1UYZA

Carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with xylotetraose
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
131
structure length
131
Chain Sequence
MVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Family 6 Carbohydrate Binding Module from Cellvibrio Mixtus Endoglucanase 5A in Complex with Oligosaccharides Reveals Two Distinct Binding Sites with Different Ligand Specificities
pubmed doi rcsb
source organism Cellvibrio mixtus
molecule tags Carbohydrate binding module
molecule keywords CELLULASE B
total genus 27
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uyzA00
1UWWA 2V72A 1LNSA 4GZ9A 4QX0A 2ZXQA 3IAQA 5LA2A 2VZTA 2J22A 1OF4A 1PX4A 1F4AA 3IAPA 3MV01 3WNMA 3CQOA 3CZJA 1PMHX 3IDAA 2VZ1A 1O59A 2ZEYA 2VZUA 2JDAA 3ZM8A 2VC9A 3HN3A 4XUPA 2KD7A 2XOMA 1UX7A 1JZ2A 2VMEA 4DUWA 5G05L 1JU4A 3D3AA 4ZXEA 1O8PA 3NNGA 4GWJA 4OMDA 2VZ3A 2C26A 3WF1A 2B9VA 1GNYA 2QBXA 2J1VA 3SEEA 1JHJA 1W8OA 1UMIA 1WKYA 2W9XA 2Y6GA 4XURA 2W47A 3GDBA 1CIYA 3WF4A 2RV9A 2XQXA 2WO2A 4LHSA 1H6XA 2LS6A 2VMCA 2EIEA 1UY0A 4E8CA 3LPFA 2BBAA 3I2GA 3GM8A 3I2FA 5JXHA 2X10A 5G04L 4BDVB 4A41A 1I5PA 2CDPA 1XNTA 3C7HA 3AC0A 2ID4A 4D8MA 3EB7A 5DN2A 1W99A 3OEAA 3U37A 1SDDB 4M4RA 5C70A 2BZDA 2VM9A 4P02B 3W5MA 1GQPA 2QQIA 2VMDA 3I2KA 4W4ZA 5LCWL 4UI9L 4HG6B 2X09A 3CZUA 2J1SA 4QB6A 4ZZ5A 1W9WA 2W46A 1PX3A 2HYXA 2VZPA 4E8DA 3WF2A 2VQTA 1DYOA 2VR4A 1NKGA 3DECA 2Z4FA 3F2ZA 3BGAA 3I3DA 2J7MA 4A4AA 3WQBA 3ETPA 2QQOA 4LKSA 2XHNA 2B4KA 5F7UA 3DYPA 3NQHA 4QB1A 3VD5A 2Y6JA 1W0NA 1H6YA 3K4DA 1JZ3A 2W5FA 3C7FA 2VTFA 4KWUA 4L0PA 1JYWA 2QQKA 2ORXA 2VO5A 3OB8A 4XVHA 4LQRA 2RJ2A 5IFTA 4FI9A 2W92A 1UY1A 3P6BA 1YQ2A 1OD3A 2W3JA 4QPWA 1GUIA 2Y6HA 2WZ8A 1GOGA 1KEXA 2LW8A 3I3BA 4QX1A 2RVAA 3FL7A 1K12A 2WN2A 2DCJA 1CZSA 2WQ8A 3WF3A 2C4XA 1UY2A 3ACFA 3I2IA 5HXMA 3T2QA 1J83A 1EUUA 1XPWA 3A7QA 3T0BA 1UXZA 1W9TA 2WO1A 4CUBA 2WBKA 5EJ1B 5IHRA 4A45A 3HNYM 2L9LA 4ZY9A 5DMYA 3I3EA 3LE0A 1XNAA 3LPGA 2ZEWA 2WAOA 4ET7A 1US2A 1XC6A 2Y8KA 4A6OA 2YFUA 4OYUA 3I97A 2YG0A 3DYOA 3FHAA 1UMHA 3SKJE 4BK5A 5CYYA 3OG2A 3IB3A 4IUGA 1KGYA 5DPNA 1UYYA 2W1QA 5IJRA 3K77A 4A3ZA 3NJVA 1CZVA 1EUTA 1PMJX 1NUKA 1WCQA 4DXTA 1TG7A 2WO3A 2ZEZA 5C71A 2E31A 4JKKA 4UOJA 3THCA 1UY4A 5CZKA 2X05A 3WF0A 1BHGA 2V5DA 4OMCA 1W9SA 1CX1A 4QX3A 3WNKA 1OT5A 1J84A 2WUHA 4XUQA 2DCKA 4Z2AA 1GOFA 3OGVA 5IFPA 4JKMA 3GGLA 1ULOA 5JUVA 3FHQA 5B4NA 2W91A 3UNPA 2W1WA 4BJ0A 4GWIA 2Y64A 4DXSA 2JD9A 3THDA 5J1XA 3HJRA 2BGOA 4A44A 3ABZA 4UAPA 2VOTA 3K4AA 4XUOA 2J1EA 4W8JA 2ZEXA 4CU7A 2VCCA 2JKXA 1JYVA 3DYMA 2YC2A 4QDSA 2VCBA 3K46A 2J1TA 3C7GA 4KI5M 4TTGA 5IYYA 2YB7A 4LPLA 3K4ZA 2VL4A 3EYPA 5EIYB 1JZ4A 4XZUG 1JI6A 5HPOA 3VDBA 3A21A 2OKXA 3SEPA 3VD3A 1UZ0A 3OGRA 4BXSV 3A22A 3T2PA 1D7PM 1T2XA 4AG4A 4QX2A 3P1IA 3ECQA 4ARXA 2VZRA 3WEZA 5JXJA 3VDCA 2W1UA 5A1AA 4DEQA 3A23A 3MUY1 2W94A 3VD4A 1CZTA 1UXXX 1TVGA 2QQJA 3VD9A 4QAWA 3OEBA 5FUIA 4DUVA 3HEIA 3GXUA 3LEGA 3ACGA 2QQMA 1US3A 1IQDC 3PUHA 3MBWA 4ARYA 1L7RA 1R64A 4JHZA 3LQCA 3CKHA 5JXGA 1O8SA 4CU9A 5EJZB 4DEVA 3OGSA 2XONA 4MADA 1K42A 2W95A 4BK4A 1SHWB 4MOAA 3HNBM 4ZZ8A 4CVUA 2WN3A 2J1AA 5DQ0A 3CMGA 3NJXA 1F4HA 1JU3A 2Y6LA 4JX0A 3MUZ1 1UYZA 3OBAA 5I0DA 2Y6KA 2C9KA 2WYSA 2QQLA 2YFZA 1L7QA 2VZQA 2J1RA 1DLCA 2DDUA 2E32A 4P08A 4RN5A 2VMFA 4QB2A 5JXIA 4KMQA 4AAXA 4YPJA 2EIDA 1ULPA 4DXRA 1GMMA 1OF3A 1JYXA 3WNPA 2WDBA 4MO3M 3MV11 2VZOA 4XUNA 3HNMA 1RYYA 2QQNA 3T0DA 4DUXA 4CU8A 2EICA 4MGSA 5C7GA 1GOHA 2VZSA 2JE8A 4OZOA 4OUEA 2VZVA 3CIHA 1DP0A 4TXWA 5B4XA 1JZ6A 3J7HA 4QDRA 1JYNA 3K75B 1MPXA 1K45A 2W87A 3E1F1 3FN9A 5JR2A 2VCAA 3UETA 1OH4A 3HOBA 3WNNA 2EIBA 4MGQA 3SKVA 3C8XA 3JXSA 2YC4A 3VDAA 2ORZA 1JZ7A 1SG3A 2W1SA 4JKLA 4PF1A 2WABA 1JZ8A 3C7OA 4M4PA 4PT6A 2WZEA 1NX9A 5LA1A 3T08A 2HLEA 2VQUA 2J1UA 2V4VA 3LEIA 3WNOA 2E26A 4CU6A 3WNLA 1NAEA 1W8NA 5JMOA 2VJXA 2BERA 4D0QA 2WAAA 3W5NA 4XUTA 4RYDA 3HPNA 3ACHA 1P8JA 3ACIA 1K3IA 3UESA 3C7EA 3T2OA 1JZ5A 3LEKA 3T09A 3VD7A 4PQQA 2R7EB 3IIIA 1UYXA 3NRUA 1HN1A 4W50A 1UY3A 4P5YA 5LA0A 3BN6A 3I2JA 4CUAA 4CUCA 4QDQA 4A42A 3T0AA 3WSOA 3CDZB 3MO4A 1GU3A 2CDOA 2BGPA 2E33A 3PUIA 4P00B 3I2HA 2PQSA
chains in the Genus database with same CATH superfamily
4TLFA 3B9CA 5KBFA 1LNSA 1V6OA 4QX0A 1FYUA 3HQRA 3WW4A 5BNOB 4LO8A 2X53S 2YXSA 1ODNA 3IAQA 4L97A 4Z92B 2VZTA 3FHIB 1EV11 2VUDA 5KR7A 1PX4A 5A6XA 1W6MA 3SMHA 1Z78A 2V09A 5ABJA 1XOYA 2WSVA 1ZRIA 3ITQA 3WINE 1YFUA 2VZ1A 2ZGTA 1LENA 1Q8OA 1VBE1 2YPJA 3NAPC 4NWWA 2VZUA 3VBRB 2JDAA 2Z42A 1GP4A 1WMEA 4PLNA 3ZFFB 3AP5A 3ZM8A 1SPPA 2PHUA 3HN3A 4XUPA 4KQ7A 5L73A 4Q8KA 3KCYA 2QFEA 2RS32 4XFCA 3KGLA 5FPZA 4ZXEA 2ET7A 2PMWB 3A4UA 3M3CA 1QOOA 1XRUA 4QKBA 1UNBA 2G9GA 3OBRA 3LAGA 1RVF2 3Q8FA 2BTVC 5FWEA 1VB2A 1PVC3 1YYNA 2HBUA 3ILFA 4AWDA 3JBG2 1PNFA 1RHI3 2J1VA 2P34A 5GJ6A 3WP5A 5C8CB 3W59A 2VMHA 4FFGA 3CJIA 3SEEA 1DQ4A 2NZ9A 4CYDA 1S0DA 2VNRA 3VHRA 1GP6A 3QOPA 4OI0A 1OFNA 1CIYA 3BALA 4QM8A 4C0BA 2ZX1A 2WS93 4CE8A 5FO9B 2R6QA 3P5BA 2AC1A 1XNBA 2BBAA 2BP6A 3I2GA 4D7TA 4I3GA 1YJKA 1Y9MA 3GF6A 3I2FA 4NIGA 1HXS1 1N47A 2X10A 3NW4A 4P9GA 3VZMA 5FMOL 2LTNA 1OFSA 3J8F2 1HXS2 4I0BA 3C7HA 5EV7A 2VY0A 3U1XA 1QIQA 3FE5A 2ID4A 3ON7A 4D8MA 3EB7A 4P9YA 4CDWC 4JAAA 4P9WA 2VD7A 2V4AA 3LIGA 3H50A 3M70A 5JIUA 1AR61 2G4IA 2EAKA 2LRPA 5C70A 2BZDA 2HWB1 3TAYA 1VLNA 1OLQA 1S0EA 1QJFA 3PIJA 4KNCA 3EBRA 3BPSA 5LB6A 1QJEA 5BNOA 3KF5A 4Y26A 1O5UA 1H1MA 4HG6B 3CZUA 3I2DA 3OYWA 5DAQA 4D69A 1JYIA 5JI7A 2A1XA 5A6QA 2W46A 1OXCA 4CDXB 2QVSB 5HCHA 2RS31 3KD4A 1PX3A 2HYXA 2VZPA 3JQWA 1OA3A 4TYSA 4CDQB 4EZHA 2RR13 3KHCA 3BI3A 3HAGA 3EQEA 4GWMA 2VR4A 3DECA 2W0XA 4RA0A 4WVWA 2E51A 1QXRA 1OOPB 3TRSB 2J7MA 2GNMA 3WQBA 4H7MA 4LOSA 1LKNA 3UT0A 2XHNA 2IXKA 1SCSA 3CF6E 2B4KA 4H7LA 2VQ0A 4CPBD 3TEZA 1O3TA 2FD8A 1VRBA 1J3QA 1W04A 2ADEA 2UWAA 4QB1A 5I93A 4DNYA 3M3IA 5FQ0B 1ZZ8A 4Q29A 3QH6A 4XC9A 2Q1MA 2MEV1 2Y6JA 3LA2A 4LMFA 2CU5A 2NP0A 1H6YA 3DPRA 4ZHNA 3WLUA 3UKVA 1JZ3A 3QH7A 5FP7A 3RQ0A 4FVVA 4Q2FA 4JTNA 4KWUA 2D7FA 5T3NA 4HL0A 1JYWA 1U12A 5K7PA 2X5IA 3MIDA 1OOPC 2QDRA 5CU1A 1RVF3 2H6BA 4LHLA 1CN1A 4N8MA 4XVHA 1UIKA 2GNTA 3QLQA 5FP4A 3VHNA 2RJ2A 2XGXA 1K5MB 4MGYE 3O1MA 3L9JT 4I09A 4Y4RA 1PGL2 4FI9A 2OZJA 2BWCA 3VLBB 3VKMA 3P6BA 4MV2A 1LB2A 4QPWA 2F6BA 3KLSA 5K0UC 4MSVA 2ZGOA 5FZ1A 2ARXA 3UL2A 1KEXA 5IW0A 3VDDA 1VAKA 3CLPA 4MHUA 2RVAA 1BK1A 5SV8A 3FL7A 3ZXGA 3USSA 2P5BA 3IZOA 3WF3A 2WNUC 2R1DA 3OYWB 1X9TA 4OQ9A 1C5HA 4FTBA 3QBQA 2FZ1A 2KXLA 1YI9A 3ACFA 3MW4A 4QX8A 1APNA 1ZBE3 4RS5A 1XPWA 2PHFA 2ZGSA 3A7QA 1W9TA 1AR81 5GZEA 4QM9A 2HWF1 2R32A 4CUBA 3ZYHA 5HCAA 1G8WA 2WBKA 1S0CA 5JOYA 5FZDA 1J3PA 5I0RA 5LATA 3D0SA 2L9LA 2GP5A 4HT1T 4I0AA 3I3EA 4K40A 3RYRA 1XNAA 4Y5SA 1X7NA 1PMIA 4UW3A 1MZ6A 1WCSA 4E9KA 1JBCA 1CJDA 2UU8A 5CADA 2DCYA 5C3PA 5GLWA 5FQ0A 3I97A 3K48A 4UYBA 3KCCA 4ZZ8A 4CA9A 5CG8A 2ZGRA 3ZSJA 4K6BA 4NJ4A 3O1TA 2XJTA 1EAH2 5DPNA 3NAPB 4U36A 3T1MA 1ST8A 3DKWA 3K77A 5IJRA 4A3ZA 4URAA 1RJ8A 1CZVA 2C1FA 2H6CA 1GNZA 1QJX1 2XQRA 4WVZA 1BMV2 1NY72 2JG9B 2XH6A 3KT1A 1RUE1 4XFGA 2C6SA 3O1PA 1C28A 2QUOA 2E31A 5DZGA 1AF9A 1KS5A 2R072 4FAHA 2JDZA 4UOJA 1QEXA 2P37A 3N9NA 3NKGA 4BIFA 4MLOA 2B39A 2P3IA 2CWMA 3ETQA 1Q8VA 5F2WA 2D97A 3DV8A 2DFBA 2X05A 2YY1A 4OLLA 2YBSA 3KQRA 4A2UA 3ZR6A 2D40A 4JQTA 1CX1A 4BLIA 2BDRA 1C1FA 5JMCA 3RS6A 4L11A 4QPGC 2RDRA 3V0AB 2DCKA 3EXUA 3HD8B 4Z2AA 3NKTA 3OGVA 1UF2C 4ISQA 2WA4A 4XZPA 1M06G 1ULOA 4G4FA 1COV2 5ACA3 5JUVA 1T6BX 2XJQA 4QQHA 5FY1A 1WW7A 2ZZJA 3T2TA 4TZDA 2YC0A 3N7LA 4JC1A 4YSFA 2WIIB 5J98B 4AFAA 3UNPA 1GZTA 2A70A 2JE9A 4UW4A 2FDJA 3S7IA 1T6GC 3UJQA 5F9TA 4R9CA 1E5SA 2XVKA 1POV1 2JD9A 5FYHA 4Z8BA 1RMU3 4NRQA 4BYYA 4G3YC 4XXPA 1IGOA 3H3ZA 5A7SA 1HQWA 1X33A 2D3SA 2JECA 2WO7A 3ZXFA 1COV3 2LROA 5DDJ3 3GNEA 3Q8EA 3TN93 3WCRA 5FWJA 1V6MA 2JKXA 1SZBA 5LA9A 4QDSA 3RSJA 4Q26A 1DGLA 2J1TA 1QGLA 4FPCA 2ZKLA 1JXNA 4JDOA 1FXZA 1B35C 2UYAA 4IETA 4XF0A 5FZAA 5JSRA 4BLJA 2BJSA 2WJSA 5K0UB 1RXFA 1V00A 3M3EA 3SC7X 3K4ZA 3WG1A 1LGNA 1GQGA 1RUJ1 1SFNA 1I1EA 3W21A 3WV6A 2G9FA 3ZVXA 2B7YA 1QWRA 5L19A 2MEV3 1H4HA 1W8HA 4N43A 4XBLA 3VDBA 1MS8A 4NE9A 3H1WA 4HZFA 1ZM1A 2FMYA 4LJHA 4O65A 1F31A 2OKXA 1EPWA 1Q3EA 1UZ0A 3VKNA 1S2KA 4JRAA 3S5QA 3IDCB 1FMD3 1QJY3 2OT7A 3T2PA 4QX2A 5JLVA 3PU3A 2AZ5A 2AH2A 2I45A 2EA7A 1O4ZA 1I9RA 3VDCA 1OUXA 4WV8A 4DQAA 3A23A 3KMHA 1UOFA 3MF9A 4DS0A 2VUCA 1WLDA 3RJRA 3S5AA 3V56A 3FBYA 3MPBA 1XJAA 4FP2A 3ST7A 4Q4Y3 5FXWA 5J09A 1PO22 1AR73 3VD9A 4RGKA 3GBGA 4NHKA 1C8M1 4QHZA 2WT1A 4QAWA 5FUIA 3ZDVA 3LEGA 4F3JA 4DUVA 1AL0G 1QQP3 1UPIA 1V9U1 2GDFA 1VPHA 2GU9A 4XPVA 2QQMA 5JZGC 2QZ2A 5EP9A 1US3A 2RMU2 1EAH1 4JGZC 3JCIA 4IEWA 3T1LA 4YM0A 3H1YA 4GJYA 4YW2A 3ZYJB 1WLCA 4S2DA 1R081 2CHHA 4PJYA 3BPZA 1RUH1 3SXWA 5JXGA 5FYSA 3SH4A 1LESA 4XJWA 2XWBB 4BXFA 4JDNA 1HRV1 2XONA 4IV3C 3D5OA 5FBZA 4CEWB 5I0TA 2W08A 4W6XA 3OPWA 3IN9A 1ZZCA 2ZZQA 5E8AA 4HMZA 3HNBM 3LKJA 1IS5A 2WN3A 4U2AA 1DHKB 4Y1YA 5BNNC 1QJX2 3NJXA 3AK0A 2PTMA 1DQ2A 1H8TA 1ZNPA 4K7JA 4N7UA 2XUEA 2ZS6B 4IL7A 5DAWA 1NCRB 5FMCA 2ZX2A 4ZKTB 4AVSA 3ROUA 3OBAA 4H14A 2C9KA 1GLHA 1MEC1 4CDXC 4DIQA 3MIEA 4W65A 3MEPA 2RS12 3SITA 3U78A 4Q0PA 3OOXA 1DBNA 2R30A 4HSLA 3AJYA 4XFHA 1BK0A 1VMJA 1L3JA 4DRVA 4NIAA 3JBG3 4H3WA 2BUKA 2E32A 1B09A 3A0NA 2XJPA 4RN5A 3AL6A 4WM8C 4Q0SA 1AX0A 4YGDA 4YPJA 3VBUC 5FZKA 3DCQA 4PCRA 4E4ZA 5F5QA 2VTXA 1V9U2 4KBBA 4BQ5A 2CNAA 4N7IA 4YARA 1GR3A 3BB6A 2RS13 1RYYA 3AMPA 1VRH3 2BV4A 3VDDB 4D7SA 3LFMA 4XQ4A 5GZDA 1OSGA 4RHV1 4HK8A 3ZFGA 1AYM1 3J8F3 1TME2 3WXPA 2VZVA 2Y0IA 4LIUA 4XHBA 3CHXA 4YGCA 5BNNB 3S0MA 1VIWB 2E7AA 4RS5B 3WX5A 2HH9A 2OXBA 3POGA 1YFYA 1D4M1 2EXIA 2W87A 2GNBA 3NNJA 5BPXA 4QT6A 4EN6B 5CG9A 2W39A 1HIXA 1W6OA 4XCAA 3NSTA 3IPVB 3OD0A 1BLZA 3OGJA 2HWE2 4TLGA 5FY9A 3WNNA 3VDAA 2GH2A 1RMU1 1S2BA 3POYA 3GJBA 4QXHA 1RUI1 4YNIA 2W1SA 4FPEA 2WABA 5F32A 3IDEA 3I59B 1H8TB 3POFA 2GC1A 4EE2A 3ZXLA 1ZBE1 2WZEA 3VBFC 5JSPA 1UN1A 2GC0A 4FOYA 2W52A 5F6LB 5JIAA 4DY5A 3MPPG 4ZU7A 3MW2A 4AQTA 4AEMA 2YU2A 4YG3A 5LA1A 3ZFEC 1G9BA 1YEWA 1HB3A 2VCMA 4XE9A 5A3WA 2FCTA 4AEJA 1RUF1 3VHOA 4YVWA 2A6VA 1SEFA 3BYWA 4MHRA 4AEDB 1PGW1 1RUJ3 1WW5A 2B42B 4FPHA 5EJ3A 2J42A 4KG0A 3WNLA 3INAA 3H7JA 1NAEA 1W8NA 2WR9A 4AI9A 3FFZA 5JMOA 2VVDA 4YFWA 5A7WB 3J7NA 1MS5A 4D0QA 1RXGA 2XJRA 3TNPB 2ZGMA 1O6UA 2IFWA 2ZOEB 1H2MA 1URXA 4N53B 4ZPIA 3LOIA 3ZN4A 5M0TA 4G9SB 3VBHB 1K3IA 3N9OA 2YUEA 1OLMA 3AVSA 3T2OA 1X82A 3UGHA 3VD7A 1AR91 3E6CC 4GALA 5IT6A 3B02A 1JUHA 3NNMA 1R1A2 3NRUA 1FOD3 1ZBA1 5LBCA 1J1TA 1OQDA 1XQNA 1TMF1 1W6QB 2G9ZA 1VBB1 4AEDC 2E63A 2ZMLA 2WKKA 3BN6A 3HMYA 3I2JA 1F35A 4CUAA 1V6IA 4Q0UA 4CUCA 1RHI1 2PYTA 3AXDA 2D3RA 3T3YA 5DXDA 1TE1B 2PAMA 3MO4A 1GZWA 2ZA9A 1O3RA 1LOGA 5BNPA 1AZDA 4K1ZA 4BQ2A 1J3RA 3AYEA 2O1QA 5DZEA 4OI2A 2CDOA 2ILMA 2BGPA 3PUIA 2XVGA 1UOBA 1G6NA 1KITA 2ZTNA 3A0KA 1UWWA 2ZX0A 1HDKA 5A80A 2RMU1 3AZWA 4GZ9A 3MHZA 4XBQA 5FZ8A 3AMQA 3OY8B 1SQ4A 2VOVA 3O14A 4LT5A 4CEYC 5FR3A 3I3MA 3ES4A 5DUXA 4CTEA 1U5IA 5T5JA 3PVBB 3MV01 4SLIA 5APAA 4DINB 5C9AC 4CZSA 3I2OA 4LBMA 5A3PA 3IDAA 3B69A 4OHZA 1O59A 2XL9A 5J48A 2QTWB 3PURA 1H8VA 4XJ9A 3I8TA 4IGOA 3OUHA 2ARCA 1ND3C 2KD7A 1E5HA 3O1OA 2WNOA 3AZXA 5A1FA 1FNYA 2D6KA 3NNGA 4LOTA 2B45X 2ARAA 5L7OA 2VOWA 3JBG1 4IDZA 3E5XA 5LBEA 5I8TA 1MACA 1C8M2 2A6XA 2QBXA 2BVBA 4C91A 2P3KA 1GZ9A 4XFFA 3THTA 1Q8SA 1WKYA 1ND2C 3NWKA 1SMVA 1YXWA 2W47A 2ZHMA 3GDBA 2ZHNA 3WF4A 4QQLA 4URTA 2WO2A 3RMXA 4LHSA 4C1WA 4NIDA 4PLMA 5F6KA 1DG6A 1OPMA 2UY8A 5EZWA 3LPFA 4D6RA 1JYCA 5E6HA 4LBLA 1YNAA 4GMP1 1W6QA 4IEUA 4BDVB 1MZ5A 3BOPA 3ZN6A 3FLRA 2CDPA 2JDPA 1SBFA 3WQ1A 4ZU5A 3NV4A 4YW6A 4MH0E 4MXWB 1U5ZA 2BOIA 3UK9A 1D4M3 1S0BA 5KC6A 1JN2P 3LWCA 3OEAA 1U0AA 1PIV2 2JIJA 4JGYC 3U37A 1SDDB 1XU2A 4PDWC 1Q5OA 1W2UA 2JG8B 2YHJA 1FX5A 1BEV1 3AYCA 5FK8A 1WA4A 4Y20A 1QY4A 1GQPA 2VMDA 1RL3A 2E53A 4OI1A 4KWLA 3ZXJA 5F1RA 2DVBA 4UI9L 2BPA2 4KL1A 4QU2A 2X09A 5FK7A 2AACA 5HXVA 4ZZ5A 2R061 5E89A 4CDQC 1DU3D 4J6GA 4FQ4A 3P3NA 4LA2A 2XJUA 5H9QA 1MVQA 5F39A 3VKOA 4CCDA 4FT8A 4P5HA 4KWKA 3BGAA 5KXCA 1W03A 2HWD3 3I3DA 4Q27A 4XQDA 2JDHA 3I49A 1SFYA 3H8XA 3AP6A 4A4AA 4JRLA 4LKSA 1UOJA 1ULDA 5L7OB 2IVJA 5FZ0A 1NA1B 4HK9A 2XJSA 3E5QA 3NQHA 3IKWA 4PIXA 2PAEA 4IGQA 3VD5A 4DB5A 5KHGA 2EALA 2GZWA 1MEC2 3B7MA 1DIWA 3ILRA 4L2NA 4ZS2A 3H3LA 2RS53 4E2SA 4IEXA 3PMSA 2ZBJA 4LLFA 1NCRC 3ZFGB 5JOZA 3K4DA 4LO5B 4NO4A 2FCUA 1OLRA 2W5FA 4AFBA 1UL9A 5BNNA 2VUJA 4FPFA 5DG2A 3LEMA 4LKFA 4YZ4A 1W3VA 4CP9A 3V65A 5C9AB 2QQKA 4YVSB 3CL1A 2VQAA 4RR3B 4Y33A 1F8VA 3PUQA 1S0JA 2VO5A 3O12A 3OB8A 4IQPA 1SACA 2D98A 4QXCA 2RG4A 5IFTA 4HN0A 3KZ4C 2A3WA 2DYCA 4ES8A 1R1A1 1OKOA 4M0HA 1TMF3 1UY1A 3B5LB 4YM1A 4DFSA 1YQ2A 4UW5A 1QJU2 3E97A 4K8FA 4PBOA 1IG3A 1TZOA 5HBAA 5HV4A 3IM0A 2K2SA 3I59A 2Y6HA 4BWOA 1GOGA 4Y20B 5A7OA 1RUNA 5AC91 1QDCA 4BZ4A 3BU7A 4AAPA 3I3QA 3NNFA 4BQYA 1E5IA 5DDJ2 5KHKA 2WA3A 1K12A 4LKEA 2DCJA 2QJVA 5B2GB 2WQ8A 2WT2A 1X8EA 3HT2A 2YGLA 4YM2A 3ZXDA 1VBD1 3WG2A 5IVFA 4CXYA 2PN5A 5FZCA 5CFCA 1VMHA 1N1SA 1EUUA 1N1TA 1SLCA 4XMIA 1Z7S2 4I3PA 4L9BA 5CISA 2HWC2 4QGLA 5D21A 4NPMA 4MYEA 1XE7A 2NYYA 4UXAA 3KM5A 1PZ7A 1Y3TA 4NHMA 1HKDA 1RUI2 1RUF2 3ES1A 2EXKA 3HNYM 4ZY9A 2VW0A 4V2WA 5DUVA 1IKPA 1SBDA 5EWSA 4XABA 2AR6A 1REFA 3H7YA 3LE0A 2ZEWA 3OJBA 2WAOA 4QHBA 5E88A 3D8CA 1US2A 4JDMA 2DVGA 4I2OA 2Z5WA 4M01A 1Z0HA 5FZEA 2YG0A 4YZ1A 1GV9A 4EN8B 1HN0A 3AVRA 3G7DA 4IUGA 5FDBA 1PM7A 4XFBA 1PGW2 4XACA 4K1YA 2XLFA 3NJVA 4OQ8A 1PGL1 1OVSA 1S0GA 3N9QA 1AR72 1PMJX 3FLTA 2EIGA 4IV1C 1WCQA 4Q4X2 4RR3A 3RYKA 3VHPA 1CAWA 4DXTA 1TG7A 4KGGA 4FPKA 1FAYA 1VAVA 3OUJA 1YUDA 1MR5A 1TME3 4YVWC 1YJLA 3H8UA 1BCXA 1H0BA 4OULA 2WNVC 1IPSA 2DTWA 4KGQA 3WF0A 4Z2WA 5A32B 5D8AA 5F37A 2BVVA 5I8YA 5LZ6A 4OMCA 1W9SA 5CKNA 2ENRA 3WNKA 1OT5A 4XJ8A 4FOWA 4MUVA 1RMU2 2NMNA 1GOFA 4TSVA 1CAVA 1IS4A 4JKMA 4HFSA 5IFPA 4QKNA 4INDA 1DQ1A 2RS11 4XXAA 2R073 1TQ5A 4S2FA 2FHRA 3AXEA 1VBB3 3FHQA 2F4LA 4MGZE 3WHTA 3KF3A 1W28A 4Z07A 5B4NA 2AREA 1WZXA 3LZZA 4Y1UA 1VR3A 4CCEA 3J4UH 1D0HA 5FYMA 4OFGA 3AFGA 5F3GA 4M3CB 4X6QB 4YW1A 3URFA 3W58A 4CXWA 4QKFA 3THDA 1ALYA 3HT1A 4A44A 4AVAA 3KT7A 4B8EA 4BQ4A 1OQEA 1LOCA 4XUOA 1UIJA 1BKZA 1QMJA 5CKMA 3WP4A 4GIQA 2JDUA 3ENRA 4RHV2 2WRAA 4B7KA 1ZRCA 2BW8A 5FOBB 3HIFA 1NLSA 5L9RA 2XMLA 2QQWA 3ZYRA 1RUE3 3VGIA 2VE1A 4R4XA 1UZVA 1QU0A 2VCBA 2P3JA 2VXJA 1OQ1A 3C7GA 4J25A 2FDKA 3ZDSA 3S7EA 4J1XA 3WNXA 3ZX7A 5FJKA 4AOCA 3VBFB 1XYOA 2YB7A 3UKTA 1Y7BA 1CVNA 4HXCA 4CUGA 2JE7A 3AKQA 4BCUA 1FATA 4Q4V1 5EIYB 1JZ4A 1AHSA 1NLRA 3KVAA 3L2YA 4FSJA 4CPBA 4LEJA 1K5MC 5HPOA 5CA6A 4YW3A 4HPKA 5FY4A 5I8SA 3VD3A 2WLQA 5FZ3A 3VBRA 2IC1A 4SBVA 4BXSV 5ACA1 3MZHA 4PIYA 4MXWA 1T2XA 4OUMA 5FPVA 4YZ2A 5FRAA 4P9XA 1HB1A 2IVIB 3ECQA 2VZRA 3MIGA 1X9PA 1GKBA 3RZGA 2VBPA 1UW8A 3N35A 3S30A 5LWBA 2W1UA 1DYKA 4YZ3A 3APBA 5A1AA 5A3OA 3JD72 1ND3A 2JG8A 5C3OA 2SLIA 3IWZA 3FJSA 2DVAA 4AFMA 4QWNA 1PK6B 5C8CA 4AZZA 2QQVA 3V0BB 4A7YA 5GALA 1UXXX 2PA7A 3CJIB 3G6JB 4PIZA 3OEBA 2Q5TA 3HEIA 5IVYA 4XW3A 3GXUA 4COYA 2DVDA 5JR7B 4GMP3 5IUQA 4E4SA 2RHPA 1OBNA 3ACGA 5J36A 1CONA 3UGGA 2RDSA 1IQDC 1BZWA 3PUHA 3MBWA 4ARYA 1OC1A 1L7RA 1OH3A 2WWUA 1O5LA 5IWFA 1R64A 4JHZA 1CPNA 1ZRDA 3VBOC 1H1AA 3MDPA 2XG3A 3CKHA 3NV1A 4ITCA 1DZTA 4Q4Y2 4CU9A 5EJZB 1OA4A 4XF4A 1AL22 2ZCWA 3PLQA 2GN7A 3OGSA 3RZHA 1LECA 1VBA2 3AM2A 4MGIE 5C8WA 5JCTA 1HX6A 4IV3B 1SHWB 4BMEA 4EYUA 2Q8EA 3R6SA 4HANA 1BQPA 3U07A 4KH9A 5K9YA 4QU1A 3H1MA 3ZN5A 2Y38A 1H2LA 2JDMA 3VBSA 3KV4A 3NJZA 3JUUA 1YWKA 3TB0A 4CEYB 1JU3A 1N3QA 2WZR3 4QGNA 2WQ4A 4BQWA 4E2QA 3MLKA 3TBDA 2YU1A 3MUZ1 4AI8A 3PDQA 2ZAHA 5I0DA 4ONUA 3WW2A 4AW7A 2Q0AA 3W5MA 2OYZA 2QQLA 2XXZA 1PM4A 2WWJA 2A7AA 4LULA 1L7QA 1W39A 4NRPA 4YGBA 1PVXA 1VRH2 2XWJB 3AP7A 1AR71 4LE3A 4YVSA 5FZBA 4RQPA 1DLCA 4AQ6A 1PVC1 2MPFA 2VMFA 2ZKNA 3T30A 2Y0OA 1NQJA 1HRI2 5FPXA 5JXIA 1EAH3 4FFHA 4M3CF 2YROA 4R4ZA 1NYWA 2EIDA 2RS51 3JZVA 2AENA 1G7YA 1UPSA 1V6JA 1GMMA 3MGUA 2WDBA 4LHNA 4MO3M 2WL1A 4R8HA 4XUNA 3HNMA 3L2HA 5GZCA 1YC61 2QQNA 3DUIA 4UT5A 1YFXA 4DUXA 4CU8A 2CTVA 5C7GA 3BIEA 5FY8A 5HCBA 2LUWA 5BYNA 3HQUA 3CIHA 4WM7B 1DP0A 3GHMA 2R1BA 2PHLA 4LORA 1N1VA 3WHUA 5L9VA 3J7HA 3RDIA 4QDRA 5FYZA 4AL9A 3VUOA 3BODA 1J59A 3MLJA 1PIV3 1W3XA 3WVJA 1ZRFA 1W9FA 4XOGA 3K2OA 3DXUA 4IEVA 1YQCA 2C9AA 4YG0A 4PHZA 3ZXKA 4FTSA 1V6KA 5JR2A 3CBNA 3ASIA 4AK3A 3OF1A 5IK5A 2DWRA 3UETA 1O7FA 1MEC3 1M4WA 3VZJA 3ZR5A 1WCKA 1IS6A 2IXLA 3C8XA 5FFOC 2VULA 2YC4A 3JXSA 5HCFA 1XE0A 4HKOA 5FLHA 3ZKUA 1JZ7A 1GNHA 4QQOA 1UU4A 4ZONA 1DCSA 3AMNA 3JD71 5FZOB 2BOJA 1LHUA 2VBDA 4HOOA 2PHXA 4CCKA 4AHWA 2HWF2 3C2UA 3POEA 4UFKA 3PMEA 2ES3A 4CCCA 1S0FA 3PVOA 4GD4A 1VB4A 1Y4WA 1PO11 2OS2A 1VALA 2HWD2 1V70A 1H9WA 4BE3A 2RM23 3CJIC 3PUAA 3U4SA 1RUE2 5F8PA 4IXLA 4CP2A 3B00A 5FMBA 1TNFA 1UQXA 3U75A 3U0ZA 5JWPA 3AP9A 1CAWB 4TWTA 4RQPB 3HN1A 1IG0A 4CDWB 5JDBA 4UFLA 3LEIA 1A6CA 2E26A 2KA3A 2VAUA 1XXNA 5FPLA 4LA3A 3U10A 4CU6A 1JMUB 4B4RA 2XLGA 4ZU4A 3NO8A 4NIIA 1REDA 3OTFA 3W5NA 3OCPA 1V6NA 2RM22 2TEPA 2H0BA 4BIOA 4ISRA 3WDTA 3Q9OA 2HWE1 3KSCA 3KVBA 4M00A 4XCBA 3ZIXA 3ZSEA 5CBLA 1YHFA 4OHYA 2PELA 3KT4A 1WBFA 3W20A 1ZRRA 1QJZA 1Y9GA 3C7EA 4NMIA 5FKCA 1BBT2 1OMIA 2GMMA 3T09A 1W2TA 1WMDA 1O3SA 2R7EB 4K9SA 2Z69A 1R083 3WDXA 3ZFFC 5FO7B 1RUI3 3KS7A 1OPOA 1RUH3 3E6DA 4LBOA 2GMPA 3RYPA 4W50A 5FREA 4QGMA 2VUAA 3ATGA 4CDUB 4GAZA 5IVJA 1E57A 2ZAAA 2CWSA 4C1XA 1LOEA 4A42A 3T0AA 3AKRA 5FZHA 3PIGA 4IV1A 2D3PA 2Y26A 4HVRA 2HJIA 3VKLA 1XSRA 5T5PA 2UYBA 1X50A 3ZXEA 3WT3A 1R1A3 2E33A 2CGOA 3MYXA 5CIRA 3I2HA 5FYCA 4DXZA 1ULGA 4RSUA 2CY6A 2ZHLA 1NLQA 3V0AA 4NPLA 2V72A 3ZYIB 4A3XA 1W2OA 4XQWA 1POQA 1VBA3 2HEVF 4DO0A 3SCGA 4RL7A 5AC93 5JZGA 4CRQA 4GKXA 2BBVA 2J22A 3M2MA 5A3LA 3MFCA 1AJKA 4F83A 4QD2A 4CDXA 4UFHA 4UFIA 4YWAA 4NHLA 2A6ZA 4HPKB 5IVBA 2RE9A 4MGKE 3Q8CA 2WFF1 1IKQA 5KXBA 4ORFA 5GZFA 2VC9A 1RUOA 5T5LA 2DTYA 2NN8A 3IDBB 1Z7S1 2D93A 4BA6A 5H9SA 1OOPA 4B3NA 4NHYA 3VBOB 5G05L 1JU4A 4DUWA 3WZ1A 3TYJA 1O8PA 4GWJA 2VZ3A 1W8FA 2C26A 1FMD1 1NA1C 1QJY1 2SBAA 4NPRA 3TEWA 1DQ5A 2R063 2B9VA 1GNYA 3J8F1 1S1AA 1UMZA 1R1ZA 2EXHA 4K3UA 5T50A 3O1VA 1JHJA 1W8OA 1UMIA 2E9QA 2W9XA 4UF0A 1TMF2 2Y6GA 2YBPA 3GCXA 1ZZBA 2HWB2 2WT0A 1DYPA 2CSGA 1ND2B 3GZTB 3R05A 5K0UA 4DMIA 1OVPA 4CP0A 3OPTA 3DEMA 5FO8B 5C5TA 2HEWF 2EIEA 2D6MA 3HBKA 1KXGA 3GM8A 4O61A 1QQP1 4BM8A 5JXHA 3PUSA 1R093 4FO9A 4A41A 1I5PA 1GQHA 1SLBA 4IE7A 4EN7B 1XNTA 1HB2A 1BMV1 1C4RA 3LSDA 3AC0A 1MS3A 1K5MA 3H42B 3KQ4B 4M3CE 4IV3A 4OHWA 5FZGA 1F9KA 4IV1B 3RJ2X 3R4DB 3UJOA 2CGNA 5DN2A 4YGEA 1WLWA 4COZA 3K3OA 4A7KA 4PDWB 2LALA 1W6NB 4R9AA 4JGYB 4M4RA 2B9UA 3I54A 3ZPOA 4EWAA 2VM9A 4RFT0 5EQUA 3DL3A 5FLIA 1GWMA 1W2NA 1YQ6A 2ZPXA 2D5HA 4IESA 4IE0A 4P02B 2QQIA 1H8TC 2TNFA 1FPN1 1W0PA 4W4ZA 4XAAA 5EPAA 5FPAA 5JOXA 1ASJ2 2JG8C 2PFWA 3PL0A 5DG1A 2ADDA 2XJVA 2J1SA 1UU5A 3IT8A 5FJHA 2UY9A 3M1HA 4QB6A 1W9WA 1JYTA 4BPZA 1AYN2 2JEMA 1MS9A 2B46X 1NE6A 3WF2A 3P3PA 2VNVA 4LIVA 2W68A 2Z4FA 3F2ZA 3WUDA 4EQVA 2XVLA 2QQPA 4PQ9A 5A6YA 2F17A 2GC2A 3FUQA 2ZJCA 3VBOA 2QQOA 4R52A 5JAXA 2VMIA 4QPGB 4WZFA 5F7UA 1VBD3 3DYPA 1AX1A 4H55A 5IK4A 2ZGKA 3IMNA 3ZLIA 3V64A 5IATA 1AXZA 4COWA 4F8AA 1CIWA 2FCVA 2OPWA 1WWYA 5E16A 1BEV2 4CCJA 4AGGA 2WQZC 3EO6A 1RUD2 1RC6A 2I2SA 3EHKA 1ENRA 1DGWX 2VTFA 3AMHA 3NAPA 1AXYA 4XF3A 1VMFA 5LY2A 3OBZA 1SFPA 3FC0A 5I0UA 3SHRA 5JSOA 3V0BA 5K4LA 4LK6A 1YQ5A 5T55A 3THPA 5EYYA 5ANNA 3BU0A 4EN0A 2YYOA 3MFAA 4M0NA 1RJ7A 5A7PA 1EV12 4ZS3A 5FP3A 5FCCA 1VBC1 4YVSC 2VW2A 4B1LA 2W92A 1ZBE2 2JD4A 4RQPC 3S6PA 2TBVA 3Q8BA 4ASKA 1HLCA 1HV0A 2RMU3 2W3JA 4AHZA 3RWNA 3DN7A 1F5FA 4Z82A 3SQOA 1GUIA 3GBWA 1WCDJ 2IXHA 2PHRA 2LW8A 4IERA 2FQPA 3J7MA 4QX1A 5IK8A 5DUUA 4K21A 2WN2A 3LCPA 1R092 1CZSA 1WD3A 2XB6C 3ZPYA 1MS1A 1LOAA 1XNCA 4GB32 1B35A 4E27A 1HRV3 3T2QA 2Q1FA 1J83A 1FI2A 3PNAA 5T5OA 3ZFEA 4E2GA 2V73A 4K8RB 3T0BA 3TWIA 1D4M2 1UXZA 2A73B 5JOWA 2VVFA 4YW7A 5FYTA 1YI7A 2BNOA 5FZ9A 3SISA 4CDWA 2ZGQA 2JB4A 5IHRA 2QCSB 1JH5A 1A34A 4QX7A 1GZCA 4A45A 5A3UA 1FOD2 2X29A 3CJXA 4GMP0 5H9RA 1D2QA 4B7EA 4KBZA 5DMYA 4NAOA 1O4TA 3LA3A 1RUG2 1RUC3 4ET7A 5KXEA 1HQLA 5FMOS 1HRV2 1XC6A 2C0ZA 1QNYA 2Y8KA 4AQSA 1SLIA 1UOGA 2YFUA 1Z7S3 5C3SA 3ZO0B 2W2IA 2RM21 3DXTA 5FUNA 3DYOA 4HVQA 4ATEA 1AR82 2DVFA 4XFIA 5J37A 5GKAC 5GLUA 2YPDA 5F5AA 3OG2A 4PI0A 2WZR1 3IB3A 1VE0A 2JJ6A 4YRDA 2W1QA 4LNVA 5GLVA 5FY0A 3WP3A 1PZ8A 1S0IA 2WLPA 1QNWA 3ZYBA 1EUTA 1BVP1 1MZEA 1DLLA 4N43B 4XDPA 5C3RA 1AR93 2JDYA 1RHI2 4GKYA 1AYN1 1NUKA 4JVAA 2Y6FA 4WVVA 5FZMA 1DGRA 3PHMA 4AEDA 5J7MA 2DBNA 2OW4A 4FPJA 3GALA 5FZFA 2RS52 3EMRA 3THCA 1UY4A 1BEV3 2Y60A 4TN7A 3ORJA 4QXKA 2NM1A 1ENQA 2IXIA 2XDVA 4AI2A 3OUIA 1UZZA 2ZABA 3O1SA 3PTYA 2ZGPA 1J84A 2WUHA 1AR62 2WSUA 3FZ3A 1W05A 2DCTA 4X8PA 2OX0A 1JODA 2AEYA 3GGLA 3EJKA 3KWVA 2DCZA 5FTTC 4AI3A 1U5XA 3MW3A 3NNLA 2K46A 4AYUA 4EN9B 4FPLA 1G9DA 4XFAA 2DUPA 1SDWA 1B35B 1LOFC 2X5IC 5A7NA 1RUJ2 2UWCA 4EJRA 1W6MB 2D6PA 1KS4A 2W91A 1WW6A 4AGVA 1KDMA 3LDBA 1OURA 2W1WA 2G19A 1Q8PA 4GWIA 3D0JA 5F5IA 1S2EA 3WW3A 2Y64A 4KU8A 5J1XA 1VJ2A 3ZFFA 3HJRA 2BGOA 3ABZA 3J9SA 2VOTA 2A6YA 1X8MA 2ATFA 2CAUA 1MS4A 4CEWA 3MIHA 1A8MA 3ACLA 1GP5A 2J1EA 3VBHC 2OA2A 2VCCA 5FXZA 1TEIA 3AMMA 4COUA 3KV6A 4EV0A 1BBT3 1VBA1 3RFRA 3F95A 3DYMA 4LKDA 3K46A 3WOGA 5KWRA 1CAXA 5JZGB 2ZGUA 4QHOA 3WP6A 3N4MA 1AXKA 4PLOA 4UF0B 3M4FA 2XBO3 4KI5M 5FZ4A 1NCRA 2FZ2A 4B1MA 2PLV1 1ND2A 1XYPA 2HWC3 4LPLA 5A3NA 1FT9A 2VL4A 1QOSA 1EPZA 1S55A 3AKTA 4OCTA 3AKSA 3B01A 5CKQA 1VBD2 5EHDA 4YLZA 2KM2A 1REEA 4Q8LA 1ZZ7A 2CYFA 3RNSA 1LJ7A 3RI9A 4IEQA 4O7XA 1XU1A 3ILNA 4IEPA 4LBQD 4UW6A 3OGRA 5HV0A 2WC2A 4BISA 3BTXA 1D7PM 1DGWA 2RJKA 2UWBA 5K8SA 2FBEA 5C6CA 1YIPA 1I5ZA 1BXHA 5JXJA 3ZYGA 3O1RA 4IEOA 3DGTA 4QPIA 2QDNA 1WA6X 4DEQA 1EP0A 4JGYA 1JS9A 3VZOA 3VD4A 2OUHA 3AZZA 1NQDA 4W6YA 3BTYA 2Q30A 2XLAA 1N3PA 2DU0A 1VBC3 5LK5A 5GZGA 1ZX5A 4Y1VA 2OVUA 1IS3A 1TNRA 1TVGA 3UKNA 4B4PA 1ENSA 4S2HA 4Z1VA 2WINB 1ENXA 1KFXL 4IEYA 5CFDC 3FMGA 4HN1A 4RFRB 5FPUA 1WBLA 2K9ZA 4FPGA 2AYHA 4CDQA 1YLLA 1XNKA 5C3QA 1RUD3 1O8SA 1W6OB 1ZZ6A 4UFMA 2OPKA 1AR63 4DEVA 3PU8A 4V1PA 4WVMA 4YW5A 2JENA 4MADA 3ZSMA 4BK4A 4GH4C 2EF6A 4I30A 4N9IA 2DUQA 4XTMA 4QPGA 4XAEA 2BEOA 5DABA 5LRRA 5F3CA 4Q4V2 4CVUA 2HWD1 2IZWA 3MLLA 1CAXB 1ZBA2 4P9LA 3M8LA 1LULA 1YRZA 1IHMA 4FOVA 4AHXA 1RINA 5BNOC 3DPRB 3PVNA 4JX0A 2P6HA 4ASLA 4CSWA 3CNAA 3WUCA 1UYZA 3N9PA 1N3OA 5FP9A 1QXPA 4LO6B 5CNAA 2WYSA 5FZIA 3OGGA 5ABJC 1NY71 1KFUL 1QDOA 3K51A 2VZQA 2J1RA 3WY6A 1W8WA 2JX9A 2X5IB 4CCLA 5FYUA 4GB33 2PHWA 1GWKA 1R082 2TUNA 4P08A 2WZR2 4LK7A 1DDLA 4QB2A 1PO12 2XR4A 4KMQA 1PNGA 5A7WA 3O0WA 4Q4W2 3WQ7A 2WNVA 5FIXA 4QPIB 1QOTA 4D94A 5D8AC 2E7TA 4UBHA 1ULPA 4DXRA 1AR92 1JYXA 3WNPA 4FOQA 4S2GA 2HBTA 1CD3G 1ONAA 5FY7A 5A33A 4MGSA 3DPRC 1GOHA 2JE8A 3VV1A 2WZPP 4OUEA 2AUYA 1W90A 4XJAA 1H30A 3BIWE 3ZMOA 4ES9A 1NCQC 4YM3A 4TXWA 2DV9A 1FV3A 2OIIA 1JZ6A 2FDFA 5DAXA 2RJLA 2QZ3A 1UX6A 4NUBA 3ZFEB 5AFBA 4NVPA 3GBFA 1JYNA 3N3HA 3K75B 1OI6A 4HLTA 1K45A 4AEKA 5FYBA 4E4DX 1N1YA 4WM8B 2YV8A 2VU9A 1YFWA 1H9PA 4KG8A 3ZMNA 5D2AA 5AVPA 1GYKA 4WVMB 1S4CA 1OA2A 1R091 4BQ1A 1OH4A 1XSQA 3HOBA 1ZYBA 4MGQA 3RZLA 3SKVA 3N9LA 1BVVA 1RGSA 4FAGA 2PAKA 2YBKA 1G86A 2ORZA 2PXJA 3O0VA 1SG3A 1UZWA 3IMMA 4JKLA 4PF1A 3RMYA 5LBBA 5LK7B 5BXXA 2ZGNA 2VOXA 1NX9A 4JTOA 5GLTA 2PQQA 3WDVA 1BBT1 2DUOA 2WFPA 3O5SA 2XKOA 5IAVA 1ULFA 4NWVA 1HB4A 1PVC2 2BFUL 3FLPA 2RDNA 5FPBA 3WD5A 4RS5C 3MI8A 1CPMA 1LAJA 3KGZA 1UKRA 1DQ0A 3LF7A 4Q1RA 4YZ5A 4GWNA 1DFQA 3O1UA 2J1UA 2JG9A 4I01A 2ZX3A 4UBGA 3VKFC 4LLOA 1RUC1 1C3HA 3POJA 3WNOA 5FLJA 2B8MA 3GCWA 4BOWA 1F5JA 1FV2A 2QKDA 1PK6C 1UD1A 2LM3A 2WNVB 5LASA 3VB9A 2MEV2 3RGBA 3ZSKA 4RYDA 1LTEA 3H8OA 1NZCA 3RI8A 1LEDA 4FPYA 5HI0A 3O0XA 3ACHA 1P8JA 2D6LX 4DZGA 5A33B 5C8CC 5FKBA 1QKQA 4GULA 3LEKA 1G9FA 4XYXA 4XF9A 4CDUC 4LHKA 2PHDA 3VZNA 2YDEA 1JUIA 1WLTA 1WGPA 3FUOA 3IIIA 3WG4A 1UO9A 3JD73 1H4GA 1ZZ9A 2Y34A 1MQTC 2XBO2 3GZEA 1UY3A 2ZGLA 4P5YA 2D6NA 2BWAA 2R071 4Q4W3 1FNZA 4WM8A 2P2KA 5LA0A 4AGRA 1V9U3 1LOBA 5SV5A 3VBUA 1OLME 3IPVA 1QH6A 1A78A 4QDQA 2DURA 1LGBA 3VZKA 2C24A 4QXBA 1RVF1 3CDZB 3WSOA 5FXXA 1KQRA 4UFJA 2EXJA 1W6PA 4JHTA 4RD7A 5ANQA 4Q0VA 3RZZA 4BH9A 2A71A 1JOPA 2FDHA 2BNNA 1CQ9A 3QD6A 4P00B 2VECA 2PQSA 3M3OA 1QJU1 3HR9A 4FXGB 3H8RA 4P9JA 4QX5A 1CGPA 2ZXQA 5LBFA 2R0FA 3JQXA 2XKPA 3HWJA 2WNUA 4LE4A 4Q4X3 2OUJA 5LA2A 4AFCA 4CXXA 3QACA 1OF4A 1U5YA 2HWE3 2MNGA 5A3TA 4Y22B 1F4AA 3IAPA 1F15A 3Q8AA 3WNMA 1PO23 3CQOA 3CZJA 1PMHX 3U14A 3LDRA 5TSWA 1C1LA 2DU1A 4P14A 4YVWB 4J1WA 2ZEYA 1LOFA 2HWB3 1VP6A 5DQ0A 5LEJA 4JV4A 2YMZA 1LU1A 2XOMA 1AR83 1MQTB 1UX7A 3BOWA 1JZ2A 1HRI1 2HWF3 2VMEA 1XE8A 3D3AA 3FBMA 1UAIA 4OMDA 5FYYA 2R49A 4C8DA 4AF9A 4AVVA 1ZA7A 2VG9A 4GB31 1NXD1 2YZ4A 3WDYA 3WF1A 5JPMB 4N53A 3VBHA 2O8QA 2P1BA 4XJUA 1GBGA 4YFZA 1RUG1 4XTPA 3CEWA 3B93A 1WD4A 1F2NA 4W6WA 3ALQA 3D4KA 3POWA 3UYJA 4XURA 1CWPA 4CP1A 1PHMA 4MXVA 2RV9A 1PIV1 2XQXA 2A3XA 3LIHA 1H6XA 3BCWA 2LS6A 2MHFA 2VMCA 4OZXA 2D6OX 3WDUA 1UY0A 4E8CA 4CP9B 1TME1 2GN3A 5FXVA 4RHV3 1H2KA 1YCIA 3GHNA 1D2SA 4GQ7A 5FZLA 5G04L 2QE3A 3NV3A 2Z79A 3R4SA 3W9AA 4KWJA 3JU9A 1I6XA 3LD8A 3RVHA 1OKQA 2GAUA 5C4WB 2IXJA 3FWEA 4Q4Y1 3USUA 1QH7A 4OUSA 4ZXKA 1W99A 1GICA 1W6PB 4RGAA 3ZYPA 5BNPB 3HBZA 3U4XA 4DY3A 2WFF3 3PVEA 2FDGA 3WW1A 3I2KA 3H9AA 4NROA 2JDNA 4X8NA 5LCWL 2WNUB 3IBMA 1WMFA 2Q1ZB 4E4HA 1UCXA 4JGZB 3ZIWA 1AX2A 4AVBA 1OD5A 3POBA 2P4EA 4E8DA 4GJZA 3AP4A 4D7YA 3PJQA 2VQTA 1DYOA 2NMOA 1NKGA 5CFDA 3VL9A 4AXOA 3GJAA 3DKQA 5BNPC 4BB3A 5LRSA 2FDIA 1ZVFA 2DFCA 4Y1XA 4RR3C 1ASJ3 4YW4A 3PJYA 2A6WA 3ETPA 1J58A 1J1LA 5FV3A 4BQ3A 2XL7A 2IFRA 3HQXA 1GSLA 5BV6A 2E7QA 3ELNA 5DDJ1 4FP3A 1FPN2 4GH4A 4Y5Z0 2CV6A 4B29A 4CEYA 1KJRA 4HSJA 1JOJA 1W0NA 5CEHA 4D3WA 3BUCA 1UZYA 4YG6A 5JI9A 5JPNB 3RZKA 5FUPA 4XHXA 3C7FA 4HBNA 5T52A 4R9BA 2DBIA 2HWC1 4L0PA 4MGTA 1LRHA 4HKLA 4N43C 5FP8A 5BUVA 4XEZA 1JW6A 1Q8QA 4D6SA 1VAMA 3BVCA 4IW3A 1AJOA 2ORXA 4HKWA 5DAVA 1VBB2 2VH9A 4LQRA 3B3QE 3GZAA 1W0OA 1CX4A 5H9PA 1FOD1 1ZBA3 5C4WA 2KR2A 2VMGA 5L36A 1UKGA 5ERLA 3USUB 2VXRA 5D8AB 1OD3A 3POSA 1AYM3 3X29B 1NE4A 5FZ7A 2WZ8A 3I3BA 2E6VA 4LXLA 4FTEA 3NJYA 2BQPA 3NVCA 2ZHKA 3KCXA 4K20A 3ZFGC 3AYAA 1HQNA 2JDKA 5GM0A 3TN92 4JQRA 1IPKA 4PBPA 4QQ2A 4N9HA 4OVEA 3IIAA 2Y33A 4WM7A 2C4XA 1UY2A 4JGZA 3I2IA 5HXMA 1PO13 1WMXA 3RPQA 3D82A 1IQAA 1ACCA 2ARBA 5BY5A 1NCQA 2WO1A 4Y3OA 5CB7A 5IK7A 4XIOA 2WFF2 1PZ9A 4FFFA 4WZCA 4KU7A 1Y9QA 5EJ1B 1Q56A 3UV9A 3M3QA 4Y4YA 2B5HA 1XBFA 4OHXA 4Y24A 3R0RA 4IEZA 3LPGA 5AFEA 3OD4A 1ZREA 5EFUA 1H1IA 1NA1A 2Q8OA 3TOJA 1V0AA 1W8UA 2EVXA 1MZFA 4A6OA 4OYUA 3ZXAC 5IVCA 3RZJA 1HJGA 2WS91 3VBFA 4Y1ZA 1KRIA 3FHAA 1UMHA 3SKJE 4BK5A 1LHVA 4HONA 1WCUA 1POV3 4LITA 5CYYA 2AEZA 2PLV2 1RUF3 2OQ6A 1KGYA 5ISLA 1UYYA 3MIFA 4AR2A 1DF0A 1NT0A 1GWLA 1VBC2 1BYHA 1RUG3 4O9GA 3SLIA 1COV1 1LU2A 5LEKA 4H2AA 1DZQA 3TN91 4ASMB 1A3KA 3CO2A 3WCSA 3VBUB 5AC92 4LBQB 2D44A 2WO3A 2ZEZA 3C3VA 4XDQA 5C71A 4JKKA 2F4PA 2NPIA 4DOUA 4FPOB 2GP3A 4HVOA 4A6SA 2BU9A 2BGCA 4AFDA 2OQ7A 2JB8A 1GZWB 1MVEA 2JG9C 2QQUA 1NXMA 5CZKA 2PLV3 4Q0QA 1XNDA 1BHGA 2V5DA 2P6CA 4FFIA 4MX3A 2R0HA 1MS0A 1ND3B 4QX3A 4LUMA 1AL23 3LA7A 4XUQA 1C57A 1PK6A 4LBKA 1LHNA 1NZIA 2JICA 3ME2A 3OY8A 3SH5A 5DAPA 4NHXA 4O9EA 3I7DA 1C5IA 5FMDA 2IUWA 1DQ6A 3N7KA 4Y22A 5F3EA 4AVTA 4AHYA 2PHTA 2UURA 3H3UA 1HV1A 3KV9A 5KHHA 4NAMA 4BJ0A 5FYVA 4CDUA 1YO8A 3VN4A 1NCQB 2I07B 4DXSA 2IWGB 4XIKA 5KC5A 3B94A 2XHKA 3AFKA 4LBNA 1GANA 1LEMA 3AZYA 4UAPA 1W2AX 1XYNA 2A5ZA 1MQTA 4EZ4A 3K4AA 4XILA 5IAXA 1LODA 1QXJA 4W8JA 4QKDA 2ZEXA 4CU7A 3LSEA 5ACA2 1AYN3 2JWPA 1UU6A 4IGPA 1JYVA 2YC2A 4P9IA 3N9MA 4N90A 1CESA 2GH8A 3OBTA 3VBSB 1RUH2 4META 3BKZA 4TTGA 5CFCC 5IYYA 4DPNA 3DF0A 4FXKB 5I0SA 2FMDA 2R043 3AB0A 3EYPA 2H0VA 4QPYA 4XZUG 1HJFA 4BU2A 1L7LA 2A75A 2ET1A 3TEXA 5BNQA 1JI6A 5ABJB 1IOAA 2CAVA 5KXDA 3A21A 1UYPA 3SH3A 2P3YA 5EXOA 3SCFA 4BMBA 3SEPA 3ZN6B 3VL8A 2K0GA 4NR1A 2WWSA 4NIHA 1SLAA 3A22A 1OUSA 3OPZA 4LO7A 4LR4A 1QQP2 5CVRA 4AG4A 1JHNA 2EAAA 3P1IA 3AKPA 3WEZA 2WYFA 4ARXA 2G1MA 1IPJA 1STMA 3ZKYA 2CGPA 2Q8DA 2R16A 5L7OC 2OZ6A 3R4UA 5F2SA 4FBFA 1SCRA 3MUY1 5F5CA 2W94A 1CZTA 3MICA 3NL1A 2BRTA 4AVCA 1RIRA 1G9CA 1CAVB 2XUMA 4NRMA 2QQJA 4IE4A 4QQPA 2Q8CA 4F7ZA 1FMD2 1LR5A 1QJY2 1DZRA 3LB9A 4N53C 3LFIA 4OI4A 4EROA 1LCLA 1FPN3 4R9DA 3LOBA 2ZACA 4V2VA 2GNDA 3E6BA 5DZFA 2XBO1 3LQCA 4Y5TA 5CFDB 2CL2A 2VTXJ 1VBE2 2JXAA 2VOKA 4LO4B 1W06A 1SLLA 1O3QA 1VRH1 2RR11 2W95A 1K42A 5FBJA 4QMAA 4CCNA 1RITA 5KHJA 4MOAA 4XBNA 2P17A 3POIA 1KJLA 4L8QA 4PDWA 3WQ0A 4L92A 1W8TA 1RTVA 3D6EA 3WG3A 2VNOA 1EV13 2NQYA 2J1AA 1HW5A 1PGSA 1JOBA 2GSYA 3CMGA 4LTAA 4LBJA 4GH4B 5GLZA 3J7LA 1F4HA 1K5JA 3WR0A 3E5UA 2Y6LA 2GC3A 4PI2A 2AGSA 1O4YA 1VBE3 3WDWA 1QJU3 3GYDA 2XPJA 1KD7A 1ZA4A 2ZMNA 1CAUB 1RUC2 1CR7A 2VGDA 2IXCA 2Y6KA 3KB5A 4AE2A 2YFZA 1AVBA 1POV0 5C9AA 4Q4X1 5J96B 2X8KA 3AYDA 4XETA 3ZSLA 1RB8G 1ASJ1 4MVTA 4FQZA 5A1LA 3GZUC 1G9AA 1C8M3 5CAZA 4JCKA 5FAXA 2DDUA 2ZX4A 1WW4A 3KV5A 1XB9A 2D43A 3LDKA 3N36A 4LUKA 2O14A 5A6ZA 4C0HA 1DGRN 4C90A 1SLTA 4AAXA 5D1IA 5A70A 3VDDC 2WS92 3T4VA 3S57A 1Q43A 2R042 5C33A 4BHPA 2BYVE 5FZ6A 1YIFA 1OF3A 5JVVA 1W8ZA 3MV11 2VZOA 3T0DA 3MF6A 2EICA 4B4QA 2VBBA 2VZSA 2YGMA 4OZOA 2RR12 1HXS3 2V5YA 5L9BA 4WBBA 2C5DA 1WUVA 1E5RA 5B4XA 5CFCB 1AUYA 3VBRC 3OSDA 5A7QA 1MPXA 1O91A 3RZMA 4I0WB 1EY2A 5F3IA 1SBEA 5FY5A 3QCWA 3E1F1 3FN9A 4HETA 4XDOA 4AI1A 3SNMA 2VCAA 3TNQA 3RWKX 3RRDA 3ZOIA 2DF7A 3CU7A 1CJPA 4CEWC 2BFUS 2O8OA 3AX4A 2EIBA 1ODMA 1KDKA 4DRRA 1IZ3A 2Q4SA 3VZLA 1YQ8A 3B9IA 3J26N 3H0OA 2VNGA 5C4WC 1QF3A 2I74A 2VW1A 3AJZA 3BTAA 3C7OA 1JZ8A 3PTRB 4M4PA 2D5FA 4AI0A 2RS33 4PT6A 1X36A 2GMEA 3N7JA 4Q4W1 5FYIA 4MG2A 3O7OA 4X6RB 2BNMA 4BQXA 2HEYF 4Q5OA 1NG0A 5FOJB 1NOVA 1CAUA 2R062 4PF5A 4I02A 2VPVA 3HVDA 3T08A 2HLEA 4IE6A 3AL5A 3BTZA 4EWDA 4Q1PA 2VQUA 5AVAA 3TEYA 3NV2A 3NMBA 4ATFA 4IE5A 2R041 4LBQA 4Q4V3 4WM7C 2V4VA 4XMAA 3FFQA 2N7GA 1SPPB 2HKXA 1QJX3 4COVA 3LGRA 1D0GA 4XJZA 1ULEA 3M7AA 2VJXA 2BERA 3I4IA 2WAAA 5E1RA 3VBSC 2A3YA 4OHVA 5A32A 4QPIC 4XUTA 5LW9A 3HPNA 4XF1A 1W9YA 1Y43B 3KHBA 1JTZX 4RGGA 1PO21 3JB8A 4JZRA 4MZUA 3N7MA 3ACIA 1I3HA 5C5UA 3UESA 5EYXA 4D6QA 2GALA 4GXLA 2ZMKA 1JZ5A 3FX3A 1LHWA 4CCMA 1ULCA 4PQQA 3ZYFA 2JIGA 2ERFA 2WNEA 4YYOA 5T54A 5DUWA 1HRI3 1UYXA 1RUD1 2JKBA 1V6LA 2HYKA 4EWEA 1H2NA 1HN1A 3MIBA 5LY1A 5A3MA 4GA9A 1AYM2 4A7ZA 4M3CA 1D4VB 3UGFA 2Z2SB 2O0OA 3SCHA 1QHDA 4NOTA 5IVEA 4FCAA 3RG0A 4L99A 5J3UA 4CCOA 3JB4C 1AL21 2ETEA 5IVVA 1GU3A 1GFF2 1LGCA 2NLRA 1BJQA 2QNKA 4NN0A 1OHFA 3AZVA 1W6NA 1C8NA 1A8DA 2VVEA 2RDQA 4UWDA 1EYBA 3U11A 4AQ2A 5I91A 5FZOA 5KHIA 3K3NA 3T4HB 1LHOA
chains in the Genus database with same CATH topology
1UWWA 2V72A 1LNSA 4GZ9A 4QX0A 2ZXQA 3IAQA 5LA2A 2VZTA 2J22A 1OF4A 1PX4A 1F4AA 3IAPA 3MV01 3WNMA 3CQOA 3CZJA 1PMHX 3IDAA 2VZ1A 1O59A 2ZEYA 2VZUA 2JDAA 3ZM8A 2VC9A 3HN3A 4XUPA 2KD7A 2XOMA 1UX7A 1JZ2A 2VMEA 4DUWA 5G05L 1JU4A 3D3AA 4ZXEA 1O8PA 3NNGA 4GWJA 4OMDA 2VZ3A 2C26A 3WF1A 2B9VA 1GNYA 2QBXA 2J1VA 3SEEA 1JHJA 1W8OA 1UMIA 1WKYA 2W9XA 2Y6GA 4XURA 2W47A 3GDBA 1CIYA 3WF4A 2RV9A 2XQXA 2WO2A 4LHSA 1H6XA 2LS6A 2VMCA 2EIEA 1UY0A 4E8CA 3LPFA 2BBAA 3I2GA 3GM8A 3I2FA 5JXHA 2X10A 5G04L 4BDVB 4A41A 1I5PA 2CDPA 1XNTA 3C7HA 3AC0A 2ID4A 4D8MA 3EB7A 5DN2A 1W99A 3OEAA 3U37A 1SDDB 4M4RA 5C70A 2BZDA 2VM9A 4P02B 3W5MA 1GQPA 2QQIA 2VMDA 3I2KA 4W4ZA 5LCWL 4UI9L 4HG6B 2X09A 3CZUA 2J1SA 4QB6A 4ZZ5A 1W9WA 2W46A 1PX3A 2HYXA 2VZPA 4E8DA 3WF2A 2VQTA 1DYOA 2VR4A 1NKGA 3DECA 2Z4FA 3F2ZA 3BGAA 3I3DA 2J7MA 4A4AA 3WQBA 3ETPA 2QQOA 4LKSA 2XHNA 2B4KA 5F7UA 3DYPA 3NQHA 4QB1A 3VD5A 2Y6JA 1W0NA 1H6YA 3K4DA 1JZ3A 2W5FA 3C7FA 2VTFA 4KWUA 4L0PA 1JYWA 2QQKA 2ORXA 2VO5A 3OB8A 4XVHA 4LQRA 2RJ2A 5IFTA 4FI9A 2W92A 1UY1A 3P6BA 1YQ2A 1OD3A 2W3JA 4QPWA 1GUIA 2Y6HA 2WZ8A 1GOGA 1KEXA 2LW8A 3I3BA 4QX1A 2RVAA 3FL7A 1K12A 2WN2A 2DCJA 1CZSA 2WQ8A 3WF3A 2C4XA 1UY2A 3ACFA 3I2IA 5HXMA 3T2QA 1J83A 1EUUA 1XPWA 3A7QA 3T0BA 1UXZA 1W9TA 2WO1A 4CUBA 2WBKA 5EJ1B 5IHRA 4A45A 3HNYM 2L9LA 4ZY9A 5DMYA 3I3EA 3LE0A 1XNAA 3LPGA 2ZEWA 2WAOA 4ET7A 1US2A 1XC6A 2Y8KA 4A6OA 2YFUA 4OYUA 3I97A 2YG0A 3DYOA 3FHAA 1UMHA 3SKJE 4BK5A 5CYYA 3OG2A 3IB3A 4IUGA 1KGYA 5DPNA 1UYYA 2W1QA 5IJRA 3K77A 4A3ZA 3NJVA 1CZVA 1EUTA 1PMJX 1NUKA 1WCQA 4DXTA 1TG7A 2WO3A 2ZEZA 5C71A 2E31A 4JKKA 4UOJA 3THCA 1UY4A 5CZKA 2X05A 3WF0A 1BHGA 2V5DA 4OMCA 1W9SA 1CX1A 4QX3A 3WNKA 1OT5A 1J84A 2WUHA 4XUQA 2DCKA 4Z2AA 1GOFA 3OGVA 5IFPA 4JKMA 3GGLA 1ULOA 5JUVA 3FHQA 5B4NA 2W91A 3UNPA 2W1WA 4BJ0A 4GWIA 2Y64A 4DXSA 2JD9A 3THDA 5J1XA 3HJRA 2BGOA 4A44A 3ABZA 4UAPA 2VOTA 3K4AA 4XUOA 2J1EA 4W8JA 2ZEXA 4CU7A 2VCCA 2JKXA 1JYVA 3DYMA 2YC2A 4QDSA 2VCBA 3K46A 2J1TA 3C7GA 4KI5M 4TTGA 5IYYA 2YB7A 4LPLA 3K4ZA 2VL4A 3EYPA 5EIYB 1JZ4A 4XZUG 1JI6A 5HPOA 3VDBA 3A21A 2OKXA 3SEPA 3VD3A 1UZ0A 3OGRA 4BXSV 3A22A 3T2PA 1D7PM 1T2XA 4AG4A 4QX2A 3P1IA 3ECQA 4ARXA 2VZRA 3WEZA 5JXJA 3VDCA 2W1UA 5A1AA 4DEQA 3A23A 3MUY1 2W94A 3VD4A 1CZTA 1UXXX 1TVGA 2QQJA 3VD9A 4QAWA 3OEBA 5FUIA 4DUVA 3HEIA 3GXUA 3LEGA 3ACGA 2QQMA 1US3A 1IQDC 3PUHA 3MBWA 4ARYA 1L7RA 1R64A 4JHZA 3LQCA 3CKHA 5JXGA 1O8SA 4CU9A 5EJZB 4DEVA 3OGSA 2XONA 4MADA 1K42A 2W95A 4BK4A 1SHWB 4MOAA 3HNBM 4ZZ8A 4CVUA 2WN3A 2J1AA 5DQ0A 3CMGA 3NJXA 1F4HA 1JU3A 2Y6LA 4JX0A 3MUZ1 1UYZA 3OBAA 5I0DA 2Y6KA 2C9KA 2WYSA 2QQLA 2YFZA 1L7QA 2VZQA 2J1RA 1DLCA 2DDUA 2E32A 4P08A 4RN5A 2VMFA 4QB2A 5JXIA 4KMQA 4AAXA 4YPJA 2EIDA 1ULPA 4DXRA 1GMMA 1OF3A 1JYXA 3WNPA 2WDBA 4MO3M 3MV11 2VZOA 4XUNA 3HNMA 1RYYA 2QQNA 3T0DA 4DUXA 4CU8A 2EICA 4MGSA 5C7GA 1GOHA 2VZSA 2JE8A 4OZOA 4OUEA 2VZVA 3CIHA 1DP0A 4TXWA 5B4XA 1JZ6A 3J7HA 4QDRA 1JYNA 3K75B 1MPXA 1K45A 2W87A 3E1F1 3FN9A 5JR2A 2VCAA 3UETA 1OH4A 3HOBA 3WNNA 2EIBA 4MGQA 3SKVA 3C8XA 3JXSA 2YC4A 3VDAA 2ORZA 1JZ7A 1SG3A 2W1SA 4JKLA 4PF1A 2WABA 1JZ8A 3C7OA 4M4PA 4PT6A 2WZEA 1NX9A 5LA1A 3T08A 2HLEA 2VQUA 2J1UA 2V4VA 3LEIA 3WNOA 2E26A 4CU6A 3WNLA 1NAEA 1W8NA 5JMOA 2VJXA 2BERA 4D0QA 2WAAA 3W5NA 4XUTA 4RYDA 3HPNA 3ACHA 1P8JA 3ACIA 1K3IA 3UESA 3C7EA 3T2OA 1JZ5A 3LEKA 3T09A 3VD7A 4PQQA 2R7EB 3IIIA 1UYXA 3NRUA 1HN1A 4W50A 1UY3A 4P5YA 5LA0A 3BN6A 3I2JA 4CUAA 4CUCA 4QDQA 4A42A 3T0AA 3WSOA 3CDZB 3MO4A 1GU3A 2CDOA 2BGPA 2E33A 3PUIA 4P00B 3I2HA 2PQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWW A;  2V72 A;  1LNS A;  4GZ9 A;  4QX0 A;  2ZXQ A;  3IAQ A;  5LA2 A;  2VZT A;  2J22 A;  1OF4 A;  1PX4 A;  1F4A A;  3IAP A;  3MV0 1;  3WNM A;  3CQO A;  3CZJ A;  1PMH X;  3IDA A;  2VZ1 A;  1O59 A;  2ZEY A;  2VZU A;  2JDA A;  3ZM8 A;  2VC9 A;  3HN3 A;  4XUP A;  2KD7 A;  2XOM A;  1UX7 A;  1JZ2 A;  2VME A;  4DUW A;  5G05 L;  1JU4 A;  3D3A A;  4ZXE A;  1O8P A;  3NNG A;  4GWJ A;  4OMD A;  2VZ3 A;  2C26 A;  3WF1 A;  2B9V A;  1GNY A;  2QBX A;  2J1V A;  3SEE A;  1JHJ A;  1W8O A;  1UMI A;  1WKY A;  2W9X A;  2Y6G A;  4XUR A;  2W47 A;  3GDB A;  1CIY A;  3WF4 A;  2RV9 A;  2XQX A;  2WO2 A;  4LHS A;  1H6X A;  2LS6 A;  2VMC A;  2EIE A;  1UY0 A;  4E8C A;  3LPF A;  2BBA A;  3I2G A;  3GM8 A;  3I2F A;  5JXH A;  2X10 A;  5G04 L;  4BDV B;  4A41 A;  1I5P A;  2CDP A;  1XNT A;  3C7H A;  3AC0 A;  2ID4 A;  4D8M A;  3EB7 A;  5DN2 A;  1W99 A;  3OEA A;  3U37 A;  1SDD B;  4M4R A;  5C70 A;  2BZD A;  2VM9 A;  4P02 B;  3W5M A;  1GQP A;  2QQI A;  2VMD A;  3I2K A;  4W4Z A;  5LCW L;  4UI9 L;  4HG6 B;  2X09 A;  3CZU A;  2J1S A;  4QB6 A;  4ZZ5 A;  1W9W A;  2W46 A;  1PX3 A;  2HYX A;  2VZP A;  4E8D A;  3WF2 A;  2VQT A;  1DYO A;  2VR4 A;  1NKG A;  3DEC A;  2Z4F A;  3F2Z A;  3BGA A;  3I3D A;  2J7M A;  4A4A A;  3WQB A;  3ETP A;  2QQO A;  4LKS A;  2XHN A;  2B4K A;  5F7U A;  3DYP A;  3NQH A;  4QB1 A;  3VD5 A;  2Y6J A;  1W0N A;  1H6Y A;  3K4D A;  1JZ3 A;  2W5F A;  3C7F A;  2VTF A;  4KWU A;  4L0P A;  1JYW A;  2QQK A;  2ORX A;  2VO5 A;  3OB8 A;  4XVH A;  4LQR A;  2RJ2 A;  5IFT A;  4FI9 A;  2W92 A;  1UY1 A;  3P6B A;  1YQ2 A;  1OD3 A;  2W3J A;  4QPW A;  1GUI A;  2Y6H A;  2WZ8 A;  1GOG A;  1KEX A;  2LW8 A;  3I3B A;  4QX1 A;  2RVA A;  3FL7 A;  1K12 A;  2WN2 A;  2DCJ A;  1CZS A;  2WQ8 A;  3WF3 A;  2C4X A;  1UY2 A;  3ACF A;  3I2I A;  5HXM A;  3T2Q A;  1J83 A;  1EUU A;  1XPW A;  3A7Q A;  3T0B A;  1UXZ A;  1W9T A;  2WO1 A;  4CUB A;  2WBK A;  5EJ1 B;  5IHR A;  4A45 A;  3HNY M;  2L9L A;  4ZY9 A;  5DMY A;  3I3E A;  3LE0 A;  1XNA A;  3LPG A;  2ZEW A;  2WAO A;  4ET7 A;  1US2 A;  1XC6 A;  2Y8K A;  4A6O A;  2YFU A;  4OYU A;  3I97 A;  2YG0 A;  3DYO A;  3FHA A;  1UMH A;  3SKJ E;  4BK5 A;  5CYY A;  3OG2 A;  3IB3 A;  4IUG A;  1KGY A;  5DPN A;  1UYY A;  2W1Q A;  5IJR A;  3K77 A;  4A3Z A;  3NJV A;  1CZV A;  1EUT A;  1PMJ X;  1NUK A;  1WCQ A;  4DXT A;  1TG7 A;  2WO3 A;  2ZEZ A;  5C71 A;  2E31 A;  4JKK A;  4UOJ A;  3THC A;  1UY4 A;  5CZK A;  2X05 A;  3WF0 A;  1BHG A;  2V5D A;  4OMC A;  1W9S A;  1CX1 A;  4QX3 A;  3WNK A;  1OT5 A;  1J84 A;  2WUH A;  4XUQ A;  2DCK A;  4Z2A A;  1GOF A;  3OGV A;  5IFP A;  4JKM A;  3GGL A;  1ULO A;  5JUV A;  3FHQ A;  5B4N A;  2W91 A;  3UNP A;  2W1W A;  4BJ0 A;  4GWI A;  2Y64 A;  4DXS A;  2JD9 A;  3THD A;  5J1X A;  3HJR A;  2BGO A;  4A44 A;  3ABZ A;  4UAP A;  2VOT A;  3K4A A;  4XUO A;  2J1E A;  4W8J A;  2ZEX A;  4CU7 A;  2VCC A;  2JKX A;  1JYV A;  3DYM A;  2YC2 A;  4QDS A;  2VCB A;  3K46 A;  2J1T A;  3C7G A;  4KI5 M;  4TTG A;  5IYY A;  2YB7 A;  4LPL A;  3K4Z A;  2VL4 A;  3EYP A;  5EIY B;  1JZ4 A;  4XZU G;  1JI6 A;  5HPO A;  3VDB A;  3A21 A;  2OKX A;  3SEP A;  3VD3 A;  1UZ0 A;  3OGR A;  4BXS V;  3A22 A;  3T2P A;  1D7P M;  1T2X A;  4AG4 A;  4QX2 A;  3P1I A;  3ECQ A;  4ARX A;  2VZR A;  3WEZ A;  5JXJ A;  3VDC A;  2W1U A;  5A1A A;  4DEQ A;  3A23 A;  3MUY 1;  2W94 A;  3VD4 A;  1CZT A;  1UXX X;  1TVG A;  2QQJ A;  3VD9 A;  4QAW A;  3OEB A;  5FUI A;  4DUV A;  3HEI A;  3GXU A;  3LEG A;  3ACG A;  2QQM A;  1US3 A;  1IQD C;  3PUH A;  3MBW A;  4ARY A;  1L7R A;  1R64 A;  4JHZ A;  3LQC A;  3CKH A;  5JXG A;  1O8S A;  4CU9 A;  5EJZ B;  4DEV A;  3OGS A;  2XON A;  4MAD A;  1K42 A;  2W95 A;  4BK4 A;  1SHW B;  4MOA A;  3HNB M;  4ZZ8 A;  4CVU A;  2WN3 A;  2J1A A;  5DQ0 A;  3CMG A;  3NJX A;  1F4H A;  1JU3 A;  2Y6L A;  4JX0 A;  3MUZ 1;  1UYZ A;  3OBA A;  5I0D A;  2Y6K A;  2C9K A;  2WYS A;  2QQL A;  2YFZ A;  1L7Q A;  2VZQ A;  2J1R A;  1DLC A;  2DDU A;  2E32 A;  4P08 A;  4RN5 A;  2VMF A;  4QB2 A;  5JXI A;  4KMQ A;  4AAX A;  4YPJ A;  2EID A;  1ULP A;  4DXR A;  1GMM A;  1OF3 A;  1JYX A;  3WNP A;  2WDB A;  4MO3 M;  3MV1 1;  2VZO A;  4XUN A;  3HNM A;  1RYY A;  2QQN A;  3T0D A;  4DUX A;  4CU8 A;  2EIC A;  4MGS A;  5C7G A;  1GOH A;  2VZS A;  2JE8 A;  4OZO A;  4OUE A;  2VZV A;  3CIH A;  1DP0 A;  4TXW A;  5B4X A;  1JZ6 A;  3J7H A;  4QDR A;  1JYN A;  3K75 B;  1MPX A;  1K45 A;  2W87 A;  3E1F 1;  3FN9 A;  5JR2 A;  2VCA A;  3UET A;  1OH4 A;  3HOB A;  3WNN A;  2EIB A;  4MGQ A;  3SKV A;  3C8X A;  3JXS A;  2YC4 A;  3VDA A;  2ORZ A;  1JZ7 A;  1SG3 A;  2W1S A;  4JKL A;  4PF1 A;  2WAB A;  1JZ8 A;  3C7O A;  4M4P A;  4PT6 A;  2WZE A;  1NX9 A;  5LA1 A;  3T08 A;  2HLE A;  2VQU A;  2J1U A;  2V4V A;  3LEI A;  3WNO A;  2E26 A;  4CU6 A;  3WNL A;  1NAE A;  1W8N A;  5JMO A;  2VJX A;  2BER A;  4D0Q A;  2WAA A;  3W5N A;  4XUT A;  4RYD A;  3HPN A;  3ACH A;  1P8J A;  3ACI A;  1K3I A;  3UES A;  3C7E A;  3T2O A;  1JZ5 A;  3LEK A;  3T09 A;  3VD7 A;  4PQQ A;  2R7E B;  3III A;  1UYX A;  3NRU A;  1HN1 A;  4W50 A;  1UY3 A;  4P5Y A;  5LA0 A;  3BN6 A;  3I2J A;  4CUA A;  4CUC A;  4QDQ A;  4A42 A;  3T0A A;  3WSO A;  3CDZ B;  3MO4 A;  1GU3 A;  2CDO A;  2BGP A;  2E33 A;  3PUI A;  4P00 B;  3I2H A;  2PQS A; 
#chains in the Genus database with same CATH topology
 4TLF A;  3B9C A;  5KBF A;  1LNS A;  1V6O A;  4QX0 A;  1FYU A;  3HQR A;  3WW4 A;  5BNO B;  4LO8 A;  2X53 S;  2YXS A;  1ODN A;  3IAQ A;  4L97 A;  4Z92 B;  2VZT A;  3FHI B;  1EV1 1;  2VUD A;  5KR7 A;  1PX4 A;  5A6X A;  1W6M A;  3SMH A;  1Z78 A;  2V09 A;  5ABJ A;  1XOY A;  2WSV A;  1ZRI A;  3ITQ A;  3WIN E;  1YFU A;  2VZ1 A;  2ZGT A;  1LEN A;  1Q8O A;  1VBE 1;  2YPJ A;  3NAP C;  4NWW A;  2VZU A;  3VBR B;  2JDA A;  2Z42 A;  1GP4 A;  1WME A;  4PLN A;  3ZFF B;  3AP5 A;  3ZM8 A;  1SPP A;  2PHU A;  3HN3 A;  4XUP A;  4KQ7 A;  5L73 A;  4Q8K A;  3KCY A;  2QFE A;  2RS3 2;  4XFC A;  3KGL A;  5FPZ A;  4ZXE A;  2ET7 A;  2PMW B;  3A4U A;  3M3C A;  1QOO A;  1XRU A;  4QKB A;  1UNB A;  2G9G A;  3OBR A;  3LAG A;  1RVF 2;  3Q8F A;  2BTV C;  5FWE A;  1VB2 A;  1PVC 3;  1YYN A;  2HBU A;  3ILF A;  4AWD A;  3JBG 2;  1PNF A;  1RHI 3;  2J1V A;  2P34 A;  5GJ6 A;  3WP5 A;  5C8C B;  3W59 A;  2VMH A;  4FFG A;  3CJI A;  3SEE A;  1DQ4 A;  2NZ9 A;  4CYD A;  1S0D A;  2VNR A;  3VHR A;  1GP6 A;  3QOP A;  4OI0 A;  1OFN A;  1CIY A;  3BAL A;  4QM8 A;  4C0B A;  2ZX1 A;  2WS9 3;  4CE8 A;  5FO9 B;  2R6Q A;  3P5B A;  2AC1 A;  1XNB A;  2BBA A;  2BP6 A;  3I2G A;  4D7T A;  4I3G A;  1YJK A;  1Y9M A;  3GF6 A;  3I2F A;  4NIG A;  1HXS 1;  1N47 A;  2X10 A;  3NW4 A;  4P9G A;  3VZM A;  5FMO L;  2LTN A;  1OFS A;  3J8F 2;  1HXS 2;  4I0B A;  3C7H A;  5EV7 A;  2VY0 A;  3U1X A;  1QIQ A;  3FE5 A;  2ID4 A;  3ON7 A;  4D8M A;  3EB7 A;  4P9Y A;  4CDW C;  4JAA A;  4P9W A;  2VD7 A;  2V4A A;  3LIG A;  3H50 A;  3M70 A;  5JIU A;  1AR6 1;  2G4I A;  2EAK A;  2LRP A;  5C70 A;  2BZD A;  2HWB 1;  3TAY A;  1VLN A;  1OLQ A;  1S0E A;  1QJF A;  3PIJ A;  4KNC A;  3EBR A;  3BPS A;  5LB6 A;  1QJE A;  5BNO A;  3KF5 A;  4Y26 A;  1O5U A;  1H1M A;  4HG6 B;  3CZU A;  3I2D A;  3OYW A;  5DAQ A;  4D69 A;  1JYI A;  5JI7 A;  2A1X A;  5A6Q A;  2W46 A;  1OXC A;  4CDX B;  2QVS B;  5HCH A;  2RS3 1;  3KD4 A;  1PX3 A;  2HYX A;  2VZP A;  3JQW A;  1OA3 A;  4TYS A;  4CDQ B;  4EZH A;  2RR1 3;  3KHC A;  3BI3 A;  3HAG A;  3EQE A;  4GWM A;  2VR4 A;  3DEC A;  2W0X A;  4RA0 A;  4WVW A;  2E51 A;  1QXR A;  1OOP B;  3TRS B;  2J7M A;  2GNM A;  3WQB A;  4H7M A;  4LOS A;  1LKN A;  3UT0 A;  2XHN A;  2IXK A;  1SCS A;  3CF6 E;  2B4K A;  4H7L A;  2VQ0 A;  4CPB D;  3TEZ A;  1O3T A;  2FD8 A;  1VRB A;  1J3Q A;  1W04 A;  2ADE A;  2UWA A;  4QB1 A;  5I93 A;  4DNY A;  3M3I A;  5FQ0 B;  1ZZ8 A;  4Q29 A;  3QH6 A;  4XC9 A;  2Q1M A;  2MEV 1;  2Y6J A;  3LA2 A;  4LMF A;  2CU5 A;  2NP0 A;  1H6Y A;  3DPR A;  4ZHN A;  3WLU A;  3UKV A;  1JZ3 A;  3QH7 A;  5FP7 A;  3RQ0 A;  4FVV A;  4Q2F A;  4JTN A;  4KWU A;  2D7F A;  5T3N A;  4HL0 A;  1JYW A;  1U12 A;  5K7P A;  2X5I A;  3MID A;  1OOP C;  2QDR A;  5CU1 A;  1RVF 3;  2H6B A;  4LHL A;  1CN1 A;  4N8M A;  4XVH A;  1UIK A;  2GNT A;  3QLQ A;  5FP4 A;  3VHN A;  2RJ2 A;  2XGX A;  1K5M B;  4MGY E;  3O1M A;  3L9J T;  4I09 A;  4Y4R A;  1PGL 2;  4FI9 A;  2OZJ A;  2BWC A;  3VLB B;  3VKM A;  3P6B A;  4MV2 A;  1LB2 A;  4QPW A;  2F6B A;  3KLS A;  5K0U C;  4MSV A;  2ZGO A;  5FZ1 A;  2ARX A;  3UL2 A;  1KEX A;  5IW0 A;  3VDD A;  1VAK A;  3CLP A;  4MHU A;  2RVA A;  1BK1 A;  5SV8 A;  3FL7 A;  3ZXG A;  3USS A;  2P5B A;  3IZO A;  3WF3 A;  2WNU C;  2R1D A;  3OYW B;  1X9T A;  4OQ9 A;  1C5H A;  4FTB A;  3QBQ A;  2FZ1 A;  2KXL A;  1YI9 A;  3ACF A;  3MW4 A;  4QX8 A;  1APN A;  1ZBE 3;  4RS5 A;  1XPW A;  2PHF A;  2ZGS A;  3A7Q A;  1W9T A;  1AR8 1;  5GZE A;  4QM9 A;  2HWF 1;  2R32 A;  4CUB A;  3ZYH A;  5HCA A;  1G8W A;  2WBK A;  1S0C A;  5JOY A;  5FZD A;  1J3P A;  5I0R A;  5LAT A;  3D0S A;  2L9L A;  2GP5 A;  4HT1 T;  4I0A A;  3I3E A;  4K40 A;  3RYR A;  1XNA A;  4Y5S A;  1X7N A;  1PMI A;  4UW3 A;  1MZ6 A;  1WCS A;  4E9K A;  1JBC A;  1CJD A;  2UU8 A;  5CAD A;  2DCY A;  5C3P A;  5GLW A;  5FQ0 A;  3I97 A;  3K48 A;  4UYB A;  3KCC A;  4ZZ8 A;  4CA9 A;  5CG8 A;  2ZGR A;  3ZSJ A;  4K6B A;  4NJ4 A;  3O1T A;  2XJT A;  1EAH 2;  5DPN A;  3NAP B;  4U36 A;  3T1M A;  1ST8 A;  3DKW A;  3K77 A;  5IJR A;  4A3Z A;  4URA A;  1RJ8 A;  1CZV A;  2C1F A;  2H6C A;  1GNZ A;  1QJX 1;  2XQR A;  4WVZ A;  1BMV 2;  1NY7 2;  2JG9 B;  2XH6 A;  3KT1 A;  1RUE 1;  4XFG A;  2C6S A;  3O1P A;  1C28 A;  2QUO A;  2E31 A;  5DZG A;  1AF9 A;  1KS5 A;  2R07 2;  4FAH A;  2JDZ A;  4UOJ A;  1QEX A;  2P37 A;  3N9N A;  3NKG A;  4BIF A;  4MLO A;  2B39 A;  2P3I A;  2CWM A;  3ETQ A;  1Q8V A;  5F2W A;  2D97 A;  3DV8 A;  2DFB A;  2X05 A;  2YY1 A;  4OLL A;  2YBS A;  3KQR A;  4A2U A;  3ZR6 A;  2D40 A;  4JQT A;  1CX1 A;  4BLI A;  2BDR A;  1C1F A;  5JMC A;  3RS6 A;  4L11 A;  4QPG C;  2RDR A;  3V0A B;  2DCK A;  3EXU A;  3HD8 B;  4Z2A A;  3NKT A;  3OGV A;  1UF2 C;  4ISQ A;  2WA4 A;  4XZP A;  1M06 G;  1ULO A;  4G4F A;  1COV 2;  5ACA 3;  5JUV A;  1T6B X;  2XJQ A;  4QQH A;  5FY1 A;  1WW7 A;  2ZZJ A;  3T2T A;  4TZD A;  2YC0 A;  3N7L A;  4JC1 A;  4YSF A;  2WII B;  5J98 B;  4AFA A;  3UNP A;  1GZT A;  2A70 A;  2JE9 A;  4UW4 A;  2FDJ A;  3S7I A;  1T6G C;  3UJQ A;  5F9T A;  4R9C A;  1E5S A;  2XVK A;  1POV 1;  2JD9 A;  5FYH A;  4Z8B A;  1RMU 3;  4NRQ A;  4BYY A;  4G3Y C;  4XXP A;  1IGO A;  3H3Z A;  5A7S A;  1HQW A;  1X33 A;  2D3S A;  2JEC A;  2WO7 A;  3ZXF A;  1COV 3;  2LRO A;  5DDJ 3;  3GNE A;  3Q8E A;  3TN9 3;  3WCR A;  5FWJ A;  1V6M A;  2JKX A;  1SZB A;  5LA9 A;  4QDS A;  3RSJ A;  4Q26 A;  1DGL A;  2J1T A;  1QGL A;  4FPC A;  2ZKL A;  1JXN A;  4JDO A;  1FXZ A;  1B35 C;  2UYA A;  4IET A;  4XF0 A;  5FZA A;  5JSR A;  4BLJ A;  2BJS A;  2WJS A;  5K0U B;  1RXF A;  1V00 A;  3M3E A;  3SC7 X;  3K4Z A;  3WG1 A;  1LGN A;  1GQG A;  1RUJ 1;  1SFN A;  1I1E A;  3W21 A;  3WV6 A;  2G9F A;  3ZVX A;  2B7Y A;  1QWR A;  5L19 A;  2MEV 3;  1H4H A;  1W8H A;  4N43 A;  4XBL A;  3VDB A;  1MS8 A;  4NE9 A;  3H1W A;  4HZF A;  1ZM1 A;  2FMY A;  4LJH A;  4O65 A;  1F31 A;  2OKX A;  1EPW A;  1Q3E A;  1UZ0 A;  3VKN A;  1S2K A;  4JRA A;  3S5Q A;  3IDC B;  1FMD 3;  1QJY 3;  2OT7 A;  3T2P A;  4QX2 A;  5JLV A;  3PU3 A;  2AZ5 A;  2AH2 A;  2I45 A;  2EA7 A;  1O4Z A;  1I9R A;  3VDC A;  1OUX A;  4WV8 A;  4DQA A;  3A23 A;  3KMH A;  1UOF A;  3MF9 A;  4DS0 A;  2VUC A;  1WLD A;  3RJR A;  3S5A A;  3V56 A;  3FBY A;  3MPB A;  1XJA A;  4FP2 A;  3ST7 A;  4Q4Y 3;  5FXW A;  5J09 A;  1PO2 2;  1AR7 3;  3VD9 A;  4RGK A;  3GBG A;  4NHK A;  1C8M 1;  4QHZ A;  2WT1 A;  4QAW A;  5FUI A;  3ZDV A;  3LEG A;  4F3J A;  4DUV A;  1AL0 G;  1QQP 3;  1UPI A;  1V9U 1;  2GDF A;  1VPH A;  2GU9 A;  4XPV A;  2QQM A;  5JZG C;  2QZ2 A;  5EP9 A;  1US3 A;  2RMU 2;  1EAH 1;  4JGZ C;  3JCI A;  4IEW A;  3T1L A;  4YM0 A;  3H1Y A;  4GJY A;  4YW2 A;  3ZYJ B;  1WLC A;  4S2D A;  1R08 1;  2CHH A;  4PJY A;  3BPZ A;  1RUH 1;  3SXW A;  5JXG A;  5FYS A;  3SH4 A;  1LES A;  4XJW A;  2XWB B;  4BXF A;  4JDN A;  1HRV 1;  2XON A;  4IV3 C;  3D5O A;  5FBZ A;  4CEW B;  5I0T A;  2W08 A;  4W6X A;  3OPW A;  3IN9 A;  1ZZC A;  2ZZQ A;  5E8A A;  4HMZ A;  3HNB M;  3LKJ A;  1IS5 A;  2WN3 A;  4U2A A;  1DHK B;  4Y1Y A;  5BNN C;  1QJX 2;  3NJX A;  3AK0 A;  2PTM A;  1DQ2 A;  1H8T A;  1ZNP A;  4K7J A;  4N7U A;  2XUE A;  2ZS6 B;  4IL7 A;  5DAW A;  1NCR B;  5FMC A;  2ZX2 A;  4ZKT B;  4AVS A;  3ROU A;  3OBA A;  4H14 A;  2C9K A;  1GLH A;  1MEC 1;  4CDX C;  4DIQ A;  3MIE A;  4W65 A;  3MEP A;  2RS1 2;  3SIT A;  3U78 A;  4Q0P A;  3OOX A;  1DBN A;  2R30 A;  4HSL A;  3AJY A;  4XFH A;  1BK0 A;  1VMJ A;  1L3J A;  4DRV A;  4NIA A;  3JBG 3;  4H3W A;  2BUK A;  2E32 A;  1B09 A;  3A0N A;  2XJP A;  4RN5 A;  3AL6 A;  4WM8 C;  4Q0S A;  1AX0 A;  4YGD A;  4YPJ A;  3VBU C;  5FZK A;  3DCQ A;  4PCR A;  4E4Z A;  5F5Q A;  2VTX A;  1V9U 2;  4KBB A;  4BQ5 A;  2CNA A;  4N7I A;  4YAR A;  1GR3 A;  3BB6 A;  2RS1 3;  1RYY A;  3AMP A;  1VRH 3;  2BV4 A;  3VDD B;  4D7S A;  3LFM A;  4XQ4 A;  5GZD A;  1OSG A;  4RHV 1;  4HK8 A;  3ZFG A;  1AYM 1;  3J8F 3;  1TME 2;  3WXP A;  2VZV A;  2Y0I A;  4LIU A;  4XHB A;  3CHX A;  4YGC A;  5BNN B;  3S0M A;  1VIW B;  2E7A A;  4RS5 B;  3WX5 A;  2HH9 A;  2OXB A;  3POG A;  1YFY A;  1D4M 1;  2EXI A;  2W87 A;  2GNB A;  3NNJ A;  5BPX A;  4QT6 A;  4EN6 B;  5CG9 A;  2W39 A;  1HIX A;  1W6O A;  4XCA A;  3NST A;  3IPV B;  3OD0 A;  1BLZ A;  3OGJ A;  2HWE 2;  4TLG A;  5FY9 A;  3WNN A;  3VDA A;  2GH2 A;  1RMU 1;  1S2B A;  3POY A;  3GJB A;  4QXH A;  1RUI 1;  4YNI A;  2W1S A;  4FPE A;  2WAB A;  5F32 A;  3IDE A;  3I59 B;  1H8T B;  3POF A;  2GC1 A;  4EE2 A;  3ZXL A;  1ZBE 1;  2WZE A;  3VBF C;  5JSP A;  1UN1 A;  2GC0 A;  4FOY A;  2W52 A;  5F6L B;  5JIA A;  4DY5 A;  3MPP G;  4ZU7 A;  3MW2 A;  4AQT A;  4AEM A;  2YU2 A;  4YG3 A;  5LA1 A;  3ZFE C;  1G9B A;  1YEW A;  1HB3 A;  2VCM A;  4XE9 A;  5A3W A;  2FCT A;  4AEJ A;  1RUF 1;  3VHO A;  4YVW A;  2A6V A;  1SEF A;  3BYW A;  4MHR A;  4AED B;  1PGW 1;  1RUJ 3;  1WW5 A;  2B42 B;  4FPH A;  5EJ3 A;  2J42 A;  4KG0 A;  3WNL A;  3INA A;  3H7J A;  1NAE A;  1W8N A;  2WR9 A;  4AI9 A;  3FFZ A;  5JMO A;  2VVD A;  4YFW A;  5A7W B;  3J7N A;  1MS5 A;  4D0Q A;  1RXG A;  2XJR A;  3TNP B;  2ZGM A;  1O6U A;  2IFW A;  2ZOE B;  1H2M A;  1URX A;  4N53 B;  4ZPI A;  3LOI A;  3ZN4 A;  5M0T A;  4G9S B;  3VBH B;  1K3I A;  3N9O A;  2YUE A;  1OLM A;  3AVS A;  3T2O A;  1X82 A;  3UGH A;  3VD7 A;  1AR9 1;  3E6C C;  4GAL A;  5IT6 A;  3B02 A;  1JUH A;  3NNM A;  1R1A 2;  3NRU A;  1FOD 3;  1ZBA 1;  5LBC A;  1J1T A;  1OQD A;  1XQN A;  1TMF 1;  1W6Q B;  2G9Z A;  1VBB 1;  4AED C;  2E63 A;  2ZML A;  2WKK A;  3BN6 A;  3HMY A;  3I2J A;  1F35 A;  4CUA A;  1V6I A;  4Q0U A;  4CUC A;  1RHI 1;  2PYT A;  3AXD A;  2D3R A;  3T3Y A;  5DXD A;  1TE1 B;  2PAM A;  3MO4 A;  1GZW A;  2ZA9 A;  1O3R A;  1LOG A;  5BNP A;  1AZD A;  4K1Z A;  4BQ2 A;  1J3R A;  3AYE A;  2O1Q A;  5DZE A;  4OI2 A;  2CDO A;  2ILM A;  2BGP A;  3PUI A;  2XVG A;  1UOB A;  1G6N A;  1KIT A;  2ZTN A;  3A0K A;  1UWW A;  2ZX0 A;  1HDK A;  5A80 A;  2RMU 1;  3AZW A;  4GZ9 A;  3MHZ A;  4XBQ A;  5FZ8 A;  3AMQ A;  3OY8 B;  1SQ4 A;  2VOV A;  3O14 A;  4LT5 A;  4CEY C;  5FR3 A;  3I3M A;  3ES4 A;  5DUX A;  4CTE A;  1U5I A;  5T5J A;  3PVB B;  3MV0 1;  4SLI A;  5APA A;  4DIN B;  5C9A C;  4CZS A;  3I2O A;  4LBM A;  5A3P A;  3IDA A;  3B69 A;  4OHZ A;  1O59 A;  2XL9 A;  5J48 A;  2QTW B;  3PUR A;  1H8V A;  4XJ9 A;  3I8T A;  4IGO A;  3OUH A;  2ARC A;  1ND3 C;  2KD7 A;  1E5H A;  3O1O A;  2WNO A;  3AZX A;  5A1F A;  1FNY A;  2D6K A;  3NNG A;  4LOT A;  2B45 X;  2ARA A;  5L7O A;  2VOW A;  3JBG 1;  4IDZ A;  3E5X A;  5LBE A;  5I8T A;  1MAC A;  1C8M 2;  2A6X A;  2QBX A;  2BVB A;  4C91 A;  2P3K A;  1GZ9 A;  4XFF A;  3THT A;  1Q8S A;  1WKY A;  1ND2 C;  3NWK A;  1SMV A;  1YXW A;  2W47 A;  2ZHM A;  3GDB A;  2ZHN A;  3WF4 A;  4QQL A;  4URT A;  2WO2 A;  3RMX A;  4LHS A;  4C1W A;  4NID A;  4PLM A;  5F6K A;  1DG6 A;  1OPM A;  2UY8 A;  5EZW A;  3LPF A;  4D6R A;  1JYC A;  5E6H A;  4LBL A;  1YNA A;  4GMP 1;  1W6Q A;  4IEU A;  4BDV B;  1MZ5 A;  3BOP A;  3ZN6 A;  3FLR A;  2CDP A;  2JDP A;  1SBF A;  3WQ1 A;  4ZU5 A;  3NV4 A;  4YW6 A;  4MH0 E;  4MXW B;  1U5Z A;  2BOI A;  3UK9 A;  1D4M 3;  1S0B A;  5KC6 A;  1JN2 P;  3LWC A;  3OEA A;  1U0A A;  1PIV 2;  2JIJ A;  4JGY C;  3U37 A;  1SDD B;  1XU2 A;  4PDW C;  1Q5O A;  1W2U A;  2JG8 B;  2YHJ A;  1FX5 A;  1BEV 1;  3AYC A;  5FK8 A;  1WA4 A;  4Y20 A;  1QY4 A;  1GQP A;  2VMD A;  1RL3 A;  2E53 A;  4OI1 A;  4KWL A;  3ZXJ A;  5F1R A;  2DVB A;  4UI9 L;  2BPA 2;  4KL1 A;  4QU2 A;  2X09 A;  5FK7 A;  2AAC A;  5HXV A;  4ZZ5 A;  2R06 1;  5E89 A;  4CDQ C;  1DU3 D;  4J6G A;  4FQ4 A;  3P3N A;  4LA2 A;  2XJU A;  5H9Q A;  1MVQ A;  5F39 A;  3VKO A;  4CCD A;  4FT8 A;  4P5H A;  4KWK A;  3BGA A;  5KXC A;  1W03 A;  2HWD 3;  3I3D A;  4Q27 A;  4XQD A;  2JDH A;  3I49 A;  1SFY A;  3H8X A;  3AP6 A;  4A4A A;  4JRL A;  4LKS A;  1UOJ A;  1ULD A;  5L7O B;  2IVJ A;  5FZ0 A;  1NA1 B;  4HK9 A;  2XJS A;  3E5Q A;  3NQH A;  3IKW A;  4PIX A;  2PAE A;  4IGQ A;  3VD5 A;  4DB5 A;  5KHG A;  2EAL A;  2GZW A;  1MEC 2;  3B7M A;  1DIW A;  3ILR A;  4L2N A;  4ZS2 A;  3H3L A;  2RS5 3;  4E2S A;  4IEX A;  3PMS A;  2ZBJ A;  4LLF A;  1NCR C;  3ZFG B;  5JOZ A;  3K4D A;  4LO5 B;  4NO4 A;  2FCU A;  1OLR A;  2W5F A;  4AFB A;  1UL9 A;  5BNN A;  2VUJ A;  4FPF A;  5DG2 A;  3LEM A;  4LKF A;  4YZ4 A;  1W3V A;  4CP9 A;  3V65 A;  5C9A B;  2QQK A;  4YVS B;  3CL1 A;  2VQA A;  4RR3 B;  4Y33 A;  1F8V A;  3PUQ A;  1S0J A;  2VO5 A;  3O12 A;  3OB8 A;  4IQP A;  1SAC A;  2D98 A;  4QXC A;  2RG4 A;  5IFT A;  4HN0 A;  3KZ4 C;  2A3W A;  2DYC A;  4ES8 A;  1R1A 1;  1OKO A;  4M0H A;  1TMF 3;  1UY1 A;  3B5L B;  4YM1 A;  4DFS A;  1YQ2 A;  4UW5 A;  1QJU 2;  3E97 A;  4K8F A;  4PBO A;  1IG3 A;  1TZO A;  5HBA A;  5HV4 A;  3IM0 A;  2K2S A;  3I59 A;  2Y6H A;  4BWO A;  1GOG A;  4Y20 B;  5A7O A;  1RUN A;  5AC9 1;  1QDC A;  4BZ4 A;  3BU7 A;  4AAP A;  3I3Q A;  3NNF A;  4BQY A;  1E5I A;  5DDJ 2;  5KHK A;  2WA3 A;  1K12 A;  4LKE A;  2DCJ A;  2QJV A;  5B2G B;  2WQ8 A;  2WT2 A;  1X8E A;  3HT2 A;  2YGL A;  4YM2 A;  3ZXD A;  1VBD 1;  3WG2 A;  5IVF A;  4CXY A;  2PN5 A;  5FZC A;  5CFC A;  1VMH A;  1N1S A;  1EUU A;  1N1T A;  1SLC A;  4XMI A;  1Z7S 2;  4I3P A;  4L9B A;  5CIS A;  2HWC 2;  4QGL A;  5D21 A;  4NPM A;  4MYE A;  1XE7 A;  2NYY A;  4UXA A;  3KM5 A;  1PZ7 A;  1Y3T A;  4NHM A;  1HKD A;  1RUI 2;  1RUF 2;  3ES1 A;  2EXK A;  3HNY M;  4ZY9 A;  2VW0 A;  4V2W A;  5DUV A;  1IKP A;  1SBD A;  5EWS A;  4XAB A;  2AR6 A;  1REF A;  3H7Y A;  3LE0 A;  2ZEW A;  3OJB A;  2WAO A;  4QHB A;  5E88 A;  3D8C A;  1US2 A;  4JDM A;  2DVG A;  4I2O A;  2Z5W A;  4M01 A;  1Z0H A;  5FZE A;  2YG0 A;  4YZ1 A;  1GV9 A;  4EN8 B;  1HN0 A;  3AVR A;  3G7D A;  4IUG A;  5FDB A;  1PM7 A;  4XFB A;  1PGW 2;  4XAC A;  4K1Y A;  2XLF A;  3NJV A;  4OQ8 A;  1PGL 1;  1OVS A;  1S0G A;  3N9Q A;  1AR7 2;  1PMJ X;  3FLT A;  2EIG A;  4IV1 C;  1WCQ A;  4Q4X 2;  4RR3 A;  3RYK A;  3VHP A;  1CAW A;  4DXT A;  1TG7 A;  4KGG A;  4FPK A;  1FAY A;  1VAV A;  3OUJ A;  1YUD A;  1MR5 A;  1TME 3;  4YVW C;  1YJL A;  3H8U A;  1BCX A;  1H0B A;  4OUL A;  2WNV C;  1IPS A;  2DTW A;  4KGQ A;  3WF0 A;  4Z2W A;  5A32 B;  5D8A A;  5F37 A;  2BVV A;  5I8Y A;  5LZ6 A;  4OMC A;  1W9S A;  5CKN A;  2ENR A;  3WNK A;  1OT5 A;  4XJ8 A;  4FOW A;  4MUV A;  1RMU 2;  2NMN A;  1GOF A;  4TSV A;  1CAV A;  1IS4 A;  4JKM A;  4HFS A;  5IFP A;  4QKN A;  4IND A;  1DQ1 A;  2RS1 1;  4XXA A;  2R07 3;  1TQ5 A;  4S2F A;  2FHR A;  3AXE A;  1VBB 3;  3FHQ A;  2F4L A;  4MGZ E;  3WHT A;  3KF3 A;  1W28 A;  4Z07 A;  5B4N A;  2ARE A;  1WZX A;  3LZZ A;  4Y1U A;  1VR3 A;  4CCE A;  3J4U H;  1D0H A;  5FYM A;  4OFG A;  3AFG A;  5F3G A;  4M3C B;  4X6Q B;  4YW1 A;  3URF A;  3W58 A;  4CXW A;  4QKF A;  3THD A;  1ALY A;  3HT1 A;  4A44 A;  4AVA A;  3KT7 A;  4B8E A;  4BQ4 A;  1OQE A;  1LOC A;  4XUO A;  1UIJ A;  1BKZ A;  1QMJ A;  5CKM A;  3WP4 A;  4GIQ A;  2JDU A;  3ENR A;  4RHV 2;  2WRA A;  4B7K A;  1ZRC A;  2BW8 A;  5FOB B;  3HIF A;  1NLS A;  5L9R A;  2XML A;  2QQW A;  3ZYR A;  1RUE 3;  3VGI A;  2VE1 A;  4R4X A;  1UZV A;  1QU0 A;  2VCB A;  2P3J A;  2VXJ A;  1OQ1 A;  3C7G A;  4J25 A;  2FDK A;  3ZDS A;  3S7E A;  4J1X A;  3WNX A;  3ZX7 A;  5FJK A;  4AOC A;  3VBF B;  1XYO A;  2YB7 A;  3UKT A;  1Y7B A;  1CVN A;  4HXC A;  4CUG A;  2JE7 A;  3AKQ A;  4BCU A;  1FAT A;  4Q4V 1;  5EIY B;  1JZ4 A;  1AHS A;  1NLR A;  3KVA A;  3L2Y A;  4FSJ A;  4CPB A;  4LEJ A;  1K5M C;  5HPO A;  5CA6 A;  4YW3 A;  4HPK A;  5FY4 A;  5I8S A;  3VD3 A;  2WLQ A;  5FZ3 A;  3VBR A;  2IC1 A;  4SBV A;  4BXS V;  5ACA 1;  3MZH A;  4PIY A;  4MXW A;  1T2X A;  4OUM A;  5FPV A;  4YZ2 A;  5FRA A;  4P9X A;  1HB1 A;  2IVI B;  3ECQ A;  2VZR A;  3MIG A;  1X9P A;  1GKB A;  3RZG A;  2VBP A;  1UW8 A;  3N35 A;  3S30 A;  5LWB A;  2W1U A;  1DYK A;  4YZ3 A;  3APB A;  5A1A A;  5A3O A;  3JD7 2;  1ND3 A;  2JG8 A;  5C3O A;  2SLI A;  3IWZ A;  3FJS A;  2DVA A;  4AFM A;  4QWN A;  1PK6 B;  5C8C A;  4AZZ A;  2QQV A;  3V0B B;  4A7Y A;  5GAL A;  1UXX X;  2PA7 A;  3CJI B;  3G6J B;  4PIZ A;  3OEB A;  2Q5T A;  3HEI A;  5IVY A;  4XW3 A;  3GXU A;  4COY A;  2DVD A;  5JR7 B;  4GMP 3;  5IUQ A;  4E4S A;  2RHP A;  1OBN A;  3ACG A;  5J36 A;  1CON A;  3UGG A;  2RDS A;  1IQD C;  1BZW A;  3PUH A;  3MBW A;  4ARY A;  1OC1 A;  1L7R A;  1OH3 A;  2WWU A;  1O5L A;  5IWF A;  1R64 A;  4JHZ A;  1CPN A;  1ZRD A;  3VBO C;  1H1A A;  3MDP A;  2XG3 A;  3CKH A;  3NV1 A;  4ITC A;  1DZT A;  4Q4Y 2;  4CU9 A;  5EJZ B;  1OA4 A;  4XF4 A;  1AL2 2;  2ZCW A;  3PLQ A;  2GN7 A;  3OGS A;  3RZH A;  1LEC A;  1VBA 2;  3AM2 A;  4MGI E;  5C8W A;  5JCT A;  1HX6 A;  4IV3 B;  1SHW B;  4BME A;  4EYU A;  2Q8E A;  3R6S A;  4HAN A;  1BQP A;  3U07 A;  4KH9 A;  5K9Y A;  4QU1 A;  3H1M A;  3ZN5 A;  2Y38 A;  1H2L A;  2JDM A;  3VBS A;  3KV4 A;  3NJZ A;  3JUU A;  1YWK A;  3TB0 A;  4CEY B;  1JU3 A;  1N3Q A;  2WZR 3;  4QGN A;  2WQ4 A;  4BQW A;  4E2Q A;  3MLK A;  3TBD A;  2YU1 A;  3MUZ 1;  4AI8 A;  3PDQ A;  2ZAH A;  5I0D A;  4ONU A;  3WW2 A;  4AW7 A;  2Q0A A;  3W5M A;  2OYZ A;  2QQL A;  2XXZ A;  1PM4 A;  2WWJ A;  2A7A A;  4LUL A;  1L7Q A;  1W39 A;  4NRP A;  4YGB A;  1PVX A;  1VRH 2;  2XWJ B;  3AP7 A;  1AR7 1;  4LE3 A;  4YVS A;  5FZB A;  4RQP A;  1DLC A;  4AQ6 A;  1PVC 1;  2MPF A;  2VMF A;  2ZKN A;  3T30 A;  2Y0O A;  1NQJ A;  1HRI 2;  5FPX A;  5JXI A;  1EAH 3;  4FFH A;  4M3C F;  2YRO A;  4R4Z A;  1NYW A;  2EID A;  2RS5 1;  3JZV A;  2AEN A;  1G7Y A;  1UPS A;  1V6J A;  1GMM A;  3MGU A;  2WDB A;  4LHN A;  4MO3 M;  2WL1 A;  4R8H A;  4XUN A;  3HNM A;  3L2H A;  5GZC A;  1YC6 1;  2QQN A;  3DUI A;  4UT5 A;  1YFX A;  4DUX A;  4CU8 A;  2CTV A;  5C7G A;  3BIE A;  5FY8 A;  5HCB A;  2LUW A;  5BYN A;  3HQU A;  3CIH A;  4WM7 B;  1DP0 A;  3GHM A;  2R1B A;  2PHL A;  4LOR A;  1N1V A;  3WHU A;  5L9V A;  3J7H A;  3RDI A;  4QDR A;  5FYZ A;  4AL9 A;  3VUO A;  3BOD A;  1J59 A;  3MLJ A;  1PIV 3;  1W3X A;  3WVJ A;  1ZRF A;  1W9F A;  4XOG A;  3K2O A;  3DXU A;  4IEV A;  1YQC A;  2C9A A;  4YG0 A;  4PHZ A;  3ZXK A;  4FTS A;  1V6K A;  5JR2 A;  3CBN A;  3ASI A;  4AK3 A;  3OF1 A;  5IK5 A;  2DWR A;  3UET A;  1O7F A;  1MEC 3;  1M4W A;  3VZJ A;  3ZR5 A;  1WCK A;  1IS6 A;  2IXL A;  3C8X A;  5FFO C;  2VUL A;  2YC4 A;  3JXS A;  5HCF A;  1XE0 A;  4HKO A;  5FLH A;  3ZKU A;  1JZ7 A;  1GNH A;  4QQO A;  1UU4 A;  4ZON A;  1DCS A;  3AMN A;  3JD7 1;  5FZO B;  2BOJ A;  1LHU A;  2VBD A;  4HOO A;  2PHX A;  4CCK A;  4AHW A;  2HWF 2;  3C2U A;  3POE A;  4UFK A;  3PME A;  2ES3 A;  4CCC A;  1S0F A;  3PVO A;  4GD4 A;  1VB4 A;  1Y4W A;  1PO1 1;  2OS2 A;  1VAL A;  2HWD 2;  1V70 A;  1H9W A;  4BE3 A;  2RM2 3;  3CJI C;  3PUA A;  3U4S A;  1RUE 2;  5F8P A;  4IXL A;  4CP2 A;  3B00 A;  5FMB A;  1TNF A;  1UQX A;  3U75 A;  3U0Z A;  5JWP A;  3AP9 A;  1CAW B;  4TWT A;  4RQP B;  3HN1 A;  1IG0 A;  4CDW B;  5JDB A;  4UFL A;  3LEI A;  1A6C A;  2E26 A;  2KA3 A;  2VAU A;  1XXN A;  5FPL A;  4LA3 A;  3U10 A;  4CU6 A;  1JMU B;  4B4R A;  2XLG A;  4ZU4 A;  3NO8 A;  4NII A;  1RED A;  3OTF A;  3W5N A;  3OCP A;  1V6N A;  2RM2 2;  2TEP A;  2H0B A;  4BIO A;  4ISR A;  3WDT A;  3Q9O A;  2HWE 1;  3KSC A;  3KVB A;  4M00 A;  4XCB A;  3ZIX A;  3ZSE A;  5CBL A;  1YHF A;  4OHY A;  2PEL A;  3KT4 A;  1WBF A;  3W20 A;  1ZRR A;  1QJZ A;  1Y9G A;  3C7E A;  4NMI A;  5FKC A;  1BBT 2;  1OMI A;  2GMM A;  3T09 A;  1W2T A;  1WMD A;  1O3S A;  2R7E B;  4K9S A;  2Z69 A;  1R08 3;  3WDX A;  3ZFF C;  5FO7 B;  1RUI 3;  3KS7 A;  1OPO A;  1RUH 3;  3E6D A;  4LBO A;  2GMP A;  3RYP A;  4W50 A;  5FRE A;  4QGM A;  2VUA A;  3ATG A;  4CDU B;  4GAZ A;  5IVJ A;  1E57 A;  2ZAA A;  2CWS A;  4C1X A;  1LOE A;  4A42 A;  3T0A A;  3AKR A;  5FZH A;  3PIG A;  4IV1 A;  2D3P A;  2Y26 A;  4HVR A;  2HJI A;  3VKL A;  1XSR A;  5T5P A;  2UYB A;  1X50 A;  3ZXE A;  3WT3 A;  1R1A 3;  2E33 A;  2CGO A;  3MYX A;  5CIR A;  3I2H A;  5FYC A;  4DXZ A;  1ULG A;  4RSU A;  2CY6 A;  2ZHL A;  1NLQ A;  3V0A A;  4NPL A;  2V72 A;  3ZYI B;  4A3X A;  1W2O A;  4XQW A;  1POQ A;  1VBA 3;  2HEV F;  4DO0 A;  3SCG A;  4RL7 A;  5AC9 3;  5JZG A;  4CRQ A;  4GKX A;  2BBV A;  2J22 A;  3M2M A;  5A3L A;  3MFC A;  1AJK A;  4F83 A;  4QD2 A;  4CDX A;  4UFH A;  4UFI A;  4YWA A;  4NHL A;  2A6Z A;  4HPK B;  5IVB A;  2RE9 A;  4MGK E;  3Q8C A;  2WFF 1;  1IKQ A;  5KXB A;  4ORF A;  5GZF A;  2VC9 A;  1RUO A;  5T5L A;  2DTY A;  2NN8 A;  3IDB B;  1Z7S 1;  2D93 A;  4BA6 A;  5H9S A;  1OOP A;  4B3N A;  4NHY A;  3VBO B;  5G05 L;  1JU4 A;  4DUW A;  3WZ1 A;  3TYJ A;  1O8P A;  4GWJ A;  2VZ3 A;  1W8F A;  2C26 A;  1FMD 1;  1NA1 C;  1QJY 1;  2SBA A;  4NPR A;  3TEW A;  1DQ5 A;  2R06 3;  2B9V A;  1GNY A;  3J8F 1;  1S1A A;  1UMZ A;  1R1Z A;  2EXH A;  4K3U A;  5T50 A;  3O1V A;  1JHJ A;  1W8O A;  1UMI A;  2E9Q A;  2W9X A;  4UF0 A;  1TMF 2;  2Y6G A;  2YBP A;  3GCX A;  1ZZB A;  2HWB 2;  2WT0 A;  1DYP A;  2CSG A;  1ND2 B;  3GZT B;  3R05 A;  5K0U A;  4DMI A;  1OVP A;  4CP0 A;  3OPT A;  3DEM A;  5FO8 B;  5C5T A;  2HEW F;  2EIE A;  2D6M A;  3HBK A;  1KXG A;  3GM8 A;  4O61 A;  1QQP 1;  4BM8 A;  5JXH A;  3PUS A;  1R09 3;  4FO9 A;  4A41 A;  1I5P A;  1GQH A;  1SLB A;  4IE7 A;  4EN7 B;  1XNT A;  1HB2 A;  1BMV 1;  1C4R A;  3LSD A;  3AC0 A;  1MS3 A;  1K5M A;  3H42 B;  3KQ4 B;  4M3C E;  4IV3 A;  4OHW A;  5FZG A;  1F9K A;  4IV1 B;  3RJ2 X;  3R4D B;  3UJO A;  2CGN A;  5DN2 A;  4YGE A;  1WLW A;  4COZ A;  3K3O A;  4A7K A;  4PDW B;  2LAL A;  1W6N B;  4R9A A;  4JGY B;  4M4R A;  2B9U A;  3I54 A;  3ZPO A;  4EWA A;  2VM9 A;  4RFT 0;  5EQU A;  3DL3 A;  5FLI A;  1GWM A;  1W2N A;  1YQ6 A;  2ZPX A;  2D5H A;  4IES A;  4IE0 A;  4P02 B;  2QQI A;  1H8T C;  2TNF A;  1FPN 1;  1W0P A;  4W4Z A;  4XAA A;  5EPA A;  5FPA A;  5JOX A;  1ASJ 2;  2JG8 C;  2PFW A;  3PL0 A;  5DG1 A;  2ADD A;  2XJV A;  2J1S A;  1UU5 A;  3IT8 A;  5FJH A;  2UY9 A;  3M1H A;  4QB6 A;  1W9W A;  1JYT A;  4BPZ A;  1AYN 2;  2JEM A;  1MS9 A;  2B46 X;  1NE6 A;  3WF2 A;  3P3P A;  2VNV A;  4LIV A;  2W68 A;  2Z4F A;  3F2Z A;  3WUD A;  4EQV A;  2XVL A;  2QQP A;  4PQ9 A;  5A6Y A;  2F17 A;  2GC2 A;  3FUQ A;  2ZJC A;  3VBO A;  2QQO A;  4R52 A;  5JAX A;  2VMI A;  4QPG B;  4WZF A;  5F7U A;  1VBD 3;  3DYP A;  1AX1 A;  4H55 A;  5IK4 A;  2ZGK A;  3IMN A;  3ZLI A;  3V64 A;  5IAT A;  1AXZ A;  4COW A;  4F8A A;  1CIW A;  2FCV A;  2OPW A;  1WWY A;  5E16 A;  1BEV 2;  4CCJ A;  4AGG A;  2WQZ C;  3EO6 A;  1RUD 2;  1RC6 A;  2I2S A;  3EHK A;  1ENR A;  1DGW X;  2VTF A;  3AMH A;  3NAP A;  1AXY A;  4XF3 A;  1VMF A;  5LY2 A;  3OBZ A;  1SFP A;  3FC0 A;  5I0U A;  3SHR A;  5JSO A;  3V0B A;  5K4L A;  4LK6 A;  1YQ5 A;  5T55 A;  3THP A;  5EYY A;  5ANN A;  3BU0 A;  4EN0 A;  2YYO A;  3MFA A;  4M0N A;  1RJ7 A;  5A7P A;  1EV1 2;  4ZS3 A;  5FP3 A;  5FCC A;  1VBC 1;  4YVS C;  2VW2 A;  4B1L A;  2W92 A;  1ZBE 2;  2JD4 A;  4RQP C;  3S6P A;  2TBV A;  3Q8B A;  4ASK A;  1HLC A;  1HV0 A;  2RMU 3;  2W3J A;  4AHZ A;  3RWN A;  3DN7 A;  1F5F A;  4Z82 A;  3SQO A;  1GUI A;  3GBW A;  1WCD J;  2IXH A;  2PHR A;  2LW8 A;  4IER A;  2FQP A;  3J7M A;  4QX1 A;  5IK8 A;  5DUU A;  4K21 A;  2WN2 A;  3LCP A;  1R09 2;  1CZS A;  1WD3 A;  2XB6 C;  3ZPY A;  1MS1 A;  1LOA A;  1XNC A;  4GB3 2;  1B35 A;  4E27 A;  1HRV 3;  3T2Q A;  2Q1F A;  1J83 A;  1FI2 A;  3PNA A;  5T5O A;  3ZFE A;  4E2G A;  2V73 A;  4K8R B;  3T0B A;  3TWI A;  1D4M 2;  1UXZ A;  2A73 B;  5JOW A;  2VVF A;  4YW7 A;  5FYT A;  1YI7 A;  2BNO A;  5FZ9 A;  3SIS A;  4CDW A;  2ZGQ A;  2JB4 A;  5IHR A;  2QCS B;  1JH5 A;  1A34 A;  4QX7 A;  1GZC A;  4A45 A;  5A3U A;  1FOD 2;  2X29 A;  3CJX A;  4GMP 0;  5H9R A;  1D2Q A;  4B7E A;  4KBZ A;  5DMY A;  4NAO A;  1O4T A;  3LA3 A;  1RUG 2;  1RUC 3;  4ET7 A;  5KXE A;  1HQL A;  5FMO S;  1HRV 2;  1XC6 A;  2C0Z A;  1QNY A;  2Y8K A;  4AQS A;  1SLI A;  1UOG A;  2YFU A;  1Z7S 3;  5C3S A;  3ZO0 B;  2W2I A;  2RM2 1;  3DXT A;  5FUN A;  3DYO A;  4HVQ A;  4ATE A;  1AR8 2;  2DVF A;  4XFI A;  5J37 A;  5GKA C;  5GLU A;  2YPD A;  5F5A A;  3OG2 A;  4PI0 A;  2WZR 1;  3IB3 A;  1VE0 A;  2JJ6 A;  4YRD A;  2W1Q A;  4LNV A;  5GLV A;  5FY0 A;  3WP3 A;  1PZ8 A;  1S0I A;  2WLP A;  1QNW A;  3ZYB A;  1EUT A;  1BVP 1;  1MZE A;  1DLL A;  4N43 B;  4XDP A;  5C3R A;  1AR9 3;  2JDY A;  1RHI 2;  4GKY A;  1AYN 1;  1NUK A;  4JVA A;  2Y6F A;  4WVV A;  5FZM A;  1DGR A;  3PHM A;  4AED A;  5J7M A;  2DBN A;  2OW4 A;  4FPJ A;  3GAL A;  5FZF A;  2RS5 2;  3EMR A;  3THC A;  1UY4 A;  1BEV 3;  2Y60 A;  4TN7 A;  3ORJ A;  4QXK A;  2NM1 A;  1ENQ A;  2IXI A;  2XDV A;  4AI2 A;  3OUI A;  1UZZ A;  2ZAB A;  3O1S A;  3PTY A;  2ZGP A;  1J84 A;  2WUH A;  1AR6 2;  2WSU A;  3FZ3 A;  1W05 A;  2DCT A;  4X8P A;  2OX0 A;  1JOD A;  2AEY A;  3GGL A;  3EJK A;  3KWV A;  2DCZ A;  5FTT C;  4AI3 A;  1U5X A;  3MW3 A;  3NNL A;  2K46 A;  4AYU A;  4EN9 B;  4FPL A;  1G9D A;  4XFA A;  2DUP A;  1SDW A;  1B35 B;  1LOF C;  2X5I C;  5A7N A;  1RUJ 2;  2UWC A;  4EJR A;  1W6M B;  2D6P A;  1KS4 A;  2W91 A;  1WW6 A;  4AGV A;  1KDM A;  3LDB A;  1OUR A;  2W1W A;  2G19 A;  1Q8P A;  4GWI A;  3D0J A;  5F5I A;  1S2E A;  3WW3 A;  2Y64 A;  4KU8 A;  5J1X A;  1VJ2 A;  3ZFF A;  3HJR A;  2BGO A;  3ABZ A;  3J9S A;  2VOT A;  2A6Y A;  1X8M A;  2ATF A;  2CAU A;  1MS4 A;  4CEW A;  3MIH A;  1A8M A;  3ACL A;  1GP5 A;  2J1E A;  3VBH C;  2OA2 A;  2VCC A;  5FXZ A;  1TEI A;  3AMM A;  4COU A;  3KV6 A;  4EV0 A;  1BBT 3;  1VBA 1;  3RFR A;  3F95 A;  3DYM A;  4LKD A;  3K46 A;  3WOG A;  5KWR A;  1CAX A;  5JZG B;  2ZGU A;  4QHO A;  3WP6 A;  3N4M A;  1AXK A;  4PLO A;  4UF0 B;  3M4F A;  2XBO 3;  4KI5 M;  5FZ4 A;  1NCR A;  2FZ2 A;  4B1M A;  2PLV 1;  1ND2 A;  1XYP A;  2HWC 3;  4LPL A;  5A3N A;  1FT9 A;  2VL4 A;  1QOS A;  1EPZ A;  1S55 A;  3AKT A;  4OCT A;  3AKS A;  3B01 A;  5CKQ A;  1VBD 2;  5EHD A;  4YLZ A;  2KM2 A;  1REE A;  4Q8L A;  1ZZ7 A;  2CYF A;  3RNS A;  1LJ7 A;  3RI9 A;  4IEQ A;  4O7X A;  1XU1 A;  3ILN A;  4IEP A;  4LBQ D;  4UW6 A;  3OGR A;  5HV0 A;  2WC2 A;  4BIS A;  3BTX A;  1D7P M;  1DGW A;  2RJK A;  2UWB A;  5K8S A;  2FBE A;  5C6C A;  1YIP A;  1I5Z A;  1BXH A;  5JXJ A;  3ZYG A;  3O1R A;  4IEO A;  3DGT A;  4QPI A;  2QDN A;  1WA6 X;  4DEQ A;  1EP0 A;  4JGY A;  1JS9 A;  3VZO A;  3VD4 A;  2OUH A;  3AZZ A;  1NQD A;  4W6Y A;  3BTY A;  2Q30 A;  2XLA A;  1N3P A;  2DU0 A;  1VBC 3;  5LK5 A;  5GZG A;  1ZX5 A;  4Y1V A;  2OVU A;  1IS3 A;  1TNR A;  1TVG A;  3UKN A;  4B4P A;  1ENS A;  4S2H A;  4Z1V A;  2WIN B;  1ENX A;  1KFX L;  4IEY A;  5CFD C;  3FMG A;  4HN1 A;  4RFR B;  5FPU A;  1WBL A;  2K9Z A;  4FPG A;  2AYH A;  4CDQ A;  1YLL A;  1XNK A;  5C3Q A;  1RUD 3;  1O8S A;  1W6O B;  1ZZ6 A;  4UFM A;  2OPK A;  1AR6 3;  4DEV A;  3PU8 A;  4V1P A;  4WVM A;  4YW5 A;  2JEN A;  4MAD A;  3ZSM A;  4BK4 A;  4GH4 C;  2EF6 A;  4I30 A;  4N9I A;  2DUQ A;  4XTM A;  4QPG A;  4XAE A;  2BEO A;  5DAB A;  5LRR A;  5F3C A;  4Q4V 2;  4CVU A;  2HWD 1;  2IZW A;  3MLL A;  1CAX B;  1ZBA 2;  4P9L A;  3M8L A;  1LUL A;  1YRZ A;  1IHM A;  4FOV A;  4AHX A;  1RIN A;  5BNO C;  3DPR B;  3PVN A;  4JX0 A;  2P6H A;  4ASL A;  4CSW A;  3CNA A;  3WUC A;  1UYZ A;  3N9P A;  1N3O A;  5FP9 A;  1QXP A;  4LO6 B;  5CNA A;  2WYS A;  5FZI A;  3OGG A;  5ABJ C;  1NY7 1;  1KFU L;  1QDO A;  3K51 A;  2VZQ A;  2J1R A;  3WY6 A;  1W8W A;  2JX9 A;  2X5I B;  4CCL A;  5FYU A;  4GB3 3;  2PHW A;  1GWK A;  1R08 2;  2TUN A;  4P08 A;  2WZR 2;  4LK7 A;  1DDL A;  4QB2 A;  1PO1 2;  2XR4 A;  4KMQ A;  1PNG A;  5A7W A;  3O0W A;  4Q4W 2;  3WQ7 A;  2WNV A;  5FIX A;  4QPI B;  1QOT A;  4D94 A;  5D8A C;  2E7T A;  4UBH A;  1ULP A;  4DXR A;  1AR9 2;  1JYX A;  3WNP A;  4FOQ A;  4S2G A;  2HBT A;  1CD3 G;  1ONA A;  5FY7 A;  5A33 A;  4MGS A;  3DPR C;  1GOH A;  2JE8 A;  3VV1 A;  2WZP P;  4OUE A;  2AUY A;  1W90 A;  4XJA A;  1H30 A;  3BIW E;  3ZMO A;  4ES9 A;  1NCQ C;  4YM3 A;  4TXW A;  2DV9 A;  1FV3 A;  2OII A;  1JZ6 A;  2FDF A;  5DAX A;  2RJL A;  2QZ3 A;  1UX6 A;  4NUB A;  3ZFE B;  5AFB A;  4NVP A;  3GBF A;  1JYN A;  3N3H A;  3K75 B;  1OI6 A;  4HLT A;  1K45 A;  4AEK A;  5FYB A;  4E4D X;  1N1Y A;  4WM8 B;  2YV8 A;  2VU9 A;  1YFW A;  1H9P A;  4KG8 A;  3ZMN A;  5D2A A;  5AVP A;  1GYK A;  4WVM B;  1S4C A;  1OA2 A;  1R09 1;  4BQ1 A;  1OH4 A;  1XSQ A;  3HOB A;  1ZYB A;  4MGQ A;  3RZL A;  3SKV A;  3N9L A;  1BVV A;  1RGS A;  4FAG A;  2PAK A;  2YBK A;  1G86 A;  2ORZ A;  2PXJ A;  3O0V A;  1SG3 A;  1UZW A;  3IMM A;  4JKL A;  4PF1 A;  3RMY A;  5LBB A;  5LK7 B;  5BXX A;  2ZGN A;  2VOX A;  1NX9 A;  4JTO A;  5GLT A;  2PQQ A;  3WDV A;  1BBT 1;  2DUO A;  2WFP A;  3O5S A;  2XKO A;  5IAV A;  1ULF A;  4NWV A;  1HB4 A;  1PVC 2;  2BFU L;  3FLP A;  2RDN A;  5FPB A;  3WD5 A;  4RS5 C;  3MI8 A;  1CPM A;  1LAJ A;  3KGZ A;  1UKR A;  1DQ0 A;  3LF7 A;  4Q1R A;  4YZ5 A;  4GWN A;  1DFQ A;  3O1U A;  2J1U A;  2JG9 A;  4I01 A;  2ZX3 A;  4UBG A;  3VKF C;  4LLO A;  1RUC 1;  1C3H A;  3POJ A;  3WNO A;  5FLJ A;  2B8M A;  3GCW A;  4BOW A;  1F5J A;  1FV2 A;  2QKD A;  1PK6 C;  1UD1 A;  2LM3 A;  2WNV B;  5LAS A;  3VB9 A;  2MEV 2;  3RGB A;  3ZSK A;  4RYD A;  1LTE A;  3H8O A;  1NZC A;  3RI8 A;  1LED A;  4FPY A;  5HI0 A;  3O0X A;  3ACH A;  1P8J A;  2D6L X;  4DZG A;  5A33 B;  5C8C C;  5FKB A;  1QKQ A;  4GUL A;  3LEK A;  1G9F A;  4XYX A;  4XF9 A;  4CDU C;  4LHK A;  2PHD A;  3VZN A;  2YDE A;  1JUI A;  1WLT A;  1WGP A;  3FUO A;  3III A;  3WG4 A;  1UO9 A;  3JD7 3;  1H4G A;  1ZZ9 A;  2Y34 A;  1MQT C;  2XBO 2;  3GZE A;  1UY3 A;  2ZGL A;  4P5Y A;  2D6N A;  2BWA A;  2R07 1;  4Q4W 3;  1FNZ A;  4WM8 A;  2P2K A;  5LA0 A;  4AGR A;  1V9U 3;  1LOB A;  5SV5 A;  3VBU A;  1OLM E;  3IPV A;  1QH6 A;  1A78 A;  4QDQ A;  2DUR A;  1LGB A;  3VZK A;  2C24 A;  4QXB A;  1RVF 1;  3CDZ B;  3WSO A;  5FXX A;  1KQR A;  4UFJ A;  2EXJ A;  1W6P A;  4JHT A;  4RD7 A;  5ANQ A;  4Q0V A;  3RZZ A;  4BH9 A;  2A71 A;  1JOP A;  2FDH A;  2BNN A;  1CQ9 A;  3QD6 A;  4P00 B;  2VEC A;  2PQS A;  3M3O A;  1QJU 1;  3HR9 A;  4FXG B;  3H8R A;  4P9J A;  4QX5 A;  1CGP A;  2ZXQ A;  5LBF A;  2R0F A;  3JQX A;  2XKP A;  3HWJ A;  2WNU A;  4LE4 A;  4Q4X 3;  2OUJ A;  5LA2 A;  4AFC A;  4CXX A;  3QAC A;  1OF4 A;  1U5Y A;  2HWE 3;  2MNG A;  5A3T A;  4Y22 B;  1F4A A;  3IAP A;  1F15 A;  3Q8A A;  3WNM A;  1PO2 3;  3CQO A;  3CZJ A;  1PMH X;  3U14 A;  3LDR A;  5TSW A;  1C1L A;  2DU1 A;  4P14 A;  4YVW B;  4J1W A;  2ZEY A;  1LOF A;  2HWB 3;  1VP6 A;  5DQ0 A;  5LEJ A;  4JV4 A;  2YMZ A;  1LU1 A;  2XOM A;  1AR8 3;  1MQT B;  1UX7 A;  3BOW A;  1JZ2 A;  1HRI 1;  2HWF 3;  2VME A;  1XE8 A;  3D3A A;  3FBM A;  1UAI A;  4OMD A;  5FYY A;  2R49 A;  4C8D A;  4AF9 A;  4AVV A;  1ZA7 A;  2VG9 A;  4GB3 1;  1NXD 1;  2YZ4 A;  3WDY A;  3WF1 A;  5JPM B;  4N53 A;  3VBH A;  2O8Q A;  2P1B A;  4XJU A;  1GBG A;  4YFZ A;  1RUG 1;  4XTP A;  3CEW A;  3B93 A;  1WD4 A;  1F2N A;  4W6W A;  3ALQ A;  3D4K A;  3POW A;  3UYJ A;  4XUR A;  1CWP A;  4CP1 A;  1PHM A;  4MXV A;  2RV9 A;  1PIV 1;  2XQX A;  2A3X A;  3LIH A;  1H6X A;  3BCW A;  2LS6 A;  2MHF A;  2VMC A;  4OZX A;  2D6O X;  3WDU A;  1UY0 A;  4E8C A;  4CP9 B;  1TME 1;  2GN3 A;  5FXV A;  4RHV 3;  1H2K A;  1YCI A;  3GHN A;  1D2S A;  4GQ7 A;  5FZL A;  5G04 L;  2QE3 A;  3NV3 A;  2Z79 A;  3R4S A;  3W9A A;  4KWJ A;  3JU9 A;  1I6X A;  3LD8 A;  3RVH A;  1OKQ A;  2GAU A;  5C4W B;  2IXJ A;  3FWE A;  4Q4Y 1;  3USU A;  1QH7 A;  4OUS A;  4ZXK A;  1W99 A;  1GIC A;  1W6P B;  4RGA A;  3ZYP A;  5BNP B;  3HBZ A;  3U4X A;  4DY3 A;  2WFF 3;  3PVE A;  2FDG A;  3WW1 A;  3I2K A;  3H9A A;  4NRO A;  2JDN A;  4X8N A;  5LCW L;  2WNU B;  3IBM A;  1WMF A;  2Q1Z B;  4E4H A;  1UCX A;  4JGZ B;  3ZIW A;  1AX2 A;  4AVB A;  1OD5 A;  3POB A;  2P4E A;  4E8D A;  4GJZ A;  3AP4 A;  4D7Y A;  3PJQ A;  2VQT A;  1DYO A;  2NMO A;  1NKG A;  5CFD A;  3VL9 A;  4AXO A;  3GJA A;  3DKQ A;  5BNP C;  4BB3 A;  5LRS A;  2FDI A;  1ZVF A;  2DFC A;  4Y1X A;  4RR3 C;  1ASJ 3;  4YW4 A;  3PJY A;  2A6W A;  3ETP A;  1J58 A;  1J1L A;  5FV3 A;  4BQ3 A;  2XL7 A;  2IFR A;  3HQX A;  1GSL A;  5BV6 A;  2E7Q A;  3ELN A;  5DDJ 1;  4FP3 A;  1FPN 2;  4GH4 A;  4Y5Z 0;  2CV6 A;  4B29 A;  4CEY A;  1KJR A;  4HSJ A;  1JOJ A;  1W0N A;  5CEH A;  4D3W A;  3BUC A;  1UZY A;  4YG6 A;  5JI9 A;  5JPN B;  3RZK A;  5FUP A;  4XHX A;  3C7F A;  4HBN A;  5T52 A;  4R9B A;  2DBI A;  2HWC 1;  4L0P A;  4MGT A;  1LRH A;  4HKL A;  4N43 C;  5FP8 A;  5BUV A;  4XEZ A;  1JW6 A;  1Q8Q A;  4D6S A;  1VAM A;  3BVC A;  4IW3 A;  1AJO A;  2ORX A;  4HKW A;  5DAV A;  1VBB 2;  2VH9 A;  4LQR A;  3B3Q E;  3GZA A;  1W0O A;  1CX4 A;  5H9P A;  1FOD 1;  1ZBA 3;  5C4W A;  2KR2 A;  2VMG A;  5L36 A;  1UKG A;  5ERL A;  3USU B;  2VXR A;  5D8A B;  1OD3 A;  3POS A;  1AYM 3;  3X29 B;  1NE4 A;  5FZ7 A;  2WZ8 A;  3I3B A;  2E6V A;  4LXL A;  4FTE A;  3NJY A;  2BQP A;  3NVC A;  2ZHK A;  3KCX A;  4K20 A;  3ZFG C;  3AYA A;  1HQN A;  2JDK A;  5GM0 A;  3TN9 2;  4JQR A;  1IPK A;  4PBP A;  4QQ2 A;  4N9H A;  4OVE A;  3IIA A;  2Y33 A;  4WM7 A;  2C4X A;  1UY2 A;  4JGZ A;  3I2I A;  5HXM A;  1PO1 3;  1WMX A;  3RPQ A;  3D82 A;  1IQA A;  1ACC A;  2ARB A;  5BY5 A;  1NCQ A;  2WO1 A;  4Y3O A;  5CB7 A;  5IK7 A;  4XIO A;  2WFF 2;  1PZ9 A;  4FFF A;  4WZC A;  4KU7 A;  1Y9Q A;  5EJ1 B;  1Q56 A;  3UV9 A;  3M3Q A;  4Y4Y A;  2B5H A;  1XBF A;  4OHX A;  4Y24 A;  3R0R A;  4IEZ A;  3LPG A;  5AFE A;  3OD4 A;  1ZRE A;  5EFU A;  1H1I A;  1NA1 A;  2Q8O A;  3TOJ A;  1V0A A;  1W8U A;  2EVX A;  1MZF A;  4A6O A;  4OYU A;  3ZXA C;  5IVC A;  3RZJ A;  1HJG A;  2WS9 1;  3VBF A;  4Y1Z A;  1KRI A;  3FHA A;  1UMH A;  3SKJ E;  4BK5 A;  1LHV A;  4HON A;  1WCU A;  1POV 3;  4LIT A;  5CYY A;  2AEZ A;  2PLV 2;  1RUF 3;  2OQ6 A;  1KGY A;  5ISL A;  1UYY A;  3MIF A;  4AR2 A;  1DF0 A;  1NT0 A;  1GWL A;  1VBC 2;  1BYH A;  1RUG 3;  4O9G A;  3SLI A;  1COV 1;  1LU2 A;  5LEK A;  4H2A A;  1DZQ A;  3TN9 1;  4ASM B;  1A3K A;  3CO2 A;  3WCS A;  3VBU B;  5AC9 2;  4LBQ B;  2D44 A;  2WO3 A;  2ZEZ A;  3C3V A;  4XDQ A;  5C71 A;  4JKK A;  2F4P A;  2NPI A;  4DOU A;  4FPO B;  2GP3 A;  4HVO A;  4A6S A;  2BU9 A;  2BGC A;  4AFD A;  2OQ7 A;  2JB8 A;  1GZW B;  1MVE A;  2JG9 C;  2QQU A;  1NXM A;  5CZK A;  2PLV 3;  4Q0Q A;  1XND A;  1BHG A;  2V5D A;  2P6C A;  4FFI A;  4MX3 A;  2R0H A;  1MS0 A;  1ND3 B;  4QX3 A;  4LUM A;  1AL2 3;  3LA7 A;  4XUQ A;  1C57 A;  1PK6 A;  4LBK A;  1LHN A;  1NZI A;  2JIC A;  3ME2 A;  3OY8 A;  3SH5 A;  5DAP A;  4NHX A;  4O9E A;  3I7D A;  1C5I A;  5FMD A;  2IUW A;  1DQ6 A;  3N7K A;  4Y22 A;  5F3E A;  4AVT A;  4AHY A;  2PHT A;  2UUR A;  3H3U A;  1HV1 A;  3KV9 A;  5KHH A;  4NAM A;  4BJ0 A;  5FYV A;  4CDU A;  1YO8 A;  3VN4 A;  1NCQ B;  2I07 B;  4DXS A;  2IWG B;  4XIK A;  5KC5 A;  3B94 A;  2XHK A;  3AFK A;  4LBN A;  1GAN A;  1LEM A;  3AZY A;  4UAP A;  1W2A X;  1XYN A;  2A5Z A;  1MQT A;  4EZ4 A;  3K4A A;  4XIL A;  5IAX A;  1LOD A;  1QXJ A;  4W8J A;  4QKD A;  2ZEX A;  4CU7 A;  3LSE A;  5ACA 2;  1AYN 3;  2JWP A;  1UU6 A;  4IGP A;  1JYV A;  2YC2 A;  4P9I A;  3N9M A;  4N90 A;  1CES A;  2GH8 A;  3OBT A;  3VBS B;  1RUH 2;  4MET A;  3BKZ A;  4TTG A;  5CFC C;  5IYY A;  4DPN A;  3DF0 A;  4FXK B;  5I0S A;  2FMD A;  2R04 3;  3AB0 A;  3EYP A;  2H0V A;  4QPY A;  4XZU G;  1HJF A;  4BU2 A;  1L7L A;  2A75 A;  2ET1 A;  3TEX A;  5BNQ A;  1JI6 A;  5ABJ B;  1IOA A;  2CAV A;  5KXD A;  3A21 A;  1UYP A;  3SH3 A;  2P3Y A;  5EXO A;  3SCF A;  4BMB A;  3SEP A;  3ZN6 B;  3VL8 A;  2K0G A;  4NR1 A;  2WWS A;  4NIH A;  1SLA A;  3A22 A;  1OUS A;  3OPZ A;  4LO7 A;  4LR4 A;  1QQP 2;  5CVR A;  4AG4 A;  1JHN A;  2EAA A;  3P1I A;  3AKP A;  3WEZ A;  2WYF A;  4ARX A;  2G1M A;  1IPJ A;  1STM A;  3ZKY A;  2CGP A;  2Q8D A;  2R16 A;  5L7O C;  2OZ6 A;  3R4U A;  5F2S A;  4FBF A;  1SCR A;  3MUY 1;  5F5C A;  2W94 A;  1CZT A;  3MIC A;  3NL1 A;  2BRT A;  4AVC A;  1RIR A;  1G9C A;  1CAV B;  2XUM A;  4NRM A;  2QQJ A;  4IE4 A;  4QQP A;  2Q8C A;  4F7Z A;  1FMD 2;  1LR5 A;  1QJY 2;  1DZR A;  3LB9 A;  4N53 C;  3LFI A;  4OI4 A;  4ERO A;  1LCL A;  1FPN 3;  4R9D A;  3LOB A;  2ZAC A;  4V2V A;  2GND A;  3E6B A;  5DZF A;  2XBO 1;  3LQC A;  4Y5T A;  5CFD B;  2CL2 A;  2VTX J;  1VBE 2;  2JXA A;  2VOK A;  4LO4 B;  1W06 A;  1SLL A;  1O3Q A;  1VRH 1;  2RR1 1;  2W95 A;  1K42 A;  5FBJ A;  4QMA A;  4CCN A;  1RIT A;  5KHJ A;  4MOA A;  4XBN A;  2P17 A;  3POI A;  1KJL A;  4L8Q A;  4PDW A;  3WQ0 A;  4L92 A;  1W8T A;  1RTV A;  3D6E A;  3WG3 A;  2VNO A;  1EV1 3;  2NQY A;  2J1A A;  1HW5 A;  1PGS A;  1JOB A;  2GSY A;  3CMG A;  4LTA A;  4LBJ A;  4GH4 B;  5GLZ A;  3J7L A;  1F4H A;  1K5J A;  3WR0 A;  3E5U A;  2Y6L A;  2GC3 A;  4PI2 A;  2AGS A;  1O4Y A;  1VBE 3;  3WDW A;  1QJU 3;  3GYD A;  2XPJ A;  1KD7 A;  1ZA4 A;  2ZMN A;  1CAU B;  1RUC 2;  1CR7 A;  2VGD A;  2IXC A;  2Y6K A;  3KB5 A;  4AE2 A;  2YFZ A;  1AVB A;  1POV 0;  5C9A A;  4Q4X 1;  5J96 B;  2X8K A;  3AYD A;  4XET A;  3ZSL A;  1RB8 G;  1ASJ 1;  4MVT A;  4FQZ A;  5A1L A;  3GZU C;  1G9A A;  1C8M 3;  5CAZ A;  4JCK A;  5FAX A;  2DDU A;  2ZX4 A;  1WW4 A;  3KV5 A;  1XB9 A;  2D43 A;  3LDK A;  3N36 A;  4LUK A;  2O14 A;  5A6Z A;  4C0H A;  1DGR N;  4C90 A;  1SLT A;  4AAX A;  5D1I A;  5A70 A;  3VDD C;  2WS9 2;  3T4V A;  3S57 A;  1Q43 A;  2R04 2;  5C33 A;  4BHP A;  2BYV E;  5FZ6 A;  1YIF A;  1OF3 A;  5JVV A;  1W8Z A;  3MV1 1;  2VZO A;  3T0D A;  3MF6 A;  2EIC A;  4B4Q A;  2VBB A;  2VZS A;  2YGM A;  4OZO A;  2RR1 2;  1HXS 3;  2V5Y A;  5L9B A;  4WBB A;  2C5D A;  1WUV A;  1E5R A;  5B4X A;  5CFC B;  1AUY A;  3VBR C;  3OSD A;  5A7Q A;  1MPX A;  1O91 A;  3RZM A;  4I0W B;  1EY2 A;  5F3I A;  1SBE A;  5FY5 A;  3QCW A;  3E1F 1;  3FN9 A;  4HET A;  4XDO A;  4AI1 A;  3SNM A;  2VCA A;  3TNQ A;  3RWK X;  3RRD A;  3ZOI A;  2DF7 A;  3CU7 A;  1CJP A;  4CEW C;  2BFU S;  2O8O A;  3AX4 A;  2EIB A;  1ODM A;  1KDK A;  4DRR A;  1IZ3 A;  2Q4S A;  3VZL A;  1YQ8 A;  3B9I A;  3J26 N;  3H0O A;  2VNG A;  5C4W C;  1QF3 A;  2I74 A;  2VW1 A;  3AJZ A;  3BTA A;  3C7O A;  1JZ8 A;  3PTR B;  4M4P A;  2D5F A;  4AI0 A;  2RS3 3;  4PT6 A;  1X36 A;  2GME A;  3N7J A;  4Q4W 1;  5FYI A;  4MG2 A;  3O7O A;  4X6R B;  2BNM A;  4BQX A;  2HEY F;  4Q5O A;  1NG0 A;  5FOJ B;  1NOV A;  1CAU A;  2R06 2;  4PF5 A;  4I02 A;  2VPV A;  3HVD A;  3T08 A;  2HLE A;  4IE6 A;  3AL5 A;  3BTZ A;  4EWD A;  4Q1P A;  2VQU A;  5AVA A;  3TEY A;  3NV2 A;  3NMB A;  4ATF A;  4IE5 A;  2R04 1;  4LBQ A;  4Q4V 3;  4WM7 C;  2V4V A;  4XMA A;  3FFQ A;  2N7G A;  1SPP B;  2HKX A;  1QJX 3;  4COV A;  3LGR A;  1D0G A;  4XJZ A;  1ULE A;  3M7A A;  2VJX A;  2BER A;  3I4I A;  2WAA A;  5E1R A;  3VBS C;  2A3Y A;  4OHV A;  5A32 A;  4QPI C;  4XUT A;  5LW9 A;  3HPN A;  4XF1 A;  1W9Y A;  1Y43 B;  3KHB A;  1JTZ X;  4RGG A;  1PO2 1;  3JB8 A;  4JZR A;  4MZU A;  3N7M A;  3ACI A;  1I3H A;  5C5U A;  3UES A;  5EYX A;  4D6Q A;  2GAL A;  4GXL A;  2ZMK A;  1JZ5 A;  3FX3 A;  1LHW A;  4CCM A;  1ULC A;  4PQQ A;  3ZYF A;  2JIG A;  2ERF A;  2WNE A;  4YYO A;  5T54 A;  5DUW A;  1HRI 3;  1UYX A;  1RUD 1;  2JKB A;  1V6L A;  2HYK A;  4EWE A;  1H2N A;  1HN1 A;  3MIB A;  5LY1 A;  5A3M A;  4GA9 A;  1AYM 2;  4A7Z A;  4M3C A;  1D4V B;  3UGF A;  2Z2S B;  2O0O A;  3SCH A;  1QHD A;  4NOT A;  5IVE A;  4FCA A;  3RG0 A;  4L99 A;  5J3U A;  4CCO A;  3JB4 C;  1AL2 1;  2ETE A;  5IVV A;  1GU3 A;  1GFF 2;  1LGC A;  2NLR A;  1BJQ A;  2QNK A;  4NN0 A;  1OHF A;  3AZV A;  1W6N A;  1C8N A;  1A8D A;  2VVE A;  2RDQ A;  4UWD A;  1EYB A;  3U11 A;  4AQ2 A;  5I91 A;  5FZO A;  5KHI A;  3K3N A;  3T4H B;  1LHO A; 
#chains in the Genus database with same CATH homology
 1UWW A;  2V72 A;  1LNS A;  4GZ9 A;  4QX0 A;  2ZXQ A;  3IAQ A;  5LA2 A;  2VZT A;  2J22 A;  1OF4 A;  1PX4 A;  1F4A A;  3IAP A;  3MV0 1;  3WNM A;  3CQO A;  3CZJ A;  1PMH X;  3IDA A;  2VZ1 A;  1O59 A;  2ZEY A;  2VZU A;  2JDA A;  3ZM8 A;  2VC9 A;  3HN3 A;  4XUP A;  2KD7 A;  2XOM A;  1UX7 A;  1JZ2 A;  2VME A;  4DUW A;  5G05 L;  1JU4 A;  3D3A A;  4ZXE A;  1O8P A;  3NNG A;  4GWJ A;  4OMD A;  2VZ3 A;  2C26 A;  3WF1 A;  2B9V A;  1GNY A;  2QBX A;  2J1V A;  3SEE A;  1JHJ A;  1W8O A;  1UMI A;  1WKY A;  2W9X A;  2Y6G A;  4XUR A;  2W47 A;  3GDB A;  1CIY A;  3WF4 A;  2RV9 A;  2XQX A;  2WO2 A;  4LHS A;  1H6X A;  2LS6 A;  2VMC A;  2EIE A;  1UY0 A;  4E8C A;  3LPF A;  2BBA A;  3I2G A;  3GM8 A;  3I2F A;  5JXH A;  2X10 A;  5G04 L;  4BDV B;  4A41 A;  1I5P A;  2CDP A;  1XNT A;  3C7H A;  3AC0 A;  2ID4 A;  4D8M A;  3EB7 A;  5DN2 A;  1W99 A;  3OEA A;  3U37 A;  1SDD B;  4M4R A;  5C70 A;  2BZD A;  2VM9 A;  4P02 B;  3W5M A;  1GQP A;  2QQI A;  2VMD A;  3I2K A;  4W4Z A;  5LCW L;  4UI9 L;  4HG6 B;  2X09 A;  3CZU A;  2J1S A;  4QB6 A;  4ZZ5 A;  1W9W A;  2W46 A;  1PX3 A;  2HYX A;  2VZP A;  4E8D A;  3WF2 A;  2VQT A;  1DYO A;  2VR4 A;  1NKG A;  3DEC A;  2Z4F A;  3F2Z A;  3BGA A;  3I3D A;  2J7M A;  4A4A A;  3WQB A;  3ETP A;  2QQO A;  4LKS A;  2XHN A;  2B4K A;  5F7U A;  3DYP A;  3NQH A;  4QB1 A;  3VD5 A;  2Y6J A;  1W0N A;  1H6Y A;  3K4D A;  1JZ3 A;  2W5F A;  3C7F A;  2VTF A;  4KWU A;  4L0P A;  1JYW A;  2QQK A;  2ORX A;  2VO5 A;  3OB8 A;  4XVH A;  4LQR A;  2RJ2 A;  5IFT A;  4FI9 A;  2W92 A;  1UY1 A;  3P6B A;  1YQ2 A;  1OD3 A;  2W3J A;  4QPW A;  1GUI A;  2Y6H A;  2WZ8 A;  1GOG A;  1KEX A;  2LW8 A;  3I3B A;  4QX1 A;  2RVA A;  3FL7 A;  1K12 A;  2WN2 A;  2DCJ A;  1CZS A;  2WQ8 A;  3WF3 A;  2C4X A;  1UY2 A;  3ACF A;  3I2I A;  5HXM A;  3T2Q A;  1J83 A;  1EUU A;  1XPW A;  3A7Q A;  3T0B A;  1UXZ A;  1W9T A;  2WO1 A;  4CUB A;  2WBK A;  5EJ1 B;  5IHR A;  4A45 A;  3HNY M;  2L9L A;  4ZY9 A;  5DMY A;  3I3E A;  3LE0 A;  1XNA A;  3LPG A;  2ZEW A;  2WAO A;  4ET7 A;  1US2 A;  1XC6 A;  2Y8K A;  4A6O A;  2YFU A;  4OYU A;  3I97 A;  2YG0 A;  3DYO A;  3FHA A;  1UMH A;  3SKJ E;  4BK5 A;  5CYY A;  3OG2 A;  3IB3 A;  4IUG A;  1KGY A;  5DPN A;  1UYY A;  2W1Q A;  5IJR A;  3K77 A;  4A3Z A;  3NJV A;  1CZV A;  1EUT A;  1PMJ X;  1NUK A;  1WCQ A;  4DXT A;  1TG7 A;  2WO3 A;  2ZEZ A;  5C71 A;  2E31 A;  4JKK A;  4UOJ A;  3THC A;  1UY4 A;  5CZK A;  2X05 A;  3WF0 A;  1BHG A;  2V5D A;  4OMC A;  1W9S A;  1CX1 A;  4QX3 A;  3WNK A;  1OT5 A;  1J84 A;  2WUH A;  4XUQ A;  2DCK A;  4Z2A A;  1GOF A;  3OGV A;  5IFP A;  4JKM A;  3GGL A;  1ULO A;  5JUV A;  3FHQ A;  5B4N A;  2W91 A;  3UNP A;  2W1W A;  4BJ0 A;  4GWI A;  2Y64 A;  4DXS A;  2JD9 A;  3THD A;  5J1X A;  3HJR A;  2BGO A;  4A44 A;  3ABZ A;  4UAP A;  2VOT A;  3K4A A;  4XUO A;  2J1E A;  4W8J A;  2ZEX A;  4CU7 A;  2VCC A;  2JKX A;  1JYV A;  3DYM A;  2YC2 A;  4QDS A;  2VCB A;  3K46 A;  2J1T A;  3C7G A;  4KI5 M;  4TTG A;  5IYY A;  2YB7 A;  4LPL A;  3K4Z A;  2VL4 A;  3EYP A;  5EIY B;  1JZ4 A;  4XZU G;  1JI6 A;  5HPO A;  3VDB A;  3A21 A;  2OKX A;  3SEP A;  3VD3 A;  1UZ0 A;  3OGR A;  4BXS V;  3A22 A;  3T2P A;  1D7P M;  1T2X A;  4AG4 A;  4QX2 A;  3P1I A;  3ECQ A;  4ARX A;  2VZR A;  3WEZ A;  5JXJ A;  3VDC A;  2W1U A;  5A1A A;  4DEQ A;  3A23 A;  3MUY 1;  2W94 A;  3VD4 A;  1CZT A;  1UXX X;  1TVG A;  2QQJ A;  3VD9 A;  4QAW A;  3OEB A;  5FUI A;  4DUV A;  3HEI A;  3GXU A;  3LEG A;  3ACG A;  2QQM A;  1US3 A;  1IQD C;  3PUH A;  3MBW A;  4ARY A;  1L7R A;  1R64 A;  4JHZ A;  3LQC A;  3CKH A;  5JXG A;  1O8S A;  4CU9 A;  5EJZ B;  4DEV A;  3OGS A;  2XON A;  4MAD A;  1K42 A;  2W95 A;  4BK4 A;  1SHW B;  4MOA A;  3HNB M;  4ZZ8 A;  4CVU A;  2WN3 A;  2J1A A;  5DQ0 A;  3CMG A;  3NJX A;  1F4H A;  1JU3 A;  2Y6L A;  4JX0 A;  3MUZ 1;  1UYZ A;  3OBA A;  5I0D A;  2Y6K A;  2C9K A;  2WYS A;  2QQL A;  2YFZ A;  1L7Q A;  2VZQ A;  2J1R A;  1DLC A;  2DDU A;  2E32 A;  4P08 A;  4RN5 A;  2VMF A;  4QB2 A;  5JXI A;  4KMQ A;  4AAX A;  4YPJ A;  2EID A;  1ULP A;  4DXR A;  1GMM A;  1OF3 A;  1JYX A;  3WNP A;  2WDB A;  4MO3 M;  3MV1 1;  2VZO A;  4XUN A;  3HNM A;  1RYY A;  2QQN A;  3T0D A;  4DUX A;  4CU8 A;  2EIC A;  4MGS A;  5C7G A;  1GOH A;  2VZS A;  2JE8 A;  4OZO A;  4OUE A;  2VZV A;  3CIH A;  1DP0 A;  4TXW A;  5B4X A;  1JZ6 A;  3J7H A;  4QDR A;  1JYN A;  3K75 B;  1MPX A;  1K45 A;  2W87 A;  3E1F 1;  3FN9 A;  5JR2 A;  2VCA A;  3UET A;  1OH4 A;  3HOB A;  3WNN A;  2EIB A;  4MGQ A;  3SKV A;  3C8X A;  3JXS A;  2YC4 A;  3VDA A;  2ORZ A;  1JZ7 A;  1SG3 A;  2W1S A;  4JKL A;  4PF1 A;  2WAB A;  1JZ8 A;  3C7O A;  4M4P A;  4PT6 A;  2WZE A;  1NX9 A;  5LA1 A;  3T08 A;  2HLE A;  2VQU A;  2J1U A;  2V4V A;  3LEI A;  3WNO A;  2E26 A;  4CU6 A;  3WNL A;  1NAE A;  1W8N A;  5JMO A;  2VJX A;  2BER A;  4D0Q A;  2WAA A;  3W5N A;  4XUT A;  4RYD A;  3HPN A;  3ACH A;  1P8J A;  3ACI A;  1K3I A;  3UES A;  3C7E A;  3T2O A;  1JZ5 A;  3LEK A;  3T09 A;  3VD7 A;  4PQQ A;  2R7E B;  3III A;  1UYX A;  3NRU A;  1HN1 A;  4W50 A;  1UY3 A;  4P5Y A;  5LA0 A;  3BN6 A;  3I2J A;  4CUA A;  4CUC A;  4QDQ A;  4A42 A;  3T0A A;  3WSO A;  3CDZ B;  3MO4 A;  1GU3 A;  2CDO A;  2BGP A;  2E33 A;  3PUI A;  4P00 B;  3I2H A;  2PQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...