1QJX1

Human rhinovirus 16 coat protein in complex with antiviral compound win68934
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
285
structure length
285
Chain Sequence
NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN VP1
publication title Analysis of Three Structurally Related Antiviral Compounds in Complex with Human Rhinovirus 16
pubmed doi rcsb
molecule tags Virus
total genus 60
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qjx100
4N53A 1AR81 5JZGC 2BFUL 2WZR3 2R073 4IV3A 2QQPA 4GB33 5C9AA 5FMOL 4CDUB 1NCQC 2WS93 2RS11 1R1A1 2R061 1RUI1 1PGL1 1M06G 4CDXA 1PGW1 1VBE1 1AR61 1B35A 3DPRB 1R092 1F8VA 1BBT2 4QPIB 2ZAHA 1AUYA 5CFCC 4Q4X2 1ND2B 2MEV1 1QJZA 3VBHC 4CEYA 4Z92B 4NWVA 5C8CA 1HRI1 1H8TC 2WS91 4AEDA 5C4WA 3NAPA 1R093 1RUJ3 1BBT3 5A32A 3VBUB 1HRV2 1HX6A 4Q4X3 5BNNA 4Y5Z0 3DPRC 4CDXB 4N43A 4QPIC 3CJIB 2IZWA 1RUE2 2BPA2 4CEWB 1PIV1 1HRV3 1EV12 4CEYB 4N53C 3ZFEA 5BNOA 5C9AC 3ZFFB 3VBUC 1FMD2 1RUE3 1ZBA2 1RUF2 1QQP1 4IV1A 4CDQA 1EV13 4CDXC 1C8M2 1QJX2 1B35C 1AL22 1BEV1 1AL0G 5L7OB 2HWF1 1K5MA 4WM7B 1FMD3 1QJY1 4CEYC 1RUF3 1NA1A 5C8CC 1DDLA 2HWC2 3JB4C 1OOPA 1QJX3 1AL23 1CJDA 4AEDC 3ZFFC 1AYN3 5BNOB 1ZBE1 2RMU3 1POV0 5BNNC 2FZ1A 1E57A 1VBA2 1VRH2 5JZGB 4GMP3 1RUD2 1POV1 1RHI2 1RVF3 1VB4A 2PLV2 4N43C 2HWC3 5FMOS 1RMU3 1AR71 1X33A 2R043 1K5MB 4NWWA 4RS5B 1RUC3 5ABJA 5CFDA 2RR11 1NA1B 1AYN1 4WM8B 1VBA3 3TN91 1RUD3 1RHI3 2RM22 1ASJ2 2PLV3 2RMU1 2XPJA 1RUI2 4FTEA 2HWB1 1PVC2 5BNOC 5CFCB 1F2NA 5DDJ1 3VBHB 1HXS2 1Z7S2 1AR91 1WCDJ 4IV1C 4CDQC 1H8TB 1FPN2 2WFF1 4YVSB 3J8F1 2R041 4Q4W2 2RM23 1ASJ3 5A33B 3FBMA 1RUC1 2RS31 2ZZQA 1K5MC 3JD72 1FOD1 4RS5C 1HXS3 1OHFA 1NY71 1Z7S3 2RS52 1NA1C 1MEC1 4WM8C 1FPN3 4PDWA 1VBB1 1OOPC 3ZFGA 4Q4W3 1R082 2WZR1 2R071 5D8AA 4GB31 3JD73 1D4M2 1PO22 4N53B 2RS53 3JBG2 4IV3B 4YVSC 1RUH2 4CDWA 5GKAC 3VBSA 5C9AB 3VBOA 1PO12 2HWE2 1R083 1QJU2 1CD3G 5ABJC 1D4M3 5CFDC 4RHV2 1B35B 1PO23 1TMF2 1RUH3 4QPGA 5J98B 3VBFA 1EAH2 4JGYA 1PO13 1TME2 2HWE3 1RUG2 4JGZA 4RFT0 5D8AB 5C8CB 1R091 1RUJ1 1BBT1 1QJU3 1VBC2 4IV3C 1VBD2 4Q4X1 4RHV3 4AEDB 5K0UA 5C4WB 3NAPB 5BNPA 4Q4Y2 1MQTA 5A32B 1V9U2 1W39A 3VBOB 1EAH3 5BNNB 1TME3 1RUG3 1ZBE2 2XBO2 1VBC3 4N43B 4PDWC 1HRV1 1VBD3 2X5IA 3ZFGC 1C8NA 4RQPA 4Q4Y3 4BCUA 3VBFB 4Q4V2 1ZBA3 4JGYB 5D8AC 3VDDA 1C8M3 5AC92 1RUE1 3ZFEB 5C4WC 3NAPC 2XBO3 4CDWC 5ACA2 3VBOC 1EV11 5BNPB 1MQTB 1NCQA 2WLPA 4Q4V3 3LOBA 4IV1B 4CDQB 1COV2 4FSJA 1AYM2 2HWD2 1FMD1 1BMV2 5AC93 1RUF1 1AR82 4QPGC 4Y4YA 4GH4A 3VBFC 4JGYC 4YVWA 1QJX1 1AL21 4JGZC 3J8F2 2RS12 1R1A2 2R062 1VRH3 1COV3 3ZFEC 4GMP0 1OOPB 1GFF2 1PGL2 1AYM3 5K0UC 1PGW2 1VBE2 2TBVA 4CDUA 5BNPC 1AR62 1MQTC 4RR3A 1MEC2 1AR83 4GMP1 1RVF1 2HWC1 1HQNA 1RMU1 2RS13 1OPOA 1R1A3 2MEV2 2R063 3DPRA 1RUI3 1HRI2 1PVC3 2X5IC 2WS92 1NG0A 4RQPC 1AR63 1VBA1 1ND2A 1RUD1 1RHI1 4YVWB 2PLV1 5ABJB 5CFDB 3VDDC 1SMVA 2MEV3 5LK7B 1HRI3 3VBUA 4RR3B 2ZTNA 2VQ0A 2RM21 1ASJ1 3M8LA 1PVC1 3HAGA 1PIV2 1HXS1 1Z7S1 1RUJ2 3CJIA 4GH4C 1FPN1 4YVWC 1IHMA 4CEWA 4Q4W1 3JBG3 4PDWB 1ND3A 1QQP2 1PIV3 3JD71 3ZFGB 4EJRA 3ZFFA 4CDUC 4SBVA 2RS51 4RR3C 1BEV2 2HWF2 1RB8G 2FZ2A 1QJY2 1TMF3 1R081 4CDWB 3VBSB 1QQP3 1NCRA 1D4M1 5L7OA 1PO21 2Y26A 3VBRA 4WM7A 1ND2C 3JBG1 3IDEA 1BEV3 1RUH1 2HWF3 1PO11 2HWE1 1QJY3 5FOJB 1ND3B 3ZXAC 4LLFA 4QPGB 1V9U3 1QJU1 1VAKA 1NOVA 4RHV1 1TMF1 4JGZB 1AR72 5JZGA 1ZBE3 1EAH1 3VBSC 2GSYA 1TME1 3S6PA 5K0UB 1RUG1 2RR12 1AYN2 3CJIC 1A6CA 1NCRB 3TN92 1VBC1 1POV3 2RMU2 2BUKA 2GH8A 2HWB2 3VBRB 1VBD1 4CEWC 4FTSA 5DDJ2 4RS5A 1X36A 4Q4Y1 1V9U1 1AR73 4WM8A 1ZBA1 1AR92 1RVF2 1ND3C 2X5IB 1VB2A 5ACA3 2WFF2 4RQPB 5CFCA 1RMU2 2RR13 1C8M1 2BBVA 3TN93 2R042 3VBHA 2XBO1 2DF7A 2HWB3 1RUC2 2RS32 3JB8A 1H8TA 5DDJ3 3VDDB 1FOD2 2HWD3 1NY72 4YVSA 4Q4V1 1AR93 2BFUS 1NCRC 5A33A 2WFF3 1NCQB 5L7OC 1VBB2 2WWSA 3VBRC 5AC91 4WM7C 5J96B 3J8F3 5ACA1 4FTBA 2WZR2 2R072 2RS33 4GB32 4QPIA 1FOD3 1VBE3 1VRH1 1MEC3 1COV1 4GH4B 1VBB3 1AYM1 2HWD1 1BMV1
chains in the Genus database with same CATH superfamily
5GZCA 2QQNA 2W94A 2CGPA 2BFUL 2I2SA 4MXWB 2CHHA 1NX9A 3ILNA 3HWJA 2Z2SB 4CVUA 1SG3A 3TEYA 3TEWA 2QQPA 4YZ3A 3WG4A 3AZYA 1LKNA 5FZHA 4MX3A 5HCAA 4L92A 3HBZA 2VZTA 3FE5A 3WCRA 2WNVC 1Z78A 1QOSA 2I74A 1T2XA 2FD8A 3SITA 3LAGA 3FC0A 2C1FA 3M3OA 5JOWA 4XAEA 1NQDA 3MLKA 4QXHA 5IVYA 1JZ5A 1B35A 1H1AA 3FUQA 3GCWA 4WVMA 4XC9A 4XDPA 5FO7B 4QPIB 2ZAHA 5LBCA 2QCSB 2R0HA 3SMHA 1UF2C 3AX4A 4FPLA 2TUNA 1UY0A 3A22A 3T0DA 4META 4Z92B 2PHTA 2CTVA 2GAUA 4M4RA 1CZTA 4L2NA 1H8TC 3ZXEA 2WS91 5I0RA 2FCVA 3POBA 5LWBA 4N8MA 2HH9A 3NAPA 1BHGA 2YYOA 1R093 1RUJ3 5T52A 5A32A 4QM9A 1NLSA 4HONA 1CJPA 4Q4X3 2WA4A 1JUIA 4Y5Z0 1CN1A 5I0TA 4JX0A 3URFA 4XBQA 3VDBA 4QPIC 4B4RA 1FNZA 4HK8A 3AXEA 5FQ0A 2AACA 2VQTA 5KHHA 1IQAA 3KHCA 4P9LA 4KNCA 1UU4A 2BPA2 1M4WA 2BGPA 2E26A 1Z0HA 4YNIA 3SH5A 2YXSA 3HJRA 3RWNA 3BN6A 5E88A 5IVCA 5EPAA 3THCA 2R1DA 3T30A 4A3XA 4LK7A 4N53C 3HNYM 3H8RA 3BTAA 4LKDA 4NVPA 1ULGA 3FHQA 4OULA 2VZ3A 3DXUA 1O3RA 2VXRA 3H8XA 1ULDA 2OZ6A 4KQ7A 1FMD2 2KA3A 3BU7A 4A45A 4CYDA 5I8TA 4QX0A 3MW2A 1QQP1 5FZOA 3B7MA 3POEA 4PQ9A 5FJKA 1AL22 1OVPA 2RDNA 4PI0A 4BH9A 1LTEA 3BOPA 2FBEA 3AVSA 1SFPA 3R0RA 3M3IA 2CGNA 4KGGA 4BQWA 3WNNA 3BKZA 4Y33A 2ARXA 5JSPA 1ZVFA 3KGLA 2R32A 1WWYA 1ENSA 4WM7B 3NJVA 2FDGA 3H50A 4YM0A 3I2IA 5H9QA 1G9FA 1DFQA 3WF4A 1JZ8A 3CEWA 4BK4A 4E4ZA 4PIYA 4AW7A 2BGOA 4JHTA 1DDLA 2HWC2 4LUKA 1D0GA 4LE3A 4OMDA 2O8OA 1CJDA 4MHRA 3MO4A 4YARA 3WR0A 5BNOB 1TNRA 1ZBE1 5DAVA 3VB9A 2LS6A 2VZOA 1JYVA 3C7OA 1NXD1 2XJTA 1UL9A 3EO6A 2YZ4A 5JZGB 2VBPA 4YPJA 1H1MA 3H7JA 5F5IA 5IYYA 1GNYA 1RUD2 2VUJA 1RVF3 4AFBA 2B45X 1BVP1 1J1TA 5JOXA 3IB3A 3ACLA 5A1FA 1MZFA 3T2OA 1W9WA 1W9TA 4M0HA 1K5MB 4RS5B 4Z8BA 3QH6A 5CKQA 3BB6A 1O4TA 1SPPB 3ZYBA 5FR3A 1LB2A 1Y4WA 1VBA3 4WM8B 3TAYA 1F5JA 3HBKA 2RMU1 1ASJ2 3BODA 4NPLA 4CCNA 4DEVA 4Y20B 5BNOC 1F2NA 5DDJ1 2GMMA 3IWZA 4Y3OA 4AR2A 4FOYA 4DRRA 2B5HA 4RGGA 3ST7A 1WMFA 4XDQA 1L3JA 3ZYGA 4IV1C 4JDOA 3ZMOA 4COYA 4LIUA 1W2TA 1K45A 1S1AA 2D93A 2EXJA 3WDUA 2R041 3NNGA 5A3PA 2RM23 5A33B 1W8FA 1IZ3A 4OLLA 4R9CA 1RUC1 4EWAA 1F35A 1OKOA 1WMDA 1K5MC 4UFHA 1S0EA 3JD72 4OUEA 4RS5C 2GH2A 1HXS3 4IW3A 4ES8A 4EROA 1LOCA 4R9BA 4WM8C 4R8HA 3THTA 3O1TA 3RYPA 5AVPA 1L7QA 1VBB1 4KU7A 4Y1XA 1OOPC 1PMIA 3GBGA 4FPCA 4XIKA 5GM0A 3UYJA 3ZFGA 5LK5A 2V5YA 3KWVA 2DCYA 3AVRA 3DYPA 3ITQA 3T0BA 4A7KA 3H3ZA 4QKFA 4B7KA 2JDYA 1IS6A 3I2KA 2CY6A 2Z42A 2VCBA 3ETPA 4FFHA 4W6WA 1KITA 1Q56A 1WD4A 2OZJA 2VULA 1IQDC 2FDJA 4QX3A 1REFA 2AZ5A 3AKQA 2ZMNA 3E1F1 1Y9GA 1GLHA 1RUH2 3OGSA 3FHIB 4M00A 5C9AB 3NL1A 3EBRA 5F6LB 5T3NA 5D1IA 3H3UA 5FYYA 1DF0A 1YJLA 4YSFA 2EXIA 1R083 2W2IA 1CZVA 4FPKA 2JDNA 4YW6A 5FP8A 1SCRA 4Y4RA 1HB1A 4FPHA 5FK7A 2A5ZA 1D4M3 1PM4A 2E32A 3HT2A 2X10A 3PVNA 2R6QA 3LA7A 4HBNA 4I0WB 1KRIA 3KB5A 2JJ6A 5CZKA 1VLNA 4XOGA 3M7AA 4ATEA 1IKQA 2JDUA 4U2AA 4JGYA 4N7IA 2RHPA 1JN2P 1PO13 2V4VA 4FPYA 5FKCA 4XZPA 2D6PA 2Q4SA 5C3SA 4ES9A 5D8AB 3SCHA 2VPVA 1BBT1 3WUCA 4URTA 2UY8A 2JENA 1VBC2 3LEIA 4LJHA 3ACGA 3O0WA 3KM5A 1VBD2 4D6QA 3POFA 1U5ZA 3PDQA 2C9AA 4AEDB 2JX9A 3AZZA 3BPZA 3NV3A 4HG6B 3VHOA 5LY1A 1SLBA 4R9AA 3ZLIA 4FOVA 3E5XA 4XJ8A 1BVVA 2VVEA 1EAH3 4M4PA 1JZ2A 4DB5A 1CAWA 2CSGA 3NW4A 3X29B 2HYKA 1HQWA 3I8TA 1V6NA 4P9JA 2JG8A 5FMCA 1OH3A 3G6JB 2GU9A 3KVAA 2XBO2 3U10A 2W68A 1OA3A 3TEXA 2IXHA 5FY4A 1OUXA 1TG7A 1HRV1 1GNHA 4ZXEA 3VLBB 3ZO0B 4CP9A 2YFZA 1WGPA 3FZ3A 4Q4Y3 3I3MA 4M01A 3POGA 1ZBA3 2GMEA 1BQPA 2TNFA 4OCTA 1W90A 3BVCA 4PLNA 5D8AC 4YZ5A 1GSLA 2D6MA 4DS0A 2GC3A 3NNLA 5A1AA 4AK3A 3NMBA 1MS3A 3OG2A 2VMCA 2D98A 1RUE1 2PHWA 3MI8A 2ZGRA 4IEZA 3VGIA 2EXKA 5K9YA 1L7LA 2N7GA 4O65A 4A7ZA 1SLLA 5DQ0A 5JIUA 4NAOA 1LHWA 2ADDA 2VZSA 3I2HA 1NCQA 3OOXA 3VD7A 5FUNA 5FYZA 4KL1A 3RRDA 2DTYA 2GNBA 4LEJA 1COV2 3E6BA 3TNQA 2PMWB 4KH9A 1GP4A 4D8MA 4WZFA 2QQLA 4FSJA 5M0TA 3AYCA 2XR4A 2Y64A 4JCKA 3ZYPA 2QTWB 1GP5A 5JOZA 1DGRA 2DURA 1YHFA 3WF3A 5GZDA 4YW1A 2WINB 4MGIE 3BCWA 4QQPA 4YVWA 3V0BA 1HB3A 1Q8SA 3I4IA 4IUGA 2VW2A 4JGZC 2RS12 1Q3EA 3WF1A 2R062 2H0VA 2DVGA 4AGGA 3HMYA 1W6MA 4GMP0 3SEPA 4YWAA 3VUOA 1O8SA 1GFF2 3PMEA 1RXGA 4CDUA 1W2UA 2FQPA 5GLVA 4AYUA 2BRTA 1W06A 1PMHX 4GMP1 4TWTA 4JHZA 4EYUA 4M3CB 2JE9A 4XEZA 2E51A 1W3VA 1V6LA 2XJQA 5CISA 2OW4A 2QFEA 3MIBA 3DPRA 3BTYA 4JTOA 3POIA 3M1HA 4NHXA 4QB2A 4D94A 3RZHA 4HMZA 1AJKA 1DGWX 4P5HA 1GKBA 2QBXA 3ACIA 1QXRA 4NHLA 4ONUA 3WLUA 4IERA 3AFGA 1ALYA 1GV9A 2VC9A 1RHI1 3D8CA 4QU1A 3RZLA 3CO2A 3ZXFA 3HVDA 4LNVA 1W2NA 4UAPA 4Y22B 5BPXA 3VDDC 3U4XA 2E33A 2WNOA 3C7EA 3DYMA 4Q26A 4AEJA 5A6YA 4FPOB 4QHZA 3H9AA 2VJXA 3K46A 2D5FA 4LLOA 1LGBA 3KGZA 5FZ0A 3I59A 5HXMA 2L9LA 2OUHA 4MH0E 3TNPB 4P9GA 2JG9A 4GWIA 3CBNA 1T6BX 3I7DA 5DABA 4RSUA 3ZXDA 2XVLA 1E5SA 3PTYA 1MZEA 4MG2A 1PVC1 1GZWA 5FP3A 1N47A 3E97A 3GZAA 4E4HA 1PIV2 2XJUA 4NRMA 1U12A 4EQVA 3CU7A 1Z7S1 5A3MA 1RUJ2 5J09A 5FPAA 3ES4A 4RYDA 1EUUA 2ORXA 1FPN1 2ZBJA 4W4ZA 2YROA 2VOWA 2KD7A 3POSA 3WW1A 1DZTA 2VU9A 4CP1A 3ZN5A 4QX1A 3CZUA 3KS7A 3JBG3 1S4CA 3FWEA 2W91A 4LBMA 4XURA 1ACCA 3QCWA 1XNKA 2IVIB 2BNNA 4OZXA 3GCXA 1AXZA 4PLMA 5JXGA 3AP4A 4XHXA 1GMMA 1XPWA 4LKFA 4NIDA 1MS9A 4L99A 4YRDA 4D69A 4Y1VA 1UXZA 1X7NA 1HJGA 1TMF3 3S7IA 1SZBA 1G6NA 2QNKA 3VBSB 4CPBA 1QQP3 1NCRA 4R4ZA 2VECA 2PAKA 1A8DA 2PHUA 5L7OA 1O4ZA 1XSQA 1Q8VA 4NIAA 3VBRA 2OX0A 5IAXA 1ND2C 3OD0A 4DNYA 1OPMA 3CQOA 4PHZA 3UESA 3WQ1A 1GQGA 3WNXA 1UOBA 2JDPA 3S0MA 2XHNA 4CCJA 4C91A 3ZXGA 3M3EA 4A6SA 2NPIA 2HWE1 2ZPXA 3JCIA 5FOJB 3SHRA 2Y0OA 4OQ8A 4GXLA 4QPGB 4NHMA 2J7MA 3J7HA 3OJBA 5CKNA 1JYIA 2J22A 2VVFA 1VAKA 1CR7A 3MYXA 1UPIA 1URXA 2JD9A 4RHV1 4C0HA 4S2DA 3SNMA 3DN7A 4O61A 3EQEA 3USUA 3C7GA 3KV6A 3SKVA 1RUNA 4XETA 3RNSA 1PM7A 1ZBE3 3ZIWA 2J1TA 4JQTA 3D4KA 3VBSC 3MHZA 3K3NA 5FPVA 3T1LA 4YGDA 3ZM8A 4OHZA 3VZJA 4LMFA 3KD4A 4B7EA 2BNMA 3OY8A 3B02A 1APNA 4DRVA 2R16A 2DTWA 2Y6LA 4LOTA 1SFYA 4ORFA 1ZRIA 2QQKA 3MICA 1LHNA 4XZUG 4CEWC 1SEFA 1YQ8A 3K77A 3QD6A 4JRAA 3POWA 2EIDA 3UJQA 3W21A 2F6BA 3BU0A 5FYMA 1JOPA 3KVBA 2DWRA 1CAVB 1RVF2 1YCIA 3AFKA 4QAWA 1W6PA 1OQDA 4LUMA 1VB2A 4GJZA 3VDCA 5CEHA 4RQPB 5C3PA 5CFCA 1AVBA 1LR5A 4XUQA 1A34A 4MZUA 4FBFA 4LK6A 2BBVA 1W6OA 4HT1T 1LEMA 3VBHA 1JZ4A 2FHRA 3BALA 2G1MA 2P17A 1UNBA 2WZ8A 1RC6A 2RS32 4GJYA 5DDJ3 2Z4FA 4BJ0A 2JDMA 1VIWB 4ARXA 1UYXA 3TRSB 4YVSA 3ES1A 4Q4V1 2SLIA 4P9XA 4UXAA 2EAAA 4E2SA 1IKPA 2AH2A 1SLTA 2W3JA 2WWSA 3VKFC 5KHJA 5AC91 5EXOA 1J83A 5LASA 3WDYA 3ZX7A 2E6VA 2PN5A 2WJSA 2P3JA 2ZA9A 2C24A 3MIDA 3SLIA 5LATA 2WZR2 4B1MA 2GZWA 2TEPA 5I93A 1H6XA 4YW4A 1VBE3 3AXDA 5A7NA 2WT1A 3DXTA 4CTEA 1VBB3 4X8NA 5H9PA 1HLCA 1AYM1 1ZM1A 2HWD1 3DUIA 4AI8A 3D0SA 4FFFA 2YHJA 1IPSA 2OPWA 1AR81 3W9AA 4XBLA 5C70A 3H3LA 3MEPA 5KC6A 3LSEA 4IV3A 4H3WA 1G8WA 2VOVA 1W6NA 4UFJA 4DXTA 5A3LA 5ISLA 3HN3A 4A41A 4QT6A 3HQRA 3OUIA 5EJ3A 1MVEA 3N7KA 5LA0A 1QGLA 1RUI1 2PHFA 2ZJCA 4B29A 1PGL1 1OKQA 4Y1YA 1IG0A 4CDXA 3KZ4C 1AR61 1ZRCA 2J1EA 3IDBB 3QLQA 2VE1A 2ZX3A 4HL0A 1CAUB 1AUYA 1LOFA 3L2HA 5F2WA 5JVVA 2O14A 4DMIA 1LESA 4MGTA 2NYYA 1CVNA 4GA9A 3RG0A 2A75A 1QJZA 5F6KA 5FZEA 5A70A 5FZLA 3B00A 3ZN6A 4NWVA 5C8CA 2NMNA 1OD5A 4NMIA 3A23A 4IE0A 4FFIA 5DG1A 5GALA 2YBKA 5IATA 3PVBB 3LEGA 4AXOA 2JB8A 1O4YA 1BBT3 1XQNA 2NN8A 2Z79A 4AVCA 5HV4A 3R4UA 3VBUB 2FDIA 4CCCA 1UCXA 5BNNA 4Z1VA 4BIOA 3OUHA 1MS4A 2VTFA 5JMOA 5FKBA 1QIQA 4EN6B 1XBFA 4CCOA 2UY9A 3H0OA 3CNAA 4N43A 4S2GA 2G4IA 1NAEA 4XW3A 1GOHA 4H7MA 2LTNA 4WVMB 4ASMB 3VV1A 3BTXA 3CJIB 4QPYA 2ID4A 1XNTA 3LFMA 2W52A 2JDZA 5FBZA 4LBQD 4MGKE 3FJSA 4CP2A 4QXKA 3WVJA 1HRV3 4TZDA 1EV12 3VKOA 2W9XA 2NQYA 4AVAA 2R30A 5SV5A 3ZFEA 5IK5A 1BJQA 1W0OA 4OZOA 5F32A 3ZFFB 2P6CA 3VBUC 4NHKA 1RUE3 2XL9A 1VAMA 2DVBA 1ZBA2 1RUF2 3PIGA 3OGVA 4BPZA 4IEQA 1OC1A 5A7WA 4CDQA 1YFXA 4K40A 4GWJA 1DYOA 1IS3A 1QJX2 1B35C 2CV6A 2J1AA 5F2SA 3QBQA 5L73A 2FDKA 3MIGA 1ODNA 2VZ1A 1AL0G 5I0UA 3INAA 3GHNA 5FQ0B 1GOGA 1UKGA 2HWF1 3IIIA 3OPTA 4UYBA 1LAJA 5IK7A 2BEOA 1LGCA 1QJY1 4MUVA 1EPZA 3LF7A 3IPVB 4J1XA 4I2OA 4XTPA 4A3ZA 1S2BA 3IDCB 4FXKB 2R7EB 2ZS6B 3ZSMA 3CHXA 1CQ9A 5JOYA 1PZ7A 4GWMA 2YV8A 3JB4C 4NJ4A 3UGGA 1NLRA 1UZ0A 1N1TA 3N36A 5TSWA 4NR1A 3ZFFC 1UYYA 3ZR6A 1AYN3 3WP6A 4PQQA 2VNOA 4I3GA 3ASIA 3VHPA 4LO6B 3SC7X 2V09A 3OGJA 4I30A 4DINB 4DUXA 4AEMA 1OMIA 5A7OA 2FZ1A 5F5CA 4CU7A 1AX2A 5FZOB 3WG1A 2D97A 2PFWA 3MBWA 4GMP3 1HW5A 1VB4A 2PLV2 3NKTA 4Q0VA 1XNBA 3F95A 1I1EA 4BU2A 3VD3A 4LOSA 3C8XA 5FMOS 3MLLA 2WNVB 3WT3A 1TNFA 1UAIA 2J1UA 3L9JT 4GKXA 1UMHA 4M0NA 2WNUA 3WUDA 2XKPA 4NWWA 3WP4A 3WINE 4GWNA 4AHYA 4BQ4A 4Y1ZA 5DPNA 5ABJA 5CFDA 2A6XA 4KG8A 1LOBA 4BXFA 4ZZ8A 3WZ1A 2BGCA 5KXEA 4W8JA 1RHI3 2EXHA 2A3XA 2HWB1 1JH5A 2VBBA 2CU5A 2YU2A 3THPA 3T08A 3J7MA 1UO9A 3D0JA 5LRSA 3ORJA 3VKMA 2XVKA 5FZAA 2Q1ZB 1AR91 2W08A 5GJ6A 4XQDA 1H8TB 2VQUA 4KWKA 4XFGA 4XCAA 3UK9A 3AP7A 2YMZA 1QU0A 3TYJA 2BDRA 2Y38A 4GIQA 1W2AX 3I3DA 2A6YA 1G7YA 4QGLA 4E9KA 3POJA 4Q4W2 4UT5A 3NVCA 2QUOA 4AVSA 5KXBA 2VUCA 4QKDA 4M3CE 3O0VA 1QOOA 2QVSB 5ANQA 4X8PA 4CCEA 4YM1A 2ZZQA 3MFCA 3UETA 4CU9A 2ZOEB 4UWDA 4M3CF 1Z7S3 5F3CA 1XNDA 1PVXA 2RDSA 2RS52 5GLUA 1MEC1 2DBIA 3RI9A 3QOPA 4NAMA 1FPN3 4PDWA 5LBFA 2AGSA 2Y6FA 2OS2A 2XHKA 1HIXA 1LNSA 3MFAA 2ERFA 4P9YA 2K9ZA 4LBOA 4LBJA 4I02A 5JAXA 2R071 3D82A 4BLIA 4GB31 5FZKA 2JDKA 1MPXA 3FN9A 4FT8A 4MGQA 1PO22 4L0PA 5LEJA 1S0GA 4N53B 4NO4A 3JBG2 4PCRA 1O91A 4CDWA 2WO1A 1XE8A 2WC2A 3OPWA 4FCAA 3VBOA 1YJKA 3PJYA 3FUOA 3ILFA 3ZXLA 2QZ3A 3GBWA 2X53S 1CAXA 3HR9A 2Y34A 1CX1A 2B39A 1I6XA 1QJU2 5CVRA 3ETQA 3GBFA 1DQ4A 3CKHA 4YGCA 5FIXA 1ST8A 1TMF2 4GALA 5KHIA 4EN0A 5IVJA 1O3SA 1JOJA 2ZX1A 3CDZB 4UF0A 5F5QA 5FPBA 4ITCA 4FP2A 2PXJA 3VBFA 2WNEA 3IMNA 4ZS3A 3POYA 1TME2 2HEVF 3B01A 3LPGA 2HWE3 2FCUA 1RUG2 5JXHA 2HBTA 1YNAA 1ZZ6A 4HOOA 3M3QA 3RS6A 5IVEA 1IGOA 2GN7A 3RZGA 1XSRA 1UOGA 3LIGA 4MV2A 4RHV3 1JZ3A 2WSVA 4XIOA 5ANNA 5K0UA 5C4WB 2K2SA 3MV11 3VZOA 1DCSA 1VJ2A 1S2KA 4LR4A 2OT7A 2ZHMA 3SEEA 4E8CA 5DAWA 1ZZBA 3GZTB 3CIHA 4YFWA 5C3RA 1OBNA 1GICA 5IUQA 4LORA 2ZCWA 3GDBA 3I2JA 4PIXA 3SXWA 1X82A 3CZJA 3ALQA 5FLIA 2DCKA 1EUTA 1ZBE2 4INDA 2Q8EA 4A42A 3V0AB 3U37A 4UFMA 3MUY1 4LHLA 4OI1A 2X5IA 1DQ5A 3H1WA 1UU5A 3ZFGC 1C8NA 2HKXA 2EA7A 4AQ6A 4DEQA 1ENRA 1N3OA 4HKLA 4XILA 4MOAA 5FYUA 3ZYHA 1SDWA 4JGYB 1DZQA 2ZEXA 5J36A 1BK1A 1JHNA 1V6OA 2HEWF 4NUBA 1OQEA 1WBFA 3AYEA 1GNZA 1UY2A 4JDMA 1YEWA 4WBBA 3JXSA 4D7SA 5C4WC 1UWWA 1BZWA 1D0HA 1DQ2A 1XB9A 2YFUA 5JUVA 4ZU7A 2IWGB 1GWMA 3O12A 2B9UA 3VKLA 5C71A 3ZKYA 3R4SA 4Q4V3 1KEXA 1S0BA 4BISA 2W0XA 2WBKA 4IV1B 4JAAA 4FQ4A 3A0KA 4LA3A 1LOGA 3K4AA 2JG8B 4K8RB 4O7XA 3OSDA 5IWFA 1FMD1 2B42B 5FUIA 3AB0A 5AC93 1BMV2 4YYOA 4N9IA 2GC1A 4S2FA 4GH4A 1D7PM 4JGYC 5DAXA 1GUIA 5H9SA 1UYPA 1A8MA 1AL21 4IDZA 3HNBM 2UWBA 1A3KA 1R1A2 5EJ1B 5T54A 2R1BA 1OOPB 4MXWA 2BJSA 1AYM3 3ACFA 3ZVXA 4TLFA 4CZSA 1PGW2 1VBE2 2J42A 2TBVA 4MGYE 4YW5A 1JU3A 4LHKA 5FZ7A 5LBBA 4RR3A 4EWEA 4DUWA 1AR83 4L9BA 5FXXA 1JYWA 2BNOA 4COZA 1ZREA 3RPQA 2HWC1 1TQ5A 1V6MA 2ENRA 3IIAA 1FXZA 1HQNA 2JG8C 4ASKA 2MEV2 2PA7A 5L19A 3U75A 2BBAA 3IBMA 2D44A 1W3XA 1QEXA 4BB3A 1F9KA 1RUI3 1HRI2 1UN1A 2F4LA 1MS1A 4CCDA 4MGZE 5JXJA 4RFRB 1NG0A 2VNGA 2WN2A 1AR63 3CJXA 5B4XA 1O3QA 1RUD1 4YVWB 1JMUB 1SCSA 4XAAA 5FZ1A 3OEAA 4W50A 1GZTA 1SMVA 2ARCA 1UZWA 4XF4A 3WXPA 2AR6A 2A6WA 1WUVA 4UW5A 4QGNA 2AENA 2WWJA 2BVBA 4P02B 5FV3A 4BWOA 3THDA 5CYYA 3WDTA 2GDFA 3VKNA 1UY3A 5ERLA 1DHKB 1C5HA 5DMYA 4DQAA 3NO8A 4PT6A 2ZTNA 2BOJA 1ASJ1 3B5LB 1ZA7A 3TWIA 3M8LA 3ZDVA 2DVDA 5BV6A 4I3PA 3O1SA 4PLOA 3E6CC 3AKRA 3J9SA 3R6SA 5IJRA 1XJAA 3HAGA 3NKGA 3UGFA 2HBUA 5BUVA 5EFUA 4QWNA 2KXLA 2UWCA 1RXFA 5A3WA 5I8YA 4AAPA 1LHVA 2IC1A 1YI7A 3LGRA 3MW3A 4LHSA 4XFAA 2FDFA 4YVWC 3VL8A 4IGOA 4OHXA 2EAKA 5CKMA 1GANA 5GLWA 1FAYA 2LRPA 5C5TA 3Q8BA 3WNPA 2W92A 4Y5TA 4FPEA 1V6IA 1ND3A 3FX3A 1JHJA 5DXDA 3W59A 3JD71 3GJBA 1X9PA 3WHUA 4CDUC 1JZ6A 2UWAA 3IKWA 4X6RB 2IFWA 3K2OA 5FYVA 5FO9B 2GC2A 4BOWA 1BEV2 2AUYA 3ZDSA 1FI2A 2E7QA 3N9QA 2JG9B 2R49A 1RB8G 3TBDA 1WLDA 2W95A 1E5HA 4LULA 3T1MA 1GZWB 2JB4A 3PU8A 4OHVA 4XFCA 5IAVA 1MZ6A 1N3PA 1OH4A 2GNTA 3A7QA 4H55A 4C1WA 3AKPA 1KXGA 2NP0A 1SACA 5AFEA 4UFIA 4D7TA 3EB7A 3ELNA 2Y26A 1C1FA 4WM7A 4XQ4A 5D2AA 3T3YA 2OIIA 4PF1A 3T2TA 5GZFA 3IDEA 1RUH1 4HXCA 4XVHA 3O1MA 4OI0A 3NNFA 2JIJA 2HWF3 3UKNA 2BW8A 4D6RA 2H0BA 3GM8A 1QJY3 5DAQA 5LCWL 1JZ7A 2EIGA 3NJXA 4Q1PA 1ULPA 2G9FA 4HN1A 1O8PA 1V9U3 1UOFA 4ZY9A 1JBCA 4IEOA 3ZN4A 1ZX5A 2EICA 4XFHA 1OA4A 5LA1A 3SISA 1SBFA 2BTVC 2JG9C 1WLWA 3DL3A 4JGZB 4V2VA 2DDUA 2X09A 3NSTA 1AR72 2XLGA 4LBKA 5JZGA 1W8ZA 3M4FA 2YPJA 4B8EA 3K51A 2XWJB 3S6PA 1W9FA 3L2YA 3T4HB 5IFTA 2RR12 1AYN2 5CG8A 2RG4A 4NRQA 1A6CA 2LUWA 4OQ9A 1NCRB 1US3A 2VD7A 3ACHA 3F2ZA 1GQHA 1VBC1 5T5LA 3TN92 1C5IA 5JCTA 4OFGA 1WMXA 2PHDA 4OUMA 2GH8A 3VBRB 1VBD1 2WAOA 2XL7A 3N3HA 1W9SA 2E9QA 4RS5A 1LECA 4CXYA 4E2QA 1BCXA 1SPPA 4BK5A 4URAA 4JKKA 1K12A 4WM8A 4YM2A 5FTTC 1OLMA 5F7UA 2ZABA 2VZVA 5ACA3 1YIPA 2WFF2 3OGRA 2NM1A 2DFCA 4QXBA 1C8M1 5FY0A 4HK9A 3W20A 5K4LA 5CADA 2XBO1 1OLRA 3QH7A 5E6HA 5T50A 3USUB 2E7TA 2HWB3 2PQQA 1OFSA 3C3VA 5I91A 3JB8A 3VDDB 5KBFA 4XMIA 3HIFA 1FOD2 2J1RA 1W9YA 3Q8EA 1NY72 1HDKA 1AR93 1NE6A 2BFUS 1NZIA 1NCRC 1TVGA 5A33A 4EZ4A 1W05A 5L7OC 2C6SA 2EALA 3VBRC 3FBYA 2Q1MA 5J96B 2ZGKA 2JE8A 5KHKA 5IK8A 1I5PA 4FQZA 4FTBA 3J7NA 1YLLA 2WO2A 4DPNA 4OHYA 3V56A 1W8UA 3RZZA 4QX5A 1BXHA 3UL2A 1SHWB 1K3IA 2ZGQA 1RL3A 3B9IA 1NQJA 1OLQA 1MS5A 3GF6A 1LOEA 1CIWA 1VRH1 4Z82A 4AEKA 1MEC3 1COV1 2O1QA 3PNAA 3AMPA 3W5NA 3GZEA 3UGHA 4WVVA 3FMGA 1UZZA 4BQ5A 2RDRA 2A71A 2BZDA 2E31A 4Q0QA 2YU1A 4B4QA 2JWPA 1KGYA 3WY6A 2R073 3AL5A 1GP6A 4K21A 1CIYA 4GB33 5FPXA 3VZNA 5C9AA 1IS5A 5FMOL 2VCMA 1W03A 2XG3A 2WS93 2RS11 1JU4A 2R061 2P3YA 1CX4A 3CF6E 2Q8OA 2KR2A 4PIZA 3U07A 4AOCA 2XKOA 4DXSA 1M06G 4KGQA 2DCJA 2WLQA 4CUAA 3PJQA 3Q8AA 1VRBA 1DGLA 1R092 3NQHA 3ENRA 5FZ6A 5T5OA 2XJVA 2EF6A 2ZGMA 4LTAA 5EZWA 4D3WA 5CFCC 1VMJA 2VBDA 4Q4X2 2VL4A 5F3IA 1ND2B 2IXKA 4AVBA 4YW2A 1SLIA 2ZEZA 3AP6A 5LB6A 3VBHC 3LKJA 4QX2A 4YLZA 5T5JA 4UBHA 4YG3A 4CEYA 4DY5A 2A73B 4A2UA 3MLJA 1WBLA 5FZ8A 1UY4A 3ME2A 3GZUC 5IFPA 4CE8A 1A78A 2OQ6A 4AEDA 3U4SA 1EPWA 4EZHA 2B7YA 1K42A 3I49A 3PUIA 2ZGPA 1WCUA 2XDVA 1YQCA 3N7JA 3GXUA 2G9ZA 4I0BA 5FP4A 4CDXB 4CCMA 1O3TA 1LU1A 5KR7A 2CNAA 1OA2A 4B1LA 1XOYA 4NIGA 3HPNA 1DYKA 3WW2A 2XJRA 3EMRA 4JTNA 2XUEA 5B2GB 2XXZA 5I0DA 5DUXA 4HETA 5FY1A 4CEWB 4E4DX 1PIV1 4HFSA 4ISRA 3GJAA 5GZEA 3ZN6B 3I2DA 3KHBA 3J26N 4XCBA 4YZ1A 2W46A 2AYHA 1MZ5A 3RGBA 2YC2A 3AZVA 2AREA 4KBBA 1WLTA 1QH7A 1X9TA 4NPRA 2WL1A 2GC0A 2WT2A 4CXXA 2V5DA 4AGVA 1REEA 4CDXC 2FMYA 2ATFA 3GHMA 1REDA 2O8QA 3HD8B 2WZPP 3S5QA 3T4VA 1SLAA 2GN3A 1Y7BA 2PHLA 4NPMA 1LOFC 2A70A 4L11A 1UMIA 1GYKA 1KS4A 1J58A 2V4AA 2B46X 1FMD3 3AC0A 1G9DA 3LPFA 4FP3A 4XUTA 4V2WA 4ASLA 1NA1A 5C8CC 5FPZA 5A6ZA 1XU2A 3I97A 5B4NA 1O6UA 4XQWA 5I0SA 5A7PA 5CAZA 4AG4A 1XYPA 1C57A 2VOTA 2VG9A 3D6EA 1AL23 3KT1A 3R4DB 2QQMA 5JDBA 4E2GA 5LBEA 2YGMA 1MR5A 2RMU3 4EN8B 2FMDA 1POV0 1Y9MA 2W1WA 2ZKNA 5BNNC 3B9CA 1S2EA 1FNYA 5BNQA 1VBA2 3DYOA 3NJZA 2J1VA 1UYZA 2YPDA 1POV1 4N43C 2VCAA 2GP5A 2HWC3 4N9HA 4AI9A 4DFSA 1QF3A 1C3HA 3MPBA 1LGNA 3O1OA 2W39A 5FY9A 4AE2A 4BMBA 4LT5A 2OVUA 2R043 3RZKA 4H14A 4FOWA 1HKDA 2ARAA 2IVJA 5FZ3A 1RUC3 1DGRN 2MNGA 2WUHA 3U14A 1YQ2A 1H9WA 1F15A 4Y22A 2VZRA 1CPNA 5A6QA 1ULFA 5T5PA 1JUHA 1RUD3 2RM22 4FTEA 1Y3TA 1RUI2 3DF0A 1BK0A 1OF4A 2ZZJA 3MUZ1 4K9SA 4EE2A 5FPUA 4IGQA 5C6CA 5JMCA 3SQOA 2VZUA 2YBSA 4LO8A 4IE6A 1HXS2 2DU0A 5EIYB 2Y60A 3ROUA 2D3RA 2A7AA 4ATFA 4AQSA 1WCDJ 2D43A 2WQZC 4I0AA 4R4XA 2VTXA 4NOTA 3VN4A 4CDQC 5FZFA 1IG3A 3H8UA 5HV0A 3J8F1 3P6BA 3T2PA 1PGSA 1ASJ3 1Q8QA 4XMAA 1QXPA 5FWJA 4RN5A 4PJYA 2RS31 2VZQA 1ULEA 4IE7A 4BHPA 2HEYF 1XRUA 3NV4A 4BDVB 4RL7A 1OHFA 2KM2A 5J1XA 1QNYA 3AMHA 1S0IA 4HPKA 4BYYA 2DVFA 1LULA 1XE7A 1D4VB 3WV6A 1JXNA 3ZR5A 2AEZA 2VM9A 1YQ5A 3I3EA 4L97A 4SLIA 1K5JA 3C2UA 2YB7A 4AWDA 3I3BA 1R082 2ZXQA 1QY4A 2NZ9A 1LHOA 2WZR1 3SCGA 4NIIA 1W6QB 3JD73 1D4M2 4KMQA 4DO0A 2K0GA 4ZXKA 3VL9A 3QACA 3NNMA 5IVFA 3WQ7A 1AXYA 3VBSA 2ZX0A 2D5HA 4MADA 1PO12 3JZVA 4FAGA 1DBNA 4FPGA 2WNUC 2Z5WA 1CD3G 2G19A 3EJKA 5ABJC 5CFDC 2UU8A 1B35B 1DQ6A 1ONAA 2AC1A 2DV9A 4BM8A 5FZMA 5C3OA 1QOTA 1PK6A 5J3UA 1RUH3 1DGWA 3OF1A 4QPGA 2UYBA 3H42B 1EAH2 1STMA 3AYDA 4JKLA 2VMGA 3OB8A 4Q0SA 1X8EA 3RJ2X 2P3IA 1OF3A 4E27A 1UW8A 2NLRA 2RDQA 5FAXA 3KF3A 3OBRA 4A4AA 3OYWA 5E16A 3IAPA 5FYCA 3NAPB 5BNPA 4Q4Y2 1MQTA 5A32B 1V9U2 1RIRA 3VBOB 5DAPA 2XLAA 4COWA 5LZ6A 2Z69A 5HXVA 1U5YA 2CL2A 3KT7A 2ET1A 5AVAA 2VNVA 3FL7A 4UW4A 5KXCA 4ZZ5A 4A7YA 3AP5A 1RTVA 1VBC3 2WO7A 1CAVA 4PDWC 4UOJA 4ZKTB 4JRLA 1VBD3 3SH3A 3APBA 2P4EA 2BOIA 2ZAAA 3DKQA 3E5UA 1CZSA 3LA2A 4GZ9A 1JODA 4J6GA 4Q29A 4RQPA 3WP5A 4BCUA 3VBFB 4AFDA 1GWLA 5F39A 5T55A 2PAMA 1H2NA 3NJYA 1UZYA 1C8M3 3ZYRA 2ZX4A 4QDRA 3NAPC 2XBO3 3RMXA 4O9EA 4CDWC 5C8WA 1B09A 5ACA2 5J37A 5LRRA 3VBOC 3UV9A 1EV11 2VVDA 4QHOA 2WLPA 1E5IA 3JQWA 4ET7A 1G9CA 1BLZA 4HLTA 4G4FA 4PBPA 3ZYJB 2ZGLA 4CU6A 3USSA 3LB9A 4XFBA 3IMMA 4QKNA 1I9RA 1J3PA 3PIJA 5FZDA 2C9KA 4K8FA 5FZ9A 1RUF1 4XXAA 4Y26A 2WYFA 1IS4A 1F5FA 4Y4YA 4FPFA 5EHDA 5FYIA 2OYZA 3T2QA 1ZRRA 2WSUA 3VBFC 4YM3A 4OYUA 1NKGA 1YRZA 1ZZ7A 5A80A 4AF9A 3H1MA 1QJX1 2Q1FA 3PUAA 2C4XA 2ZHNA 4HKOA 5FLHA 4AHWA 1QMJA 1VRH3 4ZPIA 1COV3 4Q0PA 4RA0A 1HV1A 1SBDA 3B94A 5GLZA 3ZIXA 5FO8B 4LBQA 2ILMA 3M70A 5K0UC 1V6KA 5C33A 4NRPA 1HQLA 2W1SA 4G9SB 1MEC2 5FPLA 5IVVA 2GNDA 2XWBB 3AZWA 5DZFA 3O7OA 3KMHA 1DP0A 4P00B 1RMU1 2D6NA 1OPOA 2RS13 2R063 1N1VA 3MPPG 4KBZA 4BMEA 5FOBB 1PX3A 2Q0AA 5G05L 3IZOA 2X5IC 1PVC3 1JOBA 3MDPA 2WS92 2X8KA 3FLPA 2VOKA 3P3NA 2Q8DA 2VAUA 4LXLA 3RVHA 4BA6A 3JUUA 5F9TA 2Y33A 3TEZA 4QMAA 4CXWA 1RUOA 2PLV1 4O9GA 1AF9A 5EWSA 5KWRA 1X50A 3A21A 4IESA 1CESA 1O5UA 2VR4A 2GP3A 5DZGA 4IEUA 5FXZA 3SKJE 4Q8KA 1IPJA 1PX4A 5C7GA 4BQ1A 5FFOC 1OUSA 3M2MA 3UKTA 4JVAA 1I5ZA 4X6QB 1CPMA 2DBNA 4CCKA 4XFFA 2GNMA 1UXXX 3VBUA 1ULOA 2YC4A 3AMNA 2ARBA 4K6BA 4RR3B 1WMEA 4C90A 4LHNA 4N7UA 3WCSA 5A1LA 2OXBA 4UW3A 5F1RA 1VALA 2UURA 3KCYA 4GQ7A 2WN3A 2VMEA 3P3PA 2ZGUA 2P34A 4QHBA 3ZSEA 1VE0A 3CJIA 4B3NA 4B4PA 2JKBA 4LE4A 1I3HA 1UY1A 2QE3A 4GH4C 5CNAA 1G9AA 1IHMA 4LKSA 4GAZA 2RE9A 4I01A 4ARYA 4NIHA 3CLPA 2RJ2A 3KQ4B 4Q4W1 5EYYA 5JIAA 4Q27A 1RJ8A 3RDIA 2C0ZA 3N4MA 1UIJA 2W1QA 3ECQA 3OBZA 1QQP2 1DZRA 4IEXA 2BERA 1PIV3 3ZFGB 4XJUA 4E4SA 4AAXA 2BYVE 3LEMA 1V00A 1F4AA 2RJLA 4JKMA 1UD1A 1UIKA 4PI2A 3ZFFA 2RS51 4RR3C 4YGBA 4BQ2A 1JYCA 4GD4A 4CUCA 3U0ZA 3C7HA 2YY1A 2YC0A 1J3QA 4JC1A 3WQ0A 1T6GC 3WQBA 1DYPA 1ZZ8A 4YZ4A 1QDOA 3OUJA 3IN9A 3AKTA 4AI3A 4DOUA 2VO5A 3AZXA 3BOWA 1UOJA 4AHXA 3M3CA 3NWKA 5FK8A 1PO21 3MIHA 2ZHKA 4BE3A 1G86A 3JBG1 1GQPA 3IPVA 4R9DA 1RJ7A 1OFNA 1OXCA 4CA9A 3NV2A 1YFYA 1ND3B 3S7EA 4IEPA 3ZXAC 1XYOA 4LLFA 4V1PA 1QJU1 2ZX2A 1VPHA 2HLEA 4BLJA 4QX7A 3ZMNA 3RFRA 5K7PA 4XPVA 2CDOA 4QDSA 1TMF1 1W8NA 1G9BA 1PNGA 1NZCA 3HN1A 1VAVA 4MSVA 2WFPA 3I54A 3MIEA 3UT0A 1WZXA 2VY0A 2GSYA 1Q43A 1TME1 2WQ4A 3HEIA 4K1ZA 4MXVA 1RUG1 4NN0A 3KQRA 4AVVA 1OQ1A 1YIFA 5L36A 2VH9A 2V73A 4QQLA 2WNVA 5L9RA 1POV3 2RMU2 4C1XA 2GALA 1CAWB 2EIEA 2LROA 5DDJ2 1JS9A 2FCTA 1X36A 5JR2A 3MZHA 4AQTA 3MIFA 2QQJA 2I45A 5FYBA 3AJZA 1H9PA 1ND3C 1ZRFA 3LCPA 3N9OA 5DUVA 4FPJA 4XUNA 4CP9B 3OBAA 4W6XA 4LBNA 3CMGA 3D3AA 4OI2A 2WYSA 4AHZA 3K3OA 4PBOA 3WF2A 1W2OA 1KDMA 5LY2A 1PMJX 2R042 2XVGA 3LDBA 2DF7A 4LO7A 2CWMA 4WVZA 1MACA 4C0BA 2QJVA 5FLJA 3ZYFA 3RWKX 4LIVA 1RUC2 2VCCA 1FATA 3R05A 1H8TA 4EN9B 3U1XA 4YZ2A 2HWD3 2R0FA 4CSWA 1Q5OA 4MVTA 2IUWA 1NCQB 4QQ2A 1VBB2 1UX6A 4F7ZA 4NE9A 1VMHA 3NNJA 3OCPA 3OD4A 4WV8A 3AYAA 4WM7C 1AZDA 2PHXA 3J8F3 1AJOA 3LFIA 3GGLA 5FYHA 1AXKA 1O7FA 5JI9A 1H30A 2DCZA 3LIHA 4TLGA 2RS33 3RI8A 1S0CA 3UKVA 4QPIA 3A0NA 4FOQA 2BWCA 4Z2AA 4XBNA 2F4PA 3HOBA 1NE4A 4MLOA 3VHNA 1EY2A 3V0BB 3WHTA 4PF5A 4ZU4A 1GWKA 4XUOA 5K8SA 1BMV1 1R1ZA 1PZ9A 5A3NA 4QPWA 2H6BA 4N53A 1NXMA 4DXZA 5JZGC 1W6MB 1XYNA 2WZR3 5FDBA 5DUUA 4Q8LA 3UJOA 5CB7A 5FREA 3A4UA 5DN2A 3E5QA 2D7FA 4C8DA 4CDUB 2JEMA 1NCQC 2SBAA 3JU9A 5JR7B 1NYWA 1R1A1 3KCXA 4Y24A 4AI2A 3ZOIA 4UW6A 3I3QA 2D6OX 2X05A 1V0AA 5FP7A 4MO3M 4W65A 3HNMA 4EWDA 3T0AA 4P08A 1PGW1 1QJEA 1VBE1 2D6LX 2WZEA 4QKBA 4YGEA 3DPRB 2DUOA 3N9PA 1ODMA 4QQOA 1YFUA 1F8VA 1BBT2 4UFKA 4IQPA 3I2OA 5F8PA 3LDRA 2DYCA 1W28A 4COUA 4AGRA 4HVQA 2MEV1 3O14A 1NT0A 2JE7A 3PUHA 2XLFA 3ZPOA 5JI7A 1ZNPA 3SH4A 1LRHA 2CWSA 1YC61 3WW3A 4NHYA 3B69A 1FYUA 1WLCA 1HRI1 1D2QA 1QHDA 3IM0A 1C28A 1J3RA 2JD4A 3MV01 1DLLA 2JKXA 1ZRDA 1JTZX 3N7MA 4XJZA 5C4WA 1DG6A 1ZA4A 3IT8A 3I59B 3JQXA 4OI4A 2G9GA 1OD3A 2LALA 3LQCA 3O5SA 1HRV2 1HX6A 3PUQA 5JPNB 3O1PA 2Y6GA 5L9VA 1IPKA 1KJRA 1RINA 3WDXA 4BQXA 5JPMB 3VZMA 3DPRC 3GNEA 2OKXA 5CA6A 3WF0A 3ON7A 3VD4A 3V0AA 4QD2A 4FFGA 2XOMA 2ET7A 4CP0A 5FWEA 2RVAA 2IZWA 2QDNA 2JECA 1RUE2 3AL6A 1NUKA 3PUSA 5FZ4A 3V65A 5KHGA 3H7YA 1QKQA 1FV3A 4CU8A 1SDDB 5F3GA 4XHBA 1QDCA 2OQ7A 4XJ9A 1PHMA 4CEYB 1BKZA 3O1VA 1XXNA 1QXJA 2ZEWA 3KT4A 2MPFA 1V6JA 1W0NA 4YW3A 5BNOA 5C9AC 2PTMA 1S0DA 2HJIA 3KV5A 1MS0A 2F17A 4Q0UA 4CRQA 5FXVA 5JSOA 3LZZA 4WVWA 2VW0A 5F5AA 4IV1A 2WKKA 4XE9A 2OPKA 3Q9OA 3G7DA 1EV13 1YYNA 4WZCA 3AKSA 3KV4A 3PL0A 3BIEA 1C8M2 4J1WA 2Y6JA 2Y6KA 3KSCA 4GULA 5FZIA 4XTMA 5A3OA 5C5UA 3U78A 1BEV1 1HN0A 4LPLA 4R52A 1XU1A 3BGAA 1W99A 5L7OB 4BQ3A 4RD7A 5FJHA 1OT5A 1K5MA 3HT1A 4XUPA 1H4HA 2A6VA 3U11A 2YBPA 1RUF3 1C4RA 4CEYC 2VXJA 2CAVA 2WABA 1YUDA 4YW7A 5LA9A 1OOPA 1XC6A 4DZGA 4Y20A 1QJX3 1VR3A 1ENQA 2W5FA 3HQXA 1H4GA 1DLCA 4U36A 4AEDC 2VGDA 3UNPA 4UBGA 4D7YA 4P5YA 1MS8A 2ZMKA 1RYYA 3PHMA 4FVVA 4FAHA 5JLVA 4QDQA 3WG2A 1JYNA 5APAA 4H2AA 2YGLA 2AEYA 4N90A 1E57A 2PYTA 1VRH2 3Q8CA 4HSJA 4TN7A 3LD8A 4IEYA 1RHI2 2W1UA 1KQRA 4XABA 1W8HA 4BXSV 1WW5A 3TB0A 4K20A 1KFUL 1UKRA 4HVRA 5EJZB 1ZZCA 1RMU3 2HYXA 3OY8B 3ZSLA 1AR71 1X33A 2Y8KA 3NRUA 1CONA 3LE0A 3PLQA 5HCHA 1KS5A 5CG9A 3LOIA 1Q8OA 5GLTA 4HVOA 1W04A 4CUBA 2XB6C 2RR11 1NA1B 1AYN1 2VTXJ 1UX7A 1S0FA 3TN91 4FO9A 5AFBA 2CGOA 1W6PB 2DFBA 2QZ2A 3FHAA 2PLV3 2XPJA 2OA2A 2JIGA 1PVC2 5CFCB 3W58A 4KU8A 2RV9A 1QWRA 5E1RA 1H2LA 1OVSA 1W6OB 2I07B 3VBHB 1Z7S2 1LJ7A 4CPBD 1FPN2 2WFF1 1KJLA 2IXJA 4YVSB 4QB6A 2CDPA 2BQPA 1YQ6A 2XMLA 5KC5A 5LW9A 3PTRB 3RZJA 1XNCA 4D6SA 5DG2A 3FBMA 1KD7A 1UMZA 3ZPYA 3LDKA 4DIQA 1FOD1 1Y43B 3H1YA 4TYSA 5FBJA 3O1RA 1NY71 1NA1C 4TXWA 3EXUA 5IHRA 2QQVA 4DUVA 2ZGTA 1DQ1A 5JSRA 1GOFA 1MVQA 2BV4A 4CCLA 5JXIA 4Q4W3 4HSLA 4XFIA 3OEBA 2MHFA 1SQ4A 2Q30A 5D8AA 2A6ZA 2PAEA 4I09A 2WRAA 2P6HA 1VP6A 1J84A 3AP9A 2RS53 5FCCA 4IV3B 4YVSC 2LM3A 5A7QA 1IOAA 1S0JA 5GKAC 3HQUA 1W6NB 2P5BA 3WNMA 3S5AA 3RSJA 1BYHA 2HWE2 3BTZA 2PELA 4FI9A 1HB2A 1N1YA 4LITA 1TE1B 1WW7A 2OUJA 3WNLA 4UI9L 4AZZA 2K46A 2ZGSA 1AX1A 1ZZ9A 1GZ9A 4RHV2 3AMMA 1PO23 2QQUA 4HPKB 4UFLA 2WIIB 3EYPA 2EVXA 3GALA 1WA4A 5J98B 1L7RA 4W6YA 4YG0A 3FLTA 3WNOA 3WNKA 2ZHLA 4JGZA 1H2KA 2QKDA 4RFT0 1JI6A 1R091 1RUJ1 5C8CB 1QJU3 2CYFA 2H6CA 3RJRA 4IV3C 1H8VA 4K3UA 4Q4X1 4Z2WA 3B3QE 3ZXJA 1O5LA 2IXIA 1EP0A 2P2KA 5EYXA 1W39A 3C7FA 5A3TA 2QQIA 2XONA 2VMIA 4OMCA 2BU9A 2E63A 1TME3 5BNNB 5A3UA 2WDBA 1RUG3 4F8AA 3IDAA 3TOJA 2FDHA 3OTFA 4JZRA 1DQ0A 1H0BA 3J7LA 4QB1A 1GZCA 2CAUA 2O0OA 1WA6X 2BWAA 3N7LA 4N43B 2JDAA 5FMDA 1OURA 4QXCA 5I8SA 4EN7B 2VMFA 2ZGOA 2YDEA 3MF6A 1KDKA 4IGPA 1PK6B 2W47A 4XF1A 5FY7A 2WT0A 5IW0A 4Q4V2 3WW4A 4XJWA 3VD5A 3NV1A 5IT6A 5LEKA 5CIRA 2V72A 1WCSA 5L9BA 4QM8A 1LODA 1OSGA 2VZPA 4P9IA 3VDDA 4IL7A 3WD5A 5AC92 4RGKA 3ZFEB 1U0AA 3K4DA 2D40A 3BYWA 5HPOA 3OYWB 1XE0A 4XYXA 4LO5B 1RGSA 1FX5A 3WX5A 5FYSA 3MW4A 5HBAA 5BNPB 1TZOA 4IE4A 2B9VA 1MQTB 4M3CA 3OGGA 4CUGA 2ZACA 3P1IA 2DU1A 5E8AA 1QH6A 5IK4A 3LOBA 3V64A 5F37A 1DIWA 5A7WB 4CDQB 5J7MA 4Y5SA 3GYDA 4TTGA 1PZ8A 1F4HA 4QU2A 5EP9A 1AYM2 2HWD2 2QQWA 4FXGB 1ZYBA 4K1YA 4F3JA 1UQXA 4ZONA 1WCKA 3WDWA 1RITA 1PK6C 2XUMA 4G3YC 2RJKA 4BIFA 1AR82 3BI3A 4QPGC 1FV2A 3DCQA 4L8QA 4XF3A 1GBGA 3J4UH 2Q5TA 4XXPA 4KI5M 3AM2A 1XNAA 2E7AA 3J8F2 3LSDA 5DUWA 5F3EA 1H2MA 3ZFEC 1KFXL 3AMQA 3PVEA 5BY5A 1TEIA 4HANA 1PGL2 3BUCA 1W0PA 5BNPC 4P14A 1AR62 2XQXA 1MQTC 1JYXA 1ULCA 3DV8A 2D6KA 2WAAA 3K75B 3MGUA 5FZGA 4AVTA 5J48A 5LA2A 4YG6A 1RVF1 2VW1A 3D5OA 5FY8A 2B8MA 1SBEA 2DVAA 1US2A 5D21A 2A3YA 2YG0A 4QGMA 2EIBA 1R1A3 3K48A 3VHRA 3S57A 3VDAA 3H8OA 3FFQA 2GMPA 3ABZA 1W8TA 5DZEA 3PURA 4RQPC 1SLCA 1H6YA 2ZMLA 1X8MA 4HKWA 1NLQA 1VBA1 2P1BA 4ZU5A 1ND2A 1WD3A 2WNUB 2D3PA 2PHRA 2X29A 3MF9A 1LENA 5ABJB 5CFDB 2VOXA 1OLME 4XDOA 1ENXA 2WO3A 3DGTA 1YXWA 2MEV3 4COVA 4E8DA 4MYEA 3I2FA 4LBQB 4K7JA 4OVEA 5FYTA 3T09A 2ZGNA 5LK7B 2ETEA 1HRI3 1LEDA 3RQ0A 4AQ2A 1CWPA 4F83A 3N9LA 4P9WA 1QJFA 2WA3A 3KF5A 2P37A 3S30A 4AFMA 5A7SA 4IETA 2WQ8A 1E5RA 2VQ0A 2RM21 1WW6A 2XH6A 3PVOA 4ZHNA 4YFZA 1WW4A 1H1IA 3N9NA 1QNWA 1LU2A 1U5IA 4MGSA 5CU1A 3N9MA 2UYAA 3LA3A 5HCBA 5A6XA 1HXS1 4EV0A 4IEWA 1GU3A 4OUSA 5HI0A 4LBLA 5IVBA 1LOAA 1JW6A 4LA2A 4AFAA 2IXLA 4AFCA 1VMFA 2XJPA 3RMYA 4CEWA 3VZKA 1PNFA 4BQYA 5FZBA 3ZSKA 5CBLA 1UU6A 2VMDA 4PDWB 4Q1RA 3IAQA 4JV4A 2WR9A 5BXXA 3VZLA 1DU3D 5FMBA 4EJRA 1POQA 3AJYA 3PMSA 4SBVA 5FXWA 4H7LA 2XQRA 1UZVA 2J1SA 2P3KA 4XACA 4LO4B 2D3SA 1Q8PA 3WP3A 2BVVA 4IE5A 2YUEA 2HWF2 3OBTA 2BP6A 4KG0A 4RGAA 5G04L 2FZ2A 1EYBA 1QJY2 2VNRA 1R081 3ZSJA 3FLRA 4CDWB 2ZKLA 1HJFA 2C26A 4A44A 4XF9A 5FRAA 4OHWA 4QQHA 5FUPA 5EQUA 1D4M1 4HZFA 3E6DA 5FY5A 1SFNA 1CAXB 1N3QA 1YI9A 4D0QA 2NMOA 3K4ZA 2A1XA 3WDVA 1YFWA 2VUDA 1BEV3 1U5XA 4XJAA 4IEVA 3WOGA 4Q2FA 3WSOA 3O0XA 1PO11 3KLSA 4Y1UA 1AX0A 5FZCA 1V70A 1GR3A 4MHUA 2E53A 3ILRA 3CL1A 1LHUA 4UF0B 3DECA 4BZ4A 2Y6HA 4IXLA 1JYTA 5BYNA 1NOVA 2B4KA 2JICA 3KCCA 3P5BA 3RYKA 1FT9A 3LEKA 4Z07A 2Y0IA 1F31A 4DXRA 3Q8FA 1J1LA 2ADEA 1EAH1 2C5DA 1LCLA 2Q8CA 5K0UB 1Y9QA 4Q5OA 4ZS2A 3BIWE 1D2SA 3CJIC 5C3QA 3WG3A 3SCFA 2DUPA 1OI6A 2BUKA 2HWB2 4A6OA 1HV0A 2QQOA 2QDRA 4FTSA 2DCTA 3OPZA 4J25A 4Q4Y1 4TSVA 1W8OA 1V9U1 5EV7A 1AR73 1O59A 1ZBA1 2VQAA 1AR92 3W5MA 4HN0A 3ZYIB 2X5IB 4JDNA 4LKEA 1WCQA 3FFZA 1HN1A 2VUAA 4AL9A 3PU3A 1RMU2 2RR13 3WEZA 2PQSA 2ZEYA 3I2GA 1YO8A 4KWJA 3BPSA 1AHSA 2W87A 2WWUA 3TN93 2JDHA 4GKYA 1UPSA 1CGPA 4S2HA 2A3WA 2VMHA 2DUQA 5JWPA 4DY3A 3ZKUA 3RZMA 3N35A 3VD9A 3RYRA 5E89A 2IXCA 2XJSA 2IFRA 2XGXA 2JXAA 5GZGA 4NROA 2WFF3 4KWLA 5SV8A 3DEMA 2ORZA 1HB4A 1YWKA 4ISQA 1S55A 3KV9A 1P8JA 3ZXKA 5HCFA 4JQRA 1W8WA 3AK0A 5ACA1 3ATGA 5KXDA 2R072 3LWCA 4XF0A 4KWUA 4GB32 4AI1A 4AI0A 1CAUA 1FOD3 3O1UA 3DKWA 3B93A 5FP9A 5H9RA 1WKYA 4GH4B 4LQRA 1C1LA 4QX8A 2ES3A 2LW8A 3EHKA 1J59A 1W6QA 1R64A 1N1SA
chains in the Genus database with same CATH topology
5GZCA 2CGPA 2BFUL 2I2SA 4MXWB 3ILNA 2QQPA 3HWJA 2Z2SB 4YZ3A 3WG4A 3AZYA 1LKNA 5HCAA 4MX3A 4L92A 3HBZA 3WCRA 3FE5A 2WNVC 1Z78A 1QOSA 2I74A 3SITA 3LAGA 3FC0A 2C1FA 3M3OA 5JOWA 1NQDA 3MLKA 1B35A 1H1AA 3FUQA 4WVMA 5FO7B 4QPIB 2ZAHA 2QCSB 2R0HA 3SMHA 1UF2C 3AX4A 4FPLA 2TUNA 4META 4Z92B 2PHTA 2CTVA 2GAUA 4L2NA 1H8TC 3ZXEA 2WS91 5I0RA 3NAPA 5T52A 2YYOA 1R093 1RUJ3 5A32A 4QM9A 1NLSA 1CJPA 4Q4X3 2WA4A 1JUIA 4Y5Z0 1CN1A 5I0TA 3URFA 4XBQA 4QPIC 4B4RA 1FNZA 4HK8A 3AXEA 5FQ0A 5KHHA 1IQAA 4P9LA 4KNCA 1UU4A 2BPA2 1M4WA 1Z0HA 4YNIA 3SH5A 2YXSA 3RWNA 5E88A 2R1DA 4A3XA 4N53C 3BTAA 4NVPA 4OULA 1ULGA 2VXRA 1ULDA 2OZ6A 4KQ7A 1FMD2 2KA3A 3BU7A 5I8TA 4CYDA 3MW2A 1QQP1 3B7MA 4PQ9A 1AL22 4BH9A 1LTEA 3BOPA 2FBEA 3R0RA 3M3IA 2CGNA 4KGGA 2ARXA 5JSPA 1ZVFA 3KGLA 2R32A 4WM7B 1ENSA 3H50A 4YM0A 5H9QA 1G9FA 1DFQA 3CEWA 4E4ZA 4PIYA 4AW7A 1DDLA 2HWC2 4LUKA 1D0GA 4LE3A 2O8OA 1CJDA 4YARA 3WR0A 5BNOB 1TNRA 1ZBE1 1NXD1 2XJTA 1UL9A 3EO6A 2YZ4A 5JZGB 1H1MA 3H7JA 1RUD2 2VUJA 4AFBA 1RVF3 2B45X 1BVP1 1J1TA 5JOXA 3ACLA 1MZFA 4M0HA 1K5MB 4RS5B 4Z8BA 3QH6A 3BB6A 1O4TA 1LB2A 4WM8B 1VBA3 3TAYA 1F5JA 2RMU1 1ASJ2 3BODA 4Y20B 5BNOC 1F2NA 5DDJ1 2GMMA 3IWZA 4FOYA 4DRRA 2B5HA 4RGGA 3ST7A 1WMFA 4XDQA 1L3JA 3ZYGA 4IV1C 4JDOA 3ZMOA 4COYA 2D93A 1S1AA 2EXJA 3WDUA 2R041 2RM23 5A33B 1IZ3A 4OLLA 4R9CA 1RUC1 4EWAA 1WMDA 1K5MC 1S0EA 3JD72 4RS5C 2GH2A 1HXS3 4ES8A 4EROA 1LOCA 4R9BA 4WM8C 4R8HA 3THTA 3RYPA 5AVPA 1VBB1 4KU7A 4Y1XA 1OOPC 1PMIA 3GBGA 4FPCA 4XIKA 5GM0A 3ZFGA 5LK5A 2V5YA 2DCYA 4A7KA 3H3ZA 4B7KA 1IS6A 2CY6A 2Z42A 4W6WA 1KITA 1Q56A 1WD4A 2OZJA 2VULA 1REFA 2AZ5A 3AKQA 2ZMNA 4M00A 5J36A 1GLHA 1RUH2 3FHIB 5C9AB 3NL1A 3EBRA 5F6LB 5T3NA 5D1IA 3H3UA 1DF0A 1YJLA 4YSFA 2EXIA 1R083 4FPKA 1SCRA 4FPHA 2A5ZA 1D4M3 3HT2A 3PVNA 2R6QA 3LA7A 4HBNA 4I0WB 1KRIA 3KB5A 2JJ6A 1VLNA 4XOGA 3M7AA 4ATEA 1IKQA 4U2AA 4JGYA 4N7IA 2RHPA 1JN2P 1PO13 4FPYA 4XZPA 2D6PA 2Q4SA 4ES9A 5D8AB 3SCHA 2VPVA 1BBT1 3WUCA 4URTA 2UY8A 2JENA 1VBC2 3O0WA 3KM5A 1VBD2 1U5ZA 2C9AA 4AEDB 2JX9A 3AZZA 3BPZA 3NV3A 3VHOA 1SLBA 4R9AA 4FOVA 3E5XA 4XJ8A 1BVVA 2VVEA 1EAH3 4DB5A 1CAWA 3NW4A 3X29B 2HYKA 1HQWA 3I8TA 1V6NA 4P9JA 2JG8A 3G6JB 2GU9A 2XBO2 3U10A 2W68A 1OA3A 2IXHA 3VLBB 1HRV1 1GNHA 3ZO0B 1WGPA 3FZ3A 4Q4Y3 4M01A 1ZBA3 2GMEA 1BQPA 2TNFA 5D8AC 4PLNA 4YZ5A 1GSLA 2D6MA 4DS0A 2GC3A 4AK3A 1MS3A 2D98A 1RUE1 2PHWA 3MI8A 2ZGRA 4IEZA 3VGIA 2EXKA 5K9YA 2N7GA 4A7ZA 1SLLA 5JIUA 1LHWA 1NCQA 4KL1A 3RRDA 2DTYA 2GNBA 4LEJA 1COV2 3E6BA 3TNQA 4KH9A 4WZFA 4FSJA 3AYCA 4JCKA 3ZYPA 5JOZA 1DGRA 2DURA 1YHFA 5GZDA 4YW1A 2WINB 4MGIE 3BCWA 4QQPA 4YVWA 3V0BA 3I4IA 1Q8SA 2VW2A 4JGZC 2RS12 1Q3EA 2R062 2H0VA 2DVGA 4AGGA 3HMYA 1W6MA 4GMP0 3VUOA 1GFF2 3PMEA 4CDUA 1W2UA 2FQPA 5GLVA 4AYUA 4GMP1 4TWTA 4M3CB 2JE9A 4XEZA 2E51A 1V6LA 2XJQA 2OW4A 2QFEA 3MIBA 3DPRA 4JTOA 3M1HA 4D94A 4HMZA 1AJKA 1DGWX 4P5HA 1GKBA 1QXRA 4NHLA 4ONUA 3WLUA 4IERA 3AFGA 1ALYA 1GV9A 3D8CA 1RHI1 3CO2A 3ZXFA 4LNVA 3U4XA 4Y22B 5BPXA 3VDDC 4AEJA 4Q26A 4FPOB 3H9AA 2D5FA 4LLOA 1LGBA 3KGZA 3I59A 2OUHA 4MH0E 3TNPB 4P9GA 2JG9A 3ZXDA 3I7DA 4RSUA 2XVLA 3PTYA 1MZEA 1PVC1 1GZWA 1N47A 3E97A 3GZAA 1PIV2 2XJUA 1U12A 3CU7A 1Z7S1 5A3MA 1RUJ2 5J09A 3ES4A 1FPN1 2ZBJA 2YROA 2VOWA 3POSA 3WW1A 1DZTA 2VU9A 4CP1A 3ZN5A 3KS7A 3JBG3 3FWEA 4LBMA 3QCWA 1XNKA 2BNNA 4OZXA 1AXZA 4PLMA 3AP4A 4XHXA 1MS9A 4L99A 4YRDA 4D69A 4Y1VA 1X7NA 1TMF3 3S7IA 1G6NA 2QNKA 3VBSB 1QQP3 1NCRA 4R4ZA 2VECA 2PAKA 1A8DA 2PHUA 5L7OA 1O4ZA 1Q8VA 3VBRA 1ND2C 3OD0A 4DNYA 1OPMA 3WQ1A 1GQGA 3WNXA 3S0MA 3ZXGA 3M3EA 2NPIA 2HWE1 2ZPXA 3JCIA 5FOJB 3SHRA 2Y0OA 4GXLA 4QPGB 4NHMA 3OJBA 1JYIA 2VVFA 1VAKA 1CR7A 3MYXA 1UPIA 1URXA 4C0HA 4RHV1 4S2DA 3SNMA 3DN7A 3USUA 3EQEA 1RUNA 4XETA 3RNSA 1PM7A 1ZBE3 3ZIWA 3D4KA 3VBSC 3T1LA 4YGDA 4OHZA 3VZJA 3KD4A 4B7EA 2BNMA 3OY8A 3B02A 1APNA 4DRVA 2R16A 2DTWA 4ORFA 1SFYA 3MICA 4CEWC 1LHNA 1SEFA 4JRAA 3QD6A 3POWA 3UJQA 2F6BA 1CAVB 1YCIA 1RVF2 2DWRA 3AFKA 1W6PA 1OQDA 4LUMA 1VB2A 4RQPB 5CFCA 1AVBA 1LR5A 4MZUA 4FBFA 2BBVA 1W6OA 4HT1T 1LEMA 3VBHA 2FHRA 3BALA 2P17A 1RC6A 2RS32 5DDJ3 1VIWB 3TRSB 4YVSA 3ES1A 4Q4V1 2SLIA 4P9XA 4UXAA 2EAAA 4E2SA 1IKPA 2AH2A 1SLTA 3VKFC 2WWSA 5KHJA 5AC91 5EXOA 3WDYA 3ZX7A 2E6VA 2PN5A 2WJSA 2P3JA 2ZA9A 3MIDA 3SLIA 2WZR2 2GZWA 2TEPA 5I93A 4YW4A 1VBE3 3AXDA 2WT1A 4CTEA 1VBB3 4X8NA 5H9PA 1HLCA 1AYM1 1ZM1A 2HWD1 3DUIA 4AI8A 3D0SA 2YHJA 1AR81 3W9AA 4XBLA 5KC6A 3MEPA 3LSEA 4IV3A 4H3WA 1G8WA 2VOVA 1W6NA 5A3LA 4QT6A 5EJ3A 1MVEA 3N7KA 1QGLA 1RUI1 2PHFA 2ZJCA 4B29A 1PGL1 1OKQA 4Y1YA 4CDXA 3KZ4C 1AR61 1ZRCA 3IDBB 3QLQA 2ZX3A 4HL0A 1CAUB 1AUYA 1LOFA 3L2HA 5JVVA 4DMIA 1LESA 2NYYA 1CVNA 4GA9A 3RG0A 2A75A 1QJZA 5F6KA 3B00A 3ZN6A 4NWVA 5C8CA 2NMNA 1OD5A 5DG1A 5GALA 3PVBB 4AXOA 1O4YA 1BBT3 1XQNA 2NN8A 2Z79A 4AVCA 3R4UA 3VBUB 1UCXA 5BNNA 4Z1VA 4BIOA 1MS4A 4EN6B 2UY9A 3H0OA 3CNAA 4N43A 4S2GA 2G4IA 4XW3A 4H7MA 4WVMB 2LTNA 4ASMB 3VV1A 3CJIB 4QPYA 2W52A 2JDZA 5FBZA 4LBQD 4MGKE 3FJSA 4CP2A 4QXKA 3WVJA 1HRV3 4TZDA 1EV12 3VKOA 2NQYA 4AVAA 2R30A 5SV5A 3ZFEA 5IK5A 1BJQA 1W0OA 3ZFFB 3VBUC 4NHKA 1RUE3 2XL9A 1VAMA 2DVBA 1ZBA2 1RUF2 4BPZA 4IEQA 4CDQA 1YFXA 4K40A 1IS3A 1QJX2 1B35C 2CV6A 3QBQA 5L73A 3MIGA 1AL0G 5I0UA 3INAA 3GHNA 5FQ0B 1UKGA 2HWF1 2BEOA 1LGCA 1QJY1 4MUVA 1EPZA 4I2OA 3IPVB 4J1XA 4XTPA 1S2BA 3IDCB 4FXKB 2ZS6B 3ZSMA 1CQ9A 5JOYA 1PZ7A 4GWMA 2YV8A 3JB4C 1NLRA 3N36A 1N1TA 5TSWA 4NR1A 3ZFFC 1AYN3 3WP6A 2VNOA 4I3GA 3ASIA 3VHPA 4LO6B 2V09A 3OGJA 4I30A 4DINB 4AEMA 1OMIA 2FZ1A 1AX2A 3WG1A 2D97A 2PFWA 4GMP3 1HW5A 1VB4A 2PLV2 3NKTA 4Q0VA 1XNBA 1I1EA 5FMOS 3MLLA 2WNVB 3WT3A 1TNFA 1UAIA 3L9JT 4GKXA 4M0NA 2WNUA 3WUDA 2XKPA 4NWWA 3WP4A 3WINE 4GWNA 4AHYA 4Y1ZA 5ABJA 5CFDA 2A6XA 4KG8A 1LOBA 3WZ1A 2BGCA 5KXEA 1RHI3 2EXHA 2A3XA 2HWB1 1JH5A 3THPA 3D0JA 5LRSA 3VKMA 2XVKA 2Q1ZB 1AR91 2W08A 5GJ6A 4XQDA 1H8TB 4KWKA 4XFGA 3UK9A 3AP7A 2YMZA 1QU0A 3TYJA 2Y38A 4GIQA 5IK7A 2A6YA 1G7YA 4QGLA 4E9KA 4Q4W2 5KXBA 4AVSA 3NVCA 2QUOA 4M3CE 3O0VA 1QOOA 2QVSB 4X8PA 4YM1A 2ZZQA 3MFCA 2ZOEB 4M3CF 1Z7S3 1XNDA 1PVXA 2RS52 5GLUA 1MEC1 3RI9A 3QOPA 1FPN3 4PDWA 2AGSA 2XHKA 1HIXA 3MFAA 2ERFA 4P9YA 2K9ZA 4LBOA 4LBJA 4I02A 5JAXA 2R071 3D82A 4BLIA 4GB31 4FT8A 1PO22 5LEJA 1S0GA 4N53B 4NO4A 3JBG2 4PCRA 1O91A 4CDWA 1XE8A 2WC2A 4FCAA 3VBOA 1YJKA 3PJYA 3FUOA 3ILFA 3ZXLA 2QZ3A 3GBWA 2X53S 1CAXA 3HR9A 2B39A 1I6XA 1QJU2 5CVRA 3ETQA 3GBFA 1DQ4A 4YGCA 1TMF2 4GALA 5KHIA 4EN0A 1O3SA 1JOJA 2ZX1A 5F5QA 4ITCA 4FP2A 3VBFA 2WNEA 3IMNA 3POYA 1TME2 2HEVF 3B01A 2HWE3 1RUG2 1YNAA 1ZZ6A 3M3QA 3RS6A 1IGOA 2GN7A 4MV2A 4RHV3 2WSVA 4XIOA 5K0UA 5C4WB 2K2SA 3VZOA 1VJ2A 1S2KA 4LR4A 2ZHMA 1ZZBA 3GZTB 4YFWA 1GICA 5IUQA 2ZCWA 4PIXA 3SXWA 1X82A 3ALQA 5FLIA 1ZBE2 2DCKA 4INDA 3V0AB 4LHLA 4OI1A 2X5IA 1DQ5A 3H1WA 1UU5A 3ZFGC 1C8NA 2HKXA 2EA7A 4AQ6A 1ENRA 1N3OA 4HKLA 4XILA 1SDWA 4JGYB 1DZQA 1BK1A 1JHNA 1V6OA 2HEWF 1OQEA 1WBFA 3AYEA 1GNZA 4JDMA 4WBBA 4D7SA 5C4WC 1BZWA 1D0HA 1DQ2A 4ZU7A 2IWGB 3O12A 2B9UA 3VKLA 3R4SA 4Q4V3 1S0BA 2W0XA 4IV1B 4JAAA 4FQ4A 3A0KA 4LA3A 1LOGA 2JG8B 1FMD1 2B42B 1BMV2 3AB0A 5AC93 4YYOA 4N9IA 2GC1A 4S2FA 4GH4A 4JGYC 5H9SA 1A8MA 1AL21 2UWBA 1A3KA 1R1A2 5T54A 2R1BA 1OOPB 4MXWA 1AYM3 3ZVXA 4CZSA 4TLFA 1O3RA 1PGW2 1VBE2 2TBVA 4MGYE 4YW5A 4EWEA 4LHKA 4RR3A 1AR83 4L9BA 2BNOA 4COZA 1ZREA 3RPQA 2HWC1 1TQ5A 1V6MA 2ENRA 3IIAA 1FXZA 1HQNA 2JG8C 2MEV2 2PA7A 5L19A 3IBMA 2D44A 1F9KA 1RUI3 1HRI2 1UN1A 1MS1A 4MGZE 1NG0A 2VNGA 3CJXA 1AR63 1O3QA 1RUD1 4YVWB 1SCSA 1SMVA 3WXPA 4XF4A 2AR6A 2A6WA 1WUVA 4UW5A 4QGNA 2AENA 2BVBA 4BWOA 3WDTA 2GDFA 3VKNA 1DHKB 1C5HA 4DQAA 3NO8A 2ZTNA 3B5LB 1ASJ1 3TWIA 3M8LA 2DVDA 5BV6A 4I3PA 4PLOA 3E6CC 3AKRA 3J9SA 3R6SA 5BUVA 3NKGA 3HAGA 5EFUA 2KXLA 2UWCA 5I8YA 1LHVA 2IC1A 1YI7A 3LGRA 3MW3A 4XFAA 4YVWC 3VL8A 5GLWA 4OHXA 2EAKA 1GANA 1FAYA 4FPEA 1V6IA 1ND3A 3FX3A 5DXDA 3W59A 3JD71 3WHUA 4CDUC 2UWAA 3IKWA 4X6RB 2IFWA 5FO9B 2GC2A 4BOWA 1BEV2 2AUYA 3ZDSA 1FI2A 2E7QA 2JG9B 2R49A 1RB8G 3TBDA 1WLDA 4LULA 3T1MA 1GZWB 4OHVA 4XFCA 4C1WA 1MZ6A 1N3PA 2GNTA 4H55A 3AKPA 1KXGA 2NP0A 1SACA 5AFEA 4D7TA 3ELNA 2Y26A 1C1FA 4WM7A 4XQ4A 2OIIA 3T2TA 5GZFA 3IDEA 1RUH1 4OI0A 2HWF3 3UKNA 2BW8A 2H0BA 1QJY3 2EIGA 4Q1PA 2G9FA 4HN1A 1V9U3 1JBCA 4IEOA 3ZN4A 1ZX5A 4XFHA 1OA4A 3SISA 1SBFA 2BTVC 2JG9C 1WLWA 3DL3A 4JGZB 3NSTA 1AR72 2XLGA 4LBKA 5JZGA 3M4FA 2YPJA 4B8EA 3K51A 2XWJB 3S6PA 3L2YA 2RR12 1AYN2 5CG8A 1A6CA 2LUWA 1NCRB 3TN92 1GQHA 1VBC1 5T5LA 1C5IA 5JCTA 4OFGA 4OUMA 2PHDA 2GH8A 3VBRB 1VBD1 2XL7A 3N3HA 2E9QA 4RS5A 1LECA 4E2QA 1BCXA 4YM2A 4WM8A 5FTTC 2ZABA 5ACA3 1YIPA 2WFF2 2NM1A 2DFCA 1C8M1 4HK9A 5CADA 2XBO1 1OLRA 3QH7A 5T50A 3USUB 2E7TA 2HWB3 2PQQA 1OFSA 3C3VA 5I91A 3JB8A 3VDDB 5KBFA 4XMIA 3HIFA 1FOD2 1NY72 1HDKA 1AR93 1NE6A 2BFUS 1NCRC 5A33A 5L7OC 2EALA 3VBRC 3FBYA 2Q1MA 5J96B 2ZGKA 5KHKA 5IK8A 4FQZA 4FTBA 1YLLA 4DPNA 4OHYA 3V56A 3RZZA 4QX5A 1BXHA 3UL2A 2ZGQA 1RL3A 3B9IA 1NQJA 1OLQA 1MS5A 3GF6A 1LOEA 1CIWA 1VRH1 4Z82A 4AEKA 1MEC3 1COV1 2O1QA 3PNAA 3AMPA 4WVVA 3FMGA 1UZZA 2A71A 4Q0QA 4B4QA 3WY6A 2R073 4K21A 4GB33 5FPXA 3VZNA 5C9AA 1IS5A 5FMOL 2XG3A 2WS93 2RS11 2R061 1CX4A 3CF6E 2Q8OA 4PIZA 3U07A 2XKOA 1M06G 4KGQA 2DCJA 2WLQA 3PJQA 1DGLA 1R092 3ENRA 5T5OA 2XJVA 2EF6A 2ZGMA 4LTAA 4D3WA 5CFCC 4Q4X2 1ND2B 2IXKA 4AVBA 4YW2A 1SLIA 3AP6A 4DY5A 3VBHC 3LKJA 4CEYA 4YLZA 5T5JA 4UBHA 4YG3A 2A73B 4A2UA 3MLJA 1WBLA 3ME2A 3GZUC 1A78A 4AEDA 1EPWA 2B7YA 2ZGPA 3N7JA 4I0BA 4CDXB 1O3TA 1LU1A 2CNAA 1OA2A 1DYKA 3WW2A 2XJRA 4JTNA 5B2GB 5DUXA 4HETA 4CEWB 4E4DX 1PIV1 4HFSA 4ISRA 5GZEA 3ZN6B 3I2DA 3J26N 4YZ1A 2AYHA 1MZ5A 3AZVA 4KBBA 2AREA 1WLTA 1QH7A 4NPRA 2WL1A 2GC0A 2WT2A 4AGVA 1REEA 4CDXC 2FMYA 2ATFA 3GHMA 1REDA 2O8QA 3HD8B 2WZPP 1SLAA 2GN3A 1Y7BA 2PHLA 1LOFC 2A70A 4L11A 1GYKA 1KS4A 1J58A 2B46X 1FMD3 1G9DA 4FP3A 4ASLA 1NA1A 5C8CC 5FPZA 1XU2A 4XQWA 5I0SA 5CAZA 4AG4A 1XYPA 1C57A 3D6EA 2VG9A 3KT1A 1AL23 3R4DB 5JDBA 4E2GA 2YGMA 1MR5A 2RMU3 4EN8B 2FMDA 1POV0 2ZKNA 5BNNC 3B9CA 1FNYA 5BNQA 1VBA2 3NJZA 1POV1 4N43C 2HWC3 4N9HA 4DFSA 1QF3A 1C3HA 3MPBA 1LGNA 2W39A 4AE2A 4BMBA 4LT5A 2OVUA 2R043 4H14A 4FOWA 1HKDA 1RUC3 1DGRN 2MNGA 1H9WA 4Y22A 1CPNA 1ULFA 5T5PA 1JUHA 1RUD3 2RM22 4FTEA 1Y3TA 1RUI2 3DF0A 2ZZJA 4K9SA 5C6CA 5JMCA 4LO8A 1HXS2 2DU0A 4ATFA 3ROUA 2D3RA 2A7AA 4AQSA 1WCDJ 2D43A 2WQZC 4I0AA 4R4XA 4NOTA 3VN4A 4CDQC 3H8UA 3J8F1 1PGSA 1ASJ3 1Q8QA 4XMAA 1QXPA 4PJYA 2RS31 4BHPA 1ULEA 2HEYF 1XRUA 3NV4A 4RL7A 1OHFA 2KM2A 1QNYA 3AMHA 1S0IA 4HPKA 4BYYA 2DVFA 1LULA 1XE7A 1D4VB 3WV6A 1JXNA 4L97A 4SLIA