5LZ6A

Crystal structure of human acbd3 gold domain in complex with 3a protein of aichivirus b
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
163
structure length
126
Chain Sequence
LPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Kobuviral Non-structural 3A Proteins Act as Molecular Harnesses to Hijack the Host ACBD3 Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antiviral protein
molecule keywords Golgi resident protein GCP60
total genus 25
structure length 126
sequence length 163
ec nomenclature
pdb deposition date 2016-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13897 GOLD_2 Golgi-dynamics membrane-trafficking
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.680 Mainly Beta Sandwich Jelly Rolls GOLD domain 5lz6A00
1O6UA 4TLGA 1OLMA 5LZ6A 1OLME 4UYBA
chains in the Genus database with same CATH superfamily
2Z4FA 2D6LX 3AX4A 4MXWB 1VBD3 3IDBB 2D43A 2GDFA 2HWE1 1MS3A 2A3XA 1ZX5A 5FWJA 1BHGA 4A2UA 4RGKA 4QU2A 2A6WA 4PHZA 1UZ0A 3GF6A 3LKJA 2VVEA 3OD0A 5FZOA 1JHNA 1OH3A 4CEYA 1LOEA 4YARA 4AK3A 4I09A 4LHKA 5LY1A 1ZZ6A 5C8CC 2BNMA 1W6QB 4KI5M 1LR5A 4LBOA 2DTYA 2WYFA 1YNAA 4LA2A 1VRH3 1W06A 3LPGA 1LHWA 5FY5A 3POGA 4OYUA 2WKKA 4Q1PA 3PUAA 5A7WB 1E5IA 2X29A 1F5JA 3ECQA 1I3HA 1YQ6A 4PIYA 2Q8EA 3ZO0B 2YFZA 4BQYA 1TZOA 3LIGA 5EPAA 3AYCA 2JB4A 2TEPA 4Q4X2 4M3CA 4XQ4A 5LEJA 3ACFA 1VRH2 3BTYA 3GBGA 5FZOB 2PHXA 1SLIA 5J09A 1H8TC 4XFIA 1AR63 1GU3A 4CEYB 2PHFA 1OQDA 1QH7A 1WWYA 1JZ2A 1H1MA 2XVGA 3N7MA 2VZ3A 3JBG1 5FZAA 1RVF2 3MV01 4FQ4A 1RUJ1 4I3GA 5K7PA 3WQ0A 2RMU2 5IFTA 3AL5A 3MV11 1BK0A 1W0NA 3K51A 2AGSA 4QX8A 1DZRA 2V5DA 5HV0A 4EROA 5IVVA 1ONAA 1ZBA2 2VPVA 2ORZA 4LA3A 4OI1A 2AEYA 3AMPA 5T5OA 3D0SA 3DYOA 1O3SA 1LGNA 2FBEA 2GP5A 2PLV3 1BVP1 1WW5A 2DVGA 3OTFA 3VHRA 1HV0A 1EAH1 1T6GC 2I74A 5FZIA 3BUCA 2PHUA 1UZWA 3FUOA 4OVEA 2V72A 4QXCA 3ZX7A 2VMHA 1RMU2 1YJLA 3IAQA 5EJ1B 2C5DA 3ZSEA 2XMLA 4Q2FA 4MADA 1SLAA 4CCMA 4A7ZA 5FTTC 4C1WA 1ODNA 1COV3 1D0HA 1PK6B 4I3PA 4YM2A 3WHTA 3WQBA 2VUCA 3BTXA 1QXJA 4Y1VA 1ST8A 4COZA 1OUSA 1EV11 3ZYIB 4URTA 1TME2 3M2MA 1RUI3 2GNMA 3HT1A 4QPIB 2ZHMA 2E53A 5E89A 4XE9A 1MS5A 3BI3A 1YUDA 5IWFA 3RYRA 4LBKA 3UGHA 4BIFA 3CF6E 4MLOA 4JCKA 5IUQA 1NQJA 3DPRC 4OMCA 4DO0A 1OF3A 4UW6A 1CAUB 4HETA 3VZJA 2VZ1A 4ET7A 2DUOA 2WZEA 4DXZA 4AQSA 4YSFA 4YW4A 3Q8FA 3UJQA 2JDNA 2VNOA 3U0ZA 1V00A 2Y6GA 3P3PA 4OLLA 1ULEA 5C8WA 5IVJA 2R0FA 1ASJ2 3TWIA 3ZYRA 3OEBA 3WEZA 4CDWA 4AHXA 3RPQA 4UW4A 5GZEA 2A3YA 3IPVB 2W39A 5GZFA 3PJQA 2Y34A 4Q4Y3 4QPIA 5FRAA 1GNHA 2WWUA 4IW3A 4FPOB 4QM8A 4BHPA 3BIWE 1Q8PA 5EYYA 3VBUA 2VOWA 1KD7A 3NKTA 5GZDA 1MVEA 5A7WA 3C7EA 2CGOA 2HWF1 3ZFGB 2GAUA 3CBNA 3FX3A 4HOOA 3N36A 4PDWC 2VZOA 1SLTA 4AEJA 2VR4A 3T0AA 5JOWA 1W2AX 2DFCA 5J37A 1FPN1 2ARBA 3VZOA 3N35A 4XJAA 1T6BX 3D6EA 1QJX1 3M70A 4AQ2A 2ZA9A 5L19A 1BXHA 2XVKA 3FMGA 1V9U1 2HEYF 3OBTA 3VZNA 1PO12 1Z78A 4BQ4A 2JIGA 1LENA 2X5IA 1GV9A 1UU4A 4HKOA 3AZYA 3D3AA 4AI0A 5AC93 2Q8CA 1W39A 4P5HA 3O12A 1NQDA 3AMMA 2WL1A 3CO2A 3UKVA 3WCRA 3KCYA 4WM7C 1JS9A 1NY72 4BQ5A 3ZFEA 2R063 5T50A 4JVAA 3VBOB 3ZXFA 2QTWB 2RS13 5A32A 4NRPA 3VD5A 2D98A 1NUKA 5FY9A 1C8M2 4I01A 5AVAA 3SEEA 1FAYA 4CDUB 4N53B 3ZXDA 4UW5A 1CZTA 5AC92 1H2KA 2ZPXA 1TNRA 2VZRA 3OG2A 4QX3A 4ZU5A 5FYIA 1RUG1 1W8OA 1UX7A 3VKMA 1U5ZA 3WZ1A 4AG4A 1JZ6A 4XABA 1FNZA 3OB8A 4NAMA 1RHI1 1YQ2A 4L9BA 5D8AC 1VBE2 4EQVA 5ERLA 2V73A 1JYWA 1BBT3 1LJ7A 4JTNA 3S6PA 3ZYFA 1D4M3 2AACA 3LF7A 4D7YA 1WLWA 2ZX0A 2QQIA 4XBQA 3T2OA 4QU1A 4AL9A 4FP3A 1UY3A 3POWA 5JZGC 5BXXA 1CN1A 5GLWA 1WCDJ 4TYSA 2H0BA 4XFFA 1LOFC 1LCLA 5FZKA 1WCSA 1QQP3 3LEKA 3TRSB 2ZCWA 1CONA 4XMAA 5F5CA 1ZZCA 5FQ0B 2XJQA 5H9PA 4Q27A 1QXPA 3MUY1 4CP2A 2ZGRA 5FR3A 1PIV3 2XBO1 2YDEA 1FPN3 5T52A 4CEWA 1UPSA 4PCRA 1EP0A 2JDUA 4BQXA 2OX0A 3AKTA 4OCTA 5F9TA 2VVDA 1XRUA 3N9NA 3MW3A 3A22A 1ZVFA 3TBDA 4X8PA 1OMIA 2VZPA 2QQUA 3ZYPA 4CCLA 1XNCA 3SC7X 2BP6A 2A75A 2CDPA 2RM22 1F35A 4AEMA 3E6DA 4RFT0 2GMEA 1KGYA 1OKOA 3JU9A 1I9RA 2LUWA 2VOXA 4QKNA 4YVSA 4IV1A 2VBDA 3M8LA 4PLNA 1H6XA 2JX9A 4NUBA 2WAOA 2AUYA 5FQ0A 2WS92 3B02A 1YQ8A 4HSJA 4EN6B 1XJAA 5FMDA 4GJYA 2BGOA 4MUVA 4Q5OA 5DUUA 4YPJA 1I5PA 4YVSC 2JDKA 1H9WA 1NT0A 1IPSA 2NZ9A 4NIAA 2G9ZA 2D3PA 4QQPA 3LOBA 3SEPA 1MS4A 2BWCA 4LE4A 1H2MA 1K45A 4L0PA 3RJRA 1OOPB 3VL8A 3A21A 2VNVA 1YC61 2J1VA 2EXIA 3VLBB 3WW4A 1LRHA 5A3PA 5ISLA 2HWD1 2XOMA 3IBMA 5CG9A 4KG8A 2XUMA 1YQCA 2VE1A 4Q0VA 5JSRA 2R073 2Y60A 3UV9A 1QOTA 1WMFA 1YIPA 3MLKA 5FP4A 3A23A 5A32B 3VBOA 3WV6A 2ZHNA 2D40A 1PVC3 5IAVA 3VD4A 4G9SB 1N3PA 4GH4A 1NE4A 2ARAA 4JX0A 3OGSA 2WZPP 3THCA 1IOAA 3HVDA 1RUC3 1W8WA 3VD7A 3AP5A 4A45A 1BEV2 2DV9A 1R093 1QJY1 4KQ7A 3K3NA 3L9JT 4CU6A 2JDPA 1AX1A 3HWJA 2WSUA 1PVC2 2QQPA 4ES9A 1W8NA 2ZS6B 3OF1A 4K7JA 5IT6A 2XHKA 2W3JA 2WNEA 2XL9A 3ZFEB 1R1A1 2DCZA 2SLIA 1RUC2 1GQGA 4YNIA 2JB8A 3WNNA 1YFWA 4XIKA 3ZIXA 2H6CA 3UKNA 1LU1A 4BIOA 2VJXA 2J7MA 1N1VA 3UGGA 5L9RA 5FMOS 1GANA 3ZPOA 4U36A 1BMV1 1AF9A 1GICA 1MS9A 2JG8B 3ASIA 2RR11 4NWWA 3S30A 4D3WA 5A6XA 2KA3A 1VBA3 3POSA 4R9CA 1J1LA 3NKGA 1ND2B 2ZKNA 1JYVA 1R1A3 2WO7A 1CIYA 3GM8A 4LBJA 5C8CA 5F3CA 1RC6A 4CEWB 1BVVA 1DGWX 1DF0A 4QB2A 5FZ0A 1LGCA 2ZOEB 1IHMA 2IXKA 2AEZA 3H3ZA 1W0PA 2GC2A 2ZZJA 4H7LA 3E5XA 1VBA2 4UWDA 3JUUA 1R091 4JKLA 2HEVF 2JG9B 4JTOA 4P9JA 4D8MA 4Q8KA 1R1A2 1ZBE3 1QKQA 1PO21 2F4PA 2YPJA 1YHFA 5C5TA 4E2SA 2D6MA 4CXYA 2WNUB 5FMCA 1VBC3 3KV4A 4UOJA 5FZMA 3ZMOA 5DG2A 3WINE 1GP5A 2EA7A 1HJGA 2VM9A 5B2GB 3VZMA 4CUBA 3Q8AA 4YYOA 3FHIB 1K5MC 1W04A 1C1FA 4M0HA 3VDAA 4RQPC 1IGOA 1QY4A 2GSYA 2X05A 1OXCA 4R52A 5EJZB 1UWWA 5EHDA 2P6HA 4DFSA 1VBC2 1DGLA 1SCRA 2PMWB 1J3PA 3RJ2X 1FNYA 4KWLA 2VCBA 3QBQA 5L9VA 3P5BA 4AEDB 4YZ4A 5FY4A 2DCJA 2ATFA 3ES4A 4LKSA 3ACLA 1UKRA 1FXZA 1KITA 4MGYE 5J36A 2WO1A 3NSTA 4FXKB 5F39A 3JQXA 2HWB1 5DABA 5L36A 4WVMB 4QWNA 3U4SA 1H2NA 2OQ7A 2ZTNA 3ZSLA 1I1EA 1ULFA 1ALYA 3WG3A 2B45X 2BGCA 5A33B 2WA4A 2R0HA 4NHKA 2DBIA 4WVWA 3BPZA 1PGW1 4I0BA 4EN9B 4W6YA 1AYN1 4OUSA 4BDVB 2E7AA 4AI1A 5JWPA 1PNFA 3INAA 4XQDA 1RTVA 2DVDA 2Y64A 3GJAA 5FYVA 1O4YA 2DU0A 2WSVA 2C0ZA 5FLHA 3EO6A 5LWBA 1IKPA 5CVRA 2RE9A 4AVCA 2VC9A 1K3IA 1DYPA 1AX0A 4B7KA 1W9SA 3KZ4C 3RG0A 1LB2A 1RUH1 1UMZA 4Q4V3 3A7QA 4DUWA 1RUD2 2OZJA 2RDNA 1XNBA 2W0XA 3DPRA 3OY8A 3POIA 4RD7A 3LEIA 2P6CA 4PLOA 1ULDA 5HCAA 4YW6A 4LORA 4IGQA 3ZSKA 1W3VA 3I3EA 2WZR2 3GJBA 5C9AA 2PAEA 3CL1A 1GWLA 3ELNA 3ES1A 1VMHA 1CIWA 5HCFA 5L9BA 4Q4V2 3TN92 3WNPA 3N4MA 3E97A 1VJ2A 2Y33A 1PGW2 4XF1A 5FUNA 2WNUC 5LA9A 4M4RA 3VBUC 5A6QA 5EJ3A 1Z7S3 3I3MA 1CJPA 4YW3A 4E4DX 3RYPA 3SLIA 1HJFA 3BALA 1I6XA 4QPIC 5C3SA 4QQHA 4Q1RA 1LOCA 3K4AA 5FXZA 3WF2A 1RHI3 1RUF2 1YI9A 1GNZA 5FZ8A 5JI7A 1QWRA 3TN93 1GMMA 3IZOA 2W08A 2BYVE 4AFDA 4BZ4A 4NPMA 1W6MA 3ACIA 2Y6KA 5EWSA 5FZHA 2XWBB 2BGPA 1WMDA 1Z7S2 1BCXA 2DCTA 3MIDA 1C57A 4FP2A 2ZHKA 2X53S 2Y6FA 3AP9A 1ND2A 3H7YA 3MIHA 3QCWA 4YG0A 5KXCA 4UBHA 3URFA 3ZYJB 1QJU2 3HNYM 4WM7A 4QX1A 4YW7A 1O91A 1PMIA 2TNFA 5FWEA 2BNOA 1PVXA 4HXCA 3HAGA 1AXKA 1JMUB 4AQ6A 3W20A 1JUHA 3K46A 4CA9A 2F17A 1IS3A 1OI6A 2AR6A 4LO5B 3PUSA 2VH9A 1LHOA 2GMPA 3E6BA 4FOQA 1QIQA 5K0UC 1QJX2 2QQMA 4AI2A 3NNLA 4AR2A 1SACA 5CNAA 2FQPA 4F3JA 3AXDA 2DF7A 3NRUA 4ARYA 4HG6B 2IXCA 1MZ6A 1K12A 4XDQA 4A44A 1UL9A 4AEDC 4ZZ5A 4L92A 1AYN3 3ZYGA 3DF0A 2XB6C 5FPXA 2PLV1 5LRRA 4IDZA 4CCCA 4RS5C 5BNPB 5A33A 3ZSJA 3RI8A 3N7JA 3ZR6A 3R05A 1AR62 4AEDA 4YM1A 2P4EA 3UESA 4HPKA 5J96B 1GZCA 5CISA 4TN7A 5FZ3A 2AREA 3ZOIA 5J48A 1BKZA 3AZWA 1IS5A 5FZ1A 3B9CA 2Q8DA 2RS53 2WINB 2XGXA 1WBFA 1FOD2 2XQRA 4PBOA 1JYXA 4F7ZA 1QOSA 1RUE2 2W95A 1S2KA 3OGGA 2JG9C 3BOPA 3N9QA 5DQ0A 3TEXA 1YEWA 4BMEA 2B9VA 5K8SA 5DAWA 1VMJA 1UXXX 1DGRN 1S0BA 2G4IA 1GWMA 1CZVA 2XWJB 3CKHA 2HBUA 1N3OA 1RYYA 3P3NA 4LJHA 5LK7B 3FLTA 4YW2A 2BWAA 2WRAA 3VBHA 1EPWA 3DYPA 2RG4A 2XJUA 1GP4A 3SMHA 4TLFA 5FMBA 4MXVA 4HPKB 3ZMNA 4UFHA 3SXWA 3RZZA 2XDVA 1Q8SA 1ZM1A 1YO8A 2J1RA 2KR2A 2ZGPA 2VVFA 4IV1C 3NNFA 3O0WA 3VBHC 3UETA 4BH9A 2VZSA 2R30A 2NYYA 4XUTA 5FBZA 2OVUA 2ENRA 3LQCA 2X10A 1RUI2 3T1MA 3AM2A 5LASA 4FPKA 3KT1A 3QOPA 5FDBA 2Q30A 5ABJB 5C7GA 5C33A 2UU8A 1PGL2 5LY2A 1FYUA 5JMCA 1XNDA 4Y1YA 5J98B 5FFOC 3HIFA 5FPZA 3POJA 3GDBA 3ZN6A 2ZGMA 4HFSA 4NO4A 2HWE3 3DCQA 5D21A 1YFUA 3MF6A 2LM3A 5T3NA 4U2AA 4IESA 4CDXC 4F83A 2VTXJ 1X9TA 4Y3OA 2Q1FA 4TTGA 1CAXB 5F7UA 1QNWA 5FAXA 2DTWA 1VBD2 5J1XA 5JXHA 2E33A 1YFXA 4OMDA 4FFHA 4MYEA 4DRRA 3LSEA 4FPCA 1GQPA 4C0BA 1WZXA 1RVF1 1CAVB 4N43C 1GOFA 5APAA 5I0SA 2E63A 4C0HA 4KWUA 4ZONA 5LCWL 1W03A 3RDIA 1S0EA 3AYEA 5ANNA 4UFIA 1W6NB 1LODA 5LBCA 3WDWA 4E8DA 3C3VA 5JPMB 2DUQA 1KS5A 1XB9A 1HRV2 2DWRA 1Y43B 3AP4A 2CY6A 2I2SA 3J8F3 1SDWA 2WFF3 4N43A 4PQQA 4EN0A 1C1LA 2RDSA 3UL2A 4LTAA 2E32A 2BVVA 1SDDB 4QT6A 4LLOA 5FYMA 2BV4A 3KV5A 1PO13 1AHSA 4GZ9A 1G9CA 3IDEA 1B35A 2N7GA 4FQZA 2ETEA 4CDUC 3N9PA 4A3XA 2D93A 3TEZA 1US3A 4Q8LA 4QGMA 3J8F2 1U5YA 2HWD3 2VL4A 4O65A 4RN5A 2JG8C 4ZS3A 4A6SA 4JGYA 2MNGA 3PMEA 3I59B 2FZ1A 5FY8A 4L2NA 1UOJA 1QU0A 4OHVA 4QB1A 1U12A 1S2EA 2JENA 2Q5TA 2RS12 4FPJA 4LPLA 4HK8A 1QJFA 4JRLA 3RZJA 4ITCA 4JGYC 3W59A 3ZFFB 1D4M1 2R7EB 5FYZA 3KWVA 4JZRA 3IMNA 3EB7A 1UQXA 2PHTA 2BTVC 1BJQA 4W6WA 5F3IA 2ZAHA 4XF4A 4BQ1A 1LULA 1UF2C 4JRAA 1U5XA 5E8AA 3USSA 5KHIA 5I8YA 3C7HA 4IQPA 1HW5A 4QM9A 5E6HA 2WWSA 5AVPA 5DPNA 2WNVC 1REDA 2OQ6A 5ACA1 4GB33 1MVQA 5IW0A 5F5AA 4Z2WA 5HPOA 4TSVA 1C8M1 5AFEA 1D4M2 4FTEA 3ZXLA 4KNCA 4M3CF 3PVNA 3VDDA 2VGDA 1F5FA 3IPVA 4XUOA 3TNQA 2Q8OA 3U1XA 5IVYA 4UFLA 4D0QA 4B4PA 5HBAA 4FSJA 4Q0SA 4EN7B 2XR4A 2IXLA 3CIHA 1AX2A 2P17A 1BEV1 1AUYA 1D2QA 1XNAA 2ADDA 2WQ4A 5T55A 4FPFA 2BUKA 4YG6A 2R041 1GOGA 3RYKA 1WLCA 2R6QA 4RQPA 5FYUA 3IDAA 3VDDC 4C90A 1D4VB 2O8OA 2ZEWA 3MIBA 1OHFA 1O5UA 2VMDA 2UY9A 4J6GA 1PIV1 3NAPC 4G3YC 1PMHX 1VR3A 4XZUG 1FPN2 1ZYBA 2A71A 3GNEA 3RQ0A 3KF5A 1XU2A 4OHXA 2NMOA 4V2WA 3WNOA 4QDQA 3ZN6B 4BM8A 4XJUA 1SBEA 1ND3B 5FXXA 4LBQB 3G7DA 2ES3A 2WIIB 3K2OA 5TSWA 3WNXA 1UU5A 1HV1A 2VW0A 4MVTA 3R6SA 4RA0A 1VBB3 1WMXA 2R043 5A1LA 2XVLA 4O7XA 1SEFA 4DXSA 1CAXA 5DMYA 4YZ2A 5ABJA 5FCCA 2QQWA 3OYWB 4QDRA 4AZZA 4LO4B 3KHCA 3TB0A 4YVWC 4R4ZA 5SV5A 1OFSA 1PMJX 1X8EA 4AFMA 1ULGA 3DKQA 1ND3C 2WS93 2WA3A 3KSCA 3GGLA 2PN5A 3KV9A 1M4WA 4QQOA 1W9WA 3AL6A 4ZPIA 4CU9A 5JR7B 2VTXA 4DPNA 3USUB 4CCEA 4BLJA 1ASJ3 2NMNA 3VKLA 4M3CB 1OPOA 3RGBA 4E2GA 1ND3A 2FMDA 2YGLA 5F3EA 4D7SA 3VUOA 4Q4Y2 1G9BA 3PMSA 3I97A 1PX4A 2QJVA 2ZHLA 2DVFA 3QD6A 1RUH2 5FJHA 1LU2A 1B09A 4CU7A 1NXMA 3JQWA 2ZMNA 1US2A 1Q8QA 2QQVA 1NXD1 1JZ3A 5FPBA 2GU9A 3PVEA 1XC6A 4NIIA 4AHYA 4AVVA 1MS1A 3HNMA 4MGTA 1C3HA 1V9U3 3WP6A 4BXSV 2BERA 3N3HA 4EWAA 2QDNA 5LATA 2ZGOA 5IVEA 4Y20B 2ET1A 4FTSA 1COV1 1OLQA 5HV4A 1ZRIA 4NHMA 4NOTA 5BNQA 5F1RA 2PQQA 3BVCA 1AR72 3VGIA 4DINB 1ZBE1 3HR9A 4Z92B 2C26A 1UY1A 1W8TA 1FV3A 2Y38A 2W87A 3DKWA 3JD73 4LIVA 4W4ZA 1R081 2HWB2 3MDPA 1UY2A 4Y5TA 1G86A 4QX5A 1G6NA 4IXLA 5JSPA 3RZGA 1HN0A 4BPZA 2VW2A 4IEYA 2L9LA 5C3QA 1JN2P 2KM2A 3B00A 4CPBA 4JAAA 1TMF3 1REFA 2ZGKA 4GKXA 4Z07A 1OLME 1V70A 1BQPA 1H8TB 3N9LA 4PDWB 4Z2AA 1CPNA 1LHVA 1SLLA 3MW4A 4J1WA 4MXWA 1KDKA 4LKFA 5B4NA 1VBE3 4RQPB 2VQUA 3H8UA 3I2KA 1BBT2 5GLZA 2ARXA 1NA1B 3AZZA 4AI3A 3GZAA 4CVUA 4FAGA 1JZ8A 1JYNA 2TBVA 4IEXA 5K0UB 4EN8B 2D44A 5G04L 5FOJB 1IS6A 1WD3A 1FMD2 3RNSA 1S0FA 4N8MA 5FMOL 2RR12 3I2DA 3ZSMA 2YZ4A 1BMV2 1RL3A 4IEOA 3LFMA 1S0DA 1XPWA 1EV13 4LOTA 3MZHA 1Y4WA 1SFYA 1MEC2 1H0BA 2WWJA 4I2OA 4L97A 2XLAA 2YU1A 1XU1A 4HONA 4NAOA 4P9XA 4AEKA 1FMD3 1UCXA 3E5UA 5C4WC 1TEIA 2A3WA 3WY6A 2LS6A 1DQ4A 1PO23 3SH4A 1Q8VA 2AENA 2W68A 4SLIA 2ET7A 3KGZA 3NJZA 4IE7A 1YXWA 5FP8A 4OQ8A 4R9BA 2YFUA 3O1VA 1LOBA 4NIDA 1MEC3 4XF3A 4QPGA 1JOJA 4XYXA 3V0AA 4PI0A 3TYJA 2RHPA 3H1MA 4S2GA 1BK1A 1LOFA 4XJWA 2RM23 4GMP0 2V4AA 3NV4A 4FVVA 1UU6A 2OPKA 4QGNA 1ZA4A 3FZ3A 3OCPA 3TEYA 2E51A 2VQ0A 2CL2A 3QLQA 4CDQB 3BYWA 3MGUA 4LOSA 1F8VA 1H4GA 4XFAA 5EXOA 2EALA 5BYNA 1AL22 4JQTA 3W5MA 2VOTA 3CJIB 1DCSA 4L8QA 4AI8A 1MS8A 1UZVA 2ILMA 4YZ1A 3H42B 3TNPB 3LA7A 3USUA 4QKBA 4BXFA 2YBPA 5CFDB 1C5IA 5JXGA 4IE0A 1AR61 2D6PA 5GM0A 3W5NA 2IUWA 4KU8A 4META 3V0AB 1W2OA 1X9PA 2B7YA 4N53A 5DN2A 4Y20A 3WG2A 4OHYA 5JZGA 2O0OA 3MF9A 3C7FA 4K8RB 3PJYA 3O0XA 3DV8A 5E1RA 2W1UA 4DNYA 4ES8A 4DMIA 1MEC1 4XAAA 2RV9A 1KDMA 1CAUA 1R083 2PHRA 3H3LA 4CDQA 3LDKA 2OUHA 1AJOA 2VQTA 2P3YA 1PK6A 3T2TA 3T2QA 4AVTA 4DOUA 4BK4A 3RFRA 4DIQA 1G9FA 5M0TA 5KXDA 2BJSA 1PGL1 3VBFB 2CV6A 4O9GA 4O61A 2H0VA 2WT1A 2W2IA 2ZEXA 3K77A 5E88A 5GLUA 5GKAC 4CDWB 4D7TA 1O5LA 4OHWA 1R082 4NN0A 1NKGA 5F6LB 3HJRA 3R4SA 5IK7A 4XUPA 5CFCC 3O1MA 1DQ6A 2VCCA 4M01A 3AB0A 5FK8A 2PA7A 1JH5A 2NQYA 4WZFA 2HYXA 2YBSA 1CR7A 3ITQA 2GC1A 5IJRA 3RMYA 2PFWA 4IGPA 5CKNA 2HEWF 2XUEA 4N7UA 2GNDA 4COUA 1WUVA 1VBD1 3RS6A 4ATEA 2Z79A 4KGGA 5J3UA 1XYPA 2QKDA 3E6CC 3K48A 1SLBA 3O14A 1HB2A 4JC1A 4K1ZA 4E8CA 4RYDA 1EYBA 1JI6A 3V65A 1S0CA 5A7OA 2ZGLA 2UWBA 3LDRA 2LW8A 2QDRA 4LBMA 3VBFA 1OQ1A 2R16A 1GBGA 2UYBA 3AZXA 1PM4A 1DYKA 2J1AA 4ASMB 1RUG3 4MZUA 2WS91 5CADA 3PVBB 3WNKA 1XE7A 2DVAA 3ACHA 4NMIA 1NA1A 1Q56A 4LULA 4WVMA 4Y5Z0 4AHZA 4B8EA 2HYKA 3H7JA 2YROA 1QJU3 1FT9A 2WQ8A 2XBO2 1W3XA 3MIFA 3WP5A 4UFKA 4KG0A 1ULPA 4BMBA 2VBBA 3POFA 4K6BA 4QPGB 2WNOA 1K5JA 3OSDA 4IEUA 4CDUA 3I2IA 1LEMA 1O59A 4UFMA 2P1BA 4IUGA 1ENXA 3OGJA 4UAPA 2JJ6A 2HWC3 1GUIA 3I2GA 5KXEA 1F2NA 3BODA 1RUD1 4WM8A 1NZCA 1LTEA 2X5IB 5C3OA 1WCUA 3PIGA 4P9YA 4EE2A 1VP6A 5FYBA 1KXGA 2I07B 3JZVA 4UI9L 3N9MA 4XF0A 5HCBA 5LA0A 4RR3A 5JOZA 4FFFA 5BPXA 2XXZA 4E9KA 2DFBA 4HLTA 2XL7A 4YWAA 1EAH2 1JUIA 2RS32 3M1HA 1RUNA 1A8MA 4XCAA 5KXBA 4GD4A 2MEV2 2WLQA 3Q9OA 4FOYA 4D69A 3POBA 4GH4B 2FHRA 4Q26A 5T5JA 2NP0A 1DYOA 4HK9A 4ZY9A 2LROA 4DS0A 2VY0A 2WQZC 1YCIA 3W58A 2CU5A 1WA6X 2R1BA 1LESA 2HWF2 3C7GA 3PURA 4V1PA 2RS33 3RWKX 4RSUA 4BOWA 2J1SA 2C24A 2P37A 5CZKA 1J3RA 2B5HA 2SBAA 2PXJA 1ZRDA 3ZN4A 4RR3B 1KFXL 5CFDA 3PDQA 1Z7S1 1FOD3 3NNMA 4ATFA 4AE2A 4URAA 4QPYA 2EF6A 1C4RA 2QCSB 4LQRA 2EXJA 5DDJ3 4QHBA 5F3GA 4QD2A 2ZGUA 3ZXGA 3RZHA 1CQ9A 5JZGB 4E4ZA 1UIJA 3EJKA 2RVAA 3J7MA 3MIGA 1PGSA 1ZREA 2HBTA 3B7MA 3R0RA 3IKWA 4XETA 4NPRA 1GZWA 4B7EA 1UKGA 2A73B 1CAWB 2WZR1 3PU8A 3GXUA 3SISA 3WUDA 3PUQA 4P02B 2ZKLA 4PIZA 5FUIA 4COYA 3MLJA 5FLIA 2CAVA 2KXLA 3VN4A 4YGEA 4AXOA 4DEQA 1RUD3 1WW4A 2IXHA 3AKRA 1RGSA 3NAPA 2P3JA 4XCBA 4BWOA 3HNBM 4LK7A 4LIUA 5LA1A 1KS4A 5A3WA 2WFF1 4A42A 3T09A 3M3EA 1EUUA 1X50A 1SBDA 1OFNA 5CYYA 2VOVA 1N1SA 4NWVA 5I0RA 1QHDA 1F4AA 1Y9QA 1Q3EA 3UK9A 3D4KA 3O0VA 1OVPA 3OBAA 5FY7A 2DVBA 5A3LA 1GNYA 1CVNA 1ZZ9A 4NE9A 3SITA 3ETQA 3UKTA 1UXZA 3VKFC 5BNOA 2P3KA 3KGLA 5ABJC 2BBVA 4GB31 1SPPA 2CNAA 2RDQA 3PUHA 2NLRA 4QB6A 2DCYA 4Y33A 4YGDA 3B01A 3WDVA 3JCIA 1NYWA 3VKNA 5A3TA 4XBNA 4J1XA 4FPYA 4GWJA 2EAAA 3KQRA 3FC0A 3VHOA 4FPHA 3UJOA 3JXSA 2WAAA 5FREA 5BV6A 3MO4A 2IVJA 4AHWA 1DQ0A 2NPIA 4QKFA 3GZEA 1D2SA 5FO9B 1KQRA 3RWNA 4LO8A 3OJBA 3V56A 4C1XA 4YM3A 1OA2A 2A70A 2AC1A 3IIIA 1O8PA 3J4UH 4RGGA 5FZ4A 4AFCA 1DGWA 2B39A 2BNNA 2BQPA 4IGOA 4K9SA 2VO5A 1UOBA 1QJY2 3LCPA 4CDXB 3O1PA 4AGRA 5F2WA 4KL1A 5HCHA 5H9QA 5F8PA 2QFEA 4EWEA 5GZCA 1AVBA 1NX9A 1Q5OA 3NNGA 5FZ9A 3ROUA 3J9SA 4R4XA 2E26A 2W94A 1UOFA 2B46X 3I2OA 3KM5A 4HKLA 5FPLA 2D6NA 4XW3A 2BEOA 3OUHA 1L7QA 4WBBA 4A6OA 1IG0A 4CPBD 4MH0E 4LNVA 1CZSA 5HI0A 3V0BA 5BNPC 1RVF3 2XJTA 1RUJ2 2EVXA 3APBA 4MG2A 4P9GA 3VV1A 3N7KA 3OBZA 3PU3A 5KHKA 3WHUA 4DXRA 2IVIB 5GZGA 4CXXA 5JXJA 4GQ7A 1AR91 4PLMA 4ASLA 5C71A 2X8KA 5A3NA 2WO3A 4WZCA 2OYZA 3HQRA 1V6LA 1ZBA3 2UYAA 4HN1A 5GALA 2CWMA 1LAJA 4Q4X3 2XJRA 1RUJ3 4AQTA 4IV3B 1WCKA 1H9PA 1VBE1 4BQ2A 4ONUA 1MZEA 3LA3A 3OGVA 5C9AB 2CWSA 4Y22B 2BPA2 1JOPA 4LKDA 4Y1XA 1K42A 2QBXA 1NCQC 2ZEZA 5EV7A 4HN0A 3M7AA 1RUE3 2E7TA 4QPGC 1ND2C 1HQLA 1HIXA 2Z5WA 5LW9A 2VBPA 1YYNA 1DGRA 4IERA 4BLIA 2VAUA 4XHXA 5FIXA 3NAPB 4CP0A 1FATA 4AWDA 2QQKA 3PNAA 4KMQA 3RSJA 3QACA 1TVGA 4JGZA 5IYYA 1T2XA 5DZFA 5FZGA 2VU9A 5D2AA 1UYYA 4MGKE 1J84A 3NJVA 1ULCA 4UFJA 1TE1B 2WNVB 2F4LA 2WBKA 1PVC1 4XC9A 2EIEA 2PLV2 3O1TA 4WM7B 4RFRB 2QVSB 5I8TA 3NL1A 4K1YA 2DDUA 2K2SA 1WLDA 2YXSA 1L3JA 1OA3A 2J1TA 3CHXA 3Q8EA 1COV2 1O3QA 2J1UA 1OA4A 2OA2A 4RS5A 4UT5A 3T1LA 3IWZA 5FUPA 2VCMA 4P9WA 4JGYB 1G9DA 3CZJA 2FDGA 5F2SA 4XOGA 2HWE2 2V5YA 2VUDA 5AFBA 1GQHA 4YLZA 1O3RA 3LSDA 1DLLA 1F4HA 1HQNA 2ZGQA 3B93A 3UGFA 3WOGA 4AYUA 4Y24A 4BB3A 5GJ6A 1VIWB 4OUEA 4XQWA 1UX6A 1C5HA 3A0NA 3WT3A 4D6RA 3HOBA 3ZLIA 2VNRA 4TLGA 2CGPA 1UOGA 4S2DA 4FFIA 1CWPA 2XQXA 1Y9MA 2MEV1 2WN3A 1X7NA 1TG7A 1PM7A 2R1DA 2VUJA 3HD8B 4GALA 2EIBA 3SQOA 1AZDA 4W65A 3PL0A 2FMYA 4DRVA 4FTBA 4WVZA 4XDPA 3VDDB 1AYM1 1L7LA 1IG3A 2GNBA 3FE5A 3WVJA 4AGGA 4CDXA 4CZSA 1HRV3 2ARCA 1K5MA 1IQAA 3LFIA 4IEPA 5I93A 1VLNA 3FHQA 3NV1A 5GLVA 2VG9A 5A1FA 3RZLA 5FZ6A 5JMOA 4B29A 4FBFA 3AVSA 4Q4V1 5JIAA 3GZUC 4UXAA 1KFUL 2JEMA 2JIJA 5L7OA 1UZYA 2HWC1 3D0JA 4H2AA 2Q0AA 4EJRA 1W0OA 2WUHA 2Q1ZB 4DZGA 2EXHA 2HLEA 3CDZB 3WXPA 1IZ3A 3ON7A 3RI9A 3VBOC 5IK4A 3PHMA 4YGCA 4HL0A 3MLLA 4HT1T 3FFZA 4OZXA 2WDBA 3FLPA 4Q4W1 4Q4Y1 3EBRA 3OYWA 4GWNA 1ASJ1 3AJYA 1DG6A 1W9YA 2DCKA 5EIYB 1ZZBA 1CESA 2QQJA 2ZX1A 3AXEA 4CXWA 1YRZA 3FBMA 2RMU1 4Q4W3 1OLRA 1SQ4A 3J7LA 4GB32 3GALA 2GH8A 3EMRA 2FDFA 3U10A 3PUIA 3VD3A 3AJZA 1EY2A 4XFBA 3AKSA 5JIUA 1YLLA 2O14A 4RL7A 1DIWA 2R061 3IMMA 4YW1A 5DZEA 4YFZA 5KC6A 4XVHA 2CSGA 3KVAA 4ISQA 3KT4A 1O4TA 4GWMA 5KC5A 4PF1A 3U37A 1XNKA 4XMIA 5BNNA 4JDOA 2LALA 3I2HA 4QGLA 2O1QA 4X6RB 1G9AA 1EV12 1RUOA 1W8ZA 3T0BA 4LHLA 1JTZX 2DU1A 1RUI1 2A1XA 2BRTA 2Y8KA 4EYUA 3OD4A 1MQTA 2VD7A 3WNMA 1NE6A 3IT8A 1PO11 1SFPA 2WNVA 4CCNA 1W05A 2XLGA 1UMIA 4FCAA 5LBEA 4Y26A 2WNUA 2W91A 5ANQA 1N1TA 3CMGA 4FO9A 3WUCA 2QZ3A 3I2JA 4Q29A 3SNMA 1VBB2 3AC0A 4UYBA 1VALA 4JHTA 2A6YA 1AJKA 1PIV2 3H1YA 3O7OA 2OZ6A 4BYYA 2GN7A 3ETPA 4NR1A 2ZXQA 2PAKA 4QHOA 3WQ7A 4S2HA 2OUJA 3MEPA 2MHFA 4IETA 4CRQA 2ZEYA 1XBFA 4Z82A 3VL9A 4OZOA 3MBWA 2FCTA 3LGRA 3NV2A 1S0JA 4RHV2 5FXVA 1UYPA 2PAMA 4JHZA 4NHYA 2J42A 4R9AA 1DQ5A 2HJIA 4XFGA 4A4AA 4PDWA 4PIXA 4CCJA 1J3QA 3RZMA 2W1QA 3THTA 4FXGB 5KHJA 4LHSA 2PHWA 2TUNA 2B42B 1UY4A 3IDCB 4Z1VA 5CFDC 2D5HA 5D8AB 3N9OA 5I0UA 1X33A 4HVOA 3MW2A 3V64A 3L2HA 5C70A 3OGRA 1JBCA 2ZMKA 1XNTA 2GH2A 1R092 2E7QA 1PZ7A 1H2LA 1NLRA 1PX3A 1V9U2 2CYFA 3DXTA 4HVRA 3C7OA 5F5QA 4B3NA 1RUC1 1IPJA 4K40A 5LA2A 3WDXA 5FPVA 2AZ5A 1Y7BA 2CAUA 4GAZA 4ZHNA 3DECA 1QDOA 1HN1A 2OIIA 4ZXKA 2VZUA 3ZR5A 3KCXA 4TZDA 1AR73 3H8OA 1E5RA 5FV3A 5CKQA 5DAXA 1SG3A 1VE0A 1ZNPA 4EV0A 3T30A 2VQAA 1UN1A 3JD72 1GLHA 2G19A 3Q8BA 3K75B 4QQLA 1GZTA 1REEA 1CAVA 4J25A 4QX0A 5D8AA 3O1UA 4AVAA 1VAMA 5FZCA 4LLFA 3TAYA 2D3SA 4OI0A 1W9FA 4YVWA 3SCGA 1TMF2 1HX6A 3I7DA 3NW4A 4B1MA 4N7IA 3L2YA 5CIRA 2R32A 2XKPA 3KT7A 4HANA 5JCTA 4GJZA 1NLSA 4LBQA 3AYAA 1S55A 1FX5A 1WCQA 1UYXA 5BNNB 3WW1A 2YGMA 1QF3A 3VDCA 2K0GA 3T4HB 3JBG2 1AR93 1Q8OA 3PTYA 3QH7A 2QZ2A 5LBBA 3M3CA 3HEIA 1E5HA 1ZZ8A 2ZGNA 2D7FA 2BOJA 3HN3A 5T54A 4CU8A 5H9RA 1ZBE2 1J59A 4L99A 3WW2A 4BCUA 3WSOA 1IS4A 3MI8A 2G1MA 5EFUA 1DQ2A 4QX7A 4GMP3 4CP9A 4N43B 1VRBA 3E1F1 4K3UA 2IXJA 2FCUA 1AL0G 1NAEA 1AR71 2Y6LA 1GSLA 1LECA 3ZFFA 1LGBA 4BQWA 3RVHA 1W9TA 2HWC2 5JDBA 3TEWA 5C6CA 2XPJA 1VAVA 1OT5A 3AMNA 5DAPA 1H4HA 2K46A 1RMU1 3POEA 4XDOA 2G9GA 4P00B 1PZ9A 1UY0A 2W52A 4WV8A 5KHHA 3ZFFC 2OT7A 4AW7A 3K4ZA 3IB3A 3IIAA 2OW4A 5FYSA 2Z2SB 3DGTA 3T08A 3VD9A 1YIFA 5CU1A 4X6QB 1KEXA 2EAKA 2W5FA 2WZ8A 1MR5A 2XJSA 3ZKUA 4YZ3A 3BIEA 3FUQA 2PYTA 4N9HA 4GIQA 5FZEA 3BB6A 3NJXA 2QQLA 1V6NA 5FOBB 2WJSA 4PJYA 1NCRA 2X5IC 4ZZ8A 4LE3A 1S0IA 3AMHA 3WCSA 4XBLA 4KBZA 1WW6A 1PZ8A 2ZZQA 2BBAA 2EIGA 3ZXJA 1HXS1 2CTVA 2D5FA 1IPKA 4QMAA 3ZYHA 3S5AA 2A7AA 5JPNB 5JSOA 1H6YA 4YW5A 5FP7A 2B8MA 4XJ9A 2JXAA 1OOPA 3O1OA 3WLUA 4XJ8A 5DDJ2 5CBLA 4ARXA 4DY3A 4NHLA 4JKMA 1LOAA 1V6JA 3GCWA 3M3IA 2PHDA 4L11A 1F9KA 5FYHA 5BY5A 4Y1ZA 3U4XA 3ILFA 1VBB1 1B35C 5LZ6A 1BLZA 1AYM2 3ZFGA 3I3DA 5G05L 1JXNA 5KWRA 3O5SA 3WG1A 1A6CA 3ILRA 3NJYA 2G9FA 5A3UA 1MS0A 1UAIA 2OS2A 2PQSA 5FBJA 1DHKB 1HB4A 4XXAA 5JOYA 2KD7A 4KWKA 3KD4A 4IEZA 1AYM3 4CCKA 4FOWA 1GOHA 4XHBA 3WDTA 3KHBA 1RXFA 4R9DA 5KHGA 5DDJ1 3F95A 1L7RA 3H50A 4P9LA 2DBNA 1QJU1 2AH2A 2BU9A 3KF3A 1BBT1 1LKNA 2QE3A 1A78A 4YVWB 4MV2A 1Y9GA 2VMIA 4ORFA 1JZ7A 1AR81 4FI9A 4CCDA 1U0AA 3UYJA 3AK0A 4XXPA 5I91A 1W6OB 2RS31 4JKKA 5FZDA 1AR83 1GZ9A 4KH9A 2JECA 3I49A 1AL23 1QEXA 4AVBA 4EZHA 3KS7A 2JDAA 2EXKA 5FZBA 2JE7A 1OQEA 3KV6A 1JOBA 3LB9A 1VB4A 3NVCA 1OVSA 2RS11 2ZAAA 1U5IA 2YPDA 2H6BA 2DURA 5F37A 4A7KA 4BU2A 2MPFA 3CJIA 1OURA 1J58A 3NMBA 1R64A 4D6QA 5L7OC 2FDKA 1NG0A 5FK7A 3PLQA 4LBNA 5HXVA 1W6NA 1W8UA 2J1EA 5LRSA 1H8TA 2GN3A 5A70A 1RB8G 4NRMA 1POV3 1URXA 5B4XA 1W6OA 2WN2A 1NCRB 2WABA 3CJIC 3ZDVA 4C91A 1ZRCA 3WDUA 2VXJA 4MSVA 3S7EA 4Y1UA 4AFBA 3H9AA 4YZ5A 1QGLA 2XJVA 4YM0A 3ENRA 2YHJA 1GR3A 5CFCA 5FY1A 4GKYA 5JXIA 4QX2A 1EAH3 3BCWA 4GH4C 3MFAA 2W9XA 3SCHA 5IVBA 1W6PA 3PVOA 2UY8A 3WG4A 3UNPA 2MEV3 4LBQD 3S57A 2BFUL 4NHXA 1POQA 1PHMA 3VDBA 2CHHA 4FAHA 3GBFA 1NLQA 4QHZA 4UBGA 1W99A 3PTRB 3X29B 4OFGA 4AVSA 3ZYBA 2JE9A 1N47A 1WLTA 4XEZA 1XQNA 1JZ5A 3VBSB 3VBUB 1AYN2 1J1TA 1RJ8A 2QQOA 2X09A 1XOYA 2Q4SA 1OD5A 2FCVA 3VBFC 2FDJA 1F31A 2XJPA 5BUVA 1SFNA 3M4FA 1APNA 3RZKA 3OPTA 1S4CA 3W21A 3U11A 4MGIE 4OULA 5T5LA 2Y6JA 1NA1C 2PHLA 1P8JA 3H1WA 1HKDA 5T5PA 4TWTA 2GC0A 3JB8A 2GC3A 1RINA 2PTMA 1CX4A 1W6QA 3DEMA 5IAXA 1BZWA 4DUVA 4Y4RA 3M3QA 5E16A 3CEWA 3GHMA 1RMU3 4JDNA 1VBC1 3OBRA 3T2PA 3RMXA 1DQ1A 2GALA 2I45A 3VZLA 1VRH1 5JUVA 3ATGA 1MQTC 3J8F1 4PF5A 3J26N 4YG3A 3NV3A 4GXLA 3F2ZA 2VMGA 2FDHA 4R8HA 2VUAA 4BE3A 2R071 4G4FA 4KU7A 3ZN5A 3ZVXA 4CDWC 2VMFA 3WNLA 3CNAA 4XF9A 2YC0A 1JYCA 4HKWA 5JAXA 3H8RA 3IM0A 4WM8B 3I3BA 1S1AA 3LEMA 5KBFA 2Y0OA 1OD3A 1VBA1 2YMZA 3FFQA 3ZPYA 2XLFA 3QH6A 4MGZE 1YFYA 1TQ5A 1Q43A 2D6KA 3B94A 4I30A 1TNFA 5I0TA 4GULA 4Q4X1 5D1IA 3I54A 4YFWA 4CYDA 3ALQA 2IWGB 4RHV1 4DEVA 2BFUS 3UT0A 5FP3A 2VMCA 3OPWA 4ZU4A 3AFKA 2RJKA 3KB5A 2NM1A 3VB9A 2B4KA 3BU0A 3FN9A 3THDA 5CEHA 1EPZA 4XUQA 2DUPA 4Y22A 2WFF2 3MPBA 4BQ3A 4HMZA 1LHNA 4XTMA 4AF9A 5DXDA 5C8CB 3ZKYA 3LIHA 1NY71 1QJY3 1ZA7A 1A8DA 4BA6A 1OUXA 1W8HA 5F6KA 4XACA 2B9UA 1C8NA 1UIKA 3M3OA 4ZKTB 4AAXA 4GWIA 3I8TA 3KLSA 4UF0A 4OUMA 4YVSB 5LBFA 4M3CE 1M06G 4CEWC 3GCXA 4NIGA 4XZPA 1UZZA 2VW1A 2VCAA 1QXRA 3VBSA 1D0GA 3BPSA 4C8DA 4W6XA 3JB4C 3U07A 2K9ZA 3WW3A 3ORJA 1UO9A 1CAWA 2BVBA 3RRDA 1N1YA 1X8MA 3G6JB 3VKOA 4QXBA 2R062 4JDMA 4NROA 2IXIA 2BDRA 1W6PB 5FO7B 3N7LA 1QMJA 4INDA 5IATA 3GYDA 1JU4A 2RS51 2JG9A 1WGPA 5IVCA 2HWD2 1YQ5A 2JDHA 4E4HA 4RS5B 5IHRA 2W1SA 4UF0B 2RMU3 3AVRA 1XSRA 2UWAA 3ZDSA 1O8SA 3AFGA 4JV4A 4S2FA 3SH3A 4LO6B 4Q4W2 5F32A 5K9YA 3TN91 1TMF1 5JVVA 1IKQA 3P6BA 4LEJA 1SPPB 1PK6C 4XILA 5CG8A 3ME2A 4NVPA 4OHZA 2ORXA 2WC2A 4P9IA 2ZX2A 4Y4YA 4I0WB 1BYHA 2XHNA 2OXBA 5A7QA 3LD8A 2E9QA 3HN1A 2O8QA 2NN8A 5DUWA 1GYKA 1TME1 3AKQA 4HSLA 3LPFA 1SBFA 5CAZA 1O4ZA 2RJ2A 4CE8A 4NPLA 4Z8BA 4P08A 4LXLA 5IK8A 4HZFA 2EICA 2Y26A 1QQP1 4MGSA 1TME3 4AFAA 4QDSA 4MGQA 2WT0A 2A6VA 3DPRB 3THPA 4W8JA 3OUJA 1HB1A 3FHAA 5SV8A 3T3YA 3B5LB 2VMEA 2JDYA 2IFRA 1CX1A 1SLCA 1SMVA 3LZZA 4IL7A 4JQRA 2IFWA 1FOD1 1HQWA 2GZWA 3K4DA 1GZWB 1DFQA 1UW8A 3AMQA 2VTFA 1Y3TA 4IEQA 2ZGSA 2R042 3SCFA 3O1SA 2BZDA 5ACA3 4MHRA 3POYA 5FYTA 1UD1A 4PQ9A 5FKBA 4KGQA 1MZFA 1SCSA 3DL3A 1H1AA 2C9KA 1NCQA 1O6UA 4ASKA 4DB5A 5FPAA 4A3ZA 4B4QA 3H0OA 4LK6A 3PIJA 1XXNA 3ZFGC 4MHUA 3WQ1A 4AAPA 5ACA2 2P2KA 4BK5A 4K21A 3ZM8A 5CA6A 4IV3A 1G8WA 4PT6A 1O3TA 5FY0A 2YUEA 4PBPA 1DU3D 4K20A 1HRI3 4RR3C 2R072 3ILNA 4CUAA 3TOJA 2OKXA 2QUOA 4IE5A 1RUH3 3BU7A 4QAWA 4Y5SA 3WF0A 4IV3C 4FT8A 1LOGA 4N90A 4OI2A 1STMA 3WX5A 3H8XA 3BKZA 1RIRA 1HRI2 1NCQB 4CEYC 3BOWA 1BEV3 3LDBA 4FPEA 4CDQC 2CGNA 2Y0IA 3K3OA 2Z69A 2C1FA 4IV1B 1LEDA 4B4RA 4KWJA 2ZABA 2ADEA 4W50A 5FYCA 4GMP1 3MYXA 2YY1A 3BN6A 4OQ9A 1C8M3 2R49A 1V0AA 2P34A 5A6ZA 2VZVA 4MX3A 5L73A 1QDCA 3U75A 4MO3M 2P5BA 2GNTA 5FJKA 4EZ4A 3BTAA 1MZ5A 5LB6A 2HWB3 3S7IA 4LHNA 4AI9A 4CP1A 4IE4A 1DLCA 2RR13 1RUF1 4EWDA 2VECA 5IK5A 3J7HA 3VHNA 5C4WB 1XE0A 3JBG3 1ULOA 1ZBA1 4N9IA 1V6MA 4Q0QA 2ZBJA 2E6VA 4QQ2A 2LTNA 2C6SA 1W2TA 3I3QA 2YU2A 3T0DA 3ZXEA 1X82A 2FZ2A 1YWKA 1UMHA 4ZXEA 3S0MA 4XPVA 4DXTA 1F15A 4XIOA 1QQP2 4HBNA 3AP7A 4H3WA 5JR2A 1VMFA 1UYZA 1QOOA 4M0NA 1GKBA 2EIDA 3B9IA 2WT2A 2VZQA 1V6OA 3FBYA 4H7MA 5F5IA 1I5ZA 2ZGTA 1A3KA 1DP0A 5CB7A 4ZU7A 4E2QA 3V0BB 3SKJE 4M4PA 1FMD1 5FZFA 1OH4A 4F8AA 5BNOC 2Z42A 1CJDA 3KCCA 3WD5A 5FLJA 1O7FA 2P3IA 5LEKA 1G7YA 1W6MB 3WDYA 5FYYA 2YC2A 4YRDA 5BNNC 1ZRFA 5A80A 1W90A 1PO22 5A6YA 4WM8C 3B69A 5FO8B 1JODA 2JD9A 4NRQA 2BW8A 4TXWA 3EQEA 2W47A 2YBKA 4LITA 2A5ZA 3VBRA 1FI2A 2JDMA 3VBHB 1QJZA 2JG8A 4FPGA 4RHV3 5L7OB 5C5UA 3SH5A 4QPWA 1MACA 4I02A 1ODMA 3ZXAC 4WVVA 2IC1A 4RGAA 3CJXA 3WF3A 1AXYA 4OI4A 3VBRC 2HKXA 3R4DB 3B3QE 5JI9A 1S2BA 4GA9A 1OC1A 4Q0UA 3LWCA 1DDLA 3WF1A 4E27A 1E5SA 2RM21 1XYOA 5JLVA 1HB3A 5H9SA 4DY5A 4HVQA 1PNGA 1E57A 5DG1A 2ERFA 4UW3A 5C9AC 1R1ZA 3D8CA 1RITA 2QQNA 3ACGA 3C2UA 2JICA 3D5OA 1OKQA 1X36A 3GZTB 3CLPA 3HQUA 4I0AA 2YYOA 5DZGA 1S0GA 3JD71 5A7NA 4ISRA 1EUTA 3Q8CA 1FV2A 3VBRB 2D97A 4IE6A 4CP9B 2FDIA 2JE8A 2Y6HA 2D3RA 3FLRA 4COVA 2RJLA 3A4UA 3LA2A 3HMYA 1OBNA 1VB2A 2E31A 4LUKA 1QH6A 5FZLA 1KJLA 5BNPA 1ENSA 3VZKA 3DN7A 5FXWA 3NO8A 1RXGA 4BJ0A 3WF4A 4LKEA 2XG3A 1UPIA 1POV1 3FJSA 2CDOA 3A0KA 1SHWB 1ENRA 4FPLA 5DUXA 3VHPA 3ZFEC 1HRI1 2WZR3 3ABZA 3HT2A 2AYHA 4LR4A 4IEWA 4XFHA 5DAVA 4DUXA 3AZVA 3EXUA 4E4SA 1MQTB 1JYTA 3WP4A 1D7PM 1V6IA 1WA4A 1KRIA 1ZZ7A 4LUMA 1W2UA 2YC4A 3CQOA 4Q0PA 1Z0HA 3WR0A 1CGPA 2V09A 4NIHA 2F6BA 1RUG2 2XKOA 2C9AA 5BNOB 1JHJA 1K5MB 1POV0 1YI7A 4B1LA 4KBBA 4D94A 1RHI2 1RUF3 4K8FA 2A6ZA 1AL21 4AOCA 4LT5A 2J22A 3O1RA 1HDKA 1MPXA 1AR82 2VZTA 2WO2A 3OOXA 4YGBA 1DBNA 1AR92 5EQUA 4JGZC 1B35B 4X8NA 2UWCA 5K0UA 5C4WA 1H1IA 2VNGA 3HPNA 1W8FA 4M00A 3C8XA 4CSWA 5HXMA 3MIEA 4XTPA 3I59A 5FPUA 1XSQA 1ZRRA 2JKXA 1H8VA 4QKDA 2VXRA 4FOVA 4DQAA 1C28A 3VBSC 1SZBA 1JYIA 3D82A 3KVBA 5A1AA 3OY8B 3ZXKA 3KQ4B 1XE8A 1GP6A 2XBO3 1WBLA 3HQXA 3CZUA 1WMEA 2VULA 4CCOA 1N3QA 3LE0A 1QJX3 3FWEA 4MOAA 1VPHA 2YV8A 5A7PA 5EYXA 4IEVA 3NNJA 3GBWA 2ZX3A 5A3MA 5IFPA 1HRV1 1JW6A 1WKYA 3BGAA 3DYMA 2JDZA 1LHUA 4O9EA 1DZTA 5DAQA 5C3PA 2HWF3 3H3UA 3WP3A 4V2VA 3EYPA 2GP3A 2Q1MA 5LK5A 5FP9A 3LAGA 3I2FA 4NJ4A 4BISA 1OF4A 1HXS2 4LO7A 3SHRA 4LMFA 5EP9A 2WYSA 4N53C 1V6KA 1GWKA 3FL7A 4A41A 2A6XA 3IN9A 1OSGA 2UURA 3MPPG 1A34A 1VAKA 3I4IA 1JU3A 4XAEA 5JOXA 3OUIA 3R4UA 5GLTA 1H30A 3NWKA 5FKCA 3GHNA 2ZJCA 4COWA 1NZIA 1GFF2 3HBKA 2YB7A 3BTZA 3P1IA 1HXS3 4XUNA 5FZ7A 1YJKA 3AKPA 4PI2A 2D6OX 4LBLA 5K4LA 1RJ7A 2WR9A 2RS52 1OLMA 2GMMA 3ZIWA 1OPMA 4A7YA 2ZMLA 5A7SA 2JWPA 2XONA 3U14A 1DZQA 3HBZA 4CUGA 1ACCA 4XFCA 3T4VA 1NCRC 1ENQA 1WW7A 4FFGA 3S5QA 1CD3G 1XYNA 5EZWA 3LOIA 3MHZA 4XURA 5J7MA 5AC91 3SKVA 1J83A 2WFPA 2RDRA 5KR7A 2W1WA 4JGZB 3U78A 4CTEA 4AGVA 4P14A 1IQDC 1NOVA 2V4VA 4QXKA 3ST7A 1LNSA 2OPWA 2VOKA 1OOPC 1W28A 1UNBA 3MICA 4SBVA 2IZWA 2PELA 2JKBA 2JD4A 5DUVA 5A3OA 1JZ4A 2ID4A 4XJZA 3DXUA 3CU7A 3J7NA 5IVFA 5I0DA 2ZACA 2DYCA 4D6SA 3OPZA 3MFCA 4CUCA 5C3RA 1QNYA 2HH9A 4QXHA 3W9AA 2W46A 1QJEA 2LRPA 3KMHA 5I8SA 2XH6A 5CFCB 4H55A 2C4XA 4P5YA 2FD8A 2W92A 2ZX4A 3NQHA 3AP6A 4ZS2A 3EHKA 2YG0A 1RUE1 3OEAA 3AYDA 1HLCA 5CKMA 4H14A 1CPMA 2WLPA 3MUZ1 3DUIA 1W2NA 1WD4A 2BOIA 3LEGA 1KJRA 2QNKA 1AXZA 3E5QA 3IAPA
chains in the Genus database with same CATH topology
1O6UA 4TLGA 1OLMA 5LZ6A 1OLME 4UYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O6U A;  4TLG A;  1OLM A;  5LZ6 A;  1OLM E;  4UYB A; 
#chains in the Genus database with same CATH topology
 2Z4F A;  2D6L X;  3AX4 A;  4MXW B;  1VBD 3;  3IDB B;  2D43 A;  2GDF A;  2HWE 1;  1MS3 A;  2A3X A;  1ZX5 A;  5FWJ A;  1BHG A;  4A2U A;  4RGK A;  4QU2 A;  2A6W A;  4PHZ A;  1UZ0 A;  3GF6 A;  3LKJ A;  2VVE A;  3OD0 A;  5FZO A;  1JHN A;  1OH3 A;  4CEY A;  1LOE A;  4YAR A;  4AK3 A;  4I09 A;  4LHK A;  5LY1 A;  1ZZ6 A;  5C8C C;  2BNM A;  1W6Q B;  4KI5 M;  1LR5 A;  4LBO A;  2DTY A;  2WYF A;  1YNA A;  4LA2 A;  1VRH 3;  1W06 A;  3LPG A;  1LHW A;  5FY5 A;  3POG A;  4OYU A;  2WKK A;  4Q1P A;  3PUA A;  5A7W B;  1E5I A;  2X29 A;  1F5J A;  3ECQ A;  1I3H A;  1YQ6 A;  4PIY A;  2Q8E A;  3ZO0 B;  2YFZ A;  4BQY A;  1TZO A;  3LIG A;  5EPA A;  3AYC A;  2JB4 A;  2TEP A;  4Q4X 2;  4M3C A;  4XQ4 A;  5LEJ A;  3ACF A;  1VRH 2;  3BTY A;  3GBG A;  5FZO B;  2PHX A;  1SLI A;  5J09 A;  1H8T C;  4XFI A;  1AR6 3;  1GU3 A;  4CEY B;  2PHF A;  1OQD A;  1QH7 A;  1WWY A;  1JZ2 A;  1H1M A;  2XVG A;  3N7M A;  2VZ3 A;  3JBG 1;  5FZA A;  1RVF 2;  3MV0 1;  4FQ4 A;  1RUJ 1;  4I3G A;  5K7P A;  3WQ0 A;  2RMU 2;  5IFT A;  3AL5 A;  3MV1 1;  1BK0 A;  1W0N A;  3K51 A;  2AGS A;  4QX8 A;  1DZR A;  2V5D A;  5HV0 A;  4ERO A;  5IVV A;  1ONA A;  1ZBA 2;  2VPV A;  2ORZ A;  4LA3 A;  4OI1 A;  2AEY A;  3AMP A;  5T5O A;  3D0S A;  3DYO A;  1O3S A;  1LGN A;  2FBE A;  2GP5 A;  2PLV 3;  1BVP 1;  1WW5 A;  2DVG A;  3OTF A;  3VHR A;  1HV0 A;  1EAH 1;  1T6G C;  2I74 A;  5FZI A;  3BUC A;  2PHU A;  1UZW A;  3FUO A;  4OVE A;  2V72 A;  4QXC A;  3ZX7 A;  2VMH A;  1RMU 2;  1YJL A;  3IAQ A;  5EJ1 B;  2C5D A;  3ZSE A;  2XML A;  4Q2F A;  4MAD A;  1SLA A;  4CCM A;  4A7Z A;  5FTT C;  4C1W A;  1ODN A;  1COV 3;  1D0H A;  1PK6 B;  4I3P A;  4YM2 A;  3WHT A;  3WQB A;  2VUC A;  3BTX A;  1QXJ A;  4Y1V A;  1ST8 A;  4COZ A;  1OUS A;  1EV1 1;  3ZYI B;  4URT A;  1TME 2;  3M2M A;  1RUI 3;  2GNM A;  3HT1 A;  4QPI B;  2ZHM A;  2E53 A;  5E89 A;  4XE9 A;  1MS5 A;  3BI3 A;  1YUD A;  5IWF A;  3RYR A;  4LBK A;  3UGH A;  4BIF A;  3CF6 E;  4MLO A;  4JCK A;  5IUQ A;  1NQJ A;  3DPR C;  4OMC A;  4DO0 A;  1OF3 A;  4UW6 A;  1CAU B;  4HET A;  3VZJ A;  2VZ1 A;  4ET7 A;  2DUO A;  2WZE A;  4DXZ A;  4AQS A;  4YSF A;  4YW4 A;  3Q8F A;  3UJQ A;  2JDN A;  2VNO A;  3U0Z A;  1V00 A;  2Y6G A;  3P3P A;  4OLL A;  1ULE A;  5C8W A;  5IVJ A;  2R0F A;  1ASJ 2;  3TWI A;  3ZYR A;  3OEB A;  3WEZ A;  4CDW A;  4AHX A;  3RPQ A;  4UW4 A;  5GZE A;  2A3Y A;  3IPV B;  2W39 A;  5GZF A;  3PJQ A;  2Y34 A;  4Q4Y 3;  4QPI A;  5FRA A;  1GNH A;  2WWU A;  4IW3 A;  4FPO B;  4QM8 A;  4BHP A;  3BIW E;  1Q8P A;  5EYY A;  3VBU A;  2VOW A;  1KD7 A;  3NKT A;  5GZD A;  1MVE A;  5A7W A;  3C7E A;  2CGO A;  2HWF 1;  3ZFG B;  2GAU A;  3CBN A;  3FX3 A;  4HOO A;  3N36 A;  4PDW C;  2VZO A;  1SLT A;  4AEJ A;  2VR4 A;  3T0A A;  5JOW A;  1W2A X;  2DFC A;  5J37 A;  1FPN 1;  2ARB A;  3VZO A;  3N35 A;  4XJA A;  1T6B X;  3D6E A;  1QJX 1;  3M70 A;  4AQ2 A;  2ZA9 A;  5L19 A;  1BXH A;  2XVK A;  3FMG A;  1V9U 1;  2HEY F;  3OBT A;  3VZN A;  1PO1 2;  1Z78 A;  4BQ4 A;  2JIG A;  1LEN A;  2X5I A;  1GV9 A;  1UU4 A;  4HKO A;  3AZY A;  3D3A A;  4AI0 A;  5AC9 3;  2Q8C A;  1W39 A;  4P5H A;  3O12 A;  1NQD A;  3AMM A;  2WL1 A;  3CO2 A;  3UKV A;  3WCR A;  3KCY A;  4WM7 C;  1JS9 A;  1NY7 2;  4BQ5 A;  3ZFE A;  2R06 3;  5T50 A;  4JVA A;  3VBO B;  3ZXF A;  2QTW B;  2RS1 3;  5A32 A;  4NRP A;  3VD5 A;  2D98 A;  1NUK A;  5FY9 A;  1C8M 2;  4I01 A;  5AVA A;  3SEE A;  1FAY A;  4CDU B;  4N53 B;  3ZXD A;  4UW5 A;  1CZT A;  5AC9 2;  1H2K A;  2ZPX A;  1TNR A;  2VZR A;  3OG2 A;  4QX3 A;  4ZU5 A;  5FYI A;  1RUG 1;  1W8O A;  1UX7 A;  3VKM A;  1U5Z A;  3WZ1 A;  4AG4 A;  1JZ6 A;  4XAB A;  1FNZ A;  3OB8 A;  4NAM A;  1RHI 1;  1YQ2 A;  4L9B A;  5D8A C;  1VBE 2;  4EQV A;  5ERL A;  2V73 A;  1JYW A;  1BBT 3;  1LJ7 A;  4JTN A;  3S6P A;  3ZYF A;  1D4M 3;  2AAC A;  3LF7 A;  4D7Y A;  1WLW A;  2ZX0 A;  2QQI A;  4XBQ A;  3T2O A;  4QU1 A;  4AL9 A;  4FP3 A;  1UY3 A;  3POW A;  5JZG C;  5BXX A;  1CN1 A;  5GLW A;  1WCD J;  4TYS A;  2H0B A;  4XFF A;  1LOF C;  1LCL A;  5FZK A;  1WCS A;  1QQP 3;  3LEK A;  3TRS B;  2ZCW A;  1CON A;  4XMA A;  5F5C A;  1ZZC A;  5FQ0 B;  2XJQ A;  5H9P A;  4Q27 A;  1QXP A;  3MUY 1;  4CP2 A;  2ZGR A;  5FR3 A;  1PIV 3;  2XBO 1;  2YDE A;  1FPN 3;  5T52 A;  4CEW A;  1UPS A;  4PCR A;  1EP0 A;  2JDU A;  4BQX A;  2OX0 A;  3AKT A;  4OCT A;  5F9T A;  2VVD A;  1XRU A;  3N9N A;  3MW3 A;  3A22 A;  1ZVF A;  3TBD A;  4X8P A;  1OMI A;  2VZP A;  2QQU A;  3ZYP A;  4CCL A;  1XNC A;  3SC7 X;  2BP6 A;  2A75 A;  2CDP A;  2RM2 2;  1F35 A;  4AEM A;  3E6D A;  4RFT 0;  2GME A;  1KGY A;  1OKO A;  3JU9 A;  1I9R A;  2LUW A;  2VOX A;  4QKN A;  4YVS A;  4IV1 A;  2VBD A;  3M8L A;  4PLN A;  1H6X A;  2JX9 A;  4NUB A;  2WAO A;  2AUY A;  5FQ0 A;  2WS9 2;  3B02 A;  1YQ8 A;  4HSJ A;  4EN6 B;  1XJA A;  5FMD A;  4GJY A;  2BGO A;  4MUV A;  4Q5O A;  5DUU A;  4YPJ A;  1I5P A;  4YVS C;  2JDK A;  1H9W A;  1NT0 A;  1IPS A;  2NZ9 A;  4NIA A;  2G9Z A;  2D3P A;  4QQP A;  3LOB A;  3SEP A;  1MS4 A;  2BWC A;  4LE4 A;  1H2M A;  1K45 A;  4L0P A;  3RJR A;  1OOP B;  3VL8 A;  3A21 A;  2VNV A;  1YC6 1;  2J1V A;  2EXI A;  3VLB B;  3WW4 A;  1LRH A;  5A3P A;  5ISL A;  2HWD 1;  2XOM A;  3IBM A;  5CG9 A;  4KG8 A;  2XUM A;  1YQC A;  2VE1 A;  4Q0V A;  5JSR A;  2R07 3;  2Y60 A;  3UV9 A;  1QOT A;  1WMF A;  1YIP A;  3MLK A;  5FP4 A;  3A23 A;  5A32 B;  3VBO A;  3WV6 A;  2ZHN A;  2D40 A;  1PVC 3;  5IAV A;  3VD4 A;  4G9S B;  1N3P A;  4GH4 A;  1NE4 A;  2ARA A;  4JX0 A;  3OGS A;  2WZP P;  3THC A;  1IOA A;  3HVD A;  1RUC 3;  1W8W A;  3VD7 A;  3AP5 A;  4A45 A;  1BEV 2;  2DV9 A;  1R09 3;  1QJY 1;  4KQ7 A;  3K3N A;  3L9J T;  4CU6 A;  2JDP A;  1AX1 A;  3HWJ A;  2WSU A;  1PVC 2;  2QQP A;  4ES9 A;  1W8N A;  2ZS6 B;  3OF1 A;  4K7J A;  5IT6 A;  2XHK A;  2W3J A;  2WNE A;  2XL9 A;  3ZFE B;  1R1A 1;  2DCZ A;  2SLI A;  1RUC 2;  1GQG A;  4YNI A;  2JB8 A;  3WNN A;  1YFW A;  4XIK A;  3ZIX A;  2H6C A;  3UKN A;  1LU1 A;  4BIO A;  2VJX A;  2J7M A;  1N1V A;  3UGG A;  5L9R A;  5FMO S;  1GAN A;  3ZPO A;  4U36 A;  1BMV 1;  1AF9 A;  1GIC A;  1MS9 A;  2JG8 B;  3ASI A;  2RR1 1;  4NWW A;  3S30 A;  4D3W A;  5A6X A;  2KA3 A;  1VBA 3;  3POS A;  4R9C A;  1J1L A;  3NKG A;  1ND2 B;  2ZKN A;  1JYV A;  1R1A 3;  2WO7 A;  1CIY A;  3GM8 A;  4LBJ A;  5C8C A;  5F3C A;  1RC6 A;  4CEW B;  1BVV A;  1DGW X;  1DF0 A;  4QB2 A;  5FZ0 A;  1LGC A;  2ZOE B;  1IHM A;  2IXK A;  2AEZ A;  3H3Z A;  1W0P A;  2GC2 A;  2ZZJ A;  4H7L A;  3E5X A;  1VBA 2;  4UWD A;  3JUU A;  1R09 1;  4JKL A;  2HEV F;  2JG9 B;  4JTO A;  4P9J A;  4D8M A;  4Q8K A;  1R1A 2;  1ZBE 3;  1QKQ A;  1PO2 1;  2F4P A;  2YPJ A;  1YHF A;  5C5T A;  4E2S A;  2D6M A;  4CXY A;  2WNU B;  5FMC A;  1VBC 3;  3KV4 A;  4UOJ A;  5FZM A;  3ZMO A;  5DG2 A;  3WIN E;  1GP5 A;  2EA7 A;  1HJG A;  2VM9 A;  5B2G B;  3VZM A;  4CUB A;  3Q8A A;  4YYO A;  3FHI B;  1K5M C;  1W04 A;  1C1F A;  4M0H A;  3VDA A;  4RQP C;  1IGO A;  1QY4 A;  2GSY A;  2X05 A;  1OXC A;  4R52 A;  5EJZ B;  1UWW A;  5EHD A;  2P6H A;  4DFS A;  1VBC 2;  1DGL A;  1SCR A;  2PMW B;  1J3P A;  3RJ2 X;  1FNY A;  4KWL A;  2VCB A;  3QBQ A;  5L9V A;  3P5B A;  4AED B;  4YZ4 A;  5FY4 A;  2DCJ A;  2ATF A;  3ES4 A;  4LKS A;  3ACL A;  1UKR A;  1FXZ A;  1KIT A;  4MGY E;  5J36 A;  2WO1 A;  3NST A;  4FXK B;  5F39 A;  3JQX A;  2HWB 1;  5DAB A;  5L36 A;  4WVM B;  4QWN A;  3U4S A;  1H2N A;  2OQ7 A;  2ZTN A;  3ZSL A;  1I1E A;  1ULF A;  1ALY A;  3WG3 A;  2B45 X;  2BGC A;  5A33 B;  2WA4 A;  2R0H A;  4NHK A;  2DBI A;  4WVW A;  3BPZ A;  1PGW 1;  4I0B A;  4EN9 B;  4W6Y A;  1AYN 1;  4OUS A;  4BDV B;  2E7A A;  4AI1 A;  5JWP A;  1PNF A;  3INA A;  4XQD A;  1RTV A;  2DVD A;  2Y64 A;  3GJA A;  5FYV A;  1O4Y A;  2DU0 A;  2WSV A;  2C0Z A;  5FLH A;  3EO6 A;  5LWB A;  1IKP A;  5CVR A;  2RE9 A;  4AVC A;  2VC9 A;  1K3I A;  1DYP A;  1AX0 A;  4B7K A;  1W9S A;  3KZ4 C;  3RG0 A;  1LB2 A;  1RUH 1;  1UMZ A;  4Q4V 3;  3A7Q A;  4DUW A;  1RUD 2;  2OZJ A;  2RDN A;  1XNB A;  2W0X A;  3DPR A;  3OY8 A;  3POI A;  4RD7 A;  3LEI A;  2P6C A;  4PLO A;  1ULD A;  5HCA A;  4YW6 A;  4LOR A;  4IGQ A;  3ZSK A;  1W3V A;  3I3E A;  2WZR 2;  3GJB A;  5C9A A;  2PAE A;  3CL1 A;  1GWL A;  3ELN A;  3ES1 A;  1VMH A;  1CIW A;  5HCF A;  5L9B A;  4Q4V 2;  3TN9 2;  3WNP A;  3N4M A;  3E97 A;  1VJ2 A;  2Y33 A;  1PGW 2;  4XF1 A;  5FUN A;  2WNU C;  5LA9 A;  4M4R A;  3VBU C;  5A6Q A;  5EJ3 A;  1Z7S 3;  3I3M A;  1CJP A;  4YW3 A;  4E4D X;  3RYP A;  3SLI A;  1HJF A;  3BAL A;  1I6X A;  4QPI C;  5C3S A;  4QQH A;  4Q1R A;  1LOC A;  3K4A A;  5FXZ A;  3WF2 A;  1RHI 3;  1RUF 2;  1YI9 A;  1GNZ A;  5FZ8 A;  5JI7 A;  1QWR A;  3TN9 3;  1GMM A;  3IZO A;  2W08 A;  2BYV E;  4AFD A;  4BZ4 A;  4NPM A;  1W6M A;  3ACI A;  2Y6K A;  5EWS A;  5FZH A;  2XWB B;  2BGP A;  1WMD A;  1Z7S 2;  1BCX A;  2DCT A;  3MID A;  1C57 A;  4FP2 A;  2ZHK A;  2X53 S;  2Y6F A;  3AP9 A;  1ND2 A;  3H7Y A;  3MIH A;  3QCW A;  4YG0 A;  5KXC A;  4UBH A;  3URF A;  3ZYJ B;  1QJU 2;  3HNY M;  4WM7 A;  4QX1 A;  4YW7 A;  1O91 A;  1PMI A;  2TNF A;  5FWE A;  2BNO A;  1PVX A;  4HXC A;  3HAG A;  1AXK A;  1JMU B;  4AQ6 A;  3W20 A;  1JUH A;  3K46 A;  4CA9 A;  2F17 A;  1IS3 A;  1OI6 A;  2AR6 A;  4LO5 B;  3PUS A;  2VH9 A;  1LHO A;  2GMP A;  3E6B A;  4FOQ A;  1QIQ A;  5K0U C;  1QJX 2;  2QQM A;  4AI2 A;  3NNL A;  4AR2 A;  1SAC A;  5CNA A;  2FQP A;  4F3J A;  3AXD A;  2DF7 A;  3NRU A;  4ARY A;  4HG6 B;  2IXC A;  1MZ6 A;  1K12 A;  4XDQ A;  4A44 A;  1UL9 A;  4AED C;  4ZZ5 A;  4L92 A;  1AYN 3;  3ZYG A;  3DF0 A;  2XB6 C;  5FPX A;  2PLV 1;  5LRR A;  4IDZ A;  4CCC A;  4RS5 C;  5BNP B;  5A33 A;  3ZSJ A;  3RI8 A;  3N7J A;  3ZR6 A;  3R05 A;  1AR6 2;  4AED A;  4YM1 A;  2P4E A;  3UES A;  4HPK A;  5J96 B;  1GZC A;  5CIS A;  4TN7 A;  5FZ3 A;  2ARE A;  3ZOI A;  5J48 A;  1BKZ A;  3AZW A;  1IS5 A;  5FZ1 A;  3B9C A;  2Q8D A;  2RS5 3;  2WIN B;  2XGX A;  1WBF A;  1FOD 2;  2XQR A;  4PBO A;  1JYX A;  4F7Z A;  1QOS A;  1RUE 2;  2W95 A;  1S2K A;  3OGG A;  2JG9 C;  3BOP A;  3N9Q A;  5DQ0 A;  3TEX A;  1YEW A;  4BME A;  2B9V A;  5K8S A;  5DAW A;  1VMJ A;  1UXX X;  1DGR N;  1S0B A;  2G4I A;  1GWM A;  1CZV A;  2XWJ B;  3CKH A;  2HBU A;  1N3O A;  1RYY A;  3P3N A;  4LJH A;  5LK7 B;  3FLT A;  4YW2 A;  2BWA A;  2WRA A;  3VBH A;  1EPW A;  3DYP A;  2RG4 A;  2XJU A;  1GP4 A;  3SMH A;  4TLF A;  5FMB A;  4MXV A;  4HPK B;  3ZMN A;  4UFH A;  3SXW A;  3RZZ A;  2XDV A;  1Q8S A;  1ZM1 A;  1YO8 A;  2J1R A;  2KR2 A;  2ZGP A;  2VVF A;  4IV1 C;  3NNF A;  3O0W A;  3VBH C;  3UET A;  4BH9 A;  2VZS A;  2R30 A;  2NYY A;  4XUT A;  5FBZ A;  2OVU A;  2ENR A;  3LQC A;  2X10 A;  1RUI 2;  3T1M A;  3AM2 A;  5LAS A;  4FPK A;  3KT1 A;  3QOP A;  5FDB A;  2Q30 A;  5ABJ B;  5C7G A;  5C33 A;  2UU8 A;  1PGL 2;  5LY2 A;  1FYU A;  5JMC A;  1XND A;  4Y1Y A;  5J98 B;  5FFO C;  3HIF A;  5FPZ A;  3POJ A;  3GDB A;  3ZN6 A;  2ZGM A;  4HFS A;  4NO4 A;  2HWE 3;  3DCQ A;  5D21 A;  1YFU A;  3MF6 A;  2LM3 A;  5T3N A;  4U2A A;  4IES A;  4CDX C;  4F83 A;  2VTX J;  1X9T A;  4Y3O A;  2Q1F A;  4TTG A;  1CAX B;  5F7U A;  1QNW A;  5FAX A;  2DTW A;  1VBD 2;  5J1X A;  5JXH A;  2E33 A;  1YFX A;  4OMD A;  4FFH A;  4MYE A;  4DRR A;  3LSE A;  4FPC A;  1GQP A;  4C0B A;  1WZX A;  1RVF 1;  1CAV B;  4N43 C;  1GOF A;  5APA A;  5I0S A;  2E63 A;  4C0H A;  4KWU A;  4ZON A;  5LCW L;  1W03 A;  3RDI A;  1S0E A;  3AYE A;  5ANN A;  4UFI A;  1W6N B;  1LOD A;  5LBC A;  3WDW A;  4E8D A;  3C3V A;  5JPM B;  2DUQ A;  1KS5 A;  1XB9 A;  1HRV 2;  2DWR A;  1Y43 B;  3AP4 A;  2CY6 A;  2I2S A;  3J8F 3;  1SDW A;  2WFF 3;  4N43 A;  4PQQ A;  4EN0 A;  1C1L A;  2RDS A;  3UL2 A;  4LTA A;  2E32 A;  2BVV A;  1SDD B;  4QT6 A;  4LLO A;  5FYM A;  2BV4 A;  3KV5 A;  1PO1 3;  1AHS A;  4GZ9 A;  1G9C A;  3IDE A;  1B35 A;  2N7G A;  4FQZ A;  2ETE A;  4CDU C;  3N9P A;  4A3X A;  2D93 A;  3TEZ A;  1US3 A;  4Q8L A;  4QGM A;  3J8F 2;  1U5Y A;  2HWD 3;  2VL4 A;  4O65 A;  4RN5 A;  2JG8 C;  4ZS3 A;  4A6S A;  4JGY A;  2MNG A;  3PME A;  3I59 B;  2FZ1 A;  5FY8 A;  4L2N A;  1UOJ A;  1QU0 A;  4OHV A;  4QB1 A;  1U12 A;  1S2E A;  2JEN A;  2Q5T A;  2RS1 2;  4FPJ A;  4LPL A;  4HK8 A;  1QJF A;  4JRL A;  3RZJ A;  4ITC A;  4JGY C;  3W59 A;  3ZFF B;  1D4M 1;  2R7E B;  5FYZ A;  3KWV A;  4JZR A;  3IMN A;  3EB7 A;  1UQX A;  2PHT A;  2BTV C;  1BJQ A;  4W6W A;  5F3I A;  2ZAH A;  4XF4 A;  4BQ1 A;  1LUL A;  1UF2 C;  4JRA A;  1U5X A;  5E8A A;  3USS A;  5KHI A;  5I8Y A;  3C7H A;  4IQP A;  1HW5 A;  4QM9 A;  5E6H A;  2WWS A;  5AVP A;  5DPN A;  2WNV C;  1RED A;  2OQ6 A;  5ACA 1;  4GB3 3;  1MVQ A;  5IW0 A;  5F5A A;  4Z2W A;  5HPO A;  4TSV A;  1C8M 1;  5AFE A;  1D4M 2;  4FTE A;  3ZXL A;  4KNC A;  4M3C F;  3PVN A;  3VDD A;  2VGD A;  1F5F A;  3IPV A;  4XUO A;  3TNQ A;  2Q8O A;  3U1X A;  5IVY A;  4UFL A;  4D0Q A;  4B4P A;  5HBA A;  4FSJ A;  4Q0S A;  4EN7 B;  2XR4 A;  2IXL A;  3CIH A;  1AX2 A;  2P17 A;  1BEV 1;  1AUY A;  1D2Q A;  1XNA A;  2ADD A;  2WQ4 A;  5T55 A;  4FPF A;  2BUK A;  4YG6 A;  2R04 1;  1GOG A;  3RYK A;  1WLC A;  2R6Q A;  4RQP A;  5FYU A;  3IDA A;  3VDD C;  4C90 A;  1D4V B;  2O8O A;  2ZEW A;  3MIB A;  1OHF A;  1O5U A;  2VMD A;  2UY9 A;  4J6G A;  1PIV 1;  3NAP C;  4G3Y C;  1PMH X;  1VR3 A;  4XZU G;  1FPN 2;  1ZYB A;  2A71 A;  3GNE A;  3RQ0 A;  3KF5 A;  1XU2 A;  4OHX A;  2NMO A;  4V2W A;  3WNO A;  4QDQ A;  3ZN6 B;  4BM8 A;  4XJU A;  1SBE A;  1ND3 B;  5FXX A;  4LBQ B;  3G7D A;  2ES3 A;  2WII B;  3K2O A;  5TSW A;  3WNX A;  1UU5 A;  1HV1 A;  2VW0 A;  4MVT A;  3R6S A;  4RA0 A;  1VBB 3;  1WMX A;  2R04 3;  5A1L A;  2XVL A;  4O7X A;  1SEF A;  4DXS A;  1CAX A;  5DMY A;  4YZ2 A;  5ABJ A;  5FCC A;  2QQW A;  3OYW B;  4QDR A;  4AZZ A;  4LO4 B;  3KHC A;  3TB0 A;  4YVW C;  4R4Z A;  5SV5 A;  1OFS A;  1PMJ X;  1X8E A;  4AFM A;  1ULG A;  3DKQ A;  1ND3 C;  2WS9 3;  2WA3 A;  3KSC A;  3GGL A;  2PN5 A;  3KV9 A;  1M4W A;  4QQO A;  1W9W A;  3AL6 A;  4ZPI A;  4CU9 A;  5JR7 B;  2VTX A;  4DPN A;  3USU B;  4CCE A;  4BLJ A;  1ASJ 3;  2NMN A;  3VKL A;  4M3C B;  1OPO A;  3RGB A;  4E2G A;  1ND3 A;  2FMD A;  2YGL A;  5F3E A;  4D7S A;  3VUO A;  4Q4Y 2;  1G9B A;  3PMS A;  3I97 A;  1PX4 A;  2QJV A;  2ZHL A;  2DVF A;  3QD6 A;  1RUH 2;  5FJH A;  1LU2 A;  1B09 A;  4CU7 A;  1NXM A;  3JQW A;  2ZMN A;  1US2 A;  1Q8Q A;  2QQV A;  1NXD 1;  1JZ3 A;  5FPB A;  2GU9 A;  3PVE A;  1XC6 A;  4NII A;  4AHY A;  4AVV A;  1MS1 A;  3HNM A;  4MGT A;  1C3H A;  1V9U 3;  3WP6 A;  4BXS V;  2BER A;  3N3H A;  4EWA A;  2QDN A;  5LAT A;  2ZGO A;  5IVE A;  4Y20 B;  2ET1 A;  4FTS A;  1COV 1;  1OLQ A;  5HV4 A;  1ZRI A;  4NHM A;  4NOT A;  5BNQ A;  5F1R A;  2PQQ A;  3BVC A;  1AR7 2;  3VGI A;  4DIN B;  1ZBE 1;  3HR9 A;  4Z92 B;  2C26 A;  1UY1 A;  1W8T A;  1FV3 A;  2Y38 A;  2W87 A;  3DKW A;  3JD7 3;  4LIV A;  4W4Z A;  1R08 1;  2HWB 2;  3MDP A;  1UY2 A;  4Y5T A;  1G86 A;  4QX5 A;  1G6N A;  4IXL A;  5JSP A;  3RZG A;  1HN0 A;  4BPZ A;  2VW2 A;  4IEY A;  2L9L A;  5C3Q A;  1JN2 P;  2KM2 A;  3B00 A;  4CPB A;  4JAA A;  1TMF 3;  1REF A;  2ZGK A;  4GKX A;  4Z07 A;  1OLM E;  1V70 A;  1BQP A;  1H8T B;  3N9L A;  4PDW B;  4Z2A A;  1CPN A;  1LHV A;  1SLL A;  3MW4 A;  4J1W A;  4MXW A;  1KDK A;  4LKF A;  5B4N A;  1VBE 3;  4RQP B;  2VQU A;  3H8U A;  3I2K A;  1BBT 2;  5GLZ A;  2ARX A;  1NA1 B;  3AZZ A;  4AI3 A;  3GZA A;  4CVU A;  4FAG A;  1JZ8 A;  1JYN A;  2TBV A;  4IEX A;  5K0U B;  4EN8 B;  2D44 A;  5G04 L;  5FOJ B;  1IS6 A;  1WD3 A;  1FMD 2;  3RNS A;  1S0F A;  4N8M A;  5FMO L;  2RR1 2;  3I2D A;  3ZSM A;  2YZ4 A;  1BMV 2;  1RL3 A;  4IEO A;  3LFM A;  1S0D A;  1XPW A;  1EV1 3;  4LOT A;  3MZH A;  1Y4W A;  1SFY A;  1MEC 2;  1H0B A;  2WWJ A;  4I2O A;  4L97 A;  2XLA A;  2YU1 A;  1XU1 A;  4HON A;  4NAO A;  4P9X A;  4AEK A;  1FMD 3;  1UCX A;  3E5U A;  5C4W C;  1TEI A;  2A3W A;  3WY6 A;  2LS6 A;  1DQ4 A;  1PO2 3;  3SH4 A;  1Q8V A;  2AEN A;  2W68 A;  4SLI A;  2ET7 A;  3KGZ A;  3NJZ A;  4IE7 A;  1YXW A;  5FP8 A;  4OQ8 A;  4R9B A;  2YFU A;  3O1V A;  1LOB A;  4NID A;  1MEC 3;  4XF3 A;  4QPG A;  1JOJ A;  4XYX A;  3V0A A;  4PI0 A;  3TYJ A;  2RHP A;  3H1M A;  4S2G A;  1BK1 A;  1LOF A;  4XJW A;  2RM2 3;  4GMP 0;  2V4A A;  3NV4 A;  4FVV A;  1UU6 A;  2OPK A;  4QGN A;  1ZA4 A;  3FZ3 A;  3OCP A;  3TEY A;  2E51 A;  2VQ0 A;  2CL2 A;  3QLQ A;  4CDQ B;  3BYW A;  3MGU A;  4LOS A;  1F8V A;  1H4G A;  4XFA A;  5EXO A;  2EAL A;  5BYN A;  1AL2 2;  4JQT A;  3W5M A;  2VOT A;  3CJI B;  1DCS A;  4L8Q A;  4AI8 A;  1MS8 A;  1UZV A;  2ILM A;  4YZ1 A;  3H42 B;  3TNP B;  3LA7 A;  3USU A;  4QKB A;  4BXF A;  2YBP A;  5CFD B;  1C5I A;  5JXG A;  4IE0 A;  1AR6 1;  2D6P A;  5GM0 A;  3W5N A;  2IUW A;  4KU8 A;  4MET A;  3V0A B;  1W2O A;  1X9P A;  2B7Y A;  4N53 A;  5DN2 A;  4Y20 A;  3WG2 A;  4OHY A;  5JZG A;  2O0O A;  3MF9 A;  3C7F A;  4K8R B;  3PJY A;  3O0X A;  3DV8 A;  5E1R A;  2W1U A;  4DNY A;  4ES8 A;  4DMI A;  1MEC 1;  4XAA A;  2RV9 A;  1KDM A;  1CAU A;  1R08 3;  2PHR A;  3H3L A;  4CDQ A;  3LDK A;  2OUH A;  1AJO A;  2VQT A;  2P3Y A;  1PK6 A;  3T2T A;  3T2Q A;  4AVT A;  4DOU A;  4BK4 A;  3RFR A;  4DIQ A;  1G9F A;  5M0T A;  5KXD A;  2BJS A;  1PGL 1;  3VBF B;  2CV6 A;  4O9G A;  4O61 A;  2H0V A;  2WT1 A;  2W2I A;  2ZEX A;  3K77 A;  5E88 A;  5GLU A;  5GKA C;  4CDW B;  4D7T A;  1O5L A;  4OHW A;  1R08 2;  4NN0 A;  1NKG A;  5F6L B;  3HJR A;  3R4S A;  5IK7 A;  4XUP A;  5CFC C;  3O1M A;  1DQ6 A;  2VCC A;  4M01 A;  3AB0 A;  5FK8 A;  2PA7 A;  1JH5 A;  2NQY A;  4WZF A;  2HYX A;  2YBS A;  1CR7 A;  3ITQ A;  2GC1 A;  5IJR A;  3RMY A;  2PFW A;  4IGP A;  5CKN A;  2HEW F;  2XUE A;  4N7U A;  2GND A;  4COU A;  1WUV A;  1VBD 1;  3RS6 A;  4ATE A;  2Z79 A;  4KGG A;  5J3U A;  1XYP A;  2QKD A;  3E6C C;  3K48 A;  1SLB A;  3O14 A;  1HB2 A;  4JC1 A;  4K1Z A;  4E8C A;  4RYD A;  1EYB A;  1JI6 A;  3V65 A;  1S0C A;  5A7O A;  2ZGL A;  2UWB A;  3LDR A;  2LW8 A;  2QDR A;  4LBM A;  3VBF A;  1OQ1 A;  2R16 A;  1GBG A;  2UYB A;  3AZX A;  1PM4 A;  1DYK A;  2J1A A;  4ASM B;  1RUG 3;  4MZU A;  2WS9 1;  5CAD A;  3PVB B;  3WNK A;  1XE7 A;  2DVA A;  3ACH A;  4NMI A;  1NA1 A;  1Q56 A;  4LUL A;  4WVM A;  4Y5Z 0;  4AHZ A;  4B8E A;  2HYK A;  3H7J A;  2YRO A;  1QJU 3;  1FT9 A;  2WQ8 A;  2XBO 2;  1W3X A;  3MIF A;  3WP5 A;  4UFK A;  4KG0 A;  1ULP A;  4BMB A;  2VBB A;  3POF A;  4K6B A;  4QPG B;  2WNO A;  1K5J A;  3OSD A;  4IEU A;  4CDU A;  3I2I A;  1LEM A;  1O59 A;  4UFM A;  2P1B A;  4IUG A;  1ENX A;  3OGJ A;  4UAP A;  2JJ6 A;  2HWC 3;  1GUI A;  3I2G A;  5KXE A;  1F2N A;  3BOD A;  1RUD 1;  4WM8 A;  1NZC A;  1LTE A;  2X5I B;  5C3O A;  1WCU A;  3PIG A;  4P9Y A;  4EE2 A;  1VP6 A;  5FYB A;  1KXG A;  2I07 B;  3JZV A;  4UI9 L;  3N9M A;  4XF0 A;  5HCB A;  5LA0 A;  4RR3 A;  5JOZ A;  4FFF A;  5BPX A;  2XXZ A;  4E9K A;  2DFB A;  4HLT A;  2XL7 A;  4YWA A;  1EAH 2;  1JUI A;  2RS3 2;  3M1H A;  1RUN A;  1A8M A;  4XCA A;  5KXB A;  4GD4 A;  2MEV 2;  2WLQ A;  3Q9O A;  4FOY A;  4D69 A;  3POB A;  4GH4 B;  2FHR A;  4Q26 A;  5T5J A;  2NP0 A;  1DYO A;  4HK9 A;  4ZY9 A;  2LRO A;  4DS0 A;  2VY0 A;  2WQZ C;  1YCI A;  3W58 A;  2CU5 A;  1WA6 X;  2R1B A;  1LES A;  2HWF 2;  3C7G A;  3PUR A;  4V1P A;  2RS3 3;  3RWK X;  4RSU A;  4BOW A;  2J1S A;  2C24 A;  2P37 A;  5CZK A;  1J3R A;  2B5H A;  2SBA A;  2PXJ A;  1ZRD A;  3ZN4 A;  4RR3 B;  1KFX L;  5CFD A;  3PDQ A;  1Z7S 1;  1FOD 3;  3NNM A;  4ATF A;  4AE2 A;  4URA A;  4QPY A;  2EF6 A;  1C4R A;  2QCS B;  4LQR A;  2EXJ A;  5DDJ 3;  4QHB A;  5F3G A;  4QD2 A;  2ZGU A;  3ZXG A;  3RZH A;  1CQ9 A;  5JZG B;  4E4Z A;  1UIJ A;  3EJK A;  2RVA A;  3J7M A;  3MIG A;  1PGS A;  1ZRE A;  2HBT A;  3B7M A;  3R0R A;  3IKW A;  4XET A;  4NPR A;  1GZW A;  4B7E A;  1UKG A;  2A73 B;  1CAW B;  2WZR 1;  3PU8 A;  3GXU A;  3SIS A;  3WUD A;  3PUQ A;  4P02 B;  2ZKL A;  4PIZ A;  5FUI A;  4COY A;  3MLJ A;  5FLI A;  2CAV A;  2KXL A;  3VN4 A;  4YGE A;  4AXO A;  4DEQ A;  1RUD 3;  1WW4 A;  2IXH A;  3AKR A;  1RGS A;  3NAP A;  2P3J A;  4XCB A;  4BWO A;  3HNB M;  4LK7 A;  4LIU A;  5LA1 A;  1KS4 A;  5A3W A;  2WFF 1;  4A42 A;  3T09 A;  3M3E A;  1EUU A;  1X50 A;  1SBD A;  1OFN A;  5CYY A;  2VOV A;  1N1S A;  4NWV A;  5I0R A;  1QHD A;  1F4A A;  1Y9Q A;  1Q3E A;  3UK9 A;  3D4K A;  3O0V A;  1OVP A;  3OBA A;  5FY7 A;  2DVB A;  5A3L A;  1GNY A;  1CVN A;  1ZZ9 A;  4NE9 A;  3SIT A;  3ETQ A;  3UKT A;  1UXZ A;  3VKF C;  5BNO A;  2P3K A;  3KGL A;  5ABJ C;  2BBV A;  4GB3 1;  1SPP A;  2CNA A;  2RDQ A;  3PUH A;  2NLR A;  4QB6 A;  2DCY A;  4Y33 A;  4YGD A;  3B01 A;  3WDV A;  3JCI A;  1NYW A;  3VKN A;  5A3T A;  4XBN A;  4J1X A;  4FPY A;  4GWJ A;  2EAA A;  3KQR A;  3FC0 A;  3VHO A;  4FPH A;  3UJO A;  3JXS A;  2WAA A;  5FRE A;  5BV6 A;  3MO4 A;  2IVJ A;  4AHW A;  1DQ0 A;  2NPI A;  4QKF A;  3GZE A;  1D2S A;  5FO9 B;  1KQR A;  3RWN A;  4LO8 A;  3OJB A;  3V56 A;  4C1X A;  4YM3 A;  1OA2 A;  2A70 A;  2AC1 A;  3III A;  1O8P A;  3J4U H;  4RGG A;  5FZ4 A;  4AFC A;  1DGW A;  2B39 A;  2BNN A;  2BQP A;  4IGO A;  4K9S A;  2VO5 A;  1UOB A;  1QJY 2;  3LCP A;  4CDX B;  3O1P A;  4AGR A;  5F2W A;  4KL1 A;  5HCH A;  5H9Q A;  5F8P A;  2QFE A;  4EWE A;  5GZC A;  1AVB A;  1NX9 A;  1Q5O A;  3NNG A;  5FZ9 A;  3ROU A;  3J9S A;  4R4X A;  2E26 A;  2W94 A;  1UOF A;  2B46 X;  3I2O A;  3KM5 A;  4HKL A;  5FPL A;  2D6N A;  4XW3 A;  2BEO A;  3OUH A;  1L7Q A;  4WBB A;  4A6O A;  1IG0 A;  4CPB D;  4MH0 E;  4LNV A;  1CZS A;  5HI0 A;  3V0B A;  5BNP C;  1RVF 3;  2XJT A;  1RUJ 2;  2EVX A;  3APB A;  4MG2 A;  4P9G A;  3VV1 A;  3N7K A;  3OBZ A;  3PU3 A;  5KHK A;  3WHU A;  4DXR A;  2IVI B;  5GZG A;  4CXX A;  5JXJ A;  4GQ7 A;  1AR9 1;  4PLM A;  4ASL A;  5C71 A;  2X8K A;  5A3N A;  2WO3 A;  4WZC A;  2OYZ A;  3HQR A;  1V6L A;  1ZBA 3;  2UYA A;  4HN1 A;  5GAL A;  2CWM A;  1LAJ A;  4Q4X 3;  2XJR A;  1RUJ 3;  4AQT A;  4IV3 B;  1WCK A;  1H9P A;  1VBE 1;  4BQ2 A;  4ONU A;  1MZE A;  3LA3 A;  3OGV A;  5C9A B;  2CWS A;  4Y22 B;  2BPA 2;  1JOP A;  4LKD A;  4Y1X A;  1K42 A;  2QBX A;  1NCQ C;  2ZEZ A;  5EV7 A;  4HN0 A;  3M7A A;  1RUE 3;  2E7T A;  4QPG C;  1ND2 C;  1HQL A;  1HIX A;  2Z5W A;  5LW9 A;  2VBP A;  1YYN A;  1DGR A;  4IER A;  4BLI A;  2VAU A;  4XHX A;  5FIX A;  3NAP B;  4CP0 A;  1FAT A;  4AWD A;  2QQK A;  3PNA A;  4KMQ A;  3RSJ A;  3QAC A;  1TVG A;  4JGZ A;  5IYY A;  1T2X A;  5DZF A;  5FZG A;  2VU9 A;  5D2A A;  1UYY A;  4MGK E;  1J84 A;  3NJV A;  1ULC A;  4UFJ A;  1TE1 B;  2WNV B;  2F4L A;  2WBK A;  1PVC 1;  4XC9 A;  2EIE A;  2PLV 2;  3O1T A;  4WM7 B;  4RFR B;  2QVS B;  5I8T A;  3NL1 A;  4K1Y A;  2DDU A;  2K2S A;  1WLD A;  2YXS A;  1L3J A;  1OA3 A;  2J1T A;  3CHX A;  3Q8E A;  1COV 2;  1O3Q A;  2J1U A;  1OA4 A;  2OA2 A;  4RS5 A;  4UT5 A;  3T1L A;  3IWZ A;  5FUP A;  2VCM A;  4P9W A;  4JGY B;  1G9D A;  3CZJ A;  2FDG A;  5F2S A;  4XOG A;  2HWE 2;  2V5Y A;  2VUD A;  5AFB A;  1GQH A;  4YLZ A;  1O3R A;  3LSD A;  1DLL A;  1F4H A;  1HQN A;  2ZGQ A;  3B93 A;  3UGF A;  3WOG A;  4AYU A;  4Y24 A;  4BB3 A;  5GJ6 A;  1VIW B;  4OUE A;  4XQW A;  1UX6 A;  1C5H A;  3A0N A;  3WT3 A;  4D6R A;  3HOB A;  3ZLI A;  2VNR A;  4TLG A;  2CGP A;  1UOG A;  4S2D A;  4FFI A;  1CWP A;  2XQX A;  1Y9M A;  2MEV 1;  2WN3 A;  1X7N A;  1TG7 A;  1PM7 A;  2R1D A;  2VUJ A;  3HD8 B;  4GAL A;  2EIB A;  3SQO A;  1AZD A;  4W65 A;  3PL0 A;  2FMY A;  4DRV A;  4FTB A;  4WVZ A;  4XDP A;  3VDD B;  1AYM 1;  1L7L A;  1IG3 A;  2GNB A;  3FE5 A;  3WVJ A;  4AGG A;  4CDX A;  4CZS A;  1HRV 3;  2ARC A;  1K5M A;  1IQA A;  3LFI A;  4IEP A;  5I93 A;  1VLN A;  3FHQ A;  3NV1 A;  5GLV A;  2VG9 A;  5A1F A;  3RZL A;  5FZ6 A;  5JMO A;  4B29 A;  4FBF A;  3AVS A;  4Q4V 1;  5JIA A;  3GZU C;  4UXA A;  1KFU L;  2JEM A;  2JIJ A;  5L7O A;  1UZY A;  2HWC 1;  3D0J A;  4H2A A;  2Q0A A;  4EJR A;  1W0O A;  2WUH A;  2Q1Z B;  4DZG A;  2EXH A;  2HLE A;  3CDZ B;  3WXP A;  1IZ3 A;  3ON7 A;  3RI9 A;  3VBO C;  5IK4 A;  3PHM A;  4YGC A;  4HL0 A;  3MLL A;  4HT1 T;  3FFZ A;  4OZX A;  2WDB A;  3FLP A;  4Q4W 1;  4Q4Y 1;  3EBR A;  3OYW A;  4GWN A;  1ASJ 1;  3AJY A;  1DG6 A;  1W9Y A;  2DCK A;  5EIY B;  1ZZB A;  1CES A;  2QQJ A;  2ZX1 A;  3AXE A;  4CXW A;  1YRZ A;  3FBM A;  2RMU 1;  4Q4W 3;  1OLR A;  1SQ4 A;  3J7L A;  4GB3 2;  3GAL A;  2GH8 A;  3EMR A;  2FDF A;  3U10 A;  3PUI A;  3VD3 A;  3AJZ A;  1EY2 A;  4XFB A;  3AKS A;  5JIU A;  1YLL A;  2O14 A;  4RL7 A;  1DIW A;  2R06 1;  3IMM A;  4YW1 A;  5DZE A;  4YFZ A;  5KC6 A;  4XVH A;  2CSG A;  3KVA A;  4ISQ A;  3KT4 A;  1O4T A;  4GWM A;  5KC5 A;  4PF1 A;  3U37 A;  1XNK A;  4XMI A;  5BNN A;  4JDO A;  2LAL A;  3I2H A;  4QGL A;  2O1Q A;  4X6R B;  1G9A A;  1EV1 2;  1RUO A;  1W8Z A;  3T0B A;  4LHL A;  1JTZ X;  2DU1 A;  1RUI 1;  2A1X A;  2BRT A;  2Y8K A;  4EYU A;  3OD4 A;  1MQT A;  2VD7 A;  3WNM A;  1NE6 A;  3IT8 A;  1PO1 1;  1SFP A;  2WNV A;  4CCN A;  1W05 A;  2XLG A;  1UMI A;  4FCA A;  5LBE A;  4Y26 A;  2WNU A;  2W91 A;  5ANQ A;  1N1T A;  3CMG A;  4FO9 A;  3WUC A;  2QZ3 A;  3I2J A;  4Q29 A;  3SNM A;  1VBB 2;  3AC0 A;  4UYB A;  1VAL A;  4JHT A;  2A6Y A;  1AJK A;  1PIV 2;  3H1Y A;  3O7O A;  2OZ6 A;  4BYY A;  2GN7 A;  3ETP A;  4NR1 A;  2ZXQ A;  2PAK A;  4QHO A;  3WQ7 A;  4S2H A;  2OUJ A;  3MEP A;  2MHF A;  4IET A;  4CRQ A;  2ZEY A;  1XBF A;  4Z82 A;  3VL9 A;  4OZO A;  3MBW A;  2FCT A;  3LGR A;  3NV2 A;  1S0J A;  4RHV 2;  5FXV A;  1UYP A;  2PAM A;  4JHZ A;  4NHY A;  2J42 A;  4R9A A;  1DQ5 A;  2HJI A;  4XFG A;  4A4A A;  4PDW A;  4PIX A;  4CCJ A;  1J3Q A;  3RZM A;  2W1Q A;  3THT A;  4FXG B;  5KHJ A;  4LHS A;  2PHW A;  2TUN A;  2B42 B;  1UY4 A;  3IDC B;  4Z1V A;  5CFD C;  2D5H A;  5D8A B;  3N9O A;  5I0U A;  1X33 A;  4HVO A;  3MW2 A;  3V64 A;  3L2H A;  5C70 A;  3OGR A;  1JBC A;  2ZMK A;  1XNT A;  2GH2 A;  1R09 2;  2E7Q A;  1PZ7 A;  1H2L A;  1NLR A;  1PX3 A;  1V9U 2;  2CYF A;  3DXT A;  4HVR A;  3C7O A;  5F5Q A;  4B3N A;  1RUC 1;  1IPJ A;  4K40 A;  5LA2 A;  3WDX A;  5FPV A;  2AZ5 A;  1Y7B A;  2CAU A;  4GAZ A;  4ZHN A;  3DEC A;  1QDO A;  1HN1 A;  2OII A;  4ZXK A;  2VZU A;  3ZR5 A;  3KCX A;  4TZD A;  1AR7 3;  3H8O A;  1E5R A;  5FV3 A;  5CKQ A;  5DAX A;  1SG3 A;  1VE0 A;  1ZNP A;  4EV0 A;  3T30 A;  2VQA A;  1UN1 A;  3JD7 2;  1GLH A;  2G19 A;  3Q8B A;  3K75 B;  4QQL A;  1GZT A;  1REE A;  1CAV A;  4J25 A;  4QX0 A;  5D8A A;  3O1U A;  4AVA A;  1VAM A;  5FZC A;  4LLF A;  3TAY A;  2D3S A;  4OI0 A;  1W9F A;  4YVW A;  3SCG A;  1TMF 2;  1HX6 A;  3I7D A;  3NW4 A;  4B1M A;  4N7I A;  3L2Y A;  5CIR A;  2R32 A;  2XKP A;  3KT7 A;  4HAN A;  5JCT A;  4GJZ A;  1NLS A;  4LBQ A;  3AYA A;  1S55 A;  1FX5 A;  1WCQ A;  1UYX A;  5BNN B;  3WW1 A;  2YGM A;  1QF3 A;  3VDC A;  2K0G A;  3T4H B;  3JBG 2;  1AR9 3;  1Q8O A;  3PTY A;  3QH7 A;  2QZ2 A;  5LBB A;  3M3C A;  3HEI A;  1E5H A;  1ZZ8 A;  2ZGN A;  2D7F A;  2BOJ A;  3HN3 A;  5T54 A;  4CU8 A;  5H9R A;  1ZBE 2;  1J59 A;  4L99 A;  3WW2 A;  4BCU A;  3WSO A;  1IS4 A;  3MI8 A;  2G1M A;  5EFU A;  1DQ2 A;  4QX7 A;  4GMP 3;  4CP9 A;  4N43 B;  1VRB A;  3E1F 1;  4K3U A;  2IXJ A;  2FCU A;  1AL0 G;  1NAE A;  1AR7 1;  2Y6L A;  1GSL A;  1LEC A;  3ZFF A;  1LGB A;  4BQW A;  3RVH A;  1W9T A;  2HWC 2;  5JDB A;  3TEW A;  5C6C A;  2XPJ A;  1VAV A;  1OT5 A;  3AMN A;  5DAP A;  1H4H A;  2K46 A;  1RMU 1;  3POE A;  4XDO A;  2G9G A;  4P00 B;  1PZ9 A;  1UY0 A;  2W52 A;  4WV8 A;  5KHH A;  3ZFF C;  2OT7 A;  4AW7 A;  3K4Z A;  3IB3 A;  3IIA A;  2OW4 A;  5FYS A;  2Z2S B;  3DGT A;  3T08 A;  3VD9 A;  1YIF A;  5CU1 A;  4X6Q B;  1KEX A;  2EAK A;  2W5F A;  2WZ8 A;  1MR5 A;  2XJS A;  3ZKU A;  4YZ3 A;  3BIE A;  3FUQ A;  2PYT A;  4N9H A;  4GIQ A;  5FZE A;  3BB6 A;  3NJX A;  2QQL A;  1V6N A;  5FOB B;  2WJS A;  4PJY A;  1NCR A;  2X5I C;  4ZZ8 A;  4LE3 A;  1S0I A;  3AMH A;  3WCS A;  4XBL A;  4KBZ A;  1WW6 A;  1PZ8 A;  2ZZQ A;  2BBA A;  2EIG A;  3ZXJ A;  1HXS 1;  2CTV A;  2D5F A;  1IPK A;  4QMA A;  3ZYH A;  3S5A A;  2A7A A;  5JPN B;  5JSO A;  1H6Y A;  4YW5 A;  5FP7 A;  2B8M A;  4XJ9 A;  2JXA A;  1OOP A;  3O1O A;  3WLU A;  4XJ8 A;  5DDJ 2;  5CBL A;  4ARX A;  4DY3 A;  4NHL A;  4JKM A;  1LOA A;  1V6J A;  3GCW A;  3M3I A;  2PHD A;  4L11 A;  1F9K A;  5FYH A;  5BY5 A;  4Y1Z A;  3U4X A;  3ILF A;  1VBB 1;  1B35 C;  5LZ6 A;  1BLZ A;  1AYM 2;  3ZFG A;  3I3D A;  5G05 L;  1JXN A;  5KWR A;  3O5S A;  3WG1 A;  1A6C A;  3ILR A;  3NJY A;  2G9F A;  5A3U A;  1MS0 A;  1UAI A;  2OS2 A;  2PQS A;  5FBJ A;  1DHK B;  1HB4 A;  4XXA A;  5JOY A;  2KD7 A;  4KWK A;  3KD4 A;  4IEZ A;  1AYM 3;  4CCK A;  4FOW A;  1GOH A;  4XHB A;  3WDT A;  3KHB A;  1RXF A;  4R9D A;  5KHG A;  5DDJ 1;  3F95 A;  1L7R A;  3H50 A;  4P9L A;  2DBN A;  1QJU 1;  2AH2 A;  2BU9 A;  3KF3 A;  1BBT 1;  1LKN A;  2QE3 A;  1A78 A;  4YVW B;  4MV2 A;  1Y9G A;  2VMI A;  4ORF A;  1JZ7 A;  1AR8 1;  4FI9 A;  4CCD A;  1U0A A;  3UYJ A;  3AK0 A;  4XXP A;  5I91 A;  1W6O B;  2RS3 1;  4JKK A;  5FZD A;  1AR8 3;  1GZ9 A;  4KH9 A;  2JEC A;  3I49 A;  1AL2 3;  1QEX A;  4AVB A;  4EZH A;  3KS7 A;  2JDA A;  2EXK A;  5FZB A;  2JE7 A;  1OQE A;  3KV6 A;  1JOB A;  3LB9 A;  1VB4 A;  3NVC A;  1OVS A;  2RS1 1;  2ZAA A;  1U5I A;  2YPD A;  2H6B A;  2DUR A;  5F37 A;  4A7K A;  4BU2 A;  2MPF A;  3CJI A;  1OUR A;  1J58 A;  3NMB A;  1R64 A;  4D6Q A;  5L7O C;  2FDK A;  1NG0 A;  5FK7 A;  3PLQ A;  4LBN A;  5HXV A;  1W6N A;  1W8U A;  2J1E A;  5LRS A;  1H8T A;  2GN3 A;  5A70 A;  1RB8 G;  4NRM A;  1POV 3;  1URX A;  5B4X A;  1W6O A;  2WN2 A;  1NCR B;  2WAB A;  3CJI C;  3ZDV A;  4C91 A;  1ZRC A;  3WDU A;  2VXJ A;  4MSV A;  3S7E A;  4Y1U A;  4AFB A;  3H9A A;  4YZ5 A;  1QGL A;  2XJV A;  4YM0 A;  3ENR A;  2YHJ A;  1GR3 A;  5CFC A;  5FY1 A;  4GKY A;  5JXI A;  4QX2 A;  1EAH 3;  3BCW A;  4GH4 C;  3MFA A;  2W9X A;  3SCH A;  5IVB A;  1W6P A;  3PVO A;  2UY8 A;  3WG4 A;  3UNP A;  2MEV 3;  4LBQ D;  3S57 A;  2BFU L;  4NHX A;  1POQ A;  1PHM A;  3VDB A;  2CHH A;  4FAH A;  3GBF A;  1NLQ A;  4QHZ A;  4UBG A;  1W99 A;  3PTR B;  3X29 B;  4OFG A;  4AVS A;  3ZYB A;  2JE9 A;  1N47 A;  1WLT A;  4XEZ A;  1XQN A;  1JZ5 A;  3VBS B;  3VBU B;  1AYN 2;  1J1T A;  1RJ8 A;  2QQO A;  2X09 A;  1XOY A;  2Q4S A;  1OD5 A;  2FCV A;  3VBF C;  2FDJ A;  1F31 A;  2XJP A;  5BUV A;  1SFN A;  3M4F A;  1APN A;  3RZK A;  3OPT A;  1S4C A;  3W21 A;  3U11 A;  4MGI E;  4OUL A;  5T5L A;  2Y6J A;  1NA1 C;  2PHL A;  1P8J A;  3H1W A;  1HKD A;  5T5P A;  4TWT A;  2GC0 A;  3JB8 A;  2GC3 A;  1RIN A;  2PTM A;  1CX4 A;  1W6Q A;  3DEM A;  5IAX A;  1BZW A;  4DUV A;  4Y4R A;  3M3Q A;  5E16 A;  3CEW A;  3GHM A;  1RMU 3;  4JDN A;  1VBC 1;  3OBR A;  3T2P A;  3RMX A;  1DQ1 A;  2GAL A;  2I45 A;  3VZL A;  1VRH 1;  5JUV A;  3ATG A;  1MQT C;  3J8F 1;  4PF5 A;  3J26 N;  4YG3 A;  3NV3 A;  4GXL A;  3F2Z A;  2VMG A;  2FDH A;  4R8H A;  2VUA A;  4BE3 A;  2R07 1;  4G4F A;  4KU7 A;  3ZN5 A;  3ZVX A;  4CDW C;  2VMF A;  3WNL A;  3CNA A;  4XF9 A;  2YC0 A;  1JYC A;  4HKW A;  5JAX A;  3H8R A;  3IM0 A;  4WM8 B;  3I3B A;  1S1A A;  3LEM A;  5KBF A;  2Y0O A;  1OD3 A;  1VBA 1;  2YMZ A;  3FFQ A;  3ZPY A;  2XLF A;  3QH6 A;  4MGZ E;  1YFY A;  1TQ5 A;  1Q43 A;  2D6K A;  3B94 A;  4I30 A;  1TNF A;  5I0T A;  4GUL A;  4Q4X 1;  5D1I A;  3I54 A;  4YFW A;  4CYD A;  3ALQ A;  2IWG B;  4RHV 1;  4DEV A;  2BFU S;  3UT0 A;  5FP3 A;  2VMC A;  3OPW A;  4ZU4 A;  3AFK A;  2RJK A;  3KB5 A;  2NM1 A;  3VB9 A;  2B4K A;  3BU0 A;  3FN9 A;  3THD A;  5CEH A;  1EPZ A;  4XUQ A;  2DUP A;  4Y22 A;  2WFF 2;  3MPB A;  4BQ3 A;  4HMZ A;  1LHN A;  4XTM A;  4AF9 A;  5DXD A;  5C8C B;  3ZKY A;  3LIH A;  1NY7 1;  1QJY 3;  1ZA7 A;  1A8D A;  4BA6 A;  1OUX A;  1W8H A;  5F6K A;  4XAC A;  2B9U A;  1C8N A;  1UIK A;  3M3O A;  4ZKT B;  4AAX A;  4GWI A;  3I8T A;  3KLS A;  4UF0 A;  4OUM A;  4YVS B;  5LBF A;  4M3C E;  1M06 G;  4CEW C;  3GCX A;  4NIG A;  4XZP A;  1UZZ A;  2VW1 A;  2VCA A;  1QXR A;  3VBS A;  1D0G A;  3BPS A;  4C8D A;  4W6X A;  3JB4 C;  3U07 A;  2K9Z A;  3WW3 A;  3ORJ A;  1UO9 A;  1CAW A;  2BVB A;  3RRD A;  1N1Y A;  1X8M A;  3G6J B;  3VKO A;  4QXB A;  2R06 2;  4JDM A;  4NRO A;  2IXI A;  2BDR A;  1W6P B;  5FO7 B;  3N7L A;  1QMJ A;  4IND A;  5IAT A;  3GYD A;  1JU4 A;  2RS5 1;  2JG9 A;  1WGP A;  5IVC A;  2HWD 2;  1YQ5 A;  2JDH A;  4E4H A;  4RS5 B;  5IHR A;  2W1S A;  4UF0 B;  2RMU 3;  3AVR A;  1XSR A;  2UWA A;  3ZDS A;  1O8S A;  3AFG A;  4JV4 A;  4S2F A;  3SH3 A;  4LO6 B;  4Q4W 2;  5F32 A;  5K9Y A;  3TN9 1;  1TMF 1;  5JVV A;  1IKQ A;  3P6B A;  4LEJ A;  1SPP B;  1PK6 C;  4XIL A;  5CG8 A;  3ME2 A;  4NVP A;  4OHZ A;  2ORX A;  2WC2 A;  4P9I A;  2ZX2 A;  4Y4Y A;  4I0W B;  1BYH A;  2XHN A;  2OXB A;  5A7Q A;  3LD8 A;  2E9Q A;  3HN1 A;  2O8Q A;  2NN8 A;  5DUW A;  1GYK A;  1TME 1;  3AKQ A;  4HSL A;  3LPF A;  1SBF A;  5CAZ A;  1O4Z A;  2RJ2 A;  4CE8 A;  4NPL A;  4Z8B A;  4P08 A;  4LXL A;  5IK8 A;  4HZF A;  2EIC A;  2Y26 A;  1QQP 1;  4MGS A;  1TME 3;  4AFA A;  4QDS A;  4MGQ A;  2WT0 A;  2A6V A;  3DPR B;  3THP A;  4W8J A;  3OUJ A;  1HB1 A;  3FHA A;  5SV8 A;  3T3Y A;  3B5L B;  2VME A;  2JDY A;  2IFR A;  1CX1 A;  1SLC A;  1SMV A;  3LZZ A;  4IL7 A;  4JQR A;  2IFW A;  1FOD 1;  1HQW A;  2GZW A;  3K4D A;  1GZW B;  1DFQ A;  1UW8 A;  3AMQ A;  2VTF A;  1Y3T A;  4IEQ A;  2ZGS A;  2R04 2;  3SCF A;  3O1S A;  2BZD A;  5ACA 3;  4MHR A;  3POY A;  5FYT A;  1UD1 A;  4PQ9 A;  5FKB A;  4KGQ A;  1MZF A;  1SCS A;  3DL3 A;  1H1A A;  2C9K A;  1NCQ A;  1O6U A;  4ASK A;  4DB5 A;  5FPA A;  4A3Z A;  4B4Q A;  3H0O A;  4LK6 A;  3PIJ A;  1XXN A;  3ZFG C;  4MHU A;  3WQ1 A;  4AAP A;  5ACA 2;  2P2K A;  4BK5 A;  4K21 A;  3ZM8 A;  5CA6 A;  4IV3 A;  1G8W A;  4PT6 A;  1O3T A;  5FY0 A;  2YUE A;  4PBP A;  1DU3 D;  4K20 A;  1HRI 3;  4RR3 C;  2R07 2;  3ILN A;  4CUA A;  3TOJ A;  2OKX A;  2QUO A;  4IE5 A;  1RUH 3;  3BU7 A;  4QAW A;  4Y5S A;  3WF0 A;  4IV3 C;  4FT8 A;  1LOG A;  4N90 A;  4OI2 A;  1STM A;  3WX5 A;  3H8X A;  3BKZ A;  1RIR A;  1HRI 2;  1NCQ B;  4CEY C;  3BOW A;  1BEV 3;  3LDB A;  4FPE A;  4CDQ C;  2CGN A;  2Y0I A;  3K3O A;  2Z69 A;  2C1F A;  4IV1 B;  1LED A;  4B4R A;  4KWJ A;  2ZAB A;  2ADE A;  4W50 A;  5FYC A;  4GMP 1;  3MYX A;  2YY1 A;  3BN6 A;  4OQ9 A;  1C8M 3;  2R49 A;  1V0A A;  2P34 A;  5A6Z A;  2VZV A;  4MX3 A;  5L73 A;  1QDC A;  3U75 A;  4MO3 M;  2P5B A;  2GNT A;  5FJK A;  4EZ4 A;  3BTA A;  1MZ5 A;  5LB6 A;  2HWB 3;  3S7I A;  4LHN A;  4AI9 A;  4CP1 A;  4IE4 A;  1DLC A;  2RR1 3;  1RUF 1;  4EWD A;  2VEC A;  5IK5 A;  3J7H A;  3VHN A;  5C4W B;  1XE0 A;  3JBG 3;  1ULO A;  1ZBA 1;  4N9I A;  1V6M A;  4Q0Q A;  2ZBJ A;  2E6V A;  4QQ2 A;  2LTN A;  2C6S A;  1W2T A;  3I3Q A;  2YU2 A;  3T0D A;  3ZXE A;  1X82 A;  2FZ2 A;  1YWK A;  1UMH A;  4ZXE A;  3S0M A;  4XPV A;  4DXT A;  1F15 A;  4XIO A;  1QQP 2;  4HBN A;  3AP7 A;  4H3W A;  5JR2 A;  1VMF A;  1UYZ A;  1QOO A;  4M0N A;  1GKB A;  2EID A;  3B9I A;  2WT2 A;  2VZQ A;  1V6O A;  3FBY A;  4H7M A;  5F5I A;  1I5Z A;  2ZGT A;  1A3K A;  1DP0 A;  5CB7 A;  4ZU7 A;  4E2Q A;  3V0B B;  3SKJ E;  4M4P A;  1FMD 1;  5FZF A;  1OH4 A;  4F8A A;  5BNO C;  2Z42 A;  1CJD A;  3KCC A;  3WD5 A;  5FLJ A;  1O7F A;  2P3I A;  5LEK A;  1G7Y A;  1W6M B;  3WDY A;  5FYY A;  2YC2 A;  4YRD A;  5BNN C;  1ZRF A;  5A80 A;  1W90 A;  1PO2 2;  5A6Y A;  4WM8 C;  3B69 A;  5FO8 B;  1JOD A;  2JD9 A;  4NRQ A;  2BW8 A;  4TXW A;  3EQE A;  2W47 A;  2YBK A;  4LIT A;  2A5Z A;  3VBR A;  1FI2 A;  2JDM A;  3VBH B;  1QJZ A;  2JG8 A;  4FPG A;  4RHV 3;  5L7O B;  5C5U A;  3SH5 A;  4QPW A;  1MAC A;  4I02 A;  1ODM A;  3ZXA C;  4WVV A;  2IC1 A;  4RGA A;  3CJX A;  3WF3 A;  1AXY A;  4OI4 A;  3VBR C;  2HKX A;  3R4D B;  3B3Q E;  5JI9 A;  1S2B A;  4GA9 A;  1OC1 A;  4Q0U A;  3LWC A;  1DDL A;  3WF1 A;  4E27 A;  1E5S A;  2RM2 1;  1XYO A;  5JLV A;  1HB3 A;  5H9S A;  4DY5 A;  4HVQ A;  1PNG A;  1E57 A;  5DG1 A;  2ERF A;  4UW3 A;  5C9A C;  1R1Z A;  3D8C A;  1RIT A;  2QQN A;  3ACG A;  3C2U A;  2JIC A;  3D5O A;  1OKQ A;  1X36 A;  3GZT B;  3CLP A;  3HQU A;  4I0A A;  2YYO A;  5DZG A;  1S0G A;  3JD7 1;  5A7N A;  4ISR A;  1EUT A;  3Q8C A;  1FV2 A;  3VBR B;  2D97 A;  4IE6 A;  4CP9 B;  2FDI A;  2JE8 A;  2Y6H A;  2D3R A;  3FLR A;  4COV A;  2RJL A;  3A4U A;  3LA2 A;  3HMY A;  1OBN A;  1VB2 A;  2E31 A;  4LUK A;  1QH6 A;  5FZL A;  1KJL A;  5BNP A;  1ENS A;  3VZK A;  3DN7 A;  5FXW A;  3NO8 A;  1RXG A;  4BJ0 A;  3WF4 A;  4LKE A;  2XG3 A;  1UPI A;  1POV 1;  3FJS A;  2CDO A;  3A0K A;  1SHW B;  1ENR A;  4FPL A;  5DUX A;  3VHP A;  3ZFE C;  1HRI 1;  2WZR 3;  3ABZ A;  3HT2 A;  2AYH A;  4LR4 A;  4IEW A;  4XFH A;  5DAV A;  4DUX A;  3AZV A;  3EXU A;  4E4S A;  1MQT B;  1JYT A;  3WP4 A;  1D7P M;  1V6I A;  1WA4 A;  1KRI A;  1ZZ7 A;  4LUM A;  1W2U A;  2YC4 A;  3CQO A;  4Q0P A;  1Z0H A;  3WR0 A;  1CGP A;  2V09 A;  4NIH A;  2F6B A;  1RUG 2;  2XKO A;  2C9A A;  5BNO B;  1JHJ A;  1K5M B;  1POV 0;  1YI7 A;  4B1L A;  4KBB A;  4D94 A;  1RHI 2;  1RUF 3;  4K8F A;  2A6Z A;  1AL2 1;  4AOC A;  4LT5 A;  2J22 A;  3O1R A;  1HDK A;  1MPX A;  1AR8 2;  2VZT A;  2WO2 A;  3OOX A;  4YGB A;  1DBN A;  1AR9 2;  5EQU A;  4JGZ C;  1B35 B;  4X8N A;  2UWC A;  5K0U A;  5C4W A;  1H1I A;  2VNG A;  3HPN A;  1W8F A;  4M00 A;  3C8X A;  4CSW A;  5HXM A;  3MIE A;  4XTP A;  3I59 A;  5FPU A;  1XSQ A;  1ZRR A;  2JKX A;  1H8V A;  4QKD A;  2VXR A;  4FOV A;  4DQA A;  1C28 A;  3VBS C;  1SZB A;  1JYI A;  3D82 A;  3KVB A;  5A1A A;  3OY8 B;  3ZXK A;  3KQ4 B;  1XE8 A;  1GP6 A;  2XBO 3;  1WBL A;  3HQX A;  3CZU A;  1WME A;  2VUL A;  4CCO A;  1N3Q A;  3LE0 A;  1QJX 3;  3FWE A;  4MOA A;  1VPH A;  2YV8 A;  5A7P A;  5EYX A;  4IEV A;  3NNJ A;  3GBW A;  2ZX3 A;  5A3M A;  5IFP A;  1HRV 1;  1JW6 A;  1WKY A;  3BGA A;  3DYM A;  2JDZ A;  1LHU A;  4O9E A;  1DZT A;  5DAQ A;  5C3P A;  2HWF 3;  3H3U A;  3WP3 A;  4V2V A;  3EYP A;  2GP3 A;  2Q1M A;  5LK5 A;  5FP9 A;  3LAG A;  3I2F A;  4NJ4 A;  4BIS A;  1OF4 A;  1HXS 2;  4LO7 A;  3SHR A;  4LMF A;  5EP9 A;  2WYS A;  4N53 C;  1V6K A;  1GWK A;  3FL7 A;  4A41 A;  2A6X A;  3IN9 A;  1OSG A;  2UUR A;  3MPP G;  1A34 A;  1VAK A;  3I4I A;  1JU3 A;  4XAE A;  5JOX A;  3OUI A;  3R4U A;  5GLT A;  1H30 A;  3NWK A;  5FKC A;  3GHN A;  2ZJC A;  4COW A;  1NZI A;  1GFF 2;  3HBK A;  2YB7 A;  3BTZ A;  3P1I A;  1HXS 3;  4XUN A;  5FZ7 A;  1YJK A;  3AKP A;  4PI2 A;  2D6O X;  4LBL A;  5K4L A;  1RJ7 A;  2WR9 A;  2RS5 2;  1OLM A;  2GMM A;  3ZIW A;  1OPM A;  4A7Y A;  2ZML A;  5A7S A;  2JWP A;  2XON A;  3U14 A;  1DZQ A;  3HBZ A;  4CUG A;  1ACC A;  4XFC A;  3T4V A;  1NCR C;  1ENQ A;  1WW7 A;  4FFG A;  3S5Q A;  1CD3 G;  1XYN A;  5EZW A;  3LOI A;  3MHZ A;  4XUR A;  5J7M A;  5AC9 1;  3SKV A;  1J83 A;  2WFP A;  2RDR A;  5KR7 A;  2W1W A;  4JGZ B;  3U78 A;  4CTE A;  4AGV A;  4P14 A;  1IQD C;  1NOV A;  2V4V A;  4QXK A;  3ST7 A;  1LNS A;  2OPW A;  2VOK A;  1OOP C;  1W28 A;  1UNB A;  3MIC A;  4SBV A;  2IZW A;  2PEL A;  2JKB A;  2JD4 A;  5DUV A;  5A3O A;  1JZ4 A;  2ID4 A;  4XJZ A;  3DXU A;  3CU7 A;  3J7N A;  5IVF A;  5I0D A;  2ZAC A;  2DYC A;  4D6S A;  3OPZ A;  3MFC A;  4CUC A;  5C3R A;  1QNY A;  2HH9 A;  4QXH A;  3W9A A;  2W46 A;  1QJE A;  2LRP A;  3KMH A;  5I8S A;  2XH6 A;  5CFC B;  4H55 A;  2C4X A;  4P5Y A;  2FD8 A;  2W92 A;  2ZX4 A;  3NQH A;  3AP6 A;  4ZS2 A;  3EHK A;  2YG0 A;  1RUE 1;  3OEA A;  3AYD A;  1HLC A;  5CKM A;  4H14 A;  1CPM A;  2WLP A;  3MUZ 1;  3DUI A;  1W2N A;  1WD4 A;  2BOI A;  3LEG A;  1KJR A;  2QNK A;  1AXZ A;  3E5Q A;  3IAP A; 
#chains in the Genus database with same CATH homology
 1O6U A;  4TLG A;  1OLM A;  5LZ6 A;  1OLM E;  4UYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...