3K4AA

Crystal structure of selenomethionine substituted e. coli beta-glucuronidase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
605
structure length
597
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYVGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-glucuronidase
publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
total genus 140
structure length 597
sequence length 605
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k4aA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k4aA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k4aA03
1Q1JH 2QLYA 4JO2H 1SR0A 2ITCA 2BSRA 3KJ4B 4U7KA 3GUTB 4YHGA 3O8XD 1FRGL 5HYSB 5I2IB 1MWAB 4X9HA 2FJHB 3PWLA 5GISH 2WVVB 4H8WL 3OAZH 4OD2A 5CBAB 3PWPD 1N64H 1EJOH 5E5MA 3VGEA 4WW1B 1ISZA 3U5YA 3VXSE 1RFDL 4HQQL 1RZ7L 3WIIL 5BXFA 2QQOA 1A6ZA 4XP9L 4HF5H 2X4PB 4LHUB 3O6LH 4DGYL 4Z7WE 3KYOB 1IGYA 5EBLB 4X5WA 5EBWA 2BNRB 5IHSA 4UINH 4DN3L 3RIFF 1IAIH 4GLRH 5J1SC 2CMRL 1QNQA 1OM3H 2X1WL 2RR3A 1KIRB 3MCKB 1H9VA 4UCFA 1AHWA 4NKMB 2V2WA 3BZDA 3W39B 3HNBM 3SGJA 1XIWC 3CDYA 1UD4A 3MRFA 2ESVA 3IU3B 5I1EH 1KBGL 2HJKA 2DSUA 2WAGA 4KJYB 3AS1A 1JGVH 3DXAE 5JNYB 1CZ8L 4GKLA 1D5ZA 4OF5A 2F58L 1G94A 4X83A 3WQ6A 3HJEA 1YEDB 1FNEB 3UBXA 3HUJF 4P5KA 2OL3H 4FQJH 2B1AL 2BDNH 2VT0A 4ODHL 4CN1A 1UWSA 5I71B 5LGJA 1J83A 4E41D 2ICEB 4MNQD 2A77L 5DT5A 2EEDA 4APQB 3PZQA 1ZHKA 3KPNB 4JQIH 4KUZH 4L1DA 3ARVA 5CPQA 3AI0A 3KPRD 2CKBB 1LK3L 5A40E 1FJ1A 3HZYB 4I18B 4QHUB 1BFVL 3CFEB 4TUJA 4PJGA 1UMHA 4YC2C 2MTPA 3O2WL 2DTML 4WFFD 1E4XI 1I1AC 4RNRA 4N8CH 2FYYB 1GOQA 1DYOA 2UYLB 1MHPH 5JXJA 2Q3AA 3SDXE 3F5WA 2YC1B 1ORSA 3N85H 4Y4KC 1TTUA 3GIZL 4FTVB 4PREA 4BQ2A 4UT7H 1FL6B 4FQXC 4TVPH 5EO9A 3CUHA 1CFQB 2R2EA 2PF0A 3BAJA 3QZWB 4I4WB 3RWJB 2LFGA 1JV5B 4M6MH 4MNMA 4I0PD 2OWCA 4MB4A 2ARJQ 2MQ0A 4JFFB 4Y19E 5T3XD 1BD2E 4QTIL 2CIPA 1YA5A 2GAZB 3B9EA 4KJWD 4P8VA 1IAKA 2AK1H 3ZT5A 4LFHG 1GGIH 4CUCA 3OG4B 3MBEB 4JDZA 2NY4D 4JFED 3TYFB 3CXDL 3U2SB 1E6NA 1S9WB 5T1LB 5JORB 1XSJA 4GXPA 2Q7YA 2W9EL 3VCLA 2TAAA 5SWZD 2ZXBA 1LNUA 3GSRB 4U6YB 3W5MA 2Y06L 1MJJA 3O45B 3PGCA 3VXUE 3E8UH 3IDMA 1XGPA 5I8CB 1GQLA 1RIUL 2PYFA 5J4MA 1P6AB 4OZFG 5IFHL 3L4XA 1FNAA 3PWUA 2HTLC 1XR9B 1JF5A 3CJJA 4HJJH 4YJZL 4PTVA 1UQSA 2VDOH 3FO1A 3SDYL 2AJ3A 2HFEB 4PY7B 3QNXA 5CZKA 1VFAA 1DLHB 1FORH 5D7JD 4WENB 2HN7A 3DRTA 4I2XA 2FO4A 4OCSL 4JKMA 1HH6A 1W2PA 4I0CC 3NABH 3U0TA 2QPUA 2AJZA 1UM6H 2DSVA 1J1XH 3SGJC 2P8PB 3QQNA 4X0KA 1SBSL 1XH2A 1MELA 2Z0BA 3OKNA 2X4SB 2IBZY 4JFZL 3SO3B 2B1HH 3NGBB 1P7KA 1A9EB 1T2QL 3P0YH 3G5ZA 1J0ZA 3STZB 4BFIA 4MOAA 1HZHH 5T3XL 2XXCB 2XWJB 4Z0BL 4QGYA 3QQ3A 4MAYB 3BAKA 2ZZUT 5GGTL 1EBPA 2OI9C 3FO2B 1DDHB 4W93A 2E7LA 1MAMH 4P00B 2UV3A 3S88H 5E7FA 4S10A 5DQJB 2A38A 5DJXA 2X7LB 3TFKD 5DHVB 1KN4H 4ZMAT 5TQ2L 3WDJA 5C9JB 1CFTA 4O51A 3H3KA 4GG6E 4ZS7L 2SEBB 3L5WA 4P48A 1SYSB 1A1NB 1IBGH 5D9NA 3IAQA 1KELL 4P9HC 4S2SA 3VPLA 1GHSA 3TVMA 4MGSA 1M7IA 3QDJE 4JZJB 5IVOA 1FNFA 2AI0L 5E5UB 3HCVA 4XVUC 4HPYL 2JB6A 3WYRA 2JFEX 4JL2A 3QIUA 4NF7A 1A7BA 2J1SA 4WI8A 1E4WL 2V2XA 4M4PA 3CH1B 4M6OL 3V5DB 1VFUA 5ISZD 2WKLA 3VI4F 3CZJA 1A6WH 4QF1B 2XOMA 4XB3A 4TOQA 4B9ZA 2EH7H 5MENE 3AJ7A 1SJEB 4OLZL 4G6JL 1VA9A 1ISXA 4NWTL 5TE6L 3WFEH 5E8OA 3C6LD 4ZQKA 3TTYA 4Z2GA 2DLIA 1LG2A 3DROA 2X1XR 2ORZA 1JK8A 1GC1C 4BSVB 3UG5A 4AZGA 4YGVA 1M53A 3HA0A 3WELA 1GGBL 2EIDA 3HNSH 2Z31D 5JW5A 4JKPH 3ACHA 5AC4A 3LEXA 1AXSB 4DGIH 1QLFA 4TQEH 2KZWA 4W8BA 3KS0H 3OQ3B 4UOW0 2VQTA 3INUL 4XVHA 1NSNL 3IJ7A 4A3YA 1U8JA 2Z8WC 1V0LA 3CZKA 3OZ9H 3BDBA 1TVNA 3CSBA 3SQOH 5IB3A 1K4CB 2JIWA 5CSUA 4R7NB 5F9AC 1I75A 2A9NH 2NNAA 1OHQA 4KQ3L 1MFUA 1RUPL 3BJ91 1GHFH 4EOWH 3QP3A 3IFOA 1XCTB 5KSVA 1YMME 4NRRA 2X4TB 4ZFZA 1Y6MR 2X4RA 5CEXB 1C5DB 2VC2H 5T1MB 3UR7A 4KDWA 5DA0B 5F7KC 3RJDA 1F3DH 1RVFH 5CHNA 4AAXA 4UMGA 2O26U 2OSLA 3B3IB 1J84A 4HD9A 5DUPH 3C5SB 5IJRA 2P49B 2C7UA 3H9SA 5T33H 2DQIH 3C8HA 1NOUA 4PJ9C 2DWDB 3O4OB 4U7SA 4ATDA 4WHYH 5H35A 1W9WA 1XGTA 1GOIA 4E2OA 3LHPH 3P11L 2NY0C 1BBJB 1DUZB 4GWIA 2DDQL 2VVSA 4AIZB 2FIKB 1JD9A 3T0VA 1J0IA 4EI6B 3C2AL 1HNYA 1FNSH 2XICA 4LVNB 1FP8A 2YL9A 3MC0A 3T8XB 5CCKL 3GGWA 1MNUL 3LMJL 3U9PH 3MV9E 2YC2A 1FNGB 2E7LC 3N1PC 1G0YR 1NGPL 3K2UL 1A8JH 1HWHB 3HI1A 4QXWA 3GBEA 2XHNA 4HUUB 2Y6KA 1PIFA 3M8OH 3JV4A 3O6AA 1T1XA 3IXTA 3HC3L 1AGDA 1JP5A 2X10A 5I8OH 4WSKA 1LD9A 4UZUA 2JJSA 5KTEH 5HHMB 2EDQA 5DURD 3VMOA 2HG5A 3A67L 3UTPD 1BIIB 2PW1B 4UQ2A 5D6CB 5TQ0L 4U1KB 3EJJX 2EYSB 1P8JA 2Z92B 2D0HA 3GHBH 3NH7L 3TVMC 1CF8L 3BVNA 2H8PB 1MVYA 3ARBD 1BOYA 4MJ6B 4WK9A 2Q6WB 3NCFB 2VN7A 3GSNB 5E8EB 4PJ7F 3O3AB 3QIUC 2N1KA 3F6LA 3SJVE 3EYFB 3MRHA 2YB7A 3LRGA 1F4YL 3PV6B 1EZVX 4LEXH 1QLEL 2BOBA 3CLEL 4HMDA 4I0KA 4ZYKA 3AGVA 4U1IA 2VM9A 5ANMA 1H2JA 3FFCE 4Y1AB 5IBTL 1AVAA 1NCCH 2OM5A 3UTZB 3GZKA 3QA3A 1MY7A 1F11A 1MFBH 4RGNB 2YS4A 3KXFB 1SEQL 32C2B 1V7ML 3AMLA 4UOW1 2NY6B 2R1WA 5C0GA 1U33A 4K68A 3SE4C 4V28A 3HMWH 1KCRL 1E0WA 4J2XA 5IBUB 3D69A 4MA3A 4JN1L 5EPMA 5GRXG 3D0VB 4I5BA 1IGFL 3KYMB 1FH9A 4F9DA 4QY8B 1TMCB 4M1GL 2P5EA 4ELKB 4W6WB 1D9KA 5ETUB 3KPMA 4Y5YB 1NMCC 4HEPG 1FAIL 4LLQB 1PLGL 2E9LA 1TUXA 1YY9C 1XF3B 2VE6A 2VLLB 1KEMH 4M7KH 3PUHA 3U30B 2RGSA 5C07A 1FFPA 2GJ6B 1CU4H 1MLCA 2X09A 3ABZA 3MYZA 4PJBF 2ZCKL 3MRLB 2AAAA 3QDMB 1DQJA 2GITA 3QEUB 2EH8L 1J10A 1BFSA 4Z78B 5F6IC 1GOWA 3C6SA 2DKMA 2Q86A 3TN0C 3VWKC 4M6NL 1RK1B 4HG4K 1PVHA 1NAMA 1QSVA 1OWRM 2YJQA 4BQ6A 2VZSA 4F79A 5DMKB 2OYLA 2BNRD 4WTZG 3TBVA 4AK1A 2IMMA 1BGXL 4CRPA 5C0BB 4IOFC 4GW4A 2XA3A 4GW5B 2X4QA 3F58H 3RWCB 4E42A 3V4VL 4JDVB 4I13B 2ID4A 4Y7EA 3WDHA 1JGUL 3CVHA 3U1SH 3ZTJG 1CICB 5B39A 2XWTB 3E6FB 2VZUA 1WISA 1B3WA 1A6PA 4YHLL 4P3DA 4Y16C 4LHSA 8CGTA 4G5ZL 3VH8A 1JZ4A 4GKSA 1UD5A 4C7GA 5E94B 1C5CL 1KNOA 5ESQA 1JAEA 2ESVE 3ZT7A 3D39E 4MJ4A 1TZIB 5I6SA 3BEWB 1M01A 3CVIL 4X7TB 4JRXB 4Z7NE 4FQCH 1B2WH 1KPUA 2FWOB 1SMDA 3R0MA 1MWAL 4M5ZH 4YHIB 2R2HB 3ARQA 3VFPA 2BMKA 3CNKA 3VX1A 4QXTB 4APQD 5BS0D 2Z8RA 2JJSC 3PGFH 4AENB 1U8QB 2XN9B 4LVHB 4LXFA 4JM2C 3VXPB 1QSZA 5IMKA 2VCBA 1EA9C 3JUGA 5FXCH 5A3IC 2VXSL 1RPKA 3AISA 3H9ZA 4ZFGH 2V9QA 2V2TA 5DFTA 5CZXD 4HDIA 5DMGD 1MQPA 5IOPA 4JCLA 1GQJA 3P30H 2DL9A 5IVXA 4ZFMA 3EDEA 4OOUA 1NFIB 1KBKA 4RZCB 5CGTA 1LO2L 4RAVB 3L95A 1K6QH 2PR4H 3BC9A 4U1LA 1LO3H 5F9WB 1KACB 4K8RD 1KTDB 1T22A 3DX6A 3FT4A 1UR8A 5CPSA 5E1AB 1A4JA 2JJVA 1HSAB 1WEJL 3MNZA 3LS4L 1JFQL 4DGVH 4ZUWB 3UR8A 1WTGT 3QIWA 2HKFL 2OZ4H 4N8VA 4UILL 5K9KB 5MEQB 1MWOA 4UFHA 2AEWA 1ZT1A 1MCSA 3SOBH 3RGVD 4NQCA 2EECA 3MV11 5BMFH 3MBED 4XWGL 3PWVA 5E7BA 5BZWA 2ZWLT 2ZUSA 3EDJA 3KE0A 1QI2A 5T1LD 1AD9B 3HPJA 5D1ZA 1ZOXA 4PGEB 5C7XH 4J4PA 1WGOA 1HXMA 4HJ0D 4BH7B 1HN1A 2KBGA 3KLHD 2FX7L 3G6LA 5TDPB 3GI8H 1N2RA 3PQYB 3ULUF 5D2NC 2HT4D 2EXYD 1KR0A 3VIKA 1KENH 3FOLA 1RZJH 4EBQL 1YJDL 2AKRA 4E4PA 4PR5B 2CKBL 4LAQH 1FO0H 1EHXA 4L3EE 1EO7A 3ROOB 1BVKB 1R3KA 4GXUN 3L9RB 5C0FB 2XIBA 3FY1A 2CXGA 3WD5H 4D0DB 3L1OL 5JHDA 2B5IC 1G9MC 2FL5B 5JBEA 2DMCA 4EUPB 4PJIB 3RMEA 4G42A 2WWKO 1RIVH 2DQCH 1NC2A 4OZGF 4GRMB 4QRRB 5GGQL 4K8RL 1WZAA 3CSYA 4I2XE 3U36A 2GTZB 3JTTB 1W9PA 4LSTL 4L8SA 1K45A 3MO1A 5IT2L 1A14L 3SGEI 5HYJE 4MAYD 2YDQA 5CKGA 1GL4B 3BAYA 3QWQB 3I85A 3I3EA 4AZ5A 4DWSA 3VRLE 2ZOXA 2XKNA 5JOFB 2HLAA 2Y07L 3QXWA 4HUNB 1MI5B 5ABGA 1QFUL 1Z0MA 2R0ZL 3O3DA 5I1KL 1LQ0A 3DVFA 3VG0H 4AD0A 3TZVD 4IDLA 3QDGE 1MFDL 1DBKH 4TRPL 3BIKA 5D5ME 4NZDA 2CPCA 3AOFA 3K80A 1INEH 3JVGA 4DW2H 2HFFA 3BD4A 1M4KA 4UB0H 4CAGA 4PTUA 1E4XH 2KUTA 2B0SH 4Y5VA 4LSPL 4BYHA 4MXWH 1EEYB 2FR4B 1UFUA 5MHSD 3IK2A 1B0GB 2AV7B 1D5IH 4IS6B 1V02A 3GNRA 1N3NB 5F88B 3W0WE 4EN3B 3LEIA 3CZFA 4KK8C 1JTPA 4NDMB 1S5IL 3LRHA 4EKJA 2J4WH 1KG0A 2RIKA 2R4SH 3WS3B 2FBJL 2HT2C 5A8OA 2OYMA 2M2DA 5BRPA 3RJYA 2NR6D 1R0AL 3LEKA 3LKPB 5FA3A 3MRGA 4OAWA 3SDCD 1SVCP 4JO2L 1NARA 3QIWC 1EBAA 3UXFA 4P2OB 3CLWA 1MQKL 3UTSA 5BROA 1YYMH 5CEZD 4U2ZA 4WWKA 4LSDA 3S35L 2ZWZA 3BIBX 5FO8B 1S3KH 1GZJA 5GISL 1KCKA 3VJ6A 4G8EB 3SKVA 5FOBB 3PZUA 3C08H 2EDRA 1KPVA 2UUDH 3NCYP 3BWAA 3FQUB 5ID0A 2DJSA 1YDPB 2DB8A 4R0LA 4R2GD 1N64L 2YZ8A 1I9IL 5CD5D 1W1PA 1U8LB 4HLJA 2WBJA 4OI8A 2AQ2A 5FKPB 5EZIL 3NFPB 4C56E 4HF5L 3TJHC 3VH8G 5E2UH 1KXHA 4M1CD 3LPWA 1MHEA 4PTTB 2R69H 1US3A 1WBXB 2AK4A 2FZ3A 2ZUQB 4TNWK 3AB0B 3OAUH 1IC5H 2X44D 2D31A 4F15B 5A2IH 4HCRH 1I3GL 4NKIL 5J6GB 2A6JB 5DS8B 1JVKA 5C08B 3TA3A 1IAIL 4MAUH 4LCWA 1UR2A 2GQHA 3QO1A 4NZJA 3HE7D 4FQIH 3B6SB 3HZMA 4MHHI 3ARPA 2GIYA 3EZJB 4WGWB 5EC2B 2EQDA 2YD8A 1VESA 4QOKB 3CX5K 5ID1A 3VFTA 2J7HA 1NJ9A 4PJFE 5EU6B 3MLVH 4MCYB 1GORA 5A6KA 1Z6JT 3PJSB 5GZND 4TNVK 2AEQH 5ADOH 1QNZL 4MVBD 1B3YA 1M1SA 1UKPA 5KSBF 4R3SA 1HYSD 3QUZB 4JJ5A 1KJ2B 3SDDB 1M71B 4MNJA 2VDPL 1J01A 5CEZL 4O2FB 4L0PA 3EO9L 4FLQA 1N4XH 2R4RL 2XTJB 3EJYD 1XYZA 1AR2A 4HH8A 3ZDXF 1NBQA 4DEPC 2AABH 4KUZL 1KC5H 4KKBD 1FYTA 5MEOA 4NPYA 2PTUA 1KXQA 1GUIA 2EO7A 1FA2A 5AD0B 3JXAA 4HG4J 1DSFH 1FZMA 3JVGC 3W6LA 1DQTA 4N8VG 2ZXDA 5A6SA 1TZGL 2H32A 4B5EA 5A8NA 2YUVA 3N0PB 1D3CA 5KVEL 3SY0B 1UZ1A 1VGEL 1FYHB 4IM8A 2GSGA 1L7IH 2C1PB 5C09D 5J7CC 4AISA 4ONGH 3H8NA 1IC7H 3PGDB 3N85L 1OIMA 1NCWH 1XH3A 2WINB 3CFBB 3MJ9H 5F1OB 1J05A 2C9AA 1AXTH 3AQUA 1UWEL 3LSOB 5D9MA 4U6XB 5FUZL 2NTFA 4Y1AD 4WI7A 1W3JA 2J47A 3LPGA 2VQ1A 3L7EB 2KD7A 1GPOH 4DKEH 4EZMA 1C7TA 4UQAA 1NQBA 2YD9A 3KXFD 1JGDA 3OXSA 2NY6D 5LGHH 3O4LB 1JI1A 3RU8H 2QPSA 3HOBA 3MQIA 4JZOB 1FH5H 5CG0A 4L4VA 4P0DA 4LGPB 5GS3A 3T2NL 5F7DB 4JB9H 4MJ5B 4X7SH 1FH7A 1MFCH 4OMDA 5F3BB 1OQXA 1FLRH 1T1WA 2CJUH 3T1WA 1KJMA 3BPLC 1ONQB 1YC7A 2QQLA 1TVGA 5E8DH 1JGEB 5CBEA 2W65A 4RMQA 4FQHA 4HAGA 4LF3B 2LTQB 4KFZC 3ZHDA 2P4AB 2VLJB 4JO1H 3G5VA 4AEFA 3MRNA 2WO3A 1FZJA 4LCUB 2E7BA 2F8VA 2BNUA 4X6FA 4HJJL 1H3UA 2WWCA 2P24B 3IJSA 1T83C 5D2NE 4XNYL 3TA3C 1FORL 5HGBB 3GSQA 4JFOB 3BKJH 2WIIB 5C0BD 1I1FB 3EGSA 3GSNL 4LBEA 4X7FC 4N0FB 1SVZA 1U8OA 1CZ1A 1GGUA 1T3FA 3UEZA 1GJIA 5TE7H 5ITFA 1E1EA 3G6DH 2LVCA 2VLRD 3QFJA 1GOOA 4F8TA 4TSAH 1AH1A 2Y36L 3CFJB 3VO0A 5ICZA 4Z7OE 4R6UA 5I1JH 5AWNH 5IYYA 1AP2A 2A1WL 4X4MA 2VAAA 4Y4HC 4UQ9A 1EEZA 3CFCH 4K7PX 4OCWH 1OTUD 1JYWA 2VCCA 4HEME 1LO0H 5GGUB 1HI6B 1RZIA 3FRPA 2IJ0C 4OJFH 4R7DA 3LPOA 4JRXD 3V52H 1E4NA 5AYIA 3B9KD 3KWWB 3GI9L 25C8L 2QEJA 1HHKB 2WWKT 3QJHA 4XUTA 5C0CD 3LKRA 4KZEH 1AKJA 3LKSB 4P2CG 5K59E 2R2BB 3GXUA 1JDDA 5A8MA 5IMOB 5C3LD 1W72H 3BWUC 4LCYA 1OCWH 5FDYA 3W9EB 4XAKD 1CLZH 1A6UH 5JXAH 5F3HB 3K8MA 4WI3A 4KK9C 3ULSB 5I77A 3MGAA 3L3DA 1F02I 1GIGL 4HX1A 5E8NA 5ABHA 4LHJB 1OD7A 5FFLA 1X5KA 2BFGA 2ZCHL 3ZKND 2IFGA 4AM0B 5DUML 5BXSA 3NA4A 3BXWA 2F9BT 4B3LA 1IT9H 3KR3L 3VXSB 4DZBB 3PF2A 2C7FA 1UXXX 3QNYA 4LRNH 4U1HA 5IVXE 1NCBL 4XB7A 1OTTD 1TFHA 3WFEL 4CADA 3QCTH 3VFOA 5J13B 1ODUA 3MJ7A 2IALA 3MXVH 5DD5H 5DVNA 5JW4Q 3F8UB 1IEAA 3AUVA 2C3WA 4LCCB 4X99B 1RJYB 2A0LD 5LCVL 2RFXB 3V5HB 5BV7C 1UWTA 5GRVK 5CKAA 3ILPA 2R0KH 5JUVA 2F74A 2GSJA 2ZKHL 4JKPL 2WMKA 4D6FA 4WDIB 4G9DA 5F7FA 1UKTA 5BXTA 3D25A 3RJXA 4TQEL 2CERA 1DE4B 1AJ7L 3CO4A 3WE6A 3F5LA 3DSNA 1RP8A 1T0NB 3NBNA 2W1UA 4YDVB 3MRQA 3X3GH 1Q0YL 2F53A 5HVGB 3I6LD 2N4IA 4F80A 3CFDB 4P2RB 1UWIA 2GFBB 4WNQB 1GZPB 1QQDB 3ZKQD 4HT1H 1IGCH 3ZE1F 3PZNA 1XR8A 3DXAB 5D7SL 4OKVA 3WEXB 3HB3C 4LYQA 5F9JB 1LEGA 3WL1A 3MSDA 4P8WA 5HDRA 4YZFE 3TIEA 1I9JH 4K07A 4S1QL 5HHXH 1U91A 3KPPB 4F9JA 1CIUA 1R5IB 3PHQB 5ADPL 4DZ8A 2EDDA 2W60B 5DUPL 5EULV 2CR3A 3VXME 1WV7T 1HSBB 4P8XA 4LU5H 1GJUA 1YEFH 4KU1A 3LD8C 2E8YA 2IFFL 1I1XA 4U3XA 4ZDHA 4MAVA 4EDWL 1W9UA 2BSSB 2CLRB 1AMYA 2OYPA 2F19H 1UR4A 4A4AA 4RAUA 4QRRD 3LHPL 5JHDE 3L3KB 1ACZA 5D7KD 2VX7A 4AMCA 1MEXH 4W6XB 5FYKH 4DUVA 3MLSH 1PKQA 2NW3B 2C1OB 1FGVH 4GZJA 2W1NA 3SDXB 3GSUB 4JKWA 4HWBH 3V6ZA 3MREA 1UH3A 5JPMB 4RAHA 2R0LH 1E72M 3BSGA 4NQVB 5GPRA 4Y89A 5I8OL 3AXHA 3U7BA 1K8DB 3FFDB 1MI5D 3VI3E 2JJWA 4ZXBA 4Y19B 1BD2B 1JNNL 2ZOLB 2DD8L 2HMID 1R3IH 1U8MA 3P73A 2BNJA 4P7OA 3HMXL 5DT1H 3TH4T 4GUPA 1ZHLB 1DVFA 4LGXA 2C3XA 3NTCH 3VFRB 3DETC 4LKSA 1C8YA 4F7EB 2YEZA 4RMSA 4GMSH 3CX5J 2CNCA 3FT2B 4NSKB 1GPFA 3IANA 4PJCE 3VXUB 1DQQA 1ND0A 4IRJB 2QQJA 3FKUS 3IU4H 1KOAA 3WFDH 1E70M 3IGAB 4HIXL 4L8DA 5DRZA 1XGQA 4HPOH 1V02E 2WV3A 4EXPX 3Q0HA 2FRGP 2ADJB 3Q3GB 4OGYH 4YN5A 2FHCA 4XP4H 5C0IB 5DJ6A 1B88A 2AP2A 2ZUYA 3WHXB 5IB2B 5BXPA 3ZL4H 3BISA 4W70A 1P4IH 4HAFA 3CGTA 4OLWH 1W99A 1CFVL 5IK3B 1OP5K 4OIBA 2G3JA 4C7FA 3T3MF 5J9PB 4MCZB 5EC1B 3KLAA 5C0NC 5DEFA 1VDGA 4WFGE 3TO4A 1CU4L 1NCAH 4CUAA 3RY4A 5CGYC 4ACPA 1F5WA 2QMJA 5E2VH 3DX7B 4G8IB 1ZA3A 5IROA 4ETQA 1WJ3A 1CDUA 4FQ1H 1AQDB 4MD5B 2C4XA 5IKCB 1VEPA 2MCPH 2NXZB 5LA2A 4S1DD 2E9WA 3H9HA 3MUGA 3N50A 4Z2JA 5L2KD 3QAZC 3IVKB 2GKIA 5GJSH 4ELMB 3DUSA 2EE2A 3RWHB 1ZVYA 1TDQA 2VDKL 4G8FA 5FYLH 1MVUB 4LASH 5C08D 1FL5B 1H1NA 3JV6A 2CUIA 4RA0C 4X4XB 5F72S 3LOWA 3QEGH 1OWQA 4FXGB 3HNVH 4XCNB 5HVHC 4NBYB 3KNBB 4GG6B 3AMCA 1UHVA 4QEGA 1J87A 5IB4A 1NOFA 1Q9WA 3P4NB 3PWNB 4LCWE 4NN6B 2D9CA 2NY3B 4TULH 4M5YH 3QDJB 3VRIB 5I15H 1OD9A 3DX8B 4NKOB 4HZ6A 2EKSA 3N1GC 4Y2OA 3SGEH 4WW2A 5A16A 3O8XA 3OA5A 4MMZC 5F8RC 1F3JB 4FI9A 1U8IB 1VBUA 3KYAA 4HKXB 1E4KA 4XXDB 3MROB 4FQCL 3BP5A 1B2WL 2HT3D 4M5ZL 4W4OC 3WIHH 5KVMC 2XTJD 3PWPA 4K71B 5MENB 5I1IH 5CZVH 3IETB 4RYDA 3NVQA 5I17B 3PGFL 4W84A 5F70A 4GQPH 5L6YH 3WMBA 4YHZH 5EUKA 4R4FH 4AEIH 3WLWC 2B4CH 3MS8A 4PRHE 1JNHA 3R1GL 3U57A 2P8LB 1AI1H 4S1SH 4ZFGL 1N6UA 5CSBA 4YK4B 4O5LH 4WU7B 1X4XA 1DVFC 3H9YA 3RY5A 4CVUA 5C0RH 2VZPA 4XVSH 2NZ9D 4QHMA 1SJXA 5FA4A 3C60C 1JI2A 3RZCD 1FGNL 2GY7B 2IPTH 4KI5D 4NHUA 5A1AA 3D85B 2GUYA 3PNWB 4H1LG 4L4PA 4RGOH 4QNPE 4MA7L 1UACH 3WFBL 2PW2B 2WHMA 4DGVL 1K6AA 3U4EB 1EK3A 2OYKA 4QRTB 2P5WD 5INCA 5JR1L 5KSBA 2J8UA 2H3NA 2OZ4L 1YMMB 2AXGA 3MJ8B 2YRLA 4H8WC 5BMFL 1IV8A 3OF6D 3DV4B 3QPXL 1IAOA 1LEIA 1K5NA 3Q5YA 1U8HB 2YKLH 5GGRB 2OLHA 5KANI 4AW7A 3QWOB 5C7XL 3RA7H 1A21A 3BH4A 1QEWA 3I2IA 4E41A 3M7SA 1JI6A 4MNQA 4L4VE 4XPGH 1KJ2L 3CKHA 3TCLB 1SY6H 4XBPB 5I1HH 3GI8L 4QLKA 1RULL 2P7TB 2XFFA 3KPRA 1J1PL 2CDEA 5IROC 4LVOC 2J77A 5FYJH 1JUFB 5D70H 5FKAA 3O9WC 4F2MA 1FO0L 3WSOA 1XIWB 3OR6B 4JFVA 5ECUA 3VGAC 1FV1A 3X12A 1FVCA 3MR9A 3MV9B 1CGYA 1QFHA 4PRBB 3HLAB 4NQSA 2VDMH 1UR0A 3FQTA 5LAXB 5AZEL 3WUZA 1N8ZB 3MRBA 3PBGA 1CLXA 4XMKH 1E56A 2R9HD 4JGJA 4N9GB 1I7ZA 2A83A 3RM8A 4MS8C 5BVJA 3SCWA 3HPLB 1G0CA 4I0PA 2VL5B 5AUMB 4ZXEA 3W29A 1L7TH 3QUYC 5EOCJ 2AJYL 4ORGB 3LY6A 5GGTA 4ZS6C 5IFJB 2Z93B 5GRUH 3UEQA 5LJYH 1ZT4A 4WW2C 3O8XC 3W11D 3IDXH 4JFEA 3SJVB 4HP5A 4M02A 4H26B 3GXFA 5EORL 3TO2B 4JY5H 3CK0H 4YC2B 2R0WL 1X6LA 2QSCH 1I1AB 1T66D 5SWZA 3FFCB 1DN2A 1WAAF 2P1YA 1XGRB 3O2VL 4PLKD 2DQJL 1OAUL 3GO1L 5CP3A 5DYOA 1M05A 4L9LA 4Y4KB 4PBXA 1MJ8H 1NEZG 4DW2L 1ZANH 2YPKA 4FQXB 3QJFB 1A6VH 3S5LG 2WC3A 2WW8A 1H0IA 3CFKA 5DJ0A 4PMYA 3T4AB 4MXWL 2F5BH 1T5WA 4WHTA 2J1UA 4X4YB 4GAGH 5C8JA 3GMLA 4LDOB 4FK9A 1E6ZA 2ADFL 3OHXB 5CD3A 1WBZB 2XVNA 2BSRB 1TZ7A 3WMCA 4AL8L 2R4SL 4PPTA 1NAEA 1HT6A 3LN5B 2VDNH 1S78D 2HJLB 1BX2B 4E8DA 1U58B 3PWLB 4KAQH 1TG7A 1C08A 4IMKA 3VXSD 2R29H 3BEVA 1G7PA 4D72A 1HOCA 4J27A 3V0VA 2AVGA 4U4BA 5E08H 5D4YA 1ZS8A 1CXEA 3TC9A 3I02A 1IGMH 2YD7A 5TDOA 1OAYH 3OKOA 3S34L 4WV1C 1YYML 4D9QE 1PZ2A 4NIKB 2A3CA 1TVPA 4G80B 5B38A 2ZJSL 1S3KL 1VKXA 3GM0A 4AT6A 3PTQA 1SEBA 3QDAA 3CMOL 3QBTB 3CMJA 1I7TA 5C9KA 1I1WA 4JZ5A 4K3JL 3UPAA 1IGYB 2MFNA 1A7OH 4V1DD 4X5WB 2V3DA 4N0CD 4UIMB 1YUHB 2RJ2A 4HGMA 3LAFA 2QV2A 4JFTA 2E9BA 4JANA 4AQ1B 2V3FA 4GXUM 4CVXB 5E2UL 5KVGH 5FHBH 3TIDA 1ZSDA 2V2WB 2R69L 3DXAD 3DO7B 3D3AA 1OAZL 3S36X 4XVTH 3RI5K 2EDLA 2F53E 3MRFB 1D6EA 2ESVB 2LABA 4HCRL 4K23H 1FE8H 5L0QB 2HJKB 4YHEA 1PG7W 2W92A 2QSTA 4KKCD 3L5XH 3W9DB 2IADA 5DFWH 2OXGA 5D9SA 1D5BB 4KJQC 1D5ZB 4G6AC 4HIEA 5ISZA 5IQ7H 4PY8J 4HOZA 5E99L 2OI9B 3HI5L 2M26A 1JWMA 4P5KB 2V3EA 4AD4A 1XGUA 1BYDA 5T1DL 2ERJC 1QPKA 4NUJA 2DQFB 2XFYA 3C6LA 3V6FA 3TTQA 4RQQB 3QFDA 3TA9A 4GAJL 3VXTB 3O6KL 4KJWC 1V6WA 3WD1A 1GH7A 3L3IB 3I2GA 1Q9KA 2PTVA 4I8DA 1CZTA 3OGOE 1OL0A 4JFQA 2NY4C 1DWHM 2JCCA 2Z31A 4TVCA 3H0TA 2BNQE 2W3JA 4WU5A 1OAXH 2YSSA 3S4SA 2DQGH 4ZAKC 3JV5A 3SKJH 3SUVA 4XHJD 2OR9L 1UD2A 4TUOB 1DANT 1WZ1H 1Q6DA 1X5JA 1F2QA 4LLUB 1VJSA 4OF8A 2W0FA 1DWJM 1MRDH 1WCQA 3IFNL 5DTFA 1ORSB 4PUEA 4MWFA 4Y19D 4L9LC 5C0JA 3RIAK 3ES6A 1EH9A 2EDOA 4JGMA 3H2WA 1J12A 4HIIB 2YL5A 2R1XA 3RX7A 1F97A 2Y5EA 3STLA 2VXVH 1INDH 2CGRL 4UFLA 4WFHE 4RWYL 4KHTH 1V3HA 2XJ7A 5HHVH 1L7IL 3AAZA 1UM4L 3PHOA 4HULB 2M8XA 2WANA 5DJZB 5K9JH 4XNMA 5TGBB 2EJ1A 3A6CL 1NCWL 1RP9A 5D7JC 3CHCA 5A6LA 4JDZB 3WD2A 3CDGA 3QXDA 4LVEA 4JFXB 2J62A 3VXUD 4IRJD 1EGJH 4PMNA 4IMKC 2Q7YB 3ULVH 5JPNB 4EQ3A 2YBUA 1I4FA 1U36A 5DC0A 1QRND 1LNUB 3GRWL 1I8MA 1T21A 4CMHC 4Q6IA 3PGCB 4CKQA 1JNLL 4L3EB 1HL8A 4OGAC 5IXEA 4PBWD 2VVNA 4JB9L 3NJXA 2VABA 2EDYA 2X1PA 3ZSSA 12E8H 5IJKA 3PWUB 1HF6A 5JQ6L 1N82A 2KPNA 3T1FA 3TFKC 1UB6A 4HBCH 1UQSB 5KOVC 1G9NH 3FO1B 1NL0H 2BVPA 2ZICA 1FQ9C 5E8DL 1KUMA 2XVKA 3QNXB 2ZWYA 1NBYA 3S96A 2PTTB 2ZCLL 4F7CA 3DRTB 4MJ2A 4I2XB 2FO4B 4CGTA 4KMQA 3MU7A 1BHGA 1UR9A 3U0TB 1FFNA 2AJZB 3RM9A 5F7WC 3QHZH 2NXZD 4DCQA 2RGMA 2VMEA 4PJ9B 3ARBA 1W3KA 4QCIB 3NACL 5HYJB 4FZEL 3OKNB 4YHMH 2VLMD 2CR6A 2NY0B 1P7KB 5C0EB 4NQEE 1RZFL 5EUOE 4YEEA 4ZOBA 5HGAA 4ZPVA 4AZ7A 3QQ3B 3W53A 5D72H 3MLRL 2WBKA 5TE7L 3QDGB 1I9RL 4OLYH 3LE0A 5D5MB 3MACH 4PRAB 2OTUA 2JF1A 4M8VA 4Z5RB 4IEFB 4PYHA 2D0FA 5I1JL 2P8MB 5AWNL 3WY1A 3QDJD 3KHOA 5AYQA 3P9MB 1N0XH 1T89A 3DHJA 4P23D 2Q8AL 5L88L 2Z31C 4G9FE 5I2IA 1BYAA 1MWAA 1E6PA 3FT3B 3W0WB 3BHBB 4S2SB 2FJHA 3TVMB 3RNQB 2WVVA 2NCMA 5HPCA 2HWZH 3DLQR 3DGCR 2WP3O 3QIUB 4LPLA 5MEND 5I1AA 1UJTA 3MLPA 1IEBA 3JWNC 4PRDA 5L8JB 5HPOA 4KKAD 4WW1A 1O5DT 4NUGL 4GINA 1ZHBA 1GW1A 1I7RA 5HDLA 3HU7A 1W9XA 2YDRA 3KYOA 3F5KA 5EBLA 4TX6A 4ZQKB 2AGJH 4XP1L 4MNLA 2IUZA 3DROB 2BNRA 4K94H 5JIHA 2E4TA 2VYRE 2W94A 4G7VH 2CITA 1JK8B 4M82A 1Q9LA 2EYTA 1KIRA 3UO1H 3VA6A 4HHAB 3T77B 5J3HD 4MQXC 3CBWA 5JW5B 1IT9L 5GNXA 3BYYA 4LRNL 1UXSA 4HIJB 4NZRL 3W39A 3QCTL 1PX8A 1H8NA 1L0YA 5DO2C 3ZO0A 4C56B 5F9OH 2JKXA 2BS9A 1NMCB 3MXVL 3KPSE 5DD5L 3L6FA 3O0RL 1WTLA 3JWOC 4UIKH 1N59B 3E3QC 5IB3B 1CE1L 2R0KL 1GHRA 5JNYA 2UY7A 3KDMA 3ULVF 1UA6L 2CSPA 1LDPH 3MMEB 5DD1L 1ITBB 1XPWA 1IC4L 4NJAH 1K9FA 5SWQB 5IJKC 3ALFA 1BG9A 3TN0B 3VWKB 2ID5A 2J8UE 3B8YA 4R4BA 1T7WA 3FO9B 3AFBA 4QRPE 2X05A 4HKJA 2JJTA 4PJFB 5DVLA 2XG4A 2AV1B 4APQA 1ODAA 3CXHK 3KPNA 5BS0A 1UWXH 5JUEL 2V5RA 3L4WA 5CHNB 5BVPL 2WMPA 2CKBA 4HT1L 1S46A 5M03A 2OSLB 1ZLUK 4ZNCD 2WQRA 2ARJB 3LIZL 3MSGA 4MXVE 4IIQA 1XIWD 2OTWA 3ARDC 3IYLW 3ZHLA 2XZZA 4DVRH 4KTDH 3KPRE 4Y16B 1H41A 2D22A 3MV9D 1I9JL 3EIFA 1QI4A 3SKNA 4RRPG 1LEKA 1ZLVH 3T09A 4K2UL 5DQDH 2MJWA 2YC1A 5BCAA 2QQKH 3U0WL 3UJIH 3RAJL 1YEHH 1TLKA 2DLGA 1BJMA 1S7RA 1FL6A 4UBDD 3GGWB 4BS0A 4LU5L 1A4KA 3QZWA 3RWJA 2XY1A 1LP9E 1KLFA 1N7ML 3HI1B 1T7VA 2D23A 1T1XB 4XPTH 4J3WA 1AGDB 1QBMH 3MRMA 1AGBB 1F6FB 5DJYA 1T89C 4OM0L 4PJIF 3O3BA 3AZRA 5LWYH 4JM2B 3DBXB 3UC0L 3RGVA 3MBEA 1NBVH 4M8QA 3TYFA 3SJVD 1F4HA 4HWBL 5T3XE 3RJQB 3PWJB 3I50H 1S9WA 5T1LA 2Y8KA 3BVNB 5JORA 4JEGB 4EI5D 1NUDA 1ISWA 4W8LA 3RIKA 4FNLH 5E56A 1I1AD 4XXCA 4X9YA 3FFCD 4U6YA 3NQHA 1V0NA 4MDOA 1UXZA 4XCFH 1IGIH 1K42A 4I77L 3O45A 2EEXA 3RUGE 1X5IA 4L1HA 5I8CA 3SCMC 1KR1A 4WHDA 1VAHA 4Y4KD 5A6MA 3VD5A 1JGLL 5DT1L 3T3PE 3BP6A 2YK1H 4PUDA 2VTFA 4NQTA 1BTCA 2DOCA 2PNDA 2VNCA 5JXEC 4ZTPH 1J9YA 4M4RA 3THMH 2DQTH 5HDOA 2VSCA 2F8OA 5C0GB 2R1WB 1C91A 4NZTH 1DANU 3WL9B 5EPMB 5SV3A 4NO0B 3DO3A 5D2LE 4NFCA 3IU4L 1L7RA 4I5BB 1MPXA 3WFDL 1II4E 3VVGA 2P5EB 4HPOL 3X17A 4JHBA 1W8NA 2P8PA 4L3AA 1YMHA 2X4SA 4HXBH 1RZ8A 4HWEH 2QTEA 2R23A 1A9EA 5C07B 4HH9B 5JW4R 4Q9BA 1JCKA 1NDMB 2L4OA 3BSZL 2E7HA 5ACZA 5D2NB 2XWJA 2GITB 4U0QB 4MAYA 5M17A 1P4IL 1T80A 1NH6A 4YDKH 2ZPKH 1DJSA 1I3RB 3TV3L 3EOYG 1NAMB 1CIYA 2X7LA 2X2YA 1NCAL 4JJHA 5DRWA 2Q8XA 2AXFB 3BRDA 2IPKB 4KHXL 3TZVA 4GW4B 2B5IB 3CC5B 4E42B 4OZHA 3BXNB 1C5BL 1BZQK 2IC2A 3FTGA 5B39B 4MB3A 3MBWA 4JZJA 1BQSA 4IIQC 4M43H 5HYSG 5FIEA 2CIIA 5CZXC 5J0BA 4D6EA 3QUXD 3D39D 4P3DB 2MQCA 4PLOB 4XTRD 4UZSA 5FM5O 2OK0L 4GKSB 4GRWE 1W9BM 1MCHA 1KEGL 5IWLC 3CH1A 3QEGL 4ODTH 3V5DA 4OUEA 3HNVL 4KRMB 4PIRF 4UNUA 4RFOL 3RWDB 1KNOB 5ESQB 5HJ3A 3UJJL 3OG6B 4CU8A 3UBXI 3QULB 1YN7B 3BQUC 1P69B 1I8IA 2BK8A 5L8KB 5ILTL 4M5YL 4KUCD 3MGTB 3SDCA 5I15L 4XNZC 5C70A 3IIIA 2VH5H 3MBXH 2GJXA 4CN4A 2BMKB 4M48H 4LHUG 5GIRA 4QLLA 3ARZA 3BGFC 3PUCA 4YWGH 3EYPA 2IH1B 4ALAH 4BSVA 4LSSL 3RGVC 3QH3A 1ZVHA 4KY1H 4MGQA 3SCNA 4J1UB 3HNMA 2VC9A 2V2TB 5MI0C 2XWBA 4XXCC 4PY8I 2DPEA 5CZVL 4XVUD 4KZDL 4HJ0C 4O00A 3DARA 4P3CH 3P4MB 5IVXB 4GKOA 1FIGH 1NGQH 3BH9A 3TM6A 4D9LH 2GK1B 1K4CA 1RV6X 3GMOB 4R7NA 2B4CL 2FSEB 1ZB5A 4EJ1C 2HT4C 4M9OA 1SYVB 1PY9A 2EXYC 4OOZA 1N26A 3A21A 3D3VD 1IM9D 2EIZA 1UWGH 3DX6B 4I3SH 3GEWB 4NHCH 4O5LL 5DEGA 5TFSL 3KL3A 5CJ5A 1A4JB 1XCTA 5JHLH 3WD0A 1QVBA 4Q0XH 2X0HA 2YD1A 3DSFH 3QIWB 5DVOA 1C5DA 2P48B 3B9DA 2MCG1 1TETL 3GSXA 3HE7A 3PP3K 4ZZ5A 3MTRA 2WP3T 3K3QA 3O41A 4Z7UE 4Y7MA 3OV6A 1U9KA 3FB7B 3B3IA 3P2TA 4N0UE 1MCWW 4Z7VE 3HPJB 4OIIH 1G84A 3NIGF 1RURL 2DWDA 5F6HJ 3TH3T 3CU1A 4W8JA 3ZQ9A 1HXMB 2X42A 4Y4FC 5T1KB 3HAEH 2PUQT 1JTTA 1DWGM 3B5GA 4L3ED 4AIZA 2FIKA 4X9BA 3NIYA 4XPFH 2B2XH 4EI6A 2EDKA 1B4JH 1YEIH 2XZCL 1MCBA 1VADB 3T8XA 3FOLB 1FNGA 3BAIA 3E3QE 3V4PH 3ARRA 5I6XC 4HUUA 5EIVA 4MJID 1XF2A 2XQYG 3I6GB 4BQ9A 3QZWG 2YL8A 4LYPA 2DDXA 1XH1A 3ZM8A 1SY6L 2Y24A 5AZ2H 4ZE4A 4S3JA 3N1MC 3TZVC 3GKWL 4FQLL 5JHDB 2GVYA 5D70L 5LCWL 1HKKA 5E95B 5GJTL 3GSVA 2FD6H 4OFYD 5GRJL 1BIIA 1E6RA 2A9MH 5D6CA 4U1KA 3NUKA 2EYSA 4OLXL 1ZLWK 3CPLA 4G42B 4WY7H 1GOGA 4PJ9D 2Q6WA 4RDQF 3CIQA 3PE9A 5HYJD 1L9MA 5C09A 3VRJA 3CSYB 3GSNA 1C12B 4HXAH 1CGXA 3O3AA 3U36B 4DK3A 4PMZA 1E5NA 1BQLL 2LE9A 2NY0D 4JDTL 3TBSA 4Z2LA 2EDHA 3EYFA 1OGAE 3MO1B 3PV6A 2R8SH 2XUCA 2H26A 1MREH 1DHKA 1I1CA 2VXTH 3QDGD 1J0HA 4Y1AA 1L7TL 1P4BH 1IGJB 4LQ1A 3UTZA 3Q5TA 2XKNB 5I0DA 5DC9B 3FOMB 3KXFA 3R0NA 3ZE0F 3SDCC 5EIYB 4DEPB 2WW5A 1NUGA 3O3DB 2XYLA 4ZTOH 3EO1B 5C6TH 4Q9QH 1G6RB 3L2LA 4S11A 2OJEB 3ZO9A 3D0VA 4A41A 4JY5L 3KYMA 3W0WD 4QAWA 4XX1G 4PJCB 2ICWA 4Y5VB 1F4WH 4R2GC 1EXPA 3CXHJ 3D6GA 3S97C 3VUPA 4LLQA 5L9DH 1XF3A 1K3ZA 4RMRA 2VLLA 4PJ8D 5FECB 3NCMA 1AQ0A 1BECA 1MJ8L 3CZFB 1ZANL 3VU2A 1MYRA 4XURA 4W5ZA 4HGWA 1A6VL 1KG0B 2EE3A 3QEUA 3OJDA 2A3EA 4M1CC 3VA2C 3E6HA 3CAFA 4OF0A 5JTWA 4Z78A 3L4UA 1S7SB 4GAGL 2YWZA 1VPOL 2XTLA 1EQCA 4FN0A 2LAAA 4M80A 2EYRA 3DYOA 5FA3B 4OAWB 1UMIA 1JRHL 2IQ9H 1O0VA 5DJAB 3GH4A 4K55A 3FB8B 3HE7C 5C0BA 4P46D 4M7LT 3EDDA 2J6EH 4GW5A 2VDNL 4WJXA 3L5JA 3WMSA 3VJ6B 2R29L 5EG6C 1KPVB 5FCSH 4H8UA 2VLRA 2XWTA 3WLBB 5ID0B 1UY2A 4C56D 1MCLA 3BPLB 4R5EA 1NUKA 1EVUA 4LKCB 1JNJA 1QOXA 1YY9D 4IISA 3UX9B 1OAYL 5DJDA 5FV1L 4MVBC 2EICA 1CG9B 1UT9A 3FCTB 1BSIA 4M7JH 4G8GD 1NLBH 4QRSA 2IANE 2ENYA 4UT9H 1YQVH 1TZIA 4P59H 5ITBL 2FZ3B 1B9ZA 3BEWA 4X7TA 3TN0D 4JRXA 3VWKD 3EJYC 2D31B 2FWOA 2G60H 1JDAA 2X1OA 2EC9T 4YHIA 2R2HA 4HKZA 3TA3B 4TOYH 3HJRA 1MW1A 4LCWB 4RE4A 3QO1B 3EHBC 4PRPE 5C0CA 4CCDA 4AENA 1UZ8B 4A6YB 4NC0B 5FHBL 3NDZA 1WBYB 2D0GA 5ID1B 3VFTB 1TZHB 2PF6A 4NNYB 1SDDB 4K23L 5TH2A 1FE8L 2V5SA 5BS0E 1KIQB 3LKOB 4F66A 3L5XL 4KJPD 3WNOA 5KJRH 5LXGL 5B4XA 2GFTA 4Y16D 1NFIA 3AY4A 3BLKA 5IQ7L 1CFBA 3MLYL 5EWIH 2A3BA 1E3ZA 4RAVA 4M24A 4QWWC 5DRNB 3RWIB 1KQYA 2YPVH 1IFHH 4KQ4H 4R3SB 1J5OL 2LU4A 1TNMA 1UG6A 4NWUL 4PRHB 5E1AA 4X9FA 5B22A 1EHNA 4ZUWA 1V0KA 4OI7A 3QUKA 4MZ2A 1FYTB 5E0QA 5SWSE 2WNWA 4NPYB 3SKMA 5K9KA 2NT1A 1ROWA 1XNAA 2H2PD 4JM2D 1YEEH 1FZMB 4EQ2A 1HNGA 2J1RA 4PN2A 3A3HA 4MHHG 2H32B 1FP9A 3P0VL 1NLDH 1RUAL 2UVEA 4X6CE 5DVKA 3G08B 1ZHNA 1AD9A 4EDXA 3GM8A 1OARH 1IT0A 3MUY1 1EUTA 5DO8A 4U1NA 3SDXF 2WSKA 1UM5H 4ODBD 4BH7A 3HMXA 1Q8MA 2P43B 1IGTA 4MMXC 2ZSVA 5TDPA 3O2DL 3WUFA 2KZ1B 2EEAA 1X5YA 3RILA 3MOAL 3ZLQC 1MAKA 1INDL 2PC8A 2NTFB 3VTRA 5HHVL 4PR5A 1U2YA 4NCC2 3TT1H 5FUCC 3V2AR 5K9JL 1W3LA 4JPWH 4RFNC 4FLOA 1JGDB 5D8JL 1BVKA 3L9RA 5C0FA 2VDRL 5BV7B 2VAJA 5BRQA 4KGJA 2W87A 1ZMYA 2HP4A 4D0DA 2Y6JA 1XZ0B 3QHTC 4L4VB 4NO0D 4OLEA 1GGCH 5C2BH 4G7YL 4EUPA 1T1WB 4PJIA 2C26A 3T2PA 2EDTA 3GMNB 4M56A 5FM4A 4HJGB 4GRMA 4QRRA 5E6IC 2ZP0T 4HUXA 4XP6L 3L5HA 3JTTA 5CBEB 2W65B 4TNWF 3QEHA 4UUJA 4PYGA 3PTMA 12E8L 3G5VB 2VOTA 3MRNB 1FZJB 1GQIA 4Y2DD 1DP0A 5DGRA 1MCOH 3ARUA 4X6FB 4GT7A 1LVEA 4HBCL 4A2LA 5JOFA 3VE0A 2YFUA 3B9KC 1XCQA 1LNSA 4FLSA 1MI5A 3TNMA 3RWGB 2NTSP 1IL1A 2ORBL 2Q1EA 3EGSB 2W61A 4TX8A 4NRYA 3M1BA 1U8OB 1HJWA 2UY3A 3WSUA 3QG7H 5ITFB 2N7AA 4UAOC 1QR1A 4YX2H 4X6EB 4KROD 4YHML 3HRZB 4F9PC 1EEYA 2DI9A 1B0GA 4XRCB 5B8CA 4OZHE 2AV7A 1AP2B 4IS6A 4OZFH 1N3NA 5F88A 2VAAB 5D1XD 3OBAA 4C54A 3ZKNC 4NDMA 1NAKH 4YO0B 4ELMF 1JPFA 2ZUXA 3WS3A 4KDVA 4GQRA 1T1YA 4Z7QF 1TPXC 3MACL 4J8RA 4UTBH 4V2BA 4NM8L 4PTWA 4IJ3C 3N1FC 3PDDA 3AFLA 1TQCC 4GG6F 3QJHB 3ISWA 3AM8A 2YN3A 2YZ1A 3VFWA 4CD7A 5IQ9B 2NX5E 5E4EB 4LNVA 4E5XB 2Y6SC 5DDHA 1OAKH 1WCGA 2ADGB 5FO8A 3BKCH 4OCXH 2GT9A 4DUXA 5FOBA 2Y5TB 4LCYB 2Y23A 1UYYA 1TCRB 3RDTD 1JIBA 3X11A 2ZXAA 5D7LD 1LL4A 1Z3GL 1ADQL 3WNLA 1OB0A 3L3DB 1U8LA 4PG2C 1OCQA 4LMQE 5FKPA 2YFZA 5EOCH 2RGLA 3FQNA 4KK8D 4OD3H 5FEBA 4XNXH 3I9GH 3JTSB 1NFKA 1JFXA 2E27H 2HT2D 4L4TE 4PTTA 1CI5A 5L2KA 4CADB 1WBXA 2VI0A 4DTGH 1BVNP 3NA9L 1FL3B 3WENA 2A73B 2AGJL 4HLZH 4TSCL 3FB6B 2IALB 4GS7C 4K94L 5FGSA 4GFTB 1G9ML 1JTOA 1BAFH 5DS8A 4P2QE 5C08A 4KC3B 1SM3L 2IPUK 2LW8A 5IHRA 4HV8B 3D87B 3B6SA 2AJSL 4G9DB 2G5RA 1CXIA 4JG0H 3UDWC 3D25B 2CBJA 4TVPE 1M03A 2VXUL 4PGDB 4UV4L 2OZ4A 5F9OL 4ZO9A 5CUSH 3SCUA 4URIA 2VX6A 1MVFA 3WE6B 4NO5A 4MCYA 4KDTC 1ZWIB 1AC0A 5HHQB 4QFUA 5T1KD 2KQNA 3PJSA 4OT1L 3UG4A 2F53B 5FGCE 2I24N 4MAZA 2IXUA 1LDPL 5BZDB 4O4YH 3IDJB 2B8OT 4YHOH 3U7WH 3TJHD 4YQXH 5DHYB 4OKVB 2CO7B 4W7WA 1KJ2A 1M71A 2V5TA 1ZVSA 3RPIB 3QAZB 3N15A 2ESCA 3VWJD 1JPTH 3EYSH 3VXMD 3IS0X 4U1GC 1S5HA 3C5JA 1EHLH 3C7FA 1B4RA 1MLBA 3S7GA 3TIEB 5DD6B 1IEHA 5F6HI 1FO0A 2G5BB 5I23A 5HVHB 1MCEA 3L3HA 5T5NF 1KB9K 1DBAH 4QB2A 3FHQA 5EA0H 1M7XA 1CPUA 1B0WA 5JIKA 3V7MA 5HBFA 2BNQB 3SY0A 7FABH 3WIJA 5DLMH 4Z2HA 4RAUB 4UDTA 4C7DA 2C1PA 5B8CC 4MNGE 4X6BB 3RZCA 1VFBB 2FATH 1YY8A 4A3HA 3V79C 2EC9U 4ZD3H 2NMSA 3JUYA 2WINA 4RGMC 3CFBA 3ZHKA 3CU7A 3NOIA 4A45A 3ARED 1G0DA 5C09E 1DQLL 2BVDA 3MLTB 4HS6A 3MREB 3LSOA 1E5JA 1QNRA 1XF1A 1MJ7H 1U41A 4ODUA 4U6XA 1E4LA 2G75A 4XPTL 5L7XL 3L7EA 1QBML 4NNXB 1JGIA 2P5WA 3DX9A 4OLUH 5BRZE 1C8PA 1A3RH 3A6OA 5A6BD 1R64A 4ZXBB 2HLFC 1ZE3C 1NBVL 3DURB 1A7PH 2EE6A 1MIML 3OF6A 3P73B 4FFZL 4KK5C 2HVJB 4P9HH 4AY1A 5F7DA 4MJ5A 3SCPA 4WEUD 2JEQA 4JG1L 4N1CA 4FNLL 2DQHL 1DVFB 3BYTA 3CLFL 4N5EC 3RVVC 5I16B 3C60B 3BGAA 1IGIL 4XCFL 2YEZB 2R39A 3MLUL 1U30A 3BT2H 15C8H 1OSPL 3QRGH 2WB5A 1SFSA 1OW0C 4V2XA 1ND0B 4XAWL 2YK1L 3T0EC 4WEMB 1OH4A 1RUMH 3MO4A 3WN6A 1MIEH 4OCRH 4ZFOL 1CD9B 2A6DA 3DECA 5DRZB 4ZTPL 1N6QH 2X4UB 1A1MA 1WICA 4NRSA 2P24A 2DQTL 4NZTL 4HU8A 1WE5A 3WHE0 4ETYA 4BQ5A 1SQ2N 1SJHA 5HGBA 4JFOA 2WIIA 1I1FA 4N1EA 4QX0A 3CMGA 2EE9A 4N0FA 5FUCE 1TJIH 5HDQL 3S2CA 2XZQL 1DBBH 4J6RH 1CXKA 1U2HA 4HXBL 4HWEL 2JDAA 3WQWA 1MHCA 2XPGA 2WZHA 3TO4B 4IPNB 1GAFH 1ZA3B 1PX3A 4LVOB 4ETQB 3EBVA 3O9WB 4NQEB 4B53A 2VLKE 3THDA 1UXWB 2DT3A 1UCBH 2J88H 5GGUA 2D4DA 3H9HB 2HT3C 1MCPH 1G6RL 3VGAB 4PJBE 2JIEA 5CSYA 2XZAL 4Q22A 3KWWA 2FIRT 4XNUH 4BH8B 1HHKA 1RUQH 4WI6A 1RZJC 3ZSTA 1OVZA 3RCNA 2LQRA 4XZUG 1JAKA 3HEIA 5CEYA 1NGZB 2YA1A 5I0ZA 4MD0B 3BP7B 3NDYA 4HCRA 4F8QA 1QFWL 3LKSA 5IMOA 1V08A 3DUUB 5IB4B 4G9FB 3GDBA 1Q9WB 2N56A 3W9EA 1QNOA 3C5ZC 3QUYB 5C0CE 2FHFA 5FM8A 5F3HA 1IC1A 3TGXA 3RZCC 4JFYA 2HLEA 4P99A 4ODTL 1E43A 3EKCA 2PO6C 3O8XB 4WW2B 1O8PA 4Y4HD 1XEDA 1X5AA 3NMEA 2UWEA 4AM0A 1SBBA 4MX7A 1U8KA 2KH2B 3D9AH 3VXSA 1Z9OA 4DZBA 4Z7NF 5CLTA 4PRHD 3E0GA 3PWPB 5EOQL 3S6CA 2Q3ZA 3MBXL 2XFRA 4LCCA 3WUWA 1RJYA 4ALAL 3V5HA 2RFXA 3GJEA 3HKFA 4Z7WA 1O7VA 3ZTJH 2DN7A 5EUKB 2I9TA 3ZR5A 4KY1L 3BH8B 4ESKA 3WXVH 2G8ZA 5GS0H 3SGDI 1CWYA 3JZ7A 2HVMA 2XXMB 4V1DA 5FA4B 4P3CL 1OP3K 4PF1A 1NGQL 1FZOA 1T0NA 4GRWH 4KK9D 1T04B 2BFVH 3BDXA 3KPSB 5IHLB 4O58H 2DWEA 3IDUA 4FMKA 2NY2C 3WHE1 5DD3L 3CFDA 1WDRA 3PHSA 2GFBA 4WNQA 1GZPA 2XHYA 1JWUA 3ECQA 3FN0L 3DXAA 3X14B 3ARWA 4A6YL 4OIAA 3GXMA 4F9LA 3TOPA 3DSFL 5F9JA 5INCB 1BVZA 5TF1H 4RA3A 3VXNA 2J8UB 2GSIA 1XMWA 4WV1B 2R9HC 3KPPA 1R5IA 4YEFA 1C90A 1LEIB 3GRWA 5ESAB 4XC1H 1PEWA 4OZIA 1QEWB 5F7NC 1EOMA 4MNQB 3L3KA 1NEUA 4ONOA 5DR5H 1SHWB 4TN9A 1P84J 1U3ZA 4KMTH 4PV8B 4XPFL 3KPRB 2CDEB 3IDIB 5IV2B 3OJVC 2C1OA 4LL9A 1YEIL 4GXVH 1UH2A 3GSUA 5B21A 1W0WA 1HKIA 5BQ7B 4TTGA 4U49A 3Q2CA 4NQVA 1FVCB 1NKOA 4X7CC 2V7HB 5IB5A 4NQSB 1LP9B 2HFGH 1YZZA 3BLPX 3WQVA 2YHGA 4BZ2H 4Y19A 1X4YA 3SKOA 5FK9B 2FD6L 4ZUVB 1QLRA 2ZOLA 1OF3A 3OLDA 2A9ML 4QKXB 4XC3H 1OGBA 1MJUL 4LSRH 3UAJC 2A83B 4WY7L 5BVJB 4KV5F 4FFYH 1N5YH 1A9BB 2OX5A 2ERJB 1QW9A 3WS6A 4IRSD 4DXRA 4HXAL 4V27A 5FYKU 3Q6GH 5KANG 5FCZA 1RY7B 5C0AD 4F7EA 6A3HA 1CLCA 4LPUA 1KJVB 5JXHA 3MYJB 5AY7A 2G4FA 3RHWK 1WP6A 3EYVB 2R8SL 1MREL 2WHLA 2NY4B 3FT2A 3SUUA 4KI1A 1MPAH 2UZXB 2OQJB 3RUGB 3VXUA 4IRJA 4ZAKB 4Z8FH 4R8WL 4RDQG 1W9SA 3IGAA 4I3RH 5CJXA 5E09A 5FOOA 1QRNA 5E1HB 2YUZA 3Q5OA 2WSPA 4TUKH 3Q3GA 3Q6FB 5C3TA 3IJ9A 5C0IA 5DYOB 5C6TL 2BJML 1FPTH 5D5MF 4L9LB 5CIPB 3BUYA 4NOFA 3NZHH 1R86A 5F7EL 5I19H 5IB2A 5I5RA 3UTOA 1Z0NA 4XT1C 5DJ0B 2D9QB 5D2LB 1HKMA 4WHTB 5IK3A 3LB6C 1V8HA 5L9DL 3WCYA 1JZ8A 2A3HA 1HCVA 3IFLL 5J9PA 4MCZA 5EC1A 3DETD 3QUMB 5LQBL 1H3XA 5AYUL 3U37A 2LAGB 5CD3B 5D7JB 1H3PH 2WCAA 1KB9J 1XH0A 5KAQF 3HNYM 2E26A 4OFKA 1LO4L 5IKCA 1G7JB 3QCUL 2HKHH 2CKSA 4D9QD 3BEVB 4D1IA 1PAMA 5EU5B 2YD5A 4WUKL 4NYLA 2CK0H 3RWHA 4CMHB 4KKCC 5TDOB 1NOWA 1MVUA 2NXYC 1E4MM 3T0EE 2DYPD 4RIRB 5IFTA 2WVUA 5L2KE 1VKXB 4AT6B 4B7IA 4D3CH 4JZNB 3VG9C 2W9LA 4FXGA 3OB0K 1LE9A 2PETA 4XCNA 4GG6A 3U4BL 1DBJH 3LRSB 2WMGA 2XKUA 4K3EL 4D1JA 5IB1A 5D4QA 5JA9A 2NY5H 2QR0B 3PWNA 1IJ9A 4X7EC 3WDIA 2W0KA 3RY6A 5JA8B 1AY1L 3QDJA 1A6AB 3VRIA 2B7DT 3DX8A 1CR9H 2IQAA 4NKOA 5CGYD 4P23A 4M7JL 2FEEI 4GKNB 4JANB 2CO6B 2YMXH 3ET9F 3EOTL 5HI3D 2X9YA 4CNIA 2GHWB 3TIDB 1ZSDB 4MNKA 1F3JA 4P59L 3UJTH 4UV7L 5FGBC 4WTXA 1KTRL 3ALXA 4D6GA 2BGOA 3MROA 2ZE0A 1E6JH 1NAMH 1XF4B 2IH3B 4AD5A 4TOYL 5MENA 1UYWH 3IETA 1NGYB 5DI8B 4FQ2L 5D9SB 3OAZK 4HIEB 5HGHA 3CUPB 1E6XM 2D03H 4F58H 3O6MH 3NPSC 3ZDZE 4D6IA 5BW7A 3CVHH 1JWMB 2QHLA 4JGUA 4F8XA 3GSWA 4TVSa 4PJFF 1PZUB 4WU7A 3LS5L 2BNQD 4ONFH 3VXQB 3LH2H 4L3CA 5LA1A 4F57H 4K7FA 4EKXA 4ZEPA 1Q9KB 3JXSA 4LARH 1BREA 4NNPL 2JCCB 2Z31B 3H0TB 1IFHL 4WU5B 1MCIA 5GGSY 1JPSL 2YSSB 3BP4B 1QR4A 1NQ6A 1VSCA 2PW2A 3L5IA 6FABH 1D7PM 3A6BH 2E31A 2NYYD 3QO0B 5F7MC 3ZR6A 4HWBA 4RCAA 1Q0XH 4WFHD 4CVWA 3X13A 5C0JB 5EIIB 3CZUA 1G5AA 1YEEL 3WLWD 4PBVC 4BA8A 1K12A 2J79A 4Z7UB 1UOKA 2GJJA 3QWOA 4JM2F 3MOQA 3OGSA 4N0UB 3RTQC 5J6HA 4TVDA 3C60D 4XNMB 4Z6AT 4ZO6A 3SE8L 1F58H 3BW9B 3OKKA 3QXDB 1JUFA 3DI3B 2D7OA 4OQTH 1QNSA 1BYCA 4Q58C 5EJ1B 1XIWA 1YN6A 2W47A 2DJUA 1I8MB 1T21B 4AIUA 3MV9A 1EDGA 2ADIA 4PRBA 3HLAA 2Q87A 3UYRH 1R87A 1F90H 3MLXH 5LAXA 5KBNC 1C92A 4ZENA 3ALWA 1V7NH 1IVLA 2AJVH 2FECL 4UTAH 4GRLC 3IXAB 1ED3A 1J11A 2VABB 4I3GA 4WO4C 1IMHC 5CAYB 1K9DA 3MSPA 2DI8A 5C8BB 4NQUA 1BQHA 4P9MH 3HPLA 2B31A 3T1FB 3GKZA 2VL5A 4XCEB 3MRDB 4LDLB 2JEPA 1CWVA 2NY7H 3D18B 3N18A 1NBYB 1CK0H 1I7UA 3ARFD 5IFJA 4P23C 4F7CB 3WQBA 1UY4A 3RI5F 4AMKH 2L9LA 5BYWA 3WKMH 1MY5A 3PZMA 3SJVA 3O9WD 4NQED 1RIHH 4L29A 5F44A 4F3FA 1FOBA 1A3QA 4DCQB 1CBVH 1G7HA 4EI5A 2Y25A 2VZTA 4OTXH 4XCYA 3ARDB 1I1AA 1YNLL 2XRAH 5G04L 1A7NL 3FFCA 5F7HA 4PGBA 4PJDE 5LKNA 3I2FA 4ERSH 4KKAC 4ZPVB 4Y4KA 4LEOA 1G7IA 1VEMA 1IM3B 3QJFA 3F2ZA 3PZ9A 5BW7C 2A2QT 2WCSA 4K9EH 5KSAD 3ECBA 3OEAA 4MS8D 1EFXB 2OTUB 3T4AA 1WZMA 4D0BA 5H37H 4G9FD 1YECH 2J1AA 1LMKA 1GRWA 3QUYD 1CL7H 4Z7OF 3RDKA 2APXA 3P3YA 2D3NA 1BEYL 4ZS6D 3OHXA 1WBZA 1NAKL 2HH0L 2IGFH 5CFHA 3GMPB 5IIEB 5J3HC 4W85A 3LN5A 5IGXH 4UTBL 1S9XB 2HJLA 3DYMA 1BX2A 4YNYA 2X8RA 5F1KC 1U58A 1MF2L 1OQOA 5IDIA 1E40A 4AIXA 3NFSL 2DQUL 3RIAF 4JM4H 5I1AB 2UWEE 1IEBB 4PRDB 4R26L 3SQBA 5C0DB 5E4IA 1WFOA 1OAKL 3SCMB 4YXKL 1ZHBB 2W67A 4G80A 1A6TA 5K59F 3BKCL 3O6FC 4FABH 1I7RB 1P2CA 2RJMA 4NSBA 5JLZB 5E2WH 1X5ZA 5A94A 5DEZA 5FHAH 1YEKL 1T7XA 3ILQD 2WHKA 4YDLC 1NUFA 1WZKA 1FCCA 3X3FH 3MRCB 1M6OB 1Q9LB 1YUHA 4UIMA 1DR9A 2EYTB 3KPSD 5A6AA 3BI9X 3Q1SL 3I9GL 3LQZB 1WK0A 4CVXA 4V1DE 1UXSB 1KCSH 3MNVB 5IVXF 2J7FA 1VCAA 3DO7A 1A3HA 1DL7H 2IANB 3MPCA 4UOJA 3S36L 3THCA 4DUWA 1V3IA 3L6FB 1BAFL 3QUXA 4RMTA 3D39A 2XNAB 5DJ8B 3TWCH 3SIMA 3FXYA 1U8NB 3W9DA 3K8KA 3KDMB 1CZVA 1TENA 1D5BA 4NQDD 4P5MB 3T04D 3RRQA 4JG0L 1TTFA 4QRPD 1BF2A 1F6AB 4IHOB 4UBDC 4PRPB 2MKWA 5CUSL 3KZSA 4R4BB 4E0RA 4R27A 2DQFA 1K8IB 3RPMA 1S7TA 4RQQA 4HKJB 2AXJA 3M6DA 3VXTA 5BS0B 3L3IA 3L4ZA 5KW9L 5GHWH 5KZ6A 3PV7A 4H8VA 3UCRA 4PG9B 5CJBA 4YQXL 4OZIE 5HYQB 3NNGA 4WEBL 2R2CA 2PYEE 1Q94A 1W0VB 5DSCB 4EI5C 1SY6A 3EYSL 4S1RL 4IIQB 2OTWB 4TUOA 2JIXD 2DMBA 3MLZH 4LLUA 3SKNB 1LEKB 1A3LH 3RBGA 2X9WA 1V03A 4KJQD 4G6AD 5F96H 1S7RB 3TJEL 4HIIA 3GK8L 3MOBL 4ZOCA 3WSQL 3D3VA 5EA0L 4M93C 1IM9A 1A4KB 3BQUB 3VIIA 1UA3A 2IG2H 3MRJA 5DLML 3OR7A 1W0YT 5CJQH 4IOIB 1T03H 4G6ML 3OL2A 4XNZB 5DJZA 1NBZA 3MRMB 1S7VB 4X6CB 4PTMA 4XPHH 5TGBA 3BGFB 3D2UB 5DJYB 2PWGA 2I60H 3O3BB 4ZD3L 2EDBA 1JU4A 3RGVB 3MUHL 3QG6B 4JRWA 1QP1A 3BKMH 3KVQA 2O5YH 5T5NG 4M8QB 4H20H 1TJHH 4JFXA 4OLVL 5ICYA 5ENWB 2W9DL 4ZAKD 2EPLX 2WUCH 1NCDH 5MI0B 5JPNA 4U5KA 1QKZL 3U0PB 5HSFA 1FAKT 1AFVH 4LPYA 2ZX9A 2WUBH 3VI3F 4BDVB 3SCQA 4PSPA 2DDUA 1H3WM 5IHZB 4L3EA 2CKRA 1CDHA 4MB5A 1IAMA 1G9EA 4BM7A 1MFEH 3ACGA 3SGDH 4HUKB 1QRNE 3V0WL 4M61B 3BP6B 3HZKB 3VDBA 4XV0A 2DLTA 4FP8L 2B4CC 4MJIA 1EMTL 4HOXA 5E0FA 4JFDE 2BSTA 2JLLA 1HYRC 2JK5B 1XGYH 4UFMA 4QDMA 2PTTA 3QRGL 1AO7E 4PJCF 4PV9A 1KSRA 1E6SM 4Z95H 4ZSOA 4OFYA 3IJHA 1OINA 2E8ZA 3R8QA 3QNZB 1RUML 2XVGA 1MIEL 4PJ5D 4MYWB 2NPLX 4PJ9A 4B41A 4QCIA 2DT1A 5KSUB 1OT1A 1YMHB 5HYJA 3QUXC 1RZ8B 4JO4H 4Y4FB 1GOKA 5F7LB 3PIQA 2R23B 4XTRC 2OXHA 2XTKA 3KYKH 5C0EA 3AIQA 1EO5A 5A2JH 4GSDH 5ACZB 4JVPA 4OGAD 3C8XA 1J7VR 1HCFX 2VLME 2I9LA 2B39A 4J6RL 3QDGA 1KULA 5D5MA 5IESL 1FHLA 5I6XB 4PRAA 4F7MA 2JELL 3C7HA 5ESVA 2DCKA 4BQBA 4Z5RA 3HFMH 3N04A 3OLGA 2P8MA 3GNOA 5DRWB 3WBAA 4OF7A 3P9MA 3TZVB 3AU1B 1BZ9B 4HLZG 2BBAA 4OZHB 4NC1C 1BJ8A 1NCUA 3K4AA 1QW8A 3FT3A 1MW2A 3W0WA 3BHBA 3FTGB 2QQMA 3WQ8A 3D0LA 1HQRA 3G04A 4GAYA 3RNQA 2Y4SA 2CIIB 1FC1A 1BM3H 1HP5A 4XNUL 4QXGH 4PJ8A 4GO9A 1RZGB 1UZ6E 2FGWL 4O02L 5TJWK 1F4XL 1YYLH 2O5XH 4D8PA 3A0OA 3QUML 2VDLL 4MDJB 5HJ3B 3CZEA 1I8IB 5I8KL 3OGCB 5HGGS 4P7NA 1PSKH 2EDFA 3L3GB 3SDCB 4HZLB 1HHGB 2GJXB 5I1GL 4YE4H 5AC5A 4JQXC 3SE4A 2OL3B 5GIRB 5TPWH 2J5LC 5E00B 2L0DA 1B0RA 3NCBB 4JN2B 4P46A 3FJTA 3QH3B 1MQ8A 3VFSB 2NY1C 3GH5A 4HHAA 3T77A 3N06B 2DQXA 2VZOA 3D9AL 3NSMA 4DKFH 4HIJA 5FDWA 4R2GB 2XWBB 4C56A 4F37F 2IWGA 4ZNEE 2IMNA 2DQDH 1PYWB 4L4TB 2PWDA 1DQDH 1CDYA 4UDUA 1H5VA 3BH9B 1N59A 5GSVB 1AGEA 3CFIC 3PP3H 4U3AA 5I18H 1B3ZA 5FYKE 1K9EA 3MMEA 1X5HA 4J7RA 4MGXA 1KB5H 5SWQA 2EIZB 5D9PA 5DEGB 4KVCH 2EPKX 1QTYT 1MRFL 3TN0A 3VWKA 3H3PH 2QLVB 3O2DA 3UBXG 5G05L 1EO8H 5A43C 1UA7A 3FO9A 5HHNA 4M7ZC 4OZOA 5KS9E 4PJFA 4A42A 2AV1A 3GSXB 3HE7B 2B4KA 3MA9H 1UYZA 2AQ3A 4PJAE 4H0IA 3O41B 4QNPF 4MQXD 5ALBL 2VDQH 1G1CA 5FGCB 1JYNA 4CL7A 1KCLA 5AAMA 2DCJA 3B2VH 1X5XA 2ARJA 5DO2D 1X3DA 2X5PA 3GMMA 2CBIA 1RUKH 1T7ZA 1F4AA 1PMJX 3A4XA 4Y16A 2CKNA 3RWEA 5JW3L 2RAMA 2W4XA 4YXLL 2CLZA 1JHKL 5T3ZH 5DA4A 3H42H 1H8OA 1NWRA 1A1OB 3VFGH 1BQCA 3WQ5A 3DHMA 4UT6L 4H1LH 2F61A 2YIHA 3VW3L 1XF2B 1I8LC 3P1IA 4JFFE 2PWFA 1BPLB 1AGBA 4K3DL 2AJUL 3BE1L 1ETZB 4YDJB 5IFAL 2D3LA 4MNGB 3FB5A 4CU9A 4JM2A 3DBXA 4GXVL 4NO2B 2JD9A 3GSVB 4DEVA 1EIBA 3ALGA 4LP5A 1TJGL 4QRUA 4Q9RL 3T2OA 3B9VA 4P4KC 3CPLB 1EV2E 1OGAD 3PWJA 4NRZA 3OGVA 3NFNB 4ATLA 3LV3A 2CRYA 1WC7A 3DOSA 1UKQA 3AIWA 3ARDD 3VRJB 5C09B 1RMFL 4QYOB 2HFGL 3VXOA 3OPZL 4PJ8C 4BZ2L 3FQXB 3TBSB 3DJ9A 2F54E 1JE6A 5IR1B 2ZX5A 4GBXC 4LLYA 1MXDA 2ICWJ 2H26B 3UTQB 4P02B 3MNWB 4WTWA 3EO0B 1KT2B 1XT5A 3QT2A 4FFYL 3RBSA 2WAAA 4JPVH 1BYBA 1EFXD 4OV6F 2VISB 4L8CB 4MXQC 3Q6GL 4OI9A 4JL1A 1GYAA 3EYUH 3VIJA 4GW1B 4HTYA 3KPQA 3WL9A 4OSUH 5FYLE 4P46C 4PB9H 3QXVA 4NGHH 4NO0A 1S9KC 4FZ8L 3JWOL 1XD1A 2XQBL 3WN5C 5FV2A 2NW2A 4Z8FL 1ZBVA 1T0PB 2Q20A 4I3RL 5D8WA 4W88A 2ICWB 1U8PA 1QSEE 4YBQC 3ULUH 3VIOA 4JO3L 4MQ7A 2GTWA 4TSBH 4TUKL 3F7RA 1W1YA 3C8DA 1FPTL 4HH9A 5E2TH 2YC4A 2DIJA 5F71A 5FCUH 1NDMA 2I26N 5IFPA 5D9OA 3V4UH 3SCMD 4HGWB 5D2NA 1P4LA 5I19L 5DPNA 3OJDB 2D4FA 1WAAE 1JHLL 1ADQA 3E6HB 4Y2DA 3S37H 1GOFA 3GJFH 3HR5A 2PWEA 1I3RA 1G01A 5JXED 3KS0J 1N6VA 1CTOA 2EYRB 4RFNB 3GXDA 1QG3A 3T2QA 2BV9A 1ZTXH 1T1ZB 2AXFA 4BELD 2J4GA 2IPKA 4QX1A 1Q9OB 3QIBC 1V6XA 3A4WA 3CC5A 4QB6A 3BXNA 5IEKA 2MPAH 4PGZA 2FX9H 4OM1H 3MCG1 1QD0A 2VLRB 2IAND 3SEPA 1L0XA 2CK0L 3V9FA 5E6IB 4FMFA 5TF0A 4GOSA 4KJPC 5E0CA 5DJDB 3BGMB 3UCQA 4LOUC 4RSVA 3TP4A 3ULVC 4NCDA 2FEDD 3FONB 5KAQG 5D1XA 4LSVL 1RJCA 1NMBH 4D3CL 2YPLD 3HNTH 4QRSB 3SN6N 4FXKA 3RWDA 1DBJL 3CSPA 3TPKA 4PRPD 1J1OL 2W1SA 4R4ND 3QULA 1YN7A 4EIZC 2GY5A 1RFDH 2IBBA 4HQQH 3B9KB 1RZ7H 3WIIH 4W87A 3MGTA 4HKZB 2I5YL 3D5OF 4PMRA 3BAEL 3LVEA 5C0CB 5EBMB 2IH1A 4KPHL 4DGYH 2H2PC 1TVBB 2FX8H 1ZXQA 2APBA 1URLA 4Y5XC 1G9NC 4NKDB 4M1DL 4J1UA 1JMZA 4HUMB 4MDIA 4WI4A 1F2XK 3VFNA 1K85A 3QXAA 4UAOB 3P4LA 1E6JL 4DN3H 2Q8BH 2BY2A 3RDTA 2CMRH 5D7LA 5TH2B 4QTHA 2XVPA 1TTGA 3P4MA 4NC1E 2GI7A 3G6MA 1FIEA 4HZAA 2UUDK 3F62A 3U79A 3IAGC 2WQ8A 3GMOA 2GK1A 2FSEA 1RK0B 2W5FA 1INQA 1VHPA 3T0XA 2OKXA 1SYVA 1HILA 5FYJE 1TPXB 1B3JA 5SWSD 2C3VA 4HUVB 2X70B 4IMLA 3GH7A 3U7YL 3BQUD 5D1QC 4ONFL 4IJ3B 2F58H 4YPJA 3LH2L 2VXQL 4F57L 1AE6H 3DVGA 1A0QH 1TQCB 3QUKB 4MA1C 1C16A 3W4RA 1HDMA 3S3SA 3VINA 5FM5M 4ISVA 3D2UD 3SKMB 3QWRD 3D3VE 3SO5A 1J8HE 3LN9A 1DTUA 3FB7A 4ZUUB 3JV0A 3PDOB 4PRID 1ITXA 1UYQA 1ZHNB 4NQXA 4OF3A 4EDXB 1LK3H 4U1NB 1BFVH 1H15B 5T1KA 2VCAA 1Q0XL 3W24A 1CFNB 1HE7A 4PS4H 1WLHA 2CYGA 2DQEH 4UTFA 1IGTB 3REWA 1TFVA 2ZSVB 3O2WH 2WC4A 2DTMH 4PTXA 1FG9C 2FO1A 3MLWH 2ZUNA 5FF6B 1QBLH 4Y2DC 1VADA 5I1CH 4LP4A 4YFDB 3DV6B 5DMIH 3VWJA 4BSWB 3VXMA 1MRCL 3GIZH 1G7QB 2VR5A 2OR8A 3L4VA 3HMCA 3V7AE 2ATPA 3WNNA 1GJWA 3WEOA 3I6GA 2DLFL 4U1JA 1SHMA 1F58L 3O81A 4ZFOA 4PJEE 5HYFA 5HHME 1AGCB 4J3UA 2BP3A 4QTIH 3NJ3A 4K94C 4OQTL 4MJIE 2D7TL 4NP4L 3OKYA 4EN3C 3QEQE 2YRZA 4KROC 5FAAA 5A69A 2IF7A 3RL2A 4HC1H 2ZUVA 3UYRL 3CXDH 4HUXB 1C12A 4Y4FD 4ZSOE 2OS7A 2AJVL 4RFEA 1XF5B 2VUYA 2W9EH 4UTAL 5D1XC 3QEHB 3HZVB 4UUJB 2VRKA 2Y06H 3AREA 4P9ML 2Y6HA 1PPIA 2Y9RT 4OCYL 2H6PB 3IRZA 5IVNA 1IGJA 1RIUH 1UKSA 4BK5A 4U1GB 5J11C 3VE0B 3FOMA 1XCQB 5A6BA 3TNMB 5IFHH 2FLRT 3SURA 1TQBC 1IL1B 1R3JB 3EO1A 1R3HA 4NRYB 1G6RA 3M1BB 5BOPA 2OJEA 2YOCA 4NKQB 3SDYH 4LX4A 1A5FH 4HGKC 4GPNA 3NCJL 5E9AA 1QR1B 3M17A 4OTXL 2XRAL 1UD6A 3IJYA 4PJCA 1IAII 4GLRI 3RDTC 4A2MA 2R1YA 5J57B 4OCSH 2AJXH 3BRFA 1BG4A 1PFCA 4P5YA 5B8CB 4OB5H 2WO1A 2EPOA 5A6JA 2ZUQC 5FECA 2GJ6E 1HIMH 3LEYL 4EIGB 4UR9A 4RGMB 4JFZH 1NEZB 1JPFB 1ZS2A 1KCUL 1T1YB 3S5LB 1T2QH 3JWDH 4J8RB 4POZC 1CGTA 2NX5D 1L7QA 2DT0A 4LKXA 1S7SA 1BJ1J 4FQPA 4I48B 2E6PA 1ZGLA 2WXDM 1CL7L 4WJ5A 5DFAA 1Q6EA 5HTSA 1D6VH 2ITDA 1Q1JL 5GGTH 3F65A 1FVDB 5DJAA 1YPZE 3FB8A 1C3FA 3VFWB 5LA0A 1NM9A 1W9DM 1D7FA 2CBVA 5DDHB 1GXEA 4XUQA 3UTTD 2GT9B 4LLWB 4ZS7H 3WLBA 3X11B 4DKDC 3IKKA 4O9HH 3NIDE 4WW2F 4U31A 1EJOL 4L4TD 1KLUB 4LKCA 5B39G 5CP3H 3OEBA 1CG9A 3FCTA 2V5YA 5A95A 3FQNB 3UZVB 4NZUH 4FABL 4HPYH 3V8OA 3NCCB 4P2QD 3UMTA 3T0EB 2GDVA 3O6LL 1E4WH 5L2KB 1QZ1A 3SKJE 4M6OH 3VWJC 3GNPA 4M7LH 3NSXA 4G8GE 1GOHA 4UINL 4TVPD 3X3FL 4N5UA 1T83A 3N1QC 1OM3L 4OLZH 4G6JH 1CN4A 3FQRB 4NWTH 1UZ8A 2FGZA 5TE6H 4A6YA 1X9QA 2J22A 2ED8A 2D20A 1WBYA 5I76A 4JRYD 3ZE2E 3MRIA 1TZHA 4NNYA 1UC6A 1UWWA 5I1EL 1GGBH 4NO5B 1KIQA 3LKOA 3VD9A 4M9PA 2HYMA 2BXZA 1JGVL 2QKIA 5BXRA 4BA0A 7A3HA 5DJ2B 3U48A 4F33A 3INUH 4Y4HA 1ORQB 2GK0B 5ERWA 3CHFA 2AXHA 3K81A 3AREC 1I8KA 5DRNA 3RWIA 2OL3L 2YD4A 2YN5A 2J8UF 1C8XA 4FQJL 1ZVSB 2BDNL 4PRHA 4YDIH 4ML4A 1WQVT 3ULVE 1XRVA 1S5HB 3ZKXC 3C5JB 1RUPH 4XCCH 1MLBB 1QPXA 3HG1E 4JQIL 1P6WA 5GHWL 3MV01 1FO0B 3EHBD 4QDRA 5DF0A 4QRQA 1BFNA 3MX0A 5GSRB 3SPVB 3L3HB 4MXVF 3PZVA 4H0HB 4P57B 2BHYA 3KPTA 4N8CL 3G08A 3C5ZB 3DIFA 4UDTB 1MHPL 2VIRA 1A3LL 3RZCB 3TT3H 3R4DA 4PMVA 2O93L 1YY8B 3WJJC 3WFHA 5IEHB 4M3JA 3MGOB 2PO6B 4UT7L 5DRXB 1LL6A 5BRZD 4TVPL 1JXJA 1VFOA 5F89B 4QWWD 1E71M 2OWWA 1LP9F 4HS6B 4M6ML 4YFLI 4ODUB 2G75B 1T03L 1OGTA 2VX4A 2CDFA 3C2AH 3EFFA 2P5WB 3DX9B 1DFBH 2AK1L 2I60L 1MNUH 3LMJH 1R3LB 5CJOH 1GGIL 3BKML 1NGPH 2O5YL 3K2UH 4XBGB 5IF0B 5HYEA 1XZ0A 4AXNA 4H20L 4QT5B 1JZ7A 5EZLA 3L4TA 4MTVA 2WUCL 5L2JB 3FZUC 4PRWA 4UOQA 1AFVL 3BESR 2ICWI 3A67H 3G9VA 3GMNA 3LQMA 5FB8A 4HJGA 5TQ0H 3BZEA 5E24E 3RUGF 3E8UL 1X4ZA 3L3OA 1NFDE 1CF8H 3DMMC 4OIFA 5H37G 1I1YA 2NY2B 4X0VA 1MFEL 4JREC 3G5XA 3T3PF 4W86A 3SGKA 3GB7A 1DWIM 4UOZA 1V0MA 2A6DB 1A1MB 1F4YH 2QQNH 3QQ9C 2VDOL 1FN4B 1QLEH 3CLEH 1GZQA 2Q76B 3VXRE 3AXLA 4HKBB 1SJHB 1GNXA 3RWGA 5D2LF 2RBLA 2CPUA 4KRPC 1SEQH 3NABL 3RVTC 1V7MH 1UM6L 1J1XL