3VDDC

Structure of hrv2 capsid complexed with antiviral compound bta798
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
237
structure length
237
Chain Sequence
GLPVFITPGSGQFLTTDDFQSPCALPWYHPTKEISIPGEVKNLVEICQVDSLVPINNTDTYINSENMYSVVLQSSINAPDKIFSIRTDVASQPLATTLIGEISSYFTHWTGSLRFSFMFCGTANTTVKLLLAYTPPGIAEPTTRKDAMLGTHVIWDVGLQSTISMVVPWISASHYRNTSPGRSTSGYITCWYQTRLVIPPQTPPTARLLCFVSGCKDFCLRMARDTNLHLQSGAIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Protein VP1
publication title An Orally Available 3-Ethoxybenzisoxazole Capsid Binder with Clinical Activity against Human Rhinovirus.
pubmed doi rcsb
total genus 37
structure length 237
sequence length 237
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vddC00
4Q4Y2 5C4WB 1COV2 1QJY2 1B35B 4WM7C 1PVC3 4GMP1 1VBA2 4GH4C 1HRV2 3DPRB 1QQP2 5BNOC 3VBSA 1RUG3 4IV1C 1QJU1 2HWD1 3ZFFC 5D8AC 1NCRC 4YVSB 1ZBA2 2MEV1 1AYN3 2HWD2 1OOPC 4N53C 1RVF3 3VBUB 4LLFA 3VBRA 3ZFGB 2ZAHA 1RUF3 1PGW1 4CEWC 4RS5A 5K0UB 4CDQC 1D4M1 3VBFA 1NOVA 2HWC2 3CJIA 4GMP3 1CD3G 5J96B 2HWB2 1RUC1 1NY71 3VDDC 1RUC2 1QJU3 2Y26A 2HWD3 5JZGA 2RS51 2MEV3 1VB4A 4CDWA 2RS52 1NCQA 5FMOL 4Z92B 1SMVA 5CFCB 4GB31 4GB32 5L7OB 1D4M3 1TMF2 1HRI2 4BCUA 1R081 1PGL1 1TME1 1VBD1 1AR92 5BNNA 1H8TA 1RUE2 1FOD1 2X5IB 4YVWB 4WM8B 2BUKA 5C8CC 1RUC3 2WFF2 4EJRA 5DDJ2 2HWE1 2RS53 1NA1C 1AR82 2HWE2 3M8LA 4GH4A 1ND3C 1OPOA 1EV11 4AEDC 2WS91 1EV12 3JBG1 4PDWB 4IV1A 4GB33 1AL22 3ZFFA 5D8AA 1NCRA 1M06G 2FZ2A 1OOPA 1POV1 4CDXA 4N43B 1R083 1TME3 1VBB2 1VBD3 1ZBE1 4JGZC 2WZR2 1Z7S1 5ABJB 1F2NA 1FOD3 1Z7S2 4RQPB 5C4WC 1B35C 1MEC1 3VBSB 1RUH1 4CDQA 1A6CA 2HWE3 5C9AB 1WCDJ 4FTSA 1POV0 4QPGA 3DPRC 1EV13 2R041 2WS93 3JBG3 1FMD1 3NAPB 3ZFEB 1RUI1 2RR12 4Q4Y1 1COV1 1QJY1 4YVSC 1K5MA 1C8NA 2DF7A 1POV3 3ZFGC 1VAKA 1ZBE3 1Z7S3 3CJIB 1VBA1 2TBVA 1HRV1 1MEC3 1QQP1 5K0UC 2R061 1RUH3 2R062 3JD72 4Q4W1 1AYM1 1EAH2 4Q4W2 5JZGB 1ZBA1 1CJDA 4RR3B 1AYM2 1PIV2 1NCQB 4RFT0 1RHI2 5C8CA 2R043 3IDEA 1FMD3 1RUI3 2FZ1A 2GSYA 4Q4Y3 1COV3 1QJY3 1R092 2RM21 5ACA2 1NA1A 2RM22 4FTEA 3TN92 1MQTB 1ND3A 4FSJA 2HWC1 4AEDA 1VBA3 1ASJ2 1C8M2 2BFUS 1HRV3 2HWB1 1QQP3 5L7OC 2R063 1EAH3 4Q4W3 5CFDC 1AYM3 1ZBA3 4JGZA 2X5IC 3JB4C 4YVWC 2R072 4Q4V1 1BEV2 4IV3C 5C4WA 1BMV2 1PO22 4Q4V2 1PO12 5LK7B 4JGYB 5BNPA 4IV1B 5GKAC 2RS12 2RM23 1TMF1 1HRI1 4CDXB 1X36A 4PDWC 1AR91 2HWC3 4CDUC 4FTBA 1RUE1 1ND2B 2HWF2 2HWB3 4YVSA 2WFF1 1RMU1 4Y5Z0 1OHFA 3VBHB 5DDJ1 1RMU2 4N43C 4WM7A 4QPIB 1VBE2 3ZFGA 1AR81 4QPGB 5ABJC 4RQPC 4Q4V3 3VBSC 2RMU1 4CEYC 1HQNA 3VBOB 1IHMA 2RMU2 5BNOA 5C9AC 1AL21 1K5MB 4RHV1 1TMF3 1HRI3 4RHV2 4N53A 1VBB1 2WZR1 1AR93 3NAPC 3ZFEC 2QQPA 1RUE3 1BBT1 1BBT2 2XPJA 1RUJ2 2WFF3 2BPA2 1RMU3 4CEWA 5DDJ3 1VBE3 1HXS2 2RS31 1GFF2 1FPN2 2VQ0A 1AR83 3CJIC 2RS32 2ZZQA 1VRH2 3VBRB 5C8CB 2BFUL 2RMU3 2RR11 1AUYA 1AL23 5CFDA 4RR3C 3VDDA 1PVC2 4RHV3 4RS5B 1NCQC 1RB8G 1AL0G 2X5IA 3VBUC 4IV3A 1ND3B 1VBB3 3VBFB 2WZR3 1BBT3 1RUJ3 5J98B 3JD71 1AYN2 1MQTC 1RVF2 1EAH1 2RS33 2GH8A 5AC91 1PIV1 1F8VA 4CDUA 4CDWB 5AC92 1RHI1 1RUF2 1NG0A 2ZTNA 5FOJB 2RR13 5BNPB 1VBC1 4N43A 3FBMA 2XBO1 1VBC2 1R091 5ACA1 5ABJA 2XBO2 3TN91 4RQPA 5A32A 4JGYC 4CEYA 3JB8A 1ASJ1 1C8M1 1AR61 5BNNB 1H8TB 4Q4X1 5CFCC 5C9AA 3HAGA 1AR62 4NWWA 1QJU2 5A33A 4Q4X2 2MEV2 3JD73 4CDXC 4WM7B 4GMP0 5AC93 1PIV3 3ZFEA 3NAPA 1ND2C 2R071 1BEV1 1RHI3 4WM8C 1BMV1 1PGW2 1PO21 4GH4B 3VBHC 1PO11 1RUD1 1B35A 1RUD2 5BNOB 1VBC3 4QPIC 3J8F1 1D4M2 1V9U1 2XBO3 4QPGC 2RS11 1R093 3J8F2 1V9U2 5ACA3 3ZFFB 1W39A 5D8AB 1NCRB 3TN93 4N53B 1QJZA 1OOPB 3DPRA 3VBOC 1ASJ3 1C8M3 1AR63 1DDLA 2HWF1 1NY72 1K5MC 4Q4X3 4RR3A 4CEWB 3VBUA 1VBE1 4CDQB 2R073 1BEV3 2IZWA 1PO23 1R1A1 1PO13 1RUD3 1R1A2 5K0UA 1VB2A 1HX6A 3J8F3 1V9U3 1MQTA 3VDDB 5CFDB 2RS13 3ZXAC 1AR71 1R082 1PGL2 1TME2 1VBD2 1QJX1 1AR72 3VBRC 1QJX2 1FOD2 4IV3B 2HWF3 1X33A 1RUJ1 4RS5C 2PLV1 2PLV2 1HXS1 3VBFC 1FPN1 2BBVA 4JGYA 4CDUB 1VRH1 2WS92 3JBG2 1R1A3 5CFCA 4NWVA 5L7OA 1PVC1 5JZGC 3LOBA 1AR73 1ZBE2 1QJX3 4CDWC 1ND2A 1NA1B 5FMOS 4YVWA 4WM8A 5A32B 1MEC2 3VBHA 4CEYB 5BNPC 1RUG1 4AEDB 1RUH2 4QPIA 1RUG2 5A33B 2PLV3 4Y4YA 4SBVA 1AYN1 2WLPA 1HXS3 1RVF1 1FPN3 3S6PA 3VBOA 2WWSA 5BNNC 1H8TC 4JGZB 1VRH3 2R042 4PDWA 1E57A 1FMD2 1RUF1 1RUI2
chains in the Genus database with same CATH superfamily
1COV2 4QGNA 1J3PA 3ELNA 2K46A 3H1WA 4RGKA 4COYA 1GZWB 3WNNA 1PMJX 2A6ZA 3WUCA 1B09A 5IK8A 3B9CA 1VBA2 3WQBA 5FZ4A 4BQ2A 1ALYA 4TTGA 1O91A 1O3QA 4CPBD 3ZXKA 5F5AA 4XUTA 4MLOA 2YV8A 5I8TA 1UU4A 4AVCA 4IV1C 4Q1RA 2PELA 2ERFA 3B69A 1QJU1 2B39A 5FZ9A 3ZFFC 1NE6A 5D8AC 3DKQA 1ZZ8A 2YBPA 1O4ZA 2MEV1 4YVSB 4IE5A 1V6MA 3S7IA 3WDYA 3ITQA 3H8OA 4LLFA 2DU1A 4RA0A 1XNKA 2WUHA 4UXAA 2AACA 5GALA 5JMCA 3BTXA 3SNMA 3W59A 3H1MA 2Z69A 1HJGA 5HCFA 4EN6B 1YQ2A 3O0WA 2BNOA 3FHIB 2O0OA 3LDRA 4OZXA 2I45A 4XFAA 4K1ZA 5ANQA 3IB3A 4HN1A 3CO2A 1GZTA 4BA6A 4DPNA 4CEWC 5LA1A 1BKZA 2CAVA 2WWUA 3LF7A 5LASA 4DOUA 3H7JA 4HVRA 1UYYA 2W39A 3LA7A 5FY5A 3H8RA 1N1YA 5F5IA 3IIAA 1WBFA 3F2ZA 1CAVB 3VZNA 1GLHA 3P3PA 2DURA 1YFYA 2A1XA 4GMP3 2BDRA 4FT8A 4YARA 3SKJE 5A3OA 4JDMA 1O8PA 1V0AA 3T08A 4MG2A 1H2LA 1IOAA 1J1TA 3U4XA 5B4NA 3I54A 2Y26A 2CGNA 3O1UA 2RDNA 2EAAA 4B7KA 1VB4A 5I0SA 4CDWA 2KD7A 2IUWA 2DCYA 4DMIA 2VXJA 4XFIA 1W6QA 1LECA 2WWJA 2PAMA 1Y43B 3EQEA 4QDRA 4M4RA 3RNSA 1SMVA 2H0BA 2PMWB 2DFCA 4ZS3A 1C1LA 2QQUA 5L7OB 4E9KA 2D5FA 4HSLA 1HRI2 3T09A 1PX3A 4QX5A 4DS0A 2MNGA 2JD4A 4IEZA 2VBDA 4Y4RA 3OGJA 2A71A 4JAAA 3ZYHA 4PLNA 5LRRA 3ACFA 5IK4A 5LWBA 5BUVA 4LULA 1RUC3 2QQNA 4YZ2A 3TNPB 1GUIA 1JYNA 1GQHA 3M70A 4YRDA 3H50A 4MHRA 2VCCA 2WIIB 5IWFA 1NA1C 2EXKA 1HKDA 1Q5OA 4RFRB 1KITA 2WZEA 5JWPA 3MW3A 1GWLA 1VMHA 5FY7A 1LAJA 2VVFA 1OPOA 4XPVA 5LBBA 2E6VA 3NNMA 2VNRA 2WS91 4IV1A 4X8PA 2HBTA 1CONA 4HK9A 5FZCA 3U14A 3ZFFA 5D8AA 4CCEA 1XE7A 2FZ2A 5DAWA 1NUKA 3GXUA 4XJ8A 4A7ZA 5J37A 1ENQA 1NXMA 1WMDA 2YG0A 2VZPA 1ZBE1 4JGZC 1LRHA 1SCRA 3C7GA 2D6LX 1RXFA 2BWCA 5D21A 3WNPA 1B35C 5FIXA 2DU0A 3PUIA 3VBSB 5EYXA 2DV9A 1GOHA 3ZVXA 4CP9A 1OQ1A 2FCVA 4KH9A 4AXOA 2AREA 3BU7A 1WCDJ 2P3YA 1MZ6A 4OI0A 4LBQB 4D7YA 2Y6GA 1OI6A 3DPRC 5SV5A 3B93A 1CQ9A 3IDBB 3GHNA 3N9PA 4AVTA 3DYMA 2HEYF 2Y38A 2R041 5DG1A 2BGOA 2XDVA 3OF1A 1ZZ9A 2OX0A 3T1LA 3DGTA 3ES4A 2JEMA 4Q4Y1 4YNIA 4AVBA 3AVSA 4FPYA 1C8NA 3AMNA 1H30A 1LGBA 4PQQA 1POV3 3MIFA 2WO3A 4J1XA 4XDOA 3K3NA 1WGPA 1UNBA 4Y20A 3WW4A 1VAKA 3ZFGC 4DO0A 3SHRA 3K75B 2ZKNA 4UW6A 1N3OA 1HRV1 1MEC3 3AZXA 1O3SA 2W1WA 5LA2A 4R4XA 4FPJA 4EROA 1W2NA 2WBKA 1WCUA 1SDDB 1KDKA 4L8QA 4KWLA 2DVAA 1CJDA 4LUKA 3WINE 3VGIA 4LA3A 4AHZA 1NCQB 4S2DA 4GZ9A 5A1FA 4BE3A 4ZZ5A 3WG2A 3N9NA 4TSVA 1NT0A 3RPQA 3ECQA 1YO8A 3IDEA 1IKQA 3WUDA 1RYYA 5FZ8A 1HJFA 1COV3 3HN1A 3FUOA 3WW2A 3HEIA 1KXGA 2UYAA 2G1MA 4EWEA 1NA1A 2QQOA 2HYXA 1UX6A 2RJLA 4AI1A 5EPAA 3FJSA 1YC61 2DBIA 1MQTB 5FZEA 1HQWA 3V0AA 2G4IA 1DCSA 2HWC1 1WA6X 1F4AA 1VBA3 3ZYGA 1C8M2 4A7YA 2OZ6A 3P3NA 1GR3A 1JZ3A 3OPWA 2HEVF 3UV9A 1GKBA 2R0HA 1LOCA 3HQXA 4H2AA 4B4RA 5FDBA 2CU5A 2ZGLA 2ZS6B 4GWIA 4W6XA 5E88A 4MO3M 2BEOA 2GH2A 3ACHA 1Y9GA 4JGZA 4BLIA 3JB4C 2GALA 2XUEA 1J3QA 2E9QA 4AF9A 4IV3C 2WT1A 4XF0A 1BMV2 2W1SA 4OYUA 1DHKB 3U0ZA 4Q0VA 5APAA 5BNPA 2Y60A 4LLOA 4LXLA 3H7YA 2XLFA 3KCCA 2WLQA 1ZZ7A 2QDNA 2GMMA 2D93A 2J1AA 5F3IA 5FXZA 4CU9A 3VZKA 2G9ZA 1MS9A 4ATFA 1UMHA 5JR2A 4XJZA 1QH7A 4L11A 1GNYA 1X36A 4XUQA 4PDWC 3WG1A 1RUE1 1BCXA 2RHPA 3RWNA 5IATA 3BKZA 2HWF2 3MFCA 4RYDA 3SQOA 4AG4A 4D6QA 1BVVA 1WCQA 2WFF1 1Q8PA 3LQCA 1GZ9A 1SDWA 3MPBA 4JHTA 3AZWA 5DDJ1 5FMBA 3KT4A 1HW5A 3ZSKA 2ZCWA 3PVOA 4HN0A 3ZFGA 4P9WA 3O1OA 1AR81 4QPGB 5ABJC 3PNAA 2YYOA 3D6EA 3CQOA 5IVVA 1JYCA 3ETQA 4NRPA 4XQDA 3WT3A 4Q4V3 4E8DA 2R7EB 2WNEA 5D2AA 4TN7A 1HQNA 3LA3A 5FTTC 5EXOA 3VBOB 5EJ3A 1IHMA 2X10A 2QDRA 3ILNA 3VKMA 1YYNA 4XCAA 2IVIB 1YUDA 1NX9A 5C9AC 1AL21 3UNPA 2E7AA 2ZX0A 1HRI3 3VL9A 2UU8A 3KWVA 1HIXA 3KF5A 2ZGNA 3RDIA 1VBB1 3R4UA 1REDA 2WZR1 3WY6A 1YJLA 3NAPC 4QX8A 2TNFA 5FYIA 1Z0HA 1LESA 2RDQA 2XPJA 1FV3A 2PA7A 4N90A 4K21A 2W3JA 3FL7A 4YG6A 1RMU3 5F3CA 1LULA 3QD6A 1ENSA 1VBE3 3UGGA 5FYSA 1YXWA 3RYKA 1H4HA 3A0NA 4BYYA 3I59A 5IT6A 1W6OA 2V4VA 1WLDA 3MIGA 2H6CA 3RRDA 4AK3A 5GZEA 1J1LA 1VRH2 2ZZQA 3RI9A 1LHOA 3I2IA 1V6IA 3IIIA 3TB0A 3OUIA 4QU1A 2QE3A 2RR11 3ILFA 3ALQA 1DQ0A 5BXXA 4CSWA 2Q4SA 3Q8AA 3FFQA 4RR3C 3VDDA 3WDVA 4KWJA 1PVC2 4RHV3 4TWTA 2RE9A 1RB8G 3FX3A 3KV5A 5IK5A 4Y1YA 1XXNA 4IV3A 1HN1A 2XJSA 2ZGSA 4U36A 4E2GA 2QQKA 3W5NA 4DZGA 2VOTA 3NV4A 3AMQA 2P3KA 2IFWA 4J25A 1JU3A 1WKYA 1UCXA 1JBCA 2WN2A 3M2MA 1H9WA 1UOGA 1ZZ6A 3JD71 5J3UA 1UF2C 1X8MA 1RVF2 2XVKA 4RN5A 5DUVA 1GANA 3HT2A 3E5UA 2E63A 2GH8A 3LFMA 1RUOA 1CAXA 2VZRA 3WD5A 4CDWB 1RHI1 2AGSA 5GLUA 5JPMB 4ZU4A 3WP4A 2ZTNA 4KU8A 5FY1A 1D7PM 1Y9QA 3V56A 1H1AA 3T1MA 4DUWA 1SHWB 4L2NA 1V6OA 5JPNB 2HH9A 1LJ7A 4D0QA 2W1QA 5ABJA 4YYOA 5DQ0A 5IVFA 3ZSEA 1L7QA 4CXWA 5LRSA 4HVQA 3MBWA 4YWAA 2VAUA 2W9XA 1XSRA 2WAOA 4ZXEA 3ZXFA 4CXYA 2YU2A 4JGYC 4MX3A 3BPZA 4XDPA 5FUIA 2E51A 4Z2AA 2LRPA 3PUHA 2WO1A 1AR61 4COUA 3I2FA 3WNKA 3KS7A 1H2NA 3EB7A 4Q4X1 4YG3A 3ME2A 3RYRA 3UESA 3KHBA 5C9AA 1AR62 1YIPA 1Q8QA 1VMJA 2J1SA 3POJA 2NM1A 4JTOA 4MGQA 4NR1A 4Q4X2 5B2GB 1QY4A 5IFTA 3THDA 5JI9A 4CDXC 1UD1A 5IYYA 1C3HA 1YNAA 2D3PA 1UXXX 1ZRFA 5T5LA 4AL9A 2W94A 2X29A 1XSQA 3I4IA 3NAPA 2YBKA 1JU4A 1YQ6A 5A7QA 3T4HB 4NJ4A 1BEV1 2NMNA 3AKQA 4LR4A 4YPJA 4FI9A 4C1XA 2HKXA 1PGW2 4RL7A 5DAXA 4JCKA 3NMBA 3C2UA 5FYVA 2BQPA 4Q5OA 1PM4A 2YROA 3VDAA 1WUVA 1GZWA 1D4M2 2ZX1A 3T2TA 1XNDA 2XBO3 3ZN6A 2JENA 4XCBA 3ZPOA 3ZFFB 2QQIA 2PAEA 2GP5A 5D8AB 5FUNA 1TNRA 4MSVA 2FMDA 4WVVA 2UWCA 3LKJA 4OUMA 4LPLA 3KM5A 4CP2A 3WF3A 2CHHA 4W6WA 1C8M3 3FUQA 5KXDA 1SPPA 1OPMA 4FPCA 1LOAA 5FOBB 2P3IA 3MV11 4AYUA 2D7FA 3UT0A 4RR3A 4FOQA 2NYYA 4CEWB 1OSGA 4Q1PA 5JXJA 2VTXJ 3T2PA 4BJ0A 4CP9B 5FPVA 4DRVA 2WA3A 4LO8A 3D5OA 2IZWA 4F7ZA 5A7SA 2PHLA 1JZ4A 4CCMA 3WCRA 1R1A1 3M3IA 5C5UA 1RUD3 2D6KA 1R1A2 4CCCA 5JMOA 1DP0A 3AK0A 1VLNA 5CA6A 1F5JA 2JDPA 5DAVA 1ONAA 4AVAA 3ZXAC 4NE9A 4PI0A 3C7EA 1C5HA 1R082 3GGLA 5JIAA 1QJX1 1LOGA 4AEJA 2F4LA 1PGL2 2OXBA 1D0GA 1K12A 1FX5A 2HJIA 1QJX2 3OPZA 1FOD2 2JICA 4LNVA 4Y20B 2GN3A 3HIFA 1MZFA 3THCA 2OYZA 2WYFA 5I8SA 5DN2A 2GNDA 5JXHA 1U12A 2GMPA 2HWF3 3SLIA 1NZIA 3O0VA 1RUJ1 3FWEA 1H6XA 3IPVB 3BN6A 4IEYA 1OA2A 2ZABA 4FPKA 4QHZA 3SEEA 5FLHA 5A7NA 2IXHA 2JX9A 1X7NA 3JUUA 5CIRA 5JOXA 1SFNA 3VBFC 3VL8A 2IXLA 1H2KA 5ISLA 1QNYA 3OEAA 1DQ6A 1IS6A 1UZWA 4JGYA 3TRSB 2DUQA 4D94A 3MIHA 4R9AA 3JBG2 2YY1A 4V2WA 5A3TA 3ZX7A 1F35A 3VZLA 3AYCA 5L7OA 2JXAA 1UY3A 1QWRA 4IQPA 4NO4A 1JYXA 1BK0A 4K8RB 4L0PA 1PMIA 3ST7A 1AR73 4FCAA 3AP9A 3HNBM 2XQRA 5FMOS 1NA1B 4B3NA 2ARCA 4Y1UA 4EWDA 5L36A 2BW8A 3V0BA 2VMFA 3NL1A 4MVTA 2OQ7A 2PYTA 3MI8A 3U11A 5CEHA 4PF5A 2IXIA 1I5PA 1RUH2 2YFUA 4Q8LA 4NPRA 3WQ0A 3AKRA 4QKNA 1F4HA 4CCOA 1URXA 3RSJA 2OIIA 1GOFA 3VDCA 4DXRA 4MGKE 4Q0QA 2E31A 2JJ6A 2VW0A 2VBPA 2Z42A 4ZHNA 3OBZA 5BNNC 1H8TC 2WSUA 1VRH3 4JGZB 4QX1A 5F7UA 1RUI2 1V6NA 3KF3A 1S0FA 4CCKA 1J3RA 1B35B 1O8SA 1QJY2 1W9TA 2OQ6A 3VV1A 1GICA 4AWDA 3WX5A 1SFPA 4J1WA 1W3VA 1PVC3 3R6SA 4LT5A 2L9LA 2VZTA 3GZUC 4AGVA 3HPNA 4AGGA 4GMP1 5KWRA 4GH4C 4P9IA 1E5RA 2E7QA 2A6VA 4UYBA 2P4EA 5BYNA 1XBFA 3DPRB 2HLEA 1NYWA 4FQZA 1QQP2 2H6BA 3N35A 3K3OA 4KWUA 5IVBA 3VBSA 1JYWA 5FYTA 4RGGA 2R16A 5FAXA 2NPIA 3OGSA 3ORJA 1NCRC 4R8HA 4OHYA 4LBQA 1RVF3 2XKOA 4XUPA 4YFWA 1YFXA 3LEMA 3EMRA 4PF1A 4XJAA 3ZFGB 2WAAA 2ZAHA 3DKWA 3ZMNA 4LBOA 4UW3A 1J58A 1KFXL 4Y1ZA 4YGDA 5A70A 1KRIA 3IWZA 4FPOB 1U5IA 2DVGA 1ZRDA 2KR2A 2NP0A 1CWPA 4Q2FA 3V64A 1VJ2A 2WT0A 4OMCA 2VCMA 3VBFA 1H4GA 4MXWA 2XR4A 2IFRA 2XLAA 4CPBA 5C3OA 3ZXDA 1CD3G 3NVCA 2FDIA 4D3WA 1LGCA 5J96B 2VMGA 3OTFA 2HWB2 1FV2A 1RUC1 1ZRIA 3EJKA 3MW4A 1NY71 4K7JA 1RUC2 1I6XA 3AMHA 5FZDA 4FFIA 3WNMA 4JC1A 2Y0OA 1O3TA 1H1IA 3H9AA 1LHVA 5F3GA 1AX0A 1NCQA 2VJXA 3HOBA 1NQDA 2QQWA 2YPJA 2PHXA 4FPEA 2SBAA 3W58A 3GALA 4I0AA 3P1IA 1G6NA 4QQPA 1WLTA 4I2OA 4ES9A 3BYWA 1OD5A 1GSLA 1D4M3 1Q43A 2YGMA 2VPVA 1X82A 4OZOA 1UU6A 1REEA 2JDUA 4XFHA 5HCHA 4UBHA 5BNNA 1H8TA 5FZHA 4C91A 2E26A 4WM8B 3IKWA 2OA2A 1LCLA 4FFHA 5KHGA 5FWEA 2VZ3A 1N3QA 4EJRA 4LO6B 2VNOA 2ATFA 5EYYA 1SBEA 1W6PA 5FPAA 5GM0A 1IZ3A 4NPLA 5HXVA 5JSPA 2BYVE 1O7FA 4FPLA 2FDGA 5FZ3A 5C3QA 2CYFA 2XMLA 2ZHNA 3M8LA 3VHRA 3MO4A 2D5HA 4DEQA 4EE2A 3N7MA 2Y6KA 4GH4A 4HT1T 4B1LA 3SCHA 4BQ4A 2VZVA 3I7DA 3OB8A 4N7IA 1TE1B 1O4YA 1CR7A 4PDWB 1CAXB 2VM9A 2WKKA 3PJYA 5K4LA 4GB33 1QHDA 1K5JA 4XFBA 5JCTA 2QVSB 4MH0E 1NCRA 4YLZA 5SV8A 3TYJA 1M06G 4WZFA 1POV1 2RDSA 2JE8A 2QTWB 1L7RA 4NVPA 1R083 4GQ7A 3UETA 4L99A 5ABJB 1UYZA 2YC4A 1F2NA 1FOD3 2JDHA 2WFPA 3DL3A 3FZ3A 4DRRA 1MEC1 5FO9B 1BXHA 4XMAA 4AHYA 1JZ5A 1CZTA 4NAMA 2UY9A 4C8DA 4M3CB 3U10A 2XQXA 2FMYA 5CKNA 1O4TA 2X8KA 3BB6A 1A6CA 3E6BA 4S2FA 2HWE3 4XF9A 5C9AB 3O1VA 1POV0 1UU5A 4MV2A 4QPGA 4HPKA 4N9HA 3PMEA 2LROA 4NIGA 1FI2A 3VDBA 5IAVA 1OBNA 4NRMA 2GNBA 1NXD1 2Y34A 3JBG3 3NAPB 1CIYA 4KGGA 1SACA 4ORFA 2LALA 2YUEA 2R1BA 4AEKA 1Q8VA 2ADDA 1WWYA 1COV1 4MGSA 4UWDA 1GQPA 5L73A 4FP3A 5FPXA 3G7DA 3GCXA 4FPGA 1AX2A 3WQ7A 2HEWF 2G9GA 4LBLA 3KD4A 3ZN6B 4Z82A 4EN8B 1Z7S3 1LU2A 3WHTA 1VBA1 2FDJA 3GZEA 2BOIA 2LUWA 2A75A 2XVGA 5FV3A 4MUVA 4D6RA 1MZ5A 3CF6E 4DINB 3RG0A 1RUH3 3ABZA 3CEWA 4LIVA 1SPPB 3MIDA 5FY9A 4BB3A 4QU2A 2BNNA 3B02A 4I01A 5FLJA 1TQ5A 2JB8A 1U0AA 4IEPA 5JZGB 4AI0A 4RR3B 4HBNA 1S2BA 3JXSA 1PIV2 3WP6A 4BQYA 5JVVA 3AXEA 3NJYA 3MYXA 4JKKA 1UY4A 1W03A 3WNLA 4KBBA 1RUI3 2FZ1A 5T52A 4CTEA 4B4PA 1EUUA 1Q8OA 1ENXA 3OBTA 5ERLA 2EALA 1QJY3 1LR5A 1XYOA 4PIZA 5ACA2 1EPZA 1VR3A 4XAAA 2XJQA 1CIWA 5H9SA 1H2MA 3NJVA 5K9YA 3NO8A 4FSJA 1STMA 2DCZA 4XTPA 1ASJ2 5CKMA 1DZTA 1WMFA 1X9PA 4I0WB 1CX1A 2R49A 1OKQA 1QQP3 3ZSJA 3KHCA 1IS5A 2ZJCA 3ZYIB 5A3LA 2CV6A 2VUJA 1EAH3 4XIKA 5T5PA 2CL2A 5BV6A 1IKPA 3DF0A 1C1FA 2JE9A 2X5IC 2ZGPA 3GF6A 4YM1A 2WYSA 4YVWC 3PVBB 1GNZA 2QQMA 4Q4V1 4QB1A 2OT7A 1RTVA 4Q4V2 4CUBA 4JDOA 1EY2A 5A3MA 4CCJA 2DBNA 4JGYB 4QX2A 4AI8A 5GKAC 4LBMA 3C7OA 1TEIA 3A22A 2AH2A 4OLLA 2ZX4A 2RM23 3HNMA 2PHDA 3I3QA 2J7MA 4P5YA 1HRI1 4HKOA 4AFMA 4BM8A 4CDXB 4IEWA 2EXJA 1Z78A 2E7TA 1WMXA 2PHTA 3KCXA 1ZA4A 2KM2A 3CNAA 2LW8A 2VUCA 5DZGA 5FZ1A 4W8JA 3ROUA 5CKQA 4BK4A 2HWB3 3MIEA 3KV4A 5KHJA 3V0BB 4YG0A 3AJYA 3FHAA 4YGBA 1RMU1 2A3XA 2O8OA 4FO9A 4UBGA 1KGYA 1WLWA 3MF6A 5A6ZA 4B1MA 5J48A 1RMU2 1RINA 1ZREA 1VBE2 3PJQA 4UFJA 3HWJA 3KT7A 4YZ3A 2WO2A 2F4PA 1FT9A 5E8AA 4XTMA 4BPZA 3UYJA 4XDQA 2WRAA 1PM7A 2P2KA 2W46A 1W3XA 2WZ8A 5LBEA 2RJ2A 2D98A 4XJWA 1AF9A 3J7HA 3QLQA 1OVSA 4RHV1 5I0TA 3POWA 5FQ0A 4LOTA 4GWMA 2VOWA 2WN3A 5FZLA 4RHV2 3WP5A 4UW5A 4ASKA 1XE8A 4MGIE 5FUPA 5KC6A 3A23A 3ZFEC 4PLMA 4DXZA 4AAPA 3C3VA 3ZYFA 2O1QA 2W68A 2YFZA 3WR0A 4P9XA 1RL3A 1ZRRA 4B29A 4XBLA 4Y1XA 4CEWA 3A0KA 2B8MA 4AFDA 1HXS2 5AVPA 3ZXJA 1UXZA 4P02B 3CJIC 5TSWA 1R64A 1W2OA 2O8QA 1WW4A 3H3ZA 2VMEA 3ZYRA 2EIEA 5J1XA 1HV0A 3CU7A 2PAKA 1W0PA 3E1F1 3ON7A 2GAUA 3LWCA 2ZEXA 3QOPA 5FZ0A 1T6BX 3SH3A 5J7MA 1VIWB 3F95A 2X5IA 4AGRA 3A7QA 2UY8A 2BVVA 1DQ1A 1ND3B 4QKFA 3VBFB 5DUWA 4MXWB 1WW7A 3IM0A 1W8OA 4FXKB 1BBT3 3RZMA 1WD4A 3BALA 1IG3A 2BWAA 3USUA 4E4HA 5A1LA 1JOJA 2XWJB 3IPVA 2YZ4A 3USSA 1W8NA 1AYN2 2BGPA 5T54A 5M0TA 3LEGA 3DYPA 3TNQA 5T55A 4LO5B 1CPMA 1RUF2 2PHFA 1NG0A 3A21A 4ZY9A 1UZYA 4D8MA 1AX1A 3ETPA 1V00A 2ZGQA 4AVSA 1SLIA 4CU6A 5C6CA 3FBMA 1LEMA 1S0DA 2P17A 2XBO1 3DCQA 1LHNA 4QB6A 1QJFA 3HBKA 5I93A 2XBO2 3OGRA 4META 2BERA 1W2TA 3FLTA 3ZXEA 2YC2A 1W8WA 1QDCA 2YU1A 3ZM8A 1DFQA 1WD3A 2Y33A 2ET1A 1C8M1 1KS5A 4MHUA 4PT6A 4A3XA 1BHGA 1H8TB 4BH9A 5BNNB 5LA9A 1S0CA 4BU2A 4XMIA 1UPIA 4NWWA 2F17A 1MACA 2P34A 1YCIA 2V09A 3K51A 4GJZA 2DCTA 4YM0A 2IXJA 5DZEA 4CCLA 1GP5A 1ZM1A 3KSCA 3MLLA 1W6PB 4JKLA 4WVWA 2VVDA 3HBZA 4XAEA 4GULA 1PIV3 3ZFEA 2CTVA 1ND2C 2DTWA 2OVUA 3LE0A 3TWIA 1DQ5A 2Q5TA 5GZCA 1UX7A 1JYIA 4WM8C 1BMV1 1CX4A 3GBFA 4GH4B 2ZGRA 1K42A 4D7SA 1UOFA 1SZBA 2NZ9A 1RUD1 3KT1A 3PIJA 1B35A 4X8NA 2X05A 2UURA 4DY5A 1RUD2 1VBC3 4QPIC 1GNHA 5LB6A 2FCUA 4HANA 5ACA3 4ISQA 4IGPA 1W39A 1NCRB 1APNA 4OHVA 4FXGB 1REFA 2VH9A 4XHXA 3UKTA 1EPWA 5FRAA 3ZYBA 3EXUA 2I07B 3DPRA 2GN7A 2EAKA 2OS2A 1ASJ3 3MGUA 1DDLA 5FPUA 2HWF1 3IMNA 1K5MC 2W95A 1WLCA 3HT1A 4P5HA 3D4KA 4P9JA 4PBOA 2VL4A 5FP8A 3I3BA 5LW9A 2ARBA 1RJ8A 2EIBA 1T2XA 1YI7A 2GC3A 3I2KA 5FYHA 4OQ9A 3PVNA 4HPKB 1OT5A 5DPNA 1QMJA 4CYDA 4RSUA 2W1UA 5KHKA 1ODNA 2ZGTA 3FMGA 4FP2A 4FPHA 3RS6A 3LZZA 1W9WA 1VB2A 2DVBA 3LD8A 5JAXA 5EZWA 1HX6A 4Q8KA 3GNEA 3H8XA 2R6QA 3J8F3 2JKBA 3UJQA 1S55A 2UWBA 2W47A 3WF2A 2MPFA 1AR71 5CB7A 1TME2 1VBD2 1UO9A 1AR72 3LB9A 3VBRC 2BJSA 2JG8C 3UJOA 4COVA 4UI9L 1J83A 4LEJA 1PZ8A 4BHPA 1YRZA 3WHUA 4F83A 4WVZA 3E97A 3T0BA 2YPDA 3ACIA 1NLQA 1WMEA 3H3LA 4HXCA 5IJRA 3CZJA 4CDUB 1VRH1 2VZQA 5A80A 4UFIA 3GDBA 1I3HA 2YGLA 1JOBA 4JQRA 2CWMA 4YW7A 3O12A 3I8TA 4NWVA 4BQ1A 4CU7A 1DIWA 1ODMA 4Q0UA 4DIQA 2XVLA 1LU1A 1PVC1 2A6YA 4M01A 1QXRA 3RVHA 3TAYA 4CRQA 1DG6A 5BNQA 5JZGC 1A34A 3HN3A 3JCIA 3B00A 3WW3A 1ND2A 4LK6A 3J4UH 4RD7A 4QQOA 4XUOA 1ZZBA 1KFUL 3LSEA 4Y26A 4WM8A 2IXKA 4XABA 5A32B 3WSOA 1ULEA 2W91A 3TBDA 1ULGA 2VXRA 2YMZA 1DGWA 2Y6FA 2Y6HA 3AYDA 3E5QA 5L19A 4QPIA 1YQ8A 2PHRA 4LMFA 4AQSA 2PLV3 3BU0A 4Y4YA 1MR5A 4SBVA 1I9RA 1YIFA 5EQUA 1US2A 2WJSA 4H7LA 5LBFA 1HXS3 1RVF1 1Y3TA 2BRTA 5E89A 3W21A 4QM9A 1IS4A 2E33A 4A2UA 2GC1A 1CESA 2QUOA 2V5YA 2VOVA 3N9OA 4PDWA 1MS3A 1E57A 1FMD2 3FN9A 4ZONA 2XL7A 4XILA 3ZOIA 2VULA 1V6JA 4QMAA 2Q8CA 2QCSB 4KBZA 3WDTA 4E4SA 2VBBA 4K9SA 1UOBA 3POYA 4COWA 3DXUA 4WM7C 2ZOEB 5J09A 4Z07A 3INAA 1S0BA 3WV6A 1CZSA 4QB2A 5A3PA 1G7YA 3ACGA 3GBGA 3HJRA 3AJZA 2QQVA 3EYPA 3PMSA 1KD7A 2TEPA 4BMEA 2Y0IA 5BNOC 2NLRA 2WQZC 3ZYJB 1RUG3 4B8EA 3AFGA 2ORZA 4M3CA 2WABA 2OZJA 2J1RA 5JIUA 5GZDA 4OI1A 4WVMB 2R0FA 1ZBA2 4N53C 1AYN3 4OUSA 3KB5A 1OVPA 3WF4A 1JYVA 3VBUB 1XU1A 4B4QA 4OFGA 3VBRA 4BOWA 1MS8A 4XEZA 2AEYA 2JG8A 3I3EA 3SITA 4XJUA 4M00A 1RUF3 1PGW1 3GBWA 4QDQA 5C3PA 4JZRA 2D3SA 3PTYA 1OLRA 3S7EA 3OBRA 4CDQC 1D4M1 4YW4A 3ZKYA 1KJRA 3K4DA 1QU0A 4QPYA 1NQJA 2DUOA 2WQ4A 4TYSA 2G19A 1HN0A 5FQ0B 3VHOA 4P9GA 5FFOC 4BIOA 4ES8A 4HZFA 4EN9B 1IPKA 2BGCA 5EIYB 4KNCA 2CNAA 1UYXA 4M4PA 4P14A 1Y9MA 4D69A 3AXDA 5FJKA 2HWD3 4IL7A 3VD4A 4ISRA 5JZGA 1XPWA 2RV9A 3VKFC 5JDBA 3VHPA 2CDOA 3WOGA 5CU1A 1GZCA 3DECA 3RYPA 4IGOA 5A6YA 2B9UA 2Q1FA 5FMOL 5FZAA 2ZHKA 4LQRA 4LK7A 1DF0A 1JUIA 5IHRA 4Z92B 4YGEA 4HK8A 4I3GA 2C6SA 5LY1A 4GB31 1C5IA 4X6RB 3SH4A 2V4AA 5F5QA 4GB32 4ET7A 1TMF2 3I97A 4IXLA 4IE0A 3T4VA 4XURA 1FATA 2I2SA 3JQWA 3POIA 1UN1A 2FHRA 4BQXA 1R081 4DY3A 1PGL1 4L9BA 4P00B 1S4CA 3UK9A 1AR92 4I02A 4KQ7A 1VP6A 1FOD1 2X5IB 5DABA 4HOOA 4YVWB 3TEXA 1OC1A 2BUKA 4NN0A 5DXDA 1UIJA 5CYYA 1JMUB 2W5FA 4GD4A 1JHJA 3CL1A 3USUB 3HQRA 2HWE1 4CCNA 3VUOA 5FY8A 2RS53 2AYHA 3Q8CA 3S5AA 2HWE2 4Z2WA 2YBSA 4BQWA 1VRBA 3CJXA 1S2KA 1ND3C 4HLTA 4LKFA 5HPOA 1OF3A 2QQJA 4AEDC 3WF1A 3JBG1 3H0OA 2Y64A 4XUNA 3N7JA 1W06A 2QKDA 5FZ7A 1SBFA 1HB4A 1SG3A 3ILRA 5LCWL 1LEDA 5C3RA 3U75A 3IN9A 4ITCA 1X9TA 4O9GA 2EVXA 4CDXA 1CAUB 4N8MA 5FKCA 1TME3 1VBD3 2AENA 1Z7S1 2W08A 5FZFA 4K40A 3CIHA 2J1UA 2BBAA 3FLPA 3AX4A 1Z7S2 3KZ4C 5FP4A 4D6SA 3MUZ1 4YFZA 5C4WC 3DV8A 3NJZA 5K7PA 1ZX5A 1DGRA 3HVDA 5EV7A 4GA9A 4HETA 2ZHMA 1RUH1 5F9TA 5CBLA 4IEVA 4CDQA 4UT5A 4XHBA 3MV01 4JKMA 3WLUA 1POQA 4FTSA 1QXPA 4I09A 3VD3A 4PQ9A 4XBQA 1XB9A 4Q29A 2ARXA 3O1MA 3K48A 2VQTA 5FXVA 1EV13 2EIDA 1XYPA 3QH7A 4QGMA 4BQ3A 2JB4A 3ZFEB 1RUI1 1PVXA 5FP3A 2IVJA 3FLRA 4CUCA 1QJY1 2Q1ZB 4Y24A 2DF7A 1G86A 1W6MA 3AZYA 3AL5A 4QT6A 1NLSA 2VVEA 2ZGMA 3URFA 5FP7A 4QXCA 4UFHA 3ZN4A 4GKYA 4AHWA 4IEUA 1FNYA 3CJIB 4QKDA 2UYBA 1GQGA 1LOBA 4H3WA 3SMHA 3T3YA 2A5ZA 2K2SA 1QQP1 3CLPA 1OFNA 4HFSA 1LTEA 4Q27A 5K0UC 2DDUA 1W04A 3NJXA 1FNZA 2FDFA 5F8PA 5C5TA 3W5MA 2FQPA 1VE0A 2ZX3A 4AHXA 2A73B 1EAH2 3S30A 5T50A 4NROA 5JR7B 5LZ6A 1JZ6A 3GHMA 2P37A 3BIWE 3POFA 2LM3A 3H42B 4ONUA 1AXZA 1D4VB 3OY8A 1TZOA 4RFT0 1D2QA 1WW5A 2VOXA 3KV6A 4R4ZA 5EWSA 5T5OA 4C0BA 2YDEA 1FMD3 5DZFA 3NQHA 4FOVA 3U1XA 4PLOA 2GSYA 5A6QA 3R4SA 3LPGA 1PK6B 3NSTA 2WDBA 4WBBA 3MICA 5A7PA 1R092 2RM21 2JIJA 4YSFA 2QQLA 4OHWA 1DBNA 5FYBA 2RM22 4UFLA 3TN92 5A1AA 3AP6A 1ND3A 5FO8B 5HCAA 4BIFA 4LJHA 4AEDA 2BFUS 1UMZA 3AKPA 2EXIA 4KMQA 2HWB1 1WCKA 2R063 3BTAA 4V1PA 4ZU5A 4A6OA 4W50A 3CKHA 3OUHA 4NHYA 4NOTA 5T3NA 4Q4W3 1S1AA 1AYM3 2W52A 1OD3A 1ZBA3 4LE3A 4EZ4A 1XRUA 2ZMNA 2R072 1YQ5A 2NQYA 3AKTA 3WP3A 4O65A 5C4WA 4IUGA 1PO22 3SEPA 1LOFC 2VQAA 1PO12 3SCFA 4E2SA 5LK7B 5IVCA 2WSVA 2XKPA 1RUNA 4HL0A 1A8MA 3VKOA 2JDAA 1DU3D 1UZVA 1H9PA 1IG0A 1ACCA 2RS12 1N1VA 3OYWB 2BP6A 3NKTA 4XF1A 3J9SA 5FYCA 1A78A 5KXCA 4QKBA 2V73A 4QAWA 1JOPA 5EHDA 2Q1MA 3JU9A 2VG9A 1TVGA 1QIQA 3WZ1A 3ZDSA 4CDUC 1QOSA 4F8AA 2WINB 1ND2B 4LKEA 1XJAA 2VMCA 1W0OA 3E5XA 2PTMA 5FREA 3RZKA 5BPXA 3C7HA 3POEA 2Z4FA 1OHFA 4Y5Z0 5FBZA 4E8CA 4QXKA 4FPFA 3M4FA 4E4DX 1QF3A 4N43C 1PNGA 2W2IA 4KL1A 1XC6A 1XNBA 1YI9A 4QPIB 4ZPIA 3MUY1 3K2OA 4RQPC 4NMIA 4S2GA 3EHKA 4AW7A 2D3RA 1GP6A 1BK1A 1SFYA 2DTYA 4XETA 2JIGA 1CZVA 1RXGA 3HD8B 4OULA 4OI4A 4K6BA 1SBDA 1QKQA 3TEWA 1K5MB 4CUAA 3RZHA 4LKDA 4Z1VA 1JTZX 1O5LA 1TMF3 4HG6B 3WG4A 3BTZA 3LSDA 5AFBA 1W6NA 5HI0A 2J1EA 1S0JA 5LA0A 5IUQA 2BV4A 3PUAA 2B7YA 2C24A 2D6MA 3LIGA 4F3JA 1AXYA 1AR93 4EN0A 2QQPA 5KC5A 1BBT1 1KJLA 4DB5A 1BBT2 3CZUA 1JN2P 2BPA2 3LA2A 5GZFA 1MS1A 2BNMA 2ZAAA 3HQUA 4ZKTB 2WZPP 2OPKA 3PHMA 1GFF2 1YFUA 1FPN2 1DYKA 5CNAA 3A4UA 4ZZ8A 4QHOA 2JDMA 4LHLA 4KU7A 3QCWA 3ZPYA 4FAHA 3KQ4B 3VBRB 1QOOA 2RMU3 3Q9OA 1GMMA 4UFMA 5C8CB 2JG8B 4XF3A 3K4ZA 1AUYA 3W20A 2ZZJA 3VZMA 2TUNA 1OKOA 3UL2A 2G9FA 4MOAA 3FHQA 5GLTA 3ZN5A 1GV9A 2A7AA 5FY0A 3VBUC 3SISA 3WW1A 1BLZA 3P6BA 4MZUA 4YM3A 5FR3A 2JD9A 3MLKA 1LOFA 2K9ZA 3PIGA 4N7UA 1RUJ3 3AYEA 4NIHA 5J98B 1MVQA 3D0JA 3PUQA 3GCWA 3O5SA 3ZSMA 2JKXA 2QZ2A 3KVAA 3I3DA 5KXEA 4KWKA 2C9AA 5FLIA 4C90A 1QNWA 2RS33 4LBQD 3W9AA 5F2WA 4AI9A 2QZ3A 5GLWA 4PIXA 5JOWA 4EYUA 5G04L 1PIV1 2ZPXA 4CDUA 3PTRB 3N4MA 1GWKA 2WA4A 4LHNA 1CAWB 5IVYA 5DAPA 1OF4A 2IWGB 2K0GA 3L2HA 3R4DB 2FD8A 5JOYA 5FOJB 3VKLA 1W0NA 1OLMA 3WCSA 1VBC1 2CY6A 2UWAA 3B9IA 4N43A 2JECA 1JODA 1VBC2 3BOWA 4YZ1A 4A7KA 4QPWA 5ACA1 5AFEA 2H0VA 3UKNA 3ZIWA 4RQPA 3ZMOA 1WCSA 3C8XA 5A32A 3AKSA 2Q0AA 4NRQA 3JB8A 5EJ1B 1ASJ1 5LATA 3BOPA 1SLBA 3GZAA 5IVJA 4CCDA 1Y4WA 1OA4A 1QJU2 2C5DA 3OGVA 1AZDA 2Q8OA 2J22A 5LK5A 2MEV2 4YW2A 3Q8BA 4XFFA 4WM7B 5JSRA 3IMMA 3NNFA 4NHKA 2W92A 3OPTA 1QH6A 2B45X 4EZHA 2ZEZA 4FOYA 1JI6A 5AC93 2OW4A 5F3EA 2GZWA 1FYUA 1V6LA 4LHSA 5F37A 3PDQA 1MS0A 4AQTA 5C70A 2IXCA 1K45A 1G9BA 3VBHC 2EICA 1IQDC 1S0GA 4DNYA 4LHKA 5BNOB 2GDFA 2C9KA 2DCJA 3J8F1 3NV1A 3ZKUA 1I5ZA 5C71A 1P8JA 3O1RA 1R093 3J8F2 3NNGA 5F39A 4B7EA 3O1TA 2KA3A 3TN93 2EXHA 4N53B 1JZ8A 5FZOA 4A41A 2VZSA 1DGWX 3ATGA 2Z2SB 5JSOA 4LO4B 1LB2A 2GNMA 1S2EA 2B9VA 2EA7A 3IDAA 4GJYA 4Y5SA 4L92A 1NKGA 2A6WA 4WVMA 3CHXA 3VD5A 2AUYA 3FBYA 5I0UA 1M4WA 2BTVC 3PUSA 4Q0PA 4QD2A 4XE9A 1V70A 1VBE1 4XXPA 4JRLA 3VBUA 1HV1A 4CDQB 3IT8A 3AC0A 4YZ5A 3DUIA 5KHHA 4BXSV 1UIKA 3ASIA 2R073 5L9BA 2MHFA 3CMGA 3TOJA 2XG3A 4IE6A 3KLSA 1NLRA 1PO23 4NHMA 2QBXA 1PO13 2WNUB 2JDZA 4IEQA 1DQ2A 5C3SA 5L9RA 3U4SA 2E32A 4M0HA 1V9U3 4Y22A 4EWAA 5CFDB 2RS13 3ZIXA 1VPHA 1MVEA 3PL0A 1CVNA 4MXVA 5A3UA 5L9VA 1MS5A 5GLZA 2VTXA 1W6MB 4P08A 3TEYA 3SC7X 3NW4A 1V6KA 4YW1A 2PQSA 4YM2A 3GM8A 3I2DA 3MHZA 1KS4A 4G4FA 1OQEA 2WNVB 2XJTA 3BODA 1JYTA 4RS5C 1WBLA 3NV3A 2PLV1 2RDRA 4O61A 4R9CA 1AVBA 2PLV2 1HXS1 1BQPA 1ULFA 2CGOA 1XYNA 2ORXA 2CAUA 1L3JA 3AL6A 3IAQA 1G9CA 2IC1A 5FYYA 4BLJA 3I49A 3WDWA 4A45A 2WL1A 1LENA 2PFWA 1OURA 1SEFA 2WS92 2A6XA 1QGLA 2P6HA 3EBRA 5H9RA 3OY8B 1X50A 4ZU7A 1F15A 3O1SA 1AJKA 1GWMA 1A8DA 4YW6A 1ZZCA 2R30A 3ZYPA 4DQAA 4PJYA 4XXAA 4E4ZA 4IDZA 1BZWA 4KG0A 4M3CF 2GNTA 1ZBE2 4QM8A 2FCTA 1JXNA 1ULDA 3ZLIA 4ATEA 4LO7A 4YVWA 2ZACA 2XOMA 4KG8A 5FZ6A 3VBHA 4CEYB 5BNPC 4A6SA 1QOTA 5JLVA 3KV9A 5FO7B 5KXBA 4XFCA 1RUG1 2A70A 4IW3A 4YZ4A 4AEDB 1KEXA 1RUG2 3IZOA 1PK6C 5DUUA 5A33B 4K3UA 5FKBA 4AI3A 1AYN1 2VO5A 4PCRA 2Q8EA 3EO6A 1WA4A 1FPN3 2ET7A 3N9MA 5FYUA 2KXLA 5K0UA 1W9SA 3RJ2X 3POBA 4P9LA 2WWSA 2C0ZA 4PBPA 1WW6A 2R042 2X53S 3UGFA 2V72A 2W0XA 2VCBA 1RUF1 3MF9A 1CPNA 3U37A 3BI3A 4Q4Y2 5C4WB 5F1RA 4PI2A 2PXJA 4BQ5A 3D3AA 4LBJA 1I1EA 2VD7A 5A6XA 3C7FA 2F6BA 5DAQA 5FZBA 1CAUA 5EJZB 3CDZB 1HQLA 3KGLA 1U5YA 4COZA 1YHFA 3GJBA 3J7NA 3LAGA 4AVVA 3OOXA 1HRV2 3OD0A 4A4AA 3FC0A 4KI5M 1H0BA 1ZVFA 1H1MA 5FXXA 3VHNA 2CSGA 4UF0A 1MZEA 4URTA 4W4ZA 1K3IA 4TLFA 2HWD1 1O5UA 5CG8A 2HWD2 1OOPC 1OUXA 3GJAA 4SLIA 1LOEA 5JI7A 3WVJA 3K4AA 1JS9A 1OH4A 2QFEA 2PHWA 5HV0A 5FZIA 4EQVA 1ZRCA 1F31A 1ZYBA 3RFRA 2R32A 3OBAA 1CJPA 4Y1VA 4BXFA 5G05L 2SLIA 3LOIA 5LY2A 3X29B 4RS5A 5DMYA 2DYCA 5K0UB 3LDBA 1HLCA 1WZXA 2JG9C 4WV8A 1IS3A 4XQ4A 3P5BA 3VD9A 5CVRA 4AFCA 2WT2A 4V2VA 2XH6A 1NOVA 3AB0A 2D97A 4QXBA 3VD7A 2HWC2 3CJIA 5DG2A 2A3YA 1VMFA 1JZ2A 3RI8A 1W6NB 2ILMA 4A44A 4R9BA 3VDDC 3ZR6A 3BGAA 3E6CC 1QJU3 1S0EA 4HKWA 3RQ0A 3T2OA 1YJKA 4TZDA 3AZVA 4LE4A 2RS51 2MEV3 5F6LB 1E5SA 2C4XA 1YWKA 2XUMA 1ULPA 1ENRA 4IESA 1PMHX 1XU2A 2RS52 3I2GA 4M3CE 5FYZA 5A7WA 5GLVA 5I0RA 1DQ4A 2PN5A 3BTYA 5JXIA 4QDSA 2C26A 2DFBA 4UFKA 2D43A 3I2OA 2PHUA 4AZZA 3B3QE 2AZ5A 4IGQA 5CFCB 3N9QA 4YW5A 4IEOA 2B46X 2D6OX 1PK6A 4CP0A 4XZPA 3LGRA 2E53A 4NUBA 1UKRA 3NWKA 1QJEA 4BCUA 3POGA 4OVEA 2YHJA 4J6GA 1HB1A 1TME1 1VBD1 2O14A 4FFFA 4TXWA 2ZXQA 4A42A 3ZXGA 1RUE2 2DWRA 5FMCA 1MS4A 1XNAA 2VC9A 1LHUA 2Y6JA 1LGNA 4FAGA 5I91A 5C8CC 2WFF2 2AC1A 2CWSA 3I2JA 3NKGA 5DDJ2 3GZTB 4CUGA 4BZ4A 3B01A 1W9YA 1Q56A 4N9IA 1TG7A 1AR82 2Z79A 1E5IA 4NIIA 1OLQA 2ZA9A 1QDOA 4W65A 3AYAA 4QQHA 3GYDA 1EV11 1BVP1 1UOJA 2DUPA 4S2HA 4DEVA 3LFIA 1EV12 5FPZA 5FZMA 1RC6A 4CA9A 3BPSA 3WNOA 3WF0A 1AL22 1PHMA 2VNGA 3OUJA 3OYWA 2VY0A 4DXSA 4NPMA 5HBAA 4O9EA 3KGZA 1OOPA 2VMDA 3T0DA 4ARXA 2CGPA 2ZGKA 3RJRA 2LTNA 2ETEA 3K77A 5FK8A 4N43B 3O1PA 1VBB2 4UAPA 2DVFA 2WZR2 3I3MA 1W8UA 3NRUA 1UZZA 3VZOA 1UL9A 4RQPB 2ZMLA 1OH3A 3AMMA 2WNOA 5IW0A 2NMOA 2DVDA 3M1HA 4FVVA 2V5DA 2JG9A 4XOGA 2FDKA 3H3UA 1Y7BA 1PX4A 1W05A 2VTFA 5LEJA 1DGLA 5CZKA 1MPXA 4NHLA 4I0BA 5JXGA 4H55A 1IPJA 2JDYA 3LCPA 5FCCA 1KQRA 5GJ6A 3QBQA 5A7OA 2WS93 1FMD1 2Y8KA 3MW2A 2RR12 2D6NA 3SH5A 1OXCA 2X09A 4YVSC 5IFPA 1K5MA 2FDHA 4XF4A 3OD4A 4HONA 4MADA 4XJ9A 4ARYA 1EP0A 5A3NA 5FMDA 2VMHA 1PNFA 3JQXA 5C33A 4XBNA 2HBUA 1UY0A 1ZBE3 1HB2A 3FFZA 5F6KA 1GU3A 2ARAA 3OG2A 4JDNA 2TBVA 1ULCA 1UYPA 1RITA 4LUMA 5FBJA 2VCAA 5FZOB 5KHIA 5JUVA 2R061 3WXPA 5F2SA 4DUVA 3R05A 2JWPA 3IBMA 2R062 3N9LA 2D44A 4YGCA 5FP9A 5KR7A 3J26N 3JD72 4Q4W1 3M3QA 5FPLA 1G9AA 1AYM1 1LKNA 4Q4W2 1XNCA 1ZBA1 2BZDA 4JRAA 1AYM2 1NAEA 1G8WA 4UOJA 4P9YA 4R52A 3UKVA 5EP9A 4G3YC 1RHI2 1QXJA 1IQAA 2VW1A 2J42A 3SCGA 1W6QB 5C8CA 3NNJA 4HSJA 1LNSA 2R043 2VMIA 3KQRA 3E6DA 2A3WA 3MZHA 4Q4Y3 2VZUA 2ID4A 3ZDVA 1IPSA 1XQNA 5ANNA 1F5FA 1E5HA 3THPA 1JH5A 2GU9A 3VKNA 4FTEA 2LS6A 4Y22B 1SLAA 2WO7A 1UKGA 2P1BA 1JZ7A 5T5JA 1W28A 3D0SA 2GC0A 3J7LA 3RZJA 1HRV3 5BY5A 1ZA7A 4CVUA 5L7OC 2WNUC 5B4XA 1AXKA 5IAXA 1UPSA 1C4RA 3U07A 3O0XA 3PU3A 5J36A 5CFDC 4IE4A 3O14A 4M0NA 2N7GA 4D7TA 4NIAA 3THTA 1BEV2 1W8TA 1CAWA 4CZSA 4L97A 1W2AX 5C8WA 3MLJA 3N36A 4NHXA 3T0AA 1VAMA 1JUHA 1XE0A 2YC0A 4JX0A 1R1ZA 3Q8EA 4IV1B 2WNVC 5D1IA 1D2SA 3H1YA 1O6UA 5FPBA 2YXSA 4OUEA 1IGOA 1TMF1 4IETA 3OJBA 4BISA 5CG9A 1U5XA 4Z8BA 3VN4A 1EYBA 1D0HA 3T2QA 3WNXA 1OUSA 3AM2A 1AR91 2HWC3 4FTBA 3AP4A 4LORA 2GC2A 1PZ9A 3WG3A 2HYKA 4AOCA 1W9FA 4YVSA 4LITA 3VBHB 4QX3A 3AZZA 1SLCA 2BU9A 3M7AA 2XJPA 4NIDA 4WM7A 3M3CA 4XIOA 4DUXA 1J59A 4QX7A 2XWBB 4I3PA 1NE4A 2BOJA 1W90A 3ENRA 1UZ0A 1GYKA 1HDKA 1S0IA 3U78A 3ACLA 4MGZE 1JHNA 4QGLA 1OQDA 3VBSC 5GZGA 2RMU1 4CEYC 1SQ4A 2Z5WA 2ZGOA 2RMU2 5BNOA 1DYPA 2QNKA 1W8HA 3RMXA 2JE7A 3DN7A 4ASMB 1CAVA 1LHWA 1PZ7A 2ZKLA 3NNLA 3IDCB 4INDA 4N53A 1VALA 4W6YA 4XYXA 3CBNA 1OFSA 3BCWA 2RVAA 3VZJA 2XGXA 4C1WA 3I2HA 3AVRA 3O7OA 4DFSA 1RUE3 1W2UA 3S0MA 4C0HA 4FFGA 2GMEA 5JOZA 4QHBA 1RUJ2 2B4KA 2WFF3 3ES1A 1N1TA 4GAZA 3RZGA 4LKSA 4QQLA 5DDJ3 4AFAA 2WR9A 4FQ4A 4UF0B 4DXTA 2RS31 2I74A 2OUHA 2VQ0A 1HB3A 1AR83 3K46A 1UY1A 4A3ZA 2RS32 1X8EA 3B5LB 3LIHA 4IE7A 3VLBB 2CDPA 3H8UA 4CP1A 5CISA 1DZRA 4PIYA 3TEZA 4Q26A 5DUXA 2BFUL 4XFGA 4CXXA 2WNUA 3M3OA 1DZQA 3MFAA 1CGPA 4LOSA 1AL23 5CFDA 2AR6A 1BYHA 4E27A 4ZS2A 4RS5B 1NCQC 1AL0G 2XXZA 2Y6LA 5FY4A 1UAIA 2B5HA 1VBB3 3AMPA 3V0AB 2WZR3 3G6JB 1EUTA 5CAZA 3KMHA 3VB9A 2RJKA 2AEZA 1GOGA 2WNVA 4EV0A 4AI2A 2VUDA 2ES3A 3J7MA 2VECA 4NAOA 2VNVA 5IVEA 3N3HA 2NN8A 1MQTC 3OSDA 1EAH1 3AFKA 3LEIA 2P3JA 3R0RA 1J84A 1U5ZA 5AC91 1F8VA 1L7LA 1ZNPA 5AC92 3Q8FA 5A7WB 2QJVA 5I0DA 2RG4A 1XOYA 4OHXA 3T30A 4FBFA 3OEBA 3MPPG 1UMIA 2RR13 5BNPB 1UQXA 3D8CA 4RGAA 4UW4A 5LBCA 2VR4A 3BUCA 1KDMA 2EIGA 1R091 1W99A 3PU8A 3DEMA 2YB7A 3TN91 4BK5A 4AQ2A 4YW3A 3ZO0B 4XC9A 5K8SA 1DGRN 3LPFA 4OQ8A 4CEYA 1UW8A 2PQQA 3FE5A 3DXTA 2J1TA 3MEPA 1OMIA 4FOWA 1AJOA 1US3A 5FZKA 5CFCC 5E1RA 3HAGA 4CU8A 4AR2A 2B42B 1JW6A 4MGYE 1VAVA 3JZVA 5FZGA 1YFWA 5A33A 4AEMA 5I8YA 3JD73 1W8ZA 1XNTA 3LDKA 4OCTA 1A3KA 5FJHA 1PGSA 1LODA 4JVAA 4K1YA 4LTAA 5AVAA 2WQ8A 4AFBA 4GMP0 4H14A 4Y5TA 5C7GA 4QQ2A 3SKVA 2XB6C 3POSA 1H6YA 2VE1A 3RZLA 1AHSA 1N1SA 2R071 2XJRA 4G9SB 4ZXKA 3WDUA 3ZXLA 1RHI3 5H9PA 3OCPA 3B94A 1PO21 1DLLA 1G9DA 2OKXA 1QEXA 5HCBA 1PO11 2XHKA 2ZEYA 2XJVA 3V65A 1V9U1 4URAA 4QPGC 2RS11 4GXLA 1T6GC 1V9U2 4XZUG 2ZGUA 1OLME 1DLCA 1QJZA 4XQWA 1OOPB 3AP5A 1N3PA 4XW3A 3RZZA 2XHNA 3VBOC 3PLQA 2Q30A 3PVEA 1AR63 4AE2A 3OGGA 5KBFA 1NY72 4Q4X3 4QXHA 3SXWA 5HV4A 4JTNA 4QX0A 4H7MA 4OMDA 5FXWA 1C57A 5IK7A 4I30A 2JG9B 4XVHA 4K8FA 3WDXA 3I59B 5CADA 2VUAA 1W6OB 3MIBA 1GBGA 4MGTA 1RJ7A 1FXZA 3IAPA 2WC2A 3N7LA 4WZCA 1BEV3 1GP4A 2W87A 4E2QA 2VGDA 4BWOA 5FWJA 1O3RA 2EF6A 2P5BA 3BIEA 3QACA 5FK7A 2ZEWA 3M3EA 4JV4A 1UWWA 2VQUA 3D82A 2VZOA 4GWJA 4K20A 4Q0SA 5F5CA 4KGQA 4ASLA 3RMYA 5LEKA 1MQTA 1DYOA 3VDDB 2ZMKA 1SCSA 1ST8A 4X6QB 2JDNA 2ENRA 4GALA 2D40A 5HXMA 2R1DA 3AP7A 1F9KA 2OPWA 4IEXA 3BVCA 3L9JT 4IV3B 4TLGA 4AAXA 4Y3OA 2GP3A 3HNYM 4MYEA 3WQ1A 2FBEA 2BVBA 2OUJA 2JDKA 3KVBA 4OI2A 4HMZA 1X33A 4JHZA 3DYOA 3NV2A 4LBKA 4LIUA 3WEZA 4QWNA 1BJQA 3KCYA 3S57A 2XONA 1CN1A 1RIRA 1FAYA 1FPN1 2BBVA 1SLLA 1UY2A 3PURA 4O7XA 5F32A 5E16A 4PHZA 2XL9A 4XACA 2ZX2A 2C1FA 2VU9A 2VW2A 2ZHLA 3ZR5A 2ZBJA 1R1A3 1ULOA 4U2AA 5CFCA 1Q3EA 1H8VA 2Q8DA 4IERA 3MDPA 1YLLA 4OHZA 4BDVB 1YQCA 3L2YA 2J1VA 4GKXA 4HVOA 3LOBA 5EFUA 2DCKA 3B7MA 4R9DA 1QJX3 4CDWC 2ADEA 5A3WA 1G9FA 1NZCA 1Q8SA 2VZ1A 3APBA 1O59A 1YEWA 4GWNA 3LEKA 1MEC2 3N7KA 2D6PA 1C28A 1N47A 3RWKX 4CE8A 2P6CA 3HR9A 1SLTA 1W8FA 1RGSA 2XJUA 5FYMA 4BMBA 1OA3A 4LA2A 1TNFA 4Y33A 3QH6A 2WLPA 4EN7B 5E6HA 2XLGA 4JQTA 3S6PA 3VBOA 4GIQA 3ZSLA 3S5QA 4AQ6A 4HKLA 5H9QA 3RGBA 2VOKA 3UGHA 4LBNA 3HMYA
chains in the Genus database with same CATH topology
1COV2 4QGNA 1J3PA 3ELNA 3H1WA 4COYA 1GZWB 2A6ZA 3WUCA 1B09A 5IK8A 3B9CA 1VBA2 1ALYA 1O91A 1O3QA 3ZXKA 4MLOA 2YV8A 5I8TA 1UU4A 4AVCA 4IV1C 4Q1RA 2PELA 2ERFA 3B69A 1QJU1 2B39A 3ZFFC 1NE6A 5D8AC 1ZZ8A 3S7IA 1O4ZA 2MEV1 4YVSB 1V6MA 3WDYA 4LLFA 2DU1A 4RA0A 1XNKA 4UXAA 5GALA 5JMCA 3SNMA 3W59A 3H1MA 2Z69A 5HCFA 4EN6B 3O0WA 2BNOA 3FHIB 2O0OA 4OZXA 2I45A 4XFAA 4K1ZA 4HN1A 3CO2A 4BA6A 4DPNA 4CEWC 1BKZA 2CAVA 4DOUA 3H7JA 4HVRA 2W39A 3LA7A 1N1YA 3IIAA 1WBFA 1CAVB 3VZNA 1GLHA 3P3PA 2DURA 1YFYA 4GMP3 4FT8A 4YARA 4JDMA 1H2LA 1IOAA 1J1TA 3U4XA 3I54A 2Y26A 2CGNA 2EAAA 4B7KA 1VB4A 5I0SA 4CDWA 2DCYA 4DMIA 4XFIA 1W6QA 1LECA 2PAMA 1Y43B 3EQEA 3RNSA 1SMVA 2H0BA 2DFCA 1C1LA 5L7OB 4E9KA 2D5FA 4HSLA 1HRI2 4QX5A 4DS0A 2MNGA 2JD4A 4IEZA 3OGJA 2A71A 4JAAA 4PLNA 5LRRA 5BUVA 4LULA 1RUC3 4YZ2A 3TNPB 1GQHA 3M70A 4YRDA 3H50A 2WIIB 1NA1C 2EXKA 1HKDA 1Q5OA 1KITA 5JWPA 3MW3A 2VVFA 1OPOA 4XPVA 2E6VA 2VNRA 2WS91 4IV1A 4X8PA 1CONA 4HK9A 3ZFFA 5D8AA 1XE7A 2FZ2A 4XJ8A 5J37A 4A7ZA 1ENQA 1NXMA 1WMDA 1ZBE1 4JGZC 1LRHA 1SCRA 2D6LX 2BWCA 1B35C 2DU0A 3VBSB 5EYXA 2DV9A 3ZVXA 1OQ1A 4KH9A 4AXOA 2AREA 3BU7A 1WCDJ 1MZ6A 4OI0A 4LBQB 4D7YA 1OI6A 3DPRC 5SV5A 3B93A 1CQ9A 3IDBB 3GHNA 4AVTA 2HEYF 2Y38A 2R041 5DG1A 3OF1A 1ZZ9A 3T1LA 3DGTA 3ES4A 2JEMA 4Q4Y1 4YNIA 4AVBA 4FPYA 1C8NA 3AMNA 1H30A 1LGBA 1POV3 3MIFA 4J1XA 3ZFGC 1WGPA 4Y20A 3WW4A 1VAKA 3SHRA 2ZKNA 4UW6A 1N3OA 1HRV1 1MEC3 3AZXA 1O3SA 4R4XA 4FPJA 4EROA 1KDKA 4L8QA 4KWLA 2DVAA 1CJDA 4LUKA 3WINE 3VGIA 4LA3A 4AHZA 1NCQB 4S2DA 4BE3A 3WG2A 4TSVA 3RPQA 3ECQA 1YO8A 3IDEA 1IKQA 3WUDA 3WW2A 1COV3 3HN1A 3FUOA 1KXGA 2UYAA 4EWEA 1NA1A 1UX6A 2RJLA 4AI1A 3FJSA 1MQTB 3V0AA 1HQWA 2G4IA 2HWC1 3ZYGA 4A7YA 1VBA3 1C8M2 2OZ6A 3P3NA 1GR3A 2HEVF 3UV9A 1GKBA 2R0HA 1LOCA 3HQXA 4B4RA 5FDBA 2ZGLA 2ZS6B 4W6XA 5E88A 2BEOA 2GH2A 4JGZA 4BLIA 3JB4C 2GALA 1J3QA 2E9QA 4AF9A 4IV3C 2WT1A 4XF0A 1BMV2 1DHKB 3U0ZA 4Q0VA 5BNPA 4LLOA 3H7YA 2XLFA 3KCCA 2WLQA 1ZZ7A 2QDNA 2GMMA 2D93A 3VZKA 1MS9A 4ATFA 4XJZA 1QH7A 4L11A 1X36A 4PDWC 3WG1A 1RUE1 1BCXA 2RHPA 3RWNA 2HWF2 3MFCA 4AG4A 1BVVA 2WFF1 1Q8PA 1GZ9A 1SDWA 3MPBA 5DDJ1 3AZWA 3KT4A 1HW5A 3ZSKA 2ZCWA 3PVOA 4HN0A 3ZFGA 4P9WA 1AR81 4QPGB 5ABJC 3PNAA 2YYOA 3D6EA 1JYCA 3ETQA 3WT3A 4XQDA 4Q4V3 2WNEA 1HQNA 3LA3A 5FTTC 5EXOA 3VBOB 5EJ3A 1IHMA 3ILNA 2QDRA 3VKMA 1YYNA 1YUDA 5C9AC 1AL21 2E7AA 2ZX0A 1HRI3 3VL9A 2UU8A 1HIXA 3RDIA 2ZGNA 1VBB1 3R4UA 1REDA 2WZR1 3WY6A 1YJLA 3NAPC 2TNFA 1Z0HA 1LESA 2XPJA 1FV3A 2PA7A 4N90A 4K21A 4YG6A 1RMU3 1LULA 3QD6A 1ENSA 1VBE3 1YXWA 3RYKA 1H4HA 3A0NA 4BYYA 3I59A 5IT6A 1W6OA 1WLDA 3MIGA 2H6CA 3RRDA 4AK3A 5GZEA 1J1LA 1VRH2 2ZZQA 3RI9A 1LHOA 1V6IA 3TB0A 2QE3A 2RR11 3ILFA 3ALQA 1DQ0A 5BXXA 2Q4SA 3FFQA 4RR3C 3VDDA 3WDVA 4KWJA 1PVC2 4RHV3 4TWTA 2RE9A 1RB8G 3FX3A 5IK5A 4Y1YA 1XXNA 4IV3A 2ZGSA 2XJSA 4U36A 4E2GA 4DZGA 3NV4A 3AMQA 2P3KA 2IFWA 1UCXA 1JBCA 3M2MA 1H9WA 1ZZ6A 3JD71 5J3UA 1UF2C 1X8MA 1RVF2 2XVKA 5DUVA 1GANA 3HT2A 3E5UA 2E63A 2GH8A 1RUOA 1CAXA 3WD5A 4CDWB 1RHI1 2AGSA 5GLUA 5JPMB 4ZU4A 3WP4A 2ZTNA 4KU8A 1Y9QA 3V56A 1H1AA 3T1MA 4L2NA 1V6OA 5JPNB 1LJ7A 5ABJA 4YYOA 3ZSEA 5LRSA 4HVQA 3ZXFA 4JGYC 4MX3A 3BPZA 2E51A 1AR61 4COUA 3KS7A 1H2NA 4Q4X1 4YG3A 3RYRA 3ME2A 5C9AA 1AR62 1YIPA 1Q8QA 4JTOA 4Q4X2 5B2GB 2NM1A 1ZRDA 4NR1A 5JI9A 1QY4A 4CDXC 1UD1A 1C3HA 1YNAA 2D3PA 1ZRFA 5T5LA 2X29A 3I4IA 3NAPA 1BEV1 2NMNA 3AKQA 4LR4A 4C1XA 2HKXA 1PGW2 4RL7A 4JCKA 3C2UA 2BQPA 2YROA 1WUVA 1GZWA 1D4M2 2ZX1A 3T2TA 1XNDA 2XBO3 3ZN6A 2JENA 3ZFFB 2PAEA 5D8AB 1TNRA 4MSVA 2FMDA 4WVVA 2UWCA 3LKJA 4OUMA 3KM5A 4CP2A 4W6WA 1C8M3 3FUQA 1OPMA 4FPCA 1LOAA 5FOBB 2P3IA 4AYUA 2D7FA 4RR3A 4FOQA 2NYYA 4CEWB 1OSGA 4Q1PA 4DRVA 2WA3A 4LO8A 3D5OA 2IZWA 4F7ZA 2PHLA 3WCRA 1R1A1 3M3IA 1RUD3 2D6KA 1R1A2 3AK0A 1VLNA 5CA6A 1F5JA 1ONAA 4AVAA 3ZXAC 1C5HA 1R082 5JIAA 4AEJA 1QJX1 1LOGA 1PGL2 1D0GA 2HJIA 1FX5A 3OPZA 1QJX2 1FOD2 2JICA 4LNVA 4Y20B 2GN3A 3HIFA 1MZFA 2OYZA 5I8SA 2GNDA 1U12A 2GMPA 2HWF3 3SLIA 3O0VA 1RUJ1 3FWEA 3IPVB 4IEYA 1OA2A 2ZABA 4FPKA 5FLHA 2IXHA 2JX9A 1X7NA 3JUUA 5CIRA 5JOXA 1SFNA 3VBFC 3VL8A 2IXLA 1H2KA 1QNYA 1DQ6A 1IS6A 4JGYA 3TRSB 2DUQA 4D94A 3MIHA 4R9AA 3JBG2 2YY1A 3ZX7A 3VZLA 3AYCA 5L7OA 2JXAA 1QWRA 4IQPA 4NO4A 1PMIA 3ST7A 1AR73 4FCAA 3AP9A 5FMOS 1NA1B 4B3NA 4Y1UA 4EWDA 5L36A 2BW8A 3V0BA 3NL1A 4MVTA 2PYTA 3MI8A 3U11A 4PF5A 2IXIA 1RUH2 4Q8LA 4NPRA 3WQ0A 3AKRA 1URXA 3RSJA 2OIIA 4MGKE 4Q0QA 2JJ6A 2VW0A 2Z42A 5BNNC 1H8TC 2WSUA 1VRH3 4JGZB 1RUI2 1V6NA 1S0FA 1J3RA 1B35B 1QJY2 3VV1A 1GICA 4AWDA 4J1WA 1PVC3 3R6SA 4LT5A 3GZUC 4AGVA 4AGGA 4GMP1 5KWRA 4GH4C 4P9IA 2E7QA 2A6VA 3DPRB 4FQZA 1NYWA 1QQP2 2H6BA 3N35A 3VBSA 4RGGA 2R16A 5FAXA 2NPIA 1NCRC 4R8HA 4OHYA 4LBQA 1RVF3 2XKOA 4YFWA 1YFXA 4XJAA 3ZFGB 2ZAHA 3DKWA 3ZMNA 4LBOA 4UW3A 1J58A 1KFXL 4Y1ZA 4YGDA 1KRIA 3IWZA 4FPOB 1U5IA 2DVGA 2NP0A 4Q2FA 3V64A 1VJ2A 2WT0A 3VBFA 1H4GA 4MXWA 2IFRA 2XLAA 3ZXDA 1CD3G 3NVCA 4D3WA 1LGCA 5J96B 2VMGA 3OTFA 2HWB2 1FV2A 1RUC1 3EJKA 3MW4A 1NY71 4K7JA 1RUC2 1I6XA 3AMHA 4JC1A 2Y0OA 1O3TA 1H1IA 3H9AA 1LHVA 1AX0A 1NCQA 1NQDA 2YPJA 4FPEA 2PHXA 2SBAA 3W58A 3GALA 4I0AA 1G6NA 4QQPA 1WLTA 4I2OA 4ES9A 1OD5A 1GSLA 1D4M3 1Q43A 2YGMA 2VPVA 1X82A 1UU6A 1REEA 4XFHA 4UBHA 5BNNA 1H8TA 4C91A 4WM8B 3IKWA 2OA2A 1LCLA 5KHGA 1N3QA 4EJRA 4LO6B 2VNOA 2ATFA 5EYYA 1SBEA 1W6PA 5GM0A 5HXVA 1IZ3A 5JSPA 2BYVE 1O7FA 4FPLA 2CYFA 2ZHNA 3M8LA 3VHRA 2D5HA 3N7MA 4GH4A 4HT1T 3SCHA 3I7DA 4N7IA 1TE1B 1O4YA 1CR7A 4PDWB 1CAXB 2WKKA 3PJYA 4GB33 1QHDA 5JCTA 4XFBA 2QVSB 4MH0E 1NCRA 4YLZA 5SV8A 3TYJA 1M06G 4WZFA 1POV1 4NVPA 1R083 4GQ7A 4L99A 5ABJB 1F2NA 1FOD3 2WFPA 3DL3A 3FZ3A 4DRRA 1MEC1 5FO9B 1BXHA 4XMAA 4AHYA 2UY9A 4M3CB 3U10A 2FMYA 1O4TA 2X8KA 3BB6A 1A6CA 3E6BA 4S2FA 2HWE3 4XF9A 5C9AB 1POV0 1UU5A 4MV2A 4QPGA 4HPKA 4N9HA 3PMEA 1FI2A 2GNBA 1NXD1 3JBG3 3NAPB 4KGGA 1SACA 4ORFA 2LALA 2YUEA 2R1BA 4AEKA 1Q8VA 1COV1 5L73A 4FP3A 5FPXA 3G7DA 4FPGA 1AX2A 3WQ7A 2HEWF 2G9GA 4LBLA 3KD4A 3ZN6B 4Z82A 4EN8B 1Z7S3 1LU2A 3WHTA 1VBA1 2LUWA 2A75A 2XVGA 4MUVA 1MZ5A 3CF6E 4DINB 3RG0A 1RUH3 3CEWA 3MIDA 4QU2A 2BNNA 3B02A 4I01A 5FLJA 1TQ5A 1U0AA 4IEPA 5JZGB 4AI0A 4RR3B 4HBNA 1S2BA 1PIV2 3WP6A 5JVVA 3AXEA 3MYXA 4KBBA 1RUI3 2FZ1A 5T52A 4CTEA 4B4PA 3OBTA 1Q8OA 1ENXA 2EALA 1QJY3 1LR5A 1XYOA 4PIZA 5ACA2 1EPZA 1VR3A 2XJQA 1CIWA 5H9SA 1H2MA 5K9YA 3NO8A 4FSJA 2DCZA 4XTPA 1ASJ2 1DZTA 1WMFA 4I0WB 2R49A 1OKQA 1QQP3 3ZSJA 1IS5A 2ZJCA 3ZYIB 5A3LA 2CV6A 2VUJA 1EAH3 4XIKA 5T5PA 2CL2A 5BV6A 1IKPA 3DF0A 1C1FA 2JE9A 2X5IC 2ZGPA 3GF6A 4YM1A 4YVWC 3PVBB 1GNZA 4Q4V1 1RTVA 4Q4V2 4JDOA 1EY2A 5A3MA 4JGYB 4AI8A 5GKAC 4LBMA 1TEIA 2AH2A 4OLLA 2ZX4A 2RM23 2PHDA 1HRI1 4HKOA 4AFMA 4BM8A 4CDXB 4IEWA 2EXJA 1Z78A 2E7TA 2PHTA 3KCXA 1ZA4A 2KM2A 3CNAA 5DZGA 3ROUA 2HWB3 3MIEA 5KHJA 3V0BB 4YG0A 3AJYA 4YGBA 1RMU1 2A3XA 2O8OA 4FO9A 4UBGA 3MF6A 1WLWA 5J48A 1RMU2 1RINA 1ZREA 1VBE2 3PJQA 3HWJA 3KT7A 4YZ3A 2F4PA 1FT9A 5E8AA 4XTMA 4BPZA 4XDQA 1PM7A 2P2KA 2D98A 4XJWA 1AF9A 3QLQA 5I0TA 4RHV1 5FQ0A 3POWA 4GWMA 2VOWA 3WP5A 4RHV2 4UW5A 1XE8A 4MGIE 5KC6A 3ZFEC 4PLMA 4DXZA 3C3VA 2O1QA 2W68A 3WR0A 4P9XA 1RL3A 1ZRRA 4B29A 4XBLA 4Y1XA 4CEWA 3A0KA 2B8MA 4AFDA 1HXS2 5AVPA 3ZXJA 3CJIC 5TSWA 2O8QA 1WW4A 3H3ZA 3ZYRA 1HV0A 3CU7A 2PAKA 1W0PA 2GAUA 3LWCA 3QOPA 3SH3A 5J7MA 1VIWB 2X5IA 4AGRA 2UY8A 2BVVA 1DQ1A 1ND3B 3VBFB 5DUWA 4MXWB 1WW7A 3IM0A 4FXKB 1BBT3 1WD4A 3BALA 3USUA 2BWAA 1JOJA 2XWJB 3IPVA 2YZ4A 3USSA 1AYN2 5T54A 3TNQA 5T55A 4LO5B 1CPMA 1RUF2 2PHFA 1NG0A 1UZYA 1AX1A 4AVSA 1V00A 2ZGQA 1SLIA 5C6CA 3FBMA 1LEMA 1S0DA 2P17A 2XBO1 5I93A 1LHNA 2XBO2 4META 3ZXEA 3FLTA 1QDCA 1DFQA 1WD3A 2ET1A 1C8M1 1KS5A 4A3XA 5BNNB 1H8TB 4BH9A 1S0CA 4XMIA 1UPIA 4NWWA 1MACA 2P34A 1YCIA 2V09A 3K51A 4YM0A 2DCTA 2IXJA 5DZEA 1ZM1A 3KSCA 3MLLA 1W6PB 4WVWA 2VVDA 3HBZA 4GULA 1PIV3 3ZFEA 2CTVA 1ND2C 2DTWA 2OVUA 3TWIA 1DQ5A 2Q5TA 5GZCA 1JYIA 4WM8C 1BMV1 1CX4A 3GBFA 4GH4B 2ZGRA 4D7SA 2NZ9A 1RUD1 3KT1A 1B35A 4X8NA 2UURA 4DY5A 1RUD2 1VBC3 4QPIC 1GNHA 4HANA 5ACA3 4ISQA 1W39A 1NCRB 1APNA 4OHVA 4FXGB 1REFA 2VH9A 4XHXA 3UKTA 1EPWA 5FRAA 3EXUA 2I07B 3DPRA 2GN7A 2EAKA 1ASJ3 3MGUA 1DDLA 2HWF1 3IMNA 1K5MC 1WLCA 3HT1A 4P5HA 3D4KA 4P9JA 4PBOA 2ARBA 1RJ8A 1YI7A 2GC3A 3PVNA 4HPKB 1QMJA 4CYDA 4RSUA 5KHKA 2ZGTA 3FMGA 4FP2A 4FPHA 3RS6A 3LZZA 1VB2A 2DVBA 5JAXA 5EZWA 1HX6A 4Q8KA 3GNEA 2R6QA 3J8F3 2JKBA 3UJQA 1S55A 2UWBA 2MPFA 1AR71 5CB7A 1TME2 1VBD2 1AR72 3LB9A 3VBRC 2JG8C 3UJOA 4COVA 4LEJA 1PZ8A 4BHPA 1YRZA 3WHUA 4F83A 4WVZA 3E97A 1WMEA 4CDUB 1VRH1 1I3HA 2YGLA 4JQRA 2CWMA 4BQ1A 3O12A 3I8TA 4NWVA 1DIWA 4Q0UA 2XVLA 1LU1A 1PVC1 2A6YA 4M01A 1QXRA 3TAYA 4CRQA 5BNQA 1DG6A 5JZGC 3WW3A 3JCIA 3B00A 1ND2A 3J4UH 4RD7A 4QQOA 1ZZBA 1KFUL 3LSEA 4Y26A 4WM8A 2IXKA 5A32B 1ULEA 3TBDA 1ULGA 2VXRA 2YMZA 1DGWA 3AYDA 3E5QA 4QPIA 2PHRA 4AQSA 2PLV3 4Y4YA 1MR5A 4SBVA 1I9RA 1YIFA 5IK4A 2WJSA 4H7LA 1HXS3 1RVF1 1Y3TA 5E89A 4QM9A 1IS4A 4A2UA 2GC1A 1CESA 2QUOA 2VOVA 2V5YA 4PDWA 1MS3A 1E57A 1FMD2 2XL7A 4XILA 2VULA 1V6JA 4QMAA 4E4SA 2QCSB 3WDTA 4K9SA 3POYA 4COWA 4WM7C 2ZOEB 5J09A 4Z07A 3INAA 1S0BA 3WV6A 1G7YA 3GBGA 3AJZA 3PMSA 1KD7A 2TEPA 4BMEA 2Y0IA 5BNOC 2NLRA 2WQZC 3ZYJB 1RUG3 4B8EA 3AFGA 4M3CA 2OZJA 5JIUA 5GZDA 4OI1A 4WVMB 2R0FA 1ZBA2 4N53C 1AYN3 4OUSA 3KB5A 3VBUB 1XU1A 4B4QA 4OFGA 3VBRA 4BOWA 1MS8A 4XEZA 2JG8A 3SITA 4XJUA 4M00A 1RUF3 1PGW1 3GBWA 2D3SA 3PTYA 1OLRA 3S7EA 3OBRA 4CDQC 1D4M1 4YW4A 1KJRA 1QU0A 4QPYA 1NQJA 2DUOA 2WQ4A 4TYSA 5FQ0B 3VHOA 4P9GA 5FFOC 4BIOA 4ES8A 4HZFA 4EN9B 1IPKA 2BGCA 4KNCA 2CNAA 4P14A 4D69A 3AXDA 2HWD3 4IL7A 4ISRA 5JZGA 3VKFC 5JDBA 3VHPA 3WOGA 5CU1A 1GZCA 3RYPA 2B9UA 5FMOL 2ZHKA 1DF0A 1JUIA 4Z92B 4YGEA 4HK8A 4I3GA 4GB31 1C5IA 4X6RB 3SH4A 5F5QA 4GB32 1TMF2 4IXLA 1FATA 2I2SA 3JQWA 4DY3A 1UN1A 2FHRA 1R081 1PGL1 4L9BA 3UK9A 1AR92 4I02A 4KQ7A 1VP6A 1FOD1 2X5IB 1G9AA 4YVWB 2BUKA 4NN0A 5DXDA 1UIJA 3CL1A 3USUB 2HWE1 3VUOA 2RS53 2AYHA 2HWE2 4Z2WA 3CJXA 1S2KA 1ND3C 4HLTA 4AEDC 3JBG1 3H0OA 3N7JA 2QKDA 1SBFA 3ILRA 1LEDA 3IN9A 4ITCA 4O9GA 2EVXA 4CDXA 1CAUB 1TME3 1VBD3 2AENA 1Z7S1 2W08A 4K40A 3FLPA 3AX4A 1Z7S2 3KZ4C 5C4WC 4YFZA 3DV8A 3NJZA 5K7PA 1ZX5A 1DGRA 5EV7A 4GA9A 4HETA 2ZHMA 1RUH1 5F9TA 5CBLA 4IEVA 4CDQA 4XHBA 4FTSA 3WLUA 1QXPA 4I09A 4PQ9A 4XBQA 4Q29A 2ARXA 3K48A 1EV13 1XYPA 3QH7A 4QGMA 3ZFEB 1RUI1 1PVXA 3FLRA 1QJY1 2Q1ZB 4Y24A 2DF7A 1G86A 1W6MA 3AZYA 4QT6A 1NLSA 2VVEA 2ZGMA 3URFA 3ZN4A 4AHWA 4GKYA 4IEUA 1FNYA 3CJIB 2UYBA 1GQGA 1LOBA 4H3WA 3SMHA 2A5ZA 2K2SA 1QQP1 3CLPA 1OFNA 4HFSA 1LTEA 4Q27A 5K0UC