2PHUA

Pterocarpus angolensis lectin in complex with man-8d1d3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
240
structure length
240
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Lectin
publication title How a plant lectin recognizes high mannose oligosaccharides
pubmed doi rcsb
total genus 53
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2phuA00
1LEMA 5T5JA 2E7TA 3WG4A 1AXZA 1S0CA 3WHTA 4YFZA 2EF6A 1DZQA 2W08A 3R4UA 4FOVA 4GKYA 1V6OA 2ZACA 4FPKA 4Z8BA 3APBA 2ZGTA 1UX6A 2P3KA 1BJQA 1LHVA 1WD3A 2YMZA 4ATFA 2WKKA 2A70A 5JOXA 1WW6A 4YW4A 2AENA 2ZMKA 3WDTA 4PCRA 1S0DA 3NV1A 1O4ZA 1SLCA 3V0BB 5T52A 4LBQD 2JDZA 2CWMA 2NYYA 4FPFA 2DUQA 4JRAA 4YFWA 3QLQA 5FREA 1Z78A 3WDYA 5DG2A 3IMNA 1I3HA 1SACA 3ILNA 3FFZA 5CAZA 4XBQA 3WCSA 1XQNA 4YM0A 2DVAA 4BPZA 1DLLA 1IS6A 1D2SA 3O0XA 2SBAA 2D7FA 2R0FA 1AVBA 1MS9A 1W0PA 4R9CA 1JBCA 1FAYA 1N1TA 5KXEA 1G9FA 2GALA 3OBRA 2JECA 5GZFA 1GBGA 1LHNA 5AVAA 3B69A 4FQ4A 5DZFA 4C1WA 4BLIA 1G9BA 3MEPA 2ZAAA 5CB7A 1SLAA 1WCSA 5JOZA 1DQ5A 1H9WA 3H0OA 1AX1A 1KJLA 1VLNA 3WLUA 1DGLA 1JW6A 3M3OA 4ISQA 1SCSA 4Y20A 1G9AA 2D6LX 2PHWA 3VUOA 1MS5A 1LGNA 1UN1A 3BOPA 2V73A 4XOGA 2P3JA 1N1SA 2DVGA 1V6JA 2OUHA 4FPJA 1G8WA 2A3YA 3AXDA 5EWSA 1IKQA 4R9BA 3T1LA 2E7QA 4Y1UA 3LSEA 5T5LA 4W65A 3OY8B 2GDFA 4AWDA 2D3RA 1WLCA 2UWCA 4AGGA 4XBNA 1V6LA 3VKNA 1QU0A 2NMOA 4YW5A 1OFSA 2DVBA 3R05A 3V0AB 1AZDA 3AJZA 4ITCA 1N3OA 5DXDA 3R4SA 3TAYA 2ZGKA 4K1YA 1FNYA 1QOOA 2EXIA 3N35A 3RMYA 5T54A 1QKQA 1Y7BA 1GV9A 2C9AA 2ES3A 5H9RA 5IK7A 1HLCA 4PF5A 1URXA 2JE9A 5JOWA 3LCPA 4YZ1A 3NV2A 4U2AA 2DTWA 1WLDA 3L2YA 2ZGPA 2JKBA 4LBKA 4Y22A 4ASMB 4GA9A 1G9DA 4XIKA 2W52A 3WDVA 3AYCA 2ZGQA 1GNZA 1S0BA 2VUAA 2ZZJA 5FRAA 1LTEA 1YI7A 1A3KA 1A8DA 1WLWA 2PHUA 1SFYA 3IKWA 3FBYA 4FVVA 2XB6C 5E88A 2GNBA 4R9AA 1LECA 3MW2A 2GNTA 5E89A 5GM0A 3A0KA 3IM0A 1V6KA 5EXOA 3AYAA 5T50A 3VKLA 3WVJA 1KDMA 1W6NB 4LBJA 1C4RA 2AREA 2EAKA 4GWNA 4CTEA 5E8AA 1AF9A 1KITA 1FATA 4L8QA 2WT2A 4R9DA 2ZHLA 2PHFA 4M01A 2ZHMA 3V0BA 1MS1A 5GZDA 2H0BA 2WQZC 2A75A 1QGLA 4P9XA 2NN8A 2FHRA 1ULEA 3AYDA 2ZMNA 2A3WA 4Y24A 4BMEA 5IK4A 1LGBA 2VW0A 3HMYA 1BKZA 3ZSMA 2VY0A 3A4UA 1LOGA 1SLTA 3AP7A 4LBQB 3OPZA 1DYKA 2D44A 2UWAA 1VAMA 2KM2A 2A71A 1CESA 1MACA 2YV8A 1CIWA 1AX0A 2ZGOA 2B7YA 4GALA 2UU8A 4PBOA 5H9PA 4XMIA 2A5ZA 1BQPA 2ZBJA 3OYWB 2ZGRA 4TYSA 3HN1A 2D6OX 2R49A 3ZSKA 3B9CA 2DUPA 1QDOA 2YXSA 5DZEA 3AZVA 4AVVA 4NO4A 4BM8A 3RQ0A 3FLTA 1UAIA 4YGEA 5LK5A 4WVVA 4YZ4A 3N7JA 1LOBA 2D43A 5F9TA 4DS0A 1S1AA 1D0HA 3O0VA 2E53A 1U0AA 5DUWA 1ULDA 5JDBA 1MR5A 3D4KA 1W6MB 1PZ7A 2AUYA 4YM3A 1S0IA 1G9CA 1IOAA 1CPNA 5EYXA 4DRVA 3FLPA 4LBNA 2BQPA 5HCAA 4M3CA 4DFSA 3U4XA 1UKGA 3AZXA 4XXAA 1Q8OA 4AVTA 5KXBA 1FV2A 1WW4A 3B3QE 1VAVA 4YLZA 5GJ6A 1JYIA 1UMZA 1LOAA 1GICA 2YZ4A 3NV3A 5T5PA 3SH3A 4TZDA 3SH5A 2R1BA 2AR6A 3O12A 5IT6A 1SLIA 3LSDA 4YG6A 5T55A 2VU9A 1DQ0A 2A6VA 4FOQA 1C57A 1GYKA 3GNEA 4UW4A 1F31A 1GANA 1FYUA 1Q8SA 1YIFA 3RG0A 1LULA 1X50A 4IQPA 1GLHA 2EALA 3FUOA 2ZMLA 2WNEA 1QNWA 4M3CE 1TEIA 2AGSA 5CA6A 1MZ6A 3VKFC 4FP3A 4YGCA 2DU1A 1QF3A 1LU2A 2RHPA 1LHUA 4YGDA 3ZYRA 2FMDA 3AK0A 1JXNA 1FX5A 4YG3A 1V6NA 4Q8KA 2WJSA 1RITA 4LBLA 3VKMA 3T1MA 1ULFA 2LTNA 3WNXA 3AP9A 1OKQA 1Q8VA 3WOGA 1WBFA 1DYPA 4M3CF 4K20A 2XG3A 4Y1VA 5SV8A 5DG1A 3V65A 1DFQA 1W6NA 3BIWE 5DUXA 3SLIA 3ZSLA 1W6OA 1S0EA 2GMPA 1LOEA 2DV9A 4WZFA 1UL9A 3FLRA 3UJOA 2A6YA 4SLIA 3W59A 1G7YA 3AZZA 2A7AA 3HR9A 5DZGA 5GZCA 2WT1A 5KXDA 2DYCA 2E51A 1GZWB 2HYKA 5H9QA 4YM2A 4AVSA 5GZEA 3RS6A 1W6QA 2NP0A 2D6PA 3M3EA 2ZGSA 2CYFA 2NMNA 4XHBA 4YZ5A 4GXLA 2GN7A 1KQRA 4PBPA 4ZKTB 1BXHA 4XJZA 1ENSA 2P34A 1HQWA 5IK8A 1MS4A 2PELA 1WBLA 4ISRA 4RL7A 3ENRA 3QCWA 3WCRA 1LESA 2OW4A 3AYEA 1QDCA 2D6KA 2A3XA 3AJYA 5IUQA 2ZGNA 3OYWA 3BODA 3ZXEA 3WV6A 2JD4A 2W39A 3CNAA 5F5QA 2G4IA 4FPCA 1NLSA 3ILFA 2ZHNA 1LODA 2PHXA 2CTVA 3POYA 4Y20B 1IS4A 1S0FA 2DVFA 2D3PA 2WLQA 2WSUA 1KDKA 1DQ2A 1R1ZA 3NV4A 2A6XA 1AJOA 1SBDA 2JJ6A 3WDWA 2ZA9A 4HL0A 1AJKA 2CL2A 1W6MA 4XJWA 2DTYA 4P9YA 1UPSA 4XJAA 5CBLA 4PQ9A 5JMCA 1JN2P 1Q56A 2E6VA 2EXKA 2EXJA 2ARXA 1PZ9A 5JLVA 1G86A 4ATEA 1DQ6A 1KRIA 4UW6A 3USUB 4P9WA 2NM1A 4FPLA 5KXCA 1H9PA 4FP2A 1QNYA 3ZYPA 4XJ9A 3WUCA 2A6ZA 1GZCA 3OGGA 3ZSJA 1SBFA 1YRZA 3OJBA 5H9SA 2PHRA 1JOJA 2VH9A 4XZPA 1S0GA 2YY1A 3B00A 1N1YA 1O4YA 4H55A 3AP5A 1LOCA 1IS5A 2SLIA 3PMEA 3AP4A 2EXHA 1JYCA 1LCLA 1VIWB 1W0OA 3MW3A 4XXPA 4YW2A 3AXEA 4Y1ZA 2GNMA 4XJUA 2CNAA 4GWMA 5GZGA 4FPOB 4K1ZA 2WSVA 1SCRA 4Q26A 3IPVB 2GN3A 4Y1XA 4FOYA 1V6IA 3ZXFA 4Y22B 1HKDA 4FPGA 1LOFA 4MYEA 4YGBA 4XTPA 5GALA 1QMJA 3UK9A 3JU9A 3FUQA 1LGCA 4Q1RA 1HQLA 1SBEA 4UW3A 3ZVXA 3Q9OA 3DUIA 2NZ9A 4HANA 1CQ9A 3OY8A 3KQRA 4YW3A 2ERFA 2P2KA 4DQAA 1I1EA 4OZXA 2C5DA 1V6MA 2JE7A 3AX4A 2OUJA 3UL2A 4XHXA 1ULGA 3T2TA 1WW7A 3PVOA 1LEDA 1BYHA 2VXRA 1MVQA 1ONAA 4AGVA 1YXWA 1BZWA 3INAA 5BYNA 3V0AA 4Q1PA 3SISA 4UW5A 1FV3A 1FNZA 2WT0A 3SH4A 3WHUA 4WV8A 1AXKA 1W6PB 3AP6A 2ZABA 2ZHKA 1QOTA 3N36A 2CWSA 3PJQA 4YG0A 2D6MA 3WDUA 2DURA 3WUDA 2A6WA 1AX2A 5DUUA 3O0WA 1GZWA 5GLZA 3WDXA 1B09A 1C1FA 3KM5A 1YO8A 3DGTA 4YM1A 4C1XA 1LOFC 1DQ4A 3C2UA 4FQZA 4ZXKA 1MS3A 1OQ1A 5GLVA 1CJPA 3ASIA 1CONA 3SITA 3UJQA 1RIRA 2R16A 2CY6A 1Z0HA 5JOYA 1DIWA 4RA0A 3MPPG 5GLUA 2ENRA 4M00A 3ZXJA 1LHWA 4LBMA 4Y26A 2EIGA 1MS0A 4BLJA 4FPEA 2DUOA 2GMEA 2UURA 2Z42A 4XJ8A 4WVWA 1YYNA 5HCBA 1WW5A 2VW2A 3TB0A 2DU0A 2ZKNA 1QOSA 4AYUA 4LBOA 4XDQA 4Y1YA 3AFKA 3B01A 4CRQA 5JVVA 3I4IA 4XE9A 3IN9A 3I8TA 4BMBA 1RINA 1Q8QA 2ZGMA 3N7LA 1N47A 3ZPYA 4I30A 3RRDA 3N7MA 3POWA 2R1DA 4M3CB 1CVNA 3VV1A 5IK5A 2PHTA 4FPYA 1EPWA 4GKXA 3ZXLA 1A78A 3D6EA 3SNMA 4Q27A 3VKOA 3A0NA 5GLWA 1S0JA 3ZXKA 1HDKA 1ZM1A 1GKBA 2P3IA 4LBQA 3USUA 4JC1A 4YZ2A 3W58A 1APNA 2Q5TA 4FPHA 3N7KA 1N3PA 1SLBA 3N3HA 1ULCA 2UWBA 3M2MA 3NWKA 1ENQA 4BQ1A 1GNHA 4K21A 1WD4A 3MW4A 2VW1A 4AGRA 5T5OA 3PVNA 1CPMA 3WG2A 1WUVA 4U36A 1IKPA 4NOTA 3D5OA 1UZZA 5EYYA 1C1LA 1GSLA 1MS8A 2AH2A 2DWRA 3ILRA 2GNDA 1N1VA 3IPVA 1ENRA 3JUUA 3O5SA 4XILA 2GMMA 3RMXA 4DPNA 4YW1A 5CNAA 2LALA 3GALA 4Q2FA 3RSJA 1PZ8A 3OBTA 1SLLA 2ARBA 4P14A 4XMAA 1DHKB 2OVUA 1NXD1 3AZWA 1AXYA 1LU1A 3AZYA 3V64A 2ZGUA 4KBBA 4CZSA 4YZ3A 1J1TA 5GLTA 1MZ5A 1JUIA 2D6NA 4XYXA 1F9KA 1LJ7A 1DQ1A 1GZ9A 2D3SA 1W6OB 1CR7A 1H30A 5L73A 1Q8PA 2P37A 4JCKA 1F5FA 4FOWA 4D69A 4XTMA 2I2SA 2TEPA 4F83A 1W6PA 1ZA4A 1V00A 3BTAA 3M3CA 1KJRA 2R0HA 3ATGA 1UZYA 1JHNA 4XBLA 1LHOA 3PVEA 1W6QB 3WZ1A 4DRRA 5DUVA 4BOWA 1N3QA 1LENA 1CN1A 2V5YA 3M3QA 4XIOA 3WG1A 2W68A 3M1HA 3POSA 2AYHA 1IS3A 1DBNA 5HCFA 1MVEA 2YROA 2ZGLA 3WG3A 2DVDA 4Q8LA 1VALA
chains in the Genus database with same CATH superfamily
2QQLA 3HN3A 1LEMA 1ENXA 4HXCA 5T5JA 4E8DA 4KG8A 3SCHA 3WG4A 2RJLA 4F8AA 4GKYA 2B42B 4QGNA 1HJFA 4AW7A 5HCHA 2ZACA 4PHZA 1UX6A 2VQ0A 4O61A 2VMFA 1BJQA 4AFBA 4NAOA 5FKBA 4QPGA 5F5AA 4UI9L 4JHTA 2XXZA 1VBD1 1WW6A 4PLOA 3LB9A 1BHGA 2B45X 5FPVA 1RL3A 3NV1A 1UYYA 3CJXA 1DZTA 2J1AA 1SLCA 4MGSA 4WZCA 3BI3A 4JGYB 4YFWA 2NYYA 4FPFA 4IEYA 3WDYA 4Q5OA 1OKOA 3IMNA 1JYVA 3ILNA 3VGIA 3F2ZA 3LD8A 3PL0A 5K4LA 4XBQA 3WCSA 2FCTA 1VBC1 1IS6A 2YBKA 2DBIA 3HD8B 2HEYF 1VAKA 3NJXA 4HN1A 5FQ0B 3JB8A 2CAVA 1IQAA 5A33A 1YCIA 4IV3A 2WQ8A 2P6HA 4C91A 1FAYA 3URFA 4XC9A 2GALA 1M06G 5DPNA 1J3RA 4KNCA 1LHNA 2EICA 5AVAA 1JTZX 2WS92 1J1LA 4BLIA 3MEPA 5FCCA 5CB7A 4URTA 1UYXA 4EZ4A 1QJX3 3J9SA 1SPPB 1RTVA 5FZ4A 2WNOA 1KJLA 2VUDA 4XF4A 3WP6A 3WLUA 2BJSA 2MHFA 2P1BA 5JWPA 5BY5A 1XNCA 1R1A2 4Y20A 2PHWA 5IVEA 4WM8B 1LGNA 1V9U1 4CDWC 3MI8A 4J1XA 4XOGA 3C7HA 1N1SA 2DVGA 2HEVF 3WNNA 1V6JA 2VQTA 3BN6A 4OZOA 5KHIA 3AXDA 2W92A 5ERLA 4B1MA 4GD4A 4QKFA 4ET7A 4MG2A 3ZN6B 3EBRA 4QGLA 4CDQB 4IL7A 1QXRA 3W5NA 2RMU2 4W65A 4LO7A 1C8NA 2RR13 4QXCA 1WMDA 3WD5A 1XYPA 2D3RA 5A1AA 2ADDA 2YUEA 3ZYJB 2NMOA 1LR5A 3C7OA 3H42B 3PU3A 3TWIA 5HBAA 3ZIXA 1V70A 2HYXA 2R062 3IMMA 4I3PA 5CKMA 5C3OA 2B9VA 3PLQA 5DXDA 1MEC3 3KSCA 3PHMA 5T54A 1PO22 3ZKUA 2ES3A 2BGOA 3IDBB 5JOWA 2XR4A 4Q4W3 2YGMA 1R1A1 2C26A 2DTWA 5BXXA 4AI9A 3AM2A 4OYUA 1WZXA 1GNYA 2JKBA 1XE7A 2W52A 3WDVA 3NL1A 4Z07A 5LCWL 4EN6B 1TVGA 4RGGA 3VZMA 2PHDA 2HWF3 4HN0A 1A8DA 1RMU1 2EIEA 5FZ6A 3PUQA 2XJQA 4QXKA 2ET1A 1REDA 4QKNA 4BXSV 2IFWA 4R9AA 5E89A 4CXXA 1F5JA 5FYCA 1R092 5EXOA 3OGJA 3AYAA 1YUDA 5CVRA 3WNKA 3VKLA 1COV1 5HI0A 1VB4A 1KDMA 3ZXGA 2WFPA 4CTEA 5C70A 2FZ1A 3AVRA 1PNFA 3CHXA 5BNOA 1ZRFA 1Y9QA 2WT2A 5J37A 4R9DA 5IYYA 3D0SA 5FFOC 5K7PA 2R7EB 3V0BA 2XQRA 1RUJ3 4KWKA 3MV11 1MQTB 2BTVC 3SEEA 1UU6A 2BYVE 3UGHA 1ST8A 4XFGA 3KV6A 4UYBA 5EIYB 5F39A 1RJ8A 1VBE1 4Y5TA 5IFPA 1RUG3 2VY0A 1LOGA 2R041 3FHQA 4TXWA 4N53B 3I54A 4W8JA 4Z1VA 4J6GA 5BPXA 4TLFA 4AQTA 1WCQA 1QQP2 1VAMA 2KM2A 1HRI1 3MIEA 3NAPA 2RVAA 4BQWA 5JPMB 3HBKA 3RNSA 1ZBA3 2YV8A 4AR2A 2OYZA 4Y5Z0 2B7YA 4GALA 5LK7B 1AR62 5H9PA 2WO3A 4PBOA 4XFHA 3T09A 1MPXA 1UMHA 3OYWB 2JB8A 4CEWB 1R091 1W8OA 4V2VA 3L2HA 5FPLA 1GZTA 4E4HA 3ZSKA 3UKNA 2YXSA 4AVVA 3AZVA 3U14A 2VZOA 4IEXA 3FLTA 4JRLA 1ZRRA 4RFT0 5IVFA 1YC61 2D43A 1YJLA 2FDFA 1S1AA 3O0VA 3U10A 4JGZC 3FMGA 2FDHA 1VMHA 1WLTA 2ZX1A 2BBAA 4E2QA 5JDBA 2F4PA 2G9FA 3D4KA 1W6MB 1X7NA 4I0BA 5JXGA 1YQ5A 2X09A 2WZR3 1S0IA 4BE3A 1QEXA 5EYXA 3FLPA 5BNPA 1GOHA 5APAA 4DFSA 1C8M3 1UKGA 1Q8OA 3B93A 4AVTA 3B3QE 1VAVA 4QM9A 3NV3A 1GICA 1QQP1 2YZ4A 3IT8A 3AKQA 5FZEA 2AR6A 3I7DA 3O12A 1XPWA 4KL1A 1DGWX 4YG6A 2XUEA 3LPFA 5F5CA 5T55A 2VU9A 4IV1C 5SV5A 4K3UA 5D21A 4FOQA 1GYKA 2DCKA 5A7PA 5FZ3A 5J98B 1UXXX 5KHJA 1FYUA 1Q8SA 1DDLA 3AMQA 3RG0A 1LULA 3RZZA 1J58A 3FUOA 4A45A 1QNWA 4M3CE 2ZEYA 5FZ9A 1JH5A 1CZSA 3VKFC 1Y9GA 4F3JA 3MFAA 4YGDA 4GMP3 1XE8A 3LFIA 4YVWB 3TRSB 1FX5A 1V6NA 3PNAA 4AI3A 4QKDA 1QJX2 2D97A 2WJSA 4LHNA 4Q4V3 4AQSA 5I0SA 4LBLA 3VKMA 2ZEZA 4AHZA 3T1MA 4JHZA 3MLJA 3VBOC 3WNXA 3ST7A 5KHGA 1OKQA 3WOGA 2FCUA 3F95A 5HV4A 1E5IA 4MXWA 4OI4A 4AF9A 3VN4A 4Y1VA 1XNDA 5FWJA 3H9AA 3LA7A 4O9GA 4D6SA 2KD7A 4I02A 1QXPA 3KD4A 4R4ZA 4R52A 1DZRA 3EHKA 1W6OA 2BNMA 2GMPA 2DV9A 3H7JA 5FOJB 4W4ZA 2UYAA 4HK9A 2RR12 3UJOA 2A6YA 3UETA 5DZGA 5A3LA 1CWPA 5GZCA 2R073 2BWCA 2DYCA 2HYKA 2WT1A 3GF6A 1KGYA 4RS5C 4UFIA 3UGGA 4OQ8A 1RUD3 1WA4A 3RS6A 4AEDB 4ZXEA 3TN91 2HWD3 1SQ4A 4QQLA 2NMNA 4XHBA 4YZ5A 2BZDA 4MGZE 5A33B 3WX5A 4E8CA 1X36A 1DCSA 2ZKLA 1BXHA 4XJZA 3ZFEA 2NQYA 2P34A 2B5HA 1MS4A 3NNMA 5F5IA 1WBLA 1K5MC 2WO1A 4P9LA 4AVCA 3ENRA 3RJRA 3DXTA 3WCRA 1YHFA 2OW4A 4D6QA 1QDCA 2A3XA 3SKVA 5B4XA 2G9ZA 2VOVA 3EJKA 1W8TA 5KR7A 4KMQA 3OBAA 1ASJ3 2G4IA 3K3OA 4JTOA 1TME3 3OPTA 2PHXA 2CTVA 2HWF2 2VUJA 4Y20B 3ZXAC 4CDUB 2WLQA 2WSUA 4BB3A 3UGFA 2RR11 3LDRA 3KMHA 3TYJA 5DAPA 3S6PA 2P3YA 3H8UA 3WDWA 4BIOA 2CL2A 2WN2A 4OHXA 3AKTA 5CBLA 5JMCA 1NYWA 1FI2A 2QQJA 3DXUA 4AEKA 1NY72 4CP0A 5FZLA 4ATEA 4P9WA 2NM1A 3BTZA 2X8KA 1BMV1 1QNYA 1ZRCA 5JZGC 1LKNA 3K51A 3ZSJA 1OSGA 1SBFA 1YRZA 3OJBA 3POFA 5H9SA 1RUJ2 4EYUA 1S0GA 3B00A 3K4ZA 1O4YA 1OA2A 5FMBA 5F6LB 3AP5A 1LOCA 5FXXA 3PMEA 4AL9A 3AP4A 4O65A 1UOGA 1VIWB 4YW2A 1JOBA 3AXEA 1H8TB 1RUG2 3OUIA 3TBDA 3UV9A 2XVKA 3NJZA 5GZGA 3ZDSA 4AK3A 2QQMA 1F35A 3IPVB 2GN3A 2JE8A 4Q26A 4Y1XA 5J48A 1W03A 1ZBA2 2VBBA 2XBO3 3AMMA 3IDCB 3ZXFA 2XL9A 2WNVA 2JDAA 1HRV3 1VPHA 3ES1A 3VBHA 1Q43A 4MYEA 4XTPA 5FPZA 1D4M1 1JZ5A 3NSTA 4Z2WA 4JGYC 3FUQA 1HQLA 3IAPA 4CP9A 1UOBA 1SDDB 2D98A 2TUNA 4QDRA 4P5HA 2CDPA 1TMF1 2C1FA 1NY71 1A8MA 1RXGA 3CZJA 3H50A 4XFCA 3VHRA 4XFAA 2X53S 3OY8A 2PYTA 1J83A 1OOPC 4GWIA 4YW3A 4WVMA 3TNQA 4DQAA 2YU1A 3VL8A 5FTTC 4Y4RA 2C5DA 3KCCA 3AX4A 4GQ7A 1SFPA 2BRTA 1ULGA 4R8HA 1RUJ1 1BYHA 1QIQA 2VOXA 1ONAA 2WZR2 1BZWA 1YXWA 5EJ1B 4AGVA 4YRDA 2JDPA 2X5IA 4Q1PA 1RUH3 4RQPA 1HXS3 1FV3A 1YFXA 2XLAA 4RYDA 1BVP1 4PDWA 3HIFA 5FZ0A 4YSFA 1T6GC 2HBTA 2BNNA 2CHHA 1RUG1 3AP6A 1JZ3A 3E5QA 1QH7A 2RS13 3NO8A 2CWSA 1H4HA 2DURA 1AX2A 3NNLA 3KCYA 3LAGA 3WDXA 4DEVA 1Q3EA 5FZHA 3BGAA 5CISA 1HB1A 1W8ZA 4QB6A 2XWJB 1DQ4A 1ZRIA 5C33A 3JB4C 3U0ZA 3NAPB 1MS3A 4TN7A 2AC1A 2KXLA 5DAWA 2L9LA 4QD2A 4OHVA 1DIWA 5GLUA 1KD7A 3MPPG 2ENRA 4QHOA 5FYUA 4Y26A 1PO13 3RJ2X 4CUGA 5CG9A 1EUUA 1CAVB 1BEV3 2E63A 4WM7A 3I2OA 4B3NA 2JG8C 3MIHA 4IE7A 1YYNA 2VW2A 1F4HA 2Q8OA 3RZGA 4FFIA 4AE2A 1QOSA 4O9EA 2JEMA 2WZR1 3AFKA 1K45A 4Q4V2 2IVIB 4FAHA 2Y38A 4KGGA 5JVVA 3K4AA 1X9TA 2VXJA 2VVDA 3I8TA 4OLLA 3WT3A 2ZGMA 3BU7A 3VZKA 1ULPA 3RRDA 3ZIWA 3O1PA 3M4FA 5BNPB 3WQ1A 3KLSA 3T0BA 4NRPA 4GKXA 4Y4YA 4K7JA 4NHMA 1S0JA 1W28A 1HDKA 4Q4X3 1ZM1A 5L9VA 2P3IA 5FYZA 1AUYA 1Y43B 3VBRC 5FZ7A 2IZWA 4J1WA 5CFDA 1F4AA 4CEYA 4D7SA 3N3HA 3CF6E 5A1LA 3JD73 4XDOA 2WO2A 1BCXA 1GNHA 2R072 1WD4A 3N9OA 4MXVA 5A7WB 2E31A 2J1VA 1VRH1 3WF2A 3OOXA 1RUD2 4ARXA 5AC91 3PVNA 2MEV3 4IESA 2HWD2 2DFBA 1IKPA 3CZUA 3D5OA 1XNKA 3THCA 2BOJA 2IXIA 1C1LA 2VOKA 4PIZA 2VNVA 3OGSA 1LB2A 1HX6A 4Q4V1 1ENRA 2LROA 1O4TA 3PURA 1IZ3A 4LR4A 1W8FA 5CNAA 1EAH3 3T0DA 1XU1A 3LDKA 4HK8A 3GALA 5LW9A 1DP0A 1DHKB 2ZZQA 4JV4A 1ND3A 5BNNA 4W6WA 2OPWA 3JCIA 1ASJ2 1VBD3 3KF5A 4URAA 4AI2A 1TME2 5LATA 4OI0A 1HB3A 3WP3A 5C9AA 1UWWA 4Q0UA 1S4CA 4P00B 4CXWA 1ZZBA 3M70A 4KGQA 5JAXA 2J42A 5GLTA 3O1OA 4N53C 4FXKB 5A3WA 3VD3A 2D6NA 4XYXA 1LJ7A 3ACHA 2NLRA 1PMJX 2QQOA 1W6OB 1HB4A 2CGOA 2G1MA 5EHDA 2ZJCA 3N9MA 1HQNA 4JDMA 3WNPA 1L3JA 4D69A 1JI6A 2HWD1 2JDNA 4F83A 4ORFA 1ZA4A 1KJRA 2R0HA 4LA2A 1UZYA 4XBLA 1BLZA 2BU9A 3PVEA 1SHWB 3J4UH 3PTYA 5C7GA 1J59A 5IAVA 3KZ4C 1LENA 1W8NA 3FC0A 4FXGB 2QQUA 4QPIA 3POSA 5C8CA 4JQTA 3EYPA 3K3NA 3NKTA 1ZX5A 1UZWA 2ZX3A 3A23A 5FLIA 3MGUA 2DVDA 1ZZCA 1TME1 2VTXJ 1V9U3 2E7TA 1KFUL 3WHTA 2EF6A 2XBO2 2W08A 1UXZA 1HN0A 3E1F1 4JKLA 1U5YA 4C8DA 4E2GA 4Z8BA 1HRV2 1NOVA 1W05A 2GAUA 2ZGTA 1NE4A 1LHVA 1UIKA 4XABA 3POJA 2YMZA 1POV1 4ATFA 2E26A 2VZTA 5KHHA 2A70A 4JGZB 3PUHA 4QQOA 1X8EA 5K0UA 1W9TA 2ZMKA 2E32A 1VP6A 4H14A 3OSDA 2ZEXA 3TOJA 2CAUA 4JRAA 4BQXA 1US2A 4PI2A 3ZYBA 2PN5A 4XCBA 5FREA 4E4SA 2XDVA 3IIIA 1Z78A 4WVZA 1RVF3 1H6YA 3FFZA 5CAZA 1R081 2Q0AA 5C5TA 3ZFGA 1VMJA 2Y6FA 4YM0A 1E57A 2DVAA 4LPLA 1DLLA 4JTNA 4BPZA 3O0XA 1RUH2 3M8LA 5FY5A 2XKPA 1HXS2 2X10A 5FYTA 2BGCA 4MGYE 2UY9A 4YVWC 1N1TA 3H8RA 1D7PM 4IV1B 2RS12 3ZKYA 4CUAA 2JECA 3JZVA 4J25A 3CJIA 1GBGA 4AQ2A 5JI9A 2XBO1 4NPRA 3E6CC 2VAUA 5FMOS 4I0WB 4IETA 4CA9A 3VZJA 1SLAA 1UY3A 4XPVA 1CAWB 1WCSA 1XSQA 4AG4A 3H0OA 5FY0A 1RMU3 5JOZA 4QPGC 3CO2A 2W95A 3PMSA 2JENA 1X8MA 3OEBA 5A3OA 4EE2A 1VBB3 2WNVB 3FBMA 3VBHB 1VRBA 5LA9A 3VUOA 1UN1A 5FYVA 3GZEA 1COV3 2XLGA 4RHV1 3ZO0B 1G8WA 4AFMA 1O3QA 1K3IA 1BEV2 3NNJA 4FFHA 4R9BA 3B02A 4XUTA 3IWZA 2Q1MA 2E7QA 1XRUA 3LSEA 5E6HA 3VBOB 4MLOA 2AEZA 3W21A 2YU2A 3OY8B 3ZX7A 3KGLA 4WVMB 2VOTA 4AWDA 1RUH1 2FDIA 2UWCA 2AZ5A 1HXS1 1OLRA 2WWUA 1V6LA 3VKNA 4OULA 1QU0A 3EMRA 4XVHA 4IV3C 1OFSA 2VD7A 1TZOA 1E5RA 5D2AA 1VBE3 3MHZA 4RQPB 3AJZA 2WWJA 1YWKA 2R043 2ZPXA 4OCTA 4PDWB 4K1YA 3S7EA 1FNYA 1QOOA 2EXIA 2ID4A 3N35A 4UT5A 3UKTA 3ZYFA 4AHXA 1HRI3 1Y7BA 2B9UA 1UY1A 5IK7A 4Q4X2 3WQBA 3MFCA 4RS5B 1NQJA 4XQDA 3MIDA 4ZU4A 1UCXA 2ETEA 1WLDA 3ABZA 4FSJA 3L2YA 2ZGPA 5I0TA 1AYM1 1I5PA 1DF0A 4LNVA 2XJSA 4UBHA 1G9DA 4QX8A 3AYCA 2YHJA 1GNZA 1SDWA 1S0BA 2ZZJA 4B7EA 1BEV1 2VVFA 1LTEA 2MEV2 3NJYA 4GH4A 5FRAA 1K5MB 2OQ7A 1WLWA 1UKRA 1RUC1 3IKWA 2PMWB 3FBYA 4RS5A 2XB6C 5CEHA 3MW2A 4HKOA 4EWEA 4YARA 3IM0A 2H6BA 1V6KA 3AMPA 1EAH2 2VBPA 1XBFA 5T50A 5I8YA 3AC0A 4BQYA 3H3ZA 4NUBA 1C4RA 2EAKA 4GWNA 1UO9A 1UY0A 5FY4A 2W5FA 1OH3A 3GZUC 1FATA 1VBD2 1PVC3 4EWAA 4BZ4A 4XAAA 5AFEA 5LA1A 5LRRA 2H0BA 3H1YA 4P9XA 2V5DA 3MUY1 2NN8A 4OUEA 3TEZA 2ZMNA 3WQ7A 3JQWA 3GCXA 5IK4A 2JXAA 1LGBA 2VW0A 3SQOA 4QX2A 3I3QA 2ZAHA 5B2GB 1W06A 3LE0A 1JZ8A 5ISLA 2FDGA 2D44A 5DQ0A 2UWAA 1A6CA 4LIUA 3U4SA 3K77A 5CFDB 1YQ6A 3B94A 3CU7A 4BH9A 2ET7A 4LKFA 2PAEA 2ZGOA 3A7QA 4OI2A 2ZGRA 4JKKA 4NN0A 1EAH1 3HN1A 4OMCA 2JIGA 2AACA 5EFUA 1S2EA 3DYOA 1GU3A 4A42A 4NO4A 1UAIA 4YGEA 3WF1A 3S5AA 2IFRA 1OQDA 3LZZA 3LOIA 5F9TA 4DS0A 1XSRA 4JDNA 4JQRA 2OZ6A 5LBCA 3U07A 5BNOC 1RJ7A 3J8F1 1V9U2 3ZYIB 2Q8EA 1ND3B 5BNNB 2JDYA 2AUYA 4YW6A 4CU9A 1JU3A 2VZRA 1H1IA 4DRVA 1O7FA 4LBNA 1O3SA 5HCAA 3U4XA 1OOPB 4XUOA 3ORJA 2ARAA 1XC6A 2RM23 3LF7A 4LKEA 5GJ6A 1UMZA 3LFMA 3SH3A 2GH2A 2WRAA 3HAGA 3NAPC 5FUPA 1XNTA 4UFMA 4HVQA 2VMEA 1SLIA 3LSDA 2OZJA 2BFUS 4HKLA 3IDAA 4PT6A 1RVF2 3HT2A 3TN93 5JSRA 5ABJA 4LOSA 3SMHA 4BQ5A 2QQVA 1C57A 3T4VA 2BV4A 2XJUA 4UW4A 4S2DA 4BJ0A 2DCYA 1YIFA 5FZAA 3ZFFA 1W90A 5KBFA 4K40A 4L92A 1DU3D 2UY8A 2IWGB 1M4WA 4FO9A 4RR3A 4QPIB 1HJGA 3WUDA 3ZYRA 4FP3A 2YC2A 4YGCA 1QF3A 4QU1A 4DXRA 4OHWA 2J7MA 3ZLIA 4HBNA 3HQXA 1JXNA 1VR3A 4KWJA 4Q8KA 5FJKA 5A3NA 3BKZA 4QB2A 1JU4A 1RMU2 5F2SA 3T3YA 5BNPC 4LE4A 5LA2A 1GQHA 4TWTA 1VBB2 4IEOA 3CBNA 4LUKA 4M3CF 2JG8B 2VPVA 4K20A 2XG3A 3T2QA 4DY3A 5JXHA 1COV2 1DFQA 1W9SA 1ZNPA 1W6NA 4ES8A 5K0UB 5DUXA 5J3UA 1NAEA 2RE9A 1RVF1 4N43A 2V4AA 3LEMA 5CIRA 1JMUB 2HWB1 4WZFA 2F6BA 2O8OA 3MF6A 3PVBB 3MUZ1 4IEZA 1G7YA 2IVJA 3AZZA 3HR9A 3NNFA 4SLIA 3SKJE 2E51A 3I3BA 1OXCA 2PAKA 3N9NA 3VD9A 3ZYGA 3N4MA 1VBE2 1Y9MA 2D6PA 3M3EA 2ZGSA 4IEPA 3MV01 3HNYM 2R042 4INDA 3H8OA 3VBRB 1FOD1 1KQRA 2PFWA 4CE8A 2C24A 1HRI2 3QBQA 1KS4A 4IEVA 4CCNA 3CJIB 4Q0SA 4RL7A 2DCJA 4IE6A 3QCWA 1PGW1 3AYEA 1VBB1 2D6KA 5D8AA 5A6ZA 1D4M3 2ZGNA 3N9PA 3ZMOA 4ZHNA 3O1VA 1I6XA 2YDEA 3ZYHA 2W39A 2VNOA 2E7AA 2KR2A 4XURA 5F5QA 3I2JA 3ILFA 4V2WA 3KQ4B 4YVSA 1TMF3 4LLOA 1LODA 5FMDA 2VR4A 2XGXA 3N9QA 1KDKA 4S2GA 5IJRA 1DQ2A 1TQ5A 4LA3A 1R1ZA 3Q8CA 1YFYA 5JR2A 2LW8A 1S55A 4XJWA 4MUVA 1XNAA 4XJAA 4PQ9A 3GYDA 1Q56A 4ZS2A 4BHPA 2ZXQA 2VULA 5FZIA 5A32A 2LUWA 1KRIA 1PVC2 4D94A 2J1UA 5FPAA 3MLKA 3K4DA 1H9PA 3OGRA 4FP2A 3SC7X 2WZPP 2A6ZA 3VBSA 1GZCA 3WUCA 3CQOA 3ZFEC 3FE5A 4N8MA 3GZAA 2XUMA 2VH9A 3ECQA 3LQCA 3POIA 1CD3G 4H55A 1U12A 3R0RA 3GBWA 3T4HB 1IS5A 5A1FA 3QH6A 1UY4A 1XYNA 4XF9A 1LCLA 5I8TA 3JXSA 3MW3A 2FCVA 4Y1ZA 1HV1A 4PI0A 4OHYA 2CNAA 3THTA 2O14A 4K1ZA 2WSVA 4M0HA 4XETA 1OC1A 4GJZA 1CAUB 1PX4A 2IUWA 4NPMA 1GR3A 4FPGA 3WXPA 4BU2A 4YW7A 2QE3A 5EQUA 4EZHA 4ZPIA 3KGZA 5F3CA 5K9YA 1SBEA 4PIXA 4UW3A 3ZVXA 2FMYA 3RDIA 4AEJA 4PLMA 3I2HA 4QX5A 1CQ9A 1GWLA 4M0NA 1PVC1 4Z82A 2ERFA 2YFUA 4LULA 3TEWA 3M7AA 1EP0A 2WQ4A 5BUVA 1I1EA 2EAAA 5A3PA 1XOYA 2OUJA 3UL2A 4XHXA 1LEDA 4MZUA 4UWDA 1MVQA 3FFQA 3MO4A 5FLHA 3INAA 1YFUA 1T2XA 4UW5A 3SISA 3AKSA 5IVYA 2D40A 3D0JA 5F3IA 2ZHKA 3C8XA 3K46A 1F8VA 1X9PA 1RYYA 2RM22 4B29A 4FTEA 3PJQA 4YG0A 3WDUA 3VDBA 1ZREA 2WAAA 2A6WA 2I45A 4LUMA 5GLZA 3O0WA 1GZWA 2WFF1 4N7UA 3WF0A 1VRH3 3MIGA 2WNVC 5AC93 5IVJA 3VBHC 3TN92 1RHI1 4A3ZA 4C1XA 2LS6A 4NROA 4AAPA 2CU5A 4CP2A 2ZOEB 1CJPA 2WA4A 1OUXA 4MOAA 3SITA 4AI0A 2R16A 2CY6A 1UW8A 1Z0HA 2BW8A 3CLPA 5JOYA 5JCTA 1LHWA 1VBA3 2HJIA 3V56A 1MS0A 4BLJA 2JKXA 4FPEA 2EIDA 2UURA 4NWWA 4QPGB 2K2SA 3Q8FA 5FZFA 3TB0A 4UF0A 2DU0A 3S30A 4AYUA 2QJVA 1W9YA 4LT5A 4Y1YA 3H7YA 1AR71 1OUSA 3B01A 2X5IC 3Q8EA 4XDQA 5G05L 4RQPC 3EO6A 5FP4A 5FY9A 4GMP0 2VZQA 2WUHA 1CJDA 4JKMA 4PDWC 3IN9A 1JYNA 5LEKA 2Y6GA 2XMLA 1GWMA 1N47A 2RM21 4I30A 3N7MA 4X6RB 3POWA 5L9RA 1T6BX 3I3EA 4FPYA 4LKDA 3ZXLA 1ALYA 1A78A 3D6EA 1YNAA 4NHXA 1RUOA 4KWUA 3PIGA 2RDNA 2XHKA 2ZEWA 3A0NA 5GLWA 3SXWA 4D0QA 2VO5A 3N9LA 2ORZA 4LBQA 4IV3B 3USUA 1GMMA 5A80A 1BMV2 5B4NA 4QHZA 4UAPA 4QQHA 3N7KA 1SLBA 1XU2A 2UWBA 5ABJB 1QXJA 1ENQA 1ND2A 2VC9A 3GDBA 3DKWA 5F3EA 2Y6HA 5LY1A 4AGRA 4AFAA 4XACA 2WIIB 2OIIA 3OB8A 3U75A 4WM7C 2J1TA 2F17A 5EYYA 5A3MA 1C3HA 4XZUG 3ILRA 5FP3A 3T2PA 3KT1A 2GMMA 4YW1A 2GC3A 2W47A 4RN5A 3QD6A 1NLRA 3GHNA 1PZ8A 4HG6B 1D4M2 2ARBA 3I59A 4IGPA 4XMAA 2HBUA 4BXFA 2OVUA 1POV3 1NXD1 2BBVA 4UFKA 3V64A 4CXYA 2JDMA 2VZVA 1TMF2 1FPN2 1OPOA 1CX1A 4YZ3A 4MX3A 5C3QA 4QB1A 4D3WA 1W2AX 2B46X 4B4RA 1SEFA 2A1XA 1MZ5A 4CEYC 5CFDC 1DQ1A 2D3SA 1R083 4DY5A 3HQUA 2WABA 2RV9A 4N43B 5L73A 1SZBA 2X29A 3PTRB 3JBG1 4B7KA 3J7HA 4JVAA 4LTAA 4EN7B 3O1UA 2FZ2A 1F5FA 4FOWA 1QY4A 1STMA 4K6BA 2I2SA 4PLNA 1W6PA 2W1WA 4E2SA 1V00A 3BTAA 1FT9A 3L9JT 4QX3A 2R6QA 1YFWA 4QDSA 5EP9A 1PX3A 1LRHA 4DRRA 1UQXA 1N3QA 4FI9A 3M3QA 4D7YA 5A3TA 4AVBA 3M1HA 4F7ZA 1ND3C 5BNNC 5FYMA 5HCFA 1MVEA 1IG0A 1MZFA 4CPBA 5C4WA 1VALA 1W8UA 3RI8A 2WL1A 1FPN1 4IXLA 5C9AC 2YGLA 3R4UA 3MF9A 4FOVA 3ACGA 4RHV3 4FPKA 2WN3A 3J26N 1NCRA 3H8XA 1AL21 1OURA 1WD3A 4YVSB 4LK6A 3J7NA 1UU4A 2Z69A 5A7SA 5BNOB 5FYSA 2Y34A 4YW4A 3C7FA 1KEXA 2BP6A 3P1IA 1S0DA 4AFCA 2JDHA 3V0BB 1BBT1 5T52A 2TBVA 4HKWA 4H2AA 1B35A 4LBQD 3I2KA 1GQGA 3VDAA 1H2LA 2DUQA 2WNUA 1ODNA 1W8HA 2Y8KA 3QLQA 4OUSA 3KV9A 1W99A 5JIAA 1QHDA 1TG7A 3S5QA 5DG2A 3W9AA 1RUI1 1I3HA 1SACA 1D4VB 2YBSA 1S2BA 3BVCA 4UFLA 5FYBA 1XQNA 5A32B 1EUTA 4CCEA 2WC2A 2HWE3 2E9QA 2D7FA 2J1RA 4E27A 2R0FA 4NE9A 4QPIC 2IXCA 1AVBA 1NG0A 4DUVA 1UYPA 5C8CC 1ZZ8A 1EYBA 2IXHA 5A7NA 4CUCA 1GP6A 1O3TA 1G9FA 2DBNA 1OMIA 3RZJA 3OBRA 5GZFA 1AYM3 4JDOA 1UY2A 3ROUA 4FQ4A 2VG9A 1VRH2 5AC92 4YNIA 5LBEA 2Y6LA 5IFTA 1AL0G 3LKJA 5JI7A 3WNOA 1DQ5A 1REFA 3ETQA 4YYOA 1AX1A 3DL3A 1RUC3 1VLNA 3HJRA 3P3PA 2DDUA 3UESA 4N9HA 1PGL2 5K0UC 1C5HA 3KS7A 2D6LX 3NKGA 1MS5A 3BOPA 4A7KA 2V73A 5KHKA 1VBA2 4D6RA 3QACA 2XWBB 5EWSA 5J36A 1IKQA 3VDDA 2FDKA 2XVGA 3T1LA 3U1XA 3ZFGC 3MBWA 2J1SA 1XJAA 1TNRA 2C0ZA 5FMOL 3KT7A 1D2QA 1WLCA 2IXJA 4HOOA 4AGGA 5I0RA 2RJKA 4QXHA 4L11A 5G04L 4C0HA 4V1PA 4X6QB 2GH8A 2DVBA 3R05A 3RYKA 4AOCA 4QT6A 2PLV1 5DDJ1 1AZDA 4X8NA 5LASA 4RD7A 3CJIC 3VD5A 2E33A 1VMFA 1XB9A 3R4SA 2ZGKA 3TAYA 2QBXA 4S2FA 1GV9A 1W9FA 2BNOA 2C9AA 1REEA 3VBUA 4PF5A 1URXA 5L7OA 3ES4A 3LCPA 1WCUA 4CPBD 3NQHA 2W1QA 4HPKA 4U2AA 1PGL1 4COVA 5EZWA 2RS53 4N90A 4MH0E 1OBNA 4QXBA 3WEZA 3WSOA 3ACFA 3LPGA 4GA9A 1VBA1 4XIKA 3ZR5A 4ASMB 1AYN2 5HXVA 2ZGQA 4DUXA 2FQPA 5FY7A 5FY8A 4HONA 2PHUA 5FZCA 2VNGA 5I0UA 1SFYA 1A34A 5EPAA 3J8F3 4FVVA 5E88A 3W5MA 3OD4A 1AHSA 5GM0A 1LECA 4LEJA 2GNTA 4MXWB 3TEYA 3A0KA 2CGPA 4BK5A 1YQCA 5J7MA 4UF0B 2AREA 4M4PA 4ASKA 5E8AA 1AR91 5FUIA 1AF9A 2VMGA 4L8QA 5F37A 5FV3A 5FR3A 4HZFA 4G9SB 5L36A 2QZ3A 3LOBA 4K8RB 2ZHLA 2PHFA 4UFHA 4M01A 3WW3A 3DV8A 5GZDA 2QKDA 1UIJA 2WQZC 4B1LA 4DXZA 3BPSA 2FHRA 1CZVA 5IATA 2GC2A 4BMEA 4ONUA 1R082 3HMYA 4CCMA 3E6DA 4UFJA 2Q30A 1CIYA 4LBQB 1DYKA 1PK6A 1AYN1 4ZU5A 4AI8A 3ZFEB 4AZZA 1OVPA 2A71A 2ILMA 4GH4C 1MACA 3OD0A 1W2NA 1CIWA 1JYTA 3VZLA 1QJFA 2UU8A 3MDPA 4XCAA 4XMIA 3WW2A 1BQPA 4LO6B 3AMHA 5CFCA 5I93A 3BOWA 4TYSA 2D6OX 4D7TA 4IDZA 1K12A 2DUPA 3WNMA 2W1SA 1KS5A 3CEWA 3IZOA 5DZEA 5KWRA 4BM8A 3RQ0A 1W9WA 4YZ4A 1LOBA 1UU5A 1DYOA 1QJZA 1NKGA 1D0HA 2RDQA 2E53A 5LWBA 4LOTA 4KH9A 4AEMA 5DUWA 1ULDA 1NCQA 2VJXA 3POBA 4WM8A 2BEOA 3NW4A 4RHV2 4QPWA 2VZ3A 3VL9A 1C28A 5IHRA 4YM3A 3I2GA 1G9CA 1FXZA 1IOAA 1POQA 1NX9A 4CDQA 1NZIA 4IE0A 2GZWA 4BQ4A 3D3AA 3R6SA 3DN7A 4A6OA 1YQ2A 2HWB3 2Y64A 1FV2A 2PXJA 1WW4A 3NVCA 4N7IA 4EN9B 4MHRA 1LOAA 5T5PA 4IGOA 3BYWA 2R1BA 4MV2A 1JOPA 5IT6A 1Y3TA 3VHNA 4MADA 4CU8A 1IQDC 2ZS6B 2A6VA 2ZX2A 1FOD3 1O91A 2HWE2 4DZGA 4LJHA 4LHKA 1F31A 1GANA 2VTXA 2WLPA 5AVPA 1X50A 2QTWB 4BA6A 3VDCA 3RVHA 5A7OA 2OXBA 5JSPA 5CZKA 2AGSA 1RGSA 1AYM2 1UX7A 2RHPA 3P3NA 4QKBA 3AK0A 4CP9B 5J09A 2BFUL 2VMHA 3MIBA 4B8EA 1RITA 2W1UA 1RUC2 5IUQA 1ULFA 1NZCA 4Y3OA 2MPFA 3AP9A 2Z4FA 3AL5A 1WBFA 1DYPA 4H7LA 1NCRB 1YIPA 3ZFGB 4IEWA 2VQUA 2JG9A 5SV8A 4KU7A 2HWC3 3KB5A 5FIXA 1L7LA 2YB7A 1OA4A 2X5IB 3ZSLA 4CDXA 2VOWA 1OH4A 4KI5M 5CADA 4ZZ8A 2JWPA 2XJRA 2XH6A 5ABJC 1B35B 1ZYBA 5A70A 5ACA3 2CSGA 2F4LA 3UNPA 2HWE1 4ZS3A 3AB0A 1CZTA 4LO4B 2A7AA 1MQTA 2O1QA 4SBVA 3ZFFC 5H9QA 3CIHA 4YM2A 5GZEA 1KXGA 1GOFA 4LMFA 4RR3C 2NP0A 1UYZA 5FO7B 2CYFA 2RS31 2GN7A 5D1IA 5CYYA 3AL6A 1ENSA 1O8PA 2W46A 5FYIA 3FWEA 3I2FA 4A3XA 2RG4A 4DINB 5IK8A 4ISRA 3TEXA 3CKHA 1UPIA 3B5LB 4NJ4A 4EWDA 1RUE1 4ZONA 3AJYA 3AVSA 3IB3A 3OYWA 4WM7B 1H1AA 2RS52 3BODA 3POGA 5FP8A 4FT8A 3ZXEA 2JD4A 4CEWA 4XF3A 3UT0A 4NIDA 4I2OA 2B8MA 1S2KA 1H1MA 5FXVA 1OA3A 1NLSA 2WO7A 2ZHNA 2VM9A 2VMDA 3POYA 4XFIA 2D3PA 1WMEA 2VZPA 4N43C 2OS2A 3C7GA 3ETPA 3PIJA 3RI9A 3J8F2 4HT1T 4P9JA 3NV4A 5DAXA 1AJOA 1SBDA 3VDDB 4BYYA 4HL0A 1AJKA 4XQWA 1W6MA 3T30A 3THPA 1UPSA 4E4DX 5I91A 1E5HA 1L7QA 3VBFA 3O1MA 4GZ9A 2G9GA 3ZPOA 1YI9A 5JLVA 1G86A 1DQ6A 3T2OA 2DFCA 4UW6A 1U5XA 4FPLA 5KXCA 5F3GA 3ZYPA 2YC0A 4CEYB 3C7EA 5CKNA 3OGGA 4LIVA 3WY6A 3U78A 2PHRA 1JOJA 2WFF3 2YY1A 3OPWA 4E4ZA 1HIXA 2WINB 3G7DA 4ZZ5A 2SLIA 1RHI3 1XXNA 5D8AC 4ZY9A 2EXHA 1W0OA 1JYCA 2RS51 1SG3A 4P5YA 5L7OB 2PA7A 1F15A 3AFGA 3H3UA 3WP4A 5IVCA 3NNGA 1SCRA 2J1EA 4YVSC 3DYPA 4L9BA 5F8PA 3ITQA 1GQPA 1JUHA 1HKDA 4QX7A 1LOFA 4MGKE 1DG6A 2WA3A 1FMD1 3DPRA 4YGBA 4DMIA 5CU1A 2QCSB 3JU9A 3KVBA 1H4GA 4Q1RA 2JB4A 4QM8A 4E9KA 2IXKA 1AR73 3Q9OA 5FK8A 3DUIA 4NWVA 3RGBA 5C9AB 1WMFA 2B39A 4HANA 3K2OA 4A44A 1U5IA 4BK4A 2P2KA 5J96B 2CV6A 3E5UA 1AR83 3VZOA 5BNQA 3VBSC 1V6MA 2JE7A 5J1XA 2GP3A 4QDQA 3WINE 3T2TA 1WW7A 2PAMA 3IIAA 3V0AA 2Y0IA 5K8SA 4OFGA 1FNZA 1RUF1 4JX0A 3DEMA 4N9IA 3SH4A 3VHOA 3RZHA 1AXKA 2V09A 4L0PA 5A7QA 2HWB2 4P02B 4FFGA 5C3PA 1RC6A 3N36A 5JMOA 2Z79A 1I5ZA 5DUUA 5CG8A 3HWJA 2XONA 1PK6B 2GP5A 3DGTA 3KM5A 4YM1A 4AEDA 4A7ZA 2OT7A 5C8CB 3OUHA 2DCTA 1EY2A 1OQ1A 1FOD2 5GLVA 3RPQA 1Z7S2 2VL4A 1H2KA 5E16A 2QNKA 3UJQA 2BGPA 1OF3A 2JDUA 4RA0A 3HEIA 4W50A 4BISA 2VTFA 4LBMA 4DXSA 5CFCB 3H1MA 1PGW2 3OTFA 2Q1ZB 2QQNA 4I09A 3NMBA 3ON7A 5FDBA 2K9ZA 4HFSA 1UZ0A 4XJ8A 3O1TA 1ACCA 5FO8B 5HCBA 2Q8CA 1WW5A 4LORA 1O5UA 2P4EA 2ZKNA 3D82A 3W20A 5HV0A 2D5HA 5LZ6A 4LBOA 3BUCA 4I0AA 1NCQB 4CRQA 4CDUA 1YJKA 1RXFA 1GUIA 4JZRA 3MZHA 4HSJA 1RINA 1Q8QA 2Z5WA 3N7LA 3FHAA 2Y26A 2P17A 1NA1A 1ZA7A 2ORXA 2R1DA 1CVNA 2XL7A 2HWC2 4LK7A 3VV1A 1EPWA 3JBG3 4QWNA 2QQWA 4XUQA 1O6UA 1X33A 4META 4Q27A 5FPBA 3VKOA 3ZXKA 1NXMA 4JAAA 1GKBA 5FKCA 4A6SA 5ACA2 1OI6A 3FJSA 1WKYA 3E5XA 4LITA 2YC4A 1Z7S1 1JODA 2Q5TA 5C3SA 1ULCA 3NWKA 3M2MA 3PUIA 4BQ1A 4K21A 1OLMA 1UMIA 2WS91 4KG0A 1C5IA 1J3QA 5T5OA 3KWVA 1CPMA 3WG2A 2ATFA 1WUVA 4QMAA 4U36A 1PMHX 5A6XA 1H8TA 4NOTA 2BPA2 1UZZA 3LEIA 4IE5A 4B4PA 1RUNA 1GSLA 2EVXA 1MS8A 2AH2A 1PHMA 5FZ1A 1PNGA 4C0BA 2ADEA 1FPN3 2GNDA 1N1VA 3IPVA 3MYXA 1W2UA 3O14A 4GB32 4XILA 3RMXA 4DPNA 4YWAA 5FP7A 4CUBA 5C5UA 2LALA 1XNBA 3GJAA 1AL23 1OPMA 1BK0A 3OBTA 1SLLA 5FZKA 2VZSA 2OKXA 4DO0A 2XJPA 2V72A 1AXYA 2W0XA 1LU1A 4FAGA 3DECA 2HWC1 2RMU1 4XEZA 1DLCA 2I74A 5EV7A 4LO5B 4CU6A 4CZSA 4EQVA 1BBT3 2CGNA 4TSVA 5JR7B 3ZMNA 2JG9B 3HNBM 3HQRA 3LWCA 2VMCA 3KV4A 5FZOA 1J1TA 2VE1A 3LA2A 5ACA1 1QH6A 2XPJA 3OG2A 1RUI3 4CU7A 2OPKA 4CDXB 2JD9A 2R061 2RJ2A 3OGVA 4IEUA 1H30A 5IWFA 5EJ3A 1ND2C 3CMGA 2P37A 5T3NA 5FO9B 2OX0A 2BWAA 1PO21 4XTMA 2TEPA 4BCUA 2NPIA 2PTMA 3FHIB 1OLQA 4IEQA 3S0MA 1JHNA 1WA6X 1QJY2 3TNPB 2LM3A 2WAOA 3T08A 3K75B 4GB31 2WFF2 2BOIA 4MO3M 5DUVA 4BOWA 5CKQA 4NHYA 1O5LA 2V5YA 4XIOA 3VHPA 5F1RA 2WBKA 1RHI2 2CDOA 3MICA 2W68A 4GH4B 4XQ4A 4AFDA 2GC0A 1IS3A 1DBNA 5DAQA 2WZEA 2YROA 3WG3A 5FAXA 3BALA 3PDQA 1VE0A 4BDVB 1AXZA 1S0CA 2O8QA 2VMIA 4YFZA 1O8SA 1DZQA 1NT0A 3Q8AA 1V6OA 1US3A 3APBA 1CAVA 2P3KA 4BQ2A 3USSA 4KU8A 4BIFA 2WKKA 5JOXA 4UXAA 5ANQA 1AR72 5C8WA 2AENA 3WDTA 5FZMA 4PCRA 1EV13 1O4ZA 4CDWA 5FWEA 3IDEA 4NVPA 1XE0A 2JDZA 2CWMA 1ZBE3 4PIYA 5FPXA 1ZRDA 1IGOA 1IPJA 3ALQA 1SFNA 2N7GA 5E1RA 1AR82 2PLV3 5DDJ3 5IW0A 1QJU3 1QJY1 4Q29A 3RFRA 2VECA 1D0GA 4EROA 1D2SA 4QQPA 4XF1A 1ODMA 2SBAA 2D93A 5FY1A 5FYHA 1MS9A 4I01A 1W0PA 4L2NA 4RFRB 4R9CA 3MIFA 4HETA 1JBCA 1IHMA 2Q8DA 5KXEA 5FLJA 1AR61 5C4WC 4H3WA 4GWJA 4W6YA 1EPZA 3B69A 5DZFA 5A7WA 2HLEA 4C1WA 1CAXA 3KHBA 1G9BA 1H2NA 2ZAAA 5I0DA 1NCRC 1HV0A 4AVAA 5FK7A 1H9WA 1WGPA 2VCMA 4MGQA 5FPUA 2WZ8A 3ME2A 2YPDA 1DGLA 1JW6A 3M3OA 3NRUA 4ES9A 4ISQA 4XW3A 3S57A 3THDA 3SEPA 1SCSA 1G9AA 2FD8A 3DPRB 4C90A 2P5BA 2QDRA 1W39A 2P3JA 1YQ8A 2ZX4A 1B35C 2G19A 2OUHA 4FPJA 4IW3A 2A3YA 2WNUC 2W94A 2C6SA 3BU0A 1AR81 1AR93 4G4FA 4Y1UA 5KC6A 1E5SA 5T5LA 3I97A 3AKRA 3BB6A 2GDFA 4FFFA 4XBNA 3RYRA 4MHUA 3VD4A 4Q4Y3 4LO8A 4YW5A 2H0VA 4AQ6A 4Z2AA 2Y60A 3V0AB 1JHJA 4YPJA 5LBBA 5FZDA 4ITCA 4MSVA 1N3OA 4GIQA 3JBG2 5FYYA 1K42A 1AYN3 4A7YA 3RMYA 2QZ2A 1QKQA 1I9RA 3OF1A 5H9RA 1HLCA 2DF7A 5DMYA 2JE9A 5JPNB 1OT5A 1OD5A 3MPBA 4PJYA 4OHZA 3ZFFB 4YZ1A 2KA3A 3A21A 3BIEA 3NV2A 3POEA 4RR3B 4COZA 4DEQA 4LBKA 4Y22A 3DCQA 1MEC2 3GXUA 4OVEA 1BK1A 2VUAA 3WW1A 3RZLA 1YI7A 3VDDC 3ACLA 1QJX1 3KV5A 2VBDA 1A3KA 3VBFB 4I3GA 4Q4W2 1MZEA 3BCWA 3KCXA 2GNBA 2O0OA 4DXTA 4HMZA 3FX3A 4A2UA 3QOPA 1PGSA 2DCZA 3WVJA 4LHLA 4LXLA 1AL22 1LNSA 1W6NB 4UBGA 4LBJA 5F6KA 5FMCA 4NIIA 3OUJA 1OVSA 1KITA 2J22A 3SHRA 1XYOA 1UD1A 4JGZA 3X29B 1W8WA 1WCKA 4LKSA 2Y6KA 4QQ2A 1BBT2 2ZHMA 1POV0 5LBFA 3WF4A 1MS1A 1NA1B 2AEYA 4QU2A 1IPSA 4GAZA 3VBUC 1RB8G 2A75A 1QGLA 2ZTNA 4IERA 5L7OC 1ULEA 2V4VA 3AYDA 1RUI2 3I49A 2A3WA 4Y24A 1SMVA 5GKAC 4WBBA 5FJHA 1UNBA 1BKZA 4RGAA 3ZSMA 5I8SA 5FZBA 3A4UA 3AP7A 1SLTA 1MEC1 3OPZA 4FTBA 1IG3A 1CESA 2BUKA 5DN2A 3WNLA 1JZ6A 4XUNA 1AX0A 4X8PA 4Q4W1 3LA3A 1PIV3 4IV1A 4QPYA 2A5ZA 2ZBJA 4XFFA 5D8AB 4D8MA 4TLGA 2R49A 3B9CA 1QDOA 4R4XA 2A73B 1V0AA 1CAWA 1W0NA 3LEGA 3ZN5A 1JZ7A 1W3VA 5LK5A 4WVVA 2HWF1 1O59A 3N7JA 3BPZA 1U0AA 4ASLA 4DOUA 1DGRN 1H0BA 3K48A 4LLFA 3FN9A 1MR5A 4XDPA 4AI1A 1GP4A 3E97A 1PZ7A 5A6QA 1CPNA 3GCWA 4L97A 5FOBB 4CP1A 2BQPA 4M3CA 5FBZA 3VBOA 3UYJA 2H6CA 1Q5OA 3OEAA 1LAJA 3AZXA 4NRMA 4XXAA 5FZOB 4UOJA 1OF4A 3CDZB 1WCDJ 5KXBA 3ZSEA 4YLZA 1PK6C 1JYIA 1EV12 3VBSB 1GWKA 3D8CA 4B4QA 5C71A 2VCCA 3SH5A 1ZBE2 4TZDA 3FZ3A 1HN1A 3GGLA 2GSYA 2VCAA 2HKXA 2PLV2 5DDJ2 2HH9A 1DQ0A 1QJU2 3GM8A 5FZGA 4CCOA 5JXIA 2RS33 1C8M2 3WP5A 5CFCC 2C9KA 1JZ4A 1O3RA 3S7IA 1YLLA 3GNEA 1GFF2 2VZ1A 2WDBA 2X05A 1L7RA 2VZUA 4IQPA 1GLHA 2EALA 3DF0A 3LGRA 2ZMLA 1W04A 1ZBA1 2WNEA 4PF1A 1TEIA 4HSLA 1RUE3 2Y33A 2K46A 4NMIA 2QQKA 5CA6A 1NCQC 1MZ6A 1OHFA 4WM8C 2DU1A 1LU2A 3ZR6A 1LHUA 2Y0OA 2YPJA 2FMDA 5IVBA 1VB2A 4YG3A 4OUMA 3HOBA 4QHBA 2VVEA 1JYWA 3LIHA 4PQQA 5FUNA 4MGIE 4CSWA 1K5MA 4RSUA 2W3JA 4DUWA 3EQEA 4CDQC 2LTNA 5IK5A 4Z92B 1JS9A 1Q8VA 4COYA 2XQXA 2W91A 4QX0A 2WYFA 1EV11 2RDRA 3H1WA 5FXWA 2OA2A 5DG1A 1DGWA 3V65A 2K0GA 1ZBE1 3KHCA 2QFEA 3BIWE 3SLIA 2PQSA 1AR92 1UF2C 1QJU1 1S0EA 4CDWB 1LOEA 2VQAA 2BDRA 3SCFA 1PMIA 2XOMA 2W9XA 3VB9A 1C8M1 3P6BA 3ZXDA 5L19A 4H7MA 3O7OA 3I3DA 1UL9A 3FLRA 2ZCWA 3W59A 3OCPA 5DABA 4EN0A 1HW5A 4Q4Y2 5KXDA 1GZWB 4QX1A 3EB7A 4AVSA 3I3MA 4TTGA 5JUVA 1W6QA 1G6NA 2W2IA 4COUA 1JZ2A 2QQIA 4GXLA 4PBPA 4ZKTB 5JZGA 4A41A 2W87A 1HQWA 1Y4WA 3HPNA 2PELA 2LRPA 4OI1A 1LESA 3RWKX 1CAXB 3U11A 3HVDA 3PJYA 1FMD3 3GJBA 2JICA 3WV6A 2JG9C 5JXJA 3CNAA 4IE4A 4CVUA 3GHMA 4DIQA 3DKQA 4GMP1 5A3UA 3Q8BA 4FPCA 4CCJA 3HT1A 4XF0A 2VCBA 4K9SA 4CDXC 1IS4A 1S0FA 2DVFA 4Q0QA 3AKPA 2YG0A 1CGPA 1PVXA 3BTYA 3AMNA 2A6XA 2VGDA 3P5BA 2JJ6A 1YEWA 2ZA9A 3RYPA 4JGYA 1NE6A 2UYBA 1ZZ7A 4AAXA 2DTYA 2I07B 2XJTA 4P9YA 4Q4Y1 3WW4A 1MQTC 1JN2P 2E6VA 4EJRA 2EXKA 3RZMA 4HVRA 1PM4A 1RUF3 4G3YC 2EIBA 2ARXA 1PZ9A 2EXJA 2IXLA 3G6JB 3UKVA 4S2HA 1OOPA 3USUB 4AHYA 5F32A 4XJ9A 1OQEA 5FQ0A 2QQPA 2YYOA 4XZPA 5KC5A 1ND2B 1N1YA 1VBC3 2R071 5F2WA 4NRQA 4NPLA 1RUD1 4XXPA 4CEWC 1OFNA 1CX4A 2GNMA 3J7MA 4QAWA 5IAXA 5M0TA 1PM7A 4XJUA 3QH7A 4GWMA 4Y33A 4FPOB 3VZNA 4CYDA 1SPPA 5IVVA 4FOYA 1V6IA 2YBPA 4Y22B 3ELNA 2RDSA 4DB5A 5HPOA 2XHNA 1PIV2 2GU9A 3B7MA 2C4XA 3JQXA 4GULA 4COWA 3I59B 2OQ6A 3KF3A 4DNYA 2Q4SA 5GALA 4NAMA 1QMJA 3UK9A 3E6BA 5AFBA 1LGCA 3O1SA 1ASJ1 3ACIA 3VBFC 3ZN6A 1J3PA 1F2NA 1NUKA 2NZ9A 5LRSA 3KQRA 1KFXL 2JG8A 4OZXA 4CCDA 1UOFA 3PVOA 3KVAA 4LQRA 5BYNA 2VXRA 4Q0PA 3I2DA 4XFBA 3ZN4A 2JDKA 5JIUA 2WT0A 3RZKA 4LHSA 2QDNA 4HVOA 4WV8A 3WHUA 2ZX0A 3T0AA 1W6PB 2ZABA 1Z7S3 4NHLA 1QOTA 3EXUA 5EJZB 2D6MA 3RWNA 4EN8B 2BERA 2FDJA 3DYMA 1UOJA 3ZM8A 2WS93 3ZDVA 3CL1A 1ZVFA 1B09A 4FTSA 1C1FA 1YO8A 1PIV1 4P9GA 4HLTA 1LOFC 3C2UA 4GJYA 2PQQA 4FQZA 3DPRC 2RS32 4ZXKA 3PU8A 3VBRA 2FBEA 3ASIA 1CONA 2BVVA 1R1A3 5BV6A 5C4WB 1RIRA 3FL7A 4FBFA 3ZXJA 4M00A 5FZ8A 2Q1FA 3VD7A 2EIGA 5FP9A 3WQ0A 1TNFA 1RUE2 1ZZ6A 1VJ2A 2DUOA 5A6YA 2GMEA 2Z42A 1HRV1 2Y6JA 2XKOA 3A22A 4WVWA 1TE1B 2XVLA 3WF3A 1OD3A 2RMU3 4QGMA 2JIJA 3H3LA 4MVTA 3C3VA 2HEWF 3GZTB 3I4IA 4NHKA 1PO12 1W2OA 2WNUB 1HB2A 4XE9A 4AXOA 4BMBA 5TSWA 3BTXA 1QJEA 3ZPYA 1K5JA 2R063 2P6CA 4M3CB 4M4RA 3LEKA 2PHTA 5ANNA 3SNMA 4NR1A 3OBZA 2B4KA 1PO23 2WWSA 2BVBA 2VNRA 2QUOA 4AEDC 2YFZA 3R4DB 4LE3A 4Q0VA 2GC1A 1NQDA 5LA0A 4N53A 2TNFA 4JC1A 4YZ2A 3IBMA 3W58A 1APNA 4FPHA 4RGKA 4CCCA 1N3PA 4OMDA 2RS11 4GB33 5LY2A 3U37A 1WWYA 1H2MA 1H8VA 3SCGA 2Z2SB 2XJVA 3J7LA 3MW4A 2VW1A 4XUPA 1NLQA 4BQ3A 4AHWA 4XAEA 4FCAA 2WYSA 4NIHA 3VLBB 4MGTA 1R64A 1UZVA 2DWRA 4Y5SA 4K8FA 3JUUA 3O5SA 4IGQA 4CCLA 1R093 2ARCA 2MNGA 3JD72 4BWOA 1CAUA 4CDUC 5LEJA 4EV0A 4Q2FA 1PO11 1X82A 4KWLA 3RSJA 3LDBA 3MLLA 1FMD2 4P14A 2XLFA 1GOGA 4L99A 5JSOA 4NIGA 1NA1C 3AZWA 1W3XA 4A4AA 5HXMA 3AZYA 2ZGUA 1H6XA 1OLME 3HNMA 3PUAA 4KBBA 1BVVA 2IC1A 5F7UA 4P08A 5FXZA 1WMXA 1JUIA 5FBJA 1QJY3 2D5FA 1F9KA 2QVSB 1GZ9A 1U5ZA 2R30A 4IUGA 1IPKA 1CR7A 3HBZA 1QWRA 1Q8PA 4ARYA 5L9BA 3GBFA 3PUSA 3O1RA 4JCKA 1DGRA 1ULOA 5LB6A 4CCKA 1RUF2 1W2TA 1QQP3 4NIAA 2VUCA 3GBGA 3VBUB 2JX9A 4Q4X1 2R32A 1H8TC 3B9IA 3M3CA 1JYXA 1AR63 3ATGA 3I2IA 3WR0A 4ZU7A 1P8JA 4HPKB 1LHOA 3IAQA 1W6QB 5DAVA 4KQ7A 3WZ1A 1GP5A 3JD71 1VBC2 5C3RA 3NJVA 1CN1A 1ZZ9A 3KT4A 1J84A 3WG1A 5JZGB 2EA7A 4O7XA 4P9IA 3ZOIA 4OQ9A 2MEV1 2WR9A 2AYHA 4KBZA 4W6XA 5C6CA 4YVWA 3M3IA 2ZGLA 2PHLA 3LIGA 4Q8LA
chains in the Genus database with same CATH topology
1LEMA 1ENXA 5T5JA 4KG8A 3SCHA 3WG4A 2RJLA 4F8AA 4GKYA 2B42B 4QGNA 4AW7A 2ZACA 1UX6A 2VQ0A 1BJQA 4AFBA 4QPGA 1VBD1 1WW6A 4PLOA 3LB9A 2B45X 1RL3A 3NV1A 3CJXA 1DZTA 4WZCA 1SLCA 4JGYB 4YFWA 2NYYA 4FPFA 4IEYA 3WDYA 3IMNA 3ILNA 3VGIA 4XBQA 3WCSA 1VBC1 1IS6A 3HD8B 2HEYF 1VAKA 4HN1A 5FQ0B 3JB8A 2CAVA 1IQAA 5A33A 1YCIA 4IV3A 4C91A 1FAYA 3URFA 2GALA 1M06G 1J3RA 4KNCA 1LHNA 5AVAA 1JTZX 2WS92 1J1LA 4BLIA 3MEPA 5FCCA 5CB7A 4URTA 1QJX3 3J9SA 1RTVA 3WP6A 4XF4A 1KJLA 3WLUA 5JWPA 2MHFA 5BY5A 1XNCA 1R1A2 4Y20A 2PHWA 4WM8B 1LGNA 1V9U1 4CDWC 3MI8A 4J1XA 4XOGA 1N1SA 2DVGA 2HEVF 1V6JA 5KHIA 3AXDA 3ZN6B 3EBRA 4QGLA 4CDQB 4IL7A 1QXRA 2RMU2 4W65A 4LO7A 1C8NA 2RR13 1WMDA 3WD5A 1XYPA 2D3RA 2YUEA 3ZYJB 2NMOA 1LR5A 3TWIA 5HBAA 3ZIXA 1V70A 2R062 4I3PA 5DXDA 3PLQA 1MEC3 3KSCA 3PHMA 5T54A 1PO22 2ES3A 3IDBB 5JOWA 4Q4W3 2YGMA 1R1A1 2DTWA 5BXXA 3AM2A 2JKBA 1XE7A 2W52A 3WDVA 3NL1A 4Z07A 4EN6B 4RGGA 3VZMA 2PHDA 2HWF3 4HN0A 1A8DA 1RMU1 2XJQA 4QXKA 2ET1A 1REDA 2IFWA 4R9AA 5E89A 1F5JA 1R092 5EXOA 3OGJA 3AYAA 1YUDA 5CVRA 3VKLA 1COV1 5HI0A 1VB4A 1KDMA 3ZXGA 2WFPA 4CTEA 2FZ1A 1PNFA 5BNOA 1ZRFA 1Y9QA 2WT2A 5J37A 4R9DA 3D0SA 5FFOC 5K7PA 3V0BA 1RUJ3 4KWKA 1MQTB 2BTVC 1UU6A 2BYVE 4XFGA 1RJ8A 1VBE1 1RUG3 2VY0A 1LOGA 2R041 4N53B 3I54A 4Z1VA 4J6GA 5BPXA 4TLFA 4AQTA 1QQP2 1VAMA 2KM2A 1HRI1 3MIEA 3NAPA 5JPMB 3RNSA 1ZBA3 2YV8A 2OYZA 4Y5Z0 2B7YA 4GALA 5LK7B 1AR62 5H9PA 4PBOA 4XFHA 3OYWB 4CEWB 1R091 3L2HA 3ZSKA 3UKNA 2YXSA 4AVVA 3AZVA 4IEXA 3FLTA 4JRLA 1ZRRA 4RFT0 2D43A 1YJLA 1S1AA 3O0VA 3U10A 4JGZC 3FMGA 1WLTA 2ZX1A 4E2QA 5JDBA 2F4PA 2G9FA 3D4KA 1W6MB 1X7NA 4I0BA 2WZR3 1S0IA 4BE3A 5EYXA 3FLPA 5BNPA 4DFSA 1C8M3 1UKGA 1Q8OA 3B93A 4AVTA 3B3QE 1VAVA 4QM9A 3NV3A 1GICA 1QQP1 2YZ4A 3IT8A 3AKQA 2AR6A 3I7DA 3O12A 4KL1A 1DGWX 4YG6A 5T55A 2VU9A 4IV1C 5SV5A 4K3UA 4FOQA 1GYKA 2DCKA 5J98B 5KHJA 1FYUA 1Q8SA 1DDLA 3AMQA 3RG0A 1LULA 3RZZA 1J58A 3FUOA 1QNWA 4M3CE 1JH5A 3VKFC 4F3JA 3MFAA 4YGDA 4GMP3 1XE8A 4YVWB 3TRSB 1FX5A 1V6NA 3PNAA 4AI3A 1QJX2 2D97A 2WJSA 4LHNA 4Q4V3 4AQSA 5I0SA 4LBLA 3VKMA 4AHZA 3T1MA 3MLJA 3VBOC 3WNXA 3ST7A 5KHGA 1OKQA 3WOGA 4MXWA 4OI4A 4AF9A 3VN4A 4Y1VA 1XNDA 3H9AA 3LA7A 4O9GA 4I02A 1QXPA 3KD4A 4R4ZA 4R52A 1DZRA 3EHKA 1W6OA 2BNMA 2GMPA 2DV9A 3H7JA 5FOJB 2UYAA 4HK9A 2RR12 3UJOA 2A6YA 5DZGA 5A3LA 5GZCA 2R073 2BWCA 2DYCA 2HYKA 2WT1A 3GF6A 4RS5C 1RUD3 1WA4A 3RS6A 4AEDB 3TN91 2HWD3 1SQ4A 4QQLA 2NMNA 4XHBA 4YZ5A 5A33B 4MGZE 3WX5A 1X36A 2ZKLA 1BXHA 4XJZA 3ZFEA 2NQYA 2P34A 2B5HA 1MS4A 1WBLA 1K5MC 4P9LA 4AVCA 3ENRA 3RJRA 3WCRA 1YHFA 2OW4A 1QDCA 2A3XA 2VOVA 3EJKA 1ASJ3 2G4IA 4JTOA 1TME3 2PHXA 2CTVA 2HWF2 2VUJA 4Y20B 3ZXAC 4CDUB 2WLQA 2WSUA 2RR11 3KMHA 3TYJA 3S6PA 3WDWA 3H8UA 4BIOA 2CL2A 4OHXA 3AKTA 5CBLA 5JMCA 1NYWA 1FI2A 4AEKA 1NY72 4CP0A 4ATEA 4P9WA 2NM1A 2X8KA 1BMV1 1QNYA 1ZRCA 5JZGC 1LKNA 3K51A 3ZSJA 1OSGA 1SBFA 1YRZA 3OJBA 5H9SA 1RUJ2 1S0GA 3B00A 1O4YA 1OA2A 5F6LB 3AP5A 1LOCA 3PMEA 3AP4A 1VIWB 4YW2A 3AXEA 1H8TB 1RUG2 3UV9A 3TBDA 2XVKA 3NJZA 5GZGA 3ZDSA 4AK3A 4Q26A 3IPVB 2GN3A 4Y1XA 5J48A 1ZBA2 2XBO3 3AMMA 3IDCB 3ZXFA 2XL9A 2WNVA 1HRV3 3ES1A 3VBHA 1Q43A 4MYEA 4XTPA 5FPZA 1D4M1 3NSTA 4Z2WA 4JGYC 3FUQA 1HQLA 2D98A 2TUNA 4P5HA 4XFCA 1TMF1 2C1FA 1NY71 1A8MA 3H50A 3VHRA 4XFAA 2X53S 3OY8A 2PYTA 4YW3A 1OOPC 4WVMA 3TNQA 4DQAA 3VL8A 5FTTC 2C5DA 3KCCA 3AX4A 4GQ7A 1ULGA 4R8HA 1RUJ1 1BYHA 2VOXA 4AGVA 1ONAA 2WZR2 1BZWA 1YXWA 4YRDA 2X5IA 4Q1PA 1RUH3 4RQPA 1HXS3 1FV3A 1YFXA 2XLAA 1BVP1 4PDWA 3HIFA 4YSFA 1T6GC 2BNNA 3AP6A 1RUG1 3E5QA 1QH7A 2RS13 3NO8A 2CWSA 1H4HA 2DURA 1AX2A 3KCYA 3LAGA 3WDXA 1Q3EA 2XWJB 1DQ4A 5C33A 3JB4C 3U0ZA 3NAPB 1MS3A 2KXLA 4QD2A 4OHVA 1DIWA 5GLUA 1KD7A 3MPPG 2ENRA 4Y26A 1PO13 3RJ2X 5CG9A 1CAVB 1BEV3 2E63A 4WM7A 4B3NA 2JG8C 3MIHA 1YYNA 2VW2A 2Q8OA 4AE2A 1QOSA 4O9EA 2JEMA 2WZR1 3AFKA 4Q4V2 4FAHA 2Y38A 4KGGA 5JVVA 3I8TA 2VVDA 4OLLA 3WT3A 2ZGMA 3BU7A 3VZKA 3RRDA 3ZIWA 3M4FA 5BNPB 3WQ1A 3KLSA 4GKXA 4Y4YA 4K7JA 4NHMA 1S0JA 1HDKA 4Q4X3 1ZM1A 2P3IA 1AUYA 1Y43B 3VBRC 2IZWA 4J1WA 5CFDA 4CEYA 4D7SA 3N3HA 3CF6E 3JD73 1BCXA 1GNHA 2R072 1WD4A 4MXVA 1VRH1 5AC91 1RUD2 3PVNA 2MEV3 4IESA 2HWD2 2DFBA 1IKPA 3D5OA 1XNKA 2IXIA 2VOKA 1C1LA 4PIZA 1LB2A 1HX6A 4Q4V1 1ENRA 4LR4A 1O4TA 1IZ3A 5CNAA 1EAH3 1XU1A 4HK8A 3GALA 1DHKB 2ZZQA 4JV4A 1ND3A 5BNNA 4W6WA 3JCIA 1ASJ2 1VBD3 4AI2A 1TME2 4OI0A 3WP3A 5C9AA 4Q0UA 1ZZBA 3M70A 4KGQA 5JAXA 5GLTA 4N53C 4FXKB 2D6NA 4XYXA 1LJ7A 2NLRA 1W6OB 2CGOA 2ZJCA 1HQNA 4JDMA 1L3JA 4D69A 2HWD1 4F83A 4ORFA 1ZA4A 1KJRA 2R0HA 4LA2A 1UZYA 4XBLA 3PVEA 3J4UH 3PTYA 1J59A 3KZ4C 1LENA 3FC0A 4FXGB 4QPIA 3POSA 5C8CA 3NKTA 1ZX5A 2ZX3A 5FLIA 3MGUA 2DVDA 1ZZCA 1TME1 1V9U3 2E7TA 1KFUL 3WHTA 2EF6A 2XBO2 2W08A 1U5YA 4E2GA 4Z8BA 1HRV2 1NOVA 2GAUA 2ZGTA 1NE4A 1LHVA 1UIKA 2YMZA 1POV1 4ATFA 5KHHA 2A70A 4JGZB 4QQOA 1X8EA 5K0UA 2ZMKA 1VP6A 4H14A 3TOJA 2CAUA 4JRAA 2PN5A 5FREA 4E4SA 4WVZA 1Z78A 1RVF3 3FFZA 5CAZA 1R081 2Q0AA 3ZFGA 4YM0A 1E57A 2DVAA 4BPZA 1DLLA 4JTNA 3O0XA 1RUH2 3M8LA 2XKPA 1HXS2 2BGCA 4MGYE 2UY9A 4YVWC 1N1TA 4IV1B 2RS12 2JECA 3JZVA 3CJIA 1GBGA 4AQ2A 5JI9A 2XBO1 4NPRA 3E6CC 5FMOS 4I0WB 4IETA 3VZJA 1SLAA 4XPVA 1CAWB 1WCSA 5JOZA 4AG4A 3H0OA 1RMU3 4QPGC 3CO2A 3PMSA 2JENA 1X8MA 1VBB3 2WNVB 3FBMA 3VBHB 3VUOA 1UN1A 1COV3 2XLGA 4RHV1 3ZO0B 1G8WA 4AFMA 1O3QA 1BEV2 4R9BA 3B02A 3IWZA 2Q1MA 2E7QA 1XRUA 3LSEA 3VBOB 4MLOA 3OY8B 3ZX7A 3KGLA 4WVMB 4AWDA 1RUH1 2UWCA 2AZ5A 1HXS1 1OLRA 1V6LA 3VKNA 4OULA 1QU0A 4IV3C 1OFSA 1VBE3 4RQPB 3AJZA 1YWKA 2R043 2ZPXA 4PDWB 4K1YA 3S7EA 1FNYA 1QOOA 2EXIA 3N35A 3UKTA 4AHXA 1HRI3 1Y7BA 2B9UA 5IK7A 4Q4X2 3MFCA 4RS5B 1NQJA 4XQDA 3MIDA 4ZU4A 1UCXA 2ETEA 1WLDA 4FSJA 3L2YA 2ZGPA 5I0TA 1AYM1 4LNVA 1DF0A 4UBHA 2XJSA 1G9DA 3AYCA 2YHJA 1GNZA 1SDWA 1S0BA 2ZZJA 4B7EA 1BEV1 2VVFA 1LTEA 2MEV2 4GH4A 5FRAA 1K5MB 1WLWA 1UKRA 1RUC1 3IKWA 3FBYA 2XB6C 3MW2A 4HKOA 4EWEA 4YARA 3IM0A 2H6BA 1V6KA 3AMPA 1EAH2 5T50A 5I8YA 3H3ZA 1C4RA 2EAKA 4GWNA 3GZUC 1FATA 1VBD2 1PVC3 4EWAA 4BZ4A 5AFEA 5LRRA 2H0BA 3H1YA 4P9XA 2NN8A 2ZMNA 3WQ7A 3JQWA 5IK4A 2JXAA 1LGBA 2VW0A 2ZAHA 5B2GB 2D44A 2UWAA 1A6CA 5CFDB 4BH9A 3B94A 3CU7A 2ET7A 2PAEA 2ZGOA 4OI2A 2ZGRA 4NN0A 1EAH1 3HN1A 5EFUA 4NO4A 1UAIA 4YGEA 2IFRA 1OQDA 3LZZA 3LOIA 5F9TA 4DS0A 4JDNA 5BNOC 4JQRA 2OZ6A 3U07A 1RJ7A 3J8F1 1V9U2 3ZYIB 1ND3B 5BNNB 2AUYA 1H1IA 4DRVA 1O7FA 4LBNA 1O3SA 5HCAA 3U4XA 1OOPB 2RM23 5GJ6A 1UMZA 3SH3A 2GH2A 3HAGA 3NAPC 4HVQA 1SLIA 3LSDA 2OZJA 2BFUS 4HKLA 1RVF2 3HT2A 3TN93 5JSRA 5ABJA 3SMHA 1C57A 2XJUA 4UW4A 4S2DA 2DCYA 1YIFA 3ZFFA 5KBFA 4K40A 4L92A 1DU3D 2UY8A 2IWGB 1M4WA 4FO9A 4RR3A 4QPIB 3WUDA 3ZYRA 4FP3A 4YGCA 1QF3A 4OHWA 4HBNA 3HQXA 1JXNA 1VR3A 4KWJA 4Q8KA 1RMU2 5BNPC 4LE4A 1GQHA 4TWTA 1VBB2 4IEOA 4LUKA 4M3CF 2JG8B 2VPVA 4K20A 2XG3A 4DY3A 1COV2 1DFQA 1ZNPA 1W6NA 4ES8A 5K0UB 5DUXA 5J3UA 2RE9A 1RVF1 4N43A 5CIRA 2HWB1 4WZFA 2F6BA 2O8OA 3MF6A 3PVBB 4IEZA 4SLIA 1G7YA 3AZZA 3HR9A 2E51A 2PAKA 3ZYGA 3N4MA 1VBE2 2D6PA 3M3EA 2ZGSA 4IEPA 2R042 4INDA 3VBRB 1FOD1 1KQRA 2PFWA 1HRI2 3QBQA 1KS4A 4IEVA 3CJIB 4Q0SA 4RL7A 2DCJA 3QCWA 1PGW1 3AYEA 1VBB1 2D6KA 5D8AA 1D4M3 2ZGNA 3ZMOA 1I6XA 2YDEA 2W39A 2VNOA 2E7AA 5F5QA 3ILFA 4YVSA 1TMF3 4LLOA 1LODA 2XGXA 4S2GA 1KDKA 1DQ2A 1TQ5A 4LA3A 1R1ZA 1YFYA 1S55A 4XJWA 4MUVA 4XJAA 4PQ9A 3GYDA 1Q56A 4BHPA 2VULA 5A32A 2LUWA 1KRIA 1PVC2 4D94A 3MLKA 1H9PA 4FP2A 2WZPP 2A6ZA 3VBSA 1GZCA 3WUCA 3ZFEC 3FE5A 3GZAA 2XUMA 2VH9A 3ECQA 1CD3G 4H55A 1U12A 3R0RA 3GBWA 1IS5A 3QH6A 1XYNA 4XF9A 1LCLA 5I8TA 3MW3A 4Y1ZA 1HV1A 4OHYA 2CNAA 3THTA 4K1ZA 2WSVA 4M0HA 4XETA 1CAUB 1GR3A 4FPGA 3WXPA 2QE3A 3KGZA 5K9YA 1SBEA 4PIXA 4UW3A 3ZVXA 2FMYA 3RDIA 4AEJA 4PLMA 4QX5A 1CQ9A 4M0NA 1PVC1 4Z82A 2ERFA 4LULA 3M7AA 1EP0A 2WQ4A 5BUVA 1I1EA 2EAAA 2OUJA 3UL2A 4XHXA 1LEDA 4MZUA 5FLHA 1MVQA 3FFQA 3INAA 1YFUA