4YW6A

Structural insight into divalent galactoside binding to pseudomonas aeruginosa lectin leca
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
121
Chain Sequence
b'AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I galactophilic lectin
publication title Structural Insight into Multivalent Galactoside Binding to Pseudomonas aeruginosa Lectin LecA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 23
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4yw6A00
1GWMA 5D21A 1WZXA 3F95A 4LKEA 2Q1FA 2C24A 2VXJA 1OH3A 3UT0A 4BQ5A 4CPBA 4LKFA 1W8TA 1OKOA 1GWKA 2LRPA 4BQ4A 2LROA 1W8WA 1W9FA 4LK6A 4YW7A 1HN0A 4A6SA 4AL9A 2JWPA 2WYFA 4LKDA 4CP9A 3ORJA 3ZYBA 1WCUA 4CP9B 1V0AA 1W8ZA 4LK7A 1UOJA 1W8UA 4LJHA 4BQ2A 3ZYHA 2O14A 1L7LA 1GWLA 4YW6A 1WMXA 2KR2A 4BQ3A 1W90A 2K46A 4YWAA 3ZYFA 4CPBD
chains in the Genus database with same CATH superfamily
3WXPA 2QQVA 2DCZA 1JOJA 1D2SA 2UWCA 5LY2A 2ARCA 4TTGA 2OQ7A 3JU9A 4XHXA 1H2LA 2FDGA 1QJFA 3KV6A 5G04L 4AQ2A 1LKNA 1KEXA 1KDMA 3VBRA 5GZGA 2J7MA 1RUE1 2ZABA 3WR0A 1H8TA 4GULA 4IE0A 4K3UA 2E31A 2PYTA 5K9YA 2RDSA 5CG8A 1ZRDA 1MS8A 4JQRA 4AEKA 2VULA 5EJ1B 1RUOA 2VZUA 3MW3A 2DVGA 5FJKA 5K0UA 4W65A 4NO4A 2A70A 3ACFA 4E4ZA 4OI2A 1VMJA 2CGOA 3C7HA 4BIFA 1AJOA 3MPPG 3OGSA 4IQPA 3RZJA 3PHMA 1VBB1 4HXCA 2WNEA 5FY9A 4KBZA 5HXMA 3ELNA 1JOBA 2W91A 1GP5A 2PHLA 2XMLA 3AK0A 3B69A 4PLNA 4COVA 4LBNA 5A70A 2HWC3 2WNOA 2G9ZA 3SH3A 3SMHA 1J1TA 3LFIA 1AXKA 5DAXA 4CCDA 1DQ4A 5C8CC 2VZSA 4MGYE 1JYNA 3P5BA 4MGTA 3EQEA 5C9AA 4M3CB 4H55A 1PX4A 3NVCA 4PIYA 2B4KA 2ZGSA 4Y24A 1RUC2 4UOJA 3V65A 3KV5A 3V0AA 1QDOA 2GH8A 1Y9MA 3VBSB 1O91A 2HWD1 4QDSA 5KXCA 2VCCA 4CU6A 4FFHA 1W9WA 1XE8A 2V09A 5FZOA 3BTXA 2XQXA 4NIHA 3KQRA 4QX8A 1XE0A 2AEZA 1GWKA 3AZWA 1TG7A 4RSUA 4C1WA 4IE5A 3UNPA 1UMIA 3W58A 2F6BA 1TEIA 2WL1A 3AC0A 4M3CF 4NHYA 1Q3EA 2B5HA 3GXUA 2HWB3 4HSJA 1K42A 1C8M2 2DUOA 2H6BA 2XKPA 3Q8CA 3ALQA 4CEYB 4AWDA 5FOJB 3U37A 3V0BA 1ZA4A 4C90A 1TZOA 4UW6A 3D3AA 5FYHA 3ZFEB 1JZ6A 4UYBA 1NUKA 5FUNA 4D94A 1C1FA 3A7QA 4XEZA 1Q8SA 2XJSA 4EN9B 2C5DA 5C3QA 5LA1A 2WO2A 2GP3A 2ZGQA 3ZSJA 2YB7A 4V2WA 4L8QA 1XSQA 5JUVA 3ZPYA 4YW7A 3O0WA 3VBFA 4Q4V3 4WM7B 2BGCA 4X8PA 1AJKA 4QU1A 3K4AA 2YV8A 4XIOA 5JIUA 4P9JA 1PX3A 4GJYA 4EN6B 1WD3A 2A73B 2MNGA 2ZX3A 4NE9A 5AFBA 3BN6A 2YBPA 1Y9QA 4YNIA 4Y5SA 4DXRA 2D43A 3NWKA 3ZX7A 1YNAA 2RMU3 4R4XA 4E8DA 4W6WA 4YGEA 3ZXGA 1QJZA 1IPSA 2QQUA 4XJWA 1Q8PA 3CL1A 2YPDA 3FZ3A 2Z5WA 1UZZA 1F31A 1VBE2 3OBZA 2WZR3 1B35C 1T2XA 1ZVFA 1LOCA 4C0BA 4CDXB 3ZFFA 5IVVA 3A21A 3RPQA 1BBT1 2ZEWA 1XJAA 4LEJA 4IDZA 1W6OB 4MXWA 3WOGA 3RVHA 4W50A 4QPGB 1K5MB 3BI3A 4AGRA 1IS6A 3M3OA 4OMCA 4LHLA 5KXBA 3RYKA 5FMDA 1W6PA 2GAUA 2VUDA 4LXLA 1F2NA 1HB2A 5APAA 3MFAA 1AR63 4YW6A 4IETA 1HN1A 4D8MA 4XJ8A 5IAXA 2C1FA 1AL21 1XE7A 4K20A 5J98B 4D3WA 5C6CA 1E5RA 1REFA 2VCMA 3IPVB 5BNNC 1CAXB 3AB0A 1UL9A 4QD2A 5K4LA 5FK8A 4XHBA 4LO8A 2O8QA 3HN1A 1SQ4A 1JYXA 3OSDA 4ASKA 1OT5A 3GGLA 2GNMA 4RN5A 1TME1 4UFKA 3VKOA 1QKQA 3BTYA 2BTVC 5JI7A 4ZY9A 3W5MA 2PELA 2EIBA 1WLDA 2JB8A 1AYN2 4XILA 1ZRIA 2JB4A 4E2GA 2IWGB 5KXDA 2Q4SA 1PK6B 3V64A 4BB3A 2FDHA 4QX5A 2RHPA 5EHDA 5IHRA 5FP3A 3OPWA 5ABJC 1SLLA 3ZSKA 4CDWC 2ZGMA 3N7LA 2XPJA 3L2YA 2QQKA 5T55A 3WDYA 4NMIA 3MFCA 2YU1A 5KHIA 4WVMB 2VE1A 3I8TA 1O4TA 3MO4A 2VG9A 1GR3A 2BNMA 5JAXA 4GKYA 4GWIA 1Q43A 5IVEA 2R061 5JVVA 5JOYA 1CAVA 5BNNA 1ZA7A 2LUWA 2XBO1 1JYTA 3WNXA 3I2HA 2MPFA 4JGYB 1W6MB 4RHV2 1V6MA 2P5BA 2CWSA 3WNKA 4UFIA 2B39A 3ZSMA 5A32A 2DU1A 3OBTA 4UT5A 5DABA 2DCKA 3WUCA 1CZVA 4PDWB 4BH9A 1YEWA 1HQWA 5GZDA 2O14A 3N9LA 3J7HA 3NV4A 1CAUB 2AEYA 3PVNA 4J6GA 3WZ1A 5BNOC 3GZEA 4YFWA 2ORZA 1EUTA 1D4M1 1ZNPA 1YQ2A 2D3SA 4I0AA 2WS93 4CSWA 5J36A 5EFUA 3RYRA 1UF2C 4I01A 4IEQA 4A7KA 4HK8A 4CDWA 5JSOA 4LHSA 4PLOA 2IXHA 5A7WA 1XYNA 4JHZA 3WDWA 3VZLA 2ETEA 3PURA 4HPKA 4P5HA 1FPN3 3WG1A 4C91A 1ZZ7A 5A6ZA 1WKYA 4AQSA 2JDNA 2WZPP 1XC6A 4BK4A 4EWDA 1DQ0A 3I2FA 4AI1A 4Q2FA 5FP4A 3J7MA 1ZRRA 4O9EA 4Z1VA 3H1YA 5KR7A 1RUG3 1DZTA 2WR9A 1LOAA 2VTXA 4IXLA 5B4XA 2WZ8A 2Y8KA 2BNNA 2BERA 1IKQA 2DU0A 3C7OA 3ZO0B 3N36A 3AYAA 3HVDA 4BOWA 3NAPC 1W2NA 1ULEA 3B3QE 2QQWA 3ZKYA 4PLMA 4ITCA 1GWMA 4JAAA 1CAWB 3DF0A 2HEVF 4YW5A 1UOBA 1BMV2 2CYFA 3N9MA 4Y1ZA 4K7JA 4A44A 1OC1A 2ARAA 2Q8EA 4RQPC 3O1OA 1DLCA 3N3HA 3AFGA 4LORA 1LENA 5C4WA 2C9KA 1D0HA 4LKDA 1MEC2 2JEMA 3CLPA 3IBMA 3FBYA 3I2IA 3KLSA 4INDA 2YYOA 5FCCA 3TOJA 2JG8B 4AR2A 1IG3A 1XNKA 5EWSA 3AMPA 3GYDA 5L7OC 4MYEA 1AX1A 4EQVA 5FQ0A 5H9QA 1RUF3 1N1TA 1VR3A 1RL3A 2WNVC 4WBBA 3QACA 4GWMA 4JZRA 3KHCA 4IUGA 4QHZA 3JBG1 3K77A 3M70A 5FZ8A 2VC9A 3JBG2 2WSUA 2P3YA 3V56A 4QPYA 5GZFA 3ZFGC 3FE5A 4Y26A 4FPGA 4GALA 3KCYA 1OH3A 1YFUA 4AHXA 1X50A 2R043 1QJU1 4CUGA 4AFDA 1S2EA 1YO8A 1A8MA 5FV3A 3SXWA 1VRH1 1F35A 2E33A 2TBVA 2OPWA 4TSVA 4W4ZA 4WV8A 2C0ZA 2ZHLA 3GDBA 1KITA 5FXXA 5AC91 1F5FA 2B46X 3WDUA 5AC92 4XJ9A 1YJLA 2QVSB 1AX2A 3ON7A 2EIGA 1XNAA 2WBKA 3U78A 4CEWA 2JDKA 3VZNA 5ACA3 4MVTA 1RVF2 1PZ8A 4JGZC 4UW5A 4AFCA 3AJZA 3RZMA 4JDMA 4QXCA 5LZ6A 2RG4A 2ZS6B 3ME2A 1OLME 1WBLA 3INAA 3MUZ1 1K45A 1R092 3PIJA 5IFTA 2LTNA 2WNVA 2HEYF 5FP9A 3RG0A 2CL2A 2A6YA 1QXJA 2PHDA 3KT1A 4XDPA 4CDQC 4YSFA 1DCSA 3BPSA 2GP5A 1FV2A 3POWA 1NA1B 1DQ6A 3J7NA 3MW2A 1FATA 1PVC2 2DCYA 4QX0A 3HAGA 2P1BA 5EYYA 5IUQA 2PHFA 2Y26A 2HBUA 4LTAA 4JHTA 2ZA9A 1POV0 2PHRA 1WBFA 2JE9A 2XLFA 2HWE2 3ES4A 4PHZA 2XVGA 5KHJA 1QQP1 3NSTA 3MIBA 2JG9C 5GLTA 1H4HA 5BXXA 1JUHA 3OYWA 2TEPA 5KXEA 1CVNA 1ULFA 5H9PA 3CF6E 1KDKA 1VBD1 4OUSA 3WNLA 3FL7A 2ZHMA 4N8MA 2VCAA 2QUOA 2I07B 5IVBA 4JGZA 3TEZA 3PU3A 1RYYA 3ZIWA 3ZXJA 1VIWB 2RV9A 4A42A 1Z0HA 3KHBA 1HRI2 4ZHNA 3WQ7A 4CDQA 3M2MA 2R1DA 3JQXA 4QXBA 4BIOA 2R071 2VMDA 2EXIA 3SCHA 2R072 1EV13 4XE9A 2XGXA 5LASA 2XR4A 5FY7A 2GC3A 2ZX1A 3WG4A 5CADA 1SACA 4JCKA 4FT8A 1FOD1 5LEKA 1RB8G 3NW4A 4QXKA 3NL1A 4Q4Y1 2R0FA 2Z4FA 4GMP1 3AKTA 1PIV2 4BCUA 4A6OA 2ZPXA 4RL7A 4U36A 1TMF3 1MS1A 4HLTA 4I2OA 5JOXA 1RUD2 3SHRA 2QQLA 3PDQA 2X8KA 4BQ1A 1BXHA 4GB32 3BTAA 5FYVA 5A7SA 2A5ZA 4HT1T 3NNMA 4XUTA 3GHNA 4OCTA 2E7TA 4JQTA 2W1WA 3GJAA 4CP2A 4HSLA 3H8XA 4DUXA 1SMVA 4LULA 3H9AA 2BBVA 3TN91 2ZGUA 4MADA 3I2OA 2JD4A 2RDRA 2E6VA 3N9PA 3RQ0A 1LU1A 1LRHA 1UMHA 4AAXA 1OI6A 4QHOA 5FOBB 1REEA 3KVBA 1EPZA 2O8OA 4MLOA 1CPMA 1YQ8A 3E6DA 1GWLA 4N53C 4QKFA 1X33A 4XABA 1AXZA 2VOKA 3ES1A 1A3KA 5FZ7A 4AW7A 4W6YA 4DNYA 2W5FA 2CGNA 2YFUA 3LWCA 3M3EA 5FFOC 3L9JT 1AR91 3U4SA 2OW4A 4CTEA 4PF5A 1UKGA 2EXKA 4FOYA 5FPZA 4CDUC 4MV2A 1LOFC 2R1BA 1O3RA 1LTEA 4Q1RA 2BU9A 4GIQA 4A45A 1ZBA3 5AFEA 5J37A 2YXSA 1QOSA 1V9U2 2JICA 1ENRA 4LK7A 3ZXLA 1YI7A 3ZR5A 3A22A 3MPBA 4BMBA 2RR11 4QQOA 4CP0A 1HRV2 3IN9A 4GWNA 1G9AA 2ARBA 2BGOA 3VD3A 4IGOA 4BLJA 3RWNA 2VM9A 3H3UA 2VPVA 2XH6A 1QH7A 4XURA 3ZXEA 1EP0A 3VBHC 4YW1A 4COZA 4N53A 1SLCA 3LDRA 2YBKA 1AYM1 1MVEA 4XBLA 4DMIA 3PJQA 3OB8A 1W39A 4CXXA 3UK9A 1ULGA 4AVTA 3I2DA 3WF1A 3ZVXA 3TBDA 1X8EA 2VMFA 4K21A 4CDUA 4K8FA 4OHWA 4F7ZA 1LOFA 1AR73 2BVVA 2X5IC 1GANA 2H6CA 3R0RA 4J25A 4UBHA 1LU2A 2WUHA 3VD9A 5EIYB 4SBVA 4TXWA 2RS33 4XIKA 5FZHA 5C5UA 3UKVA 3WP5A 3S5AA 1NG0A 2UY9A 3J8F3 4A4AA 4YG0A 3SEEA 2B9UA 1AX0A 4NROA 1SBFA 1OOPB 3OEAA 4YVWC 1XNBA 5CVRA 2DYCA 1UXZA 5BNPA 2A3YA 5FKCA 5LBCA 5A6YA 3T0DA 4MZUA 4TWTA 3HNYM 4Y1XA 1ULPA 1JUIA 3AFKA 5FYCA 4DO0A 5JSRA 3LEGA 5D8AA 4DUVA 2WFF1 1U5IA 1YQ5A 1OFNA 2BOJA 1ZYBA 3LSEA 1VAVA 2BP6A 4BM8A 4RR3B 4IGPA 1OXCA 4RS5B 4EN7B 4HK9A 4XC9A 1IOAA 4XCAA 3UL2A 3WEZA 2VBBA 1W8NA 1LOGA 3WF0A 3RJ2X 1G86A 2FCTA 4XXAA 1TE1B 4AI3A 4AHWA 5CFCB 4RA0A 1EAH1 1UYZA 4D69A 3CJIA 5FKBA 2X5IA 3DPRC 1VBC3 3N9NA 5BYNA 4XFHA 3POSA 1E5IA 2XONA 5HCAA 1COV1 1NY72 5FYSA 5IATA 1GP4A 2OPKA 4FPOB 2AYHA 1KS4A 2Z79A 4MGQA 4UXAA 4YVWA 1WLTA 4R8HA 3DYPA 4Q0PA 4UF0A 1D4VB 4HZFA 4MH0E 2ZHNA 4IV3C 5FPAA 5L9RA 1H30A 5A7OA 1MZFA 2TUNA 3GF6A 4LO5B 1REDA 4OHVA 5A1FA 4HVOA 4KG8A 5BNPC 4JX0A 2VZPA 2YC0A 2FDJA 3ACIA 5FZMA 4BLIA 4D6SA 4NUBA 4AXOA 2ATFA 1W3XA 3GJBA 5LY1A 1SFPA 4CCCA 4CCLA 2GALA 5J96B 2RS11 2RS12 1PO21 1RJ8A 1ZBE3 3PTRB 4HN1A 1SCSA 2CU5A 1BEV1 1ULOA 2XDVA 5A3LA 4KGQA 3LF7A 1PNGA 3H42B 2L9LA 2YY1A 3MIEA 1XBFA 2Y6JA 4XAEA 5B2GB 2HYKA 1QJX3 1F15A 1OQ1A 2ID4A 3B9CA 3CZJA 2R7EB 3WLUA 5JR7B 2LROA 4NPRA 4RGGA 3CBNA 4Q26A 2BRTA 4QPIC 4AVSA 1Q8OA 3OY8A 5CEHA 1QJY1 3VHOA 4Q4X1 1QJY2 3VL8A 2XL9A 1WA4A 2BYVE 2XL7A 3PUHA 1TQ5A 1WMDA 2A3WA 2HWF2 2WA3A 3FUOA 3ECQA 1NCRA 4W8JA 5F5QA 1G6NA 1IS5A 5FWJA 3WDVA 1C28A 4LHKA 2ZOEB 4Y1VA 1TVGA 5D1IA 5J09A 3OUJA 4EWAA 4LLOA 2Y0IA 1RMU1 4XVHA 4XFIA 1WMFA 3OG2A 1IHMA 3VDCA 2J1SA 3R4DB 1AR82 1AF9A 3I54A 2GDFA 5JZGC 4J1WA 4CPBA 1NE4A 1NT0A 5T54A 2P34A 3I59B 2XJPA 4YVSB 1C5IA 1SCRA 4P9YA 1EYBA 4P9IA 1N47A 4GH4C 4Q5OA 3OPZA 3J26N 5FP8A 1RGSA 3I3QA 5FO7B 3DUIA 1EPWA 4ET7A 2P6CA 5GM0A 1RUJ2 2P37A 1SDWA 2DF7A 4QPIA 3H1WA 4Q27A 1WW5A 2D98A 2QFEA 4L2NA 5IT6A 1ODNA 2CAVA 2K0GA 3AZZA 5A3PA 1PGL2 3URFA 3VBOC 1VBA2 1NLSA 3I4IA 4X8NA 3DN7A 2Q8CA 1WD4A 3WF3A 4LNVA 2RJLA 4AI8A 4I09A 1C4RA 3N9OA 5CFDB 2WO3A 3Q8FA 1X8MA 1RUC3 2NMOA 4R9DA 3FHIB 4CUAA 1WCSA 1FMD2 2WA4A 3BOWA 3DYOA 1JW6A 5JZGA 3VDAA 2D97A 3PNAA 5GJ6A 1W8UA 1SHWB 4XDOA 4EZHA 4IESA 4B8EA 4OI0A 4GH4A 2H0VA 2WNUC 4BDVB 3ACGA 1SPPA 3B94A 1DZRA 2DUQA 2Q1MA 3HWJA 3LB9A 2RM21 3R4SA 4I3PA 2ZZJA 4CCJA 1ZZ8A 1MZEA 4LITA 4OVEA 5FY4A 2WWSA 1C8M3 1RUNA 3MV01 3VBRC 1W04A 5FXWA 3WNPA 1H8TC 1VAMA 2QQOA 5A7QA 1UY3A 2ARXA 2IFRA 2RS52 4LA3A 4Y22B 4BA6A 3IIIA 3VHPA 3FLPA 4CCEA 1HXS1 1DQ1A 1YCIA 2VW1A 4JTNA 4CP9A 4ES8A 1UNBA 5DZGA 1OD3A 3H50A 4QWNA 2CSGA 2G4IA 3AKSA 4ZU7A 1OA4A 5KHGA 3POIA 1R081 3OOXA 4KL1A 3H8RA 2VW0A 4M00A 1C8NA 4QB1A 4KU7A 3HIFA 4IEYA 5JCTA 3MW4A 1RHI1 2GZWA 4ARXA 2JDMA 4Y20A 1AHSA 2VOTA 2WQZC 4BJ0A 3T0AA 1TNRA 4FPHA 4N9IA 1S0BA 4SLIA 4WVVA 3HNBM 4MX3A 2WAOA 5DG1A 3WCSA 3WHUA 3DYMA 5FJHA 3EJKA 2W47A 5ERLA 1RUH1 2QNKA 4LE3A 3AJYA 4DRRA 1FV3A 2JDHA 5FZ3A 3ETPA 3JD71 5ANNA 1GZCA 1O4ZA 4N43B 3WY6A 1RUE2 2GNTA 4HN0A 1H9PA 5HV4A 5C9AC 5CIRA 4IV1B 2GN3A 3R6SA 5FRAA 4BWOA 3I3BA 1VBE3 4FQZA 1YFWA 2VU9A 5DAQA 4UFJA 2WABA 3VDDB 4OQ9A 1POQA 5LCWL 1ND3C 5AVPA 4C0HA 3I3EA 4NAMA 4O9GA 5FY5A 3ZN4A 1XU2A 4QQ2A 1JH5A 3VBSA 1JI6A 3MIDA 2PLV1 1BHGA 3K75B 2PLV2 2WRAA 5FYUA 3ZDVA 1A6CA 4YRDA 1LEDA 2WC2A 3NNJA 3GBFA 1VBB2 4DINB 4E4DX 2YPJA 5JOWA 1XSRA 3O1SA 4BU2A 3LDBA 2HYXA 4AHZA 2ZAAA 3JQWA 4H7LA 4Q0VA 3WW1A 4U2AA 5T5OA 3JCIA 4CXYA 5F39A 1P8JA 4LR4A 3DKQA 3ZXDA 4CEYA 2ZEZA 2W3JA 4O7XA 4AEJA 3QOPA 3NQHA 3P6BA 2PHUA 2W1QA 1GFF2 3HQUA 4GWJA 3ZFEA 4UFLA 3NJXA 2JE7A 4LHNA 5JXHA 3POEA 2B8MA 1OHFA 2BVBA 1NX9A 1AYN3 5I91A 4MGSA 3VB9A 2Y60A 2YC4A 4FP2A 1ND3A 2HWD2 3OTFA 2E32A 4PI2A 4XF1A 5CKQA 2PMWB 3F95A 2MHFA 3VBFC 5IK4A 1K3IA 4K6BA 1UZ0A 3S57A 5F37A 4WM7A 3WQ0A 2P2KA 5EV7A 5SV8A 3O0XA 4WZFA 5I0SA 1GKBA 4S2DA 4AAPA 3GALA 1WW4A 1NCQB 1SLBA 1RXFA 1NAEA 5K0UB 2MEV1 3FHQA 5DQ0A 5GKAC 3JUUA 1OVSA 3PVOA 4X6RB 2NM1A 2VCBA 3WG2A 3A23A 4RHV3 2UWBA 3E5UA 4XJAA 5C5TA 4H7MA 2OQ6A 2Z2SB 4BISA 3W9AA 4ZS2A 1H2NA 4B4QA 3CKHA 1X9TA 5DUWA 4NPLA 3ZFFC 5KHHA 4YZ2A 5F3GA 1LHWA 3BIWE 2P17A 4YYOA 3TNPB 1PK6C 1GYKA 4ATEA 4Y5Z0 3LEIA 4QPGA 1R1A1 3VBUB 2VVFA 1R1A2 1W8HA 4QXHA 2GC0A 3EO6A 1Z7S1 3VZJA 1CIYA 2VUAA 4ES9A 4FFFA 5KC5A 4Q1PA 1V6JA 5LRRA 1VP6A 1CN1A 3O7OA 4YZ4A 3GZAA 5E89A 2P3KA 4WVWA 3IPVA 3EXUA 5DZEA 3AL6A 4XMIA 1CAXA 1JTZX 3HQXA 3KV9A 4UFMA 4YM1A 2QE3A 2WT2A 4LOTA 5FZOB 3H7YA 1W8OA 1O3QA 2D44A 5A3MA 4FSJA 3FLTA 4TZDA 1OSGA 1IG0A 3AYDA 4LBQD 5DAWA 4BK5A 2R16A 4HKLA 1HDKA 1I5PA 3CDZB 1BBT2 2AACA 2EAKA 2PA7A 5JLVA 2UWAA 1PK6A 1NLQA 4L11A 3MHZA 3UKTA 5T50A 1NXD1 1SLTA 3IT8A 4YZ3A 1W0OA 4CXWA 2KM2A 1X82A 4Q4W3 5C8CB 3BOPA 2K2SA 3AL5A 1W90A 1MEC3 4HBNA 4OULA 5CISA 1DDLA 2RDQA 3H7JA 4B3NA 3N7MA 3CEWA 1I1EA 4WVMA 1AL22 4CU7A 1LULA 1ENQA 3NJYA 2VD7A 1JXNA 4HVQA 1QF3A 1T6GC 4PJYA 4E2SA 2RJKA 1UX7A 3F2ZA 1RITA 1DQ5A 4GA9A 1OQEA 5FPVA 3SLIA 3JBG3 2KD7A 1TME2 1XYOA 3QD6A 4BQYA 5IK7A 4KQ7A 1UX6A 1UOJA 4PDWA 3T2PA 3KD4A 1OPOA 3AXEA 3M7AA 4NHLA 5J48A 5DDJ1 4NWVA 1W05A 2FCVA 5DDJ2 5CB7A 5FZGA 4AHYA 3FFZA 2VQUA 2HWC1 4P9WA 3U11A 3ZSEA 4DRVA 1QHDA 3OUHA 4KU8A 4DXTA 2NYYA 4YW2A 1D2QA 3E5QA 4GJZA 5GLVA 5A3TA 4NJ4A 2D6PA 1RVF3 3B00A 1GOGA 4EJRA 4LKFA 4ZONA 3RZGA 1RUI1 4HOOA 4AGGA 4TN7A 1RUI2 2R062 3I7DA 2JDZA 2FZ2A 4YARA 2XBO2 5J7MA 5FP7A 1R093 1NLRA 1PO13 4ZXEA 3D5OA 2P3JA 2JDPA 3IDAA 4AZZA 5FYBA 1AXYA 1G9FA 2UYBA 1PVC3 1PMIA 2WIIB 1GOHA 4LE4A 5DPNA 3MZHA 2VZ1A 5BV6A 1ASJ1 2RVAA 3EHKA 4IE6A 1ASJ2 2HWE3 2DDUA 1XNCA 1H4GA 3B5LB 4XF3A 2PHWA 1D4M2 5C33A 3TEWA 2HWB1 4LIUA 3USUB 1W9SA 3HEIA 2HWB2 3ST7A 1CAWA 1POV1 1IQDC 3KWVA 4FPEA 1MVQA 2WT0A 1GZ9A 5C4WC 1SLAA 3VN4A 1JS9A 1LOBA 3H8UA 1U5ZA 3VHNA 1DGRN 2WT1A 1J3PA 1MS9A 1B35B 1UZWA 2Y34A 3A4UA 1UU6A 1PHMA 4NAOA 4YGCA 3FUQA 4AVCA 1HRI3 3IM0A 4NIAA 4QQPA 2BJSA 4PIZA 5IVYA 4Q4V1 2R073 4CU9A 3T2TA 1KFUL 5GLUA 5ANQA 1S0JA 2WN3A 4UW4A 5EYXA 4QDQA 2WO1A 1HLCA 2EVXA 1NOVA 3CO2A 4XFGA 1PIV3 1CAVB 4FOQA 3ACLA 3KGLA 5F5IA 2PQSA 4AOCA 2RMU1 3USSA 1LGNA 2P4EA 4XPVA 1RUD3 3O1UA 1W9YA 4FFIA 2VNOA 4CEWC 3ZSLA 2OS2A 4AFMA 3GBGA 5FZAA 5A3UA 4GB33 2JDYA 2E51A 2VZRA 2WZR1 2W95A 4HONA 2GNBA 4LBMA 2IXLA 2AC1A 2YUEA 1OVPA 1GUIA 4QGNA 5K8SA 3AZXA 4XUNA 2C6SA 2YGMA 1S0EA 4KH9A 2FHRA 3RSJA 2VOWA 2CTVA 2TNFA 1LGCA 3OCPA 5KHKA 3GZTB 3EB7A 3APBA 5ABJB 2EIEA 1W0NA 2JDUA 4RD7A 4CDWB 4Q8KA 5A7WB 2ET7A 4GQ7A 3OBRA 4N90A 4CE8A 3PTYA 5A33B 1AR61 2D93A 1QJU2 3E1F1 1J59A 3MGUA 4A41A 2OX0A 5L73A 4YPJA 4URTA 1CZSA 1VRH2 1FT9A 2YMZA 3IMMA 3B9IA 2A1XA 4OLLA 4LJHA 5FPBA 3H3ZA 4XF4A 5EP9A 1E57A 2J1EA 2OUHA 5FLHA 4R4ZA 2X29A 4K1ZA 2ZXQA 3P3NA 2FD8A 4I30A 2D3RA 1D7PM 1V9U3 1GBGA 2JECA 2EXJA 3AP4A 3HMYA 2Q8OA 2D5HA 3E6BA 3PMEA 5JXJA 1HRV3 5BNOB 3VGIA 2BV4A 3HBKA 3UKNA 1DHKB 4C1XA 4BQ5A 2XVLA 3IZOA 3W5NA 2PAKA 3VDBA 1US3A 3D4KA 1AZDA 1UZVA 5LBFA 4FTSA 2WZEA 1O3TA 1BQPA 1UW8A 3DECA 2XHNA 4B1LA 2ADEA 4CCNA 1MQTC 2XUEA 2IC1A 3FX3A 4AYUA 2ZMKA 4GD4A 1G9CA 2G9FA 1RJ7A 5FXZA 3ZN6B 2GN7A 4BQWA 3Q8BA 1QQP2 5FZ0A 1JZ5A 1OUSA 1OMIA 1JYIA 4LO6B 1OA3A 4MSVA 2IXCA 1HJGA 1V6IA 3MBWA 2BFUS 5BY5A 1J1LA 3MLLA 1BCXA 3M1HA 2VZOA 4GKXA 5JI9A 1VBD2 2J22A 2V72A 2DCJA 3CQOA 4IL7A 1GQHA 4DXSA 1US2A 1OLRA 2DWRA 1ZM1A 1LESA 5LBEA 1JYWA 5I8YA 3NAPB 1HV1A 3WP4A 2DBNA 5FZBA 1J84A 5FREA 2IVIB 2J1TA 4L0PA 4QU2A 1CR7A 1DGWA 2WS91 4CCKA 4Y1YA 4IEUA 3ZXAC 1BK1A 1W6QB 3J7LA 4RQPB 1PGW1 3C2UA 4AVVA 3AVSA 2BUKA 2OZ6A 1MQTA 2V5DA 1FOD2 1O59A 3SCFA 1ZZCA 2Z42A 1Q5OA 2VUJA 3C8XA 4Q4Y2 5FZKA 5L7OB 5EXOA 4IERA 3VV1A 3O1VA 2ZGLA 1KJRA 4E2QA 2EF6A 3ZN5A 2BNOA 2WNVB 2WLPA 4PQ9A 4H2AA 2B7YA 1Y3TA 2YU2A 3VKNA 3T09A 1GLHA 2XVKA 4PI0A 3FBMA 5IFPA 4G3YC 1I3HA 5F6LB 1LGBA 3ZFGB 1RC6A 2HH9A 4K1YA 2AR6A 1DU3D 1N1YA 1WW6A 2DURA 5FMCA 2VQTA 4KWUA 3TN92 2Q1ZB 1IGOA 2F4LA 5JPMB 4OFGA 4D7TA 1PZ9A 3NV1A 3SITA 4B4RA 1ONAA 3S7IA 2ERFA 2F4PA 2XJTA 4CP1A 2PAEA 1FX5A 3RJRA 2NP0A 3OUIA 5H9RA 1JYCA 4MOAA 4XBNA 5CAZA 4JGZB 1LEMA 4RS5C 4FPYA 4O61A 1AR92 3I2GA 1LR5A 1VMHA 2FMDA 1XXNA 1RUF1 3Q8EA 4XW3A 3ZLIA 3RI9A 1PVXA 4NHXA 3J9SA 4S2GA 3WD5A 4CDQB 4FPJA 4PT6A 1QY4A 3BCWA 3ITQA 4AEDC 2XJQA 3ATGA 2JX9A 3GCWA 5JWPA 4UBGA 5CZKA 1D0GA 2R041 4QX7A 3ZDSA 2ZMLA 2RR12 5F3EA 4C8DA 4XUPA 4BQXA 2QZ2A 1OOPA 2WWJA 4FP3A 2Y6KA 2JG9B 5GLWA 4ASLA 1QJY3 1QMJA 5D8AC 3K46A 3IIAA 3BB6A 5F5CA 1K12A 2HWF3 5ACA1 4N7IA 1QDCA 3AYEA 3ETQA 1AYM2 5FWEA 3BALA 1V6OA 1QEXA 1YI9A 4RR3A 4YZ5A 3UGFA 4RS5A 4A6SA 3KB5A 4QT6A 2VECA 1QNYA 2AREA 5EJ3A 1W9TA 5FBZA 3CJIC 1AR83 1YIPA 1HJFA 2ZBJA 3BVCA 5JPNB 1YFYA 1IS4A 2C9AA 4LT5A 4G4FA 2ZCWA 2NLRA 4GZ9A 3WVJA 1XB9A 1S0IA 2Y6FA 2W94A 4AEDA 1ND2C 3FFQA 4HG6B 3TWIA 2K46A 1MS4A 1IPKA 1UWWA 3TYJA 2WN2A 5DN2A 2GH2A 1OH4A 1RUJ3 3RDIA 3B7MA 1PM4A 3AYCA 1O8SA 2BWAA 1SBEA 2QQIA 2ZACA 4A3XA 1KXGA 4RFRB 4B7EA 5LK7B 1GQPA 1J3RA 2WFF2 1GNYA 4IEPA 5HBAA 1VBA3 5FBJA 2W92A 4AG4A 4EE2A 1UOFA 1Y43B 1CWPA 4LLFA 2BZDA 3L2HA 4FTBA 2XUMA 1H6YA 4NR1A 3E5XA 4Y3OA 2OXBA 3QBQA 1GZTA 1QH6A 3MLKA 1S4CA 3O12A 5FY1A 4XFBA 3RYPA 5JR2A 3OJBA 1FMD3 1EAH2 1DGRA 1JU3A 4JVAA 2D6LX 1EUUA 2A6ZA 3DXTA 3EMRA 1EV11 2GC2A 2WKKA 2RDNA 3QH7A 1H0BA 2VBDA 3KF3A 5DUUA 4JKMA 4N53B 3VL9A 1COV2 2W0XA 5FXVA 2BGPA 3RMYA 1ND2A 4OZXA 1GZWB 5I8SA 1JN2P 2VO5A 5CKMA 4CZSA 1Q56A 4IW3A 1JZ3A 4COWA 3PIGA 3PVEA 3K3OA 3T4HB 2J1AA 1LHNA 3KF5A 4ZKTB 1TMF1 5F5AA 3SNMA 1CGPA 4CDUB 4A7ZA 2W9XA 4META 4LBQB 2W87A 3WP3A 3POJA 2I74A 1NCRC 1ST8A 4S2FA 1IZ3A 3FC0A 2WLQA 2OA2A 2HBTA 1LOEA 2RS53 2DVAA 5LRSA 2CV6A 3A0NA 1PO22 3GNEA 3RI8A 4JKKA 1BEV2 2ZKLA 3NRUA 3FN9A 3I2KA 1MZ6A 3PUQA 4LKSA 3NV2A 3LAGA 5IAVA 1DGWX 4ASMB 5FY8A 3VBHB 3I59A 1KFXL 4QX2A 4YVSA 1CJPA 4P9XA 4QM8A 5C3PA 3S7EA 1I9RA 2IUWA 5LEJA 3AKRA 5I93A 4Q4X2 1W8FA 1U5XA 1URXA 1F8VA 3GCXA 1W6NB 5DG2A 1BVP1 1O7FA 1S0GA 2RE9A 4JKLA 4NVPA 1QOTA 2UY8A 4XQDA 4B29A 2VH9A 1RUE3 2YC2A 4JRLA 5FYIA 4F3JA 4CVUA 5AVAA 5FDBA 3U0ZA 2KA3A 4AI0A 1UY0A 1RMU2 4YVWB 5FZ9A 3AP6A 1YYNA 3BIEA 2IVJA 5F3IA 2GSYA 1DBNA 1BZWA 4D7SA 5IVJA 5FMOS 1BK0A 3ENRA 2XQRA 2DFBA 1F9KA 2V5YA 1Q8VA 3PL0A 1WCUA 4P00B 3WUDA 1J58A 3LDKA 1H6XA 1VBB3 1Z78A 3KT4A 3HD8B 3O5SA 3BYWA 4XETA 4EYUA 2UYAA 3HQRA 2A6WA 4CA9A 1KQRA 1STMA 1S2KA 1UIKA 4ZPIA 1G7YA 4OI1A 3AP5A 5FY0A 1UPIA 4WM8B 5LA2A 5CBLA 1AR71 1V6KA 1VAKA 2QDRA 3MV11 3DPRB 1V6LA 4N43C 2DVDA 2RS31 2AH2A 4DEQA 3HN3A 3J8F1 4ARYA 1GP6A 3J8F2 3LEKA 4P02B 4Y22A 5GZEA 1PZ7A 4AI9A 3HNMA 3T3YA 2Q8DA 4OUEA 1MZ5A 2HWD3 2IFWA 3ZYGA 1VLNA 3Q9OA 4IV3B 4QDRA 1VE0A 4EN0A 1DLLA 3G6JB 5F2SA 5FPLA 3DCQA 4Q8LA 1E5SA 4EN8B 5BNPB 4OMDA 4K8RB 1DG6A 4KNCA 4M0NA 4NIGA 2ZGNA 5A3NA 3AVRA 3NNGA 1XYPA 3CJXA 2RM22 4MGZE 5LBBA 3OBAA 2Q1FA 5FMBA 1QXPA 3WCRA 3LIGA 4DQAA 4N43A 3M3QA 3WQBA 3C7GA 3WINE 1C57A 4IV1A 5IK5A 3AMMA 1HXS2 3W59A 5L19A 1Y7BA 3VKFC 3VDDA 3VBSC 5CG9A 3AP9A 3S5QA 1V6NA 3MEPA 4Q0UA 1R082 2EAAA 2DVBA 5A7NA 2H0BA 4PBOA 4DPNA 1U5YA 2O1QA 3E97A 5FR3A 1MACA 1RHI2 2W52A 1PMJX 4ZU5A 1AUYA 3HOBA 2CNAA 1MS3A 2JJ6A 4NRQA 2VZVA 1CJDA 3SH4A 4YM3A 5KBFA 4L97A 4NHMA 1ZREA 2BBAA 2ENRA 1RUH2 4YM0A 2VVEA 1ZBE1 2AGSA 1MR5A 2FBEA 4FPCA 3N7JA 4QHBA 3NNLA 1YRZA 3AXDA 5JZGB 2QCSB 3JD72 3LKJA 3RRDA 4CEYC 2D6OX 5F9TA 3LE0A 5L36A 5GALA 3J4UH 4M3CE 5DUVA 2PQQA 5IVCA 3IAQA 2ZX0A 3ZFEC 1LAJA 1QJX1 2NZ9A 3Q8AA 3UV9A 4UI9L 5C71A 4FXKB 4GH4B 4M3CA 3OEBA 4Q0SA 3T0BA 4DEVA 4LBJA 4Q29A 5I0DA 1LB2A 1OFSA 4IEWA 4L9BA 3O1TA 3T2QA 4FFGA 4FVVA 4TLGA 4AFAA 1BBT3 5JOZA 3PUAA 5BNNB 4IGQA 3T30A 3BTZA 3SISA 1C5HA 4FAHA 2VW2A 5HCHA 3KT7A 4WM7C 2SBAA 1NQJA 1XOYA 2C24A 3VBOB 4COYA 1HW5A 4L99A 3VBUC 2GMPA 1OKOA 2LALA 1OURA 1W9FA 2DBIA 2JXAA 1O6UA 4JTOA 2JWPA 2LM3A 5EPAA 1JHJA 4CP9B 1AL23 4PCRA 1E5HA 1NCQA 1NE6A 3OPTA 5LA0A 2WDBA 2PTMA 4AE2A 1GNZA 5JSPA 3HPNA 2GNDA 1PNFA 2XLGA 4XCBA 4EZ4A 3I3MA 2Y6HA 1TME3 2ZZQA 5FZLA 1ZX5A 2ET1A 4NOTA 4Y20B 1S1AA 2WNUB 5HCFA 4CDXC 1VMFA 1JZ4A 3CZUA 3T08A 5F3CA 1JOPA 1FNYA 1NKGA 5KC6A 3B93A 3T2OA 3WNOA 4Y4YA 4PBPA 2D40A 5DDJ3 3VD5A 1DGLA 5CA6A 4BXSV 1Q8QA 1K5MC 1W8WA 2YGLA 1HN0A 4QPGC 3VBRB 4XAAA 2HEWF 5FYYA 1H8TB 3SCGA 3GZUC 4XZUG 1X9PA 3VBUA 4HKWA 4XQ4A 4Z92B 4YGBA 3ILRA 1DYKA 4LOSA 4YLZA 2DTWA 1NXMA 1RUC1 4QQHA 2MEV2 1RUI3 2R063 4XACA 4LA2A 2XBO3 1UMZA 2BOIA 1GOFA 5A6QA 2DFCA 1ZZBA 2QDNA 1M4WA 5FUPA 1CX1A 1CZTA 4N7UA 2C26A 2WFPA 1O3SA 3DKWA 4E8CA 5IYYA 5IK8A 5LW9A 5DAPA 1YQCA 5IW0A 1QGLA 4CDXA 5FYZA 1V70A 1SDDB 4KMQA 3ROUA 4NHKA 3U1XA 1ASJ3 5FZ6A 4BHPA 5FO8B 5JMCA 4M01A 1D4M3 3C7EA 1UYYA 1C8M1 1TNFA 1V0AA 1W6OA 4L92A 4F8AA 4XFFA 1POV3 3NKTA 1K5MA 2FMYA 2YZ4A 5IJRA 3LPFA 2PXJA 3THPA 1LECA 5F8PA 5C9AB 1Z7S2 1V00A 2VMEA 4XDQA 5C8CA 2OIIA 1W2OA 1U0AA 2OT7A 2J42A 4JRAA 3V0AB 4IEVA 4V1PA 4EV0A 1R64A 2VZTA 2VL4A 4QPWA 1ND3B 2D6NA 3EYPA 3SC7X 2BWCA 1ZRCA 4M4RA 4JGYC 3NJZA 1UD1A 1S0CA 2VNRA 1OA2A 2WWUA 1GU3A 3ACHA 3D82A 4PDWC 1PMHX 5D2AA 3FMGA 1H9WA 1HIXA 1T6BX 3LOBA 4OHYA 2VR4A 4HL0A 1UY4A 1WLWA 3LOIA 3WV6A 2R0HA 4YW4A 3I49A 2XJUA 4P08A 4QKDA 5JIAA 5SV5A 4XJUA 5E6HA 1W28A 3BU0A 3V0BB 4XUQA 4AF9A 1HV0A 2D3PA 5E88A 3IB3A 3OD4A 3TEXA 4YM2A 1VBE1 2VQ0A 1EY2A 1SFNA 4IE7A 1KRIA 5FMOL 4MO3M 2HLEA 2J1RA 4WZCA 1WMEA 3CIHA 3JXSA 2GC1A 3N4MA 4Z8BA 3VHRA 3PUSA 1LNSA 2A75A 5C8WA 4JGYA 1FAYA 1W6MA 5C3OA 4LBKA 2Q30A 5T5PA 3VBFB 5HPOA 5C70A 1H2MA 1W8ZA 5JXIA 2PAMA 1OKQA 2FQPA 1FNZA 1O5LA 4QAWA 1QJU3 5A3OA 1CAUA 3AKQA 4FBFA 1VRH3 4BE3A 3USUA 1JODA 2HWC2 4FOVA 5I0TA 2FCUA 1BVVA 5AC93 1O5UA 2G9GA 4M4PA 4W6XA 2ZMNA 5CU1A 1FXZA 3NNFA 1HB4A 2VTXJ 3BODA 4ORFA 3IKWA 3FJSA 2JG8C 3ZR6A 1ENXA 3VZKA 3ZFFB 1AYN1 3RZHA 1B35A 1LJ7A 5JXGA 1L3JA 3WQ1A 1OUXA 4MXWB 3P1IA 2WAAA 4NN0A 2E7QA 3O1RA 2W1UA 3WW3A 2VBPA 1MPXA 1SZBA 2E26A 5EJZB 1GV9A 2D7FA 3U07A 3QH6A 4H14A 2SLIA 4E4HA 1W6PB 4CUCA 3DXUA 2QJVA 2Y38A 4KBBA 4HFSA 1UU5A 2I2SA 4GXLA 1SBDA 4AVAA 2OKXA 2ZEXA 4R9AA 1QQP3 2HKXA 5CKNA 3K4ZA 5IWFA 3ILNA 4XF9A 4BXFA 5BPXA 1W06A 3UT0A 3WT3A 2E7AA 3LEMA 2E53A 4XOGA 2EICA 3N9QA 4RHV1 3PLQA 1OD5A 5LB6A 2ZGKA 2OYZA 3ZKUA 3ZMOA 4AGVA 1VBD3 2VVDA 2W68A 3NV3A 3SKJE 5FO9B 5LWBA 2YG0A 5TSWA 1DF0A 2OZJA 4I0BA 2JG8A 1JZ2A 3W20A 1JYVA 4I3GA 2DTYA 3KSCA 2PFWA 2Y64A 3DV8A 1KD7A 3WF2A 4UFHA 5K7PA 5HI0A 3WW4A 1Y9GA 1NA1C 2WINB 4FPKA 4Q4V2 4CYDA 5IVFA 2JDAA 5ABJA 4J1XA 4Y4RA 5L9BA 2CY6A 1ZRFA 2WJSA 1GMMA 5FYTA 3SH5A 3UJQA 4KWKA 3C7FA 1YFXA 4CPBD 1H1AA 2W08A 5HXVA 1FOD3 5A33A 4LMFA 3WW2A 4KWLA 1GNHA 3OF1A 4P9GA 4GMP3 4Q4Y3 4XXPA 5H9SA 2X10A 3RMXA 1XU1A 5EZWA 2R49A 4TLFA 2RMU2 3MICA 3AZVA 4LIVA 1J83A 1HX6A 1DFQA 1L7RA 5A32B 1GICA 3DGTA 3R05A 3KVAA 3AMHA 5LK5A 2VXRA 3TEYA 1DYOA 1LCLA 2B9VA 2WZR2 4LO4B 5A1AA 1MS5A 3U10A 5M0TA 1KS5A 2D6KA 4DY5A 3LA2A 5A3WA 3TN93 4BYYA 5BNOA 1PGSA 1RTVA 1BMV1 2RJ2A 4B1MA 2UU8A 3UESA 3T4VA 2OUJA 2NQYA 1NA1A 4UW3A 2PHTA 1WLCA 2BEOA 5FUIA 3BUCA 3MF6A 1W99A 2ZGRA 3MUY1 4HPKB 4LPLA 4I02A 4Q4W1 4Q4W2 1MEC1 2X05A 1AR62 1G9BA 2WYSA 2I45A 2V4AA 3WX5A 4QB2A 2XOMA 3O1MA 3ZPOA 4CU8A 4FPFA 3ZN6A 1N3QA 1AR93 3N35A 3JB4C 1CONA 1L7QA 2A3XA 1IKPA 1XPWA 2N7GA 2ZHKA 5T3NA 1JZ7A 3DL3A 4AFBA 1RIRA 2XJRA 1CESA 1YWKA 3RNSA 5KWRA 2Y0OA 3D8CA 3PJYA 2XWJB 1WCQA 3R4UA 1WZXA 2RR13 2G19A 2VXJA 3NAPA 1RINA 2BQPA 1W8TA 3D0JA 3LZZA 4XYXA 5DAVA 4BQ4A 4HETA 3PVBB 4NWWA 3LA3A 4R9BA 3VD7A 1S55A 4E27A 4AI2A 3MDPA 3N7KA 2C4XA 5C4WB 2ZGOA 1W6QA 3OD0A 1Y4WA 4RQPA 3MYXA 3IDCB 1H1IA 3VUOA 3WDXA 1NYWA 1RVF1 1APNA 1AYM3 2PN5A 2VOXA 4AQTA 3AMNA 1N3OA 1VALA 2YFZA 3KS7A 3RWKX 5FQ0B 5JMOA 3VZOA 4KI5M 5L7OA 1QU0A 3KZ4C 1SLIA 4LBOA 4A3ZA 1R091 4LUKA 3OGGA 4YWAA 1PO11 3ZYFA 2ZX2A 1PO12 3M3CA 4P5YA 2XB6C 1DIWA 1CX4A 1VB4A 1SEFA 3O1PA 4IEOA 1OLMA 3U4XA 2CHHA 2EXHA 4QQLA 1PVC1 3MLJA 3ZYPA 4FAGA 3AX4A 2FDKA 3S30A 4K9SA 3UGGA 5LATA 5E8AA 3ZFGA 4D6QA 4FXGB 5DUXA 2V73A 3VZMA 1K5JA 2VQAA 4RYDA 3OGJA 1OPMA 2HWE1 3LD8A 4N9HA 3FLRA 4P9LA 4DFSA 3KV4A 2J1UA 3VKLA 1H8VA 1OLQA 2WS92 3LIHA 1W03A 4ZXKA 1WA6X 1PGW2 4CEWB 3NO8A 1YJKA 2WFF3 1L7LA 1FPN1 3RGBA 4BQ3A 1FPN2 2BW8A 1YC61 4QM9A 1WUVA 2AZ5A 2VMHA 2DCTA 1JZ8A 4FI9A 1QNWA 3ASIA 3LA7A 2XKOA 2WQ8A 4OHZA 1HQNA 2FDIA 3AMQA 1RUG1 1HRI1 1C1LA 1YQ6A 4MHRA 4IEXA 1RUG2 1EAH3 2R30A 4NRPA 4XFAA 4D6RA 4RGAA 2A6XA 4PQQA 3UYJA 4FO9A 2VMGA 4X6QB 3POGA 4CRQA 1ULCA 2OVUA 3DEMA 4YGDA 3S0MA 5ISLA 4GAZA 1DP0A 2DV9A 1COV3 2NPIA 2XXZA 1A8DA 2R32A 1OOPC 5I0RA 4QX1A 4G9SB 4FQ4A 2ZEYA 1PIV1 3LGRA 5FZEA 5C7GA 5FZCA 3CMGA 3OYWB 3SQOA 4Z07A 2JG9A 3JB8A 1DYPA 3WNNA 4DY3A 5I8TA 1JU4A 1RUD1 2QQNA 3OGVA 2Y6LA 5F2WA 2QQPA 1LHVA 2W2IA 1DZQA 3QLQA 3OGRA 4E4SA 1IQAA 4GB31 1U12A 3EBRA 1RXGA 1W3VA 1LODA 4ZZ8A 4RR3C 1I6XA 4Y5TA 1C3HA 2ZGPA 5CNAA 4EROA 4ZZ5A 2CDPA 2RS13 3GBWA 1RUF2 4LK6A 3TB0A 1VJ2A 1PO23 5DXDA 5CFCC 1UU4A 1BEV3 3ZYBA 3TNQA 3ZYIB 5BUVA 3AKPA 4LUMA 1I5ZA 4Y33A 3KCCA 2AENA 1XNDA 3T1MA 4FPLA 3VD4A 4Z82A 4B7KA 1MQTB 4O65A 2R042 4H3WA 1UZYA 3NKGA 3LCPA 3W21A 3ZIXA 4E9KA 1WGPA 4YG6A 1YUDA 3FHAA 3HR9A 4V2VA 1G9DA 3IAPA 2R6QA 4Q4X3 3AP7A 3TRSB 1BKZA 2ES3A 2P3IA 2VNGA 3HJRA 2V4VA 4YW3A 2FDFA 3UETA 5ACA2 3H0OA 4KG0A 5HCBA 4MUVA 4A2UA 2ZX4A 4MGIE 3NMBA 4BMEA 4XQWA 1V9U1 3E6CC 1NQDA 2IXIA 1ULDA 1RMU3 4ONUA 4OZOA 1HRV1 3U75A 3AM2A 3I97A 5CFCA 4QB6A 2VZQA 2JIJA 3ABZA 1ZZ9A 3M3IA 3ZYHA 2UURA 4AVBA 1QIQA 1O8PA 1G8WA 3ZOIA 1N1VA 2VJXA 4R9CA 4XBQA 1ACCA 1ALYA 3KQ4B 1NZCA 1MS0A 4JV4A 1S0DA 3IDEA 2EIDA 4WVZA 5GZCA 1HB1A 1GZWA 2P6HA 5F1RA 4QGMA 1M06G 1HQLA 3S6PA 2BDRA 3POYA 3K4DA 3WSOA 4COUA 2GMEA 1SG3A 3IWZA 3WG3A 5C3SA 1GSLA 4LBQA 2NMNA 1VB2A 1X7NA 2IXKA 5GLZA 5LA9A 1CD3G 1ODMA 4P14A 4XJZA 3MIGA 3HBZA 4Y1UA 4EWEA 1W2UA 2YHJA 1WMXA 4LO7A 4JDNA 2ZAHA 3KGZA 1N1SA 1HB3A 2PHXA 3POBA 3RZKA 4Z2WA 2O0OA 1EV12 5FK7A 1UOGA 1XNTA 5D21A 4YVSC 4A7YA 1S2BA 4GMP0 4ATFA 2GU9A 4QMAA 1XRUA 3VBHA 3ZMNA 2VNVA 3P3PA 3WDTA 2Y6GA 4OUMA 3WF4A 3LSDA 2Q5TA 5A6XA 2RM23 3RZLA 2EALA 3M4FA 1FYUA 3ZM8A 2VZ3A 1TMF2 2ZTNA 3B01A 3PU8A 3WHTA 2F17A 3UJOA 3MIHA 4KGGA 5J1XA 3CHXA 4WM8C 1W6NA 4BPZA 1NZIA 3G7DA 3LPGA 5T5JA 4Q0QA 3RFRA 1B09A 1JMUB 4UWDA 4AEDB 4OYUA 5B4NA 2KR2A 4AEMA 1OBNA 4DUWA 1UN1A 1NY71 3MF9A 4XMAA 3ZXFA 4K40A 5CFDC 1HXS3 2XG3A 4PIXA 4DB5A 2ZJCA 4AK3A 4YFZA 2Z69A 4S2HA 4F83A 1H1MA 2XHKA 3GHMA 4JC1A 1O4YA 4OI4A 4IEZA 5FZ4A 1R083 3UGHA 4QX3A 4MHUA 2VY0A 1ZZ6A 5D8AB 5HV0A 2Q0AA 1N3PA 1AVBA 4M0HA 4RGKA 1DQ2A 2JD9A 3X29B 5BNQA 2WQ4A 1IPJA 1F4AA 1UYPA 5FZDA 1RHI3 3RZZA 3ORJA 1WW7A 2B45X 4ISRA 4DS0A 4NIDA 3PUIA 3PMSA 4JDOA 1UCXA 1QJEA 3HT1A 4DXZA 2ORXA 1W0PA 1IS3A 2E63A 2CDOA 1RUH3 3ZYRA 1JHNA 2VGDA 3CJIB 4XTMA 2X5IB 2W1SA 3AZYA 3LQCA 4MXVA 4CUBA 3JD73 2VAUA 4WM8A 5C3RA 4XUOA 5J3UA 2E9QA 1QXRA 4FOWA 4I0WB 3DPRA 1PM7A 3K51A 1ZBA1 1UY1A 3IMNA 1ZBA2 4HVRA 5FPUA 1ND2B 1LHOA 4HANA 4LKEA 1OF3A 3FWEA 2LW8A 5FAXA 5CFDA 4UF0B 1X36A 1S0FA 2CWMA 4Z2AA 2LRPA 2NN8A 4XFCA 4MG2A 4AL9A 2VMCA 5F7UA 1UYXA 4IV3A 1OF4A 3ILFA 2PLV3 5I0UA 3H1MA 4PF1A 2VMIA 2JE8A 3I2JA 2HWF1 4ZU4A 5FTTC 3RS6A 3K2OA 5FLIA 1YIFA 2YDEA 3K48A 2DVFA 2BFUL 3POFA 2WO7A 1BYHA 2QZ3A 3C3VA 4IE4A 2EA7A 3WP6A 1AL0G 2D6MA 2JKXA 4LQRA 2JIGA 3KM5A 2VOVA 2CGPA 4UAPA 4BZ4A 5A80A 3THCA 4NRMA 1J3QA 1UXXX 1AR81 5FYMA 3WNMA 4OQ8A 2XWBB 1AR72 5JDBA 1WWYA 2B42B 3BKZA 4RFT0 1CQ9A 2RS32 1F5JA 4URAA 2X09A 2JKBA 4IV1C 2KXLA 3D0SA 4ZS3A 4FTEA 1ENSA 2ADDA 2YBSA 4QGLA 5DMYA 4NPMA 3T1LA 3VDDC 1CPNA 1RUJ1 3M8LA 3OY8B 5A1LA 4KWJA 3O0VA 3BU7A 1FI2A 1BLZA 4D0QA 1F4HA 1R1ZA 5T5LA 4CCMA 5FZIA 3QCWA 4QKNA 1PGL1 3THTA 2LS6A 4QKBA 1UIJA 4HKOA 1NCRB 2D5FA 2Y33A 1VBA1 3MI8A 4HMZA 5F32A 5F6KA 3VKMA 5E1RA 1LHUA 3SEPA 5DZFA 4XZPA 3K3NA 3A0KA 3MIFA 4B4PA 3ZYJB 1YHFA 2VTFA 1WCDJ 5FPXA 2YROA 2MEV3 1HKDA 2W39A 2AUYA 1UPSA 3H3LA 1JBCA 1FMD1 1UKRA 3THDA 2XJVA 4XF0A 1VRBA 2JENA 1KJLA 1UO9A 2GMMA 2QKDA 4D7YA 1VBC1 4MGKE 1CIWA 1VBC2 1A34A 4DOUA 3O14A 2X53S 2BPA2 1YXWA 2QTWB 1BJQA 3KCXA 2W46A 1H2KA 2HJIA 1OQDA 3VLBB 4QPIB 2IZWA 2QQJA 5FIXA 1SFYA 3JZVA 1UY2A 2QBXA 1WCKA 4OHXA 2DUPA 1YLLA 2WSVA 2QQMA 4LBLA 4XTPA 3TAYA 4DIQA 3H8OA 3HT2A 5A7PA 1R1A3 3VBOA 3D6EA 4YZ1A 3I3DA 2XLAA 2A6VA 1Z7S3 2IXJA 5FZFA 1UAIA 3GM8A 2FZ1A 2A7AA 2RS51 4FCAA 1VPHA 2ILMA 1NCQC 2ZGTA 3LFMA 3U14A 5K0UC 2WYFA 1ZBE2 2A71A 5T52A 1UQXA 1A78A 2K9ZA 5FZ1A 4TYSA 3BPZA 5L9VA 1W2TA 2CAUA 3CU7A 1QWRA 3IDBB 4R52A 5E16A 4NIIA 1XQNA 5CYYA 4CCOA 3B02A 4YG3A 2ZKNA 1QJX2 3CNAA 4BQ2A 5FLJA 2J1VA 5EQUA 4AQ6A 1W2AX 1KGYA 1SPPB 1GQGA 3SKVA 3NJVA 4DZGA 2WNUA 3KMHA 2VUCA 3BGAA 3ZXKA 4ISQA 1QOOA 5G05L 2G1MA
chains in the Genus database with same CATH topology
1GWMA 5D21A 1WZXA 3F95A 4LKEA 2Q1FA 2C24A 2VXJA 1OH3A 3UT0A 4BQ5A 4CPBA 4LKFA 1W8TA 1OKOA 1GWKA 2LRPA 4BQ4A 2LROA 1W8WA 1W9FA 4LK6A 4YW7A 1HN0A 4A6SA 4AL9A 2JWPA 2WYFA 4LKDA 4CP9A 3ORJA 3ZYBA 1WCUA 4CP9B 1V0AA 1W8ZA 4LK7A 1UOJA 1W8UA 4LJHA 4BQ2A 3ZYHA 2O14A 1L7LA 1GWLA 4YW6A 1WMXA 2KR2A 4BQ3A 1W90A 2K46A 4YWAA 3ZYFA 4CPBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GWM A;  5D21 A;  1WZX A;  3F95 A;  4LKE A;  2Q1F A;  2C24 A;  2VXJ A;  1OH3 A;  3UT0 A;  4BQ5 A;  4CPB A;  4LKF A;  1W8T A;  1OKO A;  1GWK A;  2LRP A;  4BQ4 A;  2LRO A;  1W8W A;  1W9F A;  4LK6 A;  4YW7 A;  1HN0 A;  4A6S A;  4AL9 A;  2JWP A;  2WYF A;  4LKD A;  4CP9 A;  3ORJ A;  3ZYB A;  1WCU A;  4CP9 B;  1V0A A;  1W8Z A;  4LK7 A;  1UOJ A;  1W8U A;  4LJH A;  4BQ2 A;  3ZYH A;  2O14 A;  1L7L A;  1GWL A;  4YW6 A;  1WMX A;  2KR2 A;  4BQ3 A;  1W90 A;  2K46 A;  4YWA A;  3ZYF A;  4CPB D; 
#chains in the Genus database with same CATH topology
 3WXP A;  2QQV A;  2DCZ A;  1JOJ A;  1D2S A;  2UWC A;  5LY2 A;  2ARC A;  4TTG A;  2OQ7 A;  3JU9 A;  4XHX A;  1H2L A;  2FDG A;  1QJF A;  3KV6 A;  5G04 L;  4AQ2 A;  1LKN A;  1KEX A;  1KDM A;  3VBR A;  5GZG A;  2J7M A;  1RUE 1;  2ZAB A;  3WR0 A;  1H8T A;  4GUL A;  4IE0 A;  4K3U A;  2E31 A;  2PYT A;  5K9Y A;  2RDS A;  5CG8 A;  1ZRD A;  1MS8 A;  4JQR A;  4AEK A;  2VUL A;  5EJ1 B;  1RUO A;  2VZU A;  3MW3 A;  2DVG A;  5FJK A;  5K0U A;  4W65 A;  4NO4 A;  2A70 A;  3ACF A;  4E4Z A;  4OI2 A;  1VMJ A;  2CGO A;  3C7H A;  4BIF A;  1AJO A;  3MPP G;  3OGS A;  4IQP A;  3RZJ A;  3PHM A;  1VBB 1;  4HXC A;  2WNE A;  5FY9 A;  4KBZ A;  5HXM A;  3ELN A;  1JOB A;  2W91 A;  1GP5 A;  2PHL A;  2XML A;  3AK0 A;  3B69 A;  4PLN A;  4COV A;  4LBN A;  5A70 A;  2HWC 3;  2WNO A;  2G9Z A;  3SH3 A;  3SMH A;  1J1T A;  3LFI A;  1AXK A;  5DAX A;  4CCD A;  1DQ4 A;  5C8C C;  2VZS A;  4MGY E;  1JYN A;  3P5B A;  4MGT A;  3EQE A;  5C9A A;  4M3C B;  4H55 A;  1PX4 A;  3NVC A;  4PIY A;  2B4K A;  2ZGS A;  4Y24 A;  1RUC 2;  4UOJ A;  3V65 A;  3KV5 A;  3V0A A;  1QDO A;  2GH8 A;  1Y9M A;  3VBS B;  1O91 A;  2HWD 1;  4QDS A;  5KXC A;  2VCC A;  4CU6 A;  4FFH A;  1W9W A;  1XE8 A;  2V09 A;  5FZO A;  3BTX A;  2XQX A;  4NIH A;  3KQR A;  4QX8 A;  1XE0 A;  2AEZ A;  1GWK A;  3AZW A;  1TG7 A;  4RSU A;  4C1W A;  4IE5 A;  3UNP A;  1UMI A;  3W58 A;  2F6B A;  1TEI A;  2WL1 A;  3AC0 A;  4M3C F;  4NHY A;  1Q3E A;  2B5H A;  3GXU A;  2HWB 3;  4HSJ A;  1K42 A;  1C8M 2;  2DUO A;  2H6B A;  2XKP A;  3Q8C A;  3ALQ A;  4CEY B;  4AWD A;  5FOJ B;  3U37 A;  3V0B A;  1ZA4 A;  4C90 A;  1TZO A;  4UW6 A;  3D3A A;  5FYH A;  3ZFE B;  1JZ6 A;  4UYB A;  1NUK A;  5FUN A;  4D94 A;  1C1F A;  3A7Q A;  4XEZ A;  1Q8S A;  2XJS A;  4EN9 B;  2C5D A;  5C3Q A;  5LA1 A;  2WO2 A;  2GP3 A;  2ZGQ A;  3ZSJ A;  2YB7 A;  4V2W A;  4L8Q A;  1XSQ A;  5JUV A;  3ZPY A;  4YW7 A;  3O0W A;  3VBF A;  4Q4V 3;  4WM7 B;  2BGC A;  4X8P A;  1AJK A;  4QU1 A;  3K4A A;  2YV8 A;  4XIO A;  5JIU A;  4P9J A;  1PX3 A;  4GJY A;  4EN6 B;  1WD3 A;  2A73 B;  2MNG A;  2ZX3 A;  4NE9 A;  5AFB A;  3BN6 A;  2YBP A;  1Y9Q A;  4YNI A;  4Y5S A;  4DXR A;  2D43 A;  3NWK A;  3ZX7 A;  1YNA A;  2RMU 3;  4R4X A;  4E8D A;  4W6W A;  4YGE A;  3ZXG A;  1QJZ A;  1IPS A;  2QQU A;  4XJW A;  1Q8P A;  3CL1 A;  2YPD A;  3FZ3 A;  2Z5W A;  1UZZ A;  1F31 A;  1VBE 2;  3OBZ A;  2WZR 3;  1B35 C;  1T2X A;  1ZVF A;  1LOC A;  4C0B A;  4CDX B;  3ZFF A;  5IVV A;  3A21 A;  3RPQ A;  1BBT 1;  2ZEW A;  1XJA A;  4LEJ A;  4IDZ A;  1W6O B;  4MXW A;  3WOG A;  3RVH A;  4W50 A;  4QPG B;  1K5M B;  3BI3 A;  4AGR A;  1IS6 A;  3M3O A;  4OMC A;  4LHL A;  5KXB A;  3RYK A;  5FMD A;  1W6P A;  2GAU A;  2VUD A;  4LXL A;  1F2N A;  1HB2 A;  5APA A;  3MFA A;  1AR6 3;  4YW6 A;  4IET A;  1HN1 A;  4D8M A;  4XJ8 A;  5IAX A;  2C1F A;  1AL2 1;  1XE7 A;  4K20 A;  5J98 B;  4D3W A;  5C6C A;  1E5R A;  1REF A;  2VCM A;  3IPV B;  5BNN C;  1CAX B;  3AB0 A;  1UL9 A;  4QD2 A;  5K4L A;  5FK8 A;  4XHB A;  4LO8 A;  2O8Q A;  3HN1 A;  1SQ4 A;  1JYX A;  3OSD A;  4ASK A;  1OT5 A;  3GGL A;  2GNM A;  4RN5 A;  1TME 1;  4UFK A;  3VKO A;  1QKQ A;  3BTY A;  2BTV C;  5JI7 A;  4ZY9 A;  3W5M A;  2PEL A;  2EIB A;  1WLD A;  2JB8 A;  1AYN 2;  4XIL A;  1ZRI A;  2JB4 A;  4E2G A;  2IWG B;  5KXD A;  2Q4S A;  1PK6 B;  3V64 A;  4BB3 A;  2FDH A;  4QX5 A;  2RHP A;  5EHD A;  5IHR A;  5FP3 A;  3OPW A;  5ABJ C;  1SLL A;  3ZSK A;  4CDW C;  2ZGM A;  3N7L A;  2XPJ A;  3L2Y A;  2QQK A;  5T55 A;  3WDY A;  4NMI A;  3MFC A;  2YU1 A;  5KHI A;  4WVM B;  2VE1 A;  3I8T A;  1O4T A;  3MO4 A;  2VG9 A;  1GR3 A;  2BNM A;  5JAX A;  4GKY A;  4GWI A;  1Q43 A;  5IVE A;  2R06 1;  5JVV A;  5JOY A;  1CAV A;  5BNN A;  1ZA7 A;  2LUW A;  2XBO 1;  1JYT A;  3WNX A;  3I2H A;  2MPF A;  4JGY B;  1W6M B;  4RHV 2;  1V6M A;  2P5B A;  2CWS A;  3WNK A;  4UFI A;  2B39 A;  3ZSM A;  5A32 A;  2DU1 A;  3OBT A;  4UT5 A;  5DAB A;  2DCK A;  3WUC A;  1CZV A;  4PDW B;  4BH9 A;  1YEW A;  1HQW A;  5GZD A;  2O14 A;  3N9L A;  3J7H A;  3NV4 A;  1CAU B;  2AEY A;  3PVN A;  4J6G A;  3WZ1 A;  5BNO C;  3GZE A;  4YFW A;  2ORZ A;  1EUT A;  1D4M 1;  1ZNP A;  1YQ2 A;  2D3S A;  4I0A A;  2WS9 3;  4CSW A;  5J36 A;  5EFU A;  3RYR A;  1UF2 C;  4I01 A;  4IEQ A;  4A7K A;  4HK8 A;  4CDW A;  5JSO A;  4LHS A;  4PLO A;  2IXH A;  5A7W A;  1XYN A;  4JHZ A;  3WDW A;  3VZL A;  2ETE A;  3PUR A;  4HPK A;  4P5H A;  1FPN 3;  3WG1 A;  4C91 A;  1ZZ7 A;  5A6Z A;  1WKY A;  4AQS A;  2JDN A;  2WZP P;  1XC6 A;  4BK4 A;  4EWD A;  1DQ0 A;  3I2F A;  4AI1 A;  4Q2F A;  5FP4 A;  3J7M A;  1ZRR A;  4O9E A;  4Z1V A;  3H1Y A;  5KR7 A;  1RUG 3;  1DZT A;  2WR9 A;  1LOA A;  2VTX A;  4IXL A;  5B4X A;  2WZ8 A;  2Y8K A;  2BNN A;  2BER A;  1IKQ A;  2DU0 A;  3C7O A;  3ZO0 B;  3N36 A;  3AYA A;  3HVD A;  4BOW A;  3NAP C;  1W2N A;  1ULE A;  3B3Q E;  2QQW A;  3ZKY A;  4PLM A;  4ITC A;  1GWM A;  4JAA A;  1CAW B;  3DF0 A;  2HEV F;  4YW5 A;  1UOB A;  1BMV 2;  2CYF A;  3N9M A;  4Y1Z A;  4K7J A;  4A44 A;  1OC1 A;  2ARA A;  2Q8E A;  4RQP C;  3O1O A;  1DLC A;  3N3H A;  3AFG A;  4LOR A;  1LEN A;  5C4W A;  2C9K A;  1D0H A;  4LKD A;  1MEC 2;  2JEM A;  3CLP A;  3IBM A;  3FBY A;  3I2I A;  3KLS A;  4IND A;  2YYO A;  5FCC A;  3TOJ A;  2JG8 B;  4AR2 A;  1IG3 A;  1XNK A;  5EWS A;  3AMP A;  3GYD A;  5L7O C;  4MYE A;  1AX1 A;  4EQV A;  5FQ0 A;  5H9Q A;  1RUF 3;  1N1T A;  1VR3 A;  1RL3 A;  2WNV C;  4WBB A;  3QAC A;  4GWM A;  4JZR A;  3KHC A;  4IUG A;  4QHZ A;  3JBG 1;  3K77 A;  3M70 A;  5FZ8 A;  2VC9 A;  3JBG 2;  2WSU A;  2P3Y A;  3V56 A;  4QPY A;  5GZF A;  3ZFG C;  3FE5 A;  4Y26 A;  4FPG A;  4GAL A;  3KCY A;  1OH3 A;  1YFU A;  4AHX A;  1X50 A;  2R04 3;  1QJU 1;  4CUG A;  4AFD A;  1S2E A;  1YO8 A;  1A8M A;  5FV3 A;  3SXW A;  1VRH 1;  1F35 A;  2E33 A;  2TBV A;  2OPW A;  4TSV A;  4W4Z A;  4WV8 A;  2C0Z A;  2ZHL A;  3GDB A;  1KIT A;  5FXX A;  5AC9 1;  1F5F A;  2B46 X;  3WDU A;  5AC9 2;  4XJ9 A;  1YJL A;  2QVS B;  1AX2 A;  3ON7 A;  2EIG A;  1XNA A;  2WBK A;  3U78 A;  4CEW A;  2JDK A;  3VZN A;  5ACA 3;  4MVT A;  1RVF 2;  1PZ8 A;  4JGZ C;  4UW5 A;  4AFC A;  3AJZ A;  3RZM A;  4JDM A;  4QXC A;  5LZ6 A;  2RG4 A;  2ZS6 B;  3ME2 A;  1OLM E;  1WBL A;  3INA A;  3MUZ 1;  1K45 A;  1R09 2;  3PIJ A;  5IFT A;  2LTN A;  2WNV A;  2HEY F;  5FP9 A;  3RG0 A;  2CL2 A;  2A6Y A;  1QXJ A;  2PHD A;  3KT1 A;  4XDP A;  4CDQ C;  4YSF A;  1DCS A;  3BPS A;  2GP5 A;  1FV2 A;  3POW A;  1NA1 B;  1DQ6 A;  3J7N A;  3MW2 A;  1FAT A;  1PVC 2;  2DCY A;  4QX0 A;  3HAG A;  2P1B A;  5EYY A;  5IUQ A;  2PHF A;  2Y26 A;  2HBU A;  4LTA A;  4JHT A;  2ZA9 A;  1POV 0;  2PHR A;  1WBF A;  2JE9 A;  2XLF A;  2HWE 2;  3ES4 A;  4PHZ A;  2XVG A;  5KHJ A;  1QQP 1;  3NST A;  3MIB A;  2JG9 C;  5GLT A;  1H4H A;  5BXX A;  1JUH A;  3OYW A;  2TEP A;  5KXE A;  1CVN A;  1ULF A;  5H9P A;  3CF6 E;  1KDK A;  1VBD 1;  4OUS A;  3WNL A;  3FL7 A;  2ZHM A;  4N8M A;  2VCA A;  2QUO A;  2I07 B;  5IVB A;  4JGZ A;  3TEZ A;  3PU3 A;  1RYY A;  3ZIW A;  3ZXJ A;  1VIW B;  2RV9 A;  4A42 A;  1Z0H A;  3KHB A;  1HRI 2;  4ZHN A;  3WQ7 A;  4CDQ A;  3M2M A;  2R1D A;  3JQX A;  4QXB A;  4BIO A;  2R07 1;  2VMD A;  2EXI A;  3SCH A;  2R07 2;  1EV1 3;  4XE9 A;  2XGX A;  5LAS A;  2XR4 A;  5FY7 A;  2GC3 A;  2ZX1 A;  3WG4 A;  5CAD A;  1SAC A;  4JCK A;  4FT8 A;  1FOD 1;  5LEK A;  1RB8 G;  3NW4 A;  4QXK A;  3NL1 A;  4Q4Y 1;  2R0F A;  2Z4F A;  4GMP 1;  3AKT A;  1PIV 2;  4BCU A;  4A6O A;  2ZPX A;  4RL7 A;  4U36 A;  1TMF 3;  1MS1 A;  4HLT A;  4I2O A;  5JOX A;  1RUD 2;  3SHR A;  2QQL A;  3PDQ A;  2X8K A;  4BQ1 A;  1BXH A;  4GB3 2;  3BTA A;  5FYV A;  5A7S A;  2A5Z A;  4HT1 T;  3NNM A;  4XUT A;  3GHN A;  4OCT A;  2E7T A;  4JQT A;  2W1W A;  3GJA A;  4CP2 A;  4HSL A;  3H8X A;  4DUX A;  1SMV A;  4LUL A;  3H9A A;  2BBV A;  3TN9 1;  2ZGU A;  4MAD A;  3I2O A;  2JD4 A;  2RDR A;  2E6V A;  3N9P A;  3RQ0 A;  1LU1 A;  1LRH A;  1UMH A;  4AAX A;  1OI6 A;  4QHO A;  5FOB B;  1REE A;  3KVB A;  1EPZ A;  2O8O A;  4MLO A;  1CPM A;  1YQ8 A;  3E6D A;  1GWL A;  4N53 C;  4QKF A;  1X33 A;  4XAB A;  1AXZ A;  2VOK A;  3ES1 A;  1A3K A;  5FZ7 A;  4AW7 A;  4W6Y A;  4DNY A;  2W5F A;  2CGN A;  2YFU A;  3LWC A;  3M3E A;  5FFO C;  3L9J T;  1AR9 1;  3U4S A;  2OW4 A;  4CTE A;  4PF5 A;  1UKG A;  2EXK A;  4FOY A;  5FPZ A;  4CDU C;  4MV2 A;  1LOF C;  2R1B A;  1O3R A;  1LTE A;  4Q1R A;  2BU9 A;  4GIQ A;  4A45 A;  1ZBA 3;  5AFE A;  5J37 A;  2YXS A;  1QOS A;  1V9U 2;  2JIC A;  1ENR A;  4LK7 A;  3ZXL A;  1YI7 A;  3ZR5 A;  3A22 A;  3MPB A;  4BMB A;  2RR1 1;  4QQO A;  4CP0 A;  1HRV 2;  3IN9 A;  4GWN A;  1G9A A;  2ARB A;  2BGO A;  3VD3 A;  4IGO A;  4BLJ A;  3RWN A;  2VM9 A;  3H3U A;  2VPV A;  2XH6 A;  1QH7 A;  4XUR A;  3ZXE A;  1EP0 A;  3VBH C;  4YW1 A;  4COZ A;  4N53 A;  1SLC A;  3LDR A;  2YBK A;  1AYM 1;  1MVE A;  4XBL A;  4DMI A;  3PJQ A;  3OB8 A;  1W39 A;  4CXX A;  3UK9 A;  1ULG A;  4AVT A;  3I2D A;  3WF1 A;  3ZVX A;  3TBD A;  1X8E A;  2VMF A;  4K21 A;  4CDU A;  4K8F A;  4OHW A;  4F7Z A;  1LOF A;  1AR7 3;  2BVV A;  2X5I C;  1GAN A;  2H6C A;  3R0R A;  4J25 A;  4UBH A;  1LU2 A;  2WUH A;  3VD9 A;  5EIY B;  4SBV A;  4TXW A;  2RS3 3;  4XIK A;  5FZH A;  5C5U A;  3UKV A;  3WP5 A;  3S5A A;  1NG0 A;  2UY9 A;  3J8F 3;  4A4A A;  4YG0 A;  3SEE A;  2B9U A;  1AX0 A;  4NRO A;  1SBF A;  1OOP B;  3OEA A;  4YVW C;  1XNB A;  5CVR A;  2DYC A;  1UXZ A;  5BNP A;  2A3Y A;  5FKC A;  5LBC A;  5A6Y A;  3T0D A;  4MZU A;  4TWT A;  3HNY M;  4Y1X A;  1ULP A;  1JUI A;  3AFK A;  5FYC A;  4DO0 A;  5JSR A;  3LEG A;  5D8A A;  4DUV A;  2WFF 1;  1U5I A;  1YQ5 A;  1OFN A;  2BOJ A;  1ZYB A;  3LSE A;  1VAV A;  2BP6 A;  4BM8 A;  4RR3 B;  4IGP A;  1OXC A;  4RS5 B;  4EN7 B;  4HK9 A;  4XC9 A;  1IOA A;  4XCA A;  3UL2 A;  3WEZ A;  2VBB A;  1W8N A;  1LOG A;  3WF0 A;  3RJ2 X;  1G86 A;  2FCT A;  4XXA A;  1TE1 B;  4AI3 A;  4AHW A;  5CFC B;  4RA0 A;  1EAH 1;  1UYZ A;  4D69 A;  3CJI A;  5FKB A;  2X5I A;  3DPR C;  1VBC 3;  3N9N A;  5BYN A;  4XFH A;  3POS A;  1E5I A;  2XON A;  5HCA A;  1COV 1;  1NY7 2;  5FYS A;  5IAT A;  1GP4 A;  2OPK A;  4FPO B;  2AYH A;  1KS4 A;  2Z79 A;  4MGQ A;  4UXA A;  4YVW A;  1WLT A;  4R8H A;  3DYP A;  4Q0P A;  4UF0 A;  1D4V B;  4HZF A;  4MH0 E;  2ZHN A;  4IV3 C;  5FPA A;  5L9R A;  1H30 A;  5A7O A;  1MZF A;  2TUN A;  3GF6 A;  4LO5 B;  1RED A;  4OHV A;  5A1F A;  4HVO A;  4KG8 A;  5BNP C;  4JX0 A;  2VZP A;  2YC0 A;  2FDJ A;  3ACI A;  5FZM A;  4BLI A;  4D6S A;  4NUB A;  4AXO A;  2ATF A;  1W3X A;  3GJB A;  5LY1 A;  1SFP A;  4CCC A;  4CCL A;  2GAL A;  5J96 B;  2RS1 1;  2RS1 2;  1PO2 1;  1RJ8 A;  1ZBE 3;  3PTR B;  4HN1 A;  1SCS A;  2CU5 A;  1BEV 1;  1ULO A;  2XDV A;  5A3L A;  4KGQ A;  3LF7 A;  1PNG A;  3H42 B;  2L9L A;  2YY1 A;  3MIE A;  1XBF A;  2Y6J A;  4XAE A;  5B2G B;  2HYK A;  1QJX 3;  1F15 A;  1OQ1 A;  2ID4 A;  3B9C A;  3CZJ A;  2R7E B;  3WLU A;  5JR7 B;  2LRO A;  4NPR A;  4RGG A;  3CBN A;  4Q26 A;  2BRT A;  4QPI C;  4AVS A;  1Q8O A;  3OY8 A;  5CEH A;  1QJY 1;  3VHO A;  4Q4X 1;  1QJY 2;  3VL8 A;  2XL9 A;  1WA4 A;  2BYV E;  2XL7 A;  3PUH A;  1TQ5 A;  1WMD A;  2A3W A;  2HWF 2;  2WA3 A;  3FUO A;  3ECQ A;  1NCR A;  4W8J A;  5F5Q A;  1G6N A;  1IS5 A;  5FWJ A;  3WDV A;  1C28 A;  4LHK A;  2ZOE B;  4Y1V A;  1TVG A;  5D1I A;  5J09 A;  3OUJ A;  4EWA A;  4LLO A;  2Y0I A;  1RMU 1;  4XVH A;  4XFI A;  1WMF A;  3OG2 A;  1IHM A;  3VDC A;  2J1S A;  3R4D B;  1AR8 2;  1AF9 A;  3I54 A;  2GDF A;  5JZG C;  4J1W A;  4CPB A;  1NE4 A;  1NT0 A;  5T54 A;  2P34 A;  3I59 B;  2XJP A;  4YVS B;  1C5I A;  1SCR A;  4P9Y A;  1EYB A;  4P9I A;  1N47 A;  4GH4 C;  4Q5O A;  3OPZ A;  3J26 N;  5FP8 A;  1RGS A;  3I3Q A;  5FO7 B;  3DUI A;  1EPW A;  4ET7 A;  2P6C A;  5GM0 A;  1RUJ 2;  2P37 A;  1SDW A;  2DF7 A;  4QPI A;  3H1W A;  4Q27 A;  1WW5 A;  2D98 A;  2QFE A;  4L2N A;  5IT6 A;  1ODN A;  2CAV A;  2K0G A;  3AZZ A;  5A3P A;  1PGL 2;  3URF A;  3VBO C;  1VBA 2;  1NLS A;  3I4I A;  4X8N A;  3DN7 A;  2Q8C A;  1WD4 A;  3WF3 A;  4LNV A;  2RJL A;  4AI8 A;  4I09 A;  1C4R A;  3N9O A;  5CFD B;  2WO3 A;  3Q8F A;  1X8M A;  1RUC 3;  2NMO A;  4R9D A;  3FHI B;  4CUA A;  1WCS A;  1FMD 2;  2WA4 A;  3BOW A;  3DYO A;  1JW6 A;  5JZG A;  3VDA A;  2D97 A;  3PNA A;  5GJ6 A;  1W8U A;  1SHW B;  4XDO A;  4EZH A;  4IES A;  4B8E A;  4OI0 A;  4GH4 A;  2H0V A;  2WNU C;  4BDV B;  3ACG A;  1SPP A;  3B94 A;  1DZR A;  2DUQ A;  2Q1M A;  3HWJ A;  3LB9 A;  2RM2 1;  3R4S A;  4I3P A;  2ZZJ A;  4CCJ A;  1ZZ8 A;  1MZE A;  4LIT A;  4OVE A;  5FY4 A;  2WWS A;  1C8M 3;  1RUN A;  3MV0 1;  3VBR C;  1W04 A;  5FXW A;  3WNP A;  1H8T C;  1VAM A;  2QQO A;  5A7Q A;  1UY3 A;  2ARX A;  2IFR A;  2RS5 2;  4LA3 A;  4Y22 B;  4BA6 A;  3III A;  3VHP A;  3FLP A;  4CCE A;  1HXS 1;  1DQ1 A;  1YCI A;  2VW1 A;  4JTN A;  4CP9 A;  4ES8 A;  1UNB A;  5DZG A;  1OD3 A;  3H50 A;  4QWN A;  2CSG A;  2G4I A;  3AKS A;  4ZU7 A;  1OA4 A;  5KHG A;  3POI A;  1R08 1;  3OOX A;  4KL1 A;  3H8R A;  2VW0 A;  4M00 A;  1C8N A;  4QB1 A;  4KU7 A;  3HIF A;  4IEY A;  5JCT A;  3MW4 A;  1RHI 1;  2GZW A;  4ARX A;  2JDM A;  4Y20 A;  1AHS A;  2VOT A;  2WQZ C;  4BJ0 A;  3T0A A;  1TNR A;  4FPH A;  4N9I A;  1S0B A;  4SLI A;  4WVV A;  3HNB M;  4MX3 A;  2WAO A;  5DG1 A;  3WCS A;  3WHU A;  3DYM A;  5FJH A;  3EJK A;  2W47 A;  5ERL A;  1RUH 1;  2QNK A;  4LE3 A;  3AJY A;  4DRR A;  1FV3 A;  2JDH A;  5FZ3 A;  3ETP A;  3JD7 1;  5ANN A;  1GZC A;  1O4Z A;  4N43 B;  3WY6 A;  1RUE 2;  2GNT A;  4HN0 A;  1H9P A;  5HV4 A;  5C9A C;  5CIR A;  4IV1 B;  2GN3 A;  3R6S A;  5FRA A;  4BWO A;  3I3B A;  1VBE 3;  4FQZ A;  1YFW A;  2VU9 A;  5DAQ A;  4UFJ A;  2WAB A;  3VDD B;  4OQ9 A;  1POQ A;  5LCW L;  1ND3 C;  5AVP A;  4C0H A;  3I3E A;  4NAM A;  4O9G A;  5FY5 A;  3ZN4 A;  1XU2 A;  4QQ2 A;  1JH5 A;  3VBS A;  1JI6 A;  3MID A;  2PLV 1;  1BHG A;  3K75 B;  2PLV 2;  2WRA A;  5FYU A;  3ZDV A;  1A6C A;  4YRD A;  1LED A;  2WC2 A;  3NNJ A;  3GBF A;  1VBB 2;  4DIN B;  4E4D X;  2YPJ A;  5JOW A;  1XSR A;  3O1S A;  4BU2 A;  3LDB A;  2HYX A;  4AHZ A;  2ZAA A;  3JQW A;  4H7L A;  4Q0V A;  3WW1 A;  4U2A A;  5T5O A;  3JCI A;  4CXY A;  5F39 A;  1P8J A;  4LR4 A;  3DKQ A;  3ZXD A;  4CEY A;  2ZEZ A;  2W3J A;  4O7X A;  4AEJ A;  3QOP A;  3NQH A;  3P6B A;  2PHU A;  2W1Q A;  1GFF 2;  3HQU A;  4GWJ A;  3ZFE A;  4UFL A;  3NJX A;  2JE7 A;  4LHN A;  5JXH A;  3POE A;  2B8M A;  1OHF A;  2BVB A;  1NX9 A;  1AYN 3;  5I91 A;  4MGS A;  3VB9 A;  2Y60 A;  2YC4 A;  4FP2 A;  1ND3 A;  2HWD 2;  3OTF A;  2E32 A;  4PI2 A;  4XF1 A;  5CKQ A;  2PMW B;  3F95 A;  2MHF A;  3VBF C;  5IK4 A;  1K3I A;  4K6B A;  1UZ0 A;  3S57 A;  5F37 A;  4WM7 A;  3WQ0 A;  2P2K A;  5EV7 A;  5SV8 A;  3O0X A;  4WZF A;  5I0S A;  1GKB A;  4S2D A;  4AAP A;  3GAL A;  1WW4 A;  1NCQ B;  1SLB A;  1RXF A;  1NAE A;  5K0U B;  2MEV 1;  3FHQ A;  5DQ0 A;  5GKA C;  3JUU A;  1OVS A;  3PVO A;  4X6R B;  2NM1 A;  2VCB A;  3WG2 A;  3A23 A;  4RHV 3;  2UWB A;  3E5U A;  4XJA A;  5C5T A;  4H7M A;  2OQ6 A;  2Z2S B;  4BIS A;  3W9A A;  4ZS2 A;  1H2N A;  4B4Q A;  3CKH A;  1X9T A;  5DUW A;  4NPL A;  3ZFF C;  5KHH A;  4YZ2 A;  5F3G A;  1LHW A;  3BIW E;  2P17 A;  4YYO A;  3TNP B;  1PK6 C;  1GYK A;  4ATE A;  4Y5Z 0;  3LEI A;  4QPG A;  1R1A 1;  3VBU B;  2VVF A;  1R1A 2;  1W8H A;  4QXH A;  2GC0 A;  3EO6 A;  1Z7S 1;  3VZJ A;  1CIY A;  2VUA A;  4ES9 A;  4FFF A;  5KC5 A;  4Q1P A;  1V6J A;  5LRR A;  1VP6 A;  1CN1 A;  3O7O A;  4YZ4 A;  3GZA A;  5E89 A;  2P3K A;  4WVW A;  3IPV A;  3EXU A;  5DZE A;  3AL6 A;  4XMI A;  1CAX A;  1JTZ X;  3HQX A;  3KV9 A;  4UFM A;  4YM1 A;  2QE3 A;  2WT2 A;  4LOT A;  5FZO B;  3H7Y A;  1W8O A;  1O3Q A;  2D44 A;  5A3M A;  4FSJ A;  3FLT A;  4TZD A;  1OSG A;  1IG0 A;  3AYD A;  4LBQ D;  5DAW A;  4BK5 A;  2R16 A;  4HKL A;  1HDK A;  1I5P A;  3CDZ B;  1BBT 2;  2AAC A;  2EAK A;  2PA7 A;  5JLV A;  2UWA A;  1PK6 A;  1NLQ A;  4L11 A;  3MHZ A;  3UKT A;  5T50 A;  1NXD 1;  1SLT A;  3IT8 A;  4YZ3 A;  1W0O A;  4CXW A;  2KM2 A;  1X82 A;  4Q4W 3;  5C8C B;  3BOP A;  2K2S A;  3AL5 A;  1W90 A;  1MEC 3;  4HBN A;  4OUL A;  5CIS A;  1DDL A;  2RDQ A;  3H7J A;  4B3N A;  3N7M A;  3CEW A;  1I1E A;  4WVM A;  1AL2 2;  4CU7 A;  1LUL A;  1ENQ A;  3NJY A;  2VD7 A;  1JXN A;  4HVQ A;  1QF3 A;  1T6G C;  4PJY A;  4E2S A;  2RJK A;  1UX7 A;  3F2Z A;  1RIT A;  1DQ5 A;  4GA9 A;  1OQE A;  5FPV A;  3SLI A;  3JBG 3;  2KD7 A;  1TME 2;  1XYO A;  3QD6 A;  4BQY A;  5IK7 A;  4KQ7 A;  1UX6 A;  1UOJ A;  4PDW A;  3T2P A;  3KD4 A;  1OPO A;  3AXE A;  3M7A A;  4NHL A;  5J48 A;  5DDJ 1;  4NWV A;  1W05 A;  2FCV A;  5DDJ 2;  5CB7 A;  5FZG A;  4AHY A;  3FFZ A;  2VQU A;  2HWC 1;  4P9W A;  3U11 A;  3ZSE A;  4DRV A;  1QHD A;  3OUH A;  4KU8 A;  4DXT A;  2NYY A;  4YW2 A;  1D2Q A;  3E5Q A;  4GJZ A;  5GLV A;  5A3T A;  4NJ4 A;  2D6P A;  1RVF 3;  3B00 A;  1GOG A;  4EJR A;  4LKF A;  4ZON A;  3RZG A;  1RUI 1;  4HOO A;  4AGG A;  4TN7 A;  1RUI 2;  2R06 2;  3I7D A;  2JDZ A;  2FZ2 A;  4YAR A;  2XBO 2;  5J7M A;  5FP7 A;  1R09 3;  1NLR A;  1PO1 3;  4ZXE A;  3D5O A;  2P3J A;  2JDP A;  3IDA A;  4AZZ A;  5FYB A;  1AXY A;  1G9F A;  2UYB A;  1PVC 3;  1PMI A;  2WII B;  1GOH A;  4LE4 A;  5DPN A;  3MZH A;  2VZ1 A;  5BV6 A;  1ASJ 1;  2RVA A;  3EHK A;  4IE6 A;  1ASJ 2;  2HWE 3;  2DDU A;  1XNC A;  1H4G A;  3B5L B;  4XF3 A;  2PHW A;  1D4M 2;  5C33 A;  3TEW A;  2HWB 1;  4LIU A;  3USU B;  1W9S A;  3HEI A;  2HWB 2;  3ST7 A;  1CAW A;  1POV 1;  1IQD C;  3KWV A;  4FPE A;  1MVQ A;  2WT0 A;  1GZ9 A;  5C4W C;  1SLA A;  3VN4 A;  1JS9 A;  1LOB A;  3H8U A;  1U5Z A;  3VHN A;  1DGR N;  2WT1 A;  1J3P A;  1MS9 A;  1B35 B;  1UZW A;  2Y34 A;  3A4U A;  1UU6 A;  1PHM A;  4NAO A;  4YGC A;  3FUQ A;  4AVC A;  1HRI 3;  3IM0 A;  4NIA A;  4QQP A;  2BJS A;  4PIZ A;  5IVY A;  4Q4V 1;  2R07 3;  4CU9 A;  3T2T A;  1KFU L;  5GLU A;  5ANQ A;  1S0J A;  2WN3 A;  4UW4 A;  5EYX A;  4QDQ A;  2WO1 A;  1HLC A;  2EVX A;  1NOV A;  3CO2 A;  4XFG A;  1PIV 3;  1CAV B;  4FOQ A;  3ACL A;  3KGL A;  5F5I A;  2PQS A;  4AOC A;  2RMU 1;  3USS A;  1LGN A;  2P4E A;  4XPV A;  1RUD 3;  3O1U A;  1W9Y A;  4FFI A;  2VNO A;  4CEW C;  3ZSL A;  2OS2 A;  4AFM A;  3GBG A;  5FZA A;  5A3U A;  4GB3 3;  2JDY A;  2E51 A;  2VZR A;  2WZR 1;  2W95 A;  4HON A;  2GNB A;  4LBM A;  2IXL A;  2AC1 A;  2YUE A;  1OVP A;  1GUI A;  4QGN A;  5K8S A;  3AZX A;  4XUN A;  2C6S A;  2YGM A;  1S0E A;  4KH9 A;  2FHR A;  3RSJ A;  2VOW A;  2CTV A;  2TNF A;  1LGC A;  3OCP A;  5KHK A;  3GZT B;  3EB7 A;  3APB A;  5ABJ B;  2EIE A;  1W0N A;  2JDU A;  4RD7 A;  4CDW B;  4Q8K A;  5A7W B;  2ET7 A;  4GQ7 A;  3OBR A;  4N90 A;  4CE8 A;  3PTY A;  5A33 B;  1AR6 1;  2D93 A;  1QJU 2;  3E1F 1;  1J59 A;  3MGU A;  4A41 A;  2OX0 A;  5L73 A;  4YPJ A;  4URT A;  1CZS A;  1VRH 2;  1FT9 A;  2YMZ A;  3IMM A;  3B9I A;  2A1X A;  4OLL A;  4LJH A;  5FPB A;  3H3Z A;  4XF4 A;  5EP9 A;  1E57 A;  2J1E A;  2OUH A;  5FLH A;  4R4Z A;  2X29 A;  4K1Z A;  2ZXQ A;  3P3N A;  2FD8 A;  4I30 A;  2D3R A;  1D7P M;  1V9U 3;  1GBG A;  2JEC A;  2EXJ A;  3AP4 A;  3HMY A;  2Q8O A;  2D5H A;  3E6B A;  3PME A;  5JXJ A;  1HRV 3;  5BNO B;  3VGI A;  2BV4 A;  3HBK A;  3UKN A;  1DHK B;  4C1X A;  4BQ5 A;  2XVL A;  3IZO A;  3W5N A;  2PAK A;  3VDB A;  1US3 A;  3D4K A;  1AZD A;  1UZV A;  5LBF A;  4FTS A;  2WZE A;  1O3T A;  1BQP A;  1UW8 A;  3DEC A;  2XHN A;  4B1L A;  2ADE A;  4CCN A;  1MQT C;  2XUE A;  2IC1 A;  3FX3 A;  4AYU A;  2ZMK A;  4GD4 A;  1G9C A;  2G9F A;  1RJ7 A;  5FXZ A;  3ZN6 B;  2GN7 A;  4BQW A;  3Q8B A;  1QQP 2;  5FZ0 A;  1JZ5 A;  1OUS A;  1OMI A;  1JYI A;  4LO6 B;  1OA3 A;  4MSV A;  2IXC A;  1HJG A;  1V6I A;  3MBW A;  2BFU S;  5BY5 A;  1J1L A;  3MLL A;  1BCX A;  3M1H A;  2VZO A;  4GKX A;  5JI9 A;  1VBD 2;  2J22 A;  2V72 A;  2DCJ A;  3CQO A;  4IL7 A;  1GQH A;  4DXS A;  1US2 A;  1OLR A;  2DWR A;  1ZM1 A;  1LES A;  5LBE A;  1JYW A;  5I8Y A;  3NAP B;  1HV1 A;  3WP4 A;  2DBN A;  5FZB A;  1J84 A;  5FRE A;  2IVI B;  2J1T A;  4L0P A;  4QU2 A;  1CR7 A;  1DGW A;  2WS9 1;  4CCK A;  4Y1Y A;  4IEU A;  3ZXA C;  1BK1 A;  1W6Q B;  3J7L A;  4RQP B;  1PGW 1;  3C2U A;  4AVV A;  3AVS A;  2BUK A;  2OZ6 A;  1MQT A;  2V5D A;  1FOD 2;  1O59 A;  3SCF A;  1ZZC A;  2Z42 A;  1Q5O A;  2VUJ A;  3C8X A;  4Q4Y 2;  5FZK A;  5L7O B;  5EXO A;  4IER A;  3VV1 A;  3O1V A;  2ZGL A;  1KJR A;  4E2Q A;  2EF6 A;  3ZN5 A;  2BNO A;  2WNV B;  2WLP A;  4PQ9 A;  4H2A A;  2B7Y A;  1Y3T A;  2YU2 A;  3VKN A;  3T09 A;  1GLH A;  2XVK A;  4PI0 A;  3FBM A;  5IFP A;  4G3Y C;  1I3H A;  5F6L B;  1LGB A;  3ZFG B;  1RC6 A;  2HH9 A;  4K1Y A;  2AR6 A;  1DU3 D;  1N1Y A;  1WW6 A;  2DUR A;  5FMC A;  2VQT A;  4KWU A;  3TN9 2;  2Q1Z B;  1IGO A;  2F4L A;  5JPM B;  4OFG A;  4D7T A;  1PZ9 A;  3NV1 A;  3SIT A;  4B4R A;  1ONA A;  3S7I A;  2ERF A;  2F4P A;  2XJT A;  4CP1 A;  2PAE A;  1FX5 A;  3RJR A;  2NP0 A;  3OUI A;  5H9R A;  1JYC A;  4MOA A;  4XBN A;  5CAZ A;  4JGZ B;  1LEM A;  4RS5 C;  4FPY A;  4O61 A;  1AR9 2;  3I2G A;  1LR5 A;  1VMH A;  2FMD A;  1XXN A;  1RUF 1;  3Q8E A;  4XW3 A;  3ZLI A;  3RI9 A;  1PVX A;  4NHX A;  3J9S A;  4S2G A;  3WD5 A;  4CDQ B;  4FPJ A;  4PT6 A;  1QY4 A;  3BCW A;  3ITQ A;  4AED C;  2XJQ A;  3ATG A;  2JX9 A;  3GCW A;  5JWP A;  4UBG A;  5CZK A;  1D0G A;  2R04 1;  4QX7 A;  3ZDS A;  2ZML A;  2RR1 2;  5F3E A;  4C8D A;  4XUP A;  4BQX A;  2QZ2 A;  1OOP A;  2WWJ A;  4FP3 A;  2Y6K A;  2JG9 B;  5GLW A;  4ASL A;  1QJY 3;  1QMJ A;  5D8A C;  3K46 A;  3IIA A;  3BB6 A;  5F5C A;  1K12 A;  2HWF 3;  5ACA 1;  4N7I A;  1QDC A;  3AYE A;  3ETQ A;  1AYM 2;  5FWE A;  3BAL A;  1V6O A;  1QEX A;  1YI9 A;  4RR3 A;  4YZ5 A;  3UGF A;  4RS5 A;  4A6S A;  3KB5 A;  4QT6 A;  2VEC A;  1QNY A;  2ARE A;  5EJ3 A;  1W9T A;  5FBZ A;  3CJI C;  1AR8 3;  1YIP A;  1HJF A;  2ZBJ A;  3BVC A;  5JPN B;  1YFY A;  1IS4 A;  2C9A A;  4LT5 A;  4G4F A;  2ZCW A;  2NLR A;  4GZ9 A;  3WVJ A;  1XB9 A;  1S0I A;  2Y6F A;  2W94 A;  4AED A;  1ND2 C;  3FFQ A;  4HG6 B;  3TWI A;  2K46 A;  1MS4 A;  1IPK A;  1UWW A;  3TYJ A;  2WN2 A;  5DN2 A;  2GH2 A;  1OH4 A;  1RUJ 3;  3RDI A;  3B7M A;  1PM4 A;  3AYC A;  1O8S A;  2BWA A;  1SBE A;  2QQI A;  2ZAC A;  4A3X A;  1KXG A;  4RFR B;  4B7E A;  5LK7 B;  1GQP A;  1J3R A;  2WFF 2;  1GNY A;  4IEP A;  5HBA A;  1VBA 3;  5FBJ A;  2W92 A;  4AG4 A;  4EE2 A;  1UOF A;  1Y43 B;  1CWP A;  4LLF A;  2BZD A;  3L2H A;  4FTB A;  2XUM A;  1H6Y A;  4NR1 A;  3E5X A;  4Y3O A;  2OXB A;  3QBQ A;  1GZT A;  1QH6 A;  3MLK A;  1S4C A;  3O12 A;  5FY1 A;  4XFB A;  3RYP A;  5JR2 A;  3OJB A;  1FMD 3;  1EAH 2;  1DGR A;  1JU3 A;  4JVA A;  2D6L X;  1EUU A;  2A6Z A;  3DXT A;  3EMR A;  1EV1 1;  2GC2 A;  2WKK A;  2RDN A;  3QH7 A;  1H0B A;  2VBD A;  3KF3 A;  5DUU A;  4JKM A;  4N53 B;  3VL9 A;  1COV 2;  2W0X A;  5FXV A;  2BGP A;  3RMY A;  1ND2 A;  4OZX A;  1GZW B;  5I8S A;  1JN2 P;  2VO5 A;  5CKM A;  4CZS A;  1Q56 A;  4IW3 A;  1JZ3 A;  4COW A;  3PIG A;  3PVE A;  3K3O A;  3T4H B;  2J1A A;  1LHN A;  3KF5 A;  4ZKT B;  1TMF 1;  5F5A A;  3SNM A;  1CGP A;  4CDU B;  4A7Z A;  2W9X A;  4MET A;  4LBQ B;  2W87 A;  3WP3 A;  3POJ A;  2I74 A;  1NCR C;  1ST8 A;  4S2F A;  1IZ3 A;  3FC0 A;  2WLQ A;  2OA2 A;  2HBT A;  1LOE A;  2RS5 3;  2DVA A;  5LRS A;  2CV6 A;  3A0N A;  1PO2 2;  3GNE A;  3RI8 A;  4JKK A;  1BEV 2;  2ZKL A;  3NRU A;  3FN9 A;  3I2K A;  1MZ6 A;  3PUQ A;  4LKS A;  3NV2 A;  3LAG A;  5IAV A;  1DGW X;  4ASM B;  5FY8 A;  3VBH B;  3I59 A;  1KFX L;  4QX2 A;  4YVS A;  1CJP A;  4P9X A;  4QM8 A;  5C3P A;  3S7E A;  1I9R A;  2IUW A;  5LEJ A;  3AKR A;  5I93 A;  4Q4X 2;  1W8F A;  1U5X A;  1URX A;  1F8V A;  3GCX A;  1W6N B;  5DG2 A;  1BVP 1;  1O7F A;  1S0G A;  2RE9 A;  4JKL A;  4NVP A;  1QOT A;  2UY8 A;  4XQD A;  4B29 A;  2VH9 A;  1RUE 3;  2YC2 A;  4JRL A;  5FYI A;  4F3J A;  4CVU A;  5AVA A;  5FDB A;  3U0Z A;  2KA3 A;  4AI0 A;  1UY0 A;  1RMU 2;  4YVW B;  5FZ9 A;  3AP6 A;  1YYN A;  3BIE A;  2IVJ A;  5F3I A;  2GSY A;  1DBN A;  1BZW A;  4D7S A;  5IVJ A;  5FMO S;  1BK0 A;  3ENR A;  2XQR A;  2DFB A;  1F9K A;  2V5Y A;  1Q8V A;  3PL0 A;  1WCU A;  4P00 B;  3WUD A;  1J58 A;  3LDK A;  1H6X A;  1VBB 3;  1Z78 A;  3KT4 A;  3HD8 B;  3O5S A;  3BYW A;  4XET A;  4EYU A;  2UYA A;  3HQR A;  2A6W A;  4CA9 A;  1KQR A;  1STM A;  1S2K A;  1UIK A;  4ZPI A;  1G7Y A;  4OI1 A;  3AP5 A;  5FY0 A;  1UPI A;  4WM8 B;  5LA2 A;  5CBL A;  1AR7 1;  1V6K A;  1VAK A;  2QDR A;  3MV1 1;  3DPR B;  1V6L A;  4N43 C;  2DVD A;  2RS3 1;  2AH2 A;  4DEQ A;  3HN3 A;  3J8F 1;  4ARY A;  1GP6 A;  3J8F 2;  3LEK A;  4P02 B;  4Y22 A;  5GZE A;  1PZ7 A;  4AI9 A;  3HNM A;  3T3Y A;  2Q8D A;  4OUE A;  1MZ5 A;  2HWD 3;  2IFW A;  3ZYG A;  1VLN A;  3Q9O A;  4IV3 B;  4QDR A;  1VE0 A;  4EN0 A;  1DLL A;  3G6J B;  5F2S A;  5FPL A;  3DCQ A;  4Q8L A;  1E5S A;  4EN8 B;  5BNP B;  4OMD A;  4K8R B;  1DG6 A;  4KNC A;  4M0N A;  4NIG A;  2ZGN A;  5A3N A;  3AVR A;  3NNG A;  1XYP A;  3CJX A;  2RM2 2;  4MGZ E;  5LBB A;  3OBA A;  2Q1F A;  5FMB A;  1QXP A;  3WCR A;  3LIG A;  4DQA A;  4N43 A;  3M3Q A;  3WQB A;  3C7G A;  3WIN E;  1C57 A;  4IV1 A;  5IK5 A;  3AMM A;  1HXS 2;  3W59 A;  5L19 A;  1Y7B A;  3VKF C;  3VDD A;  3VBS C;  5CG9 A;  3AP9 A;  3S5Q A;  1V6N A;  3MEP A;  4Q0U A;  1R08 2;  2EAA A;  2DVB A;  5A7N A;  2H0B A;  4PBO A;  4DPN A;  1U5Y A;  2O1Q A;  3E97 A;  5FR3 A;  1MAC A;  1RHI 2;  2W52 A;  1PMJ X;  4ZU5 A;  1AUY A;  3HOB A;  2CNA A;  1MS3 A;  2JJ6 A;  4NRQ A;  2VZV A;  1CJD A;  3SH4 A;  4YM3 A;  5KBF A;  4L97 A;  4NHM A;  1ZRE A;  2BBA A;  2ENR A;  1RUH 2;  4YM0 A;  2VVE A;  1ZBE 1;  2AGS A;  1MR5 A;  2FBE A;  4FPC A;  3N7J A;  4QHB A;  3NNL A;  1YRZ A;  3AXD A;  5JZG B;  2QCS B;  3JD7 2;  3LKJ A;  3RRD A;  4CEY C;  2D6O X;  5F9T A;  3LE0 A;  5L36 A;  5GAL A;  3J4U H;  4M3C E;  5DUV A;  2PQQ A;  5IVC A;  3IAQ A;  2ZX0 A;  3ZFE C;  1LAJ A;  1QJX 1;  2NZ9 A;  3Q8A A;  3UV9 A;  4UI9 L;  5C71 A;  4FXK B;  4GH4 B;  4M3C A;  3OEB A;  4Q0S A;  3T0B A;  4DEV A;  4LBJ A;  4Q29 A;  5I0D A;  1LB2 A;  1OFS A;  4IEW A;  4L9B A;  3O1T A;  3T2Q A;  4FFG A;  4FVV A;  4TLG A;  4AFA A;  1BBT 3;  5JOZ A;  3PUA A;  5BNN B;  4IGQ A;  3T30 A;  3BTZ A;  3SIS A;  1C5H A;  4FAH A;  2VW2 A;  5HCH A;  3KT7 A;  4WM7 C;  2SBA A;  1NQJ A;  1XOY A;  2C24 A;  3VBO B;  4COY A;  1HW5 A;  4L99 A;  3VBU C;  2GMP A;  1OKO A;  2LAL A;  1OUR A;  1W9F A;  2DBI A;  2JXA A;  1O6U A;  4JTO A;  2JWP A;  2LM3 A;  5EPA A;  1JHJ A;  4CP9 B;  1AL2 3;  4PCR A;  1E5H A;  1NCQ A;  1NE6 A;  3OPT A;  5LA0 A;  2WDB A;  2PTM A;  4AE2 A;  1GNZ A;  5JSP A;  3HPN A;  2GND A;  1PNF A;  2XLG A;  4XCB A;  4EZ4 A;  3I3M A;  2Y6H A;  1TME 3;  2ZZQ A;  5FZL A;  1ZX5 A;  2ET1 A;  4NOT A;  4Y20 B;  1S1A A;  2WNU B;  5HCF A;  4CDX C;  1VMF A;  1JZ4 A;  3CZU A;  3T08 A;  5F3C A;  1JOP A;  1FNY A;  1NKG A;  5KC6 A;  3B93 A;  3T2O A;  3WNO A;  4Y4Y A;  4PBP A;  2D40 A;  5DDJ 3;  3VD5 A;  1DGL A;  5CA6 A;  4BXS V;  1Q8Q A;  1K5M C;  1W8W A;  2YGL A;  1HN0 A;  4QPG C;  3VBR B;  4XAA A;  2HEW F;  5FYY A;  1H8T B;  3SCG A;  3GZU C;  4XZU G;  1X9P A;  3VBU A;  4HKW A;  4XQ4 A;  4Z92 B;  4YGB A;  3ILR A;  1DYK A;  4LOS A;  4YLZ A;  2DTW A;  1NXM A;  1RUC 1;  4QQH A;  2MEV 2;  1RUI 3;  2R06 3;  4XAC A;  4LA2 A;  2XBO 3;  1UMZ A;  2BOI A;  1GOF A;  5A6Q A;  2DFC A;  1ZZB A;  2QDN A;  1M4W A;  5FUP A;  1CX1 A;  1CZT A;  4N7U A;  2C26 A;  2WFP A;  1O3S A;  3DKW A;  4E8C A;  5IYY A;  5IK8 A;  5LW9 A;  5DAP A;  1YQC A;  5IW0 A;  1QGL A;  4CDX A;  5FYZ A;  1V70 A;  1SDD B;  4KMQ A;  3ROU A;  4NHK A;  3U1X A;  1ASJ 3;  5FZ6 A;  4BHP A;  5FO8 B;  5JMC A;  4M01 A;  1D4M 3;  3C7E A;  1UYY A;  1C8M 1;  1TNF A;  1V0A A;  1W6O A;  4L92 A;  4F8A A;  4XFF A;  1POV 3;  3NKT A;  1K5M A;  2FMY A;  2YZ4 A;  5IJR A;  3LPF A;  2PXJ A;  3THP A;  1LEC A;  5F8P A;  5C9A B;  1Z7S 2;  1V00 A;  2VME A;  4XDQ A;  5C8C A;  2OII A;  1W2O A;  1U0A A;  2OT7 A;  2J42 A;  4JRA A;  3V0A B;  4IEV A;  4V1P A;  4EV0 A;  1R64 A;  2VZT A;  2VL4 A;  4QPW A;  1ND3 B;  2D6N A;  3EYP A;  3SC7 X;  2BWC A;  1ZRC A;  4M4R A;  4JGY C;  3NJZ A;  1UD1 A;  1S0C A;  2VNR A;  1OA2 A;  2WWU A;  1GU3 A;  3ACH A;  3D82 A;  4PDW C;  1PMH X;  5D2A A;  3FMG A;  1H9W A;  1HIX A;  1T6B X;  3LOB A;  4OHY A;  2VR4 A;  4HL0 A;  1UY4 A;  1WLW A;  3LOI A;  3WV6 A;  2R0H A;  4YW4 A;  3I49 A;  2XJU A;  4P08 A;  4QKD A;  5JIA A;  5SV5 A;  4XJU A;  5E6H A;  1W28 A;  3BU0 A;  3V0B B;  4XUQ A;  4AF9 A;  1HV0 A;  2D3P A;  5E88 A;  3IB3 A;  3OD4 A;  3TEX A;  4YM2 A;  1VBE 1;  2VQ0 A;  1EY2 A;  1SFN A;  4IE7 A;  1KRI A;  5FMO L;  4MO3 M;  2HLE A;  2J1R A;  4WZC A;  1WME A;  3CIH A;  3JXS A;  2GC1 A;  3N4M A;  4Z8B A;  3VHR A;  3PUS A;  1LNS A;  2A75 A;  5C8W A;  4JGY A;  1FAY A;  1W6M A;  5C3O A;  4LBK A;  2Q30 A;  5T5P A;  3VBF B;  5HPO A;  5C70 A;  1H2M A;  1W8Z A;  5JXI A;  2PAM A;  1OKQ A;  2FQP A;  1FNZ A;  1O5L A;  4QAW A;  1QJU 3;  5A3O A;  1CAU A;  3AKQ A;  4FBF A;  1VRH 3;  4BE3 A;  3USU A;  1JOD A;  2HWC 2;  4FOV A;  5I0T A;  2FCU A;  1BVV A;  5AC9 3;  1O5U A;  2G9G A;  4M4P A;  4W6X A;  2ZMN A;  5CU1 A;  1FXZ A;  3NNF A;  1HB4 A;  2VTX J;  3BOD A;  4ORF A;  3IKW A;  3FJS A;  2JG8 C;  3ZR6 A;  1ENX A;  3VZK A;  3ZFF B;  1AYN 1;  3RZH A;  1B35 A;  1LJ7 A;  5JXG A;  1L3J A;  3WQ1 A;  1OUX A;  4MXW B;  3P1I A;  2WAA A;  4NN0 A;  2E7Q A;  3O1R A;  2W1U A;  3WW3 A;  2VBP A;  1MPX A;  1SZB A;  2E26 A;  5EJZ B;  1GV9 A;  2D7F A;  3U07 A;  3QH6 A;  4H14 A;  2SLI A;  4E4H A;  1W6P B;  4CUC A;  3DXU A;  2QJV A;  2Y38 A;  4KBB A;  4HFS A;  1UU5 A;  2I2S A;  4GXL A;  1SBD A;  4AVA A;  2OKX A;  2ZEX A;  4R9A A;  1QQP 3;  2HKX A;  5CKN A;  3K4Z A;  5IWF A;  3ILN A;  4XF9 A;  4BXF A;  5BPX A;  1W06 A;  3UT0 A;  3WT3 A;  2E7A A;  3LEM A;  2E53 A;  4XOG A;  2EIC A;  3N9Q A;  4RHV 1;  3PLQ A;  1OD5 A;  5LB6 A;  2ZGK A;  2OYZ A;  3ZKU A;  3ZMO A;  4AGV A;  1VBD 3;  2VVD A;  2W68 A;  3NV3 A;  3SKJ E;  5FO9 B;  5LWB A;  2YG0 A;  5TSW A;  1DF0 A;  2OZJ A;  4I0B A;  2JG8 A;  1JZ2 A;  3W20 A;  1JYV A;  4I3G A;  2DTY A;  3KSC A;  2PFW A;  2Y64 A;  3DV8 A;  1KD7 A;  3WF2 A;  4UFH A;  5K7P A;  5HI0 A;  3WW4 A;  1Y9G A;  1NA1 C;  2WIN B;  4FPK A;  4Q4V 2;  4CYD A;  5IVF A;  2JDA A;  5ABJ A;  4J1X A;  4Y4R A;  5L9B A;  2CY6 A;  1ZRF A;  2WJS A;  1GMM A;  5FYT A;  3SH5 A;  3UJQ A;  4KWK A;  3C7F A;  1YFX A;  4CPB D;  1H1A A;  2W08 A;  5HXV A;  1FOD 3;  5A33 A;  4LMF A;  3WW2 A;  4KWL A;  1GNH A;  3OF1 A;  4P9G A;  4GMP 3;  4Q4Y 3;  4XXP A;  5H9S A;  2X10 A;  3RMX A;  1XU1 A;  5EZW A;  2R49 A;  4TLF A;  2RMU 2;  3MIC A;  3AZV A;  4LIV A;  1J83 A;  1HX6 A;  1DFQ A;  1L7R A;  5A32 B;  1GIC A;  3DGT A;  3R05 A;  3KVA A;  3AMH A;  5LK5 A;  2VXR A;  3TEY A;  1DYO A;  1LCL A;  2B9V A;  2WZR 2;  4LO4 B;  5A1A A;  1MS5 A;  3U10 A;  5M0T A;  1KS5 A;  2D6K A;  4DY5 A;  3LA2 A;  5A3W A;  3TN9 3;  4BYY A;  5BNO A;  1PGS A;  1RTV A;  1BMV 1;  2RJ2 A;  4B1M A;  2UU8 A;  3UES A;  3T4V A;  2OUJ A;  2NQY A;  1NA1 A;  4UW3 A;  2PHT A;  1WLC A;  2BEO A;  5FUI A;  3BUC A;  3MF6 A;  1W99 A;  2ZGR A;  3MUY 1;  4HPK B;  4LPL A;  4I02 A;  4Q4W 1;  4Q4W 2;  1MEC 1;  2X05 A;  1AR6 2;  1G9B A;  2WYS A;  2I45 A;  2V4A A;  3WX5 A;  4QB2 A;  2XOM A;  3O1M A;  3ZPO A;  4CU8 A;  4FPF A;  3ZN6 A;  1N3Q A;  1AR9 3;  3N35 A;  3JB4 C;  1CON A;  1L7Q A;  2A3X A;  1IKP A;  1XPW A;  2N7G A;  2ZHK A;  5T3N A;  1JZ7 A;  3DL3 A;  4AFB A;  1RIR A;  2XJR A;  1CES A;  1YWK A;  3RNS A;  5KWR A;  2Y0O A;  3D8C A;  3PJY A;  2XWJ B;  1WCQ A;  3R4U A;  1WZX A;  2RR1 3;  2G19 A;  2VXJ A;  3NAP A;  1RIN A;  2BQP A;  1W8T A;  3D0J A;  3LZZ A;  4XYX A;  5DAV A;  4BQ4 A;  4HET A;  3PVB B;  4NWW A;  3LA3 A;  4R9B A;  3VD7 A;  1S55 A;  4E27 A;  4AI2 A;  3MDP A;  3N7K A;  2C4X A;  5C4W B;  2ZGO A;  1W6Q A;  3OD0 A;  1Y4W A;  4RQP A;  3MYX A;  3IDC B;  1H1I A;  3VUO A;  3WDX A;  1NYW A;  1RVF 1;  1APN A;  1AYM 3;  2PN5 A;  2VOX A;  4AQT A;  3AMN A;  1N3O A;  1VAL A;  2YFZ A;  3KS7 A;  3RWK X;  5FQ0 B;  5JMO A;  3VZO A;  4KI5 M;  5L7O A;  1QU0 A;  3KZ4 C;  1SLI A;  4LBO A;  4A3Z A;  1R09 1;  4LUK A;  3OGG A;  4YWA A;  1PO1 1;  3ZYF A;  2ZX2 A;  1PO1 2;  3M3C A;  4P5Y A;  2XB6 C;  1DIW A;  1CX4 A;  1VB4 A;  1SEF A;  3O1P A;  4IEO A;  1OLM A;  3U4X A;  2CHH A;  2EXH A;  4QQL A;  1PVC 1;  3MLJ A;  3ZYP A;  4FAG A;  3AX4 A;  2FDK A;  3S30 A;  4K9S A;  3UGG A;  5LAT A;  5E8A A;  3ZFG A;  4D6Q A;  4FXG B;  5DUX A;  2V73 A;  3VZM A;  1K5J A;  2VQA A;  4RYD A;  3OGJ A;  1OPM A;  2HWE 1;  3LD8 A;  4N9H A;  3FLR A;  4P9L A;  4DFS A;  3KV4 A;  2J1U A;  3VKL A;  1H8V A;  1OLQ A;  2WS9 2;  3LIH A;  1W03 A;  4ZXK A;  1WA6 X;  1PGW 2;  4CEW B;  3NO8 A;  1YJK A;  2WFF 3;  1L7L A;  1FPN 1;  3RGB A;  4BQ3 A;  1FPN 2;  2BW8 A;  1YC6 1;  4QM9 A;  1WUV A;  2AZ5 A;  2VMH A;  2DCT A;  1JZ8 A;  4FI9 A;  1QNW A;  3ASI A;  3LA7 A;  2XKO A;  2WQ8 A;  4OHZ A;  1HQN A;  2FDI A;  3AMQ A;  1RUG 1;  1HRI 1;  1C1L A;  1YQ6 A;  4MHR A;  4IEX A;  1RUG 2;  1EAH 3;  2R30 A;  4NRP A;  4XFA A;  4D6R A;  4RGA A;  2A6X A;  4PQQ A;  3UYJ A;  4FO9 A;  2VMG A;  4X6Q B;  3POG A;  4CRQ A;  1ULC A;  2OVU A;  3DEM A;  4YGD A;  3S0M A;  5ISL A;  4GAZ A;  1DP0 A;  2DV9 A;  1COV 3;  2NPI A;  2XXZ A;  1A8D A;  2R32 A;  1OOP C;  5I0R A;  4QX1 A;  4G9S B;  4FQ4 A;  2ZEY A;  1PIV 1;  3LGR A;  5FZE A;  5C7G A;  5FZC A;  3CMG A;  3OYW B;  3SQO A;  4Z07 A;  2JG9 A;  3JB8 A;  1DYP A;  3WNN A;  4DY3 A;  5I8T A;  1JU4 A;  1RUD 1;  2QQN A;  3OGV A;  2Y6L A;  5F2W A;  2QQP A;  1LHV A;  2W2I A;  1DZQ A;  3QLQ A;  3OGR A;  4E4S A;  1IQA A;  4GB3 1;  1U12 A;  3EBR A;  1RXG A;  1W3V A;  1LOD A;  4ZZ8 A;  4RR3 C;  1I6X A;  4Y5T A;  1C3H A;  2ZGP A;  5CNA A;  4ERO A;  4ZZ5 A;  2CDP A;  2RS1 3;  3GBW A;  1RUF 2;  4LK6 A;  3TB0 A;  1VJ2 A;  1PO2 3;  5DXD A;  5CFC C;  1UU4 A;  1BEV 3;  3ZYB A;  3TNQ A;  3ZYI B;  5BUV A;  3AKP A;  4LUM A;  1I5Z A;  4Y33 A;  3KCC A;  2AEN A;  1XND A;  3T1M A;  4FPL A;  3VD4 A;  4Z82 A;  4B7K A;  1MQT B;  4O65 A;  2R04 2;  4H3W A;  1UZY A;  3NKG A;  3LCP A;  3W21 A;  3ZIX A;  4E9K A;  1WGP A;  4YG6 A;  1YUD A;  3FHA A;  3HR9 A;  4V2V A;  1G9D A;  3IAP A;  2R6Q A;  4Q4X 3;  3AP7 A;  3TRS B;  1BKZ A;  2ES3 A;  2P3I A;  2VNG A;  3HJR A;  2V4V A;  4YW3 A;  2FDF A;  3UET A;  5ACA 2;  3H0O A;  4KG0 A;  5HCB A;  4MUV A;  4A2U A;  2ZX4 A;  4MGI E;  3NMB A;  4BME A;  4XQW A;  1V9U 1;  3E6C C;  1NQD A;  2IXI A;  1ULD A;  1RMU 3;  4ONU A;  4OZO A;  1HRV 1;  3U75 A;  3AM2 A;  3I97 A;  5CFC A;  4QB6 A;  2VZQ A;  2JIJ A;  3ABZ A;  1ZZ9 A;  3M3I A;  3ZYH A;  2UUR A;  4AVB A;  1QIQ A;  1O8P A;  1G8W A;  3ZOI A;  1N1V A;  2VJX A;  4R9C A;  4XBQ A;  1ACC A;  1ALY A;  3KQ4 B;  1NZC A;  1MS0 A;  4JV4 A;  1S0D A;  3IDE A;  2EID A;  4WVZ A;  5GZC A;  1HB1 A;  1GZW A;  2P6H A;  5F1R A;  4QGM A;  1M06 G;  1HQL A;  3S6P A;  2BDR A;  3POY A;  3K4D A;  3WSO A;  4COU A;  2GME A;  1SG3 A;  3IWZ A;  3WG3 A;  5C3S A;  1GSL A;  4LBQ A;  2NMN A;  1VB2 A;  1X7N A;  2IXK A;  5GLZ A;  5LA9 A;  1CD3 G;  1ODM A;  4P14 A;  4XJZ A;  3MIG A;  3HBZ A;  4Y1U A;  4EWE A;  1W2U A;  2YHJ A;  1WMX A;  4LO7 A;  4JDN A;  2ZAH A;  3KGZ A;  1N1S A;  1HB3 A;  2PHX A;  3POB A;  3RZK A;  4Z2W A;  2O0O A;  1EV1 2;  5FK7 A;  1UOG A;  1XNT A;  5D21 A;  4YVS C;  4A7Y A;  1S2B A;  4GMP 0;  4ATF A;  2GU9 A;  4QMA A;  1XRU A;  3VBH A;  3ZMN A;  2VNV A;  3P3P A;  3WDT A;  2Y6G A;  4OUM A;  3WF4 A;  3LSD A;  2Q5T A;  5A6X A;  2RM2 3;  3RZL A;  2EAL A;  3M4F A;  1FYU A;  3ZM8 A;  2VZ3 A;  1TMF 2;  2ZTN A;  3B01 A;  3PU8 A;  3WHT A;  2F17 A;  3UJO A;  3MIH A;  4KGG A;  5J1X A;  3CHX A;  4WM8 C;  1W6N A;  4BPZ A;  1NZI A;  3G7D A;  3LPG A;  5T5J A;  4Q0Q A;  3RFR A;  1B09 A;  1JMU B;  4UWD A;  4AED B;  4OYU A;  5B4N A;  2KR2 A;  4AEM A;  1OBN A;  4DUW A;  1UN1 A;  1NY7 1;  3MF9 A;  4XMA A;  3ZXF A;  4K40 A;  5CFD C;  1HXS 3;  2XG3 A;  4PIX A;  4DB5 A;  2ZJC A;  4AK3 A;  4YFZ A;  2Z69 A;  4S2H A;  4F83 A;  1H1M A;  2XHK A;  3GHM A;  4JC1 A;  1O4Y A;  4OI4 A;  4IEZ A;  5FZ4 A;  1R08 3;  3UGH A;  4QX3 A;  4MHU A;  2VY0 A;  1ZZ6 A;  5D8A B;  5HV0 A;  2Q0A A;  1N3P A;  1AVB A;  4M0H A;  4RGK A;  1DQ2 A;  2JD9 A;  3X29 B;  5BNQ A;  2WQ4 A;  1IPJ A;  1F4A A;  1UYP A;  5FZD A;  1RHI 3;  3RZZ A;  3ORJ A;  1WW7 A;  2B45 X;  4ISR A;  4DS0 A;  4NID A;  3PUI A;  3PMS A;  4JDO A;  1UCX A;  1QJE A;  3HT1 A;  4DXZ A;  2ORX A;  1W0P A;  1IS3 A;  2E63 A;  2CDO A;  1RUH 3;  3ZYR A;  1JHN A;  2VGD A;  3CJI B;  4XTM A;  2X5I B;  2W1S A;  3AZY A;  3LQC A;  4MXV A;  4CUB A;  3JD7 3;  2VAU A;  4WM8 A;  5C3R A;  4XUO A;  5J3U A;  2E9Q A;  1QXR A;  4FOW A;  4I0W B;  3DPR A;  1PM7 A;  3K51 A;  1ZBA 1;  1UY1 A;  3IMN A;  1ZBA 2;  4HVR A;  5FPU A;  1ND2 B;  1LHO A;  4HAN A;  4LKE A;  1OF3 A;  3FWE A;  2LW8 A;  5FAX A;  5CFD A;  4UF0 B;  1X36 A;  1S0F A;  2CWM A;  4Z2A A;  2LRP A;  2NN8 A;  4XFC A;  4MG2 A;  4AL9 A;  2VMC A;  5F7U A;  1UYX A;  4IV3 A;  1OF4 A;  3ILF A;  2PLV 3;  5I0U A;  3H1M A;  4PF1 A;  2VMI A;  2JE8 A;  3I2J A;  2HWF 1;  4ZU4 A;  5FTT C;  3RS6 A;  3K2O A;  5FLI A;  1YIF A;  2YDE A;  3K48 A;  2DVF A;  2BFU L;  3POF A;  2WO7 A;  1BYH A;  2QZ3 A;  3C3V A;  4IE4 A;  2EA7 A;  3WP6 A;  1AL0 G;  2D6M A;  2JKX A;  4LQR A;  2JIG A;  3KM5 A;  2VOV A;  2CGP A;  4UAP A;  4BZ4 A;  5A80 A;  3THC A;  4NRM A;  1J3Q A;  1UXX X;  1AR8 1;  5FYM A;  3WNM A;  4OQ8 A;  2XWB B;  1AR7 2;  5JDB A;  1WWY A;  2B42 B;  3BKZ A;  4RFT 0;  1CQ9 A;  2RS3 2;  1F5J A;  4URA A;  2X09 A;  2JKB A;  4IV1 C;  2KXL A;  3D0S A;  4ZS3 A;  4FTE A;  1ENS A;  2ADD A;  2YBS A;  4QGL A;  5DMY A;  4NPM A;  3T1L A;  3VDD C;  1CPN A;  1RUJ 1;  3M8L A;  3OY8 B;  5A1L A;  4KWJ A;  3O0V A;  3BU7 A;  1FI2 A;  1BLZ A;  4D0Q A;  1F4H A;  1R1Z A;  5T5L A;  4CCM A;  5FZI A;  3QCW A;  4QKN A;  1PGL 1;  3THT A;  2LS6 A;  4QKB A;  1UIJ A;  4HKO A;  1NCR B;  2D5F A;  2Y33 A;  1VBA 1;  3MI8 A;  4HMZ A;  5F32 A;  5F6K A;  3VKM A;  5E1R A;  1LHU A;  3SEP A;  5DZF A;  4XZP A;  3K3N A;  3A0K A;  3MIF A;  4B4P A;  3ZYJ B;  1YHF A;  2VTF A;  1WCD J;  5FPX A;  2YRO A;  2MEV 3;  1HKD A;  2W39 A;  2AUY A;  1UPS A;  3H3L A;  1JBC A;  1FMD 1;  1UKR A;  3THD A;  2XJV A;  4XF0 A;  1VRB A;  2JEN A;  1KJL A;  1UO9 A;  2GMM A;  2QKD A;  4D7Y A;  1VBC 1;  4MGK E;  1CIW A;  1VBC 2;  1A34 A;  4DOU A;  3O14 A;  2X53 S;  2BPA 2;  1YXW A;  2QTW B;  1BJQ A;  3KCX A;  2W46 A;  1H2K A;  2HJI A;  1OQD A;  3VLB B;  4QPI B;  2IZW A;  2QQJ A;  5FIX A;  1SFY A;  3JZV A;  1UY2 A;  2QBX A;  1WCK A;  4OHX A;  2DUP A;  1YLL A;  2WSV A;  2QQM A;  4LBL A;  4XTP A;  3TAY A;  4DIQ A;  3H8O A;  3HT2 A;  5A7P A;  1R1A 3;  3VBO A;  3D6E A;  4YZ1 A;  3I3D A;  2XLA A;  2A6V A;  1Z7S 3;  2IXJ A;  5FZF A;  1UAI A;  3GM8 A;  2FZ1 A;  2A7A A;  2RS5 1;  4FCA A;  1VPH A;  2ILM A;  1NCQ C;  2ZGT A;  3LFM A;  3U14 A;  5K0U C;  2WYF A;  1ZBE 2;  2A71 A;  5T52 A;  1UQX A;  1A78 A;  2K9Z A;  5FZ1 A;  4TYS A;  3BPZ A;  5L9V A;  1W2T A;  2CAU A;  3CU7 A;  1QWR A;  3IDB B;  4R52 A;  5E16 A;  4NII A;  1XQN A;  5CYY A;  4CCO A;  3B02 A;  4YG3 A;  2ZKN A;  1QJX 2;  3CNA A;  4BQ2 A;  5FLJ A;  2J1V A;  5EQU A;  4AQ6 A;  1W2A X;  1KGY A;  1SPP B;  1GQG A;  3SKV A;  3NJV A;  4DZG A;  2WNU A;  3KMH A;  2VUC A;  3BGA A;  3ZXK A;  4ISQ A;  1QOO A;  5G05 L;  2G1M A; 
#chains in the Genus database with same CATH homology
 1GWM A;  5D21 A;  1WZX A;  3F95 A;  4LKE A;  2Q1F A;  2C24 A;  2VXJ A;  1OH3 A;  3UT0 A;  4BQ5 A;  4CPB A;  4LKF A;  1W8T A;  1OKO A;  1GWK A;  2LRP A;  4BQ4 A;  2LRO A;  1W8W A;  1W9F A;  4LK6 A;  4YW7 A;  1HN0 A;  4A6S A;  4AL9 A;  2JWP A;  2WYF A;  4LKD A;  4CP9 A;  3ORJ A;  3ZYB A;  1WCU A;  4CP9 B;  1V0A A;  1W8Z A;  4LK7 A;  1UOJ A;  1W8U A;  4LJH A;  4BQ2 A;  3ZYH A;  2O14 A;  1L7L A;  1GWL A;  4YW6 A;  1WMX A;  2KR2 A;  4BQ3 A;  1W90 A;  2K46 A;  4YWA A;  3ZYF A;  4CPB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...