2BOIA

1.1a structure of chromobacterium violaceum lectin cv2l in complex with alpha-methyl-fucoside
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
AQQGVFTLPARINFGVTVLVNSAATQHVEIFVDNEPRAAFSGVGTGDNNLGTKVINSGSGNVRVQITANGRQSDLVSSQLVLANKLNLAVVGSEDGTDMDYNDSIVILNWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords CV-IIL LECTIN
publication title Unusual Entropy Driven Affinity of Chromobacter Violaceum Lectin Cv-Iil Towards Fucose and Mannose
pubmed doi rcsb
source organism Chromobacterium violaceum
total genus 24
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2boiA00
5A3OA 5A6XA 2JDPA 2JDMA 4UT5A 1UZVA 1OXCA 5A6YA 1GZTA 2VUDA 3DCQA 2JDHA 2BV4A 4AOCA 5A70A 1OURA 5A6QA 4CE8A 1UQXA 2XR4A 1W8HA 1OVPA 5A6ZA 2VNVA 1OUSA 2CHHA 1W8FA 2JDKA 2BOJA 3ZDVA 2VUCA 5HCHA 2JDNA 2JDUA 2WR9A 1OUXA 2BP6A 2BOIA 2WRAA 5D2AA 1OVSA 2JDYA
chains in the Genus database with same CATH superfamily
3VD3A 5LA1A 5A3WA 2WUHA 3VUOA 3VBFC 2BBAA 3AP9A 1H8VA 3E6BA 1S4CA 2WZ8A 3ZFGB 2C24A 2VD7A 1ASJ2 1H8TA 1SFYA 2HBUA 3OPZA 3VDCA 5H9RA 5FXZA 4IEQA 1CX4A 3IIAA 5FYVA 2XQRA 4FOQA 3T0AA 4CU9A 1C4RA 5T5OA 4HPKA 5A1AA 2XR4A 2ILMA 5C3RA 1KD7A 1PVC3 5CFDC 5LY1A 1YCIA 3BOWA 3NVCA 3TYJA 2XKOA 1OF3A 1O5LA 4YGDA 2A6VA 2VUCA 3NAPB 2CGPA 2VZOA 2D6OX 3H1MA 2ZGRA 4ONUA 2YHJA 1VBC1 2TEPA 3SH5A 4LXLA 1RUE1 3AMPA 2BUKA 1IS5A 4R4XA 3WUDA 3D6EA 1ENRA 3MFAA 4IDZA 1Z0HA 5A7OA 1SLIA 1QJU3 5IHRA 4DO0A 5FP7A 3WF2A 3O1OA 1OFSA 4FP3A 1NYWA 4LBMA 2CNAA 4QX1A 5T52A 4QQPA 2P3IA 5DAVA 2XDVA 3UESA 2UY8A 2Y6LA 4OI2A 4HMZA 3RYPA 4GB33 4UW5A 3B9CA 3OBAA 5JPMB 3LDBA 2HEWF 4H7LA 4RYDA 4OHZA 2PLV3 2C0ZA 3MPPG 4JAAA 4RFT0 4DXTA 2NZ9A 3HIFA 4P08A 3TNQA 4A41A 2A70A 5C9AB 4LK7A 1CAVB 5ANQA 5F39A 1O6UA 4NHMA 4YYOA 5JXIA 2BWAA 4META 2W39A 3RDIA 5I91A 3V0BB 4MXVA 1AVBA 4COVA 4QDRA 1PIV2 3BGAA 5EPAA 2DVGA 3AXEA 3D3AA 3MIBA 2GNTA 2VMDA 4QGMA 4CDWB 1W9TA 2QQUA 1W28A 2V72A 1LEDA 2OZJA 1B35A 1RJ7A 1EAH2 4QPYA 5EWSA 5IVCA 4AAPA 2EF6A 5FY9A 4YVWB 2ZGPA 4RQPB 1OURA 1HN0A 1OOPA 2PMWB 3KF5A 5FXXA 1F8VA 1VMFA 4B29A 4BIOA 2E7TA 3BIWE 1WCQA 3FFZA 4C0BA 4WZFA 2D6LX 4BXSV 3UGGA 4MGTA 4NIGA 2E33A 3VBSA 1OH3A 1HV1A 2FDJA 2YY1A 4EE2A 5CKNA 3LIGA 1COV1 4GWIA 1XC6A 1U5XA 5H9PA 5FIXA 2AC1A 3TN92 5BUVA 1Q8VA 3TEWA 3UKTA 1S2BA 2XBO2 2XVKA 1GV9A 3B5LB 4GWJA 2RS53 3KQ4B 4LR4A 2OZ6A 4Q2FA 3INAA 3K4ZA 1PO21 1R64A 2X53S 2ZGKA 5IK5A 3NJXA 4LKFA 1RUD1 3KV5A 4CEWB 1E5RA 1RXFA 1HB3A 3FHAA 4CP9A 4WM7B 1BK1A 1BHGA 1UZZA 3FUOA 1UAIA 4Q4V3 4JKMA 5JLVA 4XAAA 4LO4B 1D4M1 1HXS1 1OUSA 1XOYA 1GQPA 3ASIA 2PHUA 3LA2A 1D4VB 4W6YA 5FPLA 4AK3A 5J1XA 5ABJB 5J09A 2CAUA 2GN7A 2YGMA 4GKXA 2VY0A 5IAXA 1OHFA 1YFYA 3GZAA 5JAXA 3CJIC 4OUSA 5JSOA 4QPGA 3DPRC 1HV0A 4U2AA 4Y24A 1OBNA 2QQMA 4LE3A 3ZXGA 4GH4C 1X8EA 3I2FA 4XUTA 3HT2A 1VAKA 4LORA 1HJFA 4PQQA 5FV3A 5FZMA 4QX2A 4E4DX 5JOZA 2XJQA 3H9AA 1NOVA 2ARXA 2V5YA 3N9MA 3GALA 3KCXA 2Y0IA 1POV0 1QDCA 2QQLA 4OUMA 5LASA 3RNSA 1KFXL 4CDXB 3PIGA 3WDVA 4KNCA 3OY8A 2XJVA 2EAKA 5FREA 4H2AA 4M3CA 5L9BA 1UY1A 2QQOA 3PUQA 3U11A 3ENRA 5FLHA 2AEZA 1IQDC 4DFSA 1Q8QA 3MW3A 3ZIXA 4XJ9A 4Y33A 1XNAA 4QXHA 2GC1A 2XONA 2FDKA 4BLJA 1TVGA 2V73A 2WNVC 4B1MA 1QY4A 1PZ9A 2Y33A 5HCFA 2OYZA 5KR7A 1JZ6A 1CESA 2XLAA 4CCLA 4AHWA 5AVPA 5FMOS 2VZPA 5DG1A 5L73A 2Y8KA 1TME1 4KU8A 4KGGA 1G8WA 2R49A 1PO13 2BVBA 3WP3A 1I5ZA 1E5IA 1AJOA 1NA1A 2JXAA 3PHMA 5K0UC 2DCKA 1F5JA 2DWRA 3NL1A 2Q8OA 2A3WA 2IXCA 1CZTA 1S0FA 1MZFA 1UY0A 3AZZA 4MXWA 1ZRCA 4AVCA 5EIYB 3JBG1 1O4TA 3ME2A 4CDQB 1BVVA 2LUWA 1HKDA 5FYBA 5D8AC 3CU7A 2ZA9A 1CAXB 1R083 1HIXA 1BEV2 1QHDA 3OG2A 3USUA 3M7AA 3NJZA 1POV3 4FOYA 2ZAHA 4JGYA 3MF6A 1U5IA 1APNA 1ZVFA 4HLTA 2ZAAA 5FKBA 3DYMA 4F8AA 3RZJA 2WSVA 4QKDA 2HWF2 1OI6A 2YC4A 1RUE3 3SNMA 2WRAA 1OKQA 1ZZ7A 2LS6A 1OQDA 1R1A2 2D43A 1DDLA 5LW9A 3ZXEA 2RS33 1EUUA 1HX6A 2YBPA 4LIUA 2WT0A 2QTWB 2GMEA 3VBFA 5C33A 1RUI2 1OA4A 2A6WA 4QB1A 3KCYA 4ZU4A 1PZ8A 2W0XA 1K45A 3C7EA 3DL3A 1QJFA 3ILRA 3VBUB 3VZMA 2WBKA 4A7YA 4NROA 2ZTNA 4Y1YA 5FQ0B 2VZUA 3M1HA 3BPSA 4IV1B 1XBFA 4IUGA 4LLFA 4XDQA 5CFDA 3KZ4C 2VBPA 1NKGA 4MO3M 4NN0A 5I8YA 4QXKA 1Y9MA 5CFCB 2YC0A 3W59A 4XF1A 1W8TA 3O12A 3IAPA 1QDOA 2BOIA 4IGOA 5FZIA 1LU1A 2FQPA 1UYYA 1RXGA 2WO1A 3WHTA 1AR82 4O61A 3RZGA 4E9KA 3SEPA 1O59A 5A6YA 3AYDA 4JX0A 1VBD2 1NCQC 1AUYA 1PMIA 1QMJA 2XJPA 5C70A 3O1UA 1H8TB 5A1LA 4DY3A 3BU0A 3CDZB 4FPGA 2DCZA 2W1WA 3LOIA 4HPKB 2OS2A 2PQQA 1WZXA 2R042 2FDGA 3J8F3 3POIA 1LNSA 2FD8A 4R8HA 2X5IC 5FK8A 4BZ4A 2ZZJA 1IPKA 2JD4A 2WZEA 1G9DA 3ACGA 1UPSA 2DVBA 4EN9B 4CUAA 2ZXQA 4MADA 1RUD3 4DOUA 5BNQA 2JKXA 1AR72 1X7NA 2BZDA 2I74A 4E8DA 3I49A 4Y1VA 1SCRA 1MS4A 3AB0A 1D4M3 1HXS3 2OUHA 3KCCA 1EP0A 4I30A 1UWWA 1SHWB 2LTNA 4H14A 4XFIA 1XYOA 2P5BA 2VW1A 5GM0A 1SZBA 2ZABA 3OGGA 5C4WC 4Z92B 4NWVA 2WIIB 2ZGSA 2DVAA 4RHV1 3T1MA 1JZ7A 3ZYGA 5CG8A 5CKQA 3C8XA 5FOJB 5K8SA 4ZS2A 1ACCA 2VXRA 3UKVA 3MYXA 2GDFA 3M3EA 1RUG1 3ZKYA 4OUEA 2J1SA 4AVVA 2XPJA 1DIWA 3ZSLA 4FAGA 4FFHA 5TSWA 4FTEA 1L7LA 3IPVA 3KF3A 1B35B 4V2VA 5DDJ1 2J7MA 3ZYFA 1M4WA 1PNGA 3VDDA 5EQUA 1TNFA 3S6PA 2C6SA 1OOPB 4A7KA 1RJ8A 1XE0A 3O14A 4I09A 1XQNA 2J1RA 3W58A 3UK9A 5DAPA 3NMBA 4AGRA 4JDOA 1TME3 3VBSB 4FFIA 2ZX4A 1NZCA 1VP6A 3ACLA 4QQ2A 1YFXA 5APAA 1WLCA 3LEGA 3DPRA 3O0WA 5FXVA 1H2LA 2E7QA 5A32A 2WFF2 4FXKB 2ID4A 3SKVA 5CYYA 3S5QA 1WUVA 2XXZA 4CP9B 1WKYA 2VC9A 1R1ZA 1XNDA 5G04L 4CPBA 3KD4A 1AR62 1UOJA 5LA2A 4N7UA 3ZMNA 2ZEXA 3NV1A 4LHSA 5DMYA 1ZREA 5FY8A 2YDEA 1J1LA 1YJLA 3HQUA 3PURA 3NKGA 2WR9A 2HWC1 2PN5A 3AP6A 4IEZA 4QHZA 4XVHA 4QPGB 5FBZA 1ASJ1 1AR93 2E31A 4CCNA 2D40A 4CXXA 2QFEA 3POSA 2X29A 2DCJA 1PGSA 4LE4A 4E4ZA 5K0UA 4B8EA 3RFRA 1FV2A 3O1TA 1U5ZA 1HRI1 1JZ3A 1PGL1 3V56A 3OY8B 1LOEA 4FPLA 4K9SA 4M3CB 1FX5A 1GR3A 1MR5A 2DU1A 3MLJA 2V5DA 4N53C 3BU7A 5A6QA 2ZGTA 3N7LA 5D8AA 4C1WA 2WABA 4LPLA 3AFKA 5E88A 3ES4A 2Q1FA 3FJSA 4P02B 1VRBA 1PHMA 3VGIA 5JOWA 1BXHA 1ULOA 1Y43B 2CTVA 4M0HA 3WCSA 2R063 5CU1A 1AYN2 3B3QE 5KXDA 1ODNA 3OUJA 1PM7A 2VZ1A 3LKJA 4TLGA 1WBFA 1ZBE1 3GBFA 4R9AA 3CL1A 2E6VA 3PJQA 1REFA 2NN8A 2FZ2A 3J7MA 4N43C 1NA1B 4FTSA 1XYPA 1ZBA3 2HWB3 2OXBA 3I8TA 3SCGA 3N9QA 3MPBA 1W8WA 3HN3A 4MXWB 2DBNA 3ZFFA 1L3JA 4LHNA 1RB8G 1VBA1 1REEA 2YZ4A 3AVSA 4QB6A 5J36A 1D0HA 5A3UA 4ASMB 5DUXA 2J1EA 1YI9A 2XVGA 4I3GA 3N9LA 4KQ7A 3MHZA 3USUB 3AXDA 1DZRA 3SLIA 4MVTA 4LBLA 4JGYB 3ZYHA 3ZDVA 4NRQA 4Y4RA 4LKSA 4TWTA 1NY71 2RR11 3N7JA 5EJZB 2C9AA 3WT3A 4YZ5A 4P9GA 5JXGA 3RVHA 2WLPA 2VNGA 5L7OC 2EIDA 5F32A 3DECA 3J26N 4HBNA 1AL23 2ZHKA 5E6HA 5FZOA 2G9FA 3WP4A 1F15A 4BYYA 3O1SA 1SDWA 1GICA 3E5QA 3O7OA 4BQYA 2DVDA 5FY1A 3J8F2 3VKFC 3O1MA 1E57A 4RL7A 1JYCA 2IXHA 1WA4A 3PMSA 1YJKA 4WBBA 4YNIA 3VBFB 2JX9A 1JOJA 5L36A 3POYA 2EXKA 1NCQA 1TEIA 5A33A 4D8MA 2D6MA 3JD71 4XZPA 2HKXA 3TN91 4YZ1A 4I01A 5JSPA 4W6XA 1O3RA 4PDWB 5FMCA 1UIJA 2XJTA 1OSGA 3O1PA 4DRRA 1BBT3 5CFDB 3AJYA 4RHV3 4FBFA 3SCHA 3SMHA 3LB9A 4UFIA 1N1YA 2GU9A 2JDAA 2JECA 1YNAA 2FBEA 5A7SA 5A70A 1IKQA 2RM22 2WWJA 5K4LA 5JXJA 1NLRA 4AFBA 2VW0A 3ZOIA 5LATA 3KLSA 3O0XA 4NRMA 4PF1A 1TZOA 4Q4X2 3ZFEC 2OA2A 4EN7B 2PHDA 4URAA 3JB4C 3I2OA 1QXRA 4NAMA 4D7TA 4DMIA 5DDJ3 1JYTA 1GBGA 3WDTA 4DQAA 1AYM3 4AF9A 5FZDA 2RJLA 1PX4A 3PMEA 3H3ZA 4EQVA 3J7NA 3UV9A 1OC1A 4MGYE 1I1EA 3OPTA 5FP8A 4CXWA 1R092 4XXAA 4M00A 2ZX0A 2ARBA 3GZUC 4FPOB 5J98B 4XYXA 1ZRFA 4K1ZA 4BQ4A 5KHGA 3AP7A 2VW2A 4AXOA 5FZ0A 1MEC1 2W2IA 3WNXA 1ZA7A 1WGPA 3AM2A 2DCTA 2DF7A 1DU3D 1OXCA 1OD3A 3JB8A 5IW0A 2Y6GA 3ZVXA 1QQP1 2OPKA 4L99A 3T2OA 3M70A 5AC93 4FOWA 2AR6A 1OLME 5SV5A 3KVBA 2BBVA 4PIYA 2XB6C 5C7GA 1NZIA 1UU4A 4CP2A 1DGWA 1VB4A 4NRPA 4NIAA 4EN0A 3MBWA 3OUHA 5FZAA 4Q29A 4LUKA 2P3JA 5IVVA 4ZPIA 1FT9A 3ZSKA 4ISRA 1L7QA 2VNRA 4AVTA 4CDUA 1ASJ3 1UCXA 3JXSA 3WW1A 2BFUS 2PA7A 4CCCA 4LKDA 3WEZA 1RUH2 4P9XA 1I3HA 1PGW2 4MUVA 1NCRC 3IDAA 3LFIA 1UL9A 4XACA 4BB3A 5KHKA 1BEV1 2C1FA 4NE9A 4TYSA 3RRDA 1MS5A 1ZX5A 1N1SA 3QOPA 2J1VA 3U0ZA 2JE9A 5LBCA 5ACA2 3GXUA 2JG8A 2Q8CA 2AUYA 3GBGA 3R4DB 1RUJ2 2AH2A 2B7YA 2YV8A 4Y3OA 3VDDB 4YW2A 1M06G 5JMOA 4TN7A 5DUUA 1W8FA 1R1A1 1HB2A 1Q5OA 3E6DA 2C26A 2DYCA 4CUGA 1QNYA 3IDCB 2JWPA 2H0BA 4MGQA 1Y9GA 1PMHX 1SLLA 1YO8A 2KR2A 1C5HA 4KWLA 3WXPA 3DPRB 1YEWA 1QJZA 3B00A 2KXLA 3KS7A 1WCKA 5KC5A 1VPHA 4HVRA 2IXJA 3VHRA 5A32B 4COUA 2WO2A 3RQ0A 2VBBA 4JHZA 4EWDA 2BGOA 4PI0A 5F2SA 4FAHA 4OYUA 1A3KA 4I0AA 3R6SA 2XUMA 3NJYA 3J7HA 5C3QA 1ZBA2 4GB31 5LK5A 2HWB2 4NIIA 3VDAA 2ATFA 1PIV3 3BIEA 3HWJA 3A23A 3KWVA 3NJVA 3P6BA 5EHDA 2ARCA 1OKOA 4JZRA 2NPIA 3KGLA 1EAH3 2VBDA 4D69A 4XHBA 3ON7A 4H55A 1POQA 2EA7A 3LEKA 4NPLA 1CONA 3WQ0A 3VZLA 2ZHLA 4F83A 3EXUA 4QQHA 3ZYPA 4CEYC 3POEA 5K0UB 3DCQA 4YLZA 5JZGA 5KXEA 4UYBA 2XQXA 1IHMA 2PHTA 4ZU5A 5AFEA 4UAPA 3CZUA 4BH9A 4EN6B 4FPCA 1MS3A 1W8HA 2XBO3 2OKXA 1HB4A 3D0JA 4N90A 1VBE2 5D8AB 1WD4A 2Z2SB 1AX2A 2BRTA 3ZYIB 3EBRA 3K4DA 4MOAA 2UURA 3OUIA 4NHLA 5EJ1B 2WA3A 4YM3A 2VO5A 2JDZA 4PCRA 3C7HA 3LGRA 3ZSEA 1DQ4A 2WSUA 3URFA 3WF4A 3WV6A 2IXLA 2E51A 5L7OA 2ZPXA 1J3PA 1W6PA 3GM8A 2JIJA 3N9NA 4Y5Z0 1KEXA 1LESA 3LFMA 5A3TA 4AGVA 2CAVA 1OA2A 3AMMA 2ZHMA 3T4HB 4RN5A 4NHYA 4A45A 2B8MA 4JHTA 3E5XA 4CU8A 1C28A 3BTZA 1MS1A 3ZFFB 1V6JA 3AKRA 2GMPA 2A6XA 5DQ0A 1U5YA 4H3WA 2YXSA 3TNPB 1OPOA 4L11A 5A6ZA 1LGBA 4AWDA 3H8XA 4NAOA 1S0IA 5G05L 3JCIA 2P6HA 2VECA 4OMCA 2QQIA 2W1QA 1GOHA 1C57A 1CAWA 3E97A 3PTYA 4Y4YA 2P1BA 5GLWA 5J48A 3TBDA 3LEIA 4AR2A 3POBA 3F95A 4MGIE 1NT0A 1H4HA 3IN9A 3I2HA 3DXUA 4PF5A 3PUSA 1LOAA 3PVBB 2QQKA 2R0FA 3IDBB 2ZS6B 4QT6A 4K20A 1SPPA 1TMF2 4FI9A 4HOOA 1F4AA 5GZDA 1IPSA 3Q8CA 4XF4A 3HNYM 3ZXFA 3HD8B 2BNOA 2ZKLA 1G9CA 3OB8A 4YVSC 4UI9L 4KL1A 1NCQB 1GZWA 1H1IA 2AEYA 4HXCA 3SXWA 5A33B 1VIWB 5GZEA 4EWEA 3ILNA 5B2GB 4YW6A 1YIFA 3AMQA 3PVOA 2RDQA 3WDWA 2WFF1 4XIKA 4C1XA 3TEZA 1JU4A 1WMXA 3VKLA 2VGDA 4RGAA 1ND3C 4QGLA 4ZKTB 1PO11 3LF7A 2B42B 5LEJA 1BEV3 1F31A 2XHNA 4BIFA 5LZ6A 1J3QA 3I97A 4MX3A 5DAQA 2EIEA 2E32A 4FT8A 4UW6A 4AI1A 4RA0A 2D6KA 1CWPA 1PK6B 2HWF3 4JGZA 1FPN2 4JRAA 3BCWA 3DKQA 2OUJA 3JU9A 1R081 1ZZ6A 2GC2A 3S7EA 2CDOA 1R1A3 2O8QA 1W8OA 2R1BA 3ZIWA 1POV1 1BJQA 1MVEA 2Z42A 3OJBA 1JOBA 2C5DA 4JVAA 4PLOA 4BLIA 1RUI3 4HK8A 3WSOA 4YM2A 3VKOA 1MVQA 5A1FA 5GALA 4UWDA 3OEAA 1OVSA 3VDBA 1W0NA 1X82A 4LMFA 1T6GC 1LODA 5AVAA 2R0HA 2MEV2 1H1MA 2DFCA 2CY6A 2BERA 4MZUA 3LSDA 2RS31 2JENA 3R0RA 3JZVA 4QPIC 1QJY2 3VB9A 4OI0A 1WW4A 1G9BA 1AYN1 4K3UA 5DZEA 5T55A 5BNOC 5EXOA 1ZA4A 5FZEA 3SITA 1QJX2 1O7FA 2QQNA 2SLIA 1AR83 1UY4A 2N7GA 1TNRA 4UW3A 1IS6A 4YG0A 1NQDA 1ZZ9A 2GN3A 2GP5A 1VBD3 4ZXEA 1CZVA 4D6RA 5LCWL 4OVEA 5CVRA 5D2AA 2WZR2 1W2UA 4CDUB 4E2SA 5JPNB 3AJZA 4LOTA 3ZSJA 5I0SA 1YFWA 3F2ZA 3WDYA 1JYIA 1MQTA 2QQWA 3RYKA 2R043 2A71A 1V6LA 2MHFA 2UWBA 3T08A 2XHKA 3J9SA 2D7FA 3OGRA 4M4PA 5F5AA 3VBRC 3L2HA 4GIQA 2JG8B 1YQ6A 1XRUA 3NSTA 5FFOC 1GNZA 1OLMA 2BNMA 2LRPA 1AX1A 4YM0A 2W1SA 4AQTA 5SV8A 1OA3A 3D5OA 3J8F1 1W2OA 3ZYJB 2QUOA 1AR73 4CRQA 5KHJA 1S0JA 2VZSA 2ADEA 2O0OA 3Q8BA 2QDNA 4I0BA 2QJVA 1LKNA 3C2UA 3NNGA 5C3SA 5EV7A 2I2SA 3RGBA 3TEYA 1RUC2 4FQZA 4P14A 3RPQA 1X9TA 1JUHA 3H7JA 2GH2A 5LBBA 4IQPA 1EY2A 3IAQA 5FYUA 1W9YA 4XFAA 3FUQA 5FBJA 1HRV2 1W99A 4M4RA 2ZKNA 1QWRA 4XUNA 1MACA 4LO5B 5F37A 1KFUL 5BNNC 2RM21 4CTEA 1O91A 4AI9A 4FSJA 3FL7A 3SCFA 5FYSA 4Q8KA 1O3SA 2F6BA 1W8ZA 2ZMKA 3GYDA 4Q4X1 5IVYA 1W3XA 3EJKA 2GNBA 4FFFA 3BPZA 3HEIA 2E53A 2VNOA 4AEDC 3U07A 1RC6A 5T3NA 4I02A 1S1AA 2D93A 3HOBA 1R091 1SDDB 4JKLA 5A7PA 3ZPYA 1W2NA 2BTVC 2UU8A 5JZGB 1GFF2 3RWNA 4WV8A 2Q8EA 2VXJA 4L9BA 1DLLA 4RD7A 4YWAA 3RMYA 4AFMA 3VZNA 5C8CA 2ZGQA 5H9SA 3ECQA 4UFHA 1Z7S3 4CYDA 3W5MA 1SBDA 3AL5A 2WFF3 2OX0A 2YB7A 2ZMLA 3BTXA 5FUIA 3A7QA 4CPBD 2BDRA 1GYKA 1YQ2A 3UGFA 3THDA 4XURA 4BDVB 1S2EA 3CLPA 5GKAC 3SH3A 4AVSA 1B09A 3BN6A 3HNMA 3K3OA 5I0UA 4YZ4A 3UYJA 2BYVE 4DNYA 5I8TA 1AR63 4QX3A 3VD5A 5L7OB 2FCUA 2WNEA 1C3HA 1QXJA 2JDMA 4MHRA 5BY5A 3THTA 4AW7A 4QQOA 1KRIA 3POWA 1G7YA 3H7YA 5F8PA 5JR2A 1DZTA 5HI0A 1J83A 2BV4A 4B4PA 1IZ3A 3VBOC 3WHUA 1JN2P 3HN1A 4XOGA 5L9RA 2VVFA 5GJ6A 1RUH1 2YUEA 1XSQA 1KDMA 3RG0A 4AI8A 4QX7A 2W87A 2WZPP 5HCHA 1Y7BA 2PHRA 3OF1A 3FE5A 5A3PA 1BCXA 2FDIA 4BPZA 4LBOA 1CAWB 2GALA 5IVBA 5KHHA 2WT2A 4ARYA 2V4AA 2J42A 2P37A 1AR91 5GZCA 1Z78A 1VRH3 2WL1A 2QBXA 5HCAA 4IV3C 1DQ5A 3FBMA 4Q8LA 3U75A 1ZRDA 4W65A 1XPWA 2D97A 1LENA 1AYN3 1XU2A 2ORZA 3IMMA 3KV4A 2CWMA 3WUCA 1G9AA 1NX9A 4XTPA 2FZ1A 4IEXA 2CGOA 1U12A 3I2KA 2P4EA 5FPAA 1GZWB 4OULA 4AHZA 4HK9A 1X9PA 2BQPA 4BISA 2WC2A 5FZ7A 5K9YA 1J1TA 1RTVA 2XL7A 4DUWA 5A80A 2R061 2XG3A 4WVMA 1V6OA 1NUKA 4K1YA 3C3VA 4Q26A 1FYUA 1HB1A 2R072 5JDBA 2VM9A 4XW3A 5DZGA 5BPXA 5IVEA 1PX3A 4XJWA 1ZBA1 2CWSA 2VCBA 2HWB1 3C7GA 5FZCA 3AKTA 4R9CA 3HT1A 3IB3A 2XH6A 2VOXA 4JGZB 4AFDA 4QPIA 1DGWX 4HG6B 1G9FA 2B45X 3BKZA 1F5FA 1W6OA 2D6NA 5JIAA 1QOTA 4QM8A 1BMV2 5FZ8A 3I59A 3B7MA 2TNFA 2W91A 2HH9A 1LEMA 2QDRA 3KB5A 2B5HA 4LBQA 1KJLA 1AL21 3VLBB 5FZGA 5FY5A 4QX8A 5CNAA 4CP1A 4XJUA 3VHNA 4ES8A 2EIGA 3FN9A 1AF9A 2GSYA 5CZKA 3GCWA 3POJA 4XCBA 3MGUA 5F3CA 1AJKA 1T6BX 1CPMA 4LK6A 3WG3A 1UYZA 4JRLA 2RM23 4Q5OA 2Q4SA 1FOD2 4PBOA 4XFGA 4ZU7A 4RR3C 4PIXA 4Q4X3 4XUQA 2G9GA 4B4RA 1BBT1 1OUXA 4RGKA 1W9WA 1QH6A 2CU5A 2PELA 2ZMNA 1H6YA 2D3RA 3CNAA 3B01A 1SLAA 3ZFGC 1GWMA 1XSRA 1FXZA 1MS0A 4B4QA 5IFPA 2WKKA 5LRRA 4AGGA 4LHLA 5JOYA 2W46A 3BUCA 1GP6A 1NXMA 4IEVA 3OPWA 5GZFA 1MQTB 2DUQA 4AI0A 3Q8AA 4Q4Y2 1R093 5IVFA 5F2WA 3WP6A 3WG2A 3NNLA 1H9PA 5HXVA 1ZZCA 2VOWA 4S2HA 2RMU2 4LHKA 5C6CA 2NP0A 3JUUA 3NAPC 1DLCA 4SLIA 1K5MC 1EV12 1QOOA 1AYM1 2YROA 2XGXA 1W3VA 1WMFA 3K4AA 3AYCA 2HWE2 4OLLA 1RUF2 3OGSA 4X8PA 4JDNA 1LJ7A 3THCA 1RMU2 2W9XA 3WW3A 4QB2A 2ZGMA 1RUOA 1FMD2 2W52A 1LOFC 2IVIB 3QD6A 4IE6A 4J25A 4JV4A 4YGBA 5FYHA 4AE2A 3DXTA 2YU2A 1CJDA 3CJIA 4ES9A 3ZKUA 3ELNA 3IT8A 4GH4A 3FZ3A 1Z7S2 3CKHA 3KM5A 4MHUA 4UOJA 3WX5A 4Y5TA 4A7ZA 3BALA 3WNNA 1WWYA 4J1WA 4QDSA 2VZVA 2W5FA 3WQ1A 2DDUA 3POGA 2ERFA 3RI9A 2BEOA 2HWD2 2WWUA 1I9RA 4XFFA 3T1LA 3RI8A 3EYPA 5FPVA 3GJAA 4Q1RA 5AC91 5C9AC 5K7PA 4IESA 5EFUA 1EPWA 3V64A 1RUH3 2RE9A 1ENXA 1O5UA 2JE7A 2QKDA 3P1IA 3ROUA 2RS12 4UFKA 1KGYA 3K75B 3KHCA 4HKWA 4CCDA 2HLEA 2HYXA 4QX0A 4XF3A 4OZXA 5HV4A 2Z69A 3VD9A 3AZYA 3KSCA 3I3MA 2WNVA 2NYYA 4R52A 4XUPA 5ACA3 2YFUA 5IAVA 4CDWC 1UW8A 3AC0A 2JDYA 2YPDA 4QM9A 1RUJ3 4HKLA 3ZXDA 1E5SA 1VAVA 5LBFA 3VZOA 4YVWC 2PTMA 3U4SA 4RQPC 1C8NA 1VE0A 3AP4A 1ULDA 4INDA 3WW4A 5HBAA 3B93A 1K5JA 1D0GA 3NKTA 1X8MA 4P5YA 1V00A 4MH0E 2E7AA 1OMIA 4W50A 5FZ1A 1BVP1 4CXYA 4HETA 4XDOA 3ZM8A 1S55A 1CN1A 1W6MA 2I07B 4BQ5A 4QKNA 1VRH2 3RZZA 2QCSB 3A4UA 3ZR6A 5IJRA 5C8CB 3LAGA 5IT6A 1VBB2 1UX7A 4AFAA 1ENQA 1E5HA 2WN2A 2JIGA 2A6YA 3ABZA 4DRVA 4GALA 4LKEA 5D21A 1LECA 4D0QA 5FR3A 1KITA 5FZ3A 5IK8A 1WLDA 2BU9A 5FLIA 4XDPA 5EZWA 1W6NA 2HEVF 4KBZA 2ZBJA 4XABA 2ORXA 4GKYA 4EYUA 2CYFA 2D5HA 4OHVA 3RZLA 3W5NA 2ZEZA 3V0AA 5FUPA 3VL9A 1VBC2 4E27A 2BWCA 3PUHA 4Q0SA 4IV3A 1JBCA 2ZACA 1JODA 5ABJC 1O3TA 1UXZA 1Q43A 2XJSA 2YPJA 1BYHA 2A3XA 4DS0A 5IVJA 4N7IA 5IYYA 4XAEA 1P8JA 4K40A 3RS6A 2BOJA 3QLQA 3OD4A 1LAJA 2IVJA 4HN0A 4HANA 1U0AA 1PIV1 1FAYA 2ZHNA 3OEBA 5EJ3A 1G86A 3LE0A 3S5AA 2BP6A 2JICA 3WD5A 5LY2A 3AZXA 3GBWA 4L2NA 1EAH1 4YW7A 4CDXC 4OZOA 3UJOA 5I0RA 3S0MA 3OTFA 4N9HA 1UZYA 3ACFA 2FCTA 5E16A 1W06A 2Y60A 4FP2A 1UOBA 1VBE3 4BK5A 3LPGA 2JB4A 4QX5A 2A7AA 4AEKA 4CZSA 4E8CA 3T0DA 4LO6B 1W2AX 1YLLA 1ND2C 3E1F1 3GGLA 4XMIA 5FZ6A 2YBSA 4M3CF 1V0AA 2XBO1 3L9JT 4XQ4A 2W08A 1V9U2 4ITCA 5FWEA 3ZMOA 4EN8B 3WG1A 4D6SA 1N3PA 3ILFA 2NM1A 4QMAA 3VN4A 4ZS3A 2JJ6A 3MICA 4MLOA 4URTA 4DB5A 2X5IA 3ATGA 4WVMB 4ASLA 3VHOA 1HRV1 1JYWA 2VOKA 4CDQC 4QU2A 4QD2A 3ZYBA 4A3XA 2YC2A 1YIPA 4LIVA 1DGRN 2PFWA 2EALA 3X29B 4AAXA 1STMA 3WDUA 2DUPA 4AVAA 1PO22 4WM8C 2ENRA 4Q4W2 4UT5A 4XQWA 3UT0A 4LNVA 4QQLA 2VNVA 2VTXA 1SLBA 4QPIB 1US2A 4Y1XA 2EICA 4HT1T 4O9EA 1W6OB 5JMCA 1TMF3 5C4WA 1L7RA 1X33A 1WLTA 3I59B 3PUAA 5FO7B 5J37A 1I5PA 4RR3A 5FLJA 2CV6A 3DEMA 4MGSA 1WCSA 3RSJA 3WW2A 1IQAA 4CU6A 2HEYF 4UW4A 2BW8A 4WVVA 3ZFGA 3ZXKA 4LBQB 5I0TA 1WA6X 4XFHA 1WLWA 5IFTA 4XF0A 3SHRA 3AFGA 4FPEA 1NE6A 4LTAA 1HQWA 1HQLA 2D44A 3LDKA 3SH4A 3ZXLA 3U1XA 4CU7A 2X09A 5CFCC 2H0VA 5LEKA 1V6KA 5JCTA 3LQCA 5A3LA 2AZ5A 1K5MA 1XNCA 2WNUC 2GNMA 3IDEA 3N9OA 4MG2A 3ETPA 1HJGA 3PL0A 2VULA 4NIDA 1IOAA 2MPFA 5HCBA 5C3OA 4A42A 1SFPA 3S57A 1FPN3 2WS92 3K46A 1OQ1A 4TZDA 4GZ9A 2UY9A 4IGPA 4DPNA 2IUWA 4BMBA 5FP3A 4QPWA 4C90A 1IGOA 3LWCA 5F5IA 1UZVA 2MNGA 1GMMA 3ZYRA 2H6BA 4ZHNA 2D98A 4E4HA 4OI4A 3OBTA 4NHKA 4Q0QA 3U14A 2LROA 4NR1A 3FFQA 3IPVB 1UKRA 3N7KA 4IERA 1JW6A 2DV9A 2HWF1 4P9LA 1DGRA 1JYVA 4YW3A 4AL9A 3JBG2 1XB9A 4W6WA 1DGLA 4NPRA 4Y1UA 1LOBA 5C9AA 4M01A 2MEV3 3HMYA 2YFZA 3TEXA 4UBHA 4OQ8A 1TQ5A 1W9SA 1XU1A 4OFGA 3VD4A 3NV4A 1LGCA 1QJY3 1Q56A 1C8M2 1RUI1 4K8RB 4LO8A 5E1RA 1GZCA 1OLRA 2IWGB 1UXXX 1RL3A 1YQ8A 3CJIB 3NV3A 3I3DA 4GMP0 2ZGOA 2A6ZA 4GH4B 1KJRA 1QJX3 3WNPA 1QGLA 3THPA 2Q8DA 1MPXA 1QKQA 4PJYA 3AL6A 4IEPA 1H2MA 4UBGA 4FCAA 4EZ4A 1IG3A 2J1TA 1T2XA 2A75A 1LB2A 2ZX3A 2WZR3 2RDSA 2VQTA 3RJ2X 4DXZA 5FMBA 4N53A 1WW5A 2B9UA 3ETQA 3QBQA 1VR3A 2EIBA 2R071 5FKCA 4QHOA 3ZN4A 5CEHA 1AR81 3KT7A 1JZ4A 1CJPA 2FDFA 5C71A 5LBEA 5A3NA 2WNVB 3AYEA 3Q8FA 1VBD1 3H0OA 5F6KA 2BJSA 2K9ZA 4XJZA 4FTBA 4FPFA 1B35C 1WMDA 4PLNA 1RHI2 2YYOA 5JSRA 5D1IA 4Z2AA 3U4XA 3VHPA 2EXIA 2Z79A 4N43A 1OOPC 2Q5TA 3WVJA 2R041 3VZJA 2Y64A 3ZPOA 1IPJA 5JI9A 2PAKA 2GAUA 4IETA 4YZ2A 3AMHA 2ZX2A 2WQZC 1Q8PA 3KVAA 3VBSC 4GMP3 4A6SA 1W6MB 4PIZA 1QU0A 4AG4A 4AEJA 1RUC3 2J1UA 3VBHC 1UNBA 1VMHA 3MIEA 4A2UA 5FWJA 2FMYA 1S0CA 4P9WA 1AR71 4Q1PA 1HRV3 4UFJA 1UMIA 4BJ0A 3NV2A 4BM8A 2DFBA 1J3RA 3CEWA 3I3EA 4YZ3A 3V0AB 3R4SA 1FOD1 3LEMA 4BK4A 4BQ3A 3C7FA 4LEJA 4IV3B 1RUNA 3KV9A 4HONA 1IS4A 4BE3A 2WA4A 3M8LA 2GMMA 4JTNA 2CL2A 3HQRA 1ONAA 3OGVA 1ND2A 3B9IA 3LA3A 3NWKA 4QPGC 2CHHA 3CBNA 2B4KA 2VUAA 1CR7A 5KHIA 3I3BA 1JMUB 3CIHA 4Q4Y1 4XBNA 1CAUA 4ASKA 3HQXA 4UFLA 3KT4A 1GQHA 5FZHA 2OIIA 5ERLA 1F4HA 5KBFA 2HBTA 3CZJA 5FZOB 1DYPA 1V70A 2XL9A 2P3YA 5B4XA 3NW4A 5T5LA 3MUZ1 4V2WA 4DUXA 2LW8A 4N9IA 2RHPA 2RV9A 1LCLA 3O5SA 2A73B 2VTFA 1RMU1 4XBLA 3ZFEA 4Z8BA 3MDPA 2WO3A 1RUG2 2WYFA 4ZZ5A 2ZGLA 3CHXA 3FWEA 3WF3A 1S0EA 1VLNA 3PVEA 4WM8A 3Q8EA 2Y6KA 4FPKA 4XIOA 4Q27A 4Z07A 4XFBA 4DEVA 1X50A 5FYYA 1XNBA 1Z7S1 2WFPA 1NA1C 3DUIA 2UWAA 2Y6HA 4JCKA 1WW6A 1VJ2A 4YG6A 1FV3A 2IXKA 2PAMA 3N35A 1JHNA 2PHFA 3D4KA 4Y1ZA 1JZ5A 2X5IB 5B4NA 5GZGA 5FDBA 1ENSA 3ALQA 4AHYA 1H2NA 1N1VA 2B39A 3D0SA 1AR61 1EUTA 4NO4A 1DYOA 3KQRA 2RS11 3S30A 3O1RA 3HJRA 1ZRRA 1BK0A 3FHIB 4LITA 4P5HA 2VQ0A 4QKFA 1NG0A 3FLPA 4DEQA 4QWNA 4RS5C 3QH7A 4DIQA 3AK0A 4AVBA 1NE4A 3W20A 5CFCA 2CDPA 3JQWA 5FPBA 4CCMA 2IZWA 4D7YA 1H6XA 3ZSMA 5BNPC 2WNUA 4LULA 4TXWA 4KH9A 1YWKA 1RVF2 3N7MA 2RDNA 4X8NA 4SBVA 5FJHA 1QNWA 4M0NA 5C4WB 4LLOA 4RR3B 2Q1MA 1HN1A 1LR5A 3QACA 2W1UA 2Y0OA 2K0GA 2XLFA 1H9WA 3WP5A 4OQ9A 2HWC2 3HNBM 3IKWA 2WAAA 4O9GA 1K42A 2B46X 1VRH1 4V1PA 4Z1VA 4DXRA 4JKKA 4QXBA 1NCRA 1VBB1 1LU2A 4PDWC 1S2KA 1AXZA 1C1FA 1D2SA 3RZKA 2EXJA 2A5ZA 4P9IA 4EV0A 3H8OA 4FXGB 2VZTA 1HRI2 2PHXA 1UMZA 1PGL2 2VMFA 4HVQA 3POFA 1H2KA 2F17A 2R073 1K5MB 3UETA 5BV6A 1GU3A 1QXPA 2VQUA 2AENA 2G4IA 2ZOEB 4CSWA 4FPYA 4XEZA 2WINB 4AZZA 4F7ZA 5C5TA 4MGZE 5LA9A 1CD3G 1EPZA 5E89A 2VL4A 2NQYA 4I2OA 1K12A 3PTRB 3I54A 5H9QA 3B02A 1HDKA 1MZ6A 5T50A 1ZBE2 4E2QA 2P34A 3M3OA 4CVUA 2JDHA 1N3QA 3R4UA 4LBJA 3G7DA 4LBQD 4MSVA 5FZFA 3ZXAC 2VOTA 4BOWA 5FYZA 1S0GA 4GXLA 4WVZA 4ZXKA 4KU7A 2HJIA 2P3KA 1UU5A 1VBA2 5FAXA 3T30A 5F5CA 1ULCA 3BYWA 3M3QA 5FYMA 2DCYA 5F9TA 2VPVA 2ZGNA 1CZSA 3WF1A 5JR7B 3HBZA 5FJKA 4XC9A 1BKZA 4ZONA 2PQSA 5F3EA 1CIYA 3WNMA 5A6XA 1NY72 2RR12 5F3GA 5FPUA 3QH6A 1OLQA 2OW4A 5L9VA 4K7JA 1JYNA 3DYOA 2OT7A 3VV1A 2RVAA 2XJRA 1GZTA 2G19A 2QQVA 3E5UA 1FOD3 3U37A 1US3A 1QEXA 2YMZA 1S0DA 1V9U1 2DTYA 4L8QA 4NHXA 1UN1A 4KBBA 4CEYA 4ARXA 2D5FA 4KMQA 4R4ZA 2Q0AA 1JXNA 2GH8A 1CVNA 1UOFA 4FPJA 1GLHA 3G6JB 2XJUA 1W8NA 4XCAA 1ST8A 2QZ3A 3J7LA 4HSLA 3WR0A 2NLRA 1GWKA 1YFUA 1W2TA 1W9FA 4G3YC 3P5BA 1GZ9A 1NXD1 2J1AA 4N53B 4Q4Y3 3JD72 4ATFA 1HW5A 5CKMA 3VBHA 5CA6A 1GNHA 2BGPA 2RMU3 4LBKA 5DG2A 4GWMA 4EROA 1JYXA 1EV13 1OFNA 2QNKA 5LK7B 4Q4W1 1MZ5A 4R9BA 3I2IA 4GULA 1QJEA 3KMHA 1VALA 2HWE3 2JEMA 1RUF3 5FYTA 3KGZA 4COWA 5F5QA 3VDDC 1AXKA 2AGSA 1RMU3 4N43B 3NNJA 3WNKA 1FMD3 4CUBA 2WNOA 3K51A 4I3PA 4BU2A 3BOPA 5BYNA 4QGNA 3O0VA 3AKSA 3OD0A 3J4UH 4FO9A 1ZYBA 1FI2A 4AYUA 1DQ6A 1OF4A 3SKJE 5KXCA 3A0KA 3NO8A 4HZFA 1SBEA 4CCEA 2PYTA 2K46A 3MO4A 3K2OA 2ADDA 3IMNA 3M4FA 2XWBB 1WBLA 2FHRA 1JTZX 1PM4A 2HWD3 3DGTA 3I7DA 4G4FA 4BWOA 4Z82A 5C5UA 4YG3A 1N1TA 3MF9A 3N4MA 4TLFA 1K3IA 2HYKA 2VZRA 1AL0G 1W6PB 2RS13 4Y5SA 5J3UA 3CJXA 4LO7A 2WQ4A 1MEC2 5FY4A 4AQ2A 3GZTB 5FYIA 3PDQA 2X10A 5FTTC 5A7QA 4XILA 3W21A 3GDBA 3HBKA 1OVPA 3TAYA 2WJSA 2W47A 4QHBA 3DF0A 1QQP2 3LD8A 5DN2A 5FMOL 2WS91 4YVSA 1ND2B 1SBFA 3AVRA 3H8RA 1O8SA 1PGW1 1DYKA 2C9KA 1ZRIA 2R16A 3RMXA 2WO7A 1V6MA 3MW2A 2B9VA 1XE8A 1TG7A 3MEPA 3PUIA 4JDMA 3NNFA 1GUIA 3NRUA 1C5IA 1A6CA 1W90A 1JH5A 3HVDA 1CAUB 5ACA1 2OPWA 2RG4A 3BODA 4XF9A 3WNOA 2X05A 2V09A 2JDPA 1GANA 1ND3A 1RUJ1 4IXLA 1LHNA 1GOGA 5FYCA 1VBB3 3DYPA 4PHZA 2A1XA 3OOXA 3H3UA 1SMVA 3AKPA 3FMGA 5LRSA 2VVEA 4AI3A 3AP5A 1SPPB 4ISQA 4A44A 3N36A 1C1LA 2DURA 3ZFEB 2VMGA 5A7NA 4RSUA 5FP9A 4XXPA 4X6RB 4HN1A 4RS5A 1C8M1 2E26A 4ORFA 5F1RA 4C91A 2VAUA 4WM8B 4YGEA 3FC0A 4IEWA 3WZ1A 4BQ2A 2UYAA 5HPOA 4C8DA 1VBC3 4E4SA 4YFZA 3T4VA 1QIQA 1BZWA 2JG9C 3BB6A 4N8MA 4NPMA 4XETA 4B1LA 3HAGA 5FMDA 1RITA 5BNPA 1PVC2 1YYNA 5T5JA 3LIHA 4AI2A 2R6QA 3ZN6A 5CAZA 1GNYA 3LDRA 3RZMA 4B7KA 1QF3A 3ZFFC 1A34A 2XOMA 4FVVA 1LOCA 4P9JA 2W68A 3L2YA 1ZZBA 1N47A 4NOTA 1H0BA 2VZ3A 2P2KA 3ES1A 3GHNA 3ZN5A 4TTGA 1S0BA 1KDKA 2WLQA 1UQXA 1X36A 2OQ6A 3P3NA 2Y6FA 1QJU2 4PDWA 5LA0A 2VUJA 3AZWA 1NQJA 5CG9A 1CX1A 3K3NA 1D7PM 5T54A 2NMOA 3C7OA 3LSEA 3OGJA 2ARAA 4DXSA 5BNOA 2TBVA 1RHI1 2DUOA 3EMRA 5FZKA 2ZJCA 3ZDSA 4AEMA 2QVSB 2WNUB 2Q1ZB 3CO2A 4GB32 4I0WB 1XNTA 1BLZA 2R32A 5J96B 2PAEA 2PLV2 3FLTA 4XQDA 4GAZA 4GA9A 1A78A 2ZZQA 1UOGA 2WT1A 1J59A 1Y3TA 3RYRA 4G9SB 1V9U3 1F2NA 1VBE1 3WQ7A 1W6QA 1NCRB 4IE0A 4KG8A 3OYWA 4YFWA 4BHPA 4NIHA 3IM0A 2JKBA 5ANNA 1MS9A 2J22A 3VBRA 3I2DA 2R30A 4Q0PA 1UY2A 5FZ4A 1UU6A 2VVDA 4OI1A 4GWNA 3DN7A 2O1QA 1COV3 1DQ0A 2YU1A 3EHKA 1DFQA 1LHUA 4DY5A 3H1YA 2CGNA 5EP9A 4D6QA 2XKPA 1PO23 1PK6C 4Q4W3 3OCPA 1SLTA 4ATEA 3S7IA 1UKGA 5GLUA 1J58A 3FHQA 4W4ZA 1W0PA 4EZHA 4HKOA 4AQ6A 3KV6A 2AACA 2KM2A 1W04A 4IGQA 2RS52 1GKBA 3GNEA 4OHWA 4O65A 5FXWA 2VE1A 4Y22A 2RJ2A 4YRDA 2JE8A 2H6CA 1CQ9A 2AREA 3GCXA 4Q4V2 3H50A 2GC3A 2KA3A 4D7SA 2BPA2 5BNNA 1WW7A 1UIKA 1SG3A 1TMF1 2K2SA 2VMIA 3PIJA 1YXWA 2PHWA 1W0OA 1UO9A 3LOBA 1Q8OA 5I8SA 2VCAA 2VUDA 1O4YA 4YW5A 4A6OA 5AFBA 1WMEA 2DU0A 3CQOA 4AEDA 2PXJA 2WAOA 1YRZA 2C4XA 1Q8SA 2VU9A 2ES3A 5JI7A 4CP0A 3PU8A 4CEYB 2G9ZA 1OT5A 4NMIA 3P3PA 4C0HA 4ZZ8A 1YI7A 4BXFA 1AXYA 1RGSA 2WS93 4CDUC 4F3JA 3MZHA 4E2GA 3KHBA 1N3OA 5C8WA 4OCTA 1D2QA 5FY0A 4BQXA 1W03A 1J84A 2ZX1A 1PNFA 5T5PA 3VBHB 1H30A 4YARA 1JHJA 1FPN1 1XNKA 3CMGA 3OSDA 2VMHA 4PI2A 4KWKA 2F4PA 2JG8C 3JBG3 1LHWA 4IEOA 3SQOA 3NQHA 4UF0A 1TE1B 4Q0UA 1ZNPA 4MYEA 2CSGA 1PO12 2L9LA 2LM3A 5DUVA 2V4VA 5DUWA 1RYYA 5GLVA 3AKQA 2ZCWA 1RVF1 5F3IA 1LOGA 3TOJA 3ZR5A 1ULEA 2OVUA 1C8M3 4KWJA 4MGKE 3TWIA 2YGLA 4YW4A 3BI3A 4A4AA 3VBOA 5CISA 4Y26A 3FX3A 2WQ8A 5FOBB 4BA6A 3O1VA 2MEV1 1Y9QA 3MIDA 1R082 1FNYA 3H42B 2EVXA 3PU3A 2R1DA 2ZGUA 3B69A 3UKNA 4CEWC 2Y26A 1QJY1 1UD1A 4PLMA 2E63A 4WM7C 4NVPA 1AHSA 4KI5M 4LOSA 2OQ7A 3T0BA 3ACHA 1RUE2 1PZ7A 1QJX1 1YUDA 3IZOA 3MW4A 4XUOA 5DAXA 5FP4A 5A7WA 2ETEA 5FK7A 1JZ2A 4BCUA 3MV11 3ACIA 1UMHA 4XJAA 1G6NA 2RS32 1LGNA 2Y34A 1LTEA 2W3JA 2WZR1 2D3PA 1RHI3 4IL7A 1FATA 4QAWA 5DZFA 4YVSB 1H4GA 1DG6A 1VB2A 3T2TA 3HPNA 3LPFA 2A3YA 1O4ZA 1ODMA 1JZ8A 1ULFA 4IEYA 4LT5A 2JG9A 3MLLA 2Z5WA 2RJKA 1VAMA 5JZGC 3VKNA 1SACA 1XJAA 4XTMA 1A8DA 1ND3B 3FLRA 1PVXA 4EJRA 2F4LA 5I0DA 4AFCA 1IG0A 1OPMA 4TSVA 4JQRA 4AOCA 1QOSA 3GJBA 4XHXA 4GMP1 4GQ7A 4RS5B 2JDKA 5KXBA 4OHYA 3GHMA 3RWKX 5LB6A 3WF0A 4IW3A 1RUC1 4P00B 4Y20A 3CF6E 3I2JA 1IS3A 1V6IA 4XZUG 1W05A 3Q9OA 5GLZA 4DUVA 3KT1A 5BNPB 5CBLA 1GP4A 4GJYA 1ZZ8A 3H1WA 5LWBA 4W8JA 1UX6A 3ZN6B 1SLCA 2R7EB 1I6XA 4LJHA 3VKMA 5JUVA 1COV2 4NJ4A 1UZ0A 3JQXA 4JQTA 1YHFA 3LCPA 1DP0A 1GSLA 5ISLA 4BQ1A 3T3YA 2BNNA 2E9QA 5DPNA 3WCRA 4CE8A 1W8UA 4CCOA 4OHXA 4XJ8A 5FO9B 1UPIA 1RUD2 2FDHA 1ULPA 4LQRA 2SBAA 3A22A 4JTOA 3T09A 4AQSA 5DXDA 5BNOB 4L0PA 2ET7A 4S2GA 1KS4A 3TRSB 1HLCA 3AMNA 1NLQA 2G1MA 1D4M2 1HXS2 3PNAA 1WD3A 1O3QA 3WINE 2EAAA 1URXA 1RUG3 3D8CA 4ET7A 1CGPA 4KWUA 1JS9A 4X6QB 1LRHA 3VBUC 3OBRA 4FQ4A 2BGCA 4RFRB 1PK6A 4QKBA 3VL8A 4HL0A 4P9YA 4YPJA 1NAEA 4IV1C 1F9KA 4RGGA 3WLUA 1UZWA 1W6QB 3MV01 3OYWB 3BVCA 2P17A 2VMEA 3SEEA 5JVVA 1EYBA 3SISA 3VBRB 3NAPA 5JIUA 3WQBA 3ITQA 1MS8A 2ZEWA 4Z2WA 5F7UA 1WCUA 1UYXA 1GQGA 2IFWA 2VMCA 1XE7A 1LOFA 3K48A 5A3OA 4XFCA 1ALYA 4IEUA 3VD7A 2FCVA 2P6CA 1H8TC 5FO8B 4HFSA 4JGZC 1TME2 4CCKA 1RINA 4WZCA 1GWLA 5KC6A 1PMJX 2O14A 1OQEA 1Q3EA 3I2GA 2EXHA 1RVF3 4LA3A 4GD4A 2VCCA 3T2PA 1RIRA 4DINB 1JU3A 3LZZA 3MUY1 4Y22B 2HWC3 2BFUL 3WOGA 1CAVA 2I45A 3ORJA 1KS5A 4FOVA 5FRAA 2X8KA 1DHKB 4OMDA 3EQEA 4S2FA 4XPVA 5FY7A 5JXHA 1BQPA 5IWFA 3IWZA 3V0BA 5BNNB 2RDRA 3H8UA 5HV0A 4J6GA 5IK7A 5CB7A 1XYNA 4K6BA 4COZA 2Z4FA 4CDWA 1F35A 4XMAA 3NNMA 2DBIA 1SQ4A 2VJXA 1HRI3 3TB0A 4AHXA 3QCWA 3OBZA 5CADA 2ET1A 4QXCA 5A3MA 5HXMA 2QZ2A 4YVWA 1OH4A 3GZEA 1HQNA 1AR92 4RQPA 5IK4A 4H7MA 4AEDB 1SCSA 4YM1A 4UFMA 4WVWA 1GP5A 3IIIA 2IC1A 2WYSA 4IE4A 4MV2A 5E8AA 1PVC1 1DZQA 3E6CC 2VZQA 2JD9A 3H3LA 2LALA 3RJRA 2O8OA 2WN3A 3U10A 1QH7A 4D3WA 1ZBE3 2QE3A 4B7EA 2BVVA 2DVFA 4IE5A 3BTAA 1LHOA 1MQTC 5DABA 4YSFA 4LA2A 3ST7A 3ZO0B 3ZX7A 3UJQA 2JB8A 2D6PA 5J7MA 5KWRA 1QJU1 3AX4A 3A21A 2NMNA 4CEWA 2R062 4M3CE 1VBA3 1KQRA 4WM7A 4YW1A 4BQWA 3A0NA 2Y6JA 4UF0B 1BMV1 1DQ2A 4GJZA 1LHVA 2VR4A 4KG0A 4DZGA 1SEFA 2W95A 5ABJA 1AX0A 3M2MA 4LBNA 4O7XA 2RR13 4BMEA 5FUNA 5BXXA 2PLV1 3U78A 3DKWA 3VBOB 1SFNA 2GNDA 2W94A 4FPHA 3D82A 1Y4WA 3I3QA 1XXNA 2VG9A 3K77A 4KGQA 4QU1A 3EB7A 3WDXA 4IE7A 4A3ZA 2VCMA 4K21A 1W6NB 2AYHA 2YBKA 3N3HA 3V65A 3UNPA 4LUMA 1UF2C 4CDXA 3B94A 5JOXA 2Q30A 1O8PA 4XE9A 4XBQA 2TUNA 5I93A 2KD7A 3IBMA 1AL22 1OD5A 5A7WB 3JD73 3TN93 5EYYA 3APBA 2QQJA 2VTXJ 1ZM1A 4ZY9A 2XLGA 3WG4A 5FZBA 3RZHA 5CIRA 1WCDJ 3T2QA 1JOPA 1REDA 1UYPA 2VOVA 4Q0VA 1ULGA 4CA9A 1MZEA 3MIHA 4UXAA 3PLQA 2YG0A 1IKPA 3UL2A 2XUEA 2JG9B 5L19A 2GZWA 5M0TA 2RMU1 2RS51 2VH9A 2XWJB 1BBT2 4K8FA 2IXIA 5FZ9A 4RHV2 1EV11 1DCSA 2UYBA 4PT6A 4CDQA 5F6LB 1UY3A 3MI8A 5C8CC 2HWE1 4EWAA 2D3SA 2IFRA 1RUF1 5JWPA 2XVLA 1CAXA 1DBNA 4NUBA 3SC7X 5IATA 2XMLA 4Q4V1 3GF6A 4HSJA 4FFGA 1FMD1 5FPXA 3LA7A 2UWCA 4PBPA 3BTYA 4B3NA 4J1XA 2W92A 4JC1A 3AYAA 1LULA 3WY6A 1CIWA 1DQ1A 5DDJ2 2FMDA 1V6NA 3W9AA 1AYM2 1AZDA 1YC61 1W39A 1MEC3 2Y38A 4Y20B 4CCJA 3I4IA 5FPZA 1YQ5A 2HWD1 4YGCA 5FCCA 4R9DA 4QDQA 1QQP3 5C3PA 3HR9A 5FZLA 1VMJA 4L97A 3VBUA 5IUQA 3PJYA 1DF0A 2WDBA 3UGHA 4COYA 1NLSA 1FNZA 2WWSA 4PQ9A 5FQ0A 4IV1A 2DTWA 1KXGA 4JGYC 1GOFA 3M3CA 3PVNA 2PHLA 3AZVA 3EO6A 2VQAA 3M3IA 3VZKA 3DV8A 3R05A 2GC0A 3N9PA 1H1AA 2GP3A 4U36A 5EYXA 3MFCA 5GLTA 3WNLA 1YQCA 2ZEYA 2JDNA 3MIFA 4HVOA 2JDUA 4S2DA 5DAWA 3ZXJA 4D94A 5AC92 2QQPA 1A8MA 3MLKA 4NWWA 3ZLIA 4L92A 1CPNA 1JUIA 3MIGA 3FBYA 1JI6A 3USSA 4CUCA
chains in the Genus database with same CATH topology
5A3OA 5A6XA 2JDPA 2JDMA 4UT5A 1UZVA 1OXCA 5A6YA 1GZTA 2VUDA 3DCQA 2JDHA 2BV4A 4AOCA 5A70A 1OURA 5A6QA 4CE8A 1UQXA 2XR4A 1W8HA 1OVPA 5A6ZA 2VNVA 1OUSA 2CHHA 1W8FA 2JDKA 2BOJA 3ZDVA 2VUCA 5HCHA 2JDNA 2JDUA 2WR9A 1OUXA 2BP6A 2BOIA 2WRAA 5D2AA 1OVSA 2JDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A3O A;  5A6X A;  2JDP A;  2JDM A;  4UT5 A;  1UZV A;  1OXC A;  5A6Y A;  1GZT A;  2VUD A;  3DCQ A;  2JDH A;  2BV4 A;  4AOC A;  5A70 A;  1OUR A;  5A6Q A;  4CE8 A;  1UQX A;  2XR4 A;  1W8H A;  1OVP A;  5A6Z A;  2VNV A;  1OUS A;  2CHH A;  1W8F A;  2JDK A;  2BOJ A;  3ZDV A;  2VUC A;  5HCH A;  2JDN A;  2JDU A;  2WR9 A;  1OUX A;  2BP6 A;  2BOI A;  2WRA A;  5D2A A;  1OVS A;  2JDY A; 
#chains in the Genus database with same CATH topology
 3VD3 A;  5LA1 A;  5A3W A;  2WUH A;  3VUO A;  3VBF C;  2BBA A;  3AP9 A;  1H8V A;  3E6B A;  1S4C A;  2WZ8 A;  3ZFG B;  2C24 A;  2VD7 A;  1ASJ 2;  1H8T A;  1SFY A;  2HBU A;  3OPZ A;  3VDC A;  5H9R A;  5FXZ A;  4IEQ A;  1CX4 A;  3IIA A;  5FYV A;  2XQR A;  4FOQ A;  3T0A A;  4CU9 A;  1C4R A;  5T5O A;  4HPK A;  5A1A A;  2XR4 A;  2ILM A;  5C3R A;  1KD7 A;  1PVC 3;  5CFD C;  5LY1 A;  1YCI A;  3BOW A;  3NVC A;  3TYJ A;  2XKO A;  1OF3 A;  1O5L A;  4YGD A;  2A6V A;  2VUC A;  3NAP B;  2CGP A;  2VZO A;  2D6O X;  3H1M A;  2ZGR A;  4ONU A;  2YHJ A;  1VBC 1;  2TEP A;  3SH5 A;  4LXL A;  1RUE 1;  3AMP A;  2BUK A;  1IS5 A;  4R4X A;  3WUD A;  3D6E A;  1ENR A;  3MFA A;  4IDZ A;  1Z0H A;  5A7O A;  1SLI A;  1QJU 3;  5IHR A;  4DO0 A;  5FP7 A;  3WF2 A;  3O1O A;  1OFS A;  4FP3 A;  1NYW A;  4LBM A;  2CNA A;  4QX1 A;  5T52 A;  4QQP A;  2P3I A;  5DAV A;  2XDV A;  3UES A;  2UY8 A;  2Y6L A;  4OI2 A;  4HMZ A;  3RYP A;  4GB3 3;  4UW5 A;  3B9C A;  3OBA A;  5JPM B;  3LDB A;  2HEW F;  4H7L A;  4RYD A;  4OHZ A;  2PLV 3;  2C0Z A;  3MPP G;  4JAA A;  4RFT 0;  4DXT A;  2NZ9 A;  3HIF A;  4P08 A;  3TNQ A;  4A41 A;  2A70 A;  5C9A B;  4LK7 A;  1CAV B;  5ANQ A;  5F39 A;  1O6U A;  4NHM A;  4YYO A;  5JXI A;  2BWA A;  4MET A;  2W39 A;  3RDI A;  5I91 A;  3V0B B;  4MXV A;  1AVB A;  4COV A;  4QDR A;  1PIV 2;  3BGA A;  5EPA A;  2DVG A;  3AXE A;  3D3A A;  3MIB A;  2GNT A;  2VMD A;  4QGM A;  4CDW B;  1W9T A;  2QQU A;  1W28 A;  2V72 A;  1LED A;  2OZJ A;  1B35 A;  1RJ7 A;  1EAH 2;  4QPY A;  5EWS A;  5IVC A;  4AAP A;  2EF6 A;  5FY9 A;  4YVW B;  2ZGP A;  4RQP B;  1OUR A;  1HN0 A;  1OOP A;  2PMW B;  3KF5 A;  5FXX A;  1F8V A;  1VMF A;  4B29 A;  4BIO A;  2E7T A;  3BIW E;  1WCQ A;  3FFZ A;  4C0B A;  4WZF A;  2D6L X;  4BXS V;  3UGG A;  4MGT A;  4NIG A;  2E33 A;  3VBS A;  1OH3 A;  1HV1 A;  2FDJ A;  2YY1 A;  4EE2 A;  5CKN A;  3LIG A;  1COV 1;  4GWI A;  1XC6 A;  1U5X A;  5H9P A;  5FIX A;  2AC1 A;  3TN9 2;  5BUV A;  1Q8V A;  3TEW A;  3UKT A;  1S2B A;  2XBO 2;  2XVK A;  1GV9 A;  3B5L B;  4GWJ A;  2RS5 3;  3KQ4 B;  4LR4 A;  2OZ6 A;  4Q2F A;  3INA A;  3K4Z A;  1PO2 1;  1R64 A;  2X53 S;  2ZGK A;  5IK5 A;  3NJX A;  4LKF A;  1RUD 1;  3KV5 A;  4CEW B;  1E5R A;  1RXF A;  1HB3 A;  3FHA A;  4CP9 A;  4WM7 B;  1BK1 A;  1BHG A;  1UZZ A;  3FUO A;  1UAI A;  4Q4V 3;  4JKM A;  5JLV A;  4XAA A;  4LO4 B;  1D4M 1;  1HXS 1;  1OUS A;  1XOY A;  1GQP A;  3ASI A;  2PHU A;  3LA2 A;  1D4V B;  4W6Y A;  5FPL A;  4AK3 A;  5J1X A;  5ABJ B;  5J09 A;  2CAU A;  2GN7 A;  2YGM A;  4GKX A;  2VY0 A;  5IAX A;  1OHF A;  1YFY A;  3GZA A;  5JAX A;  3CJI C;  4OUS A;  5JSO A;  4QPG A;  3DPR C;  1HV0 A;  4U2A A;  4Y24 A;  1OBN A;  2QQM A;  4LE3 A;  3ZXG A;  4GH4 C;  1X8E A;  3I2F A;  4XUT A;  3HT2 A;  1VAK A;  4LOR A;  1HJF A;  4PQQ A;  5FV3 A;  5FZM A;  4QX2 A;  4E4D X;  5JOZ A;  2XJQ A;  3H9A A;  1NOV A;  2ARX A;  2V5Y A;  3N9M A;  3GAL A;  3KCX A;  2Y0I A;  1POV 0;  1QDC A;  2QQL A;  4OUM A;  5LAS A;  3RNS A;  1KFX L;  4CDX B;  3PIG A;  3WDV A;  4KNC A;  3OY8 A;  2XJV A;  2EAK A;  5FRE A;  4H2A A;  4M3C A;  5L9B A;  1UY1 A;  2QQO A;  3PUQ A;  3U11 A;  3ENR A;  5FLH A;  2AEZ A;  1IQD C;  4DFS A;  1Q8Q A;  3MW3 A;  3ZIX A;  4XJ9 A;  4Y33 A;  1XNA A;  4QXH A;  2GC1 A;  2XON A;  2FDK A;  4BLJ A;  1TVG A;  2V73 A;  2WNV C;  4B1M A;  1QY4 A;  1PZ9 A;  2Y33 A;  5HCF A;  2OYZ A;  5KR7 A;  1JZ6 A;  1CES A;  2XLA A;  4CCL A;  4AHW A;  5AVP A;  5FMO S;  2VZP A;  5DG1 A;  5L73 A;  2Y8K A;  1TME 1;  4KU8 A;  4KGG A;  1G8W A;  2R49 A;  1PO1 3;  2BVB A;  3WP3 A;  1I5Z A;  1E5I A;  1AJO A;  1NA1 A;  2JXA A;  3PHM A;  5K0U C;  2DCK A;  1F5J A;  2DWR A;  3NL1 A;  2Q8O A;  2A3W A;  2IXC A;  1CZT A;  1S0F A;  1MZF A;  1UY0 A;  3AZZ A;  4MXW A;  1ZRC A;  4AVC A;  5EIY B;  3JBG 1;  1O4T A;  3ME2 A;  4CDQ B;  1BVV A;  2LUW A;  1HKD A;  5FYB A;  5D8A C;  3CU7 A;  2ZA9 A;  1CAX B;  1R08 3;  1HIX A;  1BEV 2;  1QHD A;  3OG2 A;  3USU A;  3M7A A;  3NJZ A;  1POV 3;  4FOY A;  2ZAH A;  4JGY A;  3MF6 A;  1U5I A;  1APN A;  1ZVF A;  4HLT A;  2ZAA A;  5FKB A;  3DYM A;  4F8A A;  3RZJ A;  2WSV A;  4QKD A;  2HWF 2;  1OI6 A;  2YC4 A;  1RUE 3;  3SNM A;  2WRA A;  1OKQ A;  1ZZ7 A;  2LS6 A;  1OQD A;  1R1A 2;  2D43 A;  1DDL A;  5LW9 A;  3ZXE A;  2RS3 3;  1EUU A;  1HX6 A;  2YBP A;  4LIU A;  2WT0 A;  2QTW B;  2GME A;  3VBF A;  5C33 A;  1RUI 2;  1OA4 A;  2A6W A;  4QB1 A;  3KCY A;  4ZU4 A;  1PZ8 A;  2W0X A;  1K45 A;  3C7E A;  3DL3 A;  1QJF A;  3ILR A;  3VBU B;  3VZM A;  2WBK A;  4A7Y A;  4NRO A;  2ZTN A;  4Y1Y A;  5FQ0 B;  2VZU A;  3M1H A;  3BPS A;  4IV1 B;  1XBF A;  4IUG A;  4LLF A;  4XDQ A;  5CFD A;  3KZ4 C;  2VBP A;  1NKG A;  4MO3 M;  4NN0 A;  5I8Y A;  4QXK A;  1Y9M A;  5CFC B;  2YC0 A;  3W59 A;  4XF1 A;  1W8T A;  3O12 A;  3IAP A;  1QDO A;  2BOI A;  4IGO A;  5FZI A;  1LU1 A;  2FQP A;  1UYY A;  1RXG A;  2WO1 A;  3WHT A;  1AR8 2;  4O61 A;  3RZG A;  4E9K A;  3SEP A;  1O59 A;  5A6Y A;  3AYD A;  4JX0 A;  1VBD 2;  1NCQ C;  1AUY A;  1PMI A;  1QMJ A;  2XJP A;  5C70 A;  3O1U A;  1H8T B;  5A1L A;  4DY3 A;  3BU0 A;  3CDZ B;  4FPG A;  2DCZ A;  2W1W A;  3LOI A;  4HPK B;  2OS2 A;  2PQQ A;  1WZX A;  2R04 2;  2FDG A;  3J8F 3;  3POI A;  1LNS A;  2FD8 A;  4R8H A;  2X5I C;  5FK8 A;  4BZ4 A;  2ZZJ A;  1IPK A;  2JD4 A;  2WZE A;  1G9D A;  3ACG A;  1UPS A;  2DVB A;  4EN9 B;  4CUA A;  2ZXQ A;  4MAD A;  1RUD 3;  4DOU A;  5BNQ A;  2JKX A;  1AR7 2;  1X7N A;  2BZD A;  2I74 A;  4E8D A;  3I49 A;  4Y1V A;  1SCR A;  1MS4 A;  3AB0 A;  1D4M 3;  1HXS 3;  2OUH A;  3KCC A;  1EP0 A;  4I30 A;  1UWW A;  1SHW B;  2LTN A;  4H14 A;  4XFI A;  1XYO A;  2P5B A;  2VW1 A;  5GM0 A;  1SZB A;  2ZAB A;  3OGG A;  5C4W C;  4Z92 B;  4NWV A;  2WII B;  2ZGS A;  2DVA A;  4RHV 1;  3T1M A;  1JZ7 A;  3ZYG A;  5CG8 A;  5CKQ A;  3C8X A;  5FOJ B;  5K8S A;  4ZS2 A;  1ACC A;  2VXR A;  3UKV A;  3MYX A;  2GDF A;  3M3E A;  1RUG 1;  3ZKY A;  4OUE A;  2J1S A;  4AVV A;  2XPJ A;  1DIW A;  3ZSL A;  4FAG A;  4FFH A;  5TSW A;  4FTE A;  1L7L A;  3IPV A;  3KF3 A;  1B35 B;  4V2V A;  5DDJ 1;  2J7M A;  3ZYF A;  1M4W A;  1PNG A;  3VDD A;  5EQU A;  1TNF A;  3S6P A;  2C6S A;  1OOP B;  4A7K A;  1RJ8 A;  1XE0 A;  3O14 A;  4I09 A;  1XQN A;  2J1R A;  3W58 A;  3UK9 A;  5DAP A;  3NMB A;  4AGR A;  4JDO A;  1TME 3;  3VBS B;  4FFI A;  2ZX4 A;  1NZC A;  1VP6 A;  3ACL A;  4QQ2 A;  1YFX A;  5APA A;  1WLC A;  3LEG A;  3DPR A;  3O0W A;  5FXV A;  1H2L A;  2E7Q A;  5A32 A;  2WFF 2;  4FXK B;  2ID4 A;  3SKV A;  5CYY A;  3S5Q A;  1WUV A;  2XXZ A;  4CP9 B;  1WKY A;  2VC9 A;  1R1Z A;  1XND A;  5G04 L;  4CPB A;  3KD4 A;  1AR6 2;  1UOJ A;  5LA2 A;  4N7U A;  3ZMN A;  2ZEX A;  3NV1 A;  4LHS A;  5DMY A;  1ZRE A;  5FY8 A;  2YDE A;  1J1L A;  1YJL A;  3HQU A;  3PUR A;  3NKG A;  2WR9 A;  2HWC 1;  2PN5 A;  3AP6 A;  4IEZ A;  4QHZ A;  4XVH A;  4QPG B;  5FBZ A;  1ASJ 1;  1AR9 3;  2E31 A;  4CCN A;  2D40 A;  4CXX A;  2QFE A;  3POS A;  2X29 A;  2DCJ A;  1PGS A;  4LE4 A;  4E4Z A;  5K0U A;  4B8E A;  3RFR A;  1FV2 A;  3O1T A;  1U5Z A;  1HRI 1;  1JZ3 A;  1PGL 1;  3V56 A;  3OY8 B;  1LOE A;  4FPL A;  4K9S A;  4M3C B;  1FX5 A;  1GR3 A;  1MR5 A;  2DU1 A;  3MLJ A;  2V5D A;  4N53 C;  3BU7 A;  5A6Q A;  2ZGT A;  3N7L A;  5D8A A;  4C1W A;  2WAB A;  4LPL A;  3AFK A;  5E88 A;  3ES4 A;  2Q1F A;  3FJS A;  4P02 B;  1VRB A;  1PHM A;  3VGI A;  5JOW A;  1BXH A;  1ULO A;  1Y43 B;  2CTV A;  4M0H A;  3WCS A;  2R06 3;  5CU1 A;  1AYN 2;  3B3Q E;  5KXD A;  1ODN A;  3OUJ A;  1PM7 A;  2VZ1 A;  3LKJ A;  4TLG A;  1WBF A;  1ZBE 1;  3GBF A;  4R9A A;  3CL1 A;  2E6V A;  3PJQ A;  1REF A;  2NN8 A;  2FZ2 A;  3J7M A;  4N43 C;  1NA1 B;  4FTS A;  1XYP A;  1ZBA 3;  2HWB 3;  2OXB A;  3I8T A;  3SCG A;  3N9Q A;  3MPB A;  1W8W A;  3HN3 A;  4MXW B;  2DBN A;  3ZFF A;  1L3J A;  4LHN A;  1RB8 G;  1VBA 1;  1REE A;  2YZ4 A;  3AVS A;  4QB6 A;  5J36 A;  1D0H A;  5A3U A;  4ASM B;  5DUX A;  2J1E A;  1YI9 A;  2XVG A;  4I3G A;  3N9L A;  4KQ7 A;  3MHZ A;  3USU B;  3AXD A;  1DZR A;  3SLI A;  4MVT A;  4LBL A;  4JGY B;  3ZYH A;  3ZDV A;  4NRQ A;  4Y4R A;  4LKS A;  4TWT A;  1NY7 1;  2RR1 1;  3N7J A;  5EJZ B;  2C9A A;  3WT3 A;  4YZ5 A;  4P9G A;  5JXG A;  3RVH A;  2WLP A;  2VNG A;  5L7O C;  2EID A;  5F32 A;  3DEC A;  3J26 N;  4HBN A;  1AL2 3;  2ZHK A;  5E6H A;  5FZO A;  2G9F A;  3WP4 A;  1F15 A;  4BYY A;  3O1S A;  1SDW A;  1GIC A;  3E5Q A;  3O7O A;  4BQY A;  2DVD A;  5FY1 A;  3J8F 2;  3VKF C;  3O1M A;  1E57 A;  4RL7 A;  1JYC A;  2IXH A;  1WA4 A;  3PMS A;  1YJK A;  4WBB A;  4YNI A;  3VBF B;  2JX9 A;  1JOJ A;  5L36 A;  3POY A;  2EXK A;  1NCQ A;  1TEI A;  5A33 A;  4D8M A;  2D6M A;  3JD7 1;  4XZP A;  2HKX A;  3TN9 1;  4YZ1 A;  4I01 A;  5JSP A;  4W6X A;  1O3R A;  4PDW B;  5FMC A;  1UIJ A;  2XJT A;  1OSG A;  3O1P A;  4DRR A;  1BBT 3;  5CFD B;  3AJY A;  4RHV 3;  4FBF A;  3SCH A;  3SMH A;  3LB9 A;  4UFI A;  1N1Y A;  2GU9 A;  2JDA A;  2JEC A;  1YNA A;  2FBE A;  5A7S A;  5A70 A;  1IKQ A;  2RM2 2;  2WWJ A;  5K4L A;  5JXJ A;  1NLR A;  4AFB A;  2VW0 A;  3ZOI A;  5LAT A;  3KLS A;  3O0X A;  4NRM A;  4PF1 A;  1TZO A;  4Q4X 2;  3ZFE C;  2OA2 A;  4EN7 B;  2PHD A;  4URA A;  3JB4 C;  3I2O A;  1QXR A;  4NAM A;  4D7T A;  4DMI A;  5DDJ 3;  1JYT A;  1GBG A;  3WDT A;  4DQA A;  1AYM 3;  4AF9 A;  5FZD A;  2RJL A;  1PX4 A;  3PME A;  3H3Z A;  4EQV A;  3J7N A;  3UV9 A;  1OC1 A;  4MGY E;  1I1E A;  3OPT A;  5FP8 A;  4CXW A;  1R09 2;  4XXA A;  4M00 A;  2ZX0 A;  2ARB A;  3GZU C;  4FPO B;  5J98 B;  4XYX A;  1ZRF A;  4K1Z A;  4BQ4 A;  5KHG A;  3AP7 A;  2VW2 A;  4AXO A;  5FZ0 A;  1MEC 1;  2W2I A;  3WNX A;  1ZA7 A;  1WGP A;  3AM2 A;  2DCT A;  2DF7 A;  1DU3 D;  1OXC A;  1OD3 A;  3JB8 A;  5IW0 A;  2Y6G A;  3ZVX A;  1QQP 1;  2OPK A;  4L99 A;  3T2O A;  3M70 A;  5AC9 3;  4FOW A;  2AR6 A;  1OLM E;  5SV5 A;  3KVB A;  2BBV A;  4PIY A;  2XB6 C;  5C7G A;  1NZI A;  1UU4 A;  4CP2 A;  1DGW A;  1VB4 A;  4NRP A;  4NIA A;  4EN0 A;  3MBW A;  3OUH A;  5FZA A;  4Q29 A;  4LUK A;  2P3J A;  5IVV A;  4ZPI A;  1FT9 A;  3ZSK A;  4ISR A;  1L7Q A;  2VNR A;  4AVT A;  4CDU A;  1ASJ 3;  1UCX A;  3JXS A;  3WW1 A;  2BFU S;  2PA7 A;  4CCC A;  4LKD A;  3WEZ A;  1RUH 2;  4P9X A;  1I3H A;  1PGW 2;  4MUV A;  1NCR C;  3IDA A;  3LFI A;  1UL9 A;  4XAC A;  4BB3 A;  5KHK A;  1BEV 1;  2C1F A;  4NE9 A;  4TYS A;  3RRD A;  1MS5 A;  1ZX5 A;  1N1S A;  3QOP A;  2J1V A;  3U0Z A;  2JE9 A;  5LBC A;  5ACA 2;  3GXU A;  2JG8 A;  2Q8C A;  2AUY A;  3GBG A;  3R4D B;  1RUJ 2;  2AH2 A;  2B7Y A;  2YV8 A;  4Y3O A;  3VDD B;  4YW2 A;  1M06 G;  5JMO A;  4TN7 A;  5DUU A;  1W8F A;  1R1A 1;  1HB2 A;  1Q5O A;  3E6D A;  2C26 A;  2DYC A;  4CUG A;  1QNY A;  3IDC B;  2JWP A;  2H0B A;  4MGQ A;  1Y9G A;  1PMH X;  1SLL A;  1YO8 A;  2KR2 A;  1C5H A;  4KWL A;  3WXP A;  3DPR B;  1YEW A;  1QJZ A;  3B00 A;  2KXL A;  3KS7 A;  1WCK A;  5KC5 A;  1VPH A;  4HVR A;  2IXJ A;  3VHR A;  5A32 B;  4COU A;  2WO2 A;  3RQ0 A;  2VBB A;  4JHZ A;  4EWD A;  2BGO A;  4PI0 A;  5F2S A;  4FAH A;  4OYU A;  1A3K A;  4I0A A;  3R6S A;  2XUM A;  3NJY A;  3J7H A;  5C3Q A;  1ZBA 2;  4GB3 1;  5LK5 A;  2HWB 2;  4NII A;  3VDA A;  2ATF A;  1PIV 3;  3BIE A;  3HWJ A;  3A23 A;  3KWV A;  3NJV A;  3P6B A;  5EHD A;  2ARC A;  1OKO A;  4JZR A;  2NPI A;  3KGL A;  1EAH 3;  2VBD A;  4D69 A;  4XHB A;  3ON7 A;  4H55 A;  1POQ A;  2EA7 A;  3LEK A;  4NPL A;  1CON A;  3WQ0 A;  3VZL A;  2ZHL A;  4F83 A;  3EXU A;  4QQH A;  3ZYP A;  4CEY C;  3POE A;  5K0U B;  3DCQ A;  4YLZ A;  5JZG A;  5KXE A;  4UYB A;  2XQX A;  1IHM A;  2PHT A;  4ZU5 A;  5AFE A;  4UAP A;  3CZU A;  4BH9 A;  4EN6 B;  4FPC A;  1MS3 A;  1W8H A;  2XBO 3;  2OKX A;  1HB4 A;  3D0J A;  4N90 A;  1VBE 2;  5D8A B;  1WD4 A;  2Z2S B;  1AX2 A;  2BRT A;  3ZYI B;  3EBR A;  3K4D A;  4MOA A;  2UUR A;  3OUI A;  4NHL A;  5EJ1 B;  2WA3 A;  4YM3 A;  2VO5 A;  2JDZ A;  4PCR A;  3C7H A;  3LGR A;  3ZSE A;  1DQ4 A;  2WSU A;  3URF A;  3WF4 A;  3WV6 A;  2IXL A;  2E51 A;  5L7O A;  2ZPX A;  1J3P A;  1W6P A;  3GM8 A;  2JIJ A;  3N9N A;  4Y5Z 0;  1KEX A;  1LES A;  3LFM A;  5A3T A;  4AGV A;  2CAV A;  1OA2 A;  3AMM A;  2ZHM A;  3T4H B;  4RN5 A;  4NHY A;  4A45 A;  2B8M A;  4JHT A;  3E5X A;  4CU8 A;  1C28 A;  3BTZ A;  1MS1 A;  3ZFF B;  1V6J A;  3AKR A;  2GMP A;  2A6X A;  5DQ0 A;  1U5Y A;  4H3W A;  2YXS A;  3TNP B;  1OPO A;  4L11 A;  5A6Z A;  1LGB A;  4AWD A;  3H8X A;  4NAO A;  1S0I A;  5G05 L;  3JCI A;  2P6H A;  2VEC A;  4OMC A;  2QQI A;  2W1Q A;  1GOH A;  1C57 A;  1CAW A;  3E97 A;  3PTY A;  4Y4Y A;  2P1B A;  5GLW A;  5J48 A;  3TBD A;  3LEI A;  4AR2 A;  3POB A;  3F95 A;  4MGI E;  1NT0 A;  1H4H A;  3IN9 A;  3I2H A;  3DXU A;  4PF5 A;  3PUS A;  1LOA A;  3PVB B;  2QQK A;  2R0F A;  3IDB B;  2ZS6 B;  4QT6 A;  4K20 A;  1SPP A;  1TMF 2;  4FI9 A;  4HOO A;  1F4A A;  5GZD A;  1IPS A;  3Q8C A;  4XF4 A;  3HNY M;  3ZXF A;  3HD8 B;  2BNO A;  2ZKL A;  1G9C A;  3OB8 A;  4YVS C;  4UI9 L;  4KL1 A;  1NCQ B;  1GZW A;  1H1I A;  2AEY A;  4HXC A;  3SXW A;  5A33 B;  1VIW B;  5GZE A;  4EWE A;  3ILN A;  5B2G B;  4YW6 A;  1YIF A;  3AMQ A;  3PVO A;  2RDQ A;  3WDW A;  2WFF 1;  4XIK A;  4C1X A;  3TEZ A;  1JU4 A;  1WMX A;  3VKL A;  2VGD A;  4RGA A;  1ND3 C;  4QGL A;  4ZKT B;  1PO1 1;  3LF7 A;  2B42 B;  5LEJ A;  1BEV 3;  1F31 A;  2XHN A;  4BIF A;  5LZ6 A;  1J3Q A;  3I97 A;  4MX3 A;  5DAQ A;  2EIE A;  2E32 A;  4FT8 A;  4UW6 A;  4AI1 A;  4RA0 A;  2D6K A;  1CWP A;  1PK6 B;  2HWF 3;  4JGZ A;  1FPN 2;  4JRA A;  3BCW A;  3DKQ A;  2OUJ A;  3JU9 A;  1R08 1;  1ZZ6 A;  2GC2 A;  3S7E A;  2CDO A;  1R1A 3;  2O8Q A;  1W8O A;  2R1B A;  3ZIW A;  1POV 1;  1BJQ A;  1MVE A;  2Z42 A;  3OJB A;  1JOB A;  2C5D A;  4JVA A;  4PLO A;  4BLI A;  1RUI 3;  4HK8 A;  3WSO A;  4YM2 A;  3VKO A;  1MVQ A;  5A1F A;  5GAL A;  4UWD A;  3OEA A;  1OVS A;  3VDB A;  1W0N A;  1X82 A;  4LMF A;  1T6G C;  1LOD A;  5AVA A;  2R0H A;  2MEV 2;  1H1M A;  2DFC A;  2CY6 A;  2BER A;  4MZU A;  3LSD A;  2RS3 1;  2JEN A;  3R0R A;  3JZV A;  4QPI C;  1QJY 2;  3VB9 A;  4OI0 A;  1WW4 A;  1G9B A;  1AYN 1;  4K3U A;  5DZE A;  5T55 A;  5BNO C;  5EXO A;  1ZA4 A;  5FZE A;  3SIT A;  1QJX 2;  1O7F A;  2QQN A;  2SLI A;  1AR8 3;  1UY4 A;  2N7G A;  1TNR A;  4UW3 A;  1IS6 A;  4YG0 A;  1NQD A;  1ZZ9 A;  2GN3 A;  2GP5 A;  1VBD 3;  4ZXE A;  1CZV A;  4D6R A;  5LCW L;  4OVE A;  5CVR A;  5D2A A;  2WZR 2;  1W2U A;  4CDU B;  4E2S A;  5JPN B;  3AJZ A;  4LOT A;  3ZSJ A;  5I0S A;  1YFW A;  3F2Z A;  3WDY A;  1JYI A;  1MQT A;  2QQW A;  3RYK A;  2R04 3;  2A71 A;  1V6L A;  2MHF A;  2UWB A;  3T08 A;  2XHK A;  3J9S A;  2D7F A;  3OGR A;  4M4P A;  5F5A A;  3VBR C;  3L2H A;  4GIQ A;  2JG8 B;  1YQ6 A;  1XRU A;  3NST A;  5FFO C;  1GNZ A;  1OLM A;  2BNM A;  2LRP A;  1AX1 A;  4YM0 A;  2W1S A;  4AQT A;  5SV8 A;  1OA3 A;  3D5O A;  3J8F 1;  1W2O A;  3ZYJ B;  2QUO A;  1AR7 3;  4CRQ A;  5KHJ A;  1S0J A;  2VZS A;  2ADE A;  2O0O A;  3Q8B A;  2QDN A;  4I0B A;  2QJV A;  1LKN A;  3C2U A;  3NNG A;  5C3S A;  5EV7 A;  2I2S A;  3RGB A;  3TEY A;  1RUC 2;  4FQZ A;  4P14 A;  3RPQ A;  1X9T A;  1JUH A;  3H7J A;  2GH2 A;  5LBB A;  4IQP A;  1EY2 A;  3IAQ A;  5FYU A;  1W9Y A;  4XFA A;  3FUQ A;  5FBJ A;  1HRV 2;  1W99 A;  4M4R A;  2ZKN A;  1QWR A;  4XUN A;  1MAC A;  4LO5 B;  5F37 A;  1KFU L;  5BNN C;  2RM2 1;  4CTE A;  1O91 A;  4AI9 A;  4FSJ A;  3FL7 A;  3SCF A;  5FYS A;  4Q8K A;  1O3S A;  2F6B A;  1W8Z A;  2ZMK A;  3GYD A;  4Q4X 1;  5IVY A;  1W3X A;  3EJK A;  2GNB A;  4FFF A;  3BPZ A;  3HEI A;  2E53 A;  2VNO A;  4AED C;  3U07 A;  1RC6 A;  5T3N A;  4I02 A;  1S1A A;  2D93 A;  3HOB A;  1R09 1;  1SDD B;  4JKL A;  5A7P A;  3ZPY A;  1W2N A;  2BTV C;  2UU8 A;  5JZG B;  1GFF 2;  3RWN A;  4WV8 A;  2Q8E A;  2VXJ A;  4L9B A;  1DLL A;  4RD7 A;  4YWA A;  3RMY A;  4AFM A;  3VZN A;  5C8C A;  2ZGQ A;  5H9S A;  3ECQ A;  4UFH A;  1Z7S 3;  4CYD A;  3W5M A;  1SBD A;  3AL5 A;  2WFF 3;  2OX0 A;  2YB7 A;  2ZML A;  3BTX A;  5FUI A;  3A7Q A;  4CPB D;  2BDR A;  1GYK A;  1YQ2 A;  3UGF A;  3THD A;  4XUR A;  4BDV B;  1S2E A;  3CLP A;  5GKA C;  3SH3 A;  4AVS A;  1B09 A;  3BN6 A;  3HNM A;  3K3O A;  5I0U A;  4YZ4 A;  3UYJ A;  2BYV E;  4DNY A;  5I8T A;  1AR6 3;  4QX3 A;  3VD5 A;  5L7O B;  2FCU A;  2WNE A;  1C3H A;  1QXJ A;  2JDM A;  4MHR A;  5BY5 A;  3THT A;  4AW7 A;  4QQO A;  1KRI A;  3POW A;  1G7Y A;  3H7Y A;  5F8P A;  5JR2 A;  1DZT A;  5HI0 A;  1J83 A;  2BV4 A;  4B4P A;  1IZ3 A;  3VBO C;  3WHU A;  1JN2 P;  3HN1 A;  4XOG A;  5L9R A;  2VVF A;  5GJ6 A;  1RUH 1;  2YUE A;  1XSQ A;  1KDM A;  3RG0 A;  4AI8 A;  4QX7 A;  2W87 A;  2WZP P;  5HCH A;  1Y7B A;  2PHR A;  3OF1 A;  3FE5 A;  5A3P A;  1BCX A;  2FDI A;  4BPZ A;  4LBO A;  1CAW B;  2GAL A;  5IVB A;  5KHH A;  2WT2 A;  4ARY A;  2V4A A;  2J42 A;  2P37 A;  1AR9 1;  5GZC A;  1Z78 A;  1VRH 3;  2WL1 A;  2QBX A;  5HCA A;  4IV3 C;  1DQ5 A;  3FBM A;  4Q8L A;  3U75 A;  1ZRD A;  4W65 A;  1XPW A;  2D97 A;  1LEN A;  1AYN 3;  1XU2 A;  2ORZ A;  3IMM A;  3KV4 A;  2CWM A;  3WUC A;  1G9A A;  1NX9 A;  4XTP A;  2FZ1 A;  4IEX A;  2CGO A;  1U12 A;  3I2K A;  2P4E A;  5FPA A;  1GZW B;  4OUL A;  4AHZ A;  4HK9 A;  1X9P A;  2BQP A;  4BIS A;  2WC2 A;  5FZ7 A;  5K9Y A;  1J1T A;  1RTV A;  2XL7 A;  4DUW A;  5A80 A;  2R06 1;  2XG3 A;  4WVM A;  1V6O A;  1NUK A;  4K1Y A;  3C3V A;  4Q26 A;  1FYU A;  1HB1 A;  2R07 2;  5JDB A;  2VM9 A;  4XW3 A;  5DZG A;  5BPX A;  5IVE A;  1PX3 A;  4XJW A;  1ZBA 1;  2CWS A;  2VCB A;  2HWB 1;  3C7G A;  5FZC A;  3AKT A;  4R9C A;  3HT1 A;  3IB3 A;  2XH6 A;  2VOX A;  4JGZ B;  4AFD A;  4QPI A;  1DGW X;  4HG6 B;  1G9F A;  2B45 X;  3BKZ A;  1F5F A;  1W6O A;  2D6N A;  5JIA A;  1QOT A;  4QM8 A;  1BMV 2;  5FZ8 A;  3I59 A;  3B7M A;  2TNF A;  2W91 A;  2HH9 A;  1LEM A;  2QDR A;  3KB5 A;  2B5H A;  4LBQ A;  1KJL A;  1AL2 1;  3VLB B;  5FZG A;  5FY5 A;  4QX8 A;  5CNA A;  4CP1 A;  4XJU A;  3VHN A;  4ES8 A;  2EIG A;  3FN9 A;  1AF9 A;  2GSY A;  5CZK A;  3GCW A;  3POJ A;  4XCB A;  3MGU A;  5F3C A;  1AJK A;  1T6B X;  1CPM A;  4LK6 A;  3WG3 A;  1UYZ A;  4JRL A;  2RM2 3;  4Q5O A;  2Q4S A;  1FOD 2;  4PBO A;  4XFG A;  4ZU7 A;  4RR3 C;  4PIX A;  4Q4X 3;  4XUQ A;  2G9G A;  4B4R A;  1BBT 1;  1OUX A;  4RGK A;  1W9W A;  1QH6 A;  2CU5 A;  2PEL A;  2ZMN A;  1H6Y A;  2D3R A;  3CNA A;  3B01 A;  1SLA A;  3ZFG C;  1GWM A;  1XSR A;  1FXZ A;  1MS0 A;  4B4Q A;  5IFP A;  2WKK A;  5LRR A;  4AGG A;  4LHL A;  5JOY A;  2W46 A;  3BUC A;  1GP6 A;  1NXM A;  4IEV A;  3OPW A;  5GZF A;  1MQT B;  2DUQ A;  4AI0 A;  3Q8A A;  4Q4Y 2;  1R09 3;  5IVF A;  5F2W A;  3WP6 A;  3WG2 A;  3NNL A;  1H9P A;  5HXV A;  1ZZC A;  2VOW A;  4S2H A;  2RMU 2;  4LHK A;  5C6C A;  2NP0 A;  3JUU A;  3NAP C;  1DLC A;  4SLI A;  1K5M C;  1EV1 2;  1QOO A;  1AYM 1;  2YRO A;  2XGX A;  1W3V A;  1WMF A;  3K4A A;  3AYC A;  2HWE 2;  4OLL A;  1RUF 2;  3OGS A;  4X8P A;  4JDN A;  1LJ7 A;  3THC A;  1RMU 2;  2W9X A;  3WW3 A;  4QB2 A;  2ZGM A;  1RUO A;  1FMD 2;  2W52 A;  1LOF C;  2IVI B;  3QD6 A;  4IE6 A;  4J25 A;  4JV4 A;  4YGB A;  5FYH A;  4AE2 A;  3DXT A;  2YU2 A;  1CJD A;  3CJI A;  4ES9 A;  3ZKU A;  3ELN A;  3IT8 A;  4GH4 A;  3FZ3 A;  1Z7S 2;  3CKH A;  3KM5 A;  4MHU A;  4UOJ A;  3WX5 A;  4Y5T A;  4A7Z A;  3BAL A;  3WNN A;  1WWY A;  4J1W A;  4QDS A;  2VZV A;  2W5F A;  3WQ1 A;  2DDU A;  3POG A;  2ERF A;  3RI9 A;  2BEO A;  2HWD 2;  2WWU A;  1I9R A;  4XFF A;  3T1L A;  3RI8 A;  3EYP A;  5FPV A;  3GJA A;  4Q1R A;  5AC9 1;  5C9A C;  5K7P A;  4IES A;  5EFU A;  1EPW A;  3V64 A;  1RUH 3;  2RE9 A;  1ENX A;  1O5U A;  2JE7 A;  2QKD A;  3P1I A;  3ROU A;  2RS1 2;  4UFK A;  1KGY A;  3K75 B;  3KHC A;  4HKW A;  4CCD A;  2HLE A;  2HYX A;  4QX0 A;  4XF3 A;  4OZX A;  5HV4 A;  2Z69 A;  3VD9 A;  3AZY A;  3KSC A;  3I3M A;  2WNV A;  2NYY A;  4R52 A;  4XUP A;  5ACA 3;  2YFU A;  5IAV A;  4CDW C;  1UW8 A;  3AC0 A;  2JDY A;  2YPD A;  4QM9 A;  1RUJ 3;  4HKL A;  3ZXD A;  1E5S A;  1VAV A;  5LBF A;  3VZO A;  4YVW C;  2PTM A;  3U4S A;  4RQP C;  1C8N A;  1VE0 A;  3AP4 A;  1ULD A;  4IND A;  3WW4 A;  5HBA A;  3B93 A;  1K5J A;  1D0G A;  3NKT A;  1X8M A;  4P5Y A;  1V00 A;  4MH0 E;  2E7A A;  1OMI A;  4W50 A;  5FZ1 A;  1BVP 1;  4CXY A;  4HET A;  4XDO A;  3ZM8 A;  1S55 A;  1CN1 A;  1W6M A;  2I07 B;  4BQ5 A;  4QKN A;  1VRH 2;  3RZZ A;  2QCS B;  3A4U A;  3ZR6 A;  5IJR A;  5C8C B;  3LAG A;  5IT6 A;  1VBB 2;  1UX7 A;  4AFA A;  1ENQ A;  1E5H A;  2WN2 A;  2JIG A;  2A6Y A;  3ABZ A;  4DRV A;  4GAL A;  4LKE A;  5D21 A;  1LEC A;  4D0Q A;  5FR3 A;  1KIT A;  5FZ3 A;  5IK8 A;  1WLD A;  2BU9 A;  5FLI A;  4XDP A;  5EZW A;  1W6N A;  2HEV F;  4KBZ A;  2ZBJ A;  4XAB A;  2ORX A;  4GKY A;  4EYU A;  2CYF A;  2D5H A;  4OHV A;  3RZL A;  3W5N A;  2ZEZ A;  3V0A A;  5FUP A;  3VL9 A;  1VBC 2;  4E27 A;  2BWC A;  3PUH A;  4Q0S A;  4IV3 A;  1JBC A;  2ZAC A;  1JOD A;  5ABJ C;  1O3T A;  1UXZ A;  1Q43 A;  2XJS A;  2YPJ A;  1BYH A;  2A3X A;  4DS0 A;  5IVJ A;  4N7I A;  5IYY A;  4XAE A;  1P8J A;  4K40 A;  3RS6 A;  2BOJ A;  3QLQ A;  3OD4 A;  1LAJ A;  2IVJ A;  4HN0 A;  4HAN A;  1U0A A;  1PIV 1;  1FAY A;  2ZHN A;  3OEB A;  5EJ3 A;  1G86 A;  3LE0 A;  3S5A A;  2BP6 A;  2JIC A;  3WD5 A;  5LY2 A;  3AZX A;  3GBW A;  4L2N A;  1EAH 1;  4YW7 A;  4CDX C;  4OZO A;  3UJO A;  5I0R A;  3S0M A;  3OTF A;  4N9H A;  1UZY A;  3ACF A;  2FCT A;  5E16 A;  1W06 A;  2Y60 A;  4FP2 A;  1UOB A;  1VBE 3;  4BK5 A;  3LPG A;  2JB4 A;  4QX5 A;  2A7A A;  4AEK A;  4CZS A;  4E8C A;  3T0D A;  4LO6 B;  1W2A X;  1YLL A;  1ND2 C;  3E1F 1;  3GGL A;  4XMI A;  5FZ6 A;  2YBS A;  4M3C F;  1V0A A;  2XBO 1;  3L9J T;  4XQ4 A;  2W08 A;  1V9U 2;  4ITC A;  5FWE A;  3ZMO A;  4EN8 B;  3WG1 A;  4D6S A;  1N3P A;  3ILF A;  2NM1 A;  4QMA A;  3VN4 A;  4ZS3 A;  2JJ6 A;  3MIC A;  4MLO A;  4URT A;  4DB5 A;  2X5I A;  3ATG A;  4WVM B;  4ASL A;  3VHO A;  1HRV 1;  1JYW A;  2VOK A;  4CDQ C;  4QU2 A;  4QD2 A;  3ZYB A;  4A3X A;  2YC2 A;  1YIP A;  4LIV A;  1DGR N;  2PFW A;  2EAL A;  3X29 B;  4AAX A;  1STM A;  3WDU A;  2DUP A;  4AVA A;  1PO2 2;  4WM8 C;  2ENR A;  4Q4W 2;  4UT5 A;  4XQW A;  3UT0 A;  4LNV A;  4QQL A;  2VNV A;  2VTX A;  1SLB A;  4QPI B;  1US2 A;  4Y1X A;  2EIC A;  4HT1 T;  4O9E A;  1W6O B;  5JMC A;  1TMF 3;  5C4W A;  1L7R A;  1X33 A;  1WLT A;  3I59 B;  3PUA A;  5FO7 B;  5J37 A;  1I5P A;  4RR3 A;  5FLJ A;  2CV6 A;  3DEM A;  4MGS A;  1WCS A;  3RSJ A;  3WW2 A;  1IQA A;  4CU6 A;  2HEY F;  4UW4 A;  2BW8 A;  4WVV A;  3ZFG A;  3ZXK A;  4LBQ B;  5I0T A;  1WA6 X;  4XFH A;  1WLW A;  5IFT A;  4XF0 A;  3SHR A;  3AFG A;  4FPE A;  1NE6 A;  4LTA A;  1HQW A;  1HQL A;  2D44 A;  3LDK A;  3SH4 A;  3ZXL A;  3U1X A;  4CU7 A;  2X09 A;  5CFC C;  2H0V A;  5LEK A;  1V6K A;  5JCT A;  3LQC A;  5A3L A;  2AZ5 A;  1K5M A;  1XNC A;  2WNU C;  2GNM A;  3IDE A;  3N9O A;  4MG2 A;  3ETP A;  1HJG A;  3PL0 A;  2VUL A;  4NID A;  1IOA A;  2MPF A;  5HCB A;  5C3O A;  4A42 A;  1SFP A;  3S57 A;  1FPN 3;  2WS9 2;  3K46 A;  1OQ1 A;  4TZD A;  4GZ9 A;  2UY9 A;  4IGP A;  4DPN A;  2IUW A;  4BMB A;  5FP3 A;  4QPW A;  4C90 A;  1IGO A;  3LWC A;  5F5I A;  1UZV A;  2MNG A;  1GMM A;  3ZYR A;  2H6B A;  4ZHN A;  2D98 A;  4E4H A;  4OI4 A;  3OBT A;  4NHK A;  4Q0Q A;  3U14 A;  2LRO A;  4NR1 A;  3FFQ A;  3IPV B;  1UKR A;  3N7K A;  4IER A;  1JW6 A;  2DV9 A;  2HWF 1;  4P9L A;  1DGR A;  1JYV A;  4YW3 A;  4AL9 A;  3JBG 2;  1XB9 A;  4W6W A;  1DGL A;  4NPR A;  4Y1U A;  1LOB A;  5C9A A;  4M01 A;  2MEV 3;  3HMY A;  2YFZ A;  3TEX A;  4UBH A;  4OQ8 A;  1TQ5 A;  1W9S A;  1XU1 A;  4OFG A;  3VD4 A;  3NV4 A;  1LGC A;  1QJY 3;  1Q56 A;  1C8M 2;  1RUI 1;  4K8R B;  4LO8 A;  5E1R A;  1GZC A;  1OLR A;  2IWG B;  1UXX X;  1RL3 A;  1YQ8 A;  3CJI B;  3NV3 A;  3I3D A;  4GMP 0;  2ZGO A;  2A6Z A;  4GH4 B;  1KJR A;  1QJX 3;  3WNP A;  1QGL A;  3THP A;  2Q8D A;  1MPX A;  1QKQ A;  4PJY A;  3AL6 A;  4IEP A;  1H2M A;  4UBG A;  4FCA A;  4EZ4 A;  1IG3 A;  2J1T A;  1T2X A;  2A75 A;  1LB2 A;  2ZX3 A;  2WZR 3;  2RDS A;  2VQT A;  3RJ2 X;  4DXZ A;  5FMB A;  4N53 A;  1WW5 A;  2B9U A;  3ETQ A;  3QBQ A;  1VR3 A;  2EIB A;  2R07 1;  5FKC A;  4QHO A;  3ZN4 A;  5CEH A;  1AR8 1;  3KT7 A;  1JZ4 A;  1CJP A;  2FDF A;  5C71 A;  5LBE A;  5A3N A;  2WNV B;  3AYE A;  3Q8F A;  1VBD 1;  3H0O A;  5F6K A;  2BJS A;  2K9Z A;  4XJZ A;  4FTB A;  4FPF A;  1B35 C;  1WMD A;  4PLN A;  1RHI 2;  2YYO A;  5JSR A;  5D1I A;  4Z2A A;  3U4X A;  3VHP A;  2EXI A;  2Z79 A;  4N43 A;  1OOP C;  2Q5T A;  3WVJ A;  2R04 1;  3VZJ A;  2Y64 A;  3ZPO A;  1IPJ A;  5JI9 A;  2PAK A;  2GAU A;  4IET A;  4YZ2 A;  3AMH A;  2ZX2 A;  2WQZ C;  1Q8P A;  3KVA A;  3VBS C;  4GMP 3;  4A6S A;  1W6M B;  4PIZ A;  1QU0 A;  4AG4 A;  4AEJ A;  1RUC 3;  2J1U A;  3VBH C;  1UNB A;  1VMH A;  3MIE A;  4A2U A;  5FWJ A;  2FMY A;  1S0C A;  4P9W A;  1AR7 1;  4Q1P A;  1HRV 3;  4UFJ A;  1UMI A;  4BJ0 A;  3NV2 A;  4BM8 A;  2DFB A;  1J3R A;  3CEW A;  3I3E A;  4YZ3 A;  3V0A B;  3R4S A;  1FOD 1;  3LEM A;  4BK4 A;  4BQ3 A;  3C7F A;  4LEJ A;  4IV3 B;  1RUN A;  3KV9 A;  4HON A;  1IS4 A;  4BE3 A;  2WA4 A;  3M8L A;  2GMM A;  4JTN A;  2CL2 A;  3HQR A;  1ONA A;  3OGV A;  1ND2 A;  3B9I A;  3LA3 A;  3NWK A;  4QPG C;  2CHH A;  3CBN A;  2B4K A;  2VUA A;  1CR7 A;  5KHI A;  3I3B A;  1JMU B;  3CIH A;  4Q4Y 1;  4XBN A;  1CAU A;  4ASK A;  3HQX A;  4UFL A;  3KT4 A;  1GQH A;  5FZH A;  2OII A;  5ERL A;  1F4H A;  5KBF A;  2HBT A;  3CZJ A;  5FZO B;  1DYP A;  1V70 A;  2XL9 A;  2P3Y A;  5B4X A;  3NW4 A;  5T5L A;  3MUZ 1;  4V2W A;  4DUX A;  2LW8 A;  4N9I A;  2RHP A;  2RV9 A;  1LCL A;  3O5S A;  2A73 B;  2VTF A;  1RMU 1;  4XBL A;  3ZFE A;  4Z8B A;  3MDP A;  2WO3 A;  1RUG 2;  2WYF A;  4ZZ5 A;  2ZGL A;  3CHX A;  3FWE A;  3WF3 A;  1S0E A;  1VLN A;  3PVE A;  4WM8 A;  3Q8E A;  2Y6K A;  4FPK A;  4XIO A;  4Q27 A;  4Z07 A;  4XFB A;  4DEV A;  1X50 A;  5FYY A;  1XNB A;  1Z7S 1;  2WFP A;  1NA1 C;  3DUI A;  2UWA A;  2Y6H A;  4JCK A;  1WW6 A;  1VJ2 A;  4YG6 A;  1FV3 A;  2IXK A;  2PAM A;  3N35 A;  1JHN A;  2PHF A;  3D4K A;  4Y1Z A;  1JZ5 A;  2X5I B;  5B4N A;  5GZG A;  5FDB A;  1ENS A;  3ALQ A;  4AHY A;  1H2N A;  1N1V A;  2B39 A;  3D0S A;  1AR6 1;  1EUT A;  4NO4 A;  1DYO A;  3KQR A;  2RS1 1;  3S30 A;  3O1R A;  3HJR A;  1ZRR A;  1BK0 A;  3FHI B;  4LIT A;  4P5H A;  2VQ0 A;  4QKF A;  1NG0 A;  3FLP A;  4DEQ A;  4QWN A;  4RS5 C;  3QH7 A;  4DIQ A;  3AK0 A;  4AVB A;  1NE4 A;  3W20 A;  5CFC A;  2CDP A;  3JQW A;  5FPB A;  4CCM A;  2IZW A;  4D7Y A;  1H6X A;  3ZSM A;  5BNP C;  2WNU A;  4LUL A;  4TXW A;  4KH9 A;  1YWK A;  1RVF 2;  3N7M A;  2RDN A;  4X8N A;  4SBV A;  5FJH A;  1QNW A;  4M0N A;  5C4W B;  4LLO A;  4RR3 B;  2Q1M A;  1HN1 A;  1LR5 A;  3QAC A;  2W1U A;  2Y0O A;  2K0G A;  2XLF A;  1H9W A;  3WP5 A;  4OQ9 A;  2HWC 2;  3HNB M;  3IKW A;  2WAA A;  4O9G A;  1K42 A;  2B46 X;  1VRH 1;  4V1P A;  4Z1V A;  4DXR A;  4JKK A;  4QXB A;  1NCR A;  1VBB 1;  1LU2 A;  4PDW C;  1S2K A;  1AXZ A;  1C1F A;  1D2S A;  3RZK A;  2EXJ A;  2A5Z A;  4P9I A;  4EV0 A;  3H8O A;  4FXG B;  2VZT A;  1HRI 2;  2PHX A;  1UMZ A;  1PGL 2;  2VMF A;  4HVQ A;  3POF A;  1H2K A;  2F17 A;  2R07 3;  1K5M B;  3UET A;  5BV6 A;  1GU3 A;  1QXP A;  2VQU A;  2AEN A;  2G4I A;  2ZOE B;  4CSW A;  4FPY A;  4XEZ A;  2WIN B;  4AZZ A;  4F7Z A;  5C5T A;  4MGZ E;  5LA9 A;  1CD3 G;  1EPZ A;  5E89 A;  2VL4 A;  2NQY A;  4I2O A;  1K12 A;  3PTR B;  3I54 A;  5H9Q A;  3B02 A;  1HDK A;  1MZ6 A;  5T50 A;  1ZBE 2;  4E2Q A;  2P34 A;  3M3O A;  4CVU A;  2JDH A;  1N3Q A;  3R4U A;  4LBJ A;  3G7D A;  4LBQ D;  4MSV A;  5FZF A;  3ZXA C;  2VOT A;  4BOW A;  5FYZ A;  1S0G A;  4GXL A;  4WVZ A;  4ZXK A;  4KU7 A;  2HJI A;  2P3K A;  1UU5 A;  1VBA 2;  5FAX A;  3T30 A;  5F5C A;  1ULC A;  3BYW A;  3M3Q A;  5FYM A;  2DCY A;  5F9T A;  2VPV A;  2ZGN A;  1CZS A;  3WF1 A;  5JR7 B;  3HBZ A;  5FJK A;  4XC9 A;  1BKZ A;  4ZON A;  2PQS A;  5F3E A;  1CIY A;  3WNM A;  5A6X A;  1NY7 2;  2RR1 2;  5F3G A;  5FPU A;  3QH6 A;  1OLQ A;  2OW4 A;  5L9V A;  4K7J A;  1JYN A;  3DYO A;  2OT7 A;  3VV1 A;  2RVA A;  2XJR A;  1GZT A;  2G19 A;  2QQV A;  3E5U A;  1FOD 3;  3U37 A;  1US3 A;  1QEX A;  2YMZ A;  1S0D A;  1V9U 1;  2DTY A;  4L8Q A;  4NHX A;  1UN1 A;  4KBB A;  4CEY A;  4ARX A;  2D5F A;  4KMQ A;  4R4Z A;  2Q0A A;  1JXN A;  2GH8 A;  1CVN A;  1UOF A;  4FPJ A;  1GLH A;  3G6J B;  2XJU A;  1W8N A;  4XCA A;  1ST8 A;  2QZ3 A;  3J7L A;  4HSL A;  3WR0 A;  2NLR A;  1GWK A;  1YFU A;  1W2T A;  1W9F A;  4G3Y C;  3P5B A;  1GZ9 A;  1NXD 1;  2J1A A;  4N53 B;  4Q4Y 3;  3JD7 2;  4ATF A;  1HW5 A;  5CKM A;  3VBH A;  5CA6 A;  1GNH A;  2BGP A;  2RMU 3;  4LBK A;  5DG2 A;  4GWM A;  4ERO A;  1JYX A;  1EV1 3;  1OFN A;  2QNK A;  5LK7 B;  4Q4W 1;  1MZ5 A;  4R9B A;  3I2I A;  4GUL A;  1QJE A;  3KMH A;  1VAL A;  2HWE 3;  2JEM A;  1RUF 3;  5FYT A;  3KGZ A;  4COW A;  5F5Q A;  3VDD C;  1AXK A;  2AGS A;  1RMU 3;  4N43 B;  3NNJ A;  3WNK A;  1FMD 3;  4CUB A;  2WNO A;  3K51 A;  4I3P A;  4BU2 A;  3BOP A;  5BYN A;  4QGN A;  3O0V A;  3AKS A;  3OD0 A;  3J4U H;  4FO9 A;  1ZYB A;  1FI2 A;  4AYU A;  1DQ6 A;  1OF4 A;  3SKJ E;  5KXC A;  3A0K A;  3NO8 A;  4HZF A;  1SBE A;  4CCE A;  2PYT A;  2K46 A;  3MO4 A;  3K2O A;  2ADD A;  3IMN A;  3M4F A;  2XWB B;  1WBL A;  2FHR A;  1JTZ X;  1PM4 A;  2HWD 3;  3DGT A;  3I7D A;  4G4F A;  4BWO A;  4Z82 A;  5C5U A;  4YG3 A;  1N1T A;  3MF9 A;  3N4M A;  4TLF A;  1K3I A;  2HYK A;  2VZR A;  1AL0 G;  1W6P B;  2RS1 3;  4Y5S A;  5J3U A;  3CJX A;  4LO7 A;  2WQ4 A;  1MEC 2;  5FY4 A;  4AQ2 A;  3GZT B;  5FYI A;  3PDQ A;  2X10 A;  5FTT C;  5A7Q A;  4XIL A;  3W21 A;  3GDB A;  3HBK A;  1OVP A;  3TAY A;  2WJS A;  2W47 A;  4QHB A;  3DF0 A;  1QQP 2;  3LD8 A;  5DN2 A;  5FMO L;  2WS9 1;  4YVS A;  1ND2 B;  1SBF A;  3AVR A;  3H8R A;  1O8S A;  1PGW 1;  1DYK A;  2C9K A;  1ZRI A;  2R16 A;  3RMX A;  2WO7 A;  1V6M A;  3MW2 A;  2B9V A;  1XE8 A;  1TG7 A;  3MEP A;  3PUI A;  4JDM A;  3NNF A;  1GUI A;  3NRU A;  1C5I A;  1A6C A;  1W90 A;  1JH5 A;  3HVD A;  1CAU B;  5ACA 1;  2OPW A;  2RG4 A;  3BOD A;  4XF9 A;  3WNO A;  2X05 A;  2V09 A;  2JDP A;  1GAN A;  1ND3 A;  1RUJ 1;  4IXL A;  1LHN A;  1GOG A;  5FYC A;  1VBB 3;  3DYP A;  4PHZ A;  2A1X A;  3OOX A;  3H3U A;  1SMV A;  3AKP A;  3FMG A;  5LRS A;  2VVE A;  4AI3 A;  3AP5 A;  1SPP B;  4ISQ A;  4A44 A;  3N36 A;  1C1L A;  2DUR A;  3ZFE B;  2VMG A;  5A7N A;  4RSU A;  5FP9 A;  4XXP A;  4X6R B;  4HN1 A;  4RS5 A;  1C8M 1;  2E26 A;  4ORF A;  5F1R A;  4C91 A;  2VAU A;  4WM8 B;  4YGE A;  3FC0 A;  4IEW A;  3WZ1 A;  4BQ2 A;  2UYA A;  5HPO A;  4C8D A;  1VBC 3;  4E4S A;  4YFZ A;  3T4V A;  1QIQ A;  1BZW A;  2JG9 C;  3BB6 A;  4N8M A;  4NPM A;  4XET A;  4B1L A;  3HAG A;  5FMD A;  1RIT A;  5BNP A;  1PVC 2;  1YYN A;  5T5J A;  3LIH A;  4AI2 A;  2R6Q A;  3ZN6 A;  5CAZ A;  1GNY A;  3LDR A;  3RZM A;  4B7K A;  1QF3 A;  3ZFF C;  1A34 A;  2XOM A;  4FVV A;  1LOC A;  4P9J A;  2W68 A;  3L2Y A;  1ZZB A;  1N47 A;  4NOT A;  1H0B A;  2VZ3 A;  2P2K A;  3ES1 A;  3GHN A;  3ZN5 A;  4TTG A;  1S0B A;  1KDK A;  2WLQ A;  1UQX A;  1X36 A;  2OQ6 A;  3P3N A;  2Y6F A;  1QJU 2;  4PDW A;  5LA0 A;  2VUJ A;  3AZW A;  1NQJ A;  5CG9 A;  1CX1 A;  3K3N A;  1D7P M;  5T54 A;  2NMO A;  3C7O A;  3LSE A;  3OGJ A;  2ARA A;  4DXS A;  5BNO A;  2TBV A;  1RHI 1;  2DUO A;  3EMR A;  5FZK A;  2ZJC A;  3ZDS A;  4AEM A;  2QVS B;  2WNU B;  2Q1Z B;  3CO2 A;  4GB3 2;  4I0W B;  1XNT A;  1BLZ A;  2R32 A;  5J96 B;  2PAE A;  2PLV 2;  3FLT A;  4XQD A;  4GAZ A;  4GA9 A;  1A78 A;  2ZZQ A;  1UOG A;  2WT1 A;  1J59 A;  1Y3T A;  3RYR A;  4G9S B;  1V9U 3;  1F2N A;  1VBE 1;  3WQ7 A;  1W6Q A;  1NCR B;  4IE0 A;  4KG8 A;  3OYW A;  4YFW A;  4BHP A;  4NIH A;  3IM0 A;  2JKB A;  5ANN A;  1MS9 A;  2J22 A;  3VBR A;  3I2D A;  2R30 A;  4Q0P A;  1UY2 A;  5FZ4 A;  1UU6 A;  2VVD A;  4OI1 A;  4GWN A;  3DN7 A;  2O1Q A;  1COV 3;  1DQ0 A;  2YU1 A;  3EHK A;  1DFQ A;  1LHU A;  4DY5 A;  3H1Y A;  2CGN A;  5EP9 A;  4D6Q A;  2XKP A;  1PO2 3;  1PK6 C;  4Q4W 3;  3OCP A;  1SLT A;  4ATE A;  3S7I A;  1UKG A;  5GLU A;  1J58 A;  3FHQ A;  4W4Z A;  1W0P A;  4EZH A;  4HKO A;  4AQ6 A;  3KV6 A;  2AAC A;  2KM2 A;  1W04 A;  4IGQ A;  2RS5 2;  1GKB A;  3GNE A;  4OHW A;  4O65 A;  5FXW A;  2VE1 A;  4Y22 A;  2RJ2 A;  4YRD A;  2JE8 A;  2H6C A;  1CQ9 A;  2ARE A;  3GCX A;  4Q4V 2;  3H50 A;  2GC3 A;  2KA3 A;  4D7S A;  2BPA 2;  5BNN A;  1WW7 A;  1UIK A;  1SG3 A;  1TMF 1;  2K2S A;  2VMI A;  3PIJ A;  1YXW A;  2PHW A;  1W0O A;  1UO9 A;  3LOB A;  1Q8O A;  5I8S A;  2VCA A;  2VUD A;  1O4Y A;  4YW5 A;  4A6O A;  5AFB A;  1WME A;  2DU0 A;  3CQO A;  4AED A;  2PXJ A;  2WAO A;  1YRZ A;  2C4X A;  1Q8S A;  2VU9 A;  2ES3 A;  5JI7 A;  4CP0 A;  3PU8 A;  4CEY B;  2G9Z A;  1OT5 A;  4NMI A;  3P3P A;  4C0H A;  4ZZ8 A;  1YI7 A;  4BXF A;  1AXY A;  1RGS A;  2WS9 3;  4CDU C;  4F3J A;  3MZH A;  4E2G A;  3KHB A;  1N3O A;  5C8W A;  4OCT A;  1D2Q A;  5FY0 A;  4BQX A;  1W03 A;  1J84 A;  2ZX1 A;  1PNF A;  5T5P A;  3VBH B;  1H30 A;  4YAR A;  1JHJ A;  1FPN 1;  1XNK A;  3CMG A;  3OSD A;  2VMH A;  4PI2 A;  4KWK A;  2F4P A;  2JG8 C;  3JBG 3;  1LHW A;  4IEO A;  3SQO A;  3NQH A;  4UF0 A;  1TE1 B;  4Q0U A;  1ZNP A;  4MYE A;  2CSG A;  1PO1 2;  2L9L A;  2LM3 A;  5DUV A;  2V4V A;  5DUW A;  1RYY A;  5GLV A;  3AKQ A;  2ZCW A;  1RVF 1;  5F3I A;  1LOG A;  3TOJ A;  3ZR5 A;  1ULE A;  2OVU A;  1C8M 3;  4KWJ A;  4MGK E;  3TWI A;  2YGL A;  4YW4 A;  3BI3 A;  4A4A A;  3VBO A;  5CIS A;  4Y26 A;  3FX3 A;  2WQ8 A;  5FOB B;  4BA6 A;  3O1V A;  2MEV 1;  1Y9Q A;  3MID A;  1R08 2;  1FNY A;  3H42 B;  2EVX A;  3PU3 A;  2R1D A;  2ZGU A;  3B69 A;  3UKN A;  4CEW C;  2Y26 A;  1QJY 1;  1UD1 A;  4PLM A;  2E63 A;  4WM7 C;  4NVP A;  1AHS A;  4KI5 M;  4LOS A;  2OQ7 A;  3T0B A;  3ACH A;  1RUE 2;  1PZ7 A;  1QJX 1;  1YUD A;  3IZO A;  3MW4 A;  4XUO A;  5DAX A;  5FP4 A;  5A7W A;  2ETE A;  5FK7 A;  1JZ2 A;  4BCU A;  3MV1 1;  3ACI A;  1UMH A;  4XJA A;  1G6N A;  2RS3 2;  1LGN A;  2Y34 A;  1LTE A;  2W3J A;  2WZR 1;  2D3P A;  1RHI 3;  4IL7 A;  1FAT A;  4QAW A;  5DZF A;  4YVS B;  1H4G A;  1DG6 A;  1VB2 A;  3T2T A;  3HPN A;  3LPF A;  2A3Y A;  1O4Z A;  1ODM A;  1JZ8 A;  1ULF A;  4IEY A;  4LT5 A;  2JG9 A;  3MLL A;  2Z5W A;  2RJK A;  1VAM A;  5JZG C;  3VKN A;  1SAC A;  1XJA A;  4XTM A;  1A8D A;  1ND3 B;  3FLR A;  1PVX A;  4EJR A;  2F4L A;  5I0D A;  4AFC A;  1IG0 A;  1OPM A;  4TSV A;  4JQR A;  4AOC A;  1QOS A;  3GJB A;  4XHX A;  4GMP 1;  4GQ7 A;  4RS5 B;  2JDK A;  5KXB A;  4OHY A;  3GHM A;  3RWK X;  5LB6 A;  3WF0 A;  4IW3 A;  1RUC 1;  4P00 B;  4Y20 A;  3CF6 E;  3I2J A;  1IS3 A;  1V6I A;  4XZU G;  1W05 A;  3Q9O A;  5GLZ A;  4DUV A;  3KT1 A;  5BNP B;  5CBL A;  1GP4 A;  4GJY A;  1ZZ8 A;  3H1W A;  5LWB A;  4W8J A;  1UX6 A;  3ZN6 B;  1SLC A;  2R7E B;  1I6X A;  4LJH A;  3VKM A;  5JUV A;  1COV 2;  4NJ4 A;  1UZ0 A;  3JQX A;  4JQT A;  1YHF A;  3LCP A;  1DP0 A;  1GSL A;  5ISL A;  4BQ1 A;  3T3Y A;  2BNN A;  2E9Q A;  5DPN A;  3WCR A;  4CE8 A;  1W8U A;  4CCO A;  4OHX A;  4XJ8 A;  5FO9 B;  1UPI A;  1RUD 2;  2FDH A;  1ULP A;  4LQR A;  2SBA A;  3A22 A;  4JTO A;  3T09 A;  4AQS A;  5DXD A;  5BNO B;  4L0P A;  2ET7 A;  4S2G A;  1KS4 A;  3TRS B;  1HLC A;  3AMN A;  1NLQ A;  2G1M A;  1D4M 2;  1HXS 2;  3PNA A;  1WD3 A;  1O3Q A;  3WIN E;  2EAA A;  1URX A;  1RUG 3;  3D8C A;  4ET7 A;  1CGP A;  4KWU A;  1JS9 A;  4X6Q B;  1LRH A;  3VBU C;  3OBR A;  4FQ4 A;  2BGC A;  4RFR B;  1PK6 A;  4QKB A;  3VL8 A;  4HL0 A;  4P9Y A;  4YPJ A;  1NAE A;  4IV1 C;  1F9K A;  4RGG A;  3WLU A;  1UZW A;  1W6Q B;  3MV0 1;  3OYW B;  3BVC A;  2P17 A;  2VME A;  3SEE A;  5JVV A;  1EYB A;  3SIS A;  3VBR B;  3NAP A;  5JIU A;  3WQB A;  3ITQ A;  1MS8 A;  2ZEW A;  4Z2W A;  5F7U A;  1WCU A;  1UYX A;  1GQG A;  2IFW A;  2VMC A;  1XE7 A;  1LOF A;  3K48 A;  5A3O A;  4XFC A;  1ALY A;  4IEU A;  3VD7 A;  2FCV A;  2P6C A;  1H8T C;  5FO8 B;  4HFS A;  4JGZ C;  1TME 2;  4CCK A;  1RIN A;  4WZC A;  1GWL A;  5KC6 A;  1PMJ X;  2O14 A;  1OQE A;  1Q3E A;  3I2G A;  2EXH A;  1RVF 3;  4LA3 A;  4GD4 A;  2VCC A;  3T2P A;  1RIR A;  4DIN B;  1JU3 A;  3LZZ A;  3MUY 1;  4Y22 B;  2HWC 3;  2BFU L;  3WOG A;  1CAV A;  2I45 A;  3ORJ A;  1KS5 A;  4FOV A;  5FRA A;  2X8K A;  1DHK B;  4OMD A;  3EQE A;  4S2F A;  4XPV A;  5FY7 A;  5JXH A;  1BQP A;  5IWF A;  3IWZ A;  3V0B A;  5BNN B;  2RDR A;  3H8U A;  5HV0 A;  4J6G A;  5IK7 A;  5CB7 A;  1XYN A;  4K6B A;  4COZ A;  2Z4F A;  4CDW A;  1F35 A;  4XMA A;  3NNM A;  2DBI A;  1SQ4 A;  2VJX A;  1HRI 3;  3TB0 A;  4AHX A;  3QCW A;  3OBZ A;  5CAD A;  2ET1 A;  4QXC A;  5A3M A;  5HXM A;  2QZ2 A;  4YVW A;  1OH4 A;  3GZE A;  1HQN A;  1AR9 2;  4RQP A;  5IK4 A;  4H7M A;  4AED B;  1SCS A;  4YM1 A;  4UFM A;  4WVW A;  1GP5 A;  3III A;  2IC1 A;  2WYS A;  4IE4 A;  4MV2 A;  5E8A A;  1PVC 1;  1DZQ A;  3E6C C;  2VZQ A;  2JD9 A;  3H3L A;  2LAL A;  3RJR A;  2O8O A;  2WN3 A;  3U10 A;  1QH7 A;  4D3W A;  1ZBE 3;  2QE3 A;  4B7E A;  2BVV A;  2DVF A;  4IE5 A;  3BTA A;  1LHO A;  1MQT C;  5DAB A;  4YSF A;  4LA2 A;  3ST7 A;  3ZO0 B;  3ZX7 A;  3UJQ A;  2JB8 A;  2D6P A;  5J7M A;  5KWR A;  1QJU 1;  3AX4 A;  3A21 A;  2NMN A;  4CEW A;  2R06 2;  4M3C E;  1VBA 3;  1KQR A;  4WM7 A;  4YW1 A;  4BQW A;  3A0N A;  2Y6J A;  4UF0 B;  1BMV 1;  1DQ2 A;  4GJZ A;  1LHV A;  2VR4 A;  4KG0 A;  4DZG A;  1SEF A;  2W95 A;  5ABJ A;  1AX0 A;  3M2M A;  4LBN A;  4O7X A;  2RR1 3;  4BME A;  5FUN A;  5BXX A;  2PLV 1;  3U78 A;  3DKW A;  3VBO B;  1SFN A;  2GND A;  2W94 A;  4FPH A;  3D82 A;  1Y4W A;  3I3Q A;  1XXN A;  2VG9 A;  3K77 A;  4KGQ A;  4QU1 A;  3EB7 A;  3WDX A;  4IE7 A;  4A3Z A;  2VCM A;  4K21 A;  1W6N B;  2AYH A;  2YBK A;  3N3H A;  3V65 A;  3UNP A;  4LUM A;  1UF2 C;  4CDX A;  3B94 A;  5JOX A;  2Q30 A;  1O8P A;  4XE9 A;  4XBQ A;  2TUN A;  5I93 A;  2KD7 A;  3IBM A;  1AL2 2;  1OD5 A;  5A7W B;  3JD7 3;  3TN9 3;  5EYY A;  3APB A;  2QQJ A;  2VTX J;  1ZM1 A;  4ZY9 A;  2XLG A;  3WG4 A;  5FZB A;  3RZH A;  5CIR A;  1WCD J;  3T2Q A;  1JOP A;  1RED A;  1UYP A;  2VOV A;  4Q0V A;  1ULG A;  4CA9 A;  1MZE A;  3MIH A;  4UXA A;  3PLQ A;  2YG0 A;  1IKP A;  3UL2 A;  2XUE A;  2JG9 B;  5L19 A;  2GZW A;  5M0T A;  2RMU 1;  2RS5 1;  2VH9 A;  2XWJ B;  1BBT 2;  4K8F A;  2IXI A;  5FZ9 A;  4RHV 2;  1EV1 1;  1DCS A;  2UYB A;  4PT6 A;  4CDQ A;  5F6L B;  1UY3 A;  3MI8 A;  5C8C C;  2HWE 1;  4EWA A;  2D3S A;  2IFR A;  1RUF 1;  5JWP A;  2XVL A;  1CAX A;  1DBN A;  4NUB A;  3SC7 X;  5IAT A;  2XML A;  4Q4V 1;  3GF6 A;  4HSJ A;  4FFG A;  1FMD 1;  5FPX A;  3LA7 A;  2UWC A;  4PBP A;  3BTY A;  4B3N A;  4J1X A;  2W92 A;  4JC1 A;  3AYA A;  1LUL A;  3WY6 A;  1CIW A;  1DQ1 A;  5DDJ 2;  2FMD A;  1V6N A;  3W9A A;  1AYM 2;  1AZD A;  1YC6 1;  1W39 A;  1MEC 3;  2Y38 A;  4Y20 B;  4CCJ A;  3I4I A;  5FPZ A;  1YQ5 A;  2HWD 1;  4YGC A;  5FCC A;  4R9D A;  4QDQ A;  1QQP 3;  5C3P A;  3HR9 A;  5FZL A;  1VMJ A;  4L97 A;  3VBU A;  5IUQ A;  3PJY A;  1DF0 A;  2WDB A;  3UGH A;  4COY A;  1NLS A;  1FNZ A;  2WWS A;  4PQ9 A;  5FQ0 A;  4IV1 A;  2DTW A;  1KXG A;  4JGY C;  1GOF A;  3M3C A;  3PVN A;  2PHL A;  3AZV A;  3EO6 A;  2VQA A;  3M3I A;  3VZK A;  3DV8 A;  3R05 A;  2GC0 A;  3N9P A;  1H1A A;  2GP3 A;  4U36 A;  5EYX A;  3MFC A;  5GLT A;  3WNL A;  1YQC A;  2ZEY A;  2JDN A;  3MIF A;  4HVO A;  2JDU A;  4S2D A;  5DAW A;  3ZXJ A;  4D94 A;  5AC9 2;  2QQP A;  1A8M A;  3MLK A;  4NWW A;  3ZLI A;  4L92 A;  1CPN A;  1JUI A;  3MIG A;  3FBY A;  1JI6 A;  3USS A;  4CUC A; 
#chains in the Genus database with same CATH homology
 5A3O A;  5A6X A;  2JDP A;  2JDM A;  4UT5 A;  1UZV A;  1OXC A;  5A6Y A;  1GZT A;  2VUD A;  3DCQ A;  2JDH A;  2BV4 A;  4AOC A;  5A70 A;  1OUR A;  5A6Q A;  4CE8 A;  1UQX A;  2XR4 A;  1W8H A;  1OVP A;  5A6Z A;  2VNV A;  1OUS A;  2CHH A;  1W8F A;  2JDK A;  2BOJ A;  3ZDV A;  2VUC A;  5HCH A;  2JDN A;  2JDU A;  2WR9 A;  1OUX A;  2BP6 A;  2BOI A;  2WRA A;  5D2A A;  1OVS A;  2JDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...