4ASMB

Crystal structure of the catalytic domain of beta-agarase d from zobellia galactanivorans
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
357
structure length
357
Chain Sequence
QYDWDNVPIPANAGAGKTWKLQTAASDDFNYTFNPTNNVVDFGPNGNMKWYNKYHNRPNGQPNNFEGPGPTKWMQNHVAVSGGNLNIWASRIPGATKSFTGSNNTPISRPETRAGCITNKTRVKYPVFVEARVKVMNSTLASDIWLLSPDDTQEIDIMECYGGPGNDNRNSYFASKIHLSHHVFIRPPNFKDYQPADLNSWWGKNGVTQWGGKTIRIGVNWVSPTRLEYFVDGQMVRILDNDAVQTRLADGTWQYTYPAGVTSTGVNGQLIKENGYQKMNIASSLSDAKNKSNISVIDPFNYLNNGRKFSKEMDIIINVEDQSWQAEAYRSPNAAEMANFYDNNLLVDWIRVYKPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-AGARASE D
publication title Biochemical and Structural Characterization of the Complex Agarolytic Enzyme System from the Marine Bacterium Zobellia Galactanivorans.
pubmed doi rcsb
source organism Zobellia galactanivorans
molecule tags Hydrolase
total genus 98
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2012-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4asmB00
2P2KA 2A70A 4U2AA 1CESA 3OJBA 1UN1A 5SV8A 1O4YA 2GMMA 2VW1A 4NOTA 2RHPA 4FPCA 4LBQB 3ILNA 2WJSA 2CNAA 2EXJA 1FV2A 4IQPA 2SBAA 4XXAA 1EPWA 3ZSLA 1JN2P 2P37A 4YGEA 5EXOA 5CNAA 2D6MA 4LBKA 3AJZA 1DBNA 1C1LA 1AX2A 1LECA 1LJ7A 3IMNA 1G9BA 1ONAA 1ULFA 3IPVB 2JE9A 2ZHNA 2E7QA 1N47A 3AFKA 4FPKA 1LODA 2GN3A 1N3OA 2A6WA 2ZACA 3SITA 1J1TA 1LOEA 4LBQD 3RMXA 3I4IA 3VKMA 2P3IA 3AYCA 1QKQA 3VV1A 3AYDA 5KXBA 3UJOA 4UW6A 1Q8PA 2ZBJA 1V6IA 1WUVA 3T1LA 4I30A 3AP6A 4YG6A 4XE9A 2ZABA 1C1FA 3M3QA 1GBGA 4GWNA 1S0FA 1WBFA 2TEPA 1CONA 3AP4A 4RA0A 2A3XA 2BQPA 3M2MA 2R0HA 4UW5A 3R05A 4Z8BA 2C9AA 2D6OX 4FQ4A 1DQ5A 4FPOB 3MEPA 1S0GA 1W6QB 1YYNA 2GNTA 1FAYA 1SFYA 5GLVA 1UL9A 2UWBA 2WT2A 4DFSA 1LHVA 1OFSA 1MS0A 2H0BA 2ZGTA 1JUIA 3JU9A 4K1ZA 1HLCA 3V0AA 2VUAA 4HANA 4XJ9A 3ZXLA 1FX5A 1LU2A 1Z78A 4Y20A 4DS0A 1MVQA 3O5SA 1S0IA 1JW6A 4GALA 5DXDA 4YGDA 5JOWA 1W0PA 1W6MB 1LULA 1SLAA 1S0BA 3ILFA 1ULDA 3OGGA 3WCRA 1D0HA 1SLIA 4XJZA 1GLHA 1WW4A 2UWAA 1FNZA 3HMYA 3WZ1A 5JOXA 5JOYA 3RSJA 1WD3A 2D43A 3AYAA 1X50A 4YFWA 1AXKA 1Y7BA 4NO4A 5E88A 3USUB 4PCRA 1AXZA 2CY6A 2WSUA 2CWMA 2YROA 4FOYA 3JUUA 2W68A 4BMEA 1GANA 2NN8A 2D3SA 3SISA 3NV4A 5FRAA 3WG1A 1UZZA 3M3OA 3N35A 4AVVA 4P9XA 1DQ6A 1LHNA 1FNYA 3AP5A 2VH9A 4UW4A 5JLVA 4FOQA 1OKQA 3WDUA 4GWMA 2P3JA 3N7LA 2JDZA 2DUOA 2PHFA 1DQ1A 4LBQA 3T1MA 1YXWA 1YIFA 3M3EA 3WG2A 2A6ZA 1KITA 1WD4A 1SLLA 3IKWA 5LK5A 5BYNA 3R4SA 3N3HA 1UKGA 1W6PB 3PMEA 5L73A 3UJQA 1JYIA 2YXSA 1N1SA 1DFQA 4FPYA 1JHNA 4CTEA 1F9KA 1JOJA 2UU8A 3IPVA 1A3KA 1DYKA 4YFZA 1IS5A 2JE7A 2WLQA 3FUQA 1ENRA 2D7FA 2GN7A 4XZPA 1LENA 2ENRA 1XQNA 3V64A 4C1WA 3C2UA 2D6KA 1Q8OA 2W39A 2ZGUA 3OBRA 1CIWA 4YG3A 3WDYA 3W58A 5IK5A 2A3WA 4XBNA 5DZEA 1FATA 5GZDA 3MW3A 1BXHA 1AJKA 1Q8QA 2DTYA 2UURA 4MYEA 2V73A 2ZMKA 1V00A 1AX0A 1IS4A 1ULCA 3MW4A 4L8QA 3SNMA 3WOGA 1BZWA 4YZ5A 1AJOA 2ZGNA 4Y1UA 1YI7A 1LOBA 3AX4A 4TYSA 4P14A 2OVUA 1CPNA 1BKZA 1JXNA 2WT1A 2YV8A 4AGRA 4AVSA 3BIWE 4YZ1A 1BJQA 4XMIA 1S0JA 1WLDA 1W6QA 3FLPA 4D69A 1MZ6A 2A6XA 2DVGA 2DVDA 2ZAAA 4FPHA 5GJ6A 1GNHA 4R9AA 2UWCA 4Y22B 3SH3A 3WV6A 1MS5A 1MS9A 3ZPYA 3NV2A 2VY0A 5DUXA 1WLWA 3UL2A 4TZDA 2DVFA 4FPGA 2ZMLA 1JYCA 1S0CA 2DURA 2NM1A 2AGSA 3WCSA 5GZGA 3VUOA 2E7TA 3RQ0A 4F83A 5JOZA 1N1VA 1F31A 2OW4A 1IS6A 3NV3A 3OY8B 3WVJA 1W6MA 1QNWA 2W52A 2WSVA 4M3CF 2XG3A 1G86A 4Q26A 1I1EA 5CA6A 4YM0A 2VW0A 4JRAA 4LBJA 1CR7A 1QF3A 1V6LA 3WG3A 2A6YA 4XBLA 4C1XA 5FREA 3ZYRA 3USUA 4ASMB 5HCFA 4XIKA 4FPLA 4BMBA 5IK7A 1G7YA 1PZ9A 4YW4A 5GZEA 1LESA 1GZWB 1QMJA 2JD4A 1V6KA 2YMZA 2ZHMA 3LCPA 3RS6A 2ZGKA 3OYWB 4H55A 1LEMA 4W65A 1DGLA 2ARBA 3VKLA 2R16A 3AP9A 4YG0A 5CBLA 2CWSA 4ISRA 5GLZA 2JECA 4XYXA 1R1ZA 2GNDA 4XMAA 4M3CB 3V0BB 5KXEA 5T55A 4YZ4A 5H9SA 2ZGSA 2JJ6A 1OQ1A 2ERFA 1W6PA 3WHTA 4BLIA 1LHWA 1W6NA 1B09A 3WDWA 3GALA 3ZXEA 2I2SA 4XJWA 2AR6A 1KDKA 2ZZJA 1LOFC 3RRDA 4R9DA 5GALA 4BQ1A 2D3RA 2R1BA 1DHKB 1G9DA 1GKBA 1SCRA 3B3QE 3BTAA 4PQ9A 1KJRA 2ZGQA 4CZSA 1GNZA 4Q8KA 4XDQA 4HL0A 3ZYPA 4XJUA 1IS3A 1GZCA 4U36A 1LOAA 1UAIA 3B9CA 3LSDA 1V6NA 4Y1VA 2DYCA 3ENRA 4FOWA 1QDCA 1SLBA 3BODA 4FP3A 1SACA 4AGGA 1VAVA 4YM2A 1W0OA 2DV9A 2D6LX 4AGVA 2ZGPA 3POYA 4AVTA 4DQAA 5GLUA 5KXCA 3QLQA 3RMYA 1FV3A 1UMZA 4M01A 2ZA9A 2G4IA 2P3KA 4XOGA 4YW5A 4XTPA 3MPPG 3N7MA 3QCWA 4RL7A 4Y22A 1DZQA 1LGCA 1ULEA 1MR5A 2A7AA 2VU9A 5H9RA 5CAZA 1GICA 2YY1A 3FLRA 4LBOA 5DZGA 1APNA 2GALA 4ATEA 2ZGMA 2ZHLA 2ZKNA 3AZZA 3OY8A 4XJ8A 3ZSKA 1KRIA 4XJAA 1C4RA 1RITA 2PHXA 1MS4A 4GA9A 3INAA 2DUQA 2VXRA 1V6OA 5T5OA 2EAKA 2ES3A 1WW7A 4SLIA 4WV8A 5DUWA 3AYEA 3PVNA 1N3QA 5IK4A 3AXDA 2DWRA 1Q8VA 3IM0A 3O12A 4P9WA 4DPNA 1Q56A 3O0WA 4YW3A 5T54A 4FP2A 4XTMA 5EYXA 3AZVA 2DU0A 2W08A 4FPFA 1ZM1A 4KBBA 3AJYA 1SCSA 4Y26A 3ZXKA 1GZWA 4M3CE 2ZGLA 4R9BA 4AYUA 3KQRA 3VKNA 1V6JA 3ILRA 5DZFA 1QGLA 3N7KA 3OYWA 4Q1RA 4Y1YA 3L2YA 5DG2A 5JMCA 2PHWA 3SH4A 3POSA 2AREA 5T5JA 1DIWA 1IKQA 2D44A 3DGTA 4YZ3A 4ZXKA 2R49A 4M3CA 3PVEA 2WNEA 2ZMNA 3V0AB 1N3PA 1AZDA 2LALA 1DYPA 2GNBA 1ENSA 2Q5TA 1UPSA 5T52A 1WLCA 5JVVA 3ATGA 3B00A 3GNEA 2E6VA 4UW3A 1D2SA 3FFZA 3ZSJA 3U4XA 1SLTA 1G9CA 3ZXFA 2DVAA 1BQPA 4YZ2A 2CTVA 4LBLA 1G9FA 2DU1A 2A71A 2AUYA 5JDBA 1SBFA 1LHOA 4WVVA 1PZ8A 2WKKA 5H9PA 4JC1A 1SBEA 3FUOA 3KM5A 1MS1A 1QOOA 3WDVA 1YO8A 5HCAA 1QOTA 1MZ5A 4YGCA 3A0KA 3AZYA 2B7YA 3WUCA 3NV1A 2KM2A 2DVBA 3A4UA 4AWDA 1A78A 1BYHA 1I3HA 1Q8SA 2EXIA 2OUJA 4FPJA 1ENQA 1FYUA 1WBLA 4YLZA 4LBNA 1LOFA 1KQRA 4YM3A 5DG1A 5DUVA 3DUIA 3IN9A 3H0OA 4BOWA 1YRZA 1SBDA 4ATFA 4R9CA 1MACA 4BPZA 3AZWA 3O0VA 1JBCA 2AYHA 3D5OA 1AXYA 1H30A 3M3CA 4BLJA 5HCBA 4CRQA 5AVAA 4Q27A 5IK8A 3APBA 1RIRA 1W6OB 3FLTA 1LGBA 4GKXA 1DQ4A 1DQ2A 5E89A 4YM1A 3Q9OA 5CB7A 5IT6A 1IKPA 3WDTA 1LU1A 4WVWA 2WQZC 1WW6A 5IUQA 1WW5A 2OUHA 1LEDA 2AENA 4M00A 1VALA 3A0NA 3N36A 1KDMA 1VLNA 2ZHKA 4FVVA 1TEIA 4YW1A 1SLCA 4PF5A 5T50A 4FPEA 1GZ9A 2EXHA 3NWKA 4PBPA 1C57A 2ARXA 4XXPA 2NMOA 5GM0A 3AP7A 4GXLA 3TB0A 2JKBA 1QU0A 3UK9A 1DLLA 2PHUA 2ZGOA 2FMDA 2FHRA 4XIOA 1ULGA 3MW2A 2A6VA 4Y1XA 1G8WA 2EXKA 2CYFA 4GKYA 5GZCA 3HN1A 1PZ7A 3BOPA 5EYYA 3WLUA 1CJPA 3M1HA 1S0DA 3B69A 2E51A 5DUUA 3SH5A 1F5FA 2SLIA 1LTEA 2C5DA 3D6EA 4ITCA 1QNYA 3ZXJA 2NMNA 1NXD1 2HYKA 2PHRA 2R0FA 1G9AA 1UX6A 1Z0HA 4OZXA 2DTWA 1VIWB 1ZA4A 2A3YA 1GV9A 1IOAA 1LGNA 3ASIA 3V0BA 3AZXA 3WUDA 2NYYA 4DRVA 2YZ4A 1N1TA 3POWA 2V5YA 4Q1PA 4XBQA 4Y24A 5T5LA 2NP0A 1GSLA 1HQWA 2Z42A 3ZSMA 3WG4A 5GLTA 1NLSA 3VKFC 1S1AA 2NZ9A 3V65A 4DRRA 1H9PA 4K1YA 2VW2A 4Y1ZA 5E8AA 4XHBA 1LHUA 1LOGA 2D6PA 3LSEA 3T2TA 1LCLA 4JCKA 1CVNA 1HDKA 1HKDA 2PELA 4XHXA 1U0AA 3AK0A 2CL2A 3N7JA 5GZFA 1CQ9A 1LOCA 2A5ZA 2EIGA 3OBTA 3B01A 3O0XA 4FQZA 3R4UA 2P34A 1N1YA 3WDXA 1QDOA 1W6OA 2GMPA 1A8DA 2ZGRA 3CNAA 3D4KA 4PBOA 2LTNA 4K21A 3SLIA 1W6NB 2PHTA 3RG0A 4WZFA 4YW2A 4YGBA 1H9WA 3I8TA 2DUPA 1AX1A 3PVOA 4BM8A 2D6NA 3FBYA 4FOVA 4Y20B 4Q8LA 2AH2A 3ZVXA 1S0EA 1URXA 1AVBA 3OPZA 1CPMA 1VAMA 4LBMA 3AXEA 1MVEA 4Q2FA 2D3PA 1WCSA 2GNMA 2E53A 2R1DA 2A75A 2WT0A 1O4ZA 2XB6C 1AF9A 1RINA 1MS8A 1CN1A 2GDFA 1KJLA 3HR9A 3TAYA 3VKOA 2EF6A 4ISQA 3WHUA 1V6MA 3WNXA 5H9QA 5KXDA 1HQLA 4P9YA 1MS3A 5GLWA 5F9TA 5T5PA 4ZKTB 3PJQA 1QOSA 4K20A 1UZYA 2EALA 2GMEA 5F5QA 3W59A 4XILA 1DQ0A 5EWSA 1GYKA
chains in the Genus database with same CATH superfamily
4MLOA 1HRV2 1J3RA 1FT9A 2RR12 1CESA 4HSJA 4U2AA 1VRH1 3U07A 4OQ8A 3OJBA 1VRH3 1O4YA 4NOTA 1ENXA 5FMCA 1NYWA 4YPJA 5SV8A 4LBQB 3ILNA 2YFUA 3S30A 3THDA 4HK9A 4BJ0A 2Z4FA 4AF9A 3WNPA 2EXJA 2UYBA 1SHWB 1XRUA 4IQPA 4MGZE 4XXAA 4COWA 1EPWA 4ZU4A 4QKNA 3T30A 4YGEA 1UOFA 2R061 2X5IC 4F8AA 2R063 2LM3A 3Q8FA 4IGPA 4LBKA 4NPRA 5EQUA 2JDHA 2Y6JA 5D21A 1STMA 4IUGA 1G9BA 1ONAA 1BMV2 1PK6B 4FPKA 1N47A 5EFUA 3KVAA 3AKSA 5D2AA 5JAXA 2H6CA 3ACFA 2ZZQA 2QQMA 3B94A 1UY3A 3H1WA 2Z2SB 2HWE1 3RMXA 3VKMA 2HWE3 1QKQA 2FMYA 4K7JA 2Q8OA 3ZX7A 1FPN1 3K51A 5KWRA 3T0DA 1Q8PA 4COYA 1RUF2 1V6IA 4CCKA 3T1LA 4I30A 1UX7A 4XE9A 4QPWA 5EJ3A 5BNNA 1ZZCA 2GU9A 2RJ2A 3M3QA 5FR3A 1OMIA 3E5QA 4GWNA 1OHFA 4PLOA 2IXIA 1WBFA 4QAWA 1VBD2 2A3XA 2VQUA 4UW5A 4UFLA 4WM7A 4Z8BA 4IEUA 2D6OX 3GCXA 3PTYA 3F95A 4I09A 3FBMA 5FUIA 3MV11 3POBA 1O3QA 1OUXA 1ZBE1 5GLVA 1FAYA 4DFSA 5FP4A 1ZBE3 4XAEA 4DY5A 4QB1A 2WABA 2XJSA 1JUIA 4BYYA 1CX1A 1HLCA 4OZOA 5DDJ1 5FPAA 4HLTA 4YWAA 2VMDA 5E6HA 4QPIB 3ETQA 1EAH2 4Y20A 4DS0A 1JUHA 1IPKA 2QZ2A 2DCTA 5JOWA 1W0PA 1W6MB 1LULA 3VBOC 1CWPA 1K5MC 3POEA 2WQ4A 1ULDA 3OGGA 1ZZ7A 3WCRA 5F37A 3VBFB 4KL1A 4KBZA 1CAUB 3DPRC 2UWAA 4Q4V2 5ANNA 1XNTA 3WF3A 1S2KA 4X8NA 4CP1A 3RSJA 5FZDA 4XETA 1MZEA 2W87A 3PU8A 1YCIA 5FYSA 1IZ3A 4PCRA 2CY6A 2FZ2A 4FOYA 4HKOA 5JUVA 4L97A 4NPLA 5FOBB 1GANA 2VMHA 3ZSEA 5JI9A 2D3SA 4RQPA 3NV4A 1ASJ2 3X29B 1O5UA 2CU5A 1DDLA 5HXVA 4P9XA 1DQ6A 1LHNA 1UU4A 3JD72 3CJIB 1PO23 4IE7A 3VZOA 5B2GB 3LDKA 4Q0QA 4FOQA 1OKQA 3WDUA 2BUKA 1S55A 4GWMA 2BBAA 2P3JA 3AL5A 5FK7A 3HOBA 5A7QA 3TEYA 1KGYA 4LBQA 5ISLA 1YXWA 2VZTA 1OVSA 3O1SA 1QXPA 3WG2A 1WD4A 4D7SA 5BYNA 1QJZA 3N3HA 4MHRA 4MGYE 2W1QA 4NWWA 3ZN5A 1HRI3 3K48A 3IIIA 2IXCA 1J3PA 2G1MA 3OUHA 4HVRA 4LTAA 2XBO2 2YXSA 5BPXA 5L73A 1N1SA 3WNLA 4FPYA 2R041 2O8OA 3DXTA 4Q0PA 1PK6A 1A3KA 1UKRA 3PLQA 2R043 1OOPC 2N7GA 4CSWA 4TN7A 2JE7A 1R64A 3FUQA 2D7FA 3GBWA 2QFEA 2ORZA 4XZPA 1JU3A 3H8OA 3T2OA 4DMIA 1QJU1 3WDYA 3C7FA 1NT0A 1CIWA 2R30A 1OFNA 5E16A 3W58A 5DZEA 1FATA 4OUEA 3AKQA 2QE3A 3MW3A 1Q8QA 1AJKA 3S5QA 2BJSA 4DUVA 3DKWA 1AX0A 2VMEA 1RUE2 3JB8A 4Y1UA 4PF1A 4X6QB 2WT1A 2F6BA 4AGRA 4DEQA 4HOOA 1BJQA 4XMIA 1WMFA 3PUSA 1KS4A 3JXSA 4MVTA 5FPXA 3KCXA 4QHZA 2A6XA 5FYBA 2DVGA 3ZXEA 3SH3A 2BTVC 1MS5A 1OPMA 4UF0B 4K9SA 4OI2A 3ZMOA 1JYCA 4QPIA 5GZGA 2QQPA 3RQ0A 4XF9A 1N1VA 1RUC1 2OW4A 4YVWC 4CDXB 1W6MA 2YG0A 1YI9A 3MIEA 4LLOA 3BOWA 4PI2A 4Q26A 3VBFA 3MGUA 1CAUA 2B45X 2K2SA 3ZFFA 4A7ZA 2BGOA 1KEXA 4XBLA 2A1XA 2GH2A 5ACA1 2RDNA 5CFDB 5FREA 1RUG1 3ZYRA 1ND2C 3KGLA 1RUG3 1XYOA 2XVLA 4NR1A 1G7YA 2JDNA 3NMBA 2QTWB 3N9OA 4YW4A 4LXLA 3JBG1 2GC0A 3KT4A 5APAA 2XLFA 1GZWB 2JD4A 1V6KA 3JBG3 3LCPA 3TN93 2WNOA 2OS2A 4NWVA 5LA1A 4W8JA 4QPGB 4QWNA 5C5TA 3CJIA 1MQTA 4W6WA 3OYWB 3LFIA 5G05L 3T08A 4XCBA 5LK7B 2QBXA 2GZWA 2B9UA 1PVC3 3I2DA 4B1MA 3AP9A 3MUY1 5GLZA 3BTXA 3MIHA 1L7RA 2JECA 4GB31 5AFBA 1AYM2 4LK7A 4OI0A 4CCLA 1RUJ1 4CCOA 2VR4A 5KXEA 5H9SA 2JJ6A 3FHIB 1OQ1A 2OA2A 5FYHA 4AFCA 4JGYC 5BNPB 2C4XA 4EZHA 3U14A 4AVBA 3WINE 3GALA 1OLQA 4XJWA 3GCWA 3VLBB 1KDKA 4D94A 5L9BA 3D3AA 5GALA 1F5JA 5JXGA 2R1BA 3CDZB 1G9DA 3T2QA 1GKBA 1O4TA 3B3QE 4BWOA 1KJRA 3IWZA 4HL0A 1RJ7A 3H3UA 1GZCA 2BYVE 1LOAA 1GZTA 3LSDA 1V6NA 5F3EA 3KSCA 4FOWA 4W6XA 2HWD1 4ZXEA 2E7AA 4Y5Z0 5IVBA 2FDHA 4LA2A 1W0OA 3K4DA 3W20A 5HXMA 4QX5A 4DQAA 2B4KA 3H42B 2ARCA 5GLUA 1YFUA 3IAQA 2XL7A 1FV3A 1UMZA 2RS32 2VZOA 1OUSA 4B1LA 4OHYA 2RS12 4G3YC 2P3KA 5J3UA 2VNOA 4GAZA 4I0BA 4WM8C 1ZX5A 3VDAA 2VQ0A 2HYXA 3AL6A 4UF0A 2A7AA 4Y5SA 3U11A 2VU9A 1NX9A 3OOXA 3WQ1A 4UT5A 1VBE2 5CAZA 2K9ZA 3AMMA 2YY1A 4H2AA 2BNNA 2GALA 2WS92 2HLEA 3CQOA 4IEVA 3RI8A 4XJ8A 3UKTA 4AQ2A 4NIGA 3GGLA 3RYPA 4CDXA 2PHXA 1MS4A 1JYTA 1D4M2 2EAKA 2VZSA 5DUWA 3WNNA 1XPWA 3WP3A 1WMXA 1N3QA 4CUGA 1V9U3 1T2XA 3IM0A 1Q8VA 5CFDA 3U10A 2XHNA 2P1BA 5F2SA 3O0WA 5T54A 1H1IA 1CD3G 4XTMA 5EYXA 5LATA 4DXZA 4KBBA 1PGL1 4D3WA 4BCUA 1PMJX 2IXKA 1GZWA 3ZFGC 2NQYA 5CIRA 3VKNA 3ILRA 5FPVA 5FUNA 1QGLA 3OYWA 4BK5A 3KVBA 2BDRA 2PHWA 1UZVA 4ES8A 5DAPA 1XNKA 2Y60A 1UOBA 1TVGA 3V56A 3VDDC 5L36A 1K5JA 2WNEA 1AZDA 1AL21 1NQJA 2LALA 2LW8A 1DYPA 1AL23 4AK3A 5BNPA 1UPSA 5IVCA 5T52A 1WLCA 3THCA 4CEYB 2W1UA 3B00A 5FYYA 2E6VA 2QJVA 3OEAA 4UW3A 2HWC3 1CIYA 2L9LA 3WR0A 2F17A 4IE0A 4B4QA 1EY2A 3U75A 5FIXA 1HXS3 2CTVA 4LBLA 1G9FA 5FY5A 3VBUC 2YC0A 4JHTA 4NIAA 3DYPA 3CJXA 1VMJA 2VZVA 1XSQA 1U5ZA 4Q0UA 4AOCA 3HVDA 3AVSA 2IFRA 1ST8A 2J1AA 3FUOA 1MS1A 5B4NA 1MZ5A 1J59A 3O1UA 3A0KA 3AZYA 2B7YA 1GOGA 4GZ9A 4NN0A 4UYBA 2ZAHA 4RGGA 3I2GA 2DBNA 2JE8A 3NVCA 1BYHA 2EXIA 1CGPA 1WBLA 3DKQA 3EBRA 3K75B 2VG9A 1KQRA 1QJFA 2BPA2 4E8DA 4UBHA 3MIBA 1AYN1 1VB2A 1XNDA 2CAUA 2GP5A 2ORXA 2OXBA 2V4VA 3QH7A 1AYN3 3DUIA 3IN9A 5FQ0B 1RMU2 3NKTA 4QQPA 5HV4A 1PGSA 3H0OA 4BPZA 1SBDA 1MACA 5EJZB 3AZWA 4BLJA 2AYHA 1YFWA 3M3CA 4ZZ5A 3G6JB 3LFMA 1NCQB 3OEBA 5AVAA 5IVFA 3GZTB 1RIRA 3TBDA 2WO7A 1DQ4A 1DQ2A 4TTGA 5FDBA 4GJYA 2Q8DA 4S2FA 1NZCA 3DF0A 3D8CA 5A6ZA 1IKPA 3I3BA 1QWRA 3WDTA 1LU1A 1ZZBA 1WW5A 2AENA 1QY4A 2VZ3A 1KDMA 2BFUS 3FHAA 1SLCA 1OA2A 1XC6A 1E5SA 1KFUL 1QJEA 4L11A 1XSRA 2EXHA 4PBPA 1C57A 5A3TA 3TB0A 1SQ4A 3AP7A 2V4AA 1QU0A 1DF0A 1OBNA 2VVDA 1UYXA 3I7DA 3LA2A 1ULGA 3MW2A 4Y1XA 1S2BA 1QEXA 2EXKA 1UXZA 4GKYA 5FPZA 1PZ7A 1ZYBA 4I02A 1I9RA 4HK8A 3M1HA 1LR5A 1S0DA 1LNSA 2WL1A 1LTEA 4WVMB 3VD9A 2C5DA 2GSYA 2JG8B 3A22A 4Q29A 3RWKX 3Q8EA 1QNYA 3TWIA 5FPBA 3VD4A 4LKDA 1QJX2 1YC61 2HKXA 1UX6A 3WQ7A 5DABA 5LA0A 1GR3A 3UGGA 1VIWB 1ZA4A 1QQP1 1VRH2 4LR4A 4CEYA 4C91A 5JXJA 1UYZA 2Q8EA 1RVF3 1RUH1 1IOAA 3V0BA 4CP9A 1RUH3 4ZU5A 2CHHA 1NA1C 3E5UA 1ZRCA 1N1TA 3I2KA 3POWA 1POQA 3KWVA 4XBQA 3TRSB 3VL8A 3BIEA 1JYXA 1HQWA 2R062 3AB0A 2C26A 2Z42A 5LW9A 4LO8A 4PJYA 5GLTA 1H2LA 1NLSA 5FO8B 4E4SA 5CADA 4HPKA 4ZHNA 5F5CA 1H9PA 3O14A 1F4AA 2VL4A 4JVAA 5FYMA 3VZLA 1IPJA 3MO4A 2HWE2 3ME2A 3VBOB 4R8HA 3WF2A 1NKGA 5LASA 1CVNA 1TE1B 3D0JA 3E5XA 2CDPA 5FYIA 1U0AA 1KXGA 5D1IA 5AVPA 2BWCA 4K6BA 4AI2A 3N7JA 1AR73 5I8SA 3UNPA 2YPJA 5GZFA 2XLAA 1ZRFA 1POV1 1CQ9A 1LOCA 5CKMA 5F5IA 1POV3 3OBTA 4LULA 1N1YA 1AR81 1NCQA 1US2A 4IEXA 1AR83 3LF7A 1NE4A 3CKHA 5CFCC 4C8DA 1W6NB 1YJLA 3ACHA 1ZBE2 4WZFA 4YW2A 3ALQA 2XUMA 4XABA 4EYUA 4XUTA 4JKLA 4B4PA 3MIDA 4Q4X1 1AL0G 2FCVA 4Q4X3 4Q8LA 3K4ZA 4HFSA 3ZVXA 1S0EA 1Y9MA 3ABZA 4E4HA 4YSFA 2P3YA 3HNBM 3O1RA 3OD4A 2D3PA 1WCSA 1RHI1 2VC9A 3HBZA 1RHI3 1XE0A 2A75A 2Q4SA 3U0ZA 5L19A 4UOJA 1PIV1 2IXHA 2XB6C 2FBEA 1AF9A 1PX4A 3HR9A 3WHUA 4A2UA 1KJLA 1PIV3 3AMQA 5FZ8A 1OOPB 1Z7S3 3JQWA 3WNXA 1RUI1 5AFEA 1HQLA 2WAOA 5FJHA 4AFDA 5IYYA 4QGLA 3FFQA 4ZKTB 3AVRA 5CVRA 4WVMA 2O14A 2JG8A 2QQIA 4WVZA 2Y8KA 2G19A 4GH4C 1CZTA 2GMEA 5F5QA 1YNAA 2CGOA 4S2GA 2G9FA 4XILA 1PO22 3WDVA 5C3SA 1LAJA 2K0GA 4AL9A 2F4LA 2OKXA 2HWF1 5JR2A 2VOVA 2HWF3 2GMMA 4FPCA 1UZWA 4N53A 4JHZA 2JDMA 3LEKA 5I0DA 5BNOC 2H6BA 2W92A 3B5LB 4DOUA 2P37A 3BI3A 5A70A 1HRI2 5K0UB 5IW0A 4PT6A 1XJAA 3W9AA 3IPVB 1ULFA 2C9KA 5LRRA 2E7QA 2R042 2EIDA 5FLHA 5C9AC 3EHKA 2GN3A 4YYOA 1NLQA 3C7HA 3I2HA 4MHUA 2VNGA 3R4DB 3PIGA 3AFGA 2P3IA 2YPDA 3FHQA 4Q4W3 1O59A 4YVWB 1XNBA 3AYDA 1RJ8A 1YQ8A 4D6QA 1A8MA 1W03A 3MIFA 3VBOA 4RSUA 4UW6A 5KXBA 4Z92B 1E57A 1RTVA 2VZQA 3ZN4A 3AM2A 3ZYBA 1TME1 5FBJA 4Q4Y3 2ZBJA 4EWDA 5JWPA 2XVGA 1TME3 2BU9A 3LD8A 4KWKA 1UOJA 2Y0IA 4JQRA 3I2IA 1GBGA 1ND2B 1SZBA 2VTXA 1WCUA 3AP4A 1VBB1 4YVSA 2BQPA 3OB8A 2R0HA 3N9QA 3W5NA 3VBRC 1VBB3 2X09A 1NLRA 1EPZA 1W99A 2J42A 2JIJA 3OCPA 4FQ4A 2XR4A 3A21A 5A6XA 4UFKA 2UWBA 2WT2A 1OFSA 2PLV2 4K1ZA 5FMDA 1BVVA 3JU9A 3ZN6B 3NSTA 3V0AA 4XFBA 2VUAA 3TNQA 5A33B 5EZWA 3RZMA 1LU2A 2VZUA 1MVQA 2YC2A 1S0IA 1GP6A 3NNMA 4E2QA 5DXDA 4YGDA 3ZLIA 4CCDA 2J22A 1S0BA 1PX3A 3WP5A 3H7JA 3WNMA 3P3NA 4K8FA 1EUTA 4BQ4A 4JGYB 4CCJA 5JOYA 1EV11 3WZ1A 2XXZA 3CHXA 1EV13 5CISA 1WD3A 4IEYA 1VPHA 2D43A 1X50A 3VHPA 2IFWA 4NO4A 3IDEA 1OOPA 2TUNA 4ZU7A 1AXZA 1RUG2 4MGKE 4RR3C 3ZDVA 2J1TA 1TZOA 1IG0A 3ETPA 1SDDB 2XJTA 5JI7A 2E33A 1RXGA 4C0BA 2VGDA 2NN8A 1JYVA 3RPQA 3ROUA 3SISA 1UXXX 1CAXB 5FRAA 4AQTA 5FTTC 3JBG2 1UZZA 3M3OA 3N35A 4QXBA 5A3WA 3TN92 1L3JA 1FNYA 3AP5A 4HETA 4DXTA 4GMP0 3NAPA 3POGA 1QH6A 4FXGB 3E1F1 5JLVA 5FXWA 1PVC2 1OF4A 2JDZA 2DUOA 4BA6A 5I8TA 2D5HA 2PHFA 5FZKA 2Y26A 4A6OA 5KHJA 4QX7A 3JB4C 3UGFA 1IPSA 1MEC1 2B5HA 1KITA 2HBUA 4FAHA 2ZEZA 3PUQA 1PO11 1GP5A 4LE3A 4JKKA 1PO13 2QDNA 1W6PB 4S2HA 3UJQA 4WM8B 5K0UA 4PIZA 5FJKA 1OC1A 1JOJA 3IPVA 3AC0A 4YFZA 1DYKA 1IS5A 2WLQA 3C7GA 4OI1A 4URAA 1ENRA 1RGSA 3CO2A 3TNPB 2ENRA 1Q8OA 2W39A 1UMIA 2HWB1 3OD0A 1OLME 4XURA 4YVWA 5IK5A 4XBNA 2XQXA 2HWB3 4RFRB 5GZDA 3K2OA 1BXHA 1JI6A 1ZZ6A 1G6NA 4HG6B 4QX2A 1YLLA 5CYYA 3HJRA 1V00A 1I5PA 1IS4A 1ULCA 4JGZC 4L8QA 3WOGA 3H8RA 3I97A 4G9SB 1ND2A 2ZGNA 4A4AA 2F4PA 1YI7A 1J83A 1LOBA 2E26A 3VHNA 4DZGA 1CPNA 1BKZA 1JXNA 4AVSA 5ABJC 3BIWE 1Y9GA 1UW8A 3POJA 1S0JA 3LOBA 3VBSA 4ZONA 1PNGA 3GXUA 2JICA 4LKSA 1UIKA 4D69A 2GH8A 1PGW2 1MZ6A 2DVDA 2ZAAA 2NP0A 1B35C 1ZZ8A 4FPHA 1GNHA 4R9AA 2UWCA 4Y22B 3ZN6A 4AVCA 1VP6A 3N9LA 3LA3A 4KG8A 3UL2A 4TZDA 1VBA3 5A33A 1YQCA 3GHNA 2ZMLA 2DURA 1W9FA 1W8OA 4N7UA 5C4WB 3VDDB 1IS6A 2YB7A 2EIEA 4ASKA 1TG7A 3VN4A 2WNUC 4JRAA 1V9U2 1F8VA 2C0ZA 4XDOA 4FPLA 4NVPA 3HWJA 1UWWA 5JPNB 4N9HA 1O5LA 3DYOA 4ES9A 1LESA 3NW4A 2Y34A 2RS51 4I01A 3VBHB 4IERA 1PGL2 1QMJA 1CAXA 2RS53 2ZHMA 1WMDA 3ACGA 4AFAA 3OGSA 1FPN3 4XUQA 2ZGKA 4LT5A 2TNFA 2W3JA 5FZ3A 1DU3D 1HN1A 3ZKUA 5C71A 3I54A 2ARBA 4CUAA 2R16A 4YG0A 5CBLA 2W94A 1UIJA 1SPPA 1GWKA 2BNOA 2NLRA 4MO3M 4XYXA 5C7GA 1OQDA 4XQ4A 5KBFA 3HT2A 4QGNA 4M3CB 4CUBA 3KV5A 1A34A 3KV6A 2ZGSA 4Q0VA 5FY7A 1PMHX 4O65A 1AL22 2JX9A 1W6PA 2QZ3A 1UPIA 4AZZA 4WM8A 4ZS2A 3WDWA 2JXAA 3S57A 3FZ3A 2WUHA 1W39A 4IE4A 1ND3C 4FFFA 4QX0A 4AHXA 2HWC2 1NOVA 3U4SA 1LOFC 3PL0A 3RRDA 2C6SA 1HXS2 4MOAA 5DDJ3 1COV2 1VBC2 3KV4A 3B02A 3CIHA 2PXJA 1SCRA 4W50A 4PQ9A 5BNPC 4CZSA 1GNZA 2XWBB 1UYYA 3NJYA 3ACIA 3WD5A 1REEA 2OT7A 4BH9A 3OUIA 3ZYPA 3ZDSA 2DCJA 4U36A 4Y1VA 4FAGA 1O3SA 3BTYA 3AMNA 1XNAA 4QQHA 3URFA 3BODA 4FP3A 2R6QA 1VAVA 2OQ6A 5JR7B 1UF2C 1JZ6A 1VMFA 1US3A 1BCXA 2HEYF 2ZGPA 4AGVA 4FFHA 4AVTA 3CL1A 3QLQA 4H14A 4RGAA 2WNVC 1AYN2 3USSA 4M01A 5DMYA 4MGIE 2ZA9A 1GFF2 5I0SA 4XOGA 2VCMA 3I3EA 4B8EA 1W9WA 3N7MA 3OBAA 3QCWA 4Y22A 1GUIA 1LGCA 2VECA 4E2GA 1MR5A 4N7IA 1E5RA 2WO1A 3LE0A 4BQ5A 5K9YA 4UFJA 1RUNA 4NJ4A 5DZGA 2FDJA 4AAXA 4AW7A 5C4WA 2ZHLA 2K46A 1NUKA 4L0PA 4XJAA 1C4RA 1RITA 2B8MA 2HH9A 2DUQA 1YEWA 2VNVA 4LITA 4SLIA 4WV8A 2VVEA 2BBVA 3PTRB 4AEKA 2WR9A 3PVNA 4AXOA 2ZEYA 3S5AA 4DPNA 1Q56A 4COVA 1NA1B 2DU0A 4FPFA 5I93A 1C8NA 1W90A 2B39A 4ZZ8A 2VCAA 4Y26A 5FPUA 2VCCA 2Y0OA 3VBHA 1QJU3 1QJY1 1OLRA 2ZGLA 1PM4A 4O7XA 1PNFA 1QJY3 4IV1B 4CU9A 1V6JA 3HIFA 5C8CC 4Q1RA 3B7MA 4Y1YA 1K42A 3L2YA 5DAVA 5DG2A 3O1TA 1GOFA 4CPBA 4XACA 5IATA 1UNBA 1H2NA 5T5JA 2QQNA 1DIWA 1LKNA 5C3RA 4PIXA 4ASLA 3S6PA 3BUCA 1JH5A 4ZXKA 3R6SA 4PLMA 3PHMA 4M3CA 3KV9A 3PVEA 2ZMNA 5FBZA 2JEMA 5D8AC 2GNBA 5DN2A 4R52A 2ZEWA 3LGRA 5JVVA 4DNYA 4DUXA 1J1LA 3M70A 4W6YA 5FV3A 4JRLA 1RVF2 1CAWB 5FFOC 2RVAA 2YC4A 3PUAA 4MXVA 1RUH2 1SEFA 1SLTA 1G9CA 1TNFA 3NJZA 3PUHA 1W8NA 3DN7A 5FMOL 2DU1A 4KQ7A 4HT1T 4YZ2A 3T2PA 5CFCB 5FO9B 5I91A 1SBFA 4ZS3A 5JDBA 1LHOA 4IESA 2J1EA 5K7PA 1OT5A 2WAAA 4FO9A 1RUC3 1QOOA 4QPYA 3ACLA 2YBPA 3EQEA 5HCAA 1QOTA 4Q5OA 4DXRA 2LROA 3BPSA 1X8EA 1W3VA 3A4UA 4AWDA 1A78A 2OUJA 4FPJA 2KR2A 4GIQA 4XAAA 4XC9A 4QDSA 5FY0A 5ACA3 3ZR5A 3KB5A 2QQVA 3J9SA 1S2EA 5DG1A 4A3XA 2VTFA 5IWFA 1AR72 4AI1A 2ZX1A 4AE2A 1FMD1 2RJLA 1YRZA 4PDWC 3F2ZA 3UT0A 3WT3A 4ATFA 4BOWA 1FMD3 2W91A 1JBCA 1AXYA 5HCBA 2W2IA 1F4HA 3KHCA 4Q27A 1VR3A 2ZPXA 3APBA 3VL9A 5F7UA 1AR82 3DL3A 1LGBA 3FLTA 4GKXA 3GF6A 4L9BA 4NHMA 2CSGA 4GH4B 4HVQA 1ODMA 2RJKA 3Q9OA 3DYMA 1C8M1 4GB33 1JS9A 2YBKA 5DPNA 1VMHA 2IWGB 5C33A 1C8M3 1XXNA 1RUJ3 1VE0A 3DECA 2AEYA 1BVP1 2OUHA 1LEDA 2BGCA 2XHKA 3A0NA 4Q4X2 4S2DA 3VZJA 3WF1A 4B7EA 3J8F1 2O0OA 3I49A 1YWKA 3J8F3 1NCRB 1YQ5A 1NA1A 4FPEA 4LPLA 3ZYIB 4BK4A 2Q0AA 4AEDC 5BNOB 5GM0A 2OZ6A 5A7PA 2JKBA 3TEZA 3CBNA 2PHUA 1RHI2 2ZGOA 4LK6A 1CX4A 4MH0E 4OUSA 5C8WA 2XJVA 4XF0A 1W9TA 3QBQA 1PIV2 2IVJA 4IV1A 1Z7S2 2DCZA 1WWYA 4JDMA 3TYJA 3BOPA 1AR91 1IG3A 3IBMA 3B69A 1ZRDA 2UY8A 2SLIA 5A3LA 2HWD3 5FZEA 1W2UA 3Q8AA 1H8VA 5CU1A 1O91A 2HYKA 1FOD1 1GMMA 2XQRA 3VD3A 5FYUA 3UESA 1KS5A 3VD7A 2VVFA 5FZBA 2DTWA 1YUDA 2HWF2 3MF9A 4M0NA 2QQKA 3THPA 1CAWA 1LGNA 5TSWA 3VBRB 3WUDA 2J1UA 2BVVA 2NYYA 4DRVA 4EZ4A 2YZ4A 4FTSA 4CDQB 3BGAA 4O9GA 3SMHA 5CFCA 5JZGB 2EICA 3ES1A 2PHDA 2X05A 3IMMA 3D0SA 5I0TA 4LHSA 3WG4A 1D2QA 3Q8BA 5IAXA 4K1YA 4WM7C 4E8CA 3ELNA 3C7OA 4E4DX 4CP2A 1HB3A 4Q4W2 4CDUB 1CZSA 4CUCA 2PAKA 4XHBA 1W05A 2D6PA 3J4UH 3LSEA 3NNLA 2BV4A 4HMZA 3T2TA 4E9KA 1LCLA 4EQVA 4Q4Y2 4CCEA 1AR61 1X33A 1TME2 2O1QA 4XZUG 2CL2A 1AR63 2VO5A 2FQPA 2OYZA 3WX5A 2KD7A 2B46X 4LQRA 2J7MA 4QPGA 1H6XA 3B01A 4OHZA 3EMRA 5T3NA 1VBB2 3CMGA 2Z5WA 1QDOA 2ADDA 2VUCA 1IGOA 4K21A 3KF5A 3HPNA 4GH4A 4JAAA 1NXMA 2JDAA 2PHTA 4FFGA 4CEWB 1DCSA 2YU2A 3LAGA 3P3PA 1BMV1 2DUPA 2C1FA 2VXJA 3J7MA 5FZ6A 3ZYGA 5JSOA 4BDVB 5A7WB 4I0AA 3PVOA 2WFF2 2KA3A 2WWSA 3FBYA 5KC6A 1TQ5A 3IAPA 3KS7A 3VZNA 1URXA 3GBGA 4RQPC 1H8TC 3JZVA 5FO7B 1VAMA 2JB4A 4IEZA 1NCRA 3HBKA 1BK1A 2D40A 5B4XA 5BNOA 4JX0A 5FKCA 2XGXA 3K3NA 1GQGA 3OPWA 2AEZA 2WRAA 2QQOA 3KT7A 1EV12 5J09A 5F8PA 1CN1A 1VBD1 2DDUA 4URTA 3VKOA 4OHVA 5KHIA 3RZKA 1V6MA 4JKMA 1RC6A 1YFXA 4RN5A 2VQAA 4YNIA 2JD9A 1OLMA 5H9QA 4KG0A 3RJ2X 1GP4A 4DINB 5A3UA 5GLWA 1REFA 5T5PA 5FYZA 1D7PM 3PJQA 4K20A 3HNMA 1WMEA 5A80A 3T4HB 4IL7A 4TWTA 2P2KA 4J25A 1JMUB 3LOIA 1AUYA 1UN1A 2VW1A 2RHPA 1REDA 2RM22 4AI8A 3KGZA 4I0WB 4XF1A 2CNAA 5FPLA 5ABJB 2VZRA 3FN9A 3ON7A 1OVPA 2VCBA 4QHOA 5F32A 4CDQA 4DXSA 5EXOA 2ZX3A 1PO12 5JZGA 2D6MA 1WCDJ 1DBNA 3AJZA 3J26N 4HKWA 4TLGA 2PA7A 1B35B 4B4RA 3DEMA 5FZ1A 2JE9A 3T0AA 2ZHNA 4OCTA 3AFKA 4EN7B 5HI0A 1LODA 4IEWA 5FZGA 1N3OA 3SITA 1J1TA 1LOEA 4LBQD 4J1WA 4CDUA 1DGRA 2AACA 3AYCA 3HN3A 5ANQA 1R091 1W8FA 3WQBA 3WXPA 2HWB2 1R093 1XU1A 4EV0A 2IC1A 2WYSA 3AKRA 5F6KA 4LOTA 4JZRA 5FZIA 2X5IB 1WUVA 1UZ0A 2WNUB 4YG6A 1SDWA 1VJ2A 2ET1A 4CU6A 2ZABA 4QPIC 1H4HA 2PAMA 2WZ8A 3NNFA 2TEPA 1CONA 3MLLA 2WDBA 4H3WA 5FWEA 4V2VA 5LEJA 3R05A 5LA9A 2C9AA 1W9YA 1DQ5A 2QKDA 3M3IA 3MEPA 4FPOB 2XBO1 1S0GA 3KQ4B 3VBFC 4XW3A 2GNTA 1SFYA 3B9IA 3ZFFC 1QXRA 1UL9A 3OF1A 1MS0A 4CEWA 1T6BX 2BGPA 5LBBA 5J98B 4ONUA 5JMOA 3ZIWA 5A7WA 4XJ9A 1VBA2 1DGWX 4J6GA 3LZZA 4EWAA 4GJZA 1FX5A 2YDEA 1Z78A 4UAPA 4XFGA 3O5SA 1QQP3 4Y5TA 1DYOA 4FI9A 2PTMA 3PMSA 1SLAA 1JZ2A 3ILFA 1C5IA 3CJIC 1MQTC 2QUOA 3WNKA 1GLHA 1WW4A 3HMYA 1FNZA 5A32B 5A1LA 3DV8A 4AFMA 5FCCA 4QT6A 1U5YA 1XNCA 1AXKA 2Y6KA 5FY8A 3USUB 3BTZA 4META 1OA3A 3LDBA 4LIVA 5F2WA 5LBCA 2WSUA 1RYYA 1JOPA 2YROA 5A3MA 3HT1A 3JUUA 2W68A 2XJRA 4XUPA 1HIXA 1UY0A 2RS52 1K5MB 2QQLA 2WN3A 1FPN2 2VH9A 3POIA 4KGGA 4LMFA 4EN9B 1WLTA 3DPRB 4IE5A 4K3UA 2BP6A 1UY2A 5FQ0A 1ULPA 2H0VA 5F3IA 3N7LA 3ZMNA 3K77A 1DQ1A 2WZEA 1YIFA 4QXKA 2BERA 3IKWA 1SLLA 3E6DA 2JKXA 4NE9A 5LK5A 2WNVB 2R7EB 2DBIA 1UKGA 3PVBB 3LIGA 3THTA 1BEV1 1H2MA 4QU1A 4R4ZA 1B35A 1BEV3 1DFQA 2RG4A 3IDCB 5A1FA 1TNRA 4CTEA 4FBFA 3W21A 3ZYFA 4JDOA 2BRTA 2GN7A 2W9XA 2UY9A 1LENA 5DDJ2 4C1WA 1EUUA 3JQXA 4OHXA 3VZKA 2A3WA 4HONA 5AC91 4NUBA 5FZ9A 4ZPIA 1QXJA 5AC93 2MEV1 4MYEA 2OZJA 5FZLA 2X5IA 3GDBA 2MEV3 3SKVA 1CZVA 3MW4A 4IXLA 4LUKA 3SNMA 5JXIA 1C5HA 1BZWA 3S7IA 1PM7A 1AJOA 4YZ5A 3AX4A 4TYSA 4P14A 2OVUA 5FXXA 4A44A 3I3QA 2CV6A 2YV8A 5FZHA 4YZ1A 1RUI3 4QB6A 1O3RA 4IEPA 1R1A1 3NNGA 1R1A3 1WLDA 4P9JA 2WA3A 3FLPA 2R32A 3HNYM 1ZZ9A 5C8CB 5GJ6A 2R071 2OIIA 5CFDC 5JXHA 4MGQA 3WV6A 4QGMA 4EJRA 1CAVB 2R073 3M8LA 4FPGA 1S0CA 2NM1A 1WKYA 1DLCA 4QD2A 3VUOA 5JOZA 5EIYB 2P4EA 4XFHA 4COUA 3OY8B 5J36A 3NV3A 1JZ4A 3WVJA 2WSVA 2W52A 2WN2A 1A6CA 4A42A 4IV3C 5D8AB 1I1EA 4OUMA 4YM0A 2QQWA 1WGPA 5A32A 1XU2A 1QF3A 3WG3A 5LBFA 3HEIA 4C1XA 4CU8A 2BWAA 4ASMB 3USUA 3KF3A 5FWJA 3HD8B 5F3GA 5EV7A 1X36A 5IK7A 5A1AA 2RS31 1K45A 2RS33 5F5AA 4N43C 4IDZA 3AMPA 1QJU2 5F6LB 2YMZA 3C3VA 5IJRA 3H8XA 1K5MA 1XOYA 1QJY2 4YARA 4FT8A 3RS6A 3OTFA 1D0GA 3DPRA 1D4VB 3ZYHA 3OSDA 3HQUA 2ZXQA 4ZY9A 1LEMA 4W65A 1DGLA 3VKLA 2WBKA 3M4FA 4A6SA 3FL7A 4AHZA 5JPMB 3BKZA 2WC2A 3LEMA 1BK0A 4YZ4A 5C6CA 4XFCA 4QDRA 2J1SA 5FZ0A 2ERFA 4PDWB 1W6NA 1B09A 4TSVA 2I2SA 2ADEA 2AR6A 3GJBA 3MV01 3RI9A 5LA2A 4R9DA 2QCSB 1OI6A 2D3RA 4GMP1 4CU7A 2XPJA 2P6CA 3K4AA 1YQ2A 3MIGA 2YUEA 2ZGQA 1RUC2 3SHRA 2XJUA 4XDQA 1TMF1 2BOJA 4QXCA 5EJ1B 1TMF3 5BNQA 1IS3A 4Z82A 1UAIA 3B9CA 3E6BA 4UFIA 3ENRA 1YJKA 5LEKA 3H1MA 2ZX0A 2Y33A 1SACA 2VBPA 3VDCA 5A6QA 4Y3OA 5ACA2 5CG8A 3K3OA 2Y64A 3VGIA 2D6LX 3KD4A 3POYA 3WP4A 5KXCA 1AHSA 4P00B 1GNYA 3AKPA 4TXWA 1HV0A 3PURA 2WFPA 1BLZA 2Y6GA 4XFIA 2EVXA 4CDWC 5C8CA 2CAVA 1FMD2 3MPPG 4BQWA 2E63A 1DZQA 2XDVA 3MYXA 4BISA 1CAVA 3MICA 3FLRA 4MX3A 4LBOA 1UU5A 5CG9A 4ATEA 2W1WA 2ZGMA 4QB2A 4QKDA 1PMIA 2ZKNA 3OY8A 3ZSKA 4M4RA 5JIAA 1KRIA 4GB32 4GA9A 3RNSA 1MEC3 2VXRA 1C8M2 5GKAC 5D8AA 5T5OA 1RUJ2 5LZ6A 2ES3A 1WW7A 1X8MA 4PHZA 4P5HA 2DWRA 1UY4A 1LB2A 4YRDA 3J8F2 3LIHA 3EXUA 3AZVA 4MSVA 2W08A 1ZM1A 3S7EA 4GQ7A 3AJYA 2RDQA 1RMU1 3ZXKA 3UETA 4DUWA 1RMU3 1UO9A 1ULOA 3O7OA 4R9BA 4AYUA 3KQRA 3ZIXA 3LQCA 3N7KA 4P02B 3C7EA 1T6GC 4LOSA 5JMCA 4KNCA 4NRPA 3SH4A 4D6RA 2DF7A 2AREA 2HWD2 2PAEA 3DGTA 4KI5M 4O9EA 4YZ3A 5KHHA 3ZFEC 2Z69A 4E4ZA 3MLKA 2R49A 3KHBA 3O1OA 2P6HA 3PDQA 3BALA 1NE6A 3LPGA 1J58A 5FZ7A 1QHDA 5FZ4A 4A3ZA 2Q5TA 4YW7A 1W2OA 2V09A 2WINB 1R081 4PDWA 4LKEA 3ZFGB 1R083 3ATGA 3GNEA 1MZFA 4OFGA 5FZCA 1D2SA 3FFZA 2XONA 1BQPA 2ZJCA 4RFT0 2A71A 3O1VA 4LKFA 2RDSA 1J84A 1OA4A 4WVVA 1PZ8A 2WKKA 1SBEA 2XJPA 2WA4A 4UI9L 1OPOA 3ORJA 4QQ2A 3BB6A 3QOPA 4JGYA 1OQEA 4V1PA 4YGCA 1OSGA 3WUCA 1S4CA 5FMOS 2BNMA 1H8TB 2DVBA 4CXXA 1I3HA 4EROA 5J1XA 3ZR6A 1FYUA 5LBEA 3HQXA 1X9PA 3OBZA 3TOJA 3VBUB 4COZA 4YM3A 2E9QA 2WZR1 4BXFA 2WZR3 4HSLA 4XQDA 2Q1ZB 1AR62 3SC7X 2ATFA 4R9CA 1JZ5A 1JTZX 2ZEXA 1O3TA 3D5OA 4LO4B 1H30A 4P9IA 3ZYJB 3N9NA 5J96B 3NKGA 3OUJA 1U12A 3N9PA 4X8PA 1IQAA 1Q3EA 3RZLA 1O6UA 1VAKA 2YGMA 3MHZA 1SG3A 1Y3TA 4AR2A 4XUOA 3E6CC 4YM1A 2I45A 3EO6A 3I2JA 2JDYA 3D82A 2VTXJ 4O61A 4XF4A 5IT6A 1NY71 3I2FA 3FJSA 2IUWA 4WVWA 4DEVA 1WW6A 3LB9A 5IUQA 5HV0A 5LRSA 3CEWA 4M00A 1VALA 3N36A 3U37A 4V2WA 3WW4A 1VLNA 2ZHKA 4FVVA 4B3NA 5T50A 4PF5A 2JG8C 5C3PA 2VOTA 1W0NA 1XB9A 3MPBA 3NWKA 4B29A 2ZOEB 2NMOA 1ZA7A 4GXLA 2VZPA 4F7ZA 3O1PA 1DLLA 2RDRA 3BCWA 2ZX2A 3L9JT 4XIOA 5HPOA 2A6VA 2YHJA 2CYFA 3NRUA 3SKJE 4N53C 3RYKA 3ZXAC 1VB4A 1CJPA 1GQHA 5FZOB 2E51A 4K40A 5DUUA 5CKNA 3SH5A 1WZXA 1WCKA 4ITCA 5JCTA 5KC5A 3KT1A 2NMNA 1QH7A 3FE5A 2PHRA 2PHLA 2R0FA 2ET7A 4XDPA 1Z0HA 4OZXA 1G9AA 4NIHA 1Y9QA 3ST7A 1OH3A 2A3YA 2YYOA 1XE7A 3C8XA 2D97A 3ZFGA 4LJHA 1W3XA 4OQ9A 3LEIA 3RDIA 3ASIA 4NIIA 1HN0A 1I5ZA 2E32A 3AZXA 4JTNA 3SXWA 1J3QA 3M7AA 5L9VA 3ZXDA 3E97A 3ZFFB 5T5LA 4E27A 1GSLA 1XYPA 2E31A 3LPFA 3IZOA 3VDDA 3SEPA 5F3CA 5IVEA 4RHV1 2NZ9A 4RHV3 2Y6HA 1XYNA 4DRRA 2W0XA 4YVSC 2JG9C 2OX0A 4BIFA 2VW2A 1H8TA 2ARAA 1LHUA 3SCFA 1PO21 1R092 1MQTB 2LRPA 4MXWB 3VBUA 3J7HA 1HDKA 1HKDA 2PELA 3KZ4C 4Y4RA 4JV4A 4XCAA 3RYRA 3BYWA 4HXCA 1ZBA1 5EHDA 2XJQA 2EIGA 1ZBA3 1W2TA 2JENA 3QH6A 5JIUA 2B42B 1UD1A 3WDXA 3ES4A 4LEJA 2GC3A 1GWMA 4BQYA 4DIQA 1HRI1 4XEZA 1A8DA 4INDA 4PBOA 2FDIA 2VOWA 2LTNA 4M0HA 4W4ZA 3SLIA 1H2KA 4HZFA 4QXHA 1ZRRA 2HBTA 2W47A 1H9WA 1W06A 5FKBA 4RYDA 5FLJA 4BM8A 4AVAA 4CCCA 3HAGA 4EN6B 3B93A 4CYDA 1QQP2 2VD7A 3OPZA 5IFTA 4D7YA 1Y43B 3AXEA 1MVEA 3J7NA 4Q2FA 2CGPA 4LO5B 3NAPC 4CXWA 2GNMA 2R1DA 1GWLA 3T3YA 5IFPA 1O4ZA 4OHWA 4RS5C 4K8RB 5FP3A 1RINA 1MS8A 3TAYA 1Q43A 2EF6A 3PUIA 5EP9A 5L7OC 5LY1A 1NZIA 1L7LA 1MS3A 2XKPA 5FZOA 5F9TA 4I3PA 4QQLA 4BXSV 2X8KA 1GOHA 1QOSA 3FC0A 3POFA 2PLV1 3ZXGA 1UZYA 4CEWC 2VNRA 5K0UC 2PLV3 3LDRA 3W59A 3GJAA 1DGRN 5A7SA 3WCSA 4RGKA 5EWSA 1GYKA 2A70A 2JDKA 2VBDA 3BPZA 5J48A 4P5YA 4TLFA 5M0TA 1U5IA 4XVHA 3TEWA 1HB4A 4L99A 1GQPA 2WJSA 4IGQA 4QKFA 2EA7A 1W28A 4I3GA 1FV2A 2DCKA 1UOGA 1UU6A 2SBAA 5A3NA 3ZSLA 1JN2P 2PQSA 4PIYA 2ZKLA 5CNAA 2GC1A 5EPAA 1C1LA 1AX2A 1LECA 1BEV2 4EE2A 5C5UA 1LJ7A 3IMNA 3LKJA 2Q30A 5JSPA 4HVOA 3TEXA 3WQ0A 3G7DA 3N4MA 2A6WA 2ZACA 4ET7A 3I4IA 4LE4A 3VBSC 2RMU1 3TN91 3VV1A 2RMU3 4CCNA 3UJOA 1UCXA 4IV3B 2G9ZA 5AC92 4MXWA 2PMWB 4XFAA 1PVC1 2MEV2 2QQJA 3AP6A 1HW5A 2Q8CA 1HV1A 4P9LA 4A41A 1C1FA 3ZM8A 3GZUC 2XL9A 1S0FA 3I59B 3J7LA 3OGVA 4RA0A 5C9AB 3M2MA 4FTEA 1RUI2 3L2HA 1AR93 4N43B 5FMBA 1R1A2 1W6QB 1YYNA 3MF6A 1LHVA 2D5FA 2H0BA 3VD5A 1UY1A 2VMGA 2ZGTA 3ECQA 1NQDA 3RGBA 1JZ7A 1FOD3 1M4WA 2R072 4HANA 1ZNPA 3WW1A 2JDUA 1JZ8A 3U1XA 2ETEA 3IDAA 3OGJA 3ZXLA 3ZPOA 3RVHA 2AZ5A 2C24A 1JW6A 5I0RA 4GALA 2HEVF 2VULA 3VDBA 1IQDC 1RUD1 1RUD3 1YIPA 1D0HA 1SLIA 4XJZA 3I3MA 5JOXA 3EB7A 1NAEA 5FY9A 5BNNC 3AYAA 4YFWA 4ORFA 1Y7BA 5E88A 4OVEA 3KLSA 2KXLA 1EP0A 1H1MA 3AMHA 2CWMA 3T4VA 3ITQA 4BMEA 5C3OA 5FYTA 1BBT1 3N9MA 1PGW1 2RE9A 1HB2A 4MZUA 4AFBA 1BBT3 1WCQA 4R4XA 3WG1A 5LB6A 4AVVA 2Z79A 1JZ3A 4QHBA 4HKLA 3KMHA 1HRV1 2RR11 5FXZA 2DFCA 4FTBA 1HRV3 2RR13 3A23A 4UW4A 2V5DA 2X53S 4NPMA 5DAQA 2PYTA 4NAOA 4QU2A 3T1MA 3RJRA 3M3EA 2A6ZA 1ACCA 4RR3B 4N8MA 3R4SA 2LUWA 3NJXA 4BE3A 2BZDA 3GZEA 3PMEA 1V9U1 5JSRA 4CDWB 1V70A 1JYIA 4SBVA 4Z07A 4Z2AA 4YW6A 4DY3A 1JHNA 3U78A 1OH4A 1F9KA 2UU8A 2VM9A 2IXJA 4D7TA 5A6YA 4EWEA 4OLLA 4OULA 3VZMA 3V64A 1XQNA 3C2UA 2D6KA 2ZGUA 3OBRA 1DGWA 4YG3A 3H7YA 1RUF1 2VE1A 4IV3A 1JYWA 2WLPA 2DTYA 1RUF3 2UURA 5FUPA 4BZ4A 1TMF2 2V73A 3UKNA 3DCQA 2ZMKA 2IVIB 2GP3A 4OYUA 4D6SA 5DQ0A 5K4LA 4AEMA 2W46A 3MBWA 1DP0A 5J7MA 5C4WC 3PNAA 3I59A 2VOXA 4XMAA 4AI9A 1VBD3 2P17A 2P5BA 3H3ZA 1I6XA 2WWJA 5A7OA 5C9AA 2AC1A 4CVUA 4XF3A 4EN0A 3FMGA 4N43A 2WO2A 1W6QA 2ZS6B 4UFHA 2YFZA 2HWC1 4D8MA 2WO3A 3V0BB 3ZPYA 4CP9B 1ODNA 4JQTA 1MS9A 1HXS1 4MV2A 1PK6C 2VY0A 3NV2A 4NROA 1WLWA 1COV1 5DUXA 1RL3A 1VBC1 4JGZB 1EAH1 2DVFA 3EJKA 2EAAA 1COV3 4OI4A 1VBC3 5ERLA 5IVYA 1EAH3 2AGSA 5HBAA 2E7TA 3ZFEB 4F83A 4QMAA 4HN1A 1F31A 4GWIA 3VBHC 3OGRA 4BQ2A 4QM8A 1QNWA 2OQ7A 4HBNA 4HPKB 4M3CF 3VBRA 4Q4V1 1MEC2 1X82A 2XG3A 1G86A 3I2OA 5CA6A 1ZREA 3PIJA 4Q4V3 3UV9A 2VW0A 4LBJA 1CR7A 5FZAA 5IVVA 1V6LA 1W8HA 2A6YA 4CP0A 3H50A 4PI0A 2B9VA 2ZTNA 3EYPA 4BQ3A 4NAMA 4XIKA 5HCFA 3RZZA 4BMBA 3WY6A 3OPTA 4LNVA 1PZ9A 1YQ6A 4KWJA 1ASJ1 5GZEA 1OKOA 1ASJ3 4AHWA 3CZUA 3JD71 3JD73 2BW8A 2ZCWA 4H55A 1WA6X 3KCCA 2ID4A 1W8UA 1PHMA 2CWSA 4ISRA 5FOJB 5FK8A 5FXVA 4JTOA 4LHNA 3P1IA 2XVKA 1R1ZA 2GNDA 4RR3A 3SCHA 2YBSA 3CF6E 5T55A 4AQSA 3NL1A 1H6YA 1W2AX 3IT8A 3GHMA 3WHTA 2Q1MA 4BLIA 1LHWA 4CDWA 2XBO3 4KU8A 3HQRA 4NIDA 1OXCA 4X6RB 1R082 1JHJA 5DAWA 2PQQA 3NNJA 4CPBD 2ZZJA 3H3LA 3WW3A 4AQ6A 4BQ1A 2Q1FA 5FYVA 1CJDA 2VUDA 3VHRA 1DHKB 2X10A 5KHKA 2GAUA 2MPFA 2J1RA 3BTAA 3GBFA 3MUZ1 4IE6A 5SV5A 4Q8KA 1DZRA 5HCHA 4G4FA 3GZAA 5FAXA 1GU3A 4XJUA 1U5XA 4FXKB 2PFWA 2DYCA 1RUE1 5BUVA 4JDNA 2VJXA 4LORA 1QDCA 1SLBA 4N90A 1RUE3 2XH6A 3FWEA 1ND3B 4LO7A 5FP7A 3WF0A 4AGGA 4XUNA 4YM2A 1H4GA 1HJGA 4Y4YA 4WZCA 3UKVA 1IHMA 2DV9A 5FZMA 2BVBA 4KMQA 3UYJA 4QQOA 4CCMA 1Q5OA 3RMYA 1ALYA 4C90A 2WZR2 3LA7A 1MPXA 2G4IA 4NHLA 1RVF1 1F35A 4YW5A 3RZGA 1E5HA 4XTPA 2FDGA 2DFBA 4N53B 4NRMA 4RL7A 2BEOA 1ULEA 3WSOA 4AI0A 3R0RA 4A45A 4DO0A 4JGZA 5H9RA 3UGHA 1GICA 1K12A 1WA4A 3SQOA 3MDPA 1OURA 1APNA 2OPWA 4N9IA 1HB1A 1X7NA 2NPIA 3MI8A 3AZZA 3ZFEA 4DB5A 2VAUA 2VMFA 3H9AA 5ABJA 2BOIA 1NY72 3INAA 4IV1C 1V6OA 3SCGA 3WW2A 3AYEA 4BIOA 4IW3A 5IK4A 3AXDA 3O12A 4P9WA 4HN0A 2WWUA 1OD5A 4YW3A 1XBFA 3SEEA 4FP2A 5IVJA 1FXZA 2HEWF 4P08A 4FSJA 1SCSA 2X29A 1AR71 3KCYA 1HX6A 2GC2A 4OMCA 4P9GA 4RD7A 3LEGA 1QIQA 5L9RA 4M3CE 3P6BA 1DZTA 4L2NA 4QKBA 5FLIA 5FY4A 1E5IA 5DZFA 4YVSB 5A7NA 2JG9B 1SMVA 4PQQA 2WNUA 1W8ZA 3POSA 4Z2WA 4EN8B 3MFAA 1IKQA 2D44A 1AYM1 1RXFA 4WBBA 4ARXA 4A7YA 1AYM3 2XWJB 4AEJA 3BU0A 4CDXC 3V0AB 1N3PA 4XPVA 2ZX4A 3IB3A 1VRBA 1ENSA 3A7QA 4MG2A 3WF4A 2XLGA 4UWDA 1ZRIA 5KR7A 5DAXA 1RUOA 1YHFA 5BXXA 3ZSJA 3U4XA 3ZXFA 1OF3A 2DVAA 1UYPA 1KD7A 3NQHA 2FDKA 5CZKA 2AUYA 4LHLA 3GYDA 3PJYA 4FFIA 2I07B 1POV0 3CZJA 3WEZA 5BV6A 5H9PA 5F1RA 3GM8A 4JC1A 3LWCA 1Z7S1 5LCWL 3KM5A 1M06G 2VQTA 1KFXL 2OPKA 4RHV2 4QPGC 1YO8A 3MZHA 1W2NA 2CGNA 2XOMA 3BU7A 1RB8G 1W8TA 3NV1A 4QX3A 2KM2A 1C28A 2QNKA 1ND3A 1Q8SA 4IEOA 4YLZA 1F15A 1ENQA 3NO8A 4LBNA 1NG0A 1LOFA 2W95A 1X9TA 4FCAA 4GD4A 5LWBA 3NAPB 5J37A 2IZWA 1K3IA 4LA3A 4Z1VA 5DUVA 2RS11 2CDOA 4NMIA 1HQNA 2J1VA 1H1AA 2RS13 2MHFA 1XE8A 4RS5B 2TBVA 1UMHA 2Y6LA 3BVCA 4UXAA 1OD3A 3O0VA 4LO6B 5L7OB 2WQ8A 1P8JA 2JIGA 1ZBA2 1VBE1 1NCRC 4H7MA 4CRQA 1VBE3 5IK8A 2BFUL 2RV9A 1W6OB 2WS91 4LLFA 5E89A 2WS93 4UFMA 4KH9A 2VZ1A 1C3HA 5CB7A 4F3JA 4QM9A 1D4M1 1W04A 1JU4A 3W5MA 2WQZC 1D4M3 2WNVA 4LUMA 4AG4A 4CA9A 4XFFA 4IETA 4Q4W1 4I2OA 1TEIA 4MGTA 1DG6A 4YW1A 4GWJA 1GZ9A 2XKOA 1W8WA 5LY2A 4Q4Y1 2G9GA 2IXLA 2ARXA 4XXPA 4IEQA 2ILMA 3UK9A 2Y6FA 4GMP3 2FMDA 1UQXA 2FHRA 2FCTA 5KHGA 5BY5A 5I8YA 2VPVA 1HJFA 1G8WA 3WNOA 3RFRA 4GULA 4PLNA 5GZCA 4L92A 3HN1A 5FZFA 2JG9A 5C3QA 5EYYA 3WLUA 4AI3A 3MLJA 3ZKYA 4KU7A 3VBSB 4CDQC 3DXUA 1F5FA 1O7FA 5JZGC 3D6EA 4QDQA 3RZHA 3K46A 3AKTA 4C0HA 3ZXJA 2Y38A 1NXD1 4AEDB 2FCUA 2WFF1 2PN5A 3QD6A 3O1MA 1LRHA 2WFF3 2O8QA 2V72A 1JYNA 1GV9A 4CDUC 5CKQA 3IIAA 2W5FA 2A73B 5IAVA 2I74A 2DCYA 4LHKA 4Q1PA 1V0AA 2V5YA 4LIUA 4Y24A 2JDPA 4BU2A 4D0QA 3MFCA 1JOBA 3RWNA 2XMLA 3I3DA 5FYCA 3ZSMA 2JWPA 1F2NA 2VMCA 2VUJA 5FP8A 3VKFC 4BHPA 1S1AA 5IHRA 4KWUA 4M4PA 1JODA 1H0BA 2YU1A 4MADA 5I0UA 1PVXA 3V65A 3JCIA 4Y1ZA 4BQXA 4UBGA 5E8AA 2W1SA 3CLPA 4QX1A 1LOGA 5G04L 2RMU2 2WYFA 4Q0SA 1W9SA 4JCKA 4AAPA 4NHXA 2EIBA 3IDBB 1O8SA 5K8SA 4XHXA 1SFNA 3CU7A 3AK0A 3VB9A 4MGSA 4IGOA 2HJIA 2QVSB 4RS5A 5BNNB 4XQWA 2RM21 2FZ1A 4CEYC 1SPPB 2RM23 2A5ZA 5L7OA 4E2SA 2FDFA 4CE8A 3QACA 3VHOA 3O0XA 4FQZA 3WP6A 3R4UA 2P34A 4WM7B 5A3OA 1O8PA 4H7LA 1EYBA 1W6OA 2GMPA 1AR92 2ZGRA 3CNAA 3D4KA 4KGQA 2WZPP 3NJVA 2WIIB 2QDRA 3RG0A 3T09A 2JB8A 4NHKA 4YGBA 3I8TA 4Y33A 3S0MA 1AX1A 3H8UA 4ARYA 1BHGA 1FOD2 2QQUA 2VOKA 2D6NA 2MNGA 4FOVA 3ZO0B 4MUVA 3BN6A 2AH2A 4Y20B 5F39A 5E1RA 1AVBA 4BB3A 4NHYA 3PU3A 1CPMA 1L7QA 4LBMA 5FP9A 4AHYA 2YGLA 1RUD2 1YFYA 3P5BA 5A3PA 5C70A 2E53A 3H1YA 3T0BA 4KWLA 1FI2A 4CXYA 2WT0A 2VBBA 2GDFA 1SFPA 4B7KA 2FD8A 4ISQA 2D93A 2D98A 5KXDA 2LS6A 4OMDA 4P9YA 2UYAA 5CEHA 1NCQC 4NRQA 4J1XA 4A7KA 1ZVFA 4RQPB 3RZJA 1BBT2 4QX8A 3FX3A 1QJX1 2EALA 2VMIA 3OG2A 5FY1A 3Q8CA 1QJX3 2XUEA 3ZOIA 4AEDA 1DQ0A 1Y4WA 1VBA1
chains in the Genus database with same CATH topology
4MLOA 1HRV2 1J3RA 1FT9A 2RR12 1CESA 4HSJA 4U2AA 1VRH1 3U07A 3OJBA 1VRH3 1O4YA 4NOTA 1ENXA 5SV8A 1NYWA 3S30A 4AXOA 4LBQB 3ILNA 4HK9A 4AF9A 2EXJA 2UYBA 1XRUA 4IQPA 4MGZE 4XXAA 4COWA 1EPWA 4ZU4A 4YGEA 2R061 2X5IC 4F8AA 2R063 2LM3A 4LBKA 4NPRA 1G9BA 1ONAA 1BMV2 1PK6B 4FPKA 1N47A 5EFUA 5JAXA 3AKSA 2H6CA 3B94A 2ZZQA 3H1WA 2Z2SB 2HWE1 3RMXA 3VKMA 2HWE3 1QKQA 2FMYA 4K7JA 2Q8OA 3ZX7A 1FPN1 3K51A 5KWRA 1Q8PA 4COYA 1RUF2 1V6IA 3T1LA 4I30A 4XE9A 5EJ3A 5BNNA 1ZZCA 2GU9A 3M3QA 1OMIA 3E5QA 4GWNA 1OHFA 4PLOA 2IXIA 1WBFA 1VBD2 2A3XA 4UW5A 4WM7A 4Z8BA 4IEUA 2D6OX 3PTYA 4I09A 3FBMA 1O3QA 1ZBE1 5GLVA 1FAYA 4DFSA 1ZBE3 4DY5A 2XJSA 1JUIA 4BYYA 1HLCA 5DDJ1 4HLTA 4QPIB 3ETQA 1EAH2 4Y20A 4DS0A 1JUHA 1IPKA 2QZ2A 2DCTA 5JOWA 1W0PA 1W6MB 1LULA 3VBOC 1K5MC 2WQ4A 1ULDA 3OGGA 1ZZ7A 3WCRA 3VBFB 4KL1A 1CAUB 3DPRC 2UWAA 4Q4V2 4CP1A 1S2KA 4X8NA 3RSJA 4XETA 1MZEA 1YCIA 1IZ3A 4PCRA 2CY6A 2FZ2A 4FOYA 4HKOA 4L97A 5FOBB 1GANA 2VMHA 3ZSEA 5JI9A 2D3SA 4RQPA 3NV4A 1ASJ2 3X29B 1O5UA 1DDLA 5HXVA 4P9XA 1DQ6A 1LHNA 1UU4A 3JD72 3CJIB 1PO23 3VZOA 5B2GB 4Q0QA 4FOQA 1OKQA 3WDUA 2BUKA 1S55A 4GWMA 2P3JA 4LBQA 1YXWA 1QXPA 3WG2A 1WD4A 4D7SA 5BYNA 1QJZA 3N3HA 4MGYE 4NWWA 3ZN5A 1HRI3 3K48A 2IXCA 1J3PA 5BPXA 5L73A 4HVRA 4LTAA 2XBO2 2YXSA 1N1SA 4FPYA 2R041 2O8OA 4Q0PA 1PK6A 1A3KA 1UKRA 3PLQA 2R043 1OOPC 2N7GA 2JE7A 3FUQA 2D7FA 3GBWA 2QFEA 4XZPA 4DMIA 1QJU1 3WDYA 1CIWA 2R30A 1OFNA 5E16A 3W58A 5DZEA 1FATA 3AKQA 2QE3A 3MW3A 1Q8QA 1AJKA 3DKWA 1AX0A 1RUE2 3JB8A 4Y1UA 4X6QB 2WT1A 2F6BA 4AGRA 1BJQA 4XMIA 1WMFA 1KS4A 4MVTA 5FPXA 3KCXA 2A6XA 3ZXEA 2DVGA 3SH3A 2BTVC 1MS5A 1OPMA 4K9SA 4OI2A 3ZMOA 1JYCA 4QPIA 5GZGA 2QQPA 3RQ0A 4XF9A 1N1VA 1RUC1 2OW4A 4YVWC 4CDXB 1W6MA 1YI9A 3MIEA 4LLOA 3BOWA 4Q26A 3VBFA 3MGUA 1CAUA 2B45X 2K2SA 3ZFFA 4A7ZA 4XBLA 2GH2A 5ACA1 5CFDB 5FREA 1RUG1 3ZYRA 1ND2C 3KGLA 1RUG3 1XYOA 2XVLA 4NR1A 1G7YA 4YW4A 3JBG1 2GC0A 3KT4A 2XLFA 1GZWB 2JD4A 1V6KA 3JBG3 3LCPA 3TN93 4NWVA 4QPGB 3CJIA 1MQTA 4W6WA 3OYWB 2GZWA 2B9UA 1PVC3 3I2DA 3AP9A 5GLZA 3MIHA 2JECA 5AFBA 4GB31 1AYM2 4OI0A 1RUJ1 5KXEA 5H9SA 2JJ6A 3FHIB 1OQ1A 2OA2A 4AFCA 5BNPB 4JGYC 4AVBA 3WINE 3GALA 1OLQA 4XJWA 3VLBB 1KDKA 4D94A 5GALA 1F5JA 2R1BA 1G9DA 4BWOA 1GKBA 1O4TA 3B3QE 1KJRA 3IWZA 4HL0A 1RJ7A 3H3UA 1GZCA 2BYVE 1LOAA 3LSDA 1V6NA 3KSCA 4FOWA 4W6XA 2HWD1 2E7AA 4Y5Z0 4LA2A 1W0OA 4QX5A 4DQAA 5GLUA 1YFUA 2XL7A 1FV3A 1UMZA 2RS32 4OHYA 2RS12 4G3YC 2P3KA 5J3UA 2VNOA 4I0BA 4WM8C 1ZX5A 2VQ0A 2A7AA 3U11A 2VU9A 3WQ1A 1VBE2 5CAZA 2K9ZA 3AMMA 2YY1A 2BNNA 2GALA 2WS92 4IEVA 3UKTA 4AQ2A 3RI8A 4XJ8A 3RYPA 4CDXA 2PHXA 1MS4A 1D4M2 2EAKA 5DUWA 3WP3A 1N3QA 1V9U3 3IM0A 1Q8VA 5CFDA 3U10A 3O0WA 5T54A 1H1IA 1CD3G 4XTMA 5EYXA 4DXZA 4KBBA 1PGL1 4D3WA 4BCUA 2IXKA 1GZWA 3ZFGC 2NQYA 5CIRA 3VKNA 3ILRA 1QGLA 3OYWA 2PHWA 4ES8A 1XNKA 3V56A 3VDDC 5L36A 2WNEA 1AZDA 1AL21 1NQJA 2LALA 1DYPA 1AL23 4AK3A 5BNPA 1UPSA 5T52A 1WLCA 4CEYB 3B00A 2E6VA 2QJVA 4UW3A 2HWC3 4B4QA 3WR0A 1EY2A 1HXS3 2CTVA 4LBLA 1G9FA 3VBUC 2YC0A 3CJXA 1U5ZA 4Q0UA 2IFRA 3FUOA 1MS1A 1MZ5A 1J59A 3A0KA 3AZYA 2B7YA 4NN0A 2ZAHA 4RGGA 3NVCA 1BYHA 2EXIA 1CGPA 1WBLA 3EBRA 2VG9A 1KQRA 2BPA2 4UBHA 3MIBA 1AYN1 1VB2A 1XNDA 2CAUA 3QH7A 5FQ0B 1AYN3 3DUIA 3IN9A 1RMU2 3NKTA 4QQPA 1PGSA 3H0OA 4BPZA 1SBDA 1MACA 3AZWA 4BLJA 2AYHA 1YFWA 3M3CA 3G6JB 1NCQB 5AVAA 3GZTB 1RIRA 3TBDA 1DQ4A 1DQ2A 5FDBA 4S2FA 1NZCA 3DF0A 3D8CA 1IKPA 1QWRA 3WDTA 1LU1A 1ZZBA 1WW5A 2AENA 1QY4A 1KDMA 2BFUS 1SLCA 1OA2A 1KFUL 4L11A 2EXHA 4PBPA 1C57A 3TB0A 1SQ4A 3AP7A 1QU0A 1DF0A 2VVDA 3I7DA 3LA2A 1ULGA 3MW2A 4Y1XA 1S2BA 2EXKA 5FPZA 4GKYA 1PZ7A 1ZYBA 4I02A 1I9RA 4HK8A 3M1HA 1LR5A 1S0DA 2WL1A 1LTEA 4WVMB 2C5DA 2GSYA 2JG8B 4Q29A 3TWIA 1QNYA 1QJX2 2HKXA 1UX6A 3WQ7A 1GR3A 1VIWB 1ZA4A 1QQP1 1VRH2 4LR4A 4CEYA 1RVF3 1RUH1 1IOAA 3V0BA 1RUH3 4ZU5A 1NA1C 3E5UA 1ZRCA 1N1TA 3VL8A 3POWA 4XBQA 3TRSB 1HQWA 2R062 3AB0A 2Z42A 4LO8A 4PJYA 5GLTA 1H2LA 1NLSA 5FO8B 4E4SA 5CADA 4HPKA 1H9PA 3O14A 4JVAA 3VZLA 1IPJA 2HWE2 3ME2A 3VBOB 4R8HA 1CVNA 1TE1B 3D0JA 3E5XA 1U0AA 1KXGA 5D1IA 5AVPA 2BWCA 4K6BA 4AI2A 3N7JA 1AR73 5I8SA 2YPJA 5GZFA 2XLAA 1ZRFA 1POV1 1CQ9A 1LOCA 1POV3 3OBTA 4LULA 1N1YA 1AR81 1NCQA 4IEXA 1AR83 1NE4A 5CFCC 1W6NB 1YJLA 1ZBE2 4WZFA 4YW2A 3ALQA 2XUMA 4B4PA 3MIDA 4Q4X1 1AL0G 4Q4X3 4Q8LA 4HFSA 3ZVXA 1S0EA 4YSFA 3OD4A 2D3PA 1WCSA 1RHI1 3HBZA 1RHI3 2A75A 2Q4SA 3U0ZA 5L19A 1PIV1 2IXHA 2XB6C 1AF9A 2FBEA 3HR9A 3WHUA 4A2UA 1KJLA 1PIV3 3AMQA 1OOPB 1Z7S3 3JQWA 3WNXA 1RUI1 5AFEA 1HQLA 4AFDA 4QGLA 3FFQA 4ZKTB 5CVRA 4WVMA 2JG8A 4WVZA 4GH4C 2GMEA 5F5QA 1YNAA 2CGOA 4S2GA 2G9FA 4XILA 1PO22 3WDVA 2K0GA 2HWF1 2VOVA 2HWF3 2GMMA 4FPCA 4N53A 5BNOC 2H6BA 3B5LB 4DOUA 2P37A 1HRI2 5K0UB 3IPVB 1ULFA 5LRRA 2E7QA 2R042 5FLHA 5C9AC 3EHKA 2GN3A 4YYOA 2VNGA 3R4DB 3AFGA 2P3IA 4Q4W3 4YVWB 1XNBA 3AYDA 1RJ8A 5KXBA 1A8MA 3VBOA 3MIFA 4Z92B 4RSUA 4UW6A 1E57A 1RTVA 3ZN4A 4EWDA 3AM2A 5LK7B 1TME1 5JWPA 4Q4Y3 2ZBJA 2XVGA 1TME3 4KWKA 2Y0IA 4JQRA 1GBGA 1ND2B 3AP4A 1VBB1 4YVSA 2BQPA 2R0HA 3VBRC 1VBB3 1NLRA 1EPZA 4FQ4A 3OCPA 2UWBA 2WT2A 1OFSA 2PLV2 4K1ZA 1BVVA 3JU9A 3ZN6B 3NSTA 3V0AA 4XFBA 2VUAA 3TNQA 5A33B 5EZWA 1LU2A 1MVQA 1S0IA 4E2QA 5DXDA 4YGDA 1S0BA 3WP5A 3H7JA 3P3NA 4K8FA 4JGYB 5JOYA 1EV11 3WZ1A 1EV13 1WD3A 4IEYA 2D43A 1X50A 3VHPA 2IFWA 4NO4A 3IDEA 1OOPA 2TUNA 4ZU7A 1AXZA 1RUG2 4MGKE 4RR3C 4C0BA 5JI7A 2XJTA 2VGDA 2NN8A 3RPQA 3ROUA 3SISA 5FRAA 1CAXB 4AQTA 5FTTC 3JBG2 1UZZA 3M3OA 3N35A 3TN92 1L3JA 1FNYA 3AP5A 4HETA 4CEWC 4GMP0 3NAPA 4FXGB 1QH6A 5JLVA 1PVC2 2JDZA 2DUOA 4BA6A 5I8TA 2D5HA 2PHFA 5KHJA 2Y26A 3JB4C 1MEC1 2B5HA 1KITA 4FAHA 1PO11 4LE3A 1PO13 2QDNA 1W6PB 4S2HA 3UJQA 4WM8B 5K0UA 4PIZA 1JOJA 3IPVA 4YFZA 1DYKA 1IS5A 2WLQA 4OI1A 1ENRA 1RGSA 3CO2A 3TNPB 2ENRA 1Q8OA 2W39A 2HWB1 3OD0A 4YVWA 5IK5A 4XBNA 2HWB3 5GZDA 1BXHA 1ZZ6A 1G6NA 1YLLA 1V00A 1IS4A 1ULCA 4JGZC 4L8QA 3WOGA 4G9SB 1ND2A 2ZGNA 2F4PA 1YI7A 1LOBA 4DZGA 3VHNA 1CPNA 1BKZA 1JXNA 4AVSA 5ABJC 3BIWE 3LOBA 1UW8A 1S0JA 3VBSA 1PNGA 2JICA 1UIKA 4D69A 2GH8A 1PGW2 1MZ6A 2DVDA 2ZAAA 2NP0A 1B35C 1ZZ8A 4FPHA 1GNHA 4R9AA 2UWCA 4Y22B 3ZN6A 4AVCA 1VP6A 4KG8A 3LA3A 3UL2A 4TZDA 1VBA3 5A33A 3GHNA 2ZMLA 2DURA 4N7UA 5C4WB 3VDDB 1IS6A 3VN4A 2WNUC 4JRAA 1V9U2 1F8VA 2C0ZA 4FPLA 4NVPA 3HWJA 5JPNB 4N9HA 1O5LA 4ES9A 1LESA 3NW4A 4I01A 2RS51 3VBHB 1PGL2 4IERA 1QMJA 1CAXA 2RS53 2ZHMA 1WMDA 4AFAA 1FPN3 4LT5A 2ZGKA 2TNFA 1DU3D 3I54A 2ARBA 2R16A 4YG0A 5CBLA 1UIJA 2NLRA 2BNOA 4XYXA 1OQDA 4XQ4A 5KBFA 3HT2A 4QGNA 4M3CB 2ZGSA 4Q0VA 1AL22 2JX9A 1W6PA 2QZ3A 1UPIA 4WM8A 3WDWA 2JXAA 3FZ3A 1W39A 1ND3C 4AHXA 2HWC2 1NOVA 1LOFC 3RRDA 1HXS2 5DDJ3 1COV2 1VBC2 3B02A 1SCRA 4PQ9A 4CZSA 1GNZA 2XWBB 3WD5A 1REEA 4BH9A 3ZYPA 3ZDSA 2DCJA 4U36A 4Y1VA 4FAGA 1O3SA 3AMNA 3URFA 4QQHA 3BODA 4FP3A 2R6QA 1VAVA 5JR7B 1UF2C 4AGVA 1BCXA 2HEYF 2ZGPA 4AVTA 3CL1A 3QLQA 4H14A 4RGAA 2WNVC 1AYN2 3USSA 4M01A 4MGIE 2ZA9A 1GFF2 5I0SA 4XOGA 4B8EA 4E2GA 3N7MA 3QCWA 4Y22A 1LGCA 2VECA 1MR5A 4N7IA 5K9YA 1RUNA 5DZGA 4AW7A 5C4WA 2ZHLA 4XJAA 1C4RA 1RITA 2B8MA 2DUQA 4SLIA 2BBVA 4WV8A 2VVEA 4AEKA 3PVNA 4DPNA 1Q56A 4COVA 1NA1B 2DU0A 4FPFA 5I93A 1C8NA 2B39A 4Y26A 2Y0OA 3VBHA 1QJU3 1QJY1 1OLRA 2ZGLA 1PNFA 1QJY3 4IV1B 5C8CC 1V6JA 3HIFA 4Q1RA 3B7MA 4Y1YA 3L2YA 5DG2A 1H2NA 5T5JA 1DIWA 1LKNA 4PIXA 4ASLA 3S6PA 1JH5A 4ZXKA 3R6SA 4PLMA 3PHMA 4M3CA 3PVEA 2ZMNA 5FBZA 2JEMA 5D8AC 2GNBA 4R52A 3LGRA 5JVVA 4DNYA 1J1LA 3M70A 4W6YA 4JRLA 1RVF2 1CAWB 5FFOC 4MXVA 1RUH2 1SEFA 1SLTA 1G9CA 1TNFA 3NJZA 5FMOL 4YZ2A 3DN7A 2DU1A 4KQ7A 4HT1T 5FO9B 5CFCB 5JDBA 5I91A 1SBFA 1LHOA 4IESA 5K7PA 4FO9A 1RUC3 1QOOA 4QPYA 3ACLA 3EQEA 5HCAA 1QOTA 1X8EA 3A4UA 4AWDA 1A78A 2OUJA 4FPJA 4GIQA 5ACA3 3KB5A 3J9SA 5DG1A 4A3XA 4AI1A 1AR72 4AE2A 2ZX1A 1FMD1 2RJLA 1YRZA 4PDWC 3WT3A 4ATFA 4BOWA 1FMD3 1JBCA 1AXYA 5HCBA 4Q27A 1VR3A 2ZPXA