2VXJA

Crystal structure of pa-il lectin complexed with agal13bgal14glc at 1.9 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
b'AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I GALACTOPHILIC LECTIN
molecule tags Sugar binding protein
source organism Pseudomonas aeruginosa
publication title Structural Basis of the Preferential Binding for Globo-Series Glycosphingolipids Displayed by Pseudomonas Aeruginosa Lectin I.
pubmed doi rcsb
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2vxjA00
1W8UA 4A6SA 1W90A 2WYFA 4CPBD 4YW6A 1OH3A 1OKOA 4LKFA 1WCUA 1W9FA 2JWPA 1UOJA 2O14A 3ZYHA 1WMXA 1HN0A 2LROA 4LK7A 1V0AA 4BQ4A 4LK6A 4LKDA 5D21A 4BQ5A 1GWKA 1GWLA 3F95A 4YWAA 1WZXA 3UT0A 4CPBA 4CP9A 2LRPA 1W8ZA 1L7LA 2KR2A 2VXJA 4BQ2A 4LJHA 4AL9A 2C24A 1W8WA 3ZYFA 2Q1FA 4LKEA 3ZYBA 3ORJA 1W8TA 4BQ3A 1GWMA 2K46A 4CP9B 4YW7A
chains in the Genus database with same CATH superfamily
2WZ8A 1Y43B 1BYHA 1O4YA 4RQPA 1O4ZA 5K0UB 5DZGA 1C57A 3RSJA 3KZ4C 4IV3B 4I09A 1IPJA 1PVC2 3BN6A 5EFUA 5FYBA 1AHSA 4HKLA 4IEPA 1VBC1 1TME2 1OURA 3GNEA 4W4ZA 5CEHA 3BYWA 3D5OA 5GZDA 5L19A 2Y6JA 3K46A 1B35C 5LY1A 5CKQA 3C2UA 1YFUA 1GZWB 1QMJA 4GH4C 3GDBA 3SH5A 4UW6A 4YG0A 1Q8QA 5BNQA 2LS6A 2WNEA 1HRI2 3OBAA 1IS6A 1R1A3 2D3PA 3E5UA 1ASJ1 2VZPA 4NHXA 1HLCA 1D7PM 1LHNA 2JG9A 2WABA 4RHV3 1UY2A 3J26N 1MS9A 4ORFA 2LALA 4HXCA 2A6ZA 1F4HA 3PVOA 1ENQA 4ZPIA 4MO3M 1G8WA 5FO9B 4Q29A 1O4TA 2WO3A 2WS91 2XVGA 1W06A 5K0UC 2R0FA 2RM22 3UT0A 1ZRFA 4QPIB 4UOJA 3RMYA 3U14A 3WQBA 5F3IA 2LW8A 5ACA1 3VDDB 5L73A 2GSYA 3WR0A 4XIOA 2E7AA 2ZKNA 5BNNA 1SBEA 3IMNA 1AR91 1B35B 1LGBA 1BEV2 3I54A 3MYXA 5HCFA 5F2SA 5C5TA 3ACIA 4EWEA 4CEWC 3SEEA 3ON7A 2W46A 4QU1A 4CU8A 3AXDA 1DGLA 1UY4A 1VRH1 4JRAA 3BALA 4QM8A 2VTXJ 1S2EA 4IETA 1VR3A 5IUQA 4ASLA 3M7AA 3JXSA 4GD4A 2DFBA 4FTBA 1YNAA 4NN0A 4Y1ZA 1JHNA 3VBRA 3IPVA 1LU1A 1RUG2 4TXWA 4JQRA 5LRRA 4AK3A 4XXPA 4B4PA 1JOPA 2GNDA 3KLSA 5FK8A 4W8JA 5GKAC 2QFEA 3O12A 5FP9A 5F5CA 1LHWA 4AI3A 4ATEA 5DDJ3 4O65A 4OVEA 4Q4V2 1WCKA 3NKGA 2IXCA 2I45A 3NW4A 4PCRA 3KT1A 5A7PA 4CEYC 1RUH2 4AQSA 3OGJA 4FPCA 5HBAA 1W28A 1H0BA 2VECA 1CWPA 4Q27A 1POV3 3VHRA 2XOMA 4CEWB 1H2MA 5ABJB 1R083 5JIUA 1AR92 4E8CA 1RUD1 1SCSA 2DVAA 2ZXQA 5FP8A 3I3QA 3VD3A 2OZ6A 3KT7A 3VBOA 1C28A 4R52A 4GALA 4X6QB 1W99A 5AVPA 3RYKA 4BQYA 1WKYA 1IZ3A 3A22A 4HK8A 2ET1A 3TN93 1PZ8A 1ODNA 1GICA 2ZZQA 1JUHA 4CP9A 4TLFA 1PGL1 2GC0A 4CA9A 2KR2A 1EAH1 2GDFA 3VBFA 3V0BA 2V4AA 4Y4RA 4Q4W1 4Z92B 2BOIA 3VBFC 4XILA 1Q8VA 2A75A 2RE9A 1A78A 1MEC3 4CCDA 3TEWA 1QNYA 1XNBA 3MPBA 1MZEA 3UKNA 5CB7A 3JBG2 1DZQA 1W9YA 2WT1A 4LKFA 5KXDA 3AXEA 1FNZA 1NZCA 2JDHA 2YUEA 3WDUA 1I5PA 1UU6A 4Y20B 1ND2B 4NMIA 2RJLA 1U12A 3B69A 2PXJA 3GJBA 4LUMA 4X8NA 1GWKA 4XJZA 5L9VA 1DZRA 2HWF1 2J1EA 3O1PA 2Y60A 3WQ7A 5I0TA 1OVSA 4IGQA 2DUOA 1DG6A 2R49A 2W0XA 4GB31 2Q1FA 2IXLA 4YM3A 4XHBA 5AFBA 2VTXA 4XZPA 5BXXA 1CAXA 1Z7S1 3U10A 3OPWA 4M0HA 1H6XA 1RUH1 2DCZA 4BQXA 4LULA 5FQ0A 1JYCA 4IEOA 1LOFC 1FI2A 3FX3A 4CUBA 5LK7B 4KBBA 3B94A 3AM2A 3ZFFB 2PHFA 4OFGA 1ZA4A 4XAAA 3ZDVA 1HJGA 2ZGUA 3NNGA 2D6MA 3ZFGA 4D69A 4AAPA 5AC91 2X5IA 2XWBB 3VHNA 4RS5B 1DYKA 1UYZA 2HBUA 4LHKA 2YBPA 1ND2C 3NV2A 2XHNA 1ZYBA 1REDA 1ZZ7A 3K75B 3KGLA 3M3IA 3THTA 4XMAA 5LK5A 2BVVA 3MLJA 2TUNA 3ACFA 4PF5A 2WL1A 4QXBA 5FZOA 2WWUA 2Q8OA 4EN8B 3BUCA 2Z69A 4CSWA 5DAVA 1W8NA 3FUQA 2HWD1 4FO9A 2K2SA 3AMMA 1ZZ6A 2NYYA 3HT2A 4XMIA 4D6RA 4Q2FA 4Y1YA 3OBZA 2WZEA 1WA6X 5T5PA 3ZFFC 2EXHA 3PDQA 1VE0A 2ORXA 4M4PA 1OSGA 3LA3A 4XF9A 2WZPP 4RS5C 3LCPA 1VRH2 4H7MA 4OMCA 1G9FA 3E97A 4HVRA 1RUI1 3TAYA 5T55A 1WLWA 3RG0A 4DXSA 3RJRA 4OZOA 3KM5A 4JGZA 2DVBA 1VBC3 4MXVA 4JGZC 4U36A 3TRSB 3VKFC 1HB2A 3RWNA 1I5ZA 3WQ0A 1QH7A 3I59A 2ZX1A 1XRUA 4IGPA 2FD8A 3RI8A 1NE4A 3O0XA 1SFYA 2Z2SB 4B7EA 2OIIA 4MX3A 4RR3C 5C8CC 4IDZA 1CQ9A 1CAUB 4UW5A 1QF3A 1XJAA 2ET7A 4P9IA 3PLQA 2A5ZA 1HRV3 1N1TA 3A0NA 2PN5A 5CISA 2GMMA 1PO23 1JOBA 4Q4Y2 3S57A 4PIXA 4LA2A 2HEVF 3N7JA 3PTYA 3N9PA 4BM8A 3K3NA 1UIKA 3PMEA 4V2WA 4LUKA 5C3RA 2BFUS 1RUI2 2I07B 2J1SA 1S0CA 2YBKA 4Z2WA 2WN2A 2HWD3 3AKPA 3KV5A 3MFCA 5H9PA 1DZTA 5BPXA 1FNYA 4XCAA 1YJKA 4EN9B 2GZWA 1PMIA 4KG8A 3WW3A 3QOPA 2O14A 4K20A 3WNNA 1JODA 3ST7A 3CEWA 4IEQA 5FYHA 1DGWX 4NVPA 1QU0A 1DGWA 2J1VA 1E5SA 3HVDA 2GC1A 5A3TA 5GZCA 1X36A 3OSDA 4LHLA 2WLQA 1W8OA 5C8CB 4WM8C 4XAEA 4BH9A 4E2SA 3R05A 4QPGA 5GLVA 3PVEA 4ZXEA 5AC93 1YJLA 5DAQA 3VL9A 5CBLA 4B1LA 3WG2A 3ITQA 3DPRC 1TE1B 1JYXA 2CGOA 1NUKA 4Q4W2 4HLTA 2PHWA 1RUF2 1KXGA 2O8OA 5F1RA 1VBA3 4F8AA 2ZEXA 4RHV1 2VM9A 2C5DA 2XQRA 4AI0A 4E4DX 4YVWA 5E8AA 1C8M3 2A6WA 2D97A 3CHXA 4XJ9A 5A70A 2Y64A 4CPBA 3NNJA 3ZYGA 1Z78A 2EAKA 3BB6A 1KEXA 4GXLA 3DKWA 4DY3A 2G9ZA 3OUHA 3OY8A 4JHTA 1JN2P 2ZEWA 3V0AA 1W6QA 3HQXA 4CCCA 2D6KA 1AR73 4Y5SA 5FP7A 2VNGA 2VQ0A 4YFWA 1ULOA 4XFGA 3KD4A 4HETA 4MXWB 5JMOA 3FBYA 4AR2A 3OEAA 4Y3OA 4BZ4A 3O1OA 3ZSJA 3O1MA 3OGGA 5LA9A 1W9TA 2NQYA 5FOJB 3VLBB 3AYDA 3O1TA 3ZIXA 1UKRA 5C70A 2BVBA 3F95A 4NOTA 1BMV1 1AYN2 1LODA 1F5JA 3WG3A 4DO0A 3C8XA 4J6GA 2ZGRA 2UY8A 4IW3A 4Y22B 5EJ1B 3N4MA 1C5HA 2RDQA 1S0DA 5K7PA 5A33A 3ZMOA 3IWZA 1GSLA 3U37A 1VB2A 1KGYA 4IERA 4XJUA 4XF4A 3ZYPA 1H9WA 5ANNA 3PUHA 2ARXA 4KMQA 5CA6A 2MEV3 4CCMA 2W91A 1QNWA 4YLZA 2YB7A 4GMP1 4FAGA 2BERA 2JDUA 2Q1MA 4JCKA 1PVXA 2G9GA 1NLQA 1F9KA 5E88A 2UWAA 4SBVA 4GULA 4NRMA 2A71A 3PJYA 4YM1A 1PK6C 5CFDA 1BK0A 2HJIA 3KWVA 1AX0A 4H2AA 5CVRA 4COYA 2IFWA 3ACLA 4YVSC 4Y33A 3H9AA 4WVVA 1TNFA 3WCRA 1KJLA 3MUY1 5J36A 5DABA 4OI2A 1NA1A 3ZN4A 5IHRA 3W21A 4WM7A 4LJHA 5DXDA 3KCCA 4CU9A 3FHQA 1VB4A 4QX3A 5LBEA 5JSPA 2DU1A 4KH9A 3FZ3A 3ZX7A 1D2QA 1JZ8A 2RM23 5IWFA 3SCHA 5B4NA 1JH5A 4QPWA 1S0GA 3BOWA 1YYNA 2CWSA 2PAEA 3B7MA 1CAWA 2XVKA 4OLLA 4Y1UA 3M3CA 3WW2A 2WAAA 4LBKA 1C8NA 1LR5A 4DPNA 4Q26A 3MV01 4LXLA 3ZXKA 2QQOA 2X09A 1V9U2 1EY2A 3HPNA 3VBUA 2JG8A 3X29B 2WS93 2WT2A 4NHMA 3JCIA 1WA4A 5BV6A 2R063 4ARXA 2VZTA 1LAJA 4XABA 3BTYA 1BQPA 3JD72 4CDWB 1UYPA 1ASJ3 1NKGA 4W65A 2QBXA 1SFNA 3GBGA 5FYTA 3ZXFA 1K5JA 1AXYA 2WQZC 1KDKA 1NE6A 1TMF1 4YZ1A 1US2A 5HV4A 5L7OA 5BNOC 2AC1A 1ALYA 4CP2A 2UY9A 3ZYRA 2VZQA 3VV1A 3TOJA 5LA1A 1X82A 1VAKA 3M3QA 3PL0A 2HWC3 1SPPA 2DTWA 2D44A 2WO1A 4YWAA 2TBVA 5FPBA 3T2QA 2NLRA 1AR62 3OGVA 3ZDSA 5KHGA 2BWCA 1JZ6A 5DUXA 4QKBA 4RQPC 2JB8A 2GC2A 2Y38A 3AKRA 1FT9A 1RUJ3 3QLQA 3J9SA 5GLWA 1UOFA 1LB2A 3DGTA 1ZM1A 3K51A 4AG4A 2BBVA 2QQWA 3I7DA 1XPWA 1PGW1 2XLGA 4I30A 4XJ8A 5SV5A 3UESA 3TN92 3VZOA 5JDBA 3L2HA 4D94A 5FYMA 2WO7A 2WQ4A 4CE8A 1QY4A 3I3DA 5A7WA 5FZKA 3GXUA 3H8XA 3MW3A 3KV9A 2PAKA 1JYNA 4SLIA 3R4UA 2PQSA 3T1MA 2YC4A 3VDBA 5IAXA 3AZWA 1VPHA 3LEIA 4TYSA 1BBT2 1DGRA 3JUUA 4H3WA 3VD5A 1OVPA 1PM4A 3MZHA 3I2HA 1OLMA 4S2DA 2I2SA 1PK6A 4MVTA 4GB32 2YG0A 1Q8OA 2N7GA 3NNLA 3PUQA 5KC5A 1S0EA 3J7HA 3GBWA 3LA7A 5JZGC 1M06G 3U1XA 1W6OA 2ENRA 2YYOA 3HD8B 4LHSA 2PYTA 2VMHA 2XHKA 1RUNA 1UKGA 2VVDA 5LATA 3N9LA 2DVGA 4Q0UA 4Y5TA 5FZ7A 4E2QA 4CCOA 2B7YA 3BODA 4ISRA 5FYYA 5JPNB 3CZUA 3E6DA 3HQRA 4FOWA 2JD4A 5FZ6A 2ZOEB 1UAIA 5F3EA 3ROUA 3DEMA 3AMPA 3MGUA 3VZMA 2AEYA 1F15A 4KBZA 5IAVA 4MGKE 5FZIA 1QQP2 3A0KA 2JB4A 2P3KA 1HN1A 2BNNA 2R042 4LTAA 3GALA 1LOAA 1NT0A 1QEXA 4YPJA 2XG3A 3TNPB 1NY72 4B1MA 1VBB2 2XH6A 1K3IA 5A3OA 2R1BA 1GLHA 2ZACA 5LCWL 3ZSKA 1COV2 5FREA 1CJDA 2R0HA 3ORJA 4IEYA 3K3OA 1QJU2 5JR2A 3H8UA 1XNKA 2GH2A 5JZGB 3IDBB 4CDUB 4NIHA 2BYVE 2VUCA 2IFRA 3IBMA 5FZCA 3AJZA 3MEPA 1LJ7A 2V5YA 2VOKA 4QX8A 4ZS2A 4ASKA 4LKDA 1ZBA2 1QJX2 3PIJA 4PDWA 3KMHA 4Q0PA 5FO7B 2D6OX 4BOWA 1JZ5A 1MZ6A 4BWOA 2AUYA 2CY6A 5DAPA 1AX1A 4RL7A 2P3IA 5A6QA 2V09A 2H0VA 2FCVA 2AENA 3WF3A 1OOPA 4ZU4A 2QDRA 2R072 5A6XA 5C71A 4GZ9A 4O9GA 4YZ2A 1WCDJ 3KSCA 3L2YA 1XYOA 1TME3 2PTMA 5EZWA 3U78A 4DUVA 3FUOA 3DPRA 4K8FA 4NPLA 1DLCA 5FJKA 5FPUA 4QGMA 3WHUA 3PIGA 3ZOIA 5DAXA 2ZPXA 1JTZX 4LIUA 1UXXX 4WM8A 3WF2A 3BVCA 4QGNA 1O7FA 5DQ0A 4FSJA 1XNAA 3GHNA 1R1A2 4G9SB 3DXTA 3DKQA 4IUGA 5HXVA 3OOXA 5FYIA 2RS52 4E4HA 2GC3A 5F39A 3ZN6B 2WA4A 4JGYC 4ZZ5A 1VBA1 1FX5A 1K42A 2ZAAA 4BJ0A 5FMOL 1YO8A 5GLZA 1BVP1 4I02A 4FFFA 3N9NA 4H55A 4JRLA 3T0AA 3WNPA 2RM21 2EIBA 3EYPA 3LEKA 4HKWA 1AL21 1OH3A 4D6SA 1PO22 2K9ZA 3VB9A 4LOSA 3NKTA 5KXEA 3VBSC 5EP9A 4BK4A 1H2NA 1OD3A 3LF7A 3GM8A 3ZR6A 2A3YA 2Q0AA 4NUBA 3NV4A 4AEMA 3FBMA 1PGW2 2OX0A 2XJQA 1RUG1 5IFPA 2PELA 4QHOA 2QQJA 2OS2A 2VXRA 2XJVA 1W0OA 4RR3A 5IK4A 2SBAA 5A7OA 3PUIA 2E6VA 4YG6A 3KVAA 1JHJA 3LB9A 3WNKA 4C90A 2H0BA 2WLPA 1OLME 4A7ZA 4JGYB 2E51A 2K0GA 4ATFA 1GNZA 2IVIB 4A2UA 3RGBA 4F7ZA 1WCUA 5J96B 2XMLA 3AKTA 3E5QA 3UK9A 3DN7A 4QKFA 3WDVA 3MPPG 5DDJ2 1SCRA 2ZHLA 2R16A 4Q4V3 1QJY1 5A7WB 3EXUA 2Y6HA 1MQTB 4L2NA 3CO2A 5H9SA 3UNPA 5FO8B 1HRV1 5FPAA 3O1UA 2VW2A 4Q4W3 4XBQA 4HK9A 5KHJA 1DDLA 3VD7A 1XBFA 3H42B 3BIEA 2JDNA 2EVXA 5DUWA 1RUE3 1X9PA 3NAPC 4P9JA 4AI2A 1SMVA 1WLCA 1DIWA 2H6CA 3AL5A 4COUA 3WINE 1SPPB 3POGA 3MICA 3ABZA 1UZWA 2WFPA 4NRPA 1OBNA 1UD1A 1J3RA 2IXHA 2VMDA 1YC61 3PURA 4EE2A 2X10A 1MS5A 1TQ5A 2GNBA 1IKQA 1GP4A 4OHVA 2VVFA 3IKWA 1WBLA 4HMZA 1RINA 4Y1VA 2QZ3A 4QB1A 2W95A 2CGPA 2WSUA 3JQXA 1UQXA 1Q3EA 4YW1A 3RFRA 3RYRA 2VZ3A 3ES1A 2JE8A 3LPFA 1HXS2 3SMHA 5FK7A 4AFAA 1OQDA 5IYYA 4OULA 1W0PA 4DRRA 1WMEA 3WQ1A 4MGSA 4CDXB 1O3QA 2JG8B 4FPKA 4CVUA 5D8AA 5C3QA 2P6CA 5FZ8A 2VC9A 3NAPB 5A3UA 5DMYA 4WVMA 1E57A 2CDPA 4P9GA 4ASMB 1W6MB 3SXWA 5IFTA 3HNBM 3LPGA 4K7JA 1CAWB 2XJUA 1WCQA 2PHXA 2QCSB 3O5SA 1FMD3 2PMWB 3BCWA 2RV9A 4WVZA 4A3ZA 3QH7A 4XPVA 2CAVA 3ZSLA 1JU4A 3CNAA 5LB6A 2JJ6A 2XB6C 2D3SA 1IHMA 4JZRA 3VKNA 2FMYA 3ILFA 4FPJA 1ZZ9A 1JZ2A 2WINB 1XSQA 1ND3A 3IB3A 2GMPA 4YZ4A 4WM7B 1W8TA 2GNMA 1CZVA 4EWAA 5DG2A 1S2KA 4PLMA 1NZIA 4TSVA 3THCA 4YW4A 1DQ4A 3KV6A 1MVQA 2ZX4A 3USSA 1HB3A 3WNXA 2JDAA 5CFDB 4QB2A 3BOPA 1YCIA 2FDJA 2PLV3 4ISQA 2YPDA 2C0ZA 2A70A 5F5QA 1EUTA 3AMHA 4META 4P9LA 4QHZA 1MEC1 3WD5A 2WNUC 3GF6A 2W52A 3PJQA 4U2AA 3B5LB 5A3WA 1XQNA 4JHZA 4UYBA 4C0HA 1AJKA 5CFCC 1LOCA 4DEVA 3OYWB 1MACA 4XZUG 1SZBA 5FZ0A 1QXJA 5A33B 4EWDA 3SHRA 1L3JA 2P37A 3I2DA 5JLVA 4AGVA 1OD5A 4FTSA 2G9FA 2R1DA 4P9XA 4CEYA 1V9U3 2XKOA 4HVOA 4IGOA 4N43B 1ZZ8A 2GMEA 2PHLA 4LLFA 2PAMA 5JWPA 5CFDC 1ZVFA 1YI7A 2AZ5A 4AVVA 3A7QA 3NJXA 5H9QA 1SACA 2BNMA 3D0JA 1VBC2 4KL1A 3GHMA 3POYA 4ZXKA 2ZZJA 5C3OA 2FQPA 2VZUA 4PI0A 2FDIA 4PLOA 1HRI1 3LA2A 4CUCA 4FP3A 4AI9A 3ZYFA 1ULFA 2JECA 3THDA 1L7QA 1Y4WA 3V0AB 5FYSA 2X29A 3UV9A 1MS0A 2G4IA 1VIWB 2AACA 4ET7A 5GLUA 1I6XA 3U07A 4UFMA 2JE7A 3KQRA 2JXAA 4XFCA 4YVWB 2XLAA 2ZGNA 1V6OA 3IT8A 1VBB1 4Q4Y3 1UOJA 1AL23 3MLKA 4OUEA 3MLLA 5BNNC 2VZRA 4L97A 3HR9A 1OKQA 3A21A 4LK6A 4OQ8A 3OCPA 1LRHA 1BK1A 3AX4A 3NL1A 1G9AA 4R9AA 2Y6GA 2E9QA 4BPZA 4AVCA 2XL9A 2W1SA 3O14A 2OZJA 1V6NA 1XXNA 3VZLA 2WO2A 4BLIA 1OF3A 1S2BA 1LU2A 3ILRA 1DLLA 4WBBA 4URAA 1ULCA 2IUWA 1AZDA 4QX0A 1ULDA 2ZMNA 4ZS3A 5JXIA 5FMBA 4CZSA 3VDAA 1XE0A 4A7YA 4PBOA 2HWF2 1RC6A 2OPKA 3U75A 2E32A 4LITA 2VMIA 3LSEA 1ZRIA 1N3OA 4GB33 4GH4A 4KGGA 3WP4A 5IK8A 1LULA 5G04L 4OHYA 5G05L 1LESA 3H7JA 1CIYA 3NWKA 4AE2A 2QKDA 4JKMA 4AEDB 4C8DA 1YEWA 3UGFA 3WEZA 3IAQA 4EV0A 5EQUA 2OQ6A 2G1MA 4J1XA 4RFT0 2ERFA 2WYSA 2QQLA 4E4SA 3I3MA 4FPYA 4QDQA 3CIHA 3NV3A 1C8M2 3MO4A 4LA3A 3FHIB 1LEMA 4FOQA 4ZONA 2QQIA 2WA3A 4F83A 4BLJA 5F3GA 3IIAA 2JE9A 3AZZA 4LNVA 2R041 5DZEA 3W59A 1OHFA 1LHVA 2GN7A 4MH0E 4P5HA 1COV3 4IESA 4NR1A 3TB0A 1ULPA 5A3PA 1YQCA 3I59B 2OKXA 4AEDA 3FWEA 4FPOB 3Q8EA 1QJU3 2EIDA 2GP5A 2P3JA 1RGSA 3WT3A 5A3NA 4BXFA 5IVFA 5C4WC 2JDPA 5C9AC 3LFMA 5A6YA 1DBNA 1H4GA 2Q1ZB 3P3PA 4GH4B 1CESA 4P9YA 5I0RA 2DTYA 4QX5A 1SBFA 1UYYA 2BGOA 1UF2C 1J1LA 1XNTA 1C1LA 3SNMA 4K21A 4G4FA 2XGXA 2O8QA 1V70A 1ZBA3 2OVUA 4NHYA 2VW1A 4Z82A 5CNAA 4P02B 5A3LA 1CPNA 2HWE1 4LMFA 4Y26A 3VHPA 1PVC1 4Q1RA 4QMAA 1YQ6A 1IOAA 1LOFA 3FL7A 1O3RA 1IGOA 2WNOA 1IQAA 4AVSA 1UOGA 2R073 4QPIC 2XWJB 3MIHA 4C1XA 1XSRA 4PLNA 5H9RA 2MEV2 3MIGA 1WD3A 3VDDC 2J1RA 4KQ7A 3I97A 1CZSA 3T3YA 3RZKA 2C24A 2RS11 1QJZA 1O8PA 1R092 3MI8A 3PVNA 2VZSA 5DUVA 4C91A 4CCKA 4M3CF 1EV13 1S0FA 4XUPA 5IATA 4XURA 4YGBA 1DF0A 2R6QA 4CYDA 3POWA 3WG4A 3J7NA 2W92A 4COZA 5FLIA 3HNMA 5A7NA 2WFF1 1SLAA 2HEYF 2FDGA 2X5IB 4DUWA 3D3AA 1AR81 3ZFGB 1JUIA 4D7SA 3ZFFA 2VMCA 4C0BA 3CMGA 1BJQA 1IG3A 4OHWA 3M8LA 3ECQA 2RJ2A 4Q8LA 3AKQA 3W5MA 1CAXB 1XYNA 4RSUA 1UWWA 1FOD2 2EXKA 1UW8A 3GGLA 4N43A 2XLFA 4CTEA 3KHCA 2A3WA 1DQ2A 1EAH2 2HYXA 4CEYB 4QQLA 1SDWA 1DYPA 1CIWA 1SG3A 4YW7A 5ABJC 3O1VA 4LO8A 5CG9A 3A4UA 5JAXA 2VCCA 2Y0IA 3MV11 1RIRA 3NJYA 3I4IA 3QD6A 2PHUA 3M3OA 4HANA 3INAA 3OYWA 2L9LA 3H1WA 3LAGA 2EIGA 2X5IC 3N9MA 2B8MA 3HQUA 4EN7B 2JX9A 5LEJA 1SFPA 3JD73 4IEZA 3CLPA 2R061 1ASJ2 3ZLIA 3CL1A 1O5LA 2X05A 2B5HA 1XC6A 5I8SA 1MVEA 4AZZA 3NJVA 3MW2A 3VBFB 4KNCA 3H8RA 5FMCA 4NIDA 1FPN3 2E31A 2UYBA 3AVSA 4PBPA 2HWC2 4CP9B 1VBD2 1W2AX 3NVCA 3B02A 5J98B 4LORA 4JC1A 3OUIA 3U11A 5HV0A 2DCTA 5FMDA 1ND3B 2R7EB 3K2OA 3ZMNA 5FZAA 3VBOB 3H1YA 3UYJA 3LKJA 1WW4A 1HN0A 1OPOA 2HWB3 4DINB 1C5IA 4RGKA 2O0OA 1US3A 1J3QA 4KGQA 3O1SA 2JIGA 5FY9A 5J37A 4NHKA 3FC0A 2F4LA 1L7LA 4PQ9A 5KHHA 1BKZA 2WR9A 4DRVA 1W9SA 2QNKA 2RHPA 1HB4A 1W6MA 1W04A 2W1UA 4L99A 4XDQA 3OPTA 2KA3A 1UN1A 4WVMB 2C9AA 1YIFA 5FYCA 3NAPA 4IXLA 4B4QA 5ACA2 2D40A 3J4UH 3RZGA 4GKYA 4O9EA 2BUKA 1VAMA 2ZGKA 4GA9A 4IE6A 1BBT3 4B8EA 2XR4A 5D8AB 5HI0A 4CDXA 2ZABA 4BMBA 3IPVB 3VBRB 5C8WA 5FYZA 3V65A 1HXS3 2JG9C 1ODMA 2XXZA 4OCTA 4W6YA 3EO6A 5ANQA 1ND3C 2OUHA 4B4RA 2VMFA 3VBOC 5J1XA 2VZ1A 3I8TA 3RRDA 4OMDA 1H2LA 5FWEA 4A4AA 3L9JT 3QCWA 2EICA 1QOTA 1E5IA 5FXZA 4AFCA 5A6ZA 3K4AA 2DV9A 2Q4SA 4M4RA 4IE0A 2RR12 3P1IA 3Q8BA 2YU1A 3KS7A 4Y5Z0 2EALA 3S0MA 1ZRDA 5FZLA 4JKLA 1FXZA 4OI4A 3KHBA 1Y9MA 4D7YA 1SBDA 4OI0A 3AYCA 3VDDA 5JXJA 3RQ0A 1BZWA 1CR7A 1PIV2 1U0AA 1BVVA 4UFJA 1JMUB 5I0SA 1C1FA 2MEV1 3LWCA 2R043 2DWRA 5BNPC 4QQHA 1W9FA 5D8AC 1G7YA 4AFDA 2BW8A 1V9U1 4J1WA 1V6IA 2D6LX 3VBRC 2JG9B 5D21A 4JX0A 1MQTA 1O5UA 5JOZA 1QJU1 1UU5A 1UCXA 1W05A 2QVSB 5KC6A 2D3RA 4CXWA 3A23A 4XTPA 3HN3A 3T30A 4MHUA 3NJZA 2V72A 2AREA 2VCMA 2A3XA 4JQTA 2D5HA 1D4M1 2CGNA 2XJSA 3O0VA 1IS4A 4QB6A 2PLV2 1WWYA 4HONA 5LASA 3K77A 3WDXA 1AYM2 2NM1A 4FQZA 4BK5A 2Y6FA 4JGYA 4ARYA 1QJX3 4PQQA 3N35A 4IV1C 5A1AA 2JKXA 4IQPA 2P17A 5FPLA 1MPXA 1J59A 1O3SA 2QUOA 5GM0A 5K0UA 4RR3B 3ALQA 4Q4X2 4UT5A 4YW3A 5IVVA 4MGZE 3QACA 1W2TA 4XJWA 3UETA 4NHLA 5F7UA 1LOGA 4BHPA 1H4HA 2WBKA 2Q8DA 2P6HA 3WHTA 1VAVA 4Q1PA 4MLOA 1QDCA 1QWRA 2IZWA 5A7SA 5JXGA 1GOGA 2DUQA 3ZFEB 1FV3A 1OQEA 3KF5A 4FFIA 3S7IA 5GALA 5JUVA 2YFUA 4PIZA 1CAVB 2ZKLA 3N7MA 5FRAA 3BPSA 4FPEA 4QKNA 5I8TA 5FLJA 2DUPA 1U5ZA 1OOPC 1WUVA 4LOTA 1YXWA 4LQRA 5CZKA 2J22A 1NXD1 4MUVA 4A45A 1YQ8A 3KF3A 4GMP0 4QT6A 1EV11 3ZN6A 4QKDA 2JEMA 3FMGA 1VALA 2RS53 2WZR1 3WUDA 3OG2A 2WKKA 3AP4A 4LK7A 4N9IA 4N7UA 1QIQA 2DCYA 4F3JA 4AI1A 4E2GA 1UX6A 5FP3A 1W8ZA 2XUMA 1FATA 4H7LA 4WM8B 2JKBA 4UW4A 2GNTA 1PO21 2ZMLA 3ETPA 5JOYA 4HN1A 1MZFA 5LA0A 5SV8A 2BGPA 1DU3D 3DPRB 3ZFEC 4EN0A 3VD9A 3BKZA 2C9KA 4IE4A 4QQPA 2YGMA 1YFWA 4PJYA 2RJKA 5J3UA 3O7OA 5FJHA 1BEV1 5KR7A 1OOPB 3DCQA 4R4ZA 4CCEA 4XFAA 5DZFA 2R30A 4NIAA 3WNOA 4WZCA 2IXIA 3D8CA 3KQ4B 3K4ZA 3KV4A 5T54A 4A41A 3VZJA 2RS32 4PDWB 4MGTA 2QQNA 3UKVA 1I3HA 1GQPA 2ZS6B 3B01A 1WCSA 5F5AA 4DY5A 1GZTA 2R32A 4DFSA 3C3VA 3AKSA 1LCLA 1OA3A 3JZVA 4XACA 1ST8A 4HVQA 2P4EA 4HSJA 1QH6A 4LKEA 4CDUA 5JZGA 5FAXA 2ETEA 4M3CB 2CYFA 4XJAA 2W5FA 5I0UA 3ELNA 3AYEA 1IPKA 2W9XA 2VH9A 1OLQA 4Z07A 4WV8A 1CX1A 1W6PA 2UYAA 4V1PA 5FZFA 1GNYA 3N9OA 4ONUA 5HXMA 1PGSA 5J09A 2Z5WA 1RUE2 5DN2A 1NCRC 2X53S 5LBCA 2VCBA 1LHUA 2DFCA 5F6KA 3CJIA 3KB5A 5AFEA 4Q0QA 1PX3A 3NV1A 4ZU5A 1QXPA 4LPLA 5JMCA 4K40A 5E89A 3VZKA 2XBO3 2PQQA 2ZGQA 1GOFA 3ACGA 1F2NA 1R64A 1IS3A 1APNA 4ZU7A 5IW0A 1LENA 1W6OB 3K4DA 2J1UA 1HV1A 1RB8G 1K12A 1W8UA 1CX4A 1GQHA 2AH2A 3AP6A 3B9IA 3C7OA 2W94A 2YMZA 2VOWA 3S30A 3UL2A 1WGPA 4NROA 3U4XA 4V2VA 2CL2A 1K5MA 1PK6B 1WD4A 1WW7A 1ZZBA 2VUAA 3N9QA 2P5BA 2C4XA 3AZXA 1F4AA 1Z7S3 5L7OC 1HB1A 1RHI3 4JAAA 4UWDA 5F37A 3V56A 1UYXA 4XUQA 3UGHA 4XFBA 1SHWB 2VMEA 4QX7A 1QOOA 4CXXA 3JB8A 2BTVC 4YW2A 4IE7A 2RDSA 2OYZA 3RMXA 3K48A 3M4FA 5CG8A 1FMD2 3T0DA 2LM3A 2BU9A 4AHWA 1SLCA 3S7EA 4R9BA 5T50A 4QGLA 3ZPYA 4BMEA 4BQWA 3VUOA 1U5IA 1OXCA 1OUSA 3VBUC 4CUAA 3WF1A 3IDAA 2BFUL 2Q5TA 4AQ2A 4AHXA 1MS1A 3PMSA 3JQWA 1N1SA 3NO8A 3AZYA 1CGPA 1JBCA 1PGL2 3ZO0B 2DBNA 5T52A 5FR3A 5FY4A 4LBQA 4CU6A 1NOVA 1EV12 3PTRB 1U5XA 2Z79A 2ZGOA 5LBFA 1HJFA 4AXOA 4LKSA 4E8DA 5IJRA 2MHFA 2V73A 3KCYA 3R0RA 1G9BA 1W8WA 5L7OB 1MZ5A 2OPWA 3SCFA 4P5YA 1O3TA 4YYOA 5DG1A 1W9WA 5BY5A 3ZM8A 1AL0G 1TNRA 2B4KA 4XOGA 2D93A 3OJBA 3BU7A 4CDWC 5FY8A 4CDWA 1NXMA 5I93A 1M4WA 1EYBA 3T2TA 3C7EA 1NY71 2VG9A 1G9CA 3EB7A 4DOUA 5KBFA 1JOJA 5FMOS 3HBZA 2BV4A 5ISLA 3NQHA 5M0TA 2MNGA 3VBUB 4ZHNA 1POV1 4HT1T 5K9YA 1EAH3 4HFSA 4KU8A 4MV2A 1W6NA 2CAUA 5DUUA 3LZZA 4DIQA 2DCJA 2GU9A 3LGRA 3ZIWA 4FVVA 2W08A 4G3YC 4CU7A 4URTA 3AZVA 1A6CA 3KT4A 1S4CA 2D5FA 2DU0A 3PUSA 3WP5A 1GKBA 2KM2A 2Y0OA 3C7FA 1JS9A 3N36A 4L92A 3EQEA 5FBZA 3ZYBA 3DV8A 1SLLA 5IT6A 5FY0A 1UY1A 5JCTA 1JYTA 5K8SA 3FFZA 3TEXA 1TEIA 4XFFA 2DYCA 4OUSA 4UFHA 2JDKA 1OKOA 2WNVB 1HXS1 2CTVA 3MDPA 4Y1XA 5C5UA 2JWPA 3POSA 3GCXA 2YXSA 1X50A 2Q8CA 1W3VA 3ZXLA 1NA1B 1L7RA 1QXRA 1FPN2 1VBE3 2VD7A 1UPIA 1NQDA 3VD4A 3I49A 1VBD3 5FY1A 1RXGA 2E63A 2B39A 3WP3A 4L9BA 1JYVA 2XQXA 3RS6A 3MUZ1 4AHYA 1HKDA 1VMHA 3Q8AA 1CONA 4MG2A 1AL22 1C4RA 2ADEA 2YDEA 4FPFA 4QQOA 3SH4A 1UX7A 1AVBA 3R6SA 4BQ1A 4BA6A 5B4XA 5HCBA 5HCAA 3OTFA 1YUDA 1DQ5A 2VGDA 1EPWA 4GWJA 4QXHA 5EWSA 3OD0A 4CUGA 4YFZA 1WW5A 1CN1A 4XE9A 3Q9OA 1RVF2 1DYOA 3IM0A 4Y4YA 5FXXA 3RJ2X 2WNVC 4K6BA 4CCLA 5FCCA 1OT5A 4Y22A 2WC2A 4KWLA 3KVBA 5ACA3 1H1MA 1NA1C 2HWF3 4YZ3A 2YZ4A 2LRPA 3AFGA 2XVLA 1RUJ1 4Y24A 3OEBA 4MGYE 1W8HA 1MS8A 3WNLA 4AEKA 4N8MA 1VMJA 3N7LA 4S2FA 3ZN5A 2WT0A 4I0WB 4AVTA 1HQWA 1T6GC 1ZRRA 4LE4A 2RDNA 1Q5OA 2BGCA 4LE3A 4MXWA 3VBHA 2OA2A 1G9DA 2VL4A 2B45X 4CDUC 2PHRA 3S6PA 4QPGC 4P00B 1QJY2 4QXKA 1S1AA 2BNOA 2HH9A 1JU3A 4RA0A 5I91A 2W1QA 4NO4A 2CU5A 5I0DA 1CVNA 1W6QB 1XYPA 4A7KA 3OY8B 5CU1A 3W9AA 3TWIA 3B3QE 1OA4A 1RMU3 3QH6A 3TEYA 4RD7A 4COWA 1LGCA 1AR61 2D98A 4LBNA 3SISA 2MPFA 2FDHA 3M70A 4MGQA 4ZY9A 4FXKB 1W2NA 1ZNPA 4CP0A 1QJFA 2EF6A 1JI6A 4QX1A 2VPVA 4JVAA 2J1AA 1UZ0A 4AFBA 4M00A 1OMIA 3SH3A 1RUD3 3I2FA 1GP6A 1PZ7A 3R4DB 1KS4A 4IEVA 4AGGA 3RNSA 4E4ZA 2WYFA 5A32A 1KITA 2VE1A 3C7HA 3RZLA 1CJPA 2FDFA 2Z42A 4QPGB 4Q8KA 3VL8A 1J3PA 5IVYA 4OZXA 1DHKB 1LKNA 3DYOA 2P3YA 3DL3A 3LOIA 3PU8A 3LFIA 4XUTA 2Q8EA 4E9KA 4EYUA 4ES8A 3E6CC 2Y6LA 3GYDA 1AYM3 2OQ7A 1R1ZA 5EXOA 5FZGA 3BI3A 2QQUA 3BPZA 5JSOA 3H8OA 2GP3A 1RTVA 5FZ3A 2B42B 3I3BA 4MZUA 3WY6A 5LW9A 2RS13 1A8DA 1OFSA 2HWE2 2RS51 1S0IA 2WZR3 1D2SA 4JKKA 4RFRB 4R9DA 4Q4X3 4YRDA 4HSLA 3OD4A 4BXSV 5FBJA 3VGIA 4EZ4A 5JPMB 1NG0A 2UURA 2A6XA 2P1BA 2VBDA 1PMJX 2A73B 3P3NA 3WF0A 3EBRA 2A7AA 4CXYA 3RI9A 1GANA 1OI6A 4QHBA 1JYIA 4XQDA 5EJ3A 2DF7A 3NNMA 3SCGA 4RN5A 2YGLA 5KHKA 3VN4A 1R093 2LROA 1GNHA 1A8MA 3SKJE 3ZXAC 1F8VA 4Z8BA 2ZBJA 3MF6A 2QQVA 1MR5A 1D4VB 1CAUA 1V6JA 5FFOC 4RYDA 1YIPA 2KD7A 1YI9A 1TMF2 2VW0A 1PM7A 1SLTA 2W47A 3CQOA 4YGDA 3HN1A 4YARA 3VDCA 5E1RA 4WZFA 2QQPA 4QWNA 4E27A 2GH8A 4FOYA 4LIVA 4QU2A 2A1XA 4XTMA 5C9AA 4FAHA 2Y33A 1TME1 4JGZB 3URFA 1QHDA 5B2GB 5JOXA 3JB4C 5KWRA 1GZ9A 5A80A 1OC1A 3IAPA 5FY5A 1D4M3 1RITA 1FOD3 1VLNA 3WOGA 2GAUA 5FYUA 4O61A 4FFGA 2BJSA 1A3KA 2VJXA 3MIEA 1GWLA 5FY7A 1XU2A 1AYN1 2ZHKA 3BIWE 3EJKA 1AF9A 3JD71 4HN0A 4TN7A 3H0OA 1Y9GA 3GCWA 5J48A 4Z2AA 4FOVA 3MF9A 4AW7A 2JDMA 3N7KA 3WDYA 1FOD1 2IXJA 2YHJA 3POBA 3OPZA 3LDRA 1PNFA 5FZMA 4ZKTB 4YW5A 2VBPA 4HPKA 1N47A 1UY3A 4NRQA 1W2OA 4AI8A 1HIXA 4DQAA 1Y7BA 1KFUL 4XC9A 3AP5A 5FV3A 4P14A 2YC0A 5LWBA 2Z4FA 5FZOB 2VY0A 3UJOA 3AL6A 4BU2A 5BNOA 1AR83 2PA7A 4B29A 1X8EA 5E6HA 2P34A 4AF9A 3RZMA 2OUJA 1URXA 1NX9A 1AJOA 4W50A 4JDNA 4X6RB 4NAOA 1V6LA 4RS5A 1ENRA 3WVJA 2VOVA 1YRZA 5GZFA 1UU4A 2ZA9A 5FKBA 5FZDA 1UMHA 4I2OA 2PHTA 4QDRA 2DVFA 5E16A 2BZDA 2FBEA 5FTTC 2JG8C 5FZ9A 4CDXC 4AQ6A 1DGRN 4LBMA 4K1ZA 4R4XA 5JI7A 2HWB2 5L36A 1RUC3 5FQ0B 1GWMA 1VBD1 1AYM1 2WFF3 1GMMA 1BBT1 1E5HA 1VBE1 4YM0A 3H7YA 1QQP1 2XPJA 4QDSA 5KHIA 1STMA 4HKOA 2ZGPA 2RMU3 2V4VA 2E7TA 2D7FA 3ZYHA 2WDBA 4AEJA 1QOSA 2UWBA 2XBO2 1S55A 1IS5A 3GZAA 2Y6KA 3AYAA 3GJAA 1UMIA 1NCQB 5AVAA 1PMHX 4HBNA 4KG0A 4XUOA 3SC7X 1GBGA 4GWMA 1ND2A 4Y20A 4XF1A 1DFQA 2R071 1JZ7A 5EV7A 3I3EA 3RVHA 5FUIA 1BXHA 1NAEA 4EZHA 1LEDA 1OQ1A 3ATGA 3IDEA 3AC0A 4WM7C 4ZZ8A 1D0GA 1RYYA 1PVC3 3I2JA 3WUCA 3ZSMA 5IK7A 2JDZA 2OW4A 3JU9A 2QJVA 1LOBA 4YVSA 5JVVA 3NNFA 2EXJA 4UW3A 5FKCA 4LHNA 1H8VA 1XOYA 1NYWA 1ZZCA 2FHRA 1Y9QA 3J7MA 5EIYB 2YV8A 2AEZA 4N7IA 2RVAA 1FPN1 3CZJA 3T4HB 3V0BB 3ZKYA 1HQNA 3C7GA 2RR13 3LEGA 3G7DA 3J7LA 4S2HA 1QGLA 1WMFA 2TNFA 3OB8A 4MYEA 2WNUB 5IVCA 4PHZA 3IDCB 1H1AA 1T6BX 1PIV3 5F9TA 1GZCA 1MS3A 3RDIA 2ZGMA 1GU3A 5EPAA 2QQKA 1ONAA 4FPGA 3WG1A 1FAYA 1NCQC 1RMU1 2HWC1 4M0NA 3ILNA 3QBQA 2XONA 3R4SA 5D1IA 3LOBA 2WQ8A 4BIOA 4FBFA 5ABJA 3HJRA 3SEPA 2ZMKA 3H1MA 2PHDA 4CEWA 2JD9A 3G6JB 2AR6A 1C8M1 2TEPA 2ZHMA 1LNSA 4Q5OA 2ARCA 1FYUA 5FZBA 3ZSEA 5IVBA 5JXHA 1KRIA 1VRBA 2PLV1 2WNUA 3D0SA 4O7XA 4YGEA 2BRTA 3E6BA 4DB5A 3J8F2 1REFA 4MSVA 4FFHA 4GJZA 4JTOA 4LBLA 5T3NA 1J1TA 5JSRA 4QAWA 4BQ4A 3LSDA 2ZGSA 1SLIA 2HLEA 4XF0A 2EAAA 2VQUA 4YVSB 2VUJA 2YY1A 4QX2A 4AGRA 4DXRA 3I2OA 1RJ7A 4JTNA 2BBAA 1F5FA 2ZAHA 2ZX0A 3VHOA 4XBNA 2ZX3A 4YZ5A 2CNAA 2ZGTA 3HBKA 4YNIA 1OH4A 4H14A 1JXNA 3DECA 3OUJA 4NPMA 3U4SA 4M3CE 1NCQA 2BEOA 3CKHA 3IN9A 1ZRCA 2CHHA 4DS0A 1B35A 5FOBB 2ES3A 2WSVA 3GZEA 1X9TA 2WJSA 1EPZA 4A44A 5BNNB 1XE7A 5CADA 5JR7B 2AYHA 4LR4A 3B00A 2VR4A 1KD7A 5GZEA 1RUH3 4OQ9A 2W2IA 1JW6A 4QPIA 4EROA 5BUVA 3SITA 5DAWA 3BU0A 1OPMA 3MIBA 5LZ6A 3HNYM 4XDOA 5FZ1A 1RJ8A 2NZ9A 2VNOA 3POIA 2VO5A 1RXFA 3U0ZA 1PO13 5F32A 1W2UA 4GKXA 4RGGA 3LIHA 4FXGB 1H9PA 3CDZB 2VOTA 3M2MA 4L8QA 4COVA 1Z0HA 3BTXA 1GP5A 1UZZA 2A6VA 2Y8KA 1BMV2 3AJYA 2ZTNA 1ZBE2 2XDVA 4NE9A 1GFF2 1OFNA 4PIYA 2A6YA 3POFA 3Q8FA 2EXIA 4PT6A 3T09A 4TZDA 5FPZA 1GZWA 4BIFA 4CCNA 2ADDA 5BNOB 1S0JA 1W3XA 4MHRA 3VKMA 5LA2A 1HQLA 1REEA 4AEDC 1MEC2 1CD3G 1N1YA 1QDOA 4GWNA 3TBDA 3VKLA 3KCXA 4AWDA 2RDRA 3JBG3 2E7QA 4XCBA 3WW1A 1UZYA 4IV3A 4HPKB 3FJSA 2VXJA 1GR3A 3DUIA 3PU3A 4RQPB 1WLTA 5DPNA 5F5IA 1RVF3 1J84A 4YG3A 4CP1A 3JBG1 5C6CA 3AMNA 1YFYA 2UWCA 4RGAA 3WP6A 3S5QA 4XETA 3RZJA 2XJRA 4NIIA 1V6KA 1E5RA 4Q4V1 1H30A 2RS33 4I0AA 5C8CA 1POQA 1W90A 1NQJA 3DXUA 4MOAA 4YM2A 4EJRA 5KXCA 5FYVA 4AVBA 2X8KA 5BYNA 3T0BA 1AR71 5D2AA 2P2KA 2QQMA 4KWJA 1J83A 1R081 1IPSA 2VOXA 1G6NA 3Q8CA 4XUNA 1WBFA 1IG0A 4BQ5A 3BGAA 2NP0A 3IZOA 5C4WB 5HCHA 5C9AB 4FPLA 4LO5B 1ZREA 5DDJ1 3LQCA 5KXBA 4N53B 3CF6E 1DQ1A 4ES9A 4AHZA 2GALA 5IVEA 1RHI1 3FLPA 3H50A 1H1IA 1RMU2 2YBSA 4LO4B 4DMIA 5LEKA 2IVJA 5J7MA 5L9BA 3VKOA 2XJPA 3ZKUA 3FLTA 3LE0A 4BDVB 4CDQA 1I9RA 3WLUA 2B9VA 4A42A 1SQ4A 3T2PA 1WLDA 1ULEA 3VZNA 3D6EA 3GBFA 1DQ6A 1BCXA 3RWKX 3LDBA 4D0QA 3P5BA 4GIQA 4R8HA 4A6OA 5CKNA 2BQPA 1ENSA 2E53A 5FPXA 3CJXA 1NCRA 1RUOA 4OYUA 3WF4A 2W3JA 4B3NA 5FP4A 4BCUA 4W6XA 4C1WA 3ZXGA 2IXKA 3OGRA 2V5DA 3RPQA 3ZYIB 4OI1A 4TLGA 2FCTA 4AVAA 4N53C 2XKPA 3W5NA 4D7TA 2ILMA 1SEFA 4IEXA 4DZGA 1U5YA 1Z7S2 1EUUA 4XBLA 1RHI2 2JENA 3NMBA 3ZFGC 3ZXJA 2D43A 4LBJA 4XQ4A 2W1WA 4PI2A 5A3MA 1UOBA 4CRQA 5C7GA 4DEQA 1HRI3 3VBHC 2C26A 5A32B 5F3CA 5CAZA 1F35A 4RHV2 4HZFA 3OBRA 5F2WA 4BQ2A 2FDKA 4LO7A 2NMNA 3ENRA 4XEZA 4NIGA 5FDBA 2VCAA 4QM9A 4KWUA 3HIFA 4AOCA 4QD2A 1HW5A 3GZUC 2J7MA 1PIV1 1NLRA 2PFWA 1HRV2 1X7NA 2FZ2A 2RS31 2NPIA 2YC2A 4XW3A 3W20A 4AAXA 4DNYA 4UFIA 1UZVA 3FLRA 1JZ3A 4LT5A 5ERLA 2RR11 1RUE1 1ZX5A 3NRUA 1O8SA 5CFCA 4K9SA 3UGGA 4MADA 1BEV3 1CZTA 2DVDA 2JIJA 1HV0A 1UMZA 1RUI3 1UL9A 2VU9A 2XJTA 2OXBA 3EMRA 4XQWA 3D4KA 4IEWA 2AGSA 3O1RA 4UBGA 5A7QA 3WCSA 4UAPA 3WDTA 2G19A 2EIEA 3VBHB 2BP6A 2WAOA 3MIDA 2QE3A 3IMMA 3HMYA 4I3GA 2BPA2 2C1FA 1Q8PA 1D4M2 4OUMA 1RUG3 2C6SA 3M3EA 2XUEA 3MIFA 3NSTA 2E33A 4TTGA 2IWGB 2F6BA 4XXAA 2D6PA 3WDWA 3ZPOA 1DCSA 2DDUA 3WSOA 3WV6A 1H8TA 4PF1A 3ZR5A 5AC92 2W68A 2XL7A 3B93A 4LBQD 1S0BA 5FWJA 4EN6B 1Q8SA 5L9RA 3VBSB 4FQ4A 4A3XA 5T5LA 4N90A 4TWTA 4K3UA 3KGZA 3AFKA 1CPMA 2CSGA 2QZ2A 3OBTA 1R082 4XVHA 1AR93 3ETQA 5JIAA 1YHFA 1VBA2 1FMD1 3B9CA 3H3ZA 4J25A 2ZEYA 1AR82 4S2GA 1NLSA 1OLRA 1HX6A 5TSWA 3FN9A 3HOBA 1POV0 1RUF1 4QQ2A 4LO6B 3I2GA 3LIGA 1VBE2 5FZHA 1GYKA 2D6NA 2BOJA 4IV1A 4QXCA 2ARBA 2ZX2A 2VNRA 5JOWA 1O59A 2GN3A 3N3HA 1KS5A 3W58A 3DYPA 1YQ2A 4NJ4A 2HBTA 1AR72 2VAUA 3POJA 2E26A 2XBO1 1WMXA 4P9WA 3PNAA 1V00A 2VQAA 4FPHA 1OA2A 5FIXA 4B7KA 2WNVA 3FE5A 4UF0A 4CCJA 2Y26A 3RZZA 1QJX1 2OT7A 4DXTA 1RUC2 1YWKA 3RYPA 5HPOA 1MQTC 2BWAA 2KXLA 2VZOA 5LY2A 1D0HA 1B09A 2YROA 3ES4A 3USUB 4I0BA 4UXAA 1N3PA 3LDKA 1ZBE1 5BNPA 1N1VA 3TNQA 4K8RB 1GV9A 1KQRA 1AYN3 1TZOA 2QTWB 2ZGLA 2VNVA 3HWJA 1W6NB 2VVEA 4HOOA 4IL7A 4Q0VA 1UY0A 5A1LA 5I8YA 1AUYA 1ZA7A 1JZ4A 1R1A1 1Q56A 2NN8A 5BNPB 4DXZA 2VBBA 3WX5A 2ZJCA 2VMGA 3T1LA 1RVF1 4GWIA 3USUA 5GZGA 1YLLA 5IK5A 2LTNA 1Q43A 4MGIE 3SKVA 1V0AA 1MS4A 2VQTA 2O1QA 3LEMA 3MHZA 1V6MA 2WRAA 1WZXA 3E1F1 3TN91 4EQVA 1VMFA 3D82A 4UF0B 2ATFA 1H8TC 1QJY3 3ASIA 1VP6A 3AK0A 3ACHA 1UXZA 4FP2A 4GJYA 1YFXA 2WN3A 5APAA 3T4VA 5C33A 1QJEA 2B9UA 1ENXA 2I74A 3OGSA 3FFQA 5C3PA 1H6YA 1T2XA 5EYXA 5LRSA 4OHZA 3PHMA 4QPYA 2SLIA 3MW4A 4IV1B 4XHXA 4K1YA 1K5MC 5A1FA 4LBQB 4IE5A 2W39A 2J42A 3MFAA 2RMU1 3TYJA 1LOEA 1X33A 1PO11 5EHDA 3HAGA 3CBNA 4KWKA 4BYYA 1RUD2 5GJ6A 4AQTA 4D8MA 1HDKA 4IEUA 4M01A 4L11A 1RUC1 4GAZA 2JDYA 1O6UA 2CV6A 3BTAA 4D3WA 3VBSA 3T08A 2DURA 1LECA 3E5XA 3O0WA 3AP9A 5T5JA 3J8F3 1H8TB 1N3QA 4BE3A 1AX2A 1PHMA 2CWMA 2WIIB 4KI5M 1IQDC 1UIJA 2Y34A 2RG4A 1VRH3 5FLHA 4BISA 5FZ4A 4A6SA 1H2KA 2HWB1 3ME2A 1LHOA 2WS92 1GQGA 1JYWA 1WW6A 2RS12 2J1TA 1K5MB 2HWE3 3PVBB 4HL0A 4LBOA 4XFIA 2R062 4GMP3 2WZR2 3DYMA 1QKQA 1Y3TA 5IVJA 4KU7A 5LBBA 3POEA 5CIRA 5FXVA 3ZVXA 1WMDA 3ZXDA 4Z1VA 3BTZA 2JICA 3RZHA 2ID4A 5FUPA 3HEIA 5F8PA 5CFCB 3I2IA 4NPRA 3TEZA 1AXZA 4UFLA 3HT1A 1P8JA 3H3UA 2ORZA 5GLTA 1AR63 1GOHA 2YU2A 3CJIB 1VJ2A 2F17A 1KJRA 4LEJA 2UU8A 3ZYJB 1COV1 1XNCA 1YQ5A 2WWJA 3H3LA 5FPVA 1BHGA 1W8FA 4L0PA 4NWWA 1KFXL 1RUJ2 5EJZB 1LTEA 3SQOA 1TMF3 4WVWA 1W6PB 2ZHNA 4N43C 3MBWA 1PO12 4Q0SA 1O91A 3WXPA 2FMDA 4XIKA 1UNBA 4PDWC 2HWD2 4LLOA 3I2KA 3AMQA 4M3CA 2ZEZA 1DP0A 3LD8A 1ZBE3 1LGNA 2HEWF 5CYYA 1OUXA 5FXWA 5EYYA 1UPSA 4NAMA 4X8PA 4D6QA 5F6LB 4XDPA 2DBIA 2HKXA 4FCAA 4YSFA 2K46A 1TG7A 1ULGA 5C3SA 1OF4A 1TVGA 1J58A 2YPJA 4XF3A 3P6BA 1G86A 1PZ9A 4YW6A 4I3PA 2FZ1A 3WNMA 1SLBA 1UO9A 3CJIC 4YGCA 1FV2A 4AYUA 3AB0A 1DQ0A 4YVWC 2VUDA 2ARAA 3AVRA 2B46X 3WZ1A 4GQ7A 1NCRB 2F4PA 4JDMA 4P08A 4N9HA 4FT8A 1A34A 4HG6B 2QDNA 4BB3A 2BDRA 3SLIA 5T5OA 1ACCA 1XU1A 1RUF3 1W39A 4Q4X1 3IIIA 4UI9L 4OHXA 3V64A 3DF0A 3M1HA 2DCKA 1IKPA 1XE8A 3THPA 5JI9A 1R091 2CDOA 3PUAA 3F2ZA 1PX4A 4CDQB 3WW4A 1RL3A 2HYKA 5K4LA 4W6WA 5FUNA 2VZVA 2VULA 3CU7A 1X8MA 4R9CA 1QQP3 5CKMA 4I01A 1AXKA 2NMOA 3UKTA 5FZEA 2YFZA 4CPBD 1C3HA 4IV3C 1VBB3 4Q4Y1 3T2OA 4JV4A 3AP7A 4N53A 4FI9A 3J8F1 1K45A 1EP0A 1PNGA 1W0NA 4AFMA 3APBA 4ITCA 2VTFA 1ZBA1 5C4WA 4UFKA 1W03A 4NWVA 4INDA 2WFF2 2WWSA 2WUHA 2ZCWA 3FHAA 1SDDB 2Q30A 2LUWA 4JDOA 4XYXA 3UJQA 3GZTB 1KDMA 1I1EA 1BLZA 1GUIA 2EA7A 2FCUA 1F31A 4UBHA 4AL9A 1CAVA 2IC1A 3EHKA 4DUXA 2RMU2 4XFHA 3ZFEA 3OF1A 4FTEA 1XNDA 4BQ3A 2W87A 3ZXEA 3S5AA 1XB9A 4CDQC 2H6BA
chains in the Genus database with same CATH topology
1W8UA 4A6SA 1W90A 2WYFA 4CPBD 4YW6A 1OH3A 1OKOA 4LKFA 1WCUA 1W9FA 2JWPA 1UOJA 2O14A 3ZYHA 1WMXA 1HN0A 2LROA 4LK7A 1V0AA 4BQ4A 4LK6A 4LKDA 5D21A 4BQ5A 1GWKA 1GWLA 3F95A 4YWAA 1WZXA 3UT0A 4CPBA 4CP9A 2LRPA 1W8ZA 1L7LA 2KR2A 2VXJA 4BQ2A 4LJHA 4AL9A 2C24A 1W8WA 3ZYFA 2Q1FA 4LKEA 3ZYBA 3ORJA 1W8TA 4BQ3A 1GWMA 2K46A 4CP9B 4YW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8U A;  4A6S A;  1W90 A;  2WYF A;  4CPB D;  4YW6 A;  1OH3 A;  1OKO A;  4LKF A;  1WCU A;  1W9F A;  2JWP A;  1UOJ A;  2O14 A;  3ZYH A;  1WMX A;  1HN0 A;  2LRO A;  4LK7 A;  1V0A A;  4BQ4 A;  4LK6 A;  4LKD A;  5D21 A;  4BQ5 A;  1GWK A;  1GWL A;  3F95 A;  4YWA A;  1WZX A;  3UT0 A;  4CPB A;  4CP9 A;  2LRP A;  1W8Z A;  1L7L A;  2KR2 A;  2VXJ A;  4BQ2 A;  4LJH A;  4AL9 A;  2C24 A;  1W8W A;  3ZYF A;  2Q1F A;  4LKE A;  3ZYB A;  3ORJ A;  1W8T A;  4BQ3 A;  1GWM A;  2K46 A;  4CP9 B;  4YW7 A; 
#chains in the Genus database with same CATH topology
 2WZ8 A;  1Y43 B;  1BYH A;  1O4Y A;  4RQP A;  1O4Z A;  5K0U B;  5DZG A;  1C57 A;  3RSJ A;  3KZ4 C;  4IV3 B;  4I09 A;  1IPJ A;  1PVC 2;  3BN6 A;  5EFU A;  5FYB A;  1AHS A;  4HKL A;  4IEP A;  1VBC 1;  1TME 2;  1OUR A;  3GNE A;  4W4Z A;  5CEH A;  3BYW A;  3D5O A;  5GZD A;  5L19 A;  2Y6J A;  3K46 A;  1B35 C;  5LY1 A;  5CKQ A;  3C2U A;  1YFU A;  1GZW B;  1QMJ A;  4GH4 C;  3GDB A;  3SH5 A;  4UW6 A;  4YG0 A;  1Q8Q A;  5BNQ A;  2LS6 A;  2WNE A;  1HRI 2;  3OBA A;  1IS6 A;  1R1A 3;  2D3P A;  3E5U A;  1ASJ 1;  2VZP A;  4NHX A;  1HLC A;  1D7P M;  1LHN A;  2JG9 A;  2WAB A;  4RHV 3;  1UY2 A;  3J26 N;  1MS9 A;  4ORF A;  2LAL A;  4HXC A;  2A6Z A;  1F4H A;  3PVO A;  1ENQ A;  4ZPI A;  4MO3 M;  1G8W A;  5FO9 B;  4Q29 A;  1O4T A;  2WO3 A;  2WS9 1;  2XVG A;  1W06 A;  5K0U C;  2R0F A;  2RM2 2;  3UT0 A;  1ZRF A;  4QPI B;  4UOJ A;  3RMY A;  3U14 A;  3WQB A;  5F3I A;  2LW8 A;  5ACA 1;  3VDD B;  5L73 A;  2GSY A;  3WR0 A;  4XIO A;  2E7A A;  2ZKN A;  5BNN A;  1SBE A;  3IMN A;  1AR9 1;  1B35 B;  1LGB A;  1BEV 2;  3I54 A;  3MYX A;  5HCF A;  5F2S A;  5C5T A;  3ACI A;  4EWE A;  4CEW C;  3SEE A;  3ON7 A;  2W46 A;  4QU1 A;  4CU8 A;  3AXD A;  1DGL A;  1UY4 A;  1VRH 1;  4JRA A;  3BAL A;  4QM8 A;  2VTX J;  1S2E A;  4IET A;  1VR3 A;  5IUQ A;  4ASL A;  3M7A A;  3JXS A;  4GD4 A;  2DFB A;  4FTB A;  1YNA A;  4NN0 A;  4Y1Z A;  1JHN A;  3VBR A;  3IPV A;  1LU1 A;  1RUG 2;  4TXW A;  4JQR A;  5LRR A;  4AK3 A;  4XXP A;  4B4P A;  1JOP A;  2GND A;  3KLS A;  5FK8 A;  4W8J A;  5GKA C;  2QFE A;  3O12 A;  5FP9 A;  5F5C A;  1LHW A;  4AI3 A;  4ATE A;  5DDJ 3;  4O65 A;  4OVE A;  4Q4V 2;  1WCK A;  3NKG A;  2IXC A;  2I45 A;  3NW4 A;  4PCR A;  3KT1 A;  5A7P A;  4CEY C;  1RUH 2;  4AQS A;  3OGJ A;  4FPC A;  5HBA A;  1W28 A;  1H0B A;  2VEC A;  1CWP A;  4Q27 A;  1POV 3;  3VHR A;  2XOM A;  4CEW B;  1H2M A;  5ABJ B;  1R08 3;  5JIU A;  1AR9 2;  4E8C A;  1RUD 1;  1SCS A;  2DVA A;  2ZXQ A;  5FP8 A;  3I3Q A;  3VD3 A;  2OZ6 A;  3KT7 A;  3VBO A;  1C28 A;  4R52 A;  4GAL A;  4X6Q B;  1W99 A;  5AVP A;  3RYK A;  4BQY A;  1WKY A;  1IZ3 A;  3A22 A;  4HK8 A;  2ET1 A;  3TN9 3;  1PZ8 A;  1ODN A;  1GIC A;  2ZZQ A;  1JUH A;  4CP9 A;  4TLF A;  1PGL 1;  2GC0 A;  4CA9 A;  2KR2 A;  1EAH 1;  2GDF A;  3VBF A;  3V0B A;  2V4A A;  4Y4R A;  4Q4W 1;  4Z92 B;  2BOI A;  3VBF C;  4XIL A;  1Q8V A;  2A75 A;  2RE9 A;  1A78 A;  1MEC 3;  4CCD A;  3TEW A;  1QNY A;  1XNB A;  3MPB A;  1MZE A;  3UKN A;  5CB7 A;  3JBG 2;  1DZQ A;  1W9Y A;  2WT1 A;  4LKF A;  5KXD A;  3AXE A;  1FNZ A;  1NZC A;  2JDH A;  2YUE A;  3WDU A;  1I5P A;  1UU6 A;  4Y20 B;  1ND2 B;  4NMI A;  2RJL A;  1U12 A;  3B69 A;  2PXJ A;  3GJB A;  4LUM A;  4X8N A;  1GWK A;  4XJZ A;  5L9V A;  1DZR A;  2HWF 1;  2J1E A;  3O1P A;  2Y60 A;  3WQ7 A;  5I0T A;  1OVS A;  4IGQ A;  2DUO A;  1DG6 A;  2R49 A;  2W0X A;  4GB3 1;  2Q1F A;  2IXL A;  4YM3 A;  4XHB A;  5AFB A;  2VTX A;  4XZP A;  5BXX A;  1CAX A;  1Z7S 1;  3U10 A;  3OPW A;  4M0H A;  1H6X A;  1RUH 1;  2DCZ A;  4BQX A;  4LUL A;  5FQ0 A;  1JYC A;  4IEO A;  1LOF C;  1FI2 A;  3FX3 A;  4CUB A;  5LK7 B;  4KBB A;  3B94 A;  3AM2 A;  3ZFF B;  2PHF A;  4OFG A;  1ZA4 A;  4XAA A;  3ZDV A;  1HJG A;  2ZGU A;  3NNG A;  2D6M A;  3ZFG A;  4D69 A;  4AAP A;  5AC9 1;  2X5I A;  2XWB B;  3VHN A;  4RS5 B;  1DYK A;  1UYZ A;  2HBU A;  4LHK A;  2YBP A;  1ND2 C;  3NV2 A;  2XHN A;  1ZYB A;  1RED A;  1ZZ7 A;  3K75 B;  3KGL A;  3M3I A;  3THT A;  4XMA A;  5LK5 A;  2BVV A;  3MLJ A;  2TUN A;  3ACF A;  4PF5 A;  2WL1 A;  4QXB A;  5FZO A;  2WWU A;  2Q8O A;  4EN8 B;  3BUC A;  2Z69 A;  4CSW A;  5DAV A;  1W8N A;  3FUQ A;  2HWD 1;  4FO9 A;  2K2S A;  3AMM A;  1ZZ6 A;  2NYY A;  3HT2 A;  4XMI A;  4D6R A;  4Q2F A;  4Y1Y A;  3OBZ A;  2WZE A;  1WA6 X;  5T5P A;  3ZFF C;  2EXH A;  3PDQ A;  1VE0 A;  2ORX A;  4M4P A;  1OSG A;  3LA3 A;  4XF9 A;  2WZP P;  4RS5 C;  3LCP A;  1VRH 2;  4H7M A;  4OMC A;  1G9F A;  3E97 A;  4HVR A;  1RUI 1;  3TAY A;  5T55 A;  1WLW A;  3RG0 A;  4DXS A;  3RJR A;  4OZO A;  3KM5 A;  4JGZ A;  2DVB A;  1VBC 3;  4MXV A;  4JGZ C;  4U36 A;  3TRS B;  3VKF C;  1HB2 A;  3RWN A;  1I5Z A;  3WQ0 A;  1QH7 A;  3I59 A;  2ZX1 A;  1XRU A;  4IGP A;  2FD8 A;  3RI8 A;  1NE4 A;  3O0X A;  1SFY A;  2Z2S B;  4B7E A;  2OII A;  4MX3 A;  4RR3 C;  5C8C C;  4IDZ A;  1CQ9 A;  1CAU B;  4UW5 A;  1QF3 A;  1XJA A;  2ET7 A;  4P9I A;  3PLQ A;  2A5Z A;  1HRV 3;  1N1T A;  3A0N A;  2PN5 A;  5CIS A;  2GMM A;  1PO2 3;  1JOB A;  4Q4Y 2;  3S57 A;  4PIX A;  4LA2 A;  2HEV F;  3N7J A;  3PTY A;  3N9P A;  4BM8 A;  3K3N A;  1UIK A;  3PME A;  4V2W A;  4LUK A;  5C3R A;  2BFU S;  1RUI 2;  2I07 B;  2J1S A;  1S0C A;  2YBK A;  4Z2W A;  2WN2 A;  2HWD 3;  3AKP A;  3KV5 A;  3MFC A;  5H9P A;  1DZT A;  5BPX A;  1FNY A;  4XCA A;  1YJK A;  4EN9 B;  2GZW A;  1PMI A;  4KG8 A;  3WW3 A;  3QOP A;  2O14 A;  4K20 A;  3WNN A;  1JOD A;  3ST7 A;  3CEW A;  4IEQ A;  5FYH A;  1DGW X;  4NVP A;  1QU0 A;  1DGW A;  2J1V A;  1E5S A;  3HVD A;  2GC1 A;  5A3T A;  5GZC A;  1X36 A;  3OSD A;  4LHL A;  2WLQ A;  1W8O A;  5C8C B;  4WM8 C;  4XAE A;  4BH9 A;  4E2S A;  3R05 A;  4QPG A;  5GLV A;  3PVE A;  4ZXE A;  5AC9 3;  1YJL A;  5DAQ A;  3VL9 A;  5CBL A;  4B1L A;  3WG2 A;  3ITQ A;  3DPR C;  1TE1 B;  1JYX A;  2CGO A;  1NUK A;  4Q4W 2;  4HLT A;  2PHW A;  1RUF 2;  1KXG A;  2O8O A;  5F1R A;  1VBA 3;  4F8A A;  2ZEX A;  4RHV 1;  2VM9 A;  2C5D A;  2XQR A;  4AI0 A;  4E4D X;  4YVW A;  5E8A A;  1C8M 3;  2A6W A;  2D97 A;  3CHX A;  4XJ9 A;  5A70 A;  2Y64 A;  4CPB A;  3NNJ A;  3ZYG A;  1Z78 A;  2EAK A;  3BB6 A;  1KEX A;  4GXL A;  3DKW A;  4DY3 A;  2G9Z A;  3OUH A;  3OY8 A;  4JHT A;  1JN2 P;  2ZEW A;  3V0A A;  1W6Q A;  3HQX A;  4CCC A;  2D6K A;  1AR7 3;  4Y5S A;  5FP7 A;  2VNG A;  2VQ0 A;  4YFW A;  1ULO A;  4XFG A;  3KD4 A;  4HET A;  4MXW B;  5JMO A;  3FBY A;  4AR2 A;  3OEA A;  4Y3O A;  4BZ4 A;  3O1O A;  3ZSJ A;  3O1M A;  3OGG A;  5LA9 A;  1W9T A;  2NQY A;  5FOJ B;  3VLB B;  3AYD A;  3O1T A;  3ZIX A;  1UKR A;  5C70 A;  2BVB A;  3F95 A;  4NOT A;  1BMV 1;  1AYN 2;  1LOD A;  1F5J A;  3WG3 A;  4DO0 A;  3C8X A;  4J6G A;  2ZGR A;  2UY8 A;  4IW3 A;  4Y22 B;  5EJ1 B;  3N4M A;  1C5H A;  2RDQ A;  1S0D A;  5K7P A;  5A33 A;  3ZMO A;  3IWZ A;  1GSL A;  3U37 A;  1VB2 A;  1KGY A;  4IER A;  4XJU A;  4XF4 A;  3ZYP A;  1H9W A;  5ANN A;  3PUH A;  2ARX A;  4KMQ A;  5CA6 A;  2MEV 3;  4CCM A;  2W91 A;  1QNW A;  4YLZ A;  2YB7 A;  4GMP 1;  4FAG A;  2BER A;  2JDU A;  2Q1M A;  4JCK A;  1PVX A;  2G9G A;  1NLQ A;  1F9K A;  5E88 A;  2UWA A;  4SBV A;  4GUL A;  4NRM A;  2A71 A;  3PJY A;  4YM1 A;  1PK6 C;  5CFD A;  1BK0 A;  2HJI A;  3KWV A;  1AX0 A;  4H2A A;  5CVR A;  4COY A;  2IFW A;  3ACL A;  4YVS C;  4Y33 A;  3H9A A;  4WVV A;  1TNF A;  3WCR A;  1KJL A;  3MUY 1;  5J36 A;  5DAB A;  4OI2 A;  1NA1 A;  3ZN4 A;  5IHR A;  3W21 A;  4WM7 A;  4LJH A;  5DXD A;  3KCC A;  4CU9 A;  3FHQ A;  1VB4 A;  4QX3 A;  5LBE A;  5JSP A;  2DU1 A;  4KH9 A;  3FZ3 A;  3ZX7 A;  1D2Q A;  1JZ8 A;  2RM2 3;  5IWF A;  3SCH A;  5B4N A;  1JH5 A;  4QPW A;  1S0G A;  3BOW A;  1YYN A;  2CWS A;  2PAE A;  3B7M A;  1CAW A;  2XVK A;  4OLL A;  4Y1U A;  3M3C A;  3WW2 A;  2WAA A;  4LBK A;  1C8N A;  1LR5 A;  4DPN A;  4Q26 A;  3MV0 1;  4LXL A;  3ZXK A;  2QQO A;  2X09 A;  1V9U 2;  1EY2 A;  3HPN A;  3VBU A;  2JG8 A;  3X29 B;  2WS9 3;  2WT2 A;  4NHM A;  3JCI A;  1WA4 A;  5BV6 A;  2R06 3;  4ARX A;  2VZT A;  1LAJ A;  4XAB A;  3BTY A;  1BQP A;  3JD7 2;  4CDW B;  1UYP A;  1ASJ 3;  1NKG A;  4W65 A;  2QBX A;  1SFN A;  3GBG A;  5FYT A;  3ZXF A;  1K5J A;  1AXY A;  2WQZ C;  1KDK A;  1NE6 A;  1TMF 1;  4YZ1 A;  1US2 A;  5HV4 A;  5L7O A;  5BNO C;  2AC1 A;  1ALY A;  4CP2 A;  2UY9 A;  3ZYR A;  2VZQ A;  3VV1 A;  3TOJ A;  5LA1 A;  1X82 A;  1VAK A;  3M3Q A;  3PL0 A;  2HWC 3;  1SPP A;  2DTW A;  2D44 A;  2WO1 A;  4YWA A;  2TBV A;  5FPB A;  3T2Q A;  2NLR A;  1AR6 2;  3OGV A;  3ZDS A;  5KHG A;  2BWC A;  1JZ6 A;  5DUX A;  4QKB A;  4RQP C;  2JB8 A;  2GC2 A;  2Y38 A;  3AKR A;  1FT9 A;  1RUJ 3;  3QLQ A;  3J9S A;  5GLW A;  1UOF A;  1LB2 A;  3DGT A;  1ZM1 A;  3K51 A;  4AG4 A;  2BBV A;  2QQW A;  3I7D A;  1XPW A;  1PGW 1;  2XLG A;  4I30 A;  4XJ8 A;  5SV5 A;  3UES A;  3TN9 2;  3VZO A;  5JDB A;  3L2H A;  4D94 A;  5FYM A;  2WO7 A;  2WQ4 A;  4CE8 A;  1QY4 A;  3I3D A;  5A7W A;  5FZK A;  3GXU A;  3H8X A;  3MW3 A;  3KV9 A;  2PAK A;  1JYN A;  4SLI A;  3R4U A;  2PQS A;  3T1M A;  2YC4 A;  3VDB A;  5IAX A;  3AZW A;  1VPH A;  3LEI A;  4TYS A;  1BBT 2;  1DGR A;  3JUU A;  4H3W A;  3VD5 A;  1OVP A;  1PM4 A;  3MZH A;  3I2H A;  1OLM A;  4S2D A;  2I2S A;  1PK6 A;  4MVT A;  4GB3 2;  2YG0 A;  1Q8O A;  2N7G A;  3NNL A;  3PUQ A;  5KC5 A;  1S0E A;  3J7H A;  3GBW A;  3LA7 A;  5JZG C;  1M06 G;  3U1X A;  1W6O A;  2ENR A;  2YYO A;  3HD8 B;  4LHS A;  2PYT A;  2VMH A;  2XHK A;  1RUN A;  1UKG A;  2VVD A;  5LAT A;  3N9L A;  2DVG A;  4Q0U A;  4Y5T A;  5FZ7 A;  4E2Q A;  4CCO A;  2B7Y A;  3BOD A;  4ISR A;  5FYY A;  5JPN B;  3CZU A;  3E6D A;  3HQR A;  4FOW A;  2JD4 A;  5FZ6 A;  2ZOE B;  1UAI A;  5F3E A;  3ROU A;  3DEM A;  3AMP A;  3MGU A;  3VZM A;  2AEY A;  1F15 A;  4KBZ A;  5IAV A;  4MGK E;  5FZI A;  1QQP 2;  3A0K A;  2JB4 A;  2P3K A;  1HN1 A;  2BNN A;  2R04 2;  4LTA A;  3GAL A;  1LOA A;  1NT0 A;  1QEX A;  4YPJ A;  2XG3 A;  3TNP B;  1NY7 2;  4B1M A;  1VBB 2;  2XH6 A;  1K3I A;  5A3O A;  2R1B A;  1GLH A;  2ZAC A;  5LCW L;  3ZSK A;  1COV 2;  5FRE A;  1CJD A;  2R0H A;  3ORJ A;  4IEY A;  3K3O A;  1QJU 2;  5JR2 A;  3H8U A;  1XNK A;  2GH2 A;  5JZG B;  3IDB B;  4CDU B;  4NIH A;  2BYV E;  2VUC A;  2IFR A;  3IBM A;  5FZC A;  3AJZ A;  3MEP A;  1LJ7 A;  2V5Y A;  2VOK A;  4QX8 A;  4ZS2 A;  4ASK A;  4LKD A;  1ZBA 2;  1QJX 2;  3PIJ A;  4PDW A;  3KMH A;  4Q0P A;  5FO7 B;  2D6O X;  4BOW A;  1JZ5 A;  1MZ6 A;  4BWO A;  2AUY A;  2CY6 A;  5DAP A;  1AX1 A;  4RL7 A;  2P3I A;  5A6Q A;  2V09 A;  2H0V A;  2FCV A;  2AEN A;  3WF3 A;  1OOP A;  4ZU4 A;  2QDR A;  2R07 2;  5A6X A;  5C71 A;  4GZ9 A;  4O9G A;  4YZ2 A;  1WCD J;  3KSC A;  3L2Y A;  1XYO A;  1TME 3;  2PTM A;  5EZW A;  3U78 A;  4DUV A;  3FUO A;  3DPR A;  4K8F A;  4NPL A;  1DLC A;  5FJK A;  5FPU A;  4QGM A;  3WHU A;  3PIG A;  3ZOI A;  5DAX A;  2ZPX A;  1JTZ X;  4LIU A;  1UXX X;  4WM8 A;  3WF2 A;  3BVC A;  4QGN A;  1O7F A;  5DQ0 A;  4FSJ A;  1XNA A;  3GHN A;  1R1A 2;  4G9S B;  3DXT A;  3DKQ A;  4IUG A;  5HXV A;  3OOX A;  5FYI A;  2RS5 2;  4E4H A;  2GC3 A;  5F39 A;  3ZN6 B;  2WA4 A;  4JGY C;  4ZZ5 A;  1VBA 1;  1FX5 A;  1K42 A;  2ZAA A;  4BJ0 A;  5FMO L;  1YO8 A;  5GLZ A;  1BVP 1;  4I02 A;  4FFF A;  3N9N A;  4H55 A;  4JRL A;  3T0A A;  3WNP A;  2RM2 1;  2EIB A;  3EYP A;  3LEK A;  4HKW A;  1AL2 1;  1OH3 A;  4D6S A;  1PO2 2;  2K9Z A;  3VB9 A;  4LOS A;  3NKT A;  5KXE A;  3VBS C;  5EP9 A;  4BK4 A;  1H2N A;  1OD3 A;  3LF7 A;  3GM8 A;  3ZR6 A;  2A3Y A;  2Q0A A;  4NUB A;  3NV4 A;  4AEM A;  3FBM A;  1PGW 2;  2OX0 A;  2XJQ A;  1RUG 1;  5IFP A;  2PEL A;  4QHO A;  2QQJ A;  2OS2 A;  2VXR A;  2XJV A;  1W0O A;  4RR3 A;  5IK4 A;  2SBA A;  5A7O A;  3PUI A;  2E6V A;  4YG6 A;  3KVA A;  1JHJ A;  3LB9 A;  3WNK A;  4C90 A;  2H0B A;  2WLP A;  1OLM E;  4A7Z A;  4JGY B;  2E51 A;  2K0G A;  4ATF A;  1GNZ A;  2IVI B;  4A2U A;  3RGB A;  4F7Z A;  1WCU A;  5J96 B;  2XML A;  3AKT A;  3E5Q A;  3UK9 A;  3DN7 A;  4QKF A;  3WDV A;  3MPP G;  5DDJ 2;  1SCR A;  2ZHL A;  2R16 A;  4Q4V 3;  1QJY 1;  5A7W B;  3EXU A;  2Y6H A;  1MQT B;  4L2N A;  3CO2 A;  5H9S A;  3UNP A;  5FO8 B;  1HRV 1;  5FPA A;  3O1U A;  2VW2 A;  4Q4W 3;  4XBQ A;  4HK9 A;  5KHJ A;  1DDL A;  3VD7 A;  1XBF A;  3H42 B;  3BIE A;  2JDN A;  2EVX A;  5DUW A;  1RUE 3;  1X9P A;  3NAP C;  4P9J A;  4AI2 A;  1SMV A;  1WLC A;  1DIW A;  2H6C A;  3AL5 A;  4COU A;  3WIN E;  1SPP B;  3POG A;  3MIC A;  3ABZ A;  1UZW A;  2WFP A;  4NRP A;  1OBN A;  1UD1 A;  1J3R A;  2IXH A;  2VMD A;  1YC6 1;  3PUR A;  4EE2 A;  2X10 A;  1MS5 A;  1TQ5 A;  2GNB A;  1IKQ A;  1GP4 A;  4OHV A;  2VVF A;  3IKW A;  1WBL A;  4HMZ A;  1RIN A;  4Y1V A;  2QZ3 A;  4QB1 A;  2W95 A;  2CGP A;  2WSU A;  3JQX A;  1UQX A;  1Q3E A;  4YW1 A;  3RFR A;  3RYR A;  2VZ3 A;  3ES1 A;  2JE8 A;  3LPF A;  1HXS 2;  3SMH A;  5FK7 A;  4AFA A;  1OQD A;  5IYY A;  4OUL A;  1W0P A;  4DRR A;  1WME A;  3WQ1 A;  4MGS A;  4CDX B;  1O3Q A;  2JG8 B;  4FPK A;  4CVU A;  5D8A A;  5C3Q A;  2P6C A;  5FZ8 A;  2VC9 A;  3NAP B;  5A3U A;  5DMY A;  4WVM A;  1E57 A;  2CDP A;  4P9G A;  4ASM B;  1W6M B;  3SXW A;  5IFT A;  3HNB M;  3LPG A;  4K7J A;  1CAW B;  2XJU A;  1WCQ A;  2PHX A;  2QCS B;  3O5S A;  1FMD 3;  2PMW B;  3BCW A;  2RV9 A;  4WVZ A;  4A3Z A;  3QH7 A;  4XPV A;  2CAV A;  3ZSL A;  1JU4 A;  3CNA A;  5LB6 A;  2JJ6 A;  2XB6 C;  2D3S A;  1IHM A;  4JZR A;  3VKN A;  2FMY A;  3ILF A;  4FPJ A;  1ZZ9 A;  1JZ2 A;  2WIN B;  1XSQ A;  1ND3 A;  3IB3 A;  2GMP A;  4YZ4 A;  4WM7 B;  1W8T A;  2GNM A;  1CZV A;  4EWA A;  5DG2 A;  1S2K A;  4PLM A;  1NZI A;  4TSV A;  3THC A;  4YW4 A;  1DQ4 A;  3KV6 A;  1MVQ A;  2ZX4 A;  3USS A;  1HB3 A;  3WNX A;  2JDA A;  5CFD B;  4QB2 A;  3BOP A;  1YCI A;  2FDJ A;  2PLV 3;  4ISQ A;  2YPD A;  2C0Z A;  2A70 A;  5F5Q A;  1EUT A;  3AMH A;  4MET A;  4P9L A;  4QHZ A;  1MEC 1;  3WD5 A;  2WNU C;  3GF6 A;  2W52 A;  3PJQ A;  4U2A A;  3B5L B;  5A3W A;  1XQN A;  4JHZ A;  4UYB A;  4C0H A;  1AJK A;  5CFC C;  1LOC A;  4DEV A;  3OYW B;  1MAC A;  4XZU G;  1SZB A;  5FZ0 A;  1QXJ A;  5A33 B;  4EWD A;  3SHR A;  1L3J A;  2P37 A;  3I2D A;  5JLV A;  4AGV A;  1OD5 A;  4FTS A;  2G9F A;  2R1D A;  4P9X A;  4CEY A;  1V9U 3;  2XKO A;  4HVO A;  4IGO A;  4N43 B;  1ZZ8 A;  2GME A;  2PHL A;  4LLF A;  2PAM A;  5JWP A;  5CFD C;  1ZVF A;  1YI7 A;  2AZ5 A;  4AVV A;  3A7Q A;  3NJX A;  5H9Q A;  1SAC A;  2BNM A;  3D0J A;  1VBC 2;  4KL1 A;  3GHM A;  3POY A;  4ZXK A;  2ZZJ A;  5C3O A;  2FQP A;  2VZU A;  4PI0 A;  2FDI A;  4PLO A;  1HRI 1;  3LA2 A;  4CUC A;  4FP3 A;  4AI9 A;  3ZYF A;  1ULF A;  2JEC A;  3THD A;  1L7Q A;  1Y4W A;  3V0A B;  5FYS A;  2X29 A;  3UV9 A;  1MS0 A;  2G4I A;  1VIW B;  2AAC A;  4ET7 A;  5GLU A;  1I6X A;  3U07 A;  4UFM A;  2JE7 A;  3KQR A;  2JXA A;  4XFC A;  4YVW B;  2XLA A;  2ZGN A;  1V6O A;  3IT8 A;  1VBB 1;  4Q4Y 3;  1UOJ A;  1AL2 3;  3MLK A;  4OUE A;  3MLL A;  5BNN C;  2VZR A;  4L97 A;  3HR9 A;  1OKQ A;  3A21 A;  4LK6 A;  4OQ8 A;  3OCP A;  1LRH A;  1BK1 A;  3AX4 A;  3NL1 A;  1G9A A;  4R9A A;  2Y6G A;  2E9Q A;  4BPZ A;  4AVC A;  2XL9 A;  2W1S A;  3O14 A;  2OZJ A;  1V6N A;  1XXN A;  3VZL A;  2WO2 A;  4BLI A;  1OF3 A;  1S2B A;  1LU2 A;  3ILR A;  1DLL A;  4WBB A;  4URA A;  1ULC A;  2IUW A;  1AZD A;  4QX0 A;  1ULD A;  2ZMN A;  4ZS3 A;  5JXI A;  5FMB A;  4CZS A;  3VDA A;  1XE0 A;  4A7Y A;  4PBO A;  2HWF 2;  1RC6 A;  2OPK A;  3U75 A;  2E32 A;  4LIT A;  2VMI A;  3LSE A;  1ZRI A;  1N3O A;  4GB3 3;  4GH4 A;  4KGG A;  3WP4 A;  5IK8 A;  1LUL A;  5G04 L;  4OHY A;  5G05 L;  1LES A;  3H7J A;  1CIY A;  3NWK A;  4AE2 A;  2QKD A;  4JKM A;  4AED B;  4C8D A;  1YEW A;  3UGF A;  3WEZ A;  3IAQ A;  4EV0 A;  5EQU A;  2OQ6 A;  2G1M A;  4J1X A;  4RFT 0;  2ERF A;  2WYS A;  2QQL A;  4E4S A;  3I3M A;  4FPY A;  4QDQ A;  3CIH A;  3NV3 A;  1C8M 2;  3MO4 A;  4LA3 A;  3FHI B;  1LEM A;  4FOQ A;  4ZON A;  2QQI A;  2WA3 A;  4F83 A;  4BLJ A;  5F3G A;  3IIA A;  2JE9 A;  3AZZ A;  4LNV A;  2R04 1;  5DZE A;  3W59 A;  1OHF A;  1LHV A;  2GN7 A;  4MH0 E;  4P5H A;  1COV 3;  4IES A;  4NR1 A;  3TB0 A;  1ULP A;  5A3P A;  1YQC A;  3I59 B;  2OKX A;  4AED A;  3FWE A;  4FPO B;  3Q8E A;  1QJU 3;  2EID A;  2GP5 A;  2P3J A;  1RGS A;  3WT3 A;  5A3N A;  4BXF A;  5IVF A;  5C4W C;  2JDP A;  5C9A C;  3LFM A;  5A6Y A;  1DBN A;  1H4G A;  2Q1Z B;  3P3P A;  4GH4 B;  1CES A;  4P9Y A;  5I0R A;  2DTY A;  4QX5 A;  1SBF A;  1UYY A;  2BGO A;  1UF2 C;  1J1L A;  1XNT A;  1C1L A;  3SNM A;  4K21 A;  4G4F A;  2XGX A;  2O8Q A;  1V70 A;  1ZBA 3;  2OVU A;  4NHY A;  2VW1 A;  4Z82 A;  5CNA A;  4P02 B;  5A3L A;  1CPN A;  2HWE 1;  4LMF A;  4Y26 A;  3VHP A;  1PVC 1;  4Q1R A;  4QMA A;  1YQ6 A;  1IOA A;  1LOF A;  3FL7 A;  1O3R A;  1IGO A;  2WNO A;  1IQA A;  4AVS A;  1UOG A;  2R07 3;  4QPI C;  2XWJ B;  3MIH A;  4C1X A;  1XSR A;  4PLN A;  5H9R A;  2MEV 2;  3MIG A;  1WD3 A;  3VDD C;  2J1R A;  4KQ7 A;  3I97 A;  1CZS A;  3T3Y A;  3RZK A;  2C24 A;  2RS1 1;  1QJZ A;  1O8P A;  1R09 2;  3MI8 A;  3PVN A;  2VZS A;  5DUV A;  4C91 A;  4CCK A;  4M3C F;  1EV1 3;  1S0F A;  4XUP A;  5IAT A;  4XUR A;  4YGB A;  1DF0 A;  2R6Q A;  4CYD A;  3POW A;  3WG4 A;  3J7N A;  2W92 A;  4COZ A;  5FLI A;  3HNM A;  5A7N A;  2WFF 1;  1SLA A;  2HEY F;  2FDG A;  2X5I B;  4DUW A;  3D3A A;  1AR8 1;  3ZFG B;  1JUI A;  4D7S A;  3ZFF A;  2VMC A;  4C0B A;  3CMG A;  1BJQ A;  1IG3 A;  4OHW A;  3M8L A;  3ECQ A;  2RJ2 A;  4Q8L A;  3AKQ A;  3W5M A;  1CAX B;  1XYN A;  4RSU A;  1UWW A;  1FOD 2;  2EXK A;  1UW8 A;  3GGL A;  4N43 A;  2XLF A;  4CTE A;  3KHC A;  2A3W A;  1DQ2 A;  1EAH 2;  2HYX A;  4CEY B;  4QQL A;  1SDW A;  1DYP A;  1CIW A;  1SG3 A;  4YW7 A;  5ABJ C;  3O1V A;  4LO8 A;  5CG9 A;  3A4U A;  5JAX A;  2VCC A;  2Y0I A;  3MV1 1;  1RIR A;  3NJY A;  3I4I A;  3QD6 A;  2PHU A;  3M3O A;  4HAN A;  3INA A;  3OYW A;  2L9L A;  3H1W A;  3LAG A;  2EIG A;  2X5I C;  3N9M A;  2B8M A;  3HQU A;  4EN7 B;  2JX9 A;  5LEJ A;  1SFP A;  3JD7 3;  4IEZ A;  3CLP A;  2R06 1;  1ASJ 2;  3ZLI A;  3CL1 A;  1O5L A;  2X05 A;  2B5H A;  1XC6 A;  5I8S A;  1MVE A;  4AZZ A;  3NJV A;  3MW2 A;  3VBF B;  4KNC A;  3H8R A;  5FMC A;  4NID A;  1FPN 3;  2E31 A;  2UYB A;  3AVS A;  4PBP A;  2HWC 2;  4CP9 B;  1VBD 2;  1W2A X;  3NVC A;  3B02 A;  5J98 B;  4LOR A;  4JC1 A;  3OUI A;  3U11 A;  5HV0 A;  2DCT A;  5FMD A;  1ND3 B;  2R7E B;  3K2O A;  3ZMN A;  5FZA A;  3VBO B;  3H1Y A;  3UYJ A;  3LKJ A;  1WW4 A;  1HN0 A;  1OPO A;  2HWB 3;  4DIN B;  1C5I A;  4RGK A;  2O0O A;  1US3 A;  1J3Q A;  4KGQ A;  3O1S A;  2JIG A;  5FY9 A;  5J37 A;  4NHK A;  3FC0 A;  2F4L A;  1L7L A;  4PQ9 A;  5KHH A;  1BKZ A;  2WR9 A;  4DRV A;  1W9S A;  2QNK A;  2RHP A;  1HB4 A;  1W6M A;  1W04 A;  2W1U A;  4L99 A;  4XDQ A;  3OPT A;  2KA3 A;  1UN1 A;  4WVM B;  2C9A A;  1YIF A;  5FYC A;  3NAP A;  4IXL A;  4B4Q A;  5ACA 2;  2D40 A;  3J4U H;  3RZG A;  4GKY A;  4O9E A;  2BUK A;  1VAM A;  2ZGK A;  4GA9 A;  4IE6 A;  1BBT 3;  4B8E A;  2XR4 A;  5D8A B;  5HI0 A;  4CDX A;  2ZAB A;  4BMB A;  3IPV B;  3VBR B;  5C8W A;  5FYZ A;  3V65 A;  1HXS 3;  2JG9 C;  1ODM A;  2XXZ A;  4OCT A;  4W6Y A;  3EO6 A;  5ANQ A;  1ND3 C;  2OUH A;  4B4R A;  2VMF A;  3VBO C;  5J1X A;  2VZ1 A;  3I8T A;  3RRD A;  4OMD A;  1H2L A;  5FWE A;  4A4A A;  3L9J T;  3QCW A;  2EIC A;  1QOT A;  1E5I A;  5FXZ A;  4AFC A;  5A6Z A;  3K4A A;  2DV9 A;  2Q4S A;  4M4R A;  4IE0 A;  2RR1 2;  3P1I A;  3Q8B A;  2YU1 A;  3KS7 A;  4Y5Z 0;  2EAL A;  3S0M A;  1ZRD A;  5FZL A;  4JKL A;  1FXZ A;  4OI4 A;  3KHB A;  1Y9M A;  4D7Y A;  1SBD A;  4OI0 A;  3AYC A;  3VDD A;  5JXJ A;  3RQ0 A;  1BZW A;  1CR7 A;  1PIV 2;  1U0A A;  1BVV A;  4UFJ A;  1JMU B;  5I0S A;  1C1F A;  2MEV 1;  3LWC A;  2R04 3;  2DWR A;  5BNP C;  4QQH A;  1W9F A;  5D8A C;  1G7Y A;  4AFD A;  2BW8 A;  1V9U 1;  4J1W A;  1V6I A;  2D6L X;  3VBR C;  2JG9 B;  5D21 A;  4JX0 A;  1MQT A;  1O5U A;  5JOZ A;  1QJU 1;  1UU5 A;  1UCX A;  1W05 A;  2QVS B;  5KC6 A;  2D3R A;  4CXW A;  3A23 A;  4XTP A;  3HN3 A;  3T30 A;  4MHU A;  3NJZ A;  2V72 A;  2ARE A;  2VCM A;  2A3X A;  4JQT A;  2D5H A;  1D4M 1;  2CGN A;  2XJS A;  3O0V A;  1IS4 A;  4QB6 A;  2PLV 2;  1WWY A;  4HON A;  5LAS A;  3K77 A;  3WDX A;  1AYM 2;  2NM1 A;  4FQZ A;  4BK5 A;  2Y6F A;  4JGY A;  4ARY A;  1QJX 3;  4PQQ A;  3N35 A;  4IV1 C;  5A1A A;  2JKX A;  4IQP A;  2P17 A;  5FPL A;  1MPX A;  1J59 A;  1O3S A;  2QUO A;  5GM0 A;  5K0U A;  4RR3 B;  3ALQ A;  4Q4X 2;  4UT5 A;  4YW3 A;  5IVV A;  4MGZ E;  3QAC A;  1W2T A;  4XJW A;  3UET A;  4NHL A;  5F7U A;  1LOG A;  4BHP A;  1H4H A;  2WBK A;  2Q8D A;  2P6H A;  3WHT A;  1VAV A;  4Q1P A;  4MLO A;  1QDC A;  1QWR A;  2IZW A;  5A7S A;  5JXG A;  1GOG A;  2DUQ A;  3ZFE B;  1FV3 A;  1OQE A;  3KF5 A;  4FFI A;  3S7I A;  5GAL A;  5JUV A;  2YFU A;  4PIZ A;  1CAV B;  2ZKL A;  3N7M A;  5FRA A;  3BPS A;  4FPE A;  4QKN A;  5I8T A;  5FLJ A;  2DUP A;  1U5Z A;  1OOP C;  1WUV A;  4LOT A;  1YXW A;  4LQR A;  5CZK A;  2J22 A;  1NXD 1;  4MUV A;  4A45 A;  1YQ8 A;  3KF3 A;  4GMP 0;  4QT6 A;  1EV1 1;  3ZN6 A;  4QKD A;  2JEM A;  3FMG A;  1VAL A;  2RS5 3;  2WZR 1;  3WUD A;  3OG2 A;  2WKK A;  3AP4 A;  4LK7 A;  4N9I A;  4N7U A;  1QIQ A;  2DCY A;  4F3J A;  4AI1 A;  4E2G A;  1UX6 A;  5FP3 A;  1W8Z A;  2XUM A;  1FAT A;  4H7L A;  4WM8 B;  2JKB A;  4UW4 A;  2GNT A;  1PO2 1;  2ZML A;  3ETP A;  5JOY A;  4HN1 A;  1MZF A;  5LA0 A;  5SV8 A;  2BGP A;  1DU3 D;  3DPR B;  3ZFE C;  4EN0 A;  3VD9 A;  3BKZ A;  2C9K A;  4IE4 A;  4QQP A;  2YGM A;  1YFW A;  4PJY A;  2RJK A;  5J3U A;  3O7O A;  5FJH A;  1BEV 1;  5KR7 A;  1OOP B;  3DCQ A;  4R4Z A;  4CCE A;  4XFA A;  5DZF A;  2R30 A;  4NIA A;  3WNO A;  4WZC A;  2IXI A;  3D8C A;  3KQ4 B;  3K4Z A;  3KV4 A;  5T54 A;  4A41 A;  3VZJ A;  2RS3 2;  4PDW B;  4MGT A;  2QQN A;  3UKV A;  1I3H A;  1GQP A;  2ZS6 B;  3B01 A;  1WCS A;  5F5A A;  4DY5 A;  1GZT A;  2R32 A;  4DFS A;  3C3V A;  3AKS A;  1LCL A;  1OA3 A;  3JZV A;  4XAC A;  1ST8 A;  4HVQ A;  2P4E A;  4HSJ A;  1QH6 A;  4LKE A;  4CDU A;  5JZG A;  5FAX A;  2ETE A;  4M3C B;  2CYF A;  4XJA A;  2W5F A;  5I0U A;  3ELN A;  3AYE A;  1IPK A;  2W9X A;  2VH9 A;  1OLQ A;  4Z07 A;  4WV8 A;  1CX1 A;  1W6P A;  2UYA A;  4V1P A;  5FZF A;  1GNY A;  3N9O A;  4ONU A;  5HXM A;  1PGS A;  5J09 A;  2Z5W A;  1RUE 2;  5DN2 A;  1NCR C;  2X53 S;  5LBC A;  2VCB A;  1LHU A;  2DFC A;  5F6K A;  3CJI A;  3KB5 A;  5AFE A;  4Q0Q A;  1PX3 A;  3NV1 A;  4ZU5 A;  1QXP A;  4LPL A;  5JMC A;  4K40 A;  5E89 A;  3VZK A;  2XBO 3;  2PQQ A;  2ZGQ A;  1GOF A;  3ACG A;  1F2N A;  1R64 A;  1IS3 A;  1APN A;  4ZU7 A;  5IW0 A;  1LEN A;  1W6O B;  3K4D A;  2J1U A;  1HV1 A;  1RB8 G;  1K12 A;  1W8U A;  1CX4 A;  1GQH A;  2AH2 A;  3AP6 A;  3B9I A;  3C7O A;  2W94 A;  2YMZ A;  2VOW A;  3S30 A;  3UL2 A;  1WGP A;  4NRO A;  3U4X A;  4V2V A;  2CL2 A;  1K5M A;  1PK6 B;  1WD4 A;  1WW7 A;  1ZZB A;  2VUA A;  3N9Q A;  2P5B A;  2C4X A;  3AZX A;  1F4A A;  1Z7S 3;  5L7O C;  1HB1 A;  1RHI 3;  4JAA A;  4UWD A;  5F37 A;  3V56 A;  1UYX A;  4XUQ A;  3UGH A;  4XFB A;  1SHW B;  2VME A;  4QX7 A;  1QOO A;  4CXX A;  3JB8 A;  2BTV C;  4YW2 A;  4IE7 A;  2RDS A;  2OYZ A;  3RMX A;  3K48 A;  3M4F A;  5CG8 A;  1FMD 2;  3T0D A;  2LM3 A;  2BU9 A;  4AHW A;  1SLC A;  3S7E A;  4R9B A;  5T50 A;  4QGL A;  3ZPY A;  4BME A;  4BQW A;  3VUO A;  1U5I A;  1OXC A;  1OUS A;  3VBU C;  4CUA A;  3WF1 A;  3IDA A;  2BFU L;  2Q5T A;  4AQ2 A;  4AHX A;  1MS1 A;  3PMS A;  3JQW A;  1N1S A;  3NO8 A;  3AZY A;  1CGP A;  1JBC A;  1PGL 2;  3ZO0 B;  2DBN A;  5T52 A;  5FR3 A;  5FY4 A;  4LBQ A;  4CU6 A;  1NOV A;  1EV1 2;  3PTR B;  1U5X A;  2Z79 A;  2ZGO A;  5LBF A;  1HJF A;  4AXO A;  4LKS A;  4E8D A;  5IJR A;  2MHF A;  2V73 A;  3KCY A;  3R0R A;  1G9B A;  1W8W A;  5L7O B;  1MZ5 A;  2OPW A;  3SCF A;  4P5Y A;  1O3T A;  4YYO A;  5DG1 A;  1W9W A;  5BY5 A;  3ZM8 A;  1AL0 G;  1TNR A;  2B4K A;  4XOG A;  2D93 A;  3OJB A;  3BU7 A;  4CDW C;  5FY8 A;  4CDW A;  1NXM A;  5I93 A;  1M4W A;  1EYB A;  3T2T A;  3C7E A;  1NY7 1;  2VG9 A;  1G9C A;  3EB7 A;  4DOU A;  5KBF A;  1JOJ A;  5FMO S;  3HBZ A;  2BV4 A;  5ISL A;  3NQH A;  5M0T A;  2MNG A;  3VBU B;  4ZHN A;  1POV 1;  4HT1 T;  5K9Y A;  1EAH 3;  4HFS A;  4KU8 A;  4MV2 A;  1W6N A;  2CAU A;  5DUU A;  3LZZ A;  4DIQ A;  2DCJ A;  2GU9 A;  3LGR A;  3ZIW A;  4FVV A;  2W08 A;  4G3Y C;  4CU7 A;  4URT A;  3AZV A;  1A6C A;  3KT4 A;  1S4C A;  2D5F A;  2DU0 A;  3PUS A;  3WP5 A;  1GKB A;  2KM2 A;  2Y0O A;  3C7F A;  1JS9 A;  3N36 A;  4L92 A;  3EQE A;  5FBZ A;  3ZYB A;  3DV8 A;  1SLL A;  5IT6 A;  5FY0 A;  1UY1 A;  5JCT A;  1JYT A;  5K8S A;  3FFZ A;  3TEX A;  1TEI A;  4XFF A;  2DYC A;  4OUS A;  4UFH A;  2JDK A;  1OKO A;  2WNV B;  1HXS 1;  2CTV A;  3MDP A;  4Y1X A;  5C5U A;  2JWP A;  3POS A;  3GCX A;  2YXS A;  1X50 A;  2Q8C A;  1W3V A;  3ZXL A;  1NA1 B;  1L7R A;  1QXR A;  1FPN 2;  1VBE 3;  2VD7 A;  1UPI A;  1NQD A;  3VD4 A;  3I49 A;  1VBD 3;  5FY1 A;  1RXG A;  2E63 A;  2B39 A;  3WP3 A;  4L9B A;  1JYV A;  2XQX A;  3RS6 A;  3MUZ 1;  4AHY A;  1HKD A;  1VMH A;  3Q8A A;  1CON A;  4MG2 A;  1AL2 2;  1C4R A;  2ADE A;  2YDE A;  4FPF A;  4QQO A;  3SH4 A;  1UX7 A;  1AVB A;  3R6S A;  4BQ1 A;  4BA6 A;  5B4X A;  5HCB A;  5HCA A;  3OTF A;  1YUD A;  1DQ5 A;  2VGD A;  1EPW A;  4GWJ A;  4QXH A;  5EWS A;  3OD0 A;  4CUG A;  4YFZ A;  1WW5 A;  1CN1 A;  4XE9 A;  3Q9O A;  1RVF 2;  1DYO A;  3IM0 A;  4Y4Y A;  5FXX A;  3RJ2 X;  2WNV C;  4K6B A;  4CCL A;  5FCC A;  1OT5 A;  4Y22 A;  2WC2 A;  4KWL A;  3KVB A;  5ACA 3;  1H1M A;  1NA1 C;  2HWF 3;  4YZ3 A;  2YZ4 A;  2LRP A;  3AFG A;  2XVL A;  1RUJ 1;  4Y24 A;  3OEB A;  4MGY E;  1W8H A;  1MS8 A;  3WNL A;  4AEK A;  4N8M A;  1VMJ A;  3N7L A;  4S2F A;  3ZN5 A;  2WT0 A;  4I0W B;  4AVT A;  1HQW A;  1T6G C;  1ZRR A;  4LE4 A;  2RDN A;  1Q5O A;  2BGC A;  4LE3 A;  4MXW A;  3VBH A;  2OA2 A;  1G9D A;  2VL4 A;  2B45 X;  4CDU C;  2PHR A;  3S6P A;  4QPG C;  4P00 B;  1QJY 2;  4QXK A;  1S1A A;  2BNO A;  2HH9 A;  1JU3 A;  4RA0 A;  5I91 A;  2W1Q A;  4NO4 A;  2CU5 A;  5I0D A;  1CVN A;  1W6Q B;  1XYP A;  4A7K A;  3OY8 B;  5CU1 A;  3W9A A;  3TWI A;  3B3Q E;  1OA4 A;  1RMU 3;  3QH6 A;  3TEY A;  4RD7 A;  4COW A;  1LGC A;  1AR6 1;  2D98 A;  4LBN A;  3SIS A;  2MPF A;  2FDH A;  3M70 A;  4MGQ A;  4ZY9 A;  4FXK B;  1W2N A;  1ZNP A;  4CP0 A;  1QJF A;  2EF6 A;  1JI6 A;  4QX1 A;  2VPV A;  4JVA A;  2J1A A;  1UZ0 A;  4AFB A;  4M00 A;  1OMI A;  3SH3 A;  1RUD 3;  3I2F A;  1GP6 A;  1PZ7 A;  3R4D B;  1KS4 A;  4IEV A;  4AGG A;  3RNS A;  4E4Z A;  2WYF A;  5A32 A;  1KIT A;  2VE1 A;  3C7H A;  3RZL A;  1CJP A;  2FDF A;  2Z42 A;  4QPG B;  4Q8K A;  3VL8 A;  1J3P A;  5IVY A;  4OZX A;  1DHK B;  1LKN A;  3DYO A;  2P3Y A;  3DL3 A;  3LOI A;  3PU8 A;  3LFI A;  4XUT A;  2Q8E A;  4E9K A;  4EYU A;  4ES8 A;  3E6C C;  2Y6L A;  3GYD A;  1AYM 3;  2OQ7 A;  1R1Z A;  5EXO A;  5FZG A;  3BI3 A;  2QQU A;  3BPZ A;  5JSO A;  3H8O A;  2GP3 A;  1RTV A;  5FZ3 A;  2B42 B;  3I3B A;  4MZU A;  3WY6 A;  5LW9 A;  2RS1 3;  1A8D A;  1OFS A;  2HWE 2;  2RS5 1;  1S0I A;  2WZR 3;  1D2S A;  4JKK A;  4RFR B;  4R9D A;  4Q4X 3;  4YRD A;  4HSL A;  3OD4 A;  4BXS V;  5FBJ A;  3VGI A;  4EZ4 A;  5JPM B;  1NG0 A;  2UUR A;  2A6X A;  2P1B A;  2VBD A;  1PMJ X;  2A73 B;  3P3N A;  3WF0 A;  3EBR A;  2A7A A;  4CXY A;  3RI9 A;  1GAN A;  1OI6 A;  4QHB A;  1JYI A;  4XQD A;  5EJ3 A;  2DF7 A;  3NNM A;  3SCG A;  4RN5 A;  2YGL A;  5KHK A;  3VN4 A;  1R09 3;  2LRO A;  1GNH A;  1A8M A;  3SKJ E;  3ZXA C;  1F8V A;  4Z8B A;  2ZBJ A;  3MF6 A;  2QQV A;  1MR5 A;  1D4V B;  1CAU A;  1V6J A;  5FFO C;  4RYD A;  1YIP A;  2KD7 A;  1YI9 A;  1TMF 2;  2VW0 A;  1PM7 A;  1SLT A;  2W47 A;  3CQO A;  4YGD A;  3HN1 A;  4YAR A;  3VDC A;  5E1R A;  4WZF A;  2QQP A;  4QWN A;  4E27 A;  2GH8 A;  4FOY A;  4LIV A;  4QU2 A;  2A1X A;  4XTM A;  5C9A A;  4FAH A;  2Y33 A;  1TME 1;  4JGZ B;  3URF A;  1QHD A;  5B2G B;  5JOX A;  3JB4 C;  5KWR A;  1GZ9 A;  5A80 A;  1OC1 A;  3IAP A;  5FY5 A;  1D4M 3;  1RIT A;  1FOD 3;  1VLN A;  3WOG A;  2GAU A;  5FYU A;  4O61 A;  4FFG A;  2BJS A;  1A3K A;  2VJX A;  3MIE A;  1GWL A;  5FY7 A;  1XU2 A;  1AYN 1;  2ZHK A;  3BIW E;  3EJK A;  1AF9 A;  3JD7 1;  4HN0 A;  4TN7 A;  3H0O A;  1Y9G A;  3GCW A;  5J48 A;  4Z2A A;  4FOV A;  3MF9 A;  4AW7 A;  2JDM A;  3N7K A;  3WDY A;  1FOD 1;  2IXJ A;  2YHJ A;  3POB A;  3OPZ A;  3LDR A;  1PNF A;  5FZM A;  4ZKT B;  4YW5 A;  2VBP A;  4HPK A;  1N47 A;  1UY3 A;  4NRQ A;  1W2O A;  4AI8 A;  1HIX A;  4DQA A;  1Y7B A;  1KFU L;  4XC9 A;  3AP5 A;  5FV3 A;  4P14 A;  2YC0 A;  5LWB A;  2Z4F A;  5FZO B;  2VY0 A;  3UJO A;  3AL6 A;  4BU2 A;  5BNO A;  1AR8 3;  2PA7 A;  4B29 A;  1X8E A;  5E6H A;  2P34 A;  4AF9 A;  3RZM A;  2OUJ A;  1URX A;  1NX9 A;  1AJO A;  4W50 A;  4JDN A;  4X6R B;  4NAO A;  1V6L A;  4RS5 A;  1ENR A;  3WVJ A;  2VOV A;  1YRZ A;  5GZF A;  1UU4 A;  2ZA9 A;  5FKB A;  5FZD A;  1UMH A;  4I2O A;  2PHT A;  4QDR A;  2DVF A;  5E16 A;  2BZD A;  2FBE A;  5FTT C;  2JG8 C;  5FZ9 A;  4CDX C;  4AQ6 A;  1DGR N;  4LBM A;  4K1Z A;  4R4X A;  5JI7 A;  2HWB 2;  5L36 A;  1RUC 3;  5FQ0 B;  1GWM A;  1VBD 1;  1AYM 1;  2WFF 3;  1GMM A;  1BBT 1;  1E5H A;  1VBE 1;  4YM0 A;  3H7Y A;  1QQP 1;  2XPJ A;  4QDS A;  5KHI A;  1STM A;  4HKO A;  2ZGP A;  2RMU 3;  2V4V A;  2E7T A;  2D7F A;  3ZYH A;  2WDB A;  4AEJ A;  1QOS A;  2UWB A;  2XBO 2;  1S55 A;  1IS5 A;  3GZA A;  2Y6K A;  3AYA A;  3GJA A;  1UMI A;  1NCQ B;  5AVA A;  1PMH X;  4HBN A;  4KG0 A;  4XUO A;  3SC7 X;  1GBG A;  4GWM A;  1ND2 A;  4Y20 A;  4XF1 A;  1DFQ A;  2R07 1;  1JZ7 A;  5EV7 A;  3I3E A;  3RVH A;  5FUI A;  1BXH A;  1NAE A;  4EZH A;  1LED A;  1OQ1 A;  3ATG A;  3IDE A;  3AC0 A;  4WM7 C;  4ZZ8 A;  1D0G A;  1RYY A;  1PVC 3;  3I2J A;  3WUC A;  3ZSM A;  5IK7 A;  2JDZ A;  2OW4 A;  3JU9 A;  2QJV A;  1LOB A;  4YVS A;  5JVV A;  3NNF A;  2EXJ A;  4UW3 A;  5FKC A;  4LHN A;  1H8V A;  1XOY A;  1NYW A;  1ZZC A;  2FHR A;  1Y9Q A;  3J7M A;  5EIY B;  2YV8 A;  2AEZ A;  4N7I A;  2RVA A;  1FPN 1;  3CZJ A;  3T4H B;  3V0B B;  3ZKY A;  1HQN A;  3C7G A;  2RR1 3;  3LEG A;  3G7D A;  3J7L A;  4S2H A;  1QGL A;  1WMF A;  2TNF A;  3OB8 A;  4MYE A;  2WNU B;  5IVC A;  4PHZ A;  3IDC B;  1H1A A;  1T6B X;  1PIV 3;  5F9T A;  1GZC A;  1MS3 A;  3RDI A;  2ZGM A;  1GU3 A;  5EPA A;  2QQK A;  1ONA A;  4FPG A;  3WG1 A;  1FAY A;  1NCQ C;  1RMU 1;  2HWC 1;  4M0N A;  3ILN A;  3QBQ A;  2XON A;  3R4S A;  5D1I A;  3LOB A;  2WQ8 A;  4BIO A;  4FBF A;  5ABJ A;  3HJR A;  3SEP A;  2ZMK A;  3H1M A;  2PHD A;  4CEW A;  2JD9 A;  3G6J B;  2AR6 A;  1C8M 1;  2TEP A;  2ZHM A;  1LNS A;  4Q5O A;  2ARC A;  1FYU A;  5FZB A;  3ZSE A;  5IVB A;  5JXH A;  1KRI A;  1VRB A;  2PLV 1;  2WNU A;  3D0S A;  4O7X A;  4YGE A;  2BRT A;  3E6B A;  4DB5 A;  3J8F 2;  1REF A;  4MSV A;  4FFH A;  4GJZ A;  4JTO A;  4LBL A;  5T3N A;  1J1T A;  5JSR A;  4QAW A;  4BQ4 A;  3LSD A;  2ZGS A;  1SLI A;  2HLE A;  4XF0 A;  2EAA A;  2VQU A;  4YVS B;  2VUJ A;  2YY1 A;  4QX2 A;  4AGR A;  4DXR A;  3I2O A;  1RJ7 A;  4JTN A;  2BBA A;  1F5F A;  2ZAH A;  2ZX0 A;  3VHO A;  4XBN A;  2ZX3 A;  4YZ5 A;  2CNA A;  2ZGT A;  3HBK A;  4YNI A;  1OH4 A;  4H14 A;  1JXN A;  3DEC A;  3OUJ A;  4NPM A;  3U4S A;  4M3C E;  1NCQ A;  2BEO A;  3CKH A;  3IN9 A;  1ZRC A;  2CHH A;  4DS0 A;  1B35 A;  5FOB B;  2ES3 A;  2WSV A;  3GZE A;  1X9T A;  2WJS A;  1EPZ A;  4A44 A;  5BNN B;  1XE7 A;  5CAD A;  5JR7 B;  2AYH A;  4LR4 A;  3B00 A;  2VR4 A;  1KD7 A;  5GZE A;  1RUH 3;  4OQ9 A;  2W2I A;  1JW6 A;  4QPI A;  4ERO A;  5BUV A;  3SIT A;  5DAW A;  3BU0 A;  1OPM A;  3MIB A;  5LZ6 A;  3HNY M;  4XDO A;  5FZ1 A;  1RJ8 A;  2NZ9 A;  2VNO A;  3POI A;  2VO5 A;  1RXF A;  3U0Z A;  1PO1 3;  5F32 A;  1W2U A;  4GKX A;  4RGG A;  3LIH A;  4FXG B;  1H9P A;  3CDZ B;  2VOT A;  3M2M A;  4L8Q A;  4COV A;  1Z0H A;  3BTX A;  1GP5 A;  1UZZ A;  2A6V A;  2Y8K A;  1BMV 2;  3AJY A;  2ZTN A;  1ZBE 2;  2XDV A;  4NE9 A;  1GFF 2;  1OFN A;  4PIY A;  2A6Y A;  3POF A;  3Q8F A;  2EXI A;  4PT6 A;  3T09 A;  4TZD A;  5FPZ A;  1GZW A;  4BIF A;  4CCN A;  2ADD A;  5BNO B;  1S0J A;  1W3X A;  4MHR A;  3VKM A;  5LA2 A;  1HQL A;  1REE A;  4AED C;  1MEC 2;  1CD3 G;  1N1Y A;  1QDO A;  4GWN A;  3TBD A;  3VKL A;  3KCX A;  4AWD A;  2RDR A;  3JBG 3;  2E7Q A;  4XCB A;  3WW1 A;  1UZY A;  4IV3 A;  4HPK B;  3FJS A;  2VXJ A;  1GR3 A;  3DUI A;  3PU3 A;  4RQP B;  1WLT A;  5DPN A;  5F5I A;  1RVF 3;  1J84 A;  4YG3 A;  4CP1 A;  3JBG 1;  5C6C A;  3AMN A;  1YFY A;  2UWC A;  4RGA A;  3WP6 A;  3S5Q A;  4XET A;  3RZJ A;  2XJR A;  4NII A;  1V6K A;  1E5R A;  4Q4V 1;  1H30 A;  2RS3 3;  4I0A A;  5C8C A;  1POQ A;  1W90 A;  1NQJ A;  3DXU A;  4MOA A;  4YM2 A;  4EJR A;  5KXC A;  5FYV A;  4AVB A;  2X8K A;  5BYN A;  3T0B A;  1AR7 1;  5D2A A;  2P2K A;  2QQM A;  4KWJ A;  1J83 A;  1R08 1;  1IPS A;  2VOX A;  1G6N A;  3Q8C A;  4XUN A;  1WBF A;  1IG0 A;  4BQ5 A;  3BGA A;  2NP0 A;  3IZO A;  5C4W B;  5HCH A;  5C9A B;  4FPL A;  4LO5 B;  1ZRE A;  5DDJ 1;  3LQC A;  5KXB A;  4N53 B;  3CF6 E;  1DQ1 A;  4ES9 A;  4AHZ A;  2GAL A;  5IVE A;  1RHI 1;  3FLP A;  3H50 A;  1H1I A;  1RMU 2;  2YBS A;  4LO4 B;  4DMI A;  5LEK A;  2IVJ A;  5J7M A;  5L9B A;  3VKO A;  2XJP A;  3ZKU A;  3FLT A;  3LE0 A;  4BDV B;  4CDQ A;  1I9R A;  3WLU A;  2B9V A;  4A42 A;  1SQ4 A;  3T2P A;  1WLD A;  1ULE A;  3VZN A;  3D6E A;  3GBF A;  1DQ6 A;  1BCX A;  3RWK X;  3LDB A;  4D0Q A;  3P5B A;  4GIQ A;  4R8H A;  4A6O A;  5CKN A;  2BQP A;  1ENS A;  2E53 A;  5FPX A;  3CJX A;  1NCR A;  1RUO A;  4OYU A;  3WF4 A;  2W3J A;  4B3N A;  5FP4 A;  4BCU A;  4W6X A;  4C1W A;  3ZXG A;  2IXK A;  3OGR A;  2V5D A;  3RPQ A;  3ZYI B;  4OI1 A;  4TLG A;  2FCT A;  4AVA A;  4N53 C;  2XKP A;  3W5N A;  4D7T A;  2ILM A;  1SEF A;  4IEX A;  4DZG A;  1U5Y A;  1Z7S 2;  1EUU A;  4XBL A;  1RHI 2;  2JEN A;  3NMB A;  3ZFG C;  3ZXJ A;  2D43 A;  4LBJ A;  4XQ4 A;  2W1W A;  4PI2 A;  5A3M A;  1UOB A;  4CRQ A;  5C7G A;  4DEQ A;  1HRI 3;  3VBH C;  2C26 A;  5A32 B;  5F3C A;  5CAZ A;  1F35 A;  4RHV 2;  4HZF A;  3OBR A;  5F2W A;  4BQ2 A;  2FDK A;  4LO7 A;  2NMN A;  3ENR A;  4XEZ A;  4NIG A;  5FDB A;  2VCA A;  4QM9 A;  4KWU A;  3HIF A;  4AOC A;  4QD2 A;  1HW5 A;  3GZU C;  2J7M A;  1PIV 1;  1NLR A;  2PFW A;  1HRV 2;  1X7N A;  2FZ2 A;  2RS3 1;  2NPI A;  2YC2 A;  4XW3 A;  3W20 A;  4AAX A;  4DNY A;  4UFI A;  1UZV A;  3FLR A;  1JZ3 A;  4LT5 A;  5ERL A;  2RR1 1;  1RUE 1;  1ZX5 A;  3NRU A;  1O8S A;  5CFC A;  4K9S A;  3UGG A;  4MAD A;  1BEV 3;  1CZT A;  2DVD A;  2JIJ A;  1HV0 A;  1UMZ A;  1RUI 3;  1UL9 A;  2VU9 A;  2XJT A;  2OXB A;  3EMR A;  4XQW A;  3D4K A;  4IEW A;  2AGS A;  3O1R A;  4UBG A;  5A7Q A;  3WCS A;  4UAP A;  3WDT A;  2G19 A;  2EIE A;  3VBH B;  2BP6 A;  2WAO A;  3MID A;  2QE3 A;  3IMM A;  3HMY A;  4I3G A;  2BPA 2;  2C1F A;  1Q8P A;  1D4M 2;  4OUM A;  1RUG 3;  2C6S A;  3M3E A;  2XUE A;  3MIF A;  3NST A;  2E33 A;  4TTG A;  2IWG B;  2F6B A;  4XXA A;  2D6P A;  3WDW A;  3ZPO A;  1DCS A;  2DDU A;  3WSO A;  3WV6 A;  1H8T A;  4PF1 A;  3ZR5 A;  5AC9 2;  2W68 A;  2XL7 A;  3B93 A;  4LBQ D;  1S0B A;  5FWJ A;  4EN6 B;  1Q8S A;  5L9R A;  3VBS B;  4FQ4 A;  4A3X A;  5T5L A;  4N90 A;  4TWT A;  4K3U A;  3KGZ A;  3AFK A;  1CPM A;  2CSG A;  2QZ2 A;  3OBT A;  1R08 2;  4XVH A;  1AR9 3;  3ETQ A;  5JIA A;  1YHF A;  1VBA 2;  1FMD 1;  3B9C A;  3H3Z A;  4J25 A;  2ZEY A;  1AR8 2;  4S2G A;  1NLS A;  1OLR A;  1HX6 A;  5TSW A;  3FN9 A;  3HOB A;  1POV 0;  1RUF 1;  4QQ2 A;  4LO6 B;  3I2G A;  3LIG A;  1VBE 2;  5FZH A;  1GYK A;  2D6N A;  2BOJ A;  4IV1 A;  4QXC A;  2ARB A;  2ZX2 A;  2VNR A;  5JOW A;  1O59 A;  2GN3 A;  3N3H A;  1KS5 A;  3W58 A;  3DYP A;  1YQ2 A;  4NJ4 A;  2HBT A;  1AR7 2;  2VAU A;  3POJ A;  2E26 A;  2XBO 1;  1WMX A;  4P9W A;  3PNA A;  1V00 A;  2VQA A;  4FPH A;  1OA2 A;  5FIX A;  4B7K A;  2WNV A;  3FE5 A;  4UF0 A;  4CCJ A;  2Y26 A;  3RZZ A;  1QJX 1;  2OT7 A;  4DXT A;  1RUC 2;  1YWK A;  3RYP A;  5HPO A;  1MQT C;  2BWA A;  2KXL A;  2VZO A;  5LY2 A;  1D0H A;  1B09 A;  2YRO A;  3ES4 A;  3USU B;  4I0B A;  4UXA A;  1N3P A;  3LDK A;  1ZBE 1;  5BNP A;  1N1V A;  3TNQ A;  4K8R B;  1GV9 A;  1KQR A;  1AYN 3;  1TZO A;  2QTW B;  2ZGL A;  2VNV A;  3HWJ A;  1W6N B;  2VVE A;  4HOO A;  4IL7 A;  4Q0V A;  1UY0 A;  5A1L A;  5I8Y A;  1AUY A;  1ZA7 A;  1JZ4 A;  1R1A 1;  1Q56 A;  2NN8 A;  5BNP B;  4DXZ A;  2VBB A;  3WX5 A;  2ZJC A;  2VMG A;  3T1L A;  1RVF 1;  4GWI A;  3USU A;  5GZG A;  1YLL A;  5IK5 A;  2LTN A;  1Q43 A;  4MGI E;  3SKV A;  1V0A A;  1MS4 A;  2VQT A;  2O1Q A;  3LEM A;  3MHZ A;  1V6M A;  2WRA A;  1WZX A;  3E1F 1;  3TN9 1;  4EQV A;  1VMF A;  3D82 A;  4UF0 B;  2ATF A;  1H8T C;  1QJY 3;  3ASI A;  1VP6 A;  3AK0 A;  3ACH A;  1UXZ A;  4FP2 A;  4GJY A;  1YFX A;  2WN3 A;  5APA A;  3T4V A;  5C33 A;  1QJE A;  2B9U A;  1ENX A;  2I74 A;  3OGS A;  3FFQ A;  5C3P A;  1H6Y A;  1T2X A;  5EYX A;  5LRS A;  4OHZ A;  3PHM A;  4QPY A;  2SLI A;  3MW4 A;  4IV1 B;  4XHX A;  4K1Y A;  1K5M C;  5A1F A;  4LBQ B;  4IE5 A;  2W39 A;  2J42 A;  3MFA A;  2RMU 1;  3TYJ A;  1LOE A;  1X33 A;  1PO1 1;  5EHD A;  3HAG A;  3CBN A;  4KWK A;  4BYY A;  1RUD 2;  5GJ6 A;  4AQT A;  4D8M A;  1HDK A;  4IEU A;  4M01 A;  4L11 A;  1RUC 1;  4GAZ A;  2JDY A;  1O6U A;  2CV6 A;  3BTA A;  4D3W A;  3VBS A;  3T08 A;  2DUR A;  1LEC A;  3E5X A;  3O0W A;  3AP9 A;  5T5J A;  3J8F 3;  1H8T B;  1N3Q A;  4BE3 A;  1AX2 A;  1PHM A;  2CWM A;  2WII B;  4KI5 M;  1IQD C;  1UIJ A;  2Y34 A;  2RG4 A;  1VRH 3;  5FLH A;  4BIS A;  5FZ4 A;  4A6S A;  1H2K A;  2HWB 1;  3ME2 A;  1LHO A;  2WS9 2;  1GQG A;  1JYW A;  1WW6 A;  2RS1 2;  2J1T A;  1K5M B;  2HWE 3;  3PVB B;  4HL0 A;  4LBO A;  4XFI A;  2R06 2;  4GMP 3;  2WZR 2;  3DYM A;  1QKQ A;  1Y3T A;  5IVJ A;  4KU7 A;  5LBB A;  3POE A;  5CIR A;  5FXV A;  3ZVX A;  1WMD A;  3ZXD A;  4Z1V A;  3BTZ A;  2JIC A;  3RZH A;  2ID4 A;  5FUP A;  3HEI A;  5F8P A;  5CFC B;  3I2I A;  4NPR A;  3TEZ A;  1AXZ A;  4UFL A;  3HT1 A;  1P8J A;  3H3U A;  2ORZ A;  5GLT A;  1AR6 3;  1GOH A;  2YU2 A;  3CJI B;  1VJ2 A;  2F17 A;  1KJR A;  4LEJ A;  2UU8 A;  3ZYJ B;  1COV 1;  1XNC A;  1YQ5 A;  2WWJ A;  3H3L A;  5FPV A;  1BHG A;  1W8F A;  4L0P A;  4NWW A;  1KFX L;  1RUJ 2;  5EJZ B;  1LTE A;  3SQO A;  1TMF 3;  4WVW A;  1W6P B;  2ZHN A;  4N43 C;  3MBW A;  1PO1 2;  4Q0S A;  1O91 A;  3WXP A;  2FMD A;  4XIK A;  1UNB A;  4PDW C;  2HWD 2;  4LLO A;  3I2K A;  3AMQ A;  4M3C A;  2ZEZ A;  1DP0 A;  3LD8 A;  1ZBE 3;  1LGN A;  2HEW F;  5CYY A;  1OUX A;  5FXW A;  5EYY A;  1UPS A;  4NAM A;  4X8P A;  4D6Q A;  5F6L B;  4XDP A;  2DBI A;  2HKX A;  4FCA A;  4YSF A;  2K46 A;  1TG7 A;  1ULG A;  5C3S A;  1OF4 A;  1TVG A;  1J58 A;  2YPJ A;  4XF3 A;  3P6B A;  1G86 A;  1PZ9 A;  4YW6 A;  4I3P A;  2FZ1 A;  3WNM A;  1SLB A;  1UO9 A;  3CJI C;  4YGC A;  1FV2 A;  4AYU A;  3AB0 A;  1DQ0 A;  4YVW C;  2VUD A;  2ARA A;  3AVR A;  2B46 X;  3WZ1 A;  4GQ7 A;  1NCR B;  2F4P A;  4JDM A;  4P08 A;  4N9H A;  4FT8 A;  1A34 A;  4HG6 B;  2QDN A;  4BB3 A;  2BDR A;  3SLI A;  5T5O A;  1ACC A;  1XU1 A;  1RUF 3;  1W39 A;  4Q4X 1;  3III A;  4UI9 L;  4OHX A;  3V64 A;  3DF0 A;  3M1H A;  2DCK A;  1IKP A;  1XE8 A;  3THP A;  5JI9 A;  1R09 1;  2CDO A;  3PUA A;  3F2Z A;  1PX4 A;  4CDQ B;  3WW4 A;  1RL3 A;  2HYK A;  5K4L A;  4W6W A;  5FUN A;  2VZV A;  2VUL A;  3CU7 A;  1X8M A;  4R9C A;  1QQP 3;  5CKM A;  4I01 A;  1AXK A;  2NMO A;  3UKT A;  5FZE A;  2YFZ A;  4CPB D;  1C3H A;  4IV3 C;  1VBB 3;  4Q4Y 1;  3T2O A;  4JV4 A;  3AP7 A;  4N53 A;  4FI9 A;  3J8F 1;  1K45 A;  1EP0 A;  1PNG A;  1W0N A;  4AFM A;  3APB A;  4ITC A;  2VTF A;  1ZBA 1;  5C4W A;  4UFK A;  1W03 A;  4NWV A;  4IND A;  2WFF 2;  2WWS A;  2WUH A;  2ZCW A;  3FHA A;  1SDD B;  2Q30 A;  2LUW A;  4JDO A;  4XYX A;  3UJQ A;  3GZT B;  1KDM A;  1I1E A;  1BLZ A;  1GUI A;  2EA7 A;  2FCU A;  1F31 A;  4UBH A;  4AL9 A;  1CAV A;  2IC1 A;  3EHK A;  4DUX A;  2RMU 2;  4XFH A;  3ZFE A;  3OF1 A;  4FTE A;  1XND A;  4BQ3 A;  2W87 A;  3ZXE A;  3S5A A;  1XB9 A;  4CDQ C;  2H6B A; 
#chains in the Genus database with same CATH homology
 1W8U A;  4A6S A;  1W90 A;  2WYF A;  4CPB D;  4YW6 A;  1OH3 A;  1OKO A;  4LKF A;  1WCU A;  1W9F A;  2JWP A;  1UOJ A;  2O14 A;  3ZYH A;  1WMX A;  1HN0 A;  2LRO A;  4LK7 A;  1V0A A;  4BQ4 A;  4LK6 A;  4LKD A;  5D21 A;  4BQ5 A;  1GWK A;  1GWL A;  3F95 A;  4YWA A;  1WZX A;  3UT0 A;  4CPB A;  4CP9 A;  2LRP A;  1W8Z A;  1L7L A;  2KR2 A;  2VXJ A;  4BQ2 A;  4LJH A;  4AL9 A;  2C24 A;  1W8W A;  3ZYF A;  2Q1F A;  4LKE A;  3ZYB A;  3ORJ A;  1W8T A;  4BQ3 A;  1GWM A;  2K46 A;  4CP9 B;  4YW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...