4ASMB

Crystal structure of the catalytic domain of beta-agarase d from zobellia galactanivorans
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
357
structure length
357
Chain Sequence
QYDWDNVPIPANAGAGKTWKLQTAASDDFNYTFNPTNNVVDFGPNGNMKWYNKYHNRPNGQPNNFEGPGPTKWMQNHVAVSGGNLNIWASRIPGATKSFTGSNNTPISRPETRAGCITNKTRVKYPVFVEARVKVMNSTLASDIWLLSPDDTQEIDIMECYGGPGNDNRNSYFASKIHLSHHVFIRPPNFKDYQPADLNSWWGKNGVTQWGGKTIRIGVNWVSPTRLEYFVDGQMVRILDNDAVQTRLADGTWQYTYPAGVTSTGVNGQLIKENGYQKMNIASSLSDAKNKSNISVIDPFNYLNNGRKFSKEMDIIINVEDQSWQAEAYRSPNAAEMANFYDNNLLVDWIRVYKPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-AGARASE D
publication title Biochemical and Structural Characterization of the Complex Agarolytic Enzyme System from the Marine Bacterium Zobellia Galactanivorans.
pubmed doi rcsb
source organism Zobellia galactanivorans
total genus 98
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2012-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4asmB00
1UPSA 4Y22A 3I4IA 1WW5A 1A3KA 4U36A 5EYXA 2GDFA 4LBQD 2JKBA 3AJZA 5E8AA 1MZ6A 1HQWA 1URXA 3LSDA 3AZXA 4UW6A 2VUAA 1S0BA 5GLVA 4M3CF 2DVDA 4HANA 1AZDA 4F83A 1MS4A 1UX6A 1QF3A 1KDMA 4JRAA 1FV3A 1LULA 2ARXA 2WNEA 1Q8OA 2I2SA 3KM5A 2AUYA 1LESA 1J1TA 1G8WA 1GSLA 1G9FA 3N7MA 4FOYA 5E88A 3NV2A 1LGCA 4CZSA 3VUOA 4YW5A 3GNEA 3IMNA 3OYWA 2YXSA 4FPOB 4BOWA 1KJLA 1LHNA 5GLWA 1FATA 2E6VA 2EF6A 2AGSA 5DUVA 1W6OA 2D6LX 2A70A 5CNAA 1DYKA 2EIGA 4K21A 5H9PA 4YM3A 2ZGSA 5JOWA 1Y7BA 1UL9A 2ZGNA 3O5SA 4XHXA 3WNXA 3WDUA 1QOTA 1CVNA 2Q5TA 2ZMNA 2A6WA 2H0BA 4XXPA 4AVTA 3NWKA 5IK5A 1GV9A 1O4YA 4M3CE 1V6OA 1KITA 4XTPA 3T1MA 3IKWA 4FP2A 3T1LA 2VW1A 4YM2A 2R0FA 1FNYA 2P3IA 4Y1VA 3FLPA 1IKQA 2RHPA 2NYYA 2ZBJA 1ULFA 3N7JA 3V64A 4FPFA 2OUHA 2R1DA 1LHVA 3M2MA 3PVNA 3UJOA 4YZ4A 1D0HA 1FV2A 4AGVA 4XHBA 1H30A 4JC1A 1N3QA 3AP6A 4AWDA 3BTAA 1B09A 1G9CA 1ULGA 4M00A 4XIOA 2ZGLA 5DG2A 5KXEA 3NV1A 3ZSLA 2UURA 2ZHKA 4Y20B 1LU2A 1LOFC 4C1XA 1LGBA 1N1YA 1BQPA 2DVFA 2XG3A 3I8TA 2D3SA 1YXWA 3ZXEA 5HCAA 4Y1ZA 5KXBA 1R1ZA 1AJKA 1LCLA 1LU1A 1GNZA 4R9CA 4LBKA 5CBLA 5EYYA 1JUIA 2VXRA 3AYAA 2WT1A 3MPPG 3V0BA 2C9AA 2EXIA 1LOCA 1MS0A 2JD4A 1WUVA 2A6XA 4GKYA 1F5FA 3C2UA 3AZVA 5T54A 5JOXA 2DTWA 4YW3A 1N1TA 3AZZA 3AYEA 3LCPA 2ZHMA 3V65A 2NMNA 2D7FA 3W58A 5CAZA 5GJ6A 5DUUA 5GALA 3VKNA 1WD3A 4YFZA 3ZYRA 1BZWA 2GMEA 2ZGPA 3MW4A 1CQ9A 3SISA 1UKGA 1LENA 1QNYA 3O0VA 4FPHA 4Q2FA 2ZHLA 1QKQA 4W65A 3SNMA 3PJQA 3O0WA 2YV8A 3ENRA 1V6NA 3ILFA 4R9DA 1MZ5A 2DVGA 4GWMA 4TYSA 5CB7A 1SCRA 1HQLA 1APNA 2PELA 4FPJA 3R4UA 1RIRA 3B00A 2EAKA 4XMAA 2CL2A 1MS9A 5EXOA 3OY8A 1QNWA 3AXEA 4YGBA 3WHUA 1S0FA 1GZWB 3L2YA 1KDKA 4BMEA 1SLLA 4FPLA 1QOSA 5GLUA 4M3CA 5FREA 2AENA 2TEPA 4I30A 5GM0A 4YM0A 4ZKTB 1JYIA 1JXNA 3AZYA 1UMZA 1W6NB 4FPCA 2P3KA 4FP3A 1GZ9A 1Z78A 5GLTA 4K1YA 1C57A 4YLZA 5IUQA 2ZGTA 1V6KA 4ATFA 1CONA 4YG6A 2DTYA 4ITCA 4P9WA 1ONAA 1QU0A 1ZA4A 2VH9A 2WT2A 2WSUA 5F5QA 3AX4A 2NZ9A 1ULDA 3WG4A 3WV6A 3B01A 1DQ6A 2PHFA 1LHWA 1W6PB 3FUOA 5FRAA 5T5LA 3M3OA 3ILNA 3WHTA 1XQNA 1JN2P 5H9RA 1LOEA 1LECA 3POYA 4MYEA 2A3YA 3RG0A 3USUB 4Q26A 4C1WA 3N7LA 3IN9A 2P3JA 3HN1A 3N7KA 1VAVA 1G9DA 1FNZA 2PHXA 3POWA 1F9KA 1QMJA 2GN3A 1MACA 2JJ6A 4YG0A 1IOAA 3ZSJA 1CIWA 4DS0A 5GZCA 3PVOA 3R4SA 3Q9OA 5JLVA 3M3EA 1DQ1A 1VALA 3B69A 5DUWA 1WW7A 3WDWA 2GNBA 3WUCA 4YZ1A 2AREA 3M1HA 5H9SA 2PHTA 4XJ8A 1S0IA 1TEIA 1IS3A 1DQ0A 4LBQB 2P2KA 1AX1A 1BJQA 3BODA 1RITA 1S0CA 3SITA 4DRVA 3PVEA 3ZVXA 1X50A 2A75A 5DG1A 3O0XA 4XXAA 4YZ2A 4M01A 1G86A 1LTEA 3WG3A 5JOYA 2GN7A 2ZGUA 2W52A 3PMEA 4FVVA 2CNAA 1SACA 4YW2A 3UK9A 1SLBA 2D6KA 4Q8KA 5F9TA 1WLWA 2P34A 1DLLA 2NN8A 1LGNA 1VLNA 4BMBA 2FHRA 1SLTA 4XYXA 1I1EA 1YRZA 4BLJA 1W6MB 1AXKA 3AP5A 5GZGA 1GNHA 2VW2A 3IPVA 1QDCA 3RMYA 4P14A 1HKDA 1MVEA 5SV8A 1D2SA 3B3QE 1H9WA 4NO4A 4XTMA 4H55A 5EWSA 1W6QA 1LOFA 1G9AA 2CY6A 4XJUA 3AYDA 4LBOA 1Q8PA 2ZABA 1JOJA 1VIWB 1Q8QA 1WLCA 1AVBA 1V6IA 3AFKA 1WD4A 2CWSA 2JDZA 4ASMB 1OKQA 2E51A 2A6YA 1G7YA 2D6PA 3AYCA 4GWNA 5KXCA 1CR7A 2GNMA 4WVVA 4Y24A 1F31A 1UAIA 2FMDA 2ZHNA 2E53A 2ZGOA 5T50A 3SH5A 4AVVA 4XDQA 1NLSA 2PHUA 2V73A 1N47A 1QOOA 2HYKA 3O12A 1N3PA 1GKBA 3V0AB 1IS5A 4RL7A 1MS3A 3B9CA 2W08A 3ZSKA 3ZXLA 1FX5A 2ZACA 3RMXA 2ENRA 4DQAA 1LHUA 2WQZC 3A0NA 3FLRA 4Y22B 1YIFA 5T5JA 4AGGA 4XILA 3ZYPA 4YZ5A 2LALA 1A8DA 2V5YA 2A7AA 3WVJA 4SLIA 4Z8BA 1WW4A 4AYUA 2D6OX 2DURA 3CNAA 1S0EA 1GZCA 2ZGRA 4TZDA 2A5ZA 1CPNA 4XZPA 4FOWA 2ZKNA 2ZMLA 3HR9A 4GKXA 4P9YA 1OQ1A 4UW3A 4XMIA 5T52A 1VAMA 1MR5A 2D43A 3QCWA 2DU0A 2XB6C 3WG2A 4Q27A 3UJQA 2DV9A 3OYWB 3R05A 1PZ7A 4Y1YA 1N1VA 2ZA9A 1N1SA 5T5OA 4BM8A 1DYPA 1LEDA 2CWMA 2NP0A 1W6OB 4YG3A 1LEMA 4WZFA 2EXJA 3MW3A 1LOAA 1SLCA 1WLDA 1GYKA 2R1BA 3IM0A 1EPWA 2WJSA 4LBMA 4PBPA 1QGLA 1DFQA 3HMYA 2ZMKA 4K20A 3AK0A 3APBA 4FQ4A 4KBBA 2GNDA 1HLCA 3OPZA 2PHRA 2EXKA 2ZGQA 1ULCA 4Q1PA 1S1AA 5LK5A 3WG1A 1SBFA 2UWBA 2UWCA 3AZWA 4Y20A 1IKPA 3AP9A 1RINA 2LTNA 4YGCA 1C1LA 3N36A 3A0KA 1Q8VA 3AP4A 3U4XA 1FYUA 4NOTA 1DGLA 2KM2A 2D44A 2DUQA 2GMMA 2A6VA 4FPKA 2CTVA 4JCKA 4K1ZA 1S0GA 2R16A 1MS8A 1DBNA 5GZDA 4YW1A 4CRQA 4LBNA 1LOGA 4XOGA 1GANA 3DUIA 3T2TA 1IS6A 1O4ZA 2JE7A 3WDXA 1GICA 4XE9A 4FOQA 3SLIA 2B7YA 1JHNA 2G4IA 3V0BB 5JDBA 1KRIA 2AR6A 4DPNA 4Y1UA 4ZXKA 3VKFC 4CTEA 5GLZA 2VY0A 2WLQA 1DIWA 1Z0HA 2WT0A 4XIKA 3WDVA 3N35A 4WVWA 1CPMA 4UW4A 2ZGKA 3DGTA 4XBQA 3BOPA 3W59A 4BPZA 5DZGA 3RS6A 3FLTA 5IT6A 2ARBA 1ENSA 1GLHA 2PHWA 3ZXFA 2Z42A 4DRRA 2P37A 3GALA 4PQ9A 3SH4A 4AVSA 5CA6A 1IS4A 1GZWA 1JBCA 5JMCA 1QDOA 2OVUA 5L73A 4IQPA 3FFZA 3ILRA 5JOZA 2DU1A 2DYCA 3D6EA 1W6NA 4YGDA 2ZZJA 1GBGA 3FUQA 4Y1XA 3N3HA 1MS5A 4D69A 1U0AA 1UN1A 1S0DA 5E89A 5GZFA 4BLIA 1W0OA 2GMPA 3NV4A 3OY8B 2R49A 3FBYA 3WOGA 1YO8A 4L8QA 4R9BA 2W39A 2E7TA 2GALA 3AJYA 1HDKA 4M3CB 1ENQA 1Q8SA 1FAYA 4Q1RA 3D5OA 1MVQA 5GZEA 1NXD1 2OW4A 4XJZA 1UZYA 3VKOA 1CN1A 1CJPA 1W6PA 2VW0A 1DZQA 4UW5A 3ZXKA 1LJ7A 3ASIA 1AXYA 2WSVA 2YY1A 5AVAA 1AX2A 1YYNA 3A4UA 4P9XA 3WUDA 2A71A 2CYFA 2W68A 3AP7A 3USUA 4XBNA 1V6JA 1UZZA 1CESA 4XJWA 4FPGA 1S0JA 2BQPA 1ENRA 1C4RA 3VV1A 1AF9A 2DVBA 1G9BA 3M3CA 1BXHA 1MS1A 1SFYA 4PF5A 5T55A 4Y26A 5DZEA 1Q56A 2AH2A 4FPYA 1SBEA 3RRDA 5KXDA 2E7QA 3H0OA 2EALA 2A3WA 3POSA 1OFSA 2WKKA 3WDTA 2NMOA 4LBJA 1V00A 5JVVA 4YM1A 2DUOA 3ZSMA 2YROA 1AJOA 2DVAA 2EXHA 4HL0A 4LBQA 3LSEA 1SLIA 1DQ4A 2AYHA 1SBDA 4OZXA 4PBOA 2ZGMA 2DWRA 4BQ1A 4FPEA 1DHKB 2YZ4A 2OUJA 3VKMA 1BYHA 1KQRA 1N3OA 2DUPA 1ZM1A 3KQRA 5DZFA 3MW2A 2ZAAA 3WCSA 1YI7A 2YMZA 4YFWA 3RQ0A 3OBTA 3OGGA 1WBLA 1SLAA 2UU8A 3QLQA 5H9QA 3SH3A 3OJBA 3TAYA 5HCFA 1DQ5A 5IK4A 2JE9A 4ATEA 3WZ1A 2D3PA 1JW6A 2JECA 5DUXA 4GXLA 5HCBA 1W6MA 5IK8A 1LODA 1SCSA 3OBRA 4XJ9A 5T5PA 3ZPYA 4DFSA 2ES3A 5IK7A 5BYNA 1DQ2A 1KJRA 2A6ZA 3VKLA 3RSJA 4U2AA 3BIWE 4ISRA 3NV3A 4YZ3A 1PZ9A 2A3XA 2ERFA 4ISQA 3M3QA 2GNTA 4RA0A 1PZ8A 1H9PA 1WBFA 1A78A 3MEPA 3UL2A 2SBAA 1WCSA 3WCRA 4GALA 3IPVB 3ZXJA 1C1FA 4YW4A 2D6NA 4GA9A 3JUUA 1ULEA 2D3RA 4R9AA 1LHOA 4YGEA 1V6MA 3JU9A 4FOVA 4FQZA 4Q8LA 3WDYA 1W6QB 1V6LA 2C5DA 3WLUA 4AGRA 1AXZA 2SLIA 1JYCA 1LOBA 4PCRA 2R0HA 3D4KA 1AX0A 2VU9A 1BKZA 4XBLA 1I3HA 3INAA 3ATGA 3V0AA 4XJAA 2NM1A 4LBLA 2UWAA 3TB0A 1WW6A 1W0PA 2D6MA 5DXDA 3AXDA 4WV8A
chains in the Genus database with same CATH superfamily
2MHFA 3ZFGA 4Y22A 2AZ5A 1A3KA 2BRTA 2JKBA 1I5PA 4JX0A 3AC0A 2QDNA 1OUXA 1URXA 2CAVA 4RSUA 1UWWA 2RG4A 4XUQA 2CHHA 3N9QA 1OUSA 2VUAA 1AR93 2XHNA 3D8CA 2DVDA 1ZNPA 1UX6A 2BERA 4CEYA 4OHWA 1FV3A 3OBZA 3PUHA 2XJRA 4N43A 2ARXA 4P9IA 3RZKA 3KM5A 5J48A 4CDXB 3G6JB 3GZEA 1G8WA 4XC9A 5FY8A 4EN0A 4DIQA 4UF0B 4COUA 5DDJ1 3A21A 1JZ8A 5IFTA 5A3MA 2B9VA 3OYWA 1B35B 4MGYE 4COYA 3GGLA 1J84A 2W9XA 4FPOB 4LO6B 4XF0A 4B7EA 2G9ZA 1KJLA 3B7MA 4BOWA 2EF6A 3WQ0A 3POEA 4HONA 5DAVA 3U75A 3KT4A 5DUVA 5J7MA 3VBFA 3H42B 2V5DA 4MXWB 1Y7BA 2GU9A 5JSRA 2J7MA 5FYSA 2B5HA 4E27A 5JAXA 1CVNA 3E97A 1VBE3 2A6WA 3EJKA 4QB1A 2HEVF 4KNCA 4M3CE 1QH7A 4D6RA 4CDQC 5JIUA 4BB3A 3IKWA 5C8CA 2R0FA 3MLJA 1FNYA 1SZBA 4PLMA 3TEXA 4WVMA 5CG8A 4XVHA 1ULFA 4FFIA 3N7JA 3V64A 1YI9A 1QEXA 3JCIA 3NAPA 2R043 3PVNA 1D0HA 2JDYA 1DCSA 2J1RA 5C3PA 3IB3A 3PTRB 4QKDA 1ULGA 4O65A 2GH8A 4MX3A 2W1QA 3ZSLA 2Y6FA 2GP5A 1X9PA 2TNFA 2ZHKA 1WMDA 5ANNA 3LA7A 1ACCA 1VBC3 2XG3A 3I8TA 4CCCA 3NJVA 4Y1ZA 5KXBA 5C3QA 1Y3TA 1AJKA 1DGWA 1S4CA 5CVRA 1O4TA 3AYAA 3PUQA 3Q8BA 1RGSA 4JQRA 4GULA 3MO4A 2WAAA 2ZEZA 4QX1A 1LOCA 1MS0A 2JD4A 3BYWA 3KV4A 1K5JA 5IVYA 3CZJA 5FBZA 2BDRA 5IVEA 1RUI2 2PN5A 3U37A 3S5AA 3PTYA 3ZFEA 2TUNA 1Y9MA 4LITA 5DQ0A 5CAZA 2X05A 1QJU1 4JVAA 3BUCA 2Q1MA 3VKNA 4YFZA 3ZYRA 1W2UA 2ZGPA 3ON7A 4HOOA 1CQ9A 1UX7A 1LENA 2JX9A 2RS13 4FPHA 2XXZA 2HEYF 2ORXA 1V6NA 3TNPB 2DVGA 4EYUA 4XUPA 3I3DA 1HQLA 1APNA 3TN93 3E5QA 1W2AX 3JBG1 4LKDA 2W95A 5EXOA 1NQJA 2ZZQA 1RXGA 1S0FA 4WVZA 1NX9A 4KWUA 1NY71 5FZ1A 1YC61 5GLUA 1VBB3 5KHHA 2AENA 2TEPA 4JGYC 2ZKLA 5EFUA 1JYIA 1R092 2R073 3AZYA 4XW3A 4NHXA 4FPCA 1DU3D 4QU1A 5GLTA 4K1YA 5IUQA 1ND2C 5IFPA 3DECA 1H2MA 1ZBE3 1ONAA 1PMHX 4A42A 4CU7A 2NZ9A 4LIVA 5CFCA 1ZRRA 2VOVA 3B01A 4CA9A 3KV9A 1R081 4HG6B 3DL3A 2XGXA 1W6PB 3FUOA 2C24A 5EP9A 3U14A 4ZXEA 5K0UB 3WHTA 3ZMOA 1XQNA 3ALQA 4CCNA 1LOEA 4LORA 1WMEA 2A3YA 3ZIWA 3RG0A 1O7FA 1TME2 2ETEA 3IN9A 5LK7B 2EAAA 4DEQA 1UY0A 4BA6A 5L19A 2PHXA 2PQSA 2WZR2 1QMJA 2XJQA 1O91A 2P6CA 4I0WB 3H3LA 3K3OA 1X33A 3CU7A 2OS2A 1YLLA 5IHRA 4JKMA 1ST8A 1JI6A 4FT8A 2XMLA 3PVOA 2QTWB 2WFF2 3R4SA 3M3EA 2OQ6A 1BBT2 1COV1 3IIAA 1PIV3 4QHZA 5FCCA 4N53B 4Z2AA 4AEDB 2K2SA 3M1HA 4QGNA 3H8XA 1H8TA 3WNNA 1UD1A 2IXCA 4MGSA 1UXZA 1DQ0A 4RGGA 2P2KA 5JZGA 1H2LA 3SHRA 3ACGA 1BJQA 5CADA 4LK7A 3PVEA 3ZN6A 3ZXGA 4AHWA 3ZVXA 4L97A 1X50A 4OI0A 1FOD2 1RHI2 2A75A 2MEV2 3C7HA 4ZONA 3UGFA 4A7ZA 1NCRB 3MPBA 4M01A 1G86A 1MQTC 2GC2A 5D1IA 3LB9A 3WF1A 4F8AA 5JOYA 1EAH3 5M0TA 2ZGUA 3PMEA 2W52A 4LTAA 3ZKUA 2IVIB 1SLBA 2QZ3A 5FYYA 5C3SA 1DLLA 2NN8A 4LA2A 2EVXA 2FHRA 5FZGA 1HX6A 3PURA 5JSPA 5LA1A 3WP4A 1AXKA 1UYPA 5FY5A 4IXLA 4ORFA 3RWNA 2VW2A 1QDCA 1UY4A 5A1LA 2O0OA 1VRH2 1H9WA 2HWD3 1D4M2 4H55A 5F6LB 4GMP0 4Q0PA 2EA7A 4HETA 3HVDA 3TRSB 3LDBA 4A3ZA 4XJUA 5BPXA 5FLHA 4QXKA 5FZDA 1IQAA 3I2IA 4QX5A 3AL5A 2WNUC 1JOJA 3W5NA 1VIWB 1Q8QA 3VBOB 4AXOA 4H2AA 2RJLA 4EZ4A 2CWSA 3RZLA 2L9LA 4TTGA 1NA1B 2E51A 3IDAA 1G7YA 2Q8EA 5JMCA 4EJRA 1F15A 4QPGA 1F31A 1WA6X 5C71A 4JKKA 2PAEA 4P9LA 4CU9A 2VZRA 3SMHA 4XDQA 2WAOA 4HPKB 5C4WC 1W03A 1VMJA 1KS5A 2V73A 1LNSA 2VD7A 3O12A 4LNVA 1U5IA 2HJIA 2KA3A 2UYAA 4AHXA 3GDBA 4QPYA 4Y5SA 1AR92 4EWAA 5A33A 4R4ZA 4FBFA 4AI2A 1NOVA 2J1EA 4DQAA 4B7KA 3JQWA 1UYYA 5CYYA 4YVSB 3ACFA 2IWGB 2LALA 1RUE3 4Q4X3 1RXFA 2JDHA 3VBSC 1WW4A 4UFLA 4I2OA 5FYBA 1S0EA 1GZCA 1RMU3 4M0NA 4XZPA 4IGOA 3K48A 2ZX4A 4LR4A 4QQHA 2ZKNA 4LUMA 1X8EA 4GKXA 5FYUA 1OQEA 5BUVA 2P6HA 4XMIA 3OD4A 5IVCA 4PIZA 1ODNA 2BU9A 4QGMA 3VBUB 2DFCA 2DU0A 3WG2A 5JIAA 3MIHA 4L92A 4Y1YA 1AHSA 1PZ7A 5A32B 1VBE2 1OPMA 4GWIA 3MF9A 1LEDA 3AKRA 2O14A 2VCMA 2PA7A 2NP0A 4MGTA 1W6OB 2W87A 3C7GA 4Q4W3 3OBAA 4WZFA 4CEWB 3FL7A 3N4MA 1XNDA 4CDQB 1KD7A 4LKFA 5JPMB 4XABA 3R0RA 3I59B 1GYKA 1EYBA 2WRAA 3E1F1 3IM0A 4IEUA 1UXXX 2WJSA 3CJIC 1AR63 1JHJA 5LEJA 2W46A 3APBA 2J22A 1GR3A 2R042 4FQ4A 4OVEA 1W2NA 1JZ2A 4LKSA 2EXKA 2VR4A 3KF3A 1DZTA 1RUOA 3AKPA 3I3EA 1ULCA 5CFDC 4YW7A 2VQAA 3PHMA 4FFGA 1SBFA 5GKAC 5F3IA 3ZXDA 3ZYIB 4RGAA 3QH7A 4Y20A 4QPIA 3NNLA 2X10A 1VBC2 2E7AA 3A0KA 3ELNA 3FFQA 2JDKA 3DKWA 4NOTA 4CPBD 3O1VA 1CD3G 3MF6A 3DPRC 4OHZA 2D44A 2XDVA 4CU6A 2WQ8A 3HJRA 4Q4Y3 5FZHA 3D3AA 2XJPA 3LPGA 2EIBA 4IDZA 2R16A 1WZXA 4YW1A 2JDNA 4CRQA 2WO3A 2VO5A 4MHUA 1GANA 1IS6A 2RV9A 4AR2A 1AUYA 1GICA 4QMAA 4FOQA 1RUI1 5BNNC 4P9GA 4XFFA 5SV5A 4A3XA 5BNPB 3VD9A 3V0BB 4FFFA 1U12A 3URFA 4ZU7A 5I8SA 2RS12 5FY1A 4XIKA 3WVJA 1DIWA 2WT0A 1C8M3 1JOPA 4AHYA 3N35A 5AC93 2X8KA 5FAXA 3DGTA 3TEZA 4CDUA 5C33A 5FWJA 4RR3C 5JCTA 3FLTA 2ARBA 4CCEA 1W8WA 2VVDA 3GALA 3KVBA 4PQ9A 4XFBA 3T2PA 5A3NA 3QACA 4OHYA 2Y6JA 4FTEA 2OVUA 2XQRA 4LQRA 2HWE3 3VB9A 4E4SA 5FY9A 1WWYA 2XKPA 1VBB2 3ITQA 5JR7B 2OZ6A 2DU1A 2FCVA 1YHFA 2PAKA 4XURA 1W6NA 2X5IA 4CP9A 3FUQA 4IETA 3N3HA 5F7UA 1R091 2VZQA 1W0OA 2GMPA 2R49A 2AACA 4QPWA 3DYOA 1YO8A 4L8QA 4DMIA 1WKYA 2VZVA 1ZBE2 4MG2A 4PHZA 1U5ZA 3LWCA 4M3CB 1OH3A 4QQ2A 5FPVA 5IYYA 4JRLA 2PLV3 3LA2A 1FAYA 4Q1RA 3NJYA 5GZEA 2VOXA 2RR13 3H1MA 1UZYA 3F95A 3MBWA 3TYJA 4B1LA 1W05A 4UAPA 4N9IA 3VBFC 4UW5A 3ZXKA 1Y9GA 1J83A 2IVJA 1JH5A 3RYPA 2WSVA 3OPWA 5AVAA 3VZNA 4YARA 1AX2A 2P5BA 4CUBA 1YJKA 2A71A 5FK8A 3CKHA 4YVWC 5FZAA 3USUA 4IGPA 5FMDA 4IE6A 4LOTA 4FPGA 3O1MA 1TME1 5C8CC 3VV1A 2DVBA 2RE9A 1Q3EA 1IHMA 4PF5A 4EQVA 2RDQA 2WZR1 1Q56A 4AEJA 1POV3 1NLRA 2AEYA 4LE4A 5FO7B 1UOGA 3AFGA 1PIV2 3IBMA 2EALA 2B42B 5FZCA 2FDIA 3K4AA 2WFF1 3KLSA 1BBT1 2WKKA 4UXAA 4AI9A 4YM1A 2OQ7A 1AJOA 4JAAA 1RUD2 2XH6A 1SLIA 3LSEA 4IEVA 3FWEA 5EPAA 3VZLA 1SBDA 4PBOA 3GHMA 5A6QA 2DWRA 1XSRA 1DHKB 3I2JA 2B45X 4LK6A 5LRRA 2ZX1A 1O8PA 2VTFA 3I2FA 1OT5A 3GZUC 3KQRA 4O9GA 4WM7A 1YI7A 4JZRA 3WCSA 1EAH2 1FOD1 1RHI1 2MEV1 3OGSA 4OULA 5D8AA 3OGGA 1MQTB 1WBLA 4A6SA 5HV0A 2UU8A 4FFHA 1ZYBA 5LEKA 5HCFA 5FUIA 4B4PA 2JG9C 1CZSA 4ATEA 2D3PA 2K46A 2W0XA 4MHRA 4YYOA 1CAUA 4WM8C 1LODA 4XJ9A 3J7LA 3ZPYA 1HV1A 3MYXA 5C6CA 1KJRA 2VVFA 2VAUA 4U2AA 3T0BA 4QKNA 2YBSA 4ISRA 1GOFA 2HWD2 1PZ9A 2ERFA 1PZ8A 1H9PA 1JZ5A 2J1SA 4G4FA 1I5ZA 1A78A 1G6NA 1VRH1 2BGOA 1D4M1 2E33A 4IV3A 3MEPA 4QDSA 4TLGA 4DXSA 4I0AA 1IG3A 1WCSA 3WF2A 4GALA 4BZ4A 3ZXJA 2D97A 4RYDA 3KGZA 5FBJA 3JUUA 1CAXA 1LHOA 3K2OA 2QBXA 4YGEA 4FOVA 4PDWA 1HRV3 1H0BA 2FCUA 1W6QB 2OYZA 3T4HB 4AAPA 2HLEA 1V6LA 1Z7S3 4JGZB 3O1TA 3WW2A 2JWPA 1E5HA 3NNGA 2R0HA 1BVP1 4GQ7A 1BKZA 1PNFA 3V0AA 2QE3A 3MIBA 5C4WB 3RZMA 3PNAA 1YQ8A 2YFZA 2D5HA 5A3PA 4QXCA 1AR91 4XFIA 1UPSA 5A7OA 3BPSA 4DXTA 4QD2A 4GH4A 4CCLA 4LBQD 4GB33 1HB3A 3C7EA 3I2GA 1RUE2 4Q4X2 4UW6A 3RZZA 5GLVA 3UKNA 4XPVA 1LKNA 4HANA 4E2GA 1BEV3 2Y8KA 3NL1A 2QQUA 5FQ0B 1MS4A 3O1OA 1JMUB 3I54A 4QKBA 4JRAA 4QU2A 2XJSA 1LULA 2YC0A 2ET1A 1RMU2 2JIJA 3P1IA 3ACHA 3VBSB 4BXSV 4RS5A 3B02A 2I2SA 2LROA 1UOBA 2X09A 1LESA 3ZYFA 4KGGA 1G9FA 2WINB 3MI8A 3N7MA 4FOYA 5FO8B 5EV7A 3VUOA 1LGCA 2BYVE 5IATA 2JICA 3GNEA 1DGRN 1K5MB 2JG8B 3FHQA 5F5AA 2Q8DA 4ZHNA 2O1QA 4XF3A 2W1SA 1VBE1 4Q4W2 1UMIA 3EHKA 4PT6A 1JS9A 1DLCA 5CNAA 5JWPA 2Y6LA 1RC6A 4K21A 4DXRA 1Y43B 2ZGSA 1OMIA 5JOWA 1UL9A 3O5SA 1E5IA 1AR62 3S7IA 1YNAA 4GIQA 2Q5TA 1UQXA 2H0BA 4XXPA 3UESA 5FPLA 4AVTA 3CJIB 4I02A 5DPNA 5I0RA 1V6OA 3KV6A 2R041 4QAWA 2E32A 2D93A 2R7EB 3IT8A 4A4AA 3MIDA 4PI2A 5C8WA 4O9EA 1NE6A 3H7YA 3FLPA 5CFDB 1IKQA 2RHPA 3PUSA 5FZ0A 3P6BA 5D2AA 2A1XA 1CX1A 2E31A 1CAVA 2P17A 2BBVA 2ZCWA 4EWEA 4Y33A 1LHVA 3M2MA 3UJOA 1W8FA 3JZVA 4J25A 2I74A 1N3QA 1VBC1 3AP6A 4BISA 4XIOA 1F4HA 2XR4A 4Q4Y2 4M4RA 5DG2A 1M06G 3DPRB 5APAA 4EN7B 4LHKA 1XB9A 4O7XA 1PGW2 5FWEA 3MGUA 1EV13 1LGBA 1W9SA 2BV4A 2LS6A 3B9IA 3OGJA 4C1XA 5HCAA 2D3SA 1YXWA 3MLKA 3UKVA 5ACA3 3VL8A 4MO3M 1TMF2 4GWJA 1JUIA 3H3ZA 2WT1A 1OOPA 5BNNB 2C9AA 2PHLA 5DAWA 2W94A 3DF0A 4E4DX 1PX3A 2MNGA 2VTXA 4HK9A 2X29A 5AC92 1C8M2 4K8FA 4O61A 1PO23 3NJXA 1QH6A 2BFUL 1F5FA 3C2UA 4P02B 3WW3A 2RS11 2DTWA 2RDNA 2ZX3A 4I3PA 1YQ5A 1ZX5A 3LCPA 4GJYA 4XAEA 2NMNA 4RR3B 2VZUA 5GALA 4CYDA 5L7OA 1VB2A 3MW4A 3WUCA 3HN3A 4UBGA 1QNYA 5F8PA 4V1PA 2XJVA 2HWE2 4IE7A 4S2HA 3PJQA 2FDHA 4TYSA 1PMIA 4GWMA 5CB7A 4IEPA 2PELA 2KD7A 2FCTA 3ZYHA 1VBB1 4LLFA 4XMAA 2QQIA 3GYDA 3UGGA 5ABJC 1QJEA 4QT6A 5A7QA 1NYWA 2VUCA 1KDKA 4I3GA 2JEMA 3RPQA 4ASKA 1BHGA 1ND3B 4OHVA 1MZFA 2PLV2 5B4NA 1ZBE1 4OQ8A 4CXXA 2RR12 3EO6A 3WSOA 4CP0A 2P3KA 2W91A 4IUGA 2Z2SB 4V2WA 1Z78A 1UU4A 3CMGA 3GBGA 4RQPA 4YLZA 2WA3A 3UT0A 2ZGTA 3LD8A 3S0MA 2XVLA 4K9SA 5KR7A 2WZEA 1SFNA 3GM8A 5KWRA 4ITCA 4P9WA 1QU0A 3T30A 3LEGA 5JXHA 2VH9A 2WSUA 2OIIA 5FP8A 1UU5A 2WO7A 3VDDC 2XQXA 2PAMA 3LOIA 1GOGA 4YVWB 1DQ6A 2PHFA 3ROUA 1RUG3 5CKQA 1H4GA 4XCAA 1YFWA 2VQUA 5KHJA 3FN9A 3M3OA 5C8CB 2OT7A 5H9RA 2WNVA 4MYEA 1QJY3 3POYA 3BKZA 2O8OA 1VP6A 2B39A 3NNMA 4BDVB 4C1WA 4QX8A 3KSCA 1CZTA 3N7LA 4RN5A 4XUTA 2BTVC 3VD4A 3KCCA 4OUMA 1JU3A 1YJLA 1PIV1 1MACA 4YG0A 1IOAA 1HB2A 4JHZA 3ZSJA 2DBNA 4QPIC 5HXMA 1DGRA 4NHKA 1DG6A 5K9YA 3Q9OA 5DABA 5JLVA 4NWVA 1RUD1 5FYVA 1WW7A 2WQ4A 3LZZA 4AOCA 3HT1A 1RL3A 5AVPA 3CBNA 1IS3A 4LBQB 3POGA 5CIRA 3BODA 1EAH1 3SITA 1S2KA 2ZAHA 2DDUA 5LWBA 1XNKA 1UIKA 3LFMA 1AL22 4XXAA 4YZ2A 1UPIA 2JG9B 3SCFA 1LTEA 2GP3A 1LB2A 4IV1A 1J58A 1PK6A 2IXIA 4WM8B 2GN7A 2VMIA 2CNAA 3SEEA 3MIFA 5FY7A 4QM8A 4UFJA 5CKMA 4Q8KA 1UY2A 2P34A 3SKJE 5F9TA 2W92A 1LGNA 4BMBA 1HB4A 5JMOA 2HWD1 4XYXA 3VD3A 2ZS6B 1I1EA 1YRZA 4BLJA 1W6MB 2IXKA 1XSQA 2BGCA 5FZFA 1JOBA 3IPVA 5J36A 4P14A 1HKDA 3CLPA 3S6PA 4EROA 3L9JT 1TQ5A 5SV8A 3OUJA 4NO4A 3H1WA 1HRV2 2QZ2A 3H9AA 1OD5A 5EWSA 1LOFA 3VBRC 1PM4A 3VBHA 1G9AA 4CUCA 1Z7S2 3AMHA 3OUHA 3LKJA 5EJZB 5IWFA 3AYDA 4PLOA 4URTA 4NPMA 3SCHA 3ZIXA 2VOWA 2X5IC 1Q8PA 1VB4A 1W04A 3MV01 2DCZA 4CDWC 4CCDA 4MVTA 1AVBA 3VGIA 2DCTA 1WD4A 4ASMB 4MUVA 1A6CA 4KQ7A 3J8F3 1UF2C 2D6PA 3LOBA 1CR7A 4WVVA 5FOJB 1CJDA 4NE9A 2VCAA 2E53A 4TSVA 5T50A 3SH5A 4AVVA 3RNSA 4GB32 1O3SA 1N47A 1VMHA 1QOOA 2HYKA 3K46A 3K77A 3WNOA 1LAJA 1N3PA 5HI0A 1GKBA 2PMWB 3I3BA 4RL7A 3B9CA 1FX5A 1BEV2 2C6SA 1RUE1 2HH9A 3RMXA 4Q4X1 3K4DA 1J3QA 1OA2A 3ORJA 5FPAA 1LHUA 4TN7A 2Z4FA 4YPJA 2VM9A 2WQZC 3A0NA 3FLRA 3U10A 1YIFA 5T5JA 4XILA 3ZYPA 2VZPA 4CDXA 4YZ5A 1OSGA 1RMU1 4UF0A 4W6YA 4MV2A 1NCQB 2V5YA 2W2IA 4SLIA 1POQA 1B35A 1HV0A 4Z8BA 1K3IA 1LRHA 1AL0G 2NQYA 1KFUL 4W6XA 2DURA 3I7DA 4OZOA 1JZ7A 2A5ZA 1CPNA 5T3NA 3MUZ1 1O5LA 1JZ6A 5KHKA 3H50A 4BQ3A 2HEWF 4CCKA 4MXWA 3RFRA 3CEWA 4Q4W1 3RJ2X 3QCWA 4LHLA 1ZREA 4KMQA 5FZ3A 1Q43A 2DV9A 3FJSA 1UOJA 4D7SA 2H6BA 3SCGA 2IXHA 2ZA9A 1N1SA 4BQYA 1AR61 4BM8A 2CWMA 2JDAA 1I6XA 3LE0A 1QQP2 4YG3A 2YB7A 1CAWB 1LEMA 1EP0A 4WM7C 1W2OA 3MW3A 1UY1A 4ARXA 3JXSA 5D8AC 1EPWA 3P5BA 4L9BA 3M4FA 4LBMA 4XF1A 1DFQA 2ORZA 2YDEA 2YU2A 2ZMKA 3HMYA 4L11A 5C5TA 5A3LA 3KD4A 2EIEA 2HYXA 2C26A 3FZ3A 1REFA 5FPUA 4ZPIA 2VL4A 3VZOA 2PHRA 1V9U3 3U78A 3KS7A 3SKVA 2ZGQA 1S1AA 4ARYA 1VPHA 2DCKA 2IFRA 3KCYA 5FIXA 2UWCA 5BY5A 2JXAA 4Q4Y1 1RINA 1RVF3 2D98A 2LTNA 1EV12 2GC0A 1Q8VA 3AP4A 3EMRA 4XUNA 1PGW1 4IV3C 2Y60A 5FY4A 2VXJA 1PO13 4ES8A 5ACA2 5FJKA 4M0HA 4OQ9A 3TOJA 2DUQA 2GMMA 1QIQA 2F6BA 3ETPA 5D21A 4QHBA 4A45A 1TMF1 3J9SA 3LDRA 1H1AA 3DCQA 3LFIA 1SFPA 4IERA 4PDWC 5C9AB 1PO22 1LOGA 2WWSA 4XOGA 3T2TA 1O4ZA 2MPFA 5AC91 1C8M1 3ZOIA 3OD0A 2WS92 3UKTA 1VJ2A 3WNPA 2B7YA 2WA4A 1FMD3 5K7PA 3WY6A 4CP1A 1REEA 1RUD3 5JDBA 1KRIA 2RS53 4Y1UA 2R063 3VKFC 2WO1A 3ETQA 1WLTA 3FE5A 1SDWA 5L36A 1GWKA 2VQTA 1RUH2 3POJA 2VZ3A 4JTNA 1CPMA 3WDVA 2ZGKA 4XBQA 1PX4A 5DZGA 1QXRA 2PHDA 2HWE1 5FUPA 2ILMA 1NLQA 5A7WB 3ZXFA 3OEAA 3UNPA 2P37A 1US2A 1BMV2 2CAUA 5J98B 1J3RA 1JBCA 4NROA 1QDOA 3ZSEA 3PIJA 5ABJB 1D2QA 2RS33 4LUKA 5L73A 4AFDA 4Q0SA 1OQDA 2VMGA 2K0GA 5JOZA 2W47A 2XJUA 4EE2A 4ASLA 4EN8B 2VC9A 1XNAA 1E57A 1GBGA 2ZZJA 4D69A 1MS5A 5F39A 3BN6A 1U0AA 4G9SB 2PLV1 4ONUA 5E89A 5EHDA 3GF6A 4A7KA 3C8XA 3OY8B 2RR11 3FBYA 2VQ0A 1PVXA 3IAPA 4XFCA 2GALA 3E6DA 5BNQA 3LF7A 2Y64A 1ENQA 3WF0A 3DN7A 5GZCA 1NXD1 3MIGA 1RUG2 2RDSA 1CN1A 4HZFA 4XJZA 1FPN3 1W6PA 3MV11 1DZQA 4J1XA 4PIYA 2EICA 4LULA 4UFHA 3VDDB 1IPKA 5K0UA 2JIGA 2YY1A 3BI3A 1X8MA 3WUDA 1QJY2 3S5QA 3AP7A 2VVEA 4QKFA 1KEXA 3K51A 4XBNA 2VUJA 1POV1 4MGKE 5EJ1B 1S0JA 4OUSA 3FX3A 1YFXA 4Q5OA 4D8MA 1C4RA 4QXBA 2VNVA 4NHYA 1A34A 1BXHA 4CXWA 4Y26A 4I09A 3F2ZA 2XBO3 1YIPA 2FMYA 4FPYA 5FPBA 4UYBA 3W20A 4AG4A 4QB6A 3T4VA 2KR2A 4D7YA 4N53A 4AEDA 1XPWA 5K0UC 3POSA 1K45A 1GQPA 1X9TA 3HAGA 1U5YA 3ZSMA 2P3YA 2YBKA 3UYJA 2DVAA 5BNOC 3BU0A 2QQKA 2OXBA 2AYHA 5FZ8A 2ZGMA 4NRQA 3AMMA 4NHMA 4FPEA 3LQCA 1BYHA 1KQRA 2RMU3 2DUPA 1NCRA 3WNKA 4MGIE 5DZFA 5FZOB 2YMZA 4Q0UA 1OOPC 4YFWA 5LB6A 3RDIA 1AL21 5I0UA 3ZFFC 4AEMA 3CF6E 1XU1A 3AKTA 4AFBA 1SLAA 4JKLA 4FXGB 3OCPA 3M7AA 4XF9A 5A70A 5IK4A 4Q4V3 4IL7A 1XNTA 1OXCA 3WF4A 4FTSA 4BE3A 1SCSA 5T5PA 1BVVA 1Y9QA 2PXJA 2VNRA 5IK7A 2Z5WA 1JU4A 1VBD3 3BIWE 2B8MA 2JB8A 3NV3A 2R32A 1YUDA 1W90A 3M3QA 3OTFA 4ISQA 1UNBA 1HN1A 4OYUA 4RA0A 5KBFA 3PIGA 2B9UA 4NPLA 2WO2A 3R4DB 3BIEA 3VBRB 5I8YA 1HRV1 2HWF3 2JE8A 2GZWA 3OF1A 2V72A 1Z7S1 3VBOA 3WCRA 5CISA 1VRBA 4CDWB 2F4LA 4YW4A 4N7UA 1NA1A 3J8F2 4YNIA 1FI2A 1V6MA 1BCXA 3JU9A 4F3JA 2GC1A 2DBIA 5I0TA 2WBKA 3OPTA 4FAGA 1JYCA 1LOBA 1W3VA 4HPKA 5FZKA 4ZZ5A 3TNQA 2CSGA 1AX0A 2VU9A 4KGQA 4IEOA 3EXUA 3ATGA 3AMNA 3WX5A 5HV4A 1BLZA 4GB31 4IEZA 4XJAA 4LA3A 3LDKA 3TB0A 4JDOA 2D6MA 1W0PA 5DXDA 4E9KA 4GZ9A 3KWVA 1HRI3 1KS4A 1TMF3 1W0NA 4X8NA 1BEV1 4GD4A 3ES1A 2VTXJ 3FHAA 4YVSA 1RUJ3 2Q1ZB 5E8AA 1MZ6A 2G9GA 1R64A 1S2EA 3L2HA 5E16A 3LSDA 2ZEXA 1JODA 2VMDA 2B4KA 4OUEA 2WNVC 3ZFGC 1AZDA 4F83A 1QF3A 1KDMA 3HIFA 4QX2A 4NIGA 1UZWA 1Q8OA 5FLIA 1GWLA 1GSLA 4IQPA 1AYM3 2W1WA 5E88A 3NV2A 4IEQA 3D0SA 2CDOA 4YW5A 5FZIA 3VBUA 5B2GB 2FBEA 4CEYC 4RFRB 4H7LA 4N43C 2J1TA 3Q8FA 5A32A 5AFBA 2YXSA 2V4AA 3RI9A 4UBHA 4GMP1 1LHNA 5A6ZA 1FATA 2E6VA 4JGYB 2DCJA 1W6OA 2HBTA 4CEWA 1HB1A 1DYKA 2EIGA 1VBA3 4CDQA 3PVBB 3I59A 1QQP1 3WNXA 3FMGA 1ND2B 3PU3A 5IVJA 1QOTA 2ZMNA 5C3OA 5F1RA 4AI3A 5A7SA 1O4YA 4FCAA 4OI1A 4ZZ8A 4HFSA 1OA4A 1V9U2 5JI9A 4XTPA 1E5RA 4IV1C 1ZRFA 1PK6C 3T1LA 4BQXA 1KFXL 1HXS3 2P3IA 4Y1VA 4B3NA 2NYYA 3E6BA 4Q29A 1RVF2 4FPFA 2Y26A 1EUUA 2R1DA 2WWUA 3BTYA 1FV2A 5F32A 1PO12 4XHBA 4JC1A 4AK3A 1EV11 1GMMA 1QY4A 4AWDA 3BTAA 2JDMA 1ODMA 3GZAA 4Y5Z0 1OC1A 2P1BA 2ZGLA 3FHIB 5A3TA 5ACA1 4CUAA 4CSWA 3NV1A 1OLMA 5F37A 2CU5A 3VHNA 5LA0A 3NAPC 1MEC3 1LOFC 4NVPA 1S55A 1YQ6A 3R6SA 3VBHC 3AM2A 5FYZA 3ZXEA 3ZO0B 1PO21 1LU1A 3VN4A 1FMD2 4IGQA 5A6XA 4R9CA 5CBLA 1H4HA 5EYYA 5A7NA 5BNPA 3V0BA 2YFUA 2JD9A 5JXJA 2EXIA 2RS52 1GUIA 2R062 2WS91 1OLRA 4J6GA 1QWRA 3EB7A 4GKYA 4E4HA 5T54A 3AZVA 4LE3A 4Y4YA 2IFWA 4YW3A 1N1TA 4BWOA 2QQPA 1U5XA 1RUH1 3OGRA 4HLTA 4IESA 2Q4SA 5ANQA 1XNBA 2D7FA 1GWMA 3W58A 5DUUA 4NIHA 4XQ4A 1BZWA 3SISA 1PGL2 3O0VA 1AR73 2OZJA 4Q2FA 4A7YA 2RS32 1QKQA 4DEVA 1BMV1 3ENRA 1NT0A 4FI9A 1AL23 3ZFEC 4D94A 2VE1A 3KZ4C 4ES9A 1SCRA 5BV6A 1HIXA 2YC2A 1ZBA2 3AMQA 4P5YA 4B8EA 1RIRA 2PFWA 3M3IA 2XJTA 3BVCA 4KG0A 1XJAA 4LOSA 4NPRA 4CCJA 1RJ7A 4JDNA 3AXEA 1X36A 4YGBA 4B29A 3ZDSA 1PVC2 1GZWB 1C5IA 3L2YA 3THDA 3IDCB 4BMEA 1SLLA 4FPLA 1OKOA 1QOSA 5F2SA 4M3CA 3BTZA 2UY8A 4INDA 3D82A 1YQCA 4ZKTB 1TG7A 3ZM8A 2IXJA 3ES4A 2WNUB 1FPN2 4FP3A 3ZYGA 1STMA 4HBNA 5FMOL 1J1LA 4ATFA 1V6KA 5DMYA 1RUG1 4YG6A 1CZVA 5FP7A 3ZMNA 1SPPB 2OPKA 2YYOA 1ZA4A 2WT2A 1US3A 1QJY1 3IIIA 3AB0A 3V56A 1ULDA 2ID4A 3JD72 4Q0VA 3U07A 1LHWA 4CU8A 3T3YA 5T5LA 4E2SA 3ILNA 4QX0A 3NW4A 4EZHA 1C5HA 2XBO2 1LECA 4H7MA 4BU2A 4XUOA 5CFCC 1GP5A 4LO5B 3I2KA 3N7KA 2XHKA 3HN1A 2QQLA 4HN0A 1G9DA 1FNZA 2RJ2A 5EJ3A 3NJZA 5FP9A 3POWA 1F9KA 2GN3A 3GJAA 4HKWA 5FZ7A 5K4LA 1OFNA 2AEZA 1CIWA 4S2GA 5J1XA 1ZZ6A 5BNOB 1DQ1A 1VALA 3B69A 5DUWA 1XE0A 4CVUA 2RMU2 3Q8EA 4JDMA 4IEWA 2VMFA 1W99A 3HQRA 3WDWA 1P8JA 4YZ1A 2YUEA 4I01A 5H9SA 4XJ8A 1TEIA 1MQTA 3GCWA 5LRSA 3K3NA 4AL9A 3WNMA 1J59A 1RUF3 4MLOA 5FDBA 1UY3A 3S30A 2H0VA 1D4VB 1OI6A 3ZFFB 4DRVA 2C0ZA 4IEYA 4Q4V2 3D0JA 3WNLA 5DG1A 3C7FA 1H8TC 5FZEA 2XUMA 5A80A 1VBD2 5JZGC 4GMP3 3RZHA 2XKOA 4FVVA 4YW2A 3UK9A 1DYOA 3AL6A 2QDRA 2DF7A 3ZR6A 1WLWA 4C90A 4OHXA 3EBRA 1VLNA 1SLTA 1QQP3 3OSDA 2HWF2 2J42A 4QQPA 2VULA 3AP5A 3WD5A 1GQGA 3I2HA 3RMYA 4KH9A 3I49A 1ULPA 1MVEA 1D2SA 3B3QE 3BB6A 3OUIA 4D7TA 4A41A 4XTMA 3N9MA 5KC5A 1W6QA 3CIHA 3O7OA 5EIYB 4JGZA 2QQOA 1W8NA 2P4EA 3MZHA 4Z1VA 3J8F1 4R4XA 4LBOA 3WT3A 2ZABA 5LY1A 1ULOA 4DNYA 1WLCA 3T2OA 5E1RA 3H8RA 1GQHA 1V6IA 3AFKA 5C4WA 2JDZA 3BPZA 4N90A 2V09A 1OKQA 5LA2A 2Y34A 2F17A 4GWNA 4W8JA 5KXCA 4Y24A 2XWBB 3VHPA 3BOWA 1HRI2 3MUY1 1XBFA 1UAIA 2ZHNA 3TBDA 4V2VA 4K8RB 1RUJ2 5J3UA 4DINB 1LR5A 2BJSA 1UZVA 4CPBA 1K42A 4IE0A 2VZOA 4DUWA 1IS5A 4LIUA 2WN2A 3ZSKA 3ZXLA 2VUDA 1ZZ7A 3K4ZA 4QPGC 5FQ0A 4KI5M 2VBPA 3VBSA 4F7ZA 4L0PA 1PMJX 3ZFGB 2WS93 4Y22B 1JZ3A 3LEMA 4XF4A 5A3WA 1RB8G 1AYM2 1NZCA 2BZDA 1A8DA 2ZEYA 4JV4A 2FDKA 2VMHA 2BP6A 3NNFA 1K5MA 1RUH3 2A7AA 2JG8A 4XEZA 4Z07A 2UYBA 3AMPA 5FYMA 4K3UA 2D6OX 5FZ4A 4CEYB 3CNAA 3FC0A 2WIIB 4DY3A 1JYVA 4N43B 4N53C 2ZGRA 4AEDC 3B93A 4TZDA 4Z82A 4FOWA 4QQLA 4LMFA 3IDBB 2VCBA 3VD5A 1PGSA 1XNCA 1QJX3 2A73B 3HR9A 1OQ1A 1VBA2 4RHV3 4UW3A 5IJRA 2IZWA 1L7LA 3SC7X 3O14A 3I2OA 3SEPA 3HBKA 3LGRA 5I93A 3KVAA 3ME2A 3UJQA 4QHOA 3OYWB 2HWC3 4B1MA 3U4SA 1C8NA 3ACIA 3CJIA 4OI2A 3RI8A 1HN0A 3WW4A 2FZ2A 4MSVA 5FP3A 3KCXA 1NCRC 3T09A 4CCMA 3P3PA 3HD8B 4DB5A 2VOKA 4NUBA 2QVSB 1HXS2 1LOAA 1SLCA 3MICA 2WR9A 1V9U1 3UV9A 3VBFB 3O1SA 5CFDA 2R1BA 4E4ZA 3VDBA 1ENXA 4PBPA 2W3JA 3KHBA 3VDCA 1QGLA 2YG0A 3E6CC 3WEZA 2DFBA 4M4PA 3POBA 1RVF1 1HLCA 2GNDA 3M8LA 2H6CA 4Y4RA 2VZSA 1W06A 4P5HA 3DPRA 4Q1PA 5EQUA 1PO11 5LK5A 2K9ZA 1UOFA 3BTXA 4WVMB 4KWKA 1MEC2 1C1LA 3N36A 4D3WA 3RZJA 3LEKA 1JYTA 3P3NA 2VCCA 1OA3A 3NAPB 1DGLA 4MOAA 2YC4A 3THCA 4QDRA 3WP3A 2A6VA 4FPKA 3HNMA 2CTVA 2XUEA 5BNNA 2CGNA 4MH0E 2WYSA 4K1ZA 2RM23 5DAQA 1FMD1 1DBNA 3NRUA 1OD3A 3QBQA 4D6SA 1GU3A 4LBNA 5F3EA 1ALYA 1IQDC 3W21A 2RS51 1O3RA 2R061 2JE7A 1W9WA 2LRPA 1VAKA 4HMZA 4JTOA 4XE9A 3SLIA 2RDRA 1JHNA 1WCUA 2O8QA 2BFUS 4RR3A 2G4IA 4RFT0 1RUC3 3PU8A 4AE2A 2Y38A 4LT5A 2QQNA 4UI9L 4CTEA 5C7GA 1AR72 4FO9A 1Z0HA 3KF5A 3BCWA 4XCBA 3I3QA 4NRMA 4UW4A 3THPA 2YGLA 1UYZA 5C5UA 4BPZA 1W8UA 4E8CA 1C28A 3CJXA 1PGL1 1JUHA 2R30A 1I9RA 2OPWA 2RS31 3BU7A 1GLHA 4QB2A 4YVSC 3RS6A 4NIIA 3KQ4B 2PHWA 5FXZA 3ZFEB 3WQ1A 2Z42A 4BIFA 2BNNA 1O59A 1QJFA 1H8VA 2BGPA 2J1AA 4KBZA 4XFGA 1TNFA 1IS4A 5CA6A 1NUKA 1ZBA1 5CEHA 1JYNA 4H3WA 4CDUC 2LUWA 4IEXA 5KC6A 5J96B 5K8SA 1PNGA 2ARAA 1ND3A 1W8HA 2Q0AA 2VECA 2XL7A 2XLFA 3FFZA 1PVC1 5FZBA 5G04L 1E5SA 2DYCA 4HSJA 1W28A 4Y1XA 4HVOA 4QX7A 1S0DA 4QX3A 5F5CA 2PQQA 4UFKA 1RUNA 5GZFA 4N9HA 4NWWA 3VBUC 2XVGA 3NV4A 5FZMA 3ZX7A 3H3UA 4RGKA 3POFA 3MDPA 3WOGA 4BQ4A 3AVSA 1FPN1 4AI8A 1FXZA 2E7TA 2Y6GA 5FYHA 2QQMA 3AJYA 5FYIA 4Z2WA 4YVWA 1MZEA 4AQSA 4CEWC 4P9JA 1XC6A 2C1FA 2OW4A 4NMIA 5IVFA 4JQTA 1CJPA 2VW0A 3AKQA 1LJ7A 3ASIA 4DZGA 4ZS2A 3JD71 4EN9B 4QM9A 1T6GC 4N8MA 2ADEA 3A4UA 3ZYBA 5F3CA 2JENA 4P9XA 1OLQA 2CYFA 2W68A 1DP0A 3KT7A 5FKCA 4LXLA 3AVRA 3E5XA 3CL1A 2YHJA 4KWLA 3VZKA 1V6JA 2WZPP 1UZZA 4AEKA 2VJXA 2XBO1 4BHPA 1JZ4A 4K40A 4W4ZA 2Y0IA 2BQPA 5CFCB 2CGPA 5JSOA 4GJZA 1ENRA 4LLOA 1G9BA 1MS1A 1SFYA 4R8HA 3NQHA 3ZN5A 3IZOA 2VG9A 1O3TA 5KXDA 3VLBB 2XOMA 4PF1A 2W1UA 3H8UA 3WINE 5L9BA 1ASJ3 2OA2A 2A3WA 2ARCA 1OFSA 2X53S 2BVBA 4BIOA 2TBVA 1V00A 1ZZ8A 1NZIA 2RMU1 3UGHA 2DUOA 3TWIA 2YROA 4A2UA 3WQ7A 4LBQA 3BGAA 2PYTA 1TVGA 1RUF2 2Q30A 5FTTC 4OZXA 5ISLA 1NQDA 2ZTNA 3S7EA 3VKMA 1POV0 4AI1A 1XE7A 1N3OA 1QHDA 5A6YA 2JG9A 3VHOA 1HJGA 2VMCA 3MW2A 5BNPC 1NG0A 4Q4V1 1R1A3 4WM8A 1H8TB 3OOXA 1TZOA 5FP4A 3QLQA 5H9QA 3SH3A 5JZGB 1VBD1 2Q8CA 3TAYA 4BQWA 3ZN6B 1JW6A 4H14A 2JECA 5DUXA 4GXLA 5HCBA 1W6MA 5IVBA 5IK8A 3OBRA 4UOJA 4DFSA 1H1IA 2JDUA 2ES3A 4PLNA 3HWJA 1DQ2A 2A6ZA 2HWF1 4BQ5A 5FR3A 4TLFA 1AR83 2GNTA 1XYNA 2HKXA 4C91A 1RJ8A 3N9OA 3HPNA 5E6HA 3UETA 3UL2A 3AKSA 2SBAA 4CXYA 1HW5A 4Z92B 1JTZX 1T6BX 4WZCA 4ZY9A 4C8DA 1CX4A 2D6NA 4AF9A 1ULEA 2D3RA 1GZTA 1PHMA 4R9AA 2ET7A 4FQZA 3ZPOA 2VNGA 1AYN2 4UFMA 1BK1A 2SLIA 4PCRA 2GSYA 3T0AA 3ZKYA 1HRI1 2BBAA 3MLLA 4OMDA 1I3HA 1RTVA 1RUJ1 2RVAA 3S57A 4AFAA 1NXMA 4QXHA 4HVRA 4LBLA 1WW6A 3N9NA 4COVA 3AXDA 1XOYA 3GBFA 3HBZA 4WV8A 4QPGB 4AQ2A 3I4IA 1WW5A 3TEWA 4U36A 3J7HA 3OG2A 5EYXA 1DDLA 2GDFA 5IAVA 3A7QA 3AJZA 4KU7A 1VMFA 1HQWA 2FQPA 1NCQA 3AZXA 3E5UA 2Y33A 1S0BA 4M3CF 1TE1B 5A33B 1AYM1 3VZMA 4DUXA 2ZX0A 2GH2A 4LO8A 4GH4C 2BEOA 5FXVA 2V4VA 2IXLA 2WNEA 4NJ4A 3DXTA 2HWB2 2AUYA 1J1TA 4D6QA 1QJX2 4RHV2 4CZSA 4FAHA 3FBMA 1K12A 3IMNA 4KG8A 5B4XA 3MFAA 2BNOA 1VBA1 2HWC2 2WABA 4S2FA 4RS5C 4IE4A 1UW8A 4PIXA 5LBCA 3POIA 5LBEA 5GLWA 1ZBA3 5DDJ3 2I45A 2AGSA 4LO7A 1C3HA 1M4WA 1VE0A 1CAWA 2A70A 2D6LX 3H1YA 1SMVA 2YPDA 3CQOA 4NAMA 1CIYA 2QQVA 3T08A 2BW8A 2JDPA 5H9PA 4YM3A 1PVC3 2ZGNA 2YGMA 4XDPA 3PDQA 4XHXA 2WLPA 4KU8A 3LPFA 3WDUA 4CP2A 1HXS1 4MZUA 1ZZCA 2AC1A 5A1FA 3NWKA 4ZS3A 1GV9A 5C70A 1OURA 5IK5A 1KITA 3I97A 2J1UA 2ZEWA 1XE8A 4LHSA 3T1MA 1CGPA 2XPJA 4AFMA 4FP2A 2VW1A 4YM2A 3KB5A 4P00B 3KGLA 2XVKA 2ZBJA 5LASA 2XONA 2FDGA 3WR0A 4S2DA 1OH4A 2OUHA 4AGVA 2QQWA 2G19A 4YZ4A 5LY2A 3JD73 5LW9A 3QOPA 1H30A 1MEC1 1XYPA 2B46X 3NNJA 4DOUA 1G9CA 1B09A 4DY5A 5AFEA 4M00A 5KXEA 4COZA 2QKDA 2F4PA 5L9RA 2RM22 2UURA 4QGLA 1L3JA 1X82A 3CHXA 1ZZBA 4HKOA 5C9AA 4Y20B 4QPIB 5IAXA 1LU2A 3CZUA 4TXWA 1N1YA 1BQPA 1UKRA 4JGZC 3ZXAC 2DVFA 3H7JA 4B4RA 5A7PA 2ZOEB 1R1ZA 1LCLA 4Q0QA 5J37A 1GNZA 4LBKA 1WCKA 2VXRA 1RUC2 3MPPG 3WP6A 2FDFA 1DZRA 4BYYA 1EY2A 2CGOA 3U0ZA 1WUVA 2A6XA 2IC1A 3GCXA 5G05L 5JOXA 4AQ6A 1AR71 3AZZA 3VD7A 3WF3A 3AYEA 1NE4A 5A7WA 2XLAA 2ZHMA 4QWNA 3V65A 4COWA 3I3MA 4LJHA 4AVCA 4PI0A 5GJ6A 1WD3A 3SQOA 3Q8CA 4AI0A 2GMEA 1UKGA 4W65A 5ABJA 3SNMA 2ZHLA 4QQOA 3O0WA 2YV8A 4UWDA 3ILFA 4R9DA 3N9LA 1MZ5A 4CDUB 1H6YA 1QJU3 4YRDA 4X6QB 5J09A 4FPJA 3RJRA 5L7OC 3R4UA 4OFGA 3B00A 2EAKA 4EWDA 2CL2A 1MS9A 2ZX2A 3HOBA 4FTBA 3OY8A 1QNWA 2VZTA 1K5MC 2JG8C 4AFCA 2PTMA 3WHUA 2ZPXA 2JB4A 2VBDA 3LIHA 1Q5OA 2ZXQA 5FREA 5FZ6A 5C3RA 3JBG3 4I30A 5GM0A 4YM0A 1JXNA 1UMZA 1ZRIA 1W6NB 1GP6A 1D0GA 2X5IB 4CP9B 3VDDA 2VMEA 3KV5A 1GZ9A 1BK0A 4X8PA 4XAAA 1C57A 1VR3A 2QCSB 1CONA 3U1XA 2DTYA 3ZR5A 5LCWL 1GOHA 1JYWA 3QH6A 5F5QA 3AX4A 5F5IA 3WG4A 3WV6A 4I0BA 1XXNA 4HK8A 4RQPC 3VL9A 5JPNB 3NVCA 4EV0A 4K6BA 5FRAA 2BNMA 3T0DA 2BWCA 1JN2P 4XZUG 3THTA 1YQ2A 4NIDA 3USUB 2BWAA 3IWZA 3JB8A 1R083 1QXPA 4Q26A 3WQBA 2QJVA 1ASJ2 2CV6A 2P3JA 5I0SA 5FPZA 1VAVA 2BPA2 1H2NA 1DGWX 1UU6A 1W8TA 1YCIA 2XL9A 1IPJA 3PMSA 1KXGA 1GP4A 1QJZA 2JJ6A 2YU1A 3GHNA 2WZ8A 4DS0A 3DV8A 1ZVFA 3KT1A 1V70A 5FMCA 3WXPA 3C3VA 1RUF1 2VBBA 2GNBA 5FZOA 2AREA 1R1A2 2PHTA 1S0IA 3DYMA 3HT2A 1W39A 3J7MA 5DN2A 5FK7A 2Z79A 3HNBM 1AX1A 1COV3 5CU1A 1RITA 1W9FA 1S0CA 3WW1A 3IAQA 5BXXA 1H2KA 1OBNA 2E9QA 3O0XA 2XWJB 3WG3A 4OI4A 4WM7B 4BXFA 3PUIA 3TN92 2ATFA 5D8AB 1SACA 3K75B 1AR82 4A44A 4NR1A 1UYXA 4PQQA 3PLQA 2D6KA 4AVAA 4UFIA 2KXLA 2Z69A 4OCTA 4YW6A 5FY0A 3VBRA 1EUTA 4EN6B 3RYKA 1CAUB 3N9PA 3PUAA 5GZGA 2R072 3MIEA 1EPZA 1GNHA 4DUVA 4CDWA 5I8TA 2ZJCA 1YWKA 4IW3A 2EIDA 2FD8A 2HBUA 3RVHA 5A3UA 3RZGA 2CY6A 4HKLA 1ND3C 2WUHA 4HSLA 4IV3B 2CDPA 3A23A 5FUNA 3SXWA 3ZYJB 2C9KA 4LHNA 1AYN1 3KHCA 2BUKA 3O1RA 4NN0A 1IG0A 3AYCA 2A6YA 4LKEA 4P08A 1CAXB 2GNMA 1IGOA 4PDWB 5HBAA 5IVVA 3DKQA 4K7JA 1WCQA 2FMDA 1YFUA 2ZGOA 5ERLA 4IE5A 4NIAA 1NLSA 1XU2A 4AVBA 2PHUA 1SEFA 4E2QA 1F8VA 2WDBA 3OGVA 1OF3A 3V0AB 2VPVA 3O1PA 1MS3A 1W9YA 2W08A 1F35A 3B94A 2VOTA 4C0HA 2ZACA 4NAOA 1MPXA 2ENRA 4XACA 2N7GA 1O6UA 5JI7A 4AGGA 5A1AA 4YWAA 4GH4B 1F4AA 3EYPA 1WMFA 4YSFA 3RYRA 4L2NA 1D7PM 3H8OA 4XDOA 2HWB1 4BJ0A 2YBPA 4AZZA 2FZ1A 1QJX1 4RHV1 4JHTA 4AYUA 5FXWA 5JXGA 3VDAA 4CDXC 1O3QA 3M70A 4JGYA 1IPSA 4RS5B 5DDJ2 2HWC1 1XYOA 5FLJA 2E63A 4OLLA 2ZMLA 2BOJA 4P9YA 4KWJA 3BALA 1XRUA 1B35C 5T52A 1VAMA 1MR5A 2D43A 2Q1FA 1F5JA 4N7IA 1ND2A 2XB6C 4Q27A 1YFYA 3R05A 2G9FA 1H6XA 1WA4A 1N1VA 3IDEA 5I0DA 1GNYA 2Y0OA 5T5OA 1DYPA 2D5FA 4C0BA 5HCHA 4XFHA 3OEBA 2OX0A 4RD7A 2EXJA 2OKXA 2QQJA 4CE8A 4MXVA 5HXVA 1WLDA 5FYCA 4NHLA 4BK4A 2WFPA 4CCOA 4K20A 3AK0A 4KBBA 4Y5TA 4NRPA 2VNOA 1ZZ9A 3OPZA 5LZ6A 1W9TA 1FT9A 5FO9B 4FSJA 3WG1A 2UWBA 1NKGA 4CUGA 4B4QA 4HT1T 1HJFA 3ABZA 1OPOA 3AZWA 1IKPA 3AP9A 4YGCA 1CAVB 4XQDA 2RM21 3U4XA 5A3OA 5FZ9A 1FYUA 3PL0A 4META 1V0AA 1WCDJ 2WN3A 4QDQA 1UMHA 4MGZE 2KM2A 4HVQA 3HNYM 3VHRA 3JB4C 1S2BA 3KMHA 4JCKA 1OHFA 3RWKX 1S0GA 3JQXA 5TSWA 1MS8A 4ET7A 5GZDA 4A6OA 1O8SA 1RUC1 4W50A 4DXZA 2BVVA 2G1MA 3DUIA 3VZJA 3ZLIA 4E8DA 1L7RA 1SG3A 3WDXA 3WP5A 5FYTA 1OVSA 5LA9A 3ACLA 2WC2A 2NPIA 2AR6A 5CKNA 1OOPB 4DPNA 4ZXKA 1O5UA 5GLZA 2VY0A 2WLQA 4WVWA 1RUI3 4LEJA 3RGBA 3BOPA 3W59A 1QJU2 5IT6A 1SQ4A 4TWTA 1ENSA 1NAEA 4URAA 1SDDB 2QNKA 1NCQC 1OVPA 2WNOA 4DO0A 4DRRA 5HPOA 3SH4A 2JKXA 4AVSA 3MHZA 3NSTA 5L7OB 2RJKA 3IMMA 5FKBA 2UY9A 3W5MA 1GZWA 5CG9A 1CWPA 3ILRA 4G3YC 3JBG2 3USSA 3DXUA 2YPJA 1DF0A 3O1UA 3D6EA 4YGDA 1UZ0A 3I2DA 2WNUA 3DEMA 1UN1A 4Y3OA 3ZN4A 5FPXA 1NY72 4BLIA 2IUWA 4R52A 5JUVA 2DCYA 4R9BA 1YEWA 1SPPA 2W39A 2QFEA 1HQNA 5FMOS 1HDKA 3ST7A 1Q8SA 2NLRA 4HXCA 1R093 3D5OA 1MVQA 3GXUA 3VKOA 1X7NA 4D0QA 5EZWA 4L99A 2LW8A 4LO4B 4RQPB 4XFAA 5F3GA 3C7OA 1AXYA 1YYNA 2WL1A 3TEYA 1AYN3 5KHIA 5FV3A 2Y6KA 1R082 4X6RB 5FFOC 1CESA 4XJWA 4LPLA 5FXXA 1JYXA 1OF4A 5FOBB 1AF9A 3M3CA 1ASJ1 1H1MA 5T55A 5DZEA 1T2XA 2AH2A 4WBBA 1SBEA 1W8ZA 2WNVB 3B5LB 3RRDA 4AAXA 4ZU4A 4BH9A 2E7QA 5BNOA 3H0OA 1TME3 4AHZA 4W6WA 3W9AA 4BCUA 1UIJA 1J3PA 1QXJA 3CO2A 3HEIA 3U11A 1UO9A 2WZR3 2NMOA 4LBJA 3WDTA 5JVVA 3X29B 5JR2A 3PJYA 4MGQA 2EXHA 4HL0A 4ZU5A 1ZA7A 5C9AC 1W3XA 1COV2 1DQ4A 5I91A 1R1A1 1W8OA 4KL1A 3ZFFA 1UCXA 2WFF3 4BQ1A 1PM7A 3HQUA 2HWB3 2YZ4A 3ECQA 4MADA 1BBT3 2OUJA 1IZ3A 1GFF2 2VGDA 5F2WA 4XQWA 5FZLA 3J26N 3LIGA 1ZM1A 5DAXA 4PJYA 2LM3A 3MFCA 2W5FA 4OMCA 4AQTA 2ZAAA 1REDA 3HQXA 1Y4WA 3QD6A 5F6KA 3RQ0A 5LBFA 2WYFA 1WMXA 3OBTA 2R6QA 2I07B 3NKGA 3OJBA 3TN91 1DQ5A 2XLGA 2JE9A 4GAZA 5CZKA 5IW0A 1AR81 3WZ1A 2Y6HA 1FOD3 1RHI3 2MEV3 3OB8A 5FJHA 3DYPA 5LBBA 4AW7A 4IV1B 5BYNA 1A8MA 1PK6B 1TNRA 3VKLA 4HN1A 3RSJA 3EQEA 2R071 2GC3A 3LAGA 2A3XA 2E26A 3LA3A 4YZ3A 3GBWA 5JXIA 4J1WA 1WBFA 1WGPA 3GZTB 2BOIA 2C4XA 2GAUA 2WWJA 5KHGA 2Q8OA 1KGYA 1ZRDA 3IPVB 1C1FA 3J4UH 3NO8A 3GJBA 4GA9A 5L9VA 1VRH3 2QUOA 3T2QA 1D4M3 3WDYA 4Q8LA 2D40A 3J7NA 3NMBA 4UT5A 5LATA 2ADDA 3VBHB 4SBVA 2C5DA 1L7QA 1SHWB 3WLUA 1AXZA 5DAPA 3VBOC 3ZDVA 4AGRA 3G7DA 3Q8AA 4BK5A 2FDJA 3CDZB 3D4KA 1F2NA 4XBLA 1W2TA 1NA1C 3LEIA 2J1VA 3NKTA 3INAA 5FMBA 2NM1A 4FXKB 1OLME 2UWAA 1ZRCA 4XETA 3A22A 2VZ1A 4BQ2A 1RYYA
chains in the Genus database with same CATH topology
2MHFA 3ZFGA 4Y22A 2AZ5A 1A3KA 2JKBA 2QDNA 1URXA 2CAVA 4RSUA 2VUAA 1AR93 3D8CA 2DVDA 1ZNPA 1UX6A 4CEYA 4OHWA 1FV3A 4N43A 2XJRA 4P9IA 2ARXA 3KM5A 5J48A 4CDXB 3G6JB 1G8WA 4EN0A 4COUA 5DDJ1 5A3MA 3OYWA 1B35B 4MGYE 4COYA 4XF0A 4FPOB 4LO6B 4B7EA 4BOWA 1KJLA 3B7MA 2EF6A 3WQ0A 3KT4A 5DUVA 5J7MA 3VBFA 4MXWB 1Y7BA 2GU9A 5JSRA 2B5HA 4E27A 5JAXA 1CVNA 3E97A 1VBE3 2A6WA 3EJKA 2HEVF 4KNCA 4M3CE 1QH7A 4CDQC 5JIUA 3IKWA 5C8CA 2R0FA 3MLJA 1FNYA 4PLMA 4WVMA 5CG8A 1ULFA 3N7JA 3V64A 1YI9A 3JCIA 3PVNA 3NAPA 2R043 1D0HA 1ULGA 2GH8A 4MX3A 3ZSLA 2TNFA 2ZHKA 1WMDA 3LA7A 1VBC3 2XG3A 3I8TA 4Y1ZA 5KXBA 1Y3TA 1AJKA 1DGWA 5CVRA 1O4TA 3AYAA 1RGSA 4JQRA 4GULA 1LOCA 1MS0A 2JD4A 5FBZA 1RUI2 2PN5A 3PTYA 3ZFEA 2TUNA 5CAZA 1QJU1 4JVAA 2Q1MA 3VKNA 4YFZA 3ZYRA 1W2UA 2ZGPA 1CQ9A 2RS13 1LENA 2JX9A 4FPHA 2HEYF 1V6NA 3TNPB 2DVGA 1HQLA 1APNA 3TN93 3E5QA 3JBG1 5EXOA 1NQJA 2ZZQA 1S0FA 4WVZA 1NY71 5GLUA 1VBB3 5KHHA 2AENA 2TEPA 4JGYC 2ZKLA 5EFUA 1JYIA 1R092 2R073 3AZYA 4XW3A 4FPCA 1DU3D 5GLTA 4K1YA 5IUQA 1ND2C 1H2MA 1ZBE3 1ONAA 2NZ9A 5CFCA 1ZRRA 2VOVA 3B01A 1R081 3DL3A 2XGXA 1W6PB 3FUOA 5K0UB 3WHTA 3ZMOA 1XQNA 3ALQA 1LOEA 1WMEA 2A3YA 3ZIWA 3RG0A 1O7FA 1TME2 2ETEA 3IN9A 5LK7B 2EAAA 4BA6A 5L19A 2PHXA 2XJQA 2WZR2 1QMJA 1O91A 4I0WB 1X33A 3CU7A 1YLLA 4FT8A 3PVOA 3R4SA 2WFF2 3M3EA 1BBT2 1COV1 3IIAA 1PIV3 5FCCA 4N53B 4AEDB 2K2SA 3M1HA 4QGNA 1H8TA 1UD1A 2IXCA 1DQ0A 4RGGA 2P2KA 5JZGA 1H2LA 3SHRA 5CADA 1BJQA 3PVEA 3ZN6A 3ZXGA 4AHWA 3ZVXA 4L97A 1X50A 4OI0A 1FOD2 1RHI2 2A75A 2MEV2 4A7ZA 1NCRB 3MPBA 4M01A 1G86A 1MQTC 2GC2A 5D1IA 3LB9A 5JOYA 4F8AA 1EAH3 2ZGUA 3PMEA 2W52A 4LTAA 1SLBA 2QZ3A 1DLLA 2NN8A 4LA2A 2EVXA 2FHRA 1HX6A 5JSPA 3WP4A 1AXKA 4IXLA 4ORFA 3RWNA 2VW2A 1QDCA 2O0OA 1VRH2 1H9WA 2HWD3 1D4M2 4H55A 5F6LB 4GMP0 4Q0PA 2EA7A 4HETA 3TRSB 4XJUA 5BPXA 5FLHA 4QXKA 1IQAA 4QX5A 2WNUC 1JOJA 1VIWB 1Q8QA 3VBOB 4AXOA 2RJLA 2CWSA 1NA1B 2E51A 1G7YA 4EJRA 4QPGA 1F31A 2PAEA 4P9LA 3SMHA 4XDQA 4HPKB 5C4WC 2V73A 1KS5A 4LNVA 3O12A 1U5IA 2HJIA 2KA3A 2UYAA 4AHXA 4QPYA 1AR92 4EWAA 5A33A 4R4ZA 4FBFA 4AI2A 1NOVA 4DQAA 4B7KA 3JQWA 4YVSB 2IWGB 2LALA 1RUE3 4Q4X3 3VBSC 1WW4A 4I2OA 1S0EA 1GZCA 1RMU3 4M0NA 4XZPA 3K48A 2ZX4A 4LR4A 4QQHA 2ZKNA 4LUMA 1X8EA 4GKXA 1OQEA 5BUVA 4XMIA 3OD4A 4PIZA 4QGMA 3VBUB 2DFCA 2DU0A 3WG2A 5JIAA 3MIHA 4L92A 4Y1YA 1AHSA 1PZ7A 5A32B 1VBE2 1OPMA 3MF9A 1LEDA 3AKRA 2NP0A 2PA7A 1W6OB 4Q4W3 4CEWB 4WZFA 3N4MA 1XNDA 4CDQB 1KD7A 5JPMB 3R0RA 3I59B 1GYKA 1EYBA 3IM0A 4IEUA 2WJSA 5LEJA 3CJIC 1AR63 3APBA 1GR3A 2R042 4FQ4A 4OVEA 2EXKA 1DZTA 1RUOA 3AKPA 1ULCA 5CFDC 2VQAA 3PHMA 1SBFA 5GKAC 3ZXDA 3ZYIB 4RGAA 3QH7A 4Y20A 4QPIA 3A0KA 1VBC2 2E7AA 3ELNA 3FFQA 3DKWA 4NOTA 1CD3G 3MF6A 3DPRC 4OHZA 2D44A 4Q4Y3 2XJPA 2R16A 4YW1A 4CRQA 1GANA 1IS6A 1AUYA 1GICA 4QMAA 4FOQA 1RUI1 5BNNC 4P9GA 4XFFA 5SV5A 4A3XA 5BNPB 3V0BB 1U12A 3URFA 4ZU7A 5I8SA 2RS12 4AHYA 4XIKA 3WVJA 1DIWA 2WT0A 1C8M3 5AC93 3N35A 2X8KA 5FAXA 3DGTA 4CDUA 5C33A 5JCTA 4RR3C 3FLTA 2ARBA 2VVDA 3GALA 4PQ9A 4XFBA 4OHYA 3QACA 4FTEA 2OVUA 2HWE3 4E4SA 2XKPA 1VBB2 5JR7B 2OZ6A 2DU1A 2PAKA 1YHFA 1W6NA 2X5IA 3FUQA 4IETA 3N3HA 1R091 1W0OA 2GMPA 2R49A 4DMIA 1YO8A 4L8QA 1ZBE2 1U5ZA 3LWCA 4M3CB 4QQ2A 4JRLA 2PLV3 3LA2A 1FAYA 4Q1RA 5GZEA 2VOXA 2RR13 3H1MA 1UZYA 3TYJA 3VBFC 4N9IA 4UW5A 3ZXKA 3RYPA 1JH5A 3VZNA 2WSVA 5AVAA 4YARA 1AX2A 1YJKA 2A71A 4YVWC 3USUA 4FPGA 1TME1 5C8CC 3VV1A 2DVBA 2RE9A 1Q3EA 1IHMA 4PF5A 2WZR1 1Q56A 4AEJA 1POV3 1NLRA 4LE4A 5FO7B 3AFGA 1PIV2 3IBMA 2EALA 2B42B 2WFF1 3KLSA 1BBT1 2WKKA 4UXAA 4YM1A 1AJOA 4JAAA 1RUD2 2XH6A 1SLIA 3LSEA 4IEVA 3FWEA 3VZLA 1SBDA 4PBOA 3GHMA 2DWRA 1DHKB 2B45X 5LRRA 2ZX1A 3GZUC 3KQRA 4O9GA 4WM7A 1YI7A 3WCSA 1EAH2 1FOD1 1RHI1 2MEV1 4OULA 5D8AA 3OGGA 1MQTB 1WBLA 2UU8A 1ZYBA 5LEKA 5HCFA 4B4PA 2JG9C 4ATEA 2D3PA 2W0XA 4YYOA 1CAUA 4WM8C 1LODA 4XJ9A 3ZPYA 1HV1A 3MYXA 5C6CA 1KJRA 2VVFA 4U2AA 4ISRA 2HWD2 1PZ9A 2ERFA 1PZ8A 1H9PA 4G4FA 1I5ZA 1A78A 1G6NA 1VRH1 4IV3A 1D4M1 5K9YA 3MEPA 4I0AA 1WCSA 4GALA 4BZ4A 3ZXJA 2D97A 3KGZA 3JUUA 1CAXA 1LHOA 4YGEA 4FOVA 4PDWA 1HRV3 1H0BA 2OYZA 1W6QB 1V6LA 1Z7S3 4JGZB 3WW2A 2R0HA 1BVP1 4GQ7A 1BKZA 1PNFA 3V0AA 2QE3A 3MIBA 5C4WB 3PNAA 2D5HA 1AR91 4XFIA 1UPSA 4QD2A 4GH4A 4LBQD 4GB33 1RUE2 4Q4X2 4UW6A 3RZZA 5GLVA 3UKNA 4XPVA 1LKNA 4HANA 4E2GA 1BEV3 3NL1A 5FQ0B 1MS4A 3I54A 4JRAA 4QU2A 2XJSA 1LULA 2YC0A 2ET1A 1RMU2 3VBSB 4RS5A 3B02A 2I2SA 1LESA 4KGGA 1G9FA 2WINB 3MI8A 3N7MA 4FOYA 5FO8B 5EV7A 3VUOA 1LGCA 2BYVE 2JICA 3GNEA 1DGRN 1K5MB 2JG8B 2O1QA 4XF3A 1VBE1 4Q4W2 3EHKA 5CNAA 5JWPA 1RC6A 4K21A 1Y43B 2ZGSA 1OMIA 5JOWA 1UL9A 3O5SA 1AR62 3S7IA 1YNAA 4GIQA 2Q5TA 2H0BA 4XXPA 4AVTA 3CJIB 4I02A 5I0RA 1V6OA 2R041 2D93A 3IT8A 5C8WA 3MIDA 4O9EA 1NE6A 3H7YA 3FLPA 5CFDB 1IKQA 2RHPA 1CAVA 2P17A 2BBVA 2ZCWA 4EWEA 1LHVA 3M2MA 3UJOA 3JZVA 2I74A 1N3QA 1VBC1 3AP6A 4XIOA 4Q4Y2 5DG2A 1M06G 3DPRB 4EN7B 4LHKA 1PGW2 3MGUA 1EV13 1LGBA 3B9IA 3OGJA 4C1XA 5HCAA 2D3SA 1YXWA 3MLKA 3UKVA 5ACA3 3VL8A 1TMF2 1JUIA 3H3ZA 2WT1A 1OOPA 5BNNB 2C9AA 2PHLA 4E4DX 3DF0A 2MNGA 4HK9A 2X29A 5AC92 1C8M2 4K8FA 1PO23 1QH6A 2BFUL 1F5FA 3C2UA 3WW3A 2RS11 2DTWA 4I3PA 2ZX3A 1ZX5A 3LCPA 2NMNA 4RR3B 5GALA 4CYDA 5L7OA 1VB2A 3MW4A 3WUCA 4UBGA 1QNYA 4V1PA 2XJVA 2HWE2 4S2HA 3PJQA 4TYSA 1PMIA 4GWMA 5CB7A 4IEPA 2PELA 1VBB1 4LLFA 4XMAA 3GYDA 5ABJC 4QT6A 1NYWA 1KDKA 4I3GA 2JEMA 3RPQA 1ND3B 4OHVA 1MZFA 2PLV2 1ZBE1 2RR12 3EO6A 4CP0A 2P3KA 2Z2SB 1Z78A 1UU4A 3GBGA 4RQPA 4YLZA 2WA3A 2ZGTA 3S0MA 2XVLA 4K9SA 1SFNA 5KWRA 4ITCA 4P9WA 1QU0A 2VH9A 2WSUA 2OIIA 1UU5A 3VDDC 2PAMA 3LOIA 4YVWB 1DQ6A 2PHFA 3ROUA 1RUG3 1H4GA 1YFWA 5KHJA 3M3OA 5C8CB 5H9RA 2WNVA 4MYEA 1QJY3 3POYA 2O8OA 1VP6A 2B39A 4C1WA 3KSCA 3N7LA 2BTVC 3KCCA 4OUMA 1YJLA 1PIV1 1MACA 4YG0A 1IOAA 3ZSJA 4QPIC 1DGRA 4NHKA 1DG6A 3Q9OA 5JLVA 4NWVA 1RUD1 1WW7A 2WQ4A 3LZZA 3HT1A 1RL3A 5AVPA 1IS3A 4LBQB 5CIRA 3BODA 1EAH1 3SITA 1S2KA 2ZAHA 1XNKA 1UIKA 4XXAA 1AL22 4YZ2A 1UPIA 2JG9B 3SCFA 1LTEA 1LB2A 4IV1A 1J58A 1PK6A 2IXIA 4WM8B 2GN7A 2VMIA 2CNAA 3MIFA 4QM8A 4Q8KA 5F9TA 2P34A 1LGNA 4BMBA 2HWD1 4XYXA 2ZS6B 1I1EA 1YRZA 4BLJA 1W6MB 2IXKA 2BGCA 3IPVA 5J36A 4P14A 1HKDA 3CLPA 3S6PA 4EROA 3L9JT 1TQ5A 5SV8A 4NO4A 3H1WA 1HRV2 2QZ2A 3H9AA 1OD5A 5EWSA 1LOFA 3VBRC 1G9AA 3VBHA 1Z7S2 3AMHA 3LKJA 3ZIXA 3AYDA 4PLOA 4URTA 3SCHA 4CDWC 2VOWA 2X5IC 1Q8PA 1VB4A 2DCZA 4MVTA 1AVBA 3VGIA 2DCTA 1WD4A 4ASMB 4MUVA 1A6CA 4KQ7A 3J8F3 1UF2C 2D6PA 3LOBA 1CR7A 4WVVA 5FOJB 1CJDA 2E53A 4TSVA 5T50A 3SH5A 4AVVA 3RNSA 4GB32 1O3SA 1N47A 1QOOA 2HYKA 1N3PA 5HI0A 1GKBA 4RL7A 3B9CA 1FX5A 1BEV2 1RUE1 3RMXA 4Q4X1 1J3QA 1OA2A 1LHUA 2WQZC 3A0NA 3FLRA 3U10A 1YIFA 5T5JA 4XILA 3ZYPA 4CDXA 4YZ5A 1OSGA 1RMU1 4W6YA 4MV2A 1NCQB 2V5YA 4SLIA 4Z8BA 1B35A 1HV0A 1LRHA 1AL0G 2NQYA 1KFUL 4W6XA 2DURA 3I7DA 2A5ZA 1CPNA 5T3NA 1O5LA 5KHKA 3H50A 2HEWF 4MXWA 3CEWA 4Q4W1 3RJ2X 3QCWA 4LHLA 1ZREA 1Q43A 2DV9A 3FJSA 4D7SA 2H6BA 3SCGA 2IXHA 2ZA9A 1N1SA 1AR61 4BM8A 2CWMA 1I6XA 1QQP2 4YG3A 1CAWB 1LEMA 1EP0A 4WM7C 3MW3A 5D8AC 1EPWA 4LBMA 4L9BA 3M4FA 4XF1A 1DFQA 2YDEA 3HMYA 4L11A 2ZMKA 5A3LA 3KD4A 3FZ3A 1REFA 3VZOA 2PHRA 1V9U3 3KS7A 2ZGQA 1S1AA 2DCKA 2IFRA 3KCYA 2UWCA 5BY5A 2JXAA 4Q4Y1 1RINA 2LTNA 1RVF3 2D98A 1EV12 2GC0A 1Q8VA 3AP4A 1PGW1 4IV3C 5ACA2 1PO13 4ES8A 4M0HA 3TOJA 2DUQA 2GMMA 2F6BA 4QHBA 1TMF1 3J9SA 1H1AA 5C9AB 4IERA 4PDWC 1PO22 1LOGA 2WWSA 4XOGA 3T2TA 1O4ZA 2MPFA 5AC91 1C8M1 3OD0A 2WS92 3UKTA 1VJ2A 2B7YA 2WA4A 1FMD3 5K7PA 3WY6A 4CP1A 1REEA 1RUD3 5JDBA 1KRIA 2RS53 4Y1UA 2R063 3VKFC 3ETQA 1WLTA 3FE5A 1SDWA 5L36A 2CGPA 1RUH2 3WDVA 4JTNA 1CPMA 2ZGKA 4XBQA 5DZGA 1QXRA 2PHDA 2HWE1 2ILMA 3ZXFA 2P37A 1BMV2 2CAUA 5J98B 1J3RA 1JBCA 5JMCA 1QDOA 3ZSEA 5ABJB 1D2QA 2RS33 4LUKA 5L73A 4AFDA 4Q0SA 1OQDA 2VMGA 2K0GA 5JOZA 2XJUA 4ASLA 4EN8B 2ZZJA 1E57A 1GBGA 4D69A 1MS5A 1U0AA 4G9S