1FX5A

Crystal structure analysis of ulex europaeus lectin i
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
240
structure length
240
Chain Sequence
SDDLSFKFKNFSQNGKDLSFQGNASVIETGVLQLNKVGNNLPDETGGIARYIAPIHIWNCNTGELASFITSFSFFMETSANPKAATDGLTFFLAPPDSPLRRAGGYFGLFNDTKCDSSYQTVAVEFDTIGSPVNFWDPGFPHIGIDVNCVKSINAERWNKRYGLNNVANVEIIYEASSKTLTASLTYPSDQTSISVTSIVDLKEILPEWVSVGFSGSTYIGRQATHEVLNWYFTSTFINT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords ANTI-H(O) LECTIN I
publication title The 2.2 A resolution structure of the O(H) blood-group-specific lectin I from Ulex europaeus.
pubmed doi rcsb
total genus 57
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fx5A00
5GZDA 2ZHMA 3AX4A 1GYKA 1HLCA 2ZAAA 1MS8A 1LOAA 5FRAA 4LBNA 3SH3A 3I8TA 5E8AA 3SITA 1GANA 3WUCA 4CZSA 1UKGA 3OPZA 5GM0A 1VALA 2ZHKA 2P2KA 5IK8A 4GKXA 3L2YA 4BPZA 3OJBA 3V0AB 2JJ6A 1N1TA 4AGVA 2A6XA 1ENQA 4MYEA 3ILNA 3VKLA 4ATFA 3V0AA 3POYA 1W0OA 2R49A 2D3RA 4DRVA 2P3JA 2A3YA 2E7QA 3WDUA 1CQ9A 2W52A 1JN2P 3POWA 1W6PB 1V6NA 2LTNA 4HANA 2VW2A 4XXPA 2ZKNA 2CY6A 2JDZA 4XJAA 4YZ5A 1GLHA 1G9BA 1UPSA 3ZSKA 2AUYA 2UWCA 4Y22B 4GWNA 4UW4A 3N7LA 3ILFA 3SISA 1LJ7A 1GKBA 4M3CB 2V73A 1ENRA 1OQ1A 2A7AA 4XDQA 4FVVA 4YGDA 1QMJA 4W65A 2EXHA 1S0DA 2UWBA 4P9WA 4AWDA 2DTWA 1GZWB 4FPLA 3ENRA 1LOBA 2ZABA 3SH5A 4Z8BA 1LENA 1W6NA 4I30A 4U2AA 3WLUA 1N3OA 1GV9A 2P3IA 4XILA 3VKMA 1G9FA 1FATA 1Q8PA 4ZKTB 3ZSMA 3IPVA 3USUA 3OYWB 3WCSA 3GALA 3Q9OA 2D6PA 3N7KA 3U4XA 1ULFA 5JOZA 1V00A 1SBEA 5T55A 2WT0A 4YZ4A 3KM5A 5DZEA 5CAZA 3M3EA 1HQWA 1LHNA 4FQ4A 2D6NA 2D7FA 4Y1UA 1AJKA 2D3PA 1KDMA 3V0BA 2ARBA 2NZ9A 3B00A 1MZ6A 4AGRA 1KJRA 4XIOA 4DPNA 3WHTA 5F9TA 4XBQA 1N1SA 1DLLA 1MS4A 1V6OA 2ZMNA 2H0BA 3BOPA 1WD3A 2GN7A 1MVQA 1UAIA 3NV2A 2DUPA 4WVVA 5JOXA 5GZGA 1DZQA 4DRRA 1YIFA 1SCRA 3A4UA 2TEPA 1DQ1A 1DBNA 1LESA 4PQ9A 4BM8A 3W58A 1MZ5A 3WZ1A 1A8DA 1YYNA 2EXJA 5KXCA 5KXDA 1QOTA 1WW6A 2Q5TA 3RSJA 4YGBA 4Q8LA 4FPJA 2A6YA 1S0FA 4PBPA 4PBOA 1DFQA 2AR6A 2JE9A 4HL0A 2W08A 1FNZA 1QGLA 3KQRA 3UL2A 1Z0HA 4Y1XA 2R1BA 1ZA4A 1SLBA 1DQ5A 1D0HA 2WLQA 3WNXA 4Y1VA 5T5PA 3B01A 5KXEA 4PCRA 4JRAA 2NM1A 2R1DA 1VLNA 1GZCA 3AZVA 2NMOA 2A75A 3T1MA 2ZGQA 4XMIA 4CTEA 1O4YA 5IUQA 4TZDA 3B3QE 1DHKB 1R1ZA 4CRQA 3WDWA 1KDKA 3WHUA 2A71A 1YO8A 3OBRA 5JDBA 3FBYA 4GXLA 2OVUA 5T5JA 1HQLA 3LSEA 2ZGLA 4LBMA 1WUVA 3R4UA 1O4ZA 4ISRA 1QDCA 1BJQA 1WBFA 1ULDA 1X50A 2P37A 2ZGMA 3DUIA 3IN9A 3AJYA 4FPYA 3VKNA 3WG1A 3WUDA 1ONAA 1A78A 1Q8OA 2WT1A 4FPKA 2ZGTA 3AZYA 4YW3A 5BYNA 1GSLA 1SLTA 1DQ6A 3A0KA 3ZXEA 4YG6A 4JCKA 2VY0A 1LECA 1D2SA 1AVBA 1B09A 2XG3A 1FV3A 2GMMA 1S0CA 2ZHLA 2OUHA 4K20A 1RIRA 3AYDA 1F5FA 4YG3A 5GLUA 1MVEA 4L8QA 2A5ZA 2EALA 3AJZA 2R0FA 1CVNA 1N1VA 1WD4A 4FOQA 4XE9A 4Q27A 1GZ9A 4YZ2A 4FP3A 1PZ7A 2DV9A 1G9CA 1FX5A 3A0NA 3MW4A 1JXNA 3UJQA 1VAMA 2OUJA 3UK9A 4FPOB 3IPVB 1A3KA 3MW2A 3NV4A 1G9AA 1LGCA 1H9WA 3N35A 4FQZA 1G86A 1DQ4A 1PZ9A 1QNWA 1XQNA 5DZGA 4BLJA 5CNAA 1WLWA 4P9YA 1SCSA 1VIWB 1SLCA 1YI7A 3ZSLA 2ZGRA 1WW7A 5DUUA 1LOEA 2VUAA 1HDKA 4LBQA 1JYCA 3LCPA 1LU1A 2PHRA 1G7YA 1W6MA 2EAKA 4Q8KA 1MS5A 2NMNA 3V0BB 1WLCA 2DWRA 1S1AA 2ERFA 4ITCA 2GALA 3HR9A 2GMEA 5CB7A 2R16A 1W0PA 3W59A 2E51A 4RL7A 3NV3A 5GZFA 3B69A 1N3PA 3QCWA 1FAYA 5H9SA 4XJ9A 1LU2A 2DUQA 3AZZA 2VW1A 1LOFA 1V6MA 1FYUA 3AK0A 4RA0A 5T5LA 5T50A 3V65A 2ZHNA 1S0IA 1LHWA 4BOWA 1OKQA 2UU8A 1WW5A 4R9DA 3R05A 3M3OA 5LK5A 5JOYA 3AXEA 2AYHA 3FLPA 3T2TA 4LBQD 4DS0A 4K1ZA 4WV8A 2WKKA 3CNAA 1MS1A 1KQRA 1H30A 2ZA9A 1LHVA 1JOJA 1MS0A 1BKZA 1I3HA 3MEPA 3ASIA 5FREA 2BQPA 3PVOA 2GNTA 4ZXKA 1IS4A 1H9PA 1MR5A 3POSA 5GLTA 4R9CA 2DVBA 2EF6A 5SV8A 4AVVA 4D69A 1N3QA 5H9RA 4ASMB 4BMEA 5GZCA 4XMAA 2PHFA 2VXRA 1Q56A 1KJLA 3N3HA 3TAYA 2D6MA 1WLDA 2ZGPA 3BIWE 1S0BA 4PF5A 4XJWA 1W6OA 4Y24A 1J1TA 2YY1A 2ENRA 4XTPA 3T1LA 2NN8A 2C9AA 3ILRA 2YV8A 3ZSJA 2JD4A 1HKDA 5CA6A 4FP2A 1IKQA 3JU9A 5T5OA 4Y20B 4FPCA 5JLVA 1S0GA 1CPNA 2GNDA 3VKOA 1LOGA 2EIGA 4FOWA 3V64A 2VH9A 3ZYRA 1QOOA 4LBOA 1IS3A 3OBTA 1BZWA 1DYPA 4YM0A 2AH2A 1Q8VA 1WW4A 2AGSA 3ZXFA 3O0XA 1AJOA 2GMPA 4LBLA 4YM2A 4XHBA 1QF3A 1RITA 3AYEA 3C2UA 4YLZA 5T54A 4DFSA 2DVFA 4GALA 1SFYA 3AP9A 4JC1A 1IOAA 1UMZA 2NYYA 5GLWA 4UW6A 1AXZA 4AVSA 1UX6A 3I4IA 1CESA 3H0OA 3O0VA 3NWKA 5HCBA 1YRZA 2DTYA 1DQ2A 3DGTA 3AZXA 2ZACA 2D6KA 4UW5A 1ENSA 3ATGA 2ES3A 1AF9A 2ZGKA 4YW5A 2WSVA 1YXWA 1U0AA 3GNEA 5EWSA 1C1FA 4YG0A 1LGBA 4YW4A 2SBAA 4LBJA 5H9PA 1JUIA 5IK4A 1F9KA 4C1WA 4H55A 2P34A 3WDTA 3M1HA 3O12A 1AX0A 2D44A 2A3WA 3IMNA 1S0JA 2VW0A 1ZM1A 1Q8QA 3AP5A 4AYUA 4YZ1A 1QKQA 3RS6A 1JW6A 2ARXA 2PHTA 4BLIA 3NV1A 4LBQB 4FPGA 2ZBJA 1W6MB 1S0EA 3WG3A 1N1YA 4M3CE 2DU1A 2D6OX 3OGGA 4GWMA 1WBLA 2DYCA 1PZ8A 1AX1A 1CIWA 1CONA 2DVGA 2Z42A 3LSDA 2ZMLA 3IKWA 2GN3A 3AP4A 3OY8A 4XZPA 1W6QA 1W6NB 2W68A 3RG0A 2PHUA 4M3CF 1C1LA 1DGLA 4XHXA 3FLRA 1LTEA 1GICA 1DYKA 2YZ4A 5H9QA 3FLTA 2G4IA 1LULA 2E7TA 3ZYPA 3USUB 2ZGSA 3N7JA 2PHXA 4LBKA 4YGEA 2YROA 5KXBA 1UZYA 3N36A 2ZGNA 5T52A 3JUUA 4FPEA 3FFZA 3UJOA 2UWAA 1V6LA 3AP6A 4IQPA 1NLSA 2HYKA 5IT6A 2YXSA 1MS9A 3FUOA 3M3CA 4AVTA 4M00A 4NO4A 4Q2FA 3WDYA 4XJUA 1ULEA 1AXKA 1SLIA 1LHOA 1MS3A 4FOYA 5F5QA 3BTAA 4R9BA 3AZWA 3RMXA 1Y7BA 1SLLA 3ZPYA 4KBBA 4XXAA 2E53A 4YM3A 2GNBA 2ZMKA 1BYHA 3AXDA 4GKYA 2FMDA 1LGNA 1URXA 4Q26A 1AZDA 1UL9A 2EXIA 4WZFA 5L73A 2UURA 2LALA 5GLZA 4Q1PA 1BQPA 1GNHA 2W39A 4XIKA 2A3XA 2CWSA 3VKFC 3M2MA 4WVWA 3ZXJA 3N7MA 4YW2A 4NOTA 1Q8SA 1MACA 4K21A 5EXOA 1W6OB 4R9AA 5HCAA 1QDOA 2VU9A 3RMYA 5DXDA 4ATEA 1IS5A 1V6JA 2WNEA 2CYFA 1CR7A 3D4KA 4SLIA 2WJSA 1JHNA 2ZZJA 1UZZA 2CTVA 2AENA 4FPFA 1GNZA 5DG1A 3WDVA 3APBA 1NXD1 2V5YA 5DZFA 1DQ0A 3WDXA 2E6VA 1AXYA 4M01A 1TEIA 1LOCA 1LEMA 3HMYA 3MPPG 4P9XA 3SH4A 1FNYA 2WSUA 5GZEA 1UN1A 2OW4A 4OZXA 3MW3A 4XTMA 2B7YA 2A6ZA 2I2SA 5DUXA 5CBLA 1G8WA 2P3KA 3WG4A 3HN1A 5JOWA 1RINA 1C57A 4Y1YA 2JECA 2GDFA 4DQAA 1W6PA 3B9CA 5JMCA 2D43A 3ZVXA 2D3SA 4Y1ZA 4F83A 1CN1A 1QU0A 2AREA 2CL2A 1DIWA 4TYSA 4XJ8A 4Y22A 2A70A 3QLQA 1LOFC 2DVAA 1Z78A 5GJ6A 4M3CA 2EXKA 4FOVA 4YZ3A 5HCFA 3D5OA 3R4SA 3O0WA 1GZWA 3ZXKA 3AFKA 3RRDA 1N47A 2FHRA 1IKPA 5EYYA 1BXHA 1CPMA 1LODA 2WQZC 1FV2A 3OYWA 4XBLA 2ZGUA 3WOGA 3WVJA 3WV6A 1LHUA 4Q1RA 1C4RA 5EYXA 3RQ0A 1JBCA 1KRIA 1SACA 1JYIA 3VUOA 3PVEA 1G9DA 4K1YA 2DUOA 3BODA 4GA9A 5JVVA 2JKBA 1V6IA 1LCLA 2CWMA 2XB6C 5AVAA 2YMZA 3AP7A 5IK7A 1APNA 3M3QA 3PMEA 3OY8B 2R0HA 2SLIA 1W6QB 5DUWA 3D6EA 3IM0A 1ULGA 1IS6A 4Y26A 2A6WA 1V6KA 1SLAA 2JE7A 3SLIA 3O5SA 3AYCA 4YM1A 2PELA 3ZXLA 5E88A 4XBNA 5IK5A 4ISQA 4YW1A 3AYAA 4YGCA 1SBFA 3WCRA 4C1XA 2CNAA 2KM2A 1F31A 1OFSA 4XYXA 4AGGA 4UW3A 2DVDA 1QNYA 3TB0A 3VV1A 1KITA 1VAVA 2PHWA 2ZGOA 2DU0A 4BMBA 1WCSA 5GLVA 4P14A 4YFWA 2A6VA 2RHPA 1ULCA 3WG2A 4BQ1A 1GBGA 1LEDA 2WT2A 1AX2A 4Y20A 4XJZA 2NP0A 1CJPA 1QOSA 3FUQA 5DUVA 3PVNA 4U36A 5GALA 4XOGA 2GNMA 1EPWA 5DG2A 2DURA 2C5DA 3PJQA 3INAA 3SNMA 4YFZA 2D6LX 1SBDA 4FPHA 1I1EA 5E89A
chains in the Genus database with same CATH superfamily
5DAVA 1S2BA 1S2EA 2W95A 2Y6GA 4NPMA 4ZPIA 4I3PA 3OGRA 1NZCA 5E8AA 3MYXA 3VBUB 4F8AA 5KC6A 3HPNA 4RQPA 5G04L 2V09A 1QIQA 1HJFA 2XXZA 2XHNA 3Q8CA 4NUBA 5FPUA 5IK8A 3L2YA 4BPZA 4EROA 4CXYA 3FX3A 1CAVA 4GMP3 2Y0OA 4GMP1 5FBZA 4QGNA 2RM22 1HIXA 3TNPB 4Q4Y2 4L0PA 4ATFA 3POYA 5FZFA 4AEKA 4NHKA 2R49A 5CFCB 2LRPA 2PAMA 1XSRA 2W52A 2VTFA 5A7QA 3FL7A 4FAHA 1K5MB 3POWA 1O3RA 3SMHA 2JDAA 4R4ZA 3HIFA 1HRV2 1R091 4HANA 1QH6A 1JZ7A 4XXPA 2JDZA 3T2PA 1GLHA 3VBSC 1D0GA 4W50A 4DO0A 4GQ7A 1LJ7A 3IZOA 4M3CB 1NA1A 4EWDA 1ENRA 1OQ1A 3J9SA 1QMJA 2EXHA 2UWBA 3WNLA 3K2OA 1AL22 5FYCA 4EZ4A 3VDDA 1WCDJ 2DTWA 1NCQC 1DGWX 1REDA 1VBC3 2ZABA 2ZEYA 3AVSA 1LENA 1HRI3 1HRI1 3D8CA 4MXVA 1CAWB 1IPSA 3NKGA 1FATA 1FI2A 5F5CA 2JEMA 3RGBA 4ZKTB 1KD7A 2VPVA 2XWJB 3HNBM 1OOPB 1Y3TA 2Q0AA 3GALA 3MGUA 3Q9OA 4YARA 2XLAA 3VB9A 5DAWA 3N7KA 1ULFA 1IZ3A 3H50A 5BNPC 1VBE2 1V00A 4N43C 3P5BA 5F2SA 5HCHA 2WNOA 3AFGA 1TZOA 4HONA 1HQWA 1LHNA 3CEWA 4FQ4A 2D6NA 1C8M3 2D7FA 2D3PA 4I01A 2ARBA 2JENA 2R043 1YCIA 2X5IC 1HB2A 4QKFA 4NHLA 5I91A 4DPNA 5T3NA 2VMCA 3WHTA 2XQRA 1N1SA 4AQ6A 4QQOA 1UOFA 1V6OA 4LO8A 1D4M3 3NV2A 3O1OA 5JOXA 1D4M1 2PFWA 2Q4SA 1JMUB 3POJA 1YIFA 1SCRA 3FFQA 4UXAA 3LIGA 5CKMA 5ACA2 2X8KA 1VBD3 4CYDA 4DB5A 4UWDA 1JI6A 3DN7A 1VMHA 4BM8A 5IW0A 1QHDA 3DV8A 3VBFA 3F95A 4E8DA 2OYZA 1YYNA 3CIHA 2ZX0A 5C9AA 2EXJA 3H8UA 5KXDA 2W5FA 1FPN3 1QOTA 2VGDA 4GWJA 3L2HA 1FPN1 2XMLA 5A32B 3RDIA 5I0RA 2GP5A 1WMEA 2VULA 3PJYA 4Q8LA 2RDQA 1S0FA 2Z5WA 1PM4A 1ZZ8A 2HWF3 2AR6A 2BOIA 2FCVA 3UESA 4UBHA 2W08A 5FTTC 3D82A 2ZEZA 1FNZA 1QGLA 3UL2A 1Z0HA 2R1BA 3K77A 4A7KA 1DQ5A 4MSVA 2YBSA 3WP6A 3THPA 3MICA 1XBFA 3B02A 4IEUA 5A7NA 2R073 3OG2A 2RS31 2NMOA 4ZY9A 3ZIWA 3K4DA 3KCXA 2Y34A 2JIJA 3UGFA 4D8MA 2WBKA 4TZDA 3B3QE 1R1ZA 5FZDA 4AQSA 1KDKA 5CG8A 4NMIA 5EJZB 1YO8A 4RQPB 4QXHA 1Z7S3 4RYDA 4YRDA 4EE2A 5JDBA 1RUD1 3CZJA 4NN0A 4H3WA 4HK8A 2ZGLA 3D0JA 2XL7A 3U4SA 4MHUA 4PI0A 4AI1A 2JICA 1BJQA 4BHPA 2P37A 5JIUA 3WG1A 4Z2WA 3MFCA 4ZS2A 5K4LA 3VDBA 3JB8A 1Q8OA 1UMIA 1HX6A 3ZDSA 4FPKA 1YFWA 4D6RA 3ZIXA 3GBFA 4YVSB 4PT6A 5BYNA 2OA2A 5C8CC 3A0KA 1FMD3 4JCKA 4J6GA 2P6HA 5AC92 1AR63 1S0CA 2BGOA 1AR61 4AHYA 3AYDA 2RS13 5JXHA 2OZ6A 4MH0E 1NA1B 2RS11 1MVEA 4L8QA 1R1A2 3B5LB 2RS51 4SBVA 2VXJA 2HWC3 2EALA 1PO13 2R0FA 4LITA 2A73B 3FHAA 4LE3A 4RFT0 2WZR1 4XFBA 1GZ9A 1BBT1 3VDDB 4URAA 5K9YA 1VBA3 3PNAA 4C0BA 1VBA1 4PIXA 1ASJ2 4PLMA 4OI4A 1RUC2 3MV01 1RYYA 4CXWA 4IETA 5F5IA 2FDKA 4AW7A 3UK9A 1P8JA 4K6BA 2PYTA 1XYOA 4FTBA 4YW7A 1SQ4A 5DAPA 2MHFA 5L9VA 1V9U1 4P9YA 1SCSA 1VIWB 3ZSLA 3PHMA 5CVRA 2VZ1A 3ABZA 4S2DA 2VCMA 1JYCA 2WINB 4LLOA 1G7YA 5C7GA 3KT1A 3TOJA 2NMNA 1AHSA 5JUVA 3H7JA 3MIEA 5FPAA 1RJ7A 4K40A 1O59A 2ERFA 4ITCA 4DINB 3HR9A 2GMEA 1UU6A 5CB7A 1W0PA 3ACFA 1PMJX 3EB7A 1XOYA 2E51A 4P5HA 4RL7A 2WFPA 1EV13 1YI9A 4EV0A 3MBWA 1HW5A 1F4HA 1LU2A 2DUQA 3SHRA 4OZOA 3S0MA 3AK0A 4LOTA 1G6NA 1YJLA 4NHXA 5KR7A 4P00B 2UU8A 2R7EB 4CXXA 1F4AA 5B4NA 5JOYA 3SCFA 5C9AB 3AL6A 1XNAA 2AYHA 1PMHX 3UYJA 1OH3A 5C3QA 4DS0A 1C8NA 1XNCA 2JG9A 3CNAA 5C4WA 4UYBA 2ZX4A 1DP0A 4NVPA 1KQRA 3JQXA 1H30A 2ZA9A 3BKZA 1I3HA 4QX0A 3MEPA 5FREA 1IS4A 1H9PA 3POSA 5FLJA 2EF6A 4AVVA 1UY3A 4AL9A 5H9RA 1H2KA 3PIJA 3CHXA 4AI0A 2ADEA 4BMEA 4L11A 4CUGA 2ORXA 4QPGC 4LNVA 1VB2A 5CIRA 4AOCA 4WVMA 3TAYA 2D6MA 2K9ZA 1SPPA 1OMIA 2ZGPA 3BIWE 3AKTA 4GD4A 4PF5A 2WA4A 4XJWA 1GQPA 4H14A 1QJY1 2XJVA 1U5YA 2ENRA 2FD8A 3ACGA 1EAH2 1VRH1 2C9AA 2YV8A 3ZSJA 2XVGA 2G19A 3TBDA 4NWWA 1R083 4RR3C 1GP5A 3JU9A 5FXXA 1JYXA 4LIUA 4FCAA 4DXRA 4Y20B 1R64A 1H1MA 3VLBB 1OVSA 3WINE 4INDA 3VKOA 4KWLA 2C1FA 1RMU2 1CJDA 1EUTA 2VH9A 1QJZA 2QQOA 3ZKUA 3NAPC 3IMMA 3AVRA 1UY4A 5FZOA 5EIYB 2AGSA 4DOUA 4LBLA 4XF4A 4MGQA 4XHBA 3J7LA 1AYM3 1RITA 3AYEA 3C2UA 5T54A 2W1UA 4EN9B 4MG2A 4GALA 4AVBA 1IOAA 2QVSB 3MLKA 1ND2A 5FJHA 3ZXGA 4BQXA 5A6ZA 3O0VA 4DY3A 2W46A 4IUGA 3VBHA 2PLV3 1QXRA 1RXGA 4UW5A 5FO8B 2WZPP 2VOVA 3KF5A 2WS93 5JPMB 2D97A 2WSVA 4DEQA 1U0AA 2XH6A 5JXIA 4IE5A 4YW4A 1AR73 4K7JA 2RMU3 4LBJA 2ZAHA 5HXMA 1UPIA 1YNAA 2TBVA 4CCEA 3G6JB 5LWBA 3AKQA 2IXHA 2QQKA 4X6RB 3PLQA 1Q8QA 4AYUA 2F4LA 4S2HA 5K0UB 1JW6A 4ONUA 2PHTA 2QCSB 4EQVA 3NV1A 4Q4V2 2P3YA 3RI8A 4FPGA 4KGQA 3VD3A 3VD7A 1L7RA 4LPLA 1X9PA 4LJHA 4Z2AA 1S0EA 3SKVA 4E4SA 1BK1A 3ZMOA 4GWMA 2FDJA 4FT8A 5A3MA 3OF1A 4ES8A 4QD2A 1CIWA 4RA0A 1CONA 1US2A 1Y43B 3M7AA 4CCKA 4B1LA 1R092 1Y4WA 1W6NB 2W68A 1D4VB 3VBSA 1GOGA 1UX7A 3BTYA 3U75A 4L97A 4KBZA 2VZQA 1GICA 2YZ4A 5FO9B 2VE1A 5H9QA 3VBRC 5IVEA 4CUAA 4LA3A 1LRHA 1PO21 1Y9GA 4GWIA 2ZGSA 2E9QA 3USUB 5LCWL 1JOPA 4WM8A 1YFYA 2G9GA 4NAMA 5JIAA 3IWZA 5FY4A 5FY5A 4W6WA 1JTZX 4FPEA 4MV2A 5F6LB 5LEJA 5FUNA 4PIZA 2UWAA 5A3PA 2YXSA 2TNFA 2JG9B 3M3CA 4IEPA 3ECQA 4AVTA 1ACCA 4CEYA 5FK7A 2VOXA 1T6GC 4YW6A 1JYTA 1LHOA 1OD3A 4FOYA 4P02B 4GH4B 4R9BA 1JZ5A 1NYWA 3HJRA 1SLLA 2JIGA 5LB6A 3ZPYA 1QQP2 1GWLA 3LA3A 3LEGA 2GNBA 2ZMKA 1BYHA 4CU6A 2FMDA 2IUWA 2HKXA 1URXA 5IJRA 3O1PA 1E5HA 3THCA 3T2OA 5JSOA 1HN0A 2LALA 3PUAA 3GYDA 2A3XA 2WZEA 5C3RA 3HD8B 3K46A 3M2MA 5LRRA 3VKFC 4A42A 1SPPB 3N7MA 4YW2A 3LEKA 1MACA 2RDNA 2CGNA 4K21A 2YGLA 2FBEA 4AEJA 1K12A 4TLGA 5HCAA 4IV3B 3D0SA 3LF7A 3FWEA 2QNKA 2QQVA 4XPVA 4D94A 5FMOL 1XJAA 1YIPA 2PQSA 4IE6A 4MGSA 4BA6A 1CR7A 4N53C 4Q4W3 2VBDA 4SLIA 3E6BA 4GULA 1DDLA 1OSGA 1ST8A 3LDRA 5DG1A 1GNZA 3APBA 2CAUA 1NXD1 2V5YA 5DZFA 2VQAA 1AXYA 3B9IA 3C7GA 3DYMA 5CZKA 4HG6B 2WSUA 2OW4A 3LGRA 2GSYA 3LB9A 5FZOB 3OTFA 1E5RA 2WL1A 5F37A 2NPIA 2I2SA 2XJQA 5CBLA 2VAUA 5L36A 3IDEA 3ZYBA 1DU3D 2IFWA 5JOWA 2ORZA 1C57A 3I2JA 3I3QA 3S7IA 1W6PA 1JU3A 4LORA 4QB6A 3OEAA 3VBHB 4Q0SA 1HXS2 3WW3A 1ZVFA 1HRV3 1W2OA 4JGZC 4QKNA 1MQTA 5DABA 3EQEA 4BXSV 4E8CA 5K7PA 5LW9A 1POV0 4LTAA 1AYN3 3RYKA 4E27A 4BDVB 3R4SA 3HT1A 3I97A 4CPBA 5FK8A 3THTA 1UKRA 3KT4A 4XF1A 2EIEA 1H4HA 1ZYBA 3H1YA 4KMQA 3RWKX 1CPMA 4G4FA 4BQ5A 1RUD2 4M0HA 3R0RA 2K0GA 4Y5TA 1FV2A 1Y9MA 3HT2A 5J7MA 2D98A 3H1WA 2A1XA 5AFBA 1VB4A 4XETA 4LKFA 1H2NA 4CCNA 5EYXA 1UO9A 3RQ0A 1HV0A 5CISA 5KBFA 1JBCA 2BZDA 4TN7A 1BMV2 1SACA 2R30A 1RGSA 2JDKA 4MGYE 4QT6A 2AEYA 5AVAA 1ZBA1 2R0HA 3VBSB 3D6EA 1SDDB 4Y26A 2BTVC 1GFF2 4LE4A 3O5SA 2Y26A 1OUXA 4YM1A 4BQ3A 4OUEA 1RUI2 2QE3A 4LK7A 4IV1A 4AFMA 4OQ9A 3DPRC 4WM8B 5BV6A 2VNGA 1IGOA 2R32A 3AYAA 2RDSA 4YW1A 3S5AA 2RS52 4EWAA 2KM2A 4PI2A 1RL3A 3JD73 5K8SA 2WZR2 3QOPA 4IESA 1YQ2A 5FYYA 2GU9A 1ZRRA 2Y60A 4FSJA 1VAVA 2PHWA 2ZGOA 2DU0A 4CEYB 5C3PA 4BQ1A 1PX4A 4A7YA 3GZAA 4Y4YA 3BPSA 3VGIA 1UXXX 4Q0PA 3H8XA 5IVCA 2WT2A 2CHHA 2QTWB 2NP0A 1QOSA 3I3EA 3FUQA 4DUVA 3ZYGA 4QX7A 1CZSA 4V1PA 2E33A 4XOGA 2GNMA 2VC9A 5C71A 3GZUC 3DF0A 1WA6X 3KD4A 2DURA 2VNRA 3DKQA 3H1MA 5FYBA 3ZMNA 4YFZA 1AR82 2UY9A 3THDA 4AHXA 1DZRA 2XJUA 3PUIA 3ZSEA 2HWD3 1B35A 1H1AA 3O1SA 2HWD1 2BRTA 3AX4A 2Q30A 1MS8A 1W8ZA 1RC6A 5BNNC 4AI2A 5FRAA 1K42A 4DEVA 4IE7A 1IPJA 1PIV3 1ZRDA 1PIV1 3CU7A 3LA7A 1UMHA 2DCKA 3MHZA 3NO8A 2DDUA 2GC3A 2XHKA 2VZOA 3J8F1 3ZN6A 3ACIA 3F2ZA 4B4RA 4LULA 4CDUA 2D40A 2JJ6A 1YJKA 4P5YA 1N1TA 4META 2A6XA 3PUSA 2H6BA 3ILNA 3I3DA 5IVYA 4RHV1 4IE0A 4QKBA 3VZJA 1OKOA 2DCYA 4DRVA 2E7QA 3WDUA 3GF6A 3IB3A 3J7NA 4LOSA 2VQUA 5A80A 1W6PB 1UCXA 5LBCA 4QPWA 2J1UA 4EN6B 4KWUA 2VMHA 3UKVA 4EJRA 2ZKNA 4XJAA 2HH9A 5IVVA 2UWCA 2FQPA 4GWNA 4HT1T 3HAGA 2W1QA 2I74A 1MQTB 5FKCA 4FVVA 3Q8FA 4LHKA 2JDMA 4ZZ5A 5JZGC 2IXJA 1MEC2 2CGOA 4Z8BA 3BOWA 4YVWB 4FFHA 4I30A 2VTXA 4U2AA 1FOD1 3WLUA 1QJY2 2W87A 1QJX3 4XW3A 5A70A 2P3IA 4HPKB 4ZS3A 1Q8PA 5FYUA 3T3YA 3X29B 3OOXA 3ZSMA 4B29A 1ND3A 4CDQA 2EIBA 2AACA 2D6PA 4D3WA 3ZFGC 4DXZA 3MFAA 4W8JA 3KM5A 4CEWC 4XFFA 3VL9A 3GDBA 2VQ0A 1MZEA 2BEOA 2XQXA 5FZLA 4N9IA 5FFOC 4AGRA 4GAZA 1SDWA 4FTSA 2IZWA 4LMFA 3LEMA 3FJSA 4XBQA 3NNGA 1MS4A 5IATA 2ZMNA 1QJFA 4IV1B 1WD3A 2GN7A 3FN9A 4WVVA 3E6DA 5FDBA 5GZGA 3JBG1 4QQHA 2TEPA 2ZEWA 1OF3A 2FDIA 4P9GA 4CDXA 2J1AA 3DKWA 4MGTA 5HV0A 2XBO3 1BEV2 1WZXA 2OX0A 1UOGA 1US3A 2WRAA 4JVAA 2NQYA 2FMYA 1WW6A 5A1AA 2Q5TA 2PXJA 4YGBA 1A34A 4BH9A 3VD4A 1WLTA 1DFQA 2JE9A 2WABA 1QH7A 4KL1A 5F5AA 4COUA 1ULPA 5C3OA 5JCTA 1CX4A 4AI8A 4O7XA 3KQRA 4Y1XA 4F7ZA 2VMDA 3NNFA 5T5PA 3B01A 4CPBD 4QPIA 1PHMA 2NM1A 2R1DA 4QHBA 3LIHA 1VLNA 3SCHA 1B35B 2H6CA 3AZVA 1PGW2 1QJU2 3ES4A 3BTXA 2BVBA 2XLFA 4LR4A 4QU1A 4XMIA 4CTEA 4FAGA 5IUQA 1POV3 1S55A 4CRQA 4E4ZA 3B93A 2JD9A 2O0OA 4WM7C 4A4AA 2C4XA 2YHJA 4GXLA 5B2GB 1EP0A 2OZJA 4FI9A 4XURA 3LSEA 3TEWA 1PO22 4LBMA 2OQ6A 2Q1ZB 4CDUB 1K5JA 1WUVA 3ZYHA 1O4ZA 5I93A 1QDCA 3GBWA 3DUIA 3KVBA 1EAH3 2BBVA 3IN9A 4BCUA 5FXZA 1ONAA 4OFGA 2QKDA 4CUCA 5HV4A 2JE8A 3NJXA 1COV2 2WT1A 3AZYA 1YUDA 4YW3A 3AMHA 1GSLA 1DQ6A 1CIYA 2VO5A 2CDPA 3N9QA 2VY0A 5A1FA 4A2UA 4RSUA 5HBAA 1W8TA 1FV3A 2GZWA 3IIIA 1RUF2 1RIRA 1F5FA 1YFUA 4LA2A 2JX9A 2JG8C 1AR93 3AJZA 2XJPA 2W1SA 3HQUA 4HLTA 4E4HA 2CU5A 1RUH2 1TE1B 1ZZ9A 4Q27A 5L9BA 4FP3A 1O3QA 2DV9A 4UT5A 3TN93 1FX5A 3TN91 3HOBA 4ZU7A 3IDCB 1XNDA 3QACA 2OUJA 3ACLA 3S7EA 1F35A 2VVFA 3NV4A 4MZUA 3R4DB 1ND3B 3N35A 2GC1A 4FQZA 4CDQB 1DQ4A 5J96B 4CCOA 2E31A 4N7UA 1WLWA 3DXUA 2ZGRA 4GJYA 1LOEA 2VUAA 3HN3A 3EO6A 2YUEA 4PLNA 2KXLA 4C8DA 5FZ1A 1RXFA 4QXBA 5C3SA 1J3PA 1W6MA 2EAKA 4Q8KA 1MS5A 4QKDA 1WLCA 2DWRA 3S5QA 1S1AA 1XE7A 3TEZA 3KHBA 3Q8EA 2LW8A 4B4QA 2N7GA 4I02A 4Z92B 4EZHA 4LO7A 1NCRA 1U5XA 3VZNA 3LWCA 1FAYA 1VBC1 1SHWB 2G1MA 3T4HB 3MF9A 2VM9A 5A6XA 2Q8DA 2BNNA 3MLLA 1NE6A 2ZHNA 3BALA 1S0IA 1LHWA 4CDXB 2W2IA 1NAEA 3URFA 1M4WA 4R9DA 3ON7A 3IBMA 3R05A 1BK0A 1Q3EA 3WF4A 4KG8A 3IAPA 2DFCA 2IVJA 4Y4RA 1E5SA 3T2TA 1V0AA 5CFDC 1X8MA 2ETEA 4XDPA 3VBOC 1MS1A 3CO2A 4ARYA 1XNTA 4K8FA 1C8M1 1OI6A 4JKKA 2FZ2A 1JOJA 4IE4A 2R041 4QMAA 1MS0A 1BKZA 4XAEA 5D8AC 3ASIA 3U37A 2BQPA 2GNTA 4ZXKA 5CADA 4QPIB 1MR5A 2Y38A 3IT8A 3N9PA 4D69A 5SV8A 2F4PA 4AAPA 4QGMA 5FPLA 1QQP3 2XVLA 4Z82A 3A23A 1WCKA 4Q4X2 1RHI3 1ZBA2 5DMYA 1QY4A 1RHI1 1TNFA 1VBD1 1ZBE2 1S0BA 1J1TA 3A7QA 4BE3A 5FXWA 1OLQA 2JD4A 4EN0A 1W2TA 2VECA 3RNSA 4BZ4A 3BIEA 2VVDA 5J48A 4XFCA 1YC61 2Z69A 5T5OA 1TMF3 2ARAA 2HWF1 2MEV3 3TYJA 1TMF1 5JLVA 3NL1A 3VBFC 5JR2A 2CGPA 2WAAA 5FY1A 3VZKA 3KT7A 3ZYRA 3CJIC 3WF1A 3I2DA 3I2FA 4XC9A 4AEDC 1DYPA 1SG3A 1Q8VA 4PDWC 2GMPA 4BWOA 2R071 4YM2A 2YC2A 1QF3A 5FZIA 4NR1A 3W21A 3DCQA 3AP9A 4X8NA 3V56A 4EN7B 4UW6A 2XUEA 3I4IA 1YRZA 2DTYA 3AKRA 4XEZA 5EP9A 3N9LA 3NJVA 5AVPA 5ABJA 2IXCA 1Z7S1 5I0SA 1H6XA 1NQJA 1ENSA 3ATGA 1AF9A 2VBBA 2WFF3 1CAVB 4YW5A 5FZ6A 5A7OA 2WNUC 1C1FA 2SBAA 4DXTA 1ENXA 1VP6A 3UGGA 1BCXA 1JS9A 1O6UA 2VVEA 1OPOA 3PUHA 4MGIE 3R6SA 5L7OC 4QQLA 4E2GA 3WDTA 5KHKA 4QU2A 1AX0A 2A3WA 4QX8A 4LLFA 2F17A 3TWIA 3WNOA 4B3NA 4F3JA 2Y6KA 2WN2A 4JKMA 4BLIA 1GOHA 1XNKA 3IDBB 5FZCA 4UAPA 1LNSA 1BHGA 1FMD1 1GMMA 1RUG3 4XZUG 1J1LA 5FOBB 1W6MB 3LDKA 1RUJ3 3LQCA 5FUPA 1RUJ1 3ZX7A 1VBB3 1N1YA 1VBB1 2OXBA 3OGGA 1VE0A 5FXVA 4OMDA 4XF0A 1AX1A 4JGYC 2Z42A 2HWC1 1PO11 5IVBA 2ZMLA 1NCRB 3GHMA 3WSOA 2XPJA 5F3GA 3EJKA 4MXWA 2YPDA 2HWE3 3RG0A 3WF3A 1E57A 2ILMA 1UD1A 1XRUA 2PHUA 3EHKA 3NRUA 4M3CF 1DYKA 1W8HA 1W8OA 5DDJ3 1H6YA 5DDJ1 1LULA 2ZOEB 3N7JA 4LBKA 4GB32 1X33A 5JMOA 1GQGA 2YROA 1UZYA 3PL0A 3T09A 3E5UA 1RUI3 3TNQA 5E1RA 1A8MA 2Q1MA 4PF1A 2HYKA 4QB2A 4UBGA 1QEXA 1FOD2 5A3LA 3AMMA 4NO4A 3EXUA 2ZPXA 1ULEA 1SLIA 1MS3A 2ZZQA 2XOMA 3JXSA 1NG0A 5FKBA 4J1WA 3AZWA 4BJ0A 4URTA 2J22A 4P08A 4KBBA 4XUPA 2E53A 2IWGB 5HXVA 4GKYA 3K4ZA 5IFTA 4LHNA 4EYUA 1U12A 1LGNA 1EV11 5A7PA 1AZDA 1UL9A 3BGAA 3OPWA 4KWKA 1IQDC 4P9LA 2HBUA 5BXXA 4XIKA 1Y9QA 2C6SA 4CDWA 1C3HA 4HETA 1PK6C 3KZ4C 4DMIA 1Q8SA 2BGCA 1NZIA 4ZU4A 4GIQA 4OHVA 4XF3A 1XYNA 2BFUL 2HWB2 3RMYA 1AR83 2V4AA 3GJAA 2HEWF 1TME2 1L7LA 1IS5A 1W3VA 3KF3A 4OLLA 5LATA 2VBPA 2CYFA 2WNVC 2FDHA 3I3BA 1BVP1 1JHNA 3JBG2 4B7KA 3JCIA 1D7PM 2ZZJA 2CTVA 2AENA 3S30A 1NE4A 2BV4A 3WDVA 1XPWA 1DQ0A 1IG3A 2VMGA 5FZAA 3WDXA 3ZYFA 5I0DA 2XDVA 3ZFEC 4NIHA 1XE0A 4M01A 3HMYA 1LEMA 1QWRA 4P9XA 2UY8A 1FNYA 2IFRA 5A6QA 2LROA 1YWKA 4XUQA 5I0UA 1DGWA 5BNOC 1G8WA 3VD9A 3HN1A 4KI5M 3U10A 4Y1YA 4MVTA 4DQAA 2Y6FA 4AFDA 4HKLA 2NLRA 3N9OA 2ET7A 4Y1ZA 4NIGA 1VJ2A 1IG0A 4Q5OA 1CN1A 1QU0A 1UOBA 2AREA 2CL2A 3ETPA 4OVEA 1XE8A 5ABJB 2WQ4A 4Y22A 2EXKA 3HVDA 1R081 1V70A 4IW3A 4ET7A 1RUE3 3D5OA 4HSLA 1H8VA 3SEEA 1RUE1 4G3YC 3O0WA 1GZWA 3ZXKA 3AFKA 1WMDA 3U1XA 4WM7A 2CAVA 1N47A 4W6XA 1GOFA 1IKPA 5EYYA 1MEC3 3VBUC 1NQDA 1NY71 1EUUA 4C91A 4XBLA 1W8UA 1W2NA 3J7MA 4Y33A 5CYYA 3UV9A 2R063 1AYM1 2R061 1H8TA 5FLIA 4Y5SA 5APAA 1UU5A 5DQ0A 2Q8CA 1SMVA 3ZFFC 4GA9A 3MI8A 5JVVA 5CFCC 4G9SB 1RB8G 2PLV1 5FY8A 1APNA 4QB1A 5JI7A 4NIAA 1K5MC 5DAXA 2J7MA 3K3NA 4IEZA 1RVF3 4BU2A 2BYVE 2WS91 2EVXA 1RVF1 1ULGA 3WD5A 1YLLA 1V6KA 2JE7A 5LBEA 2ZX3A 4IEOA 1AR71 3NVCA 2RMU1 3ZXLA 5E88A 3LOBA 3TEYA 5FPBA 5EHDA 2Y6LA 5I8SA 3AB0A 3WF0A 4ISQA 3WY6A 2ZX2A 4C1XA 1PVC3 2V5DA 3MDPA 4XYXA 4A6SA 4IERA 3KWVA 1QNYA 1KITA 2Z4FA 2ARCA 3PDQA 4JHTA 4HK9A 4YFWA 1J84A 3FC0A 2RHPA 1ULCA 5J3UA 1LEDA 4C0HA 3PVBB 2G9ZA 1OOPC 3PTYA 4YYOA 5JI9A 5EPAA 3C7HA 3ZYJB 3BI3A 1GWKA 4AVCA 3ELNA 5DUVA 3PVNA 3C8XA 1C5IA 3GJBA 2RR13 4K3UA 4U36A 5CU1A 5E6HA 2C5DA 4CDWB 4CVUA 3PJQA 3RJRA 2D6LX 5EV7A 3CKHA 4LEJA 2ZHMA 1GYKA 3T2QA 1NCQA 3RWNA 3H8RA 4HBNA 4LBNA 3SH3A 4QDSA 4CP0A 3OBZA 3T0AA 2QQMA 1HRI2 3SITA 2VOWA 1GANA 3WUCA 4CZSA 1UKGA 5C4WB 3K48A 1VALA 1I5ZA 4GKXA 3EMRA 3OUHA 1ENQA 2YPJA 4MYEA 1PGSA 1HB3A 3VKLA 2J1EA 4N43A 5BNPA 1O3SA 4QX2A 2XKPA 4LKDA 4KGGA 2CSGA 1JN2P 5F3CA 3A21A 1OA3A 4WVMB 1VMJA 2PMWB 2X5IA 4E2SA 1MPXA 2V72A 2W1WA 1CAXA 3MIBA 4UF0A 3SQOA 1COV3 2D5HA 4JV4A 2YYOA 1UPSA 2UYBA 4Y22B 1H4GA 5BNQA 2YU1A 4FTEA 2EIDA 1GKBA 1D4M2 2V73A 3BPZA 4XDOA 5F39A 5CKQA 4XDQA 2K2SA 4YGDA 2BNMA 4Q4W1 1S0DA 4AWDA 3OD4A 1RUF3 1GZWB 3QD6A 4FPLA 1LOBA 2W92A 3SH5A 1XU1A 3VL8A 3ORJA 1UYPA 3MF6A 2Y0IA 4QGLA 4C90A 4L92A 1UY1A 1N3OA 2ID4A 2RJLA 1GV9A 3VN4A 4XILA 3VKMA 4RQPC 1G9FA 2WYSA 2YU2A 3OGVA 5C5UA 4I09A 1FPN2 4IDZA 5FZ3A 4CCLA 3WCSA 1UY2A 1W9TA 2RM23 4Q4Y3 5L9RA 2RM21 5FUIA 4BXFA 2C0ZA 1H8TB 3T4VA 1ND2B 2GH8A 1SBEA 3POIA 1HJGA 5T55A 2WT0A 1YQ8A 3HBKA 4Y3OA 3H9AA 3RZZA 3OCPA 3LZZA 4YZ4A 5DZEA 3SCGA 5CAZA 4X8PA 4AR2A 3CQOA 3ETQA 4Y1UA 1AJKA 4QXKA 4A41A 1KDMA 4PDWA 1HRV1 5GKAC 4YVSC 1OH4A 3WW2A 3I59A 2BFUS 2JKXA 2RS32 4LUKA 3H3ZA 4NRQA 5FZ8A 4WZCA 4A7ZA 1WWYA 2WAOA 1AYN1 4ZHNA 1DLLA 2VNOA 3H8OA 4A6OA 2H0BA 3BOPA 2XKOA 3Q8AA 4LO6B 1UAIA 2DUPA 1W0NA 1ZZ6A 5C6CA 1AL23 1NA1C 3A4UA 3NNLA 4UI9L 1Z7S2 1POQA 1DBNA 1LESA 3K51A 1UYZA 3VDDC 1OVPA 1GZTA 2QQWA 2YC0A 4NWVA 1PGL1 3W58A 1MZ5A 3WZ1A 1A8DA 3ZN5A 4CE8A 1CGPA 5KXCA 1H2LA 3LDBA 3WT3A 3I2HA 4JX0A 5KHGA 4B8EA 1J3QA 3WF2A 4PBOA 5C8CA 5I0TA 1VBE3 5FY0A 1ZRCA 1NUKA 2PQQA 1ZA4A 1UZVA 3ST7A 2VJXA 2WLQA 3KV9A 4Y1VA 5KXEA 1DLCA 4PCRA 5J09A 1EPZA 4JRAA 3GXUA 4A3XA 1AR62 3P3PA 2P17A 2RS12 4YSFA 2HYXA 4JGYA 2A75A 3J26N 3T1MA 5FO7B 1NCQB 5IAVA 4AG4A 1OLME 2HWC2 1PO12 2XJRA 1O4YA 3JD71 1BBT2 4BQWA 4UFKA 4TWTA 2VZUA 3WDWA 1VBA2 3D3AA 5A3TA 2A71A 4NJ4A 1X36A 2XWBB 4Q4X3 5BPXA 2OVUA 2YB7A 4NE9A 5T5JA 5ACA1 1HQLA 4AFAA 1OUSA 3H42B 4E2QA 3R4UA 5EFUA 4Q0QA 1WBFA 1V9U2 2ZGMA 1X50A 3WUDA 4N43B 4CU8A 3O7OA 3AJYA 5BNPB 3N9MA 1CAUA 5C9AC 2WN3A 1IHMA 2P1BA 4XFGA 4YWAA 4D7YA 4QX5A 2ZGTA 3LFIA 3W20A 2X5IB 1SLTA 2JDHA 4DIQA 1CAXB 5LY2A 3BTZA 1LECA 5JSRA 2WZ8A 1AVBA 1B09A 2GMMA 2GH2A 3CMGA 1L3JA 3H3UA 3OD0A 4FFIA 3WP4A 3ZN4A 4YG3A 4CA9A 1YQ5A 1EV12 4PQQA 1LR5A 2RE9A 1JUHA 1O5UA 2A5ZA 2LM3A 5A3OA 3NQHA 1CVNA 1N1VA 3BVCA 4FOQA 4XE9A 3OGSA 4YZ2A 2MNGA 1PZ7A 2O8QA 5FV3A 1G9CA 4S2FA 3IIAA 3A0NA 3WR0A 3MW4A 5FYMA 3UJQA 3UNPA 1VAMA 5EJ3A 4KQ7A 1UZWA 2W9XA 1H9WA 1D2QA 1U5IA 1QNWA 1PZ9A 2ZCWA 4BLJA 1XQNA 2VTXJ 1ODMA 3M8LA 5CNAA 5FIXA 5LASA 1SLCA 1YI7A 3MO4A 1YQCA 3KV6A 5DUUA 5A7WA 1HDKA 2JDYA 5ERLA 1OA4A 2VG9A 1LU1A 2PHRA 3LCPA 4PIYA 5LA2A 1OLRA 5JXJA 4TSVA 4JZRA 3PTRB 1BVVA 3I59B 3U11A 4QPGA 5AC93 2BU9A 2ZX1A 3OGJA 5AC91 5FCCA 3W59A 5GZFA 3B69A 1N3PA 3QCWA 5H9SA 4A45A 4XJ9A 1NT0A 1R1A3 1R1A1 5FZHA 3PIGA 1MZFA 5FZMA 3WW4A 2PHDA 1QJX1 2EAAA 5T5LA 3PURA 1PX3A 1VRH2 4RR3A 3V65A 5F1RA 4LUMA 1ASJ3 1ASJ1 1R082 1RUC3 2GP3A 4NIIA 5LA9A 3HWJA 4JHZA 3WP5A 2BJSA 3CDZB 3EYPA 3ZYIB 5D21A 4LBQD 4N8MA 1CWPA 1FT9A 4CU9A 4FXKB 3WW1A 3NAPA 4K1ZA 4WV8A 1W9FA 2B46X 2IVIB 5C8CB 5FMCA 4ZU5A 3C7FA 3W5NA 5F2WA 4BB3A 5K0UC 2IC1A 2BWCA 5FZ0A 3RYPA 3PVOA 5F6KA 4HN1A 3ZFFA 4TXWA 4R9CA 2DVBA 2WO1A 5GZCA 2B4KA 4JGYB 1UY0A 2PHFA 2W47A 4L2NA 1ZRIA 3BN6A 3SXWA 2PAEA 4H7LA 2XUMA 1KJLA 2PLV2 3N3HA 3JZVA 3IAQA 2WLPA 2RVAA 1WLDA 5FP7A 3O1MA 2IXIA 1M06G 3ZXAC 3RJ2X 2QFEA 2BUKA 1OFNA 1WKYA 2XBO1 2YY1A 1PNFA 2NN8A 2RMU2 2AZ5A 3AM2A 3ILRA 3T1LA 3DYPA 3VHPA 5CA6A 4FP2A 2C26A 2W94A 4DUXA 5FAXA 1W39A 4BQYA 1OBNA 2XJSA 4FPCA 3H7YA 5FY7A 2XR4A 2GNDA 1CAUB 2HEYF 2J1RA 2J42A 1UXZA 2EIGA 4FOWA 3V64A 2VCAA 1CAWA 3CZUA 1F5JA 4LBOA 4EWEA 5HPOA 1IS3A 2JG9C 1BZWA 2QQIA 4YM0A 5FMBA 3ZXFA 1WW4A 4COYA 3O0XA 3W5MA 1EY2A 4GH4C 5EQUA 5FP9A 5FP8A 4MX3A 3ZDVA 5LK7B 4JDMA 5GLWA 2AC1A 1POV1 1A6CA 3NWKA 3DGTA 3VBRA 4HXCA 3ZN6B 2BOJA 3AKPA 2D6KA 4KG0A 4QAWA 2D5FA 4XQWA 1YXWA 4GZ9A 3USSA 1CZVA 5H9PA 4HZFA 1EAH1 1XXNA 4IV3C 4O65A 2QQLA 4H2AA 4FBFA 2WC2A 5FYSA 3M1HA 3O12A 2OIIA 3IMNA 3WQBA 1S0JA 2VW0A 1ZM1A 1YFXA 3AP5A 4YZ1A 1QKQA 3RS6A 3FBMA 3GGLA 2HLEA 3U0ZA 4OI0A 2VMIA 1RMU3 2FDFA 5FZKA 5BUVA 3BU0A 2X09A 4P9IA 2P6CA 1I6XA 4XACA 5JWPA 2Q1FA 3WG3A 1IQAA 4ZONA 2OT7A 3UT0A 1F15A 4M3CE 4QPGB 3M70A 2DYCA 1AR91 2Z2SB 5A33A 2GN3A 3OY8A 1W6QA 3UKTA 4COWA 5ACA3 1REFA 4UFLA 4H7MA 4AAXA 1DGLA 3FLRA 3J4UH 4J1XA 4CP9A 1QXJA 4RR3B 2E7TA 3VBHC 4N53A 1UQXA 2VL4A 2PHXA 4JRLA 2G9FA 4Q4W2 3N36A 2J1SA 5T52A 3SC7X 4MHRA 3ALQA 3FFZA 4AVAA 4MADA 4IQPA 1PMIA 3T08A 4MOAA 4D7SA 3FHQA 1IPKA 3NKTA 2WQ8A 3NAPB 1MS9A 2FZ1A 3FUOA 3PMSA 3POGA 4I0BA 3N9NA 4W6YA 4Q2FA 1GQHA 3GCXA 3GZTB 4Q4V3 4Q4V1 4OI1A 3RMXA 1UNBA 2QUOA 3E5XA 3HNYM 4XXAA 4ASKA 1JZ8A 3AMQA 5EJ1B 3LD8A 1K45A 3AXDA 3VHOA 3ZFFB 2WA3A 2YBPA 2QJVA 4Q26A 1HQNA 3GHNA 3VHRA 4WZFA 3RYRA 5L73A 3KGZA 4LO5B 5GLZA 4Q1PA 5TSWA 1BQPA 4W4ZA 2IXLA 4X6QB 5LY1A 4JGZA 2CWSA 4LXLA 1WMXA 1R093 4UFHA 4WVWA 4YVSA 4MGKE 2X29A 1VPHA 5C33A 3RPQA 2B9VA 5EXOA 1TNRA 2ZKLA 4R9AA 3E6CC 3LFMA 3MPBA 2VU9A 1AYN2 3ME2A 4S2GA 5LBFA 3DXTA 1OT5A 2W91A 1NLQA 4D6QA 4ZZ8A 1JOBA 4ATEA 1V6JA 1KEXA 1STMA 3MV11 1OD5A 3NJZA 4O61A 3LAGA 1GNYA 1PM7A 2WJSA 5JAXA 4WM8C 5FYHA 5CKNA 3LEIA 4NHMA 2WWUA 5FBJA 3VDAA 3WNMA 3ZLIA 4HVRA 2E6VA 1VAKA 1PGL2 1TEIA 3MPPG 1X8EA 4IEXA 1W8WA 2L9LA 1UN1A 4OZXA 2ADDA 3MW3A 5A3WA 4CEYC 2B7YA 3B94A 2WWSA 2BGPA 2WYFA 1C28A 1VMFA 2A6ZA 2XVKA 3C7EA 4IGPA 4I0AA 2P3KA 5DUXA 3WG4A 1QQP1 4NRPA 4BQ2A 1RINA 2WIIB 2BP6A 4JDOA 2JECA 2GDFA 5JMCA 3B9CA 2D43A 4N7IA 4LO4B 2D3SA 5LA1A 3FMGA 3KHCA 4WVZA 3VBRB 1DIWA 3UETA 4E9KA 2DCTA 4AQTA 3DPRA 4XJ8A 4LHLA 1LOFC 1NOVA 1Z78A 5GJ6A 1SZBA 3T30A 1TG7A 1W28A 4K9SA 5HCFA 1AUYA 1UYXA 1UOJA 2J1TA 2MEV1 3JD72 3QH7A 2E32A 4I3GA 3NW4A 1QJEA 4K8RB 3GBGA 2OS2A 5J37A 5FY9A 4O9GA 2JDPA 2BVVA 3RFRA 1O8SA 1OXCA 2DFBA 1DGRN 4BK4A 1DG6A 2WQZC 3OYWA 1GWMA 4NROA 4NHYA 5FMDA 5J98B 5FYIA 1LHUA 4Q1RA 2V4VA 1KRIA 2GAUA 4FFGA 1JYIA 3WX5A 3PVEA 1G9DA 3K4AA 1ZNPA 4K1YA 2DUOA 3BODA 5KHHA 5D1IA 2JKBA 1QXPA 2YFUA 5FYZA 2CWMA 2XB6C 3BU7A 1ODNA 3AMPA 1JZ3A 2YMZA 1HV1A 2CDOA 3PMEA 3M3QA 5A33B 3OY8B 3FHIB 4OI2A 2SLIA 1W6QB 4OHWA 5A3NA 3BUCA 5C5TA 4AI9A 3B7MA 3IM0A 2HWD2 2WFF1 5BNNA 3ZO0B 3SLIA 4AHZA 1HXS3 4CP9B 1HXS1 2PAKA 3KQ4B 5B4XA 1J58A 4N53B 2EICA 4CP2A 4XBNA 2RS33 5IK5A 3CJXA 4BIOA 1PIV2 4OUSA 5A7SA 4YGCA 3WCRA 1MQTC 1SFNA 2CNAA 1F31A 1OFSA 1REEA 3J8F2 4RS5C 3T0BA 3TEXA 2DVDA 4R8HA 2OPWA 3VV1A 5F3IA 4IGOA 4YVWC 1RUD3 1RUG1 3KS7A 1ZZ7A 4P14A 4RHV2 5GLVA 2DCZA 5I8TA 2VZ3A 2J1VA 4A3ZA 1GBGA 4MLOA 5FWJA 4AFBA 1ALYA 4E4DX 2JDNA 5FZBA 5KHIA 1AX2A 3I2IA 2H0VA 4QHOA 2PTMA 3JQWA 4Y20A 4QPYA 1BMV1 1C5HA 1CJPA 3IDAA 2OKXA 4OUMA 1E5IA 5JPNB 2QQJA 2HWE1 1W9SA 3MIGA 4I0WB 4HSJA 5DG2A 3WNPA 5FP3A 4JGZB 3JB4C 2DF7A 1KS5A 1SBDA 4FPHA 1I1EA 2VMFA 4RGKA 4UFJA 2VZVA 1XNBA 4XVHA 2FCUA 3DEMA 4LIVA 5GZDA 3U07A 5JZGA 1HLCA 2ZAAA 2PHLA 1LOAA 1RUI1 2QQNA 3I8TA 3VZOA 4M4RA 2XL9A 3C7OA 4ORFA 4IV1C 2RS53 2WR9A 5F3EA 2DCJA 3OPZA 5GM0A 1QJX2 2WZR3 1XU2A 1BBT3 2ZHKA 2P2KA 3LOIA 1JZ2A 3OJBA 2O8OA 2B8MA 1GR3A 3P3NA 4AF9A 3ZFGA 1O91A 4AGVA 4HKWA 3O1RA 3V0AA 1W0OA 4FO9A 1DYOA 1JODA 2D3RA 3WQ0A 4Q29A 2ZEXA 4CEWA 2P3JA 2A3YA 1ZX5A 1H0BA 1CQ9A 1V9U3 1I9RA 1OC1A 1X9TA 2ET1A 2YDEA 3M4FA 4JQTA 4N9HA 4O9EA 4HVQA 5K0UA 3DECA 1V6NA 2BW8A 2LTNA 3POFA 2VW2A 3O14A 3SEPA 1J59A 4ARXA 2CY6A 1G9BA 3RZLA 4JAAA 3ZSKA 3W9AA 2AUYA 3DPRB 4UW4A 3N7LA 3ILFA 1AR81 3SISA 1KGYA 1AL0G 2A7AA 4W65A 3AMNA 3H3LA 1B35C 4P9WA 3N4MA 5L19A 3VHNA 4HFSA 4AQ2A 3ENRA 5FPXA 1W6NA 4P9JA 3OBAA 3MLJA 2FDGA 2RV9A 2XBO2 3IPVA 3USUA 3OYWB 5F8PA 1H2MA 5A3UA 1X7NA 4XAAA 4CDUC 4QQPA 5IFPA 3NNJA 2RDRA 3U4XA 3I2GA 5JOZA 2Y6JA 3M3EA 1X82A 4RFRB 1JU4A 2HJIA 3V0BA 2NZ9A 2VQTA 3B00A 4GH4A 4D0QA 1MZ6A 5IHRA 1KJRA 4XIOA 1XC6A 4OULA 5BNNB 5F9TA 1S2KA 3VZMA 4YZ5A 1MVQA 4IXLA 1H1IA 4QX3A 3KVAA 1DZQA 4DRRA 3NSTA 5IAXA 1MEC1 1LKNA 1DQ1A 1OURA 5JR7B 4PQ9A 2VUCA 4RD7A 3LA2A 1QJY3 1UWWA 1ZZCA 2K46A 5FOJB 1WA4A 4IV3A 3MUZ1 1TVGA 1VRH3 4PJYA 4OCTA 5FYVA 4R52A 3AL5A 3RSJA 2C9KA 4FPJA 4EN8B 2A6YA 1ND3C 4PBPA 4CDQC 2KA3A 3GCWA 4HL0A 1HB4A 3I2KA 3E1F1 1W05A 2PN5A 4MXWB 1CX1A 1SLBA 3WNXA 1D0HA 4NPRA 3O1TA 4TLFA 1VR3A 1O7FA 1T6BX 3RI9A 2EA7A 2VUJA 3WNNA 4CCMA 1GZCA 2JG8A 5JZGB 3I49A 2PA7A 2ZGQA 5LZ6A 1JYNA 2I07B 2WO7A 4N90A 1PVC1 1AR92 5ANQA 3S57A 1NKGA 5DN2A 4HOOA 1DHKB 4OHZA 3S6PA 3TN92 3WHUA 1Q43A 4IL7A 1LAJA 1OQEA 1UZ0A 3OBRA 4JQRA 3FBYA 5DAQA 3WXPA 3O1UA 3CLPA 4QX1A 4AFCA 4XQDA 4LK6A 2VZPA 2VCCA 1W04A 3ZFGB 4CDXC 5A6YA 2ZS6B 1BEV3 4ISRA 1Q5OA 1BEV1 1ULDA 1W3XA 3OB8A 4FPYA 3I7DA 2TUNA 3VKNA 3V0AB 1YEWA 1O3TA 2Y8KA 3PU3A 4CEWB 4DXSA 1A78A 2RR11 3T0DA 4MUVA 4M4PA 2BPA2 1SEFA 4LKSA 1XSQA 3RZMA 3ZXEA 4YG6A 2KD7A 1D2SA 4KWJA 2XG3A 3O1VA 2VZRA 3K3OA 2ZHLA 2OUHA 4K20A 4KH9A 1KXGA 1VBC2 4KNCA 2CV6A 4QPIC 5GLUA 5AFEA 1DCSA 1QJU3 1OHFA 1PGW1 1QJU1 2Y6HA 3AC0A 4HMZA 1BLZA 4HN0A 1WGPA 1WD4A 4JDNA 4B7EA 4IEQA 2VCBA 2VNVA 2VOKA 2C24A 1JXNA 3UKNA 3ZPOA 5CFDA 5FZ7A 1PO23 2B45X 3OPTA 4FPOB 3AKSA 3IPVB 1A3KA 3MW2A 3VDCA 1G9AA 1RUNA 1LGCA 5DZGA 2JDUA 3VBOA 1G86A 4OHYA 4TTGA 1W06A 1O4TA 5FYTA 2VMEA 1C8M2 1GP6A 1WW7A 3KMHA 3M3IA 2B5HA 5D8AA 3VD5A 1LB2A 1HN1A 4LBQA 2R042 4UFMA 1RJ8A 1COV1 3WNKA 1YHFA 4QDQA 5ISLA 3V0BB 2AEZA 1W8FA 2GALA 2Q8EA 1OPMA 2BERA 1T2XA 2R16A 4HKOA 3HQXA 5FJKA 1WCQA 3NV3A 1RUF1 3DYOA 1RHI2 1VBD2 5I8YA 4WM7B 4ZXEA 4V2VA 2ZTNA 1RUOA 4JKLA 3AZZA 4DZGA 2RJKA 1LOFA 1V6MA 1FYUA 2VW1A 4CSWA 4OQ8A 5T50A 1RUH3 4XQ4A 3POEA 1RUH1 4AK3A 4BOWA 1JHJA 2E7AA 2ZJCA 1OKQA 4UFIA 1WW5A 4LKEA 3DL3A 2P5BA 5CG9A 3M3OA 1OLMA 3QBQA 5D2AA 5LK5A 2HWF2 3AXEA 4Q4Y1 4XFIA 1TMF2 2MEV2 3FLPA 4QDRA 3WEZA 1ULOA 1ZRFA 1ZREA 5HI0A 1SFPA 3CJIA 5LEKA 2P4EA 1KFUL 2WKKA 4AEDA 4OHXA 3PUQA 1DZTA 2HEVF 3CL1A 1GU3A 4AI3A 1LHVA 4XFHA 3U14A 2R072 1W99A 5J1XA 4BYYA 1WCUA 3SKJE 4M0NA 2MPFA 5GLTA 2OQ7A 4QHZA 4COVA 1N3QA 1J83A 4ASMB 2JG8B 5C70A 4XMAA 1RTVA 4D7TA 2VXRA 2QQPA 1AL21 1Q56A 5FZ4A 4PHZA 1GUIA 4AZZA 2KR2A 2WNUA 1NCRC 2LS6A 2WFF2 1W6OA 4Y24A 3A22A 3LPGA 1TQ5A 4CP1A 4XTPA 4D6SA 2XONA 5L7OA 1W8NA 5BY5A 1HKDA 1IKQA 2WO3A 4L99A 4RS5A 2VZSA 4XCBA 3WP3A 2BNOA 4XUNA 1PVXA 1S0GA 3E5QA 1CPNA 1VBE1 4JTOA 5FPVA 2VZTA 4YVWA 1LOGA 4XFAA 3J7HA 2VD7A 1FMD2 1W03A 5ANNA 1QOOA 1RUG2 1XB9A 3VZLA 3OBTA 1NXMA 4HPKA 5FP4A 1RUJ2 3KV5A 2AH2A 1VBB2 1AJOA 2WDBA 3KLSA 2E63A 4DFSA 4YLZA 2B39A 2DVFA 5M0TA 1SFYA 4JC1A 4AVSA 1UMZA 2NYYA 4CCCA 3RZGA 1AXZA 4IEYA 4L9BA 4XUOA 1UX6A 4LQRA 4QXCA 1CESA 3H0OA 1ZA7A 4ES9A 1UW8A 2HWE2 5HCBA 1DQ2A 4PLOA 3AZXA 5DDJ2 1ZBA3 2ZACA 4Q4X1 4B1MA 3ROUA 1ZBE3 3LKJA 3L9JT 2ES3A 1ZBE1 2ZGKA 3OSDA 5FWEA 5EWSA 3WQ1A 3GNEA 5KWRA 1I5PA 1VRBA 1LGBA 4YG0A 1O5LA 5CFDB 3PU8A 2ATFA 1JUIA 5IK4A 5J36A 1F9KA 4NAOA 4C1WA 4H55A 2P34A 3VBOB 3Q8BA 3RZKA 1NX9A 2D44A 4GMP0 1JZ6A 2RJ2A 2WWJA 4J25A 2ARXA 5KC5A 5D8AB 4HVOA 1DGRA 4BQ4A 1JYVA 4UF0B 4LBQB 4BIFA 2X05A 4XUTA 2ZBJA 4UOJA 4CCJA 2QDRA 2B42B 2X53S 3LE0A 4MO3M 4AEMA 1CZTA 2JXAA 3KB5A 4BISA 4CCDA 2F6BA 2DU1A 2D6OX 3NJYA 3BYWA 3QH6A 2Z79A 1ZZBA 1WBLA 2VR4A 5LBBA 1PZ8A 1PK6A 2DVGA 2JB8A 4JTNA 3LSDA 3IKWA 4XZPA 3AP4A 3RZHA 3I2OA 3P1IA 4QQ2A 4DNYA 1UIJA 1C1LA 3ZR5A 2JB4A 4RN5A 5FZ9A 4XHXA 1LTEA 3BCWA 3FLTA 1OQDA 2G4IA 2WNVA 5FPZA 4A44A 3ZYPA 4V2WA 1K3IA 5ABJC 1U5ZA 1UYYA 4YGEA 4RGGA 5KXBA 4BK5A 2ZGNA 3VBFB 3JUUA 3UJOA 2Q8OA 1V6LA 2O1QA 3AP6A 3ZFEA 1NLSA 4QWNA 5FR3A 5IT6A 5FLHA 3CJIB 4AEDB 4M00A 3J8F3 3BB6A 3WDYA 2XGXA 4XJUA 4LT5A 1AXKA 5BNOA 3KV4A 4PDWB 2BWAA 2YG0A 5F5QA 2I45A 3BTAA 3MIDA 2OPKA 1Y7BA 4B4PA 2WO2A 4RHV3 1W2AX 4XF9A 3K75B 4YM3A 4FXGB 5IWFA 4CU7A 1F8VA 4GJZA 1UF2C 2EXIA 2UURA 1GNHA 2W39A 4R4XA 1JZ4A 5FQ0A 4YNIA 3POBA 4Q0VA 5FZGA 3ZXJA 2RG4A 4NOTA 1OF4A 2WNUB 1W9WA 1W6OB 3HNMA 1FXZA 1RUC1 1QDOA 2GC2A 1RUE2 2W0XA 5DXDA 4OMCA 5L7OB 4CUBA 2YFZA 4GB33 2WNEA 4GB31 3D4KA 2GC0A 2YBKA 3OEBA 4RS5B 5G05L 3VBUA 2JWPA 1UZZA 1EYBA 1PNGA 3HEIA 4FPFA 2B9UA 4AXOA 1NLRA 1NY72 2E26A 2VUDA 2YGMA 4KU7A 1OA2A 1FOD3 1DF0A 1LOCA 3SH4A 3C3VA 4DY5A 5IVFA 2UYAA 1AYM2 2R062 5GZEA 4XABA 4XTMA 2XJTA 5CFCA 3I54A 4AE2A 3I3MA 2QZ3A 2HBTA 4ASLA 3RZJA 1K5MA 4OYUA 3ZVXA 5JSPA 5E16A 1JYWA 4I2OA 4F83A 2WS92 1RVF2 3NNMA 4IEWA 5F32A 5IYYA 1YQ6A 1CD3G 1W9YA 2VOTA 3FE5A 4MGZE 1UIKA 4TYSA 4FFFA 3CF6E 3TRSB 1AR72 2A70A 3QLQA 2DVAA 4WBBA 3FZ3A 4CDWC 4M3CA 4FOVA 1S4CA 1F2NA 5IVJA 4YZ3A 4Z07A 3RVHA 3HQRA 2HWB3 2Y33A 5FMOS 3HBZA 1PVC2 2HWB1 4KU8A 1TME3 2YC4A 1TME1 2X10A 3ES1A 3RRDA 3JBG3 2QDNA 2IXKA 2FHRA 1BXHA 5C8WA 1LODA 5EZWA 5C4WC 3GM8A 3ZOIA 3WVJA 3WOGA 4Q0UA 3WV6A 2ZGUA 1OOPA 5FZEA 1C4RA 2DBNA 2R6QA 3KCYA 2D93A 3MIHA 2BBAA 5A1LA 1W90A 1UU4A 3VUOA 2FCTA 4QM8A 2RR12 3EBRA 3LPFA 3MZHA 2QZ2A 4Z1VA 1V6IA 4QM9A 1LCLA 5SV5A 1W2UA 1PK6B 3AP7A 5IK7A 4NRMA 5DPNA 5JXGA 3U78A 4NIDA 4DUWA 5DUWA 1IS6A 2A6WA 1L7QA 1SLAA 2ZXQA 4NPLA 3ZR6A 3AYCA 2PELA 2W3JA 4YPJA 2WNVB 3E97A 5KHJA 5F7UA 3KGLA 1SBFA 3ZKYA 2LUWA 5LRSA 3MIFA 3P6BA 2QQUA 4AGGA 4UW3A 4XCAA 5A7WB 3ZFEB 2Y64A 1KFXL 3TB0A 3GZEA 1RMU1 3ACHA 4RGAA 2WUHA 3ZXDA 4BMBA 3WQ7A 1WCSA 2XLGA 3UGHA 2A6VA 3KSCA 5BNOB 3WG2A 5A32A 4LHSA 2BDRA 2O14A 4IEVA 5LA0A 1O8PA 5CEHA 1WMFA 1JH5A 1GP4A 3ZM8A 3OUIA 4XJZA 3KCCA 3NMBA 4IGQA 2DBIA 3ITQA 3MUY1 5GALA 1H8TC 1HB1A 3CBNA 2QBXA 4AHWA 1ND2C 3G7DA 1EPWA 3OUJA 5FQ0B 1XYPA 3SNMA 3INAA 4Y5Z0 1J3RA 4COZA 1KS4A 5E89A
chains in the Genus database with same CATH topology
1S2BA 4I3PA 1NZCA 5E8AA 3MYXA 3VBUB 4F8AA 5KC6A 4RQPA 2V09A 5IK8A 3L2YA 4BPZA 4EROA 3FX3A 1CAVA 4GMP3 2Y0OA 4GMP1 5FBZA 4QGNA 2RM22 1HIXA 3TNPB 4Q4Y2 4ATFA 3POYA 4AEKA 4NHKA 2R49A 5CFCB 2PAMA 2W52A 4FAHA 1O3RA 1K5MB 3POWA 3SMHA 4R4ZA 3HIFA 1HRV2 1R091 4HANA 1QH6A 4XXPA 2JDZA 1GLHA 3VBSC 1D0GA 4GQ7A 1LJ7A 4M3CB 1NA1A 4EWDA 1ENRA 1OQ1A 3J9SA 1QMJA 2EXHA 2UWBA 1AL22 3VDDA 1WCDJ 2DTWA 1NCQC 1DGWX 1REDA 1VBC3 2ZABA 1LENA 1HRI3 1HRI1 3D8CA 4MXVA 1CAWB 3NKGA 1FATA 1FI2A 4ZKTB 2JEMA 1KD7A 2VPVA 2XWJB 1OOPB 1Y3TA 2Q0AA 3GALA 3MGUA 3Q9OA 4YARA 2XLAA 3N7KA 1ULFA 1IZ3A 3H50A 5BNPC 1VBE2 1V00A 4N43C 3AFGA 1HQWA 1LHNA 3CEWA 4FQ4A 2D6NA 1C8M3 2D7FA 2D3PA 4I01A 2ARBA 2JENA 2R043 1YCIA 2X5IC 5I91A 4NHLA 4DPNA 5T3NA 3WHTA 1N1SA 4AQ6A 4QQOA 1V6OA 4LO8A 1D4M3 3NV2A 5JOXA 1D4M1 2PFWA 2Q4SA 1YIFA 1SCRA 3FFQA 4UXAA 5ACA2 2X8KA 1VBD3 4CYDA 4DB5A 3DN7A 4BM8A 1QHDA 3DV8A 2OYZA 1YYNA 5C9AA 2ZX0A 2EXJA 3H8UA 5KXDA 1FPN3 1QOTA 2VGDA 5I0RA 3L2HA 1FPN1 5A32B 3RDIA 3PJYA 1WMEA 2VULA 4Q8LA 1S0FA 2Z5WA 1ZZ8A 2HWF3 2AR6A 4UBHA 2W08A 5FTTC 3D82A 1FNZA 1QGLA 3UL2A 1Z0HA 2R1BA 4A7KA 1DQ5A 4MSVA 3WP6A 3THPA 3MICA 3B02A 4IEUA 2R073 2RS31 2NMOA 3ZIWA 3KCXA 4TZDA 3B3QE 1R1ZA 4AQSA 1KDKA 5CG8A 1YO8A 4RQPB 5JDBA 1Z7S3 4YRDA 1RUD1 4NN0A 4H3WA 4HK8A 2ZGLA 3D0JA 2XL7A 4AI1A 2JICA 1BJQA 4BHPA 2P37A 5JIUA 3WG1A 4Z2WA 3MFCA 3JB8A 1Q8OA 3ZDSA 1HX6A 4FPKA 1YFWA 3ZIXA 3GBFA 4YVSB 5BYNA 2OA2A 5C8CC 3A0KA 1FMD3 4JCKA 4J6GA 5AC92 1AR63 1S0CA 1AR61 4AHYA 3AYDA 2RS13 2OZ6A 4MH0E 1NA1B 2RS11 1MVEA 4L8QA 1R1A2 3B5LB 2RS51 4SBVA 4RFT0 2HWC3 1PO13 2EALA 2R0FA 4XFBA 2A73B 5AVPA 4LE3A 3VDDB 2WZR1 5K9YA 1GZ9A 1BBT1 1VBA3 3PNAA 4C0BA 1VBA1 4PIXA 1ASJ2 4PLMA 4OI4A 1RUC2 4IETA 4AW7A 3UK9A 4K6BA 2PYTA 1XYOA 4FTBA 1SQ4A 2MHFA 1V9U1 4P9YA 1SCSA 1VIWB 3ZSLA 3PHMA 5CVRA 4S2DA 1JYCA 2WINB 4LLOA 1G7YA 3KT1A 3TOJA 2NMNA 1AHSA 3H7JA 3MIEA 1RJ7A 4K40A 2ERFA 4ITCA 4DINB 3HR9A 2GMEA 1UU6A 5CB7A 1W0PA 4P5HA 2E51A 4RL7A 4EV0A 2WFPA 1EV13 1YI9A 1HW5A 1LU2A 2DUQA 3SHRA 3S0MA 3AK0A 1G6NA 1YJLA 2UU8A 5JOYA 3SCFA 5C9AB 2AYHA 4DS0A 1C8NA 1XNCA 2JG9A 3CNAA 5C4WA 2ZX4A 4NVPA 1KQRA 3JQXA 1H30A 2ZA9A 1I3HA 5FREA 3MEPA 1IS4A 1H9PA 3POSA 5FLJA 2EF6A 4AVVA 5H9RA 1H2KA 4AI0A 4BMEA 4L11A 4QPGC 4LNVA 1VB2A 5CIRA 4WVMA 3TAYA 2D6MA 2K9ZA 1OMIA 2ZGPA 3BIWE 3AKTA 4PF5A 4XJWA 2WA4A 4H14A 1QJY1 2XJVA 1U5YA 2ENRA 1EAH2 1VRH1 2C9AA 2YV8A 3ZSJA 2XVGA 3TBDA 4NWWA 1R083 4RR3C 3JU9A 4FCAA 4Y20B 1H1MA 3VLBB 3WINE 4INDA 3VKOA 4KWLA 2C1FA 1RMU2 1CJDA 2VH9A 1QJZA 3NAPC 2AGSA 4DOUA 4LBLA 4XF4A 4XHBA 4EN9B 1AYM3 1RITA 3AYEA 3C2UA 5T54A 4GALA 4AVBA 1IOAA 2QVSB 3MLKA 1ND2A 3ZXGA 3O0VA 4DY3A 3VBHA 2PLV3 1QXRA 4UW5A 5FO8B 2WZPP 2VOVA 5JPMB 2WS93 2D97A 2WSVA 1U0AA 2XH6A 4YW4A 1AR73 4K7JA 2RMU3 4LBJA 2ZAHA 1UPIA 1YNAA 2TBVA 3G6JB 3AKQA 2IXHA 4X6RB 3PLQA 1Q8QA 4AYUA 4S2HA 5K0UB 1JW6A 4ONUA 2PHTA 2QCSB 3NV1A 4Q4V2 3RI8A 4FPGA 4KGQA 1S0EA 4E4SA 1BK1A 3ZMOA 4GWMA 4FT8A 5A3MA 3OF1A 4ES8A 4QD2A 1CIWA 4RA0A 1CONA 3M7AA 1Y43B 1R092 1W6NB 2W68A 1D4VB 3VBSA 4L97A 5FO9B 1GICA 2YZ4A 5H9QA 3VBRC 4LA3A 1LRHA 1PO21 3USUB 2ZGSA 2E9QA 4WM8A 1YFYA 2G9GA 5JIAA 3IWZA 4W6WA 1JTZX 4FPEA 4MV2A 5F6LB 5LEJA 4PIZA 2UWAA 2YXSA 2TNFA 2JG9B 3M3CA 4IEPA 3ECQA 4AVTA 4CEYA 2VOXA 1T6GC 1LHOA 4FOYA 4GH4B 4R9BA 1NYWA 1SLLA 3ZPYA 1QQP2 3LA3A 2GNBA 2ZMKA 1BYHA 2FMDA 2HKXA 1URXA 5JSOA 2LALA 3GYDA 2A3XA 3HD8B 3M2MA 5LRRA 3VKFC 3N7MA 4YW2A 1MACA 4K21A 2CGNA 2YGLA 2FBEA 4AEJA 5HCAA 4IV3B 3D0SA 3FWEA 2QNKA 4XPVA 4D94A 5FMOL 1YIPA 4BA6A 1CR7A 4N53C 4Q4W3 4SLIA 3E6BA 4GULA 1DDLA 1OSGA 5DG1A 1GNZA 3APBA 2CAUA 1NXD1 2V5YA 5DZFA 2VQAA 1AXYA 3B9IA 2WSUA 2OW4A 3LGRA 2GSYA 3LB9A 3OTFA 2WL1A 2NPIA 2I2SA 2XJQA 5CBLA 5L36A 3IDEA 1DU3D 2IFWA 5JOWA 1C57A 3S7IA 1W6PA 3VBHB 4Q0SA 1HXS2 3WW3A 1ZVFA 1HRV3 4JGZC 1MQTA 3EQEA 5K7PA 1POV0 4LTAA 1AYN3 3RYKA 4E27A 3R4SA 3HT1A 3THTA 1UKRA 3KT4A 4XF1A 1H4HA 1ZYBA 3H1YA 1CPMA 4G4FA 1RUD2 4M0HA 3R0RA 2K0GA 1FV2A 3HT2A 5J7MA 2D98A 3H1WA 5AFBA 1VB4A 4XETA 1H2NA 5EYXA 3RQ0A 5KBFA 1HV0A 1JBCA 1BMV2 1SACA 2R30A 1RGSA 4MGYE 4QT6A 5AVAA 1ZBA1 2R0HA 3VBSB 3D6EA 4Y26A 2BTVC 1GFF2 4LE4A 3O5SA 2Y26A 4YM1A 1RUI2 2QE3A 4IV1A 4AFMA 3DPRC 4WM8B 5BV6A 2VNGA 1IGOA 2R32A 3AYAA 4YW1A 2RS52 4EWAA 2KM2A 1RL3A 3JD73 5K8SA 2WZR2 3QOPA 4IESA 2GU9A 1ZRRA 4FSJA 1VAVA 2PHWA 2ZGOA 2DU0A 4CEYB 4BQ1A 4A7YA 3GZAA 4Y4YA 3VGIA 4Q0PA 2WT2A 2NP0A 1QOSA 3FUQA 3ZYGA 4V1PA 4XOGA 2GNMA 3GZUC 3DF0A 3KD4A 2DURA 2VNRA 3H1MA 3ZMNA 4YFZA 1AR82 2UY9A 4AHXA 1DZRA 2XJUA 3ZSEA 2HWD3 1B35A 1H1AA 2HWD1 3AX4A 2Q30A 1MS8A 1RC6A 5BNNC 4AI2A 5FRAA 1IPJA 1PIV3 1ZRDA 1PIV1 3CU7A 3LA7A 2DCKA 4CP0A 3NO8A 3ZN6A 2GC3A 2XHKA 3J8F1 4B4RA 4LULA 4CDUA 2D40A 2JJ6A 1YJKA 1N1TA 4META 2A6XA 2H6BA 3ILNA 4RHV1 3VZJA 2DCYA 4DRVA 2E7QA 3WDUA 3GF6A 1W6PB 1UCXA 4EN6B 2VMHA 3UKVA 4EJRA 2ZKNA 4XJAA 2UWCA 2FQPA 4GWNA 4HT1T 3HAGA 2I74A 1MQTB 4FVVA 4LHKA 5JZGC 2IXJA 1MEC2 2CGOA 4Z8BA 3BOWA 4YVWB 4I30A 4U2AA 1FOD1 3WLUA 1QJY2 1QJX3 4XW3A 2P3IA 4HPKB 1Q8PA 3X29B 3ZSMA 4B29A 1ND3A 4CDQA 2D6PA 4D3WA 3ZFGC 4DXZA 3MFAA 3KM5A 4CEWC 4XFFA 3VL9A 2VQ0A 1MZEA 2BEOA 4N9IA 5FFOC 4AGRA 1SDWA 4FTSA 2IZWA 4XBQA 3FJSA 1MS4A 2ZMNA 4IV1B 4WVVA 1WD3A 2GN7A 3E6DA 5FDBA 5GZGA 3JBG1 4QQHA 2TEPA 4P9GA 4CDXA 3DKWA 2XBO3 1BEV2 4JVAA 2NQYA 2FMYA 1WW6A 2Q5TA 4YGBA 4BH9A 1WLTA 1DFQA 2JE9A 4KL1A 1QH7A 4COUA 5JCTA 1CX4A 4AI8A 3KQRA 4Y1XA 4F7ZA 5T5PA 3B01A 4QPIA 1PHMA 2NM1A 2R1DA 4QHBA 1VLNA 3SCHA 1B35B 2H6CA 3AZVA 1PGW2 1QJU2 3ES4A 2BVBA 2XLFA 4LR4A 4XMIA 4CTEA 4FAGA 5IUQA 1POV3 1S55A 4CRQA 4E4ZA 3B93A 2O0OA 4WM7C 2YHJA 4GXLA 5B2GB 1EP0A 2OZJA 3LSEA 1PO22 4LBMA 2Q1ZB 4CDUB 1WUVA 1O4ZA 5I93A 1QDCA 3GBWA 3DUIA 1EAH3 2BBVA 3IN9A 4BCUA 1ONAA 4OFGA 2QKDA 1COV2 2WT1A 3AZYA 1YUDA 4YW3A 3AMHA 1GSLA 1DQ6A 2VY0A 4A2UA 4RSUA 5HBAA 1FV3A 2GZWA 1RUF2 1RIRA 1F5FA 1YFUA 4LA2A 2JX9A 2JG8C 1AR93 3AJZA 2XJPA 4HLTA 1RUH2 1TE1B 1ZZ9A 4Q27A 1O3QA 4FP3A 2DV9A 3TN93 1FX5A 3TN91 4ZU7A 3IDCB 1XNDA 3QACA 2OUJA 3ACLA 3S7EA 2VVFA 3NV4A 4MZUA 3R4DB 1ND3B 3N35A 2GC1A 4FQZA 4CDQB 1DQ4A 5J96B 4N7UA 1WLWA 2ZGRA 1LOEA 2VUAA 3EO6A 2YUEA 4PLNA 2KXLA 1J3PA 1W6MA 2EAKA 4Q8KA 1MS5A 1WLCA 2DWRA 1S1AA 1XE7A 4B4QA 2N7GA 4I02A 4Z92B 4LO7A 1NCRA 1U5XA 3VZNA 3LWCA 1FAYA 1VBC1 3MF9A 2BNNA 3MLLA 1NE6A 2ZHNA 3BALA 1S0IA 1LHWA 4CDXB 3URFA 1M4WA 4R9DA 3IBMA 3R05A 1Q3EA 4KG8A 2DFCA 3T2TA 5CFDC 1X8MA 2ETEA 3VBOC 1MS1A 3CO2A 4K8FA 1C8M1 1OI6A 2FZ2A 1JOJA 4QMAA 2R041 5D8AC 1MS0A 1BKZA 3ASIA 2BQPA 2GNTA 4ZXKA 5CADA 4QPIB 1MR5A 2Y38A 3IT8A 4D69A 5SV8A 2F4PA 4QGMA 1QQP3 2XVLA 4Z82A 1WCKA 4Q4X2 1RHI3 1ZBA2 1QY4A 1RHI1 1TNFA 1VBD1 1ZBE2 1S0BA 1J1TA 4BE3A 1OLQA 2JD4A 4EN0A 2VECA 3RNSA 4BZ4A 2VVDA 5J48A 4XFCA 5T5OA 2Z69A 1TMF3 2HWF1 2MEV3 3TYJA 2CGPA 1TMF1 5JLVA 3NL1A 3VBFC 3VZKA 3KT7A 3ZYRA 3CJIC 3I2DA 4AEDC 1DYPA 1Q8VA 4PDWC 2GMPA 4BWOA 2R071 4YM2A 1QF3A 4NR1A 3AP9A 4X8NA 3V56A 4EN7B 4UW6A 3I4IA 1YRZA 2DTYA 3AKRA 4XEZA 5ABJA 2IXCA 1Z7S1 5I0SA 1NQJA 1ENSA 3ATGA 1AF9A 2WFF3 4YW5A 1CAVB 2WNUC 1C1FA 2SBAA 1ENXA 1VP6A 1BCXA 2VVEA 1OPOA 4MGIE 3R6SA 5L7OC 4QQLA 4E2GA 3WDTA 5KHKA 4QU2A 1AX0A 2A3WA 4B3NA 4LLFA 4F3JA 3TWIA 4BLIA 1XNKA 3IDBB 1FMD1 1RUG3 1J1LA 5FOBB 1W6MB 1RUJ3 1RUJ1 3ZX7A 1VBB3 1N1YA 1VBB1 3OGGA 4XF0A 1AX1A 4JGYC 2Z42A 2HWC1 1PO11 2ZMLA 1NCRB 3GHMA 2XPJA 3EJKA 4MXWA 2HWE3 3RG0A 1E57A 2ILMA 1UD1A 1XRUA 2PHUA 3EHKA 4M3CF 1DYKA 5DDJ3 5DDJ1 1LULA 2ZOEB 3N7JA 4LBKA 4GB32 1X33A 1GQGA 2YROA 1UZYA 3E5UA 1RUI3 3TNQA 5E1RA 1A8MA 2Q1MA 2HYKA 4UBGA 1FOD2 5A3LA 3AMMA 4NO4A 3EXUA 2ZPXA 1ULEA 1SLIA 1MS3A 2ZZQA 1NG0A 4J1WA 3AZWA 4URTA 4KBBA 2E53A 2IWGB 5HXVA 4GKYA 4LHNA 1U12A 1LGNA 1EV11 1AZDA 1UL9A 4KWKA 4P9LA 5BXXA 4XIKA 1Y9QA 4CDWA 1C3HA 4HETA 1PK6C 3KZ4C 4DMIA 1Q8SA 2BGCA 4ZU4A 4GIQA <