4NIHA

Crystal structure of alkb e136l mutant protein with cofactors bound to dsdna containing m6a/a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
201
structure length
201
Chain Sequence
b'PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDLPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Switching Demethylation Activities between AlkB Family RNA/DNA Demethylases through Exchange of Active-Site Residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/dna
total genus 47
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2013-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4nihA00
4ZS3A 4NRPA 3O1VA 3I49A 3T4VA 3O1MA 4NIGA 3S5AA 4NPMA 3BUCA 5F8PA 3BU0A 4IE5A 4IDZA 4IE6A 4IE7A 3RZLA 3T4HB 4NIIA 4NRQA 3O1TA 4QKDA 2FDJA 2FDHA 5DABA 2FD8A 4NIDA 3T3YA 3KHCA 4QHOA 4QKBA 2FDIA 3RZMA 3O1PA 3BIEA 3KHBA 2FDKA 3S57A 3BTXA 4ZS2A 3H8XA 4IE0A 4ZHNA 4NROA 4MGTA 2IUWA 4CXYA 3BTYA 3BI3A 4RFRB 3O1RA 4QKFA 3I3MA 3O1OA 3I2OA 4NIHA 4NRMA 3O1SA 3O1UA 3RZKA 4NPLA 4O7XA 4QKNA 2FDGA 3RZJA 4NJ4A 3LFMA 3RZHA 3H8RA 3H8OA 4O61A 4JHTA 3I3QA 4OCTA 4MG2A 4IE4A 3RZGA 2FDFA 4CXXA 3BKZA 3BTZA 4CXWA
chains in the Genus database with same CATH superfamily
3VHRA 3U0ZA 1NAEA 4WVMA 4UW5A 4XILA 1MEC3 3K75B 4I30A 4JGYC 1BMV1 4JC1A 1UW8A 4AHWA 3D3AA 2BNMA 3ZKYA 4CCJA 4KBZA 1QQP2 1DQ0A 3KF5A 1RXFA 2ZX1A 3AMPA 3OBRA 4WV8A 5E6HA 4E2QA 3ZDSA 1BEV2 5EYYA 4BWOA 3K3OA 1E5SA 3KZ4C 1WLDA 2XHKA 2D3SA 3PVNA 1D4M3 2VZSA 4CDQB 2VC9A 4ZZ8A 3GZEA 4N53A 2FBEA 4IV1C 3HBKA 3MICA 3NKTA 2DVBA 1FX5A 3LGRA 4Y4YA 3DXUA 2GH2A 1OURA 1LOCA 1YQ5A 1BXHA 2OQ6A 2ZGQA 3T0BA 4YFZA 4G9SB 1U12A 2XB6C 1JZ2A 1RXGA 2PQSA 3A23A 4AW7A 3TYJA 5FZ3A 1XU2A 4ORFA 5CISA 4PDWA 2YBPA 2R1DA 4FAHA 5BNOB 2JG9C 5FCCA 3VBOB 3KHCA 1AXYA 2VVFA 4YW2A 5IVYA 2DU0A 2C6SA 3VBRC 2TNFA 2FDIA 4YVWC 3WVJA 3LEIA 1C1LA 2WQ4A 3WNKA 4K8RB 1A6CA 1HV0A 5GZFA 3MFAA 4ZZ5A 3M3EA 3DF0A 1NCRA 5IVJA 3OGSA 5JSPA 1LENA 1MZFA 3C7EA 3H7YA 5FY5A 3UT0A 1PVC2 3ZX7A 1EAH3 1QJFA 4IE0A 4AVSA 4DEVA 4JTNA 3O12A 2LW8A 4BU2A 4RA0A 1H8VA 1C8M1 4Q0PA 3E5XA 3ZO0B 2BFUS 4R8HA 5LRSA 1TMF3 4WVMB 5BXXA 1FOD3 3Q8CA 3CHXA 4URAA 4N53C 4GWMA 1JUIA 3RFRA 1DQ1A 4XFAA 3WQ7A 4ASLA 1GUIA 5FZKA 3BN6A 1O3RA 5FUPA 5HI0A 1VAVA 2WNUA 4QX0A 4N7UA 5GLWA 1S0BA 4AYUA 3B93A 3MLLA 3Q8FA 4UF0A 2EXHA 3AP5A 2Y6KA 4PQ9A 3VDBA 2J1UA 2CTVA 4PDWC 3SCHA 4CDUA 4YSFA 1AYN2 3POGA 1BZWA 2JDMA 1RUH3 4MYEA 1QJU3 3VB9A 2WABA 4RHV1 1VBB3 2D3PA 5C3QA 2P5BA 2YV8A 3VBSB 1AXKA 5J1XA 2ZXQA 5FTTC 2R072 1W6PA 5T5OA 3HN1A 1U5XA 3WNNA 4RS5B 4AR2A 3ATGA 3I2DA 2W94A 1JODA 3KGLA 3SKVA 3ZYBA 3TNQA 4K6BA 4CDXA 1NCRC 4YLZA 1RVF2 2P17A 2XJVA 1WW6A 4DRVA 2E26A 1HRV3 1FAYA 2IFWA 1XBFA 3VZLA 1OMIA 1W6QA 3RMXA 4JHTA 2GN7A 1MQTB 4XCAA 1JZ6A 2QKDA 5JPNB 4A44A 2ID4A 2LROA 4CA9A 1UO9A 1DZRA 3BKZA 2BRTA 1LOAA 2E6VA 2VW1A 3CMGA 2BFUL 2XGXA 3KV4A 3A7QA 1UYXA 4IQPA 5GM0A 1KRIA 3KWVA 4FO9A 3VLBB 1DQ6A 3SH3A 3ELNA 2MEV1 1E5RA 3KS7A 2WNUC 2VG9A 2VCBA 5FZFA 4ASMB 3T1LA 5I0UA 1MS1A 3KQ4B 2F17A 1DYPA 5HCBA 5A6QA 2OQ7A 4CDUC 5A7SA 1V6MA 1AR93 4AWDA 4QGLA 4AI8A 1JZ8A 3LF7A 1AYN1 3A0NA 1J83A 5T55A 2VCMA 4QB6A 2Q4SA 4XJ8A 4XXAA 1OA3A 1VRH3 4XBLA 2A3XA 2XMLA 4ATEA 3CJIB 2R071 4LBQD 5IK8A 1HRI2 4P9JA 2GC0A 1VB4A 5AC91 1Q56A 3QLQA 4QB2A 1J84A 4CDXC 3ZVXA 2PAKA 5FWJA 3JUUA 2VZUA 2ZABA 4FPCA 1PK6A 1RVF1 4KWJA 5LASA 1CWPA 4M3CA 1JYVA 1D2SA 3ZSKA 4COZA 1UU6A 1SDDB 2WS92 5SV5A 2OKXA 1ZRDA 3DYPA 3TOJA 4YW3A 4MV2A 3KD4A 4L9BA 1JZ4A 3RZZA 1UU4A 1R082 1PGSA 4QPGB 3IDAA 2Z2SB 4BIOA 4HPKA 1JXNA 2YG0A 2J42A 5LW9A 5F3CA 4MLOA 5A7PA 5JAXA 3O1PA 2GALA 5DUUA 3VBUA 3WG1A 3DXTA 2TEPA 3N4MA 4ZY9A 3ZFFB 4XBQA 3THPA 4OI0A 1W8OA 1K5MC 2O8OA 3IMNA 1LNSA 3FFQA 4TWTA 2XDVA 2ZEYA 1YIPA 4JGZA 3QH6A 4P9IA 4WM8A 5FAXA 3ZSMA 4MH0E 3NNLA 4B4QA 2BPA2 1VMHA 4YG6A 2DCZA 2V72A 1K12A 2DTYA 4LPLA 4DUVA 3V56A 3WW3A 1V6KA 4YM0A 3ZIXA 4FTSA 1Q8OA 5CFDA 1HRI1 1IS6A 2W0XA 5L9VA 5FY9A 3VGIA 1V70A 4Q2FA 5T52A 1C5HA 4ONUA 5JMOA 3MFCA 1PK6C 4LOSA 1UYYA 4D7SA 5HPOA 2XG3A 3HQRA 1SMVA 3LPFA 2RR13 4M4PA 2FMYA 1H1IA 2WS91 5ABJB 1JUHA 2ARXA 2CGNA 3OD4A 2Y6GA 1MS3A 4FOQA 3QACA 4AEKA 2ZAAA 1O3SA 2ARBA 2CNAA 4N9IA 4OHXA 1R081 2DWRA 5CKQA 4QT6A 1KEXA 5FY8A 4D8MA 1J3QA 1WCDJ 5I0RA 5JOXA 3ES4A 4Q1RA 4UFMA 3POWA 1OT5A 3GDBA 3WDXA 1RMU3 5F7UA 5CYYA 5B2GB 1CPMA 1YQCA 3LE0A 1Y4WA 3H8RA 1GMMA 4WM7A 1HKDA 5BV6A 1LGCA 4JGZC 4O61A 4WM8C 1GV9A 1PZ9A 2BDRA 4AQ6A 4EROA 4DY3A 1ZA7A 1SQ4A 1F5JA 2FDFA 2RM22 2KXLA 5JUVA 2BERA 1ZVFA 4JZRA 4IUGA 4V1PA 3E6CC 1RJ7A 5C3SA 2WAAA 4P9GA 3VBUB 2VQUA 4UFIA 4Q27A 1CAVA 2XKOA 1MEC2 3AYCA 2AH2A 4NRPA 4LE4A 1QU0A 4B4PA 4CCMA 2P3YA 4GB32 3T4VA 2WZR2 2WN3A 3I2KA 4XDQA 4LBQA 5LBBA 3VD7A 2WR9A 4LK7A 2EAKA 4NR1A 1AX0A 5IT6A 3D8CA 2VOXA 1ND2A 4PF1A 2PHWA 2HEYF 2HLEA 4BK4A 5J3UA 5FPAA 1D4M2 5A3OA 3TEXA 4YW1A 4OMCA 2IVIB 2BQPA 5FJHA 3VV1A 2RS53 2ZMLA 1W6MB 3DN7A 1UX7A 3HNBM 3T4HB 1HB3A 2D44A 2B7YA 2WINB 3FLRA 3MW2A 3UETA 1UKGA 4WM7C 4NHKA 2P3JA 2VZQA 1M4WA 1OVSA 1GR3A 4BH9A 2FDJA 1YUDA 2YGLA 2R0FA 5F5AA 1PM4A 3RYKA 3H8UA 3LIGA 3I2GA 5FUNA 4IEWA 4HN0A 2KM2A 2Y38A 1ULCA 2D3RA 1N1SA 5DPNA 1F9KA 3M2MA 4BQ3A 2WYSA 3KCXA 1D0GA 1W8WA 1KJLA 1OUXA 1W0PA 2XOMA 3AXEA 4IERA 1MEC1 3KHBA 4JRAA 4XDPA 3WF3A 3RS6A 4E2SA 4I09A 3FE5A 2G19A 2WT0A 2IXJA 4XUOA 2FCTA 5K4LA 5FMCA 5FO7B 2J1EA 2XVGA 2WSUA 4GD4A 1F4HA 2WIIB 3THCA 4LUKA 4C8DA 3NNGA 1ND2C 5JCTA 3FLTA 1TMF2 1IKQA 1FOD2 4JKLA 3UYJA 4BDVB 1D4M1 3KVAA 2B45X 5CFCA 4LHSA 2ZGUA 2NP0A 4YVSB 4DQAA 5I0SA 1W8UA 5HCAA 1MZ6A 4OUEA 4CU7A 2UYBA 3SITA 3I2OA 4GWJA 5AFBA 1ZNPA 1BQPA 2IXKA 4FI9A 4IV3B 4JRLA 2ZS6B 1FV2A 3SISA 2E32A 2R6QA 2ILMA 5L7OA 1QJU2 4CUGA 4YZ1A 1VBB2 2W46A 4XJWA 3R0RA 4QU1A 4HFSA 4HK9A 4MX3A 2NMNA 1QGLA 5DUVA 5FPLA 1SBDA 2WBKA 4BMBA 3TN92 3N9LA 1EUUA 1DHKB 2ZGPA 3OGGA 4PBOA 4R9AA 1HRV2 1W8FA 3GZUC 3MYXA 5B4XA 3AMMA 1XSRA 4XF0A 3E6BA 4X8NA 4XURA 2VUCA 3FUOA 4A45A 4EN6B 2LUWA 3FHIB 2VMIA 3O0XA 2ZX4A 2QBXA 4M4RA 4CP9B 1QJX2 2VZOA 3LIHA 5ACA3 3VDAA 1TMF1 4LOTA 4QXBA 2WO2A 1FOD1 1EYBA 5DDJ3 5CFCC 3IM0A 4CXWA 4A42A 2ZGMA 4TYSA 1WGPA 4J1XA 4X6QB 1RUG3 2OPKA 5AFEA 3NKGA 5C8WA 4FT8A 1HB1A 4MADA 5I0DA 1G9DA 1OLMA 3RYPA 4BK5A 4JKKA 1QEXA 2QQMA 4HKWA 4QX3A 3S5AA 1IG0A 1AR92 5L7OC 1RUH1 1QJU1 1TG7A 3NVCA 3POFA 2W52A 5T5LA 1VBD3 1VBB1 1V6LA 5DN2A 2RS12 3WW4A 5FYUA 3KT1A 3AZXA 1BLZA 3I59A 4GWIA 2VVDA 1CAXA 1APNA 4QXHA 1JTZX 1MR5A 5C6CA 3TN91 5KHJA 3U1XA 3WDTA 3KF3A 4QDRA 5C3OA 1PM7A 3OGJA 3VBFB 4GH4A 1HRV1 1KXGA 3H1YA 1X8EA 2SLIA 4P14A 4XC9A 2B5HA 4Y4RA 3RYRA 3ZSLA 3IWZA 1CGPA 3MIGA 4QPIA 3VKMA 3H50A 2DUOA 5FZ9A 1DGWA 4Q1PA 1QJX1 4FPOB 5FPBA 1GZCA 1QKQA 1T6BX 1LGBA 1DGWX 1AR72 4LNVA 3RZMA 2C9AA 2H6CA 3I2HA 2B42B 1JYCA 5I8TA 3P3PA 3OY8A 5FXWA 3SH4A 4AVTA 5FYVA 1V6NA 3GZAA 5FO9B 3KT7A 4UFJA 5KBFA 3K2OA 3QCWA 4QMAA 4ZS2A 4AL9A 4AE2A 3GBGA 5JI7A 4YZ5A 3MF6A 3S7IA 2L9LA 4EN9B 5C71A 2WC2A 1AR91 1Y9QA 1QOSA 3DL3A 3VDDB 3MPPG 2XLGA 3V0AA 2XVKA 3FN9A 3WF4A 1PO12 1U5ZA 3MW4A 3UGFA 5K7PA 1TEIA 2YBSA 5EP9A 1PIV3 4KGQA 4KWLA 4Z2WA 3PVEA 4GA9A 4LHLA 4BMEA 2D93A 3OTFA 4LMFA 5IJRA 4MGSA 1KD7A 2QQLA 2QQVA 5EJZB 3ZXDA 1ODMA 2D97A 3POJA 1NOVA 1ZREA 2Y0IA 3MF9A 2RR12 3WOGA 4Y5TA 4NRMA 1XYNA 2B39A 3T0AA 2HWE3 4GJZA 4QPIC 4EV0A 2C1FA 2QZ3A 2VMCA 2VUAA 5KR7A 3RZKA 3M8LA 5DUXA 5F6LB 5JZGA 1S0IA 2DVFA 4RL7A 3AL5A 1D2QA 1I5ZA 4AGRA 2VL4A 4PIZA 1KJRA 3OGVA 4GH4B 3OBZA 1L7LA 2EXJA 2D7FA 1V9U3 1ULGA 1X82A 5HXMA 2Q8EA 2ETEA 2HEVF 1POQA 4CZSA 1UAIA 3HEIA 2CU5A 4LO6B 3VZJA 5BNPB 5JSRA 1ODNA 3J7LA 2OVUA 1PNGA 3GYDA 4HKLA 4MG2A 3NJZA 3AK0A 4HONA 3RI9A 3M1HA 4LO4B 2W9XA 4QX8A 5FZGA 4Y1UA 3VKFC 3ZSEA 2EIEA 2XKPA 1GQHA 3N35A 1W8TA 1LU1A 2I07B 3WF1A 4AQSA 5A6XA 1G9AA 2HJIA 2HWB3 1PO11 2F4LA 2O0OA 3GZTB 2A75A 1IPKA 2R7EB 2OYZA 3M3OA 4A3ZA 1AJOA 5KXBA 3FLPA 4D6QA 2WA3A 3WNOA 3ACLA 2BNNA 5AVPA 2ZGOA 2OX0A 2OUJA 3OF1A 1DYKA 2RR11 1Y3TA 1DGRN 2JB4A 3ZFEB 4JDOA 5F8PA 4LKEA 3KCYA 4ZU4A 2VOWA 3NJYA 2A3WA 4TLGA 2E7AA 3WCSA 4DUXA 5JZGC 2O8QA 4XUTA 5B4NA 4DMIA 5LZ6A 1H8TA 1V0AA 1JH5A 3N36A 2ARAA 2VJXA 5A1AA 4OHVA 4NIIA 4K40A 5FZOB 2RJKA 3ZYIB 3NNJA 4GKXA 4UBHA 1JZ3A 1S0DA 3ACHA 2WN2A 4BOWA 5JR2A 1X7NA 4CP2A 1X50A 1T6GC 2UYAA 4CUAA 4DXRA 5DABA 3MO4A 1J3RA 4YZ3A 2PHTA 1FYUA 2NLRA 1OD3A 1ND3A 3FWEA 1GZTA 1C5IA 4I0BA 2E7TA 3PJYA 3J26N 3T1MA 4NVPA 2XONA 5C4WA 2GNDA 2BWAA 5IFTA 1AR82 3BIEA 3T2TA 3FMGA 2C9KA 1GBGA 1RUJ3 5FMOL 2DF7A 4OYUA 5FPUA 2WWUA 4H3WA 3WP4A 2DFBA 5A32B 3X29B 3BVCA 1SLAA 2WT2A 4J1WA 1W8NA 3AKTA 3PVBB 4O65A 4Q4W3 4XQ4A 2C26A 4XACA 5FYCA 3WXPA 3B69A 2BW8A 4FBFA 1P8JA 4IL7A 5A7OA 1LHVA 4JDNA 4EWAA 3SEEA 4K3UA 1D7PM 3C3VA 2ZX2A 4WVWA 3O5SA 3RPQA 1W0OA 2RS51 2Q5TA 3HPNA 3ST7A 3POSA 1U0AA 4JQRA 2ZGSA 3PUSA 1S2BA 3INAA 1UMHA 4V2VA 1X33A 4YZ2A 1ENSA 2E53A 2X05A 4XIOA 4AXOA 2VNGA 2WAOA 3WG3A 1SPPA 4W8JA 2WRAA 4CCDA 1ACCA 1MS8A 1H8TB 5FP8A 1ND3C 4QHZA 3HMYA 1NCQB 2ZGKA 3PMEA 2WKKA 4LBLA 4D94A 3BTAA 1OQ1A 1VBA2 4I3PA 4HBNA 4IEZA 5C4WC 1NQJA 4HK8A 1O4YA 4BXFA 4YGDA 4Y33A 4E4ZA 2YC4A 4Q8LA 1LHNA 2VCCA 3ILRA 1B35B 3ACGA 4YM2A 5FYIA 3RG0A 4LO7A 1G7YA 2DBNA 2W39A 4W6YA 3N9QA 1CX4A 2I45A 3OYWA 1BMV2 1JYTA 4IGOA 5HXVA 3VBHC 3WNPA 3WW2A 4Z07A 3WF2A 1ZRIA 3RDIA 2P1BA 2VD7A 4XE9A 4CXXA 2HWF3 5DDJ2 5FRAA 1PO23 4CCNA 1F31A 3EXUA 3MBWA 1AXZA 1RC6A 2GH8A 4Q0QA 4OQ9A 2WZPP 4A4AA 2R16A 4CEYB 5JOWA 5FY0A 1IQAA 2ORXA 4AI0A 1URXA 2DYCA 2PHUA 5C9AA 4YGCA 2P6CA 1JOJA 1RUF3 1VJ2A 1ZZBA 1ENXA 4MXVA 5FLJA 4AFAA 4TTGA 4XMIA 3MIEA 4D6SA 3SQOA 3VKNA 4Y1XA 3WUCA 2VM9A 5JVVA 4IDZA 3VZKA 5FKCA 1N3QA 2RV9A 3AVSA 3R4UA 3ZPOA 1WZXA 4LE3A 1OH4A 4BXSV 5EFUA 2BGCA 2YU1A 2OT7A 1VBA1 2BZDA 1SLIA 2JG9A 2VVEA 2WO7A 4XFBA 2IXHA 2JB8A 2PAEA 1IZ3A 4MSVA 1V00A 2ET7A 2NPIA 3ZXGA 1NXMA 4OLLA 2VULA 4W6XA 4FQZA 1JI6A 1GWKA 3ETQA 5IK4A 1NQDA 2WFF2 1MZEA 4S2FA 2SBAA 2DURA 2RS32 1GQPA 5C8CA 4OZXA 3VKOA 3K46A 4MGZE 1QF3A 1C8M2 1IS4A 1VBE3 4QM8A 3LCPA 5DDJ1 4BE3A 4XAEA 4AVBA 2X5IB 3A4UA 3NV4A 3OEBA 2O1QA 4C1XA 5FYSA 4RN5A 5EQUA 2JDYA 2UY8A 4PLOA 2Q0AA 1RUG1 2IXLA 4JGYB 5C9AC 1YFWA 1WW5A 3FC0A 3LB9A 1JZ7A 1VLNA 4UYBA 1NLQA 1RHI3 2EAAA 1J1TA 1JYNA 1NUKA 1YFYA 1I3HA 4CPBD 1GP6A 3AP6A 3I2JA 3MLJA 1CESA 1T2XA 3QH7A 4YM1A 1PIV2 3ZYHA 1EY2A 1LEDA 2X53S 3HR9A 4RHV2 1OLRA 3MV01 1PGL1 5KHGA 2ADDA 1HXS3 1UZYA 4IV1B 4JAAA 4XFCA 5FK8A 5DAQA 1JZ5A 2LM3A 3USUA 1HLCA 5L73A 4NIHA 2IFRA 2XH6A 1W6OA 1TNRA 3WX5A 2HWE2 4N90A 1MPXA 2XWJB 4LR4A 2A70A 2WFF1 2YUEA 3AP7A 1L3JA 2QFEA 2DCTA 3C7HA 2RS31 5C8CC 4HANA 3OUIA 1WKYA 2JJ6A 2JG9B 2CDPA 4XJ9A 2ARCA 2XLAA 3EHKA 3JXSA 3K77A 5FZMA 5FPXA 2FHRA 2VO5A 4MO3M 5T5PA 3VBRB 1DU3D 3AKRA 2YROA 4YVWB 1YCIA 1WD4A 3ROUA 3N9PA 3MDPA 1XOYA 1V9U2 4QDQA 2CDOA 3OB8A 4J6GA 5FBJA 3OCPA 3ORJA 2MEV2 2BJSA 1QXJA 4BM8A 4HVRA 3M7AA 3OPWA 1GZWA 3BOPA 4P02B 2A6ZA 1NE6A 4Y1YA 1NLSA 3AYEA 3AB0A 1QIQA 3PMSA 1PIV1 3SCFA 2DU1A 4N53B 1CPNA 4BLIA 2WQ8A 1GU3A 5GLUA 4E27A 2WFPA 4F3JA 5M0TA 4YW7A 2ZHNA 4FVVA 2J1TA 5A3WA 4Y20A 5AC92 1JYIA 3QBQA 3VBSC 3O1MA 2ADEA 5DMYA 5IFPA 1IOAA 2HWE1 1C8NA 1DZQA 4PDWB 5FZCA 5FZIA 1UYPA 3KVBA 3U78A 3WT3A 5CG8A 2J22A 4OI2A 1FNYA 1F5FA 2ZZQA 4UXAA 3ZR5A 4FFFA 3CDZB 4YGBA 2FCVA 4Z2AA 4XHXA 2ZGRA 3PJQA 4W65A 1TE1B 2B9VA 1DGLA 5FZHA 1IQDC 5FYMA 1H4GA 3ZPYA 3R6SA 3O1TA 1G9BA 1JOPA 1V9U1 5A33A 1KS5A 1Q8SA 3JB8A 4I2OA 1NCRB 5FY7A 5CKMA 4CEWA 4CP0A 2WSVA 2W1UA 3AFKA 3PTYA 2BBAA 2Q8CA 2JE8A 4OUMA 3VKLA 5A1LA 5GLTA 3FFZA 2F4PA 1K5MA 2NQYA 1N1TA 3B00A 4HL0A 4KNCA 1H1MA 5F5CA 1VE0A 2PHFA 4AHZA 1WCUA 2HYKA 4HVQA 5JXGA 3K3NA 4DEQA 5LEKA 2BBVA 4CU6A 2Q30A 1N3OA 3AMQA 4CPBA 2FDKA 2VMEA 1RUJ2 3P6BA 5FZ8A 5A70A 1W6NA 2BYVE 2QQNA 2WNUB 2YY1A 4LKSA 4QX1A 4FAGA 4UF0B 1ZZ9A 4Q4W2 1EUTA 1A8MA 1AYM3 5A3NA 4AEMA 2XL7A 3ZXFA 5BNQA 2WYFA 4CDUB 5F5IA 5EJ3A 2XHNA 1AR63 2G4IA 4IETA 5IVFA 1WUVA 3TEWA 2K46A 1EV13 4YM3A 5JXJA 2FZ2A 1RUI3 3LAGA 5FQ0A 1YQ8A 4E4SA 1W6PB 3LWCA 4Q0VA 4JCKA 3WW1A 2ZX0A 5J37A 4D0QA 1ULDA 1W0NA 1F2NA 2XBO3 3I2FA 4AGGA 5FP7A 5KWRA 4YPJA 1K5JA 3Q8EA 4CDXB 2D6OX 4Q4Y3 3ITQA 1CJPA 3WQ0A 3AKPA 2EVXA 1PZ7A 4CEWC 1ZBA3 4NN0A 1W6QB 2V5DA 4SLIA 1SFPA 5JLVA 2A73B 4MGYE 1LTEA 4PI2A 5F3IA 4N8MA 4BLJA 1XNDA 2W3JA 4KMQA 1TME3 1W2NA 3WP3A 4FPGA 1OH3A 1LULA 1S4CA 1W8HA 2VOTA 2IXCA 5KXDA 2LRPA 4OULA 4OFGA 3MGUA 2CL2A 3RZHA 2RDNA 1ST8A 2VOVA 4EJRA 1F15A 2RMU3 1RUJ1 4QAWA 1SCRA 4WZCA 3OPZA 4NIAA 3HQUA 4MOAA 4RSUA 1RL3A 1CVNA 1K5MB 1HJGA 2HEWF 2E33A 3N3HA 3OOXA 1O5LA 2Y64A 4Q4W1 3SKJE 2ZZJA 1SLLA 2ZHLA 3C7GA 1F4AA 2JDNA 2HWF2 1NXD1 2QE3A 4Z8BA 1PO22 3WHUA 2HWC3 2J1VA 2KA3A 1AL22 4GAZA 4UW3A 5C70A 1CR7A 3VL8A 4P9LA 1W9TA 2XXZA 1N47A 4IEXA 1DQ2A 1DBNA 1GQGA 3R4DB 4RQPC 3WDUA 2AYHA 4NIGA 4X6RB 1CN1A 1YJKA 4QHBA 1PK6B 3WNXA 1QY4A 4M3CB 4FPJA 4O9GA 4K21A 4A6SA 4GQ7A 3T30A 4XUNA 2YBKA 1TVGA 3ZXKA 1V6IA 2V5YA 5D21A 2Y26A 5K0UA 1CZTA 3DEMA 4GWNA 4HPKB 3MZHA 4FPLA 2P6HA 3BPSA 2PHLA 2VUJA 3MI8A 1YLLA 5JPMB 2Z79A 1XE7A 5A3PA 5CKNA 4XIKA 3B7MA 4XAAA 4BQ2A 4NRQA 4QPYA 3LDKA 4AI2A 5JXIA 4XQWA 1KGYA 1ZZ7A 5FWEA 1UU5A 4CCEA 1H2KA 1WA6X 2MHFA 1R093 3KT4A 4JGZB 4WM8B 5ERLA 2EA7A 4BIFA 4XYXA 1AUYA 5IUQA 1O7FA 1POV3 1UZVA 5KHHA 1ONAA 2HWF1 4QKBA 4EN7B 1TQ5A 4XTPA 1PO21 4S2GA 4OZOA 4GZ9A 2DBIA 5CNAA 3GALA 2P2KA 1AL21 5GZDA 4BYYA 2VXRA 1SLBA 2VTFA 5FZ1A 5HCFA 5CFDB 5J36A 1SDWA 4D69A 1Q43A 4WZFA 1LHWA 1LAJA 3OGRA 2D6LX 3GCWA 1OQEA 2K0GA 1RUF1 1ZBE3 2Y34A 5FLHA 1OPOA 2Y33A 1RHI2 5F3GA 4LQRA 4EN0A 1WLCA 1UNBA 1UXXX 4FPFA 3CIHA 4Q0UA 2WWJA 3ZM8A 5FXVA 5K0UC 5DZFA 2G1MA 4R9DA 1LKNA 2BOIA 2WLQA 3E6DA 1QNYA 3FHAA 3I3MA 3S0MA 4XOGA 4NHXA 2QVSB 2Y6HA 1HXS2 2D6PA 4Q26A 1O5UA 1PMIA 1UKRA 1UF2C 3E1F1 4XQDA 4AEDA 4TZDA 2QUOA 2VZ3A 3NV3A 4R4ZA 4WM7B 5C33A 1DDLA 4B1MA 1CIWA 4QGMA 1O8SA 1PGW2 5IAXA 3AZYA 3B5LB 5FREA 5E1RA 5IWFA 2DDUA 4CVUA 1H1AA 1OFNA 3MIFA 3IPVA 1UQXA 1EAH2 1JN2P 1Q8QA 2OIIA 1H6YA 4Y5SA 2ZA9A 4FTEA 4QM9A 1LHOA 2KR2A 4ZXEA 2FDGA 3GXUA 2R043 4RGKA 1YIFA 5EJ1B 3AP4A 1HQWA 3OBTA 5IVBA 1CAVB 2AUYA 3PUAA 2YPJA 1OA4A 2WWSA 4EZ4A 1WW4A 1MVEA 2P4EA 3CEWA 3ACFA 5LRRA 5I0TA 3S6PA 1LODA 1I6XA 5FPVA 5TSWA 3RGBA 3FX3A 3H1MA 4LBQB 4FQ4A 4AF9A 3NNMA 2XUEA 3CNAA 2PYTA 2W08A 3AYDA 1BCXA 1RHI1 3I7DA 3NRUA 1S55A 2WNVA 2FCUA 3CLPA 4LKFA 1XNKA 2EIDA 1ND2B 2Y0OA 1RUH2 3N7LA 2IWGB 1FV3A 5FOJB 2JD9A 3USSA 4QB1A 3W5MA 4ZU5A 5FZ7A 1HXS1 1Z7S3 1LGNA 3GGLA 1HB4A 3GM8A 1Q8VA 3ZFGA 4AEDC 3O1VA 3I49A 5GJ6A 3URFA 4L97A 5DAPA 5EIYB 5IK5A 4PQQA 4YZ4A 3HJRA 1K3IA 1PGW1 2PHXA 2PTMA 4BCUA 4Q8KA 4LIUA 3T2OA 3VHPA 1WMFA 2OUHA 5EPAA 5F6KA 4C1WA 2D6MA 4URTA 4B3NA 1EAH1 4QGNA 1KDKA 1ZZ8A 2JIGA 2W1QA 5A6YA 4PIXA 1FPN3 3NNFA 4XFHA 3AMHA 1N1VA 4XUQA 2GC3A 4UAPA 1DFQA 2AEZA 3SXWA 3TWIA 1W9SA 2ZHKA 4NPRA 3IDCB 2B9UA 2ZHMA 4YGEA 2B8MA 2GC1A 4M01A 1UL9A 5JXHA 2HBUA 2VW0A 3IPVB 4X8PA 2ZX3A 2VZPA 5EV7A 2ZEWA 3TB0A 3UKVA 3PDQA 4LBKA 2X29A 2WNVC 3MHZA 3D0JA 2GAUA 2YXSA 1PX3A 4NWVA 4QHOA 4C0HA 4E4HA 1TZOA 3AJYA 4EQVA 1HN1A 5FZDA 1UOGA 2Y6FA 5FBZA 4DOUA 3KMHA 5CFCB 3AKQA 3CZUA 3BOWA 1VRH2 4OHYA 4JKMA 3UL2A 5APAA 5EXOA 4FP3A 2VECA 4IGQA 3ZFGC 1OOPA 3MV11 4YW5A 1E5HA 1HN0A 3WDVA 3BGAA 5JMCA 3VZNA 3H8XA 1VRBA 3WG4A 1JS9A 5T5JA 2ORZA 5CADA 1MS4A 1WCQA 1RUNA 3AVRA 2ZAHA 1JW6A 4W6WA 2E63A 3U4SA 1EV12 5L7OB 1PNFA 3TEZA 2HWD3 3I3EA 3RI8A 1CX1A 2MNGA 3O1RA 4GMP0 1CAWA 1YI9A 4QKFA 3ZN5A 2EIBA 1V6JA 1C1FA 2PQQA 1VR3A 1YNAA 3ZMNA 1KDMA 2FMDA 5LK5A 3JU9A 4LA3A 2XUMA 1XNBA 1HB2A 2UWCA 4LULA 1ZZ6A 3QD6A 4Y24A 2IXIA 3NSTA 1ZBA2 3CKHA 3Q8AA 4KG8A 4P00B 4ISRA 3ZIWA 1DYOA 3NAPA 2A6VA 4L0PA 4LK6A 4DIQA 3OPTA 4Y1ZA 3WLUA 4TXWA 3D5OA 4EWEA 2AGSA 4UW4A 4UFKA 3WD5A 4OHWA 1TME2 5F5QA 4BJ0A 3PUHA 4QD2A 5IK7A 5FP4A 2W47A 4N43A 1PZ8A 1QQP3 3JBG3 2YDEA 4KU7A 2VTXA 4HKOA 5BNNA 4NMIA 1WWYA 2NZ9A 3LFMA 1CZVA 1QJEA 1VRH1 1C57A 1JYWA 3UKNA 2DCKA 5GZGA 1OOPC 1BEV3 4OVEA 3IBMA 1QOOA 3ZYPA 4CCLA 1VMJA 1XE8A 4XJZA 1STMA 3I3QA 4FXKB 3RWKX 4H14A 5FXZA 1AYM1 2W2IA 4YARA 3AL6A 2O14A 5FJKA 2A6XA 2JDZA 3ZN6A 5JDBA 1WMXA 3DYOA 2BV4A 1EV11 2H0VA 1IGOA 2GP5A 2HWC2 1RUI1 3GJBA 3UGGA 4E9KA 1OF3A 2N7GA 3I59B 1CAXB 2QJVA 2ZPXA 1CONA 2WO1A 2XBO1 5C5UA 3PUQA 1YRZA 4XPVA 5E8AA 1W2UA 5FV3A 5D8AA 1RMU2 2XPJA 4DNYA 1X8MA 1NT0A 4YW6A 3BALA 1ZBA1 3BUCA 3NAPC 2QQOA 2XJSA 5LWBA 1ENRA 3M3CA 4QPIB 1UWWA 2VTXJ 1RUC3 4UI9L 1ZX5A 2WZ8A 3GBWA 1TME1 3AZVA 4N43C 3IN9A 2ZGTA 1MS5A 1D0HA 5BNNC 1PVC3 2WL1A 4PLNA 5GKAC 4CYDA 5KC5A 4DO0A 3OY8B 2VMGA 3POIA 4OI4A 2Z69A 3MUZ1 1DIWA 4D3WA 3VD4A 1Q3EA 1RTVA 1BK1A 5FMOS 3VD3A 4UW6A 5LATA 3KV6A 1KITA 2C0ZA 4LO5B 5CB7A 2HBTA 4YRDA 1SACA 1W05A 3O14A 4JHZA 5BPXA 1CAUA 5A80A 3S7EA 3T3YA 1UIKA 3U75A 1W99A 1XSQA 5HV0A 4HSLA 1B09A 1HW5A 1JU3A 3ZLIA 3V0AB 3KCCA 4LO8A 2HWC1 1S0FA 3UKTA 2X10A 1G9FA 1O4TA 4RD7A 2CGPA 3P5BA 3R05A 3SNMA 3AX4A 1QH7A 2XQRA 3VZOA 3DPRA 3WQBA 2RS52 4Q4V3 5D8AC 3OSDA 1SBEA 3V0BA 3BTXA 4FOWA 4I3GA 1OSGA 1RMU1 1SLTA 1ZBE2 2UWBA 3LA7A 4BISA 5CA6A 4CDWA 1G8WA 1H9PA 4XTMA 2QTWB 1E5IA 2R073 5LA1A 4MGTA 1O6UA 3MEPA 1FI2A 4CU9A 3PUIA 1RJ8A 3NQHA 1YQ6A 1OBNA 2C5DA 4HN1A 3HWJA 1WMEA 5JZGB 3SLIA 2B4KA 3H3UA 3KB5A 3POYA 3A22A 1LOGA 4QWNA 1SG3A 1QDCA 4AFBA 1NA1A 2PMWB 3ME2A 2VE1A 4RR3A 4MVTA 4LBOA 4LIVA 5T54A 3B94A 2JG8A 1LJ7A 3N9NA 1C3HA 5ANQA 2VZTA 3U10A 5A7WA 2VU9A 3JCIA 1W28A 4V2WA 3F2ZA 5H9RA 3LKJA 1R1ZA 1SEFA 3VBHA 4BQYA 4IEQA 1WMDA 4R4XA 2WNEA 4AHXA 3ALQA 4QKNA 2R042 5C3PA 4KL1A 3V64A 2ZGNA 2PFWA 2Q1MA 1GWLA 4NJ4A 3UK9A 3G6JB 3MW3A 4AFCA 4CE8A 3DPRC 3MLKA 3Q9OA 4K20A 3H8OA 5F9TA 4ARXA 2Z5WA 1UCXA 2NYYA 4LHNA 2ZACA 5LEJA 2H6BA 3ZXLA 4LT5A 2K9ZA 5FYTA 4CDWC 1KQRA 1YYNA 1ZBE1 4GMP3 3DYMA 4Y26A 3RJ2X 5IATA 2A3YA 4AZZA 4JTOA 4DINB 2VGDA 3LSDA 5ANNA 1U5YA 5J7MA 1OF4A 2AEYA 3BU7A 5K8SA 2YZ4A 3CQOA 4PJYA 1S1AA 3JZVA 2R0HA 1NZCA 2VY0A 4KI5M 3VHOA 1GANA 1VP6A 4ZS3A 3T08A 5F1RA 1CQ9A 2GMEA 2WS93 3I2IA 1Z7S2 2XL9A 3TNPB 1NA1C 4IEUA 2RJLA 3D82A 5KXEA 4RR3C 1R083 2BUKA 4E8CA 2HKXA 4PHZA 4NHLA 1LOBA 1LOEA 3J7MA 2JG8C 4MXWA 2ZBJA 4NPMA 3U07A 2ATFA 3ZOIA 3VZMA 3EMRA 1JYXA 5IVEA 4KWKA 3WDYA 4BQ1A 4C91A 2A5ZA 2FZ1A 4IE6A 3GF6A 1ND3B 3T09A 2JE7A 2R041 2UY9A 4A6OA 5JOZA 5ACA2 2H0BA 1WD3A 2XJPA 2E51A 3H3ZA 5C4WB 1XU1A 4ES9A 1QMJA 2OZ6A 4BQ4A 4P9XA 2EIGA 4LXLA 3NO8A 2FDHA 2E9QA 2TUNA 1RUG2 3Q8BA 1DF0A 3J9SA 4FFIA 1KFUL 2IZWA 4XFFA 5EZWA 4ARYA 4EN8B 3VBHB 4PT6A 4AVAA 5LA0A 3WEZA 2VMHA 4MGKE 2BWCA 4NAMA 4CDQA 4N7IA 4U36A 3H3LA 1J58A 3WY6A 4CUCA 5FK7A 3W20A 2WUHA 2D6NA 2IC1A 5A3LA 3APBA 2QQUA 2TBVA 1VBD2 1GYKA 2DCYA 1OVPA 3GJAA 2DCJA 3N9MA 5T50A 4COYA 3EBRA 4UFLA 2PHDA 4E2GA 1Z7S1 3TEYA 1NZIA 5FP9A 4BB3A 4E8DA 1COV3 3EYPA 3DKWA 4R52A 4ET7A 1XRUA 3I8TA 3WP6A 1PGL2 3SHRA 1QWRA 5I8YA 5BNOA 3VBOA 5JIUA 1SPPB 4HXCA 4CP1A 5FUIA 5L9BA 2YYOA 4RGGA 3JQWA 3ZDVA 5C5TA 2HWD2 5C7GA 1H0BA 2GN3A 4RFRB 3HNMA 4XETA 1FPN1 4NWWA 2NN8A 3ON7A 1YWKA 3M70A 2VNRA 5ACA1 2QQWA 1NE4A 3L2HA 3H7JA 1IPSA 4TLFA 4M3CE 2LS6A 1O8PA 4LTAA 4OHZA 5H9QA 1MS9A 5LA9A 4MUVA 2RM23 1OPMA 3OYWB 2QDRA 2P34A 3BPZA 1GZ9A 1US3A 4H2AA 2J1AA 3O1SA 4XFIA 1ZM1A 4FFGA 4HLTA 4RFT0 4CDQC 3FHQA 4OUSA 1W03A 1I5PA 2V4VA 3FL7A 2CGOA 2ZKNA 4ZONA 4GB33 1ULPA 4L11A 1U5IA 4AVVA 2WZR3 3JBG2 3ACIA 1VBD1 4PBPA 2C24A 2V73A 2VPVA 2W91A 3HQXA 4LLFA 1MZ5A 1OQDA 3BCWA 1UX6A 1OD5A 5CU1A 4XF3A 3K48A 5FZBA 3HOBA 5C9AB 3D4KA 2Q8DA 4HETA 3UGHA 3VBOC 5BNOC 1FMD3 2EF6A 2FQPA 1FXZA 3ZXJA 1PVXA 1XXNA 1YO8A 2I2SA 5F3EA 3VBSA 1GP5A 5FY4A 3P1IA 1X36A 1OC1A 5H9SA 2HWD1 4MGQA 4RS5A 5KHIA 1C28A 2PXJA 2V4AA 1L7QA 2YC2A 4FPEA 3V65A 2EXKA 1RGSA 2JDKA 5DZGA 1VPHA 1LRHA 1YI7A 4AOCA 1ZZCA 5KXCA 2PLV3 3LDRA 1R64A 5LA2A 4CSWA 1MQTA 4JQTA 3VHNA 1GOGA 4XJAA 4F7ZA 2DUQA 4MZUA 3QOPA 1K45A 4XW3A 4LBMA 1OFSA 3WCRA 2IVJA 1UY3A 1Z78A 4XF1A 1ULFA 4HZFA 5E88A 5FYYA 1CZSA 1A34A 3F95A 1RUC2 1ZRRA 4PI0A 4FPHA 3U37A 2AREA 2EICA 5C8CB 3ABZA 4NHYA 5DG1A 3HD8B 1XPWA 3ZXAC 4K9SA 4FFHA 1AZDA 2KD7A 1QQP1 3JBG1 1X9PA 1BYHA 2HWB2 5LBFA 4QQOA 3RVHA 3SEPA 2NMOA 5FYHA 1BEV1 1NKGA 3PVOA 5K9YA 3J4UH 2D43A 1NY72 1POV0 3THDA 3DKQA 4S2DA 4GJYA 3S5QA 5IVCA 3OEAA 2YFUA 4NO4A 5DQ0A 4IEYA 3PLQA 3CJIA 1WBLA 4OI1A 2PA7A 2VZ1A 3J7HA 1MACA 4RS5C 4AHYA 3HAGA 4DZGA 2A1XA 1W9FA 3KGZA 3VD5A 4XMAA 4XEZA 1BHGA 2XVLA 4D6RA 2ZGLA 3ILFA 4L2NA 1RIRA 1YHFA 5GLZA 3CBNA 2EXIA 4QXKA 2VQAA 1W8ZA 5ISLA 1S0EA 2HH9A 4Q4V2 5CAZA 2R30A 4QQ2A 5CZKA 1MQTC 3ZYGA 3SC7X 3USUB 4LKDA 5CBLA 3M3IA 1W6OB 2W68A 3FJSA 2P37A 2PAMA 2WT1A 3AXDA 1DP0A 3MIHA 4GALA 4QPGA 2GDFA 1LR5A 4DFSA 1RUC1 4BHPA 2D5FA 3TN93 1H9WA 2ZJCA 2RDRA 4PIYA 1OXCA 1WLWA 3E5QA 2QDNA 3GBFA 2CY6A 1PVC1 1LHUA 5EHDA 3MPBA 3ZFFA 4KH9A 4B1LA 1VIWB 5DAXA 2HWB1 2G9GA 1H6XA 3LFIA 4YW4A 4ASKA 1QJX3 2VCAA 5LB6A 4B7KA 5FMBA 3NWKA 1NY71 1L7RA 1VMFA 2BEOA 1N3PA 4H55A 1GZWB 1V6OA 5E89A 1AJKA 3CJIC 5FYZA 1W90A 2LTNA 4EWDA 4O7XA 3GHMA 3W58A 1W04A 3WQ1A 3AJZA 2ERFA 4I0AA 1H30A 4XHBA 3HBZA 3WG2A 3HNYM 4M0NA 4KBBA 4QPWA 1X9TA 4RYDA 2JX9A 4Q4V1 2GC2A 3RQ0A 4Y20B 1XE0A 1YC61 4AK3A 5ABJA 3W5NA 1VAMA 2J1RA 3IKWA 2R063 2RS13 2WLPA 4OCTA 1Y7BA 4RQPA 4LBNA 4QPGC 5C3RA 3VUOA 1S0JA 1UPIA 5GZEA 3T0DA 2JICA 1GOHA 2ZTNA 2C4XA 1YQ2A 2CSGA 2VQTA 3MIDA 1DG6A 2JDPA 2QQKA 2RE9A 4ES8A 1IS3A 3POEA 2OA2A 3ZFFC 3C8XA 4AAPA 1W3XA 1UD1A 4XZUG 1O91A 5FKBA 3VDCA 1H2NA 3RMYA 3S30A 4LUMA 5F2WA 5A33B 5FMDA 2GMPA 3C7OA 1VAKA 3KM5A 3LA3A 4CEWB 4COVA 3RWNA 1AR73 1R1A3 3C2UA 3KSCA 3H1WA 2DV9A 2Q1FA 1NG0A 4Q4X3 4AG4A 3HT2A 4CCOA 5FFOC 4XCBA 5BY5A 1J3PA 4F83A 4OQ8A 1Z0HA 3KLSA 2JIJA 2VNVA 2OW4A 3PU8A 5E16A 2P3IA 1ASJ3 4Y22A 1GFF2 2XLFA 3FUQA 3U4XA 3ZKUA 5DG2A 3ZSJA 2PN5A 3IDEA 4P5HA 3W21A 5ABJC 1NLRA 2A6YA 1GNYA 1W6NB 3WDWA 2FD8A 4GMP1 3ILNA 1KFXL 1PO13 1QXPA 3KV5A 1UZZA 1S0GA 4UBGA 1RUF2 1XB9A 1HX6A 1Y9MA 4FPKA 4J25A 1UN1A 1BBT3 4IGPA 4YWAA 1W6MA 4B4RA 4DXTA 5FZAA 5A3MA 1QJY3 5FQ0B 5L19A 3L9JT 1JU4A 2DVGA 4I01A 4O9EA 5A1FA 4AI3A 4NE9A 1COV2 1OLME 4JV4A 4Y1VA 3GHNA 4DY5A 3POBA 4Q0SA 4RQPB 4AI9A 1LECA 5LK7B 3FZ3A 5BUVA 3B01A 4Z82A 3N7MA 4NROA 4AEJA 4UWDA 2B46X 2IUWA 4LLOA 2YC0A 5LBCA 5EYXA 1AVBA 2OS2A 3IDBB 3T2PA 3AKSA 4C0BA 1G9CA 3PIGA 3CL1A 3VBUC 3UNPA 2GNBA 1HV1A 2BNOA 2GSYA 4ITCA 1DQ5A 2Z42A 3IIAA 2YGMA 4D7TA 5I93A 4AQTA 1W2OA 3NJVA 4GULA 4JDMA 1VBE2 5JWPA 1BK0A 5EWSA 1VB2A 4C90A 1D4VB 3ZYJB 3RNSA 4H7MA 1ALYA 2AC1A 3I54A 4A2UA 5DUWA 2CHHA 2ENRA 1E57A 3KV9A 2QQJA 4B8EA 4G4FA 3ZXEA 4AFDA 1C4RA 1PMJX 1QDOA 1JBCA 1WLTA 4OMDA 5CFDC 3B9IA 5CG9A 5IHRA 2JDHA 3C7FA 4W4ZA 5FZ6A 2G9FA 3NV2A 4AAXA 2AR6A 4Y22B 4YVSA 4ISQA 3AP9A 2RG4A 5L9RA 2RJ2A 4BQXA 1GP4A 1G6NA 4XJUA 4WVZA 4IV3A 2YMZA 1COV1 1REEA 2GZWA 3K4ZA 1K42A 1BVP1 5GLVA 2JD4A 5FZ0A 3IB3A 5G05L 4QU2A 1FMD2 2XJQA 1Q5OA 4K7JA 1AL0G 3BB6A 3M3QA 4COUA 4E4DX 4FTBA 4QX5A 1WCSA 4GKYA 4UOJA 4TN7A 4LEJA 4XF9A 1FATA 4XZPA 2DFCA 3PU3A 4PLMA 3WZ1A 5K0UB 2HYXA 3CZJA 4Y3OA 4XVHA 3B9CA 2WDBA 4W50A 4A7YA 4BZ4A 2BGOA 4PF5A 4COWA 1RUE3 3DCQA 5LBEA 2PLV2 4QX7A 1ZRCA 1HJFA 1VBE1 1UMZA 2PHRA 3SCGA 5DAWA 3RSJA 1I1EA 1J59A 2JWPA 2AENA 3BODA 2WO3A 3UV9A 2RM21 2GU9A 3NL1A 3OG2A 5D2AA 5G04L 4MHUA 2R49A 4CP9A 1BVVA 1UOFA 4CCCA 2WJSA 3BU0A 3MIBA 4META 4CCKA 3E97A 1AR83 2BU9A 1Q8PA 4DRRA 4KU8A 3ZYFA 3RRDA 4XABA 4QQLA 4YVSC 1AHSA 4IE7A 4GB31 1H4HA 3HT1A 3RZLA 1OUSA 1HIXA 4FXGB 4M3CF 2WZR1 2DTWA 5FIXA 2XQXA 4CUBA 1LESA 5JIAA 4A7KA 3GCXA 1XC6A 1SLCA 4IV3C 3L2YA 4AGVA 1DLLA 3H42B 2ZEZA 2W87A 3WHTA 3SMHA 3K51A 1S2KA 2VR4A 3EJKA 3CJXA 1O59A 2E31A 1UOJA 2VAUA 4NHMA 4EE2A 5GZCA 3AZZA 1FMD1 3WNMA 1FNZA 2YB7A 1W2AX 3LEKA 3O0WA 4YNIA 5HV4A 1IHMA 3OJBA 1US2A 4M00A 3ZYRA 3IIIA 2W1WA 3LD8A 3LSEA 4UFHA 4AI1A 4XDOA 4BPZA 1XQNA 1JHJA 3J8F3 4CU8A 3VBFA 2PLV1 3S57A 1VBC3 4AEDB 1RUD3 4XFGA 1QHDA 1A3KA 1S0CA 3CF6E 1LB2A 4EZHA 5FP3A 4YG0A 4H7LA 1VBA3 5DXDA 1NYWA 2ZMNA 1UXZA 1W3VA 1IKPA 1SZBA 2K2SA 3GNEA 5DZEA 3N9OA 3PNAA 3BTYA 3BI3A 1O4ZA 4INDA 4DUWA 3JD73 4AQ2A 1OI6A 2JEMA 3WP5A 4QXCA 1RUOA 2GNMA 4IXLA 2D5HA 3HIFA 4NOTA 4EYUA 4JX0A 4A7ZA 5FY1A 2ZMKA 2CAVA 2QQPA 3N7KA 2Y6LA 1A8DA 4QQHA 1PX4A 5T3NA 2VOKA 5IAVA 1AX1A 2OZJA 2ZKLA 3AMNA 3B02A 3ASIA 4K8FA 3VDDA 1QOTA 3D6EA 1IG3A 4CRQA 1GNZA 4QDSA 2WNVB 4NPLA 1AYM2 2A6WA 3UJOA 3KQRA 1AR62 4A3XA 1OA2A 1WCKA 5AVAA 4DXSA 1DCSA 1OHFA 5DAVA 4HMZA 1RUI2 3NMBA 4P9YA 3VBFC 1DLCA 2WZEA 2BVVA 2D98A 1WW7A 2XJRA 3ZFGB 5L36A 1G86A 2XBO2 1UPSA 3ZR6A 1SHWB 2DUPA 2R062 5A3UA 4YFWA 1UZ0A 4Q5OA 2XWBB 3CO2A 4FP2A 3WF0A 5J09A 5J48A 3ECQA 4Q4Y2 5I91A 3RZGA 2VZRA 1DZTA 4DS0A 2R1BA 4LITA 3BTZA 1MVQA 2PELA 4FSJA 4I0WB 2DVDA 1XNTA 4QQPA 3TAYA 1UMIA 1DGRA 1UY1A 1GKBA 2WA4A 1HQLA 2F6BA 2XJUA 2WFF3 1S2EA 2D40A 3EO6A 2GNTA 2QCSB 4L8QA 3R4SA 2RS33 3MUY1 1QNWA 5BNPA 3LPGA 4YG3A 2W95A 1GWMA 3VDDC 4ZKTB 3OUJA 2RMU2 4Q4X2 1R1A2 1C8M3 3UJQA 5IYYA 5IVVA 3ZMOA 3WV6A 1YFXA 1AF9A 3AC0A 3AZWA 2UU8A 2Z4FA 4IE5A 1W2TA 2XR4A 4Z92B 1JOBA 1OLQA 1UYZA 1W39A 1GOFA 4BQWA 4DXZA 1F8VA 5FZLA 1SCSA 1AR61 2J7MA 3NJXA 3WINE 1ASJ2 1EP0A 2A7AA 2BTVC 3JQXA 4HSJA 1XNAA 2R32A 3ZFEA 4B29A 1OOPB 2BOJA 4A41A 5JOYA 1PMHX 2R061 1EPWA 2RS11 4QX2A 2VW2A 4XBNA 1VALA 5LY1A 4NIDA 4YYOA 5BYNA 2JECA 4RHV3 1XJAA 4Q4Y1 2UURA 3H0OA 1BBT2 1CJDA 1REDA 1ULEA 4SBVA 3U14A 1O3QA 2ZCWA 3I4IA 1FT9A 1QJY2 4GH4C 1YJLA 2BP6A 1CAWB 3M4FA 5FZOA 2BGPA 2WQZC 4N9HA 5FDBA 3T2QA 4P9WA 3IAPA 3LDBA 5BNPC 2GP3A 2Y8KA 3BIWE 3HN3A 4M0HA 4NUBA 3SH5A 2G9ZA 4KWUA 2RMU1 1AR71 1R1A1 3FBYA 4Q4X1 3AYAA 3K4DA 2BVBA 2CWSA 2EALA 3NAPB 4ZXKA 4BA6A 4CXYA 5I8SA 1R092 3W59A 2YU2A 1PHMA 3O7OA 3O0VA 4HG6B 4N43B 2MEV3 5SV8A 1CD3G 3LQCA 1TNFA 2W5FA 1ASJ1 1WA4A 1XNCA 5BNNB 3W9AA 5FO8B 1SBFA 5JSOA 3NW4A 5A32A 1MS0A 3DECA 5KC6A 5FR3A 3ZFEC 4IEOA 4NAOA 1LOFA 5A7QA 5FOBB 4WBBA 2P3KA 4UT5A 5F32A 1DQ4A 1HDKA 4K1ZA 4MHRA 1AYN3 2E7QA 4IEVA 2JDUA 3U11A 2JE9A 2RDQA 2YFZA 3H9AA 2JXAA 3A0KA 1BBT1 2W1SA 3ZN6B 1W9WA 1ENQA 1UY0A 1IPJA 2MPFA 1EPZA 2ZEXA 1CIYA 1LCLA 2ZOEB 3TBDA 5AC93 3EQEA 1QJY1 2QZ2A 2VXJA 3PIJA 4GIQA 2Y6JA 1J1LA 2ES3A 2RHPA 5F39A 1RVF3 3DGTA 3IMMA 1RB8G 2VBPA 3NV1A 5D8AB 3RZJA 3G7DA 3OD0A 4G3YC 5F2SA 2Y60A 1A78A 1NCQA 1JMUB 5H9PA 4ZU7A 5HBAA 3WR0A 4IW3A 4KGGA 1REFA 1UZWA 2GMMA 3DUIA 1R091 4LBJA 3D0SA 4HOOA 5FZ4A 4Y5Z0 4ZPIA 2VMFA 1JHNA 4CTEA 2W92A 2Q8OA 1POV1 4GXLA 1B35A 1YFUA 3I3DA 1RUE2 2AZ5A 1UIJA 3K4AA 1QJZA 4PCRA 5D1IA 1LOFC 3TRSB 3OBAA 3WNLA 1UY4A 4Q29A 4FCAA 4MGIE 4LORA 3I97A 3LOBA 2DVAA 3LOIA 1YXWA 1YEWA 5JI9A 5FLIA 5FXXA 2QQIA 3AFGA 1GLHA 3B3QE 4LHKA 1CAUB 4AFMA 4I02A 3PURA 4XXPA 1F35A 1RYYA 4DPNA 2XJTA 1HRI3 2UWAA 4CEYA 2VBBA 2RDSA 1XYOA 2I74A 3CU7A 5JR7B 2QNKA 1BKZA 4ATFA 1GSLA 1Y9GA 3WUDA 4B7EA 2AACA 3PTRB 3DPRB 1UOBA 4QKDA 3V0BB 3ENRA 2VUDA 5HCHA 1NX9A 1H8TC 4CDWB 3I3BA 4R9BA 1NCQC 1OKQA 4KQ7A 2X8KA 4WVVA 2D6KA 4HT1T 2JKXA 2X09A 3IT8A 3N7JA 4K1YA 1WBFA 3EB7A 4FOYA 1RINA 5A6ZA 5FYBA 1LU2A 2CV6A 3JB4C 1B35C 4P08A 3J8F2 2J1SA 1FPN2 1RUE1 1ZRFA 1VBC2 1NA1B 3THTA 4FOVA 4BQ5A 1RUD2 3WSOA 1GICA 4D7YA 3AM2A 4ZHNA 1H2MA 1GNHA 4RR3B 3E5UA 4XUPA 4KG0A 3VL9A 3DV8A 2JG8B 3PHMA 5A3TA 2OXBA 1H2LA 4DB5A 1N1YA 2JENA 3FBMA 3IZOA 4TSVA 1QXRA 1AR81 3ES1A 5A7WB 3JD72 1ZA4A 2A71A 1OKOA 2X5IA 4LA2A 3BYWA 4JVAA 5CVRA 5A7NA 5FZEA 4CEYC 4IEPA 3O1OA 2VNOA 3OUHA 3PL0A 4JGYA 2V09A 2VBDA 4F8AA 5F37A 2NM1A 2RVAA 5KHKA 3LEGA 3LZZA 4U2AA 1AX2A 3P3NA 5LCWL 1SFYA 5GALA 2CAUA 1ZYBA 5CIRA 3ETPA 1IS5A 3O1UA 1AL23 2JDAA 5LY2A 3VD9A 1BJQA 1W9YA 2OPWA 5J98B 1XYPA 5CEHA 3HVDA 4L92A 3RJRA 2VZVA 3ZN4A 2VH9A 4IV1A 1QH6A 1I9RA 1LEMA 1RITA 2LALA 1HQNA 4HVOA 4P5YA 5IW0A 3IAQA 3J8F1 2VQ0A 3VN4A 1M06G 2ET1A 2JKBA 1KS4A 4RGAA 1VBC1 1SFNA 2CYFA 4LJHA 2WNOA 2YPDA 1W06A 4IESA 4AVCA 1RUD1 2Q1ZB 2YHJA 3A21A 1O3TA 4IE4A 4MXWB 3LEMA 3LA2A 5FPZA 4R9CA 5J96B 4Z1VA 4FPYA 4XF4A 1UY2A 1Y43B 1ULOA 2CWMA 2VMDA 3UESA 3J7NA 4L99A 2X5IC 4S2HA 3VBRA 3JD71 4YVWA
chains in the Genus database with same CATH topology
4ZS3A 4NRPA 3O1VA 3I49A 3T4VA 3O1MA 4NIGA 3S5AA 4NPMA 3BUCA 5F8PA 3BU0A 4IE5A 4IDZA 4IE6A 4IE7A 3RZLA 3T4HB 4NIIA 4NRQA 3O1TA 4QKDA 2FDJA 2FDHA 5DABA 2FD8A 4NIDA 3T3YA 3KHCA 4QHOA 4QKBA 2FDIA 3RZMA 3O1PA 3BIEA 3KHBA 2FDKA 3S57A 3BTXA 4ZS2A 3H8XA 4IE0A 4ZHNA 4NROA 4MGTA 2IUWA 4CXYA 3BTYA 3BI3A 4RFRB 3O1RA 4QKFA 3I3MA 3O1OA 3I2OA 4NIHA 4NRMA 3O1SA 3O1UA 3RZKA 4NPLA 4O7XA 4QKNA 2FDGA 3RZJA 4NJ4A 3LFMA 3RZHA 3H8RA 3H8OA 4O61A 4JHTA 3I3QA 4OCTA 4MG2A 4IE4A 3RZGA 2FDFA 4CXXA 3BKZA 3BTZA 4CXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZS3 A;  4NRP A;  3O1V A;  3I49 A;  3T4V A;  3O1M A;  4NIG A;  3S5A A;  4NPM A;  3BUC A;  5F8P A;  3BU0 A;  4IE5 A;  4IDZ A;  4IE6 A;  4IE7 A;  3RZL A;  3T4H B;  4NII A;  4NRQ A;  3O1T A;  4QKD A;  2FDJ A;  2FDH A;  5DAB A;  2FD8 A;  4NID A;  3T3Y A;  3KHC A;  4QHO A;  4QKB A;  2FDI A;  3RZM A;  3O1P A;  3BIE A;  3KHB A;  2FDK A;  3S57 A;  3BTX A;  4ZS2 A;  3H8X A;  4IE0 A;  4ZHN A;  4NRO A;  4MGT A;  2IUW A;  4CXY A;  3BTY A;  3BI3 A;  4RFR B;  3O1R A;  4QKF A;  3I3M A;  3O1O A;  3I2O A;  4NIH A;  4NRM A;  3O1S A;  3O1U A;  3RZK A;  4NPL A;  4O7X A;  4QKN A;  2FDG A;  3RZJ A;  4NJ4 A;  3LFM A;  3RZH A;  3H8R A;  3H8O A;  4O61 A;  4JHT A;  3I3Q A;  4OCT A;  4MG2 A;  4IE4 A;  3RZG A;  2FDF A;  4CXX A;  3BKZ A;  3BTZ A;  4CXW A; 
#chains in the Genus database with same CATH topology
 3VHR A;  3U0Z A;  1NAE A;  4WVM A;  4UW5 A;  4XIL A;  1MEC 3;  3K75 B;  4I30 A;  4JGY C;  1BMV 1;  4JC1 A;  1UW8 A;  4AHW A;  3D3A A;  2BNM A;  3ZKY A;  4CCJ A;  4KBZ A;  1QQP 2;  1DQ0 A;  3KF5 A;  1RXF A;  2ZX1 A;  3AMP A;  3OBR A;  4WV8 A;  5E6H A;  4E2Q A;  3ZDS A;  1BEV 2;  5EYY A;  4BWO A;  3K3O A;  1E5S A;  3KZ4 C;  1WLD A;  2XHK A;  2D3S A;  3PVN A;  1D4M 3;  2VZS A;  4CDQ B;  2VC9 A;  4ZZ8 A;  3GZE A;  4N53 A;  2FBE A;  4IV1 C;  3HBK A;  3MIC A;  3NKT A;  2DVB A;  1FX5 A;  3LGR A;  4Y4Y A;  3DXU A;  2GH2 A;  1OUR A;  1LOC A;  1YQ5 A;  1BXH A;  2OQ6 A;  2ZGQ A;  3T0B A;  4YFZ A;  4G9S B;  1U12 A;  2XB6 C;  1JZ2 A;  1RXG A;  2PQS A;  3A23 A;  4AW7 A;  3TYJ A;  5FZ3 A;  1XU2 A;  4ORF A;  5CIS A;  4PDW A;  2YBP A;  2R1D A;  4FAH A;  5BNO B;  2JG9 C;  5FCC A;  3VBO B;  3KHC A;  1AXY A;  2VVF A;  4YW2 A;  5IVY A;  2DU0 A;  2C6S A;  3VBR C;  2TNF A;  2FDI A;  4YVW C;  3WVJ A;  3LEI A;  1C1L A;  2WQ4 A;  3WNK A;  4K8R B;  1A6C A;  1HV0 A;  5GZF A;  3MFA A;  4ZZ5 A;  3M3E A;  3DF0 A;  1NCR A;  5IVJ A;  3OGS A;  5JSP A;  1LEN A;  1MZF A;  3C7E A;  3H7Y A;  5FY5 A;  3UT0 A;  1PVC 2;  3ZX7 A;  1EAH 3;  1QJF A;  4IE0 A;  4AVS A;  4DEV A;  4JTN A;  3O12 A;  2LW8 A;  4BU2 A;  4RA0 A;  1H8V A;  1C8M 1;  4Q0P A;  3E5X A;  3ZO0 B;  2BFU S;  4R8H A;  5LRS A;  1TMF 3;  4WVM B;  5BXX A;  1FOD 3;  3Q8C A;  3CHX A;  4URA A;  4N53 C;  4GWM A;  1JUI A;  3RFR A;  1DQ1 A;  4XFA A;  3WQ7 A;  4ASL A;  1GUI A;  5FZK A;  3BN6 A;  1O3R A;  5FUP A;  5HI0 A;  1VAV A;  2WNU A;  4QX0 A;  4N7U A;  5GLW A;  1S0B A;  4AYU A;  3B93 A;  3MLL A;  3Q8F A;  4UF0 A;  2EXH A;  3AP5 A;  2Y6K A;  4PQ9 A;  3VDB A;  2J1U A;  2CTV A;  4PDW C;  3SCH A;  4CDU A;  4YSF A;  1AYN 2;  3POG A;  1BZW A;  2JDM A;  1RUH 3;  4MYE A;  1QJU 3;  3VB9 A;  2WAB A;  4RHV 1;  1VBB 3;  2D3P A;  5C3Q A;  2P5B A;  2YV8 A;  3VBS B;  1AXK A;  5J1X A;  2ZXQ A;  5FTT C;  2R07 2;  1W6P A;  5T5O A;  3HN1 A;  1U5X A;  3WNN A;  4RS5 B;  4AR2 A;  3ATG A;  3I2D A;  2W94 A;  1JOD A;  3KGL A;  3SKV A;  3ZYB A;  3TNQ A;  4K6B A;  4CDX A;  1NCR C;  4YLZ A;  1RVF 2;  2P17 A;  2XJV A;  1WW6 A;  4DRV A;  2E26 A;  1HRV 3;  1FAY A;  2IFW A;  1XBF A;  3VZL A;  1OMI A;  1W6Q A;  3RMX A;  4JHT A;  2GN7 A;  1MQT B;  4XCA A;  1JZ6 A;  2QKD A;  5JPN B;  4A44 A;  2ID4 A;  2LRO A;  4CA9 A;  1UO9 A;  1DZR A;  3BKZ A;  2BRT A;  1LOA A;  2E6V A;  2VW1 A;  3CMG A;  2BFU L;  2XGX A;  3KV4 A;  3A7Q A;  1UYX A;  4IQP A;  5GM0 A;  1KRI A;  3KWV A;  4FO9 A;  3VLB B;  1DQ6 A;  3SH3 A;  3ELN A;  2MEV 1;  1E5R A;  3KS7 A;  2WNU C;  2VG9 A;  2VCB A;  5FZF A;  4ASM B;  3T1L A;  5I0U A;  1MS1 A;  3KQ4 B;  2F17 A;  1DYP A;  5HCB A;  5A6Q A;  2OQ7 A;  4CDU C;  5A7S A;  1V6M A;  1AR9 3;  4AWD A;  4QGL A;  4AI8 A;  1JZ8 A;  3LF7 A;  1AYN 1;  3A0N A;  1J83 A;  5T55 A;  2VCM A;  4QB6 A;  2Q4S A;  4XJ8 A;  4XXA A;  1OA3 A;  1VRH 3;  4XBL A;  2A3X A;  2XML A;  4ATE A;  3CJI B;  2R07 1;  4LBQ D;  5IK8 A;  1HRI 2;  4P9J A;  2GC0 A;  1VB4 A;  5AC9 1;  1Q56 A;  3QLQ A;  4QB2 A;  1J84 A;  4CDX C;  3ZVX A;  2PAK A;  5FWJ A;  3JUU A;  2VZU A;  2ZAB A;  4FPC A;  1PK6 A;  1RVF 1;  4KWJ A;  5LAS A;  1CWP A;  4M3C A;  1JYV A;  1D2S A;  3ZSK A;  4COZ A;  1UU6 A;  1SDD B;  2WS9 2;  5SV5 A;  2OKX A;  1ZRD A;  3DYP A;  3TOJ A;  4YW3 A;  4MV2 A;  3KD4 A;  4L9B A;  1JZ4 A;  3RZZ A;  1UU4 A;  1R08 2;  1PGS A;  4QPG B;  3IDA A;  2Z2S B;  4BIO A;  4HPK A;  1JXN A;  2YG0 A;  2J42 A;  5LW9 A;  5F3C A;  4MLO A;  5A7P A;  5JAX A;  3O1P A;  2GAL A;  5DUU A;  3VBU A;  3WG1 A;  3DXT A;  2TEP A;  3N4M A;  4ZY9 A;  3ZFF B;  4XBQ A;  3THP A;  4OI0 A;  1W8O A;  1K5M C;  2O8O A;  3IMN A;  1LNS A;  3FFQ A;  4TWT A;  2XDV A;  2ZEY A;  1YIP A;  4JGZ A;  3QH6 A;  4P9I A;  4WM8 A;  5FAX A;  3ZSM A;  4MH0 E;  3NNL A;  4B4Q A;  2BPA 2;  1VMH A;  4YG6 A;  2DCZ A;  2V72 A;  1K12 A;  2DTY A;  4LPL A;  4DUV A;  3V56 A;  3WW3 A;  1V6K A;  4YM0 A;  3ZIX A;  4FTS A;  1Q8O A;  5CFD A;  1HRI 1;  1IS6 A;  2W0X A;  5L9V A;  5FY9 A;  3VGI A;  1V70 A;  4Q2F A;  5T52 A;  1C5H A;  4ONU A;  5JMO A;  3MFC A;  1PK6 C;  4LOS A;  1UYY A;  4D7S A;  5HPO A;  2XG3 A;  3HQR A;  1SMV A;  3LPF A;  2RR1 3;  4M4P A;  2FMY A;  1H1I A;  2WS9 1;  5ABJ B;  1JUH A;  2ARX A;  2CGN A;  3OD4 A;  2Y6G A;  1MS3 A;  4FOQ A;  3QAC A;  4AEK A;  2ZAA A;  1O3S A;  2ARB A;  2CNA A;  4N9I A;  4OHX A;  1R08 1;  2DWR A;  5CKQ A;  4QT6 A;  1KEX A;  5FY8 A;  4D8M A;  1J3Q A;  1WCD J;  5I0R A;  5JOX A;  3ES4 A;  4Q1R A;  4UFM A;  3POW A;  1OT5 A;  3GDB A;  3WDX A;  1RMU 3;  5F7U A;  5CYY A;  5B2G B;  1CPM A;  1YQC A;  3LE0 A;  1Y4W A;  3H8R A;  1GMM A;  4WM7 A;  1HKD A;  5BV6 A;  1LGC A;  4JGZ C;  4O61 A;  4WM8 C;  1GV9 A;  1PZ9 A;  2BDR A;  4AQ6 A;  4ERO A;  4DY3 A;  1ZA7 A;  1SQ4 A;  1F5J A;  2FDF A;  2RM2 2;  2KXL A;  5JUV A;  2BER A;  1ZVF A;  4JZR A;  4IUG A;  4V1P A;  3E6C C;  1RJ7 A;  5C3S A;  2WAA A;  4P9G A;  3VBU B;  2VQU A;  4UFI A;  4Q27 A;  1CAV A;  2XKO A;  1MEC 2;  3AYC A;  2AH2 A;  4NRP A;  4LE4 A;  1QU0 A;  4B4P A;  4CCM A;  2P3Y A;  4GB3 2;  3T4V A;  2WZR 2;  2WN3 A;  3I2K A;  4XDQ A;  4LBQ A;  5LBB A;  3VD7 A;  2WR9 A;  4LK7 A;  2EAK A;  4NR1 A;  1AX0 A;  5IT6 A;  3D8C A;  2VOX A;  1ND2 A;  4PF1 A;  2PHW A;  2HEY F;  2HLE A;  4BK4 A;  5J3U A;  5FPA A;  1D4M 2;  5A3O A;  3TEX A;  4YW1 A;  4OMC A;  2IVI B;  2BQP A;  5FJH A;  3VV1 A;  2RS5 3;  2ZML A;  1W6M B;  3DN7 A;  1UX7 A;  3HNB M;  3T4H B;  1HB3 A;  2D44 A;  2B7Y A;  2WIN B;  3FLR A;  3MW2 A;  3UET A;  1UKG A;  4WM7 C;  4NHK A;  2P3J A;  2VZQ A;  1M4W A;  1OVS A;  1GR3 A;  4BH9 A;  2FDJ A;  1YUD A;  2YGL A;  2R0F A;  5F5A A;  1PM4 A;  3RYK A;  3H8U A;  3LIG A;  3I2G A;  5FUN A;  4IEW A;  4HN0 A;  2KM2 A;  2Y38 A;  1ULC A;  2D3R A;  1N1S A;  5DPN A;  1F9K A;  3M2M A;  4BQ3 A;  2WYS A;  3KCX A;  1D0G A;  1W8W A;  1KJL A;  1OUX A;  1W0P A;  2XOM A;  3AXE A;  4IER A;  1MEC 1;  3KHB A;  4JRA A;  4XDP A;  3WF3 A;  3RS6 A;  4E2S A;  4I09 A;  3FE5 A;  2G19 A;  2WT0 A;  2IXJ A;  4XUO A;  2FCT A;  5K4L A;  5FMC A;  5FO7 B;  2J1E A;  2XVG A;  2WSU A;  4GD4 A;  1F4H A;  2WII B;  3THC A;  4LUK A;  4C8D A;  3NNG A;  1ND2 C;  5JCT A;  3FLT A;  1TMF 2;  1IKQ A;  1FOD 2;  4JKL A;  3UYJ A;  4BDV B;  1D4M 1;  3KVA A;  2B45 X;  5CFC A;  4LHS A;  2ZGU A;  2NP0 A;  4YVS B;  4DQA A;  5I0S A;  1W8U A;  5HCA A;  1MZ6 A;  4OUE A;  4CU7 A;  2UYB A;  3SIT A;  3I2O A;  4GWJ A;  5AFB A;  1ZNP A;  1BQP A;  2IXK A;  4FI9 A;  4IV3 B;  4JRL A;  2ZS6 B;  1FV2 A;  3SIS A;  2E32 A;  2R6Q A;  2ILM A;  5L7O A;  1QJU 2;  4CUG A;  4YZ1 A;  1VBB 2;  2W46 A;  4XJW A;  3R0R A;  4QU1 A;  4HFS A;  4HK9 A;  4MX3 A;  2NMN A;  1QGL A;  5DUV A;  5FPL A;  1SBD A;  2WBK A;  4BMB A;  3TN9 2;  3N9L A;  1EUU A;  1DHK B;  2ZGP A;  3OGG A;  4PBO A;  4R9A A;  1HRV 2;  1W8F A;  3GZU C;  3MYX A;  5B4X A;  3AMM A;  1XSR A;  4XF0 A;  3E6B A;  4X8N A;  4XUR A;  2VUC A;  3FUO A;  4A45 A;  4EN6 B;  2LUW A;  3FHI B;  2VMI A;  3O0X A;  2ZX4 A;  2QBX A;  4M4R A;  4CP9 B;  1QJX 2;  2VZO A;  3LIH A;  5ACA 3;  3VDA A;  1TMF 1;  4LOT A;  4QXB A;  2WO2 A;  1FOD 1;  1EYB A;  5DDJ 3;  5CFC C;  3IM0 A;  4CXW A;  4A42 A;  2ZGM A;  4TYS A;  1WGP A;  4J1X A;  4X6Q B;  1RUG 3;  2OPK A;  5AFE A;  3NKG A;  5C8W A;  4FT8 A;  1HB1 A;  4MAD A;  5I0D A;  1G9D A;  1OLM A;  3RYP A;  4BK5 A;  4JKK A;  1QEX A;  2QQM A;  4HKW A;  4QX3 A;  3S5A A;  1IG0 A;  1AR9 2;  5L7O C;  1RUH 1;  1QJU 1;  1TG7 A;  3NVC A;  3POF A;  2W52 A;  5T5L A;  1VBD 3;  1VBB 1;  1V6L A;  5DN2 A;  2RS1 2;  3WW4 A;  5FYU A;  3KT1 A;  3AZX A;  1BLZ A;  3I59 A;  4GWI A;  2VVD A;  1CAX A;  1APN A;  4QXH A;  1JTZ X;  1MR5 A;  5C6C A;  3TN9 1;  5KHJ A;  3U1X A;  3WDT A;  3KF3 A;  4QDR A;  5C3O A;  1PM7 A;  3OGJ A;  3VBF B;  4GH4 A;  1HRV 1;  1KXG A;  3H1Y A;  1X8E A;  2SLI A;  4P14 A;  4XC9 A;  2B5H A;  4Y4R A;  3RYR A;  3ZSL A;  3IWZ A;  1CGP A;  3MIG A;  4QPI A;  3VKM A;  3H50 A;  2DUO A;  5FZ9 A;  1DGW A;  4Q1P A;  1QJX 1;  4FPO B;  5FPB A;  1GZC A;  1QKQ A;  1T6B X;  1LGB A;  1DGW X;  1AR7 2;  4LNV A;  3RZM A;  2C9A A;  2H6C A;  3I2H A;  2B42 B;  1JYC A;  5I8T A;  3P3P A;  3OY8 A;  5FXW A;  3SH4 A;  4AVT A;  5FYV A;  1V6N A;  3GZA A;  5FO9 B;  3KT7 A;  4UFJ A;  5KBF A;  3K2O A;  3QCW A;  4QMA A;  4ZS2 A;  4AL9 A;  4AE2 A;  3GBG A;  5JI7 A;  4YZ5 A;  3MF6 A;  3S7I A;  2L9L A;  4EN9 B;  5C71 A;  2WC2 A;  1AR9 1;  1Y9Q A;  1QOS A;  3DL3 A;  3VDD B;  3MPP G;  2XLG A;  3V0A A;  2XVK A;  3FN9 A;  3WF4 A;  1PO1 2;  1U5Z A;  3MW4 A;  3UGF A;  5K7P A;  1TEI A;  2YBS A;  5EP9 A;  1PIV 3;  4KGQ A;  4KWL A;  4Z2W A;  3PVE A;  4GA9 A;  4LHL A;  4BME A;  2D93 A;  3OTF A;  4LMF A;  5IJR A;  4MGS A;  1KD7 A;  2QQL A;  2QQV A;  5EJZ B;  3ZXD A;  1ODM A;  2D97 A;  3POJ A;  1NOV A;  1ZRE A;  2Y0I A;  3MF9 A;  2RR1 2;  3WOG A;  4Y5T A;  4NRM A;  1XYN A;  2B39 A;  3T0A A;  2HWE 3;  4GJZ A;  4QPI C;  4EV0 A;  2C1F A;  2QZ3 A;  2VMC A;  2VUA A;  5KR7 A;  3RZK A;  3M8L A;  5DUX A;  5F6L B;  5JZG A;  1S0I A;  2DVF A;  4RL7 A;  3AL5 A;  1D2Q A;  1I5Z A;  4AGR A;  2VL4 A;  4PIZ A;  1KJR A;  3OGV A;  4GH4 B;  3OBZ A;  1L7L A;  2EXJ A;  2D7F A;  1V9U 3;  1ULG A;  1X82 A;  5HXM A;  2Q8E A;  2ETE A;  2HEV F;  1POQ A;  4CZS A;  1UAI A;  3HEI A;  2CU5 A;  4LO6 B;  3VZJ A;  5BNP B;  5JSR A;  1ODN A;  3J7L A;  2OVU A;  1PNG A;  3GYD A;  4HKL A;  4MG2 A;  3NJZ A;  3AK0 A;  4HON A;  3RI9 A;  3M1H A;  4LO4 B;  2W9X A;  4QX8 A;  5FZG A;  4Y1U A;  3VKF C;  3ZSE A;  2EIE A;  2XKP A;  1GQH A;  3N35 A;  1W8T A;  1LU1 A;  2I07 B;  3WF1 A;  4AQS A;  5A6X A;  1G9A A;  2HJI A;  2HWB 3;  1PO1 1;  2F4L A;  2O0O A;  3GZT B;  2A75 A;  1IPK A;  2R7E B;  2OYZ A;  3M3O A;  4A3Z A;  1AJO A;  5KXB A;  3FLP A;  4D6Q A;  2WA3 A;  3WNO A;  3ACL A;  2BNN A;  5AVP A;  2ZGO A;  2OX0 A;  2OUJ A;  3OF1 A;  1DYK A;  2RR1 1;  1Y3T A;  1DGR N;  2JB4 A;  3ZFE B;  4JDO A;  5F8P A;  4LKE A;  3KCY A;  4ZU4 A;  2VOW A;  3NJY A;  2A3W A;  4TLG A;  2E7A A;  3WCS A;  4DUX A;  5JZG C;  2O8Q A;  4XUT A;  5B4N A;  4DMI A;  5LZ6 A;  1H8T A;  1V0A A;  1JH5 A;  3N36 A;  2ARA A;  2VJX A;  5A1A A;  4OHV A;  4NII A;  4K40 A;  5FZO B;  2RJK A;  3ZYI B;  3NNJ A;  4GKX A;  4UBH A;  1JZ3 A;  1S0D A;  3ACH A;  2WN2 A;  4BOW A;  5JR2 A;  1X7N A;  4CP2 A;  1X50 A;  1T6G C;  2UYA A;  4CUA A;  4DXR A;  5DAB A;  3MO4 A;  1J3R A;  4YZ3 A;  2PHT A;  1FYU A;  2NLR A;  1OD3 A;  1ND3 A;  3FWE A;  1GZT A;  1C5I A;  4I0B A;  2E7T A;  3PJY A;  3J26 N;  3T1M A;  4NVP A;  2XON A;  5C4W A;  2GND A;  2BWA A;  5IFT A;  1AR8 2;  3BIE A;  3T2T A;  3FMG A;  2C9K A;  1GBG A;  1RUJ 3;  5FMO L;  2DF7 A;  4OYU A;  5FPU A;  2WWU A;  4H3W A;  3WP4 A;  2DFB A;  5A32 B;  3X29 B;  3BVC A;  1SLA A;  2WT2 A;  4J1W A;  1W8N A;  3AKT A;  3PVB B;  4O65 A;  4Q4W 3;  4XQ4 A;  2C26 A;  4XAC A;  5FYC A;  3WXP A;  3B69 A;  2BW8 A;  4FBF A;  1P8J A;  4IL7 A;  5A7O A;  1LHV A;  4JDN A;  4EWA A;  3SEE A;  4K3U A;  1D7P M;  3C3V A;  2ZX2 A;  4WVW A;  3O5S A;  3RPQ A;  1W0O A;  2RS5 1;  2Q5T A;  3HPN A;  3ST7 A;  3POS A;  1U0A A;  4JQR A;  2ZGS A;  3PUS A;  1S2B A;  3INA A;  1UMH A;  4V2V A;  1X33 A;  4YZ2 A;  1ENS A;  2E53 A;  2X05 A;  4XIO A;  4AXO A;  2VNG A;  2WAO A;  3WG3 A;  1SPP A;  4W8J A;  2WRA A;  4CCD A;  1ACC A;  1MS8 A;  1H8T B;  5FP8 A;  1ND3 C;  4QHZ A;  3HMY A;  1NCQ B;  2ZGK A;  3PME A;  2WKK A;  4LBL A;  4D94 A;  3BTA A;  1OQ1 A;  1VBA 2;  4I3P A;  4HBN A;  4IEZ A;  5C4W C;  1NQJ A;  4HK8 A;  1O4Y A;  4BXF A;  4YGD A;  4Y33 A;  4E4Z A;  2YC4 A;  4Q8L A;  1LHN A;  2VCC A;  3ILR A;  1B35 B;  3ACG A;  4YM2 A;  5FYI A;  3RG0 A;  4LO7 A;  1G7Y A;  2DBN A;  2W39 A;  4W6Y A;  3N9Q A;  1CX4 A;  2I45 A;  3OYW A;  1BMV 2;  1JYT A;  4IGO A;  5HXV A;  3VBH C;  3WNP A;  3WW2 A;  4Z07 A;  3WF2 A;  1ZRI A;  3RDI A;  2P1B A;  2VD7 A;  4XE9 A;  4CXX A;  2HWF 3;  5DDJ 2;  5FRA A;  1PO2 3;  4CCN A;  1F31 A;  3EXU A;  3MBW A;  1AXZ A;  1RC6 A;  2GH8 A;  4Q0Q A;  4OQ9 A;  2WZP P;  4A4A A;  2R16 A;  4CEY B;  5JOW A;  5FY0 A;  1IQA A;  2ORX A;  4AI0 A;  1URX A;  2DYC A;  2PHU A;  5C9A A;  4YGC A;  2P6C A;  1JOJ A;  1RUF 3;  1VJ2 A;  1ZZB A;  1ENX A;  4MXV A;  5FLJ A;  4AFA A;  4TTG A;  4XMI A;  3MIE A;  4D6S A;  3SQO A;  3VKN A;  4Y1X A;  3WUC A;  2VM9 A;  5JVV A;  4IDZ A;  3VZK A;  5FKC A;  1N3Q A;  2RV9 A;  3AVS A;  3R4U A;  3ZPO A;  1WZX A;  4LE3 A;  1OH4 A;  4BXS V;  5EFU A;  2BGC A;  2YU1 A;  2OT7 A;  1VBA 1;  2BZD A;  1SLI A;  2JG9 A;  2VVE A;  2WO7 A;  4XFB A;  2IXH A;  2JB8 A;  2PAE A;  1IZ3 A;  4MSV A;  1V00 A;  2ET7 A;  2NPI A;  3ZXG A;  1NXM A;  4OLL A;  2VUL A;  4W6X A;  4FQZ A;  1JI6 A;  1GWK A;  3ETQ A;  5IK4 A;  1NQD A;  2WFF 2;  1MZE A;  4S2F A;  2SBA A;  2DUR A;  2RS3 2;  1GQP A;  5C8C A;  4OZX A;  3VKO A;  3K46 A;  4MGZ E;  1QF3 A;  1C8M 2;  1IS4 A;  1VBE 3;  4QM8 A;  3LCP A;  5DDJ 1;  4BE3 A;  4XAE A;  4AVB A;  2X5I B;  3A4U A;  3NV4 A;  3OEB A;  2O1Q A;  4C1X A;  5FYS A;  4RN5 A;  5EQU A;  2JDY A;  2UY8 A;  4PLO A;  2Q0A A;  1RUG 1;  2IXL A;  4JGY B;  5C9A C;  1YFW A;  1WW5 A;  3FC0 A;  3LB9 A;  1JZ7 A;  1VLN A;  4UYB A;  1NLQ A;  1RHI 3;  2EAA A;  1J1T A;  1JYN A;  1NUK A;  1YFY A;  1I3H A;  4CPB D;  1GP6 A;  3AP6 A;  3I2J A;  3MLJ A;  1CES A;  1T2X A;  3QH7 A;  4YM1 A;  1PIV 2;  3ZYH A;  1EY2 A;  1LED A;  2X53 S;  3HR9 A;  4RHV 2;  1OLR A;  3MV0 1;  1PGL 1;  5KHG A;  2ADD A;  1HXS 3;  1UZY A;  4IV1 B;  4JAA A;  4XFC A;  5FK8 A;  5DAQ A;  1JZ5 A;  2LM3 A;  3USU A;  1HLC A;  5L73 A;  4NIH A;  2IFR A;  2XH6 A;  1W6O A;  1TNR A;  3WX5 A;  2HWE 2;  4N90 A;  1MPX A;  2XWJ B;  4LR4 A;  2A70 A;  2WFF 1;  2YUE A;  3AP7 A;  1L3J A;  2QFE A;  2DCT A;  3C7H A;  2RS3 1;  5C8C C;  4HAN A;  3OUI A;  1WKY A;  2JJ6 A;  2JG9 B;  2CDP A;  4XJ9 A;  2ARC A;  2XLA A;  3EHK A;  3JXS A;  3K77 A;  5FZM A;  5FPX A;  2FHR A;  2VO5 A;  4MO3 M;  5T5P A;  3VBR B;  1DU3 D;  3AKR A;  2YRO A;  4YVW B;  1YCI A;  1WD4 A;  3ROU A;  3N9P A;  3MDP A;  1XOY A;  1V9U 2;  4QDQ A;  2CDO A;  3OB8 A;  4J6G A;  5FBJ A;  3OCP A;  3ORJ A;  2MEV 2;  2BJS A;  1QXJ A;  4BM8 A;  4HVR A;  3M7A A;  3OPW A;  1GZW A;  3BOP A;  4P02 B;  2A6Z A;  1NE6 A;  4Y1Y A;  1NLS A;  3AYE A;  3AB0 A;  1QIQ A;  3PMS A;  1PIV 1;  3SCF A;  2DU1 A;  4N53 B;  1CPN A;  4BLI A;  2WQ8 A;  1GU3 A;  5GLU A;  4E27 A;  2WFP A;  4F3J A;  5M0T A;  4YW7 A;  2ZHN A;  4FVV A;  2J1T A;  5A3W A;  4Y20 A;  5AC9 2;  1JYI A;  3QBQ A;  3VBS C;  3O1M A;  2ADE A;  5DMY A;  5IFP A;  1IOA A;  2HWE 1;  1C8N A;  1DZQ A;  4PDW B;  5FZC A;  5FZI A;  1UYP A;  3KVB A;  3U78 A;  3WT3 A;  5CG8 A;  2J22 A;  4OI2 A;  1FNY A;  1F5F A;  2ZZQ A;  4UXA A;  3ZR5 A;  4FFF A;  3CDZ B;  4YGB A;  2FCV A;  4Z2A A;  4XHX A;  2ZGR A;  3PJQ A;  4W65 A;  1TE1 B;  2B9V A;  1DGL A;  5FZH A;  1IQD C;  5FYM A;  1H4G A;  3ZPY A;  3R6S A;  3O1T A;  1G9B A;  1JOP A;  1V9U 1;  5A33 A;  1KS5 A;  1Q8S A;  3JB8 A;  4I2O A;  1NCR B;  5FY7 A;  5CKM A;  4CEW A;  4CP0 A;  2WSV A;  2W1U A;  3AFK A;  3PTY A;  2BBA A;  2Q8C A;  2JE8 A;  4OUM A;  3VKL A;  5A1L A;  5GLT A;  3FFZ A;  2F4P A;  1K5M A;  2NQY A;  1N1T A;  3B00 A;  4HL0 A;  4KNC A;  1H1M A;  5F5C A;  1VE0 A;  2PHF A;  4AHZ A;  1WCU A;  2HYK A;  4HVQ A;  5JXG A;  3K3N A;  4DEQ A;  5LEK A;  2BBV A;  4CU6 A;  2Q30 A;  1N3O A;  3AMQ A;  4CPB A;  2FDK A;  2VME A;  1RUJ 2;  3P6B A;  5FZ8 A;  5A70 A;  1W6N A;  2BYV E;  2QQN A;  2WNU B;  2YY1 A;  4LKS A;  4QX1 A;  4FAG A;  4UF0 B;  1ZZ9 A;  4Q4W 2;  1EUT A;  1A8M A;  1AYM 3;  5A3N A;  4AEM A;  2XL7 A;  3ZXF A;  5BNQ A;  2WYF A;  4CDU B;  5F5I A;  5EJ3 A;  2XHN A;  1AR6 3;  2G4I A;  4IET A;  5IVF A;  1WUV A;  3TEW A;  2K46 A;  1EV1 3;  4YM3 A;  5JXJ A;  2FZ2 A;  1RUI 3;  3LAG A;  5FQ0 A;  1YQ8 A;  4E4S A;  1W6P B;  3LWC A;  4Q0V A;  4JCK A;  3WW1 A;  2ZX0 A;  5J37 A;  4D0Q A;  1ULD A;  1W0N A;  1F2N A;  2XBO 3;  3I2F A;  4AGG A;  5FP7 A;  5KWR A;  4YPJ A;  1K5J A;  3Q8E A;  4CDX B;  2D6O X;  4Q4Y 3;  3ITQ A;  1CJP A;  3WQ0 A;  3AKP A;  2EVX A;  1PZ7 A;  4CEW C;  1ZBA 3;  4NN0 A;  1W6Q B;  2V5D A;  4SLI A;  1SFP A;  5JLV A;  2A73 B;  4MGY E;  1LTE A;  4PI2 A;  5F3I A;  4N8M A;  4BLJ A;  1XND A;  2W3J A;  4KMQ A;  1TME 3;  1W2N A;  3WP3 A;  4FPG A;  1OH3 A;  1LUL A;  1S4C A;  1W8H A;  2VOT A;  2IXC A;  5KXD A;  2LRP A;  4OUL A;  4OFG A;  3MGU A;  2CL2 A;  3RZH A;  2RDN A;  1ST8 A;  2VOV A;  4EJR A;  1F15 A;  2RMU 3;  1RUJ 1;  4QAW A;  1SCR A;  4WZC A;  3OPZ A;  4NIA A;  3HQU A;  4MOA A;  4RSU A;  1RL3 A;  1CVN A;  1K5M B;  1HJG A;  2HEW F;  2E33 A;  3N3H A;  3OOX A;  1O5L A;  2Y64 A;  4Q4W 1;  3SKJ E;  2ZZJ A;  1SLL A;  2ZHL A;  3C7G A;  1F4A A;  2JDN A;  2HWF 2;  1NXD 1;  2QE3 A;  4Z8B A;  1PO2 2;  3WHU A;  2HWC 3;  2J1V A;  2KA3 A;  1AL2 2;  4GAZ A;  4UW3 A;  5C70 A;  1CR7 A;  3VL8 A;  4P9L A;  1W9T A;  2XXZ A;  1N47 A;  4IEX A;  1DQ2 A;  1DBN A;  1GQG A;  3R4D B;  4RQP C;  3WDU A;  2AYH A;  4NIG A;  4X6R B;  1CN1 A;  1YJK A;  4QHB A;  1PK6 B;  3WNX A;  1QY4 A;  4M3C B;  4FPJ A;  4O9G A;  4K21 A;  4A6S A;  4GQ7 A;  3T30 A;  4XUN A;  2YBK A;  1TVG A;  3ZXK A;  1V6I A;  2V5Y A;  5D21 A;  2Y26 A;  5K0U A;  1CZT A;  3DEM A;  4GWN A;  4HPK B;  3MZH A;  4FPL A;  2P6H A;  3BPS A;  2PHL A;  2VUJ A;  3MI8 A;  1YLL A;  5JPM B;  2Z79 A;  1XE7 A;  5A3P A;  5CKN A;  4XIK A;  3B7M A;  4XAA A;  4BQ2 A;  4NRQ A;  4QPY A;  3LDK A;  4AI2 A;  5JXI A;  4XQW A;  1KGY A;  1ZZ7 A;  5FWE A;  1UU5 A;  4CCE A;  1H2K A;  1WA6 X;  2MHF A;  1R09 3;  3KT4 A;  4JGZ B;  4WM8 B;  5ERL A;  2EA7 A;  4BIF A;  4XYX A;  1AUY A;  5IUQ A;  1O7F A;  1POV 3;  1UZV A;  5KHH A;  1ONA A;  2HWF 1;  4QKB A;  4EN7 B;  1TQ5 A;  4XTP A;  1PO2 1;  4S2G A;  4OZO A;  4GZ9 A;  2DBI A;  5CNA A;  3GAL A;  2P2K A;  1AL2 1;  5GZD A;  4BYY A;  2VXR A;  1SLB A;  2VTF A;  5FZ1 A;  5HCF A;  5CFD B;  5J36 A;  1SDW A;  4D69 A;  1Q43 A;  4WZF A;  1LHW A;  1LAJ A;  3OGR A;  2D6L X;  3GCW A;  1OQE A;  2K0G A;  1RUF 1;  1ZBE 3;  2Y34 A;  5FLH A;  1OPO A;  2Y33 A;  1RHI 2;  5F3G A;  4LQR A;  4EN0 A;  1WLC A;  1UNB A;  1UXX X;  4FPF A;  3CIH A;  4Q0U A;  2WWJ A;  3ZM8 A;  5FXV A;  5K0U C;  5DZF A;  2G1M A;  4R9D A;  1LKN A;  2BOI A;  2WLQ A;  3E6D A;  1QNY A;  3FHA A;  3I3M A;  3S0M A;  4XOG A;  4NHX A;  2QVS B;  2Y6H A;  1HXS 2;  2D6P A;  4Q26 A;  1O5U A;  1PMI A;  1UKR A;  1UF2 C;  3E1F 1;  4XQD A;  4AED A;  4TZD A;  2QUO A;  2VZ3 A;  3NV3 A;  4R4Z A;  4WM7 B;  5C33 A;  1DDL A;  4B1M A;  1CIW A;  4QGM A;  1O8S A;  1PGW 2;  5IAX A;  3AZY A;  3B5L B;  5FRE A;  5E1R A;  5IWF A;  2DDU A;  4CVU A;  1H1A A;  1OFN A;  3MIF A;  3IPV A;  1UQX A;  1EAH 2;  1JN2 P;  1Q8Q A;  2OII A;  1H6Y A;  4Y5S A;  2ZA9 A;  4FTE A;  4QM9 A;  1LHO A;  2KR2 A;  4ZXE A;  2FDG A;  3GXU A;  2R04 3;  4RGK A;  1YIF A;  5EJ1 B;  3AP4 A;  1HQW A;  3OBT A;  5IVB A;  1CAV B;  2AUY A;  3PUA A;  2YPJ A;  1OA4 A;  2WWS A;  4EZ4 A;  1WW4 A;  1MVE A;  2P4E A;  3CEW A;  3ACF A;  5LRR A;  5I0T A;  3S6P A;  1LOD A;  1I6X A;  5FPV A;  5TSW A;  3RGB A;  3FX3 A;  3H1M A;  4LBQ B;  4FQ4 A;  4AF9 A;  3NNM A;  2XUE A;  3CNA A;  2PYT A;  2W08 A;  3AYD A;  1BCX A;  1RHI 1;  3I7D A;  3NRU A;  1S55 A;  2WNV A;  2FCU A;  3CLP A;  4LKF A;  1XNK A;  2EID A;  1ND2 B;  2Y0O A;  1RUH 2;  3N7L A;  2IWG B;  1FV3 A;  5FOJ B;  2JD9 A;  3USS A;  4QB1 A;  3W5M A;  4ZU5 A;  5FZ7 A;  1HXS 1;  1Z7S 3;  1LGN A;  3GGL A;  1HB4 A;  3GM8 A;  1Q8V A;  3ZFG A;  4AED C;  3O1V A;  3I49 A;  5GJ6 A;  3URF A;  4L97 A;  5DAP A;  5EIY B;  5IK5 A;  4PQQ A;  4YZ4 A;  3HJR A;  1K3I A;  1PGW 1;  2PHX A;  2PTM A;  4BCU A;  4Q8K A;  4LIU A;  3T2O A;  3VHP A;  1WMF A;  2OUH A;  5EPA A;  5F6K A;  4C1W A;  2D6M A;  4URT A;  4B3N A;  1EAH 1;  4QGN A;  1KDK A;  1ZZ8 A;  2JIG A;  2W1Q A;  5A6Y A;  4PIX A;  1FPN 3;  3NNF A;  4XFH A;  3AMH A;  1N1V A;  4XUQ A;  2GC3 A;  4UAP A;  1DFQ A;  2AEZ A;  3SXW A;  3TWI A;  1W9S A;  2ZHK A;  4NPR A;  3IDC B;  2B9U A;  2ZHM A;  4YGE A;  2B8M A;  2GC1 A;  4M01 A;  1UL9 A;  5JXH A;  2HBU A;  2VW0 A;  3IPV B;  4X8P A;  2ZX3 A;  2VZP A;  5EV7 A;  2ZEW A;  3TB0 A;  3UKV A;  3PDQ A;  4LBK A;  2X29 A;  2WNV C;  3MHZ A;  3D0J A;  2GAU A;  2YXS A;  1PX3 A;  4NWV A;  4QHO A;  4C0H A;  4E4H A;  1TZO A;  3AJY A;  4EQV A;  1HN1 A;  5FZD A;  1UOG A;  2Y6F A;  5FBZ A;  4DOU A;  3KMH A;  5CFC B;  3AKQ A;  3CZU A;  3BOW A;  1VRH 2;  4OHY A;  4JKM A;  3UL2 A;  5APA A;  5EXO A;  4FP3 A;  2VEC A;  4IGQ A;  3ZFG C;  1OOP A;  3MV1 1;  4YW5 A;  1E5H A;  1HN0 A;  3WDV A;  3BGA A;  5JMC A;  3VZN A;  3H8X A;  1VRB A;  3WG4 A;  1JS9 A;  5T5J A;  2ORZ A;  5CAD A;  1MS4 A;  1WCQ A;  1RUN A;  3AVR A;  2ZAH A;  1JW6 A;  4W6W A;  2E63 A;  3U4S A;  1EV1 2;  5L7O B;  1PNF A;  3TEZ A;  2HWD 3;  3I3E A;  3RI8 A;  1CX1 A;  2MNG A;  3O1R A;  4GMP 0;  1CAW A;  1YI9 A;  4QKF A;  3ZN5 A;  2EIB A;  1V6J A;  1C1F A;  2PQQ A;  1VR3 A;  1YNA A;  3ZMN A;  1KDM A;  2FMD A;  5LK5 A;  3JU9 A;  4LA3 A;  2XUM A;  1XNB A;  1HB2 A;  2UWC A;  4LUL A;  1ZZ6 A;  3QD6 A;  4Y24 A;  2IXI A;  3NST A;  1ZBA 2;  3CKH A;  3Q8A A;  4KG8 A;  4P00 B;  4ISR A;  3ZIW A;  1DYO A;  3NAP A;  2A6V A;  4L0P A;  4LK6 A;  4DIQ A;  3OPT A;  4Y1Z A;  3WLU A;  4TXW A;  3D5O A;  4EWE A;  2AGS A;  4UW4 A;  4UFK A;  3WD5 A;  4OHW A;  1TME 2;  5F5Q A;  4BJ0 A;  3PUH A;  4QD2 A;  5IK7 A;  5FP4 A;  2W47 A;  4N43 A;  1PZ8 A;  1QQP 3;  3JBG 3;  2YDE A;  4KU7 A;  2VTX A;  4HKO A;  5BNN A;  4NMI A;  1WWY A;  2NZ9 A;  3LFM A;  1CZV A;  1QJE A;  1VRH 1;  1C57 A;  1JYW A;  3UKN A;  2DCK A;  5GZG A;  1OOP C;  1BEV 3;  4OVE A;  3IBM A;  1QOO A;  3ZYP A;  4CCL A;  1VMJ A;  1XE8 A;  4XJZ A;  1STM A;  3I3Q A;  4FXK B;  3RWK X;  4H14 A;  5FXZ A;  1AYM 1;  2W2I A;  4YAR A;  3AL6 A;  2O14 A;  5FJK A;  2A6X A;  2JDZ A;  3ZN6 A;  5JDB A;  1WMX A;  3DYO A;  2BV4 A;  1EV1 1;  2H0V A;  1IGO A;  2GP5 A;  2HWC 2;  1RUI 1;  3GJB A;  3UGG A;  4E9K A;  1OF3 A;  2N7G A;  3I59 B;  1CAX B;  2QJV A;  2ZPX A;  1CON A;  2WO1 A;  2XBO 1;  5C5U A;  3PUQ A;  1YRZ A;  4XPV A;  5E8A A;  1W2U A;  5FV3 A;  5D8A A;  1RMU 2;  2XPJ A;  4DNY A;  1X8M A;  1NT0 A;  4YW6 A;  3BAL A;  1ZBA 1;  3BUC A;  3NAP C;  2QQO A;  2XJS A;  5LWB A;  1ENR A;  3M3C A;  4QPI B;  1UWW A;  2VTX J;  1RUC 3;  4UI9 L;  1ZX5 A;  2WZ8 A;  3GBW A;  1TME 1;  3AZV A;  4N43 C;  3IN9 A;  2ZGT A;  1MS5 A;  1D0H A;  5BNN C;  1PVC 3;  2WL1 A;  4PLN A;  5GKA C;  4CYD A;  5KC5 A;  4DO0 A;  3OY8 B;  2VMG A;  3POI A;  4OI4 A;  2Z69 A;  3MUZ 1;  1DIW A;  4D3W A;  3VD4 A;  1Q3E A;  1RTV A;  1BK1 A;  5FMO S;  3VD3 A;  4UW6 A;  5LAT A;  3KV6 A;  1KIT A;  2C0Z A;  4LO5 B;  5CB7 A;  2HBT A;  4YRD A;  1SAC A;  1W05 A;  3O14 A;  4JHZ A;  5BPX A;  1CAU A;  5A80 A;  3S7E A;  3T3Y A;  1UIK A;  3U75 A;  1W99 A;  1XSQ A;  5HV0 A;  4HSL A;  1B09 A;  1HW5 A;  1JU3 A;  3ZLI A;  3V0A B;  3KCC A;  4LO8 A;  2HWC 1;  1S0F A;  3UKT A;  2X10 A;  1G9F A;  1O4T A;  4RD7 A;  2CGP A;  3P5B A;  3R05 A;  3SNM A;  3AX4 A;  1QH7 A;  2XQR A;  3VZO A;  3DPR A;  3WQB A;  2RS5 2;  4Q4V 3;  5D8A C;  3OSD A;  1SBE A;  3V0B A;  3BTX A;  4FOW A;  4I3G A;  1OSG A;  1RMU 1;  1SLT A;  1ZBE 2;  2UWB A;  3LA7 A;  4BIS A;  5CA6 A;  4CDW A;  1G8W A;  1H9P A;  4XTM A;  2QTW B;  1E5I A;  2R07 3;  5LA1 A;  4MGT A;  1O6U A;  3MEP A;  1FI2 A;  4CU9 A;  3PUI A;  1RJ8 A;  3NQH A;  1YQ6 A;  1OBN A;  2C5D A;  4HN1 A;  3HWJ A;  1WME A;  5JZG B;  3SLI A;  2B4K A;  3H3U A;  3KB5 A;  3POY A;  3A22 A;  1LOG A;  4QWN A;  1SG3 A;  1QDC A;  4AFB A;  1NA1 A;  2PMW B;  3ME2 A;  2VE1 A;  4RR3 A;  4MVT A;  4LBO A;  4LIV A;  5T54 A;  3B94 A;  2JG8 A;  1LJ7 A;  3N9N A;  1C3H A;  5ANQ A;  2VZT A;  3U10 A;  5A7W A;  2VU9 A;  3JCI A;  1W28 A;  4V2W A;  3F2Z A;  5H9R A;  3LKJ A;  1R1Z A;  1SEF A;  3VBH A;  4BQY A;  4IEQ A;  1WMD A;  4R4X A;  2WNE A;  4AHX A;  3ALQ A;  4QKN A;  2R04 2;  5C3P A;  4KL1 A;  3V64 A;  2ZGN A;  2PFW A;  2Q1M A;  1GWL A;  4NJ4 A;  3UK9 A;  3G6J B;  3MW3 A;  4AFC A;  4CE8 A;  3DPR C;  3MLK A;  3Q9O A;  4K20 A;  3H8O A;  5F9T A;  4ARX A;  2Z5W A;  1UCX A;  2NYY A;  4LHN A;  2ZAC A;  5LEJ A;  2H6B A;  3ZXL A;  4LT5 A;  2K9Z A;  5FYT A;  4CDW C;  1KQR A;  1YYN A;  1ZBE 1;  4GMP 3;  3DYM A;  4Y26 A;  3RJ2 X;  5IAT A;  2A3Y A;  4AZZ A;  4JTO A;  4DIN B;  2VGD A;  3LSD A;  5ANN A;  1U5Y A;  5J7M A;  1OF4 A;  2AEY A;  3BU7 A;  5K8S A;  2YZ4 A;  3CQO A;  4PJY A;  1S1A A;  3JZV A;  2R0H A;  1NZC A;  2VY0 A;  4KI5 M;  3VHO A;  1GAN A;  1VP6 A;  4ZS3 A;  3T08 A;  5F1R A;  1CQ9 A;  2GME A;  2WS9 3;  3I2I A;  1Z7S 2;  2XL9 A;  3TNP B;  1NA1 C;  4IEU A;  2RJL A;  3D82 A;  5KXE A;  4RR3 C;  1R08 3;  2BUK A;  4E8C A;  2HKX A;  4PHZ A;  4NHL A;  1LOB A;  1LOE A;  3J7M A;  2JG8 C;  4MXW A;  2ZBJ A;  4NPM A;  3U07 A;  2ATF A;  3ZOI A;  3VZM A;  3EMR A;  1JYX A;  5IVE A;  4KWK A;  3WDY A;  4BQ1 A;  4C91 A;  2A5Z A;  2FZ1 A;  4IE6 A;  3GF6 A;  1ND3 B;  3T09 A;  2JE7 A;  2R04 1;  2UY9 A;  4A6O A;  5JOZ A;  5ACA 2;  2H0B A;  1WD3 A;  2XJP A;  2E51 A;  3H3Z A;  5C4W B;  1XU1 A;  4ES9 A;  1QMJ A;  2OZ6 A;  4BQ4 A;  4P9X A;  2EIG A;  4LXL A;  3NO8 A;  2FDH A;  2E9Q A;  2TUN A;  1RUG 2;  3Q8B A;  1DF0 A;  3J9S A;  4FFI A;  1KFU L;  2IZW A;  4XFF A;  5EZW A;  4ARY A;  4EN8 B;  3VBH B;  4PT6 A;  4AVA A;  5LA0 A;  3WEZ A;  2VMH A;  4MGK E;  2BWC A;  4NAM A;  4CDQ A;  4N7I A;  4U36 A;  3H3L A;  1J58 A;  3WY6 A;  4CUC A;  5FK7 A;  3W20 A;  2WUH A;  2D6N A;  2IC1 A;  5A3L A;  3APB A;  2QQU A;  2TBV A;  1VBD 2;  1GYK A;  2DCY A;  1OVP A;  3GJA A;  2DCJ A;  3N9M A;  5T50 A;  4COY A;  3EBR A;  4UFL A;  2PHD A;  4E2G A;  1Z7S 1;  3TEY A;  1NZI A;  5FP9 A;  4BB3 A;  4E8D A;  1COV 3;  3EYP A;  3DKW A;  4R52 A;  4ET7 A;  1XRU A;  3I8T A;  3WP6 A;  1PGL 2;  3SHR A;  1QWR A;  5I8Y A;  5BNO A;  3VBO A;  5JIU A;  1SPP B;  4HXC A;  4CP1 A;  5FUI A;  5L9B A;  2YYO A;  4RGG A;  3JQW A;  3ZDV A;  5C5T A;  2HWD 2;  5C7G A;  1H0B A;  2GN3 A;  4RFR B;  3HNM A;  4XET A;  1FPN 1;  4NWW A;  2NN8 A;  3ON7 A;  1YWK A;  3M70 A;  2VNR A;  5ACA 1;  2QQW A;  1NE4 A;  3L2H A;  3H7J A;  1IPS A;  4TLF A;  4M3C E;  2LS6 A;  1O8P A;  4LTA A;  4OHZ A;  5H9Q A;  1MS9 A;  5LA9 A;  4MUV A;  2RM2 3;  1OPM A;  3OYW B;  2QDR A;  2P34 A;  3BPZ A;  1GZ9 A;  1US3 A;  4H2A A;  2J1A A;  3O1S A;  4XFI A;  1ZM1 A;  4FFG A;  4HLT A;  4RFT 0;  4CDQ C;  3FHQ A;  4OUS A;  1W03 A;  1I5P A;  2V4V A;  3FL7 A;  2CGO A;  2ZKN A;  4ZON A;  4GB3 3;  1ULP A;  4L11 A;  1U5I A;  4AVV A;  2WZR 3;  3JBG 2;  3ACI A;  1VBD 1;  4PBP A;  2C24 A;  2V73 A;  2VPV A;  2W91 A;  3HQX A;  4LLF A;  1MZ5 A;  1OQD A;  3BCW A;  1UX6 A;  1OD5 A;  5CU1 A;  4XF3 A;  3K48 A;  5FZB A;  3HOB A;  5C9A B;  3D4K A;  2Q8D A;  4HET A;  3UGH A;  3VBO C;  5BNO C;  1FMD 3;  2EF6 A;  2FQP A;  1FXZ A;  3ZXJ A;  1PVX A;  1XXN A;  1YO8 A;  2I2S A;  5F3E A;  3VBS A;  1GP5 A;  5FY4 A;  3P1I A;  1X36 A;  1OC1 A;  5H9S A;  2HWD 1;  4MGQ A;  4RS5 A;  5KHI A;  1C28 A;  2PXJ A;  2V4A A;  1L7Q A;  2YC2 A;  4FPE A;  3V65 A;  2EXK A;  1RGS A;  2JDK A;  5DZG A;  1VPH A;  1LRH A;  1YI7 A;  4AOC A;  1ZZC A;  5KXC A;  2PLV 3;  3LDR A;  1R64 A;  5LA2 A;  4CSW A;  1MQT A;  4JQT A;  3VHN A;  1GOG A;  4XJA A;  4F7Z A;  2DUQ A;  4MZU A;  3QOP A;  1K45 A;  4XW3 A;  4LBM A;  1OFS A;  3WCR A;  2IVJ A;  1UY3 A;  1Z78 A;  4XF1 A;  1ULF A;  4HZF A;  5E88 A;  5FYY A;  1CZS A;  1A34 A;  3F95 A;  1RUC 2;  1ZRR A;  4PI0 A;  4FPH A;  3U37 A;  2ARE A;  2EIC A;  5C8C B;  3ABZ A;  4NHY A;  5DG1 A;  3HD8 B;  1XPW A;  3ZXA C;  4K9S A;  4FFH A;  1AZD A;  2KD7 A;  1QQP 1;  3JBG 1;  1X9P A;  1BYH A;  2HWB 2;  5LBF A;  4QQO A;  3RVH A;  3SEP A;  2NMO A;  5FYH A;  1BEV 1;  1NKG A;  3PVO A;  5K9Y A;  3J4U H;  2D43 A;  1NY7 2;  1POV 0;  3THD A;  3DKQ A;  4S2D A;  4GJY A;  3S5Q A;  5IVC A;  3OEA A;  2YFU A;  4NO4 A;  5DQ0 A;  4IEY A;  3PLQ A;  3CJI A;  1WBL A;  4OI1 A;  2PA7 A;  2VZ1 A;  3J7H A;  1MAC A;  4RS5 C;  4AHY A;  3HAG A;  4DZG A;  2A1X A;  1W9F A;  3KGZ A;  3VD5 A;  4XMA A;  4XEZ A;  1BHG A;  2XVL A;  4D6R A;  2ZGL A;  3ILF A;  4L2N A;  1RIR A;  1YHF A;  5GLZ A;  3CBN A;  2EXI A;  4QXK A;  2VQA A;  1W8Z A;  5ISL A;  1S0E A;  2HH9 A;  4Q4V 2;  5CAZ A;  2R30 A;  4QQ2 A;  5CZK A;  1MQT C;  3ZYG A;  3SC7 X;  3USU B;  4LKD A;  5CBL A;  3M3I A;  1W6O B;  2W68 A;  3FJS A;  2P37 A;  2PAM A;  2WT1 A;  3AXD A;  1DP0 A;  3MIH A;  4GAL A;  4QPG A;  2GDF A;  1LR5 A;  4DFS A;  1RUC 1;  4BHP A;  2D5F A;  3TN9 3;  1H9W A;  2ZJC A;  2RDR A;  4PIY A;  1OXC A;  1WLW A;  3E5Q A;  2QDN A;  3GBF A;  2CY6 A;  1PVC 1;  1LHU A;  5EHD A;  3MPB A;  3ZFF A;  4KH9 A;  4B1L A;  1VIW B;  5DAX A;  2HWB 1;  2G9G A;  1H6X A;  3LFI A;  4YW4 A;  4ASK A;  1QJX 3;  2VCA A;  5LB6 A;  4B7K A;  5FMB A;  3NWK A;  1NY7 1;  1L7R A;  1VMF A;  2BEO A;  1N3P A;  4H55 A;  1GZW B;  1V6O A;  5E89 A;  1AJK A;  3CJI C;  5FYZ A;  1W90 A;  2LTN A;  4EWD A;  4O7X A;  3GHM A;  3W58 A;  1W04 A;  3WQ1 A;  3AJZ A;  2ERF A;  4I0A A;  1H30 A;  4XHB A;  3HBZ A;  3WG2 A;  3HNY M;  4M0N A;  4KBB A;  4QPW A;  1X9T A;  4RYD A;  2JX9 A;  4Q4V 1;  2GC2 A;  3RQ0 A;  4Y20 B;  1XE0 A;  1YC6 1;  4AK3 A;  5ABJ A;  3W5N A;  1VAM A;  2J1R A;  3IKW A;  2R06 3;  2RS1 3;  2WLP A;  4OCT A;  1Y7B A;  4RQP A;  4LBN A;  4QPG C;  5C3R A;  3VUO A;  1S0J A;  1UPI A;  5GZE A;  3T0D A;  2JIC A;  1GOH A;  2ZTN A;  2C4X A;  1YQ2 A;  2CSG A;  2VQT A;  3MID A;  1DG6 A;  2JDP A;  2QQK A;  2RE9 A;  4ES8 A;  1IS3 A;  3POE A;  2OA2 A;  3ZFF C;  3C8X A;  4AAP A;  1W3X A;  1UD1 A;  4XZU G;  1O91 A;  5FKB A;  3VDC A;  1H2N A;  3RMY A;  3S30 A;  4LUM A;  5F2W A;  5A33 B;  5FMD A;  2GMP A;  3C7O A;  1VAK A;  3KM5 A;  3LA3 A;  4CEW B;  4COV A;  3RWN A;  1AR7 3;  1R1A 3;  3C2U A;  3KSC A;  3H1W A;  2DV9 A;  2Q1F A;  1NG0 A;  4Q4X 3;  4AG4 A;  3HT2 A;  4CCO A;  5FFO C;  4XCB A;  5BY5 A;  1J3P A;  4F83 A;  4OQ8 A;  1Z0H A;  3KLS A;  2JIJ A;  2VNV A;  2OW4 A;  3PU8 A;  5E16 A;  2P3I A;  1ASJ 3;  4Y22 A;  1GFF 2;  2XLF A;  3FUQ A;  3U4X A;  3ZKU A;  5DG2 A;  3ZSJ A;  2PN5 A;  3IDE A;  4P5H A;  3W21 A;  5ABJ C;  1NLR A;  2A6Y A;  1GNY A;  1W6N B;  3WDW A;  2FD8 A;  4GMP 1;  3ILN A;  1KFX L;  1PO1 3;  1QXP A;  3KV5 A;  1UZZ A;  1S0G A;  4UBG A;  1RUF 2;  1XB9 A;  1HX6 A;  1Y9M A;  4FPK A;  4J25 A;  1UN1 A;  1BBT 3;  4IGP A;  4YWA A;  1W6M A;  4B4R A;  4DXT A;  5FZA A;  5A3M A;  1QJY 3;  5FQ0 B;  5L19 A;  3L9J T;  1JU4 A;  2DVG A;  4I01 A;  4O9E A;  5A1F A;  4AI3 A;  4NE9 A;  1COV 2;  1OLM E;  4JV4 A;  4Y1V A;  3GHN A;  4DY5 A;  3POB A;  4Q0S A;  4RQP B;  4AI9 A;  1LEC A;  5LK7 B;  3FZ3 A;  5BUV A;  3B01 A;  4Z82 A;  3N7M A;  4NRO A;  4AEJ A;  4UWD A;  2B46 X;  2IUW A;  4LLO A;  2YC0 A;  5LBC A;  5EYX A;  1AVB A;  2OS2 A;  3IDB B;  3T2P A;  3AKS A;  4C0B A;  1G9C A;  3PIG A;  3CL1 A;  3VBU C;  3UNP A;  2GNB A;  1HV1 A;  2BNO A;  2GSY A;  4ITC A;  1DQ5 A;  2Z42 A;  3IIA A;  2YGM A;  4D7T A;  5I93 A;  4AQT A;  1W2O A;  3NJV A;  4GUL A;  4JDM A;  1VBE 2;  5JWP A;  1BK0 A;  5EWS A;  1VB2 A;  4C90 A;  1D4V B;  3ZYJ B;  3RNS A;  4H7M A;  1ALY A;  2AC1 A;  3I54 A;  4A2U A;  5DUW A;  2CHH A;  2ENR A;  1E57 A;  3KV9 A;  2QQJ A;  4B8E A;  4G4F A;  3ZXE A;  4AFD A;  1C4R A;  1PMJ X;  1QDO A;  1JBC A;  1WLT A;  4OMD A;  5CFD C;  3B9I A;  5CG9 A;  5IHR A;  2JDH A;  3C7F A;  4W4Z A;  5FZ6 A;  2G9F A;  3NV2 A;  4AAX A;  2AR6 A;  4Y22 B;  4YVS A;  4ISQ A;  3AP9 A;  2RG4 A;  5L9R A;  2RJ2 A;  4BQX A;  1GP4 A;  1G6N A;  4XJU A;  4WVZ A;  4IV3 A;  2YMZ A;  1COV 1;  1REE A;  2GZW A;  3K4Z A;  1K42 A;  1BVP 1;  5GLV A;  2JD4 A;  5FZ0 A;  3IB3 A;  5G05 L;  4QU2 A;  1FMD 2;  2XJQ A;  1Q5O A;  4K7J A;  1AL0 G;  3BB6 A;  3M3Q A;  4COU A;  4E4D X;  4FTB A;  4QX5 A;  1WCS A;  4GKY A;  4UOJ A;  4TN7 A;  4LEJ A;  4XF9 A;  1FAT A;  4XZP A;  2DFC A;  3PU3 A;  4PLM A;  3WZ1 A;  5K0U B;  2HYX A;  3CZJ A;  4Y3O A;  4XVH A;  3B9C A;  2WDB A;  4W50 A;  4A7Y A;  4BZ4 A;  2BGO A;  4PF5 A;  4COW A;  1RUE 3;  3DCQ A;  5LBE A;  2PLV 2;  4QX7 A;  1ZRC A;  1HJF A;  1VBE 1;  1UMZ A;  2PHR A;  3SCG A;  5DAW A;  3RSJ A;  1I1E A;  1J59 A;  2JWP A;  2AEN A;  3BOD A;  2WO3 A;  3UV9 A;  2RM2 1;  2GU9 A;  3NL1 A;  3OG2 A;  5D2A A;  5G04 L;  4MHU A;  2R49 A;  4CP9 A;  1BVV A;  1UOF A;  4CCC A;  2WJS A;  3BU0 A;  3MIB A;  4MET A;  4CCK A;  3E97 A;  1AR8 3;  2BU9 A;  1Q8P A;  4DRR A;  4KU8 A;  3ZYF A;  3RRD A;  4XAB A;  4QQL A;  4YVS C;  1AHS A;  4IE7 A;  4GB3 1;  1H4H A;  3HT1 A;  3RZL A;  1OUS A;  1HIX A;  4FXG B;  4M3C F;  2WZR 1;  2DTW A;  5FIX A;  2XQX A;  4CUB A;  1LES A;  5JIA A;  4A7K A;  3GCX A;  1XC6 A;  1SLC A;  4IV3 C;  3L2Y A;  4AGV A;  1DLL A;  3H42 B;  2ZEZ A;  2W87 A;  3WHT A;  3SMH A;  3K51 A;  1S2K A;  2VR4 A;  3EJK A;  3CJX A;  1O59 A;  2E31 A;  1UOJ A;  2VAU A;  4NHM A;  4EE2 A;  5GZC A;  3AZZ A;  1FMD 1;  3WNM A;  1FNZ A;  2YB7 A;  1W2A X;  3LEK A;  3O0W A;  4YNI A;  5HV4 A;  1IHM A;  3OJB A;  1US2 A;  4M00 A;  3ZYR A;  3III A;  2W1W A;  3LD8 A;  3LSE A;  4UFH A;  4AI1 A;  4XDO A;  4BPZ A;  1XQN A;  1JHJ A;  3J8F 3;  4CU8 A;  3VBF A;  2PLV 1;  3S57 A;  1VBC 3;  4AED B;  1RUD 3;  4XFG A;  1QHD A;  1A3K A;  1S0C A;  3CF6 E;  1LB2 A;  4EZH A;  5FP3 A;  4YG0 A;  4H7L A;  1VBA 3;  5DXD A;  1NYW A;  2ZMN A;  1UXZ A;  1W3V A;  1IKP A;  1SZB A;  2K2S A;  3GNE A;  5DZE A;  3N9O A;  3PNA A;  3BTY A;  3BI3 A;  1O4Z A;  4IND A;  4DUW A;  3JD7 3;  4AQ2 A;  1OI6 A;  2JEM A;  3WP5 A;  4QXC A;  1RUO A;  2GNM A;  4IXL A;  2D5H A;  3HIF A;  4NOT A;  4EYU A;  4JX0 A;  4A7Z A;  5FY1 A;  2ZMK A;  2CAV A;  2QQP A;  3N7K A;  2Y6L A;  1A8D A;  4QQH A;  1PX4 A;  5T3N A;  2VOK A;  5IAV A;  1AX1 A;  2OZJ A;  2ZKL A;  3AMN A;  3B02 A;  3ASI A;  4K8F A;  3VDD A;  1QOT A;  3D6E A;  1IG3 A;  4CRQ A;  1GNZ A;  4QDS A;  2WNV B;  4NPL A;  1AYM 2;  2A6W A;  3UJO A;  3KQR A;  1AR6 2;  4A3X A;  1OA2 A;  1WCK A;  5AVA A;  4DXS A;  1DCS A;  1OHF A;  5DAV A;  4HMZ A;  1RUI 2;  3NMB A;  4P9Y A;  3VBF C;  1DLC A;  2WZE A;  2BVV A;  2D98 A;  1WW7 A;  2XJR A;  3ZFG B;  5L36 A;  1G86 A;  2XBO 2;  1UPS A;  3ZR6 A;  1SHW B;  2DUP A;  2R06 2;  5A3U A;  4YFW A;  1UZ0 A;  4Q5O A;  2XWB B;  3CO2 A;  4FP2 A;  3WF0 A;  5J09 A;  5J48 A;  3ECQ A;  4Q4Y 2;  5I91 A;  3RZG A;  2VZR A;  1DZT A;  4DS0 A;  2R1B A;  4LIT A;  3BTZ A;  1MVQ A;  2PEL A;  4FSJ A;  4I0W B;  2DVD A;  1XNT A;  4QQP A;  3TAY A;  1UMI A;  1DGR A;  1UY1 A;  1GKB A;  2WA4 A;  1HQL A;  2F6B A;  2XJU A;  2WFF 3;  1S2E A;  2D40 A;  3EO6 A;  2GNT A;  2QCS B;  4L8Q A;  3R4S A;  2RS3 3;  3MUY 1;  1QNW A;  5BNP A;  3LPG A;  4YG3 A;  2W95 A;  1GWM A;  3VDD C;  4ZKT B;  3OUJ A;  2RMU 2;  4Q4X 2;  1R1A 2;  1C8M 3;  3UJQ A;  5IYY A;  5IVV A;  3ZMO A;  3WV6 A;  1YFX A;  1AF9 A;  3AC0 A;  3AZW A;  2UU8 A;  2Z4F A;  4IE5 A;  1W2T A;  2XR4 A;  4Z92 B;  1JOB A;  1OLQ A;  1UYZ A;  1W39 A;  1GOF A;  4BQW A;  4DXZ A;  1F8V A;  5FZL A;  1SCS A;  1AR6 1;  2J7M A;  3NJX A;  3WIN E;  1ASJ 2;  1EP0 A;  2A7A A;  2BTV C;  3JQX A;  4HSJ A;  1XNA A;  2R32 A;  3ZFE A;  4B29 A;  1OOP B;  2BOJ A;  4A41 A;  5JOY A;  1PMH X;  2R06 1;  1EPW A;  2RS1 1;  4QX2 A;  2VW2 A;  4XBN A;  1VAL A;  5LY1 A;  4NID A;  4YYO A;  5BYN A;  2JEC A;  4RHV 3;  1XJA A;  4Q4Y 1;  2UUR A;  3H0O A;  1BBT 2;  1CJD A;  1RED A;  1ULE A;  4SBV A;  3U14 A;  1O3Q A;  2ZCW A;  3I4I A;  1FT9 A;  1QJY 2;  4GH4 C;  1YJL A;  2BP6 A;  1CAW B;  3M4F A;  5FZO A;  2BGP A;  2WQZ C;  4N9H A;  5FDB A;  3T2Q A;  4P9W A;  3IAP A;  3LDB A;  5BNP C;  2GP3 A;  2Y8K A;  3BIW E;  3HN3 A;  4M0H A;  4NUB A;  3SH5 A;  2G9Z A;  4KWU A;  2RMU 1;  1AR7 1;  1R1A 1;  3FBY A;  4Q4X 1;  3AYA A;  3K4D A;  2BVB A;  2CWS A;  2EAL A;  3NAP B;  4ZXK A;  4BA6 A;  4CXY A;  5I8S A;  1R09 2;  3W59 A;  2YU2 A;  1PHM A;  3O7O A;  3O0V A;  4HG6 B;  4N43 B;  2MEV 3;  5SV8 A;  1CD3 G;  3LQC A;  1TNF A;  2W5F A;  1ASJ 1;  1WA4 A;  1XNC A;  5BNN B;  3W9A A;  5FO8 B;  1SBF A;  5JSO A;  3NW4 A;  5A32 A;  1MS0 A;  3DEC A;  5KC6 A;  5FR3 A;  3ZFE C;  4IEO A;  4NAO A;  1LOF A;  5A7Q A;  5FOB B;  4WBB A;  2P3K A;  4UT5 A;  5F32 A;  1DQ4 A;  1HDK A;  4K1Z A;  4MHR A;  1AYN 3;  2E7Q A;  4IEV A;  2JDU A;  3U11 A;  2JE9 A;  2RDQ A;  2YFZ A;  3H9A A;  2JXA A;  3A0K A;  1BBT 1;  2W1S A;  3ZN6 B;  1W9W A;  1ENQ A;  1UY0 A;  1IPJ A;  2MPF A;  1EPZ A;  2ZEX A;  1CIY A;  1LCL A;  2ZOE B;  3TBD A;  5AC9 3;  3EQE A;  1QJY 1;  2QZ2 A;  2VXJ A;  3PIJ A;  4GIQ A;  2Y6J A;  1J1L A;  2ES3 A;  2RHP A;  5F39 A;  1RVF 3;  3DGT A;  3IMM A;  1RB8 G;  2VBP A;  3NV1 A;  5D8A B;  3RZJ A;  3G7D A;  3OD0 A;  4G3Y C;  5F2S A;  2Y60 A;  1A78 A;  1NCQ A;  1JMU B;  5H9P A;  4ZU7 A;  5HBA A;  3WR0 A;  4IW3 A;  4KGG A;  1REF A;  1UZW A;  2GMM A;  3DUI A;  1R09 1;  4LBJ A;  3D0S A;  4HOO A;  5FZ4 A;  4Y5Z 0;  4ZPI A;  2VMF A;  1JHN A;  4CTE A;  2W92 A;  2Q8O A;  1POV 1;  4GXL A;  1B35 A;  1YFU A;  3I3D A;  1RUE 2;  2AZ5 A;  1UIJ A;  3K4A A;  1QJZ A;  4PCR A;  5D1I A;  1LOF C;  3TRS B;  3OBA A;  3WNL A;  1UY4 A;  4Q29 A;  4FCA A;  4MGI E;  4LOR A;  3I97 A;  3LOB A;  2DVA A;  3LOI A;  1YXW A;  1YEW A;  5JI9 A;  5FLI A;  5FXX A;  2QQI A;  3AFG A;  1GLH A;  3B3Q E;  4LHK A;  1CAU B;  4AFM A;  4I02 A;  3PUR A;  4XXP A;  1F35 A;  1RYY A;  4DPN A;  2XJT A;  1HRI 3;  2UWA A;  4CEY A;  2VBB A;  2RDS A;  1XYO A;  2I74 A;  3CU7 A;  5JR7 B;  2QNK A;  1BKZ A;  4ATF A;  1GSL A;  1Y9G A;  3WUD A;  4B7E A;  2AAC A;  3PTR B;  3DPR B;  1UOB A;  4QKD A;  3V0B B;  3ENR A;  2VUD A;  5HCH A;  1NX9 A;  1H8T C;  4CDW B;  3I3B A;  4R9B A;  1NCQ C;  1OKQ A;  4KQ7 A;  2X8K A;  4WVV A;  2D6K A;  4HT1 T;  2JKX A;  2X09 A;  3IT8 A;  3N7J A;  4K1Y A;  1WBF A;  3EB7 A;  4FOY A;  1RIN A;  5A6Z A;  5FYB A;  1LU2 A;  2CV6 A;  3JB4 C;  1B35 C;  4P08 A;  3J8F 2;  2J1S A;  1FPN 2;  1RUE 1;  1ZRF A;  1VBC 2;  1NA1 B;  3THT A;  4FOV A;  4BQ5 A;  1RUD 2;  3WSO A;  1GIC A;  4D7Y A;  3AM2 A;  4ZHN A;  1H2M A;  1GNH A;  4RR3 B;  3E5U A;  4XUP A;  4KG0 A;  3VL9 A;  3DV8 A;  2JG8 B;  3PHM A;  5A3T A;  2OXB A;  1H2L A;  4DB5 A;  1N1Y A;  2JEN A;  3FBM A;  3IZO A;  4TSV A;  1QXR A;  1AR8 1;  3ES1 A;  5A7W B;  3JD7 2;  1ZA4 A;  2A71 A;  1OKO A;  2X5I A;  4LA2 A;  3BYW A;  4JVA A;  5CVR A;  5A7N A;  5FZE A;  4CEY C;  4IEP A;  3O1O A;  2VNO A;  3OUH A;  3PL0 A;  4JGY A;  2V09 A;  2VBD A;  4F8A A;  5F37 A;  2NM1 A;  2RVA A;  5KHK A;  3LEG A;  3LZZ A;  4U2A A;  1AX2 A;  3P3N A;  5LCW L;  1SFY A;  5GAL A;  2CAU A;  1ZYB A;  5CIR A;  3ETP A;  1IS5 A;  3O1U A;  1AL2 3;  2JDA A;  5LY2 A;  3VD9 A;  1BJQ A;  1W9Y A;  2OPW A;  5J98 B;  1XYP A;  5CEH A;  3HVD A;  4L92 A;  3RJR A;  2VZV A;  3ZN4 A;  2VH9 A;  4IV1 A;  1QH6 A;  1I9R A;  1LEM A;  1RIT A;  2LAL A;  1HQN A;  4HVO A;  4P5Y A;  5IW0 A;  3IAQ A;  3J8F 1;  2VQ0 A;  3VN4 A;  1M06 G;  2ET1 A;  2JKB A;  1KS4 A;  4RGA A;  1VBC 1;  1SFN A;  2CYF A;  4LJH A;  2WNO A;  2YPD A;  1W06 A;  4IES A;  4AVC A;  1RUD 1;  2Q1Z B;  2YHJ A;  3A21 A;  1O3T A;  4IE4 A;  4MXW B;  3LEM A;  3LA2 A;  5FPZ A;  4R9C A;  5J96 B;  4Z1V A;  4FPY A;  4XF4 A;  1UY2 A;  1Y43 B;  1ULO A;  2CWM A;  2VMD A;  3UES A;  3J7N A;  4L99 A;  2X5I C;  4S2H A;  3VBR A;  3JD7 1;  4YVW A; 
#chains in the Genus database with same CATH homology
 4ZS3 A;  4NRP A;  3O1V A;  3I49 A;  3T4V A;  3O1M A;  4NIG A;  3S5A A;  4NPM A;  3BUC A;  5F8P A;  3BU0 A;  4IE5 A;  4IDZ A;  4IE6 A;  4IE7 A;  3RZL A;  3T4H B;  4NII A;  4NRQ A;  3O1T A;  4QKD A;  2FDJ A;  2FDH A;  5DAB A;  2FD8 A;  4NID A;  3T3Y A;  3KHC A;  4QHO A;  4QKB A;  2FDI A;  3RZM A;  3O1P A;  3BIE A;  3KHB A;  2FDK A;  3S57 A;  3BTX A;  4ZS2 A;  3H8X A;  4IE0 A;  4ZHN A;  4NRO A;  4MGT A;  2IUW A;  4CXY A;  3BTY A;  3BI3 A;  4RFR B;  3O1R A;  4QKF A;  3I3M A;  3O1O A;  3I2O A;  4NIH A;  4NRM A;  3O1S A;  3O1U A;  3RZK A;  4NPL A;  4O7X A;  4QKN A;  2FDG A;  3RZJ A;  4NJ4 A;  3LFM A;  3RZH A;  3H8R A;  3H8O A;  4O61 A;  4JHT A;  3I3Q A;  4OCT A;  4MG2 A;  4IE4 A;  3RZG A;  2FDF A;  4CXX A;  3BKZ A;  3BTZ A;  4CXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...