5T3NA

Sp-2cl-camps bound to pkar cbd2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
HHEVLFQGPGAKKRKMYEDILSHVNILKDMDPYERCKVADCLKSKSYNDGEIIIKEGEEGDTFFILIDGNAVASKDNKVIKTYTKGDYFGELALLKNKPRAATIKAQNFCQVVYLDRKSFKRLLGPIEDILHRNVENYKKVLNELGLDTTCID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Disrupting the Allosteric Interaction between the Plasmodium falciparum cAMP-dependent Kinase and Its Regulatory Subunit.
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase regulatory subunit
total genus 41
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2016-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t3nA00
1O4TA 4IEOA 1ZNPA 3IWZA 4Q29A 4XFCA 2ET7A 3KGZA 1GQGA 4E2GA 1PMIA 1CAWA 4KU7A 4IEPA 4E2SA 1RC6A 3RDIA 1I6XA 4QGLA 5FDBA 4IEYA 5BV6A 4IETA 4ORFA 4JTOA 3WW2A 1NZCA 4META 3DKWA 3QACA 4L2NA 3IDCB 3UKTA 4LA2A 1NE6A 1QY4A 5FLHA 5C8WA 1ZZ9A 4A2UA 2Q4SA 5E1RA 3M70A 3NSTA 4ZU4A 5BUVA 3LOIA 5I8YA 5FLJA 3LAGA 5J3UA 3IDBB 2VQAA 5KHGA 4F8AA 3RPQA 1UD1A 1CAUB 3E97A 4QGMA 3H9AA 5KHHA 2D5FA 4FAHA 4MZUA 4UBGA 1LRHA 4H7LA 3KMHA 3TNPB 1NYWA 1FT9A 5HI0A 3PLQA 4NVPA 2Z69A 4HVRA 3KGLA 3RNSA 3SMHA 1FXZA 2PAKA 2OA2A 4LULA 1YFXA 3ST7A 5I0RA 1XRUA 4LA3A 4XFGA 2Q30A 1J1LA 4IESA 2QJVA 3DV8A 2IXHA 1Q43A 1OD5A 1VJ2A 1UIJA 5CU1A 2ET1A 4CYDA 1L3JA 2XGXA 3RYPA 1ZRRA 3WW1A 1QXJA 3LWCA 1UPIA 1YUDA 3U0ZA 4IERA 5I8SA 4Q0VA 5LRRA 2CGPA 3WW4A 4QMAA 2EAAA 5FQ0B 1J3PA 2C0ZA 2MNGA 1CAUA 4EWEA 3EBRA 2ZCWA 3ES4A 5D1IA 3MPBA 2D40A 5KBFA 1J58A 2PA7A 2XKOA 2QNKA 2B9UA 4PIZA 3IBMA 4I0AA 4AVAA 3S7EA 4QX5A 1ZZ7A 2PAMA 1OI6A 2IXLA 2PYTA 4IEWA 2WFPA 4P9GA 3U11A 4O9GA 1O5UA 3H1MA 2QCSB 3U10A 4XFAA 5JSPA 2XLAA 1OFNA 4Z82A 2GH2A 3USSA 4IEVA 2CV6A 3WW3A 3H1YA 4AVCA 2MHFA 3D0JA 3LZZA 4JVAA 4I02A 1ZRCA 4LLOA 1WGPA 3PNAA 4HN0A 1X7NA 3LA7A 4AVBA 1RL3A 1X8EA 1HW5A 3OF1A 1LKNA 4HMZA 2H6CA 3BALA 4QGNA 4AQ6A 4I0BA 2B8MA 4YARA 1CGPA 4I09A 3N4MA 4RD7A 3R6SA 4R8HA 4MGZE 3QOPA 1U12A 5JSOA 3OGJA 1ZVFA 5FPZA 5FPXA 1RGSA 5I0SA 4XFIA 4YYOA 2GC2A 2Z2SB 3EJKA 1O7FA 3CF6E 1RUOA 4D7TA 2XL9A 4JTNA 1J59A 2XKPA 4LEJA 1X8MA 2PAEA 3FJSA 4XEZA 1Y9QA 2VPVA 1UCXA 4IEXA 2N7GA 4HVQA 3CL1A 4YSFA 2QDRA 4F7ZA 1RUNA 1ZZBA 4XF1A 5I0UA 5BY5A 4MGKE 1IPKA 2D93A 1X82A 3I59B 3I54A 2V09A 1YFUA 4IEZA 1YFYA 5CADA 4AXOA 4XFHA 2IXKA 4YRDA 1H1IA 2VECA 1Y3TA 1YWKA 4HZFA 5I8TA 1SFNA 3NJZA 3MZHA 4MH0E 1VR3A 2P17A 1O3TA 1O5LA 2Q0AA 2Q1ZB 2BYVE 1ZREA 1Q5OA 1YFWA 3H50A 4K8FA 2B5HA 4KWKA 2H6BA 1G6NA 3GBFA 1O3QA 3M3IA 3E6CC 2UYAA 3OCPA 2BGCA 2IC1A 2O8QA 3MDPA 3O14A 4MX3A 1CAXA 1RTVA 2K0GA 5JSRA 3KSCA 1O3RA 1YHFA 4OFGA 1WLTA 1ZZ8A 2XLFA 3RZZA 3UKVA 2GC3A 4HLTA 4XFBA 4EV0A 2FMYA 1V70A 2HJIA 3C3VA 3DL3A 2EA7A 2F4PA 3FZ3A 3NKTA 3CEWA 4FBFA 5FQ0A 4YNIA 1CAVB 1CAWB 1ZRFA 4DINB 5BXXA 1J3RA 4QM9A 2OZ6A 1SEFA 1CAXB 4IEQA 4WBBA 3MYXA 3VHRA 3L2HA 2PHDA 4HSJA 3ELNA 2GZWA 3NW4A 4E2QA 4D7SA 3CLPA 4X6RB 4EROA 4HVOA 2O1QA 4BHPA 4KWLA 4B29A 4UXAA 3RYKA 4FT8A 5I0TA 5J7MA 2D5HA 3FHIB 3ROUA 2XL7A 3FX3A 3UKNA 4O9EA 3EO6A 4QM8A 4J1WA 4PIYA 1XE7A 2UY8A 3KCCA 3I59A 5I91A 5LRSA 2ETEA 4J1XA 4WZCA 4N9IA 1EP0A 4N9HA 1VP6A 4MGYE 1H1MA 4XF0A 4FAGA 3E5UA 4I3PA 4MV2A 2WC2A 2QVSB 4XETA 2PFWA 5CVRA 2FQPA 4HBNA 3ACLA 1UW8A 4BH9A 4EWAA 3OD0A 4WVZA 3LA3A 3BB6A 1DGWA 3OTFA 5EZWA 3BCWA 3TNQA 3E6DA 1YLLA 2GC1A 4I01A 3HT2A 4LTAA 4Q0SA 4XFFA 3JZVA 2PQQA 3CJXA 3D82A 3ETQA 3E5XA 3EQEA 3H3UA 3G7DA 4Q0PA 2OPKA 1I5ZA 1NE4A 1PM7A 5FCCA 3SCGA 4XF3A 4ONUA 3LA2A 3SXWA 1QXRA 4ZU5A 3FWEA 1IPJA 5KHKA 1DZRA 3GYDA 3NVCA 3PVBB 4Q0QA 5E16A 5AVPA 3H8UA 2IXJA 1J3QA 3CO2A 5K8SA 1UIKA 4HN1A 2OYZA 2DCTA 4L11A 1EY2A 5T3NA 5F1RA 1ZZ6A 5KHIA 2UYBA 2H0VA 3H7YA 5JCTA 4QXKA 1LB2A 1QWRA 2ZKLA 4MUVA 2K9ZA 4KL1A 1SQ4A 3E6BA 3H1WA 3S0MA 3B02A 4HSLA 2MPFA 2BNOA 3I7DA 2GC0A 1DZTA 4I2OA 1DGRA 1CAVA 3BU7A 5EFUA 5FLIA 3ES1A 3HT1A 5KHJA 3BPZA 4AQ2A 2Y0OA 2XLGA 1OMIA 1ZZCA 1TQ5A 1Q3EA 3HIFA 2HKXA 1EPZA 2IXCA 2I45A 2UY9A 1LR5A 4BYYA 5BPXA 4UBHA 3ZDSA 1EYBA 2GU9A 3SHRA 1GQHA 2BNNA 4GULA 4R52A 1ZRDA 4EWDA 2IXIA 4IEUA 3D0SA 2ATFA 1O3SA 2PHLA 5JAXA 3H7JA 2OZJA 4Q0UA 2BNMA 3E5QA 4Z07A 4PIXA 2KXLA 1ZX5A 3EHKA 4ZU7A 3S7IA 1WA4A 4KU8A 1CX4A 4JV4A 1JUHA 2CAVA 3H3ZA 4PJYA 1FI2A 2PTMA 2BEOA 5J48A 2E9QA 4LUMA 4BIFA 2EVXA 4KWJA 5LEJA 3FE5A 3DN7A 2CAUA 4X6QB 5JR7B 2GAUA 5C6CA 4MGIE 4TLFA 1NXMA 5LEKA 4XF4A 1XE8A 2XHKA 3IIAA 3RYRA 4OLLA 5I93A 3NL1A 4LUKA 3SCFA 3HQXA 3FFQA 4XF9A 3SCHA
chains in the Genus database with same CATH superfamily
2R072 4IEOA 3IWZA 4L92A 1JYTA 5F2WA 1IGOA 2HEYF 1DLCA 1GZWB 1GQGA 3VZNA 3SEPA 2TEPA 1AYM2 1CAWA 2B39A 3AYEA 2HWE1 1F9KA 1QJEA 1YCIA 4PF5A 2ORXA 2CDPA 3Q8AA 4YWAA 4A7ZA 4ZKTB 2OUJA 4ES9A 1TE1B 2BTVC 3WOGA 4AFDA 4BISA 2JE7A 1GP4A 5BV6A 1ZBA1 5HCAA 2XWJB 2YV8A 5C9AB 3GM8A 4K21A 4P9LA 2GMEA 1V6IA 4ORFA 1JYXA 1PK6B 2PHTA 1MQTB 4JTOA 1N3QA 3MPPG 4M3CE 4N8MA 4RGKA 3KT7A 2VULA 2XB6C 3POWA 4WZFA 1N47A 1WCSA 2I07B 3DPRC 3QACA 4YGEA 3ZN4A 1VRH2 3VD5A 3ZXAC 2QQMA 5F9TA 2RR11 4LO8A 3TRSB 5IVVA 2VTFA 5JMOA 4PBPA 5ISLA 1NE6A 3HOBA 2SLIA 1RUI2 2YUEA 1XE0A 1ZZ9A 2J1EA 3N9QA 3WUCA 4MSVA 3WNPA 3BTYA 2ZHLA 3KVBA 2VNRA 1HV1A 2PLV3 4P5HA 3W58A 3WY6A 2MEV2 3DCQA 1OLRA 3ZSLA 2OUHA 5L7OC 2OIIA 4SLIA 1HDKA 4XHBA 2JE8A 4RQPC 5LBFA 5E6HA 1YXWA 5CG9A 5CB7A 3IDBB 4WM8A 3V0BA 2BERA 4ET7A 2VUAA 3ZIWA 3TN92 1Y9MA 2GN7A 1W6MA 2YGLA 4F8AA 3DYPA 4LBOA 2P3JA 1UD1A 4QX0A 1CAUB 3E97A 4QGMA 2W91A 3H9AA 2BUKA 3AFKA 5C3SA 4QKFA 3WLUA 2D5FA 1FPN3 1C8NA 4CCOA 1SHWB 2IFWA 1LAJA 4QHOA 2VXJA 3KMHA 4UW4A 1JXNA 1LU1A 4IV1B 3TN91 4QU2A 1QJY1 4RHV1 4DY5A 3HBKA 2W08A 2WNOA 4NVPA 1NCRB 1UOFA 3LDBA 5FREA 2GNDA 1QJY3 4RHV3 1JYNA 3D6EA 1RUJ3 1AJOA 4JRAA 5DUUA 3AKQA 4LKDA 3EYPA 1GANA 2JDNA 4AVSA 2OA2A 1SBFA 3JB8A 1F15A 5FRAA 5C8CA 3TEWA 4AEDB 1GQPA 5FZOB 2Q1MA 1MVEA 2BRTA 1YI9A 2D44A 2HYKA 3P1IA 4LA3A 1O8SA 2Q30A 5FZ0A 4CUBA 1FNYA 1UZZA 3BODA 3LEGA 1Q43A 5DUVA 2P6CA 4AFAA 1VJ2A 1B35B 2SBAA 4R9DA 1DGWX 4Q4V1 1QIQA 3WV6A 1FMD3 1XNTA 2PHUA 3THCA 1CIWA 1K5MC 4NHKA 3RYPA 1NCQB 5FXVA 1FMD1 1QXJA 4FI9A 4NE9A 5FZDA 5A7SA 3U0ZA 3BTZA 4IERA 2CDOA 4XUTA 1YQ6A 2ZX1A 3R05A 1LOCA 4XUPA 2WZPP 4FPGA 4EZHA 4Q0VA 5LRRA 2CGPA 1SPPA 1J3PA 2ZACA 3FMGA 4XDPA 1HN1A 4LBNA 3RZJA 1C1LA 1REDA 3OBZA 3N36A 3ES4A 1BHGA 4GMP3 1VE0A 2YXSA 5K0UA 1FAYA 1PGSA 3R0RA 5KBFA 2QNKA 4CU9A 3WDUA 2ZGNA 4AVAA 3FUOA 2JIJA 3FHQA 4HK9A 4HXCA 3DUIA 3VD3A 4QX5A 1EUTA 3RMYA 2PAMA 1KS4A 1OI6A 3WP5A 3PJYA 5HPOA 1HRI1 1VBE3 4JKMA 1VAVA 2IXLA 3UYJA 1BJQA 3GDBA 2ZXQA 2WQ4A 2LW8A 5FUPA 2EXJA 2RS52 3UGHA 2QCSB 2KA3A 3O1SA 2XJRA 1OFNA 2JD4A 1FOD1 4Y24A 4J6GA 3IPVB 5A3PA 1OLQA 3LZZA 5JIUA 4OI4A 4CCJA 5A6YA 5T5OA 2BFUS 4MLOA 5DZEA 3P6BA 4XBNA 3I3QA 3PHMA 4UFMA 3VZMA 1MS8A 1D4VB 1PK6C 1QNYA 2ZX2A 1LKNA 5FUIA 4MXWA 3S5QA 2V73A 2H6CA 3ZYBA 3LEMA 3Q9OA 2BP6A 2WZR3 5FY0A 3GNEA 1A8MA 2EALA 3WQ7A 4YARA 2RM21 1KDKA 1REFA 3APBA 4I09A 5IATA 2R0FA 2HWB1 3N4MA 2R0HA 2JJ6A 1JU3A 3ZXJA 1W9TA 1R093 3OB8A 3I2JA 2XQRA 4NPLA 4RA0A 1OUSA 4K1ZA 4DO0A 1U12A 2ZGMA 4MHRA 4DEQA 1IS6A 1ZVFA 2B46X 5FPZA 1RGSA 3VBFA 2OW4A 1LHOA 3ZPOA 2VTXA 2Y6GA 1REEA 2GC2A 3DECA 2K46A 3ZFFC 4Y1XA 4QDSA 4A6OA 3ZFEC 1JHJA 1RMU1 1WD3A 1JBCA 4CXXA 4Q4Y2 5CIRA 1RUOA 3AXEA 3LSEA 4GH4C 1QNWA 4QQ2A 1OH3A 2HWF3 1ENQA 3WCSA 4B4PA 3K4AA 1NOVA 5A70A 1X8MA 3NNFA 2XBO2 1R1A2 3PIGA 3J7LA 1R082 4E27A 1SDDB 4IEXA 2GMMA 5HXMA 3J7NA 1XPWA 5I0DA 3N35A 4XBLA 3VKNA 1OOPB 1POV0 1UXZA 1RUH1 3WEZA 1NCRC 2NPIA 2WNEA 4YM3A 5BY5A 1D4M2 1RUH3 1R081 1UOGA 2RJ2A 1PO12 2Y6KA 1X82A 3I54A 1Q8PA 4PI0A 1RVF3 3O0VA 1YFUA 2X5IC 3WG2A 1WD4A 2VVDA 3PU3A 3UNPA 3WNMA 1GLHA 1VBA2 2XJSA 1H1IA 3LDKA 3ILNA 4FPOB 3B69A 4DNYA 1H2MA 5FZ3A 4BWOA 1GWLA 5I8TA 2DF7A 2WSUA 3M7AA 5K9YA 3WG4A 5LB6A 3NJZA 1AL0G 3MZHA 4ASKA 3MBWA 1ULGA 2DCYA 3SEEA 1VR3A 1W6OB 4AI1A 3B5LB 3BPSA 5D8AA 5C5UA 1OF4A 3RG0A 2OXBA 1VBD1 4FPFA 4HFSA 3JXSA 3CDZB 3OY8B 4IUGA 3TEXA 5FO8B 2AACA 4D69A 3AVRA 2B5HA 4KWKA 2E32A 2VL4A 3GZEA 5GZEA 5GLUA 3GBFA 1QOTA 1YNAA 1QJX3 4KI5M 4OHWA 2UYAA 2NM1A 5C4WB 1JZ5A 3OCPA 1UWWA 3V64A 3AP6A 3R4SA 1GICA 3B3QE 4M0NA 1SLAA 5LBCA 1CAXA 5JSRA 4IE4A 4MXVA 1HRI3 1VBE1 2QQKA 2JE9A 3W9AA 1LOFC 3NV1A 3UKVA 2GC3A 4XW3A 4EV0A 2Y0IA 1OPMA 5IFPA 2WA3A 3C3VA 2YB7A 4JHTA 1GZWA 2DBIA 4UW6A 4YG0A 4OZOA 1COV1 1CAWB 3MIHA 3WHUA 3FLPA 2D6PA 3OOXA 4QM9A 4IEQA 4Q4X2 4WBBA 3MYXA 1GP6A 3WCRA 2QTWB 1H30A 5IK5A 3U75A 2WN3A 3RI9A 4CDUA 3ELNA 4UF0A 5F5IA 2GZWA 2FHRA 1COV2 2A6WA 4E2QA 1RUC1 4HONA 1L7LA 3JUUA 1GOHA 4GA9A 5GLTA 3WDXA 4EROA 5A7OA 1D0GA 3UGFA 4FPHA 1ASJ1 4RR3A 4KWUA 5L7OB 3H8XA 3VZKA 5F3IA 5KWRA 1T6GC 5KXEA 4LOSA 5AFEA 1BBT1 1JMUB 1HN0A 3CMGA 3FX3A 3UKNA 1QOSA 4D8MA 1ZBA3 5H9QA 3VHOA 1OHFA 1S0IA 2JX9A 4QM8A 5FTTC 1POV1 2P1BA 3WZ1A 5FZCA 3NNLA 2RS32 4LNVA 5C71A 2XUMA 1M06G 3A0KA 1PX3A 5D21A 2ETEA 1PVC3 4FTSA 1O91A 4BMBA 1EP0A 2LTNA 1E5HA 1QJX2 4MGYE 4XF0A 3VDCA 3AZWA 3E5UA 2J1SA 3A23A 4UT5A 1UAIA 4QPIB 3UETA 1HB1A 1ULFA 3OGSA 4IV3B 4XETA 4P08A 3GXUA 3QCWA 3MIFA 5G05L 1N3OA 5LATA 3ZX7A 1AR91 4HBNA 3WXPA 4LKFA 4HK8A 2Z5WA 4NIDA 3KD4A 4CDQB 3T3YA 4BOWA 4AZZA 1UW8A 3T08A 1W9SA 3C7FA 4BH9A 1EV13 4EWAA 1XC6A 3USUB 1DFQA 3NNMA 4XJZA 3RWKX 5C8CC 1N1SA 3LQCA 4E4HA 4XBQA 5IK7A 4BQ5A 3O1PA 5L9BA 1WBLA 1AR92 2OVUA 4OUMA 3ABZA 3RQ0A 5AVAA 2GC1A 4AEKA 3HT2A 2RV9A 3KLSA 3K2OA 2PQQA 3NV2A 3VL8A 1UY3A 3Q8EA 1UOBA 4NRPA 4UW3A 1QGLA 1MPXA 2WS91 4Z1VA 1N1VA 1JZ3A 1MS5A 4GH4B 4PDWB 3VBUC 1PM7A 5FCCA 1L7RA 1JH5A 2W9XA 2WINB 3AMMA 4FP2A 4ONUA 4I0WB 4LBQD 1UPSA 4CEWA 1OH4A 2HYXA 3MLLA 5FWEA 1KJRA 4V2VA 2QQNA 5DAVA 4ZU5A 5T54A 3POEA 5LA0A 3GYDA 3PVBB 2WO2A 1JU4A 5F5QA 1DQ0A 4QWNA 4KGGA 3H8UA 2AEZA 1W0PA 2DFCA 2ERFA 2CL2A 2ZZJA 1S0GA 3AZZA 4CEWC 2R071 5GM0A 2DCTA 1W8FA 5IFTA 3KV9A 1EY2A 2C6SA 5F1RA 3GHNA 1ZZ6A 2Y26A 4K20A 2YFZA 3O12A 4K7JA 1AYM1 4KH9A 4DRRA 2JD9A 3ILFA 1XNDA 2WO3A 2YROA 2QDNA 4RS5B 1AR81 3GZTB 1QWRA 2ZKLA 2VZOA 4YW3A 2BDRA 3OBTA 2D6LX 5FJKA 1UKGA 3AZYA 2XH6A 3KHBA 2BZDA 3U37A 3IMNA 1W9WA 1PVXA 3MIDA 3MO4A 2W3JA 3VHPA 1QJU2 4YZ3A 3JB4C 5D2AA 3QBQA 4CDQC 1DZTA 1AVBA 2E7AA 1UX6A 3N9OA 4FFHA 4OZXA 5DZGA 1R092 3AC0A 1VBD3 3T1MA 2W52A 1AF9A 2JXAA 3BPZA 3VBHC 4AQ2A 1R1A3 2JG9C 4ZS3A 5IJRA 4YVSA 1TQ5A 1Q3EA 1ALYA 1AXZA 5HCBA 1OC1A 1F35A 2VUJA 4INDA 4NWVA 1EPZA 1KFXL 1LENA 5FYCA 2E31A 4Y1UA 2QKDA 4AI9A 5HV4A 1V6JA 3HQRA 5IHRA 3GF6A 2VW2A 4CDXC 4Q4Y3 4A7YA 2IUWA 1UYYA 3WNXA 3VBSB 4LT5A 2ZHKA 3CJIB 4YGBA 1WMEA 4ASMB 3BU0A 2IXIA 5KC6A 1H4GA 2HH9A 4D7YA 4H55A 1W8OA 4ITCA 2ENRA 3O7OA 1XB9A 3T30A 1WBFA 5BNNB 1W2AX 2W87A 5IK8A 4P00B 4LIUA 2KXLA 1SMVA 3ZN6B 1W8UA 2ZX3A 5FZ8A 5C9AC 2O8OA 2A6XA 3FLRA 4QXBA 1WLCA 2JWPA 3HD8B 4GMP0 4GD4A 2YYOA 1VMHA 3K48A 2BEOA 3MUY1 4IV3A 4XIKA 3U14A 4ATEA 4LUMA 4AW7A 3R4UA 1QQP2 4BIFA 2VG9A 4KWJA 1V6KA 3WDVA 1IKPA 3BTXA 1LOGA 3AJZA 4JRLA 4MGQA 2A3WA 4CDQA 2CAUA 1BVVA 4X6QB 2W46A 1XYPA 1FV2A 4Y1VA 5C6CA 1AL22 3FC0A 5FMCA 1KJLA 4N7IA 2AREA 4TLFA 5CG8A 4GKXA 3JD71 4AHZA 2WUHA 1DQ2A 4B3NA 4A45A 2Q5TA 4LUKA 2C9KA 2JKXA 4Q4V2 3AMNA 1GKBA 1PVC1 2DUOA 3NAPA 4BPZA 4EN9B 3FFQA 4XF9A 1HXS2 2WZR1 1O4TA 1FMD2 1ULCA 1ZNPA 2WSVA 3PVNA 3JD72 4FO9A 1AYN3 1WA6X 2ET7A 2E33A 3M3CA 4XFCA 3KGZA 1SLBA 3PJQA 2VQUA 4DXZA 2RR13 1W8HA 5IAVA 3NWKA 4IQPA 3MLKA 1RUG2 4OHZA 4LR4A 4A42A 5BNPB 2FCTA 4P9YA 4M3CB 3VUOA 1RHI3 3CIHA 3LD8A 1I6XA 3WHTA 4CCNA 1H1AA 3HN1A 5FDBA 2ADDA 2V4VA 3OBAA 5GZFA 1AX2A 3VKFC 1HJGA 1BMV1 3SH4A 4IETA 5HCFA 4AQTA 1QEXA 2XHNA 3NKGA 1OLMA 1W9FA 4COVA 1AYN2 1UZ0A 2VCBA 1V9U1 5F5AA 1NZCA 1RUE2 3Q8BA 4NOTA 3T4HB 5JXHA 1RITA 1V9U3 5KXDA 5EV7A 2JDUA 2GP5A 4NPRA 4A6SA 1W2OA 3MIEA 3UKTA 2EF6A 3RI8A 3MFCA 4Y3OA 5A7PA 3MI8A 4G3YC 1OKOA 1QY4A 1FOD2 3M4FA 2VMCA 2Q4SA 5E1RA 5CBLA 1RUE1 3NSTA 4ZU4A 4XIOA 3S6PA 4FOYA 5FYIA 3TN93 3ZFEB 1IOAA 3W5NA 1VRH1 5FLJA 2A3YA 4UAPA 5GZDA 5F39A 4CCMA 1MR5A 2ZGTA 5J3UA 4ZXEA 1RUI1 5C4WA 3IAQA 2XQXA 4L99A 1C1FA 1TNFA 1O8PA 4QKDA 4B8EA 2W1UA 5FXWA 3KT4A 3OYWA 1NCQC 4K8RB 2E63A 5ACA1 4LLFA 3WP6A 4FSJA 2BJSA 5JR2A 4UBGA 1RXFA 3PTRB 1FPN2 4IW3A 3TNPB 4GWJA 1FT9A 3CBNA 1IQDC 3F2ZA 4NPMA 4R4ZA 5E88A 5FZOA 4EN0A 1C8M1 5M0TA 4HVRA 2PMWB 3KGLA 3VBRA 1SFPA 3PUSA 4JQTA 2ZHNA 1H2LA 4YG3A 4AFCA 3PL0A 4CDWA 5ACA2 2P6HA 5AC92 1OPOA 2XDVA 1QHDA 1YFXA 3ME2A 1AR71 1QQP3 4CTEA 5A33A 2DV9A 2AC1A 1CD3G 4RFT0 2RMU2 5FYBA 2GALA 3T1LA 4BM8A 4LBJA 3WQBA 3B7MA 4GALA 3ZN6A 4EYUA 5E89A 5B2GB 4UF0B 4QX2A 1PGW1 3WDTA 2WWUA 4CP0A 5CISA 3DV8A 2W39A 4XHXA 5L73A 3V65A 2VUDA 5FZ9A 4BJ0A 1W8TA 3NNJA 2R043 1UIJA 2ZA9A 2VZ3A 5CU1A 1ZYBA 5BNNC 1L3JA 4GWNA 4FOQA 3WW1A 5A1LA 5CKMA 3S57A 1HKDA 4Q1RA 4ZZ8A 3AX4A 5I8SA 1KITA 3BIWE 5A3TA 1S0JA 4IXLA 4AVTA 4E4DX 3ZXLA 5EIYB 5L9RA 2GN3A 5FQ0B 1W6NB 2C0ZA 1CAUA 1GZTA 3ZXFA 3EBRA 5D1IA 4HKWA 3J8F3 5FZHA 4FFFA 4I3GA 1GYKA 3ASIA 4TYSA 4CEYB 3MV11 4URAA 1ONAA 3LDRA 5FPBA 2B9UA 3I3BA 3GCWA 4WM7B 3RFRA 2D7FA 4A44A 2WZEA 2BW8A 4P9JA 4XAEA 3OD4A 5C33A 3N9NA 4P02B 1WKYA 3S7EA 1DBNA 5FP3A 5C3OA 3K46A 4AHYA 5F32A 3HAGA 2H0BA 4COWA 4FFGA 4XUOA 4DXRA 1PO13 4P9GA 4NN0A 1I1EA 1UF2C 2VNGA 1NX9A 3DXTA 4TWTA 5HCHA 3H1MA 1S4CA 4CUGA 3T0BA 3U10A 1ULDA 4BQ1A 3UESA 1KS5A 1X33A 2GH2A 2V4AA 1EAH3 2CV6A 3I2OA 2PLV1 4XZUG 2Y33A 4OHYA 3IDAA 4MVTA 4AVCA 2MHFA 3D0JA 1B35A 2ZOEB 2WKKA 3LEKA 1VMFA 3LGRA 4LLOA 4RFRB 2KR2A 1X7NA 2A73B 5JXGA 2YC4A 3I2IA 1RL3A 4K40A 3V0AA 1DF0A 1HW5A 3PURA 2WWJA 3ACIA 3K4DA 3BI3A 5FYUA 4AI8A 5FAXA 1AR93 4JGYB 2JENA 3AMQA 4OUSA 3IZOA 2YGMA 2VGDA 2JIGA 4I0BA 2W1SA 5FZ7A 2JDHA 2J1TA 1PGL1 1CGPA 5CFCB 3ORJA 2A7AA 4R8HA 4UI9L 4MGZE 1RVF1 1VAKA 4QQOA 1HV0A 3U78A 1RUE3 2CWMA 4RS5A 5JSOA 1OVSA 1S2BA 1A3KA 1V6NA 2TUNA 4M3CF 3ZKUA 4Q8KA 1GMMA 3AXDA 5I0SA 2ARXA 4ZY9A 4B7EA 4XFIA 4YYOA 2OPWA 3TB0A 1AX0A 1Z7S3 3RGBA 3OSDA 2VQTA 4P9XA 3INAA 3VHNA 1GWMA 3OPZA 4XILA 1XJAA 4K1YA 3CF6E 4U2AA 2Z42A 5FKCA 2P3YA 1LTEA 3T0DA 2XL9A 1AR83 1BK0A 1NQJA 4JTNA 1TMF3 2WAOA 2XKPA 3CJIC 4FPLA 4CUAA 1W39A 1V00A 3SQOA 3VN4A 3FJSA 1DHKB 4XEZA 1CQ9A 4WM8C 1J1TA 5FZEA 4BIOA 1ND3B 1KD7A 1LGNA 5JZGC 1PZ7A 2RDSA 4XC9A 2N7GA 4PCRA 3WINE 4C90A 5JOXA 3WF0A 1SBDA 2WNUB 1SZBA 3CL1A 4HPKA 4YSFA 2X53S 4Q4V3 4F7ZA 3O1RA 1STMA 2D97A 1K5MA 2D3RA 4N7UA 5I0UA 4AG4A 4CU8A 1R1A1 4FQ4A 4BQ4A 2VCAA 5C9AA 1WMXA 1X50A 1UY1A 1AL23 3K77A 1IG0A 1K5JA 1PK6A 1UYXA 2V09A 2RS33 3GGLA 1W8ZA 3IKWA 4QHZA 1V6LA 4XFHA 5FXXA 4AAPA 1FNZA 2VECA 1UY4A 2B9VA 2R6QA 3AKSA 1D4M1 4HZFA 4XUQA 3DF0A 5FZKA 1WLWA 3GHMA 1SFNA 1PIV1 2ZTNA 3HR9A 4JDMA 3FUQA 4K9SA 2JKBA 1KGYA 2D6KA 4NWWA 1A6CA 3ENRA 1D2SA 1Z0HA 1LOBA 4TN7A 4NHXA 1AR61 1UNBA 5FMBA 1OA3A 2ADEA 1NA1C 3D3AA 2BYVE 2WS92 3NJXA 2VMDA 4Z8BA 5SV5A 5D8AC 4R9BA 2FDIA 4S2GA 3MW3A 3RZGA 2H6BA 2L9LA 3MIGA 4Q4W3 1W6MB 1DQ5A 2WNVB 3M3IA 4IE6A 4XUNA 3POYA 5DABA 3E6CC 2Y6HA 4UFLA 1PMHX 2RS13 3RSJA 3TYJA 3ZSKA 4RR3C 4B7KA 4Y20B 1AR62 3V0BB 4XDOA 3HEIA 5H9RA 3H3LA 1RTVA 2VD7A 3UL2A 4NUBA 5BNOA 1ZA7A 1O3RA 4HPKB 5HV0A 1HB3A 5JMCA 3H8OA 3NV3A 4PLOA 2UURA 3K51A 4JGZA 3A4UA 5ABJC 2FMYA 4FOWA 2WFF3 1OQ1A 3NAPB 4LKSA 4M01A 2HWB3 1VBA3 1CWPA 2F4PA 4FBFA 5H9PA 1ZRFA 4YNIA 1CAVB 4GJYA 2IWGB 2LM3A 2W92A 2X5IB 1NCRA 4IGOA 5FPAA 4CEYC 4IE7A 2JG9A 5A6QA 2ZGPA 3TAYA 3ZYIB 1RUD3 3DPRA 4JGYA 1QJU3 3OGGA 4LHSA 3J7HA 2PHDA 3JBG1 1QJZA 2DVGA 3C7EA 1IS4A 5B4XA 1H6XA 3ZYJB 1QJU1 3PVOA 3NW4A 4D7SA 3PTYA 1VBB1 3LIGA 5IVFA 4HKLA 2VOWA 2O1QA 1CJPA 4B4RA 3J26N 1OURA 1V0AA 3T0AA 4GB32 4QAWA 1TG7A 2WYSA 2YBPA 4FPEA 2D5HA 2WRAA 1MEC1 3FHIB 2BVVA 3ROUA 2VTXJ 2VW0A 4CDUB 5F2SA 3CZJA 1RUC2 2G1MA 3AP5A 3KCYA 1CJDA 4Y22A 3ATGA 4PIYA 4JDNA 4XJ9A 3I59A 1WCQA 4J1XA 3OEBA 5FZAA 4RN5A 3ZYRA 1YQ8A 4IL7A 5DUXA 3IMMA 1Z7S1 2RDRA 4N9HA 1RUJ1 3RRDA 4DPNA 1XU1A 4LITA 2VAUA 3ZFEA 4AHXA 4OMDA 3LCPA 3ZO0B 4LHKA 4V1PA 4CZSA 2YPJA 2NP0A 1CESA 5CVRA 2B42B 1JYWA 1PO22 2XONA 2D6MA 1R083 2VH9A 3S5AA 2YC2A 3LA3A 3BB6A 4GAZA 4WVZA 3PUAA 3MIBA 4DRVA 1MZ6A 5A1AA 1D0HA 2CGOA 4Q0SA 1MS0A 1PO21 1TEIA 5FBJA 3E5XA 4YZ5A 1AYM3 2BWCA 4QPGB 2WNUC 3LIHA 3W21A 4BZ4A 4O65A 1W6QA 2VW1A 4W6YA 1I5ZA 2OPKA 4H2AA 1AL21 1NE4A 2DU1A 4QX8A 1JHNA 2VZSA 3SCGA 3LA2A 5A3NA 1QXRA 3O1TA 2CY6A 5FP9A 3POSA 4FQZA 4LBQB 4N43A 1IPJA 3X29B 1G9FA 4Q0QA 3BTAA 4QU1A 3GBGA 1PVC2 3KV4A 2QBXA 4XAAA 2IXJA 4XYXA 3ZPYA 1QH6A 5A1FA 5BNQA 4TTGA 4QQLA 4DXSA 2WZR2 3IM0A 1POQA 1UIKA 4HN1A 1F31A 4CDUC 2OYZA 4GKYA 2XOMA 4OHVA 2WYFA 1N1TA 2XG3A 5KHIA 1ULPA 3LF7A 2R063 4EZ4A 4GQ7A 1RUG1 3H7YA 5FXZA 4FCAA 3B00A 2Y34A 4SBVA 4OMCA 1UY2A 2R30A 4MUVA 2ZGKA 2VOKA 4F3JA 5A32B 3E6BA 4HANA 1YQCA 4DUVA 1COV3 3S0MA 4FTEA 4IV3C 3ZOIA 3B02A 4TLGA 2C9AA 2F6BA 4WM7A 3T4VA 2BNOA 2VZ1A 3O0WA 4H3WA 5DAQA 1A8DA 3DXUA 1F5FA 1C5HA 2HWC2 1UZYA 1V9U2 4AVVA 5LA2A 1CZVA 4OUEA 4Y5SA 4ZXKA 3H8RA 1VPHA 1MVQA 2DFBA 1CZSA 3BU7A 5J09A 4YG6A 1RUF3 3F95A 3G6JB 1SCRA 2Y0OA 2WFF1 2XVGA 3GCXA 1QKQA 4R9AA 4YVWB 1FATA 4CCEA 3O1MA 4Q4W1 3HWJA 1JYCA 4LBMA 4CEWB 1PNGA 5FPVA 2AGSA 2D6OX 1QH7A 1R091 1LR5A 2RE9A 4JDOA 4BYYA 1JI6A 1LULA 3FHAA 1R64A 5JWPA 4A3ZA 1DU3D 4AF9A 5G04L 3JBG3 3VZLA 1TZOA 1VALA 2HWE3 4RS5C 4WVWA 3TEYA 2X10A 4AHWA 1W90A 1XNCA 2W94A 1OSGA 4IEUA 4ARXA 2XUEA 3Q8FA 1C57A 1ZBE1 2D3PA 1O3SA 2PHLA 3ZLIA 5ABJB 4NIGA 2OZJA 2NZ9A 2AEYA 4ARYA 3E5QA 2FDHA 4AGRA 5C70A 3V0AB 4QQHA 5BNPA 1DP0A 1VBC3 1Q8QA 1UYPA 2EIGA 2JG8B 3VDDC 3ZXDA 1H2NA 4ZU7A 1MS4A 2OT7A 3SITA 1E5RA 1YQ5A 4GWMA 4KU8A 1CX4A 1W6QB 1C8M2 4RQPA 3ZFGC 4JV4A 4EN8B 1OUXA 4QKNA 3CQOA 1ZRIA 5AC91 3JU9A 5J48A 5C5TA 1RMU3 5BNNA 2BGOA 3GBWA 5FZ4A 4Y26A 5CA6A 1CVNA 2WO7A 4P14A 4GIQA 2E26A 5JR7B 3NRUA 5CAZA 2RMU1 2GAUA 2IZWA 5E8AA 4CA9A 4DUWA 4K6BA 5JOYA 3O1VA 2ZMLA 2C4XA 4XCAA 4KGQA 1PNFA 1XE8A 4BU2A 4BK4A 1GZCA 2EIBA 4OLLA 2ZGLA 5L19A 2GDFA 2WT1A 5I93A 4LK7A 1GNYA 3MW4A 4QPYA 1RUD2 2VQ0A 3HNBM 1SLLA 2PHRA 3HQXA 4YM0A 5FP4A 4PHZA 5A3OA 4ZHNA 1VRBA 2HBTA 4S2FA 4YW2A 4HG6B 4XE9A 4BB3A 5JXJA 3W5MA 4DEVA 1PM4A 2VOTA 5T52A 2E7TA 3HQUA 4YGDA 5A7QA 1LHWA 3LPFA 4LQRA 1ND3A 1PMIA 3POGA 4KU7A 3AP4A 4OI1A 4E2SA 3VBOC 2DCKA 4Y33A 1F4HA 1RC6A 2VNOA 2HWF2 3I2GA 1O59A 3ACHA 4AQSA 4YVSC 3IDEA 4GZ9A 4IEYA 3WT3A 5KC5A 1M4WA 2ZEWA 4FPKA 3RZKA 4YVWA 2Y8KA 3UGGA 2DCJA 4KBBA 5IWFA 3WW2A 5JLVA 5CYYA 1PO23 2F17A 2P3IA 3IAPA 1BEV1 1UU5A 4META 1QMJA 1SG3A 4DS0A 2JG8C 1BYHA 1S0BA 4L2NA 3IN9A 4YFWA 5F8PA 3AYCA 2A6ZA 2R042 3KQRA 3OPWA 4MXWB 1WZXA 5J36A 2VXRA 4AGVA 2J1RA 1IPSA 4A4AA 4LJHA 5C8WA 2OQ6A 4KG8A 2VBPA 5K7PA 1QU0A 3M70A 4W65A 3N9MA 1HX6A 1ULOA 5JPNB 1G8WA 5BUVA 5LCWL 1XYNA 3WD5A 5ABJA 4AFBA 4XQ4A 3ZKYA 1C3HA 1NKGA 1MQTC 1DG6A 2R041 1K5MB 3WNLA 5BYNA 4TZDA 3DYMA 5FYTA 5FYMA 4LO5B 5DAXA 2GNTA 2IFRA 2VQAA 4XXPA 3MGUA 4D0QA 3M3EA 1RXGA 3CKHA 5KHGA 3KF5A 1BQPA 2ZGUA 4AFMA 1HLCA 2GP3A 2VCCA 3BYWA 5KHHA 5C3QA 4I30A 4LE3A 2R16A 4FAHA 2VVEA 5F3EA 3WP4A 4PI2A 2CSGA 3WQ0A 4YZ1A 3C7GA 3BUCA 1NYWA 3I8TA 1Z78A 1W6PB 3N7LA 1T2XA 4QQPA 5EJZB 3ZDVA 1CPNA 4C0HA 5HI0A 3BKZA 4QXCA 1HQNA 4QPIC 2Z69A 3NJYA 4CDXB 4DXTA 3JQWA 4LBKA 4LORA 2R49A 3BIEA 3LFMA 5KR7A 3ZR5A 2PAKA 2YFUA 4LHLA 3M1HA 2XMLA 3DYOA 3PUIA 1UY0A 3HN3A 4LULA 1XSQA 4XJWA 1RMU2 1HRV2 4ATFA 3FBMA 4M00A 5JOZA 2QUOA 2ZABA 1RJ7A 1KRIA 4XFGA 1HJFA 1J1LA 1GSLA 4RQPB 1UQXA 2ZGRA 4BK5A 1B09A 1H9PA 2IXHA 3OEAA 3HVDA 1GU3A 4Y20A 1AR72 1OQDA 1HRV1 1IS5A 2RS12 3ALQA 4CEYA 2ET1A 4CYDA 5BNOB 3BN6A 5EYYA 3THPA 3MF6A 5T5PA 2JDKA 1YUDA 1QOOA 1DQ1A 5FUNA 4NIIA 5J1XA 2Z79A 1JZ7A 3KB5A 3ZYGA 5DMYA 2EXHA 2HWE2 1HB2A 3CHXA 2EAAA 3WW4A 4WV8A 2MNGA 4CP9B 1APNA 4E8CA 4EWEA 3U07A 1QJFA 4DB5A 4XABA 3P3NA 2A3XA 3MPBA 2LRPA 1W3VA 1BCXA 1K12A 4CPBD 2D40A 4LO6B 1J58A 2PA7A 1W28A 3RMXA 2QQWA 1NT0A 1ZBA2 3IBMA 1N1YA 2P4EA 2VBBA 2YMZA 3WDWA 3MEPA 1RYYA 3VBFB 2TNFA 2ARCA 4NAMA 2VZPA 2WQZC 1ZZ7A 4CSWA 4NIAA 1GV9A 4CDWB 3NAPC 2GNMA 2A6YA 3ZYPA 2PYTA 4YGCA 4IEWA 4O9GA 2HWC3 4C0BA 4YFZA 1O5UA 5EQUA 1C4RA 3N7MA 3I3DA 4XFAA 5A7WB 4D94A 2XLAA 3O1OA 1PHMA 4CCDA 1V6OA 2BWAA 3WW3A 4Y5Z0 3H1YA 3ZXGA 1NAEA 4X8PA 2B7YA 1UMZA 1BLZA 4JVAA 2DUQA 5A3UA 4I02A 1WGPA 2PELA 3PNAA 4HN0A 4Y5TA 2WO1A 3ZXEA 4AVBA 1X8EA 2G9GA 2WNUA 5FMDA 4CP1A 3MFAA 2PLV2 3J8F2 4WVMB 2QZ3A 3SH3A 2ZKNA 4WM7C 3LFIA 2B45X 4M4RA 4XCBA 3VD7A 1RUI3 4DOUA 5CFDC 1E5IA 2EIEA 2B8MA 1V6MA 3AL6A 5FIXA 1A78A 2AYHA 4HKOA 3RVHA 3N3HA 3R6SA 1VRH3 4W6WA 5FO9B 5F6LB 2DURA 3QOPA 5C8CB 2E6VA 3VBHB 4WM8B 2IVIB 4L0PA 1GBGA 2ZS6B 4R4XA 2WN2A 5GJ6A 4MADA 1ODMA 1S2KA 2DWRA 2GMPA 2Z2SB 3EJKA 5FZBA 4JAAA 1MZEA 3PVEA 1ENSA 5CFCA 2JDMA 5FMOL 3URFA 2WLPA 1LJ7A 5LBEA 4FPJA 1ASJ2 2BU9A 3LPGA 5EJ1B 1XNBA 1NCQA 2E53A 1E57A 4EQVA 5HBAA 1GUIA 3KWVA 4GB31 4Q29A 4C1XA 4QPIA 2Z4FA 1BBT2 2PAEA 2RHPA 3WDYA 2I74A 1DQ6A 2FBEA 1E5SA 3S30A 3DEMA 2WT0A 3QH6A 4JCKA 4JQRA 2VPVA 1PZ9A 1UCXA 2Q8EA 4EE2A 3ON7A 1G9CA 2DU0A 5J37A 4HVQA 1I5PA 4E4ZA 1YIFA 2D98A 2QDRA 4M3CA 1SBEA 1ZZBA 2DVFA 2R061 3L9JT 4P9IA 4YW6A 1X36A 1CPMA 2OX0A 5F3GA 1H4HA 5T55A 4XOGA 3VDAA 3KHCA 1LCLA 3AP9A 3THTA 5APAA 3NJVA 4GJZA 1NA1B 2KM2A 3SKVA 1HIXA 4IEZA 1YFYA 4V2WA 4AXOA 3UT0A 2W2IA 4DY3A 3QLQA 4YRDA 1B35C 3POIA 2YU2A 5DG2A 1BBT3 4NJ4A 3IIIA 3CZUA 1WCUA 2ARAA 3IPVA 5A3LA 3UK9A 4IGPA 1ASJ3 3ZFFA 1GR3A 2DVAA 4AL9A 3FN9A 3WUDA 4HOOA 1O3TA 4QX1A 5BNOC 2E7QA 3USUA 4FP3A 2PHXA 1XNKA 2ES3A 3AB0A 1YO8A 3AKRA 4YVWC 1ZREA 2W1WA 2ZGOA 3KF3A 4MOAA 4Q26A 1G9BA 3W20A 1Q5OA 1OFSA 3H50A 4K8FA 1JZ8A 2WT2A 1OQEA 1S0DA 2FD8A 1YRZA 4AYUA 1TNRA 3QH7A 4OVEA 4LPLA 2VC9A 4OULA 2YZ4A 1ENRA 4CXYA 3MUZ1 2JG9B 1RHI2 3KSCA 3VKLA 1YHFA 1VBB3 1WLTA 2XLFA 5ANQA 3T2TA 2RMU3 2AUYA 5T5LA 1LHVA 1V70A 2DCZA 3D8CA 1YC61 3GZAA 3DL3A 2X8KA 2EA7A 3FZ3A 5FQ0A 4UOJA 5EYXA 4RYDA 2VO5A 3U4XA 1UXXX 4DINB 5JDBA 1J3RA 1XSRA 1RHI1 2JDPA 1W0OA 3BOWA 2FDGA 2OZ6A 4F83A 4ES8A 2XVLA 3VD9A 2R32A 4W6XA 1US2A 1W9YA 3L2HA 3ZVXA 1RB8G 1G86A 1IHMA 4TXWA 1NG0A 2RS53 2BFUL 4DMIA 5JI9A 2NMNA 3CLPA 4Q4X3 2HWC1 2AENA 2GH8A 4X6RB 4XJUA 1YI7A 3SISA 1DDLA 3E1F1 3AYDA 3K3NA 3B93A 4B29A 4UXAA 4BHPA 3RYKA 4BXFA 2YC0A 3ZXKA 3KT1A 3OY8A 2JB4A 2PHFA 5DUWA 2HWD1 1YJLA 2GNBA 1TMF2 3EO6A 2WA4A 1VBB2 2WNVC 1IZ3A 5CFDB 4N53A 1XE7A 2ZHMA 4BDVB 2XPJA 3J7MA 3KCCA 4LXLA 4QXHA 4D3WA 5LRSA 4QT6A 2VBDA 2EIDA 2XJQA 1YYNA 2J42A 2ZBJA 4ZS2A 4N9IA 3J4UH 5F7UA 4QPWA 4UFHA 1VP6A 5A6ZA 1H1MA 4FAGA 1TMF1 4NHMA 3HPNA 2QE3A 4DUXA 5GKAC 1OXCA 1US3A 1SCSA 2WC2A 4XXAA 1F2NA 5C4WC 1O4YA 2PFWA 4AI0A 1LHUA 3ZFFB 1N3PA 2FQPA 4CXWA 4B1MA 2XR4A 3ACLA 4L9BA 3WQ1A 4FTBA 1W03A 3UJQA 3T2PA 2YU1A 3EMRA 1WCKA 3OGRA 5A32A 1WW4A 3MHZA 1DGWA 4IDZA 2GSYA 3EXUA 5JVVA 4IV1A 3E6DA 1YLLA 2BBAA 2D43A 2VCMA 3UJOA 1G9DA 3D5OA 2DBNA 4A41A 4CU6A 2Y6JA 1SLIA 4UFJA 3JZVA 2BOIA 1TVGA 4XFFA 2QQPA 3CJXA 1LOFA 1QQP1 3AM2A 1Q8SA 3D82A 3ETQA 3ECQA 5FYZA 5FY7A 1G7YA 1VBD2 3GALA 1HQLA 3H3UA 1XBFA 1LODA 4D6SA 5IVCA 1OF3A 2YPDA 2FZ2A 1QDOA 3M2MA 1D4M3 2C24A 2CTVA 2WDBA 5LA9A 2CWSA 4G4FA 4YLZA 1K45A 5FK8A 3EB7A 3FBYA 4YW7A 3FWEA 5KHKA 5EWSA 1DZRA 1WLDA 1W04A 2HEWF 3J9SA 3NVCA 4HETA 5E16A 5FYHA 3VBSC 1C28A 1RINA 2VZQA 2QQVA 1J3QA 4UW5A 1HXS1 3CO2A 3H0OA 3KCXA 2QFEA 5K8SA 4P5YA 3NV4A 1BZWA 1OOPC 1W3XA 1UL9A 1RUC3 2XWBB 4L11A 1WWYA 3A0NA 5T3NA 3VLBB 5FV3A 1K3IA 4Z92B 3SNMA 1R1ZA 3RS6A 1P8JA 2H0VA 4RGAA 2C1FA 5FY1A 2HLEA 4QXKA 5SV8A 3AZVA 1GWKA 2P3KA 2J22A 4AOCA 3OJBA 2ZMKA 1SQ4A 4XTMA 4N90A 1CZTA 3H1WA 3RJ2X 5L36A 5LBBA 4LMFA 2RDNA 2PHWA 4XACA 5FY9A 3I7DA 1AHSA 1AYN1 2GC0A 3GJAA 5FKBA 2QQOA 3RWNA 1D2QA 1DYOA 5EFUA 3ES1A 1T6BX 5LK7B 1EV11 1EUUA 3LB9A 1LOEA 2XLGA 1W8WA 1ZZCA 4U36A 2YDEA 5LY2A 4O7XA 2J1UA 3I49A 3I97A 4QB2A 4CP2A 4BQ3A 2IXCA 2ZPXA 4JKLA 2XJUA 1J83A 2I45A 2ZGSA 2UY9A 2QZ2A 5BPXA 3PUQA 3V56A 1JZ4A 4UBHA 1IQAA 1EV12 3ZDSA 1EYBA 2W1QA 4N53C 4XDQA 2GU9A 4ISRA 1FX5A 2WLQA 1DYKA 5AC93 2W95A 1H2KA 1GQHA 1XYOA 4KG0A 2BNNA 3VBRB 2VMFA 2JDZA 3NO8A 4Q4W2 4R52A 4EWDA 1ZRDA 3ETPA 1WW7A 3D0SA 5JIAA 2R073 5FY4A 2AZ5A 4NRMA 5JAXA 1UN1A 2WS93 3JQXA 4WVMA 3VL9A 5CFDA 1YJKA 1F4AA 3VBUA 1QXPA 1FPN1 2K2SA 1ZX5A 1O6UA 1WA4A 4MHUA 5EHDA 3I2FA 1LHNA 1Q8OA 1ZBE2 1JUHA 1VB4A 5LWBA 2CAVA 1JYVA 1JUIA 1QDCA 2Y6FA 1DQ4A 2OQ7A 1FI2A 1KEXA 4PLMA 3WR0A 1MS1A 2BGPA 2QQLA 2A5ZA 2E9QA 4ISQA 3VDBA 3P5BA 3ZFGA 4D6RA 2E51A 2ZAHA 3DN7A 5TSWA 3RZHA 4FFIA 4YZ2A 1W2TA 4CE8A 5ACA3 3WF4A 2W47A 3AL5A 2UU8A 4YM2A 1NXMA 5LEKA 3BOPA 3RZLA 1W6NA 2XHKA 2Y60A 3RYRA 2FCVA 1LECA 1LNSA 5FOJB 1NY72 1VBC2 4FXKB 4JC1A 5FPLA 3SCFA 5FYSA 3KVAA 1KFUL 2A6VA 2VMHA 3FFZA 3AFGA 3KS7A 3SCHA 2JDYA 1H6YA 3PMEA 2X09A 1FV3A 1AR73 4PDWA 4E2GA 2DVBA 4BCUA 2ZX4A 1NY71 2EICA 4IEPA 1OOPA 2ZGQA 2CNAA 3DPRB 5C7GA 5K0UC 4C91A 5GLVA 3KM5A 4JKKA 4BQXA 2P5BA 3ACFA 1AR82 3IT8A 2XVKA 4BQWA 4NHYA 3LEIA 3RDIA 4CCLA 2TBVA 1EPWA 3LE0A 4GMP1 2Q1FA 5CKQA 4QGLA 2WZ8A 2HEVF 1I3HA 1RUG3 3OUJA 1AUYA 4LK6A 4LOTA 1FOD3 2RR12 2YBSA 5EXOA 1DYPA 1X9TA 1NQDA 4AEDC 5FZIA 3PIJA 4BMEA 2VNVA 3POFA 1NA1A 4BQ2A 2VM9A 5EJ3A 4KBZA 4YW4A 4AAXA 3TOJA 1HXS3 3AYAA 5IUQA 4CUCA 2MEV1 3DKWA 1TME3 4W8JA 4W4ZA 4YPJA 1ND2B 3IDCB 1CN1A 2VZVA 3OBRA 2JB8A 2X29A 2YHJA 1ACCA 4LA2A 3B9CA 5FLHA 4BXSV 1LGBA 2EXKA 4A2UA 3HNYM 3I2HA 1NUKA 2WABA 4QX3A 3T2QA 2JDAA 4LIVA 4Z2WA 3LOIA 1JS9A 1AXKA 5I8YA 4AK3A 2VR4A 3LAGA 1HRV3 3RZMA 4DFSA 4MYEA 1Y4WA 2Q8OA 4AEJA 4NO4A 1BK1A 2LUWA 1QJY2 4RHV2 4UFIA 5FJHA 4BLIA 1ZBE3 3J8F1 3JD73 3MV01 4P9WA 4XPVA 3RPQA 1EAH2 1SACA 4MG2A 5CZKA 5H9SA 2Y38A 3O0XA 3O5SA 1U0AA 3I2DA 4MZUA 1LRHA 4H7LA 4PLNA 5IT6A 5JPMB 2NN8A 1MACA 2CGNA 4AEMA 4XMIA 3PLQA 1WMDA 1ND3C 1H8VA 1EAH1 3RNSA 5KXBA 3SMHA 2DYCA 2DTYA 1ULEA 4KNCA 1XNAA 5IK4A 5IVYA 1FXZA 4PF1A 5L9VA 2VOVA 4QPGA 1OKQA 2ZEZA 1BKZA 2ZAAA 2FZ1A 3ST7A 3JCIA 5I0RA 2WBKA 5GALA 1HQWA 2IVJA 4N43C 2DUPA 2ILMA 1W6PA 5F3CA 4LBLA 1XRUA 4CDXA 4IESA 4LBQA 2QJVA 3T2OA 1VLNA 1DZQA 3C2UA 5GLWA 1OD5A 1JTZX 3ZM8A 3R4DB 4Q8LA 3AP7A 4RR3B 2R7EB 3VB9A 2XGXA 1ZRRA 3LWCA 1UPIA 3LOBA 1GOGA 4N53B 3VDDB 4FPCA 4Y1YA 3I2KA 5FZLA 1JYIA 3VBRC 1OVPA 4QMAA 2HBUA 3AMPA 2P37A 4MGSA 4PT6A 1FYUA 4LO4B 1OBNA 2ZCWA 5B4NA 1BVP1 3OYWB 3B01A 1DIWA 5K4LA 2XKOA 3SH5A 4YM1A 4PIZA 2RS51 4I0AA 5GLZA 1BMV2 1KXGA 3B94A 3FL7A 3MICA 5CFCC 3ZIXA 5FP7A 2EXIA 1JOJA 4XMAA 2VZUA 1YQ2A 1C8M3 2C26A 4C8DA 2A71A 2VZRA 4UFKA 1PIV2 4OQ8A 1MS9A 4L97A 3UV9A 4IE5A 3M3QA 2WFPA 1Y7BA 3U11A 4JGYC 5DAWA 5DQ0A 4NRQA 5JZGB 5FO7B 1W06A 5FZMA 1JZ6A 5JSPA 3WVJA 4Z82A 3N9PA 2UWBA 1H8TB 3USSA 5LW9A 3PU8A 4IEVA 1LU2A 3WSOA 3WG1A 1JZ2A 4RGGA 5IVBA 1W0NA 5A3WA 4MGTA 1ZRCA 5DDJ2 3PMSA 3LA7A 4H14A 2QQIA 4NR1A 4XQWA 1JW6A 2I2SA 2YG0A 2HWB2 4ZONA 5JUVA 4AR2A 3OF1A 1UKRA 2W5FA 2WIIB 4XTPA 1H9WA 1ND2A 4HMZA 1UMHA 5EP9A 3VDDA 1VMJA 2WWSA 3BALA 4QGNA 5JXIA 2FDJA 2LROA 4AQ6A 4CP9A 1SLCA 4G9SB 2VMGA 5FK7A 4XQDA 4OQ9A 1DCSA 1NLSA 3A22A 5DDJ1 1S2EA 3GZUC 3M8LA 5FOBB 1W2UA 4Q5OA 2VMEA 4RL7A 4RD7A 3I3EA 1TME2 4COZA 4COUA 4UYBA 2BVBA 5DXDA 3SKJE 3MW2A 2FDKA 5LK5A 2Q8DA 3OGJA 4XJ8A 5IVEA 5FPXA 1ZM1A 2P34A 4Y22B 2RJKA 1OD3A 3JBG2 1WW6A 1MS3A 1H8TC 1O7FA 1YEWA 3OGVA 1TME1 4FXGB 4RSUA 2V72A 4EN6B 2JICA 4QPGC 1S55A 4D7TA 5DN2A 1XXNA 3OG2A 4CCKA 1J59A 1POV3 1PGW2 1OLME 4M4PA 1MEC2 4LEJA 4QB6A 1UMIA 5DZFA 3HBZA 2WNVA 3ZR6A 4DQAA 1G9AA 3ZSEA 1Y43B 3KZ4C 1SDWA 5FZGA 2D3SA 4XZPA 4AGGA 1SFYA 1Y9QA 5CNAA 4E9KA 5JOWA 4NIHA 3AKTA 1PO11 3AMHA 2LALA 4Q2FA 5A33B 2ZX0A 1I9RA 1U5ZA 4ZZ5A 5GZGA 1AXYA 2C5DA 1W05A 1RUNA 4XF1A 2CYFA 4A7KA 3WNNA 2A75A 3NQHA 2YBKA 2PXJA 2W0XA 4M0HA 2RJLA 2AH2A 2PQSA 4MGKE 4OCTA 4KMQA 1IPKA 2PN5A 3KQ4B 1UU6A 2D93A 2XJVA 4YZ4A 1Y9GA 1UZWA 2DTWA 2ZEYA 3I59B 4NMIA 2VE1A 5FY5A 5CADA 3Q8CA 2O0OA 3ILRA 5LA1A 5D8AB 3B9IA 4QKBA 1MZFA 2IXKA 2R062 2DVDA 4TSVA 4CCCA 3QD6A 1O4ZA 2AR6A 1MEC3 1RJ8A 1HB4A 1Y3TA 2V5YA 1YWKA 3AVSA 3MF9A 3P3PA 5F6KA 1HRI2 2ZZQA 3WF1A 5A3MA 3PDQA 1NZIA 2VY0A 4AI2A 3VZOA 2ID4A 4Q1PA 4MH0E 4BLJA 5FYYA 2P17A 1O5LA 4FOVA 2Q0AA 2Q1ZB 5DG1A 4JHZA 5FFOC 3C7HA 5FBZA 5ERLA 1UU4A 3VKOA 1MZ5A 4AEDA 1YFWA 2VU9A 4EJRA 1G6NA 4PQ9A 3LSDA 4AE2A 2HWD3 1O3QA 3AZXA 5FYVA 1S0FA 2LS6A 2VZTA 4QD2A 4LO7A 4FPYA 1VB2A 3M3OA 4Y1ZA 2BGCA 2IC1A 2O8QA 3MDPA 1GFF2 3O14A 4MX3A 3WG3A 2K0GA 3N7KA 2VVFA 4ASLA 4Q4X1 4OFGA 1ZZ8A 1UO9A 3RZZA 4HLTA 4XFBA 4HL0A 2VUCA 2HJIA 1PGL2 2RM22 1S1AA 1SPPB 3NKTA 2X05A 3CEWA 3ZYHA 5CKNA 5BXXA 3POJA 1RVF2 4BE3A 1SEFA 2ARBA 1CAXB 4CRQA 3ZSMA 2VJXA 2B4KA 4JGZC 3VHRA 1PX4A 3HNMA 1GNZA 1NLRA 4XVHA 2UWCA 3ZMOA 1ST8A 4HSJA 2Y6LA 2ZMNA 4BA6A 4HT1T 3FLTA 2ORZA 4Q4Y1 1LGCA 4HVOA 4NAOA 1XU2A 2RS31 1PIV3 5HXVA 4Y4RA 4LHNA 4KWLA 3A7QA 4OI0A 5F5CA 5FY8A 4FT8A 2Q8CA 3ITQA 2XBO3 4GH4A 5DPNA 5FP8A 1RIRA 5I0TA 2YY1A 5J7MA 1KQRA 1AX1A 2WFF2 5KXCA 2XL7A 4QX7A 5A7NA 1QJX1 5A7WA 4H7MA 2XBO1 4O9EA 3THDA 3ZSJA 3VBOA 1OA2A 3C7OA 4B1LA 4GB33 4K3UA 4CVUA 4J1WA 3W59A 1ODNA 1JOPA 4O61A 2UY8A 2G4IA 5I91A 1CX1A 5A80A 1KDMA 4KQ7A 4QB1A 1AR63 3VZJA 4CPBA 2JEMA 1RUH2 4WZCA 5FPUA 2HWD2 4IV1C 5JI7A 4EN7B 5LY1A 4I3PA 4MV2A 4XJAA 5K0UB 1Q8VA 2W68A 3POBA 4GXLA 2QVSB 4NROA 2G9ZA 4FVVA 4JGZB 3PUHA 1LEMA 1K42A 5J96B 4S2HA 2BBVA 4YW1A 3WNOA 3WNKA 3I3MA 1VBA1 2X5IA 2ZJCA 1RUF1 1S0CA 3OD0A 2RG4A 2RM23 4UWDA 1YIPA 5FZ1A 3OTFA 5EZWA 4X8NA 3BCWA 3TNQA 1UOJA 3VBHA 4DIQA 1AJKA 1UYZA 3VV1A 4W50A 4COYA 4I01A 4LTAA 4OYUA 2A1XA 1RUF2 2JG8A 1JODA 3K4ZA 3EQEA 4Y4YA 1C5IA 5J98B 2NYYA 3G7DA 4OHXA 4Q0PA 4QDRA 3BGAA 5BNPC 4XF3A 5FWJA 1PZ8A 2BQPA 1CONA 3AK0A 3IB3A 4XURA 2BV4A 3SXWA 1PMJX 2R1DA 3NMBA 4URTA 4S2DA 1CR7A 4CU7A 1XOYA 1VBC1 1GNHA 1RUD1 4NHLA 4OI2A 1WMFA 4Q27A 2J7MA 1Q56A 5AVPA 2FDFA 4D6QA 3OUHA 1VBE2 3HJRA 2V5DA 1JOBA 4AWDA 4C1WA 1WCDJ 3VBFC 2NLRA 2UYBA 4ZPIA 3TBDA 3GJBA 1BXHA 1LESA 3L2YA 2OKXA 3CNAA 2DDUA 5A6XA 4JX0A 2HWF1 5JCTA 1LEDA 3OPTA 1LB2A 3TWIA 1URXA 2CHHA 1IKQA 2K9ZA 5ANNA 4KL1A 4QHBA 1AZDA 2O14A 4R9CA 5IYYA 5CEHA 1W2NA 4A3XA 4HSLA 2MPFA 3K3OA 4IE0A 2RVAA 4JZRA 5EPAA 2BPA2 2UWAA 5IAXA 1J84A 3AJYA 5T50A 1BEV2 5FR3A 4I2OA 1DGRA 1L7QA 1CAVA 3HMYA 4J25A 5FLIA 4PBOA 3ZFGB 3ZYFA 4AI3A 4DZGA 1CIYA 1WUVA 2XXZA 3DGTA 2KD7A 3CJIA 3HT1A 2NQYA 5KHJA 3WX5A 1F8VA 1OMIA 5T5JA 3C8XA 1A34A 3ACGA 2QQJA 2J1AA 3K75B 3HIFA 4E4SA 1JN2P 2WJSA 5JZGA 2A70A 1D7PM 2HKXA 2NMOA 1OA4A 3LKJA 5DAPA 1OT5A 2Y64A 1H8TA 1F5JA 2G19A 2XJTA 5FMOS 4Z2AA 5AFBA 1WW5A 2BOJA 2FMDA 3CU7A 1LOAA 1H0BA 2EAKA 3BVCA 4N43B 4PDWC 4WVVA 4GWIA 3U4SA 1UX7A 3VBUB 1ENXA 5C3PA 1W99A 1Z7S2 3SHRA 1RUJ2 4L8QA 2WAAA 3AKPA 4YVSB 4E8DA 1U5YA 3KV5A 4GULA 2VOXA 1U5XA 1ZA4A 3OUIA 2ATFA 4PQQA 1UZVA 4LE4A 5F37A 3H7JA 3VBOB 3I4IA 4Q0UA 1BEV3 2BNMA 2WR9A 2ZEXA 3VKMA 4Z07A 4PIXA 1QF3A 5LASA 1IS3A 3U1XA 2R1BA 1U5IA 2G9FA 3EHKA 4QDQA 2CU5A 2RDQA 3H42B 1W6OA 3S7IA 3WP3A 3SC7X 1NLQA 2XJPA 3VD4A 3ZMNA 3MLJA 2J1VA 1DGRN 1IG3A 1MQTA 1S0EA 3D4KA 3H3ZA 3KV6A 3ZN5A 1NXD1 4PJYA 2PTMA 3WF3A 4BQYA 2WL1A 3RJRA 3SLIA 1VAMA 5FZ6A 4IGQA 1VIWB 3T09A 2EVXA 1GP5A 5FZFA 5LEJA 3NNGA 2P2KA 3FE5A 5DDJ3 1GZ9A 4YW5A 2WQ8A 2MEV3 1ND2C 2JECA 1GOFA 4B4QA 2OS2A 3DKQA 4LKEA 4MGIE 5L7OA 2QQUA 4MO3M 5IW0A 4XF4A 5LZ6A 3IIAA 1XQNA 3VGIA 1W8NA 3O1UA 5GZCA 2FCUA 3N9LA 3NL1A 3N7JA 5IVJA 1X9PA 2RS11 5C3RA 3A21A 2D6NA 1DGLA 1DLLA 1SLTA 2F4LA 3VBSA 3TEZA 3WF2A 2VMIA 4CDWC
chains in the Genus database with same CATH topology
2R072 4IEOA 3IWZA 4L92A 1IGOA 2HEYF 1GZWB 1GQGA 3VZNA 2TEPA 1AYM2 1CAWA 2B39A 3AYEA 2HWE1 1F9KA 1YCIA 4PF5A 4A7ZA 4ZKTB 2OUJA 4ES9A 1TE1B 2BTVC 3WOGA 4AFDA 2JE7A 5BV6A 1ZBA1 5HCAA 2XWJB 2YV8A 5C9AB 4K21A 4P9LA 2GMEA 1V6IA 4ORFA 1PK6B 2PHTA 1MQTB 4JTOA 1N3QA 3MPPG 4M3CE 3KT7A 2VULA 2XB6C 3POWA 4WZFA 1N47A 1WCSA 2I07B 3DPRC 3QACA 4YGEA 3ZN4A 1VRH2 3ZXAC 5F9TA 2RR11 4LO8A 3TRSB 4PBPA 1NE6A 2SLIA 1RUI2 2YUEA 1ZZ9A 4MSVA 2ZHLA 2VNRA 1HV1A 2PLV3 4P5HA 3W58A 3WY6A 2MEV2 1OLRA 3ZSLA 2OUHA 5L7OC 2OIIA 4SLIA 1HDKA 4XHBA 4RQPC 1YXWA 5CG9A 5CB7A 3IDBB 4WM8A 3V0BA 2VUAA 3ZIWA 3TN92 2GN7A 2YGLA 1W6MA 4F8AA 4LBOA 2P3JA 1UD1A 1CAUB 3E97A 4QGMA 3H9AA 2BUKA 3AFKA 3WLUA 2D5FA 1FPN3 1C8NA 2IFWA 3KMHA 4UW4A 1JXNA 1LU1A 4IV1B 3TN91 4QU2A 1QJY1 4RHV1 4DY5A 2W08A 4NVPA 1NCRB 5FREA 2GNDA 1QJY3 4RHV3 3D6EA 1RUJ3 1AJOA 4JRAA 5DUUA 3AKQA 1GANA 4AVSA 2OA2A 1SBFA 3JB8A 5FRAA 5C8CA 4AEDB 2Q1MA 1MVEA 1YI9A 2D44A 2HYKA 4LA3A 2Q30A 1FNYA 1UZZA 3BODA 1Q43A 5DUVA 4AFAA 1VJ2A 1B35B 2SBAA 4R9DA 1DGWX 4Q4V1 3WV6A 1FMD3 2PHUA 1CIWA 1K5MC 4NHKA 3RYPA 1NCQB 1FMD1 1QXJA 3U0ZA 4IERA 2ZX1A 3R05A 1LOCA 2WZPP 4FPGA 4Q0VA 5LRRA 2CGPA 1J3PA 2ZACA 3FMGA 4LBNA 1C1LA 1REDA 3N36A 3ES4A 4GMP3 2YXSA 5K0UA 1FAYA 1PGSA 3R0RA 5KBFA 2QNKA 3WDUA 2ZGNA 4AVAA 3FUOA 4HK9A 3DUIA 4QX5A 3RMYA 2PAMA 1KS4A 1OI6A 3WP5A 3PJYA 1HRI1 1VBE3 1VAVA 2IXLA 1BJQA 2WQ4A 2EXJA 2RS52 2QCSB 2KA3A 2XJRA 1OFNA 2JD4A 1FOD1 4Y24A 4J6GA 3IPVB 1OLQA 3LZZA 5JIUA 4OI4A 5T5OA 2BFUS 4MLOA 5DZEA 4XBNA 3PHMA 3VZMA 1MS8A 1D4VB 1PK6C 1QNYA 2ZX2A 1LKNA 4MXWA 2V73A 2H6CA 3Q9OA 2WZR3 3GNEA 1A8MA 2EALA 3WQ7A 4YARA 2RM21 1KDKA 1REFA 3APBA 4I09A 2R0FA 2HWB1 3N4MA 2R0HA 2JJ6A 3ZXJA 1R093 4RA0A 4K1ZA 1U12A 2ZGMA 1IS6A 1ZVFA 2B46X 5FPZA 1RGSA 3VBFA 2OW4A 1LHOA 1REEA 2GC2A 3ZFFC 4Y1XA 3ZFEC 1RMU1 1WD3A 1JBCA 4Q4Y2 5CIRA 1RUOA 3AXEA 3LSEA 4GH4C 1QNWA 4QQ2A 2HWF3 1ENQA 3WCSA 4B4PA 1NOVA 1X8MA 2XBO2 1R1A2 1R082 4E27A 4IEXA 2GMMA 3N35A 4XBLA 3VKNA 1OOPB 1POV0 1RUH1 1NCRC 2NPIA 2WNEA 4YM3A 5BY5A 1D4M2 1RUH3 1R081 1PO12 1X82A 3I54A 1Q8PA 1RVF3 3O0VA 1YFUA 2X5IC 3WG2A 1WD4A 2VVDA 1GLHA 1VBA2 2XJSA 1H1IA 3ILNA 4FPOB 3B69A 4DNYA 1H2MA 5I8TA 4BWOA 2DF7A 2WSUA 3M7AA 5K9YA 3WG4A 3NJZA 1AL0G 3MZHA 1ULGA 2DCYA 1VR3A 1W6OB 4AI1A 3B5LB 5D8AA 3RG0A 1VBD1 4FPFA 4HFSA 3OY8B 5FO8B 4D69A 2B5HA 4KWKA 5GZEA 5GLUA 3GBFA 1QOTA 1YNAA 1QJX3 4OHWA 2UYAA 2NM1A 5C4WB 3OCPA 3V64A 3AP6A 3R4SA 1GICA 3B3QE 4M0NA 1SLAA 1CAXA 5JSRA 4MXVA 1HRI3 1VBE1 2JE9A 3W9AA 1LOFC 3NV1A 3UKVA 2GC3A 4XW3A 4EV0A 2Y0IA 1OPMA 2WA3A 3C3VA 1GZWA 4UW6A 4YG0A 1COV1 1CAWB 3MIHA 3WHUA 3FLPA 2D6PA 4QM9A 4IEQA 4Q4X2 4WBBA 3MYXA 3WCRA 5IK5A 1H30A 3RI9A 4CDUA 3ELNA 2GZWA 2FHRA 1COV2 2A6WA 4E2QA 1RUC1 5GLTA 3JUUA 4GA9A 3WDXA 4EROA 1D0GA 4FPHA 1ASJ1 4RR3A 5L7OB 3VZKA 5KWRA 1T6GC 5KXEA 5AFEA 1BBT1 3FX3A 3UKNA 1QOSA 1ZBA3 5H9QA 3VHOA 1OHFA 1S0IA 2JX9A 4QM8A 5FTTC 1POV1 3WZ1A 2RS32 4LNVA 2XUMA 1M06G 3A0KA 2ETEA 1PVC3 4FTSA 1O91A 4BMBA 1EP0A 2LTNA 1QJX2 4MGYE 4XF0A 3AZWA 3E5UA 1UAIA 4QPIB 1ULFA 4IV3B 4XETA 3QCWA 3MIFA 3ZX7A 1N3OA 1AR91 4HBNA 3WXPA 4HK8A 2Z5WA 3KD4A 4CDQB 4BOWA 1UW8A 4BH9A 1EV13 4EWAA 3USUB 1DFQA 4XJZA 5C8CC 1N1SA 4XBQA 5IK7A 1WBLA 1AR92 2OVUA 4OUMA 3RQ0A 5AVAA 2GC1A 4AEKA 3HT2A 3KLSA 2PQQA 3NV2A 3VL8A 4UW3A 1QGLA 2WS91 4Z1VA 1N1VA 1MS5A 4GH4B 4PDWB 3VBUC 1PM7A 5FCCA 4FP2A 1JH5A 2WINB 3AMMA 4ONUA 4I0WB 4LBQD 1UPSA 4CEWA 3MLLA 1KJRA 4ZU5A 5T54A 3GYDA 3PVBB 5F5QA 1DQ0A 4KGGA 3H8UA 1W0PA 2DFCA 2ERFA 2CL2A 2ZZJA 1S0GA 3AZZA 4CEWC 2R071 5GM0A 2DCTA 5F1RA 1EY2A 3GHNA 1ZZ6A 2Y26A 4K20A 3O12A 4K7JA 1AYM1 4KH9A 4DRRA 3ILFA 1XNDA 2YROA 2QDNA 4RS5B 1AR81 3GZTB 1QWRA 2ZKLA 4YW3A 3OBTA 2D6LX 1UKGA 3AZYA 2XH6A 3IMNA 1PVXA 3MIDA 3VHPA 1QJU2 4YZ3A 3JB4C 3QBQA 4CDQC 1DZTA 1AVBA 2E7AA 1UX6A 4OZXA 5DZGA 1R092 3T1MA 1VBD3 2W52A 1AF9A 2JXAA 3BPZA 3VBHC 4AQ2A 1R1A3 2JG9C 4YVSA 1TQ5A 1Q3EA 1ALYA 1AXZA 5HCBA 2VUJA 4INDA 4NWVA 1EPZA 1KFXL 1LENA 4Y1UA 2QKDA 1V6JA 3GF6A 2VW2A 4CDXC 4Q4Y3 4A7YA 4LT5A 3WNXA 3VBSB 2ZHKA 3CJIB 4YGBA 1WMEA 4ASMB 2IXIA 5KC6A 1H4GA 4D7YA 4H55A 4ITCA 2ENRA 3O7OA 1WBFA 5BNNB 5IK8A 2KXLA 1SMVA 3ZN6B 2ZX3A 5C9AC 2O8OA 2A6XA 3FLRA 1WLCA 3HD8B 4GMP0 2YYOA 3K48A 4IV3A 2BEOA 4ATEA 4XIKA 4LUMA 4AW7A 3R4UA 1QQP2 4BIFA 2VG9A 4KWJA 1V6KA 3WDVA 1IKPA 1LOGA 3AJZA 4JRLA 2A3WA 4CDQA 2CAUA 1BVVA 4X6QB 1XYPA 1FV2A 4Y1VA 5C6CA 1AL22 3FC0A 1KJLA 4N7IA 2AREA 4TLFA 5CG8A 4GKXA 3JD71 4AHZA 1DQ2A 4B3NA 2Q5TA 4LUKA 4Q4V2 3AMNA 1GKBA 1PVC1 2DUOA 3NAPA 4BPZA 4EN9B 3FFQA 4XF9A 1HXS2 2WZR1 1O4TA 1FMD2 1ULCA 1ZNPA 2WSVA 3PVNA 3JD72 4FO9A 1AYN3 2ET7A 3M3CA 4Q29A 4XFCA 3KGZA 1SLBA 3PJQA 4DXZA 2RR13 4OHZA 3NWKA 4IQPA 3MLKA 1RUG2 4LR4A 5BNPB 4P9YA 4M3CB 3VUOA 1RHI3 1I6XA 3WHTA 1H1AA 3HN1A 5FDBA 5GZFA 1AX2A 3VKFC 1BMV1 3SH4A 4IETA 5HCFA 4AQTA 3NKGA 4COVA 1AYN2 1V9U1 1NZCA 1RUE2 4NOTA 1RITA 1V9U3 5KXDA 5EV7A 4NPRA 3MIEA 3UKTA 2EF6A 3RI8A 3MFCA 3MI8A 4G3YC 1QY4A 1FOD2 3M4FA 2Q4SA 5E1RA 5CBLA 1RUE1 3NSTA 4ZU4A 4XIOA 3S6PA 4FOYA 3TN93 3ZFEB 1IOAA 1VRH1 5FLJA 2A3YA 5GZDA 1MR5A 2ZGTA 5J3UA 1RUI1 5C4WA 4L99A 1C1FA 1TNFA 4B8EA 3KT4A 3OYWA 1NCQC 2E63A 5ACA1 4LLFA 3WP6A 4FSJA 4UBGA 1FPN2 3TNPB 1FT9A 5E88A 4R4ZA 4EN0A 1C8M1 4HVRA 3KGLA 3VBRA 4YG3A 2ZHNA 1H2LA 4AFCA 5ACA2 4CDWA 5AC92 1OPOA 1QHDA 1YFXA 3ME2A 1AR71 1QQP3 4CTEA 5A33A 2DV9A 1CD3G 4RFT0 2RMU2 3T1LA 2GALA 4BM8A 4LBJA 3B7MA 4GALA 3ZN6A 5E89A 5B2GB 1PGW1 3WDTA 4CP0A 3DV8A 2W39A 4XHXA 5L73A 3V65A 2R043 1UIJA 2ZA9A 5CU1A 1ZYBA 5BNNC 1L3JA 4GWNA 4FOQA 3WW1A 1HKDA 4Q1RA 3AX4A 5I8SA 1KITA 3BIWE 1S0JA 4IXLA 4AVTA 4E4DX 3ZXLA 2GN3A 5FQ0B 1W6NB 2C0ZA 1CAUA 3ZXFA 3EBRA 5D1IA 4HKWA 3J8F3 4I3GA 1GYKA 3ASIA 4TYSA 4CEYB 1ONAA 2B9UA 4WM7B 2D7FA 2BW8A 4P9JA 3OD4A 5C33A 3S7EA 1DBNA 4AHYA 3HAGA 2H0BA 4COWA 1PO13 4P9GA 4NN0A 1I1EA 1UF2C 2VNGA 4TWTA 3H1MA 3U10A 1ULDA 4BQ1A 1KS5A 1X33A 2GH2A 1EAH3 2CV6A 2PLV1 4OHYA 4MVTA 4AVCA 2MHFA 3D0JA 1B35A 2ZOEB 2WKKA 3LGRA 4LLOA 1X7NA 2A73B 3V0AA 1RL3A 4K40A 1DF0A 1HW5A 4AI8A 5FAXA 1AR93 4JGYB 2JENA 3AMQA 4OUSA 2YGMA 2VGDA 4I0BA 1PGL1 1CGPA 5CFCB 2A7AA 4R8HA 4MGZE 1RVF1 1VAKA 4QQOA 1HV0A 1RUE3 2CWMA 4RS5A 5JSOA 1S2BA 1A3KA 1V6NA 2TUNA 4M3CF 4Q8KA 3AXDA 5I0SA 2ARXA 4B7EA 4XFIA 4YYOA 3TB0A 1AX0A 1Z7S3 4P9XA 3INAA 3VHNA 3OPZA 4XILA 4K1YA 3CF6E 4U2AA 2Z42A 1LTEA 2XL9A 1AR83 1NQJA 4JTNA 1TMF3 2XKPA 4FPLA 3CJIC 1W39A 1V00A 3VN4A 3FJSA 1DHKB 4XEZA 1CQ9A 4WM8C 1J1TA 4BIOA 1ND3B 1KD7A 1LGNA 5JZGC 1PZ7A 5JOXA 2N7GA 4PCRA 3WINE 4C90A 1SBDA 2WNUB 3CL1A 4HPKA 4YSFA 2X53S 4Q4V3 4F7ZA 2D97A 1K5MA 2D3RA 4N7UA 5I0UA 4AG4A 1R1A1 4FQ4A 5C9AA 1X50A 1AL23 1PK6A 2V09A 2RS33 3IKWA 1V6LA 4XFHA 1FNZA 2VECA 2R6QA 3AKSA 1D4M1 4HZFA 3DF0A 1WLWA 3GHMA 1SFNA 1PIV1 2ZTNA 3HR9A 4JDMA 3FUQA 4K9SA 2JKBA 2D6KA 4NWWA 1A6CA 3ENRA 1D2SA 1Z0HA 1LOBA 1AR61 1OA3A 1NA1C 2BYVE 2WS92 4Z8BA 5SV5A 5D8AC 4R9BA 4S2GA 3MW3A 2H6BA 3MIGA 4Q4W3 1W6MB 1DQ5A 2WNVB 3M3IA 3E6CC 3POYA 2RS13 3RSJA 3ZSKA 3TYJA 4B7KA 4RR3C 1AR62 4Y20B 3V0BB 5H9RA 1RTVA 3UL2A 5BNOA 1O3RA 4HPKB 5JMCA 3NV3A 4PLOA 2UURA 3K51A 4JGZA 3A4UA 5ABJC 2FMYA 4FOWA 2WFF3 1OQ1A 3NAPB 4M01A 2HWB3 1VBA3 2F4PA 4FBFA 1ZRFA 4YNIA 1CAVB 3WUCA 2IWGB 2LM3A 2X5IB 1NCRA 4CEYC 2JG9A 2ZGPA 3TAYA 3ZYIB 1RUD3 3DPRA 4JGYA 1QJU3 3OGGA 2PHDA 3JBG1 1QJZA 2DVGA 3ZYJB 1IS4A 1QJU1 3PVOA 3NW4A 4D7SA 3PTYA 1VBB1 4HKLA 2VOWA 2O1QA 1CJPA 4B4RA 3J26N 4GB32 4FPEA 2D5HA 3FHIB 1MEC1 3ROUA 2BVVA 2VW0A 4CDUB 1RUC2 3AP5A 3KCYA 1CJDA 4Y22A 3ATGA 4PIYA 4JDNA 4XJ9A 3I59A 4J1XA 3ZYRA 4IL7A 5DUXA 4N9HA 1Z7S1 1RUJ1 3RRDA 4DPNA 1XU1A 3ZFEA 4AHXA 3LCPA 3ZO0B 4LHKA 4V1PA 4CZSA 2YPJA 2NP0A 1CESA 5CVRA 2B42B 1PO22 2D6MA 1R083 2VH9A 4WVZA 3LA3A 3BB6A 3MIBA 4DRVA 1MZ6A 1D0HA 2CGOA 4Q0SA 1MS0A 1PO21 1TEIA 3E5XA 4YZ5A 1AYM3 2BWCA 4QPGB 2WNUC 4BZ4A 1W6QA 2VW1A 4W6YA 1I5ZA 2OPKA 1AL21 1NE4A 2DU1A 3SCGA 1JHNA 3LA2A 1QXRA 2CY6A 3POSA 4FQZA 4LBQB 4N43A 1IPJA 3X29B 1G9FA 4Q0QA 3BTAA 3GBGA 1PVC2 4XYXA 2IXJA 3ZPYA 1QH6A 5BNQA 4QQLA 2WZR2 3IM0A 1UIKA 4HN1A 1F31A 4CDUC 2OYZA 4GKYA 4OHVA 1N1TA 2XG3A 5KHIA 2R063 4GQ7A 1RUG1 3H7YA 4FCAA 3B00A 4SBVA 2R30A 4MUVA 2ZGKA 2VOKA 4F3JA 5A32B 3E6BA 4HANA 4FTEA 3S0MA 1COV3 4IV3C 3B02A 2C9AA 2F6BA 4WM7A 2BNOA 3O0WA 4H3WA 1A8DA 1F5FA 1C5HA 2HWC2 1UZYA 1V9U2 4AVVA 4ZXKA 1MVQA 2DFBA 3BU7A 5J09A 4YG6A 1RUF3 3G6JB 1SCRA 2Y0OA 2WFF1 2XVGA 4YVWB 1QKQA 4R9AA 1FATA 4Q4W1 3HWJA 1JYCA 4LBMA 4CEWB 1PNGA 2AGSA 2D6OX 1QH7A 1R091 1LR5A 2RE9A 4JDOA 4BYYA 1LULA 5JWPA 1DU3D 4AF9A 3JBG3 3VZLA 1VALA 2HWE3 4RS5C 4WVWA 4AHWA 1XNCA 1OSGA 4IEUA 1C57A 1ZBE1 2D3PA 1O3SA 2PHLA 5ABJB 2OZJA 2NZ9A 3E5QA 4AGRA 3V0AB 4QQHA 5BNPA 1VBC3 1Q8QA 2EIGA 2JG8B 3VDDC 4ZU7A 3ZXDA 1H2NA 1MS4A 3SITA 4GWMA 4RQPA 4KU8A 1CX4A 1W6QB 1C8M2 3ZFGC 4JV4A 4EN8B 5J48A 5AC91 3JU9A 1RMU3 5BNNA 3GBWA 4Y26A 5CA6A 1CVNA 4P14A 4GIQA 5JR7B 5CAZA 2RMU1 2GAUA 2IZWA 5E8AA 5JOYA 4K6BA 2ZMLA 4KGQA 1PNFA 1XE8A 1GZCA 4OLLA 2ZGLA 5L19A 2GDFA 2WT1A 5I93A 3MW4A 4QPYA 1RUD2 2VQ0A 1SLLA 2PHRA 3HQXA 4YM0A 4YW2A 4S2FA 4XE9A 5T52A 2E7TA 4YGDA 1LHWA 1ND3A 1PMIA 4KU7A 3AP4A 4OI1A 4E2SA 3VBOC 2DCKA 1RC6A 2VNOA 2HWF2 4AQSA 4YVSC 3IDEA 4IEYA 3WT3A 5KC5A 1M4WA 4FPKA 4YVWA 2DCJA 4KBBA 3WW2A 5JLVA 1PO23 2P3IA 1BEV1 1UU5A 4META 1QMJA 4DS0A 2JG8C 1BYHA 1S0BA 4L2NA 3IN9A 4YFWA 3AYCA 2A6ZA 2R042 3KQRA 4MXWB 5J36A 2VXRA 4AGVA 5C8WA 5K7PA 4KG8A 1QU0A 3M70A 4W65A 1HX6A 5JPNB 1G8WA 5BUVA 1XYNA 3WD5A 5ABJA 4AFBA 4XQ4A 1C3HA 1MQTC 1DG6A 2R041 1K5MB 5BYNA 4TZDA 4LO5B 2GNTA 2IFRA 2VQAA 4XXPA 3MGUA 3M3EA 5KHGA 1BQPA 2ZGUA 4AFMA 1HLCA 5KHHA 4I30A 4LE3A 2R16A 4FAHA 2VVEA 3WP4A 3WQ0A 4YZ1A 1NYWA 3I8TA 1Z78A 1W6PB 3N7LA 4QQPA 4C0HA 5HI0A 1CPNA 1HQNA 4QPIC 2Z69A 4CDXB 3JQWA 4LBKA 2R49A 2PAKA 4LHLA 3M1HA 4LULA 4XJWA 1RMU2 1HRV2 4ATFA 3FBMA 4M00A 5JOZA 2QUOA 2ZABA 1RJ7A 1KRIA 4XFGA 1J1LA 1GSLA 4RQPB 2ZGRA 1B09A 1H9PA 2IXHA 4Y20A 1AR72 1OQDA 1HRV1 1IS5A 2RS12 3ALQA 4CEYA 2ET1A 4CYDA 5BNOB 5EYYA 3THPA 3MF6A 5T5PA 1YUDA 1QOOA 1DQ1A 2Z79A 3KB5A 3ZYGA 2EXHA 2HWE2 3WW4A 2EAAA 4WV8A 2MNGA 1APNA 4EWEA 3U07A 4DB5A 3P3NA 2A3XA 3MPBA 1BCXA 2D40A 4LO6B 1J58A 2PA7A 3RMXA 1ZBA2 3IBMA 1N1YA 2YMZA 3WDWA 3MEPA 3VBFB 2TNFA 2WQZC 1ZZ7A 1GV9A 4CDWB 3NAPC 2GNMA 2A6YA 3ZYPA 2PYTA 4YGCA 4IEWA 4O9GA 2HWC3 4C0BA 4YFZA 1O5UA 1C4RA