4NIHA

Crystal structure of alkb e136l mutant protein with cofactors bound to dsdna containing m6a/a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
201
structure length
201
Chain Sequence
PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDLPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Switching Demethylation Activities between AlkB Family RNA/DNA Demethylases through Exchange of Active-Site Residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/dna
total genus 47
structure length 201
sequence length 201
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2013-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4nihA00
4QKDA 3S5AA 2FDJA 3I3MA 3O1SA 3H8RA 3I3QA 3S57A 3T3YA 3O1UA 3T4VA 3RZLA 4NRQA 3BU0A 3BI3A 4NIIA 3BTXA 3BIEA 4MGTA 4NIGA 4MG2A 3I49A 4CXWA 3RZHA 3KHCA 3BUCA 2FDKA 2FDHA 3RZJA 4OCTA 3H8OA 4NIHA 3BKZA 3RZGA 4O61A 3O1RA 3O1MA 4NJ4A 4ZHNA 3RZKA 4CXXA 4JHTA 3KHBA 3O1PA 3I2OA 2FD8A 4NPLA 3O1OA 4QHOA 2IUWA 4IE0A 4O7XA 3LFMA 4NRPA 4NRMA 2FDGA 4IDZA 3BTZA 2FDFA 4IE6A 5F8PA 3BTYA 2FDIA 3O1TA 4NIDA 4QKBA 4ZS3A 4RFRB 3H8XA 3T4HB 3O1VA 4IE5A 4QKNA 4NPMA 4ZS2A 4QKFA 4CXYA 4NROA 4IE4A 3RZMA 4IE7A 5DABA
chains in the Genus database with same CATH superfamily
1R082 3HOBA 4QQHA 3S5AA 2ZEWA 4LA2A 4YZ1A 2ID4A 1K5JA 2A6VA 2EIDA 3WNOA 1PNFA 2JX9A 2NP0A 3PVBB 1DQ2A 1R092 3MYXA 1Y4WA 5F5AA 2WZEA 3TRSB 3IDCB 5FO7B 5CEHA 2YYOA 2ZMNA 2PELA 1RC6A 1NT0A 5J1XA 3Q8CA 4XF0A 3NAPC 1UAIA 3E1F1 1I5PA 3F95A 5LBCA 1O3QA 1RUH3 5FY8A 1W8WA 3WXPA 5A6QA 1RUG2 1AXYA 1LOFA 4JKKA 5FYIA 2MHFA 1JI6A 2W52A 3AZYA 4BYYA 4CEWC 4MG2A 1W0PA 4IEUA 5F6LB 4Z92B 1QOSA 3ZKYA 2CY6A 5LY2A 4LIUA 1N1SA 3DV8A 3IPVA 1UOGA 1O6UA 2RS12 1YXWA 4ATFA 1WA6X 2VMIA 1SG3A 3ROUA 2HWD2 2J1TA 1W6QB 2VNRA 3OUIA 1H6YA 2ZZQA 1S55A 4BE3A 3VBFA 2JE7A 1TE1B 4CYDA 5CFCB 1KQRA 5AVAA 3CJXA 3WDYA 2PA7A 1V70A 5C4WA 3VDCA 1RUH1 3GXUA 4JGZA 5C7GA 4LHNA 3QD6A 3K3NA 1NX9A 2ZGNA 3FWEA 4XUOA 2ZPXA 3LDKA 5FCCA 4A45A 5LA0A 2Y34A 4WVMB 2GAUA 3RZKA 1V00A 5CVRA 1HW5A 3AVSA 5FTTC 5FPBA 4CEYC 1XOYA 5E8AA 5JSRA 1SACA 3J7HA 2WRAA 3RRDA 4LOTA 3WVJA 4ARYA 2K0GA 2RDQA 5LWBA 2P2KA 4QPWA 4X6QB 3OGRA 3O7OA 4Y22B 4QPIC 1OF3A 5FZHA 2FQPA 2VQ0A 1VAKA 1PO22 3MIHA 2LTNA 3MIDA 3SHRA 4IEQA 2Y6KA 1ZZ9A 3DPRA 3T30A 1OD3A 3ZSKA 4E2QA 5AVPA 3WCRA 4FPKA 4D6QA 1ZZ7A 4IDZA 2GMPA 3TWIA 2CGPA 1KJRA 3VZJA 1PK6A 1E5HA 1HQWA 3TN93 3JBG2 1A34A 5T5PA 1MEC1 4M4RA 1ODMA 2KM2A 4KMQA 4R52A 3RNSA 5L9VA 4LMFA 4B1LA 3KV4A 1LOGA 3U11A 3WY6A 3KVBA 1ZREA 3CU7A 4CEWB 3OGGA 4WZCA 1DFQA 4EWEA 3GNEA 4ZU4A 5F1RA 2X5IA 1EAH2 4G4FA 1AL21 1PIV2 3GJBA 2BNNA 1NCRC 3NW4A 4D8MA 2B9UA 1Z78A 2OIIA 4XHXA 5DAWA 3W59A 2XONA 2F4LA 3WQ0A 4CCJA 2E9QA 2XB6C 3IIAA 3FFZA 4Z2WA 5A3LA 2JKXA 1AX2A 1MS4A 5F32A 3KGZA 3TN91 5FZEA 1AR63 2WNVA 1RB8G 3P3PA 2FCTA 1SLCA 3HQXA 2ZGPA 2P6HA 2VUCA 3VZLA 1QJU1 3AP7A 3DN7A 4O9GA 1JYXA 1CWPA 2ZBJA 4L99A 3ZIXA 3VBOC 1XYNA 1VE0A 3WF0A 5C9AA 5GALA 4Q4W1 1BMV2 2C26A 5CYYA 1HN1A 4CEYB 2WA3A 4B8EA 1G9DA 2UY8A 1SPPB 2VNOA 3G7DA 1DCSA 5DG1A 4Y1ZA 5I91A 4YGCA 1UKGA 3IBMA 1VMFA 1OA2A 1U5IA 3C7EA 2QCSB 1BBT1 1CAUB 3O12A 1TMF3 3A0KA 4QPIB 2CTVA 4LQRA 3H8UA 5H9QA 1OT5A 1W6OA 5JAXA 3R05A 5ABJC 1AR61 2DCYA 1VALA 3VHOA 4XUNA 5FJKA 2JJ6A 3CKHA 5H9RA 3LQCA 1ZRRA 3QACA 2D6PA 4KGQA 3SH5A 1L7QA 1UXXX 4HKOA 4WM8A 5BPXA 4D3WA 5KWRA 3KHCA 4F8AA 4M3CB 4YZ4A 4AXOA 1J1LA 4OUSA 1BJQA 1SLAA 3SCGA 1J3RA 3LEMA 4MXWA 1KS4A 2JDYA 1COV1 3HPNA 1FT9A 3FN9A 4LJHA 1WW4A 3RZJA 4UAPA 1YIFA 1E5SA 4OCTA 2D98A 4KQ7A 1GP5A 4CZSA 1FNZA 3T2PA 1RVF1 1WLDA 3AL6A 3O1MA 4OZOA 2V4VA 2IVJA 4I3PA 3HBKA 4P08A 4QT6A 3WNKA 1NCRB 4IESA 5A33A 2WQ4A 4ZZ8A 1W8HA 1CONA 2RS52 1LGNA 3W9AA 1GZWB 3VUOA 2LALA 4E4ZA 4XIKA 3ZR5A 5DG2A 1G8WA 4HT1T 4HLTA 1DBNA 2QQJA 3SC7X 2JICA 1TEIA 1XNBA 1K45A 2W2IA 3ZDSA 4OHZA 1RJ7A 1C28A 4RL7A 5FZ9A 1QDOA 1F2NA 1Z7S2 2GMMA 1US3A 2IVIB 4UW6A 2ZJCA 3T1LA 1I6XA 4K8RB 2D5FA 1UY0A 1W6PA 2F4PA 1QH7A 3ACIA 1RHI2 4XABA 3VBOB 4IGPA 3ETQA 3IDBB 4MYEA 2I2SA 3ZN5A 2PLV2 4RS5C 2MEV1 5FMCA 4DS0A 1POV3 2VMEA 2V5DA 2D6OX 3AZZA 5T55A 5HCHA 3VBUA 4UBGA 5FPUA 4AGRA 5T52A 3ZFGA 3B94A 4R9DA 1OVPA 3ZXGA 2VTFA 4IEZA 2Q1MA 5F2SA 5FJHA 3MHZA 1OKOA 1K5MC 2YPJA 1SCSA 2BFUS 2J42A 3N9QA 4FPYA 3TNQA 4DQAA 2Y6GA 2HWB2 4NOTA 2H6BA 2BEOA 1IKQA 4ZS2A 4EZ4A 3BALA 2QQPA 1JYVA 3WNXA 3OBZA 2JD9A 1AR93 3B00A 4DY3A 5KHKA 4WM7A 2KA3A 4IE7A 3SQOA 1WMDA 4IEOA 2XQXA 1ZNPA 4YFWA 5T5JA 1Y3TA 2ZGSA 4HMZA 1ENXA 3VHRA 1O4YA 2FZ2A 4AFDA 2UWCA 5C5UA 1OKQA 4MXVA 1KFXL 4R9AA 3D82A 4X8PA 3ZO0B 1JXNA 5K9YA 5JXHA 2BGPA 2UY9A 3ZSLA 5JR2A 2N7GA 1G6NA 1V6KA 3FE5A 1QY4A 3C7GA 3RMYA 1V9U2 3MIEA 2JDMA 4NRQA 1UW8A 3GM8A 4O9EA 3AP4A 3AXEA 4YVSA 2IXCA 3UKNA 1C1LA 1O91A 3H9AA 1R1ZA 3M8LA 4QX1A 3SH3A 5JXJA 3NMBA 1CESA 2J1VA 3PJYA 2ZGUA 4QHZA 2DV9A 1AXKA 4BU2A 3T08A 4K20A 5A80A 4RS5B 5GLUA 1O4ZA 1AYM3 1FOD2 3H3ZA 5BNOC 1OLQA 5IYYA 1XNAA 4B7EA 4Q4V1 5HV0A 3NV4A 1NLSA 1MZ6A 2WUHA 2Y64A 4JQRA 3ZR6A 1QU0A 4DNYA 5IVCA 5IHRA 4BDVB 1QF3A 1QKQA 4ASMB 2XVLA 1XC6A 2A1XA 4BZ4A 3U37A 4HKLA 3POEA 2WWJA 4L9BA 1K5MB 1N3OA 1RUJ1 1X50A 4HKWA 5FK7A 2EALA 1ULGA 3RWKX 2IXIA 3GCWA 2Y26A 4QX7A 2P34A 1UL9A 1RUI2 5KXBA 2D3SA 2WS91 4N53C 1SFYA 4O61A 1TNFA 5HXVA 2HKXA 5FY9A 1FPN2 2VM9A 2XJRA 5BNPC 4C1WA 1CAXB 2XJQA 3FLTA 4A7KA 3MW3A 4YARA 4N43C 5K0UA 4CDQC 2BU9A 1NG0A 4HG6B 2DCJA 4CDUC 3LOIA 2WO1A 3IKWA 3GGLA 5GM0A 2PHUA 2B9VA 5E89A 5F5CA 2A3XA 3DKWA 2EXIA 3VBSC 1CZVA 5KXCA 2HWE1 1OI6A 5DDJ2 5IT6A 4XXAA 4NPLA 3A22A 4DRVA 2PHXA 3ZXKA 5CB7A 4QHOA 4E4DX 5I8TA 1ULCA 4O7XA 4AHZA 1PX3A 4PLNA 4YG0A 3UGFA 1H8VA 4SBVA 3CL1A 4KNCA 2D6MA 4HZFA 4Y1XA 4IE6A 3NJVA 5F8PA 5FMOL 1JYIA 1WMFA 3MUY1 1RUF2 3BTYA 2W3JA 2VUAA 3NV3A 2CGOA 4QM9A 4LE3A 3RVHA 1GP4A 2D40A 3ABZA 2W1QA 5KR7A 3I97A 4GMP3 5FZFA 1AXZA 1H1IA 1UZWA 2PAMA 1RMU1 3AKQA 4QD2A 2C1FA 3KT1A 4JAAA 3ZLIA 4AEDA 1W9SA 3EYPA 1R083 4FPEA 4GKYA 4FOQA 4XAEA 3O1VA 1RUOA 2W1UA 4FO9A 2J22A 4CDWC 1CAVA 1G9AA 4UOJA 4MSVA 5LA9A 1R64A 4MGKE 1XBFA 2W47A 1R093 2QTWB 5LBBA 3Q8EA 4Y1YA 3AK0A 4LLFA 5L9BA 4BQ3A 5FZBA 1S0FA 2Y6FA 2K46A 4QHBA 4DXZA 5A6YA 2GNDA 3KV6A 1I1EA 4N9HA 5FIXA 4TTGA 3AB0A 5DABA 4OUEA 3DXUA 4I01A 2V4AA 3E6BA 3U10A 4A7ZA 5IWFA 4XC9A 3H3UA 1RUG3 1ZZCA 1JOBA 2VOKA 1RUNA 4I2OA 1A78A 4M00A 3KMHA 4GALA 3WSOA 2RVAA 3BIWE 3FZ3A 1GZTA 3ZXEA 4WVZA 4CDQB 2QQIA 1CX1A 1H6XA 1LHWA 3I2IA 5FV3A 2B5HA 4QPGC 4E2GA 1W03A 2RS13 1V6IA 2UYAA 1KDMA 2ZACA 2D6KA 2HWD3 5KXEA 1BQPA 1UIJA 4AQ2A 3BYWA 1IG0A 2W92A 2XDVA 1V6OA 3PHMA 4FAGA 4K6BA 3VD9A 3W5NA 3U78A 5JIUA 1XQNA 2R1DA 4LLOA 1GR3A 1SDDB 2OZ6A 1RUG1 2Y6JA 1LGBA 4ASKA 5BY5A 2WNUC 2JE8A 1FMD1 3SEPA 1O5UA 5KXDA 3TYJA 3BUCA 4R4ZA 5FUNA 3EQEA 1DIWA 5J48A 3WG3A 1IPKA 3U0ZA 4DMIA 5FKBA 4OQ9A 4NO4A 5A70A 3ZYBA 1YCIA 3M7AA 4HVOA 4PQQA 2WT0A 4I02A 1WUVA 1HV0A 2JG9C 3K4ZA 4XILA 1GBGA 1XB9A 1GZ9A 4PT6A 1CJDA 1REFA 2BP6A 2HWD1 1NCQA 4GH4A 4XJUA 4NWWA 1JTZX 3AKRA 4XFFA 5JI7A 3T2QA 1REDA 1PO23 4NAOA 1GNZA 2ZMKA 5FBJA 5EP9A 3B93A 4LBQB 2DCKA 3BODA 3C3VA 1D7PM 3THTA 1H1MA 3JBG3 4NHYA 4QQOA 4LXLA 1RUE2 3WW3A 5HI0A 3PVEA 4QXKA 2A6WA 5LK5A 2OPKA 4CP9B 2NMOA 2E7TA 1SDWA 1D4M2 2G1MA 1F9KA 1UU4A 3E5QA 3J8F2 4A3XA 2W08A 5FXWA 4QPYA 1QOTA 1Y7BA 3MW2A 3T09A 2YBKA 3ES4A 4NRPA 1URXA 3HNMA 4XETA 3MIBA 1O3RA 2FDGA 1EAH3 3B01A 1V6NA 2UWAA 2YY1A 5FFOC 4E8DA 4IXLA 4LR4A 2V09A 4L8QA 4XFHA 1PIV3 4MUVA 3LA2A 4ISRA 2ARAA 2C6SA 4GZ9A 1ND3C 4QPGB 3BOPA 4XJAA 1Q3EA 5FYBA 5KHJA 3WG2A 3O0VA 1IGOA 4FTBA 3KVAA 2A6XA 4Y5Z0 1Q8VA 3TAYA 3RYKA 1UYXA 4EZHA 2WFF2 1K3IA 3IDEA 3D0JA 4HK9A 3DCQA 4KG8A 4CP2A 4Q0UA 2VXJA 4FOWA 1H2KA 1ND2C 3V65A 1ZYBA 2Z2SB 2WNUB 5JWPA 5L19A 3ZYPA 1NAEA 4MGIE 3USSA 3THDA 4P9WA 1RGSA 4WVVA 1Q56A 3ZSEA 3OY8A 4R9BA 1EAH1 2IFRA 5DMYA 1GWMA 2ZGQA 3V0BA 4WZFA 1EY2A 4LBJA 1RL3A 1MQTC 1PIV1 2VMHA 1R1A2 4GA9A 2C9KA 3J4UH 5LRRA 3I54A 4PDWA 2C5DA 4OHYA 2ZHLA 4DB5A 1REEA 1LGCA 1JUIA 4Y20A 3KSCA 1VBC1 3VD5A 3O0WA 1AZDA 1HV1A 1NUKA 3P3NA 5SV8A 3OCPA 4EV0A 3M3IA 4QWNA 3OPWA 1RITA 1RINA 2WWUA 1GSLA 1D4VB 2B39A 2RHPA 2HYKA 2EIBA 3UV9A 4BQ4A 1J58A 1CD3G 5K8SA 4CP1A 4ES8A 1QEXA 3GBWA 1BMV1 1ZZ8A 1Y9QA 2DUQA 4OUMA 1GZCA 1YUDA 5IVBA 3LDBA 4RR3A 4BCUA 3NKGA 1OOPB 1S2BA 1ZM1A 1UYZA 3GJAA 2VGDA 2GP3A 5IVJA 1KD7A 5FZOA 2VW0A 2XMLA 2XPJA 4ONUA 2BQPA 1VBB1 1YFWA 2RS53 2RMU2 1AYN1 2BRTA 2QVSB 3ZFFC 3GBGA 4B4PA 4BXSV 3GDBA 5CU1A 1BEV2 4JZRA 2XG3A 3OBRA 1QQP2 3NRUA 2FCUA 2LROA 4FXGB 1QGLA 1WCUA 1ZA7A 4IERA 5FZ3A 5E88A 3RI8A 4ZXKA 1SHWB 2PXJA 4A6SA 1BVP1 1Z7S3 4IEXA 5E6HA 5A7PA 4CUBA 4FSJA 5I8YA 1S0BA 1RHI3 3D5OA 1LODA 2PLV3 3V0AB 2XUMA 5IFPA 2R063 5FZGA 2RS32 1U5YA 3CDZB 5CBLA 3KHBA 1MQTB 3MPBA 4N90A 1YFUA 1H4GA 2WO3A 3PUIA 2ZXQA 1S0EA 3I3EA 1UD1A 2ZX0A 2RS51 2P37A 2HBUA 2DURA 4FOVA 4OZXA 1F31A 1SMVA 3GYDA 2AH2A 5BNNA 5C8CC 1VMJA 2JEMA 5T50A 4EN6B 1OQ1A 2EF6A 4AOCA 5CG8A 1HRV2 1YC61 4Y3OA 4CP0A 1ZRIA 5GZFA 3NNFA 2WZPP 1M4WA 2HWB3 3LEGA 5A6ZA 3N9PA 2G9ZA 3D8CA 1Z7S1 2JWPA 4NN0A 4LUKA 3LGRA 4IV1A 4HXCA 3UGHA 1W2AX 3NJXA 3H50A 3RGBA 3VBHA 2B42B 3NSTA 3JB4C 3VDDC 5AC91 4AG4A 4B29A 1RHI1 4AR2A 1VIWB 2OX0A 5J37A 1FNYA 4UI9L 4A6OA 5I8SA 1CZTA 5LB6A 2W68A 3FMGA 4ZS3A 3HIFA 4RFRB 3X29B 3CJIC 3I3DA 2YC4A 3WDTA 5GLZA 3I2FA 4TZDA 4MADA 3HD8B 1IG3A 3TNPB 1OURA 3WNPA 4KBBA 2ET1A 2WC2A 2IFWA 4QXCA 4W50A 4AHXA 4F83A 1B35A 1UZZA 1XE8A 2VQUA 4ZKTB 2FDKA 4CXYA 1K12A 1YNAA 2YB7A 4LITA 3A0NA 2Q5TA 4MVTA 4V2WA 2JG8C 2YV8A 2D93A 2ZAHA 3ZFFB 4ET7A 2A6ZA 3UGGA 2WA4A 3MW4A 1I3HA 4SLIA 2KR2A 1V9U3 2JDZA 4W4ZA 3JUUA 5FYMA 5GZGA 1QJFA 3KD4A 1Q8SA 5F3EA 3USUB 1CIYA 4M3CE 4CA9A 5LCWL 1PMIA 5CZKA 1W9FA 1QJEA 3T0DA 4FI9A 1W8TA 2VZ1A 1W06A 5CISA 2XVKA 5F3GA 3POJA 4FPLA 3AXDA 4P9XA 1PGL2 1LOBA 2WT1A 4RGGA 1U5ZA 4PQ9A 2R041 4LO8A 1W2TA 1FOD3 1ZZ6A 1A3KA 3FHAA 3ECQA 2R6QA 3EHKA 2GZWA 1YWKA 1OD5A 3VKOA 2BW8A 2GU9A 2J1SA 5EJ3A 3AFKA 5F2WA 3BTXA 5C8CB 1DZTA 5FY0A 2PQSA 4AFBA 4EN7B 3ON7A 1HRI3 1V9U1 2XGXA 4KWKA 4LO6B 3KF5A 3MF9A 3SISA 1KGYA 1RUI3 4NE9A 5C3OA 2A6YA 3VHNA 4IETA 3E5XA 3VD7A 4CCDA 1EP0A 1LOFC 1FPN3 1O4TA 4K21A 3WQ1A 4INDA 5GKAC 4P9IA 5C3SA 4FTEA 3U14A 2BNMA 5FP7A 3VDDB 1DQ6A 2E63A 3Q8AA 2EAAA 5BV6A 3FBMA 2ETEA 3MEPA 2GNBA 3K77A 4XF9A 5F7UA 1RJ8A 1FOD1 1RYYA 1YJKA 1GKBA 5LK7B 3CJIB 2HWF2 4QB2A 2VZTA 2WO2A 5FYZA 2VAUA 1LHUA 4YG6A 4RHV1 4BB3A 1W6QA 2YU1A 1B09A 2VZUA 4OMCA 4QDQA 5T54A 3BKZA 2YC2A 1F15A 4NIHA 4YW4A 3LEIA 1FXZA 1WD3A 5DDJ3 1VR3A 3CF6E 3NVCA 3OPZA 5J98B 1IS4A 4K8FA 3VBFC 4HONA 2FMDA 2Z79A 3POBA 3WHTA 5JMCA 3TOJA 3W21A 4CPBD 3NO8A 1RUD2 1IQAA 2E32A 1KEXA 2OT7A 1RUI1 5FZCA 4I0AA 1OLRA 2BGOA 3AZVA 3N9LA 4XFCA 5LBFA 1W8UA 1ZA4A 3MIFA 4WVMA 1FPN1 1WA4A 2YMZA 1RUF3 2PN5A 3MPPG 1W2UA 5LBEA 3S6PA 5BXXA 4Q4X2 4CRQA 5FLIA 4TSVA 2VOWA 3J26N 4HANA 2VR4A 1GANA 2VECA 1QJY2 3WT3A 5FZ8A 3RJRA 3LPGA 3I2KA 2EAKA 2IUWA 4LBQD 4Y22A 5JZGA 1PZ7A 2JKBA 1S2KA 5A1FA 1MS0A 1OLME 1MS1A 2VZRA 2ZX3A 3R4UA 5DDJ1 2JE9A 1XE0A 2ZA9A 3VBRC 5L36A 2R30A 2NM1A 2GH8A 4DIQA 3ZXAC 3DPRC 4HFSA 3TEYA 5FUPA 3ZSJA 5EXOA 2BPA2 5B4XA 4LBOA 1A8DA 1UZ0A 1NZCA 1Q8OA 5IW0A 1PM4A 2BBVA 3T0AA 4Q8KA 2BOIA 3AKSA 4QGMA 2UYBA 4O65A 1QJZA 4QKNA 1UO9A 2VW1A 4CEWA 1YQ8A 2ZEZA 2NZ9A 4QX5A 3IB3A 5H9PA 3SEEA 4XCBA 3LA7A 4XZUG 1ZBE3 4LBMA 4W65A 2CDOA 3ILFA 3LEKA 3FC0A 3J7LA 1NXMA 4W6WA 5FOJB 5A7QA 4JX0A 5FZ4A 2D43A 3NAPB 2Q0AA 2ZGKA 2A73B 3RJ2X 2VZ3A 2WNOA 2VZQA 3L9JT 5HCBA 5FYYA 2PHDA 3SNMA 1A6CA 3PNAA 2BNOA 4RYDA 4AFMA 4XTMA 4F7ZA 1H8TC 1DLLA 3ACHA 2RR12 2LS6A 2ZGOA 1ENRA 2WNVC 2QQUA 5FY1A 3PJQA 2AUYA 4YYOA 4F3JA 5JPNB 3RZLA 1VRBA 4OULA 2AGSA 1AR82 3HT1A 5AFBA 3B7MA 5CFDC 3JZVA 4JDNA 4CEYA 2AREA 5C9AC 3NWKA 3LOBA 5FR3A 3U07A 1SPPA 1UMHA 1J59A 3KM5A 4EQVA 2VW2A 3UKVA 4Q4Y2 4JGYC 1CAUA 1CIWA 1OHFA 1EPZA 2VXRA 5IVFA 2QQNA 2XLAA 1JZ8A 1F4HA 5HCFA 1CX4A 1NQDA 1L7RA 1XNTA 2WL1A 3VBRB 4IEYA 2OA2A 3H3LA 1WMEA 4LE4A 4IV3C 4V2VA 1ONAA 4XE9A 3VDAA 3KV9A 3EXUA 3M3QA 1MPXA 1MR5A 4AI0A 1NA1C 2K9ZA 4J1XA 4BXFA 2H0VA 4AVVA 4G9SB 4WM8C 4AHWA 5E16A 3LZZA 1OBNA 1CN1A 1C8M2 3ZX7A 2E33A 2FMYA 5BUVA 3VD4A 1HXS2 5GLVA 1RUE3 3KLSA 4IEVA 1NYWA 3WUCA 4CU8A 4PIXA 1LJ7A 5IK4A 3VKMA 3KV5A 3J8F3 1D4M3 1MVQA 1J84A 2H6CA 3AMPA 1ASJ2 1EYBA 3T2TA 4CXXA 3BOWA 4JHTA 1Q8PA 2W95A 4L0PA 4YLZA 2A71A 1BYHA 3PUAA 1GZWA 1HB3A 2DDUA 3KCYA 1SQ4A 4Z07A 2RJLA 5LEJA 2D5HA 2CGNA 3I2OA 1DQ4A 2X10A 1DHKB 1F5JA 2DVBA 4J25A 2BZDA 4NPRA 2ZGRA 1H8TB 2YDEA 3TEWA 2OW4A 2XBO3 3S5QA 4LULA 2WFF3 3ZYGA 2EIGA 5HCAA 4K3UA 3M3OA 3D4KA 4FXKB 1RUE1 5F6KA 1TMF1 3EJKA 5FLHA 2ARBA 3J8F1 2CDPA 1SZBA 2P6CA 4KWUA 2X05A 4GKXA 1SBDA 1UY4A 5CFDB 2ARXA 3J7NA 3WP6A 3LFIA 3ZXDA 3JB8A 4S2GA 5M0TA 3WZ1A 4HPKB 1IS3A 3ZOIA 4UXAA 2VCCA 4PF1A 4QX0A 2GNTA 1R1A3 2XR4A 4JGYB 4U2AA 1JYCA 2AENA 4OI2A 4XQ4A 4HSJA 1KFUL 2ADDA 2CV6A 3I2HA 3Q8FA 4LNVA 4W8JA 4COYA 1AJKA 4QKFA 4JCKA 1MS5A 5EHDA 4DPNA 3H7YA 5BYNA 4QU1A 4GWMA 3ZMOA 3PU3A 4IV3B 1PNGA 2HWC2 2DU0A 4YG3A 1UY2A 1Y9GA 2R072 2R062 1NA1B 1ENSA 1G9CA 4BWOA 3HT2A 2VUJA 4A4AA 5L7OC 1H4HA 4QKDA 3CLPA 4A44A 2GP5A 4XFGA 2VZOA 4E4SA 4WM7C 4ZU7A 1VAMA 1XRUA 4YPJA 3LKJA 4QQLA 2QQOA 1W99A 4MX3A 2D7FA 1OLMA 4BOWA 5ABJB 5FMDA 5FPVA 2VOTA 3WLUA 1KS5A 1T6BX 4FPOB 5FKCA 5L73A 4TN7A 3H0OA 5ANNA 3K4DA 3AJYA 4KWLA 4QQPA 3WP3A 3RZZA 1QNWA 1NY72 1XNKA 5KC6A 3ES1A 5A33B 3BU0A 3IT8A 3KGLA 5DUUA 3HVDA 4Z8BA 1LECA 4P9YA 2YBPA 3M2MA 4QXBA 2RMU3 2ZABA 3HN3A 4YSFA 1BEV3 1POV1 2ZCWA 1VBA2 3MLKA 4YVWA 1QQP3 1APNA 1H2NA 1UN1A 5FY4A 4AK3A 5FZ0A 4PJYA 2E26A 5FPZA 5J96B 2AEYA 4LT5A 2W94A 5FZ1A 2VTXJ 3VV1A 1UCXA 3OYWB 4CDXC 4HSLA 1KJLA 3T0BA 3IN9A 5IJRA 5FY7A 2ADEA 3PMEA 2Q1ZB 4RS5A 1H30A 1WZXA 1YRZA 5FXZA 5FMOS 1MS8A 2SBAA 2Z5WA 3AYEA 2Y38A 3HBZA 3VGIA 3LF7A 2RS33 4EE2A 4E2SA 2JXAA 1W39A 3WW2A 3QLQA 4CSWA 2PQQA 5EPAA 5JPMB 1K5MA 2WSUA 2Q8CA 1AR91 1OXCA 1W2OA 2RMU1 5DAXA 2C0ZA 5JR7B 4C91A 4CCCA 2Q8EA 1QQP1 4QMAA 4NJ4A 1HRV3 3R0RA 4J6GA 3ACFA 1W6NB 3AL5A 3AMHA 1CJPA 1SBEA 1CAXA 3IAPA 4DXTA 3I8TA 3WHUA 2WZ8A 4DUXA 1ENQA 4Q5OA 3UJQA 5L7OB 3SXWA 2R7EB 1S0IA 3LD8A 3VD3A 2O8QA 2YUEA 5K0UC 2BYVE 1ZRFA 2XL7A 1JZ3A 2RS31 1HRI2 2XJSA 2ZTNA 3LSDA 4XMIA 1GICA 2VBBA 2WINB 1OFSA 4XDPA 1G7YA 3OUHA 5I0DA 1C3HA 1RIRA 1C57A 4FP3A 1QNYA 5JSPA 3ZYHA 3FHQA 4QGNA 3BTZA 3QH6A 1LOEA 3D3AA 4WV8A 4QDSA 3O1TA 3I59B 1HRV1 3A7QA 3PUHA 5LA1A 3LCPA 3VKNA 3MFCA 3T1MA 5J7MA 4NIDA 4LUMA 5A3UA 1SBFA 4CU7A 1ZRDA 1AYM1 3H8XA 3WUDA 4BQYA 4A2UA 1CZSA 4D7TA 5KBFA 1G86A 1UMZA 2D97A 5TSWA 5FQ0B 4AFCA 4XW3A 2YGLA 2BTVC 2P17A 2XHNA 3KZ4C 5T5OA 4CDXB 2PAKA 4JV4A 2DCTA 3OUJA 1CVNA 1NLQA 3CMGA 3FJSA 3WD5A 4AEDC 3DUIA 4E8CA 2WIIB 2KD7A 1W8OA 3LSEA 5JMOA 3AYDA 2QZ2A 5H9SA 3MO4A 3HWJA 1C4RA 1W05A 3C7OA 4FFFA 3G6JB 4QXHA 4XBQA 1CAWB 3KCXA 4LHLA 1C1FA 4HK8A 5A7WB 1QWRA 1ULDA 3POYA 4OI0A 2Q8DA 4YZ3A 5B2GB 5FK8A 1W3VA 1YFYA 1OA3A 4LTAA 3MV11 1JZ7A 5DQ0A 3Q8BA 3S7IA 1DQ1A 1E5IA 1W9TA 1VBE2 2GMEA 2ZOEB 3BGAA 5EYYA 1JN2P 1DGWX 2JDPA 4AI2A 5BNOB 2ET7A 4XJZA 4CDQA 3KCCA 1J3QA 3GZAA 2JDNA 1TG7A 4A41A 1FATA 2QDNA 3RS6A 4Q26A 4L92A 4DRRA 3URFA 2BVVA 3PIJA 4MGTA 4V1PA 5JOYA 3HMYA 2HWF3 1VBD2 2P3JA 3SLIA 4FAHA 3B02A 3WNMA 5FYCA 4PLOA 5FPLA 4LPLA 4N53B 1W0OA 1XU1A 3LWCA 2ZKLA 3WP5A 4CCMA 4YGEA 1C5HA 5BNPB 5EJ1B 4BK5A 4GMP1 4DY5A 3ZXJA 1ZBE2 1VRH2 4QM8A 1RUD3 1R081 2KXLA 1TME2 4N43B 4YW5A 1HDKA 1HB2A 1MEC2 4CDUB 3NJYA 3PUQA 1VAVA 3JCIA 3UETA 1SCRA 1R091 1NLRA 3JQXA 4Q4X3 4AGVA 1ULFA 3VBSB 3AMQA 3LA3A 1W2NA 4COUA 1SFPA 5HBAA 5I0RA 2W91A 3OEAA 2WSVA 1QJY3 1O8SA 4CTEA 1AR73 2YGMA 1RUC2 2QFEA 2UURA 1AL22 3CZJA 4D0QA 2C24A 1F5FA 1UYYA 4GH4C 5DZGA 4RQPC 4LEJA 2OS2A 4G3YC 3N36A 4C1XA 4XDOA 1W0NA 1OQEA 5IK5A 1PVC3 3ZN6B 3H7JA 4AEMA 4UFMA 5EZWA 2A75A 1DZQA 4FP2A 2HJIA 4CP9A 4OHWA 3WDWA 1QJU2 2RS11 4JRAA 4Q4X1 2DTYA 3SCHA 3N9MA 5A7SA 1U12A 4S2FA 3O0XA 4Q1PA 3OGSA 4CE8A 4CDWB 4E27A 1MVEA 4D7SA 4Q4W2 1QJY1 2WABA 1X82A 4BQWA 1XYPA 1DG6A 4XEZA 3AFGA 3THCA 1BK0A 1H9WA 2YROA 1YO8A 4D69A 3HJRA 5C3RA 4XIOA 5FWJA 1YQ5A 4LHSA 2ENRA 5C5TA 2EVXA 3SCFA 1N3QA 1UY1A 2VCBA 2IZWA 3VDBA 2A3YA 4MO3M 1X9TA 2WT2A 1C5IA 1EV12 1TVGA 4HOOA 1WGPA 4MHRA 1JU4A 1XU2A 5EYXA 2RR13 2V72A 3F2ZA 1W6MB 5LEKA 4XHBA 4KH9A 1W04A 1PO12 1N1YA 3AZWA 5G05L 4A42A 2LW8A 5DUXA 1D2SA 3KWVA 2WNUA 5JUVA 3K3OA 5E1RA 1AR83 3VZMA 1GV9A 1Q8QA 1COV2 4IW3A 4AEJA 1PO21 1LAJA 4AVBA 2SLIA 2Y6HA 4XJWA 2IWGB 4ORFA 4YW2A 1X8EA 2PYTA 1XNCA 2IXLA 1QHDA 2HEYF 2XBO2 3KT4A 4HBNA 1RVF2 3JBG1 4Q4Y3 4ZPIA 4LKSA 4Z1VA 4PDWC 2YFUA 4MV2A 1OA4A 5JXIA 2A5ZA 2Q4SA 4H7MA 4GB32 2OZJA 2DYCA 4GH4B 5F3CA 1H1AA 4RQPB 4JKLA 5FREA 2QZ3A 1W9YA 2WAOA 4YZ5A 3UJOA 2RR11 4UW3A 1JODA 2X29A 2WFPA 3OEBA 2RV9A 3AP5A 2QNKA 3IM0A 2ZAAA 3L2YA 2GH2A 5FWEA 1KITA 3ZYIB 1CPNA 2ZX2A 1C8M3 1LB2A 1W8NA 5EQUA 2TBVA 4YM2A 2JG9B 1HXS3 3R4SA 1OC1A 2H0BA 3BVCA 5IVYA 1G9BA 1IPJA 4OMDA 1LENA 4NAMA 1JZ5A 1OOPA 2MEV2 2NQYA 1BCXA 1SLTA 4RR3C 4Q4Y1 5FYTA 1NKGA 4GXLA 1ASJ3 4BQXA 1F4AA 2Y33A 1JH5A 1US2A 3AMNA 4COWA 1LHNA 2WYFA 4FOYA 1T6GC 5DAQA 1HKDA 1BLZA 3K51A 1WCQA 4S2HA 3NL1A 1VB2A 4YZ2A 5I0UA 3WQBA 4XUQA 1W8FA 2ZEYA 5D8AC 4LK7A 1WD4A 1ZBA3 3N7KA 4JC1A 3S30A 1WWYA 4B4RA 2TEPA 4KBZA 5ACA2 2WN2A 4OLLA 5J09A 2BOJA 1ODNA 2DFCA 2JB4A 4Y26A 3MBWA 5G04L 2RM22 3K4AA 3N7JA 1WMXA 3THPA 3ZFEA 3V0AA 3HR9A 2ORXA 5IAVA 4H3WA 1J1TA 2VOXA 1ND3B 4JHZA 1Q5OA 4FT8A 1GOHA 3GF6A 5A7OA 1OH3A 3WG1A 2WKKA 2AC1A 5F3IA 2FD8A 4GJYA 1H9PA 2G9FA 2Y0IA 1XYOA 4R8HA 4JDOA 1NOVA 2YFZA 4W6YA 2QKDA 2VVFA 2WZR2 4IE0A 1FX5A 4QGLA 2MPFA 4AE2A 4YW7A 4AAXA 1HB1A 4BA6A 4I0BA 2EXHA 5BNNC 1WW7A 1DYKA 2YBSA 2CWMA 2EIEA 2P3KA 4Y1VA 4AAPA 4L2NA 4CCOA 4XCAA 1ND2B 2FDIA 4WVWA 3HAGA 4FFGA 4I30A 5FZIA 2HWC3 4EN8B 2J7MA 2NYYA 5FBZA 2R073 2VQAA 4IV1C 1RXFA 4K7JA 3AJZA 3AMMA 4EROA 2VE1A 2YXSA 5LY1A 2XUEA 4AVAA 5CAZA 3JXSA 3OSDA 5C70A 1IZ3A 4FPJA 4LBLA 3E5UA 3ZXFA 3PUSA 2VCAA 4HVRA 4Q4V2 4DZGA 5GLWA 1DGRN 1MZ5A 1ZZBA 3BB6A 5FLJA 1O3TA 1JBCA 5IAXA 3RYPA 3IIIA 3W5MA 2CU5A 5FZOB 3FL7A 4TLGA 2B46X 4FCAA 3NJZA 1PX4A 2FCVA 2P5BA 3DGTA 3AP6A 2P4EA 3O5SA 1RUJ2 2A70A 2R0FA 3O1SA 1X36A 3PL0A 2VU9A 2PLV1 2WLQA 3V64A 3MI8A 1I9RA 2R071 1VBA3 2R061 3USUA 5D8AB 4N8MA 2IXKA 2O8OA 2WS92 1IOAA 3D6EA 4QU2A 4YW1A 3KQRA 3T3YA 5EIYB 3SH4A 2JB8A 3ZSMA 4LO7A 1A8MA 3C7HA 4BMBA 4DEVA 1DGRA 5IFTA 3PVNA 4H2AA 3S7EA 4Y4RA 3APBA 1N47A 2DVDA 4AF9A 4IGQA 3UT0A 5CG9A 4KU7A 4S2DA 2XWBB 4LOSA 3E6CC 2HWB1 4JKMA 4TWTA 1WCSA 1W3XA 2VUDA 5A3PA 4NIGA 1IKPA 4RGKA 4Z2AA 1GNYA 2AACA 2HWE2 4HN1A 2XHKA 4JTNA 5FXVA 5JOZA 1AL0G 2WJSA 2PHRA 1LTEA 3DEMA 5A1AA 2OXBA 3LIHA 4QX2A 5DN2A 4Y5TA 3WF1A 4YFZA 4ZY9A 1ULOA 3ACGA 4UWDA 4XF4A 3GHMA 3CQOA 1JU3A 3POGA 5GLTA 4MLOA 5J36A 1WLWA 2FDHA 4GQ7A 1FV2A 2WR9A 4XBLA 2FZ1A 3N3HA 1IPSA 4OHXA 1NE6A 1PMJX 2Z69A 4UF0B 3VDDA 2R32A 1DLCA 3OGVA 4CCLA 2ARCA 2W1SA 3NV1A 1RTVA 4D6SA 1OVSA 3MLJA 2XLGA 3VKLA 5IK8A 3CJIA 2QBXA 5DAVA 4BLIA 4CVUA 4GD4A 5A6XA 1SEFA 4XF1A 1LEMA 2R16A 3OB8A 5FYSA 3IAQA 2DF7A 1E5RA 4PIYA 2VJXA 4MZUA 3UYJA 1YIPA 5D1IA 1GYKA 4YM1A 1L3JA 1FI2A 2ZGMA 2EXJA 4DO0A 3PTYA 1XXNA 4Q27A 3ZKUA 5FO8B 3S0MA 1IHMA 1GQHA 2QDRA 3HNBM 1AX1A 1WBFA 1POV0 1GWKA 2J1EA 2OVUA 3EB7A 3M3CA 2PHFA 4CCNA 5HV4A 3LDRA 1AF9A 5KC5A 2YG0A 3BU7A 2ES3A 3K46A 4R4XA 1DU3D 1X8MA 1QXPA 2G19A 3VKFC 1DQ5A 5DUVA 1HRI1 2VO5A 2B4KA 2W1WA 5JZGC 5T5LA 1HX6A 2JG8B 2WAAA 4BISA 1D0HA 2Y8KA 4JGZC 5C4WC 3T2OA 2OKXA 4DOUA 3NV2A 2C9AA 3T4HB 4EN0A 2BBAA 2WQ8A 2J1UA 5F39A 1POQA 5A32B 2ZGTA 2JENA 1S1AA 4FPGA 3JQWA 2JD4A 3WNNA 4NIAA 4AVTA 1YQ6A 2VZPA 1JOJA 4XZPA 3WV6A 4BK4A 2GALA 1AR72 4CU9A 3DXTA 1DDLA 1QDCA 2IC1A 4JVAA 4BIFA 1FMD2 1VBE3 4YM3A 2ZKNA 2YU2A 3B69A 2AZ5A 3I7DA 5FPAA 5FYHA 4CCKA 4OI1A 1S4CA 2FDJA 2DU1A 1SFNA 4AQTA 1PVC2 1WW6A 2ZZJA 3NAPA 4XOGA 3AM2A 3C7FA 3ZM8A 3WCSA 1PK6C 5LZ6A 1JZ2A 1LU2A 3O1UA 1PZ8A 3SKJE 1VBD3 1RUF1 3WDVA 1Z0HA 2JDHA 1LOCA 1S0DA 2PMWB 5FYUA 3VL8A 1GWLA 4BPZA 3PIGA 2QQVA 3QOPA 1DYOA 5L9RA 3ZYRA 1VRH3 4D7YA 4MGSA 1S0JA 1U5XA 2W46A 2X5IC 1TME3 2CWSA 4AHYA 1VBE1 2AR6A 1DGLA 1MEC3 1K42A 2XJUA 4OI4A 4N7IA 3GCXA 5A7NA 2X09A 4GWJA 3IPVB 5FRAA 2QE3A 3OF1A 4PIZA 4XUTA 4ASLA 4K40A 4EJRA 2DWRA 2ZEXA 4AQSA 3AP9A 3ILRA 4WBBA 4A7YA 4XFAA 1HIXA 3VBFB 5BNQA 3K48A 3M1HA 4PI0A 2PHLA 1VBD1 5JZGB 2VY0A 1RUC3 1AL23 5JVVA 5C4WB 3J9SA 4JGZB 3VBRA 2PHWA 3B9CA 5JI9A 4Y1UA 1CQ9A 1JUHA 1Q43A 2O0OA 4DEQA 5DZFA 4B1MA 5HPOA 1ZBE1 1VRH1 1YJLA 2VMGA 4QDRA 4FQZA 1TME1 1O5LA 4AEKA 4I09A 4IUGA 3LE0A 3U4XA 2GC0A 1VLNA 3WEZA 5A3OA 4UFKA 4QPIA 1QJU3 2V73A 3ZXLA 3INAA 5FXXA 1PGW2 2VBDA 5EV7A 4AVCA 4D6RA 4YW3A 3GZEA 1X7NA 4Q4W3 2YHJA 1HLCA 2DUOA 3I2JA 1ALYA 3DPRB 1RUC1 2P3YA 1W28A 4XQWA 1AHSA 4KL1A 4M3CA 4XBNA 1PK6B 4P14A 1BBT3 3GHNA 5ERLA 4ATEA 3H1WA 3LFMA 4K9SA 1LHOA 4RFT0 1VBC2 4XJ8A 1H8TA 4XFBA 2QQMA 3FX3A 4A3ZA 1EV13 4KWJA 2JIGA 2C4XA 4URAA 3UESA 4BHPA 2GSYA 1PO13 4C90A 4GMP0 3SKVA 2PAEA 1TZOA 2X5IB 4QB1A 3ACLA 1GLHA 2NLRA 1NCRA 1EUUA 1OUSA 2RJ2A 2XJTA 3AYCA 4P9GA 5FP9A 5CFDA 4FTSA 1ZX5A 4GWIA 5FP8A 2IXHA 3ATGA 5HXMA 1COV3 5CNAA 2QQKA 4HPKA 4BIOA 1CPMA 5DAPA 1AJOA 1QH6A 2D6NA 2D6LX 4JGYA 4X6RB 4PCRA 3AYAA 3EBRA 1O8PA 3LPFA 1ZBA2 1LOAA 2E6VA 4BQ1A 1RVF3 2WNVB 5KHIA 4GB33 1OUXA 3VBOA 1VBB2 2BV4A 1HN0A 1EV11 1AYN2 3J7MA 2JDUA 1D4M1 4IV3A 4M4PA 3RFRA 1EPWA 1PHMA 3RSJA 5D21A 4BQ2A 1NA1A 5CA6A 4Q0VA 5C9AB 4BM8A 1PO11 1UOFA 1WCDJ 1JYNA 2VD7A 1CR7A 3MDPA 2WLPA 3VBUC 1HQNA 3ZFGC 3MZHA 5KHGA 5IUQA 3UNPA 2VPVA 2BJSA 4OHVA 4I3GA 1ACCA 1TQ5A 1LESA 5IVEA 1YI9A 3NNJA 4QX3A 5CKMA 1XE7A 5ABJA 5AFEA 3PU8A 1W6OB 1YEWA 2MEV3 2Q1FA 2Y0OA 2XBO1 5FZMA 2WFF1 1FYUA 1UX6A 3OOXA 3ZMNA 3CO2A 4GB31 2OQ6A 1QJX2 5C6CA 2ZX4A 4WM8B 5EJZB 3TBDA 2E7AA 1X33A 4XXPA 4Q0PA 5K7PA 2OYZA 2I74A 4OQ8A 4MXWB 4ZU5A 4FPCA 5FZLA 3ASIA 4YVWC 3JD72 5JIAA 1UU5A 4Y33A 4PBPA 2DFBA 5FOBB 4Y5SA 3VL9A 5JSOA 2MNGA 5FZAA 3OYWA 1MACA 1R1A1 3A21A 5ANQA 3P6BA 3E97A 5ACA3 1GQPA 2JECA 2K2SA 4KGGA 5AC92 1STMA 1XSQA 5I0SA 2VBPA 2RM23 5F37A 1LCLA 2RE9A 3P1IA 4FPHA 2OQ7A 4HVQA 2ZHKA 3BN6A 4H7LA 3UK9A 3KQ4B 1ULPA 4TLFA 5I0TA 4L11A 1KDKA 3K2OA 1BXHA 3AC0A 3O1RA 4AZZA 1XSRA 2VVEA 2I45A 3ETPA 1QXJA 1LHVA 4P02B 2DBNA 2FBEA 3M4FA 2WZR3 4YVSC 5C33A 1GQGA 1UKRA 4J1WA 5FAXA 2PTMA 2WO7A 1N3PA 1MS9A 1W6NA 5JOWA 1SLBA 1W6PB 2B7YA 2YPDA 1LULA 5FZ7A 2IXJA 2GN7A 4B7KA 1T2XA 1ZVFA 4E9KA 2X8KA 1SLLA 5ACA1 1UOJA 1LR5A 3LIGA 4LBKA 3VBUB 5L7OA 2B45X 5GJ6A 3ZFGB 1L7LA 2RM21 3UKTA 4GJZA 4R9CA 1D2QA 3OBTA 3DF0A 4TXWA 5FZ6A 2FDFA 4JQTA 3KS7A 5FDBA 2AEZA 3CEWA 1BEV1 3N7LA 3MV01 1QXRA 4GWNA 2R042 3NKTA 4XACA 1BKZA 5F5QA 2VNGA 2WZR1 4Q4V3 1U0AA 1QMJA 3GBFA 3ME2A 2J1RA 4OVEA 4COVA 1XJAA 3POWA 3I59A 1UPIA 3PTRB 3OG2A 4UBHA 3DYOA 4ES9A 4W6XA 2CSGA 1RUJ3 2OUJA 3ORJA 1YQCA 4Y4YA 5B4NA 1PMHX 3KB5A 2VMCA 3N7MA 4WM7B 1UYPA 2VTXA 4YVWB 5FQ0A 4LKEA 3FBYA 1YI7A 1WW5A 2WS93 1X9PA 2RDNA 1HQLA 1GUIA 1JHNA 4CDXA 2Q30A 5IVVA 2BVBA 1HB4A 1I5ZA 1JHJA 4IGOA 1JZ6A 3RDIA 3FFQA 3WDXA 2GC1A 2NMNA 4FFIA 4YW6A 1LNSA 2CL2A 1J83A 4PLMA 5A3MA 3I3MA 3H8RA 4QX8A 5C71A 3CNAA 2LUWA 1UZVA 4OYUA 3DYMA 4GAZA 4RHV2 3NNMA 3S57A 1CAWA 4UW5A 4MH0E 4JTOA 5LW9A 5A7WA 2HWE3 1M06G 1DF0A 4YVSB 1OQDA 4NWVA 4XFIA 3WQ7A 1UNBA 5C8WA 4B4QA 2GNMA 3UL2A 2CAUA 2E53A 1YFXA 3WINE 2BFUL 4UFJA 5BNOA 2HBTA 2WQZC 2XWJB 3WOGA 1XPWA 3OPTA 3R6SA 3SITA 1PGSA 2XLFA 3QBQA 1F8VA 2CYFA 3VZNA 4Z82A 3VHPA 4UYBA 3ENRA 3TEZA 2VG9A 2LM3A 4C8DA 1RMU3 4LIVA 4CXWA 1PM7A 3RZHA 4RD7A 2VZVA 2Y6LA 4KI5M 1RUH2 2CAVA 3IWZA 4P00B 2VULA 4N53A 2NPIA 2HEWF 4NHMA 3HQUA 4ZZ5A 2HH9A 3DYPA 2GDFA 3ALQA 3M70A 4LHKA 5BNPA 4BH9A 3NNLA 4AI9A 1VB4A 2BUKA 2L9LA 2R0HA 4EWDA 3H8OA 1YLLA 4N43A 1PGL1 2XKOA 4B3NA 4HL0A 3VLBB 3HN1A 4CDUA 2DTWA 2Z4FA 5K0UB 3POSA 5DXDA 3LAGA 3PDQA 5A3NA 2ZGLA 3VBSA 5APAA 1OPMA 3ZVXA 2AYHA 4N7UA 1HJGA 1MS3A 4K1YA 4XAAA 1FV3A 1JMUB 2BWCA 3H1MA 4RA0A 4BLJA 2XXZA 3MLLA 3C8XA 3DKQA 4DXSA 2QQLA 5FY5A 4LA3A 2O1QA 5FO9B 1ZRCA 3POFA 4XDQA 2W9XA 3N9NA 4XTPA 1C8NA 2O14A 1EUTA 5DZEA 3OD0A 1AUYA 4YGDA 3O1OA 1OPOA 4ISQA 5LATA 5JXGA 2DUPA 1GFF2 1LKNA 2VNVA 2ZS6B 1JOPA 3K75B 4UW4A 5D2AA 3RWNA 3ZN6A 4E4HA 1PVXA 3AX4A 4JDMA 5F5IA 5SV5A 1HJFA 4Y24A 4C0HA 3CZUA 4CPBA 3E6DA 4DUVA 3MIGA 1AX0A 5FYVA 5F9TA 2EXKA 2W87A 1YYNA 3W20A 1OFNA 2HWF1 1DGWA 4Q0QA 4AEDB 3I3BA 4AI8A 4CDWA 1UIKA 2HLEA 4DINB 1FMD3 2WWSA 1NCQC 3ELNA 3LB9A 3OBAA 1CAVB 1JYWA 5DPNA 5LA2A 2BDRA 5J3UA 1DQ0A 4MOAA 1BVVA 1UQXA 2W39A 2RDSA 2OUHA 4NPMA 1O7FA 2JDAA 3Q9OA 4LBQA 1RUD1 2VC9A 4EN9B 3BPZA 2UU8A 3TN92 1WLCA 1V6MA 5JCTA 2TUNA 4MGQA 3RZMA 4EYUA 2VZSA 2RG4A 2XL9A 3N35A 3AVRA 3B3QE 1LRHA 4M0NA 1NQJA 1BHGA 1N1VA 5GZEA 1KRIA 3AZXA 5DUWA 1W6MA 1UZYA 3OTFA 2VOVA 5I93A 3IMMA 4H55A 2B8MA 5C3PA 1GMMA 5FP3A 4P9LA 1AR71 4YM0A 4AI3A 4ZXEA 1S0CA 4QPGA 1W8ZA 4KG0A 3N9OA 4CCEA 1LU1A 1BBT2 4IEPA 1ULEA 2VL4A 5FPXA 3FLPA 2W0XA 2HYXA 3I2DA 3ZYJB 1PVC1 4P5HA 1GOFA 2D44A 3RYRA 4LBNA 1AR62 5CIRA 2E7QA 2DBIA 1JYTA 2V5YA 2G4IA 2WYSA 4Q8LA 1BK1A 2VMFA 2XVGA 4RQPA 5GZDA 1JS9A 1W9WA 5EWSA 2QQWA 3D0SA 3O14A 4GIQA 4LO5B 1E57A 1OMIA 2CNAA 2ZX1A 4XF3A 2Q8OA 3TEXA 1YQ2A 5KHHA 3RMXA 4EWAA 2OPWA 1UY3A 2YZ4A 3I49A 2GC3A 1S0GA 1JW6A 4DFSA 1WLTA 2DCZA 2QUOA 3M3EA 2XJVA 2XQRA 3VZOA 4XMAA 1UX7A 4PHZA 3RPQA 1KXGA 2A3WA 1H2MA 2G9GA 2JG9A 4NR1A 5EFUA 1TMF2 3GZUC 4UT5A 5FZKA 1ST8A 3I2GA 4QAWA 1QOOA 2XOMA 3ZDVA 4H14A 1NCQB 1UPSA 1NZIA 3IZOA 1OOPC 3RQ0A 1O3SA 3ITQA 4TYSA 2XKPA 2ZHMA 2LRPA 5CFCA 3ZN4A 2TNFA 4MGYE 3IMNA 2PHTA 3DL3A 2RDRA 3GZTB 1XNDA 2HEVF 4META 4YRDA 1J3PA 3HEIA 4UFLA 1AR81 1IS6A 1DYPA 3C2UA 1VBC3 3WNLA 5ISLA 2NN8A 2JIJA 4U36A 3ZPOA 4C0BA 4MGZE 4CU6A 3PVOA 4AQ6A 1NE4A 3WF2A 2Z42A 1AVBA 3O1PA 2R1BA 3V56A 4BQ5A 2P1BA 3RI9A 4LORA 4ZONA 1PGW1 1V6LA 2VMDA 3ZFEC 5IATA 3DECA 1ND3A 1D0GA 4NRMA 1FAYA 2ATFA 5LRSA 5JOXA 1VPHA 3QCWA 4NMIA 3W58A 1OH4A 1N1TA 4XJ9A 1C8M1 4FBFA 2VQTA 3OD4A 4M3CF 1ND2A 3WF4A 1HXS1 1H2LA 4IQPA 2WDBA 1VBB3 1AYN3 1V6JA 4N9IA 1IQDC 5FMBA 4IE5A 5FUIA 1GP6A 1VMHA 1YHFA 2PFWA 4RGAA 4AYUA 4CUCA 5IK7A 1QIQA 1ASJ1 1P8JA 3OY8B 4AL9A 1SLIA 1MQTA 3AKTA 4YWAA 4NROA 3V0BB 4NVPA 1TNRA 4P5YA 3WP4A 4I0WB 1GOGA 4FPFA 4Q0SA 4PDWB 3MUZ1 4UFHA 4X8NA 3JU9A 1IS5A 3SMHA 2ZHNA 4Y20B 2DVFA 4OFGA 1UXZA 3H42B 3WDUA 2F6BA 5JLVA 2DVAA 1WBLA 4URTA 1ZBA1 3ZPYA 3I3QA 3TB0A 2EA7A 1QJX3 2JDKA 2R49A 4AWDA 1AR92 1DZRA 3FUOA 2A7AA 3OJBA 3VBHC 4BJ0A 4XUPA 3T4VA 4D94A 1JZ4A 1F35A 2W5FA 4AVSA 1CGPA 5D8AA 4BMEA 2CHHA 5T3NA 2FHRA 3B9IA 1S2EA 3JD73 3OGJA 4NUBA 3BI3A 1DP0A 3A4UA 3MF6A 4NIIA 4CUAA 4LKDA 4XURA 3MICA 4FVVA 4Q29A 4RR3B 3BIEA 4FQ4A 4NHLA 2ZMLA 4XPVA 4Q1RA 1GU3A 3VB9A 5AC93 3HNYM 2VVDA 1B35C 3ZFEB 2DVGA 4PI2A 2XJPA 3MGUA 3U75A 3WF3A 3ZFFA 2WNEA 3FUQA 3NQHA 4COZA 2D3PA 4M01A 3N4MA 2E31A 2WN3A 3MFAA 5A1LA 5CADA 2HWC1 2Y60A 1UMIA 1QJX1 2P3IA 1NXD1 4XVHA 1BZWA 2I07B 3VN4A 4P9JA 1OF4A 5K4LA 4PBOA 4NHKA 3B5LB 3EO6A 3A23A 2GC2A 3KF3A 2XH6A 1V0AA 3JD71 1PZ9A 3QH7A 4YNIA 4LK6A 3BCWA 1GNHA 1AYM2 1VJ2A 3RZGA 4UF0A 3AKPA 3PMSA 3NNGA 5LASA 2VH9A 5FZDA 4GULA 4CUGA 4AFAA 5C3QA 4XYXA 3RG0A 3KT7A 5CKQA 4ZHNA 4MHUA 4LKFA 4RN5A 1NY71 4IEWA 4JRLA 5C8CA 2ERFA 4UFIA 4HN0A 5BNNB 4FFHA 2VCMA 4NHXA 1OSGA 3CBNA 1MZFA 1VBA1 2E51A 2R043 4AI1A 3I4IA 4PF5A 3L2HA 4LO4B 5A3TA 3ZIWA 3FLRA 3P5BA 2YC0A 3PURA 4ARXA 3PLQA 2RJKA 1UU6A 4IV1B 4XQDA 4Q2FA 3ZYFA 3WW1A 5CKNA 3VBHB 4IL7A 2BERA 2EICA 4L97A 1W90A 4HETA 1H0BA 1LEDA 2ILMA 1MZEA 4DUWA 5FP4A 1RMU2 2X53S 5A3WA 1G9FA 4RSUA 3H1YA 1Y43B 3HQRA 1WKYA 3FHIB 1UOBA 2F17A 3BPSA 4QKBA 1RXGA 3GALA 1UF2C 3VZKA 4QB6A 2GN3A 1VP6A 5CFCC 3BTAA 3WW4A 3EMRA 1B35B 2J1AA 4M0HA 3WR0A 4ITCA 2JG8A 3WX5A 1UWWA 1Y9MA 3U1XA 2BWAA 5GZCA 1O59A 4K1ZA 3IDAA 4RHV3 2WBKA 4IE4A 5A32A 4AW7A 3POIA 3WG4A 4AGGA 3CHXA 3U4SA 5JDBA 4YGBA 2BGCA 1WCKA 4DXRA 2UWBA 3R4DB 3CIHA 3ILNA 4KU8A 4QQ2A 2D3RA 3ST7A 2QJVA 2ORZA
chains in the Genus database with same CATH topology
4QKDA 3S5AA 2FDJA 3I3MA 3O1SA 3H8RA 3I3QA 3S57A 3T3YA 3O1UA 3T4VA 3RZLA 4NRQA 3BU0A 3BI3A 4NIIA 3BTXA 3BIEA 4MGTA 4NIGA 4MG2A 3I49A 4CXWA 3RZHA 3KHCA 3BUCA 2FDKA 2FDHA 3RZJA 4OCTA 3H8OA 4NIHA 3BKZA 3RZGA 4O61A 3O1RA 3O1MA 4NJ4A 4ZHNA 3RZKA 4CXXA 4JHTA 3KHBA 3O1PA 3I2OA 2FD8A 4NPLA 3O1OA 4QHOA 2IUWA 4IE0A 4O7XA 3LFMA 4NRPA 4NRMA 2FDGA 4IDZA 3BTZA 2FDFA 4IE6A 5F8PA 3BTYA 2FDIA 3O1TA 4NIDA 4QKBA 4ZS3A 4RFRB 3H8XA 3T4HB 3O1VA 4IE5A 4QKNA 4NPMA 4ZS2A 4QKFA 4CXYA 4NROA 4IE4A 3RZMA 4IE7A 5DABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QKD A;  3S5A A;  2FDJ A;  3I3M A;  3O1S A;  3H8R A;  3I3Q A;  3S57 A;  3T3Y A;  3O1U A;  3T4V A;  3RZL A;  4NRQ A;  3BU0 A;  3BI3 A;  4NII A;  3BTX A;  3BIE A;  4MGT A;  4NIG A;  4MG2 A;  3I49 A;  4CXW A;  3RZH A;  3KHC A;  3BUC A;  2FDK A;  2FDH A;  3RZJ A;  4OCT A;  3H8O A;  4NIH A;  3BKZ A;  3RZG A;  4O61 A;  3O1R A;  3O1M A;  4NJ4 A;  4ZHN A;  3RZK A;  4CXX A;  4JHT A;  3KHB A;  3O1P A;  3I2O A;  2FD8 A;  4NPL A;  3O1O A;  4QHO A;  2IUW A;  4IE0 A;  4O7X A;  3LFM A;  4NRP A;  4NRM A;  2FDG A;  4IDZ A;  3BTZ A;  2FDF A;  4IE6 A;  5F8P A;  3BTY A;  2FDI A;  3O1T A;  4NID A;  4QKB A;  4ZS3 A;  4RFR B;  3H8X A;  3T4H B;  3O1V A;  4IE5 A;  4QKN A;  4NPM A;  4ZS2 A;  4QKF A;  4CXY A;  4NRO A;  4IE4 A;  3RZM A;  4IE7 A;  5DAB A; 
#chains in the Genus database with same CATH topology
 1R08 2;  3HOB A;  4QQH A;  3S5A A;  2ZEW A;  4LA2 A;  4YZ1 A;  2ID4 A;  1K5J A;  2A6V A;  2EID A;  3WNO A;  1PNF A;  2JX9 A;  2NP0 A;  3PVB B;  1DQ2 A;  1R09 2;  3MYX A;  1Y4W A;  5F5A A;  2WZE A;  3TRS B;  3IDC B;  5FO7 B;  5CEH A;  2YYO A;  2ZMN A;  2PEL A;  1RC6 A;  1NT0 A;  5J1X A;  3Q8C A;  4XF0 A;  3NAP C;  1UAI A;  3E1F 1;  1I5P A;  3F95 A;  5LBC A;  1O3Q A;  1RUH 3;  5FY8 A;  1W8W A;  3WXP A;  5A6Q A;  1RUG 2;  1AXY A;  1LOF A;  4JKK A;  5FYI A;  2MHF A;  1JI6 A;  2W52 A;  3AZY A;  4BYY A;  4CEW C;  4MG2 A;  1W0P A;  4IEU A;  5F6L B;  4Z92 B;  1QOS A;  3ZKY A;  2CY6 A;  5LY2 A;  4LIU A;  1N1S A;  3DV8 A;  3IPV A;  1UOG A;  1O6U A;  2RS1 2;  1YXW A;  4ATF A;  1WA6 X;  2VMI A;  1SG3 A;  3ROU A;  2HWD 2;  2J1T A;  1W6Q B;  2VNR A;  3OUI A;  1H6Y A;  2ZZQ A;  1S55 A;  4BE3 A;  3VBF A;  2JE7 A;  1TE1 B;  4CYD A;  5CFC B;  1KQR A;  5AVA A;  3CJX A;  3WDY A;  2PA7 A;  1V70 A;  5C4W A;  3VDC A;  1RUH 1;  3GXU A;  4JGZ A;  5C7G A;  4LHN A;  3QD6 A;  3K3N A;  1NX9 A;  2ZGN A;  3FWE A;  4XUO A;  2ZPX A;  3LDK A;  5FCC A;  4A45 A;  5LA0 A;  2Y34 A;  4WVM B;  2GAU A;  3RZK A;  1V00 A;  5CVR A;  1HW5 A;  3AVS A;  5FTT C;  5FPB A;  4CEY C;  1XOY A;  5E8A A;  5JSR A;  1SAC A;  3J7H A;  2WRA A;  3RRD A;  4LOT A;  3WVJ A;  4ARY A;  2K0G A;  2RDQ A;  5LWB A;  2P2K A;  4QPW A;  4X6Q B;  3OGR A;  3O7O A;  4Y22 B;  4QPI C;  1OF3 A;  5FZH A;  2FQP A;  2VQ0 A;  1VAK A;  1PO2 2;  3MIH A;  2LTN A;  3MID A;  3SHR A;  4IEQ A;  2Y6K A;  1ZZ9 A;  3DPR A;  3T30 A;  1OD3 A;  3ZSK A;  4E2Q A;  5AVP A;  3WCR A;  4FPK A;  4D6Q A;  1ZZ7 A;  4IDZ A;  2GMP A;  3TWI A;  2CGP A;  1KJR A;  3VZJ A;  1PK6 A;  1E5H A;  1HQW A;  3TN9 3;  3JBG 2;  1A34 A;  5T5P A;  1MEC 1;  4M4R A;  1ODM A;  2KM2 A;  4KMQ A;  4R52 A;  3RNS A;  5L9V A;  4LMF A;  4B1L A;  3KV4 A;  1LOG A;  3U11 A;  3WY6 A;  3KVB A;  1ZRE A;  3CU7 A;  4CEW B;  3OGG A;  4WZC A;  1DFQ A;  4EWE A;  3GNE A;  4ZU4 A;  5F1R A;  2X5I A;  1EAH 2;  4G4F A;  1AL2 1;  1PIV 2;  3GJB A;  2BNN A;  1NCR C;  3NW4 A;  4D8M A;  2B9U A;  1Z78 A;  2OII A;  4XHX A;  5DAW A;  3W59 A;  2XON A;  2F4L A;  3WQ0 A;  4CCJ A;  2E9Q A;  2XB6 C;  3IIA A;  3FFZ A;  4Z2W A;  5A3L A;  2JKX A;  1AX2 A;  1MS4 A;  5F32 A;  3KGZ A;  3TN9 1;  5FZE A;  1AR6 3;  2WNV A;  1RB8 G;  3P3P A;  2FCT A;  1SLC A;  3HQX A;  2ZGP A;  2P6H A;  2VUC A;  3VZL A;  1QJU 1;  3AP7 A;  3DN7 A;  4O9G A;  1JYX A;  1CWP A;  2ZBJ A;  4L99 A;  3ZIX A;  3VBO C;  1XYN A;  1VE0 A;  3WF0 A;  5C9A A;  5GAL A;  4Q4W 1;  1BMV 2;  2C26 A;  5CYY A;  1HN1 A;  4CEY B;  2WA3 A;  4B8E A;  1G9D A;  2UY8 A;  1SPP B;  2VNO A;  3G7D A;  1DCS A;  5DG1 A;  4Y1Z A;  5I91 A;  4YGC A;  1UKG A;  3IBM A;  1VMF A;  1OA2 A;  1U5I A;  3C7E A;  2QCS B;  1BBT 1;  1CAU B;  3O12 A;  1TMF 3;  3A0K A;  4QPI B;  2CTV A;  4LQR A;  3H8U A;  5H9Q A;  1OT5 A;  1W6O A;  5JAX A;  3R05 A;  5ABJ C;  1AR6 1;  2DCY A;  1VAL A;  3VHO A;  4XUN A;  5FJK A;  2JJ6 A;  3CKH A;  5H9R A;  3LQC A;  1ZRR A;  3QAC A;  2D6P A;  4KGQ A;  3SH5 A;  1L7Q A;  1UXX X;  4HKO A;  4WM8 A;  5BPX A;  4D3W A;  5KWR A;  3KHC A;  4F8A A;  4M3C B;  4YZ4 A;  4AXO A;  1J1L A;  4OUS A;  1BJQ A;  1SLA A;  3SCG A;  1J3R A;  3LEM A;  4MXW A;  1KS4 A;  2JDY A;  1COV 1;  3HPN A;  1FT9 A;  3FN9 A;  4LJH A;  1WW4 A;  3RZJ A;  4UAP A;  1YIF A;  1E5S A;  4OCT A;  2D98 A;  4KQ7 A;  1GP5 A;  4CZS A;  1FNZ A;  3T2P A;  1RVF 1;  1WLD A;  3AL6 A;  3O1M A;  4OZO A;  2V4V A;  2IVJ A;  4I3P A;  3HBK A;  4P08 A;  4QT6 A;  3WNK A;  1NCR B;  4IES A;  5A33 A;  2WQ4 A;  4ZZ8 A;  1W8H A;  1CON A;  2RS5 2;  1LGN A;  3W9A A;  1GZW B;  3VUO A;  2LAL A;  4E4Z A;  4XIK A;  3ZR5 A;  5DG2 A;  1G8W A;  4HT1 T;  4HLT A;  1DBN A;  2QQJ A;  3SC7 X;  2JIC A;  1TEI A;  1XNB A;  1K45 A;  2W2I A;  3ZDS A;  4OHZ A;  1RJ7 A;  1C28 A;  4RL7 A;  5FZ9 A;  1QDO A;  1F2N A;  1Z7S 2;  2GMM A;  1US3 A;  2IVI B;  4UW6 A;  2ZJC A;  3T1L A;  1I6X A;  4K8R B;  2D5F A;  1UY0 A;  1W6P A;  2F4P A;  1QH7 A;  3ACI A;  1RHI 2;  4XAB A;  3VBO B;  4IGP A;  3ETQ A;  3IDB B;  4MYE A;  2I2S A;  3ZN5 A;  2PLV 2;  4RS5 C;  2MEV 1;  5FMC A;  4DS0 A;  1POV 3;  2VME A;  2V5D A;  2D6O X;  3AZZ A;  5T55 A;  5HCH A;  3VBU A;  4UBG A;  5FPU A;  4AGR A;  5T52 A;  3ZFG A;  3B94 A;  4R9D A;  1OVP A;  3ZXG A;  2VTF A;  4IEZ A;  2Q1M A;  5F2S A;  5FJH A;  3MHZ A;  1OKO A;  1K5M C;  2YPJ A;  1SCS A;  2BFU S;  2J42 A;  3N9Q A;  4FPY A;  3TNQ A;  4DQA A;  2Y6G A;  2HWB 2;  4NOT A;  2H6B A;  2BEO A;  1IKQ A;  4ZS2 A;  4EZ4 A;  3BAL A;  2QQP A;  1JYV A;  3WNX A;  3OBZ A;  2JD9 A;  1AR9 3;  3B00 A;  4DY3 A;  5KHK A;  4WM7 A;  2KA3 A;  4IE7 A;  3SQO A;  1WMD A;  4IEO A;  2XQX A;  1ZNP A;  4YFW A;  5T5J A;  1Y3T A;  2ZGS A;  4HMZ A;  1ENX A;  3VHR A;  1O4Y A;  2FZ2 A;  4AFD A;  2UWC A;  5C5U A;  1OKQ A;  4MXV A;  1KFX L;  4R9A A;  3D82 A;  4X8P A;  3ZO0 B;  1JXN A;  5K9Y A;  5JXH A;  2BGP A;  2UY9 A;  3ZSL A;  5JR2 A;  2N7G A;  1G6N A;  1V6K A;  3FE5 A;  1QY4 A;  3C7G A;  3RMY A;  1V9U 2;  3MIE A;  2JDM A;  4NRQ A;  1UW8 A;  3GM8 A;  4O9E A;  3AP4 A;  3AXE A;  4YVS A;  2IXC A;  3UKN A;  1C1L A;  1O91 A;  3H9A A;  1R1Z A;  3M8L A;  4QX1 A;  3SH3 A;  5JXJ A;  3NMB A;  1CES A;  2J1V A;  3PJY A;  2ZGU A;  4QHZ A;  2DV9 A;  1AXK A;  4BU2 A;  3T08 A;  4K20 A;  5A80 A;  4RS5 B;  5GLU A;  1O4Z A;  1AYM 3;  1FOD 2;  3H3Z A;  5BNO C;  1OLQ A;  5IYY A;  1XNA A;  4B7E A;  4Q4V 1;  5HV0 A;  3NV4 A;  1NLS A;  1MZ6 A;  2WUH A;  2Y64 A;  4JQR A;  3ZR6 A;  1QU0 A;  4DNY A;  5IVC A;  5IHR A;  4BDV B;  1QF3 A;  1QKQ A;  4ASM B;  2XVL A;  1XC6 A;  2A1X A;  4BZ4 A;  3U37 A;  4HKL A;  3POE A;  2WWJ A;  4L9B A;  1K5M B;  1N3O A;  1RUJ 1;  1X50 A;  4HKW A;  5FK7 A;  2EAL A;  1ULG A;  3RWK X;  2IXI A;  3GCW A;  2Y26 A;  4QX7 A;  2P34 A;  1UL9 A;  1RUI 2;  5KXB A;  2D3S A;  2WS9 1;  4N53 C;  1SFY A;  4O61 A;  1TNF A;  5HXV A;  2HKX A;  5FY9 A;  1FPN 2;  2VM9 A;  2XJR A;  5BNP C;  4C1W A;  1CAX B;  2XJQ A;  3FLT A;  4A7K A;  3MW3 A;  4YAR A;  4N43 C;  5K0U A;  4CDQ C;  2BU9 A;  1NG0 A;  4HG6 B;  2DCJ A;  4CDU C;  3LOI A;  2WO1 A;  3IKW A;  3GGL A;  5GM0 A;  2PHU A;  2B9V A;  5E89 A;  5F5C A;  2A3X A;  3DKW A;  2EXI A;  3VBS C;  1CZV A;  5KXC A;  2HWE 1;  1OI6 A;  5DDJ 2;  5IT6 A;  4XXA A;  4NPL A;  3A22 A;  4DRV A;  2PHX A;  3ZXK A;  5CB7 A;  4QHO A;  4E4D X;  5I8T A;  1ULC A;  4O7X A;  4AHZ A;  1PX3 A;  4PLN A;  4YG0 A;  3UGF A;  1H8V A;  4SBV A;  3CL1 A;  4KNC A;  2D6M A;  4HZF A;  4Y1X A;  4IE6 A;  3NJV A;  5F8P A;  5FMO L;  1JYI A;  1WMF A;  3MUY 1;  1RUF 2;  3BTY A;  2W3J A;  2VUA A;  3NV3 A;  2CGO A;  4QM9 A;  4LE3 A;  3RVH A;  1GP4 A;  2D40 A;  3ABZ A;  2W1Q A;  5KR7 A;  3I97 A;  4GMP 3;  5FZF A;  1AXZ A;  1H1I A;  1UZW A;  2PAM A;  1RMU 1;  3AKQ A;  4QD2 A;  2C1F A;  3KT1 A;  4JAA A;  3ZLI A;  4AED A;  1W9S A;  3EYP A;  1R08 3;  4FPE A;  4GKY A;  4FOQ A;  4XAE A;  3O1V A;  1RUO A;  2W1U A;  4FO9 A;  2J22 A;  4CDW C;  1CAV A;  1G9A A;  4UOJ A;  4MSV A;  5LA9 A;  1R64 A;  4MGK E;  1XBF A;  2W47 A;  1R09 3;  2QTW B;  5LBB A;  3Q8E A;  4Y1Y A;  3AK0 A;  4LLF A;  5L9B A;  4BQ3 A;  5FZB A;  1S0F A;  2Y6F A;  2K46 A;  4QHB A;  4DXZ A;  5A6Y A;  2GND A;  3KV6 A;  1I1E A;  4N9H A;  5FIX A;  4TTG A;  3AB0 A;  5DAB A;  4OUE A;  3DXU A;  4I01 A;  2V4A A;  3E6B A;  3U10 A;  4A7Z A;  5IWF A;  4XC9 A;  3H3U A;  1RUG 3;  1ZZC A;  1JOB A;  2VOK A;  1RUN A;  4I2O A;  1A78 A;  4M00 A;  3KMH A;  4GAL A;  3WSO A;  2RVA A;  3BIW E;  3FZ3 A;  1GZT A;  3ZXE A;  4WVZ A;  4CDQ B;  2QQI A;  1CX1 A;  1H6X A;  1LHW A;  3I2I A;  5FV3 A;  2B5H A;  4QPG C;  4E2G A;  1W03 A;  2RS1 3;  1V6I A;  2UYA A;  1KDM A;  2ZAC A;  2D6K A;  2HWD 3;  5KXE A;  1BQP A;  1UIJ A;  4AQ2 A;  3BYW A;  1IG0 A;  2W92 A;  2XDV A;  1V6O A;  3PHM A;  4FAG A;  4K6B A;  3VD9 A;  3W5N A;  3U78 A;  5JIU A;  1XQN A;  2R1D A;  4LLO A;  1GR3 A;  1SDD B;  2OZ6 A;  1RUG 1;  2Y6J A;  1LGB A;  4ASK A;  5BY5 A;  2WNU C;  2JE8 A;  1FMD 1;  3SEP A;  1O5U A;  5KXD A;  3TYJ A;  3BUC A;  4R4Z A;  5FUN A;  3EQE A;  1DIW A;  5J48 A;  3WG3 A;  1IPK A;  3U0Z A;  4DMI A;  5FKB A;  4OQ9 A;  4NO4 A;  5A70 A;  3ZYB A;  1YCI A;  3M7A A;  4HVO A;  4PQQ A;  2WT0 A;  4I02 A;  1WUV A;  1HV0 A;  2JG9 C;  3K4Z A;  4XIL A;  1GBG A;  1XB9 A;  1GZ9 A;  4PT6 A;  1CJD A;  1REF A;  2BP6 A;  2HWD 1;  1NCQ A;  4GH4 A;  4XJU A;  4NWW A;  1JTZ X;  3AKR A;  4XFF A;  5JI7 A;  3T2Q A;  1RED A;  1PO2 3;  4NAO A;  1GNZ A;  2ZMK A;  5FBJ A;  5EP9 A;  3B93 A;  4LBQ B;  2DCK A;  3BOD A;  3C3V A;  1D7P M;  3THT A;  1H1M A;  3JBG 3;  4NHY A;  4QQO A;  4LXL A;  1RUE 2;  3WW3 A;  5HI0 A;  3PVE A;  4QXK A;  2A6W A;  5LK5 A;  2OPK A;  4CP9 B;  2NMO A;  2E7T A;  1SDW A;  1D4M 2;  2G1M A;  1F9K A;  1UU4 A;  3E5Q A;  3J8F 2;  4A3X A;  2W08 A;  5FXW A;  4QPY A;  1QOT A;  1Y7B A;  3MW2 A;  3T09 A;  2YBK A;  3ES4 A;  4NRP A;  1URX A;  3HNM A;  4XET A;  3MIB A;  1O3R A;  2FDG A;  1EAH 3;  3B01 A;  1V6N A;  2UWA A;  2YY1 A;  5FFO C;  4E8D A;  4IXL A;  4LR4 A;  2V09 A;  4L8Q A;  4XFH A;  1PIV 3;  4MUV A;  3LA2 A;  4ISR A;  2ARA A;  2C6S A;  4GZ9 A;  1ND3 C;  4QPG B;  3BOP A;  4XJA A;  1Q3E A;  5FYB A;  5KHJ A;  3WG2 A;  3O0V A;  1IGO A;  4FTB A;  3KVA A;  2A6X A;  4Y5Z 0;  1Q8V A;  3TAY A;  3RYK A;  1UYX A;  4EZH A;  2WFF 2;  1K3I A;  3IDE A;  3D0J A;  4HK9 A;  3DCQ A;  4KG8 A;  4CP2 A;  4Q0U A;  2VXJ A;  4FOW A;  1H2K A;  1ND2 C;  3V65 A;  1ZYB A;  2Z2S B;  2WNU B;  5JWP A;  5L19 A;  3ZYP A;  1NAE A;  4MGI E;  3USS A;  3THD A;  4P9W A;  1RGS A;  4WVV A;  1Q56 A;  3ZSE A;  3OY8 A;  4R9B A;  1EAH 1;  2IFR A;  5DMY A;  1GWM A;  2ZGQ A;  3V0B A;  4WZF A;  1EY2 A;  4LBJ A;  1RL3 A;  1MQT C;  1PIV 1;  2VMH A;  1R1A 2;  4GA9 A;  2C9K A;  3J4U H;  5LRR A;  3I54 A;  4PDW A;  2C5D A;  4OHY A;  2ZHL A;  4DB5 A;  1REE A;  1LGC A;  1JUI A;  4Y20 A;  3KSC A;  1VBC 1;  3VD5 A;  3O0W A;  1AZD A;  1HV1 A;  1NUK A;  3P3N A;  5SV8 A;  3OCP A;  4EV0 A;  3M3I A;  4QWN A;  3OPW A;  1RIT A;  1RIN A;  2WWU A;  1GSL A;  1D4V B;  2B39 A;  2RHP A;  2HYK A;  2EIB A;  3UV9 A;  4BQ4 A;  1J58 A;  1CD3 G;  5K8S A;  4CP1 A;  4ES8 A;  1QEX A;  3GBW A;  1BMV 1;  1ZZ8 A;  1Y9Q A;  2DUQ A;  4OUM A;  1GZC A;  1YUD A;  5IVB A;  3LDB A;  4RR3 A;  4BCU A;  3NKG A;  1OOP B;  1S2B A;  1ZM1 A;  1UYZ A;  3GJA A;  2VGD A;  2GP3 A;  5IVJ A;  1KD7 A;  5FZO A;  2VW0 A;  2XML A;  2XPJ A;  4ONU A;  2BQP A;  1VBB 1;  1YFW A;  2RS5 3;  2RMU 2;  1AYN 1;  2BRT A;  2QVS B;  3ZFF C;  3GBG A;  4B4P A;  4BXS V;  3GDB A;  5CU1 A;  1BEV 2;  4JZR A;  2XG3 A;  3OBR A;  1QQP 2;  3NRU A;  2FCU A;  2LRO A;  4FXG B;  1QGL A;  1WCU A;  1ZA7 A;  4IER A;  5FZ3 A;  5E88 A;  3RI8 A;  4ZXK A;  1SHW B;  2PXJ A;  4A6S A;  1BVP 1;  1Z7S 3;  4IEX A;  5E6H A;  5A7P A;  4CUB A;  4FSJ A;  5I8Y A;  1S0B A;  1RHI 3;  3D5O A;  1LOD A;  2PLV 3;  3V0A B;  2XUM A;  5IFP A;  2R06 3;  5FZG A;  2RS3 2;  1U5Y A;  3CDZ B;  5CBL A;  3KHB A;  1MQT B;  3MPB A;  4N90 A;  1YFU A;  1H4G A;  2WO3 A;  3PUI A;  2ZXQ A;  1S0E A;  3I3E A;  1UD1 A;  2ZX0 A;  2RS5 1;  2P37 A;  2HBU A;  2DUR A;  4FOV A;  4OZX A;  1F31 A;  1SMV A;  3GYD A;  2AH2 A;  5BNN A;  5C8C C;  1VMJ A;  2JEM A;  5T50 A;  4EN6 B;  1OQ1 A;  2EF6 A;  4AOC A;  5CG8 A;  1HRV 2;  1YC6 1;  4Y3O A;  4CP0 A;  1ZRI A;  5GZF A;  3NNF A;  2WZP P;  1M4W A;  2HWB 3;  3LEG A;  5A6Z A;  3N9P A;  2G9Z A;  3D8C A;  1Z7S 1;  2JWP A;  4NN0 A;  4LUK A;  3LGR A;  4IV1 A;  4HXC A;  3UGH A;  1W2A X;  3NJX A;  3H50 A;  3RGB A;  3VBH A;  2B42 B;  3NST A;  3JB4 C;  3VDD C;  5AC9 1;  4AG4 A;  4B29 A;  1RHI 1;  4AR2 A;  1VIW B;  2OX0 A;  5J37 A;  1FNY A;  4UI9 L;  4A6O A;  5I8S A;  1CZT A;  5LB6 A;  2W68 A;  3FMG A;  4ZS3 A;  3HIF A;  4RFR B;  3X29 B;  3CJI C;  3I3D A;  2YC4 A;  3WDT A;  5GLZ A;  3I2F A;  4TZD A;  4MAD A;  3HD8 B;  1IG3 A;  3TNP B;  1OUR A;  3WNP A;  4KBB A;  2ET1 A;  2WC2 A;  2IFW A;  4QXC A;  4W50 A;  4AHX A;  4F83 A;  1B35 A;  1UZZ A;  1XE8 A;  2VQU A;  4ZKT B;  2FDK A;  4CXY A;  1K12 A;  1YNA A;  2YB7 A;  4LIT A;  3A0N A;  2Q5T A;  4MVT A;  4V2W A;  2JG8 C;  2YV8 A;  2D93 A;  2ZAH A;  3ZFF B;  4ET7 A;  2A6Z A;  3UGG A;  2WA4 A;  3MW4 A;  1I3H A;  4SLI A;  2KR2 A;  1V9U 3;  2JDZ A;  4W4Z A;  3JUU A;  5FYM A;  5GZG A;  1QJF A;  3KD4 A;  1Q8S A;  5F3E A;  3USU B;  1CIY A;  4M3C E;  4CA9 A;  5LCW L;  1PMI A;  5CZK A;  1W9F A;  1QJE A;  3T0D A;  4FI9 A;  1W8T A;  2VZ1 A;  1W06 A;  5CIS A;  2XVK A;  5F3G A;  3POJ A;  4FPL A;  3AXD A;  4P9X A;  1PGL 2;  1LOB A;  2WT1 A;  4RGG A;  1U5Z A;  4PQ9 A;  2R04 1;  4LO8 A;  1W2T A;  1FOD 3;  1ZZ6 A;  1A3K A;  3FHA A;  3ECQ A;  2R6Q A;  3EHK A;  2GZW A;  1YWK A;  1OD5 A;  3VKO A;  2BW8 A;  2GU9 A;  2J1S A;  5EJ3 A;  3AFK A;  5F2W A;  3BTX A;  5C8C B;  1DZT A;  5FY0 A;  2PQS A;  4AFB A;  4EN7 B;  3ON7 A;  1HRI 3;  1V9U 1;  2XGX A;  4KWK A;  4LO6 B;  3KF5 A;  3MF9 A;  3SIS A;  1KGY A;  1RUI 3;  4NE9 A;  5C3O A;  2A6Y A;  3VHN A;  4IET A;  3E5X A;  3VD7 A;  4CCD A;  1EP0 A;  1LOF C;  1FPN 3;  1O4T A;  4K21 A;  3WQ1 A;  4IND A;  5GKA C;  4P9I A;  5C3S A;  4FTE A;  3U14 A;  2BNM A;  5FP7 A;  3VDD B;  1DQ6 A;  2E63 A;  3Q8A A;  2EAA A;  5BV6 A;  3FBM A;  2ETE A;  3MEP A;  2GNB A;  3K77 A;  4XF9 A;  5F7U A;  1RJ8 A;  1FOD 1;  1RYY A;  1YJK A;  1GKB A;  5LK7 B;  3CJI B;  2HWF 2;  4QB2 A;  2VZT A;  2WO2 A;  5FYZ A;  2VAU A;  1LHU A;  4YG6 A;  4RHV 1;  4BB3 A;  1W6Q A;  2YU1 A;  1B09 A;  2VZU A;  4OMC A;  4QDQ A;  5T54 A;  3BKZ A;  2YC2 A;  1F15 A;  4NIH A;  4YW4 A;  3LEI A;  1FXZ A;  1WD3 A;  5DDJ 3;  1VR3 A;  3CF6 E;  3NVC A;  3OPZ A;  5J98 B;  1IS4 A;  4K8F A;  3VBF C;  4HON A;  2FMD A;  2Z79 A;  3POB A;  3WHT A;  5JMC A;  3TOJ A;  3W21 A;  4CPB D;  3NO8 A;  1RUD 2;  1IQA A;  2E32 A;  1KEX A;  2OT7 A;  1RUI 1;  5FZC A;  4I0A A;  1OLR A;  2BGO A;  3AZV A;  3N9L A;  4XFC A;  5LBF A;  1W8U A;  1ZA4 A;  3MIF A;  4WVM A;  1FPN 1;  1WA4 A;  2YMZ A;  1RUF 3;  2PN5 A;  3MPP G;  1W2U A;  5LBE A;  3S6P A;  5BXX A;  4Q4X 2;  4CRQ A;  5FLI A;  4TSV A;  2VOW A;  3J26 N;  4HAN A;  2VR4 A;  1GAN A;  2VEC A;  1QJY 2;  3WT3 A;  5FZ8 A;  3RJR A;  3LPG A;  3I2K A;  2EAK A;  2IUW A;  4LBQ D;  4Y22 A;  5JZG A;  1PZ7 A;  2JKB A;  1S2K A;  5A1F A;  1MS0 A;  1OLM E;  1MS1 A;  2VZR A;  2ZX3 A;  3R4U A;  5DDJ 1;  2JE9 A;  1XE0 A;  2ZA9 A;  3VBR C;  5L36 A;  2R30 A;  2NM1 A;  2GH8 A;  4DIQ A;  3ZXA C;  3DPR C;  4HFS A;  3TEY A;  5FUP A;  3ZSJ A;  5EXO A;  2BPA 2;  5B4X A;  4LBO A;  1A8D A;  1UZ0 A;  1NZC A;  1Q8O A;  5IW0 A;  1PM4 A;  2BBV A;  3T0A A;  4Q8K A;  2BOI A;  3AKS A;  4QGM A;  2UYB A;  4O65 A;  1QJZ A;  4QKN A;  1UO9 A;  2VW1 A;  4CEW A;  1YQ8 A;  2ZEZ A;  2NZ9 A;  4QX5 A;  3IB3 A;  5H9P A;  3SEE A;  4XCB A;  3LA7 A;  4XZU G;  1ZBE 3;  4LBM A;  4W65 A;  2CDO A;  3ILF A;  3LEK A;  3FC0 A;  3J7L A;  1NXM A;  4W6W A;  5FOJ B;  5A7Q A;  4JX0 A;  5FZ4 A;  2D43 A;  3NAP B;  2Q0A A;  2ZGK A;  2A73 B;  3RJ2 X;  2VZ3 A;  2WNO A;  2VZQ A;  3L9J T;  5HCB A;  5FYY A;  2PHD A;  3SNM A;  1A6C A;  3PNA A;  2BNO A;  4RYD A;  4AFM A;  4XTM A;  4F7Z A;  1H8T C;  1DLL A;  3ACH A;  2RR1 2;  2LS6 A;  2ZGO A;  1ENR A;  2WNV C;  2QQU A;  5FY1 A;  3PJQ A;  2AUY A;  4YYO A;  4F3J A;  5JPN B;  3RZL A;  1VRB A;  4OUL A;  2AGS A;  1AR8 2;  3HT1 A;  5AFB A;  3B7M A;  5CFD C;  3JZV A;  4JDN A;  4CEY A;  2ARE A;  5C9A C;  3NWK A;  3LOB A;  5FR3 A;  3U07 A;  1SPP A;  1UMH A;  1J59 A;  3KM5 A;  4EQV A;  2VW2 A;  3UKV A;  4Q4Y 2;  4JGY C;  1CAU A;  1CIW A;  1OHF A;  1EPZ A;  2VXR A;  5IVF A;  2QQN A;  2XLA A;  1JZ8 A;  1F4H A;  5HCF A;  1CX4 A;  1NQD A;  1L7R A;  1XNT A;  2WL1 A;  3VBR B;  4IEY A;  2OA2 A;  3H3L A;  1WME A;  4LE4 A;  4IV3 C;  4V2V A;  1ONA A;  4XE9 A;  3VDA A;  3KV9 A;  3EXU A;  3M3Q A;  1MPX A;  1MR5 A;  4AI0 A;  1NA1 C;  2K9Z A;  4J1X A;  4BXF A;  2H0V A;  4AVV A;  4G9S B;  4WM8 C;  4AHW A;  5E16 A;  3LZZ A;  1OBN A;  1CN1 A;  1C8M 2;  3ZX7 A;  2E33 A;  2FMY A;  5BUV A;  3VD4 A;  1HXS 2;  5GLV A;  1RUE 3;  3KLS A;  4IEV A;  1NYW A;  3WUC A;  4CU8 A;  4PIX A;  1LJ7 A;  5IK4 A;  3VKM A;  3KV5 A;  3J8F 3;  1D4M 3;  1MVQ A;  1J84 A;  2H6C A;  3AMP A;  1ASJ 2;  1EYB A;  3T2T A;  4CXX A;  3BOW A;  4JHT A;  1Q8P A;  2W95 A;  4L0P A;  4YLZ A;  2A71 A;  1BYH A;  3PUA A;  1GZW A;  1HB3 A;  2DDU A;  3KCY A;  1SQ4 A;  4Z07 A;  2RJL A;  5LEJ A;  2D5H A;  2CGN A;  3I2O A;  1DQ4 A;  2X10 A;  1DHK B;  1F5J A;  2DVB A;  4J25 A;  2BZD A;  4NPR A;  2ZGR A;  1H8T B;  2YDE A;  3TEW A;  2OW4 A;  2XBO 3;  3S5Q A;  4LUL A;  2WFF 3;  3ZYG A;  2EIG A;  5HCA A;  4K3U A;  3M3O A;  3D4K A;  4FXK B;  1RUE 1;  5F6K A;  1TMF 1;  3EJK A;  5FLH A;  2ARB A;  3J8F 1;  2CDP A;  1SZB A;  2P6C A;  4KWU A;  2X05 A;  4GKX A;  1SBD A;  1UY4 A;  5CFD B;  2ARX A;  3J7N A;  3WP6 A;  3LFI A;  3ZXD A;  3JB8 A;  4S2G A;  5M0T A;  3WZ1 A;  4HPK B;  1IS3 A;  3ZOI A;  4UXA A;  2VCC A;  4PF1 A;  4QX0 A;  2GNT A;  1R1A 3;  2XR4 A;  4JGY B;  4U2A A;  1JYC A;  2AEN A;  4OI2 A;  4XQ4 A;  4HSJ A;  1KFU L;  2ADD A;  2CV6 A;  3I2H A;  3Q8F A;  4LNV A;  4W8J A;  4COY A;  1AJK A;  4QKF A;  4JCK A;  1MS5 A;  5EHD A;  4DPN A;  3H7Y A;  5BYN A;  4QU1 A;  4GWM A;  3ZMO A;  3PU3 A;  4IV3 B;  1PNG A;  2HWC 2;  2DU0 A;  4YG3 A;  1UY2 A;  1Y9G A;  2R07 2;  2R06 2;  1NA1 B;  1ENS A;  1G9C A;  4BWO A;  3HT2 A;  2VUJ A;  4A4A A;  5L7O C;  1H4H A;  4QKD A;  3CLP A;  4A44 A;  2GP5 A;  4XFG A;  2VZO A;  4E4S A;  4WM7 C;  4ZU7 A;  1VAM A;  1XRU A;  4YPJ A;  3LKJ A;  4QQL A;  2QQO A;  1W99 A;  4MX3 A;  2D7F A;  1OLM A;  4BOW A;  5ABJ B;  5FMD A;  5FPV A;  2VOT A;  3WLU A;  1KS5 A;  1T6B X;  4FPO B;  5FKC A;  5L73 A;  4TN7 A;  3H0O A;  5ANN A;  3K4D A;  3AJY A;  4KWL A;  4QQP A;  3WP3 A;  3RZZ A;  1QNW A;  1NY7 2;  1XNK A;  5KC6 A;  3ES1 A;  5A33 B;  3BU0 A;  3IT8 A;  3KGL A;  5DUU A;  3HVD A;  4Z8B A;  1LEC A;  4P9Y A;  2YBP A;  3M2M A;  4QXB A;  2RMU 3;  2ZAB A;  3HN3 A;  4YSF A;  1BEV 3;  1POV 1;  2ZCW A;  1VBA 2;  3MLK A;  4YVW A;  1QQP 3;  1APN A;  1H2N A;  1UN1 A;  5FY4 A;  4AK3 A;  5FZ0 A;  4PJY A;  2E26 A;  5FPZ A;  5J96 B;  2AEY A;  4LT5 A;  2W94 A;  5FZ1 A;  2VTX J;  3VV1 A;  1UCX A;  3OYW B;  4CDX C;  4HSL A;  1KJL A;  3T0B A;  3IN9 A;  5IJR A;  5FY7 A;  2ADE A;  3PME A;  2Q1Z B;  4RS5 A;  1H30 A;  1WZX A;  1YRZ A;  5FXZ A;  5FMO S;  1MS8 A;  2SBA A;  2Z5W A;  3AYE A;  2Y38 A;  3HBZ A;  3VGI A;  3LF7 A;  2RS3 3;  4EE2 A;  4E2S A;  2JXA A;  1W39 A;  3WW2 A;  3QLQ A;  4CSW A;  2PQQ A;  5EPA A;  5JPM B;  1K5M A;  2WSU A;  2Q8C A;  1AR9 1;  1OXC A;  1W2O A;  2RMU 1;  5DAX A;  2C0Z A;  5JR7 B;  4C91 A;  4CCC A;  2Q8E A;  1QQP 1;  4QMA A;  4NJ4 A;  1HRV 3;  3R0R A;  4J6G A;  3ACF A;  1W6N B;  3AL5 A;  3AMH A;  1CJP A;  1SBE A;  1CAX A;  3IAP A;  4DXT A;  3I8T A;  3WHU A;  2WZ8 A;  4DUX A;  1ENQ A;  4Q5O A;  3UJQ A;  5L7O B;  3SXW A;  2R7E B;  1S0I A;  3LD8 A;  3VD3 A;  2O8Q A;  2YUE A;  5K0U C;  2BYV E;  1ZRF A;  2XL7 A;  1JZ3 A;  2RS3 1;  1HRI 2;  2XJS A;  2ZTN A;  3LSD A;  4XMI A;  1GIC A;  2VBB A;  2WIN B;  1OFS A;  4XDP A;  1G7Y A;  3OUH A;  5I0D A;  1C3H A;  1RIR A;  1C57 A;  4FP3 A;  1QNY A;  5JSP A;  3ZYH A;  3FHQ A;  4QGN A;  3BTZ A;  3QH6 A;  1LOE A;  3D3A A;  4WV8 A;  4QDS A;  3O1T A;  3I59 B;  1HRV 1;  3A7Q A;  3PUH A;  5LA1 A;  3LCP A;  3VKN A;  3MFC A;  3T1M A;  5J7M A;  4NID A;  4LUM A;  5A3U A;  1SBF A;  4CU7 A;  1ZRD A;  1AYM 1;  3H8X A;  3WUD A;  4BQY A;  4A2U A;  1CZS A;  4D7T A;  5KBF A;  1G86 A;  1UMZ A;  2D97 A;  5TSW A;  5FQ0 B;  4AFC A;  4XW3 A;  2YGL A;  2BTV C;  2P17 A;  2XHN A;  3KZ4 C;  5T5O A;  4CDX B;  2PAK A;  4JV4 A;  2DCT A;  3OUJ A;  1CVN A;  1NLQ A;  3CMG A;  3FJS A;  3WD5 A;  4AED C;  3DUI A;  4E8C A;  2WII B;  2KD7 A;  1W8O A;  3LSE A;  5JMO A;  3AYD A;  2QZ2 A;  5H9S A;  3MO4 A;  3HWJ A;  1C4R A;  1W05 A;  3C7O A;  4FFF A;  3G6J B;  4QXH A;  4XBQ A;  1CAW B;  3KCX A;  4LHL A;  1C1F A;  4HK8 A;  5A7W B;  1QWR A;  1ULD A;  3POY A;  4OI0 A;  2Q8D A;  4YZ3 A;  5B2G B;  5FK8 A;  1W3V A;  1YFY A;  1OA3 A;  4LTA A;  3MV1 1;  1JZ7 A;  5DQ0 A;  3Q8B A;  3S7I A;  1DQ1 A;  1E5I A;  1W9T A;  1VBE 2;  2GME A;  2ZOE B;  3BGA A;  5EYY A;  1JN2 P;  1DGW X;  2JDP A;  4AI2 A;  5BNO B;  2ET7 A;  4XJZ A;  4CDQ A;  3KCC A;  1J3Q A;  3GZA A;  2JDN A;  1TG7 A;  4A41 A;  1FAT A;  2QDN A;  3RS6 A;  4Q26 A;  4L92 A;  4DRR A;  3URF A;  2BVV A;  3PIJ A;  4MGT A;  4V1P A;  5JOY A;  3HMY A;  2HWF 3;  1VBD 2;  2P3J A;  3SLI A;  4FAH A;  3B02 A;  3WNM A;  5FYC A;  4PLO A;  5FPL A;  4LPL A;  4N53 B;  1W0O A;  1XU1 A;  3LWC A;  2ZKL A;  3WP5 A;  4CCM A;  4YGE A;  1C5H A;  5BNP B;  5EJ1 B;  4BK5 A;  4GMP 1;  4DY5 A;  3ZXJ A;  1ZBE 2;  1VRH 2;  4QM8 A;  1RUD 3;  1R08 1;  2KXL A;  1TME 2;  4N43 B;  4YW5 A;  1HDK A;  1HB2 A;  1MEC 2;  4CDU B;  3NJY A;  3PUQ A;  1VAV A;  3JCI A;  3UET A;  1SCR A;  1R09 1;  1NLR A;  3JQX A;  4Q4X 3;  4AGV A;  1ULF A;  3VBS B;  3AMQ A;  3LA3 A;  1W2N A;  4COU A;  1SFP A;  5HBA A;  5I0R A;  2W91 A;  3OEA A;  2WSV A;  1QJY 3;  1O8S A;  4CTE A;  1AR7 3;  2YGM A;  1RUC 2;  2QFE A;  2UUR A;  1AL2 2;  3CZJ A;  4D0Q A;  2C24 A;  1F5F A;  1UYY A;  4GH4 C;  5DZG A;  4RQP C;  4LEJ A;  2OS2 A;  4G3Y C;  3N36 A;  4C1X A;  4XDO A;  1W0N A;  1OQE A;  5IK5 A;  1PVC 3;  3ZN6 B;  3H7J A;  4AEM A;  4UFM A;  5EZW A;  2A75 A;  1DZQ A;  4FP2 A;  2HJI A;  4CP9 A;  4OHW A;  3WDW A;  1QJU 2;  2RS1 1;  4JRA A;  4Q4X 1;  2DTY A;  3SCH A;  3N9M A;  5A7S A;  1U12 A;  4S2F A;  3O0X A;  4Q1P A;  3OGS A;  4CE8 A;  4CDW B;  4E27 A;  1MVE A;  4D7S A;  4Q4W 2;  1QJY 1;  2WAB A;  1X82 A;  4BQW A;  1XYP A;  1DG6 A;  4XEZ A;  3AFG A;  3THC A;  1BK0 A;  1H9W A;  2YRO A;  1YO8 A;  4D69 A;  3HJR A;  5C3R A;  4XIO A;  5FWJ A;  1YQ5 A;  4LHS A;  2ENR A;  5C5T A;  2EVX A;  3SCF A;  1N3Q A;  1UY1 A;  2VCB A;  2IZW A;  3VDB A;  2A3Y A;  4MO3 M;  1X9T A;  2WT2 A;  1C5I A;  1EV1 2;  1TVG A;  4HOO A;  1WGP A;  4MHR A;  1JU4 A;  1XU2 A;  5EYX A;  2RR1 3;  2V72 A;  3F2Z A;  1W6M B;  5LEK A;  4XHB A;  4KH9 A;  1W04 A;  1PO1 2;  1N1Y A;  3AZW A;  5G05 L;  4A42 A;  2LW8 A;  5DUX A;  1D2S A;  3KWV A;  2WNU A;  5JUV A;  3K3O A;  5E1R A;  1AR8 3;  3VZM A;  1GV9 A;  1Q8Q A;  1COV 2;  4IW3 A;  4AEJ A;  1PO2 1;  1LAJ A;  4AVB A;  2SLI A;  2Y6H A;  4XJW A;  2IWG B;  4ORF A;  4YW2 A;  1X8E A;  2PYT A;  1XNC A;  2IXL A;  1QHD A;  2HEY F;  2XBO 2;  3KT4 A;  4HBN A;  1RVF 2;  3JBG 1;  4Q4Y 3;  4ZPI A;  4LKS A;  4Z1V A;  4PDW C;  2YFU A;  4MV2 A;  1OA4 A;  5JXI A;  2A5Z A;  2Q4S A;  4H7M A;  4GB3 2;  2OZJ A;  2DYC A;  4GH4 B;  5F3C A;  1H1A A;  4RQP B;  4JKL A;  5FRE A;  2QZ3 A;  1W9Y A;  2WAO A;  4YZ5 A;  3UJO A;  2RR1 1;  4UW3 A;  1JOD A;  2X29 A;  2WFP A;  3OEB A;  2RV9 A;  3AP5 A;  2QNK A;  3IM0 A;  2ZAA A;  3L2Y A;  2GH2 A;  5FWE A;  1KIT A;  3ZYI B;  1CPN A;  2ZX2 A;  1C8M 3;  1LB2 A;  1W8N A;  5EQU A;  2TBV A;  4YM2 A;  2JG9 B;  1HXS 3;  3R4S A;  1OC1 A;  2H0B A;  3BVC A;  5IVY A;  1G9B A;  1IPJ A;  4OMD A;  1LEN A;  4NAM A;  1JZ5 A;  1OOP A;  2MEV 2;  2NQY A;  1BCX A;  1SLT A;  4RR3 C;  4Q4Y 1;  5FYT A;  1NKG A;  4GXL A;  1ASJ 3;  4BQX A;  1F4A A;  2Y33 A;  1JH5 A;  1US2 A;  3AMN A;  4COW A;  1LHN A;  2WYF A;  4FOY A;  1T6G C;  5DAQ A;  1HKD A;  1BLZ A;  3K51 A;  1WCQ A;  4S2H A;  3NL1 A;  1VB2 A;  4YZ2 A;  5I0U A;  3WQB A;  4XUQ A;  1W8F A;  2ZEY A;  5D8A C;  4LK7 A;  1WD4 A;  1ZBA 3;  3N7K A;  4JC1 A;  3S30 A;  1WWY A;  4B4R A;  2TEP A;  4KBZ A;  5ACA 2;  2WN2 A;  4OLL A;  5J09 A;  2BOJ A;  1ODN A;  2DFC A;  2JB4 A;  4Y26 A;  3MBW A;  5G04 L;  2RM2 2;  3K4A A;  3N7J A;  1WMX A;  3THP A;  3ZFE A;  3V0A A;  3HR9 A;  2ORX A;  5IAV A;  4H3W A;  1J1T A;  2VOX A;  1ND3 B;  4JHZ A;  1Q5O A;  4FT8 A;  1GOH A;  3GF6 A;  5A7O A;  1OH3 A;  3WG1 A;  2WKK A;  2AC1 A;  5F3I A;  2FD8 A;  4GJY A;  1H9P A;  2G9F A;  2Y0I A;  1XYO A;  4R8H A;  4JDO A;  1NOV A;  2YFZ A;  4W6Y A;  2QKD A;  2VVF A;  2WZR 2;  4IE0 A;  1FX5 A;  4QGL A;  2MPF A;  4AE2 A;  4YW7 A;  4AAX A;  1HB1 A;  4BA6 A;  4I0B A;  2EXH A;  5BNN C;  1WW7 A;  1DYK A;  2YBS A;  2CWM A;  2EIE A;  2P3K A;  4Y1V A;  4AAP A;  4L2N A;  4CCO A;  4XCA A;  1ND2 B;  2FDI A;  4WVW A;  3HAG A;  4FFG A;  4I30 A;  5FZI A;  2HWC 3;  4EN8 B;  2J7M A;  2NYY A;  5FBZ A;  2R07 3;  2VQA A;  4IV1 C;  1RXF A;  4K7J A;  3AJZ A;  3AMM A;  4ERO A;  2VE1 A;  2YXS A;  5LY1 A;  2XUE A;  4AVA A;  5CAZ A;  3JXS A;  3OSD A;  5C70 A;  1IZ3 A;  4FPJ A;  4LBL A;  3E5U A;  3ZXF A;  3PUS A;  2VCA A;  4HVR A;  4Q4V 2;  4DZG A;  5GLW A;  1DGR N;  1MZ5 A;  1ZZB A;  3BB6 A;  5FLJ A;  1O3T A;  1JBC A;  5IAX A;  3RYP A;  3III A;  3W5M A;  2CU5 A;  5FZO B;  3FL7 A;  4TLG A;  2B46 X;  4FCA A;  3NJZ A;  1PX4 A;  2FCV A;  2P5B A;  3DGT A;  3AP6 A;  2P4E A;  3O5S A;  1RUJ 2;  2A70 A;  2R0F A;  3O1S A;  1X36 A;  3PL0 A;  2VU9 A;  2PLV 1;  2WLQ A;  3V64 A;  3MI8 A;  1I9R A;  2R07 1;  1VBA 3;  2R06 1;  3USU A;  5D8A B;  4N8M A;  2IXK A;  2O8O A;  2WS9 2;  1IOA A;  3D6E A;  4QU2 A;  4YW1 A;  3KQR A;  3T3Y A;  5EIY B;  3SH4 A;  2JB8 A;  3ZSM A;  4LO7 A;  1A8M A;  3C7H A;  4BMB A;  4DEV A;  1DGR A;  5IFT A;  3PVN A;  4H2A A;  3S7E A;  4Y4R A;  3APB A;  1N47 A;  2DVD A;  4AF9 A;  4IGQ A;  3UT0 A;  5CG9 A;  4KU7 A;  4S2D A;  2XWB B;  4LOS A;  3E6C C;  2HWB 1;  4JKM A;  4TWT A;  1WCS A;  1W3X A;  2VUD A;  5A3P A;  4NIG A;  1IKP A;  4RGK A;  4Z2A A;  1GNY A;  2AAC A;  2HWE 2;  4HN1 A;  2XHK A;  4JTN A;  5FXV A;  5JOZ A;  1AL0 G;  2WJS A;  2PHR A;  1LTE A;  3DEM A;  5A1A A;  2OXB A;  3LIH A;  4QX2 A;  5DN2 A;  4Y5T A;  3WF1 A;  4YFZ A;  4ZY9 A;  1ULO A;  3ACG A;  4UWD A;  4XF4 A;  3GHM A;  3CQO A;  1JU3 A;  3POG A;  5GLT A;  4MLO A;  5J36 A;  1WLW A;  2FDH A;  4GQ7 A;  1FV2 A;  2WR9 A;  4XBL A;  2FZ1 A;  3N3H A;  1IPS A;  4OHX A;  1NE6 A;  1PMJ X;  2Z69 A;  4UF0 B;  3VDD A;  2R32 A;  1DLC A;  3OGV A;  4CCL A;  2ARC A;  2W1S A;  3NV1 A;  1RTV A;  4D6S A;  1OVS A;  3MLJ A;  2XLG A;  3VKL A;  5IK8 A;  3CJI A;  2QBX A;  5DAV A;  4BLI A;  4CVU A;  4GD4 A;  5A6X A;  1SEF A;  4XF1 A;  1LEM A;  2R16 A;  3OB8 A;  5FYS A;  3IAQ A;  2DF7 A;  1E5R A;  4PIY A;  2VJX A;  4MZU A;  3UYJ A;  1YIP A;  5D1I A;  1GYK A;  4YM1 A;  1L3J A;  1FI2 A;  2ZGM A;  2EXJ A;  4DO0 A;  3PTY A;  1XXN A;  4Q27 A;  3ZKU A;  5FO8 B;  3S0M A;  1IHM A;  1GQH A;  2QDR A;  3HNB M;  1AX1 A;  1WBF A;  1POV 0;  1GWK A;  2J1E A;  2OVU A;  3EB7 A;  3M3C A;  2PHF A;  4CCN A;  5HV4 A;  3LDR A;  1AF9 A;  5KC5 A;  2YG0 A;  3BU7 A;  2ES3 A;  3K46 A;  4R4X A;  1DU3 D;  1X8M A;  1QXP A;  2G19 A;  3VKF C;  1DQ5 A;  5DUV A;  1HRI 1;  2VO5 A;  2B4K A;  2W1W A;  5JZG C;  5T5L A;  1HX6 A;  2JG8 B;  2WAA A;  4BIS A;  1D0H A;  2Y8K A;  4JGZ C;  5C4W C;  3T2O A;  2OKX A;  4DOU A;  3NV2 A;  2C9A A;  3T4H B;  4EN0 A;  2BBA A;  2WQ8 A;  2J1U A;  5F39 A;  1POQ A;  5A32 B;  2ZGT A;  2JEN A;  1S1A A;  4FPG A;  3JQW A;  2JD4 A;  3WNN A;  4NIA A;  4AVT A;  1YQ6 A;  2VZP A;  1JOJ A;  4XZP A;  3WV6 A;  4BK4 A;  2GAL A;  1AR7 2;  4CU9 A;  3DXT A;  1DDL A;  1QDC A;  2IC1 A;  4JVA A;  4BIF A;  1FMD 2;  1VBE 3;  4YM3 A;  2ZKN A;  2YU2 A;  3B69 A;  2AZ5 A;  3I7D A;  5FPA A;  5FYH A;  4CCK A;  4OI1 A;  1S4C A;  2FDJ A;  2DU1 A;  1SFN A;  4AQT A;  1PVC 2;  1WW6 A;  2ZZJ A;  3NAP A;  4XOG A;  3AM2 A;  3C7F A;  3ZM8 A;  3WCS A;  1PK6 C;  5LZ6 A;  1JZ2 A;  1LU2 A;  3O1U A;  1PZ8 A;  3SKJ E;  1VBD 3;  1RUF 1;  3WDV A;  1Z0H A;  2JDH A;  1LOC A;  1S0D A;  2PMW B;  5FYU A;  3VL8 A;  1GWL A;  4BPZ A;  3PIG A;  2QQV A;  3QOP A;  1DYO A;  5L9R A;  3ZYR A;  1VRH 3;  4D7Y A;  4MGS A;  1S0J A;  1U5X A;  2W46 A;  2X5I C;  1TME 3;  2CWS A;  4AHY A;  1VBE 1;  2AR6 A;  1DGL A;  1MEC 3;  1K42 A;  2XJU A;  4OI4 A;  4N7I A;  3GCX A;  5A7N A;  2X09 A;  4GWJ A;  3IPV B;  5FRA A;  2QE3 A;  3OF1 A;  4PIZ A;  4XUT A;  4ASL A;  4K40 A;  4EJR A;  2DWR A;  2ZEX A;  4AQS A;  3AP9 A;  3ILR A;  4WBB A;  4A7Y A;  4XFA A;  1HIX A;  3VBF B;  5BNQ A;  3K48 A;  3M1H A;  4PI0 A;  2PHL A;  1VBD 1;  5JZG B;  2VY0 A;  1RUC 3;  1AL2 3;  5JVV A;  5C4W B;  3J9S A;  4JGZ B;  3VBR A;  2PHW A;  3B9C A;  5JI9 A;  4Y1U A;  1CQ9 A;  1JUH A;  1Q43 A;  2O0O A;  4DEQ A;  5DZF A;  4B1M A;  5HPO A;  1ZBE 1;  1VRH 1;  1YJL A;  2VMG A;  4QDR A;  4FQZ A;  1TME 1;  1O5L A;  4AEK A;  4I09 A;  4IUG A;  3LE0 A;  3U4X A;  2GC0 A;  1VLN A;  3WEZ A;  5A3O A;  4UFK A;  4QPI A;  1QJU 3;  2V73 A;  3ZXL A;  3INA A;  5FXX A;  1PGW 2;  2VBD A;  5EV7 A;  4AVC A;  4D6R A;  4YW3 A;  3GZE A;  1X7N A;  4Q4W 3;  2YHJ A;  1HLC A;  2DUO A;  3I2J A;  1ALY A;  3DPR B;  1RUC 1;  2P3Y A;  1W28 A;  4XQW A;  1AHS A;  4KL1 A;  4M3C A;  4XBN A;  1PK6 B;  4P14 A;  1BBT 3;  3GHN A;  5ERL A;  4ATE A;  3H1W A;  3LFM A;  4K9S A;  1LHO A;  4RFT 0;  1VBC 2;  4XJ8 A;  1H8T A;  4XFB A;  2QQM A;  3FX3 A;  4A3Z A;  1EV1 3;  4KWJ A;  2JIG A;  2C4X A;  4URA A;  3UES A;  4BHP A;  2GSY A;  1PO1 3;  4C90 A;  4GMP 0;  3SKV A;  2PAE A;  1TZO A;  2X5I B;  4QB1 A;  3ACL A;  1GLH A;  2NLR A;  1NCR A;  1EUU A;  1OUS A;  2RJ2 A;  2XJT A;  3AYC A;  4P9G A;  5FP9 A;  5CFD A;  4FTS A;  1ZX5 A;  4GWI A;  5FP8 A;  2IXH A;  3ATG A;  5HXM A;  1COV 3;  5CNA A;  2QQK A;  4HPK A;  4BIO A;  1CPM A;  5DAP A;  1AJO A;  1QH6 A;  2D6N A;  2D6L X;  4JGY A;  4X6R B;  4PCR A;  3AYA A;  3EBR A;  1O8P A;  3LPF A;  1ZBA 2;  1LOA A;  2E6V A;  4BQ1 A;  1RVF 3;  2WNV B;  5KHI A;  4GB3 3;  1OUX A;  3VBO A;  1VBB 2;  2BV4 A;  1HN0 A;  1EV1 1;  1AYN 2;  3J7M A;  2JDU A;  1D4M 1;  4IV3 A;  4M4P A;  3RFR A;  1EPW A;  1PHM A;  3RSJ A;  5D21 A;  4BQ2 A;  1NA1 A;  5CA6 A;  4Q0V A;  5C9A B;  4BM8 A;  1PO1 1;  1UOF A;  1WCD J;  1JYN A;  2VD7 A;  1CR7 A;  3MDP A;  2WLP A;  3VBU C;  1HQN A;  3ZFG C;  3MZH A;  5KHG A;  5IUQ A;  3UNP A;  2VPV A;  2BJS A;  4OHV A;  4I3G A;  1ACC A;  1TQ5 A;  1LES A;  5IVE A;  1YI9 A;  3NNJ A;  4QX3 A;  5CKM A;  1XE7 A;  5ABJ A;  5AFE A;  3PU8 A;  1W6O B;  1YEW A;  2MEV 3;  2Q1F A;  2Y0O A;  2XBO 1;  5FZM A;  2WFF 1;  1FYU A;  1UX6 A;  3OOX A;  3ZMN A;  3CO2 A;  4GB3 1;  2OQ6 A;  1QJX 2;  5C6C A;  2ZX4 A;  4WM8 B;  5EJZ B;  3TBD A;  2E7A A;  1X33 A;  4XXP A;  4Q0P A;  5K7P A;  2OYZ A;  2I74 A;  4OQ8 A;  4MXW B;  4ZU5 A;  4FPC A;  5FZL A;  3ASI A;  4YVW C;  3JD7 2;  5JIA A;  1UU5 A;  4Y33 A;  4PBP A;  2DFB A;  5FOB B;  4Y5S A;  3VL9 A;  5JSO A;  2MNG A;  5FZA A;  3OYW A;  1MAC A;  1R1A 1;  3A21 A;  5ANQ A;  3P6B A;  3E97 A;  5ACA 3;  1GQP A;  2JEC A;  2K2S A;  4KGG A;  5AC9 2;  1STM A;  1XSQ A;  5I0S A;  2VBP A;  2RM2 3;  5F37 A;  1LCL A;  2RE9 A;  3P1I A;  4FPH A;  2OQ7 A;  4HVQ A;  2ZHK A;  3BN6 A;  4H7L A;  3UK9 A;  3KQ4 B;  1ULP A;  4TLF A;  5I0T A;  4L11 A;  1KDK A;  3K2O A;  1BXH A;  3AC0 A;  3O1R A;  4AZZ A;  1XSR A;  2VVE A;  2I45 A;  3ETP A;  1QXJ A;  1LHV A;  4P02 B;  2DBN A;  2FBE A;  3M4F A;  2WZR 3;  4YVS C;  5C33 A;  1GQG A;  1UKR A;  4J1W A;  5FAX A;  2PTM A;  2WO7 A;  1N3P A;  1MS9 A;  1W6N A;  5JOW A;  1SLB A;  1W6P B;  2B7Y A;  2YPD A;  1LUL A;  5FZ7 A;  2IXJ A;  2GN7 A;  4B7K A;  1T2X A;  1ZVF A;  4E9K A;  2X8K A;  1SLL A;  5ACA 1;  1UOJ A;  1LR5 A;  3LIG A;  4LBK A;  3VBU B;  5L7O A;  2B45 X;  5GJ6 A;  3ZFG B;  1L7L A;  2RM2 1;  3UKT A;  4GJZ A;  4R9C A;  1D2Q A;  3OBT A;  3DF0 A;  4TXW A;  5FZ6 A;  2FDF A;  4JQT A;  3KS7 A;  5FDB A;  2AEZ A;  3CEW A;  1BEV 1;  3N7L A;  3MV0 1;  1QXR A;  4GWN A;  2R04 2;  3NKT A;  4XAC A;  1BKZ A;  5F5Q A;  2VNG A;  2WZR 1;  4Q4V 3;  1U0A A;  1QMJ A;  3GBF A;  3ME2 A;  2J1R A;  4OVE A;  4COV A;  1XJA A;  3POW A;  3I59 A;  1UPI A;  3PTR B;  3OG2 A;  4UBH A;  3DYO A;  4ES9 A;  4W6X A;  2CSG A;  1RUJ 3;  2OUJ A;  3ORJ A;  1YQC A;  4Y4Y A;  5B4N A;  1PMH X;  3KB5 A;  2VMC A;  3N7M A;  4WM7 B;  1UYP A;  2VTX A;  4YVW B;  5FQ0 A;  4LKE A;  3FBY A;  1YI7 A;  1WW5 A;  2WS9 3;  1X9P A;  2RDN A;  1HQL A;  1GUI A;  1JHN A;  4CDX A;  2Q30 A;  5IVV A;  2BVB A;  1HB4 A;  1I5Z A;  1JHJ A;  4IGO A;  1JZ6 A;  3RDI A;  3FFQ A;  3WDX A;  2GC1 A;  2NMN A;  4FFI A;  4YW6 A;  1LNS A;  2CL2 A;  1J83 A;  4PLM A;  5A3M A;  3I3M A;  3H8R A;  4QX8 A;  5C71 A;  3CNA A;  2LUW A;  1UZV A;  4OYU A;  3DYM A;  4GAZ A;  4RHV 2;  3NNM A;  3S57 A;  1CAW A;  4UW5 A;  4MH0 E;  4JTO A;  5LW9 A;  5A7W A;  2HWE 3;  1M06 G;  1DF0 A;  4YVS B;  1OQD A;  4NWV A;  4XFI A;  3WQ7 A;  1UNB A;  5C8W A;  4B4Q A;  2GNM A;  3UL2 A;  2CAU A;  2E53 A;  1YFX A;  3WIN E;  2BFU L;  4UFJ A;  5BNO A;  2HBT A;  2WQZ C;  2XWJ B;  3WOG A;  1XPW A;  3OPT A;  3R6S A;  3SIT A;  1PGS A;  2XLF A;  3QBQ A;  1F8V A;  2CYF A;  3VZN A;  4Z82 A;  3VHP A;  4UYB A;  3ENR A;  3TEZ A;  2VG9 A;  2LM3 A;  4C8D A;  1RMU 3;  4LIV A;  4CXW A;  1PM7 A;  3RZH A;  4RD7 A;  2VZV A;  2Y6L A;  4KI5 M;  1RUH 2;  2CAV A;  3IWZ A;  4P00 B;  2VUL A;  4N53 A;  2NPI A;  2HEW F;  4NHM A;  3HQU A;  4ZZ5 A;  2HH9 A;  3DYP A;  2GDF A;  3ALQ A;  3M70 A;  4LHK A;  5BNP A;  4BH9 A;  3NNL A;  4AI9 A;  1VB4 A;  2BUK A;  2L9L A;  2R0H A;  4EWD A;  3H8O A;  1YLL A;  4N43 A;  1PGL 1;  2XKO A;  4B3N A;  4HL0 A;  3VLB B;  3HN1 A;  4CDU A;  2DTW A;  2Z4F A;  5K0U B;  3POS A;  5DXD A;  3LAG A;  3PDQ A;  5A3N A;  2ZGL A;  3VBS A;  5APA A;  1OPM A;  3ZVX A;  2AYH A;  4N7U A;  1HJG A;  1MS3 A;  4K1Y A;  4XAA A;  1FV3 A;  1JMU B;  2BWC A;  3H1M A;  4RA0 A;  4BLJ A;  2XXZ A;  3MLL A;  3C8X A;  3DKQ A;  4DXS A;  2QQL A;  5FY5 A;  4LA3 A;  2O1Q A;  5FO9 B;  1ZRC A;  3POF A;  4XDQ A;  2W9X A;  3N9N A;  4XTP A;  1C8N A;  2O14 A;  1EUT A;  5DZE A;  3OD0 A;  1AUY A;  4YGD A;  3O1O A;  1OPO A;  4ISQ A;  5LAT A;  5JXG A;  2DUP A;  1GFF 2;  1LKN A;  2VNV A;  2ZS6 B;  1JOP A;  3K75 B;  4UW4 A;  5D2A A;  3RWN A;  3ZN6 A;  4E4H A;  1PVX A;  3AX4 A;  4JDM A;  5F5I A;  5SV5 A;  1HJF A;  4Y24 A;  4C0H A;  3CZU A;  4CPB A;  3E6D A;  4DUV A;  3MIG A;  1AX0 A;  5FYV A;  5F9T A;  2EXK A;  2W87 A;  1YYN A;  3W20 A;  1OFN A;  2HWF 1;  1DGW A;  4Q0Q A;  4AED B;  3I3B A;  4AI8 A;  4CDW A;  1UIK A;  2HLE A;  4DIN B;  1FMD 3;  2WWS A;  1NCQ C;  3ELN A;  3LB9 A;  3OBA A;  1CAV B;  1JYW A;  5DPN A;  5LA2 A;  2BDR A;  5J3U A;  1DQ0 A;  4MOA A;  1BVV A;  1UQX A;  2W39 A;  2RDS A;  2OUH A;  4NPM A;  1O7F A;  2JDA A;  3Q9O A;  4LBQ A;  1RUD 1;  2VC9 A;  4EN9 B;  3BPZ A;  2UU8 A;  3TN9 2;  1WLC A;  1V6M A;  5JCT A;  2TUN A;  4MGQ A;  3RZM A;  4EYU A;  2VZS A;  2RG4 A;  2XL9 A;  3N35 A;  3AVR A;  3B3Q E;  1LRH A;  4M0N A;  1NQJ A;  1BHG A;  1N1V A;  5GZE A;  1KRI A;  3AZX A;  5DUW A;  1W6M A;  1UZY A;  3OTF A;  2VOV A;  5I93 A;  3IMM A;  4H55 A;  2B8M A;  5C3P A;  1GMM A;  5FP3 A;  4P9L A;  1AR7 1;  4YM0 A;  4AI3 A;  4ZXE A;  1S0C A;  4QPG A;  1W8Z A;  4KG0 A;  3N9O A;  4CCE A;  1LU1 A;  1BBT 2;  4IEP A;  1ULE A;  2VL4 A;  5FPX A;  3FLP A;  2W0X A;  2HYX A;  3I2D A;  3ZYJ B;  1PVC 1;  4P5H A;  1GOF A;  2D44 A;  3RYR A;  4LBN A;  1AR6 2;  5CIR A;  2E7Q A;  2DBI A;  1JYT A;  2V5Y A;  2G4I A;  2WYS A;  4Q8L A;  1BK1 A;  2VMF A;  2XVG A;  4RQP A;  5GZD A;  1JS9 A;  1W9W A;  5EWS A;  2QQW A;  3D0S A;  3O14 A;  4GIQ A;  4LO5 B;  1E57 A;  1OMI A;  2CNA A;  2ZX1 A;  4XF3 A;  2Q8O A;  3TEX A;  1YQ2 A;  5KHH A;  3RMX A;  4EWA A;  2OPW A;  1UY3 A;  2YZ4 A;  3I49 A;  2GC3 A;  1S0G A;  1JW6 A;  4DFS A;  1WLT A;  2DCZ A;  2QUO A;  3M3E A;  2XJV A;  2XQR A;  3VZO A;  4XMA A;  1UX7 A;  4PHZ A;  3RPQ A;  1KXG A;  2A3W A;  1H2M A;  2G9G A;  2JG9 A;  4NR1 A;  5EFU A;  1TMF 2;  3GZU C;  4UT5 A;  5FZK A;  1ST8 A;  3I2G A;  4QAW A;  1QOO A;  2XOM A;  3ZDV A;  4H14 A;  1NCQ B;  1UPS A;  1NZI A;  3IZO A;  1OOP C;  3RQ0 A;  1O3S A;  3ITQ A;  4TYS A;  2XKP A;  2ZHM A;  2LRP A;  5CFC A;  3ZN4 A;  2TNF A;  4MGY E;  3IMN A;  2PHT A;  3DL3 A;  2RDR A;  3GZT B;  1XND A;  2HEV F;  4MET A;  4YRD A;  1J3P A;  3HEI A;  4UFL A;  1AR8 1;  1IS6 A;  1DYP A;  3C2U A;  1VBC 3;  3WNL A;  5ISL A;  2NN8 A;  2JIJ A;  4U36 A;  3ZPO A;  4C0B A;  4MGZ E;  4CU6 A;  3PVO A;  4AQ6 A;  1NE4 A;  3WF2 A;  2Z42 A;  1AVB A;  3O1P A;  2R1B A;  3V56 A;  4BQ5 A;  2P1B A;  3RI9 A;  4LOR A;  4ZON A;  1PGW 1;  1V6L A;  2VMD A;  3ZFE C;  5IAT A;  3DEC A;  1ND3 A;  1D0G A;  4NRM A;  1FAY A;  2ATF A;  5LRS A;  5JOX A;  1VPH A;  3QCW A;  4NMI A;  3W58 A;  1OH4 A;  1N1T A;  4XJ9 A;  1C8M 1;  4FBF A;  2VQT A;  3OD4 A;  4M3C F;  1ND2 A;  3WF4 A;  1HXS 1;  1H2L A;  4IQP A;  2WDB A;  1VBB 3;  1AYN 3;  1V6J A;  4N9I A;  1IQD C;  5FMB A;  4IE5 A;  5FUI A;  1GP6 A;  1VMH A;  1YHF A;  2PFW A;  4RGA A;  4AYU A;  4CUC A;  5IK7 A;  1QIQ A;  1ASJ 1;  1P8J A;  3OY8 B;  4AL9 A;  1SLI A;  1MQT A;  3AKT A;  4YWA A;  4NRO A;  3V0B B;  4NVP A;  1TNR A;  4P5Y A;  3WP4 A;  4I0W B;  1GOG A;  4FPF A;  4Q0S A;  4PDW B;  3MUZ 1;  4UFH A;  4X8N A;  3JU9 A;  1IS5 A;  3SMH A;  2ZHN A;  4Y20 B;  2DVF A;  4OFG A;  1UXZ A;  3H42 B;  3WDU A;  2F6B A;  5JLV A;  2DVA A;  1WBL A;  4URT A;  1ZBA 1;  3ZPY A;  3I3Q A;  3TB0 A;  2EA7 A;  1QJX 3;  2JDK A;  2R49 A;  4AWD A;  1AR9 2;  1DZR A;  3FUO A;  2A7A A;  3OJB A;  3VBH C;  4BJ0 A;  4XUP A;  3T4V A;  4D94 A;  1JZ4 A;  1F35 A;  2W5F A;  4AVS A;  1CGP A;  5D8A A;  4BME A;  2CHH A;  5T3N A;  2FHR A;  3B9I A;  1S2E A;  3JD7 3;  3OGJ A;  4NUB A;  3BI3 A;  1DP0 A;  3A4U A;  3MF6 A;  4NII A;  4CUA A;  4LKD A;  4XUR A;  3MIC A;  4FVV A;  4Q29 A;  4RR3 B;  3BIE A;  4FQ4 A;  4NHL A;  2ZML A;  4XPV A;  4Q1R A;  1GU3 A;  3VB9 A;  5AC9 3;  3HNY M;  2VVD A;  1B35 C;  3ZFE B;  2DVG A;  4PI2 A;  2XJP A;  3MGU A;  3U75 A;  3WF3 A;  3ZFF A;  2WNE A;  3FUQ A;  3NQH A;  4COZ A;  2D3P A;  4M01 A;  3N4M A;  2E31 A;  2WN3 A;  3MFA A;  5A1L A;  5CAD A;  2HWC 1;  2Y60 A;  1UMI A;  1QJX 1;  2P3I A;  1NXD 1;  4XVH A;  1BZW A;  2I07 B;  3VN4 A;  4P9J A;  1OF4 A;  5K4L A;  4PBO A;  4NHK A;  3B5L B;  3EO6 A;  3A23 A;  2GC2 A;  3KF3 A;  2XH6 A;  1V0A A;  3JD7 1;  1PZ9 A;  3QH7 A;  4YNI A;  4LK6 A;  3BCW A;  1GNH A;  1AYM 2;  1VJ2 A;  3RZG A;  4UF0 A;  3AKP A;  3PMS A;  3NNG A;  5LAS A;  2VH9 A;  5FZD A;  4GUL A;  4CUG A;  4AFA A;  5C3Q A;  4XYX A;  3RG0 A;  3KT7 A;  5CKQ A;  4ZHN A;  4MHU A;  4LKF A;  4RN5 A;  1NY7 1;  4IEW A;  4JRL A;  5C8C A;  2ERF A;  4UFI A;  4HN0 A;  5BNN B;  4FFH A;  2VCM A;  4NHX A;  1OSG A;  3CBN A;  1MZF A;  1VBA 1;  2E51 A;  2R04 3;  4AI1 A;  3I4I A;  4PF5 A;  3L2H A;  4LO4 B;  5A3T A;  3ZIW A;  3FLR A;  3P5B A;  2YC0 A;  3PUR A;  4ARX A;  3PLQ A;  2RJK A;  1UU6 A;  4IV1 B;  4XQD A;  4Q2F A;  3ZYF A;  3WW1 A;  5CKN A;  3VBH B;  4IL7 A;  2BER A;  2EIC A;  4L97 A;  1W90 A;  4HET A;  1H0B A;  1LED A;  2ILM A;  1MZE A;  4DUW A;  5FP4 A;  1RMU 2;  2X53 S;  5A3W A;  1G9F A;  4RSU A;  3H1Y A;  1Y43 B;  3HQR A;  1WKY A;  3FHI B;  1UOB A;  2F17 A;  3BPS A;  4QKB A;  1RXG A;  3GAL A;  1UF2 C;  3VZK A;  4QB6 A;  2GN3 A;  1VP6 A;  5CFC C;  3BTA A;  3WW4 A;  3EMR A;  1B35 B;  2J1A A;  4M0H A;  3WR0 A;  4ITC A;  2JG8 A;  3WX5 A;  1UWW A;  1Y9M A;  3U1X A;  2BWA A;  5GZC A;  1O59 A;  4K1Z A;  3IDA A;  4RHV 3;  2WBK A;  4IE4 A;  5A32 A;  4AW7 A;  3POI A;  3WG4 A;  4AGG A;  3CHX A;  3U4S A;  5JDB A;  4YGB A;  2BGC A;  1WCK A;  4DXR A;  2UWB A;  3R4D B;  3CIH A;  3ILN A;  4KU8 A;  4QQ2 A;  2D3R A;  3ST7 A;  2QJV A;  2ORZ A; 
#chains in the Genus database with same CATH homology
 4QKD A;  3S5A A;  2FDJ A;  3I3M A;  3O1S A;  3H8R A;  3I3Q A;  3S57 A;  3T3Y A;  3O1U A;  3T4V A;  3RZL A;  4NRQ A;  3BU0 A;  3BI3 A;  4NII A;  3BTX A;  3BIE A;  4MGT A;  4NIG A;  4MG2 A;  3I49 A;  4CXW A;  3RZH A;  3KHC A;  3BUC A;  2FDK A;  2FDH A;  3RZJ A;  4OCT A;  3H8O A;  4NIH A;  3BKZ A;  3RZG A;  4O61 A;  3O1R A;  3O1M A;  4NJ4 A;  4ZHN A;  3RZK A;  4CXX A;  4JHT A;  3KHB A;  3O1P A;  3I2O A;  2FD8 A;  4NPL A;  3O1O A;  4QHO A;  2IUW A;  4IE0 A;  4O7X A;  3LFM A;  4NRP A;  4NRM A;  2FDG A;  4IDZ A;  3BTZ A;  2FDF A;  4IE6 A;  5F8P A;  3BTY A;  2FDI A;  3O1T A;  4NID A;  4QKB A;  4ZS3 A;  4RFR B;  3H8X A;  3T4H B;  3O1V A;  4IE5 A;  4QKN A;  4NPM A;  4ZS2 A;  4QKF A;  4CXY A;  4NRO A;  4IE4 A;  3RZM A;  4IE7 A;  5DAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...