3K4AA

Crystal structure of selenomethionine substituted e. coli beta-glucuronidase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
605
structure length
597
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYVGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-glucuronidase
total genus 140
structure length 597
sequence length 605
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k4aA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k4aA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k4aA03
2VWEC 2CRYA 1CF8L 2VO5A 5GNYA 1N8ZB 3L3KB 1KGWA 1EAJA 3OGCA 4EDWL 5ETUB 2C3HA 3BZEA 3W9DA 1A64A 3VWKA 1PZ5B 5DRZB 5AAWA 3S4SG 1Z9MA 1FP9A 2C4FU 2E32A 5GGRB 1I3GH 3SQOH 1PKQA 1HILA 1OCWH 3NQHA 2ZWYA 1U8IA 3QXDB 1GQPA 2J5LC 4PJAA 4GQQA 3T4AB 5C0AB 3CSYB 1V7ML 1V3JA 4EI5C 5FO9B 4L8CA 1N82A 3ALFA 3UC0H 1MELA 5L8KB 4FQ1L 4XMLL 5F7EL 4CDGC 4O4YL 1QO3A 2HFFB 4WFHE 1N6VA 1U0QA 1I7UB 5T1MB 2GJXA 3X14A 4NIKB 3S36L 1MEXH 4NZRL 4D6CA 1AGEB 5DC0A 4LCCA 3BQUB 1B0IA 1YC7A 1P9MC 3OR7B 2EYRB 4KGJA 5KSAB 3SCNA 2Y2WA 2P5WD 4FQXD 3LEXA 2W87A 3NTCL 3OZPA 2VUOA 4KTEH 3JTTA 3Q5OA 3WEXB 2QR0B 2B1HH 3ZL4L 1EZVX 1N6UA 4QHUB 1T6VN 1YMMD 4PBXA 1WP6A 1HP5A 4PGBA 4CNIA 3VFWB 1NP2A 4NJ9H 5IB5B 1X6LA 5L8LB 5B39G 5FAAA 4HG4K 1G7PA 2R4RH 1PDKA 2NW2A 2NY2B 5KSAA 2EH8L 3K2MC 3OAZH 5KZ6A 5EIIB 1D9KB 5GS0L 4PJ9A 2W5FA 5C08B 2BY1A 4MS8D 5JTWA 4KXZI 5FKYA 4FQHB 1XCWA 1A3RL 3PHSA 1UR8A 3P4OA 1DLHB 3L7EA 3QQ3B 1W9VA 5EULV 2F54E 4YBQD 2NNAB 4Z7WE 5KSBB 4WUUE 5JW3L 3TEUA 3GSUB 5CP7A 4ZDHB 4ZNEE 4IIQB 2YDRA 4LLAA 3FXYA 2K7QA 3C08L 2BNRB 4LSSH 3BPLC 4MJIB 4UDTB 3S5LB 3GK8L 3GBMH 1JWMB 5CZKA 4KTDH 3O6MH 1RVFH 4ZUUB 3DXAB 3VXSD 1CDCA 2M8XA 1U8MA 2EDJA 1VA9A 2PO6D 3H3PL 4HUUA 1QNPA 3EDDA 5LJYH 5BZWB 4EIZC 1K5NB 4YDIH 3ESUF 1FG2B 4HGKC 4KRLB 1EH9A 3GMRB 1FL3A 2FNBA 4KGLA 3SKNB 2VERN 1WTGT 3EFFA 4QXGL 3W0WE 5GS2D 4BH7A 3KJ6L 3MO1A 4NO3A 5SWSB 1E70M 4R4ND 4X5LA 5HHME 2IUZA 3B9KD 5E5RB 4PJDB 5C70A 5FF6B 1GOKA 1P4BL 3LD8B 4ZOBA 3CZFB 3BP7A 1UXZA 4FQLH 1A1MA 4L8DB 3T3PE 2VVNA 4D6IA 1GC1C 5IROA 3BAWA 2DWDB 5E94A 3EYVA 2YDSA 1PLGL 1VFOA 3LKQB 3S34H 3Q6FA 4MNKA 5JHLH 5CG0A 3FQRA 1H6YA 1FE8L 3SDXA 4HT1L 3V5KA 1U91B 3MJ9A 4HJGA 1I1XA 1HK6A 1J5OL 4G9DB 3QIBB 4XMLH 4Q0XH 4D6HA 3JWOC 1UZ4A 2R2CA 4DJMA 4P5YA 2ZUQC 3T0EB 1LWHA 3NJ3A 1BZ7B 3ARFB 4W89A 3L4TA 1KIPA 5H8DA 3K4ZA 1AGCA 4C54A 1NAEA 4L9DA 3P9LB 3MYJB 5C0AD 3OX8B 4AYSA 1SQ2N 3RX7A 4XBEH 4HWZA 1FL5A 2E9JA 5EOQL 3G6MA 3QDGA 5JW4R 2IWGA 4KMTL 3ARYA 1TJIL 4ZFZB 4LSUH 5BQ7B 4Z7VE 3DHMA 4OV5A 1EHLH 1GAFH 4JFDE 2G75A 4LYRA 3WV0A 5DC4B 3VFMB 1G9HA 5LCVL 1S7XA 4MGQA 3KJ4B 3H9HB 3BH8A 2GFBA 5C07A 3B5GA 4N5UA 1UMHA 4XI5C 4X6DE 4JZJC 4JRYE 4M03A 3CLFH 4K94H 3UBXI 1DQJA 2UY7A 3SKMB 3E6HA 4S1SH 1UA6L 3E8UH 3EYOB 3R06B 3VWJB 1C16B 2BFVH 3IS1X 4W6YB 2AS5M 5IGXL 2IAND 4H88L 2NT0A 2AK4D 4L8BB 3BESR 1JZ4A 3W6LA 2YB7A 4ESKA 1CFBA 5JXED 3AMKA 2ADFL 3GSXA 3PWNB 4M62L 5C0BD 4R4BA 2CETA 1AC0A 1I9IL 5E6IC 2APTA 3WD5H 3WDRA 5D72H 4PTUB 4FTVB 5FYJE 4JY5L 3FQUA 4KKBC 2H6PA 3HMXL 3ZZ1A 4FABH 4Q6YA 5TE7L 1AXSA 4K3GA 4NKMA 1DR9A 4P3WA 4ZNCD 3VFOB 1CGSL 4CW1B 1U8LB 3CZ8A 2TAAA 5D6CB 1YPZA 1JFHA 3TN0B 3DRQA 1W8OA 2D31A 3QUXD 1U30A 1FAIH 4PJ7E 3BN9C 5I1JL 3GBDA 1BM3L 3OAYH 1B0GB 2NY0D 3MQIA 4NKOA 1US3A 5IFHL 1XGRA 5HOSA 1R5IA 5F1IB 1Y6MR 4P2OB 4WHTB 4B0MM 5E2VL 4S2SB 5A6BD 2Z8RA 4B41A 1W3KA 2EPLX 4PJ5E 2XKUA 2CRMA 3AIBA 3DIFB 1ZVYA 1IM3A 4YPGA 4OIAA 3KS0J 3SO5A 5HGDB 3MA9L 1TJHH 3KVQA 2YD1A 3OKOB 3E2HB 3TM6A 2X5PA 3MLXL 1NM9A 1DEDA 1Q1JL 2DQIH 5DR5L 3O6FB 5FYJD 5KTEL 4JHZA 1NC4A 1GYAA 4HK3N 4K8RC 3U57A 1ITBB 1QBBA 3MRLA 1UR9A 3WKNA 1JK8A 2W1WA 5T3XL 5M3WA 3ZIZA 1ULVA 4ZG1A 5CJQL 1MFDL 5L7XL 2AJYL 2VOTA 2F9BT 4P4KB 4OZIA 2E7BA 2Y9RT 3EMZA 2XFFA 4JFTA 1ZLSH 3TJEH 1EDQA 1FVEB 1IAIL 1U8MB 3QR3A 1OL0A 5F7UA 4NBYB 1AGBA 4U6HA 4YIQB 3PZNA 1RIUH 4Q6IA 5F6HJ 3IFOB 4PMYA 3QEHB 4HK0A 2YPLB 3N13A 1OAKL 3V79C 4TYUA 1MI5B 4PRHE 3S88H 1MAML 1U58B 2ADGB 5TH2B 4TRPL 3BAIA 1XHGA 1OQXA 3WE6B 2Q8AL 5CSZB 1KFWA 5CJBA 2VRAA 5BO1L 1OW0A 4XX1G 2VDOL 3OKNA 3UBXA 2LU7A 3DX6A 4XNUL 4KY1H 5KSAC 4N0UB 1CL7L 2JCCB 3QPQD 4PEEA 4YHPB 4PJ7F 5KW9H 4GH7B 2YSSB 1WSST 4M9OA 5FYJH 3NPSB 5GIRB 4WUUD 2OSWA 3VG9C 4HKXB 2Y5TA 4ATWA 5EU5A 3IJYB 4Y2DA 3RX5A 1CGSH 4LHQB 1KLGB 1T1XA 4MJ6A 2DSWA 1WAWA 4LFHG 3VFSB 4O2EB 2Y36L 3R0NA 3A4AA 5FYKH 2PR4L 4QRRA 4IS6A 3CH1A 2XG4A 5GGTH 2VXUH 1A7NL 3GJEA 3BYYA 4PB0L 2EYRA 3PDOA 4U1GC 4Z0BH 3CLEH 5DI8B 2O26U 1A3LL 4YJZL 4LHUB 4LVNB 4YBLC 3QSKB 2DDQH 5C86A 1J8HA 3U7VA 4W8AA 1RUQH 1RUAL 4J1UA 3RVTD 4ZXBD 5HVGB 2QV2A 5IR1B 4YK4C 3TIEB 5HBBA 4ODWB 3BPNC 5A8QA 1LO5B 1I4FB 3P0VL 2WAOA 2V2TB 1P1ZB 3LY6A 3MLWL 4RGNE 1WAAE 5DJ0B 3TWCL 3FQWA 1QEWA 1OM3H 3ZMRA 2C8NA 2E3ZA 3VIMA 4OM0L 2HVMA 3AB0B 2ARJB 4PJDE 4AD2A 5I1LB 5EUOF 5I1CL 2MHAB 2VC2H 3Q6GL 2VDRH 3VGBA 3RVUD 3AXXA 2VLLB 3WFDL 3DNKA 4KJYA 1NJ9A 4J3UA 2O5YL 3O2DL 1BEYL 1OWWA 3VRJB 4ZTOH 4CN6A 5EO9A 3QH3A 1PBGA 4GOSA 5FYKD 3U9UB 4HUMB 4ZSOA 3CVIH 2DQCL 1WGOA 1YC8A 1YNLH 1U8OA 1TZHA 2OZ4L 2OYMA 4JKKA 4GI9A 1AXSB 5ABDE 4LGSB 2ZOLB 2DLEA 1T03H 4NWUH 4R5EA 5JR1H 1N5AA 3NFPB 4JFQB 4DQOL 3ETPA 4N9GA 1P6WA 3CH9A 3CDCA 2DBLH 2PBOA 2UZIL 2H45A 2IPUG 4HIJA 4L8DA 2YKLL 3KPSB 1XFPA 1J0JA 1ODZA 2WQRA 4PY7B 5GIRA 3V8CA 5DFVC 4DGVH 3AXHA 5HNNA 4OD1H 3T0WA 3A67H 1I3RB 3LEXB 2OR8A 1FGVH 1A6UH 1FH7A 2QPUA 5F89B 1I8LA 3VFSA 5IBLD 5DSCA 4N8CL 5C8JB 2BSRB 2HTLD 3BWAB 4JFXB 4NN6B 3C7GA 1EA9C 1RZIA 3QG6A 4LRIC 1IJ9A 3D2UA 4HKBA 1G1CA 1OP5K 1IT9L 1KEML 4U1SB 1UX7A 5FKAB 3DC0A 5GS3A 1H0IA 4JG0H 1P7QB 5EU3A 1ZL1A 4PRPD 2JJSC 3F5LA 2EYSB 3GSOA 2EH7L 1VFFA 4TUKH 2ICWA 1TE1A 3V4PH 3PABB 5AWNL 3OZ9H 5HDBE 5MEPA 5IYYA 1BREA 1S46A 4ATDA 3RUGE 3JV6A 3BPCB 2FJFA 5CZXD 4P5MA 4NCDA 4TSBL 5I16A 3C7HA 1BFNA 5MHSE 4IRSB 5TFSL 2ICES 1ED3B 5HHOD 5DGQA 4LU5L 4R4FL 2CIIB 2HFEA 4HZ6A 4CD5A 1KB5L 3VDBA 5IF0B 1MFBH 4GBXA 1SEQL 1E15A 5SWZD 4MDJA 1J0HA 3KNBA 1T0MB 1M4KA 2RFXB 2I9LA 4Y7MA 2EE2A 4OFYA 1U8JB 4I0KA 5CGYC 1DBJH 4OLUL 4OZOA 5FB8A 2NTSP 2V5TA 5HGBA 3G6AB 4RIRA 5KVEL 3ARXA 4XGZB 2IMMA 4G8GE 3Q6GH 5AEAA 3KYOA 5GISL 3RWJA 4PJXE 2PXYD 2WWMD 5DHYA 1ZLWH 1WCBB 1RUKH 3SE8H 5DUPH 3K7UA 5CJ5A 5JXHA 4QHLB 3HR5A 4J6RL 1CENA 3FMGH 4MO3M 1XGUA 5CILL 4CVWA 3OWEA 2Z92A 2JCCF 3IYLW 1UMIA 1GGCH 3LAFA 3D25B 4OQTA 2QQOA 3ECBB 4N5ED 1WPCA 4ODSH 3Q2CA 4OCSH 5ILTH 3PWUA 1YNLL 4PMXA 4ZUVB 4GG6B 3VXNB 4NKOB 4ZQKA 1M7DB 3B9KB 1UH4A 2DB8A 2Q86B 3LSOB 3O6FC 4MA3A 4M5YH 2FGZA 2R56L 4Z0XA 1O59A 2CHNA 4XI5D 3GGWB 1Z9OA 1FORH 3AREA 4C55A 1CR9L 1LILA 4K7FA 4JHAH 4PRNB 2R23A 1KCKA 4HIJB 3QWOA 1V3KA 3F4VA 3OLDA 2CHOA 3ALPA 4A42A 4NSBA 1PGRB 4XNYH 1CDHA 2AI0H 2IANB 2HVKA 4XPAL 3U9PL 1HYSD 5DHVA 4QXUH 3LKRA 1RZGB 2DQIL 1NBYB 4U3AA 5DS8B 4OZFB 2NCMA 3VI4F 4L3EA 4JQIL 2NMSA 2ERJB 1ZBVA 5FO7A 3LPPA 1RI8A 1WWCA 5CMAA 3TN0C 3HI6L 1IT9H 2P1YA 3E6FB 3WUGA 1AD0B 2JELH 3F7QA 4DVRL 2XWTA 3MV8D 1KT2B 3U4EB 5EH1A 1BVKA 1IAKB 1UCBH 5EZJB 1RUML 3BN9D 5E0CA 1QSFE 2GJJA 2JJVA 1X5GA 4RDQG 43C9A 3C6LC 5TDPA 3RAJL 1VF8A 7FABH 1MRCH 1P7HL 1UQYA 1KJ3L 2V2XB 2JE8A 5I1LA 1JN6B 1UM5L 2A1WL 2EKJA 4ZE4A 3WQ6A 2BJML 5IF0A 4GKSB 4GPNA 2DN7A 4NQVA 3W29A 4LRIA 4HMDA 5HYJD 3RPIB 1ETZB 4F58H 3EMCA 3KNBB 3MXVH 2Q3AA 3U1SL 5T3XE 5CD5C 1EO7A 1X5LA 3HNVH 3WS6A 1KULA 2CKRA 1H8SA 2YMXH 3DRTA 4D71A 3AMDA 2UYLB 5TDOA 4E5XB 4ZS6C 1HEZB 2WVUA 4MNGB 4KMQA 2VDPL 1VBRA 3QFJA 4P8WA 1TQBB 3KYMB 1YEKH 3E0GA 2VLJB 1EAPB 4QY8B 2H32H 3AHTA 3QUZC 4KKLC 2X1QA 3BWUC 3DV4A 4F9DA 5IHLB 5E2TH 3TN0D 1RZKL 5KOMC 3C2AL 1PVHA 4IPNB 3BAYA 4RGNB 3QDAA 2EE9A 2FHFA 2EC9U 4N0FB 3QUML 1NMBL 4OZGB 3BHBB 1JPGA 2LAAA 4YHYB 4UQDA 4BELD 4N0YL 1FH9A 4NGHL 1LK3L 3TBYA 3I02B 3BN6A 2VN7A 2D7TL 3MLRH 3NIGE 1P4IH 4H0IA 4XWGH 4QEGA 4Q9RH 4RMQA 4GINA 4HPGA 1JV5B 4PSRA 3JWDL 3ROOA 2Y25A 5BVJB 3WEMA 4MWFA 3PL6D 5A1AA 2EDEA 3CUGA 3WXVL 1LE5B 4TNVK 3QG7L 5IBUB 5GRZA 1BVNP 5F7NC 1QSED 1CFTB 2AQ1A 3KYAA 4F3FB 5GS2H 4CN1A 1MLBB 3N0PB 3EYPA 5KAQG 5DHVH 4HBQA 5EA0L 3MFGB 3L5JA 1OAZH 4OFYD 5E6ZA 5JHLL 4ZAKD 2AQ3A 2X4QA 2Z4QA 2KL6A 4M1RA 1CN4A 1CDIA 1JDDA 4P5TA 1QBMH 3QXWA 4KQ4H 3MJ7B 4GRWE 1GU3A 4OLYH 1VADA 5EZLB 2VZTA 3P30H 3P11L 1J05A 1OTUC 3OKLB 3I2CH 1BLIA 3VIPA 2PXYA 2GK2A 1VEOA 1XZ0A 3BH9B 3HCVA 1G9EA 1KR1A 1RH9A 3U79A 3GO1H 3I75B 2HLFC 3Q5TA 3F7VB 4JR9L 3THDA 3STLB 2VL5A 3S35X 1JZ7A 1BG4A 4P0DA 5KBNC 3G6AA 4LMQI 4W6XB 1OB0A 1BJ1J 5D8ZA 1CECA 1AC6A 2ZICA 5ABEA 2J8HA 4M6AA 2JIXA 1INEH 5BVPH 2DWEB 2QKIB 3RZCB 5LBSL 2BSTB 5E4EC 3HPNA 4NHUA 4Y8DC 3DV4B 4G7VL 3WFBH 3CC5B 1UOKA 4M61A 3RP1A 3C7EA 5C07E 4WCYL 1PQZB 2ZX7A 3BP5B 3IKKA 3X14B 2O9PA 3AROA 5D6CA 5C7XH 2YUVA 1T03L 4FQPA 1H6XA 3F7VA 2YJQA 3UAJC 2H26B 3AMLA 3MCKA 1UUQA 4DGIL 4AC1X 3HC4L 3FO2B 5HHMD 4NM4H 3MRFB 5KSBE 5FO9A 2B0SL 4XNXL 5LWYL 1CGXA 3PHOB 1XH2A 4NO5B 2WSPA 5IROC 1MPAH 3L4VA 2ED8A 3OL2A 5T1LB 4MJIE 1IGCL 1NFDA 5HYIA 5A8OA 1DQDH 5L0QC 4X4ME 3NIGF 4XP5H 1W9TA 2Y8KA 2F53D 4APQB 4Z7OE 3AFBA 3PHQA 1KC5L 4MQXD 2R0LH 3CLFL 4LEXH 4XZUB 2WVVA 5DQJA 1P7QA 1E4XI 1Q0YL 3ZE0E 3D3VD 5ACZB 4OGXL 4PMDA 4BFEA 1U6AH 1UA3A 2V3FA 4IOFC 3RM4A 3HJRA 1DLFH 3MUGB 5D7SL 4F2MA 1T3FB 4E2OA 1UZ0A 4RAVA 2QHLA 4EUPG 4WDIB 3MLRL 4F7PA 4EDWH 4F37K 2AERT 1YQVH 4OCXL 4PJGA 1D3CA 5D4YA 1KCSH 1X4ZA 4DM2A 2IBGA 1ZHLA 4OLXL 2HH0H 1FBIL 3MMWA 3G9VA 3WEOA 4DKAA 3CX5J 4J3XA 1HINH 2YIHA 3W9EB 3GMPA 4GG6E 4K68A 3VVGA 4Q2ZA 4WIQA 4YO0B 5DF0A 4X8JA 5GS0D 3KLSA 2WO1A 3OQ3B 3CSPA 5D2LB 3C8KB 4PP1C 1DN0A 4G6AD 1QI5A 5IOPA 2UV3A 1G7IA 4L3EE 4R3SB 1ZLUH 1CZVA 2O92A 1LP9B 4UV4H 4JN1H 4DGYL 1TZHB 3B8YA 4QYOA 3GBML 4WI4A 1F4YL 3DETD 3MNVB 4AW7A 4D0BB 4XC1L 3LKNB 3CC5A 1F4HA 2Q7YB 2DQTH 4X4XA 5DMJB 1A6WH 4X8JB 1QVOA 3HC3L 4F37F 4Y16C 3GSRB 1MH5A 1IAOB 4LNRA 5DUPL 3I50L 1OOAA 2AEPH 4PJ8D 3O2VL 4NT6B 1UQSA 4IISA 3EFFB 4MLIA 1EGJH 2P45B 5DJ8A 5EZOH 5GS0C 5CBAA 5E5MA 3MOQA 4DEVA 2BSTA 4LASL 4P2OD 2V9QA 1DWAM 3LSOA 1NH6A 2DIEA 3IFNL 3STZB 3B8SA 3NACL 3PBGA 2VR5A 2VZ3A 1UXWA 2PTVA 4WFFE 1ND0B 2Q8AH 3T2PA 1QSFB 3FFCE 4FFVD 4LGPB 1CLOH 2YD6A 3P2TA 4JRXE 1FNSH 3QUKA 4HUKB 5I1AA 3SE9L 3VXRE 3ACHA 3FO1B 3EMQA 2Y6JA 3O3DA 3U37A 1MLCB 3WMSA 3EYFA 2WLYA 3S5LG 2J1VA 4WGVB 3GRWA 4ZAKA 2J7FA 3AUVA 3DTXA 3IDXH 4HXBL 3DHPA 3FCTB 4OKDA 4TOYL 2Z1SA 4H41A 1MWAA 3O45A 1P2CA 1ED3A 5B4XA 1RUPL 4OB5H 3PP4L 3EO0B 3QZWA 2A38A 4R27A 4M4PA 4U0RC 3SDCA 1QLFA 2WANA 5KVFH 2F53B 2VDKH 4J3VA 5EFFA 3LQZB 1OP5H 1RD6A 4PTUA 2PI6A 5B8CB 1CICD 3B2UD 3SKMA 1XR9B 2AKRA 4GG8A 1XCTA 1BJ8A 1ZE3C 4FZEH 1ROWA 5DXWA 4F7TB 1EXUB 2ZSWA 3AU1B 1D5MB 2YRPA 4NDMB 3C9NB 1BD2D 5DT1H 5IJKA 5H35A 4C56B 1YEHL 2XA8L 5DRWB 4PGDB 4L4PA 4AD5A 3EYSL 4PLOB 3QPXH 1JXJA 3LVEA 3ULUF 2EECA 2B31A 3QEHA 3R1GH 3KPPB 5F1IA 1JGEA 3EGSB 4QHKJ 1B9ZA 4J27A 4HA3A 3C7FA 3SKJL 4JFFB 4I13B 3BCDA 1J1PL 2P8PA 4XHQA 2HTKD 4NO0D 4XNZB 4UILL 1JWSB 2GJPA 1ACYH 4JHBA 4FQ2H 4J3SA 2O5YH 3AIQA 4AZGA 3LEKA 4QHMB 4APQA 2FO4A 1H3VA 2R2EA 4OCWL 5ALCH 3U0TB 2XONA 5HHNB 2DWDA 5E94B 2PYEA 4OF8A 4AH2B 4P9HC 3HAEH 1H3GA 4PJDF 1MI5E 4KROC 5ADOL 2FD6L 1E40A 3MRQB 3V6OC 1E6QM 1U2HA 4BQ6A 5J4MA 2YLLA 2V2WA 3DX7B 5EU6A 4IMLA 2J4WL 4LCWA 5EC1B 2ADIB 5EC2B 2E4TA 1IGFH 4LFHD 4YR6A 4UR9A 6A3HA 3JXAA 5C0DB 3EB7A 3O2LA 4UBDC 4W50A 1HSAB 4DN4H 2IPUK 1QSVA 2IXVA 4IM4A 1HHKA 4JJHA 5JHDE 1KXVA 4JN2A 3LN4B 3MRLB 3U4EA 3FOMB 1G7LB 2BY3A 3QNYA 5DD6B 4A6YA 5DK2B 3SCRA 1NL0L 4F7PB 1SJVA 2CK2A 5E4EB 1GOMA 4LPVA 4OUEA 3B2VH 1QNSA 4HEME 4J8RA 2OI9B 4WU7A 1UXSB 3CNKA 5C0GB 2CK0L 3UJTH 2G8ZA 4WEBL 1WEJL 5DLML 2HRPL 4WVRA 1DVFA 3WO4B 3U0PA 2NX5A 5C09A 3THMH 5BV7B 4M7LH 5ESAA 5IMMA 5DJ2A 4AENA 5GZOC 5T3ZE 1QPPA 3PQYD 4KKLD 1DLHA 4M6MH 1H4PA 4P02B 4P00B 1T2QH 4YHEA 4K8RH 4Z7QF 1GGYA 3OKYA 4XWOD 2AVGA 1OCWL 5F9DC 3BPOC 4GMTL 4DGVL 4MNLA 2F19H 2WIIB 2OXGA 3PGCA 2XRAL 4M29A 2R8SH 2G5BB 3FT3B 2WO2A 4KJQC 4NQTA 4OFIA 3ARRA 2VDNL 3F2ZA 2VDQH 1MREL 2MKWA 3MCG1 1KLGA 4HOWA 2VDOH 4K07A 4FQ1H 4BQCA 4M1CC 4HH8A 3BP5A 4JIEA 2BVPB 1SY6H 4KK9D 1S5HA 3BP7B 3VU2A 3G6LA 3LKOA 4N0FA 1TUXA 5J11C 2DTSA 4ZFFA 4NC1C 5I0DA 4WHCA 4WENB 1JP5A 4KDTC 4GG6A 1E6ZA 2MPAL 4IBLT 2J4GA 5F1OB 4YPJA 3CK0H 5T5NF 5I1IL 3IJYA 4JY6B 3PZTA 4EANA 1L7IH 4P3DA 3RGVD 3SKJH 4MNHB 4NRXA 4LP4A 3U6RB 4Y0GA 1DQLH 3RILA 1JMZA 5DEGB 2BC4A 1P4LA 1K9FA 3QEQA 4V2BA 4FF5A 3S37L 1HSAA 4Y2OA 5ALCL 4G8EA 3CSGA 1DEEB 4ZUSA 1QA9A 2F8QA 4DW2H 3MLZL 8A3HA 2BNQB 4JKWA 1KELH 5BQ7A 3TFKD 3BEVA 1HOCA 3P77A 4AT6A 1ISWA 3GGWA 2O9OA 1CGTA 2BOCB 3AQUA 4YHZL 3E2HC 2W1UA 2XZQH 5F7LB 1P9MA 5J3HD 2DYPD 5I75C 4CD4A 4RMVA 3IU3B 1G7HB 5F97E 4B5EA 4X6EA 1CFSA 4GBXB 1CEOA 5A2AA 3VX1A 2I07B 3UTTB 3ARBD 4NRYB 4GAGL 5F9OL 5FV1L 1J84A 3WIFA 3SBWC 2ZXAA 4W7WA 2DQDH 1Q9KA 2EYSA 3JXSA 4TVPD 1BVKB 1YQ2A 5A16B 4NQSB 4POZC 1A9BB 4HOXA 5GRVK 3WBAA 3KLAB 2FJFB 4TVPE 3VFWA 4Y16D 1NCAL 3O6LL 1FRGL 2VQ1B 4GAJL 4FP8H 3TV3H 2NZ9C 3SGJC 2FL5A 2VZQA 2F61A 2A6KB 4DN3L 4NCC2 4WW2A 3WXWH 3L3OA 2IH3A 4JRXB 2Y06H 3HS0B 1HXMB 3U2SA 4XP1L 1WFUA 1TCMA 3MLSH 2R0KH 2DT2A 4HPHA 5BMFL 5BS0B 4GO9A 1Q9KB 1JF6A 1DLCA 1M71B 1WC7B 2NY6D 3L4UA 1E6XM 2Z0BA 4LYPA 4NKDB 3RUGB 1L0QA 1Y0LA 4YLQT 3SKOB 4RE4A 3AMCA 5E9DB 4LPCA 1J0ZA 3NFSH 3U0TA 4B9YA 5DZOA 4M80A 2DKUA 3O0RL 4O5LH 1C8XA 3SDXE 3RM8A 2RB8A 2FR4B 5T5NG 1D9KD 5GS1C 1U33A 1W1PA 4WI8A 2YN5A 2J7MA 2R2HA 4JL1A 2SEBB 5ISZA 2GKIA 4G6JL 4KK6C 5I73B 4R7DA 1IAOA 5JA8B 5EU6D 4Q0XL 3GB7A 1IQDC 4KTYA 1X5IA 3MUZ1 1FJ1B 2YC2A 3DUUB 4NJ9L 2J47A 5IFAH 2YD2A 4XRCA 3HA0A 4J23A 2WAGA 1V7MH 3HC0A 4S1DD 3OMZA 2NXYD 4PJ5D 3PJSB 3PN8A 3RA7H 1ZGLB 1OTTD 1TJIH 2NW3B 3EOTH 3QG6B 3KPOA 3V0WH 2W46A 3QAZB 1AXTH 4BH8A 1T1ZB 3BGFC 2JF6A 3RWGB 1W0WA 4QOKA 3GHBH 5DFTA 4IMLB 4QRUA 1FLRH 1UB6A 3O3UN 3BKYH 2W9XA 2XKNB 3O6FA 4P46D 2VX4A 3P4NA 1FFPB 4S1SL 1AR1C 2O93L 3JZ7A 2ESVD 3T2NH 5LXGL 5E0FA 3SUSA 2CGRH 1OF2A 4LSQH 5IQ9B 2CO7B 2NY4B 2R1XA 3LZFH 4JPIA 1WZ1L 2J88L 2Y64A 2BVEA 4U1HA 3IVKA 1PZ3A 2J79A 3RX8A 2DSVA 3W0WD 1MCSA 2OX5A 1U41A 4OCRL 2E5EA 4RRPA 5KVFL 4LCIL 1F4WH 1NMCB 2Q1EA 2EIDA 5EOTB 1WF5A 3PXJA 3MGTA 3GJFK 5EUOA 4AWEA 4LKXA 4AENB 3IB4A 3ZTNH 1NGXA 2ZX9A 3W9DB 1L7TH 5DRXB 2IANE 4G6ML 3MV9D 4Z8FH 4MQTB 3AICA 3VGAB 2DS4A 3RTQA 5BROA 4P9HL 3TZVA 3NDZA 1RJLA 5E03A 2XYCA 3CUJA 1RJZA 2FX8H 1XCXA 3IXAA 2HAZA 1XCQA 4MD5A 3ZT6A 5E9AA 4MDIA 3VXNA 3D85B 1ZJBA 1NCNA 1BSIA 4JFHD 4Z5RB 3WXWL 5A3IC 1X5HA 2CH8A 3RGVA 1C8PA 1FYTD 3BZFA 3C5JA 3UTPD 5CUSL 1GJIA 2Q8XA 3MOBH 1E3XA 4FQIH 4L8SC 7A3HA 4GRMB 1KJMB 5GGTL 3F6IA 4HUWB 4O51B 4A41A 4HS8L 2J25A 1UQSB 5AZEH 2JEPA 3CZEA 1X6NA 3P0GB 4KRPD 5L88H 4R90H 1BFTA 3F7YA 1U8PB 3W27A 3WIHL 1F3RB 3KZSA 2OBGA 2NY1C 2AMGA 1G1YA 4PTXA 1CICC 1W0WB 1A0QH 4QOKB 1FCCA 3VFPA 3SE4C 1WICA 2VAAA 1FDLL 5AZ2H 2ZIDA 3ARBC 4XPTH 2BNRE 1VKXA 2V17H 2D2OA 5JA9A 3GFUA 4X6CE 1LE9A 2WVVB 2X4NA 4LRNH 2K1MA 4LAQL 3OX8A 1CU4H 3IDMA 4AD3A 2X70B 1X1NA 4OJYA 2PTTB 5I2IB 1M7DA 3B9KA 1PKQE 3WFEH 4UUJB 4P5MB 3I6GB 5HHQA 2W65A 5KOVC 3BX7C 4ZAKB 1TIUA 1N2RB 2CBJA 4Y1AD 1DWJM 3M07A 3RVWC 1I3UA 4ZDHA 3BAKA 4M9PA 2W1QA 3HPJA 5IJVA 5D7JB 1BQCA 1ZWIB 2WSKA 1NUKA 5D7KE 4G6KH 3SGJA 1FNEB 2AV1B 3ACGA 5F1NB 1CTNA 1IKFL 2XOTA 5D96C 1I8MA 1EIBA 3SCMD 1EO5A 1I1FA 1FIGH 3NCJH 3T1WA 2AJUL 3M8OH 3L5WB 2AJVL 3O2DH 2GY7B 5FK9B 1V7NL 5I71B 1MPXA 3C9NA 5B22A 2FBJH 3CJJA 1B3JA 1IZJA 3A0OA 2IG2L 3NIFF 3TH3T 1JPTH 5BOZG 1YMHA 5HYSG 5ECJE 2BRRL 4HF5H 1OAYH 5F7EH 4L1HA 3K75B 2RJ2A 4GRWF 4MD4A 2GUOA 4GO6B 2CUIA 1CQYA 2BNUA 4OCXH 4M5ZH 4PJIA 4Y19A 4PRDA 3N11A 3AGVA 4HIXH 5KJRH 4KKAD 1BLNB 1JRHH 4MDPA 5ERWB 4ISVA 2R0ZH 3HTLX 1FAKT 1N6QH 3N1GC 2EJ1A 1Z2KA 4Z95H 4BQ3A 4E5XA 5E2WL 4OZ4A 5ID0A 2F5AL 1T83C 2D31B 4PJAB 1T5WB 2FX8L 4NQEA 1B2WL 2NY0B 5A8MA 1T20A 4JY5H 1P69B 4X98B 4QY8A 2DDXA 2G3IA 4EN3D 1B0GA 2J7CA 5DJXB 4Z7VB 4HBCH 3CVHL 3FONB 1E4WL 3TA3A 5DJAA 2DQXA 2X42A 4JO2H 5C0BA 3MRIB 1TA3B 5E99L 3LOWA 3KGRA 4DVBB 4AEHL 1A47A 2VL4A 1HVQA 1UWXH 7TAAA 2FDMA 5HD8C 5D1XA 2ESVA 3FZUD 5KZCD 3ROOB 1G7LA 3MXVL 4WUKL 1X5AA 3RI5F 4DK6A 4WHDA 1H3XA 5D71H 4CNIB 3TA3B 5I71C 1NUNB 4OUOA 1VFBB 2G3MA 1BOYA 2GFBB 5C07B 4DXTA 5DN2A 4TUFA 5A8PA 1CLCA 4G8FA 3JSSA 4U6VL 1HJVA 3W0WA 4P5TB 4AK1A 2WIMA 1RAMA 2XKNA 4G6FD 5DMGD 1LVEA 1I7RB 3NIFE 1C16A 4JDVB 3ZDZE 2VDPH 2XWTB 1YEDA 2ZG3A 3CSBA 2HVKB 3ROLA 2DCKA 3RJYA 3UYOD 1FL5B 5ICXB 5E0QA 5F3BA 4PGZA 4B15A 2W9EH 4Y5XC 3SDXB 3V5KB 1EFXA 1BX2A 4H1LB 2RFXA 4HWEL 4AIUA 4W7VA 3T65B 1W72H 3MXWH 3VXRA 2GT9B 4ZPVA 1UVQB 2X4RA 1LP9A 2KZ1B 4G43B 1NLDH 4O00A 5EWIL 1LE5A 1QKZH 4G5ZL 4PJIB 4YDLB 2GK1A 4S3JA 4LSVH 4M1GL 1GIGL 3ARBB 1ORQB 1TNMA 3MREA 1SYSB 3TV3L 1CD9B 1FYTE 4TVSa 4DWSB 3TH2T 5JXAH 1ZHNA 4D8PB 1GQLA 5DRZA 2W62A 1REIA 5CSGA 4OD2A 3IFLL 1D6VH 1NEUA 3ECBA 3GMRA 4RL3A 3DBXB 4LLVA 1HXMA 1NEZG 2APWA 3U2SB 2W4XA 4IOIA 4M6OH 1QFPA 3NPSC 4NDMA 4TSAH 1PQZA 2VLKA 2VNCA 1G6RL 5FYKE 5BOPA 2CLRA 5IVXB 3D39B 1RZFL 4RZCA 4YDVB 2X89D 2YRZA 3QAZC 4X5WA 4Y5VC 1KQZA 2Z8VC 2AP2A 1I1YA 4KY1L 1Z6JT 4L8SA 4U7KA 3ME0A 2DM2A 2J8FA 2FZ3B 5F71A 3T8XB 4NOFA 1E6NA 3F12B 3DBXA 3SDAC 2WWCA 2X4NB 3RMEA 4OT1H 4Z7VA 2ZEYA 2CBUA 4JFDA 1D6EA 3MSDA 3IETA 1MCPH 3I2CL 4PGJA 3MR9B 2I27N 1VBUA 3QIUB 1BFOA 2B4CC 1E4KC 2VKWA 4YDIL 5JUEH 1E0VA 2OSXA 2P44B 1CLVA 2BVUA 2I5YL 1UM6L 1MWAB 1YEGH 3O45B 4LCCC 4PRHB 1BTCA 1FLRL 4Y4FC 4LCYA 3BDBA 4Z9KB 2VAJA 1IE5A 3SKUD 3LEYH 1TDQA 4F9PA 4O02H 5D2LA 2CKNA 2DJSA 4OM1L 4UT9H 1WFTA 2EE3A 4NZUL 2W1NA 3FB5B 4XBPB 2HH0L 5CBEB 1ZBCA 4U6VH 3QHMA 5GGSB 4PJ9B 4R7NA 1I1FB 3KPRD 4K3EL 2UWEA 1R64A 4JM4H 5INCB 1FSKC 3F5WA 1XGQB 1UA6H 3E8UL 5HYSB 4IDLA 4DWSD 1EDTA 2FJHA 5BW7C 5D2NC 3L3JA 4DWHA 1XF1A 1AI1L 2D4FA 4QRPB 2UYLA 2GJZA 5IUSA 4NT6A 5KVGH 4Z8FL 1G0YR 2X4UA 4CCDA 2RQ8A 5DO2C 2R0LL 4MD5B 1AGFA 1D7PM 4BFBD 2F15A 5E8OB 1SVZA 4HLJA 1JGVL 1IQDB 4TUOA 2A73B 4X4XB 1U36A 4BZ2L 3VRIA 4RE2A 2NY6B 2J8OA 1FGVL 2P8LB 2MQ3A 4XVTL 5I1HL 3GZAA 3ISWA 3UJIL 3R0MA 1HSBB 2O5XL 1PKQB 1CXIA 4Y5VB 5HHNA 4HEPG 4ZFOL 1CQKA 1HKKA 4I0PC 1Q0XH 4LSPL 4EJ1C 3FRUB 4JY4A 1T2QL 5IGXH 2EEXA 4MAUH 3L3HB 2HLAA 3CSYA 2J78A 3PTKA 3D85D 4XH2B 1P53A 3ARFC 4M3JA 3AIWA 5C71A 3QHFH 1R87A 1N8ZA 3ZJKA 1LD9A 5E8OA 3O2WL 4ORGA 4AL8H 5L88L 2ZEZA 2ARJQ 1Q94B 2GDVA 1Q9LB 2EKSB 4KPHL 4KI1A 4BH8B 3DARA 5HYFA 1I3GL 4Q7DA 3OKOA 2DJUA 4M93C 3F12A 3BHBA 35C8L 2BC4B 4GKZB 1W9XA 1BEYH 5MHSD 1DANU 3K81A 4ATLA 3AJ7A 3NCYS 4HWNA 5CBAB 4RAVB 1G6RB 1HQ4B 4ENED 1XV8A 3SE3C 4WEUD 2NY5L 5DSCB 4UUJA 4JLRA 3H7LA 1AD9A 3WDIA 3LQAL 5T3XD 3VXRD 3DURB 4H8WL 2VJXA 4KUZL 1CDYA 3QI9B 1ZWIA 3E6FA 1O7SA 4P46B 2E9LA 4AD0A 2XRAH 1JZ3A 1QHOA 1UT9A 2UUDH 4JPWH 2QEJA 4P59L 3VGDA 3LN9A 4G42A 3WSQH 5IKCA 1CBVL 3FN0H 4AM0A 5H94B 4YFLF 4LSSL 1RZGA 1ZLSL 3PP3H 3NSXA 3HLAB 1ZBKA 3RWIA 4I5BA 1OF3A 2NPLX 4UQCA 3D2UD 4QDMA 4JJ5A 3QO0B 1B3ZA 1MW2A 5TJWK 4HZAA 1HCVA 1EEZB 5CIPH 4JE4B 1R8LA 2BRRH 2A6DA 3GXFA 4MMXC 2QADB 2P5WB 1VEPA 3EGSA 3N1QC 4PJBA 3VXPB 3JTSA 1B4JH 5DT1L 3HNBM 2EZ0D 4PT6A 3U0PB 4DOHE 3FFCA 4WO4B 5A6MA 1E4LA 1UYWL 1C12A 1DHKA 5T1KD 3QT2A 4Z2JA 1GGIL 4KHTH 2FJGB 1QSEE 3UEZA 2H3NA 1NEZB 2YWZA 5F7YC 2FIKB 2QSQA 1A6ZB 3CAFA 4W5UA 4CBPA 1NMBH 3SKNA 3TYFA 1S9YA 1MIEH 1OT2A 3H9YA 5KVGL 5D7JC 5HGAB 2A3AA 3ZHKA 3JVGA 4GBXD 3RHWK 3AY4A 2YD4A 3CCHB 3ZTJG 1ZT7B 3LRSB 5SWZA 1OGTB 1F3DJ 3MLUH 3RGVB 2D24A 3IS0X 3FHQA 3AHVA 3H2WA 2J7LA 1TPXB 1CZ1A 3GGLA 5D7IF 4WWKB 1YEJH 4BSVB 3CMJA 5FO8A 1N4XL 3VFUA 2E6QA 2CR3A 5JQHC 5ACZA 1LD9B 1LO2L 3ARZA 4JGMA 1RURH 3OLIA 3BSHA 1MCLA 2D03L 2FR4A 5IT2H 4AD4A 4AQOA 1INDL 3GI9L 3SBWA 3MUJA 4MA3B 5IIEB 2ZEWA 1HKLL 4JZ5A 1J0KA 1ZT7A 2GVYA 3GIVA 5DT5A 5KSUA 2BERA 2GK0B 2OSLA 2BXZA 1B6UA 3DTXB 3N85H 4U1LB 1R0AH 1NUGA 3JWDC 4Q22A 1A1MB 4X7CC 1FVCB 1MHCB 3ZYOA 3BDXA 2A1WH 2EDBA 1VACB 1MLCA 3PP3K 3QEGL 5I30L 1BAFH 3R1GL 2J6EL 2JTDA 3MLSL 3BMVA 2CUMA 3KPRA 3TO4C 4MA8L 5JIWA 2ZNXA 5HHPB 3GMLB 2AI0L 3GMPB 4RA0C 4DZBA 2OTWA 4M7JH 4ODUA 1KTRL 4LVEA 2W9DL 3K2UH 4J3TA 1NKOA 3QNZA 1CXEA 1IGIL 3W2DL 4Y2DC 1KXTB 3MLTA 2BZDA 1XGPB 2X1PA 3BUTA 1LL6A 5BZDB 3UPAA 3QISA 3R8BB 4RISL 4D0BA 4XZUG 2EDFA 1VPOL 1PZ2A 4P23A 5FK9A 5HHVL 5BS0D 3HZVB 2E6JA 5DVNA 2CDFB 4WI6A 3CMOH 2B7DT 3T65A 1CD8A 5T1KB 4X4MA 2QV4A 4XPBH 1K5NA 1W1YA 3LKOB 2X0HA 5ENWB 5KSBA 4HZ8A 4XMPL 1MI5A 2C4FT 2WCAA 3FB6B 1MIMH 3WUZA 5FD0A 2EDDA 5DWUH 2VLJD 5HYQB 2V38A 3QYCA 5EUOB 1E0OB 2WDBA 3UTTE 4ZXOA 1KXQA 3LH2H 4MHHI 4N9GB 1OSPH 1KLUA 1I5PA 5DJ2B 4CVXB 3GHBL 3VD4A 4LPTA 3C2SA 1D5ZB 3JWDH 4X0VA 1FH5H 2RHEA 1ORSB 4HJ0D 2O5ZH 1EX0A 1K9TA 1RUMH 3K74B 3ARDD 4OUUA 1NFIA 3K0WA 3BAEL 4JY6A 5F7FA 1U6AL 1H15B 4QHNB 2WXDM 4R4FH 3WUWA 4NHUB 1AIFB 5HD8D 5KSVA 4N0RA 4EBQL 5E2TL 4KI5D 1I8KB 1KB3A 1OSEA 1FVCA 3REWA 2P8MB 3KXFE 5IFHH 3I85A 2EDWA 5TDNA 4E8CA 1M6OA 4GRWH 4K3DL 4UIMB 3FOMA 5CLWA 3QDGB 4IDJL 2CKSA 4HA1A 1MRFL 4UFJA 2ESVB 2W94A 3PZGA 5EOCL 1MY7A 2D3LA 3ZL4H 1F2XK 1K4DB 4AMKL 3U83A 2EDHA 2ICCA 2ZPKH 2VXQL 3I97A 4YR6B 4MNGE 1N2RA 4O02L 4L9LB 1RIVL 5FYLE 5IR1A 4PGCA 1F2QA 1MY5A 4PRWA 3QXTA 4EUPH 4G3YL 3RPIA 1VCAA 1Z9SA 3EO9L 3UG3A 1GQKA 4DFIA 1DVFB 2H1PL 1K85A 3QIUC 2CLZA 1BWWA 5EG6C 2BOBA 4QDQA 2HG5A 1T1YB 3MCLL 1V08A 5J7CC 5T1KA 4K3EH 5DRWA 1DQML 3X13B 3X3GH 3PL6A 4NM8L 3EYSH 3HC3H 1WIUA 3ES6B 4LNVA 1OTUD 4KRPC 4QRTA 3BGFB 2EPMX 1C1EH 3BUYA 4KQ4L 4BA0A 4GXUN 5BV7H 1XGQA 3TVMD 3WKML 1UH2A 3CKHA 3DMMB 5AC4A 3M17A 3S35H 5F44A 4UV7H 4C56A 3VGGA 5I78A 4M61B 3VKKA 3DX6B 4KUCD 4FZ8L 4HUWA 4O51A 1QOXA 4HW6A 4BZ1L 3KLAA 4ZFFB 5LKNA 4YBQC 1NBQA 2C4XA 4HS3A 4EOWH 1Q0YH 3WUBA 4QXGH 5GRJH 2WZ8A 2IFFH 2X1IA 1UY4A 4AZCB 5DWUL 3KJ6H 5ABHA 1Z0MA 2VXSL 3BE1L 5HPMB 1SBSH 3NMEA 3JWNC 2YL9A 2V5CA 3F5JA 1N5YL 1R5WA 2XYLA 4D6JA 4QHMA 4P4RA 1G0DA 3MRKA 1UY3A 3G9AB 1NOFA 1F3JB 2PWHA 1A2YB 4J7RA 4U6YA 5KVEH 4BK5A 1OAQH 3T8XA 4PG9A 4MVBC 5K93A 5KANG 3MMDA 4XNXH 3RDTB 5LWYH 4P3CH 2HT3C 4JFUA 3B83A 4RYDA 4Y2DB 4HH9A 2DOCA 3RPKA 4ZUTB 1G9NL 2D1ZA 4AZ7A 3OBAA 5F6HI 3U5YA 4MQXC 5D6DC 2VURA 4ONHA 1OAYL 4F58L 6FABH 4X7TA 3D18B 1VESA 1QRNE 3UTQA 3RCNA 1KXTA 1XMWA 3IGAA 5TDNB 3WDQA 4JZOB 2DMBA 4WLCA 1E4XH 3SKJE 4U6TA 5EB8A 5E24E 5DK2A 3HC4H 4Z2GA 5EBLA 1LDPL 1Z5LB 4NC0B 1RJLB 3MRRB 3QNZB 2J3SA 4PJCF 2F53A 3B9AA 4PS4H 3ZDYE 1CDGA 4JVUA 2QSCH 1CT8B 3CXHK 1JF1A 5IXEA 5GSRB 5MP6L 1JI1A 2A6DB 3TYGL 3BPOB 3EYQD 5G04L 3CDYA 1Y6NR 2G5BA 3J8F7 3QZWB 4XAKE 3ZTNL 4QB6A 3POHA 2BHYA 5SWSD 2OZ4H 3SDDC 5A2FA 2DI8A 4P23C 1IBGH 3NACH 3ES6A 2XG5A 3MCLH 5FFLA 1ZBWA 1WZLA 2H26A 5JPMA 1R7AA 2E31A 2ADFH 3GSXB 3HG1D 1CFNA 1U8OB 3FQTA 4H5SA 4LNRB 4PREA 4U31A 4CN4A 3DETC 5EJZB 4C7FA 4OZHB 3VXTB 3QFJB 3VD3A 5DO8A 5BRPA 2HTKC 1C7TA 2DBLL 4IIQA 1WZAA 3VW3L 2DT3A 5IW1B 2BVDA 1KIRA 1FNFA 3B3IA 3L3KA 1JHKL 1PKOA 5L8JB 2WHKA 3CCHA 3BZ4A 4O58H 4LKXB 4X9YA 4QXWA 4CW1A 1NKGA 2WZIA 4LX4A 1NDMA 4NZDA 3CVIL 4PTVA 4H7VA 1AMYA 5F7KC 3WIIH 1NEZA 2FSEB 1OAZL 4ZS7L 5GHWH 5J12C 4OLVH 5F1SA 3VMPA 4OGYL 3NTCH 3RWFA 3RI5K 4U3XA 4WNQB 3BP6B 3B3IB 4LPWA 1S7QA 4FFYH 2R9HC 5D2LE 4JVPA 1T22B 1FL6A 1UZ1A 4N9OB 4L3EB 2W59A 4U5KA 4MJ5A 2VC2L 2IQ9H 3C8DA 1UB6B 1MSPA 4DVBA 4AZBA 1YDPA 4KK8D 3TBVA 4XZUA 1P2CB 2VZSA 1PZUB 5BV7C 1A7PL 3D69B 3T08A 3GSQB 5I8KL 5EO1B 1OAUH 4WW1A 1QLEH 1EGZA 4XPGL 2R0WL 2DM3A 3CIQA 3MBEB 4JFFD 5SWQA 3UESA 1GHFH 1JZ5A 2OSLB 2V7HB 2C5DC 4HCRA 4FQQA 3TESA 1EV2E 3QO0A 4NI3A 2NW2B 5IBLC 2GUOB 3WBDA 1I7ZB 1F42A 3TTQA 3PZUA 3ZKNC 4NKIH 3L3OB 4JRXA 2EEDA 3MGTB 4LDLB 4GQ9L 3T4YB 1NCUA 2JB6B 4PP2A 3VIOA 5HJ3B 3SEPA 1O8PA 1F11A 4HX1B 1W2VA 5AWNH 4QCIB 1B31A 1BAGA 2VWEE 5BYWA 3IRPX 4PB0H 1IGCH 4PUBH 1WDRA 3PV6A 5JIKA 3U7WL 3DSNA 2V7NA 1KIUA 4M5ZL 1X5YA 3BH8B 3RWCA 2A6KA 2E7HA 3K8LA 3IRZA 5E5MB 1HQRA 3OEBA 1PIFA 2D22A 4PN2A 4NF7A 5F96L 1S9YB 4ZUUA 1MHHA 1O6IA 25C8H 1CU4L 1U3YA 1HKFA 2Y1VA 5CSZA 1AO7A 5EBGA 1PX8A 1EHLL 4RA3A 4QO1A 3QDGE 5E8EB 3A3HA 5T33H 5E00B 2ESVE 1HH9A 4OFPA 1IC1A 1S7WB 3VI3E 3AIRA 5J89A 4OD2B 4Y5VA 2YD9A 5C0CD 4JEGB 2XPGA 3C09C 4HS6B 3CFIC 4RIRB 4HLZH 4DUVA 3NA9H 4W70A 2HFGH 3FY1A 2KH2B 4YHMH 1ZHKB 1HI6A 1JYWA 1C8YA 1QYGH 4MA7L 1TCRB 3GO1L 5ETUA 4DW2L 5IVOA 3FFDA 5HI3C 1YPZB 1F4AA 4CU7A 1HSBA 4JRYD 3GRWL 2Q76A 3MODL 3MRCB 3WD5L 1OAKH 3W6MA 5EIYB 1WWAX 3CZLA 1INEL 5F9JB 3WD3A 4O9HH 2RV9A 4A3ZA 2PWEA 4XBEL 5LBSH 4C56E 2Y6HA 1S5IL 4UNUA 4H8UA 5J3HC 2CGRL 4M6NH 5HPOA 8CGTA 1CIYA 4APQD 5CBEA 3EAKA 1NAMA 3D39E 3NIDE 4WTWA 4KXZH 1B30A 4R4NC 2PYED 5EBAA 2HA1A 5EU3B 5F1NA 1JNHB 2KD7A 3ULSB 2HJKA 5JW4N 3OKLA 35C8H 1MCNA 1NLBH 4IOFD 5JOFB 4M82A 3VXSA 5CEYB 1S3KH 1I9RH 4NNYA 3OHXA 1QLEL 5H94A 1CE6B 2DL9A 4R6UA 1A3HA 1XF5A 3LB6D 1SY6A 4HQQH 3NJXA 3BC9A 3VGHA 5ADOH 3DYMA 3KLHC 1CBGA 1ADQL 3L6FB 5DO2D 5C0EA 5CZVL 2QMJA 5A3HA 3KPTA 1ESWA 1UY2A 1OTSD 2JB5H 1F4XL 2WBJC 1M05A 3PGDA 5L2JA 1BX2B 2VM9A 2EDYA 5EO9B 4PMOA 3LRHA 2LE9A 4JJ5B 4JG1L 4AYFA 2EXWD 4TTGA 4MD4B 4FTVA 2E7MA 2VXTL 1BM3H 2N4IA 4NQVB 5JHDB 4FZ8H 4GMTH 4X6FB 5IK3B 4FN0A 1BGGA 1DBAL 3BOVA 3RWJB 2VLKB 2VX6A 3WH5A 2NY3D 3TZVC 2NX5D 5C09D 2DMCA 1H0GA 25C8L 2FH6A 1BIIB 3VD7A 2B1HL 4NZJA 4EIGB 3IXTA 2NYYC 2P7TA 3VA6A 1OGBA 3SDXF 3MACH 5SV3A 4QB2A 4M62H 4XPTL 3UDWC 5I18H 1WJ3A 2QHRH 4YHPA 2X05A 4GAFB 5IHZB 4YHKL 1C7SA 5HYJB 4WUUB 5JOPE 1IC7L 1MYRA 4XVHA 4PBWD 1C92A 2BNQD 1RU9H 3GSNB 5J13B 2R2HB 3RAJH 2W66A 2IC2A 1IM3B 3I50H 4PGEB 1FHDA 1MVUA 2NY0C 3DXAE 3BZDA 4NWTH 3BXNA 1JD9A 3CFCH 2QQKA 4B50A 4JAWA 2F8XC 1KIPB 5FO7B 3UYPA 5AYBA 1AGCB 4M4RA 5FO8B 2ORBL 3QIWC 2AJXH 3D5OF 3UNPA 1MFAL 2C7UA 3RVXD 4UT6H 5C08A 4YDKL 5IB4A 3TT1L 2A6IB 2AK4E 2FB4H 2X70A 4R2GD 5LQBL 2IANA 5ICXA 1IAIH 3MV7E 5F3BB 5FKPA 3CFEB 3ZM8A 2L7UA 1E4NA 1NFDF 1N64L 3AAZA 3WF2A 3LQMA 3TTSA 2NXZD 3F6LA 1BFOB 3QQ4A 5M5DA 5BXFA 4M48L 4RGND 1CWYA 2VITB 2YKLH 3QDMA 4RFEA 5E6ID 5I15H 1A9EB 2VQ1A 5KAQF 2OP4L 2XWEA 4OF7A 4HIEB 4PJXA 1UWXK 1LEGB 2EO9A 2LQRA 3HMWL 3MYZA 2R56H 1F8TH 5HYSA 3Q0HA 5E8PB 1O5DT 1UR0A 5D7IE 2DEPA 3VFGH 1CR9H 2BVOA 1W3HA 3A7QA 3QIBD 4XC3H 4UZGA 1N6QL 4NYLB 1B6DA 1YMHB 1S7XB 4Z95L 5CUSH 5ELIA 2ATPA 4P5KA 3QUXA 3PL6B 1IVLA 4M7KH 1XC6A 2MCPL 4FQLL 3CPUA 5GJSL 2V5MA 4QRRE 5ITBH 1FP8A 1T7WA 2V6HA 2BNQE 1KJVB 1JDAA 1D5BA 2XWJB 2CDOA 4JGJA 4FQCL 1J01A 1TVBA 1NGXB 1SHMA 1EZVY 3RL2B 1E5JA 2DTMH 4HDIB 3OR6A 1ZANH 1DBKH 5TFSH 4Y16A 3DV6B 1A2YA 4U6YB 1HEZA 1JNNH 1ZXQA 1JNEA 3GH5A 1BAFL 1Y6KR 1N7ML 3BPLB 3OF6A 3WIIL 4U1GB 1CLYH 4MA8H 5DJXA 3WD4A 1U8LA 4OLVL 4X80H 1OD7A 3DSFH 4RAHA 1FIEA 2CLRB 3TIDB 4OGXH 1E43A 1H1NA 1EFQA 4GKLA 3NGBC 4FS0A 3RL2A 3QPXL 1ND0A 2Z1KA 3CZFA 4JFOB 3THML 5E95B 1OP3H 4MWFB 3UJJL 2FZ3A 4J12A 2FH8A 4YEEA 4KQ3L 4HWBA 2QQIA 3QOKA 4K9EL 1QSEB 3RDTD 1J18A 3NIYA 3ZYJA 1HHKB 4I9WE 1I7RA 4TX6A 2BSSB 3ORJA 4PY7A 1R3HA 1EVUA 2CYGA 5J1TC 3ZQ9A 3RWHA 2CEQA 1LF1A 1XEDA 2BGOA 2J75A 4HKXA 4BZ2H 3QUYB 2IADA 5F3HB 1EHXA 4HJJL 3TPKA 3QQ4B 4QGTA 1Z5LA 3HEIA 3VXUA 4BFGA 2Y36H 4IHOB 1B88A 1IARB 3U46B 2YXFA 4Y19E 3IIIA 1HJQA 1X4XA 1NLDL 4YK4B 4PJ7B 3PDGA 1S7RA 3JTSB 3MUGA 5TE7H 3I3BA 4M7ZC 3MS8A 4FMVA 2PTTA 5I2IA 2OSYA 2VQUA 1HX0A 3BH9A 1IC4L 4XVJH 1XGZA 4JQVC 1V3HA 3CX5K 3IU4H 4N8CH 4QOKD 4AT6B 3C8KA 2HT2D 3F7RA 4IRSA 1MRCL 3IFOA 1WFOA 3KYKL 2BV9A 3EO1B 1MPAL 4B3LA 3X3FL 3DECA 3AREC 3O6FD 2XZCH 1NAKL 2NYYD 1WZMA 1UEYA 4RNRA 1OIFA 3VNZA 3L7EB 3QQ3A 4XZWA 4EKXA 3FHAA 5DJ0A 1G0CA 4FXGB 4P9HH 3VG0L 3NABL 2V2XA 1TQCB 2VC9A 5DD0L 3RUGA 5GJTH 1H0DB 1JPSL 1EJOL 4F7CB 4Z77A 3D3AA 2QL1A 3U7YH 5HGBB 4YHGA 1WBXA 2CLVA 1VENA 3RY4A 1SJEB 4ORGB 4TQEH 3WNKA 1CLZL 1VFAB 3QHZL 1KCVL 4XCCH 4EDXA 2BGPA 3RWGA 3FONA 5GRUH 2FYYB 4CUBA 2NY6C 4QF1A 2KPNA 2O9RA 3C2AH 5T3XH 2YG0A 1MCOH 4ENEC 2GJXB 4PBGA 4FXGA 4OLXH 2YFUA 2ADIA 1ZANL 5EC2A 1QTYT 4ZXBA 1FBIH 5E2VH 4AZ5A 4ARXA 2XA3A 3L1OH 1ORSA 2W67A 2IJ0C 4IMKC 4G6MH 4NO5A 4X99A 4L8CB 5C08D 4R0LB 5F9AC 1QFWM 3MLVL 3F8UB 4F2MB 3QIUA 3TVMB 4FLOA 3CX2A 1HHGB 4NZTL 3EJZD 3LKSA 2F5BH 1Z9LA 5C9JA 3AC0A 1Q1JH 4M93B 3I9GH 1TA3A 3MXWL 4ETYA 3G5ZB 5INDA 3ALWA 2HFEB 3WJLA 2YHGA 3QDMD 4IPLA 3WCYA 3RKDD 4N0UE 2VI0A 3C60D 3LKQA 1AFVH 3HI5H 4PJ8C 2VABB 2JEQA 4M7JL 2MCG1 1GOIA 2A3EA 2ZUUA 3QIBA 3WBEA 3T77B 4PB9H 2VLKE 3VIKA 1FQ9C 3L3JB 4Z76A 2EO7A 1F58H 4WKAA 2R1XB 4JPIB 3UTQB 4OTXL 3VIFA 3GK8H 5I6XC 3HS0A 3MJ6A 1RVFL 2G4FA 5J9PA 3KYOB 4MXQC 1O7AA 4BUGA 4DEPC 2E0PA 3CDGA 3LMYA 4CKVX 1BQHB 5T5FL 1JWMA 5F7HA 8FABA 5IT2L 5HYJE 3FT4B 4LHUD 3ARQA 5IWLA 1INDH 3GI9H 1GUVA 1NGZA 1WWBX 2IG2H 2ADJB 3KWWA 3MRJB 5ACMA 1D5ZA 4JB9H 1IRAY 1CXKA 4JQIH 4RDQF 4M8QB 4Y1AA 1G9NC 2W95A 3OKKA 4X6CB 3SGEH 4RMUA 5I1GH 5I6XB 3VXPA 3VGEA 1ZVHA 4MJIA 1CXLA 3FB8B 1U9KA 3EJYC 4XAWH 4IRJA 3ZR5A 1T1WB 3GJFA 4OI9A 2QMKA 3WLWC 1OD9A 3QCUL 3VFPB 2AJZA 5JDJA 1KF9B 1S9WB 4LDEB 3QH3B 4RMTA 2P49B 1FFRA 2AK4B 1LWRA 3BXWA 2GTWB 3ESVF 3RKDC 4GLRH 2CCRA 3DRTB 4UTBL 1RUPH 1KPRA 4OB5L 5CPQA 4AEFA 3PWPA 3RDTA 2VLRD 3KPPA 2A83A 4PRPA 4G8EB 5I1DA 3NRUA 2Z91B 3RVXC 5IM7B 3JTTB 1ZT1A 1TR1A 2VZUA 1NCTA 3STZA 1Q9OA 3LN5A 4BS0A 4PJGE 3L4XA 4M8UA 4F8XA 5E70A 1O7VA 1W72A 4NQXB 2AABH 2VAAB 4NZUH 5HHOA 3QJHA 2V4VA 3TIEA 3ZE2E 4L29A 2WZEA 3NSNA 1MIML 2DQTL 4L4TA 4WJ5A 5JMRA 4HWZB 1H3WM 1L7QA 1SYVA 2CRIA 4HPYH 5ANMA 1UJ3C 3HZYB 3A6CH 1WDPA 2F74B 3HZMB 1FHGA 5J6HA 4HP5A 3CHFA 4PUEA 4N42A 1V3IA 4IRSD 1MHPL 3KYNA 3UTZB 5FM8A 5ADPL 3FO0H 3LHPH 1E5NA 5JORB 4NGHH 2C3XA 4P5TC 1YUHA 1JHKH 1I1WA 4FLRA 2A6IA 2GY5A 3ROLB 2EDOA 5I15L 1AFVL 2VX5A 2EQDA 1QUNA 2OP4H 5FA4A 3WO4C 1FFNB 5DEFB 1OD0A 3D0VB 3X13A 3X3GL 3QRFM 1OT5A 5LA0A 1DFBH 2X4OA 3N06B 1L7TL 1T7YA 4ZSOB 1AQ0A 5BXPA 2CIIA 3DLQR 4YHLL 4OGYH 1KPUA 2AEQL 2IAMD 3CDFA 4BM7A 5EWIH 2WMGA 2X7LB 3DX9B 4XP4H 4DZ8B 4IJ3B 2A3BA 1NJ9B 2DI9A 3EOBB 1NQ6A 5KSBF 4CVUA 1GIGH 4LLQB 2YA0A 4PJFF 3GNPA 4CADA 3O4LB 1PZ5A 4L8BA 1G0XA 4BZYA 3I75A 5GGUB 5ESQB 2P5EB 2VXQH 1D6VL 2ID5A 3KPMA 5D9OA 4KJPC 1TTFA 3MRNA 5FDWB 3J7HA 4HPOH 5HGAA 2NY7H 2OR9L 4HXAH 1B3YA 5JNYB 4ELKA 5I24A 4R2GB 1JTPA 2YC1B 2BHZA 1MREH 2VDQL 4F57L 3QIUD 5DEZA 5SX4H 1I8LC 1LO3L 2ZWLT 2LABA 4LIQL 1QKZL 1J87A 4G5ZH 4L3ED 1MHEA 2ZUMA 3DRQB 1YNKL 3OR7A 1R5VA 4PJIE 3WFHA 5A69A 3IJHA 4U6XA 1KB5H 4FQXB 4F15B 1LO0H 3KYMA 3IDJA 2NW0A 5C0JA 3POCA 4H1LA 5T1LA 3AREB 1QHPA 1DYOA 3CXDH 1QPKA 3QGVA 4G8GB 2OWCA 4HFUL 1JGIA 3PNWB 4K7PX 5AD0A 2OR7A 4JGUA 3VG9B 1FV1A 3WN5B 2I5YH 2WWDA 4LVOB 1OF4A 4XNUH 2EH7H 1UXSA 1G9MH 5C0GA 1HWHB 1V8HA 4NM4L 5E1HB 2A6JB 3HAEB 3BT2L 3O6LH 1TVGA 2V3EA 4JFDD 5J1AA 3I2KA 3HZYA 1EEQA 3GMLA 5GRJL 1QFHA 3FQRB 3WYRA 2BNJA 1ZTXH 1ISZA 2EDQA 3CMOL 4Z76B 4U1MB 3MJGX 4LLMB 4S1DC 4YHZH 5HY9B 3VFMA 2HKHH 1CK0L 3ILQC 4XBPA 2MHAA 5EO0A 5FB8B 4UDTA 3WLWD 1XCTB 4Y5YB 5E99H 3LE0A 5JUEL 1ULOA 4MJID 4R97C 1CZ8L 3BQUC 4GFTB 3SGEI 5IHUL 2BOBB 1DWGM 3PZOA 2XZZA 4EI6A 5TH2A 1E1EA 4IJ3C 1A5FH 4HUUB 3FL7A 2B20A 3RIFK 5CJQH 1NWSA 2X0YA 2RBLA 5L7XH 3P4OB 3O3EB 1M04A 4OOUA 1HT6A 4JHAL 1FYHB 1E3ZA 3ZE1E 3VFVA 1IKFH 1TG7A 4R3SA 4H26B 5C0CB 1J9CT 4FMKA 2F5AH 4PCTA 5JZ7D 3GSUA 5CP7B 2Z4FA 3HE7C 1K3IA 1LQ0A 4WWID 2J8UF 3MNVA 2BS9A 2C3VA 3SHSA 3WF3A 1I1AD 3MLWH 4X6DA 4QF1B 2XVKA 1NMAH 5FOBA 2VIRA 5E00A 2OLHA 1R6VA 5JXGA 1DWFM 1P5VA 3KPLA 2IEPA 1WEJH 3WUWG 4BFIA 3RDTC 4MHHG 3WH8A 3HUJA 4ZQKB 1L8NA 1ERNA 1SEBA 4PLJD 4L4JA 4EK7A 4A3YA 1FZOB 3PTQA 3BKYL 2DLFH 4GS7C 1U8NA 1ZB5A 4NBXB 5EU5B 2NW3A 2JJWA 2MJWA 4LSVL 4F57H 4BYHA 3QR2A 4OZFA 1NDGA 5DTFA 5DEGA 4OZGA 1U92B 2J2ZA 2DYPB 1C91A 3DVNA 2AEPL 1RIVH 4QLJA 2RVAA 1S7VA 1GH7A 1E6JH 3ARWA 3NZHH 1V6VA 1X5FA 3V5HB 2E7LC 5I8EA 1HZHH 1ZEAL 1BYCA 1S78D 5E08L 2XSBA 2MOVA 3OB8A 1MCBA 2W9EL 1RK1B 1BOGB 2NNAA 5FECA 3ULVL 3G5ZA 5INDB 1U3JA 1UY0A 3GM8A 1HHHA 3PZ9A 4QCFA 5JW5A 2UZIH 1CFTA 2ORXA 2CK0H 5LGKA 2X10A 1A6AB 1EBPA 4LF3A 3QNXA 4LPLA 5A2IH 4G9FA 3DYPA 3GYCA 1GOGA 3EO0A 1ETZA 1FZJA 4I48B 4U4BA 2EYTA 4EVNB 1MFAH 1FVEA 1RSFA 4EQ2A 1JIBA 3L3IB 3T0ED 4Y4HA 3EOAB 4J4PD 1KCUL 4CD7A 4YDJB 1UWEL 3RL1B 5CINL 4HS6A 2ICWJ 3ZSTA 5JLZB 4NSKA 1KTDB 2Z31A 4UFIA 4ZFOA 4BXSV 3BW9B 3VTRA 1A21A 4ELMB 1PG7W 1AXTL 1GZQB 5CWSB 3PIQB 3QEUA 1OAUL 4Z7OF 2PWDA 1MRDL 2YA2A 4YHIA 4RNRB 2ITCB 3OJ2C 3V6BR 5EUKA 1GVYA 3FJTA 2QSVA 1U8JA 3RY6C 3QFDB 4XP9L 4CVXA 3O11B 2VDRL 4HUXA 3L5HA 4U1IA 4RCAA 1MQKL 5GGQL 1LHZA 5T3ZH 2F54A 2OTUB 1XCQB 1FL3B 3SQBA 1Q9WB 3ZDXE 5J1XA 3ULVD 1P7QD 4D9QD 4TNWK 5ABFB 5IV2B 5DJ6B 2Q6WA 3AOFA 3UC0L 2ZUQB 1JPFB 4V1DB 1U58A 2ADGA 2MCPH 2XY1A 3QEGH 3T0EC 3C6LA 4A6YL 4GRWB 2A73A 4YXKH 4OQTL 2IGFH 4HHAB 3FFCD 1E72M 4WW2F 3RZWA 4YQXH 3S97C 1ECEA 1FAIL 3JV0A 4X7FC 3C5SA 3MRMA 5JOPD 3GSRA 3GXDA 2P5WE 1AHWC 3QWRA 2ENYA 4GWIA 1ACZA 3PHOA 1NP0A 4ZSOE 4WFFD 4KFZC 3PP4H 1XSIA 2ZCLH 2A3CA 4DOHB 1OPGL 3C5ZC 3S3SA 2RIKA 4C58B 1M6OB 4UIMA 2Q86A 2X40A 2XKSA 3PXHA 3T2OA 4NQCD 3IF1B 1KPVB 3BCFA 2DDUA 3MGOB 3GMMB 3IFPA 3OZOA 4PMZA 5TE6H 4QWWD 3S96A 4P57B 3OA5A 3UDWA 3M8OL 4GRLB 2YPKA 4ML4A 3HNSH 4LSRL 5GJSH 4OGAD 1JF5A 3P4LA 3D9AH 3TBVB 3RIAF 1OM0A 1DQJB 4KV5E 4GW4A 5C3TA 2E33A 4ONOA 1VACA 3OPZL 4JZOA 4JREB 3W9EA 2BVQA 5E2UH 3KE0A 3ZLQC 4NNYB 1MJ7L 4LARH 4QDSA 2QQNL 1KEMH 4G7VH 2EICA 3G08B 2OTWB 5DS8A 5CEXB 2HFTA 2V5DA 5B21A 2Q20A 5T3ZD 1M7IB 2DI7A 2J4WH 3Q3GB 4D9QE 5JW3H 2YDQA 2NQCA 5CS7A 3AIUA 5ID1A 4QRTB 2WMKA 1CLYL 3A23A 3RZCD 2J8GA 4LLQA 1SM3L 5IESH 4K9EC 1A0QL 4I2XA 3MUAA 2JB5L 2KKQA 3ARGB 1I1AA 4A45A 3S6TA 2D9QB 4G8IB 1JZ8A 4JM2C 1EQPA 3O3BB 6TAAA 4OCWH 2FIRT 4F9LA 3BAXA 3MCKB 3WH9A 5D5MF 5KG9A 1I7TB 3QP3A 1MAMH 1HKJA 2KUTA 2M26A 4M1DL 3PWUB 3VFOA 1BBDH 3AS0A 2NZ9D 1WKYA 1TVDA 4XPFH 1GUIA 2RGMA 1RULH 5BS0A 4HJJH 4OBRA 4ZOAA 5FF6A 4Y4FA 5CYYA 3LZFL 4PBVC 4YPGB 2QADC 2QHRL 1S5HB 2GI7A 2QQMA 3F58L 1P84J 3UERA 4U2YA 1MI5D 5T3ZL 1MNUL 1YA5A 3QI9D 3SE8L 1TZIA 1R5IB 3RDKA 2V9RA 2MMXA 3R4DA 1S7TB 3UTTD 5HHPA 3VIHA 5MEND 4B53A 1VFAA 4XPHL 1R3IL 4UFMA 3BIKA 1MJ8L 4NFBA 2R0WH 3WFZA 5KSVB 4G8GA 1TQBC 4KKCD 1H3TA 3I6LD 5ILTL 1AKJD 5GGTA 4X8XA 1MOEA 1DLFL 3LB6C 5ITFA 1X9QA 5I19H 1KJ2L 3ARDA 2XTLA 3O3AA 1JJUA 5D2NA 5EUOE 4TULH 3PDOB 1IAMA 4G9FD 4LVNC 3MSGA 3NZ8B 3CFEA 5DD1L 4ZODA 4UIKH 1U8QB 1BD2A 4CJ1A 3VCLA 1P6FA 3OSKA 3SKVA 4YE4H 2HISA 3WMBA 4YO0A 3GSNA 2YUZA 1HHGA 5HHQB 3JV6B 5I8CA 2HN7B 5D9SA 5C0IA 3T0EA 1G7QA 2RGLA 1RZKH 5C0FA 1UB5A 5GS1A 1G7IB 2DQGL 4UAPA 1FHLA 4IRZH 2CBVA 4JANB 3NA4A 4P2QD 2F5BL 2AXHA 1KJVA 1WFNA 2XXMB 3VWJA 3WFCL 3U4AA 4MADA 3UTPE 3HNTL 4AY0A 1X5KA 5JQ6H 1QBLL 3F5WB 1TTUA 3K4DA 5DJZA 3MJ9H 1NGQH 3WKZA 3DHJA 3UEQA 4P23B 2EDXA 3O4LA 4M6OL 4OBSA 3TCLA 4GXPA 5FDYA 4JKPL 1OTSC 2WBJD 4JREC 5DYOB 1JNDA 4WWKD 1KPUB 1KG0A 1JHTA 3GNML 2HLAB 2MSPA 1KIRB 3UG4A 1ZMYA 2HRPH 4K23H 4D8MA 4RX4A 1W9UA 5DJZB 3ARSA 1Q94A 1UM5H 4NUJB 1GNYA 3OKEA 3PZQA 2ICEA 3QRGL 2FRGP 2FO4B 3EO9H 3SO3B 4LCWD 3VNYA 3V0VA 4I8DA 6FABL 3MODH 5JXIA 4HS8H 4JB9L 1XSJA 5DK0A 1HNYA 4AMCA 1ZHKA 2BXYA 2WABA 3HNVL 3S7GA 3LPWA 3SUWA 5HYQA 1D6EB 3NPZB 4PJHB 3LV3B 3MBXH 5D1ZD 2OYLA 4WY7L 2ZP0T 4NQCA 4FFWD 3BZ4B 4X7SL 4C56D 4PPTA 4X0KB 3AHYA 3BZEB 5BXTA 4XVSH 2H9GB 4C7DA 5TQ2L 2FCBA 5C0RH 1P4LB 5LGHH 1A6VL 3MLYL 4MS8C 3ZR6A 1FDLH 5AZ2L 5CD3A 1KGUA 3AIEA 5ITFB 4PGCB 1ZKAA 4DKFL 3WSOA 4UT9L 3C60B 3RNQA 4KK6D 3WLBB 1MVYA 4O5LL 3CU1A 1HKIA 1MCPL 4C7GA 3UMTA 3GUTA 4A6YB 1G9NH 1FO0H 1YN7A 2P47B 4IM8A 1JV5A 3QULB 4YNYA 2AJSH 3NCYP 3U4BL 4JFFE 4MAYD 1JN6A 4LL9A 4NRXB 4ONHB 4X9GA 2WBWB 4PJBF 3LQZA 1MQRA 2E3VA 3QJFA 4OLYL 1LGVA 1H5BB 1U8KA 2YBTA 2P8MA 2QQLH 3DJ9A 4JFSA 3W39A 3TO4A 1VHPA 2P5WA 1J1XL 4AIEA 2DKSA 5E8DL 1FH5L 3R06A 1N5YH 1A9BA 1SYSA 2W47A 4GI6A 1A4KB 4H8HA 1KELL 3OKDA 1OD3A 2GFTA 3ARVA 4OJFL 1UWQA 3AY4C 3INUL 5L2KA 3O6AA 2X4RB 3S98A 1GPFA 1VDGA 4NQEE 3B6SA 4I3GA 4OIIL 5IVNA 3VD9A 5JW5B 4UI9L 3B9KC 2WBJB 2J7BA 32C2B 1F3DH 1OGAB 5KSAD 4KRPB 4PJ9C 3HR6A 5TE4L 5EIIA 4GZIA 3CFDB 4PG2C 3BGMA 3C7OA 1J0YA 4MXVF 1IFHL 4LLUA 1YEFH 3OR6B 1QRNB 4F8TA 4ONFH 1Y0LB 2DQHH 1GHSA 5IW6B 2YZ1A 3SOBL 1YMMB 1IEBB 1BZ9A 2J88H 3TF7C 4XUPA 4UQ2B 4D6EA 5JW4Q 3H9SA 5FGCB 4I18C 5IFAL 2QHAA 2W0KA 2W91A 3F5KA 2O61B 4QNPE 5J8OA 4AMKH 2VLRB 5HXMA 1H5BC 4C83A 1UYZA 2Q6WB 3RWFB 3ARUA 3S6CA 4U2ZA 1H3UA 1DQDL 1UZ6E 3GHEL 4YC2C 3CH8A 2HLFD 2LVCA 5FUOL 4HUVB 3V6OA 1U8NB 1PY9A 2YK1H 3VWJC 3VXMA 3O11A 1M71A 1WC7A 1H5VA 3B2VL 3JWOL 3RVVD 1HIZA 2VT0A 3EZJB 2AJXL 2ATKA 4Z0BL 1EJ6A 4CUCA 4J28A 3V9FA 4HK3J 4M56A 4YDKH 1EBAA 1E9LA 4S2SA 1AR2A 1OVZA 1S78C 1KPVA 4DZBB 4IDJH 5J0BA 4M6ML 2C1OA 3N04A 3I9GL 5EOCH 3MOBL 5AD0B 4S0TD 2JD9A 1T7ZA 4ZO7A 2NXZC 1BZQK 2P46B 1FNLA 3W81A 4P2QA 4U1KA 1K8DB 3TNNB 4JDVA 2VABA 3QNXB 3SO3C 1E73M 1OWRM 1V0MA 2JIWA 4BCEA 3G6JA 2ZE0A 4EE9A 3PABA 1DVFC 4N0CD 3X17A 4WW1B 5ESAB 4OIBA 3TTOA 1FO0A 3BDYH 3RTQB 1I9EA 1EFXB 1MWAL 2FJHB 1GOWA 2OWWA 3E3QC 5A2LH 1J5OH 4PJGB 3T1FB 4JPKL 3M1BA 5I1CH 3CUIA 4X9FA 4CCCA 1F4YH 2X4UB 1CLOL 1QI0A 4Y5YC 4YAQA 1OTTC 1GGIH 1MRFH 2XQXA 1CBVH 1D9KA 2Z35B 3RPMA 2EEBA 4D3CH 4ZE5A 1KT2A 4DUWA 3FN9A 4K55A 3VJ6B 3DUSB 1XGUB 2H41A 4RE3A 1LJYA 4GT7A 1YEGL 3ZDXF 2CJUL 1R24A 2C1PA 4PJEB 1K42A 3H9SB 1ZTXL 4BQ2A 1XH1A 1WZ1H 1ZGLM 3WNLA 1HKMA 2D3NA 4H5SB 4PREB 1UCTA 1A14H 3VI4E 4ZEPA 3HNYM 4YBLB 3LEYL 1FIGL 1ZLWK 1DBBL 2CKBA 3MRDA 4NWUL 3O9WB 1DQMH 3I6KA 4PJ5A 4BA8A 4WO4A 2AK4A 4EOWL 4X4YB 5I0ZA 3SURA 5B4MD 5JIHA 4G6AC 4BQ9A 1JUFA 1M05B 1HH6A 5DFAA 1FFOB 4XPFL 1V6UA 1VKXB 5E9DA 2CXGA 1SHWB 2F8VA 4XXDA 3IJHB 4UNIA 4JPWL 4JM2F 2V72A 1QNZL 1H49A 4FQXC 2H6PB 2ORBH 3FTGB 1V3LA 4C4KO 2IMNA 1UH3A 2YUXA 3CBWA 1S7UB 4Z0XB 3O3DB 2JIXB 2H32A 1VJSA 2R29L 2P8PB 1QNQA 4S3KA 4MAVA 3B4NA 4BQ5A 2C1OB 2IADB 4HXBH 3I3DA 5F3HA 3UZVB 2C0HA 1W9SA 5IVXA 4O2EA 2MKLC 3C5SB 1T22A 2EDKA 2MQCA 3MKKA 5DURD 2FWOB 1QSFA 1QW9A 4W85A 5ESVA 4HGMA 1YEJL 4GRMA 4WI5A 4BSJA 5MEOB 4HQQL 2OQJA 4L3CA 2DQEH 2DH3A 1ZVSB 3TO4D 1RK0A 4WJ5B 3FO1A 4A4AA 5I17B 3I2FA 3QUZA 3CMGA 2I60H 4W81A 3A6CL 1W1VA 5A6BA 1T2JA 1P1ZA 1OLZA 4ZTPL 4PV8A 1T3FA 1R0AL 2GIYA 3V95A 4GUPA 2LTQB 2VSDA 3HE6D 5EU6B 1KENH 5EZIL 3M1BB 4GMSL 5L2KD 4O58L 4QRSA 4PS4L 1KNOA 4NCC1 3P9LA 1FZKB 5AUMA 1LE9B 1RZKC 2FBOJ 3HRZB 2YC4A 2VMCA 3GXUA 1I4FA 1BMGA 5HGHA 3CHEA 5BRZB 4F3FA 1A7RH 4GAJH 4WUKH 1JRHI 1MH5B 2WINA 2DM4A 1U42A 4JQXC 4P4KC 2XIDA 3KXFA 4KVNL 1DN0B 4ZXEA 3U30B 5HHXL 3H9SD 4F15C 1F02I 2XTJE 2ZSVB 3D6GA 1MCKA 4MXQD 2VMDA 2V5RA 3TBTA 1X5JA 1BLNA 1VFMA 4UINL 4JDZA 1JGEB 4DN4L 5CJXC 3HRZA 5IQ7H 3CGTA 4GSDL 3HI1B 1KWGA 3ILPB 2DCJA 1H3PL 1IC5L 3GIZH 4ZO8A 2NR6D 1Z32X 1AO7B 4IUGA 5JBDA 2WINB 4WW2C 4WI2A 4LK4A 5DQ0A 3I2JA 4HOZA 2GQHA 1XH3B 4PRHD 1NC2B 1H8OA 4QX3A 1UD5A 2OS7A 2CO6B 3PV7A 5JNYA 1CI5A 3NSMA 4RAUB 2QBXA 4DTGL 4OI7A 1UZ8B 5I1EL 1S7QB 4IOIB 5IW3A 3K4AA 3GDBA 1W9WA 4TTUA 1OGTA 1L6XA 4CD6A 2DQFB 1CD1A 3SJVA 5IFJB 5DTFB 3UCRA 2R0ZL 2XT1B 3P3YA 4LSTL 5CHNA 1IGFL 1NGYB 2DQCH 1MWOA 4FTVD 3WNNA 3PUHA 4JFWA 5C0RL 3P73B 5CAYB 3NN8A 5I17A 1F4WL 1FCGA 3GEWB 1OARH 1FNGA 4NQEB 4XNYL 4ZFZA 3VXOB 4LGRB 1OGAE 4S10A 3HMWH 3NZ8A 3C6LB 3NCMA 1J88A 4LLDA 1F8TL 4QTHA 3BIAX 2H9GA 4ZENA 2PF6A 3N1PC 1XF3A 4YHYC 2FWOA 4AEEA 2NY5H 4JKMA 4F9PC 3ELAT 3MGOA 5C9JB 1UVQA 4QRRD 3BSGA 3N9KA 2XHYA 2O5XH 3GSVA 3L4YA 5BXFB 4WU7B 1SY6L 1GNXA 3BKMH 2YN3A 2BCKA 4O2FA 4I0PB 4M1GH 4NM8H 2YL8A 1MFCH 4RN5A 1XGPA 4ZO9A 5IBUG 4HAGA 3TT1H 3WSQL 2VLRE 3LN4A 3QDJA 3BO8A 1RP8A 1YQVL 3QUYA 3CK0L 3LEIA 3SCPA 3H42L 1UJ3B 2PO6B 4PYHA 1J8HD 1R3LB 4A2MA 2XQYG 4NZCA 1NGPL 4PJEA 1WT5A 4QOKE 5I79A 1W0VB 4DFHA 1V3MA 2BNUB 1W3JA 5E1AB 1A7OH 4DAGL 4ODTH 5FA3B 1K6AA 1GOOA 5HGGS 4NKQB 2GJ6E 2BSED 2V2TA 1R86A 4FMFA 4GXUM 4U1JB 1GPOL 3QHZH 1HNGA 1RP9A 4F7MB 1NDMB 1K9DA 1NWTA 1A7RL 2P4AB 2PWGA 4FNLH 2NLJB 5DC9B 1RJZB 5F72S 4RFNC 2FB4L 2J8UB 4HWBH 5IW1A 15C8H 2HWZH 4PLKD 4LLYA 3MV7B 1SEQH 1U3HB 4NSKB 3ZKND 5IM7A 2O9TA 4JKLA 5GGSY 1HL9A 5D1XD 3C5ZA 1DWIM 4I1NB 3RVWD 1OCQA 1X44A 2CSPA 4PUBL 3BN3B 3WEZA 4XT1C 3BJ91 4R8WL 3JV5A 2Z93A 1QSFD 2W0FA 3CFJB 1YECH 1F3JA 5FIEA 2VB5A 4KTEL 3MRFA 3RWEA 5D9NA 4JO1L 1NCAH 4URIA 1XGTB 3KHOA 4FQXA 1UGNA 2FGWH 2HKFL 3FRPA 3IJSB 2CQVA 2HTLC 5EO1A 4NKMB 4P7RA 4ODHH 2XVGA 5J06A 4QTHB 4UBDD 5ANMB 4EI5D 2E6PA 5F89A 4ELME 1JK8B 3O41A 3KL0A 3SUTA 2WC7A 4QRRB 1MHPH 1CGVA 3P73A 1MCRA 1XD1A 5C2BL 4UMGA 2GITA 5I8EB 4K3JH 3FO0L 4UU9A 2Q8BH 2EIZB 4PJAE 3HRPA 4QGYA 3S35L 1JGUH 3NFNB 3VFRA 4B3KA 5C7GA 1TQCC 3O8XD 5EA0H 4V1DE 5EU7E 1DUZA 1W0NA 1WV7T 3ACFA 1JNNL 1I8IA 2BOCA 3KXFD 1MJ8H 1MWAH 1HDMB 1K8IB 2AJUH 3WL1A 3AU1A 3KPNB 4GIAA 5HVFB 1VAHA 1LO2H 1F6AB 4AG4L 3WSUA 4D0CB 4CMHC 4XAWL 3ZJ6A 2NR6C 1RULL 3TBSA 5I19L 2ZNWA 4Z7UA 5F88B 3UTSA 2VLKD 4NQUA 2VMEA 4XVTH 1FO0B 5CGYD 4BJLA 5DRXA 1ZLVH 3FOLA 4F33B 1WVZA 3DV6A 1UWEH 2Y7QA 1T0NB 4NKDA 4QRQB 4MXVE 5EIVA 3S3PA 4KUZH 4OLZL 1W1TA 1NLBL 4CDHA 4XBGB 4L4TE 2L9LA 2NTFA 3WD2A 2IPTL 2XZCL 1QR1B 3QEUB 4LU5H 2ED9A 4WI3A 4TVPH 3RHWF 1I3VA 3FT4A 3U6RA 2FLBT 1WCBA 3EYQC 3ZKSD 3TONA 3O3EA 1LO3H 1AY1H 3LS5H 5F1KC 3G6JF 7FABL 5KS9B 5L9DH 2GSIB 3VDHA 4P2CG 1QQDB 3CD4A 4D9RD 1JPGB 1YY8A 5DYOA 5DMYA 2J6EA 2IF7A 4L5FH 1S9VB 2WIIA 1QRKA 2H2PD 1E4JA 1JGVH 5C0JB 3IFPB 1WWWX 1I7UA 5T1MA 3VE0A 5IEKA 1FYTB 3WQ4A 3V2AR 4HWEH 5E7FA 4WSKA 2Y4SA 2R23B 3VFNA 3H3BC 4NWTL 12E8L 1GOFA 4L3CB 5GRVL 3QRGH 4OF6A 3MYJA 5C0AA 3WFCH 3HAEA 1MCDA 4DWSC