5T3NA

Sp-2cl-camps bound to pkar cbd2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
HHEVLFQGPGAKKRKMYEDILSHVNILKDMDPYERCKVADCLKSKSYNDGEIIIKEGEEGDTFFILIDGNAVASKDNKVIKTYTKGDYFGELALLKNKPRAATIKAQNFCQVVYLDRKSFKRLLGPIEDILHRNVENYKKVLNELGLDTTCID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cAMP-dependent protein kinase regulatory subunit
publication title Disrupting the Allosteric Interaction between the Plasmodium falciparum cAMP-dependent Kinase and Its Regulatory Subunit.
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
molecule tags Transferase
total genus 41
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2016-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t3nA00
4IEYA 2XGXA 1ZRRA 2FMYA 4MZUA 1VP6A 5KHHA 2GH2A 5JAXA 3FWEA 3KSCA 1CX4A 3MPBA 5CU1A 4N9IA 3E6DA 1LRHA 1NE4A 1QXJA 2V09A 2ZCWA 5BY5A 5FLJA 1RGSA 3S7EA 1Y9QA 2IXIA 3HT2A 1H1IA 3M3IA 1YFYA 1ZX5A 2PAEA 2B8MA 2CAUA 5E1RA 1O5LA 2IXJA 1QWRA 3FZ3A 3ELNA 1O5UA 3VHRA 4XFAA 1X7NA 3QACA 1O4TA 1EYBA 1LKNA 2IXKA 3S7IA 2E9QA 3HIFA 4LUKA 1X8EA 4Q0VA 1J1LA 3BALA 4Q0QA 4HN1A 5HI0A 3MDPA 4LA2A 1Q3EA 4HVRA 4J1XA 2GAUA 4XEZA 2PAKA 5BV6A 2CV6A 2Q4SA 1RL3A 3FFQA 1RC6A 3EO6A 1HW5A 1O3TA 1YFXA 4ONUA 4BIFA 4IERA 1TQ5A 4FAGA 3UKVA 4AQ2A 5JSPA 3NSTA 2B5HA 2I45A 4IEUA 4Q0SA 3B02A 1PMIA 2UY8A 3M70A 2D93A 2GZWA 3OF1A 3D0SA 2HJIA 4HSLA 5FLHA 3H1YA 3DKWA 4JTNA 4I0BA 4YYOA 3DN7A 1NE6A 2IC1A 1ZZ7A 3DL3A 1I6XA 3ACLA 1J3PA 4EROA 3H50A 4CYDA 3BCWA 3CEWA 5I93A 2WC2A 3ROUA 4RD7A 4OFGA 4PIZA 4QM8A 4L2NA 2GC3A 3LA2A 1OMIA 1ZZBA 4Z07A 2K9ZA 4F7ZA 3OTFA 5C6CA 1J3RA 4I01A 1ZNPA 1CAWA 4K8FA 5FDBA 3NKTA 4JTOA 5LEJA 3H7YA 3RYKA 2HKXA 2QJVA 3GYDA 5FQ0A 3E6CC 4E2SA 1SQ4A 4QGNA 1UD1A 2WFPA 4XF4A 4YSFA 1EP0A 3KCCA 1IPJA 4O9GA 2GC1A 1QXRA 5KHKA 1XRUA 2UYAA 1CAUA 1Q5OA 2ATFA 2IXCA 2XLFA 4I0AA 4ZU5A 1O3QA 2QDRA 4QXKA 1QY4A 1VJ2A 4PJYA 4JV4A 4XETA 3CJXA 4AVCA 4ORFA 1DGWA 4KU7A 1IPKA 3FX3A 2Z69A 2QNKA 4I2OA 1O7FA 1ZRDA 2OA2A 3PNAA 2QVSB 4Q0PA 4HVQA 2BEOA 5I91A 3HQXA 4I09A 4IEXA 3D82A 3NVCA 4AXOA 1WA4A 3IBMA 2N7GA 3OCPA 4XF0A 3WW4A 3WW3A 4HZFA 3RNSA 1OD5A 3USSA 4E2QA 4QGMA 5I0UA 2ETEA 2CGPA 4MGKE 4BYYA 2PTMA 3DV8A 5I8YA 4MUVA 4LULA 1CAVA 1YLLA 4QGLA 4XF1A 1RTVA 3WW2A 5BUVA 4P9GA 1SFNA 2Q1ZB 3LWCA 2XKOA 3N4MA 3EQEA 1J59A 3S0MA 4IEZA 1LB2A 3QOPA 3SCFA 4FBFA 2PFWA 4OLLA 2H6CA 1YFWA 4KWKA 1WGPA 4QMAA 5LRSA 3LA7A 4LTAA 4META 4D7TA 5BXXA 2PQQA 3CO2A 4AQ6A 3E5UA 4XFFA 1FI2A 4YNIA 4BHPA 5FCCA 2BYVE 2Z2SB 2BNMA 2KXLA 3BU7A 1CAWB 1ZRCA 2XHKA 1OI6A 3KGLA 3GBFA 5FQ0B 5K8SA 1CGPA 1NXMA 5CVRA 3H3ZA 4HLTA 5FPZA 3NJZA 3H1MA 1ZRFA 2O1QA 3ES4A 3RZZA 2UYBA 3SXWA 3CLPA 4R8HA 2PAMA 4MGIE 1RUNA 1CAUB 3WW1A 3H1WA 1CAXA 3U0ZA 2IXLA 3D0JA 3IDCB 4WVZA 2BNOA 4IEOA 2CAVA 1UW8A 4MGZE 2XLGA 4HSJA 5D1IA 3I54A 5BPXA 3U10A 1GQHA 1WLTA 5AVPA 5F1RA 4IEPA 3RPQA 4QX5A 2B9UA 4TLFA 5EZWA 1RUOA 2MHFA 3BPZA 4MX3A 3E5QA 1ZZ6A 4H7LA 4IEVA 1JUHA 2Q0AA 3ST7A 3TNQA 4KL1A 1PM7A 5I0TA 3H8UA 3CL1A 3SCGA 3JZVA 1CAVB 4I3PA 4ZU7A 3OD0A 4NVPA 2DCTA 2PYTA 3SCHA 2H6BA 1NYWA 4LA3A 2D5FA 3I59A 3LA3A 4JVAA 3KMHA 4IETA 4MV2A 5I8SA 4MGYE 2FQPA 1J58A 4LLOA 5I8TA 2BGCA 2GU9A 3MYXA 3BB6A 4IEQA 1SEFA 2D40A 4UXAA 4ZU4A 2EA7A 2ET1A 2BNNA 1Y3TA 4MH0E 1ZREA 4B29A 3NL1A 3EBRA 1EPZA 4EWEA 5JSRA 3UKTA 4FAHA 1G6NA 1DZTA 2GC2A 3EHKA 4IESA 2VQAA 1XE7A 4BH9A 1YUDA 1J3QA 2ZKLA 3PVBB 4YRDA 1O3RA 4R52A 3U11A 4FT8A 4XF9A 1UPIA 4XFCA 5JR7B 2MNGA 4HN0A 4XF3A 2XLAA 4YARA 1CAXB 2EVXA 3OGJA 4Q29A 3ETQA 1LR5A 1L3JA 2O8QA 1X8MA 4QM9A 3ES1A 3G7DA 3RYRA 3C3VA 3IDBB 3IIAA 2P17A 4N9HA 2Y0OA 4I02A 1Q43A 4L11A 1UIKA 5JSOA 3HT1A 4AVAA 4GULA 1H1MA 3PLQA 2C0ZA 2PA7A 4KWJA 2UY9A 5LEKA 1YWKA 4EWDA 1ZZ8A 3SMHA 3E97A 3EJKA 5FPXA 1FT9A 4WBBA 2OZJA 2Q30A 1XE8A 5C8WA 2F4PA 3L2HA 4D7SA 5J3UA 1DGRA 3H7JA 5I0SA 4KU8A 2PHDA 2PHLA 3LZZA 4J1WA 4PIYA 3RDIA 3UKNA 3I59B 4XFHA 3E5XA 5KHJA 1X82A 5EFUA 4IEWA 1UIJA 1V70A 4LEJA 4Z82A 5CADA 3ZDSA 4HBNA 3FHIB 4LUMA 3TNPB 1YHFA 3LAGA 1U12A 2K0GA 5FLIA 2MPFA 4A2UA 3MZHA 3FE5A 2H0VA 3CF6E 3R6SA 4EWAA 5I0RA 4UBGA 5LRRA 2XKPA 1ZZCA 4XFBA 4AVBA 3RYPA 4X6QB 3LOIA 1EY2A 1UCXA 3IWZA 2D5HA 5KHGA 4KWLA 3O14A 4WZCA 4XFIA 4O9EA 5T3NA 5KHIA 1FXZA 5JCTA 3H9AA 1GQGA 5E16A 4E2GA 4EV0A 2EAAA 2XL9A 3SHRA 1NZCA 4HVOA 4F8AA 5J7MA 3I7DA 5J48A 1VR3A 2OZ6A 1O3SA 3KGZA 3NW4A 2ET7A 2VECA 4HMZA 1OFNA 2QCSB 4DINB 2GC0A 2XL7A 4UBHA 2OYZA 1ZVFA 4Q0UA 1YFUA 4X6RB 1ZZ9A 2OPKA 2VPVA 4XFGA 4PIXA 5KBFA 3FJSA 1I5ZA 3H3UA 3E6BA 1DZRA 2IXHA
chains in the Genus database with same CATH superfamily
1WCDJ 1GBGA 2XGXA 3OGVA 2ZTNA 2JE7A 4AI9A 4TSVA 2GNDA 4AEDB 1UY3A 4XXPA 1KGYA 1U5XA 3GXUA 1V6KA 2QQNA 5IK8A 3WQ7A 1UYXA 3DPRC 4XABA 2XVGA 1QJY2 2FMDA 2WO1A 4Y4YA 1BKZA 2ZABA 1QH6A 5T52A 2Y60A 4CDQA 3AMPA 5C5UA 1RUF1 3W9AA 2Y34A 4QX0A 3HBKA 1NE4A 2X05A 1TG7A 3ME2A 4RSUA 2VMCA 4QPIB 3ZXJA 1XSRA 3D6EA 2R063 4K21A 4ARYA 1E5RA 3DYMA 4FFFA 5FLJA 1KEXA 3FHAA 3S7EA 5JZGA 3T0BA 3VUOA 5EIYB 2BP6A 2B8MA 5E1RA 4YVWB 1CPMA 3T4VA 3WUCA 3J7NA 2BOIA 4LHKA 3FN9A 4INDA 4WM7A 1JZ8A 1VBB2 1AX0A 2A1XA 3VD7A 1V6NA 1FNZA 1S0IA 4H14A 1DBNA 4XFAA 3ZR5A 3ZN6A 2VMIA 4CCDA 2DWRA 2QQUA 3ZFEC 1COV1 3AXDA 4AQTA 5C7GA 1ZBA2 1UL9A 2JX9A 1O8SA 5JDBA 2O14A 5DZFA 1EYBA 4RQPA 1LKNA 3LD8A 1RUF3 3PHMA 4ISRA 4NR1A 2BRTA 2E9QA 2YU1A 4AFDA 1H9PA 1AUYA 4LUKA 5E89A 2RS52 3GZUC 4Y20A 4HN1A 1HKDA 2RS11 1WCUA 3MDPA 4ARXA 5AC93 2HWB1 5DAXA 4NPMA 1VMFA 4FPGA 1NQJA 2PAKA 2RHPA 3POSA 1DZQA 4HXCA 3PJYA 3AZVA 2YHJA 3M3EA 2FCUA 3T08A 5BNPA 3TEWA 2GH8A 4RN5A 4BIFA 4IERA 1Q8QA 3RZLA 3UGGA 1H2KA 1YQCA 5L19A 4FAGA 3VKNA 1C8NA 2VBBA 4OUMA 1OLME 2E26A 2I45A 2RM21 4IEUA 4PLMA 3WNPA 4A3XA 1COV3 4K9SA 3B02A 1PMIA 2UY8A 2D93A 4GWNA 1R083 3OUHA 4DO0A 2W91A 4G3YC 3D0SA 2HJIA 1O91A 4HSLA 1PGL1 1V6LA 1VRH1 1ZA7A 3WF3A 4V1PA 5JMCA 1JODA 2OUHA 3H1YA 3I2JA 4NHXA 2BVBA 2RS13 4LBQB 1XB9A 2HWB3 2XMLA 2W39A 2A71A 3DN7A 1GWKA 1LOGA 2FZ2A 1W6NB 1Z0HA 3BKZA 5A80A 1N3OA 1SLCA 2ZHMA 3CKHA 3TWIA 4EROA 5ACA3 1DLLA 4CYDA 4JAAA 1LOEA 3CEWA 5FWEA 4YPJA 3ZYIB 2JG8B 2DU1A 3AYEA 1W6MA 5FY8A 1V9U1 2TNFA 2VZTA 4JDNA 5T54A 4PIZA 4ZY9A 2RM23 3X29B 1AR61 3LEIA 2Y6KA 2XQRA 3C7FA 4K1ZA 4OUSA 3S30A 4UOJA 3VD3A 4AE2A 4CDQB 3VN4A 1XQNA 5BYNA 1SBEA 4UFLA 3SEPA 1UX6A 2JKBA 4Q4Y1 5I0DA 1SHWB 1J3RA 2A6VA 1QF3A 4E27A 2R073 4RA0A 2WT0A 2VNOA 4A44A 2ZGOA 1RYYA 4JTOA 3H7YA 2QQOA 4C0BA 1QDOA 2ZEZA 4M01A 1UOBA 4NIGA 1F4AA 1HDKA 1UOFA 5JZGB 2QJVA 4ET7A 5FQ0A 1OUSA 3P5BA 1VBE2 1W90A 4E2SA 4XUNA 3T3YA 3IKWA 5FZ1A 4BQ5A 4KMQA 4WM7B 2B9VA 1AR81 3KVAA 5FY9A 2YC4A 1AR91 1S2KA 3WHUA 3KCCA 1V9U3 2VGDA 4O9GA 1JMUB 3ZN6B 2KD7A 1TZOA 4Q2FA 2FCTA 4CP0A 4ES9A 5EHDA 5JLVA 3VBRC 1AR63 2G9FA 2UYAA 4MXWB 2W95A 2XJPA 3VL8A 4YZ5A 4ZU5A 1O3QA 2J1EA 4RQPB 3NAPC 5IFPA 3NWKA 3HPNA 3A22A 4Q4Y3 1LGNA 2QUOA 5FYTA 4Y20B 2BTVC 4E9KA 2JE8A 1IPKA 3FX3A 2Q8EA 4I2OA 1DCSA 3KV6A 3RZMA 2QVSB 4Q0PA 1S0JA 4W4ZA 5I91A 4PI0A 2IVIB 5K0UC 1RMU2 2XUEA 1LULA 2PHXA 4QQOA 1CESA 3RGBA 1IS5A 5BNPB 2WSUA 3PVEA 4NHYA 4CZSA 3BU0A 1KITA 3AB0A 3NVCA 1BYHA 5DAVA 3W5MA 1AR83 2ZAAA 4P9JA 2WS92 1AR93 1DP0A 2D3RA 3WW4A 4D6QA 1KD7A 1TVGA 2ARXA 3LFIA 2B46X 5DUVA 3LFMA 2VNGA 3IAPA 4FP2A 2WN2A 4HONA 1HRV1 4BQWA 2CGPA 1XNAA 2JG9A 2B7YA 4MGKE 5GLTA 3ZSEA 2V73A 2PTMA 5IVYA 2VVEA 1C28A 1PGSA 5A6XA 1COV2 1BLZA 1NA1C 4JCKA 1XNTA 4JZRA 4XF1A 4LLFA 3LDRA 5K0UA 3WW2A 4BLJA 5BUVA 2PLV1 3LWCA 3VBFA 1AYN3 4HKLA 2XH6A 3WINE 3EQEA 5DUWA 4IEZA 4CUGA 5FZBA 1UZWA 1LB2A 2DF7A 2DCKA 2HWB2 1WLCA 4FP3A 3RS6A 3WVJA 5A3PA 5A3OA 5F5QA 2W2IA 5GJ6A 1VBA1 5JPMB 3KD4A 2MEV2 2AGSA 5ABJC 1W6MB 1YFWA 3NNJA 4RYDA 5LY1A 4XJ8A 3ITQA 5ISLA 1G9FA 3J7MA 5FUIA 3N35A 4LTAA 4FXKB 4Z2AA 4DQAA 1PX4A 1HRV3 3PIGA 3VDDA 2JE9A 1UY4A 3E5UA 2J1TA 3J7LA 4XFFA 1JN2P 3NRUA 4NAMA 3CZJA 5F5AA 3W58A 3LDBA 1TE1B 5FYBA 2ORXA 2KXLA 1O4YA 3VDAA 5FKBA 4UW3A 3LB9A 1ZRCA 5KXCA 4NAOA 4RS5A 2PLV3 3TBDA 2Q8OA 4ASMB 1VRH2 4HOOA 3RJRA 1IGOA 2XJSA 5FP9A 3MLLA 1OSGA 5FQ0B 3UGHA 2BBVA 2DU0A 4CPBA 5KC5A 4B1MA 1K5MC 5CVRA 3QH7A 2BPA2 2WLQA 2W08A 1VBA3 2G9ZA 1T6GC 4MADA 1YJKA 1CIYA 3ES4A 4CU6A 2BQPA 2BFUL 3AK0A 1AX2A 2LALA 1PGW1 3SXWA 3CLPA 5T5PA 2QQKA 4CEWC 1QU0A 2ZHNA 1OXCA 3A0KA 1RUNA 4EN6B 4BQ4A 1JZ5A 2QQIA 4LHLA 1CX1A 1UKRA 2C9KA 1LAJA 1I1EA 2V4AA 4LKFA 1TME3 3VZOA 3TEZA 3D0JA 1W06A 4KBBA 4QHZA 1QJX1 1MVQA 2ILMA 2WQZC 3IDCB 2BNOA 5FY0A 5C3SA 1RHI1 1YXWA 2EF6A 2D6LX 3MV11 3VZJA 4HSJA 2WAAA 5E6HA 4ZKTB 1DIWA 1ULOA 4GB32 1WLTA 4U2AA 1BXHA 3POGA 2ZOEB 1UZ0A 2P6HA 2B9UA 2QQVA 1P8JA 1AJKA 2ZGLA 4Q26A 5C3RA 2UWBA 5HCBA 4CP2A 1SACA 5DZGA 3M3QA 4IW3A 1F5JA 2G1MA 1AXYA 2NLRA 2R042 3JUUA 4ZPIA 4RGGA 3HR9A 2ADDA 3AP4A 1W9WA 2JG9B 3SLIA 1JUHA 1RJ8A 2Q0AA 4P02B 5FJKA 3TNQA 4KL1A 1PM7A 5I0TA 5HCFA 1H8TC 4Q4V1 1DGRN 5A6QA 4IV1C 4SBVA 2ZX3A 3ZN4A 3JZVA 1PHMA 1QJX3 3AMNA 4LOTA 1LTEA 3O1RA 4LBNA 4P9XA 1RHI3 2DCTA 3VBFB 3WQ0A 2H6BA 1REDA 5FOBB 4X8NA 1OFSA 5L9RA 1PK6A 3HQRA 3LA3A 2X10A 3KMHA 3NO8A 2DVAA 1GV9A 4IE5A 1A8MA 1J58A 2GP5A 3RZJA 1W9YA 5I8TA 3ATGA 2A6ZA 4XMAA 1GOHA 4QXBA 2O0OA 4XHXA 2K2SA 2P3IA 3VDDB 2JENA 3GCWA 4B3NA 1SEFA 1QJFA 4S2HA 4Y24A 1OOPC 3MIFA 5FZEA 5IUQA 1Y9MA 4Q4V3 3GDBA 3KS7A 4AI3A 4URAA 4IE6A 5FZFA 5FZMA 1GZTA 3WG4A 1WW6A 4YM1A 4BLIA 4RS5B 1SG3A 3NL1A 1EPZA 4LE4A 4FAHA 4IESA 1GZCA 5APAA 4CCLA 3LOBA 1YUDA 1W04A 5FZOA 1KFXL 2DVBA 1VE0A 3PVBB 3NJYA 2FBEA 1O3RA 1G9DA 2R16A 4R9AA 2CHHA 2W94A 1UPIA 3SEEA 1VBA2 2DUOA 3JD71 2RDQA 1ST8A 1N1YA 1KS4A 2W47A 2EVXA 4I30A 5FP4A 5FZLA 5J96B 2Z5WA 4Q4W1 2DYCA 1L3JA 2VW0A 1GWMA 3OD4A 4NO4A 5CYYA 3G7DA 3RYRA 5FUNA 1RUJ3 1PVC2 1G9AA 5L7OA 2P17A 5LBEA 1D4M1 3THCA 2Y0OA 5L9VA 1W8OA 2OUJA 2RJ2A 3BVCA 1ULGA 2VXRA 4RFT0 5CA6A 1D4VB 2CWSA 4L11A 1MEC1 1RITA 5LK5A 1HRI2 5JSOA 1O4ZA 1DGWX 2OIIA 4LKDA 1H1MA 3PLQA 4XIKA 3ZYFA 1XE0A 5DAWA 4RR3C 3WF2A 4MVTA 4KG0A 4EWDA 1ZZ8A 1GSLA 1RUG3 2FCVA 3N9NA 3T2PA 4F3JA 3JD73 4W6WA 5CG9A 1FT9A 2R0HA 2CL2A 4FPKA 4J25A 2HYXA 4D7SA 1UPSA 1BHGA 1DGRA 2V5DA 3H7JA 1GANA 3K4DA 3AVRA 5I0SA 4KU8A 3CHXA 2PHDA 2DFCA 4FPJA 1AR73 5JIAA 4NE9A 1D4M3 4YZ3A 4A41A 5EQUA 5IHRA 3OUJA 2ZA9A 1QJX2 2ZGRA 3KLSA 1PK6B 4PIYA 4A4AA 1DGLA 1YIPA 1MEC3 4JGZA 5KHJA 2W1WA 1UOGA 1QHDA 4H2AA 1OQEA 2VNVA 1V70A 1W0OA 2EAKA 3PMEA 2VCCA 3HN1A 4LEJA 3ZOIA 3B7MA 4OYUA 2X5IC 3EXUA 4HBNA 4RHV2 3Q8AA 3ZSMA 4LUMA 3GJBA 4IGOA 1K3IA 4FCAA 5GLUA 1ONAA 1SDDB 3LAGA 3MBWA 1GOGA 5FMBA 2JD9A 5A32A 4D6RA 4NHLA 3ZSKA 4PDWC 3OJBA 2MPFA 3C7HA 4N43C 4Y3OA 1UY1A 5FY5A 4MG2A 2E7QA 2Y8KA 4EWAA 3TB0A 2C5DA 1EV11 4UBGA 4CU8A 1BK0A 2XKPA 4AVBA 1YO8A 1UU4A 2RS32 2VTFA 4NHMA 4V2WA 3LOIA 4ZZ8A 5IAXA 2ZJCA 1ENSA 3LEGA 2NZ9A 5FZOB 1BEV2 1CD3G 3IWZA 1NCQC 2D5HA 5A3NA 5KHGA 1IS4A 4KWLA 2DVDA 1AYM2 5CFDA 5GLWA 4XYXA 1BMV2 4ZS2A 5FKCA 1FXZA 1W0PA 2SBAA 3SITA 1JYVA 3ACGA 1HLCA 4FXGB 4W8JA 3ECQA 2EAAA 3MFCA 4GIQA 1CQ9A 4M3CA 5M0TA 1UZVA 1NZCA 1RXGA 4AK3A 4CDXA 2DTYA 3CBNA 3FHQA 1SCRA 5J7MA 4GH4C 1EV13 5L7OB 5K4LA 1HB2A 1WLWA 2VQUA 3SC7X 4EN8B 2FDFA 4GWJA 5F2SA 1VAKA 4CP9A 3LCPA 2J22A 2VMEA 4ATEA 4Q5OA 4M00A 4KQ7A 3VZLA 2OS2A 1NCQA 3ZYJB 1CJPA 4DINB 5EV7A 1QJU2 3KV4A 3KCYA 2VL4A 3HVDA 3OEAA 3RSJA 2FDHA 2G4IA 4AOCA 4X6RB 5TSWA 3VBHC 4JC1A 2AYHA 4FTEA 2CU5A 5JXIA 4Y1UA 3FBMA 3I2DA 3I3DA 3PUQA 3P3NA 3WDXA 5HBAA 5FMCA 3O1SA 4HKOA 1LNSA 1Y7BA 3ABZA 4IEYA 1ULPA 4AVTA 1ZRRA 4O65A 1JYNA 4AI0A 4Q4W2 2FMYA 3O1TA 3DYOA 4MZUA 3MF6A 4ITCA 5FZ8A 3THTA 1PO12 5KHHA 3FFZA 5JIUA 1UYYA 4JGZB 2WA3A 5HXVA 1MS1A 1AXZA 3KSCA 1D4M2 1CX4A 2E7AA 3GBGA 1AL21 3MPBA 3Q8FA 4N9IA 5CG8A 2XJRA 4QXCA 3E6DA 3ZFFC 4BK5A 1LRHA 1O59A 1QXJA 1XU1A 2V09A 2ZCWA 4UYBA 4QXHA 5F3CA 3RQ0A 5JMOA 3ZFGA 1J1TA 1W9FA 2GALA 3H42B 3K75B 3OPZA 4FQZA 5FBJA 3HT2A 2IXIA 1ZX5A 3MIGA 1ND2A 1RUE1 2PAEA 5A32B 5KXEA 2HWC2 4AEDC 1HQWA 4IL7A 1DDLA 3ILRA 1PO21 1F2NA 2IXJA 5FYVA 1QWRA 4DZGA 2AH2A 3POJA 1WMDA 1F15A 2ZX1A 3DGTA 4AFBA 3J26N 2YGLA 4A42A 1NG0A 3WY6A 4KGGA 2D3PA 1UY2A 2Y26A 4TLGA 1W3VA 3VDCA 4UFJA 4YGCA 1Y4WA 4Y4RA 1HV0A 3DXTA 4QPIC 4CDWA 4QQHA 3I4IA 1AL23 1WCKA 1JOBA 1MZ6A 3BIEA 1R092 3BALA 1DQ6A 5F3GA 3R0RA 2XR4A 5IAVA 3ZMNA 1Q3EA 4YVWC 4R9BA 1YQ6A 4AR2A 3OOXA 1ULDA 4HVRA 5F2WA 5CFDB 4XEZA 1W8WA 5BV6A 3AKTA 1R1ZA 1F35A 5FZ9A 1OQ1A 4XJUA 5CKMA 1O6UA 5D21A 3EO6A 3M2MA 5FYIA 1HW5A 1O3TA 3ZLIA 1YFXA 1PO23 5FYUA 1LJ7A 4ONUA 4M3CB 4QDQA 4YZ1A 1TQ5A 2VM9A 1ENXA 3AFGA 5SV8A 4CDXB 4DXZA 4AHYA 2IFWA 4LO8A 4ZZ5A 3UGFA 4HG6B 2Y6GA 3BTYA 2RJKA 1WCQA 3ZXKA 5JSPA 2VR4A 1UU5A 3HOBA 1S0EA 4CP9B 1HJGA 2VO5A 3M70A 4SLIA 4E4HA 4XDPA 1VMJA 4ISQA 4Z2WA 3F2ZA 1TEIA 4LIUA 5FLHA 3WP3A 5GZCA 3AFKA 4JTNA 1N1SA 3WNKA 2ARAA 3OBZA 4I0BA 1CZTA 3N7KA 3ZPOA 1C5HA 1NE6A 2VUCA 3LPFA 4AVVA 3BI3A 2J1VA 2VOVA 1KDKA 1TNRA 4AEKA 3O1MA 1I6XA 2A5ZA 1IQDC 3ZN5A 2WAOA 4HPKA 3BCWA 1W05A 3MEPA 3K4AA 2WC2A 1R1A2 5FJHA 3ROUA 1QIQA 3KWVA 3H8XA 2UWCA 4OFGA 2P5BA 1US2A 4QX1A 3KZ4C 1SBDA 5J09A 4OVEA 4QM8A 2GC3A 4L97A 2HBTA 3O0XA 1OMIA 2Q5TA 4IXLA 2BDRA 4COUA 1UXZA 4BXSV 1GNZA 1ZNPA 1G7YA 3ZFGB 5LEJA 1N3PA 5FPVA 1NAEA 4JDMA 3AYAA 2EXIA 2JG8C 1ND2B 1ENRA 4A7KA 1FPN3 3RVHA 1SQ4A 2WBKA 4CRQA 1HB3A 3AP6A 3ACIA 1HV1A 1RUD2 3OG2A 2WFPA 3MFAA 4XAAA 5KXDA 1OH4A 2GC1A 1QXRA 4CDQC 5F5IA 4YGEA 4Y5Z0 4WZFA 2BJSA 1LU1A 5C9AA 4UT5A 3LEKA 3ON7A 4QXKA 4CDWB 4GZ9A 5C4WA 4PJYA 4YW5A 1MS9A 4XETA 3CJXA 1RB8G 2IUWA 2D6MA 2JB4A 2ZX4A 5FAXA 5JZGC 4RL7A 4ORFA 2K46A 1DGWA 4KU7A 1AL22 2JG8A 1T6BX 2Z69A 3R4DB 4XOGA 4EN9B 3OYWA 3PNAA 4WM7C 4UAPA 4B4RA 3IZOA 4I09A 1FMD1 1WA6X 4PLOA 4IEXA 3D82A 3BYWA 4N90A 4O7XA 4NIHA 4CUAA 1ACCA 2A3YA 1WA4A 2ZAHA 1RUH1 1RUE2 3IBMA 3P3PA 2VNRA 1U0AA 2ZHLA 4XF0A 2VG9A 1D2SA 4OI1A 4CCEA 4RQPC 1PO22 4E2QA 4NWWA 4FSJA 3QBQA 5AC91 2QBXA 1BBT3 1MS5A 2JDHA 5I0UA 2O8OA 3URFA 3N7JA 3D4KA 4PBOA 4BQYA 2VBPA 3CJIA 1KDMA 1SFPA 2JEMA 4BYYA 3ZYPA 5B4NA 4JRAA 3DV8A 1LOCA 2QE3A 2RE9A 4MUVA 4PLNA 5F5CA 1JOPA 1UMIA 1CAVA 4C1XA 3UNPA 1YLLA 5ANNA 3NNMA 5GKAC 5C3QA 5BNPC 3PDQA 4P9GA 1SFNA 4IQPA 4UFHA 4OQ8A 1RUC2 3OGGA 2YC0A 4C0HA 1J59A 3S0MA 1FMD3 1HJFA 4MXWA 2YPDA 3QOPA 2RDSA 1HIXA 4FBFA 1H30A 2BUKA 4HPKB 2QQLA 1R081 4NMIA 2VZQA 3MHZA 3H0OA 1RUH3 2JWPA 3POIA 4IDZA 4QMAA 4AI2A 4META 2BOJA 3BN6A 1UZYA 1UXXX 4NRQA 3NV1A 3PMSA 1DLCA 1N1VA 4FI9A 4AQ6A 4NRPA 3M3CA 4YNIA 2YBPA 4GWIA 3OPTA 5F8PA 4OHZA 3RI9A 3I3EA 3B5LB 1IS3A 1NQDA 2WNOA 2ZBJA 4WVMA 3AZYA 5ACA1 5FZHA 4AI8A 1H6YA 3MW4A 4XILA 5JOWA 3IT8A 5FIXA 4COZA 3KGLA 4OMDA 3MI8A 3B9CA 3GBFA 2JICA 4LBQD 5DAQA 1ASJ1 2IZWA 2LM3A 2VC9A 1JZ4A 4XJZA 1LHUA 3FUOA 1S0DA 2HWF3 2W1SA 4FQ4A 1ZRFA 5A7NA 4OI2A 1CN1A 5KR7A 4OZXA 1OKQA 2UYBA 2Y6FA 3RZZA 2R071 5EYXA 4R8HA 3GALA 5C9AB 2PAMA 4AWDA 2QKDA 4P9IA 1IKQA 3U75A 3WW1A 3LDKA 1HXS2 5C4WB 3I2GA 5DUUA 2WKKA 4XIOA 1QNWA 2VVFA 3U0ZA 3KT1A 4PHZA 5FY4A 4EN7B 2QQPA 2X53S 2CAVA 3K3NA 4MGZE 4BJ0A 2XLGA 2YY1A 2WA4A 3N3HA 5FK7A 4AAPA 3OYWB 4OUEA 1GQHA 2WQ4A 1I9RA 3C2UA 1HX6A 4IEPA 3RPQA 1QH7A 1ASJ3 4QX5A 1W8TA 4XBNA 4LBKA 5GZDA 1OLQA 2RR11 4JRLA 3Q8CA 3BODA 4Q8KA 2DUQA 2AC1A 3BPZA 1OBNA 3I2IA 4CEYA 5K7PA 3GCXA 5FYHA 4Z1VA 1YQ2A 1GMMA 3E5QA 1C1FA 1ZZ6A 2W46A 5C8CA 2YZ4A 2XXZA 4OHYA 3C7GA 1A3KA 2VCBA 3CJIB 3I3BA 3KCXA 3WNNA 1ENQA 5FZKA 3A4UA 2R062 3LF7A 1CAVB 4I3PA 1GR3A 1VLNA 1SCSA 3AYDA 3OD0A 5FREA 4NVPA 3ZKUA 3SCHA 4JGYA 1QXPA 4LBMA 4QPWA 4YGDA 3TRSB 1QOOA 4JVAA 4PQQA 2NMOA 3KQRA 4MV2A 4B4QA 5BNNA 1DQ2A 2RR13 4MGYE 1LEDA 4RGKA 3V0AA 3CIHA 4KG8A 4LBOA 4LLOA 4R9DA 2WZR1 5CKQA 2J1UA 4EN0A 4MGTA 2GDFA 2JG9C 5FYSA 4CU9A 1ZBE1 4CA9A 2G19A 2GU9A 4FTBA 4EZHA 3GBWA 1HQLA 2DFBA 3MYXA 3VV1A 1RUF2 1TMF1 3NQHA 4GMP1 5FRAA 4IEQA 1AYN1 2CTVA 2KR2A 4UXAA 1PVXA 4ZU4A 3IPVA 3VBFC 3ZX7A 5A7PA 5AC92 4WVMB 1ZREA 3ZSLA 2WT1A 1VALA 3VBUB 3KT7A 4HKWA 1JTZX 4UW6A 5IK4A 1N3QA 2VZVA 3T1LA 4Z92B 1DZTA 3O12A 4BH9A 1XE7A 1E5IA 2WNUA 1J3QA 2ZKLA 3ZYGA 2YG0A 2XBO1 2CDPA 5H9PA 2WZR3 2OQ7A 2PELA 4BQXA 3VDDC 1GU3A 2SLIA 2HWD1 4COYA 3BTZA 1ZBE3 2HLEA 5EXOA 2J42A 4O61A 1R082 5E8AA 5A1FA 4ATFA 1C1LA 3HQUA 1TMF3 1ND3A 3E1F1 4GMP3 2MNGA 5JR7B 2VY0A 1WLDA 4XF3A 2XLAA 1B35A 4LO6B 5FZCA 1NX9A 1QEXA 4Q8LA 1MPXA 4Q29A 3ETQA 4QX2A 2RS12 2V72A 4RS5C 5FV3A 4QT6A 4AVSA 2ZEWA 1X8MA 1CVNA 3ES1A 2VMDA 4QM9A 4IE7A 3HBZA 3O1OA 1W2OA 3EYPA 1CWPA 3I2HA 2P34A 3AMHA 4N9HA 3MGUA 1NCRA 1S2EA 4DOUA 1WUVA 2EICA 4DUVA 5ACA2 3ZXAC 5JXGA 1LEMA 3RWNA 1UIKA 4UWDA 2BERA 2X09A 2W92A 3GZTB 4Y1VA 4AVAA 1PMHX 4PF1A 4XQDA 2XBO3 2GNTA 1B09A 2PA7A 3J8F1 1SPPA 4XUQA 2RM22 3WD5A 1ASJ2 1XNDA 1TME1 5LEKA 2HWD3 5A33A 4CEYB 1JYCA 3AKRA 5FO7B 1XSQA 5CEHA 3O1VA 1QGLA 3EJKA 3PUAA 5DUXA 4Y1XA 1LHVA 5C8CB 4FOQA 1W8ZA 1SLTA 1W8FA 2OZJA 2ARCA 5FXVA 2A7AA 1PGL2 1S0GA 5C8WA 3JB8A 2R072 1UX7A 4K7JA 4COWA 2F4PA 5F32A 2HWE1 3GZEA 4BMBA 5A6ZA 3S6PA 3ZM8A 2E32A 1XU2A 2PHLA 1EAH1 1FV3A 1GWLA 4JGYB 3LZZA 3QLQA 2A6YA 2WYFA 5F37A 2XONA 3JQWA 4FPOB 1OA3A 3B93A 4J1WA 4YVSA 4BISA 4XFHA 5A7QA 2PHUA 2PN5A 1Z7S1 2DDUA 1VBD1 5BNNB 5JOZA 1V9U2 2TBVA 4XQWA 5T50A 3V0AB 3J8F3 3AKSA 1A78A 5CADA 4AZZA 1AR62 3ZDSA 2WWJA 3W59A 4YWAA 4CVUA 3T09A 1OUXA 1JBCA 4FPCA 1Q8PA 1X50A 3MLJA 3AP9A 3FUQA 1W8UA 3UYJA 4Q4Y2 1SLAA 2VOTA 4OI4A 2K0GA 2VBDA 4YM0A 4MHUA 1LOAA 3DECA 5FLIA 2HWE3 3IPVB 4MO3M 3S5QA 2RJLA 1JZ6A 3MZHA 1A6CA 4LNVA 4FOWA 4YW3A 3FLPA 1S1AA 4LO7A 1PK6C 2H0VA 3FE5A 5IW0A 5A7SA 3R6SA 2LS6A 2VZOA 1EAH3 2ZGKA 1OD3A 4XFBA 4YM2A 3R4UA 5LB6A 1LOFA 4HFSA 4LOSA 4IGPA 2VMFA 5H9RA 1AR82 2ZGNA 3ACFA 1JH5A 3KT4A 1AR92 3AMQA 1Z7S3 4M0NA 1VBD3 5DN2A 3U37A 2WNUB 4XURA 1FX5A 2WZ8A 1BVP1 3SH3A 4YW2A 5CKNA 1K5JA 3EMRA 5FO9B 2VMGA 1BVVA 4XCBA 2PXJA 3WG2A 3ASIA 3HN3A 5KC6A 4O9EA 1ND3B 2W68A 3M4FA 3I3QA 1K45A 3C8XA 5EJ3A 1B35B 1ZBE2 1BQPA 5JOXA 4FFGA 5FZDA 1SZBA 3WR0A 4EV0A 2XL9A 3SHRA 3KM5A 4BMEA 1DQ4A 1PZ7A 1YC61 1AYN2 3PVOA 4QU2A 4K40A 1UU6A 3NJXA 5J1XA 2C26A 1PZ8A 1QDCA 4CTEA 5IK7A 1NCRB 1VR3A 1S4CA 1W6OA 3RMYA 1O3SA 3KV5A 2VQTA 4AW7A 4R4ZA 2ET7A 2VECA 3PUHA 4DUXA 2QCSB 3NKGA 3U14A 1SPPB 2ES3A 4CPBD 1JYIA 3A7QA 4UBHA 1HRV2 5A33B 1XYOA 3RWKX 1CPNA 1JHNA 2ZEYA 1EPWA 1RUJ1 2J7MA 2P3YA 2WFF3 3RZKA 4QU1A 2OPKA 1MR5A 3JXSA 3WDUA 1YYNA 2FHRA 2VPVA 3FLRA 4LR4A 3FJSA 1I5ZA 1MS3A 5L7OC 2F17A 3AZWA 3E6BA 1DZRA 2IXHA 2PLV2 3PTRB 4XVHA 5J36A 2AR6A 2JDNA 1NUKA 2WNVA 2Z42A 3Q8EA 4DFSA 1KRIA 1BCXA 4YZ4A 4G9SB 3SH5A 1RUG1 3T0AA 2CWMA 4PF5A 4YVSB 2GH2A 5E88A 1FYUA 2Q8CA 4B8EA 4UFKA 1YNAA 1RIRA 2YROA 2ZPXA 4DMIA 3K77A 5C70A 1QOTA 4MXVA 2YB7A 3VZMA 4BOWA 4NROA 5A1LA 3R4SA 1AR71 3KV9A 4GA9A 4NPLA 1TME2 2NPIA 1QJZA 4NN0A 1GFF2 4QPGA 2WO3A 1RXFA 4QD2A 3SNMA 4CDUA 5A3TA 2E63A 3LE0A 4DXTA 1O5LA 5FZAA 3WCSA 1POV1 3IDEA 3ELNA 3N36A 4JGZC 4WVWA 1CIWA 2UWAA 3KF5A 4E4ZA 1Q8OA 3QACA 1K12A 3ENRA 4QQPA 4OQ9A 1X9PA 3PTYA 4NJ4A 1PIV1 4UF0A 1PGW2 2IXKA 2XG3A 2FDKA 3MUZ1 3BOPA 2VZRA 2D7FA 1X8EA 1U5IA 4RFRB 4KH9A 1Z7S2 3CZUA 1VBD2 4QDRA 1XXNA 1WZXA 3TN91 4AFCA 5HV4A 4L92A 1WW7A 3DYPA 3TEYA 2XVLA 4LBLA 1RL3A 1DHKB 4J6GA 1RC6A 3T4HB 2DTWA 1UOJA 3B00A 4QKDA 1RHI2 2ZXQA 4BIOA 2UU8A 1UYPA 3VBOA 1Q56A 3HJRA 1POQA 1POV3 5LZ6A 1V6JA 2JDYA 4QX3A 4UFIA 3UKVA 2BW8A 4AQ2A 2XJVA 4XUTA 4NIDA 4OULA 2R49A 5A1AA 5SV5A 5JR2A 1W6OB 1YI7A 5CIRA 1XNBA 5FMDA 2GZWA 1PIV3 3OF1A 1ULCA 3VD9A 2G9GA 3BTXA 2E7TA 5CFDC 3FC0A 4DPNA 4QQLA 4DY3A 1STMA 3RJ2X 2XB6C 2YXSA 2Q8DA 1REFA 3DKWA 2R1DA 4GD4A 3RFRA 2B45X 2Y6JA 2GMEA 1O8PA 2D43A 2JB8A 3K4ZA 5FYCA 4YYOA 3TN93 4BB3A 4Q4V2 2LTNA 2ZMNA 2VZUA 3N9PA 5IVVA 2FZ1A 4CDXC 1ZZ7A 4XZUG 1XC6A 2IVJA 3DL3A 2P1BA 3ACLA 1J3PA 2HBUA 2B39A 5DG2A 4MHRA 2DCYA 4N7UA 4JQTA 4N7IA 4YGBA 2WNVB 3K51A 1VB4A 2VZSA 3T2TA 4P00B 2BWAA 5JOYA 2Y64A 3JBG1 3J9SA 5HPOA 3W5NA 3M7AA 1CR7A 1GP5A 5A7WA 4IE0A 1W6QA 2WWUA 2PMWB 1ZZBA 4E8CA 1V6MA 3LSEA 4LORA 5FY7A 1EUUA 1Q8VA 2BZDA 2D6PA 4LJHA 3PU3A 3SISA 1REEA 4I01A 1JHJA 1F4HA 1DFQA 3CNAA 4K8FA 5FDBA 3NKTA 2WIIB 3SQOA 2AUYA 3DEMA 3WF1A 3RYKA 5BNOA 4P9LA 2JECA 2BWCA 4QPGB 1NZIA 5AFBA 4CDUB 1ULFA 1RUJ2 3CDZB 2D98A 4QGNA 1NLRA 1OLMA 5GLZA 5JI7A 1QQP1 4EZ4A 4XJ9A 1DG6A 4YSFA 5IT6A 4LE3A 3ZVXA 3VKFC 4K6BA 3JBG3 1M06G 5C3PA 3INAA 5KHKA 2EALA 4W6YA 1XRUA 1VB2A 1JZ7A 3WNOA 1Q5OA 2ATFA 4I0AA 5K9YA 1FATA 3I2KA 4UF0B 5FZIA 2XUMA 4A45A 3ZFGC 4S2DA 1OA2A 1RUG2 3GGLA 3JQXA 4B7EA 1XYNA 3MW3A 4AVCA 3JD72 4LKEA 3V0BA 1ND2C 1PM4A 2DBNA 2QZ2A 5C33A 5HCHA 2D3SA 1GZ9A 4PT6A 2QNKA 3I8TA 3MIHA 1X9TA 2OA2A 4COVA 5C5TA 4HVQA 5DDJ3 1H0BA 2WO7A 2ZZQA 3B01A 4GAZA 1FOD3 2W3JA 1AR72 5CISA 1DQ5A 5LA2A 3VBOB 3P6BA 1QQP3 4CSWA 4D6SA 3OCPA 1NLSA 5CBLA 4MLOA 4HZFA 3RNSA 5A3WA 2E6VA 1MEC2 1OD5A 2X8KA 5IWFA 4CDWC 3H8OA 5DXDA 4FPYA 1JZ3A 4XZPA 2UURA 5IVFA 1GYKA 3AVSA 4XUOA 2HYKA 4B4PA 4LQRA 4CXWA 2QTWB 1VAMA 1NKGA 5GALA 1PIV2 3UESA 1VBC1 3BPSA 4IGQA 4P9YA 1F5FA 2GSYA 1DU3D 3A21A 1RVF3 5FZ6A 4QX7A 2XDVA 4F83A 2PHFA 4PBPA 4W50A 3T30A 4BCUA 5HXMA 3M3OA 3N4MA 3TN92 4AAXA 5FP7A 3ZIXA 2R1BA 2JKXA 2VCAA 1KS5A 2XWJB 2H6CA 1US3A 3SKVA 5LBCA 1WGPA 2WINB 4FO9A 3RZHA 3LA7A 5DG1A 5FP3A 4GKYA 1YI9A 3WV6A 5A7WB 1W6QB 3VKOA 3CO2A 4TZDA 1FI2A 4BHPA 4BK4A 4LK7A 2A6XA 1URXA 1SMVA 5F6KA 2BNMA 4LITA 1VMHA 1MACA 3BU7A 1H2LA 1VBC3 4P08A 1L7LA 3QD6A 2XHKA 3H3LA 3KQ4B 4QB1A 4QX8A 5D8AA 5DAPA 1WD4A 1G9BA 4M4RA 3N9OA 5BNOB 5CAZA 1VBB1 3IM0A 2L9LA 1CGPA 1KJLA 1EV12 3H3ZA 4DB5A 4YW6A 4XJWA 5F3IA 5FPZA 3WF4A 5FP8A 1QJY3 3H1MA 2O1QA 5A3MA 2WO2A 4GALA 1KXGA 5G05L 4AQSA 5FWJA 5FPAA 2I74A 1IG3A 2WR9A 2RS51 3LPGA 2Y33A 4LO4B 3ZXDA 3ZPYA 4GWMA 1W39A 1M4WA 4D94A 1I3HA 4BA6A 1FPN1 4GMP0 4TYSA 5H9QA 3V0BB 1Q8SA 4WVZA 4IEOA 2DUPA 4XPVA 1UW8A 5BPXA 3ACHA 5D1IA 4KBZA 4IV3A 2GN7A 3U10A 3ILNA 2F6BA 1VBB3 5F1RA 2XJUA 3MO4A 1S0FA 1W9TA 4N53A 3JU9A 3WF0A 3WP5A 3OBTA 4TLFA 1UF2C 4CUCA 4LKSA 2WL1A 3GHMA 5FYYA 1W99A 5EZWA 1Y9GA 5C9AC 5IVEA 1AF9A 1ZBA3 3HD8B 3L9JT 2EXKA 3OBAA 4Y5TA 2BGOA 4NRMA 2VW1A 1XNKA 4C90A 2QQMA 5BNQA 5C4WC 1QQP2 2CSGA 2RS53 1OVPA 4H7LA 4TWTA 4XXAA 3WNMA 1CZSA 1L7RA 1RUI1 2RV9A 3GJAA 4D69A 4DY5A 5FR3A 3I2FA 3VBSA 5A3UA 3H8UA 2E31A 5CFCA 2VVDA 3ZKYA 2WJSA 3SCGA 5KXBA 2XJQA 4QDSA 5GLVA 1AJOA 2HEVF 4GJZA 1MVEA 4UFMA 3W20A 2C6SA 4IUGA 2R32A 1X36A 3WZ1A 3NNLA 3OGRA 4LA3A 4FPHA 3I3MA 2E33A 1BBT1 3I59A 2R30A 5LBFA 4DXSA 5I8SA 2YU2A 3HNYM 4GJYA 1WBLA 2FQPA 1NY71 2WDBA 2CGNA 4NHKA 2BGCA 4G4FA 4XDOA 1W8HA 2F4LA 3CJIC 4FOVA 4BU2A 4XCAA 4CCNA 4LBJA 4ZS3A 5JVVA 3J4UH 2YYOA 3WDVA 4BXFA 3PURA 4EQVA 1GP6A 3RRDA 1RUI3 4AL9A 4URTA 2D40A 2DURA 4RGAA 4JKKA 2BNNA 1YQ8A 3AKPA 2VUDA 1Y3TA 4MH0E 3UL2A 4DIQA 2AREA 1VBE1 1IS6A 4X8PA 1OURA 2XOMA 5LK7B 5D8AB 3BOWA 2GP3A 4B29A 5J37A 3OY8A 5A3LA 1WCSA 1QJEA 4EWEA 5JSRA 4NIAA 1G6NA 3EHKA 2ZHKA 3MIBA 4ASKA 1DYOA 4JKMA 4HANA 2BFUS 1SLIA 5LWBA 4AG4A 2H0BA 3LSDA 4H7MA 3K3OA 2C24A 3MUY1 4YRDA 4R52A 4YG3A 3SKJE 1CONA 2P37A 4Y5SA 3VKLA 4E4DX 4BQ1A 3I2OA 2ADEA 1E5SA 4HN0A 1XNCA 1W03A 3VBUC 3OGJA 3VD5A 4R9CA 1T2XA 4FOYA 2O8QA 1AHSA 1RMU1 2HWF1 1VBE3 3C3VA 4K8RB 2Y0IA 5F9TA 4CCCA 4YW1A 3PUIA 4IV3B 2VOXA 4YLZA 4Y1ZA 5FZ0A 1S0BA 2WS91 4A6SA 1H1AA 3NJVA 3OSDA 3APBA 4N53B 4LT5A 5L9BA 2A6WA 3DPRA 2C0ZA 2EIBA 2UY9A 1H8VA 1LESA 5FOJB 4HK8A 2D6KA 1QKQA 3E97A 3KVBA 1WW5A 4OMCA 3ZO0B 3VBUA 2ZGTA 4L9BA 1PX3A 4XUPA 5FPXA 2ZGMA 1XJAA 3MPPG 4WBBA 5AVAA 3WDTA 4M4PA 1XE8A 3O0WA 3VBSB 1UZZA 4FFIA 1FV2A 4YZ2A 1OPOA 5CFCB 5J3UA 4A7YA 5A7OA 2GMMA 4W65A 1HN1A 1RMU3 2ZMLA 3N9LA 3RG0A 3VLBB 1JS9A 3N7MA 1OT5A 2VZ3A 1FPN2 3ALQA 4M3CE 1LHOA 2MEV1 2WS93 3OEBA 3VGIA 4NIIA 3I59B 1X82A 4CEYC 2J1SA 4QQ2A 3HWJA 4P9WA 5IVBA 1IOAA 4IEWA 1UIJA 1W9SA 1GQPA 5C8CC 2P4EA 4Z82A 3ORJA 1ULEA 3ZFEA 4GQ7A 5FMOS 5DMYA 3T2OA 3FHIB 3O0VA 1OF4A 1S0CA 2WZEA 5JI9A 5LCWL 1UAIA 3AJZA 3MICA 5FYZA 5GZEA 5EWSA 2WUHA 5F7UA 2C1FA 1U12A 2V4VA 2VTXA 1UMZA 3OB8A 4JGYC 3W21A 1MS8A 2WABA 4DRVA 4A2UA 5DQ0A 2WZPP 1RUI2 1VRBA 2YBKA 3ZMOA 4C8DA 4XQ4A 3Q8BA 5T5LA 5I0RA 5BNNC 3OY8B 1ZZCA 2ID4A 3RYPA 2MEV3 1V6IA 2DCZA 2ZMKA 4ES8A 1YEWA 3U4SA 2KM2A 2PHTA 4WM8B 3MLKA 3KHCA 5LY2A 2A3XA 1S2BA 3S5AA 2YDEA 1W2UA 3IIIA 4U36A 3VB9A 5L73A 3POWA 1BBT2 1EY2A 5FTTC 4D0QA 4BDVB 4B1LA 2WSVA 2W1UA 4WV8A 4AHXA 4FVVA 3I97A 1NY72 4XFIA 1AZDA 5KHIA 3JCIA 2ZGUA 4QAWA 5JCTA 1GQGA 4Q4X1 1W0NA 5FZ4A 1MQTC 1VRH3 2J1AA 2NP0A 4GB31 3WQBA 1CZVA 3QCWA 5H9SA 4BPZA 2VD7A 1G86A 4D8MA 4HVOA 4F8AA 2ZZJA 3B94A 1FMD2 1YIFA 1DYPA 2KA3A 2WNUC 1OKOA 3AZXA 4L0PA 1BK1A 1POV0 3KGZA 1JW6A 1PZ9A 4XBQA 4ZXKA 1RUH2 3O7OA 3POYA 4HMZA 4HETA 3FL7A 3AYCA 4PCRA 4QPYA 3N9MA 3DPRB 2R041 5FYMA 5FPUA 2RG4A 1ND3C 1JUIA 2GC0A 3USUA 2XL7A 3VHOA 3MIEA 1B35C 4DXRA 3VD4A 3MV01 1AVBA 2FDGA 4YM3A 1MQTA 1UN1A 4H3WA 4XBLA 3WOGA 2AENA 4OZOA 3CU7A 1C5IA 5KBFA 4Q4X3 4AHWA 4H55A 3POFA 4P5HA 4XW3A 5IJRA 4GB33 4E4SA 1NCRC 1DF0A 4FPEA 2ZKNA 3HEIA 4K1YA 4GKXA 4QKFA 3WEZA 3NNFA 4KNCA 4AEMA 4AGRA 2Y6HA 3LQCA 2D44A 1VP6A 1N47A 2HWF2 3JB4C 3NMBA 3PIJA 4XHBA 1F9KA 1IHMA 2R7EB 3AP5A 3FWEA 5JAXA 2GN3A 1D2QA 5CU1A 3SH4A 3B69A 3DXUA 2R043 4FPFA 3VBRA 1F31A 3ZFEB 3DUIA 2VZPA 4M0HA 3ZYHA 4K3UA 3PVNA 2NQYA 3NAPA 4QWNA 3THPA 1F8VA 2VQ0A 3WQ1A 4ASLA 5BY5A 1RGSA 3RMXA 5JPNB 4CCMA 1Y9QA 4XDQA 1H1IA 2BU9A 1YFYA 3M3IA 2CAUA 1NXD1 1Z78A 2GMPA 2R0FA 1H4GA 4HK9A 2ZX2A 5JWPA 3K2OA 4YVSC 3FZ3A 1O5UA 3VHRA 3WT3A 3C7EA 1X7NA 5FK8A 2XJTA 5T5OA 1O4TA 2CYFA 3R05A 1GNHA 3S7IA 2W87A 3UETA 3UK9A 4AEJA 3HIFA 4Q0VA 1J1LA 4Q0QA 3U78A 5HI0A 2FDIA 4LA2A 3WCRA 3AZZA 4J1XA 2GAUA 1UO9A 3HNBM 3FLTA 4TN7A 2CV6A 2Q4SA 1NA1A 2D6NA 2WRAA 1PVC1 3FFQA 3IN9A 1UKGA 3J7HA 3WUDA 3U4XA 4ZHNA 1LOFC 2VE1A 2E53A 1W6PA 1U5ZA 4CU7A 1MS4A 3UV9A 1HRI1 4BWOA 1LGCA 3U1XA 4JQRA 3A23A 3NSTA 4Y33A 2B5HA 2VXJA 4Q0SA 5GM0A 2RR12 4A3ZA 5ABJA 5A6YA 4ZONA 4AHZA 1G8WA 2W5FA 3D5OA 2JDZA 2YFUA 3LIGA 1V6OA 2XPJA 2YC2A 4C1WA 3USUB 5HV0A 1C8M1 5EPAA 3WLUA 4MGSA 2Y38A 2OKXA 4DNYA 2QFEA 2VMHA 2QZ3A 5FBZA 1MQTB 1WMFA 2PHRA 1IG0A 2IC1A 3ZSJA 1IPSA 1PVC3 3WG1A 1JYTA 1AL0G 1SDWA 2NN8A 2P3KA 4DEQA 3H50A 2QQWA 3B3QE 1H2NA 1ODMA 5I93A 1ZRIA 3OGSA 3AL5A 4NWVA 4AI1A 4RD7A 4Q4X2 1HRI3 2WT2A 1K5MA 4CXXA 3NNGA 4BQ3A 4YW4A 4YW7A 1KFUL 1JXNA 4JX0A 4L2NA 1APNA 3D8CA 4RHV1 2WFF1 4HT1T 3FBYA 5FUPA 2WZR2 3LA2A 3DCQA 2ARBA 2P6CA 2PHWA 4Z07A 4XMIA 5FY1A 2YFZA 2K9ZA 1YRZA 4CEWA 4F7ZA 2W1QA 3VBRB 3ZDVA 4OCTA 3OTFA 4LIVA 1C8M3 1TMF2 4D3WA 4I3GA 1LHNA 4LXLA 5C6CA 1CAWA 5EJZB 3NAPB 1V00A 5LATA 1LODA 1H4HA 2GNMA 5DZEA 3CMGA 2HKXA 5LBBA 1LOBA 3PUSA 3GYDA 3ZXLA 5FPBA 3E6CC 2WNVC 2HH9A 4AYUA 2RS31 2WN3A 1UD1A 4XF4A 5K0UB 3K48A 1EP0A 4QHOA 2J1RA 1IPJA 4I0WB 3WSOA 3ZYBA 4Q1PA 1BEV1 4QB6A 2EIDA 2XBO2 4RHV3 4LO5B 1CAUA 2IXCA 2XLFA 2A70A 2C9AA 4Q27A 4MSVA 2ZX0A 2QDRA 4MOAA 1UY0A 1QY4A 1VJ2A 2HWD2 1AYM1 4JV4A 3BGAA 5G04L 4Y22A 1SLLA 1GKBA 1BMV1 1N1TA 4TXWA 4QPGC 4Z8BA 4CDUC 5J98B 1OVSA 2JDMA 5FMOL 1H8TA 1O7FA 5IVJA 1ZRDA 1W8NA 4IV1A 3MF9A 3OPWA 2BEOA 1NA1B 3HQXA 4FTSA 2Y6LA 1ZM1A 3WP4A 4JHTA 4MYEA 2RDNA 2RS33 2XQXA 3AJYA 2R6QA 4NUBA 5B4XA 2JDKA 4AXOA 1MZFA 1W6PB 1Y43B 3ZR6A 1G9CA 4A6OA 3WW3A 2N7GA 1YQ5A 1GZWA 2W52A 2W9XA 3USSA 1DQ1A 2DBIA 1BEV3 1UWWA 3RI8A 1QJU1 1UNBA 2D6OX 1OH3A 4QGMA 5ABJB 3J8F2 2ETEA 5C3OA 1W28A 5LA0A 5KWRA 1AYM3 4TTGA 2ZS6B 2I2SA 3VHPA 5I8YA 3UJQA 3O1UA 1IQAA 4LULA 3BUCA 3NV3A 1MZEA 2A3WA 3N7LA 4QGLA 4QHBA 4DS0A 1OOPA 1RTVA 2VOKA 2C4XA 2Q1ZB 2RMU1 4KI5M 4R4XA 2ZGPA 5LASA 2HWE2 3IDAA 3VBOC 2XKOA 5B2GB 1W2TA 3AP7A 1JU3A 3M1HA 3ZIWA 3B9IA 1VAVA 2D97A 3WNLA 1QMJA 3GM8A 3SCFA 3P1IA 4CE8A 1PO11 1GLHA 1EAH2 3VL9A 3POEA 2PFWA 1SBFA 5F39A 4B7KA 5T5JA 4OLLA 5DABA 4LHNA 4KWKA 1K5MB 4QKBA 5LRSA 2LUWA 1QJU3 4D7TA 1HN0A 2PQQA 2OW4A 5BXXA 4JHZA 1XOYA 2X29A 4CEWB 4DEVA 4AFMA 5FCCA 1NLQA 2BYVE 1LGBA 2Z2SB 4XTPA 2V5YA 3KF3A 3WDYA 2HWC1 5IYYA 1CAWB 5ERLA 1S55A 4BM8A 1UQXA 2NM1A 3TOJA 4DUWA 2A73B 2RMU3 1OI6A 3AM2A 2Z4FA 1KJRA 1C8M2 1W2AX 4NPRA 4OHVA 5K8SA 1JZ2A 1HB4A 3QH6A 4Q4W3 1NXMA 2YV8A 2QQJA 4JKLA 1PO13 2CGOA 4XTMA 2BGPA 3IMMA 1WWYA 4HLTA 3NJZA 2ZEXA 4WVVA 3D3AA 3OUIA 3PL0A 4JDOA 3AXEA 4YG0A 1ZA4A 3Q9OA 5C71A 5JXHA 1VIWB 4EJRA 1KQRA 4MGIE 3F95A 1R091 3THDA 3WHTA 1CAUB 2VH9A 2VOWA 4RR3A 4P5YA 3WXPA 1RJ7A 2WQ8A 3H1WA 5EYYA 1CAXA 1PNGA 1W2NA 2ZGSA 1FNYA 4Y22B 2EIEA 2IXLA 2GNBA 3N9QA 2WFF2 4CP1A 5F6LB 5BNOC 2HWC3 3WP6A 2LRPA 3GZAA 3GHNA 2LW8A 4YFZA 2B42B 1H8TB 4CXYA 1D0GA 3I54A 4IV1B 1OA4A 2TUNA 5AVPA 3VKMA 2OT7A 3ILFA 4AGGA 4P14A 2JXAA 4OHXA 3MW2A 3AL6A 1WKYA 2YMZA 3IAQA 2VTXJ 3TAYA 1PMJX 1RUOA 1CJDA 2MHFA 2Q1FA 3O5SA 3ZXEA 2AACA 1OQDA 3T2QA 1GUIA 1GZWB 4MX3A 2OX0A 4GXLA 4CUBA 2YUEA 4S2GA 1R64A 5FZ7A 1L7QA 1R093 1YCIA 4M3CF 2X5IA 3LGRA 4BZ4A 4IEVA 5DDJ1 5GZGA 3ST7A 4LPLA 2OQ6A 3DF0A 1MS0A 3CL1A 1FOD1 2VZ1A 2DCJA 4ZU7A 5EJ1B 1GOFA 1OOPB 1OHFA 4ZXEA 2PYTA 4FFHA 4PDWA 3PU8A 4N43A 1NYWA 1C57A 1R1A1 3UJOA 3RZGA 2ZGQA 2D5FA 1X33A 2YBSA 5DPNA 3WG3A 4IETA 1ODNA 2FD8A 2CDOA 2VULA 3MIDA 2BBAA 5LA1A 3H8RA 4IE4A 3U07A 5GZFA 4AGVA 4DRRA 1TNFA 1RVF1 3BB6A 2E51A 1OF3A 1C3HA 5L36A 2EA7A 2ET1A 2VCMA 5IATA 3V64A 2P3JA 3T1MA 3EBRA 1RUD1 1ALYA 2BVVA 1R1A3 2ENRA 3UKTA 3ZXFA 2GC2A 4YFWA 1GICA 2VQAA 2P2KA 3OBRA 3WNXA 4N8MA 3M8LA 1YJLA 2RMU2 2A75A 4GH4A 2WNEA 1XPWA 5T55A 3NV4A 3A0NA 2AEZA 2FDJA 4FT8A 2ZACA 4FPLA 4V2VA 4XF9A 3U11A 2JD4A 3FMGA 1VPHA 4LMFA 2YPJA 2Q1MA 4XFCA 2IWGB 3VZNA 4RR3B 4YARA 1JYXA 2JDUA 1CAXB 5D8AC 1QNYA 3O1PA 5EP9A 4LHSA 4AFAA 1LR5A 1UMHA 4KWUA 3VBHA 4CCJA 4D7YA 1V0AA 1HB1A 4E8DA 2OXBA 3KHBA 1SFYA 4C91A 1QJY1 2WYSA 1W3XA 2AEYA 1J83A 3IDBB 3IIAA 1DYKA 1DQ0A 1RUD3 3NV2A 5FFOC 4I02A 3VDBA 1Q43A 2EIGA 5FPLA 4BE3A 1UYZA 4EE2A 1JU4A 3HAGA 3HT1A 2EXJA 4XE9A 2OVUA 4GULA 4Y1YA 1IKPA 1WBFA 3HMYA 4KWJA 4UW5A 4W6XA 2DVFA 3K46A 5JUVA 1H9WA 1YWKA 1LECA 2VJXA 5A70A 5IK5A 2PQSA 3SMHA 2I07B 3S57A 2W0XA 4UW4A 3GNEA 1WD3A 3BTAA 1PNFA 2JDAA 3ZFFA 4EYUA 2X5IB 2Q30A 5FZ3A 1H2MA 1K42A 5LW9A 2JJ6A 3PJQA 2VAUA 4QKNA 3L2HA 3T0DA 2HEYF 5HCAA 4L99A 4IV3C 1RUC1 1LHWA 2VUJA 2VW2A 4PQ9A 2OPWA 3TEXA 4N53C 1A8DA 1LCLA 1GP4A 1ZBA1 4AEDA 4AF9A 3IMNA 4PDWB 1D0HA 3LKJA 1QOSA 2VU9A 4N43B 3VHNA 3AX4A 1RUE3 1NOVA 3L2YA 2QDNA 4QB2A 3RDIA 4XACA 3UKNA 3E5XA 5EFUA 4L8QA 3DKQA 4BQ2A 1D7PM 5FZGA 1A34A 2JIGA 5IVCA 3JBG2 3CQOA 1E57A 1WMEA 3LEMA 5D2AA 3LIHA 5AFEA 4OHWA 3VBSC 2EXHA 4QPIA 5ANQA 1HQNA 5CFCC 3TNPB 1YHFA 3ZYRA 5FO8B 2B4KA 1BJQA 4Q1RA 2DV9A 5F3EA 1NCQB 1AXKA 1WMXA 1JYWA 4YVWA 1ZYBA 1LU2A 1RUC3 1GNYA 4CCOA 1FAYA 3C7OA 3CF6E 5DDJ2 3UT0A 2CNAA 2VUAA 4Y26A 3WX5A 5LRRA 3WDWA 1FOD2 2LROA 3VZKA 2XVKA 1XBFA 2TEPA 4X6QB 2NMNA 4PI2A 1XYPA 4GH4B 1IZ3A 4K20A 1BZWA 2Z79A 4XC9A 4CCKA 1OLRA 2XHNA 1NT0A 3ZXGA 1RINA 1AX1A 1UCXA 4HL0A 2HEWF 2JIJA 1HXS1 2WLPA 3AMMA 4NOTA 4S2FA 5JXJA 1OPMA 3GF6A 4YG6A 1MZ5A 3O14A 4UI9L 1JOJA 4WZCA 5T3NA 2WWSA 3H9AA 2DVGA 5CZKA 1JI6A 5E16A 3ETPA 3VBHB 4E2GA 1E5HA 2BV4A 5FXZA 5LA9A 4OI0A 1RVF2 2ERFA 3IB3A 1H6XA 3AC0A 3G6JB 2ORZA 5FXXA 3POBA 2JDPA 1J84A 4WM8C 3I7DA 4MGQA 5J48A 1OC1A 4XAEA 1I5PA 2OZ6A 1U5YA 1WW4A 3V65A 2AZ5A 2XWBB 3V56A 3NW4A 3KB5A 3BIWE 1OFNA 3HNMA 3I49A 3AKQA 3TYJA 5IFTA 2OYZA 1ZVFA 1HXS3 5FXWA 4Q0UA 4XJAA 2IFRA 4LBQA 2NYYA 4A7ZA 1YFUA 5CB7A 2R061 1C4RA 1EUTA 2YGMA 3ZFFB 1ZZ9A 1SLBA 2RDRA 3EB7A 1LENA 4KGQA 4XFGA 4PIXA 5CNAA 2RVAA 4LK6A 1W6NA 1VBC2 3H3UA 2CY6A 4WM8A
chains in the Genus database with same CATH topology
1WCDJ 1GBGA 2XGXA 2ZTNA 2JE7A 4TSVA 2GNDA 4AEDB 4XXPA 1U5XA 1V6KA 5IK8A 3WQ7A 3DPRC 2XVGA 1QJY2 2FMDA 4Y4YA 1BKZA 2ZABA 1QH6A 5T52A 4CDQA 3AMPA 1RUF1 3W9AA 1NE4A 3ME2A 4RSUA 4QPIB 3ZXJA 3D6EA 4K21A 2R063 5FLJA 3S7EA 5JZGA 3VUOA 2B8MA 5E1RA 4YVWB 1CPMA 3WUCA 4LHKA 4INDA 4WM7A 1VBB2 1AX0A 1V6NA 1FNZA 1S0IA 4H14A 1DBNA 4XFAA 3ZN6A 2VMIA 2DWRA 3ZFEC 1COV1 3AXDA 4AQTA 1ZBA2 1UL9A 2JX9A 5JDBA 5DZFA 1EYBA 4RQPA 1LKNA 1RUF3 3PHMA 4ISRA 4NR1A 2E9QA 4AFDA 1H9PA 1AUYA 4LUKA 5E89A 2RS52 3GZUC 4Y20A 4HN1A 1HKDA 2RS11 3MDPA 5AC93 2HWB1 4FPGA 1NQJA 2PAKA 2RHPA 3POSA 1DZQA 3PJYA 3AZVA 2YHJA 3M3EA 5BNPA 2GH8A 4BIFA 4IERA 1Q8QA 1H2KA 5L19A 4FAGA 3VKNA 1C8NA 4OUMA 2I45A 2RM21 4IEUA 4PLMA 4A3XA 1COV3 4K9SA 3B02A 1PMIA 2UY8A 2D93A 4GWNA 1R083 4G3YC 3D0SA 2HJIA 1O91A 4HSLA 1PGL1 1V6LA 1VRH1 4V1PA 5JMCA 2OUHA 3H1YA 2BVBA 2RS13 4LBQB 2HWB3 3DN7A 2W39A 2A71A 1LOGA 2FZ2A 1W6NB 1Z0HA 1N3OA 1SLCA 2ZHMA 3TWIA 4EROA 5ACA3 1DLLA 4CYDA 4JAAA 1LOEA 3CEWA 3ZYIB 2JG8B 2DU1A 3AYEA 1W6MA 1V9U1 2TNFA 4JDNA 5T54A 4PIZA 2RM23 3X29B 1AR61 4K1ZA 4OUSA 3S30A 4AE2A 4CDQB 3VN4A 1XQNA 5BYNA 1SBEA 1UX6A 2JKBA 4Q4Y1 1J3RA 2A6VA 1QF3A 4E27A 2R073 4RA0A 2WT0A 2VNOA 2ZGOA 4JTOA 3H7YA 4C0BA 1QDOA 4M01A 1HDKA 5JZGB 2QJVA 5FQ0A 1VBE2 4E2SA 3IKWA 4WM7B 1AR81 3WHUA 1AR91 1S2KA 3KCCA 1V9U3 2VGDA 4O9GA 3ZN6B 4Q2FA 5JLVA 4ES9A 4CP0A 3VBRC 1AR63 2G9FA 2UYAA 4MXWB 2XJPA 3VL8A 4YZ5A 4ZU5A 1O3QA 4RQPB 3NAPC 3NWKA 4Q4Y3 1LGNA 2QUOA 4Y20B 2BTVC 4E9KA 1IPKA 3FX3A 4I2OA 2QVSB 4Q0PA 1S0JA 5I91A 5K0UC 1RMU2 4QQOA 1LULA 2PHXA 1CESA 1IS5A 5BNPB 2WSUA 3PVEA 4CZSA 1KITA 3AB0A 3NVCA 1BYHA 1AR83 2ZAAA 4P9JA 2WS92 1AR93 3WW4A 2D3RA 1KD7A 2ARXA 2B46X 5DUVA 2VNGA 4FP2A 1HRV1 2CGPA 2JG9A 2B7YA 4MGKE 5GLTA 3ZSEA 2V73A 2PTMA 2VVEA 1C28A 1PGSA 1COV2 1NA1C 4JCKA 4XF1A 4LLFA 4BLJA 5K0UA 3WW2A 5BUVA 2PLV1 3LWCA 3VBFA 1AYN3 4HKLA 2XH6A 3WINE 3EQEA 5DUWA 4IEZA 1LB2A 2DF7A 2DCKA 2HWB2 1WLCA 4FP3A 3RS6A 3WVJA 5F5QA 5GJ6A 1VBA1 5JPMB 3KD4A 2MEV2 2AGSA 5ABJC 1W6MB 1YFWA 4XJ8A 1G9FA 3N35A 4LTAA 4FXKB 4DQAA 1HRV3 3VDDA 2JE9A 3E5UA 4XFFA 1JN2P 3W58A 1TE1B 2KXLA 1O4YA 4UW3A 3LB9A 1ZRCA 5KXCA 4RS5A 3TBDA 2PLV3 2Q8OA 4ASMB 1VRH2 3RJRA 1IGOA 2XJSA 3MLLA 1OSGA 5FQ0B 2BBVA 2DU0A 5KC5A 1K5MC 5CVRA 3QH7A 2BPA2 2WLQA 2W08A 1VBA3 1T6GC 1YJKA 3ES4A 2BQPA 2BFUL 3AK0A 1AX2A 2LALA 1PGW1 3SXWA 3CLPA 5T5PA 4CEWC 1QU0A 2ZHNA 3A0KA 1RUNA 4EN6B 4LHLA 1UKRA 1I1EA 1TME3 3VZOA 3D0JA 4KBBA 1QJX1 1MVQA 2ILMA 2WQZC 3IDCB 2BNOA 1RHI1 1YXWA 2EF6A 2D6LX 3VZJA 4HSJA 4ZKTB 1DIWA 4GB32 1WLTA 4U2AA 1BXHA 2ZOEB 2B9UA 1AJKA 2ZGLA 4Q26A 2UWBA 5HCBA 4CP2A 1SACA 5DZGA 3M3QA 1F5JA 2NLRA 1AXYA 2R042 3JUUA 4RGGA 3HR9A 3AP4A 2JG9B 3SLIA 1JUHA 1RJ8A 2Q0AA 1F8VA 3TNQA 4KL1A 1PM7A 5I0TA 5HCFA 1H8TC 4Q4V1 1DGRN 4IV1C 4SBVA 2ZX3A 3ZN4A 3JZVA 1PHMA 1QJX3 3AMNA 1LTEA 4LBNA 4P9XA 1RHI3 2DCTA 3VBFB 3WQ0A 2H6BA 1REDA 5FOBB 4X8NA 1OFSA 1PK6A 3LA3A 3KMHA 3NO8A 2DVAA 1GV9A 1A8MA 1J58A 5I8TA 3ATGA 2A6ZA 4XMAA 2O0OA 4XHXA 2K2SA 2P3IA 3VDDB 2JENA 4B3NA 1SEFA 4S2HA 4Y24A 1OOPC 3MIFA 5IUQA 4Q4V3 3KS7A 4AI3A 3WG4A 1WW6A 4YM1A 4BLIA 4RS5B 3NL1A 1EPZA 4LE4A 4FAHA 4IESA 1GZCA 3LOBA 1YUDA 1KFXL 2DVBA 3PVBB 2FBEA 1O3RA 1G9DA 2R16A 4R9AA 1UPIA 1VBA2 2DUOA 3JD71 1N1YA 1KS4A 2EVXA 4I30A 5J96B 2Z5WA 4Q4W1 2DYCA 1L3JA 2VW0A 3OD4A 4NO4A 3G7DA 3RYRA 1RUJ3 1PVC2 1G9AA 5L7OA 2P17A 1D4M1 2Y0OA 2OUJA 1ULGA 2VXRA 4RFT0 5CA6A 1D4VB 2CWSA 4L11A 1MEC1 1RITA 5LK5A 1HRI2 5JSOA 1O4ZA 1DGWX 2OIIA 1H1MA 3PLQA 4XIKA 4RR3C 4MVTA 4KG0A 4EWDA 1ZZ8A 1GSLA 1RUG3 4F3JA 3JD73 4W6WA 5CG9A 1FT9A 2R0HA 2CL2A 4FPKA 4D7SA 1UPSA 1DGRA 3H7JA 1GANA 5I0SA 4KU8A 5JIAA 2PHDA 2DFCA 4FPJA 1AR73 1D4M3 4YZ3A 2ZA9A 1QJX2 2ZGRA 3KLSA 1PK6B 4PIYA 1DGLA 1YIPA 1MEC3 4JGZA 5KHJA 1QHDA 1OQEA 1V70A 1W0OA 2EAKA 3PMEA 4LEJA 3HN1A 3B7MA 2X5IC 3EXUA 4HBNA 4RHV2 3ZSMA 4LUMA 4FCAA 5GLUA 1ONAA 3LAGA 5A32A 4NHLA 3ZSKA 4PDWC 3OJBA 2MPFA 4N43C 2E7QA 4EWAA 3TB0A 2C5DA 1EV11 4UBGA 2XKPA 4AVBA 1YO8A 1UU4A 2RS32 4NHMA 3LOIA 2ZJCA 1ENSA 2NZ9A 1BEV2 1CD3G 3IWZA 1NCQC 2D5HA 5KHGA 1IS4A 4KWLA 2DVDA 1AYM2 5CFDA 5GLWA 4XYXA 1BMV2 1FXZA 1W0PA 2SBAA 3SITA 1HLCA 4FXGB 3ECQA 2EAAA 3MFCA 4GIQA 1CQ9A 4M3CA 1NZCA 4AK3A 4CDXA 2DTYA 1SCRA 5J7MA 4GH4C 1EV13 5L7OB 1WLWA 4EN8B 1VAKA 3LCPA 4ATEA 4M00A 4KQ7A 3VZLA 1NCQA 3ZYJB 1CJPA 4DINB 5EV7A 1QJU2 3KCYA 3RSJA 2G4IA 4X6RB 5TSWA 3VBHC 4JC1A 2AYHA 4FTEA 4Y1UA 3FBMA 3I2DA 3P3NA 3WDXA 5HBAA 4HKOA 1Y7BA 4IEYA 4AVTA 1ZRRA 4AI0A 4Q4W2 2FMYA 4MZUA 3MF6A 4ITCA 3THTA 1PO12 5KHHA 3FFZA 5JIUA 4JGZB 2WA3A 5HXVA 1MS1A 1AXZA 3KSCA 1D4M2 1CX4A 2E7AA 3GBGA 1AL21 3MPBA 4N9IA 5CG8A 2XJRA 3ZFFC 3E6DA 1LRHA 1QXJA 1XU1A 2V09A 2ZCWA 3RQ0A 3ZFGA 1J1TA 2GALA 3OPZA 4FQZA 3HT2A 2IXIA 1ZX5A 3MIGA 1ND2A 1RUE1 2PAEA 5A32B 5KXEA 2HWC2 4AEDC 1HQWA 4IL7A 1DDLA 3ILRA 1PO21 1F2NA 2IXJA 1QWRA 4DZGA 2AH2A 1WMDA 2ZX1A 3DGTA 4AFBA 3J26N 2YGLA 1NG0A 3WY6A 4KGGA 2D3PA 2Y26A 4YGCA 1HV0A 4QPIC 4CDWA 4QQHA 3I4IA 1AL23 1WCKA 1MZ6A 1R092 3BALA 1DQ6A 3R0RA 3ZMNA 1Q3EA 4YVWC 4R9BA 1ULDA 4HVRA 5CFDB 4XEZA 5BV6A 3AKTA 1R1ZA 1OQ1A 4XJUA 3EO6A 3M2MA 1HW5A 1O3TA 1YFXA 1PO23 1LJ7A 4ONUA 4M3CB 4YZ1A 1TQ5A 1ENXA 3AFGA 5SV8A 4CDXB 4DXZA 4AHYA 2IFWA 4LO8A 2RJKA 3ZXKA 5JSPA 1UU5A 1S0EA 3M70A 4SLIA 4ISQA 4Z2WA 1TEIA 5FLHA 3WP3A 5GZCA 3AFKA 4JTNA 1N1SA 4I0BA 3N7KA 1C5HA 1NE6A 4AVVA 2VOVA 1KDKA 1TNRA 4AEKA 1I6XA 2A5ZA 3ZN5A 4HPKA 3BCWA 3MEPA 2WC2A 1R1A2 3ROUA 2UWCA 4OFGA 3KZ4C 1SBDA 5J09A 4OVEA 4QM8A 2GC3A 4L97A 3O0XA 1OMIA 2Q5TA 4IXLA 4COUA 1GNZA 1ZNPA 1G7YA 3ZFGB 5LEJA 1N3PA 4JDMA 3AYAA 2EXIA 2JG8C 1ND2B 1ENRA 4A7KA 1FPN3 1SQ4A 4CRQA 3AP6A 1HV1A 1RUD2 2WFPA 3MFAA 5KXDA 2GC1A 1QXRA 4CDQC 4YGEA 4Y5Z0 4WZFA 1LU1A 5C9AA 4QXKA 4CDWB 5C4WA 4PJYA 4YW5A 1MS9A 4XETA 3CJXA 1RB8G 2D6MA 2ZX4A 5FAXA 5JZGC 4RL7A 4ORFA 1DGWA 4KU7A 1AL22 2JG8A 3R4DB 2Z69A 4XOGA 4EN9B 3OYWA 3PNAA 4WM7C 4B4RA 4I09A 1FMD1 4PLOA 4IEXA 3D82A 4N90A 2A3YA 1WA4A 2ZAHA 1RUH1 1RUE2 3IBMA 3P3PA 2VNRA 1U0AA 2ZHLA 4XF0A 2VG9A 1D2SA 4OI1A 4RQPC 1PO22 4E2QA 4NWWA 4FSJA 3QBQA 5AC91 1BBT3 1MS5A 5I0UA 3URFA 2O8OA 3N7JA 3D4KA 4PBOA 3CJIA 1KDMA 2JEMA 4BYYA 3ZYPA 4JRAA 3DV8A 1LOCA 2QE3A 2RE9A 4MUVA 4PLNA 4C1XA 1CAVA 1YLLA 5GKAC 5BNPC 4P9GA 1SFNA 4IQPA 1RUC2 3OGGA 2YC0A 4C0HA 1J59A 3S0MA 1FMD3 4MXWA 3QOPA 1HIXA 4FBFA 1H30A 2BUKA 4HPKB 1R081 3H0OA 1RUH3 4QMAA 4AI2A 4META 1UZYA 3NV1A 3PMSA 1N1VA 4AQ6A 3M3CA 4YNIA 3RI9A 4OHZA 3B5LB 1IS3A 1NQDA 2ZBJA 4WVMA 3AZYA 5ACA1 4AI8A 3MW4A 4XILA 5JOWA 3IT8A 4COZA 3KGLA 3MI8A 3B9CA 3GBFA 2JICA 4LBQD 1ASJ1 2IZWA 2LM3A 4XJZA 1LHUA 3FUOA 1S0DA 2HWF3 4FQ4A 1ZRFA 4OI2A 1CN1A 4OZXA 1OKQA 2UYBA 3RZZA 2R071 5EYXA 4R8HA 3GALA 5C9AB 2PAMA 4AWDA 2QKDA 4P9IA 1IKQA 3WW1A 1HXS2 5C4WB 5DUUA 2WKKA 4XIOA 1QNWA 2VVFA 3U0ZA 3KT1A 2QQPA 4EN7B 2X53S 2CAVA 4MGZE 2XLGA 2YY1A 2WA4A 3N3HA 3OYWB 1GQHA 2WQ4A 1I9RA 3C2UA 1HX6A 4IEPA 3RPQA 1QH7A 1ASJ3 4QX5A 4XBNA 4LBKA 5GZDA 1OLQA 2RR11 4JRLA 3BODA 4Q8KA 2DUQA 3BPZA 4CEYA 5K7PA 4Z1VA 3E5QA 1C1FA 1ZZ6A 5C8CA 2YZ4A 4OHYA 1A3KA 3CJIB 3KCXA 1ENQA 3A4UA 2R062 1CAVB 4I3PA 1GR3A 1VLNA 1SCSA 3AYDA 3OD0A 5FREA 4NVPA 3SCHA 4JGYA 1QXPA 4LBMA 4YGDA 3TRSB 1QOOA 4JVAA 2NMOA 3KQRA 4MV2A 4B4QA 5BNNA 1DQ2A 2RR13 4MGYE 1LEDA 3V0AA 4KG8A 4LBOA 4LLOA 4R9DA 4EN0A 2WZR1 2GDFA 2JG9C 1ZBE1 4FTBA 2GU9A 3GBWA 1HQLA 2DFBA 3MYXA 3VV1A 1RUF2 1TMF1 4GMP1 5FRAA 4IEQA 1AYN1 2CTVA 4UXAA 1PVXA 4ZU4A 3IPVA 3VBFC 3ZX7A 5AC92 4WVMB 1ZREA 3ZSLA 2WT1A 1VALA 3VBUB 3KT7A 4HKWA 1JTZX 4UW6A 5IK4A 1N3QA 3T1LA 4Z92B 1DZTA 3O12A 4BH9A 1XE7A 2WNUA 1J3QA 2ZKLA 3ZYGA 2XBO1 5H9PA 2WZR3 2PELA 3VDDC 2SLIA 2HWD1 4COYA 1ZBE3 5EXOA 1R082 5E8AA 4ATFA 1C1LA 1TMF3 1ND3A 4GMP3 2MNGA 5JR7B 2VY0A 1WLDA 4XF3A 2XLAA 1B35A 4LO6B 4Q8LA 4Q29A 3ETQA 4RS5C 2RS12 4QT6A 4AVSA 4QM9A 1X8MA 1CVNA 3ES1A 3HBZA 2P34A 3AMHA 4N9HA 3MGUA 1NCRA 5ACA2 4DOUA 1WUVA 3ZXAC 1LEMA 3RWNA 1UIKA 3GZTB 4Y1VA 4AVAA 4XQDA 2XBO3 2GNTA 1B09A 2PA7A 3J8F1 3WD5A 2RM22 1ASJ2 1XNDA 1TME1 5LEKA 2HWD3 5A33A 4CEYB 1JYCA 3AKRA 5FO7B 1QGLA 3EJKA 5DUXA 4Y1XA 1LHVA 5C8CB 4FOQA 1SLTA 2OZJA 1PGL2 2A7AA 1S0GA 5C8WA 3JB8A 2R072 4K7JA 4COWA 2F4PA 2HWE1 4BMBA 3S6PA 1XU2A 2PHLA 1EAH1 1FV3A 4JGYB 3LZZA 3QLQA 2A6YA 3JQWA 4FPOB 1OA3A 3B93A 4J1WA 4YVSA 4XFHA 2PHUA 2PN5A 1Z7S1 1VBD1 5BNNB 5JOZA 1V9U2 2TBVA 4XQWA 5T50A 3V0AB 3J8F3 3AKSA 1A78A 5CADA 1AR62 3ZDSA 3W59A 1JBCA 4FPCA 1Q8PA 1X50A 3MLJA 3AP9A 3FUQA 4Q4Y2 1SLAA 4OI4A 2K0GA 4YM0A 5FLIA 1LOAA 2HWE3 3IPVB 2RJLA 3MZHA 1A6CA 4LNVA 4FOWA 4YW3A 3FLPA 1S1AA 4LO7A 1PK6C 2H0VA 3FE5A 3R6SA 1EAH3 2ZGKA 4XFBA 4YM2A 3R4UA 1LOFA 4HFSA 5H9RA 1AR82 2ZGNA 1JH5A 3KT4A 1AR92 3AMQA 1Z7S3 4M0NA 1VBD3 2WNUB 1FX5A 1BVP1 3SH3A 4YW2A 5FO9B 2VMGA 1BVVA 3WG2A 3ASIA 5KC6A 4O9EA 1ND3B 2W68A 3M4FA 5EJ3A 1B35B 1ZBE2 1BQPA 5JOXA 3WR0A 4EV0A 2XL9A 3SHRA 3KM5A 4BMEA 1DQ4A 1PZ7A 1AYN2 3PVOA 4QU2A 4K40A 1UU6A 1PZ8A 1QDCA 4CTEA 5IK7A 1NCRB 1VR3A 1W6OA 3RMYA 1O3SA 4AW7A 4R4ZA 2ET7A 2VECA 2QCSB 3NKGA 2ES3A 1JYIA 4UBHA 1HRV2 5A33B 1XYOA 1CPNA 1JHNA 1EPWA 1RUJ1 2WFF3 2OPKA 1MR5A 3WDUA 1YYNA 2FHRA 2VPVA 3FLRA 4LR4A 3FJSA 1I5ZA 1MS3A 5L7OC 3AZWA 3E6BA 1DZRA 2IXHA 2PLV2 5J36A 2AR6A 2WNVA 2Z42A 4DFSA 1KRIA 1BCXA 4YZ4A 4G9SB 3SH5A 1RUG1 2CWMA 4PF5A 4YVSB 2GH2A 5E88A 1FYUA 4B8EA 1YNAA 1RIRA 2YROA 2ZPXA 4DMIA 1QOTA 4MXVA 3VZMA 4BOWA 3R4SA 1AR71 4GA9A 1TME2 2NPIA 1QJZA 4NN0A 1GFF2 4QPGA 4QD2A 3SNMA 4CDUA 2E63A 1O5LA 3WCSA 1POV1 3IDEA 3ELNA 3N36A 4JGZC 4WVWA 1CIWA 2UWAA 4E4ZA 1Q8OA 3QACA 3ENRA 4QQPA 3PTYA 1PIV1 1PGW2 2IXKA 2XG3A 3BOPA 2D7FA 1X8EA 1U5IA 4KH9A 1Z7S2 1VBD2 1XXNA 3TN91 4AFCA 4L92A 1WW7A 2XVLA 4LBLA 1RL3A 1DHKB 4J6GA 1RC6A 2DTWA 3B00A 1RHI2 4BIOA 2UU8A 3VBOA 1Q56A 1POV3 1V6JA 3UKVA 4AQ2A 2BW8A 2XJVA 4OULA 2R49A 5SV5A 1W6OB 1YI7A 5CIRA 1XNBA 2GZWA 1PIV3 3OF1A 1ULCA 2G9GA 2E7TA 5CFDC 3FC0A 4DPNA 4QQLA 4DY3A 3RJ2X 2XB6C 2YXSA 1REFA 3DKWA 2R1DA 2B45X 3TN93 2GMEA 4YYOA 2D43A 4Q4V2 2LTNA 2ZMNA 2FZ1A 4CDXC 1ZZ7A 3DL3A 3ACLA 1J3PA 2B39A 5DG2A 2DCYA 4N7UA 4N7IA 4YGBA 2WNVB 3K51A 1VB4A 3T2TA 2BWAA 5JOYA 3JBG1 3J9SA 3M7AA 1CR7A 1W6QA 1ZZBA 1V6MA 3LSEA 1Q8VA 2D6PA 3SISA 1REEA 4I01A 1DFQA 3CNAA 4K8FA 5FDBA 3NKTA 2WIIB 2AUYA 3RYKA 5BNOA 4P9LA 2JECA 2BWCA 4QPGB 5AFBA 4CDUB 1ULFA 1RUJ2 2D98A 4QGNA 1NLRA 5GLZA 5JI7A 1QQP1