3K4AA

Crystal structure of selenomethionine substituted e. coli beta-glucuronidase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
605
structure length
597
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYVGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-glucuronidase
total genus 140
structure length 597
sequence length 605
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k4aA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k4aA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k4aA03
3QIWD 4PRAA 5MERA 3N04A 4GAJL 2P5WA 4LCYA 3O8XA 3SBWC 4D0DB 1JAKA 2APXA 2L4OA 3OZ9L 4I9WD 2QPUA 1PDKA 5DRWA 3FN9A 4R0LC 3WO4B 1E1EA 3CVIL 4DKDC 1G01A 3O0RL 1KIPA 5BRPA 4JHWH 5DD5H 1CYGA 1PX3A 4UUJB 1C8YA 4G3YL 4H20L 4U7SA 5C8JB 1RPKA 2W0KA 2DQIL 1VERA 4F15C 1ISWA 3VXRD 3S5LA 1OF4A 2IH1B 1K8IA 1GNXA 5SX4H 3S37L 5KN5B 2R8SH 4B7IA 1GGYA 3O11B 1P4IL 1FL6B 3WH7A 3DRTB 3QQ4B 2JKXA 1LEKA 2XQXA 2VUYA 1NFKA 1AXIB 1T0PB 3WEOA 4H41A 4UQCA 3T0EE 3MRHA 2BOCA 5D5ME 5F96L 4WF7A 3EIFA 1G6RB 2AVGA 5DEFA 3LQMA 2AJVL 3P9MA 3CXDL 3SCVA 3VRIA 5C0JA 2BVTA 2W46A 2D4FA 5ESVA 2WCSA 2B4CH 4QRRA 2FH8A 4K8RL 1UT9A 3MOQA 4E42A 1H49A 2FHBA 2E9JA 4G9FE 4L4VD 5TJWK 3QI9B 1VHPA 3ILQC 3UJJL 4E42B 4KJYB 3F7RA 3AIBA 1KTRL 4JFOB 2J4WH 2VT0A 4PLJC 5HDLA 4GQQA 2FO4B 1IKFH 1N0XH 1F3DH 1W1TA 4BA0A 3L3KA 2DT3A 4IJ3C 2BCKA 3Q3GA 4P9HL 2AQ3A 3CK0H 3BWUC 3WV0A 3BP6B 1KLUA 1DN2A 1G9MH 4F66A 3MRMA 3GBMH 3I3EA 2CMRL 1X7QA 2J5LC 2G75B 5HDBF 4G7VL 1HSBB 1QSEA 5DK0A 5JMOA 3V0WL 2CDFB 5A8PA 1Y0LA 5L7XH 3WO3B 3MLTA 5JW5A 3LVEA 1LO5A 2D7OA 3A6OA 1ACYL 2Y36H 5E8PA 3MJ8A 2WMHA 4XNQA 1KB5L 1A22B 3FQWA 4BFBD 4WWKB 4LSDA 1MRCH 3OZ9H 4JM2F 5K9KB 3SCMB 3I2GA 2OP4L 2R1XA 4HKXA 5JR1H 4PMVA 1PEWA 5HI4C 4FLOA 4R7NA 1V0NA 4J3VA 3MOAH 1ITXA 2WZHA 3D39A 1FZOA 3C6SB 2GSGB 4O4YL 5GISL 3C6SA 1F58L 5CINH 4PGBB 4TQEH 5CKGA 1F11B 1PKQA 5HBBA 1Q6EA 1QBBA 3VXOA 4PJIE 1UC6A 2MPAL 1ZT7A 3MX0A 2OSYA 1Q0YL 2PO6A 4Y16B 4NWUH 4X6CE 2QADC 1E43A 3HI6L 5DD5L 5JIPA 1E4WH 2AXFA 4R8WH 5KSAD 1NCAL 1W99A 1JFHA 5DJYB 4F7MB 5KVMC 1EJOH 1X3DA 2EDNA 2VDNL 5IVXF 1H3XA 1RP9A 3UG3A 3HE6A 1FNSH 2R4SL 3BUTA 5GRVL 3WIFB 2WWMD 5JORA 5FV2A 4UBDD 3CSGA 5C0NC 2VL5A 4P2CG 1QR1B 1PBYA 1E4IA 4CU6A 3PGDA 5HI4D 3VD3A 4L4TD 5E00A 4Y4HA 2VE6B 4P59H 5SWSE 1MW0A 4KKAC 4L8DA 4XCFH 3BPLC 4YHZH 5DJCA 4FFVD 5D6DA 3SUTA 4XUOA 1EDTA 4FQQA 2CKRA 1WT5C 4LLMA 4UIMA 1C8QA 3RWHA 1IKNC 1BVKB 2C1PA 3RIFF 3TA9A 3MV9D 2WVTA 4LOUC 2Z4QA 3L9RB 4X83A 3V5DA 4MADA 4WK9A 4BJLA 1KLGB 3T04D 1JNNH 2PR4H 1Z6JT 3HZYB 5E7BA 3RZCB 3EBVA 2WAOA 3CFEB 1NBQA 4JFFD 3TVMC 1UXSB 4NRXA 1MY5A 2R4SH 3HG1E 4M1CC 3EFFB 1DBAL 1FO0H 3D0LB 3VFTA 4HV8A 4FA8A 3WSUA 1X1NA 1U95B 1XGZA 4EKXA 2DIBA 4QOKD 2TAAA 2Q1EA 2VQUA 4R4ND 1MJ7L 3PL6B 4EJ1C 5CJ5A 4B5EA 5GGRY 4M48L 3ZYOA 1HILB 4M48H 3SQOH 5J57B 2CMRH 1H11A 1VBUA 3PZNA 2A3EA 5IB5A 1RURH 1MQ8A 4ZENA 3QUXB 2W07A 4DGIH 1DWJM 5LVEA 3RVUC 2ZWYA 4MNQA 4BKLB 1KB5B 4LLQB 2C8NA 1E3ZA 4UOJA 1T5WB 4JM2C 3EDFA 1KPVA 3U9PL 3IB3A 4Y19B 4OD1L 1TZ7A 1S7XA 3GM0A 3MGAA 1LQ0A 4RGND 3HPLB 2JJTC 3KVQA 3IIIA 4HIXL 1MFBL 4FQHA 3MV8D 4H88H 2BERA 1T1YB 3OG4B 2I9TA 2NXYD 5M5DA 5LGHH 1UY2A 2GJXA 5D9MA 1TJHL 3GGWA 4L8SA 3VWJA 4K68A 2EDDA 3TPKA 1QSFA 2Q76B 4R3SA 1JWMA 1QBLH 1BX2B 3GMLB 1OLZA 3VIFA 4ZAKD 1AKJB 2VRQA 2Q76A 3SKMA 1OSPL 3LIZL 3P0GB 1TETL 4BSWA 4RAUB 4WSKA 3KJ4B 3DBXA 2VCAA 2VXQL 3N12A 1EJ6A 3D0VA 4DWSC 5T1KD 3WS3B 3GKWH 2I26N 2BFVL 1YN6B 1N6UA 3OR6A 2AJUH 4N9OB 2EO9A 1XF1A 4HIHA 5ICYA 1IM3B 4PJEB 4BFIA 4NQCD 1MQPA 5F7DB 4HCRH 4NQCE 5J6GB 2ZX6A 2YKLH 4K3DL 5FGCE 3I02B 4PGJA 5ABDE 2DQGH 3RL2B 5D2LE 4HIIA 2C3GA 2ADJB 4Z5RB 2AJSH 5CEZD 3EO0B 1RZFL 4L3CB 1JDCA 1PSKL 5F3BB 3W53A 1UQSB 1MCSA 3SO5A 4ZFFA 4HK3N 1T6VN 2PW1A 4ZYKB 1NGQH 1JHKH 2RFXB 5JO5B 2L7UA 3AISA 2JB5L 4CJ0A 2WMJA 4FABL 4XNQB 2FSEA 5CJXC 3NGBC 4OZHF 1DQTA 5FHBL 4HEME 4NQSA 2BFVH 4DWHA 3DI2B 1A2YA 1KWKA 3MRFB 4WI5A 4J3XA 3CDYA 3DYMA 1VADB 1A6ZA 5EOQL 4PRPD 1GC1C 4QDMA 1FZOB 2PTTA 3VRLF 5J11B 1DZBA 2OS7A 3RWIA 2Q8AH 2Y7QA 4MZ2A 3A4XA 1G0CA 2H9GA 1XD1A 5EWIH 3NTCL 3L2MA 1QNQA 5C08B 4FFZH 4ODVH 3TA3C 1CGSH 3SE4A 4LASH 3IT8D 4FQCL 1KN4L 1R85A 2HTKD 1DVFC 1CZ8L 4FQXB 4PLJD 4P5KA 5HPOA 3A21A 1J88A 5DJYA 3FOLB 4UV7L 1CGUA 2EIDA 2J25A 1H09A 4JL2A 4RISL 3SDDA 5E1AA 4NM4L 1CF8L 3CC5A 2EXYC 1XIWC 3AY4C 4KKBC 3CFKA 3W0WD 1CZTA 1F4AA 5K33A 1DLHB 5DR5H 3VO0A 4G7YH 1P4BH 2YD9A 4M4RA 4UFMA 1JNHB 1RFDH 2G41A 1DBJL 3SDAA 2BBAA 4X0KA 5L6YH 4MQTB 3VG9B 1OD8A 5INDB 1M4KA 1PZUB 3I6LE 3WEZA 1AC0A 4PRIA 5FL1A 4H20H 1GGBL 4NJAL 3T3ME 3PN8A 2B20A 3D0VB 3UESA 1CLYH 4LXFA 4R0LA 4W87A 3X3FL 4MMXC 5DJ2B 1HJSA 2DKSA 4PS4H 5ICXB 3V5HA 4Z8FH 1CLXA 4PJXF 5B21A 5IYYA 3R06A 4BZ1L 1JWMB 3Q5TA 4L4TB 4BZYA 3ET9F 2VZ3A 2D1ZA 4F79A 4X6EB 1FNHA 3D85D 4NDMB 4KRPB 5AUMB 2BJML 3C7FA 5L9DL 3T0VA 1GC1H 1DANU 3TZVA 1OSEA 3OJDB 4GXUN 1ODZA 1T1XB 1Q0XL 3GMMB 4NF7A 3SKOA 3U37A 4LVHC 1JMZA 1XH1A 2N7BA 4GINA 2BSRA 4MXVF 1DEDA 4RMQA 2L7JA 1WLHA 2DWDA 2CK0H 4HWZB 3MUGA 3L5JA 1SMOA 3E3QC 1LE5B 3HNMA 1E0XA 4XTRC 1ZBCA 1Y0LB 2CBJA 1TVBA 2CDGA 2ZXQA 2VRKA 4ONHB 3OEAA 5D2LF 4N1CA 4G6JL 4JHWL 4ZO8A 1Y6KR 5D6CB 2XRAH 3CFBB 1KEXA 4P3DA 1LP9E 3ZO0A 3GJEA 3ZYJA 1Q38A 4CKQA 3QNZA 1QLFA 3DTXB 5ACMA 1R24B 3N11A 1IQWH 1MFEL 2D7PA 4XBGA 1HOCB 2J6EA 5B39A 4AIUA 3VU2A 2J8FA 5ID1B 3FAWA 3EFDL 3ECBA 1MCPH 1GJWA 2FX8L 3AAZA 2XWTB 3HTLX 4Y4KC 2X1WL 3UZVB 4ZSOB 2D20A 3SY0B 4HPYH 5DUBB 1ISYA 2AEQL 1DVFD 1BVLA 3VG0L 4PIRF 4AZ8A 5FDWB 2P5WB 2HISA 2CRYA 2J1TA 5C08E 1XHGA 4U0QB 5EIYB 3STZA 3P6BA 2VAJA 4RMUA 2MKWA 1D2KA 5DVMA 1T20A 4ODVL 4ODBD 2XFYA 2G9HB 4F8XA 5GGRA 3MRQB 3ROOA 1V3HA 4NO3B 4Y4FB 1S7UB 2Z91B 3HRZA 4OD3H 5GGRB 5CJOH 4KJWC 1BFNA 2YD5A 5C09D 3BX7C 1OSZB 1TTFA 3GSQA 4KAQL 4MNGE 5H2BB 3N18A 4AQOA 4IMLB 1UZ8A 5J6HB 4N5ED 2DBLL 4LQFL 1T7WA 4L8CB 1B2WH 2R56H 2JIWA 2LFGA 1YEIL 4MSWB 3MA9H 5M94B 4IM8A 5HYJA 2QQNL 1QHZA 4ZFZA 4XBEL 2HJKB 2FB4H 2NX5B 2PO6D 1T6WA 1HXJA 2GDUA 3QUYB 1XCTA 3O3EB 4FXGA 4Q22A 4X4ZA 4W86A 2ESVE 5FA4B 2LW8A 5HYQB 3LH2H 4DVRL 2OWWA 2E6PA 1M01A 5CEZE 3HE6D 4LYQA 3D69A 3L3GB 5DVOA 3D3VA 3MOBL 4XPGL 4GRWB 5DYOA 5C6TL 1CVSC 3CZUA 4JFDE 3GMNB 3AS1A 1BIHA 3IU4H 4K9EC 4Z7WA 5E5UB 3QWOB 4U1HB 3UPCA 5MERB 3W39A 1UD5A 3QPQD 3WIJA 4F3FB 3UYOD 5D9PA 5L9DH 4F8TA 1H6YA 4A2LA 1ECEA 1NWUA 4NO2B 4LFHD 2VLME 1LMKA 1XZ0B 4S1SL 3CZFA 3FFDB 4PJ8B 4PJ5B 1TFVA 1UQYA 5E4EC 1U8MA 4HU8A 5CS7A 1QFUL 4MNHA 1QI0A 5I71C 1WFTA 1GZPB 3Q48A 2H32B 1OB0A 1W72H 4J4PA 3UP1A 4B41A 3CUJA 3WN5B 43C9A 2W4XA 6TAAA 4YBQD 4I0PD 1FVCA 3G08A 4QRPE 2VX6A 4JZJB 3MXWL 3MLUH 1XGQB 4MVBD 4YXHH 2XQYG 1I3GL 3B9VA 1NFDE 2ATKB 3MV8E 3QXDB 2O61A 3QPQC 3CC5B 2EO1A 3FT4A 5JA8B 3CTTA 4HK0A 1RULH 4LCWB 4P59L 1FNEA 1I8KB 1MCNA 3M6DA 1EA9C 1H9VA 4NBYB 5FYJL 1CGXA 3NIDF 4WRLA 3KPOA 5IWLC 3GFUA 2BHUA 1CGVA 1J1XL 4XUNA 4BM7A 2J1SA 2Z8VC 4P7RA 5IW3A 5CXPA 1JNLL 1A3RH 3WEXA 4HK3J 3ARRA 4GW4B 1BVLB 1P5VA 5KVDL 5FM5O 5B8CA 4I0PC 2PYEA 3DSFL 5D1QA 4NKMA 3OKOB 2B7DT 4OQTA 2Y6SC 4LKXA 3NFSL 3GSRB 4EUPH 4YNYB 3S36H 1B0WA 3U4BH 1RJCA 4JREC 1TG7A 3QXAB 1GGIL 3BAJA 1B90A 2QKIB 3S36X 1L8NA 5A16A 3VCLA 1OAZL 2OMNA 3L3JB 1H8NA 3INUH 5BWFA 3QUYD 1JV5B 5D7LD 4RFOH 2E9BA 5KOVC 2BRQA 1KCUH 3EO9L 3FY1A 4L3CA 5IKCB 4PJ9D 1SYVB 5GRWA 1ESWA 1OAYL 5GPRA 1EO8L 3ILPB 1LE5A 1CVRA 1TETH 3KS0J 3UBXB 3LQZB 3U6RB 1A4KB 3RWFA 4AW7A 4JPVL 3KJ4C 1DUZB 2EDEA 4G7VH 2ZG2A 2QQOA 1D5ZB 3DX7B 1XGYH 2I24N 3LKSB 1V03A 1KCKA 4QRQA 3RIFK 3MLRL 5A95A 5I15L 3X14B 1C08B 1HI6B 3RY5A 3PWPB 1H3GA 2G60L 3ZYIA 2V38A 3MBEC 4QOKE 1SHWB 3CSBA 1OCWL 4BELD 4Z7NE 3HAEG 2XQYK 3VDBA 1EQPA 4Z2JA 3UYRH 4U1LB 1N6QL 2I5YH 2X4TA 2D31B 1JNJA 1O6IA 4G3YH 2E4TA 3NIFE 1XGUA 1OBAA 2J88L 1QI2A 1R3JB 4XNMA 1WZ1L 4D72A 1XRVA 1A1OB 1BYAA 5IBLD 5DHXB 4QT5B 4FTVB 1G6RL 1KTDA 5EUOA 2V4VA 3MLVL 4MJ6B 4KTDL 1CXLA 4XPBL 1Q8MA 3F7VB 4YO0B 3TO4B 5I74B 3V4VL 4AIOA 4PJXE 1KJ2B 1BIIB 4TUOA 5HPMA 1HE7A 3G5ZA 4RE4A 1UWXH 2RGSA 2O5ZL 3D5HA 3Q5YA 3SURA 1RZ7L 3L5HA 5I30L 5J11C 2GTWB 2E32A 4GW1B 4LNRB 4MDIB 5SWSD 1RJZA 4M82A 3WFBH 3QIBC 1JWUA 1UWEH 2NXYB 1KB5H 1YUHB 2DS4A 3TPUB 1RUKL 2W1WA 1F3JB 5EOCH 1UKOA 1QP1A 1U8LA 2DN7A 3FO2B 1NQ6A 3L9RA 3LKNB 4AEHH 3L3DB 4W68A 1T22B 2GHWB 5TPWL 3QDJB 3UJTH 4UT7L 3JVGC 1ZANH 3W0WA 5MEPA 4Z7VA 4JX0A 4UB0H 3GSXA 3HG1D 4ZXLA 4H25A 4HQQL 4YFEA 4XMPH 4HQQH 4EDXA 4XAKD 2GYSA 1H6XA 2NY1D 3SGEI 3DHMA 3VXUB 4AL8H 1LE9A 1FZMA 2UY2A 2R29L 5ALCH 5F21B 5IB3B 3H0TA 4I0CC 4H5SA 1M7DA 5IV2B 1NUNB 4KVCH 1D5ZA 3DX7A 5GSRA 2YXFA 4GLRI 4FFZL 1UMHA 1RUKH 2EDHA 4P3DB 5GGTA 3IAQA 3IJHB 4PP1C 4LRNH 4TNWK 4AQ1B 3T8XA 4HUUA 1ZGLM 2IFGA 3PHOB 2C1OB 4ZNEA 3UEQA 1S46A 3TZVD 3WUWA 2BVDA 5FIPA 5CHNA 4KMTH 1BJ1H 5JIWA 1VGEH 2BNRB 4GKSB 1R0AL 2PYFB 4OT1H 3S3PA 2XZCL 4MA1C 3MACH 4WFHE 4WDIB 5D7KE 3O9WD 4QTIH 4WWKA 5JHLH 4TTDC 4L3AA 3MRRB 3TNNB 4MA7H 2GKIA 1T80A 4KK9C 3TTQA 3W11D 4C7GA 4U1GB 1IL1B 1OTSD 2VXSH 3E2HC 4CGTA 4A3YA 3NCEB 4XWGL 5E2VH 3WEXB 3MZTA 4GAGL 1WP6A 3PWLB 5JTWA 3QH3A 4KK5C 3ZDXE 4ESKA 3NYDA 4M7ZB 1F4WL 3PZUA 4X6DB 2ARJQ 1AHWC 4GMTH 3KLDA 2AJXH 3BZFA 4WKHA 4G8GD 2CKBH 5DMGC 3S9DB 2QLYA 1D5MA 1DR9A 2V5TA 3SOBH 2Y5TB 5HTSA 3A6BL 2AKRB 5FYLH 1TTUA 3KDMA 1BAFH 4PJBE 1G7LB 5A8NA 3UO1L 2YUXA 5DJXA 2F54D 3DV6A 4OYUA 4WV1B 2QEJA 2ITDB 2YJQA 1P9MC 5CP3A 2FX7L 3ZT7A 1JJUA 3NFSH 3NCOA 1GPFA 3P40A 1BLNB 2Y72A 4CVZA 3RRQA 5F9JA 4M7JH 4OI9A 5EDXA 1YY8A 4HAFA 3G6JE 4GS7C 3IDYC 4HWBH 3MODH 2VR9A 5HGAB 1T2QL 4HV8B 4YBLC 2KL6A 2ZWZA 1ORSA 1V6UA 4W8LA 2CLZA 1AHWB 1NLDH 4ZXBC 3T77B 2R2BB 3VX0A 2RGMA 4HKZA 5KSBB 5HHOD 3IYLW 2DTMH 1PZ5A 1M1SA 1I1AB 1OD7A 2Y8VA 4XCNA 5DUPH 5C07D 4CCDA 3GSVB 2DCJA 3S2CA 3LIZH 2OTWB 1IGIL 4GUPB 2R1YA 4FMVA 1F8TH 1XPWA 3CMOH 5B3JF 4YHNB 4XGZB 5EFDA 3D87B 3VGEA 3MFGB 4NUGH 5I66B 5I75B 5ANMA 3KPQB 1TCRA 1LNUA 1T66C 2X10A 1VEOA 2UYLA 5CMAA 5FCSH 2DICA 3TNMB 2PWEA 3QCVH 3VIHA 3KPLA 4JFQB 4MWFA 1CFBA 1K12A 5JLZB 2AK4A 3HI1B 1ZTXH 3TYGL 1F2XK 3KYNA 3BE1H 1MFAH 2MWCA 2FR4A 4P3CH 1TPXC 2DM2A 4Y5VC 1WTLA 1MOEA 4U6YA 5F3HB 4JAMB 3QCTL 4HUKB 3NIDE 5BXFA 3VFNA 3RUGA 4J4PD 3MZGB 3TT3H 3ALFA 5AY7A 2CUMA 1IC7H 1U92A 3WBDA 2BY1A 1KOAA 3AYSA 2R0ZH 5C0IB 3LN4A 2EPMX 2YC4A 1W2VA 4JM2B 4OF3A 4UOW0 3ACGA 3MRRA 3TNNA 4QP0A 1YEKL 3TFKC 1D5XA 3A23A 1AGBB 4YR6A 7A3HA 2EEAA 4PG9B 2R0LH 4HS3A 3QDMB 2CUIA 1SVZA 3A0OA 1H8OA 3JUGA 1CIUA 4QY8B 1UY3A 4KRUA 1MCPL 5C0JB 4RE2A 3G5VA 5CD3A 4K7PX 3OKKB 3MV9B 4WI6A 3VCLB 5FYKU 3B9KC 4RNRB 1OSZA 3PP4L 4X6DA 2LU7A 4S1DC 3SGJC 5K9OB 4PSPA 3MRKB 3IF1A 1E6ZA 4QEGA 4UQ3B 2PXYC 1ZHLA 3D85B 2NNAA 1A3RL 5FUCC 1RU9H 3ZHKA 3AFBA 5J1AB 1OAQL 4JPKL 4MCZA 1KELL 4Z7UE 2EPLX 4QDRA 1M04A 4CVUA 2XVPA 4P7OA 5CIPA 3UERA 3NZ8B 4CADB 3D5OF 1HNGA 3IFOB 1UCTA 5L88H 1ZWIB 3P73B 5KW9H 3CZ8A 1DBJH 3RM4A 2KZ1B 1WEJH 5DI8B 4DGYL 5JHDA 3VFUA 4Z7WE 1I3GH 4M56A 1H3VA 3INUL 3QUMA 3EYVB 2DTML 3N0PB 4LCCB 3SO3B 1MHCA 4GRLC 2Y06H 5DN2A 3MUAA 1A1OA 2IAND 5DURD 3FONA 3M1BA 4RGMB 1HINH 5GRJL 4K3JH 1XGUB 1VACB 5DFVC 1XF4A 3MANA 4XUQA 5JUEL 1UM5L 1FVDB 3TA3D 2W9EH 1BD2A 3RA7H 1T21A 4FN0A 4JN1L 4HMEA 1KCSH 1PG7X 3AXLB 1F4XH 1MCJA 3K2UH 4ODSH 4PJIB 4H0GA 5AZEL 3QR2A 1NGYB 4NFDA 4LLDA 4P2QD 5DJAA 5HYSB 4X6CB 3IXTB 2COQA 1EUTA 2ZP0T 1UYWH 4XPTH 4RWYH 1LILA 2HFEA 1NCTA 3LMJL 4H04A 4LDLB 2C3HA 4ZZ8A 4R4BA 4Q9RL 3MYJA 1T7XA 4MJ5A 4LP4A 2CKBA 3ESVF 4RMWA 1G6VK 1AO7E 3K4AA 5SX4I 4ELMB 5JPMA 1XGPA 4PREB 4V1DE 5INCB 3UCRA 3WFLA 3X3FH 3W9EA 5A2IH 4X5XB 2E26A 1QEWA 1SEBB 5D1ZC 3NA9H 3WFHB 1YJDL 4AIXA 3D6GA 5BS0D 5JXHA 4P46A 3FOMB 5JMOC 4PYSA 4LKCB 4WEBL 2LQRA 2Q7YA 3IJ9A 4N68A 1NMBH 1CL7L 2C7UB 1R0AH 3P0YL 3PGFL 1QBAA 1WNOA 1PW3A 1WBYB 1A7PH 2OL3H 5T3XE 3TN0B 1JNDA 4HIXH 4Y5XA 1M7DB 2XXCB 3U0PA 2DSWA 3QHFH 1V7ML 1O7SA 3GNPA 2BNQE 4H8WC 1YHTA 4XI5C 4JJ5B 3FFCA 3WD5L 4HS8L 5BO1L 3VKKA 1TJIH 4I4WB 4LARH 5CEZL 1MWAL 5DRXB 5D2LA 3E6FB 3JV0A 2VMEA 2IAMB 2UY7A 2OL3B 3P77A 5D1ZA 1NARA 3EO0A 5F89A 1QSEB 2OR7A 2BC4A 3IKKA 2A0LC 3SE9L 1G7JB 3BSZH 1TCRB 1X7QB 1FE8L 5DRZB 5T33H 1WBXA 4X9BA 2PKDA 4OAWB 3QUKA 5DGQA 4TOYH 1OAXH 4PD4J 3W25A 3PWPD 3N9GL 4LF3A 4BFIB 1A14H 2P7TB 1RJYB 3JWDL 2FD6L 3LZFL 1Y6MR 1ED3B 5CJBA 1SMDA 1QLFB 3DTXA 3U30B 4O2EB 3QDAA 3VFPB 2QQKA 4QXUH 3WJJA 1HOCA 4ZDHA 4RAVB 5I8KL 2NYYD 5D8JL 2FRGP 3DUUA 4FXKA 2R2EB 4W5ZA 4U1KB 4JPWH 4B0MM 1IEBB 5I8CB 4JDZA 3ZJ6A 3CZJA 1QW9A 5ESAB 1VPOH 5CUSH 1ERNA 1ZMYA 4E41E 2YEZB 3V9FA 3O2WH 3A6CL 3VFWA 2ORZA 1V6XA 3OR7A 1XNTA 1JCKA 3ULSB 2WZIA 3WNKA 1IM3A 5CBEB 4OLXH 1MF2H 1MCOL 2R7EB 1WCBB 4OTXL 2VDOL 1NL0H 4JM4L 3SDXF 2F8XC 1Z5LA 1KCLA 5KSVA 5I73B 1G7LA 4A6YL 5F1IA 1MIEL 3TIDB 1P7QD 2BNUB 4U31A 2EEXA 2VE6A 5KSAC 4XPFH 5FHAL 5GSVA 3U5UA 4W6WB 3POCA 1EGJL 4NQCB 3HE6C 4OLZH 2VDLH 3JV4A 4P46B 1H5BC 4L5FL 1ND0B 5DK3A 4IOSD 3NVQA 5ERWA 4ATDA 4MAYC 1IBGL 2VDML 4CU9A 3DURA 1F6AB 1DEEA 1XGPB 1KJMB 1UM6L 1B3JA 3NA4A 2MCG1 2XTKA 3FO0H 3K81A 3TN0A 4KKAD 2WIIB 2Z93B 4MNJA 1C5BL 1X5KA 2FL5B 2NX5E 4M93C 2ZXBA 2X7LB 4E0RA 4ZXBA 1CLZH 3VGAC 1BPVA 3M8OH 1W0YT 3OGCA 4LGRB 4DOHE 2ARWA 5C0BA 43C9B 1FZKB 1E0VA 2OSLA 1RZ8A 3WKNA 3GEWB 4WU7A 4YEEA 1SJVA 4OCWL 2A73B 4U05A 2YD1A 1GGTA 3QPXL 12E8L 4J1UB 5F7WC 5C9KA 3WF3A 1G9NC 4LNVA 3IANA 4PJ9C 2AERT 1BTCA 1LD9A 1XSIA 4XNYL 3EYOA 4ZO9A 1ACZA 2DQHH 1JGLL 1CFNA 3EYOB 1T04A 2XONA 5CILL 1B30A 1T04B 2F58L 5I1HH 3C5ZC 1PKQE 3BD4A 1YECH 2P5EA 4FQHB 3Q1SH 5D7IB 2WBGA 1ZANL 3BAYA 2VSCA 3WSQL 2DLTA 2H1PH 1L6ZA 4EE9A 3RL1A 4P5TB 3H3KA 4MQ7B 1KPUA 2YWYA 3H9SE 3O4LD 5C0FB 2QMJA 4YR6B 3CO4A 3MFFB 1NUFA 2ZOKA 1ULVA 2XUCA 2EDYA 3EOAA 3GSUB 1RK1B 5DWUH 4KI5M 5K9OA 1JP5A 5DJZA 4AT6B 1Q94A 3DV4A 4N90D 4H8HA 1HSAB 3JV4B 5BJTA 1XSKA 2AXFB 1C1EH 4FLQA 3BH8B 2QV2A 4MCZB 5EC1A 4FQPA 2B1HH 4L8SC 5D4QA 3F62A 5D5MB 3II1A 2JALA 2PW2B 5LCWL 4HPOH 3A67H 4G9DB 2J8UA 3ZKXB 3AGVA 5I1GL 3G6LA 4XP4L 4AAXA 2PBGA 2HFGL 3UPRA 3MJ9A 2J1UA 3MRKA 4IS6B 1G7HA 5KJRH 4HIJB 5J12B 3HS0B 3ZKQD 1I4FA 4S0SD 3MJ6A 4JY6B 3VMOA 4YAQA 1VFBB 4UAPA 1E40A 1V7NH 4A6YA 1UHVA 4PRHB 4JY6A 3P4LA 3CJJA 4PP2A 2EZ0D 3WQWA 1HDMA 5JPNB 1QHOA 5CJQH 5J7CC 1EVTC 4OB5L 3QDHA 4ELKA 2J47A 1PLGL 4YK4C 5D9OA 4EVNA 4I5BB 4W4OC 1QFWH 1JGDB 3NCCB 1LO0L 1VBRA 5BVJA 3IDJB 2A83B 3LKQB 2FBOJ 4NZRH 2IAMD 1U8HB 4PJ7E 5DTFB 5E99H 2EDJA 3NFNB 2VXSL 4FZ8H 2C4FU 1TTGA 3QPXH 4ZQKA 4UT9L 3GXFA 2P24A 4NC2B 3GBML 1KXHA 3O3BA 2EH7H 2Q87A 3PGFH 2R2HA 5AC5A 4QAWA 4TSAH 5DEZA 4BQBA 4F7PB 3SJVB 2IALB 1FQ9C 1S9WA 3HE7D 3CUGA 1XF3A 1CICB 4JQVA 3QQ4A 3KPLB 4Z7QF 4AENA 5HGHA 1TZHB 4OQTH 2NY4D 4HGKC 3G5ZB 4J3WA 4RBPH 4LRNL 2DQIH 3QEUA 1YNKH 3TA3A 5J1TC 1GOWA 4HH9B 2IAMC 2OJZH 4X98A 4MQ7A 3C60A 3O3DA 2HKHH 4MDJB 4DGIL 1PBGA 3VUPA 3BQUB 5C8BB 3P9MB 1GHFL 3WIHA 3ZE2E 4C7DA 5INDA 3WSQH 1KEMH 3VNZA 2EIEA 5J3HC 1CL7I 2VZOA 2XVKA 3BXNB 1IMHC 2ZCHH 4EXPX 1MFBH 1NBYB 4X99B 3AVEA 2ATKA 1N5AA 2YC2A 2WVSA 3MLZL 4PY8J 5IXEA 3TEUA 5M7QA 3G9AB 4G80B 1NOWA 5BQ7B 3KNBB 2DTSA 1FNSL 5HYSG 1ZVHA 3QEQE 5D2NB 3SKMB 4V1DA 3ULVC 2VDLL 3VIMA 2IG2L 2JEPA 4FFWD 3PABB 2OMBA 4ZUTB 3S4SB 3THML 2X4OB 1AR1D 3SQOL 1V6YA 5I8OH 4OIFA 1HQ4A 1JPFB 1W0VB 1CDJA 1FJ1A 3MRIA 4HBCH 3FQTB 3RCNA 4QCIA 3S35X 4HDIB 4Y4KA 4LPXA 4O9HH 5LYRA 1B2WL 5JIIA 2EXWD 5ABGA 2EYTB 4UZGA 1T03H 3D2UD 4RMSA 1E5JA 3VGFA 3BPCA 1FZJA 2RAMA 3RZCD 1GIGL 4Y88A 3RWCB 4XXCC 3C7EA 2BNQA 3OZPA 4HP5A 1JV5A 5IBTL 4XVSH 1MFCH 4QFUA 5E8OA 4IRZL 5IDIA 3DXAA 4GG6A 3LKPB 3EZJB 4Q6IC 3QNYB 4KY1L 1K8DB 3S7GA 4LSRL 5F1OB 2R0WH 3FRUB 1J0HA 5I8EA 4CCEA 4KPHH 5D1ZD 4F9PA 4MAZA 2IG2H 4OM1H 5IMOB 3UPAA 1TVGA 4JVUA 5EZIL 1DE4A 1XF5B 5EZIH 2Q6WB 5DJ0A 5MEOB 4HULB 5HDRA 4MNKA 2HA1A 4JZNA 4YHYB 5IR1B 1MJ8H 3CLEL 3K77A 3IDNB 3AXIA 3HE7B 4UTAH 4NKDA 1WCBA 4ELME 1DTUA 3NUKA 2MNUA 4Z7NF 5KVGL 1VF8A 3T0EC 3I85A 2AEIT 5CSZB 4C56B 1S7UA 4AZ5A 2VISA 4L1DA 3OKNB 4HF5L 4F9JA 3DHPA 3F58H 4K8RH 3ZR5A 3N1FC 4GRLB 2Y1VA 1E6JL 2WWMC 4R8WL 1YEFH 2GTWA 5TGBB 4L9LC 3MV7E 4HG4K 4MDPA 5A8QA 3SKJH 4MZ3A 3U1SH 4RE3A 3CAFA 4I2XA 3BEWA 2WXDM 3I9GL 1WGOA 3T0AA 5ACZB 2A3BA 1EAPB 3MRLA 1JYWA 4A3ZA 3VFOA 3N06B 5EORH 4ACPA 3EOBA 3G6AB 1XEDA 4KUCF 3LS5H 1BZ7A 4ONGL 3ARFC 3PNWA 1RFDL 2MQCA 3OKMA 5ALBL 4MPKA 2ARJA 1MQRA 1PVHA 5EFFA 5C0AB 4G8IB 3U46B 5BCAA 1INEH 1INEL 1WIPA 2G3NA 1T5XA 2Z35A 4NCC2 1UH3A 2VMFA 1EEZA 3DO3A 4P2OA 3MLYL 4KRTA 4QCEA 1N59B 1WO2A 1I1YB 5SWZB 5T1DL 3IB4A 3V5KB 3HU7A 4Z9KB 5AYIA 4W5UA 4MDOA 4DXSA 1TIUA 2CDGB 4CD5A 2HKFL 4Z8FL 2NLJA 5J4MA 1I1WA 2XWBB 4W70A 3IAPA 4WHCA 4QRSA 3QIUB 5BZDA 2HRPH 1MCDA 3NPZB 3QNZB 4PJAF 4OCXH 3B9EA 3ZKMD 3TZVB 3MCLL 1UWGL 2NZ9D 4JFZH 3VFTB 4JKPL 2E27H 4JFTA 1F58H 4TVDA 2ZUUA 1NMCB 1E0OB 4RRPG 4KUCD 5IWLA 4FRWA 3QXTA 4OGYL 1E1FA 3WUFA 4J23A 3W2DL 3RHWK 1HKKA 3MLPA 4BZ1H 3HAEA 2VZRA 1BQLL 2BXYA 1E9LA 2UV3A 2VITB 8FABA 5FGBC 2JB6A 4HXAH 5KW9L 2A6JA 2YBUA 4TULL 3VX1A 2R1WA 4P4RA 4C56D 5JUVA 4J3OC 3KLHD 1OTSC 2CXGA 5IW6A 3FKUS 5D7JA 2VLJE 4HPOL 3LS4L 4X7FC 5E2WH 4M9OA 3DHUA 1F45A 1OVZA 2AABL 4M6NL 1UJ3A 3L3HB 4OFVA 4OFYD 4LYPA 1X5AA 5C0GA 3QDJE 2FECL 3L7EB 5EN2A 3OKDA 3QDJD 4XBPA 1QNPA 4WCYL 4AM0B 1K42A 1NANI 3F5LA 3EO1A 6FABL 5EC2A 3LPFA 4J3TA 1HJQA 3P11H 3L3JA 3QXAA 4U6HB 4DWSA 4U7KA 5AZEH 1FCCA 5ISZD 3MRLB 1RHFA 2VZSA 1I9EA 5FB8B 3CMGA 3KWWB 4PRNA 3C5ZA 4KI5E 4Z0BH 5EO1B 3LSOA 2QHRL 5J06A 3U0WH 4R9HA 2CR3A 4GBXD 1YYLH 3RZWA 5CD5C 1RZKC 2B0SL 1G7JA 4HDIA 4YDIH 1UWRA 1I1RA 3EFDH 2OQJB 4WUUA 2B39A 5EZLA 1K6AA 4X8JB 2EPNA 2J79A 1RK0A 1MHCB 4HJ0D 3B2VH 4IJ3B 3PL6D 3WQBA 1GSMA 1KSRA 5BZWB 3OEBA 4QOKB 2AEQH 3CDZB 4QHMB 4RGNC 1KGWA 1QOXA 3VFVA 3PUIA 5JHDB 1IGYB 2J7GA 3GRWA 3QEHA 3DVGA 5E03A 5EZOL 1S3KH 4KQ3H 3SKJE 2VCBA 2I60H 3RWIB 3GJFK 3GBNL 3HS0A 4F9LA 5I24A 4JFYA 4ATLA 5F9WB 1RZJH 5EU6B 4E2OA 2JK5B 3O2VH 4W8AA 2D0FA 3RHWF 1OGTB 5EU7C 5JW3H 4P46C 3JZ7A 3WS6A 5DRNA 3MNWA 4Y19E 4UT6L 2CBVA 4N0RA 3LMJH 1MFCL 4YDVA 3DVNB 1HHHB 4PMNA 1CZVA 1I7ZB 3CIQA 3MRNA 4AK1A 1AGCB 1E4KA 3KPPB 5DTFA 3RY4A 3TA3B 4Y5YB 5IG7B 1CLYL 3AIUA 2XTJD 1J0IA 2G8ZA 3PF2A 3RM8A 5GGQH 4QXTA 5TDPB 2I27N 5MEQA 3MBXH 2VNCA 4JZJA 3STLA 2HG5B 2VXQH 5A2LH 3FRPA 4MGSA 3U7AA 4XPBH 3QFJD 1UM5H 4OZGE 3QDGA 1EJOL 1E4LA 1I5PA 1A7OH 3VFNB 1II4E 1HHGB 3W0KA 1ZA3B 1YN7B 4OFDA 4CMMB 2I9TB 5F88B 3SCRA 2ZUNA 4QRUB 4JRYA 2A77H 1Q72L 1I1CA 3PWUA 5GGTL 4GQPH 2Q86B 4GPNA 4ZFMA 3CFJA 4XNZC 3BRGC 4A41A 4NHUA 4TYUA 1HWGB 3GIZL 3K7UA 3RWGA 5ID0A 5ABHA 1BFSA 4G80A 1INQB 3RDTB 5CIPH 1NFIA 3TYGH 4JVPA 1WWCA 4GZIA 1BX2A 2FGWL 2ZKHH 3LB6D 4GBXC 3UTTE 3WBEA 5HHNB 2ZEZA 2IQAA 5DT1H 3MV11 2PWGA 3BSGA 4E41D 4F7TA 3GBEA 3EDJA 3U0WL 1PPIA 5D4YA 3T4YA 4OQ1A 4KK8D 1BFTA 4MO3M 4WY7L 5DVNA 4MS8D 4X5LA 3S5LG 5GS1B 2QQMA 1MQKH 1X6LA 2W95A 1S8DB 4JR9H 4K9EH 3WCYA 2DD8L 3WH8A 4MJ4A 2ESVB 2WVUA 3CFCH 2DL2A 4LVOC 4XP5L 5BW7A 3V8CA 5I1JL 4LSTH 4PJFA 5GZND 4CADA 3KR3H 1BYBA 4XTRD 4ZXEA 3EHBC 5I79A 4MA8H 4URTB 4WUUE 3RWDB 1I3UA 2X9YA 1YZZA 5GS2H 3ORJA 5IGXH 1KN2H 4Y8AA 3KPRB 3T4AB 4XNUH 1E73M 4PRBB 1U30A 2HFFA 1MAKA 2WQ8A 4JO3H 4MXVE 4FQXD 5I1EL 1CFTB 2HT4C 3U4BL 3UJJH 3WXWL 4JPVH 1UZ4A 3B43A 5CEZH 2IQ9L 1FC1A 4XMLL 3BMVA 3RWJA 3U1SL 1EGJA 2NY0C 2P8MA 4GAFB 4IBLT 4Q74A 4UU9B 4ZO7A 3M17B 4IDJL 4JCLA 4PP1D 2XHYA 1A64A 1VACA 3MJ7A 2OWXA 3STZB 2VXVL 3QFJB 3TBYB 2YL9A 4ZUSA 3CHFA 2H1PL 1ZSDA 1ZEAL 3GI8L 3AS2A 4LSQH 5IMMA 4LAJH 1BD2E 4KDWA 4HFUL 2V2XA 5DQ0A 1KXVC 1KNOB 3G5XB 3PZTA 1Q0YH 2MMXA 1I8MA 1A3HA 4H88L 1U6AH 2VISB 3NCFB 5C8JA 2EQDA 1MRDH 1A14L 2OZ4A 3QUXC 2KDGA 3DXAD 3MXVH 4LCCC 4QCFA 4XAKE 3O3AA 4XZWA 5FECB 3VFMB 1VKXB 4FQQB 5AD0B 2VLKE 5BRZE 3I97A 1A0QL 4MQSB 1A9EB 3VXSB 2KH2B 4QRRD 3KL5A 1ONQB 3D39E 4OFIA 1M7IB 1OM0A 4YQXH 5GRXG 5KVFH 1C1EL 2WWKT 4WHTB 1GQJA 1NX9A 1AD9B 2QLVB 1FH8A 3HZMB 4PJIF 3CFKB 4IDJH 1L7TL 1XC6A 2DCKA 1CDIA 3DNKA 4OLVL 3C9NA 3TWCL 2WHMA 4LL9A 2WMPA 2FBJL 4LIQE 4PJBA 3NCBB 1UKTA 3CDFA 4L3ED 1KYOK 4Z0XB 4U3HA 2FHFA 2YD4A 5EUKA 3WDHA 3CLWA 3PHQA 3UJIL 5DT1L 5LGJA 3NJXA 4TX8A 3P4MB 1KGCD 4WWID 1YEHL 1A3LH 2IWGA 3DX6A 3BP7A 1MVYA 4TSAL 3M45A 4XC3H 4HF5H 4C4KT 4BS0A 1HH6A 2UWEE 4G6FD 5IOPB 1MLBB 2OR8A 4PRDB 5D9SA 4KRLB 5TE6H 1FC2D 4U3AA 3FFCE 1WAAF 2QADD 4RZCA 5IIEA 1VAHA 5FA3A 1T0MB 4XP5H 3LQCA 2OXGA 5KBNC 4XPGH 5E2UH 3R1GH 5DC0A 1A6UH 2ESVD 2AJZA 5E9DB 5E2TH 4NKQB 5IFJB 2YK1L 5JXIA 4ZUTA 1OIFA 4PRHD 5A94A 1AQMA 2QMKA 1J8HD 1FNLA 1QFWM 4R4FH 5FYKE 1K2DA 3NCYS 4XH2B 5D7IA 2XV6B 1MFVA 4ZUVA 2XNAB 4JM2D 3FT4B 1UYYA 1HSBA 5DK0B 3H7BB 2YL8A 1JNNL 2VLRA 4HGWB 5IQ7H 1IC5L 1KELH 2MCPH 4FQ1L 4L1HA 2BMKB 2YPVL 4PB9L 3WSOA 5A6BA 2Q8BH 3BP6A 1MVFA 1IGTA 2BOCB 4Z95H 4OF5A 4MB3A 3WKMH 3UJTL 3SCOA 4CD8A 5A3IC 2O9RA 1Z0MA 2AK4E 3BWAA 5A2KH 5IJKA 3GGLA 1F5WA 4I3SH 2A74B 5F1SA 1OT5A 3UR8A 5C08D 4B16A 4YN5A 5I77A 1MW2A 5ACLA 5BXSA 4H2CA 1RMFH 4NQTA 4J28A 4Y4HD 1M03A 3CMJA 1QA9A 4IMKC 4XX1E 5HYFA 4DXRA 1ZT7B 4NNYA 1KCUL 5F1KC 1CD9B 2APTA 1QI5A 2VDKL 1PKQB 2BK8A 2ED8A 4YIQB 1NFDF 4NQSB 2XTJB 5GGSB 3CUPA 4YHKH 3WFCH 1IL1A 2YFUA 3BC9A 4Y2DD 3GRWH 4OLWH 3N1MC 3UG5A 1BQSA 1RJLA 2ORXA 3JWDH 4Z7VE 5A2BA 1U8PB 5C09B 4UOZA 4H1LA 4RFNB 4XWOC 4R7NB 1E6OH 4U6HA 4DWSB 2VLMD 2IBBA 5IMLA 1WZAA 4NQEA 3VDHA 3OKEA 4ISVB 2R23B 5GQBA 1H0DA 4PGDA 4HHAB 3FO9A 4DCQB 3T0WA 5CJ8A 1B3ZA 4B3LA 2HLFC 4UI2A 1LK3H 1DWGM 2IH3A 2W0LA 5FECA 5I8OL 1LE9B 1L7RA 1MYRA 4K55A 3TGXA 1V08A 1CXKA 1I9JL 3IDXL 2DMKA 1I1AD 1HHIA 4P4KA 3LN5B 5KN5A 3EB7A 4HZ8A 4ZOCA 3MNVB 5F7DA 5H37G 4BA8A 1TCMA 4G6AD 1S7QA 5BV7B 5CINL 3H7LA 3QI9C 4UFKA 1RUPH 3MA9L 5HHPB 3DX9B 1VFAB 4F58L 2PWFA 3UTSE 3TYFB 1HI6A 1WJ3A 4Q0XH 3VIGA 1MIMH 1MJUH 1E55A 2X5PA 5IVZA 1C8PA 4DM2A 5JXEC 4OF7A 5E9DE 3TT1L 2DDUA 5G05L 5FYKD 4KZEL 2GJ6B 1DUZA 4R7DB 1AQDB 1G0XA 5CSUA 1ODUA 1FVEA 2A6KB 3ZOAA 3D9AH 4K94H 3IDYB 3R1GL 4X7CC 3V5KA 3EJYD 4DK3A 4ZS6D 4HKJA 4R4NC 1H3UA 2KBGA 5I30H 3JWOH 3ALPA 5FYKH 4KKCD 1U41A 3HNYM 3PL6A 1J10A 5IB2A 1AR1C 2C3WA 3LB6C 4HZ6A 1I7ZA 3MRNB 1LWJA 1FG9C 3VG0H 3HRZB 4ZTOL 1YC8A 3AZSA 5EIVA 5T1LB 3KLAA 2EDTA 2ENSA 3VDCA 5T5FL 4Z77A 3HC0B 5E7FA 1K4DB 2NXZB 5D7LE 1KB5A 4LLQA 3LEYL 4ZAKA 4R4BB 2VLJD 2VQTA 3WF4A 5CEXA 3VOCA 1CQYA 5I1LB 3WS6C 1RZIA 3ZJ7A 5D6CA 2YSSA 3LQAL 2BSSA 4HFUH 1S9KC 3WE6A 4KMLB 3WD3A 3R0MA 2ZOLB 3FQXB 3LN4B 3C8KA 2B5IC 4JRYB 4LSSL 3C8KB 3NSNA 1YEJL 2O5XL 1UR2A 1CDBA 1FNEB 1OTUC 4PLNC 1P1ZA 4GH7B 1BAGA 4X6DE 5DHYA 4H7VA 1CXFA 4CN6A 4IEFB 1ADQA 4Z7VB 2CIIB 3WL1A 1DSFH 1G84A 3WD4A 1WDQA 4X9HA 5MHSE 3RILA 1BGAA 3NH7L 5EB9A 5FUZL 2DMBA 2NY4B 3ZQ9A 1VDGA 1CZ8H 3R0NA 1BQHB 4YFDB 1CGTA 1JF6A 1DBBL 3RA7L 5DJ2A 4J1UA 1G7QB 3DSFH 3MBEA 3BSHA 5K59E 4JFHE 4CD7A 1CE6B 4L4VE 2FCBA 2J2ZA 1GZJA 3V0VB 4PJDA 5GGUB 4NHCH 2JJVA 3EDDA 1F42A 2PNDA 4JRYD 1FA2A 1VEPA 3KE0A 5E2WL 2XZCH 5HD8C 2VJXA 5JW4N 4EN3A 3O0RH 4XP1L 2DQGL 3QNXB 3VXUD 2AXJA 3EZ8A 2VAAA 4LLUB 2EKSB 3WD5H 1EERB 3U9UB 1DBML 3MXVL 1TQCB 4JKPH 3LQZA 3U6RA 5DQJA 1UD6A 4EKJA 4PJCA 4GI8A 2HN7B 4MD5B 1LO4L 4N8CH 4MD0A 3K1DA 2GT9A 5T1LD 4L5FH 1IILE 4G6KL 4M6MH 4TXWA 3LKOA 1KJ3L 4R90L 3FL7A 1W9UA 1YJDH 2V17H 3RGVA 3CZKA 3GB7A 4LLVB 1ORQB 2V2WA 4I77L 3SDDD 3RVTD 2E8YA 2EE9A 4O58L 5FO8B 1IZJA 4PGBA 3L3OA 1S7VA 1NC2D 4JFEA 3QWRD 2CK0L 4U1KA 1W2KT 2PYEB 2EECA 1OP5K 1ZAGA 3FONB 4LCCA 2QTEA 2X70B 3PE9A 1SM3H 4X7EC 4PJAB 1GOOA 5E5MB 1Y6NR 4FQXA 4PRID 3TO4D 3MXWH 2IF7A 5EIIB 5E0CA 4K7PH 5AG9A 3MRQA 4KKBD 5TPWH 4Z7VF 3ROOB 4JB9H 4FOMA 3OGSA 1U3HA 2HT3D 2QR0B 3I9GH 3D48R 4ACZB 2LVCA 1ZGLP 4LLYB 3AHXA 2HRLA 2QSCH 3LD8C 4JY5H 2OYLA 3HKFA 3UR7A 2VXUL 3OAYH 1JYVA 4YX2L 2WCAA 3TLRA 2OI9B 3GMQA 3QUZC 3KWXA 4NFCA 3O3BB 3CMOL 2FEEI 5F9DC 2FSEB 3Q1SL 3BVNB 5ECUA 4OZ4B 2A3CA 4D9QE 3UZEA 5KSBF 2W87A 3L4VA 4JZOB 2Y25A 4WW2A 5M17A 4DTGL 4P2OC 4JFFE 5HYQA 3HG1B 1K9TA 2VKWA 3GBDA 4HIJA 4JFHD 4Z76B 4M6NH 2OSXA 4QXGH 4WJ5A 3QUZA 1X4XA 1NBZB 4MB1A 4M02A 3DSNA 3QO1B 4WFED 5ESVB 4LKCA 4HCRA 1IFHL 4ODTL 3RKDD 2GJ6A 4R7DA 3U7YH 3LRHA 1RZGA 3AZRA 1KG0A 2J7BA 2O92A 2DWDB 1ZLUK 4L3EA 1U33A 2YA0A 4KTYA 3O41B 3SKNA 2D22A 5E2JA 2HJFB 3ES6B 3U82B 3QUML 4O51B 3VWJC 1XYFA 1A21A 2FATH 3W2DH 2EDKA 3PZVA 2ZX8A 3WHE1 4GSDH 2XWBA 5FOBA 2RBLA 1W9VA 4AG4A 5DJ6B 1H4PA 3UCQA 4HD9A 3ARBA 1F2QA 1FVCB 1IAOB 4IOFD 3QIWA 1EMTL 3QUXA 1F02I 4TUJB 4R96A 1JD9A 3O8XD 2B0SH 4ZPVB 5EFIA 1GPOL 4KV5E 1CGSL 4AYFA 3FXYA 1DVFB 4I18A 4LK4A 4P5YA 2W9XA 3L5WB 2VCCA 1IBGH 2VDMH 2F2HA 1IAKA 2BNRA 1BM3L 3NABL 2WPGA 4HJJH 1A7BA 3OQ3B 3A7QA 4NYLA 4EOWL 1DJSA 1AQHA 2XT1B 4NZTL 1AQKH 3KL0A 2F5AH 4NFBA 4OV5A 4NZUH 4AD3A 4Y5VB 1ZHKB 2LS6A 4OLYH 1JHJA 5EU4B 4LSPL 3CHEA 4H1LB 1N0LA 4ARXA 5E94A 3Q0HA 2HJLA 1OY3B 4PJHA 2JB5H 5DK2A 3IS1X 3TIEB 5D72H 4K94C 1MCLA 4Z78A 3B9KA 4IOIB 2EDOA 1AMYA 5DEGB 1W1VA 3U36A 1VCAA 3BH9B 4LLYA 3MLUL 2EYRB 3FB8A 3VXMB 2F53A 4LEXL 2QHRH 4PJEE 5J89A 5T1MB 1FZMB 1RK1A 4E4PA 3G6JB 3C2AH 3BPNB 4H1LH 3AOFA 4MA3B 5IB1A 1E4XI 4GZ9A 5HYJB 3WUGA 4XUPA 2UWEB 3VD5A 3CIVA 3W26A 3QP3A 2NY7L 1YPZB 3MMWA 2VDRH 1JFQL 1W8OA 2LU4A 1GYAA 5GS0L 1NAEA 3NBNA 5F1NA 1DDHB 2IPUG 3ROLB 2WO2A 2J3SA 1CZ1A 3PGDB 2GIYA 5KVGH 1T7VA 2VVNA 4UQ3A 3EYVA 5LQBH 3N13A 2IPKA 3IJ8A 3LQAC 4PRBA 3IGAB 4ZTPH 4M9PA 3HEIA 3UTPD 4HS6B 1A6AA 4KJPC 4XP4H 1J7VR 5GGVL 4AXNA 2LABA 2F5BL 1C93A 3NZ8A 1P53A 5DJ8A 3BRDA 5EBLB 3X11A 1P4LA 1VA9A 1AD0A 4MCYB 4CD4A 5BYWA 3BN6A 3I2KA 3VH8G 4XHJC 2E9MA 5D2NC 2V7NA 1AH1A 4U7MA 1QSED 2F74B 5TDNB 2Q8AL 4QX0A 4CUBA 1Q9KB 3GSNH 1KGUA 5E0FA 3V52H 2Q3AA 3FRUA 3N1PC 2Y06L 3GXMA 5ABFB 1VJSA 2BDNL 1CBVH 4JFSA 4XWOD 4FLSA 5E4IA 4MJIB 2BV9A 2A73A 1JUFB 3WFCL 5I71B 3SDXE 2HJFA 2HH0L 3DVNA 4HLJA 4MDIA 4PBVC 1MAMH 4Y4FD 4HJJL 1MFUA 4LAQH 2WAAA 1GOMA 4YWGL 4UFIA 4JN1H 3GBLA 3D25A 2PYED 5D1QD 4LCUB 1R3LA 5CP7B 4M62L 5F7FA 5E8PB 4L4JA 3C5SB 3GMOA 1AC6A 3SQBA 5FOBB 4X0VA 1NOFA 2VQ1A 1HJXA 3BHBA 4KUZH 2HKFH 1A47A 1KJ2A 3KLHC 2PWDA 2HFGH 5DZLA 4JG1H 1MVUB 2NW3A 4UDUB 1UWEL 5CZXD 3V79C 4OLUH 2HTKC 2Z0BA 2XZQL 2GUOB 2W1NA 5FV1L 3UDWA 4BQ9A 4WW1A 1DQQB 4WO4A 1CICC 4D0QA 4QO1A 4UNUA 2VX5A 2XSBA 5D7LA 4YHEA 4YHIA 4WUKH 5HHXH 4KY1H 1N6VA 3UAJC 4JO2L 3FT3B 3FB7A 1U9KA 4QHUA 2PQSA 4I3RL 4LCIH 1NGQL 1RHHB 2ZOLA 3FQXA 4LCIL 3OXSB 1N0XL 4NBZB 4NSKA 3KPSA 1FFOA 4NQXB 3QI9A 5D2NE 3GSOA 3RVWC 1Q9LA 3JVGA 1WIUA 5FO7B 1D6VH 1NEUA 3B8SA 4Z2LA 3ZTNL 1IAIL 4Z76A 2DWEB 4XCCL 4XP9L 1EHXA 5IFPA 1G6RA 5DEFB 4U1MA 5FOOA 2R9HD 1YQVH 1F3DJ 2NQCA 2R23A 3BESR 4H0IA 4NC1E 2B4CC 4TOQA 1OD9A 4XGZA 4UQEA 3WHXA 5I1AA 3LRSA 3OR6B 2D3NA 4XVUD 1D5IL 4OOUA 2DQHL 1A4KA 1PYWA 3BKJH 4HG6B 3E8UL 1ETZA 1S9VA 1A6TB 3PL6C 1LEIB 4AD1A 4WWKC 2ZWLT 5AAMA 1BG4A 3TCLB 1ETZB 4QF1A 3PIQB 5IBUB 2H2SD 4W85A 1MI5E 1GAFH 2JCCB 2IANB 4HUXB 2QSTA 4PJFB 1FH7A 4OJFL 3O81A 2YRLA 3T0ED 4TNWF 3MBED 3GB7B 5BVJB 4YDLC 3FT2A 3NJ3A 5D7JB 2P5WE 3ZE1F 4MA1B 3MRGA 1LL4A 2WNWA 2JF6A 2X4TB 4JFPA 1VFBA 3UYRL 3DXAE 1FHGA 3WH9A 4NKMB 1KXVA 3OKLB 5L2KE 1XH2A 4WFGE 2NY1C 5IHBA 1MAML 5BMFH 4JZNB 1A7RL 3RWEB 4Y8DC 1FYTB 3BT2H 5A6KA 4GT7A 3B5GA 2DLHA 5EUOF 4MNQD 4MCYA 5I75C 3WN6A 3VH8B 1HHJA 4XC1H 5JORB 2JFEX 4ZUSB 1TA3A 2V2WB 4LVEA 1HILA 1UWIA 3CZFB 3FFDA 4PJ8A 4PJ5A 3W4RA 2P42B 2VR4A 2ZNXA 4I48A 4W4NA 1W9TA 4H26A 4GKZA 1MRFH 1G9HA 2GK1B 4BF7A 4WI3A 2BSTA 2N4IA 1OQOA 4G8GE 1LDPH 3L4XA 4ETQB 4OOZA 1M7IA 3D25B 3SE3A 1JDAA 3FO1A 1PGRB 3BH8A 2MCPL 5C0CB 3GUTB 1HKMA 1MRDL 2VZQA 4WSJA 1H8SA 1J5OH 1R3KB 4NWTH 2Z31D 5C0AE 3VIPA 2NZ9C 4ZS7L 3UTTA 1CR9L 2A6DA 4F80A 3VXMD 1OTTD 4PJBB 1C92A 3MROB 3MLVH 5SWZE 1GMMA 2V3FA 43CAB 5IBLC 3DUSA 4CD6A 4U5IA 3MMEB 3G6DH 4X6CF 2E7LA 4HA4A 3W6MA 2MQ0A 3OKOA 4AG4H 1FRGL 1S5HB 5FGBA 1FNGB 1IGJA 3IJYB 2GJZB 4YPGA 1RD6A 5BROA 2AK1L 4NKOA 4XXDB 3VGAB 4YLQT 5FYLL 1T22A 5IV2A 3CFEA 4M1DL 5E8EA 4OSUH 5IB3A 3IFLL 4I9WE 1OINA 3G5YA 5KG9B 2FGLA 4QRPB 4YHML 2DSUA 4FABH 3I2CH 4RL3A 5EOCJ 2ZCLH 2DM3A 2XIBA 4WFFD 2NR6C 2RCSH 1JU4A 3U57A 2AXGA 1RY7B 5FYLD 2OXHA 5GS0D 4RAHA 1DN0B 4KWUA 1PMJX 4UIKL 5KS9F 4PTMA 5CCKH 2GJ6D 4U2YA 4PRPA 4UQ2B 1PZ3A 5DUBA 2QPSA 4KQ4H 5CPSA 5IMOA 4NNXB 4YGVB 1UEYA 4NYLB 3HFML 15C8L 2CK2A 1JAEA 2YKKA 1XD0A 4U2ZA 4YFLF 5B39B 4PTXA 5GJTL 2V7HA 5I16B 4AEFA 3GH4A 1UXXX 2FZ3B 2O5ZH 2X4UA 4WI9A 1ZU8A 1UY0A 5IW1B 3GKWL 2B4KA 3ZLQC 3ARWA 2HJLB 5IF0B 3OHXB 3QHTC 2CJUH 4QRTA 1T83A 1AJ7L 3QUXD 4U1LA 3V0AC 3VXRA 2FJHB 3L3HA 5C6TH 5AYQA 4W84A 2DQUL 1OP9A 1RHHA 1SY6L 1G7PB 5C0IA 1LDPL 3O6AA 1YMHB 2AJXL 1V3IA 5I2IA 3QBTB 1FHDA 1WDSA 3BISA 4PJBF 1RSFA 1XR8B 4HWEL 4HH8A 3O4LE 1IFHH 1CFSB 4EI6A 1G7IB 1MY7A 1RIHH 3IDNA 4BSJA 4LCWD 4QY8A 5F6HI 2V9TA 1KIPB 3I6GB 3FZUD 4P9HH 5I17B 1JGEA 5CWSA 4BH7B 2ERJB 5C07A 1UQZA 4KFZC 1OW0C 1WICA 2WINB 1YDPA 3F58L 5F71A 1WPCA 3NZHH 3SGDI 1UD2A 2J8UF 4AMKL 3BCDA 1Q9WB 1FAIH 4TSCH 5I1CH 1P2CB 5HVHB 4MNMA 1S9YB 1UWQA 2OYPA 3SDCD 2CLZB 1C08A 1XF2A 2K7QA 2P8MB 1UA6L 1EGJH 1MCWM 1FYHB 4JGJA 3VFSA 3VXTA 4PREA 2A1WH 5INCA 3F12B 5M3WA 3VFPA 2LTQB 2GK0B 3GJFA 5E70A 1IQDA 4RMTA 4Y1AA 4RIRB 1A1MA 1JMXA 5C0EB 1KBGH 2P47B 4JHAL 3QHZL 2GJRA 1CFQB 4HMCA 3S3JA 2ZIDA 4XCNB 1KFAL 2C4XA 1FL5A 3G04B 4GBXB 3QRFM 3KXFB 4OM0L 1A9BB 4AZCB 3G04A 3WDRA 1EBAA 5JOPE 2FD6H 1I1YA 1ZT1A 3S5LB 1L0PA 3WD0A 1KULA 1ADQL 3QFJE 5CEXB 3PTQA 4I5BA 4F58H 2WBJA 3CDGA 3MLWL 5DMJB 1SR0A 1CZSA 4BZ2H 2J7EA 4LGXA 3QQ3A 3U9PH 4ZUUA 3SDCC 3MLTB 1FE8H 3QG6B 3S8WA 2R9HC 3H9YA 3WIIL 3DV6B 4ZQKB 1OAKH 4F7CA 3LV3B 5GGSY 2VERN 3U7VA 1ZJAA 3BDYH 3O2WL 1US3A 3WQ8A 4PJ7F 1XH0A 2DQEH 3E0GA 2AXGB 4NJAH 5A3ID 1AE6L 1UENA 1TITA 2YZ1A 4XCFL 3KZSA 2IH1A 2FHCA 1I7TB 1OAYH 1CLOH 1P6AB 4LU5L 4AISA 3G6JF 2UY6A 3IFNH 1QFWI 3RAJL 1IGIH 5D7LB 1X5IA 1KJ2L 5FKAB 5C0DB 3PWUB 4KHXH 5C92A 2O61B 3WJLA 4NRSA 3DGCR 4NUJA 4P5MA 3MNZA 2X0HA 2YZ8A 3M07A 1T0MA 4EBQH 5AUMA 3AU1B 2YC1A 1PKOA 5KANG 3RU8L 2BXZA 4OI7A 4EN3B 1CXEA 4GWJA 2VAAB 2M1KA 1V7MH 4MD4A 3VA6A 3IF1B 1SQ2N 4WFEE 5K9QG 1BVZA 2ADIA 4AIEA 1NCAH 2JJWA 4QRRE 1MFDH 3BE1L 5J56B 3L4TA 4P23C 1F97A 3BZEB 4G9FA 1NLBH 4LSRH 1AGFB 2CLVA 3OZOA 4R27A 1CE6A 1ES0B 3BDXA 3O6FC 3W9DB 3QCTH 3RWCA 2NZIA 3QI9D 5GHWH 3IJHA 3WJJC 4JCMA 4ENEC 3CCHB 7FABH 2P8PB 2EKSA 2N7AA 1JBJA 1MCQA 3ARZA 3HRPA 4EOWH 2XICA 1BD2D 4HUVB 5DZOA 3F4VA 1QTYT 2Z92A 2C3XA 2HVJA 4LPTA 2AK1H 3D3VB 4GKSA 1I7RB 2W62A 1QHPA 2J6EL 1JHLL 1V0LA 2QSVA 3HZVA 1GCFA 3JWOL 1DQDH 5FYKL 1N2RB 1X9QA 2XA3A 4WENB 1CFTA 2ZEWA 2DSVA 4D0CA 2MPAH 2VITA 4NQVA 8FABB 4QOKA 2UVFA 1L9MA 2AJYH 4FZEH 1MW3A 1R7OA 3O2DL 4X9GA 3AB0C 2V6HA 1U2YA 4JO3L 1E6JH 3N1QC 3RWEA 2DSKA 3LEGA 3ZM8A 1JL8A 1ZWIA 3P73A 3WNOA 2NTFB 4P3CL 1BFVH 1D9KC 1ZSDB 2P8LA 1IEBA 4YXHL 1KUMA 1OGAD 1KBBA 4NGHH 4AYSA 4TUOB 3FQNA 4XVTL 1XMWA 5HPMB 4XPHL 5JDJA 1X5YA 3QUMB 1NDMA 2VXVH 4GMTL 2XVNA 4BQ5A 3GSUA 3PV7A 5EBWA 4Z2AA 3QJHA 3VM5A 4PCTA 1NFDB 3MV8B 3MUIA 3SCWA 1QACA 5B4NA 5BXTA 5I78A 2EDFA 5DD1H 1NCWL 2Q20A 5HHMD 1G1YA 3BEWB 1LWHA 1NKOA 4LIQH 1HKLL 1R5WB 3EW3B 1CK0L 2SEBA 3OJMB 4E41B 3TJHD 1NAKH 3FO1B 3QIBB 5E08H 4PJAE 2AJVH 2EE2A 3TVMA 4LEOB 3DPBA 1U93B 1HINL 3RAJH 1X4ZA 5ILTH 2FYYA 4HFWB 1I1XA 4OD1H 5FUZH 3PNWB 1SVCP 5EG6C 1VB9A 3VFGH 5T1KA 1GQPA 4U1IA 4YHIB 1YUHA 3ZDZF 4D6CA 1HH6B 2VR5A 1DBAH 4BFGA 5IOPA 1DEEB 5LXGH 3GXIA 5DHVA 1XNAA 5ERWB 2NY2D 4KROC 4YFLI 2XVLA 3AHTA 2CIKB 3PWNB 4ONOA 1OP5H 2WUCH 3SE3C 3MMEA 5L8JB 3GSNB 3UTPE 2QQJA 4P08A 5I1IH 3ARDB 5GZNC 1INDH 1QO3A 1LG2A 1LG1A 3H3PH 1MJ7H 4PJ8C 4QTIL 3QUZB 3KAAA 4D3CH 1Z9OA 5EJZB 1QO3B 2BVYA 2LAAA 3MJGX 4D9RE 4M81A 1Q6FA 1UJ3C 1NEZG 2XQBH 3DRQB 2HVKB 4IRSC 3OV6A 5H37H 1J5OL 1FAIL 2Z31A 3HZKB 1MCEA 3OJDA 3UTTD 5I1AB 4LPUA 1MREL 4ODUB 4YHNA 5DZNA 3WF2A 4HPGA 2X6MA 2X4SA 3PV6A 2YL5A 4Z2IA 1LP9A 4NO5B 5JOPD 2VN7A 3N1AA 1B3WA 5EU6D 1ZHBA 4XNYH 3JBG7 4GG8B 5L2KB 1MJ8L 3ARDD 3CLEH 3CFCL 4Y4KB 3TNMA 2DDQH 3VI3F 4NO0A 5EC1B 1YEGH 4YK4B 1FV1B 5DF0A 5CBAA 5C2UB 5DD0H 3BMWA 1UYZA 2XN9A 5IM7A 4XB7A 2FZ3A 4YZFE 3TBYA 4GO8A 1RU9L 3E6FA 3ISWA 3BWAB 3GHBL 4RA3A 4QHKJ 4GG6B 2V7HB 5IW1A 2ZICA 4K3DH 1ROWA 3VWKA 4ZFOA 2NW2A 4P2RE 1IGTB 1VESA 4X7TA 5FD0A 5TE4L 1NWRA 3TT3L 2RGLA 4WW2C 3QUKB 4M6OH 1NWTA 4JREB 1GUIA 3EUUA 1Q9LB 4JFUA 4PMXA 3L7FA 5E1HB 4YDIL 3WF1A 1AY1H 1O7VA 1W72A 2OK0H 2XA8L 4UBDC 4JY5L 5DHYB 3GMPA 3KDMB 5F6HJ 5SWSA 1FFNA 3QHZH 2DAVA 4F2MA 4D8PB 1JGEB 5C3LD 1ZB5A 2J8HA 4H8UA 4EI5B 2OZ4H 3DMMB 3I6GA 2VLKD 1LVEA 2R0KH 1BOGA 5BRZD 3ZSTA 4N8VB 2ORBH 1OP3K 2C7FA 4ODWB 1UQSA 4P48A 2E5EA 4NRYA 2EYRA 5ECJE 4C54A 3OKDB 2X70A 4LLMB 3GBNH 4W88A 4DZ8A 5C0BD 1SM3L 3MYJB 1XF3B 1OPGL 2UWEA 3WF0A 2XZAL 3SE8L 4D6DA 4HXBL 1H5BB 1HN1A 4KC3B 1XH3A 4XRCB 1T66D 1PX4A 2VL5B 3L3DA 1QR1A 3QNXA 4RISH 4M24A 3UTTB 1I3RB 3K3QA 2DGAA 3D69B 1WAWA 3NFPA 1YPZE 3ARQA 5HVFB 2JDAA 4HGMA 1GGBH 3SCSA 4N9GA 1I1AC 3MRBA 4OF6A 2YFZA 4YHPA 1FNAA 1ZHNA 4KI5D 1KTLA 1H2JA 2KPNA 4MD5A 1LO0H 3ZHLA 3HFMH 3W39B 5CEYA 5F70A 2NT0A 4M29A 4B3KA 3KLSA 1B6UA 4FQJH 2ZPKH 4GG6F 4PRDA 1FPTL 3OBAA 3ULUC 1SBSH 1BGXL 3R8QA 4DQOL 1IJ9A 5KAQF 4KMTL 3HPJB 1Q0XH 1EDQA 4UAOC 2DBJA 4O9HL 4QRSB 2HVKA 4LLDB 5DJAB 1KGYA 3QT2A 2IGFH 1T83C 5I6SA 4Y1AD 2DLGA 1UB5A 3NIYA 1K5NB 1FN4A 2AI0L 1HL9A 4R96B 4GO9A 1K4CA 3O9WA 3P9LA 4MGQA 3H9SA 1QYGL 1DVFA 1B4RA 3WDPP 4Z2GA 3KPNB 1WK0A 2J88H 4WTZA 3SGDH 2YLLA 3IDGA 1R5WA 4S1SH 3TBVB 4X4XB 1S7RB 3G9VA 1OD0A 2D3VA 4OZGA 4F57H 2YOCA 2ZXAA 1YYMH 3IVKA 2LU3A 5GHWL 1OWRM 2WP3O 4Y7MA 5HHMB 4L8BB 2DIAA 2YDQA 4ZPTA 3RNQA 5KSAB 1M71B 4O2FB 4RCAA 3SDCB 2GFBB 5FO9A 4G8GA 5C09A 3BZDA 2NSXA 1E28A 3QDGB 4DUWA 3K8KA 1DP0A 4TX6A 3E1F1 4WEBH 3MFFA 2XPKA 2VX7A 2OCFD 4DGVL 4Q9QH 4NQDE 5TFSH 3RVVD 1GVYA 3TTOA 5HYJD 2VDQH 4J8RB 2IFFL 3CFIC 1O59A 1A6TA 2C3VB 4JY4B 2DYPA 1DWAM 4FG6C 5GS1A 1FH5H 4FI9A 1Z9MA 1YEFL 3GJFH 5I1HL 4XZUA 5D93C 5E8EB 4YXKH 3W0WE 5KVFL 3IRPX 1X5ZA 2D4DA 2NY6C 2ZKHL 4Q97A 4MXQD 3ULUF 2E7BA 3VW3H 3HNSL 1H5BA 4U1MB 3OB8A 5T1DH 1OHQA 3RWDA 3D3VD 2DBLH 1G0DA 3NGBB 4MYWB 1GUVA 5HGBA 2W9DH 2VABB 4KDTC 3ARFB 5HHOA 1S78C 1WVZA 2BC4B 3SCTA 3MRCA 1HIMH 2XG4A 3JV6B 1B0RB 5HYIA 1TVBB 6A3HA 2OI9C 3EJYC 3KXFE 5DRZA 1M53A 1U6AL 4BSVA 3G6JA 3BP4B 2X05A 2IXVA 3VI3E 5C0AD 1CK0H 3X14A 3V5DB 4U1GC 2Y07H 1T89A 4PBXA 3I50L 5CIPB 1R24A 4HZ7A 1N3NB 5F44A 4LP5A 1QPXA 1NWSA 1V0MA 2E3ZA 3HE7A 4XBEH 5HHPA 3Q2CA 1CU4H 2WUBH 3V4PH 3FT2B 4IIQB 2IGFL 4ML4A 1XR9A 4GUPA 1W2PA 3WD2A 5LWYH 3X12B 4C59B 1SBSL 2FLRT 4NNYB 4X4ME 3UBXG 1FN4B 1WSST 4KV5F 2AJUL 1MELA 3MRDB 2XI9A 5I1DB 1SMAA 4HIEA 2DH3A 3EKCA 2VIRA 2JJUA 4AMCA 5ABEA 4YDVB 1RUAH 3IXAB 4KHTH 5TQ2L 4NSBA 1CFSA 2FH6A 5AYUH 4GZJA 4X6BA 1B88A 2Y4SA 4G6JH 5E56A 5HGGS 3RNKA 4DKEH 4XXCA 4QLJA 4NN7B 3TT1H 1N5YL 1R87A 5F1IB 3GXUA 3EYSL 4XI5D 3I2JA 1QRNA 4N0UA 1F3RB 4QYOB 5FXCH 3P11L 1GPOH 4NCC1 5D71H 4HUWA 4PMQA 4X5WA 4KK6C 3S37H 1W9PA 2AMGA 5B8CC 5CSBA 1AIFB 5L88L 3DMMD 1CTNA 1OF2A 1G7MB 3QYCA 1FP5A 1B0IA 2FNBA 4JQIH 1W3JA 3IAGC 1SG3A 4OM0H 1E0WA 3RVUD 3MBEB 3PP3K 1J84A 4L4PA 2BVOA 4V2BA 2WLZA 4UV4L 2YL6A 3D18B 4QXUL 1KBGL 4OCSH 5E9DA 1IC5H 5FK9B 3VI4E 2JJTA 4CDHA 4I2XE 3MLXL 2WP3T 2GDVA 2Y2WA 1S7TA 1IARB 1XIWD 3TCXA 3CZLA 2WBJB 3CDGB 4N5EC 1KXTB 4G6FB 3QOMA 1KR1A 2NLJB 3KYKL 1U2HA 3PWPE 1R8LA 3DUHA 3CQOA 1SY6A 1GZQB 2H2SC 3H3BC 1N4XH 4OAWA 3GSVA 2J75A 4JFOA 5DMKA 3BP4A 3BDBA 2KD7A 1VIWA 2AJZB 3NCJH 3BZ4B 3FQUB 1KACB 4AY0A 1VSCA 5I0DA 3B9DA 4HUUB 1FYTD 3P77B 3C5ZB 4JAWA 4FQLL 1NCBH 3G08B 1M6OB 2AGJL 2V5YA 1UJ3B 2YBRA 1QVOA 3PDGA 1XR9B 3QEGL 1J8HE 3UTZB 1DBBH 4QGTA 1JI2A 4YGVA 3N85H 3I6KB 4OD2A 4LF3B 1EOMA 5DO2C 1RH9A 2ENYA 4M43H 2DQUH 1HWHB 1UADC 5JXAH 3EYQC 3OL2A 1EVUA 3QDMA 4HS3B 3VXSE 2FIKB 2IEPA 3BW9A 1NCNA 3IDJA 3LKQA 5EOTB 4UT6H 1A5FL 5BVPH 2W59A 3GTNA 2J1VA 1E28B 1AQKL 4WU5A 3BPOC 5HDQH 1T1ZB 4UUJA 1U8JB 1BP3B 1ZEAH 4PUBL 1CICD 2V2TA 3NPSB 4OF0A 4F33A 4DEVA 1INDL 4GKZB 4AT6A 1KLFA 2R39A 1FFPA 3IFPA 4JQXC 2Z8RA 5FUIA 2YDSA 2XVGA 1W72L 2ICWA 1G7PA 4QNPF 3TONA 4TXEA 2DYPB 5E99L 1KIUA 3JTTB 5J9PA 5DC9B 3LDBB 4XZUB 1JWUB 4NWTL 4WO4C 4P2OD 2GAZB 1HHJB 2VTFA 2PW2A 3MOBH 3AICA 3SCMC 2DQFA 2Q3ZA 3A67L 3IKCB 3TBTA 2A77L 4F9LC 4NT6B 1HJVA 3O4LB 2ICWI 1YY9D 3HG1A 2A6DB 5KAQG 4ZE4A 4PUDA 3PGCB 4HWNA 3ACIA 2DQCH 1JFQH 4YHPB 5IHUL 3AUVA 5EA0H 4I8DA 3WNMA 5FF6A 4G8IA 1TMCB 3EGSB 3MLXH 4CN4A 2IPKB 1MI5B 1HNYA 3FFCD 1TXKA 5IFAH 3BVNA 1U36A 1HT6A 1MI5A 1DFBH 5D96C 1F3JA 3MC0A 2H6PB 5AEAA 1R5IA 1BVKA 2C1PB 4I2XB 4MB5A 4UV4H 1LO3L 4EXKA 4HC1L 3ZL4H 1Q1JL 1W9SA 5ITFB 1V05A 1MSPA 1LWRA 5AWNL 1MJUL 3SUUA 4JFYB 1PZ5B 5D72L 1PY9A 3DECA 3CK0L 2J8GA 3F2ZA 3KXFA 1P84K 4PY8I 5KG9A 1UXSA 3BYTA 4C55A 4DUXA 3FQUA 3VPLA 1KTLB 5JHDE 3ARBB 4C56A 2YA2A 3AXLA 4LSTL 2J7DA 1EEYA 5DRXA 2J4WL 2YB7A 4TNVF 5D1XD 1HKLH 1UXZA 3WDQA 1QZ1A 1OF3A 1AE6H 1HEZA 2WWCA 1AXSA 3MUGB 4IRJB 4OKVB 1IT9H 1RZIB 2WC7A 2DF3A 1LO2L 3MCG1 3VXNB 4G8EA 2WIMA 1UA3A 4X4XA 1KXQE 1UZ6E 3WUZA 4PJ5E 5EU5B 4AZHA 2DQXA 1K6QH 3QDJA 4ZFGH 1BMGA 1UM4H 1IV8A 2IQ9H 1ZHKA 4XMLH 3SE4C 3RWGB 1EXPA 3TO2B 1N7ML 3VXSD 4YHYC 3WN5A 5GZOD 4P2QB 4ZD3L 2UVEA 2DIEA 2R0LL 3V4UH 1WAAA 1NM9A 3QNYA 4GW1A 1NGWA 1ZGLB 2XZAH 1Q9OA 4I18B 1UYWL 3BH9A 1FIEA 2WQRA 2EXWC 3PWLA 1QVBA 2ADIB 4OZ4A 4XNZB 3GUTA 1HVXA 5L8KB 1LHZA 3BO8A 3L7EA 1RIUH 5I1KL 3LHPH 2PO6B 3OX8A 2IJ0C 4WI4A 5C0GB 3N1GC 3AU1A 1TJHH 4TVSa 1P7QA 5C9JA 2UUDK 1LL6A 1QRNE 1ES0A 5FHAH 4AIZB 1P7QB 2VURA 3HR6A 3IU3B 2YC1B 4DVBA 3WIFA 1YY9C 5EO9B 4DM1A 3PABA 2DQTL 1YN6A 5GS1C 4L3EB 2AQ1A 1HQ4B 5D7IF 2CERA 1BVNP 5KSBE 2AEPH 4TUKL 3TN0D 3GMRA 3FHQA 4MXQC 1DYOA 4KH2A 4O2CA 4EN3C 3AJ7A 3RIAF 1ONQA 5E9AA 3MREB 4JFFB 1QSZA 3VXPA 4DAGL 4P8XA 4PJCE 1C7SA 1YPZA 4UTBH 3X11B 4ZDHB 1IVLA 5GRJH 4QRQB 3O3UN 4HKXB 2R1XB 3LPGA 1CS6A 4O2EA 4FTVD 1YNKL 1I4FB 3L5XH 4NJ9L 4K07A 4LLVA 4ZFOB 3VWKB 4POYA 4P8WA 5T3XL 1FO0L 2H9GB 2HFFB 3WL9A 3RY6A 3ULUE 4AZCA 1WBXB 4ZYKA 2OQJA 4WUUB 3TH3T 1EEYB 1ZT1B 5TF1L 2QQLL 3QR3A 5H35A 3QFJA 4J6RL 1CXIA 1BBJB 3EYFB 3AM8C 3MJ7B 3BLKA 4D3CL 3KPQA 3HNVL 5GXBB 4G8EB 4I3SL 1DQLL 4FP8H 3F12A 1TQBB 1C91A 1UYXA 1JD7A 4RIRA 2P5ED 4PMYA 2OJEA 4V2XA 2ZSWB 4PR5B 2J1AA 5L7XL 2YRZA 3MGOA 3HLAA 2VUOA 2B1AL 1W8NA 1U93A 3O3AB 1NDMB 2A3AA 4HFWA 2F53B 3GKZA 1WBZA 4L9LB 2A6IB 5HNNA 2WBKA 1YDPB 3T2OA 4K7PL 3T1FA 1SDDB 5EZOH 5DURB 4LAQL 1C3FA 2ZUXA 4E41A 4LCUA 2F8VA 1GC1L 5L0QC 2R2BA 4F7PA 1MH5A 2GAZA 4PJGF 1KB9J 4NPYA 4ZOAA 5DGRA 3ZIZA 1ZTXL 1OF2B 5LGKA 1CDUA 1VGEL 3MV7D 3QHMA 5CGYC 3UJIH 3LQAH 3T2PA 3CGTA 1EZVX 1NCWH 2W60A 1L7QA 4LMQI 1QRNB 4U1JA 5BXPA 5F6IC 1T1XA 4J3UA 1YEJH 4RX4A 4UIMB 5FGSA 4D6JA 1N8ZA 1NFIB 1ND0A 2C7UA 1A4JA 4POZD 1QFWL 4P2OB 1MLBA 1UY1A 2GSIA 3U2SA 1P4LB 4PTWA 2LE9A 4Q0XL 2GJJA 4QHNB 2XKSA 2OP4H 3DV4B 4NHUB 2YKLL 4LKSA 3QCUL 2KQMA 4S11A 4XHQA 3TO4C 3MO1A 4S2SB 1JZ4A 4ZNEE 2F5AL 3CHDA 3KLAB 5ABFA 4GMSL 2V3EA 2YDRA 3K0WA 1FZKA 2J6EH 1M6OA 3STLB 4NQDD 5HSFA 2WC3A 4BQ3A 1UCBL 1OAUH 3ILPA 2UZYB 2UZIH 1PG7L 1MUJB 4LLWA 3RBSA 2BFGA 3RWFB 3BGMB 3K46A 4I0PB 2Y8KA 3PZGA 3V6OE 2RHEA 3HUJE 4EIZC 4KVNL 1XIWA 4YGAB 4R26H 3BZ4A 4OKDA 1A7QH 1C5DB 4OJFH 2X4QA 4IMKA 2LTQC 3ECBB 4KZDL 4KZDH 4TUJA 2EH7L 5ITBH 3B5TA 3PHOA 2H2PC 3GI8H 5MI0C 3B9KB 3Q6GH 4BK5A 1R3IL 4OZIE 2V9QA 4YDLB 5HYEA 1D7PM 2VDRL 2EDWA 4U6XB 1GOIA 5DK2B 2BDNH 1HYRC 2IQAB 2AOSA 1IKNA 1S9XB 2Q6WA 1UKQA 3PJSA 4JFEB 4NN5C 1NSNL 2YPLE 4GRLA 3K8MA 2X8RA 1E6OL 5KVEH 5T1MA 3C60D 2WMIB 2G9HA 3ME0A 4LSVL 3ZT6A 3ULSA 2CLVB 1MHPL 1BJ1J 4DTGH 4PT6A 1GONA 2Z31C 1NGXA 3B8YA 5TH2B 4ERSL 4NPYB 2ZCLL 3HE6B 2WHLA 2Y6JA 5ISZE 1E4XH 3WXVH 3QDMD 3VMPA 4F2MB 2BVUA 5DEGA 1E27A 3AIEA 2G2RB 4RWYL 1RV6X 5BS0A 4Z5RA 4YXLH 1W0WA 4YDKL 5GSVB 5FKYA 3MA7B 1CEOA 4NKIL 4ZAKB 3NMEA 5DQJB 2IADB 3NDZA 4ETQA 3UBXA 3BAIA 3CIHA 4XCEB 4OLXL 3VRIB 4CNIA 4EANA 3RVXC 2QF8A 32C2A 1FAKT 5EB8A 2NY2C 4JFDB 4KROD 5A2FA 1XFPA 1KFWA 1CG9B 4L4OA 1JZ6A 3IFNL 3BP7B 4YZFF 1IGYA 3EJZC 3VA2C 4PJCF 5F72S 3QEQB 2ATPB 1UZ6F 3JTSA 3QRGH 3O6ML 1MIEH 4RFEA 5BOZG 4NT6A 1J0JA 1TDQA 1G9NL 2ZSVB 3BN9C 3NACL 3NFNA 4JZJC 4YUEL 4KJPD 5HJ3A 3I2FA 3K75B 4Q6IB 3V6ZB 3DRQA 3V8OA 3TF7C 2PTTB 5AZ2H 5IGXL 4E0RB 3ULUD 5EU3A 1Q9KA 3WL9B 4ERSH 5FEBA 4WJ5B 5CZVH 1K5NA 4JFPB 3ALXA 3SDAC 5GGTH 5D2LB 4KJQC 4Z7QE 4YHZL 4S1DD 4JE4B 1UM6H 2CR6A 1AI1H 3QCVL 3QWOA 2XZQH 4U1HA 3ES6A 2B2XL 3MRIB 3BKJL 1A3QA 1IQDC 5AD0A 4ZUUB 4XB3A 3IXAA 1K2DB 4XH2A 4UOQA 2W38A 2FO4A 4MB4A 5DD0L 1TA3B 3KPMA 1LDSA 3ACFA 5GGUA 2Y6SD 3GIVA 1GOKA 4D9RD 1T1WB 1UCBH 5C2BH 2OTWA 1I8KA 4QXTB 1YMMD 2ZG3A 4LDEB 1GHFH 4V2CB 3VINA 3QJFA 4WV1C 3O6KH 5IFJA 2PTUA 5GGVY 2XN9E 4Y89A 3SPVB 3WUEA 2APBA 2X4NB 1MHEA 3KXFD 2J7MA 1GQIA 3W24A 1C7TA 2CESA 3CSPA 5I66A 1PIFA 4TOYL 5IVNA 1SEQH 4W7UA 5SX5K 5DHVB 2EC9T 4FNLH 3GO1L 3RY6C 1NUKA 1WDPA 3I50H 1D5IH 4NNXA 5C9JB 4MLSA 4OIBA 3EO1B 4M5ZH 3C6LB 1QYGH 2OZ4L 2FYYB 3FZUC 4M3JA 4P4KD 4M93B 3O6LH 2R15A 4YIQA 1H0IA 1J1XH 3NCMA 5HY9B 3OLIA 3QIBD 1ZS2A 5F7UA 5JDSA 2GW5A 4FXKB 3PXJA 1S7VB 1AKJA 4APQD 2ZUQC 1C12B 3BIKA 3V0WH 3HJRA 1I9RL 1NGWB 5C70A 1ZGLA 5CCKL 2NXZD 1UUQA 5IQ7L 4MMZC 4JANB 4NKIH 1JF1B 4TNVK 1H1NA 5A6MA 3P9WB 1G7QA 1TLKA 4PV8A 5FKPB 5FHBH 1OL0A 4JY4A 2GT9B 4EI6B 3MREA 1Q9WA 2UUDH 2VLRB 1S7QB 1P7HL 3MV9E 1VEMA 5F8QC 3ELAT 3W38A 1ZJBA 3P3YA 1ORQA 5C07B 4ZXBD 2P8PA 2B1AH 1RUQL 3AMGA 3MRCB 2IPTL 5CWSB 3ZE2F 5KSUB 4JPIA