3K4AA

Crystal structure of selenomethionine substituted e. coli beta-glucuronidase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
605
structure length
597
Chain Sequence
b'SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYVGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucuronidase
publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 140
structure length 597
sequence length 605
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k4aA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k4aA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k4aA03
4OJFH 3N1AA 2W0FB 3A23A 1A5FL 3DSFH 4FLOA 4IIQA 5DC4B 4C4KO 1U8OA 3MBEB 2JELL 3VXRA 4PY7A 4B5EA 1GZPB 1M71A 1KIPB 1T03L 1DLHA 1CU4H 4M8QA 4N0RA 4RWYL 4QRPB 2L9LA 1FSKC 1FDLL 2IQAA 2W9XA 2BV9A 4BCEA 3MR9A 2R7EB 3Q6FA 2QQJA 5A94A 2R56L 2PO6A 3EB7A 3RL1B 1OB1B 1V0MA 3WO4C 1AO7A 1FFRA 4HDIB 1ED3B 1YNTA 3ZJKA 1WDPA 2FSEA 4JHBA 3BKCL 3IB3A 4LKCB 4RYDA 2NT1A 4YNYB 2WWDA 1OGAD 5FHAH 1Q9WB 2D3VA 3WIJA 5I9QB 1QSFE 2EECA 3PDDA 2VLLB 2AK4D 3QXDA 3NCFB 4XVSH 1A6TA 1U3HA 3CFDA 3OKMA 2DLFL 4HA3A 4XZUA 4D9LL 1E6QM 3MRKA 4X9GA 4HXBH 3STLB 4EUPG 5CSYA 3SO3C 3LQZA 1PYWB 4YDKH 2HRPL 4BQ8A 5L0QB 4CMHB 3AREA 4POZD 5KN5A 3HPNA 1S9YB 4A45A 4WKAA 4MAZA 2QV2A 3ZE2E 4KI5F 1RU9H 4QX1A 5J11C 1LO3L 2JDAA 4F57H 2XSBA 1DLFL 1SBSL 3IAQA 3VXUE 1MCBA 3B2UD 3MSDA 3MQIA 4DZBB 2VLRB 4D0BA 1SY6L 4L4VE 2FO4B 2NZ9D 3NBNA 3PL6B 3HHRB 3U2SA 1QNQA 4Z2GA 3SUUA 5E00B 1QQDB 1QSED 2OTUB 4M1CC 5EU5B 2YLAA 3ZKXC 4MXWH 4ZAKC 1WFOA 1UG9A 2OR9L 3QQ3A 5JHDE 4J3OC 4WW1A 4GPNA 1V02E 2FD6H 1AQDA 3C6SB 3TNNB 1T21A 4NHUB 2DB8A 15C8L 3HTLX 2GK0B 5IHLB 4KJWC 4OBRA 3X14B 4HFUH 3FTGB 3WYRA 5B39G 3BD5A 4GBXD 4KKBD 3DBXA 5IF0B 5T1LD 1UKQA 1RU9L 4EI6A 1Q6EA 4ZXOA 1CLVA 3NNGA 1OAQL 2D0GA 2Y7QB 3EKCA 3V6OE 5GISH 1WZ1L 4R26H 4FQ2L 5BXFA 4LAQL 1XR8B 1D5XA 4TVSa 1ACZA 5C6TH 4JQXA 1HF6A 2HVJB 5DRXB 2CMRL 4C56D 1BVLB 3RDTD 1TQCB 2XM2A 4EN3A 2N1KA 1E3ZA 4LPXA 1J05B 1AR2A 2AEWA 4PJ8D 1P4BL 3C8DA 5D71H 3QNZA 1JV5B 4LLDB 2W67A 1AGFB 1TVHB 1JPFB 3MCKB 4W68A 4IRSC 4X7TA 1PLGL 2WHKA 3NUKA 1JHJA 4BSWA 1BEYL 1VFBA 5C09E 4OF6A 1WP6A 1BVNP 4GRMA 1A1MA 2W1WA 1D9KB 3MLTB 4PCSA 1KCSL 2FJFA 4RGOH 1JF5A 2DH3A 4B41A 1UR8A 1MIMH 3DO7B 1CS6A 2NY3C 1BBDH 4PRPA 1A2YA 4CVUA 3QHZL 1Q6CA 4Z7OF 1BQHA 1V7NH 5I17A 4PY8I 1CIDA 1E4KC 3H8NA 4JFYA 4WV1A 5GGRB 1P69B 1T0MB 1JWMA 3ARGB 5FUCC 1DBJL 1ZKAA 1CDYA 5CGYC 2HN7A 4I18B 1LF1A 4NF7A 1TQBC 1WZKA 1FH5L 4B3LA 4EAMA 1ESWA 3QNXB 1S78C 5C09D 3QPXH 1T80A 4RAHA 1TNMA 5HHPA 2NY7H 2Y06L 3BAEH 4R9HA 1C1EL 3ZHDA 1JHKL 1RUQH 1J9YA 5H35A 5IJKA 1UA6L 2ERJB 1BFVH 2DWDB 5FYJD 4U6XA 3W6LA 3Q2CA 4JDZA 5DHXB 3K81A 1XGZA 3GRWL 3LZFL 3BIAX 3VFSA 3P30H 4FABL 1F45A 4KVCH 2DYPA 1A9EA 1UXWB 3CHFA 2G5RA 1X5ZA 1F00I 2ED7A 1ZVYA 3ACHA 1SJHB 5AEAA 5TPWL 4F66A 2F53A 3VFNA 5KJRL 1HHIA 1NMBH 2JIEA 2MMXA 4H1LH 4JHAH 4YFLF 2KZWA 2F19H 2VCBA 4BDVB 1CLOH 2EE6A 3NIGF 3VA2C 1HOCB 3QPXL 5EZLB 1U8MB 4LSDA 2PTUA 2DJ4A 1DFBL 4Z2IA 4CUBA 1TA3A 4HK3N 3T2NH 5TE7L 1WEJH 4LSSH 4WO4D 3RVWD 2R4RH 1NGQL 4KKCD 4KK5C 2XXCB 4LHUB 4I5BB 4W6YB 4HOXA 4HUXB 4W8JA 3U7VA 4P3DA 4Z95L 1RIVH 5JXIA 3EOBA 4F9DA 3KPMB 1FYTA 4OCMC 1XGTB 4RISH 3EHBC 1T7WA 1HNGA 3G5YB 5I15L 1VGEL 3TJEH 2VVNA 1JBJA 3KYAA 5LQBH 5CUSL 4NQSA 5I74B 4FQHA 4DN3H 4K94H 5EU6B 1ZT4B 1Q1JH 1NMCB 4MJ5A 2X1IA 4CDHA 4ZO9A 1CZ8H 3B6SA 4PB0H 3QIWD 2KBGA 2ZNXA 3QQNA 3V4VH 2WMHA 1IM3A 3UEZA 3ZM8A 2HYXA 4IDJL 2VDPL 4RIRB 3FO0H 3C5JA 2Q1EA 4ODSH 3SE3C 5F7DB 4Y16A 1NC4A 3QCVH 5ICZA 3ZZ1A 1E6ZA 3Q5YA 3Q1SH 5CEXB 2ZSWA 3O45B 4LCWE 1IGCL 1CEOA 2VDKL 1OM0A 1WCGA 5KOVC 5F6IB 2QHLA 4PJDB 3EJZC 3ALGA 2FGLA 4HF5L 4TULL 4BS0A 2ORBL 1KLGA 2XPGA 5F93C 3SUWA 5I9QC 3QCUH 4Y5VB 4ONHB 1L7IH 1WDSA 3GZKA 4LLAA 3JXSA 5ELIA 3ZT5A 1TG7A 3VG9B 1S7WB 4A6YA 3O6FC 1OD7A 4XAWL 3L3OB 3GJFA 1GZQB 3UJTL 4PRAA 3I3BA 2UWFA 1OAZH 1R6VA 3BXNB 3PWJB 5ADPH 1NM9A 5A69A 3L4XA 2OR7A 4NC1E 2BCKB 1B6DA 2F54D 3L3DA 2WUBH 4P5TA 1XH1A 4QRPE 4OIBA 2HP4A 5CP3A 1BX2A 4I0PA 2V17L 1WIPA 3DRTB 1SM3L 2J1AA 1PG7X 3KHOA 3VWJB 2DDXA 2Z93A 3P4OB 3WEMA 3I2CH 4GMTL 3SJVE 3NN8A 4Y4FB 3IGAA 1VFOA 1WVZA 2HVKA 4MNQA 1A4JB 1WC7B 3LRHA 3GM0A 3A6BL 2FB4L 5A95A 1T20B 5DRZB 4ZXBB 3WFCL 5HDLA 4R4BA 1G7PA 4DVBA 2J79A 4AQ1B 2OI9B 2ZUUA 1DN0A 4BFGA 1KB5L 4QHLA 2I25N 5TJWK 5IQ7L 1G7JA 2O5XH 3C2AH 3H9YA 4PRID 5AUMB 2B39A 4AQOA 1YEDA 5HHVL 2XWJB 4LPWA 4QOKD 4RMWA 3F7YA 2G2RA 3BRFA 5C3TA 1MFUA 3JUGA 3UBXB 1JMZA 4UOZA 3AS2A 5GS0L 4EOWH 4Z2KA 1GAFH 2XN9D 2IAMC 2NXZB 4L8DA 2CGRL 1BHGA 3GYCA 2Z31B 3O9WD 1D5IH 4U0RC 4KKAD 3RIKA 3V79C 2J6EL 2WZPD 4Q2ZA 5GGTH 3SCUA 1TJHH 2XKSA 1PSKH 2H6PA 3B9DA 3FHQA 4N0YH 3VDCA 1GXEA 4AL8H 2VLRE 4QWWC 1TQCC 1JHTA 1C5BH 2OLHA 4OLVL 4XTRD 5FKYA 2J8UE 4YWGL 3FAWA 2GJ6A 3AXLA 1E43A 2WKGA 4YDLB 5I79A 2GCYA 3BEVB 4HU0A 2ZG2A 4P2OA 3HR6A 4CNIB 1UMIA 1AHWB 2J77A 5B39A 5L2KB 1Q9LA 1G84A 3TYGH 3WN5C 5F9DC 2H32A 1JK8B 4DXRA 3MRQA 1D9KC 4YHLL 2APBA 5KTEH 1J12A 2ADGA 3NAAL 1C12B 4KK6D 5GRXG 4GJTB 1MUJA 4DWSB 1RULL 4FQ1H 2QQLA 1ZT1A 4QTHA 5JZ7C 2A74B 3MA9H 3RPIA 3VWKD 3SKJL 2J7MA 5C8BB 1CDCA 1YQVL 2EXWC 4HGWB 2I9TB 3I02B 5EOCJ 3VGDA 1T0NB 4CUAA 4WENB 3C8HA 2IG2L 3WKNA 1W3LA 5DEGA 4R90L 5C9JB 2UY4A 3SQOL 2XTLA 4L1HA 2VVSA 1OAYH 3KR3H 5AC5A 1W9PA 4JPKH 3GNOA 5JW5A 3MLYL 5I6SA 3MKKA 5JQHC 4OZFA 5EBLB 3DV4B 1NFDF 4U3CA 1WTGT 4KUZH 1S7UA 1EMTH 3RVUD 1AJ7H 2CBIA 3CGTA 4JZOA 4NJ9L 4HAGA 4R5EA 3LMJH 2IXVA 2BDNH 4AZ7A 4XCFL 1ISWA 1X1NA 3IVKA 3HAEG 4ZPTB 1EERB 2I07A 3PP3K 4HZLB 2Q76A 4P49A 4QRRD 4LSQH 3HRZB 3W2DL 1EHAA 1RJZB 4KTEL 2VO5A 1TMQA 1QP1A 3RGVB 3TOPA 1XD0A 3THML 1QI2A 2WIIB 4Y19E 4LCYB 4KQ3H 4QFUA 4Z5RA 4QP0A 2YBUA 4XNZB 4XXDB 2P7TA 5GNYA 2NPLX 2BSSB 1E70M 3QR3A 3RL2A 4OZIE 2PW2B 5GJTL 3VUPA 4P2RB 3ZL4L 5ACZA 5GS1B 3MRDB 1I3VA 1QFUL 1R3KA 4JFHE 3QR2A 3VIIA 2EPOA 3BT2H 3LQAH 3QUKA 2VZRA 4F7CB 2FL5A 3BDXA 1HKMA 3DTXB 4HPYL 4MS8C 3MRPB 4NQDD 4YHIA 4YZFF 1T5WA 4JPVL 3RI5F 5B4NA 1KGUA 2UY6A 3V95A 3WMSA 1FNHA 4PP1C 3TLRA 2QHRH 2YPKA 5LG1A 3SKVA 2AABH 4F7TB 4MD5A 1YNKH 4MMXC 1NFIA 4FK9A 3EYVB 3FB5B 2FYYA 3FOMB 4OCLC 4FFZH 4HTYA 1BGXH 3X3FL 3RJXA 3REWA 4JFDD 4XCEA 4GSDH 1CZTA 1G94A 1UXZA 3FQWB 1PQZB 4ONFL 5FGBA 3DX9A 4UIKL 5KZ6A 3SIMA 2RJMA 2NX5A 2V9QA 4BK5A 1NMCC 1G7HB 2DN7A 1CXFA 3H0TB 1MI5E 3G5ZA 4PV9B 3G6DH 1IGJA 1Z32X 4HZ8A 1N59A 1HDMB 5H37H 5INCA 2ADJB 3THDA 3THCA 4NRYA 1VBRA 3VI4F 4U6VL 4YO0A 2CIKA 4EJ1C 5I76A 1PZ5A 2I27N 4OYUA 5C7GA 2XTKA 1K85A 3IF1B 1MCQA 4JO1L 4MJ2A 5DHVA 5A2BA 3VFUA 4LLWA 4N9GB 5JPNA 1IEAB 4MAUH 3BKML 1OTTC 3R8QA 2CK0L 5JW4N 1R0AH 5GSVA 5F6IC 1GOGA 5F9AC 2PF0A 3P9WB 3BIKA 2HLFD 2PNDA 2F58H 3FFCE 3V6FA 3ZMRA 3SCMB 3CSPA 4JY4B 5IFJB 4GG6F 4HH9B 1H15B 5E99H 1NCTA 2QJDA 4XP6L 2XFXB 3S4SG 3VPLA 3HMWL 1RIHL 3KPPB 4LHSA 4YX2H 3U82B 2NY5L 5IV2B 4ZEPA 2RV9A 1I3RA 1UG6A 2EYRB 1W0NA 4QB2A 3C60B 4IRZL 2VXSH 5E56A 1EEZA 5FYLE 2R2BA 3PIQB 3PZOA 1OTSC 3QG7H 1EGZA 2CPUA 3IS0X 2ESVA 4GRLA 3AXIA 2VDLL 3KPSD 4J4PD 5KSBB 3ROOA 3BKJH 1I1AD 1KFWA 4MSWB 2X1PA 1MCDA 4AZCA 1EVTC 5DJZA 4XPHH 5AYUL 3EYPA 1FO0H 3QEUA 4PJDE 4YBLB 5IM7B 4NO0B 2YBTA 5DJDA 5E1AB 3ILQC 4ZXBC 4N5ED 2W61A 3KLAB 2GI7A 2V7HA 3VMNA 2IUZA 3EDFA 4I8DA 1FNGA 3I6GA 5E6YA 5IVOA 2D24A 4GAGL 1LWRA 3WNLA 3D3AA 1HJUA 5DK0A 3RTQD 1QR4A 4LF3B 2ITCA 5I71B 3GM8A 5DMGC 3K2UH 5HYFA 2GIYA 4XP4L 2K9UA 3WUWB 2G9HA 5SWZE 4OCYH 1X5HA 2HKFH 3L3JA 2NXZC 3OAYH 3V4PL 1FFPB 4WGWB 2JK5B 1X6NA 4IRJA 4X6FA 5LAXA 1W2KT 3DLQR 1ZLWK 2VXUL 5GGQH 2HT3C 1LE9A 5IFAL 32C2A 2OR8A 3OAZK 3QDAA 5T1KB 3HNYM 2ATPB 4AWEA 4PJ5D 4GKOA 4HZAA 4XX1E 2YUWA 4QLRA 2VAAB 5C0AA 4GXUM 2VX5A 3AHYA 2QQOA 2ZCLL 3GI8L 1VAHA 1RJLA 3MLWL 1HKIA 4YDLC 2RR3A 3OGCA 3ZJ8A 1X6LA 4I48B 4WHTA 3IDGA 4NNYB 1HP4A 1W9XA 1RHHB 1CDGA 2P44B 1CFQB 5SWZD 5ITFB 5MEND 1UXSA 1EXUB 2E3VA 2OYKA 25C8H 2WVUA 4OSUL 1JPSH 1A6VL 4CW1B 1C16A 2I9LA 1AGCB 3QJHB 5T5NF 3HPLB 5DMKB 1OIMA 1F4WH 1U8HA 3QCTH 2OP4L 2YD2A 3JTTB 1I8IA 1NPUA 3VGFA 5FL0A 3KVQA 4TSAH 5BZWB 3QIBD 2P5EB 1TZGH 2EPLX 5EOCH 4AZIA 1MFDH 1NAML 3CUHA 3IDJB 1NOWA 4PTUA 1NEZA 5D7SL 2WHMA 3W26A 1W72H 3VFPB 4ZFGH 4Z8FL 1QNSA 4Z7WA 3AYRA 3P0GB 2RQ8A 4QHKJ 4ET7A 1UJTA 2ZUQB 5E0QA 3SKMA 2H45A 3L3HB 5FB8A 4JFOA 4QXWA 3L5XL 5EU4A 1AD9A 1T1XA 1T7XA 4KRPD 4ACPA 4EVNA 5BRPA 4HZ6A 2WMFA 1K45A 2QSQA 2CKBB 4J3XA 3F58H 4JVPA 3BGFC 3CAFA 5EIQA 3GRWA 4ZE4A 3WS6C 3GMQB 4PJHA 1C3FA 1X5FA 3WS3A 3SQBA 2JB5L 1WDQA 2ADFL 3QA3B 3BP7B 3MRHA 3CUFA 1RUKH 2YRLA 3SUVA 5DD1H 3PUCA 3TN0D 5C8JB 2FHCA 5E6IA 3A6OA 5C0BE 2WXDM 3CLFL 3PQYD 4XNZC 3PWVA 1U8PB 5F21B 4ZFGL 3D3VE 1G9HA 1CDIA 3OV6A 1H8OA 1HQRA 5HGHA 3HJRA 1TJIL 1SJEA 1BG9A 1KYOJ 3ZLQC 3LPOA 1LK3H 8A3HA 5GS1C 3I9GL 1KPRB 1Z5LB 5J1AB 2MFNA 4JFEB 1T89A 2C3XA 2F5AH 3VKKA 1XNTA 5ISZA 3GNMH 3UROR 1AKJD 3R06B 3RJYA 3BXWA 5CLWA 5ADOH 5IEKA 3GSVB 3MLXL 1QLEH 4ENEC 2BNUB 4QNPF 1AY1H 3T09A 4ZNCD 2YMXL 3QUXB 1GHFL 2ZNWA 3CPLB 4DVRL 4U1KA 2C8NA 2ICES 4Y1AD 2E7HA 4HJGB 1FGNH 4P4KD 5I1CL 1E6OL 5C0IB 2FLBT 4PGCB 4FXKB 1ZBCA 1E4WH 4PMDA 1UWUA 4OZHE 5DN2A 1MWAH 1ZVHA 4UT6L 4PTXA 2FNBA 1FGVL 1ADQL 5DMIH 1JRHL 2X1XR 4KJQC 3LKRA 1BREA 2X1WL 2A6DA 1ZEAL 2EIZB 5BXSA 1WT5A 3DUUA 4TQEH 1HXMB 1OPGL 3VRLE 4PLKD 3S6CA 4J6RL 4I2XB 4M7JH 2DICA 1XH0A 1C5CH 2NCMA 1M6OB 1I9IH 5BXRA 5CZXC 2EXYC 4HW6A 4MJ4A 2EKSA 2VI0A 4GKLA 2AEIT 5SV3A 3NCEB 2AXGA 3ARVA 1P7QD 3C08L 3EO0B 3NFPA 3LPFA 2Q7YA 5AAWA 1R3IH 1FGNL 1QKZL 3X12B 4AY1A 4G8GA 4ZOBA 4XPFL 5ANMB 3SCMC 1VACA 1AQMA 2A9NH 4LDLB 4LYQA 3DGGA 1MWAL 4TNVF 3V7AE 1A6WH 4P0DA 3SKNA 3M46A 5LJYH 2VQ1B 3BWAB 2HFGL 3FO1A 3KWWB 5I1JH 1KLFA 1S3KL 4ATLA 1LO0H 1TMCB 3C60C 3W25A 2A0LC 3WFZA 2VZQA 1ORQA 5HJ3B 5IB2A 4B15A 4QLJA 1DR9A 4UFJA 1I9IL 4S0TD 1RMFH 3H3PL 3QI9D 2W91A 3D2UD 5HHMD 5IVNA 3W29A 2XONA 2AQ3A 5F3HB 3EBAA 4KKLD 2GAZA 3BH8B 4F33B 1JGDA 1T4KA 1KG0B 5MHSE 3MOBH 1JCKA 2B1AH 4YBLC 1OP9A 3WD4A 2DM3A 4M80A 1Y6KR 2D31B 3MXVL 4AIOA 2ADIA 2FIKB 1G7IA 4FQIH 3MNZB 3UXFA 3MRMB 2Q8AH 1LO0L 4WHCA 2JEPA 5ACMA 1T1WB 3O3UN 3CVHH 2QLYA 3W37A 3RJDA 5CPQA 1KULA 2NYYC 3M17B 4O2FB 1XF5B 3E3QE 4J12A 5GPRA 2Q86A 3TBVA 1NCCL 2O5ZL 4HK0A 4XBEH 1WDRA 2QHAA 1G5AA 3Q3GB 2DF3A 4Q9QH 2MSPA 3ARBD 1CFTA 2CEQA 2D3NA 4FQQB 4L3EE 5LBSL 5KSBE 3OGRA 1CVSC 4DEVA 4WTXA 3OX8B 1UQSB 3STZA 4LX4A 2J6EA 1MCJA 5CEYA 4A2MA 1UY2A 2D23A 4TOYH 3N1GC 1JPGB 1Y0LA 4ARXA 4AMCA 1NUDA 4X99A 3TVMD 5C0CB 1UYWL 4PUDA 4LVOB 5EC2A 1FPTL 4LQFL 2C4FT 2JB6B 1CICA 5DQ0A 4ATWA 4D71A 1MJ8L 1EZVY 2WW8A 3B83A 3CSGA 5FUOH 1XR9A 4APQC 1KJ2H 1ISYA 4OCRL 4EBQL 4YHKH 4WU5B 1Z9SA 3OKNB 4BM7A 2BSED 3WXWH 2HKHL 3MRFB 1RUAL 1TDQA 3FRUB 3LH2L 1RURL 4D9QE 2A6IB 1GQPA 1MYRA 2LABA 2NXYD 3RGHA 5T1DH 1KIQB 4OLEA 3N04A 4L4PA 3NIFE 1W3JA 3VGGA 4HQQL 4PJCE 4MA1B 5D70H 2ITDB 1WBYB 2QMKA 3V0VB 2E6JA 5JXEC 1CLYH 1U8JB 1OWWA 5EB8A 3G08A 1DWJM 3GGWB 5KS9B 4XMKL 5K9KA 3I3DA 4LCCC 5EUOE 1KJ2L 4XVUD 5DGRA 4G9FA 3UERA 4GZEA 1KTLB 2QMJA 5C6PB 4H25A 1NLBH 4P5MA 1E4XI 1DWHM 1NARA 3AMDA 1EEYB 1W91A 5FO9B 3ZOAA 3HMXL 4BQBA 2EYSA 1MJJA 5BXPA 2W1QA 1T7ZA 2RGLA 1XD1A 4OMDA 4ZFMA 3BE1H 2C7UB 2AQ1A 1N26A 2ZP0T 1DE4B 3HS0A 4ZFZA 3GXDA 4NRSA 5BV7L 4KY1H 5F1OB 5DR5H 5EBWA 2EDBA 4KTYA 1ITXA 3ZKMD 5INDB 1UYQA 4LGSB 3C7EA 3QWRD 1H3XA 2YKLH 3SE4A 1MH5A 1OSZB 5C0ND 2VKXA 1QRKA 2D7QA 2W60A 5EC1B 3T4YB 2ZWLT 5HHQA 5JW4Q 1R5WB 5T5FH 3RWEA 2J1UA 3VNYA 3HNSL 2EH8H 4NO2B 1I1RA 3TWCH 4HUVA 2W46A 1VKXA 1LVEA 2YPLE 5IB3B 1EOKA 4GI8A 4V27A 4JKLA 1HK6A 3GBMH 1YMMA 4EIGB 4JRXD 1XGUA 5MEQA 2OTWB 3UC0H 5IHZB 2V4VA 3QEQA 5C08B 1YYLL 5L2JB 4WNQB 1TITA 4NQEA 3POHA 4OKVA 5E8OA 3TA3C 1H2JA 5I8KH 1S7VA 1XRVA 3UCQA 3CZJA 3D25A 3IJHB 5KS9F 3S7GA 1Z9OA 1SYVA 3TNMB 1C90A 3QUXC 3ARFA 2EEBA 1IL1A 3EDEA 4TTUA 5CG0A 1QLFB 3RWHB 2YKLL 1Q6GA 4NGHL 4U6YA 4JO4L 4W4NA 2V5DA 4ACZA 3PWNA 3F7PC 3EFDL 1Q6DA 5E2TH 1M4KA 2AJUH 3SE9L 2JJSA 4PGEB 2CIIB 3BFOA 3GZAA 5I8CA 5CGTA 1KNOB 4NKMB 4X8XA 5CCKL 1YY9D 3BZ4B 4P8WA 1JYNA 3CIHA 3WDQA 4MX7A 1U42A 4UFLA 2WZHA 5A2FA 5GRWA 4JFEE 5EG6C 1YPZB 1E4NA 3KWXA 1INDL 4WCYL 5D1XB 5I16B 3NCJL 5F7FA 1EHLH 4AIEA 2JEQA 1OH4A 4ODHH 5IBUB 4AC1X 5FO7A 3OBAA 4PJBE 1NCAH 1K8IA 3OPZH 4NPYB 2GSJA 1KN4H 4NFBA 5IK3B 3VXSD 5D5MB 5BVJA 3QUMB 1MRDH 4GKNB 1KT2B 1SYSA 4AZGA 5D2LB 4W89A 1QFHA 5TE4L 5C0JA 4LSUH 2H8PB 4UQ2A 3WSQL 3MRBA 1A7OH 2CD0A 3ZTNL 5FFLA 4G6JH 4KHXH 1LP9A 3FQRB 4JAMA 1UB5A 4TSCL 5EO0B 4PR5B 3BW9A 4OM0L 3FT4A 4N8CH 2R4SH 4YHPA 2R23A 3QNYA 4QDQA 4PRNB 2APVA 3RZCC 2BVEA 4HD9A 5C7XH 4HIJA 4W8LA 4G6FB 1RY7B 1XSKA 2R1WA 1NC2A 3NRUA 5I1LA 4CCCA 5HHOB 2EC8A 2X2YA 1IFHL 4ZS7L 4CVZB 1G7MB 1WGOA 4WJ5A 1QVOB 1ZGLP 4AEHL 5D1ZD 1HH9A 2EDEA 3ULSB 5HYSA 4XCYA 3TONA 1QFPA 3AI0A 5DQDH 4JQVA 3HN3A 3JV5A 1EGJH 2A3AA 2YL9A 4FMKA 5SV4A 2P8PB 1NSNH 3QOKA 4HIEA 5AAMA 3I3EA 5DJ6B 1MNUH 1DANT 2PYED 3O4OC 5A6KA 1W0VB 4L0PA 4OIIL 1DVFB 3O41A 5BQ7B 4XNQA 1RJCA 4FF5A 2ICCA 1EPFA 3BI9X 4R0LC 4DCQB 4W7WA 5IB1A 2VZOA 5D5MF 3F65A 4K9EC 3BPOC 1JI1A 1JAKA 5DXWA 1F2XK 3QUZA 2WCAA 2DQDL 5BROA 1FVCA 5J1XA 3BPNC 1FORH 4L8SB 1HHHA 4D94A 3BVNB 2AXFB 3AIBA 2Y25A 4OD3L 4Y2DA 5DS8B 2MJWA 1CL7L 3A21A 4X6BA 3RBSA 1EX0A 4UQ3B 1QI3A 3WJJC 2YOCA 1DLCA 4UILH 4WEBH 1I5PA 3PP4L 4HSQA 4LDOB 3RVVC 1CDJA 3FFDA 1K4CB 1XH2A 2UY3A 3RO8A 1UJ3B 4QCIA 2W59A 5FV2A 5C07E 4GUPA 4D0DB 5JBEA 5BO1L 1VJZA 2VDNL 4FQXD 2DQFA 4UINH 3SDXA 5EWIL 3MRLA 2HVMA 2BX5A 3GSNH 4MA3A 2CLVB 4GIAA 2IANE 4M7LH 4OMCA 3WO3B 5GRVL 4MNKA 4MAYD 1J1OH 2FX8H 1T6VN 4BFBD 5CJOH 3GK8L 3P0YH 4ZPVA 4JG0L 4U2ZA 3BZEA 2I26N 4LSRH 1B90A 1XH3B 4GQRA 1HILA 2DTMH 4LLYA 5DI8A 4Y4KD 3MJGX 3MV7E 5BMFL 3WL9B 5LGJB 2GDUA 5JZ7D 1TR1A 3QEGL 2CUHA 1IMHC 3MUZ1 1QRNE 1PBYA 3KXFE 3VFWB 1B4RA 3PTMA 4TVPE 5IMLA 3Q6GL 3LEGA 4MGQA 4KROB 3WL1A 4QYOB 1NAMA 4MXVF 1NCBL 4GOSA 3K1KC 2IMNA 5K9OB 3PUIA 5C0CE 3IS1X 4UB0L 1KUMA 2OZ4L 4DGIL 2AXJA 4RZCA 4V2CB 3BC9A 3AM8A 3T4AA 1E6RA 1QSFA 2B8OT 2DSVA 2UZIL 4DWHA 4KXZH 1VEPA 3KPNB 2WBWB 1K9EA 1ZGLM 5JIPA 1N0XH 3CK0L 1CD0A 3OF6A 2HMIC 3BO8B 1QRND 1JVKA 4NWUL 2D9CA 3K4ZA 5ALCL 1IKNC 5D6CA 2YSSA 1BYCA 4HKJA 5FYLL 3EUUA 3HNTH 1I7ZA 4HS6B 3UO1L 4CU8A 3WNPA 2NY2B 1LWHA 1KELH 4PB9H 4BQCA 4Z7NF 5HYQB 2XIBA 5C0EA 2GUYA 4IOFC 3C6LB 4KPHH 4BH7B 5ABEA 2AV1B 2ARJA 2J7HA 5EBGA 4F9PA 3QIUA 2NW3B 4UOQA 1OARH 2IALB 3VXUA 3EYUH 4NDMA 4QDMA 2P42B 2DSWA 1I8MA 4WY7H 3AZTA 1RUPL 4L4VA 2BGPA 2VMEA 4ERSL 5J6HA 1Z9MA 4ZUTB 3JV4A 5DD0L 4L29B 1MELA 4W85A 1QD0A 1N7MH 3HMCA 2BY0A 2D03H 1MFEH 1MVUB 2VC9A 3CXDL 2Y24A 5JHDA 1ZL1A 4U1LB 2WBJC 4KI1A 1YDPA 4JY5L 3RDTA 1V02A 2D20A 1ZWIB 1B2WH 4PRHD 2ZEZA 2VOTA 3GSWB 4Z7UF 4V2BA 4AZ8A 3M6DA 2J4WL 2VDOL 5CBAB 4HPHA 1U2HA 3QDMB 4F9LC 4JREB 4Z0BL 1E3XA 2E6QA 4M1CD 4UUJA 1EDGA 1R86A 1NL0L 3NJ3A 4E41D 4ZAKD 3W9DB 3T0EB 2JD9A 2XI9A 3N13A 1ACYH 1VFAB 3V6OA 1HJQA 3L3IB 4G6ML 2CCRA 3ESVF 5E2UH 2G41A 3RCNA 4RWHA 4KJWD 2P8MA 2P5WE 4FQLH 4M24A 1ADQA 1NCDH 3FQTB 4ZUVB 3LEIA 3N18A 1IAII 1K4DA 1N4XL 4NO5B 5J9PA 2R8SH 4OLYL 3UYPA 5CKGA 2QLVB 5TF1L 1BYAA 4ZODA 5D1XC 3EYOB 4UU9B 2X4SA 4WW2A 1IT0A 2J1KA 4F7MB 5CPTA 3M8OH 1MY7A 3HLAB 4X8JA 1HHKB 5C08E 2EDWA 3NABH 1A0QL 5C09A 3NDZA 3I6LE 4UTBL 5I1KL 4JN2B 4NZRL 3BZFA 5IB4B 1BVKB 1R3LB 1MCOL 4NKIH 5I2UA 5KVEL 4XMLL 1I7TB 3OR7B 4IRSD 4KMTH 4IM4A 4GKSA 3HE7C 5FHBL 1W8OA 5JIIA 5FA4A 3RIFK 2KDGA 2XWBB 3O6KH 3AQUA 4HKBB 1LG2A 1RZJL 3DX6A 1GVYA 2Z8WC 3BUTA 4IS6B 3AMCA 3PZMA 4YBHA 1AXSA 4MQXC 3GO1H 2BVDA 5MI0B 4IIQB 1B2YA 3GI9L 3VX0A 2VSDA 4OT1L 4PY7B 3IDUA 2NY3D 5CILL 3NIDF 1M71B 1E4MM 1I1YB 1DLHB 1UZ6E 4U49A 1YEHL 1FL6A 3I6KA 3S37L 1NCWH 2NY0C 2Z8RA 3S36L 2IQAB 1OBAA 2OK0H 3Q48A 4RA3A 3MR9B 3L6FA 4TVCA 3Q6FB 4NCDA 3LRSA 4YHNA 2PO6B 3G6AA 2VR5A 4UNIA 1CR9H 4NWTH 3S98A 1AO7B 1CFNB 3CX5K 5CGYD 1BWMA 2B1HH 1AQKH 2FSEB 1S78D 4XNXL 2CRZA 1J0YA 1T83C 1XGQB 2YHGA 2YC1B 1L7TH 1P6WA 1PEZA 4P7RA 3CHDA 2DQHL 1OP3H 1A6TB 1U3HB 1H3TA 1ZLSL 3S35L 4HUUA 1IBGH 4WIQA 4XZUB 3T8XA 2R0WH 1CBGA 2OL3L 3O6LH 3ZTJG 3MOQA 3LQZB 1DYOA 3OWEA 5EOQH 3IFOA 2R69H 4MCYB 3MODH 2ICWA 2HTLC 1UJ3C 4ODUA 1FH9A 4LHUG 4KI5E 3OG4B 2XWTA 3K8KA 3S97C 1GOKA 3U2SB 2D7PA 3KJ4B 4KK5D 4UZGA 3JVGC 3UTSE 4U31A 3HZMB 1J8HD 5HHNB 1HZHL 5IROC 4AAXA 5JQ6H 2V5CA 1DQMH 4URTB 4X6EA 3QQ3B 4KJYA 3WCYA 1NCNA 4WW1B 3EHBD 1FIGL 3EYQC 4W5UA 2DAVA 1TTFA 3OZ9H 1T21B 4OGZA 1CDBA 2D7NA 4G42A 2LAAA 4YHZL 5DTFA 3ARSA 3RWIA 2J5LC 3VGAB 4O02H 4LCIL 5D7JA 1GC1C 3DBXB 1QPKA 1MFNA 1U92B 4EI6B 2APWA 4QB6A 4RDQF 5DFVC 2LVCA 3DSNA 5JXAL 3UYRL 2CH8A 4LCWA 3W39B 4OKDA 2X4OA 3DUSB 4A4AA 1MCRA 3KE0A 4KROC 3GMLB 2JFEX 2XZAL 2VABA 1S7TA 3RX8A 2EICA 1S5HA 1UCBH 3DETC 1N3NB 3CTTA 4LRIA 1DBKL 4EN3B 5F3BA 4OV5A 1JZ6A 3JWDC 1DQML 4QPWA 1M7IB 1G9ML 2X7LB 1GOMA 1HYRC 3FQUA 1KEMH 2NLJB 1AXTH 5C86A 1OF2B 3HR5B 4X7TB 2MPAH 1IKFH 3JWOL 5DPNA 3QOMA 3O11A 5LGHH 3EJZD 4BSWB 1G0XA 3HMXA 4H20L 1F4AA 2C26A 4GRMB 5I1EL 4HWNA 3MBEA 2CLRA 1P9MC 4M5YL 1XCWA 1CGUA 4AZHA 4K3DH 4QRPA 1H3WM 4ZD3L 2ZCKH 4LU5H 3O6FD 4XUPA 1A2YB 1G1YA 3GH5A 1BAGA 4P23B 5I17B 5TQ0L 4XWGH 3U7WH 1ED3A 1EFXB 3ARQA 1JWMB 1U8IA 3SJVA 5L9DL 3MXWH 4IOIA 1AFVL 3AIQA 3RVXC 2E9WA 2VRJA 1AD0A 2UUDH 3GHBL 4OLXL 3TBWB 5F9WB 3AIRA 2RCSL 2OYMA 1ODAA 4W4OC 5HHPB 4G8EB 3IIIA 2AJVH 2YN3A 3EOTL 4DW2L 5GRJH 3INUL 4I9WD 3EDDA 4PGZA 4LNVA 5H35B 4UV4H 1TZIA 4ZUSA 4MDJB 3PXJA 5FIPA 3FQNA 3DHMA 4JDZB 3STLA 5F6HJ 4NBXB 1J01A 5TGBA 1SMAA 3D0LA 1IC4H 4HX1A 4JIEA 4TOQA 1YEKL 2DYPB 1A9EB 2PETA 1AIFA 1S9YA 3TP4A 4RFEA 2F53B 3VFNB 1HHIB 4KTDL 2FBJH 4XP5L 3UBXG 1JGEA 1Z0MA 1JGUH 3ORJA 5E7BA 1OAUH 1Q72L 3WFDL 4RX4A 1DL7L 5F8RC 4CVXA 3RBGA 1ZGLB 4DZBA 5EU7C 2VLRA 1I9JL 4QRSB 3KYKH 2FO4A 4DGYH 3PL6A 2IAMD 3DX8A 1JZ7A 2Z92A 5IGXL 4FQCL 3P11H 2J8UA 1QQDA 2YWZA 4WFGE 2OTUA 2ZOXA 4OGYH 3IFPA 5EU5A 5EFFA 4R4FL 3WLWC 3ZE1E 4OLZH 4QWWD 3C6SA 3RJQB 3L5IA 5IUSA 1FYTB 4JPWL 5T33H 4KFZC 3D9AH 1YNLL 7A3HA 3QRGH 4LVNC 5G04L 1QBML 3P9MA 3VMPA 4OQTH 3X14A 2OYLA 2W38A 3FTGA 3TO4A 2BFGA 1PD6A 5IF0A 1FFNA 2WQRA 3T0EE 2BNRE 5HHXL 3MJ9H 1QW9A 4PN2A 4UNVA 4NQCD 4NQSB 2Y7QA 4FQHB 3C2SA 3VI3E 3H7BB 4OD1L 1D9KD 2ZWZA 5DJAA 3NJVA 1JTOA 2XSAA 3B6SB 4IIQC 2W63A 1MQRA 3AS1A 1IM3B 1NWUA 2WZEA 3WNOA 1S7RB 3T04D 7TAAA 1RD6A 4G8FA 3ETPA 3UG4A 4M93C 3SCWA 5ICZB 2EXWD 5I75B 5DT1H 1NKRA 1JV5A 2PO6C 1GQJA 4K7PY 1MREL 3CH8A 1RV6X 1JU4A 1NGYB 5I6XB 1Q94A 4G7YH 1LDPH 4XCNA 3MLTA 1WFTA 4U1IB 4YC2B 3F8UB 5D96C 1E4XH 1EUUA 1QNOA 2WBGA 1UZ1A 2VXVH 2CO7B 2CKBH 2XPGB 3MZTA 3V6ZB 1WE5A 2NY4B 3GSRB 3ZSSA 1DEDA 5KSAB 2BNQD 3U79A 2VURA 4Y19A 5DVLA 5FUZH 4AENB 1U3HC 1WPCA 4Q0XH 4NRRA 3OTTA 3DI3B 5DEZA 2APXA 4A6YB 1E6JL 3K1DA 5F88B 3I2JA 4OZIA 3WKZA 4PRAB 4N5UA 4M62H 3ARGA 3NA9L 1A22B 3BMVA 3L3DB 4ZTOL 3QNXA 2XUCA 3ETBF 3AREC 1H8SA 4HUNB 4XZBA 5ABDE 5DUML 2B5IB 2CJUH 4I3SL 3N1PC 1IGML 3SGDH 1E4IA 3PTQA 5F9JB 1KJ3L 4LFHD 2IPUG 3DECA 4NKOA 3TZVA 4JG1L 4PG9A 2A9MH 2Z93B 3VU2A 4FMVA 5D7IB 1NBYA 2R0ZH 2WAAA 3IGAB 1FHDA 5ITBL 3NACL 4MNQB 4DGVH 1A1OA 3WKML 3OB0K 2DT0A 1J9CT 4MS8D 3KJ4C 4R4BB 4LHUD 1W3KA 3HI5H 4R96B 1RK0A 1G7PB 1UXWA 3VIOA 1NANH 4PP1D 4XP9H 1DN0B 3X13B 4LASL 3MV8E 4DTGL 2DQTL 3MREA 3T2QA 3GIZL 1F4YH 5JXHA 2XWDA 1FFQA 2OX5A 1MI5A 1YEDB 1HOCA 5HYEA 3AJ7A 1MLCA 5AZ2L 3VGAC 2OTPA 2G2RB 3F7YB 3P40A 2PWEA 5E9DD 4O9HH 1WZLA 4XV0A 3QQ4A 4M8UA 4D6DA 5FCUL 1BZ9A 4HCRH 4L8DB 4DZ8B 5FK9B 4LEXH 1YEFH 1FZOA 2XTJB 3V4UL 3I2GA 2F15A 3HC3L 3OL2A 1AVAA 3O3BB 4NC2B 4HUXA 1KFAH 5A16B 4JQXC 1JP5A 1UM5L 4U1JA 2PTVA 4WUUE 2OZ4A 1QPXA 3B9KA 1I1AA 4EN3C 1F2QA 3HG1B 3FFCA 5EZOH 2WM0A 2VRKA 2QF8A 2GJ6B 4GQ9L 4JFPA 1EBAA 1ISVA 5FO8A 4GW4B 1UH3A 4N1CA 1OTTD 3O8XB 4PJAF 5E08L 2VR4A 4AY0A 4YXHL 4JKPL 1JPTL 1FZJA 1ZHNB 4TPRH 4X80H 1IGYA 4DUVA 3HA0A 4M5ZH 1LL6A 3VRJB 2QQKH 3K4DA 2ADGB 5DLML 1BM3L 3FMGH 1MUJB 1AR1C 1H3UA 5F7DA 5EJZB 4K7PH 2HFFB 4WUUD 4UMGA 3CSBA 1GU3A 4XI5C 4I0KA 5CEXA 3B3IB 1HIMH 1VPOL 2B4CC 4WV1C 3NTCH 1OTSD 1TCRA 3CMGA 4HWZA 3QFDB 7FABL 3L7EB 4PJDA 2FECL 2MHAB 1MJUH 2WWKT 4CD5A 2W65A 5IMMA 5JW5B 4JZNB 5KVMC 4XXCA 4OZFB 1LEGB 2PF6A 4ONHA 4Y5VA 3OKYA 2DCJA 1S7UB 5J4MA 5T5NG 5IJKC 5DQJA 5CLTA 1W1VA 3VOCA 5F7KC 3GMPB 3L3OA 1NFDE 2A3BA 3FMGL 3ILQD 4ZXBD 3BXNA 4JRYB 3K7UA 3D18B 1VADB 2I07B 5IBLC 1RPKA 4MNLA 1IGIH 1UH4A 2H41A 3MJ6A 4U1GB 2AMGA 3MLSL 2CUIA 2VN4A 5SWZA 4W7UA 5KW9L 4KRLB 4GLRH 1ZXQA 3DRTA 1CGTA 4GXVL 2P7TB 3VWJA 43CAA 5DMGD 3R0NA 1ZVSB 3WUWG 4FZ8L 4IISA 5KSVB 2VXTH 4Y4FA 1IAIM 4S1SL 5ACZB 2VWEC 3NH7L 4JKKA 3HRPA 5L7XH 4YXLH 1T20A 5T3XH 2NXZD 4KZDH 3VFGL 3EJJX 3QUKB 4MADA 1HL9A 2FEDC 1MPXA 2FL5B 1JDDA 5AD0A 3HE6A 3O2LA 5FYJU 2HT3D 3IU3A 2CDOA 5E5UB 1T5WB 1B3ZA 3NZ8A 4PTWA 4K9EL 1A6UL 1GPOH 2IWGA 5J1SC 3QO1A 3PZGA 3IFNL 3VFOB 4MD5B 3JUZA 1NFIB 4PYGA 4K3JH 1T7VA 5TFSL 3BH4A 2FYYB 2Z9TA 4R97C 4PREB 5BVPL 3CMOH 1MOEA 4Q97A 5J1TC 2R2HB 3REWB 4XCEB 2NY1B 4ZUUA 2WNWA 5L2KD 2XZQH 1QUNA 5EBMA 2DQJH 5JPMA 1F8TL 4L4TD 1V0LA 2Z31A 3DX9B 3BYYA 4TVPL 3ULUF 3WELA 4MD4A 2NX5B 5GJSL 3HNBM 1F90H 3WUZA 2EDJA 1Z3GH 2VC2H 4DAGH 4CADA 3G5ZB 4NJAL 5CZKA 1IGJB 1BQLL 4HLZG 4OI8A 4POUB 4YXKL 1IQWH 5IFHL 4Y16C 1V7ML 5AG8A 5I75C 1J5OL 4DUWA 2CIKB 1LILA 1J86A 4H1LA 3AFLA 5F7EL 3I2KA 2WMIB 4M81A 4Y5XA 5DHVB 2YC4A 3VFUB 2A3EA 3DUHA 4LLWB 1PFCA 3HNVL 1OP5H 1OT2A 3P4NB 4S1DC 3OJVC 4MCZA 5GSVB 2VZ1A 3SDDA 4YC2C 3BIKB 1OSEA 2ZJSL 2GK1B 3WH7A 1C12A 2FJHB 5F8QC 3V6FB 3RX7A 1RSFA 1KWGA 4DWSA 2MCG1 3TO2B 3S37X 1MW2A 2A74A 4MXQC 3S36X 4XH2A 5C0BA 2GT9A 4ZZ8A 2WVTA 2EQDA 1I1XA 2DQEL 1M53A 1KBGL 3D3VA 1T0NA 2OL3A 1WZAA 1T5XB 1N8ZA 5C9JA 2P46B 1EEZB 2R2BB 1ND0A 2VL5B 3GH4A 4P4KA 5HGGS 2BFVH 5JUEL 2HLEA 4P5TC 1GGCH 3FKUS 4RGMC 2CKRA 3PWLA 3MX0A 4HXAH 5E4IA 1KN2H 3QFJB 1FAIH 3AHZA 4I0PC 4ODWA 4HH8A 1HHGA 6TAAA 1O7VA 2HYMA 2H2PC 2HJKB 3D0VB 3GKWH 1L8NA 4DM2A 4ZPTA 3QEUB 4HZLA 5DJDB 5L6YL 4E4PA 4UV7L 1RJZA 3RGVA 1V08A 2Y36L 1GORA 5D8ZA 1FNGB 5CJ8A 3I6GB 1YN6A 4GAYB 4ENED 4FZEL 4OZHA 3BGAA 4XXDA 5DK0B 5FOBB 3RWJA 1O7AA 1O8PA 3AMKA 2ITCB 3VINA 3ZQ9A 1WWAX 1GIGL 3MRDA 4ORZC 3UYOD 1DWAM 5KANI 1MFBL 3QHFH 4CD4A 2G9HB 3WXVH 1CFBA 1F3DJ 4ZE5A 4NHCL 3L3JB 3WQBA 1A7PL 5ABFB 1QBLL 4OQ1A 3BKYH 4X6FB 3N85L 5LAXB 4KJQD 5ACLA 2E26A 3QEHA 1H4PA 1LE9B 1NDGB 32C2B 1RZIA 1L6XA 1I1WA 4I3RL 5J6GA 2Y4SA 5D7IE 2ZUMA 4URIA 5TE6H 1JGLL 4F7TA 5HVWA 1VDGA 2ICEA 4NM4H 1YEEL 3QBTB 4OD2A 1ZS2A 3TT3L 2W47A 5CZXD 2EXYD 1RJLB 4HIHA 5FV1L 3SCTA 3WNNA 4BZ2L 4F3FA 3RNKA 8FABB 1R85A 1GSMA 1MVYA 4WHTB 4P2OC 4UQEA 3WD0A 1FLRH 1PQZA 4NO3B 1V3IA 1UXSB 2H3NA 4RMVA 1MCCA 2XKUA 4Y88A 1CECA 3H0TA 4FTVB 3SCMD 1QOKA 4Y4HB 2I9LB 3EGSB 5ID0B 4WI8A 1HDMA 4IUGA 4YHEA 4S2SB 5DZOA 2ADJA 2A73B 2Y5TA 2UVEA 1KCUH 4NZCA 1OW0C 1KPUA 1I8IB 3ACIA 5DWUH 4WTWA 1DQLH 3IJ8A 3N9KA 2XTJE 3C60D 2EDRA 1BAFL 2A0LD 1ZT7B 4TSBH 3ECQA 4GZ9A 3I97A 3MLUH 4XPGH 1G7QB 3QUML 3WE6A 1BLNA 3PABA 2C4FU 3CZFA 3BUYA 2XY2A 4Z7WB 3IU4H 2RGMA 1GCFA 5HYJE 3HG1E 2VLJB 3DYOA 4PBXA 5IFJA 4JY4A 1S5IH 4HH9A 1H15A 4UT9H 2VYRE 1JFQL 5FB8B 3LS4L 5C9KA 3MLVL 1AD9B 2OQJA 2XFXA 4QXGH 1G9EA 4JZJA 3ULUC 1A1NB 3W27A 4H8WL 4NYLA 5DA4A 5IV2A 4P59L 1HQ4B 5MP6L 1UWRA 1J18A 4UAPA 2FATL 3U36A 5L8LB 3AYSA 1J1XH 2CDEA 4EXKA 1CLCA 5B4XA 4A3HA 4C7GA 1L7RA 4JN1H 1CXIA 2LTQB 12E8H 3MRHB 4U1GC 1GGIH 3UP1A 4M7ZB 4L3EA 5KSBA 2QQQA 4NP4H 4OFYA 3DXAD 5I0ZA 1T2QL 5HYJD 2P8LA 4N0FB 2NYYD 2IPTL 3UTZA 1BOGB 2DQUL 1U6AH 4U3XA 1N5AB 1YN7A 5HGHB 2GY7B 4ALAL 1SJEB 2DKSA 2ZXQA 2J47A 1B3YA 3F7VA 2QQIA 4X0VA 4WU7B 4FQJH 4NO0A 2W0LA 5E1AA 4ODTL 4LPCA 2I60H 2YA0A 1H49A 2PWHA 3AZRA 3RHWK 1CIYA 2MKWA 5J89A 5C3LD 3T2OA 4YHML 5TF0A 4XPBH 5FDYA 5T1KD 5IEKB 3QDJD 2VDQL 3I50L 1A7RH 3KPRE 3PHOB 3R1GH 1QFWH 4JRYE 1OQOA 1C8QA 1U3ZA 4RMUA 1RZ7H 2DM4A 4APQD 4U1KB 2ATKA 4UIMB 4ZFOB 1Z6JT 2DI8A 2DMBA 4FRWA 1VIWA 4XHJC 3E8UH 4X6CF 2NY1C 3WHE0 4PJCA 5F44A 2JJVA 1FFPA 4JDTH 2WUHA 4JFFD 1I1FB 2GFBA 5FGBC 1QHOA 4S1RL 4TVUA 2VZ3A 4MA8L 2ZKHH 3WF0A 3BP4B 4MJIB 4BH8A 3CFCH 4PJHF 4OJYA 3EIFA 3LKRB 5EUOA 2Q87A 5FF6B 2A6DB 1V3JA 3DUUB 3IJYB 3KPRD 4HUKB 3SDCB 3AICA 4F7PA 1JGIA 3T1FA 3HFML 2P5ED 3A67L 5JXED 1RZ8B 5D1QB 5EZIH 4I48A 4N8VG 4PJGB 2EKSB 4HWEH 1MXDA 4NNYA 2DCKA 1RHHA 4YHOH 1CFQA 2QKIA 1BQUA 2AXGB 3U7AA 5ITFA 4P9ML 3NFPB 1EXUA 3GH7A 5EORH 5GGVY 2Q7YB 1OLZA 4HKXA 1RHFA 1MCPH 3TIEB 4LIQL 4D8PA 2YA2A 2OJZL 3SDAA 1TJGL 3MV9B 2YL6A 4AT6B 4WI2A 2I5YL 4G8GB 4Q6IB 3QJHA 5BRZB 1QLRB 1GC1L 4JDTL 1I8KA 1VACB 4DFHA 4Q58C 3QISA 2IPKA 3DGGB 4UFIA 4CD7A 1RZKL 3B9VA 5MEOA 3GGLA 4P46B 3LV3B 5D9SB 3WIHH 1JUFB 3FO1B 4R6UA 1W9DM 3A4XA 4LP5A 2FH8A 1IVLA 3WUFA 1H1NA 3N15A 3IDJA 2Z1SA 2L0DA 4QGYA 3VFPA 2A38A 5IB2B 4TUKL 3BQUB 5FIEA 2E0PA 3EZJB 1I85A 2IQ9H 2YPLA 3JWDL 4LYPA 2C9KA 4GRLC 4HWEL 1SHWB 2ZX8A 4JO3L 3L3HA 4JCLA 4O00A 1U8QB 4XP1H 2F2HA 1MCPL 3D39E 3PTKA 2GAZB 3U1SL 2YB7A 1FL5A 1DSFL 1JGDB 1T4KB 5DD3H 3DMMA 1EEQA 1ZJAA 2XOTA 3U7BA 2YEZA 3PF2A 4QHMB 5GQBA 5CEZH 4PSPA 4P9HL 4XBPA 2X4PB 2X89D 4TTDC 1CENA 1BF8A 3A4WA 2WSKA 3QA3A 4U1MA 1C93A 1HWHB 1OB0A 3ACGA 2ADIB 3TA3D 1G7IB 4K2UH 3VM5A 4Y2OA 2R29H 1ZU8A 2DQCH 4YHYC 4E42B 2IH3B 3U0WL 3L4TA 4BA0A 3QUXD 1A3RL 1WWWX 3VTRA 2BRRH 3AB0B 5HPMB 1SDDB 4PRWA 2FDBP 3TBVB 4DKDC 5HD8C 5J1AA 4JFEA 4HK0B 3ROLA 3SCRA 1QEWA 5I19L 1R24A 2O61B 2J1EA 3LS5H 5EO1B 1UD4A 4PJBA 3R06A 3QFJE 1F6LL 4KDVA 3OGVA 3QJFA 1PVHA 1F3DH 3STZB 4IRJC 3WDJA 3GMNB 4MTVA 4TRPH 1E0OB 1DANU 4L9LA 4P7NA 1Y0LB 2BNUA 4AM0B 4UTAL 4RBPH 1V8HA 5EC2B 2WKLA 3CPLA 1UUQA 5JLZB 1BECA 2K3TA 1TCMA 4KHTH 1LEIB 2DT3A 1XR9B 1WAAE 1UR1A 1I3UA 4CRPA 5C0IA 4GRWF 4PGCA 1FO0A 4YH6A 1JN6A 2Q6WA 1RIUH 5D7LD 5E8PA 3EW3B 1ZLVH 3FB8A 4OB5L 4P48A 3B2VL 4YE4H 1M7DB 4JHWL 5ABGA 2DQGH 1IV8A 4X83A 3BDYL 5ILTL 4ZTPH 1M6OA 1F11A 5A2LH 4AMKL 3W6MA 5E94B 4DN4L 1ZLUH 4OLWH 5GGVH 1MQQA 5E2VH 3V52L 3G08B 4J23A 3RZCD 1UENA 1JXJA 3JUYA 3LEVH 1MIEL 3EO0A 4XMPH 5TQ2L 4AD0A 2UY2A 3X12A 1HVXA 4PJ7E 3BH9A 3SY0A 3MSGA 2QL1A 3QWOB 5DMYA 3E6HA 3WQWA 1ES0A 2FX7L 1FHLA 3NGBB 4P5MB 3FZUC 3KL0A 1ZTXH 4LVHB 1A47A 1JNLL 3BWAA 2EYSB 1MJJB 5DC9B 5GGSY 2J88H 4FTVE 4ZFZB 3VMOA 1KGCE 1JGVL 1K6AA 2DI7A 4XPTH 3PUHA 1K2DB 1A6ZB 5DT7A 2B7DT 5EBWB 4M7ZC 5M5DA 4KUCF 5E6IC 3PHQB 4DKEH 3WD1A 1X7QB 2YBRA 3L1OL 1MH5B 5C07A 2OKXA 2R0KL 3BH8A 3HI6H 4F33A 2W60B 3C5ZA 5DD5H 1KQYA 1KG0A 2W0PA 3TH3T 2CDPA 4OF5A 4JE4B 2IANA 1T89C 3MMEB 4HUVB 3RVVD 2QBWA 2VLJE 5JOPE 3U7YL 5T3XD 2V3GA 2GY5A 3TEUA 1A7QH 4K3EH 3U0PB 4JM2B 4NQEB 4MNGE 1S7VB 1T1WA 3H6JA 4HG4J 5IB5A 2E40A 1HSBB 4QT5A 1KXQE 5KBNC 5TDNA 4GS7B 2E5EA 1MFAL 1LO2L 1SYVB 3ZDYF 4ELKA 3MV7A 1X5XA 3ARFB 1XF5A 3LDBC 3G6LA 1IL1B 4FXGA 3CUJA 1FNLA 2ZPKL 3QWQB 35C8H 1B9ZA 2F8OA 3V2AR 4U6YB 4ACZB 1QRNA 1QYGH 3PWNB 4O4YH 1C8YA 1W9BM 4RL3A 3W4RA 5TDOB 4XAKE 3KXFA 2BXYA 5LXGL 2HISA 4UQAA 2AK1L 3OX8A 1UQSA 3Q0HA 1B4JH 5EULV 4XNUL 1UD6A 2HH0H 4L4OA 5C0CA 4P2QD 1EFQA 4C59B 1WT5C 3ARDB 3ZHLA 1D3CA 3BEWB 1CYGA 2JB6A 4YUEH 1ETZA 4XVTL 5GIRB 5JR2A 1A6PA 2CQVA 4S3KA 3T65A 4EE9A 1CGSH 1NMAH 1K8IB 2MANA 1RQ5A 4WU5A 3S2CA 2AJ3A 3MRFA 4HMEA 1DN2A 5F89B 3OEBA 3CFEA 1SYSB 2DI9A 4O5LL 2A6IA 5C0JB 4UQ2B 4M8VA 1LD9A 4ACYA 1D5BB 1LP9B 2JJWA 1MHCA 1XF1A 4JAMB 1UB5B 5CXPA 1ZOXA 1QG3A 4QF1A 1OAXH 3S3PA 3S88H 2HMID 1ULVA 3FT4B 2ITDA 4W87A 1F42A 3D87B 5AG9A 3QG6A 1U8JA 1YJDL 3LSOA 4YHPB 2R23B 3QNYB 1RUML 2FGWL 2Z35A 2DLGA 2VE6A 4IEFB 4MJIE 4Q9RH 4PMYA 3ZR5A 3SDYL 3O2VH 2NW0A 2B4CH 1NMAL 4IOFD 2PI6A 3U4BL 4NKQB 1NC2B 5D9NA 3PN8A 5I1LB 1RP9A 2HFEB 1LHZA 4WTZA 1FRGH 4HG6B 2WMJA 1BD2B 1VGKA 4WJ5B 3RZWA 4UCFA 3CDYA 5D8JH 5B38A 3O4LE 1GNYA 2AJYL 4PJGE 2X09A 4N0UB 5FO9A 3A6CL 2IF7A 5I1HH 3W0WE 3HU7A 3B9EA 4OFPA 5J0BA 3MV9E 4MVBC 1N64L 4ELMB 1DE4A 1DJSA 4V1DD 5FYKH 5BRZE 2WBJD 1P1ZB 4PUEA 1J0KA 1K12A 4XNQB 5J7CC 1A6AA 3AMLA 3MPCA 5INDA 5IB1B 1MF2H 1O59A 1EJOL 1SJXA 2P5WA 4Q9RL 2ESCA 1OSZA 3QUZB 5EC1A 5EPMA 3AB0C 1RI8A 4R7DA 5BS0E 5T3ZH 1MQKL 1HHHB 1PZUB 2H1PH 4Y2DB 2COQA 4QDRA 5GS0C 4WWKA 4NO2A 1LP9F 2E9MA 4MZ3A 2BSRB 4JR9L 5IEHA 4P4RA 4PGDA 4OF0A 3FFDB 2OTWA 4QHNA 1AE6L 4X6DB 5C08A 5L2JA 1AP2A 4A42A 3MRJA 4ORGA 4NM8L 3TA9A 4YDVB 1TVPA 1WIOA 3IJHA 3NFNA 1N6QH 2CKSA 2DQFB 4NFDA 5FYKL 3A4AA 3ULVE 5D1XD 3TNMA 4N0CC 1G6RB 1BTCA 5KVFL 1DBAH 4K8RL 5J56B 5E8DL 4MA3B 3RWHA 1CICC 6FABH 4C83A 1SEQH 1EO8L 3WFBL 2VXQH 2ZXAA 2BK8A 3KDMB 1VFUA 3WFEL 1F3RB 4OGAC 2CIIA 3TC9A 1KGYA 1KNOA 4LLYB 4CU6A 3KHQA 2M1KA 5DI8B 3HE7D 4RRPA 1R5VA 2E32A 3BZ4A 4JQIH 3C8KB 2DBLH 1IAKB 4M6OL 4MQXD 2WZIA 4R3SA 3ZYZA 4NPYA 2VLKD 5IMLB 5IK3A 3VXPA 1CWYA 5IWLA 4BYHA 1CD9B 4GKNA 4PMXA 1KT2A 2NY0D 4G6FD 5J8OA 3W24A 5HHOD 4RZCB 3W0KA 1L0XA 1QSFB 3VXME 1FIEA 3FQRA 1E72M 3PNWB 4PR5A 1E6PA 2Y1VA 4NNPH 3U48A 3NGBC 1WZMA 1MSPA 2DLIA 2ZX5A 1P7KB 4FS0A 4LVHC 4RDQG 5F71A 1PG7H 2O9RA 4CAGA 2A6KA 2VITB 3NFSH 3SDXF 3TBTA 5D7KD 2MQCA 5D6CB 2YSSB 3X3GH 2ZUNA 1MRFL 2AJXL 4HKJB 4XZUG 1W2PA 4QTIL 3MJ7B 2XVKA 4A6YH 4FNLL 4KQ4L 1I7ZB 4CD8A 4PSRA 4E2OA 3GJFH 1JNNL 1HT6A 4B16A 4KK8C 3S9DB 1CFVL 3HJEA 4DQOL 4LK4A 4CVZA 5IHUH 1HKLH 1A9BA 3AC0A 3S34H 1FE8L 1QVOA 2ARJB 3TT1L 3ULSA 3SE4C 3QIUB 2AJSH 4GBXB 3VXMD 2QSCH 1UADC 3MCG1 5K9JH 1B88A 5F1NA 3VXUB 4UFKA 4NDMB 1PY9A 2MWCA 2WLYA 5A1AA 1I8MB 1WBXB 2WCGA 4PTTA 4L4VB 1V5JA 4EDXA 5DJ6A 5J6HB 2AI0H 3UTSA 3IDYB 3JV4B 2HTLD 1DVFA 3OSKA 3ZSTA 5BQ7A 3CH9A 2ZEXA 2W92A 4I77H 3HUJB 5JHDB 4XVJH 3MCLL 4W8AA 2VUYA 1YDPB 3RDTB 4F8TA 4NBZB 1GHSA 3F6IA 3QXUA 2E9LA 5A3HA 3X17A 4PJ8B 1YYMH 5HDQH 3SGKA 3LQCA 2LU4A 3NA4A 3QXVA 3MLZH 4GS7C 4EUPH 4OCSH 2F5BH 3RDKA 1P4IL 3ARFC 3BD3A 4L8SA 2WO3A 5I8EA 2AXFA 4WI9A 5IFPA 2PR4L 5DS8A 1V3HA 4CKQA 4RGNC 5IFTA 5F9OH 1XV8A 4KZEL 4ZQKA 5BZDA 3EYQD 4U1NA 4YGAB 4W88A 4U3AA 1Q0XL 2BY1A 2JJSC 4RAVA 5FCZA 4N90D 4JPIA 2Y07H 1BFTA 3G6JE 1P4LA 3UTTE 1FNSL 4D3CL 5B22A 3GUTA 2V6HA 1K4DB 2PB1A 4D0DA 4ODVH 5J9PB 4HT1H 1EUTA 1EAJA 1UWGL 5FM8A 5DFVD 1W0WB 4M3JA 1OGSA 3PWPE 1HJVA 3T77B 4PD4K 3BP5A 2J3SA 3ZE2F 1I8LA 3K46A 1YYML 4KROD 2B2XL 3C7FA 3WIIL 3TPUA 3DETD 5C09B 1XH3A 2IFGA 5E8EB 5AY7A 4F2MA 1GPFA 4ZMAT 4X7SL 2O5YH 3BZFB 4V28A 1CF8L 3GSUB 4U1HA 3IK2A 5DRNB 3QDHA 4RMQA 5AC4A 1BFNA 3WH6A 4GKSB 3MU7A 3WL9A 1EV2E 1UY3A 4GKZB 2HT2C 4HUWA 4JFZL 2P43B 2H32H 3SE8L 3OKLA 2BGOA 1EHNA 4RNRB 1AXSB 3TCLA 2NY5C 2J25A 1AI1L 3FXYA 5A6BD 5K9QG 1K42A 4QYOA 5IBTL 2WYSA 3MRIA 3PXHA 3ILPB 4G6KL 5K9OA 2YR3A 2WVVB 2A77L 1TNNA 2DQIH 1FL6B 3I6KB 1W9VA 1MPAH 3RA7L 3RAJH 2J8FA 2ZXDA 2V9RA 2K1MA 4HMDA 3L6FB 4F37K 3K80A 3TF7C 3LRSB 3T3PF 1HI6B 3G6AB 2WMKA 4CN1A 5JBDA 1B0RA 1MEXH 4LVEA 5JR1L 1HNFA 4JFQA 2Q3ZA 3RVXD 4JQVC 5G05L 4OZFH 1F6FB 1MRCH 1HINH 4HS8L 4OLUH 1N5YH 1QNRA 4HWUA 2VT0A 4EANA 3L4ZA 2E8ZA 1HCFX 1SQ2N 2JJTA 3ULUH 4HS6A 5CEZD 4ONGL 3QULB 4W86A 4E9LA 2QQLL 2WP3T 4WW2F 2FWOA 4QRUB 4JM4L 5F70A 3O2DL 4PEEA 3C6LA 3IFLL 4TNWK 3AU1A 2AV1A 4XCCL 5C0DB 3QDMD 1H5BB 1FV1B 2IALA 3CVIH 4MDOA 5JHLH 4YEEA 3D85D 3TM6A 2AAAA 1UACH 1OOAA 1VA9A 4Y2DC 2XQXA 4FFVC 1EZVX 3WMBA 1BVZA 2G60L 4L29A 2H9GB 3IFOB 3H42L 5EO9A 1CZSA 4HP5A 3QIWB 2V3EA 1BD2E 5DVKA 2RAMA 1NEUA 4JB9H 3GBNL 3WD5L 1JDAA 1FP9A 1ZAGA 3EYSH 3GSWA 1A14H 4N0UE 2CIPA 4K23L 2CERA 3WFLA 4KJPC 5SWSE 5KVGL 1YC8A 3W9DA 3T0EA 2BNRA 4ELME 2YC2A 4LSTH 3SKOA 3WLWD 1BJ8A 4JY6A 5C0RL 3O0RL 3L3IA 5FOOA 3UEQA 1GGBH 4UQCA 3RWDB 1EGJA 1WB0A 1BFSA 2JCCF 3EO1A 5CJ5A 4WDIA 3FQTA 2D7TL 1KC5L 4ZUVA 4OCXH 5GHWH 2BVOA 4PBVC 1MCSA 3RWIB 1UMHA 1RZFL 3TH2T 1A5FH 4HV8B 5KVDL 4IJ3B 4QY8A 2JELH 3EYOA 3JV6A 4UU9A 3VFMB 3OKDA 1HXYB 1T03H 4RWYH 4AZ6A 2VISA 2V2TB 2X4OB 1ULOA 2F54B 1GQIA 3CXHJ 1FDLH 2XQYK 4X6DE 3VXRD 3KLSA 2R56H 4Z2AA 3WF2A 5F7MC 1S7TB 1S5HB 3H3BC 5JOFB 4M1RA 3EAKA 5F3BB 1J88A 3G5XA 5BJTA 2CDFA 2APFA 3BKCH 3MUAA 4NUGL 1OD8A 1I7TA 2PO6D 3C7GA 4PTMA 3AM8C 3FQUB 1JWSA 1AO7D 2QPUA 5LA2A 4HIXL 1SHMA 2A83B 4HUMB 1LO5B 4LHQB 3DHPA 5A2JH 3O11B 4IS6A 1M05B 5SX4H 4UT7L 1CGXA 3PV6B 4FMFA 1OGAE 2XVPA 2YUZA 1GJIA 4ISVA 1Q9KA 4JHZA 2DLFH 2CLRB 4D9LH 2AK4E 1DBBL 1RVFL 3NCCB 5BV7B 1KXHA 4OTXL 1I1YA 2VH5L 3MLRL 2B0SL 1NX9A 3GXFA 1QNZL 4CN4A 4F9JA 2HT4C 5A6LA 1U3HD 4Z9KB 1CG9B 3VXTA 4FQPA 2HRPH 3EYFA 4QOKB 4M43L 4UOW1 4F9PC 4WFFD 1CFNA 2E9BA 3QIUC 3PG2A 1S9KC 1U8IB 4WHYH 3SJVB 2A1WL 4IOIB 2J7EA 1J1PL 3ARED 2EYTA 4BXSV 2XN9B 2W95A 1LO3H 1XGQA 2WV3A 1AD0B 3EMZA 4C54A 1DLFH 2YC1A 3PV7A 1SBSH 5FOJA 1BIIA 1CCZA 1JAEA 1Q6FA 2X44D 1SY6H 4PMQA 4R2GB 4O2CA 4CJ0A 3MV8A 4IPLA 1TZIB 4ZENA 4ZUSB 3VD5A 3MTRA 2ZX6A 2EIDA 3FQNB 3WDRA 2C3VB 2OR9H 1QSEE 4XWOC 5TGBB 3D0LB 4HX1B 1GJWA 2Z8SA 1WSST 1UEYA 4P8XA 1B3WA 5JTWA 4LPUA 15C8H 1AIFB 1URLA 1UKTA 3V6OC 1FHGA 4RFEB 4MCYA 1J7VR 1K8DA 3GSOB 1PEWA 1JGEB 4D2NA 5A6MA 5JW3L 1JRHI 1OAQH 1QVBA 5E2WL 4CVXB 1WZ1H 2W1NA 4PJEE 4FQ2H 3VWKB 1FP8A 1I4FA 3OJDB 1REIA 3DX8B 3U0TA 2Z92B 4LAQH 4GINA 4GMSL 4GAJL 2J8UB 1CE1L 1NUGA 2CMRH 3GXMA 3GMRA 3HZMA 4NRZA 5HHNA 3IFPB 2XYLA 4WW2C 4F58L 2BY2A 1FBIL 3HUJE 3QQ9C 2VCCA 3LPGA 1AMYA 4C56E 3ARXA 1P4BH 3W5NA 1FCGA 2DDQL 4EN3D 1PLGH 4HC1L 3BSHA 2F9BT 3P9MB 2QQNA 5I18L 3HNMA 3TO4B 1BEYH 1FFNB 1T04A 1U92A 3CU7A 1KCSH 2VQTA 1XEDA 1BG4A 4AEIL 1EXPA 3H9HA 3RU8L 3CUPA 3W39A 4G8IA 4O58L 2HJLA 3FB6B 4QRRB 5DJAB 3DUSA 2J4GA 3F5WA 3MACL 3QHZH 3GMLA 2FR4A 4E8CA 1JHLL 1AR1D 1I7UA 1N3NA 3LN5A 4PRPD 2OSLB 4LRNL 1C08B 4G8FB 3ABZA 4XI5D 4Z77A 3RIAK 1DBJH 1M7IA 2X7LA 3DRQB 4XGZA 1JTPA 2NLJA 1K3IA 1FH5H 1OF2A 3HR5A 1R7AA 2Y9RT 2EXOA 1CBVL 3DROB 1QR1A 1LO4L 3HI1A 3AVEA 4ZXLA 1Q94B 2Y06H 1NFDA 4JGJA 1XCXA 4OZFG 4HFWA 1C1EH 4XCNB 1JHKH 1IAOA 2J7FA 4HPOL 1UA6H 5GRYA 2EPKX 3T3ME 4XC3L 3VXQA 4I0CC 3MNWB 2EJ1A 4RMRA 2J8UF 4RFNC 3GRWH 1WFUA 3ZJ7A 3LZFH 4Y19B 4K07A 1FNEB 5FYKD 1YEJL 5FYJE 4FABH 4P23A 2GW5A 5K33A 1VB9A 5IBLD 4OZIB 1EFXA 4H88L 5TPWH 5KJRH 2DYPD 3A0OA 1OQXA 1EVUA 4XPAL 2F53D 3TBWA 3S8WA 5T3ZD 4YQXL 3ZYIA 3KJ6L 3OR6A 3DHJA 1LE5A 4G8EA 3GNPA 3SBWA 4KVNL 1DFBH 4YR6A 5CINL 3BLPX 3TZVB 4NKOB 5TE7H 4LARL 4PG9B 3VDBA 1XIWA 2HWZL 2VR9A 4MDJA 1NGQH 3UESA 1NBYB 2P49B 1TETL 2FEDD 3HAEH 5JOEA 5DUBB 2YL5A 1A1OB 2VTFA 2WAOA 5LA0A 4Z95H 1XCTA 1RK0B 4V2XA 4NN5B 1FG2B 4NCC2 4OUUA 5I15H 2PTTA 1VGEH 3AHVA 1OT1A 5HOSA 3NZHL 3MREB 1FYTD 2VDML 3UZQA 5CUSH 1DQQA 4DJMA 3AY4A 1MI5B 1ZGLA 3CBWA 2EDNA 3MFGB 1MLCB 5I66A 4QRSA 5D7JC 3FOLA 2APTA 2E7BA 3QQ4B 4IJ3C 1CN4A 1SMOA 1R5IA 1BZ9B 4IDJH 2VDPH 1FZOB 4WSJA 1NH6A 2XA8L 2D3LA 1ONQA 2UWEB 2SEBB 3O2WL 4OZIF 1UM6L 4MQ7B 4JO2L 3D6GA 4U1JB 4Y16D 1IGCH 1NC4D 3I2IA 1UT9A 3J8F7 2OWWA 5FECA 3BSZL 4LRIC 2JTDA 4BA8A 3B9KB 1I1AB 2VDKH 5D4YA 3W53A 3FFCB 3EFFA 3FAXA 3UPAA 4CBPA 4IMLB 4JFPB 1K6QL 1CX1A 1EDTA 1AQ0A 4ZFOL 5FO8B 4OZ4A 4HF5H 4TULH 2ORBH 2OSYA 3VD4A 3CKHA 4S1DD 1KWKA 3ZE0E 3H7BA 2C3HA 4OBSA 1OSPL 4U0QB 2XGBA 1LQ0A 3AIEA 1CXHA 5HGDB 1MCHA 3N06B 4MOAA 4RN5A 2MCPL 1FZJB 2R15A 3GEWB 3QYCA 1IGYB 4NC1C 3MBEC 4PJAE 3CCHB 5DK2A 4XAWH 1W9TA 1WCBA 1S7RA 4MXQD 5BV7C 3UJTH 3CLEL 3AUVA 4B50A 3OAYK 3FRPA 1IGFH 5M7QA 3CPUA 2F54E 1NBZA 1NGYA 3OAUL 4WHYG 5L88H 2BMKA 1TCRB 1Z9LA 4P5TD 2WZ8A 2V17H 2H2SC 4HWZB 4QHKI 5FGCE 1SM3H 2IXUA 5L8KB 3SCVA 2WN2A 2C5DC 4U1IA 4GRWH 4UZUA 2LFGA 2W65B 1P5UA 4GMTH 4I0PD 4YDJB 5IMMB 3V6ZA 5J57B 1IAIL 4M48L 5KSAA 3GSRA 5FA3A 1OGGA 4R2GC 3A6BH 2FB4H 1FZMB 3WFCH 2ED8A 4AENA 4LGXA 3KGRA 4G7VL 5DQJB 4MNQD 1S7XA 5F88A 1B1YA 2WVSA 3EMQA 5I1IL 5I30L 1MVFA 3PDGA 4JVWA 1KB5H 5IQ7H 1KF9B 5DGQA 1R7OA 3VIFA 1VHPA 3RWFA 5IJRA 5AWNL 5L0QC 2X0HA 4CMHC 5CBEB 1IGFL 3CC5B 2Z0BA 5HHVH 5SWZB 1R3JB 3WHXB 4PRIE 5JXGA 1HYSC 5L88L 3GMMB 4GZIA 5FKPB 3TTYA 5D6DA 5F9JA 1XGYL 2DTSA 2FBOJ 3PGFL 4QOKE 3TYFA 2OM5A 5EN2B 3IDNB 5HDOA 43CAB 5GS0H 4H0IA 3KLHC 5D7IA 2CGRH 1I3GL 3DIFA 4LSPL 3V0WL 4FP8L 4MQTB 2XN9E 3ULVL 1XSIA 3JWNC 3PL6C 2J6EH 1R87A 2J78A 4R96A 5CPSA 1EAPA 5AD0B 4GZJA 3HE6B 4HOWA 5C70A 4MGXA 3IU3B 1YEGL 4LQ1A 4YDIL 4MNHA 4D6HA 4OLVH 4NSBA 5HGAB 3NZ8B 3X13A 4YWGH 1IC5L 4M6AA 3P9LB 2ZOKA 3ZIZA 1XF3A 2IBZX 1TVGA 3QO1B 2A3CA 4HOZA 4PJDF 1KPVA 2GJ6D 1DUZB 4D6EA 3TO4C 1A7NL 3U37A 4P2OD 1AGBB 3VG0L 4YHLH 3RWGB 5A2KH 4L8CB 3S3JA 4ZUUB 4WVRA 5D4QA 4DZ8A 3NAAH 5EBMB 5FK9A 4EI5A 5JPMB 3BIBX 2Q8BL 1RULH 4I4WA 3O3BA 4MD4B 5E09A 3SKJH 2CDGA 3LIZL 1IRAY 3N9GL 3MGOA 5KAQF 1KSRA 1YQVH 4CADB 5A16A 1ZS8B 1VRXA 4N68A 5BXTA 3LHPL 3TN0B 1KXTB 3C09B 5HYJA 2IG2H 5HI5C 4LKSA 3HG1A 4R90H 3MJ8B 4Q7DA 5C0GB 3SQOH 4W4ZA 5B3JE 1NEZG 4H1LB 2DJUA 3UJJL 4GW4A 4UQBA 3MLYH 4YFLI 4Y5XB 3O8XA 5LCWL 4MCZB 1ZHNA 4QLKA 3SDDB 4NJ9H 4D8MA 2MTPA 3VRJA 4UQDA 4XCFH 3PE9A 4H8VA 4G3YL 3O2DA 2HFFA 5MERA 3ULUD 4XH2B 1A21A 5C0BB 2GT9B 5DUPL 3LKQB 4KTEH 3W2DH 5C0FB 2K7PA 3ARPA 3B3IA 3NCYP 3THMH 1CXLA 3D3VB 2W9EL 4QRRE 2OL3B 5A8OA 1N8ZB 2KQNA 3ARGC 5DDHA 1HJWA 3QFDA 3L95B 4M1GL 5HI4C 1WKYA 1ND0B 3L7EA 3MA7B 4I18C 4P4KB 1H3PH 4Y7EA 2MHAA 3WF1A 1EH9A 4M1DL 4YHGA 5CHNA 2UZYB 5GJTH 5IYYA 4RE2A 4JZNA 3ZL4H 3PWLB 1QFUH 1LEGA 4ODWB 4PFEA 4C7FA 2QPSA 4L9DA 1HHGB 3TZVC 4PJXB 2DH2A 3KPRA 3GMPA 2ERJC 4PCTA 2R2EA 4HPYH 4WKFA 1KCVL 4M9OA 2L7JA 4JPVH 3RMEA 4JRYA 3D18A 1HL8A 1VADA 5EA0L 3HB3C 3JV0A 4FOMA 4X4ZA 4YK4B 4NQDE 4U7SA 4Y5YA 2WAGA 4TX8A 5E8NA 2O26U 4LCCA 1OAKL 4NN5C 4GAFB 1P7QB 5J3HC 1YN6B 4LEOA 1KB9J 4OZHB 3X3FH 1NAKL 2J1TA 5DEFA 1H3PL 1ZVSA 3RWJB 1MW0A 1KTKE 1X4XA 5KSVA 2E7LA 4P3CL 4ONFH 3EO9L 4JFDE 3REVA 4UIKH 4XHJD 2NY1D 5A2IH 5A3IC 2CUMA 4FI9A 2YD6A 3BAYA 1TXKA 2GQHA 2NX5D 4XC1L 3OLEA 3ZJ6A 1I75A 1UR2A 3QEHB 3SUTA 4U6VH 4WUKL 1RZIB 3ARYA 5J6GB 3QI9B 3FO2A 4HJ0C 3VFOA 5HHMB 1UVQA 2ICEB 1U95A 4JO1H 4UI9L 3B9KC 1I1AC 4OD2B 3UJIL 4NSKB 4PREA 3UDWA 1ISZA 1BPLB 1OCWL 3BKMH 3GHEL 4HWBA 4P57A 2CK0H 1OINA 4PJ9A 4CJ1A 2R2HA 4GO8A 4HIHB 2ZSVA 2F61A 4F3FB 3RNKB 1LDSA 2YXFA 5I74C 3N1MC 3UX9B 2H3NB 4QXUL 3SPVA 1NUKA 4B3KA 1YECL 4XP6H 2PXYA 5K59E 3HMWH 4S0SD 1RIHH 4NRXB 4QEGA 3P0VL 1NDMB 2NY5H 5DVOA 3TV3L 4OM1L 2Y5TB 3B9AA 2AEPL 4IRZH 3TBYB 1H0GA 1UWXH 1KPUB 4D6GA 4XRCB 3DWTA 5EMYA 4EKXA 3D39A 4OZHF 2WMIA 5A8QA 3EMCA 2O93L 1NGPL 1H41A 2J7BA 2VDLH 4ML4A 2UWEE 3R0MA 4B9ZA 3WE6B 3P4NA 3ALWA 1BLNB 3PABB 4GRLD 2ESVD 3CZFB 3KPSE 4KXZI 1YHTA 3BUYB 1GOIA 1CFSB 1F58L 2DSUA 2GK1A 4JZ5A 2FJHA 3WF4A 1CGYA 5AYUH 4JKWA 3KPLA 3RQ3A 5GRUL 3TO2A 4XXCC 4Y5VC 1DQDL 2X4RB 3TVMB 2DJSA 2OQJB 4DUXA 1UWEL 3P4MB 4PUBL 4BQ3A 3VG9C 4AIXA 4JZJB 4FA8A 2VB5A 3H2WA 4TTDD 4NYLB 3WSOA 1JMXA 1T5XA 3EDKA 4GAGH 3U36B 3KYNB 5E9AA 2CDEB 1KTRL 2VL5A 3V8OA 2O92A 2GK2A 4KMQA 3HZVA 3KPQA 4L3EB 3TTOA 1E1EA 3QFJA 4WSKA 4XP4H 2D4DA 2P8LB 4OZOA 5JA8B 3UTZB 3VWJC 2NSXA 2ICWJ 1IM9A 4S11A 5DC0A 1UXXX 5HD8D 1YN7B 2HJKA 3D0VA 3V4PH 4Y4FC 3WQ4A 3WL0A 3F7VB 2YD7A 2VXUH 5IFAH 1HKJA 4AIZB 4MA7L 4NKDA 1HP5A 2V7NB 3SHSA 4D9RD 3O9NA 1T3FB 4NN7B 4OCWL 3U6RB 4IRJD 1WAAA 3HE6C 5JMRA 2C4XA 3KLDA 3VH8B 3VXNA 3BX7C 4GAYA 4BF7A 4WF7A 4PJ5E 2OI9C 1INEL 2ZCLH 5F96L 5FOBA 2J7DA 4R4NC 3GI8H 4PGJA 3MLWH 3PBGA 5C0AD 2CXKA 4HC1A 3SGJA 5C92A 1ODZA 4QDSA 3UBXI 4XUOA 2XY1A 2ATKB 4JL2A 3IT8D 4OSUH 4TN9A 5MENE 1A6VH 4PJCB 5HGBB 1RZJC 4K7PX 5ABFA 5B4MC 1MAML 3FT2A 2GFBB 2Z31C 3F62A 3U4AA 5IIEA 5LYRA 4PF1A 2OP4H 1NDGA 4X6CE 1YQ2A 5JBFA 2RB8A 4BH8B 1KYOK 4AG4L 2YG0A 5EUOB 4PJ7A 4KDTA 2EH7L 1G6RL 1UKSA 1GJUA 4F7PB 1NAMH 1O0VA 3T1FB 5D7SH 5KSBF 4Z8FH 2HAZA 4KKNA 4H41A 8FABA 4AD1A 5IMOA 3IJ7A 1TVDA 4M6NL 3WJJA 3CSYB 1AHWC 4NO3A 4Y5XC 2QKIB 5E2JA 1TPXB 3L5XH 4WI3A 2C9AA 3F12B 4HKXB 1A3LL 3SCNA 2XG9A 4FTVA 4D8PB 3SDAB 5B21A 3SDDC 4JRXB 4Y4HA 4BFIA 4FFWC 2Z8VC 3EGSA 5ID0A 1I8KB 4KAQL 1DP0A 4S2SA 5D2NB 3FZUD 2A73A 4DWSC 2IPKB 4EDWL 5MEOB 4P5YA 1QFOA 1P84J 2JB5H 4AEEA 2ADFH 2WQ8A 5IT2L 3ESUF 3HC4L 1ZT7A 4NZUL 1SMDA 2YD1A 3FN0L 1NKGA 1G7QA 2E33A 3CLFH 4S1QL 1XT5A 2YPLB 2NT0A 1TJIH 3DYMA 5E6ID 3NIFF 2VLJA 1PX3A 3PQYE 3UTPD 4PLOB 3I9GH 3MRNB 4PJCF 4XNYL 5T1MB 2XM1A 1M01A 4MNGA 4QRTB 1G0YR 4HHAB 5FM5M 1S7QA 1FL5B 3BISA 3CFBA 1KXQA 1A1NA 1AGEA 3DMMB 1ZMYA 1HQ4A 3GB7B 2YEZB 4N9OB 1UD2A 4XBPB 5ISZD 2XZCL 3BP6A 3BMWA 1MFCL 1DBML 3MLXH 1ZBKA 2YPVL 3VXSB 2AEQH 1MQ8A 1S7SA 4U1MB 3E2HB 5GGUB 3RGVC 2YMXH 1GHFH 2RIKA 4DVRH 4J28A 4N0FA 4P8VA 1BOGA 3OJMB 5ICYB 4M6ML 1N5AA 1NBQA 4Y1AE 5I1CH 1E6OH 3KYOA 3NSNA 4NI3A 1KCRL 5JORB 2YKKA 4WU7A 4UT6H 1V6WA 1FGVH 1ADQH 3ROLB 1QEWB 2RVAA 1JRHH 4X4ME 1R24B 4TUJA 3ZDXF 3BGMA 4PJBB 1ZEAH 4RAUB 4HS3B 1OPGH 1B0IA 3QJFB 1H9VA 4X9FA 4J6RH 1NJ9B 4PJXE 1S9XB 1Y18B 1N2RA 3OHXB 4HJJL 1MQPA 1KOAA 4L9LB 3FY1A 1VFMA 3PHOA 2AEQL 4X5LA 2BVTA 2KPNA 1TVNA 1JE6A 3U4EB 3W82A 2DLTA 5D1ZB 2EEXA 1JNJA 1G9MC 3C08H 2FJGA 2KD7A 4UIMA 4ZFOA 4BQ9A 1QKZH 5CD5C 1F4XL 2XV6B 3JWOC 4XPFH 3WBDA 4KI5M 2JIXA 1TUXA 3NSMA 1Y6MR 1I1FA 2PYEB 2ARWA 5D9MA 5CFHA 4G8GD 1FO0B 1JN6B 2Q6WB 1GRWA 3BP4A 4MJIA 4GRWE 5E8PB 5IDIA 5CZVL 3FB8B 5FF6A 1DDHA 3WEXA 2HFGH 1VESA 3IJYA 4Y7MA 3SDCA 1S3KH 5ALBL 2PWGA 1BQSA 3CUIA 1RZ8A 5D1QA 4AEFA 1F11B 3O4LA 3H3PH 5EU3A 4PJGA 3IAGC 4Z0XA 4O51B 3L9RB 2VUOA 4NFCA 3W0WA 5HYSG 3TIEA 1VEOA 3MV9A 5HHME 4AT6A 3BH9B 3SY0B 2QR0A 4Q6IA 3E6HB 5BRZA 4X5WA 1QLRA 1L6ZA 1W8NA 3KL5A 1UWTA 4AW7A 2XRAH 1ES0B 4PJBF 3NSXA 4HBCL 5I3DA 2H26B 4P46A 1W32A 3LV3A 2ZUTA 4HAFA 3MXVH 4JZJC 5D9SA 5K93A 1JUFA 5D8WA 4MVBD 4X4YA 4MAYB 3UG3A 5BS0A 4PYHA 3E3QC 4PQQA 4NZTL 2V5TA 3AXHA 4LSVH 3BQUA 3GKZA 4JANA 1QOXA 3DNKA 1NBVL 1G1CA 1NCCH 1CK0L 1U8QA 2O5ZH 4K71B 4Y4KB 2YBRB 5HY9B 5C07B 1U36A