1G9FA

Crystal structure of the soybean agglutinin in a complex with a biantennary blood group antigen analog
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
251
structure length
241
Chain Sequence
AETVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDTPKPSSLGRALYSTPIHIWDKETGSVASFAASFNFTFYAPDTKRLADGLAFFLAPIDTKPQTHAGYLGLFNENESGDQVVAVEFDTFRNSWDPPNPHIGINVNSIRSIKTTSWDLANNKVAKVLITYDASTSLLVASLVYPSQRTSNILSDVVDLKTSLPEWVRIGFSAATGLDIPGESHDVLSWSFASNLPHLDLTSFVLHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords LECTIN
publication title Weak protein-protein interactions in lectins: the crystal structure of a vegetative lectin from the legume Dolichos biflorus.
pubmed doi rcsb
total genus 46
structure length 241
sequence length 251
ec nomenclature
pdb deposition date 2000-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1g9fA00
2XB6C 4Y1VA 2EXJA 3D4KA 2VW0A 1LU2A 3ATGA 1S0IA 3M2MA 4XIOA 3ZXEA 4YM0A 5E8AA 2DTWA 4LBLA 2D3SA 3IPVB 3QCWA 4YG0A 2UU8A 4DQAA 1W0OA 2V73A 1QKQA 1SLTA 1MZ6A 3OBTA 1FX5A 3SNMA 1UPSA 2WNEA 2B7YA 4FPFA 3B69A 2PHTA 3WDUA 1MS5A 2VU9A 3HMYA 5IK5A 1BYHA 1N47A 2D6NA 1V6MA 3PVOA 4W65A 1S0FA 1RITA 3VKNA 4AGGA 1NLSA 1J1TA 3OYWB 1JOJA 1N1SA 1YRZA 4GA9A 3ZVXA 3NV3A 2D43A 1DQ2A 2ERFA 3B9CA 3AJZA 4PQ9A 1DBNA 2W52A 1LGBA 4YM2A 1YYNA 2D6MA 1DQ0A 2OW4A 4K20A 1WW5A 2NP0A 1LGCA 4BM8A 1H9PA 2A6ZA 5IUQA 2JD4A 2DURA 1WLCA 3WZ1A 2ZHNA 1QOTA 4YM1A 4GWMA 2C5DA 3DGTA 4XDQA 3N35A 2A6XA 3AK0A 5JLVA 3HN1A 3PVNA 4M3CF 2DVAA 4Q8KA 1MS1A 3V0BB 1N3QA 5KXEA 1MS9A 2WT0A 1VALA 4FVVA 5H9RA 1CESA 1JYCA 4LBQB 4M3CB 4XJZA 1LOEA 1B09A 1GBGA 2NM1A 2VH9A 4R9BA 5DG1A 3WCRA 3VV1A 1ONAA 1SLIA 1CN1A 1VIWB 1GICA 2AR6A 3O0WA 4L8QA 4LBKA 4LBNA 1QOOA 4M01A 5EXOA 4C1WA 2A7AA 2JE9A 2ZGRA 1D0HA 3QLQA 1BZWA 4M3CE 1GNZA 4P9YA 4YG6A 1YI7A 5GZFA 1ENRA 1S0GA 2D6OX 2SLIA 1LEDA 4Q26A 1GKBA 2GMEA 2YZ4A 1G7YA 3O5SA 5IK8A 2YXSA 4I30A 1N3OA 2EIGA 4FP2A 1KITA 1W6PA 1CIWA 2DTYA 2D3PA 1QDOA 1QNWA 2GDFA 2P37A 3N7MA 4FPYA 4FOYA 5GLZA 1G9DA 1W6NB 3MW2A 3RRDA 5GLWA 3WDXA 1EPWA 1HLCA 3WV6A 1LHOA 4XZPA 1FYUA 2EXKA 4BQ1A 1DYPA 4IQPA 2OUJA 3AZZA 1FNYA 1N1TA 2ES3A 1OQ1A 2CWSA 1UMZA 3ZSJA 3RSJA 4XOGA 1Z0HA 3SLIA 2WKKA 4AVTA 2GNDA 1Z78A 2LALA 3IKWA 5DXDA 3FUOA 4YLZA 2R49A 2ZMKA 2UWCA 4H55A 5CNAA 1LOFA 1MVEA 1LU1A 3IMNA 4CRQA 5CA6A 3VKMA 3LCPA 4LBQD 3VUOA 4R9CA 1WCSA 2ZGUA 1UKGA 2GALA 4FPHA 1V6NA 1CPNA 1JHNA 4XE9A 5FREA 5H9PA 1VAVA 3AXDA 4DRRA 4JC1A 3FLPA 1S0CA 5E89A 4Y26A 3V64A 1WD3A 1OKQA 2JECA 2YV8A 3KM5A 4BMBA 1GZCA 1C1FA 1N1VA 5AVAA 2ZHMA 3TAYA 1DQ6A 4XTMA 4XJUA 2AUYA 3WUDA 4FQZA 4ASMB 5CAZA 1QGLA 2P34A 1HQLA 2DWRA 5EWSA 3WG2A 2ARBA 2WSUA 2D6PA 3BODA 2ZHLA 4XMAA 4YW2A 1JW6A 4YZ1A 3RMYA 4ATFA 1KDKA 1YO8A 3FFZA 1CJPA 3MW4A 1FV2A 1V6KA 2A3XA 2WLQA 3N36A 2P3JA 3GALA 1F5FA 1S0JA 4RA0A 2NZ9A 1LHVA 2CY6A 2NMNA 4GXLA 4YGCA 5SV8A 1QU0A 2W39A 1U0AA 3WDVA 1S0EA 4XYXA 3ILRA 3SH5A 3ZXKA 3B01A 2ZGTA 3O0XA 1SBFA 2A5ZA 2DV9A 1LULA 4AGRA 4NO4A 2ZGOA 4U2AA 1FNZA 5CBLA 1SBEA 4FPKA 1AXYA 1GNHA 2DUPA 1SFYA 1LCLA 1JN2P 2A70A 2EXHA 4XJWA 3AFKA 4XHXA 1URXA 2YMZA 3INAA 1IKQA 3WUCA 1SBDA 1AJOA 3BTAA 1LHNA 4PBOA 2DUOA 1UZYA 5T5LA 1DQ1A 1QNYA 4Q2FA 4YW1A 4Z8BA 1AVBA 3L2YA 1DFQA 1LGNA 2AYHA 2ZABA 3ASIA 3AZVA 3I8TA 1W6PB 1ULEA 5GALA 3ZXFA 2PHXA 2ZKNA 5KXCA 1DQ4A 5JMCA 3U4XA 2C9AA 2GN7A 3LSEA 2UWAA 4Q1RA 5F9TA 3AYEA 3ZSKA 2VW1A 2ZGLA 4C1XA 4UW6A 5GZCA 3OJBA 4Y22A 1G9FA 1R1ZA 2YROA 4XIKA 5GJ6A 5GLVA 4FOVA 3T2TA 1KJRA 5H9QA 1MZ5A 2A6VA 3FBYA 3WNXA 2PHWA 4GALA 4AWDA 1SLCA 1W6MA 4Q8LA 2E7QA 2DVBA 3T1MA 3UK9A 1DYKA 1BJQA 1G86A 1S1AA 1IOAA 1WW4A 1ULGA 2CYFA 2TEPA 3D5OA 1SCSA 4Y1ZA 4UW4A 2GNTA 5CB7A 5T50A 2CTVA 2GN3A 2OVUA 4XJ8A 5T5PA 1IS5A 1WBFA 1V6OA 3OY8A 2DVFA 5KXDA 2FHRA 5JDBA 3M3EA 1GZWA 2ENRA 5BYNA 2I2SA 2VXRA 3SH4A 3TB0A 2XG3A 4Y1YA 3UJOA 3RQ0A 2CWMA 3POSA 5JVVA 1YIFA 3R05A 1H30A 1SLBA 5GM0A 1DZQA 1QDCA 4CZSA 1NXD1 2A75A 2ZGKA 4NOTA 3SH3A 1V6IA 4D69A 2ZGMA 5GLTA 1N1YA 1LTEA 5HCFA 2DU0A 4HANA 1C4RA 1A8DA 5DZGA 2DVDA 5DUVA 5EYYA 1X50A 2E53A 2FMDA 5GZDA 1Y7BA 2A6YA 1LHWA 4AYUA 1HDKA 1RINA 3JUUA 1MR5A 4FPEA 1CPMA 1PZ7A 3A0KA 3AP4A 2ZGNA 1N3PA 3ZXJA 4HL0A 2ZBJA 4DRVA 3BOPA 1VLNA 3N3HA 4XTPA 2JDZA 2D44A 5JOZA 3POWA 4YGBA 3V0AA 2ARXA 3NV4A 1LOBA 2YY1A 2A3YA 3ILFA 4WZFA 4YFZA 2W68A 4RL7A 2D3RA 2R1DA 3UJQA 4DFSA 1Q56A 4M00A 1LJ7A 3AZWA 1BQPA 5KXBA 3B3QE 1AX0A 4XXPA 2PHFA 1Q8SA 2WQZC 4YM3A 4FQ4A 2LTNA 1IS3A 2A71A 4FPJA 4UW3A 1GYKA 4GKYA 4BLIA 1G8WA 3V0BA 4GWNA 1UAIA 4WVWA 4XILA 2H0BA 1VAMA 3GNEA 3WLUA 1W6OA 1A3KA 5T5OA 2P2KA 3I4IA 2ZACA 2VY0A 2EF6A 1PZ8A 2HYKA 2P3KA 2V5YA 1LESA 2D7FA 4PBPA 4Y20A 4SLIA 3IM0A 4Y22B 4YZ2A 5DG2A 1IS4A 2PELA 1G9AA 1KDMA 2ZGSA 3APBA 4XHBA 5JOXA 1A78A 1G9BA 3JU9A 3N7JA 3IN9A 5JOYA 4WVVA 1W6MB 1LOFC 4Y1XA 1DQ5A 1Q8PA 1LECA 1Q8QA 4YZ3A 2ZGQA 2SBAA 1IKPA 3PMEA 3HR9A 4FOQA 3V65A 4U36A 4K1ZA 2ZAAA 1UZZA 1GANA 1LHUA 1W0PA 4OZXA 3O0VA 3AP5A 2PHUA 4FPOB 1DHKB 1UL9A 3M3QA 2AREA 4K21A 5EYXA 3WVJA 3ZYPA 3OY8B 1KJLA 5FRAA 2GMPA 1GZWB 2VUAA 1GZ9A 1ULCA 1V6LA 5E88A 1MVQA 4BPZA 2GMMA 2E51A 4ISQA 3WDTA 1S0BA 2UURA 1I3HA 4BOWA 3O12A 4XJ9A 5GZGA 2A3WA 1KQRA 4FPCA 1C57A 1SLAA 1SLLA 3AX4A 4LBMA 3D6EA 3WOGA 5GZEA 5L73A 1IS6A 4XXAA 1W6QA 1DGLA 3SITA 1OFSA 4YFWA 1LOGA 1XQNA 4PCRA 2AH2A 4LBJA 1F31A 3R4SA 3AJYA 4ZKTB 3AP7A 1UX6A 3H0OA 3USUA 4Y1UA 4DS0A 1FAYA 1AXZA 3N7LA 3T1LA 1BKZA 2D6LX 2RHPA 5DUXA 2AENA 4FPLA 1GV9A 1ZM1A 1AF9A 5T54A 1QF3A 1WW7A 3ENRA 3LSDA 4FPGA 1AXKA 4P9XA 3AP9A 3KQRA 4GKXA 2PHRA 4ZXKA 2DUQA 4XBLA 2R16A 2WT2A 4TZDA 5DZFA 4R9DA 5IK7A 4ITCA 2ZMNA 1PZ9A 4YW5A 3V0AB 1MS3A 3ZYRA 5JOWA 4BMEA 1KRIA 5DUUA 4AVVA 2R0HA 5HCBA 2GNMA 3AP6A 3OPZA 4PF5A 4Y24A 3NV2A 2WJSA 1WBLA 4ISRA 2R0FA 2GNBA 3OBRA 1GLHA 4YW4A 4WV8A 1WW6A 2CL2A 3A4UA 4XBNA 3RG0A 2DYCA 1CVNA 3NWKA 2E7TA 2EAKA 3WDYA 2VW2A 2OUHA 5T5JA 1C1LA 4P14A 3AZYA 5T55A 3W58A 4KBBA 2AGSA 1F9KA 1W6OB 2A6WA 3IPVA 3WDWA 4AGVA 1HKDA 1UN1A 3DUIA 3RS6A 4Q1PA 1WD4A 2NMOA 3WHTA 4MYEA 3NV1A 1LEMA 5F5QA 3FUQA 1AJKA 3N7KA 4Y20B 4JCKA 5GLUA 4XJAA 1QOSA 4F83A 1FV3A 5IK4A 5IT6A 3VKOA 2ZZJA 1DIWA 3OYWA 4YG3A 4TYSA 1V6JA 4LBOA 1LOAA 2NYYA 3ZXLA 2JE7A 1Q8VA 2ZHKA 2DU1A 2ZA9A 4JRAA 4Q27A 3PVEA 3SISA 1HQWA 3WG4A 3ILNA 3M3OA 3BIWE 1D2SA 1MACA 1V00A 2P3IA 1ULFA 3POYA 2KM2A 1FATA 3MEPA 1ENSA 2Z42A 4YGDA 2E6VA 2JKBA 5T52A 1WLWA 1YXWA 4P9WA 1AZDA 3W59A 4YW3A 2EALA 5HCAA 1APNA 1LOCA 1AX2A 4YGEA 2JJ6A 1CQ9A 1MS0A 4R9AA 3B00A 4AVSA 1DLLA 1GSLA 3RMXA 1MS4A 3CNAA 2BQPA 1W6QB 3ZSMA 3AYDA 2ZMLA 1Q8OA 3M3CA 4LBQA 1H9WA 4M3CA 5DUWA 2WT1A 4XBQA 5LK5A 3USUB 3A0NA 4XMIA 4CTEA 1AX1A 2CNAA 3ZPYA 3FLTA 4BLJA 1ENQA 4FOWA 1LODA 1JXNA 2WSVA 3MW3A 4FP3A 3WG3A 1O4YA 3MPPG 1CR7A 1G9CA 3VKFC 1S0DA 4ATEA 3PJQA 2DVGA 1WLDA 1WUVA 1ZA4A 3UL2A 3OGGA 3ZSLA 2NN8A 3Q9OA 3AYCA 4DPNA 1TEIA 1W6NA 5H9SA 1O4ZA 1LENA 4YZ5A 3FLRA 1JBCA 1JUIA 1SACA 2EXIA 2W08A 4K1YA 4YZ4A 5DZEA 1RIRA 1BXHA 2R1BA 1I1EA 4UW5A 1QMJA 1MS8A 1JYIA 3WCSA 2UWBA 3VKLA 1SCRA 1CONA 3AXEA 1ULDA 3R4UA 3WHUA 3M1HA 3C2UA 2ZGPA 2G4IA 2Q5TA 3AYAA 3WG1A 3AZXA 2D6KA
chains in the Genus database with same CATH superfamily
1PX4A 4Y1VA 4BXSV 4JQRA 2VW0A 1S0IA 1HXS2 1ULPA 3GHNA 5E8AA 4MLOA 4LBLA 5AFEA 2E7AA 4N9IA 2UU8A 2JIJA 1TME2 3IDBB 3Q8CA 4UFJA 4Z82A 2QQUA 5FXXA 1UPSA 1NE6A 2PHTA 5IK5A 4CDUA 1N47A 4LLOA 1PVC2 1POV0 3PVOA 1VRH1 4GULA 4KG8A 4XEZA 1VBB3 4BQ2A 4KGGA 3KT4A 4RS5B 4QB6A 3I3QA 3TNPB 1R091 5C6CA 1NXMA 3OYWB 1LRHA 1JYNA 1N1SA 3D0JA 2VMIA 5C4WB 4IV1B 1UYZA 4QX8A 3I49A 5ISLA 4GA9A 3ZVXA 3NV3A 2D43A 3MICA 3HOBA 1DQ2A 1OPMA 2WRAA 5LBBA 4KGQA 4KWKA 1QQP1 4YM2A 2QDNA 1AR61 2RM23 5FP8A 5FYTA 1DQ0A 2OW4A 3BKZA 1W03A 4Q0PA 3LQCA 5C8CA 1ALYA 1JHJA 2A6ZA 5LEKA 2JD4A 4LUMA 1WLCA 1W8WA 3ZFFA 1RUJ2 1QOTA 4IE5A 3VZJA 1WCKA 3DKWA 2XBO3 1C8M1 3DGTA 3DXUA 4JGZC 2A6XA 2VNGA 5A33B 4P08A 1O3TA 2EIDA 1NZCA 4DMIA 3WQ7A 3Q8EA 1MS1A 3V0BB 1N3QA 1RUH2 1UY0A 3HN3A 1O59A 2RS53 5KXEA 1VALA 3RYRA 2OPKA 3ZN5A 1AR92 1JYCA 2QVSB 1VB4A 2OKXA 2Z2SB 3PU3A 4MGTA 3W21A 1RTVA 1BVVA 2QQJA 4W8JA 3IBMA 1QOOA 1H2NA 4C1WA 5L7OB 2ZEXA 2JE9A 5GZFA 4Q0VA 3QLQA 5FZAA 3WNOA 5E1RA 1ENRA 5ACA2 4NN0A 5BV6A 5AC93 5IYYA 2EIGA 2BVBA 1UIJA 1CIWA 1NCQB 1QDOA 2PN5A 1RHI2 3CJIA 4J1XA 4GWJA 4QQHA 2DDUA 4AK3A 5IVYA 3RRDA 2OZJA 4LO6B 1RUE3 4NHKA 1S4CA 4XFBA 5GLWA 4LORA 3WDXA 1PO13 1HLCA 2Y6JA 4DOUA 4XZPA 4EN8B 2EXKA 3FHAA 3N9MA 1OKOA 5DQ0A 4IEYA 1RGSA 1N1TA 2VCAA 2QQPA 1OOPC 3C7EA 1BLZA 3MFAA 4RGAA 5FQ0B 4XOGA 1JZ7A 1HRV1 1YQ6A 1W9FA 2GH2A 2VNRA 1QXJA 1UOJA 2GNDA 2LALA 4KQ7A 4A6OA 3JD73 3OEAA 1LOFA 3WEZA 5A3PA 2IXKA 4C0BA 4FXGB 1PNFA 1WMEA 1R082 4R9CA 3JXSA 1GOHA 1L7RA 2MNGA 4CU7A 2BBVA 1Y9MA 4FPHA 3CDZB 5C5TA 1W3XA 1VAVA 3AXDA 3KSCA 1PK6B 3FLPA 5FZDA 1VBD1 2WBKA 4KH9A 1R64A 3H1MA 5FLJA 1WD3A 1MEC3 3MIGA 2JECA 4ASKA 4BMBA 1GZCA 1C1FA 1XE7A 3OB8A 2ZHMA 4XCBA 4CCJA 3WNKA 1PIV2 4G9SB 1H1AA 4FQZA 4DUXA 4AI3A 1OC1A 5CAZA 3J8F1 3O1RA 2VG9A 2D97A 5F3CA 3WG2A 2ARBA 2WSUA 4DXRA 4A7KA 2HWE3 1UY4A 4IEUA 3GXUA 5B2GB 1W05A 2VVEA 5CIRA 4XMAA 4YW2A 1ZRCA 4IEOA 4HKLA 4YZ1A 4QPWA 5J7MA 3FFZA 3AL6A 4I0AA 4L0PA 4RQPA 5I0TA 3BOWA 2VOXA 2WLQA 5BNNB 1F5FA 4RA0A 4RGGA 2WDBA 2VTXA 2N7GA 1NA1A 2B5HA 3WNNA 1QU0A 4MG2A 2HWC1 1CX1A 2BPA2 5JXGA 4XYXA 3E5QA 3ILRA 1OA2A 3OCPA 4IEXA 4LIVA 3SH5A 1TVGA 3O0XA 2A5ZA 3CIHA 2DV9A 4NO4A 5CBLA 3ES1A 5FZ6A 1GNHA 3HNBM 2DUPA 3OGRA 3VL8A 1LCLA 4RHV3 4AHWA 3RJRA 1AL0G 4XJWA 4XHXA 2VM9A 1D2QA 2IVJA 3AM2A 3GGLA 3PU8A 2YMZA 3INAA 1ZBE3 2BBAA 2DCJA 3ZFGA 1ZRDA 5A1AA 3WUCA 3BTAA 1AJOA 3VBSB 2DUOA 1NCRC 4K3UA 5FY1A 4Q2FA 3LD8A 3I2KA 3L2YA 1E57A 5FOBB 1DFQA 1PGW1 2AYHA 1JU4A 3AZVA 5GALA 1W6PB 1ULEA 3HAGA 3U11A 4CP0A 2VOKA 2ZKNA 3I3EA 5BY5A 2EIEA 3U4XA 4D6RA 5F9TA 1D4M1 4N43B 2ZTNA 1JYXA 3ZSKA 4C1XA 4KG0A 1IPJA 4LKSA 2WYFA 4CDXC 1RUD3 3IB3A 1R1ZA 2VUJA 1F15A 4XPVA 1UIKA 5I91A 5LWBA 4AVAA 4QKBA 4JKLA 5H9QA 4FFHA 3J4UH 1WCQA 4CDQA 4Q4Y2 2JEMA 4AR2A 4WM7B 1OI6A 4P9IA 2IXIA 2DVBA 4CVUA 3UK9A 1DYKA 1ULGA 1IOAA 3CJXA 3WP6A 1UPIA 5JPNB 2VZRA 2YDEA 4UBGA 1HB2A 1S2KA 4COYA 1CD3G 5FZHA 5T5PA 4E9KA 2HWF1 4IV3B 3U0ZA 2RJ2A 1RUG1 1QH7A 1NY71 4L2NA 4CP9B 5FO7B 5JDBA 4XABA 3BIEA 2ENRA 4QHZA 4DZGA 4Y1YA 3VDDC 4XACA 4CEWB 1W3VA 2CWMA 1RVF2 3JCIA 4L11A 1EP0A 3R05A 4JDOA 5JVVA 3POFA 4CEYB 1QDCA 3SH3A 1DGWX 4MXWB 2ZGMA 1MPXA 4QXKA 1UO9A 5GLTA 2BWAA 4QHOA 2JDKA 2DU0A 1A8DA 1GP5A 5EYYA 3WQ0A 5C8CC 2C9KA 5C5UA 2E53A 2YPJA 3KT7A 4IE4A 3ZKYA 4AYUA 1RJ8A 1HDKA 1RINA 3JUUA 4AL9A 4AQTA 2RS31 2GP5A 2VZVA 4FPEA 5EJZB 2ARAA 2XLAA 5HI0A 1W8UA 1PZ7A 1OA3A 2FCUA 3A0KA 3SKJE 1EY2A 5JXIA 2G19A 3ZXJA 4HL0A 2W91A 3RI8A 3ROUA 1FOD3 1VMHA 1YJKA 2XONA 1XU1A 3UGGA 2EVXA 2RE9A 2YG0A 5C33A 2ZX4A 1ZZ8A 2R043 4YGBA 3GM8A 5ANNA 1AR71 4R4XA 4HN1A 1QJY2 3VBHA 2B39A 4BZ4A 2YY1A 5KWRA 4DFSA 2R1DA 5D8AA 2ZCWA 3WNLA 3VLBB 4ZU5A 1BQPA 2HEYF 4G4FA 4COVA 4IEQA 1H6XA 4CUCA 2WFPA 1Q8SA 4O61A 3BI3A 5A33A 3B02A 4PLNA 3JBG2 1GYKA 3THPA 1ND3A 1G8WA 3CJIC 3V0BA 3I2GA 3ZXDA 1Y9GA 2QE3A 4Z92B 2RR12 2VCMA 5EPAA 3TN93 4DXSA 1UOFA 5FYUA 3AVRA 4QDQA 1YHFA 1L7LA 2LW8A 2P2KA 5A7WA 3ZOIA 2ZACA 2VY0A 1JYVA 3R6SA 1H1IA 4LULA 2P3KA 4LO7A 5L19A 3C3VA 5DDJ1 4Y20A 3VBFC 5LEJA 5IVEA 2PELA 2OQ7A 1DLCA 1HXS3 5JOXA 1O5LA 2VBBA 5FYZA 4LO4B 3JU9A 1V9U2 3B93A 3IN9A 1ZNPA 3MIDA 3N7JA 2BDRA 1W6MB 1LOFC 4NE9A 4Y5TA 3BGAA 1PNGA 1E5HA 1NCQA 1Q8QA 1PVC3 2KD7A 2SBAA 5FZIA 3V65A 2JDHA 3BB6A 1TMF1 3Q8FA 1HN1A 1O4TA 1W2NA 1XSQA 3N9QA 2VULA 3O1SA 4AXOA 4K1ZA 5LASA 3DXTA 3WVJA 2AREA 2MEV2 2VQTA 5FZ3A 3ZYPA 4OHYA 4WVMB 5FRAA 2R063 2GMPA 1J58A 1ACCA 1OSGA 2WA4A 4ZY9A 3TYJA 1MVQA 4OZOA 3WDTA 1XNKA 1S0BA 3OEBA 4OFGA 4A3XA 4BOWA 1KQRA 4FPCA 3ZKUA 1C57A 4LBMA 1SLLA 1XNCA 1YQ8A 3D6EA 3VGIA 1IS6A 5LB6A 1J83A 1RUJ3 1LOGA 2VJXA 4LPLA 2PAKA 3D0SA 2AH2A 2WFF2 4ZKTB 3NKTA 3OBZA 5JZGA 1DP0A 3H0OA 3KWVA 4FI9A 1FAYA 1W39A 4AI8A 1T6GC 3FC0A 3N7LA 1B35B 2VQAA 3OBAA 4RQPC 5FZKA 4FFIA 1RUH3 3ZYHA 5A3MA 3BALA 3MF6A 3GHMA 5D21A 5IJRA 1RUOA 4MVTA 1AR93 1NA1C 2WQ4A 5DUXA 1C8NA 3TEYA 1VRBA 2B46X 3C7FA 3LSDA 4FPGA 3CZJA 3Q8AA 1J3PA 2VZ3A 3H7JA 1OLME 4MX3A 2FBEA 3AFGA 3LF7A 4R9DA 4B1LA 3T09A 3GYDA 3POGA 5ACA3 5IK7A 4NMIA 3MO4A 1MS3A 3HBKA 3QBQA 4HPKB 5FYBA 3A23A 3ZFGC 3OPZA 4E4HA 4KU8A 2WJSA 1QH6A 2J42A 3H8RA 3O1MA 1RHI3 4ISRA 2HWD1 4TLFA 2JDPA 1GLHA 4YW4A 4WV8A 3WP4A 1WW6A 4NHLA 5BNNA 3MIFA 2C6SA 3WW3A 1YUDA 4GB32 4BH9A 4PDWB 2RM22 1WWYA 4OHVA 3VBRB 3NWKA 4B3NA 2VZQA 3B9IA 4OUEA 4XFCA 5T5JA 3LKJA 1NE4A 2C1FA 1UU5A 3KMHA 3AZYA 1F9KA 1XSRA 4AGVA 2JXAA 1HKDA 1UN1A 3DUIA 2XJQA 3KGZA 1IG0A 3RS6A 3UT0A 2A1XA 5HPOA 3VL9A 4GJYA 2QCSB 3FUQA 4OUSA 2J1AA 4RD7A 1GQPA 3N7KA 5FZOA 5HCHA 5FPBA 3K75B 2XQRA 4HG6B 3H42B 4CDQC 2ET7A 3VBSA 4F83A 2PAEA 2Q30A 4ES8A 2IXLA 1RXFA 4RGKA 2NQYA 4YG3A 1DIWA 3VKOA 4COUA 3NJVA 3SCHA 1NG0A 3PTRB 5J36A 1QJU1 1ZZ6A 4HKWA 3ZXLA 2VO5A 4L97A 1K3IA 1Q8VA 4KU7A 3NJXA 4Q27A 1HQWA 4JGYA 4AZZA 1J1LA 3KT1A 4QMAA 2FDGA 3B5LB 1MACA 5A3UA 2P3IA 4GQ7A 1U5IA 4HSJA 5F7UA 4YGDA 1PIV3 3AMHA 1QJX1 1YXWA 3JQWA 1O6UA 2XJRA 2K46A 1AZDA 2P5BA 4P9WA 2V72A 4LNVA 5FZCA 1FMD2 1XNBA 1APNA 1LOCA 4LHSA 2VZUA 5HCAA 1UY3A 1W9YA 2JJ6A 2BW8A 1CQ9A 4R9AA 5FZ8A 1XNDA 5CKMA 4OQ9A 4E2GA 1YNAA 2W0XA 4Q4X1 2FCVA 2ZMLA 1Q8OA 3M3CA 4DINB 3ZFEA 3GBGA 3J7LA 1UZWA 4XAAA 2HEWF 2WS91 4KNCA 4XMIA 2XL7A 2CDOA 2CNAA 5IVCA 3FLTA 1ENQA 4CP9A 2WSVA 2WNVB 5EV7A 4EN7B 4EQVA 5HV4A 1Q5OA 1O4YA 1ULOA 2FDIA 1JYTA 3PVBB 1D0GA 2XVLA 2BGPA 1H2MA 3PLQA 2DVGA 3RZGA 1PO21 4CEYA 1WUVA 4QX2A 4NRMA 5LBEA 5KHHA 4NIHA 4W50A 3AC0A 3EQEA 1CAUB 3IIIA 3SC7X 3OG2A 3SCGA 4OI4A 1QEXA 4NIAA 5FXZA 3VBHC 4NVPA 4PI0A 3MDPA 2C26A 5D8AC 1JUIA 5FZ9A 1RXGA 1AR81 5I8SA 1RIRA 1I1EA 4UW5A 1QMJA 2P1BA 5FKCA 1JYIA 1UXZA 3TRSB 2ZX0A 5DMYA 3AXEA 4Q0SA 1OF4A 1F4AA 1DG6A 5ANQA 5A6YA 1J59A 1VPHA 1ND3C 2Q5TA 3QH6A 2LS6A 5CEHA 4JGZA 4LKEA 1AHSA 3VBUA 2VMHA 3AZXA 5EIYB 2D6KA 2XB6C 2BWCA 1Y4WA 3M2MA 3NQHA 3ZXEA 4AEMA 4BDVB 1L7QA 2PQQA 2XHKA 4Q4Y3 3QCWA 3TBDA 3MFCA 4EZ4A 4LITA 4E4SA 2OT7A 1L3JA 2V73A 1TZOA 3CHXA 3OBTA 2RJLA 2WNEA 3B69A 2R30A 2VU9A 3HMYA 3OUJA 3K4ZA 1BYHA 1PMIA 3PUIA 4HN0A 4UFLA 3WX5A 2YFZA 1VBB1 1RITA 4W4ZA 1KEXA 1NQDA 1F8VA 2MPFA 1VBC2 2BERA 4IE0A 4NPLA 1NLSA 1W8TA 2LM3A 1OT5A 3OGJA 5F5IA 4BIFA 1JOJA 3BN6A 4IW3A 4P9JA 1NCQC 4O7XA 4HOOA 1RUI2 2Q0AA 2QJVA 3VD4A 2WN3A 2BYVE 3ES4A 2TUNA 5CU1A 3GZAA 1US3A 4N90A 2Y6FA 5L9BA 1SQ4A 4K20A 5EZWA 2VCBA 4BE3A 1S2BA 3RZKA 2XJPA 3OSDA 3I2FA 5JMOA 4QM8A 5CYYA 3WF3A 5J37A 2XBO1 4E4DX 1AYM2 2C5DA 1CAWB 4AFMA 1PVXA 4Y3OA 3O1UA 3KLSA 5ABJB 1COV2 3PVNA 2VZ1A 4QX5A 4H7MA 2RS51 2WT0A 4ORFA 4PT6A 1YQCA 1WMXA 2P6HA 4XAEA 4LBQB 4M0NA 4BK4A 2Z5WA 1LOEA 1B09A 2NM1A 4I3GA 4CXWA 2JB4A 3VV1A 1ONAA 1VIWB 1KD7A 3O0WA 1NT0A 4LBNA 2VVDA 4MGIE 5FMOL 2WLPA 4C0HA 1PGL1 1UY2A 2IXCA 1HRI2 2YU1A 4M3CE 1BZWA 2BOIA 5FY8A 5JI7A 4H2AA 3RYKA 1S0GA 2D6OX 2SLIA 1QJY3 4Q26A 2PLV2 4AEJA 2GMEA 3O5SA 1G7YA 2QQVA 2O1QA 3TEZA 1RMU2 2YXSA 2CHHA 4NR1A 5AC91 5FYIA 5M0TA 4DS0A 1QNWA 2Y6HA 1G9DA 4UAPA 1Q3EA 1US2A 3KV9A 3UV9A 1RUE1 2BV4A 2DCYA 1X9PA 2XDVA 4W6XA 1EPWA 1PO11 3WV6A 2X8KA 3JBG3 3LPGA 3ECQA 5L36A 1B35A 3O1OA 4BQ1A 3AKQA 1REDA 2D98A 5F32A 4EN6B 5BNNC 2OUJA 4QQ2A 2ES3A 3A21A 4YRDA 1K5JA 5F37A 3AMNA 4YVSB 5FJHA 2ARCA 3WD5A 1CAXA 1O91A 4XF3A 1IPSA 5EHDA 5DXDA 5HV0A 3FUOA 2XGXA 4YLZA 3T2PA 2UWCA 3JD71 2ADDA 1MVEA 3POBA 2JG9B 3BCWA 4IGOA 3ST7A 1WCSA 2I74A 2ZZQA 4HPKA 5JI9A 4CCNA 1UKGA 2OIIA 4PF1A 5BNOA 1CPNA 1JHNA 3DN7A 4NAMA 4XE9A 2HYXA 3VBSC 3I3DA 2IWGB 3E6CC 3OD0A 5JIUA 1WMDA 4QXHA 3ZXAC 1JOPA 5AFBA 4HVQA 4LO8A 2VUCA 3V64A 2VMCA 1MEC1 1OUXA 5F1RA 1NCRA 1QJEA 1N1VA 2WR9A 1WA4A 3TAYA 5BNQA 1DQ6A 4JGYC 4E8DA 3H7YA 3WUDA 1IZ3A 1UU6A 1Q43A 4ASMB 1QGLA 1HQLA 1YFYA 2Y60A 3SHRA 3PMSA 5CFDB 2D6PA 2HWE1 2Q1MA 4HBNA 5C9AB 1X8MA 3S7EA 1W99A 1RUF2 2X29A 3C8XA 3RMYA 4QD2A 1W2UA 2ID4A 5LY1A 1T6BX 3MW4A 3WW4A 1W9TA 3N36A 3B94A 3NNFA 4QX0A 2P3JA 1S0JA 2WFF3 2NZ9A 4QGMA 3H3UA 4UFKA 3NJYA 1D4VB 2YGMA 4IL7A 5A3WA 3I2OA 5F3IA 3WDVA 4YARA 3ZXKA 3I2DA 3B01A 2WN2A 3IAPA 3ZFEC 1LULA 4XUNA 2D93A 5BUVA 2J22A 4W6YA 1NYWA 3MPBA 2JDUA 2DCTA 3W9AA 4C90A 1SBEA 2ZEYA 4IV3C 3PJYA 3KF3A 4AW7A 4RHV1 3LDRA 3CLPA 2JG8B 1QY4A 5CFCA 1ZBE1 4CEWC 1IKQA 3LEKA 4HSLA 1WCUA 3TWIA 5FZ1A 4CEYC 1K5MB 2JIGA 3VDDA 4XFIA 3POEA 4YW1A 3RZMA 3K48A 1UCXA 3PUQA 4HXCA 1O3RA 1LGNA 4OQ8A 2C0ZA 2R062 2J1SA 3B7MA 2Y0OA 5KXCA 1DQ4A 2C9AA 4Q1RA 4GB33 4A6SA 4I0BA 5GZCA 1XOYA 1MQTB 2X5IB 5EQUA 5IVJA 1F4HA 3VZMA 2WNVA 5FK8A 2AZ5A 1RUD1 3BPSA 4XIKA 4EN0A 5GJ6A 4BK5A 3QACA 3T2TA 3OPTA 5A7QA 4D7YA 3FBYA 3VBOB 1W2OA 2PHWA 2PXJA 5C3SA 3VBUC 4AWDA 2YB7A 4QGNA 4LHLA 2G9ZA 3HQRA 2E7QA 5K9YA 4C91A 1DGRA 3WNPA 1XNTA 4Y5Z0 4Y1ZA 5F2SA 2JB8A 2VE1A 2OXBA 1IS5A 2Y6KA 1GMMA 1GZWA 5BYNA 2VXRA 3TB0A 1CAVA 2XG3A 3IAQA 4QPYA 3UJOA 4F7ZA 1NAEA 4P9GA 5J98B 1SLBA 1YIPA 3CU7A 1ODMA 1NXD1 2A75A 3RWKX 1AL21 1V6IA 2WABA 2CU5A 2FCTA 2E26A 2J1RA 5IVVA 1Z7S3 5FKBA 5HCFA 3HT1A 3E5XA 5DZGA 1FMD3 2DVDA 2QQIA 1RUC2 3EBRA 4LHNA 1X50A 2G9FA 4N53B 2QUOA 4QPGB 3IT8A 4KWJA 5GZDA 2XOMA 4Z2WA 5T3NA 2A6YA 3USSA 2Z79A 4BIOA 1JUHA 4KWUA 3SKVA 2ORZA 3NAPA 1HJFA 2QBXA 1CPMA 4MHUA 5FBJA 3VBFA 4AFAA 2C24A 4CPBA 3AP4A 1W9WA 3THCA 1JS9A 4DY3A 3MYXA 1FOD1 3MBWA 3S5QA 2WZ8A 4XTPA 4EWAA 3H8OA 1DGWA 1XE8A 2D44A 2BGCA 2DFCA 4ES9A 2R041 2XLFA 1GFF2 2LUWA 2ARXA 3V0AA 2O0OA 1QWRA 3NV4A 3O14A 4DB5A 1LOBA 3ILFA 4YFZA 2WO1A 5K0UB 3LFIA 4YWAA 3I3BA 4PJYA 3FN9A 4M00A 1LJ7A 5EJ3A 4AFDA 4OI0A 2WZEA 5G04L 3R0RA 5IFTA 3MGUA 5KR7A 2WQZC 4YM3A 4Z2AA 5CISA 2X10A 3MIEA 1X36A 1IS3A 2A71A 3LFMA 4GH4B 4RN5A 4DEQA 5ABJA 1BMV2 4BLIA 4KBZA 4GWNA 4A7ZA 3FBMA 3THTA 3UGFA 1UZVA 4WVWA 3WT3A 5F6LB 3TN91 5FDBA 3NSTA 1VAKA 3EXUA 5T5OA 4CA9A 3BU0A 2BNNA 2XR4A 1B35C 2YU2A 3I2JA 3SMHA 4BWOA 1TNFA 2J1EA 2V5YA 4XZUG 3PUHA 3S57A 1ZZBA 1VBE2 3JQXA 4Y22B 4EWDA 3IM0A 3S5AA 5DG2A 1G9AA 1VBA2 2YFUA 2ZGSA 5A7PA 4TTGA 2YGLA 4A3ZA 4QB1A 5FWJA 1A78A 4AEDB 4BYYA 1H8TA 1TME1 4YVWA 3UGHA 5JAXA 4WVVA 4Q4W2 3HJRA 1DQ5A 1SPPA 1LECA 5LATA 3GCWA 2ZGQA 4FOQA 1IKPA 1PVC1 4LKDA 4NIDA 5IVBA 4Y5SA 2K9ZA 1VBC3 4QQOA 4U36A 4PIYA 1KFUL 1UZZA 1GANA 1LHUA 1OVPA 4UFHA 5BNOC 3AP5A 3VN4A 3P5BA 4L9BA 1LR5A 1UL9A 3OOXA 1NLQA 4HFSA 4I09A 1FT9A 4K21A 5EYXA 3OY8B 3AKTA 2JE8A 4IESA 3VZOA 1RUI3 3WF0A 1JODA 4HLTA 4INDA 4IEVA 1V6LA 5FMCA 5E88A 1HB1A 2UURA 1S55A 3O12A 4MGYE 3AVSA 1H4GA 2KXLA 1SLAA 4N7UA 4IE6A 4XXAA 3THDA 1W6QA 3DV8A 1RUJ1 1DZTA 1EAH1 2P6CA 4OCTA 4QPIB 5CA6A 4LBJA 1AYM3 1F31A 3R4SA 5C70A 1VE0A 1UX6A 2JDAA 2VVFA 2GC3A 1HIXA 2BFUS 2UYAA 4Y1UA 2FDJA 3LEIA 4V2VA 3T1LA 3USUA 1COV3 5FP4A 2RS12 3WQBA 5I0DA 2ZX2A 1RUH1 5C3PA 2CV6A 4ZZ8A 2D6LX 1VRH3 3ZIWA 5B4NA 1AR91 2OZ6A 3NO8A 1YEWA 2AENA 4G3YC 1GV9A 1ZM1A 4R8HA 5DAWA 1JYWA 1HB4A 5C7GA 5J48A 2QQOA 1WW7A 3KS7A 3E97A 4P9XA 1AXKA 5IAVA 3VZLA 3ZN6A 4DO0A 2VTXJ 2ZX1A 2PHRA 4XBLA 5LZ6A 2L9LA 1GR3A 1HRI3 4P5HA 4OMDA 5DZFA 4XURA 5FTTC 5JR2A 4ITCA 5ACA1 1DDLA 1PHMA 2VUDA 3ALQA 5JOWA 2BGOA 3J9SA 5CKNA 2PLV3 2IVIB 4AVVA 1GP6A 2R6QA 1RMU3 1YC61 2J1UA 3LA2A 4P5YA 5HCBA 3RGBA 3NV2A 4AAXA 4F3JA 5CFCC 5K4LA 2P4EA 1RHI1 3VD5A 3K77A 2GNBA 3OBRA 3BTYA 5J96B 3GZTB 4LQRA 4E8CA 3WF4A 2E7TA 2OUHA 5AVPA 1W9SA 2VOVA 1ND2B 3IMMA 4JZRA 5FLIA 1QXPA 3W58A 1SHWB 4RSUA 3E6BA 1W6OB 2A6WA 3WDWA 3UNPA 3PIGA 4S2GA 4Q1PA 1EV12 4XC9A 4AVBA 1KGYA 2NMOA 2WNVC 2ZXQA 4GAZA 5HXMA 5DN2A 2Y26A 5F5QA 1I9RA 2YBPA 5JXHA 2F4PA 1QOSA 4MGKE 1K5MA 1FV3A 4CPBD 4FTEA 4RS5A 4UF0B 1R081 3OYWA 4M4PA 2W1WA 1YI9A 2Y6LA 3H1YA 1AYN2 4MZUA 5C4WA 4IV1A 1GQHA 1LOAA 2NYYA 3AB0A 2VZPA 2DU1A 2Y33A 4QDRA 4ZU7A 3ILNA 4Q4V2 1OLQA 3BIWE 4SBVA 4AEKA 2XH6A 4LMFA 3ACGA 1ULFA 3NVCA 2YC4A 4V1PA 4OHWA 1MQTA 2KM2A 1FATA 3HBZA 1ZBA2 1PIV1 2E6VA 4ET7A 2JKBA 5T52A 4CCCA 1T2XA 2VMGA 5FY9A 3W59A 4YW3A 4JKKA 3OUHA 4RFRB 4CCKA 1UMHA 2QZ2A 2Y34A 4LO5B 1RUF3 1GSLA 2EA7A 4LTAA 5JSPA 5L9RA 1I6XA 3VHRA 2CGNA 5KHGA 1RJ7A 1ST8A 1YWKA 2DCZA 3AYDA 3KQ4B 5DUWA 4NJ4A 2JX9A 5A7SA 3LDBA 3TEXA 4GWIA 4A42A 2AEYA 3I59B 5LK5A 4Q29A 3WQ1A 4D0QA 1X7NA 3I97A 3NAPC 4CDWB 5L7OA 3I54A 2W1UA 4OI1A 1CR7A 1H2KA 1WLTA 3NKGA 1XBFA 1WLDA 1DF0A 3UYJA 4FTBA 1ZA4A 2ZS6B 5FPXA 2HEVF 2NN8A 5H9SA 3WSOA 5K8SA 1RUNA 1H6YA 2H0VA 3OF1A 1EPZA 3FLRA 1JBCA 1X82A 3CEWA 2EXIA 4N53A 4O9EA 2XJSA 4YZ4A 2W1SA 2R1BA 3H8UA 5LRSA 3WCSA 2VBPA 3LGRA 2BOJA 3MF9A 4K9SA 5FQ0A 4JRLA 2ZGPA 5ABJC 1OOPB 2G4IA 1WA6X 1OVSA 5KC5A 3OD4A 1ZRIA 4DUWA 1XJAA 5A70A 3ATGA 2XMLA 3DECA 2DTWA 3U14A 3FHIB 5FMBA 1POQA 3IPVB 4Q4Y1 5K7PA 4CCDA 3WF2A 4PLMA 4DQAA 2VR4A 1MZ6A 4JDNA 1FX5A 3SNMA 4NHYA 4Q0UA 3WDUA 2IFRA 2WNOA 1MS5A 4CXYA 1UKRA 4DY5A 2D6NA 1LB2A 1PK6A 4XFHA 3CL1A 3VKNA 1S0FA 4AGGA 1J3QA 4BISA 1H8TC 1U5YA 2WINB 4YVWC 3T2QA 5SV5A 1J1TA 4FAHA 1Y43B 2XVKA 5D2AA 4YSFA 2W1QA 1SG3A 2LROA 2NPIA 4UBHA 4HVRA 3D8CA 2GC2A 4BQ4A 1BEV2 2ERFA 3B9CA 3AJZA 4PQ9A 1DBNA 2DFBA 1E5SA 1REFA 1RVF1 1LGBA 2W52A 1GWLA 3DCQA 4RR3B 2D6MA 3FHQA 1LGCA 2W95A 2WNUB 1H9PA 2FDKA 4B8EA 3WZ1A 5A32B 3AMQA 1XYNA 3I2HA 4S2FA 2D40A 4YM1A 4YVSC 4QKFA 1JZ6A 4XDQA 1RUC3 1OLRA 5FYVA 3AK0A 3N9OA 2Q4SA 1XXNA 4Q5OA 5JLVA 4LIUA 2DVAA 4Q8KA 4GZ9A 3RJ2X 3K3NA 3OGVA 5H9RA 4M3CB 2ADEA 1VMJA 1GBGA 4OYUA 4R9BA 2RG4A 5DG1A 4CCEA 3H3ZA 1SLIA 1RUG3 1R1A1 1GICA 4IETA 1ZZ9A 4BB3A 4L8QA 4XDPA 1FPN2 4LBKA 5EXOA 4I01A 3BYWA 2A7AA 1IQDC 1GP4A 4YG6A 5JMCA 1H0BA 1GNZA 4QKDA 2G9GA 3GBFA 4XF0A 5F39A 5A7OA 1QJY1 4GMP3 4WM8B 5L9VA 2YZ4A 3DYOA 1FI2A 5IK8A 2VQUA 2HWB2 4I30A 1N3OA 1KITA 1W6PA 2DTYA 2W46A 2D3PA 4FPYA 2P37A 4TLGA 5IW0A 2XJUA 4FOYA 5CFDC 1W6NB 3MW2A 2XKPA 5C9AC 3RZZA 4PIXA 4IUGA 4N43A 5JSOA 4NIGA 4FXKB 5FIXA 3RZHA 3NNGA 3A22A 3ORJA 1DYPA 2XVGA 4IQPA 2QQKA 1YJLA 1W2AX 1Z7S2 2RR11 4QM9A 1FNYA 4CDXB 1OQ1A 2CWSA 1UMZA 3RSJA 1GWKA 1Z0HA 3GBWA 3EMRA 3JB4C 4WM7A 2WKKA 4AVTA 1PX3A 4QAWA 1STMA 2HJIA 1F5JA 2ZMKA 1VBE3 4H55A 3NMBA 5CNAA 5FK7A 2OYZA 1VBA3 4CRQA 3FL7A 3ZN4A 3ZSEA 3VD7A 3VUOA 2ZGUA 4B4PA 1V9U1 1OPOA 3J26N 5FZLA 4IV3A 2XL9A 2TBVA 4CSWA 1V6NA 4Q4W3 5FREA 4DRRA 5FFOC 4CDUB 1A34A 1K5MC 2VMFA 4RS5C 4YYOA 1RL3A 4URTA 5CKQA 4Y26A 3WXPA 1GNYA 3ACIA 4AF9A 4CEWA 5LK7B 3KZ4C 5C4WC 2X53S 4IV1C 3K51A 1GOFA 2MEV1 4MXWA 3AMMA 3V56A 3CZUA 2Y0IA 3VDCA 2VQ0A 2R072 4IGQA 4Z07A 4YW6A 5KHJA 2VNVA 4META 5C3QA 3BODA 1MQTC 4MXVA 1OFNA 1JW6A 1JZ2A 2CSGA 4ATFA 1KDKA 2WZR2 3SCFA 1CJPA 4O9GA 3ZFFB 1FV2A 1V6KA 2VL4A 5FOJB 3A7QA 5J3UA 2WFF1 5SV8A 1LHVA 2CY6A 2NMNA 2YPDA 3K4DA 3T0AA 3LDKA 4JVAA 3I3MA 3NRUA 1U0AA 4Y33A 1S0EA 2CGOA 2ZAHA 2RS13 2XLGA 1HQNA 2ZGTA 4HETA 4PHZA 1P8JA 1SBFA 4S2DA 4A45A 4AHXA 2Z4FA 4AGRA 2ZGOA 4N7IA 1UWWA 4QGLA 5F2WA 1FNZA 1TMF3 2WWUA 4I2OA 1KS5A 4FPKA 3ON7A 1ZRRA 2YC2A 2QZ3A 3ACFA 3KCYA 3PTYA 1WMFA 1ASJ2 5EJ1B 4ZU4A 5L7OC 3AFKA 1URXA 1SDWA 1SBDA 4PBOA 1UYYA 1UZYA 4FTSA 5T5LA 5IFPA 4F8AA 5FWEA 3CQOA 1GOGA 3ASIA 4CE8A 5DAXA 3MUY1 4MADA 2BEOA 4K8RB 4XW3A 3CJIB 1BBT2 2VXJA 4TWTA 3U10A 1GUIA 5HXVA 2RMU2 4N53C 4QPGC 2BP6A 1W90A 3H3LA 1JU3A 3AYEA 3I59A 4GB31 3FJSA 5E6HA 2RM21 5FUNA 4BQXA 3NNMA 4UW6A 3ME2A 3OJBA 4W6WA 3ZYGA 4CDWA 1G9FA 2YROA 1KJRA 4K7JA 1BK0A 3UESA 1MZ5A 2A6VA 3WNXA 4GALA 1OD5A 1EV13 2JWPA 1W6MA 2Q8OA 2XUMA 4OMCA 1VJ2A 1VRH2 1BJQA 1S1AA 3ELNA 2TEPA 3CF6E 4BQWA 4E2SA 3D5OA 4LXLA 4BQ5A 2VOWA 4ZHNA 2QQMA 1R092 3RDIA 4A41A 1OH3A 4E2QA 4LA2A 2OVUA 4XJ8A 1AYN3 1SMVA 2W9XA 3M70A 1WBFA 1PK6C 4WVMA 2DVFA 3HQXA 1BHGA 1ENXA 3M3EA 2I2SA 3SH4A 3N9NA 1KFXL 4Q4V3 2GC0A 3RQ0A 1QQP2 1YIFA 2FQPA 4LEJA 3MV11 5GM0A 1DZQA 1AR62 5BPXA 1BCXA 1ZZ7A 4MO3M 4NOTA 1QJFA 4FCAA 4CZSA 5CADA 2VPVA 3AKRA 1N1YA 1POV3 1ZBA3 3EO6A 4EYUA 2BJSA 5IVFA 3EHKA 4B1MA 1C8M2 4HANA 1C4RA 5LA9A 1X8EA 1FMD1 2UY9A 5FZGA 4BQYA 4ASLA 2FMDA 1VB2A 2ZEWA 5DAPA 5C3OA 1ODNA 1Y7BA 3WNMA 1LHWA 1YLLA 1OF3A 1MR5A 1UZ0A 3H1WA 2PTMA 4RQPB 4X6QB 4RFT0 3DYMA 1NA1B 2ZBJA 4DRVA 1J3RA 2H6CA 5DAQA 1QJU3 4WBBA 2WZPP 3ZXGA 4FBFA 1IHMA 4HT1T 2JDZA 1IQAA 5GKAC 4OLLA 3NNLA 5JOZA 4MOAA 1W8HA 4J1WA 4RR3A 1XE0A 5FP7A 2A3YA 4WZFA 4P02B 2W68A 4RL7A 2D3RA 4NRQA 3ZDSA 4D7SA 1JZ5A 4KI5M 1XYPA 2GAUA 4QQLA 5KXBA 3B3QE 2DCKA 1AX0A 3N9LA 1D7PM 1V70A 1REEA 2D5FA 1X9TA 4PI2A 1HW5A 3AL5A 4PDWA 2J1TA 4FPJA 4P9LA 3VBRA 4EV0A 3BTXA 3D3AA 1UAIA 1HV1A 2H0BA 1A8MA 3BPZA 3GNEA 3U75A 3TEWA 4N43C 5FLHA 2QDRA 3ZMOA 1KXGA 1HRV2 3RI9A 3URFA 3HIFA 2EF6A 4X6RB 4ZXEA 3IZOA 1C28A 2OQ6A 1LESA 3RFRA 2DBNA 4YZ2A 1KDMA 4B29A 4XHBA 4WM7C 3MLJA 4CDQB 2ET1A 1G9BA 4B7KA 3S6PA 3M8LA 4XUPA 3KV5A 4Y1XA 5FMDA 4YW7A 5LBCA 4BA6A 4AQSA 3VHPA 4UXAA 4CUBA 1VBD2 3O1VA 3PNAA 1GQGA 3M4FA 5G05L 1VBC1 2GH8A 1W06A 4OZXA 1W0PA 4EJRA 5FXVA 1H4HA 5F8PA 1DHKB 2W3JA 4LK7A 3M3QA 2EAAA 2AACA 1KJLA 1YFUA 1I5ZA 1RUI1 5A6ZA 1SDDB 4XQ4A 1UD1A 3J8F2 1BEV3 4BPZA 1TNRA 4ISQA 3RZJA 2TNFA 2E33A 5A1LA 2VNOA 1NLRA 2A3WA 4S2HA 2Q8DA 1ND2C 5JCTA 1CZVA 1SZBA 3O7OA 4XFAA 3VD9A 5L73A 4QXCA 3SITA 1XPWA 1DGLA 1XQNA 3KV6A 4PCRA 2AC1A 3ZIXA 1AYM1 2HKXA 1OHFA 3PURA 4LHKA 2HWC2 4FFGA 5FZMA 3MUZ1 1COV1 2F4LA 2WAOA 3KVAA 2XJTA 4IEZA 4CU6A 5FO8B 3Q8BA 3K3OA 2RHPA 5TSWA 2V4VA 3FZ3A 4D6SA 2KR2A 4FPLA 1AF9A 4JKMA 1QF3A 3RWNA 3MHZA 1EUUA 3ENRA 1UYPA 3OTFA 2FZ2A 3KQRA 3T30A 3KCXA 1CAUA 1FPN3 3KV4A 2DUQA 1BVP1 2R16A 2WT2A 3J7NA 5CZKA 1HRI1 3DKQA 4TZDA 1VR3A 2HBTA 3PL0A 3S0MA 2ZMNA 1PZ9A 4YW5A 1UNBA 4QKNA 2PLV1 2W94A 5A80A 3VBHB 2E63A 5LW9A 3P3NA 5I0UA 2R0HA 1PGW2 1RMU1 2GNMA 3AP6A 2HWB3 4IEPA 4Y24A 5D8AB 4B7EA 3N4MA 1WBLA 2R0FA 1EAH2 2ZEZA 3C7OA 3DYPA 3C7HA 3A4UA 4XBNA 2XPJA 5A1FA 1D4M2 4YNIA 1JTZX 2EAKA 4WZCA 1ND3B 2VW2A 2A73B 5FYSA 4QX3A 3DPRB 4DUVA 1H1MA 4P14A 4MV2A 5T55A 3U07A 4LA3A 1X33A 4KMQA 5A7WB 1YFWA 1WD4A 2O8OA 4CDWC 4MYEA 1UX7A 1LEMA 1AJKA 4CYDA 5IHRA 4Y20B 3S30A 4JCKA 5GLUA 4AFCA 4XETA 5A3TA 2HLEA 5IK4A 5IT6A 1LNSA 1JZ3A 2ZZJA 2FMYA 2HWF2 1V6JA 2VBDA 1YQ2A 1NUKA 2BFUL 2WO7A 1RUG2 2ZOEB 1NY72 2I07B 2JDNA 4JRAA 3HVDA 1O8PA 2ZA9A 4R52A 1CWPA 3UKVA 5BNPB 3M3OA 2I45A 4MUVA 1D2SA 2W2IA 5LRRA 1V00A 1O5UA 2WYSA 4ZONA 4IEWA 1SFPA 3POYA 4URAA 1U5ZA 3MEPA 2Z42A 3P6BA 2OPWA 1WLWA 3ZYJB 1YQ5A 2Q8EA 2R073 1OUSA 3K46A 1CAWA 1XNAA 3ETPA 2P17A 2PHLA 2V4AA 1MS0A 3EJKA 3PDQA 1DLLA 5A6QA 3ITQA 1RUF1 4QDSA 2ORXA 3RMXA 5FO9B 2WZR3 5J09A 2RS32 1MS4A 4CP2A 1KS4A 2BQPA 2YBKA 3ZSMA 3UKTA 3PIJA 4LBQA 1H9WA 1WGPA 5A6XA 1IGOA 4IERA 1LKNA 3HPNA 4CP1A 2WT1A 4H3WA 5JZGB 2B9VA 4CTEA 2VMDA 1HJGA 4HMZA 1AX1A 3J7MA 3ZPYA 4DXTA 4XUOA 1GZTA 1W2TA 3TOJA 4FOWA 1LODA 3MW3A 4EWEA 4AVCA 1JZ4A 3WG3A 4JX0A 5LY2A 3MPPG 3OGSA 5FY7A 3S7IA 2QQNA 4XF4A 3KHCA 2JKXA 1HXS1 4UFIA 1DU3D 4ATEA 3PJQA 4NPMA 1AR72 3I7DA 3MV01 1ASJ3 4QWNA 3LAGA 4LUKA 5F3GA 2QFEA 5A3LA 2GSYA 4UYBA 3AYCA 2W87A 3LOIA 4DPNA 3ZYIB 1TEIA 4RR3C 1O4ZA 1YCIA 3ZYFA 3LE0A 3LWCA 4A7YA 5J1XA 5CG9A 1TQ5A 2CDPA 3T2OA 3C7GA 1SACA 2WNUC 4FFFA 5FAXA 5IATA 1EUTA 3SXWA 4D3WA 1BXHA 5JPMB 1MS8A 2R061 4M0HA 4P00B 2WWSA 2UWBA 2DBIA 3VKLA 1C5HA 1BBT3 2K0GA 3CO2A 1V0AA 4PDWC 3WHUA 3R4UA 3KF5A 3FFQA 2RMU3 4NAOA 3C2UA 4YVSA 3BVCA 3VBRC 1JZ8A 1PM7A 3IWZA 3O1PA 5FPVA 5FZ4A 3WG1A 1H2LA 5DDJ2 2CAUA 5LA2A 2ATFA 2EXJA 1C3HA 3D4KA 2GC1A 1LU2A 3GDBA 4XIOA 3T08A 3DF0A 2YYOA 4YM0A 3HD8B 2JG9A 2D3SA 2XQXA 3LIGA 4YG0A 1CZSA 4X8PA 2CAVA 1W0OA 1QKQA 1SLTA 2RV9A 4LJHA 2NP0A 2B7YA 4FPFA 3OUIA 3T4HB 3FE5A 5FZOB 4X8NA 1V6MA 1TMF2 4W65A 2PAMA 4WM8C 5DABA 4LE3A 5FY4A 2BRTA 2VD7A 3UETA 4XUTA 1R093 4CCMA 5DAVA 3G6JB 3LZZA 1YRZA 1YFXA 4MSVA 2Y64A 4JGYB 4XCAA 1QQP3 3NW4A 4GIQA 2PQSA 2WAAA 5DPNA 5CFDA 4A44A 4ARYA 5C9AA 1AR63 1YYNA 3I2IA 1WW5A 2K2SA 1DZRA 4BM8A 5IUQA 3VDBA 2C4XA 2DURA 4JQTA 2ZHNA 3POJA 4FO9A 5IAXA 4C8DA 4GWMA 2BNOA 3W5MA 1C8M3 4I3PA 2FDHA 3WP3A 3N35A 1RUC1 3ACLA 1IG3A 4N8MA 3HN1A 4M3CF 4H14A 1MS9A 1PMJX 1UYXA 2IZWA 3JZVA 4FVVA 4QXBA 1OA4A 4XVHA 2QKDA 4CCOA 3T0DA 1CESA 4XJZA 2VGDA 3ZFEB 3KHBA 4JTNA 2VH9A 2VCCA 3NJZA 5FZ0A 2WO2A 2BNMA 4L99A 3WCRA 4CDUC 3BU7A 1CN1A 3L2HA 2AR6A 3M7AA 4M01A 2JG8A 2LRPA 1QIQA 3F95A 2ZGRA 1D0HA 4P9YA 1YI7A 2JD9A 5LBFA 1LEDA 2WUHA 4GMP1 1GKBA 2R7EB 1AL23 5FJKA 4FP2A 1HB3A 3N7MA 3H50A 2GDFA 2HWD2 5GLZA 4KL1A 2F17A 3TNQA 3VZKA 5FPLA 1O8SA 4XQWA 1LHOA 5FYMA 1FYUA 1TE1B 1DYOA 4COWA 2X5IA 1BMV1 3ZFFC 5F5CA 5JIAA 2O8QA 4IGPA 2FD8A 3AZZA 2RDSA 5JSRA 2Y6GA 4NPRA 2O14A 4LOSA 3MIBA 3VBOA 1DCSA 3ZSJA 4OULA 1HRV3 3SLIA 5KC6A 1PM4A 2ZPXA 2QNKA 4JGZB 3IKWA 1R1A2 1Z78A 3VBUB 5LA0A 3LA3A 2R49A 4AFBA 1VBE1 3E5UA 5FBZA 1VBA1 1LU1A 1UMIA 2OS2A 2QQLA 3IMNA 3VKMA 3LCPA 4HZFA 4LBQD 4AQ6A 1XB9A 5FZ7A 3RNSA 1A6CA 3KGLA 1CGPA 5FR3A 1H8VA 4UOJA 5KBFA 3QD6A 1QJU2 2GALA 2RDQA 2WWJA 5H9PA 4Q4W1 3WW1A 2WIIB 4JC1A 2E31A 1VBD3 4HONA 2XHNA 1NKGA 1S0CA 2VAUA 5E89A 3ZM8A 4CCLA 2HH9A 5C71A 1O3QA 1OKQA 3KM5A 2YV8A 5FZEA 3ACHA 4MH0E 1NZIA 4LKFA 2PMWB 2GZWA 5AVAA 4NIIA 4ONUA 4XF1A 4XJUA 4XTMA 2AUYA 1OXCA 1QJX2 3DPRA 4EZHA 5FUIA 3J8F3 4BHPA 2P34A 1M4WA 2DWRA 4GJZA 5EWSA 3BTZA 4QPGA 3QH7A 4B4QA 2ZHLA 1J84A 2RJKA 1ZVFA 1WKYA 3NNJA 5FZFA 1YO8A 3VZNA 4Q4X2 2XXZA 2A3XA 3CMGA 2JDMA 3GALA 2KA3A 4YGCA 1OH4A 1W28A 2R32A 4GXLA 4XFGA 1TME3 2W39A 4J6GA 2WS92 2HWC3 3LEGA 4COZA 3AMPA 3E6DA 1PGSA 5FP9A 3QOPA 3ZO0B 2RS11 3DL3A 2Y38A 2B4KA 3LA7A 4EN9B 2BVVA 4U2AA 2RDNA 1ZRFA 1SEFA 5BNPA 4WVZA 1HN0A 4AI0A 1AXYA 4MGZE 1PO22 1SFYA 2B42B 4JHZA 1JMUB 4D7TA 2IFWA 1JN2P 2A70A 2EXHA 4TN7A 5K0UA 2YBSA 2DF7A 5FXWA 2X09A 1OURA 4JTOA 2Y8KA 4K40A 3HWJA 4AHZA 5EFUA 1LHNA 4HK8A 4HKOA 5EP9A 3U1XA 4OUMA 1DQ1A 3ZLIA 1QNYA 4Z8BA 1AVBA 4GH4A 3X29B 1AR82 4D8MA 2ZABA 3POIA 4QT6A 3I8TA 3ZXFA 1I5PA 1C5IA 2PHXA 4JHTA 1EAH3 1W8NA 2J1VA 5FY5A 1W0NA 2GN7A 3LSEA 2UWAA 3P1IA 4CXXA 1D4M3 3D82A 4J25A 2VW1A 2ZGLA 1UOBA 4UI9L 1NX9A 3RZLA 1CX4A 4Y22A 5JR7B 4O65A 5GLVA 1HX6A 1M06G 3PUAA 4FOVA 4BQ3A 2XUEA 4QQPA 4I02A 1W04A 4AEDA 1UU4A 4AQ2A 3HEIA 1EV11 2WC2A 1CAXB 1SLCA 4Q8LA 2PFWA 4I0WB 3LPFA 3RPQA 4ZZ5A 4IE7A 3T1MA 1K42A 1G86A 1UXXX 2CYFA 2JG9C 4PBPA 1VBB2 1WW4A 4MGSA 4AG4A 3W5NA 1XYOA 1SCSA 4M4RA 4EE2A 3DEMA 1E5IA 2GNTA 4UW4A 2JENA 2WL1A 5F6KA 5CB7A 1WCDJ 5T50A 2CTVA 2GN3A 2HWF3 2EIBA 1AYN1 4QU2A 2W5FA 4NHMA 4AHYA 4CU8A 5BNOB 1V6OA 3OY8A 5KXDA 3P3PA 2FHRA 1IPKA 4XUQA 4Q0QA 2B9UA 4XF9A 4Q4V1 2OA2A 3POSA 1QJZA 3ZMNA 1H30A 1JH5A 1NCRB 3GJBA 4LR4A 3RVHA 2ZGKA 4OHXA 4D69A 1GWMA 2RVAA 2WQ8A 4YPJA 2YUEA 1POV1 1ZBA1 1ZZCA 2PHDA 1LTEA 2XWBB 3HT2A 4QPIA 2XBO2 2UYBA 4ARXA 3MIHA 4PIZA 5DUVA 3T0BA 3LEMA 3JBG1 2BU9A 2FZ1A 2HBUA 1OLMA 2RS33 1F35A 2RS52 3U4SA 4XFFA 3RYPA 3ZR5A 4E4ZA 3EYPA 1GU3A 4BXFA 1OMIA 2ZGNA 1N3PA 4IDZA 4L92A 1R083 5A3OA 4NWWA 3BOPA 1RB8G 2E9QA 2VOTA 4V2WA 3NL1A 1VLNA 3ETQA 1ZX5A 2B45X 2V09A 3MLLA 1OD3A 3N3HA 4IXLA 3ZYBA 1PGL2 4JDMA 1XC6A 3O1TA 2QTWB 1ZYBA 4QX1A 4AI1A 3LIHA 3POWA 4Z1VA 1AR73 3WY6A 5FPAA 3N9PA 2WA3A 4GD4A 1OQDA 1E5RA 5AC92 2JG8C 3UJQA 1Q56A 1Y9QA 2VECA 3AZWA 3GZUC 5CFCB 2CGPA 4JV4A 4BU2A 5I0SA 3H8XA 4XXPA 3MLKA 1RUE2 2PHFA 3VDDB 4FQ4A 3LB9A 1PO12 4UWDA 2LTNA 3BUCA 4CUGA 4UW3A 3J7HA 4CU9A 2JDYA 4GKYA 3LOBA 1BK1A 4DNYA 2XJVA 1ND2A 4XILA 3JB8A 1VAMA 2P3YA 4JAAA 3WLUA 1S2EA 1A3KA 1W6OA 1UY1A 3I4IA 5C3RA 2X5IC 1K12A 1PZ8A 2GP3A 5I8TA 2HYKA 1XU2A 5C8CB 3HQUA 4H7LA 2D7FA 3GZEA 5DDJ3 3JD72 5A7NA 4SLIA 2IXJA 1F2NA 3ABZA 1IS4A 4MHRA 3VBOC 4CUAA 3APBA 4NROA 5FPZA 3W20A 3ZR6A 5I93A 5JXJA 4UF0A 2UY8A 2WO3A 4ZS2A 3SEPA 4D94A 2RDRA 3T3YA 2B8MA 5JOYA 2IUWA 4FSJA 1Q8PA 3MI8A 4YZ3A 3L9JT 1NQJA 1QXRA 3PMEA 2ETEA 3HR9A 1WZXA 3GCXA 1W8FA 5C8WA 2Q8CA 5JWPA 1MEC2 2D5HA 2ZAAA 4FT8A 4AE2A 3O0VA 5E16A 2PHUA 4FPOB 2Z69A 4AOCA 2NLRA 3GF6A 1MZEA 2Q1ZB 1HV0A 3WF1A 1GZWB 2VUAA 2XKOA 1GZ9A 1ULCA 4QX7A 1CAVB 4A2UA 2GMMA 1BEV1 2E51A 2YHJA 1I3HA 1VMFA 2JICA 4OI2A 3VDAA 1Y3TA 4XJ9A 2HWE2 2VZSA 5GZGA 1O3SA 3UKNA 2G1MA 2W47A 3AX4A 3DPRC 3WOGA 2X05A 1ZA7A 5GZEA 3U78A 2PA7A 1OFSA 1UF2C 3AKSA 4YFWA 4BJ0A 3F2ZA 3AJYA 3AP7A 4GMP0 4QB2A 1AXZA 2VZTA 1CZTA 2ILMA 2H6BA 3WW2A 1BKZA 4K8FA 3H9AA 3IDEA 3NAPB 3VBFB 2OX0A 1OBNA 4QU1A 4EROA 5FP3A 5T54A 2VMEA 3HNMA 2XWJB 3ZPOA 1QHDA 4RHV2 5FY0A 4DIQA 3CBNA 3AP9A 2J7MA 3IDAA 4XQDA 4GKXA 4ZXKA 1FPN1 4DEVA 5BNPC 1ZBE2 4UFMA 2PYTA 1CJDA 3SEEA 3K2OA 4KWLA 1RVF3 3V0AB 3AKPA 4TXWA 1OQEA 3ZYRA 4PLOA 3KB5A 5DUUA 1EYBA 4BMEA 5K0UC 1KRIA 5FYHA 3SQOA 2HWB1 4PF5A 2W92A 3FX3A 2VZOA 2HWD3 2CL2A 2AEZA 3RG0A 4GH4C 2IXHA 4ZS3A 1OOPA 4NUBA 2DYCA 2BTVC 4AI9A 1CVNA 4OHZA 5KHIA 3M3IA 5KHKA 1TG7A 3WDYA 4B4RA 5A3NA 5HBAA 4R4ZA 1CIYA 1RUD2 3FMGA 4E27A 1C1LA 1Z7S1 3KD4A 5F3EA 4KBBA 2AGSA 5JZGC 3IPVA 1W8OA 3WP5A 1XRUA 3ZDVA 3T4VA 4LOTA 3WHTA 5FZBA 3MZHA 3NV1A 1R1A3 2ZKLA 3E1F1 3EB7A 3IIAA 4N9HA 1NOVA 4XJAA 4AAPA 1SFNA 4AEDC 4OVEA 1K45A 3IDCB 4Y4YA 1JOBA 1H8TB 4YVWB 4FAGA 4TYSA 3VHNA 4LBOA 1LAJA 5APAA 4D6QA 4A4AA 2YC0A 1SPPB 2JE7A 2ZHKA 5D1IA 3FWEA 3PVEA 1UQXA 3SISA 3WG4A 4TSVA 1RC6A 4PQQA 3G7DA 4HVOA 5F5AA 3HNYM 2FDFA 3WINE 5FYCA 5JUVA 1AL22 3GJAA 5IWFA 2WNUA 1ENSA 2EICA 3CKHA 4LT5A 5FUPA 5A32A 1QJX3 1UOGA 2RR13 1G6NA 2MHFA 3ZFGB 1RYYA 2EALA 2R071 5LA1A 2ZX3A 1AX2A 4YGEA 4XDOA 1PMHX 3B00A 4AVSA 3KVBA 3U37A 2ZJCA 4MGQA 2WZR1 4QPIC 3CNAA 4BCUA 2IC1A 1W6QB 2BUKA 4Q4X3 5FPUA 2E32A 4M3CA 4AI2A 2F6BA 5FV3A 3WR0A 1ZREA 4QHBA 1V9U3 2WS93 4XBQA 1AUYA 3A0NA 3USUB 1FOD2 3ZX7A 1U5XA 2VTFA 5I8YA 4BLJA 1JXNA 4FP3A 5BXXA 2Q1FA 2QQWA 1G9CA 4UT5A 2R042 2VC9A 1S0DA 3KCCA 3VKFC 1VP6A 3VD3A 4HK9A 1PO23 4DXZA 4WM8A 3OPWA 4NHXA 3UL2A 1ASJ1 1DGRN 3OGGA 2GU9A 2MEV3 4K6BA 4ZPIA 3ZN6B 4LLFA 5LCWL 3PUSA 5B4XA 1O7FA 3ZSLA 3Q9OA 2V5DA 5I0RA 1W6NA 5CG8A 3VB9A 1MZFA 1JI6A 3R4DB 1LENA 4YZ5A 4K1YA 2W08A 1FXZA 4LK6A 1AR83 5DZEA 5CVRA 4NWVA 4NRPA 3K4AA 2BZDA 3TN92 1BBT1 1W8ZA 4CDXA 1SCRA 1CONA 3PHMA 1ULDA 2RMU1 3M1HA 5FCCA 4Y4RA 5ERLA 3VHOA 3AYAA 4RYDA 5FYYA 1UW8A 5FMOS 4LE4A 1U12A
chains in the Genus database with same CATH topology
4Y1VA 4JQRA 2VW0A 1S0IA 1HXS2 3GHNA 5E8AA 4MLOA 4LBLA 5AFEA 2E7AA 4N9IA 2UU8A 1TME2 3IDBB 4Z82A 1UPSA 1NE6A 2PHTA 5IK5A 4CDUA 1N47A 4LLOA 1PVC2 1POV0 3PVOA 1VRH1 4GULA 4KG8A 4XEZA 1VBB3 4KGGA 3KT4A 4RS5B 3TNPB 5C6CA 1R091 1NXMA 3OYWB 1LRHA 1N1SA 3D0JA 2VMIA 5C4WB 4IV1B 4GA9A 3ZVXA 3NV3A 2D43A 3MICA 1DQ2A 1OPMA 4KGQA 4KWKA 1QQP1 4YM2A 2QDNA 1AR61 2RM23 1DQ0A 2OW4A 4Q0PA 5C8CA 1ALYA 2A6ZA 5LEKA 2JD4A 4LUMA 1WLCA 3ZFFA 1RUJ2 1QOTA 3VZJA 1WCKA 3DKWA 2XBO3 1C8M1 3DGTA 4JGZC 2A6XA 2VNGA 5A33B 1O3TA 1NZCA 4DMIA 3WQ7A 1MS1A 3V0BB 1N3QA 1RUH2 5KXEA 2RS53 1VALA 3RYRA 2OPKA 3ZN5A 1AR92 1JYCA 2QVSB 1VB4A 2Z2SB 1RTVA 1BVVA 3IBMA 1QOOA 1H2NA 4C1WA 5L7OB 2JE9A 5GZFA 4Q0VA 3QLQA 5E1RA 1ENRA 5ACA2 4NN0A 5BV6A 5AC93 2EIGA 2BVBA 1UIJA 1CIWA 1NCQB 1QDOA 2PN5A 1RHI2 3CJIA 4J1XA 4QQHA 4AK3A 3RRDA 2OZJA 4LO6B 1RUE3 4NHKA 4XFBA 5GLWA 3WDXA 4DOUA 1PO13 1HLCA 4XZPA 4EN8B 2EXKA 4IEYA 1RGSA 1N1TA 2QQPA 1OOPC 4RGAA 3MFAA 5FQ0B 4XOGA 1HRV1 2GH2A 2VNRA 1QXJA 2GNDA 2LALA 4KQ7A 3JD73 1LOFA 2IXKA 4C0BA 4FXGB 1PNFA 1WMEA 1R082 4R9CA 2MNGA 2BBVA 4FPHA 1VAVA 3AXDA 3KSCA 1PK6B 3FLPA 1VBD1 4KH9A 5FLJA 3H1MA 1WD3A 1MEC3 3MIGA 2JECA 4BMBA 1GZCA 1C1FA 1XE7A 2ZHMA 1PIV2 4G9SB 1H1AA 4FQZA 4AI3A 5CAZA 3J8F1 2VG9A 2D97A 3WG2A 2ARBA 2WSUA 5B2GB 4A7KA 2HWE3 4IEUA 1ZRCA 2VVEA 5CIRA 4XMAA 4YW2A 4IEOA 4HKLA 4YZ1A 5J7MA 3FFZA 4I0AA 5I0TA 4RQPA 3BOWA 2VOXA 2WLQA 5BNNB 1F5FA 4RA0A 4RGGA 2N7GA 1NA1A 2B5HA 1QU0A 2HWC1 2BPA2 4XYXA 3E5QA 3ILRA 1OA2A 3OCPA 4IEXA 3SH5A 3O0XA 2A5ZA 2DV9A 4NO4A 5CBLA 3ES1A 1GNHA 2DUPA 3VL8A 1LCLA 4RHV3 4AHWA 3RJRA 1AL0G 4XJWA 4XHXA 1D2QA 3AM2A 2YMZA 3INAA 1ZBE3 3ZFGA 2DCJA 1ZRDA 3WUCA 3BTAA 1AJOA 3VBSB 2DUOA 1NCRC 4K3UA 4Q2FA 3L2YA 1E57A 5FOBB 1DFQA 1PGW1 2AYHA 3AZVA 5GALA 1W6PB 1ULEA 3HAGA 3U11A 4CP0A 2VOKA 2ZKNA 5BY5A 3U4XA 5F9TA 1D4M1 4N43B 2ZTNA 3ZSKA 4C1XA 4KG0A 1IPJA 4CDXC 1RUD3 4XPVA 1R1ZA 2VUJA 5I91A 1UIKA 4AVAA 5H9QA 3J4UH 4CDQA 4Q4Y2 2JEMA 4WM7B 1OI6A 4P9IA 2IXIA 2DVBA 3UK9A 1DYKA 1ULGA 1IOAA 3CJXA 3WP6A 1UPIA 5JPNB 4COYA 2YDEA 4UBGA 1S2KA 1CD3G 4E9KA 5T5PA 3U0ZA 2HWF1 4IV3B 1RUG1 1QH7A 1NY71 4L2NA 5JDBA 5FO7B 2ENRA 4DZGA 4Y1YA 3VDDC 4CEWB 2CWMA 4L11A 1RVF2 3JCIA 5JVVA 1EP0A 3R05A 4JDOA 4CEYB 1QDCA 3SH3A 1DGWX 4MXWB 2ZGMA 4QXKA 5GLTA 2BWAA 2DU0A 1A8DA 5EYYA 3WQ0A 5C8CC 2E53A 2YPJA 3KT7A 4AYUA 1RJ8A 1HDKA 1RINA 3JUUA 4AQTA 2RS31 4FPEA 5HI0A 2XLAA 1PZ7A 1OA3A 3A0KA 1EY2A 3ZXJA 4HL0A 3RI8A 3ROUA 1FOD3 1YJKA 1XU1A 2EVXA 2RE9A 5C33A 2ZX4A 1ZZ8A 2R043 4YGBA 1AR71 4R4XA 4HN1A 1QJY2 3VBHA 2B39A 4BZ4A 2YY1A 5KWRA 4DFSA 2R1DA 5D8AA 2ZCWA 3VLBB 4ZU5A 1BQPA 2HEYF 4G4FA 4COVA 4IEQA 2WFPA 1Q8SA 5A33A 3B02A 4PLNA 3JBG2 1GYKA 3THPA 1ND3A 1G8WA 3CJIC 3V0BA 3ZXDA 2QE3A 4Z92B 2RR12 3TN93 1YHFA 2P2KA 2ZACA 2VY0A 3R6SA 1H1IA 4LULA 2P3KA 4LO7A 5L19A 3C3VA 5DDJ1 4Y20A 3VBFC 5LEJA 2PELA 1HXS3 5JOXA 1O5LA 4LO4B 3JU9A 1V9U2 3B93A 3IN9A 1ZNPA 3MIDA 3N7JA 1W6MB 1LOFC 1PNGA 1NCQA 1Q8QA 1PVC3 2SBAA 3V65A 3BB6A 1TMF1 1O4TA 2VULA 4AXOA 4K1ZA 3WVJA 2AREA 2MEV2 3ZYPA 4OHYA 4WVMB 5FRAA 2R063 1J58A 1OSGA 2GMPA 2WA4A 3TYJA 1MVQA 3WDTA 1XNKA 1S0BA 4OFGA 4A3XA 4BOWA 1KQRA 4FPCA 1C57A 4LBMA 1SLLA 1XNCA 3D6EA 3VGIA 1IS6A 1RUJ3 1LOGA 2PAKA 3D0SA 2AH2A 2WFF2 4ZKTB 3NKTA 5JZGA 3H0OA 1FAYA 1W39A 4AI8A 1T6GC 3FC0A 3N7LA 1B35B 2VQAA 4RQPC 1RUH3 5A3MA 3BALA 3MF6A 3GHMA 1RUOA 4MVTA 1AR93 1NA1C 2WQ4A 5DUXA 1C8NA 2B46X 3LSDA 4FPGA 1J3PA 3H7JA 4MX3A 2FBEA 3AFGA 4R9DA 5IK7A 3GYDA 5ACA3 1MS3A 3QBQA 4HPKB 3ZFGC 3OPZA 4KU8A 2WJSA 1QH6A 1RHI3 4ISRA 2HWD1 4TLFA 4YW4A 1GLHA 4WV8A 3WP4A 1WW6A 4NHLA 5BNNA 3MIFA 3WW3A 1YUDA 4GB32 4BH9A 4PDWB 2RM22 4OHVA 3VBRB 3NWKA 4B3NA 3B9IA 4XFCA 5T5JA 3LKJA 1NE4A 2C1FA 1UU5A 3KMHA 3AZYA 1F9KA 4AGVA 2JXAA 1HKDA 1UN1A 3DUIA 2XJQA 3KGZA 3RS6A 3VL9A 2QCSB 3FUQA 4OUSA 4RD7A 3N7KA 4CDQC 2ET7A 3VBSA 4F83A 2PAEA 2Q30A 4ES8A 2IXLA 2NQYA 4YG3A 1DIWA 3VKOA 4COUA 3SCHA 1NG0A 5J36A 1QJU1 1ZZ6A 4HKWA 3ZXLA 4L97A 1Q8VA 4KU7A 4Q27A 1HQWA 4JGYA 1J1LA 3KT1A 4QMAA 3B5LB 1MACA 2P3IA 4GQ7A 1U5IA 4HSJA 4YGDA 1PIV3 3AMHA 1QJX1 1YXWA 3JQWA 2XJRA 4P9WA 1AZDA 4LNVA 5HCAA 1FMD2 1XNBA 1APNA 1LOCA 2JJ6A 2BW8A 1CQ9A 4R9AA 1XNDA 4E2GA 1YNAA 2W0XA 4Q4X1 3M3CA 2ZMLA 1Q8OA 4DINB 3ZFEA 3GBGA 2HEWF 2WS91 4KNCA 4XMIA 2XL7A 2CNAA 3FLTA 1ENQA 2WSVA 2WNVB 5EV7A 4EN7B 1Q5OA 1O4YA 3PVBB 1D0GA 2XVLA 1H2MA 3PLQA 2DVGA 1PO21 4CEYA 1WUVA 5KHHA 3EQEA 1CAUB 3SCGA 4OI4A 3VBHC 4NVPA 3MDPA 5D8AC 1JUIA 1AR81 5I8SA 1RIRA 1I1EA 4UW5A 1QMJA 1JYIA 3TRSB 2ZX0A 3AXEA 4Q0SA 1DG6A 1J59A 1ND3C 2Q5TA 3QH6A 4JGZA 1AHSA 3VBUA 2VMHA 3AZXA 2D6KA 2XB6C 2BWCA 3M2MA 3ZXEA 4AEMA 2XHKA 2PQQA 4Q4Y3 3QCWA 3TBDA 3MFCA 4E4SA 2V73A 1L3JA 3OBTA 2RJLA 2WNEA 3B69A 2R30A 2VU9A 3HMYA 3WX5A 1BYHA 1PMIA 4HN0A 1VBB1 1RITA 1F8VA 1NQDA 2MPFA 1VBC2 1NLSA 2LM3A 3OGJA 4BIFA 1JOJA 4P9JA 1NCQC 1RUI2 2Q0AA 2QJVA 2BYVE 3ES4A 2TUNA 5CU1A 3GZAA 4N90A 1SQ4A 4K20A 5EZWA 4BE3A 1S2BA 2XJPA 4QM8A 5J37A 2XBO1 4E4DX 1AYM2 2C5DA 1CAWB 4AFMA 1PVXA 3KLSA 5ABJB 1COV2 3PVNA 4QX5A 4H7MA 2RS51 2WT0A 4ORFA 4LBQB 4M0NA 2Z5WA 1LOEA 1B09A 2NM1A 4I3GA 3VV1A 1ONAA 1VIWB 1KD7A 3O0WA 5FMOL 4LBNA 2VVDA 4MGIE 4C0HA 2WLPA 1PGL1 2IXCA 1HRI2 4M3CE 1BZWA 5JI7A 3RYKA 1S0GA 2D6OX 2SLIA 1QJY3 4Q26A 2PLV2 4AEJA 2GMEA 3O5SA 1G7YA 2O1QA 1RMU2 2YXSA 4NR1A 5AC91 4DS0A 1QNWA 1G9DA 1Q3EA 3UV9A 1RUE1 2DCYA 4W6XA 1EPWA 1PO11 3WV6A 2X8KA 3JBG3 3ECQA 5L36A 1B35A 4BQ1A 3AKQA 1REDA 2D98A 4EN6B 5BNNC 2OUJA 4QQ2A 2ES3A 4YRDA 3AMNA 4YVSB 3WD5A 1CAXA 1O91A 4XF3A 5DXDA 3FUOA 2XGXA 4YLZA 2UWCA 3JD71 1MVEA 2JG9B 3BCWA 3ST7A 1WCSA 2I74A 2ZZQA 4HPKA 5JI9A 1UKGA 2OIIA 5BNOA 1CPNA 1JHNA 3DN7A 4XE9A 3VBSC 2IWGB 3E6CC 3OD0A 5JIUA 1WMDA 3ZXAC 5AFBA 4HVQA 4LO8A 3V64A 1MEC1 5F1RA 1NCRA 1N1VA 1WA4A 3TAYA 5BNQA 1DQ6A 4JGYC 3H7YA 3WUDA 1IZ3A 1UU6A 1Q43A 4ASMB 1QGLA 1HQLA 1YFYA 3SHRA 3PMSA 5CFDB 2D6PA 2HWE1 2Q1MA 4HBNA 5C9AB 1X8MA 3S7EA 1RUF2 2X29A 3RMYA 4QD2A 1W2UA 3MW4A 3WW4A 3N36A 3B94A 2P3JA 1S0JA 2WFF3 2NZ9A 4QGMA 3H3UA 4IL7A 1D4VB 2YGMA 3WDVA 4YARA 3ZXKA 3I2DA 3B01A 3ZFEC 1LULA 2D93A 5BUVA 4W6YA 1NYWA 3MPBA 2DCTA 4C90A 1SBEA 4IV3C 3PJYA 4AW7A 4RHV1 3CLPA 2JG8B 1QY4A 5CFCA 1ZBE1 4CEWC 1IKQA 4HSLA 3TWIA 4CEYC 1K5MB 3VDDA 4XFIA 4YW1A 1O3RA 3K48A 1UCXA 1LGNA 2C0ZA 2R062 3B7MA 2Y0OA 5KXCA 1DQ4A 2C9AA 4Q1RA 4GB33 4I0BA 5GZCA 1MQTB 2X5IB 3VZMA 4EN0A 2WNVA 2AZ5A 1RUD1 4XIKA 5GJ6A 3QACA 3T2TA 4D7YA 3FBYA 3VBOB 2PHWA 3VBUC 4AWDA 4QGNA 4LHLA 2E7QA 5K9YA 4C91A 1DGRA 4Y5Z0 4Y1ZA 1IS5A 1GZWA 5BYNA 2VXRA 3TB0A 1CAVA 2XG3A 4QPYA 3UJOA 4F7ZA 4P9GA 5J98B 1SLBA 1YIPA 3CU7A 1NXD1 2A75A 1AL21 1V6IA 1Z7S3 5HCFA 3HT1A 3E5XA 5DZGA 1FMD3 2DVDA 1RUC2 3EBRA 4LHNA 1X50A 2G9FA 4N53B 2QUOA 4QPGB 3IT8A 4KWJA 5GZDA 4Z2WA 5T3NA 2A6YA 3USSA 2Z79A 4BIOA 1JUHA 3NAPA 4AFAA 1CPMA 3VBFA 3AP4A 4DY3A 3MYXA 1FOD1 4XTPA 4EWAA 1DGWA 1XE8A 2D44A 2BGCA 2DFCA 4ES9A 2R041 2XLFA 1GFF2 2LUWA 2ARXA 3V0AA 2O0OA 1QWRA 3NV4A 3O14A 4DB5A 1LOBA 3ILFA 4YFZA 5K0UB 4PJYA 4M00A 1LJ7A 5EJ3A 4AFDA 4OI0A 3R0RA 3MGUA 2WQZC 4YM3A 3MIEA 1X36A 1IS3A 2A71A 4GH4B 5ABJA 1BMV2 4BLIA 4GWNA 4A7ZA 3FBMA 3THTA 4WVWA 3WT3A 5F6LB 3TN91 5FDBA 3NSTA 1VAKA 3EXUA 5T5OA 2BNNA 1B35C 3SMHA 4BWOA 1TNFA 2V5YA 1ZZBA 1VBE2 3JQXA 4Y22B 4EWDA 3IM0A 5DG2A 1G9AA 1VBA2 2ZGSA 2YGLA 1A78A 4AEDB 4BYYA 1H8TA 1TME1 4YVWA 5JAXA 4WVVA 4Q4W2 1DQ5A 1LECA 2ZGQA 4FOQA 1IKPA 1PVC1 2K9ZA 1VBC3 4QQOA 4U36A 4PIYA 1KFUL 1UZZA 1GANA 1LHUA 5BNOC 3AP5A 3VN4A 4L9BA 1LR5A 1UL9A 4HFSA 4I09A 4K21A 5EYXA 1FT9A 3OY8B 3AKTA 4IESA 3VZOA 1RUI3 4HLTA 4INDA 4IEVA 1V6LA 5E88A 2UURA 1S55A 3O12A 4MGYE 1H4GA 2KXLA 1SLAA 4N7UA 4XXAA 1W6QA 3DV8A 1RUJ1 1DZTA 1EAH1 4QPIB 4LBJA 1AYM3 1F31A 3R4SA 3S7IA 1UX6A 2VVFA 2GC3A 1HIXA 2BFUS 2UYAA 4Y1UA 3USUA 3T1LA 1COV3 2RS12 2ZX2A 1RUH1 2CV6A 2D6LX 1VRH3 3ZIWA 1AR91 2OZ6A