2BOIA

1.1a structure of chromobacterium violaceum lectin cv2l in complex with alpha-methyl-fucoside
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
b'AQQGVFTLPARINFGVTVLVNSAATQHVEIFVDNEPRAAFSGVGTGDNNLGTKVINSGSGNVRVQITANGRQSDLVSSQLVLANKLNLAVVGSEDGTDMDYNDSIVILNWPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CV-IIL LECTIN
publication title Unusual Entropy Driven Affinity of Chromobacter Violaceum Lectin Cv-Iil Towards Fucose and Mannose
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Lectin
total genus 24
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2boiA00
3DCQA 1W8HA 2CHHA 2JDHA 2JDPA 2JDKA 5A70A 5A6XA 1OVSA 2BOJA 1OUXA 2BOIA 4CE8A 5HCHA 2JDMA 5A3OA 1UQXA 4UT5A 4AOCA 3ZDVA 2VUDA 1GZTA 1OURA 2JDNA 2VNVA 1W8FA 1OXCA 5D2AA 2BV4A 2BP6A 1UZVA 2JDUA 2XR4A 2VUCA 2WR9A 1OVPA 1OUSA 5A6QA 2JDYA 2WRAA 5A6ZA 5A6YA
chains in the Genus database with same CATH superfamily
3WEZA 5FUIA 3QH7A 2PHDA 3ZVXA 5LRSA 3U14A 3AP7A 3CZJA 4DINB 4NJ4A 2HWF3 4ORFA 5A33A 3CF6E 4XBLA 1AR61 4UW4A 4UF0B 5FMDA 1G6NA 4A7YA 4EN7B 1LEDA 2CDPA 1AJOA 4NN0A 4FPYA 3NNLA 1OLMA 3AP6A 3H8RA 2ZPXA 1LOEA 2XHKA 1QIQA 4BLJA 2RR11 1VR3A 3RWKX 4CYDA 1JBCA 4Y1VA 4AFBA 4XACA 3DECA 3SCGA 5FZGA 2XJTA 1JU4A 2ERFA 3I2FA 4ZY9A 5DDJ3 3DPRC 3ZN6A 4RQPA 1MS4A 1W6QA 4OI2A 3VBOC 1R1A2 1LODA 1ULPA 3B94A 1QJX2 2TUNA 4G3YC 5JPMB 3IDCB 3WDTA 3MIBA 1CONA 1C28A 2E7AA 1LU1A 1QOTA 2XHNA 3C7EA 3IMMA 2LS6A 1O5LA 2J22A 2XQRA 3KM5A 1COV3 4QPYA 5T55A 3VDDB 4CEWA 4XOGA 2VY0A 1EV11 4J6GA 4WV8A 4UXAA 1H30A 4QXHA 2FMYA 5FYUA 3J26N 1WLCA 2BBVA 2DYCA 1I6XA 1UY4A 3E1F1 2RS32 2DCYA 4FPJA 3W5MA 1GWKA 1UZ0A 4DMIA 5C6CA 4EWDA 3BALA 2JG9B 5FCCA 3RMXA 3V0AA 3NL1A 2EIDA 3BI3A 5BNNA 3MZHA 2VBBA 1H1IA 3T2QA 5FO8B 2HWE2 4N90A 2K9ZA 1QOSA 5FK7A 1NQDA 2EIEA 1XC6A 1NXMA 5D8AC 3OF1A 1GNZA 3N7JA 5CFCA 3O5SA 4Y4RA 5C5UA 3PLQA 1HQLA 4KWKA 1W2AX 2VECA 1F4AA 2R30A 3QCWA 2W2IA 2YU1A 4FOYA 4FXKB 3ZDVA 2XXZA 2ZX2A 2VULA 4HKWA 5E6HA 4AK3A 4NO4A 4FFFA 4H55A 4GKXA 1DZRA 2D6PA 2XVLA 3O1OA 1S2KA 3I4IA 1Z7S2 4Y5TA 2P34A 3MIFA 4PDWC 1CAWB 3BU0A 5DABA 1LHVA 3GNEA 2Y0IA 2Z2SB 5FTTC 4NMIA 3ZN5A 1WZXA 1OUSA 3M7AA 1MVQA 1BEV3 1BQPA 2OVUA 3AJZA 3OBZA 5DUUA 4HVQA 3P3NA 1OFNA 2ET7A 4L2NA 1LENA 4MSVA 4CSWA 5C5TA 4DRVA 4COYA 4CDXB 3AX4A 3C7HA 3SISA 4AFDA 4CPBD 4CU7A 3OUIA 1A34A 4P9LA 3SQOA 4LO5B 4YM0A 1VIWB 1DGWA 2XH6A 3ILFA 5K4LA 1MS5A 3T0BA 2AR6A 5DPNA 4FP2A 2O8OA 3MDPA 5DG2A 4BQ4A 3HT1A 4PLNA 2FDGA 2ZKLA 3MIDA 1B35B 1SZBA 2Y33A 3I3MA 3LEIA 1CX1A 3GZAA 4M3CF 2RMU3 2ZS6B 3F2ZA 3TRSB 3BUCA 3ZFGB 3OBTA 2E26A 4CCCA 1NCRB 5KHKA 2PTMA 3PUHA 5LA9A 4DUXA 1QH6A 1XQNA 4EROA 2OT7A 1TMF3 4Q4W1 1V6OA 1IOAA 1H8TC 1XNAA 2AYHA 1NXD1 4IE0A 2VW0A 3S5AA 1D2SA 4UI9L 5AVPA 2DBNA 2W3JA 3FL7A 2DVFA 1QU0A 4JAAA 2RS31 5FO7B 3H1YA 4QB1A 5F5IA 1H8VA 2CGOA 5FBZA 2P4EA 3TWIA 5KC5A 1C8M3 3DV8A 1W03A 3I54A 1GNYA 2CWMA 3R4UA 3UJQA 5F37A 1LHWA 3JU9A 3POYA 3I7DA 1RUE2 1EPZA 2A73B 3C3VA 5M0TA 1J58A 3N9PA 1DQ4A 2VH9A 2Y6GA 1O5UA 3GF6A 4W6YA 5F1RA 3MFAA 1AX2A 5J48A 1PNFA 1YCIA 1VP6A 1RMU2 2XVKA 2EALA 3AZWA 4FPKA 2ZXQA 3USUA 3N9MA 2FCVA 4QX7A 3UJOA 1MS8A 3MIHA 1CZVA 3ACIA 5J1XA 4XDOA 1UL9A 3BVCA 4LBOA 3LA3A 4Q26A 4PIXA 4MG2A 4CU6A 1VBE2 1Z7S1 1KDKA 4RR3B 5DXDA 3WDVA 1BVP1 4LKFA 5IK7A 3MLJA 4CDQC 4MX3A 1VBD1 2RM23 4HXCA 3KT1A 4Q4Y3 3GCXA 4DEQA 1Y7BA 1SPPB 1PVC2 2IWGB 4Y1ZA 2YDEA 3VD4A 3DPRA 1AL21 3ME2A 2YV8A 3RYRA 3VBOA 3GZUC 3OGSA 1I9RA 4BQXA 3AXDA 4Q4V3 2C26A 1F35A 2WC2A 1VAMA 2JICA 2G9ZA 2VZSA 2Y38A 4PIYA 5FY8A 2E32A 2Q8CA 3VZLA 5DUWA 4E4ZA 3H7YA 1VBC3 2WWJA 5LASA 1TE1B 3ZDSA 4AGVA 1PK6B 2H6CA 1VB2A 5KWRA 5IK5A 2PMWB 3AMHA 4V1PA 5LRRA 4C90A 1W06A 1K5MB 1L7LA 4P9YA 1POV3 1JOJA 4PLMA 4YSFA 4CU9A 1CIYA 4JRAA 1VBB3 4NUBA 2ZMLA 1IKQA 4Q1PA 4LIVA 2RJLA 1V6JA 3PVBB 5LY2A 2JE7A 4AXOA 4KI5M 2WO1A 4XTMA 4QQLA 5CBLA 5EZWA 2VCCA 3ON7A 3CEWA 4CP2A 2EA7A 4FBFA 1NYWA 4OLLA 1JXNA 3Q8CA 1QNWA 3WG2A 1NE6A 3K48A 1LNSA 2YY1A 1HN0A 3ZIXA 3AKRA 4QPIC 2O14A 2I07B 5D8AA 1JI6A 3GYDA 4AHYA 4COVA 4LIUA 3OG2A 1Q3EA 4KWLA 3PVOA 2WS92 1J3RA 3K51A 4QX8A 4BCUA 3PDQA 1UKGA 5CG8A 2E7QA 4K40A 5F5CA 1ST8A 4E27A 1RVF2 1KRIA 3WV6A 1CN1A 5AC93 4OHYA 1TME2 1RUE1 2VOWA 4OCTA 4BU2A 2R041 3KV4A 5IATA 4PDWA 5GM0A 4AQTA 4ATFA 2WAOA 1RMU1 1JODA 4JVAA 1ZBE1 5FYHA 2R072 5JSRA 4NHMA 1H1MA 1QQP1 1VRH3 3OD4A 2Y26A 3JD72 1GOGA 3ZYBA 4XF0A 1NA1B 2JXAA 1W90A 2VMFA 1DP0A 5A32B 1DYKA 3HWJA 1N3OA 1XBFA 1VBE1 2CHHA 2ZX4A 4CVUA 3WNOA 1QJU2 5FZ8A 2V4VA 4JKLA 4HT1T 5LZ6A 1ULCA 2N7GA 3WF0A 5FIXA 1VB4A 3WF1A 4NIDA 4XJUA 1JZ2A 1Z78A 5FWEA 3TEYA 1ZBA1 3ZYIB 1W8WA 1J84A 3PIGA 5LW9A 3O1PA 3OYWA 1ULGA 4S2DA 1MS1A 3RRDA 4F8AA 3ZSJA 3N7KA 1ND2C 1Y3TA 4GJZA 4KGGA 4IDZA 1W04A 2ZGTA 2Y34A 1UD1A 4ASKA 2W95A 1ULEA 1H8TA 4IGQA 2O8QA 2OQ6A 1LKNA 1GSLA 1HQWA 5HCAA 1LOBA 5FZKA 5LCWL 4PCRA 4N43C 4CDUB 2DV9A 2UWBA 4RGKA 3B9CA 2V73A 4FSJA 3VB9A 2A1XA 4P9GA 4O65A 2YUEA 2YZ4A 3PNAA 3WQBA 2PHXA 3FZ3A 5C3OA 5FDBA 4QGLA 3B9IA 3KT4A 1US3A 3WF2A 4WZFA 2LTNA 4YWAA 4KGQA 2KA3A 4IETA 1X33A 4A7ZA 1DGWX 4KG8A 4QHOA 2VZ1A 2EICA 2P3YA 4Y33A 5JWPA 4CCLA 5I0RA 3MF6A 3THCA 5HV4A 3KV5A 1PGSA 5LA2A 1U5YA 2NLRA 2NP0A 1MQTB 3FLPA 3TAYA 1VMJA 1RVF1 2PA7A 2D98A 1Q8SA 2A3WA 4FTBA 2TNFA 1TME1 3SXWA 3IKWA 3E6BA 3KVBA 2LRPA 5CEHA 1UX7A 3ZYPA 5JZGB 2JDAA 1AXYA 2XUEA 1PK6C 2PHRA 4QQHA 3SLIA 1UY2A 4CDQA 5F39A 2WL1A 2VZUA 3CJXA 1OD5A 1XE0A 2GC1A 3PU3A 3T4VA 3UGHA 2CY6A 5ACA1 4DXSA 2R071 2FCTA 1D2QA 3F95A 1C5IA 3LA7A 3CIHA 5EPAA 5GLWA 4NRMA 3JD71 5KHIA 4ZS2A 4LBQB 1F5FA 3I2DA 2WAAA 2XG3A 4AZZA 4Q0SA 3AFKA 1BBT1 3FJSA 4S2HA 3POJA 3U0ZA 5GALA 5I91A 1O7FA 1QJU1 2UYAA 3B01A 4LKSA 3LPGA 1NLQA 2VGDA 2DUQA 3DXUA 3Q8FA 1QXPA 2D40A 4XCBA 1NCQC 1HDKA 1JYCA 2JDKA 1OPOA 3E97A 3I3DA 3QACA 4KWUA 3THTA 4EQVA 5A6XA 5A3OA 1DGLA 2YPJA 1L3JA 4XJZA 3OUHA 1PZ7A 2JENA 2WLQA 3DEMA 1GP4A 2VM9A 4AEDB 2YBKA 1JUIA 5DN2A 4K9SA 2BERA 2JIJA 3ZR5A 4OMDA 3MPPG 2BFUL 4QPIA 5FY5A 1CAWA 4XCAA 3DUIA 2VUAA 4UWDA 4E8CA 4ZU7A 3ZPYA 5DQ0A 1AYM2 1BJQA 3MIEA 1OF4A 1Q8QA 5IAVA 1AVBA 3O1SA 1WMFA 2Z79A 2ZOEB 3WP6A 1LOCA 4TXWA 5F5AA 4A42A 1QWRA 2NMNA 3POWA 4X6RB 3LEGA 3NMBA 4MHRA 4O61A 1W9YA 2GMMA 5I0UA 1WA6X 1WLWA 2P3KA 5FXVA 3MHZA 5A33B 4AAXA 1COV2 2ADEA 2F17A 4PQQA 5CFDC 4Y24A 1B35A 5F6KA 3I3EA 5FPLA 2OX0A 4FVVA 1VPHA 4CU8A 5IVVA 4AVTA 4C91A 5CADA 5JOZA 1T6BX 3UNPA 4OI4A 5I8TA 1WD4A 4M4PA 1DU3D 4UFIA 2UURA 2D6OX 1IQAA 1CVNA 1O4ZA 4QKBA 1UF2C 2DFCA 4GMP3 5FMOS 4D0QA 2VBPA 2B39A 1W6QB 1W8TA 4RQPB 5IVBA 2ZEWA 1RXFA 2P6CA 4YW7A 4HK8A 4XHXA 1YQ6A 4XQ4A 1JUHA 3H0OA 3KHBA 4NVPA 4CEWB 1AR92 1YQ2A 1QJY3 3E5XA 4R9CA 1W8FA 2R49A 1RB8G 3MUZ1 4XF4A 4CDWB 4XUTA 4P00B 1ZRRA 1LGCA 1ND2A 4M00A 5BY5A 5K0UC 4OHXA 3S30A 1HXS1 2UWAA 3MFCA 4AWDA 4B29A 5LA0A 1SFYA 4LNVA 4NIAA 4YG0A 4K7JA 3V0AB 4MUVA 4GMP0 3WDWA 5FUPA 4N43A 5BNNB 3KF3A 2R16A 4ZKTB 5FZHA 5FY0A 2HWB3 2WYFA 2BW8A 4B4PA 1FYUA 1W8NA 1O8PA 4PF5A 4QGNA 4E4DX 2VQUA 4QGMA 4ES9A 2A6ZA 5D1IA 1GYKA 1V6NA 1W8UA 1W8OA 2DBIA 1GWLA 5AVAA 1UCXA 4B1MA 3AMMA 5C4WC 3PU8A 3WDUA 2WNEA 3G7DA 5IAXA 1RIRA 4SBVA 2CNAA 1ZRCA 3TBDA 5FREA 4G4FA 3HNMA 5EYYA 1GQPA 3H8UA 4TLGA 4CTEA 2P37A 3U4XA 1WBLA 2VQAA 3OUJA 1UYPA 2HBUA 2ORXA 1J3QA 3PUSA 4FOWA 1RUF2 4ISRA 4JQTA 3M8LA 3VZMA 5GZFA 4BWOA 1PK6A 4QQPA 4RGGA 3UKNA 4BQ5A 4Q27A 3KQ4B 4RSUA 2WN2A 3IAPA 2PHWA 1JYXA 2W92A 4W8JA 5FPAA 3PVNA 4OMCA 2VU9A 2R0HA 4Y22A 2NN8A 4H3WA 1W3VA 2TBVA 5J36A 1BMV2 1C8M2 2WZPP 1PGW2 3WD5A 1JYIA 4PQ9A 3JUUA 1D4M3 2SBAA 4GWNA 2PHUA 5HCBA 4AEDC 4QXKA 2XR4A 1PO23 1O6UA 1RXGA 1ZRDA 4OQ9A 2UYBA 1S1AA 1H2NA 3AK0A 1W3XA 3IAQA 3ZFGC 3WNPA 1XOYA 1DLLA 5A3TA 3HQXA 1AR91 5A3MA 1VBA1 4AVVA 2PN5A 5FO9B 5L73A 1HB4A 3PURA 4P5YA 1UN1A 3K4AA 3KCCA 5A7SA 4S2FA 4M3CA 3P1IA 5F7UA 4MO3M 4UFLA 5ISLA 1A8MA 2MEV1 4LBJA 2BBAA 2G4IA 4BOWA 4P02B 1N1YA 1PMJX 1YFXA 1HJGA 4Q4Y2 5A7NA 1VAKA 1WW7A 4A3XA 1SLIA 2Y0OA 1RUH2 3P5BA 4I2OA 4LITA 4P08A 3U1XA 2FHRA 2Z4FA 4N9HA 3OGRA 4B1LA 3HQRA 5JCTA 2OIIA 4AW7A 4Q4V2 4BQYA 1BK1A 1GR3A 2HEVF 3PIJA 2B45X 3LB9A 3USUB 1ENSA 3B69A 2ZKNA 4N8MA 5CFDA 1AXKA 1PGL1 2XBO3 2JKBA 4Q5OA 1RUD1 3LSEA 2E31A 1CJDA 1D4VB 5JDBA 2J1TA 4FQ4A 4HG6B 5HCFA 3ALQA 3NAPC 4QKFA 5F9TA 4GB31 2IXIA 1RUF1 2D44A 1H4HA 5EV7A 2QQWA 1MS0A 1QXJA 4KL1A 5DAPA 3V64A 1IS4A 4LJHA 3O12A 5FJKA 4TWTA 3ACHA 3HAGA 3DPRB 2OW4A 3GBGA 5FR3A 3VBOB 4NIGA 3ZIWA 2CGNA 4WZCA 1A6CA 2JB4A 1YJKA 3GGLA 5FV3A 3UKTA 4OVEA 3AP5A 2DCJA 1UY3A 4XJ8A 4YM1A 2WQZC 3BIWE 4IGPA 1DFQA 2WT1A 3WLUA 1ZZ8A 1BMV1 1QDOA 4ZU5A 1PGW1 1W8ZA 4UFJA 4UFHA 4Q0QA 3WHTA 5K0UA 3PMEA 5DZFA 1PO11 3R0RA 2GALA 5ACA3 1QKQA 5LK7B 2BDRA 4XFFA 5FUNA 2KM2A 3NW4A 2EAKA 4IEQA 4LE3A 4HMZA 3V0BB 4GIQA 2BNMA 4FTSA 5H9QA 3NKGA 4JHZA 2OPKA 3RS6A 4YW4A 1R1ZA 4E2GA 2K2SA 3V65A 2E9QA 1XU1A 1ULDA 2Z69A 1VRH2 4AHWA 2WNVC 5D8AB 4HPKA 4FTEA 3IMNA 3WNNA 3WHUA 1ULFA 5FMCA 1EAH2 2RE9A 5GLZA 2XGXA 3OD0A 3TEZA 1R083 4W6XA 2WZ8A 5C4WA 4H7MA 2BVBA 1REDA 3WF3A 3O14A 3T0DA 4Y1UA 1CESA 5FZEA 5H9SA 2VTXA 2A70A 3H3ZA 1YQ5A 1RUH1 5IW0A 4BISA 4AI2A 5JIUA 4I01A 4LBQA 4XF3A 1SFNA 1CGPA 3JB8A 1OBNA 4PDWB 5F3IA 3OGJA 1W28A 3GZEA 3ZXFA 3H1WA 4GAZA 1FT9A 3S0MA 4ISQA 3WCSA 1W2TA 4GD4A 2YC4A 1YC61 2BJSA 1UU4A 4JDMA 1Y9MA 3T30A 3GZTB 1LTEA 1SMVA 4LR4A 1V9U1 1AX0A 1AR83 2W9XA 3RI8A 2WZR3 4DXRA 1PMHX 2W1WA 4N7IA 4HN0A 1WCQA 3TN92 1O3RA 4MADA 4L99A 4HANA 4XILA 1IS3A 1X8EA 4GJYA 3SH4A 3UL2A 2WT0A 4XXPA 2HEWF 4MGQA 1LESA 3GHMA 3ZYJB 3B93A 2QNKA 4NRPA 3KD4A 3UV9A 5HPOA 2EVXA 4MHUA 1FNYA 1J1TA 2BTVC 2VQ0A 4AEDA 1IG3A 4FFIA 4EN8B 3ZXGA 4BMBA 5IHRA 4IEOA 4FCAA 1UYYA 3WUCA 2WJSA 1Y9QA 5DUVA 3ZO0B 4BA6A 3OYWB 4XZUG 3LDBA 5FLIA 4LHNA 1IPJA 4Q4X1 2J1UA 1DQ1A 3BTXA 2NZ9A 4AFMA 2FDIA 2O0OA 5J96B 1H8TB 2G19A 1UMHA 1A8DA 1F2NA 1WD3A 2A7AA 2X5IC 1OUXA 3T3YA 1UY0A 2GN7A 3PUAA 5FZ9A 2QDNA 5T52A 4P9JA 2B5HA 1JTZX 3CL1A 1DDLA 4CCMA 4OHZA 1OOPC 4OYUA 1VAVA 4LA3A 5FZLA 1O59A 1XNKA 1BLZA 1O8SA 3CMGA 4JKKA 1H9PA 4XFCA 3C2UA 4QXCA 2B42B 4BIOA 2R1BA 2E6VA 4ZHNA 4IE4A 3CQOA 2C9AA 3AYDA 5T5PA 3EQEA 1EAH1 2WBKA 4FOQA 1AX1A 1ASJ1 4IW3A 1OQEA 1YO8A 3TNPB 5F3EA 4K20A 4JDOA 3WZ1A 2BOIA 3RG0A 4Z2AA 4OZXA 1IQDC 3NV2A 3H3LA 1I5ZA 2PYTA 2WFPA 4CDQB 5GZGA 4F3JA 3NAPA 1S0FA 4CDWA 1OKQA 5C9AB 2QBXA 4OUMA 2DCTA 4NAMA 2JG8C 3VD5A 2WWUA 1RUJ3 3VDBA 4W6WA 4Y1YA 5FZBA 1VALA 2HWD3 1EP0A 4RHV2 1UYZA 2D6NA 3MF9A 3WP4A 2HBTA 1MEC2 1SACA 1AYN3 3RZJA 2OUHA 2ZGUA 4ET7A 2P3JA 4QX3A 4OHVA 1M06G 4JC1A 3TN91 5FYBA 1GFF2 1K45A 4LTAA 4NHLA 4URTA 4R4ZA 5E89A 1ZZBA 2Q1FA 1NY71 2Y64A 2EIBA 2PHFA 2RS12 1KFUL 1IS6A 2BOJA 3J9SA 4YVWC 4YGBA 5KR7A 1MZEA 4LO4B 3POGA 5C33A 3WCRA 2B9VA 3R4DB 4JGZB 4AQSA 2BRTA 3AKSA 4XEZA 2A5ZA 4HSJA 1OXCA 3A21A 2WABA 1FMD3 5JVVA 3VBFC 1FOD3 4AI8A 2WKKA 3ZXLA 2WNVA 4QPIB 1LHNA 2WO2A 3VKMA 3H8XA 3I2HA 2VMGA 1G9DA 1SLCA 5EJZB 4FOVA 2I2SA 4QU1A 4XFGA 3N7LA 1W8HA 4YFWA 2XVGA 1E5SA 1XSQA 1VBA3 4BZ4A 3K75B 2Q8EA 3RVHA 3VN4A 4IV1C 2XJQA 5APAA 3W9AA 4AHXA 4FAHA 3EO6A 1DGRN 3S6PA 1GZTA 2VNVA 2FCUA 1QJY2 4EV0A 4EWAA 1MVEA 1QEXA 3VLBB 2W94A 3KCXA 2PLV3 2AEZA 1RHI3 4E9KA 1KDMA 3LFIA 1H2LA 2FBEA 2RDNA 1R1A1 1GOHA 1QJX1 1L7QA 3U07A 3PHMA 4CP0A 1PHMA 3HN1A 3CLPA 4Q0PA 2FZ2A 1AZDA 5FZ3A 1TZOA 1LHOA 1RUC2 4X6QB 4XUOA 3MICA 4Y1XA 5A1AA 3JXSA 1ULOA 2E33A 2ZX3A 3CHXA 3VKLA 4BB3A 3I3QA 3HBZA 2ZJCA 1C3HA 4OI0A 2G1MA 4AGGA 2WLPA 4RHV1 4WVMA 4QU2A 1G7YA 1MEC1 2Y6HA 3TNQA 1QOOA 4R9BA 3JQXA 4QT6A 1ND2B 4DRRA 3VHRA 2CV6A 3KV9A 1Q5OA 2HWE1 1YHFA 2GH2A 3JB4C 1XE7A 3CBNA 1R093 2RS11 5CU1A 5GLUA 4QX5A 4NIIA 3AMPA 5E16A 5C7GA 3SKJE 5JOWA 2QZ3A 3AB0A 4HKLA 1W99A 2X5IA 3W59A 4CEYC 2WWSA 4N43B 5DAWA 2IXKA 4QQ2A 1ENRA 2PHTA 1QDCA 3CKHA 1YFUA 3M3CA 4HL0A 4RS5C 2ARAA 4QDRA 1WMEA 2ILMA 3PJYA 2ZHNA 2VZPA 1IHMA 3MIGA 4NRQA 3ZOIA 1CPNA 5J37A 1CIWA 1XB9A 2VR4A 4P9XA 4IL7A 5IJRA 1UU5A 3ZLIA 1HRV3 5C9AC 2BWAA 3OGVA 4Q8KA 2DDUA 1J59A 2W08A 3BPSA 2W87A 3QD6A 3WQ1A 2A75A 4TLFA 3IIIA 2C1FA 5FZFA 4ZZ8A 4PLOA 1Q43A 2VCAA 1PO22 4ONUA 5CG9A 1MR5A 3VZKA 1UOBA 4F83A 3OY8A 4ZU4A 5FZCA 2WFF2 3MI8A 5CYYA 3VBRC 2W1QA 3MW2A 1JZ3A 2RVAA 5IFPA 2PAKA 5GLVA 3B7MA 1PIV3 1LJ7A 4JQRA 5FYMA 5BNQA 2W39A 4B7EA 1OT5A 2JG8A 2A3XA 3FMGA 4FPCA 3EMRA 5EXOA 1MACA 4AI0A 2NM1A 4JGZC 3SEEA 4Y22B 3AYCA 2BV4A 4QX2A 3ZFEC 3V0BA 2GMEA 2BWCA 4Q0UA 1GV9A 1NLRA 4UAPA 3NRUA 1U5IA 3CU7A 1CAXA 4I30A 2RS53 3JBG3 2D6MA 2WDBA 4XDQA 2CDOA 2XLGA 1WW5A 4JCKA 1RUC1 1QXRA 1YUDA 2IXLA 3GJBA 4AEJA 4XTPA 1NCQB 3FFZA 4YVWA 1V0AA 1AR72 1JOBA 1W39A 4PI0A 5A3UA 1FNZA 1LU2A 3AZVA 5A7QA 2ZZQA 1UZYA 1UQXA 1HLCA 2BGCA 4Y5SA 3IWZA 2JDNA 2WINB 1RUI3 4IEZA 3ZSLA 2A3YA 4QD2A 3VBFA 1FX5A 4M3CB 2Y6FA 1M4WA 4K21A 1W0PA 2R062 3J7HA 4IQPA 1SDWA 4XJ9A 1V6IA 2WO7A 4C0HA 3BCWA 3PUIA 1N1SA 1WUVA 4MV2A 3M4FA 5F8PA 1VMFA 2XKOA 1UAIA 3O7OA 4I0WB 2DURA 5T5LA 2D43A 3TOJA 4IV1A 1HIXA 1RUG3 2ZA9A 4DUWA 5FZOA 3H7JA 5A70A 3T1LA 3N9LA 3MPBA 4DFSA 4FP3A 3RDIA 4QX1A 3GJAA 3ZFFC 1FI2A 2QQNA 1GP5A 3EB7A 2G9GA 5CFDB 5K8SA 2WSVA 1AR63 2A6WA 1PVC1 2OQ7A 1PZ9A 4LLOA 5IVCA 1YRZA 2JB8A 3SNMA 3IB3A 3NNJA 4RFT0 1FPN2 1JZ5A 1I3HA 3ZPOA 3WW2A 3J8F2 3FLRA 1KS4A 3BIEA 2DTWA 3VBUC 4AVBA 2WFF1 2RR13 1Q8PA 1PNGA 4B7KA 5J09A 3AZZA 1YQ8A 1O3TA 3VD9A 2AREA 1UU6A 2PAMA 2UY8A 5I8SA 5FMBA 3WNKA 3DCQA 3WNMA 1ASJ3 2CTVA 4FFGA 4WVZA 4UBHA 1RL3A 2GZWA 1SLBA 4QKDA 2JECA 4A2UA 2QQMA 5C8WA 5K0UB 1EV13 1KEXA 3MW3A 4EN6B 4XURA 4AG4A 1LR5A 3NNFA 3NSTA 3NNGA 4LLFA 2ZX1A 1XNCA 2A6XA 2E53A 4ZZ5A 1AR71 4CEYA 4L92A 5AC92 1K3IA 2PFWA 2WS91 1IPKA 3NVCA 3D0JA 1GZCA 4AFAA 4XZPA 4AI9A 1AR82 2C0ZA 1GOFA 2VG9A 2WZR2 4HPKB 2Q1ZB 4CXXA 3RWNA 3UKVA 2XOMA 5A3WA 2R061 3HOBA 1OPMA 4UT5A 1HRI2 5JPNB 2V5YA 2Y60A 1VLNA 4XBQA 3D3AA 2VMEA 3NV4A 5FZ0A 5J98B 5C4WB 5C9AA 4FAGA 1BCXA 4EWEA 5FRAA 2WA4A 2YFUA 4AEMA 2ZX0A 1W2UA 2Z42A 2NPIA 3WT3A 5CNAA 1AXZA 5BV6A 2BZDA 4D6SA 4OHWA 2QQJA 1O4TA 1LOFC 1F4HA 2HWC2 4OFGA 3VBRA 1U5ZA 3ZM8A 4AEKA 1GZWB 2YROA 4AGRA 3NKTA 4ASMB 1DYOA 2YPDA 2JDHA 4BXFA 2YGLA 2JX9A 4LBKA 4RD7A 2XB6C 2XJVA 4IE7A 4AQ2A 2J1RA 4JX0A 2HWF2 3LE0A 4JGZA 4WM7C 3J8F1 1WW4A 2J1VA 2VVFA 3ZFEA 5C3RA 1S0BA 1HX6A 2BEOA 1JYNA 3ZYGA 5D2AA 1VRBA 4PT6A 1JS9A 1BYHA 3I49A 4YG3A 3HNYM 3LA2A 4YW2A 2JDUA 2Q1MA 1CPMA 2LM3A 3TYJA 4Z92B 4FT8A 4CA9A 4YM2A 3PMSA 1R1A3 4TYSA 4L8QA 1W6OB 1Y9GA 4PIZA 4YFZA 4Y3OA 5ANQA 4RN5A 5LA1A 3B00A 3AYEA 1I1EA 1LEMA 1V70A 3WF4A 3QLQA 5JI9A 4HK9A 1DZQA 2JDPA 2PXJA 1FAYA 1Q8OA 4IE5A 5DDJ2 3RNSA 3ZYRA 2DCZA 4Q4W3 4AI1A 2D6LX 5DZEA 2NYYA 4LBLA 2L9LA 2WO3A 5JXGA 4D7YA 2UU8A 4L97A 1GICA 3FLTA 3WNXA 4FO9A 3E6CC 2RS33 3RJ2X 2VQTA 2ZAHA 4IEWA 4COZA 2I45A 2P5BA 3RZGA 1YFWA 3E5QA 1RUJ2 1KQRA 1YI9A 5CZKA 5KXEA 3NV1A 2HWD2 5HI0A 1UY1A 3HPNA 1OLME 3THPA 3H9AA 3LIHA 1AYN2 2VO5A 1IPSA 2X10A 4QHBA 3ZMOA 3ZSEA 2A6YA 3K2OA 3FBYA 3ZFFA 3LSDA 1N1TA 3LCPA 3N3HA 3FX3A 1DGRA 2VZ3A 4ZONA 1I5PA 5DUXA 2VZRA 1NX9A 2D7FA 4NHYA 3I2KA 3RZHA 1QMJA 3ITQA 4LBMA 2TEPA 1Z7S3 3VBUA 3NAPB 2AENA 4J25A 2F4LA 1GZ9A 2HWC1 1FMD2 2VZTA 3ZKUA 4I3PA 1VBD3 1NT0A 4GALA 4L0PA 2EXHA 4DY5A 3D0SA 3T2TA 2VZOA 3OOXA 4D6QA 2IVJA 4FI9A 1AL23 3A22A 1UPIA 1WCUA 4R9AA 3WR0A 2AGSA 5LBCA 3VBHC 4OUEA 5B4XA 3TB0A 4AFCA 2HWF1 5C3SA 1BEV2 4XF9A 1DYPA 1S0IA 2ZBJA 1JU3A 3HD8B 1W9WA 2YHJA 4IEYA 4BYYA 4NROA 4QWNA 1UXZA 2CSGA 4DOUA 2KD7A 4A41A 1FXZA 1HV1A 3POFA 4DB5A 2DVAA 5E8AA 4MGZE 4QPGC 3U4SA 1ZA7A 4K1ZA 1PMIA 1BKZA 3O0WA 1H2KA 2GNMA 1CZSA 1AYM1 4EN9B 3BTYA 4XIOA 1RHI2 3MEPA 4UW6A 2QTWB 5KHHA 2PQQA 2WR9A 5DDJ1 3LD8A 2RMU2 2OYZA 1PM7A 3OTFA 4YRDA 2WNVB 3EBRA 1LULA 4CUGA 3O1VA 3RZKA 1SHWB 2QQUA 2ZHKA 4M4RA 1O3SA 2YC0A 4HKOA 1D0HA 2BNNA 1ZZ6A 2YB7A 3ASIA 3EJKA 1YYNA 1Q8VA 2P3IA 4O7XA 4BQWA 4IEPA 1COV1 2A6VA 1TMF2 4NPMA 3AKPA 4FPFA 3DKQA 3IIAA 4FPLA 4ZXEA 4C1WA 5EJ3A 4BXSV 4CCDA 2BFUS 3RFRA 5EYXA 2H0BA 1KS5A 2QQLA 1HW5A 1B09A 4NPRA 1N3PA 1RUE3 2NQYA 2B8MA 2J1AA 3VZJA 3T0AA 1WWYA 4XUPA 3RZZA 2R043 4GH4C 3WINE 1LOFA 4X8PA 2J1SA 1JZ8A 1RJ7A 1RMU3 3W5NA 4Z82A 1E5RA 1DQ5A 1ZBE3 2BYVE 3R4SA 5FYYA 3I8TA 1MS3A 5GJ6A 2GN3A 4OUSA 4J1XA 4BPZA 2VTFA 1QQP3 3D4KA 3ZSMA 1NCQA 3OBRA 3J4UH 3WG1A 4IV3C 4LT5A 3M2MA 3MV01 2Q8DA 4HBNA 1C4RA 1UO9A 1VBE3 5A1FA 1F9KA 1XJAA 1SEFA 3L2YA 3R05A 5L36A 2GP5A 2ETEA 4YPJA 2FDJA 2VOVA 3KCYA 1KXGA 3MBWA 4WM8B 5BPXA 4QM8A 1KJLA 1S0DA 4WVMB 1ZBA3 4NR1A 1SLLA 4JDNA 4Z07A 2YMZA 4Z8BA 4LOSA 4EE2A 1OFSA 2VE1A 2RM22 2Y6KA 3OEAA 4YGDA 5A3LA 1GKBA 1BEV1 4LULA 2V09A 4AE2A 5JSPA 1XU2A 4UFKA 1OKOA 3ETPA 4YZ5A 4XMIA 3TEXA 3NJYA 2X5IB 2QQIA 3EHKA 1W2NA 3FE5A 4DZGA 5JOYA 2F4PA 4A44A 4GULA 1VBC2 3KB5A 4JGYC 4OULA 5FP7A 4CCJA 1UMIA 2XPJA 2W1SA 2P1BA 2W46A 4QB6A 4V2WA 4XFHA 1U5XA 1BZWA 1OOPB 3E5UA 2Y6JA 3G6JB 5G04L 5L9VA 5IFTA 1VBB2 4I0AA 3FWEA 2QDRA 3GM8A 3RJRA 4LHSA 4GZ9A 3ST7A 4AAPA 5FOJB 3VHOA 1G9CA 2RS52 2VMHA 3JBG2 1W6PA 4RL7A 2EAAA 4YW1A 1TMF1 3R6SA 2RV9A 3SH5A 2WS93 1ODMA 4YZ2A 3MO4A 2IFRA 3OY8B 1QNYA 3NWKA 1RVF3 3VKNA 2YGMA 4XC9A 1AL0G 1A3KA 4G9SB 1TME3 5LB6A 5IYYA 3ZKYA 4Y5Z0 1SG3A 1C8M1 5DZGA 3O0XA 1V6MA 1ZZCA 1SLAA 2JG8B 5FXXA 5JXIA 1H1AA 2YG0A 3I2GA 4RYDA 3PTYA 4CP9B 2I74A 5FKBA 3W20A 3BTZA 2R073 4C1XA 5IT6A 4I0BA 4K1YA 4FPOB 3SCFA 2VNOA 3LWCA 1GLHA 3GHNA 1YEWA 2AZ5A 3JD73 4HN1A 4LQRA 4KMQA 5SV5A 4YM3A 1ZYBA 3VBHA 5KC6A 1JZ4A 1CAXB 2QFEA 3CDZB 1K5JA 5A3NA 1W2OA 1G9AA 1BBT3 1W9TA 4CCKA 1JZ6A 2B46X 5FAXA 2LW8A 4Y20A 3N9OA 5I0TA 1QJU3 4ARYA 4YZ1A 5H9RA 5F3CA 2FMDA 4K6BA 1RUG2 1SBDA 4YVWB 3LAGA 2ZGRA 3AKQA 2SLIA 3LEMA 2IXHA 1EUUA 4NHXA 4QPGA 4BE3A 2Z5WA 4NAOA 1J83A 2CWSA 4YW6A 4AQ6A 4C0BA 4COUA 5BNPC 4U2AA 1ODNA 2RM21 4B3NA 4Q4Y1 4LPLA 1AR62 3IN9A 3VBFB 4B4QA 4Z2WA 4E4SA 1JH5A 3UYJA 2P2KA 2VNRA 1A78A 4Q4V1 4Y4YA 4YLZA 5JOXA 3Q8AA 4BLIA 4E8DA 1SCRA 3KT7A 4N9IA 4DUVA 5FYVA 1VBC1 2R32A 1UOFA 2ZHMA 1GZWA 3VBSC 5E88A 5C8CC 4BQ3A 1NOVA 2RHPA 3VL9A 1HJFA 1UIJA 1WLTA 1POV1 3KV6A 4IV1B 5EWSA 3RSJA 3HBKA 1VBB1 3AVSA 3B3QE 4LK7A 5FZOB 4CE8A 4Z1VA 3POEA 5HXMA 1YLLA 2HKXA 3KZ4C 5KXDA 1S2EA 4YZ4A 4A3ZA 3FC0A 3ORJA 3OPTA 4GH4A 4MGTA 4KBBA 2ZGLA 1EV12 5LWBA 3APBA 3UT0A 3ZX7A 4WM8C 3FN9A 1ZNPA 1UZWA 2EIGA 4JKMA 3T08A 2WN3A 3UK9A 2QQPA 4HLTA 1BHGA 1WMDA 1ONAA 1X50A 4IV3A 3H3UA 3U37A 1W6OA 4W50A 3HIFA 3AP4A 3I59B 4IERA 3RYPA 5A6ZA 4CUAA 2B4KA 1C1LA 2ET1A 4BM8A 2WUHA 1JHNA 3WSOA 4N53B 4U36A 5IVEA 1P8JA 3VKOA 1SLTA 4XDPA 3WXPA 2VVEA 3RGBA 2PAEA 4QHZA 2GNDA 4KWJA 3WUDA 2VAUA 2O1QA 4JZRA 4META 1XXNA 4J1WA 2ARCA 3DF0A 2X05A 4LORA 1TEIA 3S7IA 3I2JA 3KF5A 3X29B 5JMCA 2J7MA 4ASLA 1Y4WA 1VRH1 3BN6A 5K7PA 4YZ3A 1HXS3 2Q5TA 3KSCA 3ZXEA 5FPUA 3AMNA 3LQCA 5FY9A 1VMHA 4DNYA 1IGOA 5D21A 1US2A 3W58A 4BJ0A 4CEYB 1H6YA 1UOJA 2DCKA 4JGYA 5I93A 2XWJB 1CR7A 1UMZA 2RDSA 4RS5B 1YNAA 3K4ZA 5LBEA 1OA2A 3VKFC 2D97A 2Q30A 2XJPA 5T54A 1W6NA 3SCHA 3ZN4A 5LEKA 1DLCA 5ABJC 2Q0AA 2FDKA 2RDQA 4P9IA 1SBEA 1OHFA 3SEPA 3BGAA 2XLFA 3UGFA 1D7PM 5T5OA 2W1UA 1QJEA 5FYCA 1CWPA 4O9GA 2HH9A 4XHBA 1AYM3 3BB6A 3BTAA 2W68A 5IVJA 5F3GA 5FYZA 3A0KA 1C8NA 1ZX5A 4R4XA 3FUQA 1RTVA 3PL0A 5IK4A 3INAA 1N47A 1MPXA 4I02A 3GDBA 3VBRB 2LUWA 3WX5A 3N36A 5G05L 3U78A 5AFEA 3HR9A 1Y43B 1OLQA 3AL5A 3WW1A 4Q4W2 2WNUC 2DU0A 2OXBA 1NUKA 4Q8LA 4UOJA 3ZFEB 3AJYA 1DIWA 3M3OA 5GZCA 1YWKA 4XXAA 1S4CA 1APNA 3DN7A 3OPZA 4HONA 4LOTA 5GKAC 2ZABA 4LO6B 3BOWA 2VUJA 4GXLA 3KMHA 4NE9A 2PELA 2WT2A 3FHAA 5FOBB 3VZNA 4MGKE 1ND3C 1RJ8A 1OH4A 2GNBA 5FZMA 5EJ1B 1XE8A 1KITA 2PHLA 3MGUA 4FPHA 4BMEA 5BNOB 2X09A 2DUOA 1D0GA 5EP9A 5BNPA 1WLDA 3GBWA 1AR93 2GP3A 2GSYA 2DFBA 4LK6A 3NV3A 1LAJA 1CJPA 2H6BA 4KG0A 4UW5A 1N1VA 1G9FA 2H0VA 1LECA 1W9FA 2BP6A 2IZWA 2MEV3 2XDVA 4PF1A 5DAQA 1KJRA 1UKRA 3BYWA 3RZLA 3VBSA 1VBD2 2DF7A 2VOTA 3L2HA 1URXA 1BXHA 4Q2FA 4XQDA 5LBBA 4R9DA 2FDFA 3A4UA 2D5HA 3J7LA 1W05A 1TVGA 1W0NA 3ZXDA 5C8CA 3M70A 3RMYA 2F6BA 2RJ2A 4MXWA 1AL22 4UW3A 3OB8A 4P9WA 4AVCA 4CUCA 1F8VA 1UXXX 3CJIC 2BUKA 1LCLA 2HJIA 4KBZA 4DS0A 4N53C 2HWB2 3ZFFB 1QJZA 4LKDA 4AOCA 2XJSA 4XFIA 2KR2A 1V00A 1J1LA 3AZXA 1MZFA 1U12A 4KU7A 3Q8BA 4WM8A 2MPFA 5LBFA 2EXKA 3D82A 5FP8A 1RUD3 4EJRA 3VBUB 4I3GA 2JIGA 5L7OC 1AJKA 4NWWA 4NHKA 3VDAA 3GBFA 4GB33 1OQDA 4QPWA 1RUF3 5FP3A 3ABZA 3UETA 3DYMA 1ZVFA 4AR2A 4PHZA 5IWFA 4DO0A 4E2QA 1YFYA 1DF0A 5FQ0B 1ZZ7A 2WQ4A 4XQWA 2JD4A 2QUOA 5J3UA 1IKPA 3K3OA 3USSA 3AMQA 1ZM1A 3FFQA 2Y8KA 4CXWA 4LEJA 5FZ1A 3T4HB 1CAVA 4CUBA 3J7MA 2FDHA 3FHQA 3HEIA 3OGGA 1OOPA 1GBGA 5LEJA 2VZVA 4GWIA 2FZ1A 2V5DA 4YGEA 5FJHA 2VXJA 2XMLA 3WP3A 3N4MA 1PO13 1H0BA 4DIQA 4GKYA 1SQ4A 2IVIB 1IZ3A 2JJ6A 3ACGA 1IG0A 3N9QA 4MGYE 4MXVA 2ARXA 3PJQA 2R042 5FKCA 1SCSA 2ZAAA 2ZGOA 2W47A 2D93A 1D4M2 4INDA 4QQOA 5DG1A 1UYXA 1AF9A 5CISA 1ZBE2 4GMP1 4NWVA 4BQ1A 3ENRA 3T2OA 2XL7A 2HEYF 5CIRA 3IPVA 1QQP2 4E4HA 4O9EA 4RA0A 1UNBA 5ABJA 4XVHA 3EYPA 4XAEA 1DCSA 3RI9A 3WVJA 3OSDA 5HV0A 1C5HA 1QJY1 1POQA 2BNOA 4BH9A 1NQJA 2VMIA 5FY7A 1ZA4A 3VDDC 1MZ5A 3ECQA 1YIPA 4CP9A 3DYOA 3C7FA 3HMYA 2AH2A 4RGAA 1DZTA 4YVSB 2ID4A 2BPA2 1CAUB 2UWCA 1XRUA 3ILNA 5C71A 3NJVA 3HJRA 1RUH3 1V6LA 5A7WB 1ZBA2 4XETA 2RDRA 2W52A 2VL4A 2J42A 2VXRA 4D69A 2K46A 1LHUA 2JG9C 4Q0VA 2BVVA 5FLHA 5T3NA 3ZSKA 4BDVB 1JN2P 1VJ2A 2HWB1 2NMOA 2W91A 3JQWA 5I0DA 4XF1A 2ZGMA 3OBAA 4LO8A 2WNUA 1V9U3 4XFAA 5F2SA 3H8OA 2DWRA 2YC2A 4WM7B 5BNOC 2AUYA 4GWJA 4H7LA 2GMPA 5FLJA 1CQ9A 1EY2A 1WCDJ 1XNDA 1WCSA 2DTYA 2QVSB 4XMAA 5FP9A 2Y6LA 2XBO2 4EN0A 1JYVA 3AFGA 4NPLA 4WVWA 1ACCA 3IDAA 3VGIA 4M01A 1IS5A 4IXLA 3P6BA 4QAWA 4CCOA 1VE0A 4M3CE 4YARA 5L19A 3O0VA 5FZDA 2Q4SA 2LROA 3BKZA 4JRLA 1ND3A 5F5QA 1QGLA 2XUMA 4QMAA 4A6OA 1XSRA 2D3RA 3O1MA 1RUOA 4K8RB 3LDRA 2GH8A 3E6DA 4Q4X3 1POV0 1T2XA 3IM0A 5HBAA 5JLVA 1F5JA 3ZYHA 4QDSA 4L9BA 1O4YA 2DU1A 4CDXC 1NG0A 2IXCA 3DL3A 3WG3A 3H50A 1EUTA 1XYNA 3HVDA 1DQ0A 4AVAA 5CKMA 1PM4A 3NJXA 1C57A 4LHLA 3AC0A 4DPNA 2CL2A 2YYOA 1ZREA 3I2OA 1YQCA 1D4M1 2GC3A 1X7NA 1X8MA 2P17A 4LUKA 3M3QA 2VC9A 1WW6A 5ACA2 1PO21 1B35C 3VDCA 5FYIA 1LB2A 3WOGA 4PBOA 4YW3A 1QH7A 1UX6A 5FK8A 4BK4A 1X82A 4HVOA 3I59A 5DAXA 3CJIA 2QZ2A 2JDYA 2ZZJA 3CZUA 3IBMA 4XJWA 1G86A 1NCRC 1W6PB 1BBT2 2ZMNA 1KGYA 3AZYA 4N53A 4Q1RA 3LF7A 1EAH3 4ITCA 4LXLA 5BUVA 1NZCA 3C7OA 3Q9OA 1W6MA 3I3BA 4A6SA 4XYXA 1OSGA 5JI7A 1PVXA 3NJZA 4ZS3A 4LUMA 3HT2A 1R082 5FPVA 2V72A 4CCEA 4JHTA 1J3PA 1GQGA 5L7OA 5KXBA 2XONA 3A0NA 2VNGA 1TG7A 4FPEA 1NZIA 2JEMA 2ES3A 2FQPA 1KD7A 1BVVA 2EF6A 3ZYFA 3UGGA 5CB7A 4CPBA 3VBHB 5C70A 1ZRFA 2WRAA 2WSUA 2R7EB 3WW3A 2EXJA 1NLSA 2QKDA 3LGRA 2XL9A 4RS5A 3TN93 2GDFA 2BU9A 4XIKA 1GU3A 4Y20B 4A4AA 4D6RA 2ZGKA 2ZGNA 2ZTNA 3ELNA 3KVAA 1OI6A 1X9TA 2XBO1 5JR2A 3H42B 1EPWA 2D3SA 4UF0A 3VD3A 5HCHA 3NO8A 4FPGA 2JE9A 4QX0A 4YGCA 3S7EA 2VUDA 1CX4A 1W9SA 4M0HA 1XYPA 4QPGB 5FMOL 3TEWA 4RR3C 5SV8A 5JAXA 1JHJA 5L9BA 4URAA 3LEKA 3LKJA 5I8YA 2E7TA 2VJXA 5JUVA 1LGBA 4YVSC 4IEVA 4AI3A 2K0GA 3MLKA 2PQSA 1GP6A 1OMIA 1H2MA 2UY9A 4P5HA 3SITA 1EYBA 3HQUA 3SKVA 1FV2A 1NE4A 4UYBA 4RFRB 1JYTA 3KS7A 1YIFA 4BK5A 3NNMA 5L9RA 4LBNA 3VDDA 2CYFA 4EZHA 2JD9A 2D3PA 1K5MC 1FPN1 2JKXA 3ZXJA 4XFBA 2OZ6A 1FATA 1ZRIA 4GH4B 2OPWA 2CU5A 1GNHA 2JG9A 4MZUA 4MYEA 1DG6A 5F32A 3A7QA 4JTNA 1WGPA 1Q56A 2ZEZA 4YNIA 2OA2A 1UWWA 1CD3G 3DXTA 1HXS2 2AC1A 4IV3B 5T5JA 5A6YA 1QJX3 5FZ7A 4AHZA 2WQ8A 3LIGA 3BOPA 5BNOA 3M3EA 1RITA 4ZPIA 3OPWA 1R081 1X9PA 3FHIB 3SMHA 3W21A 3O1TA 1K42A 5DMYA 1OF3A 3HN3A 1MS9A 2YU2A 3RPQA 2C9KA 5CKQA 3WP5A 1KFXL 4RHV3 5AC91 2C24A 1MEC3 3PTRB 1WBFA 2CAUA 2D5FA 1QF3A 5DAVA 4TZDA 3S5QA 3K3NA 1OVPA 2HWE3 2J1EA 1GMMA 1AR81 2WZR1 3GCWA 4CDXA 1LOAA 2RS13 3QH6A 4XAAA 1NA1C 3JCIA 2VTXJ 4YYOA 1HRI1 1E5HA 3OEBA 4WBBA 4JGYB 4ATEA 5E1RA 1REFA 3ES4A 4V2VA 1GANA 1HKDA 1W6NB 1F31A 4IEUA 5A80A 3U75A 5EHDA 4OI1A 2VD7A 1R64A 4LHKA 3LFMA 4JV4A 2DUPA 4L11A 3ETQA 4B8EA 5KXCA 3LOBA 4LO7A 2JWPA 4Y26A 2ZGPA 1SFPA 4KQ7A 5JSOA 2YBSA 3SHRA 5FZ4A 1TNFA 1HQNA 3ZFGA 2BGOA 3BPZA 5A3PA 4FXGB 4MGIE 1NCRA 1FOD2 2XJRA 5EIYB 5LY1A 3RZMA 4LBQD 3RYKA 3K46A 3WNLA 3I2IA 3CNAA 5FQ0A 5FPXA 2P6HA 1YJLA 2E63A 3ZN6B 4AYUA 5ANNA 2VCMA 3BODA 2BGPA 1RGSA 2QQVA 2VBDA 2BQPA 3L9JT 3AM2A 1FV3A 2VOXA 5AFBA 2MNGA 1T6GC 4CDUC 1VBA2 1YI7A 1H6XA 3GXUA 4XW3A 4DXTA 3QBQA 1JZ7A 1QJFA 4CRQA 5EFUA 1OQ1A 4OQ8A 2V4AA 5JR7B 1UPSA 4AVSA 5FPZA 2XLAA 1UOGA 2IFWA 2MEV2 4JTOA 3AXEA 4CCNA 2PLV2 5LATA 3C8XA 3DKWA 1S55A 5FFOC 3ILRA 1DQ6A 2W0XA 2VCBA 2MHFA 1STMA 5JMOA 1OD3A 2ATFA 2QJVA 3IDEA 4YG6A 1RUC3 2XQXA 1MQTC 2QQOA 1UIKA 2R6QA 4LA2A 5FPBA 3IDBB 5FXZA 1GWMA 4YW5A 3KQRA 2QCSB 5CFCB 4AF9A 3VHPA 5ERLA 3ZR6A 2IUWA 2WA3A 4RR3A 5BNPB 2XKPA 5JZGC 1UZZA 2VPVA 3PVEA 5TSWA 4QM9A 1RUJ1 2G9FA 1PX4A 1ZZ9A 4YVSA 1PGL2 1CAUA 2HWD1 1SPPA 4XE9A 4MGSA 3ZXKA 5A7WA 1HV0A 1RINA 5C3PA 1RUD2 4LKEA 3RQ0A 1OH3A 1AYN1 1QHDA 2R1DA 4IESA 1WA4A 5JIAA 3MYXA 3POIA 1DHKB 2HYKA 3LOIA 3MUY1 3VBSB 4GB32 3VD7A 2RG4A 5C8CB 1R092 2OKXA 4D3WA 1JYWA 3AVRA 3T09A 1V6KA 1TQ5A 4MXWB 3K77A 4KU8A 1K5MA 2AACA 5A1LA 2OUJA 4W4ZA 4WVVA 1LGNA 2ADDA 3M3IA 4WM7A 3WQ0A 4P14A 4TN7A 4W65A 4XJAA 3O1RA 5KHJA 1OURA 4QDQA 5A7PA 4D7SA 2ZGSA 1FMD1 1G8WA 3OJBA 1FOD1 3ZMNA 3IT8A 1PVC3 4UFMA 1S2BA 4ARXA 3KHCA 2X53S 4TSVA 1PO12 5IVFA 4MLOA 1HRV2 5T50A 1E5IA 2VUCA 5FZAA 3FUOA 2WFF3 3B02A 5HXVA 5A6QA 1S0GA 1X36A 4FFHA 2IC1A 3VZOA 1MZ6A 1NKGA 3WDXA 3OCPA 2D6KA 2VW1A 1C1FA 2ZHLA 3O1UA 5GZDA 2GC0A 3K4DA 4LMFA 3WG4A 1JMUB 1O91A 1OVSA 4COWA 1RC6A 2ZCWA 3KGLA 1BK0A 4XPVA 5KHGA 1OA4A 3D5OA 1CAVB 1CZTA 5IVYA 1PIV2 4S2GA 2Q8OA 2B9UA 3CO2A 4N7UA 3VL8A 2XJUA 3SH3A 2PLV1 1JOPA 4HOOA 1RHI1 4MH0E 3M1HA 2FD8A 3FBMA 2QQKA 4PBPA 4E2SA 5CA6A 2DVBA 3IZOA 5FZ6A 1UZVA 2VW2A 2RMU1 3ATGA 3LZZA 2GC2A 2JE8A 4PI2A 4Q29A 4F7ZA 4X8NA 5B2GB 1K12A 1OA3A 2EXIA 2QE3A 5IK8A 3A23A 3POBA 4CZSA 5CAZA 1NA1A 2E51A 2ZACA 2VOKA 5A32A 1AR73 3WY6A 2ARBA 2ZMKA 3MLLA 1NAEA 5F2WA 3U10A 2ZGQA 3U11A 4A45A 3IPVB 4ZXKA 2GNTA 3V56A 5K9YA 4H14A 4RQPC 5ABJB 1GQHA 4D94A 1V9U2 1O3QA 3DGTA 1UW8A 5BXXA 5J7MA 1W0OA 5GZEA 2R063 4CEWC 3THDA 4HZFA 2WNOA 1RUI2 4HETA 4CDWC 1WMXA 1XYOA 1F15A 3D6EA 2GU9A 3VV1A 1DBNA 4NIHA 1WKYA 2OZJA 1AUYA 4NOTA 3ES1A 1R091 5JXHA 1HB3A 4MVTA 2IXJA 2WYSA 4GWMA 2ZEXA 3HNBM 4R8HA 2YXSA 1HB1A 3KWVA 3LDKA 3B5LB 5BNNC 1XNBA 1REEA 4CDUA 4Q4X2 4AL9A 4A7KA 2X29A 3C7GA 3N9NA 3WDYA 4ES8A 2WNUB 1HN1A 1QY4A 4HFSA 1H4GA 5B4NA 5CKNA 5CFCC 5C3QA 2CGPA 3URFA 1ENQA 4PJYA 1FPN3 2ORZA 1HRV1 5H9PA 3J8F3 3WQ7A 2JDZA 2R0FA 3VUOA 1RUNA 3N7MA 4IGOA 5FYSA 4OZOA 4D7TA 5EQUA 5BYNA 5KBFA 1LRHA 5IUQA 1S0CA 1RYYA 2C4XA 3BU7A 3PUQA 4LE4A 5F6LB 5FBJA 4K8FA 4DY3A 4CXYA 1MQTA 1PZ8A 1ND3B 4QB2A 2KXLA 2RR12 3MW4A 3WW4A 2B7YA 5FP4A 1ALYA 2ENRA 2YFZA 3P3PA 3Q8EA 1Z0HA 4XUNA 2LALA 5FY1A 5JZGA 1PIV1 1ENXA 2VZQA 3H1MA 3EXUA 3MV11 4I09A 1LOGA 3AP9A 1ASJ2 4MOAA 4FQZA 4GA9A 4B4RA 3KLSA 4HVRA 2C5DA 4BIFA 3N35A 3ROUA 2VMCA 3DYPA 4H2AA 3D8CA 3J7NA 3NQHA 4IE6A 3ACFA 5CVRA 1AHSA 3LPFA 1PX3A 2DVGA 3AYAA 4D8MA 5LK5A 1WCKA 2RS51 2YBPA 3JBG1 3GALA 2C6SA 2DVDA 1N3QA 4R52A 3JZVA 4XABA 4XUQA 3AKTA 3SC7X 4KNCA 2W5FA 2ZEYA 3AL6A 3ZXAC 4EYUA 1GUIA 1OLRA 4SLIA 4UBGA 2WZEA 3UESA 4BQ2A 1G9BA 1H9WA 5A7OA 2CAVA 3S57A 1SDDB 4CP1A 4TTGA 3KGZA 4EZ4A 1HB2A 3CJIB 5FYTA 3ACLA 4IEXA 4K3UA 1SBFA 1XNTA 4QKNA 1HRI3 1TNRA 4KH9A 4C8DA 5JXJA 3I97A 4M0NA 3VHNA 1RUI1 2JDMA 2VVDA 4GQ7A 1NY72 1W6MB 4DXZA 5FZIA 1S0JA 2WIIB 2VMDA 1JW6A 1XPWA 3QOPA 5FXWA 4BHPA 1U0AA 2HLEA 4DEVA 4XBNA 4HSLA 4IUGA 2AEYA 3POSA 5L7OB 1S0EA 4DQAA 5I0SA 2X8KA 5FWJA 1DQ2A 2RJKA 5FY4A 2GAUA 1L7RA 2HYXA 2HWC3 3T2PA 2A71A 1OC1A 2OS2A 1YXWA 2XWBB 1E57A 4QXBA 1RUG1 3T1MA 5GLTA
chains in the Genus database with same CATH topology
3DCQA 1W8HA 2CHHA 2JDHA 2JDPA 2JDKA 5A70A 5A6XA 1OVSA 2BOJA 1OUXA 2BOIA 4CE8A 5HCHA 2JDMA 5A3OA 1UQXA 4UT5A 4AOCA 3ZDVA 2VUDA 1GZTA 1OURA 2JDNA 2VNVA 1W8FA 1OXCA 5D2AA 2BV4A 2BP6A 1UZVA 2JDUA 2XR4A 2VUCA 2WR9A 1OVPA 1OUSA 5A6QA 2JDYA 2WRAA 5A6ZA 5A6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DCQ A;  1W8H A;  2CHH A;  2JDH A;  2JDP A;  2JDK A;  5A70 A;  5A6X A;  1OVS A;  2BOJ A;  1OUX A;  2BOI A;  4CE8 A;  5HCH A;  2JDM A;  5A3O A;  1UQX A;  4UT5 A;  4AOC A;  3ZDV A;  2VUD A;  1GZT A;  1OUR A;  2JDN A;  2VNV A;  1W8F A;  1OXC A;  5D2A A;  2BV4 A;  2BP6 A;  1UZV A;  2JDU A;  2XR4 A;  2VUC A;  2WR9 A;  1OVP A;  1OUS A;  5A6Q A;  2JDY A;  2WRA A;  5A6Z A;  5A6Y A; 
#chains in the Genus database with same CATH topology
 3WEZ A;  5FUI A;  3QH7 A;  2PHD A;  3ZVX A;  5LRS A;  3U14 A;  3AP7 A;  3CZJ A;  4DIN B;  4NJ4 A;  2HWF 3;  4ORF A;  5A33 A;  3CF6 E;  4XBL A;  1AR6 1;  4UW4 A;  4UF0 B;  5FMD A;  1G6N A;  4A7Y A;  4EN7 B;  1LED A;  2CDP A;  1AJO A;  4NN0 A;  4FPY A;  3NNL A;  1OLM A;  3AP6 A;  3H8R A;  2ZPX A;  1LOE A;  2XHK A;  1QIQ A;  4BLJ A;  2RR1 1;  1VR3 A;  3RWK X;  4CYD A;  1JBC A;  4Y1V A;  4AFB A;  4XAC A;  3DEC A;  3SCG A;  5FZG A;  2XJT A;  1JU4 A;  2ERF A;  3I2F A;  4ZY9 A;  5DDJ 3;  3DPR C;  3ZN6 A;  4RQP A;  1MS4 A;  1W6Q A;  4OI2 A;  3VBO C;  1R1A 2;  1LOD A;  1ULP A;  3B94 A;  1QJX 2;  2TUN A;  4G3Y C;  5JPM B;  3IDC B;  3WDT A;  3MIB A;  1CON A;  1C28 A;  2E7A A;  1LU1 A;  1QOT A;  2XHN A;  3C7E A;  3IMM A;  2LS6 A;  1O5L A;  2J22 A;  2XQR A;  3KM5 A;  1COV 3;  4QPY A;  5T55 A;  3VDD B;  4CEW A;  4XOG A;  2VY0 A;  1EV1 1;  4J6G A;  4WV8 A;  4UXA A;  1H30 A;  4QXH A;  2FMY A;  5FYU A;  3J26 N;  1WLC A;  2BBV A;  2DYC A;  1I6X A;  1UY4 A;  3E1F 1;  2RS3 2;  2DCY A;  4FPJ A;  3W5M A;  1GWK A;  1UZ0 A;  4DMI A;  5C6C A;  4EWD A;  3BAL A;  2JG9 B;  5FCC A;  3RMX A;  3V0A A;  3NL1 A;  2EID A;  3BI3 A;  5BNN A;  3MZH A;  2VBB A;  1H1I A;  3T2Q A;  5FO8 B;  2HWE 2;  4N90 A;  2K9Z A;  1QOS A;  5FK7 A;  1NQD A;  2EIE A;  1XC6 A;  1NXM A;  5D8A C;  3OF1 A;  1GNZ A;  3N7J A;  5CFC A;  3O5S A;  4Y4R A;  5C5U A;  3PLQ A;  1HQL A;  4KWK A;  1W2A X;  2VEC A;  1F4A A;  2R30 A;  3QCW A;  2W2I A;  2YU1 A;  4FOY A;  4FXK B;  3ZDV A;  2XXZ A;  2ZX2 A;  2VUL A;  4HKW A;  5E6H A;  4AK3 A;  4NO4 A;  4FFF A;  4H55 A;  4GKX A;  1DZR A;  2D6P A;  2XVL A;  3O1O A;  1S2K A;  3I4I A;  1Z7S 2;  4Y5T A;  2P34 A;  3MIF A;  4PDW C;  1CAW B;  3BU0 A;  5DAB A;  1LHV A;  3GNE A;  2Y0I A;  2Z2S B;  5FTT C;  4NMI A;  3ZN5 A;  1WZX A;  1OUS A;  3M7A A;  1MVQ A;  1BEV 3;  1BQP A;  2OVU A;  3AJZ A;  3OBZ A;  5DUU A;  4HVQ A;  3P3N A;  1OFN A;  2ET7 A;  4L2N A;  1LEN A;  4MSV A;  4CSW A;  5C5T A;  4DRV A;  4COY A;  4CDX B;  3AX4 A;  3C7H A;  3SIS A;  4AFD A;  4CPB D;  4CU7 A;  3OUI A;  1A34 A;  4P9L A;  3SQO A;  4LO5 B;  4YM0 A;  1VIW B;  1DGW A;  2XH6 A;  3ILF A;  5K4L A;  1MS5 A;  3T0B A;  2AR6 A;  5DPN A;  4FP2 A;  2O8O A;  3MDP A;  5DG2 A;  4BQ4 A;  3HT1 A;  4PLN A;  2FDG A;  2ZKL A;  3MID A;  1B35 B;  1SZB A;  2Y33 A;  3I3M A;  3LEI A;  1CX1 A;  3GZA A;  4M3C F;  2RMU 3;  2ZS6 B;  3F2Z A;  3TRS B;  3BUC A;  3ZFG B;  3OBT A;  2E26 A;  4CCC A;  1NCR B;  5KHK A;  2PTM A;  3PUH A;  5LA9 A;  4DUX A;  1QH6 A;  1XQN A;  4ERO A;  2OT7 A;  1TMF 3;  4Q4W 1;  1V6O A;  1IOA A;  1H8T C;  1XNA A;  2AYH A;  1NXD 1;  4IE0 A;  2VW0 A;  3S5A A;  1D2S A;  4UI9 L;  5AVP A;  2DBN A;  2W3J A;  3FL7 A;  2DVF A;  1QU0 A;  4JAA A;  2RS3 1;  5FO7 B;  3H1Y A;  4QB1 A;  5F5I A;  1H8V A;  2CGO A;  5FBZ A;  2P4E A;  3TWI A;  5KC5 A;  1C8M 3;  3DV8 A;  1W03 A;  3I54 A;  1GNY A;  2CWM A;  3R4U A;  3UJQ A;  5F37 A;  1LHW A;  3JU9 A;  3POY A;  3I7D A;  1RUE 2;  1EPZ A;  2A73 B;  3C3V A;  5M0T A;  1J58 A;  3N9P A;  1DQ4 A;  2VH9 A;  2Y6G A;  1O5U A;  3GF6 A;  4W6Y A;  5F1R A;  3MFA A;  1AX2 A;  5J48 A;  1PNF A;  1YCI A;  1VP6 A;  1RMU 2;  2XVK A;  2EAL A;  3AZW A;  4FPK A;  2ZXQ A;  3USU A;  3N9M A;  2FCV A;  4QX7 A;  3UJO A;  1MS8 A;  3MIH A;  1CZV A;  3ACI A;  5J1X A;  4XDO A;  1UL9 A;  3BVC A;  4LBO A;  3LA3 A;  4Q26 A;  4PIX A;  4MG2 A;  4CU6 A;  1VBE 2;  1Z7S 1;  1KDK A;  4RR3 B;  5DXD A;  3WDV A;  1BVP 1;  4LKF A;  5IK7 A;  3MLJ A;  4CDQ C;  4MX3 A;  1VBD 1;  2RM2 3;  4HXC A;  3KT1 A;  4Q4Y 3;  3GCX A;  4DEQ A;  1Y7B A;  1SPP B;  1PVC 2;  2IWG B;  4Y1Z A;  2YDE A;  3VD4 A;  3DPR A;  1AL2 1;  3ME2 A;  2YV8 A;  3RYR A;  3VBO A;  3GZU C;  3OGS A;  1I9R A;  4BQX A;  3AXD A;  4Q4V 3;  2C26 A;  1F35 A;  2WC2 A;  1VAM A;  2JIC A;  2G9Z A;  2VZS A;  2Y38 A;  4PIY A;  5FY8 A;  2E32 A;  2Q8C A;  3VZL A;  5DUW A;  4E4Z A;  3H7Y A;  1VBC 3;  2WWJ A;  5LAS A;  1TE1 B;  3ZDS A;  4AGV A;  1PK6 B;  2H6C A;  1VB2 A;  5KWR A;  5IK5 A;  2PMW B;  3AMH A;  4V1P A;  5LRR A;  4C90 A;  1W06 A;  1K5M B;  1L7L A;  4P9Y A;  1POV 3;  1JOJ A;  4PLM A;  4YSF A;  4CU9 A;  1CIY A;  4JRA A;  1VBB 3;  4NUB A;  2ZML A;  1IKQ A;  4Q1P A;  4LIV A;  2RJL A;  1V6J A;  3PVB B;  5LY2 A;  2JE7 A;  4AXO A;  4KI5 M;  2WO1 A;  4XTM A;  4QQL A;  5CBL A;  5EZW A;  2VCC A;  3ON7 A;  3CEW A;  4CP2 A;  2EA7 A;  4FBF A;  1NYW A;  4OLL A;  1JXN A;  3Q8C A;  1QNW A;  3WG2 A;  1NE6 A;  3K48 A;  1LNS A;  2YY1 A;  1HN0 A;  3ZIX A;  3AKR A;  4QPI C;  2O14 A;  2I07 B;  5D8A A;  1JI6 A;  3GYD A;  4AHY A;  4COV A;  4LIU A;  3OG2 A;  1Q3E A;  4KWL A;  3PVO A;  2WS9 2;  1J3R A;  3K51 A;  4QX8 A;  4BCU A;  3PDQ A;  1UKG A;  5CG8 A;  2E7Q A;  4K40 A;  5F5C A;  1ST8 A;  4E27 A;  1RVF 2;  1KRI A;  3WV6 A;  1CN1 A;  5AC9 3;  4OHY A;  1TME 2;  1RUE 1;  2VOW A;  4OCT A;  4BU2 A;  2R04 1;  3KV4 A;  5IAT A;  4PDW A;  5GM0 A;  4AQT A;  4ATF A;  2WAO A;  1RMU 1;  1JOD A;  4JVA A;  1ZBE 1;  5FYH A;  2R07 2;  5JSR A;  4NHM A;  1H1M A;  1QQP 1;  1VRH 3;  3OD4 A;  2Y26 A;  3JD7 2;  1GOG A;  3ZYB A;  4XF0 A;  1NA1 B;  2JXA A;  1W90 A;  2VMF A;  1DP0 A;  5A32 B;  1DYK A;  3HWJ A;  1N3O A;  1XBF A;  1VBE 1;  2CHH A;  2ZX4 A;  4CVU A;  3WNO A;  1QJU 2;  5FZ8 A;  2V4V A;  4JKL A;  4HT1 T;  5LZ6 A;  1ULC A;  2N7G A;  3WF0 A;  5FIX A;  1VB4 A;  3WF1 A;  4NID A;  4XJU A;  1JZ2 A;  1Z78 A;  5FWE A;  3TEY A;  1ZBA 1;  3ZYI B;  1W8W A;  1J84 A;  3PIG A;  5LW9 A;  3O1P A;  3OYW A;  1ULG A;  4S2D A;  1MS1 A;  3RRD A;  4F8A A;  3ZSJ A;  3N7K A;  1ND2 C;  1Y3T A;  4GJZ A;  4KGG A;  4IDZ A;  1W04 A;  2ZGT A;  2Y34 A;  1UD1 A;  4ASK A;  2W95 A;  1ULE A;  1H8T A;  4IGQ A;  2O8Q A;  2OQ6 A;  1LKN A;  1GSL A;  1HQW A;  5HCA A;  1LOB A;  5FZK A;  5LCW L;  4PCR A;  4N43 C;  4CDU B;  2DV9 A;  2UWB A;  4RGK A;  3B9C A;  2V73 A;  4FSJ A;  3VB9 A;  2A1X A;  4P9G A;  4O65 A;  2YUE A;  2YZ4 A;  3PNA A;  3WQB A;  2PHX A;  3FZ3 A;  5C3O A;  5FDB A;  4QGL A;  3B9I A;  3KT4 A;  1US3 A;  3WF2 A;  4WZF A;  2LTN A;  4YWA A;  4KGQ A;  2KA3 A;  4IET A;  1X33 A;  4A7Z A;  1DGW X;  4KG8 A;  4QHO A;  2VZ1 A;  2EIC A;  2P3Y A;  4Y33 A;  5JWP A;  4CCL A;  5I0R A;  3MF6 A;  3THC A;  5HV4 A;  3KV5 A;  1PGS A;  5LA2 A;  1U5Y A;  2NLR A;  2NP0 A;  1MQT B;  3FLP A;  3TAY A;  1VMJ A;  1RVF 1;  2PA7 A;  2D98 A;  1Q8S A;  2A3W A;  4FTB A;  2TNF A;  1TME 1;  3SXW A;  3IKW A;  3E6B A;  3KVB A;  2LRP A;  5CEH A;  1UX7 A;  3ZYP A;  5JZG B;  2JDA A;  1AXY A;  2XUE A;  1PK6 C;  2PHR A;  4QQH A;  3SLI A;  1UY2 A;  4CDQ A;  5F39 A;  2WL1 A;  2VZU A;  3CJX A;  1OD5 A;  1XE0 A;  2GC1 A;  3PU3 A;  3T4V A;  3UGH A;  2CY6 A;  5ACA 1;  4DXS A;  2R07 1;  2FCT A;  1D2Q A;  3F95 A;  1C5I A;  3LA7 A;  3CIH A;  5EPA A;  5GLW A;  4NRM A;  3JD7 1;  5KHI A;  4ZS2 A;  4LBQ B;  1F5F A;  3I2D A;  2WAA A;  2XG3 A;  4AZZ A;  4Q0S A;  3AFK A;  1BBT 1;  3FJS A;  4S2H A;  3POJ A;  3U0Z A;  5GAL A;  5I91 A;  1O7F A;  1QJU 1;  2UYA A;  3B01 A;  4LKS A;  3LPG A;  1NLQ A;  2VGD A;  2DUQ A;  3DXU A;  3Q8F A;  1QXP A;  2D40 A;  4XCB A;  1NCQ C;  1HDK A;  1JYC A;  2JDK A;  1OPO A;  3E97 A;  3I3D A;  3QAC A;  4KWU A;  3THT A;  4EQV A;  5A6X A;  5A3O A;  1DGL A;  2YPJ A;  1L3J A;  4XJZ A;  3OUH A;  1PZ7 A;  2JEN A;  2WLQ A;  3DEM A;  1GP4 A;  2VM9 A;  4AED B;  2YBK A;  1JUI A;  5DN2 A;  4K9S A;  2BER A;  2JIJ A;  3ZR5 A;  4OMD A;  3MPP G;  2BFU L;  4QPI A;  5FY5 A;  1CAW A;  4XCA A;  3DUI A;  2VUA A;  4UWD A;  4E8C A;  4ZU7 A;  3ZPY A;  5DQ0 A;  1AYM 2;  1BJQ A;  3MIE A;  1OF4 A;  1Q8Q A;  5IAV A;  1AVB A;  3O1S A;  1WMF A;  2Z79 A;  2ZOE B;  3WP6 A;  1LOC A;  4TXW A;  5F5A A;  4A42 A;  1QWR A;  2NMN A;  3POW A;  4X6R B;  3LEG A;  3NMB A;  4MHR A;  4O61 A;  1W9Y A;  2GMM A;  5I0U A;  1WA6 X;  1WLW A;  2P3K A;  5FXV A;  3MHZ A;  5A33 B;  4AAX A;  1COV 2;  2ADE A;  2F17 A;  4PQQ A;  5CFD C;  4Y24 A;  1B35 A;  5F6K A;  3I3E A;  5FPL A;  2OX0 A;  4FVV A;  1VPH A;  4CU8 A;  5IVV A;  4AVT A;  4C91 A;  5CAD A;  5JOZ A;  1T6B X;  3UNP A;  4OI4 A;  5I8T A;  1WD4 A;  4M4P A;  1DU3 D;  4UFI A;  2UUR A;  2D6O X;  1IQA A;  1CVN A;  1O4Z A;  4QKB A;  1UF2 C;  2DFC A;  4GMP 3;  5FMO S;  4D0Q A;  2VBP A;  2B39 A;  1W6Q B;  1W8T A;  4RQP B;  5IVB A;  2ZEW A;  1RXF A;  2P6C A;  4YW7 A;  4HK8 A;  4XHX A;  1YQ6 A;  4XQ4 A;  1JUH A;  3H0O A;  3KHB A;  4NVP A;  4CEW B;  1AR9 2;  1YQ2 A;  1QJY 3;  3E5X A;  4R9C A;  1W8F A;  2R49 A;  1RB8 G;  3MUZ 1;  4XF4 A;  4CDW B;  4XUT A;  4P00 B;  1ZRR A;  1LGC A;  1ND2 A;  4M00 A;  5BY5 A;  5K0U C;  4OHX A;  3S30 A;  1HXS 1;  2UWA A;  3MFC A;  4AWD A;  4B29 A;  5LA0 A;  1SFY A;  4LNV A;  4NIA A;  4YG0 A;  4K7J A;  3V0A B;  4MUV A;  4GMP 0;  3WDW A;  5FUP A;  4N43 A;  5BNN B;  3KF3 A;  2R16 A;  4ZKT B;  5FZH A;  5FY0 A;  2HWB 3;  2WYF A;  2BW8 A;  4B4P A;  1FYU A;  1W8N A;  1O8P A;  4PF5 A;  4QGN A;  4E4D X;  2VQU A;  4QGM A;  4ES9 A;  2A6Z A;  5D1I A;  1GYK A;  1V6N A;  1W8U A;  1W8O A;  2DBI A;  1GWL A;  5AVA A;  1UCX A;  4B1M A;  3AMM A;  5C4W C;  3PU8 A;  3WDU A;  2WNE A;  3G7D A;  5IAX A;  1RIR A;  4SBV A;  2CNA A;  1ZRC A;  3TBD A;  5FRE A;  4G4F A;  3HNM A;  5EYY A;  1GQP A;  3H8U A;  4TLG A;  4CTE A;  2P37 A;  3U4X A;  1WBL A;  2VQA A;  3OUJ A;  1UYP A;  2HBU A;  2ORX A;  1J3Q A;  3PUS A;  4FOW A;  1RUF 2;  4ISR A;  4JQT A;  3M8L A;  3VZM A;  5GZF A;  4BWO A;  1PK6 A;  4QQP A;  4RGG A;  3UKN A;  4BQ5 A;  4Q27 A;  3KQ4 B;  4RSU A;  2WN2 A;  3IAP A;  2PHW A;  1JYX A;  2W92 A;  4W8J A;  5FPA A;  3PVN A;  4OMC A;  2VU9 A;  2R0H A;  4Y22 A;  2NN8 A;  4H3W A;  1W3V A;  2TBV A;  5J36 A;  1BMV 2;  1C8M 2;  2WZP P;  1PGW 2;  3WD5 A;  1JYI A;  4PQ9 A;  3JUU A;  1D4M 3;  2SBA A;  4GWN A;  2PHU A;  5HCB A;  4AED C;  4QXK A;  2XR4 A;  1PO2 3;  1O6U A;  1RXG A;  1ZRD A;  4OQ9 A;  2UYB A;  1S1A A;  1H2N A;  3AK0 A;  1W3X A;  3IAQ A;  3ZFG C;  3WNP A;  1XOY A;  1DLL A;  5A3T A;  3HQX A;  1AR9 1;  5A3M A;  1VBA 1;  4AVV A;  2PN5 A;  5FO9 B;  5L73 A;  1HB4 A;  3PUR A;  4P5Y A;  1UN1 A;  3K4A A;  3KCC A;  5A7S A;  4S2F A;  4M3C A;  3P1I A;  5F7U A;  4MO3 M;  4UFL A;  5ISL A;  1A8M A;  2MEV 1;  4LBJ A;  2BBA A;  2G4I A;  4BOW A;  4P02 B;  1N1Y A;  1PMJ X;  1YFX A;  1HJG A;  4Q4Y 2;  5A7N A;  1VAK A;  1WW7 A;  4A3X A;  1SLI A;  2Y0O A;  1RUH 2;  3P5B A;  4I2O A;  4LIT A;  4P08 A;  3U1X A;  2FHR A;  2Z4F A;  4N9H A;  3OGR A;  4B1L A;  3HQR A;  5JCT A;  2OII A;  4AW7 A;  4Q4V 2;  4BQY A;  1BK1 A;  1GR3 A;  2HEV F;  3PIJ A;  2B45 X;  3LB9 A;  3USU B;  1ENS A;  3B69 A;  2ZKN A;  4N8M A;  5CFD A;  1AXK A;  1PGL 1;  2XBO 3;  2JKB A;  4Q5O A;  1RUD 1;  3LSE A;  2E31 A;  1CJD A;  1D4V B;  5JDB A;  2J1T A;  4FQ4 A;  4HG6 B;  5HCF A;  3ALQ A;  3NAP C;  4QKF A;  5F9T A;  4GB3 1;  2IXI A;  1RUF 1;  2D44 A;  1H4H A;  5EV7 A;  2QQW A;  1MS0 A;  1QXJ A;  4KL1 A;  5DAP A;  3V64 A;  1IS4 A;  4LJH A;  3O12 A;  5FJK A;  4TWT A;  3ACH A;  3HAG A;  3DPR B;  2OW4 A;  3GBG A;  5FR3 A;  3VBO B;  4NIG A;  3ZIW A;  2CGN A;  4WZC A;  1A6C A;  2JB4 A;  1YJK A;  3GGL A;  5FV3 A;  3UKT A;  4OVE A;  3AP5 A;  2DCJ A;  1UY3 A;  4XJ8 A;  4YM1 A;  2WQZ C;  3BIW E;  4IGP A;  1DFQ A;  2WT1 A;  3WLU A;  1ZZ8 A;  1BMV 1;  1QDO A;  4ZU5 A;  1PGW 1;  1W8Z A;  4UFJ A;  4UFH A;  4Q0Q A;  3WHT A;  5K0U A;  3PME A;  5DZF A;  1PO1 1;  3R0R A;  2GAL A;  5ACA 3;  1QKQ A;  5LK7 B;  2BDR A;  4XFF A;  5FUN A;  2KM2 A;  3NW4 A;  2EAK A;  4IEQ A;  4LE3 A;  4HMZ A;  3V0B B;  4GIQ A;  2BNM A;  4FTS A;  5H9Q A;  3NKG A;  4JHZ A;  2OPK A;  3RS6 A;  4YW4 A;  1R1Z A;  4E2G A;  2K2S A;  3V65 A;  2E9Q A;  1XU1 A;  1ULD A;  2Z69 A;  1VRH 2;  4AHW A;  2WNV C;  5D8A B;  4HPK A;  4FTE A;  3IMN A;  3WNN A;  3WHU A;  1ULF A;  5FMC A;  1EAH 2;  2RE9 A;  5GLZ A;  2XGX A;  3OD0 A;  3TEZ A;  1R08 3;  4W6X A;  2WZ8 A;  5C4W A;  4H7M A;  2BVB A;  1RED A;  3WF3 A;  3O14 A;  3T0D A;  4Y1U A;  1CES A;  5FZE A;  5H9S A;  2VTX A;  2A70 A;  3H3Z A;  1YQ5 A;  1RUH 1;  5IW0 A;  4BIS A;  4AI2 A;  5JIU A;  4I01 A;  4LBQ A;  4XF3 A;  1SFN A;  1CGP A;  3JB8 A;  1OBN A;  4PDW B;  5F3I A;  3OGJ A;  1W28 A;  3GZE A;  3ZXF A;  3H1W A;  4GAZ A;  1FT9 A;  3S0M A;  4ISQ A;  3WCS A;  1W2T A;  4GD4 A;  2YC4 A;  1YC6 1;  2BJS A;  1UU4 A;  4JDM A;  1Y9M A;  3T30 A;  3GZT B;  1LTE A;  1SMV A;  4LR4 A;  1V9U 1;  1AX0 A;  1AR8 3;  2W9X A;  3RI8 A;  2WZR 3;  4DXR A;  1PMH X;  2W1W A;  4N7I A;  4HN0 A;  1WCQ A;  3TN9 2;  1O3R A;  4MAD A;  4L99 A;  4HAN A;  4XIL A;  1IS3 A;  1X8E A;  4GJY A;  3SH4 A;  3UL2 A;  2WT0 A;  4XXP A;  2HEW F;  4MGQ A;  1LES A;  3GHM A;  3ZYJ B;  3B93 A;  2QNK A;  4NRP A;  3KD4 A;  3UV9 A;  5HPO A;  2EVX A;  4MHU A;  1FNY A;  1J1T A;  2BTV C;  2VQ0 A;  4AED A;  1IG3 A;  4FFI A;  4EN8 B;  3ZXG A;  4BMB A;  5IHR A;  4IEO A;  4FCA A;  1UYY A;  3WUC A;  2WJS A;  1Y9Q A;  5DUV A;  3ZO0 B;  4BA6 A;  3OYW B;  4XZU G;  3LDB A;  5FLI A;  4LHN A;  1IPJ A;  4Q4X 1;  2J1U A;  1DQ1 A;  3BTX A;  2NZ9 A;  4AFM A;  2FDI A;  2O0O A;  5J96 B;  1H8T B;  2G19 A;  1UMH A;  1A8D A;  1F2N A;  1WD3 A;  2A7A A;  2X5I C;  1OUX A;  3T3Y A;  1UY0 A;  2GN7 A;  3PUA A;  5FZ9 A;  2QDN A;  5T52 A;  4P9J A;  2B5H A;  1JTZ X;  3CL1 A;  1DDL A;  4CCM A;  4OHZ A;  1OOP C;  4OYU A;  1VAV A;  4LA3 A;  5FZL A;  1O59 A;  1XNK A;  1BLZ A;  1O8S A;  3CMG A;  4JKK A;  1H9P A;  4XFC A;  3C2U A;  4QXC A;  2B42 B;  4BIO A;  2R1B A;  2E6V A;  4ZHN A;  4IE4 A;  3CQO A;  2C9A A;  3AYD A;  5T5P A;  3EQE A;  1EAH 1;  2WBK A;  4FOQ A;  1AX1 A;  1ASJ 1;  4IW3 A;  1OQE A;  1YO8 A;  3TNP B;  5F3E A;  4K20 A;  4JDO A;  3WZ1 A;  2BOI A;  3RG0 A;  4Z2A A;  4OZX A;  1IQD C;  3NV2 A;  3H3L A;  1I5Z A;  2PYT A;  2WFP A;  4CDQ B;  5GZG A;  4F3J A;  3NAP A;  1S0F A;  4CDW A;  1OKQ A;  5C9A B;  2QBX A;  4OUM A;  2DCT A;  4NAM A;  2JG8 C;  3VD5 A;  2WWU A;  1RUJ 3;  3VDB A;  4W6W A;  4Y1Y A;  5FZB A;  1VAL A;  2HWD 3;  1EP0 A;  4RHV 2;  1UYZ A;  2D6N A;  3MF9 A;  3WP4 A;  2HBT A;  1MEC 2;  1SAC A;  1AYN 3;  3RZJ A;  2OUH A;  2ZGU A;  4ET7 A;  2P3J A;  4QX3 A;  4OHV A;  1M06 G;  4JC1 A;  3TN9 1;  5FYB A;  1GFF 2;  1K45 A;  4LTA A;  4NHL A;  4URT A;  4R4Z A;  5E89 A;  1ZZB A;  2Q1F A;  1NY7 1;  2Y64 A;  2EIB A;  2PHF A;  2RS1 2;  1KFU L;  1IS6 A;  2BOJ A;  3J9S A;  4YVW C;  4YGB A;  5KR7 A;  1MZE A;  4LO4 B;  3POG A;  5C33 A;  3WCR A;  2B9V A;  3R4D B;  4JGZ B;  4AQS A;  2BRT A;  3AKS A;  4XEZ A;  2A5Z A;  4HSJ A;  1OXC A;  3A21 A;  2WAB A;  1FMD 3;  5JVV A;  3VBF C;  1FOD 3;  4AI8 A;  2WKK A;  3ZXL A;  2WNV A;  4QPI B;  1LHN A;  2WO2 A;  3VKM A;  3H8X A;  3I2H A;  2VMG A;  1G9D A;  1SLC A;  5EJZ B;  4FOV A;  2I2S A;  4QU1 A;  4XFG A;  3N7L A;  1W8H A;  4YFW A;  2XVG A;  1E5S A;  1XSQ A;  1VBA 3;  4BZ4 A;  3K75 B;  2Q8E A;  3RVH A;  3VN4 A;  4IV1 C;  2XJQ A;  5APA A;  3W9A A;  4AHX A;  4FAH A;  3EO6 A;  1DGR N;  3S6P A;  1GZT A;  2VNV A;  2FCU A;  1QJY 2;  4EV0 A;  4EWA A;  1MVE A;  1QEX A;  3VLB B;  2W94 A;  3KCX A;  2PLV 3;  2AEZ A;  1RHI 3;  4E9K A;  1KDM A;  3LFI A;  1H2L A;  2FBE A;  2RDN A;  1R1A 1;  1GOH A;  1QJX 1;  1L7Q A;  3U07 A;  3PHM A;  4CP0 A;  1PHM A;  3HN1 A;  3CLP A;  4Q0P A;  2FZ2 A;  1AZD A;  5FZ3 A;  1TZO A;  1LHO A;  1RUC 2;  4X6Q B;  4XUO A;  3MIC A;  4Y1X A;  5A1A A;  3JXS A;  1ULO A;  2E33 A;  2ZX3 A;  3CHX A;  3VKL A;  4BB3 A;  3I3Q A;  3HBZ A;  2ZJC A;  1C3H A;  4OI0 A;  2G1M A;  4AGG A;  2WLP A;  4RHV 1;  4WVM A;  4QU2 A;  1G7Y A;  1MEC 1;  2Y6H A;  3TNQ A;  1QOO A;  4R9B A;  3JQX A;  4QT6 A;  1ND2 B;  4DRR A;  3VHR A;  2CV6 A;  3KV9 A;  1Q5O A;  2HWE 1;  1YHF A;  2GH2 A;  3JB4 C;  1XE7 A;  3CBN A;  1R09 3;  2RS1 1;  5CU1 A;  5GLU A;  4QX5 A;  4NII A;  3AMP A;  5E16 A;  5C7G A;  3SKJ E;  5JOW A;  2QZ3 A;  3AB0 A;  4HKL A;  1W99 A;  2X5I A;  3W59 A;  4CEY C;  2WWS A;  4N43 B;  5DAW A;  2IXK A;  4QQ2 A;  1ENR A;  2PHT A;  1QDC A;  3CKH A;  1YFU A;  3M3C A;  4HL0 A;  4RS5 C;  2ARA A;  4QDR A;  1WME A;  2ILM A;  3PJY A;  2ZHN A;  2VZP A;  1IHM A;  3MIG A;  4NRQ A;  3ZOI A;  1CPN A;  5J37 A;  1CIW A;  1XB9 A;  2VR4 A;  4P9X A;  4IL7 A;  5IJR A;  1UU5 A;  3ZLI A;  1HRV 3;  5C9A C;  2BWA A;  3OGV A;  4Q8K A;  2DDU A;  1J59 A;  2W08 A;  3BPS A;  2W87 A;  3QD6 A;  3WQ1 A;  2A75 A;  4TLF A;  3III A;  2C1F A;  5FZF A;  4ZZ8 A;  4PLO A;  1Q43 A;  2VCA A;  1PO2 2;  4ONU A;  5CG9 A;  1MR5 A;  3VZK A;  1UOB A;  4F83 A;  3OY8 A;  4ZU4 A;  5FZC A;  2WFF 2;  3MI8 A;  5CYY A;  3VBR C;  2W1Q A;  3MW2 A;  1JZ3 A;  2RVA A;  5IFP A;  2PAK A;  5GLV A;  3B7M A;  1PIV 3;  1LJ7 A;  4JQR A;  5FYM A;  5BNQ A;  2W39 A;  4B7E A;  1OT5 A;  2JG8 A;  2A3X A;  3FMG A;  4FPC A;  3EMR A;  5EXO A;  1MAC A;  4AI0 A;  2NM1 A;  4JGZ C;  3SEE A;  4Y22 B;  3AYC A;  2BV4 A;  4QX2 A;  3ZFE C;  3V0B A;  2GME A;  2BWC A;  4Q0U A;  1GV9 A;  1NLR A;  4UAP A;  3NRU A;  1U5I A;  3CU7 A;  1CAX A;  4I30 A;  2RS5 3;  3JBG 3;  2D6M A;  2WDB A;  4XDQ A;  2CDO A;  2XLG A;  1WW5 A;  4JCK A;  1RUC 1;  1QXR A;  1YUD A;  2IXL A;  3GJB A;  4AEJ A;  4XTP A;  1NCQ B;  3FFZ A;  4YVW A;  1V0A A;  1AR7 2;  1JOB A;  1W39 A;  4PI0 A;  5A3U A;  1FNZ A;  1LU2 A;  3AZV A;  5A7Q A;  2ZZQ A;  1UZY A;  1UQX A;  1HLC A;  2BGC A;  4Y5S A;  3IWZ A;  2JDN A;  2WIN B;  1RUI 3;  4IEZ A;  3ZSL A;  2A3Y A;  4QD2 A;  3VBF A;  1FX5 A;  4M3C B;  2Y6F A;  1M4W A;  4K21 A;  1W0P A;  2R06 2;  3J7H A;  4IQP A;  1SDW A;  4XJ9 A;  1V6I A;  2WO7 A;  4C0H A;  3BCW A;  3PUI A;  1N1S A;  1WUV A;  4MV2 A;  3M4F A;  5F8P A;  1VMF A;  2XKO A;  1UAI A;  3O7O A;  4I0W B;  2DUR A;  5T5L A;  2D43 A;  3TOJ A;  4IV1 A;  1HIX A;  1RUG 3;  2ZA9 A;  4DUW A;  5FZO A;  3H7J A;  5A70 A;  3T1L A;  3N9L A;  3MPB A;  4DFS A;  4FP3 A;  3RDI A;  4QX1 A;  3GJA A;  3ZFF C;  1FI2 A;  2QQN A;  1GP5 A;  3EB7 A;  2G9G A;  5CFD B;  5K8S A;  2WSV A;  1AR6 3;  2A6W A;  1PVC 1;  2OQ7 A;  1PZ9 A;  4LLO A;  5IVC A;  1YRZ A;  2JB8 A;  3SNM A;  3IB3 A;  3NNJ A;  4RFT 0;  1FPN 2;  1JZ5 A;  1I3H A;  3ZPO A;  3WW2 A;  3J8F 2;  3FLR A;  1KS4 A;  3BIE A;  2DTW A;  3VBU C;  4AVB A;  2WFF 1;  2RR1 3;  1Q8P A;  1PNG A;  4B7K A;  5J09 A;  3AZZ A;  1YQ8 A;  1O3T A;  3VD9 A;  2ARE A;  1UU6 A;  2PAM A;  2UY8 A;  5I8S A;  5FMB A;  3WNK A;  3DCQ A;  3WNM A;  1ASJ 3;  2CTV A;  4FFG A;  4WVZ A;  4UBH A;  1RL3 A;  2GZW A;  1SLB A;  4QKD A;  2JEC A;  4A2U A;  2QQM A;  5C8W A;  5K0U B;  1EV1 3;  1KEX A;  3MW3 A;  4EN6 B;  4XUR A;  4AG4 A;  1LR5 A;  3NNF A;  3NST A;  3NNG A;  4LLF A;  2ZX1 A;  1XNC A;  2A6X A;  2E53 A;  4ZZ5 A;  1AR7 1;  4CEY A;  4L92 A;  5AC9 2;  1K3I A;  2PFW A;  2WS9 1;  1IPK A;  3NVC A;  3D0J A;  1GZC A;  4AFA A;  4XZP A;  4AI9 A;  1AR8 2;  2C0Z A;  1GOF A;  2VG9 A;  2WZR 2;  4HPK B;  2Q1Z B;  4CXX A;  3RWN A;  3UKV A;  2XOM A;  5A3W A;  2R06 1;  3HOB A;  1OPM A;  4UT5 A;  1HRI 2;  5JPN B;  2V5Y A;  2Y60 A;  1VLN A;  4XBQ A;  3D3A A;  2VME A;  3NV4 A;  5FZ0 A;  5J98 B;  5C4W B;  5C9A A;  4FAG A;  1BCX A;  4EWE A;  5FRA A;  2WA4 A;  2YFU A;  4AEM A;  2ZX0 A;  1W2U A;  2Z42 A;  2NPI A;  3WT3 A;  5CNA A;  1AXZ A;  5BV6 A;  2BZD A;  4D6S A;  4OHW A;  2QQJ A;  1O4T A;  1LOF C;  1F4H A;  2HWC 2;  4OFG A;  3VBR A;  1U5Z A;  3ZM8 A;  4AEK A;  1GZW B;  2YRO A;  4AGR A;  3NKT A;  4ASM B;  1DYO A;  2YPD A;  2JDH A;  4BXF A;  2YGL A;  2JX9 A;  4LBK A;  4RD7 A;  2XB6 C;  2XJV A;  4IE7 A;  4AQ2 A;  2J1R A;  4JX0 A;  2HWF 2;  3LE0 A;  4JGZ A;  4WM7 C;  3J8F 1;  1WW4 A;  2J1V A;  2VVF A;  3ZFE A;  5C3R A;  1S0B A;  1HX6 A;  2BEO A;  1JYN A;  3ZYG A;  5D2A A;  1VRB A;  4PT6 A;  1JS9 A;  1BYH A;  3I49 A;  4YG3 A;  3HNY M;  3LA2 A;  4YW2 A;  2JDU A;  2Q1M A;  1CPM A;  2LM3 A;  3TYJ A;  4Z92 B;  4FT8 A;  4CA9 A;  4YM2 A;  3PMS A;  1R1A 3;  4TYS A;  4L8Q A;  1W6O B;  1Y9G A;  4PIZ A;  4YFZ A;  4Y3O A;  5ANQ A;  4RN5 A;  5LA1 A;  3B00 A;  3AYE A;  1I1E A;  1LEM A;  1V70 A;  3WF4 A;  3QLQ A;  5JI9 A;  4HK9 A;  1DZQ A;  2JDP A;  2PXJ A;  1FAY A;  1Q8O A;  4IE5 A;  5DDJ 2;  3RNS A;  3ZYR A;  2DCZ A;  4Q4W 3;  4AI1 A;  2D6L X;  5DZE A;  2NYY A;  4LBL A;  2L9L A;  2WO3 A;  5JXG A;  4D7Y A;  2UU8 A;  4L97 A;  1GIC A;  3FLT A;  3WNX A;  4FO9 A;  3E6C C;  2RS3 3;  3RJ2 X;  2VQT A;  2ZAH A;  4IEW A;  4COZ A;  2I45 A;  2P5B A;  3RZG A;  1YFW A;  3E5Q A;  1RUJ 2;  1KQR A;  1YI9 A;  5CZK A;  5KXE A;  3NV1 A;  2HWD 2;  5HI0 A;  1UY1 A;  3HPN A;  1OLM E;  3THP A;  3H9A A;  3LIH A;  1AYN 2;  2VO5 A;  1IPS A;  2X10 A;  4QHB A;  3ZMO A;  3ZSE A;  2A6Y A;  3K2O A;  3FBY A;  3ZFF A;  3LSD A;  1N1T A;  3LCP A;  3N3H A;  3FX3 A;  1DGR A;  2VZ3 A;  4ZON A;  1I5P A;  5DUX A;  2VZR A;  1NX9 A;  2D7F A;  4NHY A;  3I2K A;  3RZH A;  1QMJ A;  3ITQ A;  4LBM A;  2TEP A;  1Z7S 3;  3VBU A;  3NAP B;  2AEN A;  4J25 A;  2F4L A;  1GZ9 A;  2HWC 1;  1FMD 2;  2VZT A;  3ZKU A;  4I3P A;  1VBD 3;  1NT0 A;  4GAL A;  4L0P A;  2EXH A;  4DY5 A;  3D0S A;  3T2T A;  2VZO A;  3OOX A;  4D6Q A;  2IVJ A;  4FI9 A;  1AL2 3;  3A22 A;  1UPI A;  1WCU A;  4R9A A;  3WR0 A;  2AGS A;  5LBC A;  3VBH C;  4OUE A;  5B4X A;  3TB0 A;  4AFC A;  2HWF 1;  5C3S A;  1BEV 2;  4XF9 A;  1DYP A;  1S0I A;  2ZBJ A;  1JU3 A;  3HD8 B;  1W9W A;  2YHJ A;  4IEY A;  4BYY A;  4NRO A;  4QWN A;  1UXZ A;  2CSG A;  4DOU A;  2KD7 A;  4A41 A;  1FXZ A;  1HV1 A;  3POF A;  4DB5 A;  2DVA A;  5E8A A;  4MGZ E;  4QPG C;  3U4S A;  1ZA7 A;  4K1Z A;  1PMI A;  1BKZ A;  3O0W A;  1H2K A;  2GNM A;  1CZS A;  1AYM 1;  4EN9 B;  3BTY A;  4XIO A;  1RHI 2;  3MEP A;  4UW6 A;  2QTW B;  5KHH A;  2PQQ A;  2WR9 A;  5DDJ 1;  3LD8 A;  2RMU 2;  2OYZ A;  1PM7 A;  3OTF A;  4YRD A;  2WNV B;  3EBR A;  1LUL A;  4CUG A;  3O1V A;  3RZK A;  1SHW B;  2QQU A;  2ZHK A;  4M4R A;  1O3S A;  2YC0 A;  4HKO A;  1D0H A;  2BNN A;  1ZZ6 A;  2YB7 A;  3ASI A;  3EJK A;  1YYN A;  1Q8V A;  2P3I A;  4O7X A;  4BQW A;  4IEP A;  1COV 1;  2A6V A;  1TMF 2;  4NPM A;  3AKP A;  4FPF A;  3DKQ A;  3IIA A;  4FPL A;  4ZXE A;  4C1W A;  5EJ3 A;  4BXS V;  4CCD A;  2BFU S;  3RFR A;  5EYX A;  2H0B A;  1KS5 A;  2QQL A;  1HW5 A;  1B09 A;  4NPR A;  1N3P A;  1RUE 3;  2NQY A;  2B8M A;  2J1A A;  3VZJ A;  3T0A A;  1WWY A;  4XUP A;  3RZZ A;  2R04 3;  4GH4 C;  3WIN E;  1LOF A;  4X8P A;  2J1S A;  1JZ8 A;  1RJ7 A;  1RMU 3;  3W5N A;  4Z82 A;  1E5R A;  1DQ5 A;  1ZBE 3;  2BYV E;  3R4S A;  5FYY A;  3I8T A;  1MS3 A;  5GJ6 A;  2GN3 A;  4OUS A;  4J1X A;  4BPZ A;  2VTF A;  1QQP 3;  3D4K A;  3ZSM A;  1NCQ A;  3OBR A;  3J4U H;  3WG1 A;  4IV3 C;  4LT5 A;  3M2M A;  3MV0 1;  2Q8D A;  4HBN A;  1C4R A;  1UO9 A;  1VBE 3;  5A1F A;  1F9K A;  1XJA A;  1SEF A;  3L2Y A;  3R05 A;  5L36 A;  2GP5 A;  2ETE A;  4YPJ A;  2FDJ A;  2VOV A;  3KCY A;  1KXG A;  3MBW A;  4WM8 B;  5BPX A;  4QM8 A;  1KJL A;  1S0D A;  4WVM B;  1ZBA 3;  4NR1 A;  1SLL A;  4JDN A;  4Z07 A;  2YMZ A;  4Z8B A;  4LOS A;  4EE2 A;  1OFS A;  2VE1 A;  2RM2 2;  2Y6K A;  3OEA A;  4YGD A;  5A3L A;  1GKB A;  1BEV 1;  4LUL A;  2V09 A;  4AE2 A;  5JSP A;  1XU2 A;  4UFK A;  1OKO A;  3ETP A;  4YZ5 A;  4XMI A;  3TEX A;  3NJY A;  2X5I B;  2QQI A;  3EHK A;  1W2N A;  3FE5 A;  4DZG A;  5JOY A;  2F4P A;  4A44 A;  4GUL A;  1VBC 2;  3KB5 A;  4JGY C;  4OUL A;  5FP7 A;  4CCJ A;  1UMI A;  2XPJ A;  2W1S A;  2P1B A;  2W46 A;  4QB6 A;  4V2W A;  4XFH A;  1U5X A;  1BZW A;  1OOP B;  3E5U A;  2Y6J A;  3G6J B;  5G04 L;  5L9V A;  5IFT A;  1VBB 2;  4I0A A;  3FWE A;  2QDR A;  3GM8 A;  3RJR A;  4LHS A;  4GZ9 A;  3ST7 A;  4AAP A;  5FOJ B;  3VHO A;  1G9C A;  2RS5 2;  2VMH A;  3JBG 2;  1W6P A;  4RL7 A;  2EAA A;  4YW1 A;  1TMF 1;  3R6S A;  2RV9 A;  3SH5 A;  2WS9 3;  1ODM A;  4YZ2 A;  3MO4 A;  2IFR A;  3OY8 B;  1QNY A;  3NWK A;  1RVF 3;  3VKN A;  2YGM A;  4XC9 A;  1AL0 G;  1A3K A;  4G9S B;  1TME 3;  5LB6 A;  5IYY A;  3ZKY A;  4Y5Z 0;  1SG3 A;  1C8M 1;  5DZG A;  3O0X A;  1V6M A;  1ZZC A;  1SLA A;  2JG8 B;  5FXX A;  5JXI A;  1H1A A;  2YG0 A;  3I2G A;  4RYD A;  3PTY A;  4CP9 B;  2I74 A;  5FKB A;  3W20 A;  3BTZ A;  2R07 3;  4C1X A;  5IT6 A;  4I0B A;  4K1Y A;  4FPO B;  3SCF A;  2VNO A;  3LWC A;  1GLH A;  3GHN A;  1YEW A;  2AZ5 A;  3JD7 3;  4HN1 A;  4LQR A;  4KMQ A;  5SV5 A;  4YM3 A;  1ZYB A;  3VBH A;  5KC6 A;  1JZ4 A;  1CAX B;  2QFE A;  3CDZ B;  1K5J A;  5A3N A;  1W2O A;  1G9A A;  1BBT 3;  1W9T A;  4CCK A;  1JZ6 A;  2B46 X;  5FAX A;  2LW8 A;  4Y20 A;  3N9O A;  5I0T A;  1QJU 3;  4ARY A;  4YZ1 A;  5H9R A;  5F3C A;  2FMD A;  4K6B A;  1RUG 2;  1SBD A;  4YVW B;  3LAG A;  2ZGR A;  3AKQ A;  2SLI A;  3LEM A;  2IXH A;  1EUU A;  4NHX A;  4QPG A;  4BE3 A;  2Z5W A;  4NAO A;  1J83 A;  2CWS A;  4YW6 A;  4AQ6 A;  4C0B A;  4COU A;  5BNP C;  4U2A A;  1ODN A;  2RM2 1;  4B3N A;  4Q4Y 1;  4LPL A;  1AR6 2;  3IN9 A;  3VBF B;  4B4Q A;  4Z2W A;  4E4S A;  1JH5 A;  3UYJ A;  2P2K A;  2VNR A;  1A78 A;  4Q4V 1;  4Y4Y A;  4YLZ A;  5JOX A;  3Q8A A;  4BLI A;  4E8D A;  1SCR A;  3KT7 A;  4N9I A;  4DUV A;  5FYV A;  1VBC 1;  2R32 A;  1UOF A;  2ZHM A;  1GZW A;  3VBS C;  5E88 A;  5C8C C;  4BQ3 A;  1NOV A;  2RHP A;  3VL9 A;  1HJF A;  1UIJ A;  1WLT A;  1POV 1;  3KV6 A;  4IV1 B;  5EWS A;  3RSJ A;  3HBK A;  1VBB 1;  3AVS A;  3B3Q E;  4LK7 A;  5FZO B;  4CE8 A;  4Z1V A;  3POE A;  5HXM A;  1YLL A;  2HKX A;  3KZ4 C;  5KXD A;  1S2E A;  4YZ4 A;  4A3Z A;  3FC0 A;  3ORJ A;  3OPT A;  4GH4 A;  4MGT A;  4KBB A;  2ZGL A;  1EV1 2;  5LWB A;  3APB A;  3UT0 A;  3ZX7 A;  4WM8 C;  3FN9 A;  1ZNP A;  1UZW A;  2EIG A;  4JKM A;  3T08 A;  2WN3 A;  3UK9 A;  2QQP A;  4HLT A;  1BHG A;  1WMD A;  1ONA A;  1X50 A;  4IV3 A;  3H3U A;  3U37 A;  1W6O A;  4W50 A;  3HIF A;  3AP4 A;  3I59 B;  4IER A;  3RYP A;  5A6Z A;  4CUA A;  2B4K A;  1C1L A;  2ET1 A;  4BM8 A;  2WUH A;  1JHN A;  3WSO A;  4N53 B;  4U36 A;  5IVE A;  1P8J A;  3VKO A;  1SLT A;  4XDP A;  3WXP A;  2VVE A;  3RGB A;  2PAE A;  4QHZ A;  2GND A;  4KWJ A;  3WUD A;  2VAU A;  2O1Q A;  4JZR A;  4MET A;  1XXN A;  4J1W A;  2ARC A;  3DF0 A;  2X05 A;  4LOR A;  1TEI A;  3S7I A;  3I2J A;  3KF5 A;  3X29 B;  5JMC A;  2J7M A;  4ASL A;  1Y4W A;  1VRH 1;  3BN6 A;  5K7P A;  4YZ3 A;  1HXS 3;  2Q5T A;  3KSC A;  3ZXE A;  5FPU A;  3AMN A;  3LQC A;  5FY9 A;  1VMH A;  4DNY A;  1IGO A;  5D21 A;  1US2 A;  3W58 A;  4BJ0 A;  4CEY B;  1H6Y A;  1UOJ A;  2DCK A;  4JGY A;  5I93 A;  2XWJ B;  1CR7 A;  1UMZ A;  2RDS A;  4RS5 B;  1YNA A;  3K4Z A;  5LBE A;  1OA2 A;  3VKF C;  2D97 A;  2Q30 A;  2XJP A;  5T54 A;  1W6N A;  3SCH A;  3ZN4 A;  5LEK A;  1DLC A;  5ABJ C;  2Q0A A;  2FDK A;  2RDQ A;  4P9I A;  1SBE A;  1OHF A;  3SEP A;  3BGA A;  2XLF A;  3UGF A;  1D7P M;  5T5O A;  2W1U A;  1QJE A;  5FYC A;  1CWP A;  4O9G A;  2HH9 A;  4XHB A;  1AYM 3;  3BB6 A;  3BTA A;  2W68 A;  5IVJ A;  5F3G A;  5FYZ A;  3A0K A;  1C8N A;  1ZX5 A;  4R4X A;  3FUQ A;  1RTV A;  3PL0 A;  5IK4 A;  3INA A;  1N47 A;  1MPX A;  4I02 A;  3GDB A;  3VBR B;  2LUW A;  3WX5 A;  3N36 A;  5G05 L;  3U78 A;  5AFE A;  3HR9 A;  1Y43 B;  1OLQ A;  3AL5 A;  3WW1 A;  4Q4W 2;  2WNU C;  2DU0 A;  2OXB A;  1NUK A;  4Q8L A;  4UOJ A;  3ZFE B;  3AJY A;  1DIW A;  3M3O A;  5GZC A;  1YWK A;  4XXA A;  1S4C A;  1APN A;  3DN7 A;  3OPZ A;  4HON A;  4LOT A;  5GKA C;  2ZAB A;  4LO6 B;  3BOW A;  2VUJ A;  4GXL A;  3KMH A;  4NE9 A;  2PEL A;  2WT2 A;  3FHA A;  5FOB B;  3VZN A;  4MGK E;  1ND3 C;  1RJ8 A;  1OH4 A;  2GNB A;  5FZM A;  5EJ1 B;  1XE8 A;  1KIT A;  2PHL A;  3MGU A;  4FPH A;  4BME A;  5BNO B;  2X09 A;  2DUO A;  1D0G A;  5EP9 A;  5BNP A;  1WLD A;  3GBW A;  1AR9 3;  2GP3 A;  2GSY A;  2DFB A;  4LK6 A;  3NV3 A;  1LAJ A;  1CJP A;  2H6B A;  4KG0 A;  4UW5 A;  1N1V A;  1G9F A;  2H0V A;  1LEC A;  1W9F A;  2BP6 A;  2IZW A;  2MEV 3;  2XDV A;  4PF1 A;  5DAQ A;  1KJR A;  1UKR A;  3BYW A;  3RZL A;  3VBS A;  1VBD 2;  2DF7 A;  2VOT A;  3L2H A;  1URX A;  1BXH A;  4Q2F A;  4XQD A;  5LBB A;  4R9D A;  2FDF A;  3A4U A;  2D5H A;  3J7L A;  1W05 A;  1TVG A;  1W0N A;  3ZXD A;  5C8C A;  3M70 A;  3RMY A;  2F6B A;  2RJ2 A;  4MXW A;  1AL2 2;  4UW3 A;  3OB8 A;  4P9W A;  4AVC A;  4CUC A;  1F8V A;  1UXX X;  3CJI C;  2BUK A;  1LCL A;  2HJI A;  4KBZ A;  4DS0 A;  4N53 C;  2HWB 2;  3ZFF B;  1QJZ A;  4LKD A;  4AOC A;  2XJS A;  4XFI A;  2KR2 A;  1V00 A;  1J1L A;  3AZX A;  1MZF A;  1U12 A;  4KU7 A;  3Q8B A;  4WM8 A;  2MPF A;  5LBF A;  2EXK A;  3D82 A;  5FP8 A;  1RUD 3;  4EJR A;  3VBU B;  4I3G A;  2JIG A;  5L7O C;  1AJK A;  4NWW A;  4NHK A;  3VDA A;  3GBF A;  4GB3 3;  1OQD A;  4QPW A;  1RUF 3;  5FP3 A;  3ABZ A;  3UET A;  3DYM A;  1ZVF A;  4AR2 A;  4PHZ A;  5IWF A;  4DO0 A;  4E2Q A;  1YFY A;  1DF0 A;  5FQ0 B;  1ZZ7 A;  2WQ4 A;  4XQW A;  2JD4 A;  2QUO A;  5J3U A;  1IKP A;  3K3O A;  3USS A;  3AMQ A;  1ZM1 A;  3FFQ A;  2Y8K A;  4CXW A;  4LEJ A;  5FZ1 A;  3T4H B;  1CAV A;  4CUB A;  3J7M A;  2FDH A;  3FHQ A;  3HEI A;  3OGG A;  1OOP A;  1GBG A;  5LEJ A;  2VZV A;  4GWI A;  2FZ1 A;  2V5D A;  4YGE A;  5FJH A;  2VXJ A;  2XML A;  3WP3 A;  3N4M A;  1PO1 3;  1H0B A;  4DIQ A;  4GKY A;  1SQ4 A;  2IVI B;  1IZ3 A;  2JJ6 A;  3ACG A;  1IG0 A;  3N9Q A;  4MGY E;  4MXV A;  2ARX A;  3PJQ A;  2R04 2;  5FKC A;  1SCS A;  2ZAA A;  2ZGO A;  2W47 A;  2D93 A;  1D4M 2;  4IND A;  4QQO A;  5DG1 A;  1UYX A;  1AF9 A;  5CIS A;  1ZBE 2;  4GMP 1;  4NWV A;  4BQ1 A;  3ENR A;  3T2O A;  2XL7 A;  2HEY F;  5CIR A;  3IPV A;  1QQP 2;  4E4H A;  4O9E A;  4RA0 A;  1UNB A;  5ABJ A;  4XVH A;  3EYP A;  4XAE A;  1DCS A;  3RI9 A;  3WVJ A;  3OSD A;  5HV0 A;  1C5H A;  1QJY 1;  1POQ A;  2BNO A;  4BH9 A;  1NQJ A;  2VMI A;  5FY7 A;  1ZA4 A;  3VDD C;  1MZ5 A;  3ECQ A;  1YIP A;  4CP9 A;  3DYO A;  3C7F A;  3HMY A;  2AH2 A;  4RGA A;  1DZT A;  4YVS B;  2ID4 A;  2BPA 2;  1CAU B;  2UWC A;  1XRU A;  3ILN A;  5C71 A;  3NJV A;  3HJR A;  1RUH 3;  1V6L A;  5A7W B;  1ZBA 2;  4XET A;  2RDR A;  2W52 A;  2VL4 A;  2J42 A;  2VXR A;  4D69 A;  2K46 A;  1LHU A;  2JG9 C;  4Q0V A;  2BVV A;  5FLH A;  5T3N A;  3ZSK A;  4BDV B;  1JN2 P;  1VJ2 A;  2HWB 1;  2NMO A;  2W91 A;  3JQW A;  5I0D A;  4XF1 A;  2ZGM A;  3OBA A;  4LO8 A;  2WNU A;  1V9U 3;  4XFA A;  5F2S A;  3H8O A;  2DWR A;  2YC2 A;  4WM7 B;  5BNO C;  2AUY A;  4GWJ A;  4H7L A;  2GMP A;  5FLJ A;  1CQ9 A;  1EY2 A;  1WCD J;  1XND A;  1WCS A;  2DTY A;  2QVS B;  4XMA A;  5FP9 A;  2Y6L A;  2XBO 2;  4EN0 A;  1JYV A;  3AFG A;  4NPL A;  4WVW A;  1ACC A;  3IDA A;  3VGI A;  4M01 A;  1IS5 A;  4IXL A;  3P6B A;  4QAW A;  4CCO A;  1VE0 A;  4M3C E;  4YAR A;  5L19 A;  3O0V A;  5FZD A;  2Q4S A;  2LRO A;  3BKZ A;  4JRL A;  1ND3 A;  5F5Q A;  1QGL A;  2XUM A;  4QMA A;  4A6O A;  1XSR A;  2D3R A;  3O1M A;  1RUO A;  4K8R B;  3LDR A;  2GH8 A;  3E6D A;  4Q4X 3;  1POV 0;  1T2X A;  3IM0 A;  5HBA A;  5JLV A;  1F5J A;  3ZYH A;  4QDS A;  4L9B A;  1O4Y A;  2DU1 A;  4CDX C;  1NG0 A;  2IXC A;  3DL3 A;  3WG3 A;  3H50 A;  1EUT A;  1XYN A;  3HVD A;  1DQ0 A;  4AVA A;  5CKM A;  1PM4 A;  3NJX A;  1C57 A;  4LHL A;  3AC0 A;  4DPN A;  2CL2 A;  2YYO A;  1ZRE A;  3I2O A;  1YQC A;  1D4M 1;  2GC3 A;  1X7N A;  1X8M A;  2P17 A;  4LUK A;  3M3Q A;  2VC9 A;  1WW6 A;  5ACA 2;  1PO2 1;  1B35 C;  3VDC A;  5FYI A;  1LB2 A;  3WOG A;  4PBO A;  4YW3 A;  1QH7 A;  1UX6 A;  5FK8 A;  4BK4 A;  1X82 A;  4HVO A;  3I59 A;  5DAX A;  3CJI A;  2QZ2 A;  2JDY A;  2ZZJ A;  3CZU A;  3IBM A;  4XJW A;  1G86 A;  1NCR C;  1W6P B;  1BBT 2;  2ZMN A;  1KGY A;  3AZY A;  4N53 A;  4Q1R A;  3LF7 A;  1EAH 3;  4ITC A;  4LXL A;  5BUV A;  1NZC A;  3C7O A;  3Q9O A;  1W6M A;  3I3B A;  4A6S A;  4XYX A;  1OSG A;  5JI7 A;  1PVX A;  3NJZ A;  4ZS3 A;  4LUM A;  3HT2 A;  1R08 2;  5FPV A;  2V72 A;  4CCE A;  4JHT A;  1J3P A;  1GQG A;  5L7O A;  5KXB A;  2XON A;  3A0N A;  2VNG A;  1TG7 A;  4FPE A;  1NZI A;  2JEM A;  2ES3 A;  2FQP A;  1KD7 A;  1BVV A;  2EF6 A;  3ZYF A;  3UGG A;  5CB7 A;  4CPB A;  3VBH B;  5C70 A;  1ZRF A;  2WRA A;  2WSU A;  2R7E B;  3WW3 A;  2EXJ A;  1NLS A;  2QKD A;  3LGR A;  2XL9 A;  4RS5 A;  3TN9 3;  2GDF A;  2BU9 A;  4XIK A;  1GU3 A;  4Y20 B;  4A4A A;  4D6R A;  2ZGK A;  2ZGN A;  2ZTN A;  3ELN A;  3KVA A;  1OI6 A;  1X9T A;  2XBO 1;  5JR2 A;  3H42 B;  1EPW A;  2D3S A;  4UF0 A;  3VD3 A;  5HCH A;  3NO8 A;  4FPG A;  2JE9 A;  4QX0 A;  4YGC A;  3S7E A;  2VUD A;  1CX4 A;  1W9S A;  4M0H A;  1XYP A;  4QPG B;  5FMO L;  3TEW A;  4RR3 C;  5SV8 A;  5JAX A;  1JHJ A;  5L9B A;  4URA A;  3LEK A;  3LKJ A;  5I8Y A;  2E7T A;  2VJX A;  5JUV A;  1LGB A;  4YVS C;  4IEV A;  4AI3 A;  2K0G A;  3MLK A;  2PQS A;  1GP6 A;  1OMI A;  1H2M A;  2UY9 A;  4P5H A;  3SIT A;  1EYB A;  3HQU A;  3SKV A;  1FV2 A;  1NE4 A;  4UYB A;  4RFR B;  1JYT A;  3KS7 A;  1YIF A;  4BK5 A;  3NNM A;  5L9R A;  4LBN A;  3VDD A;  2CYF A;  4EZH A;  2JD9 A;  2D3P A;  1K5M C;  1FPN 1;  2JKX A;  3ZXJ A;  4XFB A;  2OZ6 A;  1FAT A;  1ZRI A;  4GH4 B;  2OPW A;  2CU5 A;  1GNH A;  2JG9 A;  4MZU A;  4MYE A;  1DG6 A;  5F32 A;  3A7Q A;  4JTN A;  1WGP A;  1Q56 A;  2ZEZ A;  4YNI A;  2OA2 A;  1UWW A;  1CD3 G;  3DXT A;  1HXS 2;  2AC1 A;  4IV3 B;  5T5J A;  5A6Y A;  1QJX 3;  5FZ7 A;  4AHZ A;  2WQ8 A;  3LIG A;  3BOP A;  5BNO A;  3M3E A;  1RIT A;  4ZPI A;  3OPW A;  1R08 1;  1X9P A;  3FHI B;  3SMH A;  3W21 A;  3O1T A;  1K42 A;  5DMY A;  1OF3 A;  3HN3 A;  1MS9 A;  2YU2 A;  3RPQ A;  2C9K A;  5CKQ A;  3WP5 A;  1KFX L;  4RHV 3;  5AC9 1;  2C24 A;  1MEC 3;  3PTR B;  1WBF A;  2CAU A;  2D5F A;  1QF3 A;  5DAV A;  4TZD A;  3S5Q A;  3K3N A;  1OVP A;  2HWE 3;  2J1E A;  1GMM A;  1AR8 1;  2WZR 1;  3GCW A;  4CDX A;  1LOA A;  2RS1 3;  3QH6 A;  4XAA A;  1NA1 C;  3JCI A;  2VTX J;  4YYO A;  1HRI 1;  1E5H A;  3OEB A;  4WBB A;  4JGY B;  4ATE A;  5E1R A;  1REF A;  3ES4 A;  4V2V A;  1GAN A;  1HKD A;  1W6N B;  1F31 A;  4IEU A;  5A80 A;  3U75 A;  5EHD A;  4OI1 A;  2VD7 A;  1R64 A;  4LHK A;  3LFM A;  4JV4 A;  2DUP A;  4L11 A;  3ETQ A;  4B8E A;  5KXC A;  3LOB A;  4LO7 A;  2JWP A;  4Y26 A;  2ZGP A;  1SFP A;  4KQ7 A;  5JSO A;  2YBS A;  3SHR A;  5FZ4 A;  1TNF A;  1HQN A;  3ZFG A;  2BGO A;  3BPZ A;  5A3P A;  4FXG B;  4MGI E;  1NCR A;  1FOD 2;  2XJR A;  5EIY B;  5LY1 A;  3RZM A;  4LBQ D;  3RYK A;  3K46 A;  3WNL A;  3I2I A;  3CNA A;  5FQ0 A;  5FPX A;  2P6H A;  1YJL A;  2E63 A;  3ZN6 B;  4AYU A;  5ANN A;  2VCM A;  3BOD A;  2BGP A;  1RGS A;  2QQV A;  2VBD A;  2BQP A;  3L9J T;  3AM2 A;  1FV3 A;  2VOX A;  5AFB A;  2MNG A;  1T6G C;  4CDU C;  1VBA 2;  1YI7 A;  1H6X A;  3GXU A;  4XW3 A;  4DXT A;  3QBQ A;  1JZ7 A;  1QJF A;  4CRQ A;  5EFU A;  1OQ1 A;  4OQ8 A;  2V4A A;  5JR7 B;  1UPS A;  4AVS A;  5FPZ A;  2XLA A;  1UOG A;  2IFW A;  2MEV 2;  4JTO A;  3AXE A;  4CCN A;  2PLV 2;  5LAT A;  3C8X A;  3DKW A;  1S55 A;  5FFO C;  3ILR A;  1DQ6 A;  2W0X A;  2VCB A;  2MHF A;  1STM A;  5JMO A;  1OD3 A;  2ATF A;  2QJV A;  3IDE A;  4YG6 A;  1RUC 3;  2XQX A;  1MQT C;  2QQO A;  1UIK A;  2R6Q A;  4LA2 A;  5FPB A;  3IDB B;  5FXZ A;  1GWM A;  4YW5 A;  3KQR A;  2QCS B;  5CFC B;  4AF9 A;  3VHP A;  5ERL A;  3ZR6 A;  2IUW A;  2WA3 A;  4RR3 A;  5BNP B;  2XKP A;  5JZG C;  1UZZ A;  2VPV A;  3PVE A;  5TSW A;  4QM9 A;  1RUJ 1;  2G9F A;  1PX4 A;  1ZZ9 A;  4YVS A;  1PGL 2;  1CAU A;  2HWD 1;  1SPP A;  4XE9 A;  4MGS A;  3ZXK A;  5A7W A;  1HV0 A;  1RIN A;  5C3P A;  1RUD 2;  4LKE A;  3RQ0 A;  1OH3 A;  1AYN 1;  1QHD A;  2R1D A;  4IES A;  1WA4 A;  5JIA A;  3MYX A;  3POI A;  1DHK B;  2HYK A;  3LOI A;  3MUY 1;  3VBS B;  4GB3 2;  3VD7 A;  2RG4 A;  5C8C B;  1R09 2;  2OKX A;  4D3W A;  1JYW A;  3AVR A;  3T09 A;  1V6K A;  1TQ5 A;  4MXW B;  3K77 A;  4KU8 A;  1K5M A;  2AAC A;  5A1L A;  2OUJ A;  4W4Z A;  4WVV A;  1LGN A;  2ADD A;  3M3I A;  4WM7 A;  3WQ0 A;  4P14 A;  4TN7 A;  4W65 A;  4XJA A;  3O1R A;  5KHJ A;  1OUR A;  4QDQ A;  5A7P A;  4D7S A;  2ZGS A;  1FMD 1;  1G8W A;  3OJB A;  1FOD 1;  3ZMN A;  3IT8 A;  1PVC 3;  4UFM A;  1S2B A;  4ARX A;  3KHC A;  2X53 S;  4TSV A;  1PO1 2;  5IVF A;  4MLO A;  1HRV 2;  5T50 A;  1E5I A;  2VUC A;  5FZA A;  3FUO A;  2WFF 3;  3B02 A;  5HXV A;  5A6Q A;  1S0G A;  1X36 A;  4FFH A;  2IC1 A;  3VZO A;  1MZ6 A;  1NKG A;  3WDX A;  3OCP A;  2D6K A;  2VW1 A;  1C1F A;  2ZHL A;  3O1U A;  5GZD A;  2GC0 A;  3K4D A;  4LMF A;  3WG4 A;  1JMU B;  1O91 A;  1OVS A;  4COW A;  1RC6 A;  2ZCW A;  3KGL A;  1BK0 A;  4XPV A;  5KHG A;  1OA4 A;  3D5O A;  1CAV B;  1CZT A;  5IVY A;  1PIV 2;  4S2G A;  2Q8O A;  2B9U A;  3CO2 A;  4N7U A;  3VL8 A;  2XJU A;  3SH3 A;  2PLV 1;  1JOP A;  4HOO A;  1RHI 1;  4MH0 E;  3M1H A;  2FD8 A;  3FBM A;  2QQK A;  4PBP A;  4E2S A;  5CA6 A;  2DVB A;  3IZO A;  5FZ6 A;  1UZV A;  2VW2 A;  2RMU 1;  3ATG A;  3LZZ A;  2GC2 A;  2JE8 A;  4PI2 A;  4Q29 A;  4F7Z A;  4X8N A;  5B2G B;  1K12 A;  1OA3 A;  2EXI A;  2QE3 A;  5IK8 A;  3A23 A;  3POB A;  4CZS A;  5CAZ A;  1NA1 A;  2E51 A;  2ZAC A;  2VOK A;  5A32 A;  1AR7 3;  3WY6 A;  2ARB A;  2ZMK A;  3MLL A;  1NAE A;  5F2W A;  3U10 A;  2ZGQ A;  3U11 A;  4A45 A;  3IPV B;  4ZXK A;  2GNT A;  3V56 A;  5K9Y A;  4H14 A;  4RQP C;  5ABJ B;  1GQH A;  4D94 A;  1V9U 2;  1O3Q A;  3DGT A;  1UW8 A;  5BXX A;  5J7M A;  1W0O A;  5GZE A;  2R06 3;  4CEW C;  3THD A;  4HZF A;  2WNO A;  1RUI 2;  4HET A;  4CDW C;  1WMX A;  1XYO A;  1F15 A;  3D6E A;  2GU9 A;  3VV1 A;  1DBN A;  4NIH A;  1WKY A;  2OZJ A;  1AUY A;  4NOT A;  3ES1 A;  1R09 1;  5JXH A;  1HB3 A;  4MVT A;  2IXJ A;  2WYS A;  4GWM A;  2ZEX A;  3HNB M;  4R8H A;  2YXS A;  1HB1 A;  3KWV A;  3LDK A;  3B5L B;  5BNN C;  1XNB A;  1REE A;  4CDU A;  4Q4X 2;  4AL9 A;  4A7K A;  2X29 A;  3C7G A;  3N9N A;  3WDY A;  4ES8 A;  2WNU B;  1HN1 A;  1QY4 A;  4HFS A;  1H4G A;  5B4N A;  5CKN A;  5CFC C;  5C3Q A;  2CGP A;  3URF A;  1ENQ A;  4PJY A;  1FPN 3;  2ORZ A;  1HRV 1;  5H9P A;  3J8F 3;  3WQ7 A;  2JDZ A;  2R0F A;  3VUO A;  1RUN A;  3N7M A;  4IGO A;  5FYS A;  4OZO A;  4D7T A;  5EQU A;  5BYN A;  5KBF A;  1LRH A;  5IUQ A;  1S0C A;  1RYY A;  2C4X A;  3BU7 A;  3PUQ A;  4LE4 A;  5F6L B;  5FBJ A;  4K8F A;  4DY3 A;  4CXY A;  1MQT A;  1PZ8 A;  1ND3 B;  4QB2 A;  2KXL A;  2RR1 2;  3MW4 A;  3WW4 A;  2B7Y A;  5FP4 A;  1ALY A;  2ENR A;  2YFZ A;  3P3P A;  3Q8E A;  1Z0H A;  4XUN A;  2LAL A;  5FY1 A;  5JZG A;  1PIV 1;  1ENX A;  2VZQ A;  3H1M A;  3EXU A;  3MV1 1;  4I09 A;  1LOG A;  3AP9 A;  1ASJ 2;  4MOA A;  4FQZ A;  4GA9 A;  4B4R A;  3KLS A;  4HVR A;  2C5D A;  4BIF A;  3N35 A;  3ROU A;  2VMC A;  3DYP A;  4H2A A;  3D8C A;  3J7N A;  3NQH A;  4IE6 A;  3ACF A;  5CVR A;  1AHS A;  3LPF A;  1PX3 A;  2DVG A;  3AYA A;  4D8M A;  5LK5 A;  1WCK A;  2RS5 1;  2YBP A;  3JBG 1;  3GAL A;  2C6S A;  2DVD A;  1N3Q A;  4R52 A;  3JZV A;  4XAB A;  4XUQ A;  3AKT A;  3SC7 X;  4KNC A;  2W5F A;  2ZEY A;  3AL6 A;  3ZXA C;  4EYU A;  1GUI A;  1OLR A;  4SLI A;  4UBG A;  2WZE A;  3UES A;  4BQ2 A;  1G9B A;  1H9W A;  5A7O A;  2CAV A;  3S57 A;  1SDD B;  4CP1 A;  4TTG A;  3KGZ A;  4EZ4 A;  1HB2 A;  3CJI B;  5FYT A;  3ACL A;  4IEX A;  4K3U A;  1SBF A;  1XNT A;  4QKN A;  1HRI 3;  1TNR A;  4KH9 A;  4C8D A;  5JXJ A;  3I97 A;  4M0N A;  3VHN A;  1RUI 1;  2JDM A;  2VVD A;  4GQ7 A;  1NY7 2;  1W6M B;  4DXZ A;  5FZI A;  1S0J A;  2WII B;  2VMD A;  1JW6 A;  1XPW A;  3QOP A;  5FXW A;  4BHP A;  1U0A A;  2HLE A;  4DEV A;  4XBN A;  4HSL A;  4IUG A;  2AEY A;  3POS A;  5L7O B;  1S0E A;  4DQA A;  5I0S A;  2X8K A;  5FWJ A;  1DQ2 A;  2RJK A;  5FY4 A;  2GAU A;  1L7R A;  2HYX A;  2HWC 3;  3T2P A;  2A71 A;  1OC1 A;  2OS2 A;  1YXW A;  2XWB B;  1E57 A;  4QXB A;  1RUG 1;  3T1M A;  5GLT A; 
#chains in the Genus database with same CATH homology
 3DCQ A;  1W8H A;  2CHH A;  2JDH A;  2JDP A;  2JDK A;  5A70 A;  5A6X A;  1OVS A;  2BOJ A;  1OUX A;  2BOI A;  4CE8 A;  5HCH A;  2JDM A;  5A3O A;  1UQX A;  4UT5 A;  4AOC A;  3ZDV A;  2VUD A;  1GZT A;  1OUR A;  2JDN A;  2VNV A;  1W8F A;  1OXC A;  5D2A A;  2BV4 A;  2BP6 A;  1UZV A;  2JDU A;  2XR4 A;  2VUC A;  2WR9 A;  1OVP A;  1OUS A;  5A6Q A;  2JDY A;  2WRA A;  5A6Z A;  5A6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...