4YVSA

Crystal structure of the virus-like particle of a c4 strain ev71
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
226
structure length
226
Chain Sequence
SHSTAETTLDSFFSRAGLVGEIDLPLEGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGEVVPQLLQYMFVPPGAPKPDSRESLAWQTATNPSVFVKLSDPPAQVSVPFMSPASAYQWFYDGYPTFGEHKQEKDLEYGACPNNMMGTFSVRTVGTSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSIKPTGASRTAITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Yeast-Produced Enterovirus 71 and Enterovirus 71/Coxsackievirus A16 Chimeric Virus-Like Particles Provide the Structural Basis for Novel Vaccine Design against Hand-Foot-and-Mouth Disease
pubmed doi rcsb
source organism Enterovirus a71
molecule tags Virus
molecule keywords Capsid protein VP1
total genus 35
structure length 226
sequence length 226
chains with identical sequence D, G, J, M
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4yvsA00
1VBC3 1RUI2 1VBE2 1ZBA2 4RFT0 2HWC2 1TME2 4PDWC 1VB2A 2HWD2 4N43C 4Q4X2 5BNNA 1AL22 1VBE3 4RS5B 1POV1 3J8F2 1F2NA 1AR71 1AL23 4JGZC 1PIV3 3ZFEA 1H8TC 4IV1C 2FZ2A 2Y26A 1PO21 2HWD1 1ND3A 1RUC2 1PVC1 1AYM3 4QPIA 1FPN3 1AR72 4QPGB 1A6CA 1K5MA 4CEWB 4IV3C 1X36A 1E57A 2RS51 2TBVA 1AR73 4QPGA 1COV2 1RUG1 2R063 1BBT3 4QPIB 1PO22 3DPRA 3NAPA 5JZGB 2ZZQA 1RUJ1 1EAH3 2R062 4CEWA 1RUE3 4CDQA 4CEYA 5C9AC 5C4WA 1AL0G 3VBOC 1C8M1 5AC93 5CFDA 1QJX2 1NCQA 1RUH1 2WZR3 2X5IA 4GH4B 5C8CB 5DDJ3 1NOVA 3ZFGC 1AR62 4CEYB 2DF7A 4Y5Z0 1OOPB 1EV11 1PGL2 5CFDB 3VBUA 2ZTNA 2HWD3 2BFUS 4JGYA 1NY71 4RHV3 2MEV3 3VBFC 4FSJA 1B35A 1AYM1 4N43B 4YVWC 1QJX1 4Y4YA 3J8F3 2HWB3 2WS92 4LLFA 4Q4Y3 2MEV2 4CDWA 3JBG1 4EJRA 4Q4W1 1RHI1 3JB4C 4Q4Y2 1ZBE3 2WZR1 1BMV2 1R1A2 1AR91 1AYM2 1ZBE2 1FPN2 4YVSA 2WS91 1AR93 1PGW2 1MEC3 5ACA3 1ASJ1 1VBC1 2WFF2 1NG0A 1MEC2 5ACA2 1K5MC 1BMV1 1MQTC 1ND2A 2WFF3 1QQP3 5BNNB 1SMVA 1AR82 4AEDA 5BNPC 1RUE2 2XBO3 3CJIC 3M8LA 1QQP2 3HAGA 4RR3B 4RHV1 1ASJ2 3DPRB 4WM7A 2WLPA 4JGZB 1V9U2 1VBD1 2HWC1 4CDXC 4GB33 4NWVA 1AR63 5BNOC 3LOBA 1AL21 4SBVA 1NCRB 1VRH2 1VBD3 1Z7S3 4N53A 5D8AC 4RHV2 3VBSA 4WM8A 2R042 2RS53 2PLV2 3VBHB 2RMU1 2HWB2 4YVWB 1R081 1RUJ3 1QJY2 2X5IB 3ZFFC 3VBRB 1QJU1 2VQ0A 3IDEA 1B35B 1PO13 4N43A 5ABJA 4NWWA 1BEV1 4IV3A 4WM8B 1NA1B 1F8VA 2RM23 4Q4V1 1GFF2 1H8TA 4IV1A 1PVC3 1R082 1COV1 4CDUA 2BUKA 2HWF1 3VBSB 1AYN1 1VBA3 2RS33 1HRI3 4RR3A 3ZFEC 1BBT1 1FOD3 1M06G 1C8M2 4GMP0 3VDDA 5BNPB 1OHFA 4FTEA 1RVF3 5CFCA 3CJIB 1FOD2 2ZAHA 3DPRC 4YVSB 2RR11 3CJIA 1H8TB 4IV1B 5L7OA 2WWSA 2XBO1 1NCRA 3JD73 1RUC3 4PDWA 1ND2B 1FMD2 4CDWC 5BNOB 5DDJ1 1ZBA1 1HX6A 3ZXAC 1FMD3 3NAPC 5L7OB 3JBG2 4WM7B 5D8AA 1AUYA 3TN92 3VBUC 1RUD3 2R071 3VBRC 5C4WB 4RS5A 5JZGA 1ZBE1 1RUH2 4RQPC 1RHI3 4PDWB 5C8CA 1VBC2 1PVC2 1AR61 1R091 4GMP3 1ZBA3 1VB4A 4Q4X3 4BCUA 1DDLA 1VBB1 3JD71 2RS32 4N53B 1HRI2 1HRV3 2MEV1 4FTSA 4CDXA 1R092 3VBFB 1NCQC 1RVF1 1PO11 1R1A1 4CEWC 1POV3 4CDQC 2RS31 1ND3C 5AC91 1VRH1 1B35C 2R041 2HWF3 3ZFFA 1COV3 2RMU2 1EAH1 1EV12 1PGL1 2HWE1 1NY72 5GKAC 2QQPA 1AR81 5CFCB 4GH4C 1RUF3 3S6PA 1RUD2 4JGYB 1PO23 5A32B 4CDUC 1RUF2 1HRV1 5C4WC 4CEYC 2RR13 5C9AA 1EAH2 2HWE2 5A32A 1V9U1 4RQPB 3ZFEB 4JGZA 4QPIC 1PIV1 2HWE3 1HQNA 1CD3G 5ABJC 4GB32 3FBMA 5FOJB 1RUI3 1X33A 4YVSC 2HWC3 1VRH3 1Z7S2 2WS93 1VBE1 1D4M1 5D8AB 1TME1 2BBVA 1RUJ2 3VBHC 3ZFGB 3NAPB 4GB31 1OOPC 1R1A3 5CFDC 1FMD1 5K0UA 4CDQB 1K5MB 1D4M2 4IV3B 5K0UB 2HWF2 5BNNC 1R083 2RMU3 1EV13 1VBB3 3VBRA 1D4M3 3TN91 5JZGC 5A33B 2XPJA 1BBT2 2FZ1A 1RUI1 1QJY1 4AEDC 4Q4W3 5BNPA 1C8NA 4CDXB 3VBOB 1C8M3 1CJDA 2RR12 4CDUB 1BEV2 1HXS1 1TMF3 4Q4Y1 4Q4W2 4YVWA 5J98B 1V9U3 3J8F1 2XBO2 1QJX3 2WZR2 2GH8A 1MQTB 1TMF2 4Q4V2 1NCQB 5DDJ2 3JD72 5J96B 2X5IC 3ZFFB 4Q4V3 2BFUL 2PLV3 1VAKA 1RUC1 2IZWA 1ND3B 2RS12 1MQTA 1HXS2 1ND2C 1WCDJ 4WM8C 4Z92B 1MEC1 5ACA1 1NA1C 2R072 1HXS3 1TMF1 2R043 2RS52 4RQPA 1RUE1 4WM7C 1POV0 1NCRC 1RUG2 1FOD1 3JB8A 2RM22 1QJY3 1RUH3 4QPGC 5CFCC 2RS11 1RUG3 1RHI2 2R061 3VDDB 1VBA1 4JGYC 1IHMA 5K0UC 1AR92 1OPOA 1VBB2 1RB8G 1FPN1 2RM21 4RS5C 2PLV1 2WFF1 1RUF1 5BNOA 5ABJB 1HRV2 2BPA2 1RVF2 5FMOL 4RR3C 1VBA2 1AR83 1QJZA 3ZFGA 1R093 4GMP1 1QJU2 2GSYA 3VBSC 1PIV2 1BEV3 1ASJ3 1W39A 1RMU1 1QJU3 3VBFA 5A33A 5LK7B 1Z7S1 3VBHA 3VBUB 1VBD2 1OOPA 4FTBA 2RS13 1AYN2 4GH4A 3TN93 1HRI1 1RMU2 1PGW1 1RUD1 2R073 1AYN3 5FMOS 3JBG3 4CDWB 1RMU3 3VBOA 2HWB1 1NA1A 1PO12 5C9AB 5L7OC 4Q4X1 4N53C 5AC92 4AEDB 5C8CC 3VDDC 1QQP1 1TME3
chains in the Genus database with same CATH superfamily
2PAEA 4J1XA 1XYOA 1VBE2 5B2GB 2VNRA 1ZBA2 5J1XA 1GMMA 2JDHA 4QGLA 4BHPA 1VB2A 5FUNA 2YBPA 4CUAA 5BNNA 1BK1A 1VBE3 2QQKA 2XXZA 3DYMA 3ILNA 3QCWA 4L97A 5E8AA 5CBLA 5I0DA 1XU2A 1YQ8A 2IVIB 3ZYFA 2ZMKA 3RYRA 4Q8LA 4TYSA 2B39A 4X8PA 1PIV3 3KT4A 4KG0A 4P5YA 4DEQA 5IK4A 1H8TC 4IV1C 1YQ5A 1J3PA 3O7OA 2B8MA 4P9WA 3AMPA 3P3PA 1XB9A 5L19A 2QZ3A 4TWTA 2W2IA 3ZSLA 2JG8C 5FBZA 4BZ4A 4XJAA 2RDNA 4XDOA 3O1MA 4QPIA 5IK8A 1KJLA 2AH2A 1YEWA 1PX4A 5C3OA 2VUJA 1IZ3A 2R32A 4CEWB 1X36A 1AJOA 3OPZA 1LTEA 1V6MA 4QPGA 1YQCA 3FLPA 2R063 1T6GC 2G1MA 4Y1XA 3I97A 3OEAA 1PO22 5F39A 1DP0A 2E31A 4CCEA 4OUMA 2ZZQA 1G9FA 4JC1A 1LNSA 5JIAA 2GNMA 3PVEA 2FQPA 2Y6KA 4XPVA 3OTFA 1XXNA 3IPVA 1MS8A 5A7QA 1K5JA 4DXSA 5C9AC 3WQ7A 1AL0G 1GP4A 1WW4A 3K75B 4XJ9A 2OZ6A 2OUJA 2PQSA 5LA9A 4HVRA 1QJX2 5F3GA 1W28A 2B45X 2WZR3 4IESA 5CG8A 1HN0A 2E63A 2N7GA 4H55A 3NV3A 2OQ6A 4F83A 3R6SA 3Q9OA 2W0XA 3SKJE 3BTXA 1UZYA 3ZFGC 4XQDA 1EV11 3DXUA 1PGL2 2VMGA 1YYNA 1NT0A 5CFDB 3K3OA 2HWD3 2BFUS 3LEKA 4LKDA 1BVP1 4LULA 4EQVA 2RDSA 4X6RB 3BTYA 4AVSA 4N43B 1AYM1 2PHTA 1YJLA 1QJX1 4Y4YA 1NX9A 2C0ZA 3ALQA 3HJRA 3J9SA 2E7TA 4OZOA 5F5QA 4LOTA 5C70A 4NRMA 2JKXA 1F15A 2PHRA 2ZEWA 5EQUA 3U4SA 1LU1A 2TEPA 5J37A 5FP4A 3JU9A 4COVA 3VKLA 4B1LA 4H2AA 2OW4A 1ZBE3 3N7KA 4JDNA 4HL0A 3ZIXA 1H6XA 4QQPA 1AR91 4UW6A 4BQ4A 4NVPA 2OX0A 4LT5A 2XJRA 2DDUA 1H1AA 4BQ5A 5JUVA 1QNYA 1FPN2 4N90A 2P3YA 2D6NA 4JTOA 1ZM1A 3ME2A 4YG6A 4BLIA 4YW5A 5L9RA 4FFIA 2WO1A 1UZVA 2BU9A 1OURA 1VBC1 1WW7A 5EFUA 3H8RA 3IB3A 2J7MA 1MEC2 5ACA2 2KR2A 1O7FA 2WFF3 3GZTB 1EPWA 2BTVC 5EJ1B 5K7PA 1ONAA 3I2KA 4XABA 1WLTA 3WF0A 1LEMA 1VPHA 4P9YA 2ZX2A 2BZDA 3ACHA 5F1RA 4P9LA 3ZYIB 3DPRB 3EHKA 5DAVA 5DAQA 1ULEA 2NMOA 3V0BB 5JOYA 3GJBA 3OGVA 3T2QA 3OEBA 2NLRA 4NIAA 3M4FA 4INDA 3JXSA 1QJEA 4DRVA 2HWC1 1IPKA 1O3QA 2Y6GA 4XFBA 1AR63 3K46A 5FO7B 1AL21 1Z7S3 4EE2A 3FHIB 1CAXB 1W2OA 4MOAA 3WW3A 3WEZA 3RYPA 4WM8A 2VBDA 1OLQA 1S0JA 2PLV2 1O4TA 3POIA 2WZ8A 1CZVA 3MF9A 4IGOA 4TSVA 1OBNA 2G4IA 5FY0A 1DQ6A 3NJVA 3SH3A 4I0WB 3E5XA 3ZFFC 3VBRB 2QE3A 1PX3A 2VQ0A 3DV8A 1JUIA 1YJKA 4AHWA 4D0QA 1J58A 4IEQA 4RSUA 1CJPA 2QQIA 3OBAA 2DCJA 4UOJA 5ABJA 4IV3A 5JIUA 3I49A 4YW6A 2LRPA 4BU2A 5A6QA 1OFNA 5FYBA 1H8TA 4IV1A 1SLCA 5T5JA 1DGWX 4A3XA 3LAGA 3ZPOA 4AFCA 4OI1A 2J1UA 5F8PA 2BUKA 3BTAA 4BXSV 2HWF1 3NV1A 3OJBA 4R9BA 2JDZA 5FYTA 3B02A 4FO9A 2WZPP 3WF4A 2WO3A 2W46A 4FPYA 1CAUA 4COWA 3GF6A 3IMNA 5HCHA 3BPZA 4R8HA 2RS33 5JCTA 1HRI3 4EROA 1H9PA 1GNHA 4QPWA 4L92A 1WMEA 4Z2WA 4GJZA 1KDKA 2XVKA 1M06G 1FOD3 1W0PA 3ZMOA 1O91A 3H1WA 3AJYA 3OG2A 1R1ZA 1KGYA 1OHFA 4FTEA 1Q3EA 2JDPA 1GQPA 4CUBA 2UY8A 3C7OA 2D6OX 4PF1A 2OXBA 2WA3A 3BPSA 1LHNA 4QGMA 3CJIA 3POGA 4QDRA 5EWSA 4P9GA 3THTA 3ZXGA 3KV6A 2R7EB 1RUC3 4KGGA 4PDWA 3USSA 1RJ7A 3KD4A 3E5QA 3SCHA 4CDWC 3JZVA 1WLWA 5BNOB 2W87A 1O3TA 5BY5A 5CKNA 3OBRA 2P3KA 3MGUA 4R4XA 1N3PA 4CE8A 4YW7A 5F3CA 3NAPC 2VD7A 1DBNA 3ON7A 3JBG2 3OYWB 2XUMA 3TBDA 1QY4A 1ZRRA 4UW4A 3TOJA 2NMNA 4XF0A 2DURA 2A3WA 4QQLA 2HJIA 4EN6B 3O1RA 1LOBA 1W2TA 2XLFA 4LBJA 2R071 5IFTA 4W50A 1U5YA 3AXDA 2EIBA 3ZYRA 3ZN5A 1ZBE1 4HXCA 1RUH2 2YU1A 3TB0A 1IGOA 2OPKA 4XFGA 3RGBA 4Y22A 1YCIA 1O6UA 3SKVA 4D3WA 5A7OA 3ZO0B 5F5CA 4ASKA 2V4AA 3AYAA 4QX7A 1AR61 1R091 2DFBA 2D6LX 3NVCA 4MXWA 3ZXLA 3BKZA 1ZBA3 2AC1A 2VOTA 3BVCA 1VB4A 3OB8A 2EIDA 5DAWA 4KG8A 3ZDVA 4BCUA 5DUXA 3KSCA 1DDLA 2O0OA 1YIFA 4GXLA 4JAAA 5KC6A 1N1TA 4FP3A 2D3PA 2ORZA 1HRV3 2MEV1 4U36A 4FTSA 4K8FA 5A1FA 5KXBA 3CU7A 4TLFA 4NHYA 2E26A 4Y20A 1CZSA 1F4AA 2CAVA 4RD7A 2WN2A 3NL1A 1R092 3D82A 4XJWA 2YFUA 1W04A 3RNSA 1VIWB 1YIPA 3OD4A 4I3PA 5G04L 3PVNA 4BQ3A 4A6OA 2E9QA 5LBEA 3WXPA 2VNOA 1ZNPA 1AHSA 2CTVA 3POJA 3Q8BA 3RI9A 1WCKA 3IN9A 4R9DA 4CU7A 2HWF3 3BN6A 4HKWA 2AENA 3WLUA 1COV3 3KF3A 1H30A 2D40A 3LDBA 1EV12 3WP5A 1PGL1 3AFGA 3LEMA 4KI5M 1W05A 2FCVA 4QU1A 2OKXA 1W9FA 3GNEA 5HV0A 3DGTA 4HSLA 1CZTA 3C7FA 5CFCB 4KNCA 4DS0A 1RUF3 4QXCA 2QQOA 3UJQA 2WT2A 1RUD2 3ZLIA 2VZTA 5I93A 5F37A 2ZOEB 1LGCA 1PO23 4GKYA 4Q0SA 4PQQA 2RR13 1UPSA 1W3VA 4LO8A 4Q5OA 4XUNA 1H2NA 3ZFEB 1W6PA 4DXRA 1STMA 2ZX4A 1DF0A 4AAXA 1EYBA 4PJYA 2GC0A 5ABJC 5FYIA 3FBMA 4NPMA 4C1XA 3A7QA 4QU2A 3T2TA 5F2WA 4CA9A 3NKGA 1W2UA 5IVEA 2HWC3 4COUA 3WD5A 1ENXA 2WS93 4GQ7A 1VBE1 3KVBA 4OLLA 3KCCA 5CEHA 1D4M1 3GGLA 1A8DA 2FDFA 3VZNA 4IEVA 1MS5A 2RV9A 3GHNA 4XCBA 4LMFA 3VBHC 4CXWA 5H9PA 3SXWA 5FRAA 1OOPC 1R1A3 2PXJA 3GBFA 1H1MA 1NZIA 4QDQA 2ZX3A 2B46X 1VALA 1GR3A 1DYPA 2JIJA 2WIIB 3ATGA 3DYOA 3L2HA 1QDCA 1CAXA 4FQZA 2W3JA 2LROA 1OD3A 4XMAA 4E2GA 1Y9MA 1K5MB 5FZOA 2VTFA 3OCPA 4BMBA 4BH9A 1ZREA 1SFPA 5K0UB 2R6QA 5KHKA 5E88A 4D8MA 4CCOA 3WDWA 2YYOA 3VBRA 3VUOA 1G8WA 4P08A 3BUCA 2CHHA 1LEDA 1MPXA 2ZGRA 4NAOA 2W52A 2RE9A 4JCKA 3H50A 3E97A 5EP9A 3I2JA 5A6XA 2A6VA 2RJ2A 3RZKA 1ZZ7A 2AUYA 5GJ6A 5I8TA 1C8NA 4BLJA 2ZEZA 1TEIA 3CHXA 1TVGA 2ET7A 1SZBA 1XNDA 1GSLA 4XXPA 1BEV2 1F35A 1HXS1 5L9BA 4DY5A 5F9TA 3RZHA 2ZHLA 1WW5A 3M3CA 3U11A 3UYJA 5LATA 1KD7A 2WNVA 4J1WA 3ASIA 4UI9L 5A3WA 3L9JT 4LO4B 1NCQB 4D94A 3K4ZA 1K12A 3LD8A 3WINE 4A44A 2LS6A 2Z69A 3POEA 3HN1A 1FX5A 3PTRB 2VPVA 4LA3A 2BFUL 3B5LB 1RUC1 2VR4A 4QB2A 2ZX1A 1QWRA 4HETA 1ZRDA 3RVHA 1ND2C 4QM8A 2DTYA 5A3LA 5BUVA 2HYXA 1LHVA 1SPPA 1XE7A 3M3QA 5EPAA 1JYVA 2P1BA 5FO9B 4HT1T 4D7TA 1TZOA 1GZWA 1UIJA 3BODA 5FUPA 3FFQA 5A3MA 3T4VA 1REFA 1OQDA 2VVFA 3E6BA 1ZRFA 4UWDA 3AKSA 4LA2A 1I1EA 3FUQA 5FZLA 4XF1A 4TXWA 1FOD1 3U37A 1WWYA 4DNYA 5KR7A 4AVBA 1UU5A 3K2OA 4LITA 3ZYPA 1RUH3 1UKRA 2BBAA 2WINB 3KCYA 3OPWA 4QHZA 5LASA 4CYDA 2J1RA 2R061 2ARBA 2ZGKA 1QXJA 5CIRA 5FYCA 1QXRA 2JKBA 4Y4RA 5FY9A 3B69A 3KF5A 4GD4A 4PCRA 4YM0A 1QDOA 1AR92 1BYHA 2E53A 4ZPIA 4B7EA 5JWPA 1C4RA 1JOJA 1TG7A 3P1IA 1FPN1 5LA2A 1IS3A 3PJYA 4I01A 2E6VA 2WR9A 5DG2A 3ZKUA 1KRIA 5KBFA 1GNZA 4QX8A 1RYYA 2JE8A 2Y34A 3FBYA 2PLV1 4RS5C 4Y20B 3WZ1A 1RUF1 3R4DB 1HRV2 4A41A 1AR83 5JSPA 4XF3A 2WYSA 2JE7A 1XNAA 4MSVA 4MLOA 2PFWA 2QTWB 2EXHA 3VB9A 1ASJ3 1W39A 2VE1A 3IAPA 1RMU1 1QF3A 1US3A 3T08A 3VBFA 3N9NA 2WC2A 2WSVA 1G6NA 1JU3A 2ILMA 3HQUA 2WQZC 2GP3A 1KFXL 5A7PA 1QOOA 1GWMA 2R1DA 4LNVA 4QKNA 3AL6A 2QJVA 3DEMA 3VBUB 1WA6X 4KU7A 2DCZA 2K46A 2RS13 3VL8A 1C5IA 1AXZA 1SLAA 2ADEA 2W5FA 4RGGA 2BOIA 1JYTA 1HRI1 1PMJX 4AGRA 1E5RA 2W1QA 2VUAA 2XL7A 4AYUA 1S0BA 1GZCA 2VULA 4C91A 3HBKA 3H7YA 3NRUA 3JBG3 2VZQA 1UYZA 3UL2A 4CTEA 2PHFA 4TZDA 4K8RB 2HWB1 1NA1A 1V6OA 1WMFA 4IEYA 3ZR6A 3AMNA 3BU0A 1RJ8A 3WQBA 5L7OC 3IM0A 4AVVA 4FAGA 2BVBA 5CVRA 1H8VA 3D0SA 1URXA 4N53C 4MGTA 4LOSA 4AAPA 5C8CC 4DY3A 3MV11 4QQOA 1ACCA 4IE6A 3FE5A 3L2YA 1I3HA 4QD2A 3TWIA 4CCDA 1TME3 3QACA 4XHBA 5FXWA 2JG9C 2AEYA 4Y1VA 1RUI2 2BQPA 2C9KA 1XNBA 4BPZA 1X82A 2H6BA 4PDWC 2HWD2 1UKGA 3AP4A 2XHKA 4NIIA 2F6BA 2VCAA 1H2KA 4DXTA 1JXNA 3GCWA 2IUWA 3N9LA 3J8F2 2LALA 1AR71 3EQEA 1AL23 1W2AX 5KC5A 1U12A 1HB2A 3QOPA 3WVJA 4LR4A 4YM3A 4O9EA 2F4PA 3SMHA 4ZXKA 2HEYF 4DZGA 5LA1A 3IPVB 1C1LA 2ZGOA 2CWMA 5F3IA 1ZZ6A 1BJQA 3FC0A 4AI8A 1RITA 2JEMA 1HV0A 1W06A 4CUCA 1JW6A 2JB8A 2WT1A 3NNFA 5JOWA 1WCUA 1YQ2A 1AR72 2HBUA 4QX2A 3JUUA 1EUTA 1ZZ9A 1E57A 4LKEA 4NRQA 2ARXA 2ZKNA 4A42A 1DCSA 4EN7B 1LOGA 5KHGA 4GJYA 3GHMA 3J7HA 1RUG1 1GZ9A 1PNFA 3ELNA 3FHQA 1OUXA 2PHWA 2EAAA 5A3UA 2QBXA 4XHXA 4RFRB 1F5FA 5DABA 4LHKA 3UK9A 5C33A 1I9RA 3RI8A 3AMHA 3I4IA 4X6QB 4CDQA 1DZTA 1AX2A 1AX1A 4MG2A 1ENSA 4NHLA 3T0BA 5LA0A 3T0DA 1UWWA 4GWIA 1E5IA 2MHFA 2A7AA 2FHRA 3UV9A 3O1TA 1UMHA 2JECA 4I09A 1NCQA 2WAAA 2DVFA 3DUIA 4B8EA 4E4SA 5FO8B 2AGSA 3NW4A 3LEIA 4D6RA 2DVBA 3VGIA 4BOWA 3EO6A 4FPEA 3ES4A 1LOEA 5C71A 1NOVA 1SACA 3A0NA 3OUHA 3PMSA 5IVFA 1AR62 3AKRA 2FD8A 2I45A 4Y5Z0 1XPWA 2XWBB 5T3NA 4CEYB 3I3MA 2JDYA 3IDAA 3KHCA 4XUOA 1JYXA 2MEV3 3WSOA 4YVWC 4NIDA 4QKBA 5IATA 3J8F3 4LLFA 1UNBA 4Q4Y3 2MEV2 2VCCA 1LRHA 3C7GA 2G19A 1O8PA 3BCWA 4FP2A 1Y9GA 4LK7A 4Q27A 4EJRA 4KWKA 2DUOA 5FZ9A 5GZGA 2QVSB 4XC9A 2P3IA 1BMV2 2UYBA 4WBBA 5FV3A 5AVAA 1AYM2 3B7MA 1AXYA 3WQ1A 4DIQA 3G6JB 3ZOIA 3VDBA 5K8SA 1AR93 1DLLA 5CKQA 2DWRA 3A21A 1WW6A 5FZ6A 3APBA 1YFUA 1XSQA 2WFF2 4NUBA 1GP5A 2QQVA 1B09A 1W6QA 4CPBA 4D69A 3U10A 4YG3A 1ND2A 4UFIA 5DXDA 2VCMA 1QQP3 5BNNB 3CBNA 1WLDA 1SMVA 5BNPC 2GNBA 1RUE2 2VZVA 3CJIC 3M8LA 2DV9A 2VW0A 3HAGA 4RHV1 4ET7A 2D6MA 3MLJA 2YC0A 5EZWA 5GLUA 1TNFA 3E6DA 2J1VA 4AEMA 4A6SA 4A4AA 2WWJA 2XLAA 4Y22B 3ENRA 4AFDA 4CCMA 2IVJA 5JMCA 4C8DA 4WVZA 1U0AA 2V5YA 4N53A 4IQPA 4HN0A 3WT3A 1OLRA 1CIWA 4P9JA 3I59A 3WDTA 2R042 2RS53 3VBHB 1VP6A 4KMQA 1YFYA 1R081 4LBQD 3CDZB 3OUIA 1RUJ3 4OMCA 1K45A 1JZ3A 5BV6A 1CESA 4S2DA 1UU6A 3SISA 3IDEA 3WW4A 2CAUA 2W91A 1BVVA 1B35B 1PO13 2YMZA 4NJ4A 4NHKA 2W47A 4NWWA 1BEV1 4WZFA 2JENA 3VV1A 5T55A 4J6GA 1JZ4A 1OKQA 1PZ9A 3I3BA 4PIYA 3WP6A 4M00A 4BQ1A 3C8XA 2WJSA 1HKDA 2A75A 3I54A 4PLMA 4AI0A 4Y5SA 4CDUA 2RG4A 2ZEXA 3I2GA 4JDMA 3ROUA 2Q1ZB 4JVAA 2WNUC 2C4XA 1LHWA 4MV2A 1HDKA 2OUHA 3POWA 5FKBA 4CCKA 4RR3A 4Y33A 1PNGA 4GMP0 4DINB 2BNNA 4YARA 3VDDA 5I91A 2E33A 4ZS3A 5CFCA 1ULFA 1FOD2 1VLNA 2G9FA 1WCSA 4FBFA 2GP5A 2GN7A 2X8KA 2GAUA 4YVSB 2WWUA 3W59A 3ZN4A 3BB6A 3UETA 1CGPA 4LBKA 5L7OA 2DVDA 2WWSA 1NCRA 1QEXA 1LCLA 2XBO1 4XFCA 3WF3A 3H3LA 1QOSA 1ND2B 5DG1A 2P34A 4BQXA 5FLJA 4UF0A 3HIFA 4O9GA 1CQ9A 1MZ6A 1U5ZA 1HX6A 2GC3A 2J1TA 5IK7A 4JKLA 1PK6B 2BRTA 2YXSA 4YW3A 5D8AA 1V0AA 2LUWA 1M4WA 2BOJA 3HEIA 4JRLA 5IUQA 3WQ0A 3IT8A 2QNKA 5D21A 3CLPA 1W9WA 4IDZA 4CP9A 1RUD3 4G3YC 1KXGA 1C3HA 5H9RA 4BMEA 4RS5A 1KS5A 1QU0A 4YW4A 5JZGA 2RHPA 4RQPC 2GMMA 1RHI3 1Z0HA 3ZYJB 1XU1A 3CF6E 4YNIA 1UY1A 3Q8CA 1VBC2 1PVC2 4P5HA 5F5AA 2ZHKA 2FDGA 3NWKA 2JJ6A 1S2EA 2VJXA 1S0GA 4KQ7A 4MHRA 1WA4A 3N9QA 4OHXA 3T4HB 4QT6A 3JD71 2JXAA 3DL3A 3LA2A 1HRI2 1GWKA 3KT7A 2NYYA 1D2SA 2BGCA 2XLGA 2XQXA 4AEJA 3R0RA 1GP6A 5FPVA 5C5TA 3KWVA 4CDXA 1ZX5A 4AOCA 4Q26A 1RVF1 4ZKTB 1PO11 3DYPA 3MBWA 2P6HA 3OY8B 1BXHA 5J3UA 3AYDA 5T5LA 4JRAA 4LKSA 4CDQC 4OHWA 5FYSA 1NAEA 1ND3C 5JOZA 4DMIA 3O14A 3VZOA 4LUMA 1W6NA 3WNMA 4MGYE 1Q8OA 2WNEA 4KBBA 1S2KA 2BGOA 3RPQA 5CADA 2RMU2 5FZOB 1EAH1 2K9ZA 5AFEA 5L73A 3OPTA 1JOBA 3H42B 1S0EA 3WG4A 4DB5A 3LQCA 4P02B 5GKAC 3P6BA 4MGZE 5A80A 1UOFA 3SLIA 1G86A 4IXLA 2JG8B 1AR81 1AXKA 3HN3A 4GH4C 1AX0A 1JHNA 2Y60A 3HD8B 5JVVA 3HQXA 4AF9A 3S30A 3ZX7A 4JGYB 4ASMB 2O8QA 4K3UA 5IHRA 4NROA 1DG6A 2GNDA 4S2HA 1IPJA 4AHYA 5C4WC 5C9AA 2FMYA 1LR5A 3OD0A 1V9U1 4E4HA 2W1UA 1HQWA 1Y7BA 3UGFA 5A3OA 2RJLA 4B4PA 1DGRN 5FLHA 3SH4A 2R30A 4O7XA 4EWAA 4JV4A 1HQNA 1CD3G 4OUEA 2V4VA 2VNVA 3PURA 1XNTA 5EJZB 2A6YA 5JXJA 3HNBM 3I2IA 5FP8A 4DPNA 4E8CA 4CP9B 4BDVB 1VRH3 2XUEA 1ENQA 5IAVA 4NHMA 1E5SA 4AI9A 4LK6A 2NPIA 3WOGA 1WUVA 3T3YA 5AVPA 2R0HA 1UN1A 3AP6A 5D8AB 4GWNA 5IVVA 4WV8A 2VH9A 5FZGA 2ZKLA 2BBVA 4M3CB 4LE4A 5CZKA 1RXFA 3ZFGB 4JZRA 2VUDA 1XBFA 3NAPB 3CZUA 4XQWA 1Q8SA 5CFDC 1ZA4A 1GU3A 4FPHA 3H8UA 4ZHNA 1X50A 1FMD1 5FP9A 2H6CA 1W9TA 5EV7A 5KHHA 3FFZA 2EVXA 1VR3A 1W6OA 2TNFA 4GALA 4CUGA 1C57A 3I3EA 4I3GA 4AL9A 5C3SA 1A3KA 3RWNA 1D4M2 5FWEA 3ST7A 3J7MA 1R083 1UIKA 2Y6LA 3P3NA 1JHJA 4YZ4A 4ASLA 1D4M3 3U0ZA 1HB3A 1W3XA 2HEVF 4LBMA 3TN91 5A33B 1J1TA 1SFYA 4BIOA 3B00A 5LRRA 4CP1A 3U14A 5IVJA 1BBT2 3EB7A 4KWLA 4LEJA 1GLHA 2XPJA 5E16A 4XDQA 5BNQA 4UW5A 2EXJA 3PU8A 5LW9A 2CYFA 1QJY1 2VW1A 1O5UA 4AEDC 4Q4W3 4CDXB 4Q8KA 5FZEA 1C8M3 4HLTA 4YW1A 2YUEA 4UXAA 3NJYA 3GBGA 2EXKA 2RR12 3AX4A 1WD3A 2MPFA 4CDUB 4YVWA 3ZSKA 5J98B 1V9U3 4V2VA 3JQXA 3AVRA 3GZAA 1DFQA 3KGLA 1N1SA 1UX6A 2W94A 4BA6A 2WZR2 3CO2A 5FY5A 5FZKA 2GH8A 2QUOA 2WO7A 4Y1YA 1TMF2 4EN9B 4RL7A 1OH3A 5FYHA 5DDJ2 3M70A 3GXUA 1UY3A 2X5IC 2CY6A 3TNPB 4K40A 3I2HA 3UT0A 3AYCA 3VKFC 2PHLA 1L7QA 2XH6A 4AR2A 4YLZA 1NQJA 2WO2A 5ANQA 3R05A 5IAXA 1MQTA 1HXS2 1OUSA 4HK9A 5C3PA 5FTTC 2V09A 2PYTA 2XHNA 4WM8C 4Z92B 3O1VA 3OGJA 1T2XA 4YZ1A 5FXVA 1BCXA 5JOXA 1NA1C 4YGDA 2P6CA 1O3SA 2WNUA 4RGKA 1TMF1 3ETPA 2QQJA 1NUKA 3VD5A 1X9PA 4KL1A 2DUPA 1RUE1 3J4UH 4N9HA 4WM7C 3MLKA 1POV0 1S4CA 3EBRA 4LXLA 3E5UA 2X05A 2RM22 1RINA 4W65A 5FZFA 1VAMA 4PHZA 4QPGC 5CFCC 3W5NA 5I8SA 1GQGA 1N47A 3H1MA 1KDMA 1VBA1 2EA7A 2AREA 2JD9A 5LEJA 3E6CC 3THCA 3MW4A 4UAPA 2BV4A 5LY1A 1PM7A 1OPOA 5T5PA 3S7EA 1VBB2 1V6IA 4GULA 3S7IA 2ZABA 4M3CA 5FZ3A 3WDXA 5LWBA 4META 2VG9A 5FWJA 3RG0A 4OVEA 4BISA 1YO8A 4W6WA 2WZEA 5FLIA 4YGBA 3ZXJA 2BPA2 3SHRA 1ZZ8A 5ABJB 2D3RA 1U5XA 2DVGA 2LW8A 2JDMA 3AYEA 1W6OB 3O0XA 1QJZA 3T1MA 3LSDA 4QM9A 4AQ2A 5IJRA 3N9MA 4QHOA 3ZFGA 2A3YA 3VD3A 2XL9A 1UW8A 1PIV2 1BEV3 3B01A 3OBTA 5H9QA 2KA3A 1CIYA 3QH7A 3SEEA 4KBZA 2WYFA 2JWPA 1DGRA 3UKNA 3WHTA 4HVQA 1MVEA 1NXD1 2YGLA 3WP3A 5HBAA 5FPLA 4QGNA 4D6QA 1ULCA 5A33A 4OQ8A 1CR7A 4XEZA 3OSDA 3UGGA 3AZXA 5LK7B 1Z7S1 5FYVA 1W6NB 4L11A 3SH5A 5FPAA 1HN1A 1XNKA 1GOHA 3PLQA 5IYYA 4KWUA 4QDSA 5F6KA 4IE4A 5FAXA 3K77A 5TSWA 4CXXA 1V6LA 1A78A 3N36A 5DAXA 1W6MB 2J22A 2PHDA 2ATFA 5DZFA 4NMIA 1RMU2 5IWFA 2FDIA 4Y24A 2VMFA 5A70A 1SQ4A 1AYN3 4LHSA 4ZXEA 2YC2A 2VZ3A 5FMOS 4MGQA 4V2WA 4CDWB 1RMU3 4LBQB 1YFWA 4Q1RA 1PO12 4JHZA 5D1IA 2LM3A 1H1IA 2C9AA 5C9AB 3HWJA 4ES9A 4E2SA 4JDOA 4Q4X1 2W95A 2UWBA 2XJQA 4IEZA 5JR2A 1LU2A 3C2UA 3J26N 3VDDC 1QQP1 3WF2A 4MZUA 3IAQA 1GNYA 4Q29A 3MIBA 4KWJA 3OF1A 4FCAA 5CB7A 1UXZA 1X7NA 1OMIA 3X29B 4YM1A 3R4SA 1FT9A 2EICA 3O0VA 1E5HA 4LHNA 4RFT0 2WRAA 2HWC2 1OSGA 1TME2 1WLCA 1CPNA 1G9AA 2J1AA 3K51A 4K7JA 4N43C 4FFFA 3SCFA 1O5LA 1BK0A 2QZ2A 4XFIA 3TEWA 1POV1 3KV4A 1IG0A 5EIYB 2P37A 1QXPA 3NV2A 3SQOA 1F2NA 2HBTA 2VVEA 4DUXA 2ZMLA 4JGZC 5FMCA 2WN3A 3T2PA 3ZFEA 2HH9A 1ULPA 1SG3A 1KEXA 5A1AA 1WGPA 1CN1A 2Y0OA 2ZEYA 1I5PA 3THPA 1MACA 1SLBA 4LKFA 1HB4A 2HWD1 2UY9A 1OXCA 3KMHA 3OGSA 5E6HA 3K4AA 4AHXA 1XSRA 1Q8QA 5FYZA 4FOVA 1PVC1 1AYM3 2K0GA 3VN4A 1DQ5A 5CG9A 4Y26A 3NNJA 2ZGUA 2J1SA 4FFHA 3MF6A 2DBIA 4DUWA 2OA2A 1PZ8A 3W21A 4IV3C 2VZRA 4QX5A 4XJZA 3MIFA 3WCSA 2Q4SA 2RS51 4K21A 4P00B 2TBVA 4BK4A 4AQ6A 1AR73 3H7JA 3PUQA 2WQ4A 2CSGA 1COV2 2OT7A 1IOAA 4XIKA 2C5DA 1DQ4A 2XOMA 3DPRA 2KM2A 4QPIB 3VHRA 1O8SA 1XNCA 2EXIA 2Q0AA 3HOBA 4XQ4A 3I59B 2B9UA 4CVUA 5IVBA 5LRSA 2Y38A 2R062 2VW2A 3INAA 3PVBB 1IS6A 4CEWA 4Z8BA 2PAMA 4HZFA 4CEYA 3BI3A 5F32A 2P5BA 3WNNA 4AQTA 3W5MA 3VBOC 1C8M1 1NLSA 1AJKA 5AC93 5CFDA 3AP5A 2ZAAA 1RUH1 3PMEA 1W6MA 5FXZA 1LOFA 1OKOA 3KT1A 5DMYA 4XJ8A 3KQ4B 2X09A 3PUAA 5FDBA 5DDJ3 3R4UA 5KHIA 2VO5A 4OUSA 4XIOA 5CNAA 2F4LA 5CAZA 3RS6A 4LUKA 3DKWA 3TRSB 2DF7A 4LBQA 3VBUA 2ZTNA 1OI6A 5M0TA 2D43A 4ZU5A 1JZ5A 1UL9A 4FSJA 1H0BA 3PVOA 4ORFA 2UU8A 1FATA 4B4QA 1H2MA 1W03A 3MW2A 2WS92 4CCLA 5F5IA 2Z42A 3NJXA 3PJQA 4RA0A 3POYA 3JBG1 3WX5A 4CDWA 4MXVA 5JXIA 1GUIA 5HCFA 4HG6B 3N3HA 1F5JA 1XOYA 3FHAA 4Q4W1 1RHI1 2VXRA 2XGXA 1SEFA 2CGOA 3JB4C 4QQ2A 1W8UA 1WD4A 4Q0UA 2WZR1 1UF2C 3H0OA 2PAKA 3WF1A 1XQNA 1U5IA 5FK7A 2DYCA 1Q8VA 2DTWA 2J1EA 1GBGA 1F9KA 4LHLA 5HXVA 3MHZA 1ZBE2 4Y5TA 2YC4A 4YVSA 1HJFA 2XJUA 1H4HA 2WS91 4L2NA 2XQRA 1MZFA 1PGW2 2YPJA 3OUJA 1W90A 4LO6B 4P9XA 1DIWA 4ZZ5A 1ASJ1 3FX3A 5A7NA 3AKQA 3IBMA 3KM5A 3URFA 2ZGTA 1NG0A 2YY1A 3FZ3A 5I0TA 3GDBA 1F4HA 4CP2A 1K5MC 1RTVA 1BMV1 3KCXA 1I6XA 1MQTC 4C0BA 2VQAA 2B5HA 4IETA 4YW2A 3WW1A 2JG9B 3I2OA 1AR82 4AQSA 4AI3A 1FXZA 2QQUA 3LE0A 4AG4A 4BIFA 4RR3B 4JQTA 5DZGA 1ASJ2 1QGLA 3AKPA 4WM7A 3WUDA 2YGMA 3AC0A 3T2OA 4EZ4A 5GLVA 2WLPA 2FCTA 4XFHA 2Y8KA 3EYPA 2EAKA 2NQYA 3MEPA 1JBCA 3LDKA 5DUVA 2CDOA 3PHMA 1V9U2 1UD1A 1VBD1 3H3ZA 3HPNA 1JZ7A 3FL7A 4IW3A 5BNOC 3LOBA 2E32A 3RYKA 2UWCA 1OVSA 4N7UA 1H2LA 1NCRB 1VRH2 1POQA 3BGAA 3LIHA 4MYEA 4XACA 5D8AC 4JX0A 4IERA 4RHV2 1MS0A 2XJVA 1S2BA 4YG0A 3ES1A 4I30A 3O1PA 3BOWA 1JI6A 1LOAA 1S0CA 2XKOA 3N9OA 1AVBA 1PZ7A 2NN8A 1YNAA 1QJY2 1XJAA 2HKXA 4PI2A 3ETQA 4QX0A 4ZS2A 1X8EA 2IXCA 2ARCA 4UBGA 5C3QA 5F7UA 2EF6A 1DQ0A 2A70A 3M3EA 4R9CA 2WUHA 3IKWA 4H14A 1HB1A 1SFNA 4N43A 1OFSA 3I3QA 3MIGA 2D6PA 2Z5WA 2ZACA 5F2SA 3IDBB 3LF7A 4XF4A 5GZFA 1W8TA 2XJPA 4I0AA 1Y9QA 5FZBA 3GM8A 2C1FA 3WCRA 1DYOA 1GFF2 2ARAA 1LGNA 1R082 2E7QA 1OQ1A 4B29A 4EN0A 1F31A 1GZTA 2V72A 2V73A 2A6WA 2VY0A 2VZUA 3VBSB 3VDCA 1H6YA 1JYNA 2AYHA 5A3NA 4E27A 1OH4A 3S5QA 1HV1A 1CONA 1UMZA 3B94A 2A6XA 1DYKA 2CV6A 1ULOA 2ZGLA 2QKDA 2X53S 4M01A 1EUUA 1BBT1 2A5ZA 3IIAA 2IFWA 4XZUG 1S0DA 4BM8A 3WDUA 4RN5A 3DN7A 2QQMA 2CU5A 3VHNA 2QFEA 2Q8OA 4IUGA 3RWKX 3LPFA 2B42B 2BDRA 3DPRC 5FPUA 2RR11 3OGRA 5HPOA 1XE0A 4V1PA 3JQWA 5C7GA 1O3RA 1KQRA 3GZEA 1ZA7A 1DLCA 2BNMA 1UOJA 2Y6FA 2R49A 1OD5A 3WNKA 3IMMA 3MIHA 1RGSA 3ZMNA 2VQTA 2ZXQA 4X8NA 3CMGA 4RGAA 1FMD3 2O1QA 5HCAA 4AFAA 4XBNA 4WM7B 1W6QB 2ZS6B 2CDPA 1HQLA 5GLZA 2D44A 3KB5A 1W6PB 1LECA 4C0HA 1PGSA 3VBUC 2ZGNA 4XDPA 5BPXA 3VBRC 3VKMA 3JCIA 1YQ6A 3S57A 2IXIA 3GYDA 5EXOA 5I0UA 5DN2A 1G9CA 4H7MA 3A0KA 4FT8A 2UURA 4HVOA 2GZWA 2PELA 4L0PA 5FMDA 1WBLA 3RJ2X 4AFMA 1NE4A 2GDFA 2R0FA 4MX3A 1IPSA 1D2QA 2YPDA 4NPLA 1MVQA 2DCKA 5ERLA 2OZJA 2FDJA 5KXEA 1CAVB 4B7KA 1HW5A 2Q1MA 2ZA9A 1L3JA 1I5ZA 1YXWA 2E7AA 2H0BA 3N7MA 4N53B 4O61A 4DXZA 2QQWA 4FPJA 3P5BA 5DUWA 1HJGA 4YRDA 1MS3A 5FJHA 3PTYA 1CAUB 3VBFB 5IVCA 2Q30A 5F3EA 4CCCA 2XKPA 3NKTA 3N7JA 4XURA 3O1SA 3VZMA 1R1A1 3ITQA 1SLLA 4CEWC 1REEA 1WCQA 2XVGA 2I2SA 4NRPA 2CNAA 3O5SA 4LBLA 1V6JA 4AGGA 5I8YA 3BIEA 3MV01 4Z2AA 1NXMA 4HKLA 4BJ0A 2VL4A 4W6YA 2JDUA 1WZXA 2WL1A 3KS7A 1B35C 2R041 1JH5A 2D93A 3PL0A 3SNMA 1QKQA 3ZFFA 2VVDA 2XJTA 4XFAA 1FNZA 2FDKA 4FPCA 4COYA 2D6KA 3AJZA 3AKTA 1LESA 4XMIA 1NY72 3BIWE 3ILFA 4XW3A 2X29A 4E4DX 2WQ8A 1VE0A 2PTMA 5FREA 4M3CF 3HT1A 4CRQA 1V70A 5F6LB 3VHPA 3USUA 2CWSA 3S6PA 3Q8EA 3RZLA 4XCAA 5A32B 3WG1A 2C26A 1HRV1 4CU6A 4K1ZA 1EAH2 2VTXJ 3D3AA 3ZKYA 2R1BA 3LA7A 1LHOA 2GNTA 2DU1A 4XOGA 5K9YA 1K42A 3AZWA 3D8CA 3HR9A 4MO3M 2HWE3 1G9DA 1W8NA 3B9IA 2WKKA 2YBSA 4MADA 5FPBA 3UNPA 4GB32 5FOJB 1V6NA 1FAYA 5GZCA 1IKPA 1D0HA 1X33A 2D3SA 4YVSC 5I0RA 4AFBA 1PMHX 3MPBA 4EZHA 4IEOA 4J25A 2PHUA 1O4YA 1W8FA 4QX1A 1ZRIA 4Q0PA 4QB1A 5DZEA 1TME1 3FWEA 3LFIA 2EALA 5FQ0B 1IS5A 3ACIA 4K20A 2P4EA 1DHKB 1QOTA 4BWOA 5FJKA 3T1LA 3ZYGA 1PK6C 3TEXA 5DPNA 2XONA 5LZ6A 1J3RA 5T5OA 4C1WA 2WABA 4QXBA 4HOOA 5JAXA 3LSEA 2UWAA 2IWGB 4AI2A 4A7KA 5IK5A 3HMYA 4YWAA 1OPMA 2NM1A 4IV3B 1H9WA 1V6KA 2HWF2 3A23A 5L36A 1GANA 1S0FA 2BWAA 2ERFA 5FZDA 3WNOA 1UZZA 4UW3A 3ZSJA 4AVAA 1EV13 3C7EA 4QXHA 2HYKA 3QLQA 5IT6A 2VMDA 3KLSA 2D5HA 3M3OA 5I0SA 3ZM8A 4Z07A 1QNWA 1OF3A 5H9SA 5DUUA 3VD7A 2ENRA 5FPXA 1JU4A 4XUPA 2VMHA 2BERA 1YWKA 4HMZA 2FZ1A 4LBNA 3WNPA 3I2DA 2W08A 3MFCA 2FCUA 4LBOA 4R52A 2ZGQA 5JI7A 3VBOB 1CJDA 4S2GA 2XR4A 4COZA 2ET1A 3WDVA 2OPWA 1QMJA 5G05L 2GMPA 1TMF3 4Q4W2 4QMAA 5LY2A 4B4RA 4ZZ8A 3J8F1 5FZ1A 1D0GA 2B7YA 4JQRA 4OYUA 1V00A 2RDRA 3NSTA 2VCBA 1VMJA 2Y6HA 4H3WA 5FZMA 1GV9A 3H1YA 3JD72 4M3CE 4M4RA 5FUIA 5J96B 2FDHA 1S55A 1VMHA 2YBKA 3ZFFB 4XBQA 1N1YA 2GH2A 3K3NA 3H8XA 1MS1A 3EMRA 1L7LA 3ACGA 3FUOA 1MR5A 1ND3B 2RS12 2WNVB 3EJKA 1JZ8A 2KXLA 1S0IA 2XMLA 3ORJA 4IEUA 3UESA 4G9SB 4IE5A 5LBFA 3T09A 2VAUA 3LA3A 4ZU7A 4RQPA 2HEWF 5J36A 4O65A 4DUVA 1RUG2 4WVMA 1A8MA 2BJSA 3LWCA 5FMBA 5FOBB 1QJY3 1XRUA 2VOWA 3BTZA 3H3UA 5AFBA 2RS11 3IDCB 3ZSMA 4UFKA 4NN0A 3UGHA 1LGBA 1PM4A 4ATFA 1YUDA 4JGYC 5CA6A 3TEYA 1R64A 2Y64A 3OGGA 3MUY1 1UYPA 3V0BA 1IHMA 3LCPA 3Q8AA 1G7YA 3VLBB 5K0UC 1LB2A 5FY7A 1SLTA 3AB0A 2TUNA 3F95A 2Z4FA 5KHJA 2EIGA 4C90A 1VMFA 1UYYA 2RM21 5JI9A 4AW7A 2GN3A 5KXCA 3RZZA 2VOVA 2ZJCA 2DVAA 4A7YA 2SLIA 2WFF1 5BNOA 2IXJA 4Z82A 1UO9A 5FMOL 4RR3C 1VBA2 3EXUA 1UXXX 5FY8A 2OQ7A 4DOUA 3O1UA 2VZSA 3AK0A 5FZ7A 3ZR5A 1R093 4H7LA 1QJU2 2V5DA 4YPJA 4LQRA 5HV4A 1ODNA 2K2SA 4S2FA 5HCBA 4HONA 1MS9A 1OF4A 3KQRA 4GWMA 5IFPA 3FJSA 5KWRA 4K6BA 4Q0VA 3WHUA 1ZYBA 3VBHA 1GICA 4Y1UA 2BVVA 2AZ5A 3B9CA 4XTMA 5FZIA 1VBD2 2OIIA 3MIDA 1OOPA 3DECA 4FTBA 2WT0A 2RJKA 2ZCWA 3LPGA 1CAWA 4FPGA 4GH4A 4FAHA 4HPKB 3TN93 2IC1A 1GWLA 1PVXA 3WR0A 3LFMA 5K4LA 1W9SA 2VGDA 1RUD1 2YU2A 3VZJA 1YC61 1YRZA 4TTGA 1C28A 4AGVA 3S0MA 4KU8A 1MZEA 5LCWL 3N9PA 4CCJA 3VBOA 3W9AA 1WKYA 4W6XA 3WW2A 1OT5A 4MGKE 1OVPA 4OFGA 4AEKA 1T6BX 1VAVA 1ODMA 5GZDA 3IIIA 4XAAA 4Q0QA 1S1AA 1D7PM 5EHDA 5AC92 4AEDB 2QQNA 4JHTA 3VZKA 3H8OA 5J48A 1PK6A 3J7LA 3D6EA 4I0BA 2ORXA 1LJ7A 1VBC3 1UOBA 1WBFA 4KGQA 5FYMA 1EY2A 3OOXA 2ZHMA 2W39A 1J84A 1JS9A 5A3PA 4Q4X2 3AVSA 1AL22 4RS5B 4LIVA 3HQRA 5C5UA 2IXLA 5JLVA 4M0HA 4SLIA 2Q5TA 3MW3A 4FOWA 2VNGA 1N1VA 2D7FA 2W9XA 2ZGPA 3KV5A 3D4KA 5T54A 4AWDA 5JXGA 2L9LA 5A6YA 2FZ2A 3D5OA 3C7HA 4FPKA 2YDEA 4ZONA 1IKQA 1ZRCA 1UCXA 2NP0A 2Y26A 2YB7A 1PO21 2WNOA 3I2FA 4MVTA 3CEWA 1ND3A 1RUC2 2BGPA 4QWNA 4A45A 4WZCA 1DZQA 1LHUA 3LDRA 3NQHA 5LBCA 5FQ0A 4L99A 1IG3A 3B93A 1FPN3 4YGCA 3N35A 1RUOA 2VMIA 2EIEA 2A3XA 2BYVE 4QPGB 5FR3A 1A6CA 1K5MA 4MXWB 3KZ4C 3ACLA 3ZIWA 2I74A 3UKTA 5JDBA 1WMXA 1QJFA 2YV8A 3CNAA 4QX3A 1BBT3 4BQWA 5EYYA 5FZ4A 3NAPA 5JZGB 3HNYM 2HLEA 1Y43B 3F2ZA 3QD6A 4DO0A 1RUJ1 4XZPA 4GAZA 3VD9A 1EAH3 1NKGA 4PT6A 4B3NA 1RUE3 3SEPA 1EP0A 1WMDA 2B9VA 4XILA 5FY4A 5T52A 5C4WA 3CJXA 2ZMNA 2VUCA 4MGIE 1CX4A 3LGRA 1Y4WA 4XF9A 1LAJA 2YG0A 1AF9A 2X5IA 4GH4B 4OI4A 1NYWA 1LOCA 4ES8A 1HIXA 5C8CB 4URTA 2XVLA 3U75A 4P14A 3SCGA 2YROA 3O0WA 4A3ZA 1BQPA 2OYZA 4AXOA 3I3DA 4ISRA 4BQYA 1NZCA 1OOPB 3DF0A 5FYYA 4JGYA 3SC7X 1NY71 4RHV3 3KVAA 4XVHA 3VBFC 3RZJA 1B35A 4AE2A 3CL1A 2CGPA 5DAPA 5JMOA 3S5AA 3ZXDA 2HWB3 4PBOA 2P17A 1ENRA 4NPRA 3VZLA 4XTPA 1VJ2A 3V0AB 4OMDA 4Q4Y2 2YHJA 4FXGB 4EWDA 5EYXA 5J09A 1SBDA 2W68A 3N7LA 4LO7A 4M0NA 1R1A2 3LKJA 5GALA 3PNAA 4LLOA 1JYWA 4WVVA 1K3IA 5FP3A 3H9AA 4I02A 3W20A 3CQOA 2DCYA 2JG8A 2ES3A 1SCRA 4ITCA 1MEC3 3CZJA 3WG3A 3OYWA 5ACA3 5JPNB 2WAOA 2WNUB 2RDQA 2VXJA 5FK8A 2JE9A 1P8JA 3TYJA 4HANA 1SLIA 4JTNA 1MZ5A 5JXHA 2B4KA 1JUHA 1BKZA 4LJHA 1SDDB 2X10A 5HI0A 5KXDA 3HNMA 4JKMA 4AEDA 2XBO3 4LORA 3M1HA 4IEXA 1QQP2 2A71A 5FYUA 3A4UA 3IWZA 4PLOA 1CWPA 5JSOA 1GOGA 1OA4A 5A6ZA 2RVAA 2W1WA 2Y33A 4QAWA 2WA4A 1X9TA 3FMGA 5FZ0A 4PLNA 1APNA 1Q43A 1DQ2A 5SV8A 3ZN6A 4JGZB 1OQEA 2A6ZA 1MS4A 4NHXA 4CDXC 4GB33 4HN1A 4OZXA 4NWVA 4QHBA 2Z2SB 2ZPXA 1SBFA 3WG2A 3NJZA 4SBVA 4A2UA 1CAWB 1VBD3 1UYXA 4UFHA 4Y1ZA 1CPMA 1ST8A 4I2OA 3VBSA 5JR7B 1IQAA 4MGSA 4QB6A 1CAVA 1OA3A 4LE3A 3WP4A 3ZPYA 3ZXEA 2RMU1 2HWB2 4YVWB 1W8WA 5DQ0A 1J3QA 1DQ1A 1CVNA 2GMEA 2QDNA 2X5IB 3BOPA 3ZSEA 1QJU1 3U78A 1W2NA 1O59A 3GBWA 1JODA 4TLGA 3WY6A 4WM8B 2C24A 2VU9A 1Q56A 1YHFA 4ISQA 1NA1B 1GYKA 2RM23 1F8VA 1JZ6A 4ONUA 1KJRA 4Q4V1 4OHZA 1FNYA 1PVC3 1SHWB 3N4MA 5FZAA 3E1F1 1COV1 1AZDA 2VC9A 3POSA 4EN8B 4CU8A 3PUSA 1ZZCA 5CKMA 2JDNA 5EJ3A 4YGEA 3LEGA 3MLLA 1AYN1 2FMDA 1QH6A 1LENA 1VBA3 4YZ3A 2MNGA 4F3JA 1RXGA 1GKBA 4FVVA 4MH0E 4NE9A 2BNOA 2XDVA 4QKDA 3J7NA 3TEZA 2FBEA 2A1XA 3ZFEC 5CISA 1L7RA 1C8M2 5FFOC 4NO4A 4KH9A 5BYNA 3O1OA 1REDA 5FCCA 5FZ8A 1UX7A 5BNPB 4URAA 1NE6A 1RVF3 1HLCA 2VMCA 1GZWB 2YFZA 1Z78A 3CJIB 4Q2FA 2O14A 1H4GA 1X8MA 1YFXA 3PIGA 3POBA 2WLQA 2ZAHA 3NNMA 2VZOA 2VOXA 3A22A 4G4FA 1W0OA 4R4ZA 1H8TB 4IV1B 5HXMA 4HFSA 2IXHA 5A7WA 1DGLA 1TE1B 3JD73 4NAMA 1KS4A 3PDQA 2WNVC 1FMD2 2XJSA 2G9GA 3PUIA 3W58A 4ZU4A 4BK5A 1PMIA 5DDJ1 2Q8CA 1XYNA 2VBPA 2VM9A 1ZBA1 4QQHA 4EYUA 4XETA 4GIQA 4N9IA 4U2AA 3ZXAC 5L7OB 3QBQA 3RZMA 1O4ZA 3G7DA 3AL5A 1ZZBA 2PA7A 4FQ4A 3LIGA 4XUTA 1AUYA 3GCXA 4R9AA 3TN92 4BQ2A 1RUNA 3HBZA 3ILRA 3POFA 2CL2A 5C4WB 3NNGA 3O12A 4CP0A 5JPMB 2ZGMA 1ULDA 2VZPA 3MI8A 4E4ZA 3AM2A 2JX9A 4IGQA 4PDWB 4QPYA 5C8CA 1W99A 2AR6A 4N7IA 4IE7A 1Q5OA 1W0NA 2DFCA 4GMP3 1OA2A 1NLRA 1FYUA 3VHOA 4DQAA 3OBZA 1KITA 3RSJA 3V64A 4Q4X3 3NNLA 4HKOA 2Q1FA 4W8JA 3ABZA 4AHZA 2J42A 3K48A 4Y3OA 2W1SA 2OS2A 4N8MA 3HT2A 1VBB1 2G9ZA 3MFAA 3M7AA 2PHXA 2ZX0A 3QH6A 4MUVA 2PQQA 4YFZA 2RS32 1N3OA 4L8QA 1JTZX 2ZBJA 4UFLA 1W8OA 5C3RA 4PF5A 2D98A 1Q8PA 3T0AA 4UBHA 4OHVA 2UYAA 4BYYA 4FOYA 1NCQC 5APAA 4PIXA 2JICA 3ZN6B 3KV9A 2PMWB 1W8HA 1OLME 2GALA 1C5HA 4PBPA 3RZGA 3NV4A 1POV3 2VBBA 4JKKA 4UFJA 3KGZA 2RS31 3RMXA 3LOIA 3V56A 5AC91 1VRH1 2YZ4A 3DCQA 1US2A 3USUB 1N3QA 4Z1VA 1UMIA 4HSJA 3PUHA 3BYWA 4HBNA 5ANNA 3ZYHA 2XG3A 1JMUB 3MDPA 1QIQA 3U1XA 1XE8A 4CXYA 4FOQA 2HWE1 3M3IA 4CCNA 1SCSA 5FPZA 5A1LA 1ZVFA 4YSFA 1GQHA 4D6SA 2QQPA 3FN9A 4IGPA 4PQ9A 2DU0A 3AFKA 3CKHA 5C6CA 5CYYA 3FLRA 4XE9A 3GALA 4CDUC 5LEKA 2NZ9A 2VQUA 1RUF2 5GM0A 1OLMA 3AXEA 4HK8A 4AVTA 4CEYC 5JSRA 3SITA 2HWE2 2GU9A 5A32A 2H0VA 4QKFA 4RQPB 2QCSB 3AP7A 5BXXA 3LZZA 5SV5A 4JGZA 4QPIC 1FV3A 1RIRA 1PIV1 3ACFA 5IW0A 2O8OA 3U07A 4FPLA 3MZHA 1TQ5A 2Y0IA 3MO4A 4ATEA 1RUI3 4RYDA 4UYBA 4TN7A 2AEZA 2VMEA 4CPBD 1CX1A 4OI2A 3NMBA 1Z7S2 1EPZA 2JG9A 4FI9A 3AZVA 4W4ZA 4BE3A 4OI0A 3K4DA 1FV2A 4WVWA 2GC1A 3VKNA 5T50A 1DGWA 4AVCA 4YM2A 1LKNA 4XFFA 2JIGA 2VOKA 5L9VA 1RUJ2 4NR1A 1JOPA 4IL7A 4OCTA 4L9BA 4GB31 2IXKA 2XB6C 5FXXA 5FZHA 1J83A 1TNRA 2JD4A 1VRBA 5GLTA 4ARXA 2BWCA 3M2MA 1XYPA 5K0UA 2WFPA 2I07B 4CDQB 5FKCA 4GWJA 4XBLA 1LULA 2C6SA 3WV6A 3ZYBA 1UY4A 3VL9A 1JZ2A 4FXKB 5BNNC 1NQDA 1BHGA 4YYOA 2RMU3 3NO8A 4IE0A 1VBB3 3PIJA 3LB9A 4F8AA 3MYXA 3THDA 4D7YA 3BALA 5JZGC 1LOFC 4IEPA 2BP6A 1UY0A 5FBJA 1ULGA 5D2AA 3ZVXA 4D7SA 2D5FA 4QXKA 1D4VB 1JN2P 2QDRA 2XWJB 2SBAA 3AZZA 1RUI1 2PN5A 1BZWA 4HPKA 4DEVA 5B4NA 5BNPA 3RJRA 4CZSA 3TAYA 1KFUL 4MHUA 3ZXFA 4UFMA 4Q4Y1 2IFRA 3ZXKA 4IEWA 4E2QA 1QH7A 2XBO2 4XAEA 3RFRA 1QJX3 5A7WB 1MQTB 2ID4A 2DBNA 4Q4V2 1YLLA 1JYCA 4ARYA 4E9KA 3D0JA 5CU1A 1UPIA 4GKXA 4Q4V3 2PLV3 1VAKA 4NIGA 3BU7A 2IZWA 1SDWA 4YFWA 4LIUA 1WCDJ 1C1FA 5E89A 2VTXA 4K9SA 2WBKA 3AMMA 3WNXA 1MEC1 4NOTA 5ACA1 3CIHA 2DUQA 4NIHA 2R072 3MUZ1 1HXS3 4K1YA 3RQ0A 1UY2A 2R043 2RS52 2GC2A 2OVUA 2VECA 4A7ZA 1NCRC 2VZ1A 4FPFA 3AP9A 1J59A 3JB8A 4M4PA 3ZDSA 4PIZA 2ETEA 4WVMB 1RUG3 1RHI2 3VDDB 1DU3D 3AZYA 3HVDA 5FIXA 2P3JA 4LO5B 5C8WA 4PI0A 1GOFA 3VDAA 3TNQA 3U4XA 1FI2A 4FPOB 2ZGSA 3MPPG 4E8DA 3DXTA 4XXAA 1UAIA 1RB8G 1W9YA 4B1MA 4DFSA 2JDKA 2WDBA 3VKOA 1IS4A 4BB3A 1A34A 4BXFA 1G9BA 1QHDA 4P9IA 1J1LA 1ALYA 4UF0B 1XC6A 1DZRA 1RVF2 4GZ9A 4AZZA 1UU4A 2W92A 1RC6A 4LTAA 4ZY9A 5A3TA 3AMQA 5ISLA 3Q8FA 3RMYA 5B4XA 4GMP1 2A73B 2R16A 2GSYA 4LPLA 5GZEA 3VBSC 4YZ2A 2CGNA 5FP7A 3T30A 3RRDA 4UT5A 3RDIA 1OC1A 4YZ5A 1QJU3 3ECQA 3I8TA 1SBEA 1UOGA 4AK3A 1BLZA 5E1RA 5IVYA 5LBBA 2P2KA 3B3QE 2ADDA 2DCTA 2Q8DA 4OHYA 1UZ0A 2AACA 2WSUA 5LK5A 1YI9A 4CSWA 4Q1PA 5A7SA 1PHMA 5FY1A 3UJOA 4F7ZA 1SPPB 4AI1A 2JDAA 2Z79A 1UQXA 1JYIA 4XJUA 1AYN2 4XUQA 3MIEA 1YI7A 2F17A 1PGW1 2LTNA 2ZHNA 2R073 1Y3TA 1UZWA 4CU9A 3WDYA 4DRRA 2BEOA 1LODA 3DKQA 4XYXA 3IZOA 3KHBA 4EWEA 2D97A 2ZZJA 3MICA 2JB4A 3V65A 2Y6JA 3FLTA 1RL3A 5GLWA 3UKVA 3GZUC 1NLQA 4EV0A 5J7MA 3VD4A 3WNLA 3WUCA 5LB6A 4FFGA 1W8ZA 2Q8EA 2KD7A 3V0AA 3C3VA 4OQ9A 3PU3A 2BW8A 4OULA 2QQLA 3OY8A 5FZCA 4GA9A 3GJAA 2E51A 1IQDC 3I7DA
chains in the Genus database with same CATH topology
2PAEA 4J1XA 1XYOA 1VBE2 5B2GB 2VNRA 1ZBA2 4QGLA 4BHPA 1VB2A 5BNNA 1BK1A 1VBE3 4L97A 3QCWA 5E8AA 3ILNA 5CBLA 1XU2A 2ZMKA 3RYRA 4Q8LA 4TYSA 2B39A 4X8PA 1PIV3 3KT4A 4KG0A 5IK4A 1H8TC 4IV1C 1J3PA 3O7OA 2B8MA 4P9WA 3AMPA 3P3PA 5L19A 2QZ3A 4TWTA 3ZSLA 2JG8C 5FBZA 4BZ4A 4XJAA 4QPIA 5IK8A 1KJLA 2AH2A 2VUJA 1IZ3A 2R32A 4CEWB 1X36A 1AJOA 3OPZA 1LTEA 1V6MA 4QPGA 3FLPA 2R063 1T6GC 4Y1XA 1PO22 4OUMA 2ZZQA 1G9FA 4JC1A 5JIAA 2GNMA 3PVEA 2FQPA 4XPVA 3OTFA 1XXNA 3IPVA 1MS8A 5C9AC 3WQ7A 1AL0G 1WW4A 4XJ9A 2OZ6A 2OUJA 5CG8A 4HVRA 1QJX2 2B45X 2WZR3 4IESA 2E63A 2N7GA 4H55A 3NV3A 4F83A 3R6SA 3Q9OA 2W0XA 1UZYA 3ZFGC 4XQDA 1EV11 1PGL2 2VMGA 1YYNA 5CFDB 2HWD3 2BFUS 4LULA 1BVP1 4X6RB 4AVSA 4N43B 1AYM1 2PHTA 1YJLA 1QJX1 4Y4YA 3ALQA 2C0ZA 3J9SA 2E7TA 5F5QA 2PHRA 1LU1A 2TEPA 5J37A 3JU9A 4COVA 3VKLA 2OW4A 1ZBE3 3N7KA 4JDNA 4HL0A 3ZIXA 4QQPA 1AR91 4UW6A 4NVPA 4LT5A 2XJRA 1H1AA 1QNYA 1FPN2 4N90A 2D6NA 4JTOA 1ZM1A 3ME2A 4YG6A 4BLIA 4YW5A 1VBC1 1WW7A 5EFUA 1MEC2 5ACA2 1O7FA 2WFF3 3GZTB 1EPWA 2BTVC 5K7PA 1ONAA 1WLTA 1LEMA 4P9YA 2ZX2A 5F1RA 4P9LA 3ZYIB 3DPRB 3EHKA 1ULEA 2NMOA 3V0BB 5JOYA 2NLRA 3M4FA 4INDA 4DRVA 2HWC1 1IPKA 1O3QA 4XFBA 1AR63 5FO7B 1AL21 1Z7S3 3FHIB 1CAXB 3WW3A 3RYPA 4WM8A 1OLQA 1S0JA 2PLV2 1O4TA 3MF9A 4TSVA 2G4IA 1DQ6A 3SH3A 4I0WB 3E5XA 3ZFFC 3VBRB 2QE3A 2VQ0A 3DV8A 1JUIA 1YJKA 4AHWA 1J58A 4IEQA 4RSUA 1CJPA 5ABJA 2DCJA 4IV3A 5JIUA 1OFNA 1H8TA 4IV1A 1SLCA 5T5JA 1DGWX 4A3XA 3LAGA 4AFCA 4OI1A 2BUKA 3BTAA 2HWF1 3NV1A 3OJBA 4R9BA 2JDZA 2WZPP 3B02A 4FO9A 4FPYA 1CAUA 4COWA 3GF6A 3IMNA 3BPZA 4R8HA 2RS33 5JCTA 1HRI3 4EROA 1H9PA 1GNHA 4L92A 1WMEA 4Z2WA 1KDKA 2XVKA 1M06G 1FOD3 1W0PA 3ZMOA 1O91A 3H1WA 3AJYA 1R1ZA 1OHFA 4FTEA 1Q3EA 2UY8A 2D6OX 2WA3A 1LHNA 4QGMA 3CJIA 5EWSA 4P9GA 3THTA 3ZXGA 3USSA 1RUC3 4KGGA 4PDWA 1RJ7A 3KD4A 3E5QA 3SCHA 4CDWC 3JZVA 1WLWA 5BNOB 1O3TA 5BY5A 3OBRA 2P3KA 3MGUA 4R4XA 1N3PA 3NAPC 1DBNA 3OYWB 3JBG2 2XUMA 3TBDA 1QY4A 1ZRRA 4UW4A 3TOJA 2NMNA 4XF0A 2DURA 2A3WA 4QQLA 2HJIA 4EN6B 1LOBA 2XLFA 4LBJA 2R071 1U5YA 3AXDA 3ZYRA 3ZN5A 1ZBE1 1RUH2 3TB0A 1IGOA 2OPKA 4XFGA 4Y22A 1YCIA 4D3WA 3ZO0B 3AYAA 1AR61 1R091 2D6LX 2DFBA 3NVCA 4MXWA 3ZXLA 1ZBA3 1VB4A 4KG8A 4BCUA 5DUXA 3KSCA 1DDLA 2O0OA 1YIFA 4GXLA 4JAAA 5KC6A 1N1TA 4FP3A 2D3PA 1HRV3 2MEV1 4U36A 4FTSA 4K8FA 5KXBA 3CU7A 4TLFA 4Y20A 2CAVA 4RD7A 3NL1A 1R092 3D82A 4XJWA 3RNSA 1VIWB 1YIPA 3OD4A 4I3PA 3PVNA 2E9QA 3WXPA 2VNOA 1ZNPA 1AHSA 2CTVA 3RI9A 1WCKA 3IN9A 4R9DA 2HWF3 4HKWA 2AENA 3WLUA 1COV3 1H30A 2D40A 1EV12 3WP5A 1PGL1 3AFGA 3GNEA 3DGTA 4HSLA 5CFCB 4KNCA 4DS0A 1RUF3 3UJQA 2WT2A 1RUD2 5I93A 2ZOEB 1LGCA 1PO23 4GKYA 4Q0SA 2RR13 1UPSA 4LO8A 1H2NA 3ZFEB 1W6PA 2ZX4A 1DF0A 1EYBA 4PJYA 2GC0A 5ABJC 3FBMA 4C1XA 4QU2A 3T2TA 3NKGA 1W2UA 2HWC3 4COUA 3WD5A 1ENXA 2WS93 4GQ7A 1VBE1 4OLLA 3KCCA 1D4M1 1A8DA 3VZNA 4IEVA 1MS5A 3GHNA 3VBHC 5H9PA 3SXWA 5FRAA 1OOPC 1R1A3 3GBFA 1H1MA 2ZX3A 2B46X 1VALA 1GR3A 1DYPA 2WIIB 3L2HA 3ATGA 4XMAA 5GLWA 1QDCA 1CAXA 4FQZA 3UKVA 3WP6A 4E2SA 4E2GA 1K5MB 1ZREA 3OCPA 4BMBA 4BH9A 5K0UB 2R6QA 5KHKA 5E88A 2YYOA 3VBRA 3VUOA 1G8WA 1LEDA 2ZGRA 2W52A 2RE9A 4JCKA 3H50A 3E97A 2A6VA 1ZZ7A 2AUYA 5GJ6A 5I8TA 1C8NA 4BLJA 1TEIA 2ET7A 1XNDA 1GSLA 4XXPA 1BEV2 1HXS1 4DY5A 5F9TA 2ZHLA 1WW5A 3M3CA 3U11A 1KD7A 2WNVA 4J1WA 3ASIA 3L9JT 4LO4B 1NCQB 4D94A 3WINE 2Z69A 4LA3A 3HN1A 1FX5A 2VPVA 2BFUL 3B5LB 1RUC1 2ZX1A 1QWRA 4HETA 1ZRDA 1ND2C 4QM8A 2DTYA 5A3LA 5BUVA 1LHVA 1XE7A 3M3QA 5FO9B 4HT1T 4D7TA 1GZWA 1UIJA 3BODA 5A3MA 3FFQA 1REFA 1OQDA 2VVFA 3E6BA 3AKSA 4LA2A 1I1EA 3FUQA 4XF1A 1FOD1 4DNYA 4AVBA 1UU5A 3ZYPA 1RUH3 1UKRA 2WINB 3KCYA 4CYDA 2R061 2ARBA 2ZGKA 1QXJA 5CIRA 1QXRA 2JKBA 3B69A 4PCRA 4YM0A 1QDOA 1AR92 1BYHA 2E53A 4B7EA 5JWPA 1C4RA 1JOJA 1FPN1 1IS3A 3PJYA 4I01A 2E6VA 5DG2A 1KRIA 5KBFA 1GNZA 3FBYA 4RS5C 2PLV1 4Y20B 3WZ1A 1RUF1 3R4DB 1HRV2 1AR83 5JSPA 4XF3A 2JE7A 4MSVA 4MLOA 2PFWA 2EXHA 1ASJ3 1W39A 1RMU1 1QF3A 3VBFA 2WC2A 2WSVA 1G6NA 2ILMA 2WQZC 1KFXL 1QOOA 2R1DA 4LNVA 2QJVA 3VBUB 4KU7A 2DCZA 2RS13 3VL8A 1C5IA 1AXZA 1SLAA 4RGGA 1HRI1 4AGRA 2VUAA 2XL7A 4AYUA 1S0BA 1GZCA 2VULA 4C91A 3H7YA 3JBG3 3UL2A 4CTEA 4TZDA 2PHFA 2HWB1 1NA1A 1V6OA 1WMFA 4IEYA 3AMNA 1RJ8A 5L7OC 3IM0A 4AVVA 4FAGA 2BVBA 5CVRA 1H8VA 3D0SA 1URXA 4N53C 5C8CC 4DY3A 4QQOA 3FE5A 3L2YA 1I3HA 4QD2A 3TWIA 1TME3 3QACA 4XHBA 2JG9C 4Y1VA 1RUI2 2BQPA 1XNBA 4BPZA 1X82A 2H6BA 4PDWC 2HWD2 1UKGA 3AP4A 2XHKA 2F6BA 1H2KA 1JXNA 3J8F2 2LALA 1AR71 3EQEA 1AL23 5KC5A 1U12A 3WVJA 3QOPA 4LR4A 4YM3A 4O9EA 2F4PA 3SMHA 4ZXKA 2HEYF 4DZGA 3IPVB 1C1LA 2ZGOA 2CWMA 1ZZ6A 1BJQA 3FC0A 4AI8A 1RITA 2JEMA 1HV0A 1JW6A 2WT1A 5JOWA 1AR72 3JUUA 1ZZ9A 1E57A 2ARXA 2ZKNA 4EN7B 1LOGA 5KHGA 3GHMA 1RUG1 1GZ9A 1PNFA 3ELNA 2PHWA 2EAAA 4XHXA 1F5FA 4LHKA 3UK9A 5C33A 1I9RA 3RI8A 3AMHA 3I4IA 4X6QB 4CDQA 1DZTA 1AX2A 1AX1A 1ENSA 4NHLA 2MHFA 2A7AA 2FHRA 3UV9A 2JECA 4I09A 1NCQA 4B8EA 2DVFA 3DUIA 4E4SA 5FO8B 2AGSA 3NW4A 2DVBA 3VGIA 4BOWA 3EO6A 4FPEA 3ES4A 1LOEA 1NOVA 1SACA 3A0NA 3PMSA 1AR62 3AKRA 2I45A 4Y5Z0 2XWBB 5T3NA 4CEYB 2MEV3 4YVWC 3J8F3 4LLFA 4Q4Y3 2MEV2 1LRHA 4FP2A 3BCWA 4Q27A 4EJRA 4KWKA 2DUOA 5GZGA 2QVSB 2P3IA 1BMV2 2UYBA 4WBBA 5AVAA 1AYM2 3B7MA 1AXYA 3WQ1A 3G6JB 5K8SA 1AR93 1DLLA 2DWRA 1WW6A 3APBA 1YFUA 2WFF2 1B09A 1W6QA 4D69A 3U10A 4YG3A 1ND2A 5DXDA 1QQP3 5BNNB 1WLDA 1SMVA 5BNPC 2GNBA 1RUE2 3CJIC 3M8LA 2DV9A 2VW0A 3HAGA 4RHV1 2D6MA 3MLJA 2YC0A 5EZWA 5GLUA 1TNFA 3E6DA 4AEMA 2XLAA 4Y22B 3ENRA 4AFDA 5JMCA 4WVZA 1U0AA 2V5YA 4N53A 4IQPA 4HN0A 3WT3A 1OLRA 1CIWA 4P9JA 3I59A 3WDTA 2R042 2RS53 3VBHB 1VP6A 1YFYA 1R081 4LBQD 1RUJ3 5BV6A 1CESA 4S2DA 1UU6A 3SISA 3IDEA 3WW4A 2CAUA 1BVVA 1B35B 1PO13 2YMZA 4NHKA 4NWWA 4WZFA 1BEV1 2JENA 3VV1A 5T55A 4J6GA 1OKQA 1PZ9A 4PIYA 4M00A 4BQ1A 2WJSA 1HKDA 2A75A 3I54A 4PLMA 4AI0A 4CDUA 4JDMA 3ROUA 2Q1ZB 4JVAA 2WNUC 1LHWA 4MV2A 1HDKA 2OUHA 3POWA 4RR3A 1PNGA 4GMP0 4DINB 2BNNA 4YARA 3VDDA 5I91A 5CFCA 1ULFA 1FOD2 1VLNA 2G9FA 1WCSA 4FBFA 4YVSB 2GN7A 2X8KA 2GAUA 3W59A 3ZN4A 3BB6A 1CGPA 4LBKA 5L7OA 2DVDA 2WWSA 1NCRA 2XBO1 1LCLA 4XFCA 1QOSA 1ND2B 5DG1A 2P34A 5FLJA 3HIFA 4O9GA 1CQ9A 1MZ6A 1U5ZA 1HX6A 2GC3A 5IK7A 1PK6B 2YXSA 4YW3A 5D8AA 5IUQA 2LUWA 1M4WA 4JRLA 3WQ0A 3IT8A 2QNKA 3CLPA 1RUD3 4G3YC 1KXGA 1C3HA 5H9RA 4BMEA 4RS5A 1KS5A 1QU0A 4YW4A 5JZGA 2RHPA 4RQPC 2GMMA 1RHI3 1Z0HA 3ZYJB 1XU1A 3CF6E 4YNIA 1VBC2 1PVC2 4P5HA 2ZHKA 3NWKA 2JJ6A 4KQ7A 1S0GA 1WA4A 4OHXA 4QT6A 3JD71 2JXAA 3DL3A 3LA2A 1HRI2 3KT7A 2NYYA 1D2SA 2BGCA 2XLGA 4AEJA 3R0RA 4CDXA 1ZX5A 4Q26A 1RVF1 4ZKTB 1PO11 3OY8B 1BXHA 5J3UA 3AYDA 5T5LA 4JRAA 4CDQC 4OHWA 1ND3C 4DMIA 3O14A 3VZOA 4LUMA 1W6NA 4MGYE 1Q8OA 2WNEA 4KBBA 1S2KA 3RPQA 5CADA 2RMU2 1EAH1 2K9ZA 5AFEA 5L73A 1S0EA 3WG4A 4DB5A 5GKAC 4MGZE 3SLIA 1G86A 4IXLA 2JG8B 1AR81 1AXKA 5JVVA 4GH4C 1AX0A 1JHNA 3HD8B 3HQXA 4AF9A 3S30A 3ZX7A 4JGYB 4ASMB 2O8QA 4K3UA 1DG6A 2GNDA 4S2HA 1IPJA 4AHYA 5C4WC 5C9AA 2FMYA 1LR5A 3OD0A 1V9U1 1HQWA 1Y7BA 2RJLA 4B4PA 1DGRN 5FLHA 3SH4A 2R30A 4EWAA 4JV4A 1HQNA 1CD3G 2A6YA 4DPNA 1VRH3 1ENQA 4NHMA 2NPIA 3WOGA 1WUVA 5AVPA 2R0HA 1UN1A 3AP6A 5D8AB 4GWNA 4WV8A 2VH9A 2ZKLA 2BBVA 4M3CB 4LE4A 3ZFGB 3NAPB 4XQWA 1Q8SA 5CFDC 1ZA4A 4FPHA 3H8UA 1X50A 1FMD1 5KHHA 2H6CA 5EV7A 3FFZA 2EVXA 1VR3A 1W6OA 2TNFA 4GALA 1C57A 4I3GA 1A3KA 3RWNA 1D4M2 3ST7A 1R083 1UIKA 3P3NA 4YZ4A 4ASLA 1D4M3 3U0ZA 3TN91 2HEVF 4LBMA 5A33B 1J1TA 1SFYA 4BIOA 3B00A 5LRRA 4CP1A 2XPJA 1ZRFA 1BBT2 4KWLA 4LEJA 1GLHA 5E16A 4XDQA 5BNQA 4UW5A 2EXJA 2CYFA 1QJY1 2VW1A 1O5UA 4AEDC 4Q4W3 4CDXB 4Q8KA 1C8M3 4HLTA 4YW1A 2YUEA 4UXAA 3GBGA 2EXKA 2RR12 3AX4A 1WD3A 2MPFA 4CDUB 4YVWA 3ZSKA 5J98B 1V9U3 3JQXA 3GZAA 1DFQA 3KGLA 1N1SA 1UX6A 4BA6A 2WZR2 3CO2A 2GH8A 2QUOA 4Y1YA 1TMF2 4EN9B 4RL7A 5DDJ2 3M70A 2X5IC 2CY6A 3TNPB 4K40A 3AYCA 3VKFC 2PHLA 2XH6A 4YLZA 1NQJA 3R05A 1MQTA 1HXS2 4HK9A 5FTTC 2V09A 2PYTA 4WM8C 4Z92B 3OGJA 4YZ1A 1BCXA 5JOXA 1NA1C 4YGDA 1O3SA 2WNUA 1TMF1 4KL1A 2DUPA 1RUE1 3J4UH 4N9HA 4WM7C 3MLKA 1POV0 3EBRA 3E5UA 2RM22 1RINA 4W65A 1VAMA 5CFCC 4QPGC 5I8SA 1GQGA 1N47A 3H1MA 1KDMA 1VBA1 2EA7A 2AREA 5LEJA 3E6CC 3MW4A 1PM7A 1OPOA 5T5PA 3S7EA 1VBB2 1V6IA 4GULA 3S7IA 2ZABA 4M3CA 3WDXA 4META 2VG9A 3RG0A 4OVEA 1YO8A 4W6WA 5FLIA 4YGBA 3ZXJA 2BPA2 3SHRA 1ZZ8A 5ABJB 2D3RA 1U5XA 2DVGA 3T1MA 3AYEA 3O0XA 1W6OB 1QJZA 3LSDA 4QM9A 4AQ2A 3ZFGA 2A3YA 2XL9A 1UW8A 1PIV2 1BEV3 3B01A 3OBTA 5H9QA 2KA3A 3WHTA 3QH7A 3UKNA 1DGRA 4HVQA 1MVEA 1NXD1 2YGLA 3WP3A 5HBAA 4QGNA 1ULCA 5A33A 1CR7A 4XEZA 3AZXA 5LK7B 1Z7S1 1W6NB 4L11A 3SH5A 1XNKA 3PLQA 5F6KA 5FAXA 5TSWA 1V6LA 1A78A 3N36A 1W6MB 2PHDA 2ATFA 5DZFA 1RMU2 4Y24A 1SQ4A 1AYN3 5FMOS 4CDWB 1RMU3 4LBQB 1YFWA 4Q1RA 1PO12 5D1IA 2LM3A 1H1IA 2C9AA 5C9AB 3HWJA 4ES9A 4JDOA 4Q4X1 4IEZA 2UWBA 2XJQA 1LU2A 3C2UA 3J26N 3VDDC 1QQP1 4MZUA 4Q29A 3MIBA 4KWJA 3OF1A 4FCAA 5CB7A 1X7NA 1OMIA 3X29B 4YM1A 3R4SA 1FT9A 3O0VA 4LHNA 4RFT0 2HWC2 1OSGA 1TME2 1WLCA 1CPNA 1G9AA 3K51A 4K7JA 4N43C 3SCFA 1O5LA 2QZ2A 4XFIA 1POV1 2P37A 1QXPA 3NV2A 1F2NA 2VVEA 2ZMLA 4JGZC 3ZFEA 1WGPA 1CN1A 2Y0OA 3THPA 1MACA 1SLBA 2HWD1 2UY9A 3KMHA 4AHXA 5CG9A 1Q8QA 4FOVA 1PVC1 1AYM3 2K0GA 3VN4A 1DQ5A 4Y26A 2ZGUA 3MF6A 2OA2A 1PZ8A 4IV3C 4QX5A 4XJZA 3WCSA 3MIFA 2Q4SA 2RS51 4K21A 2TBVA 4AQ6A 1AR73 3H7JA 2WQ4A 1COV2 1IOAA 4XIKA 2C5DA 1DQ4A 4QPIB 3DPRA 2KM2A 3VHRA 1XNCA 2EXIA 2Q0AA 4XQ4A 3I59B 2B9UA 5LRSA 2Y38A 2R062 2VW2A 3INAA 3PVBB 1IS6A 4CEWA 4Z8BA 2PAMA 4HZFA 4CEYA 4AQTA 3VBOC 1C8M1 1NLSA 1AJKA 5AC93 5CFDA 3AP5A 2ZAAA 1RUH1 3PMEA 1W6MA 1LOFA 3KT1A 4XJ8A 5FDBA 5DDJ3 3R4UA 5KHIA 4OUSA 4XIOA 5CNAA 5CAZA 3RS6A 4LUKA 3DKWA 3TRSB 2DF7A 4LBQA 3VBUA 2ZTNA 1OI6A 2D43A 4ZU5A 1UL9A 4FSJA 1H0BA 3PVOA 4ORFA 2UU8A 1FATA 4B4QA 1H2MA 3MW2A 2WS92 2Z42A 3PJQA 4RA0A 3POYA 3JBG1 3WX5A 4CDWA 4MXVA 5HCFA 3N3HA 1F5JA 4Q4W1 1RHI1 2VXRA 2XGXA 1SEFA 2CGOA 3JB4C 4QQ2A 1WD4A 4Q0UA 2WZR1 1UF2C 3H0OA 2PAKA 1XQNA 1U5IA 2DYCA 1Q8VA 2DTWA 1GBGA 1F9KA 4LHLA 5HXVA 1ZBE2 4YVSA 2XJUA 1H4HA 2WS91 4L2NA 1MZFA 1PGW2 2YPJA 4P9XA 4LO6B 1DIWA 1ASJ1 3FX3A 3AKQA 3IBMA 3KM5A 3URFA 2ZGTA 1NG0A 2YY1A 3FZ3A 5I0TA 4CP2A 1K5MC 1RTVA 1BMV1 3KCXA 1I6XA 1MQTC 4C0BA 2VQAA 2B5HA 4IETA 4YW2A 3WW1A 2JG9B 1AR82 4AQSA 4AI3A 1FXZA 4AG4A 4BIFA 4RR3B 5DZGA 1ASJ2 1QGLA 3AKPA 4WM7A 3WUDA 2YGMA 5GLVA 2WLPA 4XFHA 2EAKA 2NQYA 3MEPA 1JBCA 5DUVA 3PHMA 1V9U2 1UD1A 1VBD1 3H3ZA 5BNOC 3LOBA 3RYKA 2UWCA 4N7UA 1H2LA 1NCRB 1VRH2 5D8AC 4MYEA 4IERA 4RHV2 1MS0A 2XJVA 1S2BA 4YG0A 3ES1A 4I30A 3BOWA 1S0CA 1LOAA 2XKOA 1AVBA 1PZ7