4YVSA

Crystal structure of the virus-like particle of a c4 strain ev71
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
226
structure length
226
Chain Sequence
SHSTAETTLDSFFSRAGLVGEIDLPLEGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGEVVPQLLQYMFVPPGAPKPDSRESLAWQTATNPSVFVKLSDPPAQVSVPFMSPASAYQWFYDGYPTFGEHKQEKDLEYGACPNNMMGTFSVRTVGTSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSIKPTGASRTAITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Yeast-Produced Enterovirus 71 and Enterovirus 71/Coxsackievirus A16 Chimeric Virus-Like Particles Provide the Structural Basis for Novel Vaccine Design against Hand-Foot-and-Mouth Disease
pubmed doi rcsb
source organism Enterovirus a71
molecule tags Virus
molecule keywords Capsid protein VP1
total genus 35
structure length 226
sequence length 226
chains with identical sequence D, G, J, M
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4yvsA00
4NWWA 5DDJ1 1VAKA 4LLFA 4WM8B 1EAH1 1AR71 4Q4Y2 5FMOL 1NA1B 5K0UC 3VBFA 2X5IB 1ND3A 1VBE3 4AEDB 2BFUL 5L7OA 5C9AC 3ZFGB 2GH8A 2RS51 1FPN1 2WS92 2RM21 1AR63 5ABJC 1RHI3 5AC92 3VBRA 2X5IC 2WFF2 1RUH1 1ASJ2 1BBT2 5C4WB 5CFCB 4RS5C 2R061 1RUC2 1OPOA 1BBT1 3NAPB 2WZR1 1VRH2 1MEC2 5LK7B 1AYN3 3DPRA 4RS5A 4RHV2 5C8CB 4RS5B 1M06G 4CDQC 1PGL2 1HRV2 4CEYA 1FPN3 1B35C 1GFF2 4QPIC 1HRV1 1QJU1 4IV3C 1ASJ3 1RMU3 1B35A 1ZBA1 3VDDB 3ZFGA 4NWVA 3J8F3 2HWE2 3ZFFA 1QJU2 1AYN2 1FMD3 2R071 1AYM2 1ND2A 1RUF2 1HX6A 2HWB2 1NA1A 1BEV2 3JB8A 4RR3A 1PGW2 1RUG1 1POV3 4Q4V3 1RUD1 4Q4W1 4JGYA 4AEDC 2XBO3 4IV1A 2WFF3 1RUD2 1RUJ1 1HRI2 3S6PA 1Z7S1 4WM8C 1VBC2 2RR11 5C4WC 1VBC1 4IV1C 5JZGA 1R091 4CDWB 5DDJ2 1RUJ2 4FTSA 4CEWB 2ZAHA 2R042 2RS32 4GB32 2TBVA 4CDUA 5BNNC 4GH4A 1NCRA 5JZGC 1MQTB 2HWB3 2Y26A 1QJZA 4WM7C 4YVSA 4Q4V1 1V9U1 4CDQB 1HRV3 1AR92 1X33A 1AL23 1NCRC 2QQPA 3TN92 1W39A 5K0UB 1FOD3 1OOPA 3ZFEA 1NCQA 5CFDA 2PLV3 2BBVA 1QJX3 1PO11 1NY71 4JGZC 1PIV2 1WCDJ 5GKAC 1MEC3 5BNOB 1PO21 1R1A3 2XBO1 4RHV3 1RUI1 4N43B 5BNPA 5CFCC 2RS33 1AR82 5A33A 5ACA2 1Z7S3 1PGL1 4Y4YA 4Q4V2 3ZFFC 1VBD1 1AL22 1VBB1 1FPN2 2WS91 1RUD3 3NAPA 2WZR3 1VBC3 4JGZB 4JGYC 1ASJ1 1RUH2 5DDJ3 1RUJ3 3IDEA 1TMF2 4RQPA 4GB33 4CDWC 1QQP3 1AUYA 1R1A2 1TME1 4N53C 2RS31 1AYM3 1RUF3 3ZFFB 1R092 3JD72 1AR93 3VDDA 4QPGB 1B35B 1D4M2 1ZBA3 5BNNA 2MEV3 2RMU2 4Q4X1 1HRI1 1HQNA 4RFT0 1VB4A 2XBO2 4WM7A 2FZ1A 4FTBA 1F2NA 2PLV2 2ZZQA 4CEYB 1HRI3 1PIV3 1RVF1 2HWC2 3VBUB 2RS12 1RUG2 4EJRA 4GMP0 1NCQC 1RUE3 5CFDC 4CDXC 1AR61 1QJY3 1ZBE3 2R043 1PVC2 2R072 5ACA3 1F8VA 2HWC1 1R082 1VBB3 4CDXA 1VBE2 1NG0A 1C8M1 3VBOA 3VBUA 5CFCA 1RHI1 5D8AA 2MEV2 2RMU3 1NA1C 4GB31 3VBRB 1BBT3 3HAGA 1QJX2 4FSJA 4AEDA 4Y5Z0 1AR91 1ND3B 3VBFB 1V9U2 3VBRC 1QQP2 2X5IA 1OOPB 3ZFEB 4WM8A 1COV1 1AR73 5K0UA 1QJY2 1ZBE2 2HWF1 1PVC3 2R073 4RHV1 2BPA2 1ND3C 3CJIB 1RB8G 4RQPC 1EV13 1TMF1 1NCRB 5BNOC 2VQ0A 4CDUB 4N53A 3DPRC 2R062 1EAH2 4PDWC 4BCUA 4GMP3 1HXS1 3JBG1 2RM22 1CJDA 4PDWA 3VBSA 1C8NA 4Q4W2 4CEYC 4PDWB 4QPIA 1OOPC 3ZFEC 1RUE2 1K5MC 4IV1B 1AL0G 4IV3A 3CJIC 4CEWC 2HWD1 1AYN1 5FOJB 2WLPA 2HWE1 3CJIA 2RR13 1PIV1 2BUKA 1C8M2 1ZBA2 1EAH3 1R081 3ZXAC 5A32A 1NCQB 5CFDB 1FOD1 1AR81 1VB2A 2RS53 2RMU1 4Q4X2 1RUC1 1PO22 3M8LA 1V9U3 2HWC3 1H8TC 5D8AB 3NAPC 1RMU2 3VBHB 4YVWA 4RR3C 3JBG3 4N43C 2HWE3 1EV12 5C8CC 1POV1 3TN91 1FMD2 4YVWC 5L7OC 5C9AA 4CDWA 4FTEA 1BEV1 5FMOS 2RR12 5ABJA 4CDUC 5C8CA 3TN93 1FOD2 3J8F1 4YVSC 5AC91 4YVWB 2HWF3 2R041 2RS52 5C4WA 1TME2 2IZWA 4Q4W3 4JGYB 1PO23 2WWSA 2XPJA 5BNNB 1RUF1 4RR3B 1QJX1 3VBSC 1AR72 1MQTC 4Q4Y1 1K5MB 1COV3 1AR83 1ND2B 5L7OB 4QPGA 1K5MA 4SBVA 2BFUS 2R063 1PO12 1VBD2 4Z92B 5BNPC 4QPGC 1VBE1 5J98B 1HXS2 2HWB1 4GMP1 4RQPB 2RM23 1VBA1 2HWD3 4JGZA 1RUI2 1X36A 1RUE1 1RUH3 4QPIB 3VBSB 1RUC3 1ND2C 5C9AB 3JBG2 1VRH3 3JB4C 1QJY1 1ZBE1 3VBHC 1R1A1 5ABJB 1COV2 1POV0 5A33B 3DPRB 1MEC1 1R093 5BNPB 1VRH1 1SMVA 3VBHA 1C8M3 1Z7S2 1PO13 1NOVA 1VBD3 1FMD1 4N43A 3JD71 2WFF1 1EV11 5BNOA 2HWF2 3VDDC 1VBA3 2MEV1 4Q4X3 1AL21 1RUI3 1RHI2 2RS13 1RUG3 2WZR2 1PGW1 1RVF3 3FBMA 1E57A 5A32B 1CD3G 5ACA1 4GH4C 1AYM1 4CDQA 1TMF3 2ZTNA 1DDLA 1QJU3 1H8TB 4YVSB 1R083 4IV3B 4Q4Y3 1VBB2 3VBOB 1MQTA 1QQP1 4CDXB 1RMU1 4GH4B 4CEWA 1BEV3 1BMV1 3JD73 1HXS3 5JZGB 1D4M3 1OHFA 2FZ2A 3LOBA 2HWD2 1PVC1 2WS93 1AR62 3VBOC 5AC93 1VBA2 1TME3 3VBUC 3ZFGC 5D8AC 1D4M1 1IHMA 2RS11 1BMV2 2GSYA 1RVF2 1NY72 1A6CA 2PLV1 5J96B 4WM7B 4N53B 2DF7A 3J8F2 1H8TA 3VBFC
chains in the Genus database with same CATH superfamily
2GDFA 4H7MA 4LLFA 4WM8B 1UX7A 3PU3A 3KB5A 4G4FA 3FL7A 1O6UA 1U5ZA 3KS7A 1CAVB 2DUQA 3JXSA 4QDSA 4F8AA 3IIIA 2V09A 3GYDA 1UYPA 1OT5A 1Q56A 3KCXA 2JIJA 4FPLA 4INDA 5FZ4A 4AEDB 4FI9A 4EWAA 5L7OA 3R4DB 4XILA 3CL1A 2RS51 1AR63 2WO2A 1RHI3 4LLOA 4AVVA 2Z4FA 1V6KA 1RUH1 4PIXA 3I3QA 1BBT2 4URTA 3O5SA 3SH4A 4IE4A 4H2AA 4FQ4A 4XFAA 3H50A 4QXHA 5FZ6A 2WZR1 1XNTA 2PXJA 1VRH2 1CONA 1MEC2 1U5XA 4AL9A 4YARA 5DAWA 3N7KA 2YC0A 3EBRA 4X6RB 1H4HA 2WC2A 5TSWA 2R0FA 4YGBA 1D2QA 1YO8A 2VMCA 2ZHKA 4EROA 1LESA 2ORXA 5C8CB 5EV7A 2JG8A 3AMHA 3IMNA 3I2JA 4AVTA 1H8VA 2PYTA 3IWZA 5F2WA 1PGL2 4NO4A 3NNJA 4NOTA 4MGSA 1IS3A 5A6ZA 4B29A 3PTRB 4L2NA 3ZKUA 3LAGA 4JAAA 1RUNA 4CEYA 4A6SA 4LE4A 3NV1A 4QPIC 1IPJA 4XAEA 2VMIA 2UU8A 3J7HA 3MIFA 5DUXA 3V0BA 2D3SA 3KZ4C 4BLIA 5T5JA 4FBFA 5HV4A 4OQ8A 1Y9MA 4RGAA 3T3YA 1GSLA 1Q5OA 3MF6A 3AXDA 4BYYA 5EP9A 5JMCA 1WKYA 2DFBA 1A3KA 2ZABA 2ZACA 1Q8VA 4D7TA 2GNMA 3BN6A 4Q0VA 1H2MA 1UOJA 4BOWA 1UQXA 3ZO0B 1UU5A 2Y60A 3SQOA 4HN1A 3CQOA 1RC6A 1AYM2 4IGPA 2D3PA 4XZUG 3H8UA 2HWB2 2W94A 2RE9A 4E2GA 5LBBA 5FQ0B 5F37A 1LKNA 1PGW2 2VOWA 3DYMA 3BPZA 3ZMOA 2E33A 3I2DA 2YHJA 4JGYA 3E6DA 1LAJA 3HJRA 5HCFA 2VCCA 1W2UA 3KT1A 3BYWA 5L73A 3D4KA 3MEPA 5IK7A 3NQHA 4ZHNA 4M3CA 2D44A 1Z7S1 1VBC2 3ETQA 1S0CA 3VZLA 4OULA 5EWSA 2RR11 1VBC1 5DAPA 3CZJA 1L7RA 1R091 5DDJ2 3ENRA 1GP6A 2IXHA 1O59A 1V6OA 2L9LA 1UU6A 2ES3A 2ZAHA 4GB32 2QUOA 4D3WA 3TRSB 2YBKA 4CPBA 4K3UA 3ZXKA 3M3IA 4W50A 2UWCA 3OCPA 2Y26A 5C3OA 1K12A 3LIHA 1YHFA 5FXWA 2HEVF 3BTYA 1LU1A 4Q4V1 4CDQB 5JOXA 2WFPA 3WD5A 1ULFA 2JJ6A 2FCUA 4NHKA 5FZHA 3B7MA 4PLOA 1SDDB 4MYEA 4B4RA 2E6VA 3O12A 2BVBA 3FFZA 3WR0A 1LJ7A 1O7FA 1APNA 1XSRA 2GNBA 4LHNA 5CFDA 2PLV3 1TEIA 3ZYJB 3M3EA 3POGA 1STMA 3ZMNA 1OLRA 1QJX3 5A1LA 2W08A 4GZ9A 3W58A 1GZ9A 3E6CC 1PIV2 3EO6A 1DQ0A 1QJEA 2DVBA 1HN1A 5FY9A 3V0BB 2V5YA 3ZXDA 5BNOB 3ZPYA 2JWPA 2R49A 3RMYA 3ZYIB 2WABA 2WINB 5BNPA 3KLSA 5CFCC 5HV0A 5APAA 2UYAA 1QXPA 5IUQA 5ACA2 1K5JA 4YPJA 2ARXA 2PAMA 4Q4V2 4YM2A 5FZIA 4BB3A 3GBGA 5A3MA 2MPFA 1JU4A 2MNGA 3CU7A 3MW3A 3O7OA 3P6BA 3PTYA 4FO9A 4XHBA 3U1XA 2XJUA 1AJOA 1JUIA 1MZEA 2ARCA 3OGSA 1AL22 3GF6A 2D6NA 4OI4A 2VOKA 3ETPA 4LBLA 2OIIA 3BVCA 4UOJA 2Z2SB 1LRHA 3AZVA 3PUAA 1UXZA 1VBC3 3ZN6B 2X29A 1D7PM 1ZZ7A 4XF9A 1ASJ1 2BYVE 4DMIA 2XG3A 4F7ZA 3S57A 1Y43B 4L92A 1RUOA 5BYNA 1K42A 4RQPA 1RXFA 2W87A 4YW3A 1ENSA 3BIEA 4OUMA 1JTZX 1QWRA 1QQP3 2UWAA 2Z42A 1AUYA 1TME1 5EYYA 4CDWC 3I49A 4BWOA 4ZU7A 2RS31 4Y4RA 5AFBA 4L9BA 2KD7A 1KD7A 4NRMA 3THPA 1OI6A 3C7FA 4Y5TA 1YFXA 4FOVA 2F6BA 4Q26A 4NR1A 3USUA 3OPWA 4BQ2A 4JDNA 3WDYA 2GAUA 1HB3A 1LGNA 3RI9A 1RJ8A 3SH3A 3TEWA 1LEMA 1Z78A 2MEV3 1Y9QA 3HNMA 5AVAA 1GWKA 2V4AA 5KXEA 2KR2A 1F2NA 1W2OA 4P5YA 5A3NA 3DV8A 1IQDC 1IS4A 1XU2A 3KT4A 4WZFA 3BU0A 3FHQA 5GZFA 4FAHA 2RS12 1OA3A 4WV8A 3IDCB 5LW9A 1WCUA 3M2MA 2D5FA 1RUE3 2XL9A 3CO2A 4AHWA 4MGTA 2VOTA 1ZBE3 3VD9A 4E4ZA 4Z07A 2VTXA 4YW6A 1W2NA 3NNGA 5ACA3 1ODMA 4U2AA 1UPSA 1US3A 1R082 4DB5A 1UZZA 4AFBA 1W2AX 4IW3A 1NG0A 1C8M1 2DDUA 1RIRA 4Q1RA 5FZ1A 1XU1A 5I8TA 2AEZA 2B9UA 1GNYA 3KMHA 3JQWA 4DXRA 3K77A 4NIIA 3H1MA 3POJA 4KWLA 4FPOB 1DQ6A 2JDHA 2XQRA 5LA9A 4JQRA 1YJLA 1BBT3 2WBKA 5CBLA 3ZM8A 4I30A 3VBFB 1UY2A 4D0QA 4JKKA 3T2PA 4R9AA 1QQP2 2WR9A 4RGKA 1OOPB 1SLIA 3ZFEB 4AVSA 5K0UA 4XJAA 5A3TA 3I3EA 2HWF1 2E9QA 4RHV1 1XE0A 3PVBB 4E8DA 3ACHA 4P9JA 3KV6A 5IVJA 3CJIB 4EN8B 3WP4A 3SLIA 5CKMA 1UY1A 5A7QA 2VQ0A 1ULDA 4DY5A 4ITCA 5HCHA 1YCIA 3RZJA 3MLLA 2FCVA 2BPA2 4C90A 4PDWC 3MBWA 4BCUA 4GMP3 1KS5A 4QXBA 4Q1PA 2ORZA 4ATEA 1F4AA 3I7DA 4XXAA 1HXS1 3O0WA 3WINE 4DXTA 4E8CA 1V6JA 1UYZA 3LEIA 1OQ1A 2LRPA 2BOIA 3RGBA 3ZYGA 4PDWB 4Z2WA 1X82A 1RITA 2GC1A 4QPIA 4LKSA 3AKSA 3WDUA 4XJWA 5T52A 1YFUA 4XUOA 3VV1A 5LY1A 3O1VA 1W6PA 1DGWX 2XJPA 2CV6A 3QH7A 1KFXL 4AVBA 3MPPG 2WLPA 2XWBB 1CX4A 1Y7BA 4ASLA 5EPAA 2ZGRA 4EWDA 2G1MA 3WF1A 3PVNA 1EPZA 2DCYA 4JDOA 1U0AA 3UGHA 5HXVA 4BZ4A 4A2UA 3HWJA 4FP3A 3LQCA 5G04L 1WD4A 1JUHA 4NHXA 2BERA 3AVSA 5CFDB 1R1ZA 2PAEA 5I8SA 3RI8A 2A7AA 2BVVA 3J26N 3UK9A 1FATA 1ZX5A 3T2OA 3MGUA 1T6BX 2Y38A 2RMU1 2VQUA 3B93A 2Y6FA 3MDPA 3KF3A 4Q4X2 2D6OX 3HEIA 1CJPA 3LFMA 4GQ7A 1V9U3 2F17A 1FV2A 1WZXA 3M70A 5IATA 2GALA 4ASMB 1RMU2 3VBHB 5FIXA 2TUNA 5LRSA 3IN9A 1UMHA 2C6SA 5CVRA 4UF0B 4DZGA 5LEJA 4HMZA 4RR3C 2VOXA 3JBG3 4LORA 5EJ3A 5LBFA 4EE2A 2HWE3 5FZ0A 5J7MA 4HANA 5C8CC 2ZEYA 3GM8A 3M4FA 2GN7A 3OUIA 5JVVA 1FMD2 4KG8A 1WGPA 2RDQA 2XR4A 5L7OC 4CU8A 4FTEA 1UY4A 2VUJA 4CCOA 3GBWA 4BK5A 2P2KA 3ME2A 5ABJA 2D6LX 3QCWA 1O3TA 4Z82A 2Z79A 3LEMA 2VVEA 3RMXA 1KFUL 1W8FA 1FOD2 2VR4A 1KXGA 1UAIA 3IDAA 4YVSC 4I3GA 4E9KA 1WMDA 2RS52 3EHKA 3A4UA 5DXDA 3BTZA 1REEA 1QOTA 3HQRA 1E5IA 4JGYB 3W9AA 1AF9A 3GBFA 1OC1A 3AB0A 3N7JA 5IW0A 3DEMA 3ZSMA 5FQ0A 1QJX1 5IVVA 3FX3A 1MQTC 1V6IA 1W8OA 2NYYA 1K5MB 4B4QA 4X6QB 3CIHA 3TAYA 1QNWA 4CCCA 3TNPB 1J1LA 1JZ5A 3DKWA 1CAVA 4BH9A 1K5MA 4C0BA 2CSGA 3VZMA 5CADA 1GP4A 4A7ZA 4YGEA 3WY6A 3T0DA 4FPFA 1PO12 2EAKA 1ZRCA 1OH4A 4BQ3A 4CSWA 5CKNA 4IEQA 4XJ8A 5JCTA 1W6QB 2HWB1 5FXVA 1FXZA 4EN9B 5GALA 1G9CA 2Q4SA 2ILMA 1VBA1 2HWD3 3GDBA 3ZN6A 4XDOA 2XJTA 5JSOA 4UFIA 1YWKA 5C3SA 2WSVA 1RUH3 3NJZA 2XB6C 4XTMA 2OUJA 1G9AA 1M4WA 3ELNA 5FZ3A 2IFRA 1SFYA 1RUC3 5EJ1B 3UNPA 3RPQA 5HPOA 3UL2A 3JB4C 4ZPIA 2XLGA 2JX9A 3ZN4A 1MZ6A 2JENA 3F2ZA 1COV2 5FZKA 2BGOA 3GCXA 5KHGA 1ZRDA 1MEC1 1QJFA 1R093 4XVHA 4UFJA 5BNPB 2WN2A 4CDXC 3VBHA 5FY0A 5L9RA 2A6ZA 4BMEA 1WW5A 2EALA 4QMAA 2UY9A 3PUIA 1VBD3 1BK0A 4Y1XA 1NX9A 3O1UA 5FUPA 2WFF1 1EV11 3FJSA 3LEKA 4J6GA 2QQLA 5FYSA 1YI9A 4W8JA 4QQPA 4JVAA 2MEV1 3HMYA 3UGFA 1RUI3 4B3NA 1W8HA 2UURA 1SCSA 1G7YA 2XJRA 4HVRA 4XE9A 5FP4A 2WZR2 4QX0A 5LASA 1H2NA 1KJRA 4M3CF 3SMHA 3FBMA 3K4ZA 1HB2A 4K8RB 2FDIA 2WNUC 1ULOA 3C8XA 4GKYA 3NV4A 3H8OA 4I2OA 2JG8C 5IVYA 4CDQA 5FAXA 2ZCWA 4JX0A 2ZTNA 4P9IA 5DUUA 5JIUA 2EICA 2QQVA 4PF5A 3WG4A 3N4MA 1QNYA 3LB9A 3BU7A 4N7UA 3POBA 4Y20A 4Q4Y3 3RVHA 4YG3A 2VMEA 3DYOA 3VBOB 1MQTA 4IEWA 4CDXB 3RZHA 4UFKA 1BEV3 2W3JA 1UZYA 3C7GA 4ONUA 4W6XA 3SC7X 5DPNA 3RJRA 4ASKA 1LR5A 1OHFA 5FPBA 2FZ2A 4CP9B 3LOBA 1X7NA 3TEZA 1PVC1 2ZJCA 1W9WA 1UY3A 3VBOC 4M3CB 5F5QA 3VBUC 3TOJA 1BVVA 3BIWE 3LEGA 4AFMA 2ZMNA 1LULA 5T5LA 1UIKA 1UOGA 4BHPA 1BMV2 1F9KA 5GLUA 5C70A 4IGOA 4KH9A 4ARYA 2D6KA 1DIWA 5FZ8A 1W6OB 3RYRA 3AMMA 4XFHA 3ZVXA 3Q8EA 1G6NA 4WM7B 4PT6A 5CIRA 3WW4A 2DF7A 4XUPA 4TZDA 2ID4A 1XOYA 1H8TA 4RA0A 4NWWA 4AK3A 5DMYA 3BKZA 3MUY1 4GIQA 1F5FA 1EAH1 2EA7A 2P37A 2IC1A 1NA1B 1XSQA 2W1QA 2EF6A 4U36A 1XPWA 3VBFA 4KU7A 4YW1A 4B1LA 3VGIA 5FO8B 1MS8A 2D43A 4HKOA 2PQSA 2ZXQA 5A3UA 3ZXLA 2GH2A 3DL3A 3OG2A 5FZMA 3THCA 4TTGA 1DGRN 1E5SA 3B69A 5FYHA 4AXOA 3S5AA 1GOFA 2RM21 3WDWA 5ABJC 3MI8A 1IPSA 3VD3A 5IFPA 3MLKA 4XFBA 2ZGTA 2RG4A 3MLJA 2WFF2 1S2BA 4HKLA 5C4WB 5DUWA 2CL2A 3T4VA 1ZRRA 1OPOA 2BQPA 1QKQA 3NAPB 5CAZA 3UKTA 3I59A 2Y33A 1W8NA 2VZPA 5LK7B 3ZR6A 4OHYA 3UETA 1OFSA 2BZDA 1AYN3 3P3PA 4S2GA 2VZRA 4E4HA 1U12A 5JMOA 4XHXA 4K8FA 4OHXA 4CA9A 2WNVB 3OD0A 2Q1FA 4FT8A 5KWRA 1GWMA 3HIFA 4H7LA 2CGPA 2VG9A 1SLCA 2P4EA 4ZY9A 1NLSA 2VL4A 5A7WB 3AX4A 3AKQA 4LPLA 1JODA 2JE8A 1O3QA 4Q5OA 1FPN3 4N9HA 3OD4A 4AI9A 3OBRA 1HRV1 1QJU1 5LA0A 1O4ZA 2AYHA 1CIYA 4NIHA 5T54A 2XLAA 4CPBD 1A8MA 2Y6HA 3HOBA 4IV3C 4E2SA 5LA1A 5CG8A 3IM0A 1ASJ3 5CISA 5I0SA 1DCSA 1WBFA 2J1UA 4M4RA 3V64A 4EYUA 4NWVA 4IL7A 2VJXA 2F4PA 2YBSA 1XNBA 4XETA 3RZLA 4ZONA 4K7JA 1TE1B 3LGRA 3ZXFA 2P3YA 2RDRA 2RJLA 3AFGA 5LCWL 1ND2A 4LO7A 1HX6A 1I3HA 5FMDA 5LBEA 3ECQA 1ODNA 1BEV2 1MVQA 2UY8A 1F15A 4RR3A 1QH6A 4IE5A 4Q4V3 3ST7A 1YEWA 1C28A 3OEBA 5LRRA 2FDGA 2LM3A 3WNXA 2G9FA 4XCAA 1JYXA 2JG9B 5IHRA 4YYOA 4IV1A 4LO5B 1RUD2 3FE5A 4LBQB 1RUJ1 2Y8KA 3H3ZA 1HRI2 3S6PA 2QJVA 1SDWA 1OVSA 2YFUA 4LBJA 4FFHA 4WM8C 2E53A 1RXGA 1H6XA 1PVXA 2VM9A 2WAOA 4AQ2A 3NJYA 3SCGA 2LW8A 4EWEA 5FYZA 3ES4A 1HJFA 2WO3A 3K2OA 1I1EA 1W6NB 5JAXA 4J1XA 2IXJA 1ONAA 4AZZA 1J3QA 3NJXA 1IG0A 5F5AA 4O7XA 3PNAA 4CDUA 5C3PA 4GH4A 4XURA 3IKWA 1GZTA 2ZX3A 1UKGA 4MGQA 1QJZA 2NMOA 1OVPA 2VMFA 3PUQA 1HRV3 4GA9A 5GZEA 1NCRC 5LBCA 4UYBA 2QQPA 2JXAA 4XMIA 3AFKA 4WZCA 5FPZA 2CGNA 3FZ3A 4E2QA 1S2EA 1LOEA 5C33A 5HXMA 1K3IA 4OMCA 1JZ3A 3AMPA 4A4AA 4ZU4A 4B7EA 3TB0A 1S0FA 5T55A 1PO11 4BISA 3ILNA 1NY71 4CUAA 3OUJA 4WVMA 5K9YA 4XACA 2PHTA 3LPGA 2I74A 1GUIA 1C5IA 4PI2A 2GC0A 5CB7A 4RHV3 2W52A 2JDZA 2ZA9A 2RS33 1AR82 1CAWA 2C1FA 3OYWB 3IIAA 4QHZA 4RD7A 5FYUA 3WXPA 1YI7A 1LOAA 4NAOA 2W5FA 5IVFA 5ISLA 2IUWA 2AZ5A 4NMIA 1DHKB 2AUYA 4LKDA 5FLIA 3T1LA 1O3RA 3SISA 5A3PA 1CR7A 1SLBA 2Y64A 4P9WA 4ORFA 1VBB1 2WS91 2OUHA 3LCPA 4GJYA 3M3QA 4Z2AA 2ZZJA 4GWJA 1RUD3 3KV5A 3LE0A 2EXKA 4FPKA 2A5ZA 5KHKA 1KS4A 4JGZB 5FY8A 4JGYC 4PIYA 2DTYA 3OUHA 2OZ6A 3MIEA 3WQ0A 2RDNA 3N9PA 4Q0QA 4PBOA 3OY8B 3U4SA 4FOQA 5CEHA 5L9VA 2RV9A 3IDEA 1AXZA 1Q43A 3LDRA 4LEJA 2WNVC 4MHRA 1UD1A 4Q2FA 4YNIA 1DU3D 1XYPA 4YW2A 2JIGA 2QQKA 1OF3A 5SV8A 3ZSKA 3OJBA 3H8RA 1VMHA 4LO4B 5FZBA 1GNHA 3KD4A 3VZKA 5LK5A 5C3QA 3AC0A 3ROUA 2BBAA 1SFNA 4O61A 2VQTA 4LO8A 2Q5TA 1S0IA 2H6BA 2FDJA 5BNNA 4OMDA 2RMU2 2VZOA 4Q4X1 4FAGA 4BQ1A 3I2KA 3PVOA 1HQNA 2XDVA 4LIVA 5C8WA 1GZWA 3MF9A 4DEVA 1FI2A 4HPKA 5IWFA 5T50A 2PLV2 1RINA 4CEYB 2W68A 4CTEA 3ORJA 2WA4A 3I2GA 2IVJA 2JKBA 2JD4A 2ZGOA 1RVF1 1WW4A 4DUXA 5KXDA 3IAPA 1RUG2 1W6MA 4EJRA 2X09A 1UF2C 3WLUA 1NCQC 5KXBA 2WQ4A 3K48A 1D0HA 1OKQA 4JKMA 1AR61 1QJY3 1GKBA 2R043 2R072 3GZUC 4OFGA 3OPTA 3T1MA 3T30A 3MV11 2ZGLA 2IFWA 1KJLA 2VW1A 3LFIA 5A80A 1PMJX 1EP0A 1DQ1A 4COYA 2VBDA 4CVUA 4CCKA 3OGGA 1VBB3 5FZGA 1ZRIA 4NIGA 3VBUA 4AAXA 4XBQA 4A6OA 1UL9A 2GC2A 4ZS3A 2XL7A 5FBZA 1PNFA 1O4YA 4GB31 3H1YA 4W4ZA 4COZA 4YM3A 3B9CA 1X9TA 2ZS6B 3RJ2X 4P9LA 1V6NA 3AP4A 1ZZ6A 1MS4A 3FWEA 1E5RA 4HFSA 4UW6A 3UESA 1ZZCA 3HAGA 3KWVA 4QQOA 1YQ8A 1S2KA 3L2HA 1IS6A 5FZOA 4Y5Z0 1AR91 4AEDA 2LROA 4AW7A 3R6SA 4OHWA 1V9U2 2NP0A 1WA6X 1XNDA 5F5IA 5HBAA 1LGCA 3OBTA 4BPZA 2B7YA 4LA2A 4IEXA 4WM8A 1JZ7A 1QJY2 2XVGA 4LXLA 3BCWA 3RWNA 4KBZA 4NN0A 1DFQA 4AHXA 1OSGA 1RB8G 1OF4A 3S7IA 3I2IA 1NCRB 5BNOC 4HZFA 3NNFA 3O0VA 1GANA 2OPWA 2R062 4N53A 2ZX2A 4Z1VA 2QDRA 2G9ZA 3H3UA 2P5BA 1RYYA 3AJZA 4QB2A 1BXHA 4PLMA 4R9BA 3F95A 4BXSV 3JBG1 4AEKA 5LA2A 1CJDA 4FFFA 4PQ9A 4QXCA 4XFFA 3UYJA 3ZXJA 5ANQA 3VBSA 1UZ0A 3EQEA 1C8NA 2Y0IA 2BNOA 5F39A 4QQLA 2ENRA 1OXCA 3POWA 4O9GA 4IDZA 4V1PA 4XTPA 3N9MA 1MS0A 2BNMA 4NVPA 4AR2A 2Q8DA 3ZYFA 3BTAA 4CXXA 3J9SA 4IV3A 1B09A 1MPXA 4Q29A 3SCFA 4LMFA 2HWD1 4N9IA 4OCTA 3MYXA 4TLFA 1UN1A 1WMXA 3WDTA 2BDRA 1QIQA 2HWE1 1F35A 4LUKA 4K1ZA 1JYCA 1K45A 4MXWA 1WLCA 4X8PA 2CWSA 3VZOA 2RR13 1PIV1 2BUKA 1LU2A 3KQ4B 1C8M2 2VZUA 2J1VA 4IEOA 4DINB 1EAH3 2WL1A 1R081 3AZYA 3LIGA 3QH6A 4LUMA 1LHUA 1YC61 2GNDA 5IK4A 4XC9A 4FFGA 5JSRA 2OA2A 4LKEA 1GOHA 2R6QA 3RYKA 3T08A 4LBOA 3WF4A 3ZYBA 2KXLA 5FJKA 1PO22 3M8LA 2HWC3 5D8AB 2K0GA 3NAPC 4LOSA 1SPPB 2ATFA 3ILFA 3TWIA 2WO7A 2WT0A 4LNVA 4YVWA 3E5UA 3OTFA 1KRIA 5DG2A 4DQAA 1FV3A 3JZVA 4N43C 4OI0A 2VQAA 1POV1 1Y4WA 4LHLA 1URXA 3LOIA 5D1IA 4ZS2A 1W8TA 3AYDA 2PHLA 1JYIA 1BEV1 4XOGA 5FMOS 2RR12 3BI3A 1UMIA 3FUQA 4FP2A 4CDUC 2XLFA 4HETA 3I4IA 4Y22A 1VJ2A 2A75A 3S0MA 4NE9A 2QQJA 3M7AA 3J8F1 5DAXA 2FCTA 2OX0A 2R041 3DN7A 1KDKA 1TME2 4CU6A 1YFYA 4S2DA 1FT9A 5FY1A 1PO23 2WWSA 1O5UA 5A6XA 2ZGUA 2BTVC 2SLIA 1BJQA 4P00B 4XF3A 2QKDA 3U10A 1N1YA 1PZ9A 2VC9A 3WW2A 1DGRA 3R05A 4XAAA 1AR72 2O8OA 2VZSA 3H0OA 2Q1ZB 1JOPA 4MH0E 2DFCA 2GMEA 3AP6A 3ZN5A 4QPGA 1H30A 1N1VA 4XFCA 3VL8A 2D6PA 2XXZA 2WZPP 4AI1A 2DU0A 2AC1A 4Z8BA 2R063 2OT7A 2VVFA 1NE6A 2RDSA 2VTXJ 3NJVA 4NRQA 2ARAA 5BNPC 4Z92B 1BK1A 1MACA 4QPGC 5DAVA 4GAZA 1QY4A 5JR7B 4K20A 1GR3A 2FDFA 4P5HA 1DGLA 3Q9OA 1QU0A 1GP5A 1W3XA 3EMRA 3OGRA 3ZXEA 4A7YA 2RM23 3I3DA 2EIGA 3N7MA 5C3RA 2BEOA 5FWJA 2ZHMA 4YGDA 1QDCA 2GC3A 3AXEA 5ANNA 3WG1A 4BIOA 3OF1A 3WNLA 2K46A 1LGBA 4RYDA 2I2SA 4ISRA 2B45X 2FHRA 3GZAA 3CF6E 2ZBJA 5C9AB 1H9WA 3O1RA 3JBG2 1C4RA 1VRH3 1ZBE1 2WWUA 1T6GC 1CAUB 4C8DA 1H1MA 5A33B 2VY0A 5LB6A 4YFZA 5J09A 2YFZA 1H1IA 3MPBA 1VRH1 3NL1A 3QACA 1C8M3 5C5UA 1I5ZA 1Z7S2 5DABA 4CZSA 4N43A 4YG0A 4MG2A 4K6BA 1VAVA 5F3EA 2KM2A 3OEAA 2A3YA 3TEXA 2WZEA 3VDBA 4NRPA 4QKNA 3VDDC 4CCNA 4Q4X3 4CUGA 2HYXA 2W95A 1PX3A 3V0AB 1RHI2 1OFNA 1W8ZA 3UGGA 1RUG3 4W6YA 1PGW1 1W9YA 2WJSA 2A3XA 3IDBB 1IPKA 2CNAA 1CVNA 1QOSA 3NVCA 5DZFA 1E57A 2YDEA 5A32B 3ACLA 1EUTA 1O8SA 1JI6A 3N7LA 1AYM1 1NE4A 5JPNB 3AKRA 1EPWA 5A3LA 1JS9A 1WUVA 2X05A 3E5XA 2GMMA 1QJU3 2VTFA 4MO3M 2C5DA 1JYVA 2CWMA 4YVSB 2JB8A 2VULA 4Y1ZA 4KWJA 1VBB2 4ZKTB 3UKVA 1QQP1 3AKPA 4IE0A 2VAUA 4CEWA 2JDMA 4A7KA 1N3OA 2EXJA 2ZGMA 1NLRA 4V2VA 2EVXA 2WYFA 3SHRA 4B4PA 2QE3A 1WCQA 4AE2A 3I97A 2IXLA 1D4M3 2PAKA 3IPVB 4OUEA 4XJ9A 3UKNA 3WNKA 5F3CA 4D6QA 3K4AA 1H9PA 1AR62 1CAXB 5AC93 3ZXGA 4O65A 5CZKA 5FYIA 5D8AC 4QKDA 3T2QA 1D4M1 1IHMA 1G9BA 4Y26A 4YZ4A 4LR4A 4MZUA 1O91A 4EV0A 1Q8OA 4LT5A 1CGPA 3PIJA 4TXWA 4QD2A 1NY72 5JIAA 1H2KA 1R64A 2E51A 2WLQA 2FQPA 3HT2A 2A1XA 2PLV1 4EZHA 3WCRA 4YSFA 4UBHA 1V6LA 4P02B 3ZYRA 2DUPA 5F6LB 4PJYA 1HDKA 3LA2A 2NMNA 3WW1A 1NZCA 3ZLIA 5A70A 4Q4Y2 5FMOL 1XNCA 2WT1A 4LBQD 4LJHA 3SCHA 4HT1T 1SG3A 4M00A 3ZOIA 5K0UC 5LEKA 3VL9A 4QU1A 2B46X 3KQRA 2K2SA 5FZCA 4NUBA 2ET7A 2ZHNA 3KHBA 5F7UA 2X5IB 3VLBB 1ND3A 3POIA 5T5PA 3H3LA 4K40A 4NIDA 2BFUL 3PHMA 3ZFGB 1PK6B 1FPN1 4NIAA 3WF3A 5AC92 3AL5A 2VCBA 2ZEZA 3VBRA 3Q8FA 2X5IC 1NQJA 4IESA 4AQSA 2DVAA 5FO7B 3H7JA 3HQXA 1GYKA 5GLWA 2WIIB 4JKLA 2R061 1BBT1 1HIXA 1PK6C 2CAVA 4GULA 2BWCA 1BZWA 2WDBA 1P8JA 5F3IA 1LENA 1UOBA 2X10A 3J4UH 2VD7A 4KWKA 4C1WA 1H1AA 1SZBA 3DPRA 4RS5A 4FXGB 4JZRA 1UWWA 4XQDA 3VHRA 5KR7A 3O1SA 2VE1A 2V72A 3ZKYA 4CDQC 3LZZA 4CE8A 2YPJA 4RN5A 4OQ9A 1KEXA 2W91A 1DYOA 3HT1A 4LA3A 5FPAA 4MV2A 1ZZ9A 1YFWA 2HEWF 3POYA 5F2SA 4Q0SA 4IETA 1W9TA 4MGKE 2A71A 1HRV2 4K1YA 2HEYF 5F1RA 5I91A 2WNUB 1BCXA 5GZDA 4QWNA 2GN3A 1B35C 1GFF2 2FDKA 3THTA 4D7YA 3KGLA 4QDRA 3BGAA 1Q3EA 3ZYHA 2YGLA 2P3KA 4MX3A 1RMU3 1ZBA1 2R7EB 3PUSA 4AQ6A 4IEZA 3Q8AA 3X29B 3ZFGA 3NWKA 1AXKA 1QMJA 2O0OA 4UW5A 5JI7A 5KC5A 5KXCA 2ZX4A 2W1SA 3GALA 1QJU2 1VP6A 3FFQA 3IB3A 4C1XA 1AYN2 1FMD3 2R071 1W0OA 2F4LA 3KV9A 3OBAA 3WQ1A 1RUF2 3RQ0A 2K9ZA 4GALA 3PDQA 4FQZA 3GHNA 3I2HA 1RUG1 1POV3 1WMFA 3OGJA 5FKBA 2D98A 4QGLA 5SV5A 2PHWA 1AHSA 2ZGPA 4Q4W1 4B7KA 2DURA 4BE3A 2P34A 4BA6A 4AEDC 4LHSA 4AEJA 2AEYA 5F9TA 1NT0A 5EHDA 4D6RA 1WCSA 3VKMA 1JH5A 1FX5A 1N47A 1UMZA 3UV9A 2XGXA 4XIKA 1HW5A 3GCWA 3WP5A 5JOZA 2BGCA 5FZ9A 1TG7A 4ZZ5A 1ULPA 4QDQA 4OZXA 3NMBA 1RTVA 3AZZA 2R0HA 5FKCA 5JZGA 1C1FA 4CDWB 4XQ4A 2QZ3A 3M3OA 4MHUA 4FTSA 1FYUA 2G9GA 5FP3A 3W5NA 1PX4A 4YZ3A 4MLOA 2WSUA 3AMNA 5BNNC 3WEZA 2OZJA 5FXXA 4C0HA 4CXYA 3NNMA 4G9SB 4KMQA 3ZR5A 1OQEA 4WM7C 4BLJA 1UO9A 4Y1YA 4YVSA 1OPMA 4XXPA 2FD8A 2DBNA 4COWA 1PNGA 1Z0HA 3MUZ1 4W6WA 1AL23 3INAA 2YUEA 2VCMA 1LODA 5JDBA 5GLVA 3THDA 3TN92 2ZMLA 4PI0A 5M0TA 1SBDA 5FPVA 4DRVA 1FOD3 1MZFA 5IAVA 4HSLA 1OURA 1NCQA 3VKOA 1SLAA 4OHZA 2BBVA 2CTVA 3ABZA 2YU1A 5J3UA 1C5HA 1QXRA 1IOAA 2IXCA 2N7GA 3NRUA 4JGZC 3IT8A 3BALA 5FZOB 2CU5A 2BWAA 1WCDJ 3DUIA 5GKAC 2VW2A 4TWTA 2VBBA 5G05L 2VECA 1R1A3 2RHPA 2DCJA 2XBO1 4IE7A 5FXZA 5KHIA 1RUI1 4JHZA 4N43B 4XUNA 2Y6KA 1ALYA 4C91A 2CDOA 4ISQA 1GLHA 4XUTA 4BM8A 4P14A 3GGLA 4META 3WG3A 5FZLA 5FY7A 5FZDA 1Y9GA 4Y4YA 1IKPA 4DPNA 3QBQA 1V00A 4YGCA 5F6KA 3RWKX 3ILRA 3I2OA 1YIPA 1UKRA 3D6EA 4L99A 3WV6A 4ZZ8A 1FPN2 2GU9A 4FPJA 2WT2A 3ZDSA 2A70A 3VD4A 5I0TA 1AX1A 1X9PA 1NUKA 1DLLA 4DS0A 2CGOA 2EIDA 2WZR3 4QPYA 4AGVA 2XONA 2DUOA 4YW4A 5JI9A 3BB6A 3FMGA 3AMQA 1OBNA 4MADA 4WVWA 3OB8A 4YRDA 4E27A 5J37A 3HBZA 5DDJ3 1W0NA 1VRBA 1TMF2 2ZGKA 3H42B 4E4DX 4QX1A 2EIBA 4HPKB 1HKDA 1YUDA 4GB33 4IERA 4IGQA 4COUA 4N53C 3K75B 5IVBA 3P1IA 2PHRA 1AYM3 2UWBA 3H9AA 3ZFFB 1LCLA 5EFUA 4I0WB 4UFLA 2D3RA 1XYNA 2BOJA 3PMSA 1AR93 3HVDA 1PM7A 4UAPA 4QPGB 4PQQA 3VDDA 1B35B 1D4M2 3W59A 2D97A 4EN6B 1ZBA3 5FOBB 4JQTA 5GLTA 1HRI1 1PM4A 3ZSJA 1OMIA 4RFT0 4QB6A 1VB4A 5I0DA 2FZ1A 1NXD1 1O3SA 3AL6A 4AVCA 4YW7A 3DECA 2ZOEB 3M3CA 1HRI3 2Q1MA 4GJZA 2A6VA 2OVUA 2WQ8A 5FMCA 1PIV3 2QTWB 2VXRA 2HWC2 1VMJA 1REDA 1VE0A 2VUAA 4GMP0 1W99A 3WP6A 2PTMA 5IFTA 1UYXA 1GZCA 1VR3A 3JU9A 2BNNA 3O14A 4RFRB 3KF5A 1PVC2 2Y0OA 4UFHA 4Y22B 3VDAA 4AVAA 2DVGA 1PGSA 5IVCA 3VHOA 4DUWA 1W05A 2JDNA 3ZSLA 2HWC1 3OGVA 3MW2A 3NSTA 5K7PA 4A42A 4L0PA 1VLNA 5CFCA 3MIGA 1RHI1 1G86A 4H55A 1AX0A 2RMU3 1J84A 1UPIA 5CA6A 4M0NA 4S2FA 4KG0A 2VBPA 2AENA 4GWNA 3MZHA 5FCCA 2Q8CA 4P9GA 2WYSA 1VAMA 1YQ5A 4CYDA 4COVA 1QJX2 1OKOA 2J22A 4PF1A 1DYPA 3SNMA 5GM0A 2XWJB 1QDOA 2PHDA 1KITA 5EXOA 3N9NA 1Q8QA 3U4XA 4AFCA 1EY2A 2X5IA 3KM5A 5E6HA 1GWLA 1AR73 2HJIA 5E1RA 2OXBA 1ZBE2 5FK7A 1CESA 2ZX0A 3MHZA 1SACA 3HNYM 5JXJA 4DOUA 5FUNA 2RJKA 4RQPC 1HN0A 1EV13 1XNAA 1OA4A 1TZOA 1F5JA 2H0VA 2Y6GA 1DQ2A 3DXUA 4YLZA 3DPRC 2ZGSA 1SBEA 4FPYA 4DIQA 2VZ1A 3D0SA 2QQUA 1N3PA 1REFA 5FLJA 4BMBA 2O1QA 2ZHLA 1V0AA 3W20A 1U5YA 2QCSB 1X8EA 2RM22 1POQA 3T2TA 4QHOA 3HQUA 1LEDA 4Q4W2 2WWJA 4NHYA 4AI3A 4CU7A 3U0ZA 4B1MA 1I5PA 3K3OA 5JR2A 1RGSA 3IPVA 3PU8A 5A7SA 4LBMA 3IAQA 1K5MC 4IV1B 1VIWB 5FYMA 1S0DA 1AL0G 3TYJA 2BW8A 2VU9A 4CEWC 4A45A 2PHXA 4AHZA 1AYN1 2WAAA 4QT6A 5JUVA 1SLLA 2B5HA 5FBJA 2YG0A 3K46A 5B2GB 2PQQA 3MIDA 3CZUA 4R52A 4YWAA 3T0BA 4YZ5A 4LE3A 5L9BA 3V65A 1LNSA 1ZBA2 5K4LA 3UJOA 3NO8A 2ZGNA 2E7QA 2VNOA 1IKQA 3WUDA 4QM8A 5A32A 1IGOA 5ERLA 2VPVA 2BJSA 1XC6A 1NCQB 1V6MA 4N90A 1W28A 5FPLA 2DVDA 1VB2A 1CZTA 2RS53 4XFIA 1OUXA 3MFAA 3BUCA 1LHOA 3U37A 2JDPA 1HB4A 2XHKA 1RUC1 2E32A 3KCYA 3WG2A 4P08A 4UBGA 3E5QA 2GP5A 2DCKA 2PA7A 3GHMA 4WBBA 4BQWA 3FLTA 1ENXA 1H8TC 4RL7A 5DZEA 1C57A 1UY0A 3FUOA 4GWIA 4QGMA 2GP3A 5FP8A 1CWPA 1L3JA 2ETEA 2OQ7A 2WRAA 2XJSA 5A1AA 4AFAA 1GU3A 4QHBA 4XIOA 5FR3A 4QX2A 4LBKA 4Y33A 1Y3TA 4Q0UA 3EXUA 5JWPA 2GMPA 4AI2A 3TN91 2JE9A 2NN8A 2R16A 4YVWC 1FNZA 4CDWA 5FZAA 1W9FA 3WHTA 5JSPA 2AREA 5T5OA 3RDIA 3JUUA 2PMWB 1F31A 3TN93 1ZZBA 2NLRA 1W2TA 3PMEA 1Q8PA 2OW4A 3EB7A 3PL0A 4YVWB 5AC91 5L19A 4XW3A 2YV8A 2ZX1A 4MOAA 2BGPA 4K21A 4HG6B 3N9QA 4YFWA 5DG1A 4BQYA 2NZ9A 3K4DA 3HNBM 4CP0A 2LALA 5H9SA 2XPJA 1JZ4A 4GD4A 4CRQA 3WUCA 1RUF1 4Q4Y1 5LWBA 1YJKA 2XUMA 1COV3 1AR83 1PMHX 4CCMA 3A7QA 2PN5A 5FYBA 4D8MA 4JDMA 3IMMA 5GZCA 1DF0A 5HCAA 1A8DA 2B39A 2HYKA 2LTNA 3APBA 3CEWA 1VBD2 2CHHA 3TBDA 4QU2A 5JZGC 4NHLA 1LHNA 3AM2A 1DYKA 1S0JA 5J98B 3RFRA 2Z5WA 1J3PA 4XCBA 1PMIA 2AH2A 2JDUA 5EYXA 2YROA 1S55A 4PHZA 5A6QA 1UU4A 5FZFA 3WNMA 1X36A 3WF0A 2V5DA 4PIZA 4KQ7A 5A1FA 3W21A 3VBSB 1CAXA 5T3NA 1BYHA 1MS5A 4OVEA 1ND2C 2HLEA 2O8QA 5FREA 4I0AA 4Q8KA 4GKXA 4Y24A 1QJY1 1PZ8A 3K51A 3VBHC 3J7LA 4HK9A 1YXWA 3SKVA 3ES1A 3UT0A 3DPRB 5A6YA 1Q8SA 3LSEA 1JYWA 2VCAA 1QEXA 1ST8A 1S0EA 1SMVA 1D2SA 2XMLA 5FLHA 2JEMA 3DKQA 1NOVA 2TNFA 3AJYA 5DQ0A 5HCBA 1UXXX 1AZDA 3B01A 3FBYA 4LTAA 2C0ZA 1YLLA 2WQZC 4YZ2A 2HWF2 4ES9A 2I45A 4N7IA 2W92A 3H8XA 1S4CA 4HXCA 1X8MA 1AL21 1PK6A 2C9AA 2VMDA 4B8EA 5FY5A 3LSDA 1CPNA 4IEPA 1UOFA 2A6WA 5BY5A 3N9OA 4JTNA 2QQOA 1W06A 1NYWA 3JQXA 4I09A 1CD3G 1WA4A 5ACA1 5H9RA 4GH4C 5FP9A 1JN2P 4OZOA 4HBNA 5I8YA 2QBXA 1TMF3 3KVAA 4I3PA 4S2HA 4Y1VA 4UWDA 5D2AA 1DGWA 1OH3A 4XABA 5DN2A 3MW4A 4KU8A 1VMFA 4IEYA 3LDKA 1US2A 5K8SA 4DRRA 1G8WA 1RMU1 4GH4B 2Y34A 4QKBA 4O9EA 1C3HA 1ZZ8A 2Y6JA 3JD73 5JZGB 1F4HA 4AFDA 2Z69A 2QNKA 4KBBA 4DO0A 3EJKA 2P3IA 1MVEA 2D6MA 2HWD2 2VZTA 4FFIA 3PJYA 2VMHA 4KI5M 2DVFA 4Y5SA 5F8PA 1J1TA 2JB4A 1TME3 1D4VB 2YXSA 3RZGA 3CLPA 1IG3A 2GNTA 4NPMA 3WHUA 3ZFGC 1SLTA 1W6MB 1MS9A 4RSUA 5FPXA 3M1HA 2RS11 3ZDVA 5GZGA 3CNAA 1YYNA 1RVF2 2LUWA 1MS3A 3KV4A 1A6CA 2B9VA 2YBPA 2ZKLA 3HN1A 2IVIB 3LWCA 2IXKA 3W5MA 4BIFA 3WP3A 5J96B 2XQXA 1GZWB 4N53B 4XF4A 1OD5A 5IK5A 3VBFC 2BRTA 5FTTC 5DDJ1 2JDYA 3DYPA 4TLGA 1VAKA 5C6CA 5IVEA 3VKNA 1ZA4A 3R4UA 5JLVA 1AR71 2B42B 2VZ3A 4DY3A 1MR5A 1ZYBA 3MICA 3B94A 4JRLA 4HOOA 3AP7A 1H0BA 4LBNA 3GJBA 1VBE3 2Q8EA 3VUOA 1A34A 3NKGA 3AP5A 3ZX7A 1LOGA 4DNYA 1JZ8A 2JG9C 5C9AC 3B00A 2BU9A 3WCSA 2GH8A 2XKOA 1NQDA 2WS92 3TEYA 1WCKA 2QVSB 2FMYA 1JHNA 3ITQA 5GLZA 4GXLA 3OY8A 2YMZA 1DP0A 1S1AA 3LA7A 4XDQA 3OBZA 4UT5A 1ASJ2 1FNYA 5CFCB 1GMMA 4RS5C 1RUC2 4NPLA 2OS2A 4FPGA 2PHFA 1IZ3A 3I54A 3POSA 4HL0A 2WN3A 4XFGA 3UJQA 4BQ4A 1JHJA 2W2IA 1EUUA 5A7WA 4RHV2 1CAUA 1N3QA 3PLQA 2VO5A 2A73B 1LHVA 4RS5B 1M06G 1UZVA 4Q8LA 1O8PA 4A44A 5L36A 2HBUA 4XZPA 3R4SA 1UCXA 1CQ9A 4HVOA 4ZU5A 2D93A 2P17A 3CBNA 1GQHA 2NM1A 5C71A 2CAUA 2DYCA 4QX5A 1UW8A 2ZKNA 2A3WA 1QF3A 3VD7A 2IXIA 4NROA 2JECA 3FHIB 4CCLA 4QB1A 1QHDA 1W9SA 3C7HA 2P6CA 1WLDA 3MIHA 5A7NA 1J83A 3B02A 1B35A 5J36A 2ZPXA 1W03A 3VDDB 1V70A 2C4XA 3DGTA 5FV3A 1WMEA 1XJAA 3J8F3 3SXWA 4QAWA 3S5QA 3WNPA 2HWE2 3ZFFA 3FC0A 4FOWA 1XXNA 3ZSEA 1IS5A 1X50A 2DWRA 2NPIA 5EQUA 1JBCA 4YM1A 1NA1A 3L2YA 3E6BA 1JXNA 3JB8A 4R9CA 3SITA 2ADDA 5IK8A 4LK7A 3USSA 3O1MA 1RUD1 2ZEXA 3DF0A 2J1TA 4E4SA 1W6NA 1CZVA 1JW6A 3WQBA 2VH9A 3NKTA 2XBO3 1WW6A 1OLME 5FWEA 5B4NA 2WFF3 2DTWA 4CP2A 4XUQA 3J7MA 4QX8A 3ZYPA 3GJAA 4CUBA 5C4WC 4IV1C 2JICA 2J1AA 2VNVA 2YC4A 3AP9A 3LKJA 4CP9A 1RUJ2 4XBNA 2ZAAA 4M0HA 4CEWB 1DQ4A 3PVEA 1H4GA 1BKZA 1AXYA 1GNZA 5JOWA 2R042 2RS32 1S0GA 2TBVA 2EIEA 2X53S 4YM0A 2XJVA 1NCRA 3C7OA 3OYWA 2QQNA 3PJQA 2QFEA 3HPNA 1MQTB 4K9SA 1OD3A 4OYUA 2HWB3 2W9XA 3QLQA 5E16A 3VZNA 3QD6A 4Y20B 4CP1A 1V9U1 3C7EA 1DZQA 1AR92 1X33A 4BJ0A 4KWUA 4NJ4A 4WVMB 4QM9A 2BV4A 1JMUB 3WNNA 1OQDA 1W39A 4Y3OA 3T09A 5K0UB 1OOPA 2CYFA 3ZFEA 3O1TA 1DZTA 2LS6A 2VZQA 3V0AA 3A0NA 4CCEA 2YGMA 3VZJA 3D0JA 5FZEA 3WDVA 3ZIWA 2OQ6A 4OI1A 1GQGA 3MFCA 4H3WA 3RS6A 3WF2A 3EYPA 5BV6A 1NXMA 2OYZA 4RGGA 1MEC3 5CG9A 1W3VA 3B5LB 4QPWA 1UIJA 1PO21 1QXJA 3WNOA 1O4TA 2R32A 3PURA 1JOJA 5FUIA 4CCJA 4KNCA 1TQ5A 1CPMA 1GBGA 3S30A 1I6XA 3ACIA 4MVTA 5A33A 3CKHA 3SH5A 1Z7S3 3C2UA 3SKJE 5A7PA 1PGL1 3NNLA 4IQPA 3WDXA 3ZFFC 2JDAA 3T4HB 1L7QA 2PHUA 4GWMA 1VBD1 3OOXA 3KHCA 2VUDA 3WOGA 3VD5A 2C9KA 2EXHA 2OPKA 2WO1A 1GQPA 2XHNA 1WW7A 2W47A 3C3VA 3NAPA 4LQRA 4MGYE 1C1LA 2VGDA 2JG9A 1LOFA 3RZKA 4AQTA 2C26A 4BQ5A 4JRAA 1RUH2 3BODA 1ACCA 3RRDA 2DCTA 5HI0A 1RUJ3 1ZNPA 3LPFA 4UXAA 3I3MA 2DCZA 1UZWA 4IXLA 1R1A2 4OUSA 3POFA 1LOCA 4AI8A 1GV9A 3AYCA 1XYOA 1RUF3 4R4XA 2YY1A 2DU1A 1NZIA 1ENQA 2E26A 3E97A 3SEEA 3ZPOA 4EN7B 2XUEA 2I07B 2ZEWA 4AYUA 1HV0A 5JXHA 1R092 2WKKA 4WVZA 5KBFA 2YB7A 3JD72 2AGSA 2TEPA 1ULEA 3G7DA 5KHHA 3VKFC 1G9DA 5I93A 3WT3A 4FVVA 5DZGA 2B4KA 3S7EA 2XJQA 1UNBA 1A78A 5B4XA 2XBO2 4WM7A 5FYCA 3HN3A 5IJRA 4FTBA 1W8UA 1UYYA 3GNEA 4AOCA 4KL1A 2WA3A 2ZZQA 2WNUA 2NQYA 1CN1A 3BPSA 2G4IA 5DAQA 1J58A 1LHWA 3I3BA 3NV2A 4FXKB 5LY2A 2MHFA 4WVVA 5AVPA 3VBUB 3RYPA 1ZRFA 1W0PA 2KA3A 3D8CA 1HJGA 3A21A 5CFDC 3I8TA 5A3OA 3URFA 2FMDA 2VZVA 2ARBA 4YZ1A 1QGLA 2Y6LA 1TVGA 4AGGA 4AWDA 4LITA 1JZ6A 3HD8B 4R9DA 4PLNA 1F8VA 2QZ2A 3LD8A 4CDXA 1CAWB 1VBE2 1CZSA 3DXTA 3VBOA 3U78A 3FHAA 4MGZE 4QQ2A 5D8AA 4MSVA 2MEV2 1NA1C 1BVP1 5A3WA 2VNRA 1ZREA 3VBRB 1S0BA 5C7GA 3VHNA 4FPCA 2VMGA 4IUGA 2FDHA 4LIUA 4XJUA 2J42A 1NLQA 4TSVA 1AX2A 1LECA 3JCIA 1FAYA 4FPHA 4JTOA 3LA3A 2QQMA 4XEZA 3N36A 5IYYA 4FSJA 4J1WA 1H2LA 3AZWA 3MO4A 2CY6A 1ND3B 4DXSA 3GZEA 1IQAA 4P9XA 1CIWA 2E31A 1RJ7A 3NV3A 1VPHA 2CDPA 2UYBA 1ZM1A 4V2WA 3VBRC 3H7YA 3WZ1A 4BQXA 1NKGA 5LZ6A 2RJ2A 1COV1 4OLLA 1LOFC 5FJHA 4QX3A 1XBFA 2H0BA 4MXWB 2IWGB 2P6HA 2HH9A 1PVC3 2R073 1DBNA 2J7MA 2J1EA 3K3NA 4L97A 4Q27A 3N35A 3U11A 1ND3C 5JXIA 1LB2A 1N1TA 2W46A 3B9IA 5BPXA 1T2XA 2YPDA 1TMF1 1KDMA 1BQPA 4URAA 4A3XA 4CDUB 5D21A 3KVBA 2ADEA 2E7AA 1EAH2 3KSCA 2ZMKA 2QDNA 1W6PB 4EQVA 5BUVA 4XPVA 4I02A 2Q8OA 1W90A 1OLQA 5FP7A 2PELA 4W65A 5BNQA 5BXXA 1EYBA 3WW3A 4PBPA 1GOGA 2X8KA 3A22A 4I0BA 2H6CA 2W1UA 4N8MA 4PDWA 3U14A 3DCQA 4CEYC 4JHTA 5IT6A 2W0XA 1BHGA 5F5CA 4D69A 4YG6A 1OOPC 3ZFEC 1RUE2 5CNAA 5E88A 3P3NA 1KGYA 1HLCA 4CU9A 2OKXA 2R1BA 3WSOA 4L11A 2W39A 3CJIC 2JDKA 4MGIE 1HB1A 4NPRA 5FOJB 3CJXA 1OA2A 3ATGA 4XMAA 4ZXEA 4BK4A 1O5LA 2DV9A 4XYXA 3ACFA 3AZXA 2O14A 5EIYB 5JPMB 3CJIA 4AGRA 2P3JA 3ACGA 2VW0A 4AI0A 1UX6A 4UW3A 3VDCA 1JOBA 2XH6A 3ZXAC 3VB9A 5I0UA 1DLCA 4LHKA 2Q30A 3L9JT 1SEFA 1U5IA 4HKWA 1FOD1 1AR81 3LF7A 5JXGA 4QGNA 3D5OA 1NAEA 3WX5A 4H14A 3H1WA 3ALQA 3GXUA 2XVKA 4CUCA 4X8NA 3A23A 2V73A 3ON7A 5FPUA 3ZIXA 3POEA 4L8QA 2ET1A 3N9LA 5H9PA 5F3GA 2C24A 1MS1A 3G6JB 1TNRA 3KGZA 2D40A 3D3AA 5EZWA 1OLMA 1OUSA 1DQ5A 2FBEA 3O1OA 2J1RA 5J1XA 3VHPA 4AEMA 1EV12 4DUVA 5C5TA 2AACA 1E5HA 3AKTA 3B3QE 2YU2A 2WNVA 4EN0A 1YQCA 5C9AA 5DUVA 5IAXA 4M3CE 4A3ZA 4SLIA 3RZZA 1XE7A 2JG8B 1G9FA 2QQWA 3O1PA 5C8CA 4AHYA 3I59B 2WUHA 1WWYA 5FY4A 1YNAA 3P5BA 2HWF3 4R4ZA 3RZMA 4UFMA 1J3RA 5C4WA 2IZWA 4OHVA 3OPZA 1WLTA 4Q4W3 5FK8A 4QQHA 4J25A 3VKLA 4M4PA 1HQWA 4F83A 3CDZB 2A6XA 4HK8A 3J7NA 1SFPA 2SBAA 3I2FA 5CYYA 1JU3A 2B8MA 2JE7A 3O0XA 1L7LA 2JKXA 1W6QA 4HN0A 4HONA 5FO9B 5BNNB 4RR3B 3MIBA 3D82A 4HVQA 1W8WA 3ASIA 3Q8BA 4BDVB 3RG0A 3VBSC 3RNSA 5FZ7A 1YRZA 1ND2B 3WVJA 1PHMA 4Q0PA 1SBFA 5L7OB 2VUCA 3VN4A 2VXJA 4ARXA 4SBVA 3USUB 4ET7A 4ATFA 1N1SA 1I9RA 3KT7A 1JYTA 1ULCA 4D6SA 4HLTA 4KGQA 1ULGA 2BFUS 3WQ7A 2VOVA 2YYOA 4DXZA 1VBE1 2RVAA 2AR6A 4NHMA 4EZ4A 2D7FA 3LDBA 1HXS2 3HBKA 3BOPA 2V4VA 3GZTB 4GMP1 3N3HA 4RQPB 5FDBA 2Q0AA 1HQLA 1W6OA 3FN9A 2EXIA 4XF1A 2ZGQA 1RUI2 1KQRA 4JGZA 4PCRA 5FYVA 1WBLA 1MZ5A 3TNQA 4BU2A 4MXVA 1ZA7A 2J1SA 5FYYA 1RUE1 4AAPA 4QPIB 1YQ6A 1DG6A 3AYAA 1QOOA 2WNEA 5J48A 3U75A 4ZXKA 4DEQA 2G19A 4NAMA 4XDPA 2VNGA 4AG4A 3MV01 4IEVA 3AVRA 3BTXA 5ABJB 4XQWA 1R1A1 2HKXA 4UI9L 4IE6A 1BLZA 1POV0 1PZ7A 4IEUA 4XJZA 3FLRA 3U07A 1QH7A 3QOPA 1YIFA 5CU1A 3T0AA 3CHXA 2YC2A 4DFSA 1SPPA 3OSDA 1LOBA 1XNKA 2ERFA 4G3YC 5GJ6A 1PO13 4UF0A 1JYNA 4LOTA 4XBLA 1FMD1 3JD71 4FPEA 4JCKA 2JD9A 2W1WA 3Q8CA 5BNOA 5JOYA 1VBA3 1WLWA 1SHWB 4QXKA 4F3JA 2R30A 2R1DA 3AK0A 1XQNA 4JC1A 3NW4A 5H9QA 4BXFA 2A6YA 2RS13 1ZVFA 4D7SA 1XRUA 1TNFA 3RSJA 1RVF3 3AYEA 1H6YA 1RL3A 2WNOA 4FCAA 5I0RA 4QKFA 4TYSA 4M01A 4JV4A 5E8AA 4I01A 3PIGA 4LULA 5FYTA 1J59A 4YW5A 2XKPA 1AJKA 1WD3A 1AVBA 1JZ2A 2WZ8A 1DDLA 2E63A 3IBMA 1H8TB 1CX1A 1R083 2XOMA 4IV3B 5KHJA 3SEPA 4CCDA 2QQIA 5F32A 1DZRA 4Y1UA 1D0GA 2D5HA 4KGGA 5FRAA 1HV1A 2BP6A 2DBIA 4A41A 1BMV1 4HSJA 3FLPA 1HXS3 5EJZB 5KC6A 4UW4A 5A7OA 2YZ4A 2P1BA 1LTEA 4CXWA 2EAAA 3BOWA 1SQ4A 2PFWA 2GZWA 2WS93 4P9YA 4AF9A 1XB9A 1SCRA 1VBA2 3CMGA 4TN7A 1ENRA 4LBQA 1GICA 3KCCA 3R0RA 5CKQA 1YQ2A 2HBTA 5FFOC 1XE8A 4ES8A 4LKFA 4MUVA 5AFEA 4R8HA 3PUHA 1VALA 2GSYA 1W04A 3HR9A 2XVLA 4LO6B 5E89A 2VVDA 5FMBA 3A0KA 3V56A 4D94A 4LK6A 3E1F1 5LATA 4FOYA 3IZOA 4XF0A 2E7TA 3J8F2 4QX7A 4OI2A
chains in the Genus database with same CATH topology
2GDFA 4H7MA 4LLFA 4WM8B 4G4FA 3KB5A 1U5ZA 3KS7A 1CAVB 2DUQA 4F8AA 2V09A 3GYDA 1Q56A 3KCXA 4INDA 4FPLA 4AEDB 4EWAA 5L7OA 3R4DB 4XILA 3CL1A 2RS51 1AR63 1RHI3 4LLOA 4AVVA 1V6KA 1RUH1 4PIXA 4URTA 1BBT2 3O5SA 3SH4A 4XFAA 4FQ4A 3H50A 2WZR1 1VRH2 1CONA 1MEC2 1U5XA 4YARA 3N7KA 2YC0A 3EBRA 4X6RB 1H4HA 2WC2A 5TSWA 2R0FA 4YGBA 1D2QA 1YO8A 4EROA 2ZHKA 5C8CB 1LESA 5EV7A 2JG8A 3AMHA 3IMNA 4AVTA 1H8VA 2PYTA 3IWZA 1PGL2 4NO4A 4NOTA 1IS3A 4B29A 4L2NA 3LAGA 4JAAA 1RUNA 4CEYA 4LE4A 3NV1A 4QPIC 1IPJA 2VMIA 2UU8A 3MIFA 5DUXA 3V0BA 2D3SA 3KZ4C 4BLIA 5T5JA 4FBFA 4RGAA 1GSLA 1Q5OA 3MF6A 3AXDA 4BYYA 5JMCA 2DFBA 1A3KA 2ZABA 2ZACA 1Q8VA 4D7TA 2GNMA 4Q0VA 1H2MA 4BOWA 3ZO0B 1UU5A 4HN1A 1RC6A 1AYM2 2D3PA 3H8UA 2HWB2 2RE9A 4E2GA 5FQ0B 1LKNA 1PGW2 2VOWA 3BPZA 3ZMOA 3I2DA 2YHJA 4JGYA 3E6DA 5HCFA 1W2UA 3KT1A 5L73A 3D4KA 3MEPA 5IK7A 4M3CA 2D44A 1Z7S1 1VBC2 3ETQA 1S0CA 3VZLA 4OULA 5EWSA 2RR11 1VBC1 1R091 5DDJ2 3ENRA 2IXHA 1V6OA 2ZAHA 1UU6A 2ES3A 4GB32 2QUOA 4D3WA 3TRSB 4K3UA 3ZXKA 3M3IA 2UWCA 3OCPA 2Y26A 1YHFA 2HEVF 1LU1A 4Q4V1 4CDQB 5JOXA 2WFPA 3WD5A 1ULFA 2JJ6A 4NHKA 3B7MA 4PLOA 4B4RA 4MYEA 2E6VA 3O12A 2BVBA 3FFZA 3WR0A 1LJ7A 1O7FA 1APNA 2GNBA 4LHNA 5CFDA 2PLV3 1TEIA 3ZYJB 3M3EA 3ZMNA 1OLRA 1QJX3 2W08A 3W58A 1GZ9A 3E6CC 1PIV2 3EO6A 1DQ0A 2DVBA 3V0BB 2V5YA 3ZXDA 5BNOB 3ZPYA 2R49A 3RMYA 3ZYIB 2WINB 5BNPA 3KLSA 5CFCC 2UYAA 1QXPA 5IUQA 5ACA2 2ARXA 2PAMA 4Q4V2 4YM2A 3GBGA 5A3MA 2MPFA 2MNGA 4FO9A 3CU7A 3MW3A 3O7OA 4XHBA 3PTYA 2XJUA 1AJOA 1JUIA 1MZEA 1AL22 3GF6A 2D6NA 4OI4A 2VOKA 4LBLA 2OIIA 2Z2SB 1LRHA 3AZVA 1VBC3 3ZN6B 2X29A 1ZZ7A 4XF9A 1ASJ1 2BYVE 4DMIA 2XG3A 4F7ZA 1Y43B 4L92A 1RUOA 5BYNA 4RQPA 4YW3A 1ENSA 4OUMA 1JTZX 1QWRA 1QQP3 2UWAA 2Z42A 1AUYA 1TME1 5EYYA 4CDWC 4BWOA 4ZU7A 2RS31 5AFBA 4L9BA 3THPA 1KD7A 1OI6A 1YFXA 4FOVA 2F6BA 4Q26A 4NR1A 3USUA 4JDNA 3WDYA 2GAUA 1LGNA 3RI9A 1RJ8A 3SH3A 1LEMA 1Z78A 2MEV3 1Y9QA 5AVAA 5KXEA 1F2NA 3DV8A 1XU2A 1IS4A 3KT4A 4WZFA 5GZFA 4FAHA 2RS12 1OA3A 4WV8A 3IDCB 3M2MA 2D5FA 1RUE3 2XL9A 3CO2A 4AHWA 1ZBE3 4E4ZA 4Z07A 5ACA3 4U2AA 1UPSA 1R082 4DB5A 1UZZA 4AFBA 1NG0A 1C8M1 1RIRA 4Q1RA 1XU1A 5I8TA 2B9UA 3KMHA 3JQWA 3H1MA 4KWLA 4FPOB 1DQ6A 4JQRA 1YJLA 1BBT3 5CBLA 4I30A 3VBFB 4R9AA 1QQP2 1OOPB 1SLIA 3ZFEB 4AVSA 5K0UA 4XJAA 2HWF1 2E9QA 4RHV1 3PVBB 4P9JA 3CJIB 4EN8B 3WP4A 3SLIA 2VQ0A 1ULDA 4DY5A 4ITCA 1YCIA 3MLLA 4C90A 4PDWC 4BCUA 4GMP3 1KS5A 4Q1PA 4ATEA 4XXAA 3I7DA 1HXS1 3O0WA 3WINE 1V6JA 1OQ1A 3ZYGA 4PDWB 4Z2WA 1X82A 1RITA 2GC1A 4QPIA 3WDUA 3AKSA 4XJWA 5T52A 1YFUA 3VV1A 1W6PA 1DGWX 2XJPA 2CV6A 3QH7A 1KFXL 4AVBA 3MPPG 2WLPA 2XWBB 1CX4A 1Y7BA 4ASLA 2ZGRA 4EWDA 3PVNA 1EPZA 2DCYA 4JDOA 1U0AA 5HXVA 4BZ4A 4A2UA 3HWJA 4FP3A 1WD4A 1JUHA 5CFDB 1R1ZA 2PAEA 5I8SA 3RI8A 2A7AA 2BVVA 3J26N 3UK9A 1FATA 1ZX5A 3MGUA 2Y38A 2RMU1 3B93A 3MDPA 4Q4X2 2D6OX 4GQ7A 1CJPA 1V9U3 1FV2A 3M70A 2GALA 4ASMB 1RMU2 3VBHB 2TUNA 5LRSA 3IN9A 5CVRA 4DZGA 5LEJA 4HMZA 4RR3C 2VOXA 3JBG3 5EJ3A 2HWE3 5J7MA 4HANA 5C8CC 3M4FA 2GN7A 5JVVA 1FMD2 4KG8A 1WGPA 5L7OC 4FTEA 2VUJA 3GBWA 2P2KA 3ME2A 5ABJA 2D6LX 3QCWA 1O3TA 4Z82A 2Z79A 2VVEA 3RMXA 1KFUL 1FOD2 1KXGA 1UAIA 4YVSC 4I3GA 4E9KA 1WMDA 2RS52 3EHKA 3A4UA 5DXDA 1REEA 1QOTA 4JGYB 3W9AA 1AF9A 3GBFA 3AB0A 3N7JA 5FQ0A 3ZSMA 1QJX1 3FX3A 1MQTC 1V6IA 2NYYA 1K5MB 4B4QA 4X6QB 3TAYA 1QNWA 3TNPB 1J1LA 3DKWA 1CAVA 4BH9A 1K5MA 4C0BA 3VZMA 5CADA 4A7ZA 4YGEA 3WY6A 4FPFA 1PO12 2EAKA 1ZRCA 4IEQA 4XJ8A 5JCTA 1W6QB 2HWB1 1FXZA 4EN9B 5GALA 1G9CA 2Q4SA 2ILMA 1VBA1 2HWD3 3ZN6A 2XJTA 5JSOA 1YWKA 2WSVA 1RUH3 3NJZA 2XB6C 4XTMA 2OUJA 1G9AA 1M4WA 3ELNA 2IFRA 1SFYA 1RUC3 3RPQA 3UL2A 3JB4C 2XLGA 2JX9A 3ZN4A 1MZ6A 2JENA 1COV2 5KHGA 1ZRDA 1MEC1 1R093 5BNPB 3VBHA 2A6ZA 4BMEA 1WW5A 2EALA 4QMAA 2UY9A 1VBD3 4Y1XA 2WFF1 1EV11 3FJSA 4J6GA 1YI9A 4QQPA 4JVAA 2MEV1 3HMYA 1RUI3 4B3NA 2UURA 1SCSA 1G7YA 2XJRA 4HVRA 4XE9A 2WZR2 1KJRA 1H2NA 4M3CF 3SMHA 3FBMA 2WNUC 4GKYA 3NV4A 4I2OA 2JG8C 4CDQA 5FAXA 2ZCWA 4P9IA 2ZTNA 5DUUA 5JIUA 4PF5A 3WG4A 3N4MA 1QNYA 3LB9A 3BU7A 4N7UA 4Y20A 4Q4Y3 4YG3A 3VBOB 1MQTA 4IEWA 4CDXB 1BEV3 1UZYA 4ONUA 4W6XA 3RJRA 1LR5A 1OHFA 2FZ2A 3LOBA 1X7NA 1PVC1 2ZJCA 3VBOC 4M3CB 5F5QA 3VBUC 3TOJA 1BVVA 3BIWE 4AFMA 2ZMNA 1LULA 5T5LA 1UIKA 4BHPA 1BMV2 1F9KA 5GLUA 4KH9A 2D6KA 1DIWA 3RYRA 1W6OB 3AMMA 4XFHA 3ZVXA 1G6NA 4WM7B 5CIRA 3WW4A 2DF7A 4TZDA 1H8TA 4RA0A 4NWWA 4AK3A 4GIQA 1F5FA 1EAH1 2EA7A 2P37A 2IC1A 1NA1B 2EF6A 4U36A 3VBFA 4KU7A 4YW1A 3VGIA 5FO8B 1MS8A 2D43A 4HKOA 3ZXLA 2GH2A 3DL3A 1DGRN 3B69A 4AXOA 2RM21 3WDWA 5ABJC 3MI8A 3MLKA 4XFBA 2ZGTA 3MLJA 2WFF2 1S2BA 4HKLA 5C4WB 5DUWA 2CL2A 1ZRRA 1OPOA 2BQPA 1QKQA 3NAPB 5CAZA 3UKTA 3I59A 5LK7B 4OHYA 1OFSA 4S2GA 1AYN3 3P3PA 1U12A 4XHXA 4K8FA 4OHXA 2WNVB 3OD0A 4FT8A 5KWRA 3HIFA 4H7LA 2CGPA 2VG9A 1SLCA 1NLSA 3AX4A 3AKQA 1O3QA 1FPN3 4N9HA 3OD4A 3OBRA 1HRV1 1QJU1 1O4ZA 2AYHA 5T54A 2XLAA 5CG8A 1A8MA 4IV3C 4E2SA 3IM0A 1ASJ3 5I0SA 1WBFA 3V64A 4NWVA 4IL7A 2F4PA 1XNBA 4XETA 4K7JA 1TE1B 3LGRA 3ZXFA 2RJLA 3AFGA 1ND2A 4LO7A 1HX6A 1I3HA 3ECQA 1BEV2 1MVQA 2UY8A 4RR3A 1QH6A 4Q4V3 3ST7A 1C28A 5LRRA 2LM3A 3WNXA 2G9FA 2JG9B 4YYOA 4IV1A 4LO5B 1RUD2 3FE5A 4LBQB 1RUJ1 3H3ZA 1HRI2 3S6PA 2QJVA 1SDWA 4LBJA 4WM8C 2E53A 1PVXA 4AQ2A 3SCGA 4EWEA 1I1EA 3ES4A 1W6NB 5JAXA 4J1XA 2IXJA 1ONAA 1J3QA 3PNAA 4CDUA 4GH4A 3IKWA 2ZX3A 1UKGA 1QJZA 2NMOA 1HRV3 4GA9A 5GZEA 1NCRC 2QQPA 2JXAA 4XMIA 3AFKA 4WZCA 5FPZA 2CGNA 3FZ3A 4E2QA 5C33A 1LOEA 3AMPA 4ZU4A 4B7EA 3TB0A 1S0FA 5T55A 1PO11 3ILNA 1NY71 4WVMA 5K9YA 2PHTA 2I74A 1C5IA 2GC0A 5CB7A 4RHV3 2W52A 2JDZA 2ZA9A 2RS33 1AR82 1CAWA 2C1FA 3OYWB 3IIAA 4RD7A 3WXPA 1YI7A 1LOAA 2AZ5A 1DHKB 2AUYA 5FLIA 3T1LA 1O3RA 3SISA 1CR7A 1SLBA 4P9WA 4ORFA 1VBB1 2WS91 2OUHA 3LCPA 3M3QA 2ZZJA 1RUD3 2EXKA 4FPKA 2A5ZA 5KHKA 1KS4A 4JGZB 4JGYC 4PIYA 2DTYA 2OZ6A 3MIEA 3WQ0A 4Q0QA 4PBOA 3OY8B 4FOQA 3IDEA 1AXZA 1Q43A 4LEJA 4Q2FA 2WNVC 1UD1A 4YNIA 1DU3D 1XYPA 4YW2A 5SV8A 3ZSKA 3OJBA 4LO4B 3VZKA 1GNHA 3KD4A 5LK5A 3ROUA 1SFNA 4LO8A 2Q5TA 1S0IA 2H6BA 5BNNA 2RMU2 4Q4X1 4FAGA 4BQ1A 3PVOA 1HQNA 5C8WA 1GZWA 3MF9A 1FI2A 4HPKA 5T50A 2PLV2 1RINA 4CEYB 2W68A 4CTEA 2WA4A 2JKBA 2JD4A 2ZGOA 1RVF1 1WW4A 5KXDA 1RUG2 1W6MA 4EJRA 1UF2C 3WLUA 1NCQC 5KXBA 2WQ4A 3K48A 1D0HA 1OKQA 1AR61 1QJY3 1GKBA 2R043 2R072 3GZUC 4OFGA 3T1MA 2ZGLA 2IFWA 1KJLA 2VW1A 1EP0A 1DQ1A 4COYA 3OGGA 1VBB3 3VBUA 4XBQA 1UL9A 2GC2A 2XL7A 5FBZA 1PNFA 1O4YA 4GB31 3H1YA 4COZA 4YM3A 3B9CA 2ZS6B 3RJ2X 4P9LA 1V6NA 3AP4A 1ZZ6A 1MS4A 3FWEA 4HFSA 4UW6A 1ZZCA 3HAGA 4QQOA 1S2KA 3L2HA 1IS6A 4AEDA 4Y5Z0 1AR91 4AW7A 3R6SA 4OHWA 1V9U2 2NP0A 1XNDA 5HBAA 1LGCA 3OBTA 2B7YA 4LA2A 4IEXA 4WM8A 2XVGA 1QJY2 3BCWA 4NN0A 1DFQA 4AHXA 1OSGA 1RB8G 1NCRB 5BNOC 4HZFA 3O0VA 4N53A 1GANA 2R062 2ZX2A 4Z1VA 2QDRA 3H3UA 3AJZA 4R9BA 1BXHA 4PLMA 3JBG1 4AEKA 1CJDA 4PQ9A 4XFFA 3ZXJA 3VBSA 3EQEA 1C8NA 2Y0IA 2BNOA 4QQLA 2ENRA 3POWA 4O9GA 4V1PA 4XTPA 1MS0A 2BNMA 4NVPA 3BTAA 3J9SA 4IV3A 1B09A 4Q29A 3SCFA 2HWD1 4N9IA 3MYXA 4TLFA 1UN1A 3WDTA 2HWE1 4LUKA 4K1ZA 1JYCA 4MXWA 4X8PA 1WLCA 3VZOA 2CWSA 2RR13 1PIV1 2BUKA 1LU2A 1C8M2 4IEOA 4DINB 1EAH3 2WL1A 1R081 3AZYA 4LUMA 3QH6A 1LHUA 2GNDA 5IK4A 5JSRA 2OA2A 2R6QA 3RYKA 4LBOA 2KXLA 1PO22 3M8LA 2HWC3 5D8AB 2K0GA 3NAPC 2ATFA 3TWIA 3ILFA 2WT0A 4LNVA 4YVWA 3E5UA 3OTFA 1KRIA 5DG2A 4DQAA 1FV3A 3JZVA 4N43C 4OI0A 2VQAA 1POV1 4LHLA 1URXA 3LOIA 5D1IA 3AYDA 2PHLA 1JYIA 1BEV1 4XOGA 5FMOS 2RR12 3FUQA 4FP2A 4CDUC 2XLFA 4HETA 3I4IA 4Y22A 1VJ2A 2A75A 3S0MA 3M7AA 3J8F1 2R041 3DN7A 1KDKA 1TME2 1YFYA 4S2DA 1FT9A 1PO23 2WWSA 1O5UA 2ZGUA 2BTVC 2SLIA 1BJQA 4XF3A 3U10A 2QKDA 1N1YA 1PZ9A 3WW2A 1DGRA 3R05A 1AR72 2O8OA 3H0OA 2Q1ZB 4MH0E 2DFCA 2GMEA 3AP6A 3ZN5A 4QPGA 1H30A 1N1VA 4XFCA 3VL8A 2D6PA 2WZPP 4AI1A 2DU0A 4Z8BA 2R063 2VVFA 1NE6A 4Z92B 5BNPC 1BK1A 1MACA 4QPGC 1QY4A 5JR7B 4K20A 1GR3A 4P5HA 1DGLA 3Q9OA 1QU0A 3ZXEA 4A7YA 2RM23 2EIGA 3N7MA 2BEOA 2ZHMA 4YGDA 1QDCA 2GC3A 3AXEA 3WG1A 4BIOA 3OF1A 1LGBA 2I2SA 4ISRA 2B45X 2FHRA 3GZAA 3CF6E 2ZBJA 5C9AB 1H9WA 3JBG2 1C4RA 1VRH3 1ZBE1 1T6GC 1CAUB 1H1MA 5A33B 2VY0A 4YFZA 5J09A 1H1IA 3MPBA 1VRH1 3NL1A 3QACA 1C8M3 1I5ZA 1Z7S2 4CZSA 4N43A 4YG0A 4K6BA 1VAVA 2KM2A 2A3YA 3VDDC 4Q4X3 3V0AB 1RHI2 1OFNA 1RUG3 4W6YA 1PGW1 3NVCA 2WJSA 2A3XA 3IDBB 1IPKA 1CVNA 1QOSA 2CNAA 5DZFA 5K8SA 1E57A 2YDEA 5A32B 3ACLA 3N7LA 1AYM1 1NE4A 5JPNB 3AKRA 1EPWA 5A3LA 1WUVA 3E5XA 2GMMA 1QJU3 2C5DA 2CWMA 4YVSB 2VULA 4Y1ZA 4KWJA 1VBB2 4ZKTB 3UKVA 1QQP1 3AKPA 4CEWA 4A7KA 1N3OA 2EXJA 2ZGMA 1NLRA 3SHRA 2EVXA 4B4PA 2QE3A 4AE2A 3UKNA 2IXLA 1D4M3 2PAKA 3IPVB 4XJ9A 1H9PA 1AR62 1CAXB 5AC93 3ZXGA 5D8AC 1D4M1 1IHMA 1G9BA 4Y26A 4YZ4A 4LR4A 4MZUA 1O91A 4EV0A 1Q8OA 4LT5A 1CGPA 4QD2A 1NY72 5JIAA 1H2KA 2E51A 2WLQA 2FQPA 3HT2A 2PLV1 4YSFA 3WCRA 4UBHA 1V6LA 3ZYRA 2DUPA 5F6LB 4PJYA 1HDKA 3LA2A 2NMNA 3WW1A 1NZCA 4Q4Y2 5FMOL 1XNCA 2WT1A 4LBQD 3SCHA 4HT1T 4M00A 5K0UC 5LEKA 3VL9A 2B46X 3KQRA 2K2SA 2ET7A 2ZHNA 2X5IB 3VLBB 1ND3A 5T5PA 4K40A 2BFUL 3PHMA 3ZFGB 1PK6B 1FPN1 5AC92 3VBRA 2X5IC 1NQJA 4IESA 4AQSA 2DVAA 5FO7B 3H7JA 3HQXA 1GYKA 5GLWA 2WIIB 2R061 1BBT1 1HIXA 1PK6C 2CAVA 4GULA 2BWCA 1BZWA 1LENA 3J4UH 4KWKA 4C1WA 1H1AA 3DPRA 4RS5A 4FXGB 4XQDA 3VHRA 4CDQC 3LZZA 2YPJA 4LA3A 3HT1A 4MV2A 1ZZ9A 1YFWA 2HEWF 3POYA 4Q0SA 4IETA 4MGKE 2A71A 1HRV2 4K1YA 2HEYF 5F1RA 5I91A 2WNUB 1BCXA 5GZDA 2GN3A 1B35C 1GFF2 3THTA 4D7YA 3KGLA 1Q3EA 2YGLA 2P3KA 4MX3A 1RMU3 1ZBA1 4AQ6A 4IEZA 3X29B 3ZFGA 3NWKA 1AXKA 1QMJA 2O0OA 4UW5A 5JI7A 5KC5A 5KXCA 2ZX4A 3GALA 1QJU2 1VP6A 3FFQA 4C1XA 1AYN2 1FMD3 2R071 1W0OA 3WQ1A 1RUF2 3RQ0A 2K9ZA 4GALA 4FQZA 3GHNA 1RUG1 1POV3 1WMFA 3OGJA 2D98A 4QGLA 5SV5A 2PHWA 1AHSA 2ZGPA 4Q4W1 4B7KA 2DURA 4BE3A 2P34A 4BA6A 4AEDC 4AEJA 5F9TA 1WCSA 3VKMA 1JH5A 1FX5A 1N47A 1UMZA 3UV9A 2XGXA 4XIKA 1HW5A 3WP5A 5JOZA 2BGCA 4OZXA 1RTVA 3AZZA 2R0HA 5JZGA 1C1FA 4CDWB 4XQ4A 2QZ3A 3M3OA 4FTSA 1FYUA 2G9GA 4YZ3A 4MLOA 2WSUA 3AMNA 5BNNC 2OZJA 4C0HA 4G9SB 1OQEA 4WM7C 4BLJA 4Y1YA 4YVSA 1OPMA 4XXPA 4COWA 1PNGA 1Z0HA 4W6WA 1AL23 3INAA 2YUEA 1LODA 5JDBA 5GLVA 3TN92 2ZMLA 1SBDA 4DRVA 1FOD3 1MZFA 4HSLA 1NCQA 3VKOA 1SLAA 4OHZA 2BBVA 2CTVA 5J3UA 1C5HA 1QXRA 1IOAA 2IXCA 2N7GA 4JGZC 3IT8A 3BALA 2BWAA 1WCDJ 3DUIA 5GKAC 2VW2A 4TWTA 2VECA 1R1A3 2RHPA 2DCJA 2XBO1 5KHIA 1RUI1 4N43B 1ALYA 4C91A 4ISQA 4BM8A 1GLHA 4P14A 4META 3WG3A 4Y4YA 1IKPA 4DPNA 3QBQA 1V00A 4YGCA 5F6KA 3ILRA 1YIPA 1UKRA 3D6EA 4L99A 3WV6A 1FPN2 2GU9A 4FPJA 2WT2A 3ZDSA 2A70A 5I0TA 1AX1A 1DLLA 4DS0A 2CGOA 2WZR3 4QPYA 4AGVA 2DUOA 4YW4