4YVSA

Crystal structure of the virus-like particle of a c4 strain ev71
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
226
structure length
226
Chain Sequence
b'SHSTAETTLDSFFSRAGLVGEIDLPLEGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGEVVPQLLQYMFVPPGAPKPDSRESLAWQTATNPSVFVKLSDPPAQVSVPFMSPASAYQWFYDGYPTFGEHKQEKDLEYGACPNNMMGTFSVRTVGTSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSIKPTGASRTAITTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Crystal Structures of Yeast-Produced Enterovirus 71 and Enterovirus 71/Coxsackievirus A16 Chimeric Virus-Like Particles Provide the Structural Basis for Novel Vaccine Design against Hand-Foot-and-Mouth Disease
pubmed doi rcsb
source organism Enterovirus a71
molecule tags Virus
total genus 35
structure length 226
sequence length 226
chains with identical sequence D, G, J, M
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4yvsA00
3J8F2 2RR13 1HRV1 1R082 4GB32 3TN92 1EAH2 4QPIC 4BCUA 5C9AA 4RR3B 3VDDB 2X5IA 1VBB2 4Q4Y1 5CFCA 1AR61 2WFF3 5CFDB 1OOPA 2MEV3 1RUJ1 4CDUB 1MQTB 3VBRB 1RUH2 1RUE3 5BNOA 2RM23 1D4M2 1COV3 1Z7S2 1AR72 4JGYB 5A33B 5BNNC 3VBOC 1QJX1 1VBA3 4PDWA 1VBB1 4RS5B 3CJIC 1NCRA 3VBUA 4FTEA 4N43A 1EV12 5ACA3 1HQNA 2Y26A 4YVSB 3JD71 3NAPA 2WWSA 2HWD2 1QJY3 2HWE3 2RR11 1SMVA 3ZFFA 5BNPA 4QPIB 2XBO3 4N53A 1BBT3 3ZFEB 2WFF1 2RS32 1RUD3 3HAGA 1FPN2 1RUG3 1RUI2 4JGZC 4AEDC 3JB8A 1RUE1 1COV1 1AUYA 1BMV2 1K5MC 1TMF2 2R072 4NWVA 3VDDA 4IV3A 2HWF3 4QPGC 1VBA1 3VBOB 5BNNB 1VRH2 3M8LA 4GMP0 4GMP3 3S6PA 5CFDA 3VBFC 1FOD3 1BEV3 1PO12 2BUKA 4RQPC 5ACA1 4CEYA 4CDUA 5A32A 1HXS2 1FMD2 3ZFGB 1QJY1 3JBG1 1AL23 1QQP3 5LK7B 4JGYA 2RS12 1B35C 4RS5A 1VRH1 2XBO1 1IHMA 1BBT1 1VBD2 1C8M3 1MEC3 1RUD1 1PGL1 4CDWC 1RUG1 1V9U3 1QJU2 4AEDB 2R061 3JB4C 1K5MB 2RMU2 4GMP1 3ZFEA 5AC93 5C4WA 2DF7A 5ABJC 5C8CB 1A6CA 3VBFB 1BEV1 4WM8C 4RQPB 4Q4V2 1RUF2 1ZBA3 1AL21 1QQP1 5D8AC 4CDQB 4YVWC 5J98B 5BNNA 3LOBA 1RHI1 5DDJ1 5K0UC 1C8M1 1MEC1 2BPA2 3ZFGA 1TME3 1H8TC 4CDWB 1NG0A 4Q4Y2 1V9U1 1AR62 4GH4A 1AYN3 1GFF2 1OHFA 2R041 1RUJ2 1AR93 4GB33 1RMU3 3TN93 5ABJB 1R1A3 4WM8B 1QJX2 4RHV1 1R093 3VBHA 1K5MA 2HWC3 3JD72 1QJZA 3DPRC 2RR12 5C8CA 3VBFA 1D4M3 1POV3 1POV0 4RQPA 3IDEA 5J96B 1HRI3 2WZR1 4CDXC 5JZGC 1VBC3 4CDQA 1AYN1 1PGW1 2WFF2 1EV13 2HWB1 1ASJ3 3ZXAC 1NA1C 1PIV3 3VBSC 2HWD3 1AR91 1RMU1 1NY71 2IZWA 1RUE2 4FTBA 1COV2 1R1A1 2RS53 4CDWA 1VBA2 4CEWC 1R091 2GH8A 2MEV1 2HWC1 5ACA2 1PO23 4IV1C 1QJY2 1ND2C 2RM21 5ABJA 3JBG2 1POV1 4RR3A 4WM8A 2WLPA 1HRI1 1RUC3 3CJIB 2XBO2 4RFT0 5JZGB 1VBC1 1BBT2 1MQTA 1AL0G 1RUD2 3VBRA 1PGL2 1ASJ1 1HXS3 5C9AC 1PIV1 1NA1B 2HWE1 2X5IC 1RUG2 5A33A 2WS93 2R062 2RS51 1OOPC 1VBE3 4YVSA 4Q4W3 5BNOC 1BEV2 1PO21 1VB2A 4Q4X3 4PDWC 1C8NA 4JGZB 4IV1B 1NCRC 3VBUC 4QPIA 1AL22 1QQP2 2HWF1 4N43C 4QPGB 1RVF3 1RUC1 3NAPC 1RB8G 5FOJB 1AYM3 1FOD1 1RHI2 5DDJ2 1C8M2 1MEC2 4EJRA 3ZFFC 5BNPC 5C9AB 4N53C 1V9U2 2X5IB 2PLV3 1B35B 2WS91 3VBOA 3CJIA 2R042 1OOPB 5JZGA 1HRV3 1VBE1 2ZZQA 4Q4W1 1ZBE3 3VDDC 4IV3C 4RHV2 4FSJA 1PVC3 1M06G 3VBUB 1AR83 3J8F3 4N43B 1VAKA 4CEYC 1RVF1 4CDUC 1R083 5AC91 3NAPB 1AYM1 5L7OC 1EAH3 1ZBA1 2WZR2 4JGZA 1VBB3 4IV1A 4SBVA 4RS5C 4AEDA 2FZ1A 5D8AB 1AYN2 1NCQC 1PGW2 1X36A 4QPGA 4YVWB 2HWB2 1RUH3 2ZAHA 1CD3G 1Z7S3 1AR92 1AR73 1RMU2 1NY72 5K0UB 1ND3C 1ZBE1 1R1A2 1TME1 1H8TB 4IV3B 1PVC1 1R092 1B35A 3ZFEC 5C4WC 4WM7C 2BFUS 2MEV2 1AR81 2HWC2 3J8F1 1OPOA 1NOVA 4CEYB 1R081 5A32B 4GB31 5FMOS 2RM22 3TN91 2BBVA 5L7OB 1EAH1 1HRI2 2FZ2A 2ZTNA 2TBVA 3FBMA 1VBC2 2RS33 1NCQB 1FPN3 2GSYA 1ASJ2 1RUI3 3DPRB 1PIV2 2HWE2 1RUH1 3ZFGC 1D4M1 1Z7S1 3JBG3 1AR71 1TMF3 4GH4C 2R073 1ND3B 1HX6A 2RS52 1VRH3 4CDXB 5D8AA 1PO13 4YVWA 1EV11 5C4WB 4WM7B 1FMD3 3VBSB 1PO22 2HWD1 1X33A 5CFCC 5K0UA 2RS13 4NWWA 3VBHC 2R063 4Y5Z0 1H8TA 2HWF2 1RUC2 4CEWB 1FOD2 1VBD3 5C8CC 1F2NA 2RS31 1FPN1 1RUI1 1QJU3 1ND2B 5L7OA 1BMV1 1TMF1 2WS92 2R071 4GH4B 4CDQC 4FTSA 4Z92B 2RMU3 2XPJA 1DDLA 1PO11 1VBE2 1RHI3 5DDJ3 1NCQA 4Q4V3 4Q4W2 1HXS1 1FMD1 1RUF3 3DPRA 2BFUL 4Q4X2 5CFCB 1W39A 2RS11 1ND3A 5FMOL 1F8VA 3VBHB 4Y4YA 4CDXA 2R043 1RVF2 5AC92 1AYM2 1VBD1 5BNOB 4WM7A 1NA1A 3VBSA 4RR3C 4LLFA 4Q4X1 1E57A 1ZBA2 4PDWB 4RHV3 4Q4Y3 1AR63 1QJU1 1NCRB 1WCDJ 5CFDC 2PLV2 1RUJ3 2QQPA 1MQTC 1VB4A 4CEWA 3VBRC 2RMU1 1HRV2 4JGYC 1CJDA 4Q4V1 1QJX3 1ZBE2 3ZFFB 1RUF1 1TME2 2WZR3 5BNPB 1ND2A 4N53B 1PVC2 2PLV1 2VQ0A 4YVSC 3JD73 2HWB3 1AR82 5GKAC
chains in the Genus database with same CATH superfamily
1CPNA 1MS3A 2RR13 3BI3A 1R082 3OF1A 3KB5A 3IIIA 3TN92 4BU2A 5DXDA 4ZPIA 2WSUA 2VNOA 1Y7BA 4QPIC 3T0AA 1J59A 4RR3B 3THDA 2B42B 2ZGPA 2E9QA 4NE9A 1W6NA 1AR61 2WBKA 5A7PA 3FN9A 5L19A 4ZZ5A 1CN1A 1EYBA 2GH2A 3H8RA 4P14A 5FKCA 1MQTB 2UYAA 3PHMA 3PUSA 1OFNA 1IOAA 1IS6A 1KXGA 2RM23 4L92A 2Z5WA 3I8TA 5A6XA 2VGDA 2R0HA 3WW1A 5JAXA 1WMXA 2XGXA 3OGRA 3VL8A 3VBOC 1KS4A 1WA6X 1HQLA 2B39A 2Y38A 3DECA 4PDWA 4YNIA 2E53A 1GZWB 1G9DA 4WV8A 1GOHA 4JV4A 4XHXA 1WUVA 5FWJA 1LAJA 3HT1A 1JU3A 3HWJA 1UPSA 3O1SA 4JVAA 4E8DA 4H7MA 1XYOA 4FPOB 5F37A 1JZ4A 2W0XA 3MI8A 5HXVA 2FHRA 1DGWX 3CIHA 2HWE3 3IDBB 1I5ZA 3LIGA 2LTNA 5JXGA 1IPSA 2IXCA 3LF7A 4JAAA 3MEPA 3QH6A 5FPLA 1IGOA 3RSJA 3ASIA 5FYHA 5BNPA 1JS9A 1V6JA 3WQ7A 3RZLA 2WZ8A 5FAXA 3BIWE 2XWBB 4DY3A 4OHYA 5FLJA 1ENQA 1RUD3 1XYPA 2VNGA 4TWTA 3OOXA 4QDSA 3WG1A 1H6XA 4B1MA 5EIYB 3JB8A 1KDMA 5FZGA 1AUYA 3GCXA 3WDWA 4Q2FA 1HKDA 1TMF2 2LROA 4NWVA 1CWPA 2J1VA 1PK6C 1WW7A 2A5ZA 4H55A 4XC9A 4F8AA 4RD7A 2JD9A 4KBZA 1BEV3 3WSOA 2PYTA 2GC1A 3C7EA 2W9XA 3OPWA 2VQTA 2XJVA 4Q1PA 3L2HA 5CBLA 2WDBA 4HK8A 2GMMA 4JDNA 4QMAA 3NV3A 5DUWA 1QJY1 3D3AA 1LOGA 2PN5A 3TWIA 3JBG1 1AL23 2B5HA 3RI9A 5KXEA 1WGPA 2RS12 4IEXA 2ZGKA 1LHWA 1NKGA 1ENXA 1IHMA 3IZOA 4XOGA 3KV4A 5A6ZA 3DV8A 2H6CA 1UCXA 3LDBA 3AMNA 5F3GA 4AK3A 4ASKA 1OT5A 5LCWL 1S2EA 3TAYA 4EN7B 3VV1A 4QQ2A 3VZJA 4QKDA 2QUOA 2WZEA 1AZDA 3J9SA 1HB1A 2ARAA 3KV9A 1JN2P 3POFA 1MS8A 4D6RA 1QJU2 3B94A 1JOPA 1VR3A 4NVPA 1LHVA 2OIIA 1GZTA 2B9VA 4JTOA 3M2MA 2JG8B 1KRIA 4FPCA 3SISA 4XE9A 1OUSA 1A3KA 2WO2A 5T5PA 3ACIA 4GMP1 3ZFEA 1ZZBA 5FP4A 1WD4A 1ZRFA 5C8CB 4K7JA 2DWRA 4LO5B 1GZCA 2NYYA 4R52A 4DIQA 1LHNA 4DPNA 3UL2A 5T5OA 4ZU4A 3ALQA 1ZBA3 2D3PA 2P3IA 5KC5A 5HXMA 1HN0A 5I91A 1TE1B 5LZ6A 1UW8A 5JOXA 3S30A 2DVDA 1BK0A 1OLQA 3NJXA 5D8AC 3ZYPA 2GNTA 3N36A 4C0HA 4PCRA 1PM4A 4HSJA 1SLIA 3MLKA 1GWMA 4AHYA 5A3NA 3RZJA 1WMEA 3PUHA 5F5CA 3WP4A 4Q0VA 5I0DA 1NZCA 2Y6JA 2BPA2 3JCIA 1TME3 4YFWA 5CZKA 1NG0A 1J83A 2XKPA 3HT2A 2V5YA 3PU3A 2AYHA 2VNVA 4GH4A 1AYN3 1QXJA 4RYDA 3WDVA 1QJFA 5J09A 4Y4RA 1REDA 2R041 1RUJ2 2ZS6B 3I59A 4YLZA 1F31A 1YC61 1RMU3 3IDCB 4DQAA 1LKNA 1UXZA 4OCTA 3POBA 2OXBA 3OGGA 5D21A 1S1AA 4RHV1 2VUDA 5E89A 4MUVA 3OTFA 3VBHA 5KHHA 1K5MA 2QQKA 3H42B 4INDA 4ISRA 4KMQA 3JD72 1QJZA 1W9FA 2ET1A 2HBUA 3AJZA 3RWKX 4LKDA 2RR12 2FMYA 1QF3A 1D4M3 3ETPA 3U75A 5FCCA 1PGSA 2CGOA 4RQPA 5FUIA 1WLDA 3T1LA 5J96B 2W47A 3FX3A 4ZU5A 1ZRCA 3IPVA 4K40A 4XUPA 2DCKA 3MICA 5A7WA 3AXEA 1PGW1 3I2OA 3M3EA 2HWB1 4LBQA 3VBSC 2D6MA 4DS0A 2FMDA 4ZKTB 3POEA 1OD3A 2DV9A 4XQ4A 1RITA 1ODMA 5FP7A 2PAMA 2BU9A 5FPZA 1DHKB 4R9CA 1R1A1 2RS53 3NSTA 4WVVA 1CAVB 3AJYA 4NJ4A 4CEWC 4CA9A 3ZKYA 4BXSV 3DKQA 1W2TA 3TNQA 2AR6A 4CU7A 4MZUA 1Z0HA 2A6XA 1N47A 2OA2A 2E7QA 3KT1A 4KWJA 1IKPA 2VD7A 3VD3A 4FAGA 2WNUB 2JICA 2RM21 1UZYA 4KI5M 4XAEA 5ABJA 5FXXA 3J7LA 4M4PA 4YPJA 3E1F1 4Y1XA 2QVSB 3CJIB 4RFT0 3CDZB 2A6VA 3ORJA 3NW4A 4IEWA 4M0HA 2DU1A 4PLOA 2YDEA 4LBKA 4Y22A 1ZZ7A 2ILMA 3KQRA 2IXKA 4XFCA 1AL0G 1RUD2 1X8MA 2BJSA 4YM0A 1BCXA 1ZNPA 2VTXA 2HWE1 2D98A 3B69A 3OCPA 4IEVA 4LHKA 2HYXA 2NZ9A 1POQA 1QOTA 2IUWA 3F2ZA 4Y1VA 1SCSA 1DYOA 2ZX0A 5APAA 2R062 2VZQA 3NNFA 4OHVA 4YGEA 3WF0A 2VVEA 4HG6B 3WUCA 3KD4A 5CKMA 3GXUA 1IPJA 1YQ2A 2J7MA 3NQHA 4PIYA 1VBE3 2ZBJA 5FPBA 4D6QA 5BNOC 4BK4A 1I5PA 3MZHA 1BEV2 1O3SA 5IFTA 4CSWA 1S0GA 1WW4A 1GSLA 1VB2A 3AB0A 4IEUA 3LEIA 4QX0A 4XXAA 4AE2A 4EROA 5I0RA 3ZMOA 2EAAA 5IVEA 5FOBB 1RJ7A 1AL22 1EY2A 4OFGA 4QPIA 4IW3A 3WF4A 3I2HA 4AHXA 1STMA 3K3NA 5EYXA 2OYZA 3AZVA 4OHWA 1RUC1 4LOSA 1GYKA 1AYM3 2AH2A 2DVFA 3MIEA 1TEIA 4XF9A 3WUDA 5FOJB 4J25A 5EP9A 1GR3A 5FYMA 3ZIWA 1R1ZA 3ZFFC 1BQPA 2DVGA 1W3VA 1E5IA 4N53C 1N1YA 1CAUA 5DAVA 4A45A 4ARXA 3MPBA 2WS91 3VBOA 4DEVA 4L2NA 2QKDA 4NHKA 4NIAA 5IFPA 1YYNA 2ZACA 3VB9A 1TNRA 5BV6A 1WKYA 5GZCA 1UX6A 4CUCA 5GJ6A 2QQLA 4Q4W1 2FDIA 1BVP1 2WNVC 2NM1A 4CZSA 3V0AB 1GNZA 3ZYBA 5HBAA 3BTZA 2RJLA 2KXLA 2VR4A 3ZXDA 4RN5A 1PVXA 3CO2A 3UK9A 3PNAA 5J3UA 1UYPA 3I3DA 3I3MA 5FY7A 1KFXL 5FIXA 1XC6A 1VAKA 4UFJA 2BGOA 3USUA 5CADA 1JODA 1TZOA 4IETA 5FV3A 2P5BA 1N3QA 1NQJA 4UOJA 2D3RA 1RYYA 2W94A 3WNNA 3V64A 5F6LB 1UU5A 1ZBA1 2WZR2 4M01A 1VBB3 4IV1A 5C7GA 2QQVA 4UBHA 2VY0A 3OBRA 2HH9A 4S2HA 4LBOA 4AFMA 5BY5A 2VULA 1YQ5A 4R8HA 1AYN2 4AG4A 2DBNA 5FYTA 1F35A 1PHMA 3HBZA 2CAVA 5I93A 5JOWA 1W8NA 1XU1A 2EXKA 4DFSA 2J1SA 1AR73 1RMU2 2RDNA 2LRPA 5K0UB 4R9AA 4OZXA 3ZN6A 4UT5A 4ASMB 1GOFA 1TME1 4MHRA 1UWWA 2GP3A 4BQ5A 2CY6A 1VAVA 2BVBA 1W0PA 4WM7C 5DG2A 1ZA4A 2BFUS 3LWCA 2AUYA 2JB4A 4LPLA 5LRSA 4GA9A 3J8F1 1JOJA 1H8VA 3ZM8A 2D43A 2O14A 4BQXA 4CCCA 2VO5A 1ZZCA 3SKJE 1DBNA 2BBVA 1YQ8A 1IS5A 3N4MA 3FFQA 4EWEA 5LA9A 3MIFA 3U11A 2R49A 2VVFA 1HIXA 3AVSA 3OEBA 5H9SA 2X8KA 2HKXA 1SHWB 4OMCA 1OUXA 1SFPA 3M3QA 5E88A 5C3QA 2RS33 4C1XA 2GN3A 2E33A 1HJGA 3AP6A 2I2SA 2DUPA 2VW1A 2W39A 4OHXA 1NCQB 3UKVA 1S0CA 3W59A 2GSYA 4XZPA 2E51A 3RNSA 4E4ZA 1D4VB 1RUH1 2OT7A 2PHRA 2YFZA 3Q8EA 3ZFGC 1D4M1 3W21A 2FDGA 3BOWA 2QTWB 2XR4A 4TLGA 3PUIA 4PQ9A 1ND3B 3NV4A 2RS52 5IW0A 1TQ5A 1BXHA 3UV9A 4DINB 3SKVA 2QBXA 4Y20A 4XCAA 1UO9A 1WLCA 1PO13 2UYBA 2YC4A 2Y6FA 4Q8LA 5D8AA 3PTYA 4BYYA 1WCKA 5CG8A 2VMGA 5FMCA 1XYNA 2CDPA 4W4ZA 4ASLA 2XB6C 4Q8KA 4FFFA 3GCWA 2J1AA 2ORXA 3PMSA 1X33A 3U07A 3TEYA 2O8OA 4HKWA 3MF9A 5EQUA 3SMHA 1G8WA 2HWF2 5FYSA 1ULCA 3G6JB 4P9GA 5C33A 1OXCA 4XFGA 1FOD2 3GHMA 1S0BA 5BYNA 1F2NA 4QXHA 3PU8A 3IBMA 4CRQA 3VKMA 1VMHA 2VCAA 4FFHA 2B7YA 4E9KA 3QLQA 5L7OA 2DCYA 4RGGA 3WT3A 1BMV1 3MUZ1 3O0WA 4IERA 2FDKA 2R071 4GH4B 4CDQC 1F4AA 3I2DA 1I1EA 3K3OA 1NAEA 4AI2A 3F95A 5DPNA 4AQSA 1DDLA 1OVSA 3K4ZA 1VBE2 1QOOA 1RHI3 2OUJA 4G9SB 4UXAA 5BUVA 3M4FA 2NP0A 2VL4A 4K8RB 1ZRDA 2WR9A 1RUF3 1FMD1 4XQDA 2OQ7A 1LCLA 1DQ0A 1O91A 1JYXA 4XTPA 2DUOA 4OI4A 1GKBA 2IVJA 4XF1A 4MXWA 4QGNA 1OA2A 1I3HA 1QWRA 3VBHB 4Y4YA 3TOJA 3LSEA 4ES8A 4D6SA 5GM0A 3FLRA 1AYM2 2F17A 4FP2A 4BQ4A 1VBD1 2DDUA 2WNOA 3H3UA 1HLCA 3PURA 3VBSA 2XVLA 1X7NA 2GNMA 1NT0A 1U12A 1AR63 5IATA 1NCRB 4JX0A 2VUJA 4FOVA 1OI6A 2A7AA 3DL3A 4O61A 2V73A 5A7WB 4PI2A 2QQPA 5CYYA 1LOBA 4CCKA 1E5HA 2ZJCA 4LK7A 1UY2A 2BERA 2QNKA 3LGRA 3PUQA 4TN7A 4YRDA 3VBRC 4LBQB 1GLHA 1LOFC 2KM2A 4FI9A 2ZABA 3OUJA 3AP9A 2UWBA 3NNGA 1OKOA 4QXKA 4Q4V1 2DURA 1YEWA 3R6SA 4CXYA 3RMYA 5IT6A 3ZSLA 1IG3A 2JENA 5DABA 2JE8A 1S0FA 1LOAA 4LJHA 4NRPA 1JZ5A 4JRLA 2VTXJ 4BOWA 4BJ0A 1GP5A 1BVVA 4KWLA 1CIYA 4LTAA 5C3PA 2A6YA 1WMDA 2WRAA 4Y5TA 3T08A 1UYYA 2P3KA 2AC1A 3HPNA 1IPKA 1IS4A 2VJXA 3OYWA 2OQ6A 4BCUA 2OKXA 2W95A 4QPWA 3VDDB 4CU8A 2PQSA 1VBB2 1U5YA 2JDYA 2Q30A 4K6BA 2YG0A 4LUKA 2QZ2A 3O1TA 5JR2A 1ZRIA 3Q9OA 4V2VA 2Q1FA 2YBKA 2CGPA 2MEV3 3HNMA 4A3ZA 4AEJA 5AFBA 4CDUB 2IXIA 1ALYA 2D5FA 1JI6A 5BNOA 1RXGA 5FZ3A 1AR72 2CNAA 3N9LA 1VBB1 4Y26A 4RS5B 3BU7A 3ENRA 5FY8A 5CKQA 3C3VA 4AVCA 1D2QA 4HMZA 4B4RA 3PVBB 3ZXEA 2RVAA 1QMJA 1EV12 4K20A 1UMZA 1QKQA 4XETA 2WZPP 2WWSA 3O1VA 2JIGA 1QJY3 3WDUA 1CVNA 3RZZA 4AAXA 1SEFA 2CWMA 3BTAA 4A7KA 3JXSA 1H2KA 3NJZA 4V2WA 2E26A 3I2FA 4IXLA 5FXVA 1Q5OA 2XG3A 4QPIB 1LRHA 1W05A 5GLVA 1UPIA 4XJWA 1H2MA 4N53A 4CP9A 5IK5A 4OZOA 2XLFA 2GZWA 1D2SA 2Y60A 4XDOA 4OHZA 1CAWA 2WFF1 5B4NA 1M4WA 1W99A 2RS32 3VDBA 4ZZ8A 1DQ5A 3ZXJA 3U14A 3K48A 4JGZC 4S2DA 1X82A 1KS5A 3NRUA 3RZGA 3I97A 1COV1 2B9UA 3ACHA 2JDUA 3JQWA 1SZBA 1K5MC 1CAUB 2G4IA 2WNVA 2W1UA 4MVTA 3ZYFA 4CCMA 1P8JA 5E16A 4QPGC 1VBA1 3VBOB 5BNNB 2W46A 5CIRA 3TEWA 3HD8B 2CGNA 4GMP3 3S6PA 3T0DA 4FOYA 4PF1A 5CFDA 1PO12 1QGLA 3HQXA 4RQPC 4DRRA 4XEZA 1W9YA 5ACA1 2D7FA 2IXJA 1CAXB 1HXS2 3LFIA 4QQHA 3SH3A 1QDCA 1QU0A 2AEZA 3PJQA 4QT6A 4QX3A 2ETEA 1RTVA 5AFEA 1URXA 4ORFA 3PMEA 4JGYA 4QU1A 2AENA 5FP9A 5K7PA 1B35C 4F7ZA 4M3CA 1FNZA 3AP4A 2VQUA 2ZGTA 4Q1RA 4AFDA 2XBO1 4ET7A 2A1XA 4TLFA 1XNKA 2UURA 1O3RA 4LO7A 5EJ1B 4XDQA 4H2AA 2J1EA 1V6OA 4QDQA 4BPZA 5E8AA 3GZUC 3RMXA 5IHRA 2Y6LA 1PGL1 3K77A 5T52A 1XNCA 1O4ZA 5ANNA 3I3EA 5JSRA 3O1UA 2ES3A 1L7RA 2YBSA 1HQWA 5BPXA 5DG1A 4FFIA 2XJPA 1C1FA 1SLLA 2EIDA 3H7JA 1E5SA 1I6XA 2ARXA 3JB4C 3UKNA 4QKNA 1PK6B 2RJKA 5AC93 4KGQA 4EQVA 3PJYA 1WWYA 4J6GA 2DF7A 5F2SA 5ABJC 1A6CA 4EWDA 1NE4A 1W6QB 2TUNA 1D7PM 2H0BA 2VM9A 1W9SA 4HOOA 2YPDA 2D5HA 2LALA 4KU8A 1RUF2 1QJEA 4CCOA 3ZN6B 2XQRA 1VAMA 4Z2AA 2Y6KA 3KCCA 4XJ8A 4FXGB 4LNVA 1AXYA 4E27A 4YVWC 1Y4WA 3KM5A 4MHUA 3QOPA 1MS4A 2WO3A 4NPLA 4H3WA 2FCVA 1RHI1 1UQXA 4D7TA 2WWJA 3VUOA 1FYUA 3WW4A 2GN7A 1JUIA 1DGRN 1MEC1 4FPLA 3P3PA 3ZFGA 2X29A 3LSDA 2P3YA 2JEMA 2Y6HA 1AR62 2NMOA 3OGVA 1OMIA 2G9GA 4IQPA 1GFF2 1O5UA 1JZ7A 1XU2A 5FYCA 3H8OA 5K9YA 1OF3A 4AFAA 4GB33 3E6CC 1VJ2A 2PHFA 1UKRA 2FCTA 1F9KA 3PDQA 3THTA 1V6KA 3GM8A 3NV1A 1R1A3 1WW5A 4ZXEA 1T2XA 2P2KA 1J58A 4BK5A 3T0BA 1SLTA 3WQ1A 3C2UA 2D3SA 4LQRA 5LBBA 4ONUA 3KCYA 5CB7A 4AHWA 3N9NA 2I07B 2E31A 1ULOA 3WV6A 1UAIA 1ZZ9A 2EAKA 2XXZA 4BHPA 1NQDA 3K2OA 1N3OA 1JMUB 5JXJA 3AMPA 3DPRC 1OH3A 2EICA 2VOXA 2ZKLA 5F2WA 5GZFA 3GJBA 3VBFA 1POV0 2ZGQA 3I3BA 2GALA 5A3PA 2XOMA 3H7YA 5C3SA 1YI9A 4XFHA 3MW3A 2XUMA 3MV01 4G3YC 3D8CA 1S2BA 3GZTB 1LR5A 2BYVE 2DBIA 5LY1A 4CDQA 3GYDA 5IYYA 2VTFA 3EYPA 1YIFA 3BU0A 1J1LA 2VZVA 2HWD3 2YUEA 3EJKA 1OFSA 1W8FA 1G9CA 4C90A 3ZPYA 4GKYA 2HEWF 3OY8A 1GP6A 4ES9A 4NIGA 4CDWA 4WBBA 4P9LA 4BQ1A 1NZIA 3BYWA 1CGPA 5IK7A 4J1XA 1AJOA 2Q1ZB 2GH8A 2MEV1 5J48A 1Q43A 3B9CA 2DUQA 3LIHA 3O7OA 4LIVA 3B5LB 4IV1C 3ILRA 3KV5A 5FZBA 1QJY2 4M3CE 2X05A 1EPZA 5FZEA 1CZVA 1R64A 1SCRA 2DTWA 3GALA 1MPXA 3JBG2 2FD8A 3DF0A 4WM8A 2ZGUA 5FP8A 1MS9A 1GANA 1O8SA 2H0VA 2JD4A 4FPKA 3R05A 1RUC3 3I2KA 2CYFA 1W0NA 2JDZA 2GMPA 2FDHA 4HT1T 3FC0A 5I8YA 1SLCA 1J3PA 1V6IA 2JDPA 5FQ0B 4UAPA 3ZSKA 1PM7A 4GD4A 4GWMA 3VBRA 1ASJ1 5C9AC 1PIV1 1UYZA 2ZEZA 1LOFA 3ZXLA 4FAHA 2DVBA 4CUBA 2X5IC 1GV9A 3ZDSA 2ZGSA 1ULGA 4JKKA 4OMDA 2WS93 4LBLA 3VN4A 2G19A 3WF2A 1XBFA 3O0XA 3WNPA 3PVOA 3A0KA 1OOPC 3G7DA 2GDFA 1DZRA 2YHJA 2CV6A 4CVUA 4NOTA 1Y9MA 4Q4W3 1VLNA 4XF4A 4COVA 3HR9A 4RSUA 2HLEA 4EN9B 1U5IA 1PO21 4G4FA 3NL1A 4SLIA 4BQYA 3VBUC 5A1AA 2VG9A 2P4EA 2PAEA 3O0VA 4N43C 1RGSA 2Q8CA 3NNMA 4EYUA 1DIWA 5FDBA 3VD9A 2PXJA 1W9WA 3OB8A 1UOGA 4IE0A 3SCHA 2AREA 3ZDVA 3HOBA 1OD5A 4YW7A 4B29A 2EVXA 1KFUL 2ZX3A 5FZOB 4L9BA 5FR3A 1H1IA 1N1SA 2D6KA 3ZYGA 4XFBA 4GJYA 1W03A 1C4RA 4LK6A 3VHNA 4CU9A 3A22A 4D94A 2R042 4XBLA 3U0ZA 4LBMA 2C5DA 4CXWA 4N8MA 3BIEA 4A3XA 3U1XA 5FZKA 4OQ8A 4UFKA 2D97A 2IFRA 3A23A 3AFKA 5F5QA 3V0BB 2WFPA 4XJUA 4YW3A 3H1WA 4IV3C 4LKEA 4KWUA 4RHV2 3U10A 3FLPA 4NRMA 3VDCA 2PELA 5FZ8A 2EIEA 1M06G 1SBEA 2JDKA 4NHMA 3J8F3 4LUMA 1H1AA 3K4DA 1RVF1 1ZZ6A 3N9PA 4LORA 3RYKA 4DZGA 3UNPA 1TVGA 3B93A 5AC91 1JHJA 3VGIA 1OQEA 3W58A 2R7EB 5L7OC 1W6MA 5LBFA 3OUIA 4QHBA 5JLVA 3JUUA 5JOZA 4AWDA 3W5NA 4JGZA 3INAA 3ILFA 4J1WA 3U4SA 1QXPA 1K45A 5JSPA 1BYHA 2F4PA 2ET7A 3RS6A 3W5MA 4XHBA 4CP9B 2FZ1A 1IG0A 2R1BA 4MOAA 5IVYA 1PGW2 1X36A 4A7YA 2ZHLA 4QPGA 2HWB2 4BQ2A 2BZDA 2HJIA 3DYMA 1RUH3 1NLSA 4DY5A 3C7GA 1CD3G 4R4ZA 3C8XA 5KXDA 4XPVA 3BPZA 3AKRA 3CU7A 2J22A 5FYVA 1DQ1A 1UX7A 1ZBE1 4TTGA 1R1A2 2UWAA 1G9FA 1JOBA 2WNVB 1H8TB 2YYOA 4HETA 4UW5A 1PVC1 4LOTA 1FATA 4MGSA 1B35A 3U37A 4YW1A 4B3NA 2WAAA 5C4WC 1GQPA 2W2IA 4CCLA 3FBYA 4PI0A 1W0OA 3VKOA 3CNAA 4NRQA 1W90A 3KZ4C 5EXOA 4CU6A 3KGLA 5F3CA 2WT2A 4U2AA 1CZTA 3U78A 4GB31 1RJ8A 1KD7A 5M0TA 3AMQA 5FMOS 2RM22 3N7KA 4N90A 5G05L 1EAH1 3VHOA 2GC2A 2IXLA 2R16A 1WCUA 4GQ7A 3I7DA 5JWPA 2TBVA 3RJ2X 4WZFA 1JBCA 3N7MA 2V72A 3THPA 2B45X 4XFAA 1LEDA 4XBNA 2BWAA 4IESA 2HWE2 1RIRA 4BH9A 2RHPA 1Z7S1 3K75B 3H8XA 1H30A 3PIGA 3H9AA 4EN8B 1W6PB 2O1QA 2R073 1LHOA 3CF6E 2MPFA 1HX6A 2VH9A 3RVHA 1VRH3 2P1BA 3CZJA 4XUOA 4AXOA 4CDXB 1LODA 2ERFA 3OEAA 4W6XA 1JZ6A 5A7SA 2BW8A 1KEXA 1H9PA 1GICA 4YM2A 1WD3A 4YVWA 3ZSJA 3O1PA 3ES4A 4WM7B 5FK8A 1A8MA 1FMD3 3J7HA 5EYYA 5FMDA 3N3HA 3ACLA 4ZY9A 4BLJA 2HWD1 3SEEA 2X10A 3M1HA 4D3WA 4EZHA 4LT5A 1W8ZA 3DCQA 3E6BA 3LFMA 2D6LX 4HPKB 3JU9A 4XF0A 2WYSA 1DG6A 1UZZA 2JG8C 2Z42A 3AP5A 1WMFA 3AYCA 1RUC2 4XMIA 1BJQA 4B1LA 1UU4A 2ZMKA 4A44A 1VBD3 4FPYA 1SFYA 5C8CC 1CR7A 1PX4A 2K0GA 3CQOA 3EMRA 3ST7A 2VQAA 1DQ6A 3WHUA 4P00B 1FPN1 3B3QE 4Q0QA 1YO8A 1RUI1 5KXBA 3SH4A 1XJAA 1ND2B 2F4LA 4OQ9A 3WNXA 4O9EA 4DO0A 4FPFA 2WN2A 2WABA 2W92A 2WS92 4CTEA 4FCAA 4YW2A 1MACA 1VP6A 4MLOA 3L2YA 4XFFA 1IS3A 2PHUA 4JDOA 3X29B 2YZ4A 1SPPA 2WQ4A 2C26A 2SLIA 1GOGA 4Q0UA 5DDJ3 4Q4V3 4Q4W2 2R6QA 1KJRA 5LBEA 3DPRA 4AQ2A 2YBPA 2BFUL 4DRVA 3OGJA 2RDRA 4XIOA 3NMBA 1W6NB 4AF9A 1RUNA 2UY9A 4NAOA 5IJRA 2JDMA 5IVJA 3W20A 1KITA 4BISA 5JCTA 2RG4A 4OVEA 1IZ3A 5FJKA 2VZTA 4XYXA 5HV0A 3MGUA 3I2GA 3VHPA 3S7EA 4NR1A 3T09A 4JKLA 4QD2A 1E57A 1BZWA 1WBLA 1ZBA2 4PDWB 5FZDA 2G1MA 4QM9A 1S0DA 1WCDJ 1UMIA 5CFDC 4BB3A 2WQZC 4OI0A 4UFMA 2LS6A 3UKTA 1Q8QA 2ZOEB 4YW6A 1SDWA 3ZPOA 4XDPA 2VZ1A 1C57A 4AEMA 3MIBA 2KA3A 2ZXQA 5EV7A 5LBCA 2RMU1 4GZ9A 3HN1A 4UF0A 2N7GA 2RV9A 2LUWA 4HONA 4DUWA 3ROUA 1UU6A 2WQ8A 1D0HA 3OBZA 4JGYC 5FLHA 1CJDA 4I01A 4AI0A 1H4GA 2BQPA 3IB3A 3WP5A 5IVVA 1TME2 1YNAA 5BNPB 3OY8B 4WVMA 5IVCA 2YB7A 4DXTA 5A3UA 2V5DA 2I74A 4YVSC 3SCGA 3FWEA 3QBQA 5GKAC 3C7HA 3JZVA 3J8F2 1DQ4A 1PZ7A 2ZGOA 4ZS2A 5LASA 1W06A 4MG2A 5FTTC 4XJAA 3P3NA 3KMHA 4RFRB 4IEZA 5C9AA 3J4UH 2X5IA 3A7QA 4W50A 4Q4Y1 4E8CA 5CFCA 1HB4A 4AGGA 3E6DA 2WFF3 4CCDA 1OC1A 2VMIA 3HBKA 1OOPA 2H6BA 3DXUA 4XFIA 5HCHA 3WP6A 3AZZA 4RL7A 2YROA 2W1WA 1LESA 4A6OA 2A3WA 5H9QA 3FMGA 4P9XA 2CWSA 1RUH2 4QQOA 3VBRB 5FZ1A 5EJZB 1D4M2 1COV3 3SC7X 3B01A 2BGCA 1W2OA 5D2AA 1QJX1 1VBA3 4HANA 1U5XA 2JDAA 3POJA 3CJIC 3Q8BA 5F3EA 2VBDA 2BOJA 3VBUA 4WZCA 1YFXA 3T2PA 3TEZA 4FTEA 5F32A 4N43A 2JG9C 3ECQA 2Q8EA 5ACA3 2K9ZA 1UY4A 1V00A 2WLQA 3CLPA 4OUSA 4P9YA 4IEYA 4A41A 3EXUA 5T50A 4X8PA 5A6YA 1KJLA 3KWVA 5F8PA 2WJSA 2YXSA 1G7YA 5JVVA 1Y9QA 5C70A 1QNWA 3KVAA 4QX7A 3KSCA 3POSA 2XBO3 4COZA 4TZDA 4Z1VA 5J36A 3LA3A 4PQQA 4EN6B 4AVTA 1XRUA 3AL5A 3QH7A 3ZFEB 5ERLA 5IUQA 4XQWA 5FZCA 1LHUA 3OD0A 3Q8CA 4AVAA 2E6VA 5FZIA 3HAGA 3MFAA 3AZYA 1REEA 4RGKA 4AW7A 1O59A 4NHYA 4NHXA 4AEDC 1RUE1 2VW0A 2WA4A 4KBBA 1H6YA 1BMV2 1V6MA 5C71A 2VMCA 4L8QA 2ZX4A 2R072 4X6RB 5JSOA 3KLSA 2D6OX 3R4UA 4IV3A 4FXKB 3HN3A 5T5LA 3H0OA 1VRH2 2ARCA 3M8LA 1L3JA 4U36A 3RQ0A 3VBFC 5T54A 2UY8A 3UESA 2XJSA 2ZGRA 5IAVA 5FUPA 3R4SA 5FYBA 5JPMB 1OBNA 4BMEA 1FMD2 1HW5A 2C24A 2XUEA 2XMLA 2GNDA 5BNNC 3O1RA 1JYTA 4ZXKA 3UETA 1LOEA 2JDNA 5A1FA 4LO8A 1HB2A 5LK7B 4E4SA 1F15A 2A75A 2BNNA 2D93A 3SITA 1GZWA 1VRH1 2HEYF 3N9MA 2XWJB 2OVUA 4Q0PA 4CCJA 3I59B 4WVZA 4COWA 2B4KA 5GLZA 1BBT1 3NVCA 1UY1A 1VBD2 1WBFA 3D0SA 1MEC3 2JE7A 1SBDA 4FOWA 5FZ4A 3SEPA 4GWJA 5BNQA 3WHTA 1H1MA 4CDWC 2QQMA 3HQUA 4IE6A 4L0PA 3HJRA 4URTA 4ISQA 2WUHA 5A7OA 4B7KA 3B00A 1RUG1 3KQ4B 1U5ZA 1DLCA 2AZ5A 1UXXX 5GLUA 1YIPA 2PHWA 1K5MB 3M3IA 1YJLA 3OGSA 5H9RA 3WDXA 1UNBA 2YV8A 2VZOA 4BDVB 5FPXA 4LE4A 5E1RA 5A70A 4GKXA 3OBAA 1CESA 4I3GA 1SLAA 5GALA 5C4WA 5LRRA 3MDPA 2EIGA 2QQIA 2P37A 5I8TA 4WM8C 1UOBA 3I3QA 1ST8A 4LITA 4Q4V2 4RQPB 3WNKA 1MS5A 3TB0A 3UGGA 4CP0A 2JECA 2Q5TA 3AVRA 4FOQA 3WQBA 3IPVB 3SLIA 4AI9A 2QQWA 1QQP1 1SFNA 3D82A 4XUTA 5J98B 3LOBA 3RGBA 2RJ2A 1MVQA 3KF3A 3M7AA 3AM2A 4XW3A 5L9RA 4OYUA 2ZCWA 5FKBA 4B8EA 1HB3A 3BOPA 2BRTA 1LU1A 2Y33A 5FBJA 1NE6A 3CBNA 5DDJ1 5K0UC 1C8M1 2ZGLA 4JCKA 4BQWA 3DYOA 1MR5A 5ISLA 2HYKA 4FO9A 3ZXGA 4Q0SA 4R4XA 4ZHNA 4S2GA 2DU0A 1V9U1 1XE7A 4FFGA 1ZA7A 3RJRA 4JHZA 2PA7A 4ZONA 4CYDA 5IVFA 1OQ1A 4P5HA 1VMJA 3UJQA 1RL3A 5CAZA 1OKQA 1ZVFA 2TEPA 4XURA 5FO7B 3PUAA 5KHKA 4AVBA 4DXRA 4DEQA 2VC9A 3TN93 1S4CA 2XL9A 5ABJB 4K9SA 4I3PA 1ACCA 4JTNA 5GZEA 2OPWA 4Q29A 4V1PA 5SV5A 1REFA 5CG9A 4N9HA 4QX8A 4HXCA 4BM8A 4FT8A 3PIJA 4AZZA 3BN6A 4MXVA 2W5FA 1LEMA 2K2SA 2JG8A 5FZLA 3S5QA 3VZNA 4Y22B 2VVDA 4GIQA 3VD7A 3VD4A 1RXFA 1FV3A 4UFHA 1WZXA 3L9JT 1UY0A 4NIIA 4W8JA 3RWNA 5C8CA 3I2IA 1JUHA 4YZ3A 4YW4A 4XUQA 1NXMA 1IQAA 4GWIA 4OUEA 3RI8A 4Q27A 1CZSA 1IKQA 5A3WA 1V70A 4YFZA 5FZFA 1K5JA 2JDHA 4MSVA 1O4YA 2WFF2 5FYIA 2QE3A 2PHXA 1ASJ3 1NA1C 1PIV3 4XXPA 1FXZA 1OQDA 2A71A 3LDKA 3RYPA 1UD1A 5L9BA 4CCEA 1AR91 2WL1A 2VBPA 1NY71 3LOIA 3S57A 2DCTA 3N9OA 1COV2 1JH5A 2WAOA 2QDNA 3O1MA 2LM3A 1BK1A 2O8QA 3FHAA 4LHLA 4BIFA 2NMNA 4YZ2A 1VBA2 5GZGA 3I54A 4ATFA 3KT7A 1NX9A 3ZOIA 3AZWA 1R091 4D0QA 2D6NA 2CL2A 1SPPB 4QGMA 5FBZA 5F9TA 2HWC1 5ACA2 1PO23 2A3YA 2OX0A 2Y8KA 3ETQA 1LOCA 3K4AA 1POV1 1Q8OA 1DFQA 3ZKUA 3GHNA 3O5SA 3KCXA 4LE3A 4LR4A 3ZX7A 1HRI1 2SBAA 2OUHA 1SG3A 1WLTA 1Y3TA 2XBO2 1ULPA 2A6ZA 3JQXA 3M3CA 4UBGA 3AMMA 3ZN4A 3Q8FA 1VBC1 1UZ0A 2ATFA 5A7NA 3BKZA 4FP3A 5B4XA 3S0MA 3MBWA 3WNLA 1CQ9A 1PGL2 2VOKA 5KBFA 1AX2A 3BVCA 4M00A 2OZJA 2Y6GA 1NLRA 4PBOA 1YHFA 2JIJA 3IWZA 2Z79A 4AGVA 2CDOA 4WVWA 1IQDC 3DYPA 5A33A 5L9VA 4NHLA 2OS2A 1C1LA 2XDVA 3P6BA 3UGHA 3LDRA 3USUB 1MS1A 3C7OA 4ITCA 4YVSA 4UF0B 2KD7A 5A3TA 3WVJA 2E63A 3IT8A 4HKOA 4Y1ZA 5FLIA 4IV1B 4FQ4A 2ID4A 3VD5A 2PTMA 1NCRC 2I45A 4K1ZA 3ZMNA 3ZR6A 3SCFA 4WVMB 3V65A 1CAVA 1RVF3 3CJXA 4BLIA 3NAPC 5LEKA 1DGWA 3ELNA 2Y0OA 4CPBD 1CONA 4PIZA 1RHI2 1O3TA 5JIAA 2GNBA 3GDBA 1MEC2 4CPBA 1S55A 4BIOA 3PVEA 4EJRA 1YXWA 5GLWA 4NIHA 2WNUA 5C9AB 2HEVF 5L36A 5GLTA 3WG4A 1S0JA 2VCCA 2X5IB 2IVIB 5JMOA 1QDOA 4QB6A 2PMWB 4K21A 3D0JA 3CJIA 4CP2A 1OOPB 1BKZA 3LE0A 4OI1A 2VPVA 5JZGA 2YU1A 1HRV3 4IL7A 5EWSA 3ZYRA 3ABZA 2JG9A 5IVBA 2ZZQA 5CA6A 1ZBE3 3T2OA 2ADEA 4PJYA 3LB9A 1B09A 4W65A 1W2AX 3OJBA 4W6WA 3VDDC 4FSJA 1PVC3 4JC1A 5IWFA 3SXWA 1AXZA 4LMFA 3J7MA 2XLAA 1ZM1A 3VBUB 3ZYJB 3OBTA 3D4KA 4GXLA 4KQ7A 4XUNA 3T4VA 3VZKA 3WCRA 2JB8A 2ZEYA 4N43B 4AI8A 4CEYC 4CDUC 2VZPA 3EBRA 1DGLA 2G9FA 3ME2A 3ZVXA 2DFCA 2P6CA 3FJSA 4E2SA 1EAH3 4HL0A 3IDAA 5DAQA 2GP5A 4PT6A 5DZEA 5FP3A 1A34A 4SBVA 4AEDA 4R9DA 4RS5C 3ZO0B 1E5RA 3BCWA 3AK0A 1GNHA 4QQPA 1H2NA 1UZWA 1W8UA 4Y20B 2WWUA 5D8AB 4M3CF 1G9AA 5EZWA 4CXXA 4OLLA 2GAUA 4O7XA 4QXCA 4JQTA 4LHSA 5A7QA 5FRAA 2W1SA 4BA6A 2VXJA 1Z7S3 4LBJA 2YC0A 2LW8A 3ON7A 2K46A 3R4DB 4XILA 4B7EA 4BXFA 5K8SA 2UU8A 5IK8A 3WDYA 5FZHA 2OW4A 2VXRA 2ZX1A 2QFEA 4MGTA 4IV3B 5BXXA 4IE7A 1UF2C 5FFOC 1WCQA 4XACA 2BV4A 2MEV2 1AR81 1OPOA 1NOVA 4B4PA 1Z78A 1R081 3WZ1A 5LA2A 3TN91 3MW2A 3U4XA 5C6CA 1YLLA 2VOTA 5L7OB 3LA2A 2P17A 1T6GC 3M70A 3V0AA 2TNFA 4QM8A 5DUUA 4P02B 2FZ2A 1JZ3A 3GF6A 3HEIA 2MNGA 4PHZA 3POWA 5A3MA 3FBMA 3UT0A 4LO6B 3VZLA 1G9BA 3TBDA 4JDMA 2VCMA 2XQXA 1QNYA 1FPN3 3M3OA 1ASJ2 1RUI3 1PIV2 5B2GB 2CHHA 4MGYE 5FMBA 4QWNA 1C5HA 4IEOA 4H14A 4M0NA 1YFWA 4MXWB 3CL1A 5FWEA 2FDJA 5T3NA 1QIQA 4DOUA 5KC6A 4MGQA 4MYEA 5FY0A 4C8DA 1GQHA 2X53S 4IEPA 2WA3A 2D6PA 2IC1A 4FPGA 4N7IA 4QQLA 5C4WB 1GZ9A 2W87A 3VBSB 1XSQA 2XL7A 4AI1A 1PO22 3C7FA 1N3PA 3AL6A 1O7FA 1G6NA 5CFCC 5K0UA 1XNTA 3DXTA 1F5JA 1S0IA 3EQEA 2R063 1EP0A 4Y5Z0 5HV4A 1MZEA 2GU9A 4NPRA 5D1IA 5HCFA 1J3RA 3GZEA 3E97A 3WNMA 1Y9GA 1VIWB 2B8MA 5DQ0A 4LA2A 4CEWB 2VBBA 5CKNA 1YRZA 4AGRA 4AOCA 4NN0A 1DP0A 1OH4A 1SDDB 4XF3A 1PZ9A 1ULEA 4YYOA 5LA1A 4OI2A 5FY5A 3FHQA 1JYVA 3IAPA 3A0NA 1Q8VA 3BODA 2A3XA 2ZHNA 4HFSA 2QDRA 3GGLA 1TMF1 5DN2A 4I2OA 1ONAA 3LPFA 3MHZA 3ZIXA 4XIKA 2BP6A 4Z92B 2RMU3 3LCPA 1DF0A 4ATEA 1VPHA 1EPWA 2GC3A 3D6EA 4HLTA 5EJ3A 3IM0A 1NCQA 2UWCA 1CX4A 4I09A 1OPMA 3NJYA 3OYWB 2L9LA 5A80A 3VHRA 5JUVA 1KGYA 4E4HA 5KXCA 3RYRA 3T3YA 3N7LA 4IDZA 1XNBA 4QHOA 1W39A 2RS11 1ND3A 2A70A 2FBEA 3KHBA 4IEQA 5FMOL 3HVDA 3RDIA 5LW9A 4YARA 3AYAA 3BPSA 3TYJA 3VZMA 2QCSB 4AR2A 3AMHA 1RVF2 4P9WA 5AC92 3OUHA 3OSDA 4LLOA 3FL7A 3TEXA 3BB6A 3T2QA 5BNOB 3LEMA 2YMZA 3VDAA 1NA1A 4RR3C 3DKWA 1ULDA 1AHSA 3I2JA 2ORZA 4Q4Y3 1QJU1 2C0ZA 3T30A 3ZSEA 4GWNA 1DQ2A 2R1DA 2PHLA 5LA0A 1ODNA 1XSRA 4NMIA 5ANQA 1YJKA 1MQTC 1VB4A 2Q4SA 2PAKA 4JRAA 1HN1A 3AC0A 1VMFA 4P5YA 2VMEA 3AFGA 4YGBA 2WINB 1GBGA 1HRV2 1OLMA 3ZR5A 2YFUA 1ZYBA 4NO4A 1QJX3 1ZBE2 4KH9A 5FPUA 2J1UA 2WYFA 4HN1A 3ZFFB 2WZR3 2PHTA 3D5OA 3FUQA 1PVC2 4N53B 3V56A 3H8UA 4LA3A 5DZGA 3ZN5A 2VQ0A 1YFYA 4S2FA 4AYUA 1CAWB 4W6YA 2JXAA 3WP3A 1QHDA 5KHGA 1MS0A 3HQRA 2BGPA 1HRV1 3FHIB 4GB32 2Z69A 5JZGB 5CEHA 2VOVA 4Y3OA 3WOGA 1EAH2 2Y64A 2J1TA 4YWAA 4EV0A 1QH6A 3I49A 1TNFA 3KT4A 4QB1A 4YZ1A 1H9WA 3SQOA 1WA4A 5CVRA 2NPIA 4RA0A 4B4QA 1D0GA 1W8OA 3THCA 5CFDB 1YFUA 3O14A 4LIUA 4BMBA 1X9TA 1JTZX 1GP4A 3SNMA 1UMHA 1Y43B 1RUJ1 4PIXA 3S5AA 4I0WB 3LD8A 3RRDA 2VMHA 5DAPA 1RUE3 4AVSA 5JMCA 5F6KA 3ACGA 1Z7S2 4MGZE 5LB6A 2YY1A 1GWKA 2W52A 4JGYB 4XVHA 5A33B 1GQGA 4M3CB 1W6OA 4NIDA 3AZXA 3VKNA 5DZFA 4QU2A 2X09A 1NCRA 4CEWA 5IK4A 1XXNA 4EWAA 4O65A 2VMFA 4LBQD 5F5IA 4CP1A 4IGOA 1HQNA 2Y26A 3GZAA 4YVSB 3JD71 3NAPA 3EB7A 4TXWA 2Q8OA 1BLZA 2HWD2 2RR11 4KG0A 2HBTA 4Y24A 1A78A 3WINE 4AAPA 1SMVA 3SH5A 4N7UA 1PNFA 2D40A 2ZPXA 3RFRA 2YC2A 2V09A 5I0UA 5DAWA 3GNEA 1XNDA 1XOYA 5LK5A 5SV8A 2ENRA 4NROA 3WXPA 4D7YA 3FE5A 2QQOA 4LO4B 1VRBA 1BBT3 3NWKA 3LZZA 3VLBB 5JPNB 4QB2A 2QZ3A 2ZX2A 3RZMA 1MZ6A 2J1RA 1FPN2 3IAQA 3OPTA 4YG0A 4UWDA 2DYCA 1RUG3 1RUI2 4CUAA 2VU9A 2JJ6A 5FY1A 3FZ3A 3B02A 1CIWA 1GWLA 3POGA 2QQNA 4QDRA 3BUCA 3VDDA 2XKOA 2HWF3 2YGMA 1UZVA 2Q1MA 5KHJA 2IFWA 1XQNA 4GMP0 4HKLA 1C5IA 4YGCA 3RPQA 5L73A 3S7IA 2EXHA 3BGAA 1FOD3 1DLLA 2ZGNA 5I0SA 1Q3EA 4N9IA 5FZ9A 5JI7A 2BUKA 5EHDA 2JG9B 2VZ3A 4CEYA 1A8DA 3FFZA 5CNAA 4CDUA 2YGLA 5A32A 3MW4A 3WD5A 1NXD1 3ZFGB 5LWBA 1JYWA 4YM1A 1QQP3 2VNRA 1NLQA 2QQJA 4TSVA 3WR0A 3MPPG 3O12A 2VUCA 4RS5A 1GU3A 5FPVA 3HIFA 1N1VA 4HK9A 2EXJA 2VAUA 4M4RA 5I8SA 2P6HA 4UYBA 1MZ5A 4LEJA 1NYWA 1C8M3 1XE0A 2ZHKA 3GBGA 1F4HA 1LGBA 3CEWA 1RUD1 2OZ6A 3ZYHA 2BOIA 2GC0A 4P08A 1V9U3 4UW6A 4AEDB 2E7AA 3A4UA 4DB5A 3IN9A 2R061 4L97A 1UL9A 5EFUA 2EALA 5FXWA 4DXSA 5FUNA 3WG3A 4QKBA 2VE1A 1EUUA 1OLME 1WCSA 2BNMA 3R0RA 4FVVA 1US3A 3VKFC 2RMU2 4UFIA 4GALA 3SHRA 4C91A 1APNA 3VBFB 2CAUA 3HMYA 4HSLA 4I30A 1BEV1 3P5BA 3VL9A 1LNSA 5LEJA 3MIGA 2C4XA 2W1QA 4K3UA 5KHIA 2YPJA 3B7MA 1OA3A 3J7NA 1RINA 1ZX5A 1V0AA 2XH6A 3LPGA 4UI9L 5FO8B 1SACA 2PHDA 4XZUG 2AGSA 1AL21 2A6WA 2YU2A 4CDQB 5BNNA 1Q56A 3DEMA 4HBNA 4MGIE 1XE8A 4A2UA 3AKQA 4KWKA 1UIKA 5TSWA 1V6LA 4R9BA 4COUA 1KDKA 3POIA 1W2UA 3ZFFA 1CAXA 5HCBA 1W8WA 2BDRA 2XONA 5F7UA 2BWCA 3MIDA 1H8TC 4CDWB 1LGCA 1PX3A 4QX5A 4Q4Y2 1N1TA 1VALA 1AF9A 3TNPB 5JXHA 4D8MA 5T5JA 2Q0AA 1OHFA 3GBWA 3AKTA 1ZREA 1AR93 1AXKA 4O9GA 1MVEA 2EIBA 3EHKA 3GJAA 3KGZA 4URAA 2R30A 2JKXA 4JKMA 1YI7A 4QXBA 3WX5A 3WF3A 4IGQA 4WM8B 3NNJA 4QAWA 3ZXFA 1QJX2 1FV2A 1YCIA 5FYYA 1UOFA 1PNGA 2EXIA 2RDSA 3FLTA 4JZRA 1DYPA 1R093 3PVNA 4DXZA 1O5LA 2ZMLA 4H7LA 3USSA 4CCNA 2HWC3 1HDKA 1PK6A 4A42A 4YZ5A 3UJOA 1DU3D 2WNUC 2XVKA 4XJZA 3ITQA 3NO8A 5JI9A 4GULA 1POV3 4JQRA 4DNYA 1W6QA 1X50A 1V6NA 4JHTA 4UFLA 3IDEA 3A21A 1HRI3 1O4TA 2WZR1 4HN0A 5LATA 4CDXC 2CSGA 5JZGC 2WO7A 1VBC3 3APBA 2XJQA 3IMMA 1AYN1 1HJFA 2O0OA 1EV13 3WW2A 5FYZA 3UGFA 3T1MA 4IGPA 3ZXAC 3WF1A 1YUDA 4P9JA 5AVPA 1RMU1 2IZWA 1RUE2 4FTBA 4MX3A 4KG8A 5AVAA 4C1WA 5DAXA 1LGNA 4LHNA 2Z2SB 5A3OA 4AQTA 4LBNA 4KL1A 1DGRA 1W04A 1O8PA 5JIUA 1PZ8A 1OVPA 3ES1A 1S2KA 2WO1A 3AP7A 1JYIA 1OLRA 5C8WA 2EA7A 1JXNA 4XABA 2QQUA 4C0BA 1O6UA 5DUVA 1J1TA 2PQQA 5F5AA 3WQ0A 1UY3A 5DMYA 2WKKA 1QH7A 4HVRA 2OPKA 2R32A 4META 1ND2C 4K1YA 1LECA 1S0EA 1X8EA 2R0FA 3WG2A 4RR3A 2WSVA 2WLPA 5FY9A 2IXHA 5FK7A 4FPJA 1SLBA 2P3JA 3J26N 4IE5A 4PBPA 4BE3A 4D69A 3MF6A 3H50A 3ILNA 3QD6A 1BBT2 3MLLA 2C9AA 1H2LA 3LKJA 5FZ0A 4XCBA 1MQTA 3PL0A 3MFCA 3WCSA 3OG2A 1SBFA 1HXS3 3UYJA 3N9QA 1NA1B 3KF5A 4YG6A 1L7LA 4AVVA 1RUG2 4K8FA 2W91A 1FT9A 3LA7A 2BBAA 4AHZA 3URFA 1FX5A 1HV0A 4Y1YA 3POYA 1JZ2A 2RS51 1W8TA 2XHNA 2ZGMA 4QX2A 1DZQA 2KR2A 3AXDA 1DCSA 3PLQA 1QY4A 1CJPA 1W6MB 4GJZA 2W08A 1PMJX 4Z07A 2BNOA 5FPAA 2Q8DA 4Q4X3 4PDWC 4FPEA 1C8NA 3B9IA 2W68A 1J84A 4JGZB 4COYA 2RE9A 4E4DX 2V4VA 2DFBA 2BEOA 4NPMA 1MZFA 1QQP2 4GAZA 2ZEXA 5FY4A 4Z2WA 2HWF1 4HZFA 4QPGB 4X8NA 5JDBA 3NKTA 4EN0A 1RB8G 3H3ZA 2VZUA 1FOD1 2ZAAA 3BALA 3KVBA 4I02A 3H1YA 3NJVA 5DDJ2 2Z4FA 3MUY1 4Z8BA 1C8M2 2FDFA 4A6SA 1H0BA 2NQYA 5BNPC 4UW3A 2VUAA 3BTXA 3HNBM 3LEKA 1QXRA 2WNEA 2Y0IA 1XPWA 1GNYA 1V9U2 2PLV3 2Y34A 1B35B 2VOWA 1JU4A 4DUXA 1YQCA 4EZ4A 3WLUA 3I4IA 4OULA 1CX1A 5I0TA 3GBFA 1K3IA 3KV6A 4F3JA 1W9TA 3VKLA 3DGTA 5JXIA 2VZSA 2VCBA 5FQ0A 1VBE1 2NN8A 2W3JA 2BVVA 4BZ4A 2P34A 2ZMNA 1UYXA 2PFWA 5KR7A 3BTYA 1W6OB 5HCAA 1QEXA 1VE0A 2C1FA 2XVGA 5E6HA 2AACA 1AR83 1OURA 4MGKE 1R083 2NLRA 3NAPB 1AYM1 1ENSA 4AEKA 2WIIB 4YGDA 5EPAA 5C5TA 5IAXA 2MHFA 4YM3A 4YW5A 2RDQA 4QHZA 1JHNA 1GMMA 3RZHA 1YWKA 1OSGA 4KNCA 1BHGA 1US2A 4FQZA 5J37A 4L11A 4XJ9A 1NCQC 4YVWB 3LQCA 5HPOA 4AQ6A 2ZAHA 1PMIA 5FO9B 1JW6A 2ADDA 3DN7A 1AR92 3OPZA 4YG3A 1NY72 4BWOA 1ND3C 2XJRA 2WT0A 3WW3A 5GZDA 3CHXA 2V4AA 1AX1A 4QGLA 2E7TA 4QKFA 4Y1UA 2JKBA 3H3LA 5FZOA 2JX9A 2QJVA 3ATGA 3O1OA 2C6SA 3OD4A 5A1LA 1H4HA 1R092 3ZFEC 4YZ4A 4EE2A 5FZ7A 1Q8SA 1Q8PA 2WC2A 4YSFA 3KHCA 1O3QA 2BTVC 2XLGA 3ZYIB 5CISA 2HWC2 2J42A 3RG0A 4CEYB 5A32B 3ZSMA 2E32A 3K46A 1EUTA 3V0BA 1ZRRA 3E5UA 4HVOA 2DCZA 2IWGB 3IKWA 1AJKA 3IMNA 2D44A 5FYUA 5C3OA 1RUOA 2VMDA 1HRI2 2ZTNA 4E2GA 3CMGA 4LXLA 4X6QB 4XTMA 4I0AA 1CPMA 1UN1A 1VBC2 5FJHA 4LKFA 4Q26A 4MADA 1K12A 1GUIA 4IUGA 4ZS3A 1FI2A 1G86A 3CKHA 3E5XA 2A73B 2GMEA 3VZOA 5F3IA 5A6QA 3AKPA 3DPRB 1W28A 1YQ6A 1PMHX 1J3QA 3JBG3 1AR71 3MLJA 4Z82A 5FZAA 1TMF3 1AVBA 3MO4A 4GH4C 4AFBA 2G9ZA 3AX4A 4RGAA 3AKSA 3N35A 4F83A 1XB9A 2VECA 4XMAA 4XAAA 1JYNA 3Q8AA 1L7QA 2ARBA 4FBFA 1W8HA 5G04L 5FXZA 4A7ZA 1EV11 4IE4A 1ZZ8A 5F39A 3MIHA 2JWPA 1T6BX 3NKGA 5DUXA 1C28A 1UIJA 2CU5A 2RS13 4NWWA 4D7SA 5C3RA 3VBHC 3N7JA 2CTVA 1SQ4A 3ZXKA 1H8TA 1LJ7A 4BQ3A 2DVAA 5JOYA 1RC6A 3QACA 4Q5OA 5FZMA 1WLWA 2B46X 4PLNA 5H9PA 5F1RA 3ACFA 2RS31 2WT1A 2DTYA 3FUOA 3K51A 4KU7A 4PF5A 3CZUA 5JR7B 4CUGA 3WDTA 1LTEA 1U0AA 1I9RA 1QJU3 2ZZJA 3AYEA 4HVQA 4ZU7A 5A3LA 4ARYA 5C5UA 2DCJA 2JE9A 1HV1A 5HI0A 3NNLA 1FNYA 3EO6A 4FTSA 2XJUA 4AL9A 3QCWA 3LAGA 4MH0E 2XPJA 2ZA9A 1LU2A 1K42A 1PO11 3TRSB 3LEGA 4L99A 2ZKNA 4NAMA 2FCUA 1LULA 1HXS1 2F6BA 4LKSA 3RZKA 4OUMA 3ZLIA 4I0BA 1XNAA 3E5QA 4Q4X2 5K4LA 1AX0A 2XJTA 4NUBA 1W6PA 4MV2A 5CFCB 4LULA 4DMIA 1F8VA 1TG7A 1F5FA 2VZRA 2R043 4CDXA 4XBQA 5FREA 1FAYA 5CU1A 4QPYA 1ENRA 2AEYA 4Y33A 1KQRA 2EF6A 4WM7A 4A4AA 2ZHMA 4LLFA 4Q4X1 1LENA 1JYCA 3AYDA 3KS7A 4RHV3 1UKGA 4HPKA 4Y5SA 1W3XA 1OF4A 1WW6A 2PLV2 3WNOA 4MO3M 2FQPA 1RUJ3 3PTRB 2XHKA 3IIAA 2WN3A 4UW4A 3WY6A 4E2QA 2VW2A 3P1IA 5J1XA 3HNYM 3MYXA 5J7MA 1NUKA 3DUIA 3T2TA 5T55A 1W2NA 3W9AA 1DZTA 5FZ6A 3MV11 4KGGA 3WEZA 4CE8A 5LY2A 1QOSA 1JZ8A 1RUF1 1DYKA 4QX1A 3T4HB 1ULFA 1ND2A 4TYSA 5KWRA 1LB2A 4FPHA 2ZEWA 1UOJA 1X9PA 1OA4A 2PLV1 3H1MA 4P9IA 3NV2A 3JD73 4PLMA 4AI3A 4AFCA 2HWB3 1AR82 1C3HA 4DUVA 2C9KA
chains in the Genus database with same CATH topology
1CPNA 1MS3A 2RR13 1R082 3OF1A 3KB5A 3TN92 5DXDA 2WSUA 2VNOA 1Y7BA 4QPIC 1J59A 4RR3B 2B42B 2ZGPA 2E9QA 1W6NA 1AR61 5L19A 1CN1A 1EYBA 2GH2A 4P14A 1MQTB 2UYAA 3PHMA 1OFNA 1IOAA 1IS6A 1KXGA 2RM23 4L92A 2Z5WA 3I8TA 2VGDA 2R0HA 3WW1A 5JAXA 2XGXA 3VL8A 5BNNC 3VBOC 1KS4A 1HQLA 2B39A 2Y38A 4PDWA 4YNIA 1G9DA 2E53A 1GZWB 4WV8A 4XHXA 4JV4A 1WUVA 3HT1A 3HWJA 1UPSA 4JVAA 4H7MA 1XYOA 4FPOB 2W0XA 3MI8A 5HXVA 2FHRA 1DGWX 2HWE3 3IDBB 1I5ZA 2LTNA 2IXCA 4JAAA 3MEPA 3QH6A 1IGOA 3RSJA 3ASIA 5BNPA 1V6JA 3WQ7A 5FAXA 3BIWE 2XWBB 4DY3A 4OHYA 5FLJA 1ENQA 1RUD3 1XYPA 2VNGA 4TWTA 3WG1A 3JB8A 1KDMA 1AUYA 3WDWA 4Q2FA 1HKDA 1TMF2 4NWVA 1PK6C 1WW7A 2A5ZA 4H55A 4F8AA 4RD7A 1BEV3 2PYTA 2GC1A 2XJVA 4Q1PA 3L2HA 5CBLA 4HK8A 2GMMA 4JDNA 4QMAA 3NV3A 5DUWA 1QJY1 3TWIA 1LOGA 2PN5A 3JBG1 1AL23 2B5HA 3RI9A 5KXEA 1WGPA 2RS12 4IEXA 2ZGKA 1LHWA 1ENXA 1IHMA 4XOGA 3DV8A 2H6CA 1UCXA 4AK3A 3AMNA 3TAYA 4EN7B 3VV1A 4QQ2A 3VZJA 2QUOA 3J9SA 1AZDA 1JN2P 1MS8A 1QJU2 3B94A 1VR3A 4NVPA 1LHVA 2OIIA 4JTOA 3M2MA 2JG8B 1KRIA 4FPCA 4XE9A 1A3KA 5T5PA 3ZFEA 4GMP1 1ZZBA 1WD4A 1ZRFA 5C8CB 4K7JA 2DWRA 4LO5B 1GZCA 2NYYA 4R52A 1LHNA 4DPNA 3UL2A 5T5OA 4ZU4A 3ALQA 1ZBA3 2D3PA 2P3IA 5KC5A 5I91A 1TE1B 1UW8A 5JOXA 3S30A 2DVDA 1OLQA 5D8AC 3ZYPA 2GNTA 3N36A 4C0HA 4PCRA 4HSJA 1SLIA 3MLKA 4AHYA 1WMEA 3WP4A 4Q0VA 1NZCA 2BPA2 3JCIA 1TME3 4YFWA 1NG0A 2XKPA 3HT2A 2V5YA 2AYHA 4GH4A 1AYN3 1QXJA 3WDVA 5J09A 1REDA 2R041 1RUJ2 2ZS6B 3I59A 4YLZA 1F31A 1RMU3 3IDCB 4DQAA 1LKNA 3OGGA 1S1AA 4RHV1 5E89A 4MUVA 3OTFA 3VBHA 5KHHA 1K5MA 4INDA 4ISRA 3JD72 1QJZA 2ET1A 3AJZA 2RR12 2FMYA 1QF3A 1D4M3 5FCCA 1PGSA 2CGOA 4RQPA 1WLDA 3T1LA 5J96B 3FX3A 4ZU5A 1ZRCA 3IPVA 4K40A 2DCKA 3MICA 3AXEA 1PGW1 3M3EA 2HWB1 4LBQA 3VBSC 2D6MA 4DS0A 2FMDA 4ZKTB 2DV9A 4XQ4A 1RITA 5FPZA 2PAMA 1DHKB 4R9CA 1R1A1 2RS53 3NSTA 4WVVA 1CAVB 3AJYA 4CEWC 3TNQA 2AR6A 4MZUA 1Z0HA 2A6XA 1N47A 2OA2A 2E7QA 3KT1A 4KWJA 1IKPA 4FAGA 2WNUB 2JICA 2RM21 1UZYA 5ABJA 4Y1XA 2QVSB 3CJIB 4RFT0 5JZGB 2A6VA 4IEWA 3NW4A 4M0HA 4PLOA 2DU1A 2YDEA 4LBKA 4Y22A 1ZZ7A 2ILMA 3KQRA 2IXKA 4XFCA 1AL0G 1RUD2 1X8MA 4YM0A 1BCXA 1ZNPA 3B69A 2HWE1 2D98A 3OCPA 4IEVA 4LHKA 2NZ9A 1QOTA 4Y1VA 1SCSA 2ZX0A 2R062 4OHVA 4YGEA 2VVEA 3WUCA 3KD4A 1IPJA 4PIYA 1VBE3 2ZBJA 5BNOC 3MZHA 1O3SA 1BEV2 1S0GA 1WW4A 1GSLA 1VB2A 3AB0A 4IEUA 4XXAA 4AE2A 4EROA 5I0RA 3ZMOA 2EAAA 5FOBB 1RJ7A 1AL22 1EY2A 4OFGA 4QPIA 4AHXA 5EYXA 2OYZA 3AZVA 4OHWA 1RUC1 5FOJB 1GYKA 1AYM3 2AH2A 2DVFA 3MIEA 1TEIA 4XF9A 3WUDA 1GR3A 3ZIWA 1R1ZA 3ZFFC 1BQPA 2DVGA 4N53C 1N1YA 1CAUA 3MPBA 2WS91 3VBOA 4L2NA 2QKDA 4NHKA 1YYNA 2ZACA 1TNRA 5BV6A 5GZCA 1UX6A 5GJ6A 4Q4W1 1BVP1 2WNVC 2NM1A 4CZSA 3V0AB 1GNZA 5HBAA 2RJLA 2KXLA 3ZXDA 1PVXA 3CO2A 3UK9A 3PNAA 5J3UA 1KFXL 1VAKA 3USUA 5CADA 4IETA 1N3QA 1NQJA 2D3RA 3V64A 5F6LB 1UU5A 1ZBA1 2WZR2 4M01A 1VBB3 4IV1A 4UBHA 2VY0A 3OBRA 4AFMA 4S2HA 4LBOA 5BY5A 2VULA 4R8HA 1AYN2 4AG4A 1PHMA 3HBZA 2CAVA 5I93A 5JOWA 1XU1A 2EXKA 4DFSA 1AR73 1RMU2 5K0UB 4R9AA 4OZXA 3ZN6A 4ASMB 1TME1 2CY6A 1VAVA 2BVBA 1W0PA 4WM7C 5DG2A 1ZA4A 2BFUS 3LWCA 2AUYA 5LRSA 4GA9A 3J8F1 1JOJA 1H8VA 2D43A 1ZZCA 1DBNA 2BBVA 1IS5A 3N4MA 3FFQA 1AR82 4EWEA 3MIFA 3U11A 2R49A 2VVFA 1HIXA 5H9SA 2X8KA 2HKXA 3M3QA 5E88A 2RS33 4C1XA 2GN3A 4OHXA 3AP6A 3UKVA 2DUPA 2I2SA 2VW1A 2W39A 1NCQB 1S0CA 3W59A 2GSYA 4XZPA 2E51A 3RNSA 4E4ZA 1D4VB 1RUH1 2PHRA 3ZFGC 1D4M1 3BOWA 4PQ9A 1ND3B 3NV4A 2RS52 1TQ5A 1BXHA 3UV9A 4DINB 4Y20A 1WLCA 2UYBA 1PO13 5D8AA 4Q8LA 3PTYA 4BYYA 1WCKA 5CG8A 2VMGA 1XYNA 4ASLA 2XB6C 4Q8KA 3PMSA 1X33A 3U07A 2O8OA 4HKWA 3MF9A 3SMHA 1G8WA 2HWF2 1ULCA 3G6JB 4P9GA 5C33A 4XFGA 1FOD2 3GHMA 1S0BA 5BYNA 1F2NA 3IBMA 4CRQA 3VKMA 2B7YA 4E9KA 3QLQA 5L7OA 2DCYA 4RGGA 3WT3A 1BMV1 4IERA 3O0WA 2R071 4GH4B 4CDQC 3I2DA 1I1EA 4AI2A 4AQSA 1DDLA 1VBE2 1QOOA 1RHI3 2OUJA 4G9SB 4UXAA 5BUVA 3M4FA 2NP0A 1ZRDA 1RUF3 1FMD1 4XQDA 1LCLA 1DQ0A 1O91A 4XTPA 2DUOA 4OI4A 1GKBA 4XF1A 4MXWA 4QGNA 1OA2A 1I3HA 1QWRA 3VBHB 4Y4YA 3TOJA 3LSEA 4ES8A 5GM0A 3FLRA 1AYM2 4FP2A 1VBD1 3H3UA 1HLCA 3VBSA 2XVLA 1X7NA 2GNMA 1U12A 1AR63 1NCRB 2VUJA 4FOVA 1OI6A 2A7AA 3DL3A 2V73A 2QQPA 1LOBA 4CEWA 2ZJCA 2QNKA 3LGRA 3VBRC 4YRDA 4LBQB 1GLHA 1LOFC 2KM2A 2ZABA 3AP9A 2UWBA 4QXKA 4Q4V1 2DURA 3R6SA 3RMYA 5IT6A 3ZSLA 2JENA 1S0FA 1LOAA 4JRLA 4BOWA 4KWLA 1BVVA 4LTAA 2A6YA 1WMDA 2P3KA 1IPKA 1IS4A 3OYWA 4BCUA 3VDDB 1VBB2 1U5YA 2Q30A 4K6BA 4LUKA 2QZ2A 3Q9OA 2CGPA 2MEV3 5AFBA 4AEJA 4CDUB 2IXIA 1ALYA 2D5FA 5BNOA 1AR72 2CNAA 1VBB1 4Y26A 4RS5B 3BU7A 3ENRA 3C3VA 4AVCA 1D2QA 4HMZA 4B4RA 3PVBB 3ZXEA 1QMJA 1EV12 4K20A 1UMZA 1QKQA 4XETA 2WZPP 2WWSA 1QJY3 3WDUA 1CVNA 3RZZA 1SEFA 2CWMA 3BTAA 4A7KA 1H2KA 3NJZA 4IXLA 5GLVA 3ZFFA 1Q5OA 2XG3A 4QPIB 1LRHA 1UPIA 4XJWA 1H2MA 4N53A 5IK5A 2XLFA 2GZWA 1D2SA 4OHZA 1CAWA 2WFF1 1M4WA 2RS32 1DQ5A 3ZXJA 3K48A 4JGZC 4S2DA 1X82A 1KS5A 1COV1 2B9UA 3JQWA 3POSA 4MVTA 2WNVA 1K5MC 1CAUB 2G4IA 5E16A 4QPGC 1VBA1 3VBOB 5BNNB 5CIRA 3HD8B 2CGNA 4GMP3 3S6PA 4FOYA 5CFDA 1PO12 1QGLA 3HQXA 4RQPC 4DRRA 4XEZA 5ACA1 2D7FA 2IXJA 1CAXB 1HXS2 3SH3A 4QQHA 1QDCA 1QU0A 3PJQA 4QT6A 2ETEA 1RTVA 5AFEA 1URXA 4ORFA 3PMEA 4JGYA 2AENA 5K7PA 1B35C 4F7ZA 4M3CA 1FNZA 3AP4A 2ZGTA 4Q1RA 4AFDA 2XBO1 4TLFA 1XNKA 2UURA 1O3RA 4LO7A 4XDQA 1V6OA 4BPZA 5E8AA 3GZUC 3RMXA 1PGL1 5T52A 1XNCA 1O4ZA 5JSRA 2ES3A 1HQWA 5BPXA 5DG1A 2XJPA 1C1FA 1SLLA 3H7JA 3JB4C 1I6XA 2ARXA 3UKNA 1PK6B 2RJKA 5AC93 4KGQA 3PJYA 4J6GA 5ABJC 2DF7A 1A6CA 4EWDA 1NE4A 1W6QB 2TUNA 2H0BA 2D5HA 2LALA 4KU8A 1RUF2 3ZN6B 1VAMA 3KCCA 4XJ8A 4FXGB 4LNVA 1AXYA 4E27A 4YVWC 3KM5A 3QOPA 1MS4A 4H3WA 1RHI1 4D7TA 3VUOA 1FYUA 3WW4A 2GN7A 1JUIA 1DGRN 1MEC1 4FPLA 3P3PA 3ZFGA 2X29A 3LSDA 2JEMA 1AR62 2NMOA 1OMIA 2G9GA 4IQPA 1GFF2 1O5UA 1XU2A 5K9YA 4AFAA 3E6CC 4GB33 1VJ2A 2PHFA 1UKRA 1F9KA 3THTA 1V6KA 3NV1A 1R1A3 1WW5A 2P2KA 1J58A 1SLTA 3WQ1A 3C2UA 2D3SA 4ONUA 3KCYA 5CB7A 4AHWA 2I07B 3WV6A 1UAIA 1ZZ9A 2EAKA 4BHPA 1NQDA 1N3OA 3AMPA 3DPRC 2VOXA 5GZFA 2ZKLA 3VBFA 1POV0 2ZGQA 2GALA 3H7YA 1YI9A 4XFHA 3MW3A 2XUMA 4G3YC 3D8CA 1S2BA 3GZTB 1LR5A 2BYVE 4CDQA 3GYDA 1YIFA 1J1LA 2HWD3 2YUEA 3EJKA 1OFSA 1G9CA 4C90A 3ZPYA 4GKYA 2HEWF 3OY8A 4ES9A 4CDWA 4WBBA 4P9LA 4BQ1A 1CGPA 5IK7A 4J1XA 1AJOA 2Q1ZB 2GH8A 2MEV1 5J48A 1Q43A 3B9CA 2DUQA 3O7OA 3B5LB 4IV1C 3ILRA 1QJY2 4M3CE 1EPZA 1SCRA 2DTWA 3GALA 3JBG2 3DF0A 4WM8A 2ZGUA 1MS9A 1GANA 4FPKA 2H0VA 2JD4A 3R05A 1RUC3 2CYFA 2JDZA 2GMPA 4HT1T 3FC0A 5I8YA 1SLCA 1J3PA 1V6IA 5FQ0B 3ZSKA 1PM7A 4GWMA 3VBRA 1ASJ1 5C9AC 1PIV1 3ZXLA 1LOFA 4FAHA 2DVBA 2X5IC 1GV9A 3ZDSA 2ZGSA 1ULGA 3VN4A 2WS93 4LBLA 3O0XA 3PVOA 3A0KA 1OOPC 3G7DA 2GDFA 1DZRA 2YHJA 2CV6A 4NOTA 4Q4W3 1VLNA 4XF4A 4COVA 3HR9A 4RSUA 4EN9B 1U5IA 1PO21 4G4FA 3NL1A 4SLIA 3VBUC 2VG9A 2PAEA 3O0VA 4N43C 1RGSA 1DIWA 5FDBA 3SCHA 2AREA 1OD5A 4B29A 2EVXA 1KFUL 2ZX3A 4L9BA 1H1IA 1N1SA 2D6KA 3ZYGA 4XFBA 1C4RA 3VHNA 4D94A 2R042 4XBLA 3U0ZA 4LBMA 2C5DA 4A3XA 2D97A 2IFRA 3AFKA 5F5QA 3V0BB 2WFPA 4XJUA 4YW3A 3H1WA 4IV3C 4RHV2 3U10A 3FLPA 2PELA 1M06G 1SBEA 4NHMA 3J8F3 4LUMA 1H1AA 3RYKA 1RVF1 1ZZ6A 4DZGA 5AC91 3B93A 3VGIA 3W58A 1OQEA 5L7OC 1W6MA 4QHBA 5JLVA 3JUUA 5JOZA 4AWDA 4JGZA 3INAA 3ILFA 4J1WA 1QXPA 5JSPA 1BYHA 2F4PA 2ET7A 3RS6A 4XHBA 2FZ1A 2R1BA 1PGW2 1X36A 4A7YA 2ZHLA 4QPGA 2HWB2 2HJIA 1RUH3 1NLSA 4DY5A 1CD3G 4R4ZA 5KXDA 4XPVA 3BPZA 3AKRA 3CU7A 1DQ1A 1ZBE1 1R1A2 2UWAA 1G9FA 2WNVB 1H8TB 2YYOA 4HETA 4UW5A 1PVC1 1FATA 1B35A 4YW1A 4B3NA 5C4WC 3FBYA 1W0OA 3VKOA 3CNAA 3KZ4C 5EXOA 3KGLA 2WT2A 4U2AA 4GB31 1RJ8A 1KD7A 3AMQA 5FMOS 2RM22 3N7KA 4N90A 1EAH1 3VHOA 2GC2A 2IXLA 2R16A 4GQ7A 3I7DA 5JWPA 2TBVA 3RJ2X 4WZFA 1JBCA 3N7MA 3THPA 2B45X 4XFAA 1LEDA 4XBNA 2BWAA 4IESA 2HWE2 1RIRA 4BH9A 2RHPA 1Z7S1 1H30A 4EN8B 3H9AA 1W6PB 2O1QA 2R073 1LHOA 3CF6E 2MPFA 1HX6A 2VH9A 1VRH3 4AXOA 4CDXB 1LODA 2ERFA 4W6XA 2BW8A 1H9PA 4YM2A 1GICA 1WD3A 4YVWA 3ZSJA 3ES4A 4WM7B 1A8MA 1FMD3 5EYYA 3N3HA 3ACLA 4BLJA 2HWD1 3M1HA 4D3WA 4LT5A 3E6BA 4HPKB 2D6LX 3JU9A 4XF0A 1DG6A 1UZZA 2JG8C 2Z42A 3AP5A 1WMFA 3AYCA 1RUC2 4XMIA 1BJQA 1UU4A 2ZMKA 1VBD3 4FPYA 1SFYA 5C8CC 1CR7A 2K0GA 3ST7A 2VQAA 1DQ6A 3WHUA 1FPN1 3B3QE 4Q0QA 1YO8A 1RUI1 5KXBA 3SH4A 1ND2B 3WNXA 4O9EA 4FPFA 2WS92 4CTEA 4FCAA 4YW2A 1MACA 1VP6A 4MLOA 3L2YA 4XFFA 1IS3A 2PHUA 4JDOA 3X29B 2YZ4A 2WQ4A 2SLIA 4Q0UA 5DDJ3 4Q4V3 4Q4W2 2R6QA 1KJRA 4AQ2A 3DPRA 2BFUL 4DRVA 3OGJA 4XIOA 1W6NB 4AF9A 1RUNA 2UY9A 1KITA 5JCTA 4OVEA 1IZ3A 4XYXA 3MGUA 3VHPA 3S7EA 4NR1A 4QD2A 1E57A 1BZWA 1WBLA 1ZBA2 4PDWB 4QM9A 1S0DA 1WCDJ 5CFDC 2WQZC 4OI0A 3UKTA 1Q8QA 2ZOEB 1SDWA 1C57A 4AEMA 3MIBA 2KA3A 5EV7A 2RMU1 3HN1A 2N7GA 2LUWA 3ROUA 1UU6A 1D0HA 4JGYC 4AI0A 5FLHA 1CJDA 4I01A 1H4GA 2BQPA 3WP5A 1TME2 1YNAA 5BNPB 3OY8B 4WVMA 2I74A 4YVSC 3SCGA 3FWEA 3QBQA 5GKAC 3JZVA 3J8F2 1DQ4A 1PZ7A 2ZGOA 5FTTC 4XJAA 3P3NA 3KMHA 4IEZA 5C9AA 3J4UH 2X5IA 4Q4Y1 5CFCA 4AGGA 3E6DA 2WFF3 2VMIA 1OOPA 2H6BA 4XFIA 3WP6A 3AZZA 4RL7A 2YROA 1LESA 2A3WA 5H9QA 3FMGA 4P9XA 2CWSA 1RUH2 4QQOA 3VBRB 1D4M2 1COV3 3B01A 2BGCA 1QJX1 1VBA3 4HANA 1U5XA 3CJIC 3VBUA 4WZCA 1YFXA 4FTEA 4N43A 2JG9C 3ECQA 5ACA3 2K9ZA 1V00A 2WLQA 3CLPA 4OUSA 4P9YA 4IEYA 3EXUA 5T50A 4X8PA 1KJLA 2WJSA 2YXSA 1G7YA 5JVVA 1Y9QA 1QNWA 3KSCA 2XBO3 4COZA 4TZDA 4Z1VA 5J36A 3LA3A 4EN6B 4AVTA 1XRUA 3QH7A 3ZFEB 5IUQA 4XQWA 4AVAA 1LHUA 3OD0A 2E6VA 3HAGA 3MFAA 3AZYA 1REEA 4AW7A 4AEDC 1RUE1 2VW0A 2WA4A 4KBBA 1BMV2 1V6MA 4L8QA 2ZX4A 2R072 4X6RB 5JSOA 3KLSA 2D6OX 3R4UA 4IV3A 4FXKB 5T5LA 3H0OA 1VRH2 3M8LA 3RQ0A 1L3JA 4U36A 3VBFC 5T54A 2UY8A 2XJSA 2ZGRA 3R4SA 5JPMB 4BMEA 1FMD2 1HW5A 2GNDA 4ZXKA 1LOEA 4LO8A 5LK7B 4E4SA 2A75A 2BNNA 2D93A 3SITA 1GZWA 1VRH1 2HEYF 2XWJB 2OVUA 4Q0PA 3I59B 4WVZA 4COWA 5GLZA 1BBT1 3NVCA 1VBD2 1WBFA 3D0SA 1MEC3 2JE7A 1SBDA 4FOWA 5BNQA 3WHTA 1H1MA 4CDWC 4URTA 4B7KA 4ISQA 3B00A 1RUG1 1U5ZA 2AZ5A 5GLUA 1YIPA 2PHWA 1K5MB 3M3IA 1YJLA 5H9RA 3WDXA 2YV8A 5FPXA 4LE4A 5E1RA 4GKXA 1CESA 4I3GA 1SLAA 5GALA 5C4WA 5LRRA 3MDPA 2EIGA 5I8TA 2P37A 4WM8C 4RQPB 4Q4V2 1MS5A 3TB0A 4CP0A 2JECA 2Q5TA 4FOQA 3IPVB 3SLIA 1QQP1 1SFNA 3D82A 3LOBA 5J98B 1MVQA 3M7AA 3AM2A 4XW3A 4B8EA 2ZCWA 3BOPA 1LU1A 1NE6A 5DDJ1 5K0UC 1C8M1 2ZGLA 4JCKA 1MR5A 2HYKA 4FO9A 3ZXGA 4Q0SA 4R4XA 4S2GA 2DU0A 1V9U1 1XE7A 3RJRA 2PA7A 4CYDA 1OQ1A 4P5HA 3UJQA 1RL3A 5CAZA 1OKQA 1ZVFA 2TEPA 5FO7B 5KHKA 4AVBA 3TN93 2XL9A 5ABJB 4K9SA 4I3PA 4JTNA 5GZEA 4Q29A 4V1PA 5SV5A 1REFA 5CG9A 4N9HA 4BM8A 4FT8A 4MXVA 1LEMA 2K2SA 2JG8A 3VZNA 4Y22B 2VVDA 4GIQA 1FV3A 3L9JT 3RWNA 5C8CA 1JUHA 4YZ3A 4YW4A 1NXMA