4YW6A

Structural insight into divalent galactoside binding to pseudomonas aeruginosa lectin leca
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight into Multivalent Galactoside Binding to Pseudomonas aeruginosa Lectin LecA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
molecule keywords PA-I galactophilic lectin
total genus 23
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4yw6A00
1OH3A 1W8UA 1WCUA 4A6SA 2O14A 1W8WA 2LROA 3ZYHA 3ORJA 1WZXA 4AL9A 4LJHA 3F95A 4BQ2A 4CPBD 1W9FA 1GWMA 4CPBA 4YWAA 4BQ4A 1HN0A 4CP9B 4YW6A 3ZYFA 1OKOA 1UOJA 2Q1FA 2WYFA 1W90A 4YW7A 1WMXA 4LK7A 2C24A 1L7LA 4LKFA 4CP9A 1V0AA 1GWLA 2KR2A 2K46A 1GWKA 1W8ZA 2VXJA 3UT0A 4LKEA 4BQ3A 4LK6A 5D21A 4LKDA 3ZYBA 1W8TA 4BQ5A 2JWPA 2LRPA
chains in the Genus database with same CATH superfamily
2UWBA 2VZVA 5A32B 2MEV2 2SBAA 2YU2A 4JGYC 3K77A 2JG9B 5BPXA 2B9UA 4RS5B 3WF1A 3I2GA 4DY5A 1O5LA 2YU1A 2GNDA 3LEMA 1QOOA 1QY4A 4IV1B 4Q0QA 2JE9A 1KXGA 1UNBA 5H9RA 4LBKA 1JBCA 2WWSA 4UOJA 4Z92B 3JUUA 3RZZA 4HKOA 2BVBA 1BEV1 5FZBA 2BTVC 2PMWB 4Q4Y1 1A6CA 4LBQD 2TUNA 1C8M3 1HB4A 3AC0A 4CU6A 1OC1A 2RJLA 4MHUA 1DLLA 4W6XA 5FYIA 1HJGA 3UYJA 4IV3A 2B42B 1TME3 4HANA 2IVJA 3FLPA 5ANNA 2JJ6A 2VBPA 3K4AA 3OY8B 2Y6JA 3B9IA 4MG2A 5LA1A 1UWWA 3NAPC 4FQ4A 2JDKA 1KS5A 4IESA 1CQ9A 2JDNA 3ST7A 1WA4A 2ZZQA 3MO4A 4UBGA 2ZHKA 2EIGA 3JB4C 1RXFA 3RZJA 5BNNA 2WNUA 1GKBA 5L9VA 2IC1A 2JDAA 3ES1A 1UQXA 4CDUB 1AYM2 2V5DA 1CAXB 4Y1VA 2FDKA 2GC1A 3VD7A 1WLCA 2QQWA 5BNQA 4BQWA 3VBRC 5FMOS 4R8HA 4XQDA 2W87A 1TE1B 1UMHA 4A6OA 3OBRA 3UESA 4MZUA 5IAVA 2JB4A 5ABJC 1XE0A 1RUG2 4DUVA 1TMF2 1HQNA 5AC92 3T2QA 1SLCA 3GHMA 1EAH3 1VBB1 3GJAA 3UNPA 2VUCA 4UF0B 2IXKA 4XF3A 3E1F1 2IXJA 4M3CA 5GM0A 3ZYGA 1QJY1 1ODMA 2V5YA 1EUUA 2RDQA 4QX7A 3PTYA 2PA7A 3BTXA 5CBLA 3OTFA 2JDHA 4FI9A 3HBZA 1R1A1 1WGPA 1UU5A 4K20A 1SCRA 1D4M1 3CKHA 5DG1A 3PMEA 4YW1A 2DV9A 2WS93 4DUXA 1PHMA 4LNVA 1HW5A 1E5IA 2DVFA 4Q27A 4QQOA 4EWAA 4CE8A 2XHKA 4OLLA 3D4KA 2DCYA 2WWJA 4Q4W1 1XB9A 5T5LA 3ILNA 3ZXDA 1CAVB 1LOBA 1WMXA 2JE8A 5C3SA 1D0GA 1SFNA 2WJSA 1HJFA 4XCBA 5GZFA 5C4WC 1RHI3 5FPVA 3MF9A 4NROA 4BHPA 1V9U2 3WVJA 1R1A2 3I3BA 5FYVA 3TN91 4BXFA 4LBQA 4JGZB 4QPGA 1WCUA 3VBRB 3B3QE 5IVCA 2J1UA 2MNGA 2X5IA 4GAZA 4CDUC 1AR72 1BCXA 2HBTA 1YXWA 4CPBA 5DDJ2 2D3RA 3NWKA 4KWUA 2YFZA 1BQPA 4Q8KA 3T30A 1G9AA 2BGCA 4AEMA 3ZIWA 2JKXA 3EHKA 2FHRA 2I74A 5FZGA 2FCVA 2P6HA 3GDBA 1WMFA 4RGAA 1H8TC 2UYAA 2WO2A 5CG8A 3VHOA 3AMNA 5GLZA 3ZFEB 3WNLA 1EV11 1JZ3A 2Y6KA 4N9IA 1MS3A 4LA3A 4B4QA 3H7JA 5FRAA 3BIWE 2PHUA 5T5PA 3MPPG 3FJSA 4LORA 1BMV2 2BJSA 2QQOA 3S30A 1ZNPA 3PVEA 1W6MB 1K3IA 3RFRA 4YVSC 4QGNA 2W5FA 1GQPA 5CB7A 1GZCA 1S0JA 1Y9GA 2YGLA 1HQLA 1KGYA 2WUHA 3N36A 4IEPA 2VCAA 1V6NA 1G8WA 2ETEA 1RC6A 3HD8B 1FOD3 1N3OA 4LK7A 4JX0A 3VDAA 1FMD2 1GQHA 4A2UA 1F35A 1H9PA 4CVUA 4FPJA 1PIV1 4LOTA 4LBOA 4XDPA 3T3YA 3LA7A 4XF4A 2RS11 4XZUG 5IVFA 4K8RB 4RS5A 1FV2A 5FZKA 3V0BB 2RV9A 3AZVA 3ZOIA 2XLFA 3WQ1A 5E1RA 4CCNA 5A3OA 3HIFA 1G7YA 2VULA 3BPZA 3IMMA 2KXLA 4YWAA 3ASIA 1YIFA 1W2OA 1W8OA 4UFHA 4Q0UA 1VB4A 2EA7A 3J7MA 2JICA 3AZZA 3F2ZA 1VRH1 3ZYPA 4HLTA 2IXIA 4OI0A 4FPKA 2XWJB 2ILMA 3T1LA 3ZDVA 3WHTA 2G19A 1V9U3 2XJTA 4SBVA 1I1EA 1ZZ7A 4H2AA 1JOPA 2IFWA 4L2NA 1S2BA 1M06G 2RE9A 2B7YA 4N53C 4PDWC 1WZXA 1IPKA 3WLUA 3VHNA 2HWE1 1AR93 2PHFA 3I97A 4WM7C 2WLQA 3N7MA 1FMD3 2WZ8A 3FFQA 4MGTA 2DVGA 2X5IC 3SXWA 3NKTA 4PI0A 3WQ0A 1B09A 1UU6A 2XJVA 3OEAA 1S0BA 2Q5TA 3I3DA 1XSQA 3NNLA 4UW4A 1OUXA 2IFRA 4QQPA 1DGWA 1H4HA 3KWVA 4WVWA 3AMHA 3GALA 4Y26A 5CKMA 1X33A 4YGCA 1Y9MA 1JHNA 4YG3A 5C4WA 2WT0A 5T5OA 5FY4A 5ISLA 4E8CA 2VZPA 4LKDA 1MZEA 4FAHA 2BBVA 1PO13 4IEQA 1RUJ3 1WBLA 1YQCA 3AFKA 4JKLA 4Q2FA 4XBLA 5AC93 5FO8B 2YROA 3F95A 1OFNA 3C7FA 4AVBA 5M0TA 3JBG1 2HJIA 3EO6A 4PI2A 1YFYA 1ZZBA 5H9PA 2WFF1 4XBQA 5JPNB 3DYOA 4CCMA 3VBFA 3PVBB 1YNAA 1AXYA 1OA3A 2FCUA 5GJ6A 4AI1A 4FOWA 1CJPA 1PK6C 1LRHA 3MUZ1 4FOQA 1AX0A 5J98B 4NIHA 3ETPA 3ZSEA 2VNOA 3JQXA 5ABJB 4C1XA 1FPN1 5KHJA 3KLSA 2D6OX 5FLJA 3RJRA 1F5JA 2D6MA 2B46X 4CUGA 1BEV3 4OYUA 4OUEA 5HCHA 1Q8PA 1PMHX 2ARXA 2VBBA 3T0DA 3WUCA 1J1LA 2X53S 1AR62 3ZFGB 1BLZA 4LXLA 3T4VA 5F32A 5C33A 3VBRA 3VB9A 4UF0A 4LO4B 1TME1 1K45A 3AP6A 3DKQA 2JDZA 2Q8OA 5FREA 2DWRA 4CP1A 1AJOA 2WABA 1ULCA 3UL2A 4EE2A 1XE8A 2JECA 4YFZA 2J1VA 1OVPA 2Q1FA 3AP5A 4OZXA 3VGIA 1O8SA 4V1PA 2ZABA 1HIXA 2XVGA 3P1IA 1UIJA 3C7HA 4Y4YA 1GWLA 3P6BA 1LHWA 3C3VA 5FZ0A 1Y3TA 1IZ3A 3KVBA 1FNYA 1YFUA 1CPNA 1CJDA 4JGZC 1VBC3 4LBLA 2L9LA 1XXNA 4X8PA 2Q8CA 5LBBA 5JR7B 1W39A 3ZKUA 1LEMA 1LHVA 1URXA 1GP6A 4ARXA 4XQ4A 2AYHA 5CFCC 4BK5A 1VBB3 3G7DA 3FUOA 4BE3A 5FUIA 5CAZA 1TNRA 3AFGA 1UKRA 1C28A 1QJY3 2HEVF 3K4DA 4KNCA 4FPOB 2VNRA 3MI8A 3O14A 3FL7A 3LPFA 4DMIA 2OS2A 4U2AA 4K7JA 4EQVA 1BZWA 3GZEA 4QDQA 4K1ZA 2VUDA 3FN9A 2XQXA 2VG9A 3JD71 2NM1A 4D7SA 3CEWA 2D6PA 1O4TA 4DRVA 2QZ3A 2CSGA 1CAXA 1XC6A 3VKNA 1WW6A 2AC1A 4FP2A 4DPNA 4FPLA 3S6PA 1U12A 2K2SA 4B3NA 1UZVA 2OQ6A 3K51A 4AQSA 1RL3A 2RR11 1RHI1 1MS9A 2HWD1 1POV0 4QM8A 3VZMA 1ZZ9A 2C6SA 3GCWA 5DXDA 3CJXA 4CP9B 1NQJA 5IK4A 2A75A 2DTYA 2Y6LA 4NMIA 2HWF1 4TWTA 3RSJA 1YI9A 2PHLA 4Q4X2 2ZGLA 4MSVA 2BYVE 3FUQA 4QPWA 4YM2A 1CAUA 1UY2A 2VZOA 1D7PM 1X36A 4CP9A 1NA1B 2QDNA 4TTGA 5KXBA 1JS9A 2O0OA 4QX8A 3NV1A 1LODA 5A1AA 3IDBB 3LB9A 3N7LA 4HONA 4K40A 2RHPA 3A4UA 3K3NA 2F6BA 4WV8A 1LHNA 4CXYA 1AYN1 2AREA 3E6CC 2HWC3 3H8RA 1DBNA 4AAPA 4AOCA 3HT1A 5GLTA 5J96B 1FV3A 4XURA 1OA2A 3E6DA 1RUOA 3ZXLA 5A32A 3V0BA 3UV9A 4BH9A 4Y20A 3ZYFA 4CDQA 1UPSA 4DY3A 2QNKA 5A7WB 2XWBB 1LOCA 1QNYA 1AF9A 4XHBA 1O6UA 2RG4A 2UWCA 1DU3D 2JKBA 3NJYA 5I8TA 1RVF3 1ZYBA 1UY1A 5LBEA 2VXJA 2WZR3 3ZSLA 1VMFA 3CL1A 1RIRA 3ZMNA 4QKBA 5FOBB 4Q26A 2GAUA 4L8QA 3H8XA 1C8M2 1MZ5A 2O14A 2NMOA 5KBFA 2QQMA 5B4NA 1W0PA 3H50A 2PQQA 1QJFA 1K5JA 3MIFA 4HG6B 4FT8A 2VZSA 2VOTA 1OA4A 2YBKA 4MYEA 4Y24A 1XYPA 3AMQA 1BHGA 3PJQA 1DZRA 2GNMA 4E2SA 3O1RA 1PIV3 1W0OA 1R082 3B00A 3I7DA 2DU1A 4CRQA 4XUNA 2VVDA 3ZR5A 3BOPA 1PO22 3BVCA 2XXZA 1ZX5A 1QOSA 4QXKA 4CEYC 4DRRA 1O8PA 1ZBE3 3B5LB 3J7NA 2PAKA 4GMP0 4P9YA 4LO8A 3ZXKA 4RGKA 3WT3A 2C9KA 1YQ6A 1RUH3 2XBO2 3INAA 4Q1RA 4Z2AA 2I45A 1VBA3 1J58A 5JIAA 3NRUA 2VQTA 2Z79A 3C8XA 4R4XA 5IVYA 4XF0A 2B4KA 3J8F2 2RR12 2XKPA 1O3RA 1RUF2 3VBUB 1S0IA 5C8WA 2YDEA 2GNTA 5B2GB 4DOUA 3M3CA 1V9U1 4JV4A 1SLAA 1H0BA 1SACA 4OI1A 1NLQA 4XILA 3Q8AA 3VBFB 3WDUA 4OHWA 4Q0SA 2WL1A 4FXGB 4Q4W2 3SH3A 2X29A 1NLRA 3OBTA 2GH8A 4GWMA 4DUWA 3RYRA 2GC0A 4B29A 2E51A 2BOJA 1HV0A 5CA6A 2ADEA 3DXUA 4LHLA 3ZYHA 4GJYA 4ARYA 3TWIA 1ZREA 2Y64A 4QDSA 2Z42A 4B1LA 3NNGA 2P3KA 5C4WB 2VZRA 1HN1A 1HLCA 2F4PA 4M3CF 5FV3A 1HN0A 3IT8A 5A7SA 3WW3A 2GDFA 1PK6A 3T2OA 3WD5A 1ZRCA 1BVP1 2R0FA 2XMLA 2NLRA 3O1TA 1REDA 1UX7A 2C24A 3J26N 5AC91 4AR2A 3LIHA 2WN2A 4MGKE 2X10A 4JVAA 4JDNA 5FK8A 2DUQA 3DPRC 3POIA 4Y1YA 4YVWB 4Z2WA 1ACCA 1HXS2 1NE6A 5E8AA 3U4XA 2BNNA 4AK3A 1BK0A 1QJZA 1QOTA 1TG7A 1AX1A 2WBKA 4PBPA 3WY6A 4YW3A 3ZYRA 1VBE2 1AYM1 4E2GA 1ST8A 3IAQA 2P5BA 3OGSA 3K75B 2WNOA 5JR2A 5DUXA 4HOOA 3OD4A 3ZN5A 2E7QA 3VDDC 1UZYA 4PIZA 2WS92 2ZPXA 4IEZA 2Y6GA 2EVXA 2QE3A 2FD8A 1X8MA 3I59B 5FY9A 1AR61 5FPBA 4M3CE 3POGA 5C6CA 1REEA 2VOVA 4ZZ5A 1R1ZA 2HLEA 3AKSA 2R6QA 4MADA 4HK9A 1T6BX 1N47A 2EIBA 1FPN2 4S2GA 2PN5A 5JIUA 3R4SA 1WCKA 5GZDA 3IN9A 2KA3A 3NO8A 1RUH2 4BQ5A 5CNAA 3RGBA 4AVAA 5FY1A 1I9RA 3UJOA 4F7ZA 2DCJA 4FPCA 4W4ZA 1RJ7A 1UXZA 3ZN4A 2CWSA 1C1FA 2XONA 1IOAA 3AVSA 3ITQA 5C5TA 4XIKA 3ZXFA 5C8CC 1POV1 3J8F3 4CEYB 4QHZA 1NKGA 1OPOA 5JXJA 1XPWA 3LA3A 3PDQA 5ABJA 3KF5A 3HJRA 5DAWA 3S57A 4Q1PA 1RITA 3E5UA 2B5HA 1U5YA 4UFLA 1N1VA 4IV1C 5GALA 2J1EA 2VW1A 4QPIA 5IVJA 1PM7A 4XXAA 1A78A 5DZFA 2QZ2A 3BN6A 5FY7A 4YZ1A 1JN2P 1H1MA 5AFBA 1A34A 4YLZA 2ATFA 4AZZA 1NCQC 3EBRA 1BMV1 3ZFEA 1O3QA 1QU0A 2VAUA 3CO2A 1COV1 1G9FA 2HWE2 2YXSA 3ON7A 4NPLA 4LA2A 1HRV2 4YM0A 5EHDA 3W58A 2P3IA 4IV3C 4EYUA 4FVVA 1WMDA 4FPHA 4NHXA 3M2MA 4LULA 5K4LA 3APBA 3ZIXA 1AVBA 1GNHA 3N3HA 4YW7A 2VCBA 3LF7A 4FCAA 1OT5A 5L19A 4IGQA 4OQ8A 4JGYA 2A6VA 5EWSA 4IW3A 1XE7A 2C5DA 1GP4A 5FZMA 5LATA 5A1LA 1A8DA 4GIQA 3AZXA 3N9OA 3TB0A 2GMPA 5CIRA 3AZYA 3R4DB 1RUNA 2BUKA 2RS33 2YPJA 2HWF3 4A42A 4QX5A 1FNZA 4Y1UA 5B4XA 4N9HA 3M3IA 3OUIA 2JDMA 1NA1C 4HPKB 4QAWA 5K0UC 4RR3B 1PGL2 2R072 2QDRA 1ND2C 3J7HA 4N53B 4PDWB 4DNYA 4ASLA 4ZZ8A 2E32A 3AMMA 2XUMA 5FFOC 5AVAA 3K46A 1Y43B 1IPJA 1JU4A 2WAAA 1CVNA 3O12A 3RZKA 2HWC1 4GKXA 4EN9B 5IJRA 1C3HA 2G1MA 1XYNA 2JIGA 3K48A 4YNIA 3TEXA 2CGNA 2R071 2BU9A 1RUC1 1KDKA 4K8FA 2VVFA 4XFFA 5JOXA 2WSVA 2X8KA 1AYN2 2YY1A 2XPJA 2VR4A 4URAA 3NNJA 1CD3G 1AX2A 5J3UA 1O3TA 5F9TA 1JTZX 2RMU3 4MX3A 1N3QA 5FYTA 1N1YA 4AE2A 3S0MA 1DHKB 1POQA 3AYEA 4WVMB 4XJ9A 3P3PA 2EAAA 1ENQA 1CWPA 4K6BA 5FPAA 4QWNA 2JG8A 3KV9A 1TEIA 2VUAA 3VBSB 3CIHA 4YGEA 4YZ2A 3WF3A 5JWPA 1QDOA 4Q4V1 4R4ZA 1CIYA 1OH4A 1UN1A 2HWD2 2IXCA 3IDCB 2I2SA 3GBWA 2VH9A 2RS53 3RWKX 5FMCA 1OUSA 3KT4A 1LR5A 1K42A 3IIAA 1T6GC 3CJIA 2WWUA 4RHV2 4B4RA 5A3UA 5IFTA 2OUHA 1IS6A 2EALA 2ZEXA 1MS4A 1MZ6A 4GH4C 1CR7A 4PJYA 4S2FA 2X05A 4BQ1A 1LGBA 1D0HA 5FR3A 4HN0A 5FTTC 4HL0A 4OULA 1XOYA 2ZGNA 4YG6A 2Z2SB 2FDFA 3FX3A 1W05A 4L11A 1YQ2A 4GQ7A 4QB6A 3VBHB 3H8OA 1RUD3 2NPIA 3M3EA 2CAUA 1H2LA 4CUBA 1PX3A 2P3YA 1L7RA 1VBA1 4O65A 3TBDA 4XFBA 3CJIB 2VW2A 4BYYA 2JEMA 2E9QA 2XB6C 3I2OA 2J22A 2BQPA 5EIYB 2XOMA 1C8NA 4P9XA 2ZOEB 1R092 3BTYA 4AVCA 2HYKA 4OHYA 3I4IA 4BQ3A 3LEKA 1L3JA 1U5ZA 5DPNA 5BNNC 1XBFA 1O3SA 3POYA 2JG9A 4HKLA 2JB8A 1HB3A 4JTOA 3WX5A 4LLOA 2VUJA 4WVMA 2ZEYA 3VBOB 2YPDA 4CCLA 4ISQA 5KHIA 3ZPOA 4CDXB 2A70A 3ZYIB 1EAH1 4BQ4A 4CDWA 2A3XA 5ACA3 1J84A 2GSYA 5LY2A 1LU1A 1US3A 1TME2 1W6OB 2F4LA 4FSJA 1JZ5A 4YVWC 2DFCA 5JOWA 3VD4A 2VD7A 1X82A 3LAGA 4D94A 4Y22A 1R1A3 3DPRA 5JZGC 1D4M3 1ZRDA 2WS91 4XF1A 5T55A 2XJRA 5FZ6A 2DCTA 1Q3EA 1GBGA 1SPPA 3GNEA 2WFPA 3PNAA 4N53A 4OHVA 4PDWA 4KG8A 3SH5A 4BCUA 2OVUA 1YI7A 2RDSA 5EQUA 1CX1A 2UY8A 4LJHA 2DUPA 4Y1XA 3N9NA 4NWWA 4NIIA 1VBD3 3A0KA 1QKQA 4LO6B 2JX9A 3WUDA 2W68A 1P8JA 1W6QB 4LT5A 1WUVA 2A73B 4M3CB 4S2HA 1JW6A 4P9GA 3WSOA 5FZCA 1AR92 1V6KA 4TXWA 4XUPA 1DQ4A 4FFIA 3DN7A 1DGRN 1OQDA 5IAXA 1QXJA 4MHRA 4EWDA 1JU3A 3WCRA 4C90A 4KH9A 4P08A 3EXUA 4BB3A 4YM1A 1H6XA 3GGLA 1IPSA 3HPNA 4CDXC 4IXLA 3H3ZA 1UKGA 3I3EA 3HQXA 1NXD1 1LOEA 2X5IB 4O61A 5F6LB 4XDQA 4BQXA 4PIYA 3RZMA 1DZQA 1GNZA 1DYKA 3IM0A 1ONAA 1SPPB 2VO5A 5JXIA 4LBNA 5HPOA 2ZGPA 3I49A 1CAVA 3OPZA 3PMSA 1PO23 4C8DA 1JYTA 3JQWA 1YJKA 4KBBA 1K12A 2DVAA 2OQ7A 5A70A 5I93A 4RFRB 2FZ2A 2CGOA 3WF4A 3WP6A 4CDQB 2LTNA 3J8F1 4H55A 1S1AA 1ULEA 5SV5A 4CEYA 1TNFA 2C1FA 3LIGA 3SEEA 5J36A 4LR4A 1CAWA 1U5XA 3AYDA 5F5AA 5FWEA 3BU0A 3GXUA 1W6PA 1BYHA 1CZVA 1VRH2 2WZR2 3BGAA 4BIFA 2K0GA 3IMNA 3Q9OA 2XVKA 5EYYA 2E7AA 1IG0A 5FKCA 3WW2A 4QHBA 1TVGA 4FOVA 5SV8A 2VVEA 5FAXA 1XQNA 4FTSA 5C3RA 4GA9A 5ANQA 4AQTA 1KQRA 1UCXA 1JZ8A 1I5PA 1NA1A 5F5IA 1ASJ2 4QD2A 3PL0A 1XNBA 4PIXA 3LOIA 4KG0A 1QJU3 1COV3 3ACGA 2XQRA 1BJQA 1F5FA 1V6IA 2VGDA 3KQRA 3LDRA 4AVTA 3SQOA 1NZCA 1OF3A 1PIV2 5C8CB 4XAAA 4TSVA 2FDHA 4CDQC 5EV7A 4EWEA 1K5MA 3QOPA 3KV5A 4ZHNA 2VMGA 4IE5A 5A7NA 3KGLA 4SLIA 4P5HA 2XJQA 4JHZA 3S7IA 4OFGA 4CCOA 3LDKA 2G4IA 3LZZA 1NCQA 3MV01 3DCQA 3OG2A 5DDJ3 5KXEA 1H8TB 5DZEA 5FPUA 4XMIA 2Y6HA 2ZTNA 3OBZA 1UYXA 3D6EA 3DYPA 3MIHA 4PF5A 2WZPP 4HFSA 3MUY1 1KEXA 1AR91 1J3RA 1PVC2 2ZMLA 1UD1A 1NY72 3H1WA 1GZWA 3PIGA 4QPIC 1W9WA 2XR4A 2WA3A 2OW4A 5FZHA 3MHZA 3BKZA 4DXSA 3MZHA 2D5FA 2V72A 2AH2A 4CEWC 3FBYA 4LKSA 4Q0PA 3AJYA 4QU2A 4PQQA 1RUI3 1MACA 4LHNA 5C8CA 4FTBA 2R073 2RDRA 3GM8A 4DZGA 1RUC3 5T54A 2VTXA 3L2HA 2R042 4AFCA 3WNOA 1PO11 5GLUA 5FYMA 2LM3A 2RMU1 3AMPA 4GALA 1OD3A 1SDDB 3H1MA 1RHI2 3AVRA 4RR3A 4LPLA 1W8ZA 3B94A 4IDZA 3NL1A 1GP5A 1W8TA 2Q1ZB 3QBQA 3MIEA 2VY0A 1WWYA 3U10A 2OKXA 1LHUA 4JDMA 2RS51 4I0AA 4N43C 1EPZA 1SFPA 4E4DX 4FBFA 5CFCB 3ACLA 3BCWA 4K1YA 1WCQA 2HWB2 2ZGSA 4NPRA 4AFBA 1LAJA 3T0AA 4R9BA 5CYYA 4CYDA 3A0NA 1J83A 1GQGA 1V6LA 3MFAA 4UFKA 4CCEA 4CCCA 1FPN3 4XETA 4LOSA 1T2XA 3HEIA 1YCIA 3K4ZA 3LE0A 5T5JA 3CNAA 4HK8A 4FO9A 1V6MA 1OQ1A 1W03A 5DUUA 3WZ1A 5BY5A 4LKFA 1V0AA 4ES8A 1KDMA 3TOJA 3WDVA 4WVZA 1ZA4A 4LUKA 3RI9A 5HBAA 2OZJA 4G4FA 2WAOA 3UETA 1RUD1 1AL22 4JDOA 2RM23 3BALA 4ONUA 4A3ZA 4DQAA 3PURA 1RUI2 3OB8A 3PUIA 4GXLA 3RZHA 5FPLA 4Y5Z0 2Z69A 3EB7A 5HI0A 3H0OA 1OLME 4C0HA 2XG3A 1GWMA 2E7TA 3SITA 1Q43A 3RMXA 1S0EA 2W52A 5CADA 4RHV1 2Q1MA 3M7AA 1DYOA 1OLQA 4GZ9A 4QQLA 4I0WB 1F15A 2R1DA 3TEZA 4M0HA 1ULPA 1VBC1 4HBNA 2R063 2MEV3 4XE9A 2W1WA 3NW4A 1R093 4HVOA 2VC9A 5A7WA 3I54A 5E6HA 1JYXA 5A7QA 3IB3A 4P00B 1CGPA 3E5QA 4AFAA 4Y20B 1DQ5A 1E57A 2RJ2A 3KSCA 2Y0IA 5ACA1 1MR5A 3OSDA 2ZBJA 4WM8A 1OMIA 2O1QA 1VB2A 2D6KA 5DUWA 3VZJA 5FXWA 4YARA 3JD73 5DABA 3NJXA 1F31A 5F37A 1BEV2 2VQ0A 3J4UH 5FLIA 2Y6FA 5LBFA 4E4SA 1RUC2 5LA2A 4YZ3A 2DCZA 5F2WA 1QF3A 2QQNA 4H14A 4J6GA 1ZBE2 5DZGA 2J1AA 2QCSB 2Z5WA 1MS1A 4K9SA 2CY6A 1NX9A 1VBD1 2EXKA 1UMZA 5J1XA 3S5QA 2ZHMA 5F8PA 1R083 4XTMA 3O5SA 4X8NA 2ZX4A 1BBT1 1JZ4A 5FY8A 4XQWA 1NCRC 2PHWA 2W92A 3IIIA 4GB32 4JQTA 4FFFA 4WM7B 4FAGA 4K3UA 4QHOA 5FPXA 2D93A 2NP0A 4BQ2A 1W8FA 3OBAA 5F5QA 2ZGKA 2W91A 5I8YA 5C3QA 1YUDA 2DDUA 4DS0A 3QH6A 5K7PA 2GALA 4OCTA 2UYBA 3AP4A 4RYDA 5D2AA 3RJ2X 1ND2A 2E26A 4HVRA 5FKBA 1ENRA 5K0UA 1RVF2 2WYFA 1ND2B 3VKMA 5IVVA 4DXZA 1L7QA 4AGRA 1VAKA 2EIEA 4WZCA 4E4ZA 3U11A 3B7MA 2WO7A 1NZIA 1YO8A 3RWNA 3LA2A 5FBZA 3UKTA 3ZFFB 3UGGA 4AFMA 3O1PA 1W3VA 4NRQA 5FZDA 2JWPA 3GYDA 3MIGA 4PBOA 2BGOA 1XNAA 2J42A 4IE7A 3VLBB 5FZ3A 2GMEA 1WLDA 3LEGA 4UFJA 1JUHA 3DF0A 2IWGB 1ZRRA 3DKWA 3AKQA 4RFT0 2P3JA 4DFSA 1RVF1 4FOYA 2W95A 2DTWA 3ZSMA 1CESA 1ULDA 3HQRA 3X29B 2WZR1 4EROA 4ZKTB 5DMYA 3AXDA 3MGUA 3PVOA 2XLGA 4U36A 3I2FA 4COZA 2GZWA 4AFDA 2OPWA 3D3AA 4KU7A 4MXWB 4QDRA 2ZGOA 1V6JA 5JXHA 5DN2A 1QGLA 1UZ0A 5I0SA 3R05A 4IGPA 1GZTA 1RINA 5F39A 1GFF2 1Q5OA 3CZUA 1XRUA 2QQKA 5FO7B 2ID4A 2NN8A 5KWRA 4XAEA 3GZUC 5EJZB 4M4PA 3TNPB 2JG8B 2H6CA 5J09A 4LE4A 3IPVB 1W8UA 1LOAA 2A3WA 2E63A 2OZ6A 2TNFA 1O4YA 3P5BA 4YVSB 4JC1A 2WC2A 2O8OA 2QQJA 1ZBE1 2BP6A 2YGMA 4YVSA 5EJ1B 5FZEA 2D5HA 3ZX7A 4CPBD 5HXMA 2JDUA 2W94A 3DV8A 1G9DA 5IW0A 1RUH1 1SBDA 4DIQA 2ZZJA 3NV3A 1H6YA 3W5MA 4COUA 1GANA 3NMBA 3CQOA 1UO9A 3QCWA 4JHTA 4AEKA 1ZBA1 4XPVA 3RVHA 4AI0A 2BRTA 2Y8KA 4MXWA 3Q8EA 5D8AC 1UU4A 2CDPA 2VOKA 1SHWB 5F6KA 5ACA2 4CCDA 1GZ9A 4L9BA 3BI3A 2A6ZA 1GUIA 4IL7A 4XUOA 4BMBA 5LCWL 4YRDA 4HPKA 3O0VA 4KMQA 5FXXA 3MYXA 3ZDSA 1YWKA 2X09A 4N7UA 1IS3A 5IUQA 2R32A 5A6XA 4YSFA 2MPFA 2D98A 4E9KA 4HMZA 2IXHA 1JH5A 1GLHA 5EFUA 3NV2A 2QQIA 5BNOA 1WLWA 1KJLA 1OHFA 1YC61 1YHFA 1B35B 3U75A 4D0QA 1ND3C 2VTXJ 1NT0A 2HWB3 1DGLA 1IHMA 1VE0A 2VMHA 3OJBA 3E6BA 4COVA 1PNGA 4JRAA 5G04L 1J3QA 1JOBA 3BODA 1RUI1 4PT6A 2AZ5A 3VZKA 3O0XA 2DF7A 5FMBA 1YYNA 1AR71 5EPAA 3SNMA 1AL21 4LHKA 5A1FA 1H2NA 2W2IA 2VW0A 4NVPA 1RYYA 3RDIA 4LIUA 1OOPA 2EAKA 2JIJA 3ACFA 3UGFA 3KT1A 1I6XA 1I5ZA 2ZAAA 5K9YA 1EAH2 1JHJA 1W2TA 1VMHA 3MV11 4IERA 3I2KA 4KWLA 4EN8B 3WW4A 1QNWA 5FMOL 1WKYA 2WNVA 2FZ1A 1QWRA 2W08A 4ITCA 2CTVA 2BFUS 1KRIA 3V0AB 4GMP3 3CF6E 4QGLA 1H2KA 3THTA 2N7GA 3UKVA 3WDTA 1AYM3 3PVNA 1SDWA 2V09A 3OF1A 4OMDA 5HCBA 2A3YA 2XH6A 1G9BA 2H0BA 1O59A 1SCSA 3HVDA 3I59A 3P3NA 2HH9A 5LBCA 1JZ2A 1DQ2A 2GC2A 5D8AA 1F9KA 4PLOA 1W6NB 4HT1T 4C1WA 3BUCA 1PVC3 3AX4A 5A3TA 1H1IA 1AR63 2A5ZA 3SLIA 1QH7A 2WYSA 3HOBA 1W8WA 4BIOA 1D4VB 2IUWA 1US2A 1U5IA 2Q4SA 3MLLA 5HV0A 4XABA 1CAWB 1XU1A 1YIPA 1CONA 3HR9A 4AI3A 1VBB2 2C0ZA 1PO12 4B1MA 5JAXA 4FTEA 1X7NA 1EYBA 3VBFC 3TEYA 5LW9A 3N9PA 4XZPA 4ZXKA 1TMF1 5CFDC 2PFWA 3CBNA 3MICA 4IUGA 3RI8A 3VKFC 1MQTA 3MBWA 2QQPA 5EP9A 3M3QA 2W1QA 5E88A 3H7YA 2JDPA 2PAMA 3KZ4C 2KR2A 3T1MA 1DP0A 3JZVA 5BXXA 5C9AB 5FY5A 1LGCA 5FOJB 4LK6A 3ZFGC 4OVEA 3B69A 1DZTA 2Q0AA 2V4AA 2WLPA 5FP9A 3NJZA 4RHV3 4XJ8A 4A6SA 4N7IA 1ASJ3 1PMJX 4NRPA 4XFGA 3QACA 4B8EA 5IYYA 4BJ0A 1LULA 2R061 3R4UA 4N43A 3WNKA 2FDGA 5J48A 2JG9C 1NYWA 3OPWA 4JRLA 4NR1A 3TAYA 4Z8BA 4QX1A 2CAVA 2VZTA 1KJRA 1WMEA 3W21A 3AYAA 4COWA 5FLHA 4OUSA 1XJAA 3NNMA 4LEJA 4QXCA 4ZS3A 2ARAA 2J1TA 1PZ7A 3DXTA 4EV0A 4IETA 4FFGA 3ZM8A 2ET7A 2WQ4A 4QB1A 4XUQA 3T2PA 3WP4A 2XBO3 4C0BA 4IE6A 1WW5A 5FZOA 3FBMA 4EZHA 1OLRA 4UBHA 2QQLA 5D1IA 1GNYA 1J59A 4A4AA 1SBFA 1J3PA 4ES9A 1LU2A 1ZVFA 4V2WA 4NPMA 4GWJA 3DEMA 2VU9A 3IPVA 4X6QB 4BISA 4Y1ZA 5LY1A 2ZGQA 2ZX1A 3M1HA 1F2NA 4XYXA 3N9MA 4AVSA 4C91A 1QMJA 4QGMA 1S55A 4XJUA 2C4XA 4GWIA 3WG4A 4EZ4A 2LALA 1G6NA 3MDPA 1BBT3 1C1LA 3KGZA 4PQ9A 4R9CA 3TEWA 2RS31 2D3PA 3VKLA 3DUIA 2ZHLA 4RGGA 5FBJA 1F8VA 4UW5A 2OPKA 4QX0A 2DVDA 3LSEA 4LBJA 3KCXA 3LDBA 4MOAA 4XJAA 2RJKA 2WQ8A 4LO7A 3ZXAC 3AKPA 2ZEZA 4M01A 3VZLA 4CU9A 4GB33 5L7OC 3MFCA 2ZAHA 4MGYE 1MQTC 4MUVA 3VBUA 1Q8OA 2PHTA 4BPZA 1Q8VA 5F3IA 2CDOA 2ARBA 1ZZCA 2OA2A 2VMDA 2GNBA 3DGTA 3CZJA 4TN7A 3RRDA 5JXGA 5L7OB 4A7YA 1WW7A 1HRV1 2GH2A 4PLNA 1IG3A 2DURA 4XBNA 1EY2A 4IGOA 3POBA 2BEOA 1FT9A 2Y0OA 2YUEA 4NHYA 2JDYA 4NAMA 4XTPA 3ZLIA 4KWJA 4NAOA 1HDKA 3FHIB 1EUTA 1FAYA 4P9WA 4CSWA 4BXSV 1W90A 3EJKA 1MVQA 1BXHA 1UOFA 1UYYA 3RMYA 1AR81 2B39A 1H8TA 1SLTA 3KD4A 1W28A 1JODA 4P9LA 2HBUA 4COYA 4PLMA 1NCQB 4TZDA 3WINE 3M8LA 5A3MA 1W3XA 4WVVA 1GYKA 3ZSKA 1BBT2 4XC9A 4N90A 4P9IA 2WINB 1VMJA 4EN7B 5IHRA 1DGRA 4PCRA 2D40A 4DEQA 3HAGA 1VLNA 3DL3A 3LQCA 1XNDA 4YW6A 2R7EB 5L9RA 5C9AA 4XFIA 3Q8BA 3UGHA 4EN6B 3DECA 1AL0G 5JZGB 2OXBA 3RNSA 2UU8A 3LFMA 1KS4A 3OGVA 5CKQA 5A33A 5A3WA 3KCYA 4ATFA 1UZZA 1OLMA 3PHMA 5FZLA 4AWDA 4J1XA 5LEKA 5I0DA 2C9AA 2JD9A 3GZAA 2YZ4A 4HN1A 5A6QA 2RVAA 4E4HA 3THDA 5FZ4A 4WM8B 3BPSA 3VZOA 1OF4A 5IK7A 1FI2A 4NN0A 3TNQA 2ZEWA 2B45X 1RTVA 2H6BA 4RL7A 4FQZA 1CX4A 1W6PB 3U4SA 4MH0E 1HKDA 3VBOC 3ZFEC 2CYFA 5CVRA 3RS6A 2DVBA 5A6ZA 1MEC1 5F5CA 2BNOA 2V4VA 1W2NA 1VBE1 1VP6A 4KGQA 1PX4A 3WR0A 4UWDA 5FP7A 3I2JA 3L9JT 3WDYA 1HXS1 2ZX2A 5BNOB 1OSGA 3TYJA 3WCSA 3UK9A 1EPWA 2ZMNA 4TLFA 4XEZA 1S0DA 2JE7A 2ZX0A 5JOYA 1VAVA 2VJXA 1RGSA 5EXOA 4A3XA 1NXMA 3JBG2 2KD7A 5HCFA 4M00A 5CISA 4YGBA 3QLQA 4KGGA 5FJKA 3ES4A 4X6RB 2XL9A 2W3JA 4GD4A 3PUSA 3RYPA 2ZXQA 2Y26A 4JTNA 1XNKA 3N7JA 3R6SA 3NNFA 4B7EA 5JUVA 1G9CA 1AR73 1QJEA 2E31A 2DBIA 4P14A 1XNTA 1ENXA 5JDBA 1IQAA 1Q56A 1NAEA 1G86A 1ZA7A 3B9CA 3ECQA 3NKGA 5FDBA 2H0VA 1PGW1 3A21A 1UIKA 4CXWA 1YFXA 4P02B 1IKQA 4AG4A 3O1SA 3NAPA 5L73A 2AEYA 3GJBA 3BTAA 3HT2A 4Q5OA 4RQPC 2RS52 1QXPA 4UFMA 3LSDA 2QBXA 4MGQA 4AGVA 2D6NA 3NSTA 5FUNA 4QXBA 4QX3A 1DQ6A 2P37A 3VHRA 3BB6A 4QU1A 2PELA 3RYKA 1ZRIA 2BFUL 4LMFA 2K9ZA 4J1WA 2D44A 4XW3A 3I3QA 3L2YA 4Q4V2 1UF2C 2WNEA 4Y4RA 4R52A 1OKOA 2XJSA 3ATGA 4BA6A 1H1AA 3THPA 3T08A 3N4MA 1W6OA 1F4HA 4NWVA 4F8AA 1YJLA 5T52A 2K46A 2PLV1 5FZ1A 3LD8A 5FQ0A 1VAMA 1IQDC 1BKZA 4QQHA 1VIWB 2XL7A 3BIEA 1TMF3 1Z7S2 2QTWB 2TEPA 1PO21 2E53A 5EJ3A 1LOFA 3NAPB 3FZ3A 2HWC2 3KV4A 5JI7A 1NCRB 2WA4A 3JXSA 3IKWA 4XXPA 1DG6A 3ZN6A 5LASA 4CU7A 2P4EA 2RS12 3VZNA 5FYUA 2PHXA 1V00A 5FZAA 2ZKNA 3GBFA 3SCFA 3WNXA 4AGGA 1RXGA 3ZPYA 1PGL1 2ZGTA 4NJ4A 4L0PA 4MXVA 3OYWA 3MEPA 4ZY9A 1CN1A 1N1TA 5IATA 2R49A 1ENSA 5A3LA 2IVIB 2E6VA 1H30A 3Q8FA 4RA0A 3FC0A 4R9DA 3JB8A 1DIWA 4QM9A 3H9AA 1SZBA 2YC2A 1OD5A 2Q30A 2YC4A 3VBHA 3WF2A 1PZ8A 3MPBA 1H8VA 1RMU1 2W46A 2YMZA 1NE4A 4RQPA 5T50A 3FHAA 4QQ2A 1FXZA 2Y34A 1UAIA 4AAXA 1SMVA 2PTMA 4W6WA 4E8DA 4UFIA 2G9FA 4O9EA 1EV12 1LESA 1QJU1 3S7EA 4XFAA 4QMAA 3V64A 1TZOA 1Z7S1 3CLPA 2GN7A 3C7EA 2OT7A 1OPMA 3V56A 1LENA 3LPGA 1FOD2 2PLV2 4BK4A 4IEXA 3A22A 4RSUA 1HB1A 4Y5TA 3BOWA 3PUAA 1UXXX 3MF6A 3POJA 1JMUB 5DDJ1 3VBSA 5FPZA 1D2SA 2CU5A 4Q4X1 5FZ7A 5APAA 2VOXA 1UX6A 3HWJA 4AF9A 3ZXGA 2OUJA 4FPYA 5KHHA 5A7PA 3VL8A 2EICA 4AEDA 3GZTB 1KD7A 3SCHA 3PJYA 1HRI2 1QJX2 1SLIA 4QB2A 4TLGA 1AJKA 3T4HB 5JZGA 3URFA 1PVXA 2CNAA 1UY3A 3FWEA 3KVAA 1C5HA 3MW4A 5JOZA 2EXIA 1EP0A 3G6JB 1SLLA 3VDDB 3W59A 4NHLA 4P5YA 1Z78A 1RJ8A 5I91A 2LS6A 4QPGC 4BMEA 1LECA 1IS4A 1S2KA 3AXEA 1W9SA 2WNVB 4ISRA 4DO0A 5BYNA 3GF6A 2ENRA 4QX2A 2QVSB 2VTFA 4RQPB 3WNPA 4GULA 4GKYA 1NQDA 3ORJA 2BGPA 2GMMA 5LRSA 2J1RA 1MPXA 1Q8QA 3KHBA 3M70A 1AR83 3IZOA 1APNA 1LCLA 3ETQA 1QJY2 3AK0A 1AHSA 2DBNA 4AXOA 5A6YA 4I3GA 4D8MA 3O7OA 4Q8LA 5FZ9A 2A1XA 3D8CA 3N9QA 4OI4A 1XU2A 1W6QA 4H7MA 3WDXA 3LCPA 3J9SA 1STMA 3ZVXA 4AL9A 5JMCA 3LKJA 2ERFA 4NIDA 3NJVA 3Q8CA 4Q4W3 3ILFA 1C5IA 2VMIA 1VPHA 4Z1VA 4LBQB 4QPGB 1MEC2 3VDBA 1S2EA 4XHXA 4CEWB 4IEVA 5FZFA 1C4RA 5DQ0A 3O1OA 3C7GA 2B9VA 2C26A 4QPIB 3TN93 2WNVC 1S4CA 4XJZA 4QPYA 3AP7A 3KB5A 2CGPA 5FZ8A 2RM21 4G9SB 3IAPA 4NHKA 3SCGA 5FYSA 2P1BA 4CDWB 1W2AX 1QQP1 1HB2A 2QQUA 1O5UA 1VALA 2IZWA 5FYCA 3SHRA 2PHDA 3MIDA 4CU8A 2EF6A 1DF0A 3CJIC 4WZFA 1MS5A 2VZ3A 3VBOA 3M3OA 3WW1A 3PLQA 5F3GA 4LTAA 1WA6X 1HRI3 1QJX3 3VBUC 1VBE3 4EN0A 5IVEA 2VMFA 3VBHC 5IK5A 5KXDA 5DAQA 3E5XA 4L99A 1HXS3 1YRZA 2A7AA 2YYOA 2MEV1 3EYPA 4YW5A 3T0BA 4JGZA 5FYZA 1R091 2Q8EA 4MLOA 3OCPA 1SFYA 4XMAA 1ULFA 4GH4B 2QQVA 3D0SA 2PHRA 1RUE2 4PF1A 1WD3A 4JKMA 1RUF1 3IDAA 4KU8A 1VBA2 2CL2A 5DG2A 2PQSA 3N35A 4DINB 5FWJA 1UYZA 2YBSA 3W20A 2CWMA 1AR82 4YPJA 3ROUA 3LFIA 1YLLA 1CIWA 4N8MA 3C2UA 3FHQA 2W0XA 1UMIA 5D21A 4BM8A 2A71A 2LRPA 4Z07A 3A7QA 4OMCA 2YV8A 5FZIA 1FOD1 3VDCA 4QKFA 1IS5A 5C3OA 5GZGA 4HKWA 2JXAA 2J7MA 5KR7A 1UOBA 1YEWA 3A23A 4LO5B 1R081 3OGGA 5GZCA 3QH7A 2R0HA 5K8SA 1RUJ2 5I0RA 2JENA 2VMEA 4UT5A 4DEVA 2WKKA 4AHWA 5LRRA 3BTZA 3WOGA 1X9PA 1JYVA 2GP5A 1WBFA 4FXKB 3JU9A 2BVVA 1W0NA 2BNMA 2O8QA 3ZYBA 2NZ9A 3SMHA 1DQ1A 1GOFA 1OKQA 3KMHA 3VV1A 3PUHA 5JLVA 1VRH3 3GCXA 5FP8A 4IEUA 5L7OA 1GOHA 4FPFA 1UZWA 4I30A 5F3CA 5KHKA 2ZKLA 2WIIB 4XDOA 2ORZA 1GSLA 1W04A 5JPMB 1VBD2 1H2MA 1SQ4A 4O7XA 4LUMA 5HCAA 2VXRA 1AUYA 3QD6A 4D6SA 2D6LX 1X50A 5CEHA 4IEYA 1LGNA 2WN3A 1N3PA 2WDBA 4P9JA 1WCSA 1E5HA 3THCA 1Q8SA 1VJ2A 5FO9B 1FMD1 4L97A 3U1XA 3OUHA 5GLVA 3U78A 4XIOA 2BOIA 3USSA 1LJ7A 3FLTA 4AHYA 4ATEA 1JZ7A 4OHZA 5LA0A 1JUIA 3OD0A 5DAVA 1MS0A 2QJVA 5HXVA 5G05L 2QFEA 4DXTA 1O7FA 2P6CA 1XNCA 2OIIA 4FPGA 2WT1A 2HYXA 5C5UA 4GJZA 1LEDA 1ZZ6A 3ZO0B 2R062 2ZGUA 5AVPA 5LK7B 2NYYA 5BV6A 1V6OA 1OFSA 1RUJ1 5FCCA 5I8SA 1JYCA 1RMU3 1B35A 5C3PA 4UAPA 3S5AA 5FIXA 1S0GA 5JI9A 1W99A 4FFHA 4R9AA 3MIBA 3AB0A 2FDIA 1COV2 5LK5A 2YFUA 5TSWA 2WFF3 5GLWA 1OBNA 4CUAA 1ZRFA 5FK7A 2W9XA 1OOPC 2FDJA 1OH3A 2XDVA 3JD72 4BLJA 4D69A 4XUTA 1Z7S3 1ZZ8A 4CCJA 1JYIA 1HQWA 4UXAA 1PGW2 4I01A 4M4RA 1LKNA 1ZBA3 2FCTA 3AZWA 4UW3A 1W9FA 1UPIA 4UW6A 1IKPA 5CKNA 2VQUA 4OQ9A 2BZDA 4A7ZA 3VDDA 1RUD2 2VCMA 1NLSA 5LEJA 3FMGA 4YYOA 4Q4X3 2ES3A 3HBKA 2BV4A 5CFDB 5C9AC 1RUE1 3ABZA 5BNOC 1AXZA 1RUG3 1WCDJ 1L7LA 2VZQA 2VE1A 3USUB 3U0ZA 3OEBA 1FATA 3AJZA 4KBZA 4MVTA 4AEJA 5EYXA 3MW2A 2VPVA 2YB7A 2A6YA 3M4FA 4NE9A 1SLBA 1ODNA 3WP5A 4WM8C 2BWCA 5J37A 4HETA 3D82A 4URTA 3PU8A 4O9GA 1QDCA 4AQ6A 1CZSA 2HWB1 1O4ZA 3ALQA 4ZU5A 4NIAA 4GWNA 3PU3A 4DXRA 2ORXA 2XHNA 3BU7A 1MVEA 5FXZA 4AYUA 1OXCA 2OYZA 2VCCA 1D4M2 4A41A 3J7LA 2G9GA 2WO1A 4META 3HN3A 1QQP2 1ULOA 3U07A 1AL23 1YQ8A 5ERLA 3HNBM 3VL9A 1JOJA 2BERA 2RM22 1WLTA 2R043 1DFQA 3K3OA 4XJWA 3BYWA 4ORFA 4FPEA 1KFUL 1UOGA 1KFXL 2ZS6B 5FYBA 5JSPA 1JYWA 1RB8G 4OI2A 3V0AA 2BW8A 2D7FA 1AZDA 1UYPA 3ZYJB 3PIJA 4N43B 3U37A 4UYBA 5F2SA 2UWAA 4MV2A 4YFWA 5A7OA 3I2IA 3ZR6A 3AP9A 4ZONA 3N7KA 3RG0A 4GMP1 4ZU7A 3JCIA 3WV6A 3W9AA 4AHZA 1SG3A 3AKTA 4CTEA 1FYUA 1IGOA 2Q8DA 3VHPA 4QXHA 1GZWB 5E89A 2ZCWA 5KXCA 2GC3A 2WFF2 1PVC1 2RDNA 2XKOA 3POSA 2ZGRA 1Y7BA 3WNNA 1ND3B 2HEWF 2AUYA 4IEOA 1ND3A 1JZ6A 4KI5M 1LOGA 4LQRA 2YC0A 3OPTA 2FMDA 3VD9A 2ARCA 2YBPA 3I2HA 5L36A 2RR13 2VMCA 3B93A 3N9LA 1W9YA 2HWD3 5EZWA 2R30A 4ZPIA 2IXLA 2AR6A 1B35C 3CU7A 4W50A 4HVQA 4WM7A 2PXJA 1W6MA 4RR3C 2P2KA 1PNFA 1W8NA 4B7KA 4V2VA 1HV1A 5A3PA 1QHDA 3ZMOA 4RN5A 1PZ9A 1QQP3 3U14A 1OI6A 4OHXA 1SBEA 3FFZA 5D8AB 4A45A 2DU0A 3WHUA 3W5NA 5FY0A 2D3SA 1AYN3 2VZUA 4L92A 1HRI1 1QJX1 3POFA 4JZRA 3WXPA 5HV4A 1TQ5A 1ASJ1 4CUCA 3OYWB 1JI6A 3CDZB 1W9TA 4I3PA 1BVVA 2DUOA 3MW3A 4LE3A 3CMGA 3WDWA 3SEPA 4ZS2A 4GH4A 4J25A 4ASKA 4ET7A 1GU3A 3O1VA 2AGSA 2W1UA 2VNVA 4FP3A 4YM3A 2FMYA 3D0JA 3LEIA 3R0RA 1NCRA 5DUVA 1UY4A 1OOPB 4DB5A 2XJPA 4D6QA 1RUF3 2FBEA 4INDA 4LITA 3ZFGA 4AI9A 5IT6A 2RS32 2TBVA 3UJQA 2XBO1 4RS5C 4IE0A 4JGYB 4NUBA 2XGXA 4QKDA 5FQ0B 4B4PA 5F3EA 2QKDA 2VL4A 3NV4A 4Q29A 2JG8C 3KF3A 4A7KA 2XVLA 3UKNA 5IFPA 1JXNA 4EJRA 2DFBA 5CFDA 3AL6A 3PTRB 3ZXEA 3OOXA 4XFCA 2P34A 1DQ0A 2B8MA 5JCTA 3WF0A 3E97A 3ME2A 3B01A 1QJU2 4AVVA 1VR3A 5FXVA 1DLCA 1W06A 2CHHA 4YG0A 5H9QA 1K5MC 3ACIA 4Q4Y3 1GMMA 3POWA 4XF9A 1J1TA 1C8M1 1RMU2 4I02A 1QXRA 4I0BA 4CP2A 1GV9A 1A3KA 5JSRA 5FMDA 4I09A 1PGSA 2R16A 2NQYA 3IWZA 5E16A 1DGWX 1SEFA 1A8MA 3ILRA 2ZX3A 3CHXA 2ADDA 4M0NA 1QH6A 1Z0HA 4XFHA 2GN3A 1OQEA 2AEZA 4GB31 4JAAA 3I2DA 3KCCA 1N1SA 4HSJA 4PHZA 1X8EA 3IDEA 4XACA 3ZSJA 2PYTA 4F83A 3B02A 5DAXA 1F4AA 5FYHA 4D3WA 1LTEA 5C70A 1MZFA 5A80A 1H4GA 5K0UB 2W1SA 3KV6A 4QT6A 1HRV3 2NMNA 3KT7A 5LB6A 4OZOA 4QKNA 3UT0A 4KQ7A 2ET1A 3RQ0A 5FUPA 4OUMA 2Y38A 5CFCA 3O0WA 2DCKA 5AFEA 1DYPA 4NOTA 2LROA 3RPQA 2UURA 3T09A 4CDUA 4IE4A 3EMRA 2WNUB 2GU9A 1REFA 4W6YA 5H9SA 2ZHNA 2WQZC 3OGJA 2OX0A 1UY0A 3WEZA 1ULGA 2VNGA 2P17A 4JCKA 5A33B 5F1RA 1X9TA 3KHCA 3RZGA 4MGSA 4JKKA 4LBMA 1LNSA 4Y5SA 3DPRB 5KC6A 2HWF2 2R1BA 4ZXEA 4Y22B 3V65A 3HMYA 1YFWA 3OGRA 4XOGA 1MS8A 4D7YA 4CP0A 4BU2A 1VRBA 4CCKA 3TN92 2BWAA 1U0AA 1VBC2 4NIGA 4AEDB 2GP3A 3LGRA 4BQYA 4RD7A 2BPA2 1O91A 4CDXA 5KC5A 2VQAA 3KQ4B 4IV1A 3ENRA 4W8JA 2A6XA 4HZFA 2EXJA 4IQPA 5I0TA 4YGDA 3VKOA 3TRSB 3ZFFA 3WG3A 5CZKA 5BNPC 1Y9QA 4IEWA 3EQEA 5FJHA 1DCSA 4NHMA 1I3HA 3PUQA 2F17A 3NQHA 2JD4A 2VM9A 1S0FA 4HSLA 3AYCA 2G9ZA 4AW7A 2WR9A 5BUVA 4XVHA 1E5RA 2KM2A 4ASMB 2FQPA 2W47A 2YG0A 4KWKA 2HKXA 4H7LA 1DDLA 1CZTA 2ZMKA 2WSUA 5LZ6A 5GKAC 3K2OA 4WBBA 2SLIA 3KM5A 1MEC3 2MHFA 4H3WA 4BLIA 1GR3A 5BNNB 2VBDA 4YW2A 5IK8A 1XYOA 4AHXA 3WQ7A 1BK1A 4D6RA 2E33A 1RUE3 3LWCA 4D7TA 3LOBA 1RUG1 3GHNA 3NVCA 5L9BA 3SISA 3ACHA 2W39A 3T2TA 2UY9A 4CDWC 4LLFA 1R64A 1JYNA 1EV13 2XUEA 5F7UA 4YVWA 2Z4FA 3VUOA 1E5SA 4NO4A 2A6WA 3ZXJA 5CU1A 3VN4A 3D5OA 4Y3OA 1GWKA 1POV3 1NG0A 4CA9A 1PK6B 2ZGMA 2DYCA 2ZJCA 2D43A 3H3LA 3ZN6B 2RMU2 4LKEA 3MLJA 1YQ5A 4KL1A 5IWFA 5CG9A 4BDVB 3O1MA 2R041 5A3NA 2XLAA 3FE5A 3DYMA 2VECA 4MGIE 2WZEA 5BNPB 1ZBA2 3AKRA 5FP3A 4K21A 1AXKA 1OURA 4S2DA 3HNMA 4Q4Y2 2RS13 3SC7X 3HN1A 3USUA 5GZEA 2WO3A 1WW4A 4AEDC 3KS7A 3SKVA 1FX5A 4A44A 3VBSC 1NY71 3ELNA 4CZSA 1QIQA 3C7OA 1PM4A 3WP3A 1QEXA 2Y60A 2EXHA 4XCAA 4BZ4A 2CV6A 1Y4WA 4CEWA 4YZ4A 2YHJA 2LUWA 4ZU4A 1KITA 3POEA 5FYYA 2AACA 5IVBA 1LHOA 3ZFFC 5BNPA 4MO3M 2ZA9A 2PAEA 3OUJA 2WNUC 5I0UA 2WT2A 3ZKYA 1CPMA 2BDRA 3MLKA 2VOWA 3I3MA 4UI9L 1WD4A 1H9WA 2PLV3 2ZACA 1LB2A 1ZM1A 1W8HA 1MQTB 3H8UA 3HNYM 1UOJA 3H42B 5FZOB 3FLRA 2J1SA 4AI2A 3I8TA 2QUOA 5C71A 2WRAA 3VD3A 2LW8A 5JSOA 5T3NA 2HEYF 2I07B 2HWE3 3SH4A 3WG1A 4E27A 1NOVA 1UW8A 4AI8A 3VD5A 4BOWA 5C7GA 5JMOA 2D97A 3AL5A 3IBMA 1HX6A 3WNMA 4BWOA 3WG2A 4TYSA 4YW4A 5FP4A 4F3JA 3O1UA 1GICA 5JVVA 3WQBA 1GOGA 1UL9A 2AENA 4W65A 1K5MB 5DAPA 5LWBA 5J7MA 2VZ1A 1M4WA 1PMIA 1S0CA 2V73A 1W6NA 2Y33A 1V70A 4AQ2A 3RZLA 3H3UA 1OVSA 1LOFC 5LA9A 3HQUA 3AM2A 1CAUB 3SKJE 4Z82A 3OY8A 4LIVA 1C57A 4Y33A 4IV3B 1D2QA 4MGZE 3JBG3 3H1YA 4CXXA 4LHSA 4Q0VA 1NUKA 2XJUA 1W2UA 2EIDA 4HXCA 4NRMA 4E2QA 4I2OA 4Q4V3 4G3YC 1ALYA 4YZ5A 5KHGA 2BBAA 4JQRA 3GBGA 1XSRA
chains in the Genus database with same CATH topology
1OH3A 1W8UA 1WCUA 4A6SA 2O14A 1W8WA 2LROA 3ZYHA 3ORJA 1WZXA 4AL9A 4LJHA 3F95A 4BQ2A 4CPBD 1W9FA 1GWMA 4CPBA 4YWAA 4BQ4A 1HN0A 4CP9B 4YW6A 3ZYFA 1OKOA 1UOJA 2Q1FA 2WYFA 1W90A 4YW7A 1WMXA 4LK7A 2C24A 1L7LA 4LKFA 4CP9A 1V0AA 1GWLA 2KR2A 2K46A 1GWKA 1W8ZA 2VXJA 3UT0A 4LKEA 4BQ3A 4LK6A 5D21A 4LKDA 3ZYBA 1W8TA 4BQ5A 2JWPA 2LRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OH3 A;  1W8U A;  1WCU A;  4A6S A;  2O14 A;  1W8W A;  2LRO A;  3ZYH A;  3ORJ A;  1WZX A;  4AL9 A;  4LJH A;  3F95 A;  4BQ2 A;  4CPB D;  1W9F A;  1GWM A;  4CPB A;  4YWA A;  4BQ4 A;  1HN0 A;  4CP9 B;  4YW6 A;  3ZYF A;  1OKO A;  1UOJ A;  2Q1F A;  2WYF A;  1W90 A;  4YW7 A;  1WMX A;  4LK7 A;  2C24 A;  1L7L A;  4LKF A;  4CP9 A;  1V0A A;  1GWL A;  2KR2 A;  2K46 A;  1GWK A;  1W8Z A;  2VXJ A;  3UT0 A;  4LKE A;  4BQ3 A;  4LK6 A;  5D21 A;  4LKD A;  3ZYB A;  1W8T A;  4BQ5 A;  2JWP A;  2LRP A; 
#chains in the Genus database with same CATH topology
 2UWB A;  2VZV A;  5A32 B;  2MEV 2;  2SBA A;  2YU2 A;  4JGY C;  3K77 A;  2JG9 B;  5BPX A;  2B9U A;  4RS5 B;  3WF1 A;  3I2G A;  4DY5 A;  1O5L A;  2YU1 A;  2GND A;  3LEM A;  1QOO A;  1QY4 A;  4IV1 B;  4Q0Q A;  2JE9 A;  1KXG A;  1UNB A;  5H9R A;  4LBK A;  1JBC A;  2WWS A;  4UOJ A;  4Z92 B;  3JUU A;  3RZZ A;  4HKO A;  2BVB A;  1BEV 1;  5FZB A;  2BTV C;  2PMW B;  4Q4Y 1;  1A6C A;  4LBQ D;  2TUN A;  1C8M 3;  1HB4 A;  3AC0 A;  4CU6 A;  1OC1 A;  2RJL A;  4MHU A;  1DLL A;  4W6X A;  5FYI A;  1HJG A;  3UYJ A;  4IV3 A;  2B42 B;  1TME 3;  4HAN A;  2IVJ A;  3FLP A;  5ANN A;  2JJ6 A;  2VBP A;  3K4A A;  3OY8 B;  2Y6J A;  3B9I A;  4MG2 A;  5LA1 A;  1UWW A;  3NAP C;  4FQ4 A;  2JDK A;  1KS5 A;  4IES A;  1CQ9 A;  2JDN A;  3ST7 A;  1WA4 A;  2ZZQ A;  3MO4 A;  4UBG A;  2ZHK A;  2EIG A;  3JB4 C;  1RXF A;  3RZJ A;  5BNN A;  2WNU A;  1GKB A;  5L9V A;  2IC1 A;  2JDA A;  3ES1 A;  1UQX A;  4CDU B;  1AYM 2;  2V5D A;  1CAX B;  4Y1V A;  2FDK A;  2GC1 A;  3VD7 A;  1WLC A;  2QQW A;  5BNQ A;  4BQW A;  3VBR C;  5FMO S;  4R8H A;  4XQD A;  2W87 A;  1TE1 B;  1UMH A;  4A6O A;  3OBR A;  3UES A;  4MZU A;  5IAV A;  2JB4 A;  5ABJ C;  1XE0 A;  1RUG 2;  4DUV A;  1TMF 2;  1HQN A;  5AC9 2;  3T2Q A;  1SLC A;  3GHM A;  1EAH 3;  1VBB 1;  3GJA A;  3UNP A;  2VUC A;  4UF0 B;  2IXK A;  4XF3 A;  3E1F 1;  2IXJ A;  4M3C A;  5GM0 A;  3ZYG A;  1QJY 1;  1ODM A;  2V5Y A;  1EUU A;  2RDQ A;  4QX7 A;  3PTY A;  2PA7 A;  3BTX A;  5CBL A;  3OTF A;  2JDH A;  4FI9 A;  3HBZ A;  1R1A 1;  1WGP A;  1UU5 A;  4K20 A;  1SCR A;  1D4M 1;  3CKH A;  5DG1 A;  3PME A;  4YW1 A;  2DV9 A;  2WS9 3;  4DUX A;  1PHM A;  4LNV A;  1HW5 A;  1E5I A;  2DVF A;  4Q27 A;  4QQO A;  4EWA A;  4CE8 A;  2XHK A;  4OLL A;  3D4K A;  2DCY A;  2WWJ A;  4Q4W 1;  1XB9 A;  5T5L A;  3ILN A;  3ZXD A;  1CAV B;  1LOB A;  1WMX A;  2JE8 A;  5C3S A;  1D0G A;  1SFN A;  2WJS A;  1HJF A;  4XCB A;  5GZF A;  5C4W C;  1RHI 3;  5FPV A;  3MF9 A;  4NRO A;  4BHP A;  1V9U 2;  3WVJ A;  1R1A 2;  3I3B A;  5FYV A;  3TN9 1;  4BXF A;  4LBQ A;  4JGZ B;  4QPG A;  1WCU A;  3VBR B;  3B3Q E;  5IVC A;  2J1U A;  2MNG A;  2X5I A;  4GAZ A;  4CDU C;  1AR7 2;  1BCX A;  2HBT A;  1YXW A;  4CPB A;  5DDJ 2;  2D3R A;  3NWK A;  4KWU A;  2YFZ A;  1BQP A;  4Q8K A;  3T30 A;  1G9A A;  2BGC A;  4AEM A;  3ZIW A;  2JKX A;  3EHK A;  2FHR A;  2I74 A;  5FZG A;  2FCV A;  2P6H A;  3GDB A;  1WMF A;  4RGA A;  1H8T C;  2UYA A;  2WO2 A;  5CG8 A;  3VHO A;  3AMN A;  5GLZ A;  3ZFE B;  3WNL A;  1EV1 1;  1JZ3 A;  2Y6K A;  4N9I A;  1MS3 A;  4LA3 A;  4B4Q A;  3H7J A;  5FRA A;  3BIW E;  2PHU A;  5T5P A;  3MPP G;  3FJS A;  4LOR A;  1BMV 2;  2BJS A;  2QQO A;  3S30 A;  1ZNP A;  3PVE A;  1W6M B;  1K3I A;  3RFR A;  4YVS C;  4QGN A;  2W5F A;  1GQP A;  5CB7 A;  1GZC A;  1S0J A;  1Y9G A;  2YGL A;  1HQL A;  1KGY A;  2WUH A;  3N36 A;  4IEP A;  2VCA A;  1V6N A;  1G8W A;  2ETE A;  1RC6 A;  3HD8 B;  1FOD 3;  1N3O A;  4LK7 A;  4JX0 A;  3VDA A;  1FMD 2;  1GQH A;  4A2U A;  1F35 A;  1H9P A;  4CVU A;  4FPJ A;  1PIV 1;  4LOT A;  4LBO A;  4XDP A;  3T3Y A;  3LA7 A;  4XF4 A;  2RS1 1;  4XZU G;  5IVF A;  4K8R B;  4RS5 A;  1FV2 A;  5FZK A;  3V0B B;  2RV9 A;  3AZV A;  3ZOI A;  2XLF A;  3WQ1 A;  5E1R A;  4CCN A;  5A3O A;  3HIF A;  1G7Y A;  2VUL A;  3BPZ A;  3IMM A;  2KXL A;  4YWA A;  3ASI A;  1YIF A;  1W2O A;  1W8O A;  4UFH A;  4Q0U A;  1VB4 A;  2EA7 A;  3J7M A;  2JIC A;  3AZZ A;  3F2Z A;  1VRH 1;  3ZYP A;  4HLT A;  2IXI A;  4OI0 A;  4FPK A;  2XWJ B;  2ILM A;  3T1L A;  3ZDV A;  3WHT A;  2G19 A;  1V9U 3;  2XJT A;  4SBV A;  1I1E A;  1ZZ7 A;  4H2A A;  1JOP A;  2IFW A;  4L2N A;  1S2B A;  1M06 G;  2RE9 A;  2B7Y A;  4N53 C;  4PDW C;  1WZX A;  1IPK A;  3WLU A;  3VHN A;  2HWE 1;  1AR9 3;  2PHF A;  3I97 A;  4WM7 C;  2WLQ A;  3N7M A;  1FMD 3;  2WZ8 A;  3FFQ A;  4MGT A;  2DVG A;  2X5I C;  3SXW A;  3NKT A;  4PI0 A;  3WQ0 A;  1B09 A;  1UU6 A;  2XJV A;  3OEA A;  1S0B A;  2Q5T A;  3I3D A;  1XSQ A;  3NNL A;  4UW4 A;  1OUX A;  2IFR A;  4QQP A;  1DGW A;  1H4H A;  3KWV A;  4WVW A;  3AMH A;  3GAL A;  4Y26 A;  5CKM A;  1X33 A;  4YGC A;  1Y9M A;  1JHN A;  4YG3 A;  5C4W A;  2WT0 A;  5T5O A;  5FY4 A;  5ISL A;  4E8C A;  2VZP A;  4LKD A;  1MZE A;  4FAH A;  2BBV A;  1PO1 3;  4IEQ A;  1RUJ 3;  1WBL A;  1YQC A;  3AFK A;  4JKL A;  4Q2F A;  4XBL A;  5AC9 3;  5FO8 B;  2YRO A;  3F95 A;  1OFN A;  3C7F A;  4AVB A;  5M0T A;  3JBG 1;  2HJI A;  3EO6 A;  4PI2 A;  1YFY A;  1ZZB A;  5H9P A;  2WFF 1;  4XBQ A;  5JPN B;  3DYO A;  4CCM A;  3VBF A;  3PVB B;  1YNA A;  1AXY A;  1OA3 A;  2FCU A;  5GJ6 A;  4AI1 A;  4FOW A;  1CJP A;  1PK6 C;  1LRH A;  3MUZ 1;  4FOQ A;  1AX0 A;  5J98 B;  4NIH A;  3ETP A;  3ZSE A;  2VNO A;  3JQX A;  5ABJ B;  4C1X A;  1FPN 1;  5KHJ A;  3KLS A;  2D6O X;  5FLJ A;  3RJR A;  1F5J A;  2D6M A;  2B46 X;  4CUG A;  1BEV 3;  4OYU A;  4OUE A;  5HCH A;  1Q8P A;  1PMH X;  2ARX A;  2VBB A;  3T0D A;  3WUC A;  1J1L A;  2X53 S;  1AR6 2;  3ZFG B;  1BLZ A;  4LXL A;  3T4V A;  5F32 A;  5C33 A;  3VBR A;  3VB9 A;  4UF0 A;  4LO4 B;  1TME 1;  1K45 A;  3AP6 A;  3DKQ A;  2JDZ A;  2Q8O A;  5FRE A;  2DWR A;  4CP1 A;  1AJO A;  2WAB A;  1ULC A;  3UL2 A;  4EE2 A;  1XE8 A;  2JEC A;  4YFZ A;  2J1V A;  1OVP A;  2Q1F A;  3AP5 A;  4OZX A;  3VGI A;  1O8S A;  4V1P A;  2ZAB A;  1HIX A;  2XVG A;  3P1I A;  1UIJ A;  3C7H A;  4Y4Y A;  1GWL A;  3P6B A;  1LHW A;  3C3V A;  5FZ0 A;  1Y3T A;  1IZ3 A;  3KVB A;  1FNY A;  1YFU A;  1CPN A;  1CJD A;  4JGZ C;  1VBC 3;  4LBL A;  2L9L A;  1XXN A;  4X8P A;  2Q8C A;  5LBB A;  5JR7 B;  1W39 A;  3ZKU A;  1LEM A;  1LHV A;  1URX A;  1GP6 A;  4ARX A;  4XQ4 A;  2AYH A;  5CFC C;  4BK5 A;  1VBB 3;  3G7D A;  3FUO A;  4BE3 A;  5FUI A;  5CAZ A;  1TNR A;  3AFG A;  1UKR A;  1C28 A;  1QJY 3;  2HEV F;  3K4D A;  4KNC A;  4FPO B;  2VNR A;  3MI8 A;  3O14 A;  3FL7 A;  3LPF A;  4DMI A;  2OS2 A;  4U2A A;  4K7J A;  4EQV A;  1BZW A;  3GZE A;  4QDQ A;  4K1Z A;  2VUD A;  3FN9 A;  2XQX A;  2VG9 A;  3JD7 1;  2NM1 A;  4D7S A;  3CEW A;  2D6P A;  1O4T A;  4DRV A;  2QZ3 A;  2CSG A;  1CAX A;  1XC6 A;  3VKN A;  1WW6 A;  2AC1 A;  4FP2 A;  4DPN A;  4FPL A;  3S6P A;  1U12 A;  2K2S A;  4B3N A;  1UZV A;  2OQ6 A;  3K51 A;  4AQS A;  1RL3 A;  2RR1 1;  1RHI 1;  1MS9 A;  2HWD 1;  1POV 0;  4QM8 A;  3VZM A;  1ZZ9 A;  2C6S A;  3GCW A;  5DXD A;  3CJX A;  4CP9 B;  1NQJ A;  5IK4 A;  2A75 A;  2DTY A;  2Y6L A;  4NMI A;  2HWF 1;  4TWT A;  3RSJ A;  1YI9 A;  2PHL A;  4Q4X 2;  2ZGL A;  4MSV A;  2BYV E;  3FUQ A;  4QPW A;  4YM2 A;  1CAU A;  1UY2 A;  2VZO A;  1D7P M;  1X36 A;  4CP9 A;  1NA1 B;  2QDN A;  4TTG A;  5KXB A;  1JS9 A;  2O0O A;  4QX8 A;  3NV1 A;  1LOD A;  5A1A A;  3IDB B;  3LB9 A;  3N7L A;  4HON A;  4K40 A;  2RHP A;  3A4U A;  3K3N A;  2F6B A;  4WV8 A;  1LHN A;  4CXY A;  1AYN 1;  2ARE A;  3E6C C;  2HWC 3;  3H8R A;  1DBN A;  4AAP A;  4AOC A;  3HT1 A;  5GLT A;  5J96 B;  1FV3 A;  4XUR A;  1OA2 A;  3E6D A;  1RUO A;  3ZXL A;  5A32 A;  3V0B A;  3UV9 A;  4BH9 A;  4Y20 A;  3ZYF A;  4CDQ A;  1UPS A;  4DY3 A;  2QNK A;  5A7W B;  2XWB B;  1LOC A;  1QNY A;  1AF9 A;  4XHB A;  1O6U A;  2RG4 A;  2UWC A;  1DU3 D;  2JKB A;  3NJY A;  5I8T A;  1RVF 3;  1ZYB A;  1UY1 A;  5LBE A;  2VXJ A;  2WZR 3;  3ZSL A;  1VMF A;  3CL1 A;  1RIR A;  3ZMN A;  4QKB A;  5FOB B;  4Q26 A;  2GAU A;  4L8Q A;  3H8X A;  1C8M 2;  1MZ5 A;  2O14 A;  2NMO A;  5KBF A;  2QQM A;  5B4N A;  1W0P A;  3H50 A;  2PQQ A;  1QJF A;  1K5J A;  3MIF A;  4HG6 B;  4FT8 A;  2VZS A;  2VOT A;  1OA4 A;  2YBK A;  4MYE A;  4Y24 A;  1XYP A;  3AMQ A;  1BHG A;  3PJQ A;  1DZR A;  2GNM A;  4E2S A;  3O1R A;  1PIV 3;  1W0O A;  1R08 2;  3B00 A;  3I7D A;  2DU1 A;  4CRQ A;  4XUN A;  2VVD A;  3ZR5 A;  3BOP A;  1PO2 2;  3BVC A;  2XXZ A;  1ZX5 A;  1QOS A;  4QXK A;  4CEY C;  4DRR A;  1O8P A;  1ZBE 3;  3B5L B;  3J7N A;  2PAK A;  4GMP 0;  4P9Y A;  4LO8 A;  3ZXK A;  4RGK A;  3WT3 A;  2C9K A;  1YQ6 A;  1RUH 3;  2XBO 2;  3INA A;  4Q1R A;  4Z2A A;  2I45 A;  1VBA 3;  1J58 A;  5JIA A;  3NRU A;  2VQT A;  2Z79 A;  3C8X A;  4R4X A;  5IVY A;  4XF0 A;  2B4K A;  3J8F 2;  2RR1 2;  2XKP A;  1O3R A;  1RUF 2;  3VBU B;  1S0I A;  5C8W A;  2YDE A;  2GNT A;  5B2G B;  4DOU A;  3M3C A;  1V9U 1;  4JV4 A;  1SLA A;  1H0B A;  1SAC A;  4OI1 A;  1NLQ A;  4XIL A;  3Q8A A;  3VBF B;  3WDU A;  4OHW A;  4Q0S A;  2WL1 A;  4FXG B;  4Q4W 2;  3SH3 A;  2X29 A;  1NLR A;  3OBT A;  2GH8 A;  4GWM A;  4DUW A;  3RYR A;  2GC0 A;  4B29 A;  2E51 A;  2BOJ A;  1HV0 A;  5CA6 A;  2ADE A;  3DXU A;  4LHL A;  3ZYH A;  4GJY A;  4ARY A;  3TWI A;  1ZRE A;  2Y64 A;  4QDS A;  2Z42 A;  4B1L A;  3NNG A;  2P3K A;  5C4W B;  2VZR A;  1HN1 A;  1HLC A;  2F4P A;  4M3C F;  5FV3 A;  1HN0 A;  3IT8 A;  5A7S A;  3WW3 A;  2GDF A;  1PK6 A;  3T2O A;  3WD5 A;  1ZRC A;  1BVP 1;  2R0F A;  2XML A;  2NLR A;  3O1T A;  1RED A;  1UX7 A;  2C24 A;  3J26 N;  5AC9 1;  4AR2 A;  3LIH A;  2WN2 A;  4MGK E;  2X10 A;  4JVA A;  4JDN A;  5FK8 A;  2DUQ A;  3DPR C;  3POI A;  4Y1Y A;  4YVW B;  4Z2W A;  1ACC A;  1HXS 2;  1NE6 A;  5E8A A;  3U4X A;  2BNN A;  4AK3 A;  1BK0 A;  1QJZ A;  1QOT A;  1TG7 A;  1AX1 A;  2WBK A;  4PBP A;  3WY6 A;  4YW3 A;  3ZYR A;  1VBE 2;  1AYM 1;  4E2G A;  1ST8 A;  3IAQ A;  2P5B A;  3OGS A;  3K75 B;  2WNO A;  5JR2 A;  5DUX A;  4HOO A;  3OD4 A;  3ZN5 A;  2E7Q A;  3VDD C;  1UZY A;  4PIZ A;  2WS9 2;  2ZPX A;  4IEZ A;  2Y6G A;  2EVX A;  2QE3 A;  2FD8 A;  1X8M A;  3I59 B;  5FY9 A;  1AR6 1;  5FPB A;  4M3C E;  3POG A;  5C6C A;  1REE A;  2VOV A;  4ZZ5 A;  1R1Z A;  2HLE A;  3AKS A;  2R6Q A;  4MAD A;  4HK9 A;  1T6B X;  1N47 A;  2EIB A;  1FPN 2;  4S2G A;  2PN5 A;  5JIU A;  3R4S A;  1WCK A;  5GZD A;  3IN9 A;  2KA3 A;  3NO8 A;  1RUH 2;  4BQ5 A;  5CNA A;  3RGB A;  4AVA A;  5FY1 A;  1I9R A;  3UJO A;  4F7Z A;  2DCJ A;  4FPC A;  4W4Z A;  1RJ7 A;  1UXZ A;  3ZN4 A;  2CWS A;  1C1F A;  2XON A;  1IOA A;  3AVS A;  3ITQ A;  5C5T A;  4XIK A;  3ZXF A;  5C8C C;  1POV 1;  3J8F 3;  4CEY B;  4QHZ A;  1NKG A;  1OPO A;  5JXJ A;  1XPW A;  3LA3 A;  3PDQ A;  5ABJ A;  3KF5 A;  3HJR A;  5DAW A;  3S57 A;  4Q1P A;  1RIT A;  3E5U A;  2B5H A;  1U5Y A;  4UFL A;  1N1V A;  4IV1 C;  5GAL A;  2J1E A;  2VW1 A;  4QPI A;  5IVJ A;  1PM7 A;  4XXA A;  1A78 A;  5DZF A;  2QZ2 A;  3BN6 A;  5FY7 A;  4YZ1 A;  1JN2 P;  1H1M A;  5AFB A;  1A34 A;  4YLZ A;  2ATF A;  4AZZ A;  1NCQ C;  3EBR A;  1BMV 1;  3ZFE A;  1O3Q A;  1QU0 A;  2VAU A;  3CO2 A;  1COV 1;  1G9F A;  2HWE 2;  2YXS A;  3ON7 A;  4NPL A;  4LA2 A;  1HRV 2;  4YM0 A;  5EHD A;  3W58 A;  2P3I A;  4IV3 C;  4EYU A;  4FVV A;  1WMD A;  4FPH A;  4NHX A;  3M2M A;  4LUL A;  5K4L A;  3APB A;  3ZIX A;  1AVB A;  1GNH A;  3N3H A;  4YW7 A;  2VCB A;  3LF7 A;  4FCA A;  1OT5 A;  5L19 A;  4IGQ A;  4OQ8 A;  4JGY A;  2A6V A;  5EWS A;  4IW3 A;  1XE7 A;  2C5D A;  1GP4 A;  5FZM A;  5LAT A;  5A1L A;  1A8D A;  4GIQ A;  3AZX A;  3N9O A;  3TB0 A;  2GMP A;  5CIR A;  3AZY A;  3R4D B;  1RUN A;  2BUK A;  2RS3 3;  2YPJ A;  2HWF 3;  4A42 A;  4QX5 A;  1FNZ A;  4Y1U A;  5B4X A;  4N9H A;  3M3I A;  3OUI A;  2JDM A;  1NA1 C;  4HPK B;  4QAW A;  5K0U C;  4RR3 B;  1PGL 2;  2R07 2;  2QDR A;  1ND2 C;  3J7H A;  4N53 B;  4PDW B;  4DNY A;  4ASL A;  4ZZ8 A;  2E32 A;  3AMM A;  2XUM A;  5FFO C;  5AVA A;  3K46 A;  1Y43 B;  1IPJ A;  1JU4 A;  2WAA A;  1CVN A;  3O12 A;  3RZK A;  2HWC 1;  4GKX A;  4EN9 B;  5IJR A;  1C3H A;  2G1M A;  1XYN A;  2JIG A;  3K48 A;  4YNI A;  3TEX A;  2CGN A;  2R07 1;  2BU9 A;  1RUC 1;  1KDK A;  4K8F A;  2VVF A;  4XFF A;  5JOX A;  2WSV A;  2X8K A;  1AYN 2;  2YY1 A;  2XPJ A;  2VR4 A;  4URA A;  3NNJ A;  1CD3 G;  1AX2 A;  5J3U A;  1O3T A;  5F9T A;  1JTZ X;  2RMU 3;  4MX3 A;  1N3Q A;  5FYT A;  1N1Y A;  4AE2 A;  3S0M A;  1DHK B;  1POQ A;  3AYE A;  4WVM B;  4XJ9 A;  3P3P A;  2EAA A;  1ENQ A;  1CWP A;  4K6B A;  5FPA A;  4QWN A;  2JG8 A;  3KV9 A;  1TEI A;  2VUA A;  3VBS B;  3CIH A;  4YGE A;  4YZ2 A;  3WF3 A;  5JWP A;  1QDO A;  4Q4V 1;  4R4Z A;  1CIY A;  1OH4 A;  1UN1 A;  2HWD 2;  2IXC A;  3IDC B;  2I2S A;  3GBW A;  2VH9 A;  2RS5 3;  3RWK X;  5FMC A;  1OUS A;  3KT4 A;  1LR5 A;  1K42 A;  3IIA A;  1T6G C;  3CJI A;  2WWU A;  4RHV 2;  4B4R A;  5A3U A;  5IFT A;  2OUH A;  1IS6 A;  2EAL A;  2ZEX A;  1MS4 A;  1MZ6 A;  4GH4 C;  1CR7 A;  4PJY A;  4S2F A;  2X05 A;  4BQ1 A;  1LGB A;  1D0H A;  5FR3 A;  4HN0 A;  5FTT C;  4HL0 A;  4OUL A;  1XOY A;  2ZGN A;  4YG6 A;  2Z2S B;  2FDF A;  3FX3 A;  1W05 A;  4L11 A;  1YQ2 A;  4GQ7 A;  4QB6 A;  3VBH B;  3H8O A;  1RUD 3;  2NPI A;  3M3E A;  2CAU A;  1H2L A;  4CUB A;  1PX3 A;  2P3Y A;  1L7R A;  1VBA 1;  4O65 A;  3TBD A;  4XFB A;  3CJI B;  2VW2 A;  4BYY A;  2JEM A;  2E9Q A;  2XB6 C;  3I2O A;  2J22 A;  2BQP A;  5EIY B;  2XOM A;  1C8N A;  4P9X A;  2ZOE B;  1R09 2;  3BTY A;  4AVC A;  2HYK A;  4OHY A;  3I4I A;  4BQ3 A;  3LEK A;  1L3J A;  1U5Z A;  5DPN A;  5BNN C;  1XBF A;  1O3S A;  3POY A;  2JG9 A;  4HKL A;  2JB8 A;  1HB3 A;  4JTO A;  3WX5 A;  4LLO A;  2VUJ A;  4WVM A;  2ZEY A;  3VBO B;  2YPD A;  4CCL A;  4ISQ A;  5KHI A;  3ZPO A;  4CDX B;  2A70 A;  3ZYI B;  1EAH 1;  4BQ4 A;  4CDW A;  2A3X A;  5ACA 3;  1J84 A;  2GSY A;  5LY2 A;  1LU1 A;  1US3 A;  1TME 2;  1W6O B;  2F4L A;  4FSJ A;  1JZ5 A;  4YVW C;  2DFC A;  5JOW A;  3VD4 A;  2VD7 A;  1X82 A;  3LAG A;  4D94 A;  4Y22 A;  1R1A 3;  3DPR A;  5JZG C;  1D4M 3;  1ZRD A;  2WS9 1;  4XF1 A;  5T55 A;  2XJR A;  5FZ6 A;  2DCT A;  1Q3E A;  1GBG A;  1SPP A;  3GNE A;  2WFP A;  3PNA A;  4N53 A;  4OHV A;  4PDW A;  4KG8 A;  3SH5 A;  4BCU A;  2OVU A;  1YI7 A;  2RDS A;  5EQU A;  1CX1 A;  2UY8 A;  4LJH A;  2DUP A;  4Y1X A;  3N9N A;  4NWW A;  4NII A;  1VBD 3;  3A0K A;  1QKQ A;  4LO6 B;  2JX9 A;  3WUD A;  2W68 A;  1P8J A;  1W6Q B;  4LT5 A;  1WUV A;  2A73 B;  4M3C B;  4S2H A;  1JW6 A;  4P9G A;  3WSO A;  5FZC A;  1AR9 2;  1V6K A;  4TXW A;  4XUP A;  1DQ4 A;  4FFI A;  3DN7 A;  1DGR N;  1OQD A;  5IAX A;  1QXJ A;  4MHR A;  4EWD A;  1JU3 A;  3WCR A;  4C90 A;  4KH9 A;  4P08 A;  3EXU A;  4BB3 A;  4YM1 A;  1H6X A;  3GGL A;  1IPS A;  3HPN A;  4CDX C;  4IXL A;  3H3Z A;  1UKG A;  3I3E A;  3HQX A;  1NXD 1;  1LOE A;  2X5I B;  4O61 A;  5F6L B;  4XDQ A;  4BQX A;  4PIY A;  3RZM A;  1DZQ A;  1GNZ A;  1DYK A;  3IM0 A;  1ONA A;  1SPP B;  2VO5 A;  5JXI A;  4LBN A;  5HPO A;  2ZGP A;  3I49 A;  1CAV A;  3OPZ A;  3PMS A;  1PO2 3;  4C8D A;  1JYT A;  3JQW A;  1YJK A;  4KBB A;  1K12 A;  2DVA A;  2OQ7 A;  5A70 A;  5I93 A;  4RFR B;  2FZ2 A;  2CGO A;  3WF4 A;  3WP6 A;  4CDQ B;  2LTN A;  3J8F 1;  4H55 A;  1S1A A;  1ULE A;  5SV5 A;  4CEY A;  1TNF A;  2C1F A;  3LIG A;  3SEE A;  5J36 A;  4LR4 A;  1CAW A;  1U5X A;  3AYD A;  5F5A A;  5FWE A;  3BU0 A;  3GXU A;  1W6P A;  1BYH A;  1CZV A;  1VRH 2;  2WZR 2;  3BGA A;  4BIF A;  2K0G A;  3IMN A;  3Q9O A;  2XVK A;  5EYY A;  2E7A A;  1IG0 A;  5FKC A;  3WW2 A;  4QHB A;  1TVG A;  4FOV A;  5SV8 A;  2VVE A;  5FAX A;  1XQN A;  4FTS A;  5C3R A;  4GA9 A;  5ANQ A;  4AQT A;  1KQR A;  1UCX A;  1JZ8 A;  1I5P A;  1NA1 A;  5F5I A;  1ASJ 2;  4QD2 A;  3PL0 A;  1XNB A;  4PIX A;  3LOI A;  4KG0 A;  1QJU 3;  1COV 3;  3ACG A;  2XQR A;  1BJQ A;  1F5F A;  1V6I A;  2VGD A;  3KQR A;  3LDR A;  4AVT A;  3SQO A;  1NZC A;  1OF3 A;  1PIV 2;  5C8C B;  4XAA A;  4TSV A;  2FDH A;  4CDQ C;  5EV7 A;  4EWE A;  1K5M A;  3QOP A;  3KV5 A;  4ZHN A;  2VMG A;  4IE5 A;  5A7N A;  3KGL A;  4SLI A;  4P5H A;  2XJQ A;  4JHZ A;  3S7I A;  4OFG A;  4CCO A;  3LDK A;  2G4I A;  3LZZ A;  1NCQ A;  3MV0 1;  3DCQ A;  3OG2 A;  5DDJ 3;  5KXE A;  1H8T B;  5DZE A;  5FPU A;  4XMI A;  2Y6H A;  2ZTN A;  3OBZ A;  1UYX A;  3D6E A;  3DYP A;  3MIH A;  4PF5 A;  2WZP P;  4HFS A;  3MUY 1;  1KEX A;  1AR9 1;  1J3R A;  1PVC 2;  2ZML A;  1UD1 A;  1NY7 2;  3H1W A;  1GZW A;  3PIG A;  4QPI C;  1W9W A;  2XR4 A;  2WA3 A;  2OW4 A;  5FZH A;  3MHZ A;  3BKZ A;  4DXS A;  3MZH A;  2D5F A;  2V72 A;  2AH2 A;  4CEW C;  3FBY A;  4LKS A;  4Q0P A;  3AJY A;  4QU2 A;  4PQQ A;  1RUI 3;  1MAC A;  4LHN A;  5C8C A;  4FTB A;  2R07 3;  2RDR A;  3GM8 A;  4DZG A;  1RUC 3;  5T54 A;  2VTX A;  3L2H A;  2R04 2;  4AFC A;  3WNO A;  1PO1 1;  5GLU A;  5FYM A;  2LM3 A;  2RMU 1;  3AMP A;  4GAL A;  1OD3 A;  1SDD B;  3H1M A;  1RHI 2;  3AVR A;  4RR3 A;  4LPL A;  1W8Z A;  3B94 A;  4IDZ A;  3NL1 A;  1GP5 A;  1W8T A;  2Q1Z B;  3QBQ A;  3MIE A;  2VY0 A;  1WWY A;  3U10 A;  2OKX A;  1LHU A;  4JDM A;  2RS5 1;  4I0A A;  4N43 C;  1EPZ A;  1SFP A;  4E4D X;  4FBF A;  5CFC B;  3ACL A;  3BCW A;  4K1Y A;  1WCQ A;  2HWB 2;  2ZGS A;  4NPR A;  4AFB A;  1LAJ A;  3T0A A;  4R9B A;  5CYY A;  4CYD A;  3A0N A;  1J83 A;  1GQG A;  1V6L A;  3MFA A;  4UFK A;  4CCE A;  4CCC A;  1FPN 3;  4XET A;  4LOS A;  1T2X A;  3HEI A;  1YCI A;  3K4Z A;  3LE0 A;  5T5J A;  3CNA A;  4HK8 A;  4FO9 A;  1V6M A;  1OQ1 A;  1W03 A;  5DUU A;  3WZ1 A;  5BY5 A;  4LKF A;  1V0A A;  4ES8 A;  1KDM A;  3TOJ A;  3WDV A;  4WVZ A;  1ZA4 A;  4LUK A;  3RI9 A;  5HBA A;  2OZJ A;  4G4F A;  2WAO A;  3UET A;  1RUD 1;  1AL2 2;  4JDO A;  2RM2 3;  3BAL A;  4ONU A;  4A3Z A;  4DQA A;  3PUR A;  1RUI 2;  3OB8 A;  3PUI A;  4GXL A;  3RZH A;  5FPL A;  4Y5Z 0;  2Z69 A;  3EB7 A;  5HI0 A;  3H0O A;  1OLM E;  4C0H A;  2XG3 A;  1GWM A;  2E7T A;  3SIT A;  1Q43 A;  3RMX A;  1S0E A;  2W52 A;  5CAD A;  4RHV 1;  2Q1M A;  3M7A A;  1DYO A;  1OLQ A;  4GZ9 A;  4QQL A;  4I0W B;  1F15 A;  2R1D A;  3TEZ A;  4M0H A;  1ULP A;  1VBC 1;  4HBN A;  2R06 3;  2MEV 3;  4XE9 A;  2W1W A;  3NW4 A;  1R09 3;  4HVO A;  2VC9 A;  5A7W A;  3I54 A;  5E6H A;  1JYX A;  5A7Q A;  3IB3 A;  4P00 B;  1CGP A;  3E5Q A;  4AFA A;  4Y20 B;  1DQ5 A;  1E57 A;  2RJ2 A;  3KSC A;  2Y0I A;  5ACA 1;  1MR5 A;  3OSD A;  2ZBJ A;  4WM8 A;  1OMI A;  2O1Q A;  1VB2 A;  2D6K A;  5DUW A;  3VZJ A;  5FXW A;  4YAR A;  3JD7 3;  5DAB A;  3NJX A;  1F31 A;  5F37 A;  1BEV 2;  2VQ0 A;  3J4U H;  5FLI A;  2Y6F A;  5LBF A;  4E4S A;  1RUC 2;  5LA2 A;  4YZ3 A;  2DCZ A;  5F2W A;  1QF3 A;  2QQN A;  4H14 A;  4J6G A;  1ZBE 2;  5DZG A;  2J1A A;  2QCS B;  2Z5W A;  1MS1 A;  4K9S A;  2CY6 A;  1NX9 A;  1VBD 1;  2EXK A;  1UMZ A;  5J1X A;  3S5Q A;  2ZHM A;  5F8P A;  1R08 3;  4XTM A;  3O5S A;  4X8N A;  2ZX4 A;  1BBT 1;  1JZ4 A;  5FY8 A;  4XQW A;  1NCR C;  2PHW A;  2W92 A;  3III A;  4GB3 2;  4JQT A;  4FFF A;  4WM7 B;  4FAG A;  4K3U A;  4QHO A;  5FPX A;  2D93 A;  2NP0 A;  4BQ2 A;  1W8F A;  3OBA A;  5F5Q A;  2ZGK A;  2W91 A;  5I8Y A;  5C3Q A;  1YUD A;  2DDU A;  4DS0 A;  3QH6 A;  5K7P A;  2GAL A;  4OCT A;  2UYB A;  3AP4 A;  4RYD A;  5D2A A;  3RJ2 X;  1ND2 A;  2E26 A;  4HVR A;  5FKB A;  1ENR A;  5K0U A;  1RVF 2;  2WYF A;  1ND2 B;  3VKM A;  5IVV A;  4DXZ A;  1L7Q A;  4AGR A;  1VAK A;  2EIE A;  4WZC A;  4E4Z A;  3U11 A;  3B7M A;  2WO7 A;  1NZI A;  1YO8 A;  3RWN A;  3LA2 A;  5FBZ A;  3UKT A;  3ZFF B;  3UGG A;  4AFM A;  3O1P A;  1W3V A;  4NRQ A;  5FZD A;  2JWP A;  3GYD A;  3MIG A;  4PBO A;  2BGO A;  1XNA A;  2J42 A;  4IE7 A;  3VLB B;  5FZ3 A;  2GME A;  1WLD A;  3LEG A;  4UFJ A;  1JUH A;  3DF0 A;  2IWG B;  1ZRR A;  3DKW A;  3AKQ A;  4RFT 0;  2P3J A;  4DFS A;  1RVF 1;  4FOY A;  2W95 A;  2DTW A;  3ZSM A;  1CES A;  1ULD A;  3HQR A;  3X29 B;  2WZR 1;  4ERO A;  4ZKT B;  5DMY A;  3AXD A;  3MGU A;  3PVO A;  2XLG A;  4U36 A;  3I2F A;  4COZ A;  2GZW A;  4AFD A;  2OPW A;  3D3A A;  4KU7 A;  4MXW B;  4QDR A;  2ZGO A;  1V6J A;  5JXH A;  5DN2 A;  1QGL A;  1UZ0 A;  5I0S A;  3R05 A;  4IGP A;  1GZT A;  1RIN A;  5F39 A;  1GFF 2;  1Q5O A;  3CZU A;  1XRU A;  2QQK A;  5FO7 B;  2ID4 A;  2NN8 A;  5KWR A;  4XAE A;  3GZU C;  5EJZ B;  4M4P A;  3TNP B;  2JG8 B;  2H6C A;  5J09 A;  4LE4 A;  3IPV B;  1W8U A;  1LOA A;  2A3W A;  2E63 A;  2OZ6 A;  2TNF A;  1O4Y A;  3P5B A;  4YVS B;  4JC1 A;  2WC2 A;  2O8O A;  2QQJ A;  1ZBE 1;  2BP6 A;  2YGM A;  4YVS A;  5EJ1 B;  5FZE A;  2D5H A;  3ZX7 A;  4CPB D;  5HXM A;  2JDU A;  2W94 A;  3DV8 A;  1G9D A;  5IW0 A;  1RUH 1;  1SBD A;  4DIQ A;  2ZZJ A;  3NV3 A;  1H6Y A;  3W5M A;  4COU A;  1GAN A;  3NMB A;  3CQO A;  1UO9 A;  3QCW A;  4JHT A;  4AEK A;  1ZBA 1;  4XPV A;  3RVH A;  4AI0 A;  2BRT A;  2Y8K A;  4MXW A;  3Q8E A;  5D8A C;  1UU4 A;  2CDP A;  2VOK A;  1SHW B;  5F6K A;  5ACA 2;  4CCD A;  1GZ9 A;  4L9B A;  3BI3 A;  2A6Z A;  1GUI A;  4IL7 A;  4XUO A;  4BMB A;  5LCW L;  4YRD A;  4HPK A;  3O0V A;  4KMQ A;  5FXX A;  3MYX A;  3ZDS A;  1YWK A;  2X09 A;  4N7U A;  1IS3 A;  5IUQ A;  2R32 A;  5A6X A;  4YSF A;  2MPF A;  2D98 A;  4E9K A;  4HMZ A;  2IXH A;  1JH5 A;  1GLH A;  5EFU A;  3NV2 A;  2QQI A;  5BNO A;  1WLW A;  1KJL A;  1OHF A;  1YC6 1;  1YHF A;  1B35 B;  3U75 A;  4D0Q A;  1ND3 C;  2VTX J;  1NT0 A;  2HWB 3;  1DGL A;  1IHM A;  1VE0 A;  2VMH A;  3OJB A;  3E6B A;  4COV A;  1PNG A;  4JRA A;  5G04 L;  1J3Q A;  1JOB A;  3BOD A;  1RUI 1;  4PT6 A;  2AZ5 A;  3VZK A;  3O0X A;  2DF7 A;  5FMB A;  1YYN A;  1AR7 1;  5EPA A;  3SNM A;  1AL2 1;  4LHK A;  5A1F A;  1H2N A;  2W2I A;  2VW0 A;  4NVP A;  1RYY A;  3RDI A;  4LIU A;  1OOP A;  2EAK A;  2JIJ A;  3ACF A;  3UGF A;  3KT1 A;  1I6X A;  1I5Z A;  2ZAA A;  5K9Y A;  1EAH 2;  1JHJ A;  1W2T A;  1VMH A;  3MV1 1;  4IER A;  3I2K A;  4KWL A;  4EN8 B;  3WW4 A;  1QNW A;  5FMO L;  1WKY A;  2WNV A;  2FZ1 A;  1QWR A;  2W08 A;  4ITC A;  2CTV A;  2BFU S;  1KRI A;  3V0A B;  4GMP 3;  3CF6 E;  4QGL A;  1H2K A;  3THT A;  2N7G A;  3UKV A;  3WDT A;  1AYM 3;  3PVN A;  1SDW A;  2V09 A;  3OF1 A;  4OMD A;  5HCB A;  2A3Y A;  2XH6 A;  1G9B A;  2H0B A;  1O59 A;  1SCS A;  3HVD A;  3I59 A;  3P3N A;  2HH9 A;  5LBC A;  1JZ2 A;  1DQ2 A;  2GC2 A;  5D8A A;  1F9K A;  4PLO A;  1W6N B;  4HT1 T;  4C1W A;  3BUC A;  1PVC 3;  3AX4 A;  5A3T A;  1H1I A;  1AR6 3;  2A5Z A;  3SLI A;  1QH7 A;  2WYS A;  3HOB A;  1W8W A;  4BIO A;  1D4V B;  2IUW A;  1US2 A;  1U5I A;  2Q4S A;  3MLL A;  5HV0 A;  4XAB A;  1CAW B;  1XU1 A;  1YIP A;  1CON A;  3HR9 A;  4AI3 A;  1VBB 2;  2C0Z A;  1PO1 2;  4B1M A;  5JAX A;  4FTE A;  1X7N A;  1EYB A;  3VBF C;  3TEY A;  5LW9 A;  3N9P A;  4XZP A;  4ZXK A;  1TMF 1;  5CFD C;  2PFW A;  3CBN A;  3MIC A;  4IUG A;  3RI8 A;  3VKF C;  1MQT A;  3MBW A;  2QQP A;  5EP9 A;  3M3Q A;  2W1Q A;  5E88 A;  3H7Y A;  2JDP A;  2PAM A;  3KZ4 C;  2KR2 A;  3T1M A;  1DP0 A;  3JZV A;  5BXX A;  5C9A B;  5FY5 A;  1LGC A;  5FOJ B;  4LK6 A;  3ZFG C;  4OVE A;  3B69 A;  1DZT A;  2Q0A A;  2V4A A;  2WLP A;  5FP9 A;  3NJZ A;  4RHV 3;  4XJ8 A;  4A6S A;  4N7I A;  1ASJ 3;  1PMJ X;  4NRP A;  4XFG A;  3QAC A;  4B8E A;  5IYY A;  4BJ0 A;  1LUL A;  2R06 1;  3R4U A;  4N43 A;  3WNK A;  2FDG A;  5J48 A;  2JG9 C;  1NYW A;  3OPW A;  4JRL A;  4NR1 A;  3TAY A;  4Z8B A;  4QX1 A;  2CAV A;  2VZT A;  1KJR A;  1WME A;  3W21 A;  3AYA A;  4COW A;  5FLH A;  4OUS A;  1XJA A;  3NNM A;  4LEJ A;  4QXC A;  4ZS3 A;  2ARA A;  2J1T A;  1PZ7 A;  3DXT A;  4EV0 A;  4IET A;  4FFG A;  3ZM8 A;  2ET7 A;  2WQ4 A;  4QB1 A;  4XUQ A;  3T2P A;  3WP4 A;  2XBO 3;  4C0B A;  4IE6 A;  1WW5 A;  5FZO A;  3FBM A;  4EZH A;  1OLR A;  4UBH A;  2QQL A;  5D1I A;  1GNY A;  1J59 A;  4A4A A;  1SBF A;  1J3P A;  4ES9 A;  1LU2 A;  1ZVF A;  4V2W A;  4NPM A;  4GWJ A;  3DEM A;  2VU9 A;  3IPV A;  4X6Q B;  4BIS A;  4Y1Z A;  5LY1 A;  2ZGQ A;  2ZX1 A;  3M1H A;  1F2N A;  4XYX A;  3N9M A;  4AVS A;  4C91 A;  1QMJ A;  4QGM A;  1S55 A;  4XJU A;  2C4X A;  4GWI A;  3WG4 A;  4EZ4 A;  2LAL A;  1G6N A;  3MDP A;  1BBT 3;  1C1L A;  3KGZ A;  4PQ9 A;  4R9C A;  3TEW A;  2RS3 1;  2D3P A;  3VKL A;  3DUI A;  2ZHL A;  4RGG A;  5FBJ A;  1F8V A;  4UW5 A;  2OPK A;  4QX0 A;  2DVD A;  3LSE A;  4LBJ A;  3KCX A;  3LDB A;  4MOA A;  4XJA A;  2RJK A;  2WQ8 A;  4LO7 A;  3ZXA C;  3AKP A;  2ZEZ A;  4M01 A;  3VZL A;  4CU9 A;  4GB3 3;  5L7O C;  3MFC A;  2ZAH A;  4MGY E;  1MQT C;  4MUV A;  3VBU A;  1Q8O A;  2PHT A;  4BPZ A;  1Q8V A;  5F3I A;  2CDO A;  2ARB A;  1ZZC A;  2OA2 A;  2VMD A;  2GNB A;  3DGT A;  3CZJ A;  4TN7 A;  3RRD A;  5JXG A;  5L7O B;  4A7Y A;  1WW7 A;  1HRV 1;  2GH2 A;  4PLN A;  1IG3 A;  2DUR A;  4XBN A;  1EY2 A;  4IGO A;  3POB A;  2BEO A;  1FT9 A;  2Y0O A;  2YUE A;  4NHY A;  2JDY A;  4NAM A;  4XTP A;  3ZLI A;  4KWJ A;  4NAO A;  1HDK A;  3FHI B;  1EUT A;  1FAY A;  4P9W A;  4CSW A;  4BXS V;  1W90 A;  3EJK A;  1MVQ A;  1BXH A;  1UOF A;  1UYY A;  3RMY A;  1AR8 1;  2B39 A;  1H8T A;  1SLT A;  3KD4 A;  1W28 A;  1JOD A;  4P9L A;  2HBU A;  4COY A;  4PLM A;  1NCQ B;  4TZD A;  3WIN E;  3M8L A;  5A3M A;  1W3X A;  4WVV A;  1GYK A;  3ZSK A;  1BBT 2;  4XC9 A;  4N90 A;  4P9I A;  2WIN B;  1VMJ A;  4EN7 B;  5IHR A;  1DGR A;  4PCR A;  2D40 A;  4DEQ A;  3HAG A;  1VLN A;  3DL3 A;  3LQC A;  1XND A;  4YW6 A;  2R7E B;  5L9R A;  5C9A A;  4XFI A;  3Q8B A;  3UGH A;  4EN6 B;  3DEC A;  1AL0 G;  5JZG B;  2OXB A;  3RNS A;  2UU8 A;  3LFM A;  1KS4 A;  3OGV A;  5CKQ A;  5A33 A;  5A3W A;  3KCY A;  4ATF A;  1UZZ A;  1OLM A;  3PHM A;  5FZL A;  4AWD A;  4J1X A;  5LEK A;  5I0D A;  2C9A A;  2JD9 A;  3GZA A;  2YZ4 A;  4HN1 A;  5A6Q A;  2RVA A;  4E4H A;  3THD A;  5FZ4 A;  4WM8 B;  3BPS A;  3VZO A;  1OF4 A;  5IK7 A;  1FI2 A;  4NN0 A;  3TNQ A;  2ZEW A;  2B45 X;  1RTV A;  2H6B A;  4RL7 A;  4FQZ A;  1CX4 A;  1W6P B;  3U4S A;  4MH0 E;  1HKD A;  3VBO C;  3ZFE C;  2CYF A;  5CVR A;  3RS6 A;  2DVB A;  5A6Z A;  1MEC 1;  5F5C A;  2BNO A;  2V4V A;  1W2N A;  1VBE 1;  1VP6 A;  4KGQ A;  1PX4 A;  3WR0 A;  4UWD A;  5FP7 A;  3I2J A;  3L9J T;  3WDY A;  1HXS 1;  2ZX2 A;  5BNO B;  1OSG A;  3TYJ A;  3WCS A;  3UK9 A;  1EPW A;  2ZMN A;  4TLF A;  4XEZ A;  1S0D A;  2JE7 A;  2ZX0 A;  5JOY A;  1VAV A;  2VJX A;  1RGS A;  5EXO A;  4A3X A;  1NXM A;  3JBG 2;  2KD7 A;  5HCF A;  4M00 A;  5CIS A;  4YGB A;  3QLQ A;  4KGG A;  5FJK A;  3ES4 A;  4X6R B;  2XL9 A;  2W3J A;  4GD4 A;  3PUS A;  3RYP A;  2ZXQ A;  2Y26 A;  4JTN A;  1XNK A;  3N7J A;  3R6S A;  3NNF A;  4B7E A;  5JUV A;  1G9C A;  1AR7 3;  1QJE A;  2E31 A;  2DBI A;  4P14 A;  1XNT A;  1ENX A;  5JDB A;  1IQA A;  1Q56 A;  1NAE A;  1G86 A;  1ZA7 A;  3B9C A;  3ECQ A;  3NKG A;  5FDB A;  2H0V A;  1PGW 1;  3A21 A;  1UIK A;  4CXW A;  1YFX A;  4P02 B;  1IKQ A;  4AG4 A;  3O1S A;  3NAP A;  5L73 A;  2AEY A;  3GJB A;  3BTA A;  3HT2 A;  4Q5O A;  4RQP C;  2RS5 2;  1QXP A;  4UFM A;  3LSD A;  2QBX A;  4MGQ A;  4AGV A;  2D6N A;  3NST A;  5FUN A;  4QXB A;  4QX3 A;  1DQ6 A;  2P37 A;  3VHR A;  3BB6 A;  4QU1 A;  2PEL A;  3RYK A;  1ZRI A;  2BFU L;  4LMF A;  2K9Z A;  4J1W A;  2D44 A;  4XW3 A;  3I3Q A;  3L2Y A;  4Q4V 2;  1UF2 C;  2WNE A;  4Y4R A;  4R52 A;  1OKO A;  2XJS A;  3ATG A;  4BA6 A;  1H1A A;  3THP A;  3T08 A;  3N4M A;  1W6O A;  1F4H A;  4NWV A;  4F8A A;  1YJL A;  5T52 A;  2K46 A;  2PLV 1;  5FZ1 A;  3LD8 A;  5FQ0 A;  1VAM A;  1IQD C;  1BKZ A;  4QQH A;  1VIW B;  2XL7 A;  3BIE A;  1TMF 3;  1Z7S 2;  2QTW B;  2TEP A;  1PO2 1;  2E53 A;  5EJ3 A;  1LOF A;  3NAP B;  3FZ3 A;  2HWC 2;  3KV4 A;  5JI7 A;  1NCR B;  2WA4 A;  3JXS A;  3IKW A;  4XXP A;  1DG6 A;  3ZN6 A;  5LAS A;  4CU7 A;  2P4E A;  2RS1 2;  3VZN A;  5FYU A;  2PHX A;  1V00 A;  5FZA A;  2ZKN A;  3GBF A;  3SCF A;  3WNX A;  4AGG A;  1RXG A;  3ZPY A;  1PGL 1;  2ZGT A;  4NJ4 A;  4L0P A;  4MXV A;  3OYW A;  3MEP A;  4ZY9 A;  1CN1 A;  1N1T A;  5IAT A;  2R49 A;  1ENS A;  5A3L A;  2IVI B;  2E6V A;  1H30 A;  3Q8F A;  4RA0 A;  3FC0 A;  4R9D A;  3JB8 A;  1DIW A;  4QM9 A;  3H9A A;  1SZB A;  2YC2 A;  1OD5 A;  2Q30 A;  2YC4 A;  3VBH A;  3WF2 A;  1PZ8 A;  3MPB A;  1H8V A;  1RMU 1;  2W46 A;  2YMZ A;  1NE4 A;  4RQP A;  5T50 A;  3FHA A;  4QQ2 A;  1FXZ A;  2Y34 A;  1UAI A;  4AAX A;  1SMV A;  2PTM A;  4W6W A;  4E8D A;  4UFI A;  2G9F A;  4O9E A;  1EV1 2;  1LES A;  1QJU 1;  3S7E A;  4XFA A;  4QMA A;  3V64 A;  1TZO A;  1Z7S 1;  3CLP A;  2GN7 A;  3C7E A;  2OT7 A;  1OPM A;  3V56 A;  1LEN A;  3LPG A;  1FOD 2;  2PLV 2;  4BK4 A;  4IEX A;  3A22 A;  4RSU A;  1HB1 A;  4Y5T A;  3BOW A;  3PUA A;  1UXX X;  3MF6 A;  3POJ A;  1JMU B;  5DDJ 1;  3VBS A;  5FPZ A;  1D2S A;  2CU5 A;  4Q4X 1;  5FZ7 A;  5APA A;  2VOX A;  1UX6 A;  3HWJ A;  4AF9 A;  3ZXG A;  2OUJ A;  4FPY A;  5KHH A;  5A7P A;  3VL8 A;  2EIC A;  4AED A;  3GZT B;  1KD7 A;  3SCH A;  3PJY A;  1HRI 2;  1QJX 2;  1SLI A;  4QB2 A;  4TLG A;  1AJK A;  3T4H B;  5JZG A;  3URF A;  1PVX A;  2CNA A;  1UY3 A;  3FWE A;  3KVA A;  1C5H A;  3MW4 A;  5JOZ A;  2EXI A;  1EP0 A;  3G6J B;  1SLL A;  3VDD B;  3W59 A;  4NHL A;  4P5Y A;  1Z78 A;  1RJ8 A;  5I91 A;  2LS6 A;  4QPG C;  4BME A;  1LEC A;  1IS4 A;  1S2K A;  3AXE A;  1W9S A;  2WNV B;  4ISR A;  4DO0 A;  5BYN A;  3GF6 A;  2ENR A;  4QX2 A;  2QVS B;  2VTF A;  4RQP B;  3WNP A;  4GUL A;  4GKY A;  1NQD A;  3ORJ A;  2BGP A;  2GMM A;  5LRS A;  2J1R A;  1MPX A;  1Q8Q A;  3KHB A;  3M70 A;  1AR8 3;  3IZO A;  1APN A;  1LCL A;  3ETQ A;  1QJY 2;  3AK0 A;  1AHS A;  2DBN A;  4AXO A;  5A6Y A;  4I3G A;  4D8M A;  3O7O A;  4Q8L A;  5FZ9 A;  2A1X A;  3D8C A;  3N9Q A;  4OI4 A;  1XU2 A;  1W6Q A;  4H7M A;  3WDX A;  3LCP A;  3J9S A;  1STM A;  3ZVX A;  4AL9 A;  5JMC A;  3LKJ A;  2ERF A;  4NID A;  3NJV A;  3Q8C A;  4Q4W 3;  3ILF A;  1C5I A;  2VMI A;  1VPH A;  4Z1V A;  4LBQ B;  4QPG B;  1MEC 2;  3VDB A;  1S2E A;  4XHX A;  4CEW B;  4IEV A;  5FZF A;  1C4R A;  5DQ0 A;  3O1O A;  3C7G A;  2B9V A;  2C26 A;  4QPI B;  3TN9 3;  2WNV C;  1S4C A;  4XJZ A;  4QPY A;  3AP7 A;  3KB5 A;  2CGP A;  5FZ8 A;  2RM2 1;  4G9S B;  3IAP A;  4NHK A;  3SCG A;  5FYS A;  2P1B A;  4CDW B;  1W2A X;  1QQP 1;  1HB2 A;  2QQU A;  1O5U A;  1VAL A;  2IZW A;  5FYC A;  3SHR A;  2PHD A;  3MID A;  4CU8 A;  2EF6 A;  1DF0 A;  3CJI C;  4WZF A;  1MS5 A;  2VZ3 A;  3VBO A;  3M3O A;  3WW1 A;  3PLQ A;  5F3G A;  4LTA A;  1WA6 X;  1HRI 3;  1QJX 3;  3VBU C;  1VBE 3;  4EN0 A;  5IVE A;  2VMF A;  3VBH C;  5IK5 A;  5KXD A;  5DAQ A;  3E5X A;  4L99 A;  1HXS 3;  1YRZ A;  2A7A A;  2YYO A;  2MEV 1;  3EYP A;  4YW5 A;  3T0B A;  4JGZ A;  5FYZ A;  1R09 1;  2Q8E A;  4MLO A;  3OCP A;  1SFY A;  4XMA A;  1ULF A;  4GH4 B;  2QQV A;  3D0S A;  2PHR A;  1RUE 2;  4PF1 A;  1WD3 A;  4JKM A;  1RUF 1;  3IDA A;  4KU8 A;  1VBA 2;  2CL2 A;  5DG2 A;  2PQS A;  3N35 A;  4DIN B;  5FWJ A;  1UYZ A;  2YBS A;  3W20 A;  2CWM A;  1AR8 2;  4YPJ A;  3ROU A;  3LFI A;  1YLL A;  1CIW A;  4N8M A;  3C2U A;  3FHQ A;  2W0X A;  1UMI A;  5D21 A;  4BM8 A;  2A71 A;  2LRP A;  4Z07 A;  3A7Q A;  4OMC A;  2YV8 A;  5FZI A;  1FOD 1;  3VDC A;  4QKF A;  1IS5 A;  5C3O A;  5GZG A;  4HKW A;  2JXA A;  2J7M A;  5KR7 A;  1UOB A;  1YEW A;  3A23 A;  4LO5 B;  1R08 1;  3OGG A;  5GZC A;  3QH7 A;  2R0H A;  5K8S A;  1RUJ 2;  5I0R A;  2JEN A;  2VME A;  4UT5 A;  4DEV A;  2WKK A;  4AHW A;  5LRR A;  3BTZ A;  3WOG A;  1X9P A;  1JYV A;  2GP5 A;  1WBF A;  4FXK B;  3JU9 A;  2BVV A;  1W0N A;  2BNM A;  2O8Q A;  3ZYB A;  2NZ9 A;  3SMH A;  1DQ1 A;  1GOF A;  1OKQ A;  3KMH A;  3VV1 A;  3PUH A;  5JLV A;  1VRH 3;  3GCX A;  5FP8 A;  4IEU A;  5L7O A;  1GOH A;  4FPF A;  1UZW A;  4I30 A;  5F3C A;  5KHK A;  2ZKL A;  2WII B;  4XDO A;  2ORZ A;  1GSL A;  1W04 A;  5JPM B;  1VBD 2;  1H2M A;  1SQ4 A;  4O7X A;  4LUM A;  5HCA A;  2VXR A;  1AUY A;  3QD6 A;  4D6S A;  2D6L X;  1X50 A;  5CEH A;  4IEY A;  1LGN A;  2WN3 A;  1N3P A;  2WDB A;  4P9J A;  1WCS A;  1E5H A;  3THC A;  1Q8S A;  1VJ2 A;  5FO9 B;  1FMD 1;  4L97 A;  3U1X A;  3OUH A;  5GLV A;  3U78 A;  4XIO A;  2BOI A;  3USS A;  1LJ7 A;  3FLT A;  4AHY A;  4ATE A;  1JZ7 A;  4OHZ A;  5LA0 A;  1JUI A;  3OD0 A;  5DAV A;  1MS0 A;  2QJV A;  5HXV A;  5G05 L;  2QFE A;  4DXT A;  1O7F A;  2P6C A;  1XNC A;  2OII A;  4FPG A;  2WT1 A;  2HYX A;  5C5U A;  4GJZ A;  1LED A;  1ZZ6 A;  3ZO0 B;  2R06 2;  2ZGU A;  5AVP A;  5LK7 B;  2NYY A;  5BV6 A;  1V6O A;  1OFS A;  1RUJ 1;  5FCC A;  5I8S A;  1JYC A;  1RMU 3;  1B35 A;  5C3P A;  4UAP A;  3S5A A;  5FIX A;  1S0G A;  5JI9 A;  1W99 A;  4FFH A;  4R9A A;  3MIB A;  3AB0 A;  2FDI A;  1COV 2;  5LK5 A;  2YFU A;  5TSW A;  2WFF 3;  5GLW A;  1OBN A;  4CUA A;  1ZRF A;  5FK7 A;  2W9X A;  1OOP C;  2FDJ A;  1OH3 A;  2XDV A;  3JD7 2;  4BLJ A;  4D69 A;  4XUT A;  1Z7S 3;  1ZZ8 A;  4CCJ A;  1JYI A;  1HQW A;  4UXA A;  1PGW 2;  4I01 A;  4M4R A;  1LKN A;  1ZBA 3;  2FCT A;  3AZW A;  4UW3 A;  1W9F A;  1UPI A;  4UW6 A;  1IKP A;  5CKN A;  2VQU A;  4OQ9 A;  2BZD A;  4A7Z A;  3VDD A;  1RUD 2;  2VCM A;  1NLS A;  5LEJ A;  3FMG A;  4YYO A;  4Q4X 3;  2ES3 A;  3HBK A;  2BV4 A;  5CFD B;  5C9A C;  1RUE 1;  3ABZ A;  5BNO C;  1AXZ A;  1RUG 3;  1WCD J;  1L7L A;  2VZQ A;  2VE1 A;  3USU B;  3U0Z A;  3OEB A;  1FAT A;  3AJZ A;  4KBZ A;  4MVT A;  4AEJ A;  5EYX A;  3MW2 A;  2VPV A;  2YB7 A;  2A6Y A;  3M4F A;  4NE9 A;  1SLB A;  1ODN A;  3WP5 A;  4WM8 C;  2BWC A;  5J37 A;  4HET A;  3D82 A;  4URT A;  3PU8 A;  4O9G A;  1QDC A;  4AQ6 A;  1CZS A;  2HWB 1;  1O4Z A;  3ALQ A;  4ZU5 A;  4NIA A;  4GWN A;  3PU3 A;  4DXR A;  2ORX A;  2XHN A;  3BU7 A;  1MVE A;  5FXZ A;  4AYU A;  1OXC A;  2OYZ A;  2VCC A;  1D4M 2;  4A41 A;  3J7L A;  2G9G A;  2WO1 A;  4MET A;  3HN3 A;  1QQP 2;  1ULO A;  3U07 A;  1AL2 3;  1YQ8 A;  5ERL A;  3HNB M;  3VL9 A;  1JOJ A;  2BER A;  2RM2 2;  1WLT A;  2R04 3;  1DFQ A;  3K3O A;  4XJW A;  3BYW A;  4ORF A;  4FPE A;  1KFU L;  1UOG A;  1KFX L;  2ZS6 B;  5FYB A;  5JSP A;  1JYW A;  1RB8 G;  4OI2 A;  3V0A A;  2BW8 A;  2D7F A;  1AZD A;  1UYP A;  3ZYJ B;  3PIJ A;  4N43 B;  3U37 A;  4UYB A;  5F2S A;  2UWA A;  4MV2 A;  4YFW A;  5A7O A;  3I2I A;  3ZR6 A;  3AP9 A;  4ZON A;  3N7K A;  3RG0 A;  4GMP 1;  4ZU7 A;  3JCI A;  3WV6 A;  3W9A A;  4AHZ A;  1SG3 A;  3AKT A;  4CTE A;  1FYU A;  1IGO A;  2Q8D A;  3VHP A;  4QXH A;  1GZW B;  5E89 A;  2ZCW A;  5KXC A;  2GC3 A;  2WFF 2;  1PVC 1;  2RDN A;  2XKO A;  3POS A;  2ZGR A;  1Y7B A;  3WNN A;  1ND3 B;  2HEW F;  2AUY A;  4IEO A;  1ND3 A;  1JZ6 A;  4KI5 M;  1LOG A;  4LQR A;  2YC0 A;  3OPT A;  2FMD A;  3VD9 A;  2ARC A;  2YBP A;  3I2H A;  5L36 A;  2RR1 3;  2VMC A;  3B93 A;  3N9L A;  1W9Y A;  2HWD 3;  5EZW A;  2R30 A;  4ZPI A;  2IXL A;  2AR6 A;  1B35 C;  3CU7 A;  4W50 A;  4HVQ A;  4WM7 A;  2PXJ A;  1W6M A;  4RR3 C;  2P2K A;  1PNF A;  1W8N A;  4B7K A;  4V2V A;  1HV1 A;  5A3P A;  1QHD A;  3ZMO A;  4RN5 A;  1PZ9 A;  1QQP 3;  3U14 A;  1OI6 A;  4OHX A;  1SBE A;  3FFZ A;  5D8A B;  4A45 A;  2DU0 A;  3WHU A;  3W5N A;  5FY0 A;  2D3S A;  1AYN 3;  2VZU A;  4L92 A;  1HRI 1;  1QJX 1;  3POF A;  4JZR A;  3WXP A;  5HV4 A;  1TQ5 A;  1ASJ 1;  4CUC A;  3OYW B;  1JI6 A;  3CDZ B;  1W9T A;  4I3P A;  1BVV A;  2DUO A;  3MW3 A;  4LE3 A;  3CMG A;  3WDW A;  3SEP A;  4ZS2 A;  4GH4 A;  4J25 A;  4ASK A;  4ET7 A;  1GU3 A;  3O1V A;  2AGS A;  2W1U A;  2VNV A;  4FP3 A;  4YM3 A;  2FMY A;  3D0J A;  3LEI A;  3R0R A;  1NCR A;  5DUV A;  1UY4 A;  1OOP B;  4DB5 A;  2XJP A;  4D6Q A;  1RUF 3;  2FBE A;  4IND A;  4LIT A;  3ZFG A;  4AI9 A;  5IT6 A;  2RS3 2;  2TBV A;  3UJQ A;  2XBO 1;  4RS5 C;  4IE0 A;  4JGY B;  4NUB A;  2XGX A;  4QKD A;  5FQ0 B;  4B4P A;  5F3E A;  2QKD A;  2VL4 A;  3NV4 A;  4Q29 A;  2JG8 C;  3KF3 A;  4A7K A;  2XVL A;  3UKN A;  5IFP A;  1JXN A;  4EJR A;  2DFB A;  5CFD A;  3AL6 A;  3PTR B;  3ZXE A;  3OOX A;  4XFC A;  2P34 A;  1DQ0 A;  2B8M A;  5JCT A;  3WF0 A;  3E97 A;  3ME2 A;  3B01 A;  1QJU 2;  4AVV A;  1VR3 A;  5FXV A;  1DLC A;  1W06 A;  2CHH A;  4YG0 A;  5H9Q A;  1K5M C;  3ACI A;  4Q4Y 3;  1GMM A;  3POW A;  4XF9 A;  1J1T A;  1C8M 1;  1RMU 2;  4I02 A;  1QXR A;  4I0B A;  4CP2 A;  1GV9 A;  1A3K A;  5JSR A;  5FMD A;  4I09 A;  1PGS A;  2R16 A;  2NQY A;  3IWZ A;  5E16 A;  1DGW X;  1SEF A;  1A8M A;  3ILR A;  2ZX3 A;  3CHX A;  2ADD A;  4M0N A;  1QH6 A;  1Z0H A;  4XFH A;  2GN3 A;  1OQE A;  2AEZ A;  4GB3 1;  4JAA A;  3I2D A;  3KCC A;  1N1S A;  4HSJ A;  4PHZ A;  1X8E A;  3IDE A;  4XAC A;  3ZSJ A;  2PYT A;  4F83 A;  3B02 A;  5DAX A;  1F4A A;  5FYH A;  4D3W A;  1LTE A;  5C70 A;  1MZF A;  5A80 A;  1H4G A;  5K0U B;  2W1S A;  3KV6 A;  4QT6 A;  1HRV 3;  2NMN A;  3KT7 A;  5LB6 A;  4OZO A;  4QKN A;  3UT0 A;  4KQ7 A;  2ET1 A;  3RQ0 A;  5FUP A;  4OUM A;  2Y38 A;  5CFC A;  3O0W A;  2DCK A;  5AFE A;  1DYP A;  4NOT A;  2LRO A;  3RPQ A;  2UUR A;  3T09 A;  4CDU A;  4IE4 A;  3EMR A;  2WNU B;  2GU9 A;  1REF A;  4W6Y A;  5H9S A;  2ZHN A;  2WQZ C;  3OGJ A;  2OX0 A;  1UY0 A;  3WEZ A;  1ULG A;  2VNG A;  2P17 A;  4JCK A;  5A33 B;  5F1R A;  1X9T A;  3KHC A;  3RZG A;  4MGS A;  4JKK A;  4LBM A;  1LNS A;  4Y5S A;  3DPR B;  5KC6 A;  2HWF 2;  2R1B A;  4ZXE A;  4Y22 B;  3V65 A;  3HMY A;  1YFW A;  3OGR A;  4XOG A;  1MS8 A;  4D7Y A;  4CP0 A;  4BU2 A;  1VRB A;  4CCK A;  3TN9 2;  2BWA A;  1U0A A;  1VBC 2;  4NIG A;  4AED B;  2GP3 A;  3LGR A;  4BQY A;  4RD7 A;  2BPA 2;  1O91 A;  4CDX A;  5KC5 A;  2VQA A;  3KQ4 B;  4IV1 A;  3ENR A;  4W8J A;  2A6X A;  4HZF A;  2EXJ A;  4IQP A;  5I0T A;  4YGD A;  3VKO A;  3TRS B;  3ZFF A;  3WG3 A;  5CZK A;  5BNP C;  1Y9Q A;  4IEW A;  3EQE A;  5FJH A;  1DCS A;  4NHM A;  1I3H A;  3PUQ A;  2F17 A;  3NQH A;  2JD4 A;  2VM9 A;  1S0F A;  4HSL A;  3AYC A;  2G9Z A;  4AW7 A;  2WR9 A;  5BUV A;  4XVH A;  1E5R A;  2KM2 A;  4ASM B;  2FQP A;  2W47 A;  2YG0 A;  4KWK A;  2HKX A;  4H7L A;  1DDL A;  1CZT A;  2ZMK A;  2WSU A;  5LZ6 A;  5GKA C;  3K2O A;  4WBB A;  2SLI A;  3KM5 A;  1MEC 3;  2MHF A;  4H3W A;  4BLI A;  1GR3 A;  5BNN B;  2VBD A;  4YW2 A;  5IK8 A;  1XYO A;  4AHX A;  3WQ7 A;  1BK1 A;  4D6R A;  2E33 A;  1RUE 3;  3LWC A;  4D7T A;  3LOB A;  1RUG 1;  3GHN A;  3NVC A;  5L9B A;  3SIS A;  3ACH A;  2W39 A;  3T2T A;  2UY9 A;  4CDW C;  4LLF A;  1R64 A;  1JYN A;  1EV1 3;  2XUE A;  5F7U A;  4YVW A;  2Z4F A;  3VUO A;  1E5S A;  4NO4 A;  2A6W A;  3ZXJ A;  5CU1 A;  3VN4 A;  3D5O A;  4Y3O A;  1GWK A;  1POV 3;  1NG0 A;  4CA9 A;  1PK6 B;  2ZGM A;  2DYC A;  2ZJC A;  2D43 A;  3H3L A;  3ZN6 B;  2RMU 2;  4LKE A;  3MLJ A;  1YQ5 A;  4KL1 A;  5IWF A;  5CG9 A;  4BDV B;  3O1M A;  2R04 1;  5A3N A;  2XLA A;  3FE5 A;  3DYM A;  2VEC A;  4MGI E;  2WZE A;  5BNP B;  1ZBA 2;  3AKR A;  5FP3 A;  4K21 A;  1AXK A;  1OUR A;  4S2D A;  3HNM A;  4Q4Y 2;  2RS1 3;  3SC7 X;  3HN1 A;  3USU A;  5GZE A;  2WO3 A;  1WW4 A;  4AED C;  3KS7 A;  3SKV A;  1FX5 A;  4A44 A;  3VBS C;  1NY7 1;  3ELN A;  4CZS A;  1QIQ A;  3C7O A;  1PM4 A;  3WP3 A;  1QEX A;  2Y60 A;  2EXH A;  4XCA A;  4BZ4 A;  2CV6 A;  1Y4W A;  4CEW A;  4YZ4 A;  2YHJ A;  2LUW A;  4ZU4 A;  1KIT A;  3POE A;  5FYY A;  2AAC A;  5IVB A;  1LHO A;  3ZFF C;  5BNP A;  4MO3 M;  2ZA9 A;  2PAE A;  3OUJ A;  2WNU C;  5I0U A;  2WT2 A;  3ZKY A;  1CPM A;  2BDR A;  3MLK A;  2VOW A;  3I3M A;  4UI9 L;  1WD4 A;  1H9W A;  2PLV 3;  2ZAC A;  1LB2 A;  1ZM1 A;  1W8H A;  1MQT B;  3H8U A;  3HNY M;  1UOJ A;  3H42 B;  5FZO B;  3FLR A;  2J1S A;  4AI2 A;  3I8T A;  2QUO A;  5C71 A;  2WRA A;  3VD3 A;  2LW8 A;  5JSO A;  5T3N A;  2HEY F;  2I07 B;  2HWE 3;  3SH4 A;  3WG1 A;  4E27 A;  1NOV A;  1UW8 A;  4AI8 A;  3VD5 A;  4BOW A;  5C7G A;  5JMO A;  2D97 A;  3AL5 A;  3IBM A;  1HX6 A;  3WNM A;  4BWO A;  3WG2 A;  4TYS A;  4YW4 A;  5FP4 A;  4F3J A;  3O1U A;  1GIC A;  5JVV A;  3WQB A;  1GOG A;  1UL9 A;  2AEN A;  4W65 A;  1K5M B;  5DAP A;  5LWB A;  5J7M A;  2VZ1 A;  1M4W A;  1PMI A;  1S0C A;  2V73 A;  1W6N A;  2Y33 A;  1V70 A;  4AQ2 A;  3RZL A;  3H3U A;  1OVS A;  1LOF C;  5LA9 A;  3HQU A;  3AM2 A;  1CAU B;  3SKJ E;  4Z82 A;  3OY8 A;  4LIV A;  1C57 A;  4Y33 A;  4IV3 B;  1D2Q A;  4MGZ E;  3JBG 3;  3H1Y A;  4CXX A;  4LHS A;  4Q0V A;  1NUK A;  2XJU A;  1W2U A;  2EID A;  4HXC A;  4NRM A;  4E2Q A;  4I2O A;  4Q4V 3;  4G3Y C;  1ALY A;  4YZ5 A;  5KHG A;  2BBA A;  4JQR A;  3GBG A;  1XSR A; 
#chains in the Genus database with same CATH homology
 1OH3 A;  1W8U A;  1WCU A;  4A6S A;  2O14 A;  1W8W A;  2LRO A;  3ZYH A;  3ORJ A;  1WZX A;  4AL9 A;  4LJH A;  3F95 A;  4BQ2 A;  4CPB D;  1W9F A;  1GWM A;  4CPB A;  4YWA A;  4BQ4 A;  1HN0 A;  4CP9 B;  4YW6 A;  3ZYF A;  1OKO A;  1UOJ A;  2Q1F A;  2WYF A;  1W90 A;  4YW7 A;  1WMX A;  4LK7 A;  2C24 A;  1L7L A;  4LKF A;  4CP9 A;  1V0A A;  1GWL A;  2KR2 A;  2K46 A;  1GWK A;  1W8Z A;  2VXJ A;  3UT0 A;  4LKE A;  4BQ3 A;  4LK6 A;  5D21 A;  4LKD A;  3ZYB A;  1W8T A;  4BQ5 A;  2JWP A;  2LRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...