3K4AA

Crystal structure of selenomethionine substituted e. coli beta-glucuronidase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
605
structure length
597
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYVGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucuronidase
publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 140
structure length 597
sequence length 605
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k4aA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k4aA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k4aA03
4XUPA 2Z4QA 3U30B 3D18B 3L3IA 2ZOKB 3RIAF 2JFEX 3GMQB 4DWSD 3X14A 4MA8L 4M48H 3PHAA 3HLAA 3VFGH 4LKSA 1IARB 4U1GB 3QIUD 2VCAA 1BAFL 3UZQA 4TUFA 2EXOA 5DJYA 4KKAC 4M00A 3A67H 1I9JH 4F3FB 1EIBA 1Q1JL 4C4KO 4W4OA 5CBAB 5DHXB 3HRZB 4AJ0A 4NUGL 4Y1AB 1TIUA 4KMTH 1J18A 3OX8B 3V6FB 1ETZB 4X9GA 4JL1A 4HA4A 5TQ0H 2J7GA 1C7SA 4F58H 1IAMA 1N5AB 2FX9L 3A6BL 3VH8A 1JNJA 2W0FA 3C9NA 3LPGA 4YBQD 1PQZB 2VLLB 3J7HA 3R0NA 5D2NA 4KUCD 4Z5RA 1OW0C 3MRPB 1G9ML 4IRJA 2W3JA 3KPRB 4PJDE 3E3QE 3N04A 2P42B 3TTYA 3MRHA 3NJXA 4KK9D 3RUGB 4GPNA 3REWB 1ZT4A 1AGEA 3MREA 3H7BB 4PY8J 4GAYA 1IBGL 1N6VA 4FABH 4Y4FD 4Q6IB 1R0AL 4XH2A 3MRDB 3RX7A 2XY1A 4PJFF 3BI9X 4XB3A 2DM7A 5IWLC 1MCHA 4O9HL 1B3YA 5EOCL 5SWSE 5DEZA 3AICA 1J8HD 1JGVH 3N1AA 1XV8A 3IFLH 4P57A 3GJFB 4X7SL 4Q74A 4F8QA 1CE6A 4MXVF 1AXSA 3QUYD 5KVMC 1T1YA 3PWPA 4JZ5A 4EUPG 5FHAL 3TNNB 5ERWA 5IQ9B 1MJ7L 4GRMA 4OJFH 4YDLC 3VRJB 4UFJA 1ZJAA 4UQ9A 1UZ1A 1G84A 2GJ6D 1IC1A 4PJDA 3O2DH 2CETA 3LRSA 2NY6B 1YEIH 5FDWB 5FXCH 4P8XA 2MMXA 5C70A 1LEGB 1RU9H 4P8UA 3GSVB 5C8BB 4GMTL 5E5RB 4UQ3A 4C56E 3VD9A 1WJ3A 3CFBB 1Z9OA 4D0BB 4FI9A 1RIHL 1MXGA 3LKNB 1VPOH 4TTUA 5A8OA 1K8DB 1YEFH 1JNLH 1S7SB 4XPHH 4I3GA 4EZMA 1IE5A 1N3NB 5C0AD 1A47A 3WE6B 4Z7WF 3LKRA 3AZRA 2ZCKH 3QA3B 4HUXA 3VE0B 3LN4A 5M5DA 4G6FB 1UACL 2HJLB 3G5VA 1C5BL 1GSMA 4ZMAT 3KDMB 3Q6FA 4JM2F 5F9WB 2AJVH 4O5LH 2DIEA 5CGYD 3ALFA 4MHHG 4ACZA 3VCLA 1HHHA 2BY2A 4JY5L 1VGKA 5I1KL 1OD0A 4A3YA 3MLXH 3IF1A 3LKQA 1CGXA 3OZ9H 3BVNA 3O3DA 2W07A 5HYSG 3NCYP 4LEOB 3QQ3B 2AJYH 1K2DA 1B2YA 4E2OA 2A3BA 2BVOA 2ZUUA 1Z9SA 5F3HB 1I7ZA 2EDKA 5DTFB 4YAQB 2GFBA 3OMZA 4C56A 4Y19D 1GJIA 5JNYB 4QRUB 5BOPA 3L7FA 4J4PD 4TTDD 5JW3H 1ZANL 5L7XL 1A4KA 3NABH 3P0VL 5E8PA 3EUUA 1EAPB 1A7RH 1D9KD 3TN0A 4L3ED 3RWEB 5EBWA 4FG6C 1YN7A 1OSPH 2Z4FA 1UWIA 3U7WH 4FZEH 2PTTB 3L1OL 4U1LA 2GITA 2W63A 5GXBB 2WMGA 5I15H 4PRWA 1UWUA 3AS0A 4X6CF 1FLRH 1HXMA 5D2LE 2FJFA 3CFEB 4Y2OA 3N11A 4JFUA 2QADB 3EJYC 3CUPB 3ESUF 1N6QH 5D96B 2Y4SA 4PYGA 4EQ3A 1LG1A 1JZ4A 2O61B 12E8H 3A6OA 3P4NB 1KTDB 2EXYD 4M4RA 4W93A 3G5XB 1MCPL 2AJUL 3HAEG 2VZVA 1GPOL 2BY0A 4CU8A 3STZB 2HVJB 4X6FB 5AEAA 4Z6AT 2DSUA 5F9JA 5IQ7H 4U1HA 4X5WB 4RGMB 4P4KA 1VFBA 3VXTB 1A3QA 2Z4QB 4K3HA 4X6EA 3L3IB 2EBNA 3O6FD 3X14B 4XXCA 3HLAB 4KJWC 2DQJH 1W9SA 4P2QD 5D2LA 4KKCD 1FPTH 4L3AA 4WU5A 5DJYB 5I75C 3QB7C 4GLRI 5ABGA 2WBJA 1XMWA 3LMJL 5SWQA 1I8LA 3DUHA 4QNPE 5I76A 5D70H 4PR5A 5CSBA 5AZEH 2VH5H 4OZFH 3AS3A 3PHOA 4YFEA 5KSVA 4LU5L 3QISA 1QG3A 3ZDYF 4PBVC 5A6JA 1N0LA 3VH8B 4JRYD 3O3BA 4MDJA 1SMDA 3O8XD 2W9DL 1NUGA 2W0FB 3C9NB 4WFEE 5D2NB 1ISZA 3K4DA 4Z5RB 1KTRL 4GKSA 1TDQA 4HHAA 4IRJB 2OYKA 4LLYA 1HH6A 3ZYOA 3MRHB 5I1DA 2Z8RA 1UC6A 1DBML 1D5ZA 1ZT4B 1AGEB 3MREB 3SDDC 3SQBA 4YHYC 4GAYB 1P2CA 1QLEH 5F88A 4XH2B 3P0YH 3TTSA 2PXYC 4S0TD 3WXVH 3QWOA 4QXUH 3TWCL 3WO4C 1ACYL 2J8UE 3AIQA 5EOTA 4JG1H 2IANE 4UFIA 1X5JA 2XFFA 2YL5A 2XTJC 4P57B 1Q0XL 4YHKL 3FT4A 5JIKA 3CVHL 4EN3D 1CE6B 4W8LA 1AXSB 3CIHA 1T1YB 3PWPB 3BKMH 4NT6A 4HWEL 2ZX7A 5ERWB 4GRMB 5I30H 3ZDZE 1JXKA 1KV3A 4H0GA 4KK8D 4GO9A 3C6LC 3GGWA 1H3WM 3GHBL 4PJDB 3LRSB 3KLSA 4TVPH 4IMKC 1MW3A 4HA1A 2F61A 3MGOA 3JUYA 2W94A 2F54D 1BQUA 1A7OH 5C07D 1IT0A 4UQ3B 1EJ6A 3L5IA 1PZ5A 1OD8A 1NEZG 4FQXA 3TBYA 2VL5A 4GMSH 2YKLH 32C2A 3CVHB 2J8UA 2G41A 4HUNB 3SUSA 3OPZL 3HS0A 4KXZI 2IANA 3RKDD 1G7QA 1OQXA 3LKRB 4HUXB 3SDAA 4C58B 1K8IA 3LN4B 3G5VB 2YLAA 4PRDA 5FYJD 3I50H 2W9XA 3Q6FB 4XNUH 4PGZA 5EZOH 2D4DA 2DBJA 1QFHA 3BGMA 2WAAA 2W59A 4OKVA 1CDIA 1EK3A 4KTYA 2RV9A 4ACZB 3VCLB 3KYMA 1HHHB 4KY1L 4MLSA 4P3CH 1ZLVH 3WNNA 1VGKB 1JAEA 3IF1B 1JP5A 3ZSSA 3LKQB 4I18A 3BVNB 1NLBH 1S9WA 2QSTA 3MJ9H 3O3DB 2N4IA 1GOGA 4I0PC 4Y89A 5CD5D 25C8L 1K2DB 4ZY9A 4CUAA 3NPZB 2BVOB 1ZB5A 1I7ZB 3WDIA 2GDUA 2GFBB 2I5YL 4C56B 1W8NA 1MW2A 1D6VL 4N42A 5IHUL 2WMIA 3L7FB 4RZCA 1RK1A 1HE7A 1A4KB 4PRAA 5E8PB 4M1RA 1R3KA 3B4NA 3TN0B 5A2IH 2CRYA 1YECL 2DQUH 2WVTA 4X8XA 5EBWB 2M26A 3T65A 1YN7B 1TE1A 4JFHD 1KELH 2RFXA 4UIKH 1HINL 2GITB 4U1LB 5D7JD 1DLFL 5F1SA 2YMXH 1HXMB 2NXZB 3LS4H 2FJFB 3IAPA 4GAGL 3ZKNC 1B31A 4NF7A 5AUMA 1V0KA 1MFUA 4QB2A 2X1OA 3M8OL 3FJTA 5D7LD 1C12A 5E95B 3QRFM 3BP4A 4ZAKC 3NA4A 1SR0A 4UOW0 1WTLA 2D7TH 4LQRA 2H3NA 5J1TC 2XPKA 2R0LL 1YJDH 3QCVL 1XPWA 3NFSL 3MRIA 5AZ2H 5F9JB 4JHZA 1QRKA 4U1HB 4HGKC 4P4KB 1VFBB 3H9SE 5LCVL 4KRTA 4X6EB 3HFML 1F4XL 4UFLA 3CZKA 3MLYL 4NQSA 1Q9WA 4BFIA 1V7ML 1OD3A 3EMZA 1CR9H 4EUPA 5EOQL 4Z7VE 4PRBA 5D2LB 3FQNA 1OB1A 4WU5B 4QTHA 3WUZA 5HGDA 5EMYA 4U7MA 2CDOA 2WBJB 3I75A 5SWQB 1BPLB 4X5XA 5I76B 5ITBH 3GIZH 4PR5B 4ZFMA 1F4WH 4YN5A 2VTFA 1G1YA 3QHZH 2ITCA 3PHOB 5HHNA 2WP3T 5KSVB 4K7FA 4XPBL 4GKLA 5EFIA 2VDRL 4PRPD 4LHUG 1TJHH 2F5AH 3O3BB 4MDJB 4FNLH 2XG4A 1MFNA 3TT3H 2QBWA 5ALBL 4RFOL 4GKSB 4HHAB 3T3PE 3H9SA 5JXEC 3L95A 5C0ND 2AJXH 3TYFA 4LLYB 4K23L 3SDXA 7TAAA 1CI5A 5J8OA 1HH6B 2FHFA 1PPIA 5I1DB 5A1AA 5JMOA 1D5ZB 3T2NL 3WHE0 4Z7VA 3CMOL 5T3ZH 3RZWA 1OAYL 4GO6B 4JM4H 1P2CB 2ICEA 2CITA 5F88B 1W2PA 1YNTA 4MB5A 3QWOB 4JZJA 4Q9RL 2W95A 5HYSA 2WIMA 4HZAA 3GBLA 3BHBA 2CO6B 4OAWA 1UCBL 5EOTB 4WO4A 2Y8VA 1ZBCA 4JFQA 1JG9A 1MCBA 3QUZA 3S37L 1I8IA 2I9TA 3HI6H 3FT4B 4PG2A 5EULV 4JFZL 3TA3A 1E6XM 5C2BH 4NT6B 5M95B 1KJVA 1JPTL 3MRMA 5E2JA 2HT2D 3MOBL 3OAUL 4XHJC 5KSAD 4AIXA 3GGWB 1ESWA 3I2CL 3EDEA 4TXEA 2ZX9A 3MANA 1F4HA 4JGJA 1KCKA 1Z9LA 1IGJA 2NX5A 1UY0A 4UTBH 2DI8A 5LQBL 3A21A 3FAXA 2BMKA 4PJDF 3LN5A 3MGOB 4FQLH 4C83A 4DZBA 4Z2GA 3RTQC 5IKCA 3MXVH 2AXHA 3RU8H 1J0IA 2LTQC 1PZ5B 1ITXA 4TOYL 5CINH 3CUGA 5KVFL 4FQXB 1Z3GL 3TBYB 3UDWC 2VL5B 32C2B 1WFUA 2J8UB 4L3CA 5A3ID 4KK6D 3HS0B 5HVHC 2IANB 3QIUA 3FO1A 1G7QB 1IGIL 3K81A 1BREA 1GOOA 3SDAB 1K8IB 1WEJL 4HH8A 2N7AA 1YC8A 3VRIA 3VWJC 3WJJC 3ETBF 4DVRL 1G9NC 4PRDB 3HAEA 4Q6YA 2WPGA 3LH2H 1DDHA 3PWVA 1NMCC 2ARWA 1LILA 3BGMB 4OKVB 3I2HA 2XIBA 3LRGA 4K71B 4JDTL 3KYMB 2F53E 4WENB 2OTWA 7CGTA 4ZUTA 1X6LA 5IUSA 5I1LA 5L88H 3RIKA 2C7UA 3DRTA 2DQTH 2DWDA 2RQ8A 4I18B 1S9WB 4ZXBB 4EI5D 1KEGH 1SY6A 3MJ7A 3CXDL 3LMYA 1KIQA 4BQBA 4Y16C 15C8L 3S6CA 4ELKA 1OT1A 4G6KL 1HHIA 4AG4L 5DRWA 4WIWA 2WMIB 5A2KH 4RZCB 1RK1B 4JG0H 1H0GA 1S7QB 1UG9A 4G8GD 4PRAB 3X17A 1LO0L 5D1XD 1R3KB 2NY1D 4NPYB 1UYWL 3H0TA 3T65B 1XRVA 2V5DA 2X44D 3CZ8A 2RFXB 3SCMC 2YD1A 2DQIH 2HVKA 4L8DA 1GU3A 2CPUA 1PY4A 5CEZH 3MFFA 2DQHH 4BH8A 2QHRL 1QSEE 2YA0A 4F7PA 5T3XH 5ADOH 2F53A 5AUMB 2E6JA 1N59A 3IXTA 3KLAA 3DLQR 1I3RA 4X9YA 5BO1H 3S5LG 1INDH 2OYLA 1C12B 1FQ9C 4XMLH 3MRFA 3BP4B 4JRWA 3SBWA 5EC1A 4FN0A 1BEYH 2C4XA 1RJYA 2H3NB 4M29A 4NBZB 4MNGE 3MRIB 1JDDA 4Y7MA 5IFHH 1KN2L 4A44A 1DQLL 5C0IA 1P6AB 1YEHH 3IS0X 1NWRA 4PFEA 4NQSB 3BZEA 1Q9WB 1ZSDA 2DTML 2V9TA 4BFIB 4PUBL 2XFRA 1JBJA 4PCTA 2AJSL 4EUPB 2NMSA 4PRBB 4NO3A 1QSEA 5EIYB 2JIXA 1MF2L 4AD4A 4N0YL 2Q8AL 4DK3A 3FQNB 1OB1B 3IFPA 4QTHB 4J7RA 5HGDB 4QRQA 3AIEA 1WCBA 3E8UL 3I75B 1W1YA 2JLLA 4X5XB 4H8WH 1S78C 4I3SL 1QFWI 3JV6A 2VN7A 3U5YA 3GBNL 4U0RC 4UQ2A 2ITCB 4LPUA 4FFVC 4M7ZC 3A3HA 3AUVA 5HHNB 4XZWA 4K7FB 4X99A 5EFIB 1FBIH 3VGFA 2OLDA 1WBXA 5JR1H 4JN2A 4IOFC 4MNGA 3IKCA 5DVOA 1MFAH 4RCAA 2CXGA 1NUKA 1H41A 3V95A 4YO0A 3VGHA 3CU1A 3H9SB 5IB4A 3L95B 2WZPD 3O9NA 3TYFB 4P5KA 4XX1E 3SDXB 1S7UA 2VLJD 4OZFG 2V7NA 2NY4D 1EHLH 1DBKH 3MV7D 5DF0A 4APQD 2E0PA 1H9VA 4LIQL 4DFIA 4Z7VB 1LGVA 1SMAA 3EDFA 2ICEB 1VEOA 3D3VE 3QUMA 4NM8L 4ZXBA 5D71H 1CGTA 2EH7H 2YB7A 3BIKA 2BSTA 1YNTB 2ERJC 1E4LA 1QPPA 1BM3H 4WI7A 4JZJB 1EO8L 5HYSB 5GJTL 1IQDA 3BHBB 1K6QL 1F6FB 4OAWB 4WO4B 4HIXL 2P45B 4JFQB 4ZZ5A 1JNDA 3QUZB 4TUKH 4QNPF 3UC0H 1I8IB 2I9TB 4ZE5A 4P5TD 3CMJA 1KC5H 1PLGL 3LEYL 3TA3B 4GT7A 3HE7D 1KJVB 3MRMB 5IHLB 1CS6A 1OAQH 1FORH 4J1UA 2XYCA 3G6DH 2P7TA 5E56A 3W38A 3CFKA 4KROB 1CLYL 3DHJA 5FM8A 2CQVA 5C2UB 4MAZA 4I0KA 2EDOA 3ULUD 4LSRH 2R4RH 1EZVY 2GYSA 1IGJB 2NX5B 2EE3A 2J1AA 1S5IL 1IT9L 4XNXH 2BMKB 3LN5B 5IJKA 1WDRA 4C83B 4DZBB 3RFZC 3THCA 2OJEA 1UXZA 1JWMA 3BP7A 5IKCB 1VA9A 2B7DT 1GQPA 4JB9L 3D3VA 4Z0XA 1GQLA 1ZVHA 1SY6L 1W1TA 2BSRA 2ZUTA 4HBQA 4GZJA 5LA2A 3E1F1 4I77L 3QQ9C 3M7SA 1KEMH 1LP9E 3CLWA 1ULVA 4ZTOL 4L3CB 5HHMB 1EUUA 5GS2D 2JELL 3QIUB 1SMOA 3FO1B 2XVNA 2QSQA 1BYDA 3PDDA 4S11A 3O41A 5TDPA 2J8UF 3VRIB 1BSIA 4Z2HA 1UZ8A 3HAEB 3WIHH 4CKQA 4XVTL 3PWVB 1DDHB 1DR9A 3ALGA 1NANI 3MACL 1JZ6A 4AL8H 4XAKD 4KHTH 1U36A 4D3CL 5B39G 1OCQA 2OTWB 4ZUTB 5I1LB 2C7UB 3DRTB 2VZ1A 2DWDB 2CUMA 1SJHA 2A3HA 3MJ7B 3BDBA 1FH5H 1QOXA 2WAGA 1KIQB 2EDFA 4MA3A 1KLGA 3ILPA 4AQ1B 1YZZA 4ELKB 4MTVA 3BQUC 1HHIB 5DRWB 4R26H 1A7PL 3VXSE 3LHPH 3WH5A 3IIIA 3UTTE 1MCEA 1L0QA 4R8WL 2IAMC 4P5YA 1A1OA 1UH2A 1C08A 3S34H 3RZCA 3O45A 4KUZH 5LWYH 5E8OA 2YL8A 3RQ3A 3DVGA 3APGA 3H0TB 5I9QC 4LVNB 2CEQA 1F6AA 5GRJH 4X0KA 3QHOA 4U6TA 2IQ9H 2NT0A 3T1FA 5L9DH 2HVKB 3DXAD 1I9RL 4L8DB 3SEEA 1AFVL 2Y6SD 3BN3B 4G9DA 3W6LA 4LHUA 4D6FA 3MFFB 1QO3A 4OD1L 4XVSH 4BH8B 4C7FA 3T1WA 4C7DA 4F7PB 2I25N 4V1DD 2F53B 4AZHA 2IFGA 2IQAA 3CX5J 1N59B 3IXTB 3KLAB 2BERA 3CNKA 1I3RB 4AIUA 3W28A 1WWCA 1YEEL 4G3YL 1RPKA 3MRFB 2W9EH 1YY9C 1H5BA 1LWJA 1AJ7L 5EC1B 3GNMH 2VLKE 3VXSA 1RJYB 3OG4B 2V5MA 2YD9A 3UTTA 5CJXC 2DQFA 1RIUL 1MFEH 2R0ZL 1K4DA 3JSSA 3TOPA 3MLRH 5ILTL 5C0IB 4A2LA 4BELD 1US2A 2ZUNA 4M43H 2JJWA 2EDBA 3W6MA 1T83C 1QBLL 5JIIA 2KD7A 5T1LD 3BZEB 1ZSDB 4JHAL 4CD6A 3DHMA 3NA9L 5JQ6L 4P23C 5KANI 1LHZA 3IU4L 3GB7A 1QSEB 4NO3B 2JIXB 2BVTA 2JK5A 1A64A 1NGQH 3L5XL 3WFEH 1F90L 5I16A 3IFPB 1UD4A 3SCSA 1LO3L 4JFHE 4QRQB 3SGJC 1T7YA 5CJOL 1WCBB 2YN3A 3FFDA 1VACA 2VMFA 4Y5YC 1XYZA 1GGCH 4DEQA 3QUML 3DMMC 1NAKL 3JV6B 5KSBE 5CP3H 4UQ2B 4NQCA 4PN2A 1XSJA 1PIFA 2AEWA 2G2RA 3DETD 5IP4A 3BMVA 4X99B 2C4FT 2VLKA 2VR5A 1UR0A 2V2WA 1WBXB 5D7LE 4JN2B 5B21A 4MNGB 3O2DA 4FP8L 3IKCB 4FQJH 4YO0B 3BN9D 1RUML 2Z8SA 5IB4B 3BKJL 4P5KB 4X4ZA 4OCWH 1S7UB 5E8DL 1U2CA 2V7NB 3O3UN 3WNPA 4GJTB 3UTSE 3NTCL 1DQML 2AV1A 3WKNA 2PWDA 3GXIA 1HKIA 3QNZA 5CZXC 5DD5L 2BDNH 3W2DL 3QUMB 4KGLA 3BAIA 2DMBA 3AU1A 3BIKB 2A38A 2BSTB 5TF0A 4FQIL 4OF5A 5GS1C 3FQTA 5CPQA 4M93B 1IQDB 3DVIA 3G04A 3CDZB 4YEFA 5KSBA 2WZIA 5H2BA 5F7WC 2GJRA 3HMXL 1QRNE 2N7BA 1NL0L 3BX7C 1J1PH 2ZPKL 4QWWD 1WV7T 4HOWA 1KENL 4QT5A 5C92A 4J1UB 2P7TB 3H6JA 1ZA3A 1GOKA 3CFKB 4UTFA 3ALWA 3C87A 4OT1L 3STBA 1W8OA 1CICC 1M6OA 1AGBA 3T3PF 1QQDA 3UTSA 4NQEE 1QHOA 3U4EA 1ZGLM 2B1AH 2OJEB 2SEBA 1JWMB 3BP7B 4FXLA 3V4VH 1W32A 4TOQA 5JR2A 1I1CA 3D3VB 4Z0XB 5ACLA 1A14L 2BSRB 4DTGH 4NWUH 2DQEH 3QIWD 2R9HD 4NJAL 3S5LA 2J1KA 1TFVA 4XMPH 4RGOL 3L4YA 1FCCA 5HYJD 5J11C 1OWRM 3WDQA 3TJHC 4LMQI 2Q7NA 3O41B 5TDPB 3PZUA 1UZ8B 1QRNA 4XPTH 2WAHA 1A21A 3AMCA 3PF2A 3PZQA 1ZTXH 4M48L 1NP0A 3MA7A 4LNRA 1OD7A 1C8XA 3AMGA 3TFKC 2V7HA 4DUXA 5DDHA 2BY3A 4E41A 5CAYB 3A67L 2WQRA 3UPAA 4GW1A 1SJHB 4WIQA 1Z32X 2B5IB 5KJRH 3KE0A 1NCDH 4NQEA 2EZ0D 5FCUH 3QI9D 1HCVA 4K3DH 4MA3B 1KLGB 3ILPB 4KMTL 3T3MF 2DLHA 2Y7QA 1CDUA 2C26A 1CEOA 5GSRA 5TQ0L 5H94A 4QDQA 1XD1A 5CZKA 4F58L 4KUCF 1JHJA 1TA3A 1A1OB 4Z2IA 4PJEE 1C08B 1NGWA 3RZCB 3O45B 4ZO6A 1GQJA 5MERA 5E8OB 2A0LD 3DVGB 5D5ME 3N50A 1F6AB 2YK1H 4X0KB 1I1WA 3AY4A 5AD0A 5JOPE 3NBNA 4PRIE 3T1FB 4FOMA 4G9DB 1JGDA 1RFDH 2Y9RT 4LHUB 3AIBA 4MSWA 1J83A 1QO3B 1UQZA 3NSXA 1V0LA 1ULOA 2R1YA 1QR4A 1KR1A 3VXUD 2Q3AA 2IQAB 1T66C 1E0OB 5CSYA 1Z0NA 4OZFA 4PJIE 1IKFH 2UWEF 4XNMA 5H37H 2WWKT 4L0PA 3F4VA 3IETA 1JGVL 1H5BB 4S1DD 1ZLVK 3AFBA 3IFLL 3C5SA 1XZ0A 2H9GA 3VXSB 4BCEA 3UTTB 5EU7E 1HWGB 1KOAA 2DQFB 1K4DB 3B2UD 4XWOD 3FZUD 4G6AD 3GK8H 4OJFL 5TQ2H 1KXQA 2JJTC 4TVPE 4ZG1A 5D5MA 3FB8A 4R4NC 5BMFH 5E8NA 4NN7B 3O2DL 3S98A 3UTOA 3X13A 4PRIA 4Y8AA 1YEIL 4XMKH 1KB3A 4PB9H 1K3IA 3CHCA 2JK5B 4O58H 5D1ZC 5I8OH 3LQAL 5I16B 5JW4Q 1J1OL 2DKMA 1VPOL 3EMCA 3FFDB 1YEFL 1VACB 3ZKMD 3OG6B 3MLZL 3P77A 1T3FA 1U8OA 4XPHL 3WIFA 4U3HA 1Z9MA 4NQCB 3S8WA 2ZCKL 4YBLC 3WELA 2G2RB 4F15B 3BIAX 1HIML 5FUIA 4KDTC 2VLKB 3ETPA 2V2WB 4CRPA 1OINA 3GH5A 1WWBX 3FOLA 5A2BA 3M17A 3QWRA 2AJVL 3JWOC 4O5LL 5D72H 1OTSC 2CXKA 5F70A 3MLXL 1BVNP 2XA3A 5EZIH 3OZ9L 3NYDA 2AV1B 2E27H 3RVWD 1J88A 2ID4A 3DO3A 4M6AA 2YDRA 3QNZB 3WUBA 4HZLA 1L9NA 1JVKA 4NCC2 1V5JA 3AU1B 5B39A 5AYQA 3U46A 3LEIA 5MI0C 3IU3A 1FGNH 1RY7B 4NQDA 3FQTB 3G5YA 3G04B 3VIPA 1XNTA 1CCZA 3TBVA 3TPKA 1GVIA 5KSBB 4MS8C 5H2BB 2AJZB 3ZM8A 1A7RL 3FO0L 2QQJA 3UR8A 1ZK9A 2WINA 3OLDA 1A8JH 4UI2A 1OSPL 4FZEL 4NBXB 3TZVD 3T2PA 5I15L 3NIDE 4QT5B 3VFRA 3MJ9A 1FLRL 1GOWA 2R15A 2XZAH 4C4KT 1ZA3B 2P1YA 2ICWA 4WI4A 1M6OB 1AGBB 1K9EA 1QQDB 3DYPA 3UTSB 3U4EB 4OD2A 4EXKA 3VGGA 1O59A 2VVNA 4P2OA 2SEBB 3UAJD 1QACA 2IXUA 4NC1C 4UFKA 4F9DA 2B8OT 2J88H 3VDHA 3MZGB 3ZYJA 1IKNA 4MXQD 2YRZA 3S5LB 1UWTA 1BFTA 2YL9A 4S1QL 3UCQA 5IQ7L 5DJ8A 4YDKH 3RO8A 5IGXH 4IISA 4XPFL 1JZ2A 5E0QA 3TVMA 1EH9A 1QRNB 2X09A 3L7EA 1RZ7H 4RAVA 1FYTD 5DC4B 3MA7B 2AOSA 3SO5A 2E5EA 4LNRB 1YNKH 2DQJL 2BHZA 1AHWA 3CBWA 3HNBM 2LV4A 3OL2A 2V7HB 3L5JA 5DDHB 1FPTL 4E41B 4GW1B 4FQHA 5A6LA 2R2BA 4NQEB 1QNOA 3NRUA 1MNUH 3U48A 1EEQA 5D70L 4YPGA 5HHPA 3TTQA 2VH5L 2Y7QB 1DE4A 1A9BA 3ULUE 5GSRB 5E9DD 2W9LA 5H94B 4BA0A 1TA3B 4Z76A 2EO7A 3PL6A 1NGWB 2J6EL 2XG5A 5MERB 2A83A 1CF8L 1LP9F 5A2LH 4LRNL 5T3ZE 5AD0B 1C90A 2FZ3A 2MNUA 4QHKI 4N0CC 3RGVD 1JGDB 5ICZA 5IFAH 4MSWB 9CGTA 3O6LL 3ARED 2R1YB 3RY6C 4K3GA 1MY7A 1QLEL 5T5NG 3EYQC 3K1DA 4P5TA 2H2SD 3P0YL 5EC2A 5SWZD 4OZFB 4OLUL 4XNMB 3WXVL 5DMGC 3I97A 3WD2A 1RAMA 4QXUL 3IETB 2C7FA 3B5HA 3PXHA 4JG1L 1ZS8A 3QUXC 3EO0A 5CUSH 1KXVA 3OXRA 4W6XB 3C5SB 1XZ0B 5FUCE 3WMBA 3UYPA 1H3UA 2H9GB 1LJYA 5JUEH 2V3EA 1CZTA 4TNWK 3CSPA 1QFPA 3OKOA 3BKML 2DICA 2HFFA 5GS3A 4KKAD 2IBGA 5I30L 3RGHA 2NY2C 4YHOH 4LNVA 5D5MB 3PV7A 3FB8B 5E8NB 2V3DA 5EJ1B 2ORZA 2WC4A 4XC3H 4G80A 3X13B 4PRIB 4V2XA 4PLOB 4RMUA 4A3HA 2CBJA 1A7OL 3S7GA 2J79A 3CUHA 2QMJA 2QMKA 3O2WH 3FXYA 3VIIA 3W24A 1RUKH 4WTWA 1NMAL 2C4FU 2QJDA 4GMSL 3P77B 2YKLL 1T3FB 1U8OB 4J12A 3ULVD 4M1GH 3WIFB 4WJXA 1HKLH 2HISA 2VUOA 2QQNL 4D1JA 5SX5H 1UR8A 2P47B 3I50L 3FOLB 4XNUL 3M17B 5EZOL 1X6NA 3ZE2F 2R69H 5EIQA 1DWJM 2UZIL 5G05L 2YL6A 1NLBL 3IGAA 4EOWH 4LOUC 4OCSL 1UKQA 5E70A 1TMCB 3OEBA 4LARH 4OF3A 4HZLB 4MVBD 4WI3A 4B53A 2D03H 3AMKA 5B39B 3U46B 5IHBA 3IU3B 2JF7A 4NQDB 5JDSA 1UKOA 1MCWW 5GGTH 2VZTA 1WF5A 3G5YB 3TBVB 5JXJA 2G3IA 2DQUL 2WINB 2JE8A 4NNPH 2UVEA 1KB5H 1KELL 5T3XE 3KLHC 4UIKL 1MQQA 2A3AA 2FR4A 1XGPA 4WHDA 3BRDA 5B8CC 4BFEA 4J27A 1LL4A 4XBEH 3VFRB 3INUL 3LS4L 1UXWA 3SDCA 2ICWB 3TYGH 1JAKA 3MUY1 3S3JA 1IGFL 4GQQA 3ELAT 1J86A 3G9AB 3D5HA 2CCRA 3SCPA 1M7DA 4K9EC 5DA4A 3QXAA 4RMWA 4OD2B 2NTSP 4P2OB 1JF1A 5A2AA 2EDWA 3NQHA 2VRQA 4HKBA 5FKYA 2PWHA 3VIKA 5I66A 3VD7A 4CU9A 4EKXA 4W8AA 4J2XA 2J7DA 4HIJA 1H0DA 2X4SA 4MCZA 5DK2A 5AZ2L 2ZCLH 2DL9A 4FQ2H 5DJ8B 2R29H 3ARBD 5F7KC 2E7LA 1MAMH 1OVZA 2X89D 3TVMB 2PN5A 5MEQA 3MLUL 5ANME 4LQ1A 2YD5A 1J11A 1EO7A 3L7EB 4BK5A 4RAVB 3BE1L 4PMXA 5MENE 1JU3A 1WTGT 1HKKA 1P53A 1AHWB 5MHSE 5I74C 2OP4H 1B9ZA 2VDQH 1PZ2A 4WFGD 4LDEB 4GW4A 4FQHB 2FB4H 2R2BB 3EYUH 5EU6E 3RVUC 5CLWA 2VMCA 1U33A 4P7QA 4QLRA 5ITBL 3GIZL 1MHHA 1F4WL 4YPGB 5HHPB 5D93C 5JW4N 2HJKA 4XB7A 3QHZL 5EIVA 4CDGC 5I73B 4E4PA 1DE4B 1A9BB 5E0FA 5CJ5A 1H4PA 2CK0H 4U1JA 1MLCA 3HZKA 1TJHL 4ODUA 2DSWA 5FUOL 2F5AL 4Z76B 5A2CA 2VO5A 3PL6B 1F5WA 5EIIA 1PFCA 2A83B 1EJOH 3DJ9A 3V0VA 5FM5M 1MFBH 2YLLA 3OKYA 3ZJ6A 5ANMA 2V17H 2X10A 5KAQF 1NCBH 2FZ3B 5ICZB 4B9ZA 2EDYA 5MENA 5GS0C 2J8OA 5D7IE 3PQYD 5T3ZL 1JGUL 2WMFA 4JM4L 2DIAA 2GQHA 5EN2A 5I71B 4D9RE 1V3HA 3C09C 5EBGA 2V5CA 1X5HA 4P5TB 2ZWZA 2NLJA 5EC2B 5HSFA 1WBZA 1ZLUK 5EU6A 3CK0L 4ZFOA 3I2FA 5BZDA 1ZS8B 1FN4A 3EO0B 3WFHA 2DCKA 2W0PA 3H8NA 2NCMA 3AHZA 3OXRB 1IAKA 4ODHH 3UESA 2RJMA 5LA0A 3HI6L 3BYYA 1O8SA 1VHPA 3PJSA 3IFOA 3K80A 2DM2A 5C2BL 3OKOB 1TJGL 3O4OC 5F7DA 3ROOA 3LPPA 2HFFB 5H37G 3U4BL 3FB6A 1B3VA 4PTVA 1T2JA 4UMGA 2F19L 3KL3A 4GG8A 3ZE1F 2P4AB 4PJEF 5A8NA 1XCTA 4G80B 3FOMA 5D4YA 1FVEA 4UTBL 1ORSA 2WABA 1JE6A 2VR4A 4NQVA 4UCFA 5D7IA 3MXVL 3DHPA 2VRJA 3RU8L 1WFNA 5CINL 5CD3A 2KL6A 4H25A 2BSED 2P8PA 1AVAA 4PMNA 5T1MA 2CIPA 1WAAF 3GTNA 4PJIF 2ADGA 4PRHE 3OKLA 1RUPH 3VXUE 4WW1A 5BV7L 5IROA 1OGAD 3KVQA 4ZUSA 2CPCA 3LH2L 4NNYA 4YXLH 4NHUA 5C08D 5IW1A 1LWHA 1V3LA 4ERSL 1U41A 4L4JA 1V6VA 3DX6A 1IZJA 4OMDA 5J57B 2PXYD 5DC9B 3C60A 4GRWF 4PRNA 4YUEH 2ESVA 5JHDD 1A1MA 5L88L 2X0YA 4AIEA 1C93A 4XCFH 2DQTL 3CH8A 4GBXC 1KEGL 3IGAB 1G9NH 1CT8A 3V8CA 4UOZA 1IC7H 1DQDH 2ZG3A 3MLWH 4P46A 4OCNC 4ORZC 2FO1A 4P7LA 2F5BH 2QV4A 5JDSB 5F9OH 4JG0L 2V2XA 2X70A 1GONA 3C6LD 4W5UA 1A02N 3WIHA 1W9XA 5GGVH 4PRHA 3NIYA 2E9BA 2R23A 3KHOA 2H1PL 4A41A 5T5FH 4LLUA 3BAJA 4L4VD 1CPUA 2VDNH 1Q6FA 2DQIL 4ZTPH 1XGPB 2FR4B 3PZNA 4IDJL 4O2FA 5CEZL 4WNQA 3PDGA 2J25A 1UXWB 1ZXQA 3SDCB 5T3XL 5ADOL 5FKPA 5HHQA 5DO2D 3SKNA 2D20A 1M7DB 2V5TA 5BO1L 3N1PC 3QXAB 1BBDH 4NRRA 2CJUH 1A6PA 4DW2H 1UWGL 1JF1B 1CFVH 5GRVL 3AIUA 3QDMD 5IMMA 2K3TA 5HVGB 4S2SA 4HKBB 5DD1H 2CR3A 5C0JA 2ATKA 5I66B 1ECEA 2Y25A 1EQCA 3IDXL 2Y64A 4HIJB 1H0DB 2X4SB 1CVSC 5DK2B 3B8YA 3ZYIA 3RVXD 5IFHL 4L1HA 3EOYG 4I0PD 5BRZD 2ORXA 1YEHL 3WKMH 4K94L 5MEQB 4CL7A 1UQSA 4LKCA 3CFJA 1B3JA 3CQOA 4I3RH 5IYYA 1A3HA 2VYRE 5CZVH 3R4DA 4ESKA 4XPGH 1A6WH 3LS5H 3NIDF 2KZ1B 4GW4B 1TTGA 4OI7A 1LK3L 3UXFA 4LVHC 3RDTD 3AHYA 4HIHB 4H8WL 4HS3A 1MHHB 2AV7A 3THMH 1LDPH 3MODL 2HJKB 3V6OC 1LEIA 3MZTA 2VQ1A 1DCLA 3QXVA 2BRQA 4DM1A 5FGBA 2VR9A 1MLCB 4U1JB 4DWSC 3HZKB 1JYVA 4P2RD 4ODUB 1T03H 2A77H 5JR1L 5DR5H 2CRMA 2NY5C 4G5ZH 1MFAL 5EIIB 4UT7L 3L5WA 4QTIH 4HS6A 5DHVH 4X9BA 3V0VB 4IRSC 4L29A 4BZ2H 3UR7A 4PJXF 5ANMB 5FYKL 1V08A 1DBKL 4ZAKD 3PZVA 1NBZA 2C3GA 4JANA 5MENB 1W0NA 4MAYC 1XSIA 3HCVA 1GNYA 5EN2B 2EYTA 3KPMA 4MHHI 2XVGA 5CP3A 1I1AA 2NLJB 3RKPA 5TE6H 1WBZB 5EU6B 4YJZL 1FYTE 4PSPA 3LZFH 4ZFOB 3REVA 5BZDB 1FN4B 4YBQC 4W68A 3WFHB 3C5ZD 1C16A 3V4PH 2F8QA 4TUKL 2BXYA 1FIGH 3UC0L 1IAKB 3P3YA 1KC5L 1NAMH 3UJJH 4JKKA 3PJSB 4WEBH 3IFOB 4KK9C 1BX2A 2C1PA 3IXAA 5F7DB 3ROOB 3MNVA 2B2XH 3ULUF 4LPVA 1V0NA 2M1KA 1OAQL 3FB6B 1FORL 1OCWL 4RISL 3K2MC 3G6DL 4RX4A 4LXFA 2A2QT 4GG8B 1OWQA 4KPHH 3FAWA 4PJ5D 4Y4FC 1XCTB 2R4RL 2B4CC 5E9DE 3KPTA 3FOMB 2BS9A 4XP5L 5C0DA 2ZP0T 1FVEB 1QVOA 1CGVA 1ORSB 1JFQH 3VU2A 4NQVB 5D7IB 1WO2A 1FAIH 4HC1H 1KLUA 4YZFF 4DK6A 3S6TA 1QSZA 4LRIC 5CD3B 4H25B 1TVDA 2P8PB 3QUYC 2JJSA 1KEML 1XH1A 4KKLD 4B3KA 5T1MB 1OAUH 1TPXB 1TZGH 2ADGB 3OKLB 4WW1B 3WEOA 5L6YH 4AK1A 2AK4A 3WIHL 4MXWL 2JF1A 4ZUSB 4LLAA 4NNYB 2V3GA 4Z2KA 2PF0A 1WFTA 2ARJQ 4NHUB 5IW1B 5FO8A 2HLEA 2CIIA 3DX6B 4YGVA 2OR7A 4MA1C 3C60B 4PRNB 5DMIH 2ESVB 3U0WH 2L0DA 1A1MB 4RGND 5E9DA 3LE0A 4J3XA 3D6GA 1CT8B 2E3VA 5CYYA 2Z92A 3CDFA 5DVMA 1UYYA 4P46B 3U7YH 4M3JA 3VJ6A 3BC9A 1YPZF 4WWKD 5L0QC 3LHPL 3BD3A 4U0QB 1KYOJ 2A6JA 2V2XB 3H3KA 2X70B 4C54A 3S34L 1KR0A 2UV3A 1T7ZA 4ODXA 4KUZL 5LWYL 4PRHB 4YC2C 1IC5H 1PKQE 4PJ8A 1GJWA 2R23B 3IB4A 2BOCA 4IIQA 5DZNA 2YJQA 2ZNWA 4LLUB 5GRJL 2IQ9L 3FB5A 4JHOA 2E32A 3EZJB 1D2KA 4O2FB 4WNQB 3RY5A 4XVSL 1EFXD 2OLHA 2Q1EA 4KQ4L 5E99H 5IB2A 5FKPB 4MQSB 4Y5VC 1HP5A 5HHQB 4MZ3A 3D39D 3SKNB 4ZPVA 2VB5A 1DUZA 6FABL 4J4PC 1FNEA 1FE8H 4K55A 1KCUH 5IMMB 2OS7A 4R97B 2E9IA 1PDKA 4S2SB 1OWWA 4HS8L 3GNML 2ATKB 5C0JB 1DEDA 4Z7UE 2ZOXA 2FJGA 2DI9A 1MFEL 1KGCE 5E03A 3VGAC 3MLRL 4K7PH 4OCRH 2J7HA 1PKQA 2GSGA 4F9JA 2YSSA 4M43L 3S9DB 4Y16D 1UQSB 4LKCB 3CFJB 1LE5A 1DSFH 4OBRA 1E56A 2G3MA 3M1BA 4P0DA 4JPIA 1MCKA 1OW0A 1UB5A 1BG4A 3OJVC 2WW5A 4YDIH 1NGQL 3WFEL 1V7NH 3SUTA 1W9DM 5TDNA 1VFFA 4J3UA 4Z0BH 4UQCA 4W89A 3D87B 8FABA 4PYHA 1GGCL 4HS3B 4BJLA 4OTXH 2AV7B 3FHQA 3Q48A 2CNCA 3SCMD 1LEIB 2NY3D 2RIKA 2VQ1B 3GHEH 4JKLA 5CGTA 5IWLA 2NY7L 2XIIA 1I1FA 2ILLA 3GSUA 3DX8A 3QIBC 3O6FC 4XC1H 4Z7UA 4JO1H 4JLRA 5E7BA 3WBEA 2CLZA 4MADA 5IR1A 3FNDA 1DBBH 2O92A 2EDNA 3L5WB 5J0BA 4HS6B 4KKCC 5JIPA 4K7PX 3N9GH 4HX1A 4W50A 3PP4L 4L29B 4ZFGL 3PWJA 3VINA 3H42H 4MQ7A 4WSKA 1A3RH 1F3RB 4QDSA 1NBZB 4JANB 1CENA 4Y4KA 2R4SL 2BDNL 3HCVB 1U8HA 2WVUA 3SKUD 2EYTB 4OUOA 2J1EA 4XAWH 3KPMB 3V52H 3CZFA 1I1AB 1MEXL 4F8TA 5CSGA 1V6WA 2ZE0A 1C1EH 3O8XC 1GXEA 3REVB 4OFVA 3VXRD 4CUCA 5GZNC 3OXSA 4GXUN 1C16B 2Z31D 1KCSH 3VFMA 3VO0A 5A8QA 3WS6C 4AD2A 1J1PL 3QRGH 1BX2B 2C1PB 1I7TA 3IXAB 5T33H 2PYEA 1V03A 3ARYA 1U3HC 3MNVB 5HI5D 3WDHA 5I6XC 3WF3A 4I0CC 1JUFA 5D8WA 1JWSA 1JMXA 4F37K 5IFPA 1E6JH 3BPLC 4I9WD 3GSNH 3F5KA 4ZS6D 2DJ4A 3QO0A 4A4AA 1QSFD 5C0DB 4CCCA 1QVOB 4YHZH 2YEZA 5BW7C 2C8NA 2B1AL 3V4VL 1MJ8L 1KLUB 5FYLL 1SM3H 2X89A 3D9AL 4IOFD 3VDCA 4DTGL 4EN3C 3OAZH 4NWUL 4GG6E 4KRLB 1IVLA 3EYSL 1S7WA 3BKYH 3NCMA 3U9UA 4XMPL 4TSBH 1BD2E 3PQYE 3KJ4C 3VFNA 4XP4L 2BCKA 4TUOA 2D9CA 1BZ9A 4AH2A 4XPTL 2AK4B 3HR6A 5GIRA 5DFTA 3IDYB 2OR9H 4LLVA 2J22A 1ZTXL 3IRZA 3ZJ7A 2PKDA 1U95A 5FO8B 4PJ9C 4JFXA 2CIIB 4YGVB 4BKLA 3PTQA 3OJMB 4AISA 3VNZA 1FG2A 5DUML 5HGHA 2QF8A 5BYWA 5E2VH 4OGZA 5E9DB 1F6LL 1KCLA 5HD8C 1BG9A 4PMRA 5F7EH 5KJRL 1FC2D 5DFVD 1E6RA 5FCUL 2Z92B 1ZT7A 3RKDC 1D7FA 1G94A 4PPTA 5IVZA 4FLSA 5TE7H 3VJ6B 4H26A 1BOGA 1A5FL 3FRUA 4GG6A 2A6JB 3P4LA 5FEBA 1U8LA 4LPWA 1Q6EA 1JZ7A 2NXYB 1BD2A 4ODXB 3JV0A 3PQYA 5CSZA 2VZRA 2QPSA 2XJ7A 2APWA 4PJ8B 1XT5A 2BOCB 4IIQB 2YK1L 1N7MH 4CMHC 2B20A 3FB5B 4WCYH 5CD5C 1FRGH 1AY1L 1RFDL 4JHBA 1KXTA 4MJ6A 4RBPK 1ISXA 3KHQA 5IB2B 5I1JH 3O9WA 5SX5K 2PQSA 3IANA 1QBAA 3TH3T 4OKDA 4ZPVB 1CFTA 1DUZB 4AIOA 1OGAE 4DKFH 1FNEB 3W27A 4JPVH 5ID0A 3NDYA 2ATPA 2HYMA 2ZWYA 1NARA 2D9QB 1BJ1J 5JHDE 1XH0A 5JPNA 5DT5A 4YK4C 4QCFA 3KXFE 2WNWA 3IFNL 5D7JC 1HVXA 2FJGB 2XTJE 1FHGA 1FSKC 5TQ2L 3N1MC 1PKQB 2GSGB 2JB5H 1KSRA 2YSSB 3K4ZA 3U30C 1I7RA 2DI7A 1LE5B 3HI5L 3M1BB 1ZWIA 4P48A 4XMKL 3KPLA 4JPIB 4BZYA 1MW1A 3BSZL 3BQUD 1UB5B 1UJ3A 2NTFA 4WRLA 4D71A 4Z78A 4O58L 5I8OL 2IAMD 2JF6A 1ZVYA 5TDNB 4XZBA 4R2GB 1OGGA 3T0VA 3SDDA 8FABB 1BGXL 5KTEH 4B15A 1VIWA 5HDLA 5F93C 5KZCB 3OF6D 2WXDM 4OZHE 5A8PA 1I1FB 1Q6GA 4RE3A 3W0WE 3GSUB 2MQCA 3KXFA 3DX8B 1UMHA 4Z7UB 4JLRB 1KQYA 2CLZB 4AT6A 5IR1B 3ZR6A 4LPTA 1MVYA 5D72L 3ZQ9A 1L7TH 2DBLH 4HMDA 3EYVA 1ZT1A 3QDME 5F96H 4HX1B 1CTOA 3VFVA 3F7PC 2FX7H 1YYMH 4OLVH 1ZMYA 4ATDA 4HJ0D 3JTTA 3PWJB 5EZIL 1YY9D 4JGUA 4MQ7B 4QPWA 3QDJE 4Y4KB 1EOKA 1FVCA 3TGXA 5FYKD 3JWOH 2RGSA 1MRFL 1U8HB 4TVCA 3U7VA 3LRHA 3GKWH 3CZFB 4Q6IC 5IT2L 3SDYH 3UJIH 2Q20A 5CCKH 4PLNC 3BDXA 1D7PM 5A6BD 3HE6D 1FGNL 4L5FH 4BF7A 3F5LA 2HJFA 5I1EH 2WBGA 4WFHE 3WUGA 1AQ0A 1GYAA 3ZTJH 4AEIL 3OXSB 3ZDXF 4OZHA 1DL7H 5C0NC 1AGFA 1HF6A 3OLGA 1TCRA 4QF1A 3TO2A 3VFMB 3W0WA 1BQLH 2HT3D 1OQOA 5KZ6A 3GBML 1I7TB 1GHFL 3SGKC 2PYEB 1E4WH 4R4BA 1P4BL 2W62A 1JUFB 4UZSA 1JWSB 2XZAL 3QDMA 4I2XA 2O5XL 4IMLA 3QO0B 4KQ3L 1KWGA 4F9PC 3QDJA 4ORGA 2YEZB 1OAZH 4YH6A 1F3DJ 5FECA 3MSDA 2ZJSL 4UR9A 1OLLA 3BYTA 5GGTA 1IEAA 4B3LA 2J88L 3NGBC 4U7KA 3NJVA 1T6VN 1XGRA 1JHKH 5M03A 1S7WB 3CVIH 1KB5A 3O11A 3U9UB 2HT2C 2CDGA 4YDKL 3DARA 2FECL 3UTZA 5IGXL 5KSAC 3VFNB 1F11A 2BCKB 2COQA 4TUOB 3VA2C 7FABH 5E9AA 1BZ9B 4ZDHA 4AH2B 5CZXD 5GIRB 3HNMA 1N26A 4LLVB 1WISA 3LPOA 1U95B 1YNKL 4D0CA 4JFXB 4BKLB 1FG2B 5HGHB 4M7KH 1IEBA 2V9RA 3H7LA 3QG7L 4FFZL 4XI5C 4W8JA 1MNUL 1NFDE 4TPRH 3TJEH 3HMCA 5A3IC 4KK6C 1ZT7B 3FO9A 3VG9C 5IVZB 3ARFD 3KPNA 4XZUG 2A6KA 4H26B 1BOGB 1Q9LA 3FRUB 2FCBA 4GG6B 5LJYH 2H26A 3U9PL 3F7RA 3Q6GH 2QLVB 4ZAKA 1U8LB 1JD9A 2Y6KA 1CICD 1BD2B 1GAFH 3PQYB 5CSZB 5I17A 1JMZA 2UWFA 2R2CA 1M01A 4WGWB 4IRZL 1D6EA 2P8MA 2RAMA 2CKNA 2ESCA 2PCPA 1DWIM 4U4BA 2APXA 4ODVH 5HTSA 5IFAL 1KXTB 2ZICA 4MJ6B 2XKNA 3E6HA 1B2WH 3ECQA 2Q8BH 3BEWA 1U8IA 2I9LA 3DPBA 3O9WB 3QR2A 3GMMA 1BZ7A 1JDCA 3UYRH 1CFTB 2EH8H 3TJHD 1NFDA 5ID0B 1HJVA 4GI6A 5I75B 2MHAA 1PSKL 3QNYA 2ATPB 1T0MA 5D1XC 2NY1C 4Z7NE 3AC0A 5CUSL 2YFZA 4O4YH 4W86A 3KYOA 4BK4A 4AD1A 4JR9L 1TTUA 1RJZA 3UBXA 1NDMB 1X5YA 1UM5H 5JUEL 1KJ3H 3TBTA 3PUHA 5FHBH 4RGMC 2VDLH 4YHOL 1WZ1L 2X4RA 1I7RB 4XC3L 2ZUVA 1ZWIB 3KPLB 5JXEA 3WF4A 4XT1C 1UJ3B 2NTFB 3BDYH 4Z78B 1LF1A 1EHXA 1OM0A 4WSJA 3TTOA 3ULVF 5LA1A 5M94B 3O2WL 4OCYH 4EIZC 4W4OC 4OFPA 3SDDB 5FYJU 5JHLH 4YHYB 1EAJA 5B4MC 2IALA 1K5NA 4GQ9H 4M1GL 1NOFA 1HKLL 3MBXH 4XNZC 5DURD 3KXFB 4D6EA 4CVUA 3FW6A 5C1MB 4AT6B 4X4XA 5I0DA 2EO9A 1HZHH 2XTJB 1T66D 4NWTH 2R69L 5D2NC 3EYVB 1ZT1B 4Z7UF 1PY9A 5C7XH 5DHYA 3VFVB 2EEAA 3VX0A 5L2KD 4G7YH 1C92A 3JTTB 1J5OH 3V7AG 1U93A 5LG1A 3CUFA 4EOWL 1SG3A 1MCRA 1FVCB 4LARL 2VL4A 3NCEB 3VFWA 2XVPA 2NNAA 2FEDD 2D03L 3CLEL 4QGYA 3DYMA 4UT9L 5LBSH 2Q6WA 4PTMA 3G6JE 2R7EB 2AK1H 2AVGA 2WC7A 1KN4H 4MDOA 4GSDL 4OFYA 3RTQA 1RZKC 2IPUG 2HJFB 5GGTL 4R4ND 4NYLA 3UERA 3CCHA 3ARZA 4P2CG 4OZHB 1AGFB 3RNQA 4AMKH 1TCRB 3UDWA 3CX2A 4NNPL 3CIQA 4QF1B 3TO2B 4RE2A 3W0WB 5IJVA 1KB5L 3HG1D 2J8GA 2I60H 5I19H 3IAQA 4UAPA 4TNVF 3C8DA 1TQCB 1MCOL 2PI6A 4QFUA 4L4TD 4M1DL 4APQC 2DD8H 4OCMC 4R4BB 3VWJA 3WJJA 1S9VA 3WNOA 5LXGH 3QDMB 2QQLL 3BD4A 3TYGL 2ICWI 1E72M 2HTKD 4Z2LA 4I2XB 3MUIA 5F7HA 4IMLB 2RGMA 5AG9A 2VXQH 3AXIA 3QDJB 1EQPA 3A4AA 4ORGB 5FECB 4LCWA 3RAJL 2EE9A 1YUHA 4V2CB 3L4XA 3QHMA 4TSCH 3L3OA 3SKMA 3IDNA 1EOMA 1IEAB 3G6JA 5B4NA 3WUWG 3QR3A 4YFDB 3RP1A 4N68A 3SE3C 5FYLD 1XGRB 5HHXH 4RMTA 4K9EH 3HE7C 1KB5B 1LO2H 1QBMH 3O11B 4ISVA 3CDGA 3O6KH 1E3ZA 2CDGB 4FQ2L 2R29L 3KYAA 3RIAK 3UTZB 1GW1A 4UINL 1W91A 1F11B 1MAML 2CUHA 35C8H 4ZDHB 4ETQA 3OAYK 1E5NA 4GO8A 5E00A 2X4OA 3CSGA 4OIIH 5AYUL 4D0CB 3ARXA 3SCMA 5ICXA 1GOQA 2XFYA 2OP4L 4OYUA 1QUNA 1IEBB 2CDPA 2VC2L 2VDQL 1NUDA 3EO1A 1AGCA 3GMNA 1VENA 3VGDA 3D3AA 3EYUL 1RHFA 5J7CC 4R4FL 2DAVA 4LASH 2DCJA 4KZDH 2DLFH 1EMTH 3FO9B 1P8JA 2W60A 5GRZA 1P9MA 3KPNB 3UX9B 5JQHC 2A6KB 2GDVA 1QNZH 2IG2L 5KS9E 4I4WB 1IC4H 1Q9LB 3HZMA 1QSFE 2H26B 3DI2B 3OKDA 4ZAKB 3VGEA 4LYRA 2VDOH 1MQPA 3MMWA 4LP4A 3UNPA 5I17B 4GG6F 1EJOL 1IGML 1CZ8H 1H15A 1LK2A 2F15A 1D6EB 2P8MB 4WV1C 3IJYA 4JCLA 2PCPB 2D7MA 3QEHA 5HYIA 2CIKA 1NCBL 4ATWA 4JFFD 5CJQH 2XKNB 4M61A 3WXWH 3E6HB 1B4JH 2GIYA 1U8IB 2I9LB 3BEWB 3GMMB 1BZ7B 1NKOA 4HEME 1QZ1A 1H1NA 2D0FA 1NFDB 4Z95H 2MHAB 2PYFA 1UYQA 3QNYB 2MQ0A 1T0MB 3AOFA 3EOTH 4CMMA 5GS0H 4PMYA 3O2LA 4FTVD 4UZUA 1GCFA 5FM5O 2BJMH 2ITDA 3KYOB 4ODHL 4NFBA 5KS9A 1RJZB 3UBXB 1D5IH 1RK0A 3W25A 3JV5A 1QSFA 3I6KA 2EPLX 2Y6SC 3TBTB 5C0FA 4M1CC 3K77A 2JJVA 3RWGA 5CBEA 4P4KC 1HIZA 3S35H 1J01A 1Q0YH 2X4RB 5IMKA 4CVWA 4UILL 3Q1SL 4H8HA 3LIZH 3PHQA 4GUPA 43CAA 5KSUA 2WZ8A 1H09A 5I1GH 4IPLA 1UR1A 1CXIA 4P08A 2BHYA 3GRWH 4B5EA 5L2JA 1L7IH 3HNTH 2LQRA 4ZUUA 5C09E 4ONFH 4PJFE 5IV2A 3F58H 2NR6C 2MPAH 3SJVE 1NAMA 1K5NB 2IALB 1QHZA 1MHCA 3G6MA 3CDYA 2GTWA 1UH3A 4N0CD 3VWKC 5H35A 4XWGH 4YFLF 1FFQA 1YNLH 1T7WA 2TAAA 5DXWA 4MXVE 4YXLL 4X4XB 3RHWF 4D8MA 3GO1H 5BWFA 1KFAH 1FLTX 1U8PA 4LAJH 4UV4H 4ODSL 4YUEL 5CHNA 5DHYB 3S35X 3WLBA 1CU4H 4ET7A 4N0UE 4HFWA 4PY7A 2UY4A 1A2YA 3QPQD 4HC1A 4X9FA 5HI4D 1RURH 4YIQA 3QUXD 2EDJA 1U93B 1CNVA 1G9NL 4XCCH 1BWWA 2GEEA 5C7GA 3KYNA 3HC3L 1DQDL 5GSVA 3OZPA 3VFWB 2NNAB 2E9LA 3L3JA 2WVVA 4D72A 3MLWL 2Q6WB 1Q6CA 4EK7A 3DETC 1V3JA 2YS4A 5C09A 4NO2A 3RTQB 4PJFA 4X8JA 5F9OL 3HZVA 4UBDC 4WWID 5DSCA 1NQ6A 4NYLB 3C8KA 1V02A 3CCHB 4DQOH 3SJVA 2LTQB 1CGWA 1JNNH 3ARDD 1RI8A 4I5BA 4EJ1C 3HA0A 3BN9C 1BWMA 5HHOE 4Z7WE 1F02I 3AXLA 2AQ2A 3RNQB 2H32H 4LCYA 1PEWA 1QYGH 5T5FL 5IJVB 5IHZA 4OZHF 4ZTPL 3C8XA 1N4XH 1H8OA 3HUJE 3VWJB 5C3LD 1GUIA 1S9VB 4KI5M 3OR6A 1C91A 3CHEA 2VAJA 1CX1A 4D0QA 1NMCB 3ZTJG 4O2EA 2R1XA 4N0UA 1E6OL 2KUTA 1GGBL 3NVQA 1Y6NR 3D0LA 1BBDL 3CFDA 3MV9D 4DW2L 1NC2D 1YC7A 4LCWB 1YUHB 1OF4A 1FFOA 1K9DA 3SKMB 3L3OB 3IDNB 3SGDI 3G6JB 5DD1L 1WICA 4HPYL 4OLXH 4PJHF 3P30H 2CLVA 3UTPD 5DN2A 4QWWC 2VXTH 4ONOA 3AROA 4X7DC 1UD3A 4ISVB 2AQ3A 3BT2H 3CDGB 2RHEA 4KRPD 1NLDH 1SEBA 3TT1H 5HHOA 4Z7WA 1MCSA 1UY2A 2HFTA 1OD9A 4W88A 5E7FA 1E73M 4ETQB 3MLTA 4NRXA 4I3RL 2XTLA 5E00B 2X4OB 4OSUH 1MFCH 1JZ8A 1WDSA 3HUJA 4Q2ZA 1W2VA 1A6WL 1N64H 1W9TA 2VZ3A 5ICXB 3MTRA 1R3IH 4K3JH 1BF8A 3JV4A 4X4YA 3EO1B 1WLHA 3LEXA 1AGCB 1C5CH 1EVTC 1IAIH 1MH5A 2BNRD 3QIWC 3GMNB 4ZXBC 1XYFA 3U83A 3V7AE 2R9HC 4M6NH 3UMTA 3THML 3KLHD 2W60B 2YD4A 3Q5YA 5LGHH 1WE5A 5L8KB 1RULL 2A1WL 1DYOA 3HZMB 3Q0HA 4LHQB 1Y0LA 1BJ1H 3OKDB 4U33A 5E1AA 4G5ZL 1IILE 2E7BA 3L9RA 4QTIL 4PGJA 1MELA 1H15B 1LK2B 2XNAA 2FJHA 5CJXA 3OQ3B 4JRXD 3FMGH 4D9LH 3IDUA 3IJYB 1KIPA 1R7OA 3QEHB 2CIKB 5FM4A 2ZZUT 3QI9C 4M61B 4KMQA 3JZ7A 4PY8I 1T83A 3ORJA 4WI8A 4OI9A 1V6YA 5C0CE 5BVJA 3NH7H 4OD3L 4P23A 2D0HA 3AMDA 1SEQH 5TE6L 3N13A 1AI1H 3QEGH 2PYFB 3ARTA 3PHSA 1JZ3A 5ICYA 4CMMB 3SGJA 2A0LC 1VFOA 3V4PL 4JPWL 1NFDF 4Y5YA 4XUTA 2ITDB 2UY5A 5BXPA 3GJFK 5KS9B 3DMMA 3B3IA 1RK0B 1NAML 4H20H 3UJJL 1QSFB 5JXHA 4WEBL 1GPFA 1UM4L 3DNKA 3I6KB 4U0RB 1FNHA 5C0FB 3EIFA 1RYYA 1U8MA 2B2XL 4OB5L 3RWGB 5CBEB 1KBKA 1E5JA 2X0HA 1HL8A 3WHXA 3RVUD 1QW9A 1SYSA 4KPHL 5IMKB 4QLJA 4P9HH 4KK5C 2ORBH 3PHQB 4GUPB 1CXFA 3MYZA 4J3VA 4CN4A 43CAB 2WUBL 4BZ1H 5KSUB 1FL5A 5DI8A 1H0IA 1JFQL 2I24N 3MGTA 2HFGH 2W1SA 4NN6C 1CQKA 1FAIL 4HC1L 1JF6A 4S1DC 3WLWC 5C0CA 5L2JB 2EJ1A 2NY0D 4QEGA 5HYQA 4ZUUB 1SVCP 3N1GC 3SKJL 5IV2B 5AYIA 2B4CH 1XNAA 3JVGC 4XNYH 3B2UC 4XWOC 4HUWA 4LX4A 3FZUC 1NAMB 2CBIA 4G6AC 4MNQE 1OAUL 1MHCB 1TZGL 2P5ED 1KULA 3HU7A 1JI6A 2GTWB 1EZVX 5FV1L 1B88A 4TULH 5H35B 2VZOA 2XICA 3CLFH 1B1YA 5L6YL 1RZGA 2X1PA 3WUWA 4Z7NF 1E4KC 3UEQA 3GXUA 3SCNA 5CLTA 3LQZA 3GSNA 4AD0A 2QEJA 1U8PB 4EI6A 1PBYA 2WV3A 4OIAA 2VRKA 1QFWH 5DMIL 4NO5A 5CHNB 2QPUA 1L9MA 4NHCH 3U0WL 4HFWB 4PY7B 1DFBH 1A2YB 3VIJA 4GW5A 1H3GA 3K3QA 4YIQB 1L8NA 2BVYA 1M71A 1MPXA 1OAKH 3KYNB 1UY1A 3D85D 5GSVB 5HYEA 3WIJA 1CICA 1U8NA 1E43A 2EQDA 3L3JB 2WVVB 1F3DH 4OZ4A 4V2BA 3U7YL 5C09B 4ALAH 4LSUH 4HT1H 4NO2B 1W72H 2BNUA 4HMEA 4PJFB 4X8JB 4JZJC 3HZVB 3RJDA 3PZTA 5DSCB 4J8RA 4NRSA 2XN9D 3C8KB 3CH9A 1T89A 3SJVB 3WH7A 1UFUA 4MNQA 4I5BB 2XZZA 4KJQD 3AB0B 3AXLB 1IC5L 4LCYB 5F3BA 3T08A 4HKZA 3MCLH 5IHZB 3MRCA 1YYLH 2I27N 4UB0H 3VMOA 1BYBA 3MA9H 3OR6B 3ESVF 3VNYA 2A3EA 1NC4D 4KROC 5E99L 1GZJA 2GW5A 1F2QA 1J0HA 4O2EB 2R1XB 2OMBA 4N0UB 1GGIL 4YEEA 1OF2A 3D0LB 3CFDB 4K8RD 5AAWA 3BAYA 2VM9A 5I78A 1QVBA 1FE8L 3C7EA 1YHTA 1KCUL 1FFOB 1OTUD 4PS4L 5EWIL 5I1CH 1VKXA 5DYOA 2DQDH 5L2KE 4LGRB 4HLZH 3TZVC 3N1FC 2CLVB 4CJ0A 3NAAH 1G7LA 3B5GA 3G6JF 1DHKA 5JBFA 1SEBB 4K7PL 4JGMA 4NBYB 3C5JA 4Z7WB 5HHOB 1QI4A 1DQJA 4QOKA 4OGXL 3MLTB 1RMFL 4NRXB 3WQWA 3BIBX 1XCWA 2DQCH 2XT1B 1RP8A 2WWKO 4Z77A 1F3JA 3HUJB 4Q2ZB 4DWHA 1UWQA 1HHJA 3LSOA 4TYUA 1PX8A 2EC9U 4NOBA 4YDIL 1V7NL 1U3JA 3JV4B 4X4YB 4HAFA 3ARRA 3LEXB 2YWYA 1AR2A 1MH5B 3HG1E 4MXQC 1MPAH 4HCRL 4NC2B 2ZKHH 2B1HH 4JY6A 3DGGA 5GPRA 5K93A 3DWTA 4QLLA 2DMCA 3I6GA 3QBTB 5GRXG 3CPLA 1E28A 1Y0LB 4JO1L 5E1AB 1DBBL 4IOSD 3QGVA 3L9RB 1YMMA 1FNSH 2XNAB 3N9GL 2FJHB 1KIPB 5IEHA 3H42L 2JJTA 3P9LA 4DUVA 1A3RL 5HI3C 1AC6A 1X5IA 3B9KC 3O3AA 1M05A 2G5RA 5K59E 5BVJB 4XAWL 2ZXAA 3V52L 3KWWA 1HN1A 4P23B 1MJUH 3VXNA 5FF6A 3MV8E 5DK3A 4YBHA 5SX4H 5IBLD 1C1EL 4J3WA 5D1ZA 2VQTA 1MW0A 3F2ZA 2EEBA 4UQAA 1CFNA 2DYPA 4HGMA 5ICYB 2KZWA 1JYWA 4GH7B 4X80H 1E4JA 2DQGL 4Y5YB 2VI0A 2OBGA 3CMGA 1UWXH 1KCSL 3DMMB 3B3IB 4AQOA 1CL7L 3O4LE 3QRGL 3RGVC 3RVTD 5T33L 3BAWA 1U8MB 1WKYA 1SYTA 1CLCA 1G0XA 2HKFH 5KS9F 2AXGA 4KDTA 3DROA 4N8PA 3AREC 5DJXA 3WN5C 4IHOA 5CJBA 43C9A 3WHXB 4JFVA 4JPKH 4AZ7A 1SYSB 2PW1A 1EDTA 1NDGA 2RR3A 3DBXA 3GSNL 2DWEA 4R5EA 3NCCB 1FL5B 3ZE0F 2CRZA 1G6RH 4DXTA 4YHZL 1WSST 4RWHA 3MGTB 5D6DC 5EO0A 5C0CB 2UYLA 4HD9A 2Y5EA 5HYQB 1SM3L 3WJLC 4ZS7H 1IMHC 3MV8A 1FDLH 2J12B 4JFFE 3BKYL 4NC1E 4HUWB 4IRSD 4AY0A 2O26U 4TSBL 1J10A 5KVDL 1UZ6F 2FEEL 1BBJA 1ITBB 1RZGB 4O2CA 3WUWB 1HNFA 4MAYD 4HPGA 1NGPL 3QPXH 1WT5A 3O4LA 2OR9L 1CZ1A 1GCYA 1Y18A 4WK9A 3LQZB 3GSNB 4HLJA 3FFCA 4QCEA 1WZLA 1W1VA 4EI6B 4NO5B 2DB8A 3NCJH 1M04A 3O0RH 1HQ4A 5E2VL 4HWBH 4GW5B 4LVEA 5ISZD 2XWBA 5F7EL 3MX0A 1M03A 1M71B 3ULVC 1BIIA 2OX5A 1MUJA 1A6UH 1RZJL 1CICB 1U8NB 3ZKXC 4YHMH 2HWZL 2XPGA 3I6LE 1VGEH 1UH4A 3L3KA 4OZ4B 5TE7L 1S7VA 5CJ8A 2AAAA 4G6JL 2DDQH 1FGVL 2BNUB 5EU5A 3TEUA 4QY8A 4KZEH 2PWFA 4NSBA 3IKKA 4J8RB 4YLQT 4M93C 2PO6A 4MNQB 2F9BT 3AVEA 5DWUH 5GGSA 2DPEA 1NJ9A 1NCWH 2XQXA 3BO8A 5F3BB 1UEMA 4HKZB 2PW2A 5IG7A 1N7ML 3UTQA 4GXUM 3VFPA 1ODAA 3MRCB 4JFYA 5J11B 1FRGL 5F7MC 4AIZA 4JZOA 1HT6A 5FYJH 3JTSA 2D0GA 2YR3A 3V6BR 4RMQA 3RWJA 4MVBC 1W3KA 5IHRA 3TPUA 3NIFF 3FL7A 2XRAL 1XIWA 3H2WA 4HWNA 4M8UA 3MBEC 3C7GA 1OF2B 2X2YA 3ARQA 3OB0K 1WCQA 4ARXA 3MKKA 4JPVL 5DUPL 3CHDA 5IJKC 5GGRA 2YHGA 1VKXB 3N0PB 2UZYB 5DYOB 2BY1A 1HHGA 4PMDA 2X9XA 4L9LC 5I3DA 1GRWA 2JB6A 1G7LB 5H8DA 3PWNA 3IT8D 3ARWA 4WEMB 5DGRA 4KC3B 2CLRA 3C5JB 4GAFB 4QX2A 4F7EA 1DQJB 1DVFA 1OL0A 2AABH 1BVZA 3AMLA 4QOKB 5SWSA 1JHLL 1PD6A 4Z77B 1F3JB 2ICES 1HHJB 1S8DA 1RVFH 3LSOB 1JFXA 4OLYH 4UOJA 3HUJF 1F4YH 3S97C 4F66A 4YX2H 4UV7H 2P5WD 4MA7H 3RY6A 4W7WA 5KTEL 4ZENA 4JY6B 5HDQH 1VSCA 2WZHA 2L4OA 3ARBC 3DGGB 4CJ1A 1QI0A 4URTB 4QRRE 2CR6A 1G5AA 4H88H 3PP3K 3SCUA 5HGGS 3I6GB 4K2UL 4K3EH 4YWGL 4PBGA 3CPLB 1E28B 2FD6H 4AZIA 1OGBA 5CXPA 4LSSL 3QDGE 2ZXDA 2IFFH 1L7TL 2DBLL 1YMMB 4Z9KB 1T2QH 5F96L 1P6WA 3MRLA 5C9JA 1HKFA 4OLVL 3VTRA 3U1SL 3V79C 4WHTA 4AEHH 5IEHB 2VMDA 3OKMA 3UTPE 5JXAH 5BZWA 2HN7A 1EPFA 3P9LB 1EHNA 4UQEA 4CW1A 2CESA 3W26A 3SUVA 5DVNA 1KYOK 3O3AB 2LU4A 1M05B 1WWWX 4JKMA 2AI0L 1IM9D 3GKWL 2C9KA 3BH8A 3KWWB 3SDYL 3HNSH 3VXNB 1Z0MA 5FF6B 3T0ED 3ZO0A 5F7UA 1ACZA 4L5FL 5D1ZB 3WQ8A 2D3NA 5I1EL 1CFNB 2DYPB 3I9GL 1H6XA 3WFDH 3A22A 4QRRA 4OZIF 3RJQB 3TO4C 5FO7A 1NWTA 1BQLL 4NUGH 3MFGB 1KCVL 1MWAH 3MOAH 1E6ZA 3CGTA 4PP2A 1E4WL 4YBLB 5C0BD 3WYRA 3QDGA 2AXGB 5JLZA 1FYHB 3DROB 4JFOA 5DJXB 2IPKB 4IHOB 43C9B 1QNSA 5HXMA 3SCVA 2FX9H 2PW1B 3NDZA 4NN7C 4WW2C 1NDGB 3KAAA 3DBXB 2DWEB 4UNIA 1S7XA 4R90H 3EJJX 4ZOBA 4MJIE 2OWXA 3L3DA 2HRPH 4J28A 1OAZL 2DT3A 2E6QA 2E8YA 3FONA 1KFWA 2LU7A 2QTEA 5EO0B 5IESH 4Y2DD 2UYLB 1PAMA 3QIBD 4RIRA 1YN6A 4M03A 3RRQA 5I8KL 3MV8B 2MTPA 3Q5TA 3X3GH 1IBGH 3CVIL 1MI5D 5CQ1A 1VRXA 5MI0B 3AHTA 1FJ1A 1BBJB 4F15C 4O9HH 4LLMA 1QP1A 2JCCE 7FABL 2HLFC 4GZIA 4B16A 4O2CB 5EOCH 1UQYA 3VI4E 4JX0A 3O4LB 1EBPA 1Y18B 2IH1A 5KBNC 5KVEL 5JBDA 2UY7A 1YEKH 4NFDA 5J9PA 3FFCB 1KWKA 4X7SH 4HZ8A 2GJJA 1IQWH 3HPJA 1AQDA 4LCCC 4Q0XL 1HQ4B 1CDYA 4S10A 5FHAH 5B8CA 5EO1A 1WUNT 3LQAC 2XWBB 3IJHA 4WVRA 5GZND 3VFTA 2UUDH 4MJIA 2GFTA 1BIIB 1MUJB 5GGQH 2YKKA 2YD6A 1T1WA 2XPGB 3LEVL 1T0PB 4IBLT 3WS3A 2EO1A 3L3KB 2CKBH 1KTKE 1S7VB 1U3HD 1MIML 5D1QD 2FECI 3T0DA 1HJXA 5D9NA 2ARJA 5EU5B 4QY8B 2EDHA 3Q6GL 4KI5D 1I5PA 2ADJA 3JUZA 2PO6B 3BAKA 5GGSB 2AJ3A 1GAFL 4G8EA 2RCSH 3TCLA 1NJ9B 1KACB 3AISA 1NBVL 5BXRA 1EDQA 3BO8B 4G9FD 5IG7B 2PW2B 1ISYA 4RSVA 2JCCA 3UTQB 1DWHM 3PZIA 3VFPB 3ZSTA 4JFYB 4AIZB 1TUXA 3B9EA 4JZOB 4ODVL 3JTSB 4K68A 1UACH 1B2WL 3RWJB 2P5EE 2FWOA 3B2VH 3OLEA 3TPUB 4LBEA 3AIVA 1T1ZA 4UOW1 2DMKA 1XIWB 3P11H 5FCSH 3UYRL 4P49A 2EH8L 4DFHA 1AGDA 1C5DA 3ARGD 4WI6A 5B38G 4NGHL 4JM2D 4JY5H 4GRWH 5I79A 5ABFA 5GGRB 1O0VA 4X6DE 3PN8A 2E7CA 4O4YL 1JL8A 3MV01 3CSYA 1HHGB 4PJ9D 2QQIA 1UM5L 3F6IA 2JB6B 1ED3A 1KJ3L 3PWNB 1CZSA 1IV8A 4UAOC 4WHCA 3GI8H 4KU1A 4U6YA 5ITFA 5HD8D 2CLRB 3ZIZA 2J5LC 2WIIA 4F7EB 1DVFB 1ZANH 4JKWA 1UCTA 4HG4K 5DO2C 5SWSB 3NUKA 1U2HA 3MU7A 2LVEA 2XN9E 3ME0A 1S8DB 3WSQH 1XF1A 3BDYL 2P5EA 2E9WA 3BUYA 4X98A 3RPMA 1B6UA 4GXVH 5T1DL 4OIFA 4M7LT 3BGFC 2CGRH 1VJSA 2J7BA 4MJ4A 2PBOA 2VLRE 4OCYL 5JW4R 1AQHA 2BNQD 2X4TA 1W9PA 5JHLL 4RWYH 3RVXC 4GQ9L 1X5XA 2F2HA 2D7QA 2OK0L 1QW8A 4X6DA 3MBXL 5ALCH 2XQYG 3WL0A 1AKJA 2MSPA 3RDKA 5CEYA 5FL1A 5DFAA 1U9KA 4DXSA 1XGYL 3D2UA 1HZHL 3KPSE 4MCYA 3WHE1 1PEZA 4Y4HD 2D7OA 2J8FA 3BPCA 1I8KA 3K8MA 1L4IA 3MRLB 1OLZA 5GJSH 5C7XL 4F2MA 5C9JB 1WITA 3AY4C 4G7YL 3GRWA 4WHTB 2XHNA 1GGUA 1AO7E 2E6PA 3OKMB 3V0WL 1J5OL 3WDRA 5BZWB 2HN7B 2NY2B 5AWNL 4XX1G 3RDTC 1MRDH 4CW1B 2XN9A 2DLEA 2GUOA 3NSNA 1S5HA 4IPNB 2Z91A 1UD6A 5LBSL 3BH8B 2YBTA 2QKIA 5HPMA 4ZEPA 2VLRA 3VIHA 4OLZH 1MCFA 3ZHDA 4XUNA 4PMQA 4HZ7A 3OV6A 2MWCA 4QRRB 5GHWH 4RRPG 5IMOA 4AMKL 4PJCF 3B83A 1F4AA 3DRQA 5FO7B 5J89A 1FOBA 3S96A 4ZXLA 1HK6A 1OB0A 2I60L 5MP6H 2AXJA 1RZKH 4PP2B 3WH9A 3KPSA 3GMOA 2DD8L 3QDGB 1WQVT 1DP0A 5JLZB 1LD9A 4JFOB 5LXGL 4JVUA 3VFUA 3EBVA 3WDPP 4XP6H 2DM4A 4B9YA 1GC1L 1OP9A 2BK8A 1AO7A 4Y1AD 1MFDH 1S7XB 4FFWC 2X1QA 3L3DB 1PG7W 4XXDA 3FONB 4Y5XC 4CN1A 4GBXA 3C5ZC 3R06A 4RIRB 1YN6B 4TSCL 4BSWA 1DBMH 3GIVA 4HG6B 4GRLA 1W99A 2APBA 2H32A 5K59F 4JN1L 5HHXL 1LEKA 4K9EL 1LO2L 3KPRD 3TV3H 1E4XL 1E4IA 3VDBA 2A6IA 1AC0A 1LDSA 3PG2A 3OR7A 3AIWA 1FJ1B 5EBMA 1R87A 35C8L 4LLMB 1ACYH 2QQOA 2ZXBA 5D4QA 2IH1B 3WD3A 1JPFA 1OP5K 4OIIL 5HJ3A 5TE4L 3KLDA 5J9PB 4KMLB 3HPJB 1AQDB 3BJ91 4NO0D 4HWEH 5B8CB 3O6AA 5EO1B 3G5ZA 1TFHA 3IJHB 3ULUH 4P3DA 3VFTB 4MJIB 4H2CA 4KKLC 3VXOA 2CDFA 3AZSA 4UT6H 4KGJA 4R9HA 1EMTL 3WSUA 1T1WB 1W0WA 5F9DC 4JO3H 3WS3B 1E6SM 1B0WA 1G1CA 4HFUL 1IM3A 1QNZL 1IC4L 4KJPC 2ARJB 3A7QA 1NAEA 3V6OE 2FH8A 4DN3H 2ADJB 1K4CA 1MQKH 2Q7YA 1EX0A 2WKGA 2I26N 2VDOL 4OOZA 2AJ3B 3K8KA 1F00I 2R56H 4GIAA 4G8EB 3TCLB 1HJQA 1CZ8L 2NY6D 5GS2H 1E9LA 1DTUA 4RGNC 3OEAA 1FZMA 2ZCHH 4EDWH 3OPZH 5M3WA 3S3PA 4P9ML 5CJQL 4Z7QE 1UXSA 3EDKA 3WXWL 1V3IA 1CN4A 4WTXA 2FWOB 4LBEB 1T1ZB 5J13C 4X0NA 4J3SA 4RQQA 4WWKC 2HAZA 4Z8FH 4HWZA 1AGDB 1C5DB 1XAUA 4LYPA 3BISA 4Z95L 5J3HD 5A6KA 1CECA 4G6FD 2VVSA 3EOTL 5ABFB 4HKXA 5GS0L 3T3ME 4M8VA 25C8H 3CSYB 5K9QG 5A6MA 1D5IL 5ISZE 1ZA6A 1ED3B 1UGNA 3ZKSD 3S88H 4YHLH 4W6WB 4U6YB 5ITFB 5IHUH 2WO3A 1WDPA 4XI5D 1HDMA 4DWSA 1CK0H 1P7QD 2WIIB 3S35L 2OTUA 2X9WA 4AZGA 3TVMC 1Q0YL 4XURA 5DC0A 3LIZL 4M6MH 1TJIL 4S1RL 4X7FC 5EDXA 5I1GL 2P5EB 3BUYB 1HINH 1DANT 3GRWL 4X98B 1L7IL 2Z1SA 4CN6A 1LL6A 3HNTL 2VX7A 4L4OA 4ONFL 2X4TB 1J8HE 2UWEE 4R6UA 1X5ZA 1RUQH 2MPAL 3C09B 2Q87A 5E5MA 4U1SA 2X05A 4X6DB 3M8OH 2W47A 3J8F7 4XWGL 3EDJA 5IBUG 1YNLL 1AKJB 1WWAX 3R8BB 3C7FA 2FLRT 3MSPA 5CEYB 3NCBB 1EO5A 3P4MA 1GHSA 5FIPA 3D2UB 5J1XA 2GJ6E 3GO1L 1HHKA 1FH8A 1NBQA 1KFAL 3BPCB 1I8KB 1NGZA 4UV4L 4PJ7F 4HA3A 4F2MB 3BCFA 2IF7A 2WCSA 3NFSH 2EDXA 3O4OB 3LCYA 1P5UA 4XCCL 3RBGA 1E0XA 2XN9B 5I2IA 4Y4FA 3T0WA 2GUOB 4QHUA 1S5HB 2NY3C 2Z91B 5D8JH 3POCA 1V7MH 2QKIB 5HPMB 2VLRB 5GNYA 2Z9TA 5C0AE 1J8HA 2VDML 2UWEA 1JHTA 3B9AA 4FS0A 3SE8L 1OTTD 1JNNL 5HY9A 4Q22A 4LRIA 1KGYA 3QUYA 5IMOB 3CTTA 3ZT7A 3PZGA 3DRQB 3S96B 5C6TH 1MWOA 1J7VR 1A4JA 3RA7H 1BECA 1U0QA 2J1SA 1LVEA 2X4UA 3KPSB 2GJ6A 3GMOB 3M46A 4WY7H 1UOKA 1LD9B 3VFUB 4CDHA 1QI2A 2PNDA 3I84A 3HNYM 1VAHA 5B4MD 4PTWA 1IGYA 1UR2A 1AO7B 2BVPA 4RFOH 1AXIB 5EFDA 5E4EC 3LPFA 4NQUA 4XXDB 4Y19E 4MNKA 3VD5A 1J1XH 1OARL 1ROWA 1W72A 4BUHA 4GBXB 3R06B 2Z31C 4BSWB 4DOHE 3GIVB 3T2NH 2JIEA 2VZUA 4GRLB 4OLXL 1T0NA 5DQDH 5EORL 2H32B 3P30L 3I3EA 5C0AA 3HJRA 1LEKB 2WHLA 4L3EE 3MJ8A 2E8ZA 4IRJD 1I3GH 5HI5C 5JXIA 2XZCH 5B38A 1NLDL 3TT1L 2A6IB 2CMRH 3OR7B 1MSPA 3RL2A 4J3OC 5EBMB 4AMCA 1UA3A 5DD6A 4ZS6C 5KAQG 4PGCA 1KGXA 3CZUA 4WEUD 5ESQA 5E6IC 1MFCL 3U2SA 1J0JA 1D5BA 1JPFB 5HJ3B 4AXNA 2C3VA 1EXUA 4DZ8A 1ULPA 4K3JL 1R3IL 5JW5A 3L4UA 4HP5A 3G5ZB 4YNYA 1CXHA 1NOWA 1IAIL 4P3DB 5HDOA 5A69A 3T0AA 3AGVA 1PX4A 3VXOB 2CDFB 5DMJB 3I2CH 4Y19A 2AGJL 2YUXA 2HMID 1MFVA 1W0WB 5LGHL 4QX0A 4J4PA 1ZHBA 3PWPD 1XF2A 3MV11 1FAKT 1IM3B 5I1IH 1D9KA 3D5OF 5BV7C 4L3EA 1K4CB 1A7QH 4R0LC 2Q7YB 1CZVA 1UKPA 3TH2T 4E0RA 3AJ7A 4QRSA 5CKGA 3FMGL 3WD4A 1FZMB 4D9LL 6CGTA 4P2QE 4DKEH 1B90A 1NWSA 1IGIH 5DFVC 1HP4A 5KOMC 1UXSB 2JCCF 4DVRH 1UYXA 2CUIA 2UVFA 3S37X 3VI4F 3SDCC 1NFKA 3NH7L 4DKDC 1XCQA 4RQQB 5TPWH 3W9EA 3WFCL 1SEQL 3HZYA 4HWZB 2J77A 2L7JA 4OM0L 1BYCA 3EZ8A 2G60H 4A6YH 4HKXB 4QGTA 1BFOA 1WIUA 4JJ5A 4JRYE 4LVHB 5F1OB 2HG5A 1N6UA 1ZA6B 3CHFA 2OWWA 2BFGA 4G6KH 3W29A 4AG4H 1NKRA 2GY5A 4PD4J 1HDMB 4DWSB 2MANA 3QIBA 2W67A 3O6FA 2OTUB 1BQHA 1IGCL 2VLMD 4V27A 4RRPA 4P9HL 4OQ1A 4P2QA 1H6YA 2ORBL 2JEQA 3S36H 2L7UA 2Z93A 1RZ8A 2IGFH 4QO1A 4M5ZL 1H3TA 2HFGL 1ZE3C 2JKXA 1RZFL 1XF4A 4D1IA 4HU0A 4RA3A 5DJZA 5ENWA 5J06A 2FDBP 1RZIA 4XNQA 4S3KA 1E3XA 3TN0D 2X4PA 1BYAA 4XNYL 3C08H 3W0KA 3THDA 2WDBA 5E5MB 4U1SB 1A0QH 3U7BA 4TULL 4JRYA 2XWJA 1R24A 3CLFL 3WIIH 3O8XA 2Q8XA 1F42A 2MFNA 3AXHA 2NXZD 4HQQL 5F1KC 4X6DF 3P4MB 4K94C 3WNKA 1E15A 5DZOA 1HHKB 1V6XA 3BESR 3A6CH 3X11A 1NGZB 4U05A 3WS6A 1G6RA 2WMKA 3BLKA 3MMDA 1LP9A 3QULA 4NHCL 5FFLA 1S7TA 3QCUH 4W85A 2VXVH 4NZRH 2F54E 3LD8C 3S36X 4F33A 3BW9A 2HH0H 5C07E 5I2IB 4BUGA 4Y4FB 4QHUB 1FNGA 3WNLA 4PLJD 2X9YA 4E8DA 1CWVA 2GJPA 2FGWH 4PUBH 2D3VA 4M1CD 1JYXA 4H7VA 1BVKA 5BW7A 4PEEA 4ALAL 4LSUL 1VADA 5KVGH 4HT1L 4OUEA 1W72L 4UNVA 1J8HB 4P4KD 2Q8AH 2UWEB 1GOIA 3VXMD 1JHTB 4JQXC 3U37A 4HK0A 1INQA 3H3BC 5HY9B 2YFUA 4EN3A 3CD4A 5FYJE 3E8UH 1QTYT 3E6FA 2UZXB 3QUYB 5CIPH 4OFDA 4HJ0C 4I3SH 5F6IC 5EB8A 2Y6GA 1A4JB 3V8OA 3HHRB 3OJDA 4UB0L 3VXQA 2X4UB 4HWBA 3FY1A 3WY1A 2GJ6B 3ZE2E 2WUCH 5FOOA 3GXDA 2VKXA