5LZ6A

Crystal structure of human acbd3 gold domain in complex with 3a protein of aichivirus b
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
163
structure length
126
Chain Sequence
LPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Antiviral protein
molecule keywords Golgi resident protein GCP60
publication title Kobuviral Non-structural 3A Proteins Act as Molecular Harnesses to Hijack the Host ACBD3 Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 126
sequence length 163
ec nomenclature
pdb deposition date 2016-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13897 GOLD_2 Golgi-dynamics membrane-trafficking
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.680 Mainly Beta Sandwich Jelly Rolls GOLD domain 5lz6A00
4TLGA 5LZ6A 1OLME 1O6UA 4UYBA 1OLMA
chains in the Genus database with same CATH superfamily
4UF0A 4DS0A 3FBMA 1O5LA 1W6QA 4FPFA 3V65A 2BP6A 4D8MA 1DBNA 1UMZA 3FX3A 3WVJA 4OUMA 5JLVA 2HEYF 2Y6JA 4CDQA 1ULCA 3JD72 2HEVF 4N53B 4I09A 1W2TA 4ZONA 5LBBA 3BUCA 5IVBA 4P9XA 1TMF3 2EALA 2Y6FA 3AKQA 1SCSA 3NNFA 1IZ3A 2PN5A 1DP0A 3AC0A 4UBHA 4UWDA 3WNKA 1WCSA 4CEWA 1S0GA 3C7FA 2XJPA 3ECQA 3M3QA 4BCUA 4KWUA 2WA3A 1REEA 2R063 5L9BA 4CDUA 3NO8A 3HD8B 4LBKA 4AEMA 3ETQA 1NOVA 4FOWA 5K8SA 4AZZA 3H3ZA 3WG4A 5C3QA 1OHFA 4YM1A 2P2KA 3LQCA 2WNVB 1XNTA 4IV3A 5DPNA 5I8TA 1VBA3 4XFGA 4CVUA 1OBNA 1DIWA 2QKDA 4CCLA 4M0HA 2R7EB 2JDHA 1GNYA 1OVSA 4WZCA 2WFF2 4M01A 4H7LA 1IKQA 4DXZA 4OUSA 3WSOA 4UFLA 1Y43B 1D4VB 2XUEA 4JAAA 4XAEA 2RM21 4P14A 3I49A 3HEIA 2ARCA 4S2FA 5FZBA 2YROA 3AZZA 3HQXA 1R093 1QOTA 5GLWA 5FDBA 1LOFC 4B1LA 4JZRA 2XJSA 4R8HA 3U07A 2HWF1 3AMPA 3UGHA 2OW4A 1K5JA 1SZBA 4O9GA 2X8KA 2C0ZA 4RD7A 3KF3A 4YNIA 2CGNA 1UX7A 4IE6A 5BNOC 4XCBA 4ZS3A 1UY0A 1FNYA 5FWEA 5ACA2 5A7SA 4MGYE 1CAUA 4YW5A 5A1AA 3J4UH 4JGYA 1H9PA 4K3UA 1WW6A 4QQ2A 5J3UA 1UY1A 1FPN2 1DLCA 2WO2A 1RUH3 3RZLA 1PIV1 1MVEA 1QQP1 1W9SA 2YU2A 3AKRA 4XW3A 4QXBA 3WNPA 4BJ0A 5C8WA 3BI3A 2HWB3 4DIQA 3VUOA 2VXRA 1H1AA 1HQWA 1TQ5A 3MZHA 1W8FA 1E57A 3H42B 1MS3A 3ACHA 4XCAA 4QKFA 1LHUA 4YSFA 5FYSA 2VUCA 2LM3A 3AXDA 2ZTNA 1N1SA 4LULA 4GB32 5C70A 3ZPOA 2PQQA 4NRPA 4N8MA 5FZEA 3VZOA 4DQAA 1GQHA 3X29B 5IK5A 1PO22 3D5OA 4KG0A 3EMRA 2BNOA 2V73A 1JH5A 3BKZA 1W9YA 2Y6GA 4EZ4A 2CY6A 4AI3A 1K12A 1HW5A 2GP3A 1F31A 3ZPYA 2DF7A 2BRTA 4YZ1A 2V5DA 1MR5A 4YWAA 3LPFA 5IAVA 3UV9A 2WNUC 5FTTC 4DMIA 2SBAA 4XF1A 2QQIA 4D3WA 1DQ6A 3ST7A 2D6NA 3BVCA 5A1LA 5DZGA 1SFYA 4AGGA 1KRIA 5BNPA 4XFIA 3MICA 4XUTA 2RR13 5LB6A 3W59A 5F5QA 4ZXEA 4LBNA 4OYUA 2XBO2 1CAXB 1KDMA 1OF4A 1OOPB 4Y1UA 3RYRA 2LW8A 3SC7X 3AZXA 2EAKA 1TME2 2EA7A 1HB1A 2OZJA 4OUEA 1IQAA 1MQTC 5F3GA 4CUCA 3VD4A 5DABA 1YQ2A 5A3TA 2PHXA 2W46A 3AVRA 3I59A 1JOJA 3PIGA 4K8RB 3VBOC 1F4AA 3N7MA 4AQ6A 3AL6A 3D0SA 3GBGA 3ZYJB 3VBFB 5JZGC 3ZN5A 4AW7A 2IXCA 1VBE2 2MEV1 2OA2A 3K51A 5F5AA 1PNGA 1OFNA 3T4HB 1IG0A 1UW8A 3H7JA 3AYEA 1UKGA 3IPVA 1W6MB 4QKBA 5FYCA 2EVXA 4PLOA 2WQZC 5C4WB 2WSUA 1DYKA 1I6XA 1SLIA 4IEXA 1UL9A 3JD71 1DGRA 5JXJA 2IWGB 2ZABA 2D40A 4A2UA 5A80A 2D44A 1JMUB 1PVC2 4UBGA 5H9QA 3ENRA 1WUVA 4N53C 1QJU2 1D0GA 4NWVA 2WZR1 4JKMA 2E9QA 4FTEA 1AXZA 2DUOA 2GP5A 2PHFA 3QD6A 2R073 4GKXA 5F5IA 4XFHA 1J3PA 4CDWA 4IV1A 3LA3A 3IB3A 2PHDA 4AK3A 2G4IA 1UYYA 2PAKA 3EJKA 1WD3A 3D82A 4EZHA 4ES9A 3AFGA 1MS9A 2P17A 1Y3TA 2D3PA 3POSA 4DEVA 3DPRA 1TVGA 1NE6A 2Y60A 3S5AA 2LUWA 1BKZA 2QVSB 1CPMA 1I5ZA 4IEQA 5A33B 4CCDA 1HJGA 3THTA 1ZZ7A 1PNFA 2ZEWA 4RS5B 2WNVC 4CCCA 4IXLA 1O3TA 5HPOA 1UKRA 1AR83 4HVOA 1VAMA 4JCKA 5LBEA 2WFF1 1HDKA 1T2XA 4FO9A 4LOTA 3HMYA 4GWNA 2BBAA 4UW5A 1HLCA 2GC1A 5C9AB 4DNYA 4AFDA 2AENA 2XLAA 3CZJA 3I8TA 3IMNA 3VBRB 4XVHA 4QDQA 1GP4A 5JOXA 5JXGA 1QKQA 4QX1A 4XTPA 2E7TA 2P5BA 2ZGUA 2JB4A 4ZS2A 5HCBA 3U4XA 1OQEA 3PUIA 3V64A 2Z79A 3OOXA 3WUDA 3GF6A 1VLNA 5LRRA 2A7AA 2Y64A 3Q9OA 5D2AA 1IS5A 1HXS2 4IEWA 4RHV2 4LJHA 1VMHA 1V0AA 4AI1A 5I0RA 3O1VA 5CG8A 4ES8A 2UURA 5ACA1 3GZUC 3KB5A 2YBSA 2ZBJA 1IG3A 2Q1ZB 1FPN1 1PZ9A 5J98B 3JBG2 3Q8CA 2RG4A 4QGLA 2P6HA 4XJ8A 4YGEA 5IT6A 4BLJA 3I2OA 5HCFA 2AACA 4RFRB 5DG1A 4CDXB 4FAGA 5BNNB 1WLTA 4I0BA 4JX0A 4GJYA 5F3EA 1OLRA 4AEDA 1C5IA 1AR93 2BNMA 2TEPA 3VV1A 1ZYBA 4AWDA 1WLDA 3PUHA 1L7LA 2W95A 4GB31 2RVAA 3AP9A 3T2QA 3UETA 2E51A 4ASLA 3BCWA 2VNOA 1B35A 1GR3A 3I3BA 4JGZB 3TYJA 4F8AA 1GANA 1PO21 2IZWA 2JDUA 4S2DA 4NR1A 4CCMA 4W50A 1C1FA 3CBNA 1POV1 5J7MA 1Q8PA 1RUI3 4FPEA 1VAKA 1WA4A 2WINB 3EBRA 4L99A 1JZ8A 3D3AA 5IYYA 3N9QA 2VQTA 3WF0A 5CEHA 3BIEA 1JYXA 3E5QA 2KA3A 1QJY2 3ABZA 4OQ9A 3AKTA 2HWC2 1HB2A 1VJ2A 1QOOA 1S1AA 2QCSB 4RA0A 3IAQA 1D0HA 4LE3A 3HR9A 2ORZA 1COV2 2NMOA 3POFA 1LHWA 4N43A 5FPUA 4JRAA 4AGRA 4GIQA 5FWJA 1CGPA 3MYXA 1C28A 4ARXA 4Y22A 1E5HA 3Q8FA 2XBO1 1Y9QA 4NHLA 1TME1 1E5IA 1WBLA 1OOPC 1HJFA 3OJBA 2PTMA 5KXEA 5J48A 3AMMA 3EHKA 1GZWA 4FPKA 1H4HA 4H14A 4MH0E 2EIEA 5ANQA 4MXVA 4S2GA 2FDIA 5LZ6A 4EN9B 5I91A 5EWSA 2VZQA 2F4PA 4BQ3A 4OI0A 1VBE1 2Z5WA 3MI8A 3O7OA 4XFBA 4LKDA 4NWWA 3VBFC 2WQ4A 3LF7A 4GJZA 4YW6A 1CZVA 4C0HA 1ASJ2 5C3OA 4Y33A 5IWFA 2W1SA 5JSOA 4JHTA 3GNEA 2R042 1FV2A 3JB8A 4IETA 1MEC2 4IL7A 4Q1PA 1OUSA 5I93A 2W92A 1A6CA 4LBOA 5FYVA 3K4ZA 2ZX1A 4KMQA 3A7QA 1N3PA 1VBB3 5C4WC 5G05L 2VBBA 1PVC1 1POQA 2BGPA 4MSVA 3T3YA 1H2MA 1QJU1 5T5OA 3VBSA 1G9CA 2WA4A 1I9RA 4LO4B 4Q8KA 3LKJA 5EV7A 4PIZA 3FHIB 5F7UA 3VDBA 4FQ4A 4YVWB 3SH3A 4IE4A 4C0BA 1BXHA 3P1IA 3I97A 3VBHB 1VBD3 2VMIA 3KF5A 1FMD3 2DCTA 2W47A 5FYYA 2OKXA 2PQSA 4P5YA 2E53A 4E4HA 2VZ1A 4AI9A 1XU2A 1ZBE2 4QPIA 4DRRA 3CEWA 1GYKA 2JICA 3JXSA 5FZ9A 3I54A 1IOAA 1G9FA 1XQNA 2ZX0A 4Y1VA 1JOPA 2X29A 5A3WA 3USSA 4Y20A 4LBJA 4D7SA 2JIGA 1H8TB 3JZVA 4RS5C 1GZCA 4CPBD 2BERA 4IEOA 4L8QA 2YC4A 4UFMA 1YEWA 2VVEA 3EQEA 3RMYA 3DF0A 3S30A 4RQPA 2WNEA 5FMBA 1TE1B 5JMCA 1GWKA 4P5HA 2B9VA 5FK7A 4E4SA 4BK5A 5C9AC 2QFEA 4XMIA 4LNVA 1H30A 3VDCA 5A3MA 1S0IA 4K21A 3VBRC 1BJQA 1HRI3 2ERFA 3LSEA 2YZ4A 2P3YA 1NG0A 3B69A 2ZXQA 2XKOA 4GWJA 4QX3A 4HPKB 2CHHA 2HJIA 4QT6A 4WBBA 5FXXA 2W2IA 3WY6A 2CDOA 1J1LA 3QACA 2OXBA 2WT2A 4YLZA 1HXS1 4RHV1 4XILA 5EQUA 1DU3D 2W5FA 3UKNA 4LA2A 2XQXA 2YBKA 1APNA 4LLOA 2IUWA 4FT8A 5GZGA 1IGOA 2PXJA 2YYOA 1ND3A 3MIGA 3KV4A 3E6BA 1S0BA 2DU0A 3V56A 2VCCA 2WWJA 4YW1A 3JBG1 2BTVC 1HQLA 4M00A 5FLIA 1RHI2 3K3OA 4AVSA 4GMP1 5JIUA 1IPKA 5FY0A 1W2UA 3TEYA 2JKBA 1YCIA 4CDXC 1UYXA 1RUNA 4LT5A 1XNKA 5A6XA 1YXWA 3KZ4C 5BY5A 5FO8B 5FOJB 1JYVA 5C33A 3BTYA 2GNBA 1O4YA 1UXXX 1ZBA3 4GWMA 4NAMA 5DDJ2 1ULEA 1X7NA 2Z4FA 2W91A 5A3UA 1GMMA 2V4VA 1R083 2J1VA 5FQ0A 1IKPA 3U11A 4YW4A 4PBOA 3LAGA 1O3SA 5KXBA 1FAYA 3WQ1A 1NZCA 4JGZC 1AZDA 4Y5Z0 4WM8B 3VD7A 1UYZA 2H0BA 4B4RA 2CGPA 1PK6A 4DEQA 2ARBA 4SLIA 2WL1A 4LO6B 2P3JA 1Q43A 1OKQA 2A5ZA 3KGZA 1Q3EA 1ONAA 2W0XA 1QJY1 5K9YA 3IMMA 4XOGA 3O1PA 2HWC1 3KQ4B 4Q4V3 4N9IA 4YM2A 4ITCA 3DL3A 3RGBA 4XJ9A 1COV1 1NZIA 2R0FA 2FZ1A 4RYDA 4GULA 3MW3A 5DAPA 1SMVA 3JUUA 1PMHX 3Q8AA 3WNXA 2VQUA 3POIA 1NLSA 3E97A 1U5XA 2KM2A 3GYDA 4HN0A 5BNQA 2Y34A 5EYYA 4P02B 4KH9A 3LB9A 4OZXA 3ASIA 3TN92 2W1QA 3J7HA 4CUAA 3OD0A 4RFT0 1G6NA 4N7UA 3OTFA 4CEYA 5A70A 3AZVA 4Q0SA 3HIFA 1Z0HA 3SNMA 3VZMA 2QQOA 1UZZA 4E4ZA 3O1MA 1RUD3 4BQ2A 1OUXA 4AQTA 5JWPA 1NCRB 2FZ2A 2ATFA 5FZAA 1O3QA 1JYTA 2ZGLA 5CFDA 1ASJ1 3QBQA 4FCAA 1W6PB 2R041 4QKNA 4EROA 1ZZ9A 1MEC1 1O5UA 2O8QA 1A3KA 3O14A 3W21A 2FCUA 2BYVE 5L7OA 3ALQA 2A6XA 2FCVA 2VGDA 2Y6HA 2ZAHA 3I4IA 3PL0A 2YFZA 4O61A 4Y1XA 2JE9A 5FZLA 2VR4A 4WVMB 1LU2A 1PVXA 5CFCA 2CU5A 2OQ6A 4WM7B 2R1BA 2ZGRA 3I2JA 3HN3A 5GZCA 2F17A 4XXAA 1QY4A 1EV13 1AL0G 4CPBA 5JOWA 2VW1A 1VBC3 1N1TA 2XLFA 4BDVB 4YVWC 5JR2A 1DQ2A 3VBHC 4BHPA 1A8MA 1PMIA 3OBTA 5EFUA 1QJX3 1DLLA 2AGSA 1ZBE1 2DCZA 1SFPA 2XXZA 2YUEA 4FXKB 2ZPXA 1WWYA 3M4FA 3OY8B 3LPGA 4KL1A 4PDWB 4CEWB 1W8WA 3LEGA 2VVFA 4NHMA 2O14A 3H50A 1IS6A 3HBZA 5JI7A 3N9PA 4MXWA 3WDWA 3AX4A 4R9DA 3POWA 4B4QA 5B4XA 3MUZ1 3RI8A 1Y9MA 2OX0A 1H8TC 1SLLA 4V1PA 3K46A 1DHKB 3CIHA 4Z07A 4D94A 1BYHA 4W6WA 3N9LA 2NP0A 4XE9A 3WOGA 4J25A 4LOSA 3E5XA 2OQ7A 1NY72 3WHTA 1ULDA 4H55A 1LOGA 1EY2A 2VOXA 1O59A 1S0EA 3Q8EA 2X5IB 5T5JA 4CP9A 1TMF2 3MV11 5C8CA 4I3PA 4M3CB 3VKNA 1CZSA 1I1EA 5D8AA 1OLME 2B39A 4MGKE 1T6BX 1J59A 4NUBA 5IJRA 2R062 1YHFA 4GKYA 1HB4A 4AAXA 2I74A 2VOTA 4I02A 4QM9A 4DUVA 3PIJA 4QB2A 5FP7A 1VE0A 4KWKA 1JN2P 5F8PA 2JG9A 2GC2A 1UAIA 1XNBA 1RHI1 3AK0A 3FUQA 3RVHA 2WT1A 3SKVA 5KXCA 2JECA 2YMZA 1VBA2 3I2DA 1RMU2 2RM22 1A8DA 2DVAA 2GC3A 1CX4A 1AF9A 2W9XA 3BTAA 4QM8A 1C8NA 3DGTA 3DXTA 3E1F1 3M3CA 5DDJ1 4COVA 2WO1A 4YGCA 4UOJA 4DUWA 5F6LB 4C90A 1GSLA 1GWMA 5FZ0A 4MGZE 4Q0PA 2EXHA 4YVSB 3MFCA 3AB0A 1D4M3 3R0RA 4DZGA 1R092 1WKYA 2A71A 3N36A 1GQGA 3KLSA 4JDOA 4P9YA 4HL0A 5F32A 4C91A 3N7KA 3ZR5A 2GC0A 3ILNA 5FPBA 1NE4A 2OUJA 4WM8C 2VMFA 2J1AA 5LATA 3NNMA 3U1XA 1WD4A 1XYNA 2A1XA 5CIRA 5L36A 3TRSB 4Z2AA 1X36A 3BN6A 1MVQA 2YPDA 5AFBA 2XJRA 2BOJA 4QXHA 1CIYA 3H1YA 1GU3A 2XDVA 3GZTB 2XOMA 2A6VA 4EJRA 5JIAA 1LCLA 1WMXA 2RMU3 1NXD1 1W6OA 2B8MA 3FFQA 3JQXA 5FZMA 4UI9L 4Y1ZA 3NV1A 4IE5A 4I30A 2W39A 2QTWB 4RGGA 4OVEA 3SQOA 1RUH2 1W04A 2EF6A 3B9IA 1X9PA 1ZA4A 3VD3A 3WP4A 4A7ZA 5BYNA 3OEAA 1YUDA 3ES1A 5JPMB 3GHNA 3OGSA 3TN91 1CESA 3VZNA 1WCUA 4COZA 1JBCA 2N7GA 4AFAA 2RS53 2ZKLA 4P9IA 3VBUA 4M3CE 4L11A 2DVBA 4XJZA 5A7WA 4NIDA 4AFMA 3M1HA 4Q8LA 1KFUL 4GH4B 1JYWA 5FMOS 1RUOA 5E1RA 2IC1A 1H1IA 1ENRA 4FFHA 3ZSEA 5DUWA 4ET7A 4FFIA 4LITA 2OIIA 1NCRC 1V70A 1K42A 1K3IA 2R30A 4Q4X3 1TNRA 3WQ7A 4JC1A 4DPNA 2YPJA 4URAA 2DBNA 2P37A 4B7KA 4AG4A 4ZHNA 1ND2A 4Q26A 4LO7A 1LAJA 3LGRA 3THCA 2K0GA 3BOPA 2DBIA 4YGDA 5T50A 2FCTA 5A7NA 3HNMA 3WP5A 1YI7A 1ZZBA 2J1UA 4WM7C 5I0TA 1WGPA 3NAPA 3VBOB 5K7PA 1KJLA 2YBPA 2RR12 3QLQA 4OZOA 2BUKA 1W03A 5L19A 2VXJA 1NA1B 2DU1A 3PVEA 4UXAA 5IW0A 4ATEA 1SDDB 2W1WA 3O1OA 5T55A 3A0NA 5LA2A 3WR0A 1UD1A 3FMGA 4AOCA 5LBCA 4PDWC 4YRDA 1S0DA 3WLUA 4CEWC 3C8XA 1UY4A 1AVBA 2VC9A 3AP6A 1V6KA 3IAPA 2AC1A 2TUNA 4WZFA 3ACFA 2ZCWA 2XGXA 2GMPA 2JD4A 3SHRA 3I3MA 1EUUA 2WZR2 4B7EA 3WXPA 1O6UA 2Y38A 3I2IA 1NY71 3BPZA 4OMDA 3N9MA 5A32A 1K5MA 3O1SA 4GQ7A 1JYIA 2QNKA 3NRUA 5FYZA 1STMA 4QAWA 4UFIA 3AZWA 2Z42A 4XDPA 4QB1A 1TMF1 3WW4A 4A6OA 3F2ZA 2PYTA 4RR3A 2X5IC 2FMYA 4LBQB 2BOIA 4XEZA 3UNPA 1LGCA 1W0NA 2R072 4DXRA 3H9AA 4XJAA 2R061 2VCAA 4BQ1A 4QX0A 1KGYA 3S6PA 3H8UA 1A34A 3FN9A 2AEYA 1HIXA 1ULFA 4OULA 2W68A 5A7QA 3U0ZA 5CBLA 4BZ4A 4JHZA 3N4MA 5IVFA 4OFGA 1VBA1 3W58A 1IPSA 1RMU1 2X09A 3EXUA 1XU1A 5FUIA 4WVVA 4Y1YA 4Q4Y3 5A6QA 1H1MA 1AR82 2VTXA 1W05A 4XFFA 3ZMOA 1GP6A 3EB7A 2WQ8A 5A7OA 1G9DA 5KHGA 3KV6A 3GCWA 2Q1FA 5FO7B 3RYKA 4ZPIA 4Z1VA 4AI8A 5TSWA 4AEKA 2FDHA 5CZKA 4FSJA 4U36A 1NCQA 1S0CA 4QHZA 1R091 5GLVA 2MHFA 3U37A 3GALA 3OPWA 4YVSC 3UKTA 1HRV3 2ZX2A 5JSRA 3TWIA 4E4DX 2BGCA 2VZUA 1NQJA 3K4AA 2GDFA 3R6SA 5KHHA 1WW5A 3N3HA 5B2GB 4TZDA 2I07B 2G19A 2E7QA 1JHJA 2FBEA 2YB7A 3DKQA 3T08A 5A6YA 5FUPA 5JSPA 3VDDA 1SLBA 2CV6A 1JZ7A 4LQRA 2QDNA 4AHYA 1U12A 2XMLA 4BXFA 3C7OA 5SV8A 2Q8OA 1RUH1 3AMNA 4LHNA 4EN6B 4DY3A 4HBNA 1A78A 3DXUA 2HWB1 1JZ3A 1LOFA 2Y0IA 3P5BA 2A75A 4RSUA 5GZFA 3VZKA 2ZMNA 1JZ4A 1CQ9A 1AR92 3S57A 1KS5A 1XNCA 3HNBM 4A44A 3K48A 2YDEA 5J96B 1ZZ8A 2JXAA 5L7OC 1ZM1A 3MUY1 4IGOA 5BNOA 3HQRA 1W8ZA 3CHXA 1OA2A 4GH4C 3AMHA 3NNLA 3U14A 3U75A 1I3HA 1BCXA 4A7YA 2BEOA 3FWEA 4WV8A 5E89A 4LBMA 4Z92B 1RUI2 2VMHA 3WF1A 5EP9A 2J7MA 2V5YA 2YFUA 3JU9A 4Y26A 1R1A3 1WW4A 5K0UA 5IVVA 1F8VA 1IPJA 2B42B 3ES4A 1ACCA 2ADDA 1MS0A 2XJQA 3FLRA 4YZ3A 3TEZA 3GXUA 3GBFA 3VHOA 4CXXA 1MZ5A 2WS93 4EV0A 1UIJA 4IERA 2VE1A 4NVPA 3EO6A 1S2BA 5K0UC 1DFQA 2B9UA 2E31A 1HV0A 3ZR6A 2J1RA 2RR11 1JUIA 1KXGA 2A6WA 3U10A 5IFTA 3J8F3 1UZWA 4Q1RA 5FXZA 1HN1A 3G7DA 1SFNA 2XB6C 1NA1C 2XWBB 5BV6A 1OPMA 1EYBA 5KR7A 4IEUA 1CAWB 1JYCA 4QPGB 4NIAA 3OUJA 1PO13 1CD3G 3H3UA 4GZ9A 4OLLA 3ZXAC 2GNMA 2H0VA 3ZN6B 3M3IA 1KDKA 3S7IA 4IV1C 3T0AA 2ETEA 4BQWA 1UZ0A 1LOBA 2WNUA 4L2NA 3KD4A 3MFAA 2NMNA 2VZOA 4XMAA 3H8OA 1F5FA 2HWE3 4AVAA 4XC9A 4ZXKA 5DZFA 3LIGA 3H7YA 3RDIA 2FD8A 1PGSA 4AVTA 3VHRA 1W2AX 4A41A 2D6KA 1JI6A 2VMGA 4YG3A 3ZFFB 2JE8A 4IE7A 2ZGNA 2VCBA 1AXKA 1VBB2 4CXWA 2B46X 1MQTA 2UY8A 2BJSA 4GWIA 5FPZA 1SLTA 4KGQA 4IUGA 5FOBB 1URXA 2WRAA 2JX9A 4V2VA 2IVJA 3VKFC 1ULPA 5H9RA 5AC93 3B9CA 5FR3A 2QQWA 2R071 2WUHA 3N35A 4HSJA 4JDNA 4TXWA 4CU9A 5HXMA 3DYMA 4B4PA 5JZGA 3M70A 1LGNA 4YG0A 3J26N 3M8LA 1W6NA 4E9KA 1VBD2 5ABJA 5JOZA 2FDGA 2XKPA 3ZDSA 1UMIA 4PCRA 5FMOL 3VHPA 3W5MA 4XIKA 3URFA 1AJOA 3M7AA 2JDMA 2VVDA 5DAVA 3ZXGA 1NX9A 2E7AA 1QH7A 3ZSLA 4XURA 4TYSA 2VM9A 1NQDA 4LO8A 5LK5A 4CZSA 4QDRA 2P6CA 2DCYA 1NT0A 1AR81 1OC1A 1ZVFA 2LALA 1VALA 4JVAA 4R9BA 1QNYA 2ET1A 3GZAA 1CX1A 4N53A 5E88A 1HX6A 2NQYA 2XH6A 2CWMA 3ZFGB 1LECA 1GKBA 1CPNA 4AXOA 1WMEA 1MZ6A 2C26A 5KC6A 3WF3A 5JCTA 2ZJCA 1UQXA 3K77A 4FPJA 5LA0A 4XUPA 1BBT3 3ZKYA 4DO0A 1SQ4A 4AEDC 5HI0A 3O0WA 4Q0UA 2VTFA 3ZM8A 2D7FA 1W0OA 1HRI2 3WF2A 1YO8A 1AHSA 2WZEA 1I5PA 2WNVA 4UAPA 5J37A 5HCHA 4FI9A 1B35C 5FO9B 1FOD3 2A3WA 4XZPA 2WYSA 4D7TA 2CGOA 3SCFA 2NYYA 3WNNA 5KXDA 1RXFA 2LRPA 2HWD2 2W94A 4FQZA 3OBAA 1UOBA 2E26A 4Q0QA 5FRAA 5FZKA 4BMEA 4Q2FA 3NJVA 2XJUA 4HT1T 3CZUA 3RJRA 3S5QA 3KS7A 2PHUA 4JKKA 2RDNA 3IDAA 1GZ9A 4EYUA 4QWNA 4LIVA 3LCPA 4AI0A 2XVKA 4HG6B 1AR91 3WNMA 3V0AB 3IIAA 1S55A 4IGQA 1V9U3 1ZBA2 3FL7A 3WDXA 4EE2A 1PO23 3TEWA 1R082 4P9WA 4PF1A 3OBZA 4Q4W3 3ZOIA 1GOGA 3CJIB 1FXZA 2EICA 3VN4A 3C2UA 5HCAA 2O8OA 4LK6A 2D6OX 1RUI1 1ZA7A 3CMGA 2C6SA 1RTVA 2JE7A 2Y33A 3CF6E 2E63A 3K3NA 3OEBA 1YFWA 2C5DA 2E33A 2J1SA 2Q8DA 5IVJA 3WP3A 4PI0A 1QJEA 3KVAA 4Q4V2 4COUA 4BIFA 1YIPA 2PAMA 3ACIA 3TB0A 1D2QA 2AREA 2RDQA 2YG0A 4BYYA 4BOWA 1BEV3 2WDBA 3QH7A 5J1XA 2ET7A 4MG2A 2DUPA 4H7MA 4OHXA 4PLMA 1JS9A 2QQLA 2RE9A 2GMMA 1EPZA 3B02A 5F3IA 3ZDVA 2RJKA 4P00B 1C8M3 1H9WA 4R9AA 2DTYA 1L7QA 3CO2A 4NRMA 2JENA 4E2GA 2K9ZA 4QPGC 4AVCA 1QDOA 3RQ0A 1V6NA 2KD7A 1GV9A 2JDYA 2VNVA 1RUD2 4OI4A 3NW4A 4XF0A 5LY1A 1H0BA 3UKVA 1LEMA 1QWRA 2JDZA 4QMAA 4QU1A 3OGGA 3VKOA 3IDEA 5APAA 4IDZA 4HN1A 5E8AA 4ZU5A 4YZ4A 1CJPA 4IESA 2ZGSA 2X05A 3OD4A 1VRBA 3AMQA 4K9SA 1OLQA 3BU7A 4XFCA 5EJ1B 4BM8A 1CAXA 1VBB1 3GM8A 1DGWX 1OOPA 3HNYM 4IE0A 3VDAA 3IKWA 2UWCA 3ZFFC 2FDFA 4BWOA 1WCKA 1XJAA 2LTNA 4KWJA 1YWKA 4XQ4A 4Q0VA 3MO4A 4OHVA 4CU7A 1C1LA 2HYKA 4URTA 1DGRN 1YQ8A 4YYOA 1LJ7A 1BK0A 4YZ5A 3OGRA 5JOYA 1EV12 1YFXA 2WIIB 3MEPA 1VBC2 1VBD1 1BK1A 3NV3A 1FMD1 2DV9A 5HV0A 2P34A 4YW3A 1AYM3 3NJZA 3O12A 3LZZA 4CCNA 4AQ2A 1JZ2A 1JZ5A 4N9HA 1QJX2 5FZOB 3DCQA 4QXCA 2ZHMA 1RUJ3 2BWCA 4PQQA 2YXSA 4YARA 2R32A 1SPPB 1RVF2 1V6IA 1W6MA 2X10A 5AVAA 3USUB 1CR7A 5C4WA 5C7GA 2RS13 5FPLA 1OF3A 3T2TA 4EWEA 3RZKA 3T0BA 1XYPA 1OQ1A 2JG9B 4Z2WA 2X53S 3ETPA 2ZA9A 4W65A 3ON7A 3ZFGC 2ZGMA 3POEA 2QBXA 2FDJA 4OHYA 3N9OA 4GD4A 5EHDA 1RUG3 1SG3A 1W2OA 2V09A 5H9PA 4PI2A 3ME2A 4X6RB 3NVCA 4XF4A 5FY7A 4HZFA 2GALA 1HRI1 4FPGA 1JTZX 2QUOA 2RS33 5FJHA 1MS8A 1UYPA 3AFKA 2WBKA 4EWDA 2VULA 5A33A 4KNCA 1JXNA 1H8VA 4RS5A 5FXWA 4B1MA 4JV4A 3B00A 1JYNA 3ZX7A 2VMDA 2DCJA 5IFPA 2HWD1 5FZ4A 1O8SA 1AR62 1CONA 1XC6A 1CWPA 2R0HA 3J7MA 3JBG3 4Q27A 4IEYA 4EN8B 3R4SA 3WCSA 1JZ6A 1ZRFA 3ACGA 1FT9A 4AFCA 5C9AA 5AFEA 1MS1A 2GNDA 5IK8A 2ZGTA 5EPAA 3I3DA 3K4DA 2GSYA 5FPAA 3VBRA 1J58A 2AZ5A 3BIWE 2QQKA 4OQ8A 1AJKA 1DZQA 4CP0A 2PHRA 5F9TA 4LHSA 5L9VA 1G8WA 2BV4A 1ZBA1 3ATGA 3RZZA 4PJYA 5LY2A 2PELA 2WZPP 1UOGA 1R081 5K4LA 5FP3A 2TBVA 4AHXA 4OHWA 2IXLA 1D4M2 1XE0A 3IDCB 2G9ZA 3ZYBA 2BGOA 3CJIC 5A6ZA 2C9KA 1QF3A 2HBUA 5FYIA 1QJY3 3ZYRA 1BLZA 4C1XA 2BVBA 4AL9A 3SH4A 1IS4A 2XL7A 4Q4V1 3ELNA 4CDXA 1UPSA 1VRH3 5BNNA 4JTNA 2WWSA 3J7NA 1KQRA 5GZEA 1AL23 4BIOA 3ORJA 3AYDA 4I01A 1OD5A 2RMU2 2VBPA 3T2PA 1U5IA 1CAVB 3CNAA 1ODMA 3ZFEB 2O1QA 3AKPA 4ZU4A 3DEMA 3TBDA 4DB5A 4XACA 3UJOA 4Q5OA 4UW4A 1ZRCA 1V6MA 1BHGA 1W3XA 2ZZJA 3LWCA 4JGZA 5FREA 3VL9A 4PLNA 3HN1A 3WD5A 1XBFA 4ONUA 4AF9A 2BWAA 1VR3A 3V0BB 1Y9GA 1LB2A 1OXCA 3ZIXA 4D69A 2RS52 3INAA 2Q1MA 5CISA 4LHKA 4LK7A 4LLFA 2JG8B 2V72A 1GNHA 1YRZA 2G1MA 4I0WB 1RUD1 2D6MA 4UW3A 4TTGA 3RJ2X 1ZRRA 5HXVA 1OQDA 1MPXA 3AP5A 4UF0B 5DAWA 2GZWA 1LOCA 1W6QB 4DRVA 2CAUA 2EIGA 1US2A 4CDQB 1OD3A 1TNFA 1ALYA 1DGLA 3NL1A 4ORFA 5A1FA 1RJ8A 1DDLA 2DDUA 2VECA 1QGLA 5KWRA 5FY5A 4IEVA 4QKDA 4BB3A 4LUKA 2SLIA 2NM1A 3BTZA 1RITA 4QQLA 2Z2SB 4AYUA 5A3LA 5FBZA 3SKJE 4F83A 1EV11 1VB4A 4B3NA 4CDUB 5CB7A 2C24A 1VBC1 1EAH3 2IXJA 4QHOA 4E8DA 5JUVA 1DYPA 1RINA 2UYAA 5JXIA 1QJX1 3PUSA 4XQWA 5FZDA 2P4EA 3RNSA 4IV3B 3BB6A 4BXSV 2GMEA 1RVF1 3WV6A 2I45A 3SCHA 2QJVA 4NROA 4OCTA 5I8YA 4YFZA 3LA7A 4B8EA 3FZ3A 1RUE3 1QXJA 2VOWA 4KBZA 1G7YA 3PURA 5FMDA 3HT1A 3W9AA 1SCRA 1W39A 2WWUA 2H6CA 1KFXL 4NPLA 5FPVA 2UWBA 2PHLA 1YQ5A 2E6VA 2JG9C 4Y4YA 1O3RA 3OCPA 3DECA 4LKFA 1OI6A 5GJ6A 1MZFA 2UWAA 2ZGOA 3VB9A 4FOVA 4YVWA 3L9JT 2QDRA 2W52A 3VBHA 1U5ZA 2XVLA 2W87A 1UZYA 3AKSA 1LR5A 4JRLA 2PLV3 1MS4A 1GQPA 1AYN3 3H1MA 4FVVA 5T54A 2DUQA 1GOFA 1LGBA 3SXWA 4AHZA 3CDZB 1IQDC 4KI5M 3R05A 5KC5A 4META 2B7YA 3PJYA 1H8TA 1CAUB 3K2OA 3KCXA 4JGYB 1AR61 5T3NA 5SV5A 3UK9A 4MVTA 4YG6A 4CE8A 3HT2A 1FNZA 5FFOC 2L9LA 1H2KA 5GKAC 3H8RA 2QE3A 4FTBA 4ZZ5A 2DWRA 4FP3A 3E6DA 2BZDA 1YFUA 2I2SA 4LA3A 2HEWF 2OUHA 3B3QE 4QQHA 4Q4Y2 5DAQA 3GJBA 3C7HA 2EXJA 2Y0OA 3LEMA 4NIHA 4L97A 3ZN4A 2ZGPA 3RI9A 5F2WA 4NPRA 4XUQA 5FV3A 2ID4A 3B94A 4ZKTB 1GWLA 2CNAA 3B01A 1Z78A 1RB8G 5FP9A 4AE2A 1N3QA 3MIEA 4HPKA 4XJUA 1FI2A 1R64A 2WYFA 3H3LA 3LEKA 4YGBA 4QX2A 4OHZA 3WEZA 4NO4A 5FP8A 3ZMNA 3OGVA 4CCKA 1D4M1 4HETA 4FPYA 3T2OA 5GALA 2H6BA 1IHMA 1HRV2 2WAAA 4LR4A 2VZ3A 2WN3A 4XPVA 1RUC3 1X8EA 5L73A 1JW6A 5BUVA 2XQRA 4E8CA 3VD5A 5FZCA 4A7KA 1GOHA 1OSGA 1TEIA 2HWB2 3ILRA 3JCIA 5DMYA 2RMU1 4XIOA 2BPA2 3HJRA 4R9CA 2ZZQA 5BNPB 1ULGA 1OFSA 4X8PA 3P3NA 5L7OB 2VNRA 2ZHKA 3GBWA 3QCWA 4A6SA 4CTEA 3ZFEC 4HK8A 1Z7S3 2WKKA 3KMHA 4HSLA 3AP4A 4MADA 3QH6A 1U0AA 5AVPA 5FY9A 4BISA 3WUCA 2D5HA 2RS51 1W8HA 4WM8A 3I59B 1AR73 3AYCA 1HKDA 3F95A 4FFGA 5GLTA 4XHXA 3I2KA 1DZRA 3HWJA 1RUF3 1GLHA 2JG8C 2ZEXA 3OUIA 5DXDA 5FLJA 1QXRA 1WMDA 2UY9A 1UIKA 4DY5A 1UOFA 4MUVA 4MX3A 1LESA 3IPVB 1O4ZA 2PA7A 2VH9A 4UFKA 4Q4X1 3VLBB 1LOEA 2GAUA 4M0NA 3S0MA 4LHLA 2UU8A 4RGAA 1AUYA 2AH2A 1R1A2 2C9AA 5DZEA 4BPZA 4CYDA 1ODNA 1TZOA 2B4KA 2R49A 2Q4SA 3G6JB 4CDQC 2WSVA 5I0DA 3FUOA 1B09A 4KU7A 3OBRA 2WS92 4Y5SA 1EUTA 4S2HA 1Q8VA 5FKBA 4XFAA 4CDWB 4IV1B 2ZGQA 2IVIB 2AYHA 1Y7BA 4MGTA 4HKLA 5C71A 4CP2A 1OLMA 1WZXA 1HQNA 2IFWA 4CDUC 3PTYA 3ROUA 4XF9A 3NJYA 3WW3A 3ZYIB 1NCRA 3DPRB 1UY3A 3WCRA 2ENRA 3PUAA 5FYBA 1KJRA 1X82A 2HKXA 2PHWA 4M4RA 3D8CA 2IXKA 1SLCA 1W6PA 3ZYGA 4IV3C 5EJ3A 1PO12 1YIFA 1N1VA 2D3SA 2J22A 2W08A 2DVGA 3CLPA 1QEXA 4QX8A 1ZRDA 2ZMKA 4MYEA 1D7PM 4QGNA 1DYOA 4WVMA 4DXSA 2HWE2 2MPFA 3C7GA 5BXXA 4Y5TA 3J7LA 4QB6A 3TNQA 3ZXDA 4WM7A 2DYCA 5LBFA 1WW7A 3K75B 3BPSA 5IK4A 3RMXA 3DYOA 3B7MA 4D6QA 1YYNA 1XE7A 1RC6A 5ISLA 3KV9A 4TN7A 3Q8BA 3RPQA 1BMV2 5A3OA 5A7PA 4LE4A 3MF9A 4QPWA 3RRDA 2CL2A 5HBAA 2VMEA 1QH6A 3I2FA 4EN0A 2CDPA 4PDWA 3A21A 4K1ZA 3OY8A 1V6LA 4XQDA 1US3A 5AC92 1O7FA 2D6PA 2VD7A 4LUMA 1QMJA 1XB9A 2BFUS 2J1TA 2KR2A 1NCQC 4N7IA 4CUBA 5IATA 2VL4A 3I3EA 2FQPA 3I2GA 3LOBA 4LXLA 5KHJA 2CSGA 1NXMA 3MV01 2JDAA 4I3GA 3MIBA 4JGYC 1YJKA 2P3KA 4K20A 2VG9A 1MZEA 1UF2C 4RGKA 4TWTA 5FY1A 4BLIA 1MACA 1RMU3 2RM23 4UT5A 2D43A 1EP0A 3MW4A 4KG8A 4HMZA 2RV9A 2JDNA 1GP5A 2BW8A 3A23A 5LA1A 4Q4Y1 3RG0A 3AJZA 1GNZA 4AEDB 2ZX3A 3ILFA 4IEZA 3VDDC 4X6QB 2PMWB 3H0OA 2X5IA 2HWF3 5CYYA 5LEKA 1OKOA 4Q29A 3MLLA 4M3CA 3L2YA 1B35B 2HH9A 4LPLA 3ZKUA 5LASA 2YC0A 3DV8A 1SDWA 3N7LA 4FPCA 1W99A 4Y24A 5FIXA 4BQXA 3KSCA 1QOSA 1BBT2 1DF0A 1PZ7A 1HRV1 1W9FA 1SBFA 2P1BA 4HKWA 1T6GC 4A45A 1SBEA 2AEZA 2MNGA 3U4SA 4HFSA 3WNLA 4K6BA 3FLTA 2DFCA 4GA9A 5C3RA 2G9FA 1PIV3 3VZJA 1QQP3 2EXIA 3AZYA 1ZREA 1C5HA 1YQ6A 4YM3A 5KHKA 1XPWA 4G9SB 3RYPA 5JDBA 4CRQA 1VP6A 1FOD2 1MS5A 4LBQD 2JIJA 4N43B 2FDKA 2VZRA 1BZWA 2CWSA 3DYPA 5CA6A 4Y22B 4OI1A 5BNPC 5EZWA 2E32A 3BYWA 1S0FA 2Y26A 1HV1A 2YY1A 1F15A 3POYA 4GXLA 5LCWL 4YVSA 3SLIA 1UO9A 2Q0AA 3BODA 5DUXA 1VPHA 3ZO0B 4HVQA 4COYA 2YC2A 1GZWB 3MLKA 4P9LA 5CG9A 4QHBA 5FZHA 3SITA 2HYXA 3L2HA 4H2AA 5FY4A 3OUHA 1DCSA 2OPKA 2GU9A 4Y4RA 4IEPA 3ZYPA 1V9U2 3PMEA 4CU8A 2CAVA 5A3PA 4D0QA 4AHWA 2OT7A 5G04L 4LKEA 4Q4W2 4QX5A 1W28A 2ILMA 3AP7A 2WAOA 1LEDA 1QJZA 1ZX5A 5D1IA 3WNOA 3J9SA 3IT8A 3UYJA 3BALA 2WLQA 5H9SA 1KEXA 1R1A1 1UNBA 5M0TA 5FPXA 1GZTA 5ERLA 3WDVA 5DG2A 1FX5A 3VBSB 3AM2A 5FZ1A 1W06A 1OH3A 2WS91 4D6SA 2JJ6A 2VUJA 3KWVA 3IWZA 1BEV2 1PGW2 3U78A 4XUOA 2QQPA 2ZOEB 5FYTA 4CDWC 3PNAA 3I7DA 4GH4A 3J8F1 3M2MA 1DQ4A 4CU6A 2MEV3 1FV3A 2ZEZA 4QPIB 1GICA 2KXLA 1J3QA 4O65A 4L9BA 3MPBA 4XDOA 4WVZA 1C8M2 4IW3A 3DPRC 5IVCA 2DCKA 1PO11 2JDKA 4P9GA 2GH8A 4Y20B 3VDDB 3JD73 4BU2A 5KBFA 4CA9A 5JVVA 2QQMA 3BGAA 5LK7B 1C3HA 5ABJC 2B5HA 4XBLA 1HN0A 3OYWA 1KITA 2IXHA 3VKMA 4A42A 2HWE1 4ISQA 2WZR3 3AVSA 1PM7A 2BU9A 4RQPB 5CNAA 4BK4A 5LEJA 4AI2A 1WCQA 4NPMA 4D7YA 4K1YA 5EIYB 2QQVA 2VQ0A 1ST8A 4NRQA 4QGMA 2VW0A 1DZTA 3HPNA 3VBOA 1W9WA 4L0PA 1BMV1 4YZ2A 2EXKA 3N7JA 2XVGA 2LROA 1NA1A 4YFWA 1FMD2 3O1TA 3O0VA 1LOAA 2PAEA 5AC91 3MW2A 3FJSA 2ZACA 4QU2A 4OMCA 3WP6A 3BU0A 1R1ZA 4NAOA 4PIYA 4MZUA 3ZLIA 1RIRA 1OMIA 1XYOA 5IVYA 1LU1A 1GUIA 4TSVA 2WFF3 2QZ2A 5E6HA 1ND3B 2JD9A 1AYM2 2VBDA 4Z8BA 3BOWA 4LIUA 4BH9A 1QXPA 2R1DA 4AVBA 4O7XA 1FYUA 4FPLA 1RUJ2 1H2NA 2XL9A 2Q5TA 1PHMA 1OH4A 3HVDA 3PHMA 4JDMA 2RS12 3HQUA 4U2AA 3RWNA 1WMFA 2VMCA 1OVPA 1XE8A 3I2HA 1GBGA 2GNTA 1H6YA 3SISA 5GZDA 1WCDJ 5FQ0B 2WLPA 2V4AA 5HV4A 2VTXJ 1W8NA 4LBQA 4N90A 2Q8CA 2ZGKA 1V6OA 3PVNA 3ZXLA 1X8MA 1RUG2 5ACA3 3POJA 1BBT1 4KQ7A 1UY2A 1PK6B 1YI9A 1NYWA 2BVVA 2VZPA 3AL5A 4XUNA 1FPN3 3P3PA 3TEXA 1JUHA 4XBNA 3RSJA 1F5JA 2ZAAA 2RS32 3PMSA 1UOJA 2IXIA 4G3YC 4MLOA 5C3PA 2JEMA 1UCXA 5IVEA 4BQ4A 1ZZCA 2D5FA 1FOD1 1ZZ6A 5F37A 1LKNA 3H8XA 5FZ7A 4Z82A 2WR9A 4GB33 3NKTA 2BDRA 4N43C 1KD7A 3TAYA 2C4XA 3HOBA 5F6KA 3ZXJA 3A0KA 5T5PA 2ZHLA 4HOOA 5C8CB 2YHJA 3QOPA 5JAXA 1DQ1A 3NV2A 4INDA 3MLJA 1LULA 2VCMA 1E5SA 2WFPA 2VZTA 1POV3 3LE0A 3NJXA 4ISRA 3A4UA 3ZVXA 3RZHA 3T1LA 3KV5A 4HANA 4UYBA 4CEYB 4QXKA 1XXNA 1V9U1 2XLGA 4DINB 1YFYA 1BVP1 1S2KA 5GLZA 3VHNA 3OF1A 4Q4W1 5CFDB 3WG2A 1G86A 4C8DA 5F3CA 1HB3A 5FUNA 2BFUL 2XJVA 3A22A 4XJWA 1W8OA 3PUQA 4F3JA 2VW2A 2R6QA 1WA6X 2EIDA 3FLPA 3OPZA 5FY8A 3O0XA 2XBO3 1LTEA 1X50A 5T52A 2R16A 2XUMA 3MGUA 3ZXKA 3S7EA 4HLTA 1TME3 1V00A 5D21A 3T4VA 3WW2A 5CAZA 3GJAA 1UN1A 3T30A 2UYBA 5CFCB 3WQBA 1VRH2 1BVVA 1LHVA 2IFRA 3VBSC 3AYAA 4A4AA 1AL22 1V6JA 4GAZA 3PVBB 4K8FA 1BEV1 1PGW1 2DFBA 2ZEYA 1YLLA 1ENSA 4P9JA 3UL2A 2VO5A 2J1EA 1ULOA 3DKWA 3WX5A 1N47A 1VBE3 3FBYA 4AFBA 2CYFA 4MHUA 3ZYHA 4CCJA 4FPOB 4OI2A 3WG3A 2ARAA 1C8M1 1UPIA 2QQUA 1C57A 1J84A 1O91A 4FP2A 4QPIC 4AR2A 4CCEA 4TLFA 3JQWA 1YQCA 4MXWB 4A3XA 2VQAA 4NN0A 5A3NA 3RZMA 2XONA 2WO3A 3LA2A 1F35A 4ASKA 4NE9A 1RJ7A 3DUIA 3GHMA 1DGWA 1PVC3 3CQOA 2XWJB 5FMCA 1G9AA 1QJU3 2J42A 3OSDA 3PDQA 1WLWA 3WT3A 4L92A 4RQPC 4XZUG 2VUAA 3SMHA 3ZSJA 1L3JA 3SCGA 4LORA 5C5TA 5DQ0A 2ZS6B 1OT5A 3D6EA 1Q8OA 1F9KA 1XNDA 1WLCA 1CVNA 1SLAA 5E16A 3VBFA 4CP1A 2DVFA 4CP9B 4FBFA 5C5UA 3D0JA 3GDBA 2VOVA 3UGFA 3KGLA 3HAGA 1UXZA 3P6BA 1CAWA 2WZ8A 2XHKA 4QPGA 4UFHA 5D8AB 1PM4A 1QDCA 3CJXA 3E5UA 1JU3A 2WO7A 2WN2A 5FCCA 3SH5A 3ZN6A 2XJTA 3FHQA 4FPHA 2ORXA 3DN7A 2PFWA 4CCOA 5CKMA 1EAH2 3E6CC 1AYM1 1Q8QA 4E27A 3IBMA 3MPPG 1XOYA 2GN3A 4LTAA 5CU1A 1ND3C 5T5LA 4B29A 4SBVA 2EAAA 1RUJ1 5CKQA 5JXHA 4XBQA 5LW9A 1M4WA 2NZ9A 5IAXA 5I0UA 1UX6A 3ZFFA 2RS11 5IUQA 4E2SA 2ZMLA 1RUE2 5FYMA 1JU4A 1J83A 4NOTA 4KU8A 5F39A 3ZSKA 4AQSA 1YNAA 4MGSA 4LO5B 1QU0A 5GLUA 2HLEA 2LS6A 2F6BA 3RFRA 3IIIA 4PHZA 1HXS3 2OPWA 4RHV3 2D93A 5CVRA 1RUG1 1VMFA 2VZSA 1X9TA 3FC0A 3ZSMA 4DUXA 2W1UA 4RL7A 5FP4A 2RJ2A 2PLV2 1PK6C 1XSQA 3H1WA 1AYN2 1W8TA 2XPJA 3D4KA 2RS31 4X8NA 3IDBB 5F2SA 1DG6A 4JKLA 1SHWB 2JB8A 2PHTA 4GMP3 4DOUA 4FAHA 3POGA 4EN7B 2XR4A 4K40A 1BQPA 3LDRA 2HWD3 2AR6A 1W6OB 3M3OA 3NKGA 2XG3A 3T1MA 1PZ8A 4JQRA 2WT0A 2A6ZA 5J09A 3ZFGA 4XXPA 1W8UA 4W4ZA 2ADEA 5FZFA 4PBPA 5I8SA 3LDKA 4HKOA 3C3VA 4PT6A 5FBJA 2GH2A 2O0OA 4FOYA 4AGVA 5BNNC 1S4CA 3VD9A 5FAXA 3VBUB 4BE3A 5A7WB 1REDA 3RZGA 1RL3A 1Y4WA 2YV8A 4CEYC 3WZ1A 1VAVA 3W20A 2C1FA 4ZU7A 1VB2A 1K45A 1OPOA 2HWC3 4MV2A 1W9TA 1ENQA 3LD8A 1COV3 3NV4A 3WQ0A 2DURA 1JODA 1QJFA 4PF5A 3VKLA 2YU1A 5CFDC 5FXVA 3MIHA 3NSTA 4NIGA 3B5LB 1NLQA 4ZZ8A 1WBFA 4HK9A 1W3VA 3SEEA 4FXGB 1RUC2 3KT1A 3NMBA 3N9NA 2D6LX 1ND2B 4XETA 3OG2A 1CZTA 1LRHA 1OA4A 3FHAA 1VRH1 3WHUA 3PU3A 1AL21 4BQYA 2JWPA 2RHPA 5CADA 5CFCC 4BMBA 3NAPB 4G4FA 4AEJA 1UMHA 3V0AA 3KT7A 3PU8A 5FZ8A 1Q56A 4NIIA 4UFJA 1H6XA 1Z7S2 2WC2A 4QQOA 4ATFA 1ASJ3 4XTMA 3FE5A 3CJIA 4MGIE 4A3ZA 3TNPB 1SBDA 2R043 2ES3A 2EIBA 1MEC3 2D3RA 2JDPA 4BA6A 3KVBA 3NWKA 4I0AA 4QQPA 4COWA 1AR72 1X33A 3MIDA 1W2NA 3LOIA 4Q4X2 2FMDA 3AJYA 2RDSA 1J1TA 5DUVA 1RUF2 1M06G 4CSWA 4GALA 4P08A 2ZHNA 3ZYFA 1POV0 1UWWA 2QQJA 5C6CA 2GN7A 2QZ3A 1DQ5A 1N1YA 2ARXA 1P8JA 4XF3A 2DTWA 3KHBA 3B93A 1NUKA 3UJQA 3PVOA 3LFIA 4K7JA 2G9GA 4LKSA 5A32B 3WG1A 1K5MB 4W6XA 1DQ0A 3WDUA 5LA9A 2VNGA 4O9EA 1VMJA 5DUUA 5JI9A 1ZBE3 1SEFA 4HVRA 2VY0A 3CL1A 4RR3B 1H2LA 5C8CC 3MDPA 4DXTA 1F2NA 4XHBA 2QQNA 2VZVA 1UU5A 5D8AC 4F7ZA 2CTVA 1XNAA 2Q8EA 4CUGA 1D2SA 3ACLA 1OURA 1W90A 1EAH1 2P3IA 1UU4A 2A3YA 4QPYA 3IN9A 3PJQA 5GM0A 3WW1A 5F1RA 3R4DB 4NHKA 4LBLA 1RVF3 2K46A 1REFA 5F5CA 3TOJA 5LWBA 1O4TA 1PGL2 3M3EA 5FLHA 2WABA 3JB4C 4KWLA 5FYUA 2OZ6A 4FTSA 5L9RA 1N3OA 1CJDA 3NNGA 5FJKA 3C7EA 1RUE1 4W8JA 3WF4A 1AXYA 5EXOA 3WDTA 3NQHA 2WNOA 4V2WA 4LMFA 2BNNA 3ITQA 1PX4A 5FK8A 4YPJA 3KT4A 4QD2A 2Y8KA 4ZY9A 1QHDA 2JKXA 1UU6A 4YM0A 4TLGA 1E5RA 3VZLA 1Q8SA 4E2QA 3KCCA 5FZIA 3I3QA 2XHNA 1NCQB 4AVVA 1NAEA 2VU9A 4KGGA 3THDA 1QNWA 5FZGA 1LENA 3MIFA 4FFFA 3O1RA 5EJZB 2PLV1 4R4ZA 2K2SA 1AX0A 1AYN1 5FZOA 3HBKA 2OVUA 4CXYA 1RHI3 2ZKNA 3OB8A 2A3XA 5B4NA 1SPPA 4MO3M 2VPVA 2A70A 3LIHA 3PTRB 1AX2A 1S2EA 4R52A 4XDQA 1EPWA 5FZ6A 3USUA 4BQ5A 3APBA 1AR63 3VGIA 2RDRA 4YW2A 5ANNA 1CN1A 1U5YA 2F4LA 3LFMA 4MHRA 5DDJ3 2D97A 2NN8A 4W6YA 5I0SA 3BTXA 2Y6KA 1H4GA 2VJXA 5C3SA 4QX7A 2WJSA 3PLQA 2ZX4A 3THPA 4XABA 1GFF2 3O5SA 3RZJA 2B45X 1IS3A 3GGLA 3KQRA 3AXEA 2VAUA 1XSRA 2YGMA 4NMIA 1JOBA 2HBTA 3IZOA 3LSDA 4XAAA 4DFSA 1J3RA 4MOAA 1OA3A 2HWF2 3VBUC 1L7RA 5DN2A 3RWKX 1RXGA 4NHYA 2Q30A 4MGQA 3RS6A 3ZXEA 5BNOB 4EQVA 1AX1A 3FFZA 4ARYA 5CKNA 5FYHA 3KCYA 4UW6A 2OS2A 4KBBA 5IHRA 4WVWA 2Z69A 4HXCA 3OPTA 1CIWA 4XYXA 4HONA 5J36A 3ZIWA 4M4PA 5K0UB 4FOQA 5FZ3A 1QIQA 1RUC1 3LEIA 1PIV2 4I2OA 1FATA 1QQP2 3TN93 1ND2C 2A6YA 1NKGA 1F4HA 4QDSA 1Q5OA 2AUYA 3EYPA 1G9BA 3MHZA 4ASMB 5IK7A 4LEJA 3R4UA 1LHNA 4JTOA 3WDYA 1RGSA 2Y6LA 4J6GA 1LODA 2DVDA 2FHRA 1RYYA 3NAPC 4GMP0 5FKCA 4J1WA 1Z7S1 2VUDA 3MF6A 4EWAA 1YC61 3T0DA 4PIXA 1S0JA 4J1XA 1PMJX 3KM5A 4NJ4A 2VOKA 1AR71 1TG7A 1C4RA 1YJLA 2NLRA 4Y3OA 3CU7A 1NLRA 3UGGA 2W3JA 2BQPA 1RUF1 2WNUB 4D6RA 5JPNB 3O1UA 1PX3A 2NPIA 3CKHA 2OYZA 3POBA 1SACA 3SEPA 4IGPA 1ZRIA 3LDBA 5JMOA 3VL8A 1VIWB 4AAPA 1JHNA 2RJLA 2TNFA 2YGLA 4C1WA 3NNJA 4JQTA 3OGJA 1CAVA 5DAXA 3T09A 3ZFEA 3OYWB 3W5NA 1W0PA 5KHIA 4PQ9A 4IQPA 1MQTB 3MBWA 3WINE 1K5MC 3GZEA 1O8PA 3J8F2 5BPXA 4NHXA 1UZVA 3IM0A 3ZXFA 4YW7A 4H3WA 1LHOA 4M3CF 3UESA 3V0BA 1KS4A 1ZNPA 1XRUA 4RR3C 3KHCA 2BBVA 5JZGB 1LNSA 5JR7B 2JG8A 2A73B 4R4XA 1ENXA 1W6NB 4RN5A 3UT0A 5ABJB 5LRSA 3GCXA 5EYXA 2MEV2 2D98A 1PGL1
chains in the Genus database with same CATH topology
4TLGA 5LZ6A 1OLME 1O6UA 4UYBA 1OLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TLG A;  5LZ6 A;  1OLM E;  1O6U A;  4UYB A;  1OLM A; 
#chains in the Genus database with same CATH topology
 4UF0 A;  4DS0 A;  3FBM A;  1O5L A;  1W6Q A;  4FPF A;  3V65 A;  2BP6 A;  4D8M A;  1DBN A;  1UMZ A;  3FX3 A;  3WVJ A;  4OUM A;  5JLV A;  2HEY F;  2Y6J A;  4CDQ A;  1ULC A;  3JD7 2;  2HEV F;  4N53 B;  4I09 A;  1W2T A;  4ZON A;  5LBB A;  3BUC A;  5IVB A;  4P9X A;  1TMF 3;  2EAL A;  2Y6F A;  3AKQ A;  1SCS A;  3NNF A;  1IZ3 A;  2PN5 A;  1DP0 A;  3AC0 A;  4UBH A;  4UWD A;  3WNK A;  1WCS A;  4CEW A;  1S0G A;  3C7F A;  2XJP A;  3ECQ A;  3M3Q A;  4BCU A;  4KWU A;  2WA3 A;  1REE A;  2R06 3;  5L9B A;  4CDU A;  3NO8 A;  3HD8 B;  4LBK A;  4AEM A;  3ETQ A;  1NOV A;  4FOW A;  5K8S A;  4AZZ A;  3H3Z A;  3WG4 A;  5C3Q A;  1OHF A;  4YM1 A;  2P2K A;  3LQC A;  2WNV B;  1XNT A;  4IV3 A;  5DPN A;  5I8T A;  1VBA 3;  4XFG A;  4CVU A;  1OBN A;  1DIW A;  2QKD A;  4CCL A;  4M0H A;  2R7E B;  2JDH A;  1GNY A;  1OVS A;  4WZC A;  2WFF 2;  4M01 A;  4H7L A;  1IKQ A;  4DXZ A;  4OUS A;  3WSO A;  4UFL A;  1Y43 B;  1D4V B;  2XUE A;  4JAA A;  4XAE A;  2RM2 1;  4P14 A;  3I49 A;  3HEI A;  2ARC A;  4S2F A;  5FZB A;  2YRO A;  3AZZ A;  3HQX A;  1R09 3;  1QOT A;  5GLW A;  5FDB A;  1LOF C;  4B1L A;  4JZR A;  2XJS A;  4R8H A;  3U07 A;  2HWF 1;  3AMP A;  3UGH A;  2OW4 A;  1K5J A;  1SZB A;  4O9G A;  2X8K A;  2C0Z A;  4RD7 A;  3KF3 A;  4YNI A;  2CGN A;  1UX7 A;  4IE6 A;  5BNO C;  4XCB A;  4ZS3 A;  1UY0 A;  1FNY A;  5FWE A;  5ACA 2;  5A7S A;  4MGY E;  1CAU A;  4YW5 A;  5A1A A;  3J4U H;  4JGY A;  1H9P A;  4K3U A;  1WW6 A;  4QQ2 A;  5J3U A;  1UY1 A;  1FPN 2;  1DLC A;  2WO2 A;  1RUH 3;  3RZL A;  1PIV 1;  1MVE A;  1QQP 1;  1W9S A;  2YU2 A;  3AKR A;  4XW3 A;  4QXB A;  3WNP A;  4BJ0 A;  5C8W A;  3BI3 A;  2HWB 3;  4DIQ A;  3VUO A;  2VXR A;  1H1A A;  1HQW A;  1TQ5 A;  3MZH A;  1W8F A;  1E57 A;  3H42 B;  1MS3 A;  3ACH A;  4XCA A;  4QKF A;  1LHU A;  4YSF A;  5FYS A;  2VUC A;  2LM3 A;  3AXD A;  2ZTN A;  1N1S A;  4LUL A;  4GB3 2;  5C70 A;  3ZPO A;  2PQQ A;  4NRP A;  4N8M A;  5FZE A;  3VZO A;  4DQA A;  1GQH A;  3X29 B;  5IK5 A;  1PO2 2;  3D5O A;  4KG0 A;  3EMR A;  2BNO A;  2V73 A;  1JH5 A;  3BKZ A;  1W9Y A;  2Y6G A;  4EZ4 A;  2CY6 A;  4AI3 A;  1K12 A;  1HW5 A;  2GP3 A;  1F31 A;  3ZPY A;  2DF7 A;  2BRT A;  4YZ1 A;  2V5D A;  1MR5 A;  4YWA A;  3LPF A;  5IAV A;  3UV9 A;  2WNU C;  5FTT C;  4DMI A;  2SBA A;  4XF1 A;  2QQI A;  4D3W A;  1DQ6 A;  3ST7 A;  2D6N A;  3BVC A;  5A1L A;  5DZG A;  1SFY A;  4AGG A;  1KRI A;  5BNP A;  4XFI A;  3MIC A;  4XUT A;  2RR1 3;  5LB6 A;  3W59 A;  5F5Q A;  4ZXE A;  4LBN A;  4OYU A;  2XBO 2;  1CAX B;  1KDM A;  1OF4 A;  1OOP B;  4Y1U A;  3RYR A;  2LW8 A;  3SC7 X;  3AZX A;  2EAK A;  1TME 2;  2EA7 A;  1HB1 A;  2OZJ A;  4OUE A;  1IQA A;  1MQT C;  5F3G A;  4CUC A;  3VD4 A;  5DAB A;  1YQ2 A;  5A3T A;  2PHX A;  2W46 A;  3AVR A;  3I59 A;  1JOJ A;  3PIG A;  4K8R B;  3VBO C;  1F4A A;  3N7M A;  4AQ6 A;  3AL6 A;  3D0S A;  3GBG A;  3ZYJ B;  3VBF B;  5JZG C;  3ZN5 A;  4AW7 A;  2IXC A;  1VBE 2;  2MEV 1;  2OA2 A;  3K51 A;  5F5A A;  1PNG A;  1OFN A;  3T4H B;  1IG0 A;  1UW8 A;  3H7J A;  3AYE A;  1UKG A;  3IPV A;  1W6M B;  4QKB A;  5FYC A;  2EVX A;  4PLO A;  2WQZ C;  5C4W B;  2WSU A;  1DYK A;  1I6X A;  1SLI A;  4IEX A;  1UL9 A;  3JD7 1;  1DGR A;  5JXJ A;  2IWG B;  2ZAB A;  2D40 A;  4A2U A;  5A80 A;  2D44 A;  1JMU B;  1PVC 2;  4UBG A;  5H9Q A;  3ENR A;  1WUV A;  4N53 C;  1QJU 2;  1D0G A;  4NWV A;  2WZR 1;  4JKM A;  2E9Q A;  4FTE A;  1AXZ A;  2DUO A;  2GP5 A;  2PHF A;  3QD6 A;  2R07 3;  4GKX A;  5F5I A;  4XFH A;  1J3P A;  4CDW A;  4IV1 A;  3LA3 A;  3IB3 A;  2PHD A;  4AK3 A;  2G4I A;  1UYY A;  2PAK A;  3EJK A;  1WD3 A;  3D82 A;  4EZH A;  4ES9 A;  3AFG A;  1MS9 A;  2P17 A;  1Y3T A;  2D3P A;  3POS A;  4DEV A;  3DPR A;  1TVG A;  1NE6 A;  2Y60 A;  3S5A A;  2LUW A;  1BKZ A;  2QVS B;  1CPM A;  1I5Z A;  4IEQ A;  5A33 B;  4CCD A;  1HJG A;  3THT A;  1ZZ7 A;  1PNF A;  2ZEW A;  4RS5 B;  2WNV C;  4CCC A;  4IXL A;  1O3T A;  5HPO A;  1UKR A;  1AR8 3;  4HVO A;  1VAM A;  4JCK A;  5LBE A;  2WFF 1;  1HDK A;  1T2X A;  4FO9 A;  4LOT A;  3HMY A;  4GWN A;  2BBA A;  4UW5 A;  1HLC A;  2GC1 A;  5C9A B;  4DNY A;  4AFD A;  2AEN A;  2XLA A;  3CZJ A;  3I8T A;  3IMN A;  3VBR B;  4XVH A;  4QDQ A;  1GP4 A;  5JOX A;  5JXG A;  1QKQ A;  4QX1 A;  4XTP A;  2E7T A;  2P5B A;  2ZGU A;  2JB4 A;  4ZS2 A;  5HCB A;  3U4X A;  1OQE A;  3PUI A;  3V64 A;  2Z79 A;  3OOX A;  3WUD A;  3GF6 A;  1VLN A;  5LRR A;  2A7A A;  2Y64 A;  3Q9O A;  5D2A A;  1IS5 A;  1HXS 2;  4IEW A;  4RHV 2;  4LJH A;  1VMH A;  1V0A A;  4AI1 A;  5I0R A;  3O1V A;  5CG8 A;  4ES8 A;  2UUR A;  5ACA 1;  3GZU C;  3KB5 A;  2YBS A;  2ZBJ A;  1IG3 A;  2Q1Z B;  1FPN 1;  1PZ9 A;  5J98 B;  3JBG 2;  3Q8C A;  2RG4 A;  4QGL A;  2P6H A;  4XJ8 A;  4YGE A;  5IT6 A;  4BLJ A;  3I2O A;  5HCF A;  2AAC A;  4RFR B;  5DG1 A;  4CDX B;  4FAG A;  5BNN B;  1WLT A;  4I0B A;  4JX0 A;  4GJY A;  5F3E A;  1OLR A;  4AED A;  1C5I A;  1AR9 3;  2BNM A;  2TEP A;  3VV1 A;  1ZYB A;  4AWD A;  1WLD A;  3PUH A;  1L7L A;  2W95 A;  4GB3 1;  2RVA A;  3AP9 A;  3T2Q A;  3UET A;  2E51 A;  4ASL A;  3BCW A;  2VNO A;  1B35 A;  1GR3 A;  3I3B A;  4JGZ B;  3TYJ A;  4F8A A;  1GAN A;  1PO2 1;  2IZW A;  2JDU A;  4S2D A;  4NR1 A;  4CCM A;  4W50 A;  1C1F A;  3CBN A;  1POV 1;  5J7M A;  1Q8P A;  1RUI 3;  4FPE A;  1VAK A;  1WA4 A;  2WIN B;  3EBR A;  4L99 A;  1JZ8 A;  3D3A A;  5IYY A;  3N9Q A;  2VQT A;  3WF0 A;  5CEH A;  3BIE A;  1JYX A;  3E5Q A;  2KA3 A;  1QJY 2;  3ABZ A;  4OQ9 A;  3AKT A;  2HWC 2;  1HB2 A;  1VJ2 A;  1QOO A;  1S1A A;  2QCS B;  4RA0 A;  3IAQ A;  1D0H A;  4LE3 A;  3HR9 A;  2ORZ A;  1COV 2;  2NMO A;  3POF A;  1LHW A;  4N43 A;  5FPU A;  4JRA A;  4AGR A;  4GIQ A;  5FWJ A;  1CGP A;  3MYX A;  1C28 A;  4ARX A;  4Y22 A;  1E5H A;  3Q8F A;  2XBO 1;  1Y9Q A;  4NHL A;  1TME 1;  1E5I A;  1WBL A;  1OOP C;  1HJF A;  3OJB A;  2PTM A;  5KXE A;  5J48 A;  3AMM A;  3EHK A;  1GZW A;  4FPK A;  1H4H A;  4H14 A;  4MH0 E;  2EIE A;  5ANQ A;  4MXV A;  4S2G A;  2FDI A;  5LZ6 A;  4EN9 B;  5I91 A;  5EWS A;  2VZQ A;  2F4P A;  4BQ3 A;  4OI0 A;  1VBE 1;  2Z5W A;  3MI8 A;  3O7O A;  4XFB A;  4LKD A;  4NWW A;  3VBF C;  2WQ4 A;  3LF7 A;  4GJZ A;  4YW6 A;  1CZV A;  4C0H A;  1ASJ 2;  5C3O A;  4Y33 A;  5IWF A;  2W1S A;  5JSO A;  4JHT A;  3GNE A;  2R04 2;  1FV2 A;  3JB8 A;  4IET A;  1MEC 2;  4IL7 A;  4Q1P A;  1OUS A;  5I93 A;  2W92 A;  1A6C A;  4LBO A;  5FYV A;  3K4Z A;  2ZX1 A;  4KMQ A;  3A7Q A;  1N3P A;  1VBB 3;  5C4W C;  5G05 L;  2VBB A;  1PVC 1;  1POQ A;  2BGP A;  4MSV A;  3T3Y A;  1H2M A;  1QJU 1;  5T5O A;  3VBS A;  1G9C A;  2WA4 A;  1I9R A;  4LO4 B;  4Q8K A;  3LKJ A;  5EV7 A;  4PIZ A;  3FHI B;  5F7U A;  3VDB A;  4FQ4 A;  4YVW B;  3SH3 A;  4IE4 A;  4C0B A;  1BXH A;  3P1I A;  3I97 A;  3VBH B;  1VBD 3;  2VMI A;  3KF5 A;  1FMD 3;  2DCT A;  2W47 A;  5FYY A;  2OKX A;  2PQS A;  4P5Y A;  2E53 A;  4E4H A;  2VZ1 A;  4AI9 A;  1XU2 A;  1ZBE 2;  4QPI A;  4DRR A;  3CEW A;  1GYK A;  2JIC A;  3JXS A;  5FZ9 A;  3I54 A;  1IOA A;  1G9F A;  1XQN A;  2ZX0 A;  4Y1V A;  1JOP A;  2X29 A;  5A3W A;  3USS A;  4Y20 A;  4LBJ A;  4D7S A;  2JIG A;  1H8T B;  3JZV A;  4RS5 C;  1GZC A;  4CPB D;  2BER A;  4IEO A;  4L8Q A;  2YC4 A;  4UFM A;  1YEW A;  2VVE A;  3EQE A;  3RMY A;  3DF0 A;  3S30 A;  4RQP A;  2WNE A;  5FMB A;  1TE1 B;  5JMC A;  1GWK A;  4P5H A;  2B9V A;  5FK7 A;  4E4S A;  4BK5 A;  5C9A C;  2QFE A;  4XMI A;  4LNV A;  1H30 A;  3VDC A;  5A3M A;  1S0I A;  4K21 A;  3VBR C;  1BJQ A;  1HRI 3;  2ERF A;  3LSE A;  2YZ4 A;  2P3Y A;  1NG0 A;  3B69 A;  2ZXQ A;  2XKO A;  4GWJ A;  4QX3 A;  4HPK B;  2CHH A;  2HJI A;  4QT6 A;  4WBB A;  5FXX A;  2W2I A;  3WY6 A;  2CDO A;  1J1L A;  3QAC A;  2OXB A;  2WT2 A;  4YLZ A;  1HXS 1;  4RHV 1;  4XIL A;  5EQU A;  1DU3 D;  2W5F A;  3UKN A;  4LA2 A;  2XQX A;  2YBK A;  1APN A;  4LLO A;  2IUW A;  4FT8 A;  5GZG A;  1IGO A;  2PXJ A;  2YYO A;  1ND3 A;  3MIG A;  3KV4 A;  3E6B A;  1S0B A;  2DU0 A;  3V56 A;  2VCC A;  2WWJ A;  4YW1 A;  3JBG 1;  2BTV C;  1HQL A;  4M00 A;  5FLI A;  1RHI 2;  3K3O A;  4AVS A;  4GMP 1;  5JIU A;  1IPK A;  5FY0 A;  1W2U A;  3TEY A;  2JKB A;  1YCI A;  4CDX C;  1UYX A;  1RUN A;  4LT5 A;  1XNK A;  5A6X A;  1YXW A;  3KZ4 C;  5BY5 A;  5FO8 B;  5FOJ B;  1JYV A;  5C33 A;  3BTY A;  2GNB A;  1O4Y A;  1UXX X;  1ZBA 3;  4GWM A;  4NAM A;  5DDJ 2;  1ULE A;  1X7N A;  2Z4F A;  2W91 A;  5A3U A;  1GMM A;  2V4V A;  1R08 3;  2J1V A;  5FQ0 A;  1IKP A;  3U11 A;  4YW4 A;  4PBO A;  3LAG A;  1O3S A;  5KXB A;  1FAY A;  3WQ1 A;  1NZC A;  4JGZ C;  1AZD A;  4Y5Z 0;  4WM8 B;  3VD7 A;  1UYZ A;  2H0B A;  4B4R A;  2CGP A;  1PK6 A;  4DEQ A;  2ARB A;  4SLI A;  2WL1 A;  4LO6 B;  2P3J A;  1Q43 A;  1OKQ A;  2A5Z A;  3KGZ A;  1Q3E A;  1ONA A;  2W0X A;  1QJY 1;  5K9Y A;  3IMM A;  4XOG A;  3O1P A;  2HWC 1;  3KQ4 B;  4Q4V 3;  4N9I A;  4YM2 A;  4ITC A;  3DL3 A;  3RGB A;  4XJ9 A;  1COV 1;  1NZI A;  2R0F A;  2FZ1 A;  4RYD A;  4GUL A;  3MW3 A;  5DAP A;  1SMV A;  3JUU A;  1PMH X;  3Q8A A;  3WNX A;  2VQU A;  3POI A;  1NLS A;  3E97 A;  1U5X A;  2KM2 A;  3GYD A;  4HN0 A;  5BNQ A;  2Y34 A;  5EYY A;  4P02 B;  4KH9 A;  3LB9 A;  4OZX A;  3ASI A;  3TN9 2;  2W1Q A;  3J7H A;  4CUA A;  3OD0 A;  4RFT 0;  1G6N A;  4N7U A;  3OTF A;  4CEY A;  5A70 A;  3AZV A;  4Q0S A;  3HIF A;  1Z0H A;  3SNM A;  3VZM A;  2QQO A;  1UZZ A;  4E4Z A;  3O1M A;  1RUD 3;  4BQ2 A;  1OUX A;  4AQT A;  5JWP A;  1NCR B;  2FZ2 A;  2ATF A;  5FZA A;  1O3Q A;  1JYT A;  2ZGL A;  5CFD A;  1ASJ 1;  3QBQ A;  4FCA A;  1W6P B;  2R04 1;  4QKN A;  4ERO A;  1ZZ9 A;  1MEC 1;  1O5U A;  2O8Q A;  1A3K A;  3O14 A;  3W21 A;  2FCU A;  2BYV E;  5L7O A;  3ALQ A;  2A6X A;  2FCV A;  2VGD A;  2Y6H A;  2ZAH A;  3I4I A;  3PL0 A;  2YFZ A;  4O61 A;  4Y1X A;  2JE9 A;  5FZL A;  2VR4 A;  4WVM B;  1LU2 A;  1PVX A;  5CFC A;  2CU5 A;  2OQ6 A;  4WM7 B;  2R1B A;  2ZGR A;  3I2J A;  3HN3 A;  5GZC A;  2F17 A;  4XXA A;  1QY4 A;  1EV1 3;  1AL0 G;  4CPB A;  5JOW A;  2VW1 A;  1VBC 3;  1N1T A;  2XLF A;  4BDV B;  4YVW C;  5JR2 A;  1DQ2 A;  3VBH C;  4BHP A;  1A8M A;  1PMI A;  3OBT A;  5EFU A;  1QJX 3;  1DLL A;  2AGS A;  1ZBE 1;  2DCZ A;  1SFP A;  2XXZ A;  2YUE A;  4FXK B;  2ZPX A;  1WWY A;  3M4F A;  3OY8 B;  3LPG A;  4KL1 A;  4PDW B;  4CEW B;  1W8W A;  3LEG A;  2VVF A;  4NHM A;  2O14 A;  3H50 A;  1IS6 A;  3HBZ A;  5JI7 A;  3N9P A;  4MXW A;  3WDW A;  3AX4 A;  4R9D A;  3POW A;  4B4Q A;  5B4X A;  3MUZ 1;  3RI8 A;  1Y9M A;  2OX0 A;  1H8T C;  1SLL A;  4V1P A;  3K46 A;  1DHK B;  3CIH A;  4Z07 A;  4D94 A;  1BYH A;  4W6W A;  3N9L A;  2NP0 A;  4XE9 A;  3WOG A;  4J25 A;  4LOS A;  3E5X A;  2OQ7 A;  1NY7 2;  3WHT A;  1ULD A;  4H55 A;  1LOG A;  1EY2 A;  2VOX A;  1O59 A;  1S0E A;  3Q8E A;  2X5I B;  5T5J A;  4CP9 A;  1TMF 2;  3MV1 1;  5C8C A;  4I3P A;  4M3C B;  3VKN A;  1CZS A;  1I1E A;  5D8A A;  1OLM E;  2B39 A;  4MGK E;  1T6B X;  1J59 A;  4NUB A;  5IJR A;  2R06 2;  1YHF A;  4GKY A;  1HB4 A;  4AAX A;  2I74 A;  2VOT A;  4I02 A;  4QM9 A;  4DUV A;  3PIJ A;  4QB2 A;  5FP7 A;  1VE0 A;  4KWK A;  1JN2 P;  5F8P A;  2JG9 A;  2GC2 A;  1UAI A;  1XNB A;  1RHI 1;  3AK0 A;  3FUQ A;  3RVH A;  2WT1 A;  3SKV A;  5KXC A;  2JEC A;  2YMZ A;  1VBA 2;  3I2D A;  1RMU 2;  2RM2 2;  1A8D A;  2DVA A;  2GC3 A;  1CX4 A;  1AF9 A;  2W9X A;  3BTA A;  4QM8 A;  1C8N A;  3DGT A;  3DXT A;  3E1F 1;  3M3C A;  5DDJ 1;  4COV A;  2WO1 A;  4YGC A;  4UOJ A;  4DUW A;  5F6L B;  4C90 A;  1GSL A;  1GWM A;  5FZ0 A;  4MGZ E;  4Q0P A;  2EXH A;  4YVS B;  3MFC A;  3AB0 A;  1D4M 3;  3R0R A;  4DZG A;  1R09 2;  1WKY A;  2A71 A;  3N36 A;  1GQG A;  3KLS A;  4JDO A;  4P9Y A;  4HL0 A;  5F32 A;  4C91 A;  3N7K A;  3ZR5 A;  2GC0 A;  3ILN A;  5FPB A;  1NE4 A;  2OUJ A;  4WM8 C;  2VMF A;  2J1A A;  5LAT A;  3NNM A;  3U1X A;  1WD4 A;  1XYN A;  2A1X A;  5CIR A;  5L36 A;  3TRS B;  4Z2A A;  1X36 A;  3BN6 A;  1MVQ A;  2YPD A;  5AFB A;  2XJR A;  2BOJ A;  4QXH A;  1CIY A;  3H1Y A;  1GU3 A;  2XDV A;  3GZT B;  2XOM A;  2A6V A;  4EJR A;  5JIA A;  1LCL A;  1WMX A;  2RMU 3;  1NXD 1;  1W6O A;  2B8M A;  3FFQ A;  3JQX A;  5FZM A;  4UI9 L;  4Y1Z A;  3NV1 A;  4IE5 A;  4I30 A;  2W39 A;  2QTW B;  4RGG A;  4OVE A;  3SQO A;  1RUH 2;  1W04 A;  2EF6 A;  3B9I A;  1X9P A;  1ZA4 A;  3VD3 A;  3WP4 A;  4A7Z A;  5BYN A;  3OEA A;  1YUD A;  3ES1 A;  5JPM B;  3GHN A;  3OGS A;  3TN9 1;  1CES A;  3VZN A;  1WCU A;  4COZ A;  1JBC A;  2N7G A;  4AFA A;  2RS5 3;  2ZKL A;  4P9I A;  3VBU A;  4M3C E;  4L11 A;  2DVB A;  4XJZ A;  5A7W A;  4NID A;  4AFM A;  3M1H A;  4Q8L A;  1KFU L;  4GH4 B;  1JYW A;  5FMO S;  1RUO A;  5E1R A;  2IC1 A;  1H1I A;  1ENR A;  4FFH A;  3ZSE A;  5DUW A;  4ET7 A;  4FFI A;  4LIT A;  2OII A;  1NCR C;  1V70 A;  1K42 A;  1K3I A;  2R30 A;  4Q4X 3;  1TNR A;  3WQ7 A;  4JC1 A;  4DPN A;  2YPJ A;  4URA A;  2DBN A;  2P37 A;  4B7K A;  4AG4 A;  4ZHN A;  1ND2 A;  4Q26 A;  4LO7 A;  1LAJ A;  3LGR A;  3THC A;  2K0G A;  3BOP A;  2DBI A;  4YGD A;  5T50 A;  2FCT A;  5A7N A;  3HNM A;  3WP5 A;  1YI7 A;  1ZZB A;  2J1U A;  4WM7 C;  5I0T A;  1WGP A;  3NAP A;  3VBO B;  5K7P A;  1KJL A;  2YBP A;  2RR1 2;  3QLQ A;  4OZO A;  2BUK A;  1W03 A;  5L19 A;  2VXJ A;  1NA1 B;  2DU1 A;  3PVE A;  4UXA A;  5IW0 A;  4ATE A;  1SDD B;  2W1W A;  3O1O A;  5T55 A;  3A0N A;  5LA2 A;  3WR0 A;  1UD1 A;  3FMG A;  4AOC A;  5LBC A;  4PDW C;  4YRD A;  1S0D A;  3WLU A;  4CEW C;  3C8X A;  1UY4 A;  1AVB A;  2VC9 A;  3AP6 A;  1V6K A;  3IAP A;  2AC1 A;  2TUN A;  4WZF A;  3ACF A;  2ZCW A;  2XGX A;  2GMP A;  2JD4 A;  3SHR A;  3I3M A;  1EUU A;  2WZR 2;  4B7E A;  3WXP A;  1O6U A;  2Y38 A;  3I2I A;  1NY7 1;  3BPZ A;  4OMD A;  3N9M A;  5A32 A;  1K5M A;  3O1S A;  4GQ7 A;  1JYI A;  2QNK A;  3NRU A;  5FYZ A;  1STM A;  4QAW A;  4UFI A;  3AZW A;  2Z42 A;  4XDP A;  4QB1 A;  1TMF 1;  3WW4 A;  4A6O A;  3F2Z A;  2PYT A;  4RR3 A;  2X5I C;  2FMY A;  4LBQ B;  2BOI A;  4XEZ A;  3UNP A;  1LGC A;  1W0N A;  2R07 2;  4DXR A;  3H9A A;  4XJA A;  2R06 1;  2VCA A;  4BQ1 A;  4QX0 A;  1KGY A;  3S6P A;  3H8U A;  1A34 A;  3FN9 A;  2AEY A;  1HIX A;  1ULF A;  4OUL A;  2W68 A;  5A7Q A;  3U0Z A;  5CBL A;  4BZ4 A;  4JHZ A;  3N4M A;  5IVF A;  4OFG A;  1VBA 1;  3W58 A;  1IPS A;  1RMU 1;  2X09 A;  3EXU A;  1XU1 A;  5FUI A;  4WVV A;  4Y1Y A;  4Q4Y 3;  5A6Q A;  1H1M A;  1AR8 2;  2VTX A;  1W05 A;  4XFF A;  3ZMO A;  1GP6 A;  3EB7 A;  2WQ8 A;  5A7O A;  1G9D A;  5KHG A;  3KV6 A;  3GCW A;  2Q1F A;  5FO7 B;  3RYK A;  4ZPI A;  4Z1V A;  4AI8 A;  5TSW A;  4AEK A;  2FDH A;  5CZK A;  4FSJ A;  4U36 A;  1NCQ A;  1S0C A;  4QHZ A;  1R09 1;  5GLV A;  2MHF A;  3U37 A;  3GAL A;  3OPW A;  4YVS C;  3UKT A;  1HRV 3;  2ZX2 A;  5JSR A;  3TWI A;  4E4D X;  2BGC A;  2VZU A;  1NQJ A;  3K4A A;  2GDF A;  3R6S A;  5KHH A;  1WW5 A;  3N3H A;  5B2G B;  4TZD A;  2I07 B;  2G19 A;  2E7Q A;  1JHJ A;  2FBE A;  2YB7 A;  3DKQ A;  3T08 A;  5A6Y A;  5FUP A;  5JSP A;  3VDD A;  1SLB A;  2CV6 A;  1JZ7 A;  4LQR A;  2QDN A;  4AHY A;  1U12 A;  2XML A;  4BXF A;  3C7O A;  5SV8 A;  2Q8O A;  1RUH 1;  3AMN A;  4LHN A;  4EN6 B;  4DY3 A;  4HBN A;  1A78 A;  3DXU A;  2HWB 1;  1JZ3 A;  1LOF A;  2Y0I A;  3P5B A;  2A75 A;  4RSU A;  5GZF A;  3VZK A;  2ZMN A;  1JZ4 A;  1CQ9 A;  1AR9 2;  3S57 A;  1KS5 A;  1XNC A;  3HNB M;  4A44 A;  3K48 A;  2YDE A;  5J96 B;  1ZZ8 A;  2JXA A;  5L7O C;  1ZM1 A;  3MUY 1;  4IGO A;  5BNO A;  3HQR A;  1W8Z A;  3CHX A;  1OA2 A;  4GH4 C;  3AMH A;  3NNL A;  3U14 A;  3U75 A;  1I3H A;  1BCX A;  4A7Y A;  2BEO A;  3FWE A;  4WV8 A;  5E89 A;  4LBM A;  4Z92 B;  1RUI 2;  2VMH A;  3WF1 A;  5EP9 A;  2J7M A;  2V5Y A;  2YFU A;  3JU9 A;  4Y26 A;  1R1A 3;  1WW4 A;  5K0U A;  5IVV A;  1F8V A;  1IPJ A;  2B42 B;  3ES4 A;  1ACC A;  2ADD A;  1MS0 A;  2XJQ A;  3FLR A;  4YZ3 A;  3TEZ A;  3GXU A;  3GBF A;  3VHO A;  4CXX A;  1MZ5 A;  2WS9 3;  4EV0 A;  1UIJ A;  4IER A;  2VE1 A;  4NVP A;  3EO6 A;  1S2B A;  5K0U C;  1DFQ A;  2B9U A;  2E31 A;  1HV0 A;  3ZR6 A;  2J1R A;  2RR1 1;  1JUI A;  1KXG A;  2A6W A;  3U10 A;  5IFT A;  3J8F 3;  1UZW A;  4Q1R A;  5FXZ A;  1HN1 A;  3G7D A;  1SFN A;  2XB6 C;  1NA1 C;  2XWB B;  5BV6 A;  1OPM A;  1EYB A;  5KR7 A;  4IEU A;  1CAW B;  1JYC A;  4QPG B;  4NIA A;  3OUJ A;  1PO1 3;  1CD3 G;  3H3U A;  4GZ9 A;  4OLL A;  3ZXA C;  2GNM A;  2H0V A;  3ZN6 B;  3M3I A;  1KDK A;  3S7I A;  4IV1 C;  3T0A A;  2ETE A;  4BQW A;  1UZ0 A;  1LOB A;  2WNU A;  4L2N A;  3KD4 A;  3MFA A;  2NMN A;  2VZO A;  4XMA A;  3H8O A;  1F5F A;  2HWE 3;  4AVA A;  4XC9 A;  4ZXK A;  5DZF A;  3LIG A;  3H7Y A;  3RDI A;  2FD8 A;  1PGS A;  4AVT A;  3VHR A;  1W2A X;  4A41 A;  2D6K A;  1JI6 A;  2VMG A;  4YG3 A;  3ZFF B;  2JE8 A;  4IE7 A;  2ZGN A;  2VCB A;  1AXK A;  1VBB 2;  4CXW A;  2B46 X;  1MQT A;  2UY8 A;  2BJS A;  4GWI A;  5FPZ A;  1SLT A;  4KGQ A;  4IUG A;  5FOB B;  1URX A;  2WRA A;  2JX9 A;  4V2V A;  2IVJ A;  3VKF C;  1ULP A;  5H9R A;  5AC9 3;  3B9C A;  5FR3 A;  2QQW A;  2R07 1;  2WUH A;  3N35 A;  4HSJ A;  4JDN A;  4TXW A;  4CU9 A;  5HXM A;  3DYM A;  4B4P A;  5JZG A;  3M70 A;  1LGN A;  4YG0 A;  3J26 N;  3M8L A;  1W6N A;  4E9K A;  1VBD 2;  5ABJ A;  5JOZ A;  2FDG A;  2XKP A;  3ZDS A;  1UMI A;  4PCR A;  5FMO L;  3VHP A;  3W5M A;  4XIK A;  3URF A;  1AJO A;  3M7A A;  2JDM A;  2VVD A;  5DAV A;  3ZXG A;  1NX9 A;  2E7A A;  1QH7 A;  3ZSL A;  4XUR A;  4TYS A;  2VM9 A;  1NQD A;  4LO8 A;  5LK5 A;  4CZS A;  4QDR A;  2P6C A;  2DCY A;  1NT0 A;  1AR8 1;  1OC1 A;  1ZVF A;  2LAL A;  1VAL A;  4JVA A;  4R9B A;  1QNY A;  2ET1 A;  3GZA A;  1CX1 A;  4N53 A;  5E88 A;  1HX6 A;  2NQY A;  2XH6 A;  2CWM A;  3ZFG B;  1LEC A;  1GKB A;  1CPN A;  4AXO A;  1WME A;  1MZ6 A;  2C26 A;  5KC6 A;  3WF3 A;  5JCT A;  2ZJC A;  1UQX A;  3K77 A;  4FPJ A;  5LA0 A;  4XUP A;  1BBT 3;  3ZKY A;  4DO0 A;  1SQ4 A;  4AED C;  5HI0 A;  3O0W A;  4Q0U A;  2VTF A;  3ZM8 A;  2D7F A;  1W0O A;  1HRI 2;  3WF2 A;  1YO8 A;  1AHS A;  2WZE A;  1I5P A;  2WNV A;  4UAP A;  5J37 A;  5HCH A;  4FI9 A;  1B35 C;  5FO9 B;  1FOD 3;  2A3W A;  4XZP A;  2WYS A;  4D7T A;  2CGO A;  3SCF A;  2NYY A;  3WNN A;  5KXD A;  1RXF A;  2LRP A;  2HWD 2;  2W94 A;  4FQZ A;  3OBA A;  1UOB A;  2E26 A;  4Q0Q A;  5FRA A;  5FZK A;  4BME A;  4Q2F A;  3NJV A;  2XJU A;  4HT1 T;  3CZU A;  3RJR A;  3S5Q A;  3KS7 A;  2PHU A;  4JKK A;  2RDN A;  3IDA A;  1GZ9 A;  4EYU A;  4QWN A;  4LIV A;  3LCP A;  4AI0 A;  2XVK A;  4HG6 B;  1AR9 1;  3WNM A;  3V0A B;  3IIA A;  1S55 A;  4IGQ A;  1V9U 3;  1ZBA 2;  3FL7 A;  3WDX A;  4EE2 A;  1PO2 3;  3TEW A;  1R08 2;  4P9W A;  4PF1 A;  3OBZ A;  4Q4W 3;  3ZOI A;  1GOG A;  3CJI B;  1FXZ A;  2EIC A;  3VN4 A;  3C2U A;  5HCA A;  2O8O A;  4LK6 A;  2D6O X;  1RUI 1;  1ZA7 A;  3CMG A;  2C6S A;  1RTV A;  2JE7 A;  2Y33 A;  3CF6 E;  2E63 A;  3K3N A;  3OEB A;  1YFW A;  2C5D A;  2E33 A;  2J1S A;  2Q8D A;  5IVJ A;  3WP3 A;  4PI0 A;  1QJE A;  3KVA A;  4Q4V 2;  4COU A;  4BIF A;  1YIP A;  2PAM A;  3ACI A;  3TB0 A;  1D2Q A;  2ARE A;  2RDQ A;  2YG0 A;  4BYY A;  4BOW A;  1BEV 3;  2WDB A;  3QH7 A;  5J1X A;  2ET7 A;  4MG2 A;  2DUP A;  4H7M A;  4OHX A;  4PLM A;  1JS9 A;  2QQL A;  2RE9 A;  2GMM A;  1EPZ A;  3B02 A;  5F3I A;  3ZDV A;  2RJK A;  4P00 B;  1C8M 3;  1H9W A;  4R9A A;  2DTY A;  1L7Q A;  3CO2 A;  4NRM A;  2JEN A;  4E2G A;  2K9Z A;  4QPG C;  4AVC A;  1QDO A;  3RQ0 A;  1V6N A;  2KD7 A;  1GV9 A;  2JDY A;  2VNV A;  1RUD 2;  4OI4 A;  3NW4 A;  4XF0 A;  5LY1 A;  1H0B A;  3UKV A;  1LEM A;  1QWR A;  2JDZ A;  4QMA A;  4QU1 A;  3OGG A;  3VKO A;  3IDE A;  5APA A;  4IDZ A;  4HN1 A;  5E8A A;  4ZU5 A;  4YZ4 A;  1CJP A;  4IES A;  2ZGS A;  2X05 A;  3OD4 A;  1VRB A;  3AMQ A;  4K9S A;  1OLQ A;  3BU7 A;  4XFC A;  5EJ1 B;  4BM8 A;  1CAX A;  1VBB 1;  3GM8 A;  1DGW X;  1OOP A;  3HNY M;  4IE0 A;  3VDA A;  3IKW A;  2UWC A;  3ZFF C;  2FDF A;  4BWO A;  1WCK A;  1XJA A;  2LTN A;  4KWJ A;  1YWK A;  4XQ4 A;  4Q0V A;  3MO4 A;  4OHV A;  4CU7 A;  1C1L A;  2HYK A;  4URT A;  1DGR N;  1YQ8 A;  4YYO A;  1LJ7 A;  1BK0 A;  4YZ5 A;  3OGR A;  5JOY A;  1EV1 2;  1YFX A;  2WII B;  3MEP A;  1VBC 2;  1VBD 1;  1BK1 A;  3NV3 A;  1FMD 1;  2DV9 A;  5HV0 A;  2P34 A;  4YW3 A;  1AYM 3;  3NJZ A;  3O12 A;  3LZZ A;  4CCN A;  4AQ2 A;  1JZ2 A;  1JZ5 A;  4N9H A;  1QJX 2;  5FZO B;  3DCQ A;  4QXC A;  2ZHM A;  1RUJ 3;  2BWC A;  4PQQ A;  2YXS A;  4YAR A;  2R32 A;  1SPP B;  1RVF 2;  1V6I A;  1W6M A;  2X10 A;  5AVA A;  3USU B;  1CR7 A;  5C4W A;  5C7G A;  2RS1 3;  5FPL A;  1OF3 A;  3T2T A;  4EWE A;  3RZK A;  3T0B A;  1XYP A;  1OQ1 A;  2JG9 B;  4Z2W A;  2X53 S;  3ETP A;  2ZA9 A;  4W65 A;  3ON7 A;  3ZFG C;  2ZGM A;  3POE A;  2QBX A;  2FDJ A;  4OHY A;  3N9O A;  4GD4 A;  5EHD A;  1RUG 3;  1SG3 A;  1W2O A;  2V09 A;  5H9P A;  4PI2 A;  3ME2 A;  4X6R B;  3NVC A;  4XF4 A;  5FY7 A;  4HZF A;  2GAL A;  1HRI 1;  4FPG A;  1JTZ X;  2QUO A;  2RS3 3;  5FJH A;  1MS8 A;  1UYP A;  3AFK A;  2WBK A;  4EWD A;  2VUL A;  5A33 A;  4KNC A;  1JXN A;  1H8V A;  4RS5 A;  5FXW A;  4B1M A;  4JV4 A;  3B00 A;  1JYN A;  3ZX7 A;  2VMD A;  2DCJ A;  5IFP A;  2HWD 1;  5FZ4 A;  1O8S A;  1AR6 2;  1CON A;  1XC6 A;  1CWP A;  2R0H A;  3J7M A;  3JBG 3;  4Q27 A;  4IEY A;  4EN8 B;  3R4S A;  3WCS A;  1JZ6 A;  1ZRF A;  3ACG A;  1FT9 A;  4AFC A;  5C9A A;  5AFE A;  1MS1 A;  2GND A;  5IK8 A;  2ZGT A;  5EPA A;  3I3D A;  3K4D A;  2GSY A;  5FPA A;  3VBR A;  1J58 A;  2AZ5 A;  3BIW E;  2QQK A;  4OQ8 A;  1AJK A;  1DZQ A;  4CP0 A;  2PHR A;  5F9T A;  4LHS A;  5L9V A;  1G8W A;  2BV4 A;  1ZBA 1;  3ATG A;  3RZZ A;  4PJY A;  5LY2 A;  2PEL A;  2WZP P;  1UOG A;  1R08 1;  5K4L A;  5FP3 A;  2TBV A;  4AHX A;  4OHW A;  2IXL A;  1D4M 2;  1XE0 A;  3IDC B;  2G9Z A;  3ZYB A;  2BGO A;  3CJI C;  5A6Z A;  2C9K A;  1QF3 A;  2HBU A;  5FYI A;  1QJY 3;  3ZYR A;  1BLZ A;  4C1X A;  2BVB A;  4AL9 A;  3SH4 A;  1IS4 A;  2XL7 A;  4Q4V 1;  3ELN A;  4CDX A;  1UPS A;  1VRH 3;  5BNN A;  4JTN A;  2WWS A;  3J7N A;  1KQR A;  5GZE A;  1AL2 3;  4BIO A;  3ORJ A;  3AYD A;  4I01 A;  1OD5 A;  2RMU 2;  2VBP A;  3T2P A;  1U5I A;  1CAV B;  3CNA A;  1ODM A;  3ZFE B;  2O1Q A;  3AKP A;  4ZU4 A;  3DEM A;  3TBD A;  4DB5 A;  4XAC A;  3UJO A;  4Q5O A;  4UW4 A;  1ZRC A;  1V6M A;  1BHG A;  1W3X A;  2ZZJ A;  3LWC A;  4JGZ A;  5FRE A;  3VL9 A;  4PLN A;  3HN1 A;  3WD5 A;  1XBF A;  4ONU A;  4AF9 A;  2BWA A;  1VR3 A;  3V0B B;  1Y9G A;  1LB2 A;  1OXC A;  3ZIX A;  4D69 A;  2RS5 2;  3INA A;  2Q1M A;  5CIS A;  4LHK A;  4LK7 A;  4LLF A;  2JG8 B;  2V72 A;  1GNH A;  1YRZ A;  2G1M A;  4I0W B;  1RUD 1;  2D6M A;  4UW3 A;  4TTG A;  3RJ2 X;  1ZRR A;  5HXV A;  1OQD A;  1MPX A;  3AP5 A;  4UF0 B;  5DAW A;  2GZW A;  1LOC A;  1W6Q B;  4DRV A;  2CAU A;  2EIG A;  1US2 A;  4CDQ B;  1OD3 A;  1TNF A;  1ALY A;  1DGL A;  3NL1 A;  4ORF A;  5A1F A;  1RJ8 A;  1DDL A;  2DDU A;  2VEC A;  1QGL A;  5KWR A;  5FY5 A;  4IEV A;  4QKD A;  4BB3 A;  4LUK A;  2SLI A;  2NM1 A;  3BTZ A;  1RIT A;  4QQL A;  2Z2S B;  4AYU A;  5A3L A;  5FBZ A;  3SKJ E;  4F83 A;  1EV1 1;  1VB4 A;  4B3N A;  4CDU B;  5CB7 A;  2C24 A;  1VBC 1;  1EAH 3;  2IXJ A;  4QHO A;  4E8D A;  5JUV A;  1DYP A;  1RIN A;  2UYA A;  5JXI A;  1QJX 1;  3PUS A;  4XQW A;  5FZD A;  2P4E A;  3RNS A;  4IV3 B;  3BB6 A;  4BXS V;  2GME A;  1RVF 1;  3WV6 A;  2I45 A;  3SCH A;  2QJV A;  4NRO A;  4OCT A;  5I8Y A;  4YFZ A;  3LA7 A;  4B8E A;  3FZ3 A;  1RUE 3;  1QXJ A;  2VOW A;  4KBZ A;  1G7Y A;  3PUR A;  5FMD A;  3HT1 A;  3W9A A;  1SCR A;  1W39 A;  2WWU A;  2H6C A;  1KFX L;  4NPL A;  5FPV A;  2UWB A;  2PHL A;  1YQ5 A;  2E6V A;  2JG9 C;  4Y4Y A;  1O3R A;  3OCP A;  3DEC A;  4LKF A;  1OI6 A;  5GJ6 A;  1MZF A;  2UWA A;  2ZGO A;  3VB9 A;  4FOV A;  4YVW A;  3L9J T;  2QDR A;  2W52 A;  3VBH A;  1U5Z A;  2XVL A;  2W87 A;  1UZY A;  3AKS A;  1LR5 A;  4JRL A;  2PLV 3;  1MS4 A;  1GQP A;  1AYN 3;  3H1M A;  4FVV A;  5T54 A;  2DUQ A;  1GOF A;  1LGB A;  3SXW A;  4AHZ A;  3CDZ B;  1IQD C;  4KI5 M;  3R05 A;  5KC5 A;  4MET A;  2B7Y A;  3PJY A;  1H8T A;  1CAU B;  3K2O A;  3KCX A;  4JGY B;  1AR6 1;  5T3N A;  5SV5 A;  3UK9 A;  4MVT A;  4YG6 A;  4CE8 A;  3HT2 A;  1FNZ A;  5FFO C;  2L9L A;  1H2K A;  5GKA C;  3H8R A;  2QE3 A;  4FTB A;  4ZZ5 A;  2DWR A;  4FP3 A;  3E6D A;  2BZD A;  1YFU A;  2I2S A;  4LA3 A;  2HEW F;  2OUH A;  3B3Q E;  4QQH A;  4Q4Y 2;  5DAQ A;  3GJB A;  3C7H A;  2EXJ A;  2Y0O A;  3LEM A;  4NIH A;  4L97 A;  3ZN4 A;  2ZGP A;  3RI9 A;  5F2W A;  4NPR A;  4XUQ A;  5FV3 A;  2ID4 A;  3B94 A;  4ZKT B;  1GWL A;  2CNA A;  3B01 A;  1Z78 A;  1RB8 G;  5FP9 A;  4AE2 A;  1N3Q A;  3MIE A;  4HPK A;  4XJU A;  1FI2 A;  1R64 A;  2WYF A;  3H3L A;  3LEK A;  4YGB A;  4QX2 A;  4OHZ A;  3WEZ A;  4NO4 A;  5FP8 A;  3ZMN A;  3OGV A;  4CCK A;  1D4M 1;  4HET A;  4FPY A;  3T2O A;  5GAL A;  2H6B A;  1IHM A;  1HRV 2;  2WAA A;  4LR4 A;  2VZ3 A;  2WN3 A;  4XPV A;  1RUC 3;  1X8E A;  5L73 A;  1JW6 A;  5BUV A;  2XQR A;  4E8C A;  3VD5 A;  5FZC A;  4A7K A;  1GOH A;  1OSG A;  1TEI A;  2HWB 2;  3ILR A;  3JCI A;  5DMY A;  2RMU 1;  4XIO A;  2BPA 2;  3HJR A;  4R9C A;  2ZZQ A;  5BNP B;  1ULG A;  1OFS A;  4X8P A;  3P3N A;  5L7O B;  2VNR A;  2ZHK A;  3GBW A;  3QCW A;  4A6S A;  4CTE A;  3ZFE C;  4HK8 A;  1Z7S 3;  2WKK A;  3KMH A;  4HSL A;  3AP4 A;  4MAD A;  3QH6 A;  1U0A A;  5AVP A;  5FY9 A;  4BIS A;  3WUC A;  2D5H A;  2RS5 1;  1W8H A;  4WM8 A;  3I59 B;  1AR7 3;  3AYC A;  1HKD A;  3F95 A;  4FFG A;  5GLT A;  4XHX A;  3I2K A;  1DZR A;  3HWJ A;  1RUF 3;  1GLH A;  2JG8 C;  2ZEX A;  3OUI A;  5DXD A;  5FLJ A;  1QXR A;  1WMD A;  2UY9 A;  1UIK A;  4DY5 A;  1UOF A;  4MUV A;  4MX3 A;  1LES A;  3IPV B;  1O4Z A;  2PA7 A;  2VH9 A;  4UFK A;  4Q4X 1;  3VLB B;  1LOE A;  2GAU A;  4M0N A;  3S0M A;  4LHL A;  2UU8 A;  4RGA A;  1AUY A;  2AH2 A;  1R1A 2;  2C9A A;  5DZE A;  4BPZ A;  4CYD A;  1ODN A;  1TZO A;  2B4K A;  2R49 A;  2Q4S A;  3G6J B;  4CDQ C;  2WSV A;  5I0D A;  3FUO A;  1B09 A;  4KU7 A;  3OBR A;  2WS9 2;  4Y5S A;  1EUT A;  4S2H A;  1Q8V A;  5FKB A;  4XFA A;  4CDW B;  4IV1 B;  2ZGQ A;  2IVI B;  2AYH A;  1Y7B A;  4MGT A;  4HKL A;  5C71 A;  4CP2 A;  1OLM A;  1WZX A;  1HQN A;  2IFW A;  4CDU C;  3PTY A;  3ROU A;  4XF9 A;  3NJY A;  3WW3 A;  3ZYI B;  1NCR A;  3DPR B;  1UY3 A;  3WCR A;  2ENR A;  3PUA A;  5FYB A;  1KJR A;  1X82 A;  2HKX A;  2PHW A;  4M4R A;  3D8C A;  2IXK A;  1SLC A;  1W6P A;  3ZYG A;  4IV3 C;  5EJ3 A;  1PO1 2;  1YIF A;  1N1V A;  2D3S A;  2J22 A;  2W08 A;  2DVG A;  3CLP A;  1QEX A;  4QX8 A;  1ZRD A;  2ZMK A;  4MYE A;  1D7P M;  4QGN A;  1DYO A;  4WVM A;  4DXS A;  2HWE 2;  2MPF A;  3C7G A;  5BXX A;  4Y5T A;  3J7L A;  4QB6 A;  3TNQ A;  3ZXD A;  4WM7 A;  2DYC A;  5LBF A;  1WW7 A;  3K75 B;  3BPS A;  5IK4 A;  3RMX A;  3DYO A;  3B7M A;  4D6Q A;  1YYN A;  1XE7 A;  1RC6 A;  5ISL A;  3KV9 A;  4TN7 A;  3Q8B A;  3RPQ A;  1BMV 2;  5A3O A;  5A7P A;  4LE4 A;  3MF9 A;  4QPW A;  3RRD A;  2CL2 A;  5HBA A;  2VME A;  1QH6 A;  3I2F A;  4EN0 A;  2CDP A;  4PDW A;  3A21 A;  4K1Z A;  3OY8 A;  1V6L A;  4XQD A;  1US3 A;  5AC9 2;  1O7F A;  2D6P A;  2VD7 A;  4LUM A;  1QMJ A;  1XB9 A;  2BFU S;  2J1T A;  2KR2 A;  1NCQ C;  4N7I A;  4CUB A;  5IAT A;  2VL4 A;  3I3E A;  2FQP A;  3I2G A;  3LOB A;  4LXL A;  5KHJ A;  2CSG A;  1NXM A;  3MV0 1;  2JDA A;  4I3G A;  3MIB A;  4JGY C;  1YJK A;  2P3K A;  4K20 A;  2VG9 A;  1MZE A;  1UF2 C;  4RGK A;  4TWT A;  5FY1 A;  4BLI A;  1MAC A;  1RMU 3;  2RM2 3;  4UT5 A;  2D43 A;  1EP0 A;  3MW4 A;  4KG8 A;  4HMZ A;  2RV9 A;  2JDN A;  1GP5 A;  2BW8 A;  3A23 A;  5LA1 A;  4Q4Y 1;  3RG0 A;  3AJZ A;  1GNZ A;  4AED B;  2ZX3 A;  3ILF A;  4IEZ A;  3VDD C;  4X6Q B;  2PMW B;  3H0O A;  2X5I A;  2HWF 3;  5CYY A;  5LEK A;  1OKO A;  4Q29 A;  3MLL A;  4M3C A;  3L2Y A;  1B35 B;  2HH9 A;  4LPL A;  3ZKU A;  5LAS A;  2YC0 A;  3DV8 A;  1SDW A;  3N7L A;  4FPC A;  1W99 A;  4Y24 A;  5FIX A;  4BQX A;  3KSC A;  1QOS A;  1BBT 2;  1DF0 A;  1PZ7 A;  1HRV 1;  1W9F A;  1SBF A;  2P1B A;  4HKW A;  1T6G C;  4A45 A;  1SBE A;  2AEZ A;  2MNG A;  3U4S A;  4HFS A;  3WNL A;  4K6B A;  3FLT A;  2DFC A;  4GA9 A;  5C3R A;  2G9F A;  1PIV 3;  3VZJ A;  1QQP 3;  2EXI A;  3AZY A;  1ZRE A;  1C5H A;  1YQ6 A;  4YM3 A;  5KHK A;  1XPW A;  4G9S B;  3RYP A;  5JDB A;  4CRQ A;  1VP6 A;  1FOD 2;  1MS5 A;  4LBQ D;  2JIJ A;  4N43 B;  2FDK A;  2VZR A;  1BZW A;  2CWS A;  3DYP A;  5CA6 A;  4Y22 B;  4OI1 A;  5BNP C;  5EZW A;  2E32 A;  3BYW A;  1S0F A;  2Y26 A;  1HV1 A;  2YY1 A;  1F15 A;  3POY A;  4GXL A;  5LCW L;  4YVS A;  3SLI A;  1UO9 A;  2Q0A A;  3BOD A;  5DUX A;  1VPH A;  3ZO0 B;  4HVQ A;  4COY A;  2YC2 A;  1GZW B;  3MLK A;  4P9L A;  5CG9 A;  4QHB A;  5FZH A;  3SIT A;  2HYX A;  3L2H A;  4H2A A;  5FY4 A;  3OUH A;  1DCS A;  2OPK A;  2GU9 A;  4Y4R A;  4IEP A;  3ZYP A;  1V9U 2;  3PME A;  4CU8 A;  2CAV A;  5A3P A;  4D0Q A;  4AHW A;  2OT7 A;  5G04 L;  4LKE A;  4Q4W 2;  4QX5 A;  1W28 A;  2ILM A;  3AP7 A;  2WAO A;  1LED A;  1QJZ A;  1ZX5 A;  5D1I A;  3WNO A;  3J9S A;  3IT8 A;  3UYJ A;  3BAL A;  2WLQ A;  5H9S A;  1KEX A;  1R1A 1;  1UNB A;  5M0T A;  5FPX A;  1GZT A;  5ERL A;  3WDV A;  5DG2 A;  1FX5 A;  3VBS B;  3AM2 A;  5FZ1 A;  1W06 A;  1OH3 A;  2WS9 1;  4D6S A;  2JJ6 A;  2VUJ A;  3KWV A;  3IWZ A;  1BEV 2;  1PGW 2;  3U78 A;  4XUO A;  2QQP A;  2ZOE B;  5FYT A;  4CDW C;  3PNA A;  3I7D A;  4GH4 A;  3J8F 1;  3M2M A;  1DQ4 A;  4CU6 A;  2MEV 3;  1FV3 A;  2ZEZ A;  4QPI B;  1GIC A;  2KXL A;  1J3Q A;  4O65 A;  4L9B A;  3MPB A;  4XDO A;  4WVZ A;  1C8M 2;  4IW3 A;  3DPR C;  5IVC A;  2DCK A;  1PO1 1;  2JDK A;  4P9G A;  2GH8 A;  4Y20 B;  3VDD B;  3JD7 3;  4BU2 A;  5KBF A;  4CA9 A;  5JVV A;  2QQM A;  3BGA A;  5LK7 B;  1C3H A;  5ABJ C;  2B5H A;  4XBL A;  1HN0 A;  3OYW A;  1KIT A;  2IXH A;  3VKM A;  4A42 A;  2HWE 1;  4ISQ A;  2WZR 3;  3AVS A;  1PM7 A;  2BU9 A;  4RQP B;  5CNA A;  4BK4 A;  5LEJ A;  4AI2 A;  1WCQ A;  4NPM A;  4D7Y A;  4K1Y A;  5EIY B;  2QQV A;  2VQ0 A;  1ST8 A;  4NRQ A;  4QGM A;  2VW0 A;  1DZT A;  3HPN A;  3VBO A;  1W9W A;  4L0P A;  1BMV 1;  4YZ2 A;  2EXK A;  3N7J A;  2XVG A;  2LRO A;  1NA1 A;  4YFW A;  1FMD 2;  3O1T A;  3O0V A;  1LOA A;  2PAE A;  5AC9 1;  3MW2 A;  3FJS A;  2ZAC A;  4QU2 A;  4OMC A;  3WP6 A;  3BU0 A;  1R1Z A;  4NAO A;  4PIY A;  4MZU A;  3ZLI A;  1RIR A;  1OMI A;  1XYO A;  5IVY A;  1LU1 A;  1GUI A;  4TSV A;  2WFF 3;  2QZ2 A;  5E6H A;  1ND3 B;  2JD9 A;  1AYM 2;  2VBD A;  4Z8B A;  3BOW A;  4LIU A;  4BH9 A;  1QXP A;  2R1D A;  4AVB A;  4O7X A;  1FYU A;  4FPL A;  1RUJ 2;  1H2N A;  2XL9 A;  2Q5T A;  1PHM A;  1OH4 A;  3HVD A;  3PHM A;  4JDM A;  2RS1 2;  3HQU A;  4U2A A;  3RWN A;  1WMF A;  2VMC A;  1OVP A;  1XE8 A;  3I2H A;  1GBG A;  2GNT A;  1H6Y A;  3SIS A;  5GZD A;  1WCD J;  5FQ0 B;  2WLP A;  2V4A A;  5HV4 A;  2VTX J;  1W8N A;  4LBQ A;  4N90 A;  2Q8C A;  2ZGK A;  1V6O A;  3PVN A;  3ZXL A;  1X8M A;  1RUG 2;  5ACA 3;  3POJ A;  1BBT 1;  4KQ7 A;  1UY2 A;  1PK6 B;  1YI9 A;  1NYW A;  2BVV A;  2VZP A;  3AL5 A;  4XUN A;  1FPN 3;  3P3P A;  3TEX A;  1JUH A;  4XBN A;  3RSJ A;  1F5J A;  2ZAA A;  2RS3 2;  3PMS A;  1UOJ A;  2IXI A;  4G3Y C;  4MLO A;  5C3P A;  2JEM A;  1UCX A;  5IVE A;  4BQ4 A;  1ZZC A;  2D5F A;  1FOD 1;  1ZZ6 A;  5F37 A;  1LKN A;  3H8X A;  5FZ7 A;  4Z82 A;  2WR9 A;  4GB3 3;  3NKT A;  2BDR A;  4N43 C;  1KD7 A;  3TAY A;  2C4X A;  3HOB A;  5F6K A;  3ZXJ A;  3A0K A;  5T5P A;  2ZHL A;  4HOO A;  5C8C B;  2YHJ A;  3QOP A;  5JAX A;  1DQ1 A;  3NV2 A;  4IND A;  3MLJ A;  1LUL A;  2VCM A;  1E5S A;  2WFP A;  2VZT A;  1POV 3;  3LE0 A;  3NJX A;  4ISR A;  3A4U A;  3ZVX A;  3RZH A;  3T1L A;  3KV5 A;  4HAN A;  4UYB A;  4CEY B;  4QXK A;  1XXN A;  1V9U 1;  2XLG A;  4DIN B;  1YFY A;  1BVP 1;  1S2K A;  5GLZ A;  3VHN A;  3OF1 A;  4Q4W 1;  5CFD B;  3WG2 A;  1G86 A;  4C8D A;  5F3C A;  1HB3 A;  5FUN A;  2BFU L;  2XJV A;  3A22 A;  4XJW A;  1W8O A;  3PUQ A;  4F3J A;  2VW2 A;  2R6Q A;  1WA6 X;  2EID A;  3FLP A;  3OPZ A;  5FY8 A;  3O0X A;  2XBO 3;  1LTE A;  1X50 A;  5T52 A;  2R16 A;  2XUM A;  3MGU A;  3ZXK A;  3S7E A;  4HLT A;  1TME 3;  1V00 A;  5D21 A;  3T4V A;  3WW2 A;  5CAZ A;  3GJA A;  1UN1 A;  3T30 A;  2UYB A;  5CFC B;  3WQB A;  1VRH 2;  1BVV A;  1LHV A;  2IFR A;  3VBS C;  3AYA A;  4A4A A;  1AL2 2;  1V6J A;  4GAZ A;  3PVB B;  4K8F A;  1BEV 1;  1PGW 1;  2DFB A;  2ZEY A;  1YLL A;  1ENS A;  4P9J A;  3UL2 A;  2VO5 A;  2J1E A;  1ULO A;  3DKW A;  3WX5 A;  1N47 A;  1VBE 3;  3FBY A;  4AFB A;  2CYF A;  4MHU A;  3ZYH A;  4CCJ A;  4FPO B;  4OI2 A;  3WG3 A;  2ARA A;  1C8M 1;  1UPI A;  2QQU A;  1C57 A;  1J84 A;  1O91 A;  4FP2 A;  4QPI C;  4AR2 A;  4CCE A;  4TLF A;  3JQW A;  1YQC A;  4MXW B;  4A3X A;  2VQA A;  4NN0 A;  5A3N A;  3RZM A;  2XON A;  2WO3 A;  3LA2 A;  1F35 A;  4ASK A;  4NE9 A;  1RJ7 A;  3DUI A;  3GHM A;  1DGW A;  1PVC 3;  3CQO A;  2XWJ B;  5FMC A;  1G9A A;  1QJU 3;  2J42 A;  3OSD A;  3PDQ A;  1WLW A;  3WT3 A;  4L92 A;  4RQP C;  4XZU G;  2VUA A;  3SMH A;  3ZSJ A;  1L3J A;  3SCG A;  4LOR A;  5C5T A;  5DQ0 A;  2ZS6 B;  1OT5 A;  3D6E A;  1Q8O A;  1F9K A;  1XND A;  1WLC A;  1CVN A;  1SLA A;  5E16 A;  3VBF A;  4CP1 A;  2DVF A;  4CP9 B;  4FBF A;  5C5U A;  3D0J A;  3GDB A;  2VOV A;  3UGF A;  3KGL A;  3HAG A;  1UXZ A;  3P6B A;  1CAW A;  2WZ8 A;  2XHK A;  4QPG A;  4UFH A;  5D8A B;  1PM4 A;  1QDC A;  3CJX A;  3E5U A;  1JU3 A;  2WO7 A;  2WN2 A;  5FCC A;  3SH5 A;  3ZN6 A;  2XJT A;  3FHQ A;  4FPH A;  2ORX A;  3DN7 A;  2PFW A;  4CCO A;  5CKM A;  1EAH 2;  3E6C C;  1AYM 1;  1Q8Q A;  4E27 A;  3IBM A;  3MPP G;  1XOY A;  2GN3 A;  4LTA A;  5CU1 A;  1ND3 C;  5T5L A;  4B29 A;  4SBV A;  2EAA A;  1RUJ 1;  5CKQ A;  5JXH A;  4XBQ A;  5LW9 A;  1M4W A;  2NZ9 A;  5IAX A;  5I0U A;  1UX6 A;  3ZFF A;  2RS1 1;  5IUQ A;  4E2S A;  2ZML A;  1RUE 2;  5FYM A;  1JU4 A;  1J83 A;  4NOT A;  4KU8 A;  5F39 A;  3ZSK A;  4AQS A;  1YNA A;  4MGS A;  4LO5 B;  1QU0 A;  5GLU A;  2HLE A;  2LS6 A;  2F6B A;  3RFR A;  3III A;  4PHZ A;  1HXS 3;  2OPW A;  4RHV 3;  2D93 A;  5CVR A;  1RUG 1;  1VMF A;  2VZS A;  1X9T A;  3FC0 A;  3ZSM A;  4DUX A;  2W1U A;  4RL7 A;  5FP4 A;  2RJ2 A;  2PLV 2;  1PK6 C;  1XSQ A;  3H1W A;  1AYN 2;  1W8T A;  2XPJ A;  3D4K A;  2RS3 1;  4X8N A;  3IDB B;  5F2S A;  1DG6 A;  4JKL A;  1SHW B;  2JB8 A;  2PHT A;  4GMP 3;  4DOU A;  4FAH A;  3POG A;  4EN7 B;  2XR4 A;  4K40 A;  1BQP A;  3LDR A;  2HWD 3;  2AR6 A;  1W6O B;  3M3O A;  3NKG A;  2XG3 A;  3T1M A;  1PZ8 A;  4JQR A;  2WT0 A;  2A6Z A;  5J09 A;  3ZFG A;  4XXP A;  1W8U A;  4W4Z A;  2ADE A;  5FZF A;  4PBP A;  5I8S A;  3LDK A;  4HKO A;  3C3V A;  4PT6 A;  5FBJ A;  2GH2 A;  2O0O A;  4FOY A;  4AGV A;  5BNN C;  1S4C A;  3VD9 A;  5FAX A;  3VBU B;  4BE3 A;  5A7W B;  1RED A;  3RZG A;  1RL3 A;  1Y4W A;  2YV8 A;  4CEY C;  3WZ1 A;  1VAV A;  3W20 A;  2C1F A;  4ZU7 A;  1VB2 A;  1K45 A;  1OPO A;  2HWC 3;  4MV2 A;  1W9T A;  1ENQ A;  3LD8 A;  1COV 3;  3NV4 A;  3WQ0 A;  2DUR A;  1JOD A;  1QJF A;  4PF5 A;  3VKL A;  2YU1 A;  5CFD C;  5FXV A;  3MIH A;  3NST A;  4NIG A;  3B5L B;  1NLQ A;  4ZZ8 A;  1WBF A;  4HK9 A;  1W3V A;  3SEE A;  4FXG B;  1RUC 2;  3KT1 A;  3NMB A;  3N9N A;  2D6L X;  1ND2 B;  4XET A;  3OG2 A;  1CZT A;  1LRH A;  1OA4 A;  3FHA A;  1VRH 1;  3WHU A;  3PU3 A;  1AL2 1;  4BQY A;  2JWP A;  2RHP A;  5CAD A;  5CFC C;  4BMB A;  3NAP B;  4G4F A;  4AEJ A;  1UMH A;  3V0A A;  3KT7 A;  3PU8 A;  5FZ8 A;  1Q56 A;  4NII A;  4UFJ A;  1H6X A;  1Z7S 2;  2WC2 A;  4QQO A;  4ATF A;  1ASJ 3;  4XTM A;  3FE5 A;  3CJI A;  4MGI E;  4A3Z A;  3TNP B;  1SBD A;  2R04 3;  2ES3 A;  2EIB A;  1MEC 3;  2D3R A;  2JDP A;  4BA6 A;  3KVB A;  3NWK A;  4I0A A;  4QQP A;  4COW A;  1AR7 2;  1X33 A;  3MID A;  1W2N A;  3LOI A;  4Q4X 2;  2FMD A;  3AJY A;  2RDS A;  1J1T A;  5DUV A;  1RUF 2;  1M06 G;  4CSW A;  4GAL A;  4P08 A;  2ZHN A;  3ZYF A;  1POV 0;  1UWW A;  2QQJ A;  5C6C A;  2GN7 A;  2QZ3 A;  1DQ5 A;  1N1Y A;  2ARX A;  1P8J A;  4XF3 A;  2DTW A;  3KHB A;  3B93 A;  1NUK A;  3UJQ A;  3PVO A;  3LFI A;  4K7J A;  2G9G A;  4LKS A;  5A32 B;  3WG1 A;  1K5M B;  4W6X A;  1DQ0 A;  3WDU A;  5LA9 A;  2VNG A;  4O9E A;  1VMJ A;  5DUU A;  5JI9 A;  1ZBE 3;  1SEF A;  4HVR A;  2VY0 A;  3CL1 A;  4RR3 B;  1H2L A;  5C8C C;  3MDP A;  4DXT A;  1F2N A;  4XHB A;  2QQN A;  2VZV A;  1UU5 A;  5D8A C;  4F7Z A;  2CTV A;  1XNA A;  2Q8E A;  4CUG A;  1D2S A;  3ACL A;  1OUR A;  1W90 A;  1EAH 1;  2P3I A;  1UU4 A;  2A3Y A;  4QPY A;  3IN9 A;  3PJQ A;  5GM0 A;  3WW1 A;  5F1R A;  3R4D B;  4NHK A;  4LBL A;  1RVF 3;  2K46 A;  1REF A;  5F5C A;  3TOJ A;  5LWB A;  1O4T A;  1PGL 2;  3M3E A;  5FLH A;  2WAB A;  3JB4 C;  4KWL A;  5FYU A;  2OZ6 A;  4FTS A;  5L9R A;  1N3O A;  1CJD A;  3NNG A;  5FJK A;  3C7E A;  1RUE 1;  4W8J A;  3WF4 A;  1AXY A;  5EXO A;  3WDT A;  3NQH A;  2WNO A;  4V2W A;  4LMF A;  2BNN A;  3ITQ A;  1PX4 A;  5FK8 A;  4YPJ A;  3KT4 A;  4QD2 A;  2Y8K A;  4ZY9 A;  1QHD A;  2JKX A;  1UU6 A;  4YM0 A;  4TLG A;  1E5R A;  3VZL A;  1Q8S A;  4E2Q A;  3KCC A;  5FZI A;  3I3Q A;  2XHN A;  1NCQ B;  4AVV A;  1NAE A;  2VU9 A;  4KGG A;  3THD A;  1QNW A;  5FZG A;  1LEN A;  3MIF A;  4FFF A;  3O1R A;  5EJZ B;  2PLV 1;  4R4Z A;  2K2S A;  1AX0 A;  1AYN 1;  5FZO A;  3HBK A;  2OVU A;  4CXY A;  1RHI 3;  2ZKN A;  3OB8 A;  2A3X A;  5B4N A;  1SPP A;  4MO3 M;  2VPV A;  2A70 A;  3LIH A;  3PTR B;  1AX2 A;  1S2E A;  4R52 A;  4XDQ A;  1EPW A;  5FZ6 A;  3USU A;  4BQ5 A;  3APB A;  1AR6 3;  3VGI A;  2RDR A;  4YW2 A;  5ANN A;  1CN1 A;  1U5Y A;  2F4L A;  3LFM A;  4MHR A;  5DDJ 3;  2D97 A;  2NN8 A;  4W6Y A;  5I0S A;  3BTX A;  2Y6K A;  1H4G A;  2VJX A;  5C3S A;  4QX7 A;  2WJS A;  3PLQ A;  2ZX4 A;  3THP A;  4XAB A;  1GFF 2;  3O5S A;  3RZJ A;  2B45 X;  1IS3 A;  3GGL A;  3KQR A;  3AXE A;  2VAU A;  1XSR A;  2YGM A;  4NMI A;  1JOB A;  2HBT A;  3IZO A;  3LSD A;  4XAA A;  4DFS A;  1J3R A;  4MOA A;  1OA3 A;  2HWF 2;  3VBU C;  1L7R A;  5DN2 A;  3RWK X;  1RXG A;  4NHY A;  2Q30 A;  4MGQ A;  3RS6 A;  3ZXE A;  5BNO B;  4EQV A;  1AX1 A;  3FFZ A;  4ARY A;  5CKN A;  5FYH A;  3KCY A;  4UW6 A;  2OS2 A;  4KBB A;  5IHR A;  4WVW A;  2Z69 A;  4HXC A;  3OPT A;  1CIW A;  4XYX A;  4HON A;  5J36 A;  3ZIW A;  4M4P A;  5K0U B;  4FOQ A;  5FZ3 A;  1QIQ A;  1RUC 1;  3LEI A;  1PIV 2;  4I2O A;  1FAT A;  1QQP 2;  3TN9 3;  1ND2 C;  2A6Y A;  1NKG A;  1F4H A;  4QDS A;  1Q5O A;  2AUY A;  3EYP A;  1G9B A;  3MHZ A;  4ASM B;  5IK7 A;  4LEJ A;  3R4U A;  1LHN A;  4JTO A;  3WDY A;  1RGS A;  2Y6L A;  4J6G A;  1LOD A;  2DVD A;  2FHR A;  1RYY A;  3NAP C;  4GMP 0;  5FKC A;  4J1W A;  1Z7S 1;  2VUD A;  3MF6 A;  4EWA A;  1YC6 1;  3T0D A;  4PIX A;  1S0J A;  4J1X A;  1PMJ X;  3KM5 A;  4NJ4 A;  2VOK A;  1AR7 1;  1TG7 A;  1C4R A;  1YJL A;  2NLR A;  4Y3O A;  3CU7 A;  1NLR A;  3UGG A;  2W3J A;  2BQP A;  1RUF 1;  2WNU B;  4D6R A;  5JPN B;  3O1U A;  1PX3 A;  2NPI A;  3CKH A;  2OYZ A;  3POB A;  1SAC A;  3SEP A;  4IGP A;  1ZRI A;  3LDB A;  5JMO A;  3VL8 A;  1VIW B;  4AAP A;  1JHN A;  2RJL A;  2TNF A;  2YGL A;  4C1W A;  3NNJ A;  4JQT A;  3OGJ A;  1CAV A;  5DAX A;  3T09 A;  3ZFE A;  3OYW B;  3W5N A;  1W0P A;  5KHI A;  4PQ9 A;  4IQP A;  1MQT B;  3MBW A;  3WIN E;  1K5M C;  3GZE A;  1O8P A;  3J8F 2;  5BPX A;  4NHX A;  1UZV A;  3IM0 A;  3ZXF A;  4YW7 A;  4H3W A;  1LHO A;  4M3C F;  3UES A;  3V0B A;  1KS4 A;  1ZNP A;  1XRU A;  4RR3 C;  3KHC A;  2BBV A;  5JZG B;  1LNS A;  5JR7 B;  2JG8 A;  2A73 B;  4R4X A;  1ENX A;  1W6N B;  4RN5 A;  3UT0 A;  5ABJ B;  5LRS A;  3GCX A;  5EYX A;  2MEV 2;  2D98 A;  1PGL 1; 
#chains in the Genus database with same CATH homology
 4TLG A;  5LZ6 A;  1OLM E;  1O6U A;  4UYB A;  1OLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...