3K4AA

Crystal structure of selenomethionine substituted e. coli beta-glucuronidase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
605
structure length
597
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYVGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-glucuronidase
total genus 140
structure length 597
sequence length 605
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k4aA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k4aA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k4aA03
3W38A 5IQ7L 3INUL 1ZBCA 1CEOA 4QY8A 5DYOA 3KXFA 1BD2B 1CLCA 1Q38A 1BJ1J 3MRHA 4ZUTA 4XBPB 3VG0H 2RFXB 2V2WB 5C2BL 2VURA 2VSDA 3GBEA 1AGCB 2JB5L 1JF1A 1FNHA 1NLDL 2JCCB 4HXBH 2FGLA 4FMVA 4OLYH 2HFFA 2VC9A 4Z7VE 3QSKB 4U6XA 2VXQL 4YEFA 3GSOA 4Q6IA 1XCQA 2KL6A 1RUPL 4KFZC 2BFGA 4P59L 5IR1A 5A2IH 2J7MA 5LA1A 4XPFH 1W3JA 2AJUH 4NZDA 4UV7L 2OYPA 1QR1B 5I75C 4JFWA 5DURB 5DQJA 4R97B 4NKQB 1T7ZA 1KB5L 3RTQC 3GMPA 1WDPA 3X3FH 1K5NA 1JDDA 1IGFL 2IPKB 3BWUC 3NAAL 1UKSA 4RQQB 4DGIH 1OD3A 4YXLL 5SWSE 1KC5H 1G9NH 3MMDA 1ECEA 3N85L 4Z7QE 4W5ZA 3D0VB 2R23A 4ODBD 4QHUB 2WZIA 2NW3A 5I8EB 1W3HA 3VFTA 4UQDA 1A9BA 3CU7A 4MCYA 5CQ1A 1QPPA 1UWIA 4PMRA 1AP2A 5D7JC 5FECB 4K3EL 3D69A 4LCYB 2A9ML 1JCKA 1B4RA 1B6DA 4R27A 4G9FD 3I6KB 4Z78B 2GJZA 4ZODA 2F74A 2W0LA 4ET7A 3ALFA 4KDTC 2XZCL 2WBJC 1HKJA 1R5IA 4TPRL 4QXUL 4KY1L 4DAGL 4WUKH 5JHDE 3IU3B 4KMTH 3NN8B 2HT2C 1PIFA 1W2VA 3QIBA 3RJXA 3BE1H 1FLRL 3QDMA 5C70A 3VGGA 5IB2A 1RQ5A 3BZFB 2ZUVA 3U82B 4MJ2A 4XAKD 3CFJB 4EUPG 1S7UA 2HLFD 4W81A 2WN2A 2AJYL 2EH8L 4GXVL 2AEQH 1WBYB 4O4YH 2VO5A 1OSZA 4ELMA 5I71C 4M3JA 4O2CB 2ZOXA 2FATH 3T09A 4CKQA 1O8PA 4JDVA 5TE4H 2DBLH 3VJ6B 3RA7L 1JU4A 5E5UB 3SGDH 1BVKB 4MQ7A 5BCAA 3B2UC 1A9EB 3VIGA 1TVBB 2ILLA 4FQQB 3POCA 5D9NA 1DL7L 1PZ5A 3VIJA 5D1XA 4AZ8A 2OTWB 3BDXA 5F96L 3MREB 5JXGA 1PG7X 4XPTH 3MRNB 1F11B 5EOCH 4L0PA 5CMAA 2FEEL 4ZEPA 4PYGA 1UWEL 4LFHG 3PIQA 5C0FB 5I8OH 5KW9H 1QKZL 4IIQA 3OX8B 4BDVB 1S8DA 1N3NA 3HKFA 3LQAL 3V6ZA 4M7ZC 5JHDD 4P9ML 5FYJE 5ILTL 3SCRA 2X4RB 3RHWK 5HHNB 1J0IA 5K9JL 2R1YB 3WS3A 5MENB 2WCGA 2NY1B 1TIUA 1T1YA 4GI9A 3L4YA 5EZLA 2GK0B 3C8HA 2Z1SA 2NTFA 5F88A 4YGVB 4B41A 1OWRM 4L4OA 2GUOB 4E8DA 3LS4L 4FXKB 4YXHH 2WWDA 3QHMA 1FYTB 3FRPG 5T1LB 2NY5L 5ISZD 5AYIA 4A6YH 1FRGL 3QHZL 1V08A 2FEDC 2YSSB 3GXIA 5HYJB 1G9EA 2OSXA 2ZUQC 5L0QC 3MBWA 2CDEB 2VZQA 4JG1L 4XRCA 3CDYA 3QNZB 2BMKA 5KS9A 2NY4C 3S96A 2XPGB 4MTVA 5E1AA 3GSWA 4AIEA 3IYLW 2E0PA 1YN6A 4MDPA 1E4NA 5DRZA 3SGJA 4OT1L 2VL5B 1CTNA 4RE2A 4RGNB 1NBQA 1UQSB 4ZUUB 3VXPB 3IIIA 4C83B 3LKQB 3B6SB 2RJMA 4WY7H 1A6VL 3MGTB 3RJDA 3AMLA 3GHBH 5ALBH 5TDNA 1P4BL 1PDKA 5HY9A 1SY6A 1I1CA 1EDTA 1ZLWK 1F4XL 1SFSA 4NBYB 3LEXB 3VXRD 1CYGA 4JRYB 4FQCL 3R06B 2K1MA 4YFLI 2PXYD 3KYNA 4ODUA 4DOHE 3L7FA 4GMTH 1UYWH 2IAMC 4O02H 3ROLA 5MEPB 1FJ1A 2A74A 1GNXA 2N56A 2R0KL 4JY6A 1INEL 3WDHA 1H2JA 3U83A 4ENEC 3KJ6H 5A95A 1U36A 5IB1A 4P2OD 3P4NA 3ZO9A 1A7RL 5I74C 2W95A 1WCGA 2VR4A 4CDGC 1OTTD 3VRLE 3C09B 5D1QD 1G84A 1RZJL 2PO6C 3ALPA 1MCPH 5CUSL 4JR9H 2BERA 2E26A 2I07B 1F6AA 4XBGB 2AMGA 2W0FA 5A6JA 2CKNA 3I84A 3S2CA 1UY1A 1M05A 4EI5A 2D22A 1H0DB 1UA6L 3DTXB 2BVTA 1U3YA 1KJ2A 1DWJM 3FKUS 4X6FA 2ESVB 5KVGH 5DHYB 1E27A 3N06B 1JWUB 3ZKSD 2HKHL 1MEXL 3HE6D 3MV9A 5AWNH 4Q22A 1BZQK 4JO3L 4WKHA 2NW2B 4JB9L 3JXAA 5A40E 2PWDA 5GRUL 1D5MB 4I2XE 2UUDH 2WIIB 1I7UB 1LEIA 1MQRA 1MW3A 4PJIB 4G42B 4F9JA 4XP9H 5EPMB 4EUPA 1TQBC 2VLRE 4UT7H 2VDNL 3RVWD 2WSKA 3DX7B 4PGDB 3M45A 4MJ4A 4KTDL 1XMWA 1BYDA 3AISA 1YECH 1HYSD 1AI1L 2A1WH 4ZFOL 4YDLC 1OPGH 4UINL 2WMKA 5B38G 3N9GL 5FHAL 1IC4L 1W72B 4FNLL 4OAWA 2OZ4L 2JB6A 2XTJE 3DVNA 3TN0A 5I2UA 1OWQA 4K55A 4LEXH 1G9ML 1VEPA 3RNKB 7CGTA 4EI5D 5EOQL 1FNAA 1G0CA 1LDSA 4RWYH 1YY8B 4PJAE 4MAZA 1LEKA 2DQHH 2HA1A 4NN5B 4APQC 4PRAA 1JNNH 4B7IA 4W4OA 3OKMA 4D0BB 1J1PL 5EFFA 4ODHL 1AGDB 2HFFB 1EFXD 4OZ4A 5EN2B 4TXWA 2DBJA 2I5YH 3NSXA 1QI3A 3PN8A 5FIPA 2Z31C 1F90H 3EGSB 4A6YB 3BAEH 4GS7C 1JNDA 2EDEA 1X6NA 1RZKH 4PJFE 1KPVA 1PZUB 5T1DH 1MJJA 4XXCC 4G6KH 1X44A 2EIEA 3OKYA 3VH8G 3X11B 5GZOC 1FL6B 2IXUA 5DD0L 4AZCA 4GWIA 1JPTL 2YDSA 4PJXB 1XF4B 2GJJA 5T1MA 3BP7A 1TCRA 4L4TD 5ID1B 2J8OA 4NRYA 4HFWB 2F54E 1FCCA 2DM2A 1ZHNA 1F4XH 4CJ1A 5FIEA 1OW0A 1YEFH 3EOBB 2NY1D 3PWJB 3BH4A 1KBGH 4HWEL 1TR1A 5I1IL 3D2UB 3BIAX 2XFFA 1PMJX 3IVKA 4OGAD 2J62A 1DQQB 1FLTX 4WJ5A 4U1NA 4JZ5A 3FB8A 1F3JB 2FGWL 3MROB 1LG1A 1IQDC 3REVB 4EQ3A 1ODAA 2P5EB 2XV6B 3SOBH 1T1WA 4FQXB 2WC3A 3BP5B 4AIXA 3MRCB 1DQJB 5C6TL 1VBRA 2PN5A 5JW4Q 3O2WL 4PJIE 4KV5E 1P53A 2GSJA 3LQZB 1M7XA 4NZUL 4GKZB 1PQZA 4Y4FB 4DVRL 2WMJA 3IU3A 3QP3A 1TITA 1LE9B 4OCRH 1RZJH 5HYSB 4FHBD 3ZKND 2ZUUA 1P9MA 2FHBA 3ARDB 1CLOH 1ZLUH 1N8ZB 4TQEH 1RIVL 5SWZE 2R4RH 1BVLB 2PI6A 3VXSD 2FRGP 1ISXA 5IWLC 1FH8A 4PG2A 4MNHB 3RGVB 3HPLB 3HC3L 5LWYH 3TJHC 3C9NB 3BD3A 3D25A 4M5YH 3W5NA 5AD0A 5CBAA 4IRSB 1AXTL 3OEBA 2ZUQB 4R7DB 3BYTA 3QCUH 3GKWL 1FVEB 1DLCA 5KVDH 3TNNB 2YBRA 4JZNA 2WO1A 1KCUH 1IT0A 2J7LA 4YN5A 1BQHG 1ZBKA 5LAXA 3MSGA 4MNGE 4YWGH 4KRUA 3GMRB 1ZLVK 1A9EA 3MA9L 3RVUC 1JD9A 1AVAA 4ATLA 1TVBA 1UD3A 4ONHB 1V0MA 3ORJA 3UJTH 3KPLB 3HMWH 1T6VN 4JLRB 2ENYA 1A7QH 1T0PB 1T83C 1Y6NR 3IS0X 3MRGB 5SWQA 4XMPH 5JW4R 1ZT1A 3STLB 4BQ4A 1I1YA 4WW1A 5IT2H 2R2BB 3GHEL 5FYKD 4AH2B 3WUZA 5FGSA 3SY0A 2WVSA 2D0HA 3TYGL 3TCLA 2WMFA 1JYXA 1FORH 1VFMA 3PV6A 1U8IB 5HBBA 5HHMD 1PG7H 4QRUA 1FN4B 3V6BR 3BP6B 4IMKC 4WEBL 3THML 4R4ND 3FN0L 3BGFC 3SO3B 1JNNL 1W99A 1W1VA 1BAFL 3CFCL 2GUOA 3T0BA 3SKOA 3BH8B 3DROB 2AERT 1AO7E 4GH7B 2KD7A 1IAOB 1OHQA 4QFUA 2OP4H 4R90L 3AREA 5H37H 2YD8A 1T21B 3QUML 2XHNA 5AYBA 4M03A 2X6MA 1TPXB 4YQXL 2X4PA 5F7LB 1DL7H 3AY4C 1A2YA 1WB0A 1EAPA 1D6EA 2GKIA 5DD0H 2OL3H 1KCUL 3HAEA 4M8QB 3O11A 4FLSA 4U49A 3INUH 3QIUB 2VL5A 1NH6A 5E08L 4IUGA 1CFTA 1GJIA 2CPUA 1UR0A 2E6QA 3FO9B 3RILA 2V5YA 1P4LB 3QWRA 1H3VA 5C0BE 3RVWC 4ELME 2Y36H 4P2QE 1UD8A 3D39B 4F7TB 4JFHE 1N82A 1MREH 2HH0L 1KBGL 2X5PA 4PRIE 3LKRA 2VZTA 2YL5A 2PKDA 2P4AB 2G9HB 5D2NC 2XSBA 1ZK9A 4E9LA 1GQLA 1E4JA 1H11A 2UVEA 5GRZA 3WQ4A 4I9WD 1E4XH 4PY7B 5EZJB 3WEMA 1UWEH 5IV2A 5C6TH 3RY5A 2DDQL 1TZGL 1QFUL 4ZG1A 3OKEA 2RHEA 4PJ5E 3G5VA 2CQVA 4RIRA 3WD4A 4S1RL 2GK2A 25C8L 4IOFC 1MHCB 4TYUA 1HXYB 4MX7A 4MXWH 1BF2A 4PRPD 1I8MB 2G75B 3NH7H 3L4UA 1J0JA 4TVPE 1UZ0A 3S88H 3L5JA 4QXWA 2JE8A 4W6YB 2RCSH 4WW2B 2GJPA 2DM4A 3K2MC 1KENL 5TQ2H 4NO2B 5H35B 3FT3A 4YR6A 3RP1A 3VX0A 1CE1L 4JHWL 4KJYA 4LLMB 1GSMA 1TUXA 5ITFA 4X9GA 5L2KD 1MCDA 1PLGL 3WEZA 1B4JH 5IHRA 3VMOA 4MS8C 5A6MA 2E40A 4H04A 3SDXE 4K7PX 4WWKB 3WBEA 4P2OB 5JA9A 1ZTXL 2BY3A 3HE7D 4WFFE 2EKSA 1GOWA 1CT8B 2M2DA 1QI5A 5BXFB 2YPLA 3B5GA 4IMLA 4XZBA 2VE6B 4G8IB 1TQCC 4WY7L 4DFIA 1QR1A 2WMHA 2ATKB 2WW5A 4H5SA 4Z95L 1MFDH 4OQTA 3DYPA 2APTA 3QI9D 4PSRA 3GMPB 2HG5A 4YBLC 1E28A 1XYZA 1LP9F 2NY0B 5BOZG 3IDIA 4HLZG 4LSPH 4I3RH 4OQTL 4IOFD 1JNHB 2W1QA 1MIEL 3L4XA 4ETQB 4XCEB 5HHMB 2W9EL 4MB5A 1CLYH 3I02B 3UBXB 3WHXB 3QISA 4JM2A 4QLLA 1BPVA 4G8GD 1RJZA 3QHFL 3WIFA 2NLJB 2J8HA 4ZPTB 1W1TA 4XMLL 5D5MB 3U0WH 4YPJA 1H15B 2NMSA 4XAWH 3MRJA 5B21A 4BZYA 1UYQA 4KZDL 4PJGA 3MLXH 1A6UL 4W7WA 3U7BA 1B2YA 4WI3A 3JTSB 3CGTA 1L6XA 4OFYA 4A2LA 3ULVL 2WDBA 4Y89A 1K6QL 2ZOLA 4WHYH 4JFFA 4AZCB 1IRAY 1UCBH 1IEHA 2CKBH 1K9DA 3EJZD 1DVFC 2NY6B 3W9EA 3UYRL 3GSRA 3RDTD 1BQLH 2ARWA 2G8ZA 4Y5VC 3GK8L 2XA8L 1PPIA 5FHAH 3JXSA 4NQCE 3LHPH 4M4RA 4NRSA 4HQQL 3ARFD 4UI2A 4WKFA 1OT2A 1AQMA 1BVKA 1X7QA 2EXYC 2V9RA 5GRVL 5M94B 1E6XM 3MOBH 3RUGF 1UR9A 4WSKA 1U8HB 4TVPL 3NVQA 3E2HC 5CIPB 1CGYA 4X9FA 5DR5H 3ARGC 2L7UA 3CVHL 3OAUH 3TIDB 1F3DJ 1T22B 3RX8A 2V4VA 5JO5B 1NKOA 3QPXH 1C5DB 2D31B 4TVUA 1AXIB 4P8UA 4N8CH 4Y19D 1H8NA 2VDOL 4PRDA 3UTSD 2HRPL 2G3MA 1DBAL 1HNGA 4PUBL 1K8IA 5DK3A 3WD1A 5D70H 1QG3A 1NGYB 2E4TA 5D9SA 1ZMYA 2F54D 4ZOAA 2QQNA 2CBJA 2YBTA 4GW4B 1DBKH 1ZLSH 3T2QA 3QDJD 3RGVA 3DRTB 1U8LB 4K3HA 3ARVA 1JGUL 4IRSA 1GW1A 3BMWA 3UTQB 4W89A 4PJCF 2WAHA 4AIZA 3AOFA 1AJ7H 2F19H 4DGYH 3C60C 4EKJA 3FMGL 5HPCA 4I1NB 4L3EB 5HYJA 5L2JA 1INEH 1V7MH 2CDEA 4N8VG 4PLNC 1A1OA 1R3JB 1NC4A 4F79A 3D3AA 4ONFL 4FLOA 4BSWB 4PJ8A 4LLAA 2IMMA 1WZKA 4XB8A 4G9DA 3TO2A 2Z8SA 1U9KA 4OZGB 4FQJH 4PJCB 5D1QA 3ARTA 3V4VL 1KULA 3KPSB 3MBEC 4HXAL 4Z7UA 4ML4A 4LSDA 43C9B 2OJEA 4KVCL 3STLA 1T1YB 5EZLB 1PG7W 2EZ0D 4OM0H 5DJXB 2EC8A 1IQWL 2NY2C 2WVUA 3SURA 3HNVL 4PJ5A 1NGZB 4L3EE 1W8OA 2VMDA 1HJXA 4PMNA 1S7RA 4FXKA 3PWPE 4LLYA 12E8H 3P9MB 1N2RB 5EBAA 1JYVA 1N5AB 1CE6B 1ORSA 1I1AB 3H9ZA 3PTMA 1FZKA 4ODUB 1AXTH 4LQFH 3RI5F 4AYFA 5LXGH 3VFOB 3N17A 1T80A 1CR9H 3SKOB 2HAZA 1H5BB 4NKIL 4JFDD 4Y1AD 1EEQA 3M8OH 2JIWA 4KDWA 4X0VA 1JHLH 4XZWA 5DRZB 3W0WA 3E3QE 1D9KA 2IADB 3DO3A 4PJ7A 1T21A 1CICC 1CD9B 3GGWB 2C1PB 3QBTB 1IGTA 4UAOB 1WZLA 1R85A 2PCPA 3CSYA 4R26L 3OKNB 3CFKA 3HPJB 3PZ9A 2P46B 1ED3B 2IQAA 1MWOA 5B3JF 2MJWA 1WZ1H 2AJVH 1PKQB 1NJ9A 4GRWB 2YXMA 3PDOA 5DJDB 2BBAA 3I6GB 4HS6B 2QQKA 3CIVA 3WD2A 3U57A 4XI5C 5IDIA 1AQDB 3KR3H 1AGFB 3QEHB 3CUHA 1LQSR 4BELD 2QR0A 3CFEB 1ZBVA 5F7EL 1WITA 4L3CB 3VXUA 2UZIH 3DYMA 4H25A 4Q2ZA 2QSCH 1BQHA 2VLMD 3JWOH 5IOPB 5DA0B 4R2GC 4Q7DA 5D9PA 1P7KB 3TPKA 2ICWB 4GRWF 3CSBA 5IHBA 4N68A 1A7OH 1LEIB 5MI0C 1UA3A 5AAWA 3AM8C 2DF3A 1ADQH 1DVFD 3O2LA 4L9LA 5EPMA 4NYLB 2G3JA 4UOW0 1ZVHA 2Y24A 1WP6A 3WDRA 3LPOA 4WFGD 4Y1AE 2WMPA 5FXCH 5L8JB 5B39B 2WCSA 2J2ZA 2EDQA 5JIKA 1UMIA 5A43C 4U7SA 5A8OA 4XHJC 4Z2IA 1T5XA 4Z0BL 5J6GB 3QUKB 4QRTA 2H8PA 5HYSG 4QGTA 3O9WD 3I85A 4FRWA 5BZDA 4DN3L 4OF7A 2PC8A 5CSZA 4QEGA 4YK4C 1R3HB 2Y5TA 4F7CB 2WBJD 4X6BB 3EFDH 2HJFB 3WIJA 4NO2A 3TOPA 1MNUL 5DHYA 3I2IA 3R1GL 1NC2B 2D0GA 1A4KB 1J9CT 1JGEA 2VVNA 3G04A 2GJ6D 3OKMB 4I18A 2B5IB 2D0FA 1WZ1L 4Y16B 4KI5M 5CWSB 2HLFC 3IDJB 1KXQE 2BRQA 2JJSA 5FD0A 3D85A 1I5PA 2WZ8A 4HGMA 4A6YA 2WZHA 2NXZB 4PRHA 1TJIH 3FAWA 1RP9A 1SDDB 4PGDA 3VWKB 1CVSC 3VXOB 5SWZA 2YEZB 4CVXA 5INDB 2OZ4A 2L4OA 3F58H 4KHXL 4NI3A 2V3FA 5DUMH 5CEXB 1S7WA 3CHCA 3UPRB 5CS7A 2GDVA 3O3AB 4K7PH 4CW1B 3C7HA 4OLZL 4MYWB 3KPRD 3D69B 4LCWE 4IM4A 3SPVB 5BV7C 2WK2A 3PWJA 3SGKC 1CZVA 1E6OH 3AAZA 3WJLC 4P2RD 1UG9A 5F1NA 1KIPA 4XP6L 4KRLB 2W94A 3UJJH 4LVOC 1KJ3L 1AGDA 1GHSA 1OGTA 1UYYA 1YEDA 2EYSA 5IJVB 4P3WA 3VG9C 2V2TA 3C5JA 2LVCA 3HMWL 2RB8A 1QYGH 4DW2L 4KHTL 5FF6B 4M9PA 4K2UH 1U8PA 3SDXF 1KEML 4S1SL 1H15A 3ULVF 2I9TB 3F4VA 4NGHH 1FL5B 3MLUH 4PLKC 5FO7A 2R1XB 4QRRD 4P2RA 3CHDA 1N4XL 1FORL 1HN1A 4QCEA 4JANA 1IBGH 1NP0A 4HJGB 4TSBL 1DYOA 3MLRL 1PG7L 4IDLA 4HKBB 1W91A 3MFFA 1MWAA 3B8YA 1L0PA 5ADPL 3G9AB 3NQHA 5FUOH 2YRLA 4ARYA 2PWGA 4HDIA 3SN6N 5E7BA 1R0AL 1T1WB 5F9JB 1BM3H 4YLQT 1EOMA 2VN4A 3MLYH 1NEZA 4PGJA 1GGYA 2XQXA 3MUAA 3UO1L 5I1LB 5JUEL 4TVSa 1FVDA 1JUFA 1XF3B 2P43B 4K71C 4NZTL 2CDOA 1KXQA 1R3KB 2VLKD 5EIIB 2VDMH 5JUVA 1TZ7A 3OZOA 1S8DB 4ZYKB 4QX2A 3V6ZB 2Q1EA 4ZFGL 5I1JH 1DTUA 1AR1D 4TTDC 2IJ0C 1CF8H 1A7PH 3BT2H 3LN5B 4PJ9D 1TJGL 5CFHA 1FE8L 1MFEL 3BZ4A 2W61A 1UJTA 3SUVA 5JNYA 4KUCD 3V4UL 4PRPA 3NFSH 2C26A 3V5KA 4GW1A 4LVOB 5CIPH 3BKCL 4JQXC 1GOMA 3J8F7 4NQCB 5C7XL 3G6DL 1PX8A 1GQIA 1CLOL 4BCEA 2FR4B 2CMRH 3D18A 4XCNB 2O26U 4HBCH 2OLHA 1IEBA 1UX7A 4Q7NA 3NIGF 3OGCA 3MV9E 5A94A 3CSGA 4LRNL 2R7EB 5DJYA 5B39G 3O4LE 5IROC 1NANH 1GC1L 1MLCB 1PKOA 3RPMA 1TZGH 2WINA 5ITBL 3NGBC 1CLVA 4X0NA 5DFWH 2QQNH 4MGXA 3WQWA 3WQVA 3WNPA 4TVPH 4U1GB 3DECA 4KJWC 2ZKHH 3OGSA 2FGZA 2AK4E 4I5BA 1A1OB 1EGJL 1IFHL 2WO2A 3QRGL 1FNFA 2D4DA 2ZP0T 2NR6C 2XVGA 1TFHA 5E6YA 1EZVY 5HY9B 1J8HE 4NO0D 4ZY9A 3H7LA 3A6CH 2JB5H 2RCSL 5ESQA 2ZXAA 2YKKA 1DE4A 1MQKL 1F6FB 3G6LA 1ROWA 2UV3A 4MNQA 3FQTA 3RM4A 3QR3A 1KC5L 3L3HB 4NPYB 1K4CB 3O6FA 4GBXC 3OHXA 4XPHH 1J0HA 1I7TB 2BJMH 3A4AA 1B0IA 2BC4B 2CERA 1A7NL 1B4JL 1B0GB 3T0EB 1FG2B 4WTZA 3UROR 3O41B 3R4DA 5BV7B 3QOKA 5IEHB 2XPKA 4M6ML 4S11A 1FZJA 4UMGA 4NQED 4ERSL 2F5BH 1NP2A 3KWWB 3TIEB 5EIVA 2XWBB 5M03A 3MLUL 2YZ1A 3DX9B 3T1FA 3K1KC 1EQPA 2G3NA 1DUZA 3QQ4B 2HVJA 4KKAC 4H0GA 2G75A 4XH2B 3RWJA 3CFKB 2W1UA 1RUAL 5DD1H 3AYSA 4ZAKB 1GC1H 2EECA 1TVHB 1H0DA 1MIEH 2W9LA 3HZKB 4Y2OA 2AQ1A 1OM0A 3LEVH 4PF1A 5D7KE 4E5XB 5MERB 4XTRD 2FX7L 3RKDC 2X7LB 4UOJA 2VVSA 1I3GH 3PDOB 5JORB 5DZNA 5SWSB 3PWPD 2A77H 3B9VA 2FYYB 4JFHD 2IF7A 5LA0A 2WUBL 5M95B 1NCCL 3H8NA 5IGXL 2Z35B 1Q94B 1QRKA 3HG1D 4L4VA 3F7PC 5E2WH 1F4AA 4P4KC 3WUFA 4GBXD 1MHPH 4PPTA 4P2OA 4G8FB 1HQRA 4X6EB 1H6YA 1T7WA 3T0XA 4JO1L 2DYPA 4JVPA 3ZE0E 5CEYB 1B3ZA 2E3ZA 2JFEX 3PABA 1ZS8B 4X6DB 3HMXL 1KEXA 4HWZB 4Y4FD 3X3GL 3QWRD 1DWFM 1NUGA 3RVTD 1ITXA 3RTQB 5BRPA 3RVXC 2OWXA 2J75A 1E4WH 1H5BC 4G6JL 5K9QG 1E6SM 4MNMA 4BFBD 3MV8B 3TYFB 4UFIA 5HHXL 5FOOA 5FECA 2GJRA 4F37F 1GGCH 1RZKC 3F7QA 4MDOA 7FABL 3S88L 2XKUA 3SDDD 4PJGF 4D0BA 1NQBA 1PZ2A 5F6HI 3S35X 3W5MA 4JFOA 1EUTA 4JFYA 1AY1H 2J8UA 4ALAH 3E3QC 2ZCLH 4XHJD 3K7UA 1FCGA 2XQBL 3O9WC 1W9VA 5ITBH 5GRUH 3WFHB 3QIBB 1GCFA 4GKLA 1C8PA 3OLGA 5I9QB 4IPLA 2N1KA 1FH5L 4JM2F 5ICXA 2E9WA 2OXHA 3RU8H 2K9UA 2AVGA 1CDYA 5HGHA 2P42B 3D85B 1K6AA 4DFHA 2NW3B 2J1TA 3ZE1F 2DQUH 1BSIA 2G5RA 1MRFH 4I77L 5CJOL 2VN7A 1JDAA 3VUPA 4HLJA 2BOCB 2LV4A 2WHKA 2HT2D 4XWOD 4G3YL 1A21A 1AR1C 4JGMA 4TTDD 1WTGT 1MHHB 3C60B 3FTGB 5FL1A 2H9GA 3PUCA 2WWCA 4Z78A 4Y88A 2GJZB 3IVKB 2UZIL 1C5CL 4PG9B 4WCYH 1RIUH 3I02A 4ZXBC 3UBXA 3BFOA 4JJ5A 5EUOE 1L0YA 3N1PC 2CIIB 4UNVA 2Y9RT 4ZFFB 1RJZB 2WV3A 3LPGA 1KCSL 3CZFA 2ZWYA 5DMIH 1KN2H 5IMMA 4LSSL 2BHZA 4D0CB 1DVFB 1VSCA 4KI5C 2NT1A 1OGTB 1UYWL 4O02L 1H3UA 3SUTA 3OGVA 4MB3A 2DSUA 3IAQA 1OVZA 3NIFF 4QHNB 3QT2A 3CXHK 1BF8A 4NDMA 3WKNA 1V3HA 3O4LB 2CHNA 2GK0A 1BFTA 3L3JB 4DTGL 1SMOA 3BVNA 3AXHA 4WV1A 1F42A 3WH7A 4YHGA 2NZ9C 3CHFA 2E31A 3GBML 3LKSA 5EC1A 3LDBC 6TAAA 1ZU8A 3VFMA 5EU5A 1G6RA 4KDVA 4QHKJ 4QOKE 2UWEA 5BRZB 2AQ3A 4ODXA 4FQHA 1EEUA 5TDPA 4BJ0A 4NRRA 2E8ZA 1NARA 3GMRA 3I6LE 1L4IA 4NKOB 3LV3A 3CFBB 4G6FD 4XT1C 5EB9A 4BA0A 2PWFA 4TX8A 3EYQC 1V0NA 3MLPA 5DJ8A 1SJEA 3POHA 2HFEB 3EO1A 3QYCA 2Q6WB 4NQDA 4KTEH 4RE4A 2GW5A 3MGTA 2BRRH 2KBGA 4D6JA 5GXBB 4ELKA 4PJHB 4HG6B 1IGMH 3RY6A 2V6HA 3IETA 3QPXL 1WFTA 1J11A 2CJUH 2UUDK 4M6NL 3VD5A 4D2NA 1E0WA 4XCFL 2A6DB 3UXFA 4LSSH 3KS0J 1IEAB 4WWKC 2J5LB 1XH1A 3QWOB 2YSSA 3SDAC 1UWUA 3ULUF 1NGZA 2MHAA 1E71M 1SHMA 2P8MA 3DV6A 5EZIH 5JXAH 3VXMD 2OLDA 2J8GA 3W11C 3V9FA 1FFNB 2D1ZA 1ZHKA 3EFFB 4YHYC 4L4TE 4OLWL 3OGCB 5GGRY 1CL7L 1IAKB 4NHUA 4MA3A 1YC7A 2XZCH 3W6LA 3HA0A 4OSUL 1DQMH 1OM3L 5J0BA 1IKFH 1Q6EA 3QQ9D 4HC1L 4C58B 3WENA 1OB1A 1ADQL 4KQ4L 4J7RA 3VXTA 3ETBF 1DLFL 3QXWA 4N8VB 3HUJF 2KPNA 2CRIA 2DH3A 4OTXL 2ZUXA 4N90E 3CSYB 5EA0H 1WBZB 1MW2A 4A2MA 4KKCC 3UP1A 3D48R 4P2OC 2MQCA 4ZFZB 5EUKB 4P4KA 3CH8A 4HX1A 4GZ9A 4IISA 3SJVB 4YBQC 3RJQB 4X6FB 4GOSA 4MDJB 3X17A 3CCHA 4PJAB 4YHPB 1S7RB 2R15A 4K23L 2LU7A 3BN6A 1AHWC 3WSOA 2AI0L 2CDFA 3TNMA 1YUHA 5IK3B 5GS0C 5E00A 3WLBB 2BP3A 1KN2L 1B0GA 4AZBA 5KS9B 3EJZC 4MMXC 4XGZB 2CJUL 4M6NH 4UFMA 3H7BB 4NNPL 1RZFL 3W4RA 3CUJA 1CFNA 2FH6A 1FHDA 3IJ9A 1GOHA 5DMGC 4UAOC 1U93A 3MRLB 3GI8H 5D8WA 2I25N 2A6IA 4GI6A 2ZSWB 2GSGA 5GHWH 2VX5A 4MB1A 4HUVB 1KXTA 2ZX9A 5E6IB 1GQPA 1JHLL 5HI5D 5KS9F 3RNKA 1R64A 4HK0B 3U7WH 5GGUB 1LLOA 3BN3B 1JPSH 3O8XC 4IOIA 1AXSB 3QUKA 1AC0A 2K7PA 4KJYB 4YHNA 1A0QL 5DC4B 1FV1B 4EBQH 4EQ2A 4LPTA 4Y5XA 1QSFB 5HHOD 4MSWA 4NQTA 3T0DA 4F7CA 4AISA 1BLIA 3C7EA 1FH7A 3EYVB 1KTDB 3HNTL 2NY2B 3O6FC 3FOMB 1F6LL 2BOBB 4A45A 4C7FA 1QSED 3DUSA 2BY0A 2CLZA 4C57C 3OZ9H 4QRSB 4H0HB 1FDLL 2GITB 1CDCA 4O5LL 1BJMA 4LHUD 1LO4L 3CH1B 1RIVH 1S9XB 1U8QB 5J11B 2ESCA 5ENWA 1D3CA 4JJHA 4MXWL 3REWB 1C5BL 3HRZA 3HN3A 3ZT7A 5GJTL 1T3FB 4CDHA 3LKNA 3GMOA 4XBGA 3PE9A 2FECI 1W72L 4Z8FL 1BJ1H 4WGVB 1KOAA 5GGSY 4NJ9L 2A3AA 5IROA 4W86A 1DQQA 4U3XA 4WJ5B 1QEWB 4G7YL 4QTIH 5I19H 4TUJA 1RZGA 3UBXI 1GGBH 2FIKB 2JJVA 5D2NB 1C8XA 3ZKXC 8CGTA 2X0HA 3SUUA 1J01A 5HYQB 3IDGA 3MLYL 1T66C 3N0PB 4HH9B 2UVFA 2ZUYA 1UZ6F 4XVJL 4PJIA 1QA9A 5MHSD 2XFRA 2EYSB 5IJVA 1MF2L 1XF4A 1KACB 3MJ8B 4PT6A 2JIXA 4GW5A 1K8DA 1EEYA 4B3KA 4O9HL 3VFWA 1A7PL 4QGYA 4ZD3L 4HXBL 1UD5A 4BQBA 1BVLA 4Y4FC 2CLRB 2D7MA 3S5LB 3GSUB 4FTVE 4DZ8A 2FX7H 2YD7A 3UZVB 1OAXH 4OD2A 2IMNA 1LWHA 3WN6A 1S7VB 5DFAA 2DSVA 1JF6A 1RPQA 1OQXA 4ZE4A 4NC1E 4NQDE 4NKMA 1OT5A 1YPZE 2Y6KA 3QDHA 2GI7A 3PGDB 4JY4A 4LDOB 1X5GA 4CD5A 4U2ZA 3BD4A 4ZS7H 1Q1JH 5HI3C 2DSWA 3S6TA 2DQTL 1UM4H 3L9RB 4E0RB 5FOBB 3QFDA 5DT7A 1PQZB 4Y4FA 1VADB 1W72H 5A16A 3I3BA 2YA1A 3RVVD 3VH8B 4U0QB 5MEQA 1DWIM 4XP5L 5E08H 1AY1L 1LO5B 2XQYK 4RMWA 3WXWL 1I1YB 4WW1B 2R2BA 3H3PL 3PDGA 4EXKA 3FAXA 4UFJA 1E4XI 5C0GA 3VO0A 3WIHH 1WCBB 3BN9D 3B9EA 3VFSB 1H0GA 1WNOA 1CD0A 2WNWA 1PEWA 1N6QH 1JG9A 4ODWA 4QPWA 2YD1A 4DAGH 3PNWB 4Q74A 4FABL 4GT7A 1A1NA 4KK8D 5IFHL 4MADA 4GW1B 6CGTA 2WO3A 4JHAL 43CAA 3P11H 4RBPK 1OGSA 4DWSD 4DWHA 1CL7I 2X4QA 2YDRA 2VRKA 5J89A 3EOTL 4Y8AA 2EEAA 4ZDHB 4PJBE 3RVXD 4J23A 3GNRA 3VIHA 1JUFB 4QKXB 5E5RB 5I1CL 3CFBA 1EAPB 3VD7A 4AMCA 1N59A 3OGOE 3SCOA 1FNSL 4P8XA 5KSUB 3BD5A 2IBGA 1C5BH 5DJ8B 1YNKH 4XPBL 1JGDB 3VD9A 2F8OA 3N1GC 3E6HB 5GRJL 5DMJB 4Z7UB 5MP6H 2OJEB 4PMDA 4PJDF 3MLVH 1PEZA 4FZEH 2EYRB 4MNHA 4UTBL 3TA3D 1AGBB 3BIKA 5B3JE 4KK5D 2IPUK 5DC0A 4F58H 2W66A 5IBUG 3TH4T 5CBAB 3FFCB 4Y5XC 3N18A 4C4KO 2VMEA 5EFIB 1KJVB 2J1SA 3OZPA 2BNQB 3A0OA 3O8XA 2DT2A 1L7TH 4CBPA 2MHAB 4Y8DC 3DV6B 1CDBA 1KTLA 1E6NA 3V5HB 5DHVB 1VA9A 2Q7NA 2WC7A 4LX4A 2WLZA 4E2OA 1C8YA 4NOBA 4LCWD 5HYFA 4HCRH 4YHZL 4LHUG 3I2GA 1PYWB 5DD3H 1A7BA 2IQAB 4WFED 4QTHB 2J4GA 1CENA 1EH9A 4DKDC 2EQDA 5LGJB 3KLAB 4OM0L 2BGOA 3RWHA 4W5UA 1LGVA 4BQCA 3N1QC 1RAMA 3A6BH 5HHPB 2DMBA 1D5IL 2J74A 4HTYA 4FF5A 2CBVA 3L1OL 4E5XA 5IV2B 1KELH 1Q1JL 3EDDA 3RZWA 5D71H 4RIRB 3HR6A 5E8DH 3NABH 2EKSB 4OM1L 3V52H 1K2DB 4L8DA 4MD4A 5DD5H 4JEGB 1QPKA 2WIMA 1W0VA 5JW4M 1E4IA 3HAEG 3V8CA 3VGAC 4LCUA 3KPNA 5F9OL 2NXZD 3DNKA 5C08B 3KYKH 5JR2A 1RK0B 3I75B 4OCLC 1UHVA 5HDOA 2O9RA 2AXGB 1WDRA 3IB4A 1F13A 4S0TD 1NLBH 4JPIA 5TFSL 1RURH 2J8UE 3RO8A 1LVEA 2BK8A 3MKKA 1CK0H 3CKHA 4F7TA 1V03A 2W47A 5D7LD 4Z9KB 3NBNA 4PUBH 2LAAA 5IQ9B 1UXSB 1P2CB 2XZAL 2Y23A 1PVHA 3MJGX 1E43A 4Z76B 2HJLB 3P9LA 2Y25A 4WWKA 4URTB 5CZXC 4I13B 5JR1H 5EU7C 3WIFB 3T2PA 4Y1AB 3GM0A 2DT1A 3KPPB 4PGCA 5KVFL 3LSOA 2HTKD 2DM3A 4XNMB 4GI8A 3CJJA 2VXVL 5EU6B 2DICA 1BVZA 4MCZA 1Y18A 4LQ1A 5A2BA 3MRIB 1G1YA 1MCLA 3T2NH 1P4IL 1FHLA 5CEYA 5SWZB 3AXXA 4KKNA 1YNKL 5INDA 5IVNA 4TULH 2VITB 3D0LB 4M7ZB 4KMQA 2XACC 1GPFA 1YNLH 3WFEL 2AW2A 1WWAX 3BH9A 3BPCB 2AP2A 3O3AA 2GTZB 4ZS6D 4JRYD 1QSFD 4NCC1 2R0ZL 3FB7A 1G0XA 4JDTL 1V3JA 4DN3H 1QI2A 3VINA 2W67A 4H20L 5ITFB 1AJ7L 1CGUA 3VD3A 5JMRA 5F9OH 2VCBA 1QNPA 2NYYC 4IRSC 2OS7A 4D0DB 2BSSA 5G05L 1NEUA 3KLHD 1US2A 1JZ3A 5GS2D 3G08A 1ZSDA 3CZFB 4RNRB 3TFKD 2AEWA 3RNQA 4A6OA 4HXAH 4XNZB 2A3BA 2XONA 5KOVC 1S3KH 3AB0B 2FX9L 3QFJE 1NUNB 2C4FT 2DI9A 5GGTH 3QH3B 1NGYA 2PYFB 4OZGF 1CXFA 2PW2B 4FTVD 1VENA 4TSAH 3MO4A 3CIHA 1A6TA 4GAGH 2CLRA 5JHLH 4KC3B 5DVKA 4G8GA 3W53A 3GSUA 4DZ8B 4MVBC 4PJEF 4ZUWB 4OZHF 4LCIH 4ZXBA 4KKBD 5IKCA 3N04A 1MWAB 4J6RH 4JFSA 1SYSB 4LP5A 4DQOL 2AJZB 2ID5A 2LE9A 1UZ1A 4MNGB 2YKLH 2CXKA 3MRQA 4G80A 1AHWA 4O2FB 1QACA 7TAAA 1JZ2A 3UPCA 3OA5A 4YPGB 5TDPB 1SJXA 3DHMA 5FB8A 5FO8A 2ARJQ 3QWQB 4FMKA 4UDUB 4OLXL 1OSPH 1BQSA 2XN9D 1R3JA 3SGEI 1DVFA 2YPLD 3L9RA 1S7UB 1CXHA 3G5ZB 2NTSP 2GEEA 4QYOA 1YQVL 4LOUC 2RGLA 4GG6B 5DQ9A 2NY1C 4ARXA 3VH8A 3KYKL 4KQ4H 2HVKA 1M1SA 4JQIH 4BKLB 4XVJH 4AD0A 3RWGB 2F8VA 1M01A 1A7OL 3O2DA 3O4LA 4JFPB 3PUHA 4JFFB 1L6ZA 4BYHA 3D2UD 1KIUA 32C2A 4NO3B 3IKCA 2FB4H 4D71A 4S1DC 3ULUC 2VAAB 4FQQA 3VPLA 4JZOA 2OSWA 1YEEH 1I1AC 2WYSA 1I1AA 1RUQH 3FFCD 2O5YL 1W9BM 4JM2C 4HU0A 5B22A 3ZJ7A 1S9KC 4KUZH 2FATL 43CAB 1H5BA 3JWNC 2V5SA 3OAYH 1MLCA 3WIHA 1OSEA 1H09A 3BSZL 1FFNA 4OFKA 5I8KL 5C8JB 1HILA 1FP8A 1AD0A 2ITCB 3TIDA 1QLRB 2HP4A 2Y6HA 1QNZL 4M7JH 4EVNA 4MA3B 4G43B 5FYJH 4XNYL 2X8RA 2FJFB 1NDMA 3GKWH 3VE0A 1OB1B 1OGBA 1U42A 4D6FA 1A6UH 4PJ5B 3STZB 3HEIA 3MLTA 4NC1C 4W8JA 5JDJA 3L95B 5KG9A 3ZR6A 1J0YA 1YYLL 1MUJA 4ZTOL 4O2EB 3PWNA 2BFVL 3F58L 3ARGB 4WI2A 2PETA 4PRWA 2XWDA 1YNTB 3P77B 1EO8L 4Z7OE 1W3LA 3NSMA 2XZQL 2DMCA 3FFCA 4TOYL 3PHAA 2J1UA 3DGCR 3FT2A 1O59A 4M29A 5BZWA 3IJ7A 1E6OL 1KB9K 2Q87A 1FBIH 3BPNB 4S2SB 1RZ7H 4AT6B 1HP4A 3TA9A 2D7QA 3GGWA 4AZIA 2R0WL 4WF7A 5A3HA 4RFOL 3TYGH 4OFDA 2DLTA 3QULB 4AENB 2XT1B 5E24E 4WV1C 4BH8B 1NC4D 4PJDE 1B3YA 3O45B 1S9VA 1P6FA 2VKXA 1KGYA 4N5EC 3VXSB 5F9DC 1HDMA 2ZKHL 2BCKA 1QYGL 4DW2H 5IVOA 1FG9C 5I1CH 4CADB 4FTVA 3VXRA 1SJVA 2X4UA 4M8UA 3BWAA 3WMBA 5C86A 2EDKA 3HZKA 4I4WB 3M46A 1OAYH 4D9QE 3UJJL 1KPRB 4WU7A 1LE5A 1MRCL 3P4OA 4QLRA 5A2AA 3SKNA 5KVDL 2EXYD 1FH9A 5EC2A 5I1DA 4X8JA 1ERNA 3OF6A 2Z35A 4NSKB 4ATDA 2F2HA 1Z3GL 3H2WA 4BQ3A 4JREC 1A5FH 2E6JA 3S5LG 3C08L 1QSEE 5ID0A 1A3QA 1MQPA 1N64H 1HQRB 2Q86A 2XWEA 3QXVA 5I73B 1D9KB 2IADA 3MS8A 3LOWA 3QFJB 4GMTL 1NGQL 4KI5D 1OIMA 2E33A 5GNYA 1H1NA 3SDXB 3HPJA 4JFEE 2DKUA 2JK5A 2P24A 4XX1E 5KN5A 2PYEB 3ZDXF 3WUEA 4GLRH 5T5FL 2W63A 5JPMB 3GZKA 1KWGA 5J1XA 1E4XL 1JNLL 2HISA 5DD1L 3AREC 2QPSA 3MJ7A 3O9WA 5HDRA 3SUSA 1TE1A 4LSVL 2ATPA 1NCNA 3X13A 3O3EA 3QXAB 4W8LA 1KJ2H 2NY4D 1XNTA 1I7UA 3CFCH 1KTDA 3KG5A 1OD9A 1P2CA 3NTCL 4Q2ZB 5K59F 1NAMH 4HV8A 4YK4B 3ARBB 4TUJB 1EAJA 2FIKA 4IMKA 1R5VB 1MCNA 4LQFL 4J1UB 1KBKA 5SX4H 4GAJL 1QBBA 1F2XK 3BT2L 4YHZH 2J1VA 3JUGA 1NUKA 3KL3A 5D8JH 5EU6A 1BD2D 1I1FB 5DD3L 3BAKA 4DGVH 3VXNB 3GUTB 3I97A 3TN0B 2QPUA 2V2XA 1WK0A 2CRMA 3VXQB 1ULPA 2OL3L 1PY4A 5I2IB 1I1XA 3HMXH 3UEQA 4DEQA 1PSKL 2VX6A 1URLA 3GMOB 4OGYH 4U33A 4BH7B 5LJYH 5MEND 1T83A 1TETH 2F54A 5J9PA 3HI6H 1YEHH 5BMFH 3ZKMC 5LCVL 3D9AH 2AOSA 2JIEA 1ITBB 1MREL 1NQ6A 3TBYA 3MLZL 1BBJB 4PV9A 5GJTH 2HN7A 3Q2CA 4FK9A 3QDJB 5E2UL 4OB5H 3VFNA 1YEDB 2W9XA 4P3CH 2VC2H 1A4KA 4FZ8H 5IVZA 3ECQA 2WVVA 3G04B 3MBED 4OKVB 1UD4A 3LEIA 3UAJD 1R3KA 4ONOA 5EIIA 5KSBA 2QQQA 1DSFH 3DXAD 2HYMA 1HZHL 2R39A 1RSFA 4PJ7E 5DZLA 4HWUA 5BXSA 1JZ6A 3EMZA 1KJ2L 4OGXL 5IHSA 1UWQA 3CPLB 4WUKL 3BVNB 4M02A 1PFCA 2NCMA 3Q3GA 5GGVH 1F02I 3GEWB 2BS9A 1XCWA 1ZT7B 5ABHA 5F7NC 1WO2A 1FL3A 1KUMA 1KB9J 3MROA 4PP2B 1JL8A 1KLGB 1JPGA 1QLEH 3WJLA 2CKBB 4G8GB 3FT4B 1A3HA 3IFOA 3U0TB 4Z2KA 2VWEE 3V95A 1DQJA 3JSSA 3K8LA 3BAEL 4XURA 5IBLD 3WUBA 3CNKA 5E9DA 5E0CA 2V3EA 3EYUH 3HI6L 1W0WA 1FO0L 3HI1B 5JW4N 3EYPA 1JI2A 1E3XA 1ZEAH 3LN5A 3A47A 1YMMA 1W0NA 5CPSA 2Q6WA 1KT2A 1J88A 1YNLL 3WFEH 5BJTB 4W4ZA 2WMIA 2JELH 3FQWB 4CRPA 5C0FA 3FQUA 3WF0A 4ZO8A 4HUNB 4D9RE 1C16B 3UTZA 4QRRA 1V3KA 3WF4A 1AIFA 1DN0A 2FO1A 5HDLA 4YE4H 1SY6L 2WWMD 3V6OE 5D93B 3KPSD 2YBRB 2YC2A 5DS8B 1TLKA 3ALWA 3O6FB 2QQLH 2CPCA 4LASH 4P9MH 3BZEA 1BFVH 4P5KB 2R4SL 4MDIA 1R3IL 4APQA 2DEPA 2YK1H 2AEIT 1N6QL 5E2TL 4G7VH 1B3JA 4EKXA 5F9JA 5CHNB 1CGSH 4FABH 5A6BD 3MCLH 1Q8MA 1J8KA 4ELMF 4XCCL 4JFVA 2WKGA 5EU4B 3QNZA 1IM9B 1OH4A 3OGRA 3OKOA 2Q20A 3M1BB 4FS0A 4Z0XA 1HKLH 4KKLC 1GZQA 3EYOB 5FA3B 4M82A 4ZNEE 3VNYA 1BZ9B 3DIFB 2DTSA 1FZOA 1RIHH 2X70A 4KQ3L 4WUUA 3ARQA 4M1RA 1G7PB 1N5YL 5HVHB 3D9AL 4HX1B 1CK0L 4G9FB 3ME0A 4MXQD 4NQCA 4YHKL 3BRFA 3GMMA 4XP1L 4WO4D 5C0AE 2F8XC 4JRYA 4U1SA 5GGQL 4ODTH 2X0YA 3CFDA 1OARL 5FFLA 4ZQKB 4F9DA 1DUYB 3STBA 1BQUA 4HKJB 4ORGA 3MRBA 3UJTL 4LGSB 1KTLB 4LKXA 1YEJL 4LPUA 3D5OF 5LBSH 3RKDD 4PRHD 4U1JA 2DYPB 4BQ5A 3A23A 4MD4B 3ULSA 5IT2L 2H2PC 1E6PA 4BM7A 1DZBA 5E09A 3VIIA 1TVHA 4DN4L 1KXTB 5L8KB 4LYPA 3GO1H 3I75A 1GQKA 4WNQB 1OF3A 5FK9B 4PMXA 4NUGH 1XF5B 2IALB 1YEFL 1M05B 3DHPA 4RFEA 3KPRB 3L5HA 1I3UA 1JRHH 4U0RC 1NFIA 5L88L 3UYOD 5FYKL 4JFYB 1H5VA 3U9PL 3L6FB 2FWOB 2BOBA 4X9HA 4OFIA 4R90H 5I30H 5I6XB 3S37X 1J83A 3MBEA 4U3HA 4YNYB 5CJ5A 2NY0C 4XBEH 1HCVA 1RJCA 1E6RA 3MACH 1ESWA 4OUUA 3LSOB 4XNMA 3N85H 5E99H 4JPKH 1V3LA 4PJ8C 5IXEA 4LVNC 4YBHA 1DBJH 2M26A 5A6LA 4RFOH 1QFUH 4JFDE 1RUMH 2DD8L 4L29A 1SG3A 4KRPB 3SDXA 1MHHA 3C60A 1J05A 4W8AA 1BFOA 4GAYB 1ONQA 2JJSC 3LN9A 2TAAA 1A14H 3G6AB 1T0MA 5B4MD 1H8SA 3C2AL 3U6RB 5BXRA 8A3HA 1NWUA 2XXCB 3QQ3A 4PP1D 1FQ9C 1WAAF 3TESA 1XGZA 4HF5L 4AD4A 5GS0D 3S34L 5I15H 2D3LA 2NXYC 1CFSB 5H2BA 2X4OB 4KI1A 1PD6A 3O2VH 3WL1A 2XHYA 2VISA 3MUGB 3GMQB 3AFBA 4DXRA 5ELIA 1BHGA 3BX7C 1TZIA 1KV3A 1BEYL 2FO4B 3OZ9L 4OKDA 5FHBH 1B6UA 2WHMA 3DC0A 3MRIA 4H8WC 2AEPH 3DARA 4G6MH 4GUPB 4S1QH 2VLME 3F6IA 4FFZL 4RMSA 3L5IA 5IFAL 4XCFH 1Z9SA 3EDJA 1CLZL 1OY3B 4K8RL 1Y0LB 3QO0A 5D7LA 3BKJL 2VLLB 5E2VH 4FFVC 3GM8A 1A4JB 5IMOA 1UY4A 3MV8A 4RMTA 2DOCA 4LVHC 4CN1A 4XXDB 5C0CA 3M17B 4HUUA 3PGFL 1BTCA 2B0SL 1D5BB 2H32A 5D1XC 4FQLH 1PX3A 2IAMB 1BGXL 1LD9B 2N7BA 4ZUWA 5GGQH 5C1MB 4S3KA 1I1RA 4M62L 4UU9A 4HGWB 4D0DA 4P2QA 5CEZD 4FA8A 1TTFA 5EULV 4H1LB 4R8WH 4MNGA 4KXZH 1RZIA 5IVZB 1I4FB 3ILQC 2HWZL 5TH2A 5ESVA 1XSJA 1LEGA 3AMCA 5JPNA 2J6EA 1CZSA 4KAQL 2BGPA 1G9HA 1JXKA 3LQZA 5HGHB 5C0IB 2Y64A 3EOYG 4QYOB 2XRAH 2ZEYA 4JO1H 3TC9A 4GG6A 2ENSA 2ITDB 2LTQC 2V5CA 4XMLH 1RULL 3IETB 2OK0H 1EDQA 1CICA 4BKLA 4DJMA 1D5XA 2AXFB 4XAWL 5D7IE 3UG4A 4U6VL 3BQUD 4JKLA 4XVTH 5CJQL 1E4WL 4G6JH 5T1KD 1E1EA 3RGVD 5LA2A 1LJYA 3O0RH 2WBJA 1CLYL 4XWGH 4OCRL 3Q5OA 3T0VA 3BP4A 3SDAA 1ZT4B 1KFAH 4GMSH 5FKPA 5FM5M 2FL5B 5BS0D 5LWYL 4BZ1H 3O3DB 5D7JA 3SJVE 1FBIL 2NZIA 3RY6C 5JOPE 5ERWA 2NSXA 4YIQA 5J6HB 2A0LC 2EO7A 4HA3A 3H9SB 3VFPA 1J0ZA 2N4IA 5KSVA 4JKPH 1KQZA 3NA9L 4LLDB 3HC0B 5GZND 3VI3E 3Q6FA 4XMKH 1V02E 1KBBA 4YDIH 1YJDH 3CBWA 4R4BB 1BGXH 3RWIB 3WBDA 5DVNA 5CZVH 2XQYG 1KLUA 4NP4H 3ZE2E 4GW4A 1JZ7A 1LO4H 1AQKH 3RVUD 4JFPA 1U8LA 3ILPB 5FM5O 2I27N 1DN0B 3OXSA 3PV6B 2YC1B 4JQIL 4O2EA 2QMJA 1ZHLB 4XPAH 2X4TB 3WO4B 5FAAA 1E0VA 1CE1H 5I17B 3RMEA 5D4YA 1G6RB 5BRZA 3FFCE 3NRUA 4V28A 4NHUB 3BGMB 4PGBA 3U4AA 1FC1A 3RL1A 1I9RH 3BZEB 4FLQA 3BH8A 3DROA 1XCTA 4QNPE 4DZBA 3RGVC 2NNAA 4BSWA 3GSVB 4OJFH 3EJYD 1A3LL 2OTUB 4TXEA 1HILB 4RYDA 5CHNA 3SDYL 4OGXH 3ZE0F 4PJCA 1BJ8A 5DUPL 5C0ND 3T1WA 3TP4A 2GFBA 5TQ0L 2NT0A 3OKOB 2A6IB 5I66A 4QHKI 2PUQT 2VT0A 2ZCKL 1JGLH 3SJVA 1ND0B 5E8PA 3OAZK 4OZIE 1L7RA 1BPLB 1CFTB 3QZWG 2QHLA 1U0QA 4JFXA 4KRPD 4YHNB 4PYSA 4OZIF 4HW6A 4LSPL 3G5YB 3ARGA 5IBTH 3CXHJ 4AEIL 1UMHA 1DBML 4L8CA 1TXKA 4AYSA 1EO7A 4MJIA 5L9DH 1KGWA 5AG8A 3R8BB 4M62H 3S6CA 1IAMA 1PKQE 4X6DF 4X5LA 3U36B 1FO0H 4OZOA 1L8NA 1U8NA 1PGRB 3MRMB 1UYXA 2AXHA 1V7ML 3EFFA 2HH0H 2YL6A 4X9YA 3SCMA 3BIBX 4PB0H 3QCVH 1UKPA 1ZL1A 1F45A 1WF5A 5DMKB 1IC1A 2ICCA 5E8NA 2ZSWA 4L4PA 1C93A 1E5NA 1MSPA 4ZFGH 5ABGA 1CPUA 4NWTH 5T3ZH 2ZUTA 6FABH 1ZVYA 3HS0A 2ED9A 4LXFA 2IFGA 3RDKA 3QUYB 1GOKA 5ECJE 1L7IL 4HFUL 2V72A 5CKAA 4W87A 3MRPA 2QR0B 3CFEA 3E6FA 4UZSA 3NZ8A 5HDBF 5JXJA 2J12B 3CCHB 1R3IH 4PJAA 2O92A 3G9VA 4MVBD 1GIGL 4JAMB 5DJCA 4F7MA 4PTMA 4LVEA 5BRZE 1GOQA 2X4SA 1INDL 2CDFB 3PJSA 3TNMB 4Y1AA 4XUTA 5D7IF 2A3HA 2H3NA 1Q9WA 3ACGA 2V7NB 5EOCL 4S0SD 2G60H 2XWJB 4OLUL 5E8OA 4UAPA 2A6KA 5EWIL 2NZ9D 4LNRA 3BLKA 2Y4SA 1K4DA 3FB5A 3IRPX 3PZOA 1T5XB 1YJDL 4NO0B 4QO1A 3Q5TA 3SGDI 5D6CB 3NGBB 3APGA 4RZCA 3PQYE 4I0PB 4FXGA 2XFYA 4NQVB 1A5FL 5I1IH 2J6EH 3GJEB 3H42L 4URIA 2DQFA 3QUXA 2GTZA 4HSQA 2VM9A 1VJSA 4MQXC 3LN4A 5E5MA 3KJ6L 1KCRL 4N90D 2DLIA 2NY0D 5GGUA 2IQ9H 2Z93B 2F54B 2B31A 2J7CA 5HI3D 2QQJA 1JNHA 4JY4B 1T7YA 2OSLA 4QRPB 1Q9LA 4CCDA 3VCLA 2X9XA 3TBYB 4PR5A 5GGVY 4ZTPL 4F58L 1JGUH 4Z2AA 2YFZA 3D3VA 5T3XD 1HJWA 1MFAL 3KVQA 3CX5J 1I8IB 3HJEA 1CFSA 5H2BB 3EYUL 3KDMA 3RZCD 1XFPA 5I8CB 4RISL 4GQ9H 2PO6B 5MP6L 2ZPKH 3AVEA 1S9XA 2B1AL 3C09C 5T33H 3T0AA 2O5ZH 1HJUA 3EJJX 4LSRH 5F1SA 4E8CA 5KBNC 1GGCL 3GSQB 4HWNA 4RQQA 4NFDA 5DDHA 1MIML 4B5EA 3SPVA 1NGWA 3F6LA 4P5TB 2IFFL 2ZOLB 1IQDA 1G7QB 2FX8L 4XX6A 4H8UA 4WU5B 4RE3A 1OB0A 4KU1A 1IC5L 4MQ7B 3A7QA 3SUWA 4R2GD 4OF0A 4XXDA 2C3GA 3QDJA 4HUUB 2E7MA 3M17A 4C54A 4GQPH 3MLWL 4GBXA 5JOEA 1T0NA 3U7YH 5D2NA 3MNZB 3O4OC 3FZUD 4P3DA 5F71A 5BQ7A 3QIBD 4LGXA 3WY1A 3GKZA 1T4KB 2WB5A 2IWGA 1FFPB 5CYYA 5JDSA 3MV8E 4PV8A 3MNVB 1QA9B 2BVEA 3G5ZA 1RUPH 3BPOC 3GJFH 1RZIB 4E41E 1K8DB 1NPUA 1NGPL 3WFCL 2F53A 3QDMB 3AYRA 3SEEA 1UEYA 5CGMA 1C91A 4ZXEA 3GSXB 4WCYL 3VRIA 1U91B 3CPLA 4AZ5A 5C0IA 2BSTB 2Z31A 4X0KB 3AZSA 1L7IH 3AY4A 4RGNE 4PMUA 4TUKL 4LOUD 3F65A 4YDJB 2R2EA 4X4ME 2DWEA 2YFUA 2NXYB 4LL9A 4Q0XL 5I1GL 4OD3L 2QMKA 2J7EA 2HKHH 5AWNL 3QA3B 3PGDA 2HRPH 1UCTA 1JPTH 1MWAH 2EE9A 4M80A 4DM1A 2XZZA 4JQXA 3W27A 5J13B 1B0RB 4W93A 1UWGH 4BSVB 5HYEA 3HNMA 4YDVA 3U2SB 1MIMH 1UFUA 1FYTE 4WHCA 4JFEB 2Q8AL 4KPHL 4PYHA 1J1PH 1X5AA 5BJTA 1AI1H 4LEOA 4HGKC 1DQDH 3FQUB 3H9SA 3VFPB 2QBXA 1K3ZA 2ARJA 5FA3A 1ZGLP 1RJYA 3RDTB 4GG8B 1UR1A 2C1OA 5DRWB 4FLRA 1DLHB 4ODSL 1OBAA 1HHHA 4G3YH 3LKOA 1MFCL 2DQCH 3PNWA 1WUNT 2WAGA 3HTLX 4NRXB 1J8HA 3AMKA 3OXSB 4RRPG 2K3TA 4YFDB 2YC1A 2AK4A 1Z2KA 5SX5K 5JQ6L 4Q9QL 1JNEA 1GVIA 3I2FA 1VACB 4U1MB 2HMIC 3AXLB 3HNYM 1S7SA 4XVHA 4DUXA 4C55A 2X4NB 1VPOH 3ZTJG 4GINA 2IANE 2X41A 3MUJA 4PG2C 5IWLA 3V5DA 4Q0XH 1NLDH 5GNXA 4N5UA 3VFVB 5FYJL 1CGWA 1CWVA 1CG9B 4QB1A 1U3HB 4KKLD 1P9MC 2OQJB 5LGJA 1L9MA 4MNQB 3O2WH 4KH2A 1GCYA 1ZHBB 3OB0H 1T2QH 3BO8A 2IBBA 2BDNH 3DTXA 3BAIA 1VESA 3PP3H 5IB4A 3ULUH 3AC0A 1DEEB 1S9YA 1XNAA 1LK3H 4OMDA 5GNZA 2DKSA 2MSPA 5F7HA 1VGEL 3SGKA 1HHIB 5I23A 4JRYE 4YX2H 1HIML 3R0NA 4AZ7A 3ULUE 4XP6H 4GSDL 5GQBA 4E42A 1B3VA 1T2XA 5CINL 5JW3H 4H25B 4D8MA 3UZQA 1EFXB 2W38A 2YD2A 3TO4B 4ODSH 5DRXA 4X7TA 1NFDF 3KWWA 3TIEA 4JY6B 4H41A 1XGPB 4N0UE 3L3GB 1BOGB 3MXVL 3UTSB 3MA7B 3QDGB 3PTKA 4GZIA 5ICZA 2EE6A 4QNPF 4DEPB 1ZGLM 3WFLA 2YUVA 3BHBB 4QRQB 5DTFB 3DVNB 2VXUH 4LGPB 2X89D 1CGVA 4XXCA 4I18C 4D9QD 1U2YA 1BG4A 1CBVH 3PUIA 2MWCA 2X9WA 1ZLVH 4Z76A 3SQOL 5ACZA 1KB5A 3MC0A 3O9WB 5EU3A 2IEPA 4OBSA 4IHOA 4IS6A 2D03H 3KNBA 4EI5B 3S35L 4JG0H 1J1OL 2HT3C 3GBLA 2EDXA 3K81A 4MJ5A 2X1OA 4W4OC 4AD3A 3L6FA 4P7RA 4AEIH 5AZ2H 1OINA 2Y36L 3MR9B 2NW2A 3NIGE 5DEFA 5HBFA 1L7TL 2VERN 3MBEB 5ICYB 2NR6D 1WAAA 3MRRB 4JZJC 4HWZA 2A6JB 4LNVA 4GJTB 4RA0C 4L5FL 3KLSA 3KPQB 1HP5A 4GQRA 3TN0C 3H0TB 2ZCKH 4K07A 5F7WC 2AJSL 3OWEA 4L9LC 4P48A 2EIDA 1H49A 3GHEH 3QHNA 3AM8A 2KH2B 4WVRA 2V2XB 1C1EH 3FXYA 4PB0L 4CCEA 2AJ3A 2OL3A 2CO7B 2XA8H 3QUMH 1KCLA 1MY7A 1TDQA 5CINH 5CEXA 3ZZ1A 4RZCB 2C5DC 4U6VH 2ZCHH 2RFXA 5FYJD 4H0IA 5DT1L 3ZT6A 4XC3L 5KJRH 4QDMA 2AJZA 4U3CA 3SKMA 3KZSA 5C07E 1MI5E 3H6JA 3FZUC 3GFUA 3H9YA 1QPXA 4LPYA 5EUOF 1AKJD 5C9JA 3FRUA 5CXPA 2EDHA 3BSZH 1NMBH 1AFVH 2J4WH 3LCYA 1KG0A 4PJ7F 4OKVA 5KZCD 5IMKB 2GAZA 5KVGL 4PRHE 2P5ED 5ACLA 3JBG7 5HDQL 2WIIA 1GRWA 5JOFA 4MCZB 3HNBM 1KCVH 4EUPB 4V1DA 1HHKA 2B2XL 4NC0B 5FCZA 3VWJD 1JBJA 3LEYH 4JHBA 5ESVB 4GKNA 1D9KC 4OZHA 3QG7L 3TZVD 1FL6A 5A2LH 4UQEA 2PO6A 4D9LH 3EW3B 3AXIA 5IESL 4HHAB 2DQGL 4JDZB 3D25B 4BK4A 3OSKA 1G01A 3IDMB 3W6MA 5DQDH 3I6LD 4NRYB 3DV4B 4JM4H 4JJ5B 4TOYH 4HJGA 1D5BA 3LDBB 4MHHG 3MSDA 5KANI 5E03A 1E56A 1RI8A 4KGJA 1M53A 4Y4KD 5IMMB 5FGCB 3CO4A 2I9LA 5JIIA 4A3ZA 3VFUB 3FW6A 1E6JH 2XKNB 4K3EH 4MXVF 1KB3A 3VXRE 3EGSA 3RKPA 4QAWA 1QVOB 4G6AD 4HBQA 2XG4A 1W9PA 2OI9C 1NEZB 1OF2A 5D1QC 3WHE1 5F8RC 3VGDA 2H2SC 2HYXA 4NDMB 3UNPA 4KVCH 1DHKA 3AI0A 1NDMB 3L3OB 1HT6A 3MX0A 2NY3C 1RZKL 3B5HA 4MAYB 5E7FA 3F2ZA 4XVUC 4P5MB 4MJ6A 2G3IA 4YDKH 4QDRA 4YAQB 4BFIA 4OF3A 3DVFA 1GNYA 3TBWB 4QDSA 2Y8VA 1X5HA 2QSTA 3O4OB 3GB7B 2YUZA 1Q6DA 2CBUA 5DJ2B 3PWLB 1LL6A 3TA3B 2WN3A 1DBBL 4M7LL 2Q8XA 3ILPA 3LMJL 3D2UA 4W85A 3U1SL 1UZ8A 2B20A 2GIYA 4R7DA 3WXVL 2ADFL 1UZ6E 3SDAB 1IT9H 4J8RA 3MANA 4UNTA 4XPGH 2V17H 3BKMH 3CK0H 5DMYA 3MBXH 1BLNA 1H3XA 5FDWB 1BYBA 4YIQB 5J6HA 1XR9A 3EAKA 5J3HC 3V8OA 1U8KB 4FMFA 5D2LF 4GKZA 3WF1A 2OTUA 2Z91A 4NJAH 1XR8B 2AV7B 4HPHA 1PBYA 4K3GA 1I85A 2DN7A 5JXEC 3U5UA 4LQRA 4PJ8D 1C12A 2A6DA 2EE3A 4MLIA 4LIQE 4TX6A 4P23B 4KJPC 3H3KA 4IIQC 4AQOA 1CN4A 3BOVA 3QWOA 2ZG1A 4BFGA 5CCKH 2BVQB 1CD1A 3P77A 3V6FA 2C3WA 3OAUL 3QEQE 4R4FH 1KPRA 4TQEL 4MNKA 5AC4A 2D7NA 4UNIA 2QSCL 1LP9B 1N7MH 2BVPA 1A6ZB 1JVKA 4H2CA 3NTCH 2DLFH 2OMNA 1CDJA 3QRGH 4JRXE 1MH5A 1X5LA 3MRKB 2WHLA 4PP1C 4Y5VA 1DUYA 1TMQA 5LAXB 2YD9A 4TSCH 3L4TA 1QP1A 2YC4A 1AE6H 2MTPA 2XIDA 4FNLH 4X4YB 5I1AB 1AD9A 2WSPA 2VWEC 4J27A 4YWGL 1U58B 1VACA 3P40A 2A3EA 1RMFH 1W9XA 1S7TA 1XF1A 3VIPA 1FPTH 4LPVA 4NQEB 4Z77B 1KR1A 2DJSA 3F7VB 1LO0L 3DJ9A 4OYUA 4P4KB 5LCVH 5GSVB 5C0NC 3STZA 1Z9LA 1FAKT 2R29H 4UCFA 4B53A 3QIBC 1U95A 5FM8A 3UTTE 2NXYD 5D1ZB 8FABA 1QO3B 5C0DA 1BZ7A 2VQ1B 2UWEF 4L8SB 1Q6CA 1YQ2A 3VDCA 2YDQA 2OCFD 4NSKA 4DWSC 4ZUSB 4KDTA 3ROOB 2W65A 4K7PY 4NJAL 3WV0A 2A83B 2J25A 4JHAH 4LAQL 1O0VA 4UI9L 2M1KA 3H7BA 5T5NG 4S1DD 3ULUD 2EPLX 3O6KL 2FYYA 5FUZH 5KZCB 1ZGLA 1U93B 4OMCA 3QULA 4AENA 2V3GA 5DMKA 3GGLA 1N7ML 2YXFA 2P24B 3QOMA 1P6WA 1WICA 1M7IB 3VXSA 3NA4A 4Y2DB 3FO9A 3ABZA 3MJ7B 1O8SA 4ZUTB 2XTKA 4TSCL 2X4UB 5I1HH 3RTQA 3C8KA 2F53D 4PJIF 4HZ7A 5GSRB 5AYUH 3G6AA 1C7SA 2VZ3A 5BO1H 1Q0YH 4HG4J 4W6WB 5I18H 1RZ8A 1UB6A 4TUFA 2ESVA 1ZS2A 4HUMB 1YMHA 4JM2D 4Q6IC 2VMFA 4NBZB 3SKNB 1JRHL 2E9IA 1KIRA 3RBSA 4X5XB 5EC2B 1V0LA 3PJSB 4I2XA 2V17L 3BKML 2E9LA 1AO7B 3FO2A 5J7CC 4JFOB 4EOWH 2V7NA 2A9NL 3OKEB 1H3GA 1I75A 2H2PD 5AZEH 3DMMD 3L3KB 1UQZA 4X4XB 5DHXB 3UETA 1YPZF 1NGPH 3CMGA 3WFCH 3RVVC 3LZFH 2W07A 3NCMA 3RAJL 1QOXA 5IQ7H 1W2PA 4BQ2A 5M5DA 2G60L 5E0FA 3LMYA 3LS5H 4PJEE 3UYPA 3W9EB 3QQ9C 1K9EA 3GSRB 3CVIH 3LRHA 3MMWA 2HG5B 3O4LD 2JCCA 3DSNA 5GS0L 4U3AA 1QFPA 5E5MB 2AQ2A 3L5XH 4N0YL 4UQ2B 3ZLQC 1BFNA 1OGAB 1BFVL 3FT3B 1YYML 4YR6B 1LL7A 1OPGL 4UINH 2DLFL 2ATPB 2P8PA 3O3EB 1ZA3B 5CJXA 2AV1A 1FYHB 5DN2A 3EZJB 1MYRA 5FYKE 3SQOH 1FFQA 2GTWA 5T1DL 3TO4D 5B8CA 3ARPA 4F2MB 2EPNA 5K9KB 1T0NB 5IHZA 1C08B 2AJUL 4UV7H 3KL0A 4WI5A 5BS0A 4UQAA 2J1AA 2BY1A 2EH7L 3SKVA 1C90A 4ODHH 4S10A 3FQWA 2XN9E 1MAMH 3L3IA 4XNZC 3KPTA 4JRXD 1NCAL 3DSFH 4HWBH 3QEGL 1HHKB 2VDNH 3VXQA 1OQOA 1CQYA 1AP2B 3QEUA 1OSZB 2NX5D 1LNSA 1OGGA 1AQHA 3N9KA 2FD6L 3MJ9L 1WAWA 1J0KA 1JTTA 3C5ZC 3IFOB 3BRDA 3HMXA 4W7UA 2HT4C 5DJ0B 4JL1A 3WH6A 5E6ZA 1MCWW 1A8JH 2A9MH 1KSRA 4P5KA 3U4BL 3ALXA 5EO1A 4E0RA 1X5YA 4D8PB 1OP5K 1R7OA 1J8HD 4R0LB 4V2BA 3P0GB 2DB8A 5LBSL 3OPZL 4FQXA 1T5WA 4JFDA 1FIGL 5KANG 2XKNA 3MNWA 1N3NB 2Y07L 3MLSL 4U1KA 4R96A 3UTZB 5GRYA 3VFGL 3TVMA 4M93B 5CD5D 3FO0L 2QQOA 4XZUG 1KLUB 4GRWH 1UADC 1ZXQA 4HZLA 3MV8D 1TVDA 3WBAA 4HMEA 3VDAA 3RL2B 2O61A 1T89C 2BSRB 4V2CB 4PRIA 2XGIA 5E6ID 4MJ6B 4BFIB 1IMHC 3GH5A 4R6UA 1IGCH 1N2RA 1MNUH 4OF5A 2X4QB 5DSCB 3PZQA 2OTWA 5BS0E 3CLFH 3WF2A 2EDFA 4NRXA 3K80A 5GGTA 2WC4A 3GSVA 4P23C 4MAUL 1GZQB 3EYOA 3QNXB 4I0PC 5EBLA 5DJZA 1YEIH 1ITCA 1IAKA 3VM5A 3AXLA 1C5DA 2D31A 2BV9A 4J4PC 4YZFE 3OXRA 3MA9H 5ADPH 2R56H 5C92A 4JFFE 4MAYC 4ACYA 1NC4B 3NCYS 5GISL 4AH2A 1PLGH 3QNYA 1AGBA 4G9FE 4KK6C 3HZYB 1QBLL 4Q9CA 3X3FL 3QXDB 2VXUL 3C2SA 4WI4A 3K8KA 4OZFB 3B2VL 4DVBA 4M61B 5FA4A 5D4QA 1HHHB 2SEBA 4GRLD 1IKNA 1DDHB 3EZ8A 4M1CD 3BLPX 4Z5RA 5DJ6B 3ETPA 1DLFH 3UTPD 3MRBB 1G0DA 1C92A 2J47A 1OP3K 1MFDL 1YDPA 4ZO6A 2Z1KA 5KTEH 1US3A 1ES0B 3IF1B 4XI5D 1OW0C 3SDCD 4Y7EA 2WQ8A 4Y5VB 3WKMH 4RL3A 3NACH 3ZOAA 2LS6A 2R69L 4QX3A 2F19L 3G6JF 3ZHLA 5A3ID 2X4NA 3AMDA 5A69A 3ZKNC 2CDGA 2PQSA 3LEKA 4HBCL 4K7FB 1ZLWH 3TJEH 1BZ9A 1J87A 3DIFA 2DQIL 5C0AA 3MA7A 5D1QB 4JKKA 1Q6GA 1ZANH 1E15A 3BISA 5C09B 5T5NF 1V05A 4L4TB 1G7PA 5HHQB 3QEQB 1IVLA 4P2RE 4MPKA 1L9NA 1OLLA 4F33A 1CZ8L 3E6FB 5FM4A 3U0WL 4HOXA 5HVWA 2B5IC 3EIFA 4HK0A 4JGJA 3Q6GL 1S9YB 1YPZA 1WC7B 4HEPG 1BFSA 4ACZA 4GO8A 1NC2A 2QADB 1YEEL 3UZEA 1AQDA 3LEVL 5L9DL 3QEHA 4LASL 3WUWA 4PJEA 3RA7H 1UZ4A 1YJDC 2J77A 4CGTA 5F7FA 4I3GA 3S37L 1P69B 1CWYA 4Z7VA 2PW1B 3VM7A 4IDJL 2XWTB 4QHLA 4J3TA 2HTLD 2PCPB 3OKNA 5ANME 3ZO0A 3C8XA 1VFBA 3M8OL 3WO3B 3KE0A 1UWSA 5CJQH 4KRTA 2J7DA 3QUXB 4F37K 3Q48A 1KJ2B 1GORA 3A6OA 5L0QB 3SKJH 4MMZC 5C0RL 5K9JH 2AJXH 3GMNA 3NH7L 4QOKB 4LLMA 1EMTH 4E41A 1UACH 1Q9LB 1SYVB 4JN2A 1V5JA 2A1WL 5DPNA 2D7OA 1BIIA 4EI5C 5DRNA 3D6GA 3T2OA 1KCKA 5J1TC 2CSPA 2QHAA 2D24A 1FRGH 5F6IB 3BC9A 3ZJKA 2VITA 4MD0A 3OKDA 3VGBA 1W72A 3PQYD 2YIHA 3CUGA 4AY0A 1FL5A 4HKZB 2ICWI 1VGKA 2PYED 3FQRB 5GJSH 4P9HL 25C8H 1G7JA 3VWKA 3RU8L 3ZMRA 2QHRL 2OL3B 2VXVH 3EOBA 1JHJA 3L7EB 3UG5A 3S5LA 5JBFA 5HHOB 5EH1A 4NN6C 4OI7A 3CXDL 2IAMA 5C0EB 4LSQL 4UU9B 3U4EB 3I2KA 2BJML 3NCOA 4NCDA 1HSBA 2ED7A 4OGZA 1NMAH 3LIZH 2P5EA 2F9BT 4G8EA 2P8PB 1D2KA 5D1ZC 4OJFL 2XM2A 1M03A 5DT1H 4NN7C 4RDQF 1I3RA 4RNRA 2VLRA 4NWUL 2CGRL 1FVDB 3WN5A 3WNOA 5ERWB 1Z3GH 2J3SA 1KJMB 5B8CB 3W0KA 2VYRE 4ZYKA 1LP9E 4JN1L 2A77L 4Y19E 2BNUB 3QZWB 4AL8L 1MCRA 2X1XR 1N8ZA 2UY6A 3SGJC 4X98B 5EIYB 1RP8A 3RUGB 4OV5A 5AYUL 5EBWB 1E4KA 1S78C 3QCTL 2WBJB 4PBWD 1M4KA 1UG6A 4P2RB 1J9YA 2OTPA 5DC9B 3HAEH 3LEYL 4P46A 4DTGH 3N15A 5F7DA 3X3GH 1GC1C 4YXKL 1NSNL 2E7LA 2UYLB 1HZHH 5DWUL 4EI6A 3SE3A 2FH8A 2VLJE 1YEKH 1B0RA 5D7IA 3IRZA 1MLBB 4TSAL 3PZTA 1XCTB 3DXAB 3GK8H 4IIQB 1X5IA 2WINB 4MQXD 2NW0A 3TEUA 4LLDA 3C5JB 3PHQA 1JPFB 1MFVA 1V6WA 2X10A 3SDCA 1WCQA 4KKAD 1MPAL 5AUMA 1INDH 5FF6A 2F58L 3VVGA 4G6AC 3L3OA 1X5FA 2FX9H 5I66B 4V2XA 3BW9A 1KPUA 3X14B 4JFUA 4R97C 3QIWA 5IHUH 2OYMA 1K8IB 4UT7L 4OLXH 2HFGH 4E4PA 1KNOB 1OTTC 4OIFA 4RGMC 4CVUA 3W0WE 2FSEA 5HHXH 1OGAD 2R29L 3MV7E 4JZOB 4O58L 3GNMH 5CZKA 3OG2A 1NCAH 3BKJH 5A6SA 3DRTA 1UCBL 4WFGE 1UACL 2J79A 4Q6YA 2BVQA 3V6FB 3WSQL 4DQOH 2ZX8A 1J8HB 4UFLA 1UY0A 3ZYIA 3NIDF 2FHCA 2APWA 1CGXA 3JV6B 1GL4B 4FQ1H 1A6ZA 4MNLA 5DZOA 2IPTH 4UIKL 1XHGA 2H6PA 3O8XB 4L3EA 2YPVH 3WD3A 2G41A 2Y72A 4X83A 3NCFB 2I5YL 1GOGA 4M8QA 5DI8A 3EFDL 4RFNC 1EBPA 1UM6H 2E32A 3PQYB 4PMOA 1HHGB 2VABA 1JAEA 1WZAA 1MRDL 3QDGD 3H3BC 3LD8B 4UDTA 2C7UA 4LHJB 1HXMA 4RISH 1V0KA 3QIUD 1ISVA 4K3JL 4OFPA 1UR4A 1DN2A 2JD9A 4NC2B 4MJIB 4AD2A 1UWXK 3WFBL 2BNQD 4JO4H 4EDWL 4ATWA 2VXQH 1RIUL 3U37A 4HCRL 4P49A 1L0XA 3RPKA 3W29A 1K4CA 2QEJA 3AREB 1A6WL 3OHXB 1FZKB 1AH1A 2WUCH 1AKJB 3FB6B 1Q9WB 1LQ0A 2BFVH 2KZ1B 4GXUN 5DRXB 3GSNL 1ADQA 4G8FA 1BYCA 2YG0A 5IB5B 3W28A 1EJOH 3HRPA 1LO2H 2DQDH 2P47B 3KPRE 4G5ZH 3UJIL 2EYTB 4L8DB 3TPUB 3B9KD 1BBDH 4CKVX 1VRXA 2IAND 1IJ9A 4L4VD 1QVBA 1XZ0A 2GFBB 3W2DL 1RZFH 1XRVA 4C7DA 4RDQG 4NQVA 1MCIA 1GJUA 4NJ9H 3L4ZA 2AAVA 4HA4A 2QQNL 2DGAA 1M71B 3DURA 3IKKA 2APXA 5H37G 3T1FB 3LE0A 5DD5L 4C56B 2IGFL 4ETYA 4OFYD 4X9BA 3HI5H 4L4TA 1VEOA 4HT1H 3DI2B 3V0WL 3JWOL 3P0VH 3O2DL 2MOVA 3VRJA 3P30L 2C4FU 1I7TA 3ZKMD 4GRMB 1JFHA 5DF0A 3FOLB 3LEGA 1FG2A 2XWJA 4OF8A 5E8OB 2J1EA 4EDXA 3NFPB 3MUHL 4P2YA 3IAGC 1EERB 4WO4C 2DYPD 1F5WA 4M00A 5GIRA 4NRZA 1LG2A 3F5KA 3WS6A 4XP4H 4B50A 5FCUH 2ID4A 2OR9H 3TT3L 1FO0B 4WLCA 1UEMA 3QO1A 1ACZA 5FGRA 3GIZH 2VIRA 5B38A 2WLYA 5JR1L 4HJ0C 2ICEA 2XOMA 5BRQA 1YQVH 1P5UA 1CDUA 3NACL 2BOCA 1DQML 1VFBB 4KROD 3VXUD 4Z7NE 1F90L 4Q58C 2GUYA 2OSLB 4QRPA 4CJ0A 3NSNA 1IGIH 1IL1B 2R2CA 1DEDA 4YC2B 1B31A 1ZANL 1MRCH 3SO5A 3I9GH 4WWKD 5SWSA 5IBTL 5CPQA 4QOKA 4TVPD 1JGEB 3C6LA 4IBLT 2W1WA 2AGJL 1T04B 2DQJL 3FN0H 2Y1VA 4WUUE 4XVSH 2Q8AH 5I18L 4I3RL 4WW2C 3MU7A 1SYTA 3MNVA 5CWSA 3OR7A 3L4WA 1VFAA 1R5WB 3CVHB 1G7LA 3QAZC 5L6YH 1JGVL 1K4DB 3FB5B 4YO0B 2Y07H 1NGQH 1QUNA 1E6ZA 4OUOA 3WLWD 4HFWA 1ZHNB 3AU1A 4P5TA 1XYFA 4YHOH 2P8LB 1MF2H 1SBSH 4IM8A 4FXGB 3WLWC 5SX5H 3BE1L 5I74B 4PFEA 3K1DA 5DJAB 1A6PA 4YDJA 4WHDA 4JFFD 1XGRB 4Q97A 3LQMA 5JQHC 3BPNC 5GPRA 2XM1A 1KJ3H 4CMMA 3RAJH 3MJ9A 1N0LA 5JQ6H 4IPNB 3QJHA 5HHOA 1KIPB 4KJQD 5IBLC 1M6OA 2J22A 2DLHA 2HFTA 1EO8H 4BSVA 3THCA 4FQ2H 2EBNA 2XTLA 3D3VD 3S37H 1QOKA 4PTVA 2EDLA 5AG9A 3KHOA 2OR8A 3ZSSA 3B8SA 3JVGC 2W59A 4MAUH 2K7QA 1CIDA 3KDMB 1G5AA 1T5WB 4JFDB 5IM7A 2VDPH 1J5OH 2IANA 3PZNA 1WPCA 4H7VA 3K46A 4WEMB 3TTQA 3VMPA 3PGFH 3RIFK 4QTIL 3B9KB 3SE9H 4KZEL 4U1KB 3JWOC 3MLRH 5KZ6A 5E9DE 1TJIL 5E8EA 1FL3B 4NN7B 1DSFL 3U7WL 3SE4C 2D2OA 4X5WA 4PP2A 4DXTA 1G94A 3KL5A 1P7QD 1CVRA 1T66D 2MMXA 3B2VH 4OIBA 1F58H 5GJSL 5JBDA 3B3IA 1E4LA 3HMCA 3N50A 2YLLA 3F12B 1JE6A 2Z8WC 1DFBH 3EB7A 5I3DA 2FJGA 1L0QA 1CIYA 4OI9A 4J8RB 3BUYB 2VCCA 3LHPL 4JQVC 3MOAH 2NPLX 5BQ7B 1Y7VA 4PMVA 2EC9U 1CI5A 1KIQB 1HNFA 1KT2B 4GFTB 1JDCA 5E94A 3DX8B 4JFZL 3VWJC 3EOTH 1C16A 1Q9OB 3ZHKA 3VA2C 5FYLD 2HFEA 4EN3C 1WBZA 2BXZA 2UY5A 4MWFB 3RZCC 1OTUC 2Z31B 5EUKA 4K9EH 5HI4C 3P4MB 1A47A 4X80L 1OGAE 1I7ZB 5KG9B 5C71A 4LRNH 3LIZL 1JTOA 1UJ3C 4P4RA 5CILH 3GHBL 4APQD 4GKSA 1S5IL 1IAOA 5F7UA 2B0SH 1IEAA 4JPWL 3FQNA 4QF1B 2CIPA 3L4VA 1VB9A 5AYQA 1GZPA 5JIHA 1SBBA 1Q9KB 4GAFB 4XMKL 4DK3A 5EU4A 2XN9A 3A3HA 3OQ3B 3JV6A 1WTLA 5I1EH 2NY2D 2CLVA 4K94L 1CFNB 4Y16D 2VDQL 1CZTA 1AR2A 2ADJA 3GTNA 3MRLA 2J4WL 2XZQH 1LILA 2WBWB 1NCBH 4H88H 3DPBA 3F5LA 1DANT 2Z4QA 4JREB 4UT6L 3U30C 4GG8A 3QI9C 2BCKB 1G7IA 3IS1X 3PQYA 4Z2GA 5JIWA 4FI9A 3BRGC 1PSKH 4TRPL 1CE6A 1ORSB 1FNLA 1TETL 4ZXOA 2SEBB 4PCTA 3L3HA 2JCCE 4GPNA 1F4YH 3SBWA 4KUCF 4MSWB 3P73A 4ZQKA 4CD6A 1CLXA 1SM3L 1DANU 3IFNL 4WU7B 1LE5B 2V38A 4Z7QF 3TJHD 5TDOB 5IIEA 3T0EA 1BQHB 5IOPA 3G5VB 5EUOB 1OCWH 5L2KA 2JEQA 5D8ZA 4X8JB 1S7XB 1P4BH 4LLWB 3UTSA 1I8MA 1UWGL 4QRPE 2P45B 3QDGA 4TVDA 4ZS6C 2NX5E 2B4CC 4KKCD 1UQYA 1MFBH 5FKAA 4KK5C 1KF9B 3LPPA 4XGZA 3VGAB 3CSPA 4LHUB 3V0VA 1F4WL 1QSEA 5DA4A 3AZTA 3EJYC 1PKQA 1WFUA 3TPUA 2DDUA 1EJ6A 5DVOA 4PJBA 2O5XH 5MEOA 2X1WL 1I8LC 4QCFA 1R87A 1TVNA 1ACYL 4NQSA 1AGFA 3VA6A 4JPVH 1FZMB 4X6BA 2LAGB 5IB4B 3T8XB 2V5RA 1IC4H 1OP9A 4JL2A 1TTUA 5D96B 4M48H 2E7CA