3K4AA

Crystal structure of selenomethionine substituted e. coli beta-glucuronidase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
605
structure length
597
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYVGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-glucuronidase
total genus 140
structure length 597
sequence length 605
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k4aA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k4aA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k4aA03
1XGZA 3ARBC 2DLIA 3OB0H 5FYLE 4MADA 5BRZA 4FG6C 4JFHD 2QQKL 5I6XB 1SEBB 4LLQA 4CMMB 5KSBB 4K7FB 3V4UH 4OZIE 2M26A 3QEQD 2IANB 1J10A 4LARH 1SVZA 3H42L 1A6AB 5HNNA 3EMZA 3K46A 2Q8AH 3ARSA 3BZFA 4GFTB 5T33L 3CJJA 5JLZA 4UDUB 2B31A 1JJUA 3AS0A 4W86A 1CE6B 2CRZA 2ZKHL 1FHGA 5D1XA 1TMCB 4NCDA 1QFWM 1IQDA 4P2QD 4UV4L 4F80A 1E6OH 3MJGX 4LRNH 3WD5L 1H1NA 5A69A 4IRJD 1XIWC 5JOFA 5JHDE 1RZJH 3UTTD 4TOYL 1MSPA 1SDDB 3MKKA 5HDRA 4U1JA 1ES0B 4PMQA 4UB0H 3WIFA 5DRZB 2FGWH 2AMGA 3FQUA 4WFGD 1DVFC 2X05A 3OZ9H 2OI9B 2E40A 4XBEH 1T1WA 4HCRL 1W0WB 3HPJA 5B38B 3SPVA 2VL4A 2BFVL 4N5EC 1D5IL 1ZA3B 1J86A 3LQMA 2ESVA 2H3NA 3PNWB 5IUSA 3MOQA 5A6MA 3ZE1E 5GRYA 1BZ7B 3MO1B 2YPLA 2EEDA 4PJHF 5DI8A 4BSWA 4QLKA 2DWDA 2P7TB 4HPYL 2ICWI 4G7YH 2ZPKL 1T03H 4KJYB 3MBED 3KL3A 5JOEA 1XH0A 2Y4SA 1ORSA 1G7QB 3RVWD 2OYLA 1C93A 2DM2A 2LVCA 4QXUL 1HH6A 1IT9L 2V3FA 5EBMA 4UILH 4NT6A 1BQUA 4U1SB 2CD0A 2L7UA 3UESA 4V2XA 2V3DA 2OSLA 5JIKA 5D72H 3TYFB 3U7YH 4JR9H 4NGHH 5CMAB 4X5LA 3RWIA 3L1OH 4U3XA 4KRPD 1C7SA 1S7RA 1T6WA 1BD2A 3BSHA 3SCMB 4V1DD 1ECEA 4XMPH 1BYCA 2XFFA 3PL6D 4Y5YB 2OR9L 2EECA 4NM8H 3HG1D 5IROC 4JLRA 3GIZH 5DS8A 1PW3A 2PXYB 3LE0A 1FO0H 2WC4A 3MROB 4HV8A 3L4XA 2WVVA 5D9SB 4NO3B 4QCIB 1T66D 1U8KB 4XC3H 4U1HA 4FZEH 3S5LG 1XF3B 5DC9B 3FONB 1NUKA 1W2VA 1FIGH 1TNNA 1TLKA 3DBXB 5IFTA 5IVZA 2QQJA 1LWHA 4NO3A 1HQ4B 3MRGB 4ALAL 5IKCA 4V2BA 1IGJB 4ONFL 1FFRA 1TJGH 3RJYA 3P40A 5H94A 4ODVL 1XRVA 1X5FA 4JZJB 4JFUA 1UYWL 1N8ZB 2Q20A 3L4YA 1OAQL 3K75B 3SY0A 1E6JL 4M7KL 5DJ0B 3EOBB 1AXSA 1A3RH 2DF3A 2BBAA 3WD3A 2Z93A 5C0JA 2JB6A 3QQ9C 3IVKB 3WSOA 1FFQA 1UQSB 2W67A 3LQCA 1UR8A 4F9LC 3THCA 3D39D 4HPOL 1K3IA 1U58B 4CCCA 3DROB 2J74A 1D5XA 5FA3B 3WD5H 1JHLH 3MRIA 4LU5H 5CP3H 1S7WB 1CDJA 4GRWH 3NCYP 4H0GA 3CDGB 4XVUD 5J56B 2KUTA 4ZXBB 1EBPA 2XM1A 3OKEA 1GZQA 2LQRA 2LTQC 5E2VH 1HJQA 1KLUA 3POHA 1X4XA 3LKNA 4JHAL 2ZUUA 3HC3L 4TRPH 1CT8B 3N1FC 3VFWA 5ERWA 4AG4L 2HMID 3QEUB 4XZWA 1B31A 1OAZH 1BJ1H 1CEOA 1D6EA 2RFXB 4KXZH 2VDLL 4YBQD 1DWIM 2DQDL 4B7IA 3VIGA 1B0GA 2Y8KA 5F6HI 2EPMX 3W27A 2Y5TB 4OKDA 2XTJB 3VXSB 5HHVH 3SDAC 4UV7L 1OGAE 2R69L 1ZT4A 5AZEH 5KTEH 4HWBA 2XICA 3HC0B 4JPWH 4ONHB 1JF1B 1LL6A 2VUOA 4XBPB 1NCWH 1U8HA 3O3DB 3HUJE 3MXVL 1QFWL 4X83A 2MQ0A 4ELKB 4HIJB 3MLUH 3RTQB 2VN7A 1QQDB 4JRYE 3S36X 2AXGA 4DQOL 3QGVA 4NHUB 1HHKB 4QDSA 3MUGB 2P5WB 5C0FB 1RULH 1YYLH 4IRZH 2DKUA 5E8EA 4P46B 4UUJA 5C0DB 4WJXA 5GGUA 2FDMA 4A6YA 1W0YT 4GZJA 5I30H 1JPSH 4MHHG 4EVNA 4W84A 2IAMB 4CN1A 2NQCA 2BSTB 3RA7L 1JF1A 2W5FA 3LMJL 2FEDC 3H9ZA 3C8KB 4EK7A 3G6DL 3KLHC 3ULVE 3WO4B 4LVOB 2ZSWB 4OUUA 3ZHDA 4EDXB 1F3JB 4RMUA 3BSZL 4OGXH 4GLRI 4LOUC 5J11B 4LLUB 2Q76A 5I1EH 3VGHA 3BYYA 2A1WL 3RY6A 5ICZB 4YNYA 1RMFL 1EFXB 5DYOB 2W9DH 4B0MM 1YNKL 5DZNA 3A47A 3N04A 1F58L 2Y5EA 1A7NH 1NUFA 3IXAB 1VF8A 3IETA 4XPBL 1T3FB 5I9QC 5E6IC 3MRFA 3I2KA 1E4XI 1RAMA 4JPKL 1N64H 1LO4H 1AC6A 3VXMB 1EA9C 1FGNH 4FMFA 4OIIH 2WC3A 4OUUB 2QADC 4KWUA 2OSXA 4KI5D 3CHCA 3L5JA 5ICYA 5LJYH 1C5BL 1A7OL 5GHWH 3U30C 1HHHB 4ELMB 4ZFOL 1P6FA 5J0BA 3BP6A 4K55A 4LCYB 1RK0A 3X13A 3G5VA 1CECA 3SCSA 4AM0A 2O61B 3L5WB 3WH8A 1RUPL 1B1YA 5DRNB 2Z91B 4O4YH 2DLGA 2ORBL 3AOFA 4KH2A 1U8MB 4AIEA 1KTDA 2OZ4L 4RIRB 3ALGA 4CBPA 1EXPA 4QXGL 1UKSA 1TETH 3T08A 1XD0A 2XVNA 5LA0A 2N56A 4Z2GA 2XM2A 1NGWB 4ZE5A 1FL5A 2GTWA 1NOWA 5TQ0H 1FVDA 3FB5A 2DMBA 5I17B 3GMNA 1U8NB 2WBWB 5L88H 3IJHB 4GKZB 2J77A 3WD0A 3CSGA 4HOWA 5F21B 4OLUL 4AD2A 2QSQA 3T8XB 4GW5A 2C3VA 3SDXF 5HGAA 5ABEA 1U2HA 3U46B 1KEGH 5SX4I 4MXWL 4LCCC 4ZUSB 4A4AA 3KL5A 2C4FU 3HE6A 4HG6B 4CU7A 3WD1A 1ETZA 5D7SL 5D4QA 1FGVH 3G6JF 1IGFL 4LLQB 2R0ZL 1DE4B 1NP2A 2CKRA 2GJXA 3ZDYE 9CGTA 1ZWIA 1HCFX 3HE6B 1KJMB 4OZ4A 2ZIDA 4PRIE 1J1OH 4J3UA 2C7FA 3HI5L 4WJ5B 2WN3A 1O59A 4MDJB 1JDDA 1QVOA 2WWKT 3EOTL 4OZGE 5C0ND 3WQ5A 1RVFH 4ZQKA 2Y6GA 4OUOA 3G08B 2PTVA 5AWNL 5GS3A 5D4YA 3PXHA 5L2KD 1VPOL 2W0LA 3AB0B 2J6EL 4QP0A 1JN6B 1NMCB 1TZIB 4HKXB 4XWGL 5IFHL 3FN0L 3PNWA 2CK0L 4IUGA 1JV5B 4UINL 3NN8B 1UH3A 2Z1SA 1NFDF 1SBSH 5AD0B 2VSCA 5J06A 1NCCH 4BUHA 3QCUH 4KQ4L 5IM7A 3MGTB 1NFDA 5DQJA 1S5IH 5MEQA 5FF6A 2C7UA 1QNRA 2VLME 2J7GA 2YC4A 4L8BB 4XGZA 3KHQA 4AAXA 5BJTB 1XSKA 4DXRA 5T3XD 1TVGA 3TTQA 1MFEL 2V5YA 3D3VB 3KPSA 3SUUA 4ACPA 1FP8A 3IJSA 4WW2F 5GGTL 2HRPL 2CBJA 2E5EA 5IMOA 2LV4A 1W9PA 4XMLL 4G8GE 1V02A 1CF8H 2YD9A 2CDGA 1HH6B 2VLKB 3BDBA 4HOXA 1DEEB 1OVZA 5KOVC 3LH2H 3OJVC 4OFIA 4QPWA 3ZYOA 4XUPA 1NOUA 1OLZA 1UA6H 5DD1H 1NWRA 4JLRB 4PY8J 4K7PL 2HJLA 4PJ7B 1RZJL 2YDSA 1R6VA 5GJSL 3O6AA 1BD2B 2X2YA 3LEGA 1MCPL 3O41B 2ATPA 1XIWB 2P24A 5KG9A 3LKRB 3RO8A 1FCCA 3SGKC 2GJPA 1WP6A 3TBSA 1LEIA 5D1QD 3BKJL 4FQLL 5C08D 5IESL 4ZSOB 3PTMA 5BXFA 3MTRA 4YZFE 3F5LA 5FECA 2WYSA 2VLKA 1LO3H 1QD0A 3PWNA 1FRGH 4FFYH 1K6AA 4JPVL 1JU3A 3LKRA 5C09E 4F8TA 5CWSA 3WFCH 5T3ZD 1OWWA 2CXKA 4PYGA 1T22B 3VXUA 4NNYA 2OTWB 2R1XB 3FT3A 2J8GA 3T3ME 4FABL 1GZJA 1CICD 3DV4A 3S35X 4M6ML 2FJFA 2VZ3A 4PYSA 4OB5H 3Q1SL 1Q94A 1E55A 2ZWLT 3CDCA 2HKHH 5EPMA 2WZPD 1LP9B 4F58L 1AKJB 4MJ5A 1OTTC 2DQHL 4IDLA 1QI0A 3F6IA 3SJVA 2NY0D 5F7WC 3CVIH 1KT2B 3GNOA 5LCVL 4UQCA 2HTLC 2NYYD 1EJOH 1K9FA 4U6HB 1OB1B 1L0XA 2YD8A 4NQSB 3BPCA 3SDDD 4L1DA 3EOTH 4GG8B 3VXUB 4HUXA 3MU7A 4GXVL 3N1MC 1HIML 3MFFB 5A40E 4F7MA 3MREA 2PBGA 1I9IL 4UTBH 4AT6A 4TTGA 2B4KA 5E9DA 1VB9A 5KEZA 3B43A 2W62A 2WAAA 1KGCE 2HT3D 3EGSA 3IDNB 3RVTC 2J6EA 5E5RB 1AGFB 4WEBL 4FP8L 2DPEA 4UTAL 5MERA 4Z7VB 4QAWA 3VFWB 5J13C 4HW6A 1A7PL 4H5SA 2EYTB 1U36A 1ZEAL 3RKDC 1QFUL 2VLRD 3CSYB 3O6KL 3O9NA 1TMQA 4K2UH 2A3EA 5JBDA 2AEWA 1UGNA 4OCLC 1T03L 5FHBH 2SEBB 2AXGB 3DX7A 5F9OL 4PLNC 3WH7A 1IARB 2AJSH 1NCTA 5CJ8A 5TGBA 1WBXB 1JMZA 2FZ3A 1F11B 2JB5L 2XKSA 2CGRH 4I8DA 3QIWD 4M43L 1Z3GH 2EDOA 2DQGL 3BMWA 3PHQA 4HU0A 3WN5A 3TVMD 3S34L 4HGWB 4JG1H 1OW0C 4J3SA 3CH1A 5ETUB 2HJKA 1MFEH 4ZXEA 3FNDA 4X98A 4DVRL 2V17H 1E3XA 2R56L 1OP3H 1MHPL 3RWDB 3QI9A 4JANA 3Q5YA 1IGCL 3U2SB 1PQZB 3V7AE 3ALWA 4LYQA 5DN2A 1NEZB 1CD9B 3VFPB 1SBSL 4MS8D 3UYOD 2FZ3B 3QDGA 5KVGL 5E8DL 2WBGA 2XGBA 1W0VA 3DX9B 1V03A 1I1AD 5JXGA 3GSNA 1E4IA 3U36B 3WHE0 4G8GA 2Q7YA 5J1SC 1NGXA 3MMDA 2YL6A 4QOKE 3MRFB 3BXWA 5E2TH 4QOKB 5INCB 3WFEH 1XZ0A 3QQ4B 4GRLD 4M7ZB 1I9EA 4WFEE 3F58H 4H8WC 4HS3A 1RIVL 4FXLA 2P8MB 4MQ7B 5DMGD 1VACA 2C5DC 3DSFH 3CXHK 4PRPE 1Y18B 3MOBH 1RZIA 4D6JA 4XP1H 4Z2KA 4PJ5B 4PJHA 2YKLH 5D7LE 1UMHA 4KHTL 3DXAD 1HNGA 2BRRH 2CR6A 3TTYA 4X6DB 1H11A 4ZFFB 4PJIA 4X8JB 3SE3A 5DT1L 5GRWA 4Z76B 2F19H 3VH8A 1FSKB 4M1CC 3MJ9L 2Y6KA 4M56A 4O2EA 4PJGE 2FWOB 3AAZA 3L4VA 3VWKA 5H35A 4MLIA 1KCLA 1TQBC 4LEXH 2O5ZH 5C7GA 2COQA 1O5DT 2GTWB 1YPZE 5EOCH 2GFBA 1Q72L 4UQAA 2DQTH 3EDJA 1LP9A 4OLVL 4ZFZB 4D94A 4APQD 3RPIB 3QRGH 3J7HA 2IFGA 3FY1A 4PBXA 3P4LA 1KSRA 3KJ4C 3VDAA 4S1QH 4HC1H 2Z1KA 2VE6A 2IAMD 1T83C 3QA3A 3BWAA 3O2LA 2BGPA 1BF2A 3GMNB 3O11A 5DFVC 2EXOA 2VLRB 2WUCL 4URTB 3EW3B 4JREB 3QA3B 1A6WH 3NFSH 4GXUN 1E4NA 3UTOA 1AIFA 2CUIA 4X4ME 2F54D 2AW2A 2BMKA 3M6DA 5LCVH 1B3JA 2J5LB 2PYFB 5IIEA 3X14B 4X7TA 2DKMA 3STLA 4OSUH 4TTDD 3NUKA 2G5BB 5I1CL 1A64A 1OF2B 2EDEA 4K7FA 2BNJA 2J8OA 5E08H 4R5EA 3KNBA 4Y7MA 5ICXA 4UNTA 2E3ZA 4DXSA 1QLEL 4L9LC 4X5WB 3MRPB 1UACH 4NQCA 1TZ7A 3DWTA 1R5WA 2VCCA 3FN9A 1U8IB 2J1EA 5DJAB 1JZ2A 2A73B 4HHAA 5CJQH 1T89C 2NXYD 3MV9D 4P3WA 5KVFL 4NQCB 3VO0A 3DX6A 4JL2A 4AL8H 1RMFH 1JPTH 3WDPP 2XY2A 1JHKL 3CFDA 5E6IB 5DJCB 4XCFL 3U48A 3KNBB 5D2NE 1E1EA 4G7VH 3AFLA 1GZPA 2VZSA 4XH2B 1T1WB 1TVNA 2C7UB 1K4DB 3SE9L 1T1ZA 4DN3L 3S37H 5GNYA 2DL2A 2NXYC 5IVNA 5BCAA 3E3QC 4PBGA 4X0KB 3RTQD 4L5FH 4X4XA 2P47B 3ES6B 1PSKH 3RGHA 4X9GA 3IDXH 3TO4C 1FV1A 5E8OA 3VJ6A 5I6SA 1UXXX 2QJDA 1LVEA 2ESCA 4KJPD 4LSSH 1J1OL 3RDKA 3CCHB 4AEIL 2X41A 5LXGH 4DWSC 4Y16A 3ZT5A 1BD2D 4NN7B 4PJ7E 5EH1A 4M6AA 4U6YA 5AWNH 1GZPB 2O5ZL 4PRHE 1T1ZB 4DGYH 2CBUA 2DIJA 1NBYB 4EIZC 5FO9B 4WU5B 3VD7A 2JIEA 2Q7NA 1J1XL 2VLKD 4JRXA 1PD6A 3AIVA 3L2LA 4G6JL 2M8XA 3NZ8A 4WDIB 4KAQH 1T1YB 1EO8L 3K74B 4NT6B 3FCTB 5MHSD 1FDLH 3JTSA 4KY1L 4GZ9A 4KKAC 3SDDA 1XGRB 3G5ZB 3TYFA 3GSQA 2VXQL 2IANE 4IRSC 3MROA 1QO3A 1CS6A 1KC5H 3QDJB 5F71A 2V5CA 1EUUA 4KRPB 4ODVH 3H9HB 1AGEB 7FABH 5E56A 1I1WA 3WSUA 4GKSA 3SDYH 2JJTC 4LHQB 3FCTA 2B5IC 2EE9A 4ODSH 2J8UB 4R90H 1A21A 4JG0L 3MLVH 3JV6A 1ORQB 4CD6A 1QRND 1AXIB 5AZ2H 3L4ZA 4CU8A 5D5MF 1ZSDA 4KKAD 4AZ6A 3VRIB 1Z9LA 4ONGL 3AIQA 3CLWA 3QAZB 3V4VL 1DQLH 2WB5A 4NQDE 5IEHB 3CVHH 5EBGA 4MAYC 4QTHA 1VFMA 1FLRL 5GPRA 5KS9A 4BUGA 4DEVA 3F7YB 4FTVE 1CI5A 1CFNB 5D1QA 5I1LB 4EI5A 4AEHL 4XAWH 1B4RA 1WPCA 1AGCA 1D9KB 4U0QB 3VXNB 4AQOA 3MUIA 1VFAA 1NEZG 3LD8B 4G9FD 5DJ0A 4WSJA 1OSZB 3QJHA 5EN2A 5IEKB 4PUDA 1H8OA 2LABA 3QEHA 2YFZA 4CRPA 2XTJC 4NCC1 2J1SA 3K2UL 4XNXL 3DRQA 5D1ZD 2F53A 1N7MH 5HHOD 2EH8L 4V1DB 2H2PD 1S9WA 2FGLA 2OJEB 2IAMC 5ICXB 1CL7H 3LS5L 3QHMA 3AU1A 5JNYB 4PJXF 2A6DA 4I2XB 2RGMA 3GRWH 1TFVA 4N0RA 5C0RL 3I02B 1GJWA 1KCVL 5DD3L 1NCBH 1JK8B 2BVQB 3DJ9A 1WZLA 2X4RB 3EYSL 1FFNA 3CXDH 1KLUB 3O3EA 1F11A 1IQWH 1E4WL 1MPAH 5E2WL 4Y4HD 2A73A 2X9YA 3INUH 4HHAB 3VWJD 1HHGB 1DQJA 4NWTL 4X4YB 5EUKB 2VXVL 4S1DC 1ZGLM 3PQYD 2V2TB 4X6FA 3U9PH 2MSPA 3MRLB 2X4RA 1ISVA 5IHLB 3WUEA 1W9VA 4NM4L 5CIPB 2FECL 2AABL 4KGJA 3L3IB 2DWDB 3MRNA 2VRQA 4DGIH 4WIQA 3LDBC 3DTXA 3IU4L 3WL9A 4GIAA 1AQKH 2BGOA 3NSMA 35C8H 4HSQA 3MRLA 4BJ0A 4RX4A 4P46A 1UY4A 2DQEH 4URIA 2D7PA 3W4RA 3RGVB 4GKLA 5TF0A 1MRFH 1HHGA 1HWGB 1XYZA 5CZVH 2E9LA 4L9LB 3BESR 2Y8VA 3X3GL 5DTFB 4LCWE 2QMKA 2AV1B 3T1FA 3UTTB 1UH4A 3EO9H 1EJOL 3VFPA 1H3PH 2RV9A 3ALFA 3VE0B 4J8RB 7A3HA 3O8XA 4G42A 1NBZB 3NCBB 2IQAA 4XX1G 3MLRH 3MLZL 2GY5A 5I76A 1XV8A 5J89A 1AVAA 1RZ7H 3EB7A 4J3OC 4XPTL 1KG0A 2J2ZA 3V4PL 3WYRA 2ICWA 1T83A 1PX3A 1K2DA 4APQB 2AQ2A 3RM8A 3SCMC 1JWMB 2OI9C 4IMLB 5ILTH 1DP0A 3IGAA 4LRNL 2G3JA 4MQ7A 2F9BT 3C09B 1CZ8L 3ZOAA 1IGML 5D6CA 1RIUL 5FEBA 5JXAL 3WSQH 1O8PA 2WZHA 1F42A 1C8PA 4WO4A 3BP5B 4P2OD 1RHFA 4PP2A 1SHMA 2NX5B 5EO0A 3WFEL 5JPNA 2H2SC 2A9MH 4ZFFA 1NAKH 4W89A 4U3CA 4GH7B 1UM4L 3OB0K 1RZKC 4GS7C 4WGVB 3FB7A 5D93B 2VYRE 5IVXE 1MNUL 4YXLH 4Y4FC 3VRIA 1K42A 1BVLB 2J1KA 3OG6B 3DARA 4RE3A 2GUYA 4WTZG 3KPQA 4G8IA 2X7LB 1I5PA 2W94A 3SKNB 1W2PA 2E6QA 1UZ1A 3D18A 4MJID 3RKPA 4FQCH 2R56H 1DVFB 1HN1A 2AAVA 2IALB 2CO7B 4C59B 5KAQF 4CCDA 4M8QA 4Z7WE 3MC0A 4MLSA 5DJZA 1MFAH 3IDYC 5A8NA 1GGIL 1AQDB 2X1WL 5FUOH 2UWEE 4FQXA 4NBYB 4EUPH 4KZDH 5EU5B 1YDPB 4M43H 4P7QA 1S7UA 4OM0H 4W8LA 1XF2A 2Y06H 3PGFL 4JFQA 1OGGA 3DHJA 1H3WM 2OR9H 4UQ2A 4PCSA 5FL0A 3MNZB 1I85C 3T4YA 1FVCB 4JX0A 1E40A 4N1EA 1QVBA 2JLLA 4X4MA 1J8HD 1MJ8L 1P9MC 3ARFD 4LVNB 1NBQA 3OSKA 4S1RH 3RUGA 4FRWA 5GSRB 1SMDA 2PWEA 2CLRB 4JFTA 1PDKA 5D7KE 5I78A 3C9NB 3QPQC 2WZ8A 2YMXH 1G7IA 1NANI 4K9EL 1OH4A 3DSFL 3QHFL 4CN6A 1UKPA 4FQXB 1IKFH 4W4ZA 1XNAA 5J13B 1IM3A 5CPSA 4KTDH 4NZJA 4XCNB 5DJXB 5A6SA 3ARRA 4A41A 4YHYB 4X6FB 3PXJA 5CP3A 1F6LL 5GRVK 5KW9L 2EDWA 3NA9L 4DZBB 4GG6F 2ZCKL 3I75A 1JP5A 1P2CB 2AKRA 2GJ6B 3LIZH 1M7IB 4D2NA 2VZUA 5IFAL 3ILPA 4QX2A 2P7TA 2W66A 1FGVL 4NCC2 1IZKA 1L0PA 1X5GA 1WIOA 3MUY1 3CFDB 5GZND 2EDNA 3L3DA 3QOMA 3C6SB 3NOIA 3T09A 5B3JE 4EUPA 5HHME 1YEGL 3ILPB 3GNMH 2MTPA 4HIXH 3RX5A 2EQDA 3BEVA 3UO1H 2VMDA 3ALXA 1LL4A 4QLJA 3ARDC 4HF5L 4WV1A 4OTXH 4EI6B 4YHYC 3DRTB 1GH7A 1SY6H 3FFDA 4Z95H 3FB8B 3IFLH 5EJ1B 4LVEA 1UD6A 2E3VA 1HSAB 2YHGA 1D5ZB 4ZOCA 3MV7E 1CE1L 1QSEE 1Y0LB 1AR1C 3VILA 1VEOA 4HK3N 2VTFA 4JZ5A 2R2HB 1Q0YH 4YBQC 1DZBA 3TFKD 4FQ1H 5B4NA 4YDIH 2DSKA 4DM1A 3RBGA 5SWQB 3IT8D 4XUQA 4NO5A 4LNRB 4MJ6B 4OSUL 3C6LD 4OD3H 5EU6E 3L5HA 3C7HA 2GAZA 3BD3A 5JORB 4ZEPA 2X1XR 25C8H 3MRRA 2ZJSH 3BGMA 4LCYA 4QTIL 4WUKH 1A6UH 4R4ND 6FABH 4PGZA 1I1AC 4N0YL 2WUCH 2VDPL 3DI2B 3GGWA 2PBOA 4FG6D 1CFVL 1Q6EA 3D69B 3KHOA 5FECB 4EBQL 2FYYA 1OAKH 1EHLL 5FM8A 1MFVA 1MW3A 3SE8L 1OCWL 1NC4B 5A3HA 5E2JA 3UYRH 4UINH 2W46A 1R3LA 1ISXA 1UX7A 4WUUA 1GGTA 3BD5A 1LWRA 1KF9B 5G04L 4OZGA 2UY4A 5GNZA 3NPSB 5D9PA 4L8SA 3E0GA 3RILA 4I48B 4L3EB 3MXWL 4XVTL 4JAMA 5C9KA 2NY3C 5DHYB 1GZQB 5E9AA 4GRWB 2YMXL 1NX9A 1R3LB 3C60D 3UJTH 5F7YC 3QJHB 1T21A 5DRXA 1KACB 5JA8B 4DW2H 3RBSA 4HEPG 2FJHB 4LYRA 3I3DA 3RGVC 3U4BH 3CPUA 2B0SL 3UTSE 4JVUA 4GO6B 1K8IB 1AGCB 1MI5B 3RWCB 3REWA 3BVNB 3A21A 1JZ5A 4WEMB 4ZAKD 2GSIA 3AU1B 5DRXB 2Y72A 2HTKD 5IW1A 5E6ID 4YWGL 4NI3A 1XGTA 4G80B 5H94B 3IDNA 4ZTOL 3DRQB 4NQCD 4A2MA 3ROLB 2EDYA 4L0PA 4OOZA 12E8L 1WAAA 4OFYA 2JD9A 3CX2A 2QSTA 2IANA 3RUGE 2ZE0A 1NWTA 4BYHA 3IU3A 3RTQA 2B4CL 2AI0H 2Y07L 1MFNA 3WKML 3GSOB 4N0CC 3VXUE 5MENA 3MRQA 1KGYA 2F5AL 4ZDHB 1MI5A 4GRMA 5H37H 1TVDA 4XBPA 3NJVA 1HJXA 3NJXA 1F6AB 2RJ2A 4JFDB 2J75A 1K12A 3WEZA 4HP5A 4PIRF 2P49B 5C0GA 1G9MH 1BMGA 3U9UB 2Z8WC 3PUHA 1XCWA 2DSWA 4HH9B 5TH2A 4FQJL 4GRMB 3GBNL 4NJAL 1MRDH 2FSEA 3DGCR 2ZCLH 3MLVL 5B39A 4A44A 5IBLD 1UHVA 2BVYA 2WHKA 5TF1H 1WGOA 3TESA 3I97A 2QSCL 1GQJA 4U6XA 2Q3ZA 4D0DA 3CZGA 3L3HA 3D5OF 1DN2A 3QEQB 2JKXA 3DURB 4NF7A 1R3HA 3C5ZD 4YHOH 3VXRA 4RAVB 2ZZUT 3KJ6L 4M7LL 3S98A 1EX0A 3QXTA 4HK0B 3N50A 3WEXA 3WIHL 2NX5D 3P4MB 4M7JL 3WUBA 1NAMA 1T0PB 3SDAD 4OTXL 1KIRA 2OSWA 1OD9A 1MREL 5TE7H 1N6QL 1B6DA 3F4VA 1AD0A 1KENH 5EG6C 3VXRB 4HA3A 1VPOH 4HKZB 4K8RH 4LCUB 1PQZA 3VMNA 1W9BM 3RVXC 3QIBC 5C0FA 2NYYC 4ML4A 4MJ6A 1L9NA 3E2HB 2E8YA 2VJXA 1Q0XL 5E1AA 1X44A 4CCEA 2QADB 4EJ1C 1P1ZB 2P1YA 2L4OA 3LDBB 5LXGL 1E43A 1CIUA 5C1MB 4B9ZA 1HHIA 3NQHA 3DX8A 1NM9A 3K8KA 1S5IL 2NY6C 3TO4D 1WDSA 2F61A 4B50A 1DWFM 1FJ1A 5CGYD 5GSVA 1K8DB 3IJYB 1CGXA 4XVUC 3NFPA 1HHHA 3TTSA 3A67H 2H32B 3NDYA 4PJ5D 3ARXA 3UYRL 1FFOB 5B3NA 5I1EL 5TQ2H 1I3RB 4DCQB 4JRYA 4X8JA 5SWSD 4Z76A 3UBXA 5EOTB 3HC4H 2X4OA 3CMGA 4HWEH 3U9PL 2BHZA 4YHPB 3RWJB 1U8MA 5AYQA 1QW9A 2ZEWA 5I0DA 4P5KB 2HG5A 3C5JB 4HUVB 1E70M 1JGIA 1NAMH 4JFXA 4G8IB 1JTOA 1N5YL 2BX5A 2V5RA 1NCBL 3KPRA 2F53E 3T4AA 2R8SL 1SHWB 1VGEH 4JFPB 4Y2DA 1RIVH 4YHPA 5I8EB 3GTNA 4JFSA 5ACMA 2Q8BL 4KTEL 3V95A 1IEHA 1BZ9B 2Q87A 4YXLL 4WKFA 2YUZA 3AMCA 3T0WA 5I71C 1AHWC 5D2NA 2E8ZA 4HC1A 4EAMA 5E1HB 3VFTB 1GQPA 4MNHB 4O2FB 3C60A 1YDPA 3U82B 5B8CB 4QLRA 3O45A 2AABH 5HI3C 4Y19D 4LIQL 4P5KA 1W0NA 4H20L 1H3GA 4BA0A 1ISWA 5JHDB 2H6PA 4JQVA 4LSUL 4LSTH 4BFBD 1AP2B 5DD6B 1I7TA 4RGOH 3WD2A 1CPUA 3WJLC 3NABL 3OLEA 4JFWA 5CCKL 2XQYG 4Z7WB 4CUAA 1CICA 1YY8A 4JVPA 4GKZA 3SE4C 5JOFB 1SYSB 1TCRB 4D0BB 4KDTC 3OLDA 4Z2IA 4J12A 5JXHA 5TDOB 4MAUH 1XGUA 3QIBA 4GO8A 5DD6A 1YJDL 2EYRB 4MA3A 3N12A 5D70H 3UTPD 5KVMC 4PF1A 1GHFH 2VZVA 4TOQA 4JHZA 3BISA 4QNPF 3GFUA 2VAAA 2YL5A 3CUIA 1CZSA 1BZ7A 5BV7C 3OKKB 4R3SB 1EOKA 5IMKB 2DICA 2F5BH 4XNZB 5AG9A 3QZWA 4ZZ8A 1OM0A 3SDAB 4NN7C 4S1RL 1I1YA 4ZUWB 1RY7B 4U1GC 1QVOB 4OLEA 2W1SA 5FM5O 2EEBA 1RJCA 2Z31C 3QG6A 4PLKD 2DD8L 1JE6A 2PETA 4LKXA 1QSEB 2X4QB 1P6AB 5AYUH 5J1AA 2O9TA 1E72M 2P24B 1HYRC 4JFFA 4PG2A 1WSST 1SBBA 3BP4B 5DHXB 3KYAA 5L8LB 1LEGB 1MPAL 1T0MB 1DQDH 2YD4A 4NSBA 1ISYA 3HNTL 3WNKA 2ICES 2AEPH 3SHSA 5IMMA 1EO8H 5JQHC 3AS2A 5K9KB 3KPLB 4LKSA 1HJWA 3O2WH 2ITCB 2ATKB 3KPOA 1GUIA 1HWHB 5SWQA 1E28B 3IB3A 2B1HL 2UVFA 5T1KA 2ADFL 3VA2C 3F7VA 3WUZA 4I0PA 1EFQA 5BV7H 2UZYB 2Q6WA 4GKOA 1CNVA 5IMMB 3DVIA 1DHKA 1OT1A 2H32A 3DV4B 2AJZA 2WW5A 1QBBA 5ALCH 3ZTJH 3QSKB 3VWKB 4Q6YA 1CFQB 4P00B 5EBWA 5TE4L 3FONA 4XPHH 3UCQA 1H3UA 4D6GA 4NQXB 4QYOA 1ZHNA 1PY4A 1BWWA 3VFVB 3B5TA 2MHAB 4QCIA 2D7NA 5AUMB 3UTSA 4OQTL 5GJTL 4CD5A 2BXYA 3O6MH 5FK9B 5DUPH 5HI4C 1D7PM 4I77H 4PREB 2WMHA 4MYWB 5DHYA 4C7GA 1P4LA 5EPMB 1I7UA 2F8QA 4AH2A 3X12B 4MNGE 3IDGA 5EORL 4AM0B 2O61A 1HDMB 2UY2A 1CGTA 4F7CB 3RU8L 3PZGA 3KPRB 1AXSB 5E8DH 3ARZA 3LB6C 2HISA 3IDJB 1E27B 2XZAL 4ZS6C 4ZPTB 4L9DA 4QRRD 4OZFH 3M17A 1DBJH 4YQXL 5DQ0A 2BFVH 2YK1H 4B53A 1D5XB 4Y5YC 5FA3A 3ZL4L 1NGZB 4EEEA 4O9HL 5TDPB 3UC0L 4RYDA 1YEEH 4LF3A 1CZ8H 1JCKA 3ZE2E 5EO9B 4XB3A 2ZUMA 2A0LC 1VENA 1A6WL 5ID1B 3NACL 4M93B 1FO0L 1LO4L 1KWGA 3SCVA 3NABH 2E32A 1J1PL 4PJBE 3WQWA 1MELA 2XZQL 5E00A 2GIYA 1G7PA 5KS9B 5EFIB 4M7ZC 3F8UB 3BIBX 3PDDA 4PMNA 3TBTB 1JZ4A 43C9B 3TT3H 5BW7A 3NTCH 4PV8A 2F54B 2HLAB 2B2XL 2GT9B 1RZ8A 2R2BB 1UY2A 5CSYA 5K33A 2NY0C 3PHSA 3NNGA 3RFZC 4DWSA 4WO4D 1PKQE 4JFFD 3ZIZA 5BVPL 1UM5H 4PRBB 2YPLB 4LK4A 1IFHL 1EHXA 4JANB 4JFZL 5CEZH 1JPFA 5DDHA 3OKMB 5LGJA 1CGWA 3LY6A 4RMVA 1JAEA 3N85H 2VDMH 4P23B 4NNXB 4ZE4A 3L3HB 3UEQA 3OLGA 1F4WH 3I9GL 4PQQA 2EDTA 3RVTD 2BC4B 1MCWM 4OLZH 4UDTA 5DD3H 1E4LA 5DJ2A 3VX0A 3VFNA 4X99A 5IJVB 1CLXA 4MAUL 3R0MA 3LS5H 1MYRA 3NJ3A 2Z35A 3HAEG 1X5ZA 1CCZA 4YFLF 2OL3H 4LKXB 4M00A 4DKEH 1QSZA 1B0RA 15C8L 4Y1AE 3ULUD 3U4EB 1KFAH 5I74B 3PZIA 1UYQA 5A2LH 5C0CD 1EHLH 3MFGB 3HAEH 1CN4A 2OQJA 1P4IH 1NFKA 1D7FA 1OGSA 1ZB5A 2DD8H 3FAXA 4PJHB 2UUDH 2FD6L 5IB4B 4GBXC 5IR1A 2Q1EA 1OTSC 2PYED 2XFXB 5DYOA 1UY1A 1OAYH 1T1YA 1UMIA 1AE6L 4FQXC 1H2JA 3ZR6A 4XNXH 3DMMA 1KFWA 3HI1A 5EOCJ 1HHJA 1ESWA 5T1KB 2FR4A 5KANG 4U1NB 4HIIB 2OR8A 4X98B 3TIEB 3SQOL 2GUOB 4KKCC 4YDVA 3R8QA 4DAGL 2W0KA 1CLCA 2VC9A 1QFWH 5FYJU 1FG2A 1RZGA 4DN4L 4MCZA 3EYSH 3DMMB 1GGUA 4RZCA 4E41D 4ZUUA 3QDGB 5CUSH 5I73B 5F7FA 1M04A 1RJZA 2D7OA 1W1PA 3U7WL 3FFCA 3W6LA 2PR4L 4BDVB 2NNAA 1WLHA 5ISZB 5FGBA 3Q3GA 3NAAL 1KYOK 4PB0H 5JUEL 1S7TA 2A6IB 3OKOB 1MQ8A 1N6UA 4U1NA 4DZ8B 4NO0B 4MDPA 3RPIA 5F1IA 4WWKB 3PP4L 2VRJA 4JHAH 1ROWA 3ARGC 3ZQ9A 1CE1H 2FJFB 3I6KA 3N9GH 3ZKND 1OB0A 1OLLA 4CNIA 1WZKA 3LPWA 5BZDB 3ULVD 5JZ7D 4BFGA 2ZXQA 3HAEB 4ZO6A 2XVPA 3KPSE 4D6EA 2EDLA 5GGRY 4O9HH 3ZKQD 4KDTA 3LPGA 1IMHC 3D0VB 3T04D 4O2FA 3LEXA 4LEOB 1UYZA 4FS0A 3ACHA 1NGZA 3FQNB 5GGSA 2NY2B 4EN3A 3RVVD 3SKMA 1KB9J 2EDRA 3FOMB 3RP1A 4PSRA 4EZMA 5CGTA 1EAPB 1MJ8H 3C5ZA 3GHEL 4K71C 1QLFA 2V5TA 4PRIA 5B4MD 4J2XA 1C12B 4Z18A 1HP5A 4JDVA 2Y36L 1B6UA 3LEXB 1ZAGA 5FA4B 2P44B 5AYIA 3W11D 3NCYS 1YEJL 1RPKA 3BKMH 4PJBA 1DE4A 4AMCA 2P45B 3T65B 2XHNA 5FUOL 4NUJA 1I1XA 1IKNA 2YUXA 4NWUL 4HX1A 1XFPA 1EHNA 2W9EH 4ZUSA 4YDJB 5HHQA 2CIKA 3ARGA 5KW9H 4JHWH 3SBWC 1GQLA 4I5BA 3WS6C 4OT1L 3S36L 2LAGB 3Q5OA 3UX9B 4Z5RB 4PJBB 2CR3A 3VFMB 4M62H 3T4YB 1W3LA 4CW1A 1C5CL 1P4BH 3QXAB 3QUYA 3QWQB 4M7JH 4ZNCD 4PR5B 2CHNA 5F6IC 4OB5L 1U33A 4P08A 4KKBC 3QO1A 1AI1H 2Y06L 3PGFH 3TZVA 1TR1A 4RL3A 3AMKA 3IDIB 1B3ZA 4R97C 1W9DM 4MGXA 1QZ1A 4DKFL 1J8KA 1K6QL 1QG3A 2WMFA 5HYSG 2EBNA 3PL6C 3NIGE 5CEXB 4MO3M 5D96C 2X89D 1MXGA 1AKJD 4LPVA 4WNQB 5DQJB 1S9YB 3PHOA 4X5XB 4JVWA 5JLZB 1N59A 1MCKA 4KK5C 1CTOA 3EBVA 1HIMH 1BVZA 1G9NC 4M29A 7CGTA 2HJKB 2JIXB 1CDGA 3S9DB 1OHQA 4Q7NA 1JI6A 1XNTA 3OKKA 4UT6H 2A9NH 4YWGH 1NMCC 2C3XA 1LQSR 5F88A 4YNYB 5IB1A 4X6CF 4JFFB 4KRMB 3AMLA 1JPGB 3K1DA 2XA3A 1S9KC 2DQFB 1UG6A 1W2KT 2BSRA 3AXIA 1L6ZA 2VISA 1IGIH 3CXHJ 2APFA 4FFVC 4Y16B 4WV1B 3TV3H 2Y7QA 3W9DA 4WLCA 3N06B 4PTWA 2R1YA 1FORL 1TZGH 1WNOA 2WABA 1NC2D 1NDGB 2LU4A 5D7IE 4PJFE 4DAGH 2ORXA 4I3SL 4R26L 4QTIH 3DETD 4LKCB 5KN5B 2ARWA 2D23A 3HPLA 2X8RA 5IV2B 1V8HA 3MLPA 4QGTA 3EO1A 1WK0A 3PL6A 1KN2H 3II1A 4CD7A 1ORSB 1LMKA 3LQAH 4YPGB 2IG2H 1YN7B 3LKQA 5DSCB 2DQEL 1QI2A 1W9TA 3SE8H 1RIUH 3SGEI 5I1DB 5TD4A 3QCUL 1TDQA 3H3PH 4U3HA 3DVNB 5BV7B 1NL0L 3FO9B 1G0XA 3QUYC 4ZXBD 1T22A 4GMTH 2UZIL 1TA3A 4M8UA 4UTFA 2DDUA 3FB5B 4OF3A 4NUGL 4Z78A 5DJDB 4BKLA 3QXWA 3QXDB 3WEMA 5CINL 4KZEH 1ZE3C 2AOSA 3UR7A 5T3XE 2Z8RA 5CHNA 5JR1L 4XZBA 2IALA 2XXMB 1C1EL 4E9LA 4CADA 5BS0E 3TWCL 4OD3L 5GS0L 5LQBL 1UR1A 4NKMB 1F90H 2YD7A 4K68A 1OSZA 4KJQC 3B9KC 3DYMA 2D0HA 4KK9C 3RVUD 1LD9A 8FABB 1QBML 2ZG1A 2IH3A 1I1FA 2G75B 4UOW1 1S7UB 2DBLH 2F19L 5D1QB 5A16B 5I1LA 2HRLA 4RBPH 2CDFA 2VDOL 5TE6H 1QYGH 2ZSVB 4MHHI 2WZEA 2VQ1B 3WHXB 4A3YA 3QJFA 1A7RH 1XIWD 2EEAA 4I0PC 2X4NA 1BX2A 4CUBA 3WMSA 3OA5A 4JDVB 4ZNEE 2FLBT 3WE6B 1L7QA 5EOCL 3O6FC 1G9EA 3ULUH 4IRJA 4UZUA 4K8RD 3ZKXC 3O4OC 5IFHH 3UP1A 4HZAA 1YN6B 2X4PB 4FQLH 3D3AA 3TH4T 5HYJD 4JHWL 4MD4B 5IB5A 4O2CB 4I4WA 1SM3H 2AEIT 2ORZA 3NGBC 2DJSA 5JIHA 2XN9B 3HZVB 1NJ9B 4O5LL 3UMTA 1HE7A 1RH9A 2CSPA 4AXNA 1YYMH 3GXFA 4U4BA 2EO1A 1A2YB 2UWFA 3MGTA 3FQWA 4ZNEA 2FEEI 4BH7B 4JM4L 3DC0A 4N90D 1N5YH 3MLYL 4POUB 5MENB 1KEML 2B20A 4JGJA 5CZKA 2XYCA 1CFVH 1H0DA 3NYDA 4DWSB 2VO5A 2FX7H 4RGND 1II4E 4BQ8A 3RDTA 1DBJL 4YQXH 1C7TA 2GJJA 2YPKB 3BAXA 4HZ6A 2EH8H 2EJ1A 5F8RC 1FVEB 4U3AA 3BEVB 2E26A 3LPFA 5FYJH 1LEKB 5FAAA 5BMFH 3HPNA 2DKSA 4M02A 3MA7A 5DXWA 5D7IA 1JAKA 4E4PA 2VUYA 3ARUA 5DEGA 4KV5F 1LO2H 4EANA 3MYZA 1T66C 2VXTL 2EDBA 3QUMA 2X4UA 2G60L 2W9LA 3MV11 4QHKJ 1H0DB 2VIRB 4Q6IB 4OFKA 4WEBH 3WV0A 1S46A 3LEVH 5IW6A 2Y7QB 1ZXQA 4JRXE 1B88A 3U36A 5EUKA 3VIMA 1EIBA 1I7RA 4TQEH 4LP5A 2K7PA 5FOOA 5D7LA 3V5KA 4ALAH 3WNMA 4HS8H 4P2RA 3WQ8A 2GJ6D 2R0WL 4D9RD 4ZOBA 1A0QL 1T2QL 5IQ9B 4MAYD 4AMKL 2QBWA 4I0PD 5AAWA 3IGAB 4FQJH 4C56A 4PJAF 4AIZB 4Z77B 3CFBB 3WMBA 2C1OB 5CMAA 5C70A 3EOAA 1MCOH 4H1LA 2VDQL 4OIBA 5CILH 2ICEB 4P2QE 4QOKA 3SE3C 3QIWA 1J8HA 1B3XA 3MPCA 3VRJA 3TBVB 2QQKA 2YC1B 2F5AH 1GQIA 4ZD3L 1LDPL 3OB8A 1VEMA 4GXUM 1I1RA 3O4OB 4RFEB 3BN6A 4G7VL 3HHRB 1AGBA 4I9WE 4XC1H 2IBZX 4JY6B 1VEPA 2A74A 1CFTA 4Z6AT 4OBSA 3O2DH 5F93C 3ECBB 5FHBL 3I6KB 1EDGA 5K9QI 1MRCL 2OXHA 1OOAA 1F3RB 2J62A 1QPXA 1JG9A 3R8BB 1FNGA 1UUQA 5BW7C 3HCVA 1U93A 5LG1A 4FFWC 1JGDA 3BH9A 5CJQL 4NO0A 2YLLA 2F58H 2PO6C 2EPOA 4OCMC 4R7DB 3N1AA 2BVEA 1A7QH 4PTTA 4XHJD 5CSBA 3NCMA 3QHNA 4KHXH 3I9GH 4AT6B 4WI6A 5B22A 1ZS8A 3SGDH 2DLHA 3Q0HA 4XVTH 4Z7VE 3VXMD 3RWCA 3TN0A 2J8UF 2ZG3A 2ZX7A 1Q9OA 4GRLB 4S1DD 4JY6A 4UI9L 1BJMA 3S3PA 3IJ8A 3I6GB 1NUDA 4RQQA 4YR6A 4W4NA 3UJTL 2CPCA 4M61A 2DGAA 4U2YA 5J1XA 3ORJA 3HUJA 1QACA 4HKJA 2FIKA 5BV7L 4ZO9A 4P9ML 3D87B 4WCYL 4S2SA 4OCSL 4I3RH 2G3NA 4JFDD 4QO1A 3T0EA 4PD4K 2DYPB 3CIHA 1J9YA 5SV3A 3CD4A 2DQHH 3HZKA 2NT0A 4M61B 4MD4A 4OJFH 3WIIH 5IB5B 3LAFA 3QIUA 1OF2A 3F2ZA 2YD1A 4X4ZA 4DKDC 2W87A 1D5BA 4P99A 4UT9L 3CHEA 1FAKT 1S9WB 2VLJE 3NIFF 2OJEA 2DYPA 3S8WA 1BQCA 1D6VH 1MWAH 3EYVA 1KCUH 4X7TB 2CMRL 3HZKB 4JN2A 5EULV 2GTZB 3PE9A 1BQHG 2G9HB 2C3VB 5I19H 3UCRA 1YQVL 3OGOE 2JK5A 4WFFE 2XY1A 5KSUA 2WUBL 5C2BH 5DJYB 1KJ2L 1U8OA 4OZIA 1TQBB 4AISA 3AIEA 1KB5L 1FGNL 5D1ZB 3QO1B 2DMKA 4NFDA 3NTCL 4MX7A 3VPLA 3IDAA 3RNKB 2M2DA 1JGEA 5DUBB 3IIIA 4NYLA 4PB0L 1G9NL 1VFOA 3O4LD 1QR1A 2BRQA 4GG6B 4JFVA 1W0WA 3Q48A 4GQ9H 1S9YA 1J18A 4Y0GA 1K4DA 4X9BA 4NHUA 3RY6C 1ISZA 1S7VB 4JCMA 1YPZB 5F72S 5DC4B 1S8DB 4TSBL 1AQMA 5I15H 2UYLA 4K7PY 3RGVD 3WKNA 3R0NA 1BFNA 2PWGA 1A9EB 2YWYA 2GSJA 4Y8DC 3X3GH 4Q22A 4NP4H 3LRHA 3KEHA 4L8SC 3LSOA 2YLAA 2R4RL 1W9WA 2JELL 4UQ9A 1FORH 5L2JB 1KEGL 3OF6D 3TM6A 4JPIB 4OI7A 3D0LB 3MJ9H 2X4QA 2AEQH 2BJML 3F12A 1VHPA 1KIPB 1DBKL 1UM6L 3FN0H 3TH2T 3PWPD 1WZMA 3GSWB 1I1YB 3CFBA 4LPWA 4GW1B 3UYPA 5BVPH 3RJXA 3IETB 3NH7L 1FIGL 5L88L 1UWXK 4F9PC 3DHPA 4JRXB 3WJJC 2E7MA 3QFDB 2ID5A 1EFXA 4HG4J 2R29L 4JM2F 1XF5A 3WDIA 3F5JA 1WKYA 3ZE0E 5EOTA 4HIEB 3M07A 1MCFA 1J05B 4HS6A 4BKLB 1XR8A 3GMLA 1UCBH 5EUOE 3LKSA 3CMOL 2CEQA 5E9DE 3VGAC 2IXVA 3CQOA 3OJ2C 1GC1H 4EI5D 3JTSB 4YHOL 2YC2A 5TQ2L 4D6DA 5EZIL 2YRLA 3HR5A 4M3JA 4PJEA 3BD4A 5EU3A 2X09A 5D72L 3O2DL 1XR8B 1UD4A 3RKDD 5HYJA 2C9KA 4UQ3B 2R2EB 3AROA 5LGKA 3QUZD 4LFHG 4RIRA 1FYTB 4N0UE 3DO3A 4ELMF 4JCLA 5HDLA 2MCPL 1N8ZA 2XUCA 5FCUL 1X6LA 3VFUB 5I8KH 5FKAA 5HGHB 4NQXA 1YMMA 3QXVA 1HI6A 1ONQA 4KMTL 4EI5C 2UZIH 1U2YA 1M7XA 1Q0XH 5L8JB 2WCSA 4Y16D 5BZWB 5DFTA 5C3TA 2VLJA 1V0KA 4E42A 1TENA 4M8VA 3P0VL 3CC5A 3RNQA 4JO4H 5I18L 4EI5B 5AYBA 2J4WH 2WMKA 3RX8A 1D5IH 1PKOA 4YHLH 2APVA 3N0PB 1DWHM 1EEYB 2D31B 1S7WA 4I77L 1ULOA 4RAHA 1LK3L 5JHLH 5JR2A 2D3NA 4D0CA 4J6RL 5B4XA 3ULSA 3O0RL 4JY4A 5CPQA 4XCYB 3BH8A 1NJ9A 1RURH 4NRYA 4ZMAT 1UYWH 4N5ED 2IAND 2R0KH 4L8SB 4F15B 2J7LA 4JAWA 2W65B 2JTDA 3S35H 3QNXA 3ZDZE 3KLDA 4XVSL 5FUCC 5HJ3B 4OCSH 4XCYA 2ESVB 5HYSA 1BQLH 4W5UA 3IDYB 3BIAX 3F5WA 3KZSA 1JWSA 5CD5D 3LRGA 2VX4A 2DM7A 4YFDB 5A6BA 3MREB 1QNOA 3SJVE 1VESA 1ULPA 4PMVA 4NKIL 3QXUA 4UIKL 3T3PE 4ELME 2FBJH 3CU7A 2C1PA 1K8IA 4U6XB 4D0DB 2ED8A 1JYVA 3WDRA 3A3HA 2ZX6A 4NQDD 4IMKC 3TGXA 2CMRH 3CX5K 1A3QA 5EBAA 2E7HA 2GT9A 3IRZA 4Y5VC 1F45A 1YMHB 3UZQA 3VX1A 1UKTA 1S7VA 3ETPA 1FP5A 1KQYA 3GNRA 4NNXA 1I9IH 4RGMB 3K2MC 3MA7B 4UTBL 1FZOA 4UAOB 3U4AA 3KG5A 4XZUG 4EUPB 3W37A 4HWUA 1NFDB 4MGSA 4R4BB 3VIHA 3I6LD 1PY9A 3ZO0A 2D22A 5A6JA 2NY2D 1Q9WB 1IJ9A 2NPLX 1KIRB 4HAGA 5C0EA 1FH8A 1OAYL 5D9SA 1ED3B 1MCQA 5JIIA 1DANU 1JGLH 1HP4A 2ARJA 3N85L 5DTFA 1Q38A 3G5ZA 1UB6B 1WV7T 1OAZL 2Y9RT 1UJTA 5EIVA 2VCAA 4N8PA 3W82A 1IFHH 1J8HB 1ZHKA 4DKEL 4QCFA 5LA2A 4PJEE 3PABA 1IEAA 2J1AA 3AIRA 3QWOB 5KG9B 2GDUA 3MACL 5JXEC 1XF5B 3QI9C 4C56B 4AIZA 2XQBL 5T3ZL 1EAJA 4HUNB 3SO3B 4JO3H 3C7FA 1NCAH 1A5FL 2WLZA 2EDHA 4OLZL 5IB4A 1RUKH 4FXKB 2P5ED 4Z2LA 4WI7A 3EZJB 1Z0MA 4UFLA 1R3HB 3JUGA 1W3KA 2YXFA 4G8GB 3VIFA 3NIDE 4OZFA 5SWZD 3UBXB 2XSAA 1X5HA 3O3AB 3OKDB 3VFSA 1A6ZB 5C0RH 3BJLA 5D6CB 4EBQH 2I60L 2YPVL 4P7LA 3L7EB 1CVSC 1I8IA 2V7NB 4QRUA 4MCZB 4XNZC 2VCBA 2P8MA 4DVRH 4JFED 4O51B 4HJGA 1FVDB 1WTLA 3B9VA 4Z95L 2PB1A 3CFJA 1AKJA 5E1AB 5C71A 5F1IB 1YMMB 1RFDH 3F65A 1NWUA 1ODZA 2H9GB 5JW4R 2Q3AA 2AK4A 1MVYA 3FT4B 4N0YH 1WF5A 5GGTH 4G8GD 4O51A 4B5EA 4ZFOA 3ECQA 1FZMB 1ZTXL 2VN4A 4NQSA 2J4WL 2F74A 3ULVL 3TVMB 4Z7WA 1W9SA 4YUEH 3I2CL 43C9A 4RWYL 2VDRH 1QHZA 3GHBL 4JB9L 4QRTA 1VERA 1BEYL 4LRIA 3CFIC 2WIIB 5GGSB 2EYTA 3QNXB 12E8H 5IDIA 4X9FA 2X40A 4UQ2B 1E6XM 1D9KC 2XQXA 3DXAB 4KROC 3JUYA 4JM2D 5EWIL 1IT9H 2EXYC 2WWMC 1U8OB 4Q9QL 4J3VA 3QT2A 4MA3B 2J8UE 4QRTB 2Y6SC 2QQIA 4ETQB 1LNUB 3KPPA 3OXRA 1DQQA 4MNQA 2J4GA 1H8SA 3ZTNL 2Y23A 3BMVA 5JO5B 2XFYA 5IK3A 1T7WA 3VD4A 1GPFA 2Y36H 3B9EA 2RAMA 2PQSA 3O6FD 4NQUA 4G9FB 1F6AA 4WIWA 4ZXLA 3PP3H 4WTXA 1UXSA 3WBDA 4E0RB 1KULA 3S36H 2EDKA 3IFPA 1QFPA 5DJ2B 2V9RA 1IAOA 3TA3C 1Q6GA 3DHUA 4Z2HA 1FNSL 5IWLA 4PUBH 3C7EA 4A2LA 2GK0A 1GGIH 2CKSA 4YGVB 2ZOLA 4TTUA 2NXZD 5IG7A 2C3GA 3OZOA 3CZUA 5C09B 2OXGA 5JW5A 3MRDA 3H9SA 5F96L 1HHKA 1KTLB 1M4KA 4OF7A 1AO7B 4AYSA 3S6CA 2QTEA 4MZ3A 5E7BA 3NFNA 2CDGB 5HYQB 5FYKD 4IIQC 3UBXI 1JYWA 4P4KA 5J6GA 1ZVYA 4WFHD 4G8EB 3MRHA 4KI5C 3B2VL 4A6YH 2ZX5A 4ZPVB 1JD9A 3BP4A 5HHPA 2YSSA 5HY9A 4PGJA 3OKNB 5FM5M 1UZ0A 3P4MA 3BKJH 3QDJE 1ZLWK 3F6LA 3CO4A 4L4OA 4ZAKB 5C0BD 1UWRA 4QLLA 3L4WA 1OSEA 5HHOB 1RZJC 5EU4B 5FHAH 3OXSB 1DSFH 1HXMA 5IG7B 4LQ1A 4W88A 1E28A 1HVQA 1JPGA 3TBSB 1LEIB 3E6FA 1FZKB 3KPNA 1KBGL 3RWHB 5ENWA 5I8CB 5F3BB 4QX3A 1OIMA 5HPMB 2VZQA 4PGBA 1BSIA 4M6NH 5DJ8A 2D1ZA 1MHHB 2R1YB 3AIBA 2RQ8A 3MLRL 1IGIL 1VKXA 3I50L 4D9QD 3MGOA 1CBVL 2OLDA 2QR0B 4R8WH 5HI3D 4MCYA 3NGBB 5DMJB 1YN7A 3NZHL 5DSCA 3SEPA 4CMHB 3OBAA 4TVDA 1CGUA 3OAZH 1UWUA 3UPRB 3OR6A 3BGMB 3NFSL 3ZHLA 4Y5YA 2DSZA 3OAUH 4P59H 5AAMA 2ZXAA 1QPPA 3LQAL 4KROB 3W5NA 1VKXB 2HFFA 1PG7W 2DM3A 3UO1L 3BKYL 5ECJE 1KELH 3K4ZA 4HDIA 4J27A 4P7NA 3LKQB 4NKDB 5KVFH 2UUDK 3SGKA 3RM4A 4LAQH 2GEEA 4QHMB 1UZ6E 1OAUL 1JI1A 3BDYL 4W6XB 1JYXA 4FNLH 2EDDA 1T80A 2J3SA 5K9JL 2H41A 3MA9H 2A9ML 1FVCA 4JFHE 1R85A 1FYHB 4X8XA 2Z91A 1QSED 5F7UA 1EEYA 4LPCA 4XVJL 4FLQA 4P0DA 3DECA 5CGYC 1NCCL 4MWFA 5I8OH 4AJ0A 2WZIA 3GI9L 4GG8A 2J8UA 5E5MB 3RWEA 1PIGA 2ITDA 4XUNA 4NRXB 3TTOA 2RR3A 4DK3A 4IPLA 3KXFA 2BNRA 1A1OA 3EOBA 3O11B 4PV8B 1CGVA 1ZVSB 1H0IA 3KGRA 2XTJE 3A6BL 3VXSE 2R2BA 1ZT7A 4PCTA 4UDUA 4CJ1A 1JGVL 1FNSH 5HYSB 1INQA 3ZM8A 1SYTA 3MLUL 3HJEA 2I07B 2H6PB 3T1WA 3DXAE 3ALPA 1FO0B 2GYSA 1FAIL 2W9XA 3CLEH 1IL1A 3HFML 3A4AA 3VINA 1V7NL 4WI8A 1HX0A 1OF4A 4P4KC 1QBAA 2ED9A 2WVTA 4NKIH 1CXFA 4Q9BA 1VADB 4F57H 4KJWC 5DVNA 2RBLA 3E1F1 4G9FA 5EN2B 5IEKA 2I9TA 2OMNA 1KIQA 1RPQA 3C2AH 4WJ5A 1D6EB 4X99B 4F9JA 3LEIA 4DM2A 3OPZH 2QHLA 1E3ZA 1VFBA 5KSVB 1C91A 2VDKL 4BZYA 4E8CA 2BNRD 5DURB 1EDQA 4XAWL 1IL1B 3RX7A 1WFUA 1HXYA 2AJXL 5JHLL 3G5YB 5EB9A 2EE3A 1LEKA 4LXFA 1CDIA 2B9VA 3J8F7 2A6KB 2WBJB 5EIYB 1PX8A 4G9DB 2WMIA 4PJIE 1XH2A 3P4OB 3ZDXF 3K2UH 5DVLA 2I9TB 1P84J 5D8JL 1K9DA 2KBGA 5C0EB 2V3GA 3C5SB 3HG1E 3ARFB 5T1DL 2NZ9C 2WHMA 4HKBA 2DIEA 3FMGH 4UT7H 1FV1B 2JB5H 2OYMA 4ODHL 4R90L 3VI4F 2OJZH 5D7IF 3N1PC 3OIHA 5FO8B 4I18B 3EO1B 5HOSA 3QULB 3RVUC 1QBLH 4P5YA 1MIML 1JHTA 4R97B 3K8LA 4YPGA 4ZFGL 1BFVL 2GUOA 1E6NA 5JUVA 2W9DL 3D3VE 4U6YB 5HHMB 4LIQH 1K45A 2ADFH 2A3BA 1ADQH 4AQ1B 4OCYL 1NH6A 4P9HL 3VCLA 4HZLA 3GSXB 3BXNA 4Z7UE 2AJSL 5CAYB 3HE6D 4X6CE 3TEUA 1V0NA 3C5SA 1UJ3A 3MV9E 2MOVA 4LLDA 4Y2DD 1A1MA 4LVHB 3H9HA 5I1AA 3MJ9A 4XPHL 3OR6B 4UZSA 3AFBA 4DCQA 3U7AA 3U4EA 5AEAA 5HGBB 5D2NC 5EO1B 3GSQB 1LGVA 1A4JA 5T3ZH 4KKNA 3O6ML 3D0VA 3BT2L 3D39E 4KK5D 3L5XL 4QDRA 4KUZH 5CP7A 3DVFA 3WS3B 3FRPA 1UWQA 5KJRL 3GXMA 4U5KA 3HI5H 1B90A 1ZVHA 1UQSA 3VM5A 3O9WD 1GGBH 3UEZA 2WKGA 3PZ9A 3ARQA 5I73C 3VGBA 3V4PH 1P4LB 1EUTA 1UWGL 2EEXA 3QWRA 4OZHE 4TN9A 2QBXA 4FF5A 5MERB 3RWJA 4R9HA 4U0RC 3LRSB 3MJ8B 2I9LB 1EGJL 3ZYJA 2JJSA 3IDUA 1JZ6A 4ZXBA 4PGCA 1ZGLB 3FOMA 2WSKA 5ECUA 5I16A 5KSAA 5E95B 5GGVL 3Q6GL 3T2OA 2ICWJ 3VD5A 5D2LB 3VIPA 5IHZA 4H0HB 3D9AH 4P46D 1T7ZA 5HHVL 1J11A 4NKQB 4ZOAA 3IANA 1ZGLA 3CZLA 1ZS8B 2RJMA 3H3PL 1GU3A 3FO1A 4CDHA 3CLEL 3REVA 4BJLA 5HGDA 2CKBL 3VOCA 2PCPA 4X5WA 5IIEB 2YZ8A 3D18B 4TSCL 4OQ1A 5C7XL 1CR9L 1OCQA 3OAZK 4JRYD 4XHQA 2ZUQC 1C1EH 1KJ2H 2XOMA 1IM9B 1X5IA 1A1NB 1FRGL 1JVKA 3A6BH 1TNMA 5H37G 4Z7VA 5BRQA 1F4XH 3LEKA 1S9XA 2VXUL 4NO2A 1NAKL 3WNNA 3GUTB 2JF7A 4LPYA 1BAFL 1HILB 1OBAA 3RDTC 4D8PB 3KYMB 5DMYA 5JXAH 1X4YA 2ZUWA 4FQHA 4M7LT 3O3EB 1QLFB 4ODXB 4P2RD 2XA8H 2NY4B 3D6GA 2F53D 1NLDH 1OAXH 3EHBC 1SYSA 1TCRA 3MRNB 4D0BA 5GGQH 4LLMB 1G7HB 3S3SA 2IAMA 3IKCA 3VI3E 2WAOA 4QB2A 5CBAB 3BKCH 1N26A 1DQLL 1G7IB 1BFSA 4EQ2A 3LH2L 1FC1A 3PP3K 4YO0B 3AREB 1SVCP 1XZ0B 2X1IA 3KYKL 1RJYA 2E7CA 4FTVD 5EBLB 4PJGB 4BQ9A 1MI5D 1UT9A 4RMWA 5L6YH 4QRSB 4EDXA 1EJ6A 4TPRH 3PBGA 2H26B 2VSDA 1ZANH 3UDWC 2GJZB 5F6HJ 4FQHB 4MA8H 5GS1A 2IH1A 4X6DE 3GBMH 5AC5A 3OX8A 4KRLB 4OLVH 5ESVA 4FQ2H 4ZPVA 2DLEA 1DUZB 4P9MH 4X7CC 2W1NA 5HTSA 4GW4B 3V79C 5HHOE 1C16A 5I1CH 3VE0A 4P23C 5F3BA 1ACYH 4ZSOE 4LAJH 5I1DA 4Y4KA 3MBXH 4HUMB 3MJ7B 1I3UA 2XWTB 5EZJA 1CG9A 4BZ2L 2QL1A 5CPTA 2D7MA 5E5UB 2J22A 3FFCE 4H04A 1UM5L 4DEPB 1G01A 2I25N 1W3JA 5CJOH 3WXWL 5CSZA 5FKPA 2W0FA 4XNMA 3AYSA 2K1MA 4GKSB 5DJ6A 1JYNA 4BFEA 1KXHA 4OLYH 4DOHB 1I7ZB 3NH7H 2DDQH 4GW1A 1KCRL 2D0FA 3SCTA 1IAKB 3FB7B 1QO3B 3K3QA 3VFVA 2HT4C 2R29H 3U0PB 4ORGA 3UPCA 1J0YA 4HQQH 3KXFE 1H6XA 4IOSD 4ACZA 2ZSVA 2KQMA 4M48H 3V9FA 2IBZY 2ED7A 2UV3A 3QCVL 1X4ZA 3C09C 3L5XH 2Z4QB 1DN0B 4HS8L 4RFNC 8CGTA 4CVXB 1RYYA 4LCWD 1TZHB 3VXTB 3WFDH 4JKMA 1U95A 3V0VA 5CEZD 3CAFA 4TSBH 3MNVB 4RRPG 4Y5XC 4MB5A 5J3HC 1JPTL 3DO7B 1I8MA 1Q6FA 3JUZA 3U46A 3D69A 1R3KA 4LBEB 2JALA 2DI7A 1CIYA 5GZOC 3L3KB 4WUKL 3MRPA 1HYSC 1MCHA 3TBWB 3AIUA 4LLVB 1YEDA 3VXNA 4NRXA 5GGTA 5I1KL 2E7BA 1UY3A 1XGYH 3LQZB 5HBBA 3ZJ6A 4NQDA 5A8PA 1R3KB 4LBEA 2YD3A 3O2DA 3FQWB 5D2LF 1JNJA 4PJDB 5J8OA 4NRZB 2DTMH 1CLYL 1T7VA 1MQKH 1BOYA 2FECI 3ZE2F 4CADB 3GKWL 4KK9D 2N1KA 2VXQH 3FT2A 1QNZH 3HMXH 3WDJA 1UG9A 3ZJ8A 4MMZC 4APQC 5I2IA 4XBGB 4YLQT 4HKXA 4YHZL 1JGEB 5DUBA 2VLMD 4X0KA 1N0XL 1VFBB 3RVVC 1P2CA 2AKRB 3LN5A 2X1OA 1BM3L 3MMEB 3MR9A 1X5AA 3C6LA 4QX1A 3QH3B 4XRCB 4X4YA 2O5XL 4RGOL 2WQRA 3JVGA 3HNSH 4ONGH 1NUNB 4KAQL 2VXSH 4BQBA 2DDXA 1Z5LA 4IOIA 1QRKA 3ACIA 1OD8A 1UR9A 2A6KA 1G6RH 4MXVF 1G9HA 3LKPA 4YO0A 2X4SA 1INEH 1N4XH 4JDZB 3OG2A 5A2IH 4XBGA 3R1GL 7FABL 1FP9A 3I2JA 2XWEA 2XNAA 1E4XL 3N17A 4LCWA 3V5KB 3I84A 4OIIL 5C6WH 1DQML 5GXBB 2AI0L 3BW9B 4HWZB 1RD6A 3WUWA 1WBYA 1D6VL 3ZJ7A 1W1TA 1BJ8A 4GW4A 1H15B 1M71B 4JE4B 4NWUH 1BIIB 4MA8L 3HR6A 3ULUC 1J8HE 3ARFA 4K3DH 2H8PB 2J7BA 3MO1A 1HIZA 2RGLA 4QHUB 2NY7L 4G7YL 5E8OB 3VJ6B 4R4BA 1KB5H 3VCLB 2AGJL 1U92B 3JV4B 3EDKA 1FNEA 4N5UA 4N8CL 3TBYB 2NXZC 1Z32X 3LZFL 4W87A 1LO5A 1R3IL 4O00A 2BK8A 2XKNB 3MBXL 1YQVH 2VZRA 4ODTL 2JF6A 2J7CA 5E2WH 5EUOB 4QHUA 3CZ8A 5JDJA 3C08L 2DQDH 2YEZB 4GQ9L 1GPOH 1GORA 5DA4A 1FNGB 4LSVH 3DVGA 4NPYA 1FH7A 4OZOA 2OTWA 2R1XA 1BIIA 3FT3B 4OCXL 5EU3B 1BVKA 4F33A 3CZFA 4UOW0 1EXUA 1CFTB 2BRRL 4U1IB 4IOFC 5ESQA 1UZ8A 2IC2A 3QDMA 2CIIB 4OD1L 1MCDA 3SDXA 4MZ2A 3O3AA 2PXYA 3OKDA 4OGAC 3VFSB 1A3HA 4R26H 3SKNA 4OF6A 4DQOH 2PC8A 5IGXH 3DNKA 1R5IA 4ZUVB 3UERA 1K9EA 4MNQE 4GWIA 5E2VL 1KN2L 2VQTA 3IFNL 5BZDA 1J5OH 4Y1AD 3ULUE 4MAYB 3P77A 4FTVA 1X5JA 3BGFC 3BQUC 1R5IB 4XNQB 4HMCA 1UWXH 4XP4L 1T1XA 2FIKB 3DMMD 4JRYB 3QDMB 4YGAB 4NSKB 4JO4L 4PRDA 3QDME 1KLGB 4S2SB 5I18H 3KPRE 1CLYH 5I1JL 1CX1A 2J8FA 2ARJQ 4KVCH 4LSPL 4AIOA 1MJUH 4G8FA 1GOWA 4PB9H 1K5NB 2JCCE 1HH9B 3FMGL 1BFOB 3TO4B 5CD5C 1MCWW 4ETYA 4XPGL 4QHLA 2V9QA 3GSVB 1ZU8A 1QNPA 1JHLL 4LU5L 5BO1L 4XNQA 1VBUA 4YDJA 1UH2A 4YBLB 5HHQB 3G6JA 1MFBH 5CD3B 2DIBA 2AK4E 3DTXB 5KJRH 4G80A 1GC1L 2AJ3A 2R8SH 3KWXA 3HRZA 4MB1A 2YD5A 2WIMA 1QR4A 4H41A 1FBIL 4NO0D 4OF0A 4AZCA 4NFBA 5T1MB 1UD8A 1AXTL 2VAJA 4JG0H 3EBAA 3QO0B 3HC0A 3AUVA 4KVNL 4ONHA 5E03A 2J6EH 4HWBL 5D1XB 4AEFA 2AJ3B 4GQQA 1EVTC 4H26A 5IK3B 1HJSA 3I75B 4ORZC 2VABB 4MA7L 4XXDA 5A2KH 2IF7A 2QQNA 2YN3A 4HFUH 1UWTA 3KPPB 3N9KA 1SJEB 2ADJA 2EXWC 4FQCL 4PRPB 1GCYA 2XNAB 5CBAA 3IXTB 1D5BB 3C6SA 1LNSA 4AG4A 4J4PD 5JOPD 2BVOB 3BUYB 1TXKA 1UWGH 4KI1A 3THMH 4QOKD 4MJ4A 5E4EB 2Y24A 2NLJB 4KJWD 5A1AA 1V6YA 3CDFA 2FIRT 5GS0H 5LQBH 1FNAA 1H15A 3VGGA 1B2YA 1VBRA 2VISB 1FSKC 3MOBL 5J7CC 2E27L 4K94L 1S9VB 4W70A 5IW6B 4OLWH 4PP2B 5D1ZA 4RA3A 5HHPB 5D7LD 5IVXB 4RFNB 5EA0H 4GSDL 3UTZA 3H3BC 3QNYB 4NKOA 2VRKA 4LLYA 4MNMA 5TFSH 1E4KC 4JPKH 3M7SA 3U7BA 4JZJC 2GAZB 4YE4L 1IC7H 1ZLUK 1BGXL 4K07A 2RVAA 1PZ2A 3DYPA 4DWSD 4MNLA 5FGRA 3VXUD 3PZOA 4X6EB 3K80A 3VG9B 3PL6B 4R7NA 2OJZL 1OL0A 2OZ4H 3MJ6A 4D1JA 4Y4HA 2AXHA 1MIMH 2VRAA 5KN5A 1BREA 5ICZA 3O8XD 5H35B 2EC9U 1U30A 1I8IB 4D6HA 3NPSC 4D6CA 4ACZB 3MRMA 2BZDA 3BE1L 4GI9A 4B9YA 4WHTA 4C7DA 1J9CT 2NY1C 1AQDA 1XD1A 1IC5L 3SDDC 5DVOA 3W9EB 1VJZA 1DSFL 3KS0H 4YDKL 2FGWL 3QHOA 1YZZA 3FT4A 1FYTA 4TULH 2ZEXA 3WIJA 3QUXC 3MNVA 1ZK9A 2DI8A 4BZ1L 3EIFA 1MCJA 1DL7L 3MYJA 4WENB 2ICCA 5GGQL 4ZFZA 2BNQB 1JGDB 2OR7A 4KU1A 4X7FC 3TJEH 4S11A 1W8OA 3O2VH 1PZ3A 2WCGA 1R86A 3S96A 2R1WA 1HZHH 1EQCA 4XB7A 4HXAL 1BVLA 3ULSB 5T5NG 4CGTA 5CYYA 1B9ZA 4JZJA 1YEDB 2XV6B 1AIFB 1JIBA 4LPXA 1QEWA 2MHAA 4FZ8H 2DOCA 3W9EA 2B1HH 1CL7I 1OARH 3HZYA 2GITB 3N1QC 2YUWA 5FO7B 1MUJB 2A9NL 1A9BA 3OMZA 2BOCA 1V0LA 1W91A 1L7IH 4LLVA 1KN4H 2AEPL 1AHWA 3INUL 1E6QM 3U6RB 2D20A 3O6LH 3IJHA 4RCAA 3RDTD 2DCJA 4FXGB 4F37F 3ARBB 5EIIA 3WDQA 2GVYA 3G6JB 3X17A 3KYKH 4MDIB 1H3PL 4A3HA 2KDGA 1H49A 1ZA6B 1B0IA 3STZA 2OP4L 1LHZA 2X9WA 4HCRA 4F7PA 3FQUB 1N0XH 2DLTA 1I7TB 1MFBL 5D6DC 1JZ7A 1ZVSA 5ERWB 5I1IL 4Q9QH 1ZLSH 2Y64A 1KXTA 2KPNA 3HMCA 5GRVL 3CDYA 1AFVH 5C0AD 3TIDB 5DO8A 4B7LA 5GRJH 2LAAA 1KB5B 4LLWB 4YAQB 2QSVA 3DRTA 1G6RL 5C0IA 3AISA 5IMLA 3O3UN 5E2TL 1JNDA 1G0CA 3BZFB 5CXPA 4JZOB 2G3IA 1U9KA 2VXUH 3H9SB 4Y4KC 1CE6A 4Z7NF 2VR5A 4MDJA 3R1GH 1Z9SA 4M1RA 3GJFK 5HD8D 1A14H 4GLRH 3ARPA 1KJ2A 3RWFA 5JW3L 3GK8H 5IMKA 1R0AH 4ZZ5A 1CYGA 1BGAA 4JDZA 1FVEA 3U7VA 1KPRA 2WC7A 2W65A 3MNWB 4GBXB 2CJUH 1FOBA 4OMDA 1NAMB 1IGCH 4EOWH 2HMIC 1MQPA 2CETA 5DMIH 3PIQA 1ZJAA 4Y19E 2VLKE 1D5MB 1T89A 4UU9A 2ZWZA 3ZO9A 3RZWA 3LSOB 2NY5L 5IMOB 4ZENA 3V5HA 3ARED 3MOAL 4S1SH 2G8ZA 4PGBB 1K3ZA 5DI8B 4TRPL 4OFYD 2BC4A 2WMGA 1M01A 5ITFB 2I5YL 5D71H 4TNVK 1NBYA 4J1UA 4M93C 1MAKA 4LSVL 1LO5B 4P2RB 1NQBA 1FZOB 1RK1B 5AZ2L 5FUZL 1P84K 1JNNH 2ZUSA 5CHNB 1A4KA 4TUKH 3GM8A 1UB5B 1W72L 2W9EL 3KDMB 3SCOA 4JY5H 5ITBL 4HXBH 1BP3B 4TUJA 5FV1L 3BT2H 4KMQA 2HTLD 3RWGA 4PGEB 1MVUB 2JCCB 4QT5A 2RCSH 1TITA 5I74C 2PN5A 5C0JB 3IVKA 3PWNB 4YHML 5IP4A 1F2XK 4UCFA 5TPWL 5E4IA 3B2VH 4JGMA 4U0RB 5SWSA 4RAUA 2VI0A 4HT1H 4PJ8B 3AHTA 5TJWK 1LO2L 2RIKA 4NQED 4P4KD 4LLDB 5BXTA 3TH3T 4OCYH 4G9FE 4XX6A 1TVPA 3V6ZB 4ERSH 1V3KA 5C8JB 2ZUTA 2FD6H 3WF0A 4JFXB 4B15A 3IDGB 1CIDA 3DBXA 4N8CH 2BJMH 3ZSTA 5C9JB 2VL5A 3PF2A 5CP7B 5M17A 1NQ6A 1GGBL 3HZYB 5A8OA 5FO7A 1MF2L 1MH5B 3OKEB 1W72B 4OZFB 2DQIL 3BDXA 4I3GA 5F89A 1HKFA 1IGTB 4W85A 1SJXA 1DANT 1NANH 1PG7L 3R06A 3GXIA 1TTFA 2QADD 4PRID 2BVPB 5FUIA 4OM0L 3LPOA 2ZOKA 3QEUA 1PYWA 2JB6B 5EZLA 1V3MA 4U6HA 4BFIA 1J0ZA 1WFNA 3QIUB 4NC2B 4DUXA 1DWGM 5A2BA 2YRPA 3VXRD 1I8KA 1KGWA 1E6OL 4MJ2A 2BNQE 5L2KE 2Z8SA 5E08L 4I9WD 2F54A 2UWEA 2ZKHH 5IHSA 5E9DB 2DIAA 2V2TA 4LSPH 1XGTB 3GM0A 3ARFC 3PP4H 1OAKL 4H8UA 4P48A 1Q0YL 5TQ0L 4GI8A 3CH9A 1B3WA 3OHXA 3T2QA 4AZCB 3MCKA 2ZOKB 2AP2A 1CDHA 2IGFH 3IFPB 1BGGA 3BDYH 1YJDC 43CAA 2MWCA 4UUJB 4YHZH 1B0GB 4N68A 1IGYA 1TFHA 3S7GA 4E41A 2CIKB 4NQVB 3ULUF 3MRDB 1U8QB 3E8UL 1WZ1L 5M03A 3I2IA 3RJQB 3UETA 4GRLC 1MAML 3SQOH 5CCKH 5FDWA 1VGKA 1OT5A 1NEUA 4C4KO 1NBZA 2DTML 4I3RL 4OIAA 3SN6N 1CTNA 2DT1A 5IQ9A 2ZUXA 4C55A 3ZL4H 2OYPA 1NGYA 1J83A 3ACFA 4LLMA 5L8KB 3H8NA 1KPUB 3BYTA 4FQPA 4WI3A 43CAB 4ZAKA 3QIWB 3RA7H 3QUXA 1V02E 2VMEA 3CTTA 3D2UA 4KRUA 4Y89A 5F1NB 3GSNB 3MZTA 3IJSB 2XN9E 1ZL1A 1F4HA 2ZG2A 1GNYA 3BKCL 4PBWD 4OM1L 3MUJA 2GDVA 5I19L 4V27A 4IOFD 1VGKB 4RMQA 4X9IA 5HPMA 3BSZH 2AXJA 4XMPL 1GL4B 4BSVB 3QWRD 2WMJA 4WFFD 3MLSH 4NN5B 1A4KB 4H7VA 1JWMA 2BVTA 4IMLA 1WC7A 4JFFE 3L1OL 5EO1A 1GIGL 1V3JA 2Z4FA 2VVSA 3BH9B 4FHBD 4O02L 4S1QL 5ADOL 4P5MA 5T3XL 3FO0H 3BEWA 1HOCA 1U3HC 3A6CL 1L7TH 4PJAB 4FQQB 5EBWB 5DQDL 1U0QA 2Z31D 5KS9F 2YJQA 1KWKA 4UOJA 3HG1A 1K85A 5HY9B 3OG4B 1DBMH 2IPUG 1ZBWA 5BQ7B 3BN9C 4NBZB 1Q9OB 2YKLL 2PYEA 3GMLB 4P5MB 2XVKA 2VDQH 4P2YA 1BQHA 5CILL 3UZVB 5TF1L 2CKNA 3FHQA 1XPWA 3C8DA 1F13A 3EDFA 1MCRA 4M6NL 2MCG1 1K6QH 3KPQB 4IDJH 4WRLA 2JELH 4PRAB 5I1HL 2NXZB 1UA3A 3MLWL 5T1DH 4M1DL 4YHGA 4O2EB 4FQIL 2G4FA 1ETZB 4KK6C 4PJXA 3ISWA 2BOCB 1C5CH 1P4BL 5E5MA 3WDHA 3VM7A 1AHWB 2JCCF 4QXGH 3WHE1 1KOAA 1IGTA 4ODBD 4EKJA 5IESH 4ARYA 1YEIH 3C7GA 3FQNA 2QMJA 2VLRA 4YHNB 3LCYA 4MNGB 2PF6A 4RWYH 4M1GL 4DOHE 4NUJB 5I17A 3BAJA 1KJ3H 2LU3A 5D1QC 4Z8FL 1BHGA 4R4FL 1DBAH 3BRGC 1FN4A 5FA4A 4D72A 4JY4B 4OCRL 1MCNA 1QFWI 4E41E 2VX6A 1GJIA 3LB6D 4JO2L 1AGFA 2R9HC 3STZB 2ZCLL 1BLIA 5D2LE 1MXDA 4MNJA 3UG3A 1TUXA 1CWVA 2GKIA 5C0IB 1GOMA 4LQRA 3P4NA 3JV5A 3HLAA 1GOFA 4Y4FA 1LP9E 2YZ1A 1MQQA 3O2WL 2VC2H 2QQQA 4F3FB 2YA2A 2Z0BA 4PFEA 3PGCB 5GNXA 3RWEB 2APWA 4TNWK 5C6TL 4IISA 3QUZB 4ZTPH 5GGRA 5A6KA 4MQXC 4H1LH 1CD1A 3O6FB 5D5ME 5DJAA 3NRUA 1UACL 1D3CA 3P4OA 4UDTB 4BH8A 2R9HD 1TVHB 5B38A 3RIFF 4HA1A 1E56A 4X5XA 5ALCL 5L7XL 1IKNC 2IMMA 4QRQB 3W0WE 5EWIH 5BS0B 1QSFE 1HKLH 2XN9A 3PWJB 2P4AB 3ABZA 1V6VA 4FP8H 2HT3C 4YGVA 4XTRC 4AWEA 2A0LD 1A22B 5TE6L 4F7TA 4PYHA 2YBTA 3T2NL 4NZCA 3CFEA 5GRUL 5F1OB 3RIAK 4PJ9B 3GSWA 4AIXA 4HXAH 2QPSA 1NBVH 4O02H 5ADOH 4P7RA 2HH0L 4UOZA 1CK0H 5A8QA 4GINA 1HF6A 5I30L 5IHBA 4BQ5A 5IQ7H 2NY5C 4ZXBC 4G6AD 1EOMA 3D48R 3OF6A 5EBMB 5F1NA 3OTTA 2J5LC 4XUYA 4OGXL 3CMOH 1X5LA 2DQTL 4M24A 3OKNA 2DWEB 1VSCA 3WQVA 2BY2A 1AJ7L 2AJXH 3O8XC 3GO1L 3TYGL 3GEWB 2WDBA 1MW2A 2BERA 1ERNA 4PJ7F 1ED3A 3G6DH 3IK2A 3BPNC 2ESVE 2MKLC 2V2WA 3L3JB 5F70A 3QFJA 4C83A 3EDEA 4F58H 1C92A 1E6SM 2W0FB 4XNMB 4LSSL 3WN5C 1EBAA 2YDQA 4W4OC 5DEGB 5C6PB 1UB5A 3KDMA 4BZ2H 3ULUL 3NSXA 4MA1B 3GSXA 5HI5D 2BP3A 4MA7H 3SKUD 2WMPA 4F7CA 3BWUC 1WCGA 4JHOA 3TVMC 4XUTA 3QFJD 1ZHKB 3QQNA 1WCBB 4MXVE 4P5TC 1L0YA 4KRNA 2ITCA 1V0MA 1HL8A 2OL3L 5SWSB 3GYCA 2F8VA 4RAUB 3M1BA 2CERA 4LSTL 4RN5A 1WT5C 4DVBB 3M17B 5IVZB 5A94A 4PJ8C 4BQ4A 4WY7H 1URLA 5LWYL 3P30L 3NZ8B 1AY1H 1U3YA 4C4KT 1WIPA 3CC5B 5C8JA 1GAFL 1G7MA 1YA5A 5ANMB 2DQCL 5FYJE 4GKNA 4O4YL 1JWUA 2R23A 2E27H 3TF7C 4DEPC 1JHTB 1RUMH 2DQUL 3QPXL 2FBJL 4FQXD 3UTSD 5F7DB 3HE7B 3V4UL 4NC0B 3LRSA 3MJ8A 1I3GH 3JBG7 5EFIA 4G6KL 5BRZE 1C3FA 3WL0A 3H7BA 4PJ8D 3QIUD 3VG0L 4ZUTB 2NTSP 2F54E 1X5XA 1HDMA 4HT1L 5A3IC 4KQ3H 2A74B 4NQCE 3GMQA 3R06B 5CS7A 5ACZA 4XMKH 1PG7X 2XJ7A 3CDGA 2YWZA 1V7ML 2G2RB 5DEZA 3MZGB 3BWAB 1W72A 1MJ7H 3EYQD 2GW5A 1EAPA 2W38A 3C5ZB 3O6KH 2ZXDA 2EDXA 3T4AB 2X4NB 1YEIL 3FB6B 3QIUC 1KXQE 2NW0A 3GUTA 4Y5VB 1A6TA 4GRWF 1ZLUH 4O2CA 1T04B 3MRQB 1OSPH 5EU7E 2N4IA 2F58L 4ODTH 3KL0A 5ID1A 1YN6A 4ZYKA 5CKAA 1S7XB 5GGVH 1UKOA 2D0GA 4R2GD 4YHLL 4PP1D 5CD3A 2DQGH 3STLB 5C0GB 4N8VB 2E0PA 3HS0B 4M48L 1VADA 5BO1H 1ZEAH 3CX5J 1U8HB 3O3DA 1NMAH 2ZEZA 3L4UA 3RDTB 1CD1B 3O6FA 4JFDA 3NA9H 3IFOB 5KVDL 4AIUA 2YBRA 4IRSD 5T1MA 5HHNA 1KNOB 4XWOC 3NCFB 3TNNA 1Q4NX 3MCLH 3ROOB 1A6VL 4H5SB 3MX0A 3RU8H 1CGSL 3CUPB 1TG7A 1IV8A 2NZIA 2PUQT 4JEGB 1C5DA 4RWHA 5GISL 4FA8A 4WKAA 2Y1VA 1RUQL 4MNKA 4A6YB 5D7IB 3HFMH 2NY2C 4M9OA 4L5FL 4OZHF 1GVYA 2VXVH 1UD3A 1IGFH 4L4TE 2HKFL 3PHOB 4N0UB 1ZHLB 4IS6A 4HOZA 3A23A 1N4XL 3S2CA 3AREC 4N42A 4QRPD 3DLQR 3H9SD 1UB6A 3QCTL 4HK3J 2VDOH 1OGTA 1WDRA 2P43B 5DEFA 2XPGB 1FBIH 4ENEC 2J7EA 1A47A 2YPLE 2VH5H 4UFMA 1YC8A 3IFOA 1KLFA 4RX4D 2E6JA 5E94A 3F58L 5INDB 4YHEA 3UJJL 3VIOA 4KKBD 3FXYA 1X7QB 3SCNA