4YVSA

Crystal structure of the virus-like particle of a c4 strain ev71
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
226
structure length
226
Chain Sequence
SHSTAETTLDSFFSRAGLVGEIDLPLEGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGEVVPQLLQYMFVPPGAPKPDSRESLAWQTATNPSVFVKLSDPPAQVSVPFMSPASAYQWFYDGYPTFGEHKQEKDLEYGACPNNMMGTFSVRTVGTSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSIKPTGASRTAITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Capsid protein VP1
publication title Crystal Structures of Yeast-Produced Enterovirus 71 and Enterovirus 71/Coxsackievirus A16 Chimeric Virus-Like Particles Provide the Structural Basis for Novel Vaccine Design against Hand-Foot-and-Mouth Disease
pubmed doi rcsb
source organism Enterovirus a71
total genus 35
structure length 226
sequence length 226
chains with identical sequence D, G, J, M
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4yvsA00
3VBUC 1SMVA 4N53B 5J96B 4CDQB 1HRV2 1FOD2 1V9U1 1HXS2 1VB2A 4YVSC 5CFDC 2HWD3 1RHI3 5J98B 2XPJA 1NOVA 1WCDJ 5L7OB 4WM7A 4N53C 4CDQC 1AR71 4Q4Y2 1QJX2 1NY71 2RS12 2WFF1 3ZFFB 1QJY1 1RUI1 5DDJ2 1C8M2 1HRI3 3J8F3 1QJU2 5L7OC 2HWB3 1VBC2 1DDLA 2PLV2 1RUH1 4JGYA 5BNOB 4IV1A 4CDXA 1R1A1 1RMU3 2XBO3 3VDDA 4RFT0 1VBA2 4N43A 1BMV1 1M06G 1PO13 5AC93 1VBD2 5BNOC 4RS5B 2MEV2 3VBUA 2QQPA 5ACA2 1MEC1 3VBOA 4YVSA 4CDUB 2RMU1 1D4M3 5CFDA 1VRH2 4RS5C 5FOJB 2VQ0A 1FMD3 4N53A 4CDQA 1VBB2 1QQP3 4CDUC 1RUF3 2BUKA 1AR72 2TBVA 4RR3B 4FTEA 2Y26A 2RS33 1AYN3 1NCRB 5L7OA 3HAGA 4Z92B 1Z7S3 1ZBA2 1RUC2 1RVF1 1OPOA 5A33A 2WZR3 3ZFFA 1OOPB 2R073 2RR12 4RR3C 5BNPB 1VBE2 2R041 1NCRC 1RUJ1 4Y4YA 5BNOA 4Q4X3 1FMD1 1OOPC 2HWF1 2HWD2 1B35B 1RHI2 4GMP0 1HRV1 5BNPC 2ZAHA 1FOD1 5C4WB 1HXS1 1EAH3 1FPN3 1TMF3 4RS5A 3CJIA 2RMU2 1B35C 1HRI2 3J8F2 1QJX1 5C4WC 5K0UB 4Q4V3 2RS11 2HWB2 3JBG1 2BBVA 1NCQB 4CEYB 5DDJ1 1C8M1 4GH4B 1AYM1 2RM23 1NA1B 1QJU1 2XBO2 4YVWB 1VBC1 1BEV3 2PLV1 1VAKA 5K0UC 1A6CA 3S6PA 1NCQC 1PO12 1POV1 1QJZA 4CEYC 5AC92 4RR3A 4CDWB 1NA1C 1AL21 1NCRA 1VBA1 4LLFA 4YVWC 1R083 1K5MB 3JD73 1TME3 1VBD1 1RUJ2 1D4M2 2HWE3 1E57A 1OHFA 4CDWC 5BNPA 5ACA1 1H8TB 1POV0 1FMD2 4GB33 1QQP2 1K5MC 1VRH1 1PGL2 5C9AB 1RUF2 1B35A 1VBB1 1CJDA 1AYN2 3VBRB 5C4WA 1H8TC 1AUYA 1Z7S2 3ZFEB 1EV11 5FMOS 2WZR2 5C9AC 2R072 3JBG2 2X5IB 1ZBA1 1RUC1 2BPA2 3VBRC 2HWC3 1AYM2 5K0UA 5BNNB 4BCUA 1COV3 3ZFEC 1NCQA 4CEYA 2RR11 4GH4A 3VBFB 4Q4X2 1VBE1 1AR93 4YVWA 2X5IC 1IHMA 3TN93 1EAH2 5BNNC 1AL22 3ZFGB 1FPN2 2HWD1 1RHI1 1TMF2 3VBFC 4CDWA 4CEWB 1K5MA 4Q4V2 4FTBA 3ZFGC 1HRI1 2HWC1 3J8F1 2RM22 1RB8G 1H8TA 2HWB1 1BEV2 4CEWC 1X33A 5C9AA 1PIV3 4RHV3 2WS93 1RMU1 2XBO1 1EV12 3VBRA 4GMP3 1R082 3ZFEA 5CFCC 4AEDB 1PO23 1PO11 5AC91 3JD72 4FTSA 1TME2 3IDEA 2HWE2 1MQTB 1AR63 2X5IA 2BFUL 1RUE3 1BBT3 5BNNA 4GB32 1D4M1 4AEDC 2RS53 1R093 3VBFA 4EJRA 3VBHB 1NG0A 1MQTC 1RUD3 1QQP1 4Q4W3 4QPGB 3M8LA 1PGL1 1RUF1 3ZFGA 2RS31 1AYN1 3VBHC 2R063 1Z7S1 1RUG3 4CEWA 1ND3B 1PVC3 2HWC2 2WZR1 4QPGC 1COV2 2R071 4CDUA 4FSJA 3JB4C 3FBMA 4WM8C 2RS51 1RMU2 1ND3C 3TN92 4Q4X1 4Y5Z0 4Q4W1 5JZGB 1EAH1 1CD3G 2FZ1A 2MEV3 3LOBA 4AEDA 1FPN1 3ZXAC 1TMF1 3VBSB 1MQTA 1OOPA 5JZGC 4Q4V1 1V9U3 2GSYA 2RM21 4RHV2 3VBSC 3VBHA 2WS92 3JB8A 1BEV1 1VB4A 4SBVA 4JGYC 2RS32 4QPGA 2WFF3 1PO22 1QJY3 1RUI3 4PDWB 1R081 1RUE2 1BBT2 1ND3A 3JD71 1TME1 1RUH3 2HWE1 4JGZB 2RS52 1R092 1R1A3 4PDWC 3VBOC 1RUD2 1C8NA 1NA1A 4GB31 4Q4W2 1AL0G 1ND2B 1AR83 4JGZC 1GFF2 3DPRB 3NAPB 5JZGA 5A33B 2R062 1MEC3 1RUG2 2RMU3 1PVC2 1ZBE3 1ND2C 3VBSA 1F2NA 1F8VA 3DPRC 1ASJ3 3NAPC 5LK7B 4NWVA 3ZFFC 5D8AB 1COV1 1PGW2 5CFCB 1AR91 4QPIB 5C8CB 3TN91 1RVF3 5D8AC 3CJIB 1AR81 4PDWA 5A32B 2R043 1HX6A 4QPIC 1RUJ3 5C8CC 1ZBE1 2IZWA 1V9U2 3CJIC 1ASJ1 2HWF3 4JGZA 5ABJB 1HRV3 1FOD3 1HXS3 2ZZQA 1NY72 1ND2A 1PIV1 4RHV1 2WFF2 1QJY2 2WS91 1RUI2 4IV3B 3DPRA 5ABJC 3NAPA 4Q4Y3 4GMP1 1QJX3 4RQPB 2RS13 1PO21 3JBG3 4WM8B 2DF7A 1RUH2 5DDJ3 1C8M3 1HQNA 1AYM3 2WLPA 1AR61 1QJU3 1R1A2 4IV3C 1VBC3 1RUE1 1BBT1 2PLV3 4NWWA 5D8AA 4RQPC 1BMV2 1AR92 5CFCA 1POV3 1R091 2ZTNA 1RUD1 1AR82 1AL23 4QPIA 1VBA3 4WM7B 5C8CA 1MEC2 1VBD3 2BFUS 2GH8A 1ZBE2 4Q4Y1 5A32A 5FMOL 2R061 5ACA3 1RUG1 4WM7C 1ASJ2 1PVC1 1X36A 4JGYB 1W39A 1VRH3 4IV1B 4CDXB 5ABJA 3VDDB 2FZ2A 1VBB3 1PIV2 4N43B 1PGW1 4GH4C 1EV13 1RVF2 1AR73 4IV1C 5GKAC 4CDXC 3VBUB 4IV3A 2WWSA 3VDDC 1ZBA3 1RUC3 2R042 4RQPA 4N43C 3VBOB 2MEV1 4YVSB 1AR62 4WM8A 5CFDB 2RR13 1VBE3 2HWF2
chains in the Genus database with same CATH superfamily
1GICA 1REEA 1SMVA 5D2AA 4HVOA 4QB6A 5LB6A 1HRV2 2HEVF 4LPLA 5M0TA 1W9FA 1V9U1 1HXS2 4Y1YA 3THTA 4QM8A 4JQRA 4YVSC 2A75A 3G7DA 3VDBA 3O1RA 2P3YA 2VBDA 5CFDC 4HMZA 2EIBA 1RHI3 5FYSA 1UKGA 3SKJE 3CU7A 5IK7A 3MLJA 3MPBA 3WHTA 2IXHA 5FPZA 2JDHA 4WM7A 1AR71 3LFMA 1QDCA 5I0RA 1DP0A 1QJX2 3TEZA 4QX1A 1S0FA 3I2JA 3ZFFB 1F5FA 2D3SA 4ZS2A 2Y34A 1RUI1 1VAVA 2JDMA 4OVEA 3CZJA 1PM7A 1YJLA 2VNOA 1HRI3 1UZZA 4E9KA 2HEYF 1ZA7A 1MPXA 3NKTA 5FJHA 2R0FA 5L7OC 1G9DA 1VBC2 2HH9A 1DDLA 4N7UA 4W65A 3T08A 2ZKNA 3N7JA 4CCLA 4I0WB 4JGYA 5IW0A 1OLRA 4I3PA 5F1RA 1RMU3 2XBO3 2WNVA 4M3CE 2H6CA 4U36A 5L9BA 3M3QA 4Q0SA 1SBDA 2QZ3A 5AVPA 2Q8DA 2PHRA 4RFT0 4KU8A 1BMV1 3DXTA 2ORXA 5GLZA 3PHMA 3C7GA 5B2GB 2X53S 1PMHX 1PO13 1QY4A 3AZWA 1Q8VA 1BVP1 2WQ8A 2WYSA 4RS5B 4BISA 2XKOA 5FQ0B 3GHMA 3WEZA 5C6CA 2OX0A 3U11A 3ACGA 1W6MB 2ZGOA 1BLZA 1VALA 3H42B 5CNAA 5ACA2 5EWSA 1POQA 2LTNA 2VMIA 3R4DB 4GWIA 4CDUB 2XHNA 1LNSA 2J1TA 1CQ9A 4YGDA 5T50A 1U5ZA 3SISA 5ISLA 3I59B 3RJ2X 1DZQA 4HVQA 5F6KA 1FMD3 1O59A 4OHVA 4YGEA 4KGGA 1OFNA 4RSUA 1W6PB 2CTVA 3E6BA 4RR3B 4LJHA 1HB4A 2D5FA 5KXDA 2RS33 2JB4A 1SPPA 3T4HB 4M0HA 4ZXKA 4AGVA 3ZXJA 4UOJA 1Z7S3 3GBFA 1JUIA 1RVF1 1OPOA 4P9WA 5JXHA 1ZM1A 4GWNA 2P3JA 4ATEA 4KG0A 1QOTA 4AFCA 3KZ4C 2WO3A 4X6RB 1NUKA 5H9RA 2A3YA 3S5AA 3AZVA 2P17A 1RUJ1 3O14A 3WDVA 2ZCWA 1IPSA 5JOYA 4E2SA 4FFIA 3AJYA 2HWF1 2Z69A 1JI6A 2NP0A 5JPNB 4R9DA 4QXCA 4IE4A 4L92A 3H1MA 5BPXA 1EAH3 4O9EA 4ITCA 1W2OA 2XJSA 2ZEZA 3U10A 1PM4A 4P02B 4KWKA 1DZRA 1IG0A 4YW6A 4EQVA 1DU3D 1REDA 2BGCA 4FPHA 3J8F2 4QGLA 5FZMA 4TXWA 1LECA 1ZZ8A 4J1WA 4Q4V3 4DXRA 5FZ0A 2SLIA 5FP9A 4LUMA 4NE9A 5I0UA 5KR7A 4LA2A 3M3EA 2G4IA 2PLV1 2ZS6B 1VAKA 3WF0A 5K0UC 4LHNA 2JXAA 5EFUA 4CRQA 3RMXA 3EQEA 3S6PA 3LCPA 1NCQC 1POV1 4P5YA 2R32A 5IVBA 2KXLA 4WVWA 4GULA 3SH4A 1NCRA 1VBA1 1CR7A 4Z82A 4YVWC 1OUXA 1PGSA 1QHDA 3MF9A 2JE8A 4BJ0A 2JE7A 2XVGA 4EZ4A 2Q5TA 1VBD1 3O12A 4AL9A 3MO4A 1D4M2 3FE5A 2YC0A 3BU7A 2XQXA 2GMMA 1OHFA 1Y7BA 3NMBA 5FZCA 1YUDA 3H8RA 3MIDA 1HB3A 3WX5A 4RGAA 1UY1A 1LTEA 3V56A 1CAWA 4GB33 4DMIA 2WKKA 1GWMA 3ZOIA 1QQP2 4AVBA 2N7GA 2PHFA 2R49A 2VUDA 3USUB 3GBWA 3OB8A 3LEMA 3N7MA 3B5LB 3SCHA 1B35A 4K40A 1KFXL 3Q8BA 4CCCA 3IIAA 1BZWA 1D4VB 1AYN2 5C4WA 1GNYA 1H8TC 2YFZA 2EXKA 1C1LA 1IS3A 3LOIA 1UMHA 1W9TA 3AL6A 4PIXA 4QXHA 3WZ1A 1LULA 2D6MA 4ZU7A 1W0PA 3PVNA 5C9AC 2YB7A 3JBG2 1WW7A 2X5IB 4O65A 2PHXA 3HIFA 4LO5B 3M3CA 2QZ2A 4JKLA 5BNNB 4Q8LA 3KB5A 1DFQA 5FZ7A 3ZFEC 2R7EB 1IQDC 4CEYA 4CYDA 2RR11 2E31A 5FBJA 2C26A 1CGPA 2J42A 3WG2A 1UCXA 4N8MA 2IXLA 4MH0E 3UT0A 2OUHA 3I4IA 3W21A 4M3CA 1JUHA 2A6XA 3RNSA 3K3NA 2YXSA 1OUSA 3K4ZA 1FPN2 4L99A 4YFWA 5CADA 1W90A 1FV2A 4P9YA 3VBFC 3E6CC 4CDWA 1C3HA 4XZPA 3UYJA 5EJ3A 1HN0A 3UKVA 5IVJA 3MLKA 4NPRA 3W9AA 1OKQA 4IEVA 4C91A 5EV7A 3RYRA 4BMEA 4BB3A 2B39A 3GYDA 4RA0A 4ES9A 3WP6A 1UIKA 5B4XA 4INDA 3VD7A 3ZFGC 2JG8B 3UKTA 4AG4A 1BK0A 4BQYA 4OUSA 1GSLA 1SACA 5EQUA 3OPWA 1RB8G 4D3WA 1JOPA 3NQHA 1AX0A 1F5JA 1L7RA 2B42B 3HNBM 1KITA 1VRBA 1KD7A 1KJRA 1ZX5A 1N1YA 2OA2A 2JJ6A 3AP7A 3LDRA 3PVEA 2W91A 5FTTC 1US2A 3EB7A 1JU3A 1AJOA 1DCSA 1U5YA 2YFUA 1L7LA 4M4PA 1SBFA 2WJSA 5A1AA 1TNFA 4NOTA 4YW3A 1LEMA 2FBEA 2MNGA 2A3WA 4XETA 5CFCC 3B93A 4AEDB 1NYWA 3UKNA 5AC91 5FZIA 3JD72 1U5XA 5C70A 3ASIA 2YC2A 4WVMA 4C0BA 1VLNA 4XQWA 5FP7A 2HWE2 4WZFA 3X29B 4QWNA 3KV4A 2EXIA 2BFUL 4XABA 1RUE3 2GU9A 4F83A 4QKFA 3FUQA 2AREA 3ZMNA 1ZNPA 2G9FA 2BDRA 2RS53 1XYPA 4EJRA 3A0KA 3VBHB 5E1RA 1MR5A 1FNYA 2QQKA 3AVSA 1TQ5A 4XACA 5A7OA 5IVVA 2K2SA 2XJQA 4AAPA 1SLAA 2WO7A 2WIIB 3OY8A 2YBKA 2JIJA 3I54A 4PBPA 2OPWA 3ZSMA 3PNAA 3OSDA 5DG2A 5F3CA 3PIJA 1OKOA 4XFGA 3PVBB 3AP4A 3NNLA 4WVVA 5FBZA 4CEWA 1J84A 2A6VA 1OC1A 1H1IA 1PVC3 1Q8SA 3CZUA 4JHTA 1GZWB 2WT0A 5EPAA 5IUQA 5A3PA 1COV2 1XU2A 2VXJA 4OHXA 2BRTA 4CDUA 4FSJA 5FYBA 3T2PA 4ARYA 4BQ4A 3FBMA 4QX5A 3BCWA 2D6LX 5FY7A 4W6YA 3WF4A 3I59A 3LQCA 1ND3C 3TN92 3V0BB 4Q4X1 4Y5Z0 3B94A 1CESA 2VVFA 2O14A 3MV11 4COYA 2C6SA 4XQDA 5K8SA 1WCUA 1DZTA 4TLGA 3U75A 3FHIB 3UJQA 2Q1MA 1LOFC 3AKQA 2V5DA 4JC1A 3ENRA 2RDSA 1TVGA 3WDYA 2VBBA 4XURA 4I0AA 1US3A 3F2ZA 3QH6A 4HT1T 1O3TA 4Y4RA 3PMEA 5CG9A 4DUWA 2WT1A 3KGZA 1V9U3 2H6BA 3ZN6B 3GZAA 2VU9A 5FLJA 1V6KA 2XMLA 2ZGLA 4FPKA 3VBSC 2ZX2A 3LAGA 3SEEA 4JTOA 4AFAA 1A8MA 5A7WB 4H14A 1W8NA 4Q27A 4JGYC 4MXVA 4JHZA 4TYSA 4QPGA 4K6BA 3AYEA 3VKFC 1BHGA 1O4ZA 1RUI3 4OYUA 1GR3A 5I0TA 2Y8KA 2DCKA 1ULDA 3Q8FA 4PT6A 1JYWA 1G9FA 4BLIA 5BUVA 2SBAA 1MS4A 2BBAA 3LF7A 2VUAA 2QQWA 2WINB 2WO1A 2Y6FA 1GQHA 2PN5A 3AZZA 2A6WA 3IT8A 3PDQA 4OHYA 4JX0A 2Y60A 4PDWC 1W8HA 3FFZA 1GOGA 3ZMOA 4L97A 1QXPA 4XMIA 1MZEA 1S0GA 5F8PA 2WNEA 1EUUA 4W4ZA 2Y6LA 4YSFA 4Q4W2 1WLWA 5DG1A 1RITA 2EA7A 1Z0HA 4GIQA 3A7QA 4JGZC 4LIUA 1GFF2 1RXFA 3D0SA 3ZKUA 4CZSA 3V0AB 5JZGA 2B9VA 3AMQA 1S0JA 2P6CA 2X05A 2J1AA 4MUVA 4DFSA 2VJXA 1ZBE3 2ERFA 2FMDA 1ND2C 4ASLA 4QB2A 1R64A 1XSRA 1DYOA 1F2NA 4H55A 4LE4A 3VLBB 5JIAA 5JXIA 1ASJ3 5LK7B 3ZXDA 2OIIA 4EN0A 4GKXA 1OLQA 3EYPA 1QOOA 2TEPA 3IMMA 1LRHA 3MI8A 4FPEA 3LWCA 4PI0A 1VIWB 5TSWA 5CFCB 3T2TA 2DWRA 3A21A 3ZYRA 3Q8AA 1DQ1A 4QDSA 2ZHMA 3E5QA 4GQ7A 1J3RA 1VJ2A 4UYBA 1W8UA 4A3XA 2D3PA 2QJVA 3NNJA 1CZVA 1RVF3 4IE6A 5FDBA 1OFSA 3LB9A 3FZ3A 1F4AA 1SFPA 1UMIA 1X8EA 1XNCA 5LBCA 4LKDA 4XCAA 4CXWA 3BPZA 3MHZA 3VUOA 2KM2A 2W52A 2XKPA 5A32B 2VZQA 1RUJ3 2WBKA 3PU8A 2FD8A 4CU7A 4CVUA 3AFKA 5IAVA 2ZHKA 3VZNA 1W3VA 2BGOA 2GNDA 3EBRA 4XCBA 2HWF3 5ABJB 2G19A 1OVPA 1JN2P 5IVFA 1VE0A 3KV6A 4CXYA 1IZ3A 2BP6A 2P6HA 1ZVFA 2XB6C 3M3OA 5LEJA 2ZA9A 4IDZA 4M3CF 2GMPA 2AC1A 4MGIE 1NY72 1H0BA 1QJY2 3ETQA 1JYCA 1J3PA 2ZBJA 3DPRA 4GAZA 4GKYA 1UOBA 4YZ4A 4FAGA 4PF1A 3N9MA 4CUBA 5IYYA 1PO21 2C4XA 4FOYA 4K1ZA 1XE0A 2DF7A 3I49A 1U12A 3LGRA 4RGKA 2VULA 5CKQA 4IUGA 2DCJA 3LEGA 5LK5A 4ISQA 3VHRA 3ZR6A 4JCKA 1Y9MA 1C1FA 1R1A2 1H8VA 3I3EA 3WLUA 4LKSA 1MVEA 1BBT1 2PLV3 3IAQA 1I3HA 4RQPC 1AR92 4Y1XA 5L19A 4OI4A 1POV3 4ZS3A 1V6LA 4LBKA 4QPIA 1VBA3 2BWCA 4WM7B 5C8CA 3H8UA 2QQIA 1YEWA 5I0DA 1VBD3 3KCXA 2BFUS 4L0PA 4YW5A 4CPBA 1H9PA 1FV3A 2VCMA 2VZPA 4J1XA 4QQHA 2BNOA 4DY3A 1QXJA 3USSA 4P14A 1I9RA 4JZRA 5BY5A 5DAXA 2ARCA 2L9LA 1WBLA 2QFEA 1S0IA 5JI7A 5FZKA 4JGYB 1ULFA 1W39A 2XDVA 1E5SA 1X50A 1GWLA 3ABZA 4Y1ZA 4XIOA 2WNVB 3LA7A 4YM1A 3RMYA 4AI9A 2GC3A 2F4PA 1CZTA 3APBA 4QKDA 1GLHA 3OUIA 2ARXA 1HB1A 1QH7A 1DYKA 1VAMA 1RINA 2O8QA 3E6DA 2VOXA 4LIVA 1RJ8A 4AFDA 4B7EA 3ACIA 2BJSA 1U0AA 3ZDSA 4ZZ5A 5KWRA 1G7YA 5GKAC 4CDXC 4YRDA 3IB3A 4MGQA 1JS9A 3LSEA 1RIRA 1IQAA 3NJYA 2WWSA 1PZ9A 3W58A 4A3ZA 4EN8B 2EXJA 1MVQA 2WAOA 1SG3A 1W8OA 2OVUA 1N3PA 4N43C 4PLNA 5E88A 4COUA 2GZWA 3LIGA 4PLMA 4WM8A 1H4HA 2QDNA 4Y5TA 5JIUA 1QMJA 2RR13 1GOHA 2JIGA 1JOJA 3IWZA 2HBTA 2JE9A 4IEWA 2Y64A 3FLRA 3HNYM 3GDBA 5J96B 3S30A 5DZGA 1FOD2 3WG1A 1MS3A 3VDCA 2X29A 1PVXA 4QX7A 2CV6A 2ORZA 2ZABA 3OBZA 3POBA 4LITA 5J98B 4BQ2A 1G9BA 1SPPB 5FFOC 1TEIA 3TNQA 1WGPA 4V2VA 3HNMA 2ADDA 2MPFA 5HCHA 4Q4Y2 4XBQA 4TLFA 4LXLA 5KBFA 2YYOA 2K9ZA 1AHSA 3POYA 5DDJ2 2Z2SB 1EP0A 5FMBA 5FY9A 4QD2A 2BTVC 4MGYE 1XSQA 3AM2A 4IGOA 1DGWX 1XB9A 2AEZA 4HPKA 1KRIA 4IV1A 4YFZA 4QX2A 4XF4A 4DY5A 4KMQA 2CU5A 4XHBA 3H3UA 2WC2A 1DLCA 2UYAA 2E63A 2ZXQA 4YG0A 5AC93 4CCDA 5T5OA 3RZKA 3VBUA 2ZMKA 5IK8A 4LBQA 2IXJA 2XGXA 4XUQA 1Q3EA 2VVDA 4QGNA 1DQ6A 1MEC1 1OA4A 1OVSA 3N9NA 1UU4A 1IPJA 5JLVA 1A8DA 5LW9A 2D5HA 3RWNA 1ENSA 3NNMA 1G9AA 2DU0A 4LBLA 2JDNA 4V2WA 4RS5C 5FOJB 2VQ0A 1EYBA 2PHUA 2YPDA 3H3ZA 4N53A 4OQ8A 4CDQA 4U2AA 4A7ZA 1VBB2 2GNMA 5HV4A 4QU2A 1HN1A 1JZ5A 2VUCA 2YBPA 2QQLA 4CDUC 2BUKA 2D6KA 2GNTA 4HK9A 3VKMA 3TRSB 5F3EA 2TBVA 5EZWA 1PX4A 2D6OX 2Y26A 3OYWA 2E9QA 5FZ9A 1O91A 1NCRB 3H7JA 1ZZCA 5HV0A 1UY2A 5CVRA 1RUC2 1YRZA 2V73A 4UW4A 1QEXA 5F5AA 3QOPA 4YW2A 1UYPA 4AW7A 1A34A 3NJZA 3DECA 1Y9QA 2UURA 4P9JA 4RR3C 2DUQA 1SHWB 2ZGNA 4AAXA 3ZYBA 2R041 5FP8A 2QQMA 4K1YA 1CAWB 4A4AA 3BIWE 3SMHA 2A71A 3LD8A 1Q8OA 1JH5A 2VE1A 4Q4X3 4C8DA 5A7SA 5BNOA 4I0BA 1WA4A 5JUVA 3ACFA 1ALYA 1B35B 1RHI2 4S2DA 3ZN4A 3MPPG 4GMP0 4OHWA 1O3RA 2FCTA 5C4WB 2VY0A 3QLQA 2Q1FA 4JKMA 3AP5A 5DZEA 5DPNA 5IHRA 5K9YA 1Y4WA 3HQRA 4CP0A 1XNBA 2GNBA 2WNOA 1HQWA 1ZRCA 2W68A 5ANNA 1XBFA 2VQUA 3M1HA 1HRI2 4QB1A 4A42A 4C1XA 2XLGA 4NHLA 1ZREA 5CZKA 1W2NA 2RS11 3JBG1 3JQXA 4IETA 4HOOA 4CEYB 1GU3A 1C8M1 1UMZA 4Z8BA 1G9CA 2IC1A 4YPJA 2VG9A 3LDKA 1QJU1 4Y24A 4AK3A 2XBO2 1YQ2A 2E33A 3O1UA 1GYKA 2AACA 2E7QA 3GJBA 1JZ8A 4ZKTB 1GP6A 1FAYA 3POGA 4M3CB 4Y1UA 3UK9A 1ZA4A 5AVAA 3A0NA 1A6CA 2WSVA 2VZ3A 4BQXA 1PO12 1QJZA 3GZEA 3WNOA 4YG3A 4Q5OA 4CDWB 3Q8CA 3VHNA 1JMUB 4LLFA 4AQ2A 3CKHA 2NYYA 4YARA 1LENA 3VN4A 2BU9A 2CDOA 4XTMA 2QNKA 1NLRA 5DUUA 3A22A 4BDVB 3U78A 2LALA 4JRAA 5CKNA 2VH9A 4NIAA 2A3XA 4FI9A 1UIJA 2D40A 4M00A 4XJ8A 4OHZA 5BNPA 5HCAA 3BKZA 3LPGA 5FP4A 1POV0 1UOFA 3NJXA 2EIGA 1FMD2 1UQXA 4KI5M 4XF9A 1YWKA 1N3QA 4XYXA 4E4DX 5JWPA 2E6VA 3BU0A 4KQ7A 2DVAA 4OI1A 3KT7A 3OGSA 1VRH1 1PGL2 2BNMA 4MV2A 3O0WA 1LAJA 3MLLA 1WLDA 2LROA 1CJDA 4BQ1A 5FZ1A 1GNHA 2GC1A 2ZMLA 1OT5A 1Z7S2 2WABA 2DCYA 3NL1A 4NRQA 2PQSA 4XF3A 5FCCA 5LASA 3WP4A 4F7ZA 4LNVA 1DHKB 2UU8A 4WVMB 4A44A 5FO9B 2JDAA 4XUPA 3OGGA 2IXIA 3RQ0A 2Z5WA 1ZBA1 4YW4A 4HANA 2XL9A 2WT2A 2HWC3 1AYM2 4Y33A 1Y43B 2FQPA 4YYOA 3WR0A 3ZYGA 4E8CA 1J1LA 1LJ7A 3H50A 3MUY1 4GH4A 1Q56A 4RFRB 4YZ5A 3ZDVA 1VBE1 2XG3A 2E53A 3UGHA 5FZEA 2G9GA 4WBBA 3IBMA 2X5IC 4AZZA 5LATA 1CWPA 1IHMA 3HVDA 3OY8B 1W99A 1WCKA 1EAH2 4O7XA 5BNNC 1W6NA 1AL22 1UL9A 2Z42A 2HWD1 4YWAA 3J26N 3TNPB 2OYZA 4AVVA 3RFRA 4UF0A 4CCKA 3ZSKA 3M70A 4CEWB 2HKXA 1K5MA 2ES3A 4Q4V2 4SLIA 4XFFA 3MIGA 4IESA 4ZPIA 5IJRA 4RYDA 3VZJA 4DNYA 5F5CA 3P3PA 3PJYA 1NZIA 1YIPA 5HCBA 4PIYA 3PVOA 4QQ2A 3J7NA 4XTPA 4D7TA 2C9KA 2HWB1 3EJKA 3IZOA 2XWJB 1DQ0A 3KSCA 5T5PA 2YUEA 3FHAA 2OPKA 3D4KA 3KD4A 5FYIA 3ZVXA 2JG8C 1PNFA 3KQ4B 1EV12 3BTZA 1RUOA 3KV5A 4EN6B 3I3QA 1MZFA 5H9QA 1NZCA 2QCSB 3VBRA 4Q26A 3ILFA 1PO23 2XWBB 2WO2A 4UBHA 1MS0A 3HJRA 5F37A 2E32A 1GZCA 2BOJA 4FFFA 1GWKA 3O1VA 2QDRA 3ZYHA 4BQ3A 1BBT3 1OQ1A 1NQJA 1WA6X 2JDYA 5L9VA 4OULA 4GB32 4AEDC 1BJQA 2GAUA 1Q43A 2P3IA 3PUAA 3R05A 3THPA 2Z4FA 4K3UA 1W9SA 3AX4A 3ZYFA 3DV8A 2CDPA 5CISA 3K2OA 2HYKA 4L11A 4AHZA 1CX1A 4QPGB 1CIYA 2VTFA 1BQPA 5FPLA 5FZBA 1RUF1 5IFPA 4PF5A 1KDMA 2PAMA 3I2IA 4XW3A 4R52A 5FUNA 1PK6A 3U07A 4QDQA 3VBHC 1CPNA 5E89A 5G05L 2DUOA 2DFCA 3I2KA 3G6JB 4DXZA 2AYHA 4QXBA 4KBZA 1LU1A 3SXWA 2WZR1 5GM0A 5JSPA 4LOSA 2R071 3C7EA 3KS7A 3RRDA 1UD1A 5JR7B 5LRRA 3LDBA 4ZU4A 2NMNA 2YY1A 4D8MA 4WM8C 5DAQA 2AGSA 3B3QE 4FOWA 3K48A 4LO8A 5KHHA 4BWOA 3AKSA 1I5PA 5FZOA 1MS9A 4LA3A 3DN7A 4Q4W1 5JZGB 4NRPA 3SQOA 1B09A 1E5RA 1CD3G 3IPVB 4L8QA 2G9ZA 3RZGA 1TMF1 1JZ4A 1H2NA 4W6WA 1MQTA 3SEPA 3WF1A 1KFUL 1SCRA 1SQ4A 1W6QA 3DYPA 2FDKA 2P3KA 4CA9A 4XJUA 3CJXA 2WYFA 1QKQA 2JECA 3I2GA 1LGCA 4E2QA 3ZO0B 1BYHA 4D69A 3B69A 2CSGA 2RM21 5FYMA 3R4UA 2RDQA 1ACCA 3DCQA 5A6XA 1BEV1 1F4HA 1QGLA 4HSJA 5A3MA 3VL8A 3IAPA 2C1FA 1YFWA 1BKZA 3ZN5A 1LHNA 4AI3A 3GF6A 1UYZA 1NLSA 3BTAA 3WDWA 3VL9A 4EV0A 3FWEA 1J3QA 1R081 2VAUA 4XILA 2ENRA 1RUE2 2J7MA 2IVJA 1SLCA 2KD7A 1TME1 3GALA 1XE7A 2PYTA 1JZ7A 2RS52 3RG0A 5A3TA 1S0BA 4MGSA 2A7AA 2VNVA 3N36A 4DEVA 2D3RA 3BB6A 1H2MA 4COZA 1WZXA 3MW2A 3OOXA 3GZTB 4ONUA 5IFTA 4UWDA 1HIXA 1AR83 4GZ9A 4B29A 3DPRB 1W3XA 2QE3A 5EJ1B 5I8SA 1KEXA 1WD4A 1MEC3 3RDIA 2ARBA 1LHWA 1PVC2 1X9TA 4QM9A 1DQ2A 1UX6A 2VZVA 3KVAA 2FHRA 4CCJA 3PJQA 4D6RA 4C90A 1JHNA 2BERA 3K4DA 2R16A 5T3NA 3ZPOA 1F8VA 5AFBA 4LKFA 4FVVA 5F5QA 2B4KA 5KC5A 5GZGA 1LOGA 1PGW2 2A6ZA 2DURA 3MICA 2DTWA 1AR91 4FPFA 2YZ4A 1J59A 3JZVA 1O5LA 4QPIB 4BXSV 3OBAA 1UN1A 5C8CB 2JDPA 3S7IA 3OGRA 4P9IA 4UFHA 3ECQA 4BA6A 4XUTA 1C4RA 3KCYA 3IMNA 3MYXA 4AQSA 1S0CA 1N1VA 1XOYA 4Y3OA 4D6QA 1G6NA 1O5UA 4E8DA 3H3LA 4LLOA 2R043 1HX6A 4Z07A 3W5NA 3CNAA 2IZWA 1V9U2 2JD4A 5E8AA 2D44A 4IEPA 4M4RA 2VTXJ 2DV9A 4KWJA 3AXEA 5F32A 4NIDA 3FL7A 2Q8EA 3B9CA 3K51A 3PUHA 5FWEA 5HI0A 4LUKA 1NLQA 2HJIA 5T54A 3WG3A 3K3OA 3DYOA 2ZZQA 3MF6A 1DGRN 1CN1A 2XONA 4RHV1 4RD7A 5DABA 5CA6A 3TYJA 1SCSA 2WS91 3AMHA 4ATFA 1RUI2 5DQ0A 3VDAA 3WV6A 5ABJC 1FT9A 2WNUA 5C3QA 3NAPA 3VKLA 4BQWA 3I2OA 1X9PA 1I1EA 2VNRA 2ZX3A 1YYNA 1WMEA 3VV1A 2RS13 5SV8A 1VMHA 3JBG3 4K8RB 3BOWA 3ALQA 3NV2A 2JG9A 4WM8B 4NIIA 5A6YA 1C8M3 1HQNA 5JR2A 2BGPA 1W6OA 3QH7A 1CX4A 2WLPA 1FATA 2R6QA 4IGPA 4IXLA 1AR61 1SLIA 5FYHA 3WNMA 1LGNA 1QJU3 3HD8B 4AQ6A 1YC61 5A6QA 3KV9A 4NWWA 5D8AA 2DUPA 4GJZA 1BMV2 2VMGA 1R091 2AR6A 2ZTNA 2Y0OA 2E7AA 1RUD1 3FX3A 4H7LA 4AEMA 4QAWA 3CMGA 2RJLA 4CP1A 1N47A 5FZDA 3VKOA 3S7EA 5A80A 4BH9A 2LUWA 2PAKA 3RS6A 1WUVA 1ZBE2 4MHUA 4Q4Y1 3UETA 1UZWA 4N90A 3OPZA 2R061 5IT6A 1FYUA 1GUIA 1JU4A 4PBOA 4OI0A 1RUG1 2HBUA 2RJ2A 1ASJ2 4WM7C 4XXPA 1XC6A 1JYTA 1HDKA 1X36A 4HPKB 4YZ1A 2DBIA 1VRH3 3KHCA 3E1F1 4IV1B 3OD4A 3J7HA 2J22A 2VR4A 4KG8A 3NV1A 1QDOA 2DYCA 5J36A 5LY1A 1GP4A 5CEHA 4FPYA 4MGTA 2FZ2A 1PIV2 4LTAA 4DB5A 1EY2A 4HETA 1OH4A 5FYCA 3WDTA 1UY4A 2IVIB 3PIGA 4GH4C 1LOCA 1QXRA 1RVF2 1UAIA 3N35A 2I2SA 1AR73 1NKGA 3ORJA 2GH2A 3W5MA 1RGSA 4IGQA 1ZRRA 2QQVA 3VBUB 4IV3A 2WNVC 4LBQB 4PCRA 1ZRIA 2WZPP 3ZYJB 1ZBA3 4H7MA 2EICA 2W46A 5FYVA 4JVAA 2V4AA 2W1SA 2P34A 4Y5SA 4Z1VA 1P8JA 5C3SA 1ENRA 1ZZ7A 5GLUA 5A7NA 5FYZA 3ZYIB 5LA1A 4TTGA 1VBE3 1NE6A 1C28A 2HWF2 1QNWA 2EIEA 4FT8A 4G4FA 4N53B 4CDQB 1Y9GA 4MVTA 2CL2A 2QBXA 3ZXEA 4ISRA 2VMCA 4BE3A 2GALA 2YDEA 1VB2A 3IKWA 4NHYA 5DZFA 4K9SA 1ZZ9A 2HWD3 1BK1A 2ZPXA 3MFCA 4RN5A 2GP3A 5FPVA 1W2AX 2UWCA 4NR1A 4FOQA 1NOVA 1WW4A 3OYWB 1U5IA 1WCDJ 3K4AA 4DO0A 1W8ZA 2UY8A 3GJAA 5J09A 1SLBA 1LOEA 1DG6A 4OZXA 1IKQA 1O7FA 3GCXA 4KWUA 4XJ9A 5DAVA 4UFLA 2WFF1 3MDPA 3IPVA 2B46X 3W20A 1QOSA 4C1WA 4P08A 4XF1A 1UPSA 4XC9A 3T0DA 2HWB3 4MYEA 2PLV2 4IQPA 1RUH1 4XBLA 5BNOB 2PQQA 2VZUA 4AVAA 1BVVA 1WKYA 1APNA 4XFHA 4YZ2A 1ODNA 3ME2A 3POWA 3VDDA 4CUAA 4TWTA 5A3UA 5FYUA 2D7FA 5CKMA 3CIHA 1VBA2 1RC6A 4BLJA 5FXVA 4OMDA 3T0BA 2JWPA 1ENQA 2I45A 2PELA 1M06G 1OPMA 3OG2A 5T5LA 1VBD2 3U14A 3N9QA 4K7JA 2MEV2 4XFBA 5L9RA 4CPBD 1OLME 2Y38A 4PJYA 1GV9A 5FAXA 1MS1A 3AKPA 2WDBA 1HKDA 4YVSA 5CFDA 1OI6A 2VZ1A 3H8XA 1NE4A 1YJKA 1IS5A 4HK8A 4GWJA 4XUOA 4LK6A 3ZPYA 2RG4A 3ZYPA 1DGLA 4ARXA 2J1EA 2C9AA 5KHGA 4YGCA 1YHFA 2VXRA 5H9SA 1RUF3 4XFCA 2YGMA 3BPSA 2CWMA 3WW3A 4PHZA 2Y0IA 4FTEA 4HXCA 5A7PA 1YQ6A 5C71A 5L7OA 2W9XA 1HQLA 3HAGA 3ACLA 3CHXA 3WOGA 4Z92B 1SBEA 1OF3A 2IFRA 2PHWA 4OI2A 2AUYA 2WZR3 4P9GA 1CAXA 3RJRA 3NWKA 1OOPB 4E4ZA 2R073 2RR12 5BNQA 2VZTA 2DBNA 2XLAA 4LO7A 3WQBA 5BNPB 5JMOA 1CZSA 1CAUA 3FLTA 1NCRC 4UFJA 3P1IA 2VQAA 2A1XA 1D0HA 1UWWA 4KBBA 4D94A 2W2IA 2EAAA 1FMD1 1XXNA 2D98A 3I7DA 2EVXA 3DYMA 4LBNA 1OD5A 4AF9A 1HRV1 2ZAHA 4AVCA 1HXS1 4QDRA 2NMOA 2W1WA 1AVBA 2Y6GA 5JMCA 3M3IA 1H6XA 1TMF3 1X82A 4M01A 5APAA 3RPQA 1C5IA 2RDNA 2W87A 5GZFA 2RMU2 1B35C 1V6OA 4EWAA 3IDCB 5D21A 4XJWA 1QJX1 3DL3A 1IGOA 2B45X 5C4WC 2BBVA 1YIFA 3AK0A 3ZXGA 1LHOA 1LOAA 1YO8A 4FP3A 4GH4B 1AXZA 1AYM1 2RM23 1YFUA 1FXZA 1NA1B 4YM3A 3RZMA 1ZZ6A 3N7KA 5JCTA 1VBC1 1BEV3 2J1UA 2ZGPA 1URXA 1O4TA 5IVEA 2CAUA 1W6NB 4QX0A 3H1WA 2VW1A 2OQ6A 4CEYC 5AC92 5FWJA 2YU1A 2FCUA 3LEIA 2YROA 4F8AA 3WDUA 1ENXA 1XPWA 2DVBA 4WV8A 4AR2A 5BYNA 3EO6A 1AL21 4UF0B 5GLVA 1R083 4BK5A 2R1BA 3KF5A 4FPLA 4ZHNA 4NPLA 2W3JA 1K5MB 4Y22A 1AJKA 2RV9A 1TME3 5EYXA 4D7YA 1W2TA 2ATFA 2OS2A 3S5QA 4LEJA 5FY4A 1SFNA 2VUJA 1XYNA 3ILRA 4CDWC 2E7TA 4COWA 5ACA1 3ON7A 5DAWA 1WCSA 4XDQA 4LK7A 4O9GA 1W03A 5GJ6A 1DGWA 2H0BA 4XAAA 5DUWA 1LKNA 1O6UA 3I3BA 4PQQA 5HCFA 3QCWA 3HR9A 2BYVE 3HWJA 3VHPA 3OUHA 3VBRB 1CJPA 1AUYA 2NN8A 4MLOA 2J1VA 4HN1A 4JAAA 1EV11 2ZX1A 3DXUA 5FXZA 5LBEA 4MGZE 1IPKA 4LHSA 1MS8A 4NHXA 5A3OA 5FPXA 2VM9A 3GBGA 2O1QA 3CDZB 3SNMA 2BPA2 3FHQA 5FPBA 4AEJA 1J83A 5K0UA 3V65A 2OUJA 4FFHA 4BCUA 1NCQA 2GN3A 2QVSB 1RJ7A 4DUVA 2VW0A 4Q4X2 5FZAA 4HL0A 3C7OA 3JCIA 3KF3A 2YMZA 4J6GA 1AR93 3SITA 4YVWA 2DDUA 4AI2A 3QACA 3R0RA 1O3SA 4Q8KA 5DXDA 1RL3A 1W9YA 4XDPA 1L3JA 1ULPA 4LHLA 5HPOA 1GOFA 3KT4A 1PK6B 2VECA 1AX2A 4I02A 2WA4A 3MIBA 4QX8A 1CONA 2VBPA 1ONAA 4AQTA 4LT5A 3POEA 1OLMA 1X7NA 4FTBA 3OD0A 3WHUA 4OMCA 2B5HA 3Q9OA 2FDJA 1RYYA 2X10A 1Y3TA 3J8F1 2ZGQA 5F2SA 4CCEA 5JI9A 4R4ZA 1H8TA 4CCOA 1H1AA 5CIRA 5G04L 3TEWA 4CEWC 2ZKLA 2ZMNA 1REFA 2XQRA 5F3IA 5IVCA 1YQCA 1HB2A 2BVVA 1V70A 3ACHA 3M2MA 4RHV3 3WNNA 4B4PA 5C9AA 2WS93 5FZOB 3M4FA 1ULCA 1S4CA 1HV0A 4XDOA 1S2EA 2VNGA 5JSRA 3ZFEA 5FZLA 4Q0QA 3FBYA 2GN7A 1V0AA 3SLIA 3IDEA 1WBFA 3H8OA 4L2NA 1MQTB 1OH3A 3H9AA 1W6QB 1AR63 1WCQA 3MV01 5FOBB 1BXHA 1W05A 3WY6A 3POSA 2NPIA 4ES8A 1D4M1 1HLCA 1NT0A 4D0QA 4FBFA 3HBKA 1R093 3VBFA 1W28A 4YGBA 1W9WA 4LE3A 3P5BA 1RUD3 2C24A 3SC7X 3UV9A 4DIQA 1QQP1 3LPFA 3OF1A 1Q8QA 4AGGA 5FLIA 5LBBA 4B4QA 2YHJA 1DYPA 4ET7A 3AZYA 3ZFGA 4A6OA 2JKXA 5LZ6A 2JX9A 3DKWA 4JDNA 2D6PA 1AYN1 2WQZC 2R063 2VZOA 1RUG3 4YG6A 2B7YA 3HMYA 2HWC2 2PAEA 3WDXA 5CYYA 4QPGC 4K20A 1UO9A 4NAOA 3KGLA 3HQUA 1ZZBA 3B02A 1PMJX 5LY2A 3DUIA 3WNKA 4NMIA 4CSWA 2XOMA 5JOZA 5CBLA 3SH5A 3B01A 4EN9B 2RS51 1RMU2 2WZ8A 3OPTA 4ZY9A 1A78A 1LCLA 5LA9A 1XYOA 4UXAA 1QH6A 1ULGA 3J7LA 4HLTA 4D7SA 2P2KA 3VZLA 4RL7A 1UY3A 2R30A 2ZHLA 4S2FA 3OJBA 1ULOA 4JQTA 4XJAA 4CCMA 3ZXFA 4CTEA 2FZ1A 3LOBA 3PTRB 1FPN1 5FZGA 2VMEA 4P9XA 4DS0A 1N1TA 3EMRA 3KCCA 2CGOA 2XJUA 1K12A 4YZ3A 1OOPA 3ZX7A 5JZGC 1IS4A 2AENA 1EUTA 4XPVA 3BOPA 5C8WA 1G86A 2A73B 1SZBA 2ZGTA 2TUNA 4QMAA 4NUBA 5FREA 2GSYA 4TZDA 4LO4B 3IDAA 3L2HA 5EJZB 5DUXA 1H30A 2E26A 5LBFA 2V72A 1VB4A 3AL5A 1O3QA 3BYWA 4KH9A 2ZGKA 4Q0UA 2RS32 3E5UA 1S0EA 2WFF3 5FYTA 1PO22 2E51A 4A45A 1F35A 3WD5A 2PHLA 4LOTA 2V09A 2MHFA 2WQ4A 1NX9A 2RJKA 3HOBA 4XZUG 1BBT2 1ND3A 3JD71 2V5YA 4FQZA 4X8PA 1RUH3 5IK5A 4Q0VA 3TEXA 3FLPA 1YI9A 2HWE1 5FMDA 1LHUA 4O61A 1XJAA 3WUCA 3P6BA 1FI2A 1C8NA 1NA1A 3UGFA 1LOFA 1I6XA 1VR3A 3AKTA 4HG6B 4DPNA 4IE0A 1AL0G 5KHJA 4K8FA 4LMFA 5CG8A 5EIYB 4Y20A 4K21A 4A7YA 3T4VA 1G8WA 1W0OA 4J25A 2WNUB 3B9IA 3NAPB 5FK8A 5FR3A 4IEOA 5A33B 3RZLA 4URAA 1W8WA 2ZHNA 4QT6A 4YLZA 5C3OA 4ZXEA 4FPGA 3ZSEA 1H6YA 3OBRA 4E4HA 2JG9B 3T2QA 4B7KA 1W6OB 3VBSA 5K7PA 3PURA 4GA9A 4KU7A 3MIHA 4IERA 3DPRC 3EHKA 5LCWL 1DIWA 4NWVA 4KL1A 4AWDA 1UYYA 5D8AB 3LA3A 1COV1 2CNAA 3VD4A 4R9AA 2JKBA 1QIQA 3NV3A 1VMJA 1JHJA 5LRSA 3ZSLA 3INAA 4MX3A 1GQPA 3IDBB 3MIEA 4RGGA 5F6LB 2BNNA 2XJTA 5CB7A 3WP3A 2O0OA 1NXMA 5D8AC 3TN91 5I8YA 3O1PA 5JXGA 1W8FA 5F39A 3CJIB 1UXZA 4AFBA 1DQ4A 3DF0A 3LEKA 4MHRA 4PDWA 2P4EA 1J1TA 4YM2A 2A5ZA 4OZOA 2ZJCA 4QPIC 3H7YA 5C8CC 1ZBE1 1OQDA 2H0VA 4Y26A 3D0JA 2C0ZA 1DF0A 1ASJ1 1AXYA 1DGRA 2QQJA 4JGZA 1BCXA 2BV4A 3POJA 1HRV3 1IG3A 1C5HA 3U1XA 1HXS3 3NNFA 2VGDA 2Y6HA 3CL1A 3OBTA 4NIGA 2XJPA 2IXCA 3GHNA 4LQRA 1PIV1 1ND2A 3LFIA 2BWAA 3SCGA 4A6SA 4IV3B 4BK4A 3J4UH 3RYKA 3O1SA 2XVLA 3ITQA 4GMP1 4M0NA 1QJX3 4CP9A 4R9CA 3N3HA 4IE5A 3RSJA 2LRPA 3WSOA 3RZJA 3HQXA 4V1PA 5FO7B 1AYM3 4KWLA 4LULA 1YCIA 2VMDA 5LEKA 1VBC3 2UY9A 5JAXA 4HZFA 3PUIA 4YW1A 3AFGA 3ZR5A 3UESA 4XFIA 2FCVA 5FLHA 2NQYA 3IN9A 2F4LA 4GWMA 4AVSA 1AXKA 3JQWA 1AR82 1DBNA 1GBGA 1E5IA 1AL23 4LBOA 1SDWA 4DRVA 1CAVA 1OA2A 1MEC2 4MG2A 1UU6A 3VB9A 1HJFA 4BM8A 3HPNA 4BMBA 5FPAA 4MO3M 2BQPA 2BW8A 3E5XA 2GP5A 1IS6A 4Q2FA 5FMOL 1IKPA 5ACA3 5C5UA 2XJVA 3GGLA 4NHMA 4XBNA 3WINE 2CGNA 2O8OA 5ERLA 4LO6B 4AI8A 2KA3A 3H0OA 1WD3A 5FP3A 1UXXX 2Q8OA 3U37A 1OQEA 4HSLA 3VZOA 2WN2A 2VOKA 3VDDB 3AXDA 1OA3A 1WLTA 2WN3A 4MOAA 1GKBA 1TE1B 3PLQA 1YLLA 1EV13 2CYFA 2ZX0A 4Q0PA 2PTMA 3MEPA 2YC4A 2VOVA 2ARAA 1OURA 2W94A 4IV1C 3WVJA 3AYDA 4MXWA 4BHPA 4XIKA 3GM8A 5E6HA 2R042 4RQPA 3U4XA 2MEV1 3BODA 4YVSB 4B4RA 5CFDB 2WSUA 2ADEA 4XUNA 4XHXA 4EZHA 3KMHA 4BZ4A 1K45A 1S2KA 4NROA 3AC0A 3GCWA 1OMIA 2QQUA 3VBUC 5HBAA 3VD9A 1Q8PA 5FRAA 1JYNA 4NAMA 1LOBA 3C7HA 2ZGSA 2CGPA 3C7FA 2DFBA 4D6SA 5FUIA 1XNDA 2LS6A 5FV3A 1XNAA 2HYXA 5FIXA 1N1SA 1JBCA 2ETEA 2XPJA 4QX3A 2ZEWA 5L7OB 4N53C 5GZDA 4CDQC 2OZ6A 3LKJA 1F15A 2LW8A 1NY71 4JRLA 2RS12 3CF6E 1CAXB 1QJY1 4MGKE 4CCNA 2DU1A 2YU2A 3E97A 3MUZ1 1ST8A 2JEMA 3OCPA 4ZZ8A 1C8M2 4QKBA 1EPWA 3J8F3 4ZONA 1CAUB 1H9WA 4LKEA 1F31A 1QJU2 3RZHA 3LIHA 3RVHA 3LE0A 5A7QA 2PHTA 3TAYA 1D2QA 4OUMA 3VD5A 3BGAA 4IL7A 4CDXA 4G3YC 3NO8A 1UW8A 3MFAA 1H2LA 1R1A1 3AZXA 3ILNA 4XFAA 4I09A 1WMFA 5FY8A 1KXGA 2CAVA 3AYCA 5FPUA 1ODMA 1T6GC 4N43A 2V4VA 5EXOA 1F9KA 1AR62 4A2UA 3QBQA 1PNGA 1PZ7A 5BNOC 3O1OA 1TZOA 2RVAA 5H9PA 4QGMA 1MZ5A 2B9UA 2QQPA 3C3VA 4XVHA 1H4GA 3HT1A 5AFEA 4X8NA 1GZ9A 4DEQA 4L9BA 3VBOA 1UPIA 2OT7A 1XNTA 4B8EA 2RMU1 5KXEA 5FZ8A 1D4M3 2GC0A 2R1DA 4W6XA 3KWVA 3VHOA 1VRH2 1V6MA 4OQ9A 5F9TA 1S1AA 2VVEA 3U4SA 3HEIA 3CEWA 3IM0A 1NXD1 1CIWA 1AZDA 1H1MA 1QQP3 2W95A 2ZOEB 3JU9A 1JYVA 2R0HA 3S57A 1YXWA 1XNKA 4LORA 3BUCA 5J3UA 4HFSA 3AP6A 1LESA 5T55A 1GANA 1AR72 4COVA 4N7IA 2VZSA 3PTYA 2CWSA 1AYN3 2YBSA 1H2KA 2I07B 3N7LA 4EN7B 3NW4A 3OGVA 2Q0AA 4DZGA 1RUNA 3OEAA 2GDFA 1SDDB 1ZBA2 5FKCA 3WP5A 1D7PM 4Y22B 5A33A 1Q5OA 2WWUA 3ZFFA 5L73A 4Y1VA 1N3OA 2K46A 3FN9A 4A7KA 3OGJA 1VBE2 3FFQA 3VZKA 4S2GA 2EXHA 3VGIA 4Y4YA 5CU1A 4R9BA 3B00A 5JOWA 2IFWA 1KJLA 2ILMA 2OW4A 3T2OA 1GP5A 2WLQA 2X09A 2D6NA 3ES1A 1YQ8A 4OLLA 1W8TA 4NO4A 3GXUA 5FZ4A 1OOPC 4META 2HWD2 1PZ8A 4ORFA 3ZLIA 2AEYA 5BNPC 3RI8A 4TN7A 1FOD1 3RYPA 3W59A 2A70A 4YNIA 1JZ6A 3NV4A 2GC2A 2Y33A 5JOXA 5KXBA 1FPN3 3A23A 3POFA 5L36A 4B1LA 5HXMA 2UWBA 2VTXA 2WUHA 4RS5A 3CJIA 2ZAAA 3FC0A 1LU2A 1QU0A 1QWRA 3HN3A 2WFPA 4MADA 4AI1A 5FQ0A 2W47A 3THCA 1W6MA 3Q8EA 4W8JA 3I8TA 5J37A 5K0UB 3WG4A 2ET7A 2HWB2 4FPOB 4AYUA 1NCQB 3ELNA 2WRAA 5DDJ1 3I2FA 4QHBA 1SEFA 3D6EA 1UOJA 2P37A 4Z2WA 3K77A 4GJYA 3MW3A 3AMMA 1SFYA 2PFWA 3KHBA 4PI2A 4YVWB 3ZIXA 2P5BA 2PMWB 3AB0A 4NRMA 4ZU5A 3UJOA 3WNXA 5I93A 5I0SA 1W6PA 3A4UA 4HVRA 4LBJA 5JSOA 2BOIA 4RR3A 2DCTA 2NM1A 2Y6KA 1NA1C 2RDRA 1J58A 5IATA 2ZACA 5DAPA 3SKVA 3KQRA 4QXKA 4FXKB 4PLOA 3JD73 2W1UA 5FJKA 2W08A 1RUJ2 2HWE3 2EF6A 2ZZJA 4HN0A 1E57A 1MZ6A 2Q4SA 5F2WA 3WF2A 2PA7A 4CU9A 1H8TB 1NAEA 1QJFA 2OXBA 3LZZA 4E4SA 4A41A 3ZSJA 3AKRA 4BU2A 2XLFA 1K5MC 2D97A 4UFMA 1JZ2A 4GXLA 5C9AB 2QUOA 1RUF2 1LHVA 4DXTA 4IE7A 2Y6JA 1VBB1 3JXSA 4IEZA 4FO9A 3ZM8A 3MIFA 3WW1A 3ZFEB 4AI0A 1SLLA 2JICA 3I97A 5FMOS 2WZR2 2VOWA 3GZUC 2BEOA 3WF3A 3ST7A 4AGRA 1I5ZA 4W50A 5GZCA 5CAZA 2R072 2WZEA 5A70A 4UT5A 3KT1A 1UNBA 3NSTA 1RUC1 5EYYA 5FK7A 4S2HA 4OFGA 3VBRC 2VMFA 2XVKA 2UYBA 1COV3 2VCBA 4DQAA 4GD4A 5LA0A 3D82A 5T52A 5GALA 4AHWA 4HKWA 3VBFB 3DGTA 4CXXA 4HBNA 1YNAA 5IWFA 1JW6A 1UY0A 4NIHA 3N9PA 3TN93 1W2UA 3NNGA 4JDMA 1V00A 3J7MA 1R1ZA 3T1MA 3R6SA 3RWKX 4FPCA 3QD6A 3ZFGB 4FFGA 1RHI1 1TMF2 2XJRA 3BIEA 3CBNA 5FZFA 3R4SA 2OKXA 1WW6A 1WWYA 3H1YA 3ZXLA 4QHOA 3VKNA 2C5DA 4OUEA 4FP2A 4HKOA 1L7QA 3NKGA 2CY6A 1T6BX 3POIA 4I30A 3TWIA 2BVBA 4R4XA 1HRI1 2HWC1 1PK6C 2RM22 2VC9A 4QQLA 5FXWA 2GMEA 1WLCA 4JTNA 3ES4A 1NQDA 5A1FA 1LR5A 3HN1A 5FXXA 1BEV2 4QPYA 4MZUA 4TSVA 5C3RA 1JODA 3WCRA 2ID4A 2AH2A 3FMGA 1X33A 4QQOA 3AMNA 3USUA 1RTVA 1PIV3 1TG7A 3TOJA 1RMU1 2XBO1 3WQ0A 3WNLA 3D3AA 5KXCA 4XEZA 1D2SA 3UGGA 3UNPA 4GMP3 2JB8A 1R082 2XUEA 1D0GA 3OTFA 2RHPA 1STMA 1VP6A 2EIDA 3C2UA 1PO11 4CU6A 2D43A 3URFA 4FTSA 1TME2 2B8MA 4ASKA 3RGBA 3KLSA 4XF0A 4E2GA 2DVGA 2ZEXA 4CP2A 5A3NA 3SCFA 2D93A 2ZGMA 1PMIA 1GZTA 2X5IA 2OQ7A 1MS5A 4G9SB 4PIZA 4XOGA 1PHMA 1VPHA 5FZ6A 4BPZA 2QQNA 4QHZA 5BNNA 3WW4A 1S2BA 1S0DA 2P1BA 4B1MA 3AP9A 4IEUA 4I01A 3LSDA 4DXSA 3K75B 1YFXA 3AYAA 4FCAA 4BIFA 3WXPA 1YFYA 1NG0A 4YW7A 3O1TA 1MQTC 2ZEYA 4NVPA 2FDHA 4CU8A 1DQ5A 3O1MA 4X6QB 1KQRA 4H2AA 4Q4W3 4BYYA 3M8LA 1PGL1 1UX7A 3IIIA 2ZX4A 5LA2A 2YV8A 4GALA 3ROUA 4XAEA 3GNEA 4I3GA 3BTXA 2RS31 4BIOA 2KR2A 5KHKA 3VD3A 4DOUA 4BOWA 1XRUA 1Z7S1 3LA2A 3O0VA 1ND3B 2FDFA 2VOTA 3O5SA 1Z78A 1JOBA 2XL7A 5C7GA 4UW5A 2JG8A 3MBWA 5KHIA 3PL0A 2VCAA 1HW5A 4UI9L 3JB4C 2K0GA 5FMCA 4PQ9A 2IWGB 4NN0A 5EP9A 2XXZA 3D5OA 3N9LA 4UAPA 3TBDA 3T09A 1JZ3A 2IUWA 3THDA 1IOAA 1A3KA 3PU3A 4Y20B 3HT2A 1GMMA 1XU1A 4EE2A 2J1SA 3I2HA 1M4WA 1C57A 1EAH1 2Q8CA 1TNRA 1DLLA 4LBQD 1UZ0A 2MEV3 4AEDA 2Q1ZB 5C5TA 5HXVA 1W04A 1W06A 4IEXA 1UYXA 3CQOA 1JXNA 2EAKA 3ZXAC 3BTYA 3MZHA 3VBSB 3WW2A 5JVVA 4QKNA 5FY5A 1UKRA 1WW5A 1JYXA 3O0XA 4LR4A 4Q4V1 3D8CA 4XQ4A 1OF4A 2XHKA 5FY1A 1O8PA 1UU5A 5DN2A 5GLWA 3VZMA 2FDGA 4FAHA 4RHV2 3VBHA 2WS92 4UBGA 3JB8A 4UFKA 1W0NA 5I8TA 1S55A 2W39A 5SV5A 2DCZA 4AFMA 3L2YA 4C0HA 1V6NA 3OEBA 4SBVA 3ETPA 2PXJA 3AVRA 4N9HA 1PX3A 3BVCA 5A6ZA 1QJY3 3T1LA 5JPMB 3S0MA 2QTWB 4PDWB 3MGUA 3PMSA 5A3LA 2IXKA 4BXFA 1SLTA 4IW3A 3U0ZA 1OBNA 4AOCA 4XE9A 4HONA 2DTYA 4AVTA 4EWEA 3K46A 2UWAA 4BQ5A 1GZWA 4NPMA 4P00B 1JYIA 4E27A 4JGZB 4IEQA 4JKKA 1R092 1R1A3 5J1XA 5IVYA 1XE8A 3VBOC 1RUD2 5ANQA 2XH6A 4GB31 1K3IA 3V64A 1GQGA 2NZ9A 4QQPA 3V0BA 1ND2B 1V6IA 3JUUA 2WWJA 2I74A 1K42A 2CHHA 1JTZX 1UZYA 3ZKYA 2R062 4CP9B 5FYYA 1ULEA 4AHYA 1RUG2 2Z79A 1ZRFA 5FO8B 1FNZA 2RMU3 3HBZA 4DUXA 1OD3A 1UOGA 4Q29A 1LEDA 5FZHA 3ZXKA 5J7MA 5K4LA 2WAAA 2DVDA 2WNUC 3NAPC 4UW6A 1QF3A 3T3YA 1KGYA 1LGBA 3ZFFC 5F3GA 4YM0A 2Q30A 4XMAA 3DKQA 3ZN6A 2XR4A 5BXXA 2W5FA 2JG9C 1LB2A 1LODA 5T5JA 1E5HA 4Q1RA 5IAXA 2QKDA 4FXGB 3TB0A 1YQ5A 4UFIA 5KC6A 1CAVB 5A7WA 2WL1A 4Q1PA 1KDKA 1O8SA 1CPMA 1XQNA 1AR81 2YPJA 1QNYA 2YGLA 4LHKA 3NJVA 5FY0A 2FDIA 2HLEA 5FKBA 1FX5A 3I3MA 1HV1A 2RE9A 3WNPA 2VZRA 3CLPA 4FOVA 5F5IA 4AEKA 3PUSA 3P3NA 3O7OA 4KNCA 3CJIC 3L9JT 4P5HA 5LWBA 2X8KA 5A1LA 2A6YA 2VD7A 2JDUA 2XUMA 2NLRA 5E16A 3F95A 4AXOA 2JDKA 1FOD3 4ASMB 4HKLA 2F17A 2VQTA 5BV6A 2AZ5A 3I2DA 4FQ4A 2JD9A 4LBMA 4XXAA 1RXGA 2WFF2 1WMDA 2G1MA 3T0AA 3NRUA 4R8HA 2ET1A 3V0AA 4MXWB 2VW2A 4Q4Y3 4Z2AA 1UZVA 2F6BA 4NHKA 3J9SA 4RQPB 4UW3A 1WMXA 4H3WA 3OUJA 3ZIWA 3BI3A 2HEWF 1OXCA 2JENA 2PHDA 5D1IA 4B3NA 1RUH2 4DINB 5DDJ3 3RZZA 5JXJA 3M7AA 1EPZA 4N9IA 5I91A 2EALA 1ZYBA 2VPVA 3KM5A 2FMYA 3BN6A 1X8MA 4IV3C 1VMFA 1RUE1 2VCCA 4NJ4A 5B4NA 4QU1A 3RI9A 4I2OA 2W1QA 4EROA 1AF9A 3B7MA 3PUQA 5CFCA 1MACA 1OSGA 5FUPA 4JDOA 1HJGA 3N9OA 5F7UA 3WUDA 3CO2A 3UL2A 2ZGRA 4CE8A 2DVFA 1T2XA 4MSVA 1QJEA 4URTA 5GLTA 5GZEA 1YI7A 5DMYA 3DEMA 2TNFA 2GH8A 4FPJA 3AMPA 5A32A 5FZ3A 2OZJA 1K5JA 2ZGUA 5IK4A 3MW4A 2VL4A 2W0XA 1CVNA 4P9LA 1AX1A 2W92A 1PVC1 2JDZA 1GNZA 2BZDA 2VO5A 2YG0A 3FJSA 4KGQA 4AE2A 2LM3A 4AHXA 3BALA 1KS4A 4CDXB 2VMHA 3WT3A 4DRRA 5JDBA 3KVBA 5ABJA 2WR9A 3C8XA 4F3JA 3I3DA 3EXUA 3TEYA 1VBB3 3NVCA 4QPWA 5DUVA 3SHRA 4N43B 5A3WA 5C33A 5C3PA 4WZCA 1PGW1 1V6JA 5J48A 3ATGA 4IEYA 4XJZA 2J1RA 1KS5A 3VDDC 3FUOA 3SH3A 4CUCA 1UF2C 3N4MA 1RUC3 3WCSA 3WQ7A 4EYUA 4JV4A 3VBOB 3T30A 1O4YA 4EWDA 2QQOA 1ZRDA 4WVZA 4OCTA 3WQ1A 2WA3A 4CUGA 5EHDA 3AJZA
chains in the Genus database with same CATH topology
1GICA 1REEA 1SMVA 4HVOA 1HRV2 2HEVF 1V9U1 1HXS2 4Y1YA 3THTA 4QM8A 4JQRA 4YVSC 2A75A 3G7DA 5CFDC 4HMZA 1RHI3 1UKGA 3CU7A 5IK7A 3MLJA 3MPBA 3WHTA 2IXHA 5FPZA 4WM7A 1AR71 1QDCA 5I0RA 1QJX2 1S0FA 3ZFFB 1F5FA 2D3SA 4AI0A 5FO9B 1RUI1 1VAVA 4OVEA 4E9KA 1PM7A 1YJLA 2VNOA 1HRI3 1UZZA 2HEYF 3NKTA 5L7OC 2R0FA 1G9DA 1VBC2 1DDLA 4N7UA 4W65A 2ZKNA 3N7JA 4I0WB 4JGYA 1OLRA 4I3PA 5F1RA 1RMU3 2XBO3 2WNVA 4M3CE 2H6CA 4U36A 3M3QA 4Q0SA 1SBDA 2QZ3A 5AVPA 2PHRA 4RFT0 4KU8A 1BMV1 5GLZA 3PHMA 5B2GB 2X53S 1PO13 1QY4A 3AZWA 1Q8VA 1BVP1 4RS5B 2XKOA 5FQ0B 3GHMA 5C6CA 3U11A 1W6MB 2ZGOA 1VALA 5CNAA 5ACA2 5EWSA 2LTNA 2VMIA 3R4DB 4CDUB 4YGDA 1CQ9A 5T50A 1U5ZA 3SISA 3I59B 3RJ2X 1DZQA 4HVQA 5F6KA 1FMD3 4OHVA 4YGEA 4KGGA 1OFNA 4RSUA 1W6PB 2CTVA 3E6BA 4RR3B 2D5FA 5KXDA 2RS33 4M0HA 4ZXKA 4AGVA 3ZXJA 1Z7S3 3GBFA 1JUIA 1RVF1 1OPOA 4P9WA 1ZM1A 4GWNA 2P3JA 4KG0A 1QOTA 4AFCA 3KZ4C 4X6RB 5H9RA 2A3YA 3AZVA 2P17A 1RUJ1 3O14A 3WDVA 2ZCWA 5JOYA 4E2SA 3AJYA 2HWF1 2Z69A 2NP0A 5JPNB 4R9DA 4L92A 3H1MA 5BPXA 1EAH3 4O9EA 4ITCA 2XJSA 3U10A 4KWKA 1DZRA 1DU3D 1REDA 2BGCA 4FPHA 3J8F2 4QGLA 1LECA 1ZZ8A 4J1WA 4Q4V3 2SLIA 4LUMA 5I0UA 4LA2A 3M3EA 2G4IA 2PLV1 2ZS6B 1VAKA 5K0UC 4LHNA 2JXAA 5EFUA 4CRQA 3RMXA 3EQEA 3S6PA 3LCPA 1NCQC 1POV1 2R32A 2KXLA 4WVWA 4GULA 3SH4A 1NCRA 1VBA1 1CR7A 4Z82A 4YVWC 1PGSA 1QHDA 3MF9A 2JE7A 2XVGA 2Q5TA 1VBD1 3O12A 1D4M2 3FE5A 2YC0A 3BU7A 2GMMA 1OHFA 1Y7BA 1YUDA 3MIDA 3WX5A 4RGAA 3V56A 1LTEA 4DMIA 1CAWA 4GB33 2WKKA 4AVBA 1QQP2 2N7GA 2PHFA 2R49A 3USUB 3GBWA 3N7MA 3SCHA 3B5LB 1B35A 4K40A 1KFXL 3IIAA 1BZWA 1D4VB 1AYN2 5C4WA 1H8TC 2EXKA 1C1LA 1IS3A 3LOIA 4PIXA 3WZ1A 1LULA 2D6MA 4ZU7A 1W0PA 3PVNA 5C9AC 3JBG2 1WW7A 2X5IB 2PHXA 3HIFA 4LO5B 3M3CA 2QZ2A 5BNNB 4Q8LA 3KB5A 1DFQA 3ZFEC 4CEYA 4CYDA 2RR11 1CGPA 3WG2A 1UCXA 2IXLA 4MH0E 2OUHA 3I4IA 4M3CA 1JUHA 2A6XA 3RNSA 2YXSA 1FPN2 4L99A 4YFWA 5CADA 1FV2A 4P9YA 3VBFC 3E6CC 4CDWA 1C3HA 4XZPA 5EJ3A 3UKVA 3MLKA 4NPRA 3W9AA 1OKQA 4IEVA 4C91A 5EV7A 3RYRA 4BMEA 4ES9A 2B39A 3GYDA 4RA0A 3WP6A 1UIKA 4INDA 3ZFGC 2JG8B 3UKTA 4AG4A 4OUSA 1GSLA 1SACA 1RB8G 4D3WA 1AX0A 1F5JA 2B42B 1KITA 1KD7A 1KJRA 1ZX5A 1N1YA 2OA2A 2JJ6A 3AP7A 3PVEA 5FTTC 3UV9A 1U5YA 1AJOA 1SBFA 2WJSA 1TNFA 4NOTA 4YW3A 1LEMA 2FBEA 2MNGA 2A3WA 4XETA 5CFCC 3B93A 4AEDB 1NYWA 3UKNA 5AC91 3JD72 1U5XA 3ASIA 4WVMA 4C0BA 1VLNA 4XQWA 2HWE2 4WZFA 3X29B 2EXIA 2BFUL 4F83A 1RUE3 2GU9A 3FUQA 2AREA 3ZMNA 1ZNPA 2G9FA 2RS53 1XYPA 4EJRA 3A0KA 3VBHB 5E1RA 1MR5A 1FNYA 1TQ5A 2K2SA 2XJQA 1SLAA 3OY8A 2WIIB 3I54A 4PBPA 3ZSMA 3PNAA 5DG2A 4XFGA 3PVBB 3AP4A 4WVVA 5FBZA 4CEWA 2A6VA 1PVC3 1H1IA 1Q8SA 5IUQA 1GZWB 2WT0A 1COV2 1XU2A 4OHXA 4CDUA 4FSJA 3FBMA 4QX5A 3BCWA 2D6LX 4W6YA 3I59A 1ND3C 3TN92 3V0BB 4Q4X1 4Y5Z0 3B94A 1CESA 2VVFA 4COYA 4XQDA 5K8SA 1DZTA 3FHIB 3UJQA 2Q1MA 1LOFC 3AKQA 4JC1A 3ENRA 3WDYA 4I0AA 3QH6A 4HT1T 1O3TA 5CG9A 3PMEA 2WT1A 3KGZA 1V9U3 2H6BA 3ZN6B 3GZAA 2VU9A 5FLJA 1V6KA 4FPKA 2ZGLA 3VBSC 2ZX2A 3LAGA 4JTOA 4AFAA 1A8MA 4H14A 4Q27A 4JGYC 4MXVA 4TYSA 4QPGA 4K6BA 3AYEA 3VKFC 1O4ZA 1RUI3 1GR3A 5I0TA 2DCKA 1ULDA 1G9FA 4BLIA 5BUVA 2SBAA 1MS4A 2VUAA 2WINB 3AZZA 1GQHA 2PN5A 3IT8A 2A6WA 4OHYA 4PDWC 3FFZA 3ZMOA 4L97A 1QXPA 4XMIA 1MZEA 1S0GA 2WNEA 4YSFA 4Q4W2 1WLWA 5DG1A 1RITA 2EA7A 1Z0HA 4GIQA 4JGZC 1GFF2 4CZSA 3D0SA 3V0AB 5JZGA 3AMQA 1S0JA 4MUVA 4DFSA 1ZBE3 2ERFA 2FMDA 1ND2C 4ASLA 1F2NA 4H55A 4LE4A 3VLBB 5JIAA 1ASJ3 5LK7B 3ZXDA 2OIIA 4EN0A 4GKXA 1OLQA 1QOOA 2TEPA 1LRHA 3MI8A 4FPEA 3LWCA 5CFCB 1VIWB 5TSWA 3T2TA 2DWRA 3ZYRA 1DQ1A 2ZHMA 3E5QA 4GQ7A 1J3RA 1VJ2A 4A3XA 2D3PA 2QJVA 1RVF3 5FDBA 1OFSA 3LB9A 3FZ3A 1X8EA 1XNCA 3BPZA 3VUOA 2KM2A 2W52A 2XKPA 5A32B 1RUJ3 3AFKA 2ZHKA 3VZNA 2GNDA 3EBRA 2HWF3 5ABJB 1JN2P 1IZ3A 2XB6C 1ZVFA 3M3OA 5LEJA 2ZA9A 4M3CF 2GMPA 4MGIE 1NY72 1H0BA 1QJY2 3ETQA 1JYCA 1J3PA 2ZBJA 3DPRA 4GKYA 4YZ4A 4FAGA 1PO21 4FOYA 4K1ZA 2DF7A 1U12A 3LGRA 2VULA 2DCJA 5LK5A 3VHRA 4ISQA 4JCKA 1C1FA 1R1A2 1H8VA 3WLUA 1MVEA 1BBT1 2PLV3 1I3HA 4RQPC 1AR92 4Y1XA 5L19A 4OI4A 1POV3 1V6LA 4LBKA 4QPIA 1VBA3 2BWCA 4WM7B 5C8CA 3H8UA 1VBD3 3KCXA 2BFUS 4YW5A 1H9PA 1FV3A 4J1XA 4QQHA 2BNOA 4DY3A 1QXJA 3USSA 4P14A 1I9RA 5BY5A 1WBLA 2QFEA 1S0IA 5JI7A 4JGYB 1ULFA 1W39A 1X50A 4Y1ZA 4XIOA 2WNVB 3LA7A 4YM1A 3RMYA 2GC3A 2F4PA 3APBA 1GLHA 4ATEA 2ARXA 1QH7A 1DYKA 1VAMA 1RINA 2O8QA 3E6DA 2VOXA 4AFDA 1RJ8A 4B7EA 1U0AA 3ZDSA 5KWRA 1G7YA 5GKAC 4CDXC 4YRDA 3LSEA 1RIRA 1IQAA 3W58A 2WWSA 1PZ9A 4EN8B 2EXJA 1MVQA 2OVUA 4N43C 4PLNA 1N3PA 4COUA 1AR62 5E88A 2GZWA 5JIUA 4PLMA 4WM8A 1H4HA 2QDNA 1QMJA 2RR13 1JOJA 3IWZA 2JE9A 4IEWA 3FLRA 5J96B 3S30A 5DZGA 1FOD2 3WG1A 1MS3A 2X29A 1PVXA 2CV6A 2ZABA 5J98B 1G9BA 5FFOC 1TEIA 3TNQA 1WGPA 2MPFA 4Q4Y2 4XBQA 4TLFA 5KBFA 2YYOA 2K9ZA 1AHSA 3POYA 5DDJ2 2Z2SB 1EP0A 4QD2A 2BTVC 4MGYE 3AM2A 1DGWX 4HPKA 1KRIA 4IV1A 4YFZA 4XF4A 4DY5A 4XHBA 3H3UA 2WC2A 2UYAA 2E63A 4YG0A 5AC93 5T5OA 3VBUA 2ZMKA 5IK8A 4LBQA 2IXJA 2XGXA 1Q3EA 2VVDA 4QGNA 1DQ6A 1MEC1 1OA4A 5JLVA 1UU4A 1IPJA 1A8DA 2D5HA 3RWNA 1ENSA 1G9AA 2DU0A 4LBLA 4RS5C 5FOJB 2VQ0A 1EYBA 2PHUA 3H3ZA 4N53A 4CDQA 4U2AA 4A7ZA 1VBB2 2GNMA 4QU2A 4CDUC 2BUKA 2D6KA 2GNTA 4HK9A 3VKMA 3TRSB 2TBVA 5EZWA 2D6OX 2Y26A 3OYWA 2E9QA 1O91A 1NCRB 3H7JA 1ZZCA 5CVRA 1RUC2 1YRZA 2V73A 4UW4A 4YW2A 4AW7A 3QOPA 3NJZA 1Y9QA 2UURA 4P9JA 4RR3C 2DUQA 2ZGNA 2R041 4K1YA 1CAWB 3BIWE 3SMHA 2A71A 1Q8OA 1JH5A 4Q4X3 5BNOA 4I0BA 1WA4A 1ALYA 1B35B 1RHI2 4S2DA 3ZN4A 3MPPG 4GMP0 4OHWA 1O3RA 5C4WB 2VY0A 3QLQA 3AP5A 5DZEA 5K9YA 4CP0A 1XNBA 2GNBA 1HQWA 1ZRCA 2W68A 3M1HA 1HRI2 4C1XA 2XLGA 4NHLA 1ZREA 2RS11 3JBG1 3JQXA 4IETA 4CEYB 1C8M1 1UMZA 4Z8BA 1G9CA 2IC1A 2VG9A 1QJU1 4Y24A 4AK3A 2XBO2 1GYKA 2E7QA 4ZKTB 1FAYA 4M3CB 4Y1UA 3UK9A 1ZA4A 5AVAA 3A0NA 1A6CA 2WSVA 1PO12 1QJZA 4YG3A 4CDWB 3VHNA 4LLFA 4AQ2A 4YARA 2NYYA 1LENA 3VN4A 4XTMA 2QNKA 1NLRA 5DUUA 2LALA 4JRAA 2VH9A 2A3XA 4XJ8A 1UIJA 2D40A 4M00A 4OHZA 5HCAA 5BNPA 1POV0 4AHYA 4XF9A 2EIGA 1FMD2 4XYXA 1YWKA 1N3QA 4E4DX 5JWPA 2E6VA 4KQ7A 2DVAA 4OI1A 3KT7A 1VRH1 1PGL2 2BNMA 4MV2A 3O0WA 3MLLA 1WLDA 1CJDA 4BQ1A 1GNHA 2GC1A 2ZMLA 1Z7S2 3NL1A 5FCCA 2DCYA 3WP4A 4XF3A 4F7ZA 4LNVA 1DHKB 2UU8A 4WVMB 3OGGA 2IXIA 3RQ0A 2Z5WA 1ZBA1 4YW4A 4HANA 2XL9A 2WT2A 2HWC3 1AYM2 4YYOA 1Y43B 2FQPA 3WR0A 3ZYGA 1J1LA 1LJ7A 3H50A 4GH4A 1Q56A 4YZ5A 1VBE1 2XG3A 2E53A 2G9GA 4WBBA 3IBMA 2X5IC 1IHMA 3OY8B 1WCKA 1EAH2 5BNNC 1W6NA 1AL22 1UL9A 2Z42A 2HWD1 3J26N 3TNPB 2OYZA 4AVVA 3ZSKA 3M70A 4CEWB 2HKXA 1K5MA 2ES3A 4Q4V2 4SLIA 4XFFA 3MIGA 4IESA 3VZJA 4DNYA 3P3PA 3PJYA 1YIPA 5HCBA 4PIYA 3PVOA 4QQ2A 4XTPA 4D7TA 2HWB1 3EJKA 2XWJB 1DQ0A 3KSCA 5T5PA 2YUEA 2OPKA 3D4KA 3KD4A 3ZVXA 2JG8C 1PNFA 1EV12 1RUOA 4EN6B 3VBRA 1MZFA 5H9QA 1NZCA 2QCSB 4Q26A 3ILFA 1PO23 2XWBB 4UBHA 1MS0A 1GZCA 2QDRA 1BBT3 1OQ1A 1NQJA 4OULA 4GB32 4AEDC 1BJQA 2GAUA 1Q43A 2P3IA 3R05A 3THPA 4K3UA 3AX4A 3DV8A 4L11A 2HYKA 4AHZA 4QPGB 1BQPA 1RUF1 4PF5A 1KDMA 2PAMA 4XW3A 4R52A 1PK6A 3U07A 3VBHC 1CPNA 5E89A 2DUOA 2DFCA 3G6JB 4DXZA 2AYHA 3SXWA 1LU1A 2WZR1 5GM0A 5JSPA 2R071 3KS7A 3RRDA 1UD1A 5JR7B 5LRRA 4ZU4A 2NMNA 2YY1A 4WM8C 2AGSA 3B3QE 4FOWA 3K48A 4LO8A 5KHHA 4BWOA 3AKSA 1MS9A 4LA3A 3DN7A 4Q4W1 5JZGB 1B09A 1CD3G 3IPVB 4L8QA 1TMF1 1H2NA 4W6WA 1MQTA 1KFUL 1SCRA 1SQ4A 1W6QA 2P3KA 4XJUA 3CJXA 1QKQA 2JECA 1LGCA 4E2QA 3ZO0B 1BYHA 4D69A 3B69A 2RM21 3R4UA 1BEV1 1QGLA 4HSJA 5A3MA 3VL8A 2C1FA 1YFWA 1BKZA 3ZN5A 1LHNA 4AI3A 3GF6A 3WDWA 1NLSA 3BTAA 3VL9A 4EV0A 3FWEA 1J3QA 1R081 4XILA 2ENRA 1RUE2 1SLCA 3GALA 1TME1 1XE7A 2PYTA 2RS52 3RG0A 1S0BA 2A7AA 3N36A 2D3RA 3BB6A 1H2MA 4COZA 3MW2A 3GZTB 4ONUA 1HIXA 1AR83 4B29A 3DPRB 2QE3A 5I8SA 1WD4A 1MEC3 3RDIA 2ARBA 1LHWA 1PVC2 4QM9A 1DQ2A 1UX6A 2FHRA 3PJQA 4C90A 1JHNA 2R16A 5T3NA 1F8VA 5AFBA 4FVVA 5F5QA 5KC5A 5GZGA 1LOGA 1PGW2 2A6ZA 2DURA 3MICA 2DTWA 1AR91 4FPFA 2YZ4A 1J59A 3JZVA 1O5LA 4QPIB 1UN1A 5C8CB 3S7IA 4P9IA 4BA6A 3ECQA 1C4RA 3KCYA 3IMNA 3MYXA 4AQSA 1S0CA 1N1VA 1G6NA 1O5UA 4LLOA 2R043 1HX6A 4Z07A 3CNAA 2IZWA 1V9U2 2JD4A 5E8AA 2D44A 4IEPA 2DV9A 4KWJA 3AXEA 3B9CA 3K51A 5HI0A 4LUKA 2HJIA 5T54A 3WG3A 2ZZQA 3MF6A 1DGRN 1CN1A 4RHV1 4RD7A 5CA6A 3TYJA 1SCSA 2WS91 3AMHA 4ATFA 1RUI2 3WV6A 5ABJC 1FT9A 2WNUA 3NAPA 3VKLA 1I1EA 2VNRA 2ZX3A 1YYNA 1WMEA 3VV1A 2RS13 5SV8A 3JBG3 4WM8B 3BOWA 3ALQA 3NV2A 2JG9A 1C8M3 1HQNA 1W6OA 3QH7A 1CX4A 2WLPA 1FATA 2R6QA 4IXLA 4AQ6A 1AR61 1SLIA 1LGNA 1QJU3 3HD8B 4NWWA 5D8AA 2DUPA 1BMV2 2VMGA 1R091 2AR6A 2ZTNA 2Y0OA 2E7AA 1RUD1 3FX3A 4H7LA 4AEMA 2RJLA 4CP1A 1N47A 3VKOA 3S7EA 4BH9A 2LUWA 2PAKA 3RS6A 1WUVA 1ZBE2 4Q4Y1 4N90A 3OPZA 2R061 5IT6A 1FYUA 4PBOA 4OI0A 1RUG1 4WM7C 1ASJ2 4XXPA 1HDKA 1X36A 4HPKB 4YZ1A 1VRH3 4IV1B 3OD4A 4KG8A 3NV1A 1QDOA 2DYCA 5J36A 2FZ2A 4FPYA 1PIV2 4LTAA 4DB5A 1EY2A 4HETA 3WDTA 4GH4C 1LOCA 1QXRA 1RVF2 1UAIA 3N35A 2I2SA 1AR73 2GH2A 1RGSA 1ZRRA 3VBUB 4IV3A 2WNVC 4LBQB 4PCRA 2WZPP 3ZYJB 1ZBA3 4H7MA 4JVAA 2P34A 4Z1VA 1ENRA 1ZZ7A 5GLUA 3ZYIB 1VBE3 1NE6A 1C28A 2HWF2 1QNWA 4FT8A 4G4FA 4N53B 4CDQB 4MVTA 3ZXEA 2CL2A 4ISRA 4BE3A 2GALA 2YDEA 1VB2A 3IKWA 5DZFA 4K9SA 1ZZ9A 2HWD3 1BK1A 2ZPXA 3MFCA 2UWCA 4NR1A 4FOQA 1NOVA 1WW4A 3OYWB 1U5IA 1WCDJ 2UY8A 5J09A 1SLBA 1LOEA 1DG6A 4OZXA 1IKQA 1O7FA 4XJ9A 2WFF1 3MDPA 3IPVA 2B46X 1QOSA 4C1WA 4XF1A 1UPSA 2HWB3 4MYEA 2PLV2 4IQPA 1RUH1 4XBLA 5BNOB 2PQQA 4AVAA 1BVVA 1APNA 4XFHA 4YZ2A 3ME2A 3POWA 3VDDA 4TWTA 2D7FA 1VBA2 1RC6A 4BLJA 1ENQA 2I45A 2PELA 1M06G 1OPMA 5T5LA 1VBD2 4K7JA 2MEV2 4XFBA 2Y38A 4PJYA 1GV9A 5FAXA 1MS1A 3AKPA 1HKDA 4YVSA 5CFDA 1OI6A 1NE4A 1YJKA 1IS5A 4HK8A 3ZPYA 3ZYPA 1DGLA 2C9AA 5KHGA 4YGCA 1YHFA 2VXRA 5H9SA 1RUF3 4XFCA 2YGMA 2CWMA 3WW3A 2Y0IA 4FTEA 5L7OA 3HAGA 1HQLA 3ACLA 3WOGA 4Z92B 1SBEA 2IFRA 2PHWA 4OI2A 2AUYA 2WZR3 4P9GA 1CAXA 3RJRA 3NWKA 1OOPB 4E4ZA 2R073 2RR12 5BNQA 2XLAA 4LO7A 5BNPB 1CAUA 3FLTA 1NCRC 2VQAA 1D0HA 4KBBA 4D94A 2EAAA 1FMD1 1XXNA 2D98A 3I7DA 2EVXA 4LBNA 1OD5A 4AF9A 1HRV1 2ZAHA 4AVCA 1HXS1 2NMOA 1AVBA 5JMCA 3M3IA 1X82A 1TMF3 4M01A 3RPQA 1C5IA 5GZFA 2RMU2 1B35C 1V6OA 4EWAA 3IDCB 4XJWA 1QJX1 3DL3A 1IGOA 2B45X 5C4WC 2BBVA 1YIFA 3AK0A 3ZXGA 1LHOA 1LOAA 1YO8A 4FP3A 4GH4B 1AXZA 1AYM1 2RM23 1YFUA 1FXZA 1NA1B 4YM3A 1ZZ6A 3N7KA 5JCTA 1VBC1 1BEV3 2ZGPA 1URXA 1O4TA 2CAUA 1W6NB 3H1WA 2VW1A 4CEYC 5AC92 2YROA 4F8AA 3WDUA 1ENXA 2DVBA 4WV8A 5BYNA 3EO6A 1AL21 5GLVA 1R083 2R1BA 4FPLA 1K5MB 4Y22A 1AJKA 5EYXA 1TME3 4D7YA 2ATFA 4LEJA 1SFNA 2VUJA 1XYNA 3ILRA 4CDWC 2E7TA 4COWA 5ACA1 1WCSA 4XDQA 4O9GA 5GJ6A 1DGWA 2H0BA 5DUWA 1LKNA 5HCFA 3QCWA