  1HB3 A;  2IFW A;  1UY1 A;  2JG8 B;  3OBA A;  1CAW A;  4RHV 3;  5GZE A;  4Y5T A;  1VJ2 A;  1APN A;  2YUE A;  1NE6 A;  1WLD A;  4ZS2 A;  2I45 A;  2LW8 A;  3DF0 A;  3OGV A;  5C9A B;  2BFU S;  3LPG A;  2WJS A;  4UFH A;  5FPA A;  1P8J A;  4OQ8 A;  1FNY A;  4PCR A;  4B29 A;  1H2L A;  2B7Y A;  4ES9 A;  3VD9 A;  4MGZ E;  5KWR A;  1O3R A;  4COZ A;  1JZ7 A;  2HWC 2;  2VXJ A;  3B00 A;  5IVC A;  2NMO A;  4QXC A;  2FCT A;  3THD A;  5IHR A;  2HEW F;  1CES A;  1FAT A;  2RHP A;  3WDU A;  2ZX3 A;  5FZI A;  1JOJ A;  3U0Z A;  5I8S A;  3OUJ A;  1H6X A;  3N3H A;  5AFE A;  1WMF A;  4X6Q B;  1UKG A;  4P9X A;  2WNU B;  3FMG A;  4YM2 A;  1OOP A;  1UKR A;  3ZXA C;  3N35 A;  1NXD 1;  3VHO A;  1R1Z A;  1GOH A;  3M3Q A;  5T52 A;  1W6Q B;  2QCS B;  4HPK B;  1N3P A;  3NV1 A;  1T2X A;  4AVV A;  5CYY A;  2ETE A;  4XHB A;  5GJ6 A;  3TEX A;  4AFM A;  1MZ5 A;  1VBC 2;  2BBA A;  2D6O X;  1LAJ A;  1ULO A;  3M8L A;  2V73 A;  2R06 2;  3M4F A;  1WBL A;  3I2K A;  1RYY A;  4PDW A;  5GLW A;  3ZYH A;  1AYM 3;  4UW6 A;  1SPP A;  3T4H B;  4P9Y A;  1EUU A;  4F7Z A;  3KM5 A;  1LEM A;  4WM7 A;  1B35 B;  1HB1 A;  2R04 2;  4OI4 A;  4Q4Y 1;  4DQA A;  5FUN A;  5FIX A;  4AQ6 A;  3AC0 A;  3GBF A;  3M1H A;  4G9S B;  5K4L A;  1W28 A;  2RMU 2;  2HYX A;  3X29 B;  2IZW A;  2QQW A;  5EYX A;  1COV 2;  1PX4 A;  1BZW A;  1GLH A;  4IEZ A;  5IYY A;  3E6D A;  2V4A A;  4CCJ A;  5F6K A;  5EWS A;  3VD4 A;  4NWV A;  3JXS A;  4IV1 A;  3VKN A;  1LHV A;  4BK5 A;  1VBD 2;  3OYW B;  2BOI A;  2E53 A;  1W8Z A;  3NVC A;  3FWE A;  1NZC A;  1REE A;  2UYA A;  4IEP A;  1DHK B;  1PMI A;  4E8D A;  3AJZ A;  4PJY A;  3ZFF C;  3HNM A;  3I59 B;  2V09 A;  3SXW A;  1ZRF A;  3OD0 A;  5CG9 A;  2EF6 A;  1QOO A;  4LMF A;  5FZ6 A;  2FDF A;  1JHJ A;  2JWP A;  4HSL A;  4XIO A;  4D6S A;  4ISQ A;  1HW5 A;  2W68 A;  4AF9 A;  2ENR A;  1Q8V A;  4AR2 A;  5FO9 B;  4M00 A;  2VMH A;  1PK6 C;  1GBG A;  1J59 A;  5K0U C;  1R09 3;  2F17 A;  3ALQ A;  1NLS A;  4BXS V;  4C91 A;  3AB0 A;  1HQN A;  2VCA A;  4J25 A;  2CYF A;  3OEB A;  2ZX0 A;  3VN4 A;  1YIP A;  1UQX A;  2A70 A;  3HJR A;  4MV2 A;  4RN5 A;  1AJO A;  2I74 A;  4Z2W A;  2OA2 A;  3FHQ A;  1TMF 2;  1W0O A;  2Y6H A;  3KT4 A;  3N36 A;  4MSV A;  2WLP A;  3DN7 A;  1LEN A;  3WF1 A;  4TLF A;  3DYM A;  1ASJ 2;  4WM8 A;  1RUF 3;  3FHI B;  3PUA A;  1VBA 1;  1C8M 2;  4XAA A;  4QB1 A;  4BQ4 A;  4F3J A;  3UT0 A;  4RHV 2;  3NAP C;  2D5F A;  3KQ4 B;  1RUD 3;  3I54 A;  1GQH A;  4ZZ8 A;  4AI3 A;  4HK9 A;  5GKA C;  4YW1 A;  3THC A;  4FT8 A;  1G9F A;  1AXK A;  1VRB A;  3FUO A;  5L7O C;  2Y60 A;  3PHM A;  4DUX A;  3POE A;  3NWK A;  4OUM A;  1DYK A;  2HWB 1;  3WSO A;  1OBN A;  3WDX A;  2G9Z A;  4Q0P A;  4A42 A;  2AEZ A;  2NN8 A;  4LO5 B;  1FI2 A;  3J7L A;  3VGI A;  2NM1 A;  2FDJ A;  5C8C A;  1HXS 3;  2JB8 A;  2KXL A;  3IDC B;  2JDP A;  4XXP A;  3TEW A;  1ZRE A;  1IZ3 A;  2FCV A;  4BQ5 A;  3LKJ A;  4V2W A;  3SKJ E;  1G9B A;  4W6X A;  3B01 A;  5KHI A;  3MGU A;  2I07 B;  2DVB A;  1DQ1 A;  4LOT A;  4P9J A;  1VB2 A;  4AI8 A;  2BDR A;  2VUJ A;  4CVU A;  1UOF A;  3CIH A;  4QDQ A;  2RDR A;  1W9S A;  3J7M A;  1LOF A;  1QIQ A;  2D3R A;  2IXJ A;  3PUR A;  4KQ7 A;  4N53 B;  4R8H A;  5DAX A;  4D6R A;  4WVZ A;  4KH9 A;  4MGI E;  3DKQ A;  2Q1M A;  5F3I A;  5D2A A;  3KT1 A;  4DRR A;  1AYM 2;  3VUO A;  1LCL A;  3HWJ A;  3GNE A;  2EXH A;  1HN0 A;  4K9S A;  5A3O A;  1A34 A;  1E5H A;  1DYO A;  1GR3 A;  3BUC A;  2Z69 A;  3ZFG C;  1W39 A;  3PVE A;  1DGL A;  1DFQ A;  3SQO A;  3RFR A;  3IIA A;  2BRT A;  3O7O A;  3IZO A;  5IW0 A;  1RVF 1;  3FE5 A;  1W2O A;  1S0B A;  2JE9 A;  2WNV B;  3NMB A;  1NT0 A;  3K3O A;  3NV3 A;  4JQR A;  2JDN A;  4K1Z A;  4H2A A;  4M0H A;  2ZGL A;  2IWG B;  3JB4 C;  5FZB A;  1YHF A;  3QOP A;  4AHX A;  3VBO A;  1SLA A;  4EQV A;  1IG3 A;  3JQX A;  1C28 A;  1FV3 A;  1JH5 A;  1OD3 A;  1BMV 1;  5FJH A;  3UGH A;  1VMF A;  4CDQ B;  1F4A A;  2JEN A;  2LRO A;  4JGY C;  4ZON A;  5J1X A;  1EP0 A;  2OVU A;  2D7F A;  2JD4 A;  4CDX A;  5GZG A;  4YW3 A;  5LA2 A;  1JYW A;  1CAW B;  2C4X A;  4CCN A;  3HPN A;  4XF4 A;  1SLB A;  1V9U 1;  3V0A A;  4XXA A;  2MEV 3;  5FZ9 A;  4NIA A;  4BQW A;  1UNB A;  4LNV A;  4QQH A;  2VCC A;  4GWI A;  3RZL A;  4K7J A;  1R09 2;  2VUD A;  3DCQ A;  4NJ4 A;  2CGN A;  5DUU A;  5HCH A;  1U12 A;  5HCF A;  2AR6 A;  4E2S A;  1IS5 A;  1UIJ A;  4TTG A;  4HL0 A;  5CU1 A;  4YG3 A;  3RZJ A;  3W58 A;  1RIR A;  1S2B A;  2VZQ A;  4Z82 A;  4XF9 A;  5FYH A;  1AYN 3;  2FMD A;  4GMP 0;  3V64 A;  5JOX A;  3LDR A;  4CP1 A;  3BYW A;  2W92 A;  1PGL 1;  3H1Y A;  4AVC A;  1O5U A;  1QDO A;  3AFK A;  3OJB A;  1RUF 2;  5EZW A;  2EAA A;  5KXD A;  5KXC A;  3RZH A;  3IDA A;  1G9C A;  1QNW A;  3ENR A;  4R9B A;  3MLJ A;  3UKV A;  1ZRR A;  1BK0 A;  4FPE A;  3GZE A;  5K7P A;  1RUD 2;  5CEH A;  1CZS A;  4XVH A;  4GKX A;  4ZU5 A;  5FXV A;  1A78 A;  5IVY A;  4A45 A;  3OGG A;  2HLE A;  3DYP A;  2G19 A;  1F31 A;  4OUS A;  5IVJ A;  1DG6 A;  5EP9 A;  2DBN A;  5L19 A;  3WIN E;  1SDW A;  4I2O A;  1DGW X;  4MGQ A;  1UPI A;  4QX2 A;  4PDW B;  1C57 A;  3LGR A;  1SPP B;  3U78 A;  1ZBE 1;  1WLC A;  5DPN A;  1RUG 3;  1X36 A;  3H0O A;  4WM7 B;  4AXO A;  4OFG A;  3IN9 A;  4RGA A;  2WO1 A;  1HXS 2;  3SCF A;  2W0X A;  4DFS A;  2GMM A;  3T2P A;  3THP A;  2KR2 A;  1JZ4 A;  3GDB A;  1OSG A;  3LEK A;  3M3I A;  4CUC A;  3WT3 A;  5H9S A;  3SH3 A;  3WUD A;  2W47 A;  4EWD A;  3KVB A;  4IV1 B;  4Q4W 1;  1MS8 A;  2D97 A;  2P3J A;  4RR3 C;  3I3E A;  2SBA A;  4RFR B;  1LOA A;  1W3X A;  4I0A A;  2A6W A;  2E31 A;  3ST7 A;  3N9Q A;  1K5M A;  3N7M A;  5JMC A;  1NA1 C;  1J3P A;  2C9A A;  4BWO A;  5LA1 A;  4XIK A;  1VAK A;  2XML A;  4N7U A;  5JWP A;  5LRS A;  2NZ9 A;  3ETP A;  1EAH 3;  3LA2 A;  5FMO L;  3WG1 A;  2A73 B;  2VVD A;  2YY1 A;  2FCU A;  1GNY A;  4V1P A;  3VBF A;  4Q8L A;  1KIT A;  1SLL A;  4XPV A;  2ZKL A;  3PUS A;  4DUW A;  1CGP A;  1EV1 1;  1CZV A;  1OC1 A;  1PO2 3;  2PFW A;  2RS3 3;  2PAM A;  3F2Z A;  3LA3 A;  4K20 A;  1GSL A;  5FWE A;  2YYO A;  4IV3 A;  4XDO A;  1O3T A;  3FX3 A;  4YGE A;  1PIV 1;  1ENR A;  1QQP 3;  1Y43 B;  1FNZ A;  2Y64 A;  3Q8B A;  4EWA A;  5IVE A;  1JUH A;  1SZB A;  2BV4 A;  2P17 A;  4QXK A;  3EMR A;  2RDS A;  3BPS A;  4JDN A;  2CU5 A;  1RHI 3;  3CBN A;  1A8M A;  2YC0 A;  3D3A A;  4XMI A;  4WM8 B;  5FZA A;  5C3S A;  4ZZ5 A;  4OZO A;  1XBF A;  1LTE A;  3FLR A;  2YGL A;  3MFA A;  4OHW A;  2YFZ A;  3VBU A;  2EAK A;  2QDR A;  1VLN A;  2JG8 C;  3ZVX A;  4D7Y A;  5JXI A;  4X6R B;  3GHM A;  1R1A 1;  5L9B A;  1PVX A;  4ZPI A;  1RUC 1;  2XOM A;  4ZU7 A;  2MEV 2;  4N8M A;  3SIS A;  3V56 A;  5C9A C;  3SH5 A;  3W20 A;  1XU2 A;  5A70 A;  2GN7 A;  2OS2 A;  4N7I A;  1A3K A;  4NHL A;  1HRI 1;  1H2M A;  4RGK A;  1VAL A;  3I7D A;  3C2U A;  5LRR A;  2VCM A;  5BNN A;  4Y22 A;  2WO2 A;  2AYH A;  4H55 A;  2PN5 A;  1SHW B;  2JG9 A;  1NLQ A;  4EN8 B;  4AYU A;  3JU9 A;  2BP6 A;  4XUP A;  5HBA A;  3LB9 A;  1AYN 2;  1BLZ A;  4FP2 A;  4BHP A;  3VBR B;  4W8J A;  2VOX A;  4CDU A;  2JDM A;  4CEY A;  2VU9 A;  3LOB A;  3LQC A;  1UX6 A;  2D93 A;  3UKT A;  1PVC 1;  2YBS A;  3RI9 A;  2NPI A;  1PNF A;  2WNU C;  2RS1 1;  2A7A A;  1Q3E A;  4URA A;  1UYP A;  2TUN A;  2VD7 A;  4HAN A;  1JW6 A;  3I2D A;  1UOJ A;  4NWW A;  5I91 A;  4BQ2 A;  2W1W A;  2C0Z A;  4PIZ A;  3ATG A;  2Z42 A;  3ZPO A;  3WZ1 A;  5A1L A;  1I1E A;  1QXR A;  2BNM A;  5G04 L;  1RUJ 3;  4RS5 C;  1PM4 A;  2XHK A;  1B35 C;  1QJX 1;  1RUG 2;  4QU1 A;  3TEZ A;  1WW6 A;  5KHH A;  3KS7 A;  4BZ4 A;  3ACL A;  5FZ1 A;  2ZEZ A;  3KV5 A;  3GZU C;  1F35 A;  4SBV A;  5JOW A;  1J1T A;  1DLC A;  1G9D A;  3L2H A;  2OUJ A;  3AMM A;  2CDP A;  3EB7 A;  5FZO B;  2MPF A;  5CKQ A;  3CEW A;  2XQR A;  2XBO 2;  1FX5 A;  1ND3 A;  4WV8 A;  4AGG A;  3VBO B;  3U4X A;  2AZ5 A;  5C4W C;  2IXI A;  4AVS A;  3WF4 A;  2WL1 A;  4QPI A;  3AZW A;  4HFS A;  3G7D A;  4LBQ A;  1UY0 A;  3HAG A;  4KG0 A;  4CP9 A;  5FZK A;  4KWL A;  5BNO B;  2XL9 A;  3ZIW A;  1EAH 2;  3JBG 3;  3ZYG A;  3BKZ A;  4ASK A;  3N9L A;  4CDX B;  3IBM A;  5BUV A;  1ULF A;  2ATF A;  5JLV A;  1PGS A;  1PO2 2;  2RS3 2;  4XJZ A;  3FHA A;  1ZZ8 A;  3SKV A;  3TB0 A;  3V0A B;  1WW7 A;  5JZG B;  1TG7 A;  1YYN A;  2PHU A;  1S2E A;  4FPL A;  4XDQ A;  1U0A A;  3FLP A;  2YU2 A;  4YYO A;  1ULG A;  5L73 A;  4L0P A;  1SAC A;  4NII A;  3T3Y A;  3WNO A;  1UW8 A;  5CIS A;  1LOB A;  1QQP 2;  5B4X A;  1PZ9 A;  2D6M A;  2Q8D A;  5LBB A;  2DYC A;  2FQP A;  3MEP A;  4DOU A;  1R08 1;  2DTY A;  2HJI A;  4IE4 A;  2JD9 A;  1QJY 3;  1RHI 2;  2O1Q A;  3ZFE B;  4BJ0 A;  3E6C C;  2GC0 A;  3PU8 A;  2F4P A;  1CPN A;  4CU6 A;  4E4Z A;  1JOB A;  4YM0 A;  1MVE A;  1LKN A;  4LKD A;  1Z0H A;  1GNZ A;  3A7Q A;  4BQY A;  1F4H A;  1U5X A;  4LPL A;  4LBM A;  2A3W A;  1W9Y A;  4B4P A;  5LK7 B;  1W8U A;  1N3O A;  4Y1Y A;  4R9C A;  3JCI A;  5KC5 A;  1GWL A;  1CAX B;  4NPM A;  3USS A;  2ZGR A;  5C7G A;  1KS4 A;  1UCX A;  5DDJ 3;  2EXI A;  5FKB A;  4FQZ A;  1FMD 3;  1G6N A;  1BEV 3;  2WZR 3;  3I3M A;  5J09 A;  2QQO A;  3VHR A;  3T1L A;  1CAV A;  2B39 A;  3VD3 A;  3OPW A;  2RG4 A;  4B7E A;  2GP3 A;  4NHX A;  2WUH A;  1AL0 G;  4CDW C;  5EJ1 B;  1TME 3;  4L97 A;  2ARC A;  3RPQ A;  3OG2 A;  4F83 A;  4XBQ A;  5C6C A;  3OPZ A;  4PIY A;  2OXB A;  5A7N A;  3RMY A;  3VZN A;  3OY8 A;  2GDF A;  2UWB A;  4LE3 A;  1C4R A;  4N53 C;  4OHY A;  4WVM A;  3NNF A;  2VZO A;  2ZCW A;  4URT A;  1K5M B;  1XNA A;  1RUJ 2;  3HN1 A;  3ZXG A;  4CEW A;  2C1F A;  3RZK A;  5LZ6 A;  1OLQ A;  2X8K A;  1FOD 1;  1QOS A;  5DUV A;  2DBI A;  1C5I A;  2ARX A;  3GBW A;  4IEW A;  3EYP A;  4LHK A;  1ODM A;  1WZX A;  1XNT A;  1UIK A;  3FFQ A;  4COW A;  3MI8 A;  5FLH A;  2BGC A;  2DVG A;  3L9J T;  3NV2 A;  1JZ2 A;  4OMD A;  4QX3 A;  4XFI A;  4GJZ A;  4IE5 A;  1O4T A;  2WNV C;  4E4D X;  2DCJ A;  4EJR A;  1KFX L;  3BI3 A;  3P3N A;  4CCD A;  2J1A A;  4IV3 B;  2J1E A;  2WT2 A;  4D3W A;  3VDB A;  2JE7 A;  5FKC A;  4COY A;  5LA0 A;  1UYY A;  3AXD A;  4A2U A;  4ASM B;  3O1R A;  1JZ8 A;  1GFF 2;  5LAT A;  2ZMN A;  1MQT B;  1GU3 A;  2BFU L;  3NW4 A;  5F5I A;  4AI0 A;  4CDQ C;  3JBG 2;  4CCL A;  1QJE A;  2WQ8 A;  4R9D A;  3VBU B;  4XAC A;  2WZ8 A;  5T55 A;  1UD1 A;  2GC3 A;  4AFC A;  3ES4 A;  5A80 A;  1STM A;  2CWM A;  3QD6 A;  2XJS A;  1BVV A;  3BU7 A;  2C9K A;  3ETQ A;  5F32 A;  3T0B A;  1K45 A;  1PO1 3;  2PLV 1;  2WFF 3;  3K4D A;  5GLU A;  4WVW A;  5LBC A;  1G9A A;  4LE4 A;  1VB4 A;  5BNN B;  4Y22 B;  1WCU A;  1W6P A;  5FRA A;  3OGR A;  2JG9 B;  4ERO A;  3WF2 A;  1S0I A;  2DCY A;  5FY0 A;  1O91 A;  1D4M 1;  5IVV A;  3FLT A;  2Z79 A;  2WYF A;  2YC4 A;  5I0U A;  1XC6 A;  1E5S A;  3AX4 A;  1QJY 2;  4CDU B;  2W3J A;  3SCH A;  3K2O A;  5LA9 A;  4AL9 A;  2EXJ A;  1F2N A;  2QBX A;  4XFG A;  4CEY B;  1X9T A;  5FPU A;  2A6X A;  5CFC C;  5J3U A;  2ZGT A;  4GQ7 A;  1UU6 A;  3LZZ A;  3ZSJ A;  4IET A;  5LB6 A;  4JC1 A;  5JUV A;  4DZG A;  4L92 A;  4Y3O A;  3VB9 A;  4QHB A;  1RED A;  4XF0 A;  1EY2 A;  1GP4 A;  5FBZ A;  1I9R A;  1AL2 1;  4PDW C;  4CYD A;  1VPH A;  2RR1 1;  5HCA A;  1WWY A;  4FAH A;  3K48 A;  3KCY A;  4AGV A;  1LOC A;  3POG A;  4ET7 A;  3HNB M;  3UES A;  5DDJ 2;  2YV8 A;  2B46 X;  3CJI A;  3NNG A;  4WM7 C;  3R6S A;  4AZZ A;  1BEV 2;  1H1M A;  1WUV A;  2WZR 2;  3KT7 A;  5FUP A;  4IDZ A;  2VOV A;  5FXW A;  1CJP A;  2ZBJ A;  2VZT A;  1UZW A;  1S0J A;  3PL0 A;  4YG6 A;  5FP8 A;  5LY2 A;  4S2G A;  2YBP A;  4DNY A;  1D2S A;  2A6Y A;  4Z8B A;  3KVA A;  1TME 2;  1GUI A;  1J3Q A;  2EIG A;  2NLR A;  4U36 A;  3HN3 A;  4Y5S A;  5KXE A;  2HWE 1;  4U2A A;  1Y3T A;  4NIG A;  5FQ0 A;  5JSO A;  4IV1 C;  1Q5O A;  1ND3 B;  1JZ6 A;  3OSD A;  3IDE A;  4CP2 A;  4KNC A;  4PLM A;  4R52 A;  4QHO A;  2CGO A;  1LNS A;  5GLZ A;  3QLQ A;  4QPI B;  1CN1 A;  1M06 G;  1S2K A;  4Y24 A;  1V6J A;  4LBQ B;  2ZAC A;  4OUE A;  1VBA 3;  2DV9 A;  3E6B A;  2WC2 A;  5IAV A;  1ALY A;  4MGK E;  2RM2 3;  3S5A A;  3WF0 A;  3WW1 A;  2B4K A;  1MS4 A;  2WYS A;  3GAL A;  5E16 A;  3B5L B;  5FO8 B;  1GQP A;  2CDO A;  2RJK A;  4CRQ A;  1ONA A;  3T2O A;  3UGG A;  3POF A;  1XQN A;  4JHZ A;  4Y5Z 0;  2Q1Z B;  5LEK A;  3AZZ A;  2VZP A;  4CUG A;  5JXH A;  1TE1 B;  2BER A;  4OHV A;  2IVJ A;  2YC2 A;  3AYC A;  5JCT A;  4FPG A;  2ADD A;  4LJH A;  1AR9 3;  4IGO A;  4UOJ A;  5EXO A;  5BPX A;  4YZ4 A;  3U75 A;  4BQX A;  2W52 A;  5IAT A;  4EN7 B;  1U5I A;  2Y6J A;  1VIW B;  4I01 A;  3VKL A;  1RUI 1;  1B09 A;  2D40 A;  2LUW A;  5CA6 A;  1IOA A;  4DXR A;  3WNM A;  5I0R A;  1WBF A;  2NYY A;  4KWU A;  3ZO0 B;  4WM8 C;  4A6S A;  4HVQ A;  1CAU B;  1MZ6 A;  2K9Z A;  2VNR A;  3AL6 A;  4D7S A;  4NRO A;  4MX3 A;  1DU3 D;  1J83 A;  1QJU 3;  3DEM A;  1SMV A;  3AZV A;  3LSE A;  2P34 A;  2XDV A;  1PO1 2;  5EPA A;  2QQU A;  3HEI A;  4YFZ A;  2D5H A;  2PAE A;  2WFF 2;  1KDK A;  3ME2 A;  4GKY A;  4NO4 A;  4P9G A;  1YI9 A;  1H8V A;  3BOW A;  4UFI A;  5I0S A;  4NE9 A;  4O7X A;  3OUI A;  4AHZ A;  5A3P A;  3LD8 A;  3TAY A;  5FYU A;  5D8A A;  2E33 A;  2QQK A;  2UY8 A;  3AXE A;  3WNL A;  4B1M A;  3VBR C;  2HWF 1;  1YFY A;  1C8N A;  3MO4 A;  1ND2 B;  3H9A A;  4HOO A;  2EAL A;  1CAV B;  1BJQ A;  1W3V A;  3HVD A;  1RVF 3;  4UW4 A;  5ERL A;  1X7N A;  5KC6 A;  1CR7 A;  3L2Y A;  1UL9 A;  4JTN A;  1NUK A;  2WRA A;  5FXZ A;  2VBD A;  4X8N A;  4B4R A;  2V4V A;  4H3W A;  3J7H A;  4MVT A;  2VMD A;  3UJO A;  1OF4 A;  4IXL A;  1SCS A;  4LKS A;  4QGM A;  3I2O A;  1NY7 2;  3M7A A;  1JUI A;  3OY8 B;  4HKW A;  1Y4W A;  4RD7 A;  5A3T A;  1LOF C;  1WME A;  4B8E A;  4WVM B;  1GNH A;  1NKG A;  4RFT 0;  2RJ2 A;  1LHO A;  2XVL A;  3LCP A;  4BA6 A;  1VRH 3;  1G86 A;  4LEJ A;  1DQ2 A;  3N7L A;  2BGO A;  5FV3 A;  3JB8 A;  3AKP A;  2ZS6 B;  4Q4X 1;  4XAE A;  2R16 A;  2WS9 1;  5C3Q A;  1XU1 A;  3NL1 A;  1W99 A;  5G05 L;  4AGR A;  1AXZ A;  4FFG A;  1MAC A;  4JV4 A;  2BUK A;  2VTX J;  4AQS A;  1HKD A;  3POB A;  1WW4 A;  2VZR A;  3OTF A;  5F5A A;  2Y26 A;  3VKM A;  2VR4 A;  1PX3 A;  2CTV A;  2SLI A;  1AR7 3;  2HH9 A;  4YZ2 A;  4GXL A;  5JIU A;  4RQP B;  3O1T A;  1OLM E;  4QGL A;  1DQ6 A;  1DQ0 A;  4YVW A;  4JKK A;  4YGC A;  2OII A;  2DF7 A;  3EHK A;  4XFA A;  5FY4 A;  3WHT A;  3KSC A;  3VBO C;  5EJ3 A;  4Z2A A;  2VBP A;  2QQP A;  4NID A;  1MS3 A;  3NO8 A;  4ZY9 A;  3OEA A;  2ZGM A;  2WAO A;  1UMZ A;  1VBA 2;  3J9S A;  1J84 A;  4FPF A;  1LGC A;  1MEC 1;  4IEY A;  4Q4V 3;  4LOR A;  3SH4 A;  5C5T A;  2RM2 2;  5BNO C;  3RZM A;  2ZAA A;  4NN0 A;  4HSJ A;  1QJF A;  1CX4 A;  1PZ8 A;  4UWD A;  3T30 A;  4AI2 A;  4E8C A;  3ZDV A;  4E9K A;  1MS9 A;  1KQR A;  1IS4 A;  1VE0 A;  3AL5 A;  3D0S A;  3GHN A;  4CP0 A;  1S0D A;  3A22 A;  4UF0 A;  1W0P A;  4KBZ A;  3T4V A;  4P9W A;  2HWC 1;  5CZK A;  3LFM A;  2J1U A;  5ACA 3;  1GIC A;  3D8C A;  1BXH A;  4BCU A;  5LWB A;  1YIF A;  4TSV A;  5FYS A;  3PVO A;  5JZG C;  4XQD A;  2B42 B;  4MGS A;  3TEY A;  2NP0 A;  1AR9 2;  2VNV A;  5JPN B;  5JXJ A;  1ZBE 3;  3ZDS A;  2AAC A;  1W6P B;  2WII B;  2EA7 A;  3HQU A;  5FK8 A;  2YXS A;  2R1D A;  2CAU A;  3LSD A;  4H14 A;  5IAX A;  5A7W A;  3MYX A;  3ACG A;  3PU3 A;  2QVS B;  4XJU A;  5A7S A;  5DZG A;  1NCQ B;  2CNA A;  3C8X A;  5AC9 3;  1J1L A;  1ULC A;  1QF3 A;  3Q8A A;  3T2Q A;  1LHU A;  1U5Z A;  3ZFE C;  5A33 A;  1VBC 1;  2HBT A;  2D6K A;  4HLT A;  1Q8S A;  2K0G A;  3ZYJ B;  2ZGN A;  1QJU 2;  4Q4W 3;  1RUE 3;  2ORZ A;  1S0G A;  4XW3 A;  2B9U A;  1UZZ A;  2R07 1;  1FPN 1;  3RRD A;  2XPJ A;  1LR5 A;  3RQ0 A;  2L9L A;  2VUC A;  2R04 1;  2TEP A;  2W91 A;  1W2N A;  4MUV A;  1GWM A;  2VUA A;  3RNS A;  5IK4 A;  3KV4 A;  4FOY A;  4QDR A;  5FAX A;  4H7L A;  3WQ7 A;  3MW3 A;  2W1Q A;  2VEC A;  4XJW A;  2VO5 A;  3AMQ A;  4AOC A;  4MG2 A;  2RMU 1;  4JRL A;  5DMY A;  1EPZ A;  2TNF A;  3KMH A;  3WDV A;  4G4F A;  3VBS A;  3AMH A;  4UXA A;  3ELN A;  5FZ3 A;  5DG1 A;  1EV1 3;  1WCD J;  4RSU A;  2AH2 A;  4LUM A;  3AKT A;  4BE3 A;  2E63 A;  3WQ0 A;  1ZM1 A;  1QHD A;  5K9Y A;  1DZT A;  1JHN A;  2NMN A;  3AVR A;  3C7F A;  3CLP A;  4WBB A;  2IC1 A;  1U5Y A;  3KF5 A;  1PIV 3;  3IT8 A;  5A3N A;  3MIG A;  5CKN A;  4E2Q A;  1SLI A;  5FQ0 B;  4XQW A;  1BHG A;  3E5U A;  4KG8 A;  3RVH A;  1RUN A;  5FBJ A;  4BLI A;  4I09 A;  5FZ0 A;  1VRH 2;  2Q5T A;  3U11 A;  2EIB A;  4CCM A;  4FAG A;  1K5M C;  2BW8 A;  3C7G A;  2AEY A;  2BNO A;  3CDZ B;  5FP9 A;  5K8S A;  5APA A;  3H1W A;  3P3P A;  4DUV A;  2ZAH A;  3GXU A;  1WA4 A;  1O4Y A;  4HG6 B;  5GLV A;  2Y6K A;  1NYW A;  4O9G A;  5L9V A;  4CXY A;  3PUQ A;  3GCW A;  5JR7 B;  1HRI 3;  3WD5 A;  3WP4 A;  2JKX A;  4XDP A;  4B1L A;  2XB6 C;  2ZA9 A;  3WDW A;  2UY9 A;  1AR7 2;  1YNA A;  3UYJ A;  2FDH A;  1QGL A;  4R9A A;  1UZ0 A;  2JB4 A;  2PHF A;  1W8F A;  2VQA A;  2W39 A;  4IV3 C;  4D69 A;  1I5P A;  3BB6 A;  1H4G A;  1VBE 1;  5F8P A;  1PGL 2;  3O5S A;  4RHV 1;  1SCR A;  4UFK A;  4R4X A;  1RMU 3;  1MQT C;  4Q4V 2;  1NQJ A;  3VL8 A;  4FBF A;  4AW7 A;  2XQX A;  4LR4 A;  4JX0 A;  4DXS A;  5JSR A;  2O14 A;  2PHD A;  3WUC A;  3WV6 A;  4LXL A;  5FXX A;  2N7G A;  3LIH A;  4FPC A;  5FZC A;  2PA7 A;  3ILN A;  4M4P A;  3GYD A;  4DY5 A;  3MF6 A;  3UK9 A;  5ACA 2;  1LU2 A;  4GMP 3;  1Y9G A;  4XET A;  4WVV A;  4I02 A;  1V0A A;  1HQW A;  2R6Q A;  3I49 A;  1K42 A;  1FYU A;  2RDN A;  1Y7B A;  3LIG A;  1AHS A;  4C0B A;  5BNN C;  5FOJ B;  4B4Q A;  1GKB A;  3ZPY A;  1AVB A;  2VW1 A;  3S7I A;  1QJX 3;  1QXJ A;  2X10 A;  4PHZ A;  3KB5 A;  4IEX A;  1ST8 A;  1W8N A;  5D8A B;  1PNG A;  5DAQ A;  1UX7 A;  3APB A;  1RB8 G;  3R4D B;  3JZV A;  5AC9 2;  4CDU C;  4CEY C;  3A4U A;  3ZFF A;  3AKQ A;  4QX8 A;  3RYR A;  1ENX A;  4A6O A;  5E8A A;  2ZAB A;  3K46 A;  3LF7 A;  4OI0 A;  4Q4W 2;  1RUE 2;  1W6N A;  1AYM 1;  1NLR A;  1OOP B;  1TNF A;  2WDB A;  2WIN B;  1I6X A;  3GZT B;  4K40 A;  1ULD A;  4DXZ A;  1F8V A;  1PK6 A;  5BNQ A;  4XYX A;  5EV7 A;  4JZR A;  5K0U A;  1CIW A;  1ZBA 1;  1YFX A;  3CF6 E;  3CQO A;  1AX1 A;  4XJA A;  1KS5 A;  4C90 A;  1NX9 A;  4XMA A;  1SEF A;  4FPY A;  5JVV A;  2GND A;  3AYD A;  3I3D A;  3J7N A;  5C3O A;  4BXF A;  2VTF A;  1AF9 A;  3EJK A;  4HKO A;  1LJ7 A;  1D2Q A;  4MOA A;  1US2 A;  2VOW A;  2WSU A;  4O61 A;  3BTY A;  4MHU A;  4N43 C;  3MIH A;  2DU1 A;  1UZY A;  5CFD A;  4QAW A;  1UOB A;  3MLL A;  4Y4R A;  4QQO A;  1PIV 2;  5CBL A;  4LK6 A;  1ZZ6 A;  2EIC A;  2WWU A;  4YVW B;  3J8F 3;  1ND3 C;  2VZ3 A;  2W9X A;  3ES1 A;  3WW4 A;  3BTX A;  4FOQ A;  3ACI A;  1O8P A;  3I4I A;  2WR9 A;  3ACH A;  1F15 A;  4FVV A;  4QPI C;  2QTW B;  3P5B A;  4AHY A;  4EZ4 A;  3EBR A;  4QXH A;  1N1V A;  3RWK X;  2WLQ A;  1R09 1;  3ASI A;  4L9B A;  4LO7 A;  3U10 A;  2DVF A;  4FPJ A;  3WOG A;  1POV 1;  1DGR N;  4OHX A;  4UF0 B;  3CHX A;  4HXC A;  2IXC A;  4QDS A;  1HRI 2;  2ZZJ A;  2BVB A;  3HQX A;  3ZMN A;  3BAL A;  3O1O A;  1DCS A;  2RS5 3;  1XPW A;  4XBL A;  2B45 X;  4QKF A;  1XE7 A;  1HJF A;  2Q8C A;  5J37 A;  1ACC A;  1RUF 1;  4XCB A;  1VMJ A;  4FPH A;  5I8T A;  1XND A;  2Y6F A;  2LAL A;  4LO4 B;  1XNB A;  3IMN A;  5E6H A;  2Y0I A;  3AKR A;  5A7W B;  1RMU 2;  3N9P A;  3PDQ A;  3WLU A;  4OI2 A;  1W9W A;  1N3Q A;  1YUD A;  2W08 A;  1W2U A;  1WW5 A;  4LKF A;  3JUU A;  5FZL A;  5A33 B;  4UW5 A;  3VD5 A;  1YI7 A;  1OH4 A;  2VZV A;  3W5N A;  5LEJ A;  5L9R A;  3S0M A;  2QQN A;  4W6W A;  2W1S A;  2VM9 A;  2XJU A;  3ZFG A;  2MHF A;  2ZGP A;  1OI6 A;  5BV6 A;  2CHH A;  3AZY A;  5CB7 A;  3VZL A;  4Q8K A;  4WZC A;  1DZQ A;  5LK5 A;  1QJX 2;  1HXS 1;  3SNM A;  1WD3 A;  2HWD 3;  3Q8C A;  4NRM A;  4LO8 A;  3MID A;  1GP5 A;  1VBB 3;  1OH3 A;  5T5O A;  2WSV A;  3VBS B;  3CU7 A;  4M3C F;  1UMI A;  2RJL A;  1BQP A;  1HRV 3;  1LOG A;  2ZEW A;  4ZXE A;  1ND2 C;  1ODN A;  5J7M A;  4GIQ A;  4P14 A;  2ZGU A;  4W4Z A;  1HV0 A;  3NRU A;  3KV6 A;  2Y38 A;  4MO3 M;  3PTR B;  1ULE A;  3FBM A;  3ZXK A;  4LUL A;  5C8C B;  4JGY A;  5A6Q A;  4A44 A;  2IVI B;  2LTN A;  1RTV A;  4CXW A;  3AM2 A;  5T54 A;  1YRZ A;  4CCC A;  3I97 A;  4V2V A;  5FFO C;  2E7A A;  3AJY A;  5A6X A;  1LRH A;  4ITC A;  1BCX A;  1S0C A;  3K77 A;  4JDM A;  1ENQ A;  4UAP A;  1TNR A;  3AZX A;  4ASL A;  2W46 A;  2VME A;  4NHM A;  4AQ2 A;  5DZF A;  4AEK A;  4COU A;  1POQ A;  2A75 A;  5F7U A;  3QH7 A;  3WY6 A;  4QPG A;  5CAD A;  4JKM A;  4A41 A;  3B9I A;  5HI0 A;  2XJV A;  2PQQ A;  3O0X A;  1JOP A;  1CD3 G;  3VZK A;  1V00 A;  2JDK A;  4KWK A;  1H1A A;  2G9G A;  3H42 B;  3OGJ A;  4H7M A;  4ONU A;  4P08 A;  4Y4Y A;  3S5Q A;  4RQP C;  3K4A A;  2BU9 A;  2WA4 A;  2WAA A;  2WNO A;  3J8F 2;  1D4M 3;  2O8Q A;  1NOV A;  3BIW E;  3ZKU A;  3DPR A;  4HKL A;  5DAP A;  3WEZ A;  1G7Y A;  3FJS A;  4Q27 A;  5IJR A;  1Q8O A;  2PAK A;  2VW2 A;  5AVP A;  5FJK A;  4OQ9 A;  4OCT A;  3WW3 A;  3WNK A;  3ZXJ A;  1UN1 A;  2FHR A;  2P37 A;  3UKN A;  3GZA A;  3VDC A;  1PGW 2;  3K51 A;  2P3Y A;  2CWS A;  2MEV 1;  2HBU A;  5EYY A;  4GB3 3;  2YG0 A;  3KZ4 C;  5DQ0 A;  4XUR A;  1ZX5 A;  2XLF A;  3Q8E A;  4NAM A;  1SBE A;  1AR6 3;  3CJX A;  2R7E B;  2JIC A;  2J1T A;  4YM3 A;  2GMP A;  3H7J A;  1K3I A;  2RS5 2;  2WO3 A;  2RR1 3;  1AYN 1;  2YGM A;  3I2H A;  2R30 A;  3CO2 A;  5H9R A;  2W5F A;  2R32 A;  1GWK A;  1QDC A;  3AVS A;  1RXG A;  3QCW A;  4OHZ A;  3WNP A;  1L3J A;  2WO7 A;  4BM8 A;  3RZG A;  3MPB A;  5A3L A;  2WZP P;  3RS6 A;  1NCQ C;  4RR3 A;  1AX0 A;  5AFB A;  5LW9 A;  2RDQ A;  2ZX1 A;  4YSF A;  4HN0 A;  4YW5 A;  2PHX A;  2VC9 A;  3H50 A;  2DFB A;  4IER A;  3KHC A;  1NA1 A;  2OT7 A;  4PQ9 A;  3NQH A;  1YJK A;  2HWE 3;  4PI0 A;  3VLB B;  2VAU A;  2ZTN A;  5CAZ A;  4BH9 A;  1BKZ A;  3M70 A;  4XF1 A;  4BIS A;  1W6N B;  1A8D A;  3ZYB A;  4Y1Z A;  4ZKT B;  5HXM A;  1GZW A;  4M0N A;  3DV8 A;  5D21 A;  4IEQ A;  3RSJ A;  1RUG 1;  5E89 A;  4DS0 A;  4X8P A;  1WGP A;  1QH6 A;  4QQ2 A;  3UJQ A;  4LIT A;  2ORX A;  2XGX A;  3O0V A;  5FMO S;  4TXW A;  5F3C A;  2HWD 2;  4EN0 A;  5M0T A;  3NJZ A;  1YFU A;  1VBB 2;  4UFJ A;  1H1I A;  1AX2 A;  3AYA A;  3O12 A;  5BXX A;  1HRV 2;  2DUO A;  3MBW A;  3WP6 A;  1O6U A;  2VW0 A;  4ORF A;  5FO7 B;  3R05 A;  1IQD C;  2XBO 1;  3WCR A;  2A3X A;  4QM9 A;  1SFN A;  3OBZ A;  3ZXL A;  1BBT 3;  4AVA A;  5JIA A;  1UY3 A;  4CUA A;  2JDH A;  5BYN A;  5CFD B;  5I8Y A;  3O1M A;  2VMF A;  2WQZ C;  2JDY A;  3MLK A;  3VHP A;  4KGG A;  2JG8 A;  1AR8 1;  3NJY A;  5JDB A;  1EAH 1;  4K8R B;  4D94 A;  4P9L A;  3TN9 3;  2WNE A;  4LHS A;  4KMQ A;  5C9A A;  4KBB A;  5I0D A;  3ROU A;  2H0B A;  2J1V A;  2UU8 A;  5FZO A;  4LK7 A;  2OQ6 A;  2DUR A;  1PO2 1;  2RS3 1;  5JPM B;  2Z2S B;  1TVG A;  2O0O A;  2QUO A;  1GYK A;  4DRV A;  3AP9 A;  5FMB A;  1OHF A;  3VL9 A;  3JD7 1;  2K46 A;  1N1T A;  2PHW A;  2I2S A;  1W8H A;  5F2S A;  3VBF B;  3WNX A;  1QQP 1;  4S2D A;  2PQS A;  1XOY A;  4QHZ A;  3PME A;  4KU8 A;  2PHT A;  4OI1 A;  4L2N A;  2ZJC A;  1PM7 A;  4JQT A;  4QU2 A;  4QQL A;  4CU8 A;  5F3G A;  3MF9 A;  4P5Y A;  1RHI 1;  1D4M 2;  3VBH A;  4A4A A;  3VDD A;  5JOZ A;  3S57 A;  1VMH A;  4HPK A;  3LE0 A;  3VZJ A;  3N4M A;  1XYN A;  4CPB D;  3EQE A;  3KCC A;  1S55 A;  5L36 A;  3ZLI A;  4AFD A;  2TBV A;  3BVC A;  2CY6 A;  1CIY A;  4NMI A;  4BYY A;  4I3G A;  2F4L A;  4FTE A;  2P6C A;  4A3Z A;  2GC1 A;  4A3X A;  4GB3 2;  5FMC A;  1IQA A;  2QJV A;  2B5H A;  2XG3 A;  1PZ7 A;  3LDK A;  4YPJ A;  2QQI A;  1BVP 1;  5GZC A;  3AMN A;  5HV0 A;  1AR6 2;  1GZC A;  4RS5 A;  2CAV A;  1B35 A;  4PI2 A;  2VMC A;  3FL7 A;  5A3M A;  5J48 A;  4YW7 A;  1JMU B;  4HBN A;  3ITQ A;  5EFU A;  2ID4 A;  4ARY A;  2E26 A;  4AHW A;  2RR1 2;  1D4V B;  3T09 A;  1LOD A;  4MLO A;  4YVS A;  2JEM A;  4CZS A;  1WKY A;  4ARX A;  5KHJ A;  1A6C A;  4Q26 A;  2WS9 3;  3LOI A;  1XYP A;  4XJ8 A;  1E5I A;  3RJ2 X;  3ZR6 A;  4JRA A;  3ZN4 A;  3MIC A;  3ON7 A;  3I2F A;  5D8A C;  3BTZ A;  4Q4Y 3;  1CVN A;  5LAS A;  2ZHM A;  4NOT A;  5E88 A;  2WA3 A;  4Y20 A;  5C4W A;  3N7J A;  3AFG A;  3I59 A;  3LEM A;  3OF1 A;  3FFZ A;  4AFB A;  2HWE 2;  2DCK A;  2VTX A;  4QGN A;  4YZ3 A;  1WMD A;  2XLA A;  1HB4 A;  1OOP C;  4NUB A;  2DCZ A;  5H9P A;  1RUJ 1;  2RV9 A;  3F95 A;  3T0A A;  1IS3 A;  4FO9 A;  1V70 A;  1IPJ A;  1VAM A;  2XH6 A;  5DAB A;  1UXZ A;  4JKL A;  3BN6 A;  3T2T A;  1MEC 3;  4UYB A;  1RUH 1;  1OUR A;  3INA A;  2WFP A;  4NVP A;  5KHG A;  2H0V A;  1F5F A;  2VNG A;  2CSG A;  3FZ3 A;  2LM3 A;  5HPO A;  5BNP A;  4LUK A;  3GGL A;  2HWC 3;  3DUI A;  2VGD A;  2Q0A A;  3I3B A;  4PT6 A;  4XTP A;  5FLJ A;  4QPG B;  2W2I A;  4GD4 A;  5FY5 A;  4D0Q A;  4OUL A;  3Q8F A;  2E32 A;  1FMD 2;  4DPN A;  1YQ5 A;  1JYX A;  2JDZ A;  4HVO A;  2PTM A;  1BBT 2;  1DDL A;  1S0E A;  5A32 A;  2X5I A;  3K4Z A;  1WLW A;  5FLI A;  3WVJ A;  4AE2 A;  1LOE A;  5IK8 A;  4Y26 A;  4YVW C;  3TBD A;  1AJK A;  3QBQ A;  1MS5 A;  3UET A;  1UF2 C;  4FPO B;  2VVF A;  4KWJ A;  3DPR B;  4PLN A;  3NST A;  2KM2 A;  3TN9 2;  1AXY A;  5A6Z A;  4XF3 A;  1IG0 A;  3POJ A;  4AVB A;  4NPL A;  2LS6 A;  1DQ5 A;  3R4U A;  4JGZ A;  1SDD B;  1HJG A;  1LED A;  3DXU A;  2B9V A;  2VZU A;  2Q8O A;  1QEX A;  4LHL A;  1JN2 P;  5C8W A;  2R07 3;  1FPN 3;  1YQ8 A;  1W8O A;  4CP9 B;  2XHN A;  5FZ8 A;  1Z7S 1;  2D6N A;  2QQJ A;  4HZF A;  4RGG A;  3S30 A;  5GZD A;  1SFP A;  1YEW A;  4LO6 B;  2GU9 A;  1W2T A;  3LDB A;  4MYE A;  5J36 A;  2HYK A;  5EJZ B;  2DWR A;  4ATF A;  2HWB 3;  1QJY 1;  4CDW A;  2OZJ A;  4OLL A;  5FZF A;  2ADE A;  5FYZ A;  1SBD A;  5FP3 A;  4OZX A;  3OBR A;  4R4Z A;  2RE9 A;  4LIU A;  4L99 A;  2BOJ A;  5KBF A;  4COV A;  1XXN A;  2BQP A;  1OVP A;  1WCQ A;  1DLL A;  4AG4 A;  1IGO A;  3H8O A;  4YM1 A;  4YWA A;  3S6P A;  1NA1 B;  2FZ1 A;  2QE3 A;  3CL1 A;  1TEI A;  3IAQ A;  1X9P A;  3KGL A;  4P5H A;  4QX1 A;  4GZ9 A;  4UI9 L;  4XJ9 A;  2YBK A;  3III A;  3ZMO A;  1GZW B;  1KFU L;  1SG3 A;  4UBG A;  5DDJ 1;  1XNC A;  1UXX X;  2FDI A;  1BEV 1;  5DUW A;  3VKF C;  2WS9 2;  1E5R A;  2R0F A;  3A21 A;  3TRS B;  5C5U A;  5FOB B;  5IT6 A;  4EN9 B;  3OB8 A;  5FPX A;  1W04 A;  1WCS A;  4Q2F A;  1TME 1;  2YRO A;  1WA6 X;  4Q4Y 2;  3HT2 A;  3VBS C;  5T5L A;  4Q0V A;  1FT9 A;  1E57 A;  1KD7 A;  4B7K A;  1XYO A;  4XAB A;  1OQE A;  3N9M A;  5I0T A;  3KD4 A;  2DTW A;  2BEO A;  5C8C C;  1C5H A;  1YJL A;  3HBK A;  3IDB B;  1JI6 A;  2ILM A;  4FOV A;  1VBE 3;  4GWN A;  1XSR A;  5C70 A;  1MEC 2;  2ZKN A;  4EZH A;  2R49 A;  2Q4S A;  3SC7 X;  2XLG A;  2DU0 A;  2YMZ A;  4LIV A;  4NAO A;  1OPM A;  3Q9O A;  1H8T A;  1I5Z A;  4GH4 A;  5FZ4 A;  4BB3 A;  5H9Q A;  2OUH A;  4N90 A;  2JKB A;  1LHW A;  2P4E A;  5A6Y A;  1UU5 A;  4N9I A;  5IUQ A;  1KJR A;  1D7P M;  4QB2 A;  2CGP A;  3NKG A;  4W6Y A;  1UYZ A;  2XWB B;  4YAR A;  1LEC A;  4XFH A;  4CEW B;  3VD7 A;  2Y34 A;  3M3E A;  1UY2 A;  1ENS A;  1V9U 3;  4XEZ A;  3RWN A;  1JBC A;  2P6H A;  5FYY A;  3UNP A;  1JS9 A;  1W0N A;  2DFC A;  2G9F A;  2J7M A;  4GJY A;  3WCS A;  4YFW A;  5ABJ A;  5CFC A;  4FP3 A;  2VH9 A;  3M2M A;  4TN7 A;  3CKH A;  3ZN6 A;  1XSQ A;  2GH2 A;  2WKK A;  4J1X A;  5A3U A;  3VBH B;  4JHT A;  5FY7 A;  1VP6 A;  3VDD B;  3ZKY A;  3D6E A;  3LAG A;  4BU2 A;  4HON A;  4K21 A;  3VDA A;  1H4H A;  4E27 A;  4LBL A;  4QX0 A;  4IUG A;  2GC2 A;  2ZGS A;  4AED A;  1KJL A;  4K6B A;  3AKS A;  4NR1 A;  5FP7 A;  2X29 A;  1PO1 1;  2R07 2;  1SLT A;  2WFF 1;  2C26 A;  1FPN 2;  3KLS A;  3RJR A;  3SCG A;  2G4I A;  4AFA A;  4RS5 B;  3G6J B;  1SBF A;  3NV4 A;  4XFF A;  4NHY A;  3CZU A;  4CDX C;  1V6N A;  4FFI A;  4QMA A;  4XUO A;  3HT1 A;  2OZ6 A;  2PHR A;  3USU A;  1ZBA 3;  5F5C A;  3U1X A;  1S4C A;  4YVS B;  2BWA A;  2HWB 2;  3U4S A;  1YLL A;  3MPP G;  1W06 A;  2Z5W A;  4MXW A;  1DP0 A;  3WNN A;  2XKO A;  1NCR A;  5FY9 A;  1HIX A;  4S2F A;  4EE2 A;  1IHM A;  1JU4 A;  1UY4 A;  3HOB A;  4OMC A;  5T5J A;  1FXZ A;  1W03 A;  5FPL A;  2WT1 A;  4Y20 B;  5C4W B;  1JYT A;  1NY7 1;  2AUY A;  2WBK A;  4QKB A;  2XUE A;  4Y1V A;  5FDB A;  3SEP A;  2VPV A;  2E6V A;  1CX1 A;  2WAB A;  3VZM A;  2Y6G A;  3IMM A;  4P02 B;  2GNM A;  1FAY A;  4LKE A;  1DF0 A;  2YFU A;  3H8U A;  4LHN A;  3LPF A;  2R06 1;  1DZR A;  3KQR A;  3ORJ A;  1YQC A;  3PUI A;  1TZO A;  5AVA A;  5T3N A;  1OF3 A;  2D6P A;  1V6O A;  5A7O A;  4AI1 A;  1ZNP A;  5CIR A;  4PIX A;  3B3Q E;  4O9E A;  5C33 A;  2VUL A;  3ECQ A;  1IKQ A;  5J96 B;  1YXW A;  3K75 B;  5FCC A;  1N47 A;  1POV 3;  2X05 A;  5BY5 A;  1BYH A;  1XB9 A;  2YZ4 A;  5BNP B;  3GCX A;  4QPW A;  2Q1F A;  1COV 1;  3CJI B;  3OGS A;  1JYC A;  3JQW A;  3MUY 1;  1JYI A;  4AEM A;  5CFD C;  1LB2 A;  2QQL A;  5A32 B;  1HV1 A;  4JTO A;  2X5I B;  5FYV A;  5F9T A;  4UFL A;  5IFP A;  1RVF 2;  1PHM A;  1VBD 1;  2QQM A;  3R0R A;  2BJS A;  1VBE 2;  3HR9 A;  4HK8 A;  3ZN5 A;  1AZD A;  2RM2 1;  2ZHN A;  1D0G A;  2QFE A;  2W95 A;  5JMO A;  1L7L A;  1UMH A;  1POV 0;  4QX5 A;  2VNO A;  3ILF A;  1ZRI A;  4Y1U A;  5FPV A;  3NKT A;  3ZR5 A;  1O7F A;  2VCB A;  4JGZ B;  1BMV 2;  5F5Q A;  1W8T A;  2AGS A;  3P1I A;  4TLG A;  2XUM A;  2P3K A;  4MZU A;  4ZXK A;  3MV1 1;  4XFB A;  5FYM A;  1CZT A;  2GNT A;  2VVE A;  4JCK A;  1AR9 1;  1W6O A;  3PTY A;  2ZGQ A;  2PXJ A;  4ATE A;  1CQ9 A;  1J3R A;  3IPV A;  4NRP A;  3E5X A;  1R1A 3;  4DIN B;  5CG8 A;  1XE0 A;  3KGZ A;  1RUC 3;  1V9U 2;  1WD4 A;  2YB7 A;  2ZHK A;  3VBR A;  2ZOE B;  3VBF C;  5JSP A;  5LBF A;  4QM8 A;  3PJY A;  3WXP A;  1GMM A;  4S2H A;  3O1S A;  4FI9 A;  5SV8 A;  5FZH A;  4CDW B;  4EYU A;  5B4N A;  5KXB A;  1T6G C;  1TMF 1;  1IS6 A;  4XCA A;  4LLO A;  1K5J A;  2Q8E A;  3WG2 A;  2YDE A;  4IEV A;  1IPS A;  3PMS A;  5FUI A;  4IE0 A;  1KXG A;  2OX0 A;  1ASJ 1;  1QJU 1;  3HQR A;  1C8M 1;  1HN1 A;  1YWK A;  2XJT A;  4KGQ A;  5FY8 A;  1OKO A;  3ZX7 A;  3MW2 A;  1JXN A;  1OLM A;  1PVC 3;  3GBG A;  1K12 A;  1OA4 A;  2RS1 3;  4XIL A;  1RXF A;  4K8F A;  2ZEX A;  2A3Y A;  3MW4 A;  1SFY A;  2D3P A;  3AP4 A;  1UAI A;  2WWJ A;  1JYV A;  4TWT A;  3VBU C;  5GM0 A;  5LY1 A;  4Z92 B;  2VXR A;  3MHZ A;  1XJA A;  4GWJ A;  1ZBA 2;  1QMJ A;  2Y8K A;  4FXK B;  1QOT A;  1KEX A;  3WP3 A;  2G1M A;  4IQP A;  2D44 A;  1OXC A;  3WDT A;  1MPX A;  1ZBE 2;  2ZHL A;  3MIB A;  2QZ3 A;  4MAD A;  4YLZ A;  2JG9 C;  5FZM A;  3ZYR A;  3T08 A;  1MZE A;  2E51 A;  4FXG B;  3ZSK A;  3V0B A;  3O1V A;  4A7Z A;  3B7M A;  3BGA A;  3POI A;  2Q30 A;  1OPO A;  3GM8 A;  3QAC A;  2E9Q A;  3IB3 A;  3AYE A;  1MR5 A;  2ZMK A;  4XE9 A;  5BNO A;  1OA2 A;  2BYV E;  5LCW L;  2FD8 A;  1VRH 1;  5LBE A;  5IK7 A;  2XXZ A;  4BQ3 A;  3ZM8 A;  5FTT C;  4JVA A;  4YW4 A;  3POW A;  4Q0Q A;  1IPK A;  5EHD A;  4J1W A;  2E7Q A;  2Y6L A;  2XJP A;  3PIG A;  1H8T B;  4GH4 B;  5JZG A;  4TYS A;  3AP5 A;  4AAX A;  5IVF A;  5HV4 A;  1AR7 1;  3WR0 A;  2XVG A;  1O3Q A;  4OYU A;  2GNB A;  2WN2 A;  2UWA A;  1Y9M A;  4NPR A;  4QPG C;  4CTE A;  4YG0 A;  3POS A;  4M3C E;  5JOY A;  4AWD A;  1EV1 2;  4PF5 A;  3U37 A;  2GN3 A;  2IXH A;  1XRU A;  3PLQ A;  5A1A A;  5IVB A;  3D82 A;  2VQT A;  3CZJ A;  3ZFE A;  3QH6 A;  4KU7 A;  1Q8Q A;  5ABJ B;  3A0K A;  3BCW A;  1UU4 A;  1BK1 A;  4Q4V 1;  3RG0 A;  2J22 A;  5CFC B;  3ZN6 B;  1H9P A;  5KR7 A;  3W59 A;  2GSY A;  3TNQ A;  4XTM A;  1FV2 A;  1X82 A;  3DPR C;  4QX7 A;  4CA9 A;  3ZOI A;  1CJD A;  3NAP A;  1ZYB A;  3GF6 A;  1R08 3;  4ISR A;  3LEG A;  2OPW A;  5ACA 1;  2KD7 A;  4AED B;  2H6B A;  1V6M A;  5L7O A;  3T0D A;  5F3E A;  1OFN A;  1CAX A;  1ZA7 A;  4QKN A;  1CWP A;  2BNN A;  1O59 A;  2H6C A;  2GH8 A;  2MNG A;  4N9H A;  2FDK A;  1R1A 2;  1RIT A;  1RUC 2;  4IGP A;  4GAL A;  4JDO A;  2NQY A;  4AI9 A;  3BU0 A;  3USU B;  4DMI A;  4Z1V A;  1QKQ A;  3W9A A;  3H3Z A;  1IKP A;  1KGY A;  1ULP A;  2WT0 A;  3LEI A;  1QXP A;  5AC9 1;  2J1R A;  2C5D A;  2QQV A;  4DB5 A;  4MXW B;  1W6M A;  2VQ0 A;  1GZT A;  5CKM A;  5EIY B;  2YU1 A;  3BPZ A;  1NCR B;  1GZ9 A;  2B8M A;  2XBO 3;  3H8R A;  1RUE 1;  2J42 A;  2QNK A;  4Q29 A;  4GWM A;  1PVC 2;  2BVV A;  2JXA A;  3J4U H;  3MDP A;  1RUD 1;  1V6L A;  1ZZC A;  4IEU A;  5JAX A;  1D0H A;  2RS1 2;  4Q1R A;  2PEL A;  1H0B A;  1AR8 3;  3O1P A;  4EN6 B;  1DGW A;  4XUT A;  1XNK A;  2X53 S;  3ZXE A;  3RYP A;  3DGT A;  2P5B A;  2XJR A;  3C7H A;  4PF1 A;  4FCA A;  5CVR A;  2XWJ B;  1LGB A;  1HQL A;  3WW2 A;  5DUX A;  1OVS A;  2D6L X;  3HD8 B;  3DL3 A;  2VOK A;  4IE7 A;  5JXG A;  3ZYI B;  3D0J A;  3ZXD A;  1GP6 A;  1L7Q A;  1LUL A;  1XE8 A;  1N1Y A;  4D6Q A;  2Z4F A;  1UWW A;  2LRP A;  2IUW A;  5A1F A;  3JD7 3;  3HIF A;  2IFR A;  1FOD 3;  5DN2 A;  4FTS A;  1QNY A;  3WP5 A;  1NZI A;  1LES A;  5C3R A;  1MQT A;  1QJZ A;  2QKD A;  3EO6 A;  4QB6 A;  1Q43 A;  2P1B A;  5GZF A;  4P9I A;  4XOG A;  3MIE A;  1F5J A;  1N1S A;  4CXX A;  2GAL A;  1W8W A;  2DUQ A;  1JZ5 A;  4KI5 M;  2IXK A;  1RUO A;  5FYC A;  3DXT A;  4ES8 A;  1KRI A;  3VKO A;  1OUX A;  1SLC A;  3WQB A;  5HCB A;  2X09 A;  5IK5 A;  2PYT A;  4BDV B;  3RZZ A;  4FFH A;  1F9K A;  1OT5 A;  1Q8P A;  4AK3 A;  2XL7 A;  5C71 A;  3I2J A;  2P3I A;  3OUH A;  3AP6 A;  1YO8 A;  4M01 A;  4MXV A;  4Y33 A;  3B94 A;  5SV5 A;  5GLT A;  5B2G B;  3EXU A;  4PBO A;  1W6O B;  3MFC A;  4LBJ A;  2R0H A;  3UV9 A;  3IPV B;  1QH7 A;  4CEW C;  2YPD A;  4L11 A;  4BLJ A;  2JDU A;  4IL7 A;  5FZD A;  1JYN A;  3N7K A;  3HMY A;  3UGF A;  4AVT A;  1EYB A;  4RYD A;  3VV1 A;  2FBE A;  2PLV 3;  1RMU 1;  4J6G A;  3PJQ A;  2A71 A;  5DAW A;  4CPB A;  4M3C A;  1OLR A;  4C8D A;  3POY A;  3NNJ A;  3VBH C;  4LOS A;  3VDD C;  2J1S A;  1GOF A;  3KWV A;  1JZ3 A;  3O14 A;  4XHX A;  3W5M A;  4RA0 A;  1US3 A;  1R08 2;  1H2N A;  5A7P A;  4CUB A;  4WZF A;  2XJQ A;  3O1U A;  4AQT A;  4XZP A;  1WCK A;  4GMP 1;  2W87 A;  5FMD A;  3WQ1 A;  1CON A;  2OW4 A;  4W50 A;  1UYX A;  3PVN A;  4BK4 A;  5FYT A;  2BBV A;  1UZV A;  2V72 A;  1NE4 A;  3FC0 A;  2CL2 A;  4XZU G;  4QWN A;  4E4S A;  2A6V A;  5F37 A;  1NAE A;  4Y1X A;  1PMJ X;  3H8X A;  1MS1 A;  4YZ1 A;  4BIO A;  3HNY M;  1J58 A;  2JIG A;  1GQG A;  2IXL A;  1RUH 3;  1JTZ X;  4XFC A;  2OKX A;  1W9F A;  1I3H A;  1YQ6 A;  4NIH A;  2ZX4 A;  4N43 A;  4YVS C;  3IKW A;  4B3N A;  5HXV A;  1AL2 3;  3PNA A;  4E4H A;  2V5Y A;  4Z07 A;  3MZH A;  3PVB B;  4IND A;  4XQ4 A;  1RGS A;  5FY1 A;  4GA9 A;  4LA2 A;  5FP4 A;  3V0B B;  4MHR A;  2W1U A;  4BMB A;  3E5Q A;  1ZA4 A;  4K1Y A;  5FYB A;  2VE1 A;  1PMH X;  3T1M A;  3B02 A;  2A1X A;  5IWF A;  1AR8 2;  3ZFF B;  2KA3 A;  1Y9Q A;  3I2I A;  3ZSL A;  3D4K A;  3GJB A;  2OQ7 A;  5ANQ A;  1W2A X;  2VQU A;  1RL3 A;  1JOD A;  2PHL A;  2EXK A;  1W05 A;  5FPZ A;  3WHU A;  2VY0 A;  1RJ7 A;  2ZXQ A;  4DXT A;  2VZS A;  2BTV C;  5FZG A;  1PK6 B;  2YPJ A;  5BNP C;  1C1F A;  1Z7S 3;  5K0U B;  4D7T A;  3JD7 2;  4OVE A;  5ISL A;  4IGQ A;  2ERF A;  1FOD 2;  2JJ6 A;  3WF3 A;  1V6I A;  2JX9 A;  3VHN A;  2YHJ A;  3CJI C;  3J8F 1;  1MZF A; 
#chains in the Genus database with same CATH homology
 5HCH A;  2WRA A;  2VUD A;  1OXC A;  2VUC A;  3DCQ A;  2BP6 A;  2WR9 A;  2VNV A;  2JDN A;  2JDU A;  1W8H A;  2JDH A;  2BV4 A;  4AOC A;  2JDM A;  2JDY A;  5A6Z A;  5D2A A;  2BOI A;  2XR4 A;  2JDK A;  1UQX A;  1OUR A;  5A6Y A;  5A6Q A;  1OUS A;  1OUX A;  2BOJ A;  5A3O A;  1OVS A;  1OVP A;  4UT5 A;  3ZDV A;  2CHH A;  5A6X A;  5A70 A;  1GZT A;  2JDP A;  1W8F A;  1UZV A;  4CE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...