1QJX1

Human rhinovirus 16 coat protein in complex with antiviral compound win68934
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
285
structure length
285
Chain Sequence
NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords PROTEIN VP1
publication title Analysis of Three Structurally Related Antiviral Compounds in Complex with Human Rhinovirus 16
pubmed doi rcsb
total genus 60
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qjx100
1RHI3 4CEYC 4YVWA 1R1A1 1V9U2 5ABJA 4RS5C 4CEYB 1NY71 3ZFEA 5ACA3 4N53A 4RS5B 4Y5Z0 1QJY1 4CDQC 4N43C 1D4M2 2HWF3 4EJRA 1RUI1 4CEWA 4N43B 4RHV1 1RUE2 1FMD2 4CDQB 5A33B 4AEDB 1ND3C 1AL23 2HWD1 5L7OA 4FTBA 5CFDA 2HWB2 2RS31 1ND3B 1POV3 2R072 2RR11 3JBG3 4IV3C 1BBT3 1H8TA 1TME1 2RMU3 1RUD2 5ABJC 5C8CA 1AR81 2WLPA 4FSJA 1VBA1 2XBO2 4YVSA 1AYM3 2HWE3 4WM7C 1F2NA 4GMP0 4WM7B 3VBSC 2WZR2 1MEC1 1HQNA 2HWC3 2GH8A 3VBSB 1VBD1 1C8M3 1RHI2 1E57A 3ZFFA 1PIV2 1RUF1 1PO23 1B35A 2HWF2 1NA1A 3HAGA 1HXS3 1ZBA3 1R083 2WFF3 3M8LA 2FZ2A 1VRH3 1AL22 1PGL1 2R062 1NCRA 1VBC2 1R1A3 2R043 1BBT2 3NAPA 5C4WA 1QJY3 4WM8A 4PDWA 2X5IA 4JGZC 4Y4YA 2RM21 1ASJ1 1PVC2 1RUI3 1R093 4RHV3 2BUKA 1MQTA 1VBE1 4JGZB 4RFT0 1TMF1 2DF7A 5CFCA 2HWD3 3J8F1 1QJX1 2RS33 5DDJ2 5BNNA 1A6CA 1ZBE2 2RR13 4QPGA 1TME3 1EAH3 1RUH1 4Q4Y2 1X36A 2WS91 4Q4X2 4NWWA 1W39A 3VBFC 1AR83 1PGW1 1PO11 5C9AC 1VBA3 3VBFB 1ND2C 1BEV1 4GB31 5C9AB 5JZGC 1ND2B 1HXS2 1ZBA2 4QPIC 3CJIA 1MEC3 4RQPA 1NCQA 1VBD3 3DPRC 4IV1A 3DPRB 1AL0G 5K0UA 3VBUA 2R042 4Q4W1 1RUF3 1EV11 1QJY2 2ZTNA 1AR72 5BNPC 1RMU2 4RHV2 1R092 1QQP2 1QJU1 1M06G 5BNPB 4CDUC 2MEV1 3VBHC 4CDXC 2RS11 1VAKA 4NWVA 4CDUB 1RUG1 3VBHB 1NCQC 1RUC1 1RVF1 1VBB2 3JD71 1AR91 4BCUA 1RUJ1 1EAH2 1AUYA 5AC92 1GFF2 2RM23 1OOPA 4IV3B 1ASJ3 5D8AC 1FPN2 4YVWC 1TMF3 1VBA2 1HRI1 2BFUS 5D8AB 4YVWB 3J8F3 3ZFEC 1QJX3 4N53C 5FMOL 2BBVA 5ABJB 1HRV2 1DDLA 3ZFEB 3TN91 4JGYA 4N53B 1D4M1 4CEWC 2TBVA 1RUH3 2WS93 4CEWB 5L7OC 1COV2 5CFDC 2HWB1 2R071 5CFDB 1BEV3 1RUF2 4GB33 3S6PA 3VDDA 1H8TC 1K5MA 2IZWA 1H8TB 5ACA2 5C8CC 2PLV1 1PGL2 3VBRA 5A32A 4YVSC 1Z7S1 1OHFA 1EV13 4CDWA 3JBG2 4Q4V1 2WZR1 4GH4A 1ASJ2 1IHMA 5LK7B 1QJU3 4RR3A 2RMU2 2GSYA 2MEV3 2RS13 3ZFFC 1PIV1 1RUG3 5BNOA 4FTSA 1B35C 1RUC3 1RVF3 1C8NA 1AR61 1AYM2 3JD73 2HWE2 1NA1C 1AR93 3LOBA 1B35B 1RUJ3 4Z92B 2HWC2 1PGW2 4GMP1 1QJZA 1C8M2 1NCRC 1HRI3 2R061 1VBC1 1BEV2 4GB32 1NCRB 3NAPC 5C4WC 3TN93 4WM8C 3NAPB 4PDWC 2X5IC 3VBOA 1BMV2 1D4M3 1PO22 4WM8B 4PDWB 2X5IB 1PVC1 4FTEA 1MQTC 2BPA2 5BNOC 5JZGB 1FOD1 1R082 2WFF2 3ZFGA 5CFCC 1MQTB 1RB8G 5BNNC 4QPIB 1VRH2 2HWB3 4QPGC 5DDJ1 5CFCB 1ZBE1 2R073 3JB8A 5BNNB 1EV12 4QPGB 4CEYA 1R1A2 2Y26A 1NY72 4RS5A 4Q4Y1 2PLV3 4Q4X1 1NG0A 4CDQA 4N43A 2RS12 5A33A 2ZAHA 1RUI2 4AEDA 1CJDA 1RUG2 1Z7S3 1SMVA 1RUC2 2HWD2 3JD72 1ND3A 1AR92 2RS32 2RR12 1F8VA 3CJIC 4CDXB 4Q4V3 2WZR3 4RQPC 4IV3A 1TME2 4RQPB 1NCQB 4IV1C 1HRI2 1AYN1 4IV1B 2FZ1A 3ZXAC 3VBUC 5K0UC 1VB4A 1AR82 2R041 1PIV3 1VBE3 2RS51 3VBUB 5K0UB 3TN92 1AR63 1V9U1 2VQ0A 1AR71 1RMU1 4AEDC 4WM7A 1R091 1QQP1 3VBSA 1MEC2 2WWSA 1VBD2 4GMP3 1RUE1 1FMD1 2R063 1VBC3 1POV0 1VBB1 1PO13 1EAH1 5L7OB 5AC91 2PLV2 1OOPC 1PVC3 1OOPB 1FOD3 1FPN1 1RUD1 1Z7S2 5FOJB 5DDJ3 5C8CB 1ZBE3 3JB4C 1HRV1 4JGYC 2XBO1 4Q4V2 4JGYB 4YVSB 1HX6A 4Q4W3 4Q4Y3 2ZZQA 4Q4X3 1COV1 2RM22 4JGZA 1VBE2 3VDDC 1RHI1 1VB2A 1TMF2 1K5MC 1AR62 3VDDB 3J8F2 1QJX2 1K5MB 5ACA1 3ZFFB 3VBRC 2HWF1 3IDEA 1RUH2 1NA1B 3VBRB 1AYN3 2WS92 5A32B 1AL21 3VBFA 1PO12 2RS53 4CDWC 5C9AA 1POV1 3JBG1 1ND2A 4GH4C 1V9U3 4CDWB 1AR73 1RMU3 2BFUL 5JZGA 1BBT1 1NOVA 4GH4B 4RR3C 1QQP3 1FOD2 2RMU1 5C4WB 1X33A 4QPIA 5FMOS 2XPJA 4RR3B 1RUE3 1FMD3 1CD3G 3DPRA 2QQPA 1VBB3 5BNOB 1AYM1 2HWE1 4Q4W2 5AC93 1WCDJ 5GKAC 2HWC1 5BNPA 1C8M1 1FPN3 1RUD3 1QJU2 4SBVA 2MEV2 4CDXA 4CDUA 1HRV3 3VBHA 3FBMA 3VBOC 2XBO3 1BMV1 4LLFA 1PO21 1RVF2 5J98B 3VBOB 1OPOA 1RUJ2 1HXS1 3ZFGC 1ZBA1 1R081 2WFF1 1AYN2 1COV3 3ZFGB 3CJIB 5J96B 1VRH1 5D8AA 2RS52
chains in the Genus database with same CATH superfamily
1SBEA 1OA3A 1UOJA 4YVWA 4CUGA 4YG0A 1UY2A 3WF4A 4AQTA 2AACA 4CEYB 3ZFEA 1QJFA 4Q1RA 4IEZA 3VL8A 3AP7A 1N1YA 3BALA 1VMFA 4Y5Z0 1S0JA 4TSVA 4CDQC 4N43C 5ERLA 2BYVE 1UW8A 5FYVA 2GNTA 5C70A 3H42B 4EJRA 3R4DB 1WLTA 4RHV1 4QD2A 2GMMA 2PHXA 4PLOA 4HT1T 5A7OA 3RGBA 2JDUA 4YNIA 3T2TA 1JYNA 3NNFA 1I3HA 1AHSA 5L7OA 4FTBA 3PURA 1G86A 2VPVA 4UW5A 1POV3 1RXGA 4CXWA 3JBG3 4JRLA 2W92A 3NKTA 5FYSA 5F8PA 1L7RA 1CJPA 3UYJA 1H8TA 4LHLA 2BOIA 4W50A 5FZCA 1QY4A 3PUHA 1NZCA 2DTWA 4HSLA 2ID4A 2ZACA 4EWAA 5FR3A 4EN8B 4JDOA 4L11A 4PQQA 1IPJA 2BGPA 5I0RA 4B1LA 3MF6A 4DY5A 3BI3A 1GNYA 4OZOA 2XL7A 4CP1A 4NIAA 2RJLA 4R4XA 3BOWA 2XVLA 4WM7B 3VBSC 1SLTA 3E5XA 2ETEA 2YV8A 3ZN5A 3HVDA 4C1WA 4ES8A 3H50A 3K51A 1VBD1 5GLVA 1ODNA 3E6BA 4XUNA 1GQGA 1Q3EA 3RYPA 2ZEWA 2J1RA 3PIGA 1Y4WA 4MGKE 4AFCA 4MVTA 2J1VA 3OG2A 4J6GA 3SMHA 3P6BA 1JZ3A 4L0PA 2P3KA 3PHMA 1DYKA 2ES3A 2XVGA 3VZNA 4M3CA 3R0RA 5GM0A 3HAGA 1IKPA 1BHGA 1HXS3 1ZBA3 2V73A 2VL4A 2DVAA 1VIWB 2WFF3 3POJA 4XXPA 3IBMA 4I30A 4XDQA 3MUY1 4HMZA 3U4XA 1H30A 2NM1A 1VRH3 5IVCA 3ZN6B 2RDRA 3IDBB 4NR1A 5JMCA 3SXWA 2R062 3POBA 1NCRA 1VBC2 5B4XA 5JSPA 1OMIA 1GMMA 2LROA 3DUIA 4AHWA 2GC2A 2H6BA 5F37A 2VAUA 3DYPA 2DFCA 2R043 1POQA 4F83A 1CN1A 3X29B 5APAA 2VMCA 4PDWA 2BOJA 2LALA 5IFPA 2VBBA 5C7GA 2YFUA 4NPMA 5FZEA 1H2MA 2W68A 1R093 2BUKA 1VBE1 3DEMA 1GBGA 3IT8A 2HWD3 3SISA 5FZ8A 3OUJA 1DGRA 1QJX1 2RS33 3EO6A 2RR13 2AUYA 4PT6A 4XQ4A 3S7IA 3S0MA 2OXBA 1BQPA 4AHYA 2C26A 2D98A 5DAQA 1Y43B 2D6NA 3I59B 3GDBA 3RZMA 1NKGA 3KZ4C 3OEBA 3UV9A 1EAH3 2C24A 1RUH1 1REEA 2ATFA 4Q4Y2 3AZXA 3AYAA 5FZIA 3SH4A 3ALQA 4PBPA 4Q4X2 1W39A 2ERFA 3RZHA 3AFGA 1PZ8A 3H3ZA 4CUAA 4P9YA 5DZEA 3PNAA 5C9AC 3FL7A 3H0OA 1N1SA 4PI2A 1LOFC 4GB31 2PHUA 5GLWA 1ND2B 4UF0A 3H8OA 2G4IA 3ZM8A 3AJYA 2ZGOA 3DN7A 3CJIA 4MGQA 1MEC3 3KVBA 5KHKA 4RQPA 5FWEA 1FV2A 1V0AA 2J1UA 2X09A 4M00A 3RYRA 1TZOA 3WNMA 5LBFA 4JKKA 2WABA 1LOBA 2WQZC 5A6ZA 2JWPA 2ARAA 2ZX3A 3DPRB 1EUTA 1Q8PA 3GCWA 4P9JA 3I2FA 4Y1XA 1JZ2A 3BYWA 2JD4A 3N7JA 2Q0AA 4B3NA 3A0KA 3WVJA 5CU1A 2C0ZA 4H7MA 3VKFC 3SQOA 4Z07A 2ZTNA 3AKPA 1REFA 3VKLA 3I3DA 3OPWA 4HONA 3POWA 4IESA 1O3TA 5L19A 1QQP2 3ITQA 3ZYBA 2LW8A 1LJ7A 4L99A 5F3IA 3TNQA 3VD7A 5JPMB 5HCHA 5B4NA 1U12A 4CUBA 4AE2A 5F5IA 3AXEA 3A7QA 2W9XA 1OF4A 3OY8B 2O8QA 4CDUB 5A3LA 1RUG1 1XE0A 2Y6GA 3VBHB 2D97A 1XC6A 3ZMOA 2ZGPA 1OQEA 5LB6A 3CKHA 3WX5A 1HB2A 1VBB2 4IUGA 4QXCA 3WNPA 1AR91 2WNEA 4FFGA 4BCUA 2CWSA 3RMYA 2VQTA 3ZOIA 2QQVA 1XJAA 3WUCA 3I3BA 4TN7A 2YG0A 2ET7A 3HPNA 5FZ1A 3GBWA 3I4IA 5FV3A 4UFKA 4LKEA 2ZGQA 1UMZA 4FOYA 1LHNA 1FPN2 1VBA2 1HRI1 2WO2A 5J48A 4D69A 1LHVA 1KDKA 2VVEA 3VHNA 5LRSA 3ZYJB 1UD1A 3ZSKA 5LEKA 3NVCA 4IE7A 3MHZA 1R1ZA 2BBVA 2ZGNA 5ABJB 1HRV2 1KEXA 3B02A 1H6YA 3NJYA 4JGYA 4N53B 5EIYB 4V2WA 1X8MA 4NIHA 1S0CA 4Q8KA 4XAEA 4AQ6A 4OFGA 2ZABA 4NO4A 1S1AA 2W2IA 2WYFA 2Z5WA 2QFEA 2V72A 4AVBA 3GXUA 5ANNA 3Q8CA 3K4AA 5BYNA 3M3QA 4ZXKA 5CFDB 1K42A 1ZZ6A 3MIFA 5FUPA 2I74A 3RDIA 2EVXA 1W6NA 1UZ0A 3PMEA 4MADA 3FUQA 5GLZA 1WCQA 3WQ1A 4A7KA 5IVYA 3K4DA 3SH5A 2PA7A 3TEWA 1TQ5A 2VCMA 3U07A 4QQHA 3UGHA 3O0XA 4XACA 5CZKA 5FP9A 5I8YA 2D6PA 4R9CA 2W08A 1PGL2 5A32A 3WINE 5IHRA 2ZX0A 4MLOA 4YVSC 3T4VA 2AGSA 4KMQA 5IK7A 1J58A 5FZ9A 1LU1A 3CBNA 4OVEA 2QQUA 1F4AA 4A45A 3INAA 3JCIA 3E6CC 1EV13 3ILFA 3MW2A 3ZIXA 1VRBA 2KA3A 3L9JT 4G3YC 5E1RA 4BQXA 2WQ4A 1ASJ2 1IHMA 1G7YA 1CR7A 4JQTA 5J36A 2RMU2 3WF0A 1UPSA 1FX5A 1W2TA 4OUSA 4QX7A 4IGOA 1LNSA 1TNFA 2RS13 2JE8A 5KXBA 2QQWA 4FP3A 2VM9A 4YM2A 5FMDA 5A7WB 4NRPA 1Q8VA 5FY4A 1LGCA 3SHRA 5BNOA 1B35C 4HSJA 4FTSA 4S2HA 1W2UA 3LFIA 3LOBA 2VCCA 1AYM2 3BTZA 3RJ2X 3UESA 2WUHA 1NQDA 1RUJ3 1WD4A 4MHRA 5IWFA 2JG8A 3TOJA 5JI7A 2GMPA 2JECA 1DQ5A 3C2UA 5A70A 4BXFA 2B7YA 4XAAA 4Y22B 5FYHA 5C8WA 1V00A 2OKXA 1O91A 1CIYA 5E6HA 1EPZA 4LKSA 3GHMA 2NMOA 2WIIB 4UOJA 2JKXA 1BEV2 3IMNA 1XSQA 5BPXA 1CZSA 3O7OA 4M3CF 4XPVA 1O3SA 3S30A 1UZYA 3OSDA 4Y1ZA 3PUIA 5T3NA 3T4HB 3CU7A 2YZ4A 3TN93 3NAPB 2OVUA 3USUB 1HB4A 4B29A 1PO22 2I07B 4H2AA 4WM8B 1UPIA 2BPA2 5BNOC 4UXAA 3NNGA 2EIDA 2PAEA 2VOWA 1YC61 3B94A 5C3QA 5CFCC 2JDKA 3AL5A 2XLFA 5F5AA 2DVDA 4QPGC 1IS5A 5BV6A 1HV1A 3RPQA 2WN3A 3ES1A 2DURA 3JB8A 2AEZA 3KT7A 2Q8OA 1ZZ9A 4XETA 4CEYA 5CEHA 1NE4A 3QACA 5L73A 4TTGA 3I49A 1JUHA 2P17A 5DN2A 3KSCA 3TBDA 2CAUA 5IFTA 5LEJA 2EIBA 1SZBA 2P5BA 1FYUA 3UJOA 2OUJA 1OA4A 2WA3A 1NQJA 2QE3A 1ZREA 2D7FA 1GNHA 1IZ3A 4V2VA 3NNMA 4JHZA 3MIEA 1Z7S3 2R1DA 5K7PA 3Q8EA 2X05A 4RSUA 2Y64A 2FDHA 1LCLA 1LB2A 4D7SA 5LK5A 3U37A 1V6KA 3BB6A 1YQ8A 1PK6A 3ILNA 2VZSA 2QZ3A 2H0BA 4H14A 5LZ6A 2QJVA 2HLEA 3PVBB 2QZ2A 3A0NA 3UKVA 2Z2SB 5AFBA 1R64A 3ZN4A 3CZUA 3TEXA 4BXSV 1CZTA 5FPUA 4XMAA 4LBMA 1XNTA 4IV1B 2FZ1A 1ZZ8A 2CNAA 4MZUA 3AZWA 3VBUC 1VB4A 3ZYGA 3ZXAC 5K0UC 5J7MA 3FE5A 4XHBA 3AZVA 5FZDA 2J42A 4BHPA 2CY6A 2D5HA 1AR63 4OI0A 1HKDA 2VQ0A 3O1UA 1BVVA 2A3WA 1RMU1 3A23A 3N35A 4I0AA 4WM7A 2HYXA 1M4WA 2DBNA 5C5TA 3O1OA 3WF3A 2E26A 4DB5A 1UZVA 2VW1A 2WWSA 2ADEA 2PFWA 5IVBA 1VBD2 3KCYA 2J7MA 2A75A 4CCMA 2R063 3QD6A 1VBC3 4JHTA 4UBGA 1W2AX 1POV0 2P4EA 2DU1A 2VU9A 1UNBA 2YBSA 2UY8A 4O65A 4I0WB 5L7OB 1LESA 3RZGA 4YW7A 4HANA 4CU8A 2QQLA 3B69A 4C0HA 2VZTA 5DG1A 4E8DA 4LITA 3U0ZA 1VE0A 1S2EA 3ASIA 1HJGA 1OOPB 2WT1A 3S5AA 4P9GA 2IWGB 5FKBA 3HNMA 4CE8A 4K40A 3ZN6A 3RVHA 3FJSA 4E4HA 4R52A 4W8JA 5FO7B 2XDVA 4RGGA 2DCZA 4Q4V2 4W65A 2FDIA 3M1HA 2YFZA 3G7DA 5FFOC 3LOIA 4N9IA 1HX6A 2WJSA 5JMOA 3BTYA 2D6LX 1W2NA 5IK5A 3M3CA 4Q4Y3 3THPA 4AOCA 3WQBA 2P3IA 2V4VA 4Q4X3 2VUAA 2W1SA 2Y38A 2JB8A 2WQ8A 4XF1A 4AAXA 1IQDC 4QWNA 4URAA 1LEMA 5FZ6A 1VBE2 3ENRA 3VDDC 3N7LA 3EHKA 2ZHKA 3OGGA 4IERA 1K5MC 2VOVA 5IVJA 4AG4A 2R0FA 1HW5A 1QJX2 3WNNA 1C4RA 1UQXA 1OVPA 2A3XA 4K1YA 3I59A 4NHXA 3IAQA 5FYBA 4I09A 2TUNA 3VBRC 1ALYA 1RUH2 4OHZA 3TEYA 2FCUA 4M0HA 5CKMA 4QQLA 2EICA 4Q0SA 5EFUA 1OLRA 1GU3A 1ND2A 1QXPA 1V9U3 3OOXA 3J7NA 4YM1A 4MUVA 1YJLA 2WZ8A 4UFLA 5D1IA 4AI0A 4YZ3A 4CDWB 4EWDA 5FO9B 1NOVA 1SDWA 4GH4B 4CPBD 1LOGA 4RR3C 1QQP3 2I45A 3FC0A 3OEAA 4KNCA 1X33A 4OHWA 1JN2P 4QPIA 1ZYBA 2OUHA 2Q5TA 4YW4A 1ENQA 3F95A 1W6OB 1RUE3 1FMD3 1CD3G 2OT7A 3DPRA 4EZ4A 1J59A 4KBBA 1VBB3 4UWDA 5FY1A 4PLMA 4KGGA 2GP5A 2CYFA 2YB7A 3VD5A 2AREA 4R8HA 3HWJA 1G9BA 4XUQA 2Z69A 1WCDJ 3GNEA 4K8RB 3D6EA 1YQCA 1S0EA 2BGOA 2ZPXA 1FPN3 1C8M1 2B45X 3VHRA 3K3NA 1JZ7A 2OPKA 1H9PA 4YFWA 3WP3A 1KJRA 1OH3A 3OY8A 4PCRA 4V1PA 5LA0A 4CDUA 4HKWA 1HRV3 1N3PA 4LBQB 3VBHA 3OF1A 4FBFA 3FBMA 3PU8A 1BMV1 2IXKA 2Y60A 4XDOA 3S57A 4BK5A 1AX1A 1WD3A 1RITA 3VBOB 4C91A 4ATFA 2AEYA 1XNDA 2C4XA 4XQDA 5A80A 2WBKA 4GD4A 2VBPA 1PZ9A 3ZFGB 3CJIB 4QKDA 5J96B 3HMYA 2XJSA 3VHPA 1LHUA 4Q1PA 4C8DA 2RS52 4IEVA 5FP4A 3KWVA 1LECA 1RHI3 2ZCWA 3KM5A 4AI2A 3V0BA 1KD7A 3PL0A 4AK3A 2G9ZA 1UX6A 1R1A1 4OUEA 4P02B 4BMEA 5ABJA 4XJWA 4RS5C 1NY71 5FZBA 1GOFA 5KXCA 4N53A 5LW9A 3E6DA 4Z82A 5F32A 1MZEA 5EJ1B 2A73B 2HWF3 4N90A 1X7NA 4AI9A 2IFWA 3I2GA 5A33B 3W59A 2W87A 3IIIA 3WV6A 1OSGA 5FJKA 1H8VA 1FNYA 1AL23 5FY8A 3WCSA 5CFDA 3ZIWA 2D3PA 3G6JB 1ND3B 2B4KA 5IK8A 4ZU5A 4DS0A 1QNYA 2ZZJA 4AHZA 3HR9A 5DUVA 1BBT3 4P9LA 2V4AA 2E6VA 4XW3A 4BE3A 5L9VA 1D2SA 2RMU3 4CRQA 1RUD2 3UNPA 5ABJC 5C8CA 1OPMA 2Y0OA 5FYMA 1WMXA 1AXYA 1CVNA 1D0GA 4OUMA 3NJXA 1AR81 1JOBA 1NE6A 4AGRA 3WNKA 2OQ7A 1VBA1 4BZ4A 2G9GA 2XBO2 3VKMA 4CCOA 1AYM3 1UKGA 2JB4A 1W6PA 1NAEA 5IAVA 4CCCA 2PQQA 3AMHA 1K45A 5IVFA 5H9PA 3QCWA 2VTXA 4PI0A 4K21A 4QU1A 1HQNA 1DZTA 2DCTA 4CYDA 3E1F1 4K6BA 4NHKA 5LATA 3LQCA 1YXWA 3D8CA 4AFAA 1Y9MA 4WVVA 2FD8A 5IUQA 4FSJA 2QTWB 4OZXA 1E57A 1LHOA 1FI2A 4B4QA 5A7WA 3B9IA 1GWMA 3MPBA 5F3CA 3ZFFA 2GC0A 5J37A 1W03A 2YY1A 3AP5A 1QGLA 5FZGA 1PO23 1UO9A 2BV4A 5IJRA 4LPLA 1EUUA 4QXHA 1MS4A 4LIVA 1H6XA 3KS7A 1W0OA 1W8OA 3POEA 4YW2A 1SPPB 4KBZA 4BMBA 2FCTA 1XU2A 2PHTA 2J22A 3M8LA 1S0BA 4JDNA 4BQ5A 3WT3A 1T6BX 1PGL1 3O12A 2XJTA 3OBTA 1Q8OA 4AXOA 1E5RA 4MSVA 4YM0A 3AP4A 4HLTA 1HB3A 4CCEA 1ZX5A 2BEOA 3FBYA 1JHJA 4I3GA 2D43A 2DTYA 3NAPA 4YFZA 4ZKTB 5HXMA 1YNAA 3USUA 4FCAA 5A3TA 1XYOA 1JODA 3T2QA 4WM8A 5KBFA 4JGZC 2UWBA 3MLLA 2RM21 3A4UA 3POSA 1ASJ1 2WFPA 4RHV3 3WCRA 2PHFA 4OMDA 5FXWA 3OCPA 5FRAA 4QQOA 5JXIA 4OI2A 1A6CA 4LUKA 3OPTA 1UOGA 1W99A 2H0VA 1BJQA 3POFA 4COYA 1VJ2A 1DU3D 1S2KA 5T50A 1H2LA 2HJIA 5DUUA 2RHPA 3W5NA 4LBLA 3R6SA 2WKKA 3ZSMA 5FJHA 2JG8B 2WS91 5AVAA 4G4FA 4LHKA 2VTFA 1OLQA 4E8CA 4JC1A 3VBFC 4Z1VA 3N3HA 1YFXA 2WAOA 5A7PA 4Y1UA 3WR0A 4NROA 2R7EB 3OGJA 1YLLA 5CG9A 1BEV1 4AVTA 2D6KA 3DKQA 5A7QA 2YDEA 4IEQA 2CWMA 4X6RB 1QXJA 1YQ2A 2VY0A 4LMFA 1JYXA 3HNBM 1QEXA 4W6YA 5E89A 3SCGA 2CGOA 1ACCA 5FPXA 1N3QA 4QQ2A 4YGEA 2RJ2A 4ZPIA 1VBD3 4QX8A 1XYNA 1GZWB 1W9FA 4IV1A 4LBOA 4IGPA 2CSGA 3AJZA 1AL0G 3IN9A 1XOYA 1SHWB 4LBQD 4A3XA 4Q4W1 4EN0A 1ST8A 4XJAA 2VCBA 4K20A 1QJY2 3EQEA 4PF1A 1RMU2 2WZPP 4DY3A 5SV5A 1D4VB 2VGDA 3HN3A 1ONAA 1QJU1 4Y20B 4KG8A 5BNPB 1W28A 2VJXA 2NLRA 4QHZA 2CU5A 2PHLA 2C5DA 2MEV1 4XZPA 1JZ6A 1O5UA 1VAKA 4XTPA 3T0DA 1JH5A 4UBHA 4YW5A 2VC9A 4BH9A 2VOXA 1EPWA 2ZKLA 3LD8A 1KS5A 3BIEA 4NOTA 1OD3A 1WGPA 1W6MB 3CZJA 4Q26A 4Q0QA 1H4GA 4LA2A 3B00A 1ZRIA 4LJHA 4JQRA 4BM8A 1OOPA 3I2IA 1PK6B 3ACFA 1X50A 4QXKA 2OX0A 4YVWC 4LA3A 4IL7A 5D8AB 1Y9QA 4HN0A 2VCAA 2DYCA 4QDSA 3ETPA 1F35A 3ZFEC 1YCIA 1QJX3 1J83A 4X6QB 1TEIA 4RL7A 4F3JA 2CGPA 3CDZB 1JZ4A 1NLSA 2OS2A 4ATEA 4BJ0A 1D4M1 3SKJE 4IE4A 1J3PA 1RUH3 1PNFA 1Y7BA 1URXA 4META 4CEWB 3P3PA 3GBFA 2WNUB 4L2NA 5L7OC 5LA9A 4QKFA 4QX1A 4XURA 5HBAA 2HWB1 1QKQA 2GNDA 2E7AA 2R071 4AZZA 1CONA 1SBFA 1RUF2 3GGLA 4GB33 2BU9A 1H8TC 1V70A 3JUUA 4S2DA 1DIWA 1H1IA 1A8DA 2IZWA 2XONA 3OPZA 5FREA 3T1LA 4LOSA 3IM0A 4HZFA 4J1XA 5JAXA 5LA1A 4DRVA 2JENA 5A1LA 3B5LB 1OI6A 5FZ4A 4XQWA 3WP6A 2WT0A 3WEZA 4DNYA 2ZGUA 5G05L 1YHFA 1MS8A 5KR7A 1LAJA 3NQHA 1SFYA 4HOOA 5FOBB 4P5YA 5JXGA 5CG8A 2VZPA 4IETA 1W90A 1YFWA 1BZWA 3ABZA 4BA6A 5AFEA 4Q0PA 1PMHX 4CP9B 1J1LA 1SLIA 5L9RA 5FWJA 2XGXA 1WCUA 2J1SA 2VMGA 1QH6A 4CDWA 4Q4V1 2WZR1 1UAIA 4XFBA 1CQ9A 2C6SA 2VR4A 4GH4A 5C5UA 1UZZA 2F17A 3E5UA 4BOWA 3N4MA 4WBBA 4YZ1A 3N9OA 2XVKA 3GHNA 1C1LA 2E9QA 1W6OA 4M3CE 2WDBA 4TLGA 2A6VA 2XWJB 3ZYHA 3KCCA 1PIV1 4FOVA 1RUG3 4E27A 3OUHA 5KHJA 4ORFA 4YZ4A 1AR93 4QMAA 5I8SA 1A34A 2AZ5A 3LSDA 4ITCA 3ZYFA 5A1AA 1GP6A 1LKNA 2AENA 2F4PA 4GMP1 2UYAA 1C8M2 1NCRC 1HRI3 3ZXGA 5HPOA 2Q8CA 5LCWL 2PAMA 1XE7A 4PHZA 4DUVA 4E2QA 4HVRA 5J1XA 3QH7A 4LBQA 3PVOA 3O0VA 3KVAA 3FFZA 1EP0A 4PDWC 3VBOA 1BMV2 3UK9A 1LTEA 1CAUB 2JE7A 2XMLA 2VW2A 2VZQA 4FFHA 1S4CA 1PVC1 2X5IB 3EYPA 3GM8A 3J7LA 4QQPA 4URTA 3KV9A 3RZLA 4IW3A 1O4YA 1QOOA 2BJSA 3H7YA 3ZFGA 4AHXA 1MQTB 3C7FA 5CISA 4I2OA 2YU2A 3LF7A 4QPIB 4YYOA 2EF6A 2YHJA 4DPNA 3RZKA 1ZBE1 4CCJA 3CEWA 5JSOA 3MIDA 2W1UA 5BNNB 4YG6A 2Z79A 2G1MA 1ENRA 1R1A2 3RWKX 2GAUA 3AP9A 1NY72 1H2NA 2XWBB 3T3YA 2JDMA 1BYHA 2B46X 1SFPA 4F8AA 3CL1A 1O8SA 5CKQA 5LBBA 3WP4A 1LULA 3HQXA 5A33A 2A70A 2D3RA 3BIWE 3HEIA 3CO2A 3IZOA 5FY7A 3VD3A 3VD9A 3D5OA 1STMA 4FPYA 4FPLA 1RUC2 1S2BA 3JD72 4MGZE 1ND3A 4LT5A 4MGTA 2K9ZA 1KFUL 4TLFA 3LSEA 5C3PA 2L9LA 3CJIC 2OPWA 4RQPC 4IV3A 4NHYA 2LRPA 5FTTC 3THTA 1OT5A 1NCQB 1UU6A 4JDMA 4A7ZA 5DAPA 1W0PA 4JX0A 4ONUA 2WSVA 4E2GA 3J7HA 5I93A 4WV8A 2R1BA 1OURA 2WO3A 1Q8SA 1AR82 2CDPA 2R041 2VQUA 3OD4A 4UAPA 1JW6A 2RS51 4YGCA 1LODA 5CNAA 1IGOA 2E7QA 3KHBA 4Q2FA 3UETA 4RYDA 1O4TA 2EIGA 3PJQA 3V0BB 4AI8A 2B5HA 5F3EA 1X82A 1WZXA 5JR7B 1I6XA 1R091 2GZWA 2VVDA 1J3QA 3O1RA 4XJ9A 2JIGA 2F4LA 4CCLA 2K46A 2XQXA 2B8MA 4XMIA 3RRDA 2WNVA 3MYXA 1DQ2A 5JOYA 2RDQA 1W8HA 5EPAA 4K8FA 1GOHA 1H1AA 4MV2A 4WZCA 1H2KA 4QM8A 5DABA 4A42A 1PO13 2QVSB 4GZ9A 1EAH1 3DV8A 1V6JA 5EXOA 3POGA 2PLV2 4UFHA 5FYTA 1XU1A 4PF5A 5LA2A 1SPPA 1W0NA 1TVGA 4AAPA 2OW4A 3BPZA 1JOJA 1RUD1 1SBDA 4NE9A 5GZDA 3PLQA 3KT1A 4AQ2A 2QQJA 4JAAA 1ZRCA 2WT2A 3W9AA 1B09A 5C8CB 4GA9A 3M2MA 1WW5A 2XXZA 3KMHA 4JGYC 5A3WA 2VZUA 2XBO1 2PTMA 2Y34A 4ISRA 4G9SB 4Y5TA 1MS5A 1LOEA 1W6PB 1DZQA 3OGSA 5DUXA 2HKXA 3Q8BA 3WDUA 3AKQA 2JJ6A 3KHCA 2P3JA 1COV1 1XNAA 4HETA 2RM22 2YUEA 2NP0A 5JCTA 2H6CA 4HK8A 2YXSA 2QQIA 3PUAA 3UKNA 3LE0A 2Y8KA 3WDVA 1VB2A 1YYNA 2XHNA 3RS6A 3O1VA 3N7MA 2QUOA 5JIUA 4HPKB 2VQAA 3RNSA 4AF9A 2HBTA 3WNLA 5ACA1 3ZFFB 5IVEA 2GP3A 2TEPA 3AYEA 1G8WA 4LO8A 3B7MA 5JUVA 4YSFA 3JZVA 2RV9A 3WP5A 1DGLA 5J3UA 2JKBA 4D3WA 3TEZA 2WS92 1JU3A 4QGLA 5EP9A 5T54A 3GJBA 3WG1A 3H8RA 1YI7A 5CKNA 5FLHA 1JYIA 2XOMA 1YEWA 5C33A 1U5ZA 2YC2A 3GYDA 5F5CA 4BPZA 2BNMA 4R9DA 2WINB 1HN0A 5ISLA 1O7FA 4FO9A 1RMU3 2D40A 5JZGA 2G9FA 2YBPA 4LEJA 4U2AA 1AXKA 3ETQA 4LKDA 1FOD2 4NJ4A 1NZIA 1PGSA 3KGZA 1KITA 5EJZB 1RL3A 1WCSA 2W5FA 2FDKA 1FATA 1GZWA 1MZFA 4MGIE 1QDOA 2TNFA 1VP6A 2IXIA 4CU9A 1H1MA 3EBRA 4HBNA 2VNGA 3UL2A 2HWE1 4IE5A 2VUJA 3KF5A 4NHLA 2JG8C 3D4KA 3FLPA 4EWEA 2FDGA 4GIQA 4Q4W2 2BRTA 1G9AA 1KJLA 4D0QA 5A7SA 3NRUA 1QU0A 4MOAA 2PHDA 4B7KA 2HWC1 1LGNA 3SCFA 5KXDA 4Y20A 1DQ6A 5BNPA 4COVA 1QJU2 3PVEA 2VECA 5CA6A 3C7GA 3PTYA 5JOWA 1GNZA 5BXXA 2MEV2 2VD7A 2V09A 2XJQA 4CDXA 1BVP1 2GU9A 1OD5A 5J98B 1W6MA 1FAYA 5FMBA 4COZA 1TNRA 3U78A 2NN8A 4BQ1A 4LBNA 1GYKA 1JXNA 1R081 4DUWA 2BTVC 2C1FA 1AYN2 3GJAA 3T2OA 1S0DA 1ULOA 1E5SA 3NNLA 5FCCA 1QJEA 5D8AA 1TE1B 4B7EA 1US3A 3RZJA 4YARA 2ZX1A 3R4UA 4CEYC 4CCDA 3WLUA 4GXLA 3MPPG 4JTOA 4MXWB 4WVZA 4XYXA 5GJ6A 2XJRA 5M0TA 1SCSA 3AKTA 4R9BA 1J1TA 2JX9A 1Q43A 3OBZA 1QJY1 1D4M2 2C9AA 1JTZX 1KQRA 2A6YA 1DHKB 1RUI1 4CEWA 4N43B 4CDQB 4QDQA 3PUQA 2WNUA 1RIRA 5A1FA 1XB9A 1HQLA 2NQYA 3OBAA 4A44A 2YC0A 1W04A 4S2FA 2HWB2 4FFFA 4FP2A 1MR5A 4C90A 4LO7A 2R072 1PK6C 3VUOA 1DBNA 4XEZA 1TME1 1DQ1A 2PAKA 4FPKA 4ES9A 4JRAA 1PNGA 2Q1ZB 2QDRA 2VNVA 4LHNA 4QGNA 1L3JA 2ZOEB 2PHRA 3FZ3A 4JZRA 1PZ7A 1PHMA 2JG9A 3B01A 3LPGA 4FVVA 4Q29A 5KHIA 3MFAA 3MZHA 2LM3A 2KM2A 1F5FA 2WLPA 1RYYA 3M3IA 3ON7A 1CAVB 4HK9A 4TWTA 3W5MA 2O1QA 3MLKA 2QQKA 4CP9A 4E4SA 5D2AA 3RI8A 1WBFA 3ZXFA 2DU0A 4WM7C 5JVVA 1JZ5A 3I54A 2ZHNA 2X53S 1GV9A 5FYZA 4UFJA 4AVVA 2ZGSA 2LUWA 4GMP0 4M0NA 2WZR2 3TYJA 1OUXA 3LEIA 3VBSB 3FHAA 1C8M3 2BGCA 1UU4A 4LULA 4NAMA 3M4FA 3H8UA 3ZSLA 3POYA 3J7MA 5FZKA 5JDBA 2FBEA 2RDNA 1G9FA 2JDNA 2VH9A 4FPCA 1PIV2 4HVOA 1H9WA 1RUF1 2GN3A 3VDBA 4ZY9A 5JLVA 4EZHA 2VE1A 4BLIA 3ME2A 3L2YA 1NA1A 2GMEA 4M4PA 3AMNA 3LEKA 1VLNA 4KWLA 1AZDA 3SC7X 3WW3A 5EZWA 5JXJA 4D6SA 2YMZA 4GALA 5IT6A 4ASKA 2ZKNA 1XRUA 3K48A 1YIFA 1OLME 5HV4A 4DEQA 1R1A3 1JYVA 1AX0A 4QX5A 4W6XA 5C4WA 3DXTA 4K7JA 4O9EA 5FZAA 3S5QA 3ZYRA 4DUXA 1CAUA 1UY0A 1W8ZA 4MX3A 2X5IA 2ZHLA 4Y4YA 4FXKB 1X9PA 1PVC2 2RE9A 1MQTA 1TMF1 2VZVA 3KV6A 3O5SA 3UJQA 5A6YA 1O5LA 1GWLA 3THCA 1BK0A 2JDZA 3WD5A 3ZKYA 3J8F1 2DDUA 4QX0A 1U5YA 4YW3A 2CAVA 1ZBE2 4XF9A 4ZZ5A 5BNNA 3W20A 1QH7A 5FPAA 3IB3A 1O8PA 3KGLA 4XC9A 5IK4A 2XH6A 1WWYA 1O59A 3WNXA 4TYSA 2EXIA 2QCSB 4M4RA 1LHWA 1UYPA 1X36A 3C7EA 2DWRA 4NWWA 4E2SA 5A3UA 2W52A 1AR83 4XUOA 3VHOA 1DYOA 2ZGMA 3WDTA 3WW1A 4I0BA 4AGGA 5LBEA 3K77A 1VBA3 1ND2C 4W4ZA 4CU7A 3MW3A 2JICA 1UU5A 5C9AB 2N7GA 4WZFA 2ORXA 1V6OA 4FPFA 1HN1A 4RGKA 1GUIA 1HXS2 4AI3A 1ZBA2 2XJPA 4QB6A 4QPIC 2C9KA 4X8PA 1NCQA 5FUIA 5HV0A 1UMHA 3RQ0A 1PM7A 3DPRC 2V5DA 3Q8FA 4CUCA 3V65A 1LGBA 3LDBA 2VG9A 3OB8A 1KFXL 5FXXA 4EQVA 3RSJA 4XFGA 1IG3A 2R042 1EYBA 5A6XA 5KWRA 2V5YA 2XUEA 3O1PA 4IE0A 1BCXA 2XR4A 3WY6A 5EJ3A 3FUOA 3NW4A 3AMPA 4N9HA 1ODMA 3SITA 1IS6A 4CZSA 1ZA4A 2MPFA 1R092 3LA2A 2VUCA 1C57A 5FUNA 3F2ZA 3RG0A 4O61A 4BB3A 2XL9A 1MPXA 1XBFA 4CDUC 3VBHC 5C71A 1W05A 3AL6A 3KD4A 3ZO0B 2ZBJA 4NWVA 4PBOA 4FPGA 2MNGA 4LE3A 4CCNA 1LU2A 4ZU4A 4H3WA 3WW4A 1NCQC 4AEMA 2ZHMA 1YRZA 4AWDA 1RUC1 1RVF1 2K2SA 3JD71 4XCAA 1XXNA 4XBQA 4DZGA 1N1VA 4FAGA 3TAYA 4BDVB 1EAH2 3ZPYA 1AUYA 4A6OA 2CHHA 2DVBA 4XCBA 4I02A 4DXSA 5JOXA 4XFAA 2IUWA 1CPNA 2RM23 2W46A 3KF3A 1ASJ3 4IV3B 3WQ7A 3ATGA 4FPJA 2JDYA 3MFCA 2Y6LA 3HBZA 1SG3A 4BQ2A 2YGMA 3FLRA 2KXLA 2WNOA 1HV0A 5L9BA 4A7YA 1W6QB 2R49A 4N53C 4AVSA 1QXRA 3DKWA 2PYTA 5JIAA 5FKCA 5DAWA 3LB9A 4N7IA 2ET1A 2WL1A 2TBVA 2HH9A 1OFNA 1T2XA 5EWSA 1OA2A 3AP6A 2WS93 4OHXA 3O0WA 2F6BA 5DZGA 3DYMA 3PIJA 1COV2 2JE9A 5FZOB 5CFDC 5FZ0A 1UKRA 4EN6B 1NYWA 3BN6A 2ZX4A 5A3PA 2WSUA 4W6WA 2YU1A 2DCYA 1MVQA 2WNVB 4XZUG 3ZKUA 1BEV3 4H55A 3O1SA 4AI1A 5GZEA 4AW7A 2DUOA 4HPKA 4PLNA 5FZMA 4KWKA 4AGVA 2W94A 4B4PA 4ZZ8A 4TZDA 5ACA2 4XE9A 2A5ZA 3NJVA 5C8CC 2PLV1 1YWKA 1C5IA 3M3OA 2J1AA 2VVFA 4JKMA 2X29A 4LHSA 4CPBA 1FXZA 3IDCB 4OCTA 3N9QA 4XIOA 5FIXA 3PJYA 2NPIA 4KI5M 4MGYE 3UGFA 1E5IA 4CCKA 5GLTA 1UF2C 2XB6C 5F9TA 5T5JA 3DYOA 5FPVA 1CZVA 1KXGA 1LR5A 4DQAA 4HG6B 1CWPA 3FMGA 1A3KA 5AVPA 4O9GA 1X9TA 2P6HA 5LBCA 4Q0VA 1QJU3 2P3YA 2WRAA 3B9CA 1C1FA 1OKQA 5GZFA 2GSYA 1BLZA 3U10A 1OQDA 2MEV3 2CTVA 3ACIA 3ZFFC 3DCQA 4DIQA 3GF6A 3ZPOA 2ZMLA 2E31A 2IXLA 3MV11 2JDAA 1P8JA 1A78A 4GWNA 4NMIA 4QDRA 4XFHA 5CADA 2HWE2 4NHMA 4CA9A 1OKOA 1VALA 1B35B 1SQ4A 2JDHA 2PMWB 2PN5A 3V56A 5IVVA 4HN1A 4YGDA 3OYWB 2Z42A 4A41A 2FMYA 4Z92B 4XF3A 2HWC2 5DQ0A 3D0SA 1PGW2 4F7ZA 5KHGA 1Y3TA 3OJBA 4KL1A 4MG2A 2W1QA 2QBXA 3LPFA 2Q4SA 3NAPC 5FO8B 4GWMA 1JOPA 4WM8C 2Q1MA 1GANA 2DBIA 4ASMB 3I2HA 1D4M3 1MS3A 4KU7A 5F2WA 1CGPA 4SLIA 4KH9A 4FTEA 3MI8A 5JZGB 1FOD1 1R082 4CXXA 1PMIA 4Z2WA 1CAWB 1WMEA 3LCPA 1UYZA 4LXLA 3HD8B 3HIFA 5A6QA 1YFYA 5FY9A 2HWB3 5CFCB 1YI9A 4XILA 1REDA 5DDJ1 2R073 2VOTA 3VGIA 2BERA 3MIBA 4A4AA 1OUSA 1EV12 1YJKA 2VXRA 3EB7A 3M3EA 1JYCA 4Q0UA 1DQ4A 4QPGB 5F6LB 4MXWA 2YYOA 2Y6HA 1JI6A 3R05A 3VKOA 1G9DA 2GC3A 5C3RA 1VAMA 4A6SA 4UW6A 1ZA7A 4AQSA 1D7PM 1NG0A 1NXMA 4P9IA 1UY3A 2KD7A 4CDQA 4N43A 1QNWA 2RS12 1F15A 4M01A 5G04L 2ZAHA 4XUPA 1RUI2 1CJDA 3ZMNA 5L36A 4XJZA 4LQRA 1WW6A 2BWAA 3MBWA 4CDXB 4Q4V3 2WZR3 4LE4A 2J1TA 1WA6X 2EALA 4PIYA 1JYWA 4ZHNA 1TME2 1OH4A 4BK4A 2D6MA 4QPWA 4IV1C 1EY2A 3IAPA 1FV3A 1RJ7A 1AYN1 4XFCA 5B2GB 3WG2A 1IG0A 2DVFA 4UFIA 3SH3A 2WA4A 4GJZA 1CAVA 5CBLA 1IOAA 1QHDA 1PIV3 1UOBA 1VBE3 2CDOA 3NV2A 3VBUB 5K0UB 5DPNA 3TN92 4TXWA 2OA2A 4L97A 1JU4A 1RJ8A 2FHRA 3M70A 3WG3A 4Y1VA 4BQ3A 5C6CA 1AR71 1W8NA 2LTNA 3ZDVA 1XPWA 1VR3A 2D44A 2O8OA 4XDPA 4BIFA 3ZYIB 3VBSA 3OBRA 5GZCA 1WUVA 3AB0A 1ZRRA 3HNYM 5FY5A 4GMP3 1O6UA 3E97A 4LLOA 2FMDA 2IVJA 3N9LA 4AR2A 5JXHA 2B42B 1ULFA 4Y24A 5D21A 4ARXA 4RGAA 4XJUA 5T5OA 1MVEA 2XUMA 1ZVFA 4QX3A 3VD4A 2E53A 3BTAA 5AC91 3MGUA 1QIQA 1OOPC 4Y4RA 3LWCA 4QPYA 4LK6A 5CVRA 1PVC3 1DLLA 5FY0A 1X8EA 2VULA 2FDFA 2SLIA 1A8MA 1W9WA 1Z7S2 1KRIA 5CAZA 2W0XA 3CHXA 4RN5A 2XG3A 4GKXA 2JG9B 2GALA 2QNKA 1ZBE3 3JB4C 1QF3A 4E4ZA 5GALA 5DXDA 3I8TA 2ZS6B 3MW4A 4CTEA 4DXRA 2ZEYA 4IEOA 4NN0A 4XXAA 3LIGA 4P08A 3CMGA 4HVQA 1HDKA 2ZZQA 3AMMA 2WN2A 3QBQA 3ZSEA 1VAVA 3MO4A 4A2UA 3N9MA 2PXJA 1UMIA 1IS3A 3BODA 4RD7A 4OI1A 1TMF2 2RVAA 5A3OA 1WLDA 2QQMA 1AR62 3VDDB 1I9RA 3J8F2 1K5MB 5FK7A 3LEGA 5FZ7A 2D93A 1WCKA 3HQUA 5EQUA 5A3NA 3HBKA 4NPLA 1CIWA 2HEVF 1MACA 3KQRA 2ZGKA 2WYSA 4NPRA 2VO5A 1DP0A 2Y6KA 3VKNA 1CX1A 3OGVA 1NA1B 1ZZCA 1XNCA 3VBRB 3C8XA 5EHDA 2ZXQA 4UW4A 4D7YA 4NUBA 5KXEA 2RS53 1V6MA 4WVWA 4XABA 5F2SA 2GH2A 4CDWC 5C9AA 1POV1 3ILRA 3JBG1 2EIEA 1S0IA 3MIGA 4GH4C 4JVAA 4EV0A 3O1MA 1LOFA 3L2HA 5I0SA 3FWEA 1MS1A 3NJZA 1F31A 1DCSA 1NX9A 3V0AB 5C4WB 1OQ1A 5E88A 5FMOS 2OZJA 2Y33A 2YROA 4RR3B 2HEYF 1UY1A 1UYYA 3K46A 2DUPA 4QGMA 4XF4A 4XF0A 3AX4A 3HT1A 3IPVB 3HT2A 2W1WA 4QT6A 3WF1A 1UIKA 3P5BA 3PUSA 1AJKA 1ENXA 1HQWA 3BGAA 4ZS3A 3O14A 4D7TA 3ZXEA 3ELNA 1AVBA 4B1MA 2VZ3A 4NAOA 4FXGB 3I3EA 4FPOB 5FPLA 2W47A 3RYKA 3BKZA 3N9PA 4WVMA 5JR2A 1PX4A 4ZONA 1GQPA 1L7LA 3ZDSA 1RUD3 1YO8A 3D82A 4UI9L 4IQPA 4SBVA 4XJ8A 5FQ0B 4CXYA 1SCRA 5H9RA 3T09A 4C0BA 1XSRA 4L8QA 3VBOC 2XBO3 3OUIA 3VDAA 3LGRA 3I2OA 3DECA 4P00B 3A21A 2PHWA 4LLFA 1NLQA 2YPDA 1F5JA 4LIUA 1RVF2 3WG4A 4D6QA 3LAGA 3DF0A 1DZRA 1OPOA 1RTVA 4LK7A 1QOTA 4IEPA 1HXS1 3ZFGC 1ZBA1 1W2OA 1XNBA 2WFF1 1S0GA 1I5PA 2WWJA 4OULA 1OBNA 4QB2A 5E16A 1COV3 2R0HA 3VV1A 2AC1A 3ZR5A 5JI9A 1O3QA 1VRH1 3ZX7A 3VL9A 3MEPA 2WAAA 2B9VA 3NV4A 5DUWA 2BZDA 2JEMA 5A3MA 5JPNB 2GDFA 4XHXA 3TNPB 3ECQA 1W6QA 5I0DA 5IW0A 5C3SA 2X8KA 4FOWA 1V9U2 3WNOA 3FLTA 5EV7A 4OQ9A 3CNAA 2GC1A 2DUQA 2VMFA 1V6NA 2ZGTA 3CQOA 4GULA 1UYXA 5ACA3 3I7DA 3VZMA 2W39A 4RS5B 1D0HA 4COUA 1SEFA 1WLWA 4MXVA 2E7TA 1RUE2 1FMD2 3HJRA 5FZOA 4AEDB 4UW3A 1ND3C 1XYPA 4GQ7A 2HWD1 4DFSA 2ZA9A 4YM3A 1W9TA 2A7AA 2E51A 1QOSA 2OZ6A 4L92A 3BTXA 3AZYA 4LUMA 2RS31 3T30A 1IS4A 4QM9A 2RR11 4OQ8A 4IV3C 4FOQA 3LEMA 5DAVA 2K0GA 2O14A 1N1TA 1HIXA 2D3SA 3NMBA 2UYBA 4FQ4A 4YLZA 4YGBA 4AEKA 1DGWX 3AYDA 1Y9GA 1K3IA 1Z0HA 3K3OA 3KT4A 3BOPA 1LENA 2X10A 3WDYA 1UOFA 2BVVA 3GBGA 2RJKA 3NL1A 3HN1A 3I97A 5FZLA 5KC5A 1JS9A 4YVSA 4ASLA 3NNJA 2BNOA 2HWE3 1U5IA 3H1WA 2GNBA 3LDKA 2GNMA 2DFBA 4Z2AA 4LBKA 1W06A 5FLJA 1F2NA 4YW6A 2Q8EA 3WF2A 3H1MA 2BNNA 1NT0A 1MEC1 3RJRA 4FAHA 2HWC3 2WNVC 4KWUA 5FPZA 2GH8A 1C3HA 2VMEA 3ACGA 2O0OA 3V64A 4I01A 1RHI2 3EXUA 2VTXJ 3H1YA 1W8WA 3T0BA 5F39A 2WR9A 4NVPA 5FYCA 1ZZBA 3BPSA 1MS9A 4ZU7A 2D6OX 4P9WA 3MF9A 1TG7A 4NIGA 4FI9A 3CLPA 5FYIA 1B35A 3LIHA 2OYZA 4CSWA 2HYKA 1VMJA 2HWF2 4GJYA 3T2PA 3OYWA 1CAXB 1NUKA 1R083 1T6GC 5LY2A 3J9SA 4XIKA 4YRDA 1UXZA 3NV1A 5SV8A 5F1RA 3K75B 5DAXA 2R6QA 3HQRA 3KV4A 4YWAA 2FZ2A 2A1XA 1CX4A 3S7EA 1AL22 4B4RA 1NLRA 3VZJA 3K4ZA 3C3VA 1O4ZA 1UN1A 3H3UA 3QOPA 1GZCA 4Y33A 1YQ5A 3AYCA 2BBAA 1KGYA 1XNKA 5HI0A 1BBT2 1ULEA 1C28A 4AYUA 2YPJA 4IXLA 4QU2A 5FAXA 5FMCA 1QJY3 1CPMA 1BXHA 2HEWF 4AL9A 2DV9A 4A3ZA 3NV3A 5LASA 3MIHA 4J25A 4ARYA 1JBCA 4EROA 2VZOA 5BNQA 1RUI3 3LA7A 1CAWA 4JGZB 4RFT0 3SCHA 4DMIA 2DF7A 5CFCA 4FQZA 2ORZA 3OTFA 3H8XA 4X8NA 5DDJ2 3AK0A 5DZFA 1W8TA 4QPGA 4HXCA 5FP8A 1ZRDA 3W58A 3ES4A 4P14A 1OVSA 4LR4A 1J84A 1WBLA 2LS6A 4IEUA 4K9SA 1UY4A 3RWNA 1WW4A 5LRRA 1TME3 4HKLA 1SLCA 2P2KA 3I3QA 4XUTA 5FXVA 1SACA 4I3PA 5FLIA 3WZ1A 1N47A 4CP2A 3GZUC 1YFUA 3A22A 2R30A 3EMRA 1SFNA 3KCXA 3WSOA 3PTRB 1PGW1 1PO11 3MICA 3Q9OA 1UL9A 2YC4A 3VBFB 3ACHA 2UURA 1LOCA 1GP5A 4BQ4A 5JOZA 3AFKA 4OHVA 1MZ5A 5CYYA 4BISA 5JZGC 5CIRA 2VZ1A 5J09A 2B39A 4MYEA 1WLCA 4UT5A 2QDNA 2SBAA 1IKQA 4JTNA 2ZJCA 5K8SA 3U75A 3KQ4B 3SKVA 4Z8BA 1KDMA 5T5LA 2PELA 2IXHA 4HL0A 2RDSA 5FYUA 4Y1YA 5TSWA 3RZZA 1US2A 1PVXA 3VZKA 2NYYA 4BYYA 5T55A 4MHUA 4LOTA 5K0UA 4YPJA 4XTMA 3THDA 3VBUA 4HFSA 3LFMA 1IPKA 1RUF3 3BU0A 1EV11 1PM4A 2E63A 3OGRA 3POIA 4IE6A 4BQYA 3CJXA 4Y26A 2IVIB 5F3GA 1AR72 5BNPC 3I2KA 4JKLA 4RHV2 4MO3M 1M06G 4Y5SA 2ZGLA 3J26N 4CDXC 1H0BA 2RS11 3OD0A 3WXPA 5BY5A 1SDDB 3NWKA 5ANQA 4OHYA 2DCKA 1V6LA 1RUJ1 2Y6FA 5KC6A 4P9XA 3UKTA 1DGRN 2UY9A 4LKFA 5AC92 3GCXA 4UFMA 1GFF2 3WOGA 1UXXX 1F9KA 3FHQA 5D8AC 2WWUA 3LZZA 3HOBA 1TMF3 1RC6A 2BFUS 2VZRA 4YVWB 1RUOA 3J8F3 5EYYA 4BQWA 5FMOL 1WMDA 3GZTB 3ZXKA 1DDLA 2W95A 3ZFEB 3DL3A 3TN91 3T08A 4EYUA 3H3LA 1CESA 3E5QA 1WW7A 5FP3A 2AYHA 2YBKA 4RFRB 3SNMA 1F4HA 4CEWC 1K5JA 5KHHA 2WNUC 4YW1A 3FHIB 1BK1A 3O1TA 2WO1A 2R32A 2A6ZA 3Q8AA 4QHBA 1S55A 5I0TA 4D94A 1FT9A 4OI4A 3AZZA 2JXAA 4LO6B 2W3JA 4PIZA 1ENSA 3S6PA 3VDDA 3D0JA 3TB0A 2GN7A 4Q8LA 1K5MA 3MDPA 3T1MA 2ARCA 5GLUA 2XHKA 1GZTA 1AXZA 4PIXA 4K3UA 1H8TB 3AC0A 2NZ9A 4XFIA 5I0UA 3VZLA 2OQ6A 3ROUA 2JG9C 4EE2A 2AH2A 4IEWA 4XVHA 2EXKA 2VMDA 3VBRA 5BUVA 4QKBA 4LORA 4QAWA 4P5HA 4OLLA 3ZYPA 3H7JA 2XKPA 1Z7S1 5DMYA 5K9YA 2UU8A 2W91A 2IFRA 3WHTA 3I2DA 3ORJA 1OHFA 1OLMA 2ZAAA 5FZFA 3SLIA 1IQAA 3JBG2 2D5FA 4GAZA 2P37A 4Y3OA 2IXCA 5EYXA 2ENRA 4EN9B 3AXDA 1D2QA 3ZSJA 1FNZA 3V0AA 3T0AA 1WA4A 4AVAA 5IATA 5LK7B 4RR3A 1VPHA 3JXSA 1PX3A 4IEYA 1JHNA 2Y0IA 4XBNA 5HXVA 3ST7A 3IPVA 2JDPA 4NIIA 3MV01 5HCAA 4AFDA 2BW8A 4YG3A 4FFIA 1RUC3 1C8NA 1AR61 1RVF3 3JD73 1UCXA 4ZXEA 1NA1C 1N3OA 2WZEA 1MS0A 3I2JA 3VB9A 1O3RA 1XE8A 3WQ0A 1ZRFA 1BKZA 2Q1FA 4M3CB 1Q56A 4QXBA 4DEVA 4U36A 4B8EA 3BCWA 3B3QE 1UZWA 4IDZA 2CV6A 1QJZA 4NRMA 4QHOA 5FQ0A 2R061 2J1EA 1VBC1 2HBUA 1QMJA 3J4UH 4GB32 4DO0A 1K12A 1YQ6A 1NCRB 5C4WC 2MHFA 1G6NA 1GZ9A 1UX7A 4RA0A 5F5QA 1J3RA 4AEJA 3C7OA 4QX2A 2X5IC 3GZEA 1NXD1 3KLSA 3PU3A 3RMXA 2EXHA 4BLJA 2P34A 4KQ7A 4PDWB 4CP0A 1MQTC 3AMQA 2ZMKA 4EN7B 3BU7A 2WFF2 3RFRA 1WMFA 2XLAA 2Z4FA 2P1BA 3AKRA 2UWAA 3N36A 2EAKA 5BNNC 1RB8G 1VRH2 1GOGA 1Q5OA 4OMCA 5DG2A 5GZGA 4XBLA 1GKBA 2OIIA 4R9AA 4QKNA 2Y26A 5CB7A 2ARBA 4H7LA 3LA3A 4RS5A 3VZOA 4NRQA 4DINB 4Q4Y1 4UYBA 2PLV3 3W21A 1DLCA 4Q4X1 3I3MA 1GQHA 2JD9A 1V6IA 2DCJA 3N9NA 1ULGA 3KB5A 4AEDA 5E8AA 2A3YA 1RUG2 4WVMB 3TWIA 1I1EA 1APNA 3APBA 1SMVA 5LWBA 2HWD2 1XQNA 1AR92 5JSRA 1YUDA 3P1IA 2RS32 4UF0B 4N8MA 2I2SA 2RR12 1F8VA 1ULPA 5I8TA 2XLGA 2VUDA 4K1ZA 2ZGRA 1LRHA 5FK8A 3DGTA 2YGLA 4JV4A 1GP4A 4RQPB 5I91A 3QLQA 1DQ0A 2P6CA 3NO8A 2PQSA 1HRI2 2QQNA 2BQPA 1W9YA 4E4DX 1AX2A 4FPEA 3GZAA 2EAAA 2G19A 5F6KA 2ZX2A 4LBJA 4IGQA 1V9U1 4XFFA 2B9UA 3SEPA 4AEDC 2Y6JA 3AVSA 2R16A 2E33A 4BIOA 1QQP1 3U11A 2BVBA 1RUNA 3AVRA 3GALA 1MEC2 2IC1A 2XJUA 3AKSA 5HCFA 2Q8DA 2WLQA 4DXZA 1OC1A 1IPSA 1UIJA 2IXJA 1GSLA 1RUE1 1FMD1 1VMHA 2CGNA 4KGQA 2Q30A 2XKOA 4AFBA 5JWPA 3VN4A 4NIDA 1U0AA 1LEDA 1KS4A 1VBB1 2VNRA 3WDWA 4BU2A 3IIAA 1C5HA 4HKOA 2ZMNA 1JYTA 3KV5A 2QQOA 3K2OA 2WC2A 4ISQA 4D8MA 4YZ2A 1CAXA 1JZ8A 3JU9A 1HLCA 1FOD3 1FPN1 2UWCA 2A71A 3WHUA 3R4SA 2ARXA 2AR6A 4INDA 4CU6A 2XJVA 5FOJB 3WW2A 3IWZA 5DDJ3 5FPBA 1SLBA 1HRV1 5FYYA 1QDCA 1UWWA 4ET7A 1ZNPA 3CF6E 4Q27A 4BWOA 1AJOA 3ACLA 3ZVXA 4CVUA 5IAXA 4JGYB 1DF0A 4YVSB 5FBJA 1QWRA 1SLAA 5FP7A 1ZM1A 2VMIA 4Q4W3 2FCVA 5T5PA 1OF3A 4R4ZA 2CL2A 4KWJA 5FZ3A 3JQWA 1DYPA 4JGZA 3JQXA 5H9QA 2FDJA 3FFQA 4DOUA 3PDQA 4L9BA 1RHI1 1G9CA 1OFSA 4GWIA 2EA7A 3N7KA 3UT0A 4FT8A 4ZS2A 4AFMA 4COWA 3FX3A 1W3VA 5F7UA 1W9SA 2ILMA 3AM2A 1W6NB 3LDRA 4OYUA 3TRSB 4LO4B 4Y22A 3U1XA 1OXCA 4D6RA 2QKDA 2RG4A 2E32A 2HWF1 4KU8A 1E5HA 1GLHA 3FN9A 3IDEA 4AVCA 3LKJA 3WUDA 1AYN3 2VOKA 5A32B 3ZXLA 1DG6A 3MUZ1 3SEEA 1S0FA 1AL21 3UGGA 3VBFA 4E9KA 3NSTA 1PO12 2NMNA 2EXJA 1GWKA 4IEXA 1L7QA 1W8FA 2A6XA 3B93A 5HCBA 3IKWA 4JCKA 3ZLIA 1HJFA 1W8UA 1RINA 3D3AA 4KG0A 1HB1A 4C1XA 2FQPA 1AR73 2BFUL 1BBT1 2DVGA 3IMMA 5T52A 5FXZA 3VDCA 2RMU1 1PMJX 3BUCA 1DGWA 1JMUB 2VW0A 3USSA 2XPJA 3WDXA 1DFQA 1RXFA 1U5XA 3CIHA 2VMHA 4MH0E 1H4HA 5C3OA 3DXUA 3P3NA 5LY1A 2QQPA 4DXTA 5BNOB 1AYM1 1ULDA 4GWJA 1Q8QA 3EJKA 2KR2A 5FDBA 3ZR6A 5AC93 3QH6A 5K4LA 4S2GA 3IDAA 2XQRA 1ULCA 5GKAC 2ADDA 2BDRA 2VNOA 4PJYA 4XOGA 5FZHA 3VLBB 4N7UA 2VXJA 1GR3A 3C7HA 3H9AA 4YZ5A 3U4SA 3BVCA 1I5ZA 3PVNA 1WKYA 1RGSA 5H9SA 4J1WA 4LNVA 2BWCA 3ZXJA 5IYYA 4FPHA 1SLLA 2ZEZA 3RI9A 5FBZA 2BP6A 1PO21 2VBDA 3NKGA 1ZZ7A 1GICA 1JUIA 1W3XA 1YIPA 4QB1A 3MLJA 4Q5OA 1RUJ2 3U14A 1LOAA 4GKYA 2WO7A 4PQ9A 3URFA 4MGSA 2A6WA 3M7AA 1Z78A 4O7XA 4DRRA 1AF9A 2JIJA 4LO5B 3ZXDA 2ZEXA 1MZ6A 3PMSA 4LTAA 5A7NA
chains in the Genus database with same CATH topology
1SBEA 1OA3A 4YVWA 4YG0A 4AQTA 4CEYB 3ZFEA 4Q1RA 3VL8A 4IEZA 3AP7A 1N1YA 3BALA 4Y5Z0 1S0JA 4TSVA 4CDQC 4N43C 2BYVE 1UW8A 2GNTA 4EJRA 3R4DB 1WLTA 4RHV1 4QD2A 2GMMA 2PHXA 4PLOA 4HT1T 4YNIA 3T2TA 1I3HA 1AHSA 5L7OA 4FTBA 1G86A 2VPVA 4UW5A 1POV3 3JBG3 4JRLA 3NKTA 1CJPA 1H8TA 4LHLA 1QY4A 1NZCA 2DTWA 4HSLA 2ZACA 4EWAA 4EN8B 4JDOA 4L11A 1IPJA 5I0RA 3MF6A 4DY5A 2XL7A 4CP1A 2RJLA 4R4XA 3BOWA 2XVLA 4WM7B 3VBSC 1SLTA 3E5XA 2ETEA 2YV8A 3ZN5A 4C1WA 4ES8A 3H50A 3K51A 1VBD1 5GLVA 3E6BA 3RYPA 1GQGA 1Q3EA 4MGKE 4AFCA 4MVTA 4J6GA 3SMHA 2P3KA 3PHMA 1DYKA 2ES3A 2XVGA 3VZNA 4M3CA 3R0RA 5GM0A 3HAGA 1IKPA 1HXS3 1ZBA3 2V73A 4XXPA 2DVAA 1VIWB 2WFF3 3IBMA 4I30A 4XDQA 4HMZA 3U4XA 1H30A 2NM1A 1VRH3 3ZN6B 3IDBB 4NR1A 5JMCA 3SXWA 2R062 1NCRA 1VBC2 5JSPA 1OMIA 3DUIA 4AHWA 2GC2A 2H6BA 2DFCA 2R043 4F83A 1CN1A 3X29B 4PDWA 2LALA 1H2MA 2W68A 1R093 2BUKA 1VBE1 1GBGA 3IT8A 2HWD3 3SISA 1DGRA 1QJX1 2RS33 3EO6A 2RR13 2AUYA 4XQ4A 3S7IA 3S0MA 1BQPA 4AHYA 2D98A 1Y43B 2D6NA 3I59B 3UV9A 3KZ4C 1EAH3 1RUH1 1REEA 2ATFA 4Q4Y2 3AZXA 3AYAA 3SH4A 3ALQA 4PBPA 4Q4X2 1W39A 2ERFA 3AFGA 1PZ8A 3H3ZA 4P9YA 5DZEA 3PNAA 5C9AC 3H0OA 1N1SA 1LOFC 4GB31 2PHUA 5GLWA 1ND2B 2G4IA 3AJYA 2ZGOA 3DN7A 3CJIA 5KHKA 1MEC3 4RQPA 1FV2A 4M00A 3RYRA 1LOBA 2WQZC 2ZX3A 3DPRB 1Q8PA 4P9JA 4Y1XA 2JD4A 3N7JA 2Q0AA 4B3NA 3A0KA 3WVJA 5CU1A 2C0ZA 4H7MA 3VKFC 4Z07A 2ZTNA 3AKPA 1REFA 3VKLA 3POWA 4IESA 1O3TA 5L19A 1QQP2 4L99A 1LJ7A 3TNQA 5JPMB 1U12A 4AE2A 3AXEA 3OY8B 5A3LA 2O8QA 4CDUB 1RUG1 3VBHB 3ZMOA 2D97A 2ZGPA 1OQEA 3WX5A 1VBB2 1AR91 2WNEA 4BCUA 2CWSA 3RMYA 3WUCA 2ET7A 3GBWA 3I4IA 2ZGQA 1UMZA 4FOYA 1LHNA 1FPN2 1VBA2 1HRI1 5J48A 4D69A 1LHVA 1KDKA 2VVEA 3VHNA 5LRSA 3ZYJB 1UD1A 3ZSKA 5LEKA 3NVCA 1R1ZA 2BBVA 2ZGNA 5ABJB 1HRV2 3B02A 4JGYA 4N53B 1X8MA 1S0CA 4Q8KA 4AQ6A 4OFGA 2ZABA 4NO4A 1S1AA 2Z5WA 2QFEA 4AVBA 5BYNA 3M3QA 4ZXKA 5CFDB 1ZZ6A 3MIFA 2I74A 3RDIA 2EVXA 1W6NA 3PMEA 5GLZA 3FUQA 3WQ1A 4A7KA 3SH5A 2PA7A 1TQ5A 3U07A 4QQHA 1PGL2 3O0XA 5I8YA 2D6PA 4R9CA 2W08A 5A32A 3WINE 2ZX0A 4MLOA 4YVSC 2AGSA 5IK7A 1J58A 1LU1A 4OVEA 3INAA 3JCIA 1EV13 3ILFA 3MW2A 3ZIXA 4G3YC 2KA3A 3L9JT 5E1RA 2WQ4A 1ASJ2 1IHMA 1G7YA 1CR7A 5J36A 2RMU2 1UPSA 1FX5A 4OUSA 1TNFA 2RS13 5KXBA 4FP3A 4YM2A 1Q8VA 3SHRA 1LGCA 5BNOA 4FTSA 1B35C 4HSJA 4S2HA 1W2UA 3LOBA 1AYM2 3RJ2X 1NQDA 1RUJ3 1WD4A 3TOJA 2JG8A 5JI7A 2GMPA 2JECA 1DQ5A 3C2UA 2B7YA 4Y22B 5C8WA 1V00A 1O91A 1EPZA 3GHMA 2NMOA 2WIIB 1BEV2 3IMNA 5BPXA 3O7OA 1O3SA 4M3CF 4XPVA 3S30A 1UZYA 4Y1ZA 5T3NA 3CU7A 2YZ4A 3TN93 3NAPB 2OVUA 3USUB 4B29A 1PO22 2I07B 4WM8B 1UPIA 2BPA2 5BNOC 4UXAA 2PAEA 2VOWA 3B94A 5CFCC 2XLFA 2DVDA 4QPGC 1IS5A 5BV6A 1HV1A 3RPQA 3ES1A 2DURA 3JB8A 3KT7A 2Q8OA 1ZZ9A 4XETA 4CEYA 1NE4A 3QACA 5L73A 1JUHA 2P17A 5LEJA 3KSCA 3TBDA 2CAUA 1FYUA 3UJOA 2OUJA 1OA4A 2WA3A 1NQJA 2QE3A 1ZREA 2D7FA 1GNHA 1IZ3A 3MIEA 1Z7S3 2R1DA 5K7PA 4RSUA 1LCLA 1LB2A 4D7SA 5LK5A 1V6KA 3BB6A 1PK6A 3ILNA 2QZ3A 2H0BA 4H14A 2QJVA 3PVBB 2QZ2A 3A0NA 3UKVA 2Z2SB 5AFBA 3ZN4A 4XMAA 4LBMA 4IV1B 2FZ1A 1ZZ8A 2CNAA 4MZUA 3AZWA 3VBUC 1VB4A 3ZYGA 3ZXAC 5K0UC 3FE5A 4XHBA 3AZVA 4BHPA 2CY6A 2D5HA 1AR63 4OI0A 1HKDA 2VQ0A 1BVVA 2A3WA 1RMU1 3N35A 4I0AA 4WM7A 1M4WA 4DB5A 2VW1A 2WWSA 2PFWA 1VBD2 3KCYA 2A75A 2R063 3QD6A 1VBC3 4UBGA 1POV0 2VU9A 2DU1A 2UY8A 4I0WB 5L7OB 1LESA 4HANA 3B69A 4C0HA 5DG1A 3U0ZA 3ASIA 1OOPB 2WT1A 4P9GA 2IWGB 4K40A 3ZN6A 3FJSA 4R52A 5FO7B 4RGGA 2DCZA 4Q4V2 4W65A 3M1HA 5FFOC 3G7DA 3LOIA 4N9IA 1HX6A 2WJSA 2D6LX 5IK5A 3M3CA 4Q4Y3 3THPA 2P3IA 4Q4X3 2VUAA 2Y38A 4XF1A 1LEMA 1VBE2 3ENRA 3VDDC 3N7LA 3EHKA 2ZHKA 3OGGA 4IERA 1K5MC 2VOVA 4AG4A 2R0FA 1HW5A 1QJX2 1C4RA 2A3XA 4K1YA 3I59A 4I09A 2TUNA 3VBRC 1ALYA 1RUH2 4OHZA 4M0HA 4QQLA 4Q0SA 5EFUA 1OLRA 1ND2A 1QXPA 1V9U3 4YM1A 4AI0A 4CDWB 4MUVA 1YJLA 5D1IA 4EWDA 5FO9B 5J7MA 4YZ3A 1NOVA 1SDWA 4GH4B 1LOGA 4RR3C 1QQP3 2I45A 3FC0A 4KNCA 1X33A 4OHWA 1JN2P 4QPIA 1ZYBA 2OUHA 2Q5TA 4YW4A 1ENQA 1W6OB 1RUE3 1FMD3 1CD3G 3DPRA 1J59A 4KBBA 1VBB3 4PLMA 4KGGA 2CYFA 2AREA 4R8HA 3HWJA 1G9BA 2Z69A 1WCDJ 3GNEA 3D6EA 1S0EA 2ZPXA 1FPN3 1C8M1 2B45X 3VHRA 2OPKA 1H9PA 4YFWA 3WP3A 1KJRA 3OY8A 4V1PA 4PCRA 4CDUA 4HKWA 1HRV3 1N3PA 4LBQB 3VBHA 3OF1A 4FBFA 3FBMA 1BMV1 2IXKA 4C91A 1AX1A 1WD3A 1RITA 3VBOB 4ATFA 1XNDA 4XQDA 1PZ9A 3ZFGB 3CJIB 5J96B 3HMYA 2XJSA 3VHPA 1LHUA 4Q1PA 2RS52 4IEVA 4AI2A 1LECA 1RHI3 2ZCWA 3KM5A 3V0BA 1KD7A 4AK3A 1UX6A 1R1A1 4BMEA 5ABJA 4XJWA 4RS5C 1NY71 5KXCA 4N53A 3E6DA 4Z82A 1MZEA 2A73B 2HWF3 4N90A 1X7NA 2IFWA 5A33B 3W59A 3WV6A 1OSGA 1H8VA 1FNYA 1AL23 3WCSA 5CFDA 3ZIWA 2D3PA 3G6JB 1ND3B 5IK8A 4ZU5A 4DS0A 1QNYA 2ZZJA 4AHZA 3HR9A 5DUVA 1BBT3 4P9LA 2E6VA 4XW3A 4BE3A 1D2SA 2RMU3 4CRQA 1RUD2 5ABJC 5C8CA 1OPMA 2Y0OA 1AXYA 1CVNA 1D0GA 4OUMA 1AR81 1NE6A 4AGRA 1VBA1 4BZ4A 2G9GA 2XBO2 3VKMA 1AYM3 1UKGA 1W6PA 2PQQA 3AMHA 5H9PA 3QCWA 4K21A 1HQNA 1DZTA 2DCTA 4CYDA 4K6BA 4NHKA 1YXWA 3D8CA 4AFAA 4WVVA 5IUQA 4OZXA 1E57A 1LHOA 1FI2A 4B4QA 3B9IA 3MPBA 3ZFFA 2GC0A 5J37A 2YY1A 3AP5A 1QGLA 1PO23 1MS4A 4YW2A 3KS7A 1W0OA 4BMBA 1XU2A 2PHTA 3M8LA 1S0BA 4JDNA 3WT3A 1PGL1 3O12A 2XJTA 3OBTA 1Q8OA 4AXOA 4MSVA 4YM0A 3AP4A 4HLTA 1ZX5A 2BEOA 3FBYA 4I3GA 2D43A 2DTYA 3NAPA 4YFZA 4ZKTB 1YNAA 3USUA 4FCAA 1XYOA 4WM8A 5KBFA 4JGZC 2UWBA 3MLLA 2RM21 3A4UA 3POSA 1ASJ1 2WFPA 4RHV3 3WCRA 2PHFA 3OCPA 5FRAA 4QQOA 4OI2A 1A6CA 4LUKA 2H0VA 1BJQA 4COYA 1VJ2A 1DU3D 1S2KA 5T50A 1H2LA 2HJIA 5DUUA 2RHPA 4LBLA 3R6SA 2WKKA 3ZSMA 2JG8B 2WS91 5AVAA 4G4FA 4LHKA 1OLQA 4JC1A 3VBFC 4Z1VA 3N3HA 1YFXA 4Y1UA 3WR0A 3OGJA 1YLLA 5CG9A 1BEV1 4AVTA 2D6KA 2YDEA 4IEQA 2CWMA 4X6RB 1QXJA 2VY0A 3SCGA 4W6YA 5E89A 2CGOA 5FPXA 1N3QA 4QQ2A 4YGEA 1VBD3 1XYNA 1GZWB 4IV1A 4LBOA 3AJZA 1AL0G 3IN9A 4LBQD 4A3XA 4Q4W1 4EN0A 4XJAA 4K20A 1QJY2 3EQEA 1RMU2 2WZPP 4DY3A 5SV5A 1D4VB 2VGDA 1ONAA 1QJU1 4Y20B 4KG8A 5BNPB 2NLRA 2PHLA 2C5DA 2MEV1 4XZPA 1O5UA 1VAKA 4XTPA 1JH5A 4UBHA 4YW5A 4BH9A 2VOXA 1EPWA 2ZKLA 1KS5A 4NOTA 1WGPA 1W6MB 4Q26A 4Q0QA 1H4GA 4LA2A 3B00A 4JQRA 4BM8A 1OOPA 4QXKA 1PK6B 1X50A 4YVWC 4LA3A 4IL7A 5D8AB 1Y9QA 4HN0A 2DYCA 3ZFEC 1YCIA 1QJX3 4X6QB 1TEIA 4RL7A 4F3JA 2CGPA 1NLSA 4ATEA 1D4M1 1J3PA 1RUH3 1PNFA 1Y7BA 1URXA 4META 4CEWB 3P3PA 3GBFA 2WNUB 4L2NA 5L7OC 5HBAA 2HWB1 1QKQA 2GNDA 2E7AA 2R071 1CONA 1SBFA 1RUF2 4GB33 1H8TC 1V70A 3JUUA 4S2DA 1DIWA 1H1IA 1A8DA 2IZWA 3OPZA 5FREA 3T1LA 5JAXA 3IM0A 4HZFA 4J1XA 4DRVA 2JENA 3B5LB 1OI6A 4DNYA 4XQWA 3WP6A 2WT0A 2ZGUA 1YHFA 1MS8A 1SFYA 5FOBB 5CG8A 4IETA 1YFWA 1BZWA 4BA6A 5AFEA 4Q0PA 1J1LA 1SLIA 2XGXA 2VMGA 1QH6A 4CDWA 4Q4V1 2WZR1 1UAIA 1CQ9A 4GH4A 1UZZA 3E5UA 4BOWA 3N4MA 4WBBA 4YZ1A 2XVKA 3GHNA 1C1LA 2E9QA 1W6OA 4M3CE 2A6VA 2XWJB 3KCCA 1PIV1 4FOVA 1RUG3 4E27A 5KHJA 4ORFA 4YZ4A 1AR93 4QMAA 5I8SA 2AZ5A 3LSDA 4ITCA 1LKNA 2AENA 2F4PA 4GMP1 2UYAA 1C8M2 1NCRC 1HRI3 3ZXGA 2PAMA 1XE7A 4E2QA 4HVRA 3QH7A 4LBQA 3PVOA 3O0VA 3FFZA 1EP0A 4PDWC 3VBOA 1BMV2 3UK9A 1LTEA 1CAUB 2JE7A 4XFBA 2VW2A 5FCCA 3E6CC 2X5IB 1PVC1 4QQPA 4URTA 4AHXA 1O4YA 1QOOA 3H7YA 3ZFGA 4I2OA 1MQTB 4QPIB 4YYOA 2YHJA 2EF6A 4DPNA 1ZBE1 5JSOA 3CEWA 3MIDA 5BNNB 4YG6A 2Z79A 1ENRA 1R1A2 2GAUA 3AP9A 1NY72 1H2NA 2XWBB 1BYHA 2B46X 4F8AA 3CL1A 3WP4A 1LULA 3HQXA 5A33A 2A70A 2D3RA 3BIWE 3CO2A 3D5OA 4FPYA 4FPLA 1RUC2 1S2BA 3JD72 4MGZE 1ND3A 4LT5A 2K9ZA 1KFUL 4TLFA 3LSEA 3CJIC 4RQPC 4IV3A 5FTTC 3THTA 4A7ZA 1NCQB 1UU6A 4JDMA 1W0PA 4ONUA 2WSVA 4E2GA 5I93A 4WV8A 2R1BA 1Q8SA 1AR82 2R041 3OD4A 1JW6A 2RS51 4YGCA 1LODA 5CNAA 1IGOA 2E7QA 4Q2FA 1O4TA 2EIGA 3PJQA 3V0BB 4AI8A 2B5HA 1X82A 5JR7B 1I6XA 1R091 2GZWA 2VVDA 1J3QA 4XJ9A 2B8MA 4XMIA 3RRDA 2WNVA 3MYXA 1DQ2A 5JOYA 4K8FA 1H1AA 4MV2A 4WZCA 1H2KA 4QM8A 1PO13 2QVSB 1EAH1 3DV8A 1V6JA 5EXOA 2PLV2 1XU1A 4PF5A 2OW4A 3BPZA 1JOJA 1RUD1 1SBDA 1ZRCA 5GZDA 3PLQA 3KT1A 4AQ2A 4JAAA 2WT2A 3W9AA 1B09A 5C8CB 4GA9A 3M2MA 1WW5A 3KMHA 4JGYC 2XBO1 2PTMA 4ISRA 4G9SB 1MS5A 1LOEA 1W6PB 1DZQA 5DUXA 2HKXA 3WDUA 3AKQA 2JJ6A 2P3JA 1COV1 4HETA 2RM22 2YUEA 2NP0A 5JCTA 2H6CA 4HK8A 2YXSA 3UKNA 3WDVA 1VB2A 1YYNA 3RS6A 3N7MA 2QUOA 5JIUA 4HPKB 2VQAA 3RNSA 4AF9A 5ACA1 3ZFFB 3AYEA 2TEPA 1G8WA 4LO8A 3B7MA 4YSFA 3JZVA 3WP5A 1DGLA 5J3UA 2JKBA 4D3WA 2WS92 4QGLA 5T54A 3WG1A 1YI7A 1JYIA 5FLHA 5C33A 1U5ZA 3GYDA 4BPZA 2BNMA 4R9DA 2WINB 1O7FA 4FO9A 1RMU3 2D40A 5JZGA 2G9FA 4LEJA 4U2AA 1AXKA 3ETQA 1FOD2 1PGSA 3KGZA 1KITA 1RL3A 1WCSA 1FATA 1GZWA 1MZFA 4MGIE 1QDOA 2TNFA 1VP6A 2IXIA 1H1MA 3EBRA 4HBNA 2VNGA 3UL2A 2HWE1 2VUJA 4NHLA 2JG8C 3D4KA 3FLPA 4EWEA 4GIQA 4Q4W2 1G9AA 1KJLA 1QU0A 2PHDA 4B7KA 2HWC1 1LGNA 3SCFA 5KXDA 4Y20A 1DQ6A 5BNPA 4COVA 1QJU2 3PVEA 2VECA 5CA6A 3PTYA 5JOWA 1GNZA 5BXXA 2MEV2 2V09A 2XJQA 4CDXA 1BVP1 2GU9A 1OD5A 5J98B 1W6MA 1FAYA 4COZA 1TNRA 2NN8A 4BQ1A 4LBNA 1GYKA 1JXNA 1R081 2BTVC 2C1FA 1AYN2 1S0DA 5D8AA 1TE1B 4B7EA 4YARA 2ZX1A 3R4UA 4CEYC 3WLUA 4GXLA 3MPPG 4JTOA 4MXWB 4WVZA 4XYXA 5GJ6A 2XJRA 1SCSA 3AKTA 4R9BA 1J1TA 2JX9A 1Q43A 1QJY1 1D4M2 2C9AA 1JTZX 1KQRA 2A6YA 1DHKB 1RUI1 4CEWA 4N43B 4CDQB 2WNUA 1RIRA 1HQLA 2NQYA 2YC0A 4S2FA 2HWB2 4FP2A 1MR5A 4C90A 4LO7A 2R072 1PK6C 3VUOA 1DBNA 4XEZA 1TME1 1DQ1A 2PAKA 4FPKA 4ES9A 4JRAA 1PNGA 2Q1ZB 2QDRA 4LHNA 4QGNA 1L3JA 2ZOEB 2PHRA 3FZ3A 1PZ7A 1PHMA 2JG9A 3B01A 4FVVA 4Q29A 5KHIA 3MZHA 3MFAA 2LM3A 2KM2A 1F5FA 2WLPA 3M3IA 4FSJA 4HK9A 1CAVB 4TWTA 2O1QA 3MLKA 4E4SA 3RI8A 1WBFA 3ZXFA 2DU0A 4WM7C 5JVVA 3I54A 2ZHNA 2X53S 1GV9A 4AVVA 2ZGSA 2LUWA 4GMP0 4M0NA 2WZR2 3TYJA 3VBSB 1C8M3 2BGCA 1UU4A 4LULA 3M4FA 3H8UA 3ZSLA 3POYA 2FBEA 1G9FA 2VH9A 4FPCA 1PIV2 4HVOA 1H9WA 1RUF1 2GN3A 5JLVA 4BLIA 3ME2A 3L2YA 1NA1A 2GMEA 3AMNA 1VLNA 4KWLA 1AZDA 3WW3A 5EZWA 2YMZA 4GALA 5IT6A 2ZKNA 1XRUA 3K48A 1YIFA 1R1A3 1AX0A 4QX5A 4W6XA 5C4WA 4K7JA 4O9EA 3ZYRA 1CAUA 4MX3A 2X5IA 2ZHLA 4Y4YA 4FXKB 1PVC2 2RE9A 1MQTA 1TMF1 3O5SA 3UJQA 1O5LA 2JDZA 3WD5A 3J8F1 4YW3A 5BNNA 1U5YA 2CAVA 1ZBE2 4XF9A 1QH7A 3KGLA 5IK4A 2XH6A 3WNXA 4TYSA 2EXIA 2QCSB 1LHWA 1X36A 4E2SA 2DWRA 4NWWA 2W52A 1AR83 3WDTA 3VHOA 2ZGMA 3WW1A 4AGGA 4I0BA 1VBA3 1ND2C 3MW3A 2JICA 1UU5A 5C9AB 2N7GA 4WZFA 4FPFA 1V6OA 1HXS2 4AI3A 1ZBA2 2XJPA 4QPIC 4X8PA 1NCQA 3RQ0A 1PM7A 3DPRC 3V65A 1LGBA 2VG9A 1KFXL 3RSJA 4XFGA 2R042 1EYBA 5KWRA 2V5YA 1BCXA 3WY6A 5EJ3A 3FUOA 3NW4A 3AMPA 4N9HA 3SITA 1IS6A 4CZSA 1ZA4A 2MPFA 1R092 3LA2A 1C57A 3RG0A 2XL9A 4CDUC 3VBHC 3ZO0B 3KD4A 2ZBJA 4NWVA 4PBOA 4FPGA 2MNGA 4LE3A 1LU2A 4ZU4A 4H3WA 3WW4A 1NCQC 4AEMA 2ZHMA 1YRZA 4AWDA 1RUC1 1RVF1 2K2SA 3JD71 4XBQA 1XXNA 4DZGA 4FAGA 1N1VA 3TAYA 1EAH2 3ZPYA 1AUYA 2DVBA 5JOXA 4I02A 4XFAA 2RM23 1CPNA