4ASMB

Crystal structure of the catalytic domain of beta-agarase d from zobellia galactanivorans
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
357
structure length
357
Chain Sequence
QYDWDNVPIPANAGAGKTWKLQTAASDDFNYTFNPTNNVVDFGPNGNMKWYNKYHNRPNGQPNNFEGPGPTKWMQNHVAVSGGNLNIWASRIPGATKSFTGSNNTPISRPETRAGCITNKTRVKYPVFVEARVKVMNSTLASDIWLLSPDDTQEIDIMECYGGPGNDNRNSYFASKIHLSHHVFIRPPNFKDYQPADLNSWWGKNGVTQWGGKTIRIGVNWVSPTRLEYFVDGQMVRILDNDAVQTRLADGTWQYTYPAGVTSTGVNGQLIKENGYQKMNIASSLSDAKNKSNISVIDPFNYLNNGRKFSKEMDIIINVEDQSWQAEAYRSPNAAEMANFYDNNLLVDWIRVYKPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-AGARASE D
publication title Biochemical and Structural Characterization of the Complex Agarolytic Enzyme System from the Marine Bacterium Zobellia Galactanivorans.
pubmed doi rcsb
source organism Zobellia galactanivorans
molecule tags Hydrolase
total genus 98
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2012-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4asmB00
3MW2A 3M3OA 1IS3A 2GDFA 4YG0A 4YGEA 5CB7A 3AXEA 4R9DA 4YG6A 1G9CA 3N7KA 3TAYA 4YZ2A 4Y1XA 5DUVA 1UL9A 4LBQD 1BYHA 5JOWA 3FFZA 3CNAA 4FOQA 4PCRA 4ASMB 1FNZA 1PZ7A 1QMJA 1MS5A 2A6ZA 2EF6A 1CIWA 1DQ5A 2P3JA 3B9CA 1AXZA 3AP4A 5T55A 3SH4A 1CN1A 2ZAAA 3A4UA 3HN1A 3GALA 1WLDA 4TYSA 3ZXJA 1WW4A 3HR9A 2H0BA 4LBQB 1FV2A 2DVDA 2GMEA 4BLJA 4FPLA 4GXLA 1LODA 3B00A 3MEPA 1UZZA 2YV8A 1G9BA 5JLVA 1W6QA 3O0VA 4XBNA 2AYHA 2PHRA 4JRAA 1UZYA 3VV1A 2CWMA 3R05A 2VU9A 1CPNA 4P9XA 2UWBA 1AX1A 4Y20B 3ZPYA 4AGRA 4K1YA 5GLVA 3ZYRA 1JXNA 2DUOA 3O12A 2ZA9A 1VALA 4XDQA 1A8DA 1ULGA 3BTAA 1FATA 3POSA 1GZCA 1FNYA 1U0AA 2PHUA 4XJWA 3WCSA 4Y22B 4UW4A 2GNTA 2GMMA 3RG0A 1UX6A 3WDWA 2OUJA 4CZSA 1RITA 3WHUA 5EWSA 3T1LA 3FUQA 3MPPG 4XXAA 2VUAA 4SLIA 3RQ0A 3LSEA 2I2SA 2LTNA 2PHXA 3M3EA 4JCKA 3HMYA 1A3KA 3WDTA 5CAZA 3JUUA 1HDKA 1O4ZA 2GALA 3PMEA 1VLNA 2WNEA 4FPJA 3IMNA 3A0KA 2DVGA 1LOAA 4RA0A 3T1MA 4K1ZA 4Y26A 1S0BA 4DQAA 2AGSA 1V6IA 2JE7A 3ZYPA 1JUIA 4FOYA 3PVOA 4FPGA 3AFKA 1ENQA 2SBAA 3PVEA 1UAIA 4FPFA 2P3IA 3IKWA 2CTVA 4BMEA 1IS5A 1MZ5A 2ZGKA 1W6OA 4PQ9A 5GLWA 3VKNA 3ZXLA 1TEIA 3D5OA 4TZDA 4Q1RA 1WBLA 3C2UA 2Z42A 3ILFA 1S0FA 3OYWA 4U36A 4RL7A 2WJSA 5DXDA 4XJZA 1AX0A 1SLLA 4I30A 3V64A 2WSUA 1MS4A 5EXOA 1C57A 1N1YA 1AJKA 1ULEA 2NN8A 1S0GA 1LULA 1UKGA 2R1BA 1LJ7A 3NV4A 1BZWA 5H9PA 1BJQA 1LECA 1F31A 4PF5A 3WDUA 4AVSA 1JOJA 3ILNA 4YW2A 2CL2A 4WVVA 5GALA 4XZPA 1UPSA 2WQZC 1QOTA 2YXSA 4FP2A 3VUOA 5EYXA 1GNZA 4K21A 1FYUA 4XBQA 4Q8LA 1BQPA 3D4KA 1IS6A 4M3CF 1S1AA 2WT1A 1Q8VA 1W6NB 5GLZA 2C5DA 2DVAA 3O5SA 4YM1A 2A75A 4ISRA 3NWKA 1G7YA 3D6EA 3UK9A 4ISQA 1AX2A 1DYKA 4WV8A 5HCBA 4M00A 1ZM1A 2OVUA 1DGLA 1Q8OA 2NP0A 3AYDA 3LSDA 2DYCA 2CWSA 2A7AA 1CVNA 4Y20A 1W6OB 2NMNA 4GALA 4UW3A 2D6NA 4Q26A 1S0IA 4AVTA 3M3QA 3B01A 2CY6A 4Y22A 3MW4A 3AZZA 3WCRA 5DUXA 1DQ2A 2WT2A 1ULFA 3I4IA 1ONAA 5AVAA 4C1XA 1GV9A 5JOYA 4YG3A 1MS3A 1WUVA 3WDXA 1V00A 1GBGA 1N3PA 5F5QA 5GZCA 2LALA 4Q27A 5T5JA 4D69A 2JE9A 3AP7A 4OZXA 1ZA4A 3A0NA 2ENRA 2A71A 4GKXA 1UMZA 1AJOA 2D3RA 1CONA 2DWRA 5E89A 1QNYA 3NV1A 3WVJA 5L73A 2A6WA 5IK4A 1WW7A 4P9YA 2YZ4A 4XJ8A 2ZMKA 2D3SA 2HYKA 3U4XA 3ZXKA 3AP9A 1KJRA 4FOWA 2PHWA 2P34A 3N35A 5DZGA 3ZSLA 5JOZA 2VW2A 1ULDA 3AZXA 4DFSA 3N36A 4YZ4A 1GKBA 1SBDA 3H0OA 5IK8A 1SFYA 1C1LA 4M3CE 2R1DA 1EPWA 1LOFC 3WG2A 1LU2A 3UL2A 1G9FA 2WKKA 2JKBA 4XILA 2GNDA 1QU0A 4GWMA 2R49A 1WBFA 5GLTA 1JW6A 5T50A 1IS4A 5GZFA 3TB0A 5IT6A 1LU1A 4FPOB 1G8WA 1S0CA 3ZSJA 1OQ1A 3T2TA 2NZ9A 3USUB 1C1FA 2DUPA 3RS6A 1SLAA 2ZMNA 2R0FA 3AJZA 3IPVB 4YGDA 4HL0A 4LBOA 5KXDA 1KRIA 4AVVA 1AF9A 2ZGRA 3N7LA 3RMXA 2ZMLA 1DBNA 1V6LA 2A3YA 1SACA 4GA9A 4YW1A 4Q8KA 2UWAA 2D6LX 4DRVA 4F83A 2ZGOA 1FX5A 1MR5A 2ZGUA 2ZKNA 2YMZA 5JOXA 1KITA 4R9BA 2A6XA 2WT0A 5HCFA 1JYCA 1W6NA 1N47A 2A3XA 2YROA 3L2YA 2JJ6A 2R16A 4PBOA 2VW1A 5E88A 1VAVA 1LHUA 2OUHA 1LCLA 1Y7BA 4GKYA 1KQRA 3IN9A 1LOFA 4W65A 3POWA 3MW3A 1GZWB 4YGCA 1CESA 1SLTA 4XHXA 1APNA 2UU8A 1KDMA 2DV9A 3ZVXA 1OFSA 3VKOA 2JDZA 3M2MA 3Q9OA 1DZQA 3ILRA 3N7MA 2VW0A 2NYYA 1LGBA 4XHBA 2GNMA 2W68A 2TEPA 1WCSA 2ZZJA 2JD4A 2A6VA 1GYKA 1Q8QA 4WZFA 3OBRA 2SLIA 4ATFA 4BOWA 4YW5A 1IKQA 3AZYA 2XG3A 1AXKA 1N3QA 4NO4A 1W6MA 3INAA 1N3OA 4YZ3A 1WLWA 3BIWE 3AXDA 3ENRA 1G9AA 3WDYA 2D6KA 2GMPA 1WD4A 3WG4A 3VKFC 2ERFA 1HLCA 1G9DA 2R0HA 1LEMA 4Z8BA 1LHVA 1DQ6A 3AZVA 3APBA 2DVBA 3WHTA 2VXRA 3RRDA 2E7QA 5E8AA 5KXBA 2D7FA 3OY8B 1DYPA 4ZKTB 2WLQA 3W58A 3WV6A 5BYNA 1D0HA 1LHNA 2DU0A 1B09A 2ZGPA 2FMDA 5FREA 1DFQA 2V73A 2G4IA 5T52A 3NV2A 4BQ1A 3WDVA 1V6KA 4AGVA 1F5FA 1MACA 4UW5A 1YRZA 1S0DA 4YLZA 2E6VA 4BPZA 1I3HA 5GZEA 2CNAA 4Y1UA 3USUA 5H9SA 4L8QA 1H9WA 1WW5A 3IPVA 1W6PB 3B69A 4ITCA 4LBMA 3VKMA 2D6OX 3SH5A 1QF3A 4NOTA 1OKQA 2ZHLA 5EYYA 1Q8PA 1QNWA 1W6MB 2DTYA 2PHFA 3OBTA 1ENSA 4JC1A 4FPKA 1QDCA 4U2AA 3WG3A 2AR6A 4R9AA 4ATEA 2D6PA 5CNAA 2E53A 4YZ5A 1AXYA 1LTEA 5CA6A 3KM5A 1UN1A 1JYIA 4YM0A 3QLQA 1YYNA 2ZGMA 3FBYA 2D43A 2W39A 3VKLA 2P2KA 4YW4A 4DS0A 1Q8SA 2GNBA 4FVVA 4Y24A 5T5LA 1MS0A 3FLTA 3O0XA 1AVBA 3NV3A 5SV8A 2ZGNA 1SLBA 1URXA 5T5OA 2ZABA 2WSVA 1GZWA 2E51A 1KJLA 1XQNA 2AENA 1C4RA 1PZ8A 3SITA 1ULCA 5IK7A 4FQZA 1DQ1A 2EAKA 2B7YA 1W0PA 3V65A 4LBKA 3DUIA 1HQLA 5KXCA 3OPZA 3WOGA 1BKZA 1DQ4A 2V5YA 4K20A 3ZSMA 2ZHKA 4XMIA 1DLLA 4UW6A 2AREA 1SCSA 2UURA 1DQ0A 1A78A 1H30A 1PZ9A 2D44A 2P3KA 3IM0A 1N1VA 4AGGA 2W08A 5DUWA 3WUDA 3R4UA 4P14A 1G86A 3SNMA 2VY0A 3ZXFA 3W59A 2AUYA 1GLHA 2ES3A 1JBCA 4FOVA 4FQ4A 3DGTA 5DG2A 3V0BA 1MS9A 3AP5A 3ZXEA 1O4YA 1VAMA 3FLRA 4XIKA 1LOEA 4M3CB 3WUCA 4M01A 2DU1A 3AP6A 5GZGA 1FV3A 3BODA 1Z78A 1LHWA 1MVEA 2D6MA 3AZWA 1W0OA 3OY8A 1WW6A 4Y1YA 1GNHA 3FLPA 3UJQA 4DRRA 2ARXA 2Q5TA 1V6MA 2EXIA 3N7JA 1CPMA 4Y1VA 1LENA 1YI7A 4Y1ZA 5JMCA 1LEDA 2A3WA 1IKPA 4R9CA 1S0JA 2NM1A 4XOGA 4XJ9A 2ZBJA 4C1WA 1SLCA 2EIGA 4XJUA 4AWDA 4KBBA 4YFWA 5IUQA 3RMYA 3AX4A 1D2SA 1GZ9A 1QGLA 4FPHA 2ARBA 1Q56A 4XTPA 1LGNA 5FRAA 4FPYA 5LK5A 1ENRA 5T54A 3V0AA 2W52A 3O0WA 5CBLA 1CR7A 1SLIA 1W6PA 2BQPA 2UWCA 1SCRA 1NLSA 2AH2A 3OGGA 1YIFA 5GM0A 3M1HA 3LCPA 1SBEA 2OW4A 1YXWA 2VH9A 4YW3A 3WNXA 4IQPA 5DZEA 3UJOA 1MZ6A 1H9PA 2DURA 4YGBA 3N3HA 3AYAA 4DPNA 3V0BB 4H55A 1HKDA 2EXHA 1RIRA 4BM8A 5F9TA 3WG1A 5JDBA 1W6QB 3BOPA 5GJ6A 1QDOA 2PELA 1X50A 1MS8A 1GSLA 2EXKA 3ZSKA 4FP3A 2EXJA 2DVFA 3FUOA 5DG1A 2JECA 1LESA 2P37A 4XYXA 5GZDA 1V6JA 1LOGA 1FAYA 2EALA 4XMAA 3OJBA 3R4SA 3SISA 1CQ9A 4XBLA 5H9RA 4FPEA 3M3CA 4P9WA 3AYCA 1GANA 3SH3A 3WZ1A 4CTEA 2GN7A 1WD3A 2CYFA 4YM3A 3QCWA 1N1TA 2KM2A 1Z0HA 1S0EA 3RSJA 4ZXKA 3WLUA 1JN2P 4XXPA 5IK5A 2XB6C 1HQWA 1IOAA 4LBJA 1LOCA 3AJYA 1BXHA 2A70A 2ZACA 1RINA 2RHPA 1JHNA 5HCAA 1SBFA 2E7TA 3V0AB 2DUQA 2FHRA 4WVWA 2ZGLA 4XJAA 5DZFA 4BLIA 5KXEA 2PHTA 3PJQA 1WLCA 2A6YA 1YO8A 4Q2FA 3SLIA 1GICA 1J1TA 1LGCA 1QOSA 2ZGQA 3JU9A 1N1SA 4LBQA 4LBNA 5JVVA 3AYEA 1QOOA 1LHOA 2ZGSA 2A5ZA 2ZHMA 3B3QE 4MYEA 4M3CA 5DUUA 1V6OA 3KQRA 5T5PA 1DHKB 3AK0A 1QKQA 4BMBA 1NXD1 4XTMA 4XIOA 4FPCA 3GNEA 1V6NA 2ZHNA 3POYA 2C9AA 2GN3A 4HANA 1CJPA 1KDKA 2NMOA 3I8TA 4YM2A 1R1ZA 4YFZA 5H9QA 1AZDA 2DTWA 1LOBA 1MS1A 2ZGTA 4GWNA 4XE9A 2D3PA 4AYUA 3OYWB 1I1EA 4CRQA 1VIWB 3ATGA 4Q1PA 1F9KA 4PBPA 2YY1A 5GLUA 1MVQA 4LBLA 4YZ1A 3ASIA 1DIWA 3PVNA
chains in the Genus database with same CATH superfamily
3M3OA 5HXMA 2JB8A 2JKXA 3VBHC 1ND3B 2E7AA 5JI7A 1FMD2 2P6HA 4UFMA 5JR7B 3N7KA 4WVMB 5C4WA 5A3LA 2XLGA 5DUVA 2IWGB 1BYHA 5A1FA 5FZ8A 1PK6C 2L9LA 4ASMB 1UU6A 1NA1C 3CZUA 3URFA 2P3JA 1AXZA 3U78A 4XAAA 1RUOA 3AP4A 5T55A 3LDKA 3D0SA 1BCXA 1XE8A 3SH4A 1UMHA 4QHOA 3FHIB 3RJ2X 1PIV3 3HN1A 4FO9A 4TYSA 4L11A 5IATA 1VRH1 4DOUA 3IAQA 4YVSA 5EPAA 3ZXAC 2H0BA 1AR93 2ZAHA 2VVEA 2Y60A 1CAWA 2PMWB 5DAQA 3B00A 5SV5A 5I93A 1UZZA 3AMMA 4QXBA 1W6QA 3BVCA 3RI8A 5FBJA 1CAXA 2CAUA 2PHRA 2DF7A 1B35C 2BOIA 1UZYA 1Y9GA 2VUCA 1RXFA 5C3SA 3VDDA 4O61A 3GCWA 4R8HA 1AX1A 3KF5A 4HONA 1AR61 4Q4Y2 3J7NA 5GLVA 1PX4A 3O12A 4XDQA 2JDUA 1RUE3 2HWB3 2I74A 1FATA 2UY9A 1ZYBA 3BTAA 4JHTA 3VBHA 3VD4A 2ID4A 1U0AA 3WCSA 2PHUA 3O1PA 5A3TA 4UAPA 3K2OA 2GNTA 4OHXA 1UX6A 3JD71 4QT6A 3CDZB 1RITA 3WHUA 5EWSA 1XRUA 1NA1A 3FUQA 3MPPG 5ABJC 3TEXA 3LSEA 5APAA 3M3EA 4NE9A 1FPN3 4RHV3 2VPVA 2CGOA 2VC9A 1NE4A 3PMEA 4COYA 2WNEA 3WF1A 3WSOA 2QQMA 3POFA 4K1ZA 5BNNC 5FXZA 4KG8A 4XFAA 2VMDA 2FDIA 3C7FA 2AGSA 3OGRA 1Y9QA 4FOYA 1QJZA 2OA2A 1B35A 4RD7A 4HPKB 1W2OA 4IGPA 2TBVA 2SBAA 1UAIA 1XPWA 5J3UA 1HX6A 2VMCA 3IKWA 4BHPA 2IFRA 2B42B 4BMEA 1IS5A 1Z7S2 3VKNA 1PM7A 4ORFA 4AEDA 4TZDA 2YC4A 2PFWA 4KWJA 5HBAA 1RJ8A 1UKRA 3EJKA 2ZX0A 3VBOB 1H0BA 4U36A 4WBBA 2QDNA 1IGOA 1AX0A 3B5LB 3BOWA 1UYXA 2HLEA 2OYZA 3V64A 2WSUA 3LEKA 1MS4A 5IFTA 1C57A 1AJKA 2R1BA 4CCDA 3BUCA 2XL7A 3VBSC 3ZIXA 5JSOA 1COV1 4D94A 3SCFA 1RXGA 1SHWB 3DKWA 5KHKA 1NYWA 1RUJ3 4GB33 1JMUB 3CJXA 3S0MA 3QH6A 4XZPA 2WFF1 1UPSA 1L7RA 3J7HA 4MXVA 4PDWC 3VUOA 2GH2A 4BU2A 4K21A 2W87A 4K9SA 3N9MA 1IS6A 4GH4C 4M3CF 1S1AA 2XGXA 5JPNB 2DVAA 3DECA 2W1WA 4ISRA 4P02B 1ALYA 3D6EA 3PTRB 5LBFA 1AX2A 3S5QA 1WA6X 3DPRA 2IVJA 2YB7A 3E5XA 1CD3G 3O1SA 4Z92B 2I45A 4I0WB 2XJRA 3UV9A 5FXXA 1CVNA 3THTA 3VL8A 4AFMA 5F39A 3VZLA 4FT8A 2B46X 4BXFA 5FCCA 2GP5A 2RM22 2P5BA 3IDAA 1UY4A 4W6WA 3VBSA 1W03A 1AR71 1PVC3 1J83A 2F4LA 2WNUC 3WCRA 5DUXA 2VZOA 4XFHA 1XYNA 5EJ3A 1ONAA 4ES8A 5JAXA 1EUTA 1HJGA 2RMU3 3P1IA 1GBGA 3ZXGA 5GZCA 1NLRA 1NE6A 1VP6A 4Q27A 4BDVB 3R6SA 3MIEA 1CX4A 3AP7A 3HWJA 3MUY1 2ENRA 4DO0A 1X9PA 2RS32 2D3RA 4UOJA 1GWLA 1JI6A 4S2HA 2KD7A 1KGYA 4TLGA 1DZRA 2Y6KA 5E89A 1QNYA 4CXXA 1VAKA 2J1TA 1PIV2 2O8QA 2XVGA 3NV1A 3PMSA 4Y4RA 3GYDA 2JG9C 2A6WA 2BWCA 1ULPA 2RDSA 2YFUA 5LA2A 4CDWC 2WYFA 3I3DA 2ZMKA 2D3SA 3U4XA 4NHLA 1X82A 1S2BA 5DZGA 2K9ZA 2P34A 3N35A 2XQXA 4LEJA 3ZSLA 5E16A 1ULDA 2Q30A 2Y6HA 1GP4A 3N36A 4OCTA 1VMJA 5IK8A 5DDJ1 1SFYA 3BI3A 4QX2A 1IPKA 1OOPB 3AMQA 1UX7A 4NIDA 1W8HA 5F2SA 2WNUA 3GHNA 2O1QA 5TSWA 5K7PA 1VBD2 1LU2A 2HWB2 2WKKA 4XILA 1BVP1 5FY8A 5HPOA 5A33A 2GNDA 1QU0A 2OZJA 4GWMA 4A4AA 3A21A 2TUNA 4KWLA 5GLTA 5T50A 5IT6A 4FPOB 5KBFA 3DF0A 4QX8A 1S0CA 3ZSJA 5FMOL 3TYJA 2ZEXA 3DV8A 2YU1A 1SLAA 4XUTA 5CADA 1CWPA 2R0FA 3AJZA 3IPVB 4ZZ8A 4HL0A 1VR3A 4RHV2 1FXZA 4CEYC 4CU9A 4AVVA 1AYN3 4AI8A 3JB4C 3N7LA 1QQP3 4MV2A 3MV01 1DBNA 1V6LA 3GGLA 1SACA 4GA9A 4Y3OA 4YW1A 4CDWA 1UOGA 4IV3B 4F83A 2ZGOA 3CEWA 1FX5A 2ZKNA 3PUAA 1F2NA 1ND3C 4JKLA 2X05A 2WT0A 5HCFA 4RQPA 1JYCA 1W6NA 3WNMA 1O3SA 5JUVA 2WAOA 2XJPA 1H4HA 1VAVA 4Y5TA 5FQ0B 1LHUA 1RUD1 2OUHA 4OI4A 1LCLA 1UQXA 2LW8A 2PLV1 3VZOA 3ZIWA 2RVAA 3IN9A 1NCQA 2RR12 4W65A 3POWA 1WMDA 2Y38A 1X7NA 1CESA 4C0HA 1JYWA 1APNA 1QXJA 5FJKA 2DV9A 3BTXA 1OFSA 3RZKA 1HRV1 1OH3A 2R061 2VW0A 2VOXA 5FKCA 2NYYA 1LGBA 1NY72 4XHBA 4AI0A 5C9AA 1RUF2 4EV0A 3MHZA 5FY5A 1X9TA 4CCCA 2WL1A 2SLIA 4GD4A 4YYOA 4ATFA 3ZYFA 4BOWA 3LE0A 5JSRA 4FFFA 1AXKA 3WNOA 1DGRN 1PGW1 4XF4A 1HN1A 3IDBB 4QMAA 4CVUA 4L0PA 3I97A 4YZ3A 2OIIA 1OUSA 2FCUA 4A6OA 1RUJ2 3BIWE 4GB32 4HSLA 4LA3A 3WDYA 2GMPA 5FZ3A 5LZ6A 2C4XA 2R32A 3PUHA 1M06G 1Z7S1 2PAEA 1PX3A 2VXJA 1LHVA 2RDQA 2WS93 4ARXA 1G6NA 3WHTA 5LWBA 3RRDA 2E7QA 1QHDA 2VMFA 3VD5A 3H8OA 3ZFFB 1OLMA 3U37A 4ZKTB 4DZGA 3U11A 4Q4V3 1LHNA 2K46A 1V9U3 3OG2A 2P6CA 5D2AA 1YQ8A 3HN3A 2GC0A 3A22A 3MIFA 5FP8A 1RUI3 3HAGA 4AI3A 4QU2A 5FWEA 1OLQA 5FREA 1MQTB 5B4NA 3RWNA 2JDAA 1XE0A 3T3YA 5I0RA 3SQOA 1VBB3 4AGVA 4UW5A 3GDBA 4LO7A 4QXHA 3J9SA 2PHDA 3KHCA 2NPIA 1OVSA 2E26A 3KQ4B 4Y5Z0 3B69A 4CP2A 3VKMA 3O1VA 3H1MA 3ZFEB 1PMJX 1JYVA 3ZMOA 4LITA 3ES1A 2R30A 2JX9A 4CUBA 2BTVC 4EE2A 2ET7A 4FPKA 1QDCA 4U2AA 3U10A 4DXZA 2X5IA 3T2QA 4D6QA 4RR3B 1LTEA 5G04L 5CA6A 3KM5A 3ZN5A 1JYIA 3MUZ1 2OKXA 2B39A 2VR4A 3FBYA 1UOJA 3NKTA 1XE7A 1ZZ6A 3U0ZA 2GNBA 4Y24A 2RM21 1UYZA 2RS51 3S5AA 4IE7A 1GZWA 2E51A 4HVQA 1O7FA 5A3UA 5A32A 3S57A 3SITA 5AC91 4XETA 4FQZA 1POV3 2EAKA 2W91A 3AVSA 1FT9A 3V65A 5FZLA 4AVBA 1VJ2A 1BKZA 3OUIA 3ZSMA 4EN9B 4I3PA 1RUC2 4XMIA 5FIXA 3WW4A 4XCBA 4KBZA 1SCSA 2OQ7A 5KWRA 5CFDA 1DQ0A 1A78A 1PZ9A 1QJY1 3ACHA 3GHMA 1R093 4M4RA 1NCRC 1DGWA 5FZOB 5AFBA 5LW9A 3R4UA 3SNMA 5BNOA 1WMFA 1AR91 5F6LB 3ZXFA 1W8TA 2AUYA 2E31A 1QQP2 2JG8B 2A1XA 2D97A 2ES3A 2WNOA 3AL6A 4L2NA 1C8M3 4XFIA 3V0BA 3BCWA 3O7OA 3WW1A 4LK6A 1BMV2 1VBE3 3NNLA 4XIKA 3NVCA 3WF4A 3Q8CA 2ZX3A 3AP6A 1NOVA 4H7LA 2ZKLA 1C3HA 1FV3A 3BODA 1MVEA 3AZWA 5A7OA 4AHXA 1RUE1 2ARXA 2FDFA 1F4HA 4YARA 4PIXA 2W1SA 1Y3TA 4EN7B 3S30A 4QXKA 2FBEA 2MEV3 1PO13 3EMRA 5C33A 1DP0A 4XJ9A 1SLCA 1FPN1 2EIGA 3H50A 4KBBA 4ZU5A 5FP3A 3JCIA 4QPWA 1UPIA 1NCRA 3AX4A 4LPLA 4RS5A 1D2SA 4HKLA 4MGKE 4FPHA 3UKVA 4CCOA 1PGSA 4IV1B 1A8MA 4FPYA 5DMYA 5LY2A 5T54A 3V0AA 2IXJA 4CU6A 1RUH2 2ZEWA 3E5QA 3O0WA 1CR7A 5FBZA 1HRI1 1SLIA 1W2NA 1W6PA 2J22A 4JKKA 4XACA 4A6SA 4P9LA 3BGAA 4QKNA 2VOKA 3M1HA 2OW4A 2D40A 4YW3A 3BU0A 5C8WA 4IQPA 5DZEA 2VOTA 1XNBA 4MGIE 1H9PA 4AEJA 4YGBA 3N3HA 4RN5A 1H8TC 4DPNA 1HXS3 1HQNA 1YQ2A 5LB6A 5KHIA 2XDVA 4H55A 1XNKA 1CAWB 1F8VA 1W8UA 5JDBA 1VRBA 3TWIA 2P17A 1W6QB 3OUHA 1PO23 3DYPA 1CAXB 2W1UA 1QJX2 1MS8A 2HJIA 4FP3A 3K46A 4IV3C 2P37A 4XYXA 3VDDB 1V6JA 2EALA 5EHDA 3OJBA 1RUI2 3R4SA 3GJAA 2VO5A 3ZYBA 3C7OA 1H1IA 2HYXA 4FPEA 3AYCA 3VN4A 4CTEA 2GN7A 1WD3A 1VMHA 5J98B 2VNOA 3VBHB 3HNMA 4AAPA 3QCWA 1VBB2 4PHZA 5FLIA 5FYIA 2YFZA 3UYJA 2ZCWA 2ZX2A 3CBNA 5IVJA 2XB6C 5ACA2 1PK6B 4LBJA 3Q8AA 1NA1B 1ASJ1 1FOD3 4M0NA 1LOCA 4NHKA 1RINA 4NIGA 3KLSA 5CKMA 3WF3A 1H8TA 1YCIA 2J1VA 2WAAA 1SBFA 3D0JA 4WVWA 4DIQA 2DCJA 2DDUA 2ZGLA 1Q5OA 5DZFA 4NHXA 5FPBA 5J37A 4XUPA 4I2OA 3I2OA 1J1TA 1QWRA 3LPFA 4AZZA 2Q8EA 1YIPA 4MYEA 5DUUA 1OURA 3CL1A 3KZ4C 3KQRA 1B35B 3AK0A 1SZBA 1QKQA 4HFSA 1OHFA 2BVVA 1H2MA 1V6NA 2ZHNA 2C9AA 4UWDA 1CJPA 1PVC1 1YFXA 1YUDA 4UFLA 4AEDB 5FY0A 2VOWA 1LOBA 5HXVA 4AYUA 2RMU1 4CRQA 3I2DA 5IVCA 4TXWA 3ATGA 4Q1PA 2ZZQA 5FYTA 4DXRA 1W9WA 2DFCA 2WYSA 1OLME 1R083 3GZTB 4WVZA 4OMDA 3ZFFC 4BCUA 4JQRA 3ASIA 3MF6A 5FV3A 3THPA 3TNPB 1IS3A 4YG0A 1VBA3 1UYYA 5FZEA 5CB7A 5AFEA 3AMHA 1R092 4OFGA 4YG6A 3TAYA 4YZ2A 4Y1XA 4EZHA 1MQTC 4BB3A 4E8CA 5JOWA 4FOQA 1RB8G 1U5XA 2V5DA 2OX0A 2ZOEB 2OZ6A 1FMD3 1QMJA 4NRMA 4V2VA 1DQ5A 1BLZA 1C8M2 3HT2A 1OD3A 2B9UA 1S4CA 1VBE2 3HD8B 4ZONA 3OPTA 3A4UA 5LBEA 3UGGA 1O59A 2VZUA 4LBQB 2WA4A 4BLJA 1YWKA 2QQJA 3ZFEC 3MEPA 2YV8A 1G9BA 2WNVA 4Q29A 5FZHA 5KR7A 3DPRB 2AZ5A 4JRAA 4CCKA 1ODMA 2JD9A 3TEZA 4Q5OA 1RJ7A 3R05A 4NIHA 2VL4A 1CPNA 3WQBA 2UWBA 3PU3A 3PURA 4LE3A 4RR3C 2C0ZA 4NROA 2DUOA 1CZVA 1PO12 4YPJA 3POSA 2FQPA 5IWFA 1AYN1 3HBKA 4FFHA 4GJZA 2YU2A 4NPRA 4UI9L 4UYBA 5ABJA 1HB4A 4Q4Y3 4R52A 1GUIA 5BNPA 2VVDA 1DCSA 4IE4A 2W1QA 4V2WA 3NNJA 2OUJA 3WDWA 4CZSA 3BTYA 1GR3A 4XXAA 3GM8A 4SLIA 3RFRA 3RQ0A 4FAGA 4JTNA 1V0AA 2I2SA 3OSDA 4TN7A 5FOBB 3HMYA 1WA4A 3WDTA 2AACA 5C8CA 2GALA 1TME3 2XLAA 3O1MA 3VL9A 3HJRA 2C24A 2IZWA 3A0KA 1JYXA 2J42A 2DVGA 1CX1A 4IESA 3H3ZA 4EJRA 5FUPA 3NW4A 4P5HA 5EZWA 1V6IA 4OQ9A 1HXS2 1JUIA 1JZ8A 5F8PA 4LORA 4AHWA 4HLTA 1ENQA 2ET1A 4K3UA 2KA3A 3PVEA 4G9SB 1QH6A 4Q4W3 2WN3A 2HWE3 4W8JA 2JG8C 4LHLA 1Y9MA 2J1AA 4J1XA 4AFDA 1F4AA 1MZ5A 5FLJA 1W6OA 5GLWA 4LO4B 2PQQA 3DEMA 4LUKA 3C2UA 3ILFA 2WNUB 1S0FA 1ZZCA 2DCKA 4N90A 4Q0VA 1XBFA 3OYWA 3KCYA 4XF3A 2XWBB 4EN8B 2Q0AA 5A33B 4XJZA 4O9GA 4QHBA 3RJRA 3FFQA 2GC3A 4I30A 2ZS6B 4E4ZA 1ULOA 1DDLA 4UFJA 1OXCA 1JZ6A 1C28A 1LULA 2CV6A 4AHYA 4JGYA 3T0DA 2WS91 1BJQA 1LECA 1F31A 2DBIA 2BGCA 3H1YA 4CDWB 2CL2A 3MIDA 4WVVA 3TEWA 4O9EA 2WQZC 4H14A 1ZBE2 2XJVA 4HXCA 3N9LA 4Q4V1 1ZX5A 1M4WA 1V9U1 5LRSA 4Q8LA 1OI6A 4DY5A 4XEZA 4RQPB 1W6NB 5C4WC 2C5DA 2WZ8A 5EFUA 3O5SA 4UBGA 2A75A 2WWJA 1OC1A 3RNSA 2P1BA 3UK9A 4W4ZA 1OA2A 5HCBA 2TNFA 1NCQB 4M00A 3LB9A 4KMQA 4IL7A 2OVUA 4HETA 4K40A 4D0QA 3AYDA 2DYCA 4QQPA 2CWSA 2C6SA 1CIYA 4S2FA 1UZVA 3LOBA 4YVSC 3U07A 3T2PA 4BJ0A 4XAEA 3GF6A 5C9AB 4LKEA 4AVTA 4XUQA 2Z2SB 2BGPA 3M3QA 3OCPA 3UT0A 4CDUA 1VBC2 2CY6A 1RHI1 4Y22A 4E4HA 2VCAA 2VCMA 5IAVA 1DQ2A 2VNRA 3UETA 3I4IA 5A80A 5AVAA 1GV9A 4COZA 4XQWA 3FX3A 3DN7A 3DXUA 4YG3A 1QJU3 2VOVA 1YJLA 5JOYA 1V00A 1XXNA 1OPOA 1DGRA 1TG7A 4Z2WA 5JPMB 4X8NA 1O3QA 3BPZA 3AKQA 1EAH2 4KG0A 4OZXA 1ZA4A 4CDXA 1WGPA 2RE9A 5L9VA 1KS4A 2P4EA 3HOBA 2DWRA 2VZ3A 1CAVA 5IVVA 5I8YA 4HKWA 5IK4A 4I0AA 2RS33 2VD7A 4P9YA 3NL1A 2HYKA 3NAPC 3ZXKA 1KJRA 1MZEA 5JOZA 5L9RA 5BY5A 3T0BA 3U14A 4HN0A 2MHFA 2F6BA 1PGL2 4DFSA 5JXHA 3GZEA 4GMP3 5DN2A 3H42B 3SXWA 5A1LA 3OPWA 2HBUA 2GZWA 3ZPOA 3LFMA 4URAA 3ACGA 2ZJCA 1XNDA 4EWDA 2JKBA 3PNAA 2J1EA 1OUXA 2BW8A 2X8KA 4N9IA 1JTZX 2QQLA 1WBFA 1JW6A 3TB0A 1IS4A 3WQ0A 5A6XA 5IAXA 1LU1A 1C8M1 1VBD3 1G8WA 1CZTA 1OQ1A 4AEDC 4F7ZA 3KVBA 1C1FA 1DLCA 3RDIA 4KWKA 4L9BA 1HB2A 3BYWA 4YGDA 2FMYA 4DUVA 5KXDA 3R0RA 1W8NA 2R072 3TBDA 3TOJA 1AF9A 1TME2 3JQWA 5A7SA 3E97A 5L9BA 4Q8KA 3LFIA 2UWAA 5D8AA 1K5JA 2D6LX 2XBO3 3NMBA 1O3RA 3T30A 5FZCA 3NAPA 2Q8OA 1MR5A 2X5IB 4QAWA 4LO5B 4IEZA 4KWUA 3VDCA 5BNQA 4XUOA 2WO1A 1SFNA 2YROA 1EV12 4B3NA 4MGYE 3ZYJB 2MEV1 1NUKA 1PO11 4Q4W2 4BZ4A 2HWE2 1Y7BA 1BBT3 4GKYA 3VHRA 2VMGA 4TSVA 1GZWB 3MYXA 4YGCA 1SLTA 4OUEA 4Y5SA 2VQUA 5A32B 1ZREA 2YUEA 3WT3A 3PLQA 2VVFA 3BPSA 1LB2A 3E6BA 3ZVXA 1P8JA 4C90A 2RR13 1EP0A 3M2MA 3OGSA 3ILRA 3Q9OA 5FZ6A 3TN93 4MGSA 2TEPA 4D7SA 4DXTA 3DPRC 3OGJA 2WZR3 2IC1A 1IKQA 2XG3A 1RUF3 1D4M2 1W6MA 3INAA 3LA2A 3LOIA 5BNOB 1WLWA 1G9AA 3AVRA 2UYBA 1R1A3 1RGSA 1WD4A 2ORXA 3IAPA 4LO8A 3VKFC 1OLRA 2WINB 4AFCA 2ERFA 1PMHX 2HWF2 1PO21 3T4HB 2FZ2A 1TZOA 2VZTA 4A7KA 1G9DA 1XJAA 2R0HA 2W2IA 2X29A 3I7DA 5CIRA 4A7YA 5FZAA 2QQPA 1W06A 5I0SA 1DQ6A 4QB2A 3APBA 4L97A 5A7PA 2EVXA 3TNQA 1ENXA 3FL7A 3P6BA 5KXBA 2D7FA 2GH8A 5LA1A 3W58A 3DYMA 4C0BA 5C5TA 1B09A 2CAVA 1A6CA 4W6XA 3POEA 2BERA 4E27A 4QDSA 3FZ3A 2ZGPA 1EUUA 5K0UA 4ASKA 2FMDA 2QQKA 4DUXA 1QIQA 1FOD1 2G4IA 2JIJA 2WR9A 2IXKA 3NO8A 3K51A 3NSTA 5T52A 4HSJA 1NCRB 1GOFA 2VUJA 4QQLA 2G9GA 4NHMA 5KHHA 2CNAA 4GULA 4M0HA 2KR2A 5H9SA 3USUA 3DKQA 5C71A 4XDOA 1T2XA 1WW5A 2PAKA 3PUIA 1QJU2 1W6PB 4ITCA 4LBMA 3VD3A 3DYOA 4CA9A 1QF3A 2ZHLA 4LO6B 5FZKA 3DL3A 3E1F1 2PHFA 4NVPA 4CEWA 3UGHA 4AQ2A 5FZGA 4AHZA 4G4FA 1XC6A 1QXPA 4FCAA 4R9AA 1NQJA 2D6PA 5CNAA 4YZ5A 1AXYA 2Q8DA 4S2GA 5FZMA 2BZDA 3QLQA 3VKLA 3LIHA 2D43A 1BVVA 3FN9A 5CG9A 3E6DA 4YW6A 4YW4A 4CP0A 1UY3A 4DS0A 4EN0A 1J3RA 3O0XA 5JZGA 3ZX7A 1R081 4AF9A 5A1AA 1GU3A 1SLBA 2ZGNA 4IEQA 2ZABA 4IGOA 1RUG3 5T5OA 2EIDA 1GWKA 4DEQA 1XQNA 2IXCA 1C4RA 3RZJA 1E5IA 1VBA1 4FTBA 4RQPC 3ZN4A 4MG2A 1DQ1A 4XQ4A 4CYDA 4HN1A 5KXCA 1UOBA 1HQLA 4IE0A 3OPZA 3WOGA 1DQ4A 3VDBA 1DLLA 5JMOA 1FMD1 1NCQC 4UW6A 2AREA 1H30A 4O7XA 4AAXA 5C3RA 3IM0A 4QDRA 1J3PA 1RUC3 2Y64A 4NMIA 2W08A 1OT5A 2HEYF 4AGGA 3O14A 4P14A 3WNKA 2QQOA 5CFCA 1H8TB 5C9AC 3W59A 4FI9A 5FUIA 5JXGA 1W9TA 2UYAA 4FOVA 1NXMA 2Y26A 3DGTA 2XBO2 2XJUA 3ZXEA 4CP9B 3WQ7A 1PGL1 2IXHA 3J8F3 4EWEA 1LOEA 4J1WA 3THCA 4A7ZA 1OA3A 4P9IA 4INDA 5FOJB 4QX3A 4LIUA 2CGPA 3WP5A 2YC0A 2RJKA 2VECA 1POQA 2D6MA 4FBFA 1W0OA 3OY8A 4AI9A 4UFHA 5ISLA 1BBT2 1SPPA 2BNOA 4YRDA 1V70A 4J6GA 4LTAA 4LKSA 4Q4Y1 2K0GA 2PTMA 3N7JA 5FZ0A 1J59A 5D1IA 1CJDA 2VE1A 3H9AA 3B02A 4I01A 4N53A 4BQ4A 4DUWA 3FHAA 1AHSA 2A3WA 2XR4A 1S0JA 3GZAA 3TN92 4C1WA 4XJUA 4AWDA 3NJXA 3KV6A 4YFWA 5IUQA 5E1RA 4N43C 5DAPA 1GZ9A 1QGLA 2JDKA 4CCLA 4B1MA 1OQDA 2WZR2 1Q56A 3PHMA 4D3WA 5FRAA 1VE0A 1ENRA 1OBNA 3WXPA 5CBLA 2N7GA 3UGFA 2BEOA 2BQPA 1GNYA 1DZTA 1F35A 4FSJA 1R1A2 1S2KA 1RUH3 2OQ6A 4E2SA 5FZIA 4Q4W1 1BEV2 2HWE1 2J7MA 2QQVA 3ES4A 3K48A 4P00B 5A3PA 1UNBA 4PIYA 2EICA 4XPVA 3UKTA 5FP7A 1HKDA 1REFA 3N9PA 2WIIB 4NN0A 4ZPIA 3CO2A 2WNVB 4GJYA 3OBAA 1QDOA 1H2LA 1X50A 2PELA 4RYDA 4FAHA 1AL23 4ZXEA 2V4AA 2JECA 2R042 5GZDA 1FAYA 3C7HA 5BUVA 2X5IC 4V1PA 4N43A 5A7NA 1I6XA 1QJX3 5F6KA 2EAAA 2YGLA 1GANA 3RPQA 1GWMA 1ND2A 1E57A 1JOPA 1HJFA 1KFXL 1RTVA 2CYFA 1N1TA 4MO3M 2LUWA 2KM2A 4QPIA 5BNPB 1IG3A 4TTGA 2EIEA 2HEWF 1JN2P 4IEXA 4XC9A 5C70A 1PM4A 3EHKA 4OULA 5I0UA 4KGQA 4O65A 2W3JA 3AJYA 1BXHA 2A70A 2YBKA 2ZACA 4D7TA 5LA0A 2FDHA 5C8CB 4B1LA 1US2A 5ACA3 3IDEA 1NAEA 4MHUA 2IXLA 3ZFGA 2DUQA 3POBA 3RZHA 4MGTA 1CAUB 2Z79A 2JEMA 3GXUA 2A6YA 2DBNA 1YO8A 2BBVA 2ARAA 4HT1T 4LBNA 1N1SA 5CFDC 1QOOA 3AKSA 4ONUA 5F3IA 1XU2A 4AR2A 3LPGA 5FZBA 2I07B 1ODNA 2VUDA 4DEVA 2XUEA 5J09A 3A7QA 5BNOC 3LA3A 1NXD1 1VMFA 4XTMA 1NKGA 4FPCA 1AL0G 1TNRA 3A23A 3POYA 5FPAA 2Z5WA 1RUG2 3AFGA 4YFZA 5HI0A 3VBSB 3X29B 4Z1VA 4P9JA 1MS1A 4OUSA 4GWNA 2O0OA 4H3WA 1IQDC 1UWWA 1H1AA 3OYWB 1I1EA 1CGPA 3OGVA 2HWD3 4PF1A 1VIWB 1ZBA3 1X8EA 2VCBA 1F9KA 4Q4X3 1MVQA 4PLOA 4COVA 4YZ1A 1YQCA 1C5IA 3PVNA 5FLHA 4CU8A 3H8RA 4I0BA 3CIHA 4YGEA 3AXEA 2Y6JA 4JGYB 2LRPA 4R9DA 3I2JA 2VAUA 1G9CA 4IETA 4AVCA 1UL9A 3J26N 3WW3A 2RS31 3OUJA 3MPBA 4AEMA 3CNAA 4PCRA 4OHWA 4UT5A 5JVVA 1MS5A 1PIV1 2EF6A 3B9CA 1UOFA 4KQ7A 4RSUA 4RS5C 4J25A 3LF7A 1WCKA 1JZ5A 3J8F2 4GMP1 3I3EA 3ZXJA 3HR9A 4KNCA 3N9OA 4AVAA 1GQPA 1FV2A 2BBAA 3G6JB 1VRH3 3VB9A 5JLVA 2J1UA 2WLPA 3VV1A 2VU9A 1O91A 1VBD1 2HWB1 3IB3A 4P9XA 3JBG2 3GBGA 2DCYA 5IW0A 4K1YA 1MEC3 1JXNA 4QX5A 4QGMA 1VALA 2XLFA 1A8DA 1AYM3 4BQWA 1AR82 1GZCA 1FNYA 4CDUB 3F2ZA 1ZZ7A 4L99A 4Y22B 4A3ZA 4UW4A 2FZ1A 2GMMA 4RHV1 1JUHA 1NLQA 1OQEA 2HKXA 4NRPA 2LTNA 1S55A 1K5MC 1A3KA 1H8VA 2QUOA 3CKHA 1O8PA 1HDKA 1UZ0A 2V4VA 2MPFA 3JD73 3JUUA 4FPJA 4LK7A 3IMNA 5L7OA 4CDXB 4R4XA 5C4WB 1LOAA 3T1MA 1RL3A 3ZN6A 2Q1FA 3AMNA 2ARCA 3ME2A 2KXLA 1REEA 1CAVB 3P5BA 5FDBA 4JAAA 1EPZA 1SDDB 4NAOA 4QQOA 4X6RB 1U5YA 1ZRFA 4M4PA 2ZX1A 1K42A 4G3YC 4RFRB 4QWNA 3AFKA 2RR11 5FUNA 2VTXJ 1H2KA 4YVSB 2ETEA 2P3IA 2XHKA 3D3AA 1AL22 3AKRA 2RG4A 5BPXA 4PQ9A 3CJIA 4NPMA 3AMPA 3OB8A 4YVWA 2WZR1 2XJQA 1I5PA 1OVPA 1TEIA 2WO7A 3D5OA 4NR1A 3C7EA 4Q1RA 2YGMA 1SEFA 1NY71 1WBLA 1RUF1 2Z42A 2GC2A 1GQHA 4JDNA 4MLOA 4DINB 5B2GB 3KV9A 1W3XA 2V09A 5C3QA 2WJSA 5DXDA 4UFKA 3H8XA 1SLLA 3NJYA 2HWC2 5LASA 4Q0PA 1K5MA 1N1YA 1ULEA 2WO2A 4XURA 2QBXA 1UKGA 4CCJA 1RUJ1 4IEOA 1JYTA 1QJFA 4GB31 3I2IA 2RV9A 4XFFA 2B9VA 4PF5A 3WDUA 3I59A 1REDA 4FFIA 2QDRA 3ILNA 1COV3 5FMOS 3ZO0B 1ZVFA 5GALA 3NJVA 1QOTA 2YXSA 1UIKA 1HB1A 2VZRA 3NAPB 5EYXA 1XSRA 2RJLA 3QH7A 1ZZ9A 5FXVA 2WFF3 3RZLA 2O14A 2XKOA 2WT1A 1Q8VA 1ZBE3 2ATFA 1D2QA 5CISA 4UFIA 2EA7A 3NWKA 4GIQA 1G7YA 4LE4A 4XFBA 4ISQA 1DYKA 3Q8EA 2FDKA 3USSA 2VQAA 2QVSB 2W94A 1UYPA 1DGLA 1Q8OA 4MX3A 1O5LA 1OF3A 4IE5A 4QM9A 2C26A 2Y6FA 4QU1A 4Y20A 2VMIA 2NMNA 3RYPA 2HWD2 2VZQA 3VHPA 4GALA 1ZBA2 3CQOA 4UW3A 1TMF2 4Q26A 2WNVC 4Q4X2 3VBRA 1JODA 2XUMA 4P9GA 2WO3A 2VBBA 2ZX4A 3POJA 5EJZB 5F3EA 5IVFA 3L2HA 1ULFA 1AR73 3VD7A 4C1XA 4MUVA 1TQ5A 3PU8A 1VBC3 1WZXA 1MS3A 2DCTA 1GFF2 1IQAA 2WUHA 3FWEA 1W8OA 3GBWA 3WDXA 5F5QA 4UXAA 5AVPA 3RZMA 4QPGC 2PHLA 5T5JA 4D69A 1HN0A 5LEJA 1PVXA 1A34A 2JE9A 1LAJA 5CYYA 2Y6GA 4ZU4A 5HV0A 1O5UA 2A71A 4GKXA 2BWAA 1AJOA 2D93A 5BNPC 1CONA 1RVF3 4KL1A 2BRTA 2AC1A 2D5FA 3KS7A 1EAH3 5JR2A 1OSGA 1QEXA 2F4PA 2QKDA 4UF0A 1WW7A 1GQGA 1KEXA 2RDNA 2YZ4A 2Y34A 3J7LA 3SCHA 5C8CC 3AP9A 3H1WA 1XNAA 1VRH2 2ORZA 2PHWA 3JZVA 4MGZE 2MNGA 5F5IA 2XL9A 1YQ5A 3ZR5A 3MIGA 3ZSEA 4OHVA 3ZYGA 4B29A 1VB4A 4A42A 2XWJB 4YZ4A 1GKBA 2CU5A 1SBDA 5FJHA 1ACCA 2QZ2A 1L7QA 4I02A 4OI1A 2R1DA 1T6GC 1MEC2 4YW7A 4E2QA 4BQ2A 1EPWA 1LOFC 1RUC1 3HNBM 5DDJ3 4NPLA 3UL2A 1TE1B 1AYM2 2K2SA 2BPA2 1AR62 3WY6A 1ZRRA 3ZYHA 2FD8A 3K75B 3I2GA 1LKNA 3M3IA 4IERA 3SEPA 2VZSA 4LULA 4K6BA 4QPGA 3T2TA 1C8NA 2NZ9A 3RS6A 2DUPA 2Q8CA 3USUB 5JXJA 1O8SA 1UF2C 3ACLA 1QQP1 4LBOA 1KRIA 4B7EA 3K3OA 3JD72 3KMHA 4XCAA 1IPSA 2ZGRA 4WM8A 1BMV1 4KU8A 3RMXA 4CEWB 2A3YA 1YFUA 4B7KA 1H4GA 4DRVA 1X8MA 4WM7A 2R073 3ZR6A 2ZGUA 2W5FA 2OPKA 2YMZA 1Y4WA 5JOXA 3MV11 5M0TA 1KITA 4JGYC 4BWOA 3L2YA 2JJ6A 4LT5A 4H7MA 2VW1A 5JZGB 3VHOA 3AKPA 1EV13 1LOFA 3HNYM 2WABA 3WF0A 3P3PA 1RUD3 2B5HA 3JB8A 2PLV3 4XHXA 4AOCA 5J36A 5F32A 3ABZA 4E8DA 1ZRCA 1KDMA 2ZEYA 4Q0UA 2IFWA 1DZQA 1W99A 2IVIB 3N7MA 3M70A 5ANQA 5F3CA 2GNMA 2W68A 1HRV3 1WCSA 2R063 4D7YA 2JD4A 5F5AA 1Q8QA 1RUH1 4CUAA 5I8SA 4YW5A 5CG8A 4JZRA 4FXGB 3UNPA 1YNAA 2J1RA 1UXZA 3KHBA 3U4SA 2IUWA 3VBUA 1N3OA 1U5IA 5FZDA 2VZVA 5CFCB 5KHJA 1HV0A 4QGNA 3LEIA 3ENRA 3EYPA 3SKVA 5JI9A 1COV2 2HH9A 1D4M3 4CDUC 2O8OA 2CSGA 5DQ0A 5C6CA 1BK1A 3I3BA 2FCTA 2WFF2 4LOTA 3AZVA 5T3NA 3KD4A 1UZWA 2HWF3 1J58A 1QJX1 2VXRA 3WNPA 1YFYA 5E8AA 4QX7A 2XKPA 3ETPA 2LROA 3OY8B 1YFWA 2VQ0A 4AQTA 2VMEA 4NIIA 4CDXC 1RUI1 1SPPB 1VPHA 3HVDA 1H6YA 2BUKA 2DU0A 1UO9A 3EO6A 1OKOA 1GMMA 4IGQA 4IEVA 2CGNA 4AI1A 5I0TA 4E4SA 1OMIA 1ZZBA 1VBB1 1PNFA 1DFQA 1FI2A 1ST8A 3TRSB 2RJ2A 3WDVA 5ACA1 1GP5A 1F5FA 4HVOA 4LMFA 4YLZA 3KCCA 1DGWX 4OUMA 2E6VA 4LNVA 2WC2A 3SKJE 4BPZA 5GZEA 3POIA 3PIGA 1MPXA 1AR72 3LEGA 4Y1UA 2JDMA 4L8QA 3BALA 4R4ZA 2D6OX 3T08A 2XJSA 4MH0E 1OKQA 2DFBA 3R4DB 3CLPA 3UKNA 3KVAA 4MXWA 2DTYA 3D82A 3VZNA 4NAMA 1ENSA 4QM8A 2FCVA 4AI2A 1RVF2 3WD5A 3B7MA 2E53A 4YM0A 3ITQA 2G9ZA 3PJYA 1YYNA 2W39A 2ZTNA 4HMZA 3C8XA 4OMCA 2WZPP 1Q8SA 5T5LA 5FMBA 1W9SA 3NV3A 4HK9A 4Q4X1 3CU7A 5D8AC 4XUNA 1URXA 1NX9A 3S6PA 2GAUA 1KJLA 1POV1 1UY0A 4NHYA 4N43B 4AQ6A 4PI0A 4S2DA 2VNVA 3RZZA 5IK7A 4IEWA 1JZ7A 3BU7A 3JQXA 5DDJ2 1U12A 2B7YA 4IV1A 1UY1A 4KGGA 5AC93 4AL9A 2V5YA 4K20A 2VBPA 4QPIB 2JDPA 3J4UH 5CU1A 1R091 4AW7A 4LKFA 3N4MA 2UURA 3FC0A 3DXTA 3LAGA 3ECQA 5FWJA 1ZRIA 4AFAA 1RC6A 3ZKUA 3L9JT 4CDQA 2VY0A 2VJXA 1QJY3 1W0NA 2VTXA 3ZFGB 1VBE1 1GLHA 1I9RA 2W95A 3IIIA 4GAZA 4CPBA 3ELNA 4FQ4A 2CHHA 3POGA 1HIXA 1MS9A 4W50A 3AP5A 2B8MA 1WCQA 1O4YA 1VAMA 3FLRA 3VD9A 4FTSA 3O1TA 1H1MA 2QQNA 5FY1A 3WUCA 2H0VA 1K3IA 2DU1A 2H6BA 2Q1MA 3RZGA 4BK4A 5GZGA 1MEC1 1QH7A 4XF1A 1Z78A 4PIZA 4EN6B 4Y1YA 1AYM1 1GNHA 2FDJA 1ZZ8A 3UJQA 4PJYA 3PUQA 4AE2A 4DRRA 5EIYB 1V6MA 3NJZA 5J7MA 1RUD2 2GU9A 2PLV2 5LRRA 2Q4SA 4MVTA 3AL5A 4NJ4A 4Y1VA 5B4XA 1YI7A 1EY2A 3WNLA 4C8DA 1U5ZA 2W92A 4AXOA 5A6ZA 1GZTA 4AEKA 2NM1A 3CF6E 3HQUA 4XQDA 4XOGA 5FZ9A 3O1RA 5E6HA 1PK6A 5DAVA 3RMYA 1WCDJ 1HRV2 2R062 3VLBB 4QQHA 2ARBA 1WMEA 1JZ3A 1W39A 5FYCA 1LGNA 4CP1A 1YQ6A 2HBTA 5FP9A 1NG0A 1PNGA 4CPBD 5K0UC 3ON7A 5A6QA 2OS2A 2B45X 2NQYA 2UWCA 1OA4A 1SCRA 2JENA 1O4TA 5BXXA 5CFDB 1NLSA 3KV5A 5JWPA 1PGW2 3BTZA 1YIFA 2QTWB 4OZOA 3LCPA 1HRI3 3IT8A 3MI8A 2JIGA 1W2UA 4JX0A 1HXS1 3UJOA 4C91A 1CZSA 3QD6A 3CZJA 4JGZC 2DURA 3LWCA 1SG3A 2XHNA 3PTYA 3VZMA 3V0BB 2J1SA 4GQ7A 1BEV3 5D21A 4BH9A 2EXHA 3NNGA 1S2EA 5F9TA 3K4AA 2BOJA 2BP6A 1SQ4A 3BOPA 5JCTA 5GJ6A 5FAXA 4MZUA 2ZXQA 3H3LA 4CEWC 4EROA 1GP6A 1GSLA 3U75A 3ZSKA 3OF1A 2DVFA 2XJTA 5DG1A 1LESA 1SMVA 1GOGA 1LOGA 3SHRA 3SISA 4LLOA 2WZEA 4XBLA 5A6YA 4QDQA 5FZ4A 5H9RA 4P9WA 3SH3A 3WZ1A 2PA7A 2R043 5DAXA 4IW3A 4AFBA 3I3QA 4L92A 1E5SA 2ADEA 3OD4A 5IVYA 4CCEA 1Z0HA 5BV6A 1DU3D 1S0EA 1X33A 3PUSA 5BNNA 3KT4A 5JZGC 2BDRA 2XVKA 2IXIA 1NZCA 1PHMA 5IK5A 4P08A 3I3MA 4LJHA 1IOAA 1JHJA 3E5UA 2WRAA 4RS5B 5KC6A 5F5CA 2FDGA 2RHPA 4JGZA 3SEEA 1ZBE1 2OXBA 5L7OB 3VZKA 1ASJ3 3V0AB 2FHRA 1YJKA 3W9AA 5KXEA 2WA3A 1UIJA 3ZN6B 3SLIA 1QOSA 4LBQA 1JZ4A 3KGZA 1RMU3 2GC1A 3AYEA 4KU7A 2ZGSA 2A5ZA 4OLLA 4M3CA 1H6XA 3WEZA 3LDRA 4IE6A 3FE5A 4MGQA 5T5PA 1DHKB 4BXSV 2GSYA 4DMIA 1POV0 4OYUA 4BMBA 5CFCC 2BJSA 3VGIA 4IXLA 2OPWA 3N9QA 1XYPA 3CJIB 1EYBA 2NMOA 4YM2A 3EBRA 4YVWB 1W8FA 1R1ZA 5F2WA 3ZDSA 4HBNA 3MLLA 2VG9A 1JOBA 2RS52 2DTWA 2C9KA 4URTA 1Q43A 4HOOA 4XE9A 2D3PA 4ASLA 1VBC1 1W2AX 2PQSA 4LHKA 3RI9A 3ZKYA 2BFUS 4BK5A 5AC92 3ACIA 5LCWL 1AUYA 4LHSA 2W9XA 4LBLA 5GLUA 1K5MB 4PDWA 1DIWA 3WINE 4CXWA 1W8ZA 3B9IA 3MW2A 2GDFA 4QX0A 1RVF1 4E4DX 3BIEA 4N53C 5FMCA 1HV1A 4GH4A 3VZJA 1EAH1 4LBQD 4QKDA 3I59B 3FFZA 1QJY2 3MGUA 1W9YA 3P3NA 2RS13 3ZYIB 1W3VA 4COUA 5C7GA 1FNZA 1PZ7A 2A6ZA 1CIWA 1QY4A 4CCNA 1AR92 1UY2A 4Y4YA 4JVAA 4OQ8A 4A41A 1CN1A 3HPNA 2ZAAA 3AM2A 4BIFA 3GALA 1WLDA 5FYVA 3WX5A 1WW4A 3BN6A 2XPJA 3LZZA 4OVEA 1XNTA 2DVDA 2GMEA 5L19A 1XYOA 4FPLA 4GXLA 1LODA 5LBCA 3RGBA 3T2OA 5F7UA 4JTOA 3O0VA 4XBNA 2AYHA 3K4ZA 2CWMA 4P5YA 1RUE2 5G05L 2G1MA 1LR5A 4Y20B 3ZPYA 4AGRA 4X8PA 1Y43B 3ZYRA 2ZA9A 3RWKX 5JSPA 1ULGA 3VBRB 3SC7X 3JBG3 4JDMA 1QXRA 4NWWA 4Z07A 3ZM8A 4CUGA 4XJWA 3W21A 1O6UA 3MFAA 4YSFA 1FPN2 5IYYA 4MHRA 3RG0A 1AR83 3LEMA 2R071 3Q8FA 4I3GA 5K8SA 1TME1 3MO4A 3T1LA 3VBFC 2JG9A 2VUAA 1YLLA 5EQUA 5FPVA 2PHXA 3GBFA 4JCKA 3MLJA 4JKMA 4ZY9A 5CAZA 2CDPA 1ND2C 1O4ZA 3LA7A 2E33A 1VLNA 3OEBA 1RYYA 2B4KA 1Q3EA 3VHNA 1HRI2 1OFNA 4RA0A 3KB5A 2X53S 4QPIC 4Y26A 4EWAA 1S0BA 3LKJA 4DQAA 4GWIA 3W5MA 1EV11 2V72A 2JICA 4XFGA 2PYTA 1JYNA 3KT1A 3ST7A 2JE7A 3ZYPA 4UF0B 4QPYA 2JXAA 2YC2A 2E63A 3PVOA 4FPGA 4TWTA 4JHZA 1T6BX 2JDYA 3IBMA 4NUBA 1I5ZA 2X10A 4FPFA 4LUMA 3ZFGC 4OHYA 3KV4A 4RGGA 5DPNA 5F37A 2CTVA 3ALQA 2ZGKA 1STMA 5ERLA 5FZ1A 5A7WA 2UY8A 3DCQA 3W5NA 3O1UA 2PN5A 5CVRA 2BYVE 1F5JA 4RGAA 4CEYA 4RL7A 5LY1A 5FYHA 2VNGA 5FYYA 3VBFA 1JU3A 1D4M1 4N9HA 5EXOA 2DCZA 4QPGB 2NN8A 1S0GA 1YHFA 1LJ7A 1ND3A 5EP9A 5FY4A 2HWC3 3NV4A 2ILMA 1BZWA 5H9PA 3NKGA 4WVMA 4DXSA 5KHGA 2HWF1 3IIAA 4AVSA 1JOJA 3FMGA 4WM8B 3BB6A 4SBVA 1ASJ2 1W05A 4QGLA 4YW2A 3T4VA 5FPLA 5FR3A 4XFCA 4JDOA 5FO8B 4WM7B 4FP2A 2W0XA 4BA6A 1E5RA 1GNZA 1W04A 3KT7A 1RMU2 1FYUA 4XBQA 1BQPA 3D4KA 3MDPA 4PLNA 5GLZA 5FK8A 3I2KA 1J84A 4YM1A 3ZXDA 1W90A 4WV8A 4I09A 3B94A 1ZM1A 2NP0A 3WNNA 1DF0A 4N8MA 3LSDA 3IWZA 4KH9A 2BVBA 4B8EA 5CKNA 2A7AA 1PVC2 3M8LA 1W6OB 1JH5A 5FXWA 2LS6A 1IG0A 2D6NA 2VM9A 1S0IA 2VULA 2XVLA 4IDZA 4H2AA 2RMU2 4IEUA 3H8UA 2BNMA 3B01A 5FZ7A 4D6RA 1IPJA 1QJU1 3AZZA 1L3JA 3MW4A 4TLFA 1WLTA 3LGRA 3WF2A 2WT2A 3HBZA 1TMF3 3VBOC 4A2UA 3LDBA 1RHI3 3HQXA 3M7AA 4Z2AA 3VBUB 3EQEA 3GJBA 1WUVA 4EZ4A 1N3PA 5F1RA 3OD0A 1WKYA 2LALA 4CU7A 5CKQA 4XZUG 2RS12 1XU1A 2Y6LA 3A0NA 2VTFA 2Y0OA 1UMZA 4GWJA 5DAWA 4ZS2A 1QJEA 5C5UA 2XXZA 1W2TA 3ZDVA 3WR0A 4A45A 3WVJA 5L73A 1KXGA 3ROUA 5FYUA 5FPXA 4XJ8A 4HPKA 3FJSA 5FYMA 5L7OC 5I8TA 4FOWA 3KGLA 1US3A 2VW2A 3AZXA 5FFOC 1IZ3A 4YNIA 2QQUA 4XABA 3H0OA 2CDOA 4K7JA 5FYZA 4AQSA 1C1LA 3MF9A 4M3CE 5EV7A 3HEIA 4XDPA 1YEWA 3WG2A 4XF9A 1F15A 4QHZA 1O3TA 1G9FA 1XSQA 2R7EB 3VBOA 2R49A 3VDAA 1HB3A 4DB5A 5GZFA 5IVEA 3MFCA 1X36A 3CJIC 2JDHA 1AYN2 4YVWC 1AR63 4QB6A 2ZMNA 2YBPA 1ZNPA 4AG4A 3WP4A 3OTFA 3QOPA 4JRLA 2XBO1 2Y8KA 4MXWB 2ZMLA 4A44A 5IHRA 4GZ9A 3SCGA 1H2NA 2QQWA 5K9YA 5FP4A 2BU9A 3ZMNA 3MIBA 4LQRA 3H7YA 4R9BA 1HW5A 2A6XA 2Q1ZB 1BBT1 4Q0QA 1N47A 2A3XA 2R16A 4PBOA 5E88A 4CCMA 5LEKA 4FFGA 3E6CC 1JZ2A 1TVGA 4AK3A 4BYYA 1KQRA 1L7LA 2OT7A 4Q0SA 4X6QB 5F3GA 1W8WA 3MW3A 1DYOA 2WWUA 2UU8A 1KD7A 4N7IA 3TN91 3H7JA 1C5HA 4LXLA 3VKOA 2JDZA 2BNNA 2WN2A 2QE3A 5LK7B 2EIBA 2ZZJA 4PQQA 1OOPC 1GYKA 2A6VA 3Q8BA 4WZFA 3OBRA 2VMHA 4EYUA 2QZ3A 1SFPA 3AZYA 5A70A 4XW3A 4ET7A 5J96B 3JXSA 4BQYA 1N3QA 4NO4A 3S7EA 1R1A1 2JWPA 1JS9A 5FK7A 3EB7A 4CDQB 1BEV1 4N7UA 1KFUL 3WQ1A 3AXDA 3IMMA 3VBRC 2D6KA 2XMLA 2PAMA 3WG4A 2WS92 1OH4A 3ACFA 1HLCA 1J3QA 2D98A 4K8FA 1LEMA 1NZIA 3IZOA 5FY9A 4ES9A 4Z8BA 4LOSA 5D8AB 4YWAA 2DVBA 4Q4V2 2PXJA 1V9U2 3PIJA 3ORJA 5K4LA 5J1XA 2YG0A 4NRQA 2R041 1DYPA 3TEYA 2WLQA 3WV6A 5BYNA 1D0HA 3CMGA 3OBZA 1E5HA 3K3NA 3PL0A 3T09A 4COWA 4OI0A 5A3WA 3I2FA 3PVBB 5JIUA 3HT1A 1BK0A 2D5HA 2AEYA 2YHJA 3LIGA 1OOPA 4ZZ5A 2V73A 2YDEA 4FXKB 5J48A 3NV2A 4BQ1A 3NRUA 1V6KA 2XOMA 2VBDA 1MACA 1YRZA 1S0DA 4QKBA 4QX1A 3ETQA 1I3HA 2WDBA 2Z4FA 3I2HA 2Y33A 1RMU1 4JQTA 1H9WA 1RHI2 1YI9A 2WQ4A 3IPVA 1UU5A 2XH6A 3SH5A 4NOTA 1OD5A 5EYYA 4CP9A 4E9KA 2F17A 3EXUA 1Q8PA 1QNWA 4LA2A 1W6MB 3LQCA 3OBTA 4XVHA 2QQIA 2YPJA 4JC1A 1XOYA 4GMP0 4IV3A 1K12A 3WG3A 1BHGA 2AR6A 4ATEA 5FYBA 1UN1A 3FBMA 2QNKA 2ZGMA 4BQXA 5KC5A 2XQRA 1D0GA 1XNCA 4LIVA 2P2KA 2C1FA 4WM8C 1RUG1 2NLRA 5FQ0A 4FVVA 5DABA 5JXIA 1RUNA 1MS0A 3FLTA 3KWVA 1AVBA 3F95A 3K4DA 5SV8A 4EQVA 2R6QA 1UW8A 4WM7C 3K77A 2WSVA 5L36A 4PI2A 2AENA 4FTEA 5A7QA 1PZ8A 5ABJB 1ULCA 3KF3A 1KS5A 4MADA 2A73B 2W46A 1R64A 2G19A 2E9QA 2ZPXA 4IEPA 4MSVA 5FTTC 5FPUA 4ZHNA 4QB1A 1W0PA 5K0UB 4LBKA 3DUIA 4META 5IVBA 2BGOA 5ANNA 5BNNB 2RS11 2ZHKA 3CHXA 4XF0A 4BIOA 5HCHA 4QKFA 1WMXA 1WCUA 2RDRA 4HK8A 3OEAA 1NT0A 2YBSA 2D44A 1K45A 1UD1A 2P3KA 4ARYA 4B4PA 1N1VA 3S7IA 5DUWA 3WUDA 4JGZB 1G86A 5FO7B 5HV4A 2QFEA 2ZEZA 1NQDA 3J8F1 1D7PM 1JBCA 5C3PA 5DG2A 2QCSB 4JV4A 4CUCA 2WWSA 5JIAA 3MBWA 3AC0A 3O1OA 4M3CB 4LHNA 3RYKA 3BKZA 4M01A 3MLKA 1W28A 4UBHA 3VBUC 4B4QA 4DY3A 1LHWA 1WW6A 3MIHA 3FLPA 5IJRA 3ZFFA 1GOHA 3JBG1 2Q5TA 4LR4A 1TNFA 1LRHA 2ADDA 2MEV2 2EXIA 3KCXA 3C3VA 3WW2A 5I91A 4HKOA 3GZUC 1DG6A 1CPMA 1AR81 1LENA 1ZA7A 4Y1ZA 5JMCA 1WWYA 1LEDA 4LKDA 3ZXLA 1MQTA 1IKPA 2H6CA 4R9CA 4RFT0 5I0DA 2ZBJA 2G9FA 4BISA 3T0AA 4PLMA 4PDWB 3RYRA 5A3OA 5LBBA 3H3UA 4XTPA 2LM3A 4MOAA 5IFPA 4OI2A 3J7MA 3M4FA 2JE8A 3PDQA 4QQ2A 5LK5A 2AEZA 3AKTA 4GH4B 2Z69A 2W52A 2JDNA 2VZPA 1CAUA 3ZOIA 1OF4A 1D4VB 5C3OA 4QXCA 3I54A 5GKAC 3ZFEA 1OPMA 2AH2A 3QACA 3OGGA 5GM0A 1SBEA 2VH9A 1YXWA 2WFPA 3NQHA 4KI5M 3WNXA 5FPZA 1J1LA 1MZ6A 3IDCB 2WQ8A 4QD2A 2Y0IA 3AYAA 3GCXA 3U1XA 5FMDA 1PO22 4RR3A 1RIRA 4BM8A 1YC61 1AL21 2HEVF 3UESA 3WG1A 4D8MA 2BFUL 4LLFA 4W6YA 3RVHA 2JB4A 2EXKA 1Z7S3 3AB0A 5EJ1B 2EXJA 3FUOA 1PMIA 2X09A 1W9FA 3N9NA 4XMAA 3WP6A 4HG6B 1MZFA 1CQ9A 2GP3A 3M3CA 1UU4A 2HWC1 4ZS3A 3ZLIA 4BQ5A 4N53B 4YM3A 4IEYA 1FOD2 3RSJA 4E2GA 5LATA 3MICA 4ZXKA 1VB2A 2QJVA 3WLUA 4XXPA 1HQWA 3HQRA 3WP3A 2JG9B 3B93A 4CXYA 4CE8A 3MZHA 1JU4A 3G7DA 3QBQA 4RGKA 5FZOA 1IHMA 4IV1C 1JHNA 5HCAA 2E7TA 4XJAA 2BV4A 2JG8A 5FY7A 2XONA 5CZKA 5FZFA 4B4RA 4BLIA 2PHTA 3NNFA 1WLCA 3PJQA 4Q2FA 5FYSA 3I49A 1GICA 3W20A 1LGCA 2ZGQA 3HIFA 3JU9A 4Y33A 4BQ3A 5A3MA 3C7GA 4BE3A 1LHOA 4DNYA 2ZHMA 4WZCA 3B3QE 2WBKA 3OOXA 5FKBA 1V6OA 2E32A 4HVRA 4F3JA 3KSCA 4CDQC 2YPDA 2YYOA 3THDA 3SMHA 2P3YA 2VCCA 4XIOA 3GNEA 1SDWA 5LA9A 2VQTA 5A3NA 2GN3A 4HANA 2VZ1A 4F8AA 1XB9A 1KDKA 3I8TA 5A7WB 4HZFA 3FHQA 2W47A 5H9QA 4NIAA 1UXXX 4PT6A 1AZDA 2HWD1 4NWVA 4Z82A 2ZGTA 1ZBA1 1R082 1TMF1 4D6SA 3LD8A 5FO9B 4IUGA 4CEYB 4CSWA 4ZU7A 1UCXA 1UMIA 3D8CA 4K8RB 3NNMA 2RM23 2RS53 3VBFB 1VBA2 4OHZA 2VGDA 3VDDC 5CEHA 4PBPA 1ZRDA 2YY1A 4A3XA 3V56A 1ND2B 1LNSA
chains in the Genus database with same CATH topology
3M3OA 3VBHC 1ND3B 2E7AA 5JI7A 1FMD2 5C4WA 5JR7B 3N7KA 4WVMB 5A3LA 2XLGA 5DUVA 2IWGB 1BYHA 1PK6C 4ASMB 1UU6A 1NA1C 3URFA 2P3JA 1AXZA 1RUOA 3AP4A 5T55A 3D0SA 1BCXA 1XE8A 3SH4A 3RJ2X 3FHIB 1PIV3 3HN1A 4FO9A 4TYSA 4L11A 1VRH1 4DOUA 4YVSA 3ZXAC 2H0BA 1AR93 2ZAHA 2VVEA 1CAWA 3B00A 5SV5A 5I93A 1UZZA 3AMMA 1W6QA 3RI8A 1CAXA 2CAUA 2PHRA 2DF7A 1B35C 1UZYA 3VDDA 4R8HA 1AX1A 1AR61 4Q4Y2 5GLVA 3O12A 4XDQA 1RUE3 2HWB3 2I74A 1FATA 2UY9A 1ZYBA 3BTAA 3VBHA 1U0AA 3WCSA 2PHUA 2GNTA 4OHXA 1UX6A 3JD71 4QT6A 1RITA 3WHUA 5EWSA 1XRUA 1NA1A 3FUQA 3MPPG 5ABJC 3LSEA 3M3EA 4RHV3 1FPN3 2VPVA 2CGOA 1NE4A 3PMEA 4COYA 2WNEA 4K1ZA 5BNNC 4KG8A 4XFAA 2AGSA 1Y9QA 4FOYA 1QJZA 2OA2A 1B35A 4RD7A 4HPKB 2TBVA 2SBAA 1UAIA 5J3UA 1HX6A 3IKWA 4BHPA 2IFRA 2B42B 4BMEA 1IS5A 1Z7S2 3VKNA 1PM7A 4ORFA 4AEDA 4TZDA 2PFWA 4KWJA 5HBAA 1RJ8A 1UKRA 3EJKA 2ZX0A 3VBOB 1H0BA 4U36A 4WBBA 2QDNA 1IGOA 1AX0A 3B5LB 3BOWA 2OYZA 3V64A 2WSUA 1MS4A 1C57A 1AJKA 2R1BA 2XL7A 3VBSC 3ZIXA 5JSOA 1COV1 4D94A 3SCFA 3DKWA 1NYWA 1RUJ3 4GB33 3CJXA 3S0MA 3QH6A 4XZPA 2WFF1 1UPSA 4MXVA 4PDWC 3VUOA 2GH2A 4K21A 4K9SA 1IS6A 4GH4C 4M3CF 1S1AA 2XGXA 5JPNB 2DVAA 4ISRA 1ALYA 3D6EA 1AX2A 3DPRA 3E5XA 1CD3G 4Z92B 2I45A 4I0WB 2XJRA 3UV9A 3THTA 1CVNA 3VL8A 4AFMA 3VZLA 4FT8A 2B46X 5FCCA 2RM22 4W6WA 3VBSA 1AR71 1PVC3 2WNUC 3WCRA 5DUXA 4XFHA 5EJ3A 1XYNA 1ONAA 4ES8A 5JAXA 2RMU3 1GBGA 3ZXGA 5GZCA 1NLRA 1NE6A 1VP6A 4Q27A 3R6SA 3MIEA 1CX4A 3AP7A 3HWJA 2ENRA 2RS32 2D3RA 4S2HA 1DZRA 5E89A 1QNYA 1VAKA 3PMSA 1PIV2 2O8QA 2XVGA 3NV1A 3GYDA 2JG9C 2A6WA 2BWCA 4CDWC 2ZMKA 2D3SA 3U4XA 4NHLA 1X82A 1S2BA 5DZGA 2K9ZA 2P34A 3N35A 4LEJA 3ZSLA 5E16A 1ULDA 2Q30A 3N36A 5IK8A 5DDJ1 1SFYA 1IPKA 1OOPB 3AMQA 2WNUA 3GHNA 2O1QA 5TSWA 5K7PA 1VBD2 1LU2A 2HWB2 2WKKA 4XILA 1BVP1 5A33A 2GNDA 1QU0A 2OZJA 4GWMA 4KWLA 2TUNA 5GLTA 5T50A 5IT6A 4FPOB 5KBFA 3DF0A 1S0CA 3ZSJA 5FMOL 3TYJA 3DV8A 1SLAA 5CADA 2R0FA 3AJZA 3IPVB 4HL0A 1VR3A 4RHV2 1FXZA 4CEYC 4AVVA 1AYN3 4AI8A 3JB4C 3N7LA 1QQP3 4MV2A 1DBNA 1V6LA 4GA9A 1SACA 4YW1A 4CDWA 4IV3B 4F83A 2ZGOA 3CEWA 1FX5A 2ZKNA 1F2NA 1ND3C 2WT0A 5HCFA 4RQPA 1JYCA 1W6NA 1O3SA 2XJPA 1H4HA 1VAVA 5FQ0B 1M06G 1LHUA 1RUD1 2OUHA 4OI4A 1LCLA 2PLV1 3VZOA 3ZIWA 3IN9A 1NCQA 2RR12 4W65A 3POWA 1WMDA 2Y38A 1X7NA 1CESA 4C0HA 1APNA 1QXJA 2DV9A 1OFSA 1HRV1 2R061 2VW0A 2VOXA 5C9AA 2NYYA 1LGBA 1NY72 4XHBA 4AI0A 1RUF2 4EV0A 2WL1A 2SLIA 4YYOA 4ATFA 4BOWA 5JSRA 1AXKA 1DGRN 1PGW1 4XF4A 3IDBB 4QMAA 4YZ3A 2OIIA 1RUJ2 3BIWE 4GB32 4HSLA 4LA3A 3WDYA 2GMPA 2R32A 1Z7S1 2PAEA 1LHVA 2WS93 1G6NA 3WHTA 3RRDA 2E7QA 1QHDA 3ZFFB 4ZKTB 4DZGA 3U11A 4Q4V3 1LHNA 1V9U3 2GC0A 3MIFA 1RUI3 3HAGA 4AI3A 4QU2A 1OLQA 5FREA 1MQTB 3RWNA 5I0RA 1VBB3 4AGVA 4UW5A 4LO7A 3J9SA 2PHDA 2NPIA 4Y5Z0 3B69A 4CP2A 3VKMA 3H1MA 3ZFEB 3ZMOA 3ES1A 2R30A 2JX9A 2BTVC 2ET7A 4FPKA 1QDCA 4U2AA 3U10A 4DXZA 2X5IA 4RR3B 1LTEA 5CA6A 3KM5A 3ZN5A 1JYIA 2B39A 3FBYA 3NKTA 1XE7A 1ZZ6A 3U0ZA 2GNBA 4Y24A 2RM21 2RS51 1GZWA 2E51A 4HVQA 1O7FA 5A32A 3SITA 5AC91 4XETA 4FQZA 1POV3 2EAKA 1FT9A 3V65A 4AVBA 1VJ2A 1BKZA 4EN9B 3ZSMA 4I3PA 1RUC2 4XMIA 3WW4A 1SCSA 5KWRA 5CFDA 1DQ0A 1A78A 1PZ9A 1QJY1 3GHMA 1R093 1NCRC 1DGWA 5AFBA 3R4UA 3SNMA 5BNOA 1WMFA 1AR91 5F6LB 3ZXFA 2AUYA 2JG8B 1QQP2 1O3TA 2D97A 2ES3A 4L2NA 4XFIA 1C8M3 3V0BA 3BCWA 3O7OA 3WW1A 1BMV2 1VBE3 4XIKA 3NVCA 2ZX3A 3AP6A 1NOVA 4H7LA 2ZKLA 1C3HA 1FV3A 3BODA 1MVEA 3AZWA 4AHXA 1RUE1 2ARXA 4YARA 4PIXA 1Y3TA 4EN7B 3S30A 4QXKA 2FBEA 2MEV3 1PO13 5C33A 4XJ9A 1SLCA 1FPN1 2EIGA 3H50A 4KBBA 4ZU5A 3JCIA 1UPIA 1NCRA 3AX4A 3UKVA 4RS5A 1D2SA 4HKLA 4MGKE 4FPHA 1PGSA 4IV1B 1A8MA 4FPYA 5T54A 3V0AA 2IXJA 1RUH2 3E5QA 3O0WA 1CR7A 5FBZA 1HRI1 1SLIA 1W6PA 4P9LA 2VOKA 3M1HA 2OW4A 2D40A 4YW3A 5C8WA 4IQPA 5DZEA 1XNBA 4MGIE 1H9PA 4AEJA 4YGBA 3N3HA 4DPNA 1H8TC 1HXS3 1HQNA 5KHIA 4H55A 1XNKA 1CAWB 1F8VA 5JDBA 3TWIA 2P17A 1W6QB 1PO23 1CAXB 1QJX2 1MS8A 2HJIA 4FP3A 4IV3C 2P37A 4XYXA 3VDDB 1V6JA 2EALA 3OJBA 1RUI2 3R4SA 1H1IA 4FPEA 3VN4A 3AYCA 4CTEA 2GN7A 1WD3A 5J98B 2VNOA 3VBHB 3QCWA 1VBB2 5FLIA 2ZCWA 2ZX2A 2XB6C 5ACA2 1PK6B 4LBJA 1NA1B 1ASJ1 1FOD3 4M0NA 1LOCA 4NHKA 1RINA 3KLSA 1H8TA 1YCIA 1SBFA 3D0JA 4WVWA 2DCJA 2ZGLA 5DZFA 1Q5OA 5J37A 4I2OA 1J1TA 1QWRA 1YIPA 4MYEA 5DUUA 3CL1A 3KZ4C 3KQRA 1B35B 3AK0A 1QKQA 4HFSA 1OHFA 2BVVA 1H2MA 1V6NA 2ZHNA 2C9AA 1CJPA 1PVC1 1YFXA 1YUDA 4AEDB 2VOWA 1LOBA 5HXVA 4AYUA 2RMU1 4CRQA 3I2DA 3ATGA 4Q1PA 2ZZQA 2DFCA 1R083 3GZTB 4WVZA 3ZFFC 4BCUA 4JQRA 3ASIA 3MF6A 3THPA 3TNPB 1IS3A 4YG0A 1VBA3 5CB7A 5AFEA 3AMHA 1R092 4OFGA 4YG6A 3TAYA 4YZ2A 4Y1XA 1MQTC 5JOWA 4FOQA 1RB8G 1U5XA 2ZOEB 2OZ6A 1FMD3 1QMJA 1DQ5A 1C8M2 3HT2A 2B9UA 1VBE2 3HD8B 3A4UA 4LBQB 2WA4A 4BLJA 1YWKA 3ZFEC 3MEPA 2YV8A 1G9BA 2WNVA 4Q29A 3DPRB 2AZ5A 4JRAA 1RJ7A 3R05A 1CPNA 2UWBA 4LE3A 4RR3C 2C0ZA 2DUOA 1PO12 3POSA 2FQPA 3VBSB 1AYN1 4NPRA 4Q4Y3 4R52A 5BNPA 2VVDA 3WDWA 4CZSA 2OUJA 1GR3A 4XXAA 4SLIA 3RQ0A 4FAGA 4JTNA 5FOBB 2I2SA 3HMYA 1WA4A 3WDTA 5C8CA 2GALA 1TME3 2XLAA 3VL9A 3A0KA 2IZWA 2DVGA 4IESA 3H3ZA 4EJRA 3NW4A 4P5HA 5EZWA 1V6IA 1HXS2 1JUIA 4AHWA 4HLTA 1ENQA 2ET1A 4K3UA 2KA3A 3PVEA 4G9SB 1QH6A 4Q4W3 2HWE3 2JG8C 4LHLA 4J1XA 4AFDA 1MZ5A 5FLJA 1W6OA 5GLWA 4LO4B 2PQQA 4LUKA 3C2UA 3ILFA 2WNUB 1S0FA 1ZZCA 2DCKA 4N90A 4Q0VA 3OYWA 3KCYA 4XF3A 2XWBB 4EN8B 2Q0AA 5A33B 4XJZA 4O9GA 4QHBA 3RJRA 3FFQA 2GC3A 4I30A 2ZS6B 4E4ZA 1DDLA 1C28A 1LULA 2CV6A 4AHYA 4JGYA 2WS91 1F31A 1BJQA 1LECA 2BGCA 3H1YA 4CDWB 2CL2A 3MIDA 4WVVA 4O9EA 2WQZC 4H14A 1ZBE2 2XJVA 4Q4V1 1ZX5A 1M4WA 1V9U1 5LRSA 4Q8LA 1OI6A 4DY5A 4XEZA 4RQPB 1W6NB 5C4WC 2C5DA 5EFUA 3O5SA 4UBGA 2A75A 3RNSA 3UK9A 1OA2A 5HCBA 2TNFA 1NCQB 4M00A 3LB9A 4IL7A 2OVUA 4HETA 4K40A 3AYDA 2DYCA 4QQPA 2CWSA 4S2FA 3LOBA 4YVSC 3U07A 3GF6A 5C9AB 4AVTA 2Z2SB 3M3QA 3OCPA 4CDUA 1VBC2 2CY6A 1RHI1 4Y22A 1DQ2A 2VNRA 3I4IA 5AVAA 1GV9A 4COZA 4XQWA 3FX3A 3DN7A 5JOYA 4YG3A 1QJU3 2VOVA 1YJLA 1V00A 1XXNA 1OPOA 1DGRA 4Z2WA 5JPMB 1O3QA 4X8NA 3BPZA 3AKQA 1EAH2 4KG0A 4OZXA 1ZA4A 4CDXA 1WGPA 2RE9A 1KS4A 2DWRA 1CAVA 5I8YA 4HKWA 5IK4A 4I0AA 2RS33 4P9YA 3NL1A 2HYKA 3NAPC 3ZXKA 1KJRA 1MZEA 5JOZA 5BY5A 4HN0A 2MHFA 2F6BA 1PGL2 4DFSA 4GMP3 3SXWA 2GZWA 2ZJCA 1XNDA 4EWDA 2JKBA 3PNAA 2BW8A 2X8KA 4N9IA 1JTZX 1WBFA 1JW6A 3TB0A 1IS4A 3WQ0A 1LU1A 1C8M1 1VBD3 1G8WA 1OQ1A 4F7ZA 4AEDC 1C1FA 3RDIA 4KWKA 4L9BA 4YGDA 2FMYA 5KXDA 3R0RA 2R072 3TBDA 3TOJA 1AF9A 1TME2 3JQWA 3E97A 4Q8KA 1O3RA 2UWAA 5D8AA 2D6LX 2XBO3 3NAPA 2Q8OA 1MR5A 2X5IB 4LO5B 4IEZA 5BNQA 1SFNA 2YROA 1EV12 4B3NA 4MGYE 3ZYJB 2MEV1 1PO11 4Q4W2 4BZ4A 2HWE2 1Y7BA 1BBT3 4GKYA 3VHRA 2VMGA 4TSVA 1GZWB 3MYXA 4YGCA 1SLTA 5A32B 1ZREA 2YUEA 3WT3A 3PLQA 2VVFA 1LB2A 3E6BA 3ZVXA 4C90A 2RR13 1EP0A 3M2MA 3Q9OA 3ILRA 3TN93 2TEPA 4D7SA 3DPRC 3OGJA 2WZR3 2IC1A 1IKQA 2XG3A 1RUF3 1D4M2 1W6MA 3INAA 3LA2A 3LOIA 5BNOB 1WLWA 1G9AA 2UYBA 1R1A3 1RGSA 1WD4A 4LO8A 3VKFC 1OLRA 2WINB 4AFCA 2ERFA 2FZ2A 2HWF2 1PO21 4A7KA 1G9DA 2R0HA 2X29A 3I7DA 4A7YA 5CIRA 2QQPA 5I0SA 1DQ6A 3APBA 4L97A 2EVXA 3TNQA 1ENXA 5KXBA 2D7FA 2GH8A 3W58A 4C0BA 1B09A 2CAVA 1A6CA 4W6XA 4E27A 3FZ3A 2ZGPA 5K0UA 2FMDA 1FOD1 2G4IA 3NSTA 2IXKA 3NO8A 3K51A 5T52A 4HSJA 1NCRB 2VUJA 4QQLA 2G9GA 4NHMA 5KHHA 2CNAA 4GULA 4M0HA 3USUA 5H9SA 1WW5A 2PAKA 1QJU2 1W6PB 4ITCA 4LBMA 1QF3A 2ZHLA 4LO6B 3DL3A 2PHFA 4NVPA 4CEWA 4AQ2A 4AHZA 4G4FA 4FCAA 1QXPA 4R9AA 1NQJA 2D6PA 5CNAA 4YZ5A 1AXYA 4S2GA 3QLQA 3VKLA 2D43A 1BVVA 5CG9A 3E6DA 4YW4A 4CP0A 4DS0A 4EN0A 1J3RA 3O0XA 5JZGA 3ZX7A 1R081 4AF9A 2ZGNA 1SLBA 4IEQA 5T5OA 2ZABA 1RUG3 1XQNA 2IXCA 1C4RA 1VBA1 4FTBA 4RQPC 3ZN4A 1DQ1A 4XQ4A 4CYDA 4HN1A 5KXCA 1HQLA 3OPZA 3WOGA 1DQ4A 1DLLA 1FMD1 1NCQC 4UW6A 2AREA 1H30A 5KHKA 3IM0A 1J3PA 1RUC3 4AGGA 2W08A 2HEYF 3O14A 4P14A 5CFCA 1H8TB 5C9AC 3W59A 2UYAA 4FOVA 1NXMA 2Y26A 3DGTA 2XBO2 2XJUA 3ZXEA 3WQ7A 1PGL1 2IXHA 3J8F3 4EWEA