5T3NA

Sp-2cl-camps bound to pkar cbd2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
HHEVLFQGPGAKKRKMYEDILSHVNILKDMDPYERCKVADCLKSKSYNDGEIIIKEGEEGDTFFILIDGNAVASKDNKVIKTYTKGDYFGELALLKNKPRAATIKAQNFCQVVYLDRKSFKRLLGPIEDILHRNVENYKKVLNELGLDTTCID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cAMP-dependent protein kinase regulatory subunit
publication title Disrupting the Allosteric Interaction between the Plasmodium falciparum cAMP-dependent Kinase and Its Regulatory Subunit.
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
molecule tags Transferase
total genus 41
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2016-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t3nA00
5BXXA 4FT8A 2GC2A 2WFPA 2XLGA 2IXLA 4P9GA 4META 4XF4A 4XF9A 4X6RB 2QNKA 1UIKA 1EY2A 1XRUA 4PIZA 4MH0E 1RGSA 3E5UA 5I0SA 1ZREA 4IETA 3BB6A 3ELNA 3KGZA 2PAEA 4PIXA 5KHIA 4LEJA 5FPZA 3WW4A 2N7GA 3G7DA 2E9QA 3CF6E 2CAVA 4ZU4A 3RYRA 3MDPA 4XEZA 1V70A 3B02A 4LA2A 5JSOA 2XKOA 1J3RA 3LAGA 3VHRA 1JUHA 2Q0AA 2Q4SA 4AXOA 4AVBA 2XLFA 3U0ZA 3E5QA 3DN7A 4N9IA 3KGLA 4XF0A 5FQ0B 4EROA 3EHKA 4JTNA 4QGNA 4PJYA 4UXAA 3USSA 1XE7A 2GC3A 5FDBA 5FQ0A 1Q43A 2H0VA 4YRDA 3ST7A 3L2HA 2BNNA 4UBGA 2ET1A 1YFXA 1YWKA 4IEPA 5KHGA 4HLTA 5JR7B 2XL7A 4IEXA 4IEYA 1FI2A 1OFNA 4EV0A 3EQEA 4IEOA 5I0TA 3UKNA 3MPBA 4Z82A 4GULA 3HQXA 2D5FA 4FAGA 3C3VA 3NKTA 2QCSB 2XLAA 1RC6A 4MGZE 4XFHA 4DINB 1EPZA 3ACLA 2XKPA 4IERA 4N9HA 3E6CC 1XE8A 2XHKA 3DL3A 4XETA 1ZRRA 5J7MA 2CV6A 1EP0A 3IIAA 5JSRA 4CYDA 1ZRCA 1CX4A 4HVQA 2Z69A 1J59A 1FXZA 4MGKE 4X6QB 2GZWA 2UYBA 3ETQA 2PHLA 2EA7A 3NVCA 5J48A 1O3SA 1I5ZA 2GAUA 5KHJA 3OTFA 3E97A 2PYTA 3H3UA 1WGPA 1O3RA 1X8EA 3CEWA 2EAAA 1J3QA 3SXWA 4IEZA 3I59B 3I54A 4KL1A 2V09A 4KWJA 5JCTA 4FBFA 4QGLA 5CADA 3ES1A 4YNIA 4BHPA 4D7SA 4I01A 4WBBA 4HSLA 1L3JA 1ZZCA 4E2QA 3RNSA 4OLLA 2EVXA 4WZCA 5EFUA 3H1YA 1J1LA 1YLLA 2PFWA 4I09A 3PVBB 4QX5A 5I93A 1G6NA 3N4MA 2OYZA 3LA2A 1ZRDA 3ES4A 1NZCA 3FWEA 3I7DA 4Q0PA 1HW5A 1Q5OA 5K8SA 4QMAA 4MX3A 1LRHA 2IXHA 2BEOA 1Q3EA 3OF1A 4JVAA 3GYDA 3WW3A 5JAXA 1X7NA 2IXKA 4KWKA 1SQ4A 5KHHA 3RYKA 3FZ3A 1ZZ7A 3H50A 3OGJA 3FJSA 3LA3A 4ONUA 2GC0A 4XF3A 3R6SA 2ET7A 1NYWA 2BNMA 1DZRA 1VJ2A 4QGMA 2VECA 4XFCA 2ATFA 4MZUA 3IDCB 4A2UA 1CAVB 5C6CA 1OD5A 2IXIA 2H6CA 1CAVA 4Q0VA 5KBFA 5FLIA 2PA7A 3H1WA 4HMZA 4JTOA 4HN0A 2PQQA 4TLFA 3S7EA 3SCGA 4YARA 2GU9A 4I0BA 2QVSB 1O4TA 2OPKA 4IEWA 3E6DA 3LA7A 2FQPA 3DV8A 3UKTA 2O8QA 4AQ2A 2Q1ZB 4D7TA 5T3NA 2UY9A 2PHDA 4I02A 1LKNA 1LR5A 2K0GA 3HT1A 2HKXA 2HJIA 1UW8A 1ZZ9A 3H7JA 1FT9A 4HVOA 1CAUB 1SEFA 1SFNA 2UY8A 4K8FA 3H7YA 4EWEA 4FAHA 5BY5A 3MYXA 1CAUA 4JV4A 3SMHA 4LA3A 1H1IA 3DKWA 1Y3TA 4LUMA 1RUNA 3D0JA 1WLTA 1RL3A 3E6BA 1UD1A 4IEQA 4ORFA 2PAMA 4YYOA 3OD0A 3RZZA 3CLPA 5FLJA 1QXRA 5LRSA 1O7FA 2KXLA 4IEUA 2PTMA 5LEJA 2BYVE 2Y0OA 2F4PA 2K9ZA 5F1RA 3HT2A 4J1XA 3I59A 3U10A 2GC1A 1CAWB 2XL9A 1H1MA 2IXCA 2VQAA 4UBHA 3S0MA 1CAWA 1VR3A 1YFUA 5EZWA 4KU7A 1ZZ6A 1GQHA 3D0SA 2PAKA 2GH2A 2QDRA 3JZVA 1IPKA 4AVCA 4BIFA 4J1WA 4XFIA 3WW1A 2D5HA 3KMHA 4LUKA 3EBRA 2DCTA 2MNGA 5I0RA 3BU7A 3FE5A 4H7LA 4IESA 2B5HA 5E16A 5BPXA 4AQ6A 1DGWA 3CJXA 3PLQA 2CGPA 2B8MA 5I91A 3SHRA 4XFFA 1J3PA 1ZNPA 4MUVA 3RDIA 4XFBA 4QM9A 1NE6A 1O5LA 4ZU5A 1U12A 4MGIE 4EWDA 2QJVA 4Q0QA 2IC1A 3M3IA 1OMIA 1YFYA 2IXJA 4E2GA 3FHIB 4QXKA 2D40A 1QY4A 3MZHA 1DGRA 4F8AA 1DZTA 1RTVA 2UYAA 5JSPA 1LB2A 1X8MA 2Z2SB 4L11A 3NJZA 4YSFA 2BGCA 1PM7A 3QOPA 1CGPA 3U11A 3IBMA 4I3PA 4MGYE 1VP6A 2OZ6A 4KWLA 3ROUA 2CAUA 5CU1A 1UIJA 4LLOA 2B9UA 4MV2A 2I45A 3SCHA 3CO2A 2ZCWA 1J58A 3FX3A 4Z07A 3WW2A 2ZKLA 3LOIA 5BUVA 4O9GA 4ZU7A 4HN1A 2P17A 4QM8A 4WVZA 3KSCA 2OA2A 3KCCA 5LEKA 2MPFA 4E2SA 1CAXB 1EYBA 5KHKA 1YHFA 3HIFA 1UPIA 1ZX5A 4BH9A 4RD7A 1NXMA 3EJKA 1I6XA 1CAXA 3NL1A 3E5XA 3PNAA 3QACA 5I8YA 2OZJA 2ETEA 4Q29A 3ZDSA 4PIYA 4IEVA 4R8HA 3NW4A 1PMIA 3IDBB 5E1RA 1TQ5A 3LWCA 4KU8A 4Q0SA 1ZZBA 1ZZ8A 1NE4A 1QXJA 1O3QA 4NVPA 3D82A 1QWRA 2VPVA 1ZVFA 1O5UA 4XFAA 5FLHA 2Q30A 3UKVA 3H9AA 3LZZA 3O14A 3EO6A 5HI0A 1UCXA 3RYPA 1O3TA 1RUOA 4I2OA 2H6BA 5CVRA 5BV6A 1YFWA 2BNOA 1ZRFA 4BYYA 4O9EA 4I0AA 4AVAA 1WA4A 2C0ZA 4LTAA 3BPZA 3H1MA 3SCFA 2WC2A 1IPJA 4OFGA 4Q0UA 1OI6A 3GBFA 1GQGA 2D93A 3S7IA 4LULA 3H3ZA 3TNQA 5AVPA 5I0UA 1X82A 4HBNA 5C8WA 4HVRA 4XF1A 4EWAA 4R52A 3M70A 3H8UA 4B29A 3FFQA 3TNPB 4HSJA 4HZFA 5I8TA 2O1QA 3IWZA 3CL1A 3BALA 5LRRA 2FMYA 3OCPA 4XFGA 5FCCA 5FPXA 5J3UA 5I8SA 2XGXA 3RPQA 4F7ZA 4L2NA 3BCWA 3NSTA 1Y9QA 5D1IA 2MHFA 1YUDA
chains in the Genus database with same CATH superfamily
2HWD3 2KM2A 4HOOA 5IHRA 1RUD2 4P9GA 1AR91 1YQCA 3OBTA 3AFKA 4META 2IWGB 4XF4A 4XF9A 1RUG3 4LK6A 4PI2A 4KI5M 4IUGA 3A0KA 3I2KA 2JIJA 1UIKA 3KT7A 4V2VA 3ZFEC 1CWPA 4RS5B 1JZ3A 4YVSC 1PIV2 5JXGA 3HAGA 1K5MB 5F5QA 2JDPA 3E5UA 5C8CB 2Y6GA 1ZREA 5FZ0A 1HKDA 3LPGA 4PIXA 1KRIA 5JPMB 1DCSA 4RR3B 5GALA 5FUIA 3R4DB 3UL2A 2N7GA 4EZ4A 1MPXA 1AR72 4XCAA 5D2AA 1LOAA 2JE9A 3CF6E 2JENA 1PNFA 2A6XA 3LQCA 5JSOA 1QJZA 1J3RA 3LAGA 3NNLA 5C7GA 1W6OA 2X5IB 3SC7X 4ZHNA 1W28A 1JU3A 3MIEA 2XLFA 4AHXA 2OT7A 1VB4A 4A3XA 3HEIA 4RHV2 2JDMA 3D6EA 1Q56A 2W68A 3MIBA 2ARXA 1QOOA 1DZQA 2Y6HA 3VBSA 5JXHA 3UGGA 1S0BA 4IW3A 4CCLA 2AGSA 4LBQD 4QGNA 4PJYA 3UGHA 3USSA 1XE7A 2GC3A 2Y6JA 5FQ0A 1NCRB 1E5RA 4A41A 4B4RA 1AR82 3FLRA 1V6LA 3V64A 2CYFA 5FXXA 2WZR1 2ET1A 2MEV1 3T09A 1WBFA 1FMD2 4Q4W3 5AVAA 4Y33A 1C8M2 3U75A 3AKPA 4P5YA 5G05L 2YBKA 4NHLA 4K9SA 1SLBA 3PU8A 3MPBA 1W3XA 3J7LA 3UJQA 2K2SA 4Q4Y1 4LNVA 3BTAA 2I74A 3WD5A 2D5FA 3C3VA 2LUWA 1BZWA 1ULCA 3O0VA 2WO2A 3O7OA 3KVAA 4A7ZA 3D4KA 2XLAA 1RC6A 3VBSC 4MGZE 2IZWA 5IVJA 3WNXA 4GALA 2JKXA 2VOKA 2B4KA 3ACLA 4IERA 2LROA 3POBA 3VZNA 4N9HA 1NA1A 3IPVB 4RL7A 4W6XA 3G6JB 1O59A 1SACA 4UAPA 4XETA 5CB7A 5T5LA 4QAWA 2FMDA 1DQ5A 1ULOA 2G19A 2WNVA 1D4M2 2YY1A 1CQ9A 2XUEA 3WNOA 4CYDA 4RSUA 3BTYA 5EJ1B 1CX4A 1J59A 4DXZA 5A7WB 3CJIA 1JUIA 3LF7A 2UYBA 3JD71 3EXUA 3PURA 4FQZA 1HJFA 3DEMA 1RUH2 3NVCA 4KH9A 4INDA 1RUI3 4Q1RA 3WV6A 4QPIB 1I5ZA 5KHJA 1U5XA 4CCNA 1MQTB 3ACHA 4ATEA 2PYTA 4JKKA 1W06A 1FPN3 1WGPA 2QQMA 4BDVB 5FP4A 4DY3A 3AX4A 4Y3OA 3SQOA 1NA1C 2GNBA 5IK7A 4DPNA 4CCEA 2RDNA 3SXWA 2QKDA 4GA9A 1LESA 4XJZA 2LRPA 2WNVC 1OF3A 3URFA 5JCTA 2WNUA 4FBFA 1OQEA 5C9AA 2D7FA 3P5BA 2VTXJ 3OGVA 4UW4A 4H7MA 4YZ1A 4YNIA 1PO22 1OLMA 4I01A 4QHZA 3NNJA 3RJ2X 5EWSA 5FPVA 4DOUA 4CEWC 1OFSA 3NNFA 2WN2A 3I3EA 1BEV3 3NV1A 1GZWB 4XIKA 5IATA 1WLDA 4K8RB 4I0WB 4Y20A 4FPEA 2UWCA 4OLLA 4F3JA 5JMOA 3K4AA 4FQ4A 4FO9A 1VBA2 3VBOA 4JDMA 5T52A 3ZN5A 2PFWA 1TE1B 5K7PA 1W9TA 3LEKA 4FPHA 2ZEYA 5A80A 2OYZA 3ZXJA 2P6HA 1DYOA 3ENRA 2A75A 4PHZA 1EPWA 2W5FA 4FXGB 1ZRDA 1W9WA 3MHZA 4PDWB 3I7DA 4FPJA 2PHTA 2WNUC 3I3QA 1Q5OA 3B00A 4Z2AA 5C9AC 5HPOA 3JCIA 2VBBA 5JPNB 4IGOA 2WRAA 1H30A 1LRHA 5A32A 4NRPA 1HN1A 3IN9A 2VOWA 4FPLA 3TEYA 2P37A 2VD7A 2YDEA 3FUOA 2RM21 4MLOA 1UQXA 1RUE3 4PLMA 1RUC1 4CUAA 5GLWA 3VBOC 5JAXA 1UX6A 2IXKA 2ZMLA 1ASJ1 5DUUA 3O1UA 3AXDA 2W95A 2XVLA 2D6PA 4FCAA 5JIUA 1AZDA 3M3CA 1W8NA 1OH3A 4JRLA 1MS9A 2W1WA 3A7QA 2GC0A 4XF3A 4OHYA 3USUA 1SCSA 5G04L 1NYWA 3U78A 2GH8A 1FV2A 2PLV2 1DZRA 2VUCA 2WT2A 1XNDA 1HXS3 2K46A 5FMOS 3RI8A 5IW0A 3UJOA 4BISA 1PX3A 3IDCB 1G8WA 2HEYF 1I9RA 1W90A 2CY6A 1NLRA 1ACCA 2Y6LA 1KXGA 1N1YA 2O0OA 1NCQB 1OD5A 1OKQA 5IJRA 2WABA 4FI9A 2H6CA 1VBD1 4XUTA 4HETA 2BPA2 5FR3A 1LTEA 4I30A 2VNVA 5F6LB 1G7YA 2Y0IA 3FL7A 1N1SA 2PA7A 2R073 3H1WA 4HMZA 1IQAA 3SCGA 4AEKA 4DO0A 2GU9A 4I0BA 3NJVA 2D6LX 3UESA 3S57A 2YBPA 3LA7A 1HRV2 1C28A 3BIEA 2PHXA 4XOGA 4ARYA 5JZGB 3UKTA 4YPJA 4MO3M 1HQWA 2QUOA 3UK9A 2O8QA 4FOVA 4AQ2A 1CESA 3HD8B 3I3BA 2WS91 3GM8A 3Q8CA 2WYFA 4OI0A 3VDDA 1IS6A 2E26A 5FZ6A 3T30A 1UYZA 4FOWA 2X29A 1EAH3 1VMJA 3M7AA 4I02A 3VKLA 2VNGA 2ARBA 5C33A 2ZGTA 4C0BA 1E5IA 2KD7A 2BW8A 3RQ0A 5C5UA 1SBDA 3RWKX 1ZZ9A 3AP5A 4BLIA 2EXJA 3C7EA 1QJY2 1PGL2 4MOAA 4A4AA 1H9WA 4PQ9A 2UY8A 2GNMA 4K8FA 4RN5A 3HPNA 3UNPA 1W6QA 4JV4A 1VBC1 4MG2A 3QH6A 4NIDA 1GP4A 5ANNA 3TN91 1IPSA 4XQWA 1GSLA 1G86A 3K3OA 1QIQA 1XYOA 3DKWA 4PLOA 4DNYA 5DG1A 1UN1A 3SITA 3T2TA 3UV9A 1W8TA 5FY0A 2VGDA 5FYVA 1A8MA 4FP3A 1IKQA 4IEQA 4BMEA 4CU7A 2D6KA 4IV3B 4LXLA 2VL4A 3ASIA 4Y1YA 2J1VA 2R7EB 4DB5A 1PMJX 1UOGA 2D3RA 4O65A 2RS33 4NIIA 1QXRA 5F9TA 3WP4A 3V56A 2HWC2 4XPVA 1AR63 4GB32 2KXLA 4LHNA 3ITQA 4ZY9A 2JG8A 2E51A 1QJU1 4H14A 5A3TA 2PTMA 5LEJA 2BYVE 4LKDA 1JI6A 1W2AX 2K9ZA 5IK4A 2VUDA 4Y24A 5F1RA 2EF6A 4NWVA 1U0AA 4DQAA 2BV4A 2RE9A 3P6BA 3WOGA 3POIA 3RZMA 4R9CA 5JI9A 1EUTA 1KFUL 1B35B 1HB2A 1H1MA 2IXCA 1WD3A 2VQAA 2VZRA 2XL9A 3AL5A 3VN4A 3ZPOA 1D7PM 2JKBA 3DPRB 1ST8A 1YFUA 3ZKUA 1F4AA 5SV8A 2ZX2A 1PO23 3N36A 1GQHA 2A70A 3KLSA 2GH2A 1GOGA 4YVWA 4YGEA 4COWA 4OUEA 4XXAA 5FWEA 1IPKA 1D2SA 1Z7S2 5FY5A 3ZFEB 4AVCA 3AJYA 4XAAA 5FOBB 1RUG1 2JG8C 4FP2A 5FZ3A 1GNYA 2D5HA 4XABA 3THDA 5J96B 2HBUA 2MNGA 3M2MA 3VD4A 5I0RA 1UKGA 5BPXA 5LBCA 4AQ6A 3ZYJB 3CJXA 1G9BA 3VD9A 5FXVA 3BOPA 3AZVA 3P1IA 5BNQA 2VAUA 2VMEA 1YXWA 5E8AA 1WW7A 1TME3 2B8MA 1OQ1A 3VBHC 3DYMA 1VRH1 3WP3A 3SHRA 2YFUA 3ZDVA 3T3YA 3KM5A 4YVWC 1TVGA 1ULGA 3J8F1 1W6NA 4FPCA 3ZOIA 3TBDA 4LIVA 1AYM2 5FP3A 1JYXA 3KS7A 2QZ3A 5GJ6A 1NE6A 2UU8A 1HV1A 2J1UA 4UI9L 5E6HA 4M4RA 4AHWA 1AR93 2LTNA 4OZOA 4UFMA 3ZLIA 3THCA 3HOBA 4XTPA 3VKFC 3NRUA 4BXFA 5JOWA 2ZGUA 5KXDA 5FZOA 3ZFFA 2IXJA 2QDNA 4JGZB 4R9BA 1UZYA 1F4HA 1H1AA 2OUHA 2DVBA 3B94A 2BFUS 3BUCA 2D40A 5GLVA 4C0HA 2F4LA 4CP9A 3AMMA 4FPOB 4CUBA 3IIIA 3JQXA 3MUZ1 3V0BA 3T0DA 3IM0A 1JYNA 5F2SA 3IDEA 1REFA 4OHXA 5A70A 2PQSA 4JHTA 5JSPA 2Z2SB 2BQPA 4XUPA 4AZZA 5CFDA 3NJZA 1PNGA 1W8HA 2WIIB 5IAVA 3VBSB 1NQJA 3ZFGA 2VTFA 3POGA 4HPKB 2JXAA 1RXFA 4UF0A 1F5JA 1AX0A 4SBVA 3ZFFC 3HQUA 4I3PA 1VP6A 4CCKA 4AFAA 3VL8A 2CAUA 1S2EA 1VAVA 4MV2A 4EQVA 3IMMA 3SCHA 5JIAA 2WZR3 2MEV3 1PVC1 3R05A 4RGAA 2ZHKA 4C91A 4Z07A 5A7QA 1WLCA 3WW2A 3ZX7A 3OSDA 3I4IA 2DV9A 2E31A 2XJTA 4NHXA 3K48A 1AYN2 2XUMA 4ZU7A 2BZDA 4HN1A 3KSCA 2R30A 5CFDC 2MPFA 4EN0A 1CAXB 1EYBA 1J83A 2VZQA 1AXKA 1G9FA 3AM2A 3ZFGC 1VBE2 3HIFA 5KHKA 4XAEA 3JBG2 4BH9A 3I3MA 1DQ1A 1LHOA 2VCBA 1IGOA 2JDNA 4QKDA 3KV9A 1SPPA 3HJRA 1F35A 2ETEA 4NIHA 4Q29A 1W6PB 5T50A 3NW4A 2VUJA 2FDFA 3ACIA 1JTZX 2WNVB 3LWCA 4DXSA 2ZMNA 2B46X 1REDA 1S2BA 2A6WA 5FZKA 4FTBA 3PUQA 5GLZA 1POV3 5H9RA 2VPVA 1ENRA 2R041 1HN0A 1PGW2 2YU1A 2WO3A 3KD4A 1O5UA 3CJIB 2Q30A 5LZ6A 3UKVA 1ZBA2 4LT5A 3IAPA 3PVNA 4Y1ZA 2XJPA 2A5ZA 3EO6A 2VULA 4RA0A 3PVOA 2XBO2 1VBB1 4FFGA 2AC1A 4LO6B 5CVRA 3HR9A 2DU0A 3N9OA 2JDYA 3BPSA 4Y5Z0 4XJ9A 3AB0A 3PDQA 2EIEA 3UYJA 4QD2A 2VTXA 1PZ7A 3MFAA 5IVCA 5DDJ3 3MW3A 5BNOA 4LTAA 5FMCA 3BPZA 1R081 3H1MA 1HB4A 3O1VA 4Q0UA 1N1VA 4OFGA 1IG3A 2HH9A 1OI6A 1W2UA 2HWE2 3BKZA 1MEC2 3RGBA 2D93A 5SV5A 1GICA 1XOYA 3POSA 5CKQA 4LULA 2D6OX 2X8KA 4W6WA 3H8RA 1XNCA 1MZFA 1FNYA 2FHRA 5AVPA 5HCBA 4B1MA 1UOFA 4NPLA 3I97A 3O1PA 2XPJA 1IKPA 2ES3A 2NPIA 1JHJA 2DVAA 4HL0A 3I2IA 4XF1A 3MUY1 4FFIA 1GQPA 1RUD1 2EXKA 5JR2A 1V9U2 2WWJA 3GJBA 1H8TB 2VJXA 2DCYA 2O1QA 2EICA 3LGRA 3SH4A 5BNOC 3Q8BA 4OQ9A 1W0NA 5LK7B 4XFGA 5FCCA 5F3IA 2BP6A 2XGXA 1TG7A 1AVBA 3BCWA 1COV3 4Y26A 5FZGA 5D1IA 1UY0A 2MHFA 4Z2WA 5DN2A 1BBT2 3AKTA 1UU4A 1FV3A 1RUF2 1GR3A 1R1ZA 4RQPB 3HBKA 5FYMA 3OUJA 3WQ1A 1VLNA 2WLQA 1DQ6A 2A6YA 1WUVA 5A32B 2QNKA 3O1OA 5J37A 1HXS1 5L73A 3M8LA 4YW7A 3W5MA 2J7MA 4M0NA 3S5QA 4BPZA 4CVUA 4PIZA 5H9PA 4YM0A 4MH0E 2GMEA 2KA3A 2HYKA 1QJX3 4IETA 3ELNA 3KGZA 4DY5A 4MXWA 4EN8B 5KHIA 5JXIA 4MYEA 2BJSA 2ZZQA 4RHV1 1EV13 1O4ZA 3WW4A 2W91A 2RM23 4NRQA 3G7DA 4FOQA 3UT0A 5DQ0A 2OX0A 3SLIA 1OBNA 2CAVA 4ZU4A 1JHNA 1L7RA 2B9VA 2WZEA 3MDPA 4WM8A 3ZMNA 3USUB 1V70A 2BWCA 2BU9A 1XYPA 3B02A 3MW4A 5A1LA 5IFPA 1NXD1 2A71A 1DGRN 4FOYA 1GV9A 1E5SA 5FZ8A 2Q4SA 4OVEA 4XCBA 4CP2A 4HONA 3U0ZA 1C8M1 4XHXA 4Q1PA 1BVP1 4QPYA 3WY6A 2Y60A 3E5QA 4N9IA 4XC9A 4XF0A 1SBEA 2EAKA 3B9CA 3NKGA 4FPKA 1O8PA 1U5IA 2WNOA 3MF6A 4JTNA 2HWB3 1J84A 5IVVA 1RB8G 1Q43A 4LE4A 2H0VA 3ST7A 2BNNA 4M3CA 5GKAC 1GNZA 5JDBA 1YWKA 3OPWA 4IEPA 3S5AA 1JYVA 4FPYA 4MHUA 1SCRA 3MPPG 5LA9A 3T1MA 4KWUA 4YWAA 2OPWA 1GBGA 3C7HA 5F32A 4HK9A 4WM8C 4QU1A 4EV0A 5HCHA 2XWJB 5I0TA 4XUOA 4QDQA 3VD7A 1WMEA 3C8XA 1WWYA 3VDDB 5DZGA 1HRI2 3GHNA 1SBFA 2C5DA 5FJHA 1W0OA 2XJSA 4FAGA 1XNAA 2XMLA 1OLQA 1S0CA 1ZBE2 3LEIA 1UU6A 2QCSB 1JODA 4LR4A 4L9BA 3AZYA 2WFF2 3AJZA 1RMU3 1LODA 4URTA 4BQ4A 4DINB 4D6SA 4L8QA 2XKPA 2W1SA 2DFBA 1W6QB 1RUH1 3JBG3 3DL3A 3MO4A 5LWBA 1CN1A 1LHUA 2QQWA 2P1BA 2OS2A 3N9QA 4HKLA 5J7MA 3BTZA 1LAJA 1HLCA 1PVXA 3ZMOA 4E4DX 1C3HA 5FZ4A 1GWMA 3VV1A 2B39A 3INAA 5FUNA 5DAXA 3WF4A 1VBC3 3SKVA 4HVQA 1UOJA 2Z69A 4MGKE 2RS52 4WM7A 2GZWA 2JG9B 2ZXQA 1SLIA 3M3OA 2IFWA 1DIWA 2QQOA 2VCCA 1KITA 2EA7A 2BVVA 4LBNA 2SBAA 1NLSA 5FZCA 3DXUA 4LBJA 3ZXDA 1K45A 5CG8A 4FTEA 2WDBA 4Z1VA 2GAUA 2GMPA 1PO21 1T6BX 2RR13 2YB7A 3ZXLA 1OXCA 2RMU2 5CFCA 1ONAA 3H3UA 3ZN4A 3WG3A 1BYHA 3K2OA 3LSEA 4P00B 4OI1A 5IT6A 1O3RA 1X8EA 3OY8A 1W04A 2FZ2A 5EIYB 5GZGA 2HWF2 5LATA 1H2NA 3WT3A 4CDQB 1VBA1 2QE3A 2VOXA 3LFMA 4KL1A 5FK8A 3QD6A 4H3WA 3PUIA 4QGLA 3WUDA 3MV01 2P34A 2Q8CA 1QJU3 2DVFA 2NN8A 1MEC3 5FZHA 4D7SA 2C26A 1GZ9A 4HXCA 2BBVA 3AP4A 3DECA 1PZ8A 4HSLA 4LHKA 4WM7C 2QQLA 1ZZCA 1MS1A 1UL9A 2EXIA 2EIDA 1R1A3 1AX1A 3RRDA 1CPMA 5EFUA 3QLQA 2RJLA 1J1LA 2C9AA 3WF0A 1BMV1 3FHQA 4QX5A 3I2FA 1JXNA 2YGMA 3DF0A 1MACA 2ZHMA 3LIGA 4QQLA 5IVFA 3VLBB 3N4MA 4CDXB 4YGDA 4N7UA 2FDHA 4QQ2A 3MLKA 1UMHA 2ZX1A 1DG6A 1UMIA 5K9YA 3LFIA 5FOJB 3A22A 2D97A 1ZM1A 4W4ZA 1F15A 2YFZA 3FWEA 4Q0PA 1WCDJ 1DF0A 2YROA 3RJRA 1ND3C 5DAVA 1VAKA 5K8SA 4GMP1 1HDKA 1QDCA 2XOMA 4R9DA 4AFDA 2FBEA 2BEOA 5FZEA 1LJ7A 5ANQA 1SLTA 1Q3EA 3R4SA 4BOWA 1US2A 4A7YA 1C5HA 2PLV1 1NAEA 4JVAA 4NJ4A 3OGGA 3HWJA 1WCSA 2XJRA 3ALQA 2Q8OA 5K0UC 4IE6A 5FAXA 4Q2FA 2W1UA 1LHNA 4LHLA 2QZ2A 5EYYA 1VALA 2EIBA 3H0OA 4P5HA 5DMYA 1YQ8A 4LBQA 4QB1A 4XZUG 1VRH3 4P02B 1KDKA 2E7QA 3F2ZA 3IMNA 2P3KA 3RSJA 2DURA 3OUHA 4P9XA 3J8F3 3W5NA 4IV1B 5FZOB 5F37A 3AZXA 2D43A 3ZFFB 3WNNA 1XB9A 2QQKA 2HEVF 4Q8LA 4ES9A 3WHTA 3WVJA 1R092 1R64A 5ISLA 2ATFA 2Y64A 5F5AA 1JOPA 4CP9B 2VMHA 1CAVB 1UO9A 3GXUA 3V0BB 1WKYA 4CDWA 5CKMA 1FX5A 5BNNC 3I2GA 4RYDA 1POV0 2VZ1A 2IXIA 4LQRA 5DZFA 4WV8A 5KBFA 4CP0A 4EN6B 5EHDA 1QQP3 1TMF3 3ZM8A 2ORXA 4TLFA 1SG3A 5ACA2 3S7EA 5CFDB 2AR6A 2DTYA 1MVQA 1V6OA 1JW6A 2OPKA 2YXSA 4XJ8A 4MGQA 2XH6A 4Q4X2 3MLJA 1QOTA 3TB0A 2TBVA 1JYCA 1QJY1 4TYSA 1PGL1 4LBOA 2W1QA 1ALYA 4CU8A 1H2KA 1S0EA 3JB8A 4K3UA 1XSQA 4D7TA 4NPRA 2CTVA 3WX5A 1I1EA 4LMFA 1W2TA 2ZMKA 2K0GA 3HT1A 3ZYPA 1ODNA 2G1MA 2VW0A 2A3XA 1CJPA 4XVHA 1HRI3 3J7NA 4CDWC 3H7JA 3GZEA 1QNYA 4YLZA 3OEAA 4LKSA 5J98B 1GMMA 1BLZA 4LORA 4CZSA 2VC9A 1POV1 1SEFA 1XNKA 3SNMA 2AUYA 5FY9A 5BY5A 1PVC3 3MYXA 4LLFA 1CAUA 1QHDA 4QB6A 1BK1A 5F5IA 2DUPA 1JH5A 4H2AA 1RYYA 2JX9A 4DUXA 5A1AA 5GLUA 4LA3A 5KXEA 1URXA 1H1IA 4YG6A 4CEWA 1Y3TA 4LUMA 4AVSA 3GHMA 3D0JA 5DDJ1 4YM3A 4BZ4A 3AYAA 3GNEA 5IVEA 3OGSA 5FYYA 3GBWA 3E6BA 1UD1A 2JD9A 3UGFA 4ORFA 1WBLA 2BDRA 4M0HA 5FWJA 4FPGA 4AAPA 1W6MB 3RZZA 1OOPB 5FPUA 2CWMA 3QBQA 4D0QA 1CZSA 2AZ5A 2WO1A 1XC6A 4IEUA 2C24A 2R043 3NO8A 2YPJA 5FK7A 2F4PA 3BYWA 3I59A 3LEMA 3U10A 5BNOB 1CAWB 3ZXFA 1KD7A 1VBB3 3A4UA 4QPGB 1SLAA 2VXRA 3S30A 1S1AA 2RDQA 2ZEWA 1RHI2 1FNZA 1MS5A 1OC1A 2JDAA 3RG0A 1AL22 4WVMA 1ND2B 1R083 3D0SA 4AEDA 1COV1 3RZLA 2AREA 5IUQA 2GN3A 2UWAA 4YW3A 3ZXAC 5FYUA 1OURA 2VZUA 4AHZA 3N35A 2QQVA 1QF3A 4GKYA 1CONA 3N9PA 4BIFA 2VY0A 4B8EA 4J1WA 5FTTC 3LDBA 2WKKA 2VVFA 3KMHA 1C1FA 2DCTA 3EBRA 4OUMA 4NMIA 4AHYA 1MZEA 3P3NA 1XQNA 5D8AA 4KG8A 4OI2A 4QKBA 1S0FA 1IOAA 3FE5A 3K75B 2B5HA 4QT6A 1QJX1 1HX6A 2ZGMA 4Q4V2 1RUD3 4XDOA 2XVGA 5FYTA 1EV11 4PT6A 5DPNA 4Y5TA 5EP9A 4R4XA 3U4XA 1S0GA 2AACA 5F5CA 1QMJA 4AVVA 5ABJC 1PM4A 4AEDC 4AFBA 1PIV3 2HBTA 4MGSA 3H42B 4YM2A 3R0RA 1W8ZA 1FOD2 3P3PA 4W6YA 2C6SA 4XFBA 2DCKA 4QM9A 1OF4A 3WDXA 2WYSA 3AP6A 2D3PA 5CZKA 2DFCA 4XW3A 1AR73 4YW2A 4MGIE 5BNPB 1GZTA 2QJVA 4YFZA 3GZAA 3JQWA 4MXWB 3PJYA 5D8AC 3M3IA 1OMIA 1VB2A 1YFYA 2GALA 2W47A 2HWB1 3NV3A 4YW5A 1K42A 4P9WA 5E88A 4QXKA 4DRRA 1QY4A 3CQOA 1K3IA 1W9FA 4WM8B 5FO9B 1IS3A 1DGRA 5AC92 2D6MA 3IAQA 1J1TA 5FXWA 4RHV3 2RDRA 1BK0A 4F8AA 1WW5A 1DZTA 3O1SA 3FMGA 3HBZA 5FFOC 1LGBA 3VBRA 4IQPA 4ZZ5A 4QDSA 4XDPA 4XE9A 1AR83 4E8CA 1UU5A 4V1PA 4KGGA 5L7OA 1LECA 4GH4C 3POEA 2BWAA 1FMD3 2BGCA 2XQXA 2ZA9A 1PM7A 5C70A 2RJ2A 1C8M3 3QOPA 3RMXA 4ISQA 4BMBA 1AYN1 3K3NA 4MGYE 2RDSA 1RMU1 4ES8A 4KWLA 3LIHA 1OT5A 3O1RA 2ZGOA 1YI9A 1UIJA 1NKGA 2ZGKA 3VZOA 5LASA 2B9UA 1YIFA 2YYOA 3JBG1 1UY3A 1PK6A 4BB3A 2VQTA 1JYTA 4GWIA 1LEDA 3CO2A 4GZ9A 3FX3A 4FFFA 4UFLA 3WQ7A 3NV4A 3WUCA 3ZR5A 2ZKLA 3LOIA 4CEYB 4A6OA 5FBZA 4COVA 2H0BA 3AXEA 3K51A 3VBRC 1Q8VA 3GBGA 2P17A 4QM8A 2VMIA 3AKQA 4GIQA 2OA2A 2Y33A 4YM1A 3T08A 5LEKA 3KQRA 2VOVA 3ILNA 3NJYA 5L7OC 3OOXA 1UYXA 1W05A 1ZX5A 2ENRA 4MSVA 3EJKA 1I6XA 1ZBA1 2WT1A 3KF3A 1L7QA 3NL1A 1D4M3 2JECA 3PNAA 5A3MA 5GZCA 5ERLA 1GOHA 1YIPA 1EUUA 2RR11 5IYYA 1PMIA 3IDBB 3VDAA 1XYNA 4Q4Y2 1H6YA 1TQ5A 2D6NA 2VBDA 4YG0A 2I07B 4JC1A 1W9YA 1JZ7A 3RZGA 1PK6C 3AK0A 4NVPA 1RUH3 4PLNA 1DU3D 4BXSV 2ZTNA 2A1XA 4L92A 3LE0A 1MEC1 3SKJE 4DUWA 3BOWA 3RYPA 5A7NA 1O3TA 1X33A 5BV6A 1YFWA 2BNOA 2JDUA 2NYYA 5EQUA 1OA3A 4EE2A 1Z0HA 5C5TA 3K4ZA 4JKMA 2FZ1A 4AL9A 4O9EA 5CFCB 3DYPA 4I0AA 2E53A 3HMYA 4AVAA 2C0ZA 1R1A1 4Y4RA 4LK7A 4CE8A 4DXRA 3OY8B 2ZGNA 3SCFA 4CDUB 2WC2A 4QKFA 4XILA 5C71A 4YZ3A 4BU2A 4LHSA 1V9U1 3VBHA 3WDWA 3T4HB 3ZXEA 4BM8A 5I0DA 1PX4A 3WCSA 3M3QA 3VBUA 4CUGA 1XNBA 1LULA 5D21A 1Y9GA 1VAMA 1YCIA 3IZOA 1O91A 4R4ZA 4N7IA 2X53S 4JDNA 1X82A 4UFJA 5I0UA 5FP7A 1VBA3 1WA6X 5C8WA 4YVSB 4IDZA 3I2OA 2VCAA 2Q1MA 4OMDA 4R52A 3M70A 2RJKA 3H8UA 3WP5A 1BBT1 2WR9A 4P9LA 3T0BA 3HN3A 1NUKA 4EN7B 4E4ZA 1CR7A 5TSWA 3MIGA 3ZXGA 5I8TA 2NM1A 3IWZA 4XBQA 3CL1A 1E57A 1LENA 4AG4A 5LRRA 2W2IA 2DTWA 5KXCA 1H9PA 2I2SA 3OCPA 3VDCA 2R32A 4A44A 5J3UA 3N7LA 5I8SA 1OLME 3RPQA 3T2PA 1IS5A 1K12A 1BQPA 3MBWA 2QQPA 5KC6A 1YUDA 5FY8A 5BXXA 3VBUC 3DKQA 3WDUA 3H8OA 2W52A 1US3A 1IQDC 3I49A 2IXLA 3ZN6A 1W03A 4XTMA 2X09A 2PHFA 4X6RB 1RVF2 5FP8A 5F6KA 2JDZA 1EY2A 4AI1A 4JKLA 4GMP3 1RGSA 5A33A 2VBPA 2VE1A 1V6MA 5C4WC 5I0SA 4RS5A 5A7SA 3SH5A 2J1TA 4ITCA 4LOSA 3ZYHA 4LEJA 1BHGA 4XJWA 4LBQB 3HN1A 2VMGA 2VMFA 4G4FA 2HEWF 3AP7A 1QQP1 1TMF1 2PLV3 3N9NA 3RMYA 1BVVA 3J9SA 4AQTA 1OKOA 1WCQA 3RYRA 2FDJA 3CHXA 4XEZA 1W6OB 2WQZC 4LA2A 2XKOA 2E32A 3VHRA 1CX1A 3BN6A 1JUHA 2Q0AA 1UXZA 3ZYRA 4AXOA 4AVBA 1RUC2 1OVSA 1SHWB 1JBCA 4W50A 2X5IA 1GP5A 1ASJ2 3DN7A 5FQ0B 3KGLA 3T2QA 3BTXA 4XBLA 5L9BA 4EROA 3EHKA 5FDBA 4U2AA 2GP3A 2ZGQA 1HRV3 1HRI1 1UZVA 4YRDA 4RS5C 3HNYM 3ACGA 2WNEA 3FFZA 1O6UA 4UBGA 3FN9A 5C8CC 2CSGA 3TEWA 1NCRA 1L7LA 3F95A 1MS4A 2BBAA 5JR7B 4L0PA 5A7PA 2XL7A 3ZSEA 3PJQA 5FIXA 4IEYA 2WFF1 2Y8KA 4NPMA 1FI2A 4HK8A 1OFNA 1ZA7A 4IEOA 1RUJ2 3MGUA 1F2NA 3UKNA 4JGYA 1PMHX 1OH4A 4PBOA 5IK8A 5FMOL 1O4YA 1VBD2 1KDMA 1QJY3 4N8MA 3OBRA 4AK3A 4OMCA 3BVCA 5A6XA 4NUBA 1KFXL 2X5IC 2VH9A 4MGTA 2Y34A 1NA1B 2RS51 1EPZA 2J22A 1YNAA 3AZZA 4N53A 4ZS2A 1JZ2A 5F2WA 1CVNA 3E6CC 3T4VA 2XHKA 2JJ6A 1NCRC 1ZRRA 1ULDA 2PHUA 4AI2A 2VO5A 3ZVXA 2CV6A 4HANA 1HB3A 4YZ5A 3MICA 2WS92 4FPFA 2RMU1 3ZSKA 2XJQA 4CEWB 1ZRCA 1VMFA 2EALA 2F17A 2WO7A 1MZ5A 4DEQA 4JGYC 2GMMA 5AFBA 1C57A 1FXZA 4X6QB 2HWF1 2ID4A 5FYHA 5C3QA 3B9IA 3ORJA 3ETQA 1A78A 3WDTA 2HWC3 5A7WA 4OHWA 1X36A 4GB33 5LW9A 4QQHA 5J48A 2PXJA 2VVDA 1SDDB 1OUXA 2XJVA 4Q26A 5KWRA 1QKQA 2G9ZA 1ZYBA 2EXHA 2WBKA 1PO12 3E97A 4GJZA 4N43A 1SDWA 3W59A 3M4FA 2B45X 4N53C 1X9PA 1M4WA 3VBFA 5H9QA 3WXPA 1NY72 3TN92 4CXWA 5GM0A 1W0PA 2PN5A 4EJRA 2EAAA 3SEEA 2GDFA 2WNUB 2A73B 3BIWE 3MLLA 3VZKA 5C9AB 1CZTA 1LOFC 3I59B 3I54A 2VQUA 1DLCA 3ES1A 3E1F1 1GFF2 2TUNA 4GWJA 2D3SA 2X10A 4ZS3A 4ISRA 2DUOA 4RFRB 4WBBA 1UWWA 3MEPA 4Y20B 3BGAA 1L3JA 3NWKA 1T6GC 5FRAA 3VUOA 2FDGA 4WVMB 1QGLA 3VBOB 1JYIA 1Z7S3 4AGGA 2FCVA 3MFCA 4BQ2A 4E2QA 3A0NA 1UX7A 2V72A 2EVXA 4WZCA 5C3SA 1A6CA 3MF9A 1OQDA 1Y43B 1BJQA 3OJBA 3APBA 5LBFA 4AFCA 5F3CA 4I09A 4N43C 3PVBB 5IFTA 3VBFC 5I93A 4QPIC 1PIV1 5DAQA 1TZOA 4P08A 4PI0A 1HB1A 1MS0A 2Q1FA 2Z5WA 3THTA 3Q9OA 4DXTA 1AL0G 3ES4A 3MIDA 3VL9A 2QTWB 2E6VA 1NZCA 1AR71 2Z42A 1HW5A 1SLCA 5DUWA 1QNWA 4QMAA 2LM3A 1GU3A 1UNBA 2CNAA 2R062 2DCZA 2IXHA 1JYWA 4GWNA 1YRZA 2HWD2 1AYM3 2OQ7A 4QXBA 3OF1A 4AI3A 5LY1A 5DUXA 5F3EA 2ARCA 1RIRA 3GYDA 3DGTA 4K40A 1GWLA 3ZSLA 1RUG2 3WP6A 5CG9A 1R091 1X7NA 2A6VA 4KWKA 3AVSA 3VB9A 2RV9A 5KHHA 3R4UA 3RYKA 1ZZ7A 2W94A 4ASMB 3OGJA 2BVBA 4NIAA 3WCRA 2VMDA 2VW1A 3FJSA 1BXHA 2A3WA 4EZHA 1N47A 1AR81 1W8FA 2LW8A 4LE3A 5FMBA 1UYPA 4ONUA 5FMDA 5LY2A 1Q8QA 4FSJA 2DVGA 3C7GA 1FMD1 1AJKA 2ET7A 4IE0A 3R6SA 5ACA1 3RZKA 4NIGA 4QGMA 2VECA 4XFCA 2DVDA 4XBNA 4Q8KA 4A2UA 4QX1A 3B3QE 4QPWA 1C4RA 5C6CA 1P8JA 5IVYA 2CU5A 3EYPA 5JWPA 4DRVA 5A3PA 4Q0VA 4Y22A 3VBRB 1WCKA 4UWDA 2JE8A 3JU9A 2QFEA 1WW4A 4NE9A 4JTOA 5HXVA 4YARA 2PQQA 3WG4A 1W2OA 4NOTA 2WSUA 2YBSA 1Q8SA 2QVSB 4QQOA 4D3WA 4XHBA 2TNFA 4IEWA 3E6DA 5B2GB 3O1MA 3DV8A 4CP1A 1DHKB 5LBBA 4LBMA 1OA2A 2Q1ZB 3WQBA 5JZGA 4Q4W2 2ZAAA 5A3LA 1D4M1 3ZSJA 2VW2A 4IE5A 5T3NA 1V6NA 2BFUL 2ZGLA 1LR5A 2HKXA 2ZEXA 1AYN3 1WD4A 2HJIA 1UZ0A 3ME2A 1FT9A 3KV5A 1VBE3 1IZ3A 1HQNA 2AYHA 3GALA 3GGLA 3KV4A 3WDYA 1NCQC 1JN2P 3BI3A 5CYYA 3WEZA 4EWEA 5L9VA 1W8UA 4FVVA 3AMNA 1I3HA 4AEMA 4YFWA 4X8NA 1UXXX 3SMHA 3UETA 4L99A 1ENQA 3CMGA 3PVEA 1OD3A 3AYEA 5M0TA 4K21A 3ZO0B 3ZYGA 3OD4A 5JZGC 3TRSB 5HCAA 3DCQA 4CCDA 3IDAA 4JAAA 4L97A 2XJUA 1GZCA 1H2LA 1ZBA3 5LBEA 2JE7A 1W2NA 2B42B 2PAMA 4UT5A 2F6BA 3T1LA 2P2KA 1OHFA 2DUQA 2XBO3 3AZWA 3D8CA 4YYOA 1XU2A 2Q8DA 5FYIA 4IV3A 3H3LA 1MZ6A 2JG8B 3S6PA 2E63A 2ORZA 3N3HA 5LRSA 1Z78A 2WZ8A 3LPFA 2ZJCA 4NHMA 1RUI2 5JI7A 1W39A 1DQ2A 1PO13 3W58A 4CCMA 2C9KA 4GMP0 5B4XA 1ND3A 1V6IA 2HWE3 1FPN2 2GC1A 1DYKA 5GZDA 3KT1A 1X9TA 4UBHA 1OVPA 4WVVA 4BK4A 1YYNA 2J1RA 2BERA 2XONA 5CNAA 3WINE 5FKBA 2KR2A 1VR3A 3VBHB 4WVWA 1B35A 3N9LA 3IT8A 2VQ0A 2QBXA 5KC5A 4KU7A 4YVWB 3VBUB 2XHNA 4QWNA 3OBZA 5DABA 5K0UA 4QHOA 2GN7A 2CL2A 1GANA 4XIOA 2G9GA 1UOBA 2DF7A 2W87A 1X50A 3JZVA 1V9U3 4IV3C 4P9YA 5EJ3A 1BEV2 2SLIA 5FZIA 3WDVA 5KR7A 1DBNA 5A6YA 4PF1A 2BOJA 1PGSA 4XFIA 2QQNA 3IKWA 3O12A 3FLPA 1CD3G 4IXLA 3WW1A 3C2UA 4XUQA 1I5PA 4B4QA 1FOD1 4DEVA 1V0AA 4MXVA 5FZ9A 2R1BA 3GCXA 5KXBA 4KBZA 4W8JA 4IESA 5E16A 1BBT3 1DGWA 2AH2A 1RUF3 2DBIA 2W3JA 3HVDA 3PLQA 4U36A 5BNNA 2CGPA 4FFHA 3WG1A 1B35C 2P4EA 4GKXA 1UAIA 3NMBA 4QQPA 4CPBA 5I91A 5LCWL 2DDUA 1H4HA 1W6NB 4JQTA 4AFMA 1G9AA 4GXLA 2ZEZA 3ZN6B 5DZEA 3TOJA 1G9CA 4BK5A 2E33A 3RZHA 1ZNPA 4MUVA 5AC91 1Q8PA 1DQ4A 4AGVA 2R0HA 3AL6A 3PL0A 1RUE2 2ZX4A 1REEA 1TNFA 2WZPP 4R9AA 3CDZB 5A33B 4EWDA 2V5YA 4Z92B 3AKSA 2YUEA 2XVKA 4CPBD 2IC1A 4P9JA 1CPNA 5JLVA 2W92A 3L9JT 1HQLA 1NX9A 1HRV1 1LHWA 2ZX0A 4TTGA 4IGQA 3KQ4B 3V65A 1V6JA 3OB8A 4A45A 1ULEA 4J25A 3OPZA 4JGZA 4DUVA 1N3PA 4NN0A 4CXXA 3AFGA 3ZIXA 1N1TA 4LBLA 2GNTA 3KCYA 3RFRA 1HXS2 2ZKNA 1FAYA 1XBFA 3ECQA 3LSDA 4O61A 3T2OA 2GP5A 2X05A 3ZFGB 1LB2A 1X8MA 4LOTA 5F8PA 3PTYA 5C3OA 4UF0B 4LPLA 4L11A 3OYWA 4A6SA 1K5JA 1A8DA 2R6QA 3AKRA 1DLLA 4DMIA 3J7MA 1DFQA 4UW6A 2G4IA 2R072 3U11A 1NLQA 1MS3A 4HPKA 4IGPA 4Q5OA 4NAOA 5JMCA 2ZS6B 3L2YA 3NJXA 5DAWA 2OZ6A 5T5PA 2RVAA 4NROA 1UKRA 1KS4A 4Y1XA 3ATGA 4DFSA 5FUPA 4JGZC 3PIJA 3WNMA 2AENA 1ZBE3 2ZCWA 4JGYB 1GUIA 4J6GA 3ACFA 3V0AA 4YW6A 1EAH2 1YQ2A 2NMOA 2WFF3 2XG3A 3FHAA 4A3ZA 4PQQA 2E7AA 4URAA 1H2MA 4WVZA 3H8XA 3KCCA 4M3CE 2WSVA 4OUSA 4E2SA 1QH6A 3FBMA 3ILRA 1JZ8A 1SPPB 1LCLA 2HWC1 1XE0A 1UPIA 3KZ4C 4GB31 5APAA 1D0HA 4N53B 2NMNA 1CAXA 4BJ0A 1B09A 3E5XA 3QACA 5I8YA 5LB6A 4Y1UA 1AXZA 2JB4A 4K6BA 4S2FA 5FYCA 2JEMA 4R8HA 3WG2A 5L19A 1W99A 4NO4A 2J1EA 2VR4A 5E89A 1POQA 1YJLA 2JD4A 2QQJA 5A7OA 5E1RA 2RS53 4KU8A 1W6PA 2JWPA 3CIHA 1ZZBA 1GNHA 4Q0SA 4RGKA 4YGBA 1QXJA 1O3QA 1DQ0A 1XPWA 4ZONA 1QWRA 3VD3A 2VCMA 5HXMA 1ZVFA 5FZAA 5DAPA 5FLHA 4ASLA 2Z4FA 1DDLA 3LZZA 2RMU3 2XR4A 3O14A 4C1WA 4COUA 2WN3A 5JXJA 1UCXA 3D5OA 5FXZA 4K7JA 1RUOA 2H6BA 5GLTA 4D94A 3ZR6A 1Z7S1 2RS32 2HWF3 4N43B 4XMAA 3VBFB 1AR62 1JS9A 3TAYA 1WA4A 1U5ZA 1NOVA 3OGRA 5CIRA 2A6ZA 1IHMA 4COYA 5LK5A 1H0BA 1IPJA 1LU1A 1XXNA 2YMZA 3OUIA 2JDKA 4ZPIA 2OUJA 5ABJA 3GBFA 3C7FA 5FPBA 3PUAA 1UZWA 3MW2A 4PBPA 3S7IA 5FZMA 5EJZB 1CZVA 5DG2A 3TNQA 2UURA 5FO7B 1ZRIA 4QX7A 1GLHA 2ZGRA 2RS12 3NNMA 3I3DA 1XJAA 5IVBA 4EWAA 5A3OA 2L9LA 1S55A 4XDQA 3CJIC 2P3YA 4BIOA 2VG9A 1XSRA 2CWSA 3LKJA 4XMIA 5FY7A 1AYM1 2O14A 3RWNA 2OVUA 1KJRA 3TNPB 4HZFA 3WR0A 3PIGA 1RVF1 1UY2A 1XU1A 2FDIA 5F7UA 3BALA 5HV0A 3GCWA 1VIWB 1H8TA 2ZX3A 1S0DA 1LOBA 4XYXA 5FY4A 4OI4A 4RGGA 3IB3A 4F7ZA 1OUSA 1Y7BA 4KG0A 3WF3A 2WT0A 4TXWA 1Y9QA 1RITA 1LNSA 4PCRA 3KHBA 4FT8A 2GC2A 2WFPA 2C1FA 2XLGA 4AAXA 3LB9A 4GH4A 1YO8A 1TME2 4RQPA 1XRUA 3W20A 4EYUA 2JIGA 1BMV2 1AHSA 1W8WA 2PHWA 4CXYA 4XQDA 4CU6A 1IG0A 3BB6A 5FZ1A 3WQ0A 2PAEA 5FPZA 3SEPA 1RINA 2YHJA 2TEPA 1QU0A 1FYUA 1AR92 2W9XA 3KF5A 1H8TC 4S2HA 2E9QA 2RHPA 5T5OA 4BQ3A 2NQYA 2JDHA 1KJLA 1R093 3HNBM 2VXJA 1WZXA 1WMDA 3POJA 2WQ8A 4W65A 1STMA 5CBLA 2PHRA 3POYA 1SMVA 2WLPA 3X29B 4QXHA 5A6ZA 3POFA 4AI8A 5J1XA 4BQ1A 2W46A 5GZEA 4RQPC 5ACA3 1D4VB 1RUJ1 3LCPA 2G9FA 5LA1A 4Y22B 4M3CB 1GWKA 4UXAA 3ZYBA 2AEZA 2DU1A 5A3WA 2VNOA 4Q4X3 3AYCA 1H8VA 3KT4A 3L2HA 3T0AA 3JB4C 3ZYFA 1YFXA 1VBE1 2ZBJA 3B7MA 2C4XA 5KHGA 4HLTA 4UW3A 1JOBA 2J1SA 4IEXA 3NQHA 2ILMA 3I2DA 4X8PA 5FJKA 3EQEA 4GAZA 4IE4A 2XB6C 4TSVA 2DCJA 3OBAA 4UFKA 4Z82A 4ASKA 5FYBA 4B4PA 4GULA 2IFRA 3HQXA 3A23A 3WF2A 1G9DA 2WZR2 4BQ5A 2MEV2 1LU2A 1PGW1 3NKTA 3GJAA 1V6KA 1YI7A 1ENSA 1WLWA 2ERFA 1U5YA 2WJSA 1VE0A 2XXZA 3LD8A 4B7EA 4NRMA 4XFHA 1S2KA 5HV4A 2W0XA 2XBO1 4QXCA 4JHZA 1QH7A 3DUIA 4HT1T 4V2WA 1XE8A 1QOSA 4D8MA 4ET7A 4YW1A 1A34A 2ZABA 4LO5B 4F83A 3ZPYA 1PO11 3PMSA 1EP0A 3IIAA 1Y4WA 3NAPA 4B1LA 3QCWA 4XACA 5JSRA 2YPDA 4N90A 1NY71 4WM7B 2HWE1 4DZGA 3NNGA 5FKCA 3FUQA 4QU2A 1LEMA 4JCKA 3J26N 3B93A 3ZXKA 4UW5A 4AYUA 4C1XA 1F31A 2D98A 2PHLA 3VDDC 4GWMA 1DP0A 2JG9A 4M4PA 1O3SA 3DYOA 3EMRA 4BE3A 1JZ5A 3OTFA 3FBYA 2ZPXA 3EB7A 2Q5TA 1W9SA 3LDRA 4MHRA 4RFT0 1S4CA 4AVTA 3CEWA 1SLLA 4B7KA 1J3QA 1ND3B 3N7JA 1RHI3 4IEZA 3U4SA 5IWFA 3JD72 2V09A 5DDJ2 1AL23 4KWJA 2V73A 3NAPC 2IVJA 2NLRA 3BODA 5FZFA 5FZBA 4CDQA 5CADA 5EV7A 2IVIB 4BHPA 4YZ2A 3ZIWA 1FATA 5LA0A 2VZVA 1DYPA 2VZTA 1RUF1 3CBNA 2YZ4A 2RS13 5C4WA 4DS0A 5FZ7A 5K0UB 3GZTB 4I3GA 5FPLA 3RNSA 1JOJA 3ZYIB 2JG9C 3B01A 3TEZA 3O0WA 4HG6B 4UYBA 2WAAA 3RZJA 5FZLA 2R1DA 3H1YA 1YLLA 2R061 1G6NA 2HWD1 1LGCA 4TN7A 2WA4A 2WWUA 2D44A 5FY1A 4Q4V3 4AI9A 2RG4A 3LA2A 3HNMA 4CDXA 1UYYA 3VZMA 4O7XA 4CDQC 2AEYA 5F3GA 2OKXA 4QB2A 1QJFA 5GZFA 1DGWX 5BNNB 2VOTA 1COV2 4MX3A 4BLJA 1FOD3 1YJKA 3GZUC 4D6RA 2P5BA 2A7AA 3N7KA 4E4HA 2VNRA 3K46A 5IK5A 4Q27A 4ZZ8A 2BUKA 5HBAA 2VUAA 1K5MA 5C8CA 4AF9A 1IS4A 3WW3A 2WUHA 3TEXA 5C3RA 5FO8B 1SQ4A 5A6QA 1AF9A 3FZ3A 2J1AA 3CKHA 4RR3A 3H50A 3OPTA 3WHUA 4CU9A 1MVEA 4XXPA 3LA3A 2HLEA 4QX8A 1QJX2 2YC2A 3KCXA 4CSWA 4CDXC 4M3CF 5J09A 4OQ8A 4NHYA 5AC93 2ADEA 1EV12 2RM22 1QXPA 2BNMA 3MIHA 1BKZA 4IV1A 4E27A 1VJ2A 3DXTA 1GYKA 2BGOA 3VKOA 5CAZA 1VRBA 5F39A 4CDWB 4ZKTB 1OPOA 4MZUA 3ON7A 1PHMA 4M00A 3CZUA 2V4VA 3VHNA 5A3UA 2YV8A 1HJGA 5FBJA 4BQXA 2DYCA 3Q8EA 5CEHA 4CTEA 4LO4B 3VHPA 4DIQA 1CAVA 1F5FA 1W3VA 4Q4W1 2P6CA 4H55A 1K5MC 2XWBB 1ZBE1 3MIFA 1PZ9A 4QX2A 2WINB 5FLIA 1JZ4A 1SFYA 2ZOEB 4HN0A 2OQ6A 3TYJA 4GD4A 4K1ZA 3OYWB 4RR3C 2IUWA 2Y38A 2YC4A 1S0IA 3U14A 4ATFA 1O4TA 1UY1A 1W8OA 5LA2A 2HWB2 2FQPA 1QJEA 4QDRA 4KGQA 2CGNA 3W9AA 1ODMA 3U1XA 4OZXA 1WW6A 3VZJA 3VKNA 4AEJA 4BCUA 3VKMA 3A21A 1V00A 4IV1C 3U37A 1M06G 2UY9A 1YQ5A 2PHDA 4OCTA 5AFEA 4OHZA 1LKNA 4Z8BA 1UW8A 2JICA 3C7OA 3AYDA 3O0XA 4BQWA 4HVOA 3V0AB 1AJOA 5B4NA 1F9KA 1SFNA 1AXYA 1CAUB 3KB5A 1APNA 4E9KA 2FDKA 1F8VA 1LHVA 1LOFA 3H7YA 3PHMA 5T54A 4FAHA 3PU3A 1AX2A 3IPVA 3LDKA 5L36A 5JOYA 1C1LA 1RMU2 2O8OA 2XQRA 1XNTA 1JZ6A 1RJ7A 3JUUA 4Q4Y3 2JB8A 1YQ6A 3I2JA 1LOCA 2PELA 5DUVA 4ZXEA 1RUI1 1TNRA 2VZSA 4NHKA 1RUNA 1WLTA 1RL3A 1UPSA 2FCTA 4D69A 3WF1A 3PUSA 3ILFA 1N3OA 5T55A 1JU4A 1FPN1 1D2QA 1SZBA 1OPMA 1VBC2 3HQRA 4KQ7A 4QPIA 3OD0A 4B3NA 1UF2C 3CLPA 4CUCA 2VVEA 3LOBA 1UMZA 5FLJA 2DBNA 1NQDA 3U07A 5CKNA 1MQTA 1O7FA 1W6MA 3OG2A 4MVTA 4D6QA 4XURA 1OOPA 2GNDA 4JDOA 4LO7A 4K1YA 2Y0OA 1S0JA 1ULPA 2RR12 3VZLA 3WSOA 3HT2A 4PF5A 5DXDA 4J1XA 3VD5A 4D7YA 1BEV1 2ADDA 3MV11 4NWWA 2Y26A 3D3AA 4LKFA 4E4SA 2FCUA 3N9MA 3AMPA 1C8NA 1BCXA 3JD73 3K77A 1CAWA 5EPAA 5BYNA 3S0MA 4KBBA 5ABJB 2QQIA 4QPGA 1Q8OA 2HYXA 2WA3A 4AEDB 4LO8A 5EZWA 4AGRA 3O1TA 1GZWA 4Y5SA 4G3YC 1QJU2 1ZZ6A 2VU9A 5JVVA 1AUYA 2BRTA 1KS5A 2PAKA 5FP9A 4LKEA 3WZ1A 2QDRA 1ND2A 4Y4YA 2YC0A 2BOIA 2CDOA 3ETPA 3CU7A 1OA4A 1MQTC 2LALA 3AC0A 3AP9A 3GF6A 4LJHA 4OYUA 4EN9B 3Q8AA 1OOPC 5D8AB 1R1A2 2QQUA 1TEIA 2A3YA 4LUKA 3VGIA 4IE7A 4S2GA 4JZRA 5IAXA 4AR2A 4PDWA 2VMCA 5H9SA 5EYXA 2VZ3A 3BU7A 3ZSMA 3CZJA 2ZHLA 3RVHA 4H7LA 4LITA 4CCCA 1E5HA 1RUE1 4HFSA 5JOZA 2R49A 4ZXKA 3OEBA 4QKNA 4P14A 3AVRA 3K4DA 4QPGC 1RVF3 2W08A 2NZ9A 4P9IA 2Q8EA 1LGNA 3N7MA 4XFFA 4S2DA 4GH4B 1NG0A 1J3PA 4LBKA 4C8DA 1ND2C 3RDIA 4YZ4A 4M01A 4CCJA 3B5LB 1O5LA 4XZPA 1U12A 4ZU5A 3SISA 3WNKA 2PMWB 1C5IA 2J42A 4UFHA 4Q0QA 1KQRA 4TLGA 4PDWC 5BNPA 5CA6A 3J7HA 4E2GA 3GDBA 1VRH2 2R0FA 3FHIB 2GSYA 4QX0A 3KWVA 4Q4X1 5FYSA 1LOEA 1CIYA 2DWRA 1N3QA 3J8F2 2OXBA 3MZHA 5HCFA 1RUC3 2R071 2Z79A 3WNLA 1OSGA 4BQYA 4C90A 1ASJ3 1NCQA 4QHBA 3LEGA 3QH7A 1RTVA 4KNCA 2UYAA 3O5SA 2YU2A 1A3KA 4AW7A 1QDOA 3VDBA 2P3IA 4UFIA 5L7OB 3AMQA 2WWSA 3J4UH 4XJUA 3KVBA 2OIIA 4LIUA 3Q8FA 4XUNA 1UZZA 4YSFA 2Y6KA 2EIGA 1CJDA 2YGLA 4NR1A 1EAH1 1QQP2 1TMF2 1CGPA 3IBMA 5BNPC 1RUJ3 1T2XA 1WMFA 2V5DA 4YW4A 3RI9A 1PK6B 3ROUA 2V4AA 5CU1A 4AOCA 1JMUB 4LLOA 3KHCA 1VMHA 1OLRA 2ZAHA 4YGCA 1NT0A 1VBD3 2I45A 4GJYA 1Y9MA 4NAMA 1HV0A 1J58A 1QEXA 2XDVA 4ARXA 3JXSA 4K20A 5L9RA 3SH3A 5CISA 2CDPA 5BUVA 4A42A 2NP0A 5C3PA 4TZDA 4O9GA 3PUHA 4E8DA 1WCUA 5T5JA 2B7YA 4CEYA 1ZA4A 3KV6A 4OULA 1KGYA 4CCOA 2R16A 5A1FA 2CGOA 5JOXA 1YHFA 3M1HA 1MR5A 4RD7A 4XJAA 1NXMA 3WLUA 2WS93 4A7KA 4TWTA 2VZOA 2OZJA 1PVC2 3ZDSA 2ZZJA 4PIYA 4IEVA 3ABZA 3I2HA 4SLIA 3THPA 1GP6A 2BTVC 1YC61 3WNPA 3M3EA 2UWBA 2E7TA 4AQSA 2RS31 3FC0A 4COZA 2CHHA 2FD8A 3FLTA 1UY4A 3NAPB 1AR61 1D0GA 1NE4A 1ZZ8A 1HIXA 4GQ7A 4WZFA 3D82A 5FZDA 5FPAA 1RHI1 4G9SB 4MADA 4AE2A 1AL21 2ZHNA 4XFAA 3NV2A 1H4GA 5FREA 2ZGSA 3H9AA 2P3JA 4OHVA 4XQ4A 3AMHA 4CEYC 1RJ8A 4QX3A 1ENXA 5HI0A 4I2OA 3TN93 2VZPA 3RS6A 3MI8A 5K4LA 2OW4A 1ZRFA 2RS11 1RXGA 4UOJA 4BYYA 2BGPA 1KEXA 2ZACA 2YG0A 3POWA 2R042 3VHOA 4CA9A 4BWOA 1SFPA 2Y6FA 3DPRA 1YEWA 4AI0A 1GQGA 1O8SA 3W21A 2VM9A 4CDUA 3PMEA 1NZIA 1VPHA 4Q4V1 1VBB2 2WL1A 3CNAA 3H3ZA 1GKBA 4HBNA 4FXKB 4JQRA 5J36A 4AWDA 5EXOA 5FV3A 3I8TA 4HVRA 4YG3A 5FYZA 5C4WB 3ZFEA 1R082 4YVSA 3B69A 1LOGA 4KMQA 4HKWA 4B29A 4JRAA 4BA6A 1WMXA 2W39A 2WAOA 4Y1VA 2WQ4A 1H6XA 3ZKYA 3FFQA 4FTSA 4HSJA 3BU0A 1DGLA 2ARAA 1CIWA 1TME1 4JX0A 4CRQA 2FMYA 2ZGPA 1MS8A 5CFCC 5FPXA 5JUVA 4IL7A 3TWIA 4HKOA 4L2NA 3PTRB 3DPRC 2LS6A 3NSTA 2R063 5A3NA 1GOFA 1ULFA 4CDUC
chains in the Genus database with same CATH topology
2HWD3 2KM2A 1RUD2 4P9GA 1AR91 3OBTA 3AFKA 4META 2IWGB 4XF4A 4XF9A 1RUG3 3A0KA 1UIKA 3KT7A 3ZFEC 4RS5B 4YVSC 1PIV2 3HAGA 1K5MB 5F5QA 5C8CB 3E5UA 1ZREA 1HKDA 4PIXA 1KRIA 5JPMB 4RR3B 5GALA 3R4DB 3UL2A 2N7GA 1AR72 1LOAA 2JE9A 3CF6E 2JENA 1PNFA 2A6XA 5JSOA 1QJZA 1J3RA 3LAGA 1W6OA 2X5IB 3MIEA 2XLFA 4AHXA 1VB4A 4A3XA 4RHV2 3D6EA 1Q56A 2W68A 3MIBA 2ARXA 1QOOA 1DZQA 3VBSA 1S0BA 2AGSA 4LBQD 4QGNA 4PJYA 3USSA 1XE7A 2GC3A 5FQ0A 1NCRB 4B4RA 1AR82 3FLRA 1V6LA 3V64A 2CYFA 2WZR1 2ET1A 2MEV1 1WBFA 1FMD2 4Q4W3 5AVAA 1C8M2 3AKPA 4NHLA 4K9SA 1SLBA 3MPBA 3UJQA 2K2SA 4Q4Y1 4LNVA 3BTAA 2I74A 3WD5A 2D5FA 3C3VA 2LUWA 1BZWA 1ULCA 3O0VA 3O7OA 4A7ZA 3D4KA 2XLAA 1RC6A 3VBSC 4MGZE 2IZWA 3WNXA 4GALA 2VOKA 3ACLA 4IERA 3VZNA 4N9HA 1NA1A 3IPVB 4RL7A 4W6XA 3G6JB 1SACA 4XETA 5CB7A 5T5LA 2FMDA 1DQ5A 2YY1A 2WNVA 1D4M2 1CQ9A 4CYDA 4RSUA 1CX4A 1J59A 4DXZA 3CJIA 1JUIA 2UYBA 3JD71 3EXUA 4FQZA 4KH9A 3NVCA 1RUH2 4INDA 1RUI3 4Q1RA 3WV6A 4QPIB 1I5ZA 5KHJA 1U5XA 1MQTB 4ATEA 2PYTA 1FPN3 1WGPA 4DY3A 3AX4A 1NA1C 2GNBA 5IK7A 4DPNA 3SXWA 2QKDA 4GA9A 1LESA 4XJZA 2WNVC 3URFA 5JCTA 2WNUA 4FBFA 1OQEA 5C9AA 2D7FA 4UW4A 4YZ1A 4H7MA 4YNIA 1PO22 4I01A 3RJ2X 5EWSA 4DOUA 4CEWC 1OFSA 1BEV3 3NV1A 1GZWB 4XIKA 1WLDA 4I0WB 4Y20A 4FPEA 2UWCA 4OLLA 4F3JA 4FQ4A 4FO9A 1VBA2 3VBOA 4JDMA 5T52A 3ZN5A 2PFWA 1TE1B 5K7PA 4FPHA 2OYZA 3ZXJA 3ENRA 2A75A 1EPWA 4FXGB 1ZRDA 4PDWB 3I7DA 4FPJA 2PHTA 2WNUC 1Q5OA 3B00A 5C9AC 3JCIA 5JPNB 1H30A 1LRHA 5A32A 3IN9A 2VOWA 4FPLA 2P37A 2YDEA 3FUOA 2RM21 4MLOA 1RUE3 4PLMA 1RUC1 5GLWA 3VBOC 5JAXA 1UX6A 2IXKA 2ZMLA 1ASJ1 5DUUA 3AXDA 2XVLA 2D6PA 4FCAA 5JIUA 1AZDA 3M3CA 4JRLA 1MS9A 2GC0A 4XF3A 4OHYA 3USUA 1SCSA 1NYWA 2GH8A 1FV2A 2PLV2 1DZRA 2WT2A 1XNDA 1HXS3 5FMOS 3RI8A 3UJOA 3IDCB 1G8WA 1I9RA 2HEYF 2CY6A 1NLRA 1KXGA 1N1YA 2O0OA 1NCQB 1OD5A 1OKQA 2H6CA 1VBD1 2BPA2 4HETA 1LTEA 4I30A 5F6LB 1G7YA 2Y0IA 1N1SA 2PA7A 2R073 3H1WA 4HMZA 1IQAA 3SCGA 4AEKA 2GU9A 4I0BA 2D6LX 3LA7A 1HRV2 1C28A 2PHXA 4XOGA 5JZGB 3UKTA 1HQWA 2QUOA 3UK9A 2O8QA 4FOVA 4AQ2A 1CESA 3HD8B 2WS91 4OI0A 3VDDA 1IS6A 4FOWA 2X29A 1EAH3 3M7AA 3VKLA 4I02A 5C33A 2VNGA 2ARBA 2ZGTA 4C0BA 2BW8A 3RQ0A 1SBDA 1ZZ9A 3AP5A 4BLIA 2EXJA 1QJY2 1PGL2 1H9WA 4PQ9A 2UY8A 2GNMA 4K8FA 1W6QA 4JV4A 1VBC1 3QH6A 3TN91 4XQWA 1GSLA 1G86A 1XYOA 3DKWA 4PLOA 4DNYA 5DG1A 1UN1A 3SITA 3T2TA 3UV9A 2VGDA 1A8MA 4FP3A 1IKQA 4IEQA 4BMEA 2D6KA 4IV3B 4Y1YA 3ASIA 4DB5A 2D3RA 2RS33 1QXRA 5F9TA 3WP4A 3V56A 2HWC2 4XPVA 1AR63 4GB32 2KXLA 4LHNA 2JG8A 2E51A 1QJU1 4H14A 2PTMA 5LEJA 2BYVE 2K9ZA 5IK4A 5F1RA 4Y24A 2EF6A 4NWVA 1U0AA 4DQAA 3WOGA 2RE9A 4R9CA 5JI9A 1KFUL 1B35B 2XL9A 1H1MA 2IXCA 1WD3A 2VQAA 3VN4A 2JKBA 3DPRB 1YFUA 5SV8A 2ZX2A 1PO23 3N36A 1GQHA 2A70A 3KLSA 2GH2A 4YVWA 4YGEA 4COWA 4XXAA 1IPKA 1D2SA 1Z7S2 3ZFEB 4AVCA 3AJYA 5FOBB 1RUG1 2JG8C 4FP2A 2D5HA 5J96B 3M2MA 2MNGA 5I0RA 1UKGA 5BPXA 4AQ6A 3ZYJB 3CJXA 1G9BA 3BOPA 3AZVA 5BNQA 5E8AA 1YXWA 1WW7A 1TME3 2B8MA 1OQ1A 3VBHC 3WP3A 1VRH1 3SHRA 3KM5A 4YVWC 1ULGA 3J8F1 1W6NA 4FPCA 3TBDA 1AYM2 3KS7A 2QZ3A 5GJ6A 1NE6A 2UU8A 1HV1A 4AHWA 1AR93 2LTNA 4XTPA 3VKFC 5KXDA 5JOWA 2ZGUA 3ZFFA 2IXJA 2QDNA 4JGZB 4R9BA 1UZYA 2OUHA 1H1AA 2DVBA 3B94A 2BFUS 2D40A 5GLVA 4C0HA 3AMMA 4FPOB 3JQXA 3V0BA 3IM0A 1ULFA 3IDEA 1REFA 4OHXA 5JSPA 2Z2SB 2BQPA 5CFDA 3NJZA 1PNGA 2WIIB 3VBSB 1NQJA 3ZFGA 4HPKB 2JXAA 1F5JA 1AX0A 4SBVA 3ZFFC 4I3PA 1VP6A 4AFAA 3VL8A 2CAUA 1VAVA 4MV2A 3SCHA 5JIAA 2WZR3 2MEV3 1PVC1 3R05A 4RGAA 2ZHKA 4C91A 4Z07A 3WW2A 1WLCA 3ZX7A 3I4IA 2DV9A 2XJTA 3K48A 1AYN2 2XUMA 4ZU7A 4HN1A 3KSCA 2R30A 5CFDC 2MPFA 4EN0A 1CAXB 1EYBA 5KHKA 1AXKA 1G9FA 3AM2A 3ZFGC 1VBE2 3HIFA 3JBG2 4BH9A 1DQ1A 1LHOA 1IGOA 2ETEA 4Q29A 1W6PB 5T50A 3NW4A 2VUJA 1JTZX 2WNVB 3LWCA 2ZMNA 2B46X 1REDA 1S2BA 2A6WA 4FTBA 5GLZA 1POV3 5H9RA 2VPVA 1ENRA 2R041 1PGW2 3KD4A 1O5UA 3CJIB 2Q30A 3UKVA 1ZBA2 4LT5A 3PVNA 4Y1ZA 2XJPA 2A5ZA 3EO6A 2VULA 4RA0A 3PVOA 2XBO2 1VBB1 5CVRA 4LO6B 3HR9A 2DU0A 4Y5Z0 4XJ9A 3AB0A 4QD2A 1PZ7A 3MFAA 5DDJ3 3MW3A 5BNOA 4LTAA 3BPZA 1R081 3H1MA 4Q0UA 1N1VA 4OFGA 1OI6A 1W2UA 2HWE2 1MEC2 2D93A 5SV5A 1GICA 3POSA 4LULA 2D6OX 2X8KA 4W6WA 1XNCA 1MZFA 1FNYA 2FHRA 5AVPA 5HCBA 2XPJA 1IKPA 2ES3A 2NPIA 2DVAA 4HL0A 4XF1A 1RUD1 2EXKA 1V9U2 1H8TB 2DCYA 2O1QA 3LGRA 3SH4A 5BNOC 5LK7B 4XFGA 5FCCA 2XGXA 1AVBA 3BCWA 1COV3 4Y26A 4Z2WA 5D1IA 2MHFA 1BBT2 3AKTA 1UU4A 1FV3A 1RUF2 1GR3A 1R1ZA 4RQPB 3WQ1A 1VLNA 2WLQA 1DQ6A 2A6YA 1WUVA 5A32B 2QNKA 5J37A 1HXS1 5L73A 3M8LA 4BPZA 4M0NA 4PIZA 5H9PA 4YM0A 4MH0E 2GMEA 2KA3A 2HYKA 1QJX3 4IETA 3ELNA 3KGZA 4DY5A 4MXWA 4EN8B 5KHIA 4MYEA 2ZZQA 4RHV1 1EV13 1O4ZA 3WW4A 2RM23 3G7DA 4FOQA 3SLIA 2CAVA 4ZU4A 1JHNA 3MDPA 4WM8A 3ZMNA 3USUB 1V70A 2BWCA 3B02A 1XYPA 3MW4A 1NXD1 2A71A 1DGRN 4FOYA 1GV9A 2Q4SA 4OVEA 4CP2A 3U0ZA 1C8M1 4XHXA 4Q1PA 1BVP1 4QPYA 3WY6A 3E5QA 4N9IA 4XF0A 1SBEA 2EAKA 3B9CA 3NKGA 4FPKA 4JTNA 1U5IA 3MF6A 2HWB3 1RB8G 1Q43A 4LE4A 2H0VA 3ST7A 2BNNA 4M3CA 5GKAC 1GNZA 5JDBA 1YWKA 4IEPA 4FPYA 1SCRA 3MPPG 3T1MA 1GBGA 4HK9A 4WM8C 4EV0A 2XWJB 5I0TA 1WMEA 3VDDB 5DZGA 1HRI2 3GHNA 1SBFA 2C5DA 1W0OA 2XJSA 4FAGA 1OLQA 1S0CA 1ZBE2 1UU6A 2QCSB 4LR4A 4L9BA 3AZYA 2WFF2 3AJZA 1RMU3 1LODA 4URTA 4DINB 4L8QA 2XKPA 2DFBA 1W6QB 1RUH1 3JBG3 3DL3A 1CN1A 1LHUA 5J7MA 4HKLA 1HLCA 1PVXA 3ZMOA 4E4DX 1C3HA 3VV1A 2B39A 3INAA 1VBC3 4HVQA 2Z69A 4MGKE 2RS52 4WM7A 2GZWA 2JG9B 1SLIA 3M3OA 2IFWA 1DIWA 1KITA 2EA7A 2BVVA 4LBNA 2SBAA 1NLSA 4LBJA 3ZXDA 5CG8A 4FTEA 4Z1VA 2GAUA 2GMPA 1PO21 2RR13 3ZXLA 2RMU2 5CFCA 1ONAA 3H3UA 3ZN4A 3WG3A 1BYHA 3LSEA 4OI1A 5IT6A 1O3RA 1X8EA 3OY8A 2FZ2A 5GZGA 2HWF2 1H2NA 3WT3A 4CDQB 1VBA1 2QE3A 2VOXA 4KL1A 3QD6A 4H3WA 4QGLA 3WUDA 2P34A 1QJU3 2DVFA 2NN8A 1MEC3 4D7SA 1GZ9A 2BBVA 3AP4A 1PZ8A 4HSLA 4LHKA 4WM7C 1ZZCA 1MS1A 1UL9A 2EXIA 1R1A3 1AX1A 3RRDA 1CPMA 5EFUA 3QLQA 2RJLA 1J1LA 2C9AA 1BMV1 4QX5A 1JXNA 2YGMA 3DF0A 1MACA 2ZHMA 4QQLA 3N4MA 3VLBB 4CDXB 4YGDA 4N7UA 4QQ2A 3MLKA 2ZX1A 1DG6A 5K9YA 5FOJB 2D97A 1ZM1A 3FWEA 4Q0PA 1WCDJ 1DF0A 2YROA 3RJRA 1ND3C 5K8SA 1VAKA 4GMP1 1HDKA 1QDCA 4AFDA 4R9DA 2FBEA 2BEOA 1LJ7A 1SLTA 1Q3EA 3R4SA 4BOWA 4A7YA 1C5HA 2PLV1 4JVAA 3OGGA 3HWJA 1WCSA 2XJRA 3ALQA 2Q8OA 5K0UC 5FAXA 4Q2FA 4LHLA 1LHNA 5EYYA 1VALA 3H0OA 4P5HA 4LBQA 1VRH3 1KDKA 2E7QA 3IMNA 2P3KA 3RSJA 2DURA 4P9XA 3J8F3 4IV1B 3AZXA 2D43A 3ZFFB 2HEVF 4Q8LA 4ES9A 3WHTA 3WVJA 1R092 2ATFA 2VMHA 1CAVB 3V0BB 4CDWA 1FX5A 5BNNC 1POV0 2IXIA 5DZFA 5KBFA 4WV8A 4CP0A 4EN6B 1QQP3 1TMF3 5ACA2 4TLFA 3S7EA 5CFDB 2AR6A 2DTYA 1MVQA 1V6OA 1JW6A 2OPKA 2YXSA 4XJ8A 2XH6A 4Q4X2 3MLJA 1QOTA 3TB0A 2TBVA 1JYCA 1QJY1 4TYSA 1PGL1 4LBOA 1ALYA 1H2KA 1S0EA 3JB8A 4K3UA 4D7TA 4NPRA 2CTVA 3WX5A 1I1EA 2ZMKA 2K0GA 3HT1A 3ZYPA 2VW0A 2A3XA 1CJPA 4CDWC 1HRI3 3H7JA 4YLZA 1QNYA 5J98B 4CZSA 1POV1 1SEFA 1XNKA 3SNMA 2AUYA 5BY5A 1PVC3 3MYXA 4LLFA 1CAUA 1QHDA 1BK1A 2DUPA 1JH5A 2JX9A 5GLUA 4LA3A 5KXEA 1URXA 1H1IA 4YG6A 4CEWA 1Y3TA 4LUMA 4AVSA 3GHMA 3D0JA 5DDJ1 4YM3A 4BZ4A 3AYAA 3GNEA 3GBWA 3E6BA 1UD1A 4ORFA 1WBLA 4M0HA 4FPGA 1W6MB 3RZZA 1OOPB 2CWMA 3QBQA 2AZ5A 4IEUA 2R043 3NO8A 2YPJA 2F4PA 3I59A 3U10A 5BNOB 1CAWB 3ZXFA 1KD7A 1VBB3 3A4UA 4QPGB 1SLAA 2VXRA 3S30A 1S1AA 1RHI2 1FNZA 1MS5A 3RG0A 1AL22 4WVMA 1ND2B 1R083 3D0SA 4AEDA 1COV1 2AREA 5IUQA 2GN3A 2UWAA 4YW3A 3ZXAC 4AHZA 3N35A 1QF3A 4GKYA 1CONA 4BIFA 2VY0A 4B8EA 4J1WA 5FTTC 2WKKA 2VVFA 3KMHA 1C1FA 2DCTA 3EBRA 4OUMA 4AHYA 1MZEA 3P3NA 1XQNA 5D8AA 4KG8A 4OI2A 1S0FA 1IOAA 3FE5A 2B5HA 4QT6A 1QJX1 1HX6A 2ZGMA 4Q4V2 1RUD3 2XVGA 1EV11 4R4XA 3U4XA 1S0GA 1QMJA 4AVVA 5ABJC 4AEDC 4AFBA 1PIV3 4YM2A 3R0RA 3P3PA 1FOD2 4W6YA 4XFBA 2DCKA 4QM9A 3WDXA 3AP6A 2D3PA 4YW2A 2DFCA 4XW3A 1AR73 4MGIE 5BNPB 2QJVA 4YFZA 3GZAA 3JQWA 4MXWB 3PJYA 5D8AC 3M3IA 1OMIA 1VB2A 1YFYA 2GALA 2HWB1 3NV3A 4YW5A 4P9WA 5E88A 4QXKA 4DRRA 1QY4A 4WM8B 5FO9B 1IS3A 1DGRA 5AC92 2D6MA 1J1TA 4RHV3 4F8AA 1WW5A 1DZTA 3FMGA 3HBZA 5FFOC 1LGBA 3VBRA 4IQPA 4XE9A 1AR83 1UU5A 4V1PA 4KGGA 5L7OA 1LECA 4GH4C 2BWAA 1FMD3 2BGCA 2ZA9A 1PM7A 3QOPA 1C8M3 3RMXA 4ISQA 4BMBA 1AYN1 4MGYE 4ES8A 1RMU1 4KWLA 2ZGOA 1YI9A 1UIJA 2ZGKA 3VZOA 2B9UA 1YIFA 2YYOA 3JBG1 1PK6A 1LEDA 3CO2A 3FX3A 3WUCA 3WQ7A 3NV4A 4CEYB 4COVA 2ZKLA 3LOIA 5FBZA 2H0BA 3AXEA 3K51A 3VBRC 1Q8VA 3GBGA 2P17A 4QM8A 2VMIA 3AKQA 4GIQA 2OA2A 5LEKA 4YM1A 3KQRA 2VOVA 3ILNA 5L7OC 1ZX5A 2ENRA 4MSVA 3EJKA 1I6XA 1ZBA1 2WT1A 3NL1A 5GZCA 3PNAA 1D4M3 2JECA 5A3MA 1YIPA 2RR11 1PMIA 3IDBB 1XYNA 4Q4Y2 1TQ5A 2D6NA 4YG0A 2I07B 4JC1A 1PK6C 3AK0A 4NVPA 1RUH3 4PLNA 1DU3D 2ZTNA 4L92A 1MEC1 3BOWA 3RYPA 1O3TA 1X33A 5BV6A 1YFWA 2BNOA 2NYYA 1OA3A 1Z0HA 2FZ1A 4O9EA 5CFCB 4I0AA 2E53A 3HMYA 4AVAA 2C0ZA 1R1A1 3OY8B 2ZGNA 3SCFA 4CDUB 2WC2A 4XILA 4YZ3A 1V9U1 3VBHA 3WDWA 3ZXEA 4BM8A 3WCSA 3M3QA 3VBUA 1XNBA 1LULA 1VAMA 1YCIA 5I0UA 1O91A 4R4ZA 4N7IA 2X53S 4JDNA 1X82A 1VBA3 5C8WA 4YVSB 2Q1MA 4R52A 3M70A 2RJKA 3H8UA 3WP5A 1BBT1 4P9LA 4EN7B 4E4ZA 1CR7A 5TSWA 3MIGA 3ZXGA 5I8TA 2NM1A 3IWZA 4XBQA 3CL1A 1E57A 1LENA 4AG4A 5LRRA 2DTWA 5KXCA 1H9PA 2I2SA 3OCPA 2R32A 5J3UA 3N7LA 5I8SA 3RPQA 1IS5A 1BQPA 2QQPA 5KC6A 1YUDA 5BXXA 3VBUC 3WDUA 2W52A 2IXLA 3ZN6A 4XTMA 4X6RB 2PHFA 1RVF2 5F6KA 2JDZA 1EY2A 4AI1A 4GMP3 1RGSA 5A33A 1V6MA 5C4WC 5I0SA 4RS5A 3SH5A 4ITCA 4LEJA 4XJWA 4LBQB 3HN1A 2VMGA 4G4FA 2HEWF 3AP7A 1QQP1 1TMF1 2PLV3 3RMYA 1BVVA 3J9SA 4AQTA 3RYRA 4XEZA 1W6OB 2WQZC 4LA2A 2XKOA 3VHRA 1JUHA 2Q0AA 3ZYRA 4AXOA 4AVBA 1RUC2 1JBCA 2X5IA 1ASJ2 3DN7A 5FQ0B 3KGLA 4XBLA 4EROA 3EHKA 5FDBA 4U2AA 2ZGQA 1HRV3 1HRI1 4YRDA 4RS5C 2WNEA 3FFZA 4UBGA 5C8CC 1NCRA 1MS4A 5JR7B 2XL7A 3ZSEA 3PJQA 4IEYA 2WFF1 1FI2A 4HK8A 1OFNA 4IEOA 1RUJ2 3MGUA 1F2NA 3UKNA 4JGYA 4PBOA 5IK8A 5FMOL 1O4YA 1VBD2 1KDMA 1QJY3 3OBRA 4AK3A 1KFXL 2X5IC 2VH9A 1NA1B 2RS51 1EPZA 4N53A 1YNAA 3AZZA 1CVNA 3E6CC 2XHKA 2JJ6A 1NCRC 1ZRRA 1ULDA 2PHUA 4AI2A 3ZVXA 2CV6A 4HANA 4YZ5A 3MICA 2WS92 4FPFA 2RMU1 3ZSKA 2XJQA 4CEWB 1ZRCA 2EALA 1MZ5A 4JGYC 2GMMA 5AFBA 1C57A 1FXZA 4X6QB 2HWF1 3B9IA 3ETQA 1A78A 3WDTA 2HWC3 4OHWA 1X36A 4GB33 4QQHA 5J48A 2VVDA 2XJVA 4Q26A 5KWRA 1QKQA 1ZYBA 2EXHA 1PO12 3E97A 4N43A 3W59A 1SDWA 3M4FA 2B45X 4N53C 3VBFA 1M4WA 5H9QA 3WXPA 1NY72 3TN92 5GM0A 1W0PA 2PN5A 4EJRA 2EAAA 2GDFA 2WNUB 2A73B 3BIWE 3MLLA 3VZKA 5C9AB 1LOFC 3I59B 3I54A 3ES1A 1GFF2 2TUNA 2D3SA 4ISRA 2DUOA 4WBBA 3MEPA 4Y20B 1L3JA