5T3NA

Sp-2cl-camps bound to pkar cbd2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
b'HHEVLFQGPGAKKRKMYEDILSHVNILKDMDPYERCKVADCLKSKSYNDGEIIIKEGEEGDTFFILIDGNAVASKDNKVIKTYTKGDYFGELALLKNKPRAATIKAQNFCQVVYLDRKSFKRLLGPIEDILHRNVENYKKVLNELGLDTTCID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cAMP-dependent protein kinase regulatory subunit
publication title Disrupting the Allosteric Interaction between the Plasmodium falciparum cAMP-dependent Kinase and Its Regulatory Subunit.
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
molecule tags Transferase
total genus 41
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2016-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t3nA00
1EPZA 1UIKA 4MV2A 2GAUA 2H6CA 4AVBA 5FPZA 5I0RA 1V70A 1PMIA 4IEUA 4BHPA 5FDBA 4XETA 1QXJA 1J3RA 4Q0QA 3S0MA 2UYAA 3NSTA 2Y0OA 5AVPA 1NYWA 3EO6A 3M3IA 2BEOA 3LWCA 2B9UA 4QGMA 4RD7A 4UBHA 5K8SA 5D1IA 1Y9QA 3RYKA 4IEWA 1ZVFA 1RL3A 2PQQA 5I8SA 3KSCA 4JTOA 4XF9A 3R6SA 2CAVA 3HQXA 4PJYA 3RYPA 3RNSA 2H0VA 3U11A 2GC2A 5BPXA 3GYDA 5CU1A 3E5UA 2XL7A 4I0AA 1Q5OA 3PVBB 1O3QA 3EHKA 2EA7A 4HVQA 3NL1A 1L3JA 1CAUB 2WC2A 1RC6A 4XFHA 4HSJA 3MZHA 4ORFA 3H9AA 1Q43A 4D7TA 4Q0UA 2B8MA 3ROUA 1XE7A 4LULA 4IEXA 1UW8A 4AVCA 5BV6A 1UCXA 4Q29A 3SHRA 4OLLA 2ZKLA 4Q0SA 1FXZA 5FQ0A 3H1MA 2OYZA 3IDCB 1X82A 2K0GA 4Z82A 3IWZA 4XFGA 2D5HA 2IXJA 3VHRA 2PAEA 3M70A 1QWRA 3N4MA 3ETQA 5I0UA 4DINB 1YUDA 3SCFA 2BNOA 5FLJA 3SCGA 2QVSB 3CL1A 3H50A 2P17A 4JVAA 3LZZA 3CF6E 1CAXB 3O14A 1U12A 2K9ZA 4B29A 4Q0PA 3JZVA 1QXRA 3FX3A 2GH2A 2BNNA 2EVXA 4NVPA 2H6BA 1OI6A 4YYOA 1LKNA 3HT1A 2PFWA 5JSRA 2QNKA 4HSLA 4KWLA 1VP6A 4I09A 4EV0A 5T3NA 5LRRA 4F8AA 4N9IA 4L11A 2PAKA 4H7LA 4MGZE 3EJKA 2C0ZA 2PYTA 4XF3A 4XFIA 4XF4A 4XEZA 3PLQA 1CAVB 1UD1A 2UYBA 3UKTA 5JCTA 1CX4A 4MGYE 3S7EA 5F1RA 1QY4A 1G6NA 4YSFA 4IEVA 3NVCA 5I0SA 1OD5A 1TQ5A 2D93A 5I93A 4UXAA 3KCCA 2WFPA 4LEJA 2PAMA 2DCTA 3E5XA 3KGZA 1IPKA 3OGJA 5KHIA 4KWKA 4R8HA 4AQ6A 4I2OA 4EWAA 2D5FA 3H8UA 1NXMA 4WVZA 3GBFA 2KXLA 3LA7A 3WW2A 2IC1A 5FLIA 2B5HA 4HBNA 3U0ZA 4O9GA 2D40A 1VR3A 4QGNA 4QM8A 1ZZCA 3FE5A 3WW3A 1WLTA 3WW1A 4PIZA 5LRSA 4IESA 4AVAA 2XHKA 1FT9A 2OPKA 3G7DA 3SXWA 1JUHA 1ZX5A 2GC3A 2Q30A 2N7GA 4ZU4A 1H1MA 4I0BA 1LRHA 5I0TA 1LB2A 3UKNA 2GC1A 5KHHA 1ZZ7A 3E6DA 4ZU7A 2O8QA 4XFFA 3IIAA 2UY9A 4IEQA 4HVOA 1CAWB 3FHIB 3BALA 4LTAA 3HIFA 3I54A 3QOPA 5JSPA 3WW4A 2O1QA 3OF1A 2I45A 1O3SA 1CAWA 3ES1A 5FQ0B 3MPBA 5I91A 2ET7A 5BXXA 1UPIA 3IDBB 2EAAA 4LA2A 4PIXA 2IXKA 4BH9A 5FPXA 3RPQA 1ZRRA 4QGLA 4I01A 4PIYA 3DN7A 1YWKA 5LEJA 4ONUA 2GC0A 5J7MA 1UIJA 4QXKA 1XRUA 3ZDSA 5EFUA 4E2QA 4KWJA 2CV6A 3FZ3A 2FQPA 3DL3A 3LAGA 5BY5A 3UKVA 4IEYA 3H3ZA 2XL9A 3H7JA 4IERA 4CYDA 4A2UA 5JSOA 1ZZ8A 4J1XA 4MGIE 3D0SA 1IPJA 4JV4A 4HMZA 2QJVA 5KBFA 1O3RA 5LEKA 3OCPA 4HN1A 4LLOA 1ZNPA 4X6RB 3H3UA 1O5LA 1SQ4A 5BUVA 4QX5A 3H7YA 2ETEA 3TNQA 4YNIA 5KHJA 3FJSA 3B02A 4ZU5A 1NE4A 4Q0VA 2IXLA 1I5ZA 2MPFA 3EBRA 2Q0AA 3OD0A 4AXOA 1ZRDA 3ELNA 4XFAA 4MUVA 4FT8A 5C6CA 3BB6A 3KMHA 2XLAA 1Y3TA 3DKWA 3D0JA 4OFGA 3E6CC 3U10A 4YARA 4GULA 4XF1A 4EROA 1EY2A 2E9QA 3I59A 4HLTA 1ZREA 1DGRA 4IEOA 1J3QA 3C3VA 3E97A 3BPZA 2XLFA 5E16A 3ST7A 3BU7A 4META 1EYBA 4IETA 4X6QB 2QDRA 2MNGA 4I3PA 1NZCA 4Z07A 4AQ2A 3TNPB 5CADA 1ZZ9A 3NJZA 3E6BA 4QM9A 2PTMA 1NE6A 4UBGA 1J1LA 4XFCA 4BYYA 3LA2A 3NKTA 2F4PA 4D7SA 2OZJA 2VPVA 3CLPA 1O4TA 5JR7B 2CGPA 4FAHA 3PNAA 5FCCA 4HVRA 1Q3EA 1RTVA 2XKPA 4KU7A 2GZWA 5I8YA 2HKXA 2IXCA 2PHLA 4LUKA 2V09A 2ATFA 4E2GA 3FFQA 1RUNA 1YLLA 3RDIA 3ES4A 1VJ2A 2MHFA 3RYRA 5J48A 2PA7A 1X7NA 1HW5A 3MYXA 1J59A 2XKOA 4FAGA 1FI2A 1LR5A 3D82A 5EZWA 3IBMA 2ZCWA 3H1YA 4MGKE 5E1RA 1XE8A 1RGSA 1RUOA 2VECA 1WA4A 1X8MA 1J3PA 4IEZA 2BNMA 2CAUA 4N9HA 3RZZA 4QMAA 2PHDA 4JTNA 5KHGA 2Z69A 3CO2A 5J3UA 3EQEA 4TLFA 2HJIA 5FLHA 2VQAA 2IXHA 1CAUA 2FMYA 3LOIA 5KHKA 4O9EA 1O7FA 2Z2SB 1PM7A 4FBFA 4P9GA 3CEWA 3USSA 4EWEA 4YRDA 4MZUA 4MX3A 4HN0A 5HI0A 3LA3A 3SMHA 5I8TA 4I02A 1ZRCA 4R52A 1DZTA 4F7ZA 2BYVE 4HZFA 2Q1ZB 3SCHA 3BCWA 1OFNA 1ZZ6A 4KU8A 1YFUA 1SFNA 1X8EA 5JAXA 2GU9A 3QACA 1DGWA 2ET1A 3E5QA 2QCSB 4J1WA 1CGPA 3DV8A 4L2NA 3NW4A 2BGCA 3CJXA 3KGLA 3OTFA 5C8WA 1CAXA 3I59B 3L2HA 4MH0E 4WZCA 1DZRA 2OZ6A 4LUMA 4E2SA 3ACLA 1O5UA 1ZZBA 1YFXA 4LA3A 2OA2A 1WGPA 5CVRA 4EWDA 4IEPA 1YFYA 1GQGA 4KL1A 1SEFA 1ZRFA 2Q4SA 1YFWA 3H1WA 3S7IA 1OMIA 4XF0A 4BIFA 1H1IA 4XFBA 2XGXA 2UY8A 3FWEA 1O3TA 1I6XA 4K8FA 3MDPA 2XLGA 1EP0A 1YHFA 1CAVA 2IXIA 3HT2A 1J58A 3I7DA 4WBBA 1GQHA
chains in the Genus database with same CATH superfamily
1OOPA 1VIWB 3P1IA 3W20A 2GSYA 3HMYA 5H9PA 1OXCA 5LW9A 5FIXA 4IEUA 2ADEA 3JD72 4W50A 1X9PA 3AMQA 4LLFA 5FDBA 3CQOA 1LHNA 4XETA 2QQVA 4Q0QA 3HN1A 3CJIA 2PHRA 1W9TA 3MIHA 5EJ3A 3WNLA 2ARBA 1Z7S2 2EALA 2RDRA 2IWGB 2RS12 3AKQA 5C71A 1CPMA 2O14A 1Q8OA 2ZMKA 3M3IA 2BEOA 4IW3A 2B9UA 2FDJA 5C70A 4OHVA 5KWRA 1I3HA 4N43C 1GFF2 4RD7A 3VBSB 3ZXLA 4RN5A 3RYKA 2R0HA 4LO7A 4A4AA 3ECQA 3ZO0B 4BDVB 1OOPC 2PQQA 4L92A 3JQWA 4GA9A 3T4HB 5FZ3A 2BTVC 4JTOA 3LPGA 3R6SA 4MHRA 3UV9A 5FPVA 1HXS2 3ZMNA 1YXWA 3RNSA 2VY0A 2H0VA 3RWNA 2DBIA 1SCSA 1W0NA 3CJIC 4I0AA 4JHTA 1Q5OA 5CU1A 1WCSA 4YG0A 1O3QA 2ZJCA 2C9AA 3WQBA 2LROA 2WS93 2AACA 4YWAA 5T54A 1Q56A 3HBKA 3WDUA 5DZFA 2X53S 5IVEA 1JN2P 1ZBA2 2TUNA 1W04A 2O8OA 4FPOB 5FZHA 2WQ8A 2B8MA 3ROUA 4NOTA 4DRRA 1AXKA 1S2BA 4YGDA 2LW8A 4IEXA 2HYKA 4OI2A 5J37A 4AVCA 1XYOA 1VMFA 5HV4A 4KMQA 1BK1A 1MZ5A 4OLLA 2RMU2 1CIYA 4ATEA 2ZKLA 1KGYA 1LHUA 3NNLA 4Q0SA 5GZGA 1EAH2 3AKRA 3N9NA 3JBG3 2XQXA 5FP7A 4QPIB 3IWZA 1GV9A 4XFGA 5ACA2 2PAEA 2VBDA 2BRTA 1VALA 4GWMA 2DFBA 5FZAA 3N4MA 5I0UA 4DINB 2P1BA 1N1SA 2Y6KA 2FMDA 5A3OA 5GZDA 3ALQA 1ND2A 1W6NB 2Y6LA 3SCGA 4NE9A 5FFOC 1RUD2 1QDCA 4D3WA 3ZXEA 2OT7A 3CF6E 5L9BA 5FY7A 2TNFA 1H0BA 5DAQA 3B9IA 4U36A 1AR72 4B29A 2J1AA 3A7QA 3DF0A 1CZSA 4G4FA 3ZSEA 1SHWB 3AB0A 4CDQB 1RUJ1 3VDDA 2EVXA 1US2A 2QQIA 1FYUA 1AVBA 2R32A 5F7UA 1JBCA 1J83A 1OI6A 4GWJA 4YZ2A 2JJ6A 5IVFA 1WBFA 4YYOA 3GZTB 3BIWE 2NYYA 5FO9B 3MUY1 1GWLA 4KWLA 1VP6A 2TBVA 4BQ5A 1H2NA 1MS4A 3Q8EA 1ND2C 4RGGA 5DUWA 5FYZA 3QH6A 2P5BA 5C8CC 2GDFA 1PNGA 2IFWA 2VZTA 1HV1A 2JKBA 4H7LA 4QX0A 4C90A 3IIIA 2PYTA 5IUQA 1O8PA 2JDUA 4XURA 2RDQA 2ZABA 3CU7A 4GKXA 4L8QA 3WNPA 2A75A 1SLCA 1CAVB 1YYNA 5JI9A 1UD1A 2VMGA 3POJA 3VDDC 1CX4A 3S7EA 1QY4A 1OQEA 1WD3A 2GN7A 1GP4A 2VL4A 3WDXA 2RS32 4Y24A 4YW6A 5A3UA 3NVCA 1QJY1 2DCJA 4QQHA 5I0SA 1NOVA 1XNCA 2D93A 1VBC1 3FUQA 1MZEA 5FZKA 1C1FA 2P4EA 4UXAA 1RUC3 3N9PA 1NY71 4LEJA 1STMA 1QHDA 2CYFA 2XONA 2YBSA 3KHBA 4QHBA 4K8RB 3CBNA 3E5XA 3OGJA 1IPKA 2E26A 5KHIA 4XDOA 1JZ7A 1QQP1 2CTVA 3R0RA 1XOYA 2ZX1A 3T09A 2E7TA 2YU2A 4YW7A 3LE0A 2AEZA 3HNYM 3MIBA 1ULPA 4MHUA 5EHDA 4AHZA 4ATFA 1W2NA 4MXWA 1NA1B 4EWAA 2ZZQA 1K5MB 1UOFA 1AL23 3TEWA 3GBFA 3GBGA 5DDJ3 2VZ1A 2FZ2A 2X5IB 5GLZA 3S30A 4CCMA 3Q8AA 4M3CF 2RM23 3TEZA 4M3CB 2B5HA 2WNVA 3OGSA 4NHKA 4BMEA 1GP5A 3ON7A 2IVIB 2A5ZA 3OY8A 3ZYJB 3RZGA 1UKGA 4QM8A 2EIBA 5CYYA 2K46A 3ZYHA 3KHCA 5EJ1B 1D4VB 4IL7A 4LBQB 1JZ2A 2JDNA 1ZBE2 1AZDA 1ASJ3 3Q9OA 4MGTA 3ZSMA 3SEPA 4LKSA 2R0FA 2RHPA 3Q8CA 3N7MA 2E7AA 5F32A 1FT9A 1LOBA 4AYUA 3G7DA 2CNAA 2RE9A 4LIVA 2DUOA 2ZX4A 1ZX5A 2I74A 1LECA 3DPRA 4YM0A 3LOBA 3MEPA 1LRHA 3VUOA 1KEXA 1LB2A 1SLLA 2XVLA 3FLTA 3VL8A 3E6DA 1SDWA 1UU5A 2VMDA 2WNVC 3WUDA 3V0AA 2WAAA 3VD9A 2XXZA 2DCZA 2WZPP 1W2AX 2B42B 1UZWA 1HRI3 3GALA 5K9YA 1YI7A 5FUNA 2WS91 1W90A 2WR9A 4XBLA 4DY3A 3I54A 2J42A 5JSPA 2YGLA 4YZ5A 2JE8A 4DOUA 5CFDA 4ASLA 2RR11 1O3SA 1V9U3 3MF9A 2Y6HA 2NLRA 1OFSA 4RGAA 5GLTA 1GWMA 1QJX3 1R1A2 3ZXDA 4NPRA 2EAAA 4DQAA 1QXPA 1X33A 4CXXA 1J84A 4BH9A 5DZEA 3RPQA 1PIV2 2A6VA 2HEYF 2OVUA 4I01A 4PIYA 2BGPA 3DPRC 2DTWA 2KD7A 3O7OA 4J25A 2GC0A 2JG8A 3WCSA 2VTFA 3ENRA 4GH4A 3PTRB 2WABA 3KS7A 4FCAA 3JBG1 4H3WA 1UAIA 3IAQA 4XTPA 1KFXL 3I3DA 2HWD2 3FZ3A 2VQUA 2FCUA 3DL3A 3LAGA 3QBQA 1W6PB 2BOJA 4JAAA 4LQRA 5BY5A 1ZYBA 4IERA 3H7JA 3B5LB 4TZDA 1D0GA 2P3YA 2ZTNA 1F15A 1S4CA 1Q8QA 4OUMA 5CFDC 3WDWA 1OVSA 2JDHA 3A23A 3IAPA 1W2TA 1DHKB 5CKMA 3FUOA 3J7MA 4LBJA 5AFEA 3TBDA 3J8F3 4CE8A 1ONAA 2X10A 3N35A 4HANA 3O12A 3X29B 3WSOA 2DU1A 4LITA 5BNNB 4XMAA 4X6RB 2JD9A 4FFFA 1UZYA 3KLSA 3V65A 2V72A 2JG8C 2BP6A 4GB33 5T55A 3NO8A 3CIHA 4GH4C 5FZGA 3M3EA 4JKMA 4IUGA 3VD4A 1H2MA 2WLPA 3N9QA 4YNIA 4XQ4A 5ANQA 4OYUA 5C9AC 3OPWA 5FWJA 3J7LA 3G6JB 4XILA 4ZU5A 3TN93 2AYHA 3MW4A 4MVTA 1W3XA 4Q0VA 1BEV2 3GZAA 1I5ZA 2HWB2 4D8MA 5A32A 3INAA 1QNWA 4FPJA 3WNXA 1S0GA 3AJYA 2R1BA 4MUVA 5GLUA 1A34A 2XLAA 4M01A 1Y3TA 2XJPA 1W6MA 2J22A 1ST8A 3MFAA 1MS3A 1XQNA 2XUMA 1QEXA 3NNGA 3A22A 3LSEA 4HLTA 1JS9A 3NJXA 2QQKA 2JD4A 1DYOA 4AK3A 4XABA 3SKVA 1Q8SA 1XU2A 1BLZA 1MVEA 1H4HA 4L99A 5CAZA 5FP9A 1EYBA 3I97A 4X6QB 1JZ5A 1RUC1 1OA4A 1W03A 1IS5A 2YHJA 4HK8A 1NZCA 1AR83 4LO8A 1ZM1A 4Z07A 4Q8LA 5AVAA 2WJSA 5DABA 1E5IA 3VBHA 3ZN6A 4QD2A 2VD7A 3E6BA 5AC92 4NIHA 1VBA2 2DF7A 1AUYA 1AL21 5LY2A 4FOVA 3MIEA 5DDJ1 4BYYA 1OSGA 3FLPA 3HJRA 2RM21 1NXD1 4XQWA 5FV3A 4I0WB 4NWWA 3RFRA 5JZGB 1ULEA 3RZMA 2OX0A 3AP5A 5CKNA 4HKOA 1VBE3 4ZPIA 4FAHA 1DQ1A 2ADDA 2RDSA 2DVGA 1RTVA 4UWDA 3N7KA 4HONA 2YXSA 1ASJ1 3ZXJA 2A6ZA 1Z0HA 2DUQA 3KWVA 1LEMA 2PHLA 4URTA 5JOWA 2FDGA 2NPIA 4YVSB 3PHMA 1H1AA 1LOAA 1YLLA 4AHWA 3POEA 1VJ2A 3J4UH 4M0HA 3RYRA 5J48A 3VBHC 5LBCA 4L9BA 1X7NA 2XOMA 1HW5A 5A3LA 1AXZA 2XKOA 2E31A 1PGW1 3WF4A 3VBSA 1MS9A 2HWF2 3H1YA 3IBMA 1JYVA 2Z79A 3T0DA 1HRI1 2YC4A 4OHYA 2BGOA 3U4SA 1RGSA 1RUOA 1WA4A 2G19A 3SLIA 3WHUA 1NCRB 1W9WA 3MV01 5F8PA 4IGQA 5IYYA 4N9HA 3RZZA 1GZ9A 2PHDA 3LFMA 1V9U1 4JTNA 1QJX1 3NKGA 4B1MA 2NMNA 1MEC2 5GZCA 3AZXA 3NNMA 4ZZ5A 5KR7A 4NMIA 4ZS3A 4TLFA 2HJIA 2AH2A 5FYBA 2DVDA 2VBBA 2ZMLA 5FPLA 1RVF3 2VW2A 1SACA 4TXWA 3ZFGB 4S2DA 5KHKA 2XH6A 4O9EA 2CSGA 1O7FA 5F3IA 2ARCA 3VBSC 3CEWA 4EWEA 1BXHA 4MX3A 3VHNA 1ZA7A 3SH3A 4FPFA 4HN0A 4YFZA 3LA3A 2XBO3 4LBNA 4DEQA 2VCCA 4R52A 2ZZJA 4Q27A 4YPJA 4B4QA 2FDKA 3PUIA 4OUSA 3SCHA 3UESA 3WY6A 3EMRA 4NWVA 4Q4X3 3AKTA 1A8MA 1IPSA 1KXGA 4QPIA 1URXA 1N3OA 2XJRA 4TN7A 1W9SA 4UFMA 4QX1A 3HOBA 1KD7A 1W0PA 4N7IA 1DGWA 4Y4RA 5IK8A 1W6NA 2ET1A 4BK5A 4WM8B 3E5QA 2F4LA 4QHZA 1OQ1A 5T5JA 3AVSA 3RI9A 1NT0A 4CDWB 4KWUA 1WMEA 4KBZA 4L2NA 2AREA 4BQWA 3V0BB 2VW1A 1BBT2 1RUE2 2P6HA 4GD4A 1DIWA 3TN91 3ZYBA 5H9SA 1DZRA 2OZ6A 4LUMA 4XCAA 2OIIA 1C4RA 4LHKA 2VR4A 1O5UA 1HQLA 1ULGA 3GHNA 5IVVA 1ZZBA 3NAPB 1YFXA 4LA3A 4CDQA 4I3GA 5FXVA 2YUEA 2G9GA 4IEPA 3KT1A 2FDIA 1KDKA 1Z7S3 1W06A 4IE7A 4NRPA 4QPIC 4YZ4A 1YFWA 4PF5A 3T08A 3VZLA 4CCNA 1C28A 2VCBA 3MW2A 3CMGA 3KF5A 3POWA 3H1WA 5CKQA 3HPNA 1JOPA 2Z42A 5DUUA 1PO13 4QKDA 4DUXA 2F17A 3VDAA 3RZKA 1VB4A 1S0JA 3I2KA 2R7EB 3VBOB 2WWSA 3UGFA 4XFBA 5FP3A 4WVMA 5EIYB 3BN6A 5GZFA 3I3MA 3VBRB 4C0HA 5B4XA 1V6LA 4BMBA 4K8FA 3T1MA 2XLGA 3FL7A 4K21A 4XBQA 2Y60A 3POSA 1CAVA 4LK6A 4CDQC 1AR81 1UYPA 3NV1A 1J58A 2XJVA 3QH7A 4P9JA 4E8CA 3AMHA 1RXGA 2QQJA 3DXUA 1UIKA 2C9KA 4MV2A 2GAUA 2H6CA 1AX0A 5DMYA 5I0RA 4FTBA 1UY3A 2LRPA 4XJUA 2WA3A 3OOXA 3WR0A 4JDNA 1ZBA3 5T5OA 2WZR2 1QXJA 1FMD2 3VN4A 3PTYA 5IK7A 2QZ2A 1WUVA 5A1LA 1N1TA 4KNCA 1MQTA 1VBE1 3WNKA 2Y0OA 4LK7A 3O0VA 4ASKA 3UT0A 5AVPA 3Q8BA 4A6SA 2ZEXA 5JLVA 2WRAA 1NA1A 3MUZ1 5DAXA 1K5MA 3MPPG 1TMF2 4NJ4A 4UW5A 1NKGA 1EAH3 1QJU2 2I07B 2X5IA 3VDCA 5TSWA 1NG0A 2A6YA 4M3CA 3KVAA 5CISA 3KZ4C 2ENRA 4Y33A 1R64A 5ACA3 1W6QB 1UMIA 5JOYA 3C7EA 2HWE3 1BMV1 3WCRA 1RL3A 2ZHKA 4XTMA 3R4SA 5FP8A 1DGRN 3I3EA 2JEMA 4XF9A 1Y9GA 5IJRA 1H2LA 2EXJA 3BTAA 4W65A 2XVKA 5LB6A 3U14A 4EYUA 2GC2A 5BPXA 1GOFA 1JU4A 3E5UA 5FYVA 1RUD3 3M3CA 2PLV3 3EHKA 4CRQA 1MQTC 4HVQA 1HLCA 1CAUB 1RC6A 2ID4A 4XFHA 5DPNA 4DO0A 2R16A 3K51A 2WNUB 1NA1C 3MZHA 3GCXA 1AF9A 1K5MC 3H9AA 3OBTA 1H6XA 3HQUA 2P3IA 2X5IC 1XJAA 4EE2A 1XE7A 2Y0IA 1GUIA 4LULA 2E53A 4FPHA 1ENRA 3ASIA 5BV6A 2WNEA 1N1VA 3U78A 1OT5A 1LGNA 1XNTA 2DVBA 3K48A 1W0OA 1O4ZA 3THPA 1RVF1 3KCXA 5APAA 3QLQA 2RJ2A 3WQ7A 2GNDA 3OGRA 3H1MA 2CY6A 3IDCB 1X82A 2ZEZA 5DUXA 1CD3G 5C5TA 1ULFA 2IXJA 4QX7A 1ODNA 3DKQA 4CUBA 1H6YA 1HB4A 2XBO1 2W87A 4GAZA 5BNOB 2VZUA 1E5HA 3D6EA 2VG9A 4Y26A 4FXKB 2RS33 2P17A 3POFA 4A7ZA 4Q4X1 4JVAA 5FJHA 5ERLA 3LZZA 4MYEA 5BNPB 4OHXA 4GJZA 1QJEA 4Q8KA 5FYUA 4BIOA 4AR2A 2YG0A 1LGBA 2OS2A 5HCHA 1LEDA 1W6PA 1FNYA 1QXRA 1W9FA 2ILMA 4XYXA 4R9AA 1HDKA 2BNNA 3PUHA 3WNOA 4URAA 3WOGA 2TEPA 4NVPA 3VHOA 1OKQA 4DPNA 2RS52 2H6BA 1FATA 1LKNA 4QQLA 5JSRA 4QKNA 5F6KA 4ASMB 5DZGA 1F5FA 3DCQA 5SV5A 4EV0A 5BNNA 4F8AA 2VTXA 4N9IA 3ZYGA 1CPNA 3IPVA 1LOGA 1UYYA 4RA0A 4XBNA 2FDHA 4BCUA 1KFUL 1Z7S1 4XF3A 1PZ8A 3H42B 4FVVA 3PDQA 1NLQA 2GNBA 3D8CA 4R4ZA 4MOAA 3ZXAC 2UYBA 1VBD2 1VBC3 3CHXA 4MGYE 3T4VA 3UKTA 5JCTA 4E9KA 1G6NA 4YSFA 1PO11 2F6BA 3ACIA 2Q8DA 1PVC2 4FSJA 4W6XA 4GWIA 3P3PA 1TQ5A 2ZS6B 5I93A 2BDRA 4K20A 5GKAC 2WL1A 5CFCA 4WVWA 3K3NA 2GH8A 5BNNC 1I9RA 3ZYIB 1JYTA 2R30A 3D4KA 4B7KA 3ORJA 2XJQA 4V2WA 4R8HA 1IKPA 1H8VA 5A3WA 4XMIA 5C5UA 4W6YA 2CGOA 3WG1A 5GZEA 1T6BX 2R062 2HYXA 4I2OA 2P37A 4B4RA 1V6KA 2ARAA 1YIFA 4HOOA 2V5DA 4NAMA 3HNMA 3LA7A 2IC1A 5FXXA 5A33B 1ZBA1 5C7GA 1R1A3 5LA2A 1UY0A 4HBNA 1LJ7A 3HN3A 1JXNA 3AXDA 1HB1A 3N3HA 4RYDA 3N9OA 1VR3A 4QGNA 1PIV3 4QX3A 3WG4A 1YQ2A 2CU5A 3FE5A 1COV2 4CCOA 1W3VA 1GLHA 1LHVA 2VXRA 2XVGA 4PIZA 5CFCC 5J1XA 3IB3A 5C3SA 1RUI2 3K3OA 1HRV2 1HJFA 1OUSA 3PUQA 4E4DX 1EAH1 1O91A 2VQ0A 3J26N 4TLGA 3NV2A 2OPKA 5JZGA 3SXWA 5ACA1 5LBEA 3T2QA 1H2KA 1JUHA 1SMVA 2HWE1 2R49A 2Y6JA 5L36A 1PX3A 4XDPA 1NCQB 3FFZA 3NNJA 3W58A 5F3GA 4XAEA 1UX7A 1C5IA 4IE4A 2Z5WA 4AQSA 4M00A 5KHHA 4ZU7A 1TNFA 3ZOIA 4IEQA 2R072 3J9SA 1CAWB 2RR13 1RUD1 2XWBB 1F5JA 2PLV1 3FHIB 4YVSA 2YC0A 5FMDA 5FZBA 4CUAA 5FPUA 3TOJA 4LTAA 2BERA 3HIFA 2BWCA 4M4RA 4CCEA 1RUF2 1F4HA 3WW4A 4Z2AA 4TTGA 4XAAA 1BVVA 2X09A 5A6ZA 1E5SA 2O1QA 3N36A 3ZR6A 5FQ0B 3ES1A 1AYM2 4D6SA 4PI0A 4BOWA 1RB8G 5CNAA 1QKQA 2IXKA 5J36A 1UZ0A 2E63A 2VJXA 1OKOA 1TME2 3OBAA 2GNMA 2PMWB 5LY1A 1XC6A 1KS5A 3DN7A 5CG8A 5FZIA 2ZHNA 1VRH2 3M3QA 4Y5SA 2VZOA 2YFUA 1NCRA 1ENSA 4ARYA 4K1YA 4CP9B 5J7MA 4D0QA 4BPZA 4QXKA 4BXSV 1UZVA 5F5QA 2WWJA 3SC7X 1DG6A 2VUCA 4KWJA 4ZZ8A 2BFUL 3AL6A 4YVSC 4CDXA 2BU9A 4CXYA 5FTTC 3PMSA 4QU1A 1NLRA 2PHFA 2XL9A 1GP6A 4CYDA 3N7JA 3VD7A 3PIGA 2JDZA 1V00A 3ZFGA 3OG2A 4IGOA 3FBMA 3KV5A 4LO6B 1W8ZA 2RS31 1IPJA 1W39A 3HAGA 4N8MA 2QJVA 3TWIA 3GXUA 3WUCA 2BZDA 2HEVF 2ZGKA 3FLRA 1CZTA 4TYSA 1G9AA 3H8RA 3B3QE 4XUNA 4LLOA 3ACGA 2NMOA 2DVAA 3C2UA 1DLLA 1NCRC 1O5LA 4IE0A 4OUEA 5BUVA 3RSJA 5JOXA 4NN0A 1PO23 1CN1A 4Y22B 3WP5A 3TNQA 3WZ1A 1D0HA 1EV13 2MEV2 2JENA 1NQDA 5GJ6A 3B02A 4I30A 4GZ9A 3VGIA 3WDVA 1HB2A 4BXFA 1F4AA 4CDXC 1VBA3 4BQ4A 4DXZA 1L7RA 1AX1A 5AC93 1FNZA 2DFCA 3ACHA 3OBRA 5J09A 1CWPA 3VKFC 2ARXA 4QHOA 1VAKA 3JQXA 2ZX2A 3LB9A 4YM1A 2W0XA 4FTEA 3OD0A 3ZFGC 5KC5A 2C4XA 2QQOA 2G9FA 2WYSA 3ELNA 3ZX7A 4XFAA 4OHZA 3VZMA 1QNYA 1D4M2 5A6XA 4WM8A 4JQRA 2D97A 1KS4A 1RHI2 3B00A 2ZAAA 1PMHX 2YBKA 1YIPA 2EXKA 2Y33A 3DKWA 4LIUA 4OFGA 4CSWA 4CDWA 4EN0A 3V0BA 4J6GA 5EWSA 5FYSA 4EROA 5EQUA 1OF4A 2YB7A 4PHZA 4EZ4A 2AEYA 1DGRA 1J3QA 4B4PA 1A78A 2EIDA 1CIWA 3NAPA 3A21A 4DFSA 4UFIA 1W8FA 5C4WB 3E97A 2XLFA 3OUJA 5E16A 1UOBA 1MVQA 2BW8A 3U37A 3AJZA 4PLMA 4NRMA 5JIAA 3AM2A 4RL7A 5LATA 5D2AA 2ZGOA 1CVNA 1SBDA 1SG3A 3KV4A 4Y1XA 5F6LB 2LM3A 2W46A 4PF1A 2HWF3 5FYTA 1DQ2A 4WM8C 3R4UA 2VMIA 4OZXA 4QKFA 4QM9A 3VBOA 4TSVA 4LKDA 4CDWC 2WO3A 3FHAA 4RHV2 1NE6A 3I2OA 4UBGA 1J1LA 3ZPYA 3LA2A 3NKTA 2WQ4A 3VBRA 2OZJA 1R1A1 3C7FA 1MEC3 5JR7B 3NAPC 4OULA 1AXYA 1PIV1 3PNAA 3T30A 4AVTA 1Q3EA 1UQXA 4NHMA 5F2WA 4P9WA 2XKPA 4KU7A 2Q8OA 4YG3A 2PHUA 3H8XA 5LA0A 3U1XA 4AE2A 3GHMA 2HKXA 5EXOA 3RRDA 3FHQA 5JXGA 5IVCA 5FZCA 4COYA 2ATFA 3VV1A 3POGA 1HX6A 1RUH2 3ZFEB 3R4DB 3FFQA 4EN8B 3MLKA 3GGLA 4UW4A 1RUNA 3ES4A 4JGZA 2AC1A 4A7KA 4CCLA 3LKJA 2WFF3 2PA7A 1CJPA 1U5IA 2R042 1JYCA 3VBOC 2HBTA 4P5HA 1AR93 4BB3A 1YI9A 3POIA 3VBRC 1MS1A 1MS0A 4XCBA 3ZR5A 1R092 2XG3A 1KITA 5JPMB 5EZWA 2OUJA 2VC9A 2W95A 2WYFA 2DYCA 2ZA9A 3GZEA 4P08A 1NY72 5LA1A 5FK7A 1CQ9A 3GDBA 2VECA 1S0IA 1J3PA 1W6QA 1QQP2 3OYWB 1PGL1 1OHFA 4JGYB 1OUXA 3ZN4A 3AP6A 3O1SA 4Y5TA 4QQOA 5IW0A 4CUGA 2G9ZA 2PQSA 2W1SA 1K45A 2Y34A 2LALA 2Z69A 3SNMA 4OI1A 5BYNA 2ZHLA 4JGZC 1ENQA 4UF0B 2EF6A 1XNDA 4IE6A 5FLHA 3BTXA 2JIJA 1RUE3 2PXJA 5FZEA 1CAUA 2AENA 1HIXA 2BFUS 2D6LX 3I2DA 5A6YA 2WNUA 3FMGA 3OUIA 4KG0A 4Q4V3 1PM7A 4FBFA 4XHXA 1T6GC 4NIDA 5LBFA 1Z78A 1GWKA 1CZVA 2B46X 3ILRA 4XJ8A 2XB6C 3KVBA 4LBMA 5FYYA 5I8TA 3P5BA 4Q4W3 1F2NA 4N53B 2BV4A 4Y4YA 4DZGA 4HZFA 2XPJA 2JICA 2VOTA 2Y8KA 4MLOA 3VL9A 3ATGA 4FFGA 3RJ2X 3SEEA 2ZGLA 4LE4A 2OXBA 5G04L 1WCDJ 1G9DA 2VO5A 4D94A 3AFGA 1V6NA 2WSUA 1Y9MA 4XQDA 2VZVA 4KU8A 1GSLA 2HWC3 5GLVA 1O59A 2FCVA 1X8EA 2YPDA 5FMOL 4PBOA 5JAXA 2WNUC 3QACA 5BNOA 5LZ6A 5A3NA 1PO21 4FO9A 4ES8A 2QCSB 1EV11 4QT6A 1RJ7A 4LXLA 1S2KA 5AC91 5FZ1A 1VAMA 1VBA1 2XMLA 3C7GA 2BGCA 3NW4A 3KGLA 4AOCA 4AZZA 1IQDC 1JU3A 5BNPA 2VUAA 5FOBB 4LORA 1QGLA 1JW6A 1WWYA 4AGGA 4YW3A 5A3PA 1FOD2 3M4FA 2W5FA 3LF7A 1LESA 5CVRA 1WGPA 3V64A 2FCTA 1EUTA 4OZOA 1R083 1ZRFA 4PT6A 4CEWA 2C6SA 4PDWB 3O0WA 3O5SA 3OEAA 3WV6A 1DZQA 4AAXA 3ZFFB 1AYN2 1OMIA 4NIAA 5BNOC 1N3PA 1QJU3 4LMFA 2A71A 4DXRA 3HD8B 4OMDA 4JQTA 1UPSA 4S2FA 3WF3A 3ZXKA 2EAKA 3AYAA 1HJGA 3AMMA 4PQ9A 4DS0A 5IHRA 5BNPC 2UY8A 5HCAA 2J1RA 3S57A 1OOPB 2AZ5A 1I6XA 3MDPA 3MFCA 4XW3A 4JKKA 2E51A 4DNYA 3TB0A 1S2EA 2A6XA 2HWF1 4HKLA 2ZGSA 4EJRA 1NUKA 1GQHA 2JWPA 4D69A 4Z92B 3PUAA 4AL9A 1GICA 2ZGTA 4A41A 4AVBA 5FPZA 3LSDA 5ABJA 4CEWC 5FZ9A 1IHMA 3MLJA 3T1LA 1XPWA 4CEYB 2J1SA 1DGLA 1O4YA 1V6MA 1F35A 2YMZA 2ZHMA 5E6HA 1W2UA 3LCPA 1J3RA 2W2IA 1MEC1 4GMP0 3S0MA 3IMMA 3NSTA 4QPWA 1N47A 1UYXA 2WLQA 3VKLA 1POQA 4CCCA 4D6QA 2GP3A 4AGRA 3AVRA 4GALA 1NYWA 3B7MA 2WWUA 3EO6A 5FJKA 1Y4WA 3LWCA 1BKZA 1H8TB 4XUPA 1DDLA 3OBZA 3JB8A 2C26A 5K8SA 5D1IA 1GNYA 4IEWA 2FBEA 1ZVFA 1X36A 1JOBA 5F2SA 4HKWA 2D7FA 2WFF1 5I8SA 5ABJC 1HKDA 3M1HA 5FXZA 4Q4Y2 1NX9A 1A6CA 3B69A 3KSCA 3KV9A 2D98A 3M7AA 4NUBA 4BJ0A 4PJYA 2J1TA 3RYPA 1AR91 5A80A 4AEJA 4COUA 2A3WA 5KXCA 4P02B 3U11A 4A45A 2X05A 5HCBA 2HH9A 2VM9A 3GYDA 4CP0A 2XL7A 1JZ8A 5L9RA 3PVBB 1H30A 3H3LA 1RUC2 4QX8A 1C3HA 1L3JA 2WC2A 1UU6A 1UOJA 3ACFA 1REEA 4JZRA 3DECA 1NCQA 1V6IA 1Q43A 3AZYA 3BGAA 4Q0UA 2GMMA 2A7AA 1XNAA 1FPN2 1UL9A 2QDNA 1JOJA 4AFBA 2VZ3A 3F95A 1RMU2 1LOCA 1UW8A 4N7UA 2EIEA 4EN7B 1VB2A 2VQTA 4QB1A 2RM22 3BOPA 3ZSJA 1UCXA 5FYHA 1JYXA 1RUE1 4W6WA 1JZ3A 2VZPA 2WA4A 4LE3A 4YW2A 3K2OA 1I5PA 3SHRA 3AZVA 4DXTA 3VBUB 3P6BA 2PHWA 4KH9A 1FXZA 2OPWA 3MIFA 2SBAA 4BQ1A 5FQ0A 1F8VA 4Q4V1 1ND2B 1QU0A 2OYZA 3B93A 1UU4A 2K0GA 3WG3A 5DG2A 2LTNA 5C8CB 3O0XA 1LTEA 4IDZA 1MR5A 4XJZA 4ITCA 3ETQA 3M3OA 5JUVA 4TWTA 4AI9A 1H9WA 1DLCA 4Q4W1 1NCQC 2BNOA 1QH6A 2CWSA 2BUKA 3K75B 2WT2A 4CP9A 1SLBA 1ND3B 2QVSB 3CL1A 3H50A 3MW3A 1D2SA 5FMOS 3THCA 2WAOA 1DQ0A 1CAXB 1QOSA 2V4VA 2WDBA 2Y64A 5JPNB 4XJAA 3O1OA 1XSRA 2HWC1 3JZVA 3B94A 1HRI2 3FX3A 1WKYA 3ZN5A 4ISRA 5JMCA 5FMCA 4Y20B 4FFHA 4YW1A 4P9YA 3KB5A 1BZWA 1POV0 3JD73 4H7MA 5EP9A 4ZONA 4MGQA 3S6PA 2VZSA 4COWA 2CHHA 2EICA 1V6OA 2PFWA 1UMHA 1AJKA 2QNKA 1QJX2 4HSLA 3AZWA 5FOJB 1MPXA 4Y1UA 4KBBA 3ZKYA 4AEMA 5LRRA 3ZXGA 3C7HA 2RS13 1OURA 1IS6A 4AEDB 4L11A 2PAKA 2HEWF 1I1EA 2UWBA 4MGZE 4QB2A 4RFT0 3WNNA 4Y22A 1W2OA 1C5HA 1YQ8A 2YY1A 3LQCA 4UYBA 4CU7A 1GZWB 1COV3 1R081 2ZXQA 4XFIA 5KXEA 1DF0A 3WQ1A 1IS4A 4MO3M 2VCAA 4XEZA 1HRV3 3UGHA 1C8M2 3I8TA 4CU8A 3WLUA 1QJU1 4JRLA 2O0OA 3LPFA 4IEVA 3VZKA 4CUCA 1BVP1 2J1EA 1HXS3 1CR7A 1TZOA 4FPCA 4K3UA 4L0PA 2VXJA 3VD5A 5JXIA 4QPGB 3AMNA 4CVUA 3KQRA 5F39A 4KGQA 4W8JA 3PU3A 2XR4A 2JX9A 5FY9A 3J8F2 2VOVA 2PAMA 3PURA 2DCTA 2VE1A 4E4HA 4AFCA 1OLQA 3EXUA 4DXSA 2YU1A 4O65A 5FKCA 3AYEA 4B3NA 3W9AA 2B45X 3RMYA 2CWMA 4GB32 5C4WA 1WCQA 3OY8B 1G8WA 3H8UA 4SBVA 3THTA 1OQDA 4G9SB 5FBJA 5LK7B 5IFPA 3WW2A 4ZXKA 1B35B 4HPKB 1AYM3 2A3XA 5DXDA 1G9FA 3BYWA 3C8XA 4G3YC 3M2MA 1FX5A 4CDUB 3U0ZA 5FUIA 2D40A 1AR62 4XZPA 2RMU3 3OD4A 1OLME 4DB5A 4CTEA 4NPLA 1HQNA 3SITA 3WW1A 1VRH3 2YFZA 3PUSA 1REFA 4IESA 4R9DA 3GNEA 4QWNA 1AL0G 1SBEA 2L9LA 4AVAA 3WQ0A 1W8HA 5FZMA 2XHKA 4LBQA 3MI8A 1RIRA 2VZRA 4OI4A 2W91A 4Y1ZA 1TE1B 2WZEA 2GC3A 2Q30A 3RVHA 5C4WC 2N7GA 3D3AA 4ZU4A 5A7OA 2CDPA 2PN5A 2EXHA 2IFRA 3PIJA 4I0BA 1PK6B 1LOEA 3UKNA 1US3A 2GC1A 1UF2C 3LEGA 4ISQA 3JUUA 2O8QA 2W3JA 1W8NA 3IIAA 2UY9A 4QAWA 4XFFA 5FR3A 5FMBA 1AR73 3VKMA 4HVOA 5BNQA 2JECA 2GMEA 5F37A 4N90A 1QMJA 4UOJA 3SH4A 4DY5A 3FC0A 3M8LA 4V2VA 2E32A 2QQUA 2I45A 3OF1A 1GOGA 5CIRA 3MPBA 4CU6A 2ET7A 5BXXA 4PIXA 4AI8A 1NQJA 2MEV3 5IK4A 1DYKA 4YGEA 4ZXEA 1ZRRA 2YGMA 5FZ7A 3UETA 1QIQA 4Q2FA 4YVWB 3RQ0A 2QUOA 4MSVA 5FYIA 3T2PA 3WD5A 1YWKA 5C9AB 1JZ4A 1YCIA 3OYWA 5A3TA 1GANA 1VBE2 1ZRIA 4JGYA 5CG9A 4GXLA 4MGSA 1UIJA 1F9KA 3HNBM 3GJAA 1W8WA 5FY4A 3A0KA 5FZLA 1LGCA 2DV9A 5EFUA 1D4M3 5SV8A 4E2QA 4A44A 1Y43B 1RHI3 3D5OA 2CV6A 3THDA 4C91A 4AI0A 4LHLA 4UF0A 3SQOA 5A7PA 2QZ3A 3UKVA 3A0NA 3H3ZA 4FQZA 1O6UA 2RJLA 3OB8A 2VNOA 2A3YA 3WT3A 4W4ZA 1ZZ8A 2ZPXA 3OSDA 4OVEA 3RMXA 5JSOA 4J1XA 4MGIE 2IUWA 1L7QA 1XNKA 3L2YA 1PM4A 5F3EA 4XPVA 2ES3A 1OPMA 1XYNA 4HMZA 3AYCA 1GZCA 2C5DA 2GALA 4JRAA 5LEKA 1JYIA 3RZHA 3OCPA 3DYPA 1GNZA 3BOWA 4HK9A 1DU3D 3H3UA 4JGYC 3DYMA 1OA2A 1WCKA 4N53A 4BWOA 2QFEA 4QX5A 3H7YA 5EJZB 4CCJA 2CGNA 2QE3A 5A7QA 2Q5TA 1HQWA 2ETEA 4Y1YA 5H9QA 5A32B 3VD3A 3ZLIA 4AFMA 5IVBA 1WMXA 5KHJA 2D3SA 3FJSA 3JD71 3VDBA 1SBFA 1VBB2 1YJKA 3T0BA 4YW5A 4P00B 4A3ZA 1W6OB 1HB3A 4OMCA 4RHV3 2Q8EA 1NE4A 2B39A 2ORXA 2IXLA 2VMCA 3GBWA 3ZYPA 3EBRA 2DVFA 3MIGA 4AF9A 4NHYA 1D2QA 5E88A 2RS11 1ZRDA 3LDRA 1ZBE3 2JG9B 3WXPA 4MADA 5C6CA 3BB6A 4HFSA 5FK8A 4S2GA 4Q5OA 3I2HA 4WV8A 3ZVXA 3D0JA 3E6CC 3U10A 1COV1 2I2SA 4YARA 2QQNA 3RG0A 3CDZB 5IATA 2WSVA 1RUI1 4BISA 1HRV1 3K4ZA 3S5AA 1ZREA 4N53C 5AFBA 2NZ9A 3BKZA 4IEOA 4AFAA 2XBO2 3C3VA 4XHBA 2RVAA 1HXS1 2R043 2W08A 3UNPA 3BTZA 1VAVA 1IG3A 3BU7A 4AVSA 4XJWA 4Q4X2 4IETA 3RJRA 4PI2A 2QDRA 4PDWA 2JE9A 3WVJA 4H2AA 3VLBB 1P8JA 3LEKA 1R093 2EIGA 4E4SA 3ZFFA 5HBAA 2VBPA 1OF3A 3O1PA 2GN3A 5A1FA 1ZZ9A 1UXXX 3NJZA 3GCWA 4JCKA 5LASA 1ACCA 1RUG2 2OQ7A 1GQPA 4P9LA 1IQAA 2R6QA 3AP7A 4RR3B 3NV3A 2C24A 4DUWA 1S0EA 2YBPA 3RZLA 2HLEA 5J98B 4RS5B 3DEMA 1EPWA 4D7SA 1AYM1 2CDOA 4UFKA 3NMBA 3GM8A 2VPVA 1OBNA 1O4TA 2JDYA 2Y26A 1PX4A 1WW4A 2A6WA 2WO2A 5FUPA 5LCWL 4DEVA 2JIGA 5T52A 2RMU1 1TME1 1OLRA 2W52A 5FCCA 2JKXA 4HVRA 1DQ5A 5T5LA 1MZFA 5C33A 5D21A 3WP6A 3ZSKA 1VRH1 4CXWA 5I8YA 4PDWC 2HWD3 4CEYA 5CA6A 2WQZC 3NJVA 3T2OA 5M0TA 2VNVA 3ZFFC 4B7EA 4E2GA 3BPSA 1BK0A 1L7LA 2JB4A 3HQRA 1JTZX 1WLCA 1CESA 1PO12 4HG6B 1RYYA 3VBFB 2XDVA 1LHOA 1OH4A 2D6OX 3ABZA 5EV7A 2BQPA 1LHWA 1IGOA 3PJQA 2QQMA 3J7NA 1FI2A 1LR5A 1H8TA 1QJZA 2VNGA 2WIIB 3D82A 1AR71 1FAYA 4FFIA 5FO7B 5E89A 4MGKE 1WW6A 2VW0A 1X8MA 1KJRA 4H14A 3RGBA 2A1XA 1LCLA 3RWKX 2BNMA 2QTWB 1U5YA 2OQ6A 5JZGC 4C0BA 2ZACA 1RINA 4CEYC 2RJKA 5KHGA 5FZ4A 5J96B 2QQWA 4HT1T 2FHRA 1U5ZA 3CO2A 1BEV3 4GMP3 3MV11 2HWB3 2PELA 2MEV1 5J3UA 3EQEA 4LNVA 4HXCA 3I2IA 4NPMA 2WO7A 1SPPB 4IV1B 4LKFA 4GKYA 1HN0A 2VULA 4YM2A 1WA6X 4CP2A 3LOIA 1FOD3 1WBLA 1WW7A 2UWAA 3MF6A 1UKRA 1H8TC 4LBLA 4P9GA 1D4M1 2KR2A 3IM0A 1JODA 5F5CA 3MHZA 3WEZA 1RHI1 2VVEA 4BLJA 5HI0A 4XACA 2VOXA 1BJQA 2W68A 4BE3A 1CONA 1ZRCA 1DZTA 5F5IA 3KT7A 4MXVA 4F7ZA 3AMPA 1QH7A 4R9CA 1AYN3 1HN1A 1LOFA 2Q1ZB 2ZOEB 2HWE2 4M3CE 2BJSA 4D7YA 4NIIA 3VBUA 1S0CA 3EB7A 2VUDA 4XUQA 1G9CA 3BCWA 1H4GA 4DMIA 1OFNA 4Y1VA 4ES9A 1PVXA 5C8CA 4OHWA 3FN9A 3LEIA 4Z2WA 1GMMA 1YEWA 4YGBA 1VMHA 4IXLA 1SFNA 5L73A 2PLV2 2GU9A 2XUEA 5K0UB 3CNAA 4Y3OA 4P14A 5F9TA 1X9TA 1WD4A 4NROA 2NP0A 1ND3A 3IKWA 3JCIA 4JKLA 3BTYA 1CGPA 2PHXA 4RQPB 1S0FA 5A70A 1W28A 1UWWA 2ZKNA 1XE0A 3CJXA 3OTFA 3DGTA 5GLWA 4RHV1 1CAXA 2J1VA 3I59B 5C8WA 1MS5A 2PHTA 1E57A 3ZPOA 2XJSA 3W21A 4E2SA 3ACLA 1LOFC 4LKEA 3GZUC 3K4AA 2YYOA 2YC2A 3VBUC 4Y20A 2OA2A 1T2XA 1ZBE1 3Q8FA 4EN9B 4CPBA 1OPOA 2DTYA 2W92A 4ET7A 1GBGA 1GQGA 5FY5A 1BQPA 2QBXA 2Q4SA 2ZGRA 4XUOA 1FV2A 2E6VA 2E7QA 2K2SA 3USUB 2JXAA 3F2ZA 4WZFA 3O1VA 2VCMA 4QKBA 3LD8A 2B9VA 4WVMB 2P3KA 4QU2A 4AFDA 3JU9A 1VLNA 4R9BA 5A7NA 1RUH1 4UI9L 2GMPA 5DQ0A 4AEDA 1ND3C 3ME2A 1PGSA 5LBBA 4QPYA 2DCYA 3E1F1 2R041 3SISA 4P5YA 3WX5A 2P2KA 3AP9A 4Q4Y3 2XGXA 1GR3A 1GZWA 3POBA 1C1LA 3VKOA 3RI8A 1RUJ2 3OJBA 4QXCA 2V73A 2D44A 4EQVA 1EP0A 2VMHA 1R091 3UYJA 5ISLA 1POV3 2ZGPA 3LEMA 3ZM8A 3RS6A 3I7DA 3V56A 4E8DA 4MG2A 4WBBA 2EXIA 4Z8BA 1C8NA 1EPZA 2B4KA 2D43A 3I3QA 4XOGA 4COZA 2FD8A 4QPGA 5FKBA 1V70A 2W1WA 1LODA 1MQTB 1PMIA 5C3RA 4BHPA 2Q8CA 5D8AB 4P9IA 4UW3A 3HEIA 2RV9A 4BQXA 5DN2A 1FPN3 1RXFA 3AP4A 3URFA 1A8DA 1Q8VA 3I2GA 4AEDC 3O1UA 1OC1A 1XBFA 1RMU3 2UYAA 1MS8A 1DYPA 4M4PA 1DBNA 3WF2A 1K5JA 3K46A 5FBZA 3T0AA 4FP2A 3PL0A 1W05A 4QGMA 2HWD1 2X8KA 4FPGA 2YV8A 5IWFA 4UBHA 1B35A 4HPKA 1J1TA 4FOYA 1SZBA 1Y9QA 1ODMA 1YO8A 5FYCA 1QJY2 5C3OA 5IFTA 4CDUA 2J7MA 1QF3A 2J1UA 1ULDA 2SLIA 4YFWA 5I0DA 1VBC2 4AEKA 1UYZA 4LHSA 5F5AA 4YW4A 1IOAA 1SLAA 4QPGC 1DQ6A 2WKKA 2CAVA 4DRVA 3BU0A 3HQXA 1M4WA 2UWCA 2VAUA 4LJHA 4U2AA 4A3XA 4BA6A 1DGWX 4OI0A 4C1XA 5A1AA 1U5XA 5IT6A 1VE0A 2EA7A 1YC61 5CEHA 3NL1A 1QOOA 1UMZA 4AG4A 3IDEA 3JXSA 5KXDA 1EUUA 1TEIA 5FREA 4HSJA 2QQPA 4ORFA 3WDTA 1TNRA 4D7TA 4M0NA 1PK6A 2WT1A 1BBT3 4FP3A 5C3PA 1B35C 5L19A 4WM7B 4IV3B 5FYMA 1BEV1 4GMP1 4BU2A 2HWB1 4CDUC 1LU1A 2P34A 3J7HA 3MLLA 4LBQD 4ZHNA 1O8SA 4ZKTB 5FZOB 4Q29A 5H9RA 1D7PM 5IVYA 5B4NA 5A7WB 1UOGA 1FOD1 5L7OB 5FWEA 5HV0A 4BZ4A 4A7YA 3KT4A 4Z82A 2D5HA 3VHRA 3BI3A 2P6CA 1GNHA 1H9PA 5HXVA 4AI3A 4CU9A 4NR1A 3PJYA 3M70A 1QWRA 4QQPA 4V1PA 3EYPA 4B1LA 3OGGA 1YUDA 4YVWA 4UW6A 3SCFA 2ORZA 1PZ9A 4QXBA 1BYHA 1C8M3 5FLJA 4ZS2A 5C9AA 5F3CA 1AYN1 1Q8PA 1PK6C 5KC6A 4O61A 2WN2A 4K40A 1G9BA 2W47A 3PMEA 2ZGMA 2WS92 4FXGB 4H55A 4XZUG 5DAWA 2NM1A 2FZ1A 1U12A 2K9ZA 3O14A 4QDQA 2VU9A 2JDMA 4Q0PA 4QXHA 2GH2A 2RR12 3S5QA 5CBLA 2A73B 2YZ4A 1UN1A 4IQPA 1SLTA 4D6RA 1PGL2 5CB7A 3UK9A 1W8UA 2WBKA 4IGPA 3ITQA 1RITA 2GNTA 2WZR3 3HT1A 4FPKA 3AXEA 2JB8A 4UFLA 1FMD3 3IPVB 4JDOA 5FPAA 2WINB 5GALA 1AHSA 5JR2A 3O1RA 4GIQA 4I09A 3AKPA 4YVWC 5T3NA 3IT8A 5FAXA 3ZYRA 1M06G 5LK5A 4FTSA 5T50A 1OLMA 3OGVA 3JBG2 3H8OA 1AR63 3EJKA 5B2GB 2ZEYA 4CCDA 2C0ZA 1TMF3 3I49A 4XDQA 1S0BA 3N9MA 4XJ9A 5HXMA 5JMOA 4NHLA 3IDAA 2QQLA 5FZ6A 4IE5A 4XF4A 1W6OA 1OH3A 2BPA2 3GF6A 4N43B 3PLQA 1JYWA 5IVJA 3O1TA 2Q1FA 5CFCB 5F1RA 4XXAA 4AGVA 4NHXA 3FBYA 1V0AA 3DUIA 2JG9A 3APBA 2UU8A 4LPLA 1JZ6A 2DDUA 1PZ7A 1OD5A 4QDSA 2WZ8A 5FZ8A 4P9XA 4Q4Y1 4YG6A 4EN6B 3KCCA 2WFPA 5LWBA 1ZA4A 1PHMA 3PVEA 3CJIB 4QB6A 2UURA 3KGZA 3LDKA 4KWKA 2G1MA 4AQ6A 5IAXA 2D6KA 1POV1 1PMJX 3W59A 3PVNA 1XSQA 2A70A 2D5FA 4UT5A 4QDRA 2G4IA 4XVHA 1PO22 1NXMA 4XIKA 2W94A 3AX4A 1CX1A 3AFKA 4WVZA 1JI6A 4K1ZA 3POYA 1EV12 2KXLA 5JIUA 4KQ7A 2VH9A 3HWJA 2ZX3A 2E33A 5FLIA 2YDEA 3KQ4B 3W5MA 1HV0A 1FPN1 3NNFA 5A6QA 1N3QA 5ANNA 4JDMA 4O9GA 1NAEA 2JG9C 2DWRA 1RMU1 3SKJE 1ZZCA 2RG4A 4LHNA 5A33A 3U75A 4Q1PA 3WW3A 1WLTA 4Y5Z0 5LRSA 1KQRA 4RR3A 3TAYA 4AHXA 4Q26A 4E27A 3OEBA 4C8DA 4RS5A 3VHPA 2OKXA 4AHYA 2LUWA 2XJUA 4BQ2A 1GU3A 3ILFA 3MGUA 4GWNA 4SLIA 1WMDA 1RJ8A 4X8PA 4FPEA 4CP1A 1W8OA 1OD3A 5C3QA 4K9SA 1H1MA 3QCWA 5I0TA 3UL2A 4FOQA 1GOHA 1MACA 1ZZ7A 3O1MA 1YJLA 3CKHA 2ZEWA 2W39A 1IKQA 2IZWA 1JHJA 2ERFA 3ILNA 1UY1A 3BALA 3L9JT 3NV4A 1XB9A 3PVOA 2RS53 2XJTA 3QOPA 5DAPA 3IN9A 4BK4A 3R05A 4RSUA 1AL22 2DURA 5DDJ2 1XNBA 1F31A 4RR3C 4A42A 3VBFA 3MICA 1CAWA 1K12A 2LS6A 1WLWA 3I4IA 3PU8A 3ZKUA 1BBT1 2RDNA 4RS5C 5FRAA 3UGGA 1UPIA 3IDBB 5I91A 3K77A 4LA2A 5FPXA 1NZIA 1LULA 1VBB3 4ZY9A 4QGLA 4LBOA 3IMNA 2Q1MA 1QOTA 1VRBA 2YROA 2V4AA 1LENA 1S55A 3VZOA 4CDXB 5LEJA 4XC9A 1ASJ2 1G7YA 4PBPA 4ONUA 4XIOA 3I2JA 1XRUA 3ZDSA 4NRQA 4OCTA 2HBUA 3LFIA 3K4DA 3WNMA 4S2HA 5JVVA 1DCSA 3AYDA 1VBD3 4B8EA 5L9VA 2FQPA 3NQHA 3DYOA 3WG2A 2WNOA 4HL0A 4YZ1A 3MIDA 3GJBA 4IEYA 4JHZA 2DU0A 1SPPA 2VZQA 4L97A 1PVC3 4IV1A 4LOSA 2D6MA 3LIGA 5FXWA 3VDDB 4A2UA 4OQ9A 4ARXA 1C8M1 3VBFC 5DUVA 4LO5B 2WFF2 3B01A 1PGW2 3D0SA 2D6PA 1KDMA 2Y6GA 3P3NA 1FV3A 1DFQA 1W99A 2Y38A 4JV4A 1AR92 2B7YA 4NO4A 3VZJA 5KBFA 1O3RA 4PLOA 4GJYA 3TEXA 4HN1A 1ZNPA 3NRUA 4AVVA 3T3YA 2R063 3J8F1 1UX6A 4LO4B 1V9U2 1SQ4A 2Z4FA 3AK0A 4FQ4A 2ZX0A 2NQYA 4UFJA 2WN3A 4E4ZA 2KA3A 4FPYA 2VTXJ 5IAVA 4AW7A 2BOIA 4PCRA 4AQTA 4JX0A 1RUG3 4YM3A 1LU2A 3T2TA 1NLSA 2WZR1 4GB31 1VPHA 4QX2A 4UAPA 1KRIA 1FMD1 4A6OA 2X29A 3VZNA 4AWDA 1XXNA 2VMFA 4IV1C 2MPFA 3HR9A 3U4XA 2Q0AA 1S0DA 4F83A 1QJFA 4OQ8A 1V6JA 3JB4C 2VUJA 4LBKA 4AXOA 5DG1A 5K0UA 1WLDA 4FT8A 1WZXA 3A4UA 3ZDVA 1RUI3 2JDAA 3KMHA 5K7PA 1AR61 3I3BA 5FZ0A 4EZHA 5JXHA 1BCXA 1TMF1 2D3RA 1MZ6A 2ZBJA 5KXBA 1OVPA 3LIHA 3UJQA 4Q4V2 4RQPA 4BQ3A 1B09A 4GULA 4XF1A 5A7SA 1EY2A 2E9QA 3I59A 1JHNA 3DXTA 2VOWA 4Z1VA 4Q4W2 2BBAA 4MXWB 1SLIA 4BLIA 2H0BA 3BPZA 3ZYFA 1UO9A 1G86A 2GP5A 1SFPA 4K6BA 3SH5A 3ST7A 4NIGA 1DP0A 2R073 4O7XA 3ZMOA 1KJLA 2XHNA 4META 4X8NA 5CZKA 2FDFA 1AX2A 5GM0A 1C57A 2P3JA 2WNVB 2MNGA 3USUA 4CCKA 4I3PA 3WF0A 4RFRB 1GKBA 2YPJA 1RUF3 4AQ2A 3TNPB 5FY0A 5K0UC 2HWC2 5CADA 4DIQA 4FPLA 4LR4A 2W9XA 2V5YA 1YQ6A 2BVBA 2ZGUA 4CPBD 3OPZA 3TN92 2IVJA 2CL2A 2PTMA 4RQPC 1REDA 4XFCA 5JI7A 3TYJA 1TME3 5IK5A 2F4PA 3MO4A 4CZSA 3BIEA 4INDA 1E5RA 4HETA 3CLPA 3ETPA 4GQ7A 3ZIXA 3KCYA 2CGPA 3DPRB 1UY4A 5T5PA 4JGZB 2W1UA 4K7JA 2GZWA 4KI5M 1LAJA 1YRZA 2DCKA 3V0AB 2IXCA 4LUKA 2C1FA 1R082 2V09A 5D8AA 3BVCA 3N7LA 3RDIA 1JUIA 3ZSLA 5JOZA 2MHFA 4YZ3A 5E8AA 3N9LA 3OUHA 4BQYA 5CFDB 1WMFA 3TRSB 1XU1A 3KD4A 3MYXA 1J59A 1UY2A 3ZFEA 4KGGA 1UNBA 3AL5A 3AKSA 4FAGA 4XXPA 1AR82 5JXJA 2KM2A 5JWPA 2ZCWA 3TEYA 3UJOA 2VOKA 5E1RA 1XE8A 1X50A 4IEZA 4C1WA 2BVVA 2RS51 2CAUA 2JG8B 1K3IA 1WW5A 4GH4B 1Y7BA 4QMAA 1U0AA 3HBZA 5D8AC 5HCFA 2XQRA 3OPTA 2BBVA 2ZAHA 5EYYA 2BWAA 1UXZA 2WO1A 2ZMNA 5EPAA 1XYPA 1VBB1 4F3JA 4XE9A 3LDBA 2VQAA 5LA9A 2IXHA 2FMYA 3NWKA 5FP4A 2QKDA 1SCRA 1GZTA 2R1DA 1W8TA 3ZFEC 3W5NA 4RGKA 4XUTA 3ZIWA 1YQ5A 3WF1A 1ENXA 4PLNA 1PNFA 2Z2SB 1IG0A 1QDOA 4AI1A 5K4LA 1GYKA 1CJDA 5EYXA 3USSA 3VB9A 2AGSA 4YLZA 3WHTA 5HPOA 1BMV2 4YRDA 4MZUA 4WM7A 4IV3A 1VBD1 1WCUA 5G05L 3WINE 3WP4A 3MBWA 3SMHA 4I02A 2DUPA 2VNRA 3BODA 2OUHA 4UFHA 1PVC1 2BYVE 5FZOA 1YQCA 3IZOA 3NJYA 5A7WA 1LNSA 5L7OA 1JYNA 4Q1RA 2JDKA 2OW4A 1JMUB 1YNAA 3KF3A 4JC1A 2W1QA 1DQ4A 3WDYA 2ZGNA 1ZZ6A 2AUYA 2VVFA 4WVVA 5FZDA 4AI2A 1JH5A 2Y6FA 1YFUA 3LGRA 1RUJ3 3QD6A 2R061 1UZZA 4QQ2A 2NN8A 2VVDA 1OA3A 1W6MB 3AC0A 3B9CA 4J1WA 3DV8A 1SDDB 4IV3C 4WM7C 1RUG1 5A3MA 1IS3A 1SFYA 5FY8A 3H0OA 5FZFA 3ZXFA 1RVF2 3L2HA 1S1AA 4MH0E 4NAOA 4WZCA 2ZGQA 1BHGA 4FOWA 4CEWB 2JDPA 1W9YA 3VKNA 3KV6A 1R1ZA 5L7OC 4EWDA 2AR6A 1YFYA 1ULOA 1K42A 4KL1A 1SEFA 3HVDA 4YGCA 1RUH3 2JE7A 2D6NA 1IZ3A 4LT5A 2XWJB 3S7IA 2DBNA 2VGDA 4COVA 4XF0A 4AAPA 4KG8A 1ULCA 3U07A 3I2FA 4BM8A 4BIFA 5JDBA 3VBHB 3ZN6B 1A3KA 1QJY3 1TG7A 1H1IA 2D3PA 3C7OA 4DUVA 2WUHA 3AZZA 5FO8B 4FI9A 4PQQA 2R071 3FWEA 1VMJA 1AJOA 1O3TA 4CA9A 3BUCA 1TVGA 5FY1A 5ABJB 3RZJA 1ALYA 4N43A 1APNA 1YHFA 2VMEA 1QQP3 2IXIA 3CZJA 3KM5A 4R4XA 1RUF1 3HT2A 3WP3A 4LOTA 5DAVA 5FPBA 2WT0A 3CZUA 1N1YA
chains in the Genus database with same CATH topology
1OOPA 1VIWB 2GSYA 3HMYA 5H9PA 4IEUA 3JD72 3AMQA 4LLFA 5FDBA 1LHNA 4XETA 4Q0QA 3HN1A 3CJIA 2PHRA 5EJ3A 3MIHA 2ARBA 1Z7S2 2EALA 2IWGB 2RS12 3AKQA 1CPMA 1Q8OA 2ZMKA 3M3IA 2BEOA 2B9UA 5KWRA 4OHVA 1I3HA 4N43C 1GFF2 4RD7A 3VBSB 3ZXLA 3RYKA 2R0HA 4LO7A 3ECQA 3ZO0B 1OOPC 2PQQA 4L92A 3JQWA 4GA9A 2BTVC 4JTOA 3R6SA 3ZMNA 3UV9A 1HXS2 1YXWA 3RNSA 2VY0A 2H0VA 3RWNA 1SCSA 5CU1A 3CJIC 4I0AA 1Q5OA 1O3QA 1WCSA 4YG0A 2ZJCA 2C9AA 2WS93 5T54A 1Q56A 3WDUA 5DZFA 2X53S 1JN2P 1ZBA2 2TUNA 2O8OA 4FPOB 2B8MA 3ROUA 4NOTA 4DRRA 1AXKA 1S2BA 4YGDA 4IEXA 2HYKA 4OI2A 5J37A 4AVCA 1XYOA 1BK1A 1MZ5A 4OLLA 2RMU2 4ATEA 2ZKLA 4Q0SA 1LHUA 5GZGA 1EAH2 3AKRA 3JBG3 4QPIB 3IWZA 1GV9A 4XFGA 5ACA2 2PAEA 1VALA 4GWMA 2DFBA 3N4MA 5I0UA 4DINB 1N1SA 2FMDA 5GZDA 3ALQA 1ND2A 1W6NB 3SCGA 5FFOC 1RUD2 1QDCA 4D3WA 3ZXEA 3CF6E 2TNFA 1H0BA 3B9IA 4U36A 1AR72 4B29A 3DF0A 4G4FA 3ZSEA 3AB0A 4CDQB 1RUJ1 3VDDA 2EVXA 1FYUA 1AVBA 2R32A 1JBCA 4YZ2A 1OI6A 2JJ6A 1WBFA 4YYOA 3GZTB 3BIWE 2NYYA 5FO9B 4KWLA 1VP6A 2TBVA 1H2NA 1MS4A 4RGGA 1ND2C 5DUWA 3QH6A 5C8CC 2GDFA 1PNGA 2IFWA 1HV1A 2JKBA 4H7LA 4C90A 2PYTA 5IUQA 2ZABA 3CU7A 4GKXA 4L8QA 2A75A 1SLCA 1CAVB 1YYNA 5JI9A 1UD1A 2VMGA 3VDDC 1CX4A 3S7EA 1QY4A 1OQEA 1WD3A 2GN7A 3WDXA 2RS32 4Y24A 3NVCA 1QJY1 2DCJA 4QQHA 5I0SA 1NOVA 1XNCA 2D93A 1VBC1 3FUQA 1MZEA 1C1FA 4UXAA 1RUC3 1NY71 4LEJA 1QHDA 2CYFA 5J36A 4QHBA 3E5XA 3OGJA 1IPKA 5KHIA 1QQP1 2CTVA 3R0RA 2ZX1A 2E7TA 4ATFA 3MIBA 4AHZA 4EWAA 4MXWA 1NA1B 2ZZQA 1K5MB 1AL23 3GBFA 3GBGA 5DDJ3 2FZ2A 2X5IB 5GLZA 3S30A 4M3CF 2RM23 4M3CB 2B5HA 2WNVA 4NHKA 4BMEA 3OY8A 2A5ZA 3ZYJB 1UKGA 4QM8A 1D4VB 4IL7A 4LBQB 1ZBE2 1AZDA 1ASJ3 3Q9OA 3ZSMA 2R0FA 2RHPA 3N7MA 2E7AA 1FT9A 1LOBA 4AYUA 3G7DA 2CNAA 2RE9A 2DUOA 2ZX4A 1ZX5A 2I74A 1LECA 3DPRA 4YM0A 3LOBA 3MEPA 1LRHA 3VUOA 1LB2A 1SLLA 2XVLA 3FLTA 3VL8A 3E6DA 1SDWA 1UU5A 2WNVC 3WUDA 3V0AA 2WZPP 2DCZA 2B42B 1HRI3 3GALA 5K9YA 1YI7A 2WS91 4XBLA 4DY3A 3I54A 5JSPA 2YGLA 4YZ5A 4DOUA 5CFDA 4ASLA 2RR11 1O3SA 1V9U3 3MF9A 2NLRA 1OFSA 4RGAA 5GLTA 1QJX3 1R1A2 3ZXDA 4NPRA 2EAAA 4DQAA 1QXPA 1X33A 4BH9A 5DZEA 3RPQA 1PIV2 2A6VA 2HEYF 2OVUA 4I01A 4PIYA 3DPRC 2DTWA 3O7OA 2GC0A 2JG8A 3WCSA 3ENRA 4GH4A 3KS7A 4FCAA 3JBG1 4H3WA 1UAIA 4XTPA 1KFXL 2HWD2 3FZ3A 3DL3A 3LAGA 3QBQA 1W6PB 4JAAA 5BY5A 1ZYBA 4IERA 3H7JA 3B5LB 4TZDA 1D0GA 2ZTNA 5CFDC 1Q8QA 4OUMA 3WDWA 1DHKB 5AFEA 3FUOA 4LBJA 3TBDA 3J8F3 1ONAA 3N35A 4HANA 3O12A 3X29B 2DU1A 5BNNB 4XMAA 4X6RB 1UZYA 3KLSA 3V65A 2JG8C 4GB33 5T55A 3NO8A 4GH4C 3M3EA 1H2MA 2WLPA 4YNIA 4XQ4A 5C9AC 3G6JB 4XILA 4ZU5A 3TN93 2AYHA 3MW4A 4MVTA 4Q0VA 1BEV2 3GZAA 1I5ZA 2HWB2 5A32A 3INAA 1QNWA 4FPJA 3WNXA 1S0GA 3AJYA 2R1BA 4MUVA 5GLUA 2XLAA 4M01A 1Y3TA 2XJPA 1W6MA 3MFAA 1MS3A 1XQNA 2XUMA 3LSEA 4HLTA 2JD4A 4AK3A 1Q8SA 1XU2A 1MVEA 1H4HA 4L99A 5CAZA 1EYBA 4X6QB 1RUC1 1OA4A 1IS5A 2YHJA 4HK8A 1NZCA 1AR83 4LO8A 1ZM1A 4Z07A 4Q8LA 5AVAA 2WJSA 3VBHA 3ZN6A 4QD2A 5AC92 3E6BA 1VBA2 2DF7A 1AUYA 1AL21 4FOVA 3MIEA 5DDJ1 4BYYA 1OSGA 3FLPA 2RM21 1NXD1 4XQWA 4I0WB 4NWWA 5JZGB 1ULEA 3AP5A 4HKOA 1VBE3 4FAHA 1DQ1A 2DVGA 1RTVA 3N7KA 2YXSA 1ASJ1 3ZXJA 2A6ZA 1Z0HA 2DUQA 4URTA 1LEMA 2PHLA 5JOWA 2NPIA 4YVSB 3PHMA 1H1AA 1LOAA 1YLLA 4AHWA 1VJ2A 3J4UH 4M0HA 3RYRA 5J48A 3VBHC 4L9BA 1X7NA 1HW5A 5A3LA 1AXZA 2XKOA 1PGW1 3VBSA 1MS9A 2HWF2 3H1YA 3IBMA 2Z79A 1HRI1 4OHYA 1RGSA 1RUOA 1WA4A 3SLIA 3WHUA 1NCRB 4N9HA 3RZZA 1GZ9A 2PHDA 1V9U1 4JTNA 1QJX1 3NKGA 2NMNA 1MEC2 5GZCA 3AZXA 4TLFA 2HJIA 2AH2A 2DVDA 2ZMLA 1RVF3 2VW2A 1SACA 3ZFGB 4S2DA 5KHKA 2XH6A 4O9EA 1O7FA 3VBSC 3CEWA 4EWEA 1BXHA 4MX3A 3VHNA 3SH3A 4FPFA 4HN0A 4YFZA 3LA3A 2XBO3 4LBNA 4R52A 2ZZJA 4Q27A 4B4QA 4OUSA 3SCHA 3WY6A 4NWVA 4Q4X3 3AKTA 1A8MA 1KXGA 4QPIA 1URXA 1N3OA 2XJRA 1KD7A 1W0PA 4N7IA 1DGWA 5IK8A 1W6NA 2ET1A 4WM8B 3E5QA 1OQ1A 5T5JA 3RI9A 4CDWB 1WMEA 4L2NA 3V0BB 2AREA 2VW1A 1BBT2 1RUE2 1DIWA 3TN91 5H9SA 1DZRA 2OZ6A 4LUMA 2OIIA 1C4RA 4LHKA 1O5UA 1HQLA 1ULGA 3GHNA 1ZZBA 3NAPB 1YFXA 4LA3A 4CDQA 4I3GA 2YUEA 2G9GA 4IEPA 3KT1A 1KDKA 1Z7S3 4YZ4A 4QPIC 1YFWA 4PF5A 3VZLA 1C28A 3MW2A 3POWA 3H1WA 2Z42A 5DUUA 1PO13 1VB4A 1S0JA 3VBOB 2WWSA 4XFBA 4WVMA 5GZFA 3VBRB 4C0HA 4BMBA 1V6LA 4K8FA 3T1MA 2XLGA 4K21A 4XBQA 3POSA 1CAVA 4CDQC 1AR81 3NV1A 1J58A 2XJVA 3QH7A 4P9JA 3AMHA 1UIKA 4MV2A 2GAUA 2H6CA 1AX0A 4FTBA 5I0RA 4XJUA 2WA3A 3WR0A 4JDNA 1ZBA3 5T5OA 2WZR2 1QXJA 1FMD2 3VN4A 3PTYA 5IK7A 2QZ2A 1WUVA 1N1TA 4KNCA 1MQTA 1VBE1 2Y0OA 3O0VA 5AVPA 5JLVA 1NA1A 1K5MA 3MPPG 1TMF2 4UW5A 1EAH3 1QJU2 2I07B 2X5IA 5TSWA 1NG0A 2A6YA 4M3CA 3KZ4C 2ENRA 5ACA3 1W6QB 1BMV1 5JOYA 2HWE3 3WCRA 1RL3A 2ZHKA 4XTMA 3R4SA 1DGRN 2JEMA 4XF9A 1H2LA 2EXJA 3BTAA 4W65A 2XVKA 2GC2A 5BPXA 3E5UA 1RUD3 3M3CA 2PLV3 3EHKA 4CRQA 1MQTC 4HVQA 1HLCA 1CAUB 1RC6A 4XFHA 2R16A 3K51A 2WNUB 1NA1C 3MZHA 1AF9A 1K5MC 3H9AA 3OBTA 2P3IA 2X5IC 1XE7A 2Y0IA 4LULA 2E53A 4FPHA 1ENRA 3ASIA 5BV6A 2WNEA 1N1VA 1LGNA 2DVBA 3K48A 1W0OA 1O4ZA 3THPA 1RVF1 3KCXA 3QLQA 3WQ7A 2GNDA 3H1MA 2CY6A 3IDCB 1X82A 5DUXA 1CD3G 1ULFA 2IXJA 2XBO1 5BNOB 3D6EA 2VG9A 4Y26A 4FXKB 2RS33 2P17A 4A7ZA 4Q4X1 4JVAA 3LZZA 4MYEA 5BNPB 4OHXA 4Q8KA 4BIOA 1LGBA 1LEDA 1W6PA 1FNYA 1QXRA 2ILMA 4XYXA 4R9AA 1HDKA 2BNNA 3WOGA 2TEPA 4NVPA 3VHOA 1OKQA 4DPNA 2RS52 2H6BA 1FATA 1LKNA 4QQLA 5JSRA 5F6KA 4ASMB 5DZGA 1F5FA 5SV5A 4EV0A 5BNNA 4F8AA 4N9IA 3ZYGA 1CPNA 3IPVA 1LOGA 4RA0A 4XBNA 4BCUA 1KFUL 1Z7S1 4XF3A 1PZ8A 4FVVA 2GNBA 3D8CA 4R4ZA 3ZXAC 2UYBA 1VBD2 1VBC3 3UKTA 4MGYE 5JCTA 4E9KA 1G6NA 4YSFA 1PO11 2F6BA 1PVC2 4FSJA 4W6XA 3P3PA 1TQ5A 2ZS6B 5I93A 4K20A 5GKAC 2WL1A 5CFCA 4WVWA 2GH8A 5BNNC 1I9RA 3ZYIB 2R30A 3D4KA 4B7KA 2XJQA 4R8HA 1IKPA 1H8VA 4XMIA 4W6YA 2CGOA 3WG1A 5GZEA 4I2OA 2R062 2P37A 4B4RA 1V6KA 1YIFA 3LA7A 2IC1A 5A33B 1ZBA1 1R1A3 4HBNA 1LJ7A 1JXNA 3AXDA 3N3HA 1VR3A 4QGNA 1PIV3 3WG4A 3FE5A 1COV2 1GLHA 1LHVA 2VXRA 2XVGA 4PIZA 5CFCC 1RUI2 1HRV2 4E4DX 1EAH1 1O91A 2VQ0A 3J26N 3NV2A 2OPKA 5JZGA 3SXWA 5ACA1 1H2KA 1JUHA 1SMVA 2HWE1 2R49A 5L36A 1NCQB 3FFZA 3W58A 4AQSA 1C5IA 2Z5WA 4M00A 5KHHA 4ZU7A 1TNFA 4IEQA 2R072 3J9SA 1CAWB 2RR13 1RUD1 2XWBB 1F5JA 2PLV1 3FHIB 4YVSA 2YC0A 3TOJA 4LTAA 3HIFA 2BWCA 1RUF2 3WW4A 1BVVA 2O1QA 3N36A 5FQ0B 3ES1A 1AYM2 4BOWA 1RB8G 5CNAA 1QKQA 2IXKA 2E63A 1TME2 2GNMA 1KS5A 3DN7A 5CG8A 2ZHNA 1VRH2 3M3QA 1NCRA 1ENSA 4K1YA 5J7MA 4BPZA 4QXKA 5F5QA 1DG6A 4KWJA 2BFUL 4YVSC 4CDXA 5FTTC 3PMSA 2XL9A 1NLRA 2PHFA 4CYDA 3N7JA 2JDZA 1V00A 3ZFGA 3FBMA 4LO6B 2RS31 1IPJA 1W39A 3HAGA 2QJVA 3TWIA 3WUCA 2HEVF 2ZGKA 3FLRA 4TYSA 1G9AA 3B3QE 4LLOA 2NMOA 2DVAA 3C2UA 1DLLA 1NCRC 1O5LA 5BUVA 3RSJA 5JOXA 4NN0A 1PO23 1CN1A 4Y22B 3WP5A 3TNQA 3WZ1A 1D0HA 1EV13 2MEV2 2JENA 1NQDA 5GJ6A 3B02A 4I30A 3VGIA 3WDVA 4CDXC 5AC93 1VBA3 4DXZA 1AX1A 1FNZA 2DFCA 5J09A 3OBRA 3VKFC 2ARXA 1VAKA 3JQXA 2ZX2A 3LB9A 4YM1A 2W0XA 4FTEA 3OD0A 3ZFGC 3ZX7A 2G9FA 3ELNA 4XFAA 4OHZA 3VZMA 1QNYA 1D4M2 4WM8A 4JQRA 2D97A 1KS4A 1RHI2 3B00A 2ZAAA 3DKWA 4OFGA 1YIPA 2EXKA 4CDWA 4EN0A 3V0BA 4J6GA 5EWSA 4EROA 1DGRA 1J3QA 4B4PA 1A78A 1CIWA 3NAPA 4DFSA 5C4WB 3E97A 2XLFA 5E16A 1MVQA 2BW8A 3AJZA 4PLMA 5JIAA 3AM2A 4RL7A 2ZGOA 1CVNA 1SBDA 4Y1XA 5F6LB 2LM3A 2HWF3 1DQ2A 4WM8C 3R4UA 2VMIA 4OZXA 4QM9A 3VBOA 4TSVA 4CDWC 4RHV2 1NE6A 4UBGA 1J1LA 3ZPYA 3LA2A 3NKTA 2WQ4A 3VBRA 2OZJA 1R1A1 1MEC3 5JR7B 3NAPC 4OULA 1AXYA 1PIV1 3PNAA 4AVTA 1Q3EA 4NHMA 4P9WA 2XKPA 4KU7A 2Q8OA 4YG3A 2PHUA 4AE2A 3GHMA 2HKXA 5EXOA 3RRDA 4COYA 2ATFA 3VV1A 1HX6A 1RUH2 3ZFEB 3R4DB 3FFQA 4EN8B 3MLKA 1RUNA 4UW4A 3ES4A 4JGZA 4A7KA 3LKJA 2WFF3 2PA7A 1CJPA 1U5IA 2R042 1JYCA 3VBOC 4P5HA 1AR93 1YI9A 3VBRC 1MS1A 1MS0A 2XG3A 1R092 1KITA 5JPMB 5EZWA 2OUJA 2DYCA 2ZA9A 1NY72 1CQ9A 2VECA 1S0IA 1J3PA 1W6QA 1QQP2 3OYWB 1PGL1 1OHFA 4JGYB 3ZN4A 3AP6A 4QQOA 2LALA 2Z69A 3SNMA 4OI1A 5BYNA 2ZHLA 4JGZC 1ENQA 2EF6A 1XNDA 5FLHA 1RUE3 1CAUA 2AENA 1HIXA 2BFUS 2D6LX 3I2DA 2WNUA 3FMGA 4KG0A 4Q4V3 1PM7A 4FBFA 4XHXA 1T6GC 1Z78A 2B46X 3ILRA 4XJ8A 2XB6C 5I8TA 4LBMA 4Q4W3 1F2NA 4N53B 4DZGA 4Y4YA 4HZFA 2XPJA 2JICA 3VL9A 4MLOA 3ATGA 3RJ2X 2ZGLA 4LE4A 1WCDJ 1G9DA 4D94A 3AFGA 1V6NA 2WSUA 4XQDA 4KU8A 1GSLA 2HWC3 5GLVA 1X8EA 5FMOL 4PBOA 5JAXA 2WNUC 3QACA 5BNOA 1PO21 4FO9A 4ES8A 2QCSB 1EV11 4QT6A 1RJ7A 1S2KA 5AC91 1VAMA 1VBA1 3NW4A 5BNPA 2BGCA 5FOBB 3KGLA 2VUAA 1QGLA 1JW6A 4AGGA 4YW3A 1FOD2 3M4FA 1LESA 5CVRA 1WGPA 3V64A 1R083 1ZRFA 4CEWA 4PDWB 3O0WA 3O5SA 3WV6A 1DZQA 3ZFFB 1AYN2 1OMIA 5BNOC 1N3PA 1QJU3 2A71A 3HD8B 1UPSA 4S2FA 3ZXKA 2EAKA 3AYAA 4PQ9A 3AMMA 4DS0A 5BNPC 2UY8A 5HCAA 1OOPB 2AZ5A 1I6XA 3MDPA 3MFCA 4XW3A 2E51A 4DNYA 3TB0A 2A6XA 2HWF1 4HKLA 2ZGSA 4EJRA 1GQHA 4D69A 4Z92B 1GICA 2ZGTA 4AVBA 5ABJA 5FPZA 3LSDA 4CEWC 1IHMA 3MLJA 3T1LA 4CEYB 1DGLA 1O4YA 1V6MA 2YMZA 2ZHMA 1W2UA 3LCPA 1J3RA 1MEC1 4GMP0 3S0MA 3NSTA 1N47A 2WLQA 3VKLA 4AGRA 4GALA 1NYWA 3B7MA 3EO6A 3LWCA 1BKZA 1H8TB 1DDLA 3JB8A 5K8SA 5D1IA 4IEWA 2FBEA 1ZVFA 1X36A 4HKWA 2D7FA 2WFF1 5I8SA 5ABJC 1HKDA 3M1HA 4Q4Y2 3B69A 1A6CA 3KSCA 2D98A 3M7AA 5KC5A 4PJYA 3RYPA 4COUA 1AR91 4AEJA 2A3WA 5KXCA 3U11A 5HCBA 3GYDA 4CP0A 2XL7A 3PVBB 1H30A 1RUC2 1C3HA 1L3JA 2WC2A 1UU6A 1REEA 1NCQA 1V6IA 1Q43A 3AZYA 4Q0UA 2GMMA 2A7AA 1FPN2 1UL9A 2QDNA 1JOJA 4AFBA 1RMU2 1LOCA 1UW8A 4N7UA 4EN7B 1VB2A 2RM22 3BOPA 3ZSJA 1UCXA 1RUE1 4W6WA 2WA4A 4LE3A 4YW2A 3SHRA 3AZVA 3VBUB 2PHWA 4KH9A 1FXZA 4BQ1A 3MIFA 2SBAA 5FQ0A 1F8VA 4Q4V1 1ND2B 1QU0A 2OYZA 3B93A 1UU4A 2K0GA 3WG3A 5DG2A 2LTNA 5C8CB 3O0XA 1LTEA 1MR5A 4XJZA 4ITCA 3ETQA 3M3OA 4TWTA 1H9WA 4Q4W1 1NCQC 2BNOA 1QH6A 2BUKA 2CWSA 2WT2A 1SLBA 1ND3B 2QVSB 3CL1A 3H50A 3MW3A 1D2SA 5FMOS 1DQ0A 1CAXB 1QOSA 5JPNB 4XJAA 2HWC1 3JZVA 3B94A 1HRI2 3FX3A 3ZN5A 4ISRA 5JMCA 4Y20B 4YW1A 4P9YA 3KB5A 1BZWA 1POV0 3JD73 4H7MA 3S6PA 4COWA 1V6OA 2PFWA 2QNKA 1AJKA 4HSLA 1QJX2 5FOJB 3AZWA 4Y1UA 4KBBA 4AEMA 5LRRA 3ZXGA 2RS13 1IS6A 4AEDB 4L11A 2PAKA 2HEWF 1I1EA 2UWBA 4MGZE 4RFT0 4Y22A 1C5HA 2YY1A 1GZWB 1COV3 1R081 4XFIA 5KXEA 1DF0A 3WQ1A 1IS4A 4XEZA 1HRV3 1C8M2 3I8TA 3WLUA 1QJU1 4JRLA 2O0OA 4IEVA 3VZKA 1BVP1 1HXS3 1CR7A 4FPCA 4K3UA 4QPGB 3AMNA 3KQRA 4KGQA 2JX9A 3J8F2 2VOVA 2PAMA 2DCTA 4AFCA 1OLQA 3EXUA 3AYEA 4B3NA 3W9AA 2B45X 3RMYA 2CWMA 4GB32 5C4WA 3OY8B 3THTA 1G8WA 3H8UA 4SBVA 4C91A 1OQDA 4G9SB 5LK7B 3WW2A 4ZXKA 1B35B 4HPKB 1AYM3 2A3XA 5DXDA 1G9FA 4G3YC 3M2MA 1FX5A 4CDUB 3U0ZA 2D40A 1AR62 4XZPA