2VXJA

Crystal structure of pa-il lectin complexed with agal13bgal14glc at 1.9 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of the Preferential Binding for Globo-Series Glycosphingolipids Displayed by Pseudomonas Aeruginosa Lectin I.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
molecule keywords PA-I GALACTOPHILIC LECTIN
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2vxjA00
1OH3A 1V0AA 4A6SA 2O14A 1W8WA 1GWLA 4LKFA 1L7LA 4CP9B 1UOJA 2C24A 5D21A 3UT0A 1W90A 1OKOA 2VXJA 3ZYFA 4BQ2A 4LK6A 4LK7A 1W8UA 4CPBA 4BQ5A 1GWKA 1W8TA 4YW7A 3ZYHA 4YW6A 4LKDA 1HN0A 2LRPA 4AL9A 4YWAA 4LKEA 2KR2A 1WCUA 1W8ZA 3F95A 4LJHA 4CP9A 2Q1FA 1W9FA 4BQ3A 2K46A 3ORJA 1GWMA 2WYFA 4CPBD 1WZXA 3ZYBA 2LROA 4BQ4A 2JWPA 1WMXA
chains in the Genus database with same CATH superfamily
1RUF1 1XBFA 2QE3A 3J7NA 3WSOA 1WCKA 4LHLA 1VMHA 1WMFA 4XCBA 2VCBA 2WQ8A 1HJGA 3AZVA 4Q4Y1 1C8M1 3Q8AA 4QQ2A 4AVSA 3A22A 1PIV3 2WZEA 4V2WA 4RL7A 4ZKTB 1QHDA 1OVPA 3J26N 3LSEA 1W6PB 4Y20A 1AYN3 1PVXA 3POWA 4M4PA 5K0UC 5DZFA 3GF6A 4E2QA 5T55A 5A6ZA 4P02B 1QNYA 3S0MA 3POIA 2G4IA 4JQTA 2TNFA 2OQ7A 5CA6A 5JPNB 1OLME 1IG3A 4XACA 4CYDA 2ETEA 2I2SA 2HEVF 5CVRA 4GB33 4YM1A 3DYMA 1WGPA 3VHRA 3POFA 1H9PA 4M3CB 2W52A 5C8WA 1DQ5A 1ZRRA 1NT0A 1V0AA 4E4DX 4Q4X2 1XYNA 2B9UA 4XETA 2WNUA 1RVF2 4FPKA 5L9BA 1PZ7A 5C3RA 1WD3A 1N47A 3K75B 3K46A 3D5OA 3AX4A 2EXJA 4IEQA 1Y9GA 5HI0A 1DIWA 4WVZA 4YARA 1G9BA 3JBG2 4RGGA 1HQWA 4XFCA 5FZCA 1PMJX 1SFNA 2VOVA 4NHXA 4AAXA 3SKVA 1UZYA 4YVSB 3WW3A 3C3VA 2VJXA 2Q1ZB 3RMYA 4DRVA 2BYVE 2HWE3 2JG9A 3HQUA 1OFSA 3EJKA 4LLFA 2JDAA 1EV11 1OOPA 1UAIA 3FFZA 2PHDA 1VBD1 3S7IA 2ATFA 1YFUA 2ET7A 1OLQA 2DVBA 2IXIA 1T2XA 1VAVA 2ES3A 4AHZA 5L36A 4FXKB 1OH4A 2OS2A 5CNAA 3TNPB 3BTZA 3BU0A 1C57A 2HWE1 3EB7A 5IYYA 3AL5A 4AE2A 3U75A 2DUPA 4BXSV 4FPYA 5IT6A 5F1RA 2PAEA 2YY1A 1PZ8A 3PJQA 4OHWA 1UU6A 4XIKA 3WHUA 1NCQB 2DBNA 1FOD2 5IAXA 3BALA 4CU7A 5BNPB 4QB2A 4J1WA 5CYYA 1HV0A 2C4XA 3UYJA 5HCHA 1AR93 1L7LA 2XUMA 1CGPA 2XQXA 1H6XA 3VBSB 1K45A 2JDPA 4XF1A 1UCXA 4Q4Y3 3O1RA 1ODMA 3OF1A 1U5ZA 1O5LA 3HNBM 3I49A 2FHRA 2DBIA 1OMIA 3ZXDA 4KU8A 4DXTA 5K9YA 4QHOA 2FDIA 2YFUA 3G7DA 2ZEZA 1ZBE2 2HWC2 2G9ZA 1V6KA 4CE8A 2GC3A 1SLCA 1XE0A 4O7XA 3AMQA 2A3XA 4XZPA 3WT3A 5F7UA 2ZGQA 3DEMA 2Z42A 3I54A 5FZHA 3VD7A 1EAH3 1RUE2 4OI1A 3SH3A 4YZ3A 1REFA 4WVWA 5LA1A 3OBZA 4FFHA 4KBBA 3M1HA 1DGRA 1OH3A 3MPPG 2RS13 5J98B 2JG9C 4DMIA 2C6SA 4XVHA 1AUYA 2GC1A 3I59B 3KQRA 3I2DA 4AZZA 1RUD2 4W6YA 3RZHA 4Y3OA 3IIIA 1SMVA 3N9MA 2XH6A 3NJZA 3U0ZA 2MEV3 3RS6A 2RR13 4KWLA 1W6NB 3S6PA 1RUH3 5C71A 5J37A 4BE3A 3WNNA 1GR3A 4K20A 4PQ9A 2PHLA 4QQLA 2X53S 1VRBA 2BOIA 2Q1FA 5A3NA 4QPYA 3O12A 4CRQA 1DG6A 2R043 4BQ5A 5FY5A 3POSA 1H4HA 5FZLA 5A3MA 1YWKA 3IBMA 4DUWA 1UO9A 4AK3A 1ZA7A 1CPNA 1O7FA 3BCWA 4K8FA 4ASLA 4KBZA 4LBNA 3NV1A 2F4LA 3VN4A 1MEC3 1WKYA 4LBKA 1KITA 5DDJ2 2PELA 2ZCWA 5F3GA 5ANNA 1DQ2A 3I3DA 2NQYA 3X29B 1C1LA 2W1UA 4ZONA 3I97A 2FZ2A 5KBFA 4PI0A 1W8TA 1PVC2 4LBMA 5DUVA 4W4ZA 3ZN4A 1PVC3 3ZSLA 3RRDA 1SZBA 4M00A 2CTVA 4IQPA 1MZEA 3CIHA 3K48A 4GWNA 1AL23 1CIYA 1URXA 2R32A 1MVQA 3AKRA 4IEPA 1BBT1 1QJU2 3HNMA 1LOFA 2ZXQA 2Q8DA 1OT5A 1CX1A 5C8CB 1QQP1 1LEDA 3OB8A 4XAAA 2IUWA 3AKTA 3B00A 4FPFA 5CFDB 3AMMA 2D5HA 2L9LA 4FFFA 4BLJA 4YFZA 4LPLA 1Q8OA 3OD4A 4P9XA 1QH6A 2RM22 2VQAA 3IMNA 5EZWA 2O1QA 5T5JA 5KC5A 1BHGA 1OLMA 2VZPA 1ZX5A 2HWF1 3WNKA 5IVVA 2NM1A 2UWBA 4OCTA 3WQBA 1TME1 4PHZA 3IB3A 3V0BB 1LKNA 2QNKA 5F5QA 5IHRA 2ZGKA 4QKDA 4Q0SA 1C4RA 1GLHA 2Y6HA 1G9CA 3WDUA 3CZJA 3KGLA 5CZKA 4YW1A 3KS7A 1J58A 3N9NA 2BFUS 2XWBB 3RZLA 5C3OA 5JWPA 1YIFA 2B5HA 3E1F1 4A7KA 3ZO0B 5D8AB 5FYHA 1CN1A 1UY3A 4N43B 4AEDC 4BQXA 1AX1A 3A4UA 5FZEA 3K4AA 1S2EA 1F31A 2KD7A 1HDKA 5F6LB 2RS32 1NYWA 3SMHA 1UN1A 4B4PA 1UZVA 5H9RA 1R082 2R7EB 2XJTA 5FY9A 4GAZA 1ZZ8A 1GNYA 4AFBA 5AC93 1FYUA 4NAMA 1F35A 3GJBA 5JXIA 2RDNA 2JD9A 2XR4A 1H8TA 4DOUA 2AC1A 2CY6A 3O1OA 1NE4A 1JI6A 3KVAA 3LA3A 4LUMA 5DAXA 3LDBA 1Z7S3 1YQ5A 1AXZA 4LO4B 2V72A 4QM8A 4A2UA 3VBOC 2E63A 1RL3A 4YG3A 4UFJA 3WINE 2W2IA 4FTSA 3H1YA 1QXRA 1SQ4A 2RDSA 3HR9A 2WZPP 4XFGA 1Q8PA 3ON7A 2D3PA 1QJEA 1Y9MA 2BRTA 2PHRA 2WKKA 2CWSA 2YC2A 4FOYA 1N1SA 1QJU3 2GNTA 4XQWA 5BNNA 1NCRA 4B1MA 1MR5A 4FQ4A 5FYMA 2FBEA 1WLCA 3POEA 3RG0A 4AR2A 3H1WA 5GLTA 1BMV1 1HQLA 3FLPA 1JOBA 3HEIA 4DRRA 4AEDB 1F2NA 5CKQA 4LOTA 1JUIA 1SBFA 1W9FA 4YSFA 2VMDA 5FY4A 3VKNA 4IGQA 3GZEA 1ASJ2 1NQDA 1V70A 4YGEA 5FZFA 1KJLA 3HAGA 5M0TA 1JZ2A 2VU9A 3GALA 3ZFEC 2JWPA 4IV3A 1L7QA 1MPXA 1QQP3 3AFGA 3V56A 2Y64A 1DU3D 3MIDA 1W0OA 3CJXA 4AW7A 1RHI3 4K8RB 4KNCA 3T1MA 1LODA 3DN7A 3JD71 3THDA 3LFMA 3S7EA 5I0DA 1K5JA 4YVWB 2VZ3A 5A6QA 1DGWA 1OI6A 4EN0A 3MPBA 4BZ4A 1HRI1 3A7QA 4HK9A 3CDZB 4FCAA 4WM8B 3CHXA 3MIEA 5D1IA 3VD3A 3KZ4C 4Q4W1 4RHV3 5CISA 1VB4A 2PQSA 5KWRA 4WV8A 1IQDC 3V64A 1J1TA 1CAWA 5A6XA 1RVF3 2EICA 3N9LA 3WG3A 3VD9A 5JXHA 2JE7A 2Y6GA 2BWCA 4C0BA 5A32B 2E26A 3PUIA 1O4TA 4HVOA 2RS12 2XJSA 2QBXA 2HWD3 4N7IA 5FY8A 1MEC2 1QEXA 1DF0A 1RUJ2 2WYSA 1WBFA 1D2SA 3FHAA 3HQXA 4RFRB 2IXJA 2XBO1 5FDBA 5J96B 4XUPA 1HJFA 2Y8KA 5DZEA 3AXEA 2WSUA 2E9QA 1UIKA 2KA3A 1OQEA 1L7RA 1QJY2 4RSUA 2FCVA 2GMMA 3MYXA 5L73A 1ND2B 1YI7A 1LRHA 3WNXA 4GH4A 3ZYHA 2VXRA 1ZZBA 5G04L 3OCPA 4Y22B 1JOPA 2WO3A 3PTRB 4LULA 1SEFA 2P3YA 5H9QA 4AEJA 4YW2A 3MFAA 2ADDA 2JB4A 4XXPA 1R1ZA 3CLPA 3CZUA 3I8TA 4ZU7A 4P9JA 5A7WA 4NRQA 1DQ4A 4F83A 5DAVA 2QDRA 1RJ7A 4UBHA 4ASMB 4NIGA 1OURA 4PQQA 3VBHB 2QQKA 4I2OA 2X5IC 1X9PA 2VBDA 3H8UA 3R0RA 4FPHA 1GKBA 2PTMA 1MS5A 5FO7B 1EPZA 1RTVA 2VC9A 1SCRA 4YW5A 3USUA 3H8XA 2C24A 3ILRA 1LHOA 3MIFA 1YQ6A 2AREA 2PHFA 5I93A 1UNBA 4FAGA 1S0DA 1Q56A 3MICA 2BEOA 4I3GA 4LIUA 1EAH2 1AR71 1GWKA 1IOAA 1RUE3 4OHXA 4Q4V3 3DXTA 3GBFA 4AAPA 5I91A 3J7MA 1QMJA 3VKOA 4YW6A 5HCFA 1HN0A 3B9CA 3ZSEA 1QJZA 3FBYA 1JXNA 2G19A 4S2GA 4YGDA 5FZ8A 1JZ4A 3HQRA 1ZZ9A 3ORJA 2D6LX 1NCQA 1UW8A 1ZBA1 2A75A 2W5FA 3FMGA 3IPVA 4XW3A 4L92A 1NZIA 4A6SA 3OGGA 4EN7B 4SLIA 4UFLA 3ZPOA 1BXHA 3WD5A 3FE5A 3OYWB 1UXXX 3A23A 2C26A 1JHJA 1UY4A 2VNVA 3TN91 1G86A 3AKQA 1POV0 2D6PA 4AGGA 4OUMA 3RYRA 1OUSA 4QPGC 2VMGA 4WBBA 5C5TA 2IXKA 2PHWA 2Q30A 4Q4X1 3WUCA 4PBPA 3SLIA 1TEIA 3ZYGA 5FZ1A 3FUOA 4CEWC 2R072 2W1SA 5F39A 5A3PA 2JG9B 4WVVA 4DEVA 4E4SA 1ULPA 2XWJB 4RGKA 5CB7A 4NVPA 5A3OA 4OLLA 4CDQA 1A6CA 4HVRA 2ZOEB 3M70A 3ALQA 5DAWA 1H30A 1KFUL 2XLAA 1Z7S2 1W6OA 4GWJA 1OPMA 4ARXA 4CUBA 5T50A 3AZWA 4R4XA 3RQ0A 4Q4X3 3RPQA 5K0UB 4RS5B 1EY2A 2QTWB 2VW1A 1UOJA 4MH0E 3SH4A 2CAUA 4Y1VA 5IVFA 2DU1A 1ND3C 1LULA 1KFXL 1D2QA 1MS4A 5IAVA 3ZN6A 2DVDA 3BYWA 3OPTA 4KQ7A 5JDBA 2XMLA 3U14A 1RMU2 3AZYA 3ZFGA 3EO6A 5DXDA 3RMXA 4LORA 1FNZA 1LCLA 1D0GA 4QX8A 2WO7A 4R9AA 3R4UA 1HRV2 3JB4C 1GOHA 2D43A 3K77A 1HXS2 1VIWB 3PURA 5FQ0B 5GZFA 1XPWA 5DDJ3 2DTWA 2CWMA 2Y0IA 2B7YA 2E51A 4RR3C 2GALA 2ZTNA 4CZSA 3NNFA 2ZGOA 2Y0OA 4Q1RA 4Y4RA 5KHKA 4Q1PA 4HG6B 5IUQA 1KS4A 4F8AA 4OI4A 1RYYA 4I0AA 3ZXEA 4LO8A 2IZWA 1FOD1 4PIYA 4Q27A 5LBBA 4COUA 3GM8A 1JYVA 3LIGA 4L9BA 4D8MA 1S1AA 4CCKA 1RXGA 3MF6A 4ET7A 2WN3A 2D98A 3N7KA 1IGOA 4JGZB 4R4ZA 3ZSKA 1GP6A 1KGYA 1UY1A 3WCRA 5KXDA 2IVIB 3UETA 4CEYB 3RZKA 2WNVB 2HLEA 5T3NA 1GYKA 1MZ5A 5I8YA 1R092 4ZXEA 2WL1A 4FFIA 4URTA 2RJKA 3C7HA 4QPWA 3N9PA 3RI8A 1IZ3A 1UY0A 2ZGNA 3QD6A 4LBLA 2HWC1 1RUF3 1ULDA 5DZGA 3QBQA 2A6WA 3AVSA 3W59A 2D3RA 1V6MA 3MGUA 4FPJA 4E2GA 3N3HA 2VXJA 4HT1T 5KXBA 5A33B 4C1XA 1POV1 4GWIA 3VZLA 1BYHA 1UL9A 4BDVB 1VPHA 1XU2A 2PYTA 1PK6A 3BTYA 2R1DA 1WLWA 1S4CA 2PHXA 5L9VA 4MHRA 2K9ZA 2IC1A 2Y6FA 3KT4A 2A5ZA 4O9GA 1SPPA 5LBFA 1G9AA 3PHMA 4GXLA 5ABJC 4NIDA 3DPRA 3RI9A 1SDDB 5IK5A 3LPFA 2OPWA 1Y4WA 3VGIA 4Y22A 1AR73 4GH4B 1A8DA 2KM2A 4IV3C 2JIGA 1CAXB 4XBLA 5SV8A 3KV4A 3ILFA 3R4DB 3VL8A 4ASKA 4KWUA 4UAPA 3ZFFC 4XAEA 4IDZA 2B8MA 2FCTA 5ANQA 1PGL2 2ORZA 3T0DA 1K5MA 4QXHA 4AYUA 2WS92 3GDBA 1F8VA 2DCTA 3U78A 3WG2A 3RZGA 4EWEA 3PMSA 3MUY1 1NAEA 5JMOA 1SDWA 2C9AA 3VBHC 1H8TC 3LCPA 1K5MC 3MLLA 2BV4A 4YYOA 4CEWB 2BBVA 3S5AA 3OGRA 3SNMA 3ETPA 2ZBJA 1JHNA 3ZYPA 4BMEA 4AI8A 1PVC1 3M8LA 2O0OA 3ZFGB 4URAA 5A6YA 4UWDA 4BHPA 2W3JA 3VHOA 1SG3A 4OMCA 1TMF2 2GMPA 1IHMA 3KV9A 3CJIA 3LGRA 3MUZ1 4UFIA 4R9BA 4YVWA 1G9FA 4GB31 2GP5A 4JVAA 4DPNA 5CFDC 5A7SA 2WABA 4Y1XA 4F7ZA 1UQXA 1V6NA 4BA6A 3LKJA 1RUF2 2UY9A 4FT8A 2J42A 4META 2QQVA 4ES8A 4B7KA 4AHYA 3TAYA 2JDNA 4Q4Y2 3I3QA 2JB8A 2JJ6A 2XLGA 3SH5A 1DZTA 3VD5A 1NQJA 1YFYA 2RM21 3I2GA 1JN2P 1GOGA 2ZZJA 2EVXA 2W95A 3HNYM 2XLFA 2CAVA 2AUYA 1DGRN 1WCDJ 4I09A 4LLOA 4D6SA 1ENRA 4AHWA 4AQ2A 1UX6A 1D0HA 2EXKA 2O14A 2P37A 2R1BA 3I7DA 4AQ6A 4D3WA 2OW4A 2VZVA 3SEEA 1CJPA 1W03A 1SBDA 1DFQA 3MIBA 4FP3A 2G9FA 2D44A 4RFT0 3NV4A 2RM23 4RYDA 2Q8CA 4DY3A 1QJFA 5F32A 3UKNA 5JXGA 4H14A 1S0GA 1W28A 2DF7A 2CGPA 3ILNA 2YC0A 3NNLA 1H1IA 2I74A 2EALA 2WA3A 5EFUA 4HVQA 1RUJ3 5DMYA 1ZRCA 3IPVB 2A6YA 1R64A 1A34A 1LTEA 1AR83 1LNSA 4PLNA 1FATA 4QB1A 5BXXA 3O1UA 4RR3B 3PLQA 1XNAA 4JGYB 1QGLA 3GZUC 1W8OA 3VV1A 5JOZA 2Z69A 3WOGA 3RZJA 4XMAA 3MHZA 2DV9A 3UL2A 5BNNC 2ZGTA 5C4WC 4LE4A 4FP2A 1NLQA 1SBEA 1JZ3A 2ZZQA 1RGSA 1VBD2 3AKSA 3VBRB 5B2GB 4LKSA 1S0EA 5E89A 5JI7A 4AVVA 3I3MA 2VH9A 2KR2A 1OXCA 3O14A 4FXGB 3ZM8A 4BB3A 5FUNA 3VZOA 1FX5A 3T2QA 4DUXA 1K42A 2WNVC 4HMZA 1NE6A 2YFZA 4OULA 1AHSA 4UBGA 5D8AC 1LGNA 1IS5A 3ZYBA 4ATEA 1GZCA 3B01A 4KG0A 4FBFA 2ZGLA 3OUJA 4I01A 5K0UA 2OKXA 2W68A 1S55A 4TZDA 1W6OB 4EWAA 1DYKA 1BMV2 5EWSA 1MACA 1ND2A 4CCJA 4PIZA 5D2AA 3KV6A 2IFWA 4NIAA 3NV2A 3INAA 5DUWA 2RDRA 1D7PM 3ZVXA 4EZ4A 3TEZA 3VZMA 5A1LA 3I2JA 3CEWA 1PIV1 2VMHA 1A3KA 3TB0A 4QQOA 5FPAA 3NAPA 4Q26A 2A71A 3SCHA 4CUGA 1SPPB 4MGYE 3PMEA 1V9U1 3LEKA 4GIQA 2Y38A 1O3QA 2YC4A 1IKQA 2K46A 5C9AB 3E6DA 1B35C 4LQRA 1AL21 1WZXA 5LW9A 3WXPA 1ZRFA 1OPOA 3MLKA 4E8CA 4XBNA 1RUH1 1TVGA 3AZXA 3M7AA 4LO6B 2LUWA 2VZRA 2X8KA 5AFEA 1I1EA 1XNTA 5FY7A 3ZXAC 4EZHA 3IDCB 4GKYA 2BP6A 5FK7A 3HBKA 4UW6A 2VZTA 2V09A 4YGCA 4LK7A 2ZX3A 3M3OA 4JC1A 1UYXA 3IMMA 1QDCA 2ZEXA 4XF3A 4Y1ZA 5FY0A 4XE9A 4E9KA 4F3JA 2JICA 1XE7A 1GNHA 2VUDA 1MEC1 4Q8LA 1XNBA 1RUJ1 5IWFA 4BCUA 1RUD1 5HPOA 1BCXA 3POJA 1PO13 2OPKA 1XOYA 3O1PA 4COVA 1RITA 2VZSA 1O59A 3WHTA 4AHXA 3NWKA 3PIJA 5DUXA 3J8F1 4PLOA 4MADA 3A0KA 1GZWA 1Y9QA 3SITA 2W47A 5FMOS 4BYYA 1DYOA 2BPA2 2VAUA 3RDIA 2FMDA 3EMRA 4QGNA 4NAOA 3LQCA 3DKWA 4NWVA 5IK4A 3PVEA 5JOXA 4FPEA 4DFSA 2UY8A 4ISRA 4CCCA 4YZ5A 4NHMA 5FQ0A 4RA0A 3WQ0A 1PMIA 2EXIA 4A3ZA 5KXCA 2WT0A 3PIGA 4COYA 1RINA 4IW3A 2A6ZA 5CKMA 4CDXC 4G4FA 5F9TA 4HKLA 1I6XA 4W50A 1AF9A 1EAH1 4CCOA 2PMWB 4Z1VA 4L2NA 1W05A 1CWPA 3NQHA 4QKFA 2AH2A 4HPKA 3BTAA 4OI0A 4XILA 2EAAA 2K2SA 5BY5A 3IKWA 2UYAA 3W5MA 2QJVA 4MXWA 2WWJA 3OBTA 1HV1A 3LAGA 1QJU1 3HD8B 1ZBA2 5SV5A 4BISA 2MEV1 3MEPA 1C5IA 2A1XA 4P14A 2R6QA 1AYN2 1OA3A 1V00A 4YPJA 2MNGA 4EYUA 5LRRA 3J7LA 4CEWA 3B3QE 3ZOIA 4TWTA 1W9TA 1AR62 4LJHA 3V0AB 4QD2A 4HK8A 1V9U3 3Q8FA 5C5UA 3VBSC 3NNMA 3BKZA 1QWRA 1O8SA 2WWUA 4LHSA 4IEUA 3OSDA 3TEXA 3H7YA 3VKFC 3RZMA 2F6BA 5C6CA 1QJY3 1V6LA 2CHHA 4OUEA 1B35B 4PJYA 1TME2 1GZ9A 5T5OA 1OD5A 5GLVA 3SCGA 5FKCA 3OYWA 2QCSB 1MQTB 2R0FA 3AP6A 2TEPA 4KWKA 3DXUA 5FZ0A 4CU9A 1RUG2 4D69A 4IEYA 3W9AA 4BWOA 3KT1A 3WNLA 1EUTA 2IXLA 2A6VA 2VMEA 3ZMOA 1RUI1 3FWEA 3OY8A 3NAPB 3GHNA 4ISQA 5E16A 3ES4A 5E88A 5GLZA 4ZZ8A 1J3PA 1C1FA 1YFWA 2QQIA 3WF0A 3PVNA 5KC6A 5BNNB 1FI2A 2YB7A 3ZR5A 2Q4SA 3OGVA 4ONUA 3ZXJA 4CDUA 5EIYB 3WV6A 4EE2A 2WYFA 4HLTA 4QGMA 4R9DA 5LASA 1FMD1 2WRAA 3T3YA 4EROA 2P2KA 1IPJA 4JHZA 1CX4A 4OUSA 2R041 4UF0B 2E53A 1KDMA 1X82A 4QX7A 3J8F3 4KGQA 2E6VA 3BPZA 5J36A 2AEYA 3USUB 2XONA 5FAXA 4A7ZA 5A3LA 5BNOC 3C7GA 2VGDA 1GZTA 1QF3A 3BOWA 2BZDA 4FVVA 3VKLA 1YLLA 5CBLA 3AMNA 3D0SA 3T4HB 1C8M3 4JDMA 4UYBA 3T0AA 5FYCA 3AP5A 4IUGA 1H2MA 3VZKA 3AK0A 1S0CA 5HV4A 1VRH1 2QQLA 1WUVA 4Y24A 1HIXA 5C9AC 1U5YA 4JGZA 4HFSA 5FPUA 2GSYA 5KXEA 2VNRA 3FLTA 4P08A 2R061 4ZS2A 2W1WA 4Z2AA 4DINB 2P17A 3VLBB 1CAUA 1NLRA 1GWLA 1A78A 2A70A 4Q29A 1K5MB 4GMP1 2WO1A 1KQRA 1X50A 4XUQA 1UY2A 4HOOA 1PK6C 1ASJ1 2WDBA 3ACLA 3NV3A 3LDKA 1U12A 2PA7A 5CIRA 3L9JT 4NIIA 3T30A 2OYZA 4P5HA 3T09A 3BOPA 4GALA 2OX0A 1UOGA 3D4KA 1G6NA 4IV1B 2WFF1 4INDA 5FZDA 3VDDC 3VHNA 1AJKA 3JUUA 5FZAA 3WW2A 3JD72 2JKXA 2BQPA 1US2A 2SBAA 1F9KA 2ZX1A 1N3PA 4BLIA 1X33A 4EWDA 1DBNA 4BQ4A 3THPA 3WP4A 1SFPA 1HRI2 4GMP0 3WVJA 2WO2A 2YXSA 4UI9L 2X29A 4AFMA 2AENA 3TWIA 2VVDA 2WFF3 1NCRC 1XYOA 3O0XA 4MXVA 5CFCA 4P5YA 2J1RA 1YUDA 2OUHA 4P9IA 4W8JA 1FV2A 3LIHA 4CXWA 2PAKA 1PO23 4TLFA 5JAXA 3TYJA 5LB6A 3ZFEB 3LOIA 2UWAA 1C28A 4BXFA 1ZA4A 1JZ5A 3BTXA 4Z8BA 1GUIA 1B09A 5C33A 4CEYC 4BQ3A 1VP6A 2VCAA 4ZXKA 3LFIA 1QOSA 4K21A 3P6BA 4YVSC 2XGXA 2WS91 2P34A 2OXBA 1CPMA 4K9SA 3IWZA 2HWD2 4IGPA 1XSQA 2D5FA 1Q43A 4XYXA 3WZ1A 1GQHA 4C0HA 5JZGB 1CIWA 2RR12 5CKNA 2XJRA 4IV1A 5EP9A 4GD4A 1IKPA 4X8NA 2XKPA 1OA4A 3H8RA 1ZM1A 5CFCC 4TTGA 1QDOA 4RHV2 2WLQA 1OQ1A 1JH5A 1PX3A 1UPIA 3I4IA 3PUQA 1FV3A 1H6YA 2VTXA 1GU3A 2FZ1A 4M01A 2HJIA 1STMA 3IDEA 4XEZA 4I3PA 1DGLA 1JMUB 5F5CA 1WA4A 1SCSA 3AMHA 1OC1A 1T6BX 2WBKA 2WZ8A 2GH8A 4JAAA 4D7SA 2F17A 1JOJA 4IE4A 4Z92B 2XVLA 2GU9A 2QDNA 2TUNA 1OSGA 3QCWA 2NYYA 2DUQA 1XC6A 1RMU3 2LS6A 3FUQA 4IERA 2VCCA 2W91A 2R49A 2V5YA 3GNEA 3OJBA 3PVOA 2QQJA 2ZHMA 1PHMA 4QB6A 2JXAA 2W46A 3H0OA 2W87A 1KXGA 5D8AA 1O91A 4H3WA 2W39A 3B93A 4HPKB 4O65A 4NHLA 4QX0A 2XL7A 5DG2A 4AFAA 4JTNA 3N7LA 3MV11 4KL1A 2WLPA 1VMJA 1TQ5A 3VBRA 2XDVA 5EHDA 1PK6B 3J7HA 1Z78A 2YBSA 3K4ZA 3ZYIB 2R073 2Q1MA 2RE9A 3O0VA 4E4HA 4JCKA 4YW4A 4NE9A 1X9TA 4LR4A 5IJRA 3ZMNA 3TN92 2WR9A 5LA0A 2XHKA 3GXUA 2BERA 3GHMA 2YGLA 1ENXA 4CDQB 1ULEA 1WA6X 4EV0A 1HB3A 4JGYA 3N7MA 4Q5OA 3SCFA 3LSDA 4KH9A 1TMF3 5FOBB 2ZX2A 2VQ0A 3CMGA 4IE7A 3KV5A 1NUKA 2R071 5GM0A 3K3NA 4KU7A 1W39A 5CU1A 4IE6A 2XJUA 4AQSA 4CPBA 1LGCA 2QKDA 4HSJA 1PNGA 2BNNA 5K4LA 5F3CA 5H9PA 1Z7S1 1PO21 4UFKA 2VMFA 1CAVA 2VG9A 5A3UA 3M2MA 1TE1B 1R083 3ZPYA 4RD7A 5DAQA 5CADA 3ECQA 2PQQA 5BNPC 5JCTA 2ET1A 5J1XA 2J1TA 3ELNA 1N1VA 4P9LA 5JXJA 5FXXA 2NPIA 4L99A 5F6KA 5A70A 1Q8SA 4Q4V2 5B4XA 5IW0A 2BGPA 4XFFA 1OLRA 3MI8A 2BGCA 2AYHA 4S2FA 1OF4A 4YLZA 5FYSA 4DO0A 3RJRA 2XG3A 2VOXA 3ZYJB 3GZTB 1GBGA 2DFCA 1IG0A 1OKOA 3UK9A 4LO5B 4NIHA 1JYXA 2J1VA 2OVUA 2DVFA 4CUCA 1XB9A 1H9WA 5A7QA 1SLAA 2JDHA 4AGVA 4A44A 3CQOA 2ZX4A 3TOJA 4JKMA 2C0ZA 4MXWB 4AXOA 4JV4A 1XYPA 1H1MA 3G6JB 3VBHA 2ZMKA 1WD4A 1GQPA 1NZCA 4XJUA 1ACCA 2R0HA 1BJQA 1NY71 4LE3A 4HKWA 4AL9A 4AI0A 1TME3 3H42B 1KDKA 2ZMNA 5ACA2 3JXSA 3SEPA 5F5IA 2HWB1 1ULCA 4UW3A 1DQ6A 2EIBA 1BK1A 1UXZA 3O1VA 1ZRDA 2XHNA 1SACA 1AYM2 1BK0A 1V9U2 3WDXA 1HN1A 5JIUA 1Q3EA 1G9DA 5G05L 2Z79A 1AL22 1R091 1LGBA 3D0JA 3GBWA 1HRV3 5T52A 1RUNA 2XKOA 2JECA 5FLIA 2VPVA 2DDUA 3H7JA 5FR3A 3WDVA 3BODA 1H2NA 5BYNA 2EIEA 1KS5A 2PHTA 5FTTC 3I3BA 4C8DA 5I0RA 4HONA 2OZJA 4XZUG 3ZXFA 3KD4A 3FJSA 3KWVA 1CAWB 4LTAA 2BJSA 4LITA 1LOGA 4R9CA 5A32A 2O8OA 4HN1A 1R1A1 2LTNA 4NMIA 4MZUA 3RVHA 3ZSMA 2XVKA 4WM8A 1WMXA 3DUIA 3FL7A 1NKGA 2ZAHA 1YXWA 1W8WA 1WCQA 1O3TA 3HVDA 3T0BA 5AC91 4RQPA 4AWDA 1O3SA 1OBNA 2BFUL 4LHKA 4W6XA 1DZQA 4UFHA 3DYOA 3VBSA 1JYNA 2PN5A 2WC2A 2Z2SB 4DY5A 4Y4YA 4Q0QA 4NN0A 4XFBA 2VR4A 1WWYA 4IETA 1LOCA 1SLTA 2VZQA 4R52A 3RNSA 2VMIA 3FC0A 2HEYF 4IEXA 1Q8QA 3H3UA 3V65A 3JCIA 5FP4A 2H6CA 2A3YA 3GCXA 3M4FA 4DZGA 3VDDA 5HXMA 2VW2A 4GZ9A 2KXLA 1GOFA 1AR81 4IL7A 2XJQA 2ZS6B 4GJYA 4AFDA 1D4M3 2WA4A 4AEDA 2H6BA 4BJ0A 5FMOL 1JYTA 2DCKA 2WUHA 2DU0A 5FXVA 1QJX3 4N53C 1PX4A 1GP4A 3KCCA 1WW7A 4XQDA 5C3PA 3J4UH 4J6GA 4CP1A 1VBB3 1FNYA 3E5QA 3OY8B 4CCDA 2WZR3 1XNCA 4LO7A 3AMPA 1DGWX 3HT1A 2CYFA 2A7AA 2PXJA 4HSLA 4XF0A 4P9WA 1TMF1 4XTPA 2HYKA 4MGSA 5BNOB 5C70A 1RUOA 2QUOA 4J25A 4UW4A 3E6BA 4WM7B 2CV6A 1WW4A 3NJYA 1A8MA 1VR3A 2B46X 2LROA 1LJ7A 1N1YA 2MEV2 1RUD3 1AYN1 1NX9A 1XJAA 4BK4A 1BBT3 1GNZA 1ULFA 1F4AA 4JRAA 1LOFC 3PVBB 4AEMA 1FT9A 2P1BA 2BVVA 1WMEA 4UT5A 1PGW2 2UYBA 4IV1C 4N43A 4XF9A 4NROA 4MHUA 4XUTA 3QLQA 4Q0UA 3F2ZA 4A45A 3WF1A 4YG0A 3KT7A 3B94A 1W2AX 2R30A 1W9YA 4MGKE 3PUHA 4Z07A 1RUG1 2ARBA 3URFA 4ZZ5A 4CXYA 3LOBA 5C3SA 5A1FA 3WF3A 1UPSA 2D6OX 4LHNA 3U07A 1W6NA 1YC61 1YNAA 1AR91 4UF0A 4MOAA 4QDQA 5A80A 1BVVA 4QKNA 4RGAA 3ZKUA 1CD3G 3LB9A 2OIIA 1V6OA 1GANA 3SHRA 1DLCA 3UGGA 2GDFA 3WG1A 3KF5A 2W94A 1I5PA 4EJRA 2H0BA 3I2FA 1W8UA 5A3TA 3GZAA 3JZVA 2AACA 1ZNPA 4LNVA 2ERFA 4P00B 2RV9A 3H50A 4XPVA 2EIGA 5AFBA 1JZ7A 2ZX0A 5ABJA 1BQPA 2PHUA 4Y1YA 3RYPA 3VB9A 4AVTA 4FSJA 3NO8A 5FXWA 1ZREA 4PT6A 2VUJA 3DGTA 1VBA2 1YJKA 1XRUA 5FO8B 1PO11 2ZHLA 3P3NA 1WBLA 2OA2A 4XMIA 1B35A 3O1MA 5F3EA 2RDQA 2P6CA 4FOVA 1VRH2 1U0AA 2NP0A 2LW8A 4BIFA 4OHYA 1ULOA 2TBVA 5LY2A 1ZZCA 2ARCA 5FWEA 4V2VA 1W8FA 4GA9A 4LK6A 1W2UA 3C2UA 4QPIA 4CTEA 1OVSA 2R062 4YNIA 1JZ6A 4N53A 4CSWA 5EXOA 4JGYC 2WQ4A 3BIEA 4N43C 2ARAA 1H8VA 4D7YA 1IS4A 4IE0A 5ISLA 2FDHA 5FZGA 2GN3A 3LA2A 1QU0A 4N90A 1PIV2 2ZPXA 5FLJA 4ARYA 3WW1A 3ZXLA 5JLVA 1KJRA 1CESA 4XUNA 2P3KA 5LY1A 4AI9A 3ZIXA 3U4XA 2RG4A 2ZKNA 4LBQB 1LAJA 2XL9A 1W2OA 4HN0A 2VCMA 3ACIA 4U2AA 4K6BA 1VJ2A 1W9SA 4ZPIA 5KHGA 3O1TA 1NA1B 1UU5A 1LECA 4QHZA 1OOPB 2V5DA 2VECA 1RUH2 3AYDA 3HN1A 4XJ8A 5BV6A 3ST7A 1VB2A 5JR2A 2PLV2 3Q9OA 1WCUA 4ZU4A 3IAPA 3CBNA 5LK5A 1HB2A 3HBZA 4XBQA 5H9SA 3USSA 4CPBD 1JW6A 3UGFA 5L19A 5C7GA 1O4ZA 1JYCA 3WW4A 2VM9A 4UW5A 4O61A 3SXWA 2VNOA 4XDPA 1CVNA 1WLDA 1VBC3 5AVPA 1AYM3 4YVWC 2HH9A 1GQGA 4QPGA 5A7OA 1E5RA 1O4YA 2Y6LA 2C5DA 4NPLA 4JHTA 5D21A 3UKVA 3ZFFB 2ZEYA 4MUVA 4WM8C 4RS5C 3UNPA 1MQTC 3Q8CA 4QPGB 1AL0G 2HWD1 1ZBE3 4ZY9A 5A33A 3J8F2 3PJYA 3BIWE 4QQHA 3ZFGC 3FHQA 1JYWA 2DVAA 5FMBA 1RB8G 4QPIC 2A6XA 2XVGA 3NKGA 1LHWA 1NCQC 4GQ7A 1UKRA 4QKBA 5CAZA 4FTBA 4GJZA 3T2TA 5FYTA 1SLBA 3OUHA 2GH2A 2WN2A 3AKPA 4RR3A 1F5JA 2ZHKA 1GSLA 1JYIA 1WCSA 2JKBA 1MZFA 1W6PA 4K7JA 1GICA 1VE0A 4B29A 5FXZA 3DECA 1RHI1 2ENRA 2VBBA 3HIFA 4IESA 2JDUA 5FMDA 3ZXKA 4K1ZA 1K3IA 5FZMA 4E4ZA 2QQWA 2NN8A 2YBPA 2F4PA 1HKDA 3DYPA 4MYEA 3U37A 5FBZA 2HYXA 3GYDA 1AXYA 1YQCA 4LBQD 1QNWA 2RS33 3E5UA 2D93A 2VBPA 3KQ4B 1Y3TA 1YEWA 1NCRB 1UMIA 4YM0A 5L7OC 5C3QA 4MGZE 2V4VA 2YYOA 4Y5Z0 3MBWA 1BEV1 4K1YA 4LIVA 5JSRA 3E6CC 4TLGA 1LHVA 2XUEA 3I59A 4CP0A 3WQ1A 3KGZA 1K12A 3D3AA 3EQEA 4TN7A 4XJZA 4HL0A 1Q8VA 4FPCA 3OG2A 5EV7A 1RUI3 1APNA 2P3JA 4Y5SA 4AGRA 3ZX7A 2DCYA 1VMFA 2VL4A 3RJ2X 5FYYA 4QPIB 1AR61 4JDNA 4GULA 3AP9A 5FK8A 2Y26A 1W90A 1LHUA 3QOPA 4ZHNA 3PTYA 3P3PA 1O5UA 1V6IA 1XE8A 5L9RA 3T4VA 3W58A 2VZOA 1ODNA 2C1FA 1DQ0A 5IK8A 3T2PA 5JUVA 1MVEA 1Y7BA 2VQUA 1Z0HA 3KHBA 1PM7A 1W9WA 4IE5A 3EYPA 2VTFA 2WNUB 4DEQA 2JG8C 3WP6A 3WP3A 2YGMA 2BNMA 2ORXA 3ASIA 2WJSA 3ENRA 3HJRA 1ZRIA 2AR6A 3WLUA 1RUI2 1PO22 2VE1A 1H0BA 4C1WA 5ABJB 2XJVA 5HV0A 4H7LA 5IATA 1QKQA 4QM9A 1LU2A 5JVVA 4Y20B 3ZYFA 1IPSA 3OTFA 1XXNA 1PM4A 5FKBA 5FUIA 3C7FA 1KRIA 1SHWB 1FMD2 1AX2A 4PIXA 5F3IA 4CVUA 2FCUA 4FTEA 4X8PA 1HRI3 4Q4V1 1OA2A 2R042 2R063 3NKTA 5FZKA 3T08A 5A1AA 5A7PA 1VAMA 3LEGA 2I07B 5BPXA 2C9KA 4OQ9A 2J1EA 1HX6A 2WNEA 4BQYA 1CAXA 4CP9A 4OI2A 2QQUA 4XXAA 2B9VA 1W2TA 1W6QB 5CFDA 5IVEA 5L7OA 5FP9A 1SFYA 3DKQA 1GFF2 3KM5A 2ZABA 4L0PA 3ME2A 4L8QA 4PI2A 4NPMA 2WNUC 3UT0A 1EYBA 4IEVA 3MIGA 3I2OA 5FLHA 4W6WA 1UMZA 3P1IA 5I0TA 5ACA1 4OHVA 2ILMA 2HWB2 1HB1A 1PGSA 2QQOA 1J1LA 3OPWA 1LR5A 4ORFA 4XDQA 5CFCB 1UZZA 4V1PA 1AYM1 1W8ZA 2CL2A 3R6SA 4WM7A 3DPRC 1DDLA 1DP0A 3I2KA 3MLJA 1ND3A 3CJIB 4JKKA 3DF0A 2BW8A 1UYYA 4Q0VA 1UOBA 2ADEA 3VUOA 2QVSB 3JB8A 4LKFA 5A7WB 1QOOA 2WFF2 3LD8A 1ENQA 2D6MA 1D4M2 4OFGA 2J22A 5E6HA 1FXZA 2WQZC 1BVP1 1DZRA 1JU4A 3PU8A 2HWC3 2RS51 1R1A2 4IGOA 2WS93 2GN7A 2XXZA 3BGAA 3LDRA 5T5PA 1VBE1 3WG4A 2P5BA 5FWJA 2B42B 1N3QA 4HXCA 2VOWA 3NRUA 2IFRA 2WFPA 1JU3A 4Y33A 3NMBA 3VBOB 4LXLA 1JZ8A 4LA2A 4HBNA 3VD4A 5FMCA 4BM8A 3M3QA 2NLRA 1PNFA 4AQTA 4O9EA 1RC6A 4AFCA 4MVTA 4XF4A 1UU4A 3VBUA 4XFAA 3FLRA 3K2OA 4B1LA 2D40A 1C8NA 1COV2 2H0VA 1YCIA 1RUC2 2NMNA 3N35A 4GMP3 4MO3M 2NZ9A 4PLMA 5FP8A 4FPLA 4I30A 4KMQA 2ZGSA 1W6QA 2PFWA 5FY1A 4KGGA 5DUUA 5EJ1B 1HQNA 2WZR2 2DFBA 3UJOA 4KWJA 1XNKA 3NJVA 2RR11 3I2IA 1J59A 4RS5A 2UWCA 2V4AA 3UESA 1OQDA 1VBC2 2Q0AA 4YFWA 2MPFA 4IV3B 1VRH3 3TRSB 1QJX2 1YFXA 5FIXA 4Q4W3 4RHV1 4NO4A 2JDMA 4MGQA 2E32A 2MHFA 3N9OA 5I0UA 3WDYA 2WWSA 2EF6A 2VULA 3THTA 3L2HA 3OBRA 1E5SA 1LEMA 4AVBA 3LEIA 1Y43B 4DUVA 2EAKA 3A0NA 2EA7A 1CJDA 1POV3 3S57A 5E8AA 4H2AA 4EQVA 4XABA 1CQ9A 4IEWA 1YYNA 1V6JA 3OBAA 4LOSA 1U5IA 4OYUA 1U5XA 2Y60A 3AC0A 2QQMA 4I0WB 5C8CC 5KHJA 4QX2A 1OFNA 4NHKA 4PDWA 4HANA 4CU6A 1PGW1 1GWMA 2WAOA 1VBD3 5FP3A 3A21A 2FDJA 5I8TA 4AVCA 4HETA 3AXDA 5JOWA 3V0AA 2LM3A 3T1LA 1H8TB 5FPVA 4DXZA 4BQ2A 3VBUC 1RJ8A 4OMDA 4CUAA 5FPXA 4Q2FA 2ZACA 1JTZX 3HN3A 4JKLA 3MV01 2WNOA 3VDAA 2JDYA 4Y5TA 5LA9A 3IM0A 3THCA 3SQOA 3M3CA 1COV3 1VBB1 3ZN6B 5FZ3A 2ZGMA 3CF6E 4H55A 1AJOA 1SLIA 3VBFC 2FDFA 1W0NA 1OHFA 3PL0A 5EPAA 3ACGA 2BDRA 5T54A 4L11A 1WMDA 2YHJA 5FYUA 1T6GC 3JBG1 1J3RA 4BH9A 5ACA3 3WF2A 2VVEA 3RGBA 1ZYBA 1MS9A 2RJ2A 3DV8A 1W04A 3R05A 1XNDA 1LESA 4OZXA 2OQ6A 5FOJB 4DB5A 1H1AA 1BKZA 5EJZB 3V0BA 4XJAA 2W9XA 2E7AA 1VBA1 4Z82A 5FUPA 3VBRC 2WIIB 1PO12 4M3CE 5DABA 3VZNA 3QH6A 3ZYRA 2GC2A 3HT2A 1EV12 1ZVFA 3ABZA 2JDKA 1YIPA 5EYXA 5I8SA 1G8WA 1M4WA 1UIJA 1EPWA 2IWGB 3NNJA 3Q8BA 1JUHA 4QX5A 5LRSA 2XPJA 5DPNA 4QAWA 2ID4A 4BQ1A 1OF3A 2E31A 4IEZA 3B9IA 2Y33A 2ZHNA 5C8CA 5F5AA 2DURA 4QT6A 1VLNA 3ACFA 3I2HA 2O8QA 4RN5A 1F15A 2HBTA 3P5BA 3WUDA 1WW5A 4AF9A 4YGBA 4D94A 4QWNA 2WT2A 4GKXA 3VHPA 2ZAAA 5EQUA 2JDZA 1NY72 1XU1A 2XJPA 1ONAA 2ZGRA 3AYAA 3PNAA 5BUVA 4NHYA 1YQ2A 2BUKA 2AZ5A 4GWMA 5LCWL 1W06A 1H2LA 1O8PA 4CCNA 3VBUB 4DNYA 5BNPA 3IDBB 4YZ2A 1NG0A 5B4NA 1QXJA 5JPMB 2R16A 3ZFFA 3BB6A 5GZEA 3ZDVA 3MDPA 2HBUA 2IXCA 3AB0A 5FO9B 1POQA 2BWAA 4I0BA 3BN6A 2CU5A 3VZJA 4YW3A 3WDTA 1I9RA 1MZ6A 4QMAA 2YV8A 3AM2A 3IN9A 4LBOA 4WM7C 5F8PA 2X5IA 4L97A 4B4RA 2PLV1 4MGTA 4LBQA 5FYBA 4PDWB 2NMOA 3B7MA 1YQ8A 2RMU1 4QU1A 4S2HA 4JTOA 3APBA 4S2DA 4ATFA 5JZGA 1LOEA 5LWBA 3FHIB 2P3IA 3S5QA 5K8SA 2W92A 3AYEA 5IVCA 3JU9A 3M3IA 2ZMLA 2BVBA 4D6RA 4ZU5A 1QOTA 3H3ZA 3WEZA 3Q8EA 3TEYA 2CGOA 3WQ7A 5K7PA 1AVBA 1LOBA 1RUG3 5GZGA 2JD4A 3BVCA 4M0NA 2WSVA 3POYA 4CDWC 4CCMA 4J1XA 1CZVA 2D6KA 3O5SA 2IVJA 2JIJA 3OEBA 2X10A 1FAYA 4IEOA 4DS0A 3NAPC 2HEWF 1NA1C 3D82A 5BNQA 2ZEWA 2ZA9A 2RVAA 4HKOA 2QZ2A 1GP5A 2VW0A 5LBCA 1RIRA 3UGHA 4WZFA 3NNGA 3ACHA 3UV9A 3PUSA 4MSVA 4NUBA 3R4SA 2OUJA 1AR82 4N9IA 4YZ1A 5J7MA 2FDKA 5JIAA 4B8EA 2DVGA 4A41A 4LA3A 1FPN1 3C8XA 4WZCA 5FZOB 2XQRA 3OPZA 5FYZA 3E5XA 3WY6A 1W99A 4YWAA 2EXHA 4G9SB 1ZBA3 2ZGUA 3WF4A 4D0QA 1RHI2 4FAHA 4BQWA 4Z2WA 1E5HA 1O3RA 3I3EA 2ZJCA 4QGLA 3TNQA 4K3UA 5JMCA 4QX3A 2VMCA 2QQPA 5A3WA 2YUEA 1ZZ6A 5FREA 2D6NA 3LF7A 4NWWA 1S0FA 5KHHA 1FPN3 4BK5A 2Y34A 4JZRA 5DN2A 4EN9B 1X7NA 4HZFA 4MLOA 4N7UA 4CP2A 4COWA 4CDUC 1BEV2 5FYVA 1OKQA 3T2OA 3FZ3A 3LWCA 5FZ6A 1I3HA 1QQP2 4XHBA 2Q8EA 4YM3A 1ULGA 1YI9A 5HCBA 1CAUB 5FJKA 2X05A 5JSPA 4A6OA 1C8M2 5FBJA 4TSVA 2UU8A 3S30A 5FFOC 3AL6A 1W8NA 2X09A 2HWF2 3N36A 4JQRA 3IAQA 2ARXA 1YHFA 2VZ1A 4X6RB 3IZOA 1CZSA 1TNRA 2QQNA 3RFRA 3H8OA 3FX3A 4DIQA 3GJAA 4AEKA 2QZ3A 2FQPA 1JODA 4WVMA 1UF2C 3HWJA 4FFGA 1JS9A 3H3LA 3KCXA 3W5NA 2JENA 4NRPA 2QFEA 5LATA 2AEZA 3IIAA 3PU3A 5FZBA 5DAPA 5GZDA 1J84A 3POBA 1IPKA 4NR1A 2YDEA 2BU9A 1AR92 4YW7A 4PF5A 1CR7A 3MZHA 5IVYA 5FZIA 4A4AA 1RVF1 1MS0A 1F5FA 3AP4A 3HOBA 3K3OA 5FPBA 4GH4C 4FPOB 2JG8A 2A73B 1VAKA 1H2KA 2RS31 2W08A 1F4HA 1S0IA 4MGIE 2I45A 4XFHA 4XHXA 3N4MA 1NLSA 1UYPA 1GMMA 2XBO3 1BEV3 3U11A 1D4VB 1Q5OA 1N3OA 4MX3A 4C90A 3UJQA 1CONA 1FMD3 4AI3A 2XOMA 4CDWA 3E97A 4PDWC 3MW4A 3HMYA 1US3A 1MQTA 3WP5A 4UFMA 2P6HA 4CCEA 4NOTA 1DLLA 2GAUA 3ATGA 5FRAA 3CL1A 5GLWA 3RWNA 4XDOA 3FFQA 5LA2A 2IXHA 1LENA 4CCLA 3ZLIA 2HWE2 4FI9A 5T5LA 3J9SA 1W8HA 3PDQA 1IS6A 3C7OA 3KB5A 3MW3A 4PBOA 2J1UA 5GALA 3BU7A 4N8MA 1OUXA 4PCRA 5FPZA 3VL9A 3OOXA 5C9AA 2VD7A 2JG8B 4Q8KA 1LU1A 1S2BA 1W6MB 2BOJA 4W65A 4AVAA 4OHZA 4A7YA 3ITQA 3U4SA 4BU2A 2DWRA 3MF9A 1ND2C 3CO2A 5KHIA 1XSRA 3GGLA 2RHPA 1XQNA 4IXLA 4LKDA 4QU2A 4FQZA 4XOGA 1ASJ3 3VBOA 1HXS3 2Q5TA 4OVEA 2VTXJ 5CG8A 2YU2A 3ETQA 3VDCA 4LBJA 3KVBA 4LT5A 4XCAA 2RS52 3IT8A 4FOWA 4E8DA 3ZR6A 1VBE3 4BIOA 1VBE2 1W3VA 3BI3A 1ZBE1 4JDOA 2BTVC 2VUAA 3KMHA 3OGJA 3WR0A 4AOCA 2EIDA 2WT1A 1DCSA 1OD3A 1ZZ7A 1RUC3 4Q4W2 3IDAA 5FZ4A 1AR63 1UWWA 4FPGA 5C4WB 4QXCA 4SBVA 1UZ0A 2B4KA 3AJYA 1RUE1 3AP7A 3WDWA 4M4RA 1GZWB 3U1XA 1E57A 5LEJA 2W1QA 1WLTA 1ND3B 4UOJA 2RS11 4A3XA 4H7MA 3BPSA 4TXWA 4EN6B 4XURA 5JSOA 1GV9A 2GMEA 3EXUA 1RUC1 3LEMA 4Q0PA 3BUCA 1REEA 5IVJA 2ZKLA 1UZWA 2CNAA 1QJY1 4CDQC 1QIQA 4D7TA 4QX1A 3B02A 2YG0A 2CDOA 3LE0A 1TNFA 2WZR1 3O7OA 5F2WA 1R1A3 2D7FA 3LA7A 2G9GA 3DCQA 1AZDA 4B7EA 5AC92 2N7GA 1C5HA 2YMZA 4YVSA 5LK7B 2VUCA 3VBFA 2YZ4A 3KHCA 1X8MA 4E27A 4QDSA 5AVAA 5CEHA 1KEXA 3NVCA 2YPDA 2YBKA 1ALYA 2OT7A 4DXSA 1W3XA 4XQ4A 1NOVA 5DDJ1 3ZN5A 3KLSA 2E33A 5A7NA 1W6MA 2HKXA 3C7EA 5HCAA 5ERLA 3POGA 4QXBA 1ST8A 2BNOA 2VNGA 5FJHA 4QXKA 1PMHX 3K4DA 2Y6JA 4NPRA 1FOD3 1RXFA 4Y1UA 5FP7A 2J7MA 1S2KA 3JD73 1YRZA 1UX7A 2VVFA 4CDXA 5LZ6A 3FBMA 2GZWA 1BBT2 1TG7A 4AG4A 2UURA 1OOPC 2FMYA 4AI1A 4M0HA 2Y6KA 4XJWA 3NL1A 3ROUA 4ES9A 3GCWA 4COZA 5JZGC 2DCJA 5HXVA 1EUUA 2XB6C 3U10A 1EP0A 4LUKA 2K0GA 3NW4A 4A42A 2AGSA 3B5LB 4TYSA 4X6QB 5EJ3A 5GJ6A 3AFKA 1W2NA 4DXRA 5FYIA 2V73A 4JRLA 2HWF3 2A3WA 2CSGA 2SLIA 4CP9B 1MS3A 1DYPA 4U36A 1NXD1 2VOKA 3VBFB 1VBB2 3M3EA 1LOAA 4RQPC 4P9YA 4K40A 3VDBA 3OUIA 4JGZC 1HB4A 3JBG3 5I0SA 2G1MA 3D8CA 1J3QA 3GBGA 5CG9A 3SC7X 1NXMA 2CGNA 4BPZA 3LZZA 4LEJA 4LKEA 3TBDA 3TEWA 1E5IA 3RYKA 2HWB3 5BNOA 1AX0A 3HPNA 5GKAC 1R081 1RMU1 4BMBA 2B45X 3EHKA 5KR7A 3H9AA 4QQPA 1LHNA 3ES1A 4M3CA 2Z4FA 3WNPA 3RWKX 1R093 1WW6A 4EN8B 3JQXA 1HRV1 3ZSJA 4KI5M 1HXS1 3ZKYA 1BLZA 1J83A 2J1SA 5F37A 1I5ZA 3K51A 3JQWA 4C91A 1DQ1A 4NJ4A 5JR7B 5E1RA 3N7JA 2RJLA 4FOQA 5FV3A 1M06G 4CDXB 2JEMA 4JX0A 3OD0A 4R8HA 1X36A 1L3JA 3FN9A 2D3SA 2GNDA 3B69A 3KSCA 5F2SA 3LPGA 3VDDB 3ZFEA 3DL3A 1UYZA 4D6QA 2RS53 4FO9A 5GLUA 3CU7A 5TSWA 1REDA 1G7YA 5HBAA 1YJLA 2D97A 3WX5A 4E2SA 4YG6A 3H1MA 5FZ9A 2DYCA 2Z5WA 5FPLA 5IK7A 1P8JA 1KD7A 1O6UA 2GC0A 4N9HA 4YZ4A 2GP3A 2OZ6A 4XC9A 4M3CF 3N9QA 1YO8A 3NSTA 4RQPB 4CA9A 4YRDA 1ENSA 4UXAA 4MG2A 2VZUA 5FZOA 1IS3A 2VY0A 4AI2A 3AJZA 5IVBA 2JE9A 1VBA3 2B39A 4B3NA 2E7TA 4BOWA 5J3UA 2FDGA 2DTYA 2E7QA 3WCSA 1D4M1 3QACA 4XUOA 4OZOA 3RSJA 2RMU2 1W0PA 3KF3A 1VALA 5APAA 1UMHA 2VQTA 4XIOA 4CXXA 2LALA 1QXPA 1BZWA 4PF1A 1C3HA 1NA1A 2YPJA 3CNAA 3MW2A 4DQAA 4CDWB 2YROA 5DQ0A 4XFIA 2GNMA 5FZ7A 1HLCA 3O1SA 3SKJE 3MO4A 3O0WA 1N1TA 4G3YC 1DHKB 1QY4A 2VO5A 4I02A 3NJXA 4XTMA 2Q8OA 1UKGA 4ZS3A 1HW5A 2WAAA 2ZGPA 5JI9A 1IQAA 1TZOA 5C4WA 3AZZA 2J1AA 1UD1A 3WNOA 2LRPA 1LB2A 3L2YA 5J48A 4KG8A 1UOFA 3W21A 2JE8A 1COV1 4QHBA 3ZDSA 5IFPA 3DPRB 1PGL1 2XBO2 2VOTA 3D6EA 3OEAA 4XJ9A 5DG1A 5JOYA 2DCZA 1EV13 2PAMA 4N53B 3RZZA 2W0XA 2X5IB 4LMFA 2JX9A 4YM2A 4NRMA 5GZCA 3AVRA 1FPN2 2CDPA 3SISA 3TN93 4P9GA 2WINB 3PUAA 3CJIC 4OQ8A 2DUOA 4WVMB 3EBRA 5LEKA 1VBC1 3CKHA 1CZTA 3MFCA 1X8EA 3WNMA 4Y26A 1JBCA 1SLLA 1QJX1 4MV2A 3ZXGA 3KCYA 1MS8A 3ZIWA 2PLV3 1MS1A 1QH7A 3MIHA 1S0BA 1H4GA 1S0JA 4B4QA 4ITCA 4CDUB 2BBAA 2BGOA 2RMU3 4QDRA 5FCCA 2FD8A 3F95A 5J09A 5EYYA 1PZ9A 3W20A 3QH7A 4CU8A 3UKTA 2WNVA 2YU1A 3OGSA 4GB32 4CEYA 2GNBA 3AYCA 3VKMA 5LBEA 2P4EA 5L7OB 1AR72 1AXKA 1CAVB 5IFTA
chains in the Genus database with same CATH topology
1OH3A 1V0AA 4A6SA 2O14A 1W8WA 1GWLA 4LKFA 1L7LA 4CP9B 1UOJA 2C24A 5D21A 3UT0A 1W90A 1OKOA 2VXJA 3ZYFA 4BQ2A 4LK6A 4LK7A 1W8UA 4CPBA 4BQ5A 1GWKA 1W8TA 4YW7A 3ZYHA 4YW6A 4LKDA 1HN0A 2LRPA 4AL9A 4YWAA 4LKEA 2KR2A 1WCUA 1W8ZA 3F95A 4LJHA 4CP9A 2Q1FA 1W9FA 4BQ3A 2K46A 3ORJA 1GWMA 2WYFA 4CPBD 1WZXA 3ZYBA 2LROA 4BQ4A 2JWPA 1WMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OH3 A;  1V0A A;  4A6S A;  2O14 A;  1W8W A;  1GWL A;  4LKF A;  1L7L A;  4CP9 B;  1UOJ A;  2C24 A;  5D21 A;  3UT0 A;  1W90 A;  1OKO A;  2VXJ A;  3ZYF A;  4BQ2 A;  4LK6 A;  4LK7 A;  1W8U A;  4CPB A;  4BQ5 A;  1GWK A;  1W8T A;  4YW7 A;  3ZYH A;  4YW6 A;  4LKD A;  1HN0 A;  2LRP A;  4AL9 A;  4YWA A;  4LKE A;  2KR2 A;  1WCU A;  1W8Z A;  3F95 A;  4LJH A;  4CP9 A;  2Q1F A;  1W9F A;  4BQ3 A;  2K46 A;  3ORJ A;  1GWM A;  2WYF A;  4CPB D;  1WZX A;  3ZYB A;  2LRO A;  4BQ4 A;  2JWP A;  1WMX A; 
#chains in the Genus database with same CATH topology
 1RUF 1;  1XBF A;  2QE3 A;  3J7N A;  3WSO A;  1WCK A;  4LHL A;  1VMH A;  1WMF A;  4XCB A;  2VCB A;  2WQ8 A;  1HJG A;  3AZV A;  4Q4Y 1;  1C8M 1;  3Q8A A;  4QQ2 A;  4AVS A;  3A22 A;  1PIV 3;  2WZE A;  4V2W A;  4RL7 A;  4ZKT B;  1QHD A;  1OVP A;  3J26 N;  3LSE A;  1W6P B;  4Y20 A;  1AYN 3;  1PVX A;  3POW A;  4M4P A;  5K0U C;  5DZF A;  3GF6 A;  4E2Q A;  5T55 A;  5A6Z A;  4P02 B;  1QNY A;  3S0M A;  3POI A;  2G4I A;  4JQT A;  2TNF A;  2OQ7 A;  5CA6 A;  5JPN B;  1OLM E;  1IG3 A;  4XAC A;  4CYD A;  2ETE A;  2I2S A;  2HEV F;  5CVR A;  4GB3 3;  4YM1 A;  3DYM A;  1WGP A;  3VHR A;  3POF A;  1H9P A;  4M3C B;  2W52 A;  5C8W A;  1DQ5 A;  1ZRR A;  1NT0 A;  1V0A A;  4E4D X;  4Q4X 2;  1XYN A;  2B9U A;  4XET A;  2WNU A;  1RVF 2;  4FPK A;  5L9B A;  1PZ7 A;  5C3R A;  1WD3 A;  1N47 A;  3K75 B;  3K46 A;  3D5O A;  3AX4 A;  2EXJ A;  4IEQ A;  1Y9G A;  5HI0 A;  1DIW A;  4WVZ A;  4YAR A;  1G9B A;  3JBG 2;  4RGG A;  1HQW A;  4XFC A;  5FZC A;  1PMJ X;  1SFN A;  2VOV A;  4NHX A;  4AAX A;  3SKV A;  1UZY A;  4YVS B;  3WW3 A;  3C3V A;  2VJX A;  2Q1Z B;  3RMY A;  4DRV A;  2BYV E;  2HWE 3;  2JG9 A;  3HQU A;  1OFS A;  3EJK A;  4LLF A;  2JDA A;  1EV1 1;  1OOP A;  1UAI A;  3FFZ A;  2PHD A;  1VBD 1;  3S7I A;  2ATF A;  1YFU A;  2ET7 A;  1OLQ A;  2DVB A;  2IXI A;  1T2X A;  1VAV A;  2ES3 A;  4AHZ A;  5L36 A;  4FXK B;  1OH4 A;  2OS2 A;  5CNA A;  3TNP B;  3BTZ A;  3BU0 A;  1C57 A;  2HWE 1;  3EB7 A;  5IYY A;  3AL5 A;  4AE2 A;  3U75 A;  2DUP A;  4BXS V;  4FPY A;  5IT6 A;  5F1R A;  2PAE A;  2YY1 A;  1PZ8 A;  3PJQ A;  4OHW A;  1UU6 A;  4XIK A;  3WHU A;  1NCQ B;  2DBN A;  1FOD 2;  5IAX A;  3BAL A;  4CU7 A;  5BNP B;  4QB2 A;  4J1W A;  5CYY A;  1HV0 A;  2C4X A;  3UYJ A;  5HCH A;  1AR9 3;  1L7L A;  2XUM A;  1CGP A;  2XQX A;  1H6X A;  3VBS B;  1K45 A;  2JDP A;  4XF1 A;  1UCX A;  4Q4Y 3;  3O1R A;  1ODM A;  3OF1 A;  1U5Z A;  1O5L A;  3HNB M;  3I49 A;  2FHR A;  2DBI A;  1OMI A;  3ZXD A;  4KU8 A;  4DXT A;  5K9Y A;  4QHO A;  2FDI A;  2YFU A;  3G7D A;  2ZEZ A;  1ZBE 2;  2HWC 2;  2G9Z A;  1V6K A;  4CE8 A;  2GC3 A;  1SLC A;  1XE0 A;  4O7X A;  3AMQ A;  2A3X A;  4XZP A;  3WT3 A;  5F7U A;  2ZGQ A;  3DEM A;  2Z42 A;  3I54 A;  5FZH A;  3VD7 A;  1EAH 3;  1RUE 2;  4OI1 A;  3SH3 A;  4YZ3 A;  1REF A;  4WVW A;  5LA1 A;  3OBZ A;  4FFH A;  4KBB A;  3M1H A;  1DGR A;  1OH3 A;  3MPP G;  2RS1 3;  5J98 B;  2JG9 C;  4DMI A;  2C6S A;  4XVH A;  1AUY A;  2GC1 A;  3I59 B;  3KQR A;  3I2D A;  4AZZ A;  1RUD 2;  4W6Y A;  3RZH A;  4Y3O A;  3III A;  1SMV A;  3N9M A;  2XH6 A;  3NJZ A;  3U0Z A;  2MEV 3;  3RS6 A;  2RR1 3;  4KWL A;  1W6N B;  3S6P A;  1RUH 3;  5C71 A;  5J37 A;  4BE3 A;  3WNN A;  1GR3 A;  4K20 A;  4PQ9 A;  2PHL A;  4QQL A;  2X53 S;  1VRB A;  2BOI A;  2Q1F A;  5A3N A;  4QPY A;  3O12 A;  4CRQ A;  1DG6 A;  2R04 3;  4BQ5 A;  5FY5 A;  3POS A;  1H4H A;  5FZL A;  5A3M A;  1YWK A;  3IBM A;  4DUW A;  1UO9 A;  4AK3 A;  1ZA7 A;  1CPN A;  1O7F A;  3BCW A;  4K8F A;  4ASL A;  4KBZ A;  4LBN A;  3NV1 A;  2F4L A;  3VN4 A;  1MEC 3;  1WKY A;  4LBK A;  1KIT A;  5DDJ 2;  2PEL A;  2ZCW A;  5F3G A;  5ANN A;  1DQ2 A;  3I3D A;  2NQY A;  3X29 B;  1C1L A;  2W1U A;  4ZON A;  3I97 A;  2FZ2 A;  5KBF A;  4PI0 A;  1W8T A;  1PVC 2;  4LBM A;  5DUV A;  4W4Z A;  3ZN4 A;  1PVC 3;  3ZSL A;  3RRD A;  1SZB A;  4M00 A;  2CTV A;  4IQP A;  1MZE A;  3CIH A;  3K48 A;  4GWN A;  1AL2 3;  1CIY A;  1URX A;  2R32 A;  1MVQ A;  3AKR A;  4IEP A;  1BBT 1;  1QJU 2;  3HNM A;  1LOF A;  2ZXQ A;  2Q8D A;  1OT5 A;  1CX1 A;  5C8C B;  1QQP 1;  1LED A;  3OB8 A;  4XAA A;  2IUW A;  3AKT A;  3B00 A;  4FPF A;  5CFD B;  3AMM A;  2D5H A;  2L9L A;  4FFF A;  4BLJ A;  4YFZ A;  4LPL A;  1Q8O A;  3OD4 A;  4P9X A;  1QH6 A;  2RM2 2;  2VQA A;  3IMN A;  5EZW A;  2O1Q A;  5T5J A;  5KC5 A;  1BHG A;  1OLM A;  2VZP A;  1ZX5 A;  2HWF 1;  3WNK A;  5IVV A;  2NM1 A;  2UWB A;  4OCT A;  3WQB A;  1TME 1;  4PHZ A;  3IB3 A;  3V0B B;  1LKN A;  2QNK A;  5F5Q A;  5IHR A;  2ZGK A;  4QKD A;  4Q0S A;  1C4R A;  1GLH A;  2Y6H A;  1G9C A;  3WDU A;  3CZJ A;  3KGL A;  5CZK A;  4YW1 A;  3KS7 A;  1J58 A;  3N9N A;  2BFU S;  2XWB B;  3RZL A;  5C3O A;  5JWP A;  1YIF A;  2B5H A;  3E1F 1;  4A7K A;  3ZO0 B;  5D8A B;  5FYH A;  1CN1 A;  1UY3 A;  4N43 B;  4AED C;  4BQX A;  1AX1 A;  3A4U A;  5FZE A;  3K4A A;  1S2E A;  1F31 A;  2KD7 A;  1HDK A;  5F6L B;  2RS3 2;  1NYW A;  3SMH A;  1UN1 A;  4B4P A;  1UZV A;  5H9R A;  1R08 2;  2R7E B;  2XJT A;  5FY9 A;  4GAZ A;  1ZZ8 A;  1GNY A;  4AFB A;  5AC9 3;  1FYU A;  4NAM A;  1F35 A;  3GJB A;  5JXI A;  2RDN A;  2JD9 A;  2XR4 A;  1H8T A;  4DOU A;  2AC1 A;  2CY6 A;  3O1O A;  1NE4 A;  1JI6 A;  3KVA A;  3LA3 A;  4LUM A;  5DAX A;  3LDB A;  1Z7S 3;  1YQ5 A;  1AXZ A;  4LO4 B;  2V72 A;  4QM8 A;  4A2U A;  3VBO C;  2E63 A;  1RL3 A;  4YG3 A;  4UFJ A;  3WIN E;  2W2I A;  4FTS A;  3H1Y A;  1QXR A;  1SQ4 A;  2RDS A;  3HR9 A;  2WZP P;  4XFG A;  1Q8P A;  3ON7 A;  2D3P A;  1QJE A;  1Y9M A;  2BRT A;  2PHR A;  2WKK A;  2CWS A;  2YC2 A;  4FOY A;  1N1S A;  1QJU 3;  2GNT A;  4XQW A;  5BNN A;  1NCR A;  4B1M A;  1MR5 A;  4FQ4 A;  5FYM A;  2FBE A;  1WLC A;  3POE A;  3RG0 A;  4AR2 A;  3H1W A;  5GLT A;  1BMV 1;  1HQL A;  3FLP A;  1JOB A;  3HEI A;  4DRR A;  4AED B;  1F2N A;  5CKQ A;  4LOT A;  1JUI A;  1SBF A;  1W9F A;  4YSF A;  2VMD A;  5FY4 A;  3VKN A;  4IGQ A;  3GZE A;  1ASJ 2;  1NQD A;  1V70 A;  4YGE A;  5FZF A;  1KJL A;  3HAG A;  5M0T A;  1JZ2 A;  2VU9 A;  3GAL A;  3ZFE C;  2JWP A;  4IV3 A;  1L7Q A;  1MPX A;  1QQP 3;  3AFG A;  3V56 A;  2Y64 A;  1DU3 D;  3MID A;  1W0O A;  3CJX A;  4AW7 A;  1RHI 3;  4K8R B;  4KNC A;  3T1M A;  1LOD A;  3DN7 A;  3JD7 1;  3THD A;  3LFM A;  3S7E A;  5I0D A;  1K5J A;  4YVW B;  2VZ3 A;  5A6Q A;  1DGW A;  1OI6 A;  4EN0 A;  3MPB A;  4BZ4 A;  1HRI 1;  3A7Q A;  4HK9 A;  3CDZ B;  4FCA A;  4WM8 B;  3CHX A;  3MIE A;  5D1I A;  3VD3 A;  3KZ4 C;  4Q4W 1;  4RHV 3;  5CIS A;  1VB4 A;  2PQS A;  5KWR A;  4WV8 A;  1IQD C;  3V64 A;  1J1T A;  1CAW A;  5A6X A;  1RVF 3;  2EIC A;  3N9L A;  3WG3 A;  3VD9 A;  5JXH A;  2JE7 A;  2Y6G A;  2BWC A;  4C0B A;  5A32 B;  2E26 A;  3PUI A;  1O4T A;  4HVO A;  2RS1 2;  2XJS A;  2QBX A;  2HWD 3;  4N7I A;  5FY8 A;  1MEC 2;  1QEX A;  1DF0 A;  1RUJ 2;  2WYS A;  1WBF A;  1D2S A;  3FHA A;  3HQX A;  4RFR B;  2IXJ A;  2XBO 1;  5FDB A;  5J96 B;  4XUP A;  1HJF A;  2Y8K A;  5DZE A;  3AXE A;  2WSU A;  2E9Q A;  1UIK A;  2KA3 A;  1OQE A;  1L7R A;  1QJY 2;  4RSU A;  2FCV A;  2GMM A;  3MYX A;  5L73 A;  1ND2 B;  1YI7 A;  1LRH A;  3WNX A;  4GH4 A;  3ZYH A;  2VXR A;  1ZZB A;  5G04 L;  3OCP A;  4Y22 B;  1JOP A;  2WO3 A;  3PTR B;  4LUL A;  1SEF A;  2P3Y A;  5H9Q A;  4AEJ A;  4YW2 A;  3MFA A;  2ADD A;  2JB4 A;  4XXP A;  1R1Z A;  3CLP A;  3CZU A;  3I8T A;  4ZU7 A;  4P9J A;  5A7W A;  4NRQ A;  1DQ4 A;  4F83 A;  5DAV A;  2QDR A;  1RJ7 A;  4UBH A;  4ASM B;  4NIG A;  1OUR A;  4PQQ A;  3VBH B;  2QQK A;  4I2O A;  2X5I C;  1X9P A;  2VBD A;  3H8U A;  3R0R A;  4FPH A;  1GKB A;  2PTM A;  1MS5 A;  5FO7 B;  1EPZ A;  1RTV A;  2VC9 A;  1SCR A;  4YW5 A;  3USU A;  3H8X A;  2C24 A;  3ILR A;  1LHO A;  3MIF A;  1YQ6 A;  2ARE A;  2PHF A;  5I93 A;  1UNB A;  4FAG A;  1S0D A;  1Q56 A;  3MIC A;  2BEO A;  4I3G A;  4LIU A;  1EAH 2;  1AR7 1;  1GWK A;  1IOA A;  1RUE 3;  4OHX A;  4Q4V 3;  3DXT A;  3GBF A;  4AAP A;  5I91 A;  3J7M A;  1QMJ A;  3VKO A;  4YW6 A;  5HCF A;  1HN0 A;  3B9C A;  3ZSE A;  1QJZ A;  3FBY A;  1JXN A;  2G19 A;  4S2G A;  4YGD A;  5FZ8 A;  1JZ4 A;  3HQR A;  1ZZ9 A;  3ORJ A;  2D6L X;  1NCQ A;  1UW8 A;  1ZBA 1;  2A75 A;  2W5F A;  3FMG A;  3IPV A;  4XW3 A;  4L92 A;  1NZI A;  4A6S A;  3OGG A;  4EN7 B;  4SLI A;  4UFL A;  3ZPO A;  1BXH A;  3WD5 A;  3FE5 A;  3OYW B;  1UXX X;  3A23 A;  2C26 A;  1JHJ A;  1UY4 A;  2VNV A;  3TN9 1;  1G86 A;  3AKQ A;  1POV 0;  2D6P A;  4AGG A;  4OUM A;  3RYR A;  1OUS A;  4QPG C;  2VMG A;  4WBB A;  5C5T A;  2IXK A;  2PHW A;  2Q30 A;  4Q4X 1;  3WUC A;  4PBP A;  3SLI A;  1TEI A;  3ZYG A;  5FZ1 A;  3FUO A;  4CEW C;  2R07 2;  2W1S A;  5F39 A;  5A3P A;  2JG9 B;  4WVV A;  4DEV A;  4E4S A;  1ULP A;  2XWJ B;  4RGK A;  5CB7 A;  4NVP A;  5A3O A;  4OLL A;  4CDQ A;  1A6C A;  4HVR A;  2ZOE B;  3M70 A;  3ALQ A;  5DAW A;  1H30 A;  1KFU L;  2XLA A;  1Z7S 2;  1W6O A;  4GWJ A;  1OPM A;  4ARX A;  4CUB A;  5T50 A;  3AZW A;  4R4X A;  3RQ0 A;  4Q4X 3;  3RPQ A;  5K0U B;  4RS5 B;  1EY2 A;  2QTW B;  2VW1 A;  1UOJ A;  4MH0 E;  3SH4 A;  2CAU A;  4Y1V A;  5IVF A;  2DU1 A;  1ND3 C;  1LUL A;  1KFX L;  1D2Q A;  1MS4 A;  5IAV A;  3ZN6 A;  2DVD A;  3BYW A;  3OPT A;  4KQ7 A;  5JDB A;  2XML A;  3U14 A;  1RMU 2;  3AZY A;  3ZFG A;  3EO6 A;  5DXD A;  3RMX A;  4LOR A;  1FNZ A;  1LCL A;  1D0G A;  4QX8 A;  2WO7 A;  4R9A A;  3R4U A;  1HRV 2;  3JB4 C;  1GOH A;  2D43 A;  3K77 A;  1HXS 2;  1VIW B;  3PUR A;  5FQ0 B;  5GZF A;  1XPW A;  5DDJ 3;  2DTW A;  2CWM A;  2Y0I A;  2B7Y A;  2E51 A;  4RR3 C;  2GAL A;  2ZTN A;  4CZS A;  3NNF A;  2ZGO A;  2Y0O A;  4Q1R A;  4Y4R A;  5KHK A;  4Q1P A;  4HG6 B;  5IUQ A;  1KS4 A;  4F8A A;  4OI4 A;  1RYY A;  4I0A A;  3ZXE A;  4LO8 A;  2IZW A;  1FOD 1;  4PIY A;  4Q27 A;  5LBB A;  4COU A;  3GM8 A;  1JYV A;  3LIG A;  4L9B A;  4D8M A;  1S1A A;  4CCK A;  1RXG A;  3MF6 A;  4ET7 A;  2WN3 A;  2D98 A;  3N7K A;  1IGO A;  4JGZ B;  4R4Z A;  3ZSK A;  1GP6 A;  1KGY A;  1UY1 A;  3WCR A;  5KXD A;  2IVI B;  3UET A;  4CEY B;  3RZK A;  2WNV B;  2HLE A;  5T3N A;  1GYK A;  1MZ5 A;  5I8Y A;  1R09 2;  4ZXE A;  2WL1 A;  4FFI A;  4URT A;  2RJK A;  3C7H A;  4QPW A;  3N9P A;  3RI8 A;  1IZ3 A;  1UY0 A;  2ZGN A;  3QD6 A;  4LBL A;  2HWC 1;  1RUF 3;  1ULD A;  5DZG A;  3QBQ A;  2A6W A;  3AVS A;  3W59 A;  2D3R A;  1V6M A;  3MGU A;  4FPJ A;  4E2G A;  3N3H A;  2VXJ A;  4HT1 T;  5KXB A;  5A33 B;  4C1X A;  1POV 1;  4GWI A;  3VZL A;  1BYH A;  1UL9 A;  4BDV B;  1VPH A;  1XU2 A;  2PYT A;  1PK6 A;  3BTY A;  2R1D A;  1WLW A;  1S4C A;  2PHX A;  5L9V A;  4MHR A;  2K9Z A;  2IC1 A;  2Y6F A;  3KT4 A;  2A5Z A;  4O9G A;  1SPP A;  5LBF A;  1G9A A;  3PHM A;  4GXL A;  5ABJ C;  4NID A;  3DPR A;  3RI9 A;  1SDD B;  5IK5 A;  3LPF A;  2OPW A;  1Y4W A;  3VGI A;  4Y22 A;  1AR7 3;  4GH4 B;  1A8D A;  2KM2 A;  4IV3 C;  2JIG A;  1CAX B;  4XBL A;  5SV8 A;  3KV4 A;  3ILF A;  3R4D B;  3VL8 A;  4ASK A;  4KWU A;  4UAP A;  3ZFF C;  4XAE A;  4IDZ A;  2B8M A;  2FCT A;  5ANQ A;  1PGL 2;  2ORZ A;  3T0D A;  1K5M A;  4QXH A;  4AYU A;  2WS9 2;  3GDB A;  1F8V A;  2DCT A;  3U78 A;  3WG2 A;  3RZG A;  4EWE A;  3PMS A;  3MUY 1;  1NAE A;  5JMO A;  1SDW A;  2C9A A;  3VBH C;  1H8T C;  3LCP A;  1K5M C;  3MLL A;  2BV4 A;  4YYO A;  4CEW B;  2BBV A;  3S5A A;  3OGR A;  3SNM A;  3ETP A;  2ZBJ A;  1JHN A;  3ZYP A;  4BME A;  4AI8 A;  1PVC 1;  3M8L A;  2O0O A;  3ZFG B;  4URA A;  5A6Y A;  4UWD A;  4BHP A;  2W3J A;  3VHO A;  1SG3 A;  4OMC A;  1TMF 2;  2GMP A;  1IHM A;  3KV9 A;  3CJI A;  3LGR A;  3MUZ 1;  4UFI A;  4R9B A;  4YVW A;  1G9F A;  4GB3 1;  2GP5 A;  4JVA A;  4DPN A;  5CFD C;  5A7S A;  2WAB A;  4Y1X A;  4F7Z A;  1UQX A;  1V6N A;  4BA6 A;  3LKJ A;  1RUF 2;  2UY9 A;  4FT8 A;  2J42 A;  4MET A;  2QQV A;  4ES8 A;  4B7K A;  4AHY A;  3TAY A;  2JDN A;  4Q4Y 2;  3I3Q A;  2JB8 A;  2JJ6 A;  2XLG A;  3SH5 A;  1DZT A;  3VD5 A;  1NQJ A;  1YFY A;  2RM2 1;  3I2G A;  1JN2 P;  1GOG A;  2ZZJ A;  2EVX A;  2W95 A;  3HNY M;  2XLF A;  2CAV A;  2AUY A;  1DGR N;  1WCD J;  4I09 A;  4LLO A;  4D6S A;  1ENR A;  4AHW A;  4AQ2 A;  1UX6 A;  1D0H A;  2EXK A;  2O14 A;  2P37 A;  2R1B A;  3I7D A;  4AQ6 A;  4D3W A;  2OW4 A;  2VZV A;  3SEE A;  1CJP A;  1W03 A;  1SBD A;  1DFQ A;  3MIB A;  4FP3 A;  2G9F A;  2D44 A;  4RFT 0;  3NV4 A;  2RM2 3;  4RYD A;  2Q8C A;  4DY3 A;  1QJF A;  5F32 A;  3UKN A;  5JXG A;  4H14 A;  1S0G A;  1W28 A;  2DF7 A;  2CGP A;  3ILN A;  2YC0 A;  3NNL A;  1H1I A;  2I74 A;  2EAL A;  2WA3 A;  5EFU A;  4HVQ A;  1RUJ 3;  5DMY A;  1ZRC A;  3IPV B;  2A6Y A;  1R64 A;  1A34 A;  1LTE A;  1AR8 3;  1LNS A;  4PLN A;  1FAT A;  4QB1 A;  5BXX A;  3O1U A;  4RR3 B;  3PLQ A;  1XNA A;  4JGY B;  1QGL A;  3GZU C;  1W8O A;  3VV1 A;  5JOZ A;  2Z69 A;  3WOG A;  3RZJ A;  4XMA A;  3MHZ A;  2DV9 A;  3UL2 A;  5BNN C;  2ZGT A;  5C4W C;  4LE4 A;  4FP2 A;  1NLQ A;  1SBE A;  1JZ3 A;  2ZZQ A;  1RGS A;  1VBD 2;  3AKS A;  3VBR B;  5B2G B;  4LKS A;  1S0E A;  5E89 A;  5JI7 A;  4AVV A;  3I3M A;  2VH9 A;  2KR2 A;  1OXC A;  3O14 A;  4FXG B;  3ZM8 A;  4BB3 A;  5FUN A;  3VZO A;  1FX5 A;  3T2Q A;  4DUX A;  1K42 A;  2WNV C;  4HMZ A;  1NE6 A;  2YFZ A;  4OUL A;  1AHS A;  4UBG A;  5D8A C;  1LGN A;  1IS5 A;  3ZYB A;  4ATE A;  1GZC A;  3B01 A;  4KG0 A;  4FBF A;  2ZGL A;  3OUJ A;  4I01 A;  5K0U A;  2OKX A;  2W68 A;  1S55 A;  4TZD A;  1W6O B;  4EWA A;  1DYK A;  1BMV 2;  5EWS A;  1MAC A;  1ND2 A;  4CCJ A;  4PIZ A;  5D2A A;  3KV6 A;  2IFW A;  4NIA A;  3NV2 A;  3INA A;  5DUW A;  2RDR A;  1D7P M;  3ZVX A;  4EZ4 A;  3TEZ A;  3VZM A;  5A1L A;  3I2J A;  3CEW A;  1PIV 1;  2VMH A;  1A3K A;  3TB0 A;  4QQO A;  5FPA A;  3NAP A;  4Q26 A;  2A71 A;  3SCH A;  4CUG A;  1SPP B;  4MGY E;  3PME A;  1V9U 1;  3LEK A;  4GIQ A;  2Y38 A;  1O3Q A;  2YC4 A;  1IKQ A;  2K46 A;  5C9A B;  3E6D A;  1B35 C;  4LQR A;  1AL2 1;  1WZX A;  5LW9 A;  3WXP A;  1ZRF A;  1OPO A;  3MLK A;  4E8C A;  4XBN A;  1RUH 1;  1TVG A;  3AZX A;  3M7A A;  4LO6 B;  2LUW A;  2VZR A;  2X8K A;  5AFE A;  1I1E A;  1XNT A;  5FY7 A;  3ZXA C;  4EZH A;  3IDC B;  4GKY A;  2BP6 A;  5FK7 A;  3HBK A;  4UW6 A;  2VZT A;  2V09 A;  4YGC A;  4LK7 A;  2ZX3 A;  3M3O A;  4JC1 A;  1UYX A;  3IMM A;  1QDC A;  2ZEX A;  4XF3 A;  4Y1Z A;  5FY0 A;  4XE9 A;  4E9K A;  4F3J A;  2JIC A;  1XE7 A;  1GNH A;  2VUD A;  1MEC 1;  4Q8L A;  1XNB A;  1RUJ 1;  5IWF A;  4BCU A;  1RUD 1;  5HPO A;  1BCX A;  3POJ A;  1PO1 3;  2OPK A;  1XOY A;  3O1P A;  4COV A;  1RIT A;  2VZS A;  1O59 A;  3WHT A;  4AHX A;  3NWK A;  3PIJ A;  5DUX A;  3J8F 1;  4PLO A;  4MAD A;  3A0K A;  1GZW A;  1Y9Q A;  3SIT A;  2W47 A;  5FMO S;  4BYY A;  1DYO A;  2BPA 2;  2VAU A;  3RDI A;  2FMD A;  3EMR A;  4QGN A;  4NAO A;  3LQC A;  3DKW A;  4NWV A;  5IK4 A;  3PVE A;  5JOX A;  4FPE A;  4DFS A;  2UY8 A;  4ISR A;  4CCC A;  4YZ5 A;  4NHM A;  5FQ0 A;  4RA0 A;  3WQ0 A;  1PMI A;  2EXI A;  4A3Z A;  5KXC A;  2WT0 A;  3PIG A;  4COY A;  1RIN A;  4IW3 A;  2A6Z A;  5CKM A;  4CDX C;  4G4F A;  5F9T A;  4HKL A;  1I6X A;  4W50 A;  1AF9 A;  1EAH 1;  4CCO A;  2PMW B;  4Z1V A;  4L2N A;  1W05 A;  1CWP A;  3NQH A;  4QKF A;  2AH2 A;  4HPK A;  3BTA A;  4OI0 A;  4XIL A;  2EAA A;  2K2S A;  5BY5 A;  3IKW A;  2UYA A;  3W5M A;  2QJV A;  4MXW A;  2WWJ A;  3OBT A;  1HV1 A;  3LAG A;  1QJU 1;  3HD8 B;  1ZBA 2;  5SV5 A;  4BIS A;  2MEV 1;  3MEP A;  1C5I A;  2A1X A;  4P14 A;  2R6Q A;  1AYN 2;  1OA3 A;  1V00 A;  4YPJ A;  2MNG A;  4EYU A;  5LRR A;  3J7L A;  4CEW A;  3B3Q E;  3ZOI A;  4TWT A;  1W9T A;  1AR6 2;  4LJH A;  3V0A B;  4QD2 A;  4HK8 A;  1V9U 3;  3Q8F A;  5C5U A;  3VBS C;  3NNM A;  3BKZ A;  1QWR A;  1O8S A;  2WWU A;  4LHS A;  4IEU A;  3OSD A;  3TEX A;  3H7Y A;  3VKF C;  3RZM A;  2F6B A;  5C6C A;  1QJY 3;  1V6L A;  2CHH A;  4OUE A;  1B35 B;  4PJY A;  1TME 2;  1GZ9 A;  5T5O A;  1OD5 A;  5GLV A;  3SCG A;  5FKC A;  3OYW A;  2QCS B;  1MQT B;  2R0F A;  3AP6 A;  2TEP A;  4KWK A;  3DXU A;  5FZ0 A;  4CU9 A;  1RUG 2;  4D69 A;  4IEY A;  3W9A A;  4BWO A;  3KT1 A;  3WNL A;  1EUT A;  2IXL A;  2A6V A;  2VME A;  3ZMO A;  1RUI 1;  3FWE A;  3OY8 A;  3NAP B;  3GHN A;  4ISQ A;  5E16 A;  3ES4 A;  5E88 A;  5GLZ A;  4ZZ8 A;  1J3P A;  1C1F A;  1YFW A;  2QQI A;  3WF0 A;  3PVN A;  5KC6 A;  5BNN B;  1FI2 A;  2YB7 A;  3ZR5 A;  2Q4S A;  3OGV A;  4ONU A;  3ZXJ A;  4CDU A;  5EIY B;  3WV6 A;  4EE2 A;  2WYF A;  4HLT A;  4QGM A;  4R9D A;  5LAS A;  1FMD 1;  2WRA A;  3T3Y A;  4ERO A;  2P2K A;  1IPJ A;  4JHZ A;  1CX4 A;  4OUS A;  2R04 1;  4UF0 B;  2E53 A;  1KDM A;  1X82 A;  4QX7 A;  3J8F 3;  4KGQ A;  2E6V A;  3BPZ A;  5J36 A;  2AEY A;  3USU B;  2XON A;  5FAX A;  4A7Z A;  5A3L A;  5BNO C;  3C7G A;  2VGD A;  1GZT A;  1QF3 A;  3BOW A;  2BZD A;  4FVV A;  3VKL A;  1YLL A;  5CBL A;  3AMN A;  3D0S A;  3T4H B;  1C8M 3;  4JDM A;  4UYB A;  3T0A A;  5FYC A;  3AP5 A;  4IUG A;  1H2M A;  3VZK A;  3AK0 A;  1S0C A;  5HV4 A;  1VRH 1;  2QQL A;  1WUV A;  4Y24 A;  1HIX A;  5C9A C;  1U5Y A;  4JGZ A;  4HFS A;  5FPU A;  2GSY A;  5KXE A;  2VNR A;  3FLT A;  4P08 A;  2R06 1;  4ZS2 A;  2W1W A;  4Z2A A;  4DIN B;  2P17 A;  3VLB B;  1CAU A;  1NLR A;  1GWL A;  1A78 A;  2A70 A;  4Q29 A;  1K5M B;  4GMP 1;  2WO1 A;  1KQR A;  1X50 A;  4XUQ A;  1UY2 A;  4HOO A;  1PK6 C;  1ASJ 1;  2WDB A;  3ACL A;  3NV3 A;  3LDK A;  1U12 A;  2PA7 A;  5CIR A;  3L9J T;  4NII A;  3T30 A;  2OYZ A;  4P5H A;  3T09 A;  3BOP A;  4GAL A;  2OX0 A;  1UOG A;  3D4K A;  1G6N A;  4IV1 B;  2WFF 1;  4IND A;  5FZD A;  3VDD C;  3VHN A;  1AJK A;  3JUU A;  5FZA A;  3WW2 A;  3JD7 2;  2JKX A;  2BQP A;  1US2 A;  2SBA A;  1F9K A;  2ZX1 A;  1N3P A;  4BLI A;  1X33 A;  4EWD A;  1DBN A;  4BQ4 A;  3THP A;  3WP4 A;  1SFP A;  1HRI 2;  4GMP 0;  3WVJ A;  2WO2 A;  2YXS A;  4UI9 L;  2X29 A;  4AFM A;  2AEN A;  3TWI A;  2VVD A;  2WFF 3;  1NCR C;  1XYO A;  3O0X A;  4MXV A;  5CFC A;  4P5Y A;  2J1R A;  1YUD A;  2OUH A;  4P9I A;  4W8J A;  1FV2 A;  3LIH A;  4CXW A;  2PAK A;  1PO2 3;  4TLF A;  5JAX A;  3TYJ A;  5LB6 A;  3ZFE B;  3LOI A;  2UWA A;  1C28 A;  4BXF A;  1ZA4 A;  1JZ5 A;  3BTX A;  4Z8B A;  1GUI A;  1B09 A;  5C33 A;  4CEY C;  4BQ3 A;  1VP6 A;  2VCA A;  4ZXK A;  3LFI A;  1QOS A;  4K21 A;  3P6B A;  4YVS C;  2XGX A;  2WS9 1;  2P34 A;  2OXB A;  1CPM A;  4K9S A;  3IWZ A;  2HWD 2;  4IGP A;  1XSQ A;  2D5F A;  1Q43 A;  4XYX A;  3WZ1 A;  1GQH A;  4C0H A;  5JZG B;  1CIW A;  2RR1 2;  5CKN A;  2XJR A;  4IV1 A;  5EP9 A;  4GD4 A;  1IKP A;  4X8N A;  2XKP A;  1OA4 A;  3H8R A;  1ZM1 A;  5CFC C;  4TTG A;  1QDO A;  4RHV 2;  2WLQ A;  1OQ1 A;  1JH5 A;  1PX3 A;  1UPI A;  3I4I A;  3PUQ A;  1FV3 A;  1H6Y A;  2VTX A;  1GU3 A;  2FZ1 A;  4M01 A;  2HJI A;  1STM A;  3IDE A;  4XEZ A;  4I3P A;  1DGL A;  1JMU B;  5F5C A;  1WA4 A;  1SCS A;  3AMH A;  1OC1 A;  1T6B X;  2WBK A;  2WZ8 A;  2GH8 A;  4JAA A;  4D7S A;  2F17 A;  1JOJ A;  4IE4 A;  4Z92 B;  2XVL A;  2GU9 A;  2QDN A;  2TUN A;  1OSG A;  3QCW A;  2NYY A;  2DUQ A;  1XC6 A;  1RMU 3;  2LS6 A;  3FUQ A;  4IER A;  2VCC A;  2W91 A;  2R49 A;  2V5Y A;  3GNE A;  3OJB A;  3PVO A;  2QQJ A;  2ZHM A;  1PHM A;  4QB6 A;  2JXA A;  2W46 A;  3H0O A;  2W87 A;  1KXG A;  5D8A A;  1O91 A;  4H3W A;  2W39 A;  3B93 A;  4HPK B;  4O65 A;  4NHL A;  4QX0 A;  2XL7 A;  5DG2 A;  4AFA A;  4JTN A;  3N7L A;  3MV1 1;  4KL1 A;  2WLP A;  1VMJ A;  1TQ5 A;  3VBR A;  2XDV A;  5EHD A;  1PK6 B;  3J7H A;  1Z78 A;  2YBS A;  3K4Z A;  3ZYI B;  2R07 3;  2Q1M A;  2RE9 A;  3O0V A;  4E4H A;  4JCK A;  4YW4 A;  4NE9 A;  1X9T A;  4LR4 A;  5IJR A;  3ZMN A;  3TN9 2;  2WR9 A;  5LA0 A;  2XHK A;  3GXU A;  2BER A;  3GHM A;  2YGL A;  1ENX A;  4CDQ B;  1ULE A;  1WA6 X;  4EV0 A;  1HB3 A;  4JGY A;  3N7M A;  4Q5O A;  3SCF A;  3LSD A;  4KH9 A;  1TMF 3;  5FOB B;  2ZX2 A;  2VQ0 A;  3CMG A;  4IE7 A;  3KV5 A;  1NUK A;  2R07 1;  5GM0 A;  3K3N A;  4KU7 A;  1W39 A;  5CU1 A;  4IE6 A;  2XJU A;  4AQS A;  4CPB A;  1LGC A;  2QKD A;  4HSJ A;  1PNG A;  2BNN A;  5K4L A;  5F3C A;  5H9P A;  1Z7S 1;  1PO2 1;  4UFK A;  2VMF A;  1CAV A;  2VG9 A;  5A3U A;  3M2M A;  1TE1 B;  1R08 3;  3ZPY A;  4RD7 A;  5DAQ A;  5CAD A;  3ECQ A;  2PQQ A;  5BNP C;  5JCT A;  2ET1 A;  5J1X A;  2J1T A;  3ELN A;  1N1V A;  4P9L A;  5JXJ A;  5FXX A;  2NPI A;  4L99 A;  5F6K A;  5A70 A;  1Q8S A;  4Q4V 2;  5B4X A;  5IW0 A;  2BGP A;  4XFF A;  1OLR A;  3MI8 A;  2BGC A;  2AYH A;  4S2F A;  1OF4 A;  4YLZ A;  5FYS A;  4DO0 A;  3RJR A;  2XG3 A;  2VOX A;  3ZYJ B;  3GZT B;  1GBG A;  2DFC A;  1IG0 A;  1OKO A;  3UK9 A;  4LO5 B;  4NIH A;  1JYX A;  2J1V A;  2OVU A;  2DVF A;  4CUC A;  1XB9 A;  1H9W A;  5A7Q A;  1SLA A;  2JDH A;  4AGV A;  4A44 A;  3CQO A;  2ZX4 A;  3TOJ A;  4JKM A;  2C0Z A;  4MXW B;  4AXO A;  4JV4 A;  1XYP A;  1H1M A;  3G6J B;  3VBH A;  2ZMK A;  1WD4 A;  1GQP A;  1NZC A;  4XJU A;  1ACC A;  2R0H A;  1BJQ A;  1NY7 1;  4LE3 A;  4HKW A;  4AL9 A;  4AI0 A;  1TME 3;  3H42 B;  1KDK A;  2ZMN A;  5ACA 2;  3JXS A;  3SEP A;  5F5I A;  2HWB 1;  1ULC A;  4UW3 A;  1DQ6 A;  2EIB A;  1BK1 A;  1UXZ A;  3O1V A;  1ZRD A;  2XHN A;  1SAC A;  1AYM 2;  1BK0 A;  1V9U 2;  3WDX A;  1HN1 A;  5JIU A;  1Q3E A;  1G9D A;  5G05 L;  2Z79 A;  1AL2 2;  1R09 1;  1LGB A;  3D0J A;  3GBW A;  1HRV 3;  5T52 A;  1RUN A;  2XKO A;  2JEC A;  5FLI A;  2VPV A;  2DDU A;  3H7J A;  5FR3 A;  3WDV A;  3BOD A;  1H2N A;  5BYN A;  2EIE A;  1KS5 A;  2PHT A;  5FTT C;  3I3B A;  4C8D A;  5I0R A;  4HON A;  2OZJ A;  4XZU G;  3ZXF A;  3KD4 A;  3FJS A;  3KWV A;  1CAW B;  4LTA A;  2BJS A;  4LIT A;  1LOG A;  4R9C A;  5A32 A;  2O8O A;  4HN1 A;  1R1A 1;  2LTN A;  4NMI A;  4MZU A;  3RVH A;  3ZSM A;  2XVK A;  4WM8 A;  1WMX A;  3DUI A;  3FL7 A;  1NKG A;  2ZAH A;  1YXW A;  1W8W A;  1WCQ A;  1O3T A;  3HVD A;  3T0B A;  5AC9 1;  4RQP A;  4AWD A;  1O3S A;  1OBN A;  2BFU L;  4LHK A;  4W6X A;  1DZQ A;  4UFH A;  3DYO A;  3VBS A;  1JYN A;  2PN5 A;  2WC2 A;  2Z2S B;  4DY5 A;  4Y4Y A;  4Q0Q A;  4NN0 A;  4XFB A;  2VR4 A;  1WWY A;  4IET A;  1LOC A;  1SLT A;  2VZQ A;  4R52 A;  3RNS A;  2VMI A;  3FC0 A;  2HEY F;  4IEX A;  1Q8Q A;  3H3U A;  3V65 A;  3JCI A;  5FP4 A;  2H6C A;  2A3Y A;  3GCX A;  3M4F A;  4DZG A;  3VDD A;  5HXM A;  2VW2 A;  4GZ9 A;  2KXL A;  1GOF A;  1AR8 1;  4IL7 A;  2XJQ A;  2ZS6 B;  4GJY A;  4AFD A;  1D4M 3;  2WA4 A;  4AED A;  2H6B A;  4BJ0 A;  5FMO L;  1JYT A;  2DCK A;  2WUH A;  2DU0 A;  5FXV A;  1QJX 3;  4N53 C;  1PX4 A;  1GP4 A;  3KCC A;  1WW7 A;  4XQD A;  5C3P A;  3J4U H;  4J6G A;  4CP1 A;  1VBB 3;  1FNY A;  3E5Q A;  3OY8 B;  4CCD A;  2WZR 3;  1XNC A;  4LO7 A;  3AMP A;  1DGW X;  3HT1 A;  2CYF A;  2A7A A;  2PXJ A;  4HSL A;  4XF0 A;  4P9W A;  1TMF 1;  4XTP A;  2HYK A;  4MGS A;  5BNO B;  5C70 A;  1RUO A;  2QUO A;  4J25 A;  4UW4 A;  3E6B A;  4WM7 B;  2CV6 A;  1WW4 A;  3NJY A;  1A8M A;  1VR3 A;  2B46 X;  2LRO A;  1LJ7 A;  1N1Y A;  2MEV 2;  1RUD 3;  1AYN 1;  1NX9 A;  1XJA A;  4BK4 A;  1BBT 3;  1GNZ A;  1ULF A;  1F4A A;  4JRA A;  1LOF C;  3PVB B;  4AEM A;  1FT9 A;  2P1B A;  2BVV A;  1WME A;  4UT5 A;  1PGW 2;  2UYB A;  4IV1 C;  4N43 A;  4XF9 A;  4NRO A;  4MHU A;  4XUT A;  3QLQ A;  4Q0U A;  3F2Z A;  4A45 A;  3WF1 A;  4YG0 A;  3KT7 A;  3B94 A;  1W2A X;  2R30 A;  1W9Y A;  4MGK E;  3PUH A;  4Z07 A;  1RUG 1;  2ARB A;  3URF A;  4ZZ5 A;  4CXY A;  3LOB A;  5C3S A;  5A1F A;  3WF3 A;  1UPS A;  2D6O X;  4LHN A;  3U07 A;  1W6N A;  1YC6 1;  1YNA A;  1AR9 1;  4UF0 A;  4MOA A;  4QDQ A;  5A80 A;  1BVV A;  4QKN A;  4RGA A;  3ZKU A;  1CD3 G;  3LB9 A;  2OII A;  1V6O A;  1GAN A;  3SHR A;  1DLC A;  3UGG A;  2GDF A;  3WG1 A;  3KF5 A;  2W94 A;  1I5P A;  4EJR A;  2H0B A;  3I2F A;  1W8U A;  5A3T A;  3GZA A;  3JZV A;  2AAC A;  1ZNP A;  4LNV A;  2ERF A;  4P00 B;  2RV9 A;  3H50 A;  4XPV A;  2EIG A;  5AFB A;  1JZ7 A;  2ZX0 A;  5ABJ A;  1BQP A;  2PHU A;  4Y1Y A;  3RYP A;  3VB9 A;  4AVT A;  4FSJ A;  3NO8 A;  5FXW A;  1ZRE A;  4PT6 A;  2VUJ A;  3DGT A;  1VBA 2;  1YJK A;  1XRU A;  5FO8 B;  1PO1 1;  2ZHL A;  3P3N A;  1WBL A;  2OA2 A;  4XMI A;  1B35 A;  3O1M A;  5F3E A;  2RDQ A;  2P6C A;  4FOV A;  1VRH 2;  1U0A A;  2NP0 A;  2LW8 A;  4BIF A;  4OHY A;  1ULO A;  2TBV A;  5LY2 A;  1ZZC A;  2ARC A;  5FWE A;  4V2V A;  1W8F A;  4GA9 A;  4LK6 A;  1W2U A;  3C2U A;  4QPI A;  4CTE A;  1OVS A;  2R06 2;  4YNI A;  1JZ6 A;  4N53 A;  4CSW A;  5EXO A;  4JGY C;  2WQ4 A;  3BIE A;  4N43 C;  2ARA A;  1H8V A;  4D7Y A;  1IS4 A;  4IE0 A;  5ISL A;  2FDH A;  5FZG A;  2GN3 A;  3LA2 A;  1QU0 A;  4N90 A;  1PIV 2;  2ZPX A;  5FLJ A;  4ARY A;  3WW1 A;  3ZXL A;  5JLV A;  1KJR A;  1CES A;  4XUN A;  2P3K A;  5LY1 A;  4AI9 A;  3ZIX A;  3U4X A;  2RG4 A;  2ZKN A;  4LBQ B;  1LAJ A;  2XL9 A;  1W2O A;  4HN0 A;  2VCM A;  3ACI A;  4U2A A;  4K6B A;  1VJ2 A;  1W9S A;  4ZPI A;  5KHG A;  3O1T A;  1NA1 B;  1UU5 A;  1LEC A;  4QHZ A;  1OOP B;  2V5D A;  2VEC A;  1RUH 2;  3AYD A;  3HN1 A;  4XJ8 A;  5BV6 A;  3ST7 A;  1VB2 A;  5JR2 A;  2PLV 2;  3Q9O A;  1WCU A;  4ZU4 A;  3IAP A;  3CBN A;  5LK5 A;  1HB2 A;  3HBZ A;  4XBQ A;  5H9S A;  3USS A;  4CPB D;  1JW6 A;  3UGF A;  5L19 A;  5C7G A;  1O4Z A;  1JYC A;  3WW4 A;  2VM9 A;  4UW5 A;  4O61 A;  3SXW A;  2VNO A;  4XDP A;  1CVN A;  1WLD A;  1VBC 3;  5AVP A;  1AYM 3;  4YVW C;  2HH9 A;  1GQG A;  4QPG A;  5A7O A;  1E5R A;  1O4Y A;  2Y6L A;  2C5D A;  4NPL A;  4JHT A;  5D21 A;  3UKV A;  3ZFF B;  2ZEY A;  4MUV A;  4WM8 C;  4RS5 C;  3UNP A;  1MQT C;  3Q8C A;  4QPG B;  1AL0 G;  2HWD 1;  1ZBE 3;  4ZY9 A;  5A33 A;  3J8F 2;  3PJY A;  3BIW E;  4QQH A;  3ZFG C;  3FHQ A;  1JYW A;  2DVA A;  5FMB A;  1RB8 G;  4QPI C;  2A6X A;  2XVG A;  3NKG A;  1LHW A;  1NCQ C;  4GQ7 A;  1UKR A;  4QKB A;  5CAZ A;  4FTB A;  4GJZ A;  3T2T A;  5FYT A;  1SLB A;  3OUH A;  2GH2 A;  2WN2 A;  3AKP A;  4RR3 A;  1F5J A;  2ZHK A;  1GSL A;  1JYI A;  1WCS A;  2JKB A;  1MZF A;  1W6P A;  4K7J A;  1GIC A;  1VE0 A;  4B29 A;  5FXZ A;  3DEC A;  1RHI 1;  2ENR A;  2VBB A;  3HIF A;  4IES A;  2JDU A;  5FMD A;  3ZXK A;  4K1Z A;  1K3I A;  5FZM A;  4E4Z A;  2QQW A;  2NN8 A;  2YBP A;  2F4P A;  1HKD A;  3DYP A;  4MYE A;  3U37 A;  5FBZ A;  2HYX A;  3GYD A;  1AXY A;  1YQC A;  4LBQ D;  1QNW A;  2RS3 3;  3E5U A;  2D93 A;  2VBP A;  3KQ4 B;  1Y3T A;  1YEW A;  1NCR B;  1UMI A;  4YM0 A;  5L7O C;  5C3Q A;  4MGZ E;  2V4V A;  2YYO A;  4Y5Z 0;  3MBW A;  1BEV 1;  4K1Y A;  4LIV A;  5JSR A;  3E6C C;  4TLG A;  1LHV A;  2XUE A;  3I59 A;  4CP0 A;  3WQ1 A;  3KGZ A;  1K12 A;  3D3A A;  3EQE A;  4TN7 A;  4XJZ A;  4HL0 A;  1Q8V A;  4FPC A;  3OG2 A;  5EV7 A;  1RUI 3;  1APN A;  2P3J A;  4Y5S A;  4AGR A;  3ZX7 A;  2DCY A;  1VMF A;  2VL4 A;  3RJ2 X;  5FYY A;  4QPI B;  1AR6 1;  4JDN A;  4GUL A;  3AP9 A;  5FK8 A;  2Y26 A;  1W90 A;  1LHU A;  3QOP A;  4ZHN A;  3PTY A;  3P3P A;  1O5U A;  1V6I A;  1XE8 A;  5L9R A;  3T4V A;  3W58 A;  2VZO A;  1ODN A;  2C1F A;  1DQ0 A;  5IK8 A;  3T2P A;  5JUV A;  1MVE A;  1Y7B A;  2VQU A;  1Z0H A;  3KHB A;  1PM7 A;  1W9W A;  4IE5 A;  3EYP A;  2VTF A;  2WNU B;  4DEQ A;  2JG8 C;  3WP6 A;  3WP3 A;  2YGM A;  2BNM A;  2ORX A;  3ASI A;  2WJS A;  3ENR A;  3HJR A;  1ZRI A;  2AR6 A;  3WLU A;  1RUI 2;  1PO2 2;  2VE1 A;  1H0B A;  4C1W A;  5ABJ B;  2XJV A;  5HV0 A;  4H7L A;  5IAT A;  1QKQ A;  4QM9 A;  1LU2 A;  5JVV A;  4Y20 B;  3ZYF A;  1IPS A;  3OTF A;  1XXN A;  1PM4 A;  5FKB A;  5FUI A;  3C7F A;  1KRI A;  1SHW B;  1FMD 2;  1AX2 A;  4PIX A;  5F3I A;  4CVU A;  2FCU A;  4FTE A;  4X8P A;  1HRI 3;  4Q4V 1;  1OA2 A;  2R04 2;  2R06 3;  3NKT A;  5FZK A;  3T08 A;  5A1A A;  5A7P A;  1VAM A;  3LEG A;  2I07 B;  5BPX A;  2C9K A;  4OQ9 A;  2J1E A;  1HX6 A;  2WNE A;  4BQY A;  1CAX A;  4CP9 A;  4OI2 A;  2QQU A;  4XXA A;  2B9V A;  1W2T A;  1W6Q B;  5CFD A;  5IVE A;  5L7O A;  5FP9 A;  1SFY A;  3DKQ A;  1GFF 2;  3KM5 A;  2ZAB A;  4L0P A;  3ME2 A;  4L8Q A;  4PI2 A;  4NPM A;  2WNU C;  3UT0 A;  1EYB A;  4IEV A;  3MIG A;  3I2O A;  5FLH A;  4W6W A;  1UMZ A;  3P1I A;  5I0T A;  5ACA 1;  4OHV A;  2ILM A;  2HWB 2;  1HB1 A;  1PGS A;  2QQO A;  1J1L A;  3OPW A;  1LR5 A;  4ORF A;  4XDQ A;  5CFC B;  1UZZ A;  4V1P A;  1AYM 1;  1W8Z A;  2CL2 A;  3R6S A;  4WM7 A;  3DPR C;  1DDL A;  1DP0 A;  3I2K A;  3MLJ A;  1ND3 A;  3CJI B;  4JKK A;  3DF0 A;  2BW8 A;  1UYY A;  4Q0V A;  1UOB A;  2ADE A;  3VUO A;  2QVS B;  3JB8 A;  4LKF A;  5A7W B;  1QOO A;  2WFF 2;  3LD8 A;  1ENQ A;  2D6M A;  1D4M 2;  4OFG A;  2J22 A;  5E6H A;  1FXZ A;  2WQZ C;  1BVP 1;  1DZR A;  1JU4 A;  3PU8 A;  2HWC 3;  2RS5 1;  1R1A 2;  4IGO A;  2WS9 3;  2GN7 A;  2XXZ A;  3BGA A;  3LDR A;  5T5P A;  1VBE 1;  3WG4 A;  2P5B A;  5FWJ A;  2B42 B;  1N3Q A;  4HXC A;  2VOW A;  3NRU A;  2IFR A;  2WFP A;  1JU3 A;  4Y33 A;  3NMB A;  3VBO B;  4LXL A;  1JZ8 A;  4LA2 A;  4HBN A;  3VD4 A;  5FMC A;  4BM8 A;  3M3Q A;  2NLR A;  1PNF A;  4AQT A;  4O9E A;  1RC6 A;  4AFC A;  4MVT A;  4XF4 A;  1UU4 A;  3VBU A;  4XFA A;  3FLR A;  3K2O A;  4B1L A;  2D40 A;  1C8N A;  1COV 2;  2H0V A;  1YCI A;  1RUC 2;  2NMN A;  3N35 A;  4GMP 3;  4MO3 M;  2NZ9 A;  4PLM A;  5FP8 A;  4FPL A;  4I30 A;  4KMQ A;  2ZGS A;  1W6Q A;  2PFW A;  5FY1 A;  4KGG A;  5DUU A;  5EJ1 B;  1HQN A;  2WZR 2;  2DFB A;  3UJO A;  4KWJ A;  1XNK A;  3NJV A;  2RR1 1;  3I2I A;  1J59 A;  4RS5 A;  2UWC A;  2V4A A;  3UES A;  1OQD A;  1VBC 2;  2Q0A A;  4YFW A;  2MPF A;  4IV3 B;  1VRH 3;  3TRS B;  1QJX 2;  1YFX A;  5FIX A;  4Q4W 3;  4RHV 1;  4NO4 A;  2JDM A;  4MGQ A;  2E32 A;  2MHF A;  3N9O A;  5I0U A;  3WDY A;  2WWS A;  2EF6 A;  2VUL A;  3THT A;  3L2H A;  3OBR A;  1E5S A;  1LEM A;  4AVB A;  3LEI A;  1Y43 B;  4DUV A;  2EAK A;  3A0N A;  2EA7 A;  1CJD A;  1POV 3;  3S57 A;  5E8A A;  4H2A A;  4EQV A;  4XAB A;  1CQ9 A;  4IEW A;  1YYN A;  1V6J A;  3OBA A;  4LOS A;  1U5I A;  4OYU A;  1U5X A;  2Y60 A;  3AC0 A;  2QQM A;  4I0W B;  5C8C C;  5KHJ A;  4QX2 A;  1OFN A;  4NHK A;  4PDW A;  4HAN A;  4CU6 A;  1PGW 1;  1GWM A;  2WAO A;  1VBD 3;  5FP3 A;  3A21 A;  2FDJ A;  5I8T A;  4AVC A;  4HET A;  3AXD A;  5JOW A;  3V0A A;  2LM3 A;  3T1L A;  1H8T B;  5FPV A;  4DXZ A;  4BQ2 A;  3VBU C;  1RJ8 A;  4OMD A;  4CUA A;  5FPX A;  4Q2F A;  2ZAC A;  1JTZ X;  3HN3 A;  4JKL A;  3MV0 1;  2WNO A;  3VDA A;  2JDY A;  4Y5T A;  5LA9 A;  3IM0 A;  3THC A;  3SQO A;  3M3C A;  1COV 3;  1VBB 1;  3ZN6 B;  5FZ3 A;  2ZGM A;  3CF6 E;  4H55 A;  1AJO A;  1SLI A;  3VBF C;  2FDF A;  1W0N A;  1OHF A;  3PL0 A;  5EPA A;  3ACG A;  2BDR A;  5T54 A;  4L11 A;  1WMD A;  2YHJ A;  5FYU A;  1T6G C;  3JBG 1;  1J3R A;  4BH9 A;  5ACA 3;  3WF2 A;  2VVE A;  3RGB A;  1ZYB A;  1MS9 A;  2RJ2 A;  3DV8 A;  1W04 A;  3R05 A;  1XND A;  1LES A;  4OZX A;  2OQ6 A;  5FOJ B;  4DB5 A;  1H1A A;  1BKZ A;  5EJZ B;  3V0B A;  4XJA A;  2W9X A;  2E7A A;  1VBA 1;  4Z82 A;  5FUP A;  3VBR C;  2WII B;  1PO1 2;  4M3C E;  5DAB A;  3VZN A;  3QH6 A;  3ZYR A;  2GC2 A;  3HT2 A;  1EV1 2;  1ZVF A;  3ABZ A;  2JDK A;  1YIP A;  5EYX A;  5I8S A;  1G8W A;  1M4W A;  1UIJ A;  1EPW A;  2IWG B;  3NNJ A;  3Q8B A;  1JUH A;  4QX5 A;  5LRS A;  2XPJ A;  5DPN A;  4QAW A;  2ID4 A;  4BQ1 A;  1OF3 A;  2E31 A;  4IEZ A;  3B9I A;  2Y33 A;  2ZHN A;  5C8C A;  5F5A A;  2DUR A;  4QT6 A;  1VLN A;  3ACF A;  3I2H A;  2O8Q A;  4RN5 A;  1F15 A;  2HBT A;  3P5B A;  3WUD A;  1WW5 A;  4AF9 A;  4YGB A;  4D94 A;  4QWN A;  2WT2 A;  4GKX A;  3VHP A;  2ZAA A;  5EQU A;  2JDZ A;  1NY7 2;  1XU1 A;  2XJP A;  1ONA A;  2ZGR A;  3AYA A;  3PNA A;  5BUV A;  4NHY A;  1YQ2 A;  2BUK A;  2AZ5 A;  4GWM A;  5LCW L;  1W06 A;  1H2L A;  1O8P A;  4CCN A;  3VBU B;  4DNY A;  5BNP A;  3IDB B;  4YZ2 A;  1NG0 A;  5B4N A;  1QXJ A;  5JPM B;  2R16 A;  3ZFF A;  3BB6 A;  5GZE A;  3ZDV A;  3MDP A;  2HBU A;  2IXC A;  3AB0 A;  5FO9 B;  1POQ A;  2BWA A;  4I0B A;  3BN6 A;  2CU5 A;  3VZJ A;  4YW3 A;  3WDT A;  1I9R A;  1MZ6 A;  4QMA A;  2YV8 A;  3AM2 A;  3IN9 A;  4LBO A;  4WM7 C;  5F8P A;  2X5I A;  4L97 A;  4B4R A;  2PLV 1;  4MGT A;  4LBQ A;  5FYB A;  4PDW B;  2NMO A;  3B7M A;  1YQ8 A;  2RMU 1;  4QU1 A;  4S2H A;  4JTO A;  3APB A;  4S2D A;  4ATF A;  5JZG A;  1LOE A;  5LWB A;  3FHI B;  2P3I A;  3S5Q A;  5K8S A;  2W92 A;  3AYE A;  5IVC A;  3JU9 A;  3M3I A;  2ZML A;  2BVB A;  4D6R A;  4ZU5 A;  1QOT A;  3H3Z A;  3WEZ A;  3Q8E A;  3TEY A;  2CGO A;  3WQ7 A;  5K7P A;  1AVB A;  1LOB A;  1RUG 3;  5GZG A;  2JD4 A;  3BVC A;  4M0N A;  2WSV A;  3POY A;  4CDW C;  4CCM A;  4J1X A;  1CZV A;  2D6K A;  3O5S A;  2IVJ A;  2JIJ A;  3OEB A;  2X10 A;  1FAY A;  4IEO A;  4DS0 A;  3NAP C;  2HEW F;  1NA1 C;  3D82 A;  5BNQ A;  2ZEW A;  2ZA9 A;  2RVA A;  4HKO A;  2QZ2 A;  1GP5 A;  2VW0 A;  5LBC A;  1RIR A;  3UGH A;  4WZF A;  3NNG A;  3ACH A;  3UV9 A;  3PUS A;  4MSV A;  4NUB A;  3R4S A;  2OUJ A;  1AR8 2;  4N9I A;  4YZ1 A;  5J7M A;  2FDK A;  5JIA A;  4B8E A;  2DVG A;  4A41 A;  4LA3 A;  1FPN 1;  3C8X A;  4WZC A;  5FZO B;  2XQR A;  3OPZ A;  5FYZ A;  3E5X A;  3WY6 A;  1W99 A;  4YWA A;  2EXH A;  4G9S B;  1ZBA 3;  2ZGU A;  3WF4 A;  4D0Q A;  1RHI 2;  4FAH A;  4BQW A;  4Z2W A;  1E5H A;  1O3R A;  3I3E A;  2ZJC A;  4QGL A;  3TNQ A;  4K3U A;  5JMC A;  4QX3 A;  2VMC A;  2QQP A;  5A3W A;  2YUE A;  1ZZ6 A;  5FRE A;  2D6N A;  3LF7 A;  4NWW A;  1S0F A;  5KHH A;  1FPN 3;  4BK5 A;  2Y34 A;  4JZR A;  5DN2 A;  4EN9 B;  1X7N A;  4HZF A;  4MLO A;  4N7U A;  4CP2 A;  4COW A;  4CDU C;  1BEV 2;  5FYV A;  1OKQ A;  3T2O A;  3FZ3 A;  3LWC A;  5FZ6 A;  1I3H A;  1QQP 2;  4XHB A;  2Q8E A;  4YM3 A;  1ULG A;  1YI9 A;  5HCB A;  1CAU B;  5FJK A;  2X05 A;  5JSP A;  4A6O A;  1C8M 2;  5FBJ A;  4TSV A;  2UU8 A;  3S30 A;  5FFO C;  3AL6 A;  1W8N A;  2X09 A;  2HWF 2;  3N36 A;  4JQR A;  3IAQ A;  2ARX A;  1YHF A;  2VZ1 A;  4X6R B;  3IZO A;  1CZS A;  1TNR A;  2QQN A;  3RFR A;  3H8O A;  3FX3 A;  4DIQ A;  3GJA A;  4AEK A;  2QZ3 A;  2FQP A;  1JOD A;  4WVM A;  1UF2 C;  3HWJ A;  4FFG A;  1JS9 A;  3H3L A;  3KCX A;  3W5N A;  2JEN A;  4NRP A;  2QFE A;  5LAT A;  2AEZ A;  3IIA A;  3PU3 A;  5FZB A;  5DAP A;  5GZD A;  1J84 A;  3POB A;  1IPK A;  4NR1 A;  2YDE A;  2BU9 A;  1AR9 2;  4YW7 A;  4PF5 A;  1CR7 A;  3MZH A;  5IVY A;  5FZI A;  4A4A A;  1RVF 1;  1MS0 A;  1F5F A;  3AP4 A;  3HOB A;  3K3O A;  5FPB A;  4GH4 C;  4FPO B;  2JG8 A;  2A73 B;  1VAK A;  1H2K A;  2RS3 1;  2W08 A;  1F4H A;  1S0I A;  4MGI E;  2I45 A;  4XFH A;  4XHX A;  3N4M A;  1NLS A;  1UYP A;  1GMM A;  2XBO 3;  1BEV 3;  3U11 A;  1D4V B;  1Q5O A;  1N3O A;  4MX3 A;  4C90 A;  3UJQ A;  1CON A;  1FMD 3;  4AI3 A;  2XOM A;  4CDW A;  3E97 A;  4PDW C;  3MW4 A;  3HMY A;  1US3 A;  1MQT A;  3WP5 A;  4UFM A;  2P6H A;  4CCE A;  4NOT A;  1DLL A;  2GAU A;  3ATG A;  5FRA A;  3CL1 A;  5GLW A;  3RWN A;  4XDO A;  3FFQ A;  5LA2 A;  2IXH A;  1LEN A;  4CCL A;  3ZLI A;  2HWE 2;  4FI9 A;  5T5L A;  3J9S A;  1W8H A;  3PDQ A;  1IS6 A;  3C7O A;  3KB5 A;  3MW3 A;  4PBO A;  2J1U A;  5GAL A;  3BU7 A;  4N8M A;  1OUX A;  4PCR A;  5FPZ A;  3VL9 A;  3OOX A;  5C9A A;  2VD7 A;  2JG8 B;  4Q8K A;  1LU1 A;  1S2B A;  1W6M B;  2BOJ A;  4W65 A;  4AVA A;  4OHZ A;  4A7Y A;  3ITQ A;  3U4S A;  4BU2 A;  2DWR A;  3MF9 A;  1ND2 C;  3CO2 A;  5KHI A;  1XSR A;  3GGL A;  2RHP A;  1XQN A;  4IXL A;  4LKD A;  4QU2 A;  4FQZ A;  4XOG A;  1ASJ 3;  3VBO A;  1HXS 3;  2Q5T A;  4OVE A;  2VTX J;  5CG8 A;  2YU2 A;  3ETQ A;  3VDC A;  4LBJ A;  3KVB A;  4LT5 A;  4XCA A;  2RS5 2;  3IT8 A;  4FOW A;  4E8D A;  3ZR6 A;  1VBE 3;  4BIO A;  1VBE 2;  1W3V A;  3BI3 A;  1ZBE 1;  4JDO A;  2BTV C;  2VUA A;  3KMH A;  3OGJ A;  3WR0 A;  4AOC A;  2EID A;  2WT1 A;  1DCS A;  1OD3 A;  1ZZ7 A;  1RUC 3;  4Q4W 2;  3IDA A;  5FZ4 A;  1AR6 3;  1UWW A;  4FPG A;  5C4W B;  4QXC A;  4SBV A;  1UZ0 A;  2B4K A;  3AJY A;  1RUE 1;  3AP7 A;  3WDW A;  4M4R A;  1GZW B;  3U1X A;  1E57 A;  5LEJ A;  2W1Q A;  1WLT A;  1ND3 B;  4UOJ A;  2RS1 1;  4A3X A;  4H7M A;  3BPS A;  4TXW A;  4EN6 B;  4XUR A;  5JSO A;  1GV9 A;  2GME A;  3EXU A;  1RUC 1;  3LEM A;  4Q0P A;  3BUC A;  1REE A;  5IVJ A;  2ZKL A;  1UZW A;  2CNA A;  1QJY 1;  4CDQ C;  1QIQ A;  4D7T A;  4QX1 A;  3B02 A;  2YG0 A;  2CDO A;  3LE0 A;  1TNF A;  2WZR 1;  3O7O A;  5F2W A;  1R1A 3;  2D7F A;  3LA7 A;  2G9G A;  3DCQ A;  1AZD A;  4B7E A;  5AC9 2;  2N7G A;  1C5H A;  2YMZ A;  4YVS A;  5LK7 B;  2VUC A;  3VBF A;  2YZ4 A;  3KHC A;  1X8M A;  4E27 A;  4QDS A;  5AVA A;  5CEH A;  1KEX A;  3NVC A;  2YPD A;  2YBK A;  1ALY A;  2OT7 A;  4DXS A;  1W3X A;  4XQ4 A;  1NOV A;  5DDJ 1;  3ZN5 A;  3KLS A;  2E33 A;  5A7N A;  1W6M A;  2HKX A;  3C7E A;  5HCA A;  5ERL A;  3POG A;  4QXB A;  1ST8 A;  2BNO A;  2VNG A;  5FJH A;  4QXK A;  1PMH X;  3K4D A;  2Y6J A;  4NPR A;  1FOD 3;  1RXF A;  4Y1U A;  5FP7 A;  2J7M A;  1S2K A;  3JD7 3;  1YRZ A;  1UX7 A;  2VVF A;  4CDX A;  5LZ6 A;  3FBM A;  2GZW A;  1BBT 2;  1TG7 A;  4AG4 A;  2UUR A;  1OOP C;  2FMY A;  4AI1 A;  4M0H A;  2Y6K A;  4XJW A;  3NL1 A;  3ROU A;  4ES9 A;  3GCW A;  4COZ A;  5JZG C;  2DCJ A;  5HXV A;  1EUU A;  2XB6 C;  3U10 A;  1EP0 A;  4LUK A;  2K0G A;  3NW4 A;  4A42 A;  2AGS A;  3B5L B;  4TYS A;  4X6Q B;  5EJ3 A;  5GJ6 A;  3AFK A;  1W2N A;  4DXR A;  5FYI A;  2V73 A;  4JRL A;  2HWF 3;  2A3W A;  2CSG A;  2SLI A;  4CP9 B;  1MS3 A;  1DYP A;  4U36 A;  1NXD 1;  2VOK A;  3VBF B;  1VBB 2;  3M3E A;  1LOA A;  4RQP C;  4P9Y A;  4K40 A;  3VDB A;  3OUI A;  4JGZ C;  1HB4 A;  3JBG 3;  5I0S A;  2G1M A;  3D8C A;  1J3Q A;  3GBG A;  5CG9 A;  3SC7 X;  1NXM A;  2CGN A;  4BPZ A;  3LZZ A;  4LEJ A;  4LKE A;  3TBD A;  3TEW A;  1E5I A;  3RYK A;  2HWB 3;  5BNO A;  1AX0 A;  3HPN A;  5GKA C;  1R08 1;  1RMU 1;  4BMB A;  2B45 X;  3EHK A;  5KR7 A;  3H9A A;  4QQP A;  1LHN A;  3ES1 A;  4M3C A;  2Z4F A;  3WNP A;  3RWK X;  1R09 3;  1WW6 A;  4EN8 B;  3JQX A;  1HRV 1;  3ZSJ A;  4KI5 M;  1HXS 1;  3ZKY A;  1BLZ A;  1J83 A;  2J1S A;  5F37 A;  1I5Z A;  3K51 A;  3JQW A;  4C91 A;  1DQ1 A;  4NJ4 A;  5JR7 B;  5E1R A;  3N7J A;  2RJL A;  4FOQ A;  5FV3 A;  1M06 G;  4CDX B;  2JEM A;  4JX0 A;  3OD0 A;  4R8H A;  1X36 A;  1L3J A;  3FN9 A;  2D3S A;  2GND A;  3B69 A;  3KSC A;  5F2S A;  3LPG A;  3VDD B;  3ZFE A;  3DL3 A;  1UYZ A;  4D6Q A;  2RS5 3;  4FO9 A;  5GLU A;  3CU7 A;  5TSW A;  1RED A;  1G7Y A;  5HBA A;  1YJL A;  2D97 A;  3WX5 A;  4E2S A;  4YG6 A;  3H1M A;  5FZ9 A;  2DYC A;  2Z5W A;  5FPL A;  5IK7 A;  1P8J A;  1KD7 A;  1O6U A;  2GC0 A;  4N9H A;  4YZ4 A;  2GP3 A;  2OZ6 A;  4XC9 A;  4M3C F;  3N9Q A;  1YO8 A;  3NST A;  4RQP B;  4CA9 A;  4YRD A;  1ENS A;  4UXA A;  4MG2 A;  2VZU A;  5FZO A;  1IS3 A;  2VY0 A;  4AI2 A;  3AJZ A;  5IVB A;  2JE9 A;  1VBA 3;  2B39 A;  4B3N A;  2E7T A;  4BOW A;  5J3U A;  2FDG A;  2DTY A;  2E7Q A;  3WCS A;  1D4M 1;  3QAC A;  4XUO A;  4OZO A;  3RSJ A;  2RMU 2;  1W0P A;  3KF3 A;  1VAL A;  5APA A;  1UMH A;  2VQT A;  4XIO A;  4CXX A;  2LAL A;  1QXP A;  1BZW A;  4PF1 A;  1C3H A;  1NA1 A;  2YPJ A;  3CNA A;  3MW2 A;  4DQA A;  4CDW B;  2YRO A;  5DQ0 A;  4XFI A;  2GNM A;  5FZ7 A;  1HLC A;  3O1S A;  3SKJ E;  3MO4 A;  3O0W A;  1N1T A;  4G3Y C;  1DHK B;  1QY4 A;  2VO5 A;  4I02 A;  3NJX A;  4XTM A;  2Q8O A;  1UKG A;  4ZS3 A;  1HW5 A;  2WAA A;  2ZGP A;  5JI9 A;  1IQA A;  1TZO A;  5C4W A;  3AZZ A;  2J1A A;  1UD1 A;  3WNO A;  2LRP A;  1LB2 A;  3L2Y A;  5J48 A;  4KG8 A;  1UOF A;  3W21 A;  2JE8 A;  1COV 1;  4QHB A;  3ZDS A;  5IFP A;  3DPR B;  1PGL 1;  2XBO 2;  2VOT A;  3D6E A;  3OEA A;  4XJ9 A;  5DG1 A;  5JOY A;  2DCZ A;  1EV1 3;  2PAM A;  4N53 B;  3RZZ A;  2W0X A;  2X5I B;  4LMF A;  2JX9 A;  4YM2 A;  4NRM A;  5GZC A;  3AVR A;  1FPN 2;  2CDP A;  3SIS A;  3TN9 3;  4P9G A;  2WIN B;  3PUA A;  3CJI C;  4OQ8 A;  2DUO A;  4WVM B;  3EBR A;  5LEK A;  1VBC 1;  3CKH A;  1CZT A;  3MFC A;  1X8E A;  3WNM A;  4Y26 A;  1JBC A;  1SLL A;  1QJX 1;  4MV2 A;  3ZXG A;  3KCY A;  1MS8 A;  3ZIW A;  2PLV 3;  1MS1 A;  1QH7 A;  3MIH A;  1S0B A;  1H4G A;  1S0J A;  4B4Q A;  4ITC A;  4CDU B;  2BBA A;  2BGO A;  2RMU 3;  4QDR A;  5FCC A;  2FD8 A;  3F95 A;  5J09 A;  5EYY A;  1PZ9 A;  3W20 A;  3QH7 A;  4CU8 A;  3UKT A;  2WNV A;  2YU1 A;  3OGS A;  4GB3 2;  4CEY A;  2GNB A;  3AYC A;  3VKM A;  5LBE A;  2P4E A;  5L7O B;  1AR7 2;  1AXK A;  1CAV B;  5IFT A; 
#chains in the Genus database with same CATH homology
 1OH3 A;  1V0A A;  4A6S A;  2O14 A;  1W8W A;  1GWL A;  4LKF A;  1L7L A;  4CP9 B;  1UOJ A;  2C24 A;  5D21 A;  3UT0 A;  1W90 A;  1OKO A;  2VXJ A;  3ZYF A;  4BQ2 A;  4LK6 A;  4LK7 A;  1W8U A;  4CPB A;  4BQ5 A;  1GWK A;  1W8T A;  4YW7 A;  3ZYH A;  4YW6 A;  4LKD A;  1HN0 A;  2LRP A;  4AL9 A;  4YWA A;  4LKE A;  2KR2 A;  1WCU A;  1W8Z A;  3F95 A;  4LJH A;  4CP9 A;  2Q1F A;  1W9F A;  4BQ3 A;  2K46 A;  3ORJ A;  1GWM A;  2WYF A;  4CPB D;  1WZX A;  3ZYB A;  2LRO A;  4BQ4 A;  2JWP A;  1WMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...