4NIHA

Crystal structure of alkb e136l mutant protein with cofactors bound to dsdna containing m6a/a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
201
structure length
201
Chain Sequence
PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDLPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Switching Demethylation Activities between AlkB Family RNA/DNA Demethylases through Exchange of Active-Site Residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/dna
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
total genus 47
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2013-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4nihA00
3O1SA 3H8XA 4NRMA 4OCTA 4ZHNA 4RFRB 4O7XA 3O1VA 3LFMA 3O1PA 4NRPA 4NIIA 4QKBA 4QKDA 3T3YA 3BIEA 4QKNA 4NIDA 4NRQA 3BUCA 3BU0A 3BKZA 2FDKA 2FDJA 4CXYA 3KHCA 3RZHA 3S5AA 3BTXA 2FDIA 2FDHA 4O61A 2IUWA 5DABA 3I49A 3RZMA 3I3QA 4ZS3A 4ZS2A 4IE5A 4NPMA 3H8RA 3BI3A 2FD8A 4NIHA 3RZGA 4IE6A 4IE4A 4JHTA 3O1OA 4NROA 2FDFA 4IDZA 4MG2A 3O1TA 3S57A 3BTYA 3O1RA 4CXXA 2FDGA 3I2OA 3BTZA 4NIGA 3O1UA 3RZKA 3KHBA 4NJ4A 3T4HB 4MGTA 3I3MA 4QHOA 4QKFA 4CXWA 4IE7A 5F8PA 3RZLA 3O1MA 3H8OA 3RZJA 4NPLA 4IE0A 3T4VA
chains in the Genus database with same CATH superfamily
1QQP2 2AC1A 4RFT0 5IK8A 2KR2A 5D21A 4FI9A 1GICA 2VMGA 1XBFA 5FYZA 1IQDC 1DQ2A 5SV8A 1A34A 3B02A 1YHFA 2CGNA 2RM23 4GA9A 4QXKA 5ABJC 4V1PA 1PGW2 2GDFA 5CNAA 5F3GA 2RDNA 2ARAA 5CISA 2RJKA 1F9KA 1O8SA 1KFXL 1AR72 4LO7A 4FAGA 1NY72 3FMGA 5F5CA 4C0BA 2ZABA 1AR93 1ODMA 3KCCA 2AACA 2VQUA 2A6VA 2I07B 4JRLA 5FZ1A 5H9RA 1H2NA 2MEV3 3OY8A 4AEKA 2PTMA 2JJ6A 1ST8A 4UW5A 3AMQA 3WINE 4LA2A 3MIGA 3VBRB 4DINB 4LIVA 5J96B 5K0UA 2UYBA 2X5IC 4QKNA 3VBOB 3NJXA 1ZBE2 3T2PA 2PHXA 5JIUA 4LHKA 4INDA 3VD3A 1EAH1 4YVWC 1VB4A 1YIFA 2IUWA 2J1AA 3FLRA 1AUYA 4K21A 1IG0A 1MZEA 4AYUA 1JW6A 1D7PM 3KM5A 2C24A 2RS12 1JI6A 1A6CA 3RQ0A 1UXZA 1KITA 1W0OA 4S2HA 1H1AA 4IETA 4YW4A 2A73B 4KQ7A 4IL7A 1PO13 3N7KA 1VRH2 1HQWA 2YU1A 2WO3A 4FFIA 4MGKE 3ZYGA 1NE6A 2VBBA 5DG1A 1UKRA 2CGOA 1AX0A 2D40A 2ZHKA 1C57A 2VR4A 1LOGA 4CDXA 3BKZA 2ZOEB 4RQPC 1ZZ6A 2BGOA 1GWMA 4M00A 1JUIA 1XNTA 1XYPA 1ZBA1 2Y6KA 3ES4A 3QACA 4QPGC 3WW3A 1LHVA 2Q5TA 3EBRA 1H2KA 4LO4B 4NIAA 3HN3A 1AJOA 1BHGA 4L8QA 4JDOA 1XNCA 4YZ3A 5I0SA 1ZM1A 5D2AA 3I2DA 4KBBA 4YM2A 1KXGA 4GKYA 2QQPA 2PYTA 1XC6A 2GN3A 2VECA 3W9AA 1CZSA 1VE0A 3CF6E 2O1QA 3HBKA 1LGNA 2K9ZA 4OHYA 2IWGB 2DCZA 5FLHA 1HRI1 3POIA 3OGGA 4AF9A 1DF0A 1EV12 4JTNA 5DG2A 3ZN5A 2JX9A 3GHMA 3TBDA 2RMU1 2PAKA 2P2KA 4GZ9A 1QXPA 2HWF3 5AC93 5IAXA 1OVPA 3MI8A 4XCBA 3HR9A 3N9LA 5IHRA 5L9BA 1R083 1RUNA 1X36A 3TOJA 1OD5A 3MFCA 3G6JB 4A7YA 3ALQA 4WVZA 4MXWB 4N43A 5TSWA 2Y33A 4YW1A 3DYOA 2Y6GA 5JCTA 4QWNA 1W8TA 3RRDA 1D0HA 5DAVA 1S4CA 3U1XA 1JHNA 4A41A 1C8NA 1NQJA 5EJ1B 5CAZA 4EZHA 3ZXGA 3NW4A 2CAUA 4GKXA 3ITQA 3Q8AA 4TTGA 3PVNA 4LO6B 3DPRC 4ZU5A 1PZ9A 2E53A 2X5IB 2HH9A 1CAWA 2ZGSA 4CDUC 2VY0A 4URAA 1QOOA 1G9DA 2FDKA 4XZUG 2RG4A 1WLTA 2GC3A 1VBA1 2PHTA 5FZDA 2FDHA 2VC9A 2OUJA 3FL7A 1UCXA 3HNBM 5C8CA 3ILFA 3R6SA 1W3XA 1ONAA 5L7OB 1RUD3 4IEYA 4MADA 3VN4A 1NA1C 5JXIA 3LEIA 2E33A 1NCQA 3ROUA 5HCHA 5BNOB 4BCUA 3LSEA 1BCXA 3NV2A 3A4UA 5AVAA 5KXCA 1IGOA 1YYNA 5EJZB 5F5IA 1MVQA 2QQVA 3I54A 4RHV3 1JYCA 4ATEA 5BNPA 1EUUA 1FPN3 3WLUA 1NQDA 3JBG1 1Q8QA 4I0AA 2KA3A 3OUHA 1HRV1 2IXHA 3VZLA 2HWB2 1VBB1 4GB33 1DBNA 3JUUA 3ZR6A 2PA7A 2DYCA 1LU1A 3KWVA 2PAMA 2WT1A 4YM0A 2OQ6A 2Y8KA 3WV6A 4MG2A 4KWUA 1IZ3A 2DUPA 4IGOA 1AR63 1YFXA 2VBDA 4QD2A 5J37A 1CX4A 5LRRA 3PLQA 1IG3A 3Q9OA 1G9AA 2V5DA 2JDNA 4NHXA 3UT0A 3MLJA 3PIGA 4JDMA 1HRI3 3H50A 1Z7S2 4CEWC 3HWJA 2ERFA 1ZBA2 2GNMA 3J7HA 4HLTA 4KU8A 3HT2A 1QF3A 1U5YA 3M1HA 4XDPA 3V0BA 1F8VA 3KV9A 4LK6A 4QT6A 2XBO1 4Y3OA 4NIDA 2L9LA 5FWJA 1EP0A 5A1LA 1GOGA 1UYZA 2D44A 3K4ZA 3K46A 3O0XA 4QX2A 4UBGA 3ZSEA 4PT6A 5DUVA 4YGDA 1MACA 5JPMB 1S0IA 3D3AA 4BQYA 4CPBD 3WCRA 4RS5A 1HN1A 2XGXA 4YZ2A 1VRH1 3IM0A 1OKOA 4N43C 5FZ3A 4Z8BA 2ET1A 1N1SA 2FQPA 3KS7A 4LLFA 5FOJB 4AEDC 4I0WB 2RS11 4JHZA 2R0HA 1QJX1 4KGGA 1UZZA 3K77A 2R6QA 2XLFA 5FYTA 4RD7A 1LOBA 3OF1A 1VIWB 5K4LA 2DVFA 3MUZ1 4FPJA 3Q8BA 4MGIE 2BVBA 3MGUA 1N47A 1GP4A 3AFKA 3LSDA 3SKJE 4EZ4A 3K4AA 5C8CC 5I0TA 1PIV1 1GNYA 4ZXKA 1AXKA 2VD7A 4XFBA 1HRV3 2VNGA 5D8AC 4CCNA 1RB8G 2X53S 1U5IA 2ZMNA 3RS6A 1UY3A 4M0HA 3MICA 4DXSA 4YFZA 4HANA 5FZEA 3ST7A 2MNGA 1URXA 2BEOA 5FIXA 4YPJA 1IS3A 4WM7B 4WZCA 3U10A 2K46A 1JODA 3AFGA 4NHYA 3EYPA 4CEYA 2PHDA 2CAVA 4BK5A 1RHI1 2VOTA 5A32B 4XIKA 1MS0A 4QKDA 3DGTA 4GWJA 2W95A 3U4SA 5JZGB 2WT2A 1UW8A 4E2QA 2XBO3 4ATFA 2XXZA 2EAAA 2UU8A 1AR92 4P9GA 2WWUA 3WNPA 5JR7B 1PO21 3CZUA 2J22A 4AGGA 1LKNA 4GWNA 1CZTA 3QH7A 3W59A 2VMDA 4IEWA 2ZJCA 4BM8A 2YG0A 2CTVA 4NJ4A 4QGMA 4IXLA 2I2SA 2XHKA 3CZJA 5IUQA 2WNUB 3N3HA 1QH6A 5JXJA 3C7HA 4COWA 1I6XA 3OEBA 2OQ7A 2YC4A 3S7EA 3WP4A 1SPPA 2DBNA 1VBD3 3UKTA 4JKKA 1NLSA 2WIIB 2YV8A 5K8SA 2W39A 3JQXA 1GOFA 1UZWA 2JDAA 5CKMA 1KD7A 1E5SA 3N36A 3KT1A 5KHKA 2G4IA 4N53A 4QHZA 5A6QA 2VO5A 3W21A 1PGL2 3CQOA 2OXBA 4CDQB 1V6KA 3R0RA 4FPHA 1H8TB 5A7QA 3KHCA 2D3SA 2WZPP 2XKPA 2HWD1 2VZSA 4XAAA 1AX1A 3EQEA 2LTNA 1VR3A 5LEJA 1WA4A 3N35A 1KJLA 4E4ZA 1PNGA 3H3UA 3J4UH 2DTWA 3OBAA 2W1UA 3LDBA 1XNKA 1ZZ7A 3X29B 1OUSA 2Y26A 1W6OB 4XCAA 4FTBA 1E5IA 3CKHA 4N90A 1YJLA 2G1MA 4P00B 1Q3EA 4ZU7A 5BNNB 4ZY9A 2CDOA 5GLWA 2VMIA 1GZWB 1WW6A 2QTWB 1H8VA 1TNFA 4CYDA 4WZFA 5HPOA 1DQ1A 2JG8B 2WN2A 3WR0A 1W6NA 1OUXA 1QJU3 1QJY1 2B9VA 3ZFEB 4JHTA 2FCVA 2HWF1 3KVAA 5AC91 2A6YA 1LOFC 1QIQA 2VJXA 5I93A 1HJGA 1YQ6A 3S7IA 3ZYIB 4AG4A 4AGRA 5AFEA 4COUA 4HN1A 1GNHA 2JICA 1CAXA 5IK5A 3DCQA 5HCFA 1R093 1LENA 4XF0A 5EPAA 1S2KA 3U37A 2CL2A 4CZSA 2RS31 2Q1ZB 4N7UA 3ZFGB 4DUWA 2K2SA 1R1A3 4Q2FA 3AL6A 5A3UA 4XAEA 3OPZA 1MR5A 4XJ8A 4ZXEA 2PN5A 2Z5WA 4LT5A 1QY4A 2ZCWA 3VBHB 4KWLA 4K40A 2WZR3 3RMYA 2ZGOA 2I45A 3F2ZA 1W9YA 4LLOA 3DKWA 3OGSA 2W3JA 3LIHA 3PUHA 3JBG3 2R16A 1W6MA 2WKKA 3M4FA 1AF9A 1MQTB 4UF0A 2K0GA 3HD8B 1LJ7A 4LR4A 1ULPA 4QQ2A 3NKGA 2R1DA 1WBLA 5HBAA 4EN6B 1RYYA 3DYMA 4PBOA 2WBKA 2PFWA 2D6NA 4NHLA 4ISQA 4GMP0 1RTVA 1RUD2 2CSGA 2JG9B 3VBOC 3WF0A 3U75A 4AI8A 3T1LA 2CGPA 5BNOA 1PX4A 3E5XA 3O7OA 4OI2A 1JZ8A 5HI0A 1GWKA 1ND3A 5I0DA 4FAHA 1IPJA 4D94A 2WS91 2J1SA 1HKDA 4B8EA 1YFWA 1V6JA 2AEZA 5LBCA 2AREA 2OVUA 2FHRA 1FNZA 4EWDA 1GZWA 3S0MA 5JUVA 4E4SA 4CCCA 4NPRA 3J9SA 3POEA 5FZCA 1RUG3 2QE3A 3CDZB 4LULA 5DZEA 4OLLA 3U0ZA 1TME3 1U0AA 4JCKA 4CP9A 4DXTA 2D98A 5K9YA 4HSJA 3VBFA 1W05A 1QDCA 3HMYA 5FCCA 1Q8SA 1Z7S1 2TUNA 2MEV2 1JOBA 3AP4A 4QDRA 4XQ4A 3I2KA 4JGYC 2VNVA 1L7LA 5FP9A 1QHDA 1DLLA 5FZHA 4Q5OA 5F32A 2BWCA 4CUBA 4FP3A 3SEEA 1K3IA 2R0FA 1X9TA 5K0UC 3EO6A 2WLQA 3NV4A 1SLAA 4Y26A 4XF4A 1SG3A 1OA4A 4D7TA 2VOXA 3OUIA 1Q8OA 3H8XA 3PIJA 1PMIA 1WGPA 2HWB1 4AFCA 2GC2A 4GIQA 4UI9L 4NRPA 3THPA 5C8CB 4ES8A 4DNYA 3IDBB 3LA2A 2CYFA 4AI0A 3PL0A 2PQSA 2SLIA 1UU4A 2J7MA 1JXNA 2G9ZA 1X82A 1M06G 4Y1VA 4XJ9A 4BIFA 1BEV2 1PGSA 2VQAA 2YHJA 1H1MA 3ACLA 3W20A 2OIIA 3TEYA 4Q4Y3 1WCUA 2XWBB 4ZONA 2W92A 2RR11 4R52A 4PQQA 4AQ6A 1YQ5A 3VBSC 4NIGA 2QQOA 2ZBJA 4IEUA 2E32A 1RUH2 5LA9A 3ZKYA 2XMLA 4CEWA 4W50A 3U78A 2GH8A 4CDWC 3MPPG 1W6PB 3DPRA 4UOJA 3O1MA 3H8OA 1SLTA 4CXYA 5FYVA 1W0PA 2WO2A 3J7NA 3OOXA 1HXS3 4L92A 1HRV2 2OT7A 1V6LA 1OPOA 1FOD3 2HKXA 1RL3A 3P5BA 1GQPA 2EIEA 5FYMA 1OQEA 4HBNA 1JHJA 3LIGA 4IV3B 4ORFA 4AI1A 2JDYA 1LECA 3NQHA 4Q4X3 2A71A 3AYEA 2F4PA 1R1ZA 3WG4A 3J7LA 4CDQC 3ORJA 5FY7A 3ACGA 4CCEA 1G9BA 3I49A 2VOWA 3FX3A 4HONA 4NIHA 4Q8LA 4LA3A 4A45A 3ACFA 1POV0 1TE1B 5A1FA 1WA6X 5DDJ2 5LCWL 2W1SA 1QGLA 4JZRA 2LM3A 4UFJA 5F3EA 4BHPA 4U2AA 2XVGA 5FLIA 3TWIA 5FO7B 1SDDB 3GXUA 3VZKA 3VD7A 3W5MA 4JKLA 2ZA9A 2ZEWA 2VGDA 1H6YA 4AZZA 2NLRA 4IESA 4IE0A 3OGJA 2JG9C 2WLPA 3RYRA 2HLEA 4CDWB 1KEXA 3BIWE 1XNBA 3VBFC 1LAJA 2YXSA 5FZ4A 3WX5A 1A3KA 5DAXA 4MV2A 3O0WA 3E6CC 4CU7A 5BV6A 3GYDA 3ZLIA 4MSVA 3WP6A 3ZYRA 2RDSA 2VUJA 4XF3A 1UY2A 4Y22A 2ADDA 3PDQA 5C9AC 4KBZA 1HXS1 2JKXA 3NAPC 3BB6A 4M3CA 1MS5A 1GMMA 3JD73 1OLRA 3ZDVA 3JU9A 5FJKA 3AP9A 3I2OA 1DLCA 1TMF3 2P3KA 4FQZA 3DN7A 1AYN1 2XL9A 3NJYA 4YW5A 2TNFA 2HWD3 1O5UA 3HJRA 3POFA 3MBWA 3O14A 2H6CA 4LK7A 1O8PA 5CZKA 4QXHA 3T4VA 1BEV1 1UZ0A 1F4AA 4FPCA 1QU0A 4O65A 4AVBA 1BVVA 4D8MA 4LTAA 3MEPA 5GLTA 2GN7A 1AYM2 4DQAA 2GH2A 3RYKA 3PJYA 3OGVA 1IS6A 1DZRA 3KCYA 1O4ZA 2BNOA 4I01A 4JGYB 5CKQA 5T52A 1OLQA 4CUCA 1KQRA 5CFDB 3FC0A 5LRSA 4Q4Y1 4A7ZA 1C3HA 2FD8A 2ZEZA 4HK8A 2HYXA 2QCSB 3ME2A 1PK6B 2O8OA 1US3A 2YUEA 4GJYA 4QPIA 1FX5A 2GC0A 1E5RA 2OPKA 4CDWA 1LNSA 1UXXX 4GH4B 1OFSA 4QHBA 2DVGA 3ABZA 1WMDA 4QQHA 5F39A 4BE3A 2IVJA 1NXMA 3RSJA 2R063 3ZYFA 2ZGNA 2JEMA 1DGWX 1ENXA 1AR82 4W6YA 5CB7A 4HSLA 5K0UB 1SPPB 3DPRB 1AYN3 1WD3A 1Q5OA 5FZIA 1J3RA 1H4HA 2CWMA 2BTVC 3R4UA 4Q0PA 5FMDA 4C90A 1BBT3 3K3NA 4EQVA 2A3XA 2WQ4A 5LA2A 1GWLA 4L9BA 3ZXJA 4OUMA 4S2DA 4WV8A 3UL2A 4CDXC 4LITA 3J8F2 3P6BA 5IVBA 5FMOL 4BYYA 5C5TA 4XBLA 1OA3A 4P9XA 4E8CA 4YM3A 2X05A 2BJSA 5JOZA 1N1VA 4OQ9A 3INAA 3EMRA 5DUUA 4YARA 4IV3C 1UX7A 5FDBA 3VB9A 4NIIA 3TN91 4OVEA 3T3YA 2JB4A 2B8MA 5C71A 2O0OA 2R30A 1IPSA 5JR2A 1YXWA 4QXCA 1DYKA 3CMGA 1N3QA 1C8M1 1IQAA 1DGRA 1W04A 1W3VA 2XJTA 2Z69A 2UWCA 2E63A 1EUTA 1RUG1 3POJA 4ASLA 5IVCA 4P9YA 1AYM1 2VUDA 1YQ2A 3AVSA 3U14A 1RUC3 4AWDA 2VMHA 3B3QE 4LKDA 2QFEA 1G9CA 1RGSA 2RS53 1OH3A 4IV3A 4QQOA 5FYCA 4DMIA 4YYOA 1CIWA 1G7YA 2YDEA 2C6SA 3B5LB 1F15A 1SHWB 3OYWA 4KI5M 1OA2A 4GWIA 3IMMA 3HQXA 3RDIA 1UIJA 2UY9A 2GU9A 1DIWA 4PIYA 3V0AA 4QAWA 2EXHA 1GZ9A 1W9WA 4XMIA 3BALA 2E51A 3HQUA 3VHRA 3WDVA 3UK9A 4AEDB 5JXHA 4SBVA 3AKRA 2WNEA 5A33A 2BU9A 4HVRA 1XXNA 3B7MA 3RI8A 4LE3A 4TLGA 3ZMNA 1NAEA 5FMCA 2Y64A 2RM22 4CA9A 3ZYHA 3S5QA 3KVBA 2CHHA 3I59A 3AJYA 4MGZE 5GLVA 5I8SA 1RHI3 2JIJA 3ON7A 5JPNB 5LBEA 3LZZA 4M3CB 2VM9A 3D4KA 4LE4A 3ZDSA 2PHWA 2D5HA 4S2GA 2RS51 4IV1C 2WABA 3I8TA 5HCAA 4HKWA 4IE5A 3BPSA 2ATFA 5IVYA 1W8WA 4O9GA 2Y6JA 2XOMA 3GZAA 2ZEYA 2EAKA 5JIAA 2Q8CA 1JZ2A 1FOD2 5DMYA 1FOD1 2PHFA 2DCYA 4QU1A 4OYUA 4YG3A 4Z07A 1SLCA 3WDTA 3W58A 1DZTA 2NYYA 3OPWA 1O3RA 1REEA 2RR13 1ASJ3 4EV0A 5GLUA 2VMEA 3UGGA 1POV1 3O1SA 1Y4WA 2XJUA 4YG6A 4PCRA 5JOWA 4LPLA 2ORZA 2Q8OA 2C5DA 1TNRA 2DUOA 1RUE1 1RUH1 4PI2A 4P9IA 3VBFB 5BNPB 1D4VB 3LOIA 4CRQA 4XILA 4LO5B 3SXWA 2O8QA 2XUMA 2W52A 5JLVA 3FBYA 4DB5A 5C3QA 2XLGA 2VZ3A 4H2AA 3VLBB 4A42A 5T5JA 2C0ZA 3ZSJA 5J3UA 1YNAA 4JQTA 4DUXA 4CCLA 5BNOC 3T0AA 4NHMA 4WM7A 3CJIA 2VOKA 4JGZB 3TN92 3WF2A 1J3QA 4XMAA 5KXBA 4OI0A 5C8WA 1JYIA 2W2IA 5FZMA 1DQ0A 4I09A 1MS8A 1LHUA 1QJU2 2JG9A 4OCTA 5GZDA 4NVPA 1QDOA 2WDBA 1LGCA 2R072 1NLQA 2Y60A 3I97A 3OD0A 4Q4W2 3JXSA 5JMCA 1VALA 3AMHA 2Y6FA 3MLKA 3O0VA 3K48A 4META 4I30A 2MEV1 2XONA 3I3QA 4P5YA 3VDDC 2HEYF 2WT0A 4RGKA 4XJUA 5IVFA 3AZXA 2WA3A 1CAVA 3O1RA 4KNCA 5L36A 2W0XA 5IATA 1HQNA 3FHQA 1VAVA 3OJBA 2Q8DA 3E1F1 4IQPA 3I2GA 3ZXKA 2EXKA 4XPVA 3AP5A 1CWPA 4XFAA 2A1XA 2IXCA 2B46X 4Y1XA 1IS4A 1YLLA 4JX0A 4I02A 2FZ1A 4KWJA 4XHBA 1B09A 1CAWB 1BK0A 2NPIA 4L0PA 1JUHA 3C2UA 1PK6C 2JKBA 1TMF2 3LA7A 1Q56A 1RUH3 3VUOA 3RZHA 1K12A 1Z78A 3WDYA 3SQOA 2AGSA 2Y6HA 3MUY1 4IV1B 4GD4A 4NAMA 3GBGA 1O59A 1ZVFA 2XJSA 3DEMA 1UU6A 3AVRA 3VDCA 2GALA 3J8F1 3RG0A 4Z92B 2OKXA 4E9KA 1T6GC 1W03A 3UJOA 2XR4A 3RWNA 1Y9QA 2C4XA 2IXKA 3LEKA 4FPLA 4K8RB 1UZYA 3C7FA 1SBFA 1WWYA 4M0NA 3WCSA 5T50A 1ULDA 4HKOA 5DUWA 5BNPC 1QWRA 5KHHA 1AXYA 1AR81 5KHJA 2X29A 2R49A 1U5ZA 3S6PA 3HVDA 5T5OA 4BH9A 3AYAA 4GMP1 5JZGA 2OUHA 4JGZA 4QM8A 1CPNA 1W6OA 3BOWA 4PIXA 5ANQA 2NZ9A 3O1TA 1RUI2 1JS9A 1IHMA 1R1A2 2DVDA 5IVVA 2JE7A 3RYPA 4H3WA 2AUYA 2ZHNA 3FHAA 2LRPA 4I3PA 3FLTA 4Q1PA 3U4XA 4WM8B 4Q4Y2 4FPKA 4GJZA 3H8UA 5FP8A 2QQKA 2Z79A 4GWMA 2JIGA 3LFMA 3ZOIA 1JMUB 4RGGA 4Y5SA 3AZYA 5I0UA 1C1FA 4HVOA 1VBC1 3WDXA 1SACA 3KV5A 4BQ2A 1OH4A 4JGYA 3JBG2 5FMOS 2X09A 3NJVA 4GALA 1RUC2 3ZMOA 1CAVB 3SISA 1ND2C 1QJY2 2EA7A 1ULFA 2P1BA 3KT4A 5L9RA 3ASIA 2ZS6B 2ZKLA 1XE8A 4IE6A 3RZZA 3ENRA 3O1OA 3WW1A 1KDKA 2ZAHA 1C1LA 4H7MA 5ABJA 1V9U3 4RL7A 3NSTA 5LEKA 5FP7A 4E2SA 4KL1A 5CADA 4DUVA 4J1XA 2WFF2 4PQ9A 2Y0IA 2VAUA 4P9LA 1GV9A 2XL7A 2QNKA 4FPGA 4MHRA 2P17A 4HPKB 4MH0E 1FV3A 1VJ2A 3NJZA 2ZMKA 4Y22B 4CCOA 2W1WA 3NAPA 3DUIA 4URTA 1KFUL 4R8HA 1W6NB 2DCKA 2X5IA 3MFAA 4E8DA 3CU7A 2RM21 3OUJA 3VKFC 2KXLA 1MQTA 5EQUA 2JDUA 3NKTA 5C7GA 4XXAA 3TEZA 4D7YA 4QXBA 4H55A 4QGNA 4G3YC 4NROA 3I2JA 5FK7A 1FPN1 2EICA 1SLLA 2WNVA 2VULA 3ZSMA 3N9MA 5FBZA 5JWPA 4AE2A 2ZPXA 3AP6A 4W6WA 1G86A 1UOJA 2DVAA 4IEQA 1W8UA 4QPIC 3VZJA 5C33A 2MHFA 4ARXA 4DO0A 3BCWA 5A3NA 4LQRA 1OI6A 1H30A 3QOPA 5G04L 5F9TA 1RVF2 5IVJA 3WNXA 1RUJ3 2VZVA 2WAAA 3OY8B 3KMHA 3BIEA 1ZYBA 5DXDA 1V9U2 3QBQA 3TYJA 4EE2A 4YGBA 2C9KA 2JDPA 3BYWA 2ZGQA 1MEC3 4H7LA 2YFUA 3Q8EA 5D8AB 4P9WA 1PMHX 3JB4C 1GR3A 5DAWA 3ZR5A 1PX3A 4QPGA 3UGFA 2WZEA 5J1XA 3ACIA 3ZXLA 5BY5A 3HQRA 2QDRA 1V6OA 4XOGA 2ZMLA 1ENQA 2OA2A 5HV0A 1UO9A 3F95A 4FXKB 1RHI2 5BUVA 3WNLA 3D5OA 4FO9A 4IEZA 2WNUA 4OHZA 3GDBA 4FOVA 4NPLA 5C5UA 1ULCA 5FO8B 3OBTA 1V6IA 2W68A 1HLCA 1XU1A 5ACA3 4Y5Z0 3ZYPA 1H9WA 3FBMA 1OFNA 1XB9A 2ZZQA 1CD3G 2UURA 2VL4A 3BVCA 4KG8A 5FPBA 3AB0A 5KR7A 1XQNA 3WG1A 3B69A 3KT7A 4Y5TA 3V0AB 1JZ4A 1K5MC 1LHOA 3RZMA 4PLMA 2QUOA 3KZ4C 1O3QA 3VDDB 2VH9A 2FMYA 3CHXA 1UWWA 4KMQA 4CU9A 1AXZA 1E5HA 4HPKA 3SC7X 4Q4W3 4TZDA 1YO8A 2FCUA 4YRDA 4UFKA 1F31A 1O3SA 4AVAA 3ZXAC 4FFFA 1US2A 4BQ1A 3NNLA 5A7NA 1UF2C 1DDLA 1SLBA 3K4DA 3POSA 4IW3A 1UU5A 3D8CA 2DU1A 3FHIB 4XUPA 5I91A 5EIYB 2VVEA 2BDRA 4W8JA 1V6MA 2RJ2A 4FFGA 1IKQA 1UL9A 3HIFA 5FZ0A 2HBUA 1QQP3 4FSJA 1BMV1 5CFCB 1LU2A 1VAKA 2WNVB 3MIBA 3FLPA 4MGQA 1WCKA 1Z0HA 3WDWA 3IMNA 4UW6A 2JD4A 1ZRCA 1RITA 3WDUA 1COV2 3HAGA 5LA0A 5A3PA 3GHNA 2BW8A 3PTYA 5JAXA 3T30A 1JH5A 2JD9A 2XBO2 4R9DA 1CZVA 1DHKB 4LO8A 1WW7A 1OKQA 2XQRA 4K9SA 1BZWA 4IE7A 2IC1A 3P3NA 4MUVA 3MO4A 5DZGA 3RZLA 3MF6A 1LB2A 4RSUA 3H42B 4QX8A 1QKQA 1AR62 1LGBA 2P4EA 1UYXA 5FZLA 3B94A 5L19A 5EP9A 1JBCA 4Y20B 2BZDA 2XJRA 1NUKA 3PMEA 1VBA3 1J1TA 4YVWA 3P3PA 1MEC1 1XYNA 3H3ZA 4YFWA 2Y34A 3TNQA 3N7LA 5LK7B 1V0AA 3PUQA 3BTYA 3J7MA 2DDUA 3UESA 4AFAA 3LDKA 4XFHA 4D0QA 3DXUA 2YMZA 3H9AA 4Y4YA 4XACA 2DCTA 4BXSV 3N4MA 4EN7B 3KQRA 4AAPA 2GNTA 5K7PA 1S0BA 4WM8C 1W2AX 3ZVXA 1N1YA 2F17A 3WQ7A 2OZ6A 1S0DA 3RNSA 5CEHA 4PF5A 4DS0A 4V2VA 3UJQA 4AI2A 2UWAA 1SZBA 4AI9A 1QJFA 5FY4A 2W47A 3JD72 3BUCA 1VBB3 3H3LA 1H8TA 3AZWA 4CTEA 3MPBA 1TG7A 2QVSB 2HWC1 2JDZA 5J36A 2ZGMA 2VBPA 1K5MB 2TBVA 2R32A 3C3VA 2RS52 1RIRA 1PGL1 1JZ3A 2H0BA 1AR83 4XF1A 3WZ1A 1RXGA 3MIEA 3ZFFC 3PUSA 1HIXA 3RZKA 2WINB 1OC1A 1S0JA 5L7OC 1CAXB 4Q0UA 3ETQA 4GXLA 4AXOA 4RGAA 1RMU2 1NKGA 2NQYA 2P6HA 5FTTC 5FZOB 2D3RA 3TRSB 1B35C 4OMDA 4WM7C 2XVKA 3KF5A 4BQ5A 5A1AA 3UNPA 1PO11 2DTYA 4NOTA 3NV1A 5E16A 4QMAA 2FMDA 3A0KA 3AXEA 2JECA 1RJ7A 4A3ZA 2RDQA 1F2NA 2ZX4A 2LROA 5SV5A 5IFTA 1EV13 5KBFA 4HMZA 1PVC1 4LJHA 3CJIB 4ZS2A 1HB1A 1DQ4A 2WJSA 3IN9A 1PIV3 2D43A 4K1YA 2DFCA 1J3PA 3CO2A 3ZIXA 4ASKA 1ZRFA 2ORXA 2RS33 5CYYA 3LA3A 4L99A 5FREA 3SKVA 4AFBA 2GMPA 3L9JT 3KV4A 2RE9A 2XDVA 3JQWA 4YVSC 3R4DB 1UQXA 2ZHLA 4QPIB 2VCCA 5E89A 3ZFGA 4C91A 1B35A 4XZPA 2WZR1 3POWA 1IS5A 2QBXA 2QQWA 1OLME 2GMMA 4CEYC 4QX0A 2BFUS 4R4ZA 3MZHA 3I2IA 2VW1A 3LWCA 5A6ZA 2ES3A 4AHZA 5JMOA 1XSQA 4NR1A 4XW3A 3S5AA 1XU2A 1PMJX 1DCSA 4FXGB 4KWKA 5T5PA 4P14A 4QB1A 3SITA 2HWC3 1CJDA 4AVSA 4BQXA 1NYWA 2Q0AA 1H6XA 2WNVC 1PK6A 1M4WA 3VBUB 4UFIA 4Y1YA 1S1AA 4HOOA 4YVSA 5FPXA 1FMD3 3N9OA 4XJAA 5CG8A 5IWFA 1CR7A 1W6PA 3WUDA 2V72A 2GP3A 5FZ6A 5HV4A 2XKOA 1OD3A 4IGQA 3ZN6B 4BK4A 4M01A 1N3PA 4XUTA 3I59B 2GMEA 3VD4A 3BN6A 2JB8A 2VVFA 2D93A 4DEVA 1VBD1 2DCJA 1F5JA 4XJWA 4OI1A 4Z82A 1F35A 4BU2A 3N7JA 4AI3A 4EN8B 1PO23 4O61A 5FYSA 4UFHA 5ABJB 2TEPA 3TAYA 3M7AA 5APAA 4A44A 4FPEA 1OOPB 1LEMA 3AKSA 3MIHA 3A0NA 4XVHA 4BQWA 1O4TA 4MX3A 3GM8A 3M3EA 1LEDA 4FOYA 2WS92 1WLCA 1WZXA 4ZKTB 2W94A 5KHGA 2SBAA 2B45X 5HCBA 3E6DA 1UKGA 5A7WA 3H1YA 3N7MA 4L11A 2B7YA 1SMVA 5FXVA 4HKLA 5GZGA 4Q26A 1YWKA 1W9FA 5LBFA 2VZQA 3FFZA 3GJBA 4HXCA 4XHXA 1JZ7A 5M0TA 1AZDA 3ZX7A 1W8NA 2HJIA 4AHYA 3VBOA 4XIOA 3AKQA 1MPXA 5IVEA 2BV4A 2B9UA 1ZZ9A 4XTMA 2IXLA 2Y0OA 4PDWA 1A8MA 1GANA 2JENA 3LPFA 4D3WA 3O1UA 2IFRA 2AEYA 1T6BX 1WLWA 2VZOA 4CXWA 4LUKA 3ZSKA 1C8M3 4M4PA 1QQP1 2W08A 1NT0A 2P3IA 4AVCA 3POBA 1JZ6A 1O3TA 3GBWA 4QM9A 2I74A 2D6KA 2PAEA 4Q4W1 2E7AA 5FK8A 1HQLA 1S0GA 4AK3A 4Y1UA 2BQPA 2DUQA 5F5QA 5LASA 3LD8A 2HWE1 1B35B 2V73A 2OX0A 3VBRC 3DKQA 2V4VA 1CVNA 5FY1A 5CFDA 1HJFA 3WW4A 3AK0A 1I5PA 1HXS2 5FYHA 1HW5A 2DFBA 1LOEA 4QPGB 3H7JA 4EWAA 5F3IA 4PDWC 4I0BA 2XVLA 1GLHA 4FT8A 2Q1FA 2D97A 5CKNA 5FQ0A 2C9AA 2NN8A 3BPZA 1GUIA 4C1XA 1WCQA 4CSWA 3MF9A 1R091 2WAOA 4LKFA 4AFMA 4W4ZA 5ISLA 2W1QA 2CDPA 1JOPA 3OPTA 4AVVA 4XETA 1YFYA 4YVSB 5IT6A 1LHNA 5BNQA 5GM0A 1V70A 2YPDA 3T1MA 1TZOA 3W5NA 1AL23 4ISRA 5BNNA 1C5HA 2BP6A 1RUE2 4NRQA 1G9FA 2VU9A 3KLSA 2YC2A 3I4IA 3IDAA 2RHPA 3OSDA 1LTEA 3CEWA 2V09A 4B1LA 5DAQA 1EAH3 1JU3A 3PMSA 3VZNA 4ONUA 2QDNA 2QQUA 1TEIA 1VPHA 2DU0A 3H7YA 4RHV2 1TVGA 1HB2A 2EALA 3B01A 2OYZA 2RVAA 2YFZA 4WVVA 3WF3A 5ACA2 1FXZA 3I3BA 2RMU2 3T4HB 4Z1VA 4MGTA 3ZXFA 3GNEA 2ZEXA 1JYVA 4UXAA 4BISA 2WO1A 3N9QA 1VP6A 3TEXA 3L2YA 1FAYA 1QNWA 2ARXA 1VBA2 1D2QA 1H2LA 3LEGA 4HETA 3C8XA 4E27A 3ZN6A 3E5QA 1LHWA 4NN0A 1HV1A 4Y33A 5FV3A 1SEFA 2GZWA 3E97A 1GYKA 2VPVA 2FZ2A 1WD4A 5L73A 1LODA 2RR12 3HT1A 3MV11 1TME1 2Y6LA 4LBNA 2OZJA 3VBUA 3THCA 3OEAA 4ITCA 1XNDA 3CJIC 5EYXA 1MS4A 4OZXA 3RZGA 1QNYA 5F5AA 2VZTA 1XE0A 3OD4A 3WP5A 1SCRA 2JG8A 2WNUC 1DP0A 3AMMA 3WVJA 2FDGA 1UY4A 4HVQA 3QD6A 3VKMA 1CESA 3FUQA 3IBMA 1ZBE3 1OOPC 3BTAA 3VBSB 1W0NA 2DF7A 3RI9A 1PM7A 3VL9A 3WQ0A 1GOHA 1XRUA 1NCRC 5JI7A 4EN0A 3OBRA 2P37A 1J84A 1LOCA 2KM2A 2VW0A 4BXFA 1KS5A 4QKBA 3B93A 1RUI3 3LB9A 3POGA 4XXPA 2R062 3IPVA 4QX1A 1UOFA 2ZX1A 1W99A 4YGEA 5T55A 3SLIA 1HB4A 1RUF1 4OI4A 1D4M1 1KS4A 4CP9B 4A3XA 5FXZA 1VMHA 1LCLA 5C3PA 2YU2A 5E1RA 5FZKA 1QOSA 1OLMA 1SLIA 2R073 1RXFA 2R043 2YBSA 2PELA 5FYIA 1A8DA 5LY2A 3BTZA 1K42A 2Q8EA 3H1MA 2ZGKA 4Q4X2 3VL8A 3WNMA 4HN0A 4DXRA 3BOPA 2XH6A 1HX6A 3WW2A 3A21A 3S30A 3RZJA 3ZYJB 2EIDA 5FKBA 3T08A 1MEC2 2A6ZA 1XYOA 2CNAA 1AHSA 3RWKX 3J26N 3WUCA 3HNYM 4K1ZA 3EJKA 5FUIA 4C0HA 4KGQA 1ULEA 2UYAA 5FPZA 3WQBA 5A6XA 1BYHA 4DIQA 4MLOA 2VG9A 5EXOA 3AYCA 2D6MA 3ZFEC 1DQ5A 4PDWB 4XUOA 5CFCC 1P8JA 3SMHA 3KV6A 1OBNA 5EJ3A 3THDA 1H4GA 4P02B 2VTXJ 3VHNA 2RJLA 1AYM3 3V56A 4FPOB 4IV1A 1K45A 3ZFFA 3UV9A 4L97A 3ZXDA 4FTEA 3POYA 1RUD1 2WQ8A 4XEZA 1O4YA 1ZRRA 5JSPA 3LDRA 5F6LB 2ETEA 2A70A 5E6HA 4K8FA 4ARYA 4TLFA 1WW4A 1E57A 3EB7A 2AR6A 4JV4A 4XE9A 3RMXA 3LQCA 2WQZC 5FAXA 4UFLA 2R041 2E7TA 4H14A 3AMNA 1VBE3 3PU8A 5CVRA 4JKMA 4YSFA 5JXGA 4LIUA 2QKDA 1CN1A 1SDWA 4YW6A 3WQ1A 2R042 2YY1A 2VXRA 4WM8A 4F3JA 2H6BA 2A6WA 1ZZBA 2IFWA 4W65A 4IGPA 5CFCA 4PBPA 5LA1A 3ZKUA 5IYYA 2VZRA 4P08A 3NL1A 2FDFA 1VRBA 4ZZ8A 3CBNA 3IB3A 2DVBA 1J59A 2P34A 2BOIA 1WKYA 5JSOA 4QU2A 1FNYA 2B39A 2D6PA 2BGCA 2CU5A 5FYBA 5I8YA 1W2OA 2E9QA 1V6NA 4N53B 3J8F3 2LUWA 4BDVB 1W8HA 5E8AA 5C4WA 3HBZA 4LBMA 1TQ5A 4YW3A 4GB31 2PLV2 2VQ0A 3R4SA 1UPIA 2ARBA 2BNNA 4IEVA 4JC1A 2ZGTA 4UW3A 3VKNA 1LESA 4TXWA 4Q29A 2XHNA 5GZEA 5A3TA 4ET7A 1S0CA 4DY5A 4X6QB 3WT3A 2FDIA 4LNVA 3LEMA 4XFFA 1OXCA 1PVC2 4XUNA 3WEZA 5CG9A 1GKBA 4HK9A 2D5FA 5B2GB 1Y43B 2IXIA 1AYN2 4ZPIA 1JZ5A 4K3UA 5H9SA 4OQ8A 3K51A 4GQ7A 3ZXEA 3M2MA 1FATA 1H0BA 2C26A 1PHMA 1QJX3 4QQLA 3UKVA 4E4HA 2IXJA 4NRMA 1RUF2 4XQWA 2ZACA 4BMEA 5IAVA 2LW8A 2PMWB 1V9U1 5L9VA 1YUDA 2R061 5A32A 4O9EA 4N7IA 1LR5A 3FFQA 4QGLA 1VMJA 3GZEA 2WFPA 1L7QA 1NCRB 1W6QB 5FZBA 3ZFGC 1JYWA 1VBE1 1RMU3 4HG6B 3H0OA 4OHWA 5F37A 5JVVA 1W8OA 3APBA 4JQRA 3ZYBA 2E26A 1EY2A 4AHWA 4CP1A 1MZFA 3T2QA 1QOTA 1WMEA 1FPN2 1OURA 1RUE3 1ZNPA 4UFMA 4A2UA 3WNKA 4AQTA 1QJZA 2A5ZA 5FP3A 3DF0A 4M3CF 2ZKNA 3ZPYA 4NWVA 1EPWA 1W2NA 1S0FA 1G8WA 3PU3A 5BYNA 3C7GA 2NM1A 1XJAA 1ZREA 4BZ4A 3P1IA 1YI9A 4CP2A 3IAPA 1BBT1 4COVA 1S2BA 4XBQA 1POV3 2P3YA 2RMU3 2QQJA 4MXWA 4N43B 4NMIA 2FDJA 4U36A 3OCPA 1SCSA 5FZGA 4CDQA 4DY3A 5C9AB 1ZRDA 1OMIA 4B4QA 5L7OA 4RA0A 4J1WA 4P5HA 4L2NA 4TWTA 4XQDA 2WC2A 1NE4A 3MHZA 4LKSA 2ENRA 4LBJA 5DPNA 5A3OA 3PVOA 4RHV1 3SHRA 3QCWA 5FO9B 1QJEA 3HPNA 3IIIA 3U11A 2JXAA 2Z2SB 3NWKA 2CV6A 1XOYA 3JZVA 1RUC1 1DGLA 1YCIA 2ILMA 2LALA 3CLPA 5JZGC 1AX2A 2EXIA 3R05A 4AOCA 1WW5A 1RC6A 2OPWA 1XNAA 3WG3A 2PHLA 4Z2AA 5FPLA 3GALA 3PHMA 5E88A 1RUJ1 4GAZA 1HN0A 3RJRA 4BJ0A 1WCDJ 2VZUA 3UKNA 4AGVA 1VLNA 2JDHA 1KJRA 3IIAA 4DRVA 1I1EA 1PVXA 3USUA 1UOBA 1BMV2 4XC9A 2JG8C 1C5IA 4KH9A 3VBHA 4LUMA 3VHPA 1RUI1 4IUGA 1I3HA 3RGBA 2F4LA 2QQMA 1NZCA 3U07A 1PO22 4XFIA 1DG6A 2BUKA 2BBVA 3MW2A 4YG0A 1NCRA 4IEXA 5GZCA 1HDKA 3EXUA 4MVTA 1ZBE1 2JWPA 4PLNA 4UT5A 4G4FA 4XURA 2AH2A 1FT9A 1Q8PA 1OQ1A 3WY6A 2XWJB 1MS1A 4NHKA 1SFYA 4B4RA 3D0JA 3NMBA 3MLLA 1KRIA 3VZMA 4KG0A 1OT5A 4Q1RA 3HOBA 5A7SA 3LAGA 2ZGRA 5EZWA 2A6XA 2KD7A 3THTA 3BI3A 2DURA 3SH3A 1C28A 5CA6A 1MQTC 1RUJ2 2LS6A 3WSOA 3VBHC 2WR9A 1NY71 2JE9A 3IZOA 4FTSA 1POQA 4KU7A 1DU3D 1QH7A 3AJZA 4BA6A 4QPWA 2A3YA 2UWBA 4LOSA 1NLRA 1WLDA 4GMP3 4PHZA 2DV9A 1TMF1 4RQPA 1GZCA 2BNMA 4AFDA 2XPJA 1K5MA 3H1WA 3A22A 3O1PA 5FY0A 3VGIA 5CFDC 2PQQA 2RS13 3PURA 1W6QA 2A3WA 1BJQA 1OHFA 3DXTA 5FRAA 1YJKA 4E2GA 2X8KA 3AZVA 3PUAA 4PIZA 1J58A 2WWJA 4K20A 1NOVA 5JOXA 2D3PA 1VBB2 2OS2A 1QMJA 4FOWA 4B1MA 1BBT2 4BB3A 4FOQA 3T0BA 4AEMA 3MDPA 1WMXA 4MZUA 1QXJA 1H1IA 2YZ4A 1ASJ1 1ULOA 5EWSA 4BQ3A 3AX4A 1JYXA 4CU8A 3VDAA 5BNNC 5DUXA 3RPQA 1U5XA 4QQPA 1J1LA 5JSRA 2GNDA 2JDMA 3NNMA 5J98B 1S2EA 2GNBA 4BIOA 2W46A 2WL1A 5KC5A 1NX9A 3AYDA 1DGRN 2P6CA 3AKTA 2WFF3 4QX7A 4CUAA 1GNZA 2WN3A 2RS32 4XJZA 3WNOA 4Q8KA 4CDXB 3WF1A 2N7GA 4DRRA 4D7SA 4N9IA 1UPSA 4CU6A 1XE7A 1VRH3 5D1IA 4JRAA 4BWOA 1QXRA 4IERA 3HN1A 2PLV3 5FXXA 5A70A 3A7QA 1LRHA 3WNNA 1GFF2 2HWF2 1PZ7A 3M70A 1J83A 3OB8A 5AC92 4OULA 4OZOA 2XUEA 4NWWA 1L7RA 4J6GA 2WSVA 2J42A 4RR3A 3WXPA 4R9BA 4Y1ZA 2NMOA 3KGZA 4FQ4A 4ZHNA 2VE1A 3I2FA 4WVWA 3V65A 1O7FA 2QQNA 3ILRA 4F83A 3V0BB 1W06A 4AQSA 3GZTB 1I5ZA 4PI0A 1ZZCA 5A3LA 5CIRA 3AM2A 2C1FA 2VMCA 5IJRA 2XQXA 1O6UA 5DABA 5FFOC 2G19A 4J25A 3NNGA 4TN7A 3T0DA 1Z7S3 3USUB 3M3OA 3UGHA 1W8ZA 4BLIA 1QEXA 3ATGA 3VV1A 3ZO0B 4A6SA 4X8NA 3TB0A 1VBC2 4FFHA 1H9PA 3KCXA 3I3MA 2W5FA 4AW7A 1EV11 4HZFA 1UY0A 3V64A 1V00A 4Q0SA 4LXLA 3C7EA 4SLIA 1YC61 4X8PA 2IZWA 1ULGA 1X33A 3LCPA 3OGRA 4JTOA 4OHXA 3I2HA 4QB6A 4JAAA 4C8DA 1FYUA 2YROA 4DOUA 1PO12 4EN9B 1SQ4A 4UWDA 4CCMA 1WMFA 3GJAA 1D2SA 2P3JA 4YVWB 1RJ8A 5LWBA 1UYPA 1DQ6A 5DN2A 1EYBA 3I3DA 4CVUA 2BYVE 4B3NA 4CDUA 2E7QA 3VDDA 1JYTA 4MGSA 4YZ5A 3ZN4A 1UNBA 3GF6A 4LHSA 4ZZ5A 2VNRA 2G9GA 5KC6A 2BOJA 1WBFA 4RS5C 4WBBA 1ZRIA 5A3WA 5C3RA 5B4XA 1NA1A 1STMA 1QJY3 2RV9A 3KD4A 4JDNA 3AL5A 3SCFA 2E31A 1ENSA 2YYOA 5C4WC 5CU1A 4Q0QA 3H8RA 2HWC2 3NRUA 5A7OA 1Q43A 2F6BA 2Q30A 4LHLA 5FZ7A 2WA4A 4AAXA 3LGRA 2HEVF 1ENRA 1YEWA 1AR61 5FY8A 3IPVB 4YZ4A 5G05L 2AENA 5FZ8A 4K7JA 5F3CA 1VBC3 2ZGLA 4ASMB 1H8TC 4Q4V2 1OF3A 3E5UA 1ND2A 4IE4A 3PJQA 4IDZA 2VW2A 2BPA2 3WP3A 2WRAA 1RUG2 3RFRA 1Y9GA 5ERLA 3MYXA 4D6RA 2WWSA 4R4XA 1W6MB 4V2WA 1ZZ8A 1W2UA 1X9PA 2O14A 3B00A 4LBKA 3O5SA 5HXVA 5FXWA 1R082 4LBQA 4GH4A 1PIV2 1ZA4A 4FPYA 2D6LX 3IAQA 2VZPA 1F5FA 2QQLA 5AVPA 4Q4X1 3USSA 1O5LA 3MW4A 2ZX0A 1IOAA 1AR73 2EF6A 2WS93 1GBGA 2B5HA 3AC0A 1IPKA 4YLZA 2J1VA 5C70A 2BRTA 1KDMA 4RN5A 3LOBA 3BTXA 5JOYA 3M3QA 1DFQA 2HBTA 3LF7A 1OPMA 1QJX2 4JGZC 1UMZA 4FCAA 3DV8A 2UY8A 5FYYA 1BQPA 3JB8A 3WD5A 4AHXA 1VBD2 2BBAA 3K75B 3EHKA 5T3NA 4DZGA 4QX5A 2R071 4AL9A 3D82A 4BOWA 1W9SA 3CNAA 5EV7A 1COV1 4K6BA 3NNFA 2NP0A 2XJPA 5C3OA 4XFCA 3OTFA 1VMFA 2EIGA 3IWZA 3PVBB 1BEV3 1XPWA 3N9PA 4UW4A 3PUIA 1T2XA 5FLJA 2A7AA 3KQ4B 1CAUA 3D0SA 5FZOA 3FJSA 1FMD2 1U12A 2H0VA 1ACCA 4N9HA 1UY1A 2AZ5A 2XJQA 1MS3A 1R081 4OFGA 3VZOA 1C4RA 2ZZJA 2ADEA 1ZA7A 2W87A 4UAPA 4X6RB 2ZXQA 4LEJA 4UBHA 1PM4A 5FPAA 2ID4A 3CJXA 4EWEA 5I8TA 3S57A 1AR71 4N8MA 4AR2A 1GP6A 4F8AA 2HWB3 3UETA 3HEIA 5AFBA 3NNJA 1AL21 4XDOA 4Q4V1 4Q0VA 1PGW1 5IW0A 2WZR2 1REDA 3C7OA 1D4M2 1K5JA 2W9XA 1UIKA 3OYWB 1SBEA 3QH6A 1UOGA 3B9CA 2VCBA 4YNIA 3O1VA 2FCTA 3FN9A 1W2TA 3G7DA 3L2HA 1L3JA 2VMFA 3NV3A 1ODNA 3QLQA 2VTXA 3BU0A 2VCMA 3NAPB 2V4AA 3BGAA 4AEJA 2J1RA 3AZZA 4BQ4A 4WVMA 4CCKA 2J1EA 5A3MA 3MIDA 4ZS3A 1MZ6A 1BVP1 3GCXA 1NXD1 2VUCA 4RS5B 1ZX5A 2CWSA 5FYUA 1WCSA 2WYFA 1UD1A 2BFUL 4TYSA 2V5YA 3O12A 4YM1A 2PXJA 4QHOA 2ZHMA 1CAUB 4FVVA 1D0GA 2EIBA 4CEWB 2PHUA 3GGLA 1COV3 1PVC3 3GZUC 2XB6C 4ES9A 5LZ6A 4A4AA 3VKLA 1NZIA 3RJ2X 2B4KA 3OG2A 1GU3A 2R1BA 5FPVA 3WHUA 4NO4A 1RVF1 5FZ9A 5FJHA 1SFPA 2VOVA 3T09A 3NO8A 2HWD2 5FY9A 1YIPA 2BVVA 4LBOA 2XG3A 2WFF1 1YI7A 5BPXA 1CJPA 1LOAA 2WZ8A 3AMPA 4XF9A 3MV01 2B42B 4R9CA 3ILNA 3IDEA 2HWE2 1CPMA 2DWRA 3M3CA 4LBQD 1MS9A 4NE9A 1BKZA 4EJRA 5FP4A 1FV2A 3KHBA 5DAPA 1DGWA 4DEQA 1APNA 2WSUA 1JU4A 4MHUA 1VAMA 4OUEA 4B7EA 4N53C 2X10A 2GSYA 2Y38A 5FZFA 3URFA 2HYKA 4XFGA 1CONA 2NMNA 3SH5A 1JYNA 1UX6A 4C1WA 1SFNA 1X7NA 4Y4RA 4XDQA 2R7EB 1YQ8A 3SEPA 2YC0A 3IKWA 2HEWF 1HRI2 4PF1A 5KWRA 1S55A 2VCAA 4F7ZA 4QDQA 1C8M2 3ZM8A 1AR91 1R092 2YBPA 4D6SA 5GZFA 1CX1A 3FUOA 3ZPOA 1AL22 4YZ1A 2BGPA 4OHVA 5LK5A 3SH4A 3ZFEA 2OW4A 1R1A1 1BK1A 3BU7A 3T2TA 2JDKA 1RINA 5F6KA 3B9IA 5J09A 3ZSLA 2WNOA 1UZVA 4FPFA 1ND3C 3CIHA 1WUVA 5FQ0B 5H9QA 1Y3TA 1EPZA 1YQCA 5F7UA 2WO7A 3I7DA 2JE8A 5C4WB 2VUAA 4QPYA 4EROA 3SNMA 1CGPA 1JN2P 4O7XA 4R9AA 1G6NA 4RFRB 4D6QA 5FOBB 1KGYA 1FMD1 3M3IA 4QDSA 1UMHA 1W9TA 2ZTNA 1OVSA 3ES1A 2HWE3 2Z42A 4HL0A 1NCQC 3DL3A 4P9JA 1ALYA 3JCIA 4YGCA 1RVF3 5A7WB 3VDBA 1JOJA 4QX3A 4NPMA 4A6OA 2E6VA 2J1UA 3T2OA 1RUF3 4I3GA 5FKCA 3UYJA 5LY1A 4ZU4A 5FWEA 3CL1A 3KF3A 5KXDA 3ZFFB 3BODA 4M4RA 4D69A 3WG2A 5D8AA 1R64A 2VTFA 5T54A 5F2WA 4DPNA 1BXHA 1EAH2 3FWEA 3Q8FA 1SBDA 1OQDA 5GALA 1IKPA 2D7FA 3WHTA 5C3SA 4DFSA 4A7KA 4RR3B 3DYPA 5DDJ3 5FPUA 4NUBA 5FY5A 2CY6A 1F4HA 3KGLA 5IK4A 2BWAA 2AYHA 2ZAAA 3KB5A 4OMCA 4LOTA 5HXMA 4G9SB 1PZ8A 4DXZA 4IEOA 4UF0B 1AL0G 1FI2A 3NVCA 4COZA 2ZX3A 1NCQB 1YFUA 2WUHA 5A6YA 3HNMA 3LPGA 5CBLA 2YGLA 4LHNA 1OF4A 1W28A 4LORA 5FR3A 5FZAA 4GULA 1N3OA 1XSRA 1I9RA 1MVEA 4LBLA 1OSGA 5I0RA 1CQ9A 1YRZA 3SCGA 4I2OA 1OOPA 3ECQA 4Y20A 2D6OX 5DZFA 1DZQA 5GKAC 4Z2WA 3VD9A 2ZGUA 3A23A 5LW9A 3MIFA 1GSLA 4WVMB 4PLOA 4AQ2A 1Y9MA 2ZX2A 3MW3A 3E6BA 1X50A 4E4DX 5C9AA 4RR3C 3GBFA 1CIYA 2RDRA 2VXJA 1NG0A 2A75A 3AXDA 3GCWA 1MZ5A 3I3EA 1HV0A 4JVAA 4MOAA 4CUGA 1GQHA 5B4NA 1UYYA 2YB7A 1N1TA 2YPJA 5FUPA 4CXXA 2PHRA 1S0EA 1GP5A 4MXVA 5KXEA 2GAUA 4EYUA 2XJVA 4Q27A 4QKFA 4B4PA 4XTPA 2ZGPA 4PJYA 4HFSA 2Q4SA 4CE8A 4W6XA 2XLAA 4TSVA 1RMU1 1X8MA 4MGYE 4XUQA 3KSCA 4LKEA 4XBNA 5T5LA 2EXJA 4B29A 5DDJ1 2QZ3A 5EHDA 1GZTA 2MPFA 5LATA 3TN93 4BPZA 1QJU1 1DYPA 5BXXA 2VNOA 1ND2B 3TNPB 3M8LA 5JI9A 1D4M3 4LMFA 4YWAA 4MO3M 3RVHA 1TME2 5FBJA 3VHOA 5IK7A 1ND3B 1VBE2 4FP2A 3DECA 1UMIA 4HT1T 4BMBA 3ACHA 4XABA 5F2SA 4MYEA 3AP7A 3SCHA 4AEDA 3VKOA 1NA1B 2WYSA 5F8PA 4XYXA 3VBSA 2BERA 1LOFA 1W90A 2DBIA 3FZ3A 1Q8VA 1W39A 2GC1A 5A7PA 4RQPB 1UN1A 4UYBA 4YW2A 4B7KA 5GLZA 2IVIB 2W91A 5LB6A 1RUOA 4Q4V3 5C6CA 5J48A 4CDUB 4S2FA 3WF4A 1BLZA 3PVEA 3PNAA 2G9FA 5ANNA 1AJKA 2VVDA 1PNFA 5LBBA 5A33B 1JTZX 2Z4FA 3K3OA 1O91A 4IEPA 5EFUA 3TEWA 4COYA 3WOGA 4BLJA 4LBQB 5FMBA 4FBFA 1Y7BA 3ETPA 4CPBA 3ELNA 5H9PA 3D6EA 5GJ6A 2PLV1 2P5BA 4GB32 2YBKA 5DQ0A 2YGMA 1AVBA 5J7MA 4AVTA 1DYOA 5A80A 2ARCA 1W8FA 3N9NA 4NAOA 2QQIA 2FBEA 4CCJA 1LULA 4OUSA 2QZ2A 3JD71 3AKPA 2J1TA 3LKJA 3FE5A 3IT8A 4CEYB 4M3CE 2ET7A 3PTRB 4CCDA 3OBZA 5KHIA 2VQTA 2GP5A 1ZBA3 3VBRA 3VD5A 2EVXA 5JDBA 1ASJ2 2Q1MA 3IDCB 2QJVA 3LFIA 3ZIWA 3LE0A 4YW7A 3VBUC 1GQGA 1HB3A 1REFA 3K2OA 4GH4C 5IFPA 1UAIA 4Y24A 4QB2A 1H2MA 5ACA1 2VZ1A 5F1RA 1X8EA 5EYYA 5FUNA 1A78A 4RYDA 3Q8CA 4CP0A 1VB2A
chains in the Genus database with same CATH topology
3O1SA 3H8XA 4NRMA 4OCTA 4ZHNA 4RFRB 4O7XA 3O1VA 3LFMA 3O1PA 4NRPA 4NIIA 4QKBA 4QKDA 3T3YA 3BIEA 4QKNA 4NIDA 4NRQA 3BUCA 3BU0A 3BKZA 2FDKA 2FDJA 4CXYA 3KHCA 3RZHA 3S5AA 3BTXA 2FDIA 2FDHA 4O61A 2IUWA 5DABA 3I49A 3RZMA 3I3QA 4ZS3A 4ZS2A 4IE5A 4NPMA 3H8RA 3BI3A 2FD8A 4NIHA 3RZGA 4IE6A 4IE4A 4JHTA 3O1OA 4NROA 2FDFA 4IDZA 4MG2A 3O1TA 3S57A 3BTYA 3O1RA 4CXXA 2FDGA 3I2OA 3BTZA 4NIGA 3O1UA 3RZKA 3KHBA 4NJ4A 3T4HB 4MGTA 3I3MA 4QHOA 4QKFA 4CXWA 4IE7A 5F8PA 3RZLA 3O1MA 3H8OA 3RZJA 4NPLA 4IE0A 3T4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O1S A;  3H8X A;  4NRM A;  4OCT A;  4ZHN A;  4RFR B;  4O7X A;  3O1V A;  3LFM A;  3O1P A;  4NRP A;  4NII A;  4QKB A;  4QKD A;  3T3Y A;  3BIE A;  4QKN A;  4NID A;  4NRQ A;  3BUC A;  3BU0 A;  3BKZ A;  2FDK A;  2FDJ A;  4CXY A;  3KHC A;  3RZH A;  3S5A A;  3BTX A;  2FDI A;  2FDH A;  4O61 A;  2IUW A;  5DAB A;  3I49 A;  3RZM A;  3I3Q A;  4ZS3 A;  4ZS2 A;  4IE5 A;  4NPM A;  3H8R A;  3BI3 A;  2FD8 A;  4NIH A;  3RZG A;  4IE6 A;  4IE4 A;  4JHT A;  3O1O A;  4NRO A;  2FDF A;  4IDZ A;  4MG2 A;  3O1T A;  3S57 A;  3BTY A;  3O1R A;  4CXX A;  2FDG A;  3I2O A;  3BTZ A;  4NIG A;  3O1U A;  3RZK A;  3KHB A;  4NJ4 A;  3T4H B;  4MGT A;  3I3M A;  4QHO A;  4QKF A;  4CXW A;  4IE7 A;  5F8P A;  3RZL A;  3O1M A;  3H8O A;  3RZJ A;  4NPL A;  4IE0 A;  3T4V A; 
#chains in the Genus database with same CATH topology
 1QQP 2;  2AC1 A;  4RFT 0;  5IK8 A;  2KR2 A;  5D21 A;  4FI9 A;  1GIC A;  2VMG A;  1XBF A;  5FYZ A;  1IQD C;  1DQ2 A;  5SV8 A;  1A34 A;  3B02 A;  1YHF A;  2CGN A;  2RM2 3;  4GA9 A;  4QXK A;  5ABJ C;  4V1P A;  1PGW 2;  2GDF A;  5CNA A;  5F3G A;  2RDN A;  2ARA A;  5CIS A;  2RJK A;  1F9K A;  1O8S A;  1KFX L;  1AR7 2;  4LO7 A;  4FAG A;  1NY7 2;  3FMG A;  5F5C A;  4C0B A;  2ZAB A;  1AR9 3;  1ODM A;  3KCC A;  2AAC A;  2VQU A;  2A6V A;  2I07 B;  4JRL A;  5FZ1 A;  5H9R A;  1H2N A;  2MEV 3;  3OY8 A;  4AEK A;  2PTM A;  2JJ6 A;  1ST8 A;  4UW5 A;  3AMQ A;  3WIN E;  4LA2 A;  3MIG A;  3VBR B;  4DIN B;  4LIV A;  5J96 B;  5K0U A;  2UYB A;  2X5I C;  4QKN A;  3VBO B;  3NJX A;  1ZBE 2;  3T2P A;  2PHX A;  5JIU A;  4LHK A;  4IND A;  3VD3 A;  1EAH 1;  4YVW C;  1VB4 A;  1YIF A;  2IUW A;  2J1A A;  3FLR A;  1AUY A;  4K21 A;  1IG0 A;  1MZE A;  4AYU A;  1JW6 A;  1D7P M;  3KM5 A;  2C24 A;  2RS1 2;  1JI6 A;  1A6C A;  3RQ0 A;  1UXZ A;  1KIT A;  1W0O A;  4S2H A;  1H1A A;  4IET A;  4YW4 A;  2A73 B;  4KQ7 A;  4IL7 A;  1PO1 3;  3N7K A;  1VRH 2;  1HQW A;  2YU1 A;  2WO3 A;  4FFI A;  4MGK E;  3ZYG A;  1NE6 A;  2VBB A;  5DG1 A;  1UKR A;  2CGO A;  1AX0 A;  2D40 A;  2ZHK A;  1C57 A;  2VR4 A;  1LOG A;  4CDX A;  3BKZ A;  2ZOE B;  4RQP C;  1ZZ6 A;  2BGO A;  1GWM A;  4M00 A;  1JUI A;  1XNT A;  1XYP A;  1ZBA 1;  2Y6K A;  3ES4 A;  3QAC A;  4QPG C;  3WW3 A;  1LHV A;  2Q5T A;  3EBR A;  1H2K A;  4LO4 B;  4NIA A;  3HN3 A;  1AJO A;  1BHG A;  4L8Q A;  4JDO A;  1XNC A;  4YZ3 A;  5I0S A;  1ZM1 A;  5D2A A;  3I2D A;  4KBB A;  4YM2 A;  1KXG A;  4GKY A;  2QQP A;  2PYT A;  1XC6 A;  2GN3 A;  2VEC A;  3W9A A;  1CZS A;  1VE0 A;  3CF6 E;  2O1Q A;  3HBK A;  1LGN A;  2K9Z A;  4OHY A;  2IWG B;  2DCZ A;  5FLH A;  1HRI 1;  3POI A;  3OGG A;  4AF9 A;  1DF0 A;  1EV1 2;  4JTN A;  5DG2 A;  3ZN5 A;  2JX9 A;  3GHM A;  3TBD A;  2RMU 1;  2PAK A;  2P2K A;  4GZ9 A;  1QXP A;  2HWF 3;  5AC9 3;  5IAX A;  1OVP A;  3MI8 A;  4XCB A;  3HR9 A;  3N9L A;  5IHR A;  5L9B A;  1R08 3;  1RUN A;  1X36 A;  3TOJ A;  1OD5 A;  3MFC A;  3G6J B;  4A7Y A;  3ALQ A;  4WVZ A;  4MXW B;  4N43 A;  5TSW A;  2Y33 A;  4YW1 A;  3DYO A;  2Y6G A;  5JCT A;  4QWN A;  1W8T A;  3RRD A;  1D0H A;  5DAV A;  1S4C A;  3U1X A;  1JHN A;  4A41 A;  1C8N A;  1NQJ A;  5EJ1 B;  5CAZ A;  4EZH A;  3ZXG A;  3NW4 A;  2CAU A;  4GKX A;  3ITQ A;  3Q8A A;  4TTG A;  3PVN A;  4LO6 B;  3DPR C;  4ZU5 A;  1PZ9 A;  2E53 A;  2X5I B;  2HH9 A;  1CAW A;  2ZGS A;  4CDU C;  2VY0 A;  4URA A;  1QOO A;  1G9D A;  2FDK A;  4XZU G;  2RG4 A;  1WLT A;  2GC3 A;  1VBA 1;  2PHT A;  5FZD A;  2FDH A;  2VC9 A;  2OUJ A;  3FL7 A;  1UCX A;  3HNB M;  5C8C A;  3ILF A;  3R6S A;  1W3X A;  1ONA A;  5L7O B;  1RUD 3;  4IEY A;  4MAD A;  3VN4 A;  1NA1 C;  5JXI A;  3LEI A;  2E33 A;  1NCQ A;  3ROU A;  5HCH A;  5BNO B;  4BCU A;  3LSE A;  1BCX A;  3NV2 A;  3A4U A;  5AVA A;  5KXC A;  1IGO A;  1YYN A;  5EJZ B;  5F5I A;  1MVQ A;  2QQV A;  3I54 A;  4RHV 3;  1JYC A;  4ATE A;  5BNP A;  1EUU A;  1FPN 3;  3WLU A;  1NQD A;  3JBG 1;  1Q8Q A;  4I0A A;  2KA3 A;  3OUH A;  1HRV 1;  2IXH A;  3VZL A;  2HWB 2;  1VBB 1;  4GB3 3;  1DBN A;  3JUU A;  3ZR6 A;  2PA7 A;  2DYC A;  1LU1 A;  3KWV A;  2PAM A;  2WT1 A;  4YM0 A;  2OQ6 A;  2Y8K A;  3WV6 A;  4MG2 A;  4KWU A;  1IZ3 A;  2DUP A;  4IGO A;  1AR6 3;  1YFX A;  2VBD A;  4QD2 A;  5J37 A;  1CX4 A;  5LRR A;  3PLQ A;  1IG3 A;  3Q9O A;  1G9A A;  2V5D A;  2JDN A;  4NHX A;  3UT0 A;  3MLJ A;  3PIG A;  4JDM A;  1HRI 3;  3H50 A;  1Z7S 2;  4CEW C;  3HWJ A;  2ERF A;  1ZBA 2;  2GNM A;  3J7H A;  4HLT A;  4KU8 A;  3HT2 A;  1QF3 A;  1U5Y A;  3M1H A;  4XDP A;  3V0B A;  1F8V A;  3KV9 A;  4LK6 A;  4QT6 A;  2XBO 1;  4Y3O A;  4NID A;  2L9L A;  5FWJ A;  1EP0 A;  5A1L A;  1GOG A;  1UYZ A;  2D44 A;  3K4Z A;  3K46 A;  3O0X A;  4QX2 A;  4UBG A;  3ZSE A;  4PT6 A;  5DUV A;  4YGD A;  1MAC A;  5JPM B;  1S0I A;  3D3A A;  4BQY A;  4CPB D;  3WCR A;  4RS5 A;  1HN1 A;  2XGX A;  4YZ2 A;  1VRH 1;  3IM0 A;  1OKO A;  4N43 C;  5FZ3 A;  4Z8B A;  2ET1 A;  1N1S A;  2FQP A;  3KS7 A;  4LLF A;  5FOJ B;  4AED C;  4I0W B;  2RS1 1;  4JHZ A;  2R0H A;  1QJX 1;  4KGG A;  1UZZ A;  3K77 A;  2R6Q A;  2XLF A;  5FYT A;  4RD7 A;  1LOB A;  3OF1 A;  1VIW B;  5K4L A;  2DVF A;  3MUZ 1;  4FPJ A;  3Q8B A;  4MGI E;  2BVB A;  3MGU A;  1N47 A;  1GP4 A;  3AFK A;  3LSD A;  3SKJ E;  4EZ4 A;  3K4A A;  5C8C C;  5I0T A;  1PIV 1;  1GNY A;  4ZXK A;  1AXK A;  2VD7 A;  4XFB A;  1HRV 3;  2VNG A;  5D8A C;  4CCN A;  1RB8 G;  2X53 S;  1U5I A;  2ZMN A;  3RS6 A;  1UY3 A;  4M0H A;  3MIC A;  4DXS A;  4YFZ A;  4HAN A;  5FZE A;  3ST7 A;  2MNG A;  1URX A;  2BEO A;  5FIX A;  4YPJ A;  1IS3 A;  4WM7 B;  4WZC A;  3U10 A;  2K46 A;  1JOD A;  3AFG A;  4NHY A;  3EYP A;  4CEY A;  2PHD A;  2CAV A;  4BK5 A;  1RHI 1;  2VOT A;  5A32 B;  4XIK A;  1MS0 A;  4QKD A;  3DGT A;  4GWJ A;  2W95 A;  3U4S A;  5JZG B;  2WT2 A;  1UW8 A;  4E2Q A;  2XBO 3;  4ATF A;  2XXZ A;  2EAA A;  2UU8 A;  1AR9 2;  4P9G A;  2WWU A;  3WNP A;  5JR7 B;  1PO2 1;  3CZU A;  2J22 A;  4AGG A;  1LKN A;  4GWN A;  1CZT A;  3QH7 A;  3W59 A;  2VMD A;  4IEW A;  2ZJC A;  4BM8 A;  2YG0 A;  2CTV A;  4NJ4 A;  4QGM A;  4IXL A;  2I2S A;  2XHK A;  3CZJ A;  5IUQ A;  2WNU B;  3N3H A;  1QH6 A;  5JXJ A;  3C7H A;  4COW A;  1I6X A;  3OEB A;  2OQ7 A;  2YC4 A;  3S7E A;  3WP4 A;  1SPP A;  2DBN A;  1VBD 3;  3UKT A;  4JKK A;  1NLS A;  2WII B;  2YV8 A;  5K8S A;  2W39 A;  3JQX A;  1GOF A;  1UZW A;  2JDA A;  5CKM A;  1KD7 A;  1E5S A;  3N36 A;  3KT1 A;  5KHK A;  2G4I A;  4N53 A;  4QHZ A;  5A6Q A;  2VO5 A;  3W21 A;  1PGL 2;  3CQO A;  2OXB A;  4CDQ B;  1V6K A;  3R0R A;  4FPH A;  1H8T B;  5A7Q A;  3KHC A;  2D3S A;  2WZP P;  2XKP A;  2HWD 1;  2VZS A;  4XAA A;  1AX1 A;  3EQE A;  2LTN A;  1VR3 A;  5LEJ A;  1WA4 A;  3N35 A;  1KJL A;  4E4Z A;  1PNG A;  3H3U A;  3J4U H;  2DTW A;  3OBA A;  2W1U A;  3LDB A;  1XNK A;  1ZZ7 A;  3X29 B;  1OUS A;  2Y26 A;  1W6O B;  4XCA A;  4FTB A;  1E5I A;  3CKH A;  4N90 A;  1YJL A;  2G1M A;  4P00 B;  1Q3E A;  4ZU7 A;  5BNN B;  4ZY9 A;  2CDO A;  5GLW A;  2VMI A;  1GZW B;  1WW6 A;  2QTW B;  1H8V A;  1TNF A;  4CYD A;  4WZF A;  5HPO A;  1DQ1 A;  2JG8 B;  2WN2 A;  3WR0 A;  1W6N A;  1OUX A;  1QJU 3;  1QJY 1;  2B9V A;  3ZFE B;  4JHT A;  2FCV A;  2HWF 1;  3KVA A;  5AC9 1;  2A6Y A;  1LOF C;  1QIQ A;  2VJX A;  5I93 A;  1HJG A;  1YQ6 A;  3S7I A;  3ZYI B;  4AG4 A;  4AGR A;  5AFE A;  4COU A;  4HN1 A;  1GNH A;  2JIC A;  1CAX A;  5IK5 A;  3DCQ A;  5HCF A;  1R09 3;  1LEN A;  4XF0 A;  5EPA A;  1S2K A;  3U37 A;  2CL2 A;  4CZS A;  2RS3 1;  2Q1Z B;  4N7U A;  3ZFG B;  4DUW A;  2K2S A;  1R1A 3;  4Q2F A;  3AL6 A;  5A3U A;  4XAE A;  3OPZ A;  1MR5 A;  4XJ8 A;  4ZXE A;  2PN5 A;  2Z5W A;  4LT5 A;  1QY4 A;  2ZCW A;  3VBH B;  4KWL A;  4K40 A;  2WZR 3;  3RMY A;  2ZGO A;  2I45 A;  3F2Z A;  1W9Y A;  4LLO A;  3DKW A;  3OGS A;  2W3J A;  3LIH A;  3PUH A;  3JBG 3;  2R16 A;  1W6M A;  2WKK A;  3M4F A;  1AF9 A;  1MQT B;  4UF0 A;  2K0G A;  3HD8 B;  1LJ7 A;  4LR4 A;  1ULP A;  4QQ2 A;  3NKG A;  2R1D A;  1WBL A;  5HBA A;  4EN6 B;  1RYY A;  3DYM A;  4PBO A;  2WBK A;  2PFW A;  2D6N A;  4NHL A;  4ISQ A;  4GMP 0;  1RTV A;  1RUD 2;  2CSG A;  2JG9 B;  3VBO C;  3WF0 A;  3U75 A;  4AI8 A;  3T1L A;  2CGP A;  5BNO A;  1PX4 A;  3E5X A;  3O7O A;  4OI2 A;  1JZ8 A;  5HI0 A;  1GWK A;  1ND3 A;  5I0D A;  4FAH A;  1IPJ A;  4D94 A;  2WS9 1;  2J1S A;  1HKD A;  4B8E A;  1YFW A;  1V6J A;  2AEZ A;  5LBC A;  2ARE A;  2OVU A;  2FHR A;  1FNZ A;  4EWD A;  1GZW A;  3S0M A;  5JUV A;  4E4S A;  4CCC A;  4NPR A;  3J9S A;  3POE A;  5FZC A;  1RUG 3;  2QE3 A;  3CDZ B;  4LUL A;  5DZE A;  4OLL A;  3U0Z A;  1TME 3;  1U0A A;  4JCK A;  4CP9 A;  4DXT A;  2D98 A;  5K9Y A;  4HSJ A;  3VBF A;  1W05 A;  1QDC A;  3HMY A;  5FCC A;  1Q8S A;  1Z7S 1;  2TUN A;  2MEV 2;  1JOB A;  3AP4 A;  4QDR A;  4XQ4 A;  3I2K A;  4JGY C;  2VNV A;  1L7L A;  5FP9 A;  1QHD A;  1DLL A;  5FZH A;  4Q5O A;  5F32 A;  2BWC A;  4CUB A;  4FP3 A;  3SEE A;  1K3I A;  2R0F A;  1X9T A;  5K0U C;  3EO6 A;  2WLQ A;  3NV4 A;  1SLA A;  4Y26 A;  4XF4 A;  1SG3 A;  1OA4 A;  4D7T A;  2VOX A;  3OUI A;  1Q8O A;  3H8X A;  3PIJ A;  1PMI A;  1WGP A;  2HWB 1;  4AFC A;  2GC2 A;  4GIQ A;  4UI9 L;  4NRP A;  3THP A;  5C8C B;  4ES8 A;  4DNY A;  3IDB B;  3LA2 A;  2CYF A;  4AI0 A;  3PL0 A;  2PQS A;  2SLI A;  1UU4 A;  2J7M A;  1JXN A;  2G9Z A;  1X82 A;  1M06 G;  4Y1V A;  4XJ9 A;  4BIF A;  1BEV 2;  1PGS A;  2VQA A;  2YHJ A;  1H1M A;  3ACL A;  3W20 A;  2OII A;  3TEY A;  4Q4Y 3;  1WCU A;  2XWB B;  4ZON A;  2W92 A;  2RR1 1;  4R52 A;  4PQQ A;  4AQ6 A;  1YQ5 A;  3VBS C;  4NIG A;  2QQO A;  2ZBJ A;  4IEU A;  2E32 A;  1RUH 2;  5LA9 A;  3ZKY A;  2XML A;  4CEW A;  4W50 A;  3U78 A;  2GH8 A;  4CDW C;  3MPP G;  1W6P B;  3DPR A;  4UOJ A;  3O1M A;  3H8O A;  1SLT A;  4CXY A;  5FYV A;  1W0P A;  2WO2 A;  3J7N A;  3OOX A;  1HXS 3;  4L92 A;  1HRV 2;  2OT7 A;  1V6L A;  1OPO A;  1FOD 3;  2HKX A;  1RL3 A;  3P5B A;  1GQP A;  2EIE A;  5FYM A;  1OQE A;  4HBN A;  1JHJ A;  3LIG A;  4IV3 B;  4ORF A;  4AI1 A;  2JDY A;  1LEC A;  3NQH A;  4Q4X 3;  2A71 A;  3AYE A;  2F4P A;  1R1Z A;  3WG4 A;  3J7L A;  4CDQ C;  3ORJ A;  5FY7 A;  3ACG A;  4CCE A;  1G9B A;  3I49 A;  2VOW A;  3FX3 A;  4HON A;  4NIH A;  4Q8L A;  4LA3 A;  4A45 A;  3ACF A;  1POV 0;  1TE1 B;  5A1F A;  1WA6 X;  5DDJ 2;  5LCW L;  2W1S A;  1QGL A;  4JZR A;  2LM3 A;  4UFJ A;  5F3E A;  4BHP A;  4U2A A;  2XVG A;  5FLI A;  3TWI A;  5FO7 B;  1SDD B;  3GXU A;  3VZK A;  3VD7 A;  3W5M A;  4JKL A;  2ZA9 A;  2ZEW A;  2VGD A;  1H6Y A;  4AZZ A;  2NLR A;  4IES A;  4IE0 A;  3OGJ A;  2JG9 C;  2WLP A;  3RYR A;  2HLE A;  4CDW B;  1KEX A;  3BIW E;  1XNB A;  3VBF C;  1LAJ A;  2YXS A;  5FZ4 A;  3WX5 A;  1A3K A;  5DAX A;  4MV2 A;  3O0W A;  3E6C C;  4CU7 A;  5BV6 A;  3GYD A;  3ZLI A;  4MSV A;  3WP6 A;  3ZYR A;  2RDS A;  2VUJ A;  4XF3 A;  1UY2 A;  4Y22 A;  2ADD A;  3PDQ A;  5C9A C;  4KBZ A;  1HXS 1;  2JKX A;  3NAP C;  3BB6 A;  4M3C A;  1MS5 A;  1GMM A;  3JD7 3;  1OLR A;  3ZDV A;  3JU9 A;  5FJK A;  3AP9 A;  3I2O A;  1DLC A;  1TMF 3;  2P3K A;  4FQZ A;  3DN7 A;  1AYN 1;  2XL9 A;  3NJY A;  4YW5 A;  2TNF A;  2HWD 3;  1O5U A;  3HJR A;  3POF A;  3MBW A;  3O14 A;  2H6C A;  4LK7 A;  1O8P A;  5CZK A;  4QXH A;  3T4V A;  1BEV 1;  1UZ0 A;  1F4A A;  4FPC A;  1QU0 A;  4O65 A;  4AVB A;  1BVV A;  4D8M A;  4LTA A;  3MEP A;  5GLT A;  2GN7 A;  1AYM 2;  4DQA A;  2GH2 A;  3RYK A;  3PJY A;  3OGV A;  1IS6 A;  1DZR A;  3KCY A;  1O4Z A;  2BNO A;  4I01 A;  4JGY B;  5CKQ A;  5T52 A;  1OLQ A;  4CUC A;  1KQR A;  5CFD B;  3FC0 A;  5LRS A;  4Q4Y 1;  4A7Z A;  1C3H A;  2FD8 A;  2ZEZ A;  4HK8 A;  2HYX A;  2QCS B;  3ME2 A;  1PK6 B;  2O8O A;  1US3 A;  2YUE A;  4GJY A;  4QPI A;  1FX5 A;  2GC0 A;  1E5R A;  2OPK A;  4CDW A;  1LNS A;  1UXX X;  4GH4 B;  1OFS A;  4QHB A;  2DVG A;  3ABZ A;  1WMD A;  4QQH A;  5F39 A;  4BE3 A;  2IVJ A;  1NXM A;  3RSJ A;  2R06 3;  3ZYF A;  2ZGN A;  2JEM A;  1DGW X;  1ENX A;  1AR8 2;  4W6Y A;  5CB7 A;  4HSL A;  5K0U B;  1SPP B;  3DPR B;  1AYN 3;  1WD3 A;  1Q5O A;  5FZI A;  1J3R A;  1H4H A;  2CWM A;  2BTV C;  3R4U A;  4Q0P A;  5FMD A;  4C90 A;  1BBT 3;  3K3N A;  4EQV A;  2A3X A;  2WQ4 A;  5LA2 A;  1GWL A;  4L9B A;  3ZXJ A;  4OUM A;  4S2D A;  4WV8 A;  3UL2 A;  4CDX C;  4LIT A;  3J8F 2;  3P6B A;  5IVB A;  5FMO L;  4BYY A;  5C5T A;  4XBL A;  1OA3 A;  4P9X A;  4E8C A;  4YM3 A;  2X05 A;  2BJS A;  5JOZ A;  1N1V A;  4OQ9 A;  3INA A;  3EMR A;  5DUU A;  4YAR A;  4IV3 C;  1UX7 A;  5FDB A;  3VB9 A;  4NII A;  3TN9 1;  4OVE A;  3T3Y A;  2JB4 A;  2B8M A;  5C71 A;  2O0O A;  2R30 A;  1IPS A;  5JR2 A;  1YXW A;  4QXC A;  1DYK A;  3CMG A;  1N3Q A;  1C8M 1;  1IQA A;  1DGR A;  1W04 A;  1W3V A;  2XJT A;  2Z69 A;  2UWC A;  2E63 A;  1EUT A;  1RUG 1;  3POJ A;  4ASL A;  5IVC A;  4P9Y A;  1AYM 1;  2VUD A;  1YQ2 A;  3AVS A;  3U14 A;  1RUC 3;  4AWD A;  2VMH A;  3B3Q E;  4LKD A;  2QFE A;  1G9C A;  1RGS A;  2RS5 3;  1OH3 A;  4IV3 A;  4QQO A;  5FYC A;  4DMI A;  4YYO A;  1CIW A;  1G7Y A;  2YDE A;  2C6S A;  3B5L B;  1F15 A;  1SHW B;  3OYW A;  4KI5 M;  1OA2 A;  4GWI A;  3IMM A;  3HQX A;  3RDI A;  1UIJ A;  2UY9 A;  2GU9 A;  1DIW A;  4PIY A;  3V0A A;  4QAW A;  2EXH A;  1GZ9 A;  1W9W A;  4XMI A;  3BAL A;  2E51 A;  3HQU A;  3VHR A;  3WDV A;  3UK9 A;  4AED B;  5JXH A;  4SBV A;  3AKR A;  2WNE A;  5A33 A;  2BU9 A;  4HVR A;  1XXN A;  3B7M A;  3RI8 A;  4LE3 A;  4TLG A;  3ZMN A;  1NAE A;  5FMC A;  2Y64 A;  2RM2 2;  4CA9 A;  3ZYH A;  3S5Q A;  3KVB A;  2CHH A;  3I59 A;  3AJY A;  4MGZ E;  5GLV A;  5I8S A;  1RHI 3;  2JIJ A;  3ON7 A;  5JPN B;  5LBE A;  3LZZ A;  4M3C B;  2VM9 A;  3D4K A;  4LE4 A;  3ZDS A;  2PHW A;  2D5H A;  4S2G A;  2RS5 1;  4IV1 C;  2WAB A;  3I8T A;  5HCA A;  4HKW A;  4IE5 A;  3BPS A;  2ATF A;  5IVY A;  1W8W A;  4O9G A;  2Y6J A;  2XOM A;  3GZA A;  2ZEY A;  2EAK A;  5JIA A;  2Q8C A;  1JZ2 A;  1FOD 2;  5DMY A;  1FOD 1;  2PHF A;  2DCY A;  4QU1 A;  4OYU A;  4YG3 A;  4Z07 A;  1SLC A;  3WDT A;  3W58 A;  1DZT A;  2NYY A;  3OPW A;  1O3R A;  1REE A;  2RR1 3;  1ASJ 3;  4EV0 A;  5GLU A;  2VME A;  3UGG A;  1POV 1;  3O1S A;  1Y4W A;  2XJU A;  4YG6 A;  4PCR A;  5JOW A;  4LPL A;  2ORZ A;  2Q8O A;  2C5D A;  1TNR A;  2DUO A;  1RUE 1;  1RUH 1;  4PI2 A;  4P9I A;  3VBF B;  5BNP B;  1D4V B;  3LOI A;  4CRQ A;  4XIL A;  4LO5 B;  3SXW A;  2O8Q A;  2XUM A;  2W52 A;  5JLV A;  3FBY A;  4DB5 A;  5C3Q A;  2XLG A;  2VZ3 A;  4H2A A;  3VLB B;  4A42 A;  5T5J A;  2C0Z A;  3ZSJ A;  5J3U A;  1YNA A;  4JQT A;  4DUX A;  4CCL A;  5BNO C;  3T0A A;  4NHM A;  4WM7 A;  3CJI A;  2VOK A;  4JGZ B;  3TN9 2;  3WF2 A;  1J3Q A;  4XMA A;  5KXB A;  4OI0 A;  5C8W A;  1JYI A;  2W2I A;  5FZM A;  1DQ0 A;  4I09 A;  1MS8 A;  1LHU A;  1QJU 2;  2JG9 A;  4OCT A;  5GZD A;  4NVP A;  1QDO A;  2WDB A;  1LGC A;  2R07 2;  1NLQ A;  2Y60 A;  3I97 A;  3OD0 A;  4Q4W 2;  3JXS A;  5JMC A;  1VAL A;  3AMH A;  2Y6F A;  3MLK A;  3O0V A;  3K48 A;  4MET A;  4I30 A;  2MEV 1;  2XON A;  3I3Q A;  4P5Y A;  3VDD C;  2HEY F;  2WT0 A;  4RGK A;  4XJU A;  5IVF A;  3AZX A;  2WA3 A;  1CAV A;  3O1R A;  4KNC A;  5L36 A;  2W0X A;  5IAT A;  1HQN A;  3FHQ A;  1VAV A;  3OJB A;  2Q8D A;  3E1F 1;  4IQP A;  3I2G A;  3ZXK A;  2EXK A;  4XPV A;  3AP5 A;  1CWP A;  4XFA A;  2A1X A;  2IXC A;  2B46 X;  4Y1X A;  1IS4 A;  1YLL A;  4JX0 A;  4I02 A;  2FZ1 A;  4KWJ A;  4XHB A;  1B09 A;  1CAW B;  1BK0 A;  2NPI A;  4L0P A;  1JUH A;  3C2U A;  1PK6 C;  2JKB A;  1TMF 2;  3LA7 A;  1Q56 A;  1RUH 3;  3VUO A;  3RZH A;  1K12 A;  1Z78 A;  3WDY A;  3SQO A;  2AGS A;  2Y6H A;  3MUY 1;  4IV1 B;  4GD4 A;  4NAM A;  3GBG A;  1O59 A;  1ZVF A;  2XJS A;  3DEM A;  1UU6 A;  3AVR A;  3VDC A;  2GAL A;  3J8F 1;  3RG0 A;  4Z92 B;  2OKX A;  4E9K A;  1T6G C;  1W03 A;  3UJO A;  2XR4 A;  3RWN A;  1Y9Q A;  2C4X A;  2IXK A;  3LEK A;  4FPL A;  4K8R B;  1UZY A;  3C7F A;  1SBF A;  1WWY A;  4M0N A;  3WCS A;  5T50 A;  1ULD A;  4HKO A;  5DUW A;  5BNP C;  1QWR A;  5KHH A;  1AXY A;  1AR8 1;  5KHJ A;  2X29 A;  2R49 A;  1U5Z A;  3S6P A;  3HVD A;  5T5O A;  4BH9 A;  3AYA A;  4GMP 1;  5JZG A;  2OUH A;  4JGZ A;  4QM8 A;  1CPN A;  1W6O A;  3BOW A;  4PIX A;  5ANQ A;  2NZ9 A;  3O1T A;  1RUI 2;  1JS9 A;  1IHM A;  1R1A 2;  2DVD A;  5IVV A;  2JE7 A;  3RYP A;  4H3W A;  2AUY A;  2ZHN A;  3FHA A;  2LRP A;  4I3P A;  3FLT A;  4Q1P A;  3U4X A;  4WM8 B;  4Q4Y 2;  4FPK A;  4GJZ A;  3H8U A;  5FP8 A;  2QQK A;  2Z79 A;  4GWM A;  2JIG A;  3LFM A;  3ZOI A;  1JMU B;  4RGG A;  4Y5S A;  3AZY A;  5I0U A;  1C1F A;  4HVO A;  1VBC 1;  3WDX A;  1SAC A;  3KV5 A;  4BQ2 A;  1OH4 A;  4JGY A;  3JBG 2;  5FMO S;  2X09 A;  3NJV A;  4GAL A;  1RUC 2;  3ZMO A;  1CAV B;  3SIS A;  1ND2 C;  1QJY 2;  2EA7 A;  1ULF A;  2P1B A;  3KT4 A;  5L9R A;  3ASI A;  2ZS6 B;  2ZKL A;  1XE8 A;  4IE6 A;  3RZZ A;  3ENR A;  3O1O A;  3WW1 A;  1KDK A;  2ZAH A;  1C1L A;  4H7M A;  5ABJ A;  1V9U 3;  4RL7 A;  3NST A;  5LEK A;  5FP7 A;  4E2S A;  4KL1 A;  5CAD A;  4DUV A;  4J1X A;  2WFF 2;  4PQ9 A;  2Y0I A;  2VAU A;  4P9L A;  1GV9 A;  2XL7 A;  2QNK A;  4FPG A;  4MHR A;  2P17 A;  4HPK B;  4MH0 E;  1FV3 A;  1VJ2 A;  3NJZ A;  2ZMK A;  4Y22 B;  4CCO A;  2W1W A;  3NAP A;  3DUI A;  4URT A;  1KFU L;  4R8H A;  1W6N B;  2DCK A;  2X5I A;  3MFA A;  4E8D A;  3CU7 A;  2RM2 1;  3OUJ A;  3VKF C;  2KXL A;  1MQT A;  5EQU A;  2JDU A;  3NKT A;  5C7G A;  4XXA A;  3TEZ A;  4D7Y A;  4QXB A;  4H55 A;  4QGN A;  4G3Y C;  4NRO A;  3I2J A;  5FK7 A;  1FPN 1;  2EIC A;  1SLL A;  2WNV A;  2VUL A;  3ZSM A;  3N9M A;  5FBZ A;  5JWP A;  4AE2 A;  2ZPX A;  3AP6 A;  4W6W A;  1G86 A;  1UOJ A;  2DVA A;  4IEQ A;  1W8U A;  4QPI C;  3VZJ A;  5C33 A;  2MHF A;  4ARX A;  4DO0 A;  3BCW A;  5A3N A;  4LQR A;  1OI6 A;  1H30 A;  3QOP A;  5G04 L;  5F9T A;  1RVF 2;  5IVJ A;  3WNX A;  1RUJ 3;  2VZV A;  2WAA A;  3OY8 B;  3KMH A;  3BIE A;  1ZYB A;  5DXD A;  1V9U 2;  3QBQ A;  3TYJ A;  4EE2 A;  4YGB A;  2C9K A;  2JDP A;  3BYW A;  2ZGQ A;  1MEC 3;  4H7L A;  2YFU A;  3Q8E A;  5D8A B;  4P9W A;  1PMH X;  3JB4 C;  1GR3 A;  5DAW A;  3ZR5 A;  1PX3 A;  4QPG A;  3UGF A;  2WZE A;  5J1X A;  3ACI A;  3ZXL A;  5BY5 A;  3HQR A;  2QDR A;  1V6O A;  4XOG A;  2ZML A;  1ENQ A;  2OA2 A;  5HV0 A;  1UO9 A;  3F95 A;  4FXK B;  1RHI 2;  5BUV A;  3WNL A;  3D5O A;  4FO9 A;  4IEZ A;  2WNU A;  4OHZ A;  3GDB A;  4FOV A;  4NPL A;  5C5U A;  1ULC A;  5FO8 B;  3OBT A;  1V6I A;  2W68 A;  1HLC A;  1XU1 A;  5ACA 3;  4Y5Z 0;  3ZYP A;  1H9W A;  3FBM A;  1OFN A;  1XB9 A;  2ZZQ A;  1CD3 G;  2UUR A;  2VL4 A;  3BVC A;  4KG8 A;  5FPB A;  3AB0 A;  5KR7 A;  1XQN A;  3WG1 A;  3B69 A;  3KT7 A;  4Y5T A;  3V0A B;  1JZ4 A;  1K5M C;  1LHO A;  3RZM A;  4PLM A;  2QUO A;  3KZ4 C;  1O3Q A;  3VDD B;  2VH9 A;  2FMY A;  3CHX A;  1UWW A;  4KMQ A;  4CU9 A;  1AXZ A;  1E5H A;  4HPK A;  3SC7 X;  4Q4W 3;  4TZD A;  1YO8 A;  2FCU A;  4YRD A;  4UFK A;  1F31 A;  1O3S A;  4AVA A;  3ZXA C;  4FFF A;  1US2 A;  4BQ1 A;  3NNL A;  5A7N A;  1UF2 C;  1DDL A;  1SLB A;  3K4D A;  3POS A;  4IW3 A;  1UU5 A;  3D8C A;  2DU1 A;  3FHI B;  4XUP A;  5I91 A;  5EIY B;  2VVE A;  2BDR A;  4W8J A;  1V6M A;  2RJ2 A;  4FFG A;  1IKQ A;  1UL9 A;  3HIF A;  5FZ0 A;  2HBU A;  1QQP 3;  4FSJ A;  1BMV 1;  5CFC B;  1LU2 A;  1VAK A;  2WNV B;  3MIB A;  3FLP A;  4MGQ A;  1WCK A;  1Z0H A;  3WDW A;  3IMN A;  4UW6 A;  2JD4 A;  1ZRC A;  1RIT A;  3WDU A;  1COV 2;  3HAG A;  5LA0 A;  5A3P A;  3GHN A;  2BW8 A;  3PTY A;  5JAX A;  3T30 A;  1JH5 A;  2JD9 A;  2XBO 2;  4R9D A;  1CZV A;  1DHK B;  4LO8 A;  1WW7 A;  1OKQ A;  2XQR A;  4K9S A;  1BZW A;  4IE7 A;  2IC1 A;  3P3N A;  4MUV A;  3MO4 A;  5DZG A;  3RZL A;  3MF6 A;  1LB2 A;  4RSU A;  3H42 B;  4QX8 A;  1QKQ A;  1AR6 2;  1LGB A;  2P4E A;  1UYX A;  5FZL A;  3B94 A;  5L19 A;  5EP9 A;  1JBC A;  4Y20 B;  2BZD A;  2XJR A;  1NUK A;  3PME A;  1VBA 3;  1J1T A;  4YVW A;  3P3P A;  1MEC 1;  1XYN A;  3H3Z A;  4YFW A;  2Y34 A;  3TNQ A;  3N7L A;  5LK7 B;  1V0A A;  3PUQ A;  3BTY A;  3J7M A;  2DDU A;  3UES A;  4AFA A;  3LDK A;  4XFH A;  4D0Q A;  3DXU A;  2YMZ A;  3H9A A;  4Y4Y A;  4XAC A;  2DCT A;  4BXS V;  3N4M A;  4EN7 B;  3KQR A;  4AAP A;  2GNT A;  5K7P A;  1S0B A;  4WM8 C;  1W2A X;  3ZVX A;  1N1Y A;  2F17 A;  3WQ7 A;  2OZ6 A;  1S0D A;  3RNS A;  5CEH A;  4PF5 A;  4DS0 A;  4V2V A;  3UJQ A;  4AI2 A;  2UWA A;  1SZB A;  4AI9 A;  1QJF A;  5FY4 A;  2W47 A;  3JD7 2;  3BUC A;  1VBB 3;  3H3L A;  1H8T A;  3AZW A;  4CTE A;  3MPB A;  1TG7 A;  2QVS B;  2HWC 1;  2JDZ A;  5J36 A;  2ZGM A;  2VBP A;  1K5M B;  2TBV A;  2R32 A;  3C3V A;  2RS5 2;  1RIR A;  1PGL 1;  1JZ3 A;  2H0B A;  1AR8 3;  4XF1 A;  3WZ1 A;  1RXG A;  3MIE A;  3ZFF C;  3PUS A;  1HIX A;  3RZK A;  2WIN B;  1OC1 A;  1S0J A;  5L7O C;  1CAX B;  4Q0U A;  3ETQ A;  4GXL A;  4AXO A;  4RGA A;  1RMU 2;  1NKG A;  2NQY A;  2P6H A;  5FTT C;  5FZO B;  2D3R A;  3TRS B;  1B35 C;  4OMD A;  4WM7 C;  2XVK A;  3KF5 A;  4BQ5 A;  5A1A A;  3UNP A;  1PO1 1;  2DTY A;  4NOT A;  3NV1 A;  5E16 A;  4QMA A;  2FMD A;  3A0K A;  3AXE A;  2JEC A;  1RJ7 A;  4A3Z A;  2RDQ A;  1F2N A;  2ZX4 A;  2LRO A;  5SV5 A;  5IFT A;  1EV1 3;  5KBF A;  4HMZ A;  1PVC 1;  4LJH A;  3CJI B;  4ZS2 A;  1HB1 A;  1DQ4 A;  2WJS A;  3IN9 A;  1PIV 3;  2D43 A;  4K1Y A;  2DFC A;  1J3P A;  3CO2 A;  3ZIX A;  4ASK A;  1ZRF A;  2ORX A;  2RS3 3;  5CYY A;  3LA3 A;  4L99 A;  5FRE A;  3SKV A;  4AFB A;  2GMP A;  3L9J T;  3KV4 A;  2RE9 A;  2XDV A;  3JQW A;  4YVS C;  3R4D B;  1UQX A;  2ZHL A;  4QPI B;  2VCC A;  5E89 A;  3ZFG A;  4C91 A;  1B35 A;  4XZP A;  2WZR 1;  3POW A;  1IS5 A;  2QBX A;  2QQW A;  1OLM E;  2GMM A;  4CEY C;  4QX0 A;  2BFU S;  4R4Z A;  3MZH A;  3I2I A;  2VW1 A;  3LWC A;  5A6Z A;  2ES3 A;  4AHZ A;  5JMO A;  1XSQ A;  4NR1 A;  4XW3 A;  3S5A A;  1XU2 A;  1PMJ X;  1DCS A;  4FXG B;  4KWK A;  5T5P A;  4P14 A;  4QB1 A;  3SIT A;  2HWC 3;  1CJD A;  4AVS A;  4BQX A;  1NYW A;  2Q0A A;  1H6X A;  2WNV C;  1PK6 A;  1M4W A;  3VBU B;  4UFI A;  4Y1Y A;  1S1A A;  4HOO A;  4YVS A;  5FPX A;  1FMD 3;  3N9O A;  4XJA A;  5CG8 A;  5IWF A;  1CR7 A;  1W6P A;  3WUD A;  2V72 A;  2GP3 A;  5FZ6 A;  5HV4 A;  2XKO A;  1OD3 A;  4IGQ A;  3ZN6 B;  4BK4 A;  4M01 A;  1N3P A;  4XUT A;  3I59 B;  2GME A;  3VD4 A;  3BN6 A;  2JB8 A;  2VVF A;  2D93 A;  4DEV A;  1VBD 1;  2DCJ A;  1F5J A;  4XJW A;  4OI1 A;  4Z82 A;  1F35 A;  4BU2 A;  3N7J A;  4AI3 A;  4EN8 B;  1PO2 3;  4O61 A;  5FYS A;  4UFH A;  5ABJ B;  2TEP A;  3TAY A;  3M7A A;  5APA A;  4A44 A;  4FPE A;  1OOP B;  1LEM A;  3AKS A;  3MIH A;  3A0N A;  4XVH A;  4BQW A;  1O4T A;  4MX3 A;  3GM8 A;  3M3E A;  1LED A;  4FOY A;  2WS9 2;  1WLC A;  1WZX A;  4ZKT B;  2W94 A;  5KHG A;  2SBA A;  2B45 X;  5HCB A;  3E6D A;  1UKG A;  5A7W A;  3H1Y A;  3N7M A;  4L11 A;  2B7Y A;  1SMV A;  5FXV A;  4HKL A;  5GZG A;  4Q26 A;  1YWK A;  1W9F A;  5LBF A;  2VZQ A;  3FFZ A;  3GJB A;  4HXC A;  4XHX A;  1JZ7 A;  5M0T A;  1AZD A;  3ZX7 A;  1W8N A;  2HJI A;  4AHY A;  3VBO A;  4XIO A;  3AKQ A;  1MPX A;  5IVE A;  2BV4 A;  2B9U A;  1ZZ9 A;  4XTM A;  2IXL A;  2Y0O A;  4PDW A;  1A8M A;  1GAN A;  2JEN A;  3LPF A;  4D3W A;  3O1U A;  2IFR A;  2AEY A;  1T6B X;  1WLW A;  2VZO A;  4CXW A;  4LUK A;  3ZSK A;  1C8M 3;  4M4P A;  1QQP 1;  2W08 A;  1NT0 A;  2P3I A;  4AVC A;  3POB A;  1JZ6 A;  1O3T A;  3GBW A;  4QM9 A;  2I74 A;  2D6K A;  2PAE A;  4Q4W 1;  2E7A A;  5FK8 A;  1HQL A;  1S0G A;  4AK3 A;  4Y1U A;  2BQP A;  2DUQ A;  5F5Q A;  5LAS A;  3LD8 A;  2HWE 1;  1B35 B;  2V73 A;  2OX0 A;  3VBR C;  3DKQ A;  2V4V A;  1CVN A;  5FY1 A;  5CFD A;  1HJF A;  3WW4 A;  3AK0 A;  1I5P A;  1HXS 2;  5FYH A;  1HW5 A;  2DFB A;  1LOE A;  4QPG B;  3H7J A;  4EWA A;  5F3I A;  4PDW C;  4I0B A;  2XVL A;  1GLH A;  4FT8 A;  2Q1F A;  2D97 A;  5CKN A;  5FQ0 A;  2C9A A;  2NN8 A;  3BPZ A;  1GUI A;  4C1X A;  1WCQ A;  4CSW A;  3MF9 A;  1R09 1;  2WAO A;  4LKF A;  4AFM A;  4W4Z A;  5ISL A;  2W1Q A;  2CDP A;  1JOP A;  3OPT A;  4AVV A;  4XET A;  1YFY A;  4YVS B;  5IT6 A;  1LHN A;  5BNQ A;  5GM0 A;  1V70 A;  2YPD A;  3T1M A;  1TZO A;  3W5N A;  1AL2 3;  4ISR A;  5BNN A;  1C5H A;  2BP6 A;  1RUE 2;  4NRQ A;  1G9F A;  2VU9 A;  3KLS A;  2YC2 A;  3I4I A;  3IDA A;  2RHP A;  3OSD A;  1LTE A;  3CEW A;  2V09 A;  4B1L A;  5DAQ A;  1EAH 3;  1JU3 A;  3PMS A;  3VZN A;  4ONU A;  2QDN A;  2QQU A;  1TEI A;  1VPH A;  2DU0 A;  3H7Y A;  4RHV 2;  1TVG A;  1HB2 A;  2EAL A;  3B01 A;  2OYZ A;  2RVA A;  2YFZ A;  4WVV A;  3WF3 A;  5ACA 2;  1FXZ A;  3I3B A;  2RMU 2;  3T4H B;  4Z1V A;  4MGT A;  3ZXF A;  3GNE A;  2ZEX A;  1JYV A;  4UXA A;  4BIS A;  2WO1 A;  3N9Q A;  1VP6 A;  3TEX A;  3L2Y A;  1FAY A;  1QNW A;  2ARX A;  1VBA 2;  1D2Q A;  1H2L A;  3LEG A;  4HET A;  3C8X A;  4E27 A;  3ZN6 A;  3E5Q A;  1LHW A;  4NN0 A;  1HV1 A;  4Y33 A;  5FV3 A;  1SEF A;  2GZW A;  3E97 A;  1GYK A;  2VPV A;  2FZ2 A;  1WD4 A;  5L73 A;  1LOD A;  2RR1 2;  3HT1 A;  3MV1 1;  1TME 1;  2Y6L A;  4LBN A;  2OZJ A;  3VBU A;  3THC A;  3OEA A;  4ITC A;  1XND A;  3CJI C;  5EYX A;  1MS4 A;  4OZX A;  3RZG A;  1QNY A;  5F5A A;  2VZT A;  1XE0 A;  3OD4 A;  3WP5 A;  1SCR A;  2JG8 A;  2WNU C;  1DP0 A;  3AMM A;  3WVJ A;  2FDG A;  1UY4 A;  4HVQ A;  3QD6 A;  3VKM A;  1CES A;  3FUQ A;  3IBM A;  1ZBE 3;  1OOP C;  3BTA A;  3VBS B;  1W0N A;  2DF7 A;  3RI9 A;  1PM7 A;  3VL9 A;  3WQ0 A;  1GOH A;  1XRU A;  1NCR C;  5JI7 A;  4EN0 A;  3OBR A;  2P37 A;  1J84 A;  1LOC A;  2KM2 A;  2VW0 A;  4BXF A;  1KS5 A;  4QKB A;  3B93 A;  1RUI 3;  3LB9 A;  3POG A;  4XXP A;  2R06 2;  3IPV A;  4QX1 A;  1UOF A;  2ZX1 A;  1W99 A;  4YGE A;  5T55 A;  3SLI A;  1HB4 A;  1RUF 1;  4OI4 A;  1D4M 1;  1KS4 A;  4CP9 B;  4A3X A;  5FXZ A;  1VMH A;  1LCL A;  5C3P A;  2YU2 A;  5E1R A;  5FZK A;  1QOS A;  1OLM A;  1SLI A;  2R07 3;  1RXF A;  2R04 3;  2YBS A;  2PEL A;  5FYI A;  1A8D A;  5LY2 A;  3BTZ A;  1K42 A;  2Q8E A;  3H1M A;  2ZGK A;  4Q4X 2;  3VL8 A;  3WNM A;  4HN0 A;  4DXR A;  3BOP A;  2XH6 A;  1HX6 A;  3WW2 A;  3A21 A;  3S30 A;  3RZJ A;  3ZYJ B;  2EID A;  5FKB A;  3T08 A;  1MEC 2;  2A6Z A;  1XYO A;  2CNA A;  1AHS A;  3RWK X;  3J26 N;  3WUC A;  3HNY M;  4K1Z A;  3EJK A;  5FUI A;  4C0H A;  4KGQ A;  1ULE A;  2UYA A;  5FPZ A;  3WQB A;  5A6X A;  1BYH A;  4DIQ A;  4MLO A;  2VG9 A;  5EXO A;  3AYC A;  2D6M A;  3ZFE C;  1DQ5 A;  4PDW B;  4XUO A;  5CFC C;  1P8J A;  3SMH A;  3KV6 A;  1OBN A;  5EJ3 A;  3THD A;  1H4G A;  4P02 B;  2VTX J;  3VHN A;  2RJL A;  1AYM 3;  3V56 A;  4FPO B;  4IV1 A;  1K45 A;  3ZFF A;  3UV9 A;  4L97 A;  3ZXD A;  4FTE A;  3POY A;  1RUD 1;  2WQ8 A;  4XEZ A;  1O4Y A;  1ZRR A;  5JSP A;  3LDR A;  5F6L B;  2ETE A;  2A70 A;  5E6H A;  4K8F A;  4ARY A;  4TLF A;  1WW4 A;  1E57 A;  3EB7 A;  2AR6 A;  4JV4 A;  4XE9 A;  3RMX A;  3LQC A;  2WQZ C;  5FAX A;  4UFL A;  2R04 1;  2E7T A;  4H14 A;  3AMN A;  1VBE 3;  3PU8 A;  5CVR A;  4JKM A;  4YSF A;  5JXG A;  4LIU A;  2QKD A;  1CN1 A;  1SDW A;  4YW6 A;  3WQ1 A;  2R04 2;  2YY1 A;  2VXR A;  4WM8 A;  4F3J A;  2H6B A;  2A6W A;  1ZZB A;  2IFW A;  4W65 A;  4IGP A;  5CFC A;  4PBP A;  5LA1 A;  3ZKU A;  5IYY A;  2VZR A;  4P08 A;  3NL1 A;  2FDF A;  1VRB A;  4ZZ8 A;  3CBN A;  3IB3 A;  2DVB A;  1J59 A;  2P34 A;  2BOI A;  1WKY A;  5JSO A;  4QU2 A;  1FNY A;  2B39 A;  2D6P A;  2BGC A;  2CU5 A;  5FYB A;  5I8Y A;  1W2O A;  2E9Q A;  1V6N A;  4N53 B;  3J8F 3;  2LUW A;  4BDV B;  1W8H A;  5E8A A;  5C4W A;  3HBZ A;  4LBM A;  1TQ5 A;  4YW3 A;  4GB3 1;  2PLV 2;  2VQ0 A;  3R4S A;  1UPI A;  2ARB A;  2BNN A;  4IEV A;  4JC1 A;  2ZGT A;  4UW3 A;  3VKN A;  1LES A;  4TXW A;  4Q29 A;  2XHN A;  5GZE A;  5A3T A;  4ET7 A;  1S0C A;  4DY5 A;  4X6Q B;  3WT3 A;  2FDI A;  4LNV A;  3LEM A;  4XFF A;  1OXC A;  1PVC 2;  4XUN A;  3WEZ A;  5CG9 A;  1GKB A;  4HK9 A;  2D5F A;  5B2G B;  1Y43 B;  2IXI A;  1AYN 2;  4ZPI A;  1JZ5 A;  4K3U A;  5H9S A;  4OQ8 A;  3K51 A;  4GQ7 A;  3ZXE A;  3M2M A;  1FAT A;  1H0B A;  2C26 A;  1PHM A;  1QJX 3;  4QQL A;  3UKV A;  4E4H A;  2IXJ A;  4NRM A;  1RUF 2;  4XQW A;  2ZAC A;  4BME A;  5IAV A;  2LW8 A;  2PMW B;  1V9U 1;  5L9V A;  1YUD A;  2R06 1;  5A32 A;  4O9E A;  4N7I A;  1LR5 A;  3FFQ A;  4QGL A;  1VMJ A;  3GZE A;  2WFP A;  1L7Q A;  1NCR B;  1W6Q B;  5FZB A;  3ZFG C;  1JYW A;  1VBE 1;  1RMU 3;  4HG6 B;  3H0O A;  4OHW A;  5F37 A;  5JVV A;  1W8O A;  3APB A;  4JQR A;  3ZYB A;  2E26 A;  1EY2 A;  4AHW A;  4CP1 A;  1MZF A;  3T2Q A;  1QOT A;  1WME A;  1FPN 2;  1OUR A;  1RUE 3;  1ZNP A;  4UFM A;  4A2U A;  3WNK A;  4AQT A;  1QJZ A;  2A5Z A;  5FP3 A;  3DF0 A;  4M3C F;  2ZKN A;  3ZPY A;  4NWV A;  1EPW A;  1W2N A;  1S0F A;  1G8W A;  3PU3 A;  5BYN A;  3C7G A;  2NM1 A;  1XJA A;  1ZRE A;  4BZ4 A;  3P1I A;  1YI9 A;  4CP2 A;  3IAP A;  1BBT 1;  4COV A;  1S2B A;  4XBQ A;  1POV 3;  2P3Y A;  2RMU 3;  2QQJ A;  4MXW A;  4N43 B;  4NMI A;  2FDJ A;  4U36 A;  3OCP A;  1SCS A;  5FZG A;  4CDQ A;  4DY3 A;  5C9A B;  1ZRD A;  1OMI A;  4B4Q A;  5L7O A;  4RA0 A;  4J1W A;  4P5H A;  4L2N A;  4TWT A;  4XQD A;  2WC2 A;  1NE4 A;  3MHZ A;  4LKS A;  2ENR A;  4LBJ A;  5DPN A;  5A3O A;  3PVO A;  4RHV 1;  3SHR A;  3QCW A;  5FO9 B;  1QJE A;  3HPN A;  3III A;  3U11 A;  2JXA A;  2Z2S B;  3NWK A;  2CV6 A;  1XOY A;  3JZV A;  1RUC 1;  1DGL A;  1YCI A;  2ILM A;  2LAL A;  3CLP A;  5JZG C;  1AX2 A;  2EXI A;  3R05 A;  4AOC A;  1WW5 A;  1RC6 A;  2OPW A;  1XNA A;  3WG3 A;  2PHL A;  4Z2A A;  5FPL A;  3GAL A;  3PHM A;  5E88 A;  1RUJ 1;  4GAZ A;  1HN0 A;  3RJR A;  4BJ0 A;  1WCD J;  2VZU A;  3UKN A;  4AGV A;  1VLN A;  2JDH A;  1KJR A;  3IIA A;  4DRV A;  1I1E A;  1PVX A;  3USU A;  1UOB A;  1BMV 2;  4XC9 A;  2JG8 C;  1C5I A;  4KH9 A;  3VBH A;  4LUM A;  3VHP A;  1RUI 1;  4IUG A;  1I3H A;  3RGB A;  2F4L A;  2QQM A;  1NZC A;  3U07 A;  1PO2 2;  4XFI A;  1DG6 A;  2BUK A;  2BBV A;  3MW2 A;  4YG0 A;  1NCR A;  4IEX A;  5GZC A;  1HDK A;  3EXU A;  4MVT A;  1ZBE 1;  2JWP A;  4PLN A;  4UT5 A;  4G4F A;  4XUR A;  2AH2 A;  1FT9 A;  1Q8P A;  1OQ1 A;  3WY6 A;  2XWJ B;  1MS1 A;  4NHK A;  1SFY A;  4B4R A;  3D0J A;  3NMB A;  3MLL A;  1KRI A;  3VZM A;  4KG0 A;  1OT5 A;  4Q1R A;  3HOB A;  5A7S A;  3LAG A;  2ZGR A;  5EZW A;  2A6X A;  2KD7 A;  3THT A;  3BI3 A;  2DUR A;  3SH3 A;  1C28 A;  5CA6 A;  1MQT C;  1RUJ 2;  2LS6 A;  3WSO A;  3VBH C;  2WR9 A;  1NY7 1;  2JE9 A;  3IZO A;  4FTS A;  1POQ A;  4KU7 A;  1DU3 D;  1QH7 A;  3AJZ A;  4BA6 A;  4QPW A;  2A3Y A;  2UWB A;  4LOS A;  1NLR A;  1WLD A;  4GMP 3;  4PHZ A;  2DV9 A;  1TMF 1;  4RQP A;  1GZC A;  2BNM A;  4AFD A;  2XPJ A;  1K5M A;  3H1W A;  3A22 A;  3O1P A;  5FY0 A;  3VGI A;  5CFD C;  2PQQ A;  2RS1 3;  3PUR A;  1W6Q A;  2A3W A;  1BJQ A;  1OHF A;  3DXT A;  5FRA A;  1YJK A;  4E2G A;  2X8K A;  3AZV A;  3PUA A;  4PIZ A;  1J58 A;  2WWJ A;  4K20 A;  1NOV A;  5JOX A;  2D3P A;  1VBB 2;  2OS2 A;  1QMJ A;  4FOW A;  4B1M A;  1BBT 2;  4BB3 A;  4FOQ A;  3T0B A;  4AEM A;  3MDP A;  1WMX A;  4MZU A;  1QXJ A;  1H1I A;  2YZ4 A;  1ASJ 1;  1ULO A;  5EWS A;  4BQ3 A;  3AX4 A;  1JYX A;  4CU8 A;  3VDA A;  5BNN C;  5DUX A;  3RPQ A;  1U5X A;  4QQP A;  1J1L A;  5JSR A;  2GND A;  2JDM A;  3NNM A;  5J98 B;  1S2E A;  2GNB A;  4BIO A;  2W46 A;  2WL1 A;  5KC5 A;  1NX9 A;  3AYD A;  1DGR N;  2P6C A;  3AKT A;  2WFF 3;  4QX7 A;  4CUA A;  1GNZ A;  2WN3 A;  2RS3 2;  4XJZ A;  3WNO A;  4Q8K A;  4CDX B;  3WF1 A;  2N7G A;  4DRR A;  4D7S A;  4N9I A;  1UPS A;  4CU6 A;  1XE7 A;  1VRH 3;  5D1I A;  4JRA A;  4BWO A;  1QXR A;  4IER A;  3HN1 A;  2PLV 3;  5FXX A;  5A70 A;  3A7Q A;  1LRH A;  3WNN A;  1GFF 2;  2HWF 2;  1PZ7 A;  3M70 A;  1J83 A;  3OB8 A;  5AC9 2;  4OUL A;  4OZO A;  2XUE A;  4NWW A;  1L7R A;  4J6G A;  2WSV A;  2J42 A;  4RR3 A;  3WXP A;  4R9B A;  4Y1Z A;  2NMO A;  3KGZ A;  4FQ4 A;  4ZHN A;  2VE1 A;  3I2F A;  4WVW A;  3V65 A;  1O7F A;  2QQN A;  3ILR A;  4F83 A;  3V0B B;  1W06 A;  4AQS A;  3GZT B;  1I5Z A;  4PI0 A;  1ZZC A;  5A3L A;  5CIR A;  3AM2 A;  2C1F A;  2VMC A;  5IJR A;  2XQX A;  1O6U A;  5DAB A;  5FFO C;  2G19 A;  4J25 A;  3NNG A;  4TN7 A;  3T0D A;  1Z7S 3;  3USU B;  3M3O A;  3UGH A;  1W8Z A;  4BLI A;  1QEX A;  3ATG A;  3VV1 A;  3ZO0 B;  4A6S A;  4X8N A;  3TB0 A;  1VBC 2;  4FFH A;  1H9P A;  3KCX A;  3I3M A;  2W5F A;  4AW7 A;  1EV1 1;  4HZF A;  1UY0 A;  3V64 A;  1V00 A;  4Q0S A;  4LXL A;  3C7E A;  4SLI A;  1YC6 1;  4X8P A;  2IZW A;  1ULG A;  1X33 A;  3LCP A;  3OGR A;  4JTO A;  4OHX A;  3I2H A;  4QB6 A;  4JAA A;  4C8D A;  1FYU A;  2YRO A;  4DOU A;  1PO1 2;  4EN9 B;  1SQ4 A;  4UWD A;  4CCM A;  1WMF A;  3GJA A;  1D2S A;  2P3J A;  4YVW B;  1RJ8 A;  5LWB A;  1UYP A;  1DQ6 A;  5DN2 A;  1EYB A;  3I3D A;  4CVU A;  2BYV E;  4B3N A;  4CDU A;  2E7Q A;  3VDD A;  1JYT A;  4MGS A;  4YZ5 A;  3ZN4 A;  1UNB A;  3GF6 A;  4LHS A;  4ZZ5 A;  2VNR A;  2G9G A;  5KC6 A;  2BOJ A;  1WBF A;  4RS5 C;  4WBB A;  1ZRI A;  5A3W A;  5C3R A;  5B4X A;  1NA1 A;  1STM A;  1QJY 3;  2RV9 A;  3KD4 A;  4JDN A;  3AL5 A;  3SCF A;  2E31 A;  1ENS A;  2YYO A;  5C4W C;  5CU1 A;  4Q0Q A;  3H8R A;  2HWC 2;  3NRU A;  5A7O A;  1Q43 A;  2F6B A;  2Q30 A;  4LHL A;  5FZ7 A;  2WA4 A;  4AAX A;  3LGR A;  2HEV F;  1ENR A;  1YEW A;  1AR6 1;  5FY8 A;  3IPV B;  4YZ4 A;  5G05 L;  2AEN A;  5FZ8 A;  4K7J A;  5F3C A;  1VBC 3;  2ZGL A;  4ASM B;  1H8T C;  4Q4V 2;  1OF3 A;  3E5U A;  1ND2 A;  4IE4 A;  3PJQ A;  4IDZ A;  2VW2 A;  2BPA 2;  3WP3 A;  2WRA A;  1RUG 2;  3RFR A;  1Y9G A;  5ERL A;  3MYX A;  4D6R A;  2WWS A;  4R4X A;  1W6M B;  4V2W A;  1ZZ8 A;  1W2U A;  1X9P A;  2O14 A;  3B00 A;  4LBK A;  3O5S A;  5HXV A;  5FXW A;  1R08 2;  4LBQ A;  4GH4 A;  1PIV 2;  1ZA4 A;  4FPY A;  2D6L X;  3IAQ A;  2VZP A;  1F5F A;  2QQL A;  5AVP A;  4Q4X 1;  3USS A;  1O5L A;  3MW4 A;  2ZX0 A;  1IOA A;  1AR7 3;  2EF6 A;  2WS9 3;  1GBG A;  2B5H A;  3AC0 A;  1IPK A;  4YLZ A;  2J1V A;  5C70 A;  2BRT A;  1KDM A;  4RN5 A;  3LOB A;  3BTX A;  5JOY A;  3M3Q A;  1DFQ A;  2HBT A;  3LF7 A;  1OPM A;  1QJX 2;  4JGZ C;  1UMZ A;  4FCA A;  3DV8 A;  2UY8 A;  5FYY A;  1BQP A;  3JB8 A;  3WD5 A;  4AHX A;  1VBD 2;  2BBA A;  3K75 B;  3EHK A;  5T3N A;  4DZG A;  4QX5 A;  2R07 1;  4AL9 A;  3D82 A;  4BOW A;  1W9S A;  3CNA A;  5EV7 A;  1COV 1;  4K6B A;  3NNF A;  2NP0 A;  2XJP A;  5C3O A;  4XFC A;  3OTF A;  1VMF A;  2EIG A;  3IWZ A;  3PVB B;  1BEV 3;  1XPW A;  3N9P A;  4UW4 A;  3PUI A;  1T2X A;  5FLJ A;  2A7A A;  3KQ4 B;  1CAU A;  3D0S A;  5FZO A;  3FJS A;  1FMD 2;  1U12 A;  2H0V A;  1ACC A;  4N9H A;  1UY1 A;  2AZ5 A;  2XJQ A;  1MS3 A;  1R08 1;  4OFG A;  3VZO A;  1C4R A;  2ZZJ A;  2ADE A;  1ZA7 A;  2W87 A;  4UAP A;  4X6R B;  2ZXQ A;  4LEJ A;  4UBH A;  1PM4 A;  5FPA A;  2ID4 A;  3CJX A;  4EWE A;  5I8T A;  3S57 A;  1AR7 1;  4N8M A;  4AR2 A;  1GP6 A;  4F8A A;  2HWB 3;  3UET A;  3HEI A;  5AFB A;  3NNJ A;  1AL2 1;  4XDO A;  4Q4V 1;  4Q0V A;  1PGW 1;  5IW0 A;  2WZR 2;  1RED A;  3C7O A;  1D4M 2;  1K5J A;  2W9X A;  1UIK A;  3OYW B;  1SBE A;  3QH6 A;  1UOG A;  3B9C A;  2VCB A;  4YNI A;  3O1V A;  2FCT A;  3FN9 A;  1W2T A;  3G7D A;  3L2H A;  1L3J A;  2VMF A;  3NV3 A;  1ODN A;  3QLQ A;  2VTX A;  3BU0 A;  2VCM A;  3NAP B;  2V4A A;  3BGA A;  4AEJ A;  2J1R A;  3AZZ A;  4BQ4 A;  4WVM A;  4CCK A;  2J1E A;  5A3M A;  3MID A;  4ZS3 A;  1MZ6 A;  1BVP 1;  3GCX A;  1NXD 1;  2VUC A;  4RS5 B;  1ZX5 A;  2CWS A;  5FYU A;  1WCS A;  2WYF A;  1UD1 A;  2BFU L;  4TYS A;  2V5Y A;  3O12 A;  4YM1 A;  2PXJ A;  4QHO A;  2ZHM A;  1CAU B;  4FVV A;  1D0G A;  2EIB A;  4CEW B;  2PHU A;  3GGL A;  1COV 3;  1PVC 3;  3GZU C;  2XB6 C;  4ES9 A;  5LZ6 A;  4A4A A;  3VKL A;  1NZI A;  3RJ2 X;  2B4K A;  3OG2 A;  1GU3 A;  2R1B A;  5FPV A;  3WHU A;  4NO4 A;  1RVF 1;  5FZ9 A;  5FJH A;  1SFP A;  2VOV A;  3T09 A;  3NO8 A;  2HWD 2;  5FY9 A;  1YIP A;  2BVV A;  4LBO A;  2XG3 A;  2WFF 1;  1YI7 A;  5BPX A;  1CJP A;  1LOA A;  2WZ8 A;  3AMP A;  4XF9 A;  3MV0 1;  2B42 B;  4R9C A;  3ILN A;  3IDE A;  2HWE 2;  1CPM A;  2DWR A;  3M3C A;  4LBQ D;  1MS9 A;  4NE9 A;  1BKZ A;  4EJR A;  5FP4 A;  1FV2 A;  3KHB A;  5DAP A;  1DGW A;  4DEQ A;  1APN A;  2WSU A;  1JU4 A;  4MHU A;  1VAM A;  4OUE A;  4B7E A;  4N53 C;  2X10 A;  2GSY A;  2Y38 A;  5FZF A;  3URF A;  2HYK A;  4XFG A;  1CON A;  2NMN A;  3SH5 A;  1JYN A;  1UX6 A;  4C1W A;  1SFN A;  1X7N A;  4Y4R A;  4XDQ A;  2R7E B;  1YQ8 A;  3SEP A;  2YC0 A;  3IKW A;  2HEW F;  1HRI 2;  4PF1 A;  5KWR A;  1S55 A;  2VCA A;  4F7Z A;  4QDQ A;  1C8M 2;  3ZM8 A;  1AR9 1;  1R09 2;  2YBP A;  4D6S A;  5GZF A;  1CX1 A;  3FUO A;  3ZPO A;  1AL2 2;  4YZ1 A;  2BGP A;  4OHV A;  5LK5 A;  3SH4 A;  3ZFE A;  2OW4 A;  1R1A 1;  1BK1 A;  3BU7 A;  3T2T A;  2JDK A;  1RIN A;  5F6K A;  3B9I A;  5J09 A;  3ZSL A;  2WNO A;  1UZV A;  4FPF A;  1ND3 C;  3CIH A;  1WUV A;  5FQ0 B;  5H9Q A;  1Y3T A;  1EPZ A;  1YQC A;  5F7U A;  2WO7 A;  3I7D A;  2JE8 A;  5C4W B;  2VUA A;  4QPY A;  4ERO A;  3SNM A;  1CGP A;  1JN2 P;  4O7X A;  4R9A A;  1G6N A;  4RFR B;  4D6Q A;  5FOB B;  1KGY A;  1FMD 1;  3M3I A;  4QDS A;  1UMH A;  1W9T A;  2ZTN A;  1OVS A;  3ES1 A;  2HWE 3;  2Z42 A;  4HL0 A;  1NCQ C;  3DL3 A;  4P9J A;  1ALY A;  3JCI A;  4YGC A;  1RVF 3;  5A7W B;  3VDB A;  1JOJ A;  4QX3 A;  4NPM A;  4A6O A;  2E6V A;  2J1U A;  3T2O A;  1RUF 3;  4I3G A;  5FKC A;  3UYJ A;  5LY1 A;  4ZU4 A;  5FWE A;  3CL1 A;  3KF3 A;  5KXD A;  3ZFF B;  3BOD A;  4M4R A;  4D69 A;  3WG2 A;  5D8A A;  1R64 A;  2VTF A;  5T54 A;  5F2W A;  4DPN A;  1BXH A;  1EAH 2;  3FWE A;  3Q8F A;  1SBD A;  1OQD A;  5GAL A;  1IKP A;  2D7F A;  3WHT A;  5C3S A;  4DFS A;  4A7K A;  4RR3 B;  3DYP A;  5DDJ 3;  5FPU A;  4NUB A;  5FY5 A;  2CY6 A;  1F4H A;  3KGL A;  5IK4 A;  2BWA A;  2AYH A;  2ZAA A;  3KB5 A;  4OMC A;  4LOT A;  5HXM A;  4G9S B;  1PZ8 A;  4DXZ A;  4IEO A;  4UF0 B;  1AL0 G;  1FI2 A;  3NVC A;  4COZ A;  2ZX3 A;  1NCQ B;  1YFU A;  2WUH A;  5A6Y A;  3HNM A;  3LPG A;  5CBL A;  2YGL A;  4LHN A;  1OF4 A;  1W28 A;  4LOR A;  5FR3 A;  5FZA A;  4GUL A;  1N3O A;  1XSR A;  1I9R A;  1MVE A;  4LBL A;  1OSG A;  5I0R A;  1CQ9 A;  1YRZ A;  3SCG A;  4I2O A;  1OOP A;  3ECQ A;  4Y20 A;  2D6O X;  5DZF A;  1DZQ A;  5GKA C;  4Z2W A;  3VD9 A;  2ZGU A;  3A23 A;  5LW9 A;  3MIF A;  1GSL A;  4WVM B;  4PLO A;  4AQ2 A;  1Y9M A;  2ZX2 A;  3MW3 A;  3E6B A;  1X50 A;  4E4D X;  5C9A A;  4RR3 C;  3GBF A;  1CIY A;  2RDR A;  2VXJ A;  1NG0 A;  2A75 A;  3AXD A;  3GCW A;  1MZ5 A;  3I3E A;  1HV0 A;  4JVA A;  4MOA A;  4CUG A;  1GQH A;  5B4N A;  1UYY A;  2YB7 A;  1N1T A;  2YPJ A;  5FUP A;  4CXX A;  2PHR A;  1S0E A;  1GP5 A;  4MXV A;  5KXE A;  2GAU A;  4EYU A;  2XJV A;  4Q27 A;  4QKF A;  4B4P A;  4XTP A;  2ZGP A;  4PJY A;  4HFS A;  2Q4S A;  4CE8 A;  4W6X A;  2XLA A;  4TSV A;  1RMU 1;  1X8M A;  4MGY E;  4XUQ A;  3KSC A;  4LKE A;  4XBN A;  5T5L A;  2EXJ A;  4B29 A;  5DDJ 1;  2QZ3 A;  5EHD A;  1GZT A;  2MPF A;  5LAT A;  3TN9 3;  4BPZ A;  1QJU 1;  1DYP A;  5BXX A;  2VNO A;  1ND2 B;  3TNP B;  3M8L A;  5JI9 A;  1D4M 3;  4LMF A;  4YWA A;  4MO3 M;  3RVH A;  1TME 2;  5FBJ A;  3VHO A;  5IK7 A;  1ND3 B;  1VBE 2;  4FP2 A;  3DEC A;  1UMI A;  4HT1 T;  4BMB A;  3ACH A;  4XAB A;  5F2S A;  4MYE A;  3AP7 A;  3SCH A;  4AED A;  3VKO A;  1NA1 B;  2WYS A;  5F8P A;  4XYX A;  3VBS A;  2BER A;  1LOF A;  1W90 A;  2DBI A;  3FZ3 A;  1Q8V A;  1W39 A;  2GC1 A;  5A7P A;  4RQP B;  1UN1 A;  4UYB A;  4YW2 A;  4B7K A;  5GLZ A;  2IVI B;  2W91 A;  5LB6 A;  1RUO A;  4Q4V 3;  5C6C A;  5J48 A;  4CDU B;  4S2F A;  3WF4 A;  1BLZ A;  3PVE A;  3PNA A;  2G9F A;  5ANN A;  1AJK A;  2VVD A;  1PNF A;  5LBB A;  5A33 B;  1JTZ X;  2Z4F A;  3K3O A;  1O91 A;  4IEP A;  5EFU A;  3TEW A;  4COY A;  3WOG A;  4BLJ A;  4LBQ B;  5FMB A;  4FBF A;  1Y7B A;  3ETP A;  4CPB A;  3ELN A;  5H9P A;  3D6E A;  5GJ6 A;  2PLV 1;  2P5B A;  4GB3 2;  2YBK A;  5DQ0 A;  2YGM A;  1AVB A;  5J7M A;  4AVT A;  1DYO A;  5A80 A;  2ARC A;  1W8F A;  3N9N A;  4NAO A;  2QQI A;  2FBE A;  4CCJ A;  1LUL A;  4OUS A;  2QZ2 A;  3JD7 1;  3AKP A;  2J1T A;  3LKJ A;  3FE5 A;  3IT8 A;  4CEY B;  4M3C E;  2ET7 A;  3PTR B;  4CCD A;  3OBZ A;  5KHI A;  2VQT A;  2GP5 A;  1ZBA 3;  3VBR A;  3VD5 A;  2EVX A;  5JDB A;  1ASJ 2;  2Q1M A;  3IDC B;  2QJV A;  3LFI A;  3ZIW A;  3LE0 A;  4YW7 A;  3VBU C;  1GQG A;  1HB3 A;  1REF A;  3K2O A;  4GH4 C;  5IFP A;  1UAI A;  4Y24 A;  4QB2 A;  1H2M A;  5ACA 1;  2VZ1 A;  5F1R A;  1X8E A;  5EYY A;  5FUN A;  1A78 A;  4RYD A;  3Q8C A;  4CP0 A;  1VB2 A; 
#chains in the Genus database with same CATH homology
 3O1S A;  3H8X A;  4NRM A;  4OCT A;  4ZHN A;  4RFR B;  4O7X A;  3O1V A;  3LFM A;  3O1P A;  4NRP A;  4NII A;  4QKB A;  4QKD A;  3T3Y A;  3BIE A;  4QKN A;  4NID A;  4NRQ A;  3BUC A;  3BU0 A;  3BKZ A;  2FDK A;  2FDJ A;  4CXY A;  3KHC A;  3RZH A;  3S5A A;  3BTX A;  2FDI A;  2FDH A;  4O61 A;  2IUW A;  5DAB A;  3I49 A;  3RZM A;  3I3Q A;  4ZS3 A;  4ZS2 A;  4IE5 A;  4NPM A;  3H8R A;  3BI3 A;  2FD8 A;  4NIH A;  3RZG A;  4IE6 A;  4IE4 A;  4JHT A;  3O1O A;  4NRO A;  2FDF A;  4IDZ A;  4MG2 A;  3O1T A;  3S57 A;  3BTY A;  3O1R A;  4CXX A;  2FDG A;  3I2O A;  3BTZ A;  4NIG A;  3O1U A;  3RZK A;  3KHB A;  4NJ4 A;  3T4H B;  4MGT A;  3I3M A;  4QHO A;  4QKF A;  4CXW A;  4IE7 A;  5F8P A;  3RZL A;  3O1M A;  3H8O A;  3RZJ A;  4NPL A;  4IE0 A;  3T4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...