2VXJA

Crystal structure of pa-il lectin complexed with agal13bgal14glc at 1.9 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PA-I GALACTOPHILIC LECTIN
publication title Structural Basis of the Preferential Binding for Globo-Series Glycosphingolipids Displayed by Pseudomonas Aeruginosa Lectin I.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2vxjA00
3ZYFA 4CPBA 4CP9A 4CPBD 1W8UA 1GWLA 1W8TA 1HN0A 1V0AA 2WYFA 5D21A 1WZXA 2JWPA 2O14A 4YW6A 1WMXA 3UT0A 2LROA 1GWMA 2VXJA 2LRPA 2KR2A 1OKOA 4LK7A 3ZYBA 4BQ4A 4LKEA 4LJHA 2Q1FA 3ZYHA 1L7LA 1W90A 4BQ2A 1OH3A 1W8WA 3ORJA 1WCUA 4LKDA 4BQ5A 1GWKA 1UOJA 4YWAA 4AL9A 4CP9B 4A6SA 3F95A 1W8ZA 2C24A 4BQ3A 4LKFA 4LK6A 2K46A 4YW7A 1W9FA
chains in the Genus database with same CATH superfamily
3M3IA 1D4M1 2DCYA 1RC6A 2LS6A 3POEA 1GWLA 3IDBB 1UY4A 4EN7B 1U0AA 5DAXA 2VOKA 5F5CA 5IVJA 1Q8VA 3VB9A 3RWNA 1V6NA 2BNMA 4RGAA 1LOBA 1FOD2 3T1MA 4P9LA 3GM8A 3RVHA 2ADEA 5K0UB 4FOWA 5SV8A 1W3VA 3ENRA 5JIAA 3T0BA 1IG0A 2TEPA 2VZRA 4BQXA 4N43A 1D0GA 2C26A 1WW6A 4AHZA 3U4XA 3EBRA 5DZFA 5C4WC 2FZ1A 2BNNA 2ZS6B 1YFUA 2OQ6A 1ZZ8A 1CIYA 4YG0A 4E2GA 4YRDA 4AI8A 2ZEXA 5D2AA 5IW0A 2BBVA 3KV9A 1W04A 4A42A 2XXZA 4S2HA 3KMHA 3RZHA 3NV3A 4CVUA 3H7YA 4WM7C 2CAUA 4N90A 3JBG1 2X5IB 4AI3A 1QDOA 2W2IA 5JSRA 4XUPA 2ENRA 1VBA2 1SHWB 1WLCA 2AENA 1W90A 3J8F1 1NLSA 3LFMA 3FHAA 3PU8A 4C1XA 5BNNC 5CISA 1JS9A 1UOBA 3AP7A 3BOPA 4P9IA 2RS51 3POFA 5A6XA 4FTBA 5AVAA 2ZX0A 2QQIA 1WA4A 4KGGA 4OMCA 3KM5A 4GH4B 3ZDVA 4CU9A 5C9AB 1DGRA 1CAWB 4HANA 4C0BA 4UXAA 4J1WA 1DGLA 4J6GA 3MF6A 1MS0A 2HWC3 3O5SA 5GLZA 3TN91 3C7GA 1JH5A 5A1LA 2WA4A 2VUCA 4QX7A 2XKPA 5IATA 2RV9A 2UYAA 4RGKA 2VZUA 4XVHA 2WN2A 1RUE3 4N9IA 3RYRA 1OKOA 2ZGRA 3AKTA 3LPGA 4TYSA 5T54A 3SQOA 4Q4Y2 5GALA 2XL7A 5FY4A 5FK7A 3OBRA 5BPXA 5FMDA 5FY1A 4CEYB 1PGSA 4F8AA 4XHBA 4ZZ8A 4M00A 2R6QA 5DDJ3 2R071 5EWSA 4CDWA 5EJZB 5CG8A 5AFEA 4XOGA 5BNPC 1MVEA 4PCRA 4OHZA 1VBD3 3GJBA 2XLAA 5IHRA 3ZKUA 4ES9A 5FJHA 5JR2A 3N9NA 5FKBA 5JZGA 4AE2A 1APNA 2CAVA 2R7EB 1VBE3 3NL1A 5H9RA 5J1XA 1DU3D 1TZOA 1YQ6A 3BPZA 1N1TA 5F39A 2Z2SB 1UQXA 3GBFA 2OYZA 4AGVA 5FOJB 4BK4A 1STMA 2VG9A 5KXEA 4BDVB 1NCRB 5A7SA 1JUHA 4MGKE 4MGSA 1O8PA 1C5IA 4QDRA 3J7NA 4K6BA 3K4AA 2GZWA 1ZZ9A 4AQSA 4IETA 4YM1A 5JMCA 2DVFA 3I3QA 4LKDA 3PU3A 4UBHA 4XJAA 4Q4V3 1W6PB 2XL9A 1ZBA1 4BM8A 1S0IA 5L9RA 1OHFA 4H2AA 3W20A 4JQTA 4XFAA 4PBOA 4KL1A 1RUD1 4Y1XA 3A7QA 3ZYFA 3B93A 4I09A 1ASJ3 1DLCA 1PGL1 1W6OB 2BJSA 2XUMA 1IPKA 2JKXA 2ZGMA 4INDA 4YSFA 4IL7A 1C8M3 4MUVA 5CIRA 4Z8BA 1XNAA 5EJ1B 3TEZA 1CVNA 1QKQA 1S0JA 1K5MA 4QWNA 4YPJA 4C0HA 4KMQA 1B09A 2VMGA 4CDUC 3ZYHA 1OFNA 2DU1A 2P17A 3G7DA 1KJLA 3CIHA 4LE4A 4XF4A 5FZLA 1PHMA 2V5DA 4RQPA 3LEIA 3UGFA 1QQP3 2PQQA 3FHQA 1NE4A 1NQJA 2XJPA 4AVBA 1U5ZA 3S5AA 1DZTA 2F4PA 2PELA 3NO8A 5G05L 4PF1A 3HOBA 4WVZA 2Q8DA 4BHPA 2ZGKA 3Q8FA 4CXYA 3QBQA 1W9FA 2ES3A 2HWC2 3HAGA 5T52A 5FIXA 3O1MA 3VBFB 5FJKA 2K9ZA 1XSRA 4FOVA 4NIAA 1LNSA 3WDXA 1PVC3 3NRUA 4GD4A 2VMHA 4K1YA 1RUE2 3P5BA 1JYVA 1TEIA 5F7UA 3CMGA 4HPKB 3THDA 4QX0A 1WCQA 4RS5B 5D1IA 1QOOA 4E2SA 2WBKA 1V70A 1DP0A 4BQWA 1OQ1A 5DDJ2 3D8CA 4K1ZA 3VLBB 4XDOA 3KV5A 2FBEA 4GWIA 4CU8A 3LIHA 3R0RA 1VMHA 1VBD2 3SEPA 2ZGLA 1OBNA 4UI9L 5EYXA 1O8SA 1XNCA 3AZVA 5I0RA 1VAKA 1VRH3 2XG3A 3LAGA 2E6VA 3KT1A 1H2MA 4FPEA 4YVWC 3WXPA 4DUWA 1M4WA 4JRLA 4HN0A 1N1YA 2D6NA 4QU1A 1VBE2 4L9BA 3THCA 4COYA 4EN0A 4DO0A 1PM4A 2B8MA 3DF0A 1GYKA 4QKNA 1QEXA 1XQNA 2EICA 2BBAA 1SEFA 1DQ5A 4QX8A 1YQCA 1UCXA 3M2MA 1G9FA 4CCLA 3WD5A 3V0AA 1MS5A 1FMD3 4QHBA 2I2SA 4HVQA 2D5HA 4V2VA 2JECA 4AEJA 1OMIA 1PGW2 3OYWA 2WDBA 4Q4V2 4XUNA 2QNKA 4M4RA 3IB3A 4QPWA 3RZGA 5EZWA 4FOYA 3O14A 5F1RA 4CRQA 3ZSLA 2DBIA 1GP4A 4MO3M 3WG3A 1CR7A 1ASJ2 3UK9A 2ZGSA 1BJQA 5F37A 2J1TA 3H42B 1HJFA 4QB1A 4CDXB 1C8M2 1YQ8A 1F4AA 2OT7A 1AYM2 1GR3A 2JDNA 1NA1A 3N9QA 4HFSA 4XCBA 2XQRA 1JZ4A 1BEV1 1FNZA 1CAUA 4MHUA 4YFWA 3WNMA 1AJKA 4CZSA 1OT5A 4C90A 2WZR1 3GBGA 2UY9A 3MIBA 4RSUA 2X53S 3MICA 4M0NA 4D7SA 1L7QA 5GZDA 2YGMA 4GJZA 1J84A 4PT6A 1GLHA 1H2NA 1F31A 1V9U3 2WS93 2Y26A 1QQP2 3KVBA 3VN4A 4FFFA 4F3JA 3O1UA 1W8HA 2P37A 5CEHA 3H0OA 1PIV3 1ZX5A 2RS33 3HQUA 4AAPA 1AXYA 4LKFA 5EHDA 5FWEA 3I97A 4NAMA 1FOD1 1GZWA 2CNAA 4AVCA 4AEDC 1HQNA 3BIEA 4I3PA 2P3YA 5FP9A 2Y6KA 1RHI3 2OS2A 4R9AA 1PVC2 4YVSA 4XE9A 2E7AA 3E5QA 1CAXB 3SISA 1NQDA 5LBFA 3AM2A 1WLDA 1Y9QA 3ZKYA 3OGVA 1XB9A 2OW4A 5GZCA 3WV6A 1X50A 3ZMOA 5LZ6A 2NP0A 4Y24A 4AFCA 5FZ8A 3AP5A 1H0BA 2YU2A 4HONA 4ZS3A 5AC93 4LOTA 3GJAA 3RSJA 1VALA 5JOXA 1VR3A 2NMNA 4PHZA 3ZXEA 4NIDA 1VRH2 2DUPA 1RJ7A 1W06A 4XCAA 4UFMA 5H9PA 3RZMA 1BMV1 1IG3A 2IVIB 5FZEA 3AKPA 1VBA1 1HX6A 2DCTA 2YPJA 4YGDA 1LKNA 3PUIA 1US2A 4LTAA 4LO7A 1NCQA 2WFF3 4R52A 4N8MA 2VH9A 1C4RA 4GJYA 1E5RA 5G04L 1O3RA 3NMBA 1F8VA 1AR63 1ZA4A 1M06G 1W6NB 3MIFA 3ACGA 1FMD2 5EFUA 3BU7A 3N4MA 3EHKA 4H14A 1H8TC 2VMIA 4JGZB 5DG2A 4CP1A 1ZM1A 3DGTA 3POWA 4LLFA 3CF6E 1K42A 4OHWA 3ZYIB 3VD5A 5E16A 3BPSA 3JZVA 2JKBA 2RDQA 4HSLA 4BLIA 3SH4A 1RMU3 5FTTC 3INAA 5FZGA 3UV9A 3VBSB 1YO8A 3ZDSA 4WZFA 4QB6A 2IZWA 4QGLA 4FPLA 4Q4Y1 2VNOA 3OTFA 4CUBA 2XB6C 1BQPA 4EV0A 1LRHA 1I9RA 5E1RA 1O4TA 2A73B 1H6YA 5F2SA 4Y33A 2FD8A 3MIDA 1XU1A 1CZSA 1RGSA 2B7YA 2W08A 2XLFA 3VDAA 3S7EA 2RJKA 4QHZA 3DECA 4O61A 5JI7A 5FZ4A 1S55A 4NPLA 4IE5A 2ARAA 3S5QA 1KD7A 3UGGA 1UWWA 4D69A 4ASLA 1REFA 1V9U2 2WS92 2GMPA 4XBNA 2WINB 1R093 2YDEA 4LO6B 1JMUB 1UKRA 3AYEA 1PIV2 2RS32 3H1WA 3IN9A 3ME2A 2G1MA 2VVFA 1PZ8A 2D6KA 4QX5A 2P34A 4IE0A 1JZ8A 5FXVA 5L9BA 2Y33A 4YZ1A 2HYXA 3WDUA 1K5MB 1RHI2 2JWPA 3CHXA 2GC3A 1CAVA 3USSA 3A23A 2RR13 1DQ2A 1HRV3 5ACA3 4OUEA 3EJKA 2AEYA 4NHLA 4RN5A 2A75A 5CFDC 3ZFEB 3NJVA 4IGOA 4HKLA 2J22A 3BTAA 5JPNB 3MHZA 1SMVA 2VJXA 2PHTA 4KQ7A 4XF3A 5AC92 2PA7A 4BE3A 2PQSA 3OY8B 2QQLA 1GV9A 1HB3A 2ZGQA 3KZ4C 2Q5TA 1JTZX 1BCXA 3S57A 3NKGA 4IERA 1DZRA 4P00B 5IVVA 1OOPA 1OPOA 3DV8A 1WCSA 2AR6A 2XPJA 4CPBD 1NYWA 1XNTA 2JE9A 5JWPA 2Y0IA 5CG9A 1ZBE3 1OF3A 3LGRA 5IFPA 4ISRA 1GWMA 2WNUA 3JU9A 2VUJA 2WFF2 5DUXA 1IKQA 2W95A 2XHKA 2ZAAA 5A6YA 5J37A 1UU6A 3VBRA 3NNGA 2BFUS 3ZYRA 1AR62 1UMHA 3C2UA 1JI6A 4H3WA 5ISLA 3T2TA 2VBPA 4DXTA 2AEZA 2HWC1 3OEAA 4NVPA 2VMEA 2QDRA 3D3AA 2XVKA 2FMDA 1UY1A 1W03A 1JYWA 3P3NA 3POYA 4OZXA 2ZHLA 1RUE1 3IPVA 1HLCA 3POGA 2GNMA 5ANNA 5FPVA 5A7WA 1SDDB 5T55A 4AQTA 1RMU2 4DIQA 1JW6A 4RGGA 1QDCA 3THTA 4QPIA 4AVVA 1BXHA 1PMHX 2MHFA 4MGIE 3ZR6A 5A6ZA 3B00A 5IVYA 2JDMA 5DDJ1 1Q5OA 4XQDA 5FYSA 3WUDA 3CU7A 4E27A 1X8EA 1GKBA 5CADA 3V0AB 1VBD1 2JDAA 1G9BA 5A32B 4XEZA 1IPSA 4ORFA 4QX2A 5BXXA 4BH9A 2ZJCA 4AK3A 4KBZA 4BOWA 1WBLA 2WABA 5LK5A 3U11A 2VR4A 3KGZA 4LBNA 4OCTA 1VBE1 2XMLA 3WHUA 2BVBA 3BCWA 4QPGA 5F3IA 2XJVA 1R092 3R4UA 3O1VA 2CYFA 5JCTA 4AFBA 3UJQA 2Q1ZB 1H30A 1QF3A 4WBBA 5L7OC 4IEYA 3I2IA 5JUVA 3VBHC 1PNFA 4S2FA 1ND3A 1ULGA 2EAKA 3I59A 1ENQA 3JUUA 4AFDA 4Y20A 4JGYB 1J3QA 4N53C 5FY8A 1VJ2A 3AL5A 1PGW1 5FXWA 4HN1A 4CTEA 4IV3C 2RR12 1HRV2 5ACA2 4ATFA 5I0TA 2W91A 2VUDA 4Y5SA 4L8QA 1QNYA 3U1XA 2X29A 5A70A 5JLVA 1AR91 4QXCA 1TNRA 4M3CB 5FBZA 2VZ1A 3PVBB 1VMFA 4B1MA 2QZ2A 2VMDA 5H9QA 4JHTA 2IXKA 2EA7A 4Q0SA 5B4XA 2DV9A 1QHDA 4IE7A 1CN1A 4QB2A 5JOZA 3WQ1A 3WF3A 3FZ3A 1AR81 3QOPA 2E32A 3FL7A 4LBKA 4UW6A 3WW2A 5FZ0A 3WW3A 1WZXA 2DU0A 1ZBE2 3VKFC 3V56A 2D97A 5TSWA 2VCAA 2R063 2RVAA 3DKQA 3NNLA 4FVVA 3VKOA 1X9PA 2K0GA 1GNYA 3ZFGC 5H9SA 2VTXJ 1REEA 3I7DA 2VD7A 1GZCA 4IGPA 1T6GC 3RPQA 4DEQA 4DUVA 2X5IA 2QCSB 3B69A 5DG1A 1IPJA 2J1AA 1PVC1 1YC61 4SLIA 3MEPA 1OQDA 1BVP1 2WZEA 2XJSA 2JDZA 3WNKA 3F95A 2DDUA 2DVAA 3ZX7A 2D44A 3AKRA 4CEWC 2B5HA 4XF9A 1XYNA 1J59A 4GH4A 5C9AA 1VBC3 1UPIA 1CAWA 5IK8A 5FYMA 4MXWA 3O1SA 5JR7B 3SH5A 1H2LA 4U2AA 1JHNA 5A1FA 3I54A 4AOCA 2D3SA 1AL23 3GZEA 1XE0A 5BUVA 5C70A 2BQPA 5E88A 3VKNA 5HBAA 2VW1A 2XBO1 1VRH1 3CKHA 1JOBA 4L0PA 1RUOA 1CONA 1UZVA 1IOAA 3MIHA 2W52A 4HK8A 2AC1A 3USUB 3SCGA 2OQ7A 4HZFA 1QJY3 1YXWA 3E1F1 4YWAA 4AL9A 3VGIA 2WQZC 4FQZA 1OUXA 2J42A 4GULA 4NIGA 2IVJA 1W0PA 2BGPA 3H7JA 3KLSA 1XNKA 4UOJA 3WNLA 3NJZA 1UYZA 2ADDA 4LUMA 1FMD1 1JXNA 5T5OA 3BTYA 1H1AA 1VBB3 4FPHA 3Q9OA 1PK6A 2WSVA 5FKCA 4GAZA 3TBDA 4B7KA 2YXSA 4W6WA 4W8JA 1AUYA 4MOAA 5F3GA 5CKQA 4BQYA 1ND2A 2JJ6A 3N9OA 1W6MB 3RGBA 2IXCA 4GZ9A 5CU1A 1NCRA 2NQYA 3B01A 3OGJA 4LBOA 2Q4SA 2VXRA 2ZPXA 3AMMA 3CJIB 4QU2A 4CA9A 4HT1T 5CAZA 4NRMA 1WD3A 1X36A 2JENA 1WCDJ 4MLOA 3GHMA 4QQOA 4PQQA 5IVCA 4IDZA 2JG9C 4CEYC 3KV4A 5KWRA 5IVEA 2QJVA 3MZHA 3E6CC 1MQTA 4ZHNA 3PDQA 4RFT0 4FOQA 2ZZJA 3AXDA 3RJ2X 1V9U1 2WS91 5K9YA 4IXLA 4C91A 4YG3A 2R062 3V64A 5FY9A 5C3PA 2KA3A 3RI9A 3J26N 2RS31 2A6VA 1EUUA 2CL2A 3M4FA 4UWDA 5E6HA 5JOYA 2WT2A 3CLPA 2A6WA 1DIWA 3HJRA 3LDKA 4OFGA 2WSUA 5EP9A 4OYUA 3WDVA 5FZ3A 1RHI1 2EF6A 4EZHA 3IDCB 3SCHA 1OOPB 3FWEA 4GWMA 1W8ZA 1ALYA 2GAUA 1ZZ6A 3MV11 4COWA 3U07A 2ZKLA 5CKNA 4QHOA 3VZNA 4ZU5A 3ZXAC 1VBC2 2BDRA 3WDWA 5C8CC 1SZBA 4LBMA 2WNUB 5J96B 5I8TA 1V0AA 4MGYE 5C7GA 3HEIA 1AF9A 3QH7A 5AC91 3VBRB 2MEV3 5FDBA 3PIGA 1AL22 3VBFA 3TYJA 1B35A 3PIJA 3T0DA 3SHRA 5A33A 2ZX4A 4UF0B 4AW7A 4E8DA 4JV4A 3BGAA 3ZVXA 4OI0A 3VD4A 1FATA 1ST8A 1AYN3 4FP3A 4NROA 1MS3A 2DYCA 1RVF3 5FY5A 1QXRA 2X8KA 5LCWL 1W2OA 4UW4A 2CSGA 3CNAA 1TME1 4HLTA 4QPIB 1AR71 4K20A 5C71A 4Q0UA 2W1QA 1O5LA 3OD4A 4P5YA 5IJRA 3P3PA 2XJRA 2VAUA 5FO8B 2CTVA 5T50A 2JIJA 2ZKNA 3N35A 3MI8A 5KHJA 2ZMLA 1VBB2 4QGNA 4RR3C 1KGYA 3K75B 4I01A 2AH2A 4AFMA 4J25A 1U5YA 1WMFA 2JG8B 1GU3A 3ZR5A 2EXJA 1LHOA 2HYKA 2D5FA 4AR2A 3JB8A 3GXUA 4I3GA 1RMU1 3I3EA 4QPGB 1UL9A 5DAQA 4Q27A 4KU8A 4EWEA 3MLJA 1CJPA 1DGWX 2J1EA 2EIDA 1NY72 4DQAA 2QQWA 3PTYA 3SXWA 3TOJA 1VB2A 4MG2A 1ND3B 2PHRA 5A6QA 1PZ9A 2DCJA 3I59B 4HSJA 4YLZA 1XNDA 4Q4X3 4Y20B 3VDDB 3HNBM 3UETA 2A6XA 1QXJA 3UYJA 2BWAA 4Y4RA 4ZZ5A 1C28A 1OKQA 4UFHA 4U36A 1LU1A 1BK0A 2TUNA 3PUSA 3WDYA 3WW4A 1MVQA 1R091 2A3YA 3K48A 5T5LA 4QDSA 5CZKA 4CDXA 4CUCA 4PIYA 4HKWA 2C1FA 3LOBA 4WM8A 2NMOA 2JB8A 1TQ5A 5C4WA 3ZLIA 4SBVA 2XJUA 1S0EA 2HKXA 1D4VB 1V6JA 1UOJA 1WMDA 1KFXL 1ZZBA 1O5UA 3DEMA 4YNIA 4CE8A 5FQ0B 2A1XA 3RRDA 1FYUA 2RR11 1HRV1 1XPWA 2QBXA 2YBKA 4YGCA 5A3PA 2QQNA 3RFRA 2LW8A 4L92A 4CDQC 1I5ZA 1IQAA 2JDPA 5JOWA 4MX3A 4X8NA 3LPFA 3H3UA 3ZFFB 1LOEA 5CA6A 3ZSKA 1WLTA 5FPXA 2MEV2 3MFCA 5DQ0A 3HVDA 5DUUA 1C8NA 2ZEZA 5FAXA 4EE2A 5BNNA 5I91A 2JIGA 2JDKA 1KDKA 1CAXA 4LLOA 1WUVA 3BU0A 2CU5A 1AYN2 3HT1A 4LA2A 1RVF2 4CUGA 1EP0A 1O59A 1ULCA 4Y26A 2VBBA 3LA3A 4KWLA 5FYYA 1NXD1 1HRI3 3NJXA 4HVRA 4FPYA 4N43C 1V6IA 3SKJE 2HWB3 1MEC3 5A7QA 5IK5A 1F5JA 1A3KA 4MXWB 5C3OA 1NZIA 3E5UA 3NQHA 1LCLA 4YYOA 1IZ3A 3SITA 4XDQA 1CPMA 3SH3A 3ETPA 3NKTA 2RDRA 1SLAA 1RINA 2IXLA 4EN8B 2IC1A 4FPGA 5FUIA 3ZYBA 2RG4A 2QVSB 4BXFA 4TWTA 5BNPA 4M4PA 4Q8KA 1IHMA 1QNWA 1S4CA 1KEXA 5GLWA 3HWJA 4Y1ZA 3K3OA 1R1A3 4KWJA 1NOVA 2AYHA 1Y9MA 1X33A 2KD7A 2HH9A 2G9ZA 3AC0A 2FHRA 1W6NA 4R8HA 3UJOA 1D7PM 5FWJA 2F17A 1ENSA 1SLBA 1SLIA 1TG7A 4JGZA 1KS4A 4Q4X2 3WHTA 1LOAA 4C8DA 5A3MA 3I2KA 3B9IA 4QPYA 1PK6B 4P08A 4XACA 2RS13 2SBAA 2GNDA 1H8VA 3AJZA 1CPNA 4YGEA 3ZIXA 3OBTA 1ND2B 4S2GA 4XBLA 3VBSA 3AMHA 4QT6A 1LESA 4Z92B 4ZU7A 2ZX1A 2G19A 5LY2A 1SFYA 1QJFA 4XMAA 1PO11 5T5PA 1BVVA 5FOBB 5JXHA 5K8SA 3DPRA 4XIOA 2F6BA 4BQ2A 4P9WA 3K4DA 3KHBA 5FZCA 4R4XA 4XUOA 3R05A 4EJRA 3FUQA 4CDWC 2R1BA 4KBBA 2RE9A 4TZDA 3FFZA 3EYPA 4MYEA 4A7YA 1MQTB 3O1TA 4LO8A 1LHNA 5CFCB 4GA9A 4FXGB 1S2KA 2Y0OA 1SG3A 1IS5A 4CDUA 5JZGC 5JI9A 2A6ZA 1T6BX 1AYM3 1R64A 1UXZA 2XOMA 2QFEA 4AXOA 2KXLA 4BQ4A 3AKSA 3FC0A 3VL8A 4IEXA 4LPLA 5E89A 5A80A 4CP0A 4AHYA 3ZFEA 5LW9A 2WAOA 4UYBA 3OF1A 2P4EA 1HRI2 2RM21 2Y8KA 2R061 3OY8A 2FDJA 3N7KA 4NHKA 2HWB2 1MEC2 2FDGA 2DVGA 4V1PA 2WR9A 2Y6LA 1ZYBA 3I2FA 1L3JA 3WG4A 5BV6A 1B35B 4XABA 5A33B 4NMIA 5C6CA 1VP6A 2D43A 3E6BA 2D6PA 5DZEA 4COZA 3ZM8A 2P6HA 4D7YA 5CBLA 2RJLA 5J09A 3BB6A 2YBSA 3A0KA 1GP5A 2XDVA 3NAPB 3LKJA 4GKXA 4XDPA 4Y3OA 1GQPA 4LBQD 3OBAA 3B7MA 4Q0VA 1VBC1 2B46X 1R1A2 3ZPOA 1IKPA 1OSGA 2LM3A 4CYDA 4CCEA 3OPZA 2R1DA 5D8AB 4KNCA 1OLMA 2Z5WA 2WO1A 2XGXA 4PQ9A 4XHXA 4D6SA 4RQPC 4AVAA 5KXDA 3K4ZA 5JMOA 1AL21 5FMCA 5E8AA 2BNOA 5JXGA 2RS12 1UO9A 4IV1C 3GALA 2HWF3 5L36A 3JCIA 4WVWA 3D0SA 4XJZA 1QJY1 1U5XA 1CQ9A 5EJ3A 5A3UA 2YG0A 1EPZA 1E5HA 4H55A 4MH0E 3OUHA 5CNAA 1COV3 2WNVB 2A3XA 2C5DA 2ORXA 2V4VA 2WUHA 2Y34A 3NJYA 4FTEA 3DXTA 1G8WA 3DYOA 3M3OA 3SCFA 5A32A 1MZ5A 2RDSA 2HEWF 2P3IA 3IMNA 1ZRDA 4A7ZA 3S30A 5JVVA 2UWCA 4XQ4A 4HOOA 5BNQA 4DXRA 4P02B 2J7MA 1HN0A 1UAIA 3DYMA 3KV6A 4RA0A 3OUIA 1MZEA 1NY71 3N7MA 4WM8B 2H6BA 2HEYF 2O0OA 4XJUA 1OC1A 3HMYA 2N7GA 4Z07A 4JGYA 3WDTA 4BPZA 3VV1A 5C4WB 3W5MA 1UX7A 3C7FA 4LBJA 2A7AA 2VULA 4QGMA 1S0FA 3BALA 2GH2A 3FUOA 5CYYA 2VOTA 3BN6A 3GDBA 5KXBA 2DWRA 1YFXA 3S0MA 3ZSJA 1AX0A 2VW2A 3S7IA 2Z79A 5LBBA 1F35A 3T2OA 4XC9A 3AP9A 4FTSA 1HQWA 2F4LA 5FRAA 4M3CA 4AEDA 4FFIA 1UU5A 2WJSA 2BERA 2YPDA 4WM7B 5IFTA 2PTMA 4GWJA 3T4HB 3TEXA 3KHCA 4Q0PA 4QD2A 4B29A 4BZ4A 1WMEA 4TSVA 5BNNB 1RJ8A 3LF7A 1YFYA 3TEWA 2ZMNA 3UT0A 2VTXA 1E57A 4NHMA 4JQRA 1I6XA 4BA6A 1J1TA 1NA1C 4AGRA 5LEKA 2OA2A 5FLHA 2WKKA 4ZY9A 3P1IA 1A8DA 2DVDA 1LOCA 2ETEA 2XQXA 4JX0A 1I3HA 4H7MA 4R9BA 4PDWC 3CJXA 2GN3A 4MHRA 4ASMB 1N1SA 4QXKA 3H50A 2VOXA 2A71A 2ZCWA 2P3JA 2MEV1 3EQEA 5FPAA 1DHKB 2FCTA 2PHFA 5LWBA 1EYBA 1YWKA 3WR0A 2VPVA 1LGCA 5KXCA 4LORA 1G6NA 3RZKA 3AFGA 2HWF2 1AYN1 2QQOA 2EXHA 5LK7B 5BNPB 4MZUA 2LROA 1BBT3 3PL0A 4JAAA 4YVSC 2R49A 3MYXA 4XBQA 4KG8A 2FDIA 1COV2 2YFUA 1Y43B 2ZGUA 5FP4A 3O1OA 4I02A 2X09A 4GMP0 3TNPB 3MPBA 2MPFA 2OUHA 5FZIA 3ZYGA 5HCBA 2ZABA 4Q29A 3USUA 1JYCA 4YW5A 1GNHA 1RXGA 1YFWA 3O7OA 3DCQA 2ET7A 3T08A 2A3WA 3WZ1A 4YZ5A 1RUH3 2ZGTA 4OVEA 4DEVA 1JBCA 4OI2A 5HCAA 3WW1A 2JD4A 3WP4A 4O9EA 4B4RA 2DUQA 2W9XA 5FZ1A 3ZXJA 4FFHA 4WVMB 2EAAA 3N9MA 1FX5A 1HJGA 1W05A 3DPRB 3WF0A 1OA4A 4PF5A 5FZ9A 2GC1A 3U78A 2RHPA 1HDKA 3FLRA 4IEVA 4Q4X1 1NCQC 4MGTA 3LIGA 4Y1YA 1SCSA 1VB4A 3VKMA 1GOGA 1OH3A 2ILMA 2VNVA 3AVSA 4FCAA 4FT8A 3OGGA 1F2NA 1N47A 1PMJX 5FZ6A 1W6MA 5FZDA 5LB6A 3VBOC 1BZWA 4AQ2A 4BIFA 3I2JA 3GNEA 2BGCA 1CX1A 3LD8A 3FN9A 4BIOA 3I3MA 3PMSA 3CJIA 4YW7A 3R4DB 3AFKA 4YZ4A 4CDUB 3D4KA 5L19A 4ISQA 3ZXFA 1MR5A 4K9SA 3B9CA 1H9WA 1SPPA 1IS6A 5FPLA 2FCVA 2ATFA 3WOGA 1ULFA 1RUNA 1CWPA 3CDZB 4JKLA 1SDWA 1PMIA 4AI9A 4CCMA 1D4M3 2B39A 1KDMA 4ZXEA 5IVFA 2YZ4A 1UMIA 2VCMA 2QZ3A 2W68A 4CCCA 3VD3A 3NV2A 5M0TA 1UX6A 4NPMA 5DABA 4FPJA 5F3CA 3WINE 1C57A 2YHJA 1IGOA 5I8YA 2P2KA 2Y6GA 3VD9A 3MW3A 3M3CA 1W9WA 2W1WA 1GSLA 4YW1A 3VDCA 2W5FA 2CGNA 4I2OA 3LSDA 4R4ZA 2HEVF 2VOWA 1I1EA 4JTNA 2I45A 4D8MA 1YQ2A 1JZ3A 4HXCA 3BKZA 4CXXA 2MNGA 1QWRA 3IAPA 1BBT2 5DAWA 1VE0A 2QQVA 1HRI1 4O65A 1YEWA 4IEWA 2W39A 1YUDA 5DMYA 5I93A 4YVWB 3UNPA 1Q8OA 2EIBA 2I74A 4NAOA 1MEC1 5JDBA 4QXHA 1CESA 2XJQA 3AX4A 4AVSA 5FYHA 3TRSB 1BLZA 1HN1A 1RUC3 1SQ4A 4UF0A 5EV7A 3JBG3 2D98A 3P6BA 4O7XA 2JXAA 2E7QA 3LEGA 5FZHA 1RUI3 3KCYA 4EQVA 3LFIA 1LHWA 5JXIA 2UYBA 2WWJA 2XH6A 3RWKX 2WLQA 3E97A 2E33A 1RUH2 4CU6A 5LATA 4DOUA 1MZ6A 1OOPC 5I0SA 2JB4A 1R1A1 3HNMA 2PHUA 3J7HA 4I0BA 1ODNA 3KGLA 3S6PA 3SEEA 3HBKA 4E9KA 2Q0AA 3M8LA 4IEZA 2V4AA 2Q30A 3POIA 1X9TA 1DYOA 3OGRA 4P9GA 2NPIA 5L7OA 1CZTA 2JG8A 2ZHKA 1IS4A 2CWSA 2RS11 4N9HA 2DFBA 3IDAA 2BRTA 4K21A 3RZJA 4XAAA 4YZ3A 3LSEA 5DAVA 5F6KA 2JDYA 4GMP3 2O8QA 1TMF3 2E9QA 2GMMA 2TBVA 4QKBA 4N53A 5LA2A 4BQ3A 3A21A 2R073 5KHGA 4D6RA 3HQXA 2DTWA 1ZRRA 3HD8B 4HKOA 1LEMA 3WX5A 1ZA7A 1P8JA 2CDOA 1JZ2A 1OF4A 1QJZA 3WF2A 3VDDA 3WNPA 4DPNA 4G4FA 4FPCA 1OA2A 4XJWA 2ARCA 2VUAA 4IEUA 1R083 3C7EA 3GCWA 4RL7A 4Q4V1 4AEKA 3CO2A 1LOFA 1A34A 1D4M2 5ERLA 3IMMA 4YGBA 1LAJA 2HLEA 1UOFA 1WGPA 4QQ2A 4D3WA 1KJRA 4IGQA 2CGPA 4AEDB 1N1VA 4CCKA 1ASJ1 3FBMA 5IK4A 1GWKA 2ZAHA 5A7OA 2YYOA 3J7LA 4GQ7A 5C5UA 5GZEA 1C8M1 5K4LA 4LQRA 3ZSEA 1AYM1 2W46A 1X7NA 4CCOA 2RDNA 5ABJC 5FLJA 4BISA 2AREA 1AXKA 2ZMKA 3H8OA 2J1VA 2JE7A 5BNOC 3ZFGA 1PX4A 5FQ0A 3HR9A 4XF1A 3ACLA 4LNVA 2CV6A 1G9DA 1SLCA 2HWD3 1QQP1 3B02A 3THPA 3KT4A 2ZEWA 3ZFFA 4FBFA 2R30A 4YZ2A 1W6QB 1WD4A 2VNRA 1QH6A 3T2QA 2NN8A 4OQ9A 3M3EA 1RUC2 2B42B 2ZOEB 3V65A 4NO4A 1X82A 4DRVA 5LRRA 3JBG2 4PIZA 4CEWA 4DMIA 3V0BA 1DG6A 1WWYA 1XOYA 4EN6B 4Y5TA 1RUI2 1K5JA 3PJQA 5F5AA 5K0UC 3H1MA 1YIPA 3SMHA 1HKDA 1ULOA 1S2BA 1OVSA 2R043 4ET7A 2WYFA 5BY5A 2VCBA 3I2DA 4XQWA 1YHFA 2VMFA 3W5NA 2QUOA 4QKFA 3ZN4A 2WO2A 4ZU4A 1BKZA 2B45X 3H3ZA 4UT5A 3UESA 1ZVFA 3ON7A 3OD0A 4BLJA 5IK7A 2DFCA 2PHWA 3WNXA 4LKSA 2B4KA 2E31A 3AP6A 3VBUA 4RHV3 2D6OX 2A6YA 4KWKA 2VZ3A 2P3KA 1HQLA 2HWF1 3JD73 1NLRA 5HV4A 3AVRA 2EXIA 4XZPA 1LOGA 2X5IC 3BTZA 2LALA 4CP9B 5C33A 1TMF2 1T2XA 3PVOA 1RUF3 1SBFA 4R9CA 4A45A 2CY6A 2R072 3D0JA 2J1SA 4B8EA 3MPPG 1HV1A 1COV1 2ZHNA 1OPMA 2WWUA 1KXGA 1JODA 4BMBA 1N3PA 4GH4C 5C9AC 3POJA 1IS3A 3T3YA 3A22A 3ITQA 4NUBA 2BGOA 1R082 3U10A 5JXJA 1NT0A 4XFHA 4A44A 5KHKA 4E4SA 1KQRA 1UD1A 2IXIA 3AYAA 3GBWA 3W21A 3W59A 3ZXLA 3I49A 4F7ZA 2Q8OA 3NNMA 4FPFA 3PJYA 4DZGA 5FP7A 2D7FA 2YB7A 2VOVA 2XR4A 2R0HA 4YFZA 4LE3A 1EY2A 2LTNA 3LZZA 1UKGA 4BQ1A 1SPPB 2WL1A 5CFDB 4LHLA 3ZYJB 1REDA 4M3CF 2ERFA 1ZRIA 4NIHA 3LE0A 1YIFA 4NJ4A 2G9GA 4Y1UA 1S0CA 1VRBA 3RYKA 3L2YA 4XAEA 5IVBA 1AJOA 3ZPYA 2XKOA 3FJSA 3J9SA 5CFCA 3BTXA 3PVEA 2PHDA 2VXJA 3RS6A 2HWD2 3RI8A 4JHZA 1UYXA 1Y4WA 5B4NA 1PGL2 4UFJA 2OPKA 5F6LB 1PIV1 3BIWE 4W4ZA 3UKNA 2ZXQA 3H8RA 2IUWA 3OBZA 2BEOA 2WIIB 1GOFA 3ILNA 1BEV3 4QQLA 5FY0A 3ZN5A 1NCRC 1TVGA 1W0NA 1W3XA 1SLTA 5C8CA 5HPOA 1UNBA 3H3LA 4NE9A 4UAPA 5APAA 4Y22B 3AXEA 2K46A 4JVAA 3J4UH 2IFRA 4CPBA 2FDFA 3N9PA 5A3OA 2R042 1HXS3 1POV0 1WW7A 4O9GA 1W8TA 5L9VA 1ONAA 4LOSA 4LBQB 4PI0A 1LGBA 4AFAA 1XBFA 4KG0A 5ANQA 2YROA 5HXVA 3EO6A 3URFA 4EWAA 1A8MA 1O6UA 1ENRA 4QX1A 2FDKA 1QJU3 2BP6A 1W8WA 2XLGA 4RHV2 5FZAA 2DBNA 2YGLA 3H1YA 1OH4A 5J36A 1NX9A 3JD72 3NAPA 5FREA 4BJ0A 2X10A 4IEOA 2JD9A 1GP6A 2HBUA 4KI5M 3ZN6A 5FY7A 1RUF2 2WFF1 1BBT1 2Y60A 5D8AA 3O1RA 1SACA 4W65A 4ZPIA 1H9PA 3ELNA 1AR61 4V2WA 3VZKA 1D2QA 1ULEA 1W0OA 3VHPA 1I5PA 2WYSA 4GB33 4Q4W3 2GNTA 2V09A 1UIKA 1G9AA 5L7OB 2NZ9A 1PX3A 3WCRA 2Y6HA 3T4VA 1DCSA 1NUKA 3EXUA 1WW5A 3LQCA 3AK0A 5LBEA 1OVPA 2WRAA 3VBFC 1VAMA 3VBHB 3ZIWA 1WA6X 4K8FA 4LULA 3KSCA 3POSA 2FMYA 3OG2A 3AZWA 4N53B 2WNVA 4GWNA 4DY5A 5CKMA 3WY6A 4MVTA 4IV3B 2VVEA 1OQEA 3B5LB 2P6CA 3I8TA 1HIXA 3Q8CA 3MLKA 4H7LA 4RS5C 5FZMA 1FV2A 5A3WA 1O3TA 4TN7A 5DN2A 4YW2A 1AX2A 2GP5A 1JYNA 3I2OA 4HVOA 4QAWA 5FLIA 3GF6A 5LEJA 4XXAA 1W99A 1UYPA 1XYOA 5JPMB 4CU7A 4Z2WA 5FXXA 4AQ6A 3Q8EA 3FMGA 4ZKTB 1RYYA 1HB4A 1JOPA 1H1IA 1L7LA 3G6JB 3LWCA 5FP8A 3BYWA 1UY2A 3T1LA 3DXUA 2BV4A 2XJTA 3B94A 3R6SA 3N7JA 1BEV2 2UWAA 3ATGA 3QACA 2YFZA 1GANA 1XC6A 1Z0HA 4ARYA 4JDOA 3ZFGB 3IM0A 4LK6A 1PO23 5ACA1 2WN3A 4M01A 1HXS2 1W8UA 4MGZE 4WM7A 2WT1A 2XWJB 2HJIA 2JICA 1LR5A 4AZZA 4OQ8A 3EMRA 2HWE3 1GQGA 2VL4A 4A4AA 3D5OA 5FR3A 1UYYA 2XONA 3SLIA 3IBMA 1Z7S3 4NR1A 1QJX3 1J3PA 5FYUA 1L7RA 4AF9A 1H4HA 4CEWB 3T2PA 4CDXC 1QJU2 1ODMA 3UGHA 3V0BB 1UZYA 3WP3A 4EROA 4Q5OA 4WM8C 5FZOB 1DYKA 3FHIB 1PM7A 2OVUA 1KRIA 3R4SA 1GNZA 1OLQA 1SBEA 1XYPA 2QKDA 1ZBE1 3T30A 4A41A 3RMYA 4OHXA 4LBLA 5FXZA 4LIVA 3O0XA 4Z2AA 1Q3EA 4W6XA 4XETA 4L11A 2YBPA 1QJEA 3D82A 4X6QB 5HXMA 1MPXA 3MIEA 3HQRA 1YYNA 1RUC1 5F3EA 2B9UA 1DGRN 4NRQA 5FZ7A 1POV3 1VPHA 4GB32 4Q4W2 4P9XA 3HN1A 2PAMA 3ROUA 1BMV2 2D40A 2ZA9A 5GLUA 3VBUB 4AAXA 4N7IA 1RUI1 4R9DA 1E5IA 1U12A 1R1ZA 1XXNA 2JDHA 3AZZA 2PYTA 2VBDA 4NHYA 4WZCA 3ORJA 1W39A 4TXWA 3TAYA 2WNOA 5DZGA 1WCUA 3NNFA 4Q0QA 1QIQA 3WCSA 2AACA 1LEDA 2C9KA 4YM3A 5K7PA 4XFBA 1EV13 5DPNA 5B2GB 1Q8SA 4TLFA 4CCDA 2ZGNA 3OPTA 1DQ4A 5IUQA 1FPN3 4OHVA 1DQ0A 4XJ9A 1YJKA 3WQ7A 2VW0A 2UWBA 3MDPA 4RD7A 1PVXA 1F5FA 5J98B 1AL0G 3KB5A 4AI0A 1NKGA 2E51A 4AWDA 1AX1A 4JKKA 4GMP1 1POQA 1TMF1 2BFUL 2JG9B 4CP2A 4WVMA 2AGSA 2WZPP 3U75A 2RMU3 3VHOA 4D7TA 3M3QA 3T0AA 2OIIA 2ZGPA 3KCXA 4GALA 1SLLA 1V00A 3K2OA 2ARBA 2B9VA 2JE8A 3NV1A 5FYVA 5EIYB 1LENA 1K3IA 1R081 5FYBA 4A3XA 2Y6JA 1PO22 2VM9A 1UU4A 4MADA 5LA0A 4AG4A 5C5TA 2QE3A 4JGZC 4OZOA 5FK8A 1G9CA 5HV0A 1QH7A 4XTPA 3KCCA 5CB7A 3VDBA 2HWE2 2ZEYA 3MW2A 3WT3A 4E8CA 1EAH3 4XFIA 4D94A 1QOTA 3IWZA 3VBSC 1A6CA 1Z7S2 4NRPA 1QJX2 5JAXA 3MLLA 2DF7A 1RTVA 5CVRA 4AYUA 2Q8EA 5J3UA 4QMAA 5BYNA 4G3YC 3OCPA 5C8CB 1JOJA 2WT0A 1UPSA 4IUGA 4BQ5A 4DINB 3WF4A 1URXA 3DPRC 1RUJ3 2WC2A 1UN1A 1XSQA 3MUY1 2HWD1 1AR93 2E7TA 2NYYA 4CCNA 2TNFA 3AYCA 4BYYA 1JN2P 5IAVA 1C1LA 1OD3A 2WQ8A 3GCXA 2A70A 5GLTA 2W3JA 3ZMNA 1BHGA 2OUJA 3WUCA 5A1AA 3SNMA 2CHHA 1WW4A 2ZHMA 3MFAA 1J3RA 1AR83 2WZ8A 5F32A 4CXWA 1LU2A 3AMNA 2BW8A 2W0XA 1G7YA 1K5MC 3O1PA 3M1HA 2D6LX 2CWMA 2Y64A 2R041 1C5HA 3ZN6B 2E53A 4IQPA 1XJAA 3FBYA 4YVWA 2JDUA 5FMOL 1US3A 1DGWA 1EV12 2DURA 2GC0A 3AMPA 4RR3B 3WNOA 3HNYM 1FAYA 3POBA 4IV1A 4XXPA 5A7PA 3KQ4B 3ZFEC 1JHJA 3AZYA 1FPN2 4W50A 4CSWA 1W28A 2FDHA 1UIJA 5FZFA 2CDPA 1F4HA 1DZQA 1NLQA 1UF2C 4F83A 4YARA 4RHV1 1D2SA 1Q56A 3MGUA 2BWCA 3VZJA 2GSYA 2G9FA 3GHNA 3MV01 5FYIA 3JD71 4CCJA 4DB5A 4WVVA 5LA9A 1TE1B 1Q8QA 4BCUA 4OLLA 1DYPA 1DF0A 2PLV3 2WNEA 3TEYA 1RUF1 1J83A 4EZ4A 2RMU2 1OURA 1O4ZA 2YMZA 3C7HA 3KQRA 3H8UA 3I3BA 2QQKA 1AXZA 3LEKA 2NLRA 2D93A 2XBO3 1VBB1 2IXJA 4D6QA 2VY0A 2Z69A 3JXSA 1K45A 1KS5A 4NIIA 3WP6A 2DVBA 2DCZA 2PFWA 2ZACA 3ACFA 2VQ0A 4L97A 1U5IA 3PUAA 1ULDA 2XHNA 4YW3A 4YM0A 3LB9A 3UKVA 4FSJA 2GP3A 3NV4A 5FPBA 1ACCA 1EAH2 1JYTA 3ACHA 1UZ0A 2W1SA 3PNAA 4LK7A 1NAEA 3LA2A 4KGQA 2V72A 2EXKA 2VU9A 3IZOA 3MO4A 4JC1A 3SKVA 4BXSV 3IT8A 4AI2A 4FP2A 4COUA 4HBNA 4CDQB 4OI4A 4LUKA 3GGLA 1C3HA 1H2KA 1DDLA 4XURA 3VZOA 1RUJ2 2YV8A 3WQ0A 1UY0A 1AR92 2CGOA 3Q8AA 2YC4A 3I3DA 2V5YA 1IQDC 2UU8A 4J1XA 2XVGA 3PUQA 2E63A 3ETQA 2H0VA 2VZVA 1FNYA 3ILFA 5C8WA 4BMEA 2OPWA 2VZOA 2OKXA 4A3ZA 4PDWA 1WLWA 1AR82 1W2TA 2BZDA 1RUG3 4N43B 2E26A 4LO5B 4JGYC 2I07B 5T5JA 1W6QA 1HXS1 1CD3G 1ZNPA 3JB4C 4P9YA 5FPUA 2PHLA 3AZXA 3U0ZA 1GBGA 1N3QA 3DN7A 3Q8BA 4A6SA 1SFPA 3CZUA 1F15A 1DQ6A 2RJ2A 2ARXA 2WWSA 5DAPA 1OI6A 4JDMA 2BOJA 1CGPA 4JRAA 2WO7A 1QJU1 1HW5A 4YW6A 4K8RB 1AHSA 3X29B 4OHYA 1RVF1 2Y38A 4QQPA 1WCKA 2W1UA 4RFRB 2GH8A 4LHNA 1H8TA 1VIWB 3PTRB 1F9KA 2OXBA 2PLV2 4X8PA 3LA7A 1H4GA 3ECQA 4B4PA 3QCWA 2QQUA 3KWVA 2WFPA 4PBPA 5AFBA 3D6EA 3I2GA 3RJRA 3TNQA 5IYYA 1FT9A 2VE1A 5I0DA 1O3SA 2ZZQA 4MV2A 2XBO2 2YUEA 3IIIA 1JYXA 3K51A 3KD4A 4GB31 4GIQA 4Q4W1 3DUIA 3WQBA 2H0BA 4B7EA 1BYHA 1LHVA 3ILRA 4P5HA 2VQTA 1N3OA 1ZZ7A 4CP9A 2BPA2 1PZ7A 1TME3 2VO5A 1AR73 2PXJA 3BODA 4LHSA 1GMMA 4LR4A 4IE4A 5IWFA 4HL0A 3RDIA 3K77A 4CDWB 4DS0A 3AJYA 4BU2A 3WLUA 1SBDA 2WLPA 3VBOA 3WEZA 2ET1A 1W8FA 2VVDA 4GKYA 1S1AA 2PAEA 2VTFA 3C8XA 2WA3A 4JDNA 5JZGB 4HMZA 3H8XA 5FCCA 1S0GA 3I4IA 2OX0A 4QQHA 3ZXKA 2IWGB 2GMEA 3GZUC 4UW5A 4BB3A 1D0HA 1ENXA 2QQJA 5FO7B 3CQOA 1AVBA 4URTA 5CFDA 3AKQA 4YG6A 1X8MA 4K3UA 4JZRA 2KR2A 4P9JA 3HN3A 4E4HA 2W87A 1A78A 1RUG2 3U4SA 1PO21 2GU9A 5DUWA 1GFF2 1UZZA 1O3QA 3RZLA 4OI1A 1LULA 5HCFA 1PNGA 2EVXA 2VQUA 4IESA 1DFQA 1JYIA 4Y4YA 2D3RA 4PLOA 4DFSA 3K46A 4JCKA 2HWE1 2D6MA 3B3QE 3AMQA 2EIEA 1OD5A 4QM8A 4B3NA 1LB2A 4EYUA 1Z7S1 4W6YA 1QJX1 4GXLA 2FQPA 4G9SB 2UURA 2GDFA 4C1WA 1VMJA 2GN7A 3CJIC 1UMZA 1KITA 3GYDA 1GZ9A 4Y22A 2YY1A 2O14A 4OUSA 2VQAA 2XWBB 5JSPA 3O12A 4Q26A 1JZ6A 4DNYA 4UFLA 1UZWA 4YM2A 4XZUG 5HCHA 3CBNA 4RQPB 4AI1A 3RQ0A 4LBQA 3VHNA 3ACIA 3VHRA 2SLIA 2QQMA 5FV3A 3NSTA 1W8OA 2HWB1 3ZYPA 5EYYA 4IV1B 5HI0A 2QQPA 3ALQA 1OA3A 1S0DA 4HK9A 3BUCA 4IW3A 1LGNA 1DLLA 1POV1 3DYPA 3J8F3 4XW3A 1SCRA 3E5XA 4HG6B 3ZXDA 3QD6A 2RS53 1V6LA 2W47A 1C1FA 2VZTA 2R32A 2WO3A 4PJYA 3RZZA 5J48A 4JKMA 1TME2 5D21A 3JQWA 1AR72 3MBWA 3O0VA 3VZMA 3OUJA 3RYPA 4AHXA 5A7NA 1FXZA 3F2ZA 2W94A 1ZZCA 3VD7A 4IEQA 2OZJA 1EV11 3TN93 2BOIA 3C7OA 4ZS2A 2ORZA 4LKEA 4XF0A 3OB8A 4XILA 3MF9A 4LIUA 2G4IA 2WNUC 1YJLA 1FPN1 4XUTA 3ZXGA 3I2HA 1ZRCA 5KBFA 4FPOB 3VBRC 3FX3A 2AUYA 3N36A 1RB8G 3VBHA 5JIUA 1AZDA 3C3VA 3LDBA 1W9YA 2GC2A 4PI2A 1MS4A 1YNAA 2ZX3A 2VECA 4Q1RA 4LHKA 3VZLA 4PIXA 3L2HA 4QKDA 1GUIA 2YU1A 5FMBA 1RL3A 1BK1A 2ZBJA 5GKAC 3GZAA 1QY4A 4IV3A 2RMU1 1Y9GA 2PHXA 3LCPA 4M0HA 4X6RB 3PMEA 1W9TA 3PVNA 3WG2A 4E4DX 5C3RA 4QPIC 1XRUA 1UY3A 3HPNA 1QOSA 4EWDA 4ITCA 3TWIA 1YLLA 4L2NA 1LTEA 3OYWB 4BK5A 4Z82A 5F5QA 2C4XA 2LUWA 4MSVA 3OOXA 4XFCA 3K3NA 1GZTA 5F5IA 3VL9A 2GNBA 3ZO0B 2O8OA 1YI7A 2J1UA 2J1RA 3E6DA 4XUQA 5DXDA 3UKTA 5ABJA 5FZBA 1LJ7A 4PLMA 1PO13 2JG8C 5BNOA 1QMJA 4OUMA 4LO4B 1EAH1 2C6SA 2K2SA 4AVTA 4PLNA 4QPGC 1NA1B 4EN9B 4E2QA 1CAUB 2W92A 4FI9A 4AEMA 4RYDA 5LASA 2IXHA 4PDWB 1ZBA3 1ND3C 4ZONA 1H6XA 3NWKA 4A2UA 5J7MA 5FO9B 3VDDC 1RUJ1 1RUD3 4D0QA 4I0WB 4ES8A 1W2NA 1SFNA 2V73A 4LJHA 4NOTA 4LT5A 4UFKA 4B1LA 1DQ1A 5EPAA 4XPVA 1LOFC 2BVVA 4FQ4A 2WQ4A 4QXBA 1MS8A 2OZ6A 5KHHA 5K0UA 2YC2A 5FMOS 4ATEA 2VGDA 2DCKA 1GOHA 1GZWB 1JZ7A 1KFUL 3LDRA 3NVCA 5FZOA 3WF1A 3GZTB 3J8F2 4QX3A 4YVSB 2IFWA 1W2AX 2AZ5A 3AYDA 4NWVA 2RS52 1XU2A 4I0AA 2X05A 3T09A 3U14A 5F8PA 4WV8A 3AL6A 3KT7A 4N7UA 4TLGA 1RIRA 2RM23 2YC0A 4ARXA 1H8TB 4Y1VA 2XUEA 4NN0A 3OSDA 4OULA 3IDEA 3MW4A 4JTOA 3TN92 1EPWA 3JQXA 2C0ZA 4OMDA 4UBGA 3LOIA 1EUTA 3A4UA 2VC9A 3CZJA 1CIWA 3ZFFC 2BTVC 5AVPA 1JU4A 1MACA 1S0BA 2VMCA 4FAGA 3O0WA 1QU0A 1YQ5A 4XIKA 5JSOA 4LA3A 2JX9A 4IE6A 4Q8LA 5KR7A 1V6OA 1JU3A 4S2DA 2PLV1 1NCQB 3IIAA 3KF3A 3LEMA 5IAXA 3ASIA 1YI9A 4URAA 4B4QA 1LHUA 2DUOA 3DKWA 1CX4A 4K7JA 3ZOIA 3VBOB 5FYTA 4FAHA 5KC6A 1LECA 1HV0A 1OLME 2VZQA 2QDNA 4FO9A 5FFOC 1HB2A 3WG1A 3FFQA 4LITA 1Z78A 4HETA 4DXSA 5A3TA 3ZSMA 1GQHA 3PURA 2GALA 3CL1A 5FUPA 5A3NA 2JG9A 4CEYA 3DL3A 5KC5A 1PO12 1E5SA 3VBUC 4XFGA 2ZX2A 4ONUA 1JUIA 3IKWA 2P5BA 1H1MA 5FYCA 1Q43A 4Q2FA 2H6CA 1V6KA 1FV3A 1NZCA 1Q8PA 5FYZA 3VKLA 3W9AA 1ZBA2 3RNSA 5EXOA 3KS7A 1XE8A 3OEBA 4L99A 5FPZA 2Q8CA 2PN5A 5LY1A 2QTWB 5LBCA 2LRPA 3AB0A 4I30A 4XTMA 1OLRA 1XE7A 1XNBA 1RUD2 3ABZA 2VCCA 1G86A 1PK6C 3IAQA 3PHMA 2D3PA 4DY3A 1K12A 5DUVA 3M70A 1CJDA 5GZFA 1LODA 1ND2C 4NWWA 1UXXX 1MZFA 3HBZA 3UL2A 1RXFA 4DXZA 3U37A 4MGQA 4Q1PA 4XYXA 2WAAA 2WZR3 4ZXKA 3VUOA 1DBNA 2BU9A 2BUKA 1WKYA 1O4YA 1W6PA 2UY8A 1CAVB 1MS1A 5F2WA 3OGSA 1RUG1 4NPRA 5FZKA 1S2EA 2DTYA 2P1BA 1MS9A 2R16A 3ES1A 4P14A 2RM22 1GICA 3QH6A 3RG0A 5L73A 1W6OA 1YRZA 3N7LA 3W58A 2Z42A 2PMWB 3A0NA 3EB7A 1RITA 1MQTC 2BYVE 4XFFA 4M3CE 1FOD3 5CFCC 4KWUA 2Q1FA 2VZPA 5C3SA 3WNNA 4FFGA 4XMIA 3NNJA 1TNFA 5GM0A 4AHWA 3QLQA 3WP5A 4CUAA 4QM9A 1O91A 5I0UA 3RMXA 5KHIA 3N9LA 4DUXA 1QXPA 1W2UA 4KU7A 2Y6FA 3HIFA 1OXCA 4UFIA 2L9LA 3TB0A 4E4ZA 4FPKA 2Q1MA 4BWOA 1UOGA 4RR3A 2O1QA 1HB1A 3KVAA 3HT2A 3AP4A 4LMFA 1WMXA 1J58A 1YCIA 3FLTA 3BI3A 2EALA 1CZVA 4KH9A 2XVLA 1VAVA 1WBFA 4A7KA 1VBA3 3BVCA 3L9JT 1NG0A 4Y5Z0 5FP3A 3NW4A 2HBTA 2JEMA 3OPWA 4HPKA 1B35C 3IPVB 1QJY2 3KF5A 4QDQA 5A7WB 4RS5A 4COVA 1OFSA 1RUH1 2FCUA 2VNGA 4FXKB 5GJ6A 3MIGA 1QGLA 1ULPA 4LXLA 4ASKA 3WSOA 4NHXA 3J7MA 2ZTNA 4UW3A 4K40A 5FUNA 5SV5A 2FZ2A 2PAKA 5C3QA 3PUHA 1FI2A 3NAPC 1NE6A 5GZGA 2KM2A 3SC7X 3FLPA 3APBA 5IT6A 2R0FA 2ZGOA 1NXMA 4META 5FBJA 1Y3TA 3ST7A 4XJ8A 5D8AC 5F9TA 5LRSA 5I8SA 1ZREA 5GLVA 4DRRA 1O7FA 1OUSA 3BOWA 5EQUA 3WVJA 4IEPA 2NM1A 1JZ5A 3PLQA 4TTGA 4A6OA 5T3NA 1J1LA 2A5ZA 4Q4Y3 3N3HA 3FE5A 4MXVA 5ABJB 1V6MA 4YW4A 5BNOB 2C9AA 1VLNA 3ES4A 3M7AA 3MUZ1 1W9SA 4AGGA 4Z1VA 5A3LA 1Y7BA 1ZRFA 3H9AA 2WZR2 3OJBA 4CDQA 2ID4A 2VZSA 5LA1A 2EIGA 2C24A 2Z4FA 2WNVC 1UW8A 1W8NA 4LEJA 3CEWA
chains in the Genus database with same CATH topology
3ZYFA 4CPBA 4CP9A 4CPBD 1W8UA 1GWLA 1W8TA 1HN0A 1V0AA 2WYFA 5D21A 1WZXA 2JWPA 2O14A 4YW6A 1WMXA 3UT0A 2LROA 1GWMA 2VXJA 2LRPA 2KR2A 1OKOA 4LK7A 3ZYBA 4BQ4A 4LKEA 4LJHA 2Q1FA 3ZYHA 1L7LA 1W90A 4BQ2A 1OH3A 1W8WA 3ORJA 1WCUA 4LKDA 4BQ5A 1GWKA 1UOJA 4YWAA 4AL9A 4CP9B 4A6SA 3F95A 1W8ZA 2C24A 4BQ3A 4LKFA 4LK6A 2K46A 4YW7A 1W9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYF A;  4CPB A;  4CP9 A;  4CPB D;  1W8U A;  1GWL A;  1W8T A;  1HN0 A;  1V0A A;  2WYF A;  5D21 A;  1WZX A;  2JWP A;  2O14 A;  4YW6 A;  1WMX A;  3UT0 A;  2LRO A;  1GWM A;  2VXJ A;  2LRP A;  2KR2 A;  1OKO A;  4LK7 A;  3ZYB A;  4BQ4 A;  4LKE A;  4LJH A;  2Q1F A;  3ZYH A;  1L7L A;  1W90 A;  4BQ2 A;  1OH3 A;  1W8W A;  3ORJ A;  1WCU A;  4LKD A;  4BQ5 A;  1GWK A;  1UOJ A;  4YWA A;  4AL9 A;  4CP9 B;  4A6S A;  3F95 A;  1W8Z A;  2C24 A;  4BQ3 A;  4LKF A;  4LK6 A;  2K46 A;  4YW7 A;  1W9F A; 
#chains in the Genus database with same CATH topology
 3M3I A;  1D4M 1;  2DCY A;  1RC6 A;  2LS6 A;  3POE A;  1GWL A;  3IDB B;  1UY4 A;  4EN7 B;  1U0A A;  5DAX A;  2VOK A;  5F5C A;  5IVJ A;  1Q8V A;  3VB9 A;  3RWN A;  1V6N A;  2BNM A;  4RGA A;  1LOB A;  1FOD 2;  3T1M A;  4P9L A;  3GM8 A;  3RVH A;  2ADE A;  5K0U B;  4FOW A;  5SV8 A;  1W3V A;  3ENR A;  5JIA A;  3T0B A;  1IG0 A;  2TEP A;  2VZR A;  4BQX A;  4N43 A;  1D0G A;  2C26 A;  1WW6 A;  4AHZ A;  3U4X A;  3EBR A;  5DZF A;  5C4W C;  2FZ1 A;  2BNN A;  2ZS6 B;  1YFU A;  2OQ6 A;  1ZZ8 A;  1CIY A;  4YG0 A;  4E2G A;  4YRD A;  4AI8 A;  2ZEX A;  5D2A A;  5IW0 A;  2BBV A;  3KV9 A;  1W04 A;  4A42 A;  2XXZ A;  4S2H A;  3KMH A;  3RZH A;  3NV3 A;  4CVU A;  3H7Y A;  4WM7 C;  2CAU A;  4N90 A;  3JBG 1;  2X5I B;  4AI3 A;  1QDO A;  2W2I A;  5JSR A;  4XUP A;  2ENR A;  1VBA 2;  1SHW B;  1WLC A;  2AEN A;  1W90 A;  3J8F 1;  1NLS A;  3LFM A;  3FHA A;  3PU8 A;  4C1X A;  5BNN C;  5CIS A;  1JS9 A;  1UOB A;  3AP7 A;  3BOP A;  4P9I A;  2RS5 1;  3POF A;  5A6X A;  4FTB A;  5AVA A;  2ZX0 A;  2QQI A;  1WA4 A;  4KGG A;  4OMC A;  3KM5 A;  4GH4 B;  3ZDV A;  4CU9 A;  5C9A B;  1DGR A;  1CAW B;  4HAN A;  4C0B A;  4UXA A;  4J1W A;  1DGL A;  4J6G A;  3MF6 A;  1MS0 A;  2HWC 3;  3O5S A;  5GLZ A;  3TN9 1;  3C7G A;  1JH5 A;  5A1L A;  2WA4 A;  2VUC A;  4QX7 A;  2XKP A;  5IAT A;  2RV9 A;  2UYA A;  4RGK A;  2VZU A;  4XVH A;  2WN2 A;  1RUE 3;  4N9I A;  3RYR A;  1OKO A;  2ZGR A;  3AKT A;  3LPG A;  4TYS A;  5T54 A;  3SQO A;  4Q4Y 2;  5GAL A;  2XL7 A;  5FY4 A;  5FK7 A;  3OBR A;  5BPX A;  5FMD A;  5FY1 A;  4CEY B;  1PGS A;  4F8A A;  4XHB A;  4ZZ8 A;  4M00 A;  2R6Q A;  5DDJ 3;  2R07 1;  5EWS A;  4CDW A;  5EJZ B;  5CG8 A;  5AFE A;  4XOG A;  5BNP C;  1MVE A;  4PCR A;  4OHZ A;  1VBD 3;  3GJB A;  2XLA A;  5IHR A;  3ZKU A;  4ES9 A;  5FJH A;  5JR2 A;  3N9N A;  5FKB A;  5JZG A;  4AE2 A;  1APN A;  2CAV A;  2R7E B;  1VBE 3;  3NL1 A;  5H9R A;  5J1X A;  1DU3 D;  1TZO A;  1YQ6 A;  3BPZ A;  1N1T A;  5F39 A;  2Z2S B;  1UQX A;  3GBF A;  2OYZ A;  4AGV A;  5FOJ B;  4BK4 A;  1STM A;  2VG9 A;  5KXE A;  4BDV B;  1NCR B;  5A7S A;  1JUH A;  4MGK E;  4MGS A;  1O8P A;  1C5I A;  4QDR A;  3J7N A;  4K6B A;  3K4A A;  2GZW A;  1ZZ9 A;  4AQS A;  4IET A;  4YM1 A;  5JMC A;  2DVF A;  3I3Q A;  4LKD A;  3PU3 A;  4UBH A;  4XJA A;  4Q4V 3;  1W6P B;  2XL9 A;  1ZBA 1;  4BM8 A;  1S0I A;  5L9R A;  1OHF A;  4H2A A;  3W20 A;  4JQT A;  4XFA A;  4PBO A;  4KL1 A;  1RUD 1;  4Y1X A;  3A7Q A;  3ZYF A;  3B93 A;  4I09 A;  1ASJ 3;  1DLC A;  1PGL 1;  1W6O B;  2BJS A;  2XUM A;  1IPK A;  2JKX A;  2ZGM A;  4IND A;  4YSF A;  4IL7 A;  1C8M 3;  4MUV A;  5CIR A;  4Z8B A;  1XNA A;  5EJ1 B;  3TEZ A;  1CVN A;  1QKQ A;  1S0J A;  1K5M A;  4QWN A;  4YPJ A;  4C0H A;  4KMQ A;  1B09 A;  2VMG A;  4CDU C;  3ZYH A;  1OFN A;  2DU1 A;  2P17 A;  3G7D A;  1KJL A;  3CIH A;  4LE4 A;  4XF4 A;  5FZL A;  1PHM A;  2V5D A;  4RQP A;  3LEI A;  3UGF A;  1QQP 3;  2PQQ A;  3FHQ A;  1NE4 A;  1NQJ A;  2XJP A;  4AVB A;  1U5Z A;  3S5A A;  1DZT A;  2F4P A;  2PEL A;  3NO8 A;  5G05 L;  4PF1 A;  3HOB A;  4WVZ A;  2Q8D A;  4BHP A;  2ZGK A;  3Q8F A;  4CXY A;  3QBQ A;  1W9F A;  2ES3 A;  2HWC 2;  3HAG A;  5T52 A;  5FIX A;  3O1M A;  3VBF B;  5FJK A;  2K9Z A;  1XSR A;  4FOV A;  4NIA A;  1LNS A;  3WDX A;  1PVC 3;  3NRU A;  4GD4 A;  2VMH A;  4K1Y A;  1RUE 2;  3P5B A;  1JYV A;  1TEI A;  5F7U A;  3CMG A;  4HPK B;  3THD A;  4QX0 A;  1WCQ A;  4RS5 B;  5D1I A;  1QOO A;  4E2S A;  2WBK A;  1V70 A;  1DP0 A;  4BQW A;  1OQ1 A;  5DDJ 2;  3D8C A;  4K1Z A;  3VLB B;  4XDO A;  3KV5 A;  2FBE A;  4GWI A;  4CU8 A;  3LIH A;  3R0R A;  1VMH A;  1VBD 2;  3SEP A;  2ZGL A;  1OBN A;  4UI9 L;  5EYX A;  1O8S A;  1XNC A;  3AZV A;  5I0R A;  1VAK A;  1VRH 3;  2XG3 A;  3LAG A;  2E6V A;  3KT1 A;  1H2M A;  4FPE A;  4YVW C;  3WXP A;  4DUW A;  1M4W A;  4JRL A;  4HN0 A;  1N1Y A;  2D6N A;  4QU1 A;  1VBE 2;  4L9B A;  3THC A;  4COY A;  4EN0 A;  4DO0 A;  1PM4 A;  2B8M A;  3DF0 A;  1GYK A;  4QKN A;  1QEX A;  1XQN A;  2EIC A;  2BBA A;  1SEF A;  1DQ5 A;  4QX8 A;  1YQC A;  1UCX A;  3M2M A;  1G9F A;  4CCL A;  3WD5 A;  3V0A A;  1MS5 A;  1FMD 3;  4QHB A;  2I2S A;  4HVQ A;  2D5H A;  4V2V A;  2JEC A;  4AEJ A;  1OMI A;  1PGW 2;  3OYW A;  2WDB A;  4Q4V 2;  4XUN A;  2QNK A;  4M4R A;  3IB3 A;  4QPW A;  3RZG A;  5EZW A;  4FOY A;  3O14 A;  5F1R A;  4CRQ A;  3ZSL A;  2DBI A;  1GP4 A;  4MO3 M;  3WG3 A;  1CR7 A;  1ASJ 2;  3UK9 A;  2ZGS A;  1BJQ A;  5F37 A;  2J1T A;  3H42 B;  1HJF A;  4QB1 A;  4CDX B;  1C8M 2;  1YQ8 A;  1F4A A;  2OT7 A;  1AYM 2;  1GR3 A;  2JDN A;  1NA1 A;  3N9Q A;  4HFS A;  4XCB A;  2XQR A;  1JZ4 A;  1BEV 1;  1FNZ A;  1CAU A;  4MHU A;  4YFW A;  3WNM A;  1AJK A;  4CZS A;  1OT5 A;  4C90 A;  2WZR 1;  3GBG A;  2UY9 A;  3MIB A;  4RSU A;  2X53 S;  3MIC A;  4M0N A;  4D7S A;  1L7Q A;  5GZD A;  2YGM A;  4GJZ A;  1J84 A;  4PT6 A;  1GLH A;  1H2N A;  1F31 A;  1V9U 3;  2WS9 3;  2Y26 A;  1QQP 2;  3KVB A;  3VN4 A;  4FFF A;  4F3J A;  3O1U A;  1W8H A;  2P37 A;  5CEH A;  3H0O A;  1PIV 3;  1ZX5 A;  2RS3 3;  3HQU A;  4AAP A;  1AXY A;  4LKF A;  5EHD A;  5FWE A;  3I97 A;  4NAM A;  1FOD 1;  1GZW A;  2CNA A;  4AVC A;  4AED C;  1HQN A;  3BIE A;  4I3P A;  2P3Y A;  5FP9 A;  2Y6K A;  1RHI 3;  2OS2 A;  4R9A A;  1PVC 2;  4YVS A;  4XE9 A;  2E7A A;  3E5Q A;  1CAX B;  3SIS A;  1NQD A;  5LBF A;  3AM2 A;  1WLD A;  1Y9Q A;  3ZKY A;  3OGV A;  1XB9 A;  2OW4 A;  5GZC A;  3WV6 A;  1X50 A;  3ZMO A;  5LZ6 A;  2NP0 A;  4Y24 A;  4AFC A;  5FZ8 A;  3AP5 A;  1H0B A;  2YU2 A;  4HON A;  4ZS3 A;  5AC9 3;  4LOT A;  3GJA A;  3RSJ A;  1VAL A;  5JOX A;  1VR3 A;  2NMN A;  4PHZ A;  3ZXE A;  4NID A;  1VRH 2;  2DUP A;  1RJ7 A;  1W06 A;  4XCA A;  4UFM A;  5H9P A;  3RZM A;  1BMV 1;  1IG3 A;  2IVI B;  5FZE A;  3AKP A;  1VBA 1;  1HX6 A;  2DCT A;  2YPJ A;  4YGD A;  1LKN A;  3PUI A;  1US2 A;  4LTA A;  4LO7 A;  1NCQ A;  2WFF 3;  4R52 A;  4N8M A;  2VH9 A;  1C4R A;  4GJY A;  1E5R A;  5G04 L;  1O3R A;  3NMB A;  1F8V A;  1AR6 3;  1ZA4 A;  1M06 G;  1W6N B;  3MIF A;  3ACG A;  1FMD 2;  5EFU A;  3BU7 A;  3N4M A;  3EHK A;  4H14 A;  1H8T C;  2VMI A;  4JGZ B;  5DG2 A;  4CP1 A;  1ZM1 A;  3DGT A;  3POW A;  4LLF A;  3CF6 E;  1K42 A;  4OHW A;  3ZYI B;  3VD5 A;  5E16 A;  3BPS A;  3JZV A;  2JKB A;  2RDQ A;  4HSL A;  4BLI A;  3SH4 A;  1RMU 3;  5FTT C;  3INA A;  5FZG A;  3UV9 A;  3VBS B;  1YO8 A;  3ZDS A;  4WZF A;  4QB6 A;  2IZW A;  4QGL A;  4FPL A;  4Q4Y 1;  2VNO A;  3OTF A;  4CUB A;  2XB6 C;  1BQP A;  4EV0 A;  1LRH A;  1I9R A;  5E1R A;  1O4T A;  2A73 B;  1H6Y A;  5F2S A;  4Y33 A;  2FD8 A;  3MID A;  1XU1 A;  1CZS A;  1RGS A;  2B7Y A;  2W08 A;  2XLF A;  3VDA A;  3S7E A;  2RJK A;  4QHZ A;  3DEC A;  4O61 A;  5JI7 A;  5FZ4 A;  1S55 A;  4NPL A;  4IE5 A;  2ARA A;  3S5Q A;  1KD7 A;  3UGG A;  1UWW A;  4D69 A;  4ASL A;  1REF A;  1V9U 2;  2WS9 2;  2GMP A;  4XBN A;  2WIN B;  1R09 3;  2YDE A;  4LO6 B;  1JMU B;  1UKR A;  3AYE A;  1PIV 2;  2RS3 2;  3H1W A;  3IN9 A;  3ME2 A;  2G1M A;  2VVF A;  1PZ8 A;  2D6K A;  4QX5 A;  2P34 A;  4IE0 A;  1JZ8 A;  5FXV A;  5L9B A;  2Y33 A;  4YZ1 A;  2HYX A;  3WDU A;  1K5M B;  1RHI 2;  2JWP A;  3CHX A;  2GC3 A;  1CAV A;  3USS A;  3A23 A;  2RR1 3;  1DQ2 A;  1HRV 3;  5ACA 3;  4OUE A;  3EJK A;  2AEY A;  4NHL A;  4RN5 A;  2A75 A;  5CFD C;  3ZFE B;  3NJV A;  4IGO A;  4HKL A;  2J22 A;  3BTA A;  5JPN B;  3MHZ A;  1SMV A;  2VJX A;  2PHT A;  4KQ7 A;  4XF3 A;  5AC9 2;  2PA7 A;  4BE3 A;  2PQS A;  3OY8 B;  2QQL A;  1GV9 A;  1HB3 A;  2ZGQ A;  3KZ4 C;  2Q5T A;  1JTZ X;  1BCX A;  3S57 A;  3NKG A;  4IER A;  1DZR A;  4P00 B;  5IVV A;  1OOP A;  1OPO A;  3DV8 A;  1WCS A;  2AR6 A;  2XPJ A;  4CPB D;  1NYW A;  1XNT A;  2JE9 A;  5JWP A;  2Y0I A;  5CG9 A;  1ZBE 3;  1OF3 A;  3LGR A;  5IFP A;  4ISR A;  1GWM A;  2WNU A;  3JU9 A;  2VUJ A;  2WFF 2;  5DUX A;  1IKQ A;  2W95 A;  2XHK A;  2ZAA A;  5A6Y A;  5J37 A;  1UU6 A;  3VBR A;  3NNG A;  2BFU S;  3ZYR A;  1AR6 2;  1UMH A;  3C2U A;  1JI6 A;  4H3W A;  5ISL A;  3T2T A;  2VBP A;  4DXT A;  2AEZ A;  2HWC 1;  3OEA A;  4NVP A;  2VME A;  2QDR A;  3D3A A;  2XVK A;  2FMD A;  1UY1 A;  1W03 A;  1JYW A;  3P3N A;  3POY A;  4OZX A;  2ZHL A;  1RUE 1;  3IPV A;  1HLC A;  3POG A;  2GNM A;  5ANN A;  5FPV A;  5A7W A;  1SDD B;  5T55 A;  4AQT A;  1RMU 2;  4DIQ A;  1JW6 A;  4RGG A;  1QDC A;  3THT A;  4QPI A;  4AVV A;  1BXH A;  1PMH X;  2MHF A;  4MGI E;  3ZR6 A;  5A6Z A;  3B00 A;  5IVY A;  2JDM A;  5DDJ 1;  1Q5O A;  4XQD A;  5FYS A;  3WUD A;  3CU7 A;  4E27 A;  1X8E A;  1GKB A;  5CAD A;  3V0A B;  1VBD 1;  2JDA A;  1G9B A;  5A32 B;  4XEZ A;  1IPS A;  4ORF A;  4QX2 A;  5BXX A;  4BH9 A;  2ZJC A;  4AK3 A;  4KBZ A;  4BOW A;  1WBL A;  2WAB A;  5LK5 A;  3U11 A;  2VR4 A;  3KGZ A;  4LBN A;  4OCT A;  1VBE 1;  2XML A;  3WHU A;  2BVB A;  3BCW A;  4QPG A;  5F3I A;  2XJV A;  1R09 2;  3R4U A;  3O1V A;  2CYF A;  5JCT A;  4AFB A;  3UJQ A;  2Q1Z B;  1H30 A;  1QF3 A;  4WBB A;  5L7O C;  4IEY A;  3I2I A;  5JUV A;  3VBH C;  1PNF A;  4S2F A;  1ND3 A;  1ULG A;  2EAK A;  3I59 A;  1ENQ A;  3JUU A;  4AFD A;  4Y20 A;  4JGY B;  1J3Q A;  4N53 C;  5FY8 A;  1VJ2 A;  3AL5 A;  1PGW 1;  5FXW A;  4HN1 A;  4CTE A;  4IV3 C;  2RR1 2;  1HRV 2;  5ACA 2;  4ATF A;  5I0T A;  2W91 A;  2VUD A;  4Y5S A;  4L8Q A;  1QNY A;  3U1X A;  2X29 A;  5A70 A;  5JLV A;  1AR9 1;  4QXC A;  1TNR A;  4M3C B;  5FBZ A;  2VZ1 A;  3PVB B;  1VMF A;  4B1M A;  2QZ2 A;  2VMD A;  5H9Q A;  4JHT A;  2IXK A;  2EA7 A;  4Q0S A;  5B4X A;  2DV9 A;  1QHD A;  4IE7 A;  1CN1 A;  4QB2 A;  5JOZ A;  3WQ1 A;  3WF3 A;  3FZ3 A;  1AR8 1;  3QOP A;  2E32 A;  3FL7 A;  4LBK A;  4UW6 A;  3WW2 A;  5FZ0 A;  3WW3 A;  1WZX A;  2DU0 A;  1ZBE 2;  3VKF C;  3V56 A;  2D97 A;  5TSW A;  2VCA A;  2R06 3;  2RVA A;  3DKQ A;  3NNL A;  4FVV A;  3VKO A;  1X9P A;  2K0G A;  1GNY A;  3ZFG C;  5H9S A;  2VTX J;  1REE A;  3I7D A;  2VD7 A;  1GZC A;  4IGP A;  1T6G C;  3RPQ A;  4DEQ A;  4DUV A;  2X5I A;  2QCS B;  3B69 A;  5DG1 A;  1IPJ A;  2J1A A;  1PVC 1;  1YC6 1;  4SLI A;  3MEP A;  1OQD A;  1BVP 1;  2WZE A;  2XJS A;  2JDZ A;  3WNK A;  3F95 A;  2DDU A;  2DVA A;  3ZX7 A;  2D44 A;  3AKR A;  4CEW C;  2B5H A;  4XF9 A;  1XYN A;  1J59 A;  4GH4 A;  5C9A A;  1VBC 3;  1UPI A;  1CAW A;  5IK8 A;  5FYM A;  4MXW A;  3O1S A;  5JR7 B;  3SH5 A;  1H2L A;  4U2A A;  1JHN A;  5A1F A;  3I54 A;  4AOC A;  2D3S A;  1AL2 3;  3GZE A;  1XE0 A;  5BUV A;  5C70 A;  2BQP A;  5E88 A;  3VKN A;  5HBA A;  2VW1 A;  2XBO 1;  1VRH 1;  3CKH A;  1JOB A;  4L0P A;  1RUO A;  1CON A;  1UZV A;  1IOA A;  3MIH A;  2W52 A;  4HK8 A;  2AC1 A;  3USU B;  3SCG A;  2OQ7 A;  4HZF A;  1QJY 3;  1YXW A;  3E1F 1;  4YWA A;  4AL9 A;  3VGI A;  2WQZ C;  4FQZ A;  1OUX A;  2J42 A;  4GUL A;  4NIG A;  2IVJ A;  1W0P A;  2BGP A;  3H7J A;  3KLS A;  1XNK A;  4UOJ A;  3WNL A;  3NJZ A;  1UYZ A;  2ADD A;  4LUM A;  1FMD 1;  1JXN A;  5T5O A;  3BTY A;  1H1A A;  1VBB 3;  4FPH A;  3Q9O A;  1PK6 A;  2WSV A;  5FKC A;  4GAZ A;  3TBD A;  4B7K A;  2YXS A;  4W6W A;  4W8J A;  1AUY A;  4MOA A;  5F3G A;  5CKQ A;  4BQY A;  1ND2 A;  2JJ6 A;  3N9O A;  1W6M B;  3RGB A;  2IXC A;  4GZ9 A;  5CU1 A;  1NCR A;  2NQY A;  3B01 A;  3OGJ A;  4LBO A;  2Q4S A;  2VXR A;  2ZPX A;  3AMM A;  3CJI B;  4QU2 A;  4CA9 A;  4HT1 T;  5CAZ A;  4NRM A;  1WD3 A;  1X36 A;  2JEN A;  1WCD J;  4MLO A;  3GHM A;  4QQO A;  4PQQ A;  5IVC A;  4IDZ A;  2JG9 C;  4CEY C;  3KV4 A;  5KWR A;  5IVE A;  2QJV A;  3MZH A;  3E6C C;  1MQT A;  4ZHN A;  3PDQ A;  4RFT 0;  4FOQ A;  2ZZJ A;  3AXD A;  3RJ2 X;  1V9U 1;  2WS9 1;  5K9Y A;  4IXL A;  4C91 A;  4YG3 A;  2R06 2;  3V64 A;  5FY9 A;  5C3P A;  2KA3 A;  3RI9 A;  3J26 N;  2RS3 1;  2A6V A;  1EUU A;  2CL2 A;  3M4F A;  4UWD A;  5E6H A;  5JOY A;  2WT2 A;  3CLP A;  2A6W A;  1DIW A;  3HJR A;  3LDK A;  4OFG A;  2WSU A;  5EP9 A;  4OYU A;  3WDV A;  5FZ3 A;  1RHI 1;  2EF6 A;  4EZH A;  3IDC B;  3SCH A;  1OOP B;  3FWE A;  4GWM A;  1W8Z A;  1ALY A;  2GAU A;  1ZZ6 A;  3MV1 1;  4COW A;  3U07 A;  2ZKL A;  5CKN A;  4QHO A;  3VZN A;  4ZU5 A;  3ZXA C;  1VBC 2;  2BDR A;  3WDW A;  5C8C C;  1SZB A;  4LBM A;  2WNU B;  5J96 B;  5I8T A;  1V0A A;  4MGY E;  5C7G A;  3HEI A;  1AF9 A;  3QH7 A;  5AC9 1;  3VBR B;  2MEV 3;  5FDB A;  3PIG A;  1AL2 2;  3VBF A;  3TYJ A;  1B35 A;  3PIJ A;  3T0D A;  3SHR A;  5A33 A;  2ZX4 A;  4UF0 B;  4AW7 A;  4E8D A;  4JV4 A;  3BGA A;  3ZVX A;  4OI0 A;  3VD4 A;  1FAT A;  1ST8 A;  1AYN 3;  4FP3 A;  4NRO A;  1MS3 A;  2DYC A;  1RVF 3;  5FY5 A;  1QXR A;  2X8K A;  5LCW L;  1W2O A;  4UW4 A;  2CSG A;  3CNA A;  1TME 1;  4HLT A;  4QPI B;  1AR7 1;  4K20 A;  5C71 A;  4Q0U A;  2W1Q A;  1O5L A;  3OD4 A;  4P5Y A;  5IJR A;  3P3P A;  2XJR A;  2VAU A;  5FO8 B;  2CTV A;  5T50 A;  2JIJ A;  2ZKN A;  3N35 A;  3MI8 A;  5KHJ A;  2ZML A;  1VBB 2;  4QGN A;  4RR3 C;  1KGY A;  3K75 B;  4I01 A;  2AH2 A;  4AFM A;  4J25 A;  1U5Y A;  1WMF A;  2JG8 B;  1GU3 A;  3ZR5 A;  2EXJ A;  1LHO A;  2HYK A;  2D5F A;  4AR2 A;  3JB8 A;  3GXU A;  4I3G A;  1RMU 1;  3I3E A;  4QPG B;  1UL9 A;  5DAQ A;  4Q27 A;  4KU8 A;  4EWE A;  3MLJ A;  1CJP A;  1DGW X;  2J1E A;  2EID A;  1NY7 2;  4DQA A;  2QQW A;  3PTY A;  3SXW A;  3TOJ A;  1VB2 A;  4MG2 A;  1ND3 B;  2PHR A;  5A6Q A;  1PZ9 A;  2DCJ A;  3I59 B;  4HSJ A;  4YLZ A;  1XND A;  4Q4X 3;  4Y20 B;  3VDD B;  3HNB M;  3UET A;  2A6X A;  1QXJ A;  3UYJ A;  2BWA A;  4Y4R A;  4ZZ5 A;  1C28 A;  1OKQ A;  4UFH A;  4U36 A;  1LU1 A;  1BK0 A;  2TUN A;  3PUS A;  3WDY A;  3WW4 A;  1MVQ A;  1R09 1;  2A3Y A;  3K48 A;  5T5L A;  4QDS A;  5CZK A;  4CDX A;  4CUC A;  4PIY A;  4HKW A;  2C1F A;  3LOB A;  4WM8 A;  2NMO A;  2JB8 A;  1TQ5 A;  5C4W A;  3ZLI A;  4SBV A;  2XJU A;  1S0E A;  2HKX A;  1D4V B;  1V6J A;  1UOJ A;  1WMD A;  1KFX L;  1ZZB A;  1O5U A;  3DEM A;  4YNI A;  4CE8 A;  5FQ0 B;  2A1X A;  3RRD A;  1FYU A;  2RR1 1;  1HRV 1;  1XPW A;  2QBX A;  2YBK A;  4YGC A;  5A3P A;  2QQN A;  3RFR A;  2LW8 A;  4L92 A;  4CDQ C;  1I5Z A;  1IQA A;  2JDP A;  5JOW A;  4MX3 A;  4X8N A;  3LPF A;  3H3U A;  3ZFF B;  1LOE A;  5CA6 A;  3ZSK A;  1WLT A;  5FPX A;  2MEV 2;  3MFC A;  5DQ0 A;  3HVD A;  5DUU A;  1C8N A;  2ZEZ A;  5FAX A;  4EE2 A;  5BNN A;  5I91 A;  2JIG A;  2JDK A;  1KDK A;  1CAX A;  4LLO A;  1WUV A;  3BU0 A;  2CU5 A;  1AYN 2;  3HT1 A;  4LA2 A;  1RVF 2;  4CUG A;  1EP0 A;  1O59 A;  1ULC A;  4Y26 A;  2VBB A;  3LA3 A;  4KWL A;  5FYY A;  1NXD 1;  1HRI 3;  3NJX A;  4HVR A;  4FPY A;  4N43 C;  1V6I A;  3SKJ E;  2HWB 3;  1MEC 3;  5A7Q A;  5IK5 A;  1F5J A;  1A3K A;  4MXW B;  5C3O A;  1NZI A;  3E5U A;  3NQH A;  1LCL A;  4YYO A;  1IZ3 A;  3SIT A;  4XDQ A;  1CPM A;  3SH3 A;  3ETP A;  3NKT A;  2RDR A;  1SLA A;  1RIN A;  2IXL A;  4EN8 B;  2IC1 A;  4FPG A;  5FUI A;  3ZYB A;  2RG4 A;  2QVS B;  4BXF A;  4TWT A;  5BNP A;  4M4P A;  4Q8K A;  1IHM A;  1QNW A;  1S4C A;  1KEX A;  5GLW A;  3HWJ A;  4Y1Z A;  3K3O A;  1R1A 3;  4KWJ A;  1NOV A;  2AYH A;  1Y9M A;  1X33 A;  2KD7 A;  2HH9 A;  2G9Z A;  3AC0 A;  2FHR A;  1W6N A;  4R8H A;  3UJO A;  1D7P M;  5FWJ A;  2F17 A;  1ENS A;  1SLB A;  1SLI A;  1TG7 A;  4JGZ A;  1KS4 A;  4Q4X 2;  3WHT A;  1LOA A;  4C8D A;  5A3M A;  3I2K A;  3B9I A;  4QPY A;  1PK6 B;  4P08 A;  4XAC A;  2RS1 3;  2SBA A;  2GND A;  1H8V A;  3AJZ A;  1CPN A;  4YGE A;  3ZIX A;  3OBT A;  1ND2 B;  4S2G A;  4XBL A;  3VBS A;  3AMH A;  4QT6 A;  1LES A;  4Z92 B;  4ZU7 A;  2ZX1 A;  2G19 A;  5LY2 A;  1SFY A;  1QJF A;  4XMA A;  1PO1 1;  5T5P A;  1BVV A;  5FOB B;  5JXH A;  5K8S A;  3DPR A;  4XIO A;  2F6B A;  4BQ2 A;  4P9W A;  3K4D A;  3KHB A;  5FZC A;  4R4X A;  4XUO A;  3R05 A;  4EJR A;  3FUQ A;  4CDW C;  2R1B A;  4KBB A;  2RE9 A;  4TZD A;  3FFZ A;  3EYP A;  4MYE A;  4A7Y A;  1MQT B;  3O1T A;  4LO8 A;  1LHN A;  5CFC B;  4GA9 A;  4FXG B;  1S2K A;  2Y0O A;  1SG3 A;  1IS5 A;  4CDU A;  5JZG C;  5JI9 A;  2A6Z A;  1T6B X;  1AYM 3;  1R64 A;  1UXZ A;  2XOM A;  2QFE A;  4AXO A;  2KXL A;  4BQ4 A;  3AKS A;  3FC0 A;  3VL8 A;  4IEX A;  4LPL A;  5E89 A;  5A80 A;  4CP0 A;  4AHY A;  3ZFE A;  5LW9 A;  2WAO A;  4UYB A;  3OF1 A;  2P4E A;  1HRI 2;  2RM2 1;  2Y8K A;  2R06 1;  3OY8 A;  2FDJ A;  3N7K A;  4NHK A;  2HWB 2;  1MEC 2;  2FDG A;  2DVG A;  4V1P A;  2WR9 A;  2Y6L A;  1ZYB A;  3I2F A;  1L3J A;  3WG4 A;  5BV6 A;  1B35 B;  4XAB A;  5A33 B;  4NMI A;  5C6C A;  1VP6 A;  2D43 A;  3E6B A;  2D6P A;  5DZE A;  4COZ A;  3ZM8 A;  2P6H A;  4D7Y A;  5CBL A;  2RJL A;  5J09 A;  3BB6 A;  2YBS A;  3A0K A;  1GP5 A;  2XDV A;  3NAP B;  3LKJ A;  4GKX A;  4XDP A;  4Y3O A;  1GQP A;  4LBQ D;  3OBA A;  3B7M A;  4Q0V A;  1VBC 1;  2B46 X;  1R1A 2;  3ZPO A;  1IKP A;  1OSG A;  2LM3 A;  4CYD A;  4CCE A;  3OPZ A;  2R1D A;  5D8A B;  4KNC A;  1OLM A;  2Z5W A;  2WO1 A;  2XGX A;  4PQ9 A;  4XHX A;  4D6S A;  4RQP C;  4AVA A;  5KXD A;  3K4Z A;  5JMO A;  1AL2 1;  5FMC A;  5E8A A;  2BNO A;  5JXG A;  2RS1 2;  1UO9 A;  4IV1 C;  3GAL A;  2HWF 3;  5L36 A;  3JCI A;  4WVW A;  3D0S A;  4XJZ A;  1QJY 1;  1U5X A;  1CQ9 A;  5EJ3 A;  5A3U A;  2YG0 A;  1EPZ A;  1E5H A;  4H55 A;  4MH0 E;  3OUH A;  5CNA A;  1COV 3;  2WNV B;  2A3X A;  2C5D A;  2ORX A;  2V4V A;  2WUH A;  2Y34 A;  3NJY A;  4FTE A;  3DXT A;  1G8W A;  3DYO A;  3M3O A;  3SCF A;  5A32 A;  1MZ5 A;  2RDS A;  2HEW F;  2P3I A;  3IMN A;  1ZRD A;  4A7Z A;  3S30 A;  5JVV A;  2UWC A;  4XQ4 A;  4HOO A;  5BNQ A;  4DXR A;  4P02 B;  2J7M A;  1HN0 A;  1UAI A;  3DYM A;  3KV6 A;  4RA0 A;  3OUI A;  1MZE A;  1NY7 1;  3N7M A;  4WM8 B;  2H6B A;  2HEY F;  2O0O A;  4XJU A;  1OC1 A;  3HMY A;  2N7G A;  4Z07 A;  4JGY A;  3WDT A;  4BPZ A;  3VV1 A;  5C4W B;  3W5M A;  1UX7 A;  3C7F A;  4LBJ A;  2A7A A;  2VUL A;  4QGM A;  1S0F A;  3BAL A;  2GH2 A;  3FUO A;  5CYY A;  2VOT A;  3BN6 A;  3GDB A;  5KXB A;  2DWR A;  1YFX A;  3S0M A;  3ZSJ A;  1AX0 A;  2VW2 A;  3S7I A;  2Z79 A;  5LBB A;  1F35 A;  3T2O A;  4XC9 A;  3AP9 A;  4FTS A;  1HQW A;  2F4L A;  5FRA A;  4M3C A;  4AED A;  4FFI A;  1UU5 A;  2WJS A;  2BER A;  2YPD A;  4WM7 B;  5IFT A;  2PTM A;  4GWJ A;  3T4H B;  3TEX A;  3KHC A;  4Q0P A;  4QD2 A;  4B29 A;  4BZ4 A;  1WME A;  4TSV A;  5BNN B;  1RJ8 A;  3LF7 A;  1YFY A;  3TEW A;  2ZMN A;  3UT0 A;  2VTX A;  1E57 A;  4NHM A;  4JQR A;  1I6X A;  4BA6 A;  1J1T A;  1NA1 C;  4AGR A;  5LEK A;  2OA2 A;  5FLH A;  2WKK A;  4ZY9 A;  3P1I A;  1A8D A;  2DVD A;  1LOC A;  2ETE A;  2XQX A;  4JX0 A;  1I3H A;  4H7M A;  4R9B A;  4PDW C;  3CJX A;  2GN3 A;  4MHR A;  4ASM B;  1N1S A;  4QXK A;  3H50 A;  2VOX A;  2A71 A;  2ZCW A;  2P3J A;  2MEV 1;  3EQE A;  5FPA A;  1DHK B;  2FCT A;  2PHF A;  5LWB A;  1EYB A;  1YWK A;  3WR0 A;  2VPV A;  1LGC A;  5KXC A;  4LOR A;  1G6N A;  3RZK A;  3AFG A;  2HWF 2;  1AYN 1;  2QQO A;  2EXH A;  5LK7 B;  5BNP B;  4MZU A;  2LRO A;  1BBT 3;  3PL0 A;  4JAA A;  4YVS C;  2R49 A;  3MYX A;  4XBQ A;  4KG8 A;  2FDI A;  1COV 2;  2YFU A;  1Y43 B;  2ZGU A;  5FP4 A;  3O1O A;  4I02 A;  2X09 A;  4GMP 0;  3TNP B;  3MPB A;  2MPF A;  2OUH A;  5FZI A;  3ZYG A;  5HCB A;  2ZAB A;  4Q29 A;  3USU A;  1JYC A;  4YW5 A;  1GNH A;  1RXG A;  1YFW A;  3O7O A;  3DCQ A;  2ET7 A;  3T08 A;  2A3W A;  3WZ1 A;  4YZ5 A;  1RUH 3;  2ZGT A;  4OVE A;  4DEV A;  1JBC A;  4OI2 A;  5HCA A;  3WW1 A;  2JD4 A;  3WP4 A;  4O9E A;  4B4R A;  2DUQ A;  2W9X A;  5FZ1 A;  3ZXJ A;  4FFH A;  4WVM B;  2EAA A;  3N9M A;  1FX5 A;  1HJG A;  1W05 A;  3DPR B;  3WF0 A;  1OA4 A;  4PF5 A;  5FZ9 A;  2GC1 A;  3U78 A;  2RHP A;  1HDK A;  3FLR A;  4IEV A;  4Q4X 1;  1NCQ C;  4MGT A;  3LIG A;  4Y1Y A;  1SCS A;  1VB4 A;  3VKM A;  1GOG A;  1OH3 A;  2ILM A;  2VNV A;  3AVS A;  4FCA A;  4FT8 A;  3OGG A;  1F2N A;  1N47 A;  1PMJ X;  5FZ6 A;  1W6M A;  5FZD A;  5LB6 A;  3VBO C;  1BZW A;  4AQ2 A;  4BIF A;  3I2J A;  3GNE A;  2BGC A;  1CX1 A;  3LD8 A;  3FN9 A;  4BIO A;  3I3M A;  3PMS A;  3CJI A;  4YW7 A;  3R4D B;  3AFK A;  4YZ4 A;  4CDU B;  3D4K A;  5L19 A;  4ISQ A;  3ZXF A;  1MR5 A;  4K9S A;  3B9C A;  1H9W A;  1SPP A;  1IS6 A;  5FPL A;  2FCV A;  2ATF A;  3WOG A;  1ULF A;  1RUN A;  1CWP A;  3CDZ B;  4JKL A;  1SDW A;  1PMI A;  4AI9 A;  4CCM A;  1D4M 3;  2B39 A;  1KDM A;  4ZXE A;  5IVF A;  2YZ4 A;  1UMI A;  2VCM A;  2QZ3 A;  2W68 A;  4CCC A;  3VD3 A;  3NV2 A;  5M0T A;  1UX6 A;  4NPM A;  5DAB A;  4FPJ A;  5F3C A;  3WIN E;  1C57 A;  2YHJ A;  1IGO A;  5I8Y A;  2P2K A;  2Y6G A;  3VD9 A;  3MW3 A;  3M3C A;  1W9W A;  2W1W A;  1GSL A;  4YW1 A;  3VDC A;  2W5F A;  2CGN A;  4I2O A;  3LSD A;  4R4Z A;  2HEV F;  2VOW A;  1I1E A;  4JTN A;  2I45 A;  4D8M A;  1YQ2 A;  1JZ3 A;  4HXC A;  3BKZ A;  4CXX A;  2MNG A;  1QWR A;  3IAP A;  1BBT 2;  5DAW A;  1VE0 A;  2QQV A;  1HRI 1;  4O65 A;  1YEW A;  4IEW A;  2W39 A;  1YUD A;  5DMY A;  5I93 A;  4YVW B;  3UNP A;  1Q8O A;  2EIB A;  2I74 A;  4NAO A;  1MEC 1;  5JDB A;  4QXH A;  1CES A;  2XJQ A;  3AX4 A;  4AVS A;  5FYH A;  3TRS B;  1BLZ A;  1HN1 A;  1RUC 3;  1SQ4 A;  4UF0 A;  5EV7 A;  3JBG 3;  2D98 A;  3P6B A;  4O7X A;  2JXA A;  2E7Q A;  3LEG A;  5FZH A;  1RUI 3;  3KCY A;  4EQV A;  3LFI A;  1LHW A;  5JXI A;  2UYB A;  2WWJ A;  2XH6 A;  3RWK X;  2WLQ A;  3E97 A;  2E33 A;  1RUH 2;  4CU6 A;  5LAT A;  4DOU A;  1MZ6 A;  1OOP C;  5I0S A;  2JB4 A;  1R1A 1;  3HNM A;  2PHU A;  3J7H A;  4I0B A;  1ODN A;  3KGL A;  3S6P A;  3SEE A;  3HBK A;  4E9K A;  2Q0A A;  3M8L A;  4IEZ A;  2V4A A;  2Q30 A;  3POI A;  1X9T A;  1DYO A;  3OGR A;  4P9G A;  2NPI A;  5L7O A;  1CZT A;  2JG8 A;  2ZHK A;  1IS4 A;  2CWS A;  2RS1 1;  4N9H A;  2DFB A;  3IDA A;  2BRT A;  4K21 A;  3RZJ A;  4XAA A;  4YZ3 A;  3LSE A;  5DAV A;  5F6K A;  2JDY A;  4GMP 3;  2O8Q A;  1TMF 3;  2E9Q A;  2GMM A;  2TBV A;  4QKB A;  4N53 A;  5LA2 A;  4BQ3 A;  3A21 A;  2R07 3;  5KHG A;  4D6R A;  3HQX A;  2DTW A;  1ZRR A;  3HD8 B;  4HKO A;  1LEM A;  3WX5 A;  1ZA7 A;  1P8J A;  2CDO A;  1JZ2 A;  1OF4 A;  1QJZ A;  3WF2 A;  3VDD A;  3WNP A;  4DPN A;  4G4F A;  4FPC A;  1OA2 A;  4XJW A;  2ARC A;  2VUA A;  4IEU A;  1R08 3;  3C7E A;  3GCW A;  4RL7 A;  4Q4V 1;  4AEK A;  3CO2 A;  1LOF A;  1A34 A;  1D4M 2;  5ERL A;  3IMM A;  4YGB A;  1LAJ A;  2HLE A;  1UOF A;  1WGP A;  4QQ2 A;  4D3W A;  1KJR A;  4IGQ A;  2CGP A;  4AED B;  1N1V A;  4CCK A;  1ASJ 1;  3FBM A;  5IK4 A;  1GWK A;  2ZAH A;  5A7O A;  2YYO A;  3J7L A;  4GQ7 A;  5C5U A;  5GZE A;  1C8M 1;  5K4L A;  4LQR A;  3ZSE A;  1AYM 1;  2W46 A;  1X7N A;  4CCO A;  2RDN A;  5ABJ C;  5FLJ A;  4BIS A;  2ARE A;  1AXK A;  2ZMK A;  3H8O A;  2J1V A;  2JE7 A;  5BNO C;  3ZFG A;  1PX4 A;  5FQ0 A;  3HR9 A;  4XF1 A;  3ACL A;  4LNV A;  2CV6 A;  1G9D A;  1SLC A;  2HWD 3;  1QQP 1;  3B02 A;  3THP A;  3KT4 A;  2ZEW A;  3ZFF A;  4FBF A;  2R30 A;  4YZ2 A;  1W6Q B;  1WD4 A;  2VNR A;  1QH6 A;  3T2Q A;  2NN8 A;  4OQ9 A;  3M3E A;  1RUC 2;  2B42 B;  2ZOE B;  3V65 A;  4NO4 A;  1X82 A;  4DRV A;  5LRR A;  3JBG 2;  4PIZ A;  4CEW A;  4DMI A;  3V0B A;  1DG6 A;  1WWY A;  1XOY A;  4EN6 B;  4Y5T A;  1RUI 2;  1K5J A;  3PJQ A;  5F5A A;  5K0U C;  3H1M A;  1YIP A;  3SMH A;  1HKD A;  1ULO A;  1S2B A;  1OVS A;  2R04 3;  4ET7 A;  2WYF A;  5BY5 A;  2VCB A;  3I2D A;  4XQW A;  1YHF A;  2VMF A;  3W5N A;  2QUO A;  4QKF A;  3ZN4 A;  2WO2 A;  4ZU4 A;  1BKZ A;  2B45 X;  3H3Z A;  4UT5 A;  3UES A;  1ZVF A;  3ON7 A;  3OD0 A;  4BLJ A;  5IK7 A;  2DFC A;  2PHW A;  3WNX A;  4LKS A;  2B4K A;  2E31 A;  3AP6 A;  3VBU A;  4RHV 3;  2D6O X;  2A6Y A;  4KWK A;  2VZ3 A;  2P3K A;  1HQL A;  2HWF 1;  3JD7 3;  1NLR A;  5HV4 A;  3AVR A;  2EXI A;  4XZP A;  1LOG A;  2X5I C;  3BTZ A;  2LAL A;  4CP9 B;  5C33 A;  1TMF 2;  1T2X A;  3PVO A;  1RUF 3;  1SBF A;  4R9C A;  4A45 A;  2CY6 A;  2R07 2;  3D0J A;  2J1S A;  4B8E A;  3MPP G;  1HV1 A;  1COV 1;  2ZHN A;  1OPM A;  2WWU A;  1KXG A;  1JOD A;  4BMB A;  1N3P A;  4GH4 C;  5C9A C;  3POJ A;  1IS3 A;  3T3Y A;  3A22 A;  3ITQ A;  4NUB A;  2BGO A;  1R08 2;  3U10 A;  5JXJ A;  1NT0 A;  4XFH A;  4A44 A;  5KHK A;  4E4S A;  1KQR A;  1UD1 A;  2IXI A;  3AYA A;  3GBW A;  3W21 A;  3W59 A;  3ZXL A;  3I49 A;  4F7Z A;  2Q8O A;  3NNM A;  4FPF A;  3PJY A;  4DZG A;  5FP7 A;  2D7F A;  2YB7 A;  2VOV A;  2XR4 A;  2R0H A;  4YFZ A;  4LE3 A;  1EY2 A;  2LTN A;  3LZZ A;  1UKG A;  4BQ1 A;  1SPP B;  2WL1 A;  5CFD B;  4LHL A;  3ZYJ B;  1RED A;  4M3C F;  2ERF A;  1ZRI A;  4NIH A;  3LE0 A;  1YIF A;  4NJ4 A;  2G9G A;  4Y1U A;  1S0C A;  1VRB A;  3RYK A;  3L2Y A;  4XAE A;  5IVB A;  1AJO A;  3ZPY A;  2XKO A;  3FJS A;  3J9S A;  5CFC A;  3BTX A;  3PVE A;  2PHD A;  2VXJ A;  3RS6 A;  2HWD 2;  3RI8 A;  4JHZ A;  1UYX A;  1Y4W A;  5B4N A;  1PGL 2;  4UFJ A;  2OPK A;  5F6L B;  1PIV 1;  3BIW E;  4W4Z A;  3UKN A;  2ZXQ A;  3H8R A;  2IUW A;  3OBZ A;  2BEO A;  2WII B;  1GOF A;  3ILN A;  1BEV 3;  4QQL A;  5FY0 A;  3ZN5 A;  1NCR C;  1TVG A;  1W0N A;  1W3X A;  1SLT A;  5C8C A;  5HPO A;  1UNB A;  3H3L A;  4NE9 A;  4UAP A;  5APA A;  4Y22 B;  3AXE A;  2K46 A;  4JVA A;  3J4U H;  2IFR A;  4CPB A;  2FDF A;  3N9P A;  5A3O A;  2R04 2;  1HXS 3;  1POV 0;  1WW7 A;  4O9G A;  1W8T A;  5L9V A;  1ONA A;  4LOS A;  4LBQ B;  4PI0 A;  1LGB A;  4AFA A;  1XBF A;  4KG0 A;  5ANQ A;  2YRO A;  5HXV A;  3EO6 A;  3URF A;  4EWA A;  1A8M A;  1O6U A;  1ENR A;  4QX1 A;  2FDK A;  1QJU 3;  2BP6 A;  1W8W A;  2XLG A;  4RHV 2;  5FZA A;  2DBN A;  2YGL A;  3H1Y A;  1OH4 A;  5J36 A;  1NX9 A;  3JD7 2;  3NAP A;  5FRE A;  4BJ0 A;  2X10 A;  4IEO A;  2JD9 A;  1GP6 A;  2HBU A;  4KI5 M;  3ZN6 A;  5FY7 A;  1RUF 2;  2WFF 1;  1BBT 1;  2Y60 A;  5D8A A;  3O1R A;  1SAC A;  4W65 A;  4ZPI A;  1H9P A;  3ELN A;  1AR6 1;  4V2W A;  3VZK A;  1D2Q A;  1ULE A;  1W0O A;  3VHP A;  1I5P A;  2WYS A;  4GB3 3;  4Q4W 3;  2GNT A;  2V09 A;  1UIK A;  1G9A A;  5L7O B;  2NZ9 A;  1PX3 A;  3WCR A;  2Y6H A;  3T4V A;  1DCS A;  1NUK A;  3EXU A;  1WW5 A;  3LQC A;  3AK0 A;  5LBE A;  1OVP A;  2WRA A;  3VBF C;  1VAM A;  3VBH B;  3ZIW A;  1WA6 X;  4K8F A;  4LUL A;  3KSC A;  3POS A;  2FMY A;  3OG2 A;  3AZW A;  4N53 B;  2WNV A;  4GWN A;  4DY5 A;  5CKM A;  3WY6 A;  4MVT A;  4IV3 B;  2VVE A;  1OQE A;  3B5L B;  2P6C A;  3I8T A;  1HIX A;  3Q8C A;  3MLK A;  4H7L A;  4RS5 C;  5FZM A;  1FV2 A;  5A3W A;  1O3T A;  4TN7 A;  5DN2 A;  4YW2 A;  1AX2 A;  2GP5 A;  1JYN A;  3I2O A;  4HVO A;  4QAW A;  5FLI A;  3GF6 A;  5LEJ A;  4XXA A;  1W99 A;  1UYP A;  1XYO A;  5JPM B;  4CU7 A;  4Z2W A;  5FXX A;  4AQ6 A;  3Q8E A;  3FMG A;  4ZKT B;  1RYY A;  1HB4 A;  1JOP A;  1H1I A;  1L7L A;  3G6J B;  3LWC A;  5FP8 A;  3BYW A;  1UY2 A;  3T1L A;  3DXU A;  2BV4 A;  2XJT A;  3B94 A;  3R6S A;  3N7J A;  1BEV 2;  2UWA A;  3ATG A;  3QAC A;  2YFZ A;  1GAN A;  1XC6 A;  1Z0H A;  4ARY A;  4JDO A;  3ZFG B;  3IM0 A;  4LK6 A;  1PO2 3;  5ACA 1;  2WN3 A;  4M01 A;  1HXS 2;  1W8U A;  4MGZ E;  4WM7 A;  2WT1 A;  2XWJ B;  2HJI A;  2JIC A;  1LR5 A;  4AZZ A;  4OQ8 A;  3EMR A;  2HWE 3;  1GQG A;  2VL4 A;  4A4A A;  3D5O A;  5FR3 A;  1UYY A;  2XON A;  3SLI A;  3IBM A;  1Z7S 3;  4NR1 A;  1QJX 3;  1J3P A;  5FYU A;  1L7R A;  4AF9 A;  1H4H A;  4CEW B;  3T2P A;  4CDX C;  1QJU 2;  1ODM A;  3UGH A;  3V0B B;  1UZY A;  3WP3 A;  4ERO A;  4Q5O A;  4WM8 C;  5FZO B;  1DYK A;  3FHI B;  1PM7 A;  2OVU A;  1KRI A;  3R4S A;  1GNZ A;  1OLQ A;  1SBE A;  1XYP A;  2QKD A;  1ZBE 1;  3T30 A;  4A41 A;  3RMY A;  4OHX A;  4LBL A;  5FXZ A;  4LIV A;  3O0X A;  4Z2A A;  1Q3E A;  4W6X A;  4XET A;  4L11 A;  2YBP A;  1QJE A;  3D82 A;  4X6Q B;  5HXM A;  1MPX A;  3MIE A;  3HQR A;  1YYN A;  1RUC 1;  5F3E A;  2B9U A;  1DGR N;  4NRQ A;  5FZ7 A;  1POV 3;  1VPH A;  4GB3 2;  4Q4W 2;  4P9X A;  3HN1 A;  2PAM A;  3ROU A;  1BMV 2;  2D40 A;  2ZA9 A;  5GLU A;  3VBU B;  4AAX A;  4N7I A;  1RUI 1;  4R9D A;  1E5I A;  1U12 A;  1R1Z A;  1XXN A;  2JDH A;  3AZZ A;  2PYT A;  2VBD A;  4NHY A;  4WZC A;  3ORJ A;  1W39 A;  4TXW A;  3TAY A;  2WNO A;  5DZG A;  1WCU A;  3NNF A;  4Q0Q A;  1QIQ A;  3WCS A;  2AAC A;  1LED A;  2C9K A;  4YM3 A;  5K7P A;  4XFB A;  1EV1 3;  5DPN A;  5B2G B;  1Q8S A;  4TLF A;  4CCD A;  2ZGN A;  3OPT A;  1DQ4 A;  5IUQ A;  1FPN 3;  4OHV A;  1DQ0 A;  4XJ9 A;  1YJK A;  3WQ7 A;  2VW0 A;  2UWB A;  3MDP A;  4RD7 A;  1PVX A;  1F5F A;  5J98 B;  1AL0 G;  3KB5 A;  4AI0 A;  1NKG A;  2E51 A;  4AWD A;  1AX1 A;  4JKK A;  4GMP 1;  1POQ A;  1TMF 1;  2BFU L;  2JG9 B;  4CP2 A;  4WVM A;  2AGS A;  2WZP P;  3U75 A;  2RMU 3;  3VHO A;  4D7T A;  3M3Q A;  3T0A A;  2OII A;  2ZGP A;  3KCX A;  4GAL A;  1SLL A;  1V00 A;  3K2O A;  2ARB A;  2B9V A;  2JE8 A;  3NV1 A;  5FYV A;  5EIY B;  1LEN A;  1K3I A;  1R08 1;  5FYB A;  4A3X A;  2Y6J A;  1PO2 2;  2VM9 A;  1UU4 A;  4MAD A;  5LA0 A;  4AG4 A;  5C5T A;  2QE3 A;  4JGZ C;  4OZO A;  5FK8 A;  1G9C A;  5HV0 A;  1QH7 A;  4XTP A;  3KCC A;  5CB7 A;  3VDB A;  2HWE 2;  2ZEY A;  3MW2 A;  3WT3 A;  4E8C A;  1EAH 3;  4XFI A;  4D94 A;  1QOT A;  3IWZ A;  3VBS C;  1A6C A;  1Z7S 2;  4NRP A;  1QJX 2;  5JAX A;  3MLL A;  2DF7 A;  1RTV A;  5CVR A;  4AYU A;  2Q8E A;  5J3U A;  4QMA A;  5BYN A;  4G3Y C;  3OCP A;  5C8C B;  1JOJ A;  2WT0 A;  1UPS A;  4IUG A;  4BQ5 A;  4DIN B;  3WF4 A;  1URX A;  3DPR C;  1RUJ 3;  2WC2 A;  1UN1 A;  1XSQ A;  3MUY 1;  2HWD 1;  1AR9 3;  2E7T A;  2NYY A;  4CCN A;  2TNF A;  3AYC A;  4BYY A;  1JN2 P;  5IAV A;  1C1L A;  1OD3 A;  2WQ8 A;  3GCX A;  2A70 A;  5GLT A;  2W3J A;  3ZMN A;  1BHG A;  2OUJ A;  3WUC A;  5A1A A;  3SNM A;  2CHH A;  1WW4 A;  2ZHM A;  3MFA A;  1J3R A;  1AR8 3;  2WZ8 A;  5F32 A;  4CXW A;  1LU2 A;  3AMN A;  2BW8 A;  2W0X A;  1G7Y A;  1K5M C;  3O1P A;  3M1H A;  2D6L X;  2CWM A;  2Y64 A;  2R04 1;  1C5H A;  3ZN6 B;  2E53 A;  4IQP A;  1XJA A;  3FBY A;  4YVW A;  2JDU A;  5FMO L;  1US3 A;  1DGW A;  1EV1 2;  2DUR A;  2GC0 A;  3AMP A;  4RR3 B;  3WNO A;  3HNY M;  1FAY A;  3POB A;  4IV1 A;  4XXP A;  5A7P A;  3KQ4 B;  3ZFE C;  1JHJ A;  3AZY A;  1FPN 2;  4W50 A;  4CSW A;  1W28 A;  2FDH A;  1UIJ A;  5FZF A;  2CDP A;  1F4H A;  1DZQ A;  1NLQ A;  1UF2 C;  4F83 A;  4YAR A;  4RHV 1;  1D2S A;  1Q56 A;  3MGU A;  2BWC A;  3VZJ A;  2GSY A;  2G9F A;  3GHN A;  3MV0 1;  5FYI A;  3JD7 1;  4CCJ A;  4DB5 A;  4WVV A;  5LA9 A;  1TE1 B;  1Q8Q A;  4BCU A;  4OLL A;  1DYP A;  1DF0 A;  2PLV 3;  2WNE A;  3TEY A;  1RUF 1;  1J83 A;  4EZ4 A;  2RMU 2;  1OUR A;  1O4Z A;  2YMZ A;  3C7H A;  3KQR A;  3H8U A;  3I3B A;  2QQK A;  1AXZ A;  3LEK A;  2NLR A;  2D93 A;  2XBO 3;  1VBB 1;  2IXJ A;  4D6Q A;  2VY0 A;  2Z69 A;  3JXS A;  1K45 A;  1KS5 A;  4NII A;  3WP6 A;  2DVB A;  2DCZ A;  2PFW A;  2ZAC A;  3ACF A;  2VQ0 A;  4L97 A;  1U5I A;  3PUA A;  1ULD A;  2XHN A;  4YW3 A;  4YM0 A;  3LB9 A;  3UKV A;  4FSJ A;  2GP3 A;  3NV4 A;  5FPB A;  1ACC A;  1EAH 2;  1JYT A;  3ACH A;  1UZ0 A;  2W1S A;  3PNA A;  4LK7 A;  1NAE A;  3LA2 A;  4KGQ A;  2V72 A;  2EXK A;  2VU9 A;  3IZO A;  3MO4 A;  4JC1 A;  3SKV A;  4BXS V;  3IT8 A;  4AI2 A;  4FP2 A;  4COU A;  4HBN A;  4CDQ B;  4OI4 A;  4LUK A;  3GGL A;  1C3H A;  1H2K A;  1DDL A;  4XUR A;  3VZO A;  1RUJ 2;  2YV8 A;  3WQ0 A;  1UY0 A;  1AR9 2;  2CGO A;  3Q8A A;  2YC4 A;  3I3D A;  2V5Y A;  1IQD C;  2UU8 A;  4J1X A;  2XVG A;  3PUQ A;  2E63 A;  3ETQ A;  2H0V A;  2VZV A;  1FNY A;  3ILF A;  5C8W A;  4BME A;  2OPW A;  2VZO A;  2OKX A;  4A3Z A;  4PDW A;  1WLW A;  1AR8 2;  1W2T A;  2BZD A;  1RUG 3;  4N43 B;  2E26 A;  4LO5 B;  4JGY C;  2I07 B;  5T5J A;  1W6Q A;  1HXS 1;  1CD3 G;  1ZNP A;  3JB4 C;  4P9Y A;  5FPU A;  2PHL A;  3AZX A;  3U0Z A;  1GBG A;  1N3Q A;  3DN7 A;  3Q8B A;  4A6S A;  1SFP A;  3CZU A;  1F15 A;  1DQ6 A;  2RJ2 A;  2ARX A;  2WWS A;  5DAP A;  1OI6 A;  4JDM A;  2BOJ A;  1CGP A;  4JRA A;  2WO7 A;  1QJU 1;  1HW5 A;  4YW6 A;  4K8R B;  1AHS A;  3X29 B;  4OHY A;  1RVF 1;  2Y38 A;  4QQP A;  1WCK A;  2W1U A;  4RFR B;  2GH8 A;  4LHN A;  1H8T A;  1VIW B;  3PTR B;  1F9K A;  2OXB A;  2PLV 2;  4X8P A;  3LA7 A;  1H4G A;  3ECQ A;  4B4P A;  3QCW A;  2QQU A;  3KWV A;  2WFP A;  4PBP A;  5AFB A;  3D6E A;  3I2G A;  3RJR A;  3TNQ A;  5IYY A;  1FT9 A;  2VE1 A;  5I0D A;  1O3S A;  2ZZQ A;  4MV2 A;  2XBO 2;  2YUE A;  3III A;  1JYX A;  3K51 A;  3KD4 A;  4GB3 1;  4GIQ A;  4Q4W 1;  3DUI A;  3WQB A;  2H0B A;  4B7E A;  1BYH A;  1LHV A;  3ILR A;  4P5H A;  2VQT A;  1N3O A;  1ZZ7 A;  4CP9 A;  2BPA 2;  1PZ7 A;  1TME 3;  2VO5 A;  1AR7 3;  2PXJ A;  3BOD A;  4LHS A;  1GMM A;  4LR4 A;  4IE4 A;  5IWF A;  4HL0 A;  3RDI A;  3K77 A;  4CDW B;  4DS0 A;  3AJY A;  4BU2 A;  3WLU A;  1SBD A;  2WLP A;  3VBO A;  3WEZ A;  2ET1 A;  1W8F A;  2VVD A;  4GKY A;  1S1A A;  2PAE A;  2VTF A;  3C8X A;  2WA3 A;  4JDN A;  5JZG B;  4HMZ A;  3H8X A;  5FCC A;  1S0G A;  3I4I A;  2OX0 A;  4QQH A;  3ZXK A;  2IWG B;  2GME A;  3GZU C;  4UW5 A;  4BB3 A;  1D0H A;  1ENX A;  2QQJ A;  5FO7 B;  3CQO A;  1AVB A;  4URT A;  5CFD A;  3AKQ A;  4YG6 A;  1X8M A;  4K3U A;  4JZR A;  2KR2 A;  4P9J A;  3HN3 A;  4E4H A;  2W87 A;  1A78 A;  1RUG 2;  3U4S A;  1PO2 1;  2GU9 A;  5DUW A;  1GFF 2;  1UZZ A;  1O3Q A;  3RZL A;  4OI1 A;  1LUL A;  5HCF A;  1PNG A;  2EVX A;  2VQU A;  4IES A;  1DFQ A;  1JYI A;  4Y4Y A;  2D3R A;  4PLO A;  4DFS A;  3K46 A;  4JCK A;  2HWE 1;  2D6M A;  3B3Q E;  3AMQ A;  2EIE A;  1OD5 A;  4QM8 A;  4B3N A;  1LB2 A;  4EYU A;  1Z7S 1;  4W6Y A;  1QJX 1;  4GXL A;  2FQP A;  4G9S B;  2UUR A;  2GDF A;  4C1W A;  1VMJ A;  2GN7 A;  3CJI C;  1UMZ A;  1KIT A;  3GYD A;  1GZ9 A;  4Y22 A;  2YY1 A;  2O14 A;  4OUS A;  2VQA A;  2XWB B;  5JSP A;  3O12 A;  4Q26 A;  1JZ6 A;  4DNY A;  4UFL A;  1UZW A;  4YM2 A;  4XZU G;  5HCH A;  3CBN A;  4RQP B;  4AI1 A;  3RQ0 A;  4LBQ A;  3VHN A;  3ACI A;  3VHR A;  2SLI A;  2QQM A;  5FV3 A;  3NST A;  1W8O A;  2HWB 1;  3ZYP A;  5EYY A;  4IV1 B;  5HI0 A;  2QQP A;  3ALQ A;  1OA3 A;  1S0D A;  4HK9 A;  3BUC A;  4IW3 A;  1LGN A;  1DLL A;  1POV 1;  3DYP A;  3J8F 3;  4XW3 A;  1SCR A;  3E5X A;  4HG6 B;  3ZXD A;  3QD6 A;  2RS5 3;  1V6L A;  2W47 A;  1C1F A;  2VZT A;  2R32 A;  2WO3 A;  4PJY A;  3RZZ A;  5J48 A;  4JKM A;  1TME 2;  5D21 A;  3JQW A;  1AR7 2;  3MBW A;  3O0V A;  3VZM A;  3OUJ A;  3RYP A;  4AHX A;  5A7N A;  1FXZ A;  3F2Z A;  2W94 A;  1ZZC A;  3VD7 A;  4IEQ A;  2OZJ A;  1EV1 1;  3TN9 3;  2BOI A;  3C7O A;  4ZS2 A;  2ORZ A;  4LKE A;  4XF0 A;  3OB8 A;  4XIL A;  3MF9 A;  4LIU A;  2G4I A;  2WNU C;  1YJL A;  1FPN 1;  4XUT A;  3ZXG A;  3I2H A;  1ZRC A;  5KBF A;  4FPO B;  3VBR C;  3FX3 A;  2AUY A;  3N36 A;  1RB8 G;  3VBH A;  5JIU A;  1AZD A;  3C3V A;  3LDB A;  1W9Y A;  2GC2 A;  4PI2 A;  1MS4 A;  1YNA A;  2ZX3 A;  2VEC A;  4Q1R A;  4LHK A;  3VZL A;  4PIX A;  3L2H A;  4QKD A;  1GUI A;  2YU1 A;  5FMB A;  1RL3 A;  1BK1 A;  2ZBJ A;  5GKA C;  3GZA A;  1QY4 A;  4IV3 A;  2RMU 1;  1Y9G A;  2PHX A;  3LCP A;  4M0H A;  4X6R B;  3PME A;  1W9T A;  3PVN A;  3WG2 A;  4E4D X;  5C3R A;  4QPI C;  1XRU A;  1UY3 A;  3HPN A;  1QOS A;  4EWD A;  4ITC A;  3TWI A;  1YLL A;  4L2N A;  1LTE A;  3OYW B;  4BK5 A;  4Z82 A;  5F5Q A;  2C4X A;  2LUW A;  4MSV A;  3OOX A;  4XFC A;  3K3N A;  1GZT A;  5F5I A;  3VL9 A;  2GNB A;  3ZO0 B;  2O8O A;  1YI7 A;  2J1U A;  2J1R A;  3E6D A;  4XUQ A;  5DXD A;  3UKT A;  5ABJ A;  5FZB A;  1LJ7 A;  4PLM A;  1PO1 3;  2JG8 C;  5BNO A;  1QMJ A;  4OUM A;  4LO4 B;  1EAH 1;  2C6S A;  2K2S A;  4AVT A;  4PLN A;  4QPG C;  1NA1 B;  4EN9 B;  4E2Q A;  1CAU B;  2W92 A;  4FI9 A;  4AEM A;  4RYD A;  5LAS A;  2IXH A;  4PDW B;  1ZBA 3;  1ND3 C;  4ZON A;  1H6X A;  3NWK A;  4A2U A;  5J7M A;  5FO9 B;  3VDD C;  1RUJ 1;  1RUD 3;  4D0Q A;  4I0W B;  4ES8 A;  1W2N A;  1SFN A;  2V73 A;  4LJH A;  4NOT A;  4LT5 A;  4UFK A;  4B1L A;  1DQ1 A;  5EPA A;  4XPV A;  1LOF C;  2BVV A;  4FQ4 A;  2WQ4 A;  4QXB A;  1MS8 A;  2OZ6 A;  5KHH A;  5K0U A;  2YC2 A;  5FMO S;  4ATE A;  2VGD A;  2DCK A;  1GOH A;  1GZW B;  1JZ7 A;  1KFU L;  3LDR A;  3NVC A;  5FZO A;  3WF1 A;  3GZT B;  3J8F 2;  4QX3 A;  4YVS B;  2IFW A;  1W2A X;  2AZ5 A;  3AYD A;  4NWV A;  2RS5 2;  1XU2 A;  4I0A A;  2X05 A;  3T09 A;  3U14 A;  5F8P A;  4WV8 A;  3AL6 A;  3KT7 A;  4N7U A;  4TLG A;  1RIR A;  2RM2 3;  2YC0 A;  4ARX A;  1H8T B;  4Y1V A;  2XUE A;  4NN0 A;  3OSD A;  4OUL A;  3IDE A;  3MW4 A;  4JTO A;  3TN9 2;  1EPW A;  3JQX A;  2C0Z A;  4OMD A;  4UBG A;  3LOI A;  1EUT A;  3A4U A;  2VC9 A;  3CZJ A;  1CIW A;  3ZFF C;  2BTV C;  5AVP A;  1JU4 A;  1MAC A;  1S0B A;  2VMC A;  4FAG A;  3O0W A;  1QU0 A;  1YQ5 A;  4XIK A;  5JSO A;  4LA3 A;  2JX9 A;  4IE6 A;  4Q8L A;  5KR7 A;  1V6O A;  1JU3 A;  4S2D A;  2PLV 1;  1NCQ B;  3IIA A;  3KF3 A;  3LEM A;  5IAX A;  3ASI A;  1YI9 A;  4URA A;  4B4Q A;  1LHU A;  2DUO A;  3DKW A;  1CX4 A;  4K7J A;  3ZOI A;  3VBO B;  5FYT A;  4FAH A;  5KC6 A;  1LEC A;  1HV0 A;  1OLM E;  2VZQ A;  2QDN A;  4FO9 A;  5FFO C;  1HB2 A;  3WG1 A;  3FFQ A;  4LIT A;  1Z78 A;  4HET A;  4DXS A;  5A3T A;  3ZSM A;  1GQH A;  3PUR A;  2GAL A;  3CL1 A;  5FUP A;  5A3N A;  2JG9 A;  4CEY A;  3DL3 A;  5KC5 A;  1PO1 2;  1E5S A;  3VBU C;  4XFG A;  2ZX2 A;  4ONU A;  1JUI A;  3IKW A;  2P5B A;  1H1M A;  5FYC A;  1Q43 A;  4Q2F A;  2H6C A;  1V6K A;  1FV3 A;  1NZC A;  1Q8P A;  5FYZ A;  3VKL A;  3W9A A;  1ZBA 2;  3RNS A;  5EXO A;  3KS7 A;  1XE8 A;  3OEB A;  4L99 A;  5FPZ A;  2Q8C A;  2PN5 A;  5LY1 A;  2QTW B;  5LBC A;  2LRP A;  3AB0 A;  4I30 A;  4XTM A;  1OLR A;  1XE7 A;  1XNB A;  1RUD 2;  3ABZ A;  2VCC A;  1G86 A;  1PK6 C;  3IAQ A;  3PHM A;  2D3P A;  4DY3 A;  1K12 A;  5DUV A;  3M70 A;  1CJD A;  5GZF A;  1LOD A;  1ND2 C;  4NWW A;  1UXX X;  1MZF A;  3HBZ A;  3UL2 A;  1RXF A;  4DXZ A;  3U37 A;  4MGQ A;  4Q1P A;  4XYX A;  2WAA A;  2WZR 3;  4ZXK A;  3VUO A;  1DBN A;  2BU9 A;  2BUK A;  1WKY A;  1O4Y A;  1W6P A;  2UY8 A;  1CAV B;  1MS1 A;  5F2W A;  3OGS A;  1RUG 1;  4NPR A;  5FZK A;  1S2E A;  2DTY A;  2P1B A;  1MS9 A;  2R16 A;  3ES1 A;  4P14 A;  2RM2 2;  1GIC A;  3QH6 A;  3RG0 A;  5L73 A;  1W6O A;  1YRZ A;  3N7L A;  3W58 A;  2Z42 A;  2PMW B;  3A0N A;  3EB7 A;  1RIT A;  1MQT C;  2BYV E;  4XFF A;  4M3C E;  1FOD 3;  5CFC C;  4KWU A;  2Q1F A;  2VZP A;  5C3S A;  3WNN A;  4FFG A;  4XMI A;  3NNJ A;  1TNF A;  5GM0 A;  4AHW A;  3QLQ A;  3WP5 A;  4CUA A;  4QM9 A;  1O91 A;  5I0U A;  3RMX A;  5KHI A;  3N9L A;  4DUX A;  1QXP A;  1W2U A;  4KU7 A;  2Y6F A;  3HIF A;  1OXC A;  4UFI A;  2L9L A;  3TB0 A;  4E4Z A;  4FPK A;  2Q1M A;  4BWO A;  1UOG A;  4RR3 A;  2O1Q A;  1HB1 A;  3KVA A;  3HT2 A;  3AP4 A;  4LMF A;  1WMX A;  1J58 A;  1YCI A;  3FLT A;  3BI3 A;  2EAL A;  1CZV A;  4KH9 A;  2XVL A;  1VAV A;  1WBF A;  4A7K A;  1VBA 3;  3BVC A;  3L9J T;  1NG0 A;  4Y5Z 0;  5FP3 A;  3NW4 A;  2HBT A;  2JEM A;  3OPW A;  4HPK A;  1B35 C;  3IPV B;  1QJY 2;  3KF5 A;  4QDQ A;  5A7W B;  4RS5 A;  4COV A;  1OFS A;  1RUH 1;  2FCU A;  2VNG A;  4FXK B;  5GJ6 A;  3MIG A;  1QGL A;  1ULP A;  4LXL A;  4ASK A;  3WSO A;  4NHX A;  3J7M A;  2ZTN A;  4UW3 A;  4K40 A;  5FUN A;  5SV5 A;  2FZ2 A;  2PAK A;  5C3Q A;  3PUH A;  1FI2 A;  3NAP C;  1NE6 A;  5GZG A;  2KM2 A;  3SC7 X;  3FLP A;  3APB A;  5IT6 A;  2R0F A;  2ZGO A;  1NXM A;  4MET A;  5FBJ A;  1Y3T A;  3ST7 A;  4XJ8 A;  5D8A C;  5F9T A;  5LRS A;  5I8S A;  1ZRE A;  5GLV A;  4DRR A;  1O7F A;  1OUS A;  3BOW A;  5EQU A;  3WVJ A;  4IEP A;  2NM1 A;  1JZ5 A;  3PLQ A;  4TTG A;  4A6O A;  5T3N A;  1J1L A;  2A5Z A;  4Q4Y 3;  3N3H A;  3FE5 A;  4MXV A;  5ABJ B;  1V6M A;  4YW4 A;  5BNO B;  2C9A A;  1VLN A;  3ES4 A;  3M7A A;  3MUZ 1;  1W9S A;  4AGG A;  4Z1V A;  5A3L A;  1Y7B A;  1ZRF A;  3H9A A;  2WZR 2;  3OJB A;  4CDQ A;  2ID4 A;  2VZS A;  5LA1 A;  2EIG A;  2C24 A;  2Z4F A;  2WNV C;  1UW8 A;  1W8N A;  4LEJ A;  3CEW A; 
#chains in the Genus database with same CATH homology
 3ZYF A;  4CPB A;  4CP9 A;  4CPB D;  1W8U A;  1GWL A;  1W8T A;  1HN0 A;  1V0A A;  2WYF A;  5D21 A;  1WZX A;  2JWP A;  2O14 A;  4YW6 A;  1WMX A;  3UT0 A;  2LRO A;  1GWM A;  2VXJ A;  2LRP A;  2KR2 A;  1OKO A;  4LK7 A;  3ZYB A;  4BQ4 A;  4LKE A;  4LJH A;  2Q1F A;  3ZYH A;  1L7L A;  1W90 A;  4BQ2 A;  1OH3 A;  1W8W A;  3ORJ A;  1WCU A;  4LKD A;  4BQ5 A;  1GWK A;  1UOJ A;  4YWA A;  4AL9 A;  4CP9 B;  4A6S A;  3F95 A;  1W8Z A;  2C24 A;  4BQ3 A;  4LKF A;  4LK6 A;  2K46 A;  4YW7 A;  1W9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...