2VXJA

Crystal structure of pa-il lectin complexed with agal13bgal14glc at 1.9 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I GALACTOPHILIC LECTIN
publication title Structural Basis of the Preferential Binding for Globo-Series Glycosphingolipids Displayed by Pseudomonas Aeruginosa Lectin I.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2vxjA00
1WZXA 3ORJA 4CPBD 2VXJA 1W8UA 4LKFA 5D21A 4AL9A 4BQ4A 4LK6A 3UT0A 2LRPA 4LJHA 4A6SA 3ZYBA 2C24A 1W90A 2LROA 1UOJA 1W9FA 1W8WA 2KR2A 2O14A 1GWMA 3ZYHA 2Q1FA 4LKDA 1WCUA 4YW6A 4CP9B 4BQ2A 4CPBA 1GWKA 3ZYFA 1GWLA 2JWPA 2K46A 3F95A 1V0AA 2WYFA 4YWAA 1W8ZA 1OKOA 4LK7A 4BQ5A 4CP9A 4LKEA 4YW7A 1W8TA 1HN0A 4BQ3A 1OH3A 1L7LA 1WMXA
chains in the Genus database with same CATH superfamily
5FYUA 4CUCA 4YZ5A 1POQA 4BXSV 2D3SA 3VN4A 3J8F3 1GR3A 4GXLA 3U4XA 1AXZA 5BY5A 2ZGOA 4GWJA 1TME1 4CU8A 2XUMA 4OZXA 2WLPA 4V2VA 5G05L 4HVQA 5HCAA 1ND3B 2R1DA 5F5QA 2EIDA 4P02B 4CSWA 1MQTC 2XQRA 1UZZA 2V4AA 2A1XA 1H4GA 3OGGA 4CU7A 3FHQA 3ZFGC 1PZ8A 5FXWA 4A3XA 3ZPYA 5FUNA 1SFNA 1ZZ6A 2VMGA 5FZ4A 5CFCA 1UIJA 4AI1A 1UD1A 3GZTB 5FZIA 3ZSEA 5AVPA 1W9SA 3JD73 3RYKA 2GC1A 2Q8DA 4BK4A 1GOGA 1W06A 1LRHA 4W6YA 2QVSB 1VBE3 4LK6A 2OW4A 2AYHA 1TVGA 3SITA 2WWSA 4A6SA 1W3XA 1UCXA 3H8UA 4XDQA 3TB0A 2XJVA 3RZGA 2VG9A 4RL7A 1I1EA 2EXIA 1H8TA 3NAPB 3U37A 5FREA 5DDJ3 3MLJA 4AFBA 4Y1UA 2YY1A 4JTOA 2WIIB 5CFDC 2R043 2QZ2A 4GB32 5J37A 2JWPA 3KGLA 4LTAA 4IV1C 1VALA 3LIHA 1NXMA 1IPJA 2XONA 5ABJB 3JUUA 4RR3A 3GZEA 1VBD2 2XVLA 3AMHA 1NG0A 1JUIA 1SLCA 2E51A 1TZOA 2JG8C 2JX9A 1UYYA 3AMPA 3HNBM 3GJBA 3NKTA 5KHHA 4IUGA 1HXS2 1LHVA 3AZYA 2B5HA 4SLIA 3ZM8A 4XPVA 1WD4A 2IUWA 5HI0A 1CAVB 1BBT3 3ETPA 1AR73 3FLTA 3PURA 4WM8A 4I0WB 1S0JA 1V6NA 2W3JA 4OHXA 1CQ9A 1FMD3 1R64A 5L7OB 4ZXEA 1NXD1 4RD7A 3ZYHA 1VJ2A 2WNVA 4I30A 4M01A 5JSRA 3TBDA 4YW6A 3ZX7A 1OURA 3VD4A 4BQ2A 3C7EA 4WZCA 3AVRA 1VBA2 2ZGQA 3KF3A 3WNOA 1CX4A 2LUWA 3HVDA 4LBQB 3NV1A 5LA2A 1O91A 1SFYA 1QU0A 4UF0A 2PFWA 4LORA 4XUNA 3OPTA 3S5AA 3SXWA 1RHI3 4META 4AL9A 1UX7A 1SBDA 2R30A 4PIZA 3O1OA 2WO1A 1LGNA 2RS32 1H6YA 4LBKA 1GICA 2BOIA 4BQYA 2HWF2 2VZ1A 2XR4A 4CDUB 1A6CA 2DVGA 4EZ4A 3SQOA 1AL0G 1HIXA 1L3JA 3AYEA 4MGQA 2W68A 3D6EA 4LKDA 2K9ZA 1RVF1 3CZUA 5J09A 2RS11 1VBC1 2IVJA 4AI2A 4F7ZA 4EJRA 4K8RB 2PXJA 4MXWB 3V0BA 3SISA 5D2AA 2VBDA 3I3MA 3UJOA 4COWA 5D8AC 5LK7B 2W1SA 2VULA 1W28A 4TYSA 2FZ2A 1UYXA 2P2KA 5L9VA 1DG6A 3CBNA 3MW4A 3GNEA 3BTZA 2FMDA 1W6NB 2Y0IA 2IC1A 1MS8A 3RI8A 1UNBA 3WLUA 3O1MA 4GQ7A 1W90A 1XPWA 2WN3A 3CU7A 4FP3A 5C4WB 4HSLA 4Y20B 2PAKA 4LLOA 4UFLA 3I8TA 3WNLA 5HCBA 1QH6A 2WA3A 1W8HA 2H0BA 3LA7A 4MGIE 3MLKA 2ID4A 5A32B 5KHKA 4S2HA 2P3YA 4OMDA 1GQGA 1ND2A 3ELNA 4CDXC 4K40A 1ENSA 3CJIB 1YFYA 1CAUB 2FHRA 3VZKA 3WDUA 2CDOA 3OCPA 1H2MA 4YZ2A 4ZKTB 2R0FA 3DPRB 2WZEA 1IHMA 1ULCA 1W6OA 1U12A 1PX3A 1LEMA 4KWJA 3SH3A 3OPWA 4Z1VA 3DYPA 3RJRA 2DCKA 2PELA 4OMCA 5IW0A 4S2DA 2B9UA 2HWB3 1RUOA 2I45A 3O1UA 2JDKA 1WLTA 1U5IA 3MIHA 1CONA 4OUMA 2XUEA 4Q1RA 4GB31 1AUYA 4N53C 3POGA 4W6XA 2OUJA 1RUE3 5A7WA 1FI2A 3MFAA 3QD6A 4GKYA 4TLFA 1JZ3A 1J3QA 3VDDB 1D0GA 1QJEA 5K8SA 2ZEYA 2TUNA 1VBD1 1YWKA 2B39A 2QQLA 1EUTA 3ITQA 4UFMA 3W21A 3HQUA 3ZDSA 3AKPA 3ZMOA 2QDRA 1HXS1 5LWBA 5C5TA 1DP0A 3T3YA 4CEWA 1BEV2 5BNNA 2JKBA 2PAMA 1PNFA 3LQCA 5JCTA 4N9HA 1V70A 5GLVA 4ORFA 3HMYA 2AENA 2PHTA 2ZX4A 1I9RA 3AKTA 3U1XA 3IM0A 1O8SA 4NWVA 4AEJA 3VBUB 2D5FA 4YW1A 1S4CA 1VBA1 4TN7A 5T5PA 1ZX5A 1FT9A 4AVAA 1UKRA 4R9DA 3BTYA 2AEZA 1GQHA 1RUNA 3OGRA 3J8F2 1PMIA 1QIQA 3I7DA 3WEZA 5EQUA 3DN7A 2B4KA 4GD4A 5GALA 1XU2A 3LZZA 3NSTA 4MHRA 2RS31 1K3IA 4LA2A 1JZ2A 2VW0A 1LAJA 2HWF1 1AF9A 3WF0A 1C5IA 2Y0OA 4YGCA 2WFPA 4D6RA 4N8MA 4WVMB 1JHNA 3M3EA 2XWBB 3AYCA 1ZBA3 5JZGC 5H9SA 3JD72 4ASMB 2FDJA 3WXPA 3MEPA 3RDIA 1ULPA 1FPN3 1CAWB 5LATA 2AUYA 1NCRC 2YBSA 2ZHLA 3N9OA 4KNCA 5KBFA 5M0TA 3LD8A 3ROUA 4MHUA 3WW3A 3KS7A 5A3TA 4JKMA 5FK7A 1VBE2 1W39A 3N3HA 3RZLA 3WQ1A 5FZAA 2FQPA 3AK0A 3C3VA 4K20A 1C3HA 2D6PA 2G9FA 3ILFA 3N7LA 2O8QA 2XJQA 4AFAA 5JMCA 2P37A 2FDFA 1XYNA 1NLRA 1S0CA 2JDMA 4UFKA 2OVUA 3MW2A 3B3QE 3VBSB 2Q5TA 4RGKA 4KU7A 5CAZA 2R042 5FFOC 1YYNA 3S57A 2OX0A 1GOHA 1QF3A 3CL1A 4IQPA 4LIVA 4AVSA 4WV8A 4CDWC 1YO8A 2GALA 4XXAA 2WO3A 2XKOA 2YDEA 3KD4A 1VMHA 4E8DA 3VBFC 2F4LA 3MIEA 3WZ1A 3E1F1 5LZ6A 2FCVA 4RFT0 2F4PA 1Z7S3 4P9WA 4QB2A 3OUHA 1AR72 1DLCA 1SBEA 2XGXA 4QAWA 3OUIA 3WDTA 1L7LA 4FQ4A 1GP4A 3PVBB 4GJZA 1Y3TA 2CGPA 3JQXA 1PVC3 1UAIA 5JOWA 4OYUA 1YIFA 2ZKLA 5CBLA 2BU9A 5KXBA 3HNYM 5DPNA 2TNFA 4QQ2A 3VDBA 4NROA 2ZGNA 3VHOA 2WA4A 2X53S 3ZKUA 2VOKA 5JOYA 3HD8B 4JQRA 3I2JA 5FY7A 4QX8A 1EPZA 3MBWA 4YNIA 4HG6B 3KT7A 5FKCA 4NN0A 4CEYB 2VTXJ 2J1RA 3PTYA 4IV3A 1GUIA 5FO9B 3O7OA 4K7JA 2P3JA 2YMZA 3KM5A 4MOAA 1RHI2 4AGGA 4XOGA 5EYYA 4ET7A 1W9WA 4HN1A 5BNPA 1XXNA 1LJ7A 2NN8A 3KF5A 3LWCA 5DG2A 1BEV1 2XL7A 5C8CA 4LKFA 2OPWA 1CPNA 4YVWB 5IJRA 4IEYA 5FY4A 1CAXA 1UY2A 1H6XA 4PI2A 5LB6A 5E88A 3WW4A 1BQPA 1V6OA 2W52A 4GH4A 4OI4A 1SLIA 3WNXA 1CX1A 1QH7A 1DZQA 2DUQA 3NV2A 3POSA 4DZGA 4FOVA 4K3UA 2GH2A 4KWUA 3LB9A 1POV1 2YBPA 3NMBA 3LSEA 2GU9A 1ND3A 3HWJA 5T3NA 4DNYA 3PVOA 5GZCA 1I6XA 1QMJA 4LKSA 5FXZA 1HX6A 1O59A 5IVCA 4UW4A 3J8F1 3HQXA 3OOXA 4M3CA 2Q8OA 4W8JA 4A45A 1UMIA 1GMMA 4JRLA 2GP3A 3MIBA 4PDWC 5EZWA 1XNDA 2K0GA 1BLZA 2VOWA 3UK9A 1XSRA 4KWLA 2DUPA 3FL7A 1MS4A 1NA1A 2YU2A 3LSDA 4ZXKA 3U0ZA 1HLCA 1O7FA 4KI5M 1J3PA 5F9TA 3BI3A 3WP3A 1IQDC 5DZGA 5F7UA 4U36A 1LR5A 4QGLA 4XFHA 4OULA 4UBGA 1GNZA 3JD71 3WF3A 4BK5A 3AX4A 2EVXA 4Y5Z0 1YQ8A 4H14A 5CFCB 1UZ0A 2JECA 3GXUA 3FJSA 3T08A 2P3KA 4J25A 3M2MA 3DL3A 4NAMA 1IGOA 2HWE3 1VBE1 1XRUA 2VCMA 5A33A 1CVNA 4FPOB 2F6BA 5FMCA 3E6DA 3CDZB 3ECQA 2B8MA 4NHKA 5FQ0A 5LA0A 1R083 3L9JT 1IS4A 3R4UA 4YLZA 2DTYA 1H8TB 4LHSA 1DGLA 4LJHA 4MGKE 5EHDA 3I2KA 4NIDA 4YVSA 1XNCA 3BTAA 3Q8EA 3BPSA 1UMZA 1RC6A 2R041 2TBVA 4WM7C 4QGNA 2JE8A 5IWFA 1RUE2 4MO3M 4OCTA 2BOJA 1IKPA 4OQ8A 1JU4A 4N90A 1UOFA 2WAAA 4DQAA 2Y60A 1ODNA 4RR3B 3VL8A 4QGMA 1G9DA 2UYBA 1E57A 5T5LA 2K46A 1VMJA 2P6HA 2PLV3 1AR71 4XW3A 3WQBA 3MGUA 4PLMA 4UW3A 1O4YA 4WM8B 3RQ0A 3J7MA 1FNZA 4XF9A 5EJ3A 4DXTA 1LENA 1IS6A 4GJYA 4B4PA 4CUBA 2WNVB 3J7LA 1LU2A 3CQOA 3LOBA 2WDBA 3UKTA 2GAUA 4CXXA 2CNAA 4RS5C 1QOOA 1N47A 3MI8A 4C1WA 2DU1A 2ZHMA 4KMQA 2ZJCA 5JVVA 1QWRA 1O3SA 3AL6A 4E4SA 2WNUC 2DCJA 2JE7A 5KXEA 2XPJA 4UF0B 1UU5A 3MV11 4N43A 3RWKX 4Z8BA 3ZFFA 1RHI1 4QPGC 3ZSMA 1Y4WA 1W04A 4ARXA 4DRVA 2W39A 4XABA 2ERFA 3DF0A 5J36A 2VO5A 1C28A 3J4UH 1V6LA 1PX4A 3PUIA 1EP0A 1QHDA 1UU4A 2RS13 4MXWA 2W1UA 3APBA 1FV2A 1N1YA 1ZBA2 2QZ3A 3DUIA 1FPN2 5FLJA 3IT8A 5FY1A 3V0BB 4XIKA 4PIXA 2JJ6A 4P9LA 4CPBA 1C8NA 4IEVA 3CEWA 5GJ6A 5IHRA 3NVCA 4XF4A 2O1QA 5FZBA 1OFSA 1H1MA 4XETA 2XOMA 3AXEA 5LY1A 4UAPA 1OKOA 2JDYA 4EROA 5BNQA 1NCQC 4FT8A 1I5PA 2OXBA 4XDOA 1TNRA 4KGGA 5A7NA 3FFZA 1D4M3 2Y33A 1CAUA 4XXPA 3PMSA 1NLSA 4BXFA 2OPKA 3T1MA 4EQVA 2XJUA 5EJ1B 2V09A 1Q56A 3I3QA 2J7MA 2JG9A 3DEMA 3ON7A 3C2UA 3LE0A 5FKBA 3VDAA 2X05A 3ZDVA 5FR3A 4HL0A 5FYYA 4GMP3 1ND2B 3BVCA 3J26N 3POFA 1KEXA 1W6MA 4NR1A 4A6OA 1LKNA 1W2NA 4FPHA 5FZKA 2D93A 4QM8A 5FK8A 1WCDJ 5FPLA 2A3WA 2HKXA 2WWUA 4L2NA 1C8M3 4KWKA 5B4XA 1SACA 1PVC2 1UO9A 3CF6E 3T0BA 3B02A 2BDRA 4E2QA 1K5MA 3DGTA 1OA3A 1NX9A 1LNSA 2D5HA 3ZYIB 4BOWA 4XQDA 4TWTA 4M3CF 1BJQA 3PJYA 2SLIA 3ETQA 1BMV2 3WW1A 1S0GA 1KFXL 2RDRA 4UW5A 4DMIA 2WINB 4QDSA 1RUE1 2BJSA 1ZZ8A 1EPWA 1W8WA 3AZZA 5A7WB 1FX5A 2C26A 2JIGA 4AVBA 1AR83 2VD7A 4MVTA 2ZMNA 5TSWA 2GNMA 4YSFA 1UYPA 3GDBA 1ULGA 4L92A 5FPVA 3ZXFA 3D82A 3I54A 2VZUA 4IV1A 4XZPA 4CEWB 2D6LX 2QTWB 4BQ5A 5BNNB 4YRDA 1AXYA 2VCCA 5L9BA 3AJYA 2KXLA 1HKDA 2JG8A 1IG0A 1MS1A 1B35A 5DQ0A 1URXA 5LK5A 4UOJA 4FVVA 1MS9A 3H1YA 3HEIA 3L2HA 1QNYA 3URFA 3OBZA 1SLTA 1UPSA 4O65A 4V2WA 3T0DA 1GFF2 3U14A 1UL9A 2YB7A 3P3NA 4IETA 3SKVA 1UZVA 2PHLA 2VM9A 4NPRA 1HB1A 4TSVA 3B5LB 3AC0A 4G3YC 1O4TA 3P6BA 4MXVA 2RG4A 2RS33 3DKWA 1PGL2 2I07B 4LO4B 4AOCA 5FZ1A 3KVBA 1BKZA 1RIRA 3F95A 4XJ8A 4FSJA 1OBNA 2AACA 3UL2A 3WD5A 3NNLA 4BM8A 3WOGA 1WMFA 3MZHA 3RZJA 4XURA 2YUEA 3BIWE 3DXUA 4ZU7A 1VPHA 2Q1MA 2IFWA 4HVOA 3I59A 4M0HA 4CCKA 5F37A 4X8NA 3O0XA 2VOVA 2W87A 1N1SA 4E4ZA 1ZBA1 3UV9A 1GZCA 2UU8A 3U4SA 4FPJA 1EV13 1J84A 1VB4A 1PZ7A 4Y1XA 3AZVA 3ES1A 4LQRA 1IZ3A 1FPN1 3DYMA 4JGYA 5FY8A 3H3ZA 1B09A 4CP1A 4KGQA 3NAPC 4H2AA 1OF3A 1WA6X 3CHXA 2O0OA 1XC6A 4NRMA 2HWE2 5FLIA 3THPA 3WDWA 3WP6A 4BE3A 3VD3A 1HQLA 2PHFA 4D3WA 5I0DA 3RS6A 4LULA 1UZYA 1R082 4XFFA 5KWRA 2A6XA 2FZ1A 2CL2A 4QHZA 5GZFA 5A6XA 4JV4A 1E5SA 5JXJA 2DVDA 3O12A 1DLLA 5ABJC 2IXLA 1RL3A 4OI2A 4M4PA 4W65A 5FY0A 5A3MA 4MV2A 4XTPA 2RHPA 3W20A 3RWNA 4D6SA 4LHLA 3UESA 1APNA 1JS9A 1TE1B 3VKOA 2UY8A 1LOGA 2VMEA 2VZPA 4LBMA 4QM9A 5FXVA 1OQ1A 1F8VA 2J1UA 4GWIA 5T54A 4AQ6A 1Y43B 4CCEA 4F3JA 1KJLA 5A70A 3CO2A 5J7MA 5JXHA 3L2YA 5FBZA 1UYZA 3Q8BA 2QQKA 5L7OC 4BQWA 5EJZB 2VTXA 4DFSA 2ZA9A 5K0UC 2HLEA 2PLV2 5ACA2 1Y9MA 3ASIA 3B94A 1W0PA 3KLSA 4RA0A 1XNBA 1WGPA 1WMEA 5JOXA 5LEJA 1GZWA 3H0OA 3ZFEA 1ULDA 1PVC1 3HJRA 2E7TA 3UNPA 3M4FA 1QGLA 2BFUS 3IAPA 1LEDA 2QCSB 3N9MA 3WNPA 3KV5A 1RYYA 2C1FA 3H3LA 4CCCA 3ACFA 2VOXA 1BMV1 4AWDA 1A8MA 1OLMA 1XNKA 2CSGA 3FN9A 3GF6A 1UU6A 3KB5A 3MPBA 1KQRA 2C24A 3FX3A 4G9SB 5FYTA 4FFHA 2VW1A 2VNOA 3QH7A 3X29B 4ZZ5A 1OSGA 1G6NA 2XJRA 3K75B 3PIGA 2CDPA 3FHIB 4IV3B 4CDUC 4EV0A 4Z2AA 2VNGA 5LRRA 5FXXA 5JLVA 2RR13 4LBLA 5FP8A 4QQOA 5C71A 5F2WA 3UETA 1J1TA 1DBNA 1XSQA 5H9RA 4ISRA 1V6IA 1XBFA 2ZAAA 3K4DA 5KXDA 3DCQA 2LTNA 4I3PA 4AK3A 1BZWA 5C8CB 2DVAA 1BK0A 5CNAA 3I49A 3PUQA 1AJOA 1F9KA 1CAXB 3CKHA 4QKNA 4CZSA 3H9AA 4PCRA 2IFRA 3VBHA 4GH4B 5CA6A 2W46A 2BNOA 1SPPA 1LULA 4P9GA 5C6CA 3WUCA 5FYIA 3MUZ1 3WW2A 4AI8A 1W9FA 3O1SA 3LKJA 1PHMA 3ILNA 4CDQA 4AG4A 2VGDA 5FDBA 1F4HA 3WF2A 5FYBA 3S0MA 5GLTA 1NOVA 3VB9A 4M3CB 4XBNA 3R6SA 1PGL1 1SMVA 3IIAA 5FWJA 1A3KA 4XJZA 1OPMA 1JHJA 4Y1YA 2WYFA 2DURA 2CU5A 1NA1B 4LBNA 1D4M2 3CJIC 4BQ1A 1VAMA 1H4HA 3T2TA 4XHBA 2J1SA 1YUDA 2ZHKA 3VD9A 4J1XA 1W8UA 1WCQA 2GMEA 3DPRC 5IAVA 1HW5A 1Q8PA 2XJTA 3E6BA 2WQ4A 4OFGA 3TN93 3GGLA 4JX0A 2NMNA 3S30A 4B1MA 2GMMA 5K7PA 4BDVB 2P5BA 5FWEA 3VD7A 4HKWA 4Y26A 4FQZA 1OOPA 3O14A 3JB4C 2HWE1 3K48A 3HIFA 4B29A 4LUKA 4Q0QA 2DVBA 3CJXA 1C8M2 2ZAHA 1QY4A 1GANA 4XYXA 5A33B 3KSCA 4XHXA 1YCIA 4LPLA 5EP9A 1R081 4KL1A 1JZ6A 3GBWA 5FQ0B 4XAAA 4CTEA 5H9QA 3D8CA 3R4DB 5ANNA 5EYXA 3VDDC 1WD3A 4R9BA 1J1LA 4QXBA 4YVSB 2YBKA 4OHWA 4D69A 2XKPA 1O5LA 1RUG3 5I0TA 5CG9A 3H8OA 3WT3A 4YZ3A 1AR82 4B7KA 1UKGA 3G6JB 4HKOA 1REEA 4QWNA 4M0NA 4LO8A 3U75A 3UGHA 1ASJ3 2VVEA 3M3OA 4IEQA 4LBQD 5F6LB 2R16A 2ZEXA 1JBCA 2PLV1 4NHYA 4CCNA 4CYDA 2D6MA 4JAAA 4UWDA 4Y5TA 5CVRA 2RM23 3VBUC 1JYVA 1WA4A 2JDNA 2X10A 2Z69A 3TAYA 4XJWA 4EN9B 1W9YA 5FPXA 4Q4Y3 4DO0A 1S0BA 4CUGA 5L73A 5E6HA 1TMF3 1K12A 3R05A 5I93A 1REFA 1IS5A 1IPSA 3I3BA 3HBZA 4FPLA 2E53A 4BQ3A 5JPMB 4B4RA 4DEVA 1FNYA 3KQRA 5FBJA 3C7GA 1S0FA 5H9PA 5LW9A 1WW7A 2EAAA 3CMGA 3FHAA 3BTXA 3O0VA 2FMYA 5FRAA 1QEXA 1AXKA 1VB2A 1DQ1A 1ZNPA 3EHKA 3I4IA 4H7LA 2EICA 5A1LA 4N43B 3AMNA 4LMFA 3ZFFB 2RE9A 2Y6JA 3ME2A 4I3GA 4P9XA 3WG2A 1EY2A 4S2GA 2ENRA 1X7NA 3NV3A 3ACIA 4PQQA 4WZFA 1CZTA 3MUY1 2VR4A 1DYPA 3O1TA 3W58A 1V0AA 1AL23 2MHFA 1A34A 2FDGA 2CY6A 2WWJA 2G9GA 5FMBA 4NE9A 2P3IA 4W6WA 2GC0A 1EV12 3OD4A 4DUVA 2A75A 3JXSA 5C3QA 3PU8A 5A6QA 2DYCA 2E63A 4GWNA 2VH9A 4G4FA 4QHOA 3RMXA 3KVAA 3TEYA 3ZN4A 1EAH3 3KCXA 5FMOS 5ANQA 3T1LA 1W2OA 2Q30A 1RXGA 2D3PA 4CXWA 1AX0A 1CIWA 2UYAA 3VBSC 2Q0AA 1PGSA 4HN0A 3M3CA 2MEV3 3OUJA 1PM4A 2P6CA 2BVVA 1LTEA 1W6PA 3GBFA 2QNKA 2YU1A 5KHGA 1N1TA 1GP5A 2VU9A 1L7QA 4Q4V3 5I8SA 1D4M1 1ULEA 1T6BX 3VBOA 1O3QA 2YGLA 1G7YA 2WBKA 1AHSA 1RINA 2DV9A 3Q8AA 3BALA 4U2AA 1GWKA 2RDSA 1YIPA 3N9LA 4QQPA 1VMFA 4Y22A 1PM7A 5E89A 3WX5A 2JG9B 2QUOA 4BZ4A 4GMP1 4QXCA 1JZ7A 1BXHA 1J83A 2GMPA 2Q8EA 2RDQA 1W6MB 3AP5A 4AHXA 4L99A 2X5IA 4FTBA 3FLRA 1YFXA 1YEWA 4A44A 1X8EA 3AKRA 4CRQA 3NNJA 1C8M1 1OPOA 4IW3A 4E27A 1H1AA 2DFCA 2E9QA 2KM2A 4IDZA 3AKSA 4EN6B 4WVWA 2BV4A 1CWPA 4DXRA 1KS4A 1X8MA 3TWIA 4CU9A 1K5MB 1YC61 2VZTA 5L19A 2ILMA 5L36A 4DS0A 1LOFC 3PMEA 1BK1A 4AHYA 4TTGA 2NPIA 1BCXA 5F5CA 2JICA 4XF3A 4XIOA 2AH2A 2CWMA 1AR81 4YYOA 4YVWC 3LPGA 1ALYA 1QKQA 3LPFA 2RR12 2VMHA 4BHPA 3BIEA 5F32A 3WDXA 4IEPA 2WL1A 1K45A 2D6NA 3QH6A 2RDNA 4DUWA 1MZEA 2YV8A 2XLGA 3GBGA 3OGSA 4XF1A 4IV1B 3VBRC 1PK6A 4JKLA 4UFHA 5FZCA 1GLHA 1G9AA 1DFQA 3EBRA 3SC7X 2DU0A 2JG8B 2A7AA 5JPNB 1B35B 4PI0A 2AC1A 4JC1A 4RFRB 5F8PA 3AP4A 4A7ZA 1UN1A 3RZHA 1GNYA 3MDPA 1MS0A 4BMBA 4NOTA 3KHBA 2D6KA 2WJSA 2J1EA 2GP5A 2C9KA 5EFUA 1PIV3 2OQ7A 4XJAA 4QPWA 5LA9A 5IATA 2VTFA 1YJLA 3ZYRA 1R1A3 1ZREA 4ZHNA 4FPGA 4LXLA 5CFCC 3SEEA 5IVBA 1PMHX 1RUI3 1XE7A 2VCBA 5EV7A 2C0ZA 2JB8A 3I59B 2IVIB 3VDCA 2ARXA 3QOPA 3C7FA 4QPGA 4Y5SA 3TN92 1EV11 4EWAA 4PQ9A 2W5FA 1RB8G 1Y7BA 2ZACA 3EMRA 5DABA 4JGYB 4L9BA 4J1WA 2VUCA 3KZ4C 1LESA 4HSJA 5JIAA 3H1MA 1H8TC 1HB2A 1LGBA 3OEBA 1OF4A 1W8NA 1LU1A 3ZIXA 4I2OA 4Q8KA 4AEDA 1G9FA 2ZGRA 4GZ9A 3ZOIA 4YM2A 2Y6FA 2QDNA 5CKMA 4FAHA 3NJVA 4MGYE 4UI9L 5HBAA 2OA2A 5A3UA 1PVXA 4OUEA 4UFJA 4W50A 4RR3C 1MZ6A 1RTVA 2DBIA 5FZ8A 3TOJA 5J1XA 1HJFA 3RPQA 5EIYB 5EWSA 2YGMA 5FYMA 3IBMA 1OD5A 5HV4A 5FYSA 5I0SA 4CP9A 4YW7A 5FYHA 1RUG2 1UW8A 1YQ2A 2D43A 3H1WA 3AKQA 3ZYJB 3SH5A 3ILRA 1Q43A 1BHGA 4P9JA 4QDRA 1C5HA 2C5DA 1ASJ2 1DGWX 4WM8C 1ZRFA 5SV8A 5E8AA 3A7QA 5GZDA 3UT0A 1ZVFA 1QOSA 4M00A 1D2QA 4QU2A 5FP4A 2VQ0A 3CLPA 2WNVC 3RFRA 5FPUA 2C9AA 2RM22 2WSVA 1DHKB 2QBXA 3B69A 1XU1A 5F3CA 4Q4Y2 1GZWB 5DAVA 3EXUA 3ZFEB 1K5JA 1TMF2 1VRBA 4MGZE 3U78A 2GNDA 4LT5A 2QFEA 2BBAA 2IXHA 1PMJX 2BQPA 3FUQA 1AX2A 1LGCA 1Q5OA 3G7DA 2FDKA 3T2PA 2WR9A 4IGPA 5GLUA 2MNGA 2D40A 3USUA 4Z07A 3KWVA 1CESA 3ZXLA 4AE2A 4D7YA 5CG8A 1JUHA 1RUJ3 2OYZA 3DECA 3VKLA 3PTRB 1DGWA 5F3EA 1ZBE3 5FZ7A 5A6YA 1GV9A 5JR2A 2RR11 2BP6A 3ABZA 1QXJA 5A3NA 4O9GA 4XFIA 1DZTA 3RI9A 1JW6A 1MS5A 4FPYA 1OVPA 5FYCA 5FLHA 1US3A 2VZOA 1AL22 4DUXA 1OC1A 4HK8A 4AVCA 5C3PA 3PUAA 3SH4A 2LS6A 1OXCA 1SQ4A 5JXIA 2NYYA 5AC92 1IG3A 1WUVA 4A7KA 3VBHB 4HFSA 1QJU3 2ET1A 3THDA 3ZYGA 4MLOA 3FC0A 1SPPB 4PLOA 1JYNA 2XLAA 2J22A 4XFCA 3WHUA 2B42B 1CIYA 1EAH2 4N9IA 1F31A 5FUIA 4D6QA 1HRI3 3D0JA 4GULA 3V0AA 4XDPA 5K9YA 4CDQB 2MEV2 3BU7A 4E9KA 4A2UA 3JQWA 3FBYA 5HPOA 2Z2SB 4QDQA 1OH4A 5FP3A 3WNNA 1YJKA 4XMIA 4Q4V2 1YQ6A 4NJ4A 2BYVE 5K0UA 3M3QA 2GC2A 1WW6A 4B3NA 1ND2C 4DOUA 1YHFA 4Q0VA 4YFZA 1CZSA 5F6KA 5ISLA 2Y6GA 1PO22 3ZXJA 1XB9A 4O7XA 4QD2A 3Q8CA 4NMIA 1LECA 4UYBA 3TN91 5D1IA 2WNEA 5DZFA 3T30A 1XE0A 2JDHA 2F17A 5BXXA 2HWC3 3VZMA 4COVA 2ES3A 2YZ4A 3LAGA 5J98B 4AFCA 4DPNA 4HXCA 1LOBA 2BVBA 2PAEA 3PJQA 1OOPB 1VRH2 1WLWA 2R1BA 4C0BA 4XZUG 4AHWA 5DAQA 2ZMKA 1D7PM 5F2SA 1G9CA 4MADA 4AFMA 3K3OA 1J58A 3T09A 3A0NA 4JHZA 2WFF3 3SHRA 3D3AA 4C1XA 2JXAA 3TNPB 3TRSB 5FPAA 2VNVA 3SNMA 2WLQA 4M4RA 4JGZA 4YGEA 1LOEA 2CWSA 1FOD2 3IIIA 5LCWL 1ZRDA 2VXRA 1RUG1 3LEGA 4RQPA 1OLQA 4QKBA 5FMDA 4IESA 1RUC3 5ACA3 2GDFA 4EN8B 1XNTA 4CEWC 2PMWB 5FZOA 4D94A 1ASJ1 4JZRA 5T5JA 2OT7A 5AFBA 3VHRA 1Q8QA 5JXGA 5FJKA 4E4DX 2ARCA 3ACLA 5A1AA 2ORXA 2A3YA 2RM21 1QXRA 2B9VA 4XF0A 4AR2A 1AR62 5AVAA 4ES8A 2ET7A 1LHWA 3LDBA 4QQHA 2WAOA 1K42A 4Q4Y1 4XMAA 4CDWB 1JU3A 4Q2FA 3ALQA 1TMF1 4EE2A 3GCXA 1OVSA 5EPAA 4BPZA 2E7QA 3Q9OA 4CCJA 1U5ZA 3JBG3 4KG0A 2ZX3A 3BGAA 4QPIA 5CKQA 1ZRIA 3QLQA 1GQPA 4PHZA 4SBVA 5LY2A 4YG3A 5BNOA 2XQXA 2ZEZA 5DUUA 3KQ4B 3POEA 4QKDA 1WBLA 2DBNA 4DB5A 4FPFA 1PIV2 3VD5A 3T2QA 1O8PA 4CU6A 3POWA 3I3DA 3USSA 1SLBA 1R1A2 3POBA 4JRAA 2P17A 4AVTA 5IK5A 1HQWA 2BUKA 1HB4A 3RG0A 3MV01 5FPBA 2PYTA 1O5UA 1DQ2A 1RUI2 5C9AA 4QX0A 3WCRA 5CISA 2QKDA 4LBOA 4UFIA 1AL21 4XUTA 5HXVA 4DXSA 5JI9A 4BMEA 1KRIA 2FDHA 5FZDA 2GNTA 4HVRA 4IL7A 1E5HA 4YFWA 1UY4A 1S1AA 2VZ3A 5AC91 2WN2A 4CVUA 3I97A 3M8LA 4IXLA 5CB7A 3NNMA 3Q8FA 3NKGA 1YI7A 5BUVA 1AVBA 4AF9A 1EAH1 1R092 4RN5A 4LHNA 3ZR5A 3LEIA 1P8JA 2PHWA 2XDVA 4L8QA 4DEQA 4IEWA 3WG1A 1L7RA 3PUSA 4UBHA 3B9CA 2MEV1 4I0AA 3OBAA 3A0KA 3K3NA 1S0DA 3WINE 1W6PB 2OQ6A 3PUHA 4Q4V1 2XBO3 1SFPA 4ZZ8A 3LF7A 3VBOB 3C7OA 3HN1A 1GKBA 2KD7A 3WNMA 1MQTA 1E5RA 2J42A 2QQVA 4GWMA 4IEOA 3IWZA 3ZFGA 4R4XA 3NRUA 4Y22B 5LBBA 4COUA 4OQ9A 1W8ZA 5C3RA 3O1VA 4HPKA 4FTSA 3GHMA 3IMNA 1WKYA 1GNHA 1AYM3 1W8TA 4BU2A 5JSPA 4LR4A 2ZMLA 4XJ9A 2X5IB 3ZXEA 2VZQA 3NWKA 4BLIA 5C8WA 1VRH1 3J7NA 4IGQA 3VHPA 2W1QA 1Y9GA 1ZA4A 3SCHA 4AQ2A 1XYOA 4ITCA 2P4EA 3I3EA 1VBB3 3BUCA 5DG1A 4IE4A 5FTTC 1W8OA 4XBQA 1U0AA 3D4KA 5CEHA 2ZPXA 4Y4RA 1U5XA 4IV3C 1YFWA 4JQTA 4MSVA 2ZHNA 3J9SA 4ISQA 2Q4SA 4R9CA 2VZVA 1FOD1 2R7EB 3ES4A 5CFDA 5BNPC 1ZRRA 1RUJ2 1H2NA 1QDCA 4XUPA 4HKLA 2YPDA 5C8CC 1JZ8A 1ZBE2 3AFGA 2WZR3 4LE3A 3V65A 2R073 4BQ4A 3IDCB 2DUOA 4GAZA 4GIQA 1GZTA 4GH4C 4JCKA 4BWOA 1AR61 3P5BA 1IOAA 3LA2A 2P34A 1UOJA 1PK6B 1LHOA 1S2KA 4NO4A 4BLJA 1JOJA 1ND3C 2JDUA 4DINB 2RVAA 4V1PA 2WZPP 4IERA 4K6BA 2D44A 1QJU2 2RMU3 1D2SA 3S5QA 2A5ZA 3LFIA 2IXKA 2VOTA 3O1RA 1V6KA 3K51A 2A6WA 3QBQA 1DYOA 2ZXQA 3N9NA 1A78A 5LBFA 4Q26A 5I91A 1HRI2 1RUH2 2EXKA 1ZZ7A 3LFMA 1NQJA 4XUOA 3SKJE 1NA1C 4CXYA 2GSYA 5A7PA 1PIV1 2CAUA 1X50A 4ASLA 4AAXA 5C3OA 1R1A1 4BISA 4AQSA 2FBEA 2PQSA 2XVKA 4P08A 2JDAA 2V72A 1RUI1 1WW5A 2ZX2A 1QOTA 5I0UA 2NLRA 1JYIA 2YFUA 4GALA 3THCA 2Z4FA 1KD7A 2HBTA 3LEKA 4FAGA 3ZN5A 4QPGB 2N7GA 2HWC2 5EXOA 2VVDA 5HV0A 1KDKA 3WNKA 2H6BA 1R091 2PTMA 4LK7A 3WHTA 1BVP1 2FCTA 3VZOA 3ZMNA 2I74A 4Y1ZA 2BW8A 5BPXA 2CAVA 1N3OA 4YVSC 4LUMA 5D8AA 4AEDB 3OYWA 2WFF2 3C7HA 1W0NA 2BPA2 4D7TA 1RMU3 4Q1PA 2V73A 4Q29A 4URAA 3OY8A 1LODA 2XHKA 2W0XA 5T50A 4CCDA 1CR7A 4QT6A 2YYOA 1GZ9A 3NV4A 1FAYA 1ULOA 5FZHA 2EAKA 2JDPA 3VV1A 4EYUA 3AXDA 5A3LA 2WS93 4ZONA 4QMAA 4CP9B 3E5UA 1RUC2 4FO9A 3RYRA 4BJ0A 1DU3D 5FV3A 4PBPA 5DZEA 4ONUA 2OKXA 2WYSA 3NW4A 4IEUA 5IVYA 4QX7A 4CDXA 2ZGSA 3VKFC 1W2AX 1LOAA 5F5AA 1Q8SA 5FY9A 5G04L 1AX1A 3SEPA 2VZRA 3VZNA 2WT1A 3IKWA 3OD0A 2O8OA 4FTEA 3WY6A 3HOBA 1OHFA 1W05A 3JBG2 5IFTA 2SBAA 4AGRA 1JTZX 2VECA 3E97A 3HT2A 5JI7A 2OZJA 1MACA 4LBJA 4N43C 4QXKA 2IWGB 1HJGA 3V56A 3ZFFC 1ZRCA 3KV4A 3MLLA 3W5NA 2GZWA 2VUJA 3USUB 1RUJ1 4TXWA 1SDWA 2ZOEB 4N53A 3GZAA 4XAEA 2NM1A 4RHV3 4AXOA 4AYUA 3FFQA 1ZBE1 4IEXA 4ATFA 2BZDA 3WDVA 1LOFA 1AR93 1X82A 4XTMA 2NQYA 4LIUA 1SZBA 3H7YA 3JZVA 1ENQA 5F3GA 2ORZA 4QKFA 3IDAA 5JMOA 1M4WA 2D3RA 4PJYA 1JMUB 4N7UA 4YW4A 1VLNA 3INAA 4UXAA 5FP9A 5C4WC 3IN9A 1F15A 3ZKYA 1QJU1 1YQ5A 1OMIA 2CGNA 3ACHA 4LNVA 4P00B 5A80A 1DGRA 3KV9A 3N7MA 4EWEA 4F8AA 3VBRA 2WO2A 2VCAA 1VBC2 2HH9A 2V5YA 1HRI1 1RUH1 3IMMA 4JKKA 4QX5A 4AZZA 3I2GA 3V0AB 2GN7A 1O3TA 1MEC3 1N3QA 1YNAA 3N9PA 4MYEA 4J6GA 1WMXA 4MX3A 5FCCA 4CUAA 2YC0A 1NZIA 3GYDA 2HBUA 3MIGA 3BCWA 3UGFA 2YG0A 2XBO2 2JG9C 2RJ2A 5E16A 2A73B 4D7SA 5K0UB 4B7EA 2ADEA 1Z78A 3OGVA 4HMZA 4YGDA 5IVJA 2CV6A 1VAVA 4KBBA 3BU0A 1YXWA 2DCZA 1JYCA 2PA7A 5T5OA 5FZGA 1C1FA 5C7GA 2HWC1 4ZS3A 1AYM2 5JZGA 2JB4A 4ZU5A 2GC3A 4Y3OA 3LOIA 1K5MC 3B01A 2UY9A 1NCRA 1PO13 2ZZQA 4XQ4A 3WR0A 4AGVA 3A4UA 4O9EA 4XUQA 3I2HA 4FCAA 1RJ7A 1CD3G 1VBB2 2C4XA 2WFF1 4L97A 1RUF3 4FOYA 5DUVA 2WSUA 4XBLA 3IAQA 4XC9A 1OT5A 1YRZA 1OUSA 2D7FA 3ZLIA 2JEMA 3LEMA 1MVQA 5FZMA 3KHCA 2IXCA 4JGZB 5DUXA 1JOBA 5ACA1 3AP7A 1RUC1 4HANA 4H7MA 4RQPB 1OQDA 2VQTA 4CCMA 4Y1VA 5FZOB 1DF0A 4X6QB 4CDWA 1DDLA 2WZR2 3UKNA 2R072 4MUVA 3VBFA 4P5HA 1B35C 2X29A 2JE9A 4A7YA 1H8VA 1EUUA 1V6MA 1WZXA 2WRAA 2VAUA 1QJY3 1CPMA 4PF5A 1UY1A 1YQCA 2BERA 3S7EA 4Q4W3 5JWPA 2VMDA 3ZN6A 4M3CE 2GN3A 2B45X 4WVVA 3JBG1 2RMU2 4H3WA 4OI1A 1EYBA 2L9LA 4QPIB 1IPKA 3AMMA 4AEKA 1W03A 1TNFA 4AI0A 3MFCA 2PHRA 1BYHA 5BNOB 1POV0 3ZYFA 3NJZA 3NJXA 2BWCA 1UY0A 3EYPA 2E31A 1UOGA 4ZPIA 3HNMA 5K4LA 4CPBD 4E8CA 3OPZA 5AC93 4F83A 5LBCA 1ACCA 3OTFA 1LOCA 1HV0A 1QQP3 2DCTA 4JGYC 4EN7B 5C9AB 3B9IA 2WUHA 2W9XA 1QJZA 2LROA 1ZA7A 1HV1A 5FIXA 1TQ5A 2K2SA 2ZABA 1KDMA 1LCLA 4ATEA 3VZLA 5IK7A 2KA3A 1QXPA 2OUHA 2UWBA 2RS53 1XNAA 3M70A 2D98A 3D5OA 1S55A 2BTVC 3DV8A 3IB3A 4KQ7A 4K1ZA 3VHNA 2CHHA 3SLIA 5SV5A 3NL1A 5DN2A 5JIUA 1MR5A 3IDBB 1HRV3 2EALA 3VUOA 1PO23 1RMU2 2Y64A 2G4IA 2QQJA 4COYA 1AZDA 1SEFA 3ATGA 2XBO1 4Z92B 2OIIA 3MF6A 4PDWA 4Y33A 3AYDA 3H8XA 5A1FA 4QX2A 1SCSA 3OG2A 5LA1A 1RITA 1UZWA 2VMFA 3C8XA 4PBOA 4JVAA 2WS92 1MQTB 2D97A 2ZBJA 1R1ZA 4ES9A 1JYXA 2E7AA 4MG2A 1NUKA 1VRH3 4NVPA 3ZFGB 1HB3A 5HCFA 3T2OA 4AFDA 4YZ1A 1AYM1 1NT0A 4HPKB 3ZFEC 2QE3A 4QQLA 1X9TA 3H7JA 4Q4X3 3K2OA 1STMA 1Q8OA 3HR9A 3N7KA 4YWAA 1UMHA 1SCRA 4CEYC 3OBTA 5T52A 2AEYA 1WCSA 1VBB1 2JENA 4JDMA 2ZGPA 1WMDA 2W2IA 2VC9A 3E5XA 4R4ZA 5DXDA 5DMYA 1FOD3 2ARAA 4Q0PA 4RGGA 1UXXX 5IYYA 1AYN3 2VBPA 3A23A 3HQRA 5JR7B 1JYTA 3KGZA 1X9PA 1UQXA 5B2GB 1Q3EA 2CTVA 4WM7A 5CFDB 1H0BA 3CNAA 3K4AA 4TZDA 4RHV2 5J48A 4OHZA 3RZMA 2UWAA 4KH9A 1NZCA 1AR63 2QQPA 2WZR1 1AR92 1DQ4A 2HEVF 2R071 4QPYA 5IVEA 4LOTA 3W5MA 2W92A 2VMIA 2EF6A 3M3IA 1ZZBA 3AMQA 3MYXA 2ZGLA 3VBHC 3P3PA 2VNRA 3DYOA 1F5FA 1HN1A 3E5QA 1U5YA 5F5IA 4PT6A 5KXCA 2XB6C 2PQQA 5FOJB 2MPFA 2Q1ZB 3VGIA 3M7AA 3S6PA 4CDQC 2RMU1 3KCYA 1MPXA 3U07A 4AI3A 4C0HA 1O3RA 1GBGA 2BEOA 4OVEA 2VW2A 2JD9A 4NIGA 1XE8A 1CN1A 5JSOA 2LM3A 2QJVA 4INDA 3HN3A 2XH6A 4RS5A 2WKKA 4NPMA 4RSUA 2JIJA 4XQWA 1MEC2 5C33A 2DTWA 4NIIA 3R0RA 4XFGA 2WNUA 2QQWA 4B8EA 4HETA 2ETEA 4MGSA 5GZGA 1GSLA 5FYZA 3NO8A 3BB6A 3POJA 4LA3A 5C3SA 4YM0A 2TEPA 3N35A 3ENRA 3ORJA 2VXJA 2QQIA 3RGBA 1COV3 1DQ6A 1Z0HA 4I09A 4IE0A 5FPZA 1OOPC 1R093 1W2UA 3WQ0A 4K8FA 4FXGB 2ARBA 1NE4A 3DKQA 2FCUA 2CYFA 2WZ8A 1G86A 1UXZA 2DFBA 1DZRA 3PL0A 5BYNA 3GCWA 4MH0E 1PO12 1QDOA 4FPKA 2E32A 1H9PA 1W3VA 5E1RA 2G9ZA 5A7SA 1RUD3 3LDRA 1KXGA 2EIGA 3V64A 1PGW2 3CIHA 5D8AB 5ABJA 3OYWB 1OFNA 1RUF2 2BGOA 5CYYA 4P9IA 1RMU1 1DYKA 1YFUA 2AR6A 1JI6A 2BFUL 4P9YA 5A7OA 4LOSA 1NCQA 1WWYA 3OY8B 5IK8A 3GM8A 4I0BA 1LHUA 5DDJ2 1OD3A 3BN6A 5GKAC 3HT1A 1SHWB 4XACA 1ZZ9A 1NLQA 1SLLA 2ZCWA 4PF1A 2WS91 1WLCA 3MF9A 4N7IA 3ZXKA 3O0WA 3ZPOA 1DGRN 3AZWA 1NE6A 2VE1A 1MZ5A 4MGTA 2AGSA 2ZGTA 3IPVA 2ZEWA 2Z79A 4A3ZA 3TEZA 3OEAA 4CDXB 4COZA 2Y26A 1KS5A 1S2EA 2R6QA 1QJY2 2LALA 2VPVA 1BBT2 5GLZA 2XXZA 4IE5A 4DY5A 2IZWA 4LKEA 5CIRA 1W2TA 4Q4W2 3K46A 1UF2C 5CU1A 4XVHA 2HWD3 2W94A 4RGAA 3T0AA 3QACA 1FMD2 4FPEA 4XFBA 3WG3A 3S7IA 3N4MA 3CZJA 2RJKA 3ZYPA 4ARYA 1W6QB 4WBBA 1KGYA 2E6VA 3NNGA 3RJ2X 2C6SA 1ONAA 1H2KA 4RYDA 4XILA 3MW3A 4FI9A 2W47A 4Y4YA 3E6CC 1W9TA 3B00A 4YG6A 5CZKA 1GP6A 5BV6A 2VBBA 4RHV1 2D6OX 4N53B 4KBZA 3TNQA 4BCUA 5I0RA 1ZZCA 2XMLA 4FFGA 1KITA 2YFZA 1AR91 4Q8LA 3DXTA 3ZSLA 2HJIA 1V9U3 1JN2P 4P14A 4KU8A 4HK9A 2W1WA 3AL5A 5FJHA 1QQP2 1QJX3 2LW8A 1GYKA 4W4ZA 2G19A 1WBFA 3EJKA 2GH8A 3K77A 4L11A 1I3HA 2R063 1RUH3 2JD4A 3WV6A 4ASKA 2LRPA 1H30A 3PIJA 5I8YA 2Y6LA 4HBNA 5FAXA 1O6UA 2RS52 3WF1A 2KR2A 5A6ZA 2ZTNA 2O14A 1OQEA 2ZKNA 4IE7A 3VBRB 4BB3A 4X6RB 1Q8VA 2AREA 4NRQA 1GOFA 1MEC1 1UY3A 2WNOA 4Q0SA 3BOPA 1TME3 3VBOC 1MVEA 3UJQA 5F39A 1HRV2 4ZY9A 4NPLA 1YLLA 2HYKA 2V4VA 4TLGA 5KC6A 4DRRA 4CCLA 2EXHA 4CP2A 3SCGA 5LEKA 1JODA 3KV6A 3WQ7A 3OGJA 3MPPG 3FUOA 3WSOA 3O1PA 3UKVA 4YPJA 3O5SA 4E2SA 4KG8A 1SBFA 2X5IC 1FYUA 3LA3A 3N7JA 1JZ5A 3HBKA 3MIFA 2P1BA 2E26A 1OUXA 1VP6A 2XLFA 2YROA 3BPZA 4H55A 4YW5A 2H0VA 2IXIA 3THTA 5JZGB 4Q4X2 5FZ9A 2YHJA 3GZUC 1PO11 1J59A 4R8HA 1OLME 5FZ3A 4QU1A 1NCRB 4ZS2A 3NAPA 3PDQA 1GWLA 1DQ0A 5JDBA 5DAWA 2J1AA 1PNGA 1UOBA 1PGW1 1JH5A 2W95A 5IFPA 1RUF1 3A22A 3WVJA 4OI0A 3OSDA 5A3PA 1F2NA 2A6VA 1A8DA 2H6CA 5BNNC 1AYN2 2X8KA 2XWJB 1UPIA 1JOPA 3FE5A 1O4ZA 3POIA 4GKXA 1C57A 1OLRA 2HWB2 5D21A 5DDJ1 5IAXA 2EA7A 4JDNA 1XJAA 3AFKA 2YPJA 2XHNA 3ZXAC 4L0PA 4FOWA 4HONA 3B7MA 3H3UA 3I2DA 3ST7A 1E5IA 3U10A 2WABA 1CAVA 4K9SA 4QXHA 5LBEA 1GWMA 1PK6C 2VZSA 4EZHA 1C4RA 3FWEA 3RRDA 3LIGA 4NHXA 4OHYA 1REDA 1CGPA 2WC2A 2IXJA 4WVZA 1S0EA 5L7OA 3VBFB 5HCHA 1IS3A 4NIHA 1QJY1 3JCIA 1BBT1 2R0HA 3UGGA 1W0OA 5F3IA 4Q4W1 2VY0A 3RZKA 1HN0A 3OBRA 2BGCA 3M1HA 1FMD1 3ZN6B 5FZLA 4LBQA 1SDDB 3IDEA 4O61A 3AJZA 5KHIA 2BGPA 4C90A 2A6YA 1QJFA 2ATFA 2ZGUA 2A71A 4NHMA 1C1LA 5FMOL 3FBMA 2YXSA 5FO7B 3GALA 4EN0A 2QQMA 4ZU4A 1M06G 1RXFA 2PN5A 3W9AA 1AJKA 4YZ4A 2A70A 5FZFA 3BOWA 4CDUA 3JB8A 4JTNA 1DQ5A 3AVSA 5IUQA 4AW7A 4EWDA 1HDKA 2V5DA 2PHDA 1N3PA 2CGOA 1VAKA 1COV2 1QQP1 2VQAA 2Y6HA 3GJAA 2Y38A 3ZVXA 5DUWA 5HXMA 1RVF3 4PIYA 2VJXA 1DCSA 1OH3A 1VBC3 5GLWA 3WP4A 3GHNA 4AHZA 2VQUA 3LGRA 3KCCA 2VUDA 4AEDC 1VR3A 2RJLA 1UWWA 2RS51 5KR7A 4DY3A 1D0HA 1H9WA 3IZOA 4R9AA 3W59A 2WQZC 3ACGA 1W6NA 5IVVA 2HEYF 1RUD2 1TG7A 1XYPA 2BNNA 4AEMA 2Q1FA 4XCBA 5C4WA 1WCUA 1HRV1 4NUBA 4Y20A 4E4HA 4FBFA 3TEXA 1PO21 4UT5A 1S2BA 4FPCA 4E2GA 2PHUA 3PHMA 2WT2A 4LO5B 3SCFA 4PDWB 3FMGA 3FZ3A 3VL9A 5A32A 1NYWA 2DVFA 4CE8A 3VKNA 3CJIA 1V00A 3PVEA 3N36A 2DWRA 4S2FA 2BRTA 4OLLA 4D0QA 2XG3A 3T4VA 2G1MA 3DPRA 3KT1A 2FD8A 2QQUA 2Y34A 1FV3A 3ZXDA 1H1IA 2B7YA 3RNSA 3ZSJA 1I5ZA 4Q4X1 5CKNA 3WF4A 4OHVA 4R52A 3POYA 4FP2A 4JDOA 1UX6A 1F35A 1Z7S2 5FZ0A 1NY72 3RZZA 1UIKA 2FDIA 3EO6A 3AP9A 2HWD2 1KJRA 1W6OB 1IQAA 4OZOA 3SMHA 1D4VB 5JAXA 2UWCA 3VLBB 1IKQA 1BVVA 4D8MA 2JKXA 1T6GC 4GB33 4A41A 3TYJA 1X36A 1AYN1 3AB0A 1F5JA 4LO6B 2Z42A 3VDDA 1RGSA 2HWB1 2DF7A 2EXJA 4LLFA 4QHBA 3MO4A 4LHKA 1VBD3 3AZXA 3D0SA 3PLQA 5CADA 4Q27A 3H8RA 1X33A 2AZ5A 4WM7B 2NZ9A 4HT1T 1HXS3 1OA4A 3VZJA 1H2LA 4B1LA 4HLTA 4A4AA 4NHLA 1V6JA 2BNMA 4DXZA 1WCKA 1FATA 3P1IA 4K1YA 1V9U2 3KT4A 2A3XA 2NP0A 2UURA 5DAXA 3J7HA 5FUPA 4NAOA 3JU9A 1QJX2 1NQDA 4Z2WA 4C8DA 1VIWB 3VBUA 1G9BA 4Z82A 2HYXA 2R062 5KC5A 3EB7A 3H50A 4B4QA 5FO8B 1VBA3 1CJPA 4A42A 1ENRA 4OUSA 4AQTA 2X09A 4YARA 1Y9QA 4Q5OA 1KFUL 3RMYA 4BQXA 1JZ4A 5APAA 3WG4A 4RS5B 4YW2A 2Z5WA 2HEWF 2R49A 3HAGA 4IGOA 3WDYA 4C91A 1TME2 4YM1A 2EIBA 1W99A 4QX1A 4YW3A 4AAPA 2WQ8A 5DAPA 3RYPA 1F4AA 5LRSA 2WNUB 2DCYA 3NJYA 1WW4A 2E33A 2HWF3 3I2FA 1W8FA 3UYJA 3PVNA 1G8WA 4K21A 4CCOA 2XVGA 5IVFA 4WVMA 2XJPA 2PHXA 1COV1 3B93A 1XQNA 5AFEA 3OJBA 4YM3A 2GNBA 4FFIA 3ZIWA 5FYVA 4YGBA 4HOOA 3N9QA 1CAWA 4LO7A 1FXZA 4BH9A 1TEIA 1WLDA 1ULFA 1NKGA 4UW6A 5ERLA 4GMP0 2EIEA 2XL9A 2QQOA 2ZS6B 2Q8CA 2VVFA 2ZZJA 3BYWA 4FXKB 5GM0A 3WCSA 3ZSKA 4BA6A 2OZ6A 2W08A 4YG0A 1XOYA 4AI9A 4XFAA 1ST8A 1JYWA 4Y24A 2XJSA 3EQEA 3PU3A 1RUD1 4HZFA 5KHJA 1ZM1A 4I02A 1ENXA 4XJUA 4CP0A 3VBSA 4JGZC 4X8PA 5A7QA 3NNFA 2ADDA 4Q0UA 4IE6A 1PZ9A 4I01A 1CZVA 5FP7A 4QX3A 4RQPC 5C5UA 4NWWA 4IEZA 5B4NA 5IT6A 5I8TA 3MIDA 2B46X 2BWAA 2VMCA 1NCQB 2ZGMA 2ZX1A 3MHZA 3ZR6A 2OS2A 3AP6A 4LE4A 3WUDA 2YC2A 1VE0A 4LEJA 1NAEA 2W91A 4XEZA 4JHTA 3I2OA 2I2SA 1OKQA 3TEWA 1LHNA 1SLAA 2ZX0A 1OI6A 3U11A 2J1TA 1CJDA 1US2A 2YC4A 4NRPA 4XE9A 3IPVB 3MICA 5J96B 2Y6KA 3RSJA 5JOZA 1GU3A 4BIFA 3H42B 1SG3A 5F1RA 2NMOA 3OB8A 3R4SA 3VKMA 1W6QA 4PLNA 1Z7S1 3FLPA 3F2ZA 2DDUA 3WP5A 3OF1A 4QPIC 1OA2A 4FOQA 2A6ZA 1S0IA 1NY71 2J1VA 4BIOA 5JUVA 3BODA 5GZEA 4URTA 3LDKA 2HWD1 1ODMA 5BNOC 2WO7A 3ZO0B 4DIQA 5J3UA 5A3WA 2Y8KA 3AM2A 1MZFA 3QCWA 1LB2A 2WT0A 1YI9A 3HPNA 1N1VA 4QB6A 5L9RA 4CEYA 3RVHA 4QB1A 5C70A 2BBVA 5T55A 2ZGKA 3A21A 4LITA 4MZUA 3KMHA 3AYAA 2RV9A 2VL4A 5FZ6A 4AVVA 1ZYBA 3ZYBA 1MS3A 5C9AC 5FOBB 5LASA 1J3RA 3NQHA 1T2XA 1BEV3 4P5YA 4YVWA 1DIWA 1V9U1 3T4HB 5FZEA 4GA9A 5A3OA 1QJX1 3ZXGA 1HQNA 4BYYA 4FFFA 5BNPB 1RVF2 3I2IA 2JDZA 3LCPA 2RS12 4XCAA 5FY5A 1RJ8A 2R061 4NIAA 3K4ZA 2QQNA 3PNAA 2R32A 2VUAA 4CA9A 1QNWA 5IK4A 1POV3 1JXNA 3BKZA
chains in the Genus database with same CATH topology
1WZXA 3ORJA 4CPBD 2VXJA 1W8UA 4LKFA 5D21A 4AL9A 4BQ4A 4LK6A 3UT0A 2LRPA 4LJHA 4A6SA 3ZYBA 2C24A 1W90A 2LROA 1UOJA 1W9FA 1W8WA 2KR2A 2O14A 1GWMA 3ZYHA 2Q1FA 4LKDA 1WCUA 4YW6A 4CP9B 4BQ2A 4CPBA 1GWKA 3ZYFA 1GWLA 2JWPA 2K46A 3F95A 1V0AA 2WYFA 4YWAA 1W8ZA 1OKOA 4LK7A 4BQ5A 4CP9A 4LKEA 4YW7A 1W8TA 1HN0A 4BQ3A 1OH3A 1L7LA 1WMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WZX A;  3ORJ A;  4CPB D;  2VXJ A;  1W8U A;  4LKF A;  5D21 A;  4AL9 A;  4BQ4 A;  4LK6 A;  3UT0 A;  2LRP A;  4LJH A;  4A6S A;  3ZYB A;  2C24 A;  1W90 A;  2LRO A;  1UOJ A;  1W9F A;  1W8W A;  2KR2 A;  2O14 A;  1GWM A;  3ZYH A;  2Q1F A;  4LKD A;  1WCU A;  4YW6 A;  4CP9 B;  4BQ2 A;  4CPB A;  1GWK A;  3ZYF A;  1GWL A;  2JWP A;  2K46 A;  3F95 A;  1V0A A;  2WYF A;  4YWA A;  1W8Z A;  1OKO A;  4LK7 A;  4BQ5 A;  4CP9 A;  4LKE A;  4YW7 A;  1W8T A;  1HN0 A;  4BQ3 A;  1OH3 A;  1L7L A;  1WMX A; 
#chains in the Genus database with same CATH topology
 5FYU A;  4CUC A;  4YZ5 A;  1POQ A;  4BXS V;  2D3S A;  3VN4 A;  3J8F 3;  1GR3 A;  4GXL A;  3U4X A;  1AXZ A;  5BY5 A;  2ZGO A;  4GWJ A;  1TME 1;  4CU8 A;  2XUM A;  4OZX A;  2WLP A;  4V2V A;  5G05 L;  4HVQ A;  5HCA A;  1ND3 B;  2R1D A;  5F5Q A;  2EID A;  4P02 B;  4CSW A;  1MQT C;  2XQR A;  1UZZ A;  2V4A A;  2A1X A;  1H4G A;  3OGG A;  4CU7 A;  3FHQ A;  3ZFG C;  1PZ8 A;  5FXW A;  4A3X A;  3ZPY A;  5FUN A;  1SFN A;  1ZZ6 A;  2VMG A;  5FZ4 A;  5CFC A;  1UIJ A;  4AI1 A;  1UD1 A;  3GZT B;  5FZI A;  3ZSE A;  5AVP A;  1W9S A;  3JD7 3;  3RYK A;  2GC1 A;  2Q8D A;  4BK4 A;  1GOG A;  1W06 A;  1LRH A;  4W6Y A;  2QVS B;  1VBE 3;  4LK6 A;  2OW4 A;  2AYH A;  1TVG A;  3SIT A;  2WWS A;  4A6S A;  1W3X A;  1UCX A;  3H8U A;  4XDQ A;  3TB0 A;  2XJV A;  3RZG A;  2VG9 A;  4RL7 A;  1I1E A;  2EXI A;  1H8T A;  3NAP B;  3U37 A;  5FRE A;  5DDJ 3;  3MLJ A;  4AFB A;  4Y1U A;  2YY1 A;  4JTO A;  2WII B;  5CFD C;  2R04 3;  2QZ2 A;  4GB3 2;  5J37 A;  2JWP A;  3KGL A;  4LTA A;  4IV1 C;  1VAL A;  3LIH A;  1NXM A;  1IPJ A;  2XON A;  5ABJ B;  3JUU A;  4RR3 A;  3GZE A;  1VBD 2;  2XVL A;  3AMH A;  1NG0 A;  1JUI A;  1SLC A;  2E51 A;  1TZO A;  2JG8 C;  2JX9 A;  1UYY A;  3AMP A;  3HNB M;  3GJB A;  3NKT A;  5KHH A;  4IUG A;  1HXS 2;  1LHV A;  3AZY A;  2B5H A;  4SLI A;  3ZM8 A;  4XPV A;  1WD4 A;  2IUW A;  5HI0 A;  1CAV B;  1BBT 3;  3ETP A;  1AR7 3;  3FLT A;  3PUR A;  4WM8 A;  4I0W B;  1S0J A;  1V6N A;  2W3J A;  4OHX A;  1CQ9 A;  1FMD 3;  1R64 A;  5L7O B;  4ZXE A;  1NXD 1;  4RD7 A;  3ZYH A;  1VJ2 A;  2WNV A;  4I30 A;  4M01 A;  5JSR A;  3TBD A;  4YW6 A;  3ZX7 A;  1OUR A;  3VD4 A;  4BQ2 A;  3C7E A;  4WZC A;  3AVR A;  1VBA 2;  2ZGQ A;  3KF3 A;  3WNO A;  1CX4 A;  2LUW A;  3HVD A;  4LBQ B;  3NV1 A;  5LA2 A;  1O91 A;  1SFY A;  1QU0 A;  4UF0 A;  2PFW A;  4LOR A;  4XUN A;  3OPT A;  3S5A A;  3SXW A;  1RHI 3;  4MET A;  4AL9 A;  1UX7 A;  1SBD A;  2R30 A;  4PIZ A;  3O1O A;  2WO1 A;  1LGN A;  2RS3 2;  1H6Y A;  4LBK A;  1GIC A;  2BOI A;  4BQY A;  2HWF 2;  2VZ1 A;  2XR4 A;  4CDU B;  1A6C A;  2DVG A;  4EZ4 A;  3SQO A;  1AL0 G;  1HIX A;  1L3J A;  3AYE A;  4MGQ A;  2W68 A;  3D6E A;  4LKD A;  2K9Z A;  1RVF 1;  3CZU A;  5J09 A;  2RS1 1;  1VBC 1;  2IVJ A;  4AI2 A;  4F7Z A;  4EJR A;  4K8R B;  2PXJ A;  4MXW B;  3V0B A;  3SIS A;  5D2A A;  2VBD A;  3I3M A;  3UJO A;  4COW A;  5D8A C;  5LK7 B;  2W1S A;  2VUL A;  1W28 A;  4TYS A;  2FZ2 A;  1UYX A;  2P2K A;  5L9V A;  1DG6 A;  3CBN A;  3MW4 A;  3GNE A;  3BTZ A;  2FMD A;  1W6N B;  2Y0I A;  2IC1 A;  1MS8 A;  3RI8 A;  1UNB A;  3WLU A;  3O1M A;  4GQ7 A;  1W90 A;  1XPW A;  2WN3 A;  3CU7 A;  4FP3 A;  5C4W B;  4HSL A;  4Y20 B;  2PAK A;  4LLO A;  4UFL A;  3I8T A;  3WNL A;  5HCB A;  1QH6 A;  2WA3 A;  1W8H A;  2H0B A;  3LA7 A;  4MGI E;  3MLK A;  2ID4 A;  5A32 B;  5KHK A;  4S2H A;  2P3Y A;  4OMD A;  1GQG A;  1ND2 A;  3ELN A;  4CDX C;  4K40 A;  1ENS A;  3CJI B;  1YFY A;  1CAU B;  2FHR A;  3VZK A;  3WDU A;  2CDO A;  3OCP A;  1H2M A;  4YZ2 A;  4ZKT B;  2R0F A;  3DPR B;  2WZE A;  1IHM A;  1ULC A;  1W6O A;  1U12 A;  1PX3 A;  1LEM A;  4KWJ A;  3SH3 A;  3OPW A;  4Z1V A;  3DYP A;  3RJR A;  2DCK A;  2PEL A;  4OMC A;  5IW0 A;  4S2D A;  2B9U A;  2HWB 3;  1RUO A;  2I45 A;  3O1U A;  2JDK A;  1WLT A;  1U5I A;  3MIH A;  1CON A;  4OUM A;  2XUE A;  4Q1R A;  4GB3 1;  1AUY A;  4N53 C;  3POG A;  4W6X A;  2OUJ A;  1RUE 3;  5A7W A;  1FI2 A;  3MFA A;  3QD6 A;  4GKY A;  4TLF A;  1JZ3 A;  1J3Q A;  3VDD B;  1D0G A;  1QJE A;  5K8S A;  2ZEY A;  2TUN A;  1VBD 1;  1YWK A;  2B39 A;  2QQL A;  1EUT A;  3ITQ A;  4UFM A;  3W21 A;  3HQU A;  3ZDS A;  3AKP A;  3ZMO A;  2QDR A;  1HXS 1;  5LWB A;  5C5T A;  1DP0 A;  3T3Y A;  4CEW A;  1BEV 2;  5BNN A;  2JKB A;  2PAM A;  1PNF A;  3LQC A;  5JCT A;  4N9H A;  1V70 A;  5GLV A;  4ORF A;  3HMY A;  2AEN A;  2PHT A;  2ZX4 A;  1I9R A;  3AKT A;  3U1X A;  3IM0 A;  1O8S A;  4NWV A;  4AEJ A;  3VBU B;  2D5F A;  4YW1 A;  1S4C A;  1VBA 1;  4TN7 A;  5T5P A;  1ZX5 A;  1FT9 A;  4AVA A;  1UKR A;  4R9D A;  3BTY A;  2AEZ A;  1GQH A;  1RUN A;  3OGR A;  3J8F 2;  1PMI A;  1QIQ A;  3I7D A;  3WEZ A;  5EQU A;  3DN7 A;  2B4K A;  4GD4 A;  5GAL A;  1XU2 A;  3LZZ A;  3NST A;  4MHR A;  2RS3 1;  1K3I A;  4LA2 A;  1JZ2 A;  2VW0 A;  1LAJ A;  2HWF 1;  1AF9 A;  3WF0 A;  1C5I A;  2Y0O A;  4YGC A;  2WFP A;  4D6R A;  4N8M A;  4WVM B;  1JHN A;  3M3E A;  2XWB B;  3AYC A;  1ZBA 3;  5JZG C;  5H9S A;  3JD7 2;  4ASM B;  2FDJ A;  3WXP A;  3MEP A;  3RDI A;  1ULP A;  1FPN 3;  1CAW B;  5LAT A;  2AUY A;  1NCR C;  2YBS A;  2ZHL A;  3N9O A;  4KNC A;  5KBF A;  5M0T A;  3LD8 A;  3ROU A;  4MHU A;  3WW3 A;  3KS7 A;  5A3T A;  4JKM A;  5FK7 A;  1VBE 2;  1W39 A;  3N3H A;  3RZL A;  3WQ1 A;  5FZA A;  2FQP A;  3AK0 A;  3C3V A;  4K20 A;  1C3H A;  2D6P A;  2G9F A;  3ILF A;  3N7L A;  2O8Q A;  2XJQ A;  4AFA A;  5JMC A;  2P37 A;  2FDF A;  1XYN A;  1NLR A;  1S0C A;  2JDM A;  4UFK A;  2OVU A;  3MW2 A;  3B3Q E;  3VBS B;  2Q5T A;  4RGK A;  4KU7 A;  5CAZ A;  2R04 2;  5FFO C;  1YYN A;  3S57 A;  2OX0 A;  1GOH A;  1QF3 A;  3CL1 A;  4IQP A;  4LIV A;  4AVS A;  4WV8 A;  4CDW C;  1YO8 A;  2GAL A;  4XXA A;  2WO3 A;  2XKO A;  2YDE A;  3KD4 A;  1VMH A;  4E8D A;  3VBF C;  2F4L A;  3MIE A;  3WZ1 A;  3E1F 1;  5LZ6 A;  2FCV A;  4RFT 0;  2F4P A;  1Z7S 3;  4P9W A;  4QB2 A;  3OUH A;  1AR7 2;  1DLC A;  1SBE A;  2XGX A;  4QAW A;  3OUI A;  3WDT A;  1L7L A;  4FQ4 A;  1GP4 A;  3PVB B;  4GJZ A;  1Y3T A;  2CGP A;  3JQX A;  1PVC 3;  1UAI A;  5JOW A;  4OYU A;  1YIF A;  2ZKL A;  5CBL A;  2BU9 A;  5KXB A;  3HNY M;  5DPN A;  2TNF A;  4QQ2 A;  3VDB A;  4NRO A;  2ZGN A;  3VHO A;  2WA4 A;  2X53 S;  3ZKU A;  2VOK A;  5JOY A;  3HD8 B;  4JQR A;  3I2J A;  5FY7 A;  4QX8 A;  1EPZ A;  3MBW A;  4YNI A;  4HG6 B;  3KT7 A;  5FKC A;  4NN0 A;  4CEY B;  2VTX J;  2J1R A;  3PTY A;  4IV3 A;  1GUI A;  5FO9 B;  3O7O A;  4K7J A;  2P3J A;  2YMZ A;  3KM5 A;  4MOA A;  1RHI 2;  4AGG A;  4XOG A;  5EYY A;  4ET7 A;  1W9W A;  4HN1 A;  5BNP A;  1XXN A;  1LJ7 A;  2NN8 A;  3KF5 A;  3LWC A;  5DG2 A;  1BEV 1;  2XL7 A;  5C8C A;  4LKF A;  2OPW A;  1CPN A;  4YVW B;  5IJR A;  4IEY A;  5FY4 A;  1CAX A;  1UY2 A;  1H6X A;  4PI2 A;  5LB6 A;  5E88 A;  3WW4 A;  1BQP A;  1V6O A;  2W52 A;  4GH4 A;  4OI4 A;  1SLI A;  3WNX A;  1CX1 A;  1QH7 A;  1DZQ A;  2DUQ A;  3NV2 A;  3POS A;  4DZG A;  4FOV A;  4K3U A;  2GH2 A;  4KWU A;  3LB9 A;  1POV 1;  2YBP A;  3NMB A;  3LSE A;  2GU9 A;  1ND3 A;  3HWJ A;  5T3N A;  4DNY A;  3PVO A;  5GZC A;  1I6X A;  1QMJ A;  4LKS A;  5FXZ A;  1HX6 A;  1O59 A;  5IVC A;  4UW4 A;  3J8F 1;  3HQX A;  3OOX A;  4M3C A;  2Q8O A;  4W8J A;  4A45 A;  1UMI A;  1GMM A;  4JRL A;  2GP3 A;  3MIB A;  4PDW C;  5EZW A;  1XND A;  2K0G A;  1BLZ A;  2VOW A;  3UK9 A;  1XSR A;  4KWL A;  2DUP A;  3FL7 A;  1MS4 A;  1NA1 A;  2YU2 A;  3LSD A;  4ZXK A;  3U0Z A;  1HLC A;  1O7F A;  4KI5 M;  1J3P A;  5F9T A;  3BI3 A;  3WP3 A;  1IQD C;  5DZG A;  5F7U A;  4U36 A;  1LR5 A;  4QGL A;  4XFH A;  4OUL A;  4UBG A;  1GNZ A;  3JD7 1;  3WF3 A;  4BK5 A;  3AX4 A;  2EVX A;  4Y5Z 0;  1YQ8 A;  4H14 A;  5CFC B;  1UZ0 A;  2JEC A;  3GXU A;  3FJS A;  3T08 A;  2P3K A;  4J25 A;  3M2M A;  3DL3 A;  4NAM A;  1IGO A;  2HWE 3;  1VBE 1;  1XRU A;  2VCM A;  5A33 A;  1CVN A;  4FPO B;  2F6B A;  5FMC A;  3E6D A;  3CDZ B;  3ECQ A;  2B8M A;  4NHK A;  5FQ0 A;  5LA0 A;  1R08 3;  3L9J T;  1IS4 A;  3R4U A;  4YLZ A;  2DTY A;  1H8T B;  4LHS A;  1DGL A;  4LJH A;  4MGK E;  5EHD A;  3I2K A;  4NID A;  4YVS A;  1XNC A;  3BTA A;  3Q8E A;  3BPS A;  1UMZ A;  1RC6 A;  2R04 1;  2TBV A;  4WM7 C;  4QGN A;  2JE8 A;  5IWF A;  1RUE 2;  4MO3 M;  4OCT A;  2BOJ A;  1IKP A;  4OQ8 A;  1JU4 A;  4N90 A;  1UOF A;  2WAA A;  4DQA A;  2Y60 A;  1ODN A;  4RR3 B;  3VL8 A;  4QGM A;  1G9D A;  2UYB A;  1E57 A;  5T5L A;  2K46 A;  1VMJ A;  2P6H A;  2PLV 3;  1AR7 1;  4XW3 A;  3WQB A;  3MGU A;  4PLM A;  4UW3 A;  1O4Y A;  4WM8 B;  3RQ0 A;  3J7M A;  1FNZ A;  4XF9 A;  5EJ3 A;  4DXT A;  1LEN A;  1IS6 A;  4GJY A;  4B4P A;  4CUB A;  2WNV B;  3J7L A;  1LU2 A;  3CQO A;  3LOB A;  2WDB A;  3UKT A;  2GAU A;  4CXX A;  2CNA A;  4RS5 C;  1QOO A;  1N47 A;  3MI8 A;  4C1W A;  2DU1 A;  2ZHM A;  4KMQ A;  2ZJC A;  5JVV A;  1QWR A;  1O3S A;  3AL6 A;  4E4S A;  2WNU C;  2DCJ A;  2JE7 A;  5KXE A;  2XPJ A;  4UF0 B;  1UU5 A;  3MV1 1;  4N43 A;  3RWK X;  4Z8B A;  3ZFF A;  1RHI 1;  4QPG C;  3ZSM A;  1Y4W A;  1W04 A;  4ARX A;  4DRV A;  2W39 A;  4XAB A;  2ERF A;  3DF0 A;  5J36 A;  2VO5 A;  1C28 A;  3J4U H;  1V6L A;  1PX4 A;  3PUI A;  1EP0 A;  1QHD A;  1UU4 A;  2RS1 3;  4MXW A;  2W1U A;  3APB A;  1FV2 A;  1N1Y A;  1ZBA 2;  2QZ3 A;  3DUI A;  1FPN 2;  5FLJ A;  3IT8 A;  5FY1 A;  3V0B B;  4XIK A;  4PIX A;  2JJ6 A;  4P9L A;  4CPB A;  1C8N A;  4IEV A;  3CEW A;  5GJ6 A;  5IHR A;  3NVC A;  4XF4 A;  2O1Q A;  5FZB A;  1OFS A;  1H1M A;  4XET A;  2XOM A;  3AXE A;  5LY1 A;  4UAP A;  1OKO A;  2JDY A;  4ERO A;  5BNQ A;  1NCQ C;  4FT8 A;  1I5P A;  2OXB A;  4XDO A;  1TNR A;  4KGG A;  5A7N A;  3FFZ A;  1D4M 3;  2Y33 A;  1CAU A;  4XXP A;  3PMS A;  1NLS A;  4BXF A;  2OPK A;  3T1M A;  4EQV A;  2XJU A;  5EJ1 B;  2V09 A;  1Q56 A;  3I3Q A;  2J7M A;  2JG9 A;  3DEM A;  3ON7 A;  3C2U A;  3LE0 A;  5FKB A;  3VDA A;  2X05 A;  3ZDV A;  5FR3 A;  4HL0 A;  5FYY A;  4GMP 3;  1ND2 B;  3BVC A;  3J26 N;  3POF A;  1KEX A;  1W6M A;  4NR1 A;  4A6O A;  1LKN A;  1W2N A;  4FPH A;  5FZK A;  2D93 A;  4QM8 A;  5FK8 A;  1WCD J;  5FPL A;  2A3W A;  2HKX A;  2WWU A;  4L2N A;  1C8M 3;  4KWK A;  5B4X A;  1SAC A;  1PVC 2;  1UO9 A;  3CF6 E;  3T0B A;  3B02 A;  2BDR A;  4E2Q A;  1K5M A;  3DGT A;  1OA3 A;  1NX9 A;  1LNS A;  2D5H A;  3ZYI B;  4BOW A;  4XQD A;  4TWT A;  4M3C F;  1BJQ A;  3PJY A;  2SLI A;  3ETQ A;  1BMV 2;  3WW1 A;  1S0G A;  1KFX L;  2RDR A;  4UW5 A;  4DMI A;  2WIN B;  4QDS A;  1RUE 1;  2BJS A;  1ZZ8 A;  1EPW A;  1W8W A;  3AZZ A;  5A7W B;  1FX5 A;  2C26 A;  2JIG A;  4AVB A;  1AR8 3;  2VD7 A;  4MVT A;  2ZMN A;  5TSW A;  2GNM A;  4YSF A;  1UYP A;  3GDB A;  1ULG A;  4L92 A;  5FPV A;  3ZXF A;  3D82 A;  3I54 A;  2VZU A;  4IV1 A;  4XZP A;  4CEW B;  2D6L X;  2QTW B;  4BQ5 A;  5BNN B;  4YRD A;  1AXY A;  2VCC A;  5L9B A;  3AJY A;  2KXL A;  1HKD A;  2JG8 A;  1IG0 A;  1MS1 A;  1B35 A;  5DQ0 A;  1URX A;  5LK5 A;  4UOJ A;  4FVV A;  1MS9 A;  3H1Y A;  3HEI A;  3L2H A;  1QNY A;  3URF A;  3OBZ A;  1SLT A;  1UPS A;  4O65 A;  4V2W A;  3T0D A;  1GFF 2;  3U14 A;  1UL9 A;  2YB7 A;  3P3N A;  4IET A;  3SKV A;  1UZV A;  2PHL A;  2VM9 A;  4NPR A;  1HB1 A;  4TSV A;  3B5L B;  3AC0 A;  4G3Y C;  1O4T A;  3P6B A;  4MXV A;  2RG4 A;  2RS3 3;  3DKW A;  1PGL 2;  2I07 B;  4LO4 B;  4AOC A;  5FZ1 A;  3KVB A;  1BKZ A;  1RIR A;  3F95 A;  4XJ8 A;  4FSJ A;  1OBN A;  2AAC A;  3UL2 A;  3WD5 A;  3NNL A;  4BM8 A;  3WOG A;  1WMF A;  3MZH A;  3RZJ A;  4XUR A;  2YUE A;  3BIW E;  3DXU A;  4ZU7 A;  1VPH A;  2Q1M A;  2IFW A;  4HVO A;  3I59 A;  4M0H A;  4CCK A;  5F37 A;  4X8N A;  3O0X A;  2VOV A;  2W87 A;  1N1S A;  4E4Z A;  1ZBA 1;  3UV9 A;  1GZC A;  2UU8 A;  3U4S A;  4FPJ A;  1EV1 3;  1J84 A;  1VB4 A;  1PZ7 A;  4Y1X A;  3AZV A;  3ES1 A;  4LQR A;  1IZ3 A;  1FPN 1;  3DYM A;  4JGY A;  5FY8 A;  3H3Z A;  1B09 A;  4CP1 A;  4KGQ A;  3NAP C;  4H2A A;  1OF3 A;  1WA6 X;  3CHX A;  2O0O A;  1XC6 A;  4NRM A;  2HWE 2;  5FLI A;  3THP A;  3WDW A;  3WP6 A;  4BE3 A;  3VD3 A;  1HQL A;  2PHF A;  4D3W A;  5I0D A;  3RS6 A;  4LUL A;  1UZY A;  1R08 2;  4XFF A;  5KWR A;  2A6X A;  2FZ1 A;  2CL2 A;  4QHZ A;  5GZF A;  5A6X A;  4JV4 A;  1E5S A;  5JXJ A;  2DVD A;  3O12 A;  1DLL A;  5ABJ C;  2IXL A;  1RL3 A;  4OI2 A;  4M4P A;  4W65 A;  5FY0 A;  5A3M A;  4MV2 A;  4XTP A;  2RHP A;  3W20 A;  3RWN A;  4D6S A;  4LHL A;  3UES A;  1APN A;  1JS9 A;  1TE1 B;  3VKO A;  2UY8 A;  1LOG A;  2VME A;  2VZP A;  4LBM A;  4QM9 A;  5FXV A;  1OQ1 A;  1F8V A;  2J1U A;  4GWI A;  5T54 A;  4AQ6 A;  1Y43 B;  4CCE A;  4F3J A;  1KJL A;  5A70 A;  3CO2 A;  5J7M A;  5JXH A;  3L2Y A;  5FBZ A;  1UYZ A;  3Q8B A;  2QQK A;  5L7O C;  4BQW A;  5EJZ B;  2VTX A;  4DFS A;  2ZA9 A;  5K0U C;  2HLE A;  2PLV 2;  5ACA 2;  1Y9M A;  3ASI A;  3B94 A;  1W0P A;  3KLS A;  4RA0 A;  1XNB A;  1WGP A;  1WME A;  5JOX A;  5LEJ A;  1GZW A;  3H0O A;  3ZFE A;  1ULD A;  1PVC 1;  3HJR A;  2E7T A;  3UNP A;  3M4F A;  1QGL A;  2BFU S;  3IAP A;  1LED A;  2QCS B;  3N9M A;  3WNP A;  3KV5 A;  1RYY A;  2C1F A;  3H3L A;  4CCC A;  3ACF A;  2VOX A;  1BMV 1;  4AWD A;  1A8M A;  1OLM A;  1XNK A;  2CSG A;  3FN9 A;  3GF6 A;  1UU6 A;  3KB5 A;  3MPB A;  1KQR A;  2C24 A;  3FX3 A;  4G9S B;  5FYT A;  4FFH A;  2VW1 A;  2VNO A;  3QH7 A;  3X29 B;  4ZZ5 A;  1OSG A;  1G6N A;  2XJR A;  3K75 B;  3PIG A;  2CDP A;  3FHI B;  4IV3 B;  4CDU C;  4EV0 A;  4Z2A A;  2VNG A;  5LRR A;  5FXX A;  5JLV A;  2RR1 3;  4LBL A;  5FP8 A;  4QQO A;  5C71 A;  5F2W A;  3UET A;  1J1T A;  1DBN A;  1XSQ A;  5H9R A;  4ISR A;  1V6I A;  1XBF A;  2ZAA A;  3K4D A;  5KXD A;  3DCQ A;  2LTN A;  4I3P A;  4AK3 A;  1BZW A;  5C8C B;  2DVA A;  1BK0 A;  5CNA A;  3I49 A;  3PUQ A;  1AJO A;  1F9K A;  1CAX B;  3CKH A;  4QKN A;  4CZS A;  3H9A A;  4PCR A;  2IFR A;  3VBH A;  4GH4 B;  5CA6 A;  2W46 A;  2BNO A;  1SPP A;  1LUL A;  4P9G A;  5C6C A;  3WUC A;  5FYI A;  3MUZ 1;  3WW2 A;  4AI8 A;  1W9F A;  3O1S A;  3LKJ A;  1PHM A;  3ILN A;  4CDQ A;  4AG4 A;  2VGD A;  5FDB A;  1F4H A;  3WF2 A;  5FYB A;  3S0M A;  5GLT A;  1NOV A;  3VB9 A;  4M3C B;  4XBN A;  3R6S A;  1PGL 1;  1SMV A;  3IIA A;  5FWJ A;  1A3K A;  4XJZ A;  1OPM A;  1JHJ A;  4Y1Y A;  2WYF A;  2DUR A;  2CU5 A;  1NA1 B;  4LBN A;  1D4M 2;  3CJI C;  4BQ1 A;  1VAM A;  1H4H A;  3T2T A;  4XHB A;  2J1S A;  1YUD A;  2ZHK A;  3VD9 A;  4J1X A;  1W8U A;  1WCQ A;  2GME A;  3DPR C;  5IAV A;  1HW5 A;  1Q8P A;  2XJT A;  3E6B A;  2WQ4 A;  4OFG A;  3TN9 3;  3GGL A;  4JX0 A;  2NMN A;  3S30 A;  4B1M A;  2GMM A;  5K7P A;  4BDV B;  2P5B A;  5FWE A;  3VD7 A;  4HKW A;  4Y26 A;  4FQZ A;  1OOP A;  3O14 A;  3JB4 C;  2HWE 1;  3K48 A;  3HIF A;  4B29 A;  4LUK A;  4Q0Q A;  2DVB A;  3CJX A;  1C8M 2;  2ZAH A;  1QY4 A;  1GAN A;  4XYX A;  5A33 B;  3KSC A;  4XHX A;  1YCI A;  4LPL A;  5EP9 A;  1R08 1;  4KL1 A;  1JZ6 A;  3GBW A;  5FQ0 B;  4XAA A;  4CTE A;  5H9Q A;  3D8C A;  3R4D B;  5ANN A;  5EYX A;  3VDD C;  1WD3 A;  4R9B A;  1J1L A;  4QXB A;  4YVS B;  2YBK A;  4OHW A;  4D69 A;  2XKP A;  1O5L A;  1RUG 3;  5I0T A;  5CG9 A;  3H8O A;  3WT3 A;  4YZ3 A;  1AR8 2;  4B7K A;  1UKG A;  3G6J B;  4HKO A;  1REE A;  4QWN A;  4M0N A;  4LO8 A;  3U75 A;  3UGH A;  1ASJ 3;  2VVE A;  3M3O A;  4IEQ A;  4LBQ D;  5F6L B;  2R16 A;  2ZEX A;  1JBC A;  2PLV 1;  4NHY A;  4CCN A;  4CYD A;  2D6M A;  4JAA A;  4UWD A;  4Y5T A;  5CVR A;  2RM2 3;  3VBU C;  1JYV A;  1WA4 A;  2JDN A;  2X10 A;  2Z69 A;  3TAY A;  4XJW A;  4EN9 B;  1W9Y A;  5FPX A;  4Q4Y 3;  4DO0 A;  1S0B A;  4CUG A;  5L73 A;  5E6H A;  1TMF 3;  1K12 A;  3R05 A;  5I93 A;  1REF A;  1IS5 A;  1IPS A;  3I3B A;  3HBZ A;  4FPL A;  2E53 A;  4BQ3 A;  5JPM B;  4B4R A;  4DEV A;  1FNY A;  3KQR A;  5FBJ A;  3C7G A;  1S0F A;  5H9P A;  5LW9 A;  1WW7 A;  2EAA A;  3CMG A;  3FHA A;  3BTX A;  3O0V A;  2FMY A;  5FRA A;  1QEX A;  1AXK A;  1VB2 A;  1DQ1 A;  1ZNP A;  3EHK A;  3I4I A;  4H7L A;  2EIC A;  5A1L A;  4N43 B;  3AMN A;  4LMF A;  3ZFF B;  2RE9 A;  2Y6J A;  3ME2 A;  4I3G A;  4P9X A;  3WG2 A;  1EY2 A;  4S2G A;  2ENR A;  1X7N A;  3NV3 A;  3ACI A;  4PQQ A;  4WZF A;  1CZT A;  3MUY 1;  2VR4 A;  1DYP A;  3O1T A;  3W58 A;  1V0A A;  1AL2 3;  2MHF A;  1A34 A;  2FDG A;  2CY6 A;  2WWJ A;  2G9G A;  5FMB A;  4NE9 A;  2P3I A;  4W6W A;  2GC0 A;  1EV1 2;  3OD4 A;  4DUV A;  2A75 A;  3JXS A;  5C3Q A;  3PU8 A;  5A6Q A;  2DYC A;  2E63 A;  4GWN A;  2VH9 A;  4G4F A;  4QHO A;  3RMX A;  3KVA A;  3TEY A;  3ZN4 A;  1EAH 3;  3KCX A;  5FMO S;  5ANQ A;  3T1L A;  1W2O A;  2Q30 A;  1RXG A;  2D3P A;  4CXW A;  1AX0 A;  1CIW A;  2UYA A;  3VBS C;  2Q0A A;  1PGS A;  4HN0 A;  3M3C A;  2MEV 3;  3OUJ A;  1PM4 A;  2P6C A;  2BVV A;  1LTE A;  1W6P A;  3GBF A;  2QNK A;  2YU1 A;  5KHG A;  1N1T A;  1GP5 A;  2VU9 A;  1L7Q A;  4Q4V 3;  5I8S A;  1D4M 1;  1ULE A;  1T6B X;  3VBO A;  1O3Q A;  2YGL A;  1G7Y A;  2WBK A;  1AHS A;  1RIN A;  2DV9 A;  3Q8A A;  3BAL A;  4U2A A;  1GWK A;  2RDS A;  1YIP A;  3N9L A;  4QQP A;  1VMF A;  4Y22 A;  1PM7 A;  5E89 A;  3WX5 A;  2JG9 B;  2QUO A;  4BZ4 A;  4GMP 1;  4QXC A;  1JZ7 A;  1BXH A;  1J83 A;  2GMP A;  2Q8E A;  2RDQ A;  1W6M B;  3AP5 A;  4AHX A;  4L99 A;  2X5I A;  4FTB A;  3FLR A;  1YFX A;  1YEW A;  4A44 A;  1X8E A;  3AKR A;  4CRQ A;  3NNJ A;  1C8M 1;  1OPO A;  4IW3 A;  4E27 A;  1H1A A;  2DFC A;  2E9Q A;  2KM2 A;  4IDZ A;  3AKS A;  4EN6 B;  4WVW A;  2BV4 A;  1CWP A;  4DXR A;  1KS4 A;  1X8M A;  3TWI A;  4CU9 A;  1K5M B;  1YC6 1;  2VZT A;  5L19 A;  2ILM A;  5L36 A;  4DS0 A;  1LOF C;  3PME A;  1BK1 A;  4AHY A;  4TTG A;  2NPI A;  1BCX A;  5F5C A;  2JIC A;  4XF3 A;  4XIO A;  2AH2 A;  2CWM A;  1AR8 1;  4YYO A;  4YVW C;  3LPG A;  1ALY A;  1QKQ A;  3LPF A;  2RR1 2;  2VMH A;  4BHP A;  3BIE A;  5F32 A;  3WDX A;  4IEP A;  2WL1 A;  1K45 A;  2D6N A;  3QH6 A;  2RDN A;  4DUW A;  1MZE A;  2YV8 A;  2XLG A;  3GBG A;  3OGS A;  4XF1 A;  4IV1 B;  3VBR C;  1PK6 A;  4JKL A;  4UFH A;  5FZC A;  1GLH A;  1G9A A;  1DFQ A;  3EBR A;  3SC7 X;  2DU0 A;  2JG8 B;  2A7A A;  5JPN B;  1B35 B;  4PI0 A;  2AC1 A;  4JC1 A;  4RFR B;  5F8P A;  3AP4 A;  4A7Z A;  1UN1 A;  3RZH A;  1GNY A;  3MDP A;  1MS0 A;  4BMB A;  4NOT A;  3KHB A;  2D6K A;  2WJS A;  2J1E A;  2GP5 A;  2C9K A;  5EFU A;  1PIV 3;  2OQ7 A;  4XJA A;  4QPW A;  5LA9 A;  5IAT A;  2VTF A;  1YJL A;  3ZYR A;  1R1A 3;  1ZRE A;  4ZHN A;  4FPG A;  4LXL A;  5CFC C;  3SEE A;  5IVB A;  1PMH X;  1RUI 3;  1XE7 A;  2VCB A;  5EV7 A;  2C0Z A;  2JB8 A;  3I59 B;  2IVI B;  3VDC A;  2ARX A;  3QOP A;  3C7F A;  4QPG A;  4Y5S A;  3TN9 2;  1EV1 1;  4EWA A;  4PQ9 A;  2W5F A;  1RB8 G;  1Y7B A;  2ZAC A;  3EMR A;  5DAB A;  4JGY B;  4L9B A;  4J1W A;  2VUC A;  3KZ4 C;  1LES A;  4HSJ A;  5JIA A;  3H1M A;  1H8T C;  1HB2 A;  1LGB A;  3OEB A;  1OF4 A;  1W8N A;  1LU1 A;  3ZIX A;  4I2O A;  4Q8K A;  4AED A;  1G9F A;  2ZGR A;  4GZ9 A;  3ZOI A;  4YM2 A;  2Y6F A;  2QDN A;  5CKM A;  4FAH A;  3NJV A;  4MGY E;  4UI9 L;  5HBA A;  2OA2 A;  5A3U A;  1PVX A;  4OUE A;  4UFJ A;  4W50 A;  4RR3 C;  1MZ6 A;  1RTV A;  2DBI A;  5FZ8 A;  3TOJ A;  5J1X A;  1HJF A;  3RPQ A;  5EIY B;  5EWS A;  2YGM A;  5FYM A;  3IBM A;  1OD5 A;  5HV4 A;  5FYS A;  5I0S A;  4CP9 A;  4YW7 A;  5FYH A;  1RUG 2;  1UW8 A;  1YQ2 A;  2D43 A;  3H1W A;  3AKQ A;  3ZYJ B;  3SH5 A;  3ILR A;  1Q43 A;  1BHG A;  4P9J A;  4QDR A;  1C5H A;  2C5D A;  1ASJ 2;  1DGW X;  4WM8 C;  1ZRF A;  5SV8 A;  5E8A A;  3A7Q A;  5GZD A;  3UT0 A;  1ZVF A;  1QOS A;  4M00 A;  1D2Q A;  4QU2 A;  5FP4 A;  2VQ0 A;  3CLP A;  2WNV C;  3RFR A;  5FPU A;  2C9A A;  2RM2 2;  2WSV A;  1DHK B;  2QBX A;  3B69 A;  1XU1 A;  5F3C A;  4Q4Y 2;  1GZW B;  5DAV A;  3EXU A;  3ZFE B;  1K5J A;  1TMF 2;  1VRB A;  4MGZ E;  3U78 A;  2GND A;  4LT5 A;  2QFE A;  2BBA A;  2IXH A;  1PMJ X;  2BQP A;  3FUQ A;  1AX2 A;  1LGC A;  1Q5O A;  3G7D A;  2FDK A;  3T2P A;  2WR9 A;  4IGP A;  5GLU A;  2MNG A;  2D40 A;  3USU A;  4Z07 A;  3KWV A;  1CES A;  3ZXL A;  4AE2 A;  4D7Y A;  5CG8 A;  1JUH A;  1RUJ 3;  2OYZ A;  3DEC A;  3VKL A;  3PTR B;  1DGW A;  5F3E A;  1ZBE 3;  5FZ7 A;  5A6Y A;  1GV9 A;  5JR2 A;  2RR1 1;  2BP6 A;  3ABZ A;  1QXJ A;  5A3N A;  4O9G A;  4XFI A;  1DZT A;  3RI9 A;  1JW6 A;  1MS5 A;  4FPY A;  1OVP A;  5FYC A;  5FLH A;  1US3 A;  2VZO A;  1AL2 2;  4DUX A;  1OC1 A;  4HK8 A;  4AVC A;  5C3P A;  3PUA A;  3SH4 A;  2LS6 A;  1OXC A;  1SQ4 A;  5JXI A;  2NYY A;  5AC9 2;  1IG3 A;  1WUV A;  4A7K A;  3VBH B;  4HFS A;  1QJU 3;  2ET1 A;  3THD A;  3ZYG A;  4MLO A;  3FC0 A;  1SPP B;  4PLO A;  1JYN A;  2XLA A;  2J22 A;  4XFC A;  3WHU A;  2B42 B;  1CIY A;  1EAH 2;  4N9I A;  1F31 A;  5FUI A;  4D6Q A;  1HRI 3;  3D0J A;  4GUL A;  3V0A A;  4XDP A;  5K9Y A;  4CDQ B;  2MEV 2;  3BU7 A;  4E9K A;  4A2U A;  3JQW A;  3FBY A;  5HPO A;  2Z2S B;  4QDQ A;  1OH4 A;  5FP3 A;  3WNN A;  1YJK A;  4XMI A;  4Q4V 2;  1YQ6 A;  4NJ4 A;  2BYV E;  5K0U A;  3M3Q A;  2GC2 A;  1WW6 A;  4B3N A;  1ND2 C;  4DOU A;  1YHF A;  4Q0V A;  4YFZ A;  1CZS A;  5F6K A;  5ISL A;  2Y6G A;  1PO2 2;  3ZXJ A;  1XB9 A;  4O7X A;  4QD2 A;  3Q8C A;  4NMI A;  1LEC A;  4UYB A;  3TN9 1;  5D1I A;  2WNE A;  5DZF A;  3T30 A;  1XE0 A;  2JDH A;  2F17 A;  5BXX A;  2HWC 3;  3VZM A;  4COV A;  2ES3 A;  2YZ4 A;  3LAG A;  5J98 B;  4AFC A;  4DPN A;  4HXC A;  1LOB A;  2BVB A;  2PAE A;  3PJQ A;  1OOP B;  1VRH 2;  1WLW A;  2R1B A;  4C0B A;  4XZU G;  4AHW A;  5DAQ A;  2ZMK A;  1D7P M;  5F2S A;  1G9C A;  4MAD A;  4AFM A;  3K3O A;  1J58 A;  3T09 A;  3A0N A;  4JHZ A;  2WFF 3;  3SHR A;  3D3A A;  4C1X A;  2JXA A;  3TNP B;  3TRS B;  5FPA A;  2VNV A;  3SNM A;  2WLQ A;  4M4R A;  4JGZ A;  4YGE A;  1LOE A;  2CWS A;  1FOD 2;  3III A;  5LCW L;  1ZRD A;  2VXR A;  1RUG 1;  3LEG A;  4RQP A;  1OLQ A;  4QKB A;  5FMD A;  4IES A;  1RUC 3;  5ACA 3;  2GDF A;  4EN8 B;  1XNT A;  4CEW C;  2PMW B;  5FZO A;  4D94 A;  1ASJ 1;  4JZR A;  5T5J A;  2OT7 A;  5AFB A;  3VHR A;  1Q8Q A;  5JXG A;  5FJK A;  4E4D X;  2ARC A;  3ACL A;  5A1A A;  2ORX A;  2A3Y A;  2RM2 1;  1QXR A;  2B9V A;  4XF0 A;  4AR2 A;  1AR6 2;  5AVA A;  4ES8 A;  2ET7 A;  1LHW A;  3LDB A;  4QQH A;  2WAO A;  1K42 A;  4Q4Y 1;  4XMA A;  4CDW B;  1JU3 A;  4Q2F A;  3ALQ A;  1TMF 1;  4EE2 A;  3GCX A;  1OVS A;  5EPA A;  4BPZ A;  2E7Q A;  3Q9O A;  4CCJ A;  1U5Z A;  3JBG 3;  4KG0 A;  2ZX3 A;  3BGA A;  4QPI A;  5CKQ A;  1ZRI A;  3QLQ A;  1GQP A;  4PHZ A;  4SBV A;  5LY2 A;  4YG3 A;  5BNO A;  2XQX A;  2ZEZ A;  5DUU A;  3KQ4 B;  3POE A;  4QKD A;  1WBL A;  2DBN A;  4DB5 A;  4FPF A;  1PIV 2;  3VD5 A;  3T2Q A;  1O8P A;  4CU6 A;  3POW A;  3I3D A;  3USS A;  1SLB A;  1R1A 2;  3POB A;  4JRA A;  2P17 A;  4AVT A;  5IK5 A;  1HQW A;  2BUK A;  1HB4 A;  3RG0 A;  3MV0 1;  5FPB A;  2PYT A;  1O5U A;  1DQ2 A;  1RUI 2;  5C9A A;  4QX0 A;  3WCR A;  5CIS A;  2QKD A;  4LBO A;  4UFI A;  1AL2 1;  4XUT A;  5HXV A;  4DXS A;  5JI9 A;  4BME A;  1KRI A;  2FDH A;  5FZD A;  2GNT A;  4HVR A;  4IL7 A;  1E5H A;  4YFW A;  1UY4 A;  1S1A A;  2VZ3 A;  5AC9 1;  2WN2 A;  4CVU A;  3I97 A;  3M8L A;  4IXL A;  5CB7 A;  3NNM A;  3Q8F A;  3NKG A;  1YI7 A;  5BUV A;  1AVB A;  4AF9 A;  1EAH 1;  1R09 2;  4RN5 A;  4LHN A;  3ZR5 A;  3LEI A;  1P8J A;  2PHW A;  2XDV A;  4L8Q A;  4DEQ A;  4IEW A;  3WG1 A;  1L7R A;  3PUS A;  4UBH A;  3B9C A;  2MEV 1;  4I0A A;  3OBA A;  3A0K A;  3K3N A;  1S0D A;  3WIN E;  1W6P B;  2OQ6 A;  3PUH A;  4Q4V 1;  2XBO 3;  1SFP A;  4ZZ8 A;  3LF7 A;  3VBO B;  3C7O A;  3HN1 A;  1GKB A;  2KD7 A;  3WNM A;  1MQT A;  1E5R A;  2J42 A;  2QQV A;  4GWM A;  4IEO A;  3IWZ A;  3ZFG A;  4R4X A;  3NRU A;  4Y22 B;  5LBB A;  4COU A;  4OQ9 A;  1W8Z A;  5C3R A;  3O1V A;  4HPK A;  4FTS A;  3GHM A;  3IMN A;  1WKY A;  1GNH A;  1AYM 3;  1W8T A;  4BU2 A;  5JSP A;  4LR4 A;  2ZML A;  4XJ9 A;  2X5I B;  3ZXE A;  2VZQ A;  3NWK A;  4BLI A;  5C8W A;  1VRH 1;  3J7N A;  4IGQ A;  3VHP A;  2W1Q A;  1Y9G A;  1ZA4 A;  3SCH A;  4AQ2 A;  1XYO A;  4ITC A;  2P4E A;  3I3E A;  1VBB 3;  3BUC A;  5DG1 A;  4IE4 A;  5FTT C;  1W8O A;  4XBQ A;  1U0A A;  3D4K A;  5CEH A;  2ZPX A;  4Y4R A;  1U5X A;  4IV3 C;  1YFW A;  4JQT A;  4MSV A;  2ZHN A;  3J9S A;  4ISQ A;  2Q4S A;  4R9C A;  2VZV A;  1FOD 1;  2R7E B;  3ES4 A;  5CFD A;  5BNP C;  1ZRR A;  1RUJ 2;  1H2N A;  1QDC A;  4XUP A;  4HKL A;  2YPD A;  5C8C C;  1JZ8 A;  1ZBE 2;  3AFG A;  2WZR 3;  4LE3 A;  3V65 A;  2R07 3;  4BQ4 A;  3IDC B;  2DUO A;  4GAZ A;  4GIQ A;  1GZT A;  4GH4 C;  4JCK A;  4BWO A;  1AR6 1;  3P5B A;  1IOA A;  3LA2 A;  2P34 A;  1UOJ A;  1PK6 B;  1LHO A;  1S2K A;  4NO4 A;  4BLJ A;  1JOJ A;  1ND3 C;  2JDU A;  4DIN B;  2RVA A;  4V1P A;  2WZP P;  4IER A;  4K6B A;  2D44 A;  1QJU 2;  2RMU 3;  1D2S A;  3S5Q A;  2A5Z A;  3LFI A;  2IXK A;  2VOT A;  3O1R A;  1V6K A;  3K51 A;  2A6W A;  3QBQ A;  1DYO A;  2ZXQ A;  3N9N A;  1A78 A;  5LBF A;  4Q26 A;  5I91 A;  1HRI 2;  1RUH 2;  2EXK A;  1ZZ7 A;  3LFM A;  1NQJ A;  4XUO A;  3SKJ E;  1NA1 C;  4CXY A;  2GSY A;  5A7P A;  1PIV 1;  2CAU A;  1X50 A;  4ASL A;  4AAX A;  5C3O A;  1R1A 1;  4BIS A;  4AQS A;  2FBE A;  2PQS A;  2XVK A;  4P08 A;  2JDA A;  2V72 A;  1RUI 1;  1WW5 A;  2ZX2 A;  1QOT A;  5I0U A;  2NLR A;  1JYI A;  2YFU A;  4GAL A;  3THC A;  2Z4F A;  1KD7 A;  2HBT A;  3LEK A;  4FAG A;  3ZN5 A;  4QPG B;  2N7G A;  2HWC 2;  5EXO A;  2VVD A;  5HV0 A;  1KDK A;  3WNK A;  2H6B A;  1R09 1;  2PTM A;  4LK7 A;  3WHT A;  1BVP 1;  2FCT A;  3VZO A;  3ZMN A;  2I74 A;  4Y1Z A;  2BW8 A;  5BPX A;  2CAV A;  1N3O A;  4YVS C;  4LUM A;  5D8A A;  4AED B;  3OYW A;  2WFF 2;  3C7H A;  1W0N A;  2BPA 2;  4D7T A;  1RMU 3;  4Q1P A;  2V73 A;  4Q29 A;  4URA A;  3OY8 A;  1LOD A;  2XHK A;  2W0X A;  5T50 A;  4CCD A;  1CR7 A;  4QT6 A;  2YYO A;  1GZ9 A;  3NV4 A;  1FAY A;  1ULO A;  5FZH A;  2EAK A;  2JDP A;  3VV1 A;  4EYU A;  3AXD A;  5A3L A;  2WS9 3;  4ZON A;  4QMA A;  4CP9 B;  3E5U A;  1RUC 2;  4FO9 A;  3RYR A;  4BJ0 A;  1DU3 D;  5FV3 A;  4PBP A;  5DZE A;  4ONU A;  2OKX A;  2WYS A;  3NW4 A;  4IEU A;  5IVY A;  4QX7 A;  4CDX A;  2ZGS A;  3VKF C;  1W2A X;  1LOA A;  5F5A A;  1Q8S A;  5FY9 A;  5G04 L;  1AX1 A;  3SEP A;  2VZR A;  3VZN A;  2WT1 A;  3IKW A;  3OD0 A;  2O8O A;  4FTE A;  3WY6 A;  3HOB A;  1OHF A;  1W05 A;  3JBG 2;  5IFT A;  2SBA A;  4AGR A;  1JTZ X;  2VEC A;  3E97 A;  3HT2 A;  5JI7 A;  2OZJ A;  1MAC A;  4LBJ A;  4N43 C;  4QXK A;  2IWG B;  1HJG A;  3V56 A;  3ZFF C;  1ZRC A;  3KV4 A;  3MLL A;  3W5N A;  2GZW A;  2VUJ A;  3USU B;  1RUJ 1;  4TXW A;  1SDW A;  2ZOE B;  4N53 A;  3GZA A;  4XAE A;  2NM1 A;  4RHV 3;  4AXO A;  4AYU A;  3FFQ A;  1ZBE 1;  4IEX A;  4ATF A;  2BZD A;  3WDV A;  1LOF A;  1AR9 3;  1X82 A;  4XTM A;  2NQY A;  4LIU A;  1SZB A;  3H7Y A;  3JZV A;  1ENQ A;  5F3G A;  2ORZ A;  4QKF A;  3IDA A;  5JMO A;  1M4W A;  2D3R A;  4PJY A;  1JMU B;  4N7U A;  4YW4 A;  1VLN A;  3INA A;  4UXA A;  5FP9 A;  5C4W C;  3IN9 A;  1F15 A;  3ZKY A;  1QJU 1;  1YQ5 A;  1OMI A;  2CGN A;  3ACH A;  4LNV A;  4P00 B;  5A80 A;  1DGR A;  3KV9 A;  3N7M A;  4EWE A;  4F8A A;  3VBR A;  2WO2 A;  2VCA A;  1VBC 2;  2HH9 A;  2V5Y A;  1HRI 1;  1RUH 1;  3IMM A;  4JKK A;  4QX5 A;  4AZZ A;  3I2G A;  3V0A B;  2GN7 A;  1O3T A;  1MEC 3;  1N3Q A;  1YNA A;  3N9P A;  4MYE A;  4J6G A;  1WMX A;  4MX3 A;  5FCC A;  4CUA A;  2YC0 A;  1NZI A;  3GYD A;  2HBU A;  3MIG A;  3BCW A;  3UGF A;  2YG0 A;  2XBO 2;  2JG9 C;  2RJ2 A;  5E16 A;  2A73 B;  4D7S A;  5K0U B;  4B7E A;  2ADE A;  1Z78 A;  3OGV A;  4HMZ A;  4YGD A;  5IVJ A;  2CV6 A;  1VAV A;  4KBB A;  3BU0 A;  1YXW A;  2DCZ A;  1JYC A;  2PA7 A;  5T5O A;  5FZG A;  1C1F A;  5C7G A;  2HWC 1;  4ZS3 A;  1AYM 2;  5JZG A;  2JB4 A;  4ZU5 A;  2GC3 A;  4Y3O A;  3LOI A;  1K5M C;  3B01 A;  2UY9 A;  1NCR A;  1PO1 3;  2ZZQ A;  4XQ4 A;  3WR0 A;  4AGV A;  3A4U A;  4O9E A;  4XUQ A;  3I2H A;  4FCA A;  1RJ7 A;  1CD3 G;  1VBB 2;  2C4X A;  2WFF 1;  4L97 A;  1RUF 3;  4FOY A;  5DUV A;  2WSU A;  4XBL A;  3IAQ A;  4XC9 A;  1OT5 A;  1YRZ A;  1OUS A;  2D7F A;  3ZLI A;  2JEM A;  3LEM A;  1MVQ A;  5FZM A;  3KHC A;  2IXC A;  4JGZ B;  5DUX A;  1JOB A;  5ACA 1;  3AP7 A;  1RUC 1;  4HAN A;  4H7M A;  4RQP B;  1OQD A;  2VQT A;  4CCM A;  4Y1V A;  5FZO B;  1DF0 A;  4X6Q B;  4CDW A;  1DDL A;  2WZR 2;  3UKN A;  2R07 2;  4MUV A;  3VBF A;  4P5H A;  1B35 C;  2X29 A;  2JE9 A;  4A7Y A;  1H8V A;  1EUU A;  1V6M A;  1WZX A;  2WRA A;  2VAU A;  1QJY 3;  1CPM A;  4PF5 A;  1UY1 A;  1YQC A;  2BER A;  3S7E A;  4Q4W 3;  5JWP A;  2VMD A;  3ZN6 A;  4M3C E;  2GN3 A;  2B45 X;  4WVV A;  3JBG 1;  2RMU 2;  4H3W A;  4OI1 A;  1EYB A;  2L9L A;  4QPI B;  1IPK A;  3AMM A;  4AEK A;  1W03 A;  1TNF A;  4AI0 A;  3MFC A;  2PHR A;  1BYH A;  5BNO B;  1POV 0;  3ZYF A;  3NJZ A;  3NJX A;  2BWC A;  1UY0 A;  3EYP A;  2E31 A;  1UOG A;  4ZPI A;  3HNM A;  5K4L A;  4CPB D;  4E8C A;  3OPZ A;  5AC9 3;  4F83 A;  5LBC A;  1ACC A;  3OTF A;  1LOC A;  1HV0 A;  1QQP 3;  2DCT A;  4JGY C;  4EN7 B;  5C9A B;  3B9I A;  2WUH A;  2W9X A;  1QJZ A;  2LRO A;  1ZA7 A;  1HV1 A;  5FIX A;  1TQ5 A;  2K2S A;  2ZAB A;  1KDM A;  1LCL A;  4ATE A;  3VZL A;  5IK7 A;  2KA3 A;  1QXP A;  2OUH A;  2UWB A;  2RS5 3;  1XNA A;  3M70 A;  2D98 A;  3D5O A;  1S55 A;  2BTV C;  3DV8 A;  3IB3 A;  4KQ7 A;  4K1Z A;  3VHN A;  2CHH A;  3SLI A;  5SV5 A;  3NL1 A;  5DN2 A;  5JIU A;  1MR5 A;  3IDB B;  1HRV 3;  2EAL A;  3VUO A;  1PO2 3;  1RMU 2;  2Y64 A;  2G4I A;  2QQJ A;  4COY A;  1AZD A;  1SEF A;  3ATG A;  2XBO 1;  4Z92 B;  2OII A;  3MF6 A;  4PDW A;  4Y33 A;  3AYD A;  3H8X A;  5A1F A;  4QX2 A;  1SCS A;  3OG2 A;  5LA1 A;  1RIT A;  1UZW A;  2VMF A;  3C8X A;  4PBO A;  4JVA A;  2WS9 2;  1MQT B;  2D97 A;  2ZBJ A;  1R1Z A;  4ES9 A;  1JYX A;  2E7A A;  4MG2 A;  1NUK A;  1VRH 3;  4NVP A;  3ZFG B;  1HB3 A;  5HCF A;  3T2O A;  4AFD A;  4YZ1 A;  1AYM 1;  1NT0 A;  4HPK B;  3ZFE C;  2QE3 A;  4QQL A;  1X9T A;  3H7J A;  4Q4X 3;  3K2O A;  1STM A;  1Q8O A;  3HR9 A;  3N7K A;  4YWA A;  1UMH A;  1SCR A;  4CEY C;  3OBT A;  5T52 A;  2AEY A;  1WCS A;  1VBB 1;  2JEN A;  4JDM A;  2ZGP A;  1WMD A;  2W2I A;  2VC9 A;  3E5X A;  4R4Z A;  5DXD A;  5DMY A;  1FOD 3;  2ARA A;  4Q0P A;  4RGG A;  1UXX X;  5IYY A;  1AYN 3;  2VBP A;  3A23 A;  3HQR A;  5JR7 B;  1JYT A;  3KGZ A;  1X9P A;  1UQX A;  5B2G B;  1Q3E A;  2CTV A;  4WM7 A;  5CFD B;  1H0B A;  3CNA A;  3K4A A;  4TZD A;  4RHV 2;  5J48 A;  4OHZ A;  3RZM A;  2UWA A;  4KH9 A;  1NZC A;  1AR6 3;  2QQP A;  2WZR 1;  1AR9 2;  1DQ4 A;  2HEV F;  2R07 1;  4QPY A;  5IVE A;  4LOT A;  3W5M A;  2W92 A;  2VMI A;  2EF6 A;  3M3I A;  1ZZB A;  3AMQ A;  3MYX A;  2ZGL A;  3VBH C;  3P3P A;  2VNR A;  3DYO A;  1F5F A;  1HN1 A;  3E5Q A;  1U5Y A;  5F5I A;  4PT6 A;  5KXC A;  2XB6 C;  2PQQ A;  5FOJ B;  2MPF A;  2Q1Z B;  3VGI A;  3M7A A;  3S6P A;  4CDQ C;  2RMU 1;  3KCY A;  1MPX A;  3U07 A;  4AI3 A;  4C0H A;  1O3R A;  1GBG A;  2BEO A;  4OVE A;  2VW2 A;  2JD9 A;  4NIG A;  1XE8 A;  1CN1 A;  5JSO A;  2LM3 A;  2QJV A;  4IND A;  3HN3 A;  2XH6 A;  4RS5 A;  2WKK A;  4NPM A;  4RSU A;  2JIJ A;  4XQW A;  1MEC 2;  5C33 A;  2DTW A;  4NII A;  3R0R A;  4XFG A;  2WNU A;  2QQW A;  4B8E A;  4HET A;  2ETE A;  4MGS A;  5GZG A;  1GSL A;  5FYZ A;  3NO8 A;  3BB6 A;  3POJ A;  4LA3 A;  5C3S A;  4YM0 A;  2TEP A;  3N35 A;  3ENR A;  3ORJ A;  2VXJ A;  2QQI A;  3RGB A;  1COV 3;  1DQ6 A;  1Z0H A;  4I09 A;  4IE0 A;  5FPZ A;  1OOP C;  1R09 3;  1W2U A;  3WQ0 A;  4K8F A;  4FXG B;  2ARB A;  1NE4 A;  3DKQ A;  2FCU A;  2CYF A;  2WZ8 A;  1G86 A;  1UXZ A;  2DFB A;  1DZR A;  3PL0 A;  5BYN A;  3GCW A;  4MH0 E;  1PO1 2;  1QDO A;  4FPK A;  2E32 A;  1H9P A;  1W3V A;  5E1R A;  2G9Z A;  5A7S A;  1RUD 3;  3LDR A;  1KXG A;  2EIG A;  3V64 A;  1PGW 2;  3CIH A;  5D8A B;  5ABJ A;  3OYW B;  1OFN A;  1RUF 2;  2BGO A;  5CYY A;  4P9I A;  1RMU 1;  1DYK A;  1YFU A;  2AR6 A;  1JI6 A;  2BFU L;  4P9Y A;  5A7O A;  4LOS A;  1NCQ A;  1WWY A;  3OY8 B;  5IK8 A;  3GM8 A;  4I0B A;  1LHU A;  5DDJ 2;  1OD3 A;  3BN6 A;  5GKA C;  3HT1 A;  1SHW B;  4XAC A;  1ZZ9 A;  1NLQ A;  1SLL A;  2ZCW A;  4PF1 A;  2WS9 1;  1WLC A;  3MF9 A;  4N7I A;  3ZXK A;  3O0W A;  3ZPO A;  1DGR N;  3AZW A;  1NE6 A;  2VE1 A;  1MZ5 A;  4MGT A;  2AGS A;  2ZGT A;  3IPV A;  2ZEW A;  2Z79 A;  4A3Z A;  3TEZ A;  3OEA A;  4CDX B;  4COZ A;  2Y26 A;  1KS5 A;  1S2E A;  2R6Q A;  1QJY 2;  2LAL A;  2VPV A;  1BBT 2;  5GLZ A;  2XXZ A;  4IE5 A;  4DY5 A;  2IZW A;  4LKE A;  5CIR A;  1W2T A;  4Q4W 2;  3K46 A;  1UF2 C;  5CU1 A;  4XVH A;  2HWD 3;  2W94 A;  4RGA A;  3T0A A;  3QAC A;  1FMD 2;  4FPE A;  4XFB A;  3WG3 A;  3S7I A;  3N4M A;  3CZJ A;  2RJK A;  3ZYP A;  4ARY A;  1W6Q B;  4WBB A;  1KGY A;  2E6V A;  3NNG A;  3RJ2 X;  2C6S A;  1ONA A;  1H2K A;  4RYD A;  4XIL A;  3MW3 A;  4FI9 A;  2W47 A;  4Y4Y A;  3E6C C;  1W9T A;  3B00 A;  4YG6 A;  5CZK A;  1GP6 A;  5BV6 A;  2VBB A;  4RHV 1;  2D6O X;  4N53 B;  4KBZ A;  3TNQ A;  4BCU A;  5I0R A;  1ZZC A;  2XML A;  4FFG A;  1KIT A;  2YFZ A;  1AR9 1;  4Q8L A;  3DXT A;  3ZSL A;  2HJI A;  1V9U 3;  1JN2 P;  4P14 A;  4KU8 A;  4HK9 A;  2W1W A;  3AL5 A;  5FJH A;  1QQP 2;  1QJX 3;  2LW8 A;  1GYK A;  4W4Z A;  2G19 A;  1WBF A;  3EJK A;  2GH8 A;  3K77 A;  4L11 A;  1I3H A;  2R06 3;  1RUH 3;  2JD4 A;  3WV6 A;  4ASK A;  2LRP A;  1H30 A;  3PIJ A;  5I8Y A;  2Y6L A;  4HBN A;  5FAX A;  1O6U A;  2RS5 2;  3WF1 A;  2KR2 A;  5A6Z A;  2ZTN A;  2O14 A;  1OQE A;  2ZKN A;  4IE7 A;  3VBR B;  4BB3 A;  4X6R B;  1Q8V A;  2ARE A;  4NRQ A;  1GOF A;  1MEC 1;  1UY3 A;  2WNO A;  4Q0S A;  3BOP A;  1TME 3;  3VBO C;  1MVE A;  3UJQ A;  5F39 A;  1HRV 2;  4ZY9 A;  4NPL A;  1YLL A;  2HYK A;  2V4V A;  4TLG A;  5KC6 A;  4DRR A;  4CCL A;  2EXH A;  4CP2 A;  3SCG A;  5LEK A;  1JOD A;  3KV6 A;  3WQ7 A;  3OGJ A;  3MPP G;  3FUO A;  3WSO A;  3O1P A;  3UKV A;  4YPJ A;  3O5S A;  4E2S A;  4KG8 A;  1SBF A;  2X5I C;  1FYU A;  3LA3 A;  3N7J A;  1JZ5 A;  3HBK A;  3MIF A;  2P1B A;  2E26 A;  1OUX A;  1VP6 A;  2XLF A;  2YRO A;  3BPZ A;  4H55 A;  4YW5 A;  2H0V A;  2IXI A;  3THT A;  5JZG B;  4Q4X 2;  5FZ9 A;  2YHJ A;  3GZU C;  1PO1 1;  1J59 A;  4R8H A;  1OLM E;  5FZ3 A;  4QU1 A;  1NCR B;  4ZS2 A;  3NAP A;  3PDQ A;  1GWL A;  1DQ0 A;  5JDB A;  5DAW A;  2J1A A;  1PNG A;  1UOB A;  1PGW 1;  1JH5 A;  2W95 A;  5IFP A;  1RUF 1;  3A22 A;  3WVJ A;  4OI0 A;  3OSD A;  5A3P A;  1F2N A;  2A6V A;  1A8D A;  2H6C A;  5BNN C;  1AYN 2;  2X8K A;  2XWJ B;  1UPI A;  1JOP A;  3FE5 A;  1O4Z A;  3POI A;  4GKX A;  1C57 A;  1OLR A;  2HWB 2;  5D21 A;  5DDJ 1;  5IAX A;  2EA7 A;  4JDN A;  1XJA A;  3AFK A;  2YPJ A;  2XHN A;  3ZXA C;  4L0P A;  4FOW A;  4HON A;  3B7M A;  3H3U A;  3I2D A;  3ST7 A;  1E5I A;  3U10 A;  2WAB A;  1CAV A;  4K9S A;  4QXH A;  5LBE A;  1GWM A;  1PK6 C;  2VZS A;  4EZH A;  1C4R A;  3FWE A;  3RRD A;  3LIG A;  4NHX A;  4OHY A;  1RED A;  1CGP A;  2WC2 A;  2IXJ A;  4WVZ A;  1S0E A;  5L7O A;  3VBF B;  5HCH A;  1IS3 A;  4NIH A;  1QJY 1;  3JCI A;  1BBT 1;  2R0H A;  3UGG A;  1W0O A;  5F3I A;  4Q4W 1;  2VY0 A;  3RZK A;  1HN0 A;  3OBR A;  2BGC A;  3M1H A;  1FMD 1;  3ZN6 B;  5FZL A;  4LBQ A;  1SDD B;  3IDE A;  4O61 A;  3AJZ A;  5KHI A;  2BGP A;  4C90 A;  2A6Y A;  1QJF A;  2ATF A;  2ZGU A;  2A71 A;  4NHM A;  1C1L A;  5FMO L;  3FBM A;  2YXS A;  5FO7 B;  3GAL A;  4EN0 A;  2QQM A;  4ZU4 A;  1M06 G;  1RXF A;  2PN5 A;  3W9A A;  1AJK A;  4YZ4 A;  2A70 A;  5FZF A;  3BOW A;  4CDU A;  3JB8 A;  4JTN A;  1DQ5 A;  3AVS A;  5IUQ A;  4AW7 A;  4EWD A;  1HDK A;  2V5D A;  2PHD A;  1N3P A;  2CGO A;  1VAK A;  1COV 2;  1QQP 1;  2VQA A;  2Y6H A;  3GJA A;  2Y38 A;  3ZVX A;  5DUW A;  5HXM A;  1RVF 3;  4PIY A;  2VJX A;  1DCS A;  1OH3 A;  1VBC 3;  5GLW A;  3WP4 A;  3GHN A;  4AHZ A;  2VQU A;  3LGR A;  3KCC A;  2VUD A;  4AED C;  1VR3 A;  2RJL A;  1UWW A;  2RS5 1;  5KR7 A;  4DY3 A;  1D0H A;  1H9W A;  3IZO A;  4R9A A;  3W59 A;  2WQZ C;  3ACG A;  1W6N A;  5IVV A;  2HEY F;  1RUD 2;  1TG7 A;  1XYP A;  2BNN A;  4AEM A;  2Q1F A;  4XCB A;  5C4W A;  1WCU A;  1HRV 1;  4NUB A;  4Y20 A;  4E4H A;  4FBF A;  3TEX A;  1PO2 1;  4UT5 A;  1S2B A;  4FPC A;  4E2G A;  2PHU A;  3PHM A;  2WT2 A;  4LO5 B;  3SCF A;  4PDW B;  3FMG A;  3FZ3 A;  3VL9 A;  5A32 A;  1NYW A;  2DVF A;  4CE8 A;  3VKN A;  3CJI A;  1V00 A;  3PVE A;  3N36 A;  2DWR A;  4S2F A;  2BRT A;  4OLL A;  4D0Q A;  2XG3 A;  3T4V A;  2G1M A;  3DPR A;  3KT1 A;  2FD8 A;  2QQU A;  2Y34 A;  1FV3 A;  3ZXD A;  1H1I A;  2B7Y A;  3RNS A;  3ZSJ A;  1I5Z A;  4Q4X 1;  5CKN A;  3WF4 A;  4OHV A;  4R52 A;  3POY A;  4FP2 A;  4JDO A;  1UX6 A;  1F35 A;  1Z7S 2;  5FZ0 A;  1NY7 2;  3RZZ A;  1UIK A;  2FDI A;  3EO6 A;  3AP9 A;  2HWD 2;  1KJR A;  1W6O B;  1IQA A;  4OZO A;  3SMH A;  1D4V B;  5JAX A;  2UWC A;  3VLB B;  1IKQ A;  1BVV A;  4D8M A;  2JKX A;  1T6G C;  4GB3 3;  4A41 A;  3TYJ A;  1X36 A;  1AYN 1;  3AB0 A;  1F5J A;  4LO6 B;  2Z42 A;  3VDD A;  1RGS A;  2HWB 1;  2DF7 A;  2EXJ A;  4LLF A;  4QHB A;  3MO4 A;  4LHK A;  1VBD 3;  3AZX A;  3D0S A;  3PLQ A;  5CAD A;  4Q27 A;  3H8R A;  1X33 A;  2AZ5 A;  4WM7 B;  2NZ9 A;  4HT1 T;  1HXS 3;  1OA4 A;  3VZJ A;  1H2L A;  4B1L A;  4HLT A;  4A4A A;  4NHL A;  1V6J A;  2BNM A;  4DXZ A;  1WCK A;  1FAT A;  3P1I A;  4K1Y A;  1V9U 2;  3KT4 A;  2A3X A;  2NP0 A;  2UUR A;  5DAX A;  3J7H A;  5FUP A;  4NAO A;  3JU9 A;  1QJX 2;  1NQD A;  4Z2W A;  4C8D A;  1VIW B;  3VBU A;  1G9B A;  4Z82 A;  2HYX A;  2R06 2;  5KC5 A;  3EB7 A;  3H50 A;  4B4Q A;  5FO8 B;  1VBA 3;  1CJP A;  4A42 A;  1ENR A;  4OUS A;  4AQT A;  2X09 A;  4YAR A;  1Y9Q A;  4Q5O A;  1KFU L;  3RMY A;  4BQX A;  1JZ4 A;  5APA A;  3WG4 A;  4RS5 B;  4YW2 A;  2Z5W A;  2HEW F;  2R49 A;  3HAG A;  4IGO A;  3WDY A;  4C91 A;  1TME 2;  4YM1 A;  2EIB A;  1W99 A;  4QX1 A;  4YW3 A;  4AAP A;  2WQ8 A;  5DAP A;  3RYP A;  1F4A A;  5LRS A;  2WNU B;  2DCY A;  3NJY A;  1WW4 A;  2E33 A;  2HWF 3;  3I2F A;  1W8F A;  3UYJ A;  3PVN A;  1G8W A;  4K21 A;  4CCO A;  2XVG A;  5IVF A;  4WVM A;  2XJP A;  2PHX A;  1COV 1;  3B93 A;  1XQN A;  5AFE A;  3OJB A;  4YM3 A;  2GNB A;  4FFI A;  3ZIW A;  5FYV A;  4YGB A;  4HOO A;  3N9Q A;  1CAW A;  4LO7 A;  1FXZ A;  4BH9 A;  1TEI A;  1WLD A;  1ULF A;  1NKG A;  4UW6 A;  5ERL A;  4GMP 0;  2EIE A;  2XL9 A;  2QQO A;  2ZS6 B;  2Q8C A;  2VVF A;  2ZZJ A;  3BYW A;  4FXK B;  5GM0 A;  3WCS A;  3ZSK A;  4BA6 A;  2OZ6 A;  2W08 A;  4YG0 A;  1XOY A;  4AI9 A;  4XFA A;  1ST8 A;  1JYW A;  4Y24 A;  2XJS A;  3EQE A;  3PU3 A;  1RUD 1;  4HZF A;  5KHJ A;  1ZM1 A;  4I02 A;  1ENX A;  4XJU A;  4CP0 A;  3VBS A;  4JGZ C;  4X8P A;  5A7Q A;  3NNF A;  2ADD A;  4Q0U A;  4IE6 A;  1PZ9 A;  4I01 A;  1CZV A;  5FP7 A;  4QX3 A;  4RQP C;  5C5U A;  4NWW A;  4IEZ A;  5B4N A;  5IT6 A;  5I8T A;  3MID A;  2B46 X;  2BWA A;  2VMC A;  1NCQ B;  2ZGM A;  2ZX1 A;  3MHZ A;  3ZR6 A;  2OS2 A;  3AP6 A;  4LE4 A;  3WUD A;  2YC2 A;  1VE0 A;  4LEJ A;  1NAE A;  2W91 A;  4XEZ A;  4JHT A;  3I2O A;  2I2S A;  1OKQ A;  3TEW A;  1LHN A;  1SLA A;  2ZX0 A;  1OI6 A;  3U11 A;  2J1T A;  1CJD A;  1US2 A;  2YC4 A;  4NRP A;  4XE9 A;  3IPV B;  3MIC A;  5J96 B;  2Y6K A;  3RSJ A;  5JOZ A;  1GU3 A;  4BIF A;  3H42 B;  1SG3 A;  5F1R A;  2NMO A;  3OB8 A;  3R4S A;  3VKM A;  1W6Q A;  4PLN A;  1Z7S 1;  3FLP A;  3F2Z A;  2DDU A;  3WP5 A;  3OF1 A;  4QPI C;  1OA2 A;  4FOQ A;  2A6Z A;  1S0I A;  1NY7 1;  2J1V A;  4BIO A;  5JUV A;  3BOD A;  5GZE A;  4URT A;  3LDK A;  2HWD 1;  1ODM A;  5BNO C;  2WO7 A;  3ZO0 B;  4DIQ A;  5J3U A;  5A3W A;  2Y8K A;  3AM2 A;  1MZF A;  3QCW A;  1LB2 A;  2WT0 A;  1YI9 A;  3HPN A;  1N1V A;  4QB6 A;  5L9R A;  4CEY A;  3RVH A;  4QB1 A;  5C70 A;  2BBV A;  5T55 A;  2ZGK A;  3A21 A;  4LIT A;  4MZU A;  3KMH A;  3AYA A;  2RV9 A;  2VL4 A;  5FZ6 A;  4AVV A;  1ZYB A;  3ZYB A;  1MS3 A;  5C9A C;  5FOB B;  5LAS A;  1J3R A;  3NQH A;  1T2X A;  1BEV 3;  4P5Y A;  4YVW A;  1DIW A;  1V9U 1;  3T4H B;  5FZE A;  4GA9 A;  5A3O A;  1QJX 1;  3ZXG A;  1HQN A;  4BYY A;  4FFF A;  5BNP B;  1RVF 2;  3I2I A;  2JDZ A;  3LCP A;  2RS1 2;  4XCA A;  5FY5 A;  1RJ8 A;  2R06 1;  4NIA A;  3K4Z A;  2QQN A;  3PNA A;  2R32 A;  2VUA A;  4CA9 A;  1QNW A;  5IK4 A;  1POV 3;  1JXN A;  3BKZ A; 
#chains in the Genus database with same CATH homology
 1WZX A;  3ORJ A;  4CPB D;  2VXJ A;  1W8U A;  4LKF A;  5D21 A;  4AL9 A;  4BQ4 A;  4LK6 A;  3UT0 A;  2LRP A;  4LJH A;  4A6S A;  3ZYB A;  2C24 A;  1W90 A;  2LRO A;  1UOJ A;  1W9F A;  1W8W A;  2KR2 A;  2O14 A;  1GWM A;  3ZYH A;  2Q1F A;  4LKD A;  1WCU A;  4YW6 A;  4CP9 B;  4BQ2 A;  4CPB A;  1GWK A;  3ZYF A;  1GWL A;  2JWP A;  2K46 A;  3F95 A;  1V0A A;  2WYF A;  4YWA A;  1W8Z A;  1OKO A;  4LK7 A;  4BQ5 A;  4CP9 A;  4LKE A;  4YW7 A;  1W8T A;  1HN0 A;  4BQ3 A;  1OH3 A;  1L7L A;  1WMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...