4NIHA

Crystal structure of alkb e136l mutant protein with cofactors bound to dsdna containing m6a/a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
201
structure length
201
Chain Sequence
PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDLPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Switching Demethylation Activities between AlkB Family RNA/DNA Demethylases through Exchange of Active-Site Residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/dna
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
total genus 47
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2013-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4nihA00
4QHOA 4O61A 3T4HB 4IE6A 3BTZA 4OCTA 4NRMA 3BUCA 5F8PA 2FDHA 2FDKA 3RZJA 3S57A 3T4VA 4NIHA 4NPLA 3O1OA 4NRQA 2FD8A 3T3YA 3RZLA 3LFMA 4MG2A 2FDIA 4NROA 4QKDA 3I2OA 3RZHA 4IE7A 4ZS2A 3O1MA 2FDJA 4IE0A 3O1SA 3O1VA 3BTYA 2FDFA 3I3QA 3KHCA 3I49A 3O1RA 3H8OA 3S5AA 4NIDA 4NIGA 4MGTA 3BI3A 3BU0A 4QKNA 3BIEA 4IDZA 4QKFA 4NRPA 4ZS3A 4IE4A 3RZGA 3O1TA 3RZKA 4NPMA 4JHTA 4IE5A 4NIIA 4NJ4A 4O7XA 3KHBA 4CXWA 4ZHNA 3O1UA 3H8RA 3O1PA 3I3MA 2IUWA 3BTXA 4RFRB 3H8XA 5DABA 4CXXA 3RZMA 3BKZA 4CXYA 2FDGA 4QKBA
chains in the Genus database with same CATH superfamily
1WA4A 1JXNA 2VY0A 4CU7A 3LEKA 4FOVA 5FUPA 1LGBA 1MS3A 4CDWA 3WDWA 3SH4A 1DQ2A 4BLIA 4N90A 3S7IA 4DY5A 2VNOA 4EZ4A 3AP7A 2O8QA 1C8M2 3ZYBA 4A41A 4BDVB 4Q2FA 1HRI3 1VBE2 1YQ6A 1VAMA 2DCJA 4QPIC 1AXZA 1SLAA 4QXCA 3U10A 2QFEA 4OMDA 1SCSA 2D6PA 5E8AA 2QQPA 3SH3A 1L3JA 3FMGA 5FUIA 2P2KA 1XSQA 4CEYB 2ATFA 1AUYA 4FPEA 3WP6A 1LEDA 3VUOA 2JE8A 1OT5A 4CDQA 1LOAA 3ES4A 4NUBA 1BEV3 2I74A 1JZ4A 2W1WA 4Q4V2 4EJRA 2WS92 4URAA 1AX0A 1JZ7A 1L7QA 1RGSA 3MW4A 4ZPIA 1KDKA 3AZVA 4ZXKA 3LAGA 1J59A 4A7YA 1RUJ1 2BQPA 4KWKA 4GD4A 2VZUA 4YWAA 1R082 3BTYA 2YBPA 1NE6A 5FZCA 1OOPA 1W6MA 5IVJA 1G9FA 4IV1B 4LBQA 1XPWA 1U12A 5ISLA 4RN5A 2XLAA 2D6NA 2OX0A 1OUSA 4GZ9A 1K5MA 1PVC2 2CL2A 4UAPA 1UU4A 1UMZA 4NMIA 3PVEA 5B4XA 4YVWC 2GAUA 1UOBA 5HV4A 3U37A 1FMD2 4B4QA 4XAAA 1FATA 1KITA 3WDTA 1Q3EA 1NY72 1OD5A 3CJIA 1UIKA 1OLME 2D97A 3PUAA 1VBC3 2LROA 4FPFA 2H6BA 3GYDA 4GMP1 4NO4A 3WW2A 1VBE3 5C3OA 1UY0A 1YI7A 2VXJA 3NNGA 3H1YA 4B4PA 1IGOA 1NAEA 1VBA1 2E63A 2VNVA 2Y0OA 3USSA 5FDBA 1PM4A 3NNLA 4BZ4A 1MS0A 4B1LA 4CDXA 4RGKA 1FPN1 1JI6A 2CGOA 4U2AA 3CMGA 3PJQA 3NVCA 5G05L 4XURA 5SV5A 2JECA 2XDVA 3U11A 1OH4A 2JDZA 4QPIB 5A7SA 5IVEA 4E2SA 4N9IA 5F8PA 1EPZA 4A7KA 2ZCWA 2O14A 3JD73 2WNUB 2ZEWA 3N9NA 4CDWB 4CDXC 1O5UA 4OUEA 3RMYA 4MUVA 1LU2A 2Y6KA 4IEWA 2Y26A 2OIIA 3NJXA 1UOJA 5GLVA 1RVF3 1RUC3 1HV0A 3RI8A 5F7UA 2DFCA 3B93A 4BIFA 5I8TA 3T08A 3K4DA 5HPOA 4IEZA 2BFUL 1DLLA 4UF0B 5IK5A 2ARAA 1PNFA 1OKQA 3J8F2 5K0UA 1QH7A 1UO9A 4LK7A 4Q0UA 4BWOA 1CN1A 4TLGA 1ZM1A 2VUAA 1BJQA 3MIDA 3RS6A 3TYJA 2X29A 1EV12 4CYDA 5LBBA 3P1IA 4CU6A 3W58A 1GZWA 1NQJA 4LO7A 2OXBA 1PNGA 5IJRA 2ET1A 4Q0QA 5H9SA 1DZTA 2JG8C 5FQ0B 4B7KA 2WWSA 3THDA 1OPMA 1PO11 2XXZA 3PMSA 4IUGA 1N3PA 5FZ7A 1O5LA 3ILRA 5FRAA 3VHNA 5LA1A 2VD7A 5LBFA 4QKNA 2D3PA 2RVAA 1GWKA 3N7MA 4GJZA 5K4LA 2YG0A 5A80A 1JW6A 3LB9A 4FFGA 5JZGA 3SNMA 4KGGA 4RFRB 3H8UA 3M2MA 2DVBA 4XXPA 3I59A 2P37A 2YC2A 1YQ5A 3O1SA 4YNIA 1ZREA 2C0ZA 3LSEA 3QBQA 3RWKX 5A3PA 2XQRA 4OCTA 1D7PM 1AJOA 3U0ZA 3CQOA 4LKSA 2YXSA 5EYXA 2D44A 4PI2A 5CKQA 1PMIA 3LD8A 4AI1A 5IYYA 2HWC2 1UU5A 4DRRA 4LBJA 1OA4A 2XJUA 3GZEA 5F9TA 4P9IA 4EZHA 3W9AA 2JDAA 4B8EA 4DIQA 1XB9A 2XR4A 4IQPA 4C8DA 2HKXA 3ALQA 1WGPA 3M3EA 2IWGB 4NHMA 2XVLA 3I54A 4WVZA 2R042 1G6NA 4XFAA 4CDWC 5I91A 1ENXA 1LULA 4R9DA 1RUH2 2QZ3A 3JBG3 4N8MA 2HEYF 4Z07A 2FDHA 1RTVA 3POFA 4MSVA 5FZ4A 2VW1A 1SBFA 3U07A 2XL9A 3JD72 3KB5A 3LQCA 4AI0A 4OI0A 2VOVA 2JXAA 1V70A 2RS31 1ALYA 3S57A 4KWJA 4BPZA 2V73A 4ARXA 1H2LA 5C7GA 1AXKA 4D69A 3OGGA 4MG2A 2VE1A 1W2AX 4I0AA 3ST7A 2W9XA 1OLQA 1DQ1A 1J3RA 4LKFA 3CDZB 5AVAA 3PL0A 1IOAA 1IZ3A 4E8CA 4A7ZA 2KA3A 4YZ2A 2XUEA 5GZCA 1ZBE1 1WW4A 4PIXA 2HEVF 2RM21 3DCQA 2QZ2A 2PHLA 1H4GA 2A7AA 1UOGA 1JN2P 1JYCA 1WCSA 5DG2A 3H7YA 1CAXB 1XNBA 2WO7A 3MHZA 3DN7A 1FT9A 4HFSA 4P9YA 3WVJA 5JIAA 4EN7B 1ZRDA 1QJU1 5L9RA 3U75A 2W91A 2OYZA 4M3CA 1DGWX 5DN2A 1MR5A 1XC6A 4YPJA 2VQUA 2RMU3 1S55A 2JDHA 5T5JA 4ZY9A 1V6MA 4W50A 4QX8A 1DP0A 3VDAA 3MLJA 2XJSA 1UYZA 4R9AA 4AQSA 3ZDVA 1W28A 3M3CA 3M8LA 4DB5A 3H9AA 1YFYA 4I09A 1W3XA 1TMF1 2C1FA 5CFDB 4QX3A 3C8XA 3GBGA 5JDBA 3MF6A 5FY4A 1VRBA 3BB6A 4LR4A 4UFKA 1WBLA 2CSGA 2W47A 2VO5A 2Q4SA 4D7TA 1C8M3 3K3OA 1NQDA 2TNFA 1NUKA 2MPFA 1QIQA 3O0WA 4LJHA 4Q4V1 3KV6A 2BJSA 1ULPA 2D40A 3QLQA 2CAUA 3FFZA 2RDQA 5T5LA 5F37A 1NLQA 2CTVA 2PAMA 3CF6E 4DO0A 1UW8A 2RS53 1RUE3 4QMAA 2J1EA 3ZX7A 2JB4A 2XGXA 5FMOL 1GFF2 1ND3B 2PLV2 4XBLA 3T2PA 4AYUA 2GALA 4IV3A 1NCQC 2V4VA 1Q8SA 1UYXA 5H9PA 4ZHNA 4M00A 5FPZA 3EQEA 4KU7A 1US2A 4PF5A 3DKWA 1YO8A 1RUC1 1RVF1 3ZOIA 1A78A 4J25A 4AEMA 3BTZA 2VGDA 4XOGA 3FHQA 4YZ1A 3LFIA 4QX0A 1UYPA 2ZJCA 3CJXA 5I8SA 2HH9A 3IDEA 4R9BA 1JOPA 3C7EA 4LHKA 4ZXEA 4C1XA 1W03A 1YEWA 5KHHA 1Z78A 3POYA 4LEJA 2Q5TA 4DINB 2YBKA 1DLCA 3V65A 3AKRA 2ZX4A 2HWC3 1DYOA 2V5YA 3THPA 4YLZA 1CX1A 2A6YA 2BBVA 2VJXA 5AFEA 2WR9A 4NHXA 4RSUA 5EJ1B 2WNEA 4LUKA 2A6WA 1UYYA 5A32A 4JHTA 2VOXA 1ULOA 4NJ4A 1OA3A 1ENRA 3HNMA 1LAJA 1AYN2 1CONA 1O59A 2DTWA 3NKGA 5DUXA 3R05A 3O1PA 4I30A 5FO9B 4XUQA 4I3PA 4NWVA 3D6EA 1LEMA 2JD9A 4QWNA 5FY9A 5GLWA 1KS4A 1QJY3 3V0BA 1IS6A 5GZGA 1G9DA 2D98A 3AVRA 3V0BB 3PUHA 5FYIA 4GH4A 1UCXA 3PUSA 4WM8B 2C24A 2JIJA 4I2OA 4LXLA 1KJRA 4R8HA 1GOHA 2ZGSA 3R0RA 4LPLA 1OA2A 3FUOA 3ZN4A 4QPGA 1VMHA 2DCZA 3T30A 4K1ZA 3NRUA 3QH6A 1AHSA 4RGAA 2ARBA 3MO4A 4FBFA 3M7AA 1H9WA 2AYHA 4XHBA 3DL3A 4XQ4A 4C0BA 1STMA 4A4AA 1E57A 4QGNA 5C3QA 1FXZA 4Z1VA 4JC1A 4XCAA 1V00A 2BDRA 4DQAA 3IKWA 5H9QA 4LULA 4UFJA 4XBQA 3WF3A 1G86A 1PMJX 1EV11 4CEWC 3V0AB 4XFGA 3N9MA 4D8MA 5FYVA 1A6CA 5IVCA 4BQWA 2PYTA 3WD5A 3VKFC 1F4AA 3I8TA 5JSOA 1K45A 1LCLA 2ZBJA 1QJX2 4YW1A 1BBT1 4R9CA 3HBKA 5C3RA 1BMV2 4AEDC 3UYJA 3WX5A 3J7MA 2BWCA 1A8MA 1T2XA 4ZS3A 4YG0A 2OT7A 2NZ9A 3EO6A 3AKSA 4QPWA 1W9FA 2IFRA 4FT8A 1ZZ8A 5FZEA 3OB8A 3BPZA 1GQPA 4ATEA 4AVAA 4FI9A 1ZRCA 1REDA 2HWB3 1DGLA 4AFBA 3OD0A 1W04A 3ZFGC 4QM9A 3PIJA 2BTVC 1O6UA 3VZLA 4E4ZA 1CGPA 3T4VA 3WQ1A 5EQUA 5LY2A 3I2FA 4EN9B 2WBKA 1UPSA 1W2TA 2YV8A 2BOJA 2R7EB 3GZAA 3GJAA 1C1LA 4QKDA 4XBNA 4Z2WA 2BWAA 1JBCA 4D0QA 2MEV1 2DBIA 2QQMA 1LJ7A 4CSWA 3AZWA 5F2SA 4FPLA 1REEA 3HR9A 1UY1A 1Z7S2 4WVMB 4O9EA 2BNOA 4DXTA 1AR63 3K4AA 3RG0A 4DFSA 2VAUA 1D0GA 5BPXA 3J7NA 3BU7A 3OJBA 2A71A 4XF0A 4IEXA 4BU2A 2EAKA 4WM8C 1RUF2 4CXYA 4XEZA 4PIYA 1S0JA 2FCTA 5BNPC 4RYDA 1TME2 1WCUA 3ZMOA 4E4DX 5BNOC 5LA9A 1IQDC 1ND2B 2XL7A 2EVXA 3ZM8A 4JRAA 4QQPA 2Q0AA 3H3UA 1QJEA 1PZ9A 3ZPOA 4AHZA 3O14A 5LBEA 1LHNA 3KMHA 3T2TA 5DZGA 3ACFA 1R1A1 1W2UA 1W0NA 4QT6A 4CEWB 2ZX1A 4LHSA 5JIUA 3T2QA 2G9ZA 1LGNA 1PO12 2PQSA 1R64A 1H8TC 4UW3A 3MUZ1 2QQOA 5LASA 2VZOA 1V6LA 3FC0A 5F3CA 3LEMA 4HMZA 2YBSA 2B42B 3OBTA 4GB32 2JG8A 4NRQA 2F17A 2FD8A 3G6JB 3PVBB 4ZZ8A 3ETPA 1F8VA 2WAAA 3I3EA 4HSJA 3UGHA 1GMMA 5BNOA 4MHUA 1QNYA 2Q8EA 4UOJA 5LK5A 2UWBA 1OFSA 3FLTA 1VMFA 4LLFA 2RJ2A 4M0HA 5D8AA 1JHJA 3MICA 4AI8A 2R1DA 4SLIA 3N7JA 1CZTA 1B35C 2WQ8A 3I2GA 1OQDA 4Q4W3 2VZ1A 5FXWA 4RQPA 2HBTA 5K0UC 3NJVA 4ITCA 5FZLA 1VBA2 4OUMA 4FFIA 4FOWA 3ZYIB 3ME2A 5A6QA 1X8EA 1SPPA 2R49A 5J7MA 2D6OX 5FY0A 1IKQA 5BUVA 2Z2SB 1YQCA 1S0EA 2XONA 4YFZA 1NOVA 2V72A 5JOWA 2OQ7A 2W87A 4Q27A 1MVQA 2WS93 3R4DB 3PMEA 4FQZA 4KGQA 1JYXA 4IEVA 2FDJA 2R043 1XJAA 4JGZA 1UIJA 2C5DA 3S5AA 4L99A 3DECA 4RS5B 5JSRA 4DY3A 1HN0A 2GDFA 1U5ZA 1UY2A 2YFUA 4IETA 1XE0A 4HKOA 3J7HA 4JQTA 1DDLA 5BNPB 3DEMA 4XDOA 1EAH3 1O4TA 1VIWB 2DF7A 4DXZA 4I0WB 1ND2C 2ZGPA 4N43B 1NXMA 3NKTA 2ZZQA 4HVQA 1R081 3FL7A 2JG9A 4DXRA 2VUDA 5FTTC 1LENA 4OI4A 2FQPA 2CGNA 2F6BA 2GNBA 1QOTA 3MV01 2IXJA 4H3WA 5FXVA 1HW5A 3RZLA 1S1AA 3RDIA 4CDUA 5F5IA 4TSVA 2KD7A 1MZEA 4AFDA 3PNAA 1AVBA 1AR61 4GMP0 1X7NA 3F2ZA 3E5UA 5FZFA 5JWPA 5KXBA 3TEZA 2WZ8A 4HKWA 2FDFA 1N1TA 2PLV3 1WBFA 3U1XA 2GC2A 5L9VA 1GNYA 3WZ1A 1HKDA 2IVJA 5IVFA 4PQ9A 2QQVA 4Y1XA 4CCDA 2VZQA 1AR91 1GYKA 3JXSA 1X8MA 3GJBA 2DCKA 3WDVA 4Q4X1 5KXDA 5BNPA 2JDUA 3POGA 3KHBA 4GJYA 1FMD3 4JV4A 4S2HA 5CZKA 2XBO3 5KBFA 2FBEA 2VECA 2TEPA 1UMIA 5JOYA 3LEIA 1OOPC 1LOEA 3LKJA 4MVTA 1HRV3 2EIBA 1NA1C 2J42A 2R071 4URTA 4N7IA 1IQAA 1VR3A 2ZGTA 4HSLA 2P6HA 1S0CA 5K0UB 5IK8A 3BOPA 2IXIA 1BK0A 3JZVA 4YVSA 3KGZA 5FOJB 1S0FA 2BGCA 4UT5A 5DG1A 5I0UA 2EXKA 2VR4A 4W6YA 1SPPB 1D2QA 3MZHA 3HQRA 3BI3A 1COV2 2HWE3 3ROUA 1JOJA 3FZ3A 2J22A 3ABZA 1V9U3 3N9LA 3OGVA 1OFNA 4IE4A 1ASJ1 3HMYA 2OZ6A 5FJHA 1PM7A 4WM8A 3RZGA 1O3TA 2DU1A 1BBT2 2IVIB 1Y43B 5LZ6A 4YM0A 3ZSKA 3RZZA 3VD7A 4RS5C 2XBO1 1RXGA 2H0BA 2WNVA 3JCIA 2GMMA 1EUTA 4I02A 2E7AA 3ELNA 2HBUA 2E32A 1UZWA 2XH6A 4G9SB 1QU0A 4N43C 2LALA 2FMYA 5AFBA 4XF3A 4MOAA 2UYAA 2VPVA 2RM23 3EYPA 2QCSB 3MW3A 3AP9A 4CPBA 5D21A 4LUMA 2WO3A 5FPBA 4XACA 1JTZX 4EWDA 2XKPA 4R4ZA 2YPDA 5J98B 5A33A 3OBRA 2BBAA 3N36A 3CU7A 3KM5A 5DQ0A 3WF1A 1RUE2 2C4XA 4TLFA 3H0OA 3ZKYA 2UURA 2DU0A 1QJX1 2VMDA 4OHWA 2WUHA 4JX0A 4BK4A 5FWJA 3CZJA 5A6XA 3C7OA 3VZMA 4Q4Y1 1NG0A 1U5XA 2FZ1A 1RUC2 1RVF2 2E6VA 4UFMA 4H2AA 4XUOA 5JPMB 4XZUG 3LWCA 4CEWA 1AL22 1WMFA 1O4YA 1XBFA 1NCRC 4IESA 4Y1VA 3WCSA 2CU5A 4L9BA 2W1UA 1HJFA 2Y8KA 1OOPB 4AL9A 2HWE2 2XG3A 5LB6A 2XQXA 1NA1B 4ATFA 5FZIA 4BCUA 4BH9A 5HCFA 4QPIA 5L9BA 2PTMA 3W21A 4PJYA 4NHKA 1IPJA 4IE5A 5C8WA 1H9PA 2PMWB 5A7OA 1RHI1 4P14A 5F5AA 4AGGA 3H8XA 3L2YA 4CDQB 2EIEA 5BNQA 1AX2A 2AENA 2VOWA 4AVCA 1FV2A 3C7FA 4OHXA 4QB1A 1OSGA 4AF9A 5C4WA 3NJYA 1TZOA 3AFGA 3ZKUA 2WN2A 1W6PA 1ZVFA 3RSJA 1U0AA 4GH4B 3SCGA 1RUH3 2I2SA 4XDQA 3HAGA 2ZGQA 4IW3A 3WG2A 3B7MA 5FZOB 1GP5A 1PO13 2EICA 5C5TA 3ZXEA 1IS3A 4WZCA 2XJVA 3OGRA 4YW3A 5A3UA 1SCRA 3RI9A 5ABJA 1MPXA 1QJU2 1VLNA 1BLZA 3QACA 3P3NA 4GALA 1XRUA 4XTMA 1WCKA 3KVAA 5LK7B 3WUCA 5F2WA 2TBVA 4X8PA 4MZUA 2BNNA 5C9AB 1WD3A 3ENRA 1CR7A 3FX3A 4IV1A 4LBQB 3CIHA 3N9QA 1VRH3 4GXLA 3N35A 4RR3A 4R52A 3V0AA 2QUOA 1ZZ6A 3RYKA 4QQLA 1BYHA 2VQAA 1RITA 1RUH1 2B9VA 4KH9A 2A1XA 3ZYPA 4BMBA 1VBD2 4NVPA 2DURA 5A33B 4TN7A 1VBD1 1DGWA 3AP5A 2X53S 3J9SA 4IDZA 4NN0A 2QQKA 3AMNA 4LLOA 3N9OA 1NCRB 3ASIA 4XF4A 5AVPA 3WQBA 2V5DA 3OF1A 1SBEA 4D6QA 1BMV1 4AR2A 2ARCA 5J37A 5ANQA 1EUUA 1HQNA 4WM7B 5C3PA 3IM0A 4Y1ZA 3AC0A 1ZRIA 4PIZA 1DCSA 2D3RA 2PAKA 4PBPA 1OQ1A 1VP6A 3HNBM 4UFIA 1W9WA 3N4MA 2VCBA 3LDBA 1DIWA 2VUJA 3V56A 1RC6A 5FZ9A 2JDNA 2B5HA 3SC7X 3ZFEC 4AWDA 5E1RA 1YI9A 1M4WA 3PUQA 1QF3A 3UJQA 1OXCA 1GR3A 1ZBA3 2HLEA 4NPMA 2HWF1 3OTFA 4Y3OA 4A42A 3H8RA 4Q4Y3 4BQ2A 2GSYA 2JB8A 2RR12 2NPIA 2C26A 1A8DA 1NKGA 2WZEA 3AKQA 2DCTA 1ZZ9A 3OGJA 3I2JA 4CCOA 4AI9A 4CU8A 3U4XA 2R6QA 2RG4A 3BUCA 1JZ6A 2HWD3 3DPRB 1OKOA 1AR83 2RS13 4RQPB 4YRDA 4YW7A 3PHMA 1IS5A 1K5MB 3HD8B 4XVHA 3ZMNA 1Y7BA 3VBSC 3ZFFA 4BQ5A 1TG7A 3Q9OA 1K12A 4XIOA 4YGCA 3TRSB 5GZEA 1H2NA 1SACA 2UYBA 4AZZA 3RQ0A 3WW3A 2P3IA 5IVVA 3WNKA 4YM2A 5KHIA 3SH5A 5FQ0A 1W9YA 4C0HA 5JOXA 3MGUA 1QMJA 2EF6A 4HT1T 4E8DA 3VBHB 2R30A 5JLVA 2CWSA 3A4UA 5JMOA 2A73B 1QDCA 4HXCA 1GNZA 3NSTA 2ZMLA 1VB2A 1V9U1 4IV3B 4UW6A 1JYIA 1NCQA 3SXWA 1LGCA 3K77A 4FPOB 3JD71 4X6RB 3U78A 4LA3A 2K9ZA 3G7DA 5FY7A 2OS2A 1S2BA 1FPN2 3I49A 2DVFA 1YIFA 5FYCA 4QHBA 1KGYA 5HXMA 3FLRA 1GWLA 3SCFA 2RS11 4COUA 2WYSA 1LKNA 2GC3A 2VVDA 1C3HA 1QXRA 4MH0E 3E97A 2HWD1 1NY71 1JH5A 1ZZCA 3I2KA 1QXJA 4W65A 5DAQA 3EXUA 4K7JA 5IFPA 4LNVA 4EE2A 3MFAA 1FMD1 4A6SA 1E5SA 3N7KA 1MQTA 3T0BA 4IXLA 4M3CB 1CJPA 1AR93 3VKLA 2P3JA 4YM3A 4JZRA 4CCMA 3VDCA 4AVTA 1Q8QA 5I8YA 5IVBA 1ZBE3 4NR1A 2ZXQA 2ARXA 3WNPA 2J1TA 2JKBA 5BV6A 1YC61 3DPRC 4ZKTB 5K8SA 5A32B 3EHKA 2R16A 1HLCA 4XC9A 2JJ6A 1GICA 5FKBA 3LZZA 3LGRA 4QU2A 2A70A 4L8QA 1K5MC 2AC1A 4OHYA 4YARA 4E2GA 2PHFA 2Y6FA 2DUQA 2X09A 2WT0A 2ZHLA 3HEIA 5FJKA 5ERLA 1VBB2 2HWB1 1TE1B 2GN3A 1G9BA 2WQZC 4MGYE 2IXLA 3MIEA 4RL7A 4C1WA 2BU9A 2Z4FA 5FZ6A 2EXJA 3JBG1 1H0BA 4W6WA 3AYCA 5DDJ3 5FUNA 3UJOA 3ZIWA 4ARYA 2GU9A 2QQWA 4Q29A 1H8TA 1SFNA 1EP0A 1EYBA 1OVSA 4EROA 4XYXA 4P9JA 2BGOA 5BXXA 3VHPA 4AEJA 3BU0A 5E16A 3HNYM 2UU8A 1LRHA 1VRH1 5EYYA 3O1TA 1DZRA 4OI1A 4NPRA 1NX9A 1RJ8A 4YFWA 1T6GC 2VZPA 5GLTA 4H55A 3VD5A 5HCAA 3RZMA 1Z0HA 4N53B 3DYPA 4GB33 5DDJ1 2RHPA 1RMU2 1JZ8A 1HRI1 1SZBA 4PCRA 1UXZA 4M3CF 2BFUS 2VZVA 1W6QA 3NV2A 1P8JA 2NN8A 2VCAA 4CCEA 4TZDA 1SHWB 2CV6A 3PDQA 1S2KA 2ENRA 2VL4A 4LBNA 1CD3G 1UU6A 4OUSA 3VBOB 5CFCA 1CAWA 2CDOA 4L0PA 5LEKA 5GJ6A 1X36A 4ZZ5A 1RUJ3 4YZ3A 2WT1A 4CUAA 1W6QB 4BLJA 3A22A 4CVUA 3GHNA 1CAVA 5L7OC 1DQ5A 5DZFA 1REFA 2ZX2A 2XVGA 1LR5A 3KSCA 3GF6A 2HWC1 2RDSA 1QQP2 3VBFA 2C9AA 1RYYA 3AJZA 1B35A 3E5XA 2IZWA 1RHI3 5DDJ2 1Z7S3 3H3LA 1ENSA 5EP9A 2R072 2OQ6A 1KFXL 3UT0A 2Z5WA 1H1MA 1JOBA 3KHCA 5T5PA 1AYM2 1R092 3VBHA 4MYEA 5L19A 5FP9A 2J1VA 2XKOA 3AXEA 1E5RA 3NW4A 1Q8PA 2GZWA 1HJGA 2VVEA 1PGW1 1FPN3 5A7NA 2P4EA 5ANNA 4MGZE 1LOFC 2WKKA 3OGSA 1J84A 1O7FA 2QTWB 3KGLA 3RYRA 3ZYHA 2VMFA 3AB0A 3BIWE 2O8OA 3I97A 3GALA 1HB1A 1PO22 1XU1A 1GOFA 5JI7A 4LBQD 2PHDA 1RMU1 1BVP1 3NNFA 3RZJA 5A3MA 3ILFA 4BJ0A 2RR11 4PHZA 3ZYJB 4A44A 4OQ9A 4ES8A 1AL0G 1IG3A 3OUJA 1ND2A 4FTEA 3PJYA 4N53C 1HDKA 4HVRA 1FNYA 1Q56A 1BHGA 4HK8A 3TN91 4JGZC 1S0GA 3SITA 4MHRA 4AQ2A 4GWNA 3AYEA 4CCLA 2YZ4A 1GQHA 3B9IA 4PDWB 5F3GA 1VALA 3K2OA 2XOMA 1J1TA 2Q1MA 3NMBA 1RB8G 1ODMA 5C5UA 3S6PA 5IK7A 1GLHA 1EAH2 2G9GA 3ACGA 4B1MA 4CU9A 4CUBA 2FDKA 4B7EA 3SKJE 1PGSA 1YNAA 3O7OA 1VE0A 1QQP1 4LO6B 5L7OB 1NLRA 1BKZA 3KQRA 4HVOA 5FXZA 2FDIA 5FZGA 1HRI2 3AMMA 2WA4A 2YGMA 4AGRA 1SLTA 4UI9L 4HONA 3ZSLA 2OPKA 3AL6A 1KJLA 2Q1ZB 1GANA 2K0GA 2B9UA 3U14A 3KF5A 4LBMA 3T1MA 4PT6A 1HXS2 2QJVA 2XJTA 2Y38A 1Y9MA 4CXWA 1UKGA 2MEV2 3N3HA 2D7FA 3RWNA 3J8F3 2O0OA 1UZZA 4MGQA 3ACLA 4CXXA 2E9QA 4EWEA 1N1SA 2WWUA 1BCXA 4ONUA 3BKZA 2WO1A 2R073 1IPKA 5APAA 3ZXLA 1PIV2 5FV3A 4AEDA 1PZ8A 1GSLA 1C57A 1VJ2A 5FO7B 3ZSJA 1WMXA 2VZ3A 2RS33 3KVBA 2HWB2 4E4SA 2NM1A 2LTNA 2WZR1 4V2WA 1HRV2 1YFUA 2B8MA 2GNDA 2TUNA 5FLHA 4ZS2A 5L36A 2FZ2A 4AEKA 1OLRA 1Y9GA 3ZXKA 2ZAAA 3ZSEA 4U36A 1XNAA 1DHKB 2Q8CA 4E2QA 1QWRA 2EAAA 3VDDC 4J6GA 2JEMA 3D4KA 3INAA 1RUG2 2X5IA 1QJX3 5DAVA 4DPNA 1QH6A 1HV1A 1OF4A 3BTXA 2ET7A 4BIOA 5LEJA 3E5QA 4XFBA 1PX3A 4BQ4A 5C71A 4RHV2 4XFCA 4JDOA 2E7TA 4PDWC 5IK4A 2PELA 3LIHA 3OY8A 2VCCA 4ASKA 2W52A 2QE3A 2BPA2 1FNZA 1C5IA 3A21A 4HPKA 3MF9A 3L9JT 4COYA 1PGL1 1MEC3 1RUI2 1WMEA 2A75A 3ON7A 1AZDA 2BEOA 3DYMA 1GBGA 2V09A 3FE5A 1VBC1 4OYUA 1MQTC 1VMJA 4D7SA 4AHWA 4GA9A 1PVC3 1K5JA 1I5ZA 3E6CC 1Q8OA 4M3CE 5EV7A 2WNUC 3ZYFA 4CDXB 1C8NA 5CKNA 1C4RA 1KXGA 2BOIA 1H8VA 1CQ9A 2KXLA 2VM9A 4INDA 3ZFGA 3IIAA 4PBOA 1ENQA 2KR2A 4CCJA 4LKEA 4JDNA 2J7MA 3AJYA 1CPNA 3KQ4B 1JU3A 1MS9A 2XMLA 4Q4W1 3TNPB 2P34A 2WFPA 3CNAA 3QCWA 1TVGA 1PIV3 2W46A 4FQ4A 3WY6A 2ETEA 3CKHA 2JICA 3VBUA 1QGLA 5CEHA 2QNKA 1RIRA 3UV9A 4OHZA 5KR7A 4FP2A 3WDYA 3KCYA 3NJZA 2WFF2 4HKLA 2ZS6B 3FWEA 4AI3A 4F7ZA 4YSFA 1ST8A 3AZXA 3VGIA 2IXCA 4CUGA 3KD4A 3VZNA 1BK1A 3RPQA 4AI2A 4PLOA 4YW5A 1ULDA 3VBUC 4E4HA 4O61A 5C8CB 1XE8A 1YJLA 3LOBA 1RINA 1MEC1 2YYOA 5FYBA 3VDDB 3ZN6A 2NP0A 5A1LA 3LIGA 1R1A3 5E6HA 1ASJ2 1W8FA 3O5SA 4FFHA 1YFXA 4CP9A 4RHV3 4EN6B 2PXJA 2R063 2ZHMA 3AYAA 1HQWA 1SG3A 3ACIA 1D0HA 1LHWA 3VKOA 3LDRA 2XUMA 4Y24A 1R083 1RUD1 2DVGA 3WQ7A 4G4FA 4QKFA 2UY9A 5DUWA 3VBFB 3ZXFA 1MACA 2NQYA 3SISA 3RNSA 1RMU3 3TEYA 5CB7A 1FOD1 3IMMA 4YG3A 3RZKA 1WW6A 1YJKA 1AF9A 2FHRA 2LRPA 4K9SA 1IG0A 4XHXA 4IE6A 1MQTB 5E89A 5JXIA 1OUXA 1GP6A 2OPWA 4NWWA 4BHPA 1ZRFA 1W9TA 3OY8B 5KXEA 3MIBA 1YCIA 4S2FA 2WQ4A 3UKNA 3U4SA 2W1SA 3FFQA 1T6BX 1V6KA 4FPYA 2ZGOA 1I5PA 2Y0IA 5FMDA 4C90A 4AK3A 4OI2A 3K3NA 5J48A 1AYN1 3NV4A 5DAWA 2BW8A 3QOPA 5C3SA 2NLRA 1TEIA 2Y6HA 3KCXA 4EN0A 4BQYA 4AVBA 2RDNA 2HWE1 1VBB3 5G04L 5CADA 1IHMA 4FPGA 5FZ8A 1AL21 2WAOA 3ES1A 4WVWA 5DABA 2WC2A 3APBA 2PHWA 3W20A 4P5HA 2CY6A 4IV1C 1AR82 1X9TA 1W06A 4QHOA 4XJ8A 4COWA 2GMPA 2VH9A 4CPBD 4LO8A 5FFOC 3WW1A 3IBMA 4DXSA 3Q8FA 5CIRA 3WQ0A 2D93A 2OZJA 2P5BA 2RV9A 3KWVA 3WG1A 4EQVA 1D4M1 4TWTA 3WNOA 1A3KA 2HYKA 5KWRA 1QQP3 5JPNB 4NIAA 3I3DA 1CAUA 4OVEA 4XFFA 4LIVA 4EWAA 5JAXA 4IL7A 4G3YC 2BUKA 1GZCA 3ZXGA 1GU3A 4K6BA 2VVFA 4CDUB 3AKTA 4Q0SA 3KV4A 4Y1YA 3KT4A 3TN92 1KS5A 4XUTA 3IDBB 4XE9A 1ODNA 4BMEA 5CVRA 2E31A 4YW4A 3K4ZA 2JG9B 4YG6A 1YFWA 4PQQA 1AYN3 1SMVA 4Q0PA 1WZXA 4XJWA 4KU8A 2A3XA 5EZWA 3KCCA 3VBFC 5F5CA 3ZN5A 2VTXJ 3O0VA 2VTFA 2XLFA 2CDPA 3KT7A 3VV1A 2ZAHA 1YWKA 1CPMA 4V1PA 4LK6A 3WG4A 2Z69A 4PF1A 1E5HA 5T52A 2ZKLA 3P3PA 4BXSV 2ZKNA 5FMOS 1FI2A 2PLV1 2UWAA 3HQUA 4UYBA 4Y1UA 3UGGA 5DUVA 3OUHA 3ZO0B 4EN8B 5LCWL 4PDWA 1LU1A 4W6XA 1LECA 3AP4A 2PAEA 5FLIA 1O8PA 5JZGC 4FOYA 4AHXA 2LW8A 1JU4A 1CZVA 1LTEA 3ETQA 3KF3A 4AAXA 1JYVA 4LOSA 1S2EA 1PX4A 3UETA 1DQ0A 1DG6A 1G8WA 1QY4A 4RHV1 1WW7A 4XJAA 1ND3C 2EIGA 3WP5A 2QBXA 2VG9A 3E1F1 1RHI2 3ZR5A 4Z8BA 1NCRA 4LA2A 1R1A2 1UMHA 3JQXA 4HK9A 4YVWA 5F39A 1K42A 3H1WA 2W92A 2QDNA 4META 2WLPA 3HQXA 4HANA 2BERA 1GWMA 5I0TA 1Y3TA 1R091 2RM22 4MGSA 3D82A 2JG8B 4A3XA 1O3QA 2B46X 1XU2A 5FY1A 1UL9A 4JKKA 2CGPA 1DU3D 1SFPA 3JU9A 1KQRA 3JUUA 3ACHA 2B4KA 2J1UA 2VMIA 2Q8OA 2X05A 2LUWA 2QVSB 3BTAA 5A6ZA 4N7UA 5IT6A 4Q8LA 4Y33A 2VU9A 1BVVA 3HT1A 4QGMA 1U5YA 4UW5A 5A7PA 4CDUC 3PURA 1PIV1 1AXYA 1MEC2 1RUI3 2R0FA 1RXFA 2VQTA 3THCA 5JUVA 4Q4X2 2RS51 1UY4A 2JG9C 4Y4RA 2X10A 1QOOA 3VBRA 1DBNA 3WNXA 1O4ZA 1RUE1 3CZUA 5ACA2 4XMIA 2GNMA 3M4FA 1C8M1 2IXKA 4X6QB 3THTA 1YYNA 4IEOA 4QXHA 2ZZJA 2ZEXA 2XLGA 5LATA 4XMAA 3SQOA 3D0JA 5A1AA 2HEWF 1DYKA 3PU3A 1GZTA 5JVVA 5KC5A 4K21A 4JGZB 4AG4A 4Z2AA 5JOZA 1URXA 2R1BA 1OMIA 4GKYA 3WLUA 1K3IA 2WN3A 5HBAA 4K8FA 1F35A 2VBDA 4GB31 1KD7A 2CWMA 4NIHA 2JIGA 4KG8A 2YU2A 3IZOA 3NNJA 2ZGMA 1GV9A 4JHZA 5B2GB 4QM8A 1OQEA 4DMIA 4AW7A 5JZGB 5EPAA 2PHUA 4N53A 5ACA1 2Y34A 4NAMA 1Y9QA 1BZWA 5LRRA 2EA7A 1W99A 2Y6GA 1JHNA 4XF9A 5KHJA 2D6MA 2V4AA 5CG8A 2ID4A 4XAEA 5FREA 4QU1A 2VMCA 3HWJA 3O1UA 4KI5M 5JMCA 4P00B 1AYM1 1WD4A 2LS6A 2FCUA 2YU1A 4KNCA 4NAOA 2Q8DA 1D2SA 1IPSA 4W4ZA 1NZIA 4M4RA 2A3YA 1I9RA 5FZKA 4AEDB 2J1RA 4FVVA 1GZWB 2SLIA 4Z82A 2PQQA 2PHRA 1LNSA 1UY3A 4GMP3 2WS91 3TBDA 3WV6A 1JYNA 3OEBA 3MUY1 4YZ4A 3TNQA 2X8KA 4P9WA 3OPWA 3I3QA 4KL1A 4AFCA 2QQNA 4CA9A 2OKXA 4KWLA 3H42B 1LB2A 3EJKA 4NIGA 4BQXA 4FO9A 1DQ6A 2VZTA 1ULGA 5C6CA 1KRIA 3CL1A 2JX9A 1J1LA 4NRPA 2OW4A 3J8F1 4KG0A 1A34A 3IAPA 1WKYA 3AZYA 3DPRA 1PK6A 3B00A 3GCXA 3Q8BA 3LA7A 5JR2A 4IGOA 5ACA3 4H7MA 2VMEA 3VD4A 5L7OA 3H50A 4CEYA 1WCQA 2WIIB 1OH3A 3EBRA 4N9HA 1JZ5A 1F31A 3AFKA 4QQ2A 1W90A 4XCBA 4P9GA 3SEPA 2W3JA 5FZOA 3AL5A 3WSOA 3PUIA 3WNMA 2RJKA 2WT2A 5LA2A 5EIYB 3QH7A 4F8AA 1JUHA 4NROA 5FOBB 3OCPA 4COZA 5CFCC 4HPKB 3T09A 3NV1A 3D0SA 1S0IA 1N3OA 2VTXA 1XOYA 1F5FA 2YC0A 4RA0A 3KZ4C 3RYPA 4AFAA 5BNNA 3FHIB 5CFDC 2XJPA 4DOUA 1I3HA 1EPWA 1ZNPA 1GP4A 3JB8A 3BGAA 4Y5TA 3DV8A 3AZZA 4CCNA 2ZMKA 4LHNA 3O0XA 4LMFA 5CYYA 5A3WA 5FR3A 1RUF3 2XPJA 5FZ0A 2W1QA 3W5MA 4HL0A 3N9PA 4SBVA 2BRTA 5BNOB 3USUB 1TNRA 3UKVA 4HN1A 1W2OA 1CAUB 2OVUA 4QQHA 1G9AA 2GP3A 4JCKA 4KBZA 4PLNA 5F3EA 2Y64A 4CP1A 1OURA 1QJY1 3SHRA 1NCQB 5EXOA 3UKTA 3VKMA 4LO4B 1PZ7A 4GKXA 4FPHA 3AM2A 3UNPA 1U5IA 4UFLA 4IE7A 4HLTA 3OBZA 4DZGA 3POIA 5FAXA 4WV8A 3M3QA 4FFFA 1H8TB 3DXUA 1W8NA 3J26N 1OBNA 1C1FA 1PO23 4QX2A 3H1MA 5KC6A 4QQOA 3HN1A 2BNMA 3AMPA 4B29A 4CP2A 1SBDA 4CP0A 2OA2A 3ZFFB 2YMZA 3KS7A 1LHUA 4NHYA 2JE7A 1TME1 4NRMA 3W5NA 3O12A 4UXAA 3BOWA 1R093 1W8UA 3IPVA 3OPZA 4GWMA 1MS4A 1FOD2 1HN1A 1ND3A 1UWWA 3ZXJA 4ET7A 3DUIA 4FPJA 5F6LB 5CA6A 1LOGA 5K9YA 3OG2A 5FO8B 1RUG3 3IAQA 3MPPG 3E6DA 4GWJA 4IGQA 5D1IA 5LA0A 5LY1A 1CJDA 1AYM3 2DDUA 1BQPA 3WF2A 4AHYA 1ULCA 5CFCB 1ZZBA 2OUHA 3FBMA 3MBWA 4DEVA 4BOWA 3I4IA 3UK9A 2E33A 5FMBA 1MZFA 2Y6JA 1AR71 1X33A 3DGTA 5CBLA 1BBT3 4GAZA 5GZFA 2B7YA 3LOIA 3VZOA 4COVA 2DTYA 2E7QA 2YHJA 1F15A 1OVPA 1QDOA 1ZA7A 3FN9A 2H0VA 3LSDA 3OUIA 3SEEA 4LT5A 1ZZ7A 4XZPA 5EJZB 2PHXA 3WNNA 1V6JA 2JENA 1NT0A 4CTEA 5M0TA 5IHRA 4W8JA 4DUXA 4JRLA 1QJZA 2MEV3 4IEUA 1UX7A 5I93A 2ZX0A 4MGTA 3LPGA 5A3NA 3I2HA 3WW4A 1WMDA 1ZX5A 1KEXA 4MGKE 4Y22B 2W2IA 3TB0A 1QOSA 3M1HA 4DUWA 3VN4A 4FAHA 2GH8A 4IEQA 5LWBA 5CG9A 2HJIA 3WUDA 1NYWA 5IVYA 2RMU1 1KDMA 3D8CA 1HB3A 4D7YA 3DYOA 3M70A 1F2NA 3GXUA 1WLDA 1I6XA 1QJU3 4JTNA 1FX5A 4E27A 2J1SA 1OF3A 1AR72 1XSRA 2WWJA 4K40A 1Y4WA 3PVOA 4FTSA 4XETA 1TMF2 2CYFA 2G9FA 2SBAA 4IE0A 3WT3A 3KT1A 3ZFFC 5FMCA 3NWKA 3ZFGB 1ZRRA 4S2GA 4OZOA 3LA2A 2B45X 1LOCA 4LE4A 3S0MA 4XILA 1SQ4A 1SEFA 1XNCA 4QXKA 4BXFA 1O8SA 1V6NA 5FPUA 2WA3A 3BODA 3KLSA 1N1VA 1YRZA 1PGL2 4WBBA 2ADDA 5CKMA 1BEV1 4GULA 1UOFA 2DUPA 4MV2A 4P9XA 2AUYA 3M3OA 4LBOA 4JQRA 4QPGC 4AGVA 3ZFEA 2JDYA 4FP3A 5IATA 3PTRB 3S30A 4CCCA 1MS5A 5C4WB 4L11A 4CUCA 1W39A 3LFMA 5FYZA 1UNBA 4QX5A 4D6SA 3SLIA 5GM0A 2EXHA 4J1WA 2YB7A 5AC93 3CBNA 4Y4YA 1AR92 4QB6A 1TME3 1QJFA 4Y20A 4O65A 5T50A 2EXIA 4QX7A 3B9CA 3MLLA 5FLJA 2ERFA 1ZBE2 1W8WA 1W6OB 2RR13 3WCRA 3POJA 3I7DA 4L97A 3CJIB 1RUD3 5BY5A 4XTPA 2F4LA 1SFYA 5CU1A 4F83A 1G9CA 4XUPA 3K48A 3ZIXA 3B94A 3JQWA 1FOD3 1VBA3 1YLLA 3DKQA 1F5JA 3PLQA 5HXVA 4CZSA 4I3GA 1H4HA 3R4SA 4X8NA 1DF0A 3MV11 4XXAA 4MXVA 1HQLA 3I3BA 5FZDA 4BK5A 1RUG1 2MNGA 3WXPA 1UPIA 4CCKA 5D2AA 3C2UA 4NHLA 4ES9A 4K3UA 1CZSA 4BQ3A 2HWD2 1WLCA 5FZ3A 1CWPA 5C70A 1TMF3 2E53A 1ASJ3 1H1IA 5FXXA 4RD7A 1W3VA 3MLKA 1CIYA 4LQRA 1HB2A 2XB6C 1SLLA 1HX6A 5J36A 3MFCA 1AX1A 3GBFA 4XPVA 3WOGA 1Q43A 2WDBA 4QHZA 2VULA 4H14A 3GHMA 3MEPA 3X29B 2JKXA 3D3AA 4KQ7A 5KHKA 3AP6A 1B35B 1EV13 4DRVA 2D6LX 1XXNA 5K7PA 2RMU2 1EY2A 3D5OA 1S4CA 2WNUA 4FOQA 2W39A 1AR81 3AK0A 1VRH2 2AACA 3NO8A 4B4RA 4JKMA 3GBWA 1S0DA 1CAVB 1XYPA 5A7QA 3AXDA 4Y20B 5JSPA 2VZRA 2P3YA 1M06G 1LHVA 4QPGB 3SKVA 2P6CA 3WINE 5KXCA 3CHXA 3ZR6A 5C4WC 3LEGA 3ZDSA 1OLMA 4P5YA 1H6YA 4HOOA 4OLLA 2VMHA 3K51A 1RUI1 3EB7A 5FZBA 3FUQA 1ZBA2 2P17A 4OHVA 4BM8A 2W0XA 3VD9A 4ISQA 1IKPA 4XIKA 5J3UA 2DVAA 4V2VA 1HRV1 2XBO2 3MIFA 3NL1A 3OPTA 4K1YA 5AC92 3ZVXA 3AYDA 1X82A 4LORA 3PU8A 3CJIC 4ZONA 2WINB 4AQ6A 3QD6A 4LBLA 5BYNA 3WHTA 2X5IC 5HCHA 1UD1A 3MIHA 3HOBA 1DYPA 2J1AA 2O1QA 5IW0A 3OEAA 4BISA 4XJUA 4QDQA 5E88A 2C9KA 2WLQA 2HWF2 3R6SA 4E9KA 1SDWA 3A23A 4Q0VA 2QQLA 2OUJA 5CISA 1YUDA 3LF7A 4AVVA 1L7RA 1CIWA 1MZ6A 4WZFA 3VKNA 1V0AA 1UF2C 1JODA 2I07B 3VHOA 3S7EA 2WZR2 3WP4A 3K46A 4XFHA 3WNLA 2D5HA 1XNDA 1LODA 2GC1A 1DQ4A 1H6XA 1J3PA 1UXXX 1VPHA 2VBPA 3BN6A 4K20A 4XDPA 2WL1A 3OD4A 1UZ0A 5FCCA 2ORXA 1W8OA 1NZCA 1OC1A 2LM3A 4ISRA 2WSVA 4ASLA 2D6KA 3AMHA 2PA7A 4RFT0 4PI0A 3RJ2X 1UAIA 1HIXA 4ZU5A 1HXS1 2PHTA 4S2DA 1VB4A 4R4XA 3UL2A 3FLPA 4FSJA 1E5IA 1UN1A 3P5BA 5FP8A 3S5QA 3WG3A 2AR6A 3CLPA 1COV1 1CVNA 1W6NA 3RGBA 1Q8VA 1W9SA 2B39A 2D5FA 2RS52 2ZEZA 4LHLA 4BB3A 3OYWA 5EHDA 3HPNA 5B4NA 4M4PA 4RS5A 4Y26A 5FBJA 2E51A 2VBBA 3B01A 4EV0A 2BZDA 2ZPXA 4QDSA 5GKAC 1IS4A 2YROA 2Z42A 2ZA9A 3ATGA 4LTAA 4Z92B 2ZHNA 4UW4A 5DXDA 3I59B 4MGIE 1MZ5A 1X50A 1SDDB 2QQUA 3H3ZA 2DVDA 1W6NB 3POWA 3GNEA 5A3LA 2VQ0A 3OSDA 3H8OA 4NIDA 3RFRA 1OPOA 1UX6A 4BA6A 4IEYA 3N7LA 1LHOA 1JUIA 3EMRA 4XUNA 4A3ZA 4YM1A 3P6BA 2X5IB 3LPFA 4YGBA 4RQPC 1WUVA 2F4PA 3KV5A 5SV8A 1PHMA 2P1BA 2ZTNA 5J1XA 2WFF3 4GIQA 2YDEA 1CX4A 5F5QA 5IWFA 2GP5A 1UKRA 4HETA 3L2HA 5FPLA 1F4HA 2WNOA 1W8TA 2A5ZA 2W94A 4JVAA 1V6IA 1W6MB 3TEXA 3HBZA 4NPLA 4A6OA 1DZQA 1TNFA 5LW9A 1LOFA 1PVXA 4Q26A 4XJZA 1RUF1 3SMHA 4FPCA 1PMHX 4P08A 3O1VA 4XQDA 4HBNA 5DAXA 3POSA 2Q30A 5HI0A 2D3SA 1SLBA 3T2OA 1AJKA 3VBHC 4XJ9A 4MADA 1NXD1 5A3OA 3BALA 3BIEA 1H1AA 2D43A 1LOBA 5A3TA 5FYUA 4Y22A 3V64A 2CAVA 3IMNA 1RUJ2 1KFUL 1RJ7A 2ORZA 3ZSMA 4KWUA 3A7QA 1NE4A 5AC91 3HJRA 4LIUA 2A3WA 2AZ5A 2DCYA 5GALA 3IN9A 1RUNA 1ZBA1 2YUEA 3I2IA 2DWRA 4GWIA 1S0BA 5TSWA 3T3YA 1MS1A 4UBGA 1W6OA 1WW5A 1DGRA 2ZABA 3LDKA 1O91A 4QX1A 3PVNA 2YPJA 3TAYA 5KHGA 3JB4C 3ZYRA 4CDQC 2YFZA 4I01A 2RS12 1POV0 1PGW2 1QHDA 2WSUA 3FBYA 1JS9A 4Q1RA 2R061 2XWBB 3POEA 4FCAA 1Z7S1 2R062 1POQA 4ORFA 1VBD3 2Y33A 3URFA 5I0RA 3I3MA 1F9KA 4GH4C 3GZUC 3OYWB 5HV0A 2RE9A 4XQWA 2FDGA 1N47A 2YC4A 4H7LA 3VBRC 1V9U2 3BYWA 3JBG2 5FBZA 3M3IA 5FYTA 2AEZA 4JDMA 3B02A 1MS8A 5EFUA 3ZN6B 5J96B 1NA1A 3ILNA 2DUOA 4PLMA 1PK6C 3Q8EA 5FYSA 1D4M3 3MPBA 2W68A 5T5OA 2BV4A 5FPAA 2K2SA 1C28A 5FYHA 1VBE1 1GKBA 3VB9A 5A1FA 5C9AC 1FV3A 5FK8A 2AGSA 2HYXA 2BGPA 2AEYA 3HT2A 2ZX3A 2VOKA 3MIGA 2NMOA 3R4UA 4LBKA 1J58A 1JMUB 3IDAA 3MI8A 4ASMB 1HB4A 1XYNA 2JDMA 4BE3A 4F3JA 3WEZA 5I0DA 5FKCA 5JR7B 5GLUA 4M01A 5H9RA 1W0PA 5JI9A 1ZA4A 1MVEA 1QNWA 3NAPB 3TN93 3WF4A 5DMYA 1WLTA 3F95A 4CE8A 4LKDA 2E26A 1QEXA 2QQIA 3GDBA 4XABA 1OHFA 2VNGA 4DNYA 4M0NA 4A45A 3ZXDA 2IXHA 3OOXA 4I0BA 1AR73 5CNAA 3W59A 1WLWA 1XQNA 3ZYGA 1PVC1 2CHHA 5ABJB 2DYCA 4WM7C 3NV3A 4YGDA 2G19A 1H2MA 1V6OA 2BVBA 2EALA 2A6VA 4JGYB 1W0OA 2ADEA 1WWYA 1YQ8A 2ZGLA 2AH2A 4OFGA 2NMNA 3WP3A 2JDKA 3Q8AA 3LE0A 3VBOC 4JAAA 4QD2A 1AL23 1ONAA 4QGLA 3VZJA 3VHRA 3ZFEB 1D4M2 2ILMA 1UZVA 3E6BA 1VBB1 2XWJB 4OMCA 5FZ1A 3J7LA 5IFTA 1Q5OA 1BEV2 1NLSA 2GN7A 2ZGUA 2DBNA 5A7WB 4JGYA 4UBHA 2XHKA 3UESA 3Q8CA 4YW6A 5FIXA 3RZHA 3IT8A 1CESA 3DXTA 4YVSB 3VBRB 2XVKA 3VL8A 4WVMA 1YQ2A 2WABA 3GZTB 5A70A 4BYYA 3LCPA 1H30A 1PK6B 1JYWA 5EWSA 3TWIA 5JXHA 3VZKA 3FHAA 3IPVB 2WZR3 4LO5B 5FP3A 5FY5A 4AOCA 2WJSA 5DAPA 5JXGA 4FAGA 4L92A 4Q8KA 1H2KA 5F6KA 4P9LA 3WR0A 4MXWB 3VBSB 5LRSA 3GCWA 4Q4W2 1GOGA 3TEWA 3B5LB 2NYYA 4LE3A 5DZEA 4L2NA 1GZ9A 3C7GA 5C8CA 4MLOA 4Q4V3 4RR3B 2C6SA 2BYVE 2VNRA 2VC9A 1QKQA 3IWZA 5CAZA 2YY1A 2EIDA 2DV9A 1W2NA 2WFF1 3SCHA 3C3VA 3J4UH 2UY8A 3NAPC 4AXOA 2G1MA 3BPSA 4MXWA 3VBSA 1LESA 2R32A 4IV3C 3B3QE 4KBBA 4YYOA 4TTGA 4QB2A 2L9LA 2PN5A 4N43A 3CO2A 5DUUA 5IAVA 5ABJC 4IERA 3O1RA 2DFBA 3OBAA 2KM2A 3ZLIA 4NE9A 3WF0A 1W8HA 2BVVA 1YHFA 5T54A 2A6ZA 2QDRA 2WNVB 4JGYC 2QKDA 2MHFA 1FAYA 1WCDJ 1QXPA 1ZYBA 2H6CA 5A7WA 4D3WA 4AQTA 4J1XA 1N1YA 3K75B 3PTYA 2ZGNA 2ES3A 4YZ5A 2WRAA 2VCMA 2ZGKA 5J09A 3MW2A 1VBC2 3MDPA 5BNNB 3ECQA 5F32A 4OULA 2XJRA 4Q4X3 2JWPA 5FP4A 5F3IA 4Y5SA 3HN3A 2K46A 2WYFA 2XHNA 1UQXA 3GGLA 1SLIA 2A6XA 4YVSC 4A2UA 2GH2A 4MO3M 2Z79A 1XE7A 2QQJA 2VUCA 4AE2A 4QAWA 4CRQA 4WM7A 4QXBA 3T0AA 4Q4Y2 1XNTA 4LITA 4NOTA 4KMQA 4XFIA 2WZPP 5D8AB 1W05A 2GMEA 3VL9A 5IUQA 2HWF3 3VD3A 3I2OA 5FY8A 3UGFA 4CP9B 4C91A 2IC1A 4TXWA 3T0DA 1DGRN 2WO2A 3A0NA 3C7HA 1DFQA 5GLZA 4AFMA 1HXS3 5F1RA 1RUD2 3VDDA 2Y60A 4DEQA 4MX3A 4QDRA 2BP6A 4RR3C 4XF1A 1OD3A 3WDXA 2VW0A 1D4VB 2VZSA 3BVCA 3NQHA 2ZOEB 5FZHA 4UFHA 3VLBB 2FCVA 2G4IA 3VDBA 3NAPA 4UF0A 3RJRA 3RVHA 3FJSA 3AX4A 4HG6B 4QKBA 5FYYA 1OI6A 2W95A 3T4HB 1FYUA 4BQ1A 2RS32 3IB3A 4FXGB 4Y5Z0 1EAH1 4UWDA 3B69A 1TQ5A 3IIIA 4EYUA 3O1OA 3H7JA 5HCBA 5IAXA 4FPKA 4ZU4A 2ZEYA 4DUVA 2VMGA 3WDUA 3DF0A 1GUIA 2P3KA 4K8RB 4ZU7A 2R041 4RGGA 1C5HA 3HIFA 3CEWA 4HZFA 1SLCA 5FZMA 2WNVC 3TOJA 5T3NA 1POV3 1W6PB 5I0SA 1YXWA 5FYMA 3RMXA 1ULFA 1CAWB 1US3A 3VBOA 1G7YA 2IUWA 4HN0A 4FXKB 2N7GA 1W8ZA 2Q1FA 2VXRA 3ZXAC 5CFDA 5BNNC 2RJLA 2IFWA 1ACCA 1XYOA 1WA6X 3WHUA 1UZYA 2ZHKA 2ZMNA 4LOTA 3BCWA 4WVVA 4IEPA 1PO21 5C33A 3ITQA 1J3QA 1RUOA 2W5FA 4Q5OA 2JDPA 4CEYC 1XNKA 1J83A 2UWCA 4DS0A 4GQ7A 5JXJA 3HVDA 5FPXA 1R1ZA 1B09A 3ZPYA 5GZDA 5A6YA 3T1LA 1JYTA 5D8AC 2XJQA 1POV1 3AKPA 5L73A 3AVSA 3GM8A 3NNMA 2RDRA 5LBCA 3LA3A 4B3NA 1O3RA 1COV3 5EJ3A 3AMQA 4O9GA 1BXHA 1YIPA 2GC0A 5T55A 3ORJA 1VAKA 5FPVA 4YGEA 2GNTA 1CAXA 1ULEA 3PIGA 4JKLA 4AAPA 2VOTA 3MYXA 5FP7A 1VAVA 3POBA 4OQ8A 2JE9A 3RRDA 1L7LA 2ZACA 4IGPA 2FMDA 4FTBA 3IDCB 4JTOA 1APNA 2I45A 1X9PA 5FK7A 3I2DA 1I1EA 3O1MA 4D94A 2YGLA 3KV9A 2VW2A 5C9AA 5FWEA 2R0HA 1JZ3A 3VBUB 1O3SA 1GNHA 2AREA 4YVWB 4OZXA 5JCTA 4Q1PA 5C8CC 4TYSA 1GQGA 4YW2A 4P02B 2Y6LA 5FZAA 2PFWA 1RL3A 4XW3A 4D6RA 1N3QA 5DPNA 1AR62 4NIIA 1JZ2A 4O7XA 2ZGRA 3A0KA 2CNAA 3USUA 2JD4A 4QPYA 4AVSA 2W08A 1QJY2
chains in the Genus database with same CATH topology
4QHOA 4O61A 3T4HB 4IE6A 3BTZA 4OCTA 4NRMA 3BUCA 5F8PA 2FDHA 2FDKA 3RZJA 3S57A 3T4VA 4NIHA 4NPLA 3O1OA 4NRQA 2FD8A 3T3YA 3RZLA 3LFMA 4MG2A 2FDIA 4NROA 4QKDA 3I2OA 3RZHA 4IE7A 4ZS2A 3O1MA 2FDJA 4IE0A 3O1SA 3O1VA 3BTYA 2FDFA 3I3QA 3KHCA 3I49A 3O1RA 3H8OA 3S5AA 4NIDA 4NIGA 4MGTA 3BI3A 3BU0A 4QKNA 3BIEA 4IDZA 4QKFA 4NRPA 4ZS3A 4IE4A 3RZGA 3O1TA 3RZKA 4NPMA 4JHTA 4IE5A 4NIIA 4NJ4A 4O7XA 3KHBA 4CXWA 4ZHNA 3O1UA 3H8RA 3O1PA 3I3MA 2IUWA 3BTXA 4RFRB 3H8XA 5DABA 4CXXA 3RZMA 3BKZA 4CXYA 2FDGA 4QKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QHO A;  4O61 A;  3T4H B;  4IE6 A;  3BTZ A;  4OCT A;  4NRM A;  3BUC A;  5F8P A;  2FDH A;  2FDK A;  3RZJ A;  3S57 A;  3T4V A;  4NIH A;  4NPL A;  3O1O A;  4NRQ A;  2FD8 A;  3T3Y A;  3RZL A;  3LFM A;  4MG2 A;  2FDI A;  4NRO A;  4QKD A;  3I2O A;  3RZH A;  4IE7 A;  4ZS2 A;  3O1M A;  2FDJ A;  4IE0 A;  3O1S A;  3O1V A;  3BTY A;  2FDF A;  3I3Q A;  3KHC A;  3I49 A;  3O1R A;  3H8O A;  3S5A A;  4NID A;  4NIG A;  4MGT A;  3BI3 A;  3BU0 A;  4QKN A;  3BIE A;  4IDZ A;  4QKF A;  4NRP A;  4ZS3 A;  4IE4 A;  3RZG A;  3O1T A;  3RZK A;  4NPM A;  4JHT A;  4IE5 A;  4NII A;  4NJ4 A;  4O7X A;  3KHB A;  4CXW A;  4ZHN A;  3O1U A;  3H8R A;  3O1P A;  3I3M A;  2IUW A;  3BTX A;  4RFR B;  3H8X A;  5DAB A;  4CXX A;  3RZM A;  3BKZ A;  4CXY A;  2FDG A;  4QKB A; 
#chains in the Genus database with same CATH topology
 1WA4 A;  1JXN A;  2VY0 A;  4CU7 A;  3LEK A;  4FOV A;  5FUP A;  1LGB A;  1MS3 A;  4CDW A;  3WDW A;  3SH4 A;  1DQ2 A;  4BLI A;  4N90 A;  3S7I A;  4DY5 A;  2VNO A;  4EZ4 A;  3AP7 A;  2O8Q A;  1C8M 2;  3ZYB A;  4A41 A;  4BDV B;  4Q2F A;  1HRI 3;  1VBE 2;  1YQ6 A;  1VAM A;  2DCJ A;  4QPI C;  1AXZ A;  1SLA A;  4QXC A;  3U10 A;  2QFE A;  4OMD A;  1SCS A;  2D6P A;  5E8A A;  2QQP A;  3SH3 A;  1L3J A;  3FMG A;  5FUI A;  2P2K A;  1XSQ A;  4CEY B;  2ATF A;  1AUY A;  4FPE A;  3WP6 A;  1LED A;  3VUO A;  2JE8 A;  1OT5 A;  4CDQ A;  1LOA A;  3ES4 A;  4NUB A;  1BEV 3;  2I74 A;  1JZ4 A;  2W1W A;  4Q4V 2;  4EJR A;  2WS9 2;  4URA A;  1AX0 A;  1JZ7 A;  1L7Q A;  1RGS A;  3MW4 A;  4ZPI A;  1KDK A;  3AZV A;  4ZXK A;  3LAG A;  1J59 A;  4A7Y A;  1RUJ 1;  2BQP A;  4KWK A;  4GD4 A;  2VZU A;  4YWA A;  1R08 2;  3BTY A;  2YBP A;  1NE6 A;  5FZC A;  1OOP A;  1W6M A;  5IVJ A;  1G9F A;  4IV1 B;  4LBQ A;  1XPW A;  1U12 A;  5ISL A;  4RN5 A;  2XLA A;  2D6N A;  2OX0 A;  1OUS A;  4GZ9 A;  1K5M A;  1PVC 2;  2CL2 A;  4UAP A;  1UU4 A;  1UMZ A;  4NMI A;  3PVE A;  5B4X A;  4YVW C;  2GAU A;  1UOB A;  5HV4 A;  3U37 A;  1FMD 2;  4B4Q A;  4XAA A;  1FAT A;  1KIT A;  3WDT A;  1Q3E A;  1NY7 2;  1OD5 A;  3CJI A;  1UIK A;  1OLM E;  2D97 A;  3PUA A;  1VBC 3;  2LRO A;  4FPF A;  2H6B A;  3GYD A;  4GMP 1;  4NO4 A;  3WW2 A;  1VBE 3;  5C3O A;  1UY0 A;  1YI7 A;  2VXJ A;  3NNG A;  3H1Y A;  4B4P A;  1IGO A;  1NAE A;  1VBA 1;  2E63 A;  2VNV A;  2Y0O A;  3USS A;  5FDB A;  1PM4 A;  3NNL A;  4BZ4 A;  1MS0 A;  4B1L A;  4CDX A;  4RGK A;  1FPN 1;  1JI6 A;  2CGO A;  4U2A A;  3CMG A;  3PJQ A;  3NVC A;  5G05 L;  4XUR A;  5SV5 A;  2JEC A;  2XDV A;  3U11 A;  1OH4 A;  2JDZ A;  4QPI B;  5A7S A;  5IVE A;  4E2S A;  4N9I A;  5F8P A;  1EPZ A;  4A7K A;  2ZCW A;  2O14 A;  3JD7 3;  2WNU B;  2ZEW A;  3N9N A;  4CDW B;  4CDX C;  1O5U A;  4OUE A;  3RMY A;  4MUV A;  1LU2 A;  2Y6K A;  4IEW A;  2Y26 A;  2OII A;  3NJX A;  1UOJ A;  5GLV A;  1RVF 3;  1RUC 3;  1HV0 A;  3RI8 A;  5F7U A;  2DFC A;  3B93 A;  4BIF A;  5I8T A;  3T08 A;  3K4D A;  5HPO A;  4IEZ A;  2BFU L;  1DLL A;  4UF0 B;  5IK5 A;  2ARA A;  1PNF A;  1OKQ A;  3J8F 2;  5K0U A;  1QH7 A;  1UO9 A;  4LK7 A;  4Q0U A;  4BWO A;  1CN1 A;  4TLG A;  1ZM1 A;  2VUA A;  1BJQ A;  3MID A;  3RS6 A;  3TYJ A;  2X29 A;  1EV1 2;  4CYD A;  5LBB A;  3P1I A;  4CU6 A;  3W58 A;  1GZW A;  1NQJ A;  4LO7 A;  2OXB A;  1PNG A;  5IJR A;  2ET1 A;  4Q0Q A;  5H9S A;  1DZT A;  2JG8 C;  5FQ0 B;  4B7K A;  2WWS A;  3THD A;  1OPM A;  1PO1 1;  2XXZ A;  3PMS A;  4IUG A;  1N3P A;  5FZ7 A;  1O5L A;  3ILR A;  5FRA A;  3VHN A;  5LA1 A;  2VD7 A;  5LBF A;  4QKN A;  2D3P A;  2RVA A;  1GWK A;  3N7M A;  4GJZ A;  5K4L A;  2YG0 A;  5A80 A;  1JW6 A;  3LB9 A;  4FFG A;  5JZG A;  3SNM A;  4KGG A;  4RFR B;  3H8U A;  3M2M A;  2DVB A;  4XXP A;  3I59 A;  2P37 A;  2YC2 A;  1YQ5 A;  3O1S A;  4YNI A;  1ZRE A;  2C0Z A;  3LSE A;  3QBQ A;  3RWK X;  5A3P A;  2XQR A;  4OCT A;  1D7P M;  1AJO A;  3U0Z A;  3CQO A;  4LKS A;  2YXS A;  5EYX A;  2D44 A;  4PI2 A;  5CKQ A;  1PMI A;  3LD8 A;  4AI1 A;  5IYY A;  2HWC 2;  1UU5 A;  4DRR A;  4LBJ A;  1OA4 A;  2XJU A;  3GZE A;  5F9T A;  4P9I A;  4EZH A;  3W9A A;  2JDA A;  4B8E A;  4DIQ A;  1XB9 A;  2XR4 A;  4IQP A;  4C8D A;  2HKX A;  3ALQ A;  1WGP A;  3M3E A;  2IWG B;  4NHM A;  2XVL A;  3I54 A;  4WVZ A;  2R04 2;  1G6N A;  4XFA A;  4CDW C;  5I91 A;  1ENX A;  1LUL A;  4R9D A;  1RUH 2;  2QZ3 A;  3JBG 3;  4N8M A;  2HEY F;  4Z07 A;  2FDH A;  1RTV A;  3POF A;  4MSV A;  5FZ4 A;  2VW1 A;  1SBF A;  3U07 A;  2XL9 A;  3JD7 2;  3KB5 A;  3LQC A;  4AI0 A;  4OI0 A;  2VOV A;  2JXA A;  1V70 A;  2RS3 1;  1ALY A;  3S57 A;  4KWJ A;  4BPZ A;  2V73 A;  4ARX A;  1H2L A;  5C7G A;  1AXK A;  4D69 A;  3OGG A;  4MG2 A;  2VE1 A;  1W2A X;  4I0A A;  3ST7 A;  2W9X A;  1OLQ A;  1DQ1 A;  1J3R A;  4LKF A;  3CDZ B;  5AVA A;  3PL0 A;  1IOA A;  1IZ3 A;  4E8C A;  4A7Z A;  2KA3 A;  4YZ2 A;  2XUE A;  5GZC A;  1ZBE 1;  1WW4 A;  4PIX A;  2HEV F;  2RM2 1;  3DCQ A;  2QZ2 A;  2PHL A;  1H4G A;  2A7A A;  1UOG A;  1JN2 P;  1JYC A;  1WCS A;  5DG2 A;  3H7Y A;  1CAX B;  1XNB A;  2WO7 A;  3MHZ A;  3DN7 A;  1FT9 A;  4HFS A;  4P9Y A;  3WVJ A;  5JIA A;  4EN7 B;  1ZRD A;  1QJU 1;  5L9R A;  3U75 A;  2W91 A;  2OYZ A;  4M3C A;  1DGW X;  5DN2 A;  1MR5 A;  1XC6 A;  4YPJ A;  2VQU A;  2RMU 3;  1S55 A;  2JDH A;  5T5J A;  4ZY9 A;  1V6M A;  4W50 A;  4QX8 A;  1DP0 A;  3VDA A;  3MLJ A;  2XJS A;  1UYZ A;  4R9A A;  4AQS A;  3ZDV A;  1W28 A;  3M3C A;  3M8L A;  4DB5 A;  3H9A A;  1YFY A;  4I09 A;  1W3X A;  1TMF 1;  2C1F A;  5CFD B;  4QX3 A;  3C8X A;  3GBG A;  5JDB A;  3MF6 A;  5FY4 A;  1VRB A;  3BB6 A;  4LR4 A;  4UFK A;  1WBL A;  2CSG A;  2W47 A;  2VO5 A;  2Q4S A;  4D7T A;  1C8M 3;  3K3O A;  1NQD A;  2TNF A;  1NUK A;  2MPF A;  1QIQ A;  3O0W A;  4LJH A;  4Q4V 1;  3KV6 A;  2BJS A;  1ULP A;  2D40 A;  3QLQ A;  2CAU A;  3FFZ A;  2RDQ A;  5T5L A;  5F37 A;  1NLQ A;  2CTV A;  2PAM A;  3CF6 E;  4DO0 A;  1UW8 A;  2RS5 3;  1RUE 3;  4QMA A;  2J1E A;  3ZX7 A;  2JB4 A;  2XGX A;  5FMO L;  1GFF 2;  1ND3 B;  2PLV 2;  4XBL A;  3T2P A;  4AYU A;  2GAL A;  4IV3 A;  1NCQ C;  2V4V A;  1Q8S A;  1UYX A;  5H9P A;  4ZHN A;  4M00 A;  5FPZ A;  3EQE A;  4KU7 A;  1US2 A;  4PF5 A;  3DKW A;  1YO8 A;  1RUC 1;  1RVF 1;  3ZOI A;  1A78 A;  4J25 A;  4AEM A;  3BTZ A;  2VGD A;  4XOG A;  3FHQ A;  4YZ1 A;  3LFI A;  4QX0 A;  1UYP A;  2ZJC A;  3CJX A;  5I8S A;  2HH9 A;  3IDE A;  4R9B A;  1JOP A;  3C7E A;  4LHK A;  4ZXE A;  4C1X A;  1W03 A;  1YEW A;  5KHH A;  1Z78 A;  3POY A;  4LEJ A;  2Q5T A;  4DIN B;  2YBK A;  1DLC A;  3V65 A;  3AKR A;  2ZX4 A;  2HWC 3;  1DYO A;  2V5Y A;  3THP A;  4YLZ A;  1CX1 A;  2A6Y A;  2BBV A;  2VJX A;  5AFE A;  2WR9 A;  4NHX A;  4RSU A;  5EJ1 B;  2WNE A;  4LUK A;  2A6W A;  1UYY A;  5A32 A;  4JHT A;  2VOX A;  1ULO A;  4NJ4 A;  1OA3 A;  1ENR A;  3HNM A;  1LAJ A;  1AYN 2;  1CON A;  1O59 A;  2DTW A;  3NKG A;  5DUX A;  3R05 A;  3O1P A;  4I30 A;  5FO9 B;  4XUQ A;  4I3P A;  4NWV A;  3D6E A;  1LEM A;  2JD9 A;  4QWN A;  5FY9 A;  5GLW A;  1KS4 A;  1QJY 3;  3V0B A;  1IS6 A;  5GZG A;  1G9D A;  2D98 A;  3AVR A;  3V0B B;  3PUH A;  5FYI A;  4GH4 A;  1UCX A;  3PUS A;  4WM8 B;  2C24 A;  2JIJ A;  4I2O A;  4LXL A;  1KJR A;  4R8H A;  1GOH A;  2ZGS A;  3R0R A;  4LPL A;  1OA2 A;  3FUO A;  3ZN4 A;  4QPG A;  1VMH A;  2DCZ A;  3T30 A;  4K1Z A;  3NRU A;  3QH6 A;  1AHS A;  4RGA A;  2ARB A;  3MO4 A;  4FBF A;  3M7A A;  1H9W A;  2AYH A;  4XHB A;  3DL3 A;  4XQ4 A;  4C0B A;  1STM A;  4A4A A;  1E57 A;  4QGN A;  5C3Q A;  1FXZ A;  4Z1V A;  4JC1 A;  4XCA A;  1V00 A;  2BDR A;  4DQA A;  3IKW A;  5H9Q A;  4LUL A;  4UFJ A;  4XBQ A;  3WF3 A;  1G86 A;  1PMJ X;  1EV1 1;  4CEW C;  3V0A B;  4XFG A;  3N9M A;  4D8M A;  5FYV A;  1A6C A;  5IVC A;  4BQW A;  2PYT A;  3WD5 A;  3VKF C;  1F4A A;  3I8T A;  5JSO A;  1K45 A;  1LCL A;  2ZBJ A;  1QJX 2;  4YW1 A;  1BBT 1;  4R9C A;  3HBK A;  5C3R A;  1BMV 2;  4AED C;  3UYJ A;  3WX5 A;  3J7M A;  2BWC A;  1A8M A;  1T2X A;  4ZS3 A;  4YG0 A;  2OT7 A;  2NZ9 A;  3EO6 A;  3AKS A;  4QPW A;  1W9F A;  2IFR A;  4FT8 A;  1ZZ8 A;  5FZE A;  3OB8 A;  3BPZ A;  1GQP A;  4ATE A;  4AVA A;  4FI9 A;  1ZRC A;  1RED A;  2HWB 3;  1DGL A;  4AFB A;  3OD0 A;  1W04 A;  3ZFG C;  4QM9 A;  3PIJ A;  2BTV C;  1O6U A;  3VZL A;  4E4Z A;  1CGP A;  3T4V A;  3WQ1 A;  5EQU A;  5LY2 A;  3I2F A;  4EN9 B;  2WBK A;  1UPS A;  1W2T A;  2YV8 A;  2BOJ A;  2R7E B;  3GZA A;  3GJA A;  1C1L A;  4QKD A;  4XBN A;  4Z2W A;  2BWA A;  1JBC A;  4D0Q A;  2MEV 1;  2DBI A;  2QQM A;  1LJ7 A;  4CSW A;  3AZW A;  5F2S A;  4FPL A;  1REE A;  3HR9 A;  1UY1 A;  1Z7S 2;  4WVM B;  4O9E A;  2BNO A;  4DXT A;  1AR6 3;  3K4A A;  3RG0 A;  4DFS A;  2VAU A;  1D0G A;  5BPX A;  3J7N A;  3BU7 A;  3OJB A;  2A71 A;  4XF0 A;  4IEX A;  4BU2 A;  2EAK A;  4WM8 C;  1RUF 2;  4CXY A;  4XEZ A;  4PIY A;  1S0J A;  2FCT A;  5BNP C;  4RYD A;  1TME 2;  1WCU A;  3ZMO A;  4E4D X;  5BNO C;  5LA9 A;  1IQD C;  1ND2 B;  2XL7 A;  2EVX A;  3ZM8 A;  4JRA A;  4QQP A;  2Q0A A;  3H3U A;  1QJE A;  1PZ9 A;  3ZPO A;  4AHZ A;  3O14 A;  5LBE A;  1LHN A;  3KMH A;  3T2T A;  5DZG A;  3ACF A;  1R1A 1;  1W2U A;  1W0N A;  4QT6 A;  4CEW B;  2ZX1 A;  4LHS A;  5JIU A;  3T2Q A;  2G9Z A;  1LGN A;  1PO1 2;  2PQS A;  1R64 A;  1H8T C;  4UW3 A;  3MUZ 1;  2QQO A;  5LAS A;  2VZO A;  1V6L A;  3FC0 A;  5F3C A;  3LEM A;  4HMZ A;  2YBS A;  2B42 B;  3OBT A;  4GB3 2;  2JG8 A;  4NRQ A;  2F17 A;  2FD8 A;  3G6J B;  3PVB B;  4ZZ8 A;  3ETP A;  1F8V A;  2WAA A;  3I3E A;  4HSJ A;  3UGH A;  1GMM A;  5BNO A;  4MHU A;  1QNY A;  2Q8E A;  4UOJ A;  5LK5 A;  2UWB A;  1OFS A;  3FLT A;  1VMF A;  4LLF A;  2RJ2 A;  4M0H A;  5D8A A;  1JHJ A;  3MIC A;  4AI8 A;  2R1D A;  4SLI A;  3N7J A;  1CZT A;  1B35 C;  2WQ8 A;  3I2G A;  1OQD A;  4Q4W 3;  2VZ1 A;  5FXW A;  4RQP A;  2HBT A;  5K0U C;  3NJV A;  4ITC A;  5FZL A;  1VBA 2;  4OUM A;  4FFI A;  4FOW A;  3ZYI B;  3ME2 A;  5A6Q A;  1X8E A;  1SPP A;  2R49 A;  5J7M A;  2D6O X;  5FY0 A;  1IKQ A;  5BUV A;  2Z2S B;  1YQC A;  1S0E A;  2XON A;  4YFZ A;  1NOV A;  2V72 A;  5JOW A;  2OQ7 A;  2W87 A;  4Q27 A;  1MVQ A;  2WS9 3;  3R4D B;  3PME A;  4FQZ A;  4KGQ A;  1JYX A;  4IEV A;  2FDJ A;  2R04 3;  1XJA A;  4JGZ A;  1UIJ A;  2C5D A;  3S5A A;  4L99 A;  3DEC A;  4RS5 B;  5JSR A;  4DY3 A;  1HN0 A;  2GDF A;  1U5Z A;  1UY2 A;  2YFU A;  4IET A;  1XE0 A;  4HKO A;  3J7H A;  4JQT A;  1DDL A;  5BNP B;  3DEM A;  4XDO A;  1EAH 3;  1O4T A;  1VIW B;  2DF7 A;  4DXZ A;  4I0W B;  1ND2 C;  2ZGP A;  4N43 B;  1NXM A;  3NKT A;  2ZZQ A;  4HVQ A;  1R08 1;  3FL7 A;  2JG9 A;  4DXR A;  2VUD A;  5FTT C;  1LEN A;  4OI4 A;  2FQP A;  2CGN A;  2F6B A;  2GNB A;  1QOT A;  3MV0 1;  2IXJ A;  4H3W A;  5FXV A;  1HW5 A;  3RZL A;  1S1A A;  3RDI A;  4CDU A;  5F5I A;  4TSV A;  2KD7 A;  1MZE A;  4AFD A;  3PNA A;  1AVB A;  1AR6 1;  4GMP 0;  1X7N A;  3F2Z A;  3E5U A;  5FZF A;  5JWP A;  5KXB A;  3TEZ A;  2WZ8 A;  4HKW A;  2FDF A;  1N1T A;  2PLV 3;  1WBF A;  3U1X A;  2GC2 A;  5L9V A;  1GNY A;  3WZ1 A;  1HKD A;  2IVJ A;  5IVF A;  4PQ9 A;  2QQV A;  4Y1X A;  4CCD A;  2VZQ A;  1AR9 1;  1GYK A;  3JXS A;  1X8M A;  3GJB A;  2DCK A;  3WDV A;  4Q4X 1;  5KXD A;  5BNP A;  2JDU A;  3POG A;  3KHB A;  4GJY A;  1FMD 3;  4JV4 A;  4S2H A;  5CZK A;  2XBO 3;  5KBF A;  2FBE A;  2VEC A;  2TEP A;  1UMI A;  5JOY A;  3LEI A;  1OOP C;  1LOE A;  3LKJ A;  4MVT A;  1HRV 3;  2EIB A;  1NA1 C;  2J42 A;  2R07 1;  4URT A;  4N7I A;  1IQA A;  1VR3 A;  2ZGT A;  4HSL A;  2P6H A;  1S0C A;  5K0U B;  5IK8 A;  3BOP A;  2IXI A;  1BK0 A;  3JZV A;  4YVS A;  3KGZ A;  5FOJ B;  1S0F A;  2BGC A;  4UT5 A;  5DG1 A;  5I0U A;  2EXK A;  2VR4 A;  4W6Y A;  1SPP B;  1D2Q A;  3MZH A;  3HQR A;  3BI3 A;  1COV 2;  2HWE 3;  3ROU A;  1JOJ A;  3FZ3 A;  2J22 A;  3ABZ A;  1V9U 3;  3N9L A;  3OGV A;  1OFN A;  4IE4 A;  1ASJ 1;  3HMY A;  2OZ6 A;  5FJH A;  1PM7 A;  4WM8 A;  3RZG A;  1O3T A;  2DU1 A;  1BBT 2;  2IVI B;  1Y43 B;  5LZ6 A;  4YM0 A;  3ZSK A;  3RZZ A;  3VD7 A;  4RS5 C;  2XBO 1;  1RXG A;  2H0B A;  2WNV A;  3JCI A;  2GMM A;  1EUT A;  4I02 A;  2E7A A;  3ELN A;  2HBU A;  2E32 A;  1UZW A;  2XH6 A;  4G9S B;  1QU0 A;  4N43 C;  2LAL A;  2FMY A;  5AFB A;  4XF3 A;  4MOA A;  2UYA A;  2VPV A;  2RM2 3;  3EYP A;  2QCS B;  3MW3 A;  3AP9 A;  4CPB A;  5D21 A;  4LUM A;  2WO3 A;  5FPB A;  4XAC A;  1JTZ X;  4EWD A;  2XKP A;  4R4Z A;  2YPD A;  5J98 B;  5A33 A;  3OBR A;  2BBA A;  3N36 A;  3CU7 A;  3KM5 A;  5DQ0 A;  3WF1 A;  1RUE 2;  2C4X A;  4TLF A;  3H0O A;  3ZKY A;  2UUR A;  2DU0 A;  1QJX 1;  2VMD A;  4OHW A;  2WUH A;  4JX0 A;  4BK4 A;  5FWJ A;  3CZJ A;  5A6X A;  3C7O A;  3VZM A;  4Q4Y 1;  1NG0 A;  1U5X A;  2FZ1 A;  1RUC 2;  1RVF 2;  2E6V A;  4UFM A;  4H2A A;  4XUO A;  5JPM B;  4XZU G;  3LWC A;  4CEW A;  1AL2 2;  1WMF A;  1O4Y A;  1XBF A;  1NCR C;  4IES A;  4Y1V A;  3WCS A;  2CU5 A;  4L9B A;  2W1U A;  1HJF A;  2Y8K A;  1OOP B;  4AL9 A;  2HWE 2;  2XG3 A;  5LB6 A;  2XQX A;  1NA1 B;  4ATF A;  5FZI A;  4BCU A;  4BH9 A;  5HCF A;  4QPI A;  5L9B A;  2PTM A;  3W21 A;  4PJY A;  4NHK A;  1IPJ A;  4IE5 A;  5C8W A;  1H9P A;  2PMW B;  5A7O A;  1RHI 1;  4P14 A;  5F5A A;  4AGG A;  3H8X A;  3L2Y A;  4CDQ B;  2EIE A;  5BNQ A;  1AX2 A;  2AEN A;  2VOW A;  4AVC A;  1FV2 A;  3C7F A;  4OHX A;  4QB1 A;  1OSG A;  4AF9 A;  5C4W A;  3NJY A;  1TZO A;  3AFG A;  3ZKU A;  2WN2 A;  1W6P A;  1ZVF A;  3RSJ A;  1U0A A;  4GH4 B;  3SCG A;  1RUH 3;  2I2S A;  4XDQ A;  3HAG A;  2ZGQ A;  4IW3 A;  3WG2 A;  3B7M A;  5FZO B;  1GP5 A;  1PO1 3;  2EIC A;  5C5T A;  3ZXE A;  1IS3 A;  4WZC A;  2XJV A;  3OGR A;  4YW3 A;  5A3U A;  1SCR A;  3RI9 A;  5ABJ A;  1MPX A;  1QJU 2;  1VLN A;  1BLZ A;  3QAC A;  3P3N A;  4GAL A;  1XRU A;  4XTM A;  1WCK A;  3KVA A;  5LK7 B;  3WUC A;  5F2W A;  2TBV A;  4X8P A;  4MZU A;  2BNN A;  5C9A B;  1WD3 A;  3ENR A;  1CR7 A;  3FX3 A;  4IV1 A;  4LBQ B;  3CIH A;  3N9Q A;  1VRH 3;  4GXL A;  3N35 A;  4RR3 A;  4R52 A;  3V0A A;  2QUO A;  1ZZ6 A;  3RYK A;  4QQL A;  1BYH A;  2VQA A;  1RIT A;  1RUH 1;  2B9V A;  4KH9 A;  2A1X A;  3ZYP A;  4BMB A;  1VBD 2;  4NVP A;  2DUR A;  5A33 B;  4TN7 A;  1VBD 1;  1DGW A;  3AP5 A;  2X53 S;  3J9S A;  4IDZ A;  4NN0 A;  2QQK A;  3AMN A;  4LLO A;  3N9O A;  1NCR B;  3ASI A;  4XF4 A;  5AVP A;  3WQB A;  2V5D A;  3OF1 A;  1SBE A;  4D6Q A;  1BMV 1;  4AR2 A;  2ARC A;  5J37 A;  5ANQ A;  1EUU A;  1HQN A;  4WM7 B;  5C3P A;  3IM0 A;  4Y1Z A;  3AC0 A;  1ZRI A;  4PIZ A;  1DCS A;  2D3R A;  2PAK A;  4PBP A;  1OQ1 A;  1VP6 A;  3HNB M;  4UFI A;  1W9W A;  3N4M A;  2VCB A;  3LDB A;  1DIW A;  2VUJ A;  3V56 A;  1RC6 A;  5FZ9 A;  2JDN A;  2B5H A;  3SC7 X;  3ZFE C;  4AWD A;  5E1R A;  1YI9 A;  1M4W A;  3PUQ A;  1QF3 A;  3UJQ A;  1OXC A;  1GR3 A;  1ZBA 3;  2HLE A;  4NPM A;  2HWF 1;  3OTF A;  4Y3O A;  4A42 A;  3H8R A;  4Q4Y 3;  4BQ2 A;  2GSY A;  2JB8 A;  2RR1 2;  2NPI A;  2C26 A;  1A8D A;  1NKG A;  2WZE A;  3AKQ A;  2DCT A;  1ZZ9 A;  3OGJ A;  3I2J A;  4CCO A;  4AI9 A;  4CU8 A;  3U4X A;  2R6Q A;  2RG4 A;  3BUC A;  1JZ6 A;  2HWD 3;  3DPR B;  1OKO A;  1AR8 3;  2RS1 3;  4RQP B;  4YRD A;  4YW7 A;  3PHM A;  1IS5 A;  1K5M B;  3HD8 B;  4XVH A;  3ZMN A;  1Y7B A;  3VBS C;  3ZFF A;  4BQ5 A;  1TG7 A;  3Q9O A;  1K12 A;  4XIO A;  4YGC A;  3TRS B;  5GZE A;  1H2N A;  1SAC A;  2UYB A;  4AZZ A;  3RQ0 A;  3WW3 A;  2P3I A;  5IVV A;  3WNK A;  4YM2 A;  5KHI A;  3SH5 A;  5FQ0 A;  1W9Y A;  4C0H A;  5JOX A;  3MGU A;  1QMJ A;  2EF6 A;  4HT1 T;  4E8D A;  3VBH B;  2R30 A;  5JLV A;  2CWS A;  3A4U A;  5JMO A;  2A73 B;  1QDC A;  4HXC A;  1GNZ A;  3NST A;  2ZML A;  1VB2 A;  1V9U 1;  4IV3 B;  4UW6 A;  1JYI A;  1NCQ A;  3SXW A;  1LGC A;  3K77 A;  4FPO B;  3JD7 1;  4X6R B;  3U78 A;  4LA3 A;  2K9Z A;  3G7D A;  5FY7 A;  2OS2 A;  1S2B A;  1FPN 2;  3I49 A;  2DVF A;  1YIF A;  5FYC A;  4QHB A;  1KGY A;  5HXM A;  3FLR A;  1GWL A;  3SCF A;  2RS1 1;  4COU A;  2WYS A;  1LKN A;  2GC3 A;  2VVD A;  1C3H A;  1QXR A;  4MH0 E;  3E97 A;  2HWD 1;  1NY7 1;  1JH5 A;  1ZZC A;  3I2K A;  1QXJ A;  4W65 A;  5DAQ A;  3EXU A;  4K7J A;  5IFP A;  4LNV A;  4EE2 A;  3MFA A;  1FMD 1;  4A6S A;  1E5S A;  3N7K A;  1MQT A;  3T0B A;  4IXL A;  4M3C B;  1CJP A;  1AR9 3;  3VKL A;  2P3J A;  4YM3 A;  4JZR A;  4CCM A;  3VDC A;  4AVT A;  1Q8Q A;  5I8Y A;  5IVB A;  1ZBE 3;  4NR1 A;  2ZXQ A;  2ARX A;  3WNP A;  2J1T A;  2JKB A;  5BV6 A;  1YC6 1;  3DPR C;  4ZKT B;  5K8S A;  5A32 B;  3EHK A;  2R16 A;  1HLC A;  4XC9 A;  2JJ6 A;  1GIC A;  5FKB A;  3LZZ A;  3LGR A;  4QU2 A;  2A70 A;  4L8Q A;  1K5M C;  2AC1 A;  4OHY A;  4YAR A;  4E2G A;  2PHF A;  2Y6F A;  2DUQ A;  2X09 A;  2WT0 A;  2ZHL A;  3HEI A;  5FJK A;  5ERL A;  1VBB 2;  2HWB 1;  1TE1 B;  2GN3 A;  1G9B A;  2WQZ C;  4MGY E;  2IXL A;  3MIE A;  4RL7 A;  4C1W A;  2BU9 A;  2Z4F A;  5FZ6 A;  2EXJ A;  3JBG 1;  1H0B A;  4W6W A;  3AYC A;  5DDJ 3;  5FUN A;  3UJO A;  3ZIW A;  4ARY A;  2GU9 A;  2QQW A;  4Q29 A;  1H8T A;  1SFN A;  1EP0 A;  1EYB A;  1OVS A;  4ERO A;  4XYX A;  4P9J A;  2BGO A;  5BXX A;  3VHP A;  4AEJ A;  3BU0 A;  5E16 A;  3HNY M;  2UU8 A;  1LRH A;  1VRH 1;  5EYY A;  3O1T A;  1DZR A;  4OI1 A;  4NPR A;  1NX9 A;  1RJ8 A;  4YFW A;  1T6G C;  2VZP A;  5GLT A;  4H55 A;  3VD5 A;  5HCA A;  3RZM A;  1Z0H A;  4N53 B;  3DYP A;  4GB3 3;  5DDJ 1;  2RHP A;  1RMU 2;  1JZ8 A;  1HRI 1;  1SZB A;  4PCR A;  1UXZ A;  4M3C F;  2BFU S;  2VZV A;  1W6Q A;  3NV2 A;  1P8J A;  2NN8 A;  2VCA A;  4CCE A;  4TZD A;  1SHW B;  2CV6 A;  3PDQ A;  1S2K A;  2ENR A;  2VL4 A;  4LBN A;  1CD3 G;  1UU6 A;  4OUS A;  3VBO B;  5CFC A;  1CAW A;  2CDO A;  4L0P A;  5LEK A;  5GJ6 A;  1X36 A;  4ZZ5 A;  1RUJ 3;  4YZ3 A;  2WT1 A;  4CUA A;  1W6Q B;  4BLJ A;  3A22 A;  4CVU A;  3GHN A;  1CAV A;  5L7O C;  1DQ5 A;  5DZF A;  1REF A;  2ZX2 A;  2XVG A;  1LR5 A;  3KSC A;  3GF6 A;  2HWC 1;  2RDS A;  1QQP 2;  3VBF A;  2C9A A;  1RYY A;  3AJZ A;  1B35 A;  3E5X A;  2IZW A;  1RHI 3;  5DDJ 2;  1Z7S 3;  3H3L A;  1ENS A;  5EP9 A;  2R07 2;  2OQ6 A;  1KFX L;  3UT0 A;  2Z5W A;  1H1M A;  1JOB A;  3KHC A;  5T5P A;  1AYM 2;  1R09 2;  3VBH A;  4MYE A;  5L19 A;  5FP9 A;  2J1V A;  2XKO A;  3AXE A;  1E5R A;  3NW4 A;  1Q8P A;  2GZW A;  1HJG A;  2VVE A;  1PGW 1;  1FPN 3;  5A7N A;  2P4E A;  5ANN A;  4MGZ E;  1LOF C;  2WKK A;  3OGS A;  1J84 A;  1O7F A;  2QTW B;  3KGL A;  3RYR A;  3ZYH A;  2VMF A;  3AB0 A;  3BIW E;  2O8O A;  3I97 A;  3GAL A;  1HB1 A;  1PO2 2;  1XU1 A;  1GOF A;  5JI7 A;  4LBQ D;  2PHD A;  1RMU 1;  1BVP 1;  3NNF A;  3RZJ A;  5A3M A;  3ILF A;  4BJ0 A;  2RR1 1;  4PHZ A;  3ZYJ B;  4A44 A;  4OQ9 A;  4ES8 A;  1AL0 G;  1IG3 A;  3OUJ A;  1ND2 A;  4FTE A;  3PJY A;  4N53 C;  1HDK A;  4HVR A;  1FNY A;  1Q56 A;  1BHG A;  4HK8 A;  3TN9 1;  4JGZ C;  1S0G A;  3SIT A;  4MHR A;  4AQ2 A;  4GWN A;  3AYE A;  4CCL A;  2YZ4 A;  1GQH A;  3B9I A;  4PDW B;  5F3G A;  1VAL A;  3K2O A;  2XOM A;  1J1T A;  2Q1M A;  3NMB A;  1RB8 G;  1ODM A;  5C5U A;  3S6P A;  5IK7 A;  1GLH A;  1EAH 2;  2G9G A;  3ACG A;  4B1M A;  4CU9 A;  4CUB A;  2FDK A;  4B7E A;  3SKJ E;  1PGS A;  1YNA A;  3O7O A;  1VE0 A;  1QQP 1;  4LO6 B;  5L7O B;  1NLR A;  1BKZ A;  3KQR A;  4HVO A;  5FXZ A;  2FDI A;  5FZG A;  1HRI 2;  3AMM A;  2WA4 A;  2YGM A;  4AGR A;  1SLT A;  4UI9 L;  4HON A;  3ZSL A;  2OPK A;  3AL6 A;  1KJL A;  2Q1Z B;  1GAN A;  2K0G A;  2B9U A;  3U14 A;  3KF5 A;  4LBM A;  3T1M A;  4PT6 A;  1HXS 2;  2QJV A;  2XJT A;  2Y38 A;  1Y9M A;  4CXW A;  1UKG A;  2MEV 2;  3N3H A;  2D7F A;  3RWN A;  3J8F 3;  2O0O A;  1UZZ A;  4MGQ A;  3ACL A;  4CXX A;  2E9Q A;  4EWE A;  1N1S A;  2WWU A;  1BCX A;  4ONU A;  3BKZ A;  2WO1 A;  2R07 3;  1IPK A;  5APA A;  3ZXL A;  1PIV 2;  5FV3 A;  4AED A;  1PZ8 A;  1GSL A;  1C57 A;  1VJ2 A;  5FO7 B;  3ZSJ A;  1WMX A;  2VZ3 A;  2RS3 3;  3KVB A;  2HWB 2;  4E4S A;  2NM1 A;  2LTN A;  2WZR 1;  4V2W A;  1HRV 2;  1YFU A;  2B8M A;  2GND A;  2TUN A;  5FLH A;  4ZS2 A;  5L36 A;  2FZ2 A;  4AEK A;  1OLR A;  1Y9G A;  3ZXK A;  2ZAA A;  3ZSE A;  4U36 A;  1XNA A;  1DHK B;  2Q8C A;  4E2Q A;  1QWR A;  2EAA A;  3VDD C;  4J6G A;  2JEM A;  3D4K A;  3INA A;  1RUG 2;  2X5I A;  1QJX 3;  5DAV A;  4DPN A;  1QH6 A;  1HV1 A;  1OF4 A;  3BTX A;  2ET7 A;  4BIO A;  5LEJ A;  3E5Q A;  4XFB A;  1PX3 A;  4BQ4 A;  5C71 A;  4RHV 2;  4XFC A;  4JDO A;  2E7T A;  4PDW C;  5IK4 A;  2PEL A;  3LIH A;  3OY8 A;  2VCC A;  4ASK A;  2W52 A;  2QE3 A;  2BPA 2;  1FNZ A;  1C5I A;  3A21 A;  4HPK A;  3MF9 A;  3L9J T;  4COY A;  1PGL 1;  1MEC 3;  1RUI 2;  1WME A;  2A75 A;  3ON7 A;  1AZD A;  2BEO A;  3DYM A;  1GBG A;  2V09 A;  3FE5 A;  1VBC 1;  4OYU A;  1MQT C;  1VMJ A;  4D7S A;  4AHW A;  4GA9 A;  1PVC 3;  1K5J A;  1I5Z A;  3E6C C;  1Q8O A;  4M3C E;  5EV7 A;  2WNU C;  3ZYF A;  4CDX B;  1C8N A;  5CKN A;  1C4R A;  1KXG A;  2BOI A;  1H8V A;  1CQ9 A;  2KXL A;  2VM9 A;  4IND A;  3ZFG A;  3IIA A;  4PBO A;  1ENQ A;  2KR2 A;  4CCJ A;  4LKE A;  4JDN A;  2J7M A;  3AJY A;  1CPN A;  3KQ4 B;  1JU3 A;  1MS9 A;  2XML A;  4Q4W 1;  3TNP B;  2P34 A;  2WFP A;  3CNA A;  3QCW A;  1TVG A;  1PIV 3;  2W46 A;  4FQ4 A;  3WY6 A;  2ETE A;  3CKH A;  2JIC A;  3VBU A;  1QGL A;  5CEH A;  2QNK A;  1RIR A;  3UV9 A;  4OHZ A;  5KR7 A;  4FP2 A;  3WDY A;  3KCY A;  3NJZ A;  2WFF 2;  4HKL A;  2ZS6 B;  3FWE A;  4AI3 A;  4F7Z A;  4YSF A;  1ST8 A;  3AZX A;  3VGI A;  2IXC A;  4CUG A;  3KD4 A;  3VZN A;  1BK1 A;  3RPQ A;  4AI2 A;  4PLO A;  4YW5 A;  1ULD A;  3VBU C;  4E4H A;  4O61 A;  5C8C B;  1XE8 A;  1YJL A;  3LOB A;  1RIN A;  1MEC 1;  2YYO A;  5FYB A;  3VDD B;  3ZN6 A;  2NP0 A;  5A1L A;  3LIG A;  1R1A 3;  5E6H A;  1ASJ 2;  1W8F A;  3O5S A;  4FFH A;  1YFX A;  4CP9 A;  4RHV 3;  4EN6 B;  2PXJ A;  2R06 3;  2ZHM A;  3AYA A;  1HQW A;  1SG3 A;  3ACI A;  1D0H A;  1LHW A;  3VKO A;  3LDR A;  2XUM A;  4Y24 A;  1R08 3;  1RUD 1;  2DVG A;  3WQ7 A;  4G4F A;  4QKF A;  2UY9 A;  5DUW A;  3VBF B;  3ZXF A;  1MAC A;  2NQY A;  3SIS A;  3RNS A;  1RMU 3;  3TEY A;  5CB7 A;  1FOD 1;  3IMM A;  4YG3 A;  3RZK A;  1WW6 A;  1YJK A;  1AF9 A;  2FHR A;  2LRP A;  4K9S A;  1IG0 A;  4XHX A;  4IE6 A;  1MQT B;  5E89 A;  5JXI A;  1OUX A;  1GP6 A;  2OPW A;  4NWW A;  4BHP A;  1ZRF A;  1W9T A;  3OY8 B;  5KXE A;  3MIB A;  1YCI A;  4S2F A;  2WQ4 A;  3UKN A;  3U4S A;  2W1S A;  3FFQ A;  1T6B X;  1V6K A;  4FPY A;  2ZGO A;  1I5P A;  2Y0I A;  5FMD A;  4C90 A;  4AK3 A;  4OI2 A;  3K3N A;  5J48 A;  1AYN 1;  3NV4 A;  5DAW A;  2BW8 A;  3QOP A;  5C3S A;  2NLR A;  1TEI A;  2Y6H A;  3KCX A;  4EN0 A;  4BQY A;  4AVB A;  2RDN A;  2HWE 1;  1VBB 3;  5G04 L;  5CAD A;  1IHM A;  4FPG A;  5FZ8 A;  1AL2 1;  2WAO A;  3ES1 A;  4WVW A;  5DAB A;  2WC2 A;  3APB A;  2PHW A;  3W20 A;  4P5H A;  2CY6 A;  4IV1 C;  1AR8 2;  1X9T A;  1W06 A;  4QHO A;  4XJ8 A;  4COW A;  2GMP A;  2VH9 A;  4CPB D;  4LO8 A;  5FFO C;  3WW1 A;  3IBM A;  4DXS A;  3Q8F A;  5CIR A;  3WQ0 A;  2D93 A;  2OZJ A;  2P5B A;  2RV9 A;  3KWV A;  3WG1 A;  4EQV A;  1D4M 1;  4TWT A;  3WNO A;  1A3K A;  2HYK A;  5KWR A;  1QQP 3;  5JPN B;  4NIA A;  3I3D A;  1CAU A;  4OVE A;  4XFF A;  4LIV A;  4EWA A;  5JAX A;  4IL7 A;  4G3Y C;  2BUK A;  1GZC A;  3ZXG A;  1GU3 A;  4K6B A;  2VVF A;  4CDU B;  3AKT A;  4Q0S A;  3KV4 A;  4Y1Y A;  3KT4 A;  3TN9 2;  1KS5 A;  4XUT A;  3IDB B;  4XE9 A;  1ODN A;  4BME A;  5CVR A;  2E31 A;  4YW4 A;  3K4Z A;  2JG9 B;  4YG6 A;  1YFW A;  4PQQ A;  1AYN 3;  1SMV A;  4Q0P A;  1WZX A;  4XJW A;  4KU8 A;  2A3X A;  5EZW A;  3KCC A;  3VBF C;  5F5C A;  3ZN5 A;  2VTX J;  3O0V A;  2VTF A;  2XLF A;  2CDP A;  3KT7 A;  3VV1 A;  2ZAH A;  1YWK A;  1CPM A;  4V1P A;  4LK6 A;  3WG4 A;  2Z69 A;  4PF1 A;  1E5H A;  5T52 A;  2ZKL A;  3P3P A;  4BXS V;  2ZKN A;  5FMO S;  1FI2 A;  2PLV 1;  2UWA A;  3HQU A;  4UYB A;  4Y1U A;  3UGG A;  5DUV A;  3OUH A;  3ZO0 B;  4EN8 B;  5LCW L;  4PDW A;  1LU1 A;  4W6X A;  1LEC A;  3AP4 A;  2PAE A;  5FLI A;  1O8P A;  5JZG C;  4FOY A;  4AHX A;  2LW8 A;  1JU4 A;  1CZV A;  1LTE A;  3ETQ A;  3KF3 A;  4AAX A;  1JYV A;  4LOS A;  1S2E A;  1PX4 A;  3UET A;  1DQ0 A;  1DG6 A;  1G8W A;  1QY4 A;  4RHV 1;  1WW7 A;  4XJA A;  1ND3 C;  2EIG A;  3WP5 A;  2QBX A;  2VG9 A;  3E1F 1;  1RHI 2;  3ZR5 A;  4Z8B A;  1NCR A;  4LA2 A;  1R1A 2;  1UMH A;  3JQX A;  4HK9 A;  4YVW A;  5F39 A;  1K42 A;  3H1W A;  2W92 A;  2QDN A;  4MET A;  2WLP A;  3HQX A;  4HAN A;  2BER A;  1GWM A;  5I0T A;  1Y3T A;  1R09 1;  2RM2 2;  4MGS A;  3D82 A;  2JG8 B;  4A3X A;  1O3Q A;  2B46 X;  1XU2 A;  5FY1 A;  1UL9 A;  4JKK A;  2CGP A;  1DU3 D;  1SFP A;  3JU9 A;  1KQR A;  3JUU A;  3ACH A;  2B4K A;  2J1U A;  2VMI A;  2Q8O A;  2X05 A;  2LUW A;  2QVS B;  3BTA A;  5A6Z A;  4N7U A;  5IT6 A;  4Q8L A;  4Y33 A;  2VU9 A;  1BVV A;  3HT1 A;  4QGM A;  1U5Y A;  4UW5 A;  5A7P A;  4CDU C;  3PUR A;  1PIV 1;  1AXY A;  1MEC 2;  1RUI 3;  2R0F A;  1RXF A;  2VQT A;  3THC A;  5JUV A;  4Q4X 2;  2RS5 1;  1UY4 A;  2JG9 C;  4Y4R A;  2X10 A;  1QOO A;  3VBR A;  1DBN A;  3WNX A;  1O4Z A;  1RUE 1;  3CZU A;  5ACA 2;  4XMI A;  2GNM A;  3M4F A;  1C8M 1;  2IXK A;  4X6Q B;  3THT A;  1YYN A;  4IEO A;  4QXH A;  2ZZJ A;  2ZEX A;  2XLG A;  5LAT A;  4XMA A;  3SQO A;  3D0J A;  5A1A A;  2HEW F;  1DYK A;  3PU3 A;  1GZT A;  5JVV A;  5KC5 A;  4K21 A;  4JGZ B;  4AG4 A;  4Z2A A;  5JOZ A;  1URX A;  2R1B A;  1OMI A;  4GKY A;  3WLU A;  1K3I A;  2WN3 A;  5HBA A;  4K8F A;  1F35 A;  2VBD A;  4GB3 1;  1KD7 A;  2CWM A;  4NIH A;  2JIG A;  4KG8 A;  2YU2 A;  3IZO A;  3NNJ A;  2ZGM A;  1GV9 A;  4JHZ A;  5B2G B;  4QM8 A;  1OQE A;  4DMI A;  4AW7 A;  5JZG B;  5EPA A;  2PHU A;  4N53 A;  5ACA 1;  2Y34 A;  4NAM A;  1Y9Q A;  1BZW A;  5LRR A;  2EA7 A;  1W99 A;  2Y6G A;  1JHN A;  4XF9 A;  5KHJ A;  2D6M A;  2V4A A;  5CG8 A;  2ID4 A;  4XAE A;  5FRE A;  4QU1 A;  2VMC A;  3HWJ A;  3O1U A;  4KI5 M;  5JMC A;  4P00 B;  1AYM 1;  1WD4 A;  2LS6 A;  2FCU A;  2YU1 A;  4KNC A;  4NAO A;  2Q8D A;  1D2S A;  1IPS A;  4W4Z A;  1NZI A;  4M4R A;  2A3Y A;  1I9R A;  5FZK A;  4AED B;  2J1R A;  4FVV A;  1GZW B;  2SLI A;  4Z82 A;  2PQQ A;  2PHR A;  1LNS A;  1UY3 A;  4GMP 3;  2WS9 1;  3TBD A;  3WV6 A;  1JYN A;  3OEB A;  3MUY 1;  4YZ4 A;  3TNQ A;  2X8K A;  4P9W A;  3OPW A;  3I3Q A;  4KL1 A;  4AFC A;  2QQN A;  4CA9 A;  2OKX A;  4KWL A;  3H42 B;  1LB2 A;  3EJK A;  4NIG A;  4BQX A;  4FO9 A;  1DQ6 A;  2VZT A;  1ULG A;  5C6C A;  1KRI A;  3CL1 A;  2JX9 A;  1J1L A;  4NRP A;  2OW4 A;  3J8F 1;  4KG0 A;  1A34 A;  3IAP A;  1WKY A;  3AZY A;  3DPR A;  1PK6 A;  3B00 A;  3GCX A;  3Q8B A;  3LA7 A;  5JR2 A;  4IGO A;  5ACA 3;  4H7M A;  2VME A;  3VD4 A;  5L7O A;  3H50 A;  4CEY A;  1WCQ A;  2WII B;  1OH3 A;  3EBR A;  4N9H A;  1JZ5 A;  1F31 A;  3AFK A;  4QQ2 A;  1W90 A;  4XCB A;  4P9G A;  3SEP A;  2W3J A;  5FZO A;  3AL5 A;  3WSO A;  3PUI A;  3WNM A;  2RJK A;  2WT2 A;  5LA2 A;  5EIY B;  3QH7 A;  4F8A A;  1JUH A;  4NRO A;  5FOB B;  3OCP A;  4COZ A;  5CFC C;  4HPK B;  3T09 A;  3NV1 A;  3D0S A;  1S0I A;  1N3O A;  2VTX A;  1XOY A;  1F5F A;  2YC0 A;  4RA0 A;  3KZ4 C;  3RYP A;  4AFA A;  5BNN A;  3FHI B;  5CFD C;  2XJP A;  4DOU A;  1I3H A;  1EPW A;  1ZNP A;  1GP4 A;  3JB8 A;  3BGA A;  4Y5T A;  3DV8 A;  3AZZ A;  4CCN A;  2ZMK A;  4LHN A;  3O0X A;  4LMF A;  5CYY A;  5A3W A;  5FR3 A;  1RUF 3;  2XPJ A;  5FZ0 A;  2W1Q A;  3W5M A;  4HL0 A;  3N9P A;  4SBV A;  2BRT A;  5BNO B;  3USU B;  1TNR A;  3UKV A;  4HN1 A;  1W2O A;  1CAU B;  2OVU A;  4QQH A;  1G9A A;  2GP3 A;  4JCK A;  4KBZ A;  4PLN A;  5F3E A;  2Y64 A;  4CP1 A;  1OUR A;  1QJY 1;  3SHR A;  1NCQ B;  5EXO A;  3UKT A;  3VKM A;  4LO4 B;  1PZ7 A;  4GKX A;  4FPH A;  3AM2 A;  3UNP A;  1U5I A;  4UFL A;  4IE7 A;  4HLT A;  3OBZ A;  4DZG A;  3POI A;  5FAX A;  4WV8 A;  3M3Q A;  4FFF A;  1H8T B;  3DXU A;  1W8N A;  3J26 N;  1OBN A;  1C1F A;  1PO2 3;  4QX2 A;  3H1M A;  5KC6 A;  4QQO A;  3HN1 A;  2BNM A;  3AMP A;  4B29 A;  4CP2 A;  1SBD A;  4CP0 A;  2OA2 A;  3ZFF B;  2YMZ A;  3KS7 A;  1LHU A;  4NHY A;  2JE7 A;  1TME 1;  4NRM A;  3W5N A;  3O12 A;  4UXA A;  3BOW A;  1R09 3;  1W8U A;  3IPV A;  3OPZ A;  4GWM A;  1MS4 A;  1FOD 2;  1HN1 A;  1ND3 A;  1UWW A;  3ZXJ A;  4ET7 A;  3DUI A;  4FPJ A;  5F6L B;  5CA6 A;  1LOG A;  5K9Y A;  3OG2 A;  5FO8 B;  1RUG 3;  3IAQ A;  3MPP G;  3E6D A;  4GWJ A;  4IGQ A;  5D1I A;  5LA0 A;  5LY1 A;  1CJD A;  1AYM 3;  2DDU A;  1BQP A;  3WF2 A;  4AHY A;  1ULC A;  5CFC B;  1ZZB A;  2OUH A;  3FBM A;  3MBW A;  4DEV A;  4BOW A;  3I4I A;  3UK9 A;  2E33 A;  5FMB A;  1MZF A;  2Y6J A;  1AR7 1;  1X33 A;  3DGT A;  5CBL A;  1BBT 3;  4GAZ A;  5GZF A;  2B7Y A;  3LOI A;  3VZO A;  4COV A;  2DTY A;  2E7Q A;  2YHJ A;  1F15 A;  1OVP A;  1QDO A;  1ZA7 A;  3FN9 A;  2H0V A;  3LSD A;  3OUI A;  3SEE A;  4LT5 A;  1ZZ7 A;  4XZP A;  5EJZ B;  2PHX A;  3WNN A;  1V6J A;  2JEN A;  1NT0 A;  4CTE A;  5M0T A;  5IHR A;  4W8J A;  4DUX A;  4JRL A;  1QJZ A;  2MEV 3;  4IEU A;  1UX7 A;  5I93 A;  2ZX0 A;  4MGT A;  3LPG A;  5A3N A;  3I2H A;  3WW4 A;  1WMD A;  1ZX5 A;  1KEX A;  4MGK E;  4Y22 B;  2W2I A;  3TB0 A;  1QOS A;  3M1H A;  4DUW A;  3VN4 A;  4FAH A;  2GH8 A;  4IEQ A;  5LWB A;  5CG9 A;  2HJI A;  3WUD A;  1NYW A;  5IVY A;  2RMU 1;  1KDM A;  3D8C A;  1HB3 A;  4D7Y A;  3DYO A;  3M70 A;  1F2N A;  3GXU A;  1WLD A;  1I6X A;  1QJU 3;  4JTN A;  1FX5 A;  4E27 A;  2J1S A;  1OF3 A;  1AR7 2;  1XSR A;  2WWJ A;  4K40 A;  1Y4W A;  3PVO A;  4FTS A;  4XET A;  1TMF 2;  2CYF A;  2G9F A;  2SBA A;  4IE0 A;  3WT3 A;  3KT1 A;  3ZFF C;  5FMC A;  3NWK A;  3ZFG B;  1ZRR A;  4S2G A;  4OZO A;  3LA2 A;  2B45 X;  1LOC A;  4LE4 A;  3S0M A;  4XIL A;  1SQ4 A;  1SEF A;  1XNC A;  4QXK A;  4BXF A;  1O8S A;  1V6N A;  5FPU A;  2WA3 A;  3BOD A;  3KLS A;  1N1V A;  1YRZ A;  1PGL 2;  4WBB A;  2ADD A;  5CKM A;  1BEV 1;  4GUL A;  1UOF A;  2DUP A;  4MV2 A;  4P9X A;  2AUY A;  3M3O A;  4LBO A;  4JQR A;  4QPG C;  4AGV A;  3ZFE A;  2JDY A;  4FP3 A;  5IAT A;  3PTR B;  3S30 A;  4CCC A;  1MS5 A;  5C4W B;  4L11 A;  4CUC A;  1W39 A;  3LFM A;  5FYZ A;  1UNB A;  4QX5 A;  4D6S A;  3SLI A;  5GM0 A;  2EXH A;  4J1W A;  2YB7 A;  5AC9 3;  3CBN A;  4Y4Y A;  1AR9 2;  4QB6 A;  1TME 3;  1QJF A;  4Y20 A;  4O65 A;  5T50 A;  2EXI A;  4QX7 A;  3B9C A;  3MLL A;  5FLJ A;  2ERF A;  1ZBE 2;  1W8W A;  1W6O B;  2RR1 3;  3WCR A;  3POJ A;  3I7D A;  4L97 A;  3CJI B;  1RUD 3;  5BY5 A;  4XTP A;  2F4L A;  1SFY A;  5CU1 A;  4F83 A;  1G9C A;  4XUP A;  3K48 A;  3ZIX A;  3B94 A;  3JQW A;  1FOD 3;  1VBA 3;  1YLL A;  3DKQ A;  1F5J A;  3PLQ A;  5HXV A;  4CZS A;  4I3G A;  1H4H A;  3R4S A;  4X8N A;  1DF0 A;  3MV1 1;  4XXA A;  4MXV A;  1HQL A;  3I3B A;  5FZD A;  4BK5 A;  1RUG 1;  2MNG A;  3WXP A;  1UPI A;  4CCK A;  5D2A A;  3C2U A;  4NHL A;  4ES9 A;  4K3U A;  1CZS A;  4BQ3 A;  2HWD 2;  1WLC A;  5FZ3 A;  1CWP A;  5C70 A;  1TMF 3;  2E53 A;  1ASJ 3;  1H1I A;  5FXX A;  4RD7 A;  1W3V A;  3MLK A;  1CIY A;  4LQR A;  1HB2 A;  2XB6 C;  1SLL A;  1HX6 A;  5J36 A;  3MFC A;  1AX1 A;  3GBF A;  4XPV A;  3WOG A;  1Q43 A;  2WDB A;  4QHZ A;  2VUL A;  4H14 A;  3GHM A;  3MEP A;  3X29 B;  2JKX A;  3D3A A;  4KQ7 A;  5KHK A;  3AP6 A;  1B35 B;  1EV1 3;  4DRV A;  2D6L X;  1XXN A;  5K7P A;  2RMU 2;  1EY2 A;  3D5O A;  1S4C A;  2WNU A;  4FOQ A;  2W39 A;  1AR8 1;  3AK0 A;  1VRH 2;  2AAC A;  3NO8 A;  4B4R A;  4JKM A;  3GBW A;  1S0D A;  1CAV B;  1XYP A;  5A7Q A;  3AXD A;  4Y20 B;  5JSP A;  2VZR A;  2P3Y A;  1M06 G;  1LHV A;  4QPG B;  3SKV A;  2P6C A;  3WIN E;  5KXC A;  3CHX A;  3ZR6 A;  5C4W C;  3LEG A;  3ZDS A;  1OLM A;  4P5Y A;  1H6Y A;  4HOO A;  4OLL A;  2VMH A;  3K51 A;  1RUI 1;  3EB7 A;  5FZB A;  3FUQ A;  1ZBA 2;  2P17 A;  4OHV A;  4BM8 A;  2W0X A;  3VD9 A;  4ISQ A;  1IKP A;  4XIK A;  5J3U A;  2DVA A;  4V2V A;  1HRV 1;  2XBO 2;  3MIF A;  3NL1 A;  3OPT A;  4K1Y A;  5AC9 2;  3ZVX A;  3AYD A;  1X82 A;  4LOR A;  3PU8 A;  3CJI C;  4ZON A;  2WIN B;  4AQ6 A;  3QD6 A;  4LBL A;  5BYN A;  3WHT A;  2X5I C;  5HCH A;  1UD1 A;  3MIH A;  3HOB A;  1DYP A;  2J1A A;  2O1Q A;  5IW0 A;  3OEA A;  4BIS A;  4XJU A;  4QDQ A;  5E88 A;  2C9K A;  2WLQ A;  2HWF 2;  3R6S A;  4E9K A;  1SDW A;  3A23 A;  4Q0V A;  2QQL A;  2OUJ A;  5CIS A;  1YUD A;  3LF7 A;  4AVV A;  1L7R A;  1CIW A;  1MZ6 A;  4WZF A;  3VKN A;  1V0A A;  1UF2 C;  1JOD A;  2I07 B;  3VHO A;  3S7E A;  2WZR 2;  3WP4 A;  3K46 A;  4XFH A;  3WNL A;  2D5H A;  1XND A;  1LOD A;  2GC1 A;  1DQ4 A;  1H6X A;  1J3P A;  1UXX X;  1VPH A;  2VBP A;  3BN6 A;  4K20 A;  4XDP A;  2WL1 A;  3OD4 A;  1UZ0 A;  5FCC A;  2ORX A;  1W8O A;  1NZC A;  1OC1 A;  2LM3 A;  4ISR A;  2WSV A;  4ASL A;  2D6K A;  3AMH A;  2PA7 A;  4RFT 0;  4PI0 A;  3RJ2 X;  1UAI A;  1HIX A;  4ZU5 A;  1HXS 1;  2PHT A;  4S2D A;  1VB4 A;  4R4X A;  3UL2 A;  3FLP A;  4FSJ A;  1E5I A;  1UN1 A;  3P5B A;  5FP8 A;  3S5Q A;  3WG3 A;  2AR6 A;  3CLP A;  1COV 1;  1CVN A;  1W6N A;  3RGB A;  1Q8V A;  1W9S A;  2B39 A;  2D5F A;  2RS5 2;  2ZEZ A;  4LHL A;  4BB3 A;  3OYW A;  5EHD A;  3HPN A;  5B4N A;  4M4P A;  4RS5 A;  4Y26 A;  5FBJ A;  2E51 A;  2VBB A;  3B01 A;  4EV0 A;  2BZD A;  2ZPX A;  4QDS A;  5GKA C;  1IS4 A;  2YRO A;  2Z42 A;  2ZA9 A;  3ATG A;  4LTA A;  4Z92 B;  2ZHN A;  4UW4 A;  5DXD A;  3I59 B;  4MGI E;  1MZ5 A;  1X50 A;  1SDD B;  2QQU A;  3H3Z A;  2DVD A;  1W6N B;  3POW A;  3GNE A;  5A3L A;  2VQ0 A;  3OSD A;  3H8O A;  4NID A;  3RFR A;  1OPO A;  1UX6 A;  4BA6 A;  4IEY A;  3N7L A;  1LHO A;  1JUI A;  3EMR A;  4XUN A;  4A3Z A;  4YM1 A;  3P6B A;  2X5I B;  3LPF A;  4YGB A;  4RQP C;  1WUV A;  2F4P A;  3KV5 A;  5SV8 A;  1PHM A;  2P1B A;  2ZTN A;  5J1X A;  2WFF 3;  4GIQ A;  2YDE A;  1CX4 A;  5F5Q A;  5IWF A;  2GP5 A;  1UKR A;  4HET A;  3L2H A;  5FPL A;  1F4H A;  2WNO A;  1W8T A;  2A5Z A;  2W94 A;  4JVA A;  1V6I A;  1W6M B;  3TEX A;  3HBZ A;  4NPL A;  4A6O A;  1DZQ A;  1TNF A;  5LW9 A;  1LOF A;  1PVX A;  4Q26 A;  4XJZ A;  1RUF 1;  3SMH A;  4FPC A;  1PMH X;  4P08 A;  3O1V A;  4XQD A;  4HBN A;  5DAX A;  3POS A;  2Q30 A;  5HI0 A;  2D3S A;  1SLB A;  3T2O A;  1AJK A;  3VBH C;  4XJ9 A;  4MAD A;  1NXD 1;  5A3O A;  3BAL A;  3BIE A;  1H1A A;  2D43 A;  1LOB A;  5A3T A;  5FYU A;  4Y22 A;  3V64 A;  2CAV A;  3IMN A;  1RUJ 2;  1KFU L;  1RJ7 A;  2ORZ A;  3ZSM A;  4KWU A;  3A7Q A;  1NE4 A;  5AC9 1;  3HJR A;  4LIU A;  2A3W A;  2AZ5 A;  2DCY A;  5GAL A;  3IN9 A;  1RUN A;  1ZBA 1;  2YUE A;  3I2I A;  2DWR A;  4GWI A;  1S0B A;  5TSW A;  3T3Y A;  1MS1 A;  4UBG A;  1W6O A;  1WW5 A;  1DGR A;  2ZAB A;  3LDK A;  1O91 A;  4QX1 A;  3PVN A;  2YPJ A;  3TAY A;  5KHG A;  3JB4 C;  3ZYR A;  4CDQ C;  2YFZ A;  4I01 A;  2RS1 2;  1POV 0;  1PGW 2;  1QHD A;  2WSU A;  3FBY A;  1JS9 A;  4Q1R A;  2R06 1;  2XWB B;  3POE A;  4FCA A;  1Z7S 1;  2R06 2;  1POQ A;  4ORF A;  1VBD 3;  2Y33 A;  3URF A;  5I0R A;  3I3M A;  1F9K A;  4GH4 C;  3GZU C;  3OYW B;  5HV0 A;  2RE9 A;  4XQW A;  2FDG A;  1N47 A;  2YC4 A;  4H7L A;  3VBR C;  1V9U 2;  3BYW A;  3JBG 2;  5FBZ A;  3M3I A;  5FYT A;  2AEZ A;  4JDM A;  3B02 A;  1MS8 A;  5EFU A;  3ZN6 B;  5J96 B;  1NA1 A;  3ILN A;  2DUO A;  4PLM A;  1PK6 C;  3Q8E A;  5FYS A;  1D4M 3;  3MPB A;  2W68 A;  5T5O A;  2BV4 A;  5FPA A;  2K2S A;  1C28 A;  5FYH A;  1VBE 1;  1GKB A;  3VB9 A;  5A1F A;  5C9A C;  1FV3 A;  5FK8 A;  2AGS A;  2HYX A;  2BGP A;  2AEY A;  3HT2 A;  2ZX3 A;  2VOK A;  3MIG A;  2NMO A;  3R4U A;  4LBK A;  1J58 A;  1JMU B;  3IDA A;  3MI8 A;  4ASM B;  1HB4 A;  1XYN A;  2JDM A;  4BE3 A;  4F3J A;  3WEZ A;  5I0D A;  5FKC A;  5JR7 B;  5GLU A;  4M01 A;  5H9R A;  1W0P A;  5JI9 A;  1ZA4 A;  1MVE A;  1QNW A;  3NAP B;  3TN9 3;  3WF4 A;  5DMY A;  1WLT A;  3F95 A;  4CE8 A;  4LKD A;  2E26 A;  1QEX A;  2QQI A;  3GDB A;  4XAB A;  1OHF A;  2VNG A;  4DNY A;  4M0N A;  4A45 A;  3ZXD A;  2IXH A;  3OOX A;  4I0B A;  1AR7 3;  5CNA A;  3W59 A;  1WLW A;  1XQN A;  3ZYG A;  1PVC 1;  2CHH A;  5ABJ B;  2DYC A;  4WM7 C;  3NV3 A;  4YGD A;  2G19 A;  1H2M A;  1V6O A;  2BVB A;  2EAL A;  2A6V A;  4JGY B;  1W0O A;  2ADE A;  1WWY A;  1YQ8 A;  2ZGL A;  2AH2 A;  4OFG A;  2NMN A;  3WP3 A;  2JDK A;  3Q8A A;  3LE0 A;  3VBO C;  4JAA A;  4QD2 A;  1AL2 3;  1ONA A;  4QGL A;  3VZJ A;  3VHR A;  3ZFE B;  1D4M 2;  2ILM A;  1UZV A;  3E6B A;  1VBB 1;  2XWJ B;  4OMC A;  5FZ1 A;  3J7L A;  5IFT A;  1Q5O A;  1BEV 2;  1NLS A;  2GN7 A;  2ZGU A;  2DBN A;  5A7W B;  4JGY A;  4UBH A;  2XHK A;  3UES A;  3Q8C A;  4YW6 A;  5FIX A;  3RZH A;  3IT8 A;  1CES A;  3DXT A;  4YVS B;  3VBR B;  2XVK A;  3VL8 A;  4WVM A;  1YQ2 A;  2WAB A;  3GZT B;  5A70 A;  4BYY A;  3LCP A;  1H30 A;  1PK6 B;  1JYW A;  5EWS A;  3TWI A;  5JXH A;  3VZK A;  3FHA A;  3IPV B;  2WZR 3;  4LO5 B;  5FP3 A;  5FY5 A;  4AOC A;  2WJS A;  5DAP A;  5JXG A;  4FAG A;  4L92 A;  4Q8K A;  1H2K A;  5F6K A;  4P9L A;  3WR0 A;  4MXW B;  3VBS B;  5LRS A;  3GCW A;  4Q4W 2;  1GOG A;  3TEW A;  3B5L B;  2NYY A;  4LE3 A;  5DZE A;  4L2N A;  1GZ9 A;  3C7G A;  5C8C A;  4MLO A;  4Q4V 3;  4RR3 B;  2C6S A;  2BYV E;  2VNR A;  2VC9 A;  1QKQ A;  3IWZ A;  5CAZ A;  2YY1 A;  2EID A;  2DV9 A;  1W2N A;  2WFF 1;  3SCH A;  3C3V A;  3J4U H;  2UY8 A;  3NAP C;  4AXO A;  2G1M A;  3BPS A;  4MXW A;  3VBS A;  1LES A;  2R32 A;  4IV3 C;  3B3Q E;  4KBB A;  4YYO A;  4TTG A;  4QB2 A;  2L9L A;  2PN5 A;  4N43 A;  3CO2 A;  5DUU A;  5IAV A;  5ABJ C;  4IER A;  3O1R A;  2DFB A;  3OBA A;  2KM2 A;  3ZLI A;  4NE9 A;  3WF0 A;  1W8H A;  2BVV A;  1YHF A;  5T54 A;  2A6Z A;  2QDR A;  2WNV B;  4JGY C;  2QKD A;  2MHF A;  1FAY A;  1WCD J;  1QXP A;  1ZYB A;  2H6C A;  5A7W A;  4D3W A;  4AQT A;  4J1X A;  1N1Y A;  3K75 B;  3PTY A;  2ZGN A;  2ES3 A;  4YZ5 A;  2WRA A;  2VCM A;  2ZGK A;  5J09 A;  3MW2 A;  1VBC 2;  3MDP A;  5BNN B;  3ECQ A;  5F32 A;  4OUL A;  2XJR A;  4Q4X 3;  2JWP A;  5FP4 A;  5F3I A;  4Y5S A;  3HN3 A;  2K46 A;  2WYF A;  2XHN A;  1UQX A;  3GGL A;  1SLI A;  2A6X A;  4YVS C;  4A2U A;  2GH2 A;  4MO3 M;  2Z79 A;  1XE7 A;  2QQJ A;  2VUC A;  4AE2 A;  4QAW A;  4CRQ A;  4WM7 A;  4QXB A;  3T0A A;  4Q4Y 2;  1XNT A;  4LIT A;  4NOT A;  4KMQ A;  4XFI A;  2WZP P;  5D8A B;  1W05 A;  2GME A;  3VL9 A;  5IUQ A;  2HWF 3;  3VD3 A;  3I2O A;  5FY8 A;  3UGF A;  4CP9 B;  4C91 A;  2IC1 A;  4TXW A;  3T0D A;  1DGR N;  2WO2 A;  3A0N A;  3C7H A;  1DFQ A;  5GLZ A;  4AFM A;  1HXS 3;  5F1R A;  1RUD 2;  3VDD A;  2Y60 A;  4DEQ A;  4MX3 A;  4QDR A;  2BP6 A;  4RR3 C;  4XF1 A;  1OD3 A;  3WDX A;  2VW0 A;  1D4V B;  2VZS A;  3BVC A;  3NQH A;  2ZOE B;  5FZH A;  4UFH A;  3VLB B;  2FCV A;  2G4I A;  3VDB A;  3NAP A;  4UF0 A;  3RJR A;  3RVH A;  3FJS A;  3AX4 A;  4HG6 B;  4QKB A;  5FYY A;  1OI6 A;  2W95 A;  3T4H B;  1FYU A;  4BQ1 A;  2RS3 2;  3IB3 A;  4FXG B;  4Y5Z 0;  1EAH 1;  4UWD A;  3B69 A;  1TQ5 A;  3III A;  4EYU A;  3O1O A;  3H7J A;  5HCB A;  5IAX A;  4FPK A;  4ZU4 A;  2ZEY A;  4DUV A;  2VMG A;  3WDU A;  3DF0 A;  1GUI A;  2P3K A;  4K8R B;  4ZU7 A;  2R04 1;  4RGG A;  1C5H A;  3HIF A;  3CEW A;  4HZF A;  1SLC A;  5FZM A;  2WNV C;  3TOJ A;  5T3N A;  1POV 3;  1W6P B;  5I0S A;  1YXW A;  5FYM A;  3RMX A;  1ULF A;  1CAW B;  1US3 A;  3VBO A;  1G7Y A;  2IUW A;  4HN0 A;  4FXK B;  2N7G A;  1W8Z A;  2Q1F A;  2VXR A;  3ZXA C;  5CFD A;  5BNN C;  2RJL A;  2IFW A;  1ACC A;  1XYO A;  1WA6 X;  3WHU A;  1UZY A;  2ZHK A;  2ZMN A;  4LOT A;  3BCW A;  4WVV A;  4IEP A;  1PO2 1;  5C33 A;  3ITQ A;  1J3Q A;  1RUO A;  2W5F A;  4Q5O A;  2JDP A;  4CEY C;  1XNK A;  1J83 A;  2UWC A;  4DS0 A;  4GQ7 A;  5JXJ A;  3HVD A;  5FPX A;  1R1Z A;  1B09 A;  3ZPY A;  5GZD A;  5A6Y A;  3T1L A;  1JYT A;  5D8A C;  2XJQ A;  1POV 1;  3AKP A;  5L73 A;  3AVS A;  3GM8 A;  3NNM A;  2RDR A;  5LBC A;  3LA3 A;  4B3N A;  1O3R A;  1COV 3;  5EJ3 A;  3AMQ A;  4O9G A;  1BXH A;  1YIP A;  2GC0 A;  5T55 A;  3ORJ A;  1VAK A;  5FPV A;  4YGE A;  2GNT A;  1CAX A;  1ULE A;  3PIG A;  4JKL A;  4AAP A;  2VOT A;  3MYX A;  5FP7 A;  1VAV A;  3POB A;  4OQ8 A;  2JE9 A;  3RRD A;  1L7L A;  2ZAC A;  4IGP A;  2FMD A;  4FTB A;  3IDC B;  4JTO A;  1APN A;  2I45 A;  1X9P A;  5FK7 A;  3I2D A;  1I1E A;  3O1M A;  4D94 A;  2YGL A;  3KV9 A;  2VW2 A;  5C9A A;  5FWE A;  2R0H A;  1JZ3 A;  3VBU B;  1O3S A;  1GNH A;  2ARE A;  4YVW B;  4OZX A;  5JCT A;  4Q1P A;  5C8C C;  4TYS A;  1GQG A;  4YW2 A;  4P02 B;  2Y6L A;  5FZA A;  2PFW A;  1RL3 A;  4XW3 A;  4D6R A;  1N3Q A;  5DPN A;  1AR6 2;  4NII A;  1JZ2 A;  4O7X A;  2ZGR A;  3A0K A;  2CNA A;  3USU A;  2JD4 A;  4QPY A;  4AVS A;  2W08 A;  1QJY 2; 
#chains in the Genus database with same CATH homology
 4QHO A;  4O61 A;  3T4H B;  4IE6 A;  3BTZ A;  4OCT A;  4NRM A;  3BUC A;  5F8P A;  2FDH A;  2FDK A;  3RZJ A;  3S57 A;  3T4V A;  4NIH A;  4NPL A;  3O1O A;  4NRQ A;  2FD8 A;  3T3Y A;  3RZL A;  3LFM A;  4MG2 A;  2FDI A;  4NRO A;  4QKD A;  3I2O A;  3RZH A;  4IE7 A;  4ZS2 A;  3O1M A;  2FDJ A;  4IE0 A;  3O1S A;  3O1V A;  3BTY A;  2FDF A;  3I3Q A;  3KHC A;  3I49 A;  3O1R A;  3H8O A;  3S5A A;  4NID A;  4NIG A;  4MGT A;  3BI3 A;  3BU0 A;  4QKN A;  3BIE A;  4IDZ A;  4QKF A;  4NRP A;  4ZS3 A;  4IE4 A;  3RZG A;  3O1T A;  3RZK A;  4NPM A;  4JHT A;  4IE5 A;  4NII A;  4NJ4 A;  4O7X A;  3KHB A;  4CXW A;  4ZHN A;  3O1U A;  3H8R A;  3O1P A;  3I3M A;  2IUW A;  3BTX A;  4RFR B;  3H8X A;  5DAB A;  4CXX A;  3RZM A;  3BKZ A;  4CXY A;  2FDG A;  4QKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...