3VDDC

Structure of hrv2 capsid complexed with antiviral compound bta798
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
237
structure length
237
Chain Sequence
GLPVFITPGSGQFLTTDDFQSPCALPWYHPTKEISIPGEVKNLVEICQVDSLVPINNTDTYINSENMYSVVLQSSINAPDKIFSIRTDVASQPLATTLIGEISSYFTHWTGSLRFSFMFCGTANTTVKLLLAYTPPGIAEPTTRKDAMLGTHVIWDVGLQSTISMVVPWISASHYRNTSPGRSTSGYITCWYQTRLVIPPQTPPTARLLCFVSGCKDFCLRMARDTNLHLQSGAIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein VP1
publication title An Orally Available 3-Ethoxybenzisoxazole Capsid Binder with Clinical Activity against Human Rhinovirus.
pubmed doi rcsb
molecule tags Virus
total genus 37
structure length 237
sequence length 237
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vddC00
3VDDC 1NCQC 1AR61 1IHMA 1HRV2 1V9U3 2RS31 1TME3 1NA1C 3VBUA 2ZTNA 4CDUC 3VBRC 2BUKA 5C9AB 2R061 1QJX2 5C4WB 4RS5A 4CEYB 1ASJ2 1ND2A 1VBE1 2R071 3NAPB 3VBSA 1TMF2 5ACA1 5A32A 3VBOC 2RR12 2DF7A 2HWD1 5AC93 3JB8A 1ZBA3 1AL22 4Q4W2 4JGZB 4CEYC 3VBUC 1BMV2 1AYN1 1OPOA 1BEV2 1R081 4RS5C 2BBVA 2GH8A 1VBC3 4GH4B 2RM23 2XBO2 1QQP2 1POV1 3VBHB 3DPRA 3S6PA 1X36A 4WM7A 2WFF3 5FMOS 4Z92B 3J8F2 4RHV3 1GFF2 1F8VA 3FBMA 3JD72 1PIV3 2R043 1VBD1 1HQNA 1H8TB 1F2NA 4RR3A 4BCUA 4RFT0 3CJIB 1HXS2 1MEC3 1HRV1 2MEV1 1TME2 1RUG1 1VAKA 1PGW1 1QJU3 1RUI1 5BNNA 1RMU1 5BNOA 4IV1A 5K0UA 1OOPB 4IV3B 1QJX3 4CEWA 1Z7S1 1HRI3 1FPN1 1QJY3 1ASJ1 4RR3C 1VRH1 4AEDC 1TMF3 1PO13 4CDWC 2RR13 2Y26A 4RQPC 1WCDJ 4CDQB 1ZBA2 1B35B 1AR91 4JGYA 4GMP1 3ZFEA 1AL23 1AUYA 3VBFB 3ZFGA 5L7OA 2WLPA 4IV1C 4Q4W1 4Q4X2 1AYM3 1BEV3 1RHI1 2HWF1 3VDDA 2RM22 4YVSB 4QPIB 1FMD1 2HWB1 4WM8C 3ZXAC 1QQP3 1RUC3 3ZFFC 3VBFC 2XPJA 2XBO1 1C8M1 1PO21 1AL0G 2RMU1 1AR82 2PLV1 4JGYC 4NWWA 3ZFEC 3TN91 1R1A2 5L7OC 4QPGC 5C8CB 3VBRA 3J8F3 5CFDB 1VBA1 3JD73 3JBG1 1NY71 3HAGA 1MQTC 5DDJ3 2WZR3 1DDLA 4CDXB 1FOD1 1K5MB 1MEC2 3VBOA 1V9U1 2RS13 4YVWB 1HXS3 1PVC3 5C9AA 1QJU2 5C4WA 4CEYA 1TME1 5FMOL 4N53B 1BBT2 1RUJ3 5BNPB 1VBB2 2ZAHA 1COV2 1X33A 4FTBA 1RUD2 1HRI2 1QJY2 1EAH3 1PO12 2BFUS 5C9AC 1RUF3 5AC91 1VB4A 1ZBA1 5C4WC 2WWSA 1AYM2 4PDWB 4Q4X3 2HWC3 3NAPC 3JB4C 3VBHA 1CJDA 1ZBE3 1RUH2 1VBC1 5JZGB 1RUC2 4GB31 1ND2B 4Q4V3 1POV0 4JGZC 3VBSB 1AR83 1R1A3 1H8TA 2WFF1 4GH4C 4RHV1 1RUE2 1PIV1 2R041 3VBHC 1POV3 5DDJ2 2WZR2 4AEDA 2RS12 1PVC2 4CDWA 4RQPA 1MEC1 4FSJA 2FZ2A 2RS52 2HWE3 1EV12 3DPRB 1QJU1 1RUJ2 1RVF3 4WM7B 1H8TC 1BBT3 4FTEA 5CFCB 1AR62 1AR73 1R093 1VBB3 1D4M3 1NCRB 3CJIC 1COV3 1QJX1 4CDQA 1ND3B 4WM8A 1RUD3 1B35A 1EAH2 3ZFFA 3VBFA 1QJY1 1RUG3 1RUF2 1TMF1 1PO11 2RR11 1PGL2 1OOPC 4QPGA 4IV3C 1AL21 4EJRA 2QQPA 4YVSA 4QPIA 2FZ1A 3LOBA 2HWC2 5BNNB 5BNOB 1BMV1 2R072 1BEV1 1ZBE2 1FPN3 1MQTA 5K0UB 1M06G 4CDQC 2HWD2 1B35C 1RUH3 4SBVA 4Q4V2 2BFUL 1QQP1 5CFDA 1CD3G 1SMVA 1VB2A 4YVSC 4QPIC 2X5IB 4N43B 3J8F1 3ZFGB 5D8AB 1A6CA 5ABJB 4Q4Y3 1RUE3 3JD71 4FTSA 1C8M3 3VDDB 1NCQB 5DDJ1 5A33B 1W39A 2PLV3 4N53A 5C8CC 2RS11 5CFDC 2HWE2 1HXS1 1PVC1 2RS53 1RVF2 1VBD2 2WS93 5D8AC 1EV13 1NA1B 1AR72 1R092 1D4M2 2VQ0A 3NAPA 1AR63 3VBRB 4CDUB 4CDXC 1K5MC 2RS33 4YVWC 1FOD3 2MEV2 1E57A 1RUG2 5LK7B 1NG0A 1PGW2 1RUI2 4JGZA 1EAH1 4N53C 1RMU2 3VBOB 4PDWA 1RUF1 5BNPC 2R063 4LLFA 4GH4A 1PGL1 1Z7S2 5JZGA 3VBUB 1FPN2 2GSYA 1VRH2 1VBE3 2R073 4Q4X1 2HWC1 5ACA3 4RS5B 2HWD3 2RM21 1ZBE1 1AR92 4Q4V1 5A32B 4PDWC 5J98B 1AYN3 1RHI2 1QJZA 1R083 2HWF2 1AR81 1R1A1 1FMD2 5FOJB 2HWB2 5JZGC 4Q4Y2 3CJIA 1ND2C 4GB33 1RB8G 1C8M2 1PO22 1HX6A 3VBSC 2RMU2 2PLV2 3TN92 2ZZQA 1OOPA 1VBA2 2WS92 5CFCA 4IV3A 3JBG2 1NY72 2HWE1 1C8NA 1VBD3 1NCRA 1RVF1 1ND3A 1NOVA 1BBT1 2RS32 1FOD2 1AR71 1R091 1V9U2 1VBB1 1D4M1 5GKAC 2BPA2 1HRV3 1COV1 2MEV3 1RUD1 1HRI1 1OHFA 3IDEA 1RUI3 3DPRC 4AEDB 4RR3B 4WM7C 1RMU3 4CDWB 2R062 4RQPB 5CFCC 4GMP0 1NCRC 1ND3C 1Z7S3 4IV1B 1VBE2 1AYM1 5ACA2 2IZWA 2TBVA 1ASJ3 1VRH3 4CEWB 5AC92 1RUH1 1AR93 4GMP3 5C8CA 1RUC1 4WM8B 2X5IA 1AYN2 3M8LA 4N43A 3ZFFB 1R082 4Q4W3 4NWVA 5D8AA 5J96B 5BNNC 5BNOC 5ABJA 1RHI3 2HWF3 4JGYB 3ZFEB 5K0UC 5L7OB 4QPGB 1FMD3 1VBC2 4CDXA 1K5MA 4Y4YA 2HWB3 1NCQA 5A33A 4GB32 4CEWC 4YVWA 4Q4Y1 1RUE1 2XBO3 1PO23 2RMU3 1MQTB 2WZR1 3TN93 1NA1A 4Y5Z0 2WFF2 2X5IC 5BNPA 4N43C 4RHV2 3ZFGC 1VBA3 4CDUA 5ABJC 3JBG3 2RS51 1PIV2 2R042 2WS91 1EV11 1RUJ1
chains in the Genus database with same CATH superfamily
5FUNA 3N7KA 2A6VA 1GOGA 2RS31 1D2SA 3RG0A 4XF9A 4P9GA 1XRUA 4LIVA 3ZO0B 5HXMA 2Y60A 2ZHMA 3WNKA 2XKPA 3KGZA 3UJQA 1W6QA 5IFTA 4FOVA 3AM2A 4ASKA 3ZXFA 2RVAA 4YG0A 1NA1C 3AYDA 2HEVF 1S1AA 3VBUA 2WNVA 3ETPA 3LAGA 1WBLA 5C4WB 1XE0A 4H7MA 4XBQA 4E8CA 1QU0A 3I2GA 1ND2A 2GDFA 1I9RA 1JOJA 2DBNA 2JDNA 3CDZB 3H42B 1UY3A 5HCFA 3PMEA 1ST8A 1RJ8A 1TMF2 1XE8A 2YGLA 2QJVA 2YU1A 4Q0VA 4Y5TA 4ZS3A 5FREA 3VBOC 2OX0A 2HWD1 1DP0A 2D7FA 4GIQA 4YW2A 1TNRA 3IDCB 2RDQA 3JB8A 3OSDA 3UGHA 3ZPOA 3H8OA 1EY2A 2DVGA 4R8HA 3LSDA 1D7PM 2LTNA 4XBNA 1W8WA 2WO2A 4AFDA 2VQAA 1ULEA 3UNPA 3KLSA 2NQYA 3FLTA 1GOFA 1OH3A 2VOKA 1AYN1 1OPOA 2VC9A 1R081 1X9PA 3LKJA 3BU7A 2OQ7A 4S2GA 4XUQA 4IEYA 3THCA 2VZQA 3N9MA 4RS5C 1PGSA 2W3JA 1POQA 2E26A 2Q8EA 3WCSA 5C5UA 1RTVA 3AX4A 2RM23 4HL0A 5CB7A 2D6MA 1U5IA 2B45X 4L0PA 3EO6A 1BQPA 4G4FA 5FKBA 2PQQA 5A80A 3S6PA 2XLGA 3ILRA 4CVUA 1U5YA 3D8CA 4TXWA 1QHDA 1JH5A 1W03A 2VL4A 4L8QA 3J8F2 5FMOS 1GFF2 1KJLA 1IG0A 1OA3A 4QX3A 5F3CA 4K1ZA 5GALA 2IUWA 2HEWF 1PIV3 3JD72 2R043 3MPBA 1UKRA 1VBD1 1WCKA 3R0RA 5DZEA 1W8HA 4YW5A 2PA7A 1HQNA 5JI9A 4P00B 1K42A 1H8TB 2ZA9A 2KA3A 2QKDA 1Y3TA 4LBMA 5F2SA 3AP7A 4NUBA 2BVVA 4RR3A 3CJXA 4M3CF 4BCUA 4EYUA 1Q8QA 3HN3A 4LK6A 3CJIB 4O65A 2P3KA 1HXS2 4PQQA 4AAPA 4AW7A 5KWRA 2ZXQA 4B4RA 2CV6A 2VCMA 4XTPA 5A7QA 4DZGA 2D93A 3IAQA 1J84A 3BTZA 1X82A 2C4XA 4XIKA 1GZ9A 5C5TA 3T4VA 2A7AA 4FXGB 2VQTA 4OHXA 4YGEA 3I54A 1VAVA 1OUSA 3LDKA 4I0WB 1RGSA 3A0NA 3KV4A 4IV3B 5E1RA 2BVBA 3M4FA 3KWVA 3RJRA 4CEWA 4X6RB 1DQ5A 1J3RA 3WHTA 1HRI3 4FPOB 1LOBA 1ASJ1 1OUXA 3KD4A 4CUBA 2X10A 1YI9A 1TMF3 2B4KA 1WW5A 1H1AA 4OUSA 2Y26A 4CDWC 3I49A 1ZBA2 2GMEA 3J4UH 1B35B 2GN7A 4QAWA 2ATFA 1AR91 4Q8KA 4W50A 3GZEA 2JD4A 3FZ3A 2LALA 2ZEXA 3JQXA 3VBFB 1IZ3A 2WLPA 5FY1A 5G05L 3DN7A 4QD2A 3FE5A 4FPGA 4IV1C 4Q4W1 4Q4X2 1RHI1 2ADDA 3VDDA 4B1LA 2A1XA 2HWB1 3MF9A 1U12A 1ZRIA 2ZGSA 4DB5A 1JUHA 2BU9A 2CWMA 3N3HA 4LKSA 1V6NA 5K9YA 4NRPA 4OFGA 3ZFFC 3A22A 2XBO1 1PO21 4LORA 1GR3A 2K46A 5LB6A 1WMXA 1AR82 2P17A 3EHKA 3WDXA 1GBGA 4E9KA 5C8CB 4CXYA 1VALA 3J8F3 4GWNA 4OUMA 1VBA1 3PMSA 2D98A 4ISQA 3U14A 1BK1A 4NHXA 3WXPA 3JD73 4ISRA 1NY71 4NIAA 3M1HA 4WBBA 4LBNA 2EA7A 5CISA 1DGWX 3VZJA 4Y4RA 3DF0A 1MQTC 1UPSA 2VUJA 3SITA 1CR7A 2ZZJA 4LHLA 4UW3A 1FOD1 4WZCA 1O3TA 1OH4A 3EJKA 4BQ5A 3IBMA 1HXS3 1NQJA 5FZ6A 5C9AA 5E16A 4UF0A 1QJU2 2RJLA 1W3XA 3D0SA 4GZ9A 5GLUA 3SKJE 4CEYA 3WQ0A 5J3UA 2W0XA 3S0MA 2V72A 5LK5A 1UCXA 3AC0A 5FKCA 4AVSA 1LGCA 4FPEA 3ATGA 4N9IA 2Y6KA 5I93A 1VBB2 1MR5A 4MXWA 3O1TA 3HQUA 4TWTA 1COV2 4WVZA 2V09A 1K3IA 2UYBA 5T5OA 3MW4A 4WVWA 3T2QA 2OQ6A 4GWIA 1KS5A 3GNEA 1PZ7A 4IL7A 1XNBA 1JZ8A 4B29A 4N7UA 1RUF3 5T52A 4IEWA 4AOCA 1CAWA 1BZWA 3ETQA 2OKXA 5FY0A 5LA9A 3MO4A 2B9UA 1QNWA 3CHXA 3ROUA 3GZAA 4Q4X3 1G9DA 1CX1A 3SH5A 3VBHA 1CJPA 2BNMA 3U10A 1RUH2 3ZN6A 5JZGB 3B01A 2QCSB 3I59A 4Y1UA 4UW5A 3IM0A 4YGBA 3RS6A 2FDKA 1AX2A 1SLTA 4Q4V3 5FXVA 1POV0 3S57A 5FR3A 4O7XA 2XHKA 1ZRDA 3H0OA 4IERA 3MEPA 3T0BA 2ERFA 4B8EA 3VBSB 3TNPB 4D0QA 1YIFA 1AR83 4GD4A 4LNVA 3O0WA 4XVHA 4ZHNA 3VL8A 1JZ3A 1QJEA 3Q8FA 3HOBA 4OZXA 4XQ4A 1LTEA 2UWAA 3H8RA 4A7KA 5IFPA 5FUIA 4IEQA 2GP5A 3T30A 4FFFA 2BWAA 1RUE2 3LGRA 1PIV1 4JRAA 2R041 3X29B 2P3YA 2YU2A 2YZ4A 4P9IA 1UZZA 2AEYA 1OD5A 1CIWA 2ZGQA 1O6UA 5FY8A 3AMMA 4JZRA 1A3KA 3E5UA 4AI1A 1CVNA 2RS12 3IDAA 4FBFA 5CEHA 5IK7A 2ZEZA 3WR0A 4OULA 4N7IA 2XQRA 4FSJA 4GULA 2PXJA 2HWE3 1N1TA 1LODA 5FRAA 3O14A 1RUJ2 2OS2A 2C26A 4NHYA 3CNAA 3SEEA 1GP5A 1ULGA 2IFRA 2JDPA 2VAUA 4V1PA 4UI9L 1OFNA 4AYUA 1XOYA 1NYWA 5EWSA 3APBA 4CCCA 1VBB3 4FFGA 4PF5A 1NCRB 5EQUA 3T2OA 3WW4A 1COV3 4OMDA 4FPFA 2VOVA 4WM8A 4YG3A 5JXJA 1FATA 5JPMB 5FZAA 4YWAA 1HN1A 4PI0A 2XLFA 5A7WB 4JKKA 4MGKE 2P37A 4TLGA 2XJSA 4YPJA 2VUDA 1CAXA 1WLCA 1TMF1 5FPLA 3I3BA 5FYCA 1N1VA 2W1SA 1JXNA 1UY2A 1YQ8A 1OOPC 2P34A 2VJXA 2WWUA 2YC4A 4KWKA 3WF2A 4QQPA 1EUTA 5FIXA 1BVVA 5EIYB 2VBPA 3TBDA 1UYPA 5A3TA 2E31A 5BNNB 5BNOB 4W65A 2VOWA 5K0UB 3WNXA 2DTYA 4YZ4A 2DUPA 1RUH3 2BGOA 2VUAA 4E2QA 3IWZA 3FX3A 4OYUA 3LEIA 2BFUL 2J1EA 3ASIA 5ANNA 5DAXA 3T1LA 5I0DA 1QF3A 4DUXA 1JU4A 4CP9B 3OBRA 5DXDA 1JHJA 4MGTA 3OGRA 1CD3G 2ZGOA 3I3EA 1SMVA 4NIIA 2D6OX 1H4HA 3K3NA 1PMHX 1VB2A 4AI2A 4YVSC 4QPIC 5FYVA 5HV0A 3C7FA 1FNZA 2GMPA 3J8F1 3ZFGB 1GU3A 2DUOA 1DLLA 1RUE3 3JD71 2F17A 5FMCA 4DINB 3KB5A 4OUEA 3H1WA 5DG1A 3WUCA 4IEVA 1PNGA 4PBPA 4DEQA 3RYRA 1C8M3 4NN0A 1G6NA 3V0BA 2YG0A 3FJSA 5KHGA 1OI6A 2PLV3 2W2IA 4XILA 5LA0A 1BYHA 5FZHA 4XMAA 1HXS1 4XTMA 1UU4A 2QZ3A 1DQ6A 2W91A 3D3AA 3FBYA 5F3GA 5JI7A 5IVFA 1F15A 1H9PA 1UOGA 1A8MA 1LOGA 1FV3A 1NA1B 2B8MA 5KR7A 5FYBA 2W46A 3MFCA 3L9JT 4NJ4A 5FXWA 5AFBA 1R092 5FYUA 1GNZA 1NE6A 2ADEA 3RZKA 1XSQA 2H6CA 3AP5A 3FMGA 3FUQA 3FLRA 4CCDA 1NLRA 2BTVC 2ZGTA 4XC9A 2VNRA 1RUI2 2UU8A 3KCYA 1GWKA 5DZGA 1WWYA 1RMU2 4N53C 3VBOB 5HV4A 4XJ9A 4A7YA 1REDA 1RUF1 3UYJA 2VQUA 1LGNA 3SH3A 1XNTA 3QACA 4GH4A 3T08A 2JD9A 4XIOA 3K4ZA 5JIAA 1IGOA 1U5XA 1W8UA 1Z7S2 3AYCA 1GOHA 1PK6A 3BTYA 1VRH2 2JB8A 1OFSA 1UX7A 4Q4X1 3PVOA 5I8TA 3QOPA 4RS5B 3POBA 4LHNA 3VD5A 1UW8A 5LATA 2O1QA 4M0NA 4LLOA 1XPWA 1LKNA 4E4SA 3CBNA 3L2YA 5BNQA 1K12A 1G9AA 4Q4V1 5B2GB 4XFGA 4YFWA 3O1PA 5GLWA 5KXEA 5A7SA 5CIRA 2XJVA 3POFA 4QX0A 5J98B 2IC1A 1QJZA 2EAKA 4P9YA 1QXJA 1AR81 2XONA 3J7NA 2WNVC 5AVAA 2NMNA 3F95A 3WLUA 5GZEA 3PJYA 2BV4A 1IQAA 5FOJB 5F5CA 2VTXA 1IG3A 3NQHA 4AEJA 3KT7A 1ND2C 4QM8A 5T5LA 1QIQA 3D4KA 2VECA 2VBDA 3RSJA 1B09A 2RJ2A 5H9PA 3VHNA 3C7EA 1O4YA 4RA0A 1W6NB 4XJWA 5FZOB 3MICA 2V73A 3GDBA 1R1ZA 3UJOA 2B9VA 3MF6A 1S55A 4BDVB 4QB6A 2HWE1 4NVPA 1G9BA 2P5BA 3WF3A 3KHCA 3VLBB 2HBUA 5ANQA 2VZUA 2XR4A 2RS32 2WJSA 3M3CA 5J48A 3MIEA 3AZXA 4LK7A 5BV6A 5F5IA 1CONA 1DYPA 1VBB1 1X8EA 1DBNA 3S5QA 3S5AA 1COV1 2JG8A 3LFIA 3OF1A 3ZX7A 2R6QA 4FAHA 3PJQA 2XL7A 4G3YC 1RUI3 3NJXA 3TAYA 2FDHA 3VHPA 2WSUA 1RMU3 3HPNA 4YW1A 4LHSA 3POJA 1ACCA 4W6YA 4XF3A 4XJZA 4CDWB 1N3OA 5CFCC 5FO9B 5IVBA 1V00A 2KR2A 1OT5A 2JX9A 3WX5A 4YM0A 2UYAA 3KV6A 2VVFA 1W0OA 3PLQA 1Z7S3 3BN6A 2BERA 4IV1B 2BJSA 2H6BA 5SV8A 4AXOA 5LW9A 2TBVA 1VRH3 3AKQA 3LIHA 4XYXA 2QNKA 5DABA 1UYXA 4I30A 1HQWA 3WDYA 2UY9A 2ZS6B 4KMQA 1RUH1 2ZPXA 5H9QA 4XJAA 1KRIA 3DXUA 2FQPA 3OUIA 4XQDA 2EALA 3GBGA 4DEVA 2ZX1A 3BGAA 2Q4SA 1OVSA 1NKGA 1AYN2 4N43A 3ZFFB 4QXHA 1R082 4Y26A 3TEWA 5L9BA 2O8QA 1N47A 4OVEA 2WAAA 2GN3A 4LQRA 3I4IA 5F5QA 4BQXA 3W58A 4OI0A 4BH9A 1LRHA 2PYTA 5A6XA 1OMIA 2GH2A 3HT1A 4Y4YA 4QX7A 5EJ3A 4GB32 1T6GC 4CEWC 4S2HA 4YVWA 1JW6A 4UT5A 1HB3A 1RUE1 4FP3A 3R05A 5FJKA 2WBKA 1S2BA 1SCSA 1MQTB 3I2FA 1SDWA 4XCBA 5DMYA 1W3VA 1QXRA 3KCCA 5IAXA 1OA2A 4FPYA 1XU2A 2WFF2 4D7SA 3EXUA 5BNPA 3RZLA 2E6VA 2EIDA 2JG9A 3H3LA 4Y20A 4C1XA 4G9SB 5ABJC 1XB9A 2JDMA 4M3CA 4PIXA 1JS9A 2QQMA 3CQOA 2W47A 3PIGA 1AXYA 4URTA 1RUJ1 2E7QA 4DXRA 3WP5A 3VDDC 1NCQC 3UV9A 1G9FA 3B00A 3RYKA 3OPZA 2OT7A 4Q29A 3OY8B 4Y22A 5FMBA 2GC1A 3WY6A 2OUJA 2D3PA 2BYVE 4RYDA 4META 3DCQA 4L2NA 3C8XA 3H1MA 2V5DA 1J3PA 4YW3A 3R4DB 1PX4A 3RMYA 3AXDA 4IEZA 1H6YA 1ZZ8A 2BUKA 5LASA 3OCPA 3H7YA 1OF3A 5FY9A 2N7GA 3HNYM 2GNDA 5FWJA 2XWJB 4GQ7A 1ASJ2 3FHIB 4LTAA 4J6GA 4P9JA 3AB0A 1UY4A 2DVDA 4QT6A 3N7MA 2ZMNA 4ZKTB 2DCZA 4D69A 5K7PA 4R9CA 5DG2A 5A32A 3D0JA 3NNFA 1UMHA 3ZXDA 2DF7A 3MHZA 4LE3A 1ENXA 1GP4A 5F5AA 1WZXA 3RGBA 2JDYA 1DHKB 4Q4W2 3AXEA 4CEYC 1FYUA 1BMV2 1XNDA 3BYWA 2GNMA 4FO9A 1HLCA 1QWRA 1OQEA 1JYVA 4M0HA 2BBVA 4AQ6A 4GJZA 1XSRA 1ONAA 2UWBA 3HNBM 2WNOA 1O5UA 4D6SA 2GMMA 1JYTA 2XBO2 4AHXA 1POV1 4YW4A 2VNGA 2AH2A 4K3UA 4MHUA 4P9LA 2P3JA 4WM7A 2EXHA 1WUVA 5LBFA 1JOBA 1W2UA 3P3NA 4X6QB 2KXLA 3RZMA 3SKVA 2WFF3 2BQPA 1HIXA 4BXFA 3ZLIA 1YC61 1F8VA 3FBMA 1IQDC 3OPWA 3ACGA 2RJKA 4LPLA 1EPZA 4MZUA 1F4AA 1SBFA 3KT4A 1OPMA 4W6XA 3UT0A 3H1YA 5A1LA 2WLQA 4QX1A 2ZX2A 5FBJA 4QGMA 4RFT0 2PHRA 3LFMA 3WNOA 4EWEA 1MEC3 3ZSMA 4Q0PA 4LO5B 3DECA 2VTFA 2WZPP 1UZ0A 1V6LA 5F3EA 2Q0AA 3OBTA 1RUI1 3T4HB 3EQEA 1CAUA 4AGVA 5KC5A 1RMU1 4COZA 4QWNA 1MZFA 1QJFA 1DF0A 3MPPG 3NSTA 3POIA 1OOPB 4S2FA 3WP3A 4KBBA 1YLLA 1LHVA 1WW7A 2E51A 4MLOA 2GNTA 1SLBA 4ZONA 2J22A 3ENRA 1ODMA 3EB7A 1W0NA 1Z7S1 5IWFA 5CVRA 5L73A 4BU2A 1FX5A 4E2SA 2QQLA 4EN6B 2FDGA 1CIYA 1VRH1 1WKYA 2CAUA 2XQXA 2F6BA 1WMFA 1S0IA 1PO13 3A4UA 1IS6A 1WLTA 4IE5A 1WCDJ 3AP9A 3ST7A 4YARA 5LY1A 4D3WA 2WFPA 3D6EA 4JGYA 1LU2A 1H6XA 1EUUA 1ZX5A 1YQ2A 2LROA 2P4EA 2YHJA 5HCAA 5A3LA 2AREA 4YG6A 2D3RA 1QNYA 4DXZA 2Y34A 3ZM8A 2XHNA 3PU3A 2YC2A 2CHHA 4UFKA 2ZEWA 2BWCA 3VDBA 4XFAA 1I5PA 2IXLA 3CL1A 2HJIA 5EYYA 5D1IA 1CAVA 2RM22 4XFIA 4AGGA 4YVSB 4QPIB 3FUOA 2VCAA 1URXA 3WW3A 3GZUC 4WM8C 1NXD1 4R9DA 1QKQA 4QX8A 3ZXAC 4BLIA 5C3RA 1LAJA 1RUC3 4XBLA 3VL9A 5EHDA 4HZFA 1WLWA 1DZTA 2VG9A 3H8XA 2A75A 2WN2A 4M00A 3JZVA 5KBFA 4ZPIA 2ZGRA 2HKXA 3ZFEC 4XF1A 2AC1A 4QHBA 1R1A2 4AFBA 4CXWA 1ALYA 1R64A 5L7OC 3B93A 3KS7A 1W9TA 4JQTA 5I0SA 1EYBA 4RD7A 4XJUA 5CKQA 2WR9A 3IPVA 4JHTA 2W87A 3RI8A 1YO8A 4QXCA 2R1DA 1E5HA 4RL7A 4AR2A 2Y6GA 1DDLA 3ZXKA 3B9CA 4GXLA 4DRRA 3ZR6A 1S0DA 3AKSA 5J09A 3ZYBA 4QKBA 1DGWA 3S7EA 1V6JA 3QCWA 5APAA 2PN5A 4UFMA 5K4LA 3O1RA 2GP3A 1W90A 3RYPA 3KHBA 5C4WA 2VXJA 5I8SA 3T0DA 2A6ZA 4N53B 4XDPA 3CF6E 2K0GA 3PUQA 4XQWA 3SQOA 4COUA 2QQVA 3NNLA 2ZHNA 5E6HA 1C5IA 1KGYA 1XXNA 4YNIA 5IUQA 1X33A 5H9SA 1GQHA 1J1TA 3RZJA 2D44A 1RUD2 1RINA 1HRI2 4BQ4A 2E63A 2XL9A 4Y1VA 4BPZA 1I1EA 1C3HA 4E8DA 1YIPA 4EN0A 4YGDA 1QOOA 1TVGA 2BFUS 3AL6A 3CU7A 3NJZA 3NRUA 4XPVA 4Y1XA 3ZXGA 4COVA 5IVJA 5FZDA 2EICA 2C0ZA 4YGCA 2MNGA 2WC2A 4OI4A 5JSOA 1C5HA 1SCRA 3B02A 5L9VA 2WWSA 3BPZA 1XE7A 3ZKUA 5A7PA 3WOGA 4KBZA 4MSVA 4LO7A 4PI2A 5IVCA 1BCXA 3IZOA 2HWC3 2VE1A 5AVPA 5EPAA 2WNVB 1CJDA 4J1WA 2VO5A 1ZBE3 2X05A 4ATEA 4H7LA 4QU2A 5A7NA 1IS5A 1AX0A 4GB31 1JOPA 4B1MA 4XFHA 1ND2B 1XC6A 2VCBA 3SLIA 2CL2A 4KH9A 4BYYA 2W1QA 1DU3D 2XG3A 4QHZA 2XH6A 3VDCA 5A3PA 3GCXA 4IW3A 1LOAA 5E8AA 3O1VA 4RGAA 1O7FA 2J1TA 1R1A3 5F1RA 3U07A 3ABZA 1H8TA 2WFF1 4GH4C 4MUVA 3Q8CA 2ZKNA 3ZMNA 3QLQA 3LPFA 2O14A 2OYZA 1CX4A 1PK6C 2IFWA 5BY5A 4NPMA 5FOBB 2NP0A 3BKZA 2BGPA 2VOXA 2YV8A 3AVSA 3CZJA 4K9SA 4R4XA 2HEYF 4WVMB 4I0BA 4RQPA 4BQ1A 5C70A 1KITA 1MEC1 3WDWA 3KT1A 3ZXEA 3A21A 1FI2A 3H3UA 3U1XA 3MI8A 2AYHA 4DIQA 4NIDA 3BB6A 1XQNA 4KG8A 3ZDSA 2ZHLA 4FPCA 4HSLA 3LA2A 3CMGA 5CFCB 2VMIA 4JC1A 4OQ9A 3WW1A 4YZ5A 2PFWA 5EJ1B 2W52A 3BTXA 5BYNA 1HQLA 4KGQA 1W2NA 2ZCWA 1C1FA 3BOPA 1DFQA 4A6SA 1RUD3 2JDKA 4BQWA 1B35A 5GZCA 1D0HA 1OC1A 2XXZA 2XJPA 3ZXLA 4K6BA 2XUMA 2I45A 3LCPA 5A1AA 5KXBA 3VBFA 4XUNA 1RUG3 1QDCA 2QQOA 1AF9A 1RUF2 2CDPA 1SLIA 1JYIA 1PO11 4Y24A 3M3IA 2DFCA 2MPFA 4JTNA 4EJRA 2AUYA 2JDHA 4ET7A 3ZOIA 4ARYA 3BODA 2VZRA 5GLZA 1TG7A 2FDJA 3IB3A 1O8SA 1BMV1 3PNAA 4M4PA 1FPN3 1DGRN 4UBGA 3WF4A 1M06G 4ASMB 4CDQC 4HT1T 2DVBA 2JG8C 2ARBA 2YFZA 3LEKA 4Q4V2 1VPHA 4SBVA 5FO8B 1VLNA 1YQ5A 2DU0A 3B7MA 4CSWA 3ZIWA 1GMMA 4YZ3A 2P3IA 3KSCA 2VY0A 3SC7X 4KGGA 3THPA 1WLDA 4XABA 4XAEA 5C3OA 5FDBA 2VZVA 2YYOA 1LHOA 4HN0A 1DQ2A 3S30A 2CY6A 1UXXX 3AJZA 1C4RA 2W5FA 3I2HA 4LEJA 1ZNPA 4QKFA 5JMCA 2ZX0A 3ME2A 1KDKA 3ITQA 2Z42A 5D8AB 3P3PA 4IEXA 4AL9A 5ABJB 1UZWA 5FQ0B 3WEZA 4FTSA 3VHOA 1G86A 1Y43B 2JDAA 3AMQA 4NO4A 3OEAA 1W6PB 4Q0QA 1NCQB 4MX3A 3VDDB 2JXAA 1JYWA 3N9NA 3R4SA 5CAZA 1GSLA 4UWDA 2BDRA 5CFDC 2HWE2 2AEZA 1MVQA 2ZEYA 2YBPA 1BLZA 2C9AA 3ZVXA 3GALA 2WS93 3NV1A 1UXZA 3WSOA 1H9WA 2R32A 1OLQA 2Q8DA 4MGYE 1ULCA 3DKQA 4FOQA 3NKTA 3NAPA 4GALA 4AVBA 3T2PA 3I2IA 2PHFA 4CP0A 1UU5A 4KNCA 4YVWC 4HK9A 3LEGA 2RDSA 3DL3A 1MS3A 4NAMA 1FNYA 5LK7B 5LEJA 4LBQD 4YM3A 3GF6A 2JE7A 4JGZA 4AF9A 5FPUA 5JCTA 4AZZA 1X9TA 3U4SA 1PHMA 1Q8SA 5BNPC 5CA6A 2JG9C 4WVVA 5JXGA 3OGGA 4BISA 1V6KA 4LLFA 4UF0B 1JYCA 2YROA 1JZ5A 1BVP1 1W2AX 1SEFA 3MV11 4I02A 5JZGA 4MVTA 4K1YA 3LDRA 1MS9A 5ISLA 2HWC1 3K3OA 3QH7A 5ACA3 5JUVA 5FZKA 3WG3A 1YYNA 3VD4A 2RM21 1ZBE1 5KXCA 4C0BA 2DUQA 2IXJA 2PTMA 3W21A 4FPHA 1NQDA 2HBTA 4PDWC 4LUKA 5FXZA 2HWF2 1CGPA 1YFYA 3KVAA 3MIGA 5FZIA 3UGFA 4FXKB 4BK4A 2TEPA 3Q8AA 1R1A1 3W20A 5AFEA 4RGGA 1SG3A 3GHNA 5A3OA 5A3NA 5F37A 1CAWB 4Q0SA 3E6CC 1WMEA 1YHFA 3D82A 3TEXA 4XXAA 1WW6A 3FFQA 3N9PA 3O1UA 4OHYA 2VNVA 1D0GA 4MH0E 3RZGA 1RB8G 1O4TA 3O12A 1C8M2 3HD8B 3HIFA 1HX6A 4OCTA 3M7AA 4E4DX 2PLV2 2Y6HA 2IXKA 4P9WA 2QUOA 3TN92 1MZ6A 2BGCA 3ZN6B 3R4UA 1O3SA 2E33A 3U75A 1QXPA 3ZSKA 1OURA 2AZ5A 5A3WA 3JBG2 4IE7A 1NCRA 1PM4A 2ZGPA 5C33A 4B7KA 2O8OA 3AZZA 3GHMA 4HFSA 4Z2AA 3WDTA 3EYPA 2DU1A 3NL1A 2OA2A 1DQ4A 1HRV3 1YQCA 5F39A 4FAGA 1RUD1 1HN0A 1HRI1 3MGUA 1OHFA 4GKXA 1V6MA 5FZ1A 1H30A 2TUNA 3AVRA 4WM7C 3Q8EA 3IMNA 4XUOA 3U78A 5C7GA 4EE2A 4CU7A 3B5LB 4C91A 5BPXA 2ZAAA 2LW8A 3POYA 5A6ZA 3J7LA 3T09A 1YCIA 1ND3C 5DUVA 5IT6A 2DCKA 2D5HA 4A2UA 4M01A 4E2GA 2E9QA 4JAAA 1RUOA 1Y9MA 5F6KA 4JHZA 2FD8A 4CP9A 4NR1A 1UIJA 2DDUA 2VM9A 4NIHA 4BA6A 1UPIA 4OMCA 4XZPA 4YM2A 4WM8B 5KHHA 2PHLA 2QDRA 4J1XA 4XHXA 4BLJA 1LGBA 1CAXB 5IW0A 4AHYA 3TRSB 4PHZA 5FYMA 2XLAA 3FHQA 2HWF3 1W9FA 4A3ZA 1JN2P 2CGNA 1FAYA 3ZFEB 3HN1A 1BK0A 1ZZBA 1C28A 5L7OB 4CDXA 1K5MA 2W1WA 3OTFA 4XMIA 2WSVA 1UZYA 3P6BA 1MZEA 5FP9A 4YLZA 2ETEA 3BIWE 1NE4A 3AZWA 2E32A 3PVEA 3U37A 3I7DA 2VMDA 5JR2A 4BQYA 1YFUA 2HYXA 4HVQA 3TN93 1NA1A 1Q56A 1M4WA 2X5IC 3K75B 4RHV2 2EXJA 1W9YA 1VAMA 3WINE 2A71A 5FZ4A 3JBG3 2ZX4A 3HR9A 1I6XA 5A6QA 1N1SA 2WS91 4BMEA 1YRZA 5J7MA 3WDVA 3H9AA 2OPWA 1W6OB 3P5BA 2OPKA 1F35A 1IHMA 4TZDA 4NHMA 3POEA 3ZYPA 1U5ZA 4W8JA 1BJQA 2YUEA 4W6WA 3L2HA 2FBEA 2V4AA 3IKWA 2GALA 1UOBA 3LZZA 2DVAA 1W6MA 4HBNA 3ZYIB 3PVNA 1TME3 1W9SA 2D97A 5T54A 1L3JA 1AXKA 3V0BB 2QQJA 4QGNA 1ZA7A 4CDUC 4ORFA 2WQZC 5FK8A 1GUIA 4Y1YA 1QJX2 2QQNA 2A6YA 1SFPA 2RG4A 4RS5A 5A1FA 5IHRA 4KU8A 5DUXA 3VD9A 2VMGA 2NMOA 1F4HA 2H0VA 2X29A 3KMHA 4XEZA 2Y6LA 3OGJA 3POWA 3OG2A 3S7IA 5DAVA 2D5FA 1Y7BA 5FZ7A 3NW4A 5ACA1 4K7JA 5FZLA 3IDBB 1WD4A 4BWOA 5E88A 1L7LA 4CUCA 3KQRA 2QTWB 3W59A 4JTOA 4KL1A 1JZ6A 3VBUC 1PVXA 4ES8A 1UO9A 4LBQA 1JYNA 5FYIA 1OF4A 4MOAA 5CYYA 3HVDA 1VMJA 1S0EA 2YY1A 4LA2A 5EV7A 2QVSB 5LA2A 4Q26A 4AWDA 4EN8B 3WQ1A 1Q5OA 1UY1A 3K2OA 4GH4B 1SDDB 3H8UA 4AHWA 2FHRA 5FPZA 3OD0A 5GLVA 4ONUA 3OPTA 4PQ9A 4R52A 1PK6B 2HLEA 4IUGA 5A70A 4M3CE 3DPRA 3PTYA 1EPWA 1X36A 3UGGA 2Q8CA 3AP4A 1K45A 5H9RA 4LO6B 5L36A 1H2MA 3ZN5A 4RHV3 5JOZA 2B5HA 4CTEA 4P02B 3CLPA 3M3OA 2ZMLA 2WABA 1JBCA 5FZEA 3PDQA 4AI8A 1UMZA 1NT0A 3PL0A 2BNOA 4AEMA 4AI9A 4LULA 1WA4A 4PT6A 1ZYBA 4U36A 1YXWA 1HRV1 1LOFA 4BQ3A 2FDIA 2TNFA 5CNAA 3LA7A 1W99A 3DXTA 3RNSA 4QDQA 3UKTA 1S0FA 1IPSA 4AI0A 4IV1A 1TQ5A 2Y33A 3VZOA 1LECA 4MV2A 4S2DA 3BU0A 1HB1A 3J7MA 1QJX3 1RXGA 2VVDA 3ECQA 4QU1A 4TTGA 3MW2A 4KI5M 3USUB 5C3PA 3RQ0A 3AP6A 3I2DA 3TNQA 1QJY3 4F3JA 4RR3C 1UY0A 4E4HA 3SEPA 3C3VA 2J7MA 2Q1FA 1UZVA 4M4RA 4IETA 5A7OA 4RQPC 2Q8OA 4CDQB 5HPOA 2ES3A 1MZ5A 2JB4A 3B9IA 3KCXA 2JG8B 1Q8PA 4NPLA 1J1LA 1GKBA 1XYNA 3WF1A 3VKLA 1JZ4A 1LOCA 3BUCA 2XB6C 2WT1A 1OBNA 1XNAA 1ZZCA 2CTVA 2K9ZA 1AYM3 3A23A 3HJRA 2HWF1 3O0XA 2WKKA 3V65A 2ZJCA 4YW7A 4DUWA 1KJRA 4IXLA 4U2AA 2B42B 2XMLA 3IAPA 4LO4B 1QH6A 2VD7A 2CSGA 2Y38A 4XCAA 4B7EA 4TN7A 2Z2SB 3VBFC 2WUHA 4PF1A 1PZ8A 1C8M1 1HW5A 3UKVA 3ELNA 1SPPB 1E5RA 4PLNA 2PLV1 3POGA 1RJ7A 1SFNA 4LOSA 3WV6A 3TN91 1OLMA 3AK0A 5JXIA 1W9WA 2ZHKA 3RI9A 3VBRA 4EN7B 4DS0A 1PMIA 2JICA 3C7HA 4TYSA 1VMHA 4OHVA 5CFDB 2XJUA 3J26N 4H55A 3MZHA 2WNUA 2BBAA 1MACA 3JBG1 4XF4A 4OI1A 1IS3A 4E4ZA 2IXHA 4FFIA 4QGLA 2VPVA 4JRLA 1WD3A 1DQ0A 1PX3A 2O0OA 1HV1A 2E7TA 1UIKA 5DDJ3 3VGIA 2WZR3 3ZKYA 3IMMA 3ZYFA 3ZYGA 5CBLA 1MEC2 4JDNA 5F2WA 2ZGNA 2P6CA 2PHWA 4YVWB 1Z0HA 1PVC3 2CNAA 4IGOA 3BTAA 4AI3A 3MV01 3V64A 5K8SA 3VKNA 4MGZE 4R4ZA 3OEBA 3SISA 3PU8A 4HK8A 4JCKA 4ES9A 1TME1 4EQVA 3C7GA 1BBT2 2ORXA 4OZOA 4CCJA 2I2SA 1NZIA 5BNPB 1QOTA 2JG9B 4FPJA 4LITA 4AVVA 1WMDA 2XVKA 4FTBA 2WO7A 4XETA 3RJ2X 1LEMA 2EIGA 3MLJA 4D6RA 4D7YA 3BOWA 2QE3A 5KXDA 1O59A 1QGLA 1EAH3 1PO12 5D2AA 3MLKA 5FYSA 1H2LA 3RZZA 4LT5A 2Z4FA 1KS4A 5C9AC 1KDMA 2IXCA 4Y22B 3AKTA 5T3NA 4KG0A 4EROA 1VE0A 5HCHA 5I0TA 4BXSV 3BALA 1UU6A 4LA3A 4PDWB 4UFLA 3MDPA 3NAPC 4QB2A 4W4ZA 2QQWA 4P5HA 5FP7A 2JKXA 3DYOA 1RUC2 3SCGA 4O61A 2XVGA 2GC0A 3OBZA 3UK9A 4JGZC 4YRDA 3BVCA 3VKMA 5CKMA 2FCTA 2DFBA 4K40A 5CADA 2W08A 4D7TA 3THDA 3MUY1 3N9OA 4RHV1 3URFA 1MPXA 1US2A 1NZCA 4GAZA 5A6YA 4QPWA 3WNPA 3VZLA 3WDUA 2PHTA 1BHGA 3VBHC 3JU9A 1PMJX 5JMOA 1YUDA 4AEDA 2OZ6A 3OYWB 3E6BA 1XU1A 3UKNA 4B4QA 2WZEA 5GJ6A 4FT8A 3VKFC 5KHKA 4FPKA 3UESA 5FPVA 2NM1A 4CU9A 1KXGA 2XWBB 2FZ2A 1MS8A 2RS52 2ZGMA 4HPKA 4LHKA 4HKOA 1RVF3 4V2WA 4WM7B 1BBT3 4GA9A 1AR62 2OZJA 5I0UA 1AR73 3MIBA 1D4M3 3W5NA 4L99A 2ZACA 4CZSA 1QJX1 3B69A 3O5SA 3V0AA 1MS1A 1ND3B 4FOWA 3VZMA 3NV2A 1JYXA 2IVIB 5FZ0A 5F7UA 1HJGA 1QJY1 2G1MA 2MHFA 4Q2FA 3TOJA 1SBEA 3HQRA 4QPGA 2DVFA 4FCAA 4FOYA 4CCNA 1JZ7A 1STMA 5ERLA 2QQPA 1YJKA 4QPIA 4YVSA 2FZ1A 4HKLA 4XZUG 2HWC2 4K21A 1CAUB 1V0AA 3N36A 4HN1A 2R072 4P9XA 5IYYA 1ZBE2 4LBLA 2PELA 2D6PA 2B7YA 2ZBJA 2YMZA 1ENQA 3TYJA 4MG2A 1OA4A 4JVAA 3WVJA 1LR5A 2W9XA 2VMFA 5DAWA 4CRQA 3FC0A 2VZOA 4PIYA 2BRTA 2Q5TA 5FTTC 3QD6A 5HXVA 1GZWA 1SFYA 1Q8VA 1DYKA 1L7RA 2P2KA 2X53S 3AMNA 5D21A 4AFCA 4KU7A 4AVAA 1H1MA 2AENA 1DZQA 2F4PA 1UYYA 1APNA 4ZU4A 4COWA 3ES1A 3K48A 4XDQA 3ZN4A 4CP1A 1UX6A 2UURA 4CXXA 2EIEA 2X5IB 1UYZA 3DYMA 4INDA 3AFGA 3RRDA 1A6CA 4Q4Y3 2FCVA 4BZ4A 5CU1A 4C90A 3ZSLA 5JIUA 1I3HA 2VR4A 3HNMA 1RYYA 3JQWA 4YM1A 3RWKX 1KFXL 1CAVB 5DDJ1 5A33B 2WQ8A 1W39A 1UQXA 1NX9A 3WHUA 1H1IA 4N53A 1ENRA 4Q5OA 4BIOA 2R1BA 1GYKA 4GWJA 3THTA 4F83A 1PVC1 4AAXA 4QXKA 2RS53 2A70A 2BOJA 4CCOA 4BJ0A 3LPGA 4LBOA 2VMEA 1JI6A 2C6SA 4LIUA 4I2OA 3NKGA 4SLIA 1A8DA 4XDOA 2W39A 4BB3A 3ZDVA 4BHPA 4BMBA 1HDKA 2WQ4A 1AR63 4CDUB 4CDXC 1K5MC 4UXAA 2PMWB 3I2KA 4AQSA 1FOD3 1LU1A 1LHWA 1Y9GA 2VW1A 3IPVB 3SCFA 2MEV2 1E57A 1FXZA 3PIJA 1O3QA 1RUG2 1NG0A 1PGW2 4LOTA 2G9ZA 1EAH1 2NN8A 2NZ9A 1J59A 5FZ3A 1W28A 1T2XA 1F5FA 2A3WA 1W6QB 4IE6A 4E27A 2R063 1JODA 1PGL1 4QMAA 4XUPA 2GAUA 1FT9A 5FUPA 1VR3A 2WA4A 2W92A 1Y9QA 3VBUB 1FPN2 4OI2A 4WZFA 1VBE3 2ID4A 1OQDA 2R073 2VW0A 3LDBA 4Y33A 1JU3A 2CU5A 5EP9A 4UOJA 4JQRA 2VW2A 4HVRA 4PJYA 3OUJA 4LR4A 2CGOA 2VU9A 1GICA 4I09A 3T1MA 1RL3A 1H2KA 4NMIA 3JCIA 3WQ7A 3B94A 3MFAA 5JSRA 5JXHA 1DLCA 5E89A 3VDAA 2Z5WA 3E5QA 4EZHA 2QDNA 5T5JA 2EVXA 3PUAA 1FMD2 4QDSA 4Z82A 5FLHA 3LA3A 1O5LA 3ZR5A 3CJIA 4KWUA 4Q1RA 2DCJA 4WVMA 1CPMA 3Q8BA 5FLJA 3LEMA 3ALQA 1Y4WA 2RMU2 1ZZ9A 3K4AA 3VN4A 1RC6A 4ZY9A 2VZPA 1RXFA 1D2QA 2QZ2A 2WS92 5CFCA 4CE8A 1CESA 3MUZ1 4IV3A 2SBAA 1RUNA 1C8NA 1UOJA 5BXXA 3LD8A 3ZSEA 1RVF1 1ZZ6A 1LESA 4Z07A 1BBT1 2LM3A 4NE9A 4QQLA 5DZFA 4B4PA 1TEIA 5FP4A 5I8YA 5KHJA 3CZUA 3ZPYA 1KEXA 1AR71 1V9U2 2BPA2 1D4M1 5JR7B 2J1RA 2A73B 3A0KA 1OSGA 3DKWA 2B39A 2MEV3 3PTRB 2VBBA 4AEKA 3IDEA 1IS4A 2L9LA 3DPRC 4O9EA 1W8OA 4R9BA 3SNMA 4RR3B 3HQXA 1SLAA 4A42A 3DGTA 5C6CA 2FDFA 2J1UA 4RQPB 3VD3A 3AYAA 1NAEA 4LUMA 4A41A 4FQZA 2ZKLA 4UAPA 1W2OA 4AVTA 5J37A 5JOWA 2XOMA 4EN9B 5C8WA 4Z2WA 4Y1ZA 2WZ8A 5B4XA 3ORJA 4CCKA 1J83A 3JXSA 5ACA2 1REEA 1TZOA 2IZWA 2C9KA 3J9SA 2GNBA 2JIJA 3DUIA 1PZ9A 4V2VA 2BEOA 2Y0IA 3WNNA 1E5IA 4YSFA 5IK5A 2JDZA 3N9LA 3RWNA 4P08A 4CEWB 5AC92 4ZZ8A 2HH9A 5IVVA 1LOFC 4GMP3 5C8CA 1RUC1 5FXXA 5GLTA 1WW4A 2WRAA 3LB9A 5DN2A 1ZVFA 3M8LA 2DBIA 3TEYA 5J96B 4NWVA 5D8AA 5FCCA 4OHWA 5ABJA 2KM2A 1SLLA 3ILFA 4HLTA 4AFMA 5FQ0A 4TLFA 4Z1VA 2V4VA 5FBZA 1UF2C 4DRVA 1ENSA 1FMD3 1VBC2 4AE2A 1W6PA 5FPBA 1NCQA 4UFJA 3OGVA 2G9GA 2OW4A 4JDMA 4Q4Y1 4QKDA 2WIIB 1W06A 5T50A 4LBJA 3ACIA 2RHPA 2RMU3 5I91A 4OHZA 2RDNA 5FZFA 1VP6A 1SLCA 2JIGA 4O9GA 3KF5A 4MO3M 5EFUA 4AQ2A 3OOXA 2BW8A 2AGSA 2WO1A 4N43C 3MW3A 4QKNA 4CCEA 3AMPA 4XFBA 3WNLA 4AVCA 1S2EA 2RS51 3AFKA 4JDOA 3CKHA 1C57A 5FYYA 2WINB 3O1OA 4UW4A 1DIWA 1LOEA 5IVYA 5IATA 2J42A 4RSUA 3ZYHA 1P8JA 3J7HA 4CYDA 1AR61 1HRV2 3ZSJA 1V9U3 1AJOA 1G7YA 3FWEA 2XUEA 1GZTA 2ZGLA 4HVOA 3WD5A 1LCLA 5JOXA 2ZOEB 4AFAA 1SBDA 3PHMA 2WAOA 3HBZA 4ASLA 5IK4A 2J1SA 5T55A 1DQ1A 2YBKA 4D8MA 3SCHA 1OLRA 1GP6A 1T6BX 2JJ6A 4MGQA 3DYPA 2ZTNA 2D3SA 3VBRC 4EWAA 2FMYA 1WGPA 2WO3A 5C9AB 1ULFA 4XE9A 4EWDA 1OXCA 2R061 3AJYA 1UWWA 2VULA 2WNUC 1UAIA 3OJBA 4CEYB 4EZ4A 2VTXJ 3WG4A 1IPJA 4A7ZA 4NIGA 3VKOA 2C5DA 4NROA 3HWJA 2WN3A 1YI7A 1CZSA 1DCSA 1HV0A 1VBE1 2NPIA 1PNFA 2DTWA 2R071 3I97A 2ET7A 3NAPB 4MXWB 1W0PA 2RR12 4WV8A 4CCMA 3CIHA 2R49A 3HEIA 2QFEA 4NRMA 5AC93 1ODNA 2WT2A 1SACA 3LWCA 1ZBA3 2B46X 1AL22 5T5PA 1S2KA 2ARXA 2YPDA 4JGZB 2OIIA 1O91A 5FYHA 3TWIA 1VJ2A 1BEV2 4I3GA 1F9KA 1TNFA 3AKRA 4F8AA 2VNOA 4H2AA 4ARXA 5JSPA 2I74A 2GH8A 1VBC3 1ZM1A 3KGLA 4LKEA 1ZREA 3RPQA 4QQ2A 5C3QA 3WT3A 3O1MA 1QQP2 2VH9A 4IE0A 5A3MA 3OGSA 4MXVA 1YEWA 4MYEA 3VBHB 4QB1A 3VV1A 4ZU5A 1JUIA 2QQUA 3NMBA 1LENA 2YGMA 3M3EA 3I59B 4FPLA 4CP2A 4BK5A 5BUVA 4ZXEA 1IKQA 2D6LX 3VUOA 3WG2A 4A44A 4Z92B 1OVPA 2EXKA 5FO7B 3V56A 5SV5A 4UW6A 4HXCA 3TB0A 3LSEA 4CA9A 5CG9A 5JLVA 2VOTA 5EZWA 2CAVA 4CUAA 5EJZB 3SMHA 4DUVA 5B4NA 5A7WA 5C3SA 1A34A 4I3PA 3VHRA 1JMUB 1DYOA 4XUTA 1F2NA 4N9HA 5CKNA 2GC2A 1JHNA 3LF7A 2JE9A 1UL9A 5IK8A 1N3PA 2I07B 5FYTA 1XBFA 4I01A 4CU6A 2MEV1 1TME2 3TEZA 1RUG1 1VAKA 1PGW1 1QJU3 1QMJA 3K46A 3H7JA 3GBWA 3O7OA 5BNNA 5BNOA 4PIZA 1V70A 2RV9A 1N1YA 5K0UA 5CZKA 5L19A 3O1SA 2G9FA 1UNBA 2DCYA 5DUWA 1DG6A 1PM7A 4QHOA 3MBWA 4C1WA 2PHDA 4HOOA 2YBSA 2IXIA 3PURA 3U11A 3SH4A 1FPN1 4AEDC 4BQ2A 4FI9A 4BOWA 1F5JA 4AG4A 3DEMA 2RR13 4QX2A 2NLRA 1TE1B 3ZFEA 2DURA 4GMP1 5GZDA 4DO0A 2A6WA 1AL23 1AUYA 3ZFGA 5L7OA 2DCTA 1W2TA 1W04A 3LE0A 5KC6A 2DWRA 3PUSA 3FFZA 3INAA 1OKQA 1NLSA 1L7QA 1YWKA 2RDRA 3R6SA 3WQBA 4EV0A 1BEV3 2AR6A 1S0JA 3NJVA 4FP2A 1FV2A 3WP6A 1MS0A 5FP8A 3VZNA 4XOGA 1HJFA 3I2JA 1IKPA 1FMD1 5FV3A 4QQOA 3USSA 5FK7A 4COYA 5FFOC 3T2TA 2LRPA 1GWMA 1QQP3 3HBKA 4KWLA 4AQTA 4NHLA 2WA3A 2XPJA 3NV4A 2XJQA 4J25A 1AL0G 2RMU1 2UY8A 4QDRA 2R7EB 5DPNA 1O4ZA 4NWWA 4JGYC 4Q8LA 2R0HA 3VZKA 4QPGC 3QBQA 1W6OA 4DQAA 4IESA 5HCBA 5EYXA 1UKGA 2YC0A 1GLHA 4H14A 2Y6FA 3HAGA 2ZX3A 4X8NA 4K8RB 1W8TA 2VXRA 3ZYJB 2Y8KA 2A5ZA 1ULOA 3RVHA 4CDXB 3PVBB 1K5MB 3VBOA 4QQHA 2V5YA 1V9U1 2RS13 2ZMKA 3B3QE 4BIFA 2BZDA 2UWCA 4DPNA 4A4AA 2VMCA 5DQ0A 3BCWA 2ARAA 4Y3OA 3DV8A 1LJ7A 5FMOL 4UYBA 2YPJA 1RUJ3 1KD7A 3GJAA 1X8MA 2K2SA 4XHBA 5EXOA 2GU9A 5IJRA 2ZAHA 4LXLA 3N35A 4QPYA 2BOIA 1Q43A 1RITA 3KZ4C 2D6KA 4QM9A 2Q1MA 1QJY2 3JUUA 4NOTA 4L11A 4MHRA 1W8NA 3EMRA 4Y5SA 5FP3A 4YZ2A 2PAEA 3PUIA 2J1AA 2VZTA 3E5XA 4AK3A 1XNKA 5DUUA 4C0HA 1VB4A 5AC91 3W5MA 4Q1PA 3ACFA 3ZYRA 3KQ4B 1SQ4A 1ZBA1 4K8FA 5C4WC 1JTZX 4DXTA 1QOSA 1C1LA 1W6MB 3KV9A 2HYKA 1AYM2 1CQ9A 2CYFA 1ZZ7A 3ZMOA 5J1XA 3RZHA 5DAQA 2CWSA 3JB4C 5LBBA 5F6LB 5JAXA 3M3QA 2YXSA 1VBC1 1OLME 3OBAA 1W6NA 3POSA 2VVEA 5FZOA 5FYZA 2VMHA 3D5OA 1D4VB 4CUGA 4XAAA 4NAOA 4ZU7A 4GWMA 2WT0A 4HKWA 2D43A 1ZRRA 3G7DA 3NNMA 3AMHA 4FQ4A 3Q9OA 2Y64A 2SLIA 1LEDA 3I8TA 1HKDA 1OD3A 2VZSA 1YFXA 2WWJA 5IAVA 4MADA 2GZWA 1QH7A 5LEKA 1XJAA 1O3RA 1Q3EA 4IDZA 1GWLA 3FHAA 4RFRB 4XJ8A 4HONA 4LKDA 2G19A 3E1F1 4LBQB 3K51A 2W1UA 5FJHA 1POV3 5DDJ2 5C71A 2WZR2 1US3A 1CN1A 3E97A 3I2OA 1DGLA 1PVC2 3FN9A 4CDWA 1GQGA 4OQ8A 3AKPA 1XNCA 4JX0A 3NV3A 2E7AA 3KV5A 5JVVA 1REFA 1EV12 2XJRA 3DPRB 3KVBA 1QJU1 2JKBA 2IWGB 3VB9A 1H8TC 5L9RA 1X7NA 4JKLA 3USUA 3P1IA 3U0ZA 1OKOA 3CEWA 3GCWA 4FTEA 4GKYA 2ZGKA 3NJYA 4GJYA 1SZBA 1R093 4P5YA 1GQPA 3I3DA 3CJIC 4JKMA 3I3QA 1UMIA 3OB8A 4XFFA 4DFSA 2F4LA 4CDQA 5LWBA 3VBSA 1EAH2 5F8PA 2XGXA 1CZTA 2EAAA 3NWKA 3ZFFA 4D94A 4DY3A 3ZXJA 1AXZA 1H2NA 2NYYA 4H3WA 4UBHA 4B3NA 4IGPA 4IEOA 2WNEA 1V6OA 4RN5A 2RR11 1PGL2 4KQ7A 2ORZA 1ZRFA 4IV3C 1QDOA 1AL21 5J36A 2Q1ZB 4PBOA 3LOBA 1J58A 4R9AA 2R16A 4PCRA 2VZ1A 4CPBD 1BEV1 4LKFA 1MQTA 1S4CA 1H4GA 5FPAA 2HWD2 4TSVA 1J3QA 5FZCA 3UL2A 2PHXA 1B35C 4AGRA 1SPPA 1YNAA 1GZCA 3LOIA 5GZFA 4URAA 1YFWA 3OD4A 3GYDA 2PAMA 4A45A 1X50A 2X8KA 1QQP1 4FFHA 3T3YA 5G04L 2FCUA 5CFDA 2VGDA 4A3XA 2ET1A 1LHNA 5LY2A 3AYEA 2Q30A 2AACA 3H50A 3WCRA 4OLLA 2RE9A 1U0AA 3GGLA 3WW2A 2D6NA 1ULDA 4NPRA 3IT8A 1AZDA 1SHWB 1ULPA 4HG6B 4N43B 4XF0A 3WNMA 1YJLA 3NVCA 3OY8A 5FPXA 4XFCA 4DY5A 1UOFA 4Z8BA 4YFZA 5I0RA 1MS4A 2GC3A 5LRSA 3N7JA 5F32A 5FY5A 2C1FA 2ZGUA 4HSJA 1ZRCA 4K20A 2CGPA 5FAXA 4UFIA 5C8CC 4DNYA 2RS11 3ON7A 1H0BA 5LCWL 4L92A 2JWPA 3MYXA 1RVF2 3A7QA 1VBD2 5D8AC 1IOAA 1EV13 5JDBA 3WUDA 3RMXA 3FL7A 2WYFA 3AL5A 1AR72 4XXPA 3BIEA 1XYOA 1E5SA 1D4M2 1HB4A 2VQ0A 4Y20B 3VBRB 1VMFA 1DGRA 2RS33 4M3CB 4XURA 2R0FA 1W8ZA 2WNUB 2LS6A 1EP0A 2Y6JA 4D6QA 5HBAA 3C2UA 1S0CA 1NLQA 3AZYA 1Z78A 3N9QA 3PUHA 1F31A 4N8MA 2EIBA 1O8PA 4ITCA 1UN1A 3UETA 2A3XA 5FWEA 4QXBA 1ZA4A 2BNNA 1LHUA 1QY4A 4PDWA 3GXUA 4PLMA 2Z79A 3VD7A 3N7LA 1GV9A 3KM5A 2A6XA 4KWJA 5DAPA 1HB2A 3NNGA 1H8VA 4C8DA 4NHKA 5F3IA 2WDBA 2QQKA 2JDUA 2QBXA 4XACA 1GNYA 1RIRA 2GSYA 2G4IA 4HETA 3HT2A 4A6OA 4DMIA 3GM8A 2ZABA 3O0VA 2W68A 2W94A 4IE4A 4N90A 2YDEA 2HWD3 4I0AA 2ENRA 2KD7A 4ZS2A 1AR92 1IPKA 1KQRA 1N3QA 2OUHA 3WP4A 3GBFA 2H0BA 4YYOA 3I3MA 1CZVA 1DZRA 1WCQA 4YW6A 2YFUA 5A32B 4XW3A 3U4XA 1AYN3 1RHI2 1R083 4QX5A 3QH6A 3LQCA 2ARCA 2VZ3A 4BM8A 1MVEA 1BXHA 5FLIA 3H3ZA 5FZBA 2HWB2 5JZGC 1YQ6A 4Q4Y2 3OYWA 3IIAA 3C7OA 3M70A 5A3UA 4GB33 1VRBA 4RGKA 1GANA 2WL1A 5JOYA 1PO22 4X8PA 3SHRA 3VBSC 4IGQA 4JV4A 1K5JA 3HMYA 4CU8A 3MIDA 1KFUL 2ZZQA 2P1BA 2PHUA 5LA1A 1OOPA 1VBA2 2VCCA 4HANA 4Q27A 5TSWA 1VIWB 2YB7A 4LO8A 1NY72 2PAKA 2JE8A 4FVVA 1VBD3 2PQSA 4LJHA 5FZ8A 3LIGA 2FMDA 1ND3A 1NOVA 1XYPA 1AVBA 2A3YA 2XVLA 4CCLA 5LRRA 4UFHA 1FOD2 2XJTA 4IEUA 1Q8OA 3ZIXA 1R091 5GKAC 2JEMA 5CG8A 1V6IA 3MIFA 1GNHA 1LNSA 2EXIA 3ILNA 1BKZA 4L9BA 4AEDB 2WYSA 3K4DA 1G9CA 2DYCA 2XDVA 4Q0UA 2R062 2XKOA 4GMP0 3OUHA 5GZGA 3ACLA 4MGSA 1NCRC 2E53A 3W9AA 4HPKB 4DXSA 1A78A 2CDOA 1NUKA 1NXMA 1VBE2 1AYM1 3G6JB 4HMZA 5IVEA 1CWPA 1ASJ3 2OVUA 3NNJA 3MLLA 1LB2A 4YZ1A 3ES4A 4PLOA 2P6HA 3RFRA 4DOUA 2IVJA 3FLPA 4L97A 5LZ6A 1WBFA 2LUWA 1MS5A 2OXBA 1AR93 3AZVA 5GM0A 1UD1A 1I5ZA 1WA6X 4BE3A 3V0AB 1WCUA 5FZ9A 3E6DA 2W95A 2QQIA 2R30A 5JWPA 2X5IA 3WZ1A 5F9TA 3CO2A 3M2MA 3F2ZA 3KF3A 4Q4W3 4F7ZA 5BNNC 1G8WA 5BNOC 3ACHA 1RHI3 4LMFA 4JGYB 5K0UC 4NRQA 4P14A 5LBCA 5KHIA 1JZ2A 3IIIA 4QPGB 4ATFA 4ZXKA 1WCSA 5FZMA 5FZGA 2HWB3 4IQPA 5FMDA 2DV9A 3EBRA 5A33A 3T0AA 1QEXA 5HI0A 2X09A 1AHSA 2Y0OA 1S0GA 3SXWA 4LBKA 3N4MA 1CPNA 2XBO3 1PO23 2C24A 2J1VA 2WZR1 5M0TA 3GJBA 3NO8A 4LE4A 4CPBA 3RDIA 4Y5Z0 2JECA 2ILMA 1W8FA 1AJKA 1S0BA 2Z69A 5FY4A 4ZZ5A 1OQ1A 1LULA 3GZTB 4IEPA 1VBA3 3ZFGC 4CDUA 3BI3A 1GZWB 3K77A 5FY7A 2BP6A 2EF6A 5JPNB 1PIV2 2R042 4MGIE 3MIHA 3WF0A 3BPSA 1EV11 4AHZA 3IN9A 2D40A 2JENA 1AX1A 3WG1A 1W05A 5LBEA 2VUCA
chains in the Genus database with same CATH topology
3N7KA 2A6VA 2RS31 1D2SA 3RG0A 4XF9A 4P9GA 1XRUA 3ZO0B 2ZHMA 2XKPA 3KGZA 3UJQA 1W6QA 4FOVA 3AM2A 3ZXFA 4YG0A 1NA1C 3AYDA 2HEVF 1S1AA 3VBUA 2WNVA 3LAGA 1WBLA 5C4WB 4H7MA 4XBQA 1QU0A 1ND2A 2GDFA 1I9RA 1JOJA 5HCFA 3PMEA 4Q0VA 1RJ8A 1TMF2 1XE8A 2YGLA 2QJVA 5FREA 3VBOC 2HWD1 4GIQA 2D7FA 4YW2A 1TNRA 3IDCB 3JB8A 1EY2A 2DVGA 4R8HA 3LSDA 2LTNA 4XBNA 4AFDA 5AFEA 2VQAA 1ULEA 3KLSA 2NQYA 3FLTA 2VOKA 1AYN1 1OPOA 1R081 3LKJA 4S2GA 3BU7A 4IEYA 4RS5C 1PGSA 3WCSA 1RTVA 3AX4A 2RM23 4HL0A 5CB7A 2D6MA 1U5IA 2B45X 3EO6A 1BQPA 4G4FA 2PQQA 3S6PA 2XLGA 3ILRA 1U5YA 3D8CA 1QHDA 1JH5A 4L8QA 5FMOS 3J8F2 1GFF2 1KJLA 1OA3A 4K1ZA 5GALA 3JD72 2HEWF 1PIV3 3MPBA 2R043 3R0RA 1UKRA 1VBD1 1WCKA 5DZEA 4YW5A 3WDWA 5JI9A 2PA7A 1HQNA 1H8TB 2ZA9A 2KA3A 2QKDA 1Y3TA 4LBMA 3AP7A 2BVVA 4RR3A 3CJXA 4M3CF 4BCUA 1Q8QA 4AW7A 3CJIB 5KWRA 2P3KA 1HXS2 4B4RA 2CV6A 4XTPA 4DZGA 2D93A 1X82A 4XIKA 1GZ9A 2A7AA 4FXGB 4OHXA 4YGEA 3I54A 1VAVA 4I0WB 1RGSA 3A0NA 4IV3B 5E1RA 2BVBA 3M4FA 3RJRA 4CEWA 4X6RB 1DQ5A 1J3RA 3WHTA 1HRI3 4FPOB 1LOBA 1ASJ1 3KD4A 1YI9A 1TMF3 1WW5A 1H1AA 4OUSA 2Y26A 4CDWC 1ZBA2 2GMEA 3J4UH 1B35B 2GN7A 4Q8KA 2ATFA 1AR91 2JD4A 3FZ3A 2LALA 3VBFB 3JQXA 1IZ3A 2WLPA 3DN7A 4QD2A 3FE5A 4FPGA 4IV1C 4Q4W1 4Q4X2 1RHI1 3VDDA 2HWB1 3MF9A 1U12A 2ZGSA 4DB5A 1JUHA 2CWMA 3N3HA 5K9YA 1V6NA 4OFGA 3ZFFC 2XBO1 1PO21 1GR3A 1AR82 2P17A 3EHKA 3WDXA 1GBGA 4E9KA 5C8CB 1VALA 3J8F3 4GWNA 4OUMA 1VBA1 3PMSA 2D98A 4ISQA 1BK1A 3WXPA 3JD73 4ISRA 1NY71 3M1HA 4WBBA 4LBNA 2EA7A 1DGWX 3VZJA 3DF0A 1MQTC 1UPSA 2VUJA 3SITA 1CR7A 2ZZJA 4LHLA 4UW3A 1FOD1 4WZCA 1O3TA 3EJKA 3IBMA 1HXS3 1NQJA 5C9AA 5E16A 1QJU2 2RJLA 3D0SA 5GLUA 4CEYA 3WQ0A 5J3UA 2W0XA 3S0MA 5LK5A 1UCXA 4AVSA 1LGCA 4FPEA 3ATGA 4N9IA 5I93A 1VBB2 1MR5A 4MXWA 4TWTA 4WVZA 1COV2 2V09A 2UYBA 5T5OA 3MW4A 4WVWA 1KS5A 3GNEA 1PZ7A 4IL7A 1XNBA 4B29A 4N7UA 1RUF3 5T52A 4IEWA 1CAWA 1BZWA 3ETQA 2B9UA 1QNWA 3ROUA 3GZAA 4Q4X3 1G9DA 3SH5A 3VBHA 1CJPA 2BNMA 3U10A 1RUH2 3ZN6A 5JZGB 3B01A 2QCSB 3I59A 4Y1UA 4UW5A 3IM0A 4YGBA 3RS6A 1AX2A 1SLTA 4Q4V3 1POV0 2XHKA 1ZRDA 3H0OA 4IERA 3MEPA 4B8EA 2ERFA 3VBSB 3TNPB 1YIFA 1AR83 4LNVA 3O0WA 3VL8A 4OZXA 4XQ4A 1LTEA 2UWAA 4A7KA 4IEQA 2BWAA 1RUE2 3LGRA 1PIV1 4JRAA 2R041 3X29B 2YZ4A 4P9IA 1UZZA 1OD5A 1CIWA 2ZGQA 3AMMA 1A3KA 3E5UA 4AI1A 1CVNA 2RS12 5IK7A 4FBFA 3WR0A 4OULA 4N7IA 4FSJA 4GULA 2HWE3 1N1TA 1LODA 5FRAA 3O14A 1RUJ2 3CNAA 1ULGA 2IFRA 4V1PA 1OFNA 4AYUA 1NYWA 5EWSA 3APBA 1VBB3 4PF5A 1NCRB 3WW4A 1COV3 4FPFA 2VOVA 4WM8A 4YG3A 1FATA 5JPMB 2XLFA 4MGKE 2P37A 2XJSA 1CAXA 1WLCA 1TMF1 1N1VA 1JXNA 1OOPC 2P34A 4KWKA 4QQPA 1BVVA 3TBDA 5BNNB 5BNOB 4W65A 2VOWA 5K0UB 3WNXA 2DTYA 4YZ4A 2DUPA 1RUH3 2VUAA 4E2QA 3IWZA 3FX3A 2BFUL 3ASIA 3T1LA 1QF3A 3OBRA 5DXDA 1CD3G 2ZGOA 1SMVA 2D6OX 1H4HA 1VB2A 4AI2A 4YVSC 4QPIC 1FNZA 2GMPA 3J8F1 3ZFGB 2DUOA 1DLLA 1RUE3 3JD71 4DINB 3KB5A 3H1WA 5DG1A 3WUCA 4IEVA 1PNGA 4PBPA 3RYRA 1C8M3 4NN0A 1G6NA 3V0BA 3FJSA 5KHGA 1OI6A 2PLV3 4XILA 1BYHA 4XMAA 1HXS1 4XTMA 1UU4A 2QZ3A 1DQ6A 3FBYA 5JI7A 1H9PA 1A8MA 1LOGA 1FV3A 1NA1B 2B8MA 3MFCA 3L9JT 5AFBA 1R092 1GNZA 1NE6A 3AP5A 2H6CA 3FMGA 3FUQA 3FLRA 1NLRA 2BTVC 2ZGTA 2VNRA 1RUI2 2UU8A 3KCYA 5DZGA 4N53C 1RMU2 3VBOB 4XJ9A 4A7YA 1REDA 1RUF1 1LGNA 3SH3A 3QACA 4GH4A 4XIOA 5JIAA 1IGOA 1U5XA 1Z7S2 3AYCA 1PK6A 1VRH2 1OFSA 4Q4X1 3PVOA 5I8TA 3QOPA 4RS5B 4LHNA 1UW8A 2O1QA 4M0NA 4LLOA 1LKNA 4E4SA 3L2YA 5BNQA 1G9AA 4Q4V1 5B2GB 4XFGA 4YFWA 5GLWA 5KXEA 5CIRA 2XJVA 5J98B 2IC1A 1QJZA 2EAKA 4P9YA 1QXJA 1AR81 2WNVC 5AVAA 2NMNA 3WLUA 5GZEA 3PJYA 1IQAA 5FOJB 4AEJA 3KT7A 1ND2C 4QM8A 5T5LA 3D4KA 2VECA 3RSJA 1B09A 5H9PA 3VHNA 1O4YA 4RA0A 1W6NB 4XJWA 3MICA 2V73A 1R1ZA 3UJOA 3MF6A 1S55A 2HWE1 4NVPA 1G9BA 3VLBB 2RS32 2WJSA 3M3CA 5J48A 3MIEA 3AZXA 5BV6A 1CONA 1DYPA 1VBB1 1X8EA 1DBNA 1COV1 2JG8A 3OF1A 3ZX7A 2R6QA 4FAHA 3PJQA 2XL7A 4G3YC 1RUI3 3TAYA 3VHPA 2WSUA 1RMU3 4YW1A 4W6YA 4CDWB 4XF3A 4XJZA 1N3OA 5CFCC 5FO9B 1V00A 2JX9A 3WX5A 4YM0A 2UYAA 2VVFA 1W0OA 3PLQA 1Z7S3 4IV1B 5SV8A 2H6BA 4AXOA 2TBVA 1VRH3 3AKQA 4XYXA 2QNKA 4I30A 1HQWA 3WDYA 2UY9A 2ZS6B 1RUH1 2ZPXA 5H9QA 4XJAA 1KRIA 2FQPA 4XQDA 2EALA 3GBGA 2ZX1A 2Q4SA 1AYN2 4N43A 3ZFFB 1R082 4Y26A 2O8QA 1N47A 4OVEA 2GN3A 5F5QA 3I4IA 4OI0A 3W58A 4BH9A 1LRHA 2PYTA 1OMIA 2GH2A 3HT1A 4Y4YA 5EJ3A 4GB32 1T6GC 4CEWC 4S2HA 4YVWA 1JW6A 1RUE1 4FP3A 3R05A 1S2BA 1SCSA 1MQTB 1SDWA 1QXRA 3KCCA 1OA2A 4FPYA 1XU2A 2WFF2 4D7SA 3EXUA 5BNPA 2E6VA 2JG9A 4Y20A 4C1XA 4G9SB 5ABJC 4M3CA 4PIXA 4URTA 1AXYA 1RUJ1 2E7QA 3WP5A 3VDDC 1NCQC 3UV9A 1G9FA 3B00A 3RYKA 3OPZA 4Q29A 3OY8B 4Y22A 2GC1A 3WY6A 2OUJA 2D3PA 2BYVE 4META 4L2NA 4YW3A 3H1MA 1J3PA 3R4DB 3RMYA 3AXDA 4IEZA 1ZZ8A 2BUKA 3OCPA 3H7YA 2N7GA 2GNDA 2XWJB 4GQ7A 1ASJ2 3FHIB 4LTAA 4J6GA 4P9JA 3AB0A 2DVDA 4QT6A 3N7MA 2ZMNA 4ZKTB 2DCZA 4D69A 5K7PA 4R9CA 5DG2A 5A32A 3D0JA 3ZXDA 2DF7A 4LE3A 1ENXA 1DHKB 4Q4W2 3AXEA 4CEYC 1FYUA 1BMV2 1XNDA 2GNMA 4FO9A 1HLCA 1QWRA 1OQEA 4M0HA 2BBVA 4AQ6A 1ONAA 2UWBA 1O5UA 2GMMA 2XBO2 4AHXA 1POV1 4YW4A 2VNGA 2AH2A 4K3UA 4P9LA 2P3JA 4WM7A 2EXHA 1WUVA 1W2UA 3P3NA 4X6QB 2KXLA 2WFF3 2BQPA 1HIXA 1F8VA 3FBMA 2RJKA 1EPZA 4MZUA 1SBFA 4W6XA 3KT4A 1OPMA 3H1YA 2WLQA 2ZX2A 4QGMA 4RFT0 2PHRA 4EWEA 1MEC3 3ZSMA 4Q0PA 4LO5B 2WZPP 1V6LA 2Q0AA 3OBTA 1RUI1 3EQEA 1CAUA 4AGVA 5KC5A 1RMU1 4COZA 1MZFA 3MPPG 1DF0A 3NSTA 1OOPB 4S2FA 3WP3A 4KBBA 1YLLA 1LHVA 1WW7A 2E51A 4MLOA 2GNTA 1SLBA 3ENRA 1Z7S1 5CVRA 5L73A 4EN6B 1FX5A 4E2SA 1VRH1 2CAUA 2F6BA 1WMFA 1S0IA 1PO13 3A4UA 1IS6A 1WLTA 3ST7A 1WCDJ 3AP9A 4YARA 4D3WA 2WFPA 3D6EA 4JGYA 1LU2A 2YHJA 1ZX5A 5HCAA 5A3LA 2AREA 4YG6A 2D3RA 1QNYA 4DXZA 2BWCA 4XFAA 2IXLA 3CL1A 2HJIA 5EYYA 5D1IA 1CAVA 2RM22 4XFIA 4AGGA 4YVSB 4QPIB 3FUOA 1URXA 3WW3A 3GZUC 4WM8C 1NXD1 4R9DA 1QKQA 3ZXAC 4BLIA 1RUC3 4XBLA 3VL9A 4HZFA 1WLWA 1DZTA 2VG9A 2A75A 4M00A 3JZVA 5KBFA 2ZGRA 2HKXA 3ZFEC 4XF1A 4QHBA 4AFBA 1R1A2 1ALYA 5L7OC 3B93A 3KS7A 1EYBA 4RD7A 4XJUA 3IPVA 3RI8A 1YO8A 2R1DA 4RL7A 1DDLA 3ZXKA 3B9CA 4GXLA 4DRRA 1S0DA 3AKSA 5J09A 1DGWA 3S7EA 1V6JA 3QCWA 2PN5A 3RYPA 5C4WA 5I8SA 2A6ZA 4N53B 3CF6E 2K0GA 4XQWA 4COUA 2ZHNA 1C5IA 1XXNA 4YNIA 5IUQA 1X33A 5H9SA 1GQHA 1J1TA 2D44A 1RUD2 1RINA 1HRI2 2E63A 2XL9A 4Y1VA 4BPZA 1I1EA 1C3HA 1YIPA 4EN0A 4YGDA 1QOOA 2BFUS 3CU7A 4Y1XA 3ZXGA 3NJZA 4COVA 4XPVA 2C0ZA 4YGCA 2MNGA 2WC2A 4OI4A 5JSOA 1C5HA 1SCRA 3B02A 2WWSA 3BPZA 1XE7A 3WOGA 4MSVA 4LO7A 1BCXA 2HWC3 5AVPA 2WNVB 1CJDA 4J1WA 1ZBE3 4ATEA 4H7LA 4QU2A 1IS5A 1AX0A 4GB31 4XFHA 1ND2B 3SLIA 2CL2A 4KH9A 4BYYA 2XG3A 1DU3D 2XH6A 1LOAA 5E8AA 4RGAA 1O7FA 5F1RA 1R1A3 3U07A 1H8TA 2WFF1 4GH4C 3ZMNA 2ZKNA 3QLQA 2OYZA 1CX4A 1PK6C 2IFWA 5BY5A 5FOBB 2NP0A 2VOXA 2YV8A 4K9SA 4R4XA 4WVMB 2HEYF 4I0BA 4RQPA 4BQ1A 1KITA 1MEC1 3KT1A 3ZXEA 1FI2A 3H3UA 3MI8A 2AYHA 3BB6A 1XQNA 4KG8A 3ZDSA 2ZHLA 4FPCA 4HSLA 3LA2A 5CFCB 2VMIA 4JC1A 3WW1A 4YZ5A 2PFWA 2W52A 5BYNA 1HQLA 4KGQA 2ZCWA 1C1FA 3BOPA 1DFQA 1RUD3 1B35A 5GZCA 1D0HA 3ZXLA 2XJPA 4K6BA 2XUMA 2I45A 3LCPA 5KXBA 3VBFA 1RUG3 1QDCA 1AF9A 1RUF2 1SLIA 1JYIA 1PO11 4Y24A 3M3IA 2DFCA 2MPFA 4JTNA 4EJRA 2AUYA 3BODA 5GLZA 1BMV1 3PNAA 1FPN3 1DGRN 4UBGA 1M06G 4ASMB 4CDQC 4HT1T 2DVBA 2JG8C 2ARBA 4Q4V2 4SBVA 5FO8B 1VLNA 2DU0A 3B7MA 3ZIWA 4YZ3A 2P3IA 3KSCA 2VY0A 4KGGA 3THPA 1WLDA 5FDBA 2YYOA 1LHOA 4HN0A 1DQ2A 3S30A 2CY6A 3AJZA 1C4RA 4LEJA 5JMCA 1ZNPA 2ZX0A 3ME2A 1KDKA 5D8AB 2Z42A 3P3PA 4IEXA 5ABJB 5FQ0B 4FTSA 3VHOA 1G86A 1Y43B 3AMQA 4NO4A 1W6PB 4Q0QA 1NCQB 4MX3A 3VDDB 2JXAA 3R4SA 5CAZA 1GSLA 5CFDC 2HWE2 1MVQA 2C9AA 3ZVXA 3GALA 2WS93 3NV1A 1H9WA 2R32A 1OLQA 4MGYE 1ULCA 4FOQA 3NKTA 3NAPA 4GALA 4AVBA 2PHFA 4CP0A 1UU5A 4KNCA 4YVWC 4HK9A 3DL3A 1MS3A 1FNYA 5LK7B 5LEJA 4LBQD 4YM3A 3GF6A 2JE7A 4JGZA 4AF9A 5JCTA 1PHMA 1Q8SA 5BNPC 5CA6A 2JG9C 4WVVA 3OGGA 1V6KA 4LLFA 1JYCA 2YROA 1BVP1 4I02A 1SEFA 5JZGA 4MVTA 4K1YA 1MS9A 2HWC1 5ACA3 3QH7A 3WG3A 1YYNA 2RM21 1ZBE1 5KXCA 4C0BA 2DUQA 2IXJA 2PTMA 4FPHA 1NQDA 4PDWC 4LUKA 2HWF2 1CGPA 1YFYA 3MIGA 4FXKB 2TEPA 1R1A1 4RGGA 3E6CC 3GHNA 1CAWB 4Q0SA 1WMEA 1YHFA 3D82A 4XXAA 1WW6A 3FFQA 4OHYA 1D0GA 4MH0E 1RB8G 1O4TA 3O12A 1C8M2 3HD8B 3HIFA 1HX6A 3M7AA 4E4DX 2PLV2 4P9WA 2IXKA 2QUOA 3TN92 1MZ6A 2BGCA 3ZN6B 3R4UA 1O3SA 1QXPA 3ZSKA 2AZ5A 3JBG2 1NCRA 2ZGPA 5C33A 4B7KA 2O8OA 3AZZA 3GHMA 4HFSA 3WDTA 2DU1A 3NL1A 2OA2A 1DQ4A 1HRV3 4FAGA 1RUD1 1HRI1 3MGUA 1OHFA 4GKXA 1V6MA 1H30A 2TUNA 4WM7C 3IMNA 3B5LB 4C91A 5BPXA 2ZAAA 3POYA 1YCIA 1ND3C 5DUVA 5IT6A 2DCKA 2D5HA 4A2UA 4M01A 4E2GA 2E9QA 4JAAA 1RUOA 5F6KA 4NR1A 1UIJA 4BA6A 1UPIA 4YM2A 4XZPA 4WM8B 5KHHA 2PHLA 2QDRA 4J1XA 4XHXA 4BLJA 1LGBA 1CAXB 4AHYA 3TRSB 2XLAA 2HWF3 1JN2P 2CGNA 1FAYA 3ZFEB 3HN1A 1ZZBA 1C28A 5L7OB 4CDXA 1K5MA 3OTFA 4XMIA 2WSVA 1UZYA 1MZEA 4YLZA 2ETEA 3BIWE 1NE4A 3AZWA 3PVEA 3I7DA 1YFUA 4HVQA 3TN93 1NA1A 1Q56A 2X5IC 1M4WA 4RHV2 2EXJA 1VAMA 3WINE 2A71A 3JBG3 2ZX4A 3HR9A 1I6XA 1N1SA 2WS91 4BMEA 1YRZA 5J7MA 3WDVA 3H9AA 1W6OB 2OPKA 1IHMA 4TZDA 4NHMA 3ZYPA 1U5ZA 1BJQA 2YUEA 4W6WA 3L2HA 2FBEA 3IKWA 2GALA 3LZZA 3ZYIB 2DVAA 1W6MA 4HBNA 3PVNA 1TME3 2D97A 5T54A 1L3JA 1AXKA 3V0BB 4QGNA 4CDUC 4ORFA 2WQZC 4Y1YA 1QJX2 2A6YA 4RS5A 4KU8A 5DUXA 2VMGA 2NMOA 2H0VA 2X29A 3KMHA 4XEZA 3OGJA 3POWA 3S7IA 2D5FA 1Y7BA 5ACA1 3NW4A 4K7JA 3IDBB 1WD4A 4BWOA 5E88A 3KQRA 3W59A 4JTOA 4KL1A 3VBUC 1PVXA 4ES8A 4LBQA 1S0EA 2YY1A 4LA2A 5EV7A 2QVSB 4AWDA 4Q26A 4EN8B 3WQ1A 1Q5OA 4GH4B 3H8UA 4AHWA 2FHRA 5FPZA 3OD0A 5GLVA 4ONUA 4PQ9A 4R52A 1PK6B 4M3CE 3DPRA 3PTYA 1EPWA 1X36A 3AP4A 5H9RA 4LO6B 5L36A 1H2MA 3ZN5A 4RHV3 5JOZA 2B5HA 4CTEA 3CLPA 3M3OA 2ZMLA 1JBCA 4AI8A 1UMZA 2BNOA 4AEMA 4LULA 1WA4A 1ZYBA 4U36A 1YXWA 1HRV1 1LOFA 2TNFA 5CNAA 3LA7A 3RNSA 3UKTA 1S0FA 4AI0A 4IV1A 1TQ5A 3VZOA 1LECA 4MV2A 4S2DA 1QJX3 2VVDA 3ECQA 3MW2A 3USUB 3RQ0A 3AP6A 3I2DA 3TNQA 1QJY3 4F3JA 4RR3C 3C3VA 4IETA 2Q8OA 4RQPC 4CDQB 2ES3A 1MZ5A 3B9IA 3KCXA 2JG8B 1Q8PA 1J1LA 1GKBA 1XYNA 3VKLA 1LOCA 2XB6C 2WT1A 2CTVA 1ZZCA 2K9ZA 4MUVA 1AYM3 3O0XA 2HWF1 2WKKA 3V65A 2ZJCA 1KJRA 4IXLA 4U2AA 2B42B 4LO4B 1QH6A 2Y38A 4B7EA 2Z2SB 3VBFC 1PZ8A 1C8M1 1HW5A 3UKVA 3ELNA 4PLNA 2PLV1 3WV6A 1RJ7A 1SFNA 3TN91 3AK0A 3RI9A 2ZHKA 3VBRA 4EN7B 4DS0A 1PMIA 2JICA 4TYSA 5CFDB 4OHVA 2XJUA 3J26N 4H55A 3MZHA 2WNUA 1MACA 3JBG1 4XF4A 4OI1A 1IS3A 4E4ZA 2IXHA 4QGLA 2VPVA 4JRLA 1WD3A 1DQ0A 2O0OA 1HV1A 2E7TA 1UIKA 5DDJ3 3VGIA 2WZR3 3ZYGA 5CBLA 1MEC2 4JDNA 2ZGNA 4YVWB 2PHWA 4AI3A 1Z0HA 1PVC3 2CNAA 3BTAA 3V64A 5K8SA 3VKNA 4MGZE 4R4ZA 3SISA 4HK8A 4JCKA 4ES9A 1TME1 1BBT2 2I2SA 5BNPB 1QOTA 2JG9B 4FPJA 4AVVA 1WMDA 2