5T3NA

Sp-2cl-camps bound to pkar cbd2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
HHEVLFQGPGAKKRKMYEDILSHVNILKDMDPYERCKVADCLKSKSYNDGEIIIKEGEEGDTFFILIDGNAVASKDNKVIKTYTKGDYFGELALLKNKPRAATIKAQNFCQVVYLDRKSFKRLLGPIEDILHRNVENYKKVLNELGLDTTCID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords cAMP-dependent protein kinase regulatory subunit
publication title Disrupting the Allosteric Interaction between the Plasmodium falciparum cAMP-dependent Kinase and Its Regulatory Subunit.
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
total genus 41
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2016-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t3nA00
1CAUA 1OMIA 3M3IA 4I2OA 5I0RA 4META 3BU7A 5J7MA 2CGPA 3LA3A 4EROA 4ONUA 4QX5A 4OFGA 5FLIA 3I54A 5I8YA 4BH9A 1EYBA 4LUKA 2QDRA 4ZU7A 4LLOA 4I3PA 3QOPA 4IEZA 1XE8A 3NSTA 2GC3A 3U11A 2PFWA 5BV6A 5CU1A 4FAHA 4KU8A 3HT1A 2OA2A 1UIKA 4E2SA 2WC2A 3D0JA 2CAUA 3IDCB 1L3JA 3SCGA 3I59B 4IEQA 1RTVA 4XFCA 2BGCA 3GYDA 5I8TA 2D5FA 4HMZA 4Q0QA 3H50A 1RUNA 3LWCA 2PYTA 1VP6A 1PMIA 3HT2A 3KSCA 2CAVA 1O5LA 3WW1A 4QGLA 1Q3EA 3UKTA 2PQQA 3ELNA 3GBFA 4NVPA 2H6CA 3EQEA 4YSFA 4E2GA 2GC2A 4XF4A 4FBFA 3WW3A 3ACLA 2BNMA 1EPZA 3PVBB 4XFFA 5AVPA 1FXZA 4QGMA 3FWEA 4LUMA 5KHIA 3OCPA 4IEYA 4X6QB 5BPXA 1ZZ6A 3QACA 1RUOA 2PHLA 3CF6E 4O9EA 4QXKA 4AQ2A 1V70A 5HI0A 2CV6A 2IXHA 1ZREA 4MGYE 1ZVFA 4JV4A 2H6BA 4XFGA 4MGKE 5T3NA 4MGZE 2XL9A 1RC6A 3LZZA 5I8SA 4F8AA 2GU9A 4GULA 4Q0PA 3E5XA 4BIFA 5FLHA 2UYAA 1LKNA 5EZWA 1YFWA 3CJXA 1ZNPA 3SHRA 4X6RB 1NE4A 2XKPA 3CEWA 2XL7A 1QXRA 3U10A 2ET7A 1XRUA 4PJYA 5K8SA 4UXAA 5I93A 4EWEA 5FCCA 1XE7A 4IEVA 2PTMA 1DGWA 1X82A 1SQ4A 2MNGA 3FZ3A 1I5ZA 2OPKA 3BCWA 4ZU4A 1SFNA 1X7NA 4O9GA 4UBHA 3RDIA 4MV2A 1IPKA 1VR3A 3B02A 3WW4A 2DCTA 1OD5A 1VJ2A 3I59A 2GAUA 3OD0A 1ZZCA 2Y0OA 5JSPA 3C3VA 1O3QA 5JSRA 4WVZA 5BXXA 2EAAA 3H1YA 1J3QA 4YRDA 1Y3TA 3M70A 3PLQA 4IEPA 1RGSA 4IERA 4XF9A 4R8HA 1ZZ8A 1CAXB 2H0VA 3ES1A 2GC1A 4KL1A 1TQ5A 3SCFA 3H1WA 1ZZBA 1GQGA 3H7JA 5I91A 1J3PA 4YNIA 2PHDA 5CADA 1J1LA 2BNNA 3NKTA 1ZRFA 4J1XA 1PM7A 2BNOA 4MGIE 4Q0UA 3MDPA 3LA7A 4XEZA 3H8UA 3NVCA 3FHIB 2ZCWA 4MZUA 1ZX5A 2B8MA 1O4TA 3USSA 2GH2A 3D0SA 4PIZA 3ROUA 2HJIA 4IEWA 2QNKA 2ETEA 3E5UA 3IBMA 1UD1A 3N4MA 1WLTA 5CVRA 1YLLA 4OLLA 3RPQA 5LEKA 4I09A 4TLFA 1J58A 3BPZA 3ES4A 4AVAA 4YARA 1CGPA 1U12A 4BHPA 3TNQA 3ST7A 3RYPA 1HW5A 2XKOA 5FDBA 4LULA 3R6SA 3IWZA 5FQ0A 2FQPA 5C8WA 4AVCA 4JTNA 4I01A 5FPXA 5I0TA 4IEXA 2IXCA 4MH0E 3RYRA 4BYYA 2EA7A 2V09A 3RZZA 1NYWA 3DKWA 1J3RA 1FI2A 4HN0A 2GC0A 4MUVA 1CAVB 3PNAA 4KU7A 4PIXA 5C6CA 5KHJA 3LA2A 2PA7A 4E2QA 1QXJA 5KHGA 3RYKA 3JZVA 4HVOA 4XF0A 1FT9A 3E6BA 5F1RA 3E97A 3H9AA 2K9ZA 2UY8A 4KWJA 1H1MA 2MPFA 4HN1A 1CAXA 4KWLA 4QGNA 5JAXA 5E16A 4EV0A 2Q0AA 2IC1A 2OYZA 1WA4A 3VHRA 3H3ZA 3EBRA 2Q30A 3IIAA 4YYOA 3H3UA 4A2UA 4Z82A 4J1WA 4XETA 4QM9A 2Z2SB 4ZU5A 4EWAA 2P17A 4AVBA 2E9QA 2PAKA 4FT8A 1CX4A 2KXLA 1YUDA 2BEOA 2IXIA 3EO6A 5I0UA 1J59A 1ZRRA 1YHFA 4QM8A 5J48A 2OZ6A 1Q43A 4FAGA 1ZRCA 4L11A 3O14A 3I7DA 4KWKA 5I0SA 4CYDA 3CLPA 4B29A 3TNPB 4EWDA 1OFNA 4XFIA 3EJKA 4LA2A 3KGZA 2O1QA 3NJZA 2GZWA 1YFYA 3D82A 2K0GA 3BALA 3S7EA 3KGLA 4ORFA 2QJVA 4R52A 5BY5A 3E6CC 1WGPA 3SMHA 3KMHA 3RNSA 2VECA 5KBFA 4LTAA 3LOIA 3MZHA 1DZRA 3CO2A 2ZKLA 4IEOA 5LRRA 3L2HA 2EVXA 4AXOA 5J3UA 4JTOA 3NW4A 3FX3A 1YWKA 3ETQA 4WZCA 3DV8A 2ET1A 4I02A 4XFBA 1SEFA 1EY2A 1GQHA 4LA3A 3UKNA 1CAWB 1CAVA 2C0ZA 1ZRDA 3MPBA 2XHKA 4LEJA 1NZCA 3NL1A 4Q0VA 4HVRA 1RL3A 2XLGA 1H1IA 4WBBA 3ZDSA 4QMAA 1JUHA 4IESA 4Q0SA 1CAUB 4IEUA 3IDBB 2I45A 1O3RA 4XFAA 3DL3A 1X8MA 1UW8A 2F4PA 2XLFA 4XF1A 4Q29A 2O8QA 2Q1ZB 5FLJA 1LB2A 4JVAA 2XGXA 1LRHA 5BUVA 3U0ZA 4N9IA 4UBGA 3HQXA 4IETA 1O3TA 4H7LA 2Z69A 3UKVA 3CL1A 4HSLA 3FE5A 2HKXA 2QVSB 5LRSA 4RD7A 5EFUA 5JCTA 1ZZ7A 1YFXA 4XFHA 1Y9QA 4P9GA 5JR7B 2PAMA 1DGRA 1Q5OA 2IXJA 1UIJA 5E1RA 5LEJA 5FPZA 3S0MA 1OI6A 3WW2A 2MHFA 3BB6A 2VPVA 5D1IA 3OGJA 4AQ6A 4Z07A 4D7TA 2BYVE 4K8FA 4PIYA 2B9UA 4HBNA 4N9HA 3H1MA 4HSJA 4D7SA 3KCCA 3SXWA 4I0BA 4DINB 1LR5A 2UY9A 2WFPA 2UYBA 1QWRA 2Q4SA 3E5QA 5FQ0B 4HZFA 1QY4A 2XLAA 4HLTA 2PAEA 5KHHA 2D40A 3OTFA 1NE6A 2QCSB 3S7IA 1O5UA 2D5HA 3LAGA 5JSOA 3HIFA 5KHKA 3FFQA 1UCXA 1YFUA 2VQAA 1NXMA 2N7GA 1EP0A 4XF3A 4L2NA 2IXLA 4F7ZA 2ATFA 1O3SA 1O7FA 1ZZ9A 1CAWA 2OZJA 3E6DA 1X8EA 1G6NA 4HVQA 1IPJA 3MYXA 3SCHA 3OF1A 1DZTA 2B5HA 4MX3A 3G7DA 2IXKA 1I6XA 3EHKA 3H7YA 2FMYA 3FJSA 2D93A 3DN7A 1UPIA 4I0AA
chains in the Genus database with same CATH superfamily
1CAUA 3G6JB 1AR91 3ZN4A 1U5ZA 2GNTA 3I2DA 3RG0A 4C90A 4DXTA 1ULGA 3FC0A 2ADDA 2YC0A 2BFUS 2EIEA 3LA3A 4EROA 2ZX2A 4ONUA 4YZ3A 1XU2A 4XZPA 5G04L 1LENA 1QDOA 1NX9A 4LK7A 5FLIA 1EYBA 3R4UA 4FP2A 3T0AA 4UW4A 5JPNB 1W3VA 2ZGUA 4URTA 4XPVA 2JG8B 3CMGA 5ABJC 4IEZA 5C4WA 3AKRA 4YZ4A 1W6OB 1W6NA 2Y0IA 5FXZA 3HT1A 5LB6A 1UIKA 3I3BA 1J1TA 1JYCA 1WWYA 5HXVA 2WC2A 5E89A 2ZGLA 5FZMA 3WVJA 1RVF3 2Z5WA 1NXD1 3I2JA 1L3JA 3IDCB 3NJYA 1DCSA 5BNPA 4UFJA 5FZCA 5FTTC 3B01A 4AEDB 3SCGA 2AACA 4ARXA 5A6QA 1ZA7A 1V9U3 3ZFGA 1TME2 3FL7A 5GM0A 4X8NA 1RTVA 4TZDA 3C7FA 5LBBA 3WCRA 3BTXA 3UGHA 3C2UA 4L92A 1HV1A 1IQDC 2ZGMA 3ACFA 4YW4A 1LEMA 4HMZA 3WSOA 5JMCA 2CSGA 3R05A 3AZYA 1WMXA 2JDNA 3TEXA 3IM0A 1JZ8A 5A1LA 2DWRA 1V6IA 5JZGB 2A73B 4D6RA 3WP5A 1S0JA 5K0UB 2PYTA 1AXYA 1O5LA 2PMWB 1XYNA 2XWJB 1OPMA 4QGLA 1Q3EA 1SBFA 3NJXA 4MO3M 2XBO2 4LLFA 2L9LA 1QH6A 1S0GA 3I97A 3EQEA 3VL9A 1AL22 3OPTA 4U2AA 1AUYA 2GC2A 4BMBA 5H9RA 1ENRA 4E2GA 4YSFA 2VCAA 1CPNA 1QJX3 3B9CA 3GZAA 4MVTA 4BXSV 5FZ1A 1QXPA 4OZXA 3ACLA 4XDQA 1EPZA 3GCXA 4Q4W3 3HN3A 4LUMA 3OCPA 2WWSA 4LOTA 3CDZB 4NHYA 2A70A 1WBFA 3A23A 1S0IA 4ZY9A 3ZKYA 5A6XA 3HBKA 4K3UA 5GLVA 5HCBA 4N43B 5FKCA 3GF6A 1ZBA3 1VE0A 4HK9A 3VBSC 4JKKA 3LQCA 4K40A 4MGYE 4SBVA 2HWD2 4JV4A 4CCKA 2H6BA 1ZRIA 1GP6A 2RS31 4GMP1 2VH9A 4MGZE 1RC6A 4YVSA 5T3NA 5EPAA 3MEPA 2A3YA 2GU9A 2JDZA 4XUTA 1YI9A 5C3QA 1A78A 3WP3A 2UYAA 4MHUA 2VMDA 5GZGA 1BXHA 1LKNA 1L7RA 1VBD2 2HWF2 3BU0A 2QUOA 1RUE1 4BQ1A 3FFZA 5FP8A 2FHRA 3CJXA 1IZ3A 3SHRA 1ND2B 1W8UA 5F6KA 3SEEA 3VKFC 2VZ3A 2W94A 1OD3A 3THCA 2GMMA 2XL7A 2Z42A 4AWDA 3N7MA 2GN7A 1H4GA 4AR2A 1RUG1 3PMSA 4LKDA 2FMDA 3TN91 5F6LB 1H9WA 4UXAA 2R7EB 3R0RA 2VW1A 4FO9A 1X82A 1FV3A 3PVOA 4Y1YA 1ULEA 1JOBA 2YG0A 1SLTA 2P1BA 1W6OA 3O0XA 1OBNA 5FUNA 3TEWA 5A3WA 4NE9A 1YC61 4FVVA 3GZEA 5GLZA 3WW4A 2DCTA 1FATA 3NMBA 1VAKA 4AEDA 1W9FA 3N9MA 2ZACA 1W2TA 1YQ6A 4UOJA 5DABA 1O3QA 2WA4A 2Y64A 3BOPA 4AEJA 5JSRA 4CXWA 2CL2A 4BPZA 5C7GA 1HRV2 1J3QA 2R041 4XXAA 1QJY3 4R4ZA 4CZSA 4CUAA 1RUI2 1W6PB 1OQEA 2C9KA 2VQ0A 2X8KA 3M70A 4XCBA 4AAPA 1GZ9A 4OHYA 5JZGA 5JR2A 1IGOA 1ZZ8A 3E1F1 2OVUA 1BJQA 1RUD2 1XBFA 1HIXA 1LEDA 2GC1A 3ZSKA 1RUJ3 3PJYA 1WLCA 1GQGA 3H7JA 2ZGPA 4LO5B 3ZSEA 1OUXA 4D0QA 1NKGA 1YJKA 4MLOA 3WNPA 1OLMA 1PVC1 3PVEA 2GP5A 2BDRA 1J3PA 5EJ3A 3P5BA 5IVYA 5CADA 3M2MA 4COVA 4CCNA 4D8MA 3GJBA 5FJHA 2A5ZA 4FTBA 3WP4A 5A7NA 1PK6C 2BERA 4MGIE 1KDKA 1JI6A 1MZ6A 1TEIA 3ACGA 1K45A 5DN2A 1CN1A 5H9PA 1YRZA 2B4KA 1RHI1 1MVQA 4FI9A 3NVCA 3PIJA 4MZUA 1F5JA 5CISA 3N9QA 2B8MA 1O4TA 3HOBA 3KV9A 1QJFA 4N43A 4UI9L 2EALA 3USSA 5CNAA 5DUXA 1TMF3 3VZOA 3T4HB 2ETEA 3WXPA 1O59A 5FZBA 3E5UA 3HN1A 1K5MC 4O65A 2PHXA 2R0FA 4YZ5A 2P3KA 4RN5A 4S2DA 1VBC1 2E6VA 3AK0A 4XW3A 1UD1A 4XYXA 4AHYA 3MIGA 1PHMA 1YLLA 3RPQA 1OQDA 2AENA 2ARAA 2Q8DA 2Q5TA 3BPZA 3ON7A 4FPEA 4MGSA 5FZGA 2ZA9A 5DAXA 2PHWA 5T54A 4CA9A 1VBB1 3I2KA 2ZMNA 2FDHA 1RVF2 5F2WA 5EV7A 5FDBA 4CU7A 5FV3A 5FQ0A 3GZTB 3O12A 3PJQA 4AVCA 4TXWA 2JE9A 1CJDA 2YU2A 2Q8OA 3VBHB 1V9U2 2DUQA 3FUOA 4AL9A 3BODA 1REFA 4EN6B 1X50A 1W6MA 4DB5A 2IXCA 4MH0E 5F3EA 2D98A 2DBNA 1MS4A 4BQ5A 4AZZA 1G7YA 1MVEA 2CGNA 2WNUC 1K42A 1NYWA 4DY5A 4Y5Z0 4SLIA 3F95A 2WNUB 2ZKNA 5T5PA 2WT0A 5A7SA 3THPA 1CAVB 2BBVA 3N35A 4A45A 5B4NA 1H6YA 2MEV1 5C6CA 3NV2A 2W3JA 4OYUA 5KHJA 3WLUA 1QEXA 1EUUA 1QXJA 2BWAA 1W04A 2ZGSA 1AXKA 1W6PA 2YV8A 3RYKA 5F7UA 1F35A 4XF0A 1FT9A 2XDVA 5F37A 3E6BA 2ZHMA 1WCKA 5F1RA 4AGGA 3IB3A 4KWJA 3LF7A 1JYIA 3FBMA 2J42A 2KA3A 4KWLA 4XMAA 1C8M3 3Q8AA 5F3IA 1R091 2BQPA 3RS6A 2ZZQA 4MSVA 1WUVA 3LEIA 5SV8A 2OYZA 1MZ5A 3K4AA 1X9PA 3EBRA 3J8F3 3IIAA 1Y4WA 2XJVA 3EXUA 3H3UA 1KJLA 4Z82A 3U07A 4WVWA 1ZBA2 4JGYC 2DFBA 1IKQA 4XBNA 1PO23 2PAKA 4S2FA 3ZYIB 3NV3A 4FT8A 1CX4A 4GWIA 2GMEA 2ZEWA 1GOGA 2IXIA 4Q4Y1 4UFKA 4NROA 4QM8A 4WVMB 5BNOC 1EAH3 3VBRB 1UKGA 1ZRCA 3ZSJA 4A44A 4LHLA 1RUF3 1GZWB 5HCHA 3K46A 1OQ1A 1S2KA 1HQWA 4LKSA 1A8MA 5A6ZA 3CNAA 1DDLA 4JGZB 1F8VA 2B42B 1UU4A 4IE6A 4W4ZA 4OQ8A 3ZXGA 3GDBA 4NHXA 1GP4A 3TNPB 4EWDA 2WSUA 3IN9A 3LDRA 2WT1A 1UMZA 3KM5A 2JD9A 4LA2A 3ZM8A 1BMV1 1TE1B 3MGUA 4ET7A 1KGYA 1K12A 3NJZA 4DNYA 3PIGA 2A7AA 4EN8B 2W52A 1IKPA 3BALA 2FDFA 3B5LB 3TAYA 2VW0A 1PMHX 3UYJA 4R52A 4EJRA 5FO9B 1NLSA 5FPVA 1WGPA 4BQ2A 4CEWC 1AZDA 1AHSA 1S0FA 1APNA 5DG1A 4TLGA 5CEHA 2DF7A 2VECA 1OPOA 3AJYA 5T55A 3W58A 4D69A 3LOIA 4B7EA 3HEIA 3VBHA 3CO2A 5HV4A 3H8OA 2ZKLA 1ST8A 1ONAA 2QZ3A 5DUUA 2EVXA 4XDOA 1QIQA 1CD3G 4YM0A 1VALA 1QJY2 2EF6A 4XJWA 2AGSA 5J1XA 1YWKA 2WNOA 3WP6A 4COUA 3O1UA 2CWMA 3DV8A 4LBOA 5FBZA 4XFBA 5DUWA 3NO8A 4GD4A 2WNUA 1GQHA 4CU6A 1ULDA 5AFEA 2VOTA 1C1FA 1AR61 1RUJ2 1W6QB 1CAVA 2YDEA 3A7QA 2J1EA 3CU7A 3RMYA 5IFTA 2VMIA 2XHKA 4RL7A 1JOPA 4LEJA 1S0DA 2E7AA 1AR93 2JKBA 4TSVA 1BVVA 5HXMA 5I0DA 3K2OA 2XJUA 2VCBA 3ZDVA 5BYNA 1HN0A 2LW8A 3ZLIA 2O0OA 3T2TA 2W0XA 3WNOA 2VZRA 5FXXA 4XJZA 3WOGA 3VBOC 3LDBA 3IDBB 3IMNA 2AZ5A 5GJ6A 2JB8A 2XMLA 3AYDA 1O3RA 2WAOA 4XFAA 4Q4X3 1WBLA 3VBOB 1UW8A 2VJXA 1SZBA 3C7GA 3T2PA 4EN0A 3W5NA 1OF4A 5LBCA 1ASJ1 1H8TB 1Z78A 3VHOA 1I1EA 3U0ZA 5GLTA 3HMYA 1RMU1 1TMF2 2GP3A 1UMHA 3AP6A 4IETA 2GN3A 3ZR5A 5J98B 5LA9A 3SKVA 4AFCA 2DU1A 4XJUA 2XJPA 4Q1PA 1C57A 1TVGA 2HKXA 3MIBA 4Y1VA 1A3KA 1R1A1 4OMCA 4RD7A 4K8RB 5HV0A 4O7XA 5LRSA 2HLEA 2P5BA 1C28A 4WVMA 5JCTA 1ZZ7A 5FYCA 3ZYJB 5KWRA 3VBRA 2ZXQA 3UESA 3WDXA 1OSGA 1UY3A 3J4UH 3POWA 3TEYA 1GZWA 3DGTA 3BVCA 3KF5A 3NAPB 3OEAA 5JR7B 4NUBA 3TB0A 3S5QA 1BK0A 2IVJA 4K1ZA 2P3YA 5ERLA 4JX0A 3VLBB 1AJOA 4JGZA 4LR4A 4KH9A 2PHRA 1VMFA 2VBBA 3APBA 4F83A 3ME2A 1FMD1 2MHFA 1JYVA 2VPVA 1D4VB 4CXYA 2UWAA 4LT5A 3SQOA 4B3NA 5FPAA 1J84A 2VZOA 2ZHLA 4IV3C 3ZN5A 4OHXA 4A6SA 2B9UA 4P00B 1W8TA 4FPOB 4HBNA 4OUEA 4IV3B 3ZOIA 3WG2A 3ECQA 4UFLA 1HKDA 3MLLA 3X29B 4OI4A 5F2SA 5A70A 2WZR2 1JU4A 4NHMA 4I0BA 3O1RA 4BXFA 2WIIB 2XJRA 2UY9A 1LECA 4CEWA 1JZ4A 1NUKA 4I30A 1O4ZA 5FY1A 2Q4SA 1NY72 2V73A 3VBFB 2EXKA 2ZX3A 4BQXA 4Q5OA 4K1YA 1TNFA 2W1QA 4XQDA 3MI8A 4BZ4A 4TYSA 2XLAA 3ALQA 2J7MA 4HLTA 4A3ZA 1ODMA 5AC91 2PAEA 1DQ5A 3I2IA 2VTXA 3P3PA 1PGW2 2I07B 2QCSB 3OEBA 1OXCA 1BVP1 1GYKA 3J7LA 5KHKA 1XNAA 1UCXA 4YW2A 1MS1A 4GMP3 5C3SA 2VQAA 1JZ2A 4XCAA 5FOBB 5T5LA 4F7ZA 1C8M2 1JZ7A 1O7FA 1W6QA 3MPPG 1X8EA 1IOAA 3ZXFA 1IPJA 1RUE3 1REDA 3J8F2 4AK3A 1FNYA 2Y6GA 3OF1A 1DZTA 4IGOA 1CIWA 5JOXA 5EJZB 4NHLA 3WQ1A 2OIIA 2UU8A 2WBKA 4MX3A 5LW9A 1PO22 4CP2A 1REEA 4HKOA 2A6ZA 2RS13 3LE0A 4A7KA 4XJ8A 4ZU7A 1OMIA 3M3IA 4AI2A 4BISA 4META 3POJA 3BU7A 1UWWA 5J7MA 5JOWA 5L36A 2ZHKA 3VBOA 4NOTA 1DGLA 1EAH2 1MACA 3POEA 3AVRA 4ARYA 1RUF2 3DUIA 4BH9A 2WINB 2QDRA 3VKNA 2PXJA 4ZPIA 3RVHA 1HXS1 1SLLA 2DV9A 1XXNA 2WO1A 2VG9A 4FFFA 2RS51 5C5UA 2GC3A 2DVDA 2PFWA 4YLZA 4AI1A 2P2KA 5C3PA 2UURA 2VQUA 5CU1A 4G9SB 4CSWA 4IW3A 4FAHA 4BU2A 2BGOA 4B7KA 1D2QA 3AYEA 4JCKA 5A3NA 2YXSA 4QPIC 4BJ0A 2VBPA 2R043 2PQSA 5JMOA 4DRVA 1W90A 3VGIA 4E4ZA 3I59B 2WDBA 3NAPA 3PUIA 1E5RA 2D43A 2J1TA 1S55A 4LHNA 4IEQA 4FQZA 1WMDA 3QD6A 5F5QA 1LAJA 2XJSA 3GYDA 3WCSA 3POBA 4NIAA 1AX1A 5KR7A 2D5FA 4YG0A 2QBXA 3H50A 2ZX0A 1JYXA 1QJU2 3CQOA 3D6EA 4UW6A 3LEMA 1XNBA 1MQTB 1PVC3 3AZWA 3HT2A 3KSCA 1F5FA 5IAXA 1ULOA 1BQPA 4IV3A 4LBMA 4ASMB 3AP4A 1V6KA 5FZ0A 2Y33A 3UKTA 3URFA 2PQQA 5EYYA 1DGRN 2YGMA 2CDOA 3POFA 5C71A 4XF4A 1RHI3 4FSJA 4UW3A 2WO2A 2AUYA 4LKEA 1CIYA 2DCYA 3T08A 5GLWA 3AKSA 5A80A 2I2SA 1SLIA 1XSQA 2BTVC 2YYOA 2CYFA 1FXZA 3PVBB 4QGMA 4WM7B 5AVPA 4G3YC 5KHIA 4MGTA 1AR92 3ZFGC 5ACA1 3THDA 4RFT0 2GALA 1HB1A 4DO0A 4FPJA 1RUOA 4DY3A 2PHLA 3CF6E 4O9EA 1OLRA 1LGBA 3VN4A 2X5IC 2ZEZA 4QXKA 5KXCA 3CIHA 4KG8A 3MLJA 1C3HA 3DEMA 2JB4A 4FQ4A 5H9SA 4Z1VA 1VBC3 3N7LA 4DZGA 2FDKA 3H0OA 4B8EA 3VDAA 4Q4X2 5C33A 1CPMA 5DG2A 3AL6A 1Q56A 1WCUA 1Y7BA 1SDDB 4QQHA 5IVCA 1ZREA 1DG6A 1O8PA 2K2SA 4XFGA 3WDYA 5EWSA 5FXWA 2XL9A 2A3XA 4N7IA 1XU1A 3LEGA 4YG6A 1GANA 5I8SA 3WDUA 3OGVA 1HB2A 4JAAA 2J1AA 4GB31 1X36A 4Q0PA 3Q8CA 4FPCA 4BIFA 2XVGA 4L99A 3AP5A 1Q8OA 2VCCA 5EZWA 2X29A 5EXOA 1QOSA 1YFWA 4ASLA 1XOYA 2JIJA 2DVFA 1ZNPA 2XHNA 1S2EA 1JYNA 1MEC3 4BM8A 1EUTA 1N1SA 4N53C 2DUOA 1KRIA 1JTZX 4ES8A 1SLAA 4DEQA 1A34A 2VE1A 4N53B 3U10A 5LA0A 3M3EA 1XRUA 4QXCA 5K8SA 3WF4A 5FCCA 4Y22B 4E8DA 5A1FA 4KBBA 3D8CA 3IIIA 2DBIA 3FZ3A 1WW6A 4QDRA 1AX2A 1UX7A 2CU5A 1PIV1 1SDWA 1W99A 5CKMA 3AC0A 4O9GA 1X7NA 4UBHA 2WLQA 1AR83 4F3JA 5JWPA 1VR3A 3ORJA 5GZEA 1ULPA 2OQ6A 4TWTA 3I59A 1RITA 1MS8A 2Y0OA 3LB9A 1VRH3 2ZOEB 3NNMA 2IFWA 4P14A 2HEWF 5BXXA 3V0BB 5CKNA 5A7WB 4XURA 1Z7S1 3FHQA 5E8AA 1Y3TA 1W2NA 3H8RA 3K4ZA 4QQOA 3T1MA 1LESA 3CBNA 4AHXA 1HDKA 4IERA 4FCAA 4XF9A 3N9OA 2BFUL 4R8HA 4FP3A 4DEVA 1RJ7A 1MQTA 3SH3A 2AH2A 2H0VA 5C8CB 4W6YA 1GWLA 2DTWA 2JG8C 4KL1A 2FBEA 3KT7A 3T2OA 2RMU3 3RJRA 5EHDA 1GMMA 3JBG1 2W87A 1DF0A 4NO4A 3IPVB 2BOJA 3LD8A 2W9XA 5I91A 3WZ1A 4YNIA 3M8LA 3OJBA 4Z92B 3H3LA 1JU3A 1VBA1 2EXIA 2JICA 3N9NA 3QBQA 4GKYA 4XBLA 4J1XA 1NA1B 1K3IA 2BNOA 3HNMA 1XNCA 4Q0UA 3POSA 4WM7A 1RUE2 4AEDC 4AHWA 3MDPA 2VNGA 3JD71 3OPWA 4HANA 1AX0A 4XEZA 4K20A 2VUCA 3FHIB 1W8NA 3A0KA 4Y20A 1AR73 2ZAAA 2RS12 2VD7A 5ISLA 3DKQA 5J09A 1W0NA 4PI2A 1UY0A 5D21A 1O8SA 2X5IA 3EMRA 5E6HA 1SBEA 5JZGC 2E26A 1PGL1 4IEWA 3VKLA 5K0UC 3VD5A 5CYYA 1LULA 1R083 1BEV1 5L9BA 5KC5A 5BNQA 2YPJA 5FYIA 5FZ6A 4BOWA 4QQ2A 4XC9A 3KVAA 4CCMA 2ARXA 4QD2A 2HWC3 4QHZA 4XOGA 3VZJA 4K21A 1HRI1 2VMFA 3N4MA 5F5CA 2D44A 4FPGA 4YARA 2O8OA 3LKJA 3ES4A 1CGPA 3ZMOA 4LOSA 5L7OB 5LK5A 2R0HA 3CHXA 4BA6A 5F32A 2ZAHA 5EP9A 1OH3A 1HW5A 4KI5M 4MGQA 3LSDA 5IWFA 3RYPA 3ST7A 2R042 4LULA 1LHWA 1G9DA 1HQLA 1ZBE1 3OBZA 3KV5A 3OB8A 4JTNA 4N53A 3RWKX 4LO7A 3UK9A 1US3A 5AFBA 1DHKB 3UETA 4CDXB 5FPXA 4N43C 1OVPA 2RHPA 3HD8B 4HG6B 3UL2A 4EN9B 4HFSA 3P3NA 4KG0A 3ZXEA 2C1FA 1PO11 1D0GA 1QNYA 2V5YA 3DKWA 1J3RA 1V6NA 4LBKA 3ZIXA 4HN0A 5JOZA 1PVC2 1XC6A 1RUH3 3DXTA 4AI0A 4NIDA 3WG1A 4XUNA 4P08A 3PNAA 3UJOA 3V64A 4YM1A 2QE3A 4PF5A 1PNFA 2VVEA 4LO4B 3NRUA 4MYEA 1VMJA 5A7WA 3OBAA 1JYWA 1RHI2 2QFEA 4AYUA 2WN3A 4HVOA 4BWOA 1W8ZA 1ND2C 4HPKB 3C7OA 3H9AA 4IUGA 3MICA 3TOJA 2UY8A 4RHV3 2WN2A 3UGGA 5FY0A 2J1UA 2MPFA 1ASJ3 3OD4A 4E27A 1OA4A 3KWVA 1SACA 3GBWA 2C4XA 4W6WA 5E16A 4EV0A 1RMU3 5FUPA 5FYHA 5C8CA 2AEZA 5JAXA 2IC1A 1WA4A 3ZN6B 2ZEXA 3LPGA 4UF0B 2JG8A 3H3ZA 1CWPA 4YYOA 4I3GA 2W5FA 3ETPA 5FXVA 4A2UA 4AEKA 1IS6A 1VBC2 3IPVA 4XETA 4EWAA 2Z2SB 1YQ5A 4LPLA 4AVBA 2HYKA 2BZDA 2J1VA 1NA1A 3DYOA 3OUJA 4RR3B 5G05L 4JRAA 2K46A 1BBT3 2KXLA 5KXBA 2BEOA 4JDMA 1WD4A 2WNVB 4RGGA 1RXFA 3WEZA 1J59A 2GH8A 1YCIA 1S0CA 4JKLA 2EXHA 1F4AA 2OZ6A 2Q1FA 2XWBB 4OCTA 2OUJA 4O61A 4B1MA 4FAGA 2XVKA 1FMD3 4GXLA 2QQJA 2OT7A 1GWMA 3IKWA 2QQOA 4KWKA 1NOVA 5I0SA 5FKBA 1IS5A 2VMCA 4WVVA 4QXBA 1OLQA 4B29A 1CX1A 1V6LA 4PLMA 1VBE3 4JQRA 2G1MA 1MEC2 3BYWA 1CZVA 5FJKA 1LOEA 2AC1A 4QPWA 2Y6KA 5K0UA 4XFIA 2ZJCA 4PF1A 4BIOA 4BQ4A 3EJKA 3NNFA 2W2IA 4IE5A 2YY1A 4YM2A 2GZWA 1AL21 1WKYA 2C9AA 2K0GA 2VU9A 4LQRA 4TN7A 3LEKA 3KGLA 1FPN1 2QJVA 5T5JA 4P9XA 5L7OA 3E6CC 3GBGA 4RFRB 3KLSA 2JJ6A 1DP0A 5CG9A 1AR82 2RDQA 1QQP3 5AC93 3AFKA 3JQWA 4C0BA 1XSRA 2JE8A 3VHPA 4EN7B 1W8HA 2ARCA 1LNSA 2GNMA 2SBAA 1VRH2 4COZA 1UN1A 1VRBA 2XXZA 3QH7A 4CDXA 5FZOB 1UOBA 2JKXA 2VBDA 1LTEA 2Y6JA 4B4RA 1EV11 3W59A 4C0HA 3Q8EA 1JYTA 5LY1A 4CUCA 2HH9A 2WS93 3DYMA 4AOCA 1LOGA 4OI2A 4M0NA 2WQ4A 2D6MA 4LBNA 2G9ZA 4UFIA 5FYZA 3WG3A 1EY2A 4BLJA 4COYA 2YU1A 3ASIA 4NPLA 4P9IA 1QMJA 4IXLA 3ZR6A 3UV9A 2ENRA 3NWKA 4AEMA 3DPRC 3HNYM 1DLLA 2B9VA 3IT8A 3KS7A 4QXHA 3UKNA 4LXLA 2RMU2 2VZVA 4QB6A 3DPRB 3D3AA 3RI8A 1ZRDA 3MPBA 1AYM3 5FY8A 3KB5A 3WR0A 4Q4Y2 1KDMA 2VUDA 1UXXX 5C9AB 4PCRA 4PQ9A 2AREA 2Y6LA 3NL1A 4C8DA 1WCDJ 1QDCA 1RL3A 2RJKA 1VB4A 1BYHA 4HPKA 1KEXA 4CDWB 3M3QA 3WF0A 4GMP0 1ND2A 4LE3A 4QPGB 1HXS3 1UZ0A 3VBHC 5IAVA 1H6XA 3PU8A 2XLFA 4CDUB 4R9AA 4NWVA 3ZN6A 4B4PA 2DVAA 2XGXA 1AR72 5BUVA 1D4M3 1KXGA 3RFRA 3IMMA 1BMV2 2VO5A 3HQXA 1G86A 1O3TA 2R071 4XQ4A 1R082 2WZR3 3WNNA 2HWB1 3WDTA 4RR3A 5FMOL 3KT4A 2JX9A 2WNVA 2HWC2 4OQ9A 5FUIA 2VAUA 1OC1A 1RINA 4JHTA 1WCSA 1YFXA 2JDMA 4XFHA 3T2QA 3WINE 1RUI1 1NAEA 5KXEA 1LJ7A 3AMPA 4X8PA 5C5TA 2VOWA 5FR3A 5FZFA 1G9AA 2YHJA 3V0AB 5L9VA 2RR13 4RYDA 2RM21 5LEJA 1LHVA 1RUD1 1LU1A 2YB7A 1B09A 5D1IA 3OGJA 4XTMA 4Z07A 3W9AA 3WF2A 1JXNA 4CXXA 3IAQA 5FP4A 3ZYFA 1I3HA 5DZEA 3MFCA 3ZFEB 5AVAA 3ZXDA 1LU2A 4D7SA 1UO9A 1QU0A 5E88A 3KCCA 4GKXA 2WL1A 5DZGA 4Q8LA 4AFDA 2PN5A 3SXWA 1XNTA 5FMDA 5ACA3 1DU3D 1RUH2 5A32B 4M3CF 4DINB 4AGRA 2R1BA 2WFPA 4JQTA 2HYXA 5C3OA 4Y5SA 3VBRC 4DFSA 4L8QA 2DCZA 2NM1A 4KBZA 3M4FA 3WQ7A 2OX0A 3KF3A 1H9PA 4ISQA 5FZOA 3EB7A 5KHHA 4JGZC 2X05A 2D40A 5IW0A 3OTFA 1N1TA 5FY4A 1YQCA 2DYCA 2BPA2 5FY5A 2F17A 2WYSA 5A7QA 4A41A 3HIFA 4AQSA 4AVSA 4RHV2 3NJVA 3MFAA 4GWNA 1ASJ2 1EP0A 2XH6A 2SLIA 2IXLA 4XF3A 4GWJA 4QB2A 1RMU2 3VKMA 1O3SA 1ZZ9A 3EYPA 5APAA 3DPRA 5DDJ3 4FPHA 5FZ3A 3BTAA 1POV3 2A71A 5CG8A 2B5HA 1R1A2 3C7HA 4W65A 3WT3A 3H7YA 1NCRB 2QTWB 3FJSA 3LCPA 4RQPB 2WKKA 1RVF1 4AFBA 4AVVA 1VLNA 4DPNA 2P3IA 1V0AA 1VAVA 4BQ3A 4I0AA 4CDWA 1BBT2 4HL0A 4XJAA 4I2OA 4QPGA 5FZIA 2KM2A 2CGPA 2ORXA 3ZSMA 4YFZA 1QJU3 4CDUA 1LHOA 1CZTA 4QX5A 1FMD2 3KHBA 4MOAA 2E7QA 2IFRA 4LUKA 1Q8VA 4IGPA 2VR4A 4I3PA 2BBAA 2AEYA 1XE8A 3S5AA 1VBE2 3ACHA 3L9JT 2ZS6B 3T09A 3TEZA 1YQ2A 2WA3A 3O5SA 5GZFA 5A7OA 4KU8A 2OA2A 1UZZA 4HKLA 2W39A 3ZYRA 3P1IA 3FBYA 2QQLA 3D0JA 1E5HA 1JOJA 2CAUA 4QKBA 1Z7S3 3NQHA 1QJEA 1KS5A 4B4QA 1WMFA 5IT6A 2WRAA 2VQTA 1QJX1 4QX0A 4C91A 2GNBA 2NLRA 5FO8B 5H9QA 4I0WB 3VHNA 1RIRA 4Q4W1 4AI3A 2Y6HA 4OHWA 5I8TA 4ASKA 1QQP2 5AC92 1MR5A 1JH5A 3BN6A 4YZ1A 1HQNA 1UYXA 2XUEA 5JLVA 2JDYA 2V72A 4EYUA 4Y1XA 4UAPA 1EPWA 4P9YA 2D3SA 3W20A 2CDPA 1WLDA 5HPOA 4FOVA 2JE7A 2O14A 1GZCA 2LTNA 4LK6A 1BLZA 3Q8BA 2CAVA 1H8TC 1ZBA1 1JHJA 2LROA 3BOWA 3ZFEA 1B35C 3WW1A 4EE2A 5C70A 3ZVXA 4GJYA 2WS92 3KT1A 1B35B 2VZ1A 3ELNA 3GBFA 3J26N 3D5OA 2WZPP 2P37A 4CUBA 4NIHA 2H6CA 2XQXA 3JD73 5DAQA 1G9CA 4GH4B 3K77A 5A33B 1S2BA 1UY2A 4FBFA 5A32A 3AZVA 2BVVA 3A0NA 3CJIB 1O6UA 4Q4V1 3WDVA 1UU5A 2BNMA 4NPRA 4XFFA 4W8JA 5GALA 1STMA 2ID4A 3CKHA 5D8AB 3NAPC 1AYM2 1A8DA 4R9BA 4WZFA 2P4EA 2VOKA 4IEYA 3ILRA 4MHRA 4AQTA 3I2FA 3RZHA 4KWUA 1ZZ6A 2Q1MA 1SCSA 5BPXA 1D2SA 4JRLA 2DFCA 1FNZA 1BEV3 2P6HA 2XVLA 2NYYA 4NWWA 1NCQB 1W8WA 2WR9A 4INDA 1HXS2 5F9TA 1I5PA 4JC1A 2CV6A 4MADA 1QOOA 2D6OX 4L9BA 5T50A 3I49A 4Y5TA 3WHTA 5FZAA 3PUAA 3RWNA 4RSUA 3VZNA 2Q8EA 2HWE1 5KC6A 3KQ4B 2YROA 4MGKE 3WV6A 5FPBA 3PL0A 3LZZA 4F8AA 4GQ7A 4PBOA 1D4M2 1ZYBA 3E5XA 1E5IA 5FLHA 3FLTA 1NCRA 4RQPA 1W8OA 1JMUB 5FMCA 3PTRB 3RZMA 2V4VA 5A3UA 1ZBE3 3AYCA 1W9WA 2VMEA 4P9JA 4QX1A 4NPMA 3VBFC 4X6RB 1SBDA 4FFIA 5L73A 2B46X 1GICA 1NE4A 2Q8CA 4Z2AA 2XKPA 2YC2A 3CEWA 3K51A 4LORA 4OZOA 4A7ZA 1FX5A 1FOD1 2CHHA 4FFHA 4CEYB 5I93A 4YWAA 2RR12 4OUMA 4IEVA 1XJAA 1IPSA 1DGWA 3AMMA 3F2ZA 4NRQA 1UOJA 1WZXA 2DCJA 4QQPA 1OA3A 2RS33 3K75B 2E53A 1RUJ1 4PBPA 2Z4FA 5B2GB 2VVDA 5L9RA 2YBSA 3O7OA 4C1XA 3BCWA 1OF3A 1SFNA 1W3XA 2TUNA 3RDIA 3K3NA 5LATA 1RB8G 5FWJA 1LOFC 2UWCA 4KNCA 5JDBA 1OD5A 1VJ2A 2VMHA 1R1ZA 2GAUA 2A6WA 3OD0A 1YO8A 2OPWA 2WAAA 4DMIA 3ZXLA 2ILMA 4DRRA 5CFDB 2W91A 3S57A 3I3QA 1Q8QA 2J22A 4AFMA 5ACA2 4YRDA 4J6GA 4D6SA 5A3PA 2FDIA 1YIPA 2W47A 2VW2A 3PLQA 4IEPA 1RUG3 2LUWA 4LO6B 4LHKA 3TN93 1SHWB 3LOBA 3INAA 4BB3A 3A4UA 3IDEA 1HJGA 4KGQA 2PLV1 2WUHA 5BNNB 1TQ5A 2FZ1A 1LHNA 2A3WA 1ZZBA 2EAKA 2A6VA 3FMGA 5HCAA 3O1PA 1H8TA 3BTYA 3TYJA 2JG9B 1B35A 1YQ8A 2RG4A 2FZ2A 3MF9A 2QQVA 2PHTA 2X53S 1JW6A 4FFGA 3VDDC 3OOXA 4GH4A 1YI7A 4ITCA 5A33A 2G9GA 1GKBA 2PHDA 2YBPA 1J1LA 4CUGA 2ZPXA 1BHGA 3NKTA 2LRPA 4GWMA 3B00A 1OOPC 3CJIA 3VDDB 4ATFA 3BIWE 1ZRFA 1PM7A 4FXGB 1OOPB 5DDJ2 5D8AA 4D3WA 1ND3C 3H8UA 1UOFA 4ISRA 2VY0A 2FDJA 1WD3A 1C5HA 1ND3B 1H1AA 1ULFA 3GZUC 4BQWA 1C4RA 2VNOA 2ZCWA 1DQ6A 4HKWA 4M3CE 4CU8A 3O1OA 2HEVF 4PDWB 2GH2A 3U4XA 1U5XA 4PIZA 4Y4YA 5FZKA 2HJIA 3Q8FA 3LFIA 3MIFA 1MQTC 1Z0HA 2QNKA 1HB3A 1JBCA 4XAAA 4QKFA 1VIWB 4U36A 4ZXKA 4AI9A 1OKQA 1FPN3 1H2LA 3SC7X 3ZFFC 3IBMA 2Y34A 2FDGA 3KQRA 3AXEA 2BRTA 1UZVA 1WLTA 2W1WA 3I3EA 1X33A 2XJTA 3ZFFB 3ZPOA 2BVBA 3J9SA 1IS3A 5GZCA 1J58A 2HBUA 4NRPA 1HX6A 1AYN1 2WWUA 2LM3A 3TNQA 4BHPA 3HPNA 1NY71 3AP7A 4BLIA 4WM7C 4Z2WA 2W68A 1KJRA 2P3JA 2XKOA 4ZS2A 1Z7S2 4S2GA 3R6SA 3IWZA 3VBFA 3QLQA 1NG0A 4GA9A 3T30A 2FQPA 1PGW1 1UZWA 2B45X 4YG3A 3T0BA 5JI9A 1AF9A 1U5IA 4D7YA 4IEXA 1ACCA 3PURA 2D6LX 2EA7A 4DOUA 2V09A 3L2YA 4XUQA 3N7JA 5A3LA 1IS4A 5IVJA 1IHMA 4COWA 1W6NB 3J8F1 4UW5A 3I2OA 1COV1 4BQYA 1GU3A 1PX4A 4XVHA 5LK7B 2D6KA 3BGAA 4KU7A 1GOHA 1LOFA 4PIXA 3U4SA 5M0TA 5T52A 3RZGA 2NQYA 3ZPYA 1VBB3 1PNGA 2FD8A 2ZHNA 5CFDA 3JD72 3JQXA 2PA7A 3LA2A 5CKQA 3ZYPA 4E2QA 5KHGA 5LBFA 3JZVA 3UGFA 4QKNA 1EAH1 3LGRA 3E97A 4OHVA 2LS6A 3VB9A 1RUF1 4YZ2A 2R061 4OHZA 1I9RA 4YFWA 1OVSA 2QQNA 5F5AA 4YW1A 5JXJA 4QPYA 3MLKA 2TEPA 3NNGA 4Q26A 3DYPA 4E9KA 2R073 2ZGNA 1FYUA 1BEV2 3HR9A 3VHRA 1SMVA 2D3PA 2HWB3 2JG9A 2Q30A 1V6MA 4H14A 4J1WA 1PZ7A 2DTYA 1JHNA 3M7AA 4ZZ8A 5F3CA 4QM9A 1N3OA 2P6CA 2P17A 2E9QA 2MEV3 3VDDA 2VGDA 3NKGA 4E4DX 5JXHA 1UZYA 1OOPA 1UPSA 4L0PA 3T0DA 4FPFA 4FPYA 2RM23 1Q8PA 5A3OA 2E51A 5J48A 1UYPA 4YVWC 1ND3A 3WG4A 1Q43A 4FOWA 5F3GA 3IDAA 4L11A 3TWIA 1DQ2A 2TNFA 4CCOA 4YVWB 3DXUA 4BK4A 1W2UA 2NPIA 1ZBE2 3KCYA 4CPBD 5JPMB 3I2HA 1R093 2D6PA 4CYDA 4FXKB 3RGBA 3MW2A 1MZFA 5C8CC 2GDFA 1OFNA 1HV0A 3B7MA 4YPJA 4EZ4A 4WM8B 3B69A 4TTGA 1C1LA 1ZM1A 1PO12 4YGEA 5A6YA 1HB4A 3KGZA 5FP9A 4B1LA 2O1QA 2WFF1 4QX7A 3ZFFA 2DDUA 4IDZA 3D82A 3RZKA 2LALA 4Q4Y3 2CTVA 2RS32 4FPKA 4LIUA 5K4LA 3C8XA 1PVXA 3MUY1 5BY5A 3LIGA 1W28A 1NA1C 3QCWA 1RUC1 3OGRA 4IV1C 3VBUB 1KD7A 3NV4A 4K9SA 1W0OA 2FCVA 2WLPA 3SMHA 2F4LA 2Y38A 4IV1B 3RNSA 5KBFA 4ZS3A 5A1AA 3O1TA 4MXVA 1AL0G 4IE7A 4LIVA 2BJSA 2NZ9A 3O0WA 2XR4A 4FTSA 3WNKA 4LHSA 4JTOA 4Q4X1 4YGBA 2J1RA 3RMXA 1POQA 3FX3A 3WD5A 4Y3OA 3ETQA 1RUG2 5IVVA 4WZCA 5ABJB 1BZWA 2OXBA 4I02A 3TN92 1F31A 2YFUA 4M4RA 3TRSB 4DXRA 3GHNA 4FPLA 4QQLA 5FYSA 2RE9A 2PHFA 1N1YA 2BWCA 1UX6A 1ENXA 4ZONA 3JB8A 2R6QA 1DYOA 1W9YA 4QX2A 1N47A 3AMNA 2C0ZA 1UAIA 2KD7A 1QF3A 4BCUA 2XG3A 3VZMA 1PZ8A 1W8FA 3I2GA 5GZDA 5L7OC 1NZCA 2R30A 3WX5A 4HVRA 4WBBA 1H1IA 2JDAA 3POYA 4K6BA 4IESA 2D3RA 4Q0SA 1OURA 4URAA 5JXGA 5FZ4A 1XQNA 2I74A 1LGNA 4KGGA 4N90A 5LBEA 1WLWA 5FREA 4A6OA 2XQRA 2F4PA 5FYMA 4CDXC 2D97A 4XF1A 3CZUA 1NT0A 4Q29A 1LB2A 2CY6A 5FPLA 4JVAA 2NMOA 4Y22A 3AB0A 1LRHA 4PHZA 1POV0 2VMGA 2VVFA 4N9IA 5FZEA 1AR63 4CCEA 4NRMA 3M3OA 4H7LA 1S0EA 4R9CA 1CVNA 1FPN2 3FE5A 2JENA 4FOQA 4CTEA 1QGLA 5FOJB 5EFUA 2GMPA 3P6BA 3OYWB 1UU6A 1DFQA 1LGCA 1QJZA 3AXDA 3N3HA 5FMBA 3BKZA 1Y9QA 4YGDA 4KQ7A 4BDVB 3BTZA 4YVWA 3V0BA 5JI7A 1SCRA 3NNLA 1Q5OA 1W9TA 2IXJA 5JUVA 4DUVA 1UIJA 2VTFA 5LA1A 3S0MA 3WW2A 4CDQC 5IHRA 2JDKA 4IL7A 1EV12 2WWJA 4AG4A 5LASA 5ANQA 4WM8A 4CDQB 1DYKA 3GJAA 1H30A 3VBSB 3UNPA 1QKQA 1W39A 4D7TA 2BYVE 4K8FA 2NMNA 4UFMA 2WJSA 2BV4A 1CJPA 4N9HA 1QNWA 2VL4A 3JCIA 2VNRA 4LKFA 5IFPA 4Q4V3 1YYNA 1R1A3 3KV6A 5FP3A 4HT1T 2YUEA 4CP9B 1N3QA 2DUPA 3HQRA 4RR3C 3VBUA 3LPFA 2ES3A 4CU9A 1MZEA 3H42B 3N36A 1KS4A 2WNVC 2YGLA 4QHOA 4E4SA 1LR5A 1SPPB 4IV1A 3BUCA 2OUHA 4CVUA 1JS9A 1N3PA 1TME1 3I4IA 5JIAA 1WMEA 4AAXA 5FQ0B 5FYBA 3MW3A 2RS11 1VBB2 3OUIA 1GNHA 3JUUA 2DURA 4QX8A 4Y33A 1J83A 3ZMNA 5J36A 1OHFA 2E33A 1OKOA 4ZZ5A 3VDBA 2ZGRA 3S7IA 1UYZA 1W6MB 3LAGA 1UL9A 2HWE3 3K4DA 4R9DA 5ABJA 3FFQA 3PVNA 3M1HA 5FO7B 1UKRA 1DZQA 1NXMA 3ZIWA 4Z8BA 1O4YA 3THTA 2ATFA 1CZSA 1GWKA 4CPBA 2JECA 3E6DA 2P34A 2XBO1 1UY1A 2ZABA 2R072 4V2WA 3WNLA 3MBWA 3MYXA 2HWB2 3W21A 3SCHA 1CESA 3KVBA 2YPDA 5JXIA 1W0PA 1H2KA 5IYYA 3EHKA 4Y1ZA 2MEV2 3N7KA 3VD4A 4MXWB 1UPIA 3SH5A 3U75A 4PI0A 2QKDA 3KHCA 4LJHA 2R49A 1V6JA 3WF3A 4AI8A 5I0RA 1FOD3 1L7LA 1IQAA 4PT6A 1N1VA 2DCKA 3SEPA 5DPNA 4HOOA 3ZO0B 1XYPA 2RM22 4XZUG 5BNNA 2VOVA 5A3MA 5I8YA 2UWBA 3AKTA 3I54A 4OFGA 3VKOA 4Q27A 1US2A 3AMQA 4XE9A 4LLOA 3RJ2X 1HLCA 5T5OA 5SV5A 3QOPA 1R092 2CGOA 3ILNA 5IJRA 4DUWA 3NSTA 3J7HA 3U11A 2QQPA 2HWD1 4LMFA 1GBGA 4OULA 1YXWA 1F4HA 5BV6A 4P5HA 1PX3A 2IUWA 5KXDA 3GALA 5DUVA 2RJLA 4E2SA 3OYWA 1K5JA 4NMIA 1PK6B 2Y60A 3O1MA 3WNMA 5C9AC 3AX4A 1VBD1 1E5SA 2HWF1 3ILFA 2ZGTA 1U0AA 2E63A 2JWPA 3AKPA 4IE4A 4P02B 4YW6A 4PQQA 4LBJA 1GV9A 5FYUA 4JZRA 4XFCA 1SLCA 2BGCA 4CDWC 4QU1A 5LZ6A 2C6SA 2ZGOA 1TZOA 4K7JA 2PLV3 4QPGC 4D6QA 3RZJA 3NW4A 4Q0QA 5IUQA 3AZZA 4RA0A 4CDUC 4CDQA 4DUXA 1RUNA 2W1SA 3VBSA 5FWEA 1PM4A 2RS53 3LWCA 4QAWA 1VP6A 1PMIA 3U37A 4FTEA 1LOCA 2V4AA 2VCMA 1K5MB 1W2AX 2VXJA 3FN9A 4RGKA 3N9LA 4UF0A 5DXDA 2ZGQA 4NIIA 3WDWA 3WUDA 2OQ7A 2GSYA 2AYHA 4CP9A 2EICA 3MF6A 4NVPA 1GNYA 1WW7A 4H3WA 4XIKA 2X10A 5FP7A 2ZMKA 3CZJA 4N8MA 5FZLA 2XONA 5JIUA 5CB7A 3HAGA 1JZ3A 3WW3A 1SPPA 1DQ4A 2A6YA 1F15A 1L7QA 5GKAC 1M4WA 4AGVA 1PGSA 3O0VA 5FAXA 1RJ8A 3ACIA 3RZLA 3OGSA 1NQJA 1H8VA 3FWEA 1W05A 5CBLA 4QX3A 1HRV1 2VZSA 3LSEA 4QWNA 5FBJA 4ES9A 4ZXEA 5K7PA 1UY4A 4X6QB 4CCLA 3QACA 2J1SA 4P9LA 1MEC1 4UT5A 4E4HA 4JDNA 5CZKA 1F9KA 1PMJX 4AQ2A 4XAEA 4W50A 2WZEA 4M3CB 4M01A 2GNDA 3MUZ1 3VDCA 1V70A 5HI0A 4P5YA 2ZX4A 4XJ9A 4D94A 2IXHA 3AMHA 1S1AA 1ZVFA 5TSWA 5FMOS 4A3XA 1H4HA 2JXAA 3ZFEC 2QDNA 1VPHA 5A7PA 3VD3A 5IK4A 1AYN3 1JUIA 2RDRA 4BMEA 2ADEA 5EIYB 5K9YA 3OSDA 3LIHA 2QZ2A 4GULA 3ZYHA 1AR62 2JEMA 1AR81 3GCWA 4CCJA 1W03A 2W92A 4MXWA 2JDHA 3U14A 5EYXA 4FOYA 2OKXA 1Q8SA 1QJX2 2WYFA 3WF1A 1VRH1 5HCFA 3TBDA 4Q4W2 1QHDA 5J96B 3MIHA 1ULCA 4Q1RA 4M4PA 4XABA 4PLOA 1ENQA 2ZTNA 4S2HA 1QXRA 3MHZA 2ET7A 4IQPA 4Y26A 2YFZA 3JB4C 3B3QE 4PJYA 4EWEA 5DMYA 1NLRA 1XE7A 1COV3 3RQ0A 2PTMA 2TBVA 1SQ4A 1Y43B 2MNGA 2WNEA 2EXJA 4HXCA 1I5ZA 1UYYA 3HWJA 2V5DA 3RI9A 1CONA 3LDKA 2RMU1 4JGYB 2OPKA 4LO8A 4GB33 4ZU4A 2ZEYA 4AVTA 4MV2A 3QH6A 1RYYA 1XPWA 4JKMA 1IPKA 3B02A 1PK6A 2VULA 1Y9MA 4XUOA 4Q4V2 1NCRC 4RQPC 5C9AA 4AFAA 5HBAA 1ZZCA 2BUKA 5JSPA 3C3VA 1H2MA 2R063 2RJ2A 1MS5A 5BNOB 1OUSA 4WVZA 5FY7A 5JOYA 3BI3A 2EAAA 1FV2A 3AKQA 3H1YA 1ENSA 2ZMLA 3ZXKA 5IK8A 3AP9A 3J7NA 2JD4A 4IGQA 2WQ8A 1GP5A 3MW4A 2ERFA 5IK5A 1RGSA 1V9U1 2VZPA 4GIQA 4QU2A 4XBQA 1AR71 5DQ0A 1JZ5A 1CAXB 3ES1A 5FZHA 4GJZA 2G19A 1ALYA 1G8WA 1K5MA 5CFCC 4OI1A 1PIV3 3SCFA 3H1WA 2WABA 2VOXA 4CCDA 4M00A 3WUCA 4N7UA 1MS3A 1R081 2HWE2 5CIRA 5CFCB 1OLME 2DVGA 1XB9A 3A22A 3WHUA 1ODNA 1IG3A 4OUSA 4LITA 5FY9A 1BK1A 3UT0A 3MO4A 2EIGA 2HWC1 2NN8A 3FLPA 2KR2A 2BNNA 3NV1A 4R4XA 4AF9A 2H0BA 4YW5A 2PHUA 1OFSA 3PMEA 3AZXA 4CEWB 4LE4A 3LA7A 3DECA 3R4DB 5F39A 1OT5A 2EIDA 3D4KA 2BW8A 3AJZA 3DF0A 3OPZA 3SH4A 5GLUA 3ABZA 2C5DA 2VZQA 2F6BA 2QQMA 1LOAA 1DQ0A 3KD4A 3V0AA 3O1SA 3C7EA 4H55A 3AYAA 1ZX5A 2RV9A 1GR3A 4XACA 3OBTA 4M3CA 3S30A 5A3TA 5FZ7A 1FOD2 3VUOA 3D0SA 1TNRA 3IAPA 2PELA 3ROUA 2WFF3 5IVBA 4DXSA 4XHBA 4BK5A 2EIBA 3I3MA 5FIXA 5FYYA 3JBG3 2C24A 5IVEA 2XJQA 5FFOC 1RUC3 1SLBA 2DU0A 1VBA3 3HNBM 5CVRA 5LEKA 4OLLA 4CP1A 2VXRA 5EQUA 5DAWA 3NNJA 4GH4C 5CA6A 1ZA4A 1RUH1 4I09A 1MS0A 1GUIA 1KFXL 1W9SA 4TLFA 5F5IA 1UOGA 3VD7A 4AVAA 1U12A 1P8JA 3HVDA 4CCCA 1M06G 1LHUA 3CJIC 1LODA 2Z79A 1F2NA 2WO3A 5FK7A 4HONA 1GOFA 1AXZA 1UF2C 5D8AC 2FCTA 3PU3A 3SLIA 2DVBA 3MV11 1WCQA 4NJ4A 5C8WA 4LBQD 1XE0A 3ZXAC 1GZTA 4I01A 4RHV1 4JHZA 5I0TA 3SISA 1NCQC 3OBRA 2XB6C 4GALA 5L19A 2PLV2 3RYRA 3PUSA 1GLHA 4BYYA 4Q2FA 4OI0A 4JDOA 2QQKA 4JGYA 3RZZA 1HRI3 1T6BX 2BU9A 3B93A 1FI2A 2QQUA 5FYTA 5B4XA 2NP0A 2RS52 2RDNA 1UMIA 2GC0A 5LWBA 4CE8A 3T4VA 4GZ9A 3AM2A 3ZXJA 5FPUA 4MUVA 4IE0A 1G9BA 3V56A 3USUB 4UFHA 2VTXJ 3J7MA 3U1XA 3RSJA 5BNOA 1D0HA 4EZHA 1BBT1 2A6XA 3GXUA 3SKJE 5LY2A 5FZDA 4BE3A 4YW7A 2E7TA 2K9ZA 4NHKA 1H1MA 1H0BA 1DIWA 1R64A 2QQIA 4QDQA 4HN1A 4YM3A 1CAXA 1VAMA 4QGNA 2QQWA 1QJY1 1BCXA 4OMDA 1LCLA 4QT6A 4CEYC 3MV01 2Q0AA 3DCQA 4XXPA 2A75A 1PO13 2VM9A 2YC4A 1VBE1 4LBLA 5LA2A 1SG3A 3W5MA 5CFCA 4Y4RA 3BPSA 3PHMA 1XYOA 2AR6A 3FUQA 4ZU5A 4LBQB 1XNDA 1FAYA 1WW4A 3WQBA 2Y6FA 4A42A 4RS5C 2ARBA 2VUJA 3R4SA 1YUDA 3EO6A 1AYN2 3OY8B 4RS5B 3GM8A 3T1LA 5I0UA 1ZRRA 1YHFA 3KZ4C 2B39A 3WQ0A 4CRQA 5CFDC 4XQWA 1QQP1 2WZ8A 3O14A 5IATA 2W46A 4NN0A 2ORZA 5EJ1B 5LCWL 3I7DA 1OA2A 2WO7A 1GSLA 1O91A 1AVBA 1YJLA 2R16A 2WT2A 3CLPA 3M3CA 5D2AA 3FLRA 3PTYA 5C3RA 1GQPA 4WV8A 3ZX7A 4QB1A 5BNNC 1KQRA 1KITA 3AFGA 3ZKUA 2WS91 2JG9C 1TMF1 4G4FA 4LNVA 1T6GC 1COV2 1YFYA 4M0HA 3B9IA 1DLCA 5DAPA 3HQUA 3S7EA 4YW3A 4ORFA 5FZ9A 1TME3 3WNXA 3IZOA 2YBKA 1GFF2 4A7YA 2E32A 4GB32 4KMQA 3I3DA 1AYM1 1W2OA 1WA6X 3PUHA 4AE2A 3KMHA 4LTAA 5J37A 3OGGA 1NZIA 4Y24A 4V1PA 1CR7A 1DZRA 1LOBA 3MZHA 2W08A 2B7YA 2R062 4IEOA 1CQ9A 5LRRA 3L2HA 4AXOA 1W06A 4PDWC 5J3UA 2Y26A 4XDPA 3JXSA 2IWGB 2VZUA 3FHAA 1HJFA 1NCQA 1S0BA 1DGWX 1PZ9A 1GNZA 2BGPA 2G4IA 2RDSA 2XBO3 3ENRA 2ET1A 3GGLA 4H2AA 4Y1UA 1SEFA 1AL23 3S6PA 2VZTA 1D4M1 2YZ4A 4LA3A 4QKDA 5DAVA 1CAWB 1PIV2 1S4CA 4DQAA 3USUA 3UJQA 2XOMA 3I8TA 5CAZA 3SITA 4NR1A 2WZR1 3Q9OA 1WW5A 4QPIB 1DBNA 1IG0A 3MIDA 4Q0VA 3ITQA 2XLGA 4YGCA 3ZDSA 3H8XA 4QMAA 1JUHA 2X09A 1SFYA 2XUMA 1CAUB 1H2NA 2FCUA 4A4AA 3MIEA 5IVFA 4IEUA 4NAOA 2I45A 3VZLA 1T2XA 1EV13 2WSVA 3GHMA 2VC9A 3DL3A 1X8MA 4ATEA 4DIQA 2RR11 2R32A 2HWD3 2OS2A 1D7PM 3U78A 2O8QA 2Q1ZB 2ZZJA 5FLJA 1VMHA 3OUHA 4H7MA 4CEYA 3O1VA 4OVEA 2CNAA 3ZYGA 4UYBA 3PDQA 4UBGA 5FZ8A 4ZKTB 1C8M1 2CWSA 3KV4A 4DS0A 5C4WC 4MG2A 2WFF2 4LBQA 4QHBA 5C4WB 3PUQA 2HEYF 2Z69A 1VBD3 2HWF3 3ATGA 2W95A 3CL1A 4UWDA 3JBG2 4HSLA 2BOIA 4XUPA 3UKVA 3V65A 3K3OA 2XPJA 1MS9A 2QVSB 2OW4A 3A21A 3OY8A 5BNPC 4RS5A 2IVIB 4V2VA 1RUC2 1VBA2 5BNPB 2RVAA 3RRDA 1JZ6A 1PO21 1NLQA 5FK8A 2WQZC 4EQVA 2C26A 4P9GA 3OG2A 1SFPA 4XIOA 4C1WA 1RXGA 2PAMA 4XHXA 1DGRA 3ZFGB 4GAZA 1DYPA 1QOTA 2BP6A 4HETA 4Y20B 3AVSA 4AHZA 4AW7A 5FYVA 3ZSLA 5FPZA 1G9FA 1OI6A 2X5IB 4P9WA 3BB6A 3JU9A 2E31A 2JDUA 1JODA 3N9PA 3BIEA 4AQ6A 1Y9GA 2Y8KA 1VB2A 1JN2P 2ZBJA 1QH7A 4PLNA 4DXZA 2IZWA 3AL5A 4PIYA 3HBZA 3HJRA 1PGL2 2JDPA 1U5YA 1UXZA 2JIGA 5F8PA 1A6CA 4QDSA 3H1MA 4HSJA 3ZYBA 1KFUL 3GNEA 2ZX1A 1YIFA 1UQXA 2W1UA 3SNMA 3VL8A 1HRI2 4ZHNA 5DDJ1 1HRV3 1POV1 2D6NA 1RUI3 1TG7A 3T3YA 4HK8A 4W6XA 1BKZA 1V6OA 1C5IA 2R1DA 2UYBA 5ANNA 1QWRA 3E5QA 1V00A 5IK7A 5DZFA 4NAMA 2ZGKA 1C8NA 4HZFA 2D7FA 1RUD3 1QY4A 3WY6A 2A1XA 3LFMA 1X9TA 1MPXA 1YEWA 1NE6A 3POIA 1O5UA 2D5HA 2HBTA 2G9FA 1QJU1 4PDWA 3KCXA 5JSOA 1DQ1A 1YFUA 4XTPA 4WM8C 4NIGA 2YMZA 2N7GA 5FRAA 3VV1A 4Q8KA 1E57A 4J25A 4L2NA 2VUAA 1YNAA 1AJKA 1NQDA 3K48A 1CAWA 1HN1A 2OZJA 4RGAA 1G6NA 4YVSC 4CP0A 4HVQA 3VD9A 4L97A 1UNBA 3POGA 4QPIA 4YVSB 4XILA 1OH4A 2VNVA 3G7DA 2IXKA 1URXA 1I6XA 3B94A 3VBUC 2FMYA 3VZKA 2D93A 4E8CA 4XMIA 3DN7A 1XNKA 5E1RA 5JVVA
chains in the Genus database with same CATH topology
1CAUA 3G6JB 1AR91 3ZN4A 1U5ZA 2GNTA 3I2DA 3RG0A 4C90A 1ULGA 3FC0A 2YC0A 2BFUS 3LA3A 4EROA 2ZX2A 4ONUA 4YZ3A 1XU2A 4XZPA 1LENA 1QDOA 5FLIA 1EYBA 3R4UA 4FP2A 4UW4A 5JPNB 2ZGUA 4URTA 4XPVA 2JG8B 5ABJC 4IEZA 5C4WA 3AKRA 4YZ4A 1W6OB 1W6NA 2Y0IA 3HT1A 1UIKA 1J1TA 1JYCA 5HXVA 3WVJA 2WC2A 5E89A 2ZGLA 5JOYA 1JYIA 1RVF3 2Z5WA 1NXD1 3IDCB 1L3JA 5BNPA 5FTTC 3B01A 4AEDB 3SCGA 1V9U3 3ZFGA 1TME2 5GM0A 4X8NA 1RTVA 4TZDA 3WCRA 3C2UA 4L92A 1HV1A 2ZGMA 4YW4A 1LEMA 4HMZA 5JMCA 3R05A 3AZYA 3IM0A 2DWRA 1V6IA 5JZGB 2A73B 3WP5A 1S0JA 5K0UB 2PYTA 1AXYA 1O5LA 2XWJB 1XYNA 1OPMA 4QGLA 1Q3EA 1SBFA 2XBO2 4LLFA 1QH6A 1S0GA 3VL9A 3EQEA 4BMBA 1AL22 4U2AA 4YSFA 1AUYA 2GC2A 4E2GA 5H9RA 1ENRA 1CPNA 1QJX3 3B9CA 3GZAA 4MVTA 1QXPA 4OZXA 3ACLA 4XDQA 1EPZA 4Q4W3 4LUMA 3OCPA 2WWSA 2A70A 1WBFA 1S0IA 4K3UA 5GLVA 5HCBA 4N43B 3GF6A 1ZBA3 4HK9A 3VBSC 4K40A 4MGYE 4SBVA 2HWD2 4JV4A 2H6BA 5T3NA 2RS31 4GMP1 2VH9A 4MGZE 1RC6A 4YVSA 3MEPA 2A3YA 2GU9A 2JDZA 1YI9A 1A78A 3WP3A 2UYAA 5GZGA 1BXHA 1LKNA 1VBD2 2HWF2 2QUOA 1RUE1 4BQ1A 3FFZA 2FHRA 3CJXA 1IZ3A 3SHRA 1ND2B 5F6KA 3VKFC 2GMMA 2XL7A 2Z42A 4AWDA 3N7MA 2GN7A 1H4GA 1RUG1 3PMSA 2FMDA 3TN91 5F6LB 1H9WA 4UXAA 3R0RA 2VW1A 4FO9A 1X82A 1FV3A 3PVOA 4Y1YA 1ULEA 1SLTA 1W6OA 3O0XA 4FVVA 5GLZA 3WW4A 2DCTA 1FATA 1VAKA 4AEDA 2ZACA 1O3QA 2WA4A 3BOPA 4AEJA 5JSRA 2CL2A 4BPZA 1HRV2 1J3QA 2R041 4XXAA 1QJY3 4R4ZA 4CZSA 1RUI2 1W6PB 1OQEA 2X8KA 2VQ0A 3M70A 1GZ9A 4OHYA 5JZGA 1IGOA 1ZZ8A 2OVUA 1BJQA 1RUD2 1HIXA 1LEDA 2GC1A 3ZSKA 1RUJ3 3PJYA 1WLCA 1GQGA 3H7JA 2ZGPA 4LO5B 3ZSEA 1YJKA 4MLOA 1PVC1 3PVEA 1J3PA 5EJ3A 5CADA 3M2MA 4COVA 2A5ZA 4FTBA 3WP4A 1PK6C 4MGIE 1KDKA 1MZ6A 1TEIA 1CN1A 5H9PA 1YRZA 1RHI1 1MVQA 3NVCA 4MZUA 1F5JA 2B8MA 1O4TA 4N43A 2EALA 3USSA 5CNAA 5DUXA 1TMF3 3VZOA 2ETEA 3WXPA 3E5UA 3HN1A 1K5MC 2PHXA 2R0FA 4YZ5A 2P3KA 4S2DA 1VBC1 2E6VA 3AK0A 4XW3A 1UD1A 4XYXA 4AHYA 3MIGA 1PHMA 1YLLA 3RPQA 1OQDA 2AENA 2Q5TA 3BPZA 4FPEA 2ZA9A 2PHWA 5T54A 1VBB1 2ZMNA 1RVF2 5FDBA 5EV7A 5FQ0A 3GZTB 3O12A 3PJQA 4AVCA 3VBHB 2JE9A 1CJDA 2Q8OA 1V9U2 2DUQA 3FUOA 3BODA 1REFA 4EN6B 1X50A 1W6MA 4DB5A 2IXCA 4MH0E 2D98A 1MS4A 1G7YA 1MVEA 2CGNA 2WNUC 1NYWA 4DY5A 4Y5Z0 4SLIA 2WNUB 2ZKNA 5T5PA 2WT0A 3THPA 1CAVB 2BBVA 3N35A 2MEV1 5C6CA 3NV2A 5KHJA 3WLUA 1QXJA 2BWAA 2ZGSA 1AXKA 1W6PA 2YV8A 3RYKA 4XF0A 1FT9A 3E6BA 2ZHMA 1WCKA 5F1RA 4AGGA 4KWJA 3FBMA 4KWLA 2KA3A 4XMAA 1C8M3 3RS6A 1R091 2BQPA 2ZZQA 4MSVA 1WUVA 5SV8A 2OYZA 1MZ5A 3EBRA 3J8F3 3IIAA 2XJVA 3EXUA 3H3UA 1KJLA 4Z82A 3U07A 4WVWA 1ZBA2 4JGYC 2DFBA 1IKQA 4XBNA 1PO23 2PAKA 4S2FA 3ZYIB 3NV3A 4FT8A 1CX4A 2GMEA 4Q4Y1 2IXIA 4QM8A 4WVMB 5BNOC 1EAH3 3VBRB 1UKGA 1ZRCA 3ZSJA 4LHLA 1RUF3 1GZWB 1OQ1A 1S2KA 1HQWA 1A8MA 3CNAA 1DDLA 4JGZB 1F8VA 2B42B 1UU4A 3ZXGA 3TNPB 4EWDA 2WSUA 3IN9A 2WT1A 1UMZA 3KM5A 4LA2A 1BMV1 1TE1B 3MGUA 3NJZA 4DNYA 2A7AA 4EN8B 2W52A 1IKPA 3BALA 3B5LB 3TAYA 2VW0A 4EJRA 4R52A 5FO9B 1NLSA 1WGPA 4CEWC 1AZDA 1AHSA 1S0FA 1APNA 5DG1A 2DF7A 2VECA 1OPOA 3AJYA 5T55A 3W58A 4D69A 3LOIA 4B7EA 3VBHA 3CO2A 2ZKLA 1ONAA 2QZ3A 5DUUA 2EVXA 4YM0A 1CD3G 1VALA 1QJY2 2EF6A 4XJWA 2AGSA 1YWKA 3WP6A 4COUA 2CWMA 3DV8A 4LBOA 5FBZA 4XFBA 5DUWA 3NO8A 2WNUA 1GQHA 1ULDA 5AFEA 1C1FA 2YDEA 1AR61 1RUJ2 1CAVA 1W6QB 3CU7A 3RMYA 2VMIA 2XHKA 4RL7A 4LEJA 1S0DA 2E7AA 1AR93 2JKBA 4TSVA 1BVVA 2XJUA 5BYNA 2O0OA 3T2TA 2W0XA 4XJZA 3WOGA 3VBOC 3IDBB 3IMNA 2AZ5A 5GJ6A 3AYDA 1O3RA 4XFAA 4Q4X3 1WBLA 3VBOB 1UW8A 4EN0A 1ASJ1 1H8TB 1Z78A 3VHOA 1I1EA 3U0ZA 5GLTA 3HMYA 1RMU1 1TMF2 3AP6A 4IETA 2GN3A 5J98B 4AFCA 2DU1A 4XJUA 2XJPA 4Q1PA 1C57A 2HKXA 3MIBA 4Y1VA 1A3KA 1R1A1 4RD7A 5LRSA 1C28A 4WVMA 5JCTA 1ZZ7A 3ZYJB 5KWRA 3VBRA 3WDXA 1OSGA 3J4UH 3POWA 1GZWA 3DGTA 3NAPB 3TB0A 5JR7B 4K1ZA 3VLBB 1AJOA 4JGZA 4LR4A 4KH9A 2PHRA 3APBA 4F83A 3ME2A 1FMD1 2MHFA 2VPVA 1D4VB 4LT5A 2UWAA 4B3NA 2ZHLA 4IV3C 3ZN5A 4OHXA 2B9UA 4FPOB 4HBNA 4IV3B 3WG2A 3ECQA 1HKDA 3MLLA 3X29B 4OI4A 2WZR2 4NHMA 4I0BA 2WIIB 2XJRA 2UY9A 1LECA 4CEWA 4I30A 1O4ZA 2Q4SA 1NY72 2V73A 3VBFB 2EXKA 2ZX3A 4K1YA 1TNFA 4XQDA 3MI8A 4BZ4A 4TYSA 2XLAA 3ALQA 4HLTA 5AC91 2PAEA 1DQ5A 3P3PA 1PGW2 2I07B 2QCSB 1BVP1 1GYKA 5KHKA 1UCXA 4YW2A 1MS1A 4GMP3 2VQAA 5FOBB 5T5LA 4F7ZA 1C8M2 1O7FA 1W6QA 3MPPG 1X8EA 1IOAA 3ZXFA 1IPJA 1RUE3 1REDA 3J8F2 4AK3A 1FNYA 5JOXA 3OF1A 1DZTA 1CIWA 4NHLA 3WQ1A 2OIIA 2UU8A 4MX3A 1PO22 4CP2A 1REEA 4HKOA 2A6ZA 2RS13 4ZU7A 4A7KA 4XJ8A 1OMIA 3M3IA 4AI2A 4META 3BU7A 5J7MA 5JOWA 5L36A 2ZHKA 3VBOA 4NOTA 1DGLA 1EAH2 1MACA 1RUF2 3DUIA 4BH9A 2WINB 2QDRA 3VKNA 1HXS1 1SLLA 2DV9A 1XXNA 2VG9A 2RS51 2GC3A 2DVDA 2PFWA 4YLZA 4AI1A 2P2KA 2UURA 5CU1A 4FAHA 4G9SB 4B7KA 1D2QA 3AYEA 4JCKA 2YXSA 4QPIC 2R043 4DRVA 3VGIA 4E4ZA 3I59B 3NAPA 2D43A 1S55A 4LHNA 4IEQA 4FQZA 1WMDA 3QD6A 5F5QA 2XJSA 3GYDA 3WCSA 1AX1A 2D5FA 4YG0A 3H50A 2ZX0A 1QJU2 3D6EA 4UW6A 1XNBA 1MQTB 1PVC3 3AZWA 3HT2A 3KSCA 1F5FA 1BQPA 4IV3A 4LBMA 4ASMB 3AP4A 1V6KA 3UKTA 3URFA 2PQQA 5EYYA 1DGRN 2YGMA 4XF4A 1RHI3 4FSJA 4UW3A 2AUYA 2DCYA 5GLWA 3AKSA 2I2SA 1SLIA 2YYOA 2BTVC 3PVBB 2CYFA 1FXZA 4QGMA 4WM7B 5AVPA 5KHIA 4G3YC 1AR92 3ZFGC 5ACA1 4RFT0 2GALA 4FPJA 1RUOA 4DY3A 2PHLA 3CF6E 4O9EA 1OLRA 1LGBA 3VN4A 2X5IC 4QXKA 5KXCA 4KG8A 3MLJA 1C3HA 4FQ4A 4Z1VA 5H9SA 1VBC3 3N7LA 4DZGA 3H0OA 4B8EA 4Q4X2 5C33A 1CPMA 5DG2A 1ZREA 1Q56A 1Y7BA 4QQHA 1DG6A 2K2SA 4XFGA 3WDYA 5EWSA 2XL9A 2A3XA 4N7IA 1XU1A 4YG6A 5I8SA 1GANA 3WDUA 4JAAA 4Q0PA 4GB31 1X36A 4FPCA 4BIFA 2XVGA 4L99A 3AP5A 1Q8OA 5EZWA 2X29A 5EXOA 1QOSA 1YFWA 4ASLA 2DVFA 1ZNPA 1MEC3 4BM8A 1N1SA 4N53C 2DUOA 1KRIA 1JTZX 4ES8A 1SLAA 4N53B 3U10A 3M3EA 1XRUA 5K8SA 5FCCA 4Y22B 4KBBA 3D8CA 3FZ3A 1WW6A 1AX2A 1PIV1 1SDWA 4O9GA 1X7NA 4UBHA 2WLQA 1AR83 4F3JA 5JWPA 1VR3A 5GZEA 4TWTA 3I59A 1RITA 1MS8A 2Y0OA 3LB9A 1VRH3 2ZOEB 2IFWA 4P14A 2HEWF 5BXXA 3V0BB 1Z7S1 5E8AA 1Y3TA 4QQOA 3T1MA 1LESA 4AHXA 1HDKA 4IERA 4FCAA 4XF9A 2BFUL 4R8HA 4FP3A 1RJ7A 1MQTA 3SH3A 2AH2A 2H0VA 5C8CB 4W6YA 2DTWA 2JG8C 4KL1A 2FBEA 3KT7A 2RMU3 3RJRA 3JBG1 1DF0A 4NO4A 3IPVB 5I91A 3WZ1A 4YNIA 3M8LA 3OJBA 4Z92B 1VBA1 2EXIA 4GKYA 2JICA 3QBQA 4XBLA 4J1XA 1NA1B 2BNOA 1XNCA 4Q0UA 3POSA 4WM7A 1RUE2 4AEDC 4AHWA 3MDPA 2VNGA 3JD71 4HANA 4XEZA 1AX0A 4K20A 3FHIB 3A0KA 4Y20A 1AR73 2ZAAA 2RS12 5J09A 2X5IA 1SBEA 5JZGC 1PGL1 4IEWA 3VKLA 5K0UC 1LULA 1R083 1BEV1 5KC5A 5BNQA 2YPJA 4BOWA 4QQ2A 2ARXA 4QD2A 2HWC3 3VZJA 4XOGA 3N4MA 4K21A 1HRI1 2D44A 4FPGA 4YARA 2O8OA 3LKJA 3ES4A 1CGPA 3ZMOA 5L7OB 5LK5A 2R0HA 4BA6A 2ZAHA 3ST7A 3RYPA 1HW5A 3LSDA 2R042 4LULA 1LHWA 1G9DA 1HQLA 1ZBE1 4JTNA 4N53A 3UK9A 4LO7A 5AFBA 1DHKB 4CDXB 5FPXA 4N43C 2RHPA 3HD8B 3UL2A 4EN9B 4HFSA 3P3NA 4KG0A 3ZXEA 2C1FA 2V5YA 1D0GA 1PO11 1QNYA 3DKWA 1J3RA 1V6NA 4LBKA 3ZIXA 4HN0A 5JOZA 1PVC2 1RUH3 4AI0A 3WG1A 3PNAA 3UJOA 3V64A 4YM1A 2QE3A 4PF5A 1PNFA 2VVEA 4LO4B 4MYEA 1RHI2 2QFEA 4AYUA 4BWOA 4HVOA 1ND2C 4HPKB 3H9AA 3MICA 3TOJA 2UY8A 4RHV3 2MPFA 1ASJ3 3OD4A 4E27A 1OA4A 1SACA 3GBWA 4W6WA 5E16A 5C8CA 4EV0A 1RMU3 5JAXA 2IC1A 1WA4A 3ZN6B 2JG8A 3H3ZA 4YYOA 4I3GA 4AEKA 4A2UA 1IS6A 1VBC2 3IPVA 4XETA 4EWAA 2Z2SB 4AVBA 2HYKA 1NA1A 4RR3B 4JRAA 5KXBA 1BBT3 2KXLA 2BEOA 4JDMA 1WD4A 2WNVB 4RGGA 1J59A 2GH8A 1YCIA 1S0CA 2EXHA 2OZ6A 2XWBB 2OUJA 4FAGA 2XVKA 1FMD3 4GXLA 3IKWA 4KWKA 1NOVA 5I0SA 1IS5A 4WVVA 1OLQA 4B29A 1V6LA 4PLMA 1VBE3 4JQRA 1MEC2 1LOEA 5K0UA 4XFIA 2ZJCA 4BIOA 3EJKA 2YY1A 4YM2A 2GZWA 1AL21 2C9AA 2VU9A 2K0GA 3KGLA 1FPN1 2QJVA 5T5JA 4P9XA 5L7OA 3E6CC 3GBGA 3KLSA 2JJ6A 5CG9A 1AR82 1QQP3 5AC93 3AFKA 3JQWA 4C0BA 3VHPA 4EN7B 2GNMA 2SBAA 1VRH2 4COZA 1UN1A 3QH7A 4CDXA 1LTEA 4B4RA 1EV11 3W59A 4C0HA 2WS93 1LOGA 4OI2A 4M0NA 2WQ4A 2D6MA 4LBNA 3WG3A 1EY2A 4BLJA 4COYA 3ASIA 4P9IA 4AEMA 1QMJA 4IXLA 3UV9A 2ENRA 3NWKA 3DPRC 3IT8A 1DLLA 3UKNA 3KS7A 2RMU2 3DPRB 3RI8A 1ZRDA 3MPBA 1AYM3 3KB5A 3WR0A 4Q4Y2 1KDMA 5C9AB 4PCRA 4PQ9A 2AREA 3NL1A 1WCDJ 1QDCA 1RL3A 2RJKA 1VB4A 1BYHA 4HPKA 4CDWB 3M3QA 4GMP0 1ND2A 4LE3A 4QPGB 1HXS3 3VBHC 2XLFA 4CDUB 4R9AA 4NWVA 3ZN6A 4B4PA 2DVAA 2XGXA 1AR72 5BUVA 1D4M3 1KXGA 1BMV2 3HQXA 1G86A 1O3TA 2R071 4XQ4A 1R082 2WZR3 2HWB1 3WDTA 4RR3A 5FMOL 3KT4A 2JX9A 2WNVA 2HWC2 1RINA 1WCSA 1YFXA 4XFHA 3WINE 5KXEA 1RUI1 1LJ7A 3AMPA 4X8PA 1G9AA 2VOWA 2YHJA 3V0AB 2RR13 2RM21 5LEJA 1LHVA 1RUD1 1LU1A 1B09A 5D1IA 3OGJA 4XTMA 4Z07A 3W9AA 1JXNA 1I3HA 5DZEA 3MFCA 3ZFEB 5AVAA 3ZXDA 1LU2A 4D7SA 1QU0A 5E88A 3KCCA 4GKXA 2WL1A 5DZGA 4Q8LA 4AFDA 2PN5A 3SXWA 5ACA3 1DU3D 1RUH2 5A32B 4M3CF 4DINB 4AGRA 2R1BA 2WFPA 3VBRC 4DFSA 4L8QA 2DCZA 2NM1A 3M4FA 3WQ7A 4ISQA 1H9PA 5KHHA 4JGZC 2D40A 3OTFA 1N1TA 2DYCA 2BPA2 4AVSA 3HIFA 4AQSA 4RHV2 3MFAA 4GWNA 1ASJ2 1EP0A 2XH6A 2SLIA 2IXLA 4XF3A 3VKMA 1RMU2 1O3SA 1ZZ9A 3DPRA 5DDJ3 4FPHA 3BTAA 1POV3 2A71A 5CG8A 2B5HA 1R1A2 4W65A 3WT3A 3H7YA 1NCRB 3FJSA 3LCPA 4RQPB 4AFBA 2WKKA 1RVF1 4AVVA 1VLNA 4DPNA 2P3IA 1VAVA 4I0AA 4CDWA 1BBT2 4HL0A 4XJAA 4I2OA 4QPGA 2KM2A 2CGPA 4YFZA 3ZSMA 1QJU3 4CDUA 1LHOA 4QX5A 1FMD2 2E7QA 2IFRA 4LUKA 1Q8VA 4I3PA 1XE8A 1VBE2 3L9JT 2ZS6B 2WA3A 3O5SA 5GZFA 4KU8A 2OA2A 1UZZA 4HKLA 2W39A 3ZYRA 3FBYA 3D0JA 1JOJA 2CAUA 1Z7S3 1KS5A 4B4QA 1WMFA 5IT6A 1QJX1 2GNBA 2NLRA 5FO8B 5H9QA 4I0WB 3VHNA 1RIRA 4Q4W1 4AI3A 4OHWA 5I8TA 1QQP2 5AC92 1MR5A 1JH5A 4YZ1A 1HQNA 5JLVA 4Y1XA 1EPWA 4P9YA 2D3SA 1WLDA 4FOVA 2JE7A 1GZCA 2LTNA 2CAVA 1H8TC 1ZBA1 3BOWA 3ZFEA 1B35C 3WW1A 3ZVXA 2WS92 3KT1A 1B35B 3ELNA 3J26N 3GBFA 2WZPP 3D5OA 2P37A 2H6CA 3JD73 1G9CA 4GH4B 5A33B 1S2BA 4FBFA 5A32A 3AZVA 2BVVA 3A0NA 3CJIB 4Q4V1 3WDVA 1UU5A 2BNMA 4NPRA 4XFFA 5GALA 5D8AB 3NAPC 1AYM2 1A8DA 4R9BA 4WZFA 4IEYA 2VOKA 3ILRA 4AQTA 5BPXA 1ZZ6A 2Q1MA 1SCSA 1D2SA 4JRLA 2DFCA 1FNZA 1BEV3 2XVLA 2NYYA 4NWWA 1NCQB 4INDA 1HXS2 5F9TA 4JC1A 2CV6A 1QOOA 2D6OX 4L9BA 5T50A 3WHTA 3RWNA 4RSUA 3VZNA 2HWE1 5KC6A 2YROA 4MGKE 3WV6A 3LZZA 4F8AA 4GQ7A 4PBOA 1D4M2 1ZYBA 3E5XA 5FLHA 3FLTA 1NCRA 4RQPA 1ZBE3 3AYCA 4P9JA 3VBFC 4X6RB 1SBDA 5L73A 2B46X 1GICA 1NE4A 2XKPA 3CEWA 3K51A 4A7ZA 1FX5A 1FOD1 4CEYB 5I93A 2RR12 4OUMA 4IEVA 3AMMA 1DGWA 2DCJA 4QQPA 1OA3A 2RS33 2E53A 1RUJ1 4PBPA 5B2GB 2VVDA 4C1XA 3O7OA 3BCWA 1SFNA 2TUNA 3RDIA 1RB8G 1LOFC 2UWCA 4KNCA 5JDBA 1OD5A 1VJ2A 2VMHA 1R1ZA 2GAUA 2A6WA 3OD0A 1YO8A 4DMIA 3ZXLA 2ILMA 4DRRA 5CFDB 1Q8QA 4AFMA 5ACA2 4YRDA 4J6GA 1YIPA 2VW2A 3PLQA 4IEPA 1RUG3 2LUWA 4LO6B 4LHKA 3TN93 3LOBA 3INAA