2BOIA

1.1a structure of chromobacterium violaceum lectin cv2l in complex with alpha-methyl-fucoside
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
AQQGVFTLPARINFGVTVLVNSAATQHVEIFVDNEPRAAFSGVGTGDNNLGTKVINSGSGNVRVQITANGRQSDLVSSQLVLANKLNLAVVGSEDGTDMDYNDSIVILNWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual Entropy Driven Affinity of Chromobacter Violaceum Lectin Cv-Iil Towards Fucose and Mannose
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Lectin
molecule keywords CV-IIL LECTIN
total genus 24
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2boiA00
2VUDA 1W8FA 1OVPA 2VNVA 1OUSA 5A6XA 1W8HA 1OXCA 2JDYA 3DCQA 5A6ZA 5A6QA 5A70A 2JDMA 1OVSA 2BOJA 2JDHA 2JDPA 1OUXA 1UQXA 2JDNA 2JDKA 2VUCA 2BV4A 1GZTA 4AOCA 5D2AA 1OURA 2JDUA 4UT5A 2WRAA 2CHHA 2BOIA 5A6YA 5HCHA 2WR9A 3ZDVA 4CE8A 1UZVA 2BP6A 2XR4A 5A3OA
chains in the Genus database with same CATH superfamily
4CDUA 4A3ZA 1RVF1 3P6BA 4G9SB 4FO9A 4MGIE 2PAMA 2VMEA 4URTA 4CU6A 2VMHA 2YBSA 3ZSEA 2ZGKA 3TN91 4FPFA 2E32A 4AHWA 1E5HA 5T54A 3ZYBA 5I8TA 5JOYA 2PLV2 3O1MA 1NT0A 4JCKA 1AHSA 5A7SA 2IZWA 4XFCA 2WO2A 4YW5A 4YW3A 2Q1MA 3AKQA 3FLTA 1S2EA 3B5LB 2VMDA 3KM5A 2D6NA 2DVDA 2ID4A 2JG8C 1N1YA 2OUJA 4QX5A 1J84A 2MEV2 3WDYA 3IB3A 2XBO3 4OHXA 1ZRIA 3POFA 3THCA 1AR83 2RS12 4NIDA 3FLPA 1OA3A 2ZBJA 3USSA 1MACA 3OB8A 5AFEA 4NIIA 2WO7A 3I3EA 5FR3A 4Q4V1 1CVNA 5IVFA 2IFWA 1JMUB 4EN8B 2VJXA 3NJVA 4ES8A 5LWBA 4W6YA 3KZ4C 1V6KA 3MV01 1NCQB 4XCBA 1PK6C 1C3HA 2VVEA 4QX3A 5D8AA 5A1LA 4AFCA 1O4YA 1JZ6A 4IE6A 1ULCA 1KD7A 2JG9A 4Q5OA 3AMNA 3BUCA 1BHGA 3ZXJA 2MEV3 3Q8FA 1XYPA 3VV1A 5F37A 2QQUA 4XFFA 3PUQA 2PFWA 3MI8A 4KL1A 1U5YA 1W6MB 1FV3A 2XJTA 3FZ3A 4UW4A 4AYUA 2QQOA 5JXHA 4DXRA 4A2UA 1VE0A 4WM7A 4BQ3A 3MUZ1 1HXS2 1QJX2 4LKDA 5E88A 2VMGA 3ZSMA 1K5MB 4EN0A 4AEMA 2D44A 2W5FA 2C6SA 3DYOA 3I2OA 2XR4A 1K5JA 1SBEA 3OY8B 5A3OA 3WCSA 5AFBA 5EYYA 4XURA 4Y1VA 5LA2A 4CDWB 1GZWB 5AVPA 3DUIA 1J59A 4JZRA 3ILNA 5KXBA 4GKYA 1V9U3 2UY8A 4QPGA 4EV0A 1GZ9A 1RJ8A 2JDHA 2Y33A 1HQWA 5IK8A 1U12A 1A6CA 2R0HA 4V1PA 5FZ0A 3WNKA 5FKBA 3WP6A 4AI2A 3M3EA 3MF9A 4WVVA 1GZWA 5CFDB 2E53A 2PELA 4FTEA 1LHUA 1MEC3 1PHMA 2F4LA 3PTYA 3I2GA 1LNSA 2CY6A 1ZA4A 3VKNA 4Z82A 2WQ4A 5CNAA 4PF5A 3SCFA 4YG3A 3W5NA 5ISLA 2ZGOA 1VBE2 1YIPA 2HYKA 5C4WB 2GSYA 2HBTA 2ZGMA 4FXGB 2AR6A 4K9SA 5IUQA 1TNRA 2D43A 3QH6A 3PUHA 1W2NA 1W04A 1ULPA 4AI8A 2D7FA 3AL6A 5J98B 1AYN1 1FT9A 1ASJ2 1LODA 1UPIA 4NO4A 3I2IA 2DCTA 1PIV2 3PMEA 1O4TA 3UESA 3WNLA 2R042 4NWVA 3VBFB 1JZ5A 4M0NA 1BK1A 1KEXA 2VH9A 3LE0A 3WD5A 1AX1A 4GMP1 3THPA 1SFYA 3ME2A 3L2YA 3KHBA 4XCAA 5AVAA 3ZFGB 1ZRCA 3VZMA 1QDCA 2ATFA 2RM23 2C9AA 2AUYA 1ONAA 1DP0A 1QY4A 1X8MA 5GLUA 5J09A 2G9ZA 4LBQD 2JENA 1MS0A 5FJHA 3D8CA 1OLQA 4BQ5A 3GYDA 2SBAA 1W8HA 2BNNA 2WZEA 3PVNA 1DZQA 4RL7A 5FPXA 4XBNA 1U5IA 5FZ1A 3J9SA 4JRLA 1OC1A 5A70A 3ROUA 2ARAA 1NXMA 3MEPA 2D93A 2VNOA 5ABJA 5KBFA 5JXJA 1IQAA 1DQ5A 2XB6C 2P3KA 2MHFA 2WT2A 1KRIA 1WMXA 2JKXA 4JHZA 1HW5A 1VRH2 1UYXA 4OLLA 5FQ0A 2KR2A 5AC91 1RMU2 4O9GA 2G9FA 4R9CA 1RYYA 3I2FA 2FDFA 4LBQB 3GF6A 3ZDVA 4K1YA 1K42A 4OUSA 4XJ9A 1L7QA 1CN1A 2E7QA 4AAPA 1BEV2 1OOPB 1UYZA 4Q4Y1 4ASMB 5A3MA 1FX5A 2IVIB 3RZGA 4IEXA 3ZIWA 4DXSA 4YM2A 5FYMA 2ZGRA 4ISRA 2XJQA 3WINE 3S5AA 4ZXKA 1SPPA 3M3CA 3GM8A 3FHAA 1XB9A 4JV4A 3A4UA 2VZ1A 3Q8EA 1NCQC 3UKNA 2NM1A 1OOPA 2AC1A 3NQHA 3PJYA 5TSWA 4OUMA 2PLV3 1UY3A 4BE3A 3KT7A 4GA9A 2PLV1 4Z1VA 5FBZA 2OQ6A 3RZZA 1H8TA 1VAKA 3LOBA 3AX4A 5M0TA 3VZJA 1PO22 1SCSA 1EV13 1ZM1A 3R4UA 4I01A 1JYIA 3ZKYA 1ND2A 1V00A 3DF0A 2Y60A 3RJ2X 2EIDA 2VULA 2W1WA 3MIEA 3NMBA 2XH6A 2X10A 4KWUA 5C6CA 5CAZA 1EAH1 5CEHA 2RS13 3RZLA 4JAAA 3U14A 2IXLA 2VNRA 3AYDA 2UU8A 4E2QA 4AXOA 5CFDC 4I2OA 2RS33 5KXDA 3EB7A 4COYA 1AR73 2A70A 1C5HA 1AR71 3HN3A 3S30A 2QJVA 2HJIA 4XIOA 4CCKA 5BUVA 1XE0A 5J37A 4UFKA 4B1MA 3LEMA 3LA2A 1ENQA 1ALYA 4L8QA 4AVSA 1WCSA 5JOXA 5L36A 1PGL2 4BLIA 2AYHA 2PA7A 1CONA 1S0DA 1FMD1 3OYWB 3AP4A 1GU3A 5C71A 3W9AA 1QEXA 5JPMB 4XJAA 1D7PM 3POGA 3U10A 3BN6A 2UWBA 5HPOA 5J1XA 2WYFA 2IWGB 3CL1A 1AZDA 3MDPA 3NKGA 1UW8A 1V70A 4WBBA 2WZPP 2D3RA 4LKFA 3LEKA 2UYAA 4EJRA 1JOBA 2W1UA 4FQZA 3FJSA 1COV3 1JZ3A 2YHJA 3UJOA 1UWWA 2VZVA 4YARA 1KJLA 1LGBA 4CCDA 5JWPA 5FYUA 4AQ6A 1WW4A 1H4HA 5BNNC 5FWJA 1XSRA 3RYPA 1S0FA 5FP8A 1IPJA 2Z69A 2HWD2 4COUA 2GU9A 5JI9A 3HN1A 2DTWA 1NUKA 1OLMA 1C8NA 5FZ7A 2XUEA 1LOCA 1GP4A 4D7SA 4LHNA 5I0UA 1RMU1 3ENRA 1LTEA 1NZIA 2ZHLA 4OULA 2Y6HA 3EQEA 4HPKA 2QQVA 3N35A 3OBTA 3WLUA 4CUGA 5KR7A 4HL0A 1UU4A 2WS91 2AENA 1HN0A 4KBZA 1PMIA 3RGBA 5D21A 3HD8B 3RZKA 2XJUA 2Y0IA 4FP3A 3V64A 2ZKLA 3HQXA 2VAUA 1Y7BA 1HRV1 4Q4Y3 1CPNA 1O3QA 1LOFC 1PVC1 1XNCA 2MEV1 2WN2A 5JCTA 1AR93 4CE8A 2B9UA 4OFGA 1AR91 3DXUA 2ET1A 2QQKA 4GULA 3TRSB 4Q0UA 1N1VA 1WCUA 5DAQA 5DN2A 1OVPA 3RG0A 2XKPA 3AXDA 4Q0VA 4QHBA 4JDOA 3VKOA 4LA2A 1AXYA 1RMU3 4ZS2A 3D0SA 5DAPA 4JC1A 4BQ1A 3T4VA 3O7OA 2R30A 4JRAA 4QPIC 3VZNA 3DL3A 2WBKA 3ZDSA 2CYFA 4XUTA 5BNQA 4HT1T 1UOFA 2P6HA 1VBC3 4N53B 2WS93 1BEV3 3FUQA 3OPTA 3TN92 4LA3A 5C33A 1KS4A 4IETA 2JXAA 1DQ1A 5IK5A 1ZX5A 4YVWC 3K75B 1TME1 2GP3A 2VECA 1RGSA 3ACGA 1B35C 3LD8A 4DXZA 4DUVA 4E4DX 5FXVA 4JX0A 2XBO2 2I45A 2ZEXA 3CHXA 3ZMNA 1RUH2 3OGVA 1YQ6A 2A3YA 2ZOEB 2EICA 3ZN6A 2ZGSA 1SZBA 4L0PA 4D8MA 2OIIA 4Q8LA 2Q0AA 2AH2A 2KA3A 4BLJA 2DVBA 3JCIA 4QPGC 3ZN4A 1HRI1 3T2TA 4M3CE 2V73A 4UOJA 4N43B 3ZSKA 3V0BA 3ACIA 4QGLA 2R7EB 2W95A 2GNDA 4LLOA 1CZSA 2ZHNA 1Y9MA 3M2MA 5IAVA 1FMD3 2VW2A 3VL8A 4UYBA 4CU8A 1JU4A 1AYN3 2W94A 2ZTNA 1ZZ7A 3U75A 1NG0A 1UMIA 4QKFA 3VBSA 3ZFFB 3E6CC 1F31A 2XJVA 4BZ4A 3WCRA 5I0SA 5BY5A 1RUNA 2WINB 3TB0A 1UU5A 2K46A 2XUMA 3HEIA 2J42A 3PUAA 2HWD1 4XDPA 4BOWA 2W91A 1EAH3 5F5IA 1O3SA 3ZFGA 4HBNA 2VCAA 3LFIA 1O91A 1R64A 4GJZA 4NRMA 1YQCA 4IV1C 1ZBE3 5A3UA 4TSVA 1W6NA 5T50A 1H9PA 2B4KA 1NE6A 5HCAA 4Q4X2 5DAWA 4FPOB 2XKOA 1GUIA 2GNMA 3GBGA 1GOGA 4LXLA 4ZU5A 2W39A 3B3QE 2ET7A 2RS32 3KLSA 2W46A 1KS5A 4LO5B 5CZKA 1T2XA 1Q8VA 2A5ZA 2DTYA 2J1UA 2ZAHA 4DEVA 3H50A 1WD3A 5FPZA 3WF4A 5JR2A 2BQPA 4E8DA 1UY4A 4FFIA 3CJIC 4LPLA 1HXS1 1QJX1 1TVGA 1AR81 3KGZA 1R092 1H1AA 1L7LA 4RFRB 4XFHA 1PGW1 5FP3A 4L9BA 2CWSA 4WVMB 2RS51 3ZYPA 5DUUA 4LBQA 3A0KA 5EHDA 2WC2A 5LRRA 4LIVA 2WNUA 3H3UA 1O5LA 5GKAC 5C9AA 2R041 4K21A 4FTBA 4XF9A 5I0DA 5DG2A 1H2NA 4LIUA 2Q8CA 5F3IA 2D3SA 5FZOB 2E6VA 3BTZA 4QKBA 2VBBA 4BK4A 2KXLA 5E8AA 3H1WA 4DOUA 4XFIA 3E5XA 4QKNA 1DQ6A 3VBOB 2LROA 2BVVA 1LJ7A 4G4FA 3ZFEC 2EAKA 2YFZA 5FJKA 1W8WA 4ATFA 3OTFA 3CJIB 5FZ6A 4CEYB 1WKYA 4DIQA 5JZGB 1ODNA 1W05A 3AKPA 1AR63 4QKDA 4C8DA 2LALA 5I8SA 2MPFA 4JQRA 3J7NA 4LBMA 2VM9A 2ZX4A 3RQ0A 4PLNA 3VBRA 3LCPA 4BA6A 4CDQB 5EJ3A 4XE9A 4DB5A 3MPPG 1LKNA 2ZMLA 5FV3A 3IIIA 2GH2A 2BV4A 4BMEA 3PMSA 3URFA 1B35A 1C1LA 1G8WA 1N3PA 1RUE3 1VAMA 3HMYA 3IIAA 4MOAA 4NWWA 3LA3A 3BIWE 1AYM3 3OEBA 4GIQA 3NO8A 4LOSA 5FDBA 2OPKA 3RYKA 2YZ4A 5GZDA 5LRSA 4GB33 1O7FA 1HQLA 1APNA 3HOBA 1TME2 3HNYM 4WM8B 5EJ1B 1W2AX 1UMHA 5FOBB 4Y24A 3E1F1 2UWAA 1Q8OA 1GOHA 4N9IA 1CD3G 1WGPA 5GALA 1M06G 4BPZA 2OX0A 1QOTA 3N4MA 2BZDA 1ND3A 4A41A 4P9GA 5A7NA 1BJQA 2I74A 3OGRA 1SACA 2OUHA 2BGOA 2WFF3 1W9FA 5IVCA 3ZYHA 3IM0A 4IEZA 3RZMA 3ABZA 3AVSA 1PZ9A 2RJKA 4XUQA 5I91A 3I49A 5DDJ1 3EMRA 4XFAA 4UWDA 3FWEA 1OOPC 1YFXA 5F8PA 4JKKA 3KD4A 1IS5A 1HB2A 5C3OA 1WZXA 4NROA 1MZEA 4IGOA 3D3AA 3SEEA 4BU2A 3HT2A 2V4VA 4P5YA 4LE4A 4Z92B 4X8NA 2MNGA 4J1WA 2RMU1 3VBFC 5K0UB 1C8M2 2PYTA 5FTTC 1RUC3 3K3NA 2XWBB 4MGYE 1GICA 4KI5M 4MXWA 4AVTA 2VQAA 2NMNA 5A1AA 2K2SA 3LFMA 5BYNA 1AR72 2XL7A 3O1PA 4OMDA 1JW6A 1RIRA 1DZTA 2WT1A 4YM1A 4BQ2A 2HEVF 5LEJA 1H8VA 2VZUA 1WW5A 2VG9A 3JXSA 3VBOA 2WUHA 5FYVA 3WZ1A 2HWB3 3ALQA 3JBG2 2R0FA 3I2KA 4CZSA 4I02A 2A6WA 5F7UA 2VTFA 4IERA 4R52A 1W03A 1VMJA 3C8XA 2J1VA 5JR7B 4AQTA 4HZFA 1QQP2 3OUHA 5GZEA 2DBIA 1AYM1 5F2SA 1OMIA 4GZ9A 3IMNA 2WWJA 2ZEWA 1J3RA 4D3WA 1JTZX 4OYUA 3HPNA 2VQUA 3AC0A 2EXIA 4UI9L 4LLFA 2GALA 5FXXA 1OH3A 4YGBA 3QH7A 1EAH2 3AZVA 5EV7A 4BQYA 2L9LA 4MYEA 5FYIA 3JD73 1B35B 1AVBA 2VMIA 4LBNA 4HVRA 2D6MA 3Q8BA 3I2JA 4M00A 3ZLIA 2E33A 3WDXA 3FUOA 1V0AA 5FZDA 5FPBA 4E4ZA 4KGQA 4XBQA 3M8LA 1N3QA 2RDSA 4GJYA 5J36A 3NNMA 2ZPXA 4PIYA 3J8F2 3O0VA 4XAAA 4FPKA 1REFA 5FRAA 5LBEA 4AG4A 1SEFA 5F6LB 1MEC2 4GH4C 2BDRA 3H42B 4KGGA 2CDOA 3T09A 2LM3A 3OGSA 1LRHA 4QGNA 2VGDA 1JYXA 2XQRA 3NAPB 1H0BA 2R6QA 2ZGQA 4CYDA 1HV1A 2JE9A 1K5MC 1ENXA 1LB2A 1UX7A 3WUCA 3OPWA 3AFKA 4KQ7A 3ZYRA 1WD4A 4CP9A 5A6QA 1G9FA 1SLCA 1US3A 5IVJA 5I0RA 2NYYA 1VB2A 1X8EA 4CSWA 1V6MA 3N9OA 1CR7A 1GQPA 4ET7A 1MVEA 4HMZA 4NHLA 3T3YA 4FPYA 2ZS6B 2GMEA 2OYZA 1CAUB 1NA1B 1XU1A 4P00B 4QQPA 3WF1A 1YHFA 2A6VA 5A3WA 4Q27A 1AR62 1YRZA 1SBFA 2R49A 1XYOA 4A7KA 4CCOA 1SPPB 3LDRA 4CCMA 2NZ9A 3MW4A 2YPDA 1PVC2 1PZ7A 5JI7A 1KITA 1W6QA 2DUOA 2ZKNA 3UV9A 4HONA 3VBRB 1GQGA 3BVCA 1AR92 3DEMA 3VBSB 1JHJA 3CZJA 1ZREA 3I3DA 3GZUC 2HWD3 1AF9A 4K8RB 4YW7A 4OHWA 3I7DA 3INAA 2Y6GA 4XEZA 5FMOS 4XVHA 2QTWB 1N1SA 1ZRDA 1RUJ3 5IVVA 1QNYA 3E5QA 4GKXA 4AEJA 3IKWA 4P9XA 1NQDA 1COV1 1PIV3 1HRV3 3ELNA 2BYVE 4HANA 3SEPA 5C3SA 2FD8A 3BPZA 2IXIA 3IAPA 1O8SA 2GN3A 5FZAA 3O5SA 4OMCA 3B02A 4WM8A 1RHI2 1HDKA 5CFCC 1EY2A 1BXHA 3ETPA 5H9PA 5DQ0A 4D6SA 5B4NA 1OH4A 5EFUA 1FPN3 5DDJ2 3OOXA 3K4DA 1RUH1 1UAIA 2ZX0A 4QPIB 1G9DA 2VL4A 1NCRB 2Q8EA 4GWIA 4QM8A 3N7KA 4EZHA 3GJBA 5GZGA 5JSOA 2WL1A 4NPRA 1VBB1 2FMDA 4PQQA 4LBOA 4OCTA 4QX2A 2JDNA 1QJY3 1F9KA 2CTVA 2FDKA 1J1LA 5K0UC 3NKTA 4NPLA 3FX3A 4DRVA 4H7MA 1LEMA 4N90A 4W6WA 3VD5A 4UW5A 4PBOA 1BZWA 1GANA 3MHZA 1R1A2 1RTVA 4IV1B 3VDBA 3IMMA 1G6NA 3P1IA 1RUF2 2VOXA 5FZ3A 3WG2A 3POSA 3DKQA 3WSOA 5KXCA 5LK5A 4JKLA 4M3CB 1U5XA 3PVEA 1OA2A 1PO23 1QJY2 3ZYGA 3BTYA 2Z5WA 3T4HB 1RITA 3NJYA 4N9HA 1JS9A 2VR4A 3MV11 1GNYA 5T5LA 4CXXA 4A4AA 3MW3A 2XOMA 2RS52 3WNMA 2LUWA 5IW0A 4MO3M 3H3LA 1MQTB 1QQP3 3WT3A 3GBFA 3DGTA 1NA1A 5FY9A 4W8JA 4M3CA 3SMHA 1QJU2 2WNUC 2WQ8A 4QXKA 4HPKB 1ZZ9A 4KNCA 1TG7A 1XNTA 2DVGA 1LECA 3M4FA 2OKXA 5B4XA 1W6QB 3I4IA 2GNBA 2VQTA 4JDMA 4GALA 3BALA 3AP6A 4TN7A 1C1FA 1QHDA 1RUJ1 1S0EA 2ZGNA 4MGSA 3UKVA 4AF9A 3ZYIB 2YY1A 3KV4A 1WCKA 2OQ7A 1R081 2X5IA 3AP7A 4IDZA 1J3QA 4LEJA 3WF3A 5K9YA 1PNFA 1QOSA 4FPHA 2EIBA 3ILRA 1QH7A 1V9U2 4YZ2A 1F5JA 3CEWA 3LA7A 1FNZA 1FV2A 3WOGA 1S2KA 3H8UA 2WSUA 3T2PA 5FYTA 3ZYFA 4HOOA 4LHLA 1OKOA 2E7TA 1PZ8A 4XXAA 2JICA 4XJ8A 2X5IB 3VBRC 3NV2A 5C70A 1W2OA 1SFNA 1W6MA 1HV0A 4WV8A 1JZ8A 1UY0A 3HIFA 4WM7B 4F8AA 1GZCA 5FY4A 4Q0QA 1FI2A 1UN1A 3MLJA 3VBUC 4CUAA 4CP9B 1SLIA 1GNZA 4N43C 3V0AA 2JJ6A 5ABJC 4S2GA 4Q1PA 4IGPA 4K1ZA 4QM9A 1CX4A 2JG9C 3FLRA 4NE9A 1S2BA 4W6XA 5J7MA 4CP2A 3O1SA 1LOEA 5L7OB 2VZPA 4XMIA 3WXPA 4QQHA 2YC4A 2H6CA 2D98A 4L11A 3UYJA 2ZJCA 3KHCA 4XFBA 3VBSC 5DUXA 2CGPA 2OVUA 2XQXA 1L3JA 1YJLA 4QPGB 4BQWA 4N43A 3KT1A 4PDWA 2AGSA 1OQDA 1KQRA 1X50A 1YI9A 2Z4FA 5DG1A 2OW4A 3ZXAC 2VC9A 4HSLA 4Y20B 2BFUL 1H2KA 3P3NA 4IE5A 2WLQA 4H2AA 5FWEA 2WR9A 4XF4A 1JOJA 3FHQA 4XW3A 2QQWA 5KHIA 1WLCA 4DZGA 1Q56A 4D94A 1EYBA 5F5CA 3LDKA 1JH5A 4DY5A 1HN1A 1M4WA 1OUSA 2OZ6A 4JGYB 3ZR6A 3TBDA 4AVBA 3ZPYA 1Q5OA 2E63A 4NIGA 4IE4A 2ERFA 2WNVA 3AK0A 2BWCA 1RUI2 2G4IA 2ZABA 1YWKA 4YVWA 3ZXKA 2Z2SB 2D6KA 4MXVA 4YRDA 4DQAA 5A1FA 3AP5A 5EQUA 2FDHA 2YU1A 2X5IC 3I3QA 4LBJA 5FY5A 4B3NA 1VP6A 1ASJ3 4I0AA 4C0HA 3RPQA 4N53C 4QPIA 1S0CA 4Y26A 1XPWA 3WX5A 5A80A 2AACA 4XHBA 5A3TA 1I9RA 4P9YA 1RUC1 2D6PA 4QU2A 3F95A 4XETA 5CKNA 4IQPA 3HWJA 1OFNA 3WP5A 2XBO1 1B09A 2EVXA 2PMWB 2W1SA 3PDQA 4OVEA 3CF6E 3WUDA 1XXNA 2X29A 4MSVA 5T5JA 1NLRA 3QLQA 1O8PA 3LKJA 1QDOA 3MYXA 4JVAA 5FMOL 1HRI2 3S5QA 4A44A 4RGGA 1BMV1 2A7AA 4Z8BA 4ZU4A 4R8HA 4C90A 3MFAA 3POBA 4GMP3 3HBKA 4LO4B 2RJLA 4JHTA 4Q4V2 3ZN6B 4LK6A 4MVTA 3KV9A 3IDCB 1N47A 1NQJA 2WNUB 5FPVA 3JQXA 1W6PB 2B39A 4YM3A 4PQ9A 2WAAA 3CO2A 1D4M3 2RV9A 3WP4A 3KQRA 3VZOA 3KVAA 3J4UH 2DUPA 2VO5A 1H4GA 1WW7A 1XRUA 2XVKA 3O1OA 3VHRA 5ACA1 2FBEA 2D5FA 4YW1A 2BOJA 2JIJA 5LBCA 3AYEA 1XQNA 3K77A 4XFGA 2ZACA 5HV0A 3NWKA 1ULEA 3QBQA 3U1XA 2UWCA 4PHZA 1UYYA 3WVJA 5F6KA 1C8M3 1EUUA 2B8MA 1VALA 2WFF1 4P9JA 1UCXA 5DPNA 4CEWA 1GP5A 1FOD2 1RUG2 2YBPA 1IPSA 3FE5A 1LOGA 3B9CA 5KHGA 4JGYA 2OZJA 5HXMA 2YGMA 4QHZA 4JTOA 3LAGA 1HJGA 2LTNA 4R4ZA 3ZR5A 4DMIA 2BUKA 1YFUA 4XDQA 1SLBA 5FPAA 4AI3A 2W3JA 1BBT1 2QFEA 1JZ4A 1T6GC 1POV3 1VBD3 4OQ9A 4CDWA 5DZGA 3R0RA 4UW3A 5FZEA 4HXCA 2H6BA 2JDPA 1QIQA 3OGGA 4PI2A 1LENA 3ZO0B 1SLAA 4FBFA 2YDEA 1JYVA 1AX0A 5SV8A 4JTNA 3O1TA 2ARCA 5F5AA 3IAQA 1VBE1 2PN5A 4YVSC 1VBB3 5C5UA 2QBXA 5IT6A 4XBLA 3A23A 2AEYA 3JD72 2VUDA 3V0BB 2PAKA 1Y43B 1HB4A 2JE8A 5EJZB 5CADA 1AL21 2GDFA 2VOVA 2UY9A 3KVBA 5CU1A 4PIZA 4PIXA 5BNOA 1XNAA 1W28A 1LGCA 2WT0A 5GZFA 2P2KA 5FPLA 1KDMA 3USUB 4W65A 1ULFA 2P3YA 4LJHA 1H9WA 4W4ZA 4XABA 3GZTB 4I3GA 5D2AA 1OURA 2JB8A 4K7JA 4NHKA 4ZPIA 4KWLA 3VKLA 2C4XA 4Q4Y2 5C3PA 1DYOA 2R1BA 4J6GA 3N9LA 1E57A 5CG8A 2R071 4LBLA 2V5DA 4GD4A 2P17A 1CWPA 4Y1XA 3BTXA 1V6JA 2Y0OA 2NP0A 3WY6A 3W58A 1S55A 4KWJA 4YZ5A 3LSDA 4YZ1A 2JWPA 1CZVA 3BOPA 5FYZA 5L7OC 4AK3A 1ZNPA 4LORA 4AW7A 3RYRA 4S2DA 5E1RA 3RI9A 3KB5A 3NV3A 4QQLA 3VZKA 4CA9A 2VZ3A 1WA4A 4CEWB 3ES4A 1PO21 2NMOA 2XG3A 3J26N 2WKKA 5DMYA 2Q4SA 1A34A 4CDXB 2DFBA 4FPCA 3UETA 1VRBA 2JG9B 1R1A1 2PHDA 1X9TA 1O6UA 5HI0A 2YC0A 4OI1A 5I93A 2BNOA 1YJKA 2J7MA 3N9MA 4GB32 1NLSA 2WO3A 4X8PA 5CKQA 4YWAA 5A33A 4RA0A 4SLIA 3VDAA 4GAZA 4P02B 3B93A 4EN9B 2IC1A 4YM0A 2XJRA 2QNKA 1ULDA 2Z79A 3ORJA 4V2WA 1OD5A 3DPRA 2WA4A 2CU5A 4IE0A 1OVSA 1K3IA 1SG3A 3PNAA 1D4VB 4UFJA 1WBFA 2WNEA 2LS6A 1HQNA 2HKXA 5G04L 3H7YA 1OSGA 1W8TA 3IPVB 3PIGA 1DGWX 2QQMA 3CKHA 3E6DA 1J3PA 2N7GA 2C5DA 1SQ4A 4KH9A 4BIOA 1RVF3 3R05A 5FZCA 1DDLA 1DF0A 3FFZA 4GQ7A 5GZCA 3TEXA 3SH3A 1UOBA 1ZYBA 4ZS3A 3LPFA 1W0NA 1RL3A 5FYBA 3FBMA 4XMAA 1UO9A 1ND3C 2BU9A 3ACLA 3AP9A 3ITQA 3MBWA 2QDRA 5JVVA 3SLIA 1H8TC 5DUWA 1GKBA 3C7GA 1QH6A 2WQZC 1VIWB 3N9QA 3NNLA 3C2UA 4Y22B 3WNOA 4JKMA 4Y1YA 1DBNA 5HBAA 3O0WA 1BYHA 1J1TA 1TMF3 3S0MA 4HK8A 5CFCA 1VJ2A 3AZZA 3KWVA 4V2VA 4HVQA 1VBD2 2FCUA 2ILMA 1LGNA 2Z42A 1GMMA 4X6RB 2BW8A 3UGHA 5A6YA 5J96B 4INDA 3OEAA 2VCBA 4IEYA 5GM0A 1QJU1 4XACA 4Y22A 4CXYA 5JIUA 5CBLA 5F2WA 4XF3A 3B94A 5FAXA 2XVLA 3IT8A 1BCXA 3S7EA 4F83A 4AZZA 1G7YA 2PHRA 4CCNA 3ZVXA 3T0AA 4CCLA 4URAA 2DU0A 4AVVA 4D7TA 4HG6B 4LO8A 3JQWA 4NHYA 3HQRA 2WO1A 4Q0PA 4XAEA 5E6HA 5DUVA 4D0QA 5JXIA 5FUPA 3PHMA 3A22A 4YLZA 3VHPA 3RZHA 3PUSA 3TNPB 1X7NA 2VOKA 1VB4A 4EQVA 3N36A 3VBHC 1BEV1 2XXZA 2QDNA 4U2AA 4QXCA 1U5ZA 2B46X 4QX8A 3O1VA 1IHMA 1DIWA 3VN4A 1PK6A 3HJRA 5JPNB 4CDUC 2WN3A 1ACCA 4KWKA 1JZ7A 5J3UA 2JX9A 2FDIA 5FZGA 3VGIA 3RZJA 2D6OX 4G3YC 5IFTA 2E51A 3EO6A 4UW6A 1UY1A 3HQUA 5FY0A 4ISQA 5A7QA 2GAUA 2O0OA 1CAVA 2HEYF 2W68A 5CYYA 3RI8A 2W87A 4A45A 5JAXA 3JB4C 1TEIA 4RQPC 1RUI1 1UMZA 2RMU3 1UPSA 3S57A 3TYJA 3D4KA 2EA7A 1QJZA 1YEWA 3ZPOA 2GNTA 3H8OA 1W06A 3OSDA 1OLME 3VKMA 4NIHA 1F8VA 4XDOA 3N9PA 2VW0A 1DLLA 2XL9A 1UZZA 3O14A 1Q8PA 4MLOA 4A6OA 1H1IA 2WRAA 3PU8A 4XYXA 5BNNB 1CAVB 5FMDA 4ZXEA 3GCXA 3WW4A 2BGCA 4IESA 2D5HA 1WCQA 3Q8AA 5H9SA 2DF7A 4XTPA 1NA1C 1VBA1 4M0HA 1DQ4A 4Y3OA 4BQ4A 1BVVA 3OBZA 1Q3EA 1IKQA 5KHKA 1UOGA 3DCQA 4LHSA 3SITA 4XQDA 3O12A 1SCRA 5IVYA 2YV8A 4E4SA 1PGL1 4GWMA 3VDCA 5LA9A 1DU3D 2LRPA 2EF6A 3WNNA 4N8MA 3K2OA 3MW2A 3GGLA 3ST7A 3HAGA 2BJSA 2IUWA 4JQTA 3VBUA 3CJXA 1BK0A 4Y1UA 3MUY1 3SHRA 3WDWA 2P34A 5JUVA 2DUQA 2WZR3 4NIAA 3L9JT 1IZ3A 1A3KA 3AYCA 4MX3A 4MGKE 4NPMA 4AQSA 2ZEYA 4OUEA 1LOBA 2WFF2 3GZAA 1DGLA 1W90A 1NCRC 3K4AA 3KMHA 1DZRA 1K45A 1OQEA 3W59A 2HWC1 2G19A 2QQIA 1NXD1 2ETEA 3A21A 2CDPA 3AMMA 3OF1A 4N7IA 1I1EA 1XJAA 4WVZA 1VBA3 2WA3A 2Y6LA 3BGAA 4Z2WA 1NZCA 3OYWA 4RHV2 3T0DA 1ZZCA 1GV9A 2XWJB 1ND3B 5EPAA 4B4RA 2YC2A 1QXJA 1EV12 1BKZA 2W1QA 4WVMA 1AR82 4UF0B 4AAXA 5CFDA 5JLVA 1OFSA 1GBGA 2HWB2 1W2TA 3USUA 4AEDA 3I3MA 2XJPA 3C3VA 1GSLA 5FYHA 3T08A 4AE2A 1XNBA 2CSGA 1W9YA 4FPEA 3KGLA 1LHOA 1UZVA 1PMHX 1GFF2 1XOYA 4HN0A 3WNXA 2W9XA 1Y3TA 1V6IA 1VAVA 3IWZA 2JIGA 2ZAAA 2ZZQA 3AFGA 2VCMA 4Q4X1 2F6BA 3WQBA 1QXRA 3AB0A 3VBFA 5C3QA 1W6OA 2HH9A 2R073 5GLZA 1MS8A 2WSVA 2PHXA 3N7LA 1V9U1 1EPWA 4ARXA 4AQ2A 3O1UA 1W3XA 5LBBA 4BH9A 3N3HA 4FTSA 2FMYA 2V09A 4LE3A 1LAJA 4FPGA 4TXWA 1AXKA 5CISA 3ZM8A 5IYYA 3VB9A 2Y6FA 3GXUA 1NCRA 3VD7A 2VE1A 2W2IA 3UK9A 5ANQA 5GLVA 2FHRA 4JGYC 1ZZ8A 2R072 1O59A 4CRQA 4IEWA 1S0GA 3X29B 2IFRA 3WQ1A 5ABJB 1I6XA 4BMBA 5JMCA 1K5MA 3T0BA 5FLHA 1IGOA 5SV5A 1OUXA 2XJSA 3OD0A 4H55A 4DPNA 5BNPB 4Y1ZA 1YLLA 4LQRA 1OPMA 1BBT2 2O1QA 3ZFFC 5DZEA 3ZXEA 4HVOA 2QQNA 1GWMA 4BQXA 3ZN5A 1J58A 1LCLA 2A1XA 4RYDA 5I8YA 3MLKA 4Q1RA 1IG3A 4I09A 4CCEA 2K0GA 4HK9A 1YUDA 3SNMA 1X9PA 4EROA 4PBPA 4IEOA 1P8JA 2F4PA 4C91A 1J83A 3WDTA 2YYOA 2ZMKA 3I2HA 2BRTA 3J8F3 3NL1A 4PT6A 4YVSA 3ZXDA 1YNAA 2BBVA 4R9DA 2DCJA 2TBVA 2XONA 4IV3B 2EIEA 5FZKA 1IPKA 1YXWA 1PO12 2GMPA 3H8RA 4QX1A 4H14A 5KC6A 5JOZA 4EE2A 2RR12 5JZGA 2WWUA 1CAWB 4K6BA 3CJIA 4XJUA 4DRRA 2HWE1 1SDDB 4YZ4A 3JUUA 1LU2A 2QQJA 4MZUA 2JDUA 3ZFEB 3LZZA 4AFMA 1QF3A 4FOWA 1NLQA 1QQP1 1QWRA 5FZIA 2Y6JA 1W8OA 1AJOA 2JEMA 4IL7A 1RUE2 3EXUA 4LTAA 4S2FA 3PTRB 4XHXA 3ZX7A 5A3LA 2Y64A 4YPJA 2ADDA 2CNAA 2J1SA 5FXWA 1BVP1 3UL2A 1H1MA 5A7WB 1S0BA 1OI6A 3VDDB 2VNGA 4ASKA 5KXEA 4MGTA 4C0BA 2RS11 1VMHA 1V6OA 1RHI3 5F32A 5DABA 3AMPA 5EZWA 3RFRA 3CDZB 3ECQA 5LY1A 3MIFA 4O7XA 4RFT0 4EZ4A 5JSRA 1CESA 2ARBA 1POV0 2WZ8A 1DYPA 4XJWA 1EPZA 5FYSA 3UJQA 3WF2A 2GC0A 4CDQC 3TEYA 3P3PA 5GJ6A 3O0XA 3JZVA 3PURA 4RN5A 3PU3A 2E31A 3FC0A 1AYM2 1MVQA 5EP9A 4UBHA 1R1A3 1G9CA 3SH5A 5HCHA 1O3TA 1UF2C 2ZHMA 3ES1A 1GP6A 4NOTA 5EWSA 2DCKA 3ZXLA 2A71A 1Y4WA 1VLNA 2A6YA 4MGQA 2ADEA 1XU2A 1UIJA 4QT6A 1YO8A 4PJYA 2TUNA 4RQPB 3T1LA 2QE3A 3WR0A 4ZKTB 5JZGC 1VBC1 1PK6B 2P5BA 1SFPA 3PJQA 2YG0A 2EXKA 2H0BA 3D0JA 1JYTA 1EUTA 4XUPA 2XVGA 4AI0A 5IATA 1JBCA 1POQA 4IUGA 4K20A 1Q43A 5FZ8A 1KDKA 4WZCA 4COWA 4BM8A 3LWCA 2R1DA 1RUOA 4FP2A 1GZTA 2VTXJ 4B29A 4NHMA 3J8F1 3OCPA 2EIGA 4I0WB 5D1IA 2A75A 2I2SA 1LU1A 2BVBA 5GLTA 4B7EA 2JD4A 4FQ4A 4MXWB 4CVUA 3H9AA 1CQ9A 3NAPC 4XZPA 5F39A 3U07A 1QGLA 4L99A 4XF0A 1BLZA 3QCWA 3AZWA 1OF4A 3G7DA 5C9AB 3TEZA 1V6LA 2BGPA 1FNYA 2VZSA 4H7LA 4ATEA 1JYWA 4MG2A 3B7MA 2LW8A 2E26A 3AXEA 1HXS3 1QJX3 2ZZJA 2B7YA 3LQCA 3T1MA 2O14A 3MIBA 4IXLA 1FAYA 5FK7A 4CCCA 1S0IA 3HBZA 3ZFEA 1DHKB 1ZZBA 3RWNA 4QX7A 2P3JA 1URXA 3BTAA 5LBFA 2RDQA 3HR9A 4NRPA 2R32A 5HXVA 4QQOA 1PGW2 4FOYA 2GC2A 3UGGA 4NUBA 5FCCA 4CDQA 1XE7A 1POV1 1VBD1 1WCDJ 1CJDA 4QXBA 2VZQA 3DXTA 3VDDC 2Y26A 4LUKA 1COV2 3JBG3 5FO8B 3RRDA 1RINA 1TNFA 4QDRA 4Y33A 5FMBA 2XLGA 1NOVA 2O8QA 4N53A 1AL22 2D6LX 4Q4W1 2Q5TA 2IVJA 2ZEZA 1MZ6A 3RWKX 4XIKA 3NAPA 3DECA 1C28A 1VBE3 4IV3C 1YC61 3M1HA 1XBFA 2DFCA 5CG9A 4Q2FA 1KGYA 1XC6A 3C7EA 1RJ7A 3NV1A 3A0NA 3VD3A 5K8SA 2DWRA 4D6QA 5FBJA 2ZGUA 5BPXA 4XTMA 2Y38A 3MIHA 1QNWA 2DU1A 1D2QA 1RUE1 4WZFA 2K9ZA 1VRH1 1JZ2A 2DCZA 1L7RA 1LOAA 3V0AB 1OXCA 2A3WA 1HIXA 1W8NA 1YCIA 4Z2AA 3NNJA 4PI0A 4HLTA 4TYSA 3VHOA 2B45X 4IV1A 2ZGTA 5IJRA 5FZHA 2ARXA 2V5YA 3BU7A 3MPBA 4PDWC 3VKFC 4AVCA 3LSEA 2VOWA 1GR3A 4BK5A 4QWNA 5T3NA 3Q9OA 2C0ZA 3BODA 5FLJA 3TNQA 1ODMA 4LITA 2HWC3 4FOVA 3ZYJB 3AZXA 1ZBA2 5E89A 3A7QA 4Y4YA 2NPIA 5T5PA 4CP0A 2VVFA 1F4HA 4D6RA 2VXRA 4XQ4A 1WMEA 2VU9A 3K4ZA 3WG4A 3K46A 4I0BA 3AMHA 4LMFA 4HKLA 4HETA 3IBMA 1W9WA 2B9VA 1X33A 3N7MA 4QB6A 1UXXX 3UNPA 1JUHA 4IEVA 4AHZA 4IE7A 4KU7A 2JD9A 3TN93 1DYKA 1MS3A 4FPJA 4YVWB 5FY7A 4AI1A 4CP1A 1S0JA 1UL9A 4XOGA 1QXPA 1W0PA 3R4SA 5FFOC 4CDXC 4EWEA 3MLLA 1GNHA 2BOIA 4EN7B 4X6QB 2WDBA 5ACA3 3MO4A 3DV8A 5FO9B 3OBAA 4AI9A 1HRV2 3ZSJA 1ULGA 2YFUA 1TME3 2XGXA 1JU3A 4O65A 2Q30A 3G6JB 3NJXA 4Q4V3 5E16A 2WAOA 1G86A 2A6ZA 3VD4A 3MGUA 5GLWA 4OQ8A 3WDUA 1AYN2 4YYOA 4GWNA 5FQ0B 4AHXA 1UZYA 3VD9A 4CU7A 4XQWA 1DQ2A 4HN1A 3J7LA 1E5RA 3BPSA 3FMGA 5KHJA 2R062 4BJ0A 2HLEA 3POJA 5APAA 3HT1A 5C8CC 2QVSB 4PLMA 2VW1A 4Y5Z0 4O9EA 5C7GA 1UNBA 3WW1A 4A6SA 2VTXA 3DYMA 1NCQA 5D8AB 4EWDA 2QZ3A 4TTGA 2OA2A 1MQTC 1US2A 4JDNA 5ERLA 4XZUG 1ZBE2 1FYUA 3J7MA 3W5MA 4BXFA 3EHKA 3U78A 4XF1A 3J7HA 2YROA 3GNEA 3D5OA 4A7ZA 5H9RA 4MHRA 5IFPA 5LK7B 2ORXA 3KT4A 1OT5A 1QJEA 2VMFA 4IEPA 3HNBM 4U36A 5CVRA 3LIHA 3FN9A 1DGWA 3MIDA 4E4HA 1ULOA 1W6NB 1DFQA 1YIFA 4R9AA 3RS6A 5A33B 5AC92 2RDRA 4M4RA 3SH4A 4AHYA 1VMFA 1MPXA 4FCAA 4ZU7A 3ILFA 5CB7A 3OG2A 2ZX1A 2Y6KA 1O3RA 4XXPA 1JYNA 1JOPA 4P9LA 1KXGA 1UIKA 4CXWA 4DUWA 4OHZA 1Z0HA 1NE4A 1DGRA 4YFWA 4BXSV 3OUJA 2YXSA 1VR3A 3C7OA 3OJBA 2PTMA 1R1ZA 3GHMA 2PAEA 4RD7A 4FXKB 2BPA2 4UAPA 2AZ5A 2VZOA 1X82A 1I5ZA 2WWSA 2OT7A 1LHWA 3B69A 4SBVA 3D6EA 4DY3A 5IHRA 1LULA 2GZWA 3ZXFA 2P4EA 5JIAA 2VMCA 4A3XA 2B5HA 4NVPA 5LY2A 1R093 3UT0A 2RS31 4A7YA 5LEKA 2GN7A 4UFHA 5EYXA 1W8ZA 2HWF3 3WW2A 2H0VA 4ZY9A 5FO7B 1HJFA 3QACA 4Y5TA 1W0OA 2DV9A 2R043 4QQ2A 2VBDA 1BMV2 4FI9A 2QQPA 1ZBA3 1UY2A 3PIJA 4CDUB 1YI7A 2D40A 3ZFGC 3WHUA 2IXCA 5K0UA 4ITCA 5FZFA 5KC5A 3BKZA 4LULA 3KF5A 4MHUA 3T2OA 1DQ0A 4OI4A 2NQYA 4QHOA 1RUJ2 4YZ3A 2ZX2A 3ON7A 4E9KA 4PLOA 4ZZ8A 1GYKA 4LK7A 4UT5A 3H1MA 5A32A 2Q1FA 1XNDA 2FCVA 4QB2A 4QGMA 4B8EA 2V4AA 4AL9A 1Y9QA 4OHVA 2PXJA 1XYNA 1CAXB 3KV5A 4K8FA 5EXOA 2W52A 4MH0E 2G1MA 4LOTA 4WVWA 1HLCA 2FCTA 4MUVA 4XUOA 4XUNA 4COVA 3CIHA 1TQ5A 1WMDA 1VBC2 3NV4A 3CLPA 1JODA 1RB8G 1H6YA 5H9QA 3BOWA 2ZA9A 2G9GA 1FPN1 4TLGA 1PVXA 1SHWB 5I0TA 2XMLA 1QJY1 5LA1A 5F9TA 1YFYA 3HVDA 4AGRA 3WHTA 2HWB1 1FMD2 3KV6A 3RMXA 4Y4RA 1UYPA 1RUF3 2VOTA 3NRUA 4L97A 3WQ0A 1HB3A 1AJKA 5ACA2 5FP9A 1N3OA 1VRH3 3GZEA 2RVAA 5EIYB 4ORFA 2HWF1 3ATGA 4P08A 1Y9GA 1QJU3 4LUMA 1OD3A 2WS92 2BBAA 1HRI3 1R091 5IAXA 2CGNA 4Q4W2 4FPLA 2KM2A 5CA6A 3GDBA 4AEDB 3M3QA 2ZX3A 1GWLA 2WIIB 1NY71 2DVFA 1F5FA 1RXGA 3FBYA 1SLTA 3IPVA 2FQPA 4NRQA 5DAXA 4ES9A 3ASIA 4B4PA 1H2MA 2RJ2A 3PLQA 3OGJA 2JG8A 2BP6A 2GC3A 4AEKA 3AKTA 4O61A 1Q8SA 1JYCA 3FL7A 4CUCA 1MS1A 1SLLA 1LEDA 2GH8A 1S1AA 1S4CA 5LATA 3QOPA 4UXAA 3DPRC 1V6NA 1W3VA 1UKRA 1CPMA 1RC6A 4TWTA 2JG8B 4YG6A 2J1EA 4QU1A 4ARYA 5JOWA 3ZXGA 1STMA 3B9IA 2O8OA 1RUC2 1PX3A 2R16A 4LO7A 1E5SA 3U4XA 2IXHA 1Z7S2 3EJKA 2E9QA 1DGRN 1GLHA 4QPYA 1CX1A 5F3GA 4ONUA 2YMZA 3SKVA 3JD71 5BXXA 2DYCA 4RS5A 1SDWA 1ZBA1 3GCWA 3WV6A 1MS4A 2B42B 2VXJA 1CZTA 4B1LA 3S6PA 2GMMA 3EYPA 3RSJA 2Y34A 1NKGA 5F1RA 5A7OA 3CZUA 4BCUA 2WNOA 1OLRA 4GWJA 3V65A 1A8MA 4CTEA 1Z7S3 2CV6A 4RSUA 5T55A 3WNPA 4YGDA 4NN0A 1WW6A 2RG4A 2VY0A 3PVOA 4TLFA 5IWFA 4IEUA 4RS5B 3TAYA 3H8XA 3E5UA 4UF0A 2P1BA 4PCRA 4UFIA 1ZVFA 4M3CF 2ORZA 1PX4A 2QKDA 3ZIXA 4Q0SA 3T30A 4FAGA 1QOOA 5FYCA 2HWC2 1H30A 4DXTA 1UZ0A 4GB31 4AGVA 3I59A 2A6XA 3AM2A 1IOAA 4YVSB 3AZYA 3UKTA 3NSTA 1EP0A 1IQDC 1W99A 3RJRA 1JI6A 3B00A 3U37A 3R4DB 3KSCA 1TZOA 3N7JA 3TWIA 3VBOC 3M3IA 2AREA 4EWAA 3TOJA 5FKCA 5IK7A 1MZFA 2P3IA 5FZOA 2VUJA 4CU9A 1A8DA 1W9SA 4AWDA 1YQ8A 1ENRA 3ZOIA 4KU8A 5A32B 1O4ZA 2JECA 2RR13 4B4QA 2BWAA 2RM22 2YB7A 4K3UA 4AEDC 1CJPA 1CAXA 2D97A 1IG0A 3AKSA 2OPWA 4AGGA 4I30A 3C7HA 3ZKUA 1AX2A 3I97A 3LEGA 3N9NA 5LCWL 1DLCA 3BU0A 4NJ4A 1R083 3KF3A 4AFDA 1PIV1 2YUEA 2WZR2 4Q8KA 5DZFA 2WNVC 4HKOA 2J1RA 5IK4A 3H0OA 3IZOA 2W47A 1UD1A 3I8TA 1UXZA 4OI2A 4FOQA 4E8CA 5A7PA 5C5TA 1G9AA 5CIRA 2BEOA 4E2GA 3AJYA 1OKQA 3M70A 5LASA 5L9VA 3NNGA 2WYSA 3POWA 4IGQA 1RUH3 2JB4A 2PHFA 1HB1A 3AKRA 4NAMA 3W20A 3WDVA 2VBPA 1D4M2 3KS7A 5IVBA 4EYUA 2R061 3VBHA 5FOJB 4DUXA 1OBNA 5F5QA 3RMYA 4OHYA 2I07B 2QUOA 2CL2A 4QDSA 5FZBA 5L7OA 3THTA 3VLBB 1LHNA 4E27A 3LB9A 3AMQA 4ASLA 2HBUA 4BYYA 1ZZ6A 1YQ2A 4Q26A 2JDMA 1T6BX 5FP7A 4K40A 5FMCA 5FYYA 4FFFA 1FATA 4IEQA 2FDGA 3MICA 4J1XA 1D0GA 3E97A 1WLDA 3LEIA 3ZFFA 1ZBE1 3O1RA 2YPJA 4Y20A 5HCBA 1WA6X 3S7IA 5IVEA 4FVVA 2VD7A 4RHV3 2QCSB 1JHNA 1RVF2 2VVDA 4PDWB 5LA0A 1YYNA 2C1FA 2HWE3 2ZXQA 3VDDA 3GHNA 3K48A 1H8TB 4Q4W3 3DN7A 5FUIA 4TZDA 1PM4A 1WMFA 4GH4B 1NY72 2WLPA 1AR61 5KWRA 2BERA 3LOIA 2RS53 2WABA 3MIGA 1OA4A 2D3PA 2PQQA 1O5UA 4Z07A 3BYWA 2JDAA 3WG1A 2GC1A 4C1XA 4CPBA 5C8WA 2DURA 2CAUA 1ZRFA 1C8M1 1WWYA 2Q8OA 1HX6A 1UZWA 1W6OB 3ACFA 4RGAA 2FZ2A 3SCHA 2RDNA 1WBLA 1RXFA 2ENRA 1XSQA 4ZONA 4CPBD 2PHUA 4CEWC 1GWKA 2VQ0A 4I3PA 2V72A 3NNFA 2AEZA 1F4AA 4LKEA 2DVAA 5L73A 3HNMA 5HV4A 1A78A 4XJZA 5A3NA 1BBT3 3LF7A 3JBG1 4Q4X3 4MV2A 2W92A 4FT8A 4GMP0 3IDAA 5FXZA 1F2NA 1KFXL 4D7YA 1PNGA 5A6ZA 4P9IA 1IS3A 3C7FA 4CDWC 1D0HA 4C1WA 5FLIA 4UFMA 3DYPA 1EV11 5F3CA 4NR1A 4NMIA 3FFQA 4EN6B 3ZMOA 5JMOA 2JDKA 1AL23 2VUCA 1X36A 2RMU2 3PVBB 3DKWA 3GBWA 4LO6B 1W39A 3I59B 2ZHKA 1F15A 1BQPA 2RE9A 4QPWA 4BDVB 1CIWA 3CQOA 1MQTA 2RM21 2BFUS 3CMGA 1PVC3 1SMVA 5T52A 4AR2A 2PHLA 4UBGA 4CEYA 1W2UA 4F3JA 3K51A 1E5IA 1VPHA 1D4M1 1OHFA 4NAOA 5FP4A 5FUNA 3WQ7A 4CCJA 1JXNA 2VZRA 5DAVA 1W9TA 2DCYA 2ZMNA 4D69A 2VCCA 4P14A 2HYXA 5C3RA 1D2SA 1ST8A 5C8CA 3SC7X 5D8AC 3KQ4B 3BI3A 4LT5A 3WW3A 3AVRA 3VZLA 2QZ2A 5LZ6A 3OBRA 1ND2B 4IV3A 5C9AC 4BHPA 4KBBA 4WM7C 2HWF2 3E6BA 4CEYC 2VUAA 4BIFA 1PM7A 1AL0G 4Y5SA 2EALA 1PO13 4RS5C 1CAWA 5JSPA 2VZTA 4FFHA 3QD6A 3T2QA 2JE7A 3IDEA 4YSFA 3SQOA 3I2DA 5K4LA 4NHXA 2XLAA 3NJZA 2RHPA 1WLWA 4XPVA 4BISA 4LNVA 1CGPA 4M4PA 2PQSA 5A3PA 3VL9A 1FPN2 1QU0A 1MEC1 5DDJ3 1W8FA 4RGKA 4XC9A 3PL0A 1ZRRA 3FHIB 5A7WA 3U0ZA 1ASJ1 1OQ1A 5CFCB 3CBNA 4M01A 2VPVA 2OXBA 4CDXA 3MZHA 5FREA 4IW3A 2YGLA 4LKSA 4R4XA 2ES3A 3I54A 5FZ9A 1R082 1PMJX 3H3ZA 1YQ5A 2WZR1 2OS2A 1RUD1 4MGZE 1RUD3 3GALA 4HFSA 2PHWA 3VBHB 2DBNA 2FDJA 3MF6A 3OPZA 4MADA 3OD4A 3H1YA 1Z7S1 3DPRB 2R063 2Y8KA 1TE1B 2J22A 4Q29A 1RHI1 4QDQA 3B01A 1AXZA 3RVHA 2QQLA 4P5HA 2F17A 1GQHA 1K12A 4HKWA 3WF0A 2FZ1A 2JDYA 3ETQA 3EBRA 4KG8A 1LOFA 2HWE2 2J1TA 2X53S 4CUBA 1GOFA 2CWMA 3BIEA 4QXHA 2NLRA 1UU6A 3OUIA 4LHKA 2W08A 1TMF2 4YNIA 1U0AA 5BNOB 1F35A 4YW4A 1REDA 2IXJA 2E7AA 4FFGA 5FY8A 1FXZA 1LESA 5BV6A 1WUVA 4GH4A 1UOJA 5C4WA 4AOCA 1OPOA 1VBA2 3M3OA 5T5OA 3VHNA 4LBKA 2P37A 5FY1A 4LR4A 4AFAA 5ANNA 1Q8QA 1IS4A 2Q8DA 1UKGA 2UURA 4META 1QKQA 3SISA 4AFBA 2HEWF 2XLFA 4JGZC 5FPUA 1W8UA 4RR3C 4UFLA 2J1AA 1RUF1 1REEA 3KCCA 2RR11 5AC93 5C8CB 2JKBA 1PO11 5G05L 4QX0A 4F7ZA 3K3OA 4HSJA 4YFZA 3SXWA 1I5PA 2KD7A 3AYAA 3CU7A 3I3BA 3P5BA 4S2HA 2YU2A 4B7KA 3IDBB 1Z78A 3WG3A 4A42A 3F2ZA 5KHHA 4XILA 1XE8A 4COZA 2NN8A 5BNPA 2UYBA 2X05A 2X8KA 4DNYA 3IN9A 4BWOA 4ZZ5A 5HCFA 3GJAA 1IKPA 3ZSLA 2TEPA 4DEQA 3LGRA 1ND2C 1FOD3 1RUG3 2CAVA 1SBDA 2WFPA 1FOD1 1RUG1 4KG0A 4DFSA 4DO0A 3OY8A 3M7AA 4W50A 3VBUB 2JDZA 3SKJE 1H6XA 2IXKA 1ENSA 1NX9A 1ZA7A 4N7UA 3Q8CA 1W6PA 4YW2A 3PUIA 2XHNA 4H3WA 3ACHA 3UGFA 5LB6A 4L2NA 4YGEA 1CAUA 4QB1A 3AL5A 3V56A 1JN2P 4L92A 5JXGA 1VBB2 1XNKA 1LHVA 4YGCA 1YFWA 3RNSA 4P9WA 5FIXA 2C9KA 1NAEA 3JB8A 3RDIA 4J25A 3MFCA 1DG6A 2EXJA 2YBKA 3AJZA 4RR3B 4FAHA 2C24A 2PHTA 2ZGPA 2A3XA 3BB6A 1MR5A 2X09A 5B2GB 1MZ5A 5CKMA 1QMJA 2XPJA 4FSJA 4OI0A 3KCYA 2CGOA 4RHV1 3POYA 4KMQA 4BB3A 4YG0A 4GXLA 3POIA 1QJFA 1MS9A 3WEZA 1IS6A 3L2HA 2WJSA 5BNNA 5FK8A 1OF3A 1I3HA 4OZOA 5BNPC 4DINB 3JU9A 1UQXA 4RR3A 3WP3A 2Q1ZB 5K7PA 5JDBA 4QD2A 2DDUA 1CIYA 3U4SA 1C5IA 1LR5A 3H7JA 4AVAA 1H2LA 1TMF1 3SCGA 2XDVA 1WLTA 4WM8C 3THDA 1KFUL 1UX6A 3W21A 3LDBA 2ZGLA 1NYWA 2CHHA 3POEA 2W0XA 1C57A 2P6CA 2XHKA 3CNAA 5DXDA 3LPGA 5LW9A 2EAAA 5L9RA 3U11A 1PGSA 1N1TA 2BNMA 2WNVB 4JGZA 4ZHNA 2VNVA 4YW6A 5A6XA 5FZMA 1DCSA 3BCWA 3VUOA 5FZLA 1G9BA 1RUI3 3APBA 4PF1A 5FZ4A 4E2SA 5L9BA 2EXHA 2A73B 3LIGA 5F3EA 5C4WC 2C26A 4DS0A 2ZCWA 2GP5A 1MS5A 4RQPA 4QAWA 1HKDA 1KJRA 4JGZB 4QMAA 1C4RA 1AUYA 5L19A 3NW4A 5J48A 3D82A 5BNOC 4R9BA 3KCXA 3TEWA 1JUIA 3R6SA 4OZXA 3NVCA 1RUD2 2BTVC 2SLIA 2TNFA
chains in the Genus database with same CATH topology
2VUDA 1W8FA 1OVPA 2VNVA 1OUSA 5A6XA 1W8HA 1OXCA 2JDYA 3DCQA 5A6ZA 5A6QA 5A70A 2JDMA 1OVSA 2BOJA 2JDHA 2JDPA 1OUXA 1UQXA 2JDNA 2JDKA 2VUCA 2BV4A 1GZTA 4AOCA 5D2AA 1OURA 2JDUA 4UT5A 2WRAA 2CHHA 2BOIA 5A6YA 5HCHA 2WR9A 3ZDVA 4CE8A 1UZVA 2BP6A 2XR4A 5A3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUD A;  1W8F A;  1OVP A;  2VNV A;  1OUS A;  5A6X A;  1W8H A;  1OXC A;  2JDY A;  3DCQ A;  5A6Z A;  5A6Q A;  5A70 A;  2JDM A;  1OVS A;  2BOJ A;  2JDH A;  2JDP A;  1OUX A;  1UQX A;  2JDN A;  2JDK A;  2VUC A;  2BV4 A;  1GZT A;  4AOC A;  5D2A A;  1OUR A;  2JDU A;  4UT5 A;  2WRA A;  2CHH A;  2BOI A;  5A6Y A;  5HCH A;  2WR9 A;  3ZDV A;  4CE8 A;  1UZV A;  2BP6 A;  2XR4 A;  5A3O A; 
#chains in the Genus database with same CATH topology
 4CDU A;  4A3Z A;  1RVF 1;  3P6B A;  4G9S B;  4FO9 A;  4MGI E;  2PAM A;  2VME A;  4URT A;  4CU6 A;  2VMH A;  2YBS A;  3ZSE A;  2ZGK A;  3TN9 1;  4FPF A;  2E32 A;  4AHW A;  1E5H A;  5T54 A;  3ZYB A;  5I8T A;  5JOY A;  2PLV 2;  3O1M A;  1NT0 A;  4JCK A;  1AHS A;  5A7S A;  2IZW A;  4XFC A;  2WO2 A;  4YW5 A;  4YW3 A;  2Q1M A;  3AKQ A;  3FLT A;  1S2E A;  3B5L B;  2VMD A;  3KM5 A;  2D6N A;  2DVD A;  2ID4 A;  2JG8 C;  1N1Y A;  2OUJ A;  4QX5 A;  1J84 A;  2MEV 2;  3WDY A;  3IB3 A;  2XBO 3;  4OHX A;  1ZRI A;  3POF A;  3THC A;  1AR8 3;  2RS1 2;  4NID A;  3FLP A;  1OA3 A;  2ZBJ A;  3USS A;  1MAC A;  3OB8 A;  5AFE A;  4NII A;  2WO7 A;  3I3E A;  5FR3 A;  4Q4V 1;  1CVN A;  5IVF A;  2IFW A;  1JMU B;  4EN8 B;  2VJX A;  3NJV A;  4ES8 A;  5LWB A;  4W6Y A;  3KZ4 C;  1V6K A;  3MV0 1;  1NCQ B;  4XCB A;  1PK6 C;  1C3H A;  2VVE A;  4QX3 A;  5D8A A;  5A1L A;  4AFC A;  1O4Y A;  1JZ6 A;  4IE6 A;  1ULC A;  1KD7 A;  2JG9 A;  4Q5O A;  3AMN A;  3BUC A;  1BHG A;  3ZXJ A;  2MEV 3;  3Q8F A;  1XYP A;  3VV1 A;  5F37 A;  2QQU A;  4XFF A;  3PUQ A;  2PFW A;  3MI8 A;  4KL1 A;  1U5Y A;  1W6M B;  1FV3 A;  2XJT A;  3FZ3 A;  4UW4 A;  4AYU A;  2QQO A;  5JXH A;  4DXR A;  4A2U A;  1VE0 A;  4WM7 A;  4BQ3 A;  3MUZ 1;  1HXS 2;  1QJX 2;  4LKD A;  5E88 A;  2VMG A;  3ZSM A;  1K5M B;  4EN0 A;  4AEM A;  2D44 A;  2W5F A;  2C6S A;  3DYO A;  3I2O A;  2XR4 A;  1K5J A;  1SBE A;  3OY8 B;  5A3O A;  3WCS A;  5AFB A;  5EYY A;  4XUR A;  4Y1V A;  5LA2 A;  4CDW B;  1GZW B;  5AVP A;  3DUI A;  1J59 A;  4JZR A;  3ILN A;  5KXB A;  4GKY A;  1V9U 3;  2UY8 A;  4QPG A;  4EV0 A;  1GZ9 A;  1RJ8 A;  2JDH A;  2Y33 A;  1HQW A;  5IK8 A;  1U12 A;  1A6C A;  2R0H A;  4V1P A;  5FZ0 A;  3WNK A;  5FKB A;  3WP6 A;  4AI2 A;  3M3E A;  3MF9 A;  4WVV A;  1GZW A;  5CFD B;  2E53 A;  2PEL A;  4FTE A;  1LHU A;  1MEC 3;  1PHM A;  2F4L A;  3PTY A;  3I2G A;  1LNS A;  2CY6 A;  1ZA4 A;  3VKN A;  4Z82 A;  2WQ4 A;  5CNA A;  4PF5 A;  3SCF A;  4YG3 A;  3W5N A;  5ISL A;  2ZGO A;  1VBE 2;  1YIP A;  2HYK A;  5C4W B;  2GSY A;  2HBT A;  2ZGM A;  4FXG B;  2AR6 A;  4K9S A;  5IUQ A;  1TNR A;  2D43 A;  3QH6 A;  3PUH A;  1W2N A;  1W04 A;  1ULP A;  4AI8 A;  2D7F A;  3AL6 A;  5J98 B;  1AYN 1;  1FT9 A;  1ASJ 2;  1LOD A;  1UPI A;  4NO4 A;  3I2I A;  2DCT A;  1PIV 2;  3PME A;  1O4T A;  3UES A;  3WNL A;  2R04 2;  4NWV A;  3VBF B;  1JZ5 A;  4M0N A;  1BK1 A;  1KEX A;  2VH9 A;  3LE0 A;  3WD5 A;  1AX1 A;  4GMP 1;  3THP A;  1SFY A;  3ME2 A;  3L2Y A;  3KHB A;  4XCA A;  5AVA A;  3ZFG B;  1ZRC A;  3VZM A;  1QDC A;  2ATF A;  2RM2 3;  2C9A A;  2AUY A;  1ONA A;  1DP0 A;  1QY4 A;  1X8M A;  5GLU A;  5J09 A;  2G9Z A;  4LBQ D;  2JEN A;  1MS0 A;  5FJH A;  3D8C A;  1OLQ A;  4BQ5 A;  3GYD A;  2SBA A;  1W8H A;  2BNN A;  2WZE A;  3PVN A;  1DZQ A;  4RL7 A;  5FPX A;  4XBN A;  1U5I A;  5FZ1 A;  3J9S A;  4JRL A;  1OC1 A;  5A70 A;  3ROU A;  2ARA A;  1NXM A;  3MEP A;  2D93 A;  2VNO A;  5ABJ A;  5KBF A;  5JXJ A;  1IQA A;  1DQ5 A;  2XB6 C;  2P3K A;  2MHF A;  2WT2 A;  1KRI A;  1WMX A;  2JKX A;  4JHZ A;  1HW5 A;  1VRH 2;  1UYX A;  4OLL A;  5FQ0 A;  2KR2 A;  5AC9 1;  1RMU 2;  4O9G A;  2G9F A;  4R9C A;  1RYY A;  3I2F A;  2FDF A;  4LBQ B;  3GF6 A;  3ZDV A;  4K1Y A;  1K42 A;  4OUS A;  4XJ9 A;  1L7Q A;  1CN1 A;  2E7Q A;  4AAP A;  1BEV 2;  1OOP B;  1UYZ A;  4Q4Y 1;  4ASM B;  5A3M A;  1FX5 A;  2IVI B;  3RZG A;  4IEX A;  3ZIW A;  4DXS A;  4YM2 A;  5FYM A;  2ZGR A;  4ISR A;  2XJQ A;  3WIN E;  3S5A A;  4ZXK A;  1SPP A;  3M3C A;  3GM8 A;  3FHA A;  1XB9 A;  4JV4 A;  3A4U A;  2VZ1 A;  3Q8E A;  1NCQ C;  3UKN A;  2NM1 A;  1OOP A;  2AC1 A;  3NQH A;  3PJY A;  5TSW A;  4OUM A;  2PLV 3;  1UY3 A;  4BE3 A;  3KT7 A;  4GA9 A;  2PLV 1;  4Z1V A;  5FBZ A;  2OQ6 A;  3RZZ A;  1H8T A;  1VAK A;  3LOB A;  3AX4 A;  5M0T A;  3VZJ A;  1PO2 2;  1SCS A;  1EV1 3;  1ZM1 A;  3R4U A;  4I01 A;  1JYI A;  3ZKY A;  1ND2 A;  1V00 A;  3DF0 A;  2Y60 A;  3RJ2 X;  2EID A;  2VUL A;  2W1W A;  3MIE A;  3NMB A;  2XH6 A;  2X10 A;  4KWU A;  5C6C A;  5CAZ A;  1EAH 1;  5CEH A;  2RS1 3;  3RZL A;  4JAA A;  3U14 A;  2IXL A;  2VNR A;  3AYD A;  2UU8 A;  4E2Q A;  4AXO A;  5CFD C;  4I2O A;  2RS3 3;  5KXD A;  3EB7 A;  4COY A;  1AR7 3;  2A70 A;  1C5H A;  1AR7 1;  3HN3 A;  3S30 A;  2QJV A;  2HJI A;  4XIO A;  4CCK A;  5BUV A;  1XE0 A;  5J37 A;  4UFK A;  4B1M A;  3LEM A;  3LA2 A;  1ENQ A;  1ALY A;  4L8Q A;  4AVS A;  1WCS A;  5JOX A;  5L36 A;  1PGL 2;  4BLI A;  2AYH A;  2PA7 A;  1CON A;  1S0D A;  1FMD 1;  3OYW B;  3AP4 A;  1GU3 A;  5C71 A;  3W9A A;  1QEX A;  5JPM B;  4XJA A;  1D7P M;  3POG A;  3U10 A;  3BN6 A;  2UWB A;  5HPO A;  5J1X A;  2WYF A;  2IWG B;  3CL1 A;  1AZD A;  3MDP A;  3NKG A;  1UW8 A;  1V70 A;  4WBB A;  2WZP P;  2D3R A;  4LKF A;  3LEK A;  2UYA A;  4EJR A;  1JOB A;  2W1U A;  4FQZ A;  3FJS A;  1COV 3;  1JZ3 A;  2YHJ A;  3UJO A;  1UWW A;  2VZV A;  4YAR A;  1KJL A;  1LGB A;  4CCD A;  5JWP A;  5FYU A;  4AQ6 A;  1WW4 A;  1H4H A;  5BNN C;  5FWJ A;  1XSR A;  3RYP A;  1S0F A;  5FP8 A;  1IPJ A;  2Z69 A;  2HWD 2;  4COU A;  2GU9 A;  5JI9 A;  3HN1 A;  2DTW A;  1NUK A;  1OLM A;  1C8N A;  5FZ7 A;  2XUE A;  1LOC A;  1GP4 A;  4D7S A;  4LHN A;  5I0U A;  1RMU 1;  3ENR A;  1LTE A;  1NZI A;  2ZHL A;  4OUL A;  2Y6H A;  3EQE A;  4HPK A;  2QQV A;  3N35 A;  3OBT A;  3WLU A;  4CUG A;  5KR7 A;  4HL0 A;  1UU4 A;  2WS9 1;  2AEN A;  1HN0 A;  4KBZ A;  1PMI A;  3RGB A;  5D21 A;  3HD8 B;  3RZK A;  2XJU A;  2Y0I A;  4FP3 A;  3V64 A;  2ZKL A;  3HQX A;  2VAU A;  1Y7B A;  1HRV 1;  4Q4Y 3;  1CPN A;  1O3Q A;  1LOF C;  1PVC 1;  1XNC A;  2MEV 1;  2WN2 A;  5JCT A;  1AR9 3;  4CE8 A;  2B9U A;  4OFG A;  1AR9 1;  3DXU A;  2ET1 A;  2QQK A;  4GUL A;  3TRS B;  4Q0U A;  1N1V A;  1WCU A;  5DAQ A;  5DN2 A;  1OVP A;  3RG0 A;  2XKP A;  3AXD A;  4Q0V A;  4QHB A;  4JDO A;  3VKO A;  4LA2 A;  1AXY A;  1RMU 3;  4ZS2 A;  3D0S A;  5DAP A;  4JC1 A;  4BQ1 A;  3T4V A;  3O7O A;  2R30 A;  4JRA A;  4QPI C;  3VZN A;  3DL3 A;  2WBK A;  3ZDS A;  2CYF A;  4XUT A;  5BNQ A;  4HT1 T;  1UOF A;  2P6H A;  1VBC 3;  4N53 B;  2WS9 3;  1BEV 3;  3FUQ A;  3OPT A;  3TN9 2;  4LA3 A;  5C33 A;  1KS4 A;  4IET A;  2JXA A;  1DQ1 A;  5IK5 A;  1ZX5 A;  4YVW C;  3K75 B;  1TME 1;  2GP3 A;  2VEC A;  1RGS A;  3ACG A;  1B35 C;  3LD8 A;  4DXZ A;  4DUV A;  4E4D X;  5FXV A;  4JX0 A;  2XBO 2;  2I45 A;  2ZEX A;  3CHX A;  3ZMN A;  1RUH 2;  3OGV A;  1YQ6 A;  2A3Y A;  2ZOE B;  2EIC A;  3ZN6 A;  2ZGS A;  1SZB A;  4L0P A;  4D8M A;  2OII A;  4Q8L A;  2Q0A A;  2AH2 A;  2KA3 A;  4BLJ A;  2DVB A;  3JCI A;  4QPG C;  3ZN4 A;  1HRI 1;  3T2T A;  4M3C E;  2V73 A;  4UOJ A;  4N43 B;  3ZSK A;  3V0B A;  3ACI A;  4QGL A;  2R7E B;  2W95 A;  2GND A;  4LLO A;  1CZS A;  2ZHN A;  1Y9M A;  3M2M A;  5IAV A;  1FMD 3;  2VW2 A;  3VL8 A;  4UYB A;  4CU8 A;  1JU4 A;  1AYN 3;  2W94 A;  2ZTN A;  1ZZ7 A;  3U75 A;  1NG0 A;  1UMI A;  4QKF A;  3VBS A;  3ZFF B;  3E6C C;  1F31 A;  2XJV A;  4BZ4 A;  3WCR A;  5I0S A;  5BY5 A;  1RUN A;  2WIN B;  3TB0 A;  1UU5 A;  2K46 A;  2XUM A;  3HEI A;  2J42 A;  3PUA A;  2HWD 1;  4XDP A;  4BOW A;  2W91 A;  1EAH 3;  5F5I A;  1O3S A;  3ZFG A;  4HBN A;  2VCA A;  3LFI A;  1O91 A;  1R64 A;  4GJZ A;  4NRM A;  1YQC A;  4IV1 C;  1ZBE 3;  5A3U A;  4TSV A;  1W6N A;  5T50 A;  1H9P A;  2B4K A;  1NE6 A;  5HCA A;  4Q4X 2;  5DAW A;  4FPO B;  2XKO A;  1GUI A;  2GNM A;  3GBG A;  1GOG A;  4LXL A;  4ZU5 A;  2W39 A;  3B3Q E;  2ET7 A;  2RS3 2;  3KLS A;  2W46 A;  1KS5 A;  4LO5 B;  5CZK A;  1T2X A;  1Q8V A;  2A5Z A;  2DTY A;  2J1U A;  2ZAH A;  4DEV A;  3H50 A;  1WD3 A;  5FPZ A;  3WF4 A;  5JR2 A;  2BQP A;  4E8D A;  1UY4 A;  4FFI A;  3CJI C;  4LPL A;  1HXS 1;  1QJX 1;  1TVG A;  1AR8 1;  3KGZ A;  1R09 2;  1H1A A;  1L7L A;  4RFR B;  4XFH A;  1PGW 1;  5FP3 A;  4L9B A;  2CWS A;  4WVM B;  2RS5 1;  3ZYP A;  5DUU A;  4LBQ A;  3A0K A;  5EHD A;  2WC2 A;  5LRR A;  4LIV A;  2WNU A;  3H3U A;  1O5L A;  5GKA C;  5C9A A;  2R04 1;  4K21 A;  4FTB A;  4XF9 A;  5I0D A;  5DG2 A;  1H2N A;  4LIU A;  2Q8C A;  5F3I A;  2D3S A;  5FZO B;  2E6V A;  3BTZ A;  4QKB A;  2VBB A;  4BK4 A;  2KXL A;  5E8A A;  3H1W A;  4DOU A;  4XFI A;  3E5X A;  4QKN A;  1DQ6 A;  3VBO B;  2LRO A;  2BVV A;  1LJ7 A;  4G4F A;  3ZFE C;  2EAK A;  2YFZ A;  5FJK A;  1W8W A;  4ATF A;  3OTF A;  3CJI B;  5FZ6 A;  4CEY B;  1WKY A;  4DIQ A;  5JZG B;  1ODN A;  1W05 A;  3AKP A;  1AR6 3;  4QKD A;  4C8D A;  2LAL A;  5I8S A;  2MPF A;  4JQR A;  3J7N A;  4LBM A;  2VM9 A;  2ZX4 A;  3RQ0 A;  4PLN A;  3VBR A;  3LCP A;  4BA6 A;  4CDQ B;  5EJ3 A;  4XE9 A;  4DB5 A;  3MPP G;  1LKN A;  2ZML A;  5FV3 A;  3III A;  2GH2 A;  2BV4 A;  4BME A;  3PMS A;  3URF A;  1B35 A;  1C1L A;  1G8W A;  1N3P A;  1RUE 3;  1VAM A;  3HMY A;  3IIA A;  4MOA A;  4NWW A;  3LA3 A;  3BIW E;  1AYM 3;  3OEB A;  4GIQ A;  3NO8 A;  4LOS A;  5FDB A;  2OPK A;  3RYK A;  2YZ4 A;  5GZD A;  5LRS A;  4GB3 3;  1O7F A;  1HQL A;  1APN A;  3HOB A;  1TME 2;  3HNY M;  4WM8 B;  5EJ1 B;  1W2A X;  1UMH A;  5FOB B;  4Y24 A;  3E1F 1;  2UWA A;  1Q8O A;  1GOH A;  4N9I A;  1CD3 G;  1WGP A;  5GAL A;  1M06 G;  4BPZ A;  2OX0 A;  1QOT A;  3N4M A;  2BZD A;  1ND3 A;  4A41 A;  4P9G A;  5A7N A;  1BJQ A;  2I74 A;  3OGR A;  1SAC A;  2OUH A;  2BGO A;  2WFF 3;  1W9F A;  5IVC A;  3ZYH A;  3IM0 A;  4IEZ A;  3RZM A;  3ABZ A;  3AVS A;  1PZ9 A;  2RJK A;  4XUQ A;  5I91 A;  3I49 A;  5DDJ 1;  3EMR A;  4XFA A;  4UWD A;  3FWE A;  1OOP C;  1YFX A;  5F8P A;  4JKK A;  3KD4 A;  1IS5 A;  1HB2 A;  5C3O A;  1WZX A;  4NRO A;  1MZE A;  4IGO A;  3D3A A;  3SEE A;  4BU2 A;  3HT2 A;  2V4V A;  4P5Y A;  4LE4 A;  4Z92 B;  4X8N A;  2MNG A;  4J1W A;  2RMU 1;  3VBF C;  5K0U B;  1C8M 2;  2PYT A;  5FTT C;  1RUC 3;  3K3N A;  2XWB B;  4MGY E;  1GIC A;  4KI5 M;  4MXW A;  4AVT A;  2VQA A;  2NMN A;  5A1A A;  2K2S A;  3LFM A;  5BYN A;  1AR7 2;  2XL7 A;  3O1P A;  4OMD A;  1JW6 A;  1RIR A;  1DZT A;  2WT1 A;  4YM1 A;  4BQ2 A;  2HEV F;  5LEJ A;  1H8V A;  2VZU A;  1WW5 A;  2VG9 A;  3JXS A;  3VBO A;  2WUH A;  5FYV A;  3WZ1 A;  2HWB 3;  3ALQ A;  3JBG 2;  2R0F A;  3I2K A;  4CZS A;  4I02 A;  2A6W A;  5F7U A;  2VTF A;  4IER A;  4R52 A;  1W03 A;  1VMJ A;  3C8X A;  2J1V A;  5JR7 B;  4AQT A;  4HZF A;  1QQP 2;  3OUH A;  5GZE A;  2DBI A;  1AYM 1;  5F2S A;  1OMI A;  4GZ9 A;  3IMN A;  2WWJ A;  2ZEW A;  1J3R A;  4D3W A;  1JTZ X;  4OYU A;  3HPN A;  2VQU A;  3AC0 A;  2EXI A;  4UI9 L;  4LLF A;  2GAL A;  5FXX A;  1OH3 A;  4YGB A;  3QH7 A;  1EAH 2;  3AZV A;  5EV7 A;  4BQY A;  2L9L A;  4MYE A;  5FYI A;  3JD7 3;  1B35 B;  1AVB A;  2VMI A;  4LBN A;  4HVR A;  2D6M A;  3Q8B A;  3I2J A;  4M00 A;  3ZLI A;  2E33 A;  3WDX A;  3FUO A;  1V0A A;  5FZD A;  5FPB A;  4E4Z A;  4KGQ A;  4XBQ A;  3M8L A;  1N3Q A;  2RDS A;  4GJY A;  5J36 A;  3NNM A;  2ZPX A;  4PIY A;  3J8F 2;  3O0V A;  4XAA A;  4FPK A;  1REF A;  5FRA A;  5LBE A;  4AG4 A;  1SEF A;  5F6L B;  1MEC 2;  4GH4 C;  2BDR A;  3H42 B;  4KGG A;  2CDO A;  3T09 A;  2LM3 A;  3OGS A;  1LRH A;  4QGN A;  2VGD A;  1JYX A;  2XQR A;  3NAP B;  1H0B A;  2R6Q A;  2ZGQ A;  4CYD A;  1HV1 A;  2JE9 A;  1K5M C;  1ENX A;  1LB2 A;  1UX7 A;  3WUC A;  3OPW A;  3AFK A;  4KQ7 A;  3ZYR A;  1WD4 A;  4CP9 A;  5A6Q A;  1G9F A;  1SLC A;  1US3 A;  5IVJ A;  5I0R A;  2NYY A;  1VB2 A;  1X8E A;  4CSW A;  1V6M A;  3N9O A;  1CR7 A;  1GQP A;  4ET7 A;  1MVE A;  4HMZ A;  4NHL A;  3T3Y A;  4FPY A;  2ZS6 B;  2GME A;  2OYZ A;  1CAU B;  1NA1 B;  1XU1 A;  4P00 B;  4QQP A;  3WF1 A;  1YHF A;  2A6V A;  5A3W A;  4Q27 A;  1AR6 2;  1YRZ A;  1SBF A;  2R49 A;  1XYO A;  4A7K A;  4CCO A;  1SPP B;  3LDR A;  4CCM A;  2NZ9 A;  3MW4 A;  2YPD A;  1PVC 2;  1PZ7 A;  5JI7 A;  1KIT A;  1W6Q A;  2DUO A;  2ZKN A;  3UV9 A;  4HON A;  3VBR B;  1GQG A;  3BVC A;  1AR9 2;  3DEM A;  3VBS B;  1JHJ A;  3CZJ A;  1ZRE A;  3I3D A;  3GZU C;  2HWD 3;  1AF9 A;  4K8R B;  4YW7 A;  4OHW A;  3I7D A;  3INA A;  2Y6G A;  4XEZ A;  5FMO S;  4XVH A;  2QTW B;  1N1S A;  1ZRD A;  1RUJ 3;  5IVV A;  1QNY A;  3E5Q A;  4GKX A;  4AEJ A;  3IKW A;  4P9X A;  1NQD A;  1COV 1;  1PIV 3;  1HRV 3;  3ELN A;  2BYV E;  4HAN A;  3SEP A;  5C3S A;  2FD8 A;  3BPZ A;  2IXI A;  3IAP A;  1O8S A;  2GN3 A;  5FZA A;  3O5S A;  4OMC A;  3B02 A;  4WM8 A;  1RHI 2;  1HDK A;  5CFC C;  1EY2 A;  1BXH A;  3ETP A;  5H9P A;  5DQ0 A;  4D6S A;  5B4N A;  1OH4 A;  5EFU A;  1FPN 3;  5DDJ 2;  3OOX A;  3K4D A;  1RUH 1;  1UAI A;  2ZX0 A;  4QPI B;  1G9D A;  2VL4 A;  1NCR B;  2Q8E A;  4GWI A;  4QM8 A;  3N7K A;  4EZH A;  3GJB A;  5GZG A;  5JSO A;  2WL1 A;  4NPR A;  1VBB 1;  2FMD A;  4PQQ A;  4LBO A;  4OCT A;  4QX2 A;  2JDN A;  1QJY 3;  1F9K A;  2CTV A;  2FDK A;  1J1L A;  5K0U C;  3NKT A;  4NPL A;  3FX3 A;  4DRV A;  4H7M A;  1LEM A;  4N90 A;  4W6W A;  3VD5 A;  4UW5 A;  4PBO A;  1BZW A;  1GAN A;  3MHZ A;  1R1A 2;  1RTV A;  4IV1 B;  3VDB A;  3IMM A;  1G6N A;  3P1I A;  1RUF 2;  2VOX A;  5FZ3 A;  3WG2 A;  3POS A;  3DKQ A;  3WSO A;  5KXC A;  5LK5 A;  4JKL A;  4M3C B;  1U5X A;  3PVE A;  1OA2 A;  1PO2 3;  1QJY 2;  3ZYG A;  3BTY A;  2Z5W A;  3T4H B;  1RIT A;  3NJY A;  4N9H A;  1JS9 A;  2VR4 A;  3MV1 1;  1GNY A;  5T5L A;  4CXX A;  4A4A A;  3MW3 A;  2XOM A;  2RS5 2;  3WNM A;  2LUW A;  5IW0 A;  4MO3 M;  3H3L A;  1MQT B;  1QQP 3;  3WT3 A;  3GBF A;  3DGT A;  1NA1 A;  5FY9 A;  4W8J A;  4M3C A;  3SMH A;  1QJU 2;  2WNU C;  2WQ8 A;  4QXK A;  4HPK B;  1ZZ9 A;  4KNC A;  1TG7 A;  1XNT A;  2DVG A;  1LEC A;  3M4F A;  2OKX A;  5B4X A;  1W6Q B;  3I4I A;  2GNB A;  2VQT A;  4JDM A;  4GAL A;  3BAL A;  3AP6 A;  4TN7 A;  1C1F A;  1QHD A;  1RUJ 1;  1S0E A;  2ZGN A;  4MGS A;  3UKV A;  4AF9 A;  3ZYI B;  2YY1 A;  3KV4 A;  1WCK A;  2OQ7 A;  1R08 1;  2X5I A;  3AP7 A;  4IDZ A;  1J3Q A;  4LEJ A;  3WF3 A;  5K9Y A;  1PNF A;  1QOS A;  4FPH A;  2EIB A;  3ILR A;  1QH7 A;  1V9U 2;  4YZ2 A;  1F5J A;  3CEW A;  3LA7 A;  1FNZ A;  1FV2 A;  3WOG A;  1S2K A;  3H8U A;  2WSU A;  3T2P A;  5FYT A;  3ZYF A;  4HOO A;  4LHL A;  1OKO A;  2E7T A;  1PZ8 A;  4XXA A;  2JIC A;  4XJ8 A;  2X5I B;  3VBR C;  3NV2 A;  5C70 A;  1W2O A;  1SFN A;  1W6M A;  1HV0 A;  4WV8 A;  1JZ8 A;  1UY0 A;  3HIF A;  4WM7 B;  4F8A A;  1GZC A;  5FY4 A;  4Q0Q A;  1FI2 A;  1UN1 A;  3MLJ A;  3VBU C;  4CUA A;  4CP9 B;  1SLI A;  1GNZ A;  4N43 C;  3V0A A;  2JJ6 A;  5ABJ C;  4S2G A;  4Q1P A;  4IGP A;  4K1Z A;  4QM9 A;  1CX4 A;  2JG9 C;  3FLR A;  4NE9 A;  1S2B A;  4W6X A;  5J7M A;  4CP2 A;  3O1S A;  1LOE A;  5L7O B;  2VZP A;  4XMI A;  3WXP A;  4QQH A;  2YC4 A;  2H6C A;  2D98 A;  4L11 A;  3UYJ A;  2ZJC A;  3KHC A;  4XFB A;  3VBS C;  5DUX A;  2CGP A;  2OVU A;  2XQX A;  1L3J A;  1YJL A;  4QPG B;  4BQW A;  4N43 A;  3KT1 A;  4PDW A;  2AGS A;  1OQD A;  1KQR A;  1X50 A;  1YI9 A;  2Z4F A;  5DG1 A;  2OW4 A;  3ZXA C;  2VC9 A;  4HSL A;  4Y20 B;  2BFU L;  1H2K A;  3P3N A;  4IE5 A;  2WLQ A;  4H2A A;  5FWE A;  2WR9 A;  4XF4 A;  1JOJ A;  3FHQ A;  4XW3 A;  2QQW A;  5KHI A;  1WLC A;  4DZG A;  1Q56 A;  4D94 A;  1EYB A;  5F5C A;  3LDK A;  1JH5 A;  4DY5 A;  1HN1 A;  1M4W A;  1OUS A;  2OZ6 A;  4JGY B;  3ZR6 A;  3TBD A;  4AVB A;  3ZPY A;  1Q5O A;  2E63 A;  4NIG A;  4IE4 A;  2ERF A;  2WNV A;  3AK0 A;  2BWC A;  1RUI 2;  2G4I A;  2ZAB A;  1YWK A;  4YVW A;  3ZXK A;  2Z2S B;  2D6K A;  4MXV A;  4YRD A;  4DQA A;  5A1F A;  3AP5 A;  5EQU A;  2FDH A;  2YU1 A;  2X5I C;  3I3Q A;  4LBJ A;  5FY5 A;  4B3N A;  1VP6 A;  1ASJ 3;  4I0A A;  4C0H A;  3RPQ A;  4N53 C;  4QPI A;  1S0C A;  4Y26 A;  1XPW A;  3WX5 A;  5A80 A;  2AAC A;  4XHB A;  5A3T A;  1I9R A;  4P9Y A;  1RUC 1;  2D6P A;  4QU2 A;  3F95 A;  4XET A;  5CKN A;  4IQP A;  3HWJ A;  1OFN A;  3WP5 A;  2XBO 1;  1B09 A;  2EVX A;  2PMW B;  2W1S A;  3PDQ A;  4OVE A;  3CF6 E;  3WUD A;  1XXN A;  2X29 A;  4MSV A;  5T5J A;  1NLR A;  3QLQ A;  1O8P A;  3LKJ A;  1QDO A;  3MYX A;  4JVA A;  5FMO L;  1HRI 2;  3S5Q A;  4A44 A;  4RGG A;  1BMV 1;  2A7A A;  4Z8B A;  4ZU4 A;  4R8H A;  4C90 A;  3MFA A;  3POB A;  4GMP 3;  3HBK A;  4LO4 B;  2RJL A;  4JHT A;  4Q4V 2;  3ZN6 B;  4LK6 A;  4MVT A;  3KV9 A;  3IDC B;  1N47 A;  1NQJ A;  2WNU B;  5FPV A;  3JQX A;  1W6P B;  2B39 A;  4YM3 A;  4PQ9 A;  2WAA A;  3CO2 A;  1D4M 3;  2RV9 A;  3WP4 A;  3KQR A;  3VZO A;  3KVA A;  3J4U H;  2DUP A;  2VO5 A;  1H4G A;  1WW7 A;  1XRU A;  2XVK A;  3O1O A;  3VHR A;  5ACA 1;  2FBE A;  2D5F A;  4YW1 A;  2BOJ A;  2JIJ A;  5LBC A;  3AYE A;  1XQN A;  3K77 A;  4XFG A;  2ZAC A;  5HV0 A;  3NWK A;  1ULE A;  3QBQ A;  3U1X A;  2UWC A;  4PHZ A;  1UYY A;  3WVJ A;  5F6K A;  1C8M 3;  1EUU A;  2B8M A;  1VAL A;  2WFF 1;  4P9J A;  1UCX A;  5DPN A;  4CEW A;  1GP5 A;  1FOD 2;  1RUG 2;  2YBP A;  1IPS A;  3FE5 A;  1LOG A;  3B9C A;  5KHG A;  4JGY A;  2OZJ A;  5HXM A;  2YGM A;  4QHZ A;  4JTO A;  3LAG A;  1HJG A;  2LTN A;  4R4Z A;  3ZR5 A;  4DMI A;  2BUK A;  1YFU A;  4XDQ A;  1SLB A;  5FPA A;  4AI3 A;  2W3J A;  1BBT 1;  2QFE A;  1JZ4 A;  1T6G C;  1POV 3;  1VBD 3;  4OQ9 A;  4CDW A;  5DZG A;  3R0R A;  4UW3 A;  5FZE A;  4HXC A;  2H6B A;  2JDP A;  1QIQ A;  3OGG A;  4PI2 A;  1LEN A;  3ZO0 B;  1SLA A;  4FBF A;  2YDE A;  1JYV A;  1AX0 A;  5SV8 A;  4JTN A;  3O1T A;  2ARC A;  5F5A A;  3IAQ A;  1VBE 1;  2PN5 A;  4YVS C;  1VBB 3;  5C5U A;  2QBX A;  5IT6 A;  4XBL A;  3A23 A;  2AEY A;  3JD7 2;  2VUD A;  3V0B B;  2PAK A;  1Y43 B;  1HB4 A;  2JE8 A;  5EJZ B;  5CAD A;  1AL2 1;  2GDF A;  2VOV A;  2UY9 A;  3KVB A;  5CU1 A;  4PIZ A;  4PIX A;  5BNO A;  1XNA A;  1W28 A;  1LGC A;  2WT0 A;  5GZF A;  2P2K A;  5FPL A;  1KDM A;  3USU B;  4W65 A;  1ULF A;  2P3Y A;  4LJH A;  1H9W A;  4W4Z A;  4XAB A;  3GZT B;  4I3G A;  5D2A A;  1OUR A;  2JB8 A;  4K7J A;  4NHK A;  4ZPI A;  4KWL A;  3VKL A;  2C4X A;  4Q4Y 2;  5C3P A;  1DYO A;  2R1B A;  4J6G A;  3N9L A;  1E57 A;  5CG8 A;  2R07 1;  4LBL A;  2V5D A;  4GD4 A;  2P17 A;  1CWP A;  4Y1X A;  3BTX A;  1V6J A;  2Y0O A;  2NP0 A;  3WY6 A;  3W58 A;  1S55 A;  4KWJ A;  4YZ5 A;  3LSD A;  4YZ1 A;  2JWP A;  1CZV A;  3BOP A;  5FYZ A;  5L7O C;  4AK3 A;  1ZNP A;  4LOR A;  4AW7 A;  3RYR A;  4S2D A;  5E1R A;  3RI9 A;  3KB5 A;  3NV3 A;  4QQL A;  3VZK A;  4CA9 A;  2VZ3 A;  1WA4 A;  4CEW B;  3ES4 A;  1PO2 1;  2NMO A;  2XG3 A;  3J26 N;  2WKK A;  5DMY A;  2Q4S A;  1A34 A;  4CDX B;  2DFB A;  4FPC A;  3UET A;  1VRB A;  2JG9 B;  1R1A 1;  2PHD A;  1X9T A;  1O6U A;  5HI0 A;  2YC0 A;  4OI1 A;  5I93 A;  2BNO A;  1YJK A;  2J7M A;  3N9M A;  4GB3 2;  1NLS A;  2WO3 A;  4X8P A;  5CKQ A;  4YWA A;  5A33 A;  4RA0 A;  4SLI A;  3VDA A;  4GAZ A;  4P02 B;  3B93 A;  4EN9 B;  2IC1 A;  4YM0 A;  2XJR A;  2QNK A;  1ULD A;  2Z79 A;  3ORJ A;  4V2W A;  1OD5 A;  3DPR A;  2WA4 A;  2CU5 A;  4IE0 A;  1OVS A;  1K3I A;  1SG3 A;  3PNA A;  1D4V B;  4UFJ A;  1WBF A;  2WNE A;  2LS6 A;  1HQN A;  2HKX A;  5G04 L;  3H7Y A;  1OSG A;  1W8T A;  3IPV B;  3PIG A;  1DGW X;  2QQM A;  3CKH A;  3E6D A;  1J3P A;  2N7G A;  2C5D A;  1SQ4 A;  4KH9 A;  4BIO A;  1RVF 3;  3R05 A;  5FZC A;  1DDL A;  1DF0 A;  3FFZ A;  4GQ7 A;  5GZC A;  3TEX A;  3SH3 A;  1UOB A;  1ZYB A;  4ZS3 A;  3LPF A;  1W0N A;  1RL3 A;  5FYB A;  3FBM A;  4XMA A;  1UO9 A;  1ND3 C;  2BU9 A;  3ACL A;  3AP9 A;  3ITQ A;  3MBW A;  2QDR A;  5JVV A;  3SLI A;  1H8T C;  5DUW A;  1GKB A;  3C7G A;  1QH6 A;  2WQZ C;  1VIW B;  3N9Q A;  3NNL A;  3C2U A;  4Y22 B;  3WNO A;  4JKM A;  4Y1Y A;  1DBN A;  5HBA A;  3O0W A;  1BYH A;  1J1T A;  1TMF 3;  3S0M A;  4HK8 A;  5CFC A;  1VJ2 A;  3AZZ A;  3KWV A;  4V2V A;  4HVQ A;  1VBD 2;  2FCU A;  2ILM A;  1LGN A;  2Z42 A;  1GMM A;  4X6R B;  2BW8 A;  3UGH A;  5A6Y A;  5J96 B;  4IND A;  3OEA A;  2VCB A;  4IEY A;  5GM0 A;  1QJU 1;  4XAC A;  4Y22 A;  4CXY A;  5JIU A;  5CBL A;  5F2W A;  4XF3 A;  3B94 A;  5FAX A;  2XVL A;  3IT8 A;  1BCX A;  3S7E A;  4F83 A;  4AZZ A;  1G7Y A;  2PHR A;  4CCN A;  3ZVX A;  3T0A A;  4CCL A;  4URA A;  2DU0 A;  4AVV A;  4D7T A;  4HG6 B;  4LO8 A;  3JQW A;  4NHY A;  3HQR A;  2WO1 A;  4Q0P A;  4XAE A;  5E6H A;  5DUV A;  4D0Q A;  5JXI A;  5FUP A;  3PHM A;  3A22 A;  4YLZ A;  3VHP A;  3RZH A;  3PUS A;  3TNP B;  1X7N A;  2VOK A;  1VB4 A;  4EQV A;  3N36 A;  3VBH C;  1BEV 1;  2XXZ A;  2QDN A;  4U2A A;  4QXC A;  1U5Z A;  2B46 X;  4QX8 A;  3O1V A;  1IHM A;  1DIW A;  3VN4 A;  1PK6 A;  3HJR A;  5JPN B;  4CDU C;  2WN3 A;  1ACC A;  4KWK A;  1JZ7 A;  5J3U A;  2JX9 A;  2FDI A;  5FZG A;  3VGI A;  3RZJ A;  2D6O X;  4G3Y C;  5IFT A;  2E51 A;  3EO6 A;  4UW6 A;  1UY1 A;  3HQU A;  5FY0 A;  4ISQ A;  5A7Q A;  2GAU A;  2O0O A;  1CAV A;  2HEY F;  2W68 A;  5CYY A;  3RI8 A;  2W87 A;  4A45 A;  5JAX A;  3JB4 C;  1TEI A;  4RQP C;  1RUI 1;  1UMZ A;  2RMU 3;  1UPS A;  3S57 A;  3TYJ A;  3D4K A;  2EA7 A;  1QJZ A;  1YEW A;  3ZPO A;  2GNT A;  3H8O A;  1W06 A;  3OSD A;  1OLM E;  3VKM A;  4NIH A;  1F8V A;  4XDO A;  3N9P A;  2VW0 A;  1DLL A;  2XL9 A;  1UZZ A;  3O14 A;  1Q8P A;  4MLO A;  4A6O A;  1H1I A;  2WRA A;  3PU8 A;  4XYX A;  5BNN B;  1CAV B;  5FMD A;  4ZXE A;  3GCX A;  3WW4 A;  2BGC A;  4IES A;  2D5H A;  1WCQ A;  3Q8A A;  5H9S A;  2DF7 A;  4XTP A;  1NA1 C;  1VBA 1;  4M0H A;  1DQ4 A;  4Y3O A;  4BQ4 A;  1BVV A;  3OBZ A;  1Q3E A;  1IKQ A;  5KHK A;  1UOG A;  3DCQ A;  4LHS A;  3SIT A;  4XQD A;  3O12 A;  1SCR A;  5IVY A;  2YV8 A;  4E4S A;  1PGL 1;  4GWM A;  3VDC A;  5LA9 A;  1DU3 D;  2LRP A;  2EF6 A;  3WNN A;  4N8M A;  3K2O A;  3MW2 A;  3GGL A;  3ST7 A;  3HAG A;  2BJS A;  2IUW A;  4JQT A;  3VBU A;  3CJX A;  1BK0 A;  4Y1U A;  3MUY 1;  3SHR A;  3WDW A;  2P34 A;  5JUV A;  2DUQ A;  2WZR 3;  4NIA A;  3L9J T;  1IZ3 A;  1A3K A;  3AYC A;  4MX3 A;  4MGK E;  4NPM A;  4AQS A;  2ZEY A;  4OUE A;  1LOB A;  2WFF 2;  3GZA A;  1DGL A;  1W90 A;  1NCR C;  3K4A A;  3KMH A;  1DZR A;  1K45 A;  1OQE A;  3W59 A;  2HWC 1;  2G19 A;  2QQI A;  1NXD 1;  2ETE A;  3A21 A;  2CDP A;  3AMM A;  3OF1 A;  4N7I A;  1I1E A;  1XJA A;  4WVZ A;  1VBA 3;  2WA3 A;  2Y6L A;  3BGA A;  4Z2W A;  1NZC A;  3OYW A;  4RHV 2;  3T0D A;  1ZZC A;  1GV9 A;  2XWJ B;  1ND3 B;  5EPA A;  4B4R A;  2YC2 A;  1QXJ A;  1EV1 2;  1BKZ A;  2W1Q A;  4WVM A;  1AR8 2;  4UF0 B;  4AAX A;  5CFD A;  5JLV A;  1OFS A;  1GBG A;  2HWB 2;  1W2T A;  3USU A;  4AED A;  3I3M A;  2XJP A;  3C3V A;  1GSL A;  5FYH A;  3T08 A;  4AE2 A;  1XNB A;  2CSG A;  1W9Y A;  4FPE A;  3KGL A;  1LHO A;  1UZV A;  1PMH X;  1GFF 2;  1XOY A;  4HN0 A;  3WNX A;  2W9X A;  1Y3T A;  1V6I A;  1VAV A;  3IWZ A;  2JIG A;  2ZAA A;  2ZZQ A;  3AFG A;  2VCM A;  4Q4X 1;  2F6B A;  3WQB A;  1QXR A;  3AB0 A;  3VBF A;  5C3Q A;  1W6O A;  2HH9 A;  2R07 3;  5GLZ A;  1MS8 A;  2WSV A;  2PHX A;  3N7L A;  1V9U 1;  1EPW A;  4ARX A;  4AQ2 A;  3O1U A;  1W3X A;  5LBB A;  4BH9 A;  3N3H A;  4FTS A;  2FMY A;  2V09 A;  4LE3 A;  1LAJ A;  4FPG A;  4TXW A;  1AXK A;  5CIS A;  3ZM8 A;  5IYY A;  3VB9 A;  2Y6F A;  3GXU A;  1NCR A;  3VD7 A;  2VE1 A;  2W2I A;  3UK9 A;  5ANQ A;  5GLV A;  2FHR A;  4JGY C;  1ZZ8 A;  2R07 2;  1O59 A;  4CRQ A;  4IEW A;  1S0G A;  3X29 B;  2IFR A;  3WQ1 A;  5ABJ B;  1I6X A;  4BMB A;  5JMC A;  1K5M A;  3T0B A;  5FLH A;  1IGO A;  5SV5 A;  1OUX A;  2XJS A;  3OD0 A;  4H55 A;  4DPN A;  5BNP B;  4Y1Z A;  1YLL A;  4LQR A;  1OPM A;  1BBT 2;  2O1Q A;  3ZFF C;  5DZE A;  3ZXE A;  4HVO A;  2QQN A;  1GWM A;  4BQX A;  3ZN5 A;  1J58 A;  1LCL A;  2A1X A;  4RYD A;  5I8Y A;  3MLK A;  4Q1R A;  1IG3 A;  4I09 A;  4CCE A;  2K0G A;  4HK9 A;  1YUD A;  3SNM A;  1X9P A;  4ERO A;  4PBP A;  4IEO A;  1P8J A;  2F4P A;  4C91 A;  1J83 A;  3WDT A;  2YYO A;  2ZMK A;  3I2H A;  2BRT A;  3J8F 3;  3NL1 A;  4PT6 A;  4YVS A;  3ZXD A;  1YNA A;  2BBV A;  4R9D A;  2DCJ A;  2TBV A;  2XON A;  4IV3 B;  2EIE A;  5FZK A;  1IPK A;  1YXW A;  1PO1 2;  2GMP A;  3H8R A;  4QX1 A;  4H14 A;  5KC6 A;  5JOZ A;  4EE2 A;  2RR1 2;  5JZG A;  2WWU A;  1CAW B;  4K6B A;  3CJI A;  4XJU A;  4DRR A;  2HWE 1;  1SDD B;  4YZ4 A;  3JUU A;  1LU2 A;  2QQJ A;  4MZU A;  2JDU A;  3ZFE B;  3LZZ A;  4AFM A;  1QF3 A;  4FOW A;  1NLQ A;  1QQP 1;  1QWR A;  5FZI A;  2Y6J A;  1W8O A;  1AJO A;  2JEM A;  4IL7 A;  1RUE 2;  3EXU A;  4LTA A;  4S2F A;  3PTR B;  4XHX A;  3ZX7 A;  5A3L A;  2Y64 A;  4YPJ A;  2ADD A;  2CNA A;  2J1S A;  5FXW A;  1BVP 1;  3UL2 A;  1H1M A;  5A7W B;  1S0B A;  1OI6 A;  3VDD B;  2VNG A;  4ASK A;  5KXE A;  4MGT A;  4C0B A;  2RS1 1;  1VMH A;  1V6O A;  1RHI 3;  5F32 A;  5DAB A;  3AMP A;  5EZW A;  3RFR A;  3CDZ B;  3ECQ A;  5LY1 A;  3MIF A;  4O7X A;  4RFT 0;  4EZ4 A;  5JSR A;  1CES A;  2ARB A;  1POV 0;  2WZ8 A;  1DYP A;  4XJW A;  1EPZ A;  5FYS A;  3UJQ A;  3WF2 A;  2GC0 A;  4CDQ C;  3TEY A;  3P3P A;  5GJ6 A;  3O0X A;  3JZV A;  3PUR A;  4RN5 A;  3PU3 A;  2E31 A;  3FC0 A;  1AYM 2;  1MVQ A;  5EP9 A;  4UBH A;  1R1A 3;  1G9C A;  3SH5 A;  5HCH A;  1O3T A;  1UF2 C;  2ZHM A;  3ES1 A;  1GP6 A;  4NOT A;  5EWS A;  2DCK A;  3ZXL A;  2A71 A;  1Y4W A;  1VLN A;  2A6Y A;  4MGQ A;  2ADE A;  1XU2 A;  1UIJ A;  4QT6 A;  1YO8 A;  4PJY A;  2TUN A;  4RQP B;  3T1L A;  2QE3 A;  3WR0 A;  4ZKT B;  5JZG C;  1VBC 1;  1PK6 B;  2P5B A;  1SFP A;  3PJQ A;  2YG0 A;  2EXK A;  2H0B A;  3D0J A;  1JYT A;  1EUT A;  4XUP A;  2XVG A;  4AI0 A;  5IAT A;  1JBC A;  1POQ A;  4IUG A;  4K20 A;  1Q43 A;  5FZ8 A;  1KDK A;  4WZC A;  4COW A;  4BM8 A;  3LWC A;  2R1D A;  1RUO A;  4FP2 A;  1GZT A;  2VTX J;  4B29 A;  4NHM A;  3J8F 1;  3OCP A;  2EIG A;  4I0W B;  5D1I A;  2A75 A;  2I2S A;  1LU1 A;  2BVB A;  5GLT A;  4B7E A;  2JD4 A;  4FQ4 A;  4MXW B;  4CVU A;  3H9A A;  1CQ9 A;  3NAP C;  4XZP A;  5F39 A;  3U07 A;  1QGL A;  4L99 A;  4XF0 A;  1BLZ A;  3QCW A;  3AZW A;  1OF4 A;  3G7D A;  5C9A B;  3TEZ A;  1V6L A;  2BGP A;  1FNY A;  2VZS A;  4H7L A;  4ATE A;  1JYW A;  4MG2 A;  3B7M A;  2LW8 A;  2E26 A;  3AXE A;  1HXS 3;  1QJX 3;  2ZZJ A;  2B7Y A;  3LQC A;  3T1M A;  2O14 A;  3MIB A;  4IXL A;  1FAY A;  5FK7 A;  4CCC A;  1S0I A;  3HBZ A;  3ZFE A;  1DHK B;  1ZZB A;  3RWN A;  4QX7 A;  2P3J A;  1URX A;  3BTA A;  5LBF A;  2RDQ A;  3HR9 A;  4NRP A;  2R32 A;  5HXV A;  4QQO A;  1PGW 2;  4FOY A;  2GC2 A;  3UGG A;  4NUB A;  5FCC A;  4CDQ A;  1XE7 A;  1POV 1;  1VBD 1;  1WCD J;  1CJD A;  4QXB A;  2VZQ A;  3DXT A;  3VDD C;  2Y26 A;  4LUK A;  1COV 2;  3JBG 3;  5FO8 B;  3RRD A;  1RIN A;  1TNF A;  4QDR A;  4Y33 A;  5FMB A;  2XLG A;  1NOV A;  2O8Q A;  4N53 A;  1AL2 2;  2D6L X;  4Q4W 1;  2Q5T A;  2IVJ A;  2ZEZ A;  1MZ6 A;  3RWK X;  4XIK A;  3NAP A;  3DEC A;  1C28 A;  1VBE 3;  4IV3 C;  1YC6 1;  3M1H A;  1XBF A;  2DFC A;  5CG9 A;  4Q2F A;  1KGY A;  1XC6 A;  3C7E A;  1RJ7 A;  3NV1 A;  3A0N A;  3VD3 A;  5K8S A;  2DWR A;  4D6Q A;  5FBJ A;  2ZGU A;  5BPX A;  4XTM A;  2Y38 A;  3MIH A;  1QNW A;  2DU1 A;  1D2Q A;  1RUE 1;  4WZF A;  2K9Z A;  1VRH 1;  1JZ2 A;  2DCZ A;  1L7R A;  1LOA A;  3V0A B;  1OXC A;  2A3W A;  1HIX A;  1W8N A;  1YCI A;  4Z2A A;  3NNJ A;  4PI0 A;  4HLT A;  4TYS A;  3VHO A;  2B45 X;  4IV1 A;  2ZGT A;  5IJR A;  5FZH A;  2ARX A;  2V5Y A;  3BU7 A;  3MPB A;  4PDW C;  3VKF C;  4AVC A;  3LSE A;  2VOW A;  1GR3 A;  4BK5 A;  4QWN A;  5T3N A;  3Q9O A;  2C0Z A;  3BOD A;  5FLJ A;  3TNQ A;  1ODM A;  4LIT A;  2HWC 3;  4FOV A;  3ZYJ B;  3AZX A;  1ZBA 2;  5E89 A;  3A7Q A;  4Y4Y A;  2NPI A;  5T5P A;  4CP0 A;  2VVF A;  1F4H A;  4D6R A;  2VXR A;  4XQ4 A;  1WME A;  2VU9 A;  3K4Z A;  3WG4 A;  3K46 A;  4I0B A;  3AMH A;  4LMF A;  4HKL A;  4HET A;  3IBM A;  1W9W A;  2B9V A;  1X33 A;  3N7M A;  4QB6 A;  1UXX X;  3UNP A;  1JUH A;  4IEV A;  4AHZ A;  4IE7 A;  4KU7 A;  2JD9 A;  3TN9 3;  1DYK A;  1MS3 A;  4FPJ A;  4YVW B;  5FY7 A;  4AI1 A;  4CP1 A;  1S0J A;  1UL9 A;  4XOG A;  1QXP A;  1W0P A;  3R4S A;  5FFO C;  4CDX C;  4EWE A;  3MLL A;  1GNH A;  2BOI A;  4EN7 B;  4X6Q B;  2WDB A;  5ACA 3;  3MO4 A;  3DV8 A;  5FO9 B;  3OBA A;  4AI9 A;  1HRV 2;  3ZSJ A;  1ULG A;  2YFU A;  1TME 3;  2XGX A;  1JU3 A;  4O65 A;  2Q30 A;  3G6J B;  3NJX A;  4Q4V 3;  5E16 A;  2WAO A;  1G86 A;  2A6Z A;  3VD4 A;  3MGU A;  5GLW A;  4OQ8 A;  3WDU A;  1AYN 2;  4YYO A;  4GWN A;  5FQ0 B;  4AHX A;  1UZY A;  3VD9 A;  4CU7 A;  4XQW A;  1DQ2 A;  4HN1 A;  3J7L A;  1E5R A;  3BPS A;  3FMG A;  5KHJ A;  2R06 2;  4BJ0 A;  2HLE A;  3POJ A;  5APA A;  3HT1 A;  5C8C C;  2QVS B;  4PLM A;  2VW1 A;  4Y5Z 0;  4O9E A;  5C7G A;  1UNB A;  3WW1 A;  4A6S A;  2VTX A;  3DYM A;  1NCQ A;  5D8A B;  4EWD A;  2QZ3 A;  4TTG A;  2OA2 A;  1MQT C;  1US2 A;  4JDN A;  5ERL A;  4XZU G;  1ZBE 2;  1FYU A;  3J7M A;  3W5M A;  4BXF A;  3EHK A;  3U78 A;  4XF1 A;  3J7H A;  2YRO A;  3GNE A;  3D5O A;  4A7Z A;  5H9R A;  4MHR A;  5IFP A;  5LK7 B;  2ORX A;  3KT4 A;  1OT5 A;  1QJE A;  2VMF A;  4IEP A;  3HNB M;  4U36 A;  5CVR A;  3LIH A;  3FN9 A;  1DGW A;  3MID A;  4E4H A;  1ULO A;  1W6N B;  1DFQ A;  1YIF A;  4R9A A;  3RS6 A;  5A33 B;  5AC9 2;  2RDR A;  4M4R A;  3SH4 A;  4AHY A;  1VMF A;  1MPX A;  4FCA A;  4ZU7 A;  3ILF A;  5CB7 A;  3OG2 A;  2ZX1 A;  2Y6K A;  1O3R A;  4XXP A;  1JYN A;  1JOP A;  4P9L A;  1KXG A;  1UIK A;  4CXW A;  4DUW A;  4OHZ A;  1Z0H A;  1NE4 A;  1DGR A;  4YFW A;  4BXS V;  3OUJ A;  2YXS A;  1VR3 A;  3C7O A;  3OJB A;  2PTM A;  1R1Z A;  3GHM A;  2PAE A;  4RD7 A;  4FXK B;  2BPA 2;  4UAP A;  2AZ5 A;  2VZO A;  1X82 A;  1I5Z A;  2WWS A;  2OT7 A;  1LHW A;  3B69 A;  4SBV A;  3D6E A;  4DY3 A;  5IHR A;  1LUL A;  2GZW A;  3ZXF A;  2P4E A;  5JIA A;  2VMC A;  4A3X A;  2B5H A;  4NVP A;  5LY2 A;  1R09 3;  3UT0 A;  2RS3 1;  4A7Y A;  5LEK A;  2GN7 A;  4UFH A;  5EYX A;  1W8Z A;  2HWF 3;  3WW2 A;  2H0V A;  4ZY9 A;  5FO7 B;  1HJF A;  3QAC A;  4Y5T A;  1W0O A;  2DV9 A;  2R04 3;  4QQ2 A;  2VBD A;  1BMV 2;  4FI9 A;  2QQP A;  1ZBA 3;  1UY2 A;  3PIJ A;  4CDU B;  1YI7 A;  2D40 A;  3ZFG C;  3WHU A;  2IXC A;  5K0U A;  4ITC A;  5FZF A;  5KC5 A;  3BKZ A;  4LUL A;  3KF5 A;  4MHU A;  3T2O A;  1DQ0 A;  4OI4 A;  2NQY A;  4QHO A;  1RUJ 2;  4YZ3 A;  2ZX2 A;  3ON7 A;  4E9K A;  4PLO A;  4ZZ8 A;  1GYK A;  4LK7 A;  4UT5 A;  3H1M A;  5A32 A;  2Q1F A;  1XND A;  2FCV A;  4QB2 A;  4QGM A;  4B8E A;  2V4A A;  4AL9 A;  1Y9Q A;  4OHV A;  2PXJ A;  1XYN A;  1CAX B;  3KV5 A;  4K8F A;  5EXO A;  2W52 A;  4MH0 E;  2G1M A;  4LOT A;  4WVW A;  1HLC A;  2FCT A;  4MUV A;  4XUO A;  4XUN A;  4COV A;  3CIH A;  1TQ5 A;  1WMD A;  1VBC 2;  3NV4 A;  3CLP A;  1JOD A;  1RB8 G;  1H6Y A;  5H9Q A;  3BOW A;  2ZA9 A;  2G9G A;  1FPN 1;  4TLG A;  1PVX A;  1SHW B;  5I0T A;  2XML A;  1QJY 1;  5LA1 A;  5F9T A;  1YFY A;  3HVD A;  4AGR A;  3WHT A;  2HWB 1;  1FMD 2;  3KV6 A;  3RMX A;  4Y4R A;  1UYP A;  1RUF 3;  2VOT A;  3NRU A;  4L97 A;  3WQ0 A;  1HB3 A;  1AJK A;  5ACA 2;  5FP9 A;  1N3O A;  1VRH 3;  3GZE A;  2RVA A;  5EIY B;  4ORF A;  2HWF 1;  3ATG A;  4P08 A;  1Y9G A;  1QJU 3;  4LUM A;  1OD3 A;  2WS9 2;  2BBA A;  1HRI 3;  1R09 1;  5IAX A;  2CGN A;  4Q4W 2;  4FPL A;  2KM2 A;  5CA6 A;  3GDB A;  4AED B;  3M3Q A;  2ZX3 A;  1GWL A;  2WII B;  1NY7 1;  2DVF A;  1F5F A;  1RXG A;  3FBY A;  1SLT A;  3IPV A;  2FQP A;  4NRQ A;  5DAX A;  4ES9 A;  3ASI A;  4B4P A;  1H2M A;  2RJ2 A;  3PLQ A;  3OGJ A;  2JG8 A;  2BP6 A;  2GC3 A;  4AEK A;  3AKT A;  4O61 A;  1Q8S A;  1JYC A;  3FL7 A;  4CUC A;  1MS1 A;  1SLL A;  1LED A;  2GH8 A;  1S1A A;  1S4C A;  5LAT A;  3QOP A;  4UXA A;  3DPR C;  1V6N A;  1W3V A;  1UKR A;  1CPM A;  1RC6 A;  4TWT A;  2JG8 B;  4YG6 A;  2J1E A;  4QU1 A;  4ARY A;  5JOW A;  3ZXG A;  1STM A;  3B9I A;  2O8O A;  1RUC 2;  1PX3 A;  2R16 A;  4LO7 A;  1E5S A;  3U4X A;  2IXH A;  1Z7S 2;  3EJK A;  2E9Q A;  1DGR N;  1GLH A;  4QPY A;  1CX1 A;  5F3G A;  4ONU A;  2YMZ A;  3SKV A;  3JD7 1;  5BXX A;  2DYC A;  4RS5 A;  1SDW A;  1ZBA 1;  3GCW A;  3WV6 A;  1MS4 A;  2B42 B;  2VXJ A;  1CZT A;  4B1L A;  3S6P A;  2GMM A;  3EYP A;  3RSJ A;  2Y34 A;  1NKG A;  5F1R A;  5A7O A;  3CZU A;  4BCU A;  2WNO A;  1OLR A;  4GWJ A;  3V65 A;  1A8M A;  4CTE A;  1Z7S 3;  2CV6 A;  4RSU A;  5T55 A;  3WNP A;  4YGD A;  4NN0 A;  1WW6 A;  2RG4 A;  2VY0 A;  3PVO A;  4TLF A;  5IWF A;  4IEU A;  4RS5 B;  3TAY A;  3H8X A;  3E5U A;  4UF0 A;  2P1B A;  4PCR A;  4UFI A;  1ZVF A;  4M3C F;  2ORZ A;  1PX4 A;  2QKD A;  3ZIX A;  4Q0S A;  3T30 A;  4FAG A;  1QOO A;  5FYC A;  2HWC 2;  1H30 A;  4DXT A;  1UZ0 A;  4GB3 1;  4AGV A;  3I59 A;  2A6X A;  3AM2 A;  1IOA A;  4YVS B;  3AZY A;  3UKT A;  3NST A;  1EP0 A;  1IQD C;  1W99 A;  3RJR A;  1JI6 A;  3B00 A;  3U37 A;  3R4D B;  3KSC A;  1TZO A;  3N7J A;  3TWI A;  3VBO C;  3M3I A;  2ARE A;  4EWA A;  3TOJ A;  5FKC A;  5IK7 A;  1MZF A;  2P3I A;  5FZO A;  2VUJ A;  4CU9 A;  1A8D A;  1W9S A;  4AWD A;  1YQ8 A;  1ENR A;  3ZOI A;  4KU8 A;  5A32 B;  1O4Z A;  2JEC A;  2RR1 3;  4B4Q A;  2BWA A;  2RM2 2;  2YB7 A;  4K3U A;  4AED C;  1CJP A;  1CAX A;  2D97 A;  1IG0 A;  3AKS A;  2OPW A;  4AGG A;  4I30 A;  3C7H A;  3ZKU A;  1AX2 A;  3I97 A;  3LEG A;  3N9N A;  5LCW L;  1DLC A;  3BU0 A;  4NJ4 A;  1R08 3;  3KF3 A;  4AFD A;  1PIV 1;  2YUE A;  2WZR 2;  4Q8K A;  5DZF A;  2WNV C;  4HKO A;  2J1R A;  5IK4 A;  3H0O A;  3IZO A;  2W47 A;  1UD1 A;  3I8T A;  1UXZ A;  4OI2 A;  4FOQ A;  4E8C A;  5A7P A;  5C5T A;  1G9A A;  5CIR A;  2BEO A;  4E2G A;  3AJY A;  1OKQ A;  3M70 A;  5LAS A;  5L9V A;  3NNG A;  2WYS A;  3POW A;  4IGQ A;  1RUH 3;  2JB4 A;  2PHF A;  1HB1 A;  3AKR A;  4NAM A;  3W20 A;  3WDV A;  2VBP A;  1D4M 2;  3KS7 A;  5IVB A;  4EYU A;  2R06 1;  3VBH A;  5FOJ B;  4DUX A;  1OBN A;  5F5Q A;  3RMY A;  4OHY A;  2I07 B;  2QUO A;  2CL2 A;  4QDS A;  5FZB A;  5L7O A;  3THT A;  3VLB B;  1LHN A;  4E27 A;  3LB9 A;  3AMQ A;  4ASL A;  2HBU A;  4BYY A;  1ZZ6 A;  1YQ2 A;  4Q26 A;  2JDM A;  1T6B X;  5FP7 A;  4K40 A;  5FMC A;  5FYY A;  4FFF A;  1FAT A;  4IEQ A;  2FDG A;  3MIC A;  4J1X A;  1D0G A;  3E97 A;  1WLD A;  3LEI A;  3ZFF A;  1ZBE 1;  3O1R A;  2YPJ A;  4Y20 A;  5HCB A;  1WA6 X;  3S7I A;  5IVE A;  4FVV A;  2VD7 A;  4RHV 3;  2QCS B;  1JHN A;  1RVF 2;  2VVD A;  4PDW B;  5LA0 A;  1YYN A;  2C1F A;  2HWE 3;  2ZXQ A;  3VDD A;  3GHN A;  3K48 A;  1H8T B;  4Q4W 3;  3DN7 A;  5FUI A;  4TZD A;  1PM4 A;  1WMF A;  4GH4 B;  1NY7 2;  2WLP A;  1AR6 1;  5KWR A;  2BER A;  3LOI A;  2RS5 3;  2WAB A;  3MIG A;  1OA4 A;  2D3P A;  2PQQ A;  1O5U A;  4Z07 A;  3BYW A;  2JDA A;  3WG1 A;  2GC1 A;  4C1X A;  4CPB A;  5C8W A;  2DUR A;  2CAU A;  1ZRF A;  1C8M 1;  1WWY A;  2Q8O A;  1HX6 A;  1UZW A;  1W6O B;  3ACF A;  4RGA A;  2FZ2 A;  3SCH A;  2RDN A;  1WBL A;  1RXF A;  2ENR A;  1XSQ A;  4ZON A;  4CPB D;  2PHU A;  4CEW C;  1GWK A;  2VQ0 A;  4I3P A;  2V72 A;  3NNF A;  2AEZ A;  1F4A A;  4LKE A;  2DVA A;  5L73 A;  3HNM A;  5HV4 A;  1A78 A;  4XJZ A;  5A3N A;  1BBT 3;  3LF7 A;  3JBG 1;  4Q4X 3;  4MV2 A;  2W92 A;  4FT8 A;  4GMP 0;  3IDA A;  5FXZ A;  1F2N A;  1KFX L;  4D7Y A;  1PNG A;  5A6Z A;  4P9I A;  1IS3 A;  3C7F A;  4CDW C;  1D0H A;  4C1W A;  5FLI A;  4UFM A;  3DYP A;  1EV1 1;  5F3C A;  4NR1 A;  4NMI A;  3FFQ A;  4EN6 B;  3ZMO A;  5JMO A;  2JDK A;  1AL2 3;  2VUC A;  1X36 A;  2RMU 2;  3PVB B;  3DKW A;  3GBW A;  4LO6 B;  1W39 A;  3I59 B;  2ZHK A;  1F15 A;  1BQP A;  2RE9 A;  4QPW A;  4BDV B;  1CIW A;  3CQO A;  1MQT A;  2RM2 1;  2BFU S;  3CMG A;  1PVC 3;  1SMV A;  5T52 A;  4AR2 A;  2PHL A;  4UBG A;  4CEY A;  1W2U A;  4F3J A;  3K51 A;  1E5I A;  1VPH A;  1D4M 1;  1OHF A;  4NAO A;  5FP4 A;  5FUN A;  3WQ7 A;  4CCJ A;  1JXN A;  2VZR A;  5DAV A;  1W9T A;  2DCY A;  2ZMN A;  4D69 A;  2VCC A;  4P14 A;  2HYX A;  5C3R A;  1D2S A;  1ST8 A;  5C8C A;  3SC7 X;  5D8A C;  3KQ4 B;  3BI3 A;  4LT5 A;  3WW3 A;  3AVR A;  3VZL A;  2QZ2 A;  5LZ6 A;  3OBR A;  1ND2 B;  4IV3 A;  5C9A C;  4BHP A;  4KBB A;  4WM7 C;  2HWF 2;  3E6B A;  4CEY C;  2VUA A;  4BIF A;  1PM7 A;  1AL0 G;  4Y5S A;  2EAL A;  1PO1 3;  4RS5 C;  1CAW A;  5JSP A;  2VZT A;  4FFH A;  3QD6 A;  3T2Q A;  2JE7 A;  3IDE A;  4YSF A;  3SQO A;  3I2D A;  5K4L A;  4NHX A;  2XLA A;  3NJZ A;  2RHP A;  1WLW A;  4XPV A;  4BIS A;  4LNV A;  1CGP A;  4M4P A;  2PQS A;  5A3P A;  3VL9 A;  1FPN 2;  1QU0 A;  1MEC 1;  5DDJ 3;  1W8F A;  4RGK A;  4XC9 A;  3PL0 A;  1ZRR A;  3FHI B;  5A7W A;  3U0Z A;  1ASJ 1;  1OQ1 A;  5CFC B;  3CBN A;  4M01 A;  2VPV A;  2OXB A;  4CDX A;  3MZH A;  5FRE A;  4IW3 A;  2YGL A;  4LKS A;  4R4X A;  2ES3 A;  3I54 A;  5FZ9 A;  1R08 2;  1PMJ X;  3H3Z A;  1YQ5 A;  2WZR 1;  2OS2 A;  1RUD 1;  4MGZ E;  1RUD 3;  3GAL A;  4HFS A;  2PHW A;  3VBH B;  2DBN A;  2FDJ A;  3MF6 A;  3OPZ A;  4MAD A;  3OD4 A;  3H1Y A;  1Z7S 1;  3DPR B;  2R06 3;  2Y8K A;  1TE1 B;  2J22 A;  4Q29 A;  1RHI 1;  4QDQ A;  3B01 A;  1AXZ A;  3RVH A;  2QQL A;  4P5H A;  2F17 A;  1GQH A;  1K12 A;  4HKW A;  3WF0 A;  2FZ1 A;  2JDY A;  3ETQ A;  3EBR A;  4KG8 A;  1LOF A;  2HWE 2;  2J1T A;  2X53 S;  4CUB A;  1GOF A;  2CWM A;  3BIE A;  4QXH A;  2NLR A;  1UU6 A;  3OUI A;  4LHK A;  2W08 A;  1TMF 2;  4YNI A;  1U0A A;  5BNO B;  1F35 A;  4YW4 A;  1RED A;  2IXJ A;  2E7A A;  4FFG A;  5FY8 A;  1FXZ A;  1LES A;  5BV6 A;  1WUV A;  4GH4 A;  1UOJ A;  5C4W A;  4AOC A;  1OPO A;  1VBA 2;  3M3O A;  5T5O A;  3VHN A;  4LBK A;  2P37 A;  5FY1 A;  4LR4 A;  4AFA A;  5ANN A;  1Q8Q A;  1IS4 A;  2Q8D A;  1UKG A;  2UUR A;  4MET A;  1QKQ A;  3SIS A;  4AFB A;  2HEW F;  2XLF A;  4JGZ C;  5FPU A;  1W8U A;  4RR3 C;  4UFL A;  2J1A A;  1RUF 1;  1REE A;  3KCC A;  2RR1 1;  5AC9 3;  5C8C B;  2JKB A;  1PO1 1;  5G05 L;  4QX0 A;  4F7Z A;  3K3O A;  4HSJ A;  4YFZ A;  3SXW A;  1I5P A;  2KD7 A;  3AYA A;  3CU7 A;  3I3B A;  3P5B A;  4S2H A;  2YU2 A;  4B7K A;  3IDB B;  1Z78 A;  3WG3 A;  4A42 A;  3F2Z A;  5KHH A;  4XIL A;  1XE8 A;  4COZ A;  2NN8 A;  5BNP A;  2UYB A;  2X05 A;  2X8K A;  4DNY A;  3IN9 A;  4BWO A;  4ZZ5 A;  5HCF A;  3GJA A;  1IKP A;  3ZSL A;  2TEP A;  4DEQ A;  3LGR A;  1ND2 C;  1FOD 3;  1RUG 3;  2CAV A;  1SBD A;  2WFP A;  1FOD 1;  1RUG 1;  4KG0 A;  4DFS A;  4DO0 A;  3OY8 A;  3M7A A;  4W50 A;  3VBU B;  2JDZ A;  3SKJ E;  1H6X A;  2IXK A;  1ENS A;  1NX9 A;  1ZA7 A;  4N7U A;  3Q8C A;  1W6P A;  4YW2 A;  3PUI A;  2XHN A;  4H3W A;  3ACH A;  3UGF A;  5LB6 A;  4L2N A;  4YGE A;  1CAU A;  4QB1 A;  3AL5 A;  3V56 A;  1JN2 P;  4L92 A;  5JXG A;  1VBB 2;  1XNK A;  1LHV A;  4YGC A;  1YFW A;  3RNS A;  4P9W A;  5FIX A;  2C9K A;  1NAE A;  3JB8 A;  3RDI A;  4J25 A;  3MFC A;  1DG6 A;  2EXJ A;  2YBK A;  3AJZ A;  4RR3 B;  4FAH A;  2C24 A;  2PHT A;  2ZGP A;  2A3X A;  3BB6 A;  1MR5 A;  2X09 A;  5B2G B;  1MZ5 A;  5CKM A;  1QMJ A;  2XPJ A;  4FSJ A;  4OI0 A;  3KCY A;  2CGO A;  4RHV 1;  3POY A;  4KMQ A;  4BB3 A;  4YG0 A;  4GXL A;  3POI A;  1QJF A;  1MS9 A;  3WEZ A;  1IS6 A;  3L2H A;  2WJS A;  5BNN A;  5FK8 A;  1OF3 A;  1I3H A;  4OZO A;  5BNP C;  4DIN B;  3JU9 A;  1UQX A;  4RR3 A;  3WP3 A;  2Q1Z B;  5K7P A;  5JDB A;  4QD2 A;  2DDU A;  1CIY A;  3U4S A;  1C5I A;  1LR5 A;  3H7J A;  4AVA A;  1H2L A;  1TMF 1;  3SCG A;  2XDV A;  1WLT A;  4WM8 C;  3THD A;  1KFU L;  1UX6 A;  3W21 A;  3LDB A;  2ZGL A;  1NYW A;  2CHH A;  3POE A;  2W0X A;  1C57 A;  2P6C A;  2XHK A;  3CNA A;  5DXD A;  3LPG A;  5LW9 A;  2EAA A;  5L9R A;  3U11 A;  1PGS A;  1N1T A;  2BNM A;  2WNV B;  4JGZ A;  4ZHN A;  2VNV A;  4YW6 A;  5A6X A;  5FZM A;  1DCS A;  3BCW A;  3VUO A;  5FZL A;  1G9B A;  1RUI 3;  3APB A;  4PF1 A;  5FZ4 A;  4E2S A;  5L9B A;  2EXH A;  2A73 B;  3LIG A;  5F3E A;  5C4W C;  2C26 A;  4DS0 A;  2ZCW A;  2GP5 A;  1MS5 A;  4RQP A;  4QAW A;  1HKD A;  1KJR A;  4JGZ B;  4QMA A;  1C4R A;  1AUY A;  5L19 A;  3NW4 A;  5J48 A;  3D82 A;  5BNO C;  4R9B A;  3KCX A;  3TEW A;  1JUI A;  3R6S A;  4OZX A;  3NVC A;  1RUD 2;  2BTV C;  2SLI A;  2TNF A; 
#chains in the Genus database with same CATH homology
 2VUD A;  1W8F A;  1OVP A;  2VNV A;  1OUS A;  5A6X A;  1W8H A;  1OXC A;  2JDY A;  3DCQ A;  5A6Z A;  5A6Q A;  5A70 A;  2JDM A;  1OVS A;  2BOJ A;  2JDH A;  2JDP A;  1OUX A;  1UQX A;  2JDN A;  2JDK A;  2VUC A;  2BV4 A;  1GZT A;  4AOC A;  5D2A A;  1OUR A;  2JDU A;  4UT5 A;  2WRA A;  2CHH A;  2BOI A;  5A6Y A;  5HCH A;  2WR9 A;  3ZDV A;  4CE8 A;  1UZV A;  2BP6 A;  2XR4 A;  5A3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...