2VXJA

Crystal structure of pa-il lectin complexed with agal13bgal14glc at 1.9 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of the Preferential Binding for Globo-Series Glycosphingolipids Displayed by Pseudomonas Aeruginosa Lectin I.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
molecule keywords PA-I GALACTOPHILIC LECTIN
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2vxjA00
1W90A 3ZYHA 1WZXA 2K46A 4BQ2A 4CPBA 2C24A 1V0AA 4LKDA 2Q1FA 4LKEA 2LROA 2VXJA 4YWAA 1W8TA 4CP9A 4AL9A 4YW6A 1GWKA 1L7LA 3F95A 3ORJA 1W8UA 4LKFA 4CP9B 1UOJA 1OKOA 1OH3A 5D21A 4LJHA 4CPBD 1W8ZA 4BQ4A 1W9FA 1HN0A 3ZYBA 2LRPA 4LK7A 1WMXA 2O14A 3UT0A 1GWMA 1GWLA 2WYFA 4YW7A 4BQ5A 4A6SA 2KR2A 1WCUA 1W8WA 4BQ3A 2JWPA 3ZYFA 4LK6A
chains in the Genus database with same CATH superfamily
3HVDA 2WSVA 1HB4A 4KWJA 5CNAA 2RDSA 3IKWA 3ZYHA 4CDWC 3GDBA 3HAGA 5EP9A 5F6KA 4MUVA 3IPVA 2AZ5A 3AYDA 4JZRA 4Q4W1 2ZABA 5GLUA 3ZIXA 3N7MA 1XOYA 4HOOA 3DPRC 1GANA 1C1LA 1QH7A 1WW7A 3MEPA 3TN91 1WCSA 4CCOA 1G9BA 1K12A 4K9SA 1H9WA 5JI9A 2MEV1 1DBNA 2B45X 1NKGA 2RR12 2UU8A 4JX0A 3KVAA 1CAXB 1W99A 1SQ4A 4GB32 3VDDB 1BJQA 3LOBA 5LBCA 2PYTA 1TME1 2I2SA 5EYXA 2V73A 2PHLA 4DZGA 2DFBA 2LRPA 2YU2A 1UXXX 4B1LA 1EUTA 1POQA 4W6YA 3APBA 2KA3A 4YW7A 4XBLA 4IW3A 3WW3A 5FRAA 3AZXA 5HCBA 4HK8A 2NN8A 3MBWA 5KBFA 1XJAA 1GZWA 4FPYA 4DY3A 4JHTA 1ODMA 2UY8A 2JX9A 5FZBA 5FV3A 4YYOA 4LUKA 3DXTA 3NQHA 1C5HA 3T2OA 1YQ5A 2XL9A 5FYIA 1VRH1 2RS33 4FOWA 1LCLA 5BNNB 1LKNA 5T5JA 2XXZA 5FZMA 4C8DA 4XUNA 1NXMA 2XWBB 3DN7A 2PXJA 4OFGA 5LRRA 1LHNA 2PN5A 3I49A 3E5QA 1HB3A 2HWB1 2A75A 4MGZE 5BUVA 1ZRIA 1ZZ9A 1JU3A 3KS7A 4YW2A 2W1QA 3ZR6A 5A3MA 2O1QA 3N9QA 5FJKA 2VTFA 3JD71 3SEEA 4DXRA 2PQQA 4XIKA 2WS92 2DU0A 4RHV2 2X5IA 2YFUA 4LBQB 4O7XA 3LSEA 3NNGA 4ZS2A 4DMIA 1Q56A 1BBT2 3CKHA 1AR91 4AQ6A 5JUVA 4HSJA 4PQQA 1HQNA 3WDVA 3WNXA 4QHZA 3H8OA 5BNNA 3SC7X 1JOJA 1ULOA 4KNCA 2VCBA 4FQ4A 1W6MA 1PO21 1H8TA 1POV3 1VBA1 2HWE2 3P3PA 4ORFA 1FPN2 1N3QA 4IE4A 2JG9A 3WNPA 4LIVA 1QJZA 1RUI2 2C9AA 4YZ5A 1UY1A 1AVBA 3V0BB 3EXUA 2X53S 1EV11 2QJVA 1G86A 5FWEA 2XL7A 4IEXA 4CP1A 3U0ZA 4QPGB 1GNZA 2OZ6A 3UJOA 4CCJA 1W2AX 3I2IA 2JDNA 1U5ZA 3JXSA 3ETPA 1LOAA 4I0AA 1YFUA 4Y3OA 3KGLA 3CL1A 5DUXA 2VQUA 4LO6B 1OMIA 2R042 5ANQA 4JRLA 4MHRA 1XSQA 3DUIA 1GP4A 4LOSA 4BZ4A 1RUOA 1WA6X 2EF6A 1VRH3 2DCTA 4RHV1 1UF2C 5FMOL 3LIHA 2DURA 2C9KA 3G7DA 4XFAA 5A80A 2CGPA 4XQWA 4QX2A 1DGRA 3N9MA 1U5XA 2D7FA 1E57A 2WQ8A 3KM5A 1ZZCA 2J1RA 1GICA 2RR11 4OHXA 5KWRA 3ZDVA 1OT5A 4R4XA 5IHRA 5KHKA 3O1MA 1BEV3 1LB2A 1BMV1 2WFF2 2P17A 4C91A 5TSWA 3C3VA 1NCRC 5FCCA 2C24A 2RM21 2DVDA 3AFKA 3B93A 1BBT3 1CIYA 2BJSA 1JBCA 1O6UA 4FQZA 1PNGA 2YG0A 4QAWA 5EV7A 5F5AA 1AR82 2BPA2 1G7YA 5CFCB 3TNPB 3I2OA 3B01A 4BE3A 1YFYA 3GCXA 3LZZA 5FYTA 3SH5A 1VLNA 3O1PA 2R073 5LEKA 3QD6A 4I01A 3GJBA 1RXFA 4QXBA 5KR7A 3U14A 4YRDA 1LGBA 1CZVA 1HB1A 2W92A 1GMMA 1H8VA 2GAUA 4K1YA 5C33A 4MYEA 1AR61 1Q8OA 2BNMA 2BFUS 3LGRA 3WQ1A 3WG4A 1LHVA 3VD7A 1W6NA 2Q8CA 4QXHA 3LB9A 5T5PA 1CPNA 1OD3A 1WKYA 2C26A 2UYAA 4N8MA 2R16A 3ZXJA 5JOWA 3J26N 3Q9OA 2G9ZA 3C7HA 4Q26A 1O7FA 4QKFA 3T4HB 1X7NA 3RI8A 3V56A 2QQVA 5A3NA 1RYYA 4AWDA 4OQ8A 5C6CA 4J6GA 5CKNA 5FZ9A 4ARXA 2WL1A 1CJPA 1YFWA 3RSJA 2VNGA 1KS4A 3B9IA 2W5FA 2IXKA 3CJIA 3BOWA 3POSA 4M4RA 4O61A 4K8RB 4X6QB 5A3LA 4LE4A 3UJQA 3KLSA 1RJ7A 2WZR1 3CEWA 3OTFA 4XACA 2R6QA 5E1RA 1S0FA 2RDQA 3ATGA 4UAPA 4PIXA 5ANNA 2JKXA 5JSOA 4NRPA 1R1A3 1C8NA 4GMP1 3TOJA 3IM0A 1I3HA 3QOPA 5FZ6A 2JG8B 2H6CA 4LLFA 5LASA 3FFQA 1LRHA 4COVA 1Q43A 1WLDA 3AMMA 1VBE1 4AI0A 1JHJA 3BPZA 1C4RA 1IG0A 4RGKA 5F3GA 1AR62 3BKZA 2P37A 3HQUA 3VHOA 1YWKA 3D8CA 4QKBA 1V70A 3U4XA 2B46X 1C8M2 4IGPA 4RR3B 2W0XA 2AGSA 4N90A 1UAIA 4K7JA 1V9U3 4RR3C 4Y26A 4AHWA 1ND2A 1A6CA 2VZ3A 4OHZA 5CFDB 1ZRCA 4CEYB 2CY6A 4Q0QA 4GXLA 1PGSA 3OPWA 5FZKA 2D3PA 3HD8B 1VB4A 2HWE3 5F6LB 3D3AA 2QQIA 3WHTA 1P8JA 3AXEA 3ZFEC 4AI3A 1I6XA 2RJKA 3AL5A 4Y22B 5JI7A 2FZ1A 4YFZA 3KT4A 1MACA 1MS1A 2VMIA 4H7MA 5FUNA 5A7WB 3CHXA 1WCKA 2ZA9A 1QQP2 3R4SA 1Y4WA 5ACA1 5FYSA 5GLWA 1N1TA 2HEWF 4LJHA 4OUMA 4WVZA 5FZAA 4A7KA 1H30A 1GP5A 3T2QA 1JZ6A 3AP9A 2HKXA 4YZ2A 3OD4A 5EPAA 4QX7A 4ES8A 3TRSB 4CSWA 2DUPA 1UMZA 1XYOA 2G9GA 3ILRA 4QPGA 1UU6A 5CVRA 2SBAA 5C3OA 2Y6FA 2B7YA 3IN9A 4S2FA 2VW0A 1L3JA 5F9TA 4AHYA 2ZX0A 4J1WA 1PMJX 3RI9A 2WJSA 4LBQD 4LORA 2B42B 5L7OA 3LAGA 4PF5A 1Q3EA 1VBE3 3PVNA 1W9TA 4P14A 1MQTC 1QGLA 3URFA 1B35C 2QDRA 1FNZA 4JRAA 2R063 3MIHA 4YG6A 4BHPA 2VZQA 2BEOA 3TAYA 3WVJA 2ZGTA 4D7TA 1V9U1 3ELNA 5JIUA 1ZBA1 1NY71 4M00A 2E51A 2ZEZA 3NV1A 2TBVA 2GNMA 1VRH2 4ZU5A 2VMCA 3OEBA 2DBNA 4LHLA 2Z4FA 4OUEA 3W59A 4XCBA 5I91A 1N3PA 1YEWA 4LBKA 1I9RA 3W5NA 4CPBA 2J1SA 3M1HA 2R043 5DZEA 5A1FA 1JI6A 4P9IA 5JXGA 2IVIB 2UWAA 3MPBA 1H6XA 4QQPA 5K8SA 2LS6A 4LXLA 1W0NA 1L7LA 2ZMNA 2PHWA 2YU1A 5IK7A 3Q8EA 4FVVA 1K45A 1BVP1 2J1AA 1KEXA 3NNFA 3AJYA 2QUOA 2AENA 2YC0A 4E2SA 1GV9A 2RS12 3THCA 3VBOC 2KD7A 4TSVA 1EAH1 2IXIA 4DPNA 1JYTA 3ZFGA 4LT5A 1HDKA 4PI0A 3NJZA 4EROA 2AEYA 3HNYM 1RB8G 2IXLA 2P1BA 2J7MA 3PVBB 2ORZA 4MOAA 1KFXL 1QEXA 1QQP3 2A3XA 1WBFA 4HT1T 1W8NA 3VBUC 1WW4A 3VZKA 2DCJA 1OPMA 2HEYF 2Q1MA 4IE6A 5FOBB 5I0RA 4V2WA 3VKMA 5A6QA 5GLZA 2R30A 2DBIA 2Y0IA 3FLTA 2H0VA 5C4WB 3ENRA 2JDAA 5F3IA 1W6OB 3ORJA 3K2OA 4DQAA 2VBPA 4LNVA 3A23A 3C7EA 1JYVA 2C5DA 3WEZA 1AYN3 2RS13 2VCAA 2DV9A 3PUIA 4N53B 4WZFA 3SISA 5J48A 2E9QA 3LPFA 5JWPA 2PHUA 1KS5A 2PLV2 1A34A 3LDKA 3E5XA 3MYXA 2OT7A 1O91A 2X8KA 1W8WA 3P5BA 4HLTA 4JKMA 2B9UA 2Y34A 1IS6A 3WDXA 4CXWA 3AMQA 4GJZA 1KFUL 4XFBA 3RMYA 2NP0A 2VC9A 2VH9A 3CNAA 2XG3A 5I0TA 2DF7A 2AACA 2CU5A 3FFZA 5EFUA 5LA2A 2CDOA 5D2AA 3ZN5A 4KMQA 3M4FA 2YBSA 3N9OA 5G05L 2ETEA 5H9PA 4C0HA 5BYNA 2ENRA 1X8MA 4YZ1A 3AYAA 2XQRA 4IL7A 4MGSA 1HN0A 1OKQA 3A4UA 2VOXA 1HQWA 4K8FA 1OA3A 4YW5A 1S1AA 1YQ8A 2C6SA 3FUQA 2QNKA 4DUVA 1VR3A 2OW4A 1OQEA 1UZZA 2HEVF 2EIBA 2ZHMA 4LBMA 3THDA 3ZXFA 1ZZ7A 1AR81 2ARBA 3ASIA 4KU7A 1MS0A 2K46A 4GKYA 1BLZA 3CJXA 2QQNA 2RM22 3J8F3 2NM1A 4PDWB 3WD5A 2B4KA 3I3BA 4FFIA 4BYYA 4A42A 4KBBA 2X5IC 3K4AA 3K77A 3M70A 1SFYA 4IETA 2V5DA 3NWKA 3I3QA 5FYZA 4KG0A 1SDDB 3KVBA 1JHNA 3H7YA 1H6YA 3OEAA 3PL0A 2HLEA 2PLV3 1H9PA 2RS11 1RVF1 1XNTA 2P5BA 1GKBA 3OOXA 2VVFA 4QWNA 1O5UA 1QXRA 1SPPB 4L99A 4OLLA 2WYFA 1G8WA 3KB5A 1XB9A 3O0VA 4Q4X3 2ZXQA 3ZFFB 2OQ6A 3RZGA 4UI9L 3PUHA 1ULGA 5A3OA 1I5ZA 1UMHA 2HWF2 2W68A 3BPSA 1BHGA 3ZSJA 2A6XA 1KGYA 5I8SA 1Q5OA 4AW7A 2YROA 2WO3A 1OLQA 1VBC3 2OPKA 4HANA 2JECA 4YWAA 3USUB 2CAVA 5DDJ2 3ZYIB 5IFTA 4AOCA 1IS5A 3WSOA 1W9SA 4BOWA 1NZIA 5FYCA 1X50A 4BPZA 3BU7A 4BMEA 5FOJB 5FUPA 3MF6A 1ENQA 3MFAA 4XFHA 2FDGA 3SITA 4XHXA 4INDA 1RUI1 4QDQA 4BDVB 4P5YA 4YGBA 3NNJA 4TWTA 1Y9QA 1BXHA 1YYNA 3GBGA 2QBXA 3WCSA 3I59B 4Y5TA 1UY0A 3ZYFA 4NAMA 3TEZA 2BDRA 4IV3B 4B4QA 4UFKA 3M3EA 1I5PA 4ZPIA 1YXWA 3AZWA 1SMVA 1BBT1 1DLLA 3V0AB 2EXHA 3Q8BA 1LHOA 3WF2A 4CXXA 4EWEA 2Q8EA 3JCIA 2JG8C 2A6WA 1AR71 2YC4A 5FY5A 1SLIA 3W21A 3POYA 4AZZA 5DABA 5FBZA 2E31A 4CUAA 1RUH3 2R071 1JODA 1YNAA 4QT6A 3DF0A 1CAWB 3M3QA 4W50A 1TME3 1DZTA 3J7LA 2ZKLA 5FXWA 2EIGA 4IEQA 3AKQA 2ARXA 3ZPYA 4BQ5A 2XJQA 4YVSA 5JXIA 3KWVA 1RC6A 4UXAA 3O7OA 4YGCA 1GOGA 4A3XA 4AAXA 1T6GC 1CAXA 3GM8A 4Q4X1 1QXJA 1LU2A 4EZ4A 4UW3A 1A3KA 5DUVA 1OLRA 2JDKA 2NMOA 5FYHA 1JS9A 4Y1XA 4A7ZA 3N36A 1VAVA 5FZHA 1F9KA 1CAWA 4XJZA 1JZ4A 4L2NA 5KHHA 3KD4A 3E6DA 5BNOB 1X8EA 3P3NA 4E4SA 1WWYA 2WUHA 1OLME 1C8M3 1KQRA 2HWB2 2QE3A 4NHLA 4M3CB 4UW4A 3PLQA 1RUJ1 5DAVA 4CCDA 1US3A 1F4HA 2CAUA 4QGMA 1BZWA 3M3OA 3ZDSA 4AEMA 1CGPA 1CX4A 3EYPA 3NAPA 5EQUA 5AVAA 1S0DA 5A7NA 5C70A 5FMCA 4CUGA 4DB5A 5FR3A 4IEUA 1Z7S2 3SCFA 5EWSA 2RE9A 2XJPA 4H7LA 1JMUB 2DTYA 1FYUA 2LROA 2YMZA 2WFF3 3BU0A 1XE7A 1O8PA 3OUJA 3SLIA 1RINA 3UESA 4LITA 4AFBA 3H3LA 2LTNA 5C9AA 3NNLA 3AXDA 4FPCA 4XZPA 4AF9A 4AVCA 1IPSA 4Z2AA 1DQ0A 2XWJB 1FMD1 4PCRA 3T09A 4QM9A 1BK0A 3OGRA 1H4GA 4I09A 4YLZA 4DRVA 3WF4A 1PNFA 1H8TB 1UIJA 5FP7A 3UYJA 2GP5A 4AEKA 4C1XA 2VQ0A 4PBPA 1JTZX 5K4LA 4Q4Y1 1OSGA 2GC1A 1C1FA 4XMAA 2YUEA 3ILFA 5D8AB 4CCNA 1WCDJ 3J7MA 2EICA 2WDBA 2HWC2 4N43C 1MZEA 3TN92 3CMGA 3I3DA 2W1WA 3MHZA 4N43B 3BTZA 4OVEA 3AX4A 2BWCA 1EUUA 1F5FA 4XZUG 2WINB 4CP9A 2V72A 2VW2A 4FPJA 5ACA3 2QFEA 3HN3A 3KV4A 4LBOA 4ZY9A 2VQAA 5C9AC 1UPIA 5J96B 1XRUA 2D5FA 4Y5Z0 1O3QA 2UY9A 3I3MA 2JDUA 4PJYA 5DUUA 2KXLA 5LY1A 2JE8A 2GP3A 4QU2A 3MDPA 2NQYA 4UBHA 4Y1UA 1CAUA 3HR9A 4AEJA 5BNPB 1UIKA 3O14A 3SKVA 4XXPA 4NRQA 1ODNA 3VKNA 1PVC2 4XUQA 3HT1A 1Q8PA 1OF4A 3J8F2 5LBEA 2WIIB 3VHPA 3ZFFA 1QNYA 4QX5A 3A21A 3T4VA 4NMIA 2FCUA 3I3EA 2WFF1 3R4DB 3I2DA 4NROA 1TVGA 4XFGA 2BU9A 3LA2A 4XF1A 3USUA 4BQ1A 1RHI1 3CZUA 1GZTA 4CA9A 1CAUB 3WT3A 1LECA 5IVVA 4HPKA 4QPWA 3ZVXA 5A70A 2VAUA 4DO0A 1RVF2 5AFEA 1ULCA 4AEDA 1AR63 4A4AA 1J3PA 1DQ4A 4LA3A 1O5LA 1QY4A 2RMU3 2YPJA 3IZOA 3PMEA 3RQ0A 4H3WA 4Z07A 4HN0A 2R041 3UKVA 4NPLA 5B4NA 5GLTA 4TLFA 3VKLA 4ZU4A 3GBFA 2VZUA 1W0PA 2JICA 5J09A 4UF0B 1F35A 3U11A 2D6PA 3ACFA 2Q1ZB 2VZ1A 4J25A 1W39A 1YI9A 2VECA 3DPRA 4GULA 5DZFA 3VBHA 1AX0A 3DECA 5IVCA 1R081 1UNBA 1D2SA 5FBJA 4EQVA 2OQ7A 4S2GA 1REEA 3DV8A 2ZACA 1YI7A 3JB8A 1RMU3 2JJ6A 3CO2A 1M4WA 5CFDC 1Z78A 1H2MA 1ZZ8A 5EXOA 1NA1B 2VM9A 1UYYA 1REFA 1W6QB 4B8EA 1PK6B 1ZYBA 2DVFA 2OPWA 3OSDA 1IQAA 3DYMA 2CGNA 2EA7A 3FN9A 4E2QA 2GN3A 2XHNA 4QPIB 2J42A 3AP4A 3H3UA 4KI5M 5IT6A 2WWUA 4IV1C 2Y6HA 3O1UA 5FPAA 5A33B 2VZSA 1UN1A 1AYN1 5HCHA 2HWD2 5FZLA 1T2XA 3WQ7A 2QQJA 3X29B 4HVQA 3SEPA 3ON7A 3KV9A 1WMEA 4RS5B 2XHKA 2IFRA 5GLVA 2XLFA 1UKRA 3NL1A 2W9XA 4M0HA 4I0WB 4MGTA 1HXS2 4AFMA 1LOCA 4ZU7A 4CE8A 3OGSA 3M3IA 5SV5A 4KU8A 5FY1A 3IAQA 2VCMA 5C8CB 3O1SA 2XKPA 2IWGB 3MF9A 4PIZA 2P34A 5K9YA 1UX6A 2E26A 3WP4A 1XNKA 5A33A 1XU1A 3AYEA 5GZGA 1GZWB 1CR7A 2WN2A 1UOBA 3KF3A 1DDLA 4RS5A 2PELA 4P9WA 2ZEXA 2BTVC 4WM7C 1FX5A 2ZGKA 2XPJA 4KL1A 5C8CA 2VY0A 1I1EA 1C3HA 3CLPA 4ZXKA 1SCRA 2D40A 2JWPA 5C3RA 1H2NA 4K1ZA 4PDWC 5FY4A 1OPOA 4R52A 3HIFA 4IEVA 5LWBA 3VL8A 1VB2A 3FWEA 5T54A 3VKFC 2XR4A 4QHOA 2QQOA 3C8XA 5K0UA 2BBAA 3VBRB 3NAPC 4E8DA 4WM8B 4XAEA 3PU3A 2DCKA 1B09A 3U78A 5FP4A 2D6MA 1NLSA 1DIWA 2A3WA 4MADA 4O9EA 4CP9B 1X9PA 1TNRA 4MGYE 1C57A 2VOTA 2XBO3 4QM8A 1RVF3 1TG7A 1GOHA 1KITA 5EJZB 5FZ7A 4AI2A 3AJZA 4CDXA 4L9BA 3S6PA 3JBG1 4IE7A 2SLIA 3RZZA 5IVJA 5GKAC 4NE9A 4AFAA 2CWSA 1OQ1A 2AREA 2UWBA 1UZWA 3PURA 3WUDA 4BCUA 1ONAA 4AVVA 1QOSA 3FZ3A 3S7IA 4M4PA 2RJLA 4NO4A 4MVTA 3BYWA 3T2PA 5KXDA 3MIFA 4F8AA 1HV1A 1J83A 3CU7A 4LHKA 2WWJA 4JHZA 4QKNA 4UWDA 4Y20A 2V09A 1COV2 5H9SA 3VDBA 3K3NA 1HRV3 1PGL1 2AH2A 4YVSC 1CONA 2Q5TA 1ND3B 2WQZC 2R1BA 3LFIA 3VGIA 2DFCA 3IWZA 4YZ3A 4IE5A 5KXCA 5FZ3A 2OUJA 3POIA 5KHIA 2WNUA 4O65A 5FYBA 4Y1YA 2RDRA 2XLGA 4RD7A 4AYUA 3WNNA 4A6OA 4C0BA 3H7JA 1ZBE2 2D5HA 4Q27A 1RUC1 2QVSB 3IDAA 5FZ1A 1SCSA 4BM8A 1LESA 2VGDA 3WW2A 2WN3A 1QQP1 1W8FA 3RS6A 4AEDB 2JDMA 1D4VB 1CQ9A 3ZFGC 5JOXA 4XETA 1LR5A 1YIPA 3GCWA 2W1UA 3LQCA 2YBPA 1ST8A 3C7FA 4ASLA 3UGGA 2R1DA 2ZZJA 5C7GA 1D0HA 1RUF1 4YW6A 5CKMA 3VV1A 4CEWA 3TBDA 2WZ8A 2HBTA 3D5OA 2CGOA 2JD9A 1RUH1 1JZ8A 1TQ5A 1PM4A 5JR7B 1NLRA 5L36A 3CBNA 2D6NA 2RS52 2ZTNA 3LEIA 3WXPA 3FMGA 2WA3A 1MS5A 2Q8DA 5FKBA 2WWSA 3IB3A 1GSLA 2DDUA 2IVJA 4GB33 3VBSC 5J1XA 1VBB1 4B7KA 1QWRA 3WF3A 1CAVB 1VBE2 1L7RA 4HZFA 4WBBA 3E6BA 4IV1B 2W3JA 1W2NA 3JQXA 5F5CA 1AX1A 4HMZA 2ILMA 1CZSA 2VW1A 5A7PA 3ZMNA 2BNOA 1W3XA 2DCZA 5F3CA 1PVC1 5IW0A 1W6NB 4Q4Y2 4O9GA 3EO6A 4AVAA 2OXBA 4JV4A 1WGPA 1OHFA 1RITA 2ADDA 1V6MA 2Y6LA 3M2MA 1V6JA 4TZDA 3CZJA 3JBG2 5GZCA 1ND2B 2BZDA 2XQXA 3VN4A 2GMMA 1RUJ3 3U1XA 4XJ9A 2OX0A 1LNSA 1PGW1 2A6ZA 1FPN3 2VNVA 4KBZA 2KR2A 4OI4A 2OVUA 2IZWA 4EN0A 3CJIB 1S2BA 1AR83 2IC1A 5FMDA 1REDA 3HBKA 4BQYA 5FQ0A 4XJWA 1PGL2 1YHFA 1XU2A 3R6SA 3T1LA 3EJKA 3KCXA 4CCMA 2WLQA 1LULA 3OGVA 4LO8A 1N47A 5ERLA 4E4HA 2WC2A 1MZFA 4Q1RA 3ZXDA 4F83A 5CFDA 3A7QA 1O3RA 4FOYA 3RNSA 1CESA 4QQHA 3MLJA 1OKOA 4GH4A 2EIDA 3PUAA 2WSUA 3ZXEA 2J22A 3PTRB 1FMD3 4W4ZA 3POJA 1GR3A 4NHKA 3GZUC 1OD5A 1AX2A 2ZEYA 5HI0A 2J1EA 4N9IA 4D6RA 3H8XA 4RL7A 1KRIA 1GU3A 1F5JA 1GWLA 4L8QA 3WW4A 4CDWB 4Z92B 1W8OA 1WCUA 2GZWA 1MR5A 4X8NA 5FZ0A 1FI2A 1G9DA 1ND2C 5FZ8A 2GMEA 3W58A 4IUGA 1HQLA 1X9TA 5F32A 3PIJA 1FV2A 1UYXA 2DWRA 3Q8FA 4LOTA 3VZLA 4ES9A 2ZMKA 1Z7S1 1DQ6A 5IJRA 3B94A 1WW5A 4IXLA 1AL21 5JMOA 4XCAA 3O12A 3AZYA 3W5MA 1ZBA2 1OLMA 3D82A 2H0BA 1KDMA 1E5RA 4JVAA 3U37A 3ZKYA 5IAXA 3S57A 5F39A 4Y22A 2XMLA 4CP0A 4CDWA 2MHFA 1G9CA 3LCPA 4LHSA 3ZYBA 1RUI3 1E5SA 1UY3A 4AGGA 1VAMA 2OUHA 1J3QA 3VBSB 4CCEA 4CDXB 3NV2A 1W6MB 1AR72 4L11A 4FXGB 3VBHC 1XE8A 1ND3C 3GHMA 2CYFA 3SCHA 3WP6A 5LCWL 1AR93 2D44A 5J36A 4OMCA 5BPXA 3J7HA 2VXJA 1C28A 1JN2P 2X10A 3FBMA 1J59A 2ARCA 4KWLA 2JEMA 1OVSA 1PO23 1POV1 4QX3A 4XAAA 1BYHA 2ZGPA 3BIWE 3WR0A 1M06G 5HPOA 3NNMA 4YGEA 2PHTA 4YFWA 5F1RA 1RHI3 2W87A 4KWUA 5FREA 3TNQA 3V0AA 3ZN4A 2QCSB 2DUOA 3H1WA 5KC5A 5F5QA 3FLRA 1ZRDA 3WZ1A 3BUCA 4AFCA 3BN6A 2R072 1XNCA 3K48A 5ACA2 5F37A 5HV0A 4HKWA 2TUNA 1TEIA 2RMU1 2NZ9A 5CYYA 4YPJA 4D6QA 5C4WA 4COZA 4DIQA 4I3GA 5FPVA 2VCCA 4A44A 1UW8A 3DXUA 4CDQC 5FP3A 1JYWA 1W3VA 1DP0A 2E7QA 2V5YA 5HXMA 2XLAA 5FPLA 2A6YA 4RHV3 2FD8A 4ZHNA 5E16A 2WO2A 3FX3A 4PIYA 5FLHA 3OBRA 1S2KA 4YG0A 1C8M1 3MV01 3H8RA 2AEZA 5FYVA 1Y7BA 3KF5A 1LGNA 1OFNA 2ZOEB 4JGZA 4XFCA 1NX9A 2K2SA 2OS2A 4DXZA 1UL9A 2K9ZA 4Q1PA 4B7EA 4BA6A 4META 3E5UA 1DZRA 4JGZC 4D69A 3PNAA 1WUVA 5DUWA 3G6JB 5G04L 1L7QA 4IGOA 2ET1A 5IVBA 2Y64A 2VTXA 3I97A 3NVCA 5IVEA 4YG3A 2VMDA 3PJYA 5DG2A 2PAEA 2BVVA 3NAPB 1PX3A 2JDZA 4R9DA 1QIQA 5GZFA 3VD9A 3VD5A 1ZBE3 4Q29A 1FOD2 4EN7B 1XNDA 2PA7A 4MO3M 3ILNA 5FY0A 3WHUA 3OGGA 4JC1A 1XYPA 4QMAA 1LHWA 5DN2A 4PBOA 4QKDA 1IPJA 5CISA 4OHYA 1PX4A 4FXKB 1W2OA 1V6IA 2J1VA 5LZ6A 1B35A 1CWPA 3UKNA 1Y9GA 4NIDA 4GWJA 2Z69A 1S2EA 1G9FA 4FTBA 3UNPA 2AC1A 2BGCA 2A5ZA 1ENXA 4AVBA 3FHAA 1N1VA 2C4XA 1J3RA 1KJRA 3B00A 4QPGC 1CN1A 4RR3A 1NA1C 2WKKA 4FPHA 2AYHA 3DKQA 3T0BA 1V6NA 3K51A 5I0UA 4D6SA 2ZX4A 1C5IA 3LA7A 5FAXA 3USSA 3NSTA 5J3UA 2Y26A 3SXWA 1VBD3 4P9LA 3ZXAC 3T2TA 5LY2A 4SLIA 4XJUA 2JB4A 2X09A 2GNBA 2E33A 3GZAA 3KZ4C 5JIAA 1QJY2 1SBEA 1IQDC 5A7WA 4NAOA 5IK4A 1GNHA 1NZCA 1W2UA 5F8PA 3SCGA 2D6LX 2P3KA 2FMYA 1W9WA 1VPHA 4CU9A 4HFSA 5IFPA 2D97A 2W47A 1LOBA 4XILA 1O4TA 1QOOA 3VKOA 2ZGUA 1OH4A 4AG4A 2P3JA 1DLCA 2EXKA 1NE6A 4MSVA 2MPFA 2XBO2 3PUSA 3NV3A 2AR6A 2YB7A 5IWFA 3VDCA 4CUBA 4F3JA 4P9YA 1JYCA 1CPMA 5FPBA 3E97A 1VALA 5L7OB 4LIUA 5A6ZA 3W9AA 4DY5A 4H55A 4KG8A 3H50A 3NKTA 1RUG2 3BTXA 4FSJA 4Y33A 1JOBA 3R4UA 3NMBA 1LOFC 1OOPB 1JW6A 2RVAA 4FPOB 4JDOA 5JCTA 2W2IA 1JUHA 1UWWA 2JD4A 4QX1A 4DFSA 5F5IA 3WG1A 5J98B 3J9SA 2ZS6B 3WX5A 3H0OA 3ZXLA 4AE2A 1RTVA 1Y3TA 4LO4B 1AYN2 1MS4A 4P5HA 1RMU1 2D6OX 4Q0VA 1S4CA 3TB0A 1VAKA 4RGAA 4IGQA 3VZNA 4AQ2A 1ZA7A 2WT0A 1W28A 2JIJA 1PO22 5IK8A 1UMIA 4AR2A 5IATA 4D7YA 1HRV2 4BK4A 3V65A 1R091 2VMFA 1UX7A 1H4HA 2GNTA 2GDFA 3QCWA 4YVWB 1DGWX 1OOPA 1AR92 1PMIA 1D2QA 2RV9A 3N7JA 2DTWA 4LBJA 5CU1A 3O1OA 3J4UH 1AXZA 2P6HA 5B4XA 3HQRA 4AI1A 4AVSA 2WS91 2HWF3 2WQ4A 3P6BA 4BWOA 3UV9A 4AFDA 3I59A 3RYRA 1VP6A 3ZOIA 1MZ5A 5LK7B 1HXS3 4LHNA 1HJGA 1MZ6A 3ZFGB 1V9U2 4A45A 1CD3G 3KT1A 2G19A 4CZSA 4N53C 5JZGA 5E6HA 1SDWA 2XUEA 4KQ7A 1ZBA3 1QMJA 1PO11 2D3SA 3K46A 3JQWA 4URAA 4I02A 3BI3A 4YVWA 1OURA 1SFNA 4JGZB 2VL4A 4BLIA 1OA2A 5JLVA 3OUHA 2MNGA 1W06A 3I8TA 4PI2A 3RMXA 3ITQA 2PMWB 5AVPA 4H2AA 3WINE 1PZ7A 2X29A 2W1SA 3LDRA 4NOTA 4Q4V3 4HL0A 4IEZA 5C9AB 4XUPA 3IMMA 4YW4A 1Y9MA 4XUOA 1BVVA 1NQJA 3INAA 3AKPA 2DYCA 3ZSEA 2BNNA 1POV0 1GQPA 3H9AA 4JDNA 5E88A 5FY7A 3BTYA 5K7PA 3IT8A 3ACLA 1RMU2 2DVBA 4Y1ZA 5LEJA 4XJ8A 3U75A 3PMSA 4UOJA 1VMFA 1TMF1 2BQPA 1DGWA 3PUQA 3T30A 4CDQB 2P6CA 2JG9C 4BXSV 4GA9A 4XTMA 1QJFA 3POEA 1LGCA 1H8TC 2HH9A 1ZRFA 2Q30A 5BNOA 5A1LA 5F2WA 1IGOA 2H6BA 5DDJ3 1UCXA 2WNEA 4YARA 1OUSA 1V6LA 3POGA 4MLOA 3D0SA 1IHMA 4Y1VA 1KXGA 1VE0A 3EB7A 4FPFA 4XTPA 5T5OA 5LA0A 2HWF1 4LEJA 3LSDA 2NMNA 5KHGA 2P2KA 4ATFA 4WZCA 1GFF2 3AP6A 3N9PA 2DU1A 2GSYA 5C5UA 5FTTC 4YM1A 2XBO1 3RPQA 4EWDA 4WVMA 3T08A 5LRSA 4Z8BA 3ZIWA 3KV5A 3HMYA 3JBG3 5FLJA 3VBRC 3T1MA 2FDIA 1FATA 2EVXA 2FDKA 5IUQA 2XUMA 1YO8A 4W6XA 1YQCA 4EYUA 4QQLA 3T3YA 3QH6A 1FT9A 1MQTB 4Q0UA 2BWAA 4K40A 4J1XA 3U10A 2YBKA 2NLRA 2XOMA 4FFGA 5L9BA 4CDXC 2LUWA 1XNAA 2ZCWA 1W8TA 1K5JA 3GBWA 1LOEA 2ORXA 3OJBA 1NUKA 4RFT0 3W20A 3SH3A 4YM3A 4PLOA 5FZDA 2QDNA 3D4KA 3RWKX 3WY6A 4G9SB 5LK5A 1ENSA 4TTGA 5I8TA 4AQSA 3VHRA 2WZEA 4DNYA 2WZR2 3GHNA 4G3YC 5A3TA 1QF3A 2JB8A 4AAPA 1TMF3 5EYYA 4NIIA 3VBOA 4GWIA 5I8YA 1HKDA 3UETA 1ND3A 5A3WA 1UXZA 1BQPA 1W2TA 2ID4A 1X82A 3OPZA 5I0DA 5JDBA 1SBFA 3WDUA 3FC0A 4FI9A 4PLMA 2VUJA 4GWNA 4FPEA 2UURA 1RL3A 2Y38A 4NHYA 5JSRA 1PMHX 3LD8A 4HPKB 4MV2A 3NO8A 1LEDA 1U5IA 2XDVA 4SBVA 2W08A 3TN93 3FUOA 1SPPA 3MPPG 3FL7A 4QPIC 4CUCA 2FBEA 3WV6A 2MEV3 1VBB2 2VOWA 4HN1A 1RUE1 2PLV1 3PVOA 1SLCA 1O4ZA 1SBDA 2Y6GA 1EAH2 3QACA 4BIOA 1TMF2 2UYBA 3NKGA 2LW8A 2Z79A 3GZTB 3AP7A 3IPVB 1UYZA 4MGIE 4YZ4A 4NPMA 1MVQA 4COWA 4EN8B 5EHDA 2I45A 5FK8A 3UT0A 4FAHA 1PK6A 2YYOA 1QXPA 2WRAA 4IV3A 5EIYB 3WNMA 5C5TA 3DKWA 4Q8KA 1AZDA 4FOQA 2YZ4A 1PIV1 3KHCA 2YV8A 4LKEA 1ASJ1 1QJU1 2BV4A 3ZYRA 3K4ZA 2Z5WA 3NJXA 5CADA 4BMBA 1GQHA 2ZJCA 4B1MA 1AJKA 4L97A 2BVBA 4FTSA 1NOVA 4LPLA 3MIBA 2FCTA 3AYCA 1JOPA 2IXJA 1NYWA 3A0NA 3RYKA 1DHKB 5SV8A 1F31A 5C3SA 2OZJA 5F2SA 3SHRA 3ZFFC 4QU1A 3WLUA 2PAMA 2IUWA 4NIHA 3H1YA 3HNMA 3LWCA 1DQ2A 1FPN1 2UWCA 5T5LA 1ZX5A 1VBA2 3DPRB 3JD73 4JGYC 1VMHA 4R9BA 5FO9B 2B5HA 3HBZA 2XJRA 4WVWA 5A7SA 3ZSMA 1JZ5A 3LF7A 3FE5A 1X36A 3SMHA 5LBFA 1GZCA 5JPNB 5FO7B 4YGDA 4ASMB 1IS4A 5T50A 3E6CC 1AR73 3OY8B 4HSLA 1W6QA 2CDPA 2DVGA 3I2FA 4QB6A 2N7GA 4MXWB 1W6PB 2WO1A 1SLLA 2LALA 4FPGA 3OBAA 2GH8A 2HYKA 4KGQA 1K5MB 1DF0A 2YGMA 1YRZA 2WZPP 1WMXA 2JE9A 1ULEA 3AM2A 1W04A 5ABJA 5BNPC 1AL22 3WNKA 1SZBA 5CG8A 4XHBA 4GH4B 4D8MA 1NCQA 2ZGLA 3C2UA 4RYDA 1O4YA 1DYPA 3ROUA 5KHJA 4Q5OA 4QX8A 2Y6JA 5C4WC 4U2AA 1G9AA 4IE0A 4DRRA 5EZWA 1DU3D 2QZ3A 3EHKA 4NWWA 4NIAA 1Z7S3 3FHQA 4MX3A 1R092 1S0BA 4XPVA 2VBDA 1H2KA 3PDQA 2RHPA 2ZHNA 4URTA 4CCKA 3S0MA 3AMHA 2XB6C 1W8ZA 4AK3A 4KH9A 4NUBA 1DCSA 2Q4SA 1SLBA 1KD7A 2A71A 3VBUA 3RG0A 1RUE2 5D8AA 3ZYPA 1KJLA 3K75B 4FFHA 3BCWA 2VR4A 1BEV1 1EY2A 4TYSA 4BQ3A 5D8AC 4Z2WA 5FO8B 1OUXA 4Q4W2 3WQBA 2AUYA 1IOAA 2HYXA 5IYYA 4DXSA 2GNDA 4WVVA 2OA2A 3IDEA 3RYPA 3ES1A 5CEHA 4XQ4A 4G4FA 1RUNA 2NPIA 1AXYA 1NE4A 5FDBA 1EPZA 4GZ9A 4XOGA 2VOVA 1UKGA 1O59A 1UQXA 3NJYA 5JOYA 1PGW2 4LBNA 3VUOA 1OH3A 2I07B 2JDPA 2W91A 1TNFA 1WBLA 4GJYA 3ZO0B 1E5HA 4ZXEA 3VBRA 2PTMA 3OBZA 4QQOA 1ALYA 3H3ZA 1K5MC 5K0UB 1FOD3 2ZAAA 2D3RA 1SLTA 4Q4Y3 1DGRN 1ENRA 1GQGA 4Y24A 4BJ0A 1MS8A 4CYDA 4EWAA 4BQ2A 5JMCA 1JYNA 2VZVA 2BOJA 4CU6A 2VPVA 5C71A 4NVPA 2YY1A 3WCRA 3A22A 1DYKA 4S2HA 2G4IA 4XMIA 4PT6A 3ACHA 4CDUA 4DUWA 4R9CA 4QHBA 3VL9A 1XSRA 5DAQA 5BNOC 2XVGA 2VZPA 1UOGA 3DL3A 5FK7A 1UU4A 2ZGRA 3LEMA 3ES4A 2VU9A 4LO5B 1XE0A 3ETQA 3JB4C 2EIEA 3E1F1 1R64A 4I30A 3RZLA 1F8VA 2Q0AA 5FIXA 3ZKUA 4BQWA 2KM2A 5DQ0A 2W46A 1APNA 4JQTA 1VMJA 2DVAA 5BNNC 2WNUB 2D43A 2PHXA 1UO9A 1OOPC 2O0OA 4CDUB 3PU8A 4UF0A 2YC2A 1YJKA 4GD4A 2FMDA 4P9GA 4UBGA 5T55A 3J7NA 4K21A 4OYUA 4UT5A 3VBHB 1CVNA 2GALA 5DG1A 5FWJA 2WS93 4OUSA 1BMV2 2FDFA 3D0JA 3POWA 4DXTA 2BERA 3KMHA 3B69A 3MLKA 4WM7B 2R7EB 4N9HA 5A7OA 2ZZQA 5CAZA 3GNEA 4MHUA 1WCQA 1AYM1 1W9YA 4FPLA 1S0IA 5JXHA 4CEWB 1N1SA 1FOD1 1JXNA 5FJHA 5FKCA 1XYNA 3A0KA 4QQ2A 2XGXA 5I0SA 4ZS3A 1RUG3 5CIRA 1WZXA 4ISRA 3VHNA 2ZGMA 4Q2FA 1R1ZA 2ERFA 1MVEA 3AB0A 3RGBA 2WNVC 2GN7A 1GP6A 1JH5A 1EP0A 1GYKA 4NJ4A 3VBFB 2ZMLA 1EV12 3OUIA 3ZFEB 5EJ1B 1CIWA 3Q8AA 1JZ3A 2OKXA 3VDDA 2NYYA 4R9AA 1G6NA 3THPA 2Y33A 2V4VA 4JDMA 3KV6A 5L73A 1OVPA 3VD4A 3R05A 3OGJA 4XURA 4ATEA 2YGLA 3L2HA 2I74A 3BVCA 4LR4A 2XJVA 4QDRA 4JTOA 4CEYA 3CDZB 4QX0A 3LEGA 1YQ2A 4V2VA 5FMOS 1R1A2 1HN1A 2JKBA 4OHWA 5A6XA 3CJIC 2B39A 5CKQA 4FP2A 3WDTA 2RMU2 2E7TA 5FQ0B 3R0RA 2X5IB 1U12A 2W39A 4LQRA 1U0AA 4XYXA 5GALA 4E27A 3O1VA 3KCCA 4CDUC 1HRI3 2R061 4V1PA 2B9VA 2WNUC 2XJTA 3IIAA 4LBLA 4MGKE 1EPWA 2JDYA 3JZVA 4I3PA 1HB2A 1WMFA 1JYIA 4C90A 1UYPA 3AMNA 1X33A 2WA4A 2HJIA 4ONUA 4OI0A 4COUA 4FP3A 4PHZA 2J1TA 3BGAA 3M7AA 4LK6A 5FPXA 1RUG1 3IDBB 2F6BA 2GC3A 4M0NA 3RVHA 3QLQA 4LBQA 4XBQA 1TE1B 4A3ZA 2B8MA 1YIFA 3RFRA 3NW4A 3B02A 4QXCA 2K0GA 1F2NA 3SNMA 3LDBA 5FUIA 1T6BX 1W8HA 5L9RA 2BYVE 4F7ZA 4QGNA 1RJ8A 3I7DA 4RQPC 2JG9B 3ME2A 1VRBA 5DAWA 4MGQA 2P4EA 2ZBJA 3WF0A 3ZLIA 1UZ0A 2MEV2 2VXRA 1ACCA 2JDHA 3OD0A 3V0BA 4PLNA 2ZEWA 4A7YA 3N7KA 4JKKA 4UW6A 3JU9A 4AHZA 3C7GA 2BGPA 1ZNPA 1QJX3 1OXCA 4GKXA 4HXCA 1R093 4YW1A 4CU7A 1A78A 2P3IA 5FPUA 1N1YA 3I2KA 3KSCA 4LULA 5BY5A 1CX1A 4AL9A 1S0EA 4XF0A 3I2JA 3ZSKA 3N9LA 1BCXA 1IKPA 2ATFA 1OA4A 3VDAA 1HXS1 5A7QA 3C7OA 3BB6A 2ZGQA 4XC9A 3AVRA 4D3WA 4Z82A 3H42B 4BQ4A 1SG3A 3ZN6A 1S0GA 2Z42A 3ZXGA 1GBGA 1TME2 4DUXA 1PO13 3BOPA 1DG6A 4UW5A 4W8JA 5GJ6A 4QB1A 3ZM8A 3VLBB 3MI8A 4E4DX 4KGGA 5DAXA 5JZGC 2WR9A 1PIV3 2CHHA 1NXD1 3AVSA 3BODA 4ITCA 3MLLA 4Q4V1 1ASJ3 1QJU3 3MFCA 1D4M3 1YUDA 4ZONA 1YCIA 4FTEA 2ZHLA 1FAYA 2JXAA 1LODA 3RZKA 3WG3A 1ZREA 1UOFA 1VBD2 3EMRA 3ZN6B 1UOJA 3ZX7A 1OQDA 5GM0A 1DQ5A 1JZ7A 3MUY1 1YJLA 1NG0A 1A8DA 4WM7A 4CRQA 3AL6A 4FO9A 1RHI2 3B3QE 4N7IA 2Q8OA 2O14A 2JE7A 4M3CE 2ZKNA 3IBMA 4HK9A 3AMPA 4IV1A 4JKLA 5C3QA 1ZZBA 4JGYA 2F4PA 1NAEA 4A41A 2Y8KA 2VQTA 3HPNA 4FOVA 4WV8A 5DDJ1 4D7SA 2BW8A 1COV3 3VZMA 2ZX2A 3J8F1 4CU8A 5IVFA 4CDQA 4IQPA 3KQRA 3BALA 3MUZ1 4IERA 4Q4W3 4B4RA 4YM0A 4AI9A 2YXSA 3QBQA 3ACIA 4P9XA 2BRTA 3ECQA 5FMBA 1W0OA 2W94A 3MZHA 2D98A 2OYZA 1UPSA 1QHDA 4JGYB 2VE1A 1PVXA 3K4DA 4LTAA 1HRI2 3ZFEA 3ZR5A 3WNOA 1DYOA 2RS32 4XE9A 1VBB3 2Z2SB 4X6RB 3EQEA 4R4ZA 5CA6A 5CBLA 4JTNA 5L19A 3GF6A 4DOUA 4EN6B 1TZOA 3IAPA 4TLGA 4NPRA 4DS0A 5A3PA 5CZKA 4LKSA 5A1AA 2PHFA 3FHIB 3OB8A 2QZ2A 4HVOA 4OQ9A 1D4M1 5AFBA 5KXEA 1VBC1 1LTEA 3NJVA 5T52A 1J1TA 1JZ2A 5JR2A 4XBNA 5A32B 2WLPA 1PO12 2CNAA 4XW3A 4ARYA 1WA4A 1UY4A 2JG8A 5FZ4A 5DZGA 3VBFC 1RUC2 3ZPOA 2W95A 3TWIA 1GNYA 3NV4A 3D6EA 3VZOA 2E7AA 4LK7A 2CV6A 3UL2A 5JAXA 1CZTA 5A3UA 2QKDA 4CEYC 3CQOA 4YM2A 5FFOC 5A6YA 2VG9A 4OCTA 5FXVA 3WDYA 4XEZA 4FFFA 1COV1 1YC61 2PFWA 3SQOA 2W52A 4RFRB 3VDDC 4YNIA 1QJY3 4Q4V2 5A32A 5LA1A 2WT1A 2HWC1 4FPKA 4IESA 2PHDA 3IIIA 3CIHA 1VBA3 3JD72 4XFIA 4HG6B 1W8UA 1LENA 2EAAA 3BIEA 4EZHA 4P02B 3N3HA 1RUE3 4UFLA 3NRUA 3TEXA 3UGFA 4NWVA 1RUJ2 3N9NA 2EAKA 1MEC1 4NR1A 5FP9A 4QGLA 1VIWB 1W9FA 1EYBA 4XXAA 4XF9A 1D0GA 1AHSA 5KC6A 5LBBA 3MIEA 5FZEA 4E8CA 4U36A 1FV3A 4UFMA 1QH6A 1XXNA 1SFPA 2VZOA 2VZRA 4E9KA 4RN5A 5BXXA 3DYOA 2YHJA 1SACA 4OZOA 3I2HA 4XF4A 3WP5A 4M01A 2CSGA 3TEWA 4XDPA 2ET7A 2IXHA 1H1IA 3DGTA 4GQ7A 3AZZA 1KDKA 3LEKA 3HJRA 2WT2A 1XQNA 1K3IA 1AL23 4Q0PA 3RJ2X 1N3OA 5IAVA 3VBSA 1BEV2 1RGSA 5FY8A 3OG2A 3MICA 1RUD3 1F4AA 3HT2A 2HWD1 1MEC2 4IEWA 2QQPA 2E32A 4BQXA 1NCRA 4TXWA 2RR13 2FDJA 1A8MA 3AK0A 3MW2A 3S5QA 3LFMA 3RWNA 1ULPA 2GMPA 5J37A 2D6KA 2XH6A 2VNRA 4LLOA 5JVVA 1STMA 4E4ZA 3N4MA 2HBUA 4YVSB 1WLWA 5DPNA 5F3EA 5FP8A 2VZTA 1H0BA 1QJY1 1LJ7A 5APAA 4S2DA 1YLLA 2HWC3 4OHVA 3UK9A 5C3PA 4JQRA 4BLJA 1HJFA 1LHUA 1IKQA 4IEPA 3GALA 5I93A 2VULA 1WD3A 1QOTA 1NCRB 3LOIA 2XJUA 5HV4A 1OC1A 1O8SA 2F17A 2VTXJ 1AYM3 2VUCA 1E5IA 3MW3A 4UFJA 1H1MA 2OIIA 3OY8A 2XVKA 4M3CA 2VO5A 5GZDA 3UKTA 5GZEA 3I54A 1LAJA 1YQ6A 4GMP0 2GH2A 4EJRA 4BK5A 1VBC2 4OI1A 2A7AA 5IVYA 4FAGA 2EALA 1K5MA 1PM7A 1DQ1A 4CXYA 3L2YA 4FCAA 5JZGB 3O1TA 4N53A 2ZAHA 1W03A 5BV6A 3ZYJB 1OF3A 1QJX2 5AC92 2ZHKA 1URXA 2RS31 3F95A 1NCQB 2F4LA 5FZOA 5J7MA 1WMDA 4XF3A 4DEQA 1HW5A 3I2GA 1RUD1 5KXBA 1AYM2 1W6OA 2ZX3A 1V6OA 4IDZA 5FYUA 3U07A 1H2LA 2FQPA 4XIOA 5DAPA 2HWB3 2E6VA 5FXXA 1H1AA 1VJ2A 4COYA 2CL2A 4CCCA 4EN9B 4D94A 2QQUA 3FJSA 5DMYA 1FXZA 1LU1A 2VNOA 3N35A 2E63A 2WBKA 2ZX1A 4LE3A 4MZUA 4AQTA 4GMP3 1MPXA 1J84A 5FYMA 3IDCB 2IFWA 3VBUB 4XUTA 1PIV2 5FZOB 3F2ZA 1LEMA 1QNWA 1NT0A 2WABA 3TYJA 2BGOA 5C8CC 3LPGA 4X8PA 2PQSA 1B35B 2FHRA 1ZBE1 3RJRA 3VBOB 5LB6A 1IS3A 3POFA 1HRI1 4B3NA 2XVLA 4TN7A 4XVHA 4CPBD 3ST7A 3OYWB 3S7EA 4NHMA 1EV13 4RS5C 1S0JA 4BISA 1GLHA 4NHXA 3H1MA 3KGZA 3OF1A 1NLQA 1RUH2 2VVDA 4DINB 4CVUA 4YVWC 5IK5A 3MIDA 3WDWA 3GXUA 4BB3A 4OMDA 3UGHA 2C1FA 2QTWB 1BKZA 4BIFA 5FXZA 2EXJA 3K3OA 1WD4A 5M0TA 4L0PA 2R32A 1W90A 5H9RA 4PF1A 5LW9A 4CTEA 4HETA 4GH4C 2XKOA 2ZGOA 5HCFA 1OBNA 3O1RA 3H8UA 3L9JT 3GZEA 1GWKA 1J58A 1Q8VA 3THTA 4OULA 4LA2A 1OFSA 2E53A 1XC6A 4NN0A 5D21A 3WF1A 1R083 3GJAA 5L7OC 5ISLA 4H14A 4DEVA 3RZHA 1ZVFA 1FMD2 1GOFA 2WO7A 4B29A 5FYYA 1O3SA 3WOGA 1Y43B 1RUD2 1JUIA 1SLAA 2G9FA 3HN1A 1GZ9A 2ZGNA 2Y6KA 5E8AA 4A6SA 3ZXKA 1VBD1 2TEPA 5HCAA 2VJXA 3ABZA 4OI2A 5EJ3A 1QJX1 3AKTA 3SKJE 1HLCA 2WNVA 2WAOA 4HVRA 3PJQA 2RM23 2A6VA 3DEMA 1SEFA 4BH9A 1Z0HA 1MS3A 2C0ZA 1D7PM 3KHBA 3AKRA 3M3CA 2J1UA 1NA1A 1DGLA 2O8QA 4LMFA 4D0QA 3N7LA 3LIGA 3U4SA 3SH4A 1LOFA 1ZZ6A 3IMNA 3V64A 1JYXA 1V00A 2JIGA 2XONA 2FZ2A 1PZ9A 3WW1A 3LE0A 2PAKA 5JXJA 1Q8QA 4MG2A 3RZMA 3RDIA 2X05A 1UY2A 4HONA 4NRMA 4Y4RA 2G1MA 3WUCA 4MH0E 3AP5A 2WNVB 1HX6A 5FLIA 4QXKA 2LM3A 1F15A 4HKLA 4JAAA 3HOBA 2A3YA 4W65A 5FZFA 1ULDA 1MS9A 2ES3A 3O0WA 4GWMA 1NQDA 1U5YA 2RDNA 3ALQA 4P9JA 3PHMA 2QQKA 2VVEA 2WFPA 2Y60A 3AZVA 1US2A 3M8LA 4Z1VA 4ISQA 2GU9A 4P00B 1UZVA 4YW3A 1QU0A 1ZA4A 3HNBM 4AEDC 4CEWC 1WLCA 4QPIA 2VMGA 3AKSA 4GIQA 4Q0SA 4JCKA 1GUIA 3T0DA 2RS53 1QDCA 2Y0OA 2R062 3WNLA 2ADEA 2WZR3 5HBAA 2CTVA 4L92A 1GWMA 3VD3A 3VBFA 2WAAA 2QQLA 2FDHA 3O5SA 1ULFA 1HV0A 2R49A 4RGGA 4MXWA 2P3YA 1R1A1 4R8HA 3AC0A 1K42A 4XFFA 2Q1FA 5CG9A 3MV11 2BOIA 4IEOA 4BU2A 2VMEA 1CJDA 1IG3A 3WP3A 5LA9A 4AXOA 5T3NA 5BNQA 4I2OA 2VOKA 4YSFA 1JU4A 1FNYA 1QJEA 1IPKA 1W05A 4ZZ8A 4Q4X2 1AF9A 3I4IA 2WNOA 2BP6A 4XJAA 3B9CA 2VD7A 1PZ8A 5FZGA 3S5AA 1NY72 2WYSA 4C1WA 4P08A 5FY9A 3HEIA 4I0BA 5FPZA 3Q8CA 3S30A 3ZSLA 5CFCC 1UD1A 1PHMA 3MIGA 1OI6A 3AFGA 3HQXA 4KWKA 4WM8A 2CWMA 1Q8SA 2QQMA 4XDQA 2R0FA 1QKQA 4XDOA 1J1LA 1W6PA 2VUAA 5AC93 2L9LA 2YDEA 3OCPA 3TEYA 2YPDA 5CB7A 2HWE1 2YFZA 3KQ4B 1O3TA 4W6WA 4WM8C 1ASJ2 1HIXA 1QJU2 3WQ0A 3FLPA 1BK1A 3DYPA 1NCQC 3RRDA 5ABJB 3DCQA 1HRV1 5JPMB 1WLTA 5BNPA 5ABJC 1S0CA 3P1IA 4GALA 4LO7A 1RIRA 4QPYA 5K0UC 2RJ2A 5JSPA 3PVEA 2BUKA 2DCYA 3VB9A 2RS51 4Y20B 3HWJA 4K3UA 2D93A 4PDWA 2PHRA 1DFQA 4RQPB 4K6BA 1MQTA 1R082 1RUC3 3OBTA 3OYWA 4HKOA 4QB2A 4E2GA 4UFHA 1RUF2 2R0HA 5E89A 4MXVA 3RZJA 3MGUA 4Y5SA 1DZQA 1XNBA 2VMHA 5DXDA 1UZYA 4AVTA 4HBNA 4ZKTB 5F7UA 4N7UA 2BFUL 4Y4YA 1D4M2 1XPWA 4WVMB 1UU5A 4CP2A 5B2GB 4AHXA 2A1XA 3GYDA 2XJSA 3PTYA 1YFXA 2FCVA 2TNFA 4N43A 1RUF3 5FZCA 4M3CF 2ARAA 3KT7A 3PIGA 4LKFA 3ACGA 3EBRA 4A2UA 4CCLA 1LOGA 1V6KA 2QQWA 4B4PA 5L9VA 4FBFA 3OPTA 3JUUA 4RQPA 2RG4A 1MEC3 4FT8A 4RSUA 5HXVA 4BXFA 3POBA 5JOZA 3B7MA 5H9QA 4GB31 4LUMA 2ZGSA 2A70A 4AI8A 1AJOA 5AC91 4GAZA 2A73B 4AGRA 1WW6A 3LKJA 1AL0G 4NIGA 4AGVA 3T0AA 4K20A 1AUYA 1V0AA 3O0XA 4LKDA 5CFCA 3LA3A 1IZ3A 4Q8LA 4QD2A 5FZIA 3ZMOA 4QDSA 4RA0A 1XBFA 4UYBA 4ZZ5A 2O8OA 4UFIA 2GC2A 1RXGA 1PVC3 4XQDA 4OZXA 4IV3C 5LATA 1CAVA 3FBYA 1PK6C 2IXCA 2BBVA 3VZJA 3QH7A 3GGLA 4EV0A 3MO4A 1ZRRA 4IEYA 5C8WA 2VUDA 2ZPXA 4XABA 3WG2A 1AXKA 4ET7A 2DUQA 2HWD3 4EE2A 2V4AA 1QDOA 3B5LB 1EAH3 2EXIA 1SHWB 3KCYA 2GC0A 3CF6E 3BTAA 4ASKA 4PQ9A 2VBBA 1S55A 5D1IA 1ZM1A 2JENA 3ZYGA 3MW4A
chains in the Genus database with same CATH topology
1W90A 3ZYHA 1WZXA 2K46A 4BQ2A 4CPBA 2C24A 1V0AA 4LKDA 2Q1FA 4LKEA 2LROA 2VXJA 4YWAA 1W8TA 4CP9A 4AL9A 4YW6A 1GWKA 1L7LA 3F95A 3ORJA 1W8UA 4LKFA 4CP9B 1UOJA 1OKOA 1OH3A 5D21A 4LJHA 4CPBD 1W8ZA 4BQ4A 1W9FA 1HN0A 3ZYBA 2LRPA 4LK7A 1WMXA 2O14A 3UT0A 1GWMA 1GWLA 2WYFA 4YW7A 4BQ5A 4A6SA 2KR2A 1WCUA 1W8WA 4BQ3A 2JWPA 3ZYFA 4LK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W90 A;  3ZYH A;  1WZX A;  2K46 A;  4BQ2 A;  4CPB A;  2C24 A;  1V0A A;  4LKD A;  2Q1F A;  4LKE A;  2LRO A;  2VXJ A;  4YWA A;  1W8T A;  4CP9 A;  4AL9 A;  4YW6 A;  1GWK A;  1L7L A;  3F95 A;  3ORJ A;  1W8U A;  4LKF A;  4CP9 B;  1UOJ A;  1OKO A;  1OH3 A;  5D21 A;  4LJH A;  4CPB D;  1W8Z A;  4BQ4 A;  1W9F A;  1HN0 A;  3ZYB A;  2LRP A;  4LK7 A;  1WMX A;  2O14 A;  3UT0 A;  1GWM A;  1GWL A;  2WYF A;  4YW7 A;  4BQ5 A;  4A6S A;  2KR2 A;  1WCU A;  1W8W A;  4BQ3 A;  2JWP A;  3ZYF A;  4LK6 A; 
#chains in the Genus database with same CATH topology
 3HVD A;  2WSV A;  1HB4 A;  4KWJ A;  5CNA A;  2RDS A;  3IKW A;  3ZYH A;  4CDW C;  3GDB A;  3HAG A;  5EP9 A;  5F6K A;  4MUV A;  3IPV A;  2AZ5 A;  3AYD A;  4JZR A;  4Q4W 1;  2ZAB A;  5GLU A;  3ZIX A;  3N7M A;  1XOY A;  4HOO A;  3DPR C;  1GAN A;  1C1L A;  1QH7 A;  1WW7 A;  3MEP A;  3TN9 1;  1WCS A;  4CCO A;  1G9B A;  1K12 A;  4K9S A;  1H9W A;  5JI9 A;  2MEV 1;  1DBN A;  2B45 X;  1NKG A;  2RR1 2;  2UU8 A;  4JX0 A;  3KVA A;  1CAX B;  1W99 A;  1SQ4 A;  4GB3 2;  3VDD B;  1BJQ A;  3LOB A;  5LBC A;  2PYT A;  1TME 1;  2I2S A;  5EYX A;  2V73 A;  2PHL A;  4DZG A;  2DFB A;  2LRP A;  2YU2 A;  1UXX X;  4B1L A;  1EUT A;  1POQ A;  4W6Y A;  3APB A;  2KA3 A;  4YW7 A;  4XBL A;  4IW3 A;  3WW3 A;  5FRA A;  3AZX A;  5HCB A;  4HK8 A;  2NN8 A;  3MBW A;  5KBF A;  1XJA A;  1GZW A;  4FPY A;  4DY3 A;  4JHT A;  1ODM A;  2UY8 A;  2JX9 A;  5FZB A;  5FV3 A;  4YYO A;  4LUK A;  3DXT A;  3NQH A;  1C5H A;  3T2O A;  1YQ5 A;  2XL9 A;  5FYI A;  1VRH 1;  2RS3 3;  4FOW A;  1LCL A;  5BNN B;  1LKN A;  5T5J A;  2XXZ A;  5FZM A;  4C8D A;  4XUN A;  1NXM A;  2XWB B;  3DN7 A;  2PXJ A;  4OFG A;  5LRR A;  1LHN A;  2PN5 A;  3I49 A;  3E5Q A;  1HB3 A;  2HWB 1;  2A75 A;  4MGZ E;  5BUV A;  1ZRI A;  1ZZ9 A;  1JU3 A;  3KS7 A;  4YW2 A;  2W1Q A;  3ZR6 A;  5A3M A;  2O1Q A;  3N9Q A;  5FJK A;  2VTF A;  3JD7 1;  3SEE A;  4DXR A;  2PQQ A;  4XIK A;  2WS9 2;  2DU0 A;  4RHV 2;  2X5I A;  2YFU A;  4LBQ B;  4O7X A;  3LSE A;  3NNG A;  4ZS2 A;  4DMI A;  1Q56 A;  1BBT 2;  3CKH A;  1AR9 1;  4AQ6 A;  5JUV A;  4HSJ A;  4PQQ A;  1HQN A;  3WDV A;  3WNX A;  4QHZ A;  3H8O A;  5BNN A;  3SC7 X;  1JOJ A;  1ULO A;  4KNC A;  2VCB A;  4FQ4 A;  1W6M A;  1PO2 1;  1H8T A;  1POV 3;  1VBA 1;  2HWE 2;  3P3P A;  4ORF A;  1FPN 2;  1N3Q A;  4IE4 A;  2JG9 A;  3WNP A;  4LIV A;  1QJZ A;  1RUI 2;  2C9A A;  4YZ5 A;  1UY1 A;  1AVB A;  3V0B B;  3EXU A;  2X53 S;  1EV1 1;  2QJV A;  1G86 A;  5FWE A;  2XL7 A;  4IEX A;  4CP1 A;  3U0Z A;  4QPG B;  1GNZ A;  2OZ6 A;  3UJO A;  4CCJ A;  1W2A X;  3I2I A;  2JDN A;  1U5Z A;  3JXS A;  3ETP A;  1LOA A;  4I0A A;  1YFU A;  4Y3O A;  3KGL A;  3CL1 A;  5DUX A;  2VQU A;  4LO6 B;  1OMI A;  2R04 2;  5ANQ A;  4JRL A;  4MHR A;  1XSQ A;  3DUI A;  1GP4 A;  4LOS A;  4BZ4 A;  1RUO A;  1WA6 X;  2EF6 A;  1VRH 3;  2DCT A;  4RHV 1;  1UF2 C;  5FMO L;  3LIH A;  2DUR A;  2C9K A;  3G7D A;  4XFA A;  5A80 A;  2CGP A;  4XQW A;  4QX2 A;  1DGR A;  3N9M A;  1U5X A;  2D7F A;  1E57 A;  2WQ8 A;  3KM5 A;  1ZZC A;  2J1R A;  1GIC A;  2RR1 1;  4OHX A;  5KWR A;  3ZDV A;  1OT5 A;  4R4X A;  5IHR A;  5KHK A;  3O1M A;  1BEV 3;  1LB2 A;  1BMV 1;  2WFF 2;  2P17 A;  4C91 A;  5TSW A;  3C3V A;  1NCR C;  5FCC A;  2C24 A;  2RM2 1;  2DVD A;  3AFK A;  3B93 A;  1BBT 3;  1CIY A;  2BJS A;  1JBC A;  1O6U A;  4FQZ A;  1PNG A;  2YG0 A;  4QAW A;  5EV7 A;  5F5A A;  1AR8 2;  2BPA 2;  1G7Y A;  5CFC B;  3TNP B;  3I2O A;  3B01 A;  4BE3 A;  1YFY A;  3GCX A;  3LZZ A;  5FYT A;  3SH5 A;  1VLN A;  3O1P A;  2R07 3;  5LEK A;  3QD6 A;  4I01 A;  3GJB A;  1RXF A;  4QXB A;  5KR7 A;  3U14 A;  4YRD A;  1LGB A;  1CZV A;  1HB1 A;  2W92 A;  1GMM A;  1H8V A;  2GAU A;  4K1Y A;  5C33 A;  4MYE A;  1AR6 1;  1Q8O A;  2BNM A;  2BFU S;  3LGR A;  3WQ1 A;  3WG4 A;  1LHV A;  3VD7 A;  1W6N A;  2Q8C A;  4QXH A;  3LB9 A;  5T5P A;  1CPN A;  1OD3 A;  1WKY A;  2C26 A;  2UYA A;  4N8M A;  2R16 A;  3ZXJ A;  5JOW A;  3J26 N;  3Q9O A;  2G9Z A;  3C7H A;  4Q26 A;  1O7F A;  4QKF A;  3T4H B;  1X7N A;  3RI8 A;  3V56 A;  2QQV A;  5A3N A;  1RYY A;  4AWD A;  4OQ8 A;  5C6C A;  4J6G A;  5CKN A;  5FZ9 A;  4ARX A;  2WL1 A;  1CJP A;  1YFW A;  3RSJ A;  2VNG A;  1KS4 A;  3B9I A;  2W5F A;  2IXK A;  3CJI A;  3BOW A;  3POS A;  4M4R A;  4O61 A;  4K8R B;  4X6Q B;  5A3L A;  4LE4 A;  3UJQ A;  3KLS A;  1RJ7 A;  2WZR 1;  3CEW A;  3OTF A;  4XAC A;  2R6Q A;  5E1R A;  1S0F A;  2RDQ A;  3ATG A;  4UAP A;  4PIX A;  5ANN A;  2JKX A;  5JSO A;  4NRP A;  1R1A 3;  1C8N A;  4GMP 1;  3TOJ A;  3IM0 A;  1I3H A;  3QOP A;  5FZ6 A;  2JG8 B;  2H6C A;  4LLF A;  5LAS A;  3FFQ A;  1LRH A;  4COV A;  1Q43 A;  1WLD A;  3AMM A;  1VBE 1;  4AI0 A;  1JHJ A;  3BPZ A;  1C4R A;  1IG0 A;  4RGK A;  5F3G A;  1AR6 2;  3BKZ A;  2P37 A;  3HQU A;  3VHO A;  1YWK A;  3D8C A;  4QKB A;  1V70 A;  3U4X A;  2B46 X;  1C8M 2;  4IGP A;  4RR3 B;  2W0X A;  2AGS A;  4N90 A;  1UAI A;  4K7J A;  1V9U 3;  4RR3 C;  4Y26 A;  4AHW A;  1ND2 A;  1A6C A;  2VZ3 A;  4OHZ A;  5CFD B;  1ZRC A;  4CEY B;  2CY6 A;  4Q0Q A;  4GXL A;  1PGS A;  3OPW A;  5FZK A;  2D3P A;  3HD8 B;  1VB4 A;  2HWE 3;  5F6L B;  3D3A A;  2QQI A;  3WHT A;  1P8J A;  3AXE A;  3ZFE C;  4AI3 A;  1I6X A;  2RJK A;  3AL5 A;  4Y22 B;  5JI7 A;  2FZ1 A;  4YFZ A;  3KT4 A;  1MAC A;  1MS1 A;  2VMI A;  4H7M A;  5FUN A;  5A7W B;  3CHX A;  1WCK A;  2ZA9 A;  1QQP 2;  3R4S A;  1Y4W A;  5ACA 1;  5FYS A;  5GLW A;  1N1T A;  2HEW F;  4LJH A;  4OUM A;  4WVZ A;  5FZA A;  4A7K A;  1H30 A;  1GP5 A;  3T2Q A;  1JZ6 A;  3AP9 A;  2HKX A;  4YZ2 A;  3OD4 A;  5EPA A;  4QX7 A;  4ES8 A;  3TRS B;  4CSW A;  2DUP A;  1UMZ A;  1XYO A;  2G9G A;  3ILR A;  4QPG A;  1UU6 A;  5CVR A;  2SBA A;  5C3O A;  2Y6F A;  2B7Y A;  3IN9 A;  4S2F A;  2VW0 A;  1L3J A;  5F9T A;  4AHY A;  2ZX0 A;  4J1W A;  1PMJ X;  3RI9 A;  2WJS A;  4LBQ D;  4LOR A;  2B42 B;  5L7O A;  3LAG A;  4PF5 A;  1Q3E A;  1VBE 3;  3PVN A;  1W9T A;  4P14 A;  1MQT C;  1QGL A;  3URF A;  1B35 C;  2QDR A;  1FNZ A;  4JRA A;  2R06 3;  3MIH A;  4YG6 A;  4BHP A;  2VZQ A;  2BEO A;  3TAY A;  3WVJ A;  2ZGT A;  4D7T A;  1V9U 1;  3ELN A;  5JIU A;  1ZBA 1;  1NY7 1;  4M00 A;  2E51 A;  2ZEZ A;  3NV1 A;  2TBV A;  2GNM A;  1VRH 2;  4ZU5 A;  2VMC A;  3OEB A;  2DBN A;  4LHL A;  2Z4F A;  4OUE A;  3W59 A;  4XCB A;  5I91 A;  1N3P A;  1YEW A;  4LBK A;  1I9R A;  3W5N A;  4CPB A;  2J1S A;  3M1H A;  2R04 3;  5DZE A;  5A1F A;  1JI6 A;  4P9I A;  5JXG A;  2IVI B;  2UWA A;  3MPB A;  1H6X A;  4QQP A;  5K8S A;  2LS6 A;  4LXL A;  1W0N A;  1L7L A;  2ZMN A;  2PHW A;  2YU1 A;  5IK7 A;  3Q8E A;  4FVV A;  1K45 A;  1BVP 1;  2J1A A;  1KEX A;  3NNF A;  3AJY A;  2QUO A;  2AEN A;  2YC0 A;  4E2S A;  1GV9 A;  2RS1 2;  3THC A;  3VBO C;  2KD7 A;  4TSV A;  1EAH 1;  2IXI A;  4DPN A;  1JYT A;  3ZFG A;  4LT5 A;  1HDK A;  4PI0 A;  3NJZ A;  4ERO A;  2AEY A;  3HNY M;  1RB8 G;  2IXL A;  2P1B A;  2J7M A;  3PVB B;  2ORZ A;  4MOA A;  1KFX L;  1QEX A;  1QQP 3;  2A3X A;  1WBF A;  4HT1 T;  1W8N A;  3VBU C;  1WW4 A;  3VZK A;  2DCJ A;  1OPM A;  2HEY F;  2Q1M A;  4IE6 A;  5FOB B;  5I0R A;  4V2W A;  3VKM A;  5A6Q A;  5GLZ A;  2R30 A;  2DBI A;  2Y0I A;  3FLT A;  2H0V A;  5C4W B;  3ENR A;  2JDA A;  5F3I A;  1W6O B;  3ORJ A;  3K2O A;  4DQA A;  2VBP A;  4LNV A;  3A23 A;  3C7E A;  1JYV A;  2C5D A;  3WEZ A;  1AYN 3;  2RS1 3;  2VCA A;  2DV9 A;  3PUI A;  4N53 B;  4WZF A;  3SIS A;  5J48 A;  2E9Q A;  3LPF A;  5JWP A;  2PHU A;  1KS5 A;  2PLV 2;  1A34 A;  3LDK A;  3E5X A;  3MYX A;  2OT7 A;  1O91 A;  2X8K A;  1W8W A;  3P5B A;  4HLT A;  4JKM A;  2B9U A;  2Y34 A;  1IS6 A;  3WDX A;  4CXW A;  3AMQ A;  4GJZ A;  1KFU L;  4XFB A;  3RMY A;  2NP0 A;  2VC9 A;  2VH9 A;  3CNA A;  2XG3 A;  5I0T A;  2DF7 A;  2AAC A;  2CU5 A;  3FFZ A;  5EFU A;  5LA2 A;  2CDO A;  5D2A A;  3ZN5 A;  4KMQ A;  3M4F A;  2YBS A;  3N9O A;  5G05 L;  2ETE A;  5H9P A;  4C0H A;  5BYN A;  2ENR A;  1X8M A;  4YZ1 A;  3AYA A;  2XQR A;  4IL7 A;  4MGS A;  1HN0 A;  1OKQ A;  3A4U A;  2VOX A;  1HQW A;  4K8F A;  1OA3 A;  4YW5 A;  1S1A A;  1YQ8 A;  2C6S A;  3FUQ A;  2QNK A;  4DUV A;  1VR3 A;  2OW4 A;  1OQE A;  1UZZ A;  2HEV F;  2EIB A;  2ZHM A;  4LBM A;  3THD A;  3ZXF A;  1ZZ7 A;  1AR8 1;  2ARB A;  3ASI A;  4KU7 A;  1MS0 A;  2K46 A;  4GKY A;  1BLZ A;  3CJX A;  2QQN A;  2RM2 2;  3J8F 3;  2NM1 A;  4PDW B;  3WD5 A;  2B4K A;  3I3B A;  4FFI A;  4BYY A;  4A42 A;  4KBB A;  2X5I C;  3K4A A;  3K77 A;  3M70 A;  1SFY A;  4IET A;  2V5D A;  3NWK A;  3I3Q A;  5FYZ A;  4KG0 A;  1SDD B;  3KVB A;  1JHN A;  3H7Y A;  1H6Y A;  3OEA A;  3PL0 A;  2HLE A;  2PLV 3;  1H9P A;  2RS1 1;  1RVF 1;  1XNT A;  2P5B A;  1GKB A;  3OOX A;  2VVF A;  4QWN A;  1O5U A;  1QXR A;  1SPP B;  4L99 A;  4OLL A;  2WYF A;  1G8W A;  3KB5 A;  1XB9 A;  3O0V A;  4Q4X 3;  2ZXQ A;  3ZFF B;  2OQ6 A;  3RZG A;  4UI9 L;  3PUH A;  1ULG A;  5A3O A;  1I5Z A;  1UMH A;  2HWF 2;  2W68 A;  3BPS A;  1BHG A;  3ZSJ A;  2A6X A;  1KGY A;  5I8S A;  1Q5O A;  4AW7 A;  2YRO A;  2WO3 A;  1OLQ A;  1VBC 3;  2OPK A;  4HAN A;  2JEC A;  4YWA A;  3USU B;  2CAV A;  5DDJ 2;  3ZYI B;  5IFT A;  4AOC A;  1IS5 A;  3WSO A;  1W9S A;  4BOW A;  1NZI A;  5FYC A;  1X50 A;  4BPZ A;  3BU7 A;  4BME A;  5FOJ B;  5FUP A;  3MF6 A;  1ENQ A;  3MFA A;  4XFH A;  2FDG A;  3SIT A;  4XHX A;  4IND A;  1RUI 1;  4QDQ A;  4BDV B;  4P5Y A;  4YGB A;  3NNJ A;  4TWT A;  1Y9Q A;  1BXH A;  1YYN A;  3GBG A;  2QBX A;  3WCS A;  3I59 B;  4Y5T A;  1UY0 A;  3ZYF A;  4NAM A;  3TEZ A;  2BDR A;  4IV3 B;  4B4Q A;  4UFK A;  3M3E A;  1I5P A;  4ZPI A;  1YXW A;  3AZW A;  1SMV A;  1BBT 1;  1DLL A;  3V0A B;  2EXH A;  3Q8B A;  1LHO A;  3WF2 A;  4CXX A;  4EWE A;  2Q8E A;  3JCI A;  2JG8 C;  2A6W A;  1AR7 1;  2YC4 A;  5FY5 A;  1SLI A;  3W21 A;  3POY A;  4AZZ A;  5DAB A;  5FBZ A;  2E31 A;  4CUA A;  1RUH 3;  2R07 1;  1JOD A;  1YNA A;  4QT6 A;  3DF0 A;  1CAW B;  3M3Q A;  4W50 A;  1TME 3;  1DZT A;  3J7L A;  2ZKL A;  5FXW A;  2EIG A;  4IEQ A;  3AKQ A;  2ARX A;  3ZPY A;  4BQ5 A;  2XJQ A;  4YVS A;  5JXI A;  3KWV A;  1RC6 A;  4UXA A;  3O7O A;  4YGC A;  1GOG A;  4A3X A;  4AAX A;  1T6G C;  1CAX A;  3GM8 A;  4Q4X 1;  1QXJ A;  1LU2 A;  4EZ4 A;  4UW3 A;  1A3K A;  5DUV A;  1OLR A;  2JDK A;  2NMO A;  5FYH A;  1JS9 A;  4Y1X A;  4A7Z A;  3N36 A;  1VAV A;  5FZH A;  1F9K A;  1CAW A;  4XJZ A;  1JZ4 A;  4L2N A;  5KHH A;  3KD4 A;  3E6D A;  5BNO B;  1X8E A;  3P3N A;  4E4S A;  1WWY A;  2WUH A;  1OLM E;  1C8M 3;  1KQR A;  2HWB 2;  2QE3 A;  4NHL A;  4M3C B;  4UW4 A;  3PLQ A;  1RUJ 1;  5DAV A;  4CCD A;  1US3 A;  1F4H A;  2CAU A;  4QGM A;  1BZW A;  3M3O A;  3ZDS A;  4AEM A;  1CGP A;  1CX4 A;  3EYP A;  3NAP A;  5EQU A;  5AVA A;  1S0D A;  5A7N A;  5C70 A;  5FMC A;  4CUG A;  4DB5 A;  5FR3 A;  4IEU A;  1Z7S 2;  3SCF A;  5EWS A;  2RE9 A;  2XJP A;  4H7L A;  1JMU B;  2DTY A;  1FYU A;  2LRO A;  2YMZ A;  2WFF 3;  3BU0 A;  1XE7 A;  1O8P A;  3OUJ A;  3SLI A;  1RIN A;  3UES A;  4LIT A;  4AFB A;  3H3L A;  2LTN A;  5C9A A;  3NNL A;  3AXD A;  4FPC A;  4XZP A;  4AF9 A;  4AVC A;  1IPS A;  4Z2A A;  1DQ0 A;  2XWJ B;  1FMD 1;  4PCR A;  3T09 A;  4QM9 A;  1BK0 A;  3OGR A;  1H4G A;  4I09 A;  4YLZ A;  4DRV A;  3WF4 A;  1PNF A;  1H8T B;  1UIJ A;  5FP7 A;  3UYJ A;  2GP5 A;  4AEK A;  4C1X A;  2VQ0 A;  4PBP A;  1JTZ X;  5K4L A;  4Q4Y 1;  1OSG A;  2GC1 A;  1C1F A;  4XMA A;  2YUE A;  3ILF A;  5D8A B;  4CCN A;  1WCD J;  3J7M A;  2EIC A;  2WDB A;  2HWC 2;  4N43 C;  1MZE A;  3TN9 2;  3CMG A;  3I3D A;  2W1W A;  3MHZ A;  4N43 B;  3BTZ A;  4OVE A;  3AX4 A;  2BWC A;  1EUU A;  1F5F A;  4XZU G;  2WIN B;  4CP9 A;  2V72 A;  2VW2 A;  4FPJ A;  5ACA 3;  2QFE A;  3HN3 A;  3KV4 A;  4LBO A;  4ZY9 A;  2VQA A;  5C9A C;  1UPI A;  5J96 B;  1XRU A;  2D5F A;  4Y5Z 0;  1O3Q A;  2UY9 A;  3I3M A;  2JDU A;  4PJY A;  5DUU A;  2KXL A;  5LY1 A;  2JE8 A;  2GP3 A;  4QU2 A;  3MDP A;  2NQY A;  4UBH A;  4Y1U A;  1CAU A;  3HR9 A;  4AEJ A;  5BNP B;  1UIK A;  3O14 A;  3SKV A;  4XXP A;  4NRQ A;  1ODN A;  3VKN A;  1PVC 2;  4XUQ A;  3HT1 A;  1Q8P A;  1OF4 A;  3J8F 2;  5LBE A;  2WII B;  3VHP A;  3ZFF A;  1QNY A;  4QX5 A;  3A21 A;  3T4V A;  4NMI A;  2FCU A;  3I3E A;  2WFF 1;  3R4D B;  3I2D A;  4NRO A;  1TVG A;  4XFG A;  2BU9 A;  3LA2 A;  4XF1 A;  3USU A;  4BQ1 A;  1RHI 1;  3CZU A;  1GZT A;  4CA9 A;  1CAU B;  3WT3 A;  1LEC A;  5IVV A;  4HPK A;  4QPW A;  3ZVX A;  5A70 A;  2VAU A;  4DO0 A;  1RVF 2;  5AFE A;  1ULC A;  4AED A;  1AR6 3;  4A4A A;  1J3P A;  1DQ4 A;  4LA3 A;  1O5L A;  1QY4 A;  2RMU 3;  2YPJ A;  3IZO A;  3PME A;  3RQ0 A;  4H3W A;  4Z07 A;  4HN0 A;  2R04 1;  3UKV A;  4NPL A;  5B4N A;  5GLT A;  4TLF A;  3VKL A;  4ZU4 A;  3GBF A;  2VZU A;  1W0P A;  2JIC A;  5J09 A;  4UF0 B;  1F35 A;  3U11 A;  2D6P A;  3ACF A;  2Q1Z B;  2VZ1 A;  4J25 A;  1W39 A;  1YI9 A;  2VEC A;  3DPR A;  4GUL A;  5DZF A;  3VBH A;  1AX0 A;  3DEC A;  5IVC A;  1R08 1;  1UNB A;  1D2S A;  5FBJ A;  4EQV A;  2OQ7 A;  4S2G A;  1REE A;  3DV8 A;  2ZAC A;  1YI7 A;  3JB8 A;  1RMU 3;  2JJ6 A;  3CO2 A;  1M4W A;  5CFD C;  1Z78 A;  1H2M A;  1ZZ8 A;  5EXO A;  1NA1 B;  2VM9 A;  1UYY A;  1REF A;  1W6Q B;  4B8E A;  1PK6 B;  1ZYB A;  2DVF A;  2OPW A;  3OSD A;  1IQA A;  3DYM A;  2CGN A;  2EA7 A;  3FN9 A;  4E2Q A;  2GN3 A;  2XHN A;  4QPI B;  2J42 A;  3AP4 A;  3H3U A;  4KI5 M;  5IT6 A;  2WWU A;  4IV1 C;  2Y6H A;  3O1U A;  5FPA A;  5A33 B;  2VZS A;  1UN1 A;  1AYN 1;  5HCH A;  2HWD 2;  5FZL A;  1T2X A;  3WQ7 A;  2QQJ A;  3X29 B;  4HVQ A;  3SEP A;  3ON7 A;  3KV9 A;  1WME A;  4RS5 B;  2XHK A;  2IFR A;  5GLV A;  2XLF A;  1UKR A;  3NL1 A;  2W9X A;  4M0H A;  4I0W B;  4MGT A;  1HXS 2;  4AFM A;  1LOC A;  4ZU7 A;  4CE8 A;  3OGS A;  3M3I A;  5SV5 A;  4KU8 A;  5FY1 A;  3IAQ A;  2VCM A;  5C8C B;  3O1S A;  2XKP A;  2IWG B;  3MF9 A;  4PIZ A;  2P34 A;  5K9Y A;  1UX6 A;  2E26 A;  3WP4 A;  1XNK A;  5A33 A;  1XU1 A;  3AYE A;  5GZG A;  1GZW B;  1CR7 A;  2WN2 A;  1UOB A;  3KF3 A;  1DDL A;  4RS5 A;  2PEL A;  4P9W A;  2ZEX A;  2BTV C;  4WM7 C;  1FX5 A;  2ZGK A;  2XPJ A;  4KL1 A;  5C8C A;  2VY0 A;  1I1E A;  1C3H A;  3CLP A;  4ZXK A;  1SCR A;  2D40 A;  2JWP A;  5C3R A;  1H2N A;  4K1Z A;  4PDW C;  5FY4 A;  1OPO A;  4R52 A;  3HIF A;  4IEV A;  5LWB A;  3VL8 A;  1VB2 A;  3FWE A;  5T54 A;  3VKF C;  2XR4 A;  4QHO A;  2QQO A;  3C8X A;  5K0U A;  2BBA A;  3VBR B;  3NAP C;  4E8D A;  4WM8 B;  4XAE A;  3PU3 A;  2DCK A;  1B09 A;  3U78 A;  5FP4 A;  2D6M A;  1NLS A;  1DIW A;  2A3W A;  4MAD A;  4O9E A;  4CP9 B;  1X9P A;  1TNR A;  4MGY E;  1C57 A;  2VOT A;  2XBO 3;  4QM8 A;  1RVF 3;  1TG7 A;  1GOH A;  1KIT A;  5EJZ B;  5FZ7 A;  4AI2 A;  3AJZ A;  4CDX A;  4L9B A;  3S6P A;  3JBG 1;  4IE7 A;  2SLI A;  3RZZ A;  5IVJ A;  5GKA C;  4NE9 A;  4AFA A;  2CWS A;  1OQ1 A;  2ARE A;  2UWB A;  1UZW A;  3PUR A;  3WUD A;  4BCU A;  1ONA A;  4AVV A;  1QOS A;  3FZ3 A;  3S7I A;  4M4P A;  2RJL A;  4NO4 A;  4MVT A;  3BYW A;  3T2P A;  5KXD A;  3MIF A;  4F8A A;  1HV1 A;  1J83 A;  3CU7 A;  4LHK A;  2WWJ A;  4JHZ A;  4QKN A;  4UWD A;  4Y20 A;  2V09 A;  1COV 2;  5H9S A;  3VDB A;  3K3N A;  1HRV 3;  1PGL 1;  2AH2 A;  4YVS C;  1CON A;  2Q5T A;  1ND3 B;  2WQZ C;  2R1B A;  3LFI A;  3VGI A;  2DFC A;  3IWZ A;  4YZ3 A;  4IE5 A;  5KXC A;  5FZ3 A;  2OUJ A;  3POI A;  5KHI A;  2WNU A;  4O65 A;  5FYB A;  4Y1Y A;  2RDR A;  2XLG A;  4RD7 A;  4AYU A;  3WNN A;  4A6O A;  4C0B A;  3H7J A;  1ZBE 2;  2D5H A;  4Q27 A;  1RUC 1;  2QVS B;  3IDA A;  5FZ1 A;  1SCS A;  4BM8 A;  1LES A;  2VGD A;  3WW2 A;  2WN3 A;  1QQP 1;  1W8F A;  3RS6 A;  4AED B;  2JDM A;  1D4V B;  1CQ9 A;  3ZFG C;  5JOX A;  4XET A;  1LR5 A;  1YIP A;  3GCW A;  2W1U A;  3LQC A;  2YBP A;  1ST8 A;  3C7F A;  4ASL A;  3UGG A;  2R1D A;  2ZZJ A;  5C7G A;  1D0H A;  1RUF 1;  4YW6 A;  5CKM A;  3VV1 A;  4CEW A;  3TBD A;  2WZ8 A;  2HBT A;  3D5O A;  2CGO A;  2JD9 A;  1RUH 1;  1JZ8 A;  1TQ5 A;  1PM4 A;  5JR7 B;  1NLR A;  5L36 A;  3CBN A;  2D6N A;  2RS5 2;  2ZTN A;  3LEI A;  3WXP A;  3FMG A;  2WA3 A;  1MS5 A;  2Q8D A;  5FKB A;  2WWS A;  3IB3 A;  1GSL A;  2DDU A;  2IVJ A;  4GB3 3;  3VBS C;  5J1X A;  1VBB 1;  4B7K A;  1QWR A;  3WF3 A;  1CAV B;  1VBE 2;  1L7R A;  4HZF A;  4WBB A;  3E6B A;  4IV1 B;  2W3J A;  1W2N A;  3JQX A;  5F5C A;  1AX1 A;  4HMZ A;  2ILM A;  1CZS A;  2VW1 A;  5A7P A;  3ZMN A;  2BNO A;  1W3X A;  2DCZ A;  5F3C A;  1PVC 1;  5IW0 A;  1W6N B;  4Q4Y 2;  4O9G A;  3EO6 A;  4AVA A;  2OXB A;  4JV4 A;  1WGP A;  1OHF A;  1RIT A;  2ADD A;  1V6M A;  2Y6L A;  3M2M A;  1V6J A;  4TZD A;  3CZJ A;  3JBG 2;  5GZC A;  1ND2 B;  2BZD A;  2XQX A;  3VN4 A;  2GMM A;  1RUJ 3;  3U1X A;  4XJ9 A;  2OX0 A;  1LNS A;  1PGW 1;  2A6Z A;  1FPN 3;  2VNV A;  4KBZ A;  2KR2 A;  4OI4 A;  2OVU A;  2IZW A;  4EN0 A;  3CJI B;  1S2B A;  1AR8 3;  2IC1 A;  5FMD A;  1RED A;  3HBK A;  4BQY A;  5FQ0 A;  4XJW A;  1PGL 2;  1YHF A;  1XU2 A;  3R6S A;  3T1L A;  3EJK A;  3KCX A;  4CCM A;  2WLQ A;  1LUL A;  3OGV A;  4LO8 A;  1N47 A;  5ERL A;  4E4H A;  2WC2 A;  1MZF A;  4Q1R A;  3ZXD A;  4F83 A;  5CFD A;  3A7Q A;  1O3R A;  4FOY A;  3RNS A;  1CES A;  4QQH A;  3MLJ A;  1OKO A;  4GH4 A;  2EID A;  3PUA A;  2WSU A;  3ZXE A;  2J22 A;  3PTR B;  1FMD 3;  4W4Z A;  3POJ A;  1GR3 A;  4NHK A;  3GZU C;  1OD5 A;  1AX2 A;  2ZEY A;  5HI0 A;  2J1E A;  4N9I A;  4D6R A;  3H8X A;  4RL7 A;  1KRI A;  1GU3 A;  1F5J A;  1GWL A;  4L8Q A;  3WW4 A;  4CDW B;  4Z92 B;  1W8O A;  1WCU A;  2GZW A;  1MR5 A;  4X8N A;  5FZ0 A;  1FI2 A;  1G9D A;  1ND2 C;  5FZ8 A;  2GME A;  3W58 A;  4IUG A;  1HQL A;  1X9T A;  5F32 A;  3PIJ A;  1FV2 A;  1UYX A;  2DWR A;  3Q8F A;  4LOT A;  3VZL A;  4ES9 A;  2ZMK A;  1Z7S 1;  1DQ6 A;  5IJR A;  3B94 A;  1WW5 A;  4IXL A;  1AL2 1;  5JMO A;  4XCA A;  3O12 A;  3AZY A;  3W5M A;  1ZBA 2;  1OLM A;  3D82 A;  2H0B A;  1KDM A;  1E5R A;  4JVA A;  3U37 A;  3ZKY A;  5IAX A;  3S57 A;  5F39 A;  4Y22 A;  2XML A;  4CP0 A;  4CDW A;  2MHF A;  1G9C A;  3LCP A;  4LHS A;  3ZYB A;  1RUI 3;  1E5S A;  1UY3 A;  4AGG A;  1VAM A;  2OUH A;  1J3Q A;  3VBS B;  4CCE A;  4CDX B;  3NV2 A;  1W6M B;  1AR7 2;  4L11 A;  4FXG B;  3VBH C;  1XE8 A;  1ND3 C;  3GHM A;  2CYF A;  3SCH A;  3WP6 A;  5LCW L;  1AR9 3;  2D44 A;  5J36 A;  4OMC A;  5BPX A;  3J7H A;  2VXJ A;  1C28 A;  1JN2 P;  2X10 A;  3FBM A;  1J59 A;  2ARC A;  4KWL A;  2JEM A;  1OVS A;  1PO2 3;  1POV 1;  4QX3 A;  4XAA A;  1BYH A;  2ZGP A;  3BIW E;  3WR0 A;  1M06 G;  5HPO A;  3NNM A;  4YGE A;  2PHT A;  4YFW A;  5F1R A;  1RHI 3;  2W87 A;  4KWU A;  5FRE A;  3TNQ A;  3V0A A;  3ZN4 A;  2QCS B;  2DUO A;  3H1W A;  5KC5 A;  5F5Q A;  3FLR A;  1ZRD A;  3WZ1 A;  3BUC A;  4AFC A;  3BN6 A;  2R07 2;  1XNC A;  3K48 A;  5ACA 2;  5F37 A;  5HV0 A;  4HKW A;  2TUN A;  1TEI A;  2RMU 1;  2NZ9 A;  5CYY A;  4YPJ A;  4D6Q A;  5C4W A;  4COZ A;  4DIQ A;  4I3G A;  5FPV A;  2VCC A;  4A44 A;  1UW8 A;  3DXU A;  4CDQ C;  5FP3 A;  1JYW A;  1W3V A;  1DP0 A;  2E7Q A;  2V5Y A;  5HXM A;  2XLA A;  5FPL A;  2A6Y A;  4RHV 3;  2FD8 A;  4ZHN A;  5E16 A;  2WO2 A;  3FX3 A;  4PIY A;  5FLH A;  3OBR A;  1S2K A;  4YG0 A;  1C8M 1;  3MV0 1;  3H8R A;  2AEZ A;  5FYV A;  1Y7B A;  3KF5 A;  1LGN A;  1OFN A;  2ZOE B;  4JGZ A;  4XFC A;  1NX9 A;  2K2S A;  2OS2 A;  4DXZ A;  1UL9 A;  2K9Z A;  4Q1P A;  4B7E A;  4BA6 A;  4MET A;  3E5U A;  1DZR A;  4JGZ C;  4D69 A;  3PNA A;  1WUV A;  5DUW A;  3G6J B;  5G04 L;  1L7Q A;  4IGO A;  2ET1 A;  5IVB A;  2Y64 A;  2VTX A;  3I97 A;  3NVC A;  5IVE A;  4YG3 A;  2VMD A;  3PJY A;  5DG2 A;  2PAE A;  2BVV A;  3NAP B;  1PX3 A;  2JDZ A;  4R9D A;  1QIQ A;  5GZF A;  3VD9 A;  3VD5 A;  1ZBE 3;  4Q29 A;  1FOD 2;  4EN7 B;  1XND A;  2PA7 A;  4MO3 M;  3ILN A;  5FY0 A;  3WHU A;  3OGG A;  4JC1 A;  1XYP A;  4QMA A;  1LHW A;  5DN2 A;  4PBO A;  4QKD A;  1IPJ A;  5CIS A;  4OHY A;  1PX4 A;  4FXK B;  1W2O A;  1V6I A;  2J1V A;  5LZ6 A;  1B35 A;  1CWP A;  3UKN A;  1Y9G A;  4NID A;  4GWJ A;  2Z69 A;  1S2E A;  1G9F A;  4FTB A;  3UNP A;  2AC1 A;  2BGC A;  2A5Z A;  1ENX A;  4AVB A;  3FHA A;  1N1V A;  2C4X A;  1J3R A;  1KJR A;  3B00 A;  4QPG C;  1CN1 A;  4RR3 A;  1NA1 C;  2WKK A;  4FPH A;  2AYH A;  3DKQ A;  3T0B A;  1V6N A;  3K51 A;  5I0U A;  4D6S A;  2ZX4 A;  1C5I A;  3LA7 A;  5FAX A;  3USS A;  3NST A;  5J3U A;  2Y26 A;  3SXW A;  1VBD 3;  4P9L A;  3ZXA C;  3T2T A;  5LY2 A;  4SLI A;  4XJU A;  2JB4 A;  2X09 A;  2GNB A;  2E33 A;  3GZA A;  3KZ4 C;  5JIA A;  1QJY 2;  1SBE A;  1IQD C;  5A7W A;  4NAO A;  5IK4 A;  1GNH A;  1NZC A;  1W2U A;  5F8P A;  3SCG A;  2D6L X;  2P3K A;  2FMY A;  1W9W A;  1VPH A;  4CU9 A;  4HFS A;  5IFP A;  2D97 A;  2W47 A;  1LOB A;  4XIL A;  1O4T A;  1QOO A;  3VKO A;  2ZGU A;  1OH4 A;  4AG4 A;  2P3J A;  1DLC A;  2EXK A;  1NE6 A;  4MSV A;  2MPF A;  2XBO 2;  3PUS A;  3NV3 A;  2AR6 A;  2YB7 A;  5IWF A;  3VDC A;  4CUB A;  4F3J A;  4P9Y A;  1JYC A;  1CPM A;  5FPB A;  3E97 A;  1VAL A;  5L7O B;  4LIU A;  5A6Z A;  3W9A A;  4DY5 A;  4H55 A;  4KG8 A;  3H50 A;  3NKT A;  1RUG 2;  3BTX A;  4FSJ A;  4Y33 A;  1JOB A;  3R4U A;  3NMB A;  1LOF C;  1OOP B;  1JW6 A;  2RVA A;  4FPO B;  4JDO A;  5JCT A;  2W2I A;  1JUH A;  1UWW A;  2JD4 A;  4QX1 A;  4DFS A;  5F5I A;  3WG1 A;  5J98 B;  3J9S A;  2ZS6 B;  3WX5 A;  3H0O A;  3ZXL A;  4AE2 A;  1RTV A;  1Y3T A;  4LO4 B;  1AYN 2;  1MS4 A;  4P5H A;  1RMU 1;  2D6O X;  4Q0V A;  1S4C A;  3TB0 A;  1VAK A;  4RGA A;  4IGQ A;  3VZN A;  4AQ2 A;  1ZA7 A;  2WT0 A;  1W28 A;  2JIJ A;  1PO2 2;  5IK8 A;  1UMI A;  4AR2 A;  5IAT A;  4D7Y A;  1HRV 2;  4BK4 A;  3V65 A;  1R09 1;  2VMF A;  1UX7 A;  1H4H A;  2GNT A;  2GDF A;  3QCW A;  4YVW B;  1DGW X;  1OOP A;  1AR9 2;  1PMI A;  1D2Q A;  2RV9 A;  3N7J A;  2DTW A;  4LBJ A;  5CU1 A;  3O1O A;  3J4U H;  1AXZ A;  2P6H A;  5B4X A;  3HQR A;  4AI1 A;  4AVS A;  2WS9 1;  2HWF 3;  2WQ4 A;  3P6B A;  4BWO A;  3UV9 A;  4AFD A;  3I59 A;  3RYR A;  1VP6 A;  3ZOI A;  1MZ5 A;  5LK7 B;  1HXS 3;  4LHN A;  1HJG A;  1MZ6 A;  3ZFG B;  1V9U 2;  4A45 A;  1CD3 G;  3KT1 A;  2G19 A;  4CZS A;  4N53 C;  5JZG A;  5E6H A;  1SDW A;  2XUE A;  4KQ7 A;  1ZBA 3;  1QMJ A;  1PO1 1;  2D3S A;  3K46 A;  3JQW A;  4URA A;  4I02 A;  3BI3 A;  4YVW A;  1OUR A;  1SFN A;  4JGZ B;  2VL4 A;  4BLI A;  1OA2 A;  5JLV A;  3OUH A;  2MNG A;  1W06 A;  3I8T A;  4PI2 A;  3RMX A;  3ITQ A;  2PMW B;  5AVP A;  4H2A A;  3WIN E;  1PZ7 A;  2X29 A;  2W1S A;  3LDR A;  4NOT A;  4Q4V 3;  4HL0 A;  4IEZ A;  5C9A B;  4XUP A;  3IMM A;  4YW4 A;  1Y9M A;  4XUO A;  1BVV A;  1NQJ A;  3INA A;  3AKP A;  2DYC A;  3ZSE A;  2BNN A;  1POV 0;  1GQP A;  3H9A A;  4JDN A;  5E88 A;  5FY7 A;  3BTY A;  5K7P A;  3IT8 A;  3ACL A;  1RMU 2;  2DVB A;  4Y1Z A;  5LEJ A;  4XJ8 A;  3U75 A;  3PMS A;  4UOJ A;  1VMF A;  1TMF 1;  2BQP A;  1DGW A;  3PUQ A;  3T30 A;  4CDQ B;  2P6C A;  2JG9 C;  4BXS V;  4GA9 A;  4XTM A;  1QJF A;  3POE A;  1LGC A;  1H8T C;  2HH9 A;  1ZRF A;  2Q30 A;  5BNO A;  5A1L A;  5F2W A;  1IGO A;  2H6B A;  5DDJ 3;  1UCX A;  2WNE A;  4YAR A;  1OUS A;  1V6L A;  3POG A;  4MLO A;  3D0S A;  1IHM A;  4Y1V A;  1KXG A;  1VE0 A;  3EB7 A;  4FPF A;  4XTP A;  5T5O A;  5LA0 A;  2HWF 1;  4LEJ A;  3LSD A;  2NMN A;  5KHG A;  2P2K A;  4ATF A;  4WZC A;  1GFF 2;  3AP6 A;  3N9P A;  2DU1 A;  2GSY A;  5C5U A;  5FTT C;  4YM1 A;  2XBO 1;  3RPQ A;  4EWD A;  4WVM A;  3T08 A;  5LRS A;  4Z8B A;  3ZIW A;  3KV5 A;  3HMY A;  3JBG 3;  5FLJ A;  3VBR C;  3T1M A;  2FDI A;  1FAT A;  2EVX A;  2FDK A;  5IUQ A;  2XUM A;  1YO8 A;  4W6X A;  1YQC A;  4EYU A;  4QQL A;  3T3Y A;  3QH6 A;  1FT9 A;  1MQT B;  4Q0U A;  2BWA A;  4K40 A;  4J1X A;  3U10 A;  2YBK A;  2NLR A;  2XOM A;  4FFG A;  5L9B A;  4CDX C;  2LUW A;  1XNA A;  2ZCW A;  1W8T A;  1K5J A;  3GBW A;  1LOE A;  2ORX A;  3OJB A;  1NUK A;  4RFT 0;  3W20 A;  3SH3 A;  4YM3 A;  4PLO A;  5FZD A;  2QDN A;  3D4K A;  3RWK X;  3WY6 A;  4G9S B;  5LK5 A;  1ENS A;  4TTG A;  5I8T A;  4AQS A;  3VHR A;  2WZE A;  4DNY A;  2WZR 2;  3GHN A;  4G3Y C;  5A3T A;  1QF3 A;  2JB8 A;  4AAP A;  1TMF 3;  5EYY A;  4NII A;  3VBO A;  4GWI A;  5I8Y A;  1HKD A;  3UET A;  1ND3 A;  5A3W A;  1UXZ A;  1BQP A;  1W2T A;  2ID4 A;  1X82 A;  3OPZ A;  5I0D A;  5JDB A;  1SBF A;  3WDU A;  3FC0 A;  4FI9 A;  4PLM A;  2VUJ A;  4GWN A;  4FPE A;  2UUR A;  1RL3 A;  2Y38 A;  4NHY A;  5JSR A;  1PMH X;  3LD8 A;  4HPK B;  4MV2 A;  3NO8 A;  1LED A;  1U5I A;  2XDV A;  4SBV A;  2W08 A;  3TN9 3;  3FUO A;  1SPP A;  3MPP G;  3FL7 A;  4QPI C;  4CUC A;  2FBE A;  3WV6 A;  2MEV 3;  1VBB 2;  2VOW A;  4HN1 A;  1RUE 1;  2PLV 1;  3PVO A;  1SLC A;  1O4Z A;  1SBD A;  2Y6G A;  1EAH 2;  3QAC A;  4BIO A;  1TMF 2;  2UYB A;  3NKG A;  2LW8 A;  2Z79 A;  3GZT B;  3AP7 A;  3IPV B;  1UYZ A;  4MGI E;  4YZ4 A;  4NPM A;  1MVQ A;  4COW A;  4EN8 B;  5EHD A;  2I45 A;  5FK8 A;  3UT0 A;  4FAH A;  1PK6 A;  2YYO A;  1QXP A;  2WRA A;  4IV3 A;  5EIY B;  3WNM A;  5C5T A;  3DKW A;  4Q8K A;  1AZD A;  4FOQ A;  2YZ4 A;  1PIV 1;  3KHC A;  2YV8 A;  4LKE A;  1ASJ 1;  1QJU 1;  2BV4 A;  3ZYR A;  3K4Z A;  2Z5W A;  3NJX A;  5CAD A;  4BMB A;  1GQH A;  2ZJC A;  4B1M A;  1AJK A;  4L97 A;  2BVB A;  4FTS A;  1NOV A;  4LPL A;  3MIB A;  2FCT A;  3AYC A;  1JOP A;  2IXJ A;  1NYW A;  3A0N A;  3RYK A;  1DHK B;  5SV8 A;  1F31 A;  5C3S A;  2OZJ A;  5F2S A;  3SHR A;  3ZFF C;  4QU1 A;  3WLU A;  2PAM A;  2IUW A;  4NIH A;  3H1Y A;  3HNM A;  3LWC A;  1DQ2 A;  1FPN 1;  2UWC A;  5T5L A;  1ZX5 A;  1VBA 2;  3DPR B;  3JD7 3;  4JGY C;  1VMH A;  4R9B A;  5FO9 B;  2B5H A;  3HBZ A;  2XJR A;  4WVW A;  5A7S A;  3ZSM A;  1JZ5 A;  3LF7 A;  3FE5 A;  1X36 A;  3SMH A;  5LBF A;  1GZC A;  5JPN B;  5FO7 B;  4YGD A;  4ASM B;  1IS4 A;  5T50 A;  3E6C C;  1AR7 3;  3OY8 B;  4HSL A;  1W6Q A;  2CDP A;  2DVG A;  3I2F A;  4QB6 A;  2N7G A;  4MXW B;  1W6P B;  2WO1 A;  1SLL A;  2LAL A;  4FPG A;  3OBA A;  2GH8 A;  2HYK A;  4KGQ A;  1K5M B;  1DF0 A;  2YGM A;  1YRZ A;  2WZP P;  1WMX A;  2JE9 A;  1ULE A;  3AM2 A;  1W04 A;  5ABJ A;  5BNP C;  1AL2 2;  3WNK A;  1SZB A;  5CG8 A;  4XHB A;  4GH4 B;  4D8M A;  1NCQ A;  2ZGL A;  3C2U A;  4RYD A;  1O4Y A;  1DYP A;  3ROU A;  5KHJ A;  4Q5O A;  4QX8 A;  2Y6J A;  5C4W C;  4U2A A;  1G9A A;  4IE0 A;  4DRR A;  5EZW A;  1DU3 D;  2QZ3 A;  3EHK A;  4NWW A;  4NIA A;  1Z7S 3;  3FHQ A;  4MX3 A;  1R09 2;  1S0B A;  4XPV A;  2VBD A;  1H2K A;  3PDQ A;  2RHP A;  2ZHN A;  4URT A;  4CCK A;  3S0M A;  3AMH A;  2XB6 C;  1W8Z A;  4AK3 A;  4KH9 A;  4NUB A;  1DCS A;  2Q4S A;  1SLB A;  1KD7 A;  2A71 A;  3VBU A;  3RG0 A;  1RUE 2;  5D8A A;  3ZYP A;  1KJL A;  3K75 B;  4FFH A;  3BCW A;  2VR4 A;  1BEV 1;  1EY2 A;  4TYS A;  4BQ3 A;  5D8A C;  4Z2W A;  5FO8 B;  1OUX A;  4Q4W 2;  3WQB A;  2AUY A;  1IOA A;  2HYX A;  5IYY A;  4DXS A;  2GND A;  4WVV A;  2OA2 A;  3IDE A;  3RYP A;  3ES1 A;  5CEH A;  4XQ4 A;  4G4F A;  1RUN A;  2NPI A;  1AXY A;  1NE4 A;  5FDB A;  1EPZ A;  4GZ9 A;  4XOG A;  2VOV A;  1UKG A;  1O59 A;  1UQX A;  3NJY A;  5JOY A;  1PGW 2;  4LBN A;  3VUO A;  1OH3 A;  2I07 B;  2JDP A;  2W91 A;  1TNF A;  1WBL A;  4GJY A;  3ZO0 B;  1E5H A;  4ZXE A;  3VBR A;  2PTM A;  3OBZ A;  4QQO A;  1ALY A;  3H3Z A;  1K5M C;  5K0U B;  1FOD 3;  2ZAA A;  2D3R A;  1SLT A;  4Q4Y 3;  1DGR N;  1ENR A;  1GQG A;  4Y24 A;  4BJ0 A;  1MS8 A;  4CYD A;  4EWA A;  4BQ2 A;  5JMC A;  1JYN A;  2VZV A;  2BOJ A;  4CU6 A;  2VPV A;  5C71 A;  4NVP A;  2YY1 A;  3WCR A;  3A22 A;  1DYK A;  4S2H A;  2G4I A;  4XMI A;  4PT6 A;  3ACH A;  4CDU A;  4DUW A;  4R9C A;  4QHB A;  3VL9 A;  1XSR A;  5DAQ A;  5BNO C;  2XVG A;  2VZP A;  1UOG A;  3DL3 A;  5FK7 A;  1UU4 A;  2ZGR A;  3LEM A;  3ES4 A;  2VU9 A;  4LO5 B;  1XE0 A;  3ETQ A;  3JB4 C;  2EIE A;  3E1F 1;  1R64 A;  4I30 A;  3RZL A;  1F8V A;  2Q0A A;  5FIX A;  3ZKU A;  4BQW A;  2KM2 A;  5DQ0 A;  2W46 A;  1APN A;  4JQT A;  1VMJ A;  2DVA A;  5BNN C;  2WNU B;  2D43 A;  2PHX A;  1UO9 A;  1OOP C;  2O0O A;  4CDU B;  3PU8 A;  4UF0 A;  2YC2 A;  1YJK A;  4GD4 A;  2FMD A;  4P9G A;  4UBG A;  5T55 A;  3J7N A;  4K21 A;  4OYU A;  4UT5 A;  3VBH B;  1CVN A;  2GAL A;  5DG1 A;  5FWJ A;  2WS9 3;  4OUS A;  1BMV 2;  2FDF A;  3D0J A;  3POW A;  4DXT A;  2BER A;  3KMH A;  3B69 A;  3MLK A;  4WM7 B;  2R7E B;  4N9H A;  5A7O A;  2ZZQ A;  5CAZ A;  3GNE A;  4MHU A;  1WCQ A;  1AYM 1;  1W9Y A;  4FPL A;  1S0I A;  5JXH A;  4CEW B;  1N1S A;  1FOD 1;  1JXN A;  5FJH A;  5FKC A;  1XYN A;  3A0K A;  4QQ2 A;  2XGX A;  5I0S A;  4ZS3 A;  1RUG 3;  5CIR A;  1WZX A;  4ISR A;  3VHN A;  2ZGM A;  4Q2F A;  1R1Z A;  2ERF A;  1MVE A;  3AB0 A;  3RGB A;  2WNV C;  2GN7 A;  1GP6 A;  1JH5 A;  1EP0 A;  1GYK A;  4NJ4 A;  3VBF B;  2ZML A;  1EV1 2;  3OUI A;  3ZFE B;  5EJ1 B;  1CIW A;  3Q8A A;  1JZ3 A;  2OKX A;  3VDD A;  2NYY A;  4R9A A;  1G6N A;  3THP A;  2Y33 A;  2V4V A;  4JDM A;  3KV6 A;  5L73 A;  1OVP A;  3VD4 A;  3R05 A;  3OGJ A;  4XUR A;  4ATE A;  2YGL A;  3L2H A;  2I74 A;  3BVC A;  4LR4 A;  2XJV A;  4QDR A;  4JTO A;  4CEY A;  3CDZ B;  4QX0 A;  3LEG A;  1YQ2 A;  4V2V A;  5FMO S;  1R1A 2;  1HN1 A;  2JKB A;  4OHW A;  5A6X A;  3CJI C;  2B39 A;  5CKQ A;  4FP2 A;  3WDT A;  2RMU 2;  2E7T A;  5FQ0 B;  3R0R A;  2X5I B;  1U12 A;  2W39 A;  4LQR A;  1U0A A;  4XYX A;  5GAL A;  4E27 A;  3O1V A;  3KCC A;  4CDU C;  1HRI 3;  2R06 1;  4V1P A;  2B9V A;  2WNU C;  2XJT A;  3IIA A;  4LBL A;  4MGK E;  1EPW A;  2JDY A;  3JZV A;  4I3P A;  1HB2 A;  1WMF A;  1JYI A;  4C90 A;  1UYP A;  3AMN A;  1X33 A;  2WA4 A;  2HJI A;  4ONU A;  4OI0 A;  4COU A;  4FP3 A;  4PHZ A;  2J1T A;  3BGA A;  3M7A A;  4LK6 A;  5FPX A;  1RUG 1;  3IDB B;  2F6B A;  2GC3 A;  4M0N A;  3RVH A;  3QLQ A;  4LBQ A;  4XBQ A;  1TE1 B;  4A3Z A;  2B8M A;  1YIF A;  3RFR A;  3NW4 A;  3B02 A;  4QXC A;  2K0G A;  1F2N A;  3SNM A;  3LDB A;  5FUI A;  1T6B X;  1W8H A;  5L9R A;  2BYV E;  4F7Z A;  4QGN A;  1RJ8 A;  3I7D A;  4RQP C;  2JG9 B;  3ME2 A;  1VRB A;  5DAW A;  4MGQ A;  2P4E A;  2ZBJ A;  3WF0 A;  3ZLI A;  1UZ0 A;  2MEV 2;  2VXR A;  1ACC A;  2JDH A;  3OD0 A;  3V0B A;  4PLN A;  2ZEW A;  4A7Y A;  3N7K A;  4JKK A;  4UW6 A;  3JU9 A;  4AHZ A;  3C7G A;  2BGP A;  1ZNP A;  1QJX 3;  1OXC A;  4GKX A;  4HXC A;  1R09 3;  4YW1 A;  4CU7 A;  1A78 A;  2P3I A;  5FPU A;  1N1Y A;  3I2K A;  3KSC A;  4LUL A;  5BY5 A;  1CX1 A;  4AL9 A;  1S0E A;  4XF0 A;  3I2J A;  3ZSK A;  3N9L A;  1BCX A;  1IKP A;  2ATF A;  1OA4 A;  3VDA A;  1HXS 1;  5A7Q A;  3C7O A;  3BB6 A;  2ZGQ A;  4XC9 A;  3AVR A;  4D3W A;  4Z82 A;  3H42 B;  4BQ4 A;  1SG3 A;  3ZN6 A;  1S0G A;  2Z42 A;  3ZXG A;  1GBG A;  1TME 2;  4DUX A;  1PO1 3;  3BOP A;  1DG6 A;  4UW5 A;  4W8J A;  5GJ6 A;  4QB1 A;  3ZM8 A;  3VLB B;  3MI8 A;  4E4D X;  4KGG A;  5DAX A;  5JZG C;  2WR9 A;  1PIV 3;  2CHH A;  1NXD 1;  3AVS A;  3BOD A;  4ITC A;  3MLL A;  4Q4V 1;  1ASJ 3;  1QJU 3;  3MFC A;  1D4M 3;  1YUD A;  4ZON A;  1YCI A;  4FTE A;  2ZHL A;  1FAY A;  2JXA A;  1LOD A;  3RZK A;  3WG3 A;  1ZRE A;  1UOF A;  1VBD 2;  3EMR A;  3ZN6 B;  1UOJ A;  3ZX7 A;  1OQD A;  5GM0 A;  1DQ5 A;  1JZ7 A;  3MUY 1;  1YJL A;  1NG0 A;  1A8D A;  4WM7 A;  4CRQ A;  3AL6 A;  4FO9 A;  1RHI 2;  3B3Q E;  4N7I A;  2Q8O A;  2O14 A;  2JE7 A;  4M3C E;  2ZKN A;  3IBM A;  4HK9 A;  3AMP A;  4IV1 A;  4JKL A;  5C3Q A;  1ZZB A;  4JGY A;  2F4P A;  1NAE A;  4A41 A;  2Y8K A;  2VQT A;  3HPN A;  4FOV A;  4WV8 A;  5DDJ 1;  4D7S A;  2BW8 A;  1COV 3;  3VZM A;  2ZX2 A;  3J8F 1;  4CU8 A;  5IVF A;  4CDQ A;  4IQP A;  3KQR A;  3BAL A;  3MUZ 1;  4IER A;  4Q4W 3;  4B4R A;  4YM0 A;  4AI9 A;  2YXS A;  3QBQ A;  3ACI A;  4P9X A;  2BRT A;  3ECQ A;  5FMB A;  1W0O A;  2W94 A;  3MZH A;  2D98 A;  2OYZ A;  1UPS A;  1QHD A;  4JGY B;  2VE1 A;  1PVX A;  3K4D A;  4LTA A;  1HRI 2;  3ZFE A;  3ZR5 A;  3WNO A;  1DYO A;  2RS3 2;  4XE9 A;  1VBB 3;  2Z2S B;  4X6R B;  3EQE A;  4R4Z A;  5CA6 A;  5CBL A;  4JTN A;  5L19 A;  3GF6 A;  4DOU A;  4EN6 B;  1TZO A;  3IAP A;  4TLG A;  4NPR A;  4DS0 A;  5A3P A;  5CZK A;  4LKS A;  5A1A A;  2PHF A;  3FHI B;  3OB8 A;  2QZ2 A;  4HVO A;  4OQ9 A;  1D4M 1;  5AFB A;  5KXE A;  1VBC 1;  1LTE A;  3NJV A;  5T52 A;  1J1T A;  1JZ2 A;  5JR2 A;  4XBN A;  5A32 B;  2WLP A;  1PO1 2;  2CNA A;  4XW3 A;  4ARY A;  1WA4 A;  1UY4 A;  2JG8 A;  5FZ4 A;  5DZG A;  3VBF C;  1RUC 2;  3ZPO A;  2W95 A;  3TWI A;  1GNY A;  3NV4 A;  3D6E A;  3VZO A;  2E7A A;  4LK7 A;  2CV6 A;  3UL2 A;  5JAX A;  1CZT A;  5A3U A;  2QKD A;  4CEY C;  3CQO A;  4YM2 A;  5FFO C;  5A6Y A;  2VG9 A;  4OCT A;  5FXV A;  3WDY A;  4XEZ A;  4FFF A;  1COV 1;  1YC6 1;  2PFW A;  3SQO A;  2W52 A;  4RFR B;  3VDD C;  4YNI A;  1QJY 3;  4Q4V 2;  5A32 A;  5LA1 A;  2WT1 A;  2HWC 1;  4FPK A;  4IES A;  2PHD A;  3III A;  3CIH A;  1VBA 3;  3JD7 2;  4XFI A;  4HG6 B;  1W8U A;  1LEN A;  2EAA A;  3BIE A;  4EZH A;  4P02 B;  3N3H A;  1RUE 3;  4UFL A;  3NRU A;  3TEX A;  3UGF A;  4NWV A;  1RUJ 2;  3N9N A;  2EAK A;  1MEC 1;  4NR1 A;  5FP9 A;  4QGL A;  1VIW B;  1W9F A;  1EYB A;  4XXA A;  4XF9 A;  1D0G A;  1AHS A;  5KC6 A;  5LBB A;  3MIE A;  5FZE A;  4E8C A;  4U36 A;  1FV3 A;  4UFM A;  1QH6 A;  1XXN A;  1SFP A;  2VZO A;  2VZR A;  4E9K A;  4RN5 A;  5BXX A;  3DYO A;  2YHJ A;  1SAC A;  4OZO A;  3I2H A;  4XF4 A;  3WP5 A;  4M01 A;  2CSG A;  3TEW A;  4XDP A;  2ET7 A;  2IXH A;  1H1I A;  3DGT A;  4GQ7 A;  3AZZ A;  1KDK A;  3LEK A;  3HJR A;  2WT2 A;  1XQN A;  1K3I A;  1AL2 3;  4Q0P A;  3RJ2 X;  1N3O A;  5IAV A;  3VBS A;  1BEV 2;  1RGS A;  5FY8 A;  3OG2 A;  3MIC A;  1RUD 3;  1F4A A;  3HT2 A;  2HWD 1;  1MEC 2;  4IEW A;  2QQP A;  2E32 A;  4BQX A;  1NCR A;  4TXW A;  2RR1 3;  2FDJ A;  1A8M A;  3AK0 A;  3MW2 A;  3S5Q A;  3LFM A;  3RWN A;  1ULP A;  2GMP A;  5J37 A;  2D6K A;  2XH6 A;  2VNR A;  4LLO A;  5JVV A;  1STM A;  4E4Z A;  3N4M A;  2HBU A;  4YVS B;  1WLW A;  5DPN A;  5F3E A;  5FP8 A;  2VZT A;  1H0B A;  1QJY 1;  1LJ7 A;  5APA A;  4S2D A;  1YLL A;  2HWC 3;  4OHV A;  3UK9 A;  5C3P A;  4JQR A;  4BLJ A;  1HJF A;  1LHU A;  1IKQ A;  4IEP A;  3GAL A;  5I93 A;  2VUL A;  1WD3 A;  1QOT A;  1NCR B;  3LOI A;  2XJU A;  5HV4 A;  1OC1 A;  1O8S A;  2F17 A;  2VTX J;  1AYM 3;  2VUC A;  1E5I A;  3MW3 A;  4UFJ A;  1H1M A;  2OII A;  3OY8 A;  2XVK A;  4M3C A;  2VO5 A;  5GZD A;  3UKT A;  5GZE A;  3I54 A;  1LAJ A;  1YQ6 A;  4GMP 0;  2GH2 A;  4EJR A;  4BK5 A;  1VBC 2;  4OI1 A;  2A7A A;  5IVY A;  4FAG A;  2EAL A;  1K5M A;  1PM7 A;  1DQ1 A;  4CXY A;  3L2Y A;  4FCA A;  5JZG B;  3O1T A;  4N53 A;  2ZAH A;  1W03 A;  5BV6 A;  3ZYJ B;  1OF3 A;  1QJX 2;  5AC9 2;  2ZHK A;  1URX A;  2RS3 1;  3F95 A;  1NCQ B;  2F4L A;  5FZO A;  5J7M A;  1WMD A;  4XF3 A;  4DEQ A;  1HW5 A;  3I2G A;  1RUD 1;  5KXB A;  1AYM 2;  1W6O A;  2ZX3 A;  1V6O A;  4IDZ A;  5FYU A;  3U07 A;  1H2L A;  2FQP A;  4XIO A;  5DAP A;  2HWB 3;  2E6V A;  5FXX A;  1H1A A;  1VJ2 A;  4COY A;  2CL2 A;  4CCC A;  4EN9 B;  4D94 A;  2QQU A;  3FJS A;  5DMY A;  1FXZ A;  1LU1 A;  2VNO A;  3N35 A;  2E63 A;  2WBK A;  2ZX1 A;  4LE3 A;  4MZU A;  4AQT A;  4GMP 3;  1MPX A;  1J84 A;  5FYM A;  3IDC B;  2IFW A;  3VBU B;  4XUT A;  1PIV 2;  5FZO B;  3F2Z A;  1LEM A;  1QNW A;  1NT0 A;  2WAB A;  3TYJ A;  2BGO A;  5C8C C;  3LPG A;  4X8P A;  2PQS A;  1B35 B;  2FHR A;  1ZBE 1;  3RJR A;  3VBO B;  5LB6 A;  1IS3 A;  3POF A;  1HRI 1;  4B3N A;  2XVL A;  4TN7 A;  4XVH A;  4CPB D;  3ST7 A;  3OYW B;  3S7E A;  4NHM A;  1EV1 3;  4RS5 C;  1S0J A;  4BIS A;  1GLH A;  4NHX A;  3H1M A;  3KGZ A;  3OF1 A;  1NLQ A;  1RUH 2;  2VVD A;  4DIN B;  4CVU A;  4YVW C;  5IK5 A;  3MID A;  3WDW A;  3GXU A;  4BB3 A;  4OMD A;  3UGH A;  2C1F A;  2QTW B;  1BKZ A;  4BIF A;  5FXZ A;  2EXJ A;  3K3O A;  1WD4 A;  5M0T A;  4L0P A;  2R32 A;  1W90 A;  5H9R A;  4PF1 A;  5LW9 A;  4CTE A;  4HET A;  4GH4 C;  2XKO A;  2ZGO A;  5HCF A;  1OBN A;  3O1R A;  3H8U A;  3L9J T;  3GZE A;  1GWK A;  1J58 A;  1Q8V A;  3THT A;  4OUL A;  4LA2 A;  1OFS A;  2E53 A;  1XC6 A;  4NN0 A;  5D21 A;  3WF1 A;  1R08 3;  3GJA A;  5L7O C;  5ISL A;  4H14 A;  4DEV A;  3RZH A;  1ZVF A;  1FMD 2;  1GOF A;  2WO7 A;  4B29 A;  5FYY A;  1O3S A;  3WOG A;  1Y43 B;  1RUD 2;  1JUI A;  1SLA A;  2G9F A;  3HN1 A;  1GZ9 A;  2ZGN A;  2Y6K A;  5E8A A;  4A6S A;  3ZXK A;  1VBD 1;  2TEP A;  5HCA A;  2VJX A;  3ABZ A;  4OI2 A;  5EJ3 A;  1QJX 1;  3AKT A;  3SKJ E;  1HLC A;  2WNV A;  2WAO A;  4HVR A;  3PJQ A;  2RM2 3;  2A6V A;  3DEM A;  1SEF A;  4BH9 A;  1Z0H A;  1MS3 A;  2C0Z A;  1D7P M;  3KHB A;  3AKR A;  3M3C A;  2J1U A;  1NA1 A;  1DGL A;  2O8Q A;  4LMF A;  4D0Q A;  3N7L A;  3LIG A;  3U4S A;  3SH4 A;  1LOF A;  1ZZ6 A;  3IMN A;  3V64 A;  1JYX A;  1V00 A;  2JIG A;  2XON A;  2FZ2 A;  1PZ9 A;  3WW1 A;  3LE0 A;  2PAK A;  5JXJ A;  1Q8Q A;  4MG2 A;  3RZM A;  3RDI A;  2X05 A;  1UY2 A;  4HON A;  4NRM A;  4Y4R A;  2G1M A;  3WUC A;  4MH0 E;  3AP5 A;  2WNV B;  1HX6 A;  5FLI A;  4QXK A;  2LM3 A;  1F15 A;  4HKL A;  4JAA A;  3HOB A;  2A3Y A;  4W65 A;  5FZF A;  1ULD A;  1MS9 A;  2ES3 A;  3O0W A;  4GWM A;  1NQD A;  1U5Y A;  2RDN A;  3ALQ A;  4P9J A;  3PHM A;  2QQK A;  2VVE A;  2WFP A;  2Y60 A;  3AZV A;  1US2 A;  3M8L A;  4Z1V A;  4ISQ A;  2GU9 A;  4P00 B;  1UZV A;  4YW3 A;  1QU0 A;  1ZA4 A;  3HNB M;  4AED C;  4CEW C;  1WLC A;  4QPI A;  2VMG A;  3AKS A;  4GIQ A;  4Q0S A;  4JCK A;  1GUI A;  3T0D A;  2RS5 3;  1QDC A;  2Y0O A;  2R06 2;  3WNL A;  2ADE A;  2WZR 3;  5HBA A;  2CTV A;  4L92 A;  1GWM A;  3VD3 A;  3VBF A;  2WAA A;  2QQL A;  2FDH A;  3O5S A;  1ULF A;  1HV0 A;  2R49 A;  4RGG A;  4MXW A;  2P3Y A;  1R1A 1;  4R8H A;  3AC0 A;  1K42 A;  4XFF A;  2Q1F A;  5CG9 A;  3MV1 1;  2BOI A;  4IEO A;  4BU2 A;  2VME A;  1CJD A;  1IG3 A;  3WP3 A;  5LA9 A;  4AXO A;  5T3N A;  5BNQ A;  4I2O A;  2VOK A;  4YSF A;  1JU4 A;  1FNY A;  1QJE A;  1IPK A;  1W05 A;  4ZZ8 A;  4Q4X 2;  1AF9 A;  3I4I A;  2WNO A;  2BP6 A;  4XJA A;  3B9C A;  2VD7 A;  1PZ8 A;  5FZG A;  3S5A A;  1NY7 2;  2WYS A;  4C1W A;  4P08 A;  5FY9 A;  3HEI A;  4I0B A;  5FPZ A;  3Q8C A;  3S30 A;  3ZSL A;  5CFC C;  1UD1 A;  1PHM A;  3MIG A;  1OI6 A;  3AFG A;  3HQX A;  4KWK A;  4WM8 A;  2CWM A;  1Q8S A;  2QQM A;  4XDQ A;  2R0F A;  1QKQ A;  4XDO A;  1J1L A;  1W6P A;  2VUA A;  5AC9 3;  2L9L A;  2YDE A;  3OCP A;  3TEY A;  2YPD A;  5CB7 A;  2HWE 1;  2YFZ A;  3KQ4 B;  1O3T A;  4W6W A;  4WM8 C;  1ASJ 2;  1HIX A;  1QJU 2;  3WQ0 A;  3FLP A;  1BK1 A;  3DYP A;  1NCQ C;  3RRD A;  5ABJ B;  3DCQ A;  1HRV 1;  5JPM B;  1WLT A;  5BNP A;  5ABJ C;  1S0C A;  3P1I A;  4GAL A;  4LO7 A;  1RIR A;  4QPY A;  5K0U C;  2RJ2 A;  5JSP A;  3PVE A;  2BUK A;  2DCY A;  3VB9 A;  2RS5 1;  4Y20 B;  3HWJ A;  4K3U A;  2D93 A;  4PDW A;  2PHR A;  1DFQ A;  4RQP B;  4K6B A;  1MQT A;  1R08 2;  1RUC 3;  3OBT A;  3OYW A;  4HKO A;  4QB2 A;  4E2G A;  4UFH A;  1RUF 2;  2R0H A;  5E89 A;  4MXV A;  3RZJ A;  3MGU A;  4Y5S A;  1DZQ A;  1XNB A;  2VMH A;  5DXD A;  1UZY A;  4AVT A;  4HBN A;  4ZKT B;  5F7U A;  4N7U A;  2BFU L;  4Y4Y A;  1D4M 2;  1XPW A;  4WVM B;  1UU5 A;  4CP2 A;  5B2G B;  4AHX A;  2A1X A;  3GYD A;  2XJS A;  3PTY A;  1YFX A;  2FCV A;  2TNF A;  4N43 A;  1RUF 3;  5FZC A;  4M3C F;  2ARA A;  3KT7 A;  3PIG A;  4LKF A;  3ACG A;  3EBR A;  4A2U A;  4CCL A;  1LOG A;  1V6K A;  2QQW A;  4B4P A;  5L9V A;  4FBF A;  3OPT A;  3JUU A;  4RQP A;  2RG4 A;  1MEC 3;  4FT8 A;  4RSU A;  5HXV A;  4BXF A;  3POB A;  5JOZ A;  3B7M A;  5H9Q A;  4GB3 1;  4LUM A;  2ZGS A;  2A70 A;  4AI8 A;  1AJO A;  5AC9 1;  4GAZ A;  2A73 B;  4AGR A;  1WW6 A;  3LKJ A;  1AL0 G;  4NIG A;  4AGV A;  3T0A A;  4K20 A;  1AUY A;  1V0A A;  3O0X A;  4LKD A;  5CFC A;  3LA3 A;  1IZ3 A;  4Q8L A;  4QD2 A;  5FZI A;  3ZMO A;  4QDS A;  4RA0 A;  1XBF A;  4UYB A;  4ZZ5 A;  2O8O A;  4UFI A;  2GC2 A;  1RXG A;  1PVC 3;  4XQD A;  4OZX A;  4IV3 C;  5LAT A;  1CAV A;  3FBY A;  1PK6 C;  2IXC A;  2BBV A;  3VZJ A;  3QH7 A;  3GGL A;  4EV0 A;  3MO4 A;  1ZRR A;  4IEY A;  5C8W A;  2VUD A;  2ZPX A;  4XAB A;  3WG2 A;  1AXK A;  4ET7 A;  2DUQ A;  2HWD 3;  4EE2 A;  2V4A A;  1QDO A;  3B5L B;  1EAH 3;  2EXI A;  1SHW B;  3KCY A;  2GC0 A;  3CF6 E;  3BTA A;  4ASK A;  4PQ9 A;  2VBB A;  1S55 A;  5D1I A;  1ZM1 A;  2JEN A;  3ZYG A;  3MW4 A; 
#chains in the Genus database with same CATH homology
 1W90 A;  3ZYH A;  1WZX A;  2K46 A;  4BQ2 A;  4CPB A;  2C24 A;  1V0A A;  4LKD A;  2Q1F A;  4LKE A;  2LRO A;  2VXJ A;  4YWA A;  1W8T A;  4CP9 A;  4AL9 A;  4YW6 A;  1GWK A;  1L7L A;  3F95 A;  3ORJ A;  1W8U A;  4LKF A;  4CP9 B;  1UOJ A;  1OKO A;  1OH3 A;  5D21 A;  4LJH A;  4CPB D;  1W8Z A;  4BQ4 A;  1W9F A;  1HN0 A;  3ZYB A;  2LRP A;  4LK7 A;  1WMX A;  2O14 A;  3UT0 A;  1GWM A;  1GWL A;  2WYF A;  4YW7 A;  4BQ5 A;  4A6S A;  2KR2 A;  1WCU A;  1W8W A;  4BQ3 A;  2JWP A;  3ZYF A;  4LK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...