3K4AA

Crystal structure of selenomethionine substituted e. coli beta-glucuronidase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
605
structure length
597
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYVGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucuronidase
publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 140
structure length 597
sequence length 605
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k4aA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k4aA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k4aA03
4GZEA 3QRGH 4JN1L 3ETPA 1E71M 4UTBL 5I17B 2NXYB 1GU3A 3FN3A 3IDJB 3NH7L 3SDDD 1CDUA 2D2OA 3BJ91 2ESVD 2QV4A 5A2FA 1YYMH 1KLGA 4MS8C 4WLCA 5E70A 2RQ8A 1M53A 1L0XA 4XH2B 1N4XL 2Y36L 5F7DA 3JWDL 1S9VA 1MCFA 5FA3B 1OD8A 4HIHB 3K2UL 4S1QL 5I16B 3RZCA 5DHVH 4R7NB 2AS5M 3MCLL 1NCTA 5DR5L 4QDRA 4ZO7A 2MSPA 5T5FH 4LSSL 4P3DA 4Y89A 5FUOH 3N1PC 3LD8B 1BX2B 5EU6E 4PGCB 5CINH 4RFOH 1TG7A 1EXUA 3RM9A 5ABFA 3PV6A 2F53A 2DIJA 4H8VA 1QSED 3B2VL 3DI2B 3THMH 4DZ8B 5HPMB 1GSMA 4ZS6C 1YN7B 3VA2C 3VFUA 1UQYA 1V3IA 1OD7A 3PZNA 1FG9C 2J4GA 2CITA 3ARGC 3SDAD 4TNVF 1JZ6A 1UADC 3M17A 5E7FA 2VITB 1MCPH 1P7QB 5HGAA 3PHAA 3NZHH 2DAVA 4M7ZC 4P2YA 3QWOA 1UG9A 4KKLD 4UQ3B 1HI6B 2GK1B 4OF0A 4PJ7A 3JTTB 5E2WL 1IBGL 4H0GA 2PKDA 5J89A 3IAQA 4F8QA 4GRWB 1KGWA 1YDPB 3T3MF 3UCQA 4HKJA 5JXIA 3AXIA 4M3KB 3V4VH 2NTFB 5FM5M 3MRCB 4P2RA 3UAJD 2P7TB 4X9GA 5EOQL 2RFXB 4TVPD 1GGIL 4I3RH 1FZMB 3HR6A 4NFDA 5ACLA 3S4SB 5CEXB 4XUOA 4WO4D 3KAAA 4EUPH 4D94A 4W8AA 5EJ1B 4EDWH 3S96B 2F61A 4Z0BH 2F15A 3OR6A 1I4FA 1QBML 3ARFC 4QLLA 4LLMB 5DJ0B 4TULH 3A6OA 3VXUE 1IEAB 5B38A 1YUHB 4PP2A 1OSEA 4DWSC 1L7IL 3MBEA 2CKBL 4HWBL 2VXVH 5GGQL 4H8UA 1F6AA 4GBXD 1A2YA 3W0WD 1I3VA 5GGVH 4IOSD 3VGEA 3RWCB 3MNZA 2O92A 2F5AH 2V9TA 2DSKA 3B9EA 3I9GL 3SO3C 2CGRH 4RGOL 3GGLA 3P4NB 1UHVA 2EYRA 3G5XA 2Z35B 4XVSH 3VWJA 1R3LB 4A3ZA 1GORA 1J12A 2YRLA 3QDAA 5I8KL 1QVBA 1Q4NX 4L9DA 5HGBA 1B3VA 2XA8H 3KDMA 5F7WC 3SUSA 4YR6B 1WISA 1J1PH 4JPKL 2OWWA 1NBQA 4G8IA 3MRGB 4NQCB 2NX5E 2AQ1A 1MCWM 2G5RA 5H35A 4JIEA 3VTRA 5HD8D 4CMMB 2CPCA 3AU1A 4S1RH 2O5ZL 4EI6B 1I1CA 3MKKA 5FYKD 2FX9H 2YPKB 5GGSY 4LCIH 1DQML 3NDZA 1UXWA 2E31A 2ATKB 1JWSB 4P7RA 2PTTB 4ODUA 1BM3L 4JFYB 3FO2A 1ZGLB 2DI9A 4NP4H 5F3BB 3DIFA 3PWLB 1VFUA 3DBXA 1C1EH 5DUBA 5ANME 3R1GH 5FOBB 3WN5A 5FO7B 2ZUQC 3DVNA 3B6SB 3X13A 4NQVB 1MAML 4EXKA 1H5BC 1JRHI 4AZ6A 1NANI 5EO1B 4G6MH 4WFFE 4BKLA 5ECUA 1MEXH 5DURB 4ODSH 2ADJB 2C1PB 3F58H 3SKJE 3LN9A 4CVWA 3BPOC 1CGWA 4I0PA 1JTPA 1W99A 1FL6B 3UTQA 1DQQB 4XVTH 4OFPA 2Q8AL 1UEYA 4CD5A 5I1KL 3NGBB 1JHLL 3SKOA 4QTHB 4N8VB 5JR2A 1QEWB 1UH2A 4TQEL 2J7GA 4DEPB 3OKMB 3PNWB 4FQXC 2EKJA 4OUOA 4UNUA 5HGDB 3HPLB 4F2MA 4CJ0A 4PJCB 1ACZA 1WAAF 4LHUB 4LSPL 3S7GA 1SBSL 2W60B 1PG7X 1IGYB 2A6DB 5DJ8A 4XCNB 2HRLA 4FG6D 5FHAH 4PTVA 1FDLH 4PRHE 5EULV 2GQHA 4LVEA 2DH2A 3IJSA 1OAUL 4HCRH 3ULVF 3SE8H 3CUHA 1NPUA 1CD8A 2VAJA 5DJAB 5CPTA 4P9HL 3D6GA 4UI2A 4KJYA 3K4ZA 2BC4A 2DOCA 4WIWA 4IMLB 5BQ7A 2WWDA 4J3SA 4L3ED 3RNQA 5FA4A 3SPVA 2ZUMA 5C1MB 2Z0BA 4JRXE 2WBKA 4PJGE 1Q94A 3RVXD 1CF8L 2HFFA 3RTQB 5JW4M 1MCLA 3UR7A 4JREB 1XF5A 1VENA 4F7PA 1PEWA 2OR8A 1MCOH 5D1ZB 4X80L 3F7PC 4B16A 3V9FA 2R0ZL 3UBXB 1CLOH 1S7WA 5EPMA 1E6JH 5C0EB 1IAII 1WAWA 1R3HB 5GSRA 4OZFH 4DZBA 4EQ3A 1NL0L 5IT2H 2KBGA 4ZMAT 2BRRH 1FAIL 4W84A 3QEGH 1UQZA 4L4TA 2DI7A 4NFCA 4ACPA 5BXPA 4U3HA 5GGTL 3RDTB 1WQVT 1EEUA 4PJAA 2PTUA 5IP4A 3UX9B 2XPKA 4JAMB 3O4OB 4LP5A 3VM5A 4X6EA 5CLTA 1DQLL 4WW2C 3REVB 1MH5A 3GSNH 4BS0A 2J4WL 4I77H 3H7BB 3WIHA 1ACYH 3F5WA 2VLJA 3Q48A 3PP4H 4X6CA 2IAMC 3IFNH 1UM5L 1HXYB 3EYUH 5T33H 3FFCD 4UOW1 4G6AC 1G84A 3U37A 4QFUA 5C0RH 4YHPB 5F7KC 4JPVL 4B50A 4U3CA 3WNMA 3WNPA 4DK3A 4JHOA 4POZC 5GGSA 5GRUL 3ULUC 5DO2C 3L5XH 4I3SL 2QHRL 4OGZA 4YQXH 2YA1A 3MLXL 5C9KA 1MCDA 3NPSB 3HNMA 2A83B 3HPJA 3T2OA 3CZKA 1ZS2A 1DBJL 5ADPH 4DKDC 5DD5L 4BUHA 5D1XB 3BMVA 4Z76B 4UIKL 2Q6WA 3VVGA 1LVEA 4RMUA 3WEOA 5H2BA 1NCAH 2B31A 32C2B 4JM2C 3SJVB 3VG0H 5E2VH 4YDKH 2NR6C 4XZUG 4RMTA 4EDXA 2XWBA 2FYYA 5IHLB 2D4DA 4YXHL 3SGEI 4PJFF 1C8QA 4YGVB 1IGMH 4PJXB 1ZVSA 3X12A 2KZWA 4WDIB 1UACH 1N0LA 1NQ6A 5D7JA 2WO3A 3LEVH 3V5DB 4ARXA 3KPPA 3F5KA 5B21A 2YXFA 1I1FA 5FYLD 2XACC 3EBVA 5HBBA 3MSPA 4NN6C 3UG3A 5G04L 4WEUD 4F37F 2I24N 3LZFH 4P2QB 4D6DA 1I7UB 4JKKA 4NQXA 5HYJE 4PJ9A 2BVTA 1ZA6B 2XHNA 5E5RB 3PZOA 2AJSL 5FCUL 5HGHB 5I1EL 3CLEL 1A4JA 1NJ9B 2O5XH 1LDSA 3UTPE 3HFML 4LSTH 1T4KB 3TA3B 3IFOA 1ZAGA 5D2NA 1JGEB 2R8SH 5FYJE 3GH7A 4AZHA 2OCFD 3S35L 4PUDA 5MENA 3IRPX 3MUGA 4QX0A 4Q9BA 1R3KA 3O6LL 2R0KL 5FL0A 3MGTA 4MADA 3WQ6A 1XIWA 5JXEC 1KJ2L 1KIQA 2R23A 4Z7UA 1PMJX 1VADB 1GZJA 1AGCB 5KSUB 1KPUB 1DYOA 1WP6A 3DX6B 4LBEA 4ZXBB 2MCG1 3PUHA 3PZ9A 1T0NA 3EO0B 5E6ZA 3P0VH 3GMPA 5SV4A 3CAFA 4LPCA 4GG6F 5BO1H 2WKLA 1J0IA 5T3ZH 4CDHA 4DAGH 5FFLA 2E9IA 4HG4K 5AYUL 3KYKL 4D2NA 5JOFA 3T0ED 3QUZD 4UCFA 2W1QA 2WW8A 2W0FA 2R29L 4GRLA 4XUQA 4DVBB 1FBIL 4O9HL 4RFEA 1MVUB 4MXQC 3LEGA 2XFXA 4Z7NE 1NWTA 1CD1B 2DSWA 2I07B 4BSVB 1RJLA 1NMBL 5BV7B 3GO1L 3WV0A 4U6TA 2HT3C 5FL1A 3BW9A 2UWFA 3DTXA 1U8NB 2ZSWB 2FDBP 4K9EL 4U0RC 3VJ6A 1OOAA 4MNKA 1U2HA 4ZE4A 1HKKA 2E7HA 4L8SA 2AI0H 5KW9L 4ZZ8A 3L7FB 2IQ9H 4AZBA 2DLIA 4QXTA 4P4KB 5EZOH 1T03H 5E00A 4RZCA 4NHCL 1XCXA 1CLVA 3IKKA 2VZUA 5JPMB 2HFEB 2N56A 3CUPA 3QNXA 3S88H 2DMKA 3L2MA 3Q3GB 5E9DD 1OF2A 5A6KA 3OB0K 2EICA 1U95B 2IG2L 1G94A 1KB5H 2N4IA 3RX7A 4CU7A 2WBJC 4NM4H 1FFQA 4PP1D 2HJLB 4OIIH 5F96H 3E0GA 2VLLB 2HH0L 4LQ1A 2DPEA 2PYEE 4KKAD 4JQXA 1IM3B 4KTDH 3CXDL 4LQFL 5F1NB 4HDIB 2IFFL 3RWDB 1Y6MR 2BJML 3DRQB 1YHTA 1I3RA 1T2XA 4UQEA 2PXYB 4AM0B 3LPPA 2XG4A 4AT6B 3MOBH 4AENA 4BH8A 5FUZL 3WN5C 5C09D 2BSRA 4WHYH 1G0XA 2R1XB 3LS4H 2WQ8A 2AJUH 2OTUB 2FZ3A 3B5GA 2HG5B 2J88H 3NACH 4Z78B 2XZQL 3MXVH 4XNZB 1YQVH 4GRMA 3OWEA 1KLFA 3SOBH 2F8QA 1U8QA 3ZKMD 1JYVA 1ULPA 2W91A 4MNHA 2FH6A 4N0UB 5KN5A 1G5AA 3G6LA 1BQHG 1G7LA 5CGYC 4H25A 4HK0B 4PRDA 3MLVH 4C4KT 3ARBD 3UBXI 3I97A 3INUL 1QBLH 2XN9D 4YX2L 5DHXB 3CFDB 1L6XA 4Q6IB 5I66A 4XCFL 3LKRA 3D25A 4M80A 1TDQA 5F9WB 1JGLL 4M6NL 1T22B 3FRUA 3U4BH 3M7SA 2WIMA 4LOUC 2VM9A 3BEWA 2K3TA 1MFNA 5DS8B 2W9DL 2ZG2A 4J3XA 4GMTH 4QNPF 2VZQA 3H0TA 3U30C 1HHJB 3PHQB 3IETA 1KB3A 2FIKA 4JQVA 2AK4B 1E4LA 1CE6B 3SURA 4WRLA 4MZ2A 1IGIL 5FOOA 5J06A 2HKFL 4MJ4A 2RJ2A 3DMMA 1XGRB 4PJDB 4XPBL 2W9LA 3FT3A 3SBWA 2HP4A 2AXFB 3UTZA 3GMLA 5C08E 1MFEH 1G01A 4JHBA 5DJCB 5CEZD 4OIFA 1EZVY 1BIHA 2B8OT 2VAAA 1NUGA 3L3GB 4JHAL 2VURA 2VE6B 1OWRM 3K4AA 3A6CL 1ZLWK 5IB3B 4X4ZA 5HVHB 3I2HA 1LWHA 3BKJH 5KZ6A 2DL2A 3CC5A 3N9GL 5CLWA 4MQTB 4NQDB 3FB8A 3OX8A 5DHVB 1W8NA 1U2YA 2NY6B 3QRFM 4MA8H 5I0DA 3DV6A 1H6YA 3WBEA 1X6LA 1U8KB 3GZAA 4F7CB 4MJ6A 3RI5K 1KTLB 3V4UH 1CLXA 1A1NB 5L8LB 1TQCB 4NRZB 1HJUA 2EO1A 4HQQH 3LKPB 3WLBA 4BCEA 1CGYA 3OR7A 1XHGA 3X3GL 3B9KD 1H3TA 4JY4B 1WDSA 2GJZB 1C5CH 3VXPB 4N90E 3SDDA 3UEZA 1WZLA 1RHHB 2ESVA 3O11A 1A5FH 4L3AA 1AXSA 3C5ZB 5A6JA 3B9DA 3MRHA 2AVGA 3QDJB 4QO1A 4AEIH 3G5YA 4HH9B 4HJ0D 3DHUA 2YD8A 2ZIDA 3SKJL 3FB7B 3U0TB 1LNUA 4BSWB 4IOIA 1BFSA 4HIJB 5D7IF 1U6AL 2HLAB 3SEEA 1UZ1A 1XPWA 1KR1A 3CX2A 3BDYH 2Z9TA 2E7LA 1L7TH 2ZUVA 3V5KA 2VL5B 3C08L 4MDJB 1GGTA 1QSEA 3MRIB 2AKRB 1S7TA 4N8CL 2PCPA 3MMDA 5FOJA 5ESVB 2XA3A 4UAPA 4OZHB 3HUJA 4NN7C 3LE0A 1QPXA 3MRLA 1LDPH 4MO3M 4O4YH 1CGTA 3SDAA 4EUPB 5J0BA 1QKZH 3WXVL 1HNFA 4WI4A 4H1LG 2VZ1A 43CAB 4I8DA 2EO7A 4Y1AB 1BVKB 4UQDA 2H3NB 3HC4H 3Q0HA 2H2PC 3LPOA 1QR1B 1NMAH 5CZVL 1X5XA 3SIMA 2NY3C 1QNZH 2C8NA 2CDFB 2F8OA 2FRGP 3CLFH 5DLMH 2DICA 4M1CD 3FONB 4PYGA 3GEWB 1KF9B 4CW1A 3QDGE 1BQLL 3WKNA 1K42A 3AHYA 3GSWB 4FFZH 1XGQA 3SY0B 3BP5B 4PGBB 2WO1A 3PUIA 5JMOA 4WO4A 1MJUL 3REWA 2W59A 3ARZA 5CHNB 4QCIB 4BQ6A 5DSCA 1U8PA 3FO0H 3J7HA 4GQ9L 3VGHA 2XOMA 2JJUA 3I6KA 2BNRD 3NJVA 5CSGA 2DQCL 3N1FC 4S1SL 2W65A 4XPFL 4JANA 4W86A 4GBXA 1NP2A 2WMHA 1US2A 4Z0XA 4Y4HC 3MJ7A 3PQYB 4GI9A 1ZB5A 3PABA 3STLB 3T77B 4TXWA 3O0RH 3QO1B 4P02B 2DQGH 2HLFD 1A6ZB 3ZTNL 4GSDL 3TVMA 5HBFA 2DSVA 2JEQA 4N1CA 3ZJKA 3T4AA 5F21B 2FIRT 1K4CA 1CECA 3GMMA 4FNLH 3H3PH 4KC3B 3QDMB 1YY9C 1GJWA 4HULB 3VXTA 2DDXA 4IHOA 4LARH 4S0TD 3RDKA 4OD1L 3RQ3A 1UY0A 2I60H 4XP9L 4P7OA 3A0OA 2YD2A 5FECB 1IZJA 2LFGA 1UWIA 4C58B 5LWYH 3ULVE 2H26B 4MAYB 4J3OC 5F1KC 2AQ2A 2QQKH 1ES0B 3O6AA 3EDKA 4WWKD 1X5JA 5C07B 1RZJC 3AISA 5IKCA 1IEHA 4PG2C 1K6QL 2P5ED 2J25A 4RGMC 5TJWK 1MIEH 3QUMA 4ZUSA 3P30L 5B3JF 4X0KB 2HYMA 5E08L 1W3LA 1IC4H 1PKQE 2ADGB 4XZBA 2AOSA 3WEZA 4NPYA 1RUPH 2EDYA 2GSIA 5E8PA 2Y2WA 2GJPA 1CI5A 1ZVHA 4DQOH 3VRJB 2X8RA 2UY6A 3FL7A 4KK9C 3TNMA 3VIOA 1OAXH 2AJXL 2XPGA 2H2SD 1HE7A 1GHFH 4JFXA 5DT1H 1G1YA 1IAKA 3OLEA 2EQDA 1RURH 3TT3L 1NCWH 1NGQH 3RUGB 5FUIA 2CMRH 3MJ9L 4DKFL 3Q6GH 3WDPP 1A64A 2CIKA 1IKNA 2UY5A 1MHHA 1G7JB 1MWAL 4PJBF 5F7HA 1DWHM 3MNWA 5GNZA 3LCYA 3GRWL 2ZWLT 5F70A 4HWEH 1RU9L 3KJ4B 3RWGA 1RPKA 1MFDL 5KVMC 4ZYKB 3T8XA 1GIGL 4U2YA 3JTSA 5GS0L 1G9EA 4XMKL 4NGHL 4RWYL 3FQXB 4G8GD 4BFIB 2OTWA 3KXFE 3WCYA 4F9LA 3NCFB 4OCWL 2QADB 4QYOB 4RGNE 5EWIL 1G7QB 1A02N 4AD4A 4F7EB 1N5AB 3HZYB 5JIPA 4NQEB 3O45B 1DDHA 2WO2A 5CXPA 2ZX5A 5JIWA 1XMWA 3T0WA 4L3EA 2ARJQ 1HHIA 3RVWD 1WKYA 4OLXH 1QRNB 3RY5A 4QY8B 5T1KD 4XWGL 5DI8B 2WAOA 2D9QB 2W0LA 3GSNB 4LAQL 4JFWA 1LMKA 3WFEL 1X7QA 2ID5A 1XCQA 3X3FH 2GHWB 5JORA 3HAEA 1NFDF 1NCBL 1JV5A 5KSAB 3MGOA 1M03A 5C7XH 1P7KB 8FABA 3LV3B 5D7LD 1TJIL 3VWKB 2FL5A 4XI5C 1WICA 3DSNA 5G05L 3ZO0A 3MO1B 3KS0J 3MRDA 4Y4FC 3CTTA 1LWRA 1FO0L 1RZKL 3EW3B 5KSBB 4WUUB 2UY4A 4XXDA 2V2WB 4P23D 4OUUA 3VW3L 2G3NA 4KKCC 3QWRD 4KI5E 4BH7B 1S7QA 3LQAL 1BJ8A 4HU0A 1UZ8B 3LRGA 4MNGB 4UFLA 2G5BA 1V7NH 1BIIA 2IAND 3JSSA 3FFCA 1T1ZA 4L9LB 2D23A 4JFFE 3FW6A 4XNUL 2AJYL 4OAWB 1SYSA 1IE5A 1DLCA 4X6DE 3HE6C 3AIEA 3VO0A 2ORZA 1YPZB 4UU9A 3WJLA 5I19L 5KVGL 2ENSA 1BVLA 2J7FA 1M05B 4I4WA 1NKOA 3V6OA 2QKIB 4A6YL 5K9JH 3QO0B 4CVUA 3SDDC 2ESCA 4XNQA 4KHXH 4NZRL 3Q6FB 3EYPA 4HZLA 2W61A 1NMCB 3U2SA 4BSJA 1U8JB 1T7XA 3MRRA 2PBGA 4D6EA 1J8HB 1NBYB 3DURB 5DC4B 5EOTA 1HSAA 2GUOA 1J0ZA 4WHCA 3A21A 3SUTA 4RQQB 1UKTA 3RPIA 1ADQH 3K8LA 3GUTA 3C5JB 4AISA 2HT2D 4XNMA 1PSKH 1YEHH 2MJWA 3TYGL 2MPAH 3ZR5A 3NIGE 4RNRA 2J7DA 3BSZL 3UJIL 3L3DB 2NY1B 1T20A 1P4IH 5BXFB 2G75B 2WLZA 1WGOA 1WZ1H 2P47B 2CIIB 3HZKA 4HIIA 5JHLL 4M1GL 3EOTL 2APVA 5TPWL 3HI6H 3FO1A 2PW1B 4TNVK 3VIPA 4Z7VB 3AS1A 3AVEA 3GMOA 4IDLA 5B4MC 1EO7A 1VFAA 4NDMB 4UFHA 4LSVL 3WDRA 5DMGD 1W2KT 2J12B 5GRVK 3PTMA 2DYPD 3RKDC 1K4DB 2WWMC 1T3FB 4HBCL 4NC2B 3CVHH 1RIUH 1J7VR 1HINL 1KTKE 2QLVB 5L7XH 1QOKA 1IQWH 3VFGH 4BFGA 4KDWA 3S5LB 3SCPA 1P5VA 3OJMB 1ORSB 4LKXB 5EUOA 1OCQA 1UR8A 1HYSC 3F7RA 2DLFL 3JUZA 1UH3A 5I71B 4HOZA 1KCSH 5IBTL 2YB7A 3BCDA 1P6FA 4FZEH 1S7UA 2X42A 3WO4C 3ARQA 4P9ML 5KJRL 3VRIA 4OKVB 1RUAH 5C0FA 1O6IA 5DZLA 4LRNH 1HDMB 1CL7H 5EMYA 3FMGL 3BVNB 1WZMA 3FZUC 4MCYA 3T0EA 1A22B 4LCWD 3QUZA 1T2JA 1F5WA 4NSKA 2EPLX 1KACB 1WZKA 5AC4A 3PWPE 5EB9A 5A16B 3QQ9D 5CUSL 5TDOB 4CDGC 4DVRH 1FCGA 4LLWA 5ILTH 2WMIA 3CH1A 3HNVL 1KB5B 3CCHA 4ZUVA 1JXJA 1U3HB 3SDCD 2G8ZA 2DM7A 4PUBH 1MXGA 3KLAA 3TVMC 2XI9A 2NXZB 3SEPA 2LABA 3VXRD 5F6IC 5TQ2H 5DK0A 4RAUA 3WSUA 2Q8BL 1FE8H 4QRRD 3OXRB 3LPFA 3CKHA 1X5IA 4POUB 4CN1A 35C8L 3EOAB 4EQ2A 1VIWA 1YY8A 3TBWA 4PV8A 4BFEA 4Y5XB 1JNHA 4QNPE 2Q3AA 1N0XH 4M24A 1JDCA 4TUJB 3FJTA 1UWQA 1XGZA 1B4JH 3OEAA 2DT1A 1Q6DA 5E9DA 7FABH 1ESWA 3NQHA 1IGJB 3PL6C 4ORGA 2VOTA 2FJHA 4C56D 3B3IB 2DQHH 1AD0B 4FQIH 3W9EA 1B88A 2QQQA 1AFVL 1JNEA 5D96B 3MRBB 1NLBH 3PWJA 2BNQE 2NY5C 4G9DB 1HWHB 3ZKND 3ULSB 4QB2A 2CRYA 2I9TA 5DK3A 3NSXA 4MQ7A 3IDXH 4H20H 3ZDXF 5B8CB 5GJSH 3MODL 3CX5K 2VERN 1GNYA 1MQPA 5IHZA 4ONGL 3K2MC 1EHAA 1H3XA 1M7IB 1A9EB 2VDML 5E7BA 1T1XA 4MNQD 3W9DA 4Y5YA 1OGAD 4LP4A 3RY6C 4JO4L 5C09A 3BIAX 5H8DA 4ZFZB 3RWJA 3KPLB 3KPMB 4KDVA 4QHLB 5E0QA 5BRZB 4OQTH 4AY0A 2VX4A 4MD4A 1JGDA 4U1JA 5B39G 4IJ3B 1GHRA 3O2VL 1U92B 3X14A 5IVXB 3ILPB 5C0NC 3ZHLA 1A7PL 3ARBA 2IBZX 4U6HB 1D5ZB 3WUGA 2CDGB 1W9SA 2XN9A 1QVOB 3PWVA 1OT5A 15C8L 3PGDA 4MHHI 4O5LH 4MJID 3WFCL 1RYYA 4UNTA 2FHFA 4GRWE 1T0MB 5E2JA 1UR1A 4YXLL 1QSFE 3QG6A 2JELH 1E4IA 4I18C 1A7BA 1GQIA 4G3YL 5A6BD 1M1SA 4N0RA 5ICYB 3R0NA 1B1YA 3WDQA 1JGUL 5JTWA 3KYNB 1U33A 1P2CA 4XTRD 1YNLL 4YC2B 2IMNA 4YHZL 1EO5A 3QI9D 4C57C 2F54D 1D6EB 1FLRH 1OQXA 4JE4B 2OSYA 5C0JB 3EFDL 1TVHB 2CHNA 2EIDA 1P1ZB 4Q9QH 5BOPA 1RD6A 2VLRD 5DK2A 3MO4A 4XPHL 4WNQB 5ITBH 2Y07L 3PGCA 2PW2A 3MLYH 4OCXH 5H37G 2FECL 4BJ0A 4ELMA 2XQYK 4WTWA 4I1NB 3ZYJA 3KL3A 3GXUA 4ODTL 2C3GA 4U1LA 5DJXA 3IJYB 4HG4J 4NKOB 3WF3A 3LKSA 1JNNH 3O2DA 3NNGA 1FFNB 1BEYL 3MCKB 4GS7B 2BHYA 4ZTOH 3VFPA 3VH8G 2C1OB 3L5IA 3W81A 5JW4Q 4YNYA 1WBZA 4KKNA 3WBDA 1V03A 1LP9E 3PJSB 3B9KA 3BN6A 3OKLB 3QIWC 4URTB 5BMFH 3GBLA 1F8TL 2H32A 2XZZA 4HUVB 1OGTA 2YRZA 1T1WA 1TZ7A 2A6IB 2BDNH 3LPGA 3GZKA 1J84A 5EU6D 1IEBB 4X4YB 1HJVA 3Q5TA 1J1XL 4YXKL 2VMFA 4ZSOA 3P0YL 1NEZG 4W6WB 2Y25A 3BYTA 3QFDB 3MV7D 3WKML 3EYSH 1IGTA 4LCCB 4IIQC 2PO6B 1QLFB 1T6WA 3AMCA 2L4OA 3TTQA 3QXUA 4PJHA 4BZYA 2D31A 1HXJA 2YJQA 4X4MA 3EHBC 2FHBA 3CH9A 4XVHA 2YPLE 4LLVA 5DQ9B 1BMGA 1OWQA 2J7BA 3QNYB 1U93A 2ADIB 4P5KA 4ALAH 4EJ1C 4QXGH 4D9RE 2HJKB 3WF2A 1NKRA 2G3JA 5D6CB 1FZOB 3HRZB 4LYQA 3PV7A 1ITXA 5J6HA 5DEFA 2AV7B 5J11B 2Y23A 2AGJH 5CBEB 3LSOB 5BJTB 4YHYB 1CGSL 3QXVA 5KS9B 2NNAB 3LKQB 4WTZG 3AMLA 3O3AB 1EFXD 2OJEB 1AO7B 1FSKC 3P73A 2D3LA 2E26A 4HS3A 1A1MB 3THDA 2BSSB 2YFZA 3PGFL 1W0VA 2BSTA 5SX4H 3MV8D 2XSAA 3VI4E 3NBNA 1A7NL 5JW4R 4DFHA 4F57L 4QDQA 3QXTA 1OAQH 4KRTA 1OPGH 4D9LL 3JWOL 3LRSB 1MFBH 5A2KH 4ODXB 1KXTA 2EZ0D 1E3ZA 1FCCA 2NW2B 3A22A 3CVIL 3GJFA 3S98A 1ZLSL 1QI3A 5BS0B 4WI7A 2XM2A 5EH1A 3QEUB 1JF5A 1KXVC 2BNRA 4AIZB 3HMXH 4Z2GA 2W4XA 1CICD 2WINB 5DC0A 4U2ZA 5AYBA 1XF4B 1UWWA 2YK1H 4AMKH 1FYTB 3TV3H 5I24A 1ZWIA 2ADFH 1JPFA 2WN2A 1EVTC 2Z93A 2XWTB 5IW6A 3BP4B 4G6KL 1OF3A 4GI6A 4M7LH 1S46A 4NZUH 1MJJA 1UB5A 1BQUA 5FXCH 1CIUA 2VABB 1LL7A 1NC2B 1GOOA 4K3HA 1OSZA 3ARGB 1VCAA 2G4FA 5I1AB 3WFHB 4V2XA 1B3XA 4TUKH 2WVUA 4M7ZB 3PDOA 3FT4A 4PLNC 5HHXL 5IQ7L 3OG2A 1LO2L 1A0QH 1KCRH 4UT6H 4LHQB 5IYYA 5EB8A 1EEZB 3O2WH 3WHE1 4UFJA 3DO7A 1EO8L 2AV1B 3WE6B 3LN5A 2WAGA 1ND0B 3JVGA 4TNWK 4KQ4H 3UC0L 1SVCP 2Y9RT 1Q9LB 3DUHA 3C87A 4AC1X 4G9FD 4ONHB 2GAZB 4KMQA 1C8YA 4MB3A 2X70B 2ZUUA 4BJLA 1R7AA 5FKPA 5SX5K 1FNEA 4JO2H 1JDAA 3JXAA 4WWKA 3RAJH 1G7MB 3N12A 3C8KB 2HFTA 5EORH 4OF6A 2P5EA 3WXWL 2FGWL 1IC7H 4Q9RH 1G0DA 3ARFB 2X5PA 1MSPA 1LE9A 1PPIA 1IQDA 4DWSB 3TT1L 2WCAA 4M8QA 1N6QH 3VIHA 4PS4H 1PBYA 5IXEA 3VFVB 3QXDB 3MYZA 3AAZB 3VGAC 1U58A 5L2KD 1UD2A 4U1SB 1T1YB 1QFOA 3S4SG 5DJ2B 1ZLVH 1MLCA 4JZOB 3SJVE 3DXAB 3PWUB 2P24A 1KBGH 1KTRL 3ZHDA 3WH8A 2BVPB 3EJZC 3TNNA 3UO1L 4PJXE 2YLAA 3NIYA 4D6IA 5ICXB 25C8H 2QQNL 3GNOA 4RIRB 4UV4L 3MLZH 1XAUA 1ZANH 4ETYA 3QEQB 1FPTH 3I6LD 3MJ8A 4LKCB 3HMWH 5CD3B 1OD3A 5D6DC 5CPSA 2OQJA 5D5MB 1XGUB 2WZEA 3L9RB 3W27A 5ETUB 4YHOL 4PPTA 3D85B 5LCVL 5F93C 2LAGB 3WD1A 1TLKA 4G8GA 4HXBL 4P2QE 5CWSB 4U6XA 5TE4H 3W11C 3ARBC 1MJ7H 3LVEA 4F58H 3H9SD 1GAFH 1D3CA 5MHSD 5JNYB 4JRXD 3ZHKA 4UQCA 4QHMB 1UM6L 3BXNB 5H94A 1QNOA 1XR8B 2ZCLH 1EERB 3QB7C 3WUFA 1N2RA 1WEJL 4J8RB 2AEIT 1CFNA 1S78D 3H9HA 3KPSD 5C9JB 4HTYA 5T1KA 4MAZA 2ZUQB 5DJ6B 1XH0A 4YWGH 2WUBH 4H88H 1H5BB 4XPAH 4GG6A 2DCKA 1F6LL 3UJTH 3PZMA 4L8BB 2VISB 4YPGB 3CSYB 1DUZB 2CKBA 4LYRA 1W9PA 4HWBA 2QR0A 4AG4H 3BPOB 5D7LA 3V52L 1ECEA 3WHXA 4R4BB 1I9RL 5EC1B 4J6RL 1RZFL 4PJ5D 2BP3A 1R5IB 1RZJH 5HHOD 5JW3L 2QPUA 4P99A 2VDLL 2QQLH 3VIGA 5IW1B 3QZWA 3MLWL 4Y88A 5TDPA 1GGBH 3BAKA 4P23A 5BZDB 4LPLA 4FQXB 4PREA 5T3XL 3QWRA 4M82A 4OOZA 5DTFB 1AQDB 2JB6A 1H3UA 1D2KA 5JQ6H 4QGTA 5DRWB 1A3LL 2IANA 4CBPA 3U79A 4YO0B 4LIQL 1IAIL 3NABL 4XRCB 1HVQA 3LOWA 3W38A 1A14L 4QHNB 5D9NA 3HC0B 1KJMA 4MCZB 4NKIH 3ARVA 4D3CH 1CXFA 5IHUH 1HSBA 2QSCH 1PDKA 1UWGL 4Q7NA 1LEGA 4N8VG 2R39A 3O8XC 3O3UN 1JI2A 2O93L 2VDNL 3JV4A 3T1FB 4IRJB 1OTUC 1FH8A 1IGCL 3RZWA 3WL9A 3B8YA 3UPCA 5JW5B 3OJ2C 1MNUL 5TFSL 5I76A 1XGTB 4HJ0C 2CLRA 4WTXA 1ORQA 4M7JH 4QOKD 1UVQA 3EYVB 4XCEB 5A6LA 5CIPA 1RP8A 1HVXA 5DJYA 1F4HA 4X4XA 3U7WL 1GXEA 4XC1H 3KWWA 4TVCA 3CVHB 3HC3L 2EEXA 1LEKB 3S97C 1A6VH 4ZS7H 1HHGA 1KNOA 2XZCL 2GSJA 4HFWB 2WABA 2DMCA 4QXUL 3HZVB 5CSUA 4FP8L 4ZNEA 1HCVA 1N6UA 3EFFB 4JFDB 4WW2B 1JAKA 3UTPD 1M01A 5I8CB 2B2XL 3L3HA 4DGIH 2IAMB 3CFCL 2DYPA 3C09C 2X4UA 1D9KD 1I7TB 3E6HB 4G5ZL 4D8PB 2J77A 1NQBA 2QSVA 1MY7A 1JPTL 5E99L 1QLEL 5AEAA 5GS0D 3MREB 2VXSH 3QFJB 2BSED 3ZSSA 5I9QC 5C8JA 3BE1H 1YMMD 3ZDYF 3VXMB 2BFVL 1B2YA 3R4DA 4OM0L 1OTTD 2LU3A 4XBEL 1A47A 1ZMYA 3ULVC 2VXTH 4U1HB 4OIBA 1I9JH 5CJQL 4JM2B 1EBAA 3FOLB 4BK4A 1BG9A 1IT9L 4W8JA 1GPOL 1YEJL 4P46D 5GISH 1AP2A 2J8UF 2AK4E 4I9WE 4PJEF 1I1RA 1SG3A 4D1IA 2YUZA 1KIPB 1CE1L 3BQUD 4LCWA 3OB0H 1K3IA 4KAQL 4OJFH 5EUKB 3PV6B 1UFUA 1ODAA 4MWFB 3G6DL 4PMQA 2NY4C 2VXQL 5HPOA 4QRUA 1UWEL 4Y8AA 4RE4A 2YRPA 4P4RB 1P69B 2CD0A 4P59L 4UDTA 4XBPA 1P4BL 3KVQA 4NN6B 4QKXB 4TSCH 1FZKA 5GGTA 5GZOC 3A7QA 3VXRA 3IF1A 2JJVA 4OCMC 4BA8A 4OSUH 1OSPH 4QRRA 3QWOB 5CBAA 1YZZA 4L3CB 2X4NA 1CG9B 2DT0A 1DBMH 3PIQB 3VDCA 5JHDB 4FF5A 3LQMA 1GZQB 4S2SB 3D48R 1JD7A 4W8LA 3IDGB 4BELD 1MI5B 1CZ8H 2V38A 3ZE1E 3POCA 5EBWA 1MF2H 3SKMB 5JUEH 2PF0A 5JA9A 3KPQB 4PJ8D 4C56A 3OZOA 4RDQG 1U3YA 2VDOL 4PBXA 2PR4H 3BN9D 1GOIA 1A6TB 3CFKB 1V0NA 4W88A 5LGHL 1I85C 1FNSH 1WIOA 1F42A 2X4TA 3AMDA 4RGNC 1AGFA 2R2HA 5D9SA 5DD1L 4MNQA 4PP2B 3JWDC 5I18L 1OGAA 5ECJE 2D1ZA 4NI3A 5EO9B 3BESR 3UESA 1INEL 1WK0A 3W0WB 5GNYA 3IDYC 4D0CA 2IUZA 1QRKA 3U5UA 1EBPA 3U82B 3MMEB 2MKLC 4OCRL 4OZHE 1OLLA 5D8JH 5CILH 5EFFA 1W0WB 1M7DA 2MKWA 5F7YC 2YC2A 2NY2C 3QSKB 2YLLA 5FGCB 3C2AH 4ATLA 4U0RB 4I0KA 1W9BM 1JTTA 4GWJA 1FORH 2XRAL 5DVNA 1GHSA 4Y1AE 4Y19E 5IB1B 5EU3B 4MJIA 5I75C 1WDRA 1ZLWH 2HN7B 1CNVA 1UB6B 2BRQA 3IIIA 3WIFB 3OKDB 5A6BA 5EA0H 1ZOXA 3ALWA 3PF2A 4OFDA 1KFWA 3M46A 4XAWH 4PRIE 3OBAA 2P8LA 1UC6A 2WBJB 2VLME 2VZ3A 5ICZA 5MERB 3QI9A 2F54A 3BHBA 3AIVA 5DWUH 1EPFA 1XV8A 1F3RB 1WC7A 4OB5L 2B0SL 1X1NA 2ICWA 1I7ZA 1KJ2A 5L6YH 4WJ5A 1K45A 1KCVL 3GSOA 3B83A 3LQZB 4WVRA 5LA2A 2F58L 2ICEB 4ZD3L 2VLRA 4UB0H 1OD0A 4E41E 4GW1A 3WN5B 2JJWA 4YHNA 2ZPKL 2VVNA 3RGVD 2LW8A 1KTDB 4KI5M 3DX9A 2XT1B 4E42A 4NNXA 3ARED 3VXNB 1BGAA 5FYKH 4YHIA 4HKXB 1DVFD 3P77A 1UYWL 2CLZA 4XVUD 4YDJB 3SDYH 4JFPB 1TTUA 5KZCB 3FQUA 4A3HA 2NY5H 4U1NB 1XSIA 3UCRA 4FQCH 5LAXA 3SKOB 3QA3A 2YEZB 3PHSA 2NQCA 4MX7A 1DL7H 4JPIA 4LAJH 5DMKB 5GGRY 4KZDH 1IARB 3A6BL 2XVPA 1G9NC 2P8MA 4WV1A 3HG1A 4KUZH 1CWVA 1HQRB 3N1QC 3EZ8A 3TN0D 3A67L 5GRYA 1YEKL 2Y6SD 3FY1A 1R3JB 3QUKA 3WELA 3QHOA 3CK0H 2Q76A 5I8EB 5EU6A 4GKNA 3WNNA 4OZIF 5A2BA 3HNTL 2YOCA 3U30B 8A3HA 4S0SD 2QPSA 4HJJL 4FN0A 3MV7A 3BP7B 1SJEB 4NJAL 2YKLL 3BO8A 4LLQB 1FFPA 1ISXA 2QQMA 1RZIA 3QPXL 1Z9SA 2PYFB 3SKVA 3IU3B 4XNXL 4KJYB 3CZLA 1C91A 5J9PA 1FNGB 4GAJL 2AAAA 3CD4A 4BQ3A 1IL1B 3BP6B 2BY1A 3QPQD 1U8IA 3TOPA 3RA7L 4PJIE 1CFVL 3CZJA 3TZVD 2YD9A 3CX5J 2DQUH 2UWEB 5EIIB 5HYQA 1JWMA 2EH8H 4WHTA 3BKCH 4C55A 4K7PY 3QIBD 2W66A 1QYGH 1FVCB 1KB9K 4MD0A 2R2EB 2DIEA 3W28A 5IJVB 3SKUD 2CK0L 4BF7A 1EFXA 1MCNA 3TO4C 3U7YL 2E32A 3RUGE 5IHSA 1CXIA 1M6OB 3S2CA 5FYKU 3F2ZA 4KHTL 4NBXB 3IJHA 3MV8A 4OT1H 2X4QB 3IU4L 3RL2B 3UZVB 1J1OL 3RMEA 5C6WH 1ZHBB 4K94C 5IMLB 2DDUA 2J7CA 3UEQA 1RI8A 1BECA 3QUXD 2OR9H 1DP0A 5T1LB 4WCYL 1TE1A 2EIBA 4XVJH 4WWID 3QG7L 1D5XA 3D2UB 5DJDA 1QNPA 1I8KA 1MRDL 3BH8B 1CICA 3KR3L 3UTSB 2YMXH 1A6UH 5L2JB 2BVOA 3ECQA 2VH5L 1DLHA 3HRPA 3HPJB 4V1DE 1LO3L 4JFTA 1BVZA 2MFNA 1DLFH 3FCTB 1B0GA 4FK9A 4NN7B 1BPVA 3OLDA 1GQKA 5GHWH 1KIRA 3G04B 3HE7D 1OB1B 1S9XA 4HIXH 5ID1A 4LQRA 3QHFL 4ONFL 5BV7L 4EDXB 2XWBB 1QNRA 1N59A 3QNZA 2FEEI 4OUEA 1I1YB 5I5RA 4EN3D 3VFRA 3QQNA 3VD7A 2NY3B 1BGXL 4Y2DC 5FYJH 5KSBE 4TPRL 4YHGA 1V6YA 1A7QL 4G9FA 4M7LT 1FIEA 1E15A 5SWSB 2A3BA 5GGRA 2Y6LA 1CD0A 2EDFA 5JO5B 3VFNB 1UX7A 1IAIM 1VACA 4AWEA 5F89A 3D5HA 4EUPG 5HSFA 3ZKQD 1HHKB 3T2PA 4XWOC 1VGEH 3DGCR 1BFVL 5ACZA 5ENWB 2R56L 3CFBB 4JZJC 2WZIA 2IH1B 3NZ8A 2AK1L 1DFBH 1UQSB 3O6FD 3ETBF 4NO0B 4PBGA 2C4XA 4FFVC 4CD6A 1ZA3A 1CT8A 1H3PL 3CXHK 5FYLH 4Y4HB 2DGAA 5L2KA 3U1SH 4ODVL 4OCNC 4NZTH 3WSQL 2DT3A 3PZGA 4F8TA 2NLJB 3UTTB 5EU4A 2VIRB 1Q1JL 4MSWB 1S5HA 3OKNB 4F66A 3TBYA 4HOWA 1RP9A 3BJLA 5FF6B 1SMDA 1O0VA 3T4YA 4KRLB 3LMYA 1PYWB 1DHKA 1HILB 2OP4L 4M48L 4ACZA 3TO2B 3BRDA 1TA3B 3DV4B 4LVNC 3AIBA 3EIFA 3FOMA 3ARUA 3D3VB 2CUHA 2HISA 4PJCF 1JZ2A 1AR1D 1JK8A 3KXFD 1E0OB 3SUWA 4HPHA 1U9KA 4KPHH 3SGDH 3GK8L 2ZNWA 5BVPH 3KYOB 2PQSA 3OJDA 1BBDH 3H9SA 4B9YA 3NDYA 5FYJU 3BSHA 2JJSA 3I6GA 4FQJL 4M5YL 4JRXA 3AS2A 3I75B 2XXCB 4HMCA 2BOBB 4X7TA 1UYXA 4QHUA 1ZBKA 4Y16D 1NC4B 5EN2B 4CJ1A 4J4PD 3GNMH 4HUXB 5JXJA 3KPSA 4KTYA 1MJ8L 5IVZA 1BZ9A 5IROA 3OLGA 1BQHA 2E40A 4YHLL 3QRGL 4W87A 4NM8H 2A77H 3JWNC 4LRIA 1A6WH 3FKUS 2NYYD 1C5BH 1YYML 4U0QB 4GMSL 3WN6A 1UWXH 2C7FA 2H9GA 3F62A 2X4RA 4K7FA 4UZUA 2C7UA 3BH9A 4PJ5A 1UYQA 5HHOA 3QXAB 1J86A 2WBGA 3MZGB 3C6LC 4KI5D 4AEFA 4LDLB 1CXHA 1Z3GL 5FUOL 5KVDL 5CINL 3PUCA 4RFOL 4W89A 3SE9L 2AEWA 4PGEA 2G41A 3CLWA 3BD4A 2AXGA 2C3VB 4G7VH 3EB7A 1A7RL 2J1UA 4TOYH 3U0PB 2B1HL 3THML 1UY4A 3CZ8A 1CQKA 2YL5A 4FLRA 4JFFD 4R0LC 3OIHA 5AD0A 1G9HA 4LCYA 4JDZB 4YBQD 5CAYB 4DGVL 3W37A 5SX4I 4IRSD 5EC2A 4W85A 2NSXA 4XNYH 4NNYB 5MEPB 1E28A 2HJFA 1T7VA 5FO9A 4ZO9A 3BMWA 3TPUB 1JHTB 1KPRB 4PRDB 2V2XB 3NZHL 1E1FA 2MCPH 3RIFF 1ZGLM 4PLOB 4MA3B 3KPRB 2FJFB 5INCA 1CCZA 4IMKA 1FGNH 4OZGE 4WV1C 3RJDA 1LD9A 3LKOA 4MAUH 3AIRA 4DN4H 2RGLA 5K9KA 5LGKA 1TNMA 3V4VL 1SEBA 2HT4D 1ZSDA 4ZUUB 4DGYH 5B3NA 2EC9U 3HPNA 3CHCA 3TM6A 5F7EH 2N7BA 1IM9B 3H0TB 2CERA 1CN4A 1J0JA 3O3DB 4A2MA 1G9MC 4QOKA 4BUGA 3GXFA 1BAFL 3GB7A 5CP3H 5D2LE 5D7SH 5IM7B 2IWGA 4I5BB 4HOXA 1BFNA 4UQ9A 1NCUA 1G6RH 2QJDA 4OZFG 3SDXF 1NWRA 1AIFB 4FTVD 4Y4FB 2JIWA 1BYDA 5D70H 2ZCHH 3IFLH 5DA0B 3QQ4A 4GKSB 4R26H 4JJ5A 4TULL 1P6AB 1TVBB 3UPRA 2EXWD 3TIDB 3BSGA 5ID0B 2VXVL 1CS6A 3NIDE 4K3EH 1JHKL 2JJTA 3WF1A 1NGYB 4HZ7A 4ENED 3MJ9A 5BYWA 2DL9A 3MOAH 3MUHL 3AM8A 1UD8A 5A2JH 1MWAA 1LJYA 4D0BB 1NUNB 3GRWA 4KJPD 1K8DA 3HOBA 5CD5C 1D9KA 3RHWF 4PV9A 5HHME 1UYYA 1B3JA 1U41A 2VRQA 4ISVA 4MJ6B 4J28A 4CADA 3HE6B 4NRYB 3OTTA 2V5SA 3C9NB 3WFLA 2JALA 2VMEA 1G7HB 3WS6C 1I7RA 2XA8L 3NFSL 3CNKA 1YMMA 4FFWD 4M6OH 3CU7A 1HKLL 4H1LA 1J1PL 3SDDB 4QRTA 1NH6A 4JRYB 1T80A 4PJ7F 1MCEA 3MA9H 1QBAA 4AZCA 3SE3A 3ZYIA 2EZ0C 2AJVL 4S1RL 3DSFL 4D0DB 3ZQ9A 12E8L 1VFBA 4P46A 4LCIL 3L3KA 2R1YA 4XZUB 1WT5C 5BZWB 5JOPE 5JDSB 4G7YH 4IOIB 5T1MB 5F1IB 4C59B 3C7EA 5ISZB 4PLJC 3IRZA 3BQUA 1QQDA 1ULVA 4JFQA 4ZXOA 2VDQH 4NP4L 1GCYA 3VFSB 3WQ8A 5E94B 3W39B 3OKKB 4DEQA 1C1EL 5I1JH 1SEQH 3PP3H 1AI1H 4I2XE 2AP2A 3TJEL 5IESL 1QO3B 2I26N 3R1GL 4PTXA 4XUTA 1FO0A 5FGBC 1HQ4B 4WU7A 1V3LA 7TAAA 4G6ML 2FDMA 3OKYA 2A6KB 4OF7A 3G08B 4UV7L 5L8JB 4PMDA 1MEXL 4KGLA 4ODSL 1B0RA 2WP3O 5EDXA 3F58L 1AQHA 5T3XD 1IJ9A 2A3AA 4XVTL 4KVNH 4TTDD 4JFZL 3HB3D 3NIFF 1UJTA 3EYOB 2UY7A 2BVQA 1KLUA 1MHCB 4JKWA 5KOVC 4JY6A 4CKVX 5E6IC 4OJYA 4JL2A 1JPSH 4PJ8A 2VZVA 5FM5O 1VFOA 2OWXA 5IIEA 5SWZE 4EE9A 2XVNA 2R4SH 4UZGA 5C0CA 2VRAA 3F7QA 2M26A 1E27B 2PB1A 3WO4B 4A6YA 4X6BA 4PY8J 1U8PB 1M04A 5DXWA 3NPZB 3FN0H 3KL0A 5FHAL 3I6KB 3L5WA 1IC1A 3GMNA 2GJ6B 1S9WA 2Z31C 5FDWB 4WEMB 1NCDH 5DEZA 4WI5A 1FVDA 4HCRL 2J1TA 1DTUA 4XC3H 4ZZ5A 2H8PB 5CJ5A 5ANMB 2ZICA 3IT8D 3OKEA 3GM0A 4JO3H 3WLWD 4WI3A 4F33B 1QHZA 1VFFA 2DD8H 2EDWA 5F8RC 1P7QD 4YDIH 3QHNA 4ZFGH 3VXSE 4CD8A 1T7WA 2YD3A 3UMTA 3PDGA 2APXA 4HUUA 4R4ND 3ULVH 3L6FB 3TVMB 1NFIA 1QPKA 1BD2E 1MCOL 1NARA 4WGWB 4Z7OF 1NWUA 1T04B 1NGXB 3LB6D 1CFQB 1FG2A 3ZE0F 5F6IB 1CLOL 3NN8A 3H7LA 1O7SA 3SCRA 1E6JL 3HCVB 3ROOB 1I1AD 1F4YH 3TCXA 5IR1B 3SCNA 2K7PA 4RFNC 5IT2L 2WWKO 4N68A 1WITA 1Q38A 2YBTA 1OM0A 2BRRL 4IHOB 2J1SA 1AO7E 3QEGL 5GPRA 4HKZB 5K93A 2X4SB 1E4KA 1W3KA 3GI9L 2X1QA 4ZQKA 1H3WM 2E3ZA 3O6KL 2GITA 5IK3B 3PL6B 4JDVB 2FATH 2ATPA 1K2DA 3GSNL 4I77L 1GGYA 3EKCA 4P3CH 3WSOA 1CVSC 1MCQA 1Z9MA 3EYUL 2BXZA 5BS0E 3OG4B 4PRHB 5C0RL 2JKXA 1W1YA 1ZHNA 2CDEB 4M62L 2CIPA 4MQXC 4GW4A 3RJXA 3DGGB 1W72H 5C0AE 2R4RH 1K5NB 4TN9A 4UIMA 4HWZA 1FYTE 1EMTH 3G6AA 1XFPA 4HK3N 3RGVA 2X44D 4JCLA 1BBJB 4FFYH 5KG9A 2YPVL 4WHYG 3FTGB 3AREA 4L5FL 3VCLA 4PJGB 2H6PA 4JM4H 1DVFA 5GJTL 1X5FA 5KTEH 1UWTA 4P7LA 1MREH 2XPGB 5FO8B 3T65B 1NCAL 3D69A 1UZ6F 1AHWC 5E9AA 3CPLB 3VG0L 2NY7L 5E2VL 5IJKA 2XV6B 4JQIH 4J3TA 4U1KA 4NQCD 4DTGH 4XURA 2Y36H 5CJOH 3FQNA 2E7BA 1IGML 3MLSL 3P40A 1S8DB 3QJHA 3CFEA 3JWDH 4W7VA 1NM9A 2WIIB 2ARJB 5I1HL 3K2UH 1UACL 3TN0A 1S9YB 3K75B 3HKFA 1A3HA 5EZJB 3MRJA 4KDTA 4I18B 1P7HL 1NCCL 3IKCB 3QUYC 3KPOB 4LSSH 3WKZA 2TAAA 4IEFB 4X5WA 3ZT5A 1IVLA 4XPGH 4YK4C 3KE0A 2P5WB 4WSKA 3V5HA 2QEJA 2B4CC 2Z91B 5E03A 3LZFL 5IB2B 5A2CA 3WL1A 3RY4A 5IB4A 4JB9H 2KH2B 1CDHA 1D7PM 2J7EA 1ZS8B 4K8RL 4D9RD 5AAMA 4PSRA 1U3JA 4X6CF 3HZMA 4LSTL 4G42A 2JIXB 3C2SA 4NBYB 2O61A 2R8SL 2Q20A 5DURD 4A3YA 5C0IB 2EDQA 5GRXG 2X1PA 4PY7B 5E2WH 2C0HA 1IBGH 2CPUA 2ZEZA 2IQAB 3UETA 3TZVA 1JN6A 2IMMA 3UP1A 2F8XC 1BFTA 1Q8MA 4P5MB 2CJUH 4Z9KB 3QIBA 1SYVA 4ZDHA 2QHLA 3A47A 4AIXA 3K74B 5EBMA 3P0VL 1RZ8A 5L9DL 5HI5C 3DXAE 4L8DB 1OY3B 5BO1L 3QEHB 1WV7T 4GQPH 1B2WH 5T3ZL 5L0QC 1W3JA 4LHUD 2CCRA 1EA9C 3QIWB 5DD3H 4UBDD 1PZ3A 3X17A 4P8XA 1QBMH 3QEQE 3AB0C 3L95B 3QUXA 4WFGE 1DANU 3ROLA 2G5BB 5D5ME 5TGBA 1VPOH 1ZV5A 2D7TL 1ODZA 1EDQA 2YHGA 2E7MA 3AXXA 4PLKD 1D9KC 1OD9A 2V7HA 3G6JE 2ZOXA 4L4VA 4HIEA 4IIQB 1NDMB 4Q9CA 3WEXA 2J78A 3D39E 1JYWA 2AI0L 5DJZA 1F4AA 1MAKA 3RTQD 1G9NH 5I1IL 2IQ9L 4UI9L 2IADB 5GS1A 2ZG3A 1VEPA 5D1ZD 4PMXA 5EZOL 3TBTB 4F7TA 1T03L 1J10A 5SX5H 4G43A 3NJXA 3S88L 1GGCH 1I8MB 2WANA 1KCLA 3LKNA 2OR7A 3TBVA 3MYJA 4X5LA 1KB5L 4W7WA 4JPKH 4NM4L 5IQ9A 5F96L 3T3PE 4O51B 4Z8FL 1UXSB 3RDTD 3PWNB 3BQUC 3DYOA 3UTOA 5IHRA 1BYBA 2O5ZH 5E6YA 5MP6L 1EHNA 3N1MC 4YEEA 3QOKA 2G9HB 1T66C 4KQ3L 4NKDA 5TE7L 1JD9A 1BM3H 3I02B 3MOBL 4P8VA 5HJ3A 4XBGA 3BPCA 2EEDA 2UYLA 1VJZA 3LS4L 1WCBB 1UJ3A 2AJUL 5E1AB 5EZIH 1OAYL 4NNPH 4PGDB 1GQJA 1MIMH 1UCTA 5CJ8A 1YEGH 1X4YA 4F80A 1DUYA 3MXVL 1C8PA 5FGSA 3G5ZB 1IILE 4XCCL 1S7XB 4QWWC 5I2IA 4H8WL 1G7IA 1QFHA 3LQAC 4S1DC 3DRTA 5CEYB 4K3DL 2R2BA 3O6FA 5D1XD 4U6VH 1QBLL 1ZT4A 5CZXD 2G2RA 1FN4A 5C6TL 1UD6A 1S7RB 3WL0A 1S7VA 4NO5A 2EKSA 4E0RB 2Y5TA 4ODBD 4W8BA 4PB0L 4PJ8C 1YMHA 4KI1A 2Z4QB 3SJVD 1MCSA 2Q8AH 4FXGA 3T08A 4HA1A 3U4BL 5DF0A 4WFEE 4KTEH 5JPNA 2OK0H 3PZVA 2CDPA 4HZ8A 4HPGA 1QLRB 2GSGA 3NRUA 3BN9C 4Z7WF 4Z18A 5INDB 1Q9OA 2XTLA 3BWAB 4JY5L 2PETA 2Z4FA 3AHVA 2PYEB 5I1DA 1J0KA 1MRCL 4OFIA 1ZHKB 4LSPH 2YFUA 5AZ2H 1SBSH 1HYRC 3VFTA 2OL3H 3GSXB 4NSKB 1J0HA 2A6JB 4P2QD 1WE5A 3KXFA 1MFEL 4Y8DC 1KB9J 4ZUVB 5HHPB 5HI4D 1OAUH 3W4RA 3IDIB 4JFOB 3VFMB 1JAEA 1F4WH 3WD4A 3TA3D 3IDNA 1KT2A 5DRZA 4ZO6A 3VXOB 5HY9A 4U1MB 4YJZL 1CF8H 4XGZB 2WZHA 4PMYA 5BXRA 4Y16A 2ZWZA 3O81A 1IAMA 4J4PA 1RH9A 1EAPB 5L8KB 5LGJA 4HQQL 3EJYD 4O2EA 1V08A 4ZXBD 2PWDA 1II4E 5E9DB 3FQWB 3ARDC 4QRSA 1NL0H 1C5CL 2BVEA 2J8UA 2VLKB 5DD0H 3VXME 4PJEA 3VIJA 3VGAB 1NDGB 3AMKA 1UD3A 1UXZA 2BS9A 2A0LC 1A5FL 4IUGA 1MW2A 2P44B 4P2OC 5GGTH 3PWJB 5DD6A 4Y4KC 2EC9T 1E73M 4E8CA 5IG7B 4UDUB 5BVJB 4CKQA 3C8HA 4R96B 2LTQC 4ZAKC 1KC5H 4AK1A 3BDYL 1MW1A 3QIUD 2F53E 5C08B 1MFAH 4JFFA 1FC1A 3C60C 2XTJC 4XAKE 4X6DA 3VXQB 4IRSA 5GRUH 4G80B 3U4EA 2ZWYA 4NN5C 1LDPL 2CRIA 4O4YL 4AEHH 5IEHB 1IKFH 4PRAB 3C7OA 1K3ZA 1F4XL 2W5FA 4P4KD 1QKZL 3ARBB 3GBEA 1G6RB 5DD5H 4UIKH 3I50H 2XTKA 2FX7H 1QI5A 4NJ9H 3O9WC 5FIPA 4LLYA 1FV1B 2VRJA 1NMAL 4AQ1B 2W92A 1QNZL 1HH9A 3CLFL 3AXLA 5HHNA 3MXWL 5DLML 2EXYC 5JIIA 3LRHA 1QOXA 4V2BA 4FQHA 1F2QA 5CKGA 3SE4C 2X09A 3IVKA 3OGRA 2CBIA 4MB5A 3PXHA 3AICA 5EZLA 2PXYD 2XKNB 3WUWB 2HMID 1R5WA 2X4PB 3ZJ7A 4PRBA 3FO0L 5C6PB 4FTVA 3NCOA 3CXHJ 3IXTB 3MRPA 2DWDB 2VX6A 5CGMA 1EV2E 3GMRA 1RIHL 3X11A 1D5IL 4GUPA 1MUJA 5F6HJ 5DK2B 5HYSA 4K71C 5D4YA 1HOCB 1RPQA 1ZLUK 4M61B 2AJSH 5FCUH 5I1EH 4X8JB 4P57A 3U6RA 3CLEH 1KJVB 3HFMH 2J8HA 1E4WL 1AXTL 2DQDL 2DI8A 5A8PA 3O0RL 4Z7VF 1LWJA 2DQGL 2QQNA 2FEDC 3S35H 4N0FA 3LKSB 5BRPA 3O6LH 5KSVA 4LKSA 5A40E 3L4UA 5FGCE 3U57A 4I13B 2D0GA 3HUJF 1EX0A 2LQRA 2CESA 4BZ1L 4GAYA 3P6BA 5A95A 1ZK9A 3IJ8A 3HI1A 4LK4A 2FO4B 1WTGT 5DRXA 3O8XB 4RAVB 3UG4A 4RBPH 4LARL 3P4OB 3W24A 3QDGB 1FL3B 3VX0A 2KZ1B 3GJEB 1WWCA 3RWEB 2BMKB 5J12C 4ZE5A 1T1WB 3QUXC 2ITDB 1KN2H 3C5SA 4MXWH 5CSBA 2WCGA 2A73B 1HT6A 2WSKA 5LWYL 4ZSOB 4HFUH 1QA9B 2J6EH 1TZHA 1V3KA 1AKJB 2QQKL 4XP1L 1ZBCA 3GBDA 4L4JA 2WAHA 5J6GA 4HJGB 2CKRA 3IAPA 4DOHB 1RMFL 3MRFA 4UUJB 4G8EB 3GO1H 1TVGA 3VUPA 1T2QH 1LO4H 1IC4L 1SJHA 4K9EH 4LGPB 5F9OL 5KW9H 4NQDD 1GOWA 2Z8SA 5CMAB 4XB8A 4NT6A 2NY6D 2RBLA 4DQOL 1TETL 3BGFC 2VKXA 3MV9B 3PHOA 4NHCH 1AVAA 1G9MH 1OAXL 5ELIA 3BLKA 3QAZC 4PRNB 3C09B 5DT1L 5I17A 2V5TA 3N50A 3IDJA 1EIBA 4F15C 4Z77B 1QBBA 1NCWL 1NGQL 3FQTB 3C5ZD 2HH0H 3T0AA 4HU8A 4Z2HA 1PQZB 4XH2A 2PTVA 3Q6GL 5GNXA 3KZSA 3QDJD 1W0VB 3CXDH 5I9QB 3VDBA 3VRLE 4X9BA 5FA3A 2G60H 4HIHA 2BJMH 5IFPA 5I16A 4WFHE 4KUCD 4R7NA 1UJ3C 3GGWB 1BQSA 1TJHL 3VMOA 5BW7A 4RN5A 4KVCH 4HEPG 5ERWB 5J7CC 2LS6A 1BX2A 4PGCA 5EBGA 3OV6A 1CD9B 3IB3A 4M1DH 1UR4A 4YFEA 4Q0XL 3BXWA 4DZ8A 5HPMA 1YN7A 2Y7QA 5F1OB 2IC2A 4KJQC 2X9YA 4BM7A 2JK5B 4D9QE 1FL5B 4E2OA 1NBZB 2NY4B 3TWCL 4GO6B 4H04A 4WI9A 2VITA 1P7QA 1UZ6E 3II1A 1H0DB 1OP3K 3INUH 4UQ3A 4OLXL 1HI6A 2GK1A 4XXCC 3JTTA 4Y1AD 2BCKB 3T2NL 3CDZB 4R7DB 4XCFH 1A1OB 1WLHA 1YDPA 2LVCA 2UWEE 4HH8A 3X3FL 1UY1A 5C7XL 3GXIA 5HNNA 2NTFA 4HUWB 4K55A 1B9ZA 3MRCA 4ZPTB 1I1AA 3J8F7 3S36H 1QI0A 2P7TA 3I84A 3OHXB 3V0WL 2FD6H 2GY5A 2RFXA 5E95B 1W72B 1RJZA 2DQTH 4L4TE 3S4SA 5A6AA 5CEXA 1Z2KA 4PJAE 1IGIH 1J5OH 1MLBB 2HKFH 1N3NB 3S96A 2QL1A 2ED8A 5D1QC 3P9WB 3ZE2F 5BWFA 2QV2A 1ZJBA 4LLMA 1CDCA 5DJ0A 4MDOA 5I74C 5J57B 1V6VA 4X6CE 1IEAA 2OS7A 1YUHA 1V7NL 3S9DB 3WH5A 5E4EC 3MUIA 3IAGC 3GSVB 3PTQA 2X41A 4UINH 3RWCA 4RGNB 3PQYD 1TENA 3UTSE 5IFHH 4V28A 5C92A 4LPUA 4DEVA 1LK3L 2FB4L 3P4NA 1T89C 3T09A 4DKEL 1S7SA 1OVZA 4W70A 2Z35A 3IDYB 3BIKB 5I15H 1K12A 1I8LA 3D18B 4KHXL 3V79C 4PJFB 3RWHB 1KELH 3K3QA 2DJ4A 1P9MC 1CU4H 3FB6A 5AWNH 2XHYA 2D7QA 4YLQT 1TVDA 5IMMB 2AABL 1MLCB 4GLRH 4YR6A 3QDMD 2X9WA 5CZKA 1ONQA 2NY2B 1KJ3L 1GNXA 1CLZH 4M7KL 3MRGA 4NQCA 5CSZB 5CEZL 2D3VA 3N1GC 1ADQL 3TNNB 2WV3A 4CMMA 3AJ7A 2JCCF 4EBQL 3FO9B 1UKPA 4EI6A 1GC1C 1PSKL 1YEHL 5B38G 2MPAL 4R3SB 5D71H 3OGCA 1LK2B 1XGYH 2VCCA 3GKWH 2ATKA 1OWWA 1JWSA 4MAYD 1WWWX 1DCLA 1WFOA 2PTTA 5EIQA 1MW3A 1AJ7H 1H8OA 2VN4A 2D3NA 1WZ1L 4JFYA 1ZGLA 5TF1L 1RJYB 5C07D 5F3BA 3IJ7A 3C08H 3PWLA 2KPNA 3HI6L 4OGAC 3QCUL 2WHKA 1LQSR 1DANT 3B2UD 5FOBA 4U7KA 5FO7A 3B6SA 4XHJD 1EDTA 4LCUB 3ALXA 4NQVA 4HG6B 2ZUNA 1QR4A 1A4KB 3ZSTA 3CVHL 5EO1A 1FA2A 1CLYL 5D2NE 3WXVH 4UOW0 4ELKB 2ADJA 2C1PA 2WHMA 5E8OB 5MENE 1PAMA 3BZ4B 1EGJL 1FL6A 3D5OF 4JFHD 1HIML 43C9B 4GG6B 3DHJA 1HJSA 2AEQL 4ZUWB 1EUUA 2WVTA 4Z7UE 1Z5LB 4JFED 4QTHA 3UTTE 5IHBA 4N8VA 2ZSVB 1W32A 1QEWA 1T83A 5MEQB 3OKMA 2LAAA 3PNWA 2CKSA 5HGDA 3HPLA 3RU8H 4PJCA 4P2CG 2BHZA 5HDOA 1MJUH 4PIRF 4LHUA 5CYYA 3RIKA 5TDPB 2W60A 4NWUH 1IGYA 2A6DA 3L1OH 4XCNA 3ULUL 4LNRB 2B20A 4GQ9H 3D3VE 1Q0XL 4DVRL 3DUUB 3BPNC 4S1SH 4FQQB 2QADD 4XPFH 3AHZA 1NEZB 5DJAA 1KJMB 3KYAA 4KH2A 4NQED 2IGFL 3RHWK 4N1EA 4IMLA 5TQ2L 2FBOJ 4N5ED 1Q9WB 5K59F 1FE8L 1ZTXH 3KHOA 3HNBM 3A3HA 1QRND 3ARRA 1UA7A 3RTQA 1LILA 4GSDH 2V17H 5JA8B 1U8HB 1TUXA 3S35X 5D1ZA 3JV4B 1N0XL 5KSAD 1OHQA 3UBXA 4S10A 1OAKH 5C0EA 4N5UA 1R3HA 2DKUA 4OI8A 3VWKD 3W6MA 4DW2H 5CJXC 1MQQA 5ABHA 2DQHL 3OL2A 2QMJA 4M1RA 2B4CH 1NLBL 3RDTA 4XP9H 4HKBB 3VMPA 4GKZB 4WUUD 3UYRL 4JAMA 3IDXL 3NCCB 5CCKH 1NUFA 3GIVB 4Y5VA 3TO4B 3REVA 1XF3B 2CRZA 2YN5A 3QHTC 4GH7B 5E2UH 2QSQA 3H7BA 1IGFH 1F11B 1KGYA 4PG9B 4AYSA 2EE3A 3PWPB 3UPAA 1BYCA 4OLZH 1HXYA 1VKXB 4C83B 3K8KA 4YHPA 5HVWA 3GH5A 3VDHA 4P5TC 4JLRB 1G7PB 4O02L 3P30H 1LL4A 2VR5A 3HLAB 4OQTL 2YD7A 3IB4A 4APQC 3RVUD 2AXJA 2A3HA 2FEEL 2G3MA 1W0YT 2A83A 3ZYZA 3HB3C 2X1IA 5IBLD 1JGVL 3NCBB 3LN4A 2EDEA 3R0MA 2X4OB 2UZIL 4J3UA 2OL3B 1S5IH 5D1XA 2EH7H 5DUML 2BNUB 3OZPA 5GIRB 4O5LL 3AC0A 1D5BB 1QFUL 32C2A 3DUSB 3SJVA 1J8HD 3BN3B 1B31A 2JELL 5BW7C 2EDHA 3EDDA 4DKFH 3SDXA 4HS8L 3SHSA 2VT0A 4JG1H 3HMCA 4K8RD 4YGVA 2UZYB 4PJXA 4OLUL 2YA0A 5C3LD 2BNQB 4KJWC 4WDIA 2HKHH 2JFEX 1BREA 2NY1D 1RU9H 2EDJA 3V5DA 1FLRL 2Y6HA 5F9JB 1T7YA 4HHAB 5F7LB 2NTSP 3TFKC 2I9LA 4M5ZL 3V7AE 1BTCA 2OLDA 3CO4A 3IJ9A 2E9BA 2Y72A 1US3A 2IXVA 1R3IH 4Y2DB 3L3OA 1WCGA 4Q9QL 4RWYH 2W87A 1I7UA 1TNNA 1ZA6A 5ITBL 4LEOB 3MLYL 4OCXL 5HGHA 3L5JA 1A6AB 5T3ZD 2YWYA 1NJ9A 3AZSA 3VGFA 1T4KA 3TA3A 1TCRA 1OGSA 1V02A 1JGEA 1LO0H 3D9AL 4U1IB 1U8MB 2WMFA 3GYCA 1KXQA 1I1AC 4JCMA 1JNNL 1YJDC 2EIZA 3QULB 4HGWB 3WFEH 4JZJB 5FIEA 1MQKL 4ZTOL 5T1DL 1NCBH 4MJ2A 1AGCA 4LDEB 1KPUA 5GSVB 4P5YA 3DX6A 4ZXBA 1QSFB 5CQ1A 1E6NA 3EO0A 1OGBA 2WM0A 3S36X 2ESVE 4HS6B 5D7IB 3AGVA 3E6FB 4OI7A 4JRYE 1J05B 1AD9B 1JP5A 3E1F1 4XB7A 4QTIH 3VW3H 4YHKH 2W95A 1N8ZB 1E4XH 4DUXA 3ALFA 4FMFA 2AERT 5I79A 2OZ4L 3CBWA 2X4TB 3EYSL 4DVBA 1C5DB 3LQAH 4P49A 1AGFB 4OBRA 5ISZE 4KK8C 2YKKA 1MVUA 5F97E 5D9SB 4PB9H 3QIUA 1OGAB 1CD1A 1T6VN 2I07A 4BSVA 1U3HD 2GT9A 3BAJA 1QSEE 5DA4A 4FMKA 3IDMA 3SUUA 4HAGA 1B6DA 2NXZD 4XNUH 4V27A 1U8NA 2AJYH 2ZSWA 2Z1KA 2HVJB 2SEBB 1OIFA 4ALAL 3L7FA 4N0YL 2BGPA 4QXGL 4C7DA 3S34H 2FJGB 4P4KA 4PMNA 1JHJA 2XM1A 5J8OA 5JPMA 2A2QT 4NZRH 2HFEA 4ELMF 2AGJL 3VFOB 3Q3GA 3PBGA 5IJRA 1U95A 3AHTA 3SUVA 1O5DT 1LP9B 3CHDA 2V5CA 2HJLA 5CFHA 4KZEL 2QTEA 4OF5A 2VLLA 3SCMC 3UR8A 1IM3A 4HW6A 4D0QA 5F1NA 4HDIA 3K0WA 4OTXL 4X98B 3RWDA 3TYGH 2UY2A 3DRQA 5D9OA 1WWBX 1OAQL 4MVBD 1OPGL 2DLHA 1MFBL 5DFVD 3I3BA 2PXYA 4HPYH 4AM0A 2A9NH 2WYSA 1NAKH 2KL6A 3IXAB 5I6SA 5JBFA 2COQA 5KVFL 3EOTH 2Y8KA 2R1XA 2P48B 2OTUA 3C6LB 3HMXL 1U3ZA 3HN3A 3GSRB 2E7CA 4XMLL 2GJ6E 2HG5A 1FH7A 5BRZD 3B5HA 2YPLB 5I1LB 3OEBA 1BLNB 2YK1L 5BRQA 3TV3L 2ADFL 2BY0A 3BEVA 3WMCA 3LDBC 4N0UA 4AXNA 3T04D 1GOKA 4HK0A 2DDQL 4R0LB 4YHIB 4M7LL 4K23H 4NZUL 4PJHF 3W53A 3RVVD 4XUPA 3CFDA 4Q6IA 4ZODA 2DQFB 5IV2B 5ABEA 5IF0B 2OYPA 5JIKA 1UD4A 2NY0C 4TUKL 4U05A 5FB8A 2A9ML 4Z7QE 4ATDA 5F7NC 1T22A 3TIEB 3FHAA 2DLFH 1F58H 1A0QL 1E6XM 3NFPB 4UT6L 3I3EA 5DS8A 2J8FA 3ULUF 3SO5A 1PZ5A 5DEGB 3OGOE 4P9MH 3HG1B 1HHJA 3PHQA 1SYTA 3DROB 1CE6A 3WH7A 3MFFB 4AD2A 3QUKB 1URLA 2ITCB 4ZTPH 3BIBX 4B15A 2DB8A 5FYKE 2XSBA 1XGRA 4PJDA 3STZB 4MOAA 3CDYA 1SY6L 1JZ8A 2AXFA 1FFPB 1DN0B 4JO2L 3VU2A 3ES6A 4QPWA 1JVKA 2Y06H 3U4AA 4GG8A 5DJCA 3FB5B 3L3GA 1X5LA 3N06B 4RMVA 4MLSA 4JZ5A 2VE6A 3QQ3B 4Q9RL 1IC7L 4JREC 2GKIA 2A74B 1AR2A 3U5YA 5IB3A 2ICES 5HHQB 1BGGA 3RX8A 1ZLVK 5ALCL 5J9PB 3JZ7A 2Q8BH 5D4QA 4NQDA 1N6QL 5DHVA 4R27A 4IBLT 2DTMH 35C8H 5HDBF 4IDJL 1U8KA 4F7CA 1KTLA 5M3WA 1A1NA 4M6MH 4NRZA 1YEIH 3LKPA 4HF5L 4PJBB 4QX2A 3RWFB 1MQRA 4JY4A 2YL8A 1OTSD 2GJZA 3VXPA 5MEOB 4TUFA 4Y5VC 2EDXA 1KBGL 1R8LA 3C5ZA 3G9AB 3ZE2E 3V7AG 2EPNA 1VRXA 3RWIB 2XJ7A 3QDJA 1GJIA 1RZGA 4BQ8A 4HH9A 1QFWH 25C8L 2V3DA 5ALBH 3FB7A 3U0TA 1ZANL 4OGXH 2J3SA 4BSWA 1EH9A 2HLAA 4IOFD 4GAGL 3HMWL 3HR5B 2PO6D 3G5VB 5C0GB 1X5GA 2VL5A 2P5WE 4JO4H 1GGUA 4MDJA 5CP7A 4AMCA 4EZMA 3MRIA 1OF4A 2AKRA 5HDQL 5TE4L 4PY8I 4P0DA 1MJ7L 3DX8B 4R8WH 5JLZB 5ESVA 2FLRT 2YWZA 1I8IB 1GAFL 2W9EL 2IPUG 4OZHA 5F1SA 1FGVL 3W82A 4M4PA 4KK5C 1NFDB 3O2VH 1GMMA 5DVOA 4EUPA 2ZCLL 3ZR6A 3HJEA 1FNLA 4L3EE 5JZ7C 2Z1SA 1HKFA 1ED3B 43CAA 2WWCA 4CUCA 4Y1AA 1BVKA 2WUBL 4H88L 2H3NA 3WFCH 2ZX9A 3MA7B 5IB5B 3UJTL 3VFWA 1QR1A 4KKBD 2CDFA 1AO7D 3HTLX 3WO3B 4AG4L 3I85A 3FONA 1LEIB 3RZCC 1U30A 4KU1A 4G3YH 5GS3A 1R85A 3GSWA 4LYPA 1TXKA 5TQ0H 1RZJL 3MOQA 3SY0A 3BP5A 3NA9H 4PGBA 4MS8D 4NKMB 3RO8A 2QQLL 1DE4B 5CHNA 1ZHLB 2GFBA 4QCIA 1GGBL 5E6IB 5J56B 2VCBA 5I23A 3ARPA 1I9IL 1NGPH 3EFDH 5BS0D 1X3DA 1GONA 2YIHA 1KULA 2GTZB 1XSJA 3F7YB 5IEKB 4N0CC 4XPHH 3OLIA 2Y07H 3FFCE 2PWFA 2MNUA 1FYTD 4JZNB 1E5NA 2DH3A 2J47A 3MLUH 4ZOAA 3OF6D 3PQYA 4NKIL 4D3CL 4W5UA 4Z5RB 1VB9A 4W68A 4ZS6D 2X9XA 4UFKA 3T77A 3STLA 2Z31B 5IHUL 4RMWA 2QSCL 3QO1A 2WBWB 1NC2D 3S37H 1A6ZA 3ARGD 1E43A 2DBJA 4HC1H 4I48B 4NYLB 1W9WA 2YC1B 3AIQA 4D1JA 1EJOH 2E6JA 1T21B 2V7NB 2OXGA 5GGUB 3QDMA 3TPKA 1F8TH 2GVYA 2B7DT 1TZIB 1MFCH 1N7ML 4H26B 1VGKA 4M7JL 4NUGL 5K33A 3SCWA 1NKGA 4ACZB 3RJQB 1JL8A 3QIUC 4RFNB 5FECA 1CGVA 1YN6B 1T0PB 4YXKH 1VJSA 1A6VL 2GTWB 3U46B 4WK9A 2V2TB 4W4ZA 3WFDL 3MBEC 5I8OL 2H26A 3WKMH 3EYQC 4MAYA 4NZJA 5IGXL 2XWJB 1ES0A 1WBYB 3GHEH 5FYLE 2C9KA 2D22A 3ECBB 5C07A 2IH3B 4X7SH 5HI3C 1NAML 1KV3A 3WIIH 3ARFD 5HYFA 1K8IB 7CGTA 4MDIB 4X0KA 1JPGB 2ADGA 3VWJC 4OQ1A 1Y6KR 4DWSD 1QHOA 4LPVA 5TF0A 2WUCH 3VRJA 2DWEB 3V0AC 3ELAT 4Z7WA 4AD3A 3H42H 4WJXA 4PRPD 4LPWA 2Z92B 3TYFB 4Q58C 2Y8VA 5HDRA 3BE1L 4OFKA 5EUOE 2IPUK 3DXAD 1LQ0A 4KMTH 4NQSB 4H8HA 4JFEA 4HCRA 3FFDA 1I75A 3SCOA 4OZ4B 1E4MM 1T5XB 1AHWB 1G7JA 3VIKA 1DEEB 3HI5L 4F57H 5GISL 1UUQA 4WEBL 2XYLA 3SKNB 3JWOH 3QEQD 3AFBA 4WFGD 1AGBB 4ZYKA 3T0EE 4QP0A 1SR0A 4MA1C 2W94A 4OJFL 1CXKA 3D85D 3BAEH 4UOZA 3SGJA 4BFIA 3QUYB 5KVEH 4F9DA 5AD0B 2J7HA 2D03H 3ILQC 5DQJB 4YK4B 4QYOA 2W9XA 1G7QA 4X6FB 4DKAA 1K9EA 4TSCL 4F7EA 1AGDB 2J5LC 1N5AA 1QSVA 2V9RA 3HZYA 4DCQB 5FO9B 1GUVA 4I0PC 2HWZH 4NQEA 3O45A 5IFJB 4P8UA 1OSPL 1QRNA 4QY8A 2DJUA 3PTKA 3LEXB 2XKSA 2YUXA 3GSNA 4LF3B 4CNIA 1IV8A 3APGA 1GC1H 4U33A 4XCYB 5KSAA 1CZ8L 4EI5D 5HHXH 3EDFA 1P7KA 3B8SA 3LV3A 5CKAA 1LO2H 3NCYS 5E9DE 3VWKA 5JUEL 3ARYA 3RVTC 5FEBA 2CHOA 2VLKE 5JBDA 4DXSA 2R0LH 3MO1A 3D0LB 4HXAH 4HV8A 2WZ8A 2J1RA 5EO0A 4KY1H 2CSPA 3BZFB 5KSBA 4WUUA 3IDAA 2V2WA 5HOSA 2EO9A 2J7MA 4U1GC 1FVEB 4FQXD 3HA0A 2GK0B 5F88B 4ATWA 2YG0A 4OM1H 1RK0B 1FNSL 4WY7H 2P8PB 5L0QB 4BH7A 2OM5A 4JJ5B 3OAUH 2YSSB 4RCAA 1UZ8A 3IS1X 5EIVA 4MNGA 4JL1A 3L7EA 4TOQA 4NC0B 1LE5B 4CRPA 5C09E 3C8DA 4AD5A 1VBRA 3AB0B 3PE9A 2D0FA 3L4WA 4CN4A 1PG7W 4OAWA 1YPZA 3TT1H 1M05A 3HAEG 5K9QG 3T3ME 5D8JL 4O58L 3EO1B 3TH3T 2QKIA 4NZCA 2FO1A 3QO0A 1GOQA 4O2CB 1JNLH 2OSLB 2P43B 3C2AL 4HUNB 4IRJD 4HX1B 4ET7A 2XN9E 2EYTB 3Q6FA 4UOJA 2UZXB 1KEML 2HTLC 1U8JA 3V4PL 3QJFB 3O9NA 4PN2A 1NLDH 2DQJL 1H3VA 2MHAA 4RA0C 1J8HA 3NFNB 1NBYA 1WCQA 3DURA 3L4XA 4FQLH 4RQQA 1Y6NR 2GEEA 3I2FA 4XP6H 3WD5L 3UO1H 1EEQA 3C5JA 5EA0L 1L9NA 3JV6B 4PYSA 4OCSL 4XAWL 1VFBB 2QQNH 3L3KB 3L3IB 1FFOA 3L3DA 3GBML 1DBAL 1JCKA 1JRHH 5DWUL 1NANH 5BXFA 2G75A 1MFVA 2VKWA 4GLRI 5M95B 2CIIA 4PR5B 4YZFF 4YHOH 5C0DB 4ZY9A 4X9FA 3S6CA 1P8JA 4JFDD 1KSRA 1OL0A 4ZENA 2PW1A 2EE2A 4Z7VA 4CUBA 1YA5A 4UB0L 5J1SC 4NDMA 1CDYA 1A3QA 2IAMD 1BZ7B 5I77A 4G6AD 5EFIB 4ELME 1K4DA 4WU7B 1T3FA 1UM6H 1B3ZA 3I3DA 5GQBA 1WEJH 4UT7L 4POZD 3SDYL 3ULUD 4K7PL 5DO2D 3DETC 5EU7C 3S5LA 3W6LA 2NY5L 3QFJD 4B3LA 3BGMA 3WQ4A 5FAAA 4LKXA 1ORSA 3VXMD 2R0WL 4Y19B 2VQTA 4W81A 4AD0A 2HTKC 1KLUB 5GRJH 3QCVH 1C93A 1DL7L 4LX4A 2W0KA 3QHZH 4X7DC 1I9EA 2EDBA 1TPXC 5D7JC 4J6RH 1INQB 2V5MA 4PJ8B 4ORZC 4JM2D 5JR1L 4OKVA 3BUYB 1XSKA 2NR6D 1HDMA 1WDPA 3BVNA 4DM2A 4PRIB 3CK0L 5C0CB 3U36B 4JO1H 2D9CA 3VIIA 4ZSOE 1UENA 4PJ9C 1HX0A 2ZUXA 4LLDB 5A16A 5TDOA 3MRNB 2F19H 3V6ZB 1KB5A 4PJHE 4OV5B 4LIQH 4QLKA 5D2NC 1U3HA 4DOHE 2C5DC 3NABH 1XF2B 4X4ME 4E41B 1N64L 2BY2A 2K9UA 4QDMA 2FCBA 4OD3H 5TDNB 3GSUB 3OXRA 5C2UB 4KMLB 1XIWC 5DHYB 1U8OB 2YL6A 1R24B 3POHA 5JHDD 3EOAA 3N13A 5DT5A 3ZDZF 3S37X 2DQUL 1XNTA 2W1SA 3MV9E 4Y5XA 2EH8L 1MI5D 3BKCL 4TUJA 1QYGL 1OH4A 4X99B 5CG0A 1ZLUH 3C7FA 2X7LB 1IGJA 2CUMA 1H2JA 3UDWA 1NGWB 1MNUH 5TFSH 3KLHD 5FKAB 3UG5A 1JNDA 1WAAE 1L7RA 4XHQA 3B3IA 5JXED 1AD0A 1U2CA 1FP9A 1W9VA 2J74A 5SWQA 4QT5B 3TJHC 3MRBA 5E2TH 4CD7A 4GRLC 3C7HA 4G9DA 4OZOA 3ULSA 1H09A 3U7WH 3ARDB 4X5XB 3DX7B 5B8CA 3EUUA 1HCFX 2V9QA 1K2DB 2WZPD 2BOCB 1CFBA 2IPTH 1B3WA 1M7IA 4P2OB 1A9EA 3I2CL 5I3DA 4Y4KB 4XVJL 4N8PA 2WVSA 4U49A 1VFMA 4ZPVA 4JGUA 1CIDA 2D7OA 1YJDH 3OZ9H 4L8SC 4ZFZA 3KPLA 2FBJL 2LTQB 3KPMA 4QHLA 4ZAKB 4CVXB 5ADOL 4KXZH 2YMXL 5LQBH 1A6UL 5BRZA 4MNLA 2EEAA 4PFEA 4PTWA 3CFCH 3OKOB 1UM4H 2VSDA 2BVYA 2EDKA 1U92A 5F6HI 5IVXA 2HT3D 3ILPA 4G5ZH 5I1CH 4NF7A 3C60B 2XTJB 4U6HA 1D5ZA 2DS4A 2CDGA 4PJIB 1JPTH 5E99H 4DUWA 4YBLC 3AZRA 5D9MA 2CLVB 1QVOA 4NN5B 4OLVH 2M1KA 3VIMA 3N04A 5GHWL 1T0MA 1R86A 4HIXL 1VERA 2BFVH 4JQXC 4OM0H 4PMOA 2F5BH 5M5DA 1BOGB 1C16B 3KJ4C 5TH2B 3ISWA 2CRMA 4JHWH 1U8LB 2DM2A 2YA2A 3O9WB 3FQNB 5ICYA 3DHPA 4TVDA 1QUNA 1IT9H 4NRXB 3KYNA 2JIEA 1YEJH 2WBJD 4C54A 3MRJB 2FSEB 5FYJL 3BT2H 4NZDA 1CE1H 4X83A 1D6EA 1WWAX 5DDHB 4EOWH 1CBGA 5C2BL 4UILH 1BPLB 4RYDA 1DZBA 5C0JA 1OW0A 1TVHA 1LO5B 3V5HB 1DJSA 1HK6A 2VXQH 1P1ZA 4S11A 2WNWA 2BVUA 5AY7A 1UWEH 4ERSH 4N5EC 4X7EC 4P59H 4WNQA 4E5XB 2IEPA 2I27N 4OZFB 1VGEL 2P5EE 1Z9LA 3V0VB 4FMVA 1DFBL 1FH5H 4K2UL 4K71B 4V1DB 3A4WA 1VBUA 3OAZH 3IJYA 4NKOA 2GCYB 5BXTA 5KZCD 2WLYA 4QCFA 1FFNA 3MCKA 2IBZY 5CGYD 2BV9A 2ZCKH 2JCCA 4NZTL 4QRQB 4PJFE 3BKML 4XPTL 3PJSA 4JQVC 3MU7A 3OKLA 4TUOB 2IALB 3WUWG 4JN2B 4HUVA 1RZ7H 3DMMC 1OP3H 4TVUA 4LOUD 2A6IA 3TH4T 4KK6C 3V2AR 1FJ1B 3ABZA 3RL1B 4X4YA 1IEBA 3SBWC 4CCEA 4KRPC 4XMPH 2ZOKB 4AH2A 3QFDA 5J12B 2LU4A 3WHE0 4LCCA 3QUXB 2PO6A 1QLFA 5DD1H 5TGBB 3CZUA 2E9WA 5I18H