4YW6A

Structural insight into divalent galactoside binding to pseudomonas aeruginosa lectin leca
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I galactophilic lectin
publication title Structural Insight into Multivalent Galactoside Binding to Pseudomonas aeruginosa Lectin LecA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 23
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4yw6A00
1V0AA 1WZXA 4YW6A 4YW7A 4LK6A 4BQ4A 2K46A 1W90A 1W8UA 1OH3A 4LK7A 4CP9A 1W9FA 4CPBD 5D21A 3ZYBA 4A6SA 1GWLA 1W8WA 2C24A 1GWKA 2O14A 3ORJA 2LROA 2WYFA 4LKDA 1HN0A 1WMXA 3ZYHA 4BQ3A 1W8ZA 1L7LA 2LRPA 4BQ2A 2VXJA 4CP9B 2KR2A 4LKFA 4LJHA 2JWPA 3UT0A 1W8TA 2Q1FA 1GWMA 3F95A 1OKOA 4YWAA 4BQ5A 1WCUA 4LKEA 4CPBA 3ZYFA 4AL9A 1UOJA
chains in the Genus database with same CATH superfamily
1S0EA 3AZZA 3NNLA 4O65A 3CEWA 1LGNA 4AAPA 1OPMA 5AFBA 4PCRA 2GH2A 5K0UA 3HEIA 1EPZA 3AX4A 2Y6FA 1D0GA 2PN5A 5T5OA 2J7MA 4FTSA 4F8AA 3ZSKA 3N35A 4IV1A 2KA3A 4NUBA 1OOPA 1UY3A 3TWIA 5L7OC 4IGOA 2C9KA 5A1LA 3VHOA 5CFDA 1GZTA 3PU3A 3SHRA 4NIGA 2OKXA 2XOMA 4LBQB 2NMNA 3RZLA 4XUPA 3ZOIA 3C7GA 3LA7A 1RUC2 1KFXL 1J83A 3LE0A 2I45A 2I74A 3NKTA 5CKQA 4J1XA 5KHKA 2VZPA 2WAOA 3JB4C 3KSCA 3NQHA 3P6BA 5B4XA 4HOOA 4CCLA 3DV8A 2VZRA 4WBBA 2Y38A 2K2SA 3KV6A 2CV6A 3DECA 1F4HA 4IE6A 1JZ6A 4HKWA 3K3NA 2LROA 3ZYJB 3VBUC 2PMWB 4KWUA 1K12A 3K4DA 2HYKA 3VKLA 3B9IA 1XRUA 3G6JB 3NO8A 4NIAA 2R042 1PGL2 3MBWA 5A6XA 2XVKA 2PA7A 2WNVA 4XXPA 4ZY9A 3UK9A 2RS31 3OB8A 3USUA 5C8CB 4HVQA 1CD3G 1WKYA 2HYXA 3WUDA 4JHTA 4CCNA 3VDBA 2R062 1RUH1 2MEV1 2P3JA 3AP9A 1Q43A 1H2NA 4JKMA 4XUOA 3WEZA 3AXEA 4S2FA 5FYVA 4PDWC 1JUHA 5LRRA 3U10A 1T6BX 4TYSA 4QMAA 5T52A 5C3PA 3DGTA 2R0HA 1XNCA 3N3HA 4GMP1 4MZUA 4IGQA 3LQCA 4XQWA 3RYKA 1Q8VA 4IEZA 1FX5A 4Y1XA 4DPNA 4CP1A 4GULA 1C4RA 1ND3B 5C3SA 3AKQA 1AL21 2OVUA 2FDFA 5B2GB 4R8HA 3TNQA 1DGWA 2CDPA 5LA0A 3A23A 5JPMB 2WBKA 2ZX3A 1XE0A 3NJYA 2VUCA 2YXSA 1WW4A 2QQMA 5FOJB 5D2AA 2PLV3 5DAQA 3RPQA 1UYPA 1OSGA 1TME3 1W0NA 2X05A 2P1BA 4L8QA 4RS5B 3PU8A 5I0UA 4BPZA 5BNPB 2GMEA 2CAUA 4Q4Y3 2V5DA 5KXBA 4Q2FA 1S4CA 2JIJA 1H8TA 1OFNA 2VMGA 3M3IA 1POQA 2VJXA 4I02A 3KWVA 3POWA 4WM7B 1C8M1 1N3OA 1H0BA 1QQP1 4Y24A 4CDQC 1PK6C 1RVF1 1AX1A 5A7QA 4JTOA 1UY1A 2J1EA 1R093 2DV9A 2RR11 1KFUL 1GP4A 1PMHX 5GLZA 4ATEA 3WG1A 1DYOA 1RUJ3 2P4EA 2IVJA 2WQZC 4Z8BA 5GM0A 1BBT2 3GBGA 3AYAA 3OPTA 3V65A 1O91A 1FATA 5FR3A 1J58A 4YW5A 4C0HA 5IVJA 4LBOA 4LITA 4HK8A 1AXYA 3EXUA 4ASKA 3Q8EA 1HDKA 3POGA 4XW3A 4Z07A 3RNSA 5C5UA 5F9TA 2W46A 4I30A 3ZLIA 1LOEA 2ZS6B 3ZX7A 3T2PA 1TMF1 4N43B 5KXCA 4JGZA 4XJ9A 2QDRA 3GM8A 1S0CA 3L2YA 3VZKA 3NJXA 1YQ5A 2WO7A 3BU7A 2GC1A 3FHQA 5EJ3A 2FHRA 4Q4V3 5LWBA 2PHTA 3AB0A 5KHGA 5FY7A 4LT5A 1W6OA 2E7TA 4Z92B 1JUIA 3THDA 2FD8A 2ZGUA 3QLQA 3J9SA 1SLIA 4FPGA 2QQIA 1XBFA 4AR2A 5D1IA 4IERA 4TN7A 1XNKA 5FKCA 3I2GA 4HZFA 1WZXA 4Q4X1 3ZKUA 1BCXA 2FZ1A 2EXJA 5SV8A 2JE9A 1LHUA 3ZFFA 1HRV2 2YMZA 5FZ8A 2D6MA 1SFNA 2WNUC 1LCLA 4XXAA 2OT7A 2YYOA 2OW4A 3VDCA 1FT9A 2FCVA 3O1TA 1NCQB 1LENA 1QMJA 3VD4A 2VMCA 3R6SA 5LBEA 4XDQA 5K0UB 1IS5A 2B45X 1RUF3 3BKZA 3NRUA 2WA3A 2TUNA 4AEMA 5FPZA 3BVCA 2RJLA 2VOKA 1OMIA 4IV1B 4AEDA 1OOPB 5IW0A 4PIZA 4CUGA 2PHLA 4AI0A 4MHRA 4XJAA 5CA6A 4NMIA 4CCMA 5J1XA 5CFDB 2VZUA 1X50A 5FP4A 3U0ZA 3IKWA 2HWE1 4QD2A 5JXHA 4M3CE 2UWBA 1GU3A 3WDVA 4NWVA 3THCA 4BQ1A 3IDCB 4NIIA 1OD5A 2YU2A 3OUHA 5FZMA 1W9FA 3ZPYA 2XLGA 3N4MA 3L2HA 5FIXA 3OGVA 3I7DA 1HRI3 4Y26A 2E9QA 1BXHA 2EIBA 5FYHA 2MNGA 1CN1A 5FZ3A 4BU2A 4OZOA 4YVWA 5L19A 3B93A 1CVNA 4E4HA 3LAGA 4I3PA 3CQOA 1QJFA 1RUG1 4AHXA 1WCUA 2BOJA 2JE7A 4V2VA 2WNVB 2XHKA 3USUB 3T08A 2W2IA 1XSQA 3H3LA 4GAZA 4RFRB 3BPZA 2Z2SB 4H55A 1B35C 1LODA 1HB4A 3MFAA 5L9BA 2YBPA 1SBFA 3WXPA 2QNKA 4PLMA 4BDVB 1LNSA 1AR83 5AC92 1ULPA 5HV4A 1F8VA 2E7QA 1DIWA 4NJ4A 1V6NA 1R1ZA 2JDZA 3VV1A 3EQEA 4EN7B 5E6HA 1HLCA 1SFYA 2Q30A 2DU0A 5F3IA 2JB8A 4BHPA 1OF4A 2DURA 2V73A 3TEZA 4WZFA 1YLLA 2VQTA 5HCHA 4Q0VA 4OUEA 4D0QA 1AR73 5JIUA 4CDQA 3AYDA 5E8AA 1HXS2 3ZYFA 1UKGA 3SISA 4MGYE 1QNYA 2ILMA 4PLNA 5LZ6A 5LASA 2EXIA 2FZ2A 4RGAA 1UOGA 4ZU4A 3AYEA 4EN8B 1QXRA 2GNMA 2F17A 5GJ6A 3MFCA 3UJOA 3MPBA 4XJUA 3DN7A 3N7JA 3C7HA 4GB33 1ZRDA 4SLIA 4META 3SKVA 5DDJ2 1VRBA 2MHFA 1XNDA 1FV2A 5JAXA 1E57A 4QQ2A 3J4UH 1H8TB 1QXJA 1JZ4A 2B7YA 2ZGSA 4XBQA 3QH7A 2WS93 5CADA 4AFCA 3NJZA 1XYPA 3FLTA 4R4ZA 3N7KA 1F5FA 1UY4A 4RYDA 3A4UA 5JSOA 1VAVA 1ZZ9A 3LCPA 1Z7S3 3ZYRA 2QZ2A 1PX3A 3OJBA 4Z82A 2VW2A 1G9AA 5A1AA 2HWB3 3IBMA 3O0VA 4OUMA 5LA1A 3HJRA 4NWWA 5BY5A 1R64A 5DUXA 3S30A 4XQ4A 2JG8A 3VZOA 2V09A 1WMEA 5JCTA 5FY5A 2ZHLA 4JRAA 2NLRA 1RUE2 5I0RA 1PO11 1O5UA 1QGLA 4JGZB 1NXD1 3U78A 2PTMA 4P9WA 4YGCA 2W47A 3KF5A 3ECQA 4N7IA 3SMHA 1CGPA 3WD5A 1GYKA 2BVVA 5BNNC 2QKDA 2OZJA 5FZ1A 1BK0A 1YQ2A 3SH4A 4C8DA 1KQRA 3T0DA 3ZSJA 1NZCA 4KGGA 3HVDA 2GC2A 1TNFA 2SBAA 4RHV2 4BE3A 1W6OB 3JBG1 1OC1A 3Q9OA 1OUSA 4MX3A 4AE2A 1VBB3 4G3YC 2HWD3 1UXZA 2UWCA 4DY5A 1ODMA 4CUCA 1RUD3 2X5IA 1HQWA 2C26A 3EO6A 5FREA 5IJRA 4IESA 2XMLA 1NQJA 3ZFFB 2D7FA 3D8CA 2R073 3C3VA 3VKOA 1JU4A 3R4DB 4TLGA 1LOGA 1IS3A 1ND2B 1WCQA 2IXJA 3ACGA 4L0PA 4ARYA 3NNFA 5FCCA 5DG2A 5JOXA 4A3ZA 1SCSA 1GICA 3H8OA 1GBGA 3GF6A 1SLBA 4FQ4A 3K3OA 3PVNA 3OTFA 1VAMA 2CGPA 1MZ6A 4XIKA 2JD9A 5FMOL 3ZN4A 2ERFA 2YFUA 4LLOA 4Q0QA 5FYYA 3ZM8A 1U5ZA 2HJIA 4AEDB 4N53A 3B5LB 5A3UA 1W8UA 3HBKA 4BXFA 2J22A 1SFPA 4CP9A 1URXA 3ST7A 2A6ZA 2UWAA 2IFWA 3LA2A 4QDQA 5A1FA 5FFOC 4XQDA 2Q8EA 2LRPA 1IS6A 1PO23 3TAYA 2ZAHA 2ZHNA 4JQTA 1UQXA 3NL1A 1S0FA 4FPOB 3IIAA 1L3JA 2LUWA 1KXGA 4XFAA 1FPN2 1MS0A 2VGDA 4LKSA 1GOGA 4DO0A 4DFSA 2BNOA 3KT1A 3O1SA 4PF1A 4YVWB 2QQKA 5CG9A 1PMIA 2RMU2 5K4LA 1QDOA 2B4KA 1W2UA 3VKNA 1QJX2 2XBO1 2VW1A 2VE1A 4J25A 3F2ZA 1JHNA 4QB1A 1LEMA 1CAXA 5FUPA 4EN6B 4HT1T 1AR93 1XPWA 4K20A 4ZU7A 4RGKA 4P5YA 3WNKA 4WVMA 3RZGA 1YRZA 2VXJA 3IMNA 1PZ8A 1GZWA 4FT8A 4COYA 1DLCA 1GR3A 1HIXA 4LBKA 1RMU3 3ELNA 2W91A 1G9BA 3LEIA 1QH6A 3ZN5A 4ISQA 3GJAA 4XFHA 4ZS3A 2IXKA 4BMEA 4HMZA 5C8CC 2CNAA 5EV7A 1V6LA 2WZR1 3LSDA 2DVBA 2RV9A 1IPSA 1WW6A 1F5JA 4JV4A 1E5RA 4DS0A 4ZXKA 3W9AA 1HJFA 1CONA 2RHPA 5FZAA 4LBJA 1VBD2 2ZGNA 2YGLA 3MW3A 4YZ2A 3KCXA 2RS52 2ZGMA 3MLJA 1H4GA 3RS6A 2YV8A 5JMCA 4BM8A 1ZREA 1O3TA 3SCHA 4BA6A 2FDKA 3ZYIB 3LWCA 1BQPA 4MGKE 2SLIA 2ARCA 4Y5TA 1SQ4A 1ND3C 3MW2A 3FX3A 3I97A 3BPSA 1Y3TA 4XCAA 5DXDA 1NA1A 1OH4A 1RINA 4BMBA 1QJU1 3HAGA 2CGOA 3SH5A 4M3CA 5BNPC 1FOD3 4RS5C 4FPLA 4AGGA 2JECA 1CAVA 4QKNA 3GZEA 4S2GA 2FDIA 4LIVA 1LULA 4JHZA 1XU1A 4XTPA 5FPBA 5D21A 2D6LX 4O9EA 4WZCA 4NVPA 1QY4A 4WM7C 1EUUA 3B69A 1X8EA 3CJIC 5DABA 5IHRA 1OQDA 5LBCA 4AI9A 5GLTA 2RDRA 1REFA 2Y6LA 1PGW2 2ZGKA 4KQ7A 2VC9A 4LJHA 2ZTNA 1D7PM 2JJ6A 2JG8B 1BEV1 2PHXA 4M00A 2AEYA 3KM5A 2QTWB 3CF6E 1LOAA 1TQ5A 4B29A 3SKJE 2E53A 1CR7A 4K8RB 2QBXA 4KBZA 3QD6A 1WBFA 1VBC1 3DF0A 4OMDA 4XBNA 1XNAA 4YG0A 2L9LA 2WFF1 1OLQA 1UZ0A 2VW0A 5A32A 1AYN3 2DYCA 3QBQA 5IFPA 2PHWA 1CWPA 3O1VA 1ZBA2 4K9SA 3BIWE 1NLSA 1YUDA 5A3LA 4ES8A 2K0GA 2ET7A 3Q8CA 4NO4A 3DYMA 3H3ZA 4N43C 4XAAA 3NWKA 4PBPA 3RI9A 1CX4A 3OEBA 5FBZA 2VU9A 2J1TA 1YWKA 1AYM1 3I2JA 2UY9A 3JD72 1NOVA 3LIHA 1YEWA 4IEWA 5IVCA 2X5IB 4Y5Z0 2D5HA 5LA9A 4C1WA 4CRQA 1RUOA 2HWD1 4COWA 2CDOA 4QQLA 2RM21 5T50A 3MHZA 4IEPA 4WVVA 4XUQA 5T5PA 3TBDA 5C8WA 3T09A 5A33A 4N90A 3TEWA 2Y0IA 3BCWA 4KG8A 5FLJA 4QPGA 4YW6A 4A7KA 2VTXA 5FLHA 2WABA 4X6QB 2V72A 5HCAA 3N36A 2ZACA 3LDKA 1ZX5A 4I2OA 3KGZA 4BYYA 1L7RA 1GFF2 1SMVA 2VTXJ 3AXDA 2P6HA 4HLTA 2JDMA 1UKRA 4N53B 1NCQC 1C5HA 2WDBA 3N9MA 1SHWB 5JXGA 1ULOA 3LDBA 4MSVA 4CP9B 4B4QA 1NLQA 2BOIA 4AQ2A 2WJSA 5FZOA 1TNRA 3WF1A 5K0UC 3EJKA 4GJYA 4E4ZA 2RS12 5JPNB 1V9U2 3ZXEA 5AVPA 1UZWA 2R1BA 3CBNA 3FUOA 3BN6A 1Q3EA 3FN9A 4IV1C 1G86A 3OD0A 1OOPC 1WLDA 4YW3A 3WINE 3HT1A 5FQ0A 2XONA 5HCFA 3WF2A 3ZKYA 3OOXA 3H7YA 5CFDC 1EAH2 2RS33 1PO21 3H3UA 1BMV1 5A7WA 1IQAA 2ZEWA 5C5TA 1VB2A 2Z5WA 2JXAA 5FK7A 1RUH3 2MEV3 4OULA 1W04A 2BU9A 3SCFA 3SEEA 2XR4A 4IEXA 5FYZA 4CEYA 3WF0A 5LEKA 4P9LA 1TG7A 3ZMOA 1L7LA 1NCRA 1CAXB 1YC61 1U0AA 1ZZ7A 1QH7A 2A3YA 2R7EB 4QGNA 4GMP3 3D0SA 2DUPA 5A3PA 2D97A 2WKKA 4WVMB 1JYTA 1GQGA 2XWJB 1DZTA 4CPBA 1GZWB 2FDHA 1AL23 4QHBA 1OXCA 1ZM1A 2BUKA 3C7FA 3J7HA 1KRIA 2EA7A 3AP5A 3K4ZA 4LK6A 1VE0A 2WNVC 1LU2A 3U4SA 1O8PA 4PIYA 3VBFA 2OPWA 1US3A 2ZEXA 4LPLA 5EZWA 4K40A 3ZIXA 2JG9A 2H0BA 5ACA2 5JXIA 2C5DA 3IMMA 1NKGA 5FK8A 1W05A 1XNTA 4ZHNA 4QX0A 3ZSMA 4FTBA 3E97A 4XC9A 2GAUA 2P34A 1EV11 2WWSA 3O0WA 1UL9A 2WN3A 4O9GA 5KC5A 2P3KA 4OQ9A 1WW7A 3GHMA 4DEQA 3M70A 1RVF3 2GMPA 3N7LA 1HW5A 4YYOA 4AQTA 5JOYA 1XSRA 1HQNA 2RR13 3G7DA 1NZIA 3ACIA 3CJIA 1H2MA 2QQWA 2R32A 2WT1A 4CDXA 4OCTA 3K51A 2TEPA 4NPRA 2W1QA 4BQ4A 1HB1A 1NA1B 4GWNA 4JCKA 3JB8A 4R52A 4M3CB 2B46X 4PQQA 4W4ZA 1PVC1 1RB8G 5DZFA 4D3WA 3R0RA 4YGEA 5KR7A 1CAVB 2BBVA 5FLIA 1NY71 1WW5A 4NHKA 5FYCA 3I54A 4XFFA 3HOBA 2JWPA 4E8DA 1MS1A 3N7MA 5FZ6A 1TMF3 1H8TC 1YQ6A 2PAKA 2AENA 2OUHA 4QPWA 1SPPA 1OFSA 3H1YA 3LGRA 1W2OA 1J3PA 2RDSA 3SNMA 3FMGA 4JDMA 4HN1A 2A1XA 1D4M2 2XG3A 4LMFA 1NYWA 5KHHA 5JUVA 3NV4A 1PM4A 1ENRA 2BW8A 3ZXKA 4A6OA 4D7TA 5KHJA 3AMQA 2VAUA 5JR2A 1LHVA 4AVTA 5IFTA 3KT4A 1J1LA 1ASJ1 2WZ8A 3TEYA 2ET1A 2VOTA 1N1TA 4Q4X3 5A32B 3WX5A 4EZHA 2W5FA 1H1IA 2ZEZA 1VBE2 4HANA 4DXSA 5M0TA 5BPXA 2X10A 1Y9MA 2ZZQA 4YRDA 1KGYA 3AP6A 3TN92 1DQ0A 3ATGA 3M7AA 1GNHA 3VBSA 4JGZC 5I0SA 3RI8A 4LHNA 2P2KA 1UY0A 4LNVA 4AEJA 2IWGB 3WW3A 2X09A 5DMYA 3LOBA 2QDNA 2OUJA 4JVAA 5FXWA 5HV0A 4IE5A 3WG3A 3NMBA 3W5MA 4IL7A 1KDKA 4CXXA 3ASIA 1CJDA 4XDOA 3WVJA 3NW4A 2VNOA 2WIIB 2XJSA 1QJY2 3HNBM 3KT7A 5DAVA 5DZEA 1ZRRA 1ZNPA 2BDRA 2Y26A 5FOBB 1JBCA 1H9WA 2JIGA 4AAXA 1WLWA 3ZXGA 5A33B 1VRH1 3BB6A 3CLPA 1SLAA 4XHBA 4OVEA 4QPGB 4NE9A 3K48A 2QQPA 3WNXA 3KCYA 3ZR6A 2Y6KA 1COV2 2HWE3 4QGMA 4AWDA 4ZZ5A 3ZO0B 2D44A 1OPOA 1MEC1 2BP6A 5C6CA 2Y60A 3JXSA 3ZFFC 3OY8A 1SLLA 4OI1A 1E5SA 4JDNA 3LOIA 3KHBA 5J3UA 1ND2C 2W1SA 1W9TA 3WLUA 3TOJA 5F3EA 1JZ7A 2ATFA 2J1AA 1WCSA 5FZOB 3RWNA 3VD5A 4KL1A 3U1XA 2HWF2 4LA3A 5SV5A 5I93A 1WCKA 5LEJA 3M3EA 3DKQA 2XH6A 1RUG3 3HMYA 2WYSA 4KNCA 3H0OA 4AEDC 1RIRA 1AR62 5FQ0B 4XMIA 1AL0G 2VZOA 2DUQA 1SZBA 3LFIA 3MV11 2PHDA 3QACA 1UPIA 1UZYA 4PF5A 2FCTA 3LDRA 5A7WB 3MDPA 3MW4A 1UAIA 3VDDB 3UNPA 1DBNA 1Q5OA 2DCYA 2NM1A 4LOTA 1UMZA 2VO5A 1QXPA 3BALA 1GWMA 3AC0A 4GKYA 1R081 4CEYB 1DQ6A 2HWC1 2VOWA 4BQ5A 2XXZA 1NCRB 5FZIA 1H1MA 1H2LA 2E33A 3PUAA 2GDFA 2OX0A 2WA4A 5IAXA 4QPIA 4YVWC 1Q8OA 2HEWF 2VQAA 3DXUA 1OF3A 1XU2A 2R6QA 4R9BA 4OHWA 5JSPA 4D7YA 3RWKX 1PIV2 2IXHA 2V4AA 4GKXA 1H9PA 3GGLA 4LA2A 4N9HA 3VZMA 1ZBE1 2ZX0A 2VMIA 2O14A 4P00B 5IUQA 4QU2A 1B09A 3T2TA 5C71A 4DQAA 3HN1A 3WR0A 3FZ3A 4LR4A 2CGNA 4Q5OA 2BEOA 3HR9A 5C70A 3EBRA 1LJ7A 2Y0OA 3VBFB 4FBFA 4ES9A 4F3JA 3KVAA 3K77A 1JYXA 3THPA 2JX9A 3I2IA 1FMD1 2JG9B 4AFBA 2QQNA 4F83A 2A6WA 3AMPA 4FPHA 1YJKA 2ENRA 5HCBA 1W2NA 5F37A 2GP3A 2VG9A 2D6OX 2V4VA 3W5NA 4AVBA 3PUQA 4YM1A 4Y33A 5FZEA 4E2QA 4UI9L 1DF0A 3UKNA 1S0JA 5EPAA 1W6MA 1R1A1 3ILFA 3LIGA 1DLLA 4GA9A 4NIHA 5DZGA 2I2SA 2YC2A 1DCSA 3D82A 3CJIB 4CE8A 4CDXB 2JD4A 4UW5A 2XL7A 1LB2A 5BNOA 2W94A 4JAAA 3A0KA 3OBRA 3WNOA 1W06A 1C57A 2QJVA 2W3JA 3R05A 4GMP0 2TNFA 4TXWA 5JXJA 4KBBA 2Q0AA 2VVDA 2D6KA 2WL1A 5FXZA 1YFXA 5A6YA 3VBHA 5EIYB 4YZ3A 4P9XA 2TBVA 3T0BA 4HSJA 1HV1A 4Y20A 1J1TA 1PO13 2D93A 5F3GA 1SPPB 3PHMA 4LORA 4OHZA 2DCKA 4BCUA 1IG3A 2PLV2 5A80A 4BQXA 1SG3A 4P02B 3FWEA 4EQVA 1TME2 2OIIA 1IOAA 2EIGA 2ZHMA 1SBEA 4M0HA 1MS5A 2A75A 5GKAC 1UU6A 1N3QA 1Y43B 4Q4Y2 2PAMA 3M2MA 1XNBA 4QHZA 4QAWA 2Y6GA 3JU9A 3AKSA 3CJXA 5K9YA 2QQUA 4E2SA 3JBG3 4UW3A 5F39A 1RHI1 2WQ8A 4WVZA 4D69A 1O3QA 5FUIA 4YGDA 1W2AX 2R30A 4EN9B 1Z78A 3IWZA 2VBPA 3RJRA 5EQUA 3VZNA 2ZMKA 3UL2A 1OQEA 5FYTA 1DFQA 1AX0A 1QF3A 1EUTA 1R092 2JG8C 3AZXA 1XJAA 3KLSA 2Q5TA 5F3CA 1RUJ2 1EY2A 4XABA 3V0BA 3VBSB 2VMFA 5E88A 5AVAA 3I2OA 2WUHA 4CCKA 4P9YA 1WA6X 4XETA 2A71A 2BGCA 2ZX1A 3URFA 1QWRA 3FFQA 2NZ9A 2OYZA 1ND2A 3NNMA 1O6UA 3HN3A 2WC2A 1TZOA 2XL9A 2YG0A 3CHXA 3WQBA 2E51A 2VZTA 2BJSA 1VJ2A 2BGOA 3S5QA 2RE9A 1BJQA 1YCIA 3LF7A 3PVBB 1UX7A 2D6PA 3KVBA 2YGMA 4A41A 3PUSA 3E5QA 4B8EA 4LBQD 1A8MA 2F6BA 5GZDA 2X5IC 4PIXA 3U07A 3DYPA 3QOPA 3H7JA 3OY8B 4Y1YA 1RUC1 1T6GC 4Q4V2 1X33A 4ZZ8A 4A44A 4DINB 4YW7A 2Z42A 5A3NA 3O1UA 2J1RA 3KGLA 3J8F2 5IVVA 4FPKA 4HBNA 3ZXLA 1CZVA 1XXNA 5LY2A 4B4PA 3SITA 1YNAA 4MGSA 4ZU5A 2ZPXA 3RMXA 3OCPA 5BXXA 3JQXA 3LEKA 1VMFA 2XBO3 3BOWA 5FMOS 4Q8KA 5FZ9A 4A4AA 4N53C 3PURA 3B01A 1M4WA 4HVRA 2R041 3SXWA 1PGL1 3KHCA 1VBA2 1UYXA 1UXXX 2HBUA 1BVP1 3OG2A 2R061 1RUF2 5F32A 3V64A 1PMJX 3B7MA 4L9BA 2BQPA 3UGGA 3ZYGA 4CCDA 1GNZA 1F9KA 1LGCA 2UYBA 2O0OA 5T55A 4YG6A 5EP9A 4UBGA 2XHNA 5LW9A 4QPIB 4PQ9A 4YNIA 4NIDA 3PDQA 1V00A 1DGWX 5FTTC 2WZR3 1UY2A 4BQYA 1WMXA 2ADEA 1LGBA 3POYA 2DCZA 5FXXA 2ZXQA 4C1XA 2ARAA 3I3DA 5I8YA 2CU5A 3OYWA 3ABZA 3H1MA 1UX6A 3PMEA 4COUA 2CAVA 4GZ9A 1D4VB 2YHJA 1RYYA 1HRI2 1W8NA 2D6NA 5DG1A 3PJYA 2VUDA 1NUKA 4YZ1A 1C3HA 1S55A 3VBRA 2Z69A 2KD7A 4MXWA 3FC0A 1W0OA 3FHAA 3RG0A 4Y5SA 1I5ZA 1GOFA 1HX6A 2VMDA 1BLZA 3EYPA 4FQZA 3WF3A 3ZIWA 3DXTA 5FBJA 1UZVA 2QQOA 4A6SA 4M3CF 1QJU3 4EROA 3A0NA 2C0ZA 3FJSA 3UGFA 1YI7A 1MVQA 1W6MB 2DWRA 2XVLA 5JIAA 1GUIA 1OI6A 4NR1A 3CZUA 2PQQA 4MXVA 1JI6A 3NNJA 4DIQA 2ZBJA 1AR82 4EWEA 4UOJA 5FP7A 5BNOB 3NJVA 2AH2A 1BBT1 3POBA 4CCOA 5EXOA 5IT6A 1UZZA 4LHLA 4PI0A 2VVFA 1TEIA 1H1AA 1KJLA 1LHNA 2OQ6A 2A5ZA 1EP0A 4CDWA 5C4WA 4LO6B 1BEV3 2J1UA 2W0XA 3VZLA 3VBHB 4LO4B 5GLWA 1AR72 3SLIA 4YLZA 4CUBA 1NA1C 4UXAA 4P9JA 1V6IA 4Y20B 3W59A 2VH9A 5JZGA 1VBC3 3HBZA 5CIRA 4E2GA 2PHUA 1NXMA 4XZPA 2WFF3 4GB32 3CZJA 4IEYA 3TEXA 4RHV3 2ZGOA 3WDTA 5DUVA 1ONAA 1JYIA 4FFGA 4XMAA 1MR5A 1C28A 5KXDA 4GQ7A 5JMOA 2ZEYA 5JI9A 2IXCA 1OQ1A 3Q8AA 4Y1ZA 3RMYA 5J48A 4K3UA 3U75A 1JZ3A 3VUOA 2H6BA 1AYM3 3JZVA 5CBLA 4XJWA 4GXLA 2WS92 5C3RA 1MQTC 3A22A 4Q27A 4BZ4A 3O1RA 1DDLA 4E8CA 1LRHA 4Q1PA 2EICA 2ZGLA 3OGJA 1DYKA 1HRV1 3ZFGA 2RM23 2ZAAA 3J7NA 3V0BB 1Z7S2 2CY6A 3PLQA 4QT6A 5FY0A 3VB9A 4KMQA 1AX2A 1YFWA 4AOCA 5IVBA 4BWOA 1G8WA 2HWB2 2VULA 1QKQA 4B4RA 4YM3A 4QM9A 1C5IA 4KWKA 1POV3 3HQXA 3K2OA 5FPVA 4IGPA 2WFPA 1OUXA 2XUEA 2W87A 5FYBA 2PFWA 1FNYA 2DF7A 2H6CA 1MS3A 4Q26A 4XDPA 2Z4FA 1WBLA 3GCXA 1RXFA 2EAAA 2XJRA 2WO1A 5F1RA 3B94A 5H9PA 3DEMA 4AHWA 5LY1A 4AGRA 1XE7A 4I01A 3ES4A 1FV3A 2X8KA 1FPN3 5LATA 3V56A 1SBDA 4GWJA 4X6RB 3LA3A 1ENSA 1O8SA 4LQRA 1GQPA 4QPGC 4XACA 5ANQA 4FO9A 1VBB2 1ZZBA 4H3WA 1SACA 4QQOA 4OI0A 1ULEA 1RUD2 4WM8A 2HBTA 4JRLA 3GDBA 1ENQA 4YG3A 4XAEA 4CVUA 1ULDA 3M3OA 2R072 5IVEA 3KCCA 2WZPP 1UOJA 1QHDA 2GZWA 2VPVA 3AL6A 5A6QA 5LK5A 1AHSA 1K5MA 2AC1A 5JLVA 5F7UA 1K45A 5FP9A 3FBYA 1O3SA 3JCIA 2JDPA 4HN0A 3P5BA 5GALA 4BISA 2BRTA 2VTFA 3KQRA 4FP3A 4GD4A 4IEVA 4XF1A 2A6XA 3C7OA 3UKVA 5I0TA 4CP2A 4FTEA 1RJ7A 3WP6A 5AC91 1DYPA 1DZQA 1REEA 4R4XA 3BU0A 5FP8A 4DZGA 5A7OA 4Y4RA 4QKDA 5FKBA 1S0BA 3AZVA 5D8AA 4UFHA 3VDDC 5KC6A 2DUOA 4YM2A 1LR5A 1VBD3 2B9VA 3FE5A 3HWJA 4KU7A 2CYFA 1LHWA 3CDZB 5C9AA 1FI2A 3AZYA 3OYWB 3O0XA 4RFT0 4CEYC 5JOZA 3BIEA 4XVHA 4BXSV 3JUUA 3POFA 2QFEA 1HXS1 1EV13 1NCRC 3M4FA 5CAZA 4DXZA 4CDUB 2P3YA 2DVGA 4LEJA 3VZJA 3AP7A 1SLCA 4OHVA 3VBRB 4W65A 1WMFA 4MXWB 1ULGA 3NAPB 1JOPA 3UETA 1QOTA 5DDJ1 2PAEA 4IE0A 4INDA 1OA4A 1S0GA 4DB5A 1XC6A 3ETPA 3POJA 1N3PA 3LEMA 5F2SA 4LTAA 5FWEA 3WNMA 4ITCA 4JGYA 3VBFC 3F95A 2VR4A 1AR92 2XVGA 4E27A 1QEXA 3B9CA 1PVC3 4BIFA 2JG9C 3LSEA 5FZFA 4CTEA 1PZ7A 1H8VA 4HFSA 1OLME 4CXWA 3PUHA 1UWWA 5FUNA 5FY4A 1W6QA 1JYWA 1PHMA 1F4AA 1JODA 1JTZX 3LKJA 1YIPA 4YFWA 3RYPA 3BTYA 2ZGQA 4MVTA 1C1LA 1AJOA 1YI9A 1OHFA 2G4IA 3I3EA 2W1WA 3T30A 4CDWB 2DBNA 2YPDA 5C4WB 1UNBA 2IZWA 3DYOA 5FRAA 1GQHA 3VKFC 1ACCA 5FZCA 1FXZA 2BGPA 4CDXC 1DGLA 2JDNA 4EZ4A 1GP6A 5JVVA 1QNWA 2EVXA 2ID4A 3DKWA 1MQTA 4M0NA 3T2QA 1RUE1 3M8LA 4AG4A 1BYHA 5A3WA 3AZWA 4ASLA 2IXLA 5JZGB 3M3QA 5KBFA 5JWPA 5EHDA 4NRQA 1V6OA 1ASJ3 4AXOA 3OPZA 2CWSA 2JDKA 1IGOA 4I3GA 5L73A 3AMHA 4QKFA 2Y33A 4AL9A 2DFCA 2Q1ZB 3I3MA 5TSWA 2VMHA 4DXTA 2ZX2A 2JDHA 3LB9A 3OGRA 4XF9A 2VCAA 4RHV1 4XE9A 5FZLA 1T2XA 2DVAA 5FZGA 1JH5A 4B1MA 2O8QA 3UYJA 4D94A 4NRMA 4FSJA 1X82A 1FOD2 4KH9A 5FY1A 4JKLA 1O59A 4UW4A 5ERLA 5I0DA 3ZFGB 3DPRA 4K1YA 1HN1A 4OUSA 2RDQA 3WT3A 4AVAA 3LZZA 2ZGPA 3ROUA 2PQSA 1VRH3 2ZGRA 3H8UA 5CB7A 2A3WA 4LULA 5BV6A 4A7ZA 3KD4A 1S0DA 1MEC3 2A73B 4QHOA 4UFIA 4XCBA 4UT5A 2R49A 3VBOA 5FPXA 3O1MA 1W6PA 4YZ4A 1CAWA 3UV9A 2CTVA 2GN3A 3IN9A 3VBSC 4CYDA 2NYYA 4LE4A 1W9WA 3C7EA 1POV1 3WQ0A 5FPAA 5F6LB 2RS13 1X36A 3BYWA 1H6YA 2GALA 2WYFA 5T5LA 5CEHA 4OI4A 3DCQA 1YQCA 1FNZA 2OXBA 1Q8QA 2D40A 3GBWA 2QQVA 3FL7A 2AYHA 1AYN2 3T4HB 1UOBA 1YFUA 3ZSLA 5H9SA 5K8SA 3ZXFA 1GV9A 4A3XA 1LOFA 1ULCA 2J1VA 3WUCA 1NG0A 4CEWA 2K9ZA 3PL0A 5IVFA 3WNLA 4LKEA 2O1QA 1FPN1 3SEPA 4IXLA 4WM8B 5T5JA 1OBNA 2EF6A 5J36A 2RMU1 2VZVA 3NKGA 2VXRA 1RJ8A 3E6BA 1QJX1 1R083 2A7AA 2OZ6A 2EIDA 2YDEA 5HXMA 2JKXA 2HWC3 4QX5A 3VDDA 1WLCA 3ZFEA 4URTA 3RRDA 4UFKA 4CU9A 1K5MB 4KWJA 2W1UA 4AQ6A 1RUI2 4IETA 2P17A 4IEOA 2RG4A 2ZABA 4LKFA 5F5QA 2LW8A 5FZBA 1W8TA 1CIWA 4ZONA 2FMDA 4W6YA 4YVSB 1AUYA 1BVVA 1OKOA 1ZBE3 2H0VA 5FYSA 2UY8A 5FJKA 2VZQA 2WQ4A 4MGTA 3ZVXA 5D8AB 5ACA3 1I6XA 5FWJA 4RQPA 2E32A 4QXKA 4HONA 2AEZA 2YZ4A 2WSVA 1BK1A 1FMD3 1BHGA 5C9AB 4OHYA 2W92A 1IPKA 1ZA7A 4J6GA 4L11A 1VBD1 3MIHA 3VLBB 3VHRA 5JOWA 2RS51 1N1SA 3IAQA 2RS32 4QPIC 4Q4W2 2Y6HA 3MYXA 4CU8A 2HLEA 2O8OA 2MEV2 5FV3A 2Q1FA 1R1A3 2BFUL 3BTXA 4RL7A 5JI7A 1UMHA 3AKTA 1MZFA 3NSTA 4DRRA 2XJVA 2IFRA 4NAOA 5DQ0A 4BOWA 4QXCA 1RL3A 1X9PA 1I9RA 4CA9A 2EIEA 3FFZA 2JENA 5FMBA 1J84A 3WQ7A 4JGYB 4AK3A 4LHSA 3RSJA 4P9GA 3WP5A 2DBIA 4S2HA 2PHFA 3NVCA 3RZZA 2B5HA 2PYTA 3HNYM 4WV8A 1C1FA 4MOAA 1AL22 2ZA9A 5A3OA 4TWTA 1Y9QA 3AKPA 3KB5A 1DQ4A 1W6QB 1CESA 3N9LA 3QH6A 2WRAA 2WO2A 4LIUA 3S6PA 5KWRA 1JXNA 4K7JA 4XJZA 4A45A 4A42A 4LLFA 1PGW1 1W3XA 4RSUA 2VY0A 3BOPA 5LBFA 1VAKA 4WVWA 5BNOC 1TE1B 1MQTB 2VUJA 1RHI3 5ANNA 4C0BA 3PTYA 4COZA 3T3YA 1C8M2 1QQP2 1LESA 4PBOA 3ZXDA 1RVF2 3GYDA 5A3MA 3H8RA 4NROA 1M06G 2EXKA 1WLTA 4D6QA 3VBHC 2RR12 5IVYA 1ZBA1 2G19A 4FVVA 1OVPA 4LBNA 1KS5A 3WHTA 1IKPA 2GC0A 4QPYA 4XPVA 4YZ5A 3MF9A 3SH3A 2ZMLA 3WF4A 2Y8KA 3ZMNA 4DMIA 4Y3OA 3RZHA 3JD71 5IK8A 1HJGA 2A70A 2WN2A 1YIFA 1UIJA 2DDUA 4XURA 1H4HA 2BWCA 2BYVE 3RQ0A 1BKZA 1YHFA 5ABJA 3DPRB 4CU7A 4HVOA 2BBAA 1TMF2 2YU1A 1KJRA 4MUVA 1SDWA 3A21A 5DUUA 3I4IA 4AI1A 4B3NA 3ACFA 5EWSA 3K46A 4NHMA 2XJPA 3VBOB 1W6PB 3O14A 4FI9A 1CAWB 1RUC3 5FZDA 3GCWA 1DZRA 1RITA 2R0FA 4YW1A 5LA2A 3WDWA 4ZPIA 3R4SA 2E31A 3IM0A 1S2KA 4RR3A 3X29B 5J09A 4RD7A 2Q8OA 4C91A 4QDSA 4Q4X2 4UAPA 3KV4A 2RS11 1OLMA 1V9U1 2XLFA 2E26A 3AFKA 2XQRA 4NHLA 4XIOA 4CEWB 3VGIA 1WCDJ 2W52A 4LO5B 4AVCA 1Z0HA 2R043 3I3QA 3OGGA 3VKMA 1Y9GA 3WDYA 2G9FA 2MPFA 4GH4A 4MGQA 3UESA 4AHYA 1EAH1 2Y34A 4SBVA 5E89A 4JC1A 4D6RA 2WNEA 4HPKA 5L9VA 2R063 1HN0A 4AYUA 1GMMA 4HG6B 4LBMA 4HL0A 2JEMA 2I07B 4I0WB 4IQPA 2CHHA 1UF2C 1MZEA 1UCXA 2VCCA 5A70A 1RUI1 3ZFEB 2VZSA 4QX1A 4B7EA 1PIV3 3V0AA 2HWE2 4FAGA 1J59A 3ACHA 3I49A 4IE7A 1JZ2A 1OA2A 3B00A 3WCRA 1HB3A 1IKQA 1J3RA 2C6SA 4OHXA 4Y1UA 4BK4A 4CXYA 1GWLA 2NMOA 3TYJA 4QWNA 4RQPB 2DCTA 4ARXA 4DRVA 4FXGB 3O7OA 2C1FA 2XQXA 1RC6A 4FFHA 4I0BA 3WW4A 1V70A 4BLJA 4UFMA 4DOUA 1RUG2 4Q4W1 5ACA1 3CO2A 4ORFA 3HIFA 2HH9A 4AVSA 3IPVA 5IK4A 2FMYA 1WGPA 5EYYA 2E63A 4R9DA 2VQ0A 1RTVA 1UD1A 1A8DA 3CMGA 3A7QA 4M01A 5FYUA 3AJZA 3UKTA 3LPFA 4DXRA 1KD7A 1CAUA 2OS2A 2GH8A 4O7XA 5FPLA 4ASMB 1QOOA 4JQRA 4OLLA 3WP3A 2GP5A 2C9AA 2JDUA 2ORXA 4AFAA 3U11A 1NAEA 1BBT3 4BK5A 1NLRA 1VLNA 4QXBA 4CDUC 3P3PA 1JYNA 2XB6C 1OKQA 2AR6A 1ODNA 1CZSA 1XOYA 3GXUA 5F5AA 3VBRC 3MIEA 4OFGA 2AZ5A 2YUEA 3DUIA 3NAPC 2LALA 2YBKA 4Q1RA 3LEGA 4XF3A 3WDXA 1H2KA 1AVBA 2UYAA 4MLOA 2XUMA 2WNOA 1ULFA 5FY8A 1JOBA 3ES1A 4JZRA 4PJYA 5FPUA 3PNAA 4I0AA 1A34A 1U5IA 4TSVA 4UBHA 4KU8A 4N9IA 3TRSB 4GIQA 3OSDA 4H7LA 3E5XA 4RN5A 4UFJA 5G05L 4P5HA 2KXLA 3AVSA 3WOGA 1D4M1 2AACA 2RJ2A 3I3BA 5FZ4A 2VUAA 1JZ8A 4E4DX 3PUIA 2VNGA 4HETA 4XUTA 5GLUA 2G1MA 1ST8A 2YY1A 2RJKA 2VVEA 5GZFA 3N9OA 3WQ1A 3O1PA 1YXWA 3T0AA 4CZSA 5G04L 5A7PA 1Q8SA 4CDWC 5C4WC 3I2HA 3S5AA 4NHXA 2D5FA 3OBZA 1VB4A 1VBE1 5FMCA 2YBSA 4N8MA 4QB6A 1HRV3 1U5XA 2PELA 4EWAA 3KV9A 3MPPG 4PLOA 4XUNA 3TN91 4BIOA 4FOQA 4XEZA 1FYUA 4YFZA 2DCJA 5JZGC 1SLTA 4UFLA 3AP4A 1LEDA 3UJQA 1X9TA 2VNRA 1GLHA 1V0AA 2WLQA 2VZ3A 4IV3A 1JOJA 2QVSB 3PTRB 3POEA 2LS6A 3D3AA 4NPLA 3I59A 5FZ0A 3WCSA 4AEKA 5ABJB 1W28A 1XE8A 2YC4A 1QJY1 1JU3A 1VP6A 3IIIA 2G9ZA 4FFFA 1PO12 2ORZA 3HD8B 5LK7B 2AGSA 4Q0PA 4UF0A 4UYBA 3ZYPA 1G9DA 2VOXA 5CNAA 1IG0A 5CFCB 2FDGA 1COV1 2NPIA 3PIGA 5CKMA 3J8F3 4A7YA 3J26N 3ZFGC 1NE6A 3IAPA 4YWAA 1O7FA 2ZHKA 3BTAA 4KGQA 4XTMA 4AF9A 5KXEA 3S57A 1I5PA 1K42A 3JBG2 3WY6A 4NN0A 4DUXA 2VCMA 2VZ1A 2Y64A 1NX9A 5L7OA 1PVXA 1VPHA 4RR3B 3AMMA 5FAXA 2E6VA 3MO4A 3POSA 4K8FA 2PHRA 1WA4A 5DUWA 2HWF1 1HQLA 3I2KA 1W8FA 2IC1A 4FXKB 1JZ5A 3EMRA 2JICA 5T3NA 1VBA3 4AVVA 5FXVA 4AFDA 4BLIA 2EXHA 3AJYA 3TNPB 1AR61 4BQ3A 4H14A 4EJRA 1V6KA 1KEXA 2EAKA 4GH4B 4E4SA 4I09A 1LU1A 1DQ1A 4HPKB 5HXVA 4MO3M 2QCSB 4XZUG 5CG8A 2XKOA 5J37A 1ZYBA 3VBUA 3K4AA 5AC93 5E1RA 4AQSA 3P3NA 1SDDB 4LXLA 1O3RA 5I91A 4LO7A 3V0AB 3O1OA 3POIA 5A7NA 4WM8C 2DFBA 4XHXA 3WSOA 4CPBD 4ATFA 1YJLA 1PIV1 5DN2A 4B1LA 4PDWA 1JN2P 1HXS3 3OBTA 2FCUA 1WD3A 5F5IA 4KWLA 4CU6A 1K5JA 1U5YA 5AFEA 1K5MC 3NNGA 4JKKA 1D2QA 4BH9A 1QDCA 1XB9A 1D2SA 2FDJA 2VL4A 1MPXA 3ZN6A 2F4LA 5LRSA 3N9PA 2Q4SA 4Q0UA 4Q29A 3VHPA 3E6CC 4YVSC 4CDUA 2YB7A 3LD8A 1GANA 2XBO2 5H9RA 5DDJ3 1J3QA 2XGXA 2Z79A 4Y22A 3BGAA 2BVBA 3IPVB 3NAPA 3ETQA 4Y1VA 1UW8A 4EN0A 3D6EA 5D8AC 5H9QA 3MZHA 3RDIA 1FAYA 3O5SA 4L92A 1LTEA 1LAJA 1W8WA 5C3OA 5GZEA 4TZDA 5C9AC 4CCEA 1CAUB 1YYNA 3AL5A 1QIQA 5BYNA 5CVRA 5JR7B 1S1AA 2JDAA 2DTWA 1XQNA 2FQPA 4QGLA 4R9CA 3NV1A 2WR9A 3INAA 3KZ4C 1AJKA 2QUOA 3OF1A 5K7PA 3M1HA 1OLRA 2ZMNA 5CU1A 4AW7A 2WZR2 1CPMA 1QU0A 1PK6A 1PM7A 2IXIA 2R1DA 4K21A 1GZCA 1ZRCA 1WD4A 3J7MA 3ON7A 2N7GA 4QKBA 4EYUA 2GNBA 2B39A 2J42A 4FPCA 4OZXA 2ZKLA 2WINB 3ZPOA 1RUE3 1MACA 1OH3A 4JGYC 4XFBA 1JYCA 2B9UA 1GNYA 3VDAA 1UIKA 2PLV1 2XDVA 1V6JA 3TB0A 1W03A 3KS7A 2OA2A 3LPGA 3RJ2X 3U14A 1TME1 3RZKA 1ENXA 3AVRA 3RZJA 1LHOA 4QQPA 1QOSA 4GWIA 4X8NA 4X8PA 2XJUA 4Q4Y1 5FZHA 1L7QA 2XPJA 1W8OA 1DQ5A 2BNMA 1EPWA 3SQOA 1MS8A 2YFZA 3VL8A 2X53S 3ZDVA 2QQJA 1QJU2 3D4KA 3BUCA 3H50A 3AYCA 2GU9A 5BUVA 2CWMA 2VCBA 3MUZ1 4ZS2A 2IUWA 3MI8A 4LO8A 3K75B 1R091 4XJ8A 1E5HA 4BJ0A 3ALQA 3CL1A 4YM0A 1RUJ1 2XWBB 1PGSA 4AI8A 4LK7A 3FHIB 4CUAA 2DVDA 3VD7A 1A3KA 3FLRA 5JSRA 1MS9A 4HK9A 4OMCA 1UYZA 1OURA 1F31A 1VMJA 4IV3B 2ZKNA 1JHJA 1KITA 5FYIA 5I8SA 5CISA 5B4NA 4V1PA 1BEV2 4ZKTB 1O5LA 3I59B 3W20A 1G9FA 3WW2A 2RDNA 4FCAA 4IUGA 3Q8BA 5BNQA 1GP5A 3IDAA 2WNUA 3MIFA 3PMSA 2D3RA 4AGVA 4ET7A 2A3XA 3LFMA 3WP4A 1VBC2 3GNEA 4UF0B 4FPYA 3MIDA 2LTNA 3PIJA 4GALA 5FJHA 2HKXA 4EE2A 1S0IA 1XYOA 4PI2A 2WFF2 4F7ZA 4YW2A 4BQWA 5FO8B 3RVHA 5IYYA 4HKOA 2VNVA 1G9CA 1RGSA 2JE8A 1UYYA 2XKPA 3DPRC 2D3SA 3MUY1 4NPMA 2ZCWA 2OQ7A 2GMMA 3OUIA 4LUMA 1UO9A 2J1SA 4Q4V1 3RYRA 1AF9A 5L7OB 4L97A 3B3QE 3J8F1 3HQUA 2ZX4A 4C90A 2WWJA 1KDMA 3CIHA 1AYM2 4LKDA 3GZAA 5FO7B 1W39A 4TTGA 1V6MA 4FOVA 1YO8A 2RMU3 4XILA 3SC7X 4D6SA 3WZ1A 3VBOC 1N47A 4NHYA 1QJZA 2XJTA 3IB3A 1Q56A 1QJX3 2HWD2 4ONUA 4URAA 2BWAA 2RM22 1PZ9A 3D5OA 3OBAA 5F5CA 1ZRFA 4W8JA 1ALYA 5JDBA 2XJQA 3U4XA 4P08A 3T1MA 1VBA1 1VMHA 4IEQA 4DUWA 4AZZA 1S2EA 2JB4A 3RFRA 2VMEA 4O61A 4D8MA 1RUF1 1W90A 2XLAA 1LOFC 4CEWC 3VBUB 2Q8CA 3R4UA 3USSA 3NV3A 4LHKA 1ZZ6A 2C24A 1GWKA 2JDYA 5L9RA 2WO3A 4CCJA 1PNFA 4KI5M 4YVSA 2B42B 5J7MA 3BI3A 5J96B 2VECA 1DGRA 2V5YA 1ZZ8A 1Y7BA 2VBBA 5LCWL 2R16A 1W9YA 1JYVA 1BZWA 4AFMA 5GZGA 1LECA 4MHUA 1B35A 2QE3A 4PDWB 2D43A 4Y4YA 2P37A 3ZFEC 1KS4A 3ZR5A 3HQRA 1HRI1 1SCRA 1AXKA 4NOTA 2RS53 4P9IA 3QCWA 1STMA 1PO22 1UN1A 3OGSA 4JX0A 4S2DA 3H9AA 4MGIE 3ZN6B 1W6NA 4DUVA 4MADA 1BMV2 4PHZA 1GKBA 2VBDA 4QU1A 3C2UA 5FDBA 3OUJA 4NAMA 4OYUA 3MLLA 4Y22B 1RXGA 1TVGA 4Z2AA 3VL9A 2VOVA 2DTYA 3MF6A 5IWFA 1ZVFA 4YARA 4EV0A 5A3TA 4RQPC 5A6ZA 5IAVA 1JS9A 1DGRN 1A78A 1DU3D 1ZRIA 4P14A 3VN4A 1IPJA 1G6NA 4FPFA 1RUNA 3CKHA 1REDA 3D0JA 2ZJCA 2FBEA 2QQLA 3ME2A 4CSWA 1LKNA 1AR81 2B8MA 1DQ2A 5L36A 1W2TA 3ILRA 4HXCA 3RGBA 1H6XA 1K3IA 1RMU2 4XF4A 5FYMA 2K46A 4CDQB 5C33A 1W9SA 1PK6B 4FPEA 2BFUS 4XBLA 1F35A 3WHUA 2YC0A 1P8JA 3H42B 3IZOA 3KF3A 1AXZA 4DNYA 1AR71 1YQ8A 1EV12 1O4YA 4UW6A 3ZYHA 4COVA 1I1EA 2IVIB 1E5IA 1WWYA 2CSGA 5FZ7A 2GNTA 4D7SA 3VD9A 4H7MA 2CL2A 3CU7A 4AI2A 4GWMA 4DEVA 4GB31 4XOGA 4JDOA 4QB2A 4HKLA 3OEAA 3ZXAC 5HBAA 5IK5A 3ZSEA 4LUKA 3MV01 3IT8A 2BNNA 1ZBA3 2W95A 4FFIA 3PJQA 3IDBB 4U2AA 4MYEA 1OT5A 3AKRA 1YFYA 1N1YA 4YSFA 1UOFA 4FAHA 2X29A 3CNAA 4QM8A 3PVOA 3JD73 3FBMA 1PNGA 1UU4A 2ZGTA 3ITQA 4XF0A 3WW1A 1PVC2 2WS91 3DL3A 3IDEA 4ZXEA 5BNNA 3RZMA 4QDRA 3WG2A 4CCCA 1O4ZA 2LM3A 1LOCA 1NY72 5ISLA 4UWDA 5EJ1B 4YW4A 5IK7A 2GSYA 4QX3A 1Z7S1 5T54A 4OQ8A 4M4RA 5FZKA 1UMIA 2HWB1 3GHNA 5FP3A 1U12A 3E1F1 2ZOEB 3MLKA 4QXHA 2AREA 2W68A 4CP0A 3UGHA 3THTA 4XFIA 2WNUB 3GZTB 5DAWA 5HI0A 1EYBA 3EHKA 1CX1A 3WNNA 3I2DA 1DHKB 1ASJ2 4V2WA 3H1WA 2VQUA 4LBLA 4TLFA 5GZCA 5FY9A 3WV6A 2WZEA 4PT6A 3BODA 1GOHA 1V9U3 4BB3A 5ABJC 2ARBA 4AHZA 1IS4A 1I3HA 2DU1A 4N7UA 3N9QA 5CKNA 1W3VA 1EAH3 1VBB1 2GN7A 5CFCC 1ZZCA 1F2NA 2GNDA 2EALA 4B7KA 1RUD1 4GJZA 2BTVC 3EB7A 4L2NA 5EFUA 2P3IA 3ZXJA 4K6BA 1S2BA 4FPJA 3T2OA 1WUVA 2R071 2W39A 1RUI3 3AM2A 5APAA 1VRH2 2WLPA 3ZDSA 3C8XA 3OD4A 2HEYF 4RR3C 3O12A 4G9SB 5CZKA 4L99A 1MEC2 5LB6A 2ES3A 2RVAA 3KV5A 4IEUA 4LBQA 4MGZE 5HPOA 2BPA2 3W21A 4BQ2A 4M4PA 3FUQA 4Q0SA 5F6KA 3JQWA 2P6CA 1POV0 3MICA 2YPJA 4FOYA 4GH4C 3L9JT 1DP0A 4NRPA 5I8TA 2AUYA 2A6VA 2ADDA 2ZZJA 2WSUA 4XFCA 3VHNA 1CZTA 1APNA 2UURA 4MG2A 1CPNA 5DAXA 1F15A 4XYXA 1B35B 1W0PA 4Q4W3 4QQHA 3WNPA 3N9NA 3AFGA 5J98B 1O4TA 1GZ9A 5C8CA 1ZA4A 1W6NB 2DVFA 2D3PA 1JW6A 3MEPA 1IZ3A 1W8HA 3P1IA 1W8ZA 4Q8LA 1OA3A 4YPJA 1X7NA 1R082 3T1LA 4HSLA 3NV2A 2HWC2 1RUH2 4QX8A 2OPKA 1HV0A 2C4XA 2BV4A 2NP0A 4R9AA 5C7GA 5IATA 1AR91 4W6XA 5F2WA 1LOBA 3E5UA 2G9GA 4JTNA 5DPNA 3PVEA 4W50A 5E16A 2WAAA 3S7EA 2P5BA 1ND3A 3GZUC 4YGBA 4W6WA 1ZBE2 1RMU1 2BERA 2PXJA 3KMHA 2VD7A 2Y6JA 1X8MA 1WMDA 4MH0E 3ZYBA 5GLVA 3H8XA 1W99A 5CYYA 1PX4A 4IDZA 1DG6A 3S7IA 5BNPA 3J7LA 1FMD2 4RS5A 1D4M3 1OVSA 1UU5A 1VIWB 2KR2A 4AI3A 3M3CA 3I2FA 3GJBA 3UT0A 4EWDA 1C8M3 2A6YA 2ETEA 1QQP3 3OPWA 1G7YA 1IHMA 3ILNA 5EYXA 5A7SA 2JKBA 3MIBA 4LE3A 2WT0A 1VALA 3KQ4B 4RGGA 5FO9B 1MS4A 3E6DA 1NQDA 4WM7A 1A6CA 2UU8A 1R1A2 4J1WA 3ACLA 2BZDA 2NQYA 1VBE3 4G4FA 2KM2A 4LOSA 4FP2A 4Z1VA 1MZ5A 3TN93 3GBFA 1CJPA 2WT2A 3VD3A 5FMDA 2VM9A 3Q8FA 4K1ZA 1UPSA 2QZ3A 1HKDA 1MVEA 2E7AA 3T4VA 3WG4A 5BNNB 1FOD1 4H2AA 3U37A 3HNMA 4DY3A 2NN8A 2GC3A 2W9XA 3I8TA 4U36A 1QJY3 4A2UA 1AZDA 5F8PA 3S0MA 4FOWA 4ISRA 2W08A 3APBA 1NT0A 4N43A 1JMUB 4XFGA 1NE4A 1QJEA 1Y4WA 1C8NA 1CIYA 1OD3A 1D0HA 1COV3 1GSLA 1HB2A 3W58A 3B02A 3HT2A 1Q8PA 5EJZB 5LBBA 5CFCA 4IE4A 2ARXA 2HEVF 3ORJA 4OI2A 3WDUA 3BTZA 4Z2WA 1RHI2 2Q1MA 1SEFA 3AMNA 4QX2A 3MGUA 3AK0A 1XYNA 2WWUA 5KHIA 3HPNA 4IV3C 2D98A 4RA0A 4QX7A 4IW3A 4KG0A 4E9KA 1CQ9A 1N1VA 2HWF3 1AYN1 2YROA 3ENRA 2Q8DA 1H30A 1US2A 2F4PA 5C3QA 1VR3A 5DAPA 3SCGA 3GALA 1AR63 1IQDC 1NCQA 3MIGA 3FLPA 4MV2A
chains in the Genus database with same CATH topology
1V0AA 1WZXA 4YW6A 4YW7A 4LK6A 4BQ4A 2K46A 1W90A 1W8UA 1OH3A 4LK7A 4CP9A 1W9FA 4CPBD 5D21A 3ZYBA 4A6SA 1GWLA 1W8WA 2C24A 1GWKA 2O14A 3ORJA 2LROA 2WYFA 4LKDA 1HN0A 1WMXA 3ZYHA 4BQ3A 1W8ZA 1L7LA 2LRPA 4BQ2A 2VXJA 4CP9B 2KR2A 4LKFA 4LJHA 2JWPA 3UT0A 1W8TA 2Q1FA 1GWMA 3F95A 1OKOA 4YWAA 4BQ5A 1WCUA 4LKEA 4CPBA 3ZYFA 4AL9A 1UOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V0A A;  1WZX A;  4YW6 A;  4YW7 A;  4LK6 A;  4BQ4 A;  2K46 A;  1W90 A;  1W8U A;  1OH3 A;  4LK7 A;  4CP9 A;  1W9F A;  4CPB D;  5D21 A;  3ZYB A;  4A6S A;  1GWL A;  1W8W A;  2C24 A;  1GWK A;  2O14 A;  3ORJ A;  2LRO A;  2WYF A;  4LKD A;  1HN0 A;  1WMX A;  3ZYH A;  4BQ3 A;  1W8Z A;  1L7L A;  2LRP A;  4BQ2 A;  2VXJ A;  4CP9 B;  2KR2 A;  4LKF A;  4LJH A;  2JWP A;  3UT0 A;  1W8T A;  2Q1F A;  1GWM A;  3F95 A;  1OKO A;  4YWA A;  4BQ5 A;  1WCU A;  4LKE A;  4CPB A;  3ZYF A;  4AL9 A;  1UOJ A; 
#chains in the Genus database with same CATH topology
 1S0E A;  3AZZ A;  3NNL A;  4O65 A;  3CEW A;  1LGN A;  4AAP A;  1OPM A;  5AFB A;  4PCR A;  2GH2 A;  5K0U A;  3HEI A;  1EPZ A;  3AX4 A;  2Y6F A;  1D0G A;  2PN5 A;  5T5O A;  2J7M A;  4FTS A;  4F8A A;  3ZSK A;  3N35 A;  4IV1 A;  2KA3 A;  4NUB A;  1OOP A;  1UY3 A;  3TWI A;  5L7O C;  4IGO A;  2C9K A;  5A1L A;  3VHO A;  5CFD A;  1GZT A;  3PU3 A;  3SHR A;  4NIG A;  2OKX A;  2XOM A;  4LBQ B;  2NMN A;  3RZL A;  4XUP A;  3ZOI A;  3C7G A;  3LA7 A;  1RUC 2;  1KFX L;  1J83 A;  3LE0 A;  2I45 A;  2I74 A;  3NKT A;  5CKQ A;  4J1X A;  5KHK A;  2VZP A;  2WAO A;  3JB4 C;  3KSC A;  3NQH A;  3P6B A;  5B4X A;  4HOO A;  4CCL A;  3DV8 A;  2VZR A;  4WBB A;  2Y38 A;  2K2S A;  3KV6 A;  2CV6 A;  3DEC A;  1F4H A;  4IE6 A;  1JZ6 A;  4HKW A;  3K3N A;  2LRO A;  3ZYJ B;  3VBU C;  2PMW B;  4KWU A;  1K12 A;  3K4D A;  2HYK A;  3VKL A;  3B9I A;  1XRU A;  3G6J B;  3NO8 A;  4NIA A;  2R04 2;  1PGL 2;  3MBW A;  5A6X A;  2XVK A;  2PA7 A;  2WNV A;  4XXP A;  4ZY9 A;  3UK9 A;  2RS3 1;  3OB8 A;  3USU A;  5C8C B;  4HVQ A;  1CD3 G;  1WKY A;  2HYX A;  3WUD A;  4JHT A;  4CCN A;  3VDB A;  2R06 2;  1RUH 1;  2MEV 1;  2P3J A;  3AP9 A;  1Q43 A;  1H2N A;  4JKM A;  4XUO A;  3WEZ A;  3AXE A;  4S2F A;  5FYV A;  4PDW C;  1JUH A;  5LRR A;  3U10 A;  1T6B X;  4TYS A;  4QMA A;  5T52 A;  5C3P A;  3DGT A;  2R0H A;  1XNC A;  3N3H A;  4GMP 1;  4MZU A;  4IGQ A;  3LQC A;  4XQW A;  3RYK A;  1Q8V A;  4IEZ A;  1FX5 A;  4Y1X A;  4DPN A;  4CP1 A;  4GUL A;  1C4R A;  1ND3 B;  5C3S A;  3AKQ A;  1AL2 1;  2OVU A;  2FDF A;  5B2G B;  4R8H A;  3TNQ A;  1DGW A;  2CDP A;  5LA0 A;  3A23 A;  5JPM B;  2WBK A;  2ZX3 A;  1XE0 A;  3NJY A;  2VUC A;  2YXS A;  1WW4 A;  2QQM A;  5FOJ B;  5D2A A;  2PLV 3;  5DAQ A;  3RPQ A;  1UYP A;  1OSG A;  1TME 3;  1W0N A;  2X05 A;  2P1B A;  4L8Q A;  4RS5 B;  3PU8 A;  5I0U A;  4BPZ A;  5BNP B;  2GME A;  2CAU A;  4Q4Y 3;  2V5D A;  5KXB A;  4Q2F A;  1S4C A;  2JIJ A;  1H8T A;  1OFN A;  2VMG A;  3M3I A;  1POQ A;  2VJX A;  4I02 A;  3KWV A;  3POW A;  4WM7 B;  1C8M 1;  1N3O A;  1H0B A;  1QQP 1;  4Y24 A;  4CDQ C;  1PK6 C;  1RVF 1;  1AX1 A;  5A7Q A;  4JTO A;  1UY1 A;  2J1E A;  1R09 3;  2DV9 A;  2RR1 1;  1KFU L;  1GP4 A;  1PMH X;  5GLZ A;  4ATE A;  3WG1 A;  1DYO A;  1RUJ 3;  2P4E A;  2IVJ A;  2WQZ C;  4Z8B A;  5GM0 A;  1BBT 2;  3GBG A;  3AYA A;  3OPT A;  3V65 A;  1O91 A;  1FAT A;  5FR3 A;  1J58 A;  4YW5 A;  4C0H A;  5IVJ A;  4LBO A;  4LIT A;  4HK8 A;  1AXY A;  3EXU A;  4ASK A;  3Q8E A;  1HDK A;  3POG A;  4XW3 A;  4Z07 A;  3RNS A;  5C5U A;  5F9T A;  2W46 A;  4I30 A;  3ZLI A;  1LOE A;  2ZS6 B;  3ZX7 A;  3T2P A;  1TMF 1;  4N43 B;  5KXC A;  4JGZ A;  4XJ9 A;  2QDR A;  3GM8 A;  1S0C A;  3L2Y A;  3VZK A;  3NJX A;  1YQ5 A;  2WO7 A;  3BU7 A;  2GC1 A;  3FHQ A;  5EJ3 A;  2FHR A;  4Q4V 3;  5LWB A;  2PHT A;  3AB0 A;  5KHG A;  5FY7 A;  4LT5 A;  1W6O A;  2E7T A;  4Z92 B;  1JUI A;  3THD A;  2FD8 A;  2ZGU A;  3QLQ A;  3J9S A;  1SLI A;  4FPG A;  2QQI A;  1XBF A;  4AR2 A;  5D1I A;  4IER A;  4TN7 A;  1XNK A;  5FKC A;  3I2G A;  4HZF A;  1WZX A;  4Q4X 1;  3ZKU A;  1BCX A;  2FZ1 A;  2EXJ A;  5SV8 A;  2JE9 A;  1LHU A;  3ZFF A;  1HRV 2;  2YMZ A;  5FZ8 A;  2D6M A;  1SFN A;  2WNU C;  1LCL A;  4XXA A;  2OT7 A;  2YYO A;  2OW4 A;  3VDC A;  1FT9 A;  2FCV A;  3O1T A;  1NCQ B;  1LEN A;  1QMJ A;  3VD4 A;  2VMC A;  3R6S A;  5LBE A;  4XDQ A;  5K0U B;  1IS5 A;  2B45 X;  1RUF 3;  3BKZ A;  3NRU A;  2WA3 A;  2TUN A;  4AEM A;  5FPZ A;  3BVC A;  2RJL A;  2VOK A;  1OMI A;  4IV1 B;  4AED A;  1OOP B;  5IW0 A;  4PIZ A;  4CUG A;  2PHL A;  4AI0 A;  4MHR A;  4XJA A;  5CA6 A;  4NMI A;  4CCM A;  5J1X A;  5CFD B;  2VZU A;  1X50 A;  5FP4 A;  3U0Z A;  3IKW A;  2HWE 1;  4QD2 A;  5JXH A;  4M3C E;  2UWB A;  1GU3 A;  3WDV A;  4NWV A;  3THC A;  4BQ1 A;  3IDC B;  4NII A;  1OD5 A;  2YU2 A;  3OUH A;  5FZM A;  1W9F A;  3ZPY A;  2XLG A;  3N4M A;  3L2H A;  5FIX A;  3OGV A;  3I7D A;  1HRI 3;  4Y26 A;  2E9Q A;  1BXH A;  2EIB A;  5FYH A;  2MNG A;  1CN1 A;  5FZ3 A;  4BU2 A;  4OZO A;  4YVW A;  5L19 A;  3B93 A;  1CVN A;  4E4H A;  3LAG A;  4I3P A;  3CQO A;  1QJF A;  1RUG 1;  4AHX A;  1WCU A;  2BOJ A;  2JE7 A;  4V2V A;  2WNV B;  2XHK A;  3USU B;  3T08 A;  2W2I A;  1XSQ A;  3H3L A;  4GAZ A;  4RFR B;  3BPZ A;  2Z2S B;  4H55 A;  1B35 C;  1LOD A;  1HB4 A;  3MFA A;  5L9B A;  2YBP A;  1SBF A;  3WXP A;  2QNK A;  4PLM A;  4BDV B;  1LNS A;  1AR8 3;  5AC9 2;  1ULP A;  5HV4 A;  1F8V A;  2E7Q A;  1DIW A;  4NJ4 A;  1V6N A;  1R1Z A;  2JDZ A;  3VV1 A;  3EQE A;  4EN7 B;  5E6H A;  1HLC A;  1SFY A;  2Q30 A;  2DU0 A;  5F3I A;  2JB8 A;  4BHP A;  1OF4 A;  2DUR A;  2V73 A;  3TEZ A;  4WZF A;  1YLL A;  2VQT A;  5HCH A;  4Q0V A;  4OUE A;  4D0Q A;  1AR7 3;  5JIU A;  4CDQ A;  3AYD A;  5E8A A;  1HXS 2;  3ZYF A;  1UKG A;  3SIS A;  4MGY E;  1QNY A;  2ILM A;  4PLN A;  5LZ6 A;  5LAS A;  2EXI A;  2FZ2 A;  4RGA A;  1UOG A;  4ZU4 A;  3AYE A;  4EN8 B;  1QXR A;  2GNM A;  2F17 A;  5GJ6 A;  3MFC A;  3UJO A;  3MPB A;  4XJU A;  3DN7 A;  3N7J A;  3C7H A;  4GB3 3;  1ZRD A;  4SLI A;  4MET A;  3SKV A;  5DDJ 2;  1VRB A;  2MHF A;  1XND A;  1FV2 A;  5JAX A;  1E57 A;  4QQ2 A;  3J4U H;  1H8T B;  1QXJ A;  1JZ4 A;  2B7Y A;  2ZGS A;  4XBQ A;  3QH7 A;  2WS9 3;  5CAD A;  4AFC A;  3NJZ A;  1XYP A;  3FLT A;  4R4Z A;  3N7K A;  1F5F A;  1UY4 A;  4RYD A;  3A4U A;  5JSO A;  1VAV A;  1ZZ9 A;  3LCP A;  1Z7S 3;  3ZYR A;  2QZ2 A;  1PX3 A;  3OJB A;  4Z82 A;  2VW2 A;  1G9A A;  5A1A A;  2HWB 3;  3IBM A;  3O0V A;  4OUM A;  5LA1 A;  3HJR A;  4NWW A;  5BY5 A;  1R64 A;  5DUX A;  3S30 A;  4XQ4 A;  2JG8 A;  3VZO A;  2V09 A;  1WME A;  5JCT A;  5FY5 A;  2ZHL A;  4JRA A;  2NLR A;  1RUE 2;  5I0R A;  1PO1 1;  1O5U A;  1QGL A;  4JGZ B;  1NXD 1;  3U78 A;  2PTM A;  4P9W A;  4YGC A;  2W47 A;  3KF5 A;  3ECQ A;  4N7I A;  3SMH A;  1CGP A;  3WD5 A;  1GYK A;  2BVV A;  5BNN C;  2QKD A;  2OZJ A;  5FZ1 A;  1BK0 A;  1YQ2 A;  3SH4 A;  4C8D A;  1KQR A;  3T0D A;  3ZSJ A;  1NZC A;  4KGG A;  3HVD A;  2GC2 A;  1TNF A;  2SBA A;  4RHV 2;  4BE3 A;  1W6O B;  3JBG 1;  1OC1 A;  3Q9O A;  1OUS A;  4MX3 A;  4AE2 A;  1VBB 3;  4G3Y C;  2HWD 3;  1UXZ A;  2UWC A;  4DY5 A;  1ODM A;  4CUC A;  1RUD 3;  2X5I A;  1HQW A;  2C26 A;  3EO6 A;  5FRE A;  5IJR A;  4IES A;  2XML A;  1NQJ A;  3ZFF B;  2D7F A;  3D8C A;  2R07 3;  3C3V A;  3VKO A;  1JU4 A;  3R4D B;  4TLG A;  1LOG A;  1IS3 A;  1ND2 B;  1WCQ A;  2IXJ A;  3ACG A;  4L0P A;  4ARY A;  3NNF A;  5FCC A;  5DG2 A;  5JOX A;  4A3Z A;  1SCS A;  1GIC A;  3H8O A;  1GBG A;  3GF6 A;  1SLB A;  4FQ4 A;  3K3O A;  3PVN A;  3OTF A;  1VAM A;  2CGP A;  1MZ6 A;  4XIK A;  2JD9 A;  5FMO L;  3ZN4 A;  2ERF A;  2YFU A;  4LLO A;  4Q0Q A;  5FYY A;  3ZM8 A;  1U5Z A;  2HJI A;  4AED B;  4N53 A;  3B5L B;  5A3U A;  1W8U A;  3HBK A;  4BXF A;  2J22 A;  1SFP A;  4CP9 A;  1URX A;  3ST7 A;  2A6Z A;  2UWA A;  2IFW A;  3LA2 A;  4QDQ A;  5A1F A;  5FFO C;  4XQD A;  2Q8E A;  2LRP A;  1IS6 A;  1PO2 3;  3TAY A;  2ZAH A;  2ZHN A;  4JQT A;  1UQX A;  3NL1 A;  1S0F A;  4FPO B;  3IIA A;  1L3J A;  2LUW A;  1KXG A;  4XFA A;  1FPN 2;  1MS0 A;  2VGD A;  4LKS A;  1GOG A;  4DO0 A;  4DFS A;  2BNO A;  3KT1 A;  3O1S A;  4PF1 A;  4YVW B;  2QQK A;  5CG9 A;  1PMI A;  2RMU 2;  5K4L A;  1QDO A;  2B4K A;  1W2U A;  3VKN A;  1QJX 2;  2XBO 1;  2VW1 A;  2VE1 A;  4J25 A;  3F2Z A;  1JHN A;  4QB1 A;  1LEM A;  1CAX A;  5FUP A;  4EN6 B;  4HT1 T;  1AR9 3;  1XPW A;  4K20 A;  4ZU7 A;  4RGK A;  4P5Y A;  3WNK A;  4WVM A;  3RZG A;  1YRZ A;  2VXJ A;  3IMN A;  1PZ8 A;  1GZW A;  4FT8 A;  4COY A;  1DLC A;  1GR3 A;  1HIX A;  4LBK A;  1RMU 3;  3ELN A;  2W91 A;  1G9B A;  3LEI A;  1QH6 A;  3ZN5 A;  4ISQ A;  3GJA A;  4XFH A;  4ZS3 A;  2IXK A;  4BME A;  4HMZ A;  5C8C C;  2CNA A;  5EV7 A;  1V6L A;  2WZR 1;  3LSD A;  2DVB A;  2RV9 A;  1IPS A;  1WW6 A;  1F5J A;  4JV4 A;  1E5R A;  4DS0 A;  4ZXK A;  3W9A A;  1HJF A;  1CON A;  2RHP A;  5FZA A;  4LBJ A;  1VBD 2;  2ZGN A;  2YGL A;  3MW3 A;  4YZ2 A;  3KCX A;  2RS5 2;  2ZGM A;  3MLJ A;  1H4G A;  3RS6 A;  2YV8 A;  5JMC A;  4BM8 A;  1ZRE A;  1O3T A;  3SCH A;  4BA6 A;  2FDK A;  3ZYI B;  3LWC A;  1BQP A;  4MGK E;  2SLI A;  2ARC A;  4Y5T A;  1SQ4 A;  1ND3 C;  3MW2 A;  3FX3 A;  3I97 A;  3BPS A;  1Y3T A;  4XCA A;  5DXD A;  1NA1 A;  1OH4 A;  1RIN A;  4BMB A;  1QJU 1;  3HAG A;  2CGO A;  3SH5 A;  4M3C A;  5BNP C;  1FOD 3;  4RS5 C;  4FPL A;  4AGG A;  2JEC A;  1CAV A;  4QKN A;  3GZE A;  4S2G A;  2FDI A;  4LIV A;  1LUL A;  4JHZ A;  1XU1 A;  4XTP A;  5FPB A;  5D21 A;  2D6L X;  4O9E A;  4WZC A;  4NVP A;  1QY4 A;  4WM7 C;  1EUU A;  3B69 A;  1X8E A;  3CJI C;  5DAB A;  5IHR A;  1OQD A;  5LBC A;  4AI9 A;  5GLT A;  2RDR A;  1REF A;  2Y6L A;  1PGW 2;  2ZGK A;  4KQ7 A;  2VC9 A;  4LJH A;  2ZTN A;  1D7P M;  2JJ6 A;  2JG8 B;  1BEV 1;  2PHX A;  4M00 A;  2AEY A;  3KM5 A;  2QTW B;  3CF6 E;  1LOA A;  1TQ5 A;  4B29 A;  3SKJ E;  2E53 A;  1CR7 A;  4K8R B;  2QBX A;  4KBZ A;  3QD6 A;  1WBF A;  1VBC 1;  3DF0 A;  4OMD A;  4XBN A;  1XNA A;  4YG0 A;  2L9L A;  2WFF 1;  1OLQ A;  1UZ0 A;  2VW0 A;  5A32 A;  1AYN 3;  2DYC A;  3QBQ A;  5IFP A;  2PHW A;  1CWP A;  3O1V A;  1ZBA 2;  4K9S A;  3BIW E;  1NLS A;  1YUD A;  5A3L A;  4ES8 A;  2K0G A;  2ET7 A;  3Q8C A;  4NO4 A;  3DYM A;  3H3Z A;  4N43 C;  4XAA A;  3NWK A;  4PBP A;  3RI9 A;  1CX4 A;  3OEB A;  5FBZ A;  2VU9 A;  2J1T A;  1YWK A;  1AYM 1;  3I2J A;  2UY9 A;  3JD7 2;  1NOV A;  3LIH A;  1YEW A;  4IEW A;  5IVC A;  2X5I B;  4Y5Z 0;  2D5H A;  5LA9 A;  4C1W A;  4CRQ A;  1RUO A;  2HWD 1;  4COW A;  2CDO A;  4QQL A;  2RM2 1;  5T50 A;  3MHZ A;  4IEP A;  4WVV A;  4XUQ A;  5T5P A;  3TBD A;  5C8W A;  3T09 A;  5A33 A;  4N90 A;  3TEW A;  2Y0I A;  3BCW A;  4KG8 A;  5FLJ A;  4QPG A;  4YW6 A;  4A7K A;  2VTX A;  5FLH A;  2WAB A;  4X6Q B;  2V72 A;  5HCA A;  3N36 A;  2ZAC A;  3LDK A;  1ZX5 A;  4I2O A;  3KGZ A;  4BYY A;  1L7R A;  1GFF 2;  1SMV A;  2VTX J;  3AXD A;  2P6H A;  4HLT A;  2JDM A;  1UKR A;  4N53 B;  1NCQ C;  1C5H A;  2WDB A;  3N9M A;  1SHW B;  5JXG A;  1ULO A;  3LDB A;  4MSV A;  4CP9 B;  4B4Q A;  1NLQ A;  2BOI A;  4AQ2 A;  2WJS A;  5FZO A;  1TNR A;  3WF1 A;  5K0U C;  3EJK A;  4GJY A;  4E4Z A;  2RS1 2;  5JPN B;  1V9U 2;  3ZXE A;  5AVP A;  1UZW A;  2R1B A;  3CBN A;  3FUO A;  3BN6 A;  1Q3E A;  3FN9 A;  4IV1 C;  1G86 A;  3OD0 A;  1OOP C;  1WLD A;  4YW3 A;  3WIN E;  3HT1 A;  5FQ0 A;  2XON A;  5HCF A;  3WF2 A;  3ZKY A;  3OOX A;  3H7Y A;  5CFD C;  1EAH 2;  2RS3 3;  1PO2 1;  3H3U A;  1BMV 1;  5A7W A;  1IQA A;  2ZEW A;  5C5T A;  1VB2 A;  2Z5W A;  2JXA A;  5FK7 A;  1RUH 3;  2MEV 3;  4OUL A;  1W04 A;  2BU9 A;  3SCF A;  3SEE A;  2XR4 A;  4IEX A;  5FYZ A;  4CEY A;  3WF0 A;  5LEK A;  4P9L A;  1TG7 A;  3ZMO A;  1L7L A;  1NCR A;  1CAX B;  1YC6 1;  1U0A A;  1ZZ7 A;  1QH7 A;  2A3Y A;  2R7E B;  4QGN A;  4GMP 3;  3D0S A;  2DUP A;  5A3P A;  2D97 A;  2WKK A;  4WVM B;  1JYT A;  1GQG A;  2XWJ B;  1DZT A;  4CPB A;  1GZW B;  2FDH A;  1AL2 3;  4QHB A;  1OXC A;  1ZM1 A;  2BUK A;  3C7F A;  3J7H A;  1KRI A;  2EA7 A;  3AP5 A;  3K4Z A;  4LK6 A;  1VE0 A;  2WNV C;  1LU2 A;  3U4S A;  1O8P A;  4PIY A;  3VBF A;  2OPW A;  1US3 A;  2ZEX A;  4LPL A;  5EZW A;  4K40 A;  3ZIX A;  2JG9 A;  2H0B A;  5ACA 2;  5JXI A;  2C5D A;  3IMM A;  1NKG A;  5FK8 A;  1W05 A;  1XNT A;  4ZHN A;  4QX0 A;  3ZSM A;  4FTB A;  3E97 A;  4XC9 A;  2GAU A;  2P34 A;  1EV1 1;  2WWS A;  3O0W A;  1UL9 A;  2WN3 A;  4O9G A;  5KC5 A;  2P3K A;  4OQ9 A;  1WW7 A;  3GHM A;  4DEQ A;  3M70 A;  1RVF 3;  2GMP A;  3N7L A;  1HW5 A;  4YYO A;  4AQT A;  5JOY A;  1XSR A;  1HQN A;  2RR1 3;  3G7D A;  1NZI A;  3ACI A;  3CJI A;  1H2M A;  2QQW A;  2R32 A;  2WT1 A;  4CDX A;  4OCT A;  3K51 A;  2TEP A;  4NPR A;  2W1Q A;  4BQ4 A;  1HB1 A;  1NA1 B;  4GWN A;  4JCK A;  3JB8 A;  4R52 A;  4M3C B;  2B46 X;  4PQQ A;  4W4Z A;  1PVC 1;  1RB8 G;  5DZF A;  4D3W A;  3R0R A;  4YGE A;  5KR7 A;  1CAV B;  2BBV A;  5FLI A;  1NY7 1;  1WW5 A;  4NHK A;  5FYC A;  3I54 A;  4XFF A;  3HOB A;  2JWP A;  4E8D A;  1MS1 A;  3N7M A;  5FZ6 A;  1TMF 3;  1H8T C;  1YQ6 A;  2PAK A;  2AEN A;  2OUH A;  4QPW A;  1SPP A;  1OFS A;  3H1Y A;  3LGR A;  1W2O A;  1J3P A;  2RDS A;  3SNM A;  3FMG A;  4JDM A;  4HN1 A;  2A1X A;  1D4M 2;  2XG3 A;  4LMF A;  1NYW A;  5KHH A;  5JUV A;  3NV4 A;  1PM4 A;  1ENR A;  2BW8 A;  3ZXK A;  4A6O A;  4D7T A;  5KHJ A;  3AMQ A;  2VAU A;  5JR2 A;  1LHV A;  4AVT A;  5IFT A;  3KT4 A;  1J1L A;  1ASJ 1;  2WZ8 A;  3TEY A;  2ET1 A;  2VOT A;  1N1T A;  4Q4X 3;  5A32 B;  3WX5 A;  4EZH A;  2W5F A;  1H1I A;  2ZEZ A;  1VBE 2;  4HAN A;  4DXS A;  5M0T A;  5BPX A;  2X10 A;  1Y9M A;  2ZZQ A;  4YRD A;  1KGY A;  3AP6 A;  3TN9 2;  1DQ0 A;  3ATG A;  3M7A A;  1GNH A;  3VBS A;  4JGZ C;  5I0S A;  3RI8 A;  4LHN A;  2P2K A;  1UY0 A;  4LNV A;  4AEJ A;  2IWG B;  3WW3 A;  2X09 A;  5DMY A;  3LOB A;  2QDN A;  2OUJ A;  4JVA A;  5FXW A;  5HV0 A;  4IE5 A;  3WG3 A;  3NMB A;  3W5M A;  4IL7 A;  1KDK A;  4CXX A;  3ASI A;  1CJD A;  4XDO A;  3WVJ A;  3NW4 A;  2VNO A;  2WII B;  2XJS A;  1QJY 2;  3HNB M;  3KT7 A;  5DAV A;  5DZE A;  1ZRR A;  1ZNP A;  2BDR A;  2Y26 A;  5FOB B;  1JBC A;  1H9W A;  2JIG A;  4AAX A;  1WLW A;  3ZXG A;  5A33 B;  1VRH 1;  3BB6 A;  3CLP A;  1SLA A;  4XHB A;  4OVE A;  4QPG B;  4NE9 A;  3K48 A;  2QQP A;  3WNX A;  3KCY A;  3ZR6 A;  2Y6K A;  1COV 2;  2HWE 3;  4QGM A;  4AWD A;  4ZZ5 A;  3ZO0 B;  2D44 A;  1OPO A;  1MEC 1;  2BP6 A;  5C6C A;  2Y60 A;  3JXS A;  3ZFF C;  3OY8 A;  1SLL A;  4OI1 A;  1E5S A;  4JDN A;  3LOI A;  3KHB A;  5J3U A;  1ND2 C;  2W1S A;  1W9T A;  3WLU A;  3TOJ A;  5F3E A;  1JZ7 A;  2ATF A;  2J1A A;  1WCS A;  5FZO B;  3RWN A;  3VD5 A;  4KL1 A;  3U1X A;  2HWF 2;  4LA3 A;  5SV5 A;  5I93 A;  1WCK A;  5LEJ A;  3M3E A;  3DKQ A;  2XH6 A;  1RUG 3;  3HMY A;  2WYS A;  4KNC A;  3H0O A;  4AED C;  1RIR A;  1AR6 2;  5FQ0 B;  4XMI A;  1AL0 G;  2VZO A;  2DUQ A;  1SZB A;  3LFI A;  3MV1 1;  2PHD A;  3QAC A;  1UPI A;  1UZY A;  4PF5 A;  2FCT A;  3LDR A;  5A7W B;  3MDP A;  3MW4 A;  1UAI A;  3VDD B;  3UNP A;  1DBN A;  1Q5O A;  2DCY A;  2NM1 A;  4LOT A;  1UMZ A;  2VO5 A;  1QXP A;  3BAL A;  1GWM A;  3AC0 A;  4GKY A;  1R08 1;  4CEY B;  1DQ6 A;  2HWC 1;  2VOW A;  4BQ5 A;  2XXZ A;  1NCR B;  5FZI A;  1H1M A;  1H2L A;  2E33 A;  3PUA A;  2GDF A;  2OX0 A;  2WA4 A;  5IAX A;  4QPI A;  4YVW C;  1Q8O A;  2HEW F;  2VQA A;  3DXU A;  1OF3 A;  1XU2 A;  2R6Q A;  4R9B A;  4OHW A;  5JSP A;  4D7Y A;  3RWK X;  1PIV 2;  2IXH A;  2V4A A;  4GKX A;  1H9P A;  3GGL A;  4LA2 A;  4N9H A;  3VZM A;  1ZBE 1;  2ZX0 A;  2VMI A;  2O14 A;  4P00 B;  5IUQ A;  4QU2 A;  1B09 A;  3T2T A;  5C71 A;  4DQA A;  3HN1 A;  3WR0 A;  3FZ3 A;  4LR4 A;  2CGN A;  4Q5O A;  2BEO A;  3HR9 A;  5C70 A;  3EBR A;  1LJ7 A;  2Y0O A;  3VBF B;  4FBF A;  4ES9 A;  4F3J A;  3KVA A;  3K77 A;  1JYX A;  3THP A;  2JX9 A;  3I2I A;  1FMD 1;  2JG9 B;  4AFB A;  2QQN A;  4F83 A;  2A6W A;  3AMP A;  4FPH A;  1YJK A;  2ENR A;  5HCB A;  1W2N A;  5F37 A;  2GP3 A;  2VG9 A;  2D6O X;  2V4V A;  3W5N A;  4AVB A;  3PUQ A;  4YM1 A;  4Y33 A;  5FZE A;  4E2Q A;  4UI9 L;  1DF0 A;  3UKN A;  1S0J A;  5EPA A;  1W6M A;  1R1A 1;  3ILF A;  3LIG A;  1DLL A;  4GA9 A;  4NIH A;  5DZG A;  2I2S A;  2YC2 A;  1DCS A;  3D82 A;  3CJI B;  4CE8 A;  4CDX B;  2JD4 A;  4UW5 A;  2XL7 A;  1LB2 A;  5BNO A;  2W94 A;  4JAA A;  3A0K A;  3OBR A;  3WNO A;  1W06 A;  1C57 A;  2QJV A;  2W3J A;  3R05 A;  4GMP 0;  2TNF A;  4TXW A;  5JXJ A;  4KBB A;  2Q0A A;  2VVD A;  2D6K A;  2WL1 A;  5FXZ A;  1YFX A;  5A6Y A;  3VBH A;  5EIY B;  4YZ3 A;  4P9X A;  2TBV A;  3T0B A;  4HSJ A;  1HV1 A;  4Y20 A;  1J1T A;  1PO1 3;  2D93 A;  5F3G A;  1SPP B;  3PHM A;  4LOR A;  4OHZ A;  2DCK A;  4BCU A;  1IG3 A;  2PLV 2;  5A80 A;  4BQX A;  1SG3 A;  4P02 B;  3FWE A;  4EQV A;  1TME 2;  2OII A;  1IOA A;  2EIG A;  2ZHM A;  1SBE A;  4M0H A;  1MS5 A;  2A75 A;  5GKA C;  1UU6 A;  1N3Q A;  1Y43 B;  4Q4Y 2;  2PAM A;  3M2M A;  1XNB A;  4QHZ A;  4QAW A;  2Y6G A;  3JU9 A;  3AKS A;  3CJX A;  5K9Y A;  2QQU A;  4E2S A;  3JBG 3;  4UW3 A;  5F39 A;  1RHI 1;  2WQ8 A;  4WVZ A;  4D69 A;  1O3Q A;  5FUI A;  4YGD A;  1W2A X;  2R30 A;  4EN9 B;  1Z78 A;  3IWZ A;  2VBP A;  3RJR A;  5EQU A;  3VZN A;  2ZMK A;  3UL2 A;  1OQE A;  5FYT A;  1DFQ A;  1AX0 A;  1QF3 A;  1EUT A;  1R09 2;  2JG8 C;  3AZX A;  1XJA A;  3KLS A;  2Q5T A;  5F3C A;  1RUJ 2;  1EY2 A;  4XAB A;  3V0B A;  3VBS B;  2VMF A;  5E88 A;  5AVA A;  3I2O A;  2WUH A;  4CCK A;  4P9Y A;  1WA6 X;  4XET A;  2A71 A;  2BGC A;  2ZX1 A;  3URF A;  1QWR A;  3FFQ A;  2NZ9 A;  2OYZ A;  1ND2 A;  3NNM A;  1O6U A;  3HN3 A;  2WC2 A;  1TZO A;  2XL9 A;  2YG0 A;  3CHX A;  3WQB A;  2E51 A;  2VZT A;  2BJS A;  1VJ2 A;  2BGO A;  3S5Q A;  2RE9 A;  1BJQ A;  1YCI A;  3LF7 A;  3PVB B;  1UX7 A;  2D6P A;  3KVB A;  2YGM A;  4A41 A;  3PUS A;  3E5Q A;  4B8E A;  4LBQ D;  1A8M A;  2F6B A;  5GZD A;  2X5I C;  4PIX A;  3U07 A;  3DYP A;  3QOP A;  3H7J A;  3OY8 B;  4Y1Y A;  1RUC 1;  1T6G C;  4Q4V 2;  1X33 A;  4ZZ8 A;  4A44 A;  4DIN B;  4YW7 A;  2Z42 A;  5A3N A;  3O1U A;  2J1R A;  3KGL A;  3J8F 2;  5IVV A;  4FPK A;  4HBN A;  3ZXL A;  1CZV A;  1XXN A;  5LY2 A;  4B4P A;  3SIT A;  1YNA A;  4MGS A;  4ZU5 A;  2ZPX A;  3RMX A;  3OCP A;  5BXX A;  3JQX A;  3LEK A;  1VMF A;  2XBO 3;  3BOW A;  5FMO S;  4Q8K A;  5FZ9 A;  4A4A A;  4N53 C;  3PUR A;  3B01 A;  1M4W A;  4HVR A;  2R04 1;  3SXW A;  1PGL 1;  3KHC A;  1VBA 2;  1UYX A;  1UXX X;  2HBU A;  1BVP 1;  3OG2 A;  2R06 1;  1RUF 2;  5F32 A;  3V64 A;  1PMJ X;  3B7M A;  4L9B A;  2BQP A;  3UGG A;  3ZYG A;  4CCD A;  1GNZ A;  1F9K A;  1LGC A;  2UYB A;  2O0O A;  5T55 A;  4YG6 A;  5EP9 A;  4UBG A;  2XHN A;  5LW9 A;  4QPI B;  4PQ9 A;  4YNI A;  4NID A;  3PDQ A;  1V00 A;  1DGW X;  5FTT C;  2WZR 3;  1UY2 A;  4BQY A;  1WMX A;  2ADE A;  1LGB A;  3POY A;  2DCZ A;  5FXX A;  2ZXQ A;  4C1X A;  2ARA A;  3I3D A;  5I8Y A;  2CU5 A;  3OYW A;  3ABZ A;  3H1M A;  1UX6 A;  3PME A;  4COU A;  2CAV A;  4GZ9 A;  1D4V B;  2YHJ A;  1RYY A;  1HRI 2;  1W8N A;  2D6N A;  5DG1 A;  3PJY A;  2VUD A;  1NUK A;  4YZ1 A;  1C3H A;  1S55 A;  3VBR A;  2Z69 A;  2KD7 A;  4MXW A;  3FC0 A;  1W0O A;  3FHA A;  3RG0 A;  4Y5S A;  1I5Z A;  1GOF A;  1HX6 A;  2VMD A;  1BLZ A;  3EYP A;  4FQZ A;  3WF3 A;  3ZIW A;  3DXT A;  5FBJ A;  1UZV A;  2QQO A;  4A6S A;  4M3C F;  1QJU 3;  4ERO A;  3A0N A;  2C0Z A;  3FJS A;  3UGF A;  1YI7 A;  1MVQ A;  1W6M B;  2DWR A;  2XVL A;  5JIA A;  1GUI A;  1OI6 A;  4NR1 A;  3CZU A;  2PQQ A;  4MXV A;  1JI6 A;  3NNJ A;  4DIQ A;  2ZBJ A;  1AR8 2;  4EWE A;  4UOJ A;  5FP7 A;  5BNO B;  3NJV A;  2AH2 A;  1BBT 1;  3POB A;  4CCO A;  5EXO A;  5IT6 A;  1UZZ A;  4LHL A;  4PI0 A;  2VVF A;  1TEI A;  1H1A A;  1KJL A;  1LHN A;  2OQ6 A;  2A5Z A;  1EP0 A;  4CDW A;  5C4W A;  4LO6 B;  1BEV 3;  2J1U A;  2W0X A;  3VZL A;  3VBH B;  4LO4 B;  5GLW A;  1AR7 2;  3SLI A;  4YLZ A;  4CUB A;  1NA1 C;  4UXA A;  4P9J A;  1V6I A;  4Y20 B;  3W59 A;  2VH9 A;  5JZG A;  1VBC 3;  3HBZ A;  5CIR A;  4E2G A;  2PHU A;  1NXM A;  4XZP A;  2WFF 3;  4GB3 2;  3CZJ A;  4IEY A;  3TEX A;  4RHV 3;  2ZGO A;  3WDT A;  5DUV A;  1ONA A;  1JYI A;  4FFG A;  4XMA A;  1MR5 A;  1C28 A;  5KXD A;  4GQ7 A;  5JMO A;  2ZEY A;  5JI9 A;  2IXC A;  1OQ1 A;  3Q8A A;  4Y1Z A;  3RMY A;  5J48 A;  4K3U A;  3U75 A;  1JZ3 A;  3VUO A;  2H6B A;  1AYM 3;  3JZV A;  5CBL A;  4XJW A;  4GXL A;  2WS9 2;  5C3R A;  1MQT C;  3A22 A;  4Q27 A;  4BZ4 A;  3O1R A;  1DDL A;  4E8C A;  1LRH A;  4Q1P A;  2EIC A;  2ZGL A;  3OGJ A;  1DYK A;  1HRV 1;  3ZFG A;  2RM2 3;  2ZAA A;  3J7N A;  3V0B B;  1Z7S 2;  2CY6 A;  3PLQ A;  4QT6 A;  5FY0 A;  3VB9 A;  4KMQ A;  1AX2 A;  1YFW A;  4AOC A;  5IVB A;  4BWO A;  1G8W A;  2HWB 2;  2VUL A;  1QKQ A;  4B4R A;  4YM3 A;  4QM9 A;  1C5I A;  4KWK A;  1POV 3;  3HQX A;  3K2O A;  5FPV A;  4IGP A;  2WFP A;  1OUX A;  2XUE A;  2W87 A;  5FYB A;  2PFW A;  1FNY A;  2DF7 A;  2H6C A;  1MS3 A;  4Q26 A;  4XDP A;  2Z4F A;  1WBL A;  3GCX A;  1RXF A;  2EAA A;  2XJR A;  2WO1 A;  5F1R A;  3B94 A;  5H9P A;  3DEM A;  4AHW A;  5LY1 A;  4AGR A;  1XE7 A;  4I01 A;  3ES4 A;  1FV3 A;  2X8K A;  1FPN 3;  5LAT A;  3V56 A;  1SBD A;  4GWJ A;  4X6R B;  3LA3 A;  1ENS A;  1O8S A;  4LQR A;  1GQP A;  4QPG C;  4XAC A;  5ANQ A;  4FO9 A;  1VBB 2;  1ZZB A;  4H3W A;  1SAC A;  4QQO A;  4OI0 A;  1ULE A;  1RUD 2;  4WM8 A;  2HBT A;  4JRL A;  3GDB A;  1ENQ A;  4YG3 A;  4XAE A;  4CVU A;  1ULD A;  3M3O A;  2R07 2;  5IVE A;  3KCC A;  2WZP P;  1UOJ A;  1QHD A;  2GZW A;  2VPV A;  3AL6 A;  5A6Q A;  5LK5 A;  1AHS A;  1K5M A;  2AC1 A;  5JLV A;  5F7U A;  1K45 A;  5FP9 A;  3FBY A;  1O3S A;  3JCI A;  2JDP A;  4HN0 A;  3P5B A;  5GAL A;  4BIS A;  2BRT A;  2VTF A;  3KQR A;  4FP3 A;  4GD4 A;  4IEV A;  4XF1 A;  2A6X A;  3C7O A;  3UKV A;  5I0T A;  4CP2 A;  4FTE A;  1RJ7 A;  3WP6 A;  5AC9 1;  1DYP A;  1DZQ A;  1REE A;  4R4X A;  3BU0 A;  5FP8 A;  4DZG A;  5A7O A;  4Y4R A;  4QKD A;  5FKB A;  1S0B A;  3AZV A;  5D8A A;  4UFH A;  3VDD C;  5KC6 A;  2DUO A;  4YM2 A;  1LR5 A;  1VBD 3;  2B9V A;  3FE5 A;  3HWJ A;  4KU7 A;  2CYF A;  1LHW A;  3CDZ B;  5C9A A;  1FI2 A;  3AZY A;  3OYW B;  3O0X A;  4RFT 0;  4CEY C;  5JOZ A;  3BIE A;  4XVH A;  4BXS V;  3JUU A;  3POF A;  2QFE A;  1HXS 1;  1EV1 3;  1NCR C;  3M4F A;  5CAZ A;  4DXZ A;  4CDU B;  2P3Y A;  2DVG A;  4LEJ A;  3VZJ A;  3AP7 A;  1SLC A;  4OHV A;  3VBR B;  4W65 A;  1WMF A;  4MXW B;  1ULG A;  3NAP B;  1JOP A;  3UET A;  1QOT A;  5DDJ 1;  2PAE A;  4IE0 A;  4IND A;  1OA4 A;  1S0G A;  4DB5 A;  1XC6 A;  3ETP A;  3POJ A;  1N3P A;  3LEM A;  5F2S A;  4LTA A;  5FWE A;  3WNM A;  4ITC A;  4JGY A;  3VBF C;  3F95 A;  2VR4 A;  1AR9 2;  2XVG A;  4E27 A;  1QEX A;  3B9C A;  1PVC 3;  4BIF A;  2JG9 C;  3LSE A;  5FZF A;  4CTE A;  1PZ7 A;  1H8V A;  4HFS A;  1OLM E;  4CXW A;  3PUH A;  1UWW A;  5FUN A;  5FY4 A;  1W6Q A;  1JYW A;  1PHM A;  1F4A A;  1JOD A;  1JTZ X;  3LKJ A;  1YIP A;  4YFW A;  3RYP A;  3BTY A;  2ZGQ A;  4MVT A;  1C1L A;  1AJO A;  1YI9 A;  1OHF A;  2G4I A;  3I3E A;  2W1W A;  3T30 A;  4CDW B;  2DBN A;  2YPD A;  5C4W B;  1UNB A;  2IZW A;  3DYO A;  5FRA A;  1GQH A;  3VKF C;  1ACC A;  5FZC A;  1FXZ A;  2BGP A;  4CDX C;  1DGL A;  2JDN A;  4EZ4 A;  1GP6 A;  5JVV A;  1QNW A;  2EVX A;  2ID4 A;  3DKW A;  1MQT A;  4M0N A;  3T2Q A;  1RUE 1;  3M8L A;  4AG4 A;  1BYH A;  5A3W A;  3AZW A;  4ASL A;  2IXL A;  5JZG B;  3M3Q A;  5KBF A;  5JWP A;  5EHD A;  4NRQ A;  1V6O A;  1ASJ 3;  4AXO A;  3OPZ A;  2CWS A;  2JDK A;  1IGO A;  4I3G A;  5L73 A;  3AMH A;  4QKF A;  2Y33 A;  4AL9 A;  2DFC A;  2Q1Z B;  3I3M A;  5TSW A;  2VMH A;  4DXT A;  2ZX2 A;  2JDH A;  3LB9 A;  3OGR A;  4XF9 A;  2VCA A;  4RHV 1;  4XE9 A;  5FZL A;  1T2X A;  2DVA A;  5FZG A;  1JH5 A;  4B1M A;  2O8Q A;  3UYJ A;  4D94 A;  4NRM A;  4FSJ A;  1X82 A;  1FOD 2;  4KH9 A;  5FY1 A;  4JKL A;  1O59 A;  4UW4 A;  5ERL A;  5I0D A;  3ZFG B;  3DPR A;  4K1Y A;  1HN1 A;  4OUS A;  2RDQ A;  3WT3 A;  4AVA A;  3LZZ A;  2ZGP A;  3ROU A;  2PQS A;  1VRH 3;  2ZGR A;  3H8U A;  5CB7 A;  2A3W A;  4LUL A;  5BV6 A;  4A7Z A;  3KD4 A;  1S0D A;  1MEC 3;  2A73 B;  4QHO A;  4UFI A;  4XCB A;  4UT5 A;  2R49 A;  3VBO A;  5FPX A;  3O1M A;  1W6P A;  4YZ4 A;  1CAW A;  3UV9 A;  2CTV A;  2GN3 A;  3IN9 A;  3VBS C;  4CYD A;  2NYY A;  4LE4 A;  1W9W A;  3C7E A;  1POV 1;  3WQ0 A;  5FPA A;  5F6L B;  2RS1 3;  1X36 A;  3BYW A;  1H6Y A;  2GAL A;  2WYF A;  5T5L A;  5CEH A;  4OI4 A;  3DCQ A;  1YQC A;  1FNZ A;  2OXB A;  1Q8Q A;  2D40 A;  3GBW A;  2QQV A;  3FL7 A;  2AYH A;  1AYN 2;  3T4H B;  1UOB A;  1YFU A;  3ZSL A;  5H9S A;  5K8S A;  3ZXF A;  1GV9 A;  4A3X A;  1LOF A;  1ULC A;  2J1V A;  3WUC A;  1NG0 A;  4CEW A;  2K9Z A;  3PL0 A;  5IVF A;  3WNL A;  4LKE A;  2O1Q A;  1FPN 1;  3SEP A;  4IXL A;  4WM8 B;  5T5J A;  1OBN A;  2EF6 A;  5J36 A;  2RMU 1;  2VZV A;  3NKG A;  2VXR A;  1RJ8 A;  3E6B A;  1QJX 1;  1R08 3;  2A7A A;  2OZ6 A;  2EID A;  2YDE A;  5HXM A;  2JKX A;  2HWC 3;  4QX5 A;  3VDD A;  1WLC A;  3ZFE A;  4URT A;  3RRD A;  4UFK A;  4CU9 A;  1K5M B;  4KWJ A;  2W1U A;  4AQ6 A;  1RUI 2;  4IET A;  2P17 A;  4IEO A;  2RG4 A;  2ZAB A;  4LKF A;  5F5Q A;  2LW8 A;  5FZB A;  1W8T A;  1CIW A;  4ZON A;  2FMD A;  4W6Y A;  4YVS B;  1AUY A;  1BVV A;  1OKO A;  1ZBE 3;  2H0V A;  5FYS A;  2UY8 A;  5FJK A;  2VZQ A;  2WQ4 A;  4MGT A;  3ZVX A;  5D8A B;  5ACA 3;  1I6X A;  5FWJ A;  4RQP A;  2E32 A;  4QXK A;  4HON A;  2AEZ A;  2YZ4 A;  2WSV A;  1BK1 A;  1FMD 3;  1BHG A;  5C9A B;  4OHY A;  2W92 A;  1IPK A;  1ZA7 A;  4J6G A;  4L11 A;  1VBD 1;  3MIH A;  3VLB B;  3VHR A;  5JOW A;  2RS5 1;  1N1S A;  3IAQ A;  2RS3 2;  4QPI C;  4Q4W 2;  2Y6H A;  3MYX A;  4CU8 A;  2HLE A;  2O8O A;  2MEV 2;  5FV3 A;  2Q1F A;  1R1A 3;  2BFU L;  3BTX A;  4RL7 A;  5JI7 A;  1UMH A;  3AKT A;  1MZF A;  3NST A;  4DRR A;  2XJV A;  2IFR A;  4NAO A;  5DQ0 A;  4BOW A;  4QXC A;  1RL3 A;  1X9P A;  1I9R A;  4CA9 A;  2EIE A;  3FFZ A;  2JEN A;  5FMB A;  1J84 A;  3WQ7 A;  4JGY B;  4AK3 A;  4LHS A;  3RSJ A;  4P9G A;  3WP5 A;  2DBI A;  4S2H A;  2PHF A;  3NVC A;  3RZZ A;  2B5H A;  2PYT A;  3HNY M;  4WV8 A;  1C1F A;  4MOA A;  1AL2 2;  2ZA9 A;  5A3O A;  4TWT A;  1Y9Q A;  3AKP A;  3KB5 A;  1DQ4 A;  1W6Q B;  1CES A;  3N9L A;  3QH6 A;  2WRA A;  2WO2 A;  4LIU A;  3S6P A;  5KWR A;  1JXN A;  4K7J A;  4XJZ A;  4A45 A;  4A42 A;  4LLF A;  1PGW 1;  1W3X A;  4RSU A;  2VY0 A;  3BOP A;  5LBF A;  1VAK A;  4WVW A;  5BNO C;  1TE1 B;  1MQT B;  2VUJ A;  1RHI 3;  5ANN A;  4C0B A;  3PTY A;  4COZ A;  3T3Y A;  1C8M 2;  1QQP 2;  1LES A;  4PBO A;  3ZXD A;  1RVF 2;  3GYD A;  5A3M A;  3H8R A;  4NRO A;  1M06 G;  2EXK A;  1WLT A;  4D6Q A;  3VBH C;  2RR1 2;  5IVY A;  1ZBA 1;  2G19 A;  4FVV A;  1OVP A;  4LBN A;  1KS5 A;  3WHT A;  1IKP A;  2GC0 A;  4QPY A;  4XPV A;  4YZ5 A;  3MF9 A;  3SH3 A;  2ZML A;  3WF4 A;  2Y8K A;  3ZMN A;  4DMI A;  4Y3O A;  3RZH A;  3JD7 1;  5IK8 A;  1HJG A;  2A70 A;  2WN2 A;  1YIF A;  1UIJ A;  2DDU A;  4XUR A;  1H4H A;  2BWC A;  2BYV E;  3RQ0 A;  1BKZ A;  1YHF A;  5ABJ A;  3DPR B;  4CU7 A;  4HVO A;  2BBA A;  1TMF 2;  2YU1 A;  1KJR A;  4MUV A;  1SDW A;  3A21 A;  5DUU A;  3I4I A;  4AI1 A;  4B3N A;  3ACF A;  5EWS A;  3K46 A;  4NHM A;  2XJP A;  3VBO B;  1W6P B;  3O14 A;  4FI9 A;  1CAW B;  1RUC 3;  5FZD A;  3GCW A;  1DZR A;  1RIT A;  2R0F A;  4YW1 A;  5LA2 A;  3WDW A;  4ZPI A;  3R4S A;  2E31 A;  3IM0 A;  1S2K A;  4RR3 A;  3X29 B;  5J09 A;  4RD7 A;  2Q8O A;  4C91 A;  4QDS A;  4Q4X 2;  4UAP A;  3KV4 A;  2RS1 1;  1OLM A;  1V9U 1;  2XLF A;  2E26 A;  3AFK A;  2XQR A;  4NHL A;  4XIO A;  4CEW B;  3VGI A;  1WCD J;  2W52 A;  4LO5 B;  4AVC A;  1Z0H A;  2R04 3;  3I3Q A;  3OGG A;  3VKM A;  1Y9G A;  3WDY A;  2G9F A;  2MPF A;  4GH4 A;  4MGQ A;  3UES A;  4AHY A;  1EAH 1;  2Y34 A;  4SBV A;  5E89 A;  4JC1 A;  4D6R A;  2WNE A;  4HPK A;  5L9V A;  2R06 3;  1HN0 A;  4AYU A;  1GMM A;  4HG6 B;  4LBM A;  4HL0 A;  2JEM A;  2I07 B;  4I0W B;  4IQP A;  2CHH A;  1UF2 C;  1MZE A;  1UCX A;  2VCC A;  5A70 A;  1RUI 1;  3ZFE B;  2VZS A;  4QX1 A;  4B7E A;  1PIV 3;  3V0A A;  2HWE 2;  4FAG A;  1J59 A;  3ACH A;  3I49 A;  4IE7 A;  1JZ2 A;  1OA2 A;  3B00 A;  3WCR A;  1HB3 A;  1IKQ A;  1J3R A;  2C6S A;  4OHX A;  4Y1U A;  4BK4 A;  4CXY A;  1GWL A;  2NMO A;  3TYJ A;  4QWN A;  4RQP B;  2DCT A;  4ARX A;  4DRV A;  4FXG B;  3O7O A;  2C1F A;  2XQX A;  1RC6 A;  4FFH A;  4I0B A;  3WW4 A;  1V70 A;  4BLJ A;  4UFM A;  4DOU A;  1RUG 2;  4Q4W 1;  5ACA 1;  3CO2 A;  4ORF A;  3HIF A;  2HH9 A;  4AVS A;  3IPV A;  5IK4 A;  2FMY A;  1WGP A;  5EYY A;  2E63 A;  4R9D A;  2VQ0 A;  1RTV A;  1UD1 A;  1A8D A;  3CMG A;  3A7Q A;  4M01 A;  5FYU A;  3AJZ A;  3UKT A;  3LPF A;  4DXR A;  1KD7 A;  1CAU A;  2OS2 A;  2GH8 A;  4O7X A;  5FPL A;  4ASM B;  1QOO A;  4JQR A;  4OLL A;  3WP3 A;  2GP5 A;  2C9A A;  2JDU A;  2ORX A;  4AFA A;  3U11 A;  1NAE A;  1BBT 3;  4BK5 A;  1NLR A;  1VLN A;  4QXB A;  4CDU C;  3P3P A;  1JYN A;  2XB6 C;  1OKQ A;  2AR6 A;  1ODN A;  1CZS A;  1XOY A;  3GXU A;  5F5A A;  3VBR C;  3MIE A;  4OFG A;  2AZ5 A;  2YUE A;  3DUI A;  3NAP C;  2LAL A;  2YBK A;  4Q1R A;  3LEG A;  4XF3 A;  3WDX A;  1H2K A;  1AVB A;  2UYA A;  4MLO A;  2XUM A;  2WNO A;  1ULF A;  5FY8 A;  1JOB A;  3ES1 A;  4JZR A;  4PJY A;  5FPU A;  3PNA A;  4I0A A;  1A34 A;  1U5I A;  4TSV A;  4UBH A;  4KU8 A;  4N9I A;  3TRS B;  4GIQ A;  3OSD A;  4H7L A;  3E5X A;  4RN5 A;  4UFJ A;  5G05 L;  4P5H A;  2KXL A;  3AVS A;  3WOG A;  1D4M 1;  2AAC A;  2RJ2 A;  3I3B A;  5FZ4 A;  2VUA A;  1JZ8 A;  4E4D X;  3PUI A;  2VNG A;  4HET A;  4XUT A;  5GLU A;  2G1M A;  1ST8 A;  2YY1 A;  2RJK A;  2VVE A;  5GZF A;  3N9O A;  3WQ1 A;  3O1P A;  1YXW A;  3T0A A;  4CZS A;  5G04 L;  5A7P A;  1Q8S A;  4CDW C;  5C4W C;  3I2H A;  3S5A A;  4NHX A;  2D5F A;  3OBZ A;  1VB4 A;  1VBE 1;  5FMC A;  2YBS A;  4N8M A;  4QB6 A;  1HRV 3;  1U5X A;  2PEL A;  4EWA A;  3KV9 A;  3MPP G;  4PLO A;  4XUN A;  3TN9 1;  4BIO A;  4FOQ A;  4XEZ A;  1FYU A;  4YFZ A;  2DCJ A;  5JZG C;  1SLT A;  4UFL A;  3AP4 A;  1LED A;  3UJQ A;  1X9T A;  2VNR A;  1GLH A;  1V0A A;  2WLQ A;  2VZ3 A;  4IV3 A;  1JOJ A;  2QVS B;  3PTR B;  3POE A;  2LS6 A;  3D3A A;  4NPL A;  3I59 A;  5FZ0 A;  3WCS A;  4AEK A;  5ABJ B;  1W28 A;  1XE8 A;  2YC4 A;  1QJY 1;  1JU3 A;  1VP6 A;  3III A;  2G9Z A;  4FFF A;  1PO1 2;  2ORZ A;  3HD8 B;  5LK7 B;  2AGS A;  4Q0P A;  4UF0 A;  4UYB A;  3ZYP A;  1G9D A;  2VOX A;  5CNA A;  1IG0 A;  5CFC B;  2FDG A;  1COV 1;  2NPI A;  3PIG A;  5CKM A;  3J8F 3;  4A7Y A;  3J26 N;  3ZFG C;  1NE6 A;  3IAP A;  4YWA A;  1O7F A;  2ZHK A;  3BTA A;  4KGQ A;  4XTM A;  4AF9 A;  5KXE A;  3S57 A;  1I5P A;  1K42 A;  3JBG 2;  3WY6 A;  4NN0 A;  4DUX A;  2VCM A;  2VZ1 A;  2Y64 A;  1NX9 A;  5L7O A;  1PVX A;  1VPH A;  4RR3 B;  3AMM A;  5FAX A;  2E6V A;  3MO4 A;  3POS A;  4K8F A;  2PHR A;  1WA4 A;  5DUW A;  2HWF 1;  1HQL A;  3I2K A;  1W8F A;  2IC1 A;  4FXK B;  1JZ5 A;  3EMR A;  2JIC A;  5T3N A;  1VBA 3;  4AVV A;  5FXV A;  4AFD A;  4BLI A;  2EXH A;  3AJY A;  3TNP B;  1AR6 1;  4BQ3 A;  4H14 A;  4EJR A;  1V6K A;  1KEX A;  2EAK A;  4GH4 B;  4E4S A;  4I09 A;  1LU1 A;  1DQ1 A;  4HPK B;  5HXV A;  4MO3 M;  2QCS B;  4XZU G;  5CG8 A;  2XKO A;  5J37 A;  1ZYB A;  3VBU A;  3K4A A;  5AC9 3;  5E1R A;  4AQS A;  3P3N A;  1SDD B;  4LXL A;  1O3R A;  5I91 A;  4LO7 A;  3V0A B;  3O1O A;  3POI A;  5A7N A;  4WM8 C;  2DFB A;  4XHX A;  3WSO A;  4CPB D;  4ATF A;  1YJL A;  1PIV 1;  5DN2 A;  4B1L A;  4PDW A;  1JN2 P;  1HXS 3;  3OBT A;  2FCU A;  1WD3 A;  5F5I A;  4KWL A;  4CU6 A;  1K5J A;  1U5Y A;  5AFE A;  1K5M C;  3NNG A;  4JKK A;  1D2Q A;  4BH9 A;  1QDC A;  1XB9 A;  1D2S A;  2FDJ A;  2VL4 A;  1MPX A;  3ZN6 A;  2F4L A;  5LRS A;  3N9P A;  2Q4S A;  4Q0U A;  4Q29 A;  3VHP A;  3E6C C;  4YVS C;  4CDU A;  2YB7 A;  3LD8 A;  1GAN A;  2XBO 2;  5H9R A;  5DDJ 3;  1J3Q A;  2XGX A;  2Z79 A;  4Y22 A;  3BGA A;  2BVB A;  3IPV B;  3NAP A;  3ETQ A;  4Y1V A;  1UW8 A;  4EN0 A;  3D6E A;  5D8A C;  5H9Q A;  3MZH A;  3RDI A;  1FAY A;  3O5S A;  4L92 A;  1LTE A;  1LAJ A;  1W8W A;  5C3O A;  5GZE A;  4TZD A;  5C9A C;  4CCE A;  1CAU B;  1YYN A;  3AL5 A;  1QIQ A;  5BYN A;  5CVR A;  5JR7 B;  1S1A A;  2JDA A;  2DTW A;  1XQN A;  2FQP A;  4QGL A;  4R9C A;  3NV1 A;  2WR9 A;  3INA A;  3KZ4 C;  1AJK A;  2QUO A;  3OF1 A;  5K7P A;  3M1H A;  1OLR A;  2ZMN A;  5CU1 A;  4AW7 A;  2WZR 2;  1CPM A;  1QU0 A;  1PK6 A;  1PM7 A;  2IXI A;  2R1D A;  4K21 A;  1GZC A;  1ZRC A;  1WD4 A;  3J7M A;  3ON7 A;  2N7G A;  4QKB A;  4EYU A;  2GNB A;  2B39 A;  2J42 A;  4FPC A;  4OZX A;  2ZKL A;  2WIN B;  3ZPO A;  1RUE 3;  1MAC A;  1OH3 A;  4JGY C;  4XFB A;  1JYC A;  2B9U A;  1GNY A;  3VDA A;  1UIK A;  2PLV 1;  2XDV A;  1V6J A;  3TB0 A;  1W03 A;  3KS7 A;  2OA2 A;  3LPG A;  3RJ2 X;  3U14 A;  1TME 1;  3RZK A;  1ENX A;  3AVR A;  3RZJ A;  1LHO A;  4QQP A;  1QOS A;  4GWI A;  4X8N A;  4X8P A;  2XJU A;  4Q4Y 1;  5FZH A;  1L7Q A;  2XPJ A;  1W8O A;  1DQ5 A;  2BNM A;  1EPW A;  3SQO A;  1MS8 A;  2YFZ A;  3VL8 A;  2X53 S;  3ZDV A;  2QQJ A;  1QJU 2;  3D4K A;  3BUC A;  3H50 A;  3AYC A;  2GU9 A;  5BUV A;  2CWM A;  2VCB A;  3MUZ 1;  4ZS2 A;  2IUW A;  3MI8 A;  4LO8 A;  3K75 B;  1R09 1;  4XJ8 A;  1E5H A;  4BJ0 A;  3ALQ A;  3CL1 A;  4YM0 A;  1RUJ 1;  2XWB B;  1PGS A;  4AI8 A;  4LK7 A;  3FHI B;  4CUA A;  2DVD A;  3VD7 A;  1A3K A;  3FLR A;  5JSR A;  1MS9 A;  4HK9 A;  4OMC A;  1UYZ A;  1OUR A;  1F31 A;  1VMJ A;  4IV3 B;  2ZKN A;  1JHJ A;  1KIT A;  5FYI A;  5I8S A;  5CIS A;  5B4N A;  4V1P A;  1BEV 2;  4ZKT B;  1O5L A;  3I59 B;  3W20 A;  1G9F A;  3WW2 A;  2RDN A;  4FCA A;  4IUG A;  3Q8B A;  5BNQ A;  1GP5 A;  3IDA A;  2WNU A;  3MIF A;  3PMS A;  2D3R A;  4AGV A;  4ET7 A;  2A3X A;  3LFM A;  3WP4 A;  1VBC 2;  3GNE A;  4UF0 B;  4FPY A;  3MID A;  2LTN A;  3PIJ A;  4GAL A;  5FJH A;  2HKX A;  4EE2 A;  1S0I A;  1XYO A;  4PI2 A;  2WFF 2;  4F7Z A;  4YW2 A;  4BQW A;  5FO8 B;  3RVH A;  5IYY A;  4HKO A;  2VNV A;  1G9C A;  1RGS A;  2JE8 A;  1UYY A;  2XKP A;  3DPR C;  2D3S A;  3MUY 1;  4NPM A;  2ZCW A;  2OQ7 A;  2GMM A;  3OUI A;  4LUM A;  1UO9 A;  2J1S A;  4Q4V 1;  3RYR A;  1AF9 A;  5L7O B;  4L97 A;  3B3Q E;  3J8F 1;  3HQU A;  2ZX4 A;  4C90 A;  2WWJ A;  1KDM A;  3CIH A;  1AYM 2;  4LKD A;  3GZA A;  5FO7 B;  1W39 A;  4TTG A;  1V6M A;  4FOV A;  1YO8 A;  2RMU 3;  4XIL A;  3SC7 X;  4D6S A;  3WZ1 A;  3VBO C;  1N47 A;  4NHY A;  1QJZ A;  2XJT A;  3IB3 A;  1Q56 A;  1QJX 3;  2HWD 2;  4ONU A;  4URA A;  2BWA A;  2RM2 2;  1PZ9 A;  3D5O A;  3OBA A;  5F5C A;  1ZRF A;  4W8J A;  1ALY A;  5JDB A;  2XJQ A;  3U4X A;  4P08 A;  3T1M A;  1VBA 1;  1VMH A;  4IEQ A;  4DUW A;  4AZZ A;  1S2E A;  2JB4 A;  3RFR A;  2VME A;  4O61 A;  4D8M A;  1RUF 1;  1W90 A;  2XLA A;  1LOF C;  4CEW C;  3VBU B;  2Q8C A;  3R4U A;  3USS A;  3NV3 A;  4LHK A;  1ZZ6 A;  2C24 A;  1GWK A;  2JDY A;  5L9R A;  2WO3 A;  4CCJ A;  1PNF A;  4KI5 M;  4YVS A;  2B42 B;  5J7M A;  3BI3 A;  5J96 B;  2VEC A;  1DGR A;  2V5Y A;  1ZZ8 A;  1Y7B A;  2VBB A;  5LCW L;  2R16 A;  1W9Y A;  1JYV A;  1BZW A;  4AFM A;  5GZG A;  1LEC A;  4MHU A;  1B35 A;  2QE3 A;  4PDW B;  2D43 A;  4Y4Y A;  2P37 A;  3ZFE C;  1KS4 A;  3ZR5 A;  3HQR A;  1HRI 1;  1SCR A;  1AXK A;  4NOT A;  2RS5 3;  4P9I A;  3QCW A;  1STM A;  1PO2 2;  1UN1 A;  3OGS A;  4JX0 A;  4S2D A;  3H9A A;  4MGI E;  3ZN6 B;  1W6N A;  4DUV A;  4MAD A;  1BMV 2;  4PHZ A;  1GKB A;  2VBD A;  4QU1 A;  3C2U A;  5FDB A;  3OUJ A;  4NAM A;  4OYU A;  3MLL A;  4Y22 B;  1RXG A;  1TVG A;  4Z2A A;  3VL9 A;  2VOV A;  2DTY A;  3MF6 A;  5IWF A;  1ZVF A;  4YAR A;  4EV0 A;  5A3T A;  4RQP C;  5A6Z A;  5IAV A;  1JS9 A;  1DGR N;  1A78 A;  1DU3 D;  1ZRI A;  4P14 A;  3VN4 A;  1IPJ A;  1G6N A;  4FPF A;  1RUN A;  3CKH A;  1RED A;  3D0J A;  2ZJC A;  2FBE A;  2QQL A;  3ME2 A;  4CSW A;  1LKN A;  1AR8 1;  2B8M A;  1DQ2 A;  5L36 A;  1W2T A;  3ILR A;  4HXC A;  3RGB A;  1H6X A;  1K3I A;  1RMU 2;  4XF4 A;  5FYM A;  2K46 A;  4CDQ B;  5C33 A;  1W9S A;  1PK6 B;  4FPE A;  2BFU S;  4XBL A;  1F35 A;  3WHU A;  2YC0 A;  1P8J A;  3H42 B;  3IZO A;  3KF3 A;  1AXZ A;  4DNY A;  1AR7 1;  1YQ8 A;  1EV1 2;  1O4Y A;  4UW6 A;  3ZYH A;  4COV A;  1I1E A;  2IVI B;  1E5I A;  1WWY A;  2CSG A;  5FZ7 A;  2GNT A;  4D7S A;  3VD9 A;  4H7M A;  2CL2 A;  3CU7 A;  4AI2 A;  4GWM A;  4DEV A;  4GB3 1;  4XOG A;  4JDO A;  4QB2 A;  4HKL A;  3OEA A;  3ZXA C;  5HBA A;  5IK5 A;  3ZSE A;  4LUK A;  3MV0 1;  3IT8 A;  2BNN A;  1ZBA 3;  2W95 A;  4FFI A;  3PJQ A;  3IDB B;  4U2A A;  4MYE A;  1OT5 A;  3AKR A;  1YFY A;  1N1Y A;  4YSF A;  1UOF A;  4FAH A;  2X29 A;  3CNA A;  4QM8 A;  3PVO A;  3JD7 3;  3FBM A;  1PNG A;  1UU4 A;  2ZGT A;  3ITQ A;  4XF0 A;  3WW1 A;  1PVC 2;  2WS9 1;  3DL3 A;  3IDE A;  4ZXE A;  5BNN A;  3RZM A;  4QDR A;  3WG2 A;  4CCC A;  1O4Z A;  2LM3 A;  1LOC A;  1NY7 2;  5ISL A;  4UWD A;  5EJ1 B;  4YW4 A;  5IK7 A;  2GSY A;  4QX3 A;  1Z7S 1;  5T54 A;  4OQ8 A;  4M4R A;  5FZK A;  1UMI A;  2HWB 1;  3GHN A;  5FP3 A;  1U12 A;  3E1F 1;  2ZOE B;  3MLK A;  4QXH A;  2ARE A;  2W68 A;  4CP0 A;  3UGH A;  3THT A;  4XFI A;  2WNU B;  3GZT B;  5DAW A;  5HI0 A;  1EYB A;  3EHK A;  1CX1 A;  3WNN A;  3I2D A;  1DHK B;  1ASJ 2;  4V2W A;  3H1W A;  2VQU A;  4LBL A;  4TLF A;  5GZC A;  5FY9 A;  3WV6 A;  2WZE A;  4PT6 A;  3BOD A;  1GOH A;  1V9U 3;  4BB3 A;  5ABJ C;  2ARB A;  4AHZ A;  1IS4 A;  1I3H A;  2DU1 A;  4N7U A;  3N9Q A;  5CKN A;  1W3V A;  1EAH 3;  1VBB 1;  2GN7 A;  5CFC C;  1ZZC A;  1F2N A;  2GND A;  2EAL A;  4B7K A;  1RUD 1;  4GJZ A;  2BTV C;  3EB7 A;  4L2N A;  5EFU A;  2P3I A;  3ZXJ A;  4K6B A;  1S2B A;  4FPJ A;  3T2O A;  1WUV A;  2R07 1;  2W39 A;  1RUI 3;  3AM2 A;  5APA A;  1VRH 2;  2WLP A;  3ZDS A;  3C8X A;  3OD4 A;  2HEY F;  4RR3 C;  3O12 A;  4G9S B;  5CZK A;  4L99 A;  1MEC 2;  5LB6 A;  2ES3 A;  2RVA A;  3KV5 A;  4IEU A;  4LBQ A;  4MGZ E;  5HPO A;  2BPA 2;  3W21 A;  4BQ2 A;  4M4P A;  3FUQ A;  4Q0S A;  5F6K A;  3JQW A;  2P6C A;  1POV 0;  3MIC A;  2YPJ A;  4FOY A;  4GH4 C;  3L9J T;  1DP0 A;  4NRP A;  5I8T A;  2AUY A;  2A6V A;  2ADD A;  2ZZJ A;  2WSU A;  4XFC A;  3VHN A;  1CZT A;  1APN A;  2UUR A;  4MG2 A;  1CPN A;  5DAX A;  1F15 A;  4XYX A;  1B35 B;  1W0P A;  4Q4W 3;  4QQH A;  3WNP A;  3N9N A;  3AFG A;  5J98 B;  1O4T A;  1GZ9 A;  5C8C A;  1ZA4 A;  1W6N B;  2DVF A;  2D3P A;  1JW6 A;  3MEP A;  1IZ3 A;  1W8H A;  3P1I A;  1W8Z A;  4Q8L A;  1OA3 A;  4YPJ A;  1X7N A;  1R08 2;  3T1L A;  4HSL A;  3NV2 A;  2HWC 2;  1RUH 2;  4QX8 A;  2OPK A;  1HV0 A;  2C4X A;  2BV4 A;  2NP0 A;  4R9A A;  5C7G A;  5IAT A;  1AR9 1;  4W6X A;  5F2W A;  1LOB A;  3E5U A;  2G9G A;  4JTN A;  5DPN A;  3PVE A;  4W50 A;  5E16 A;  2WAA A;  3S7E A;  2P5B A;  1ND3 A;  3GZU C;  4YGB A;  4W6W A;  1ZBE 2;  1RMU 1;  2BER A;  2PXJ A;  3KMH A;  2VD7 A;  2Y6J A;  1X8M A;  1WMD A;  4MH0 E;  3ZYB A;  5GLV A;  3H8X A;  1W99 A;  5CYY A;  1PX4 A;  4IDZ A;  1DG6 A;  3S7I A;  5BNP A;  3J7L A;  1FMD 2;  4RS5 A;  1D4M 3;  1OVS A;  1UU5 A;  1VIW B;  2KR2 A;  4AI3 A;  3M3C A;  3I2F A;  3GJB A;  3UT0 A;  4EWD A;  1C8M 3;  2A6Y A;  2ETE A;  1QQP 3;  3OPW A;  1G7Y A;  1IHM A;  3ILN A;  5EYX A;  5A7S A;  2JKB A;  3MIB A;  4LE3 A;  2WT0 A;  1VAL A;  3KQ4 B;  4RGG A;  5FO9 B;  1MS4 A;  3E6D A;  1NQD A;  4WM7 A;  1A6C A;  2UU8 A;  1R1A 2;  4J1W A;  3ACL A;  2BZD A;  2NQY A;  1VBE 3;  4G4F A;  2KM2 A;  4LOS A;  4FP2 A;  4Z1V A;  1MZ5 A;  3TN9 3;  3GBF A;  1CJP A;  2WT2 A;  3VD3 A;  5FMD A;  2VM9 A;  3Q8F A;  4K1Z A;  1UPS A;  2QZ3 A;  1HKD A;  1MVE A;  2E7A A;  3T4V A;  3WG4 A;  5BNN B;  1FOD 1;  4H2A A;  3U37 A;  3HNM A;  4DY3 A;  2NN8 A;  2GC3 A;  2W9X A;  3I8T A;  4U36 A;  1QJY 3;  4A2U A;  1AZD A;  5F8P A;  3S0M A;  4FOW A;  4ISR A;  2W08 A;  3APB A;  1NT0 A;  4N43 A;  1JMU B;  4XFG A;  1NE4 A;  1QJE A;  1Y4W A;  1C8N A;  1CIY A;  1OD3 A;  1D0H A;  1COV 3;  1GSL A;  1HB2 A;  3W58 A;  3B02 A;  3HT2 A;  1Q8P A;  5EJZ B;  5LBB A;  5CFC A;  4IE4 A;  2ARX A;  2HEV F;  3ORJ A;  4OI2 A;  3WDU A;  3BTZ A;  4Z2W A;  1RHI 2;  2Q1M A;  1SEF A;  3AMN A;  4QX2 A;  3MGU A;  3AK0 A;  1XYN A;  2WWU A;  5KHI A;  3HPN A;  4IV3 C;  2D98 A;  4RA0 A;  4QX7 A;  4IW3 A;  4KG0 A;  4E9K A;  1CQ9 A;  1N1V A;  2HWF 3;  1AYN 1;  2YRO A;  3ENR A;  2Q8D A;  1H30 A;  1US2 A;  2F4P A;  5C3Q A;  1VR3 A;  5DAP A;  3SCG A;  3GAL A;  1AR6 3;  1IQD C;  1NCQ A;  3MIG A;  3FLP A;  4MV2 A; 
#chains in the Genus database with same CATH homology
 1V0A A;  1WZX A;  4YW6 A;  4YW7 A;  4LK6 A;  4BQ4 A;  2K46 A;  1W90 A;  1W8U A;  1OH3 A;  4LK7 A;  4CP9 A;  1W9F A;  4CPB D;  5D21 A;  3ZYB A;  4A6S A;  1GWL A;  1W8W A;  2C24 A;  1GWK A;  2O14 A;  3ORJ A;  2LRO A;  2WYF A;  4LKD A;  1HN0 A;  1WMX A;  3ZYH A;  4BQ3 A;  1W8Z A;  1L7L A;  2LRP A;  4BQ2 A;  2VXJ A;  4CP9 B;  2KR2 A;  4LKF A;  4LJH A;  2JWP A;  3UT0 A;  1W8T A;  2Q1F A;  1GWM A;  3F95 A;  1OKO A;  4YWA A;  4BQ5 A;  1WCU A;  4LKE A;  4CPB A;  3ZYF A;  4AL9 A;  1UOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...