3X29B

Crystal structure of mouse claudin-19 in complex with c-terminal fragment of clostridium perfringens enterotoxin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
117
Chain Sequence
AAATERLNLTDALNSNPAGNLYDWRSSNSYPWTQKLNLHLTITATGQKYRILASKIVDFNIYSNNFNNLVKLEQSLGDGVKDHYVDISLDAGQYVLVMKANSSYSGNYPYAILFQKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Claudin-19
publication title Structural insight into tight junction disassembly by Clostridium perfringens enterotoxin
pubmed doi rcsb
source organism Mus musculus
total genus 23
structure length 117
sequence length 117
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1050 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3x29B00
2QUOA 4P5HA 3X29B 3ZIXA 5B2GB 3AM2A 3ZIWA 2XH6A 2YHJA
chains in the Genus database with same CATH superfamily
1V6MA 1SPPB 3MIEA 3VBSC 1AX1A 2E33A 4K40A 1POV1 2JG9B 5IFTA 3BTYA 4BISA 1HW5A 5F8PA 3A0NA 1WMXA 2WBKA 1RMU2 3NNMA 4AHYA 2XR4A 5G04L 4YVSB 3D0JA 4MGZE 2GP5A 1UPSA 3W21A 1VBE2 5IUQA 3ZXLA 4Y1YA 1YFUA 3KVAA 3AP6A 3FN9A 3TYJA 3T0BA 3KMHA 3WNNA 1R1A3 2CSGA 4JGYB 2IXIA 4D7YA 5KBFA 1SZBA 2XXZA 1Y9MA 1WW4A 4NOTA 4B1MA 1W6PB 4XXAA 5A70A 2RMU2 4NRMA 1YQ8A 5JI9A 2VO5A 2ZABA 3M2MA 1PGL2 2ES3A 2R30A 2RVAA 2BVVA 4CU6A 3VHOA 3GXUA 2P1BA 2YB7A 1OQ1A 2BGOA 4IGPA 1VBD3 2LS6A 1U5YA 2YUEA 1FMD1 3WF4A 5FDBA 2JDPA 3THDA 1U12A 3FLTA 2B45X 4SLIA 5FZAA 5CKQA 2VULA 1DLCA 2VCCA 5ANQA 3O14A 5JPNB 2GH2A 5K4LA 1AUYA 1RUH1 4I2OA 1J84A 1TMF3 1UNBA 1QXJA 3LDRA 4XJ9A 1QJEA 4BXSV 4PLMA 1MEC1 2V72A 3PTRB 4Y24A 2ZMKA 4A6SA 2VZTA 4FO9A 3MIFA 4AG4A 2O1QA 3LZZA 1O5UA 4OFGA 4B4RA 1AHSA 4IV1B 1AL21 1NCQC 4NIDA 1CJDA 2KM2A 2O0OA 4JQTA 4EN7B 4LKEA 2DFBA 2WL1A 4ITCA 2BFUL 3CKHA 1RUG1 1X36A 4PI2A 5E88A 4EROA 1KFXL 3KZ4C 2R16A 2VNOA 3HOBA 2JWPA 2P2KA 2Z42A 4IUGA 4Y5Z0 5T5LA 4W6WA 2MHFA 4XETA 5G05L 5IWFA 3NNFA 3RRDA 2BBAA 1DZTA 3RPQA 4Q1RA 4ATFA 4GXLA 1PVC2 3AJZA 1ZREA 1HRV3 2P6HA 3U4XA 2FDGA 2LROA 4JDMA 1W6NA 5DDJ2 2AZ5A 1ZX5A 2RS32 3O0XA 1QMJA 1AR91 2JD9A 2Y6HA 3C7HA 5F3CA 1AR71 5I0UA 4L8QA 1YLLA 2B42B 2HWF2 2JG8A 2KXLA 1CD3G 5F6KA 1DIWA 3QCWA 4IXLA 1MVEA 4XF3A 4Z82A 1HIXA 3ZXDA 5KHJA 1D2SA 1UPIA 1G9FA 4FCAA 4Q4W2 2YFUA 2W39A 2X8KA 5EZWA 1RUF1 2HWD3 2E53A 4COUA 1FNZA 1C5IA 4OQ8A 5GLWA 1TNFA 5L73A 4HETA 3UGFA 3P1IA 1RUE1 1MZFA 1RB8G 2IWGB 1HB2A 2LW8A 1FPN2 2ZCWA 4FPLA 4AQ2A 5JXIA 1PO12 4YZ4A 4Y1UA 5FZOA 3OY8B 3FZ3A 3JBG2 3VL9A 4AVCA 4XAAA 4YG3A 2AR6A 2I45A 2VG9A 1LHOA 1LHUA 1E5IA 1AZDA 2J1TA 5A7QA 4BQXA 1O3TA 2A5ZA 5HCFA 1UF2C 2Y60A 2Z2SB 1ODMA 3MYXA 2EALA 4L2NA 5DAVA 1PX3A 2ZHLA 1W2UA 1YQ5A 3DF0A 3B9CA 4KBBA 1Z7S1 4FXGB 3ZVXA 4R8HA 3BYWA 2A3XA 1CAVA 3ASIA 4MUVA 2FQPA 2UYAA 4E4DX 1XOYA 3ZFFB 1DGRN 1S2KA 2D43A 3ZXGA 2QQPA 5SV5A 3VUOA 3NRUA 4N43A 4DMIA 5F2WA 3POWA 2DURA 1JOJA 2A71A 2VPVA 3JD71 4QB2A 4AI0A 3FFZA 4CDQB 2XJQA 1CVNA 2PQQA 3OGJA 5H9PA 1H0BA 4AVSA 1GFF2 1UMHA 3U10A 4C0HA 3LSEA 1UY3A 3SH4A 1Y7BA 1HQLA 1NQDA 1RUI1 4QMAA 3RSJA 2RDSA 4HLTA 4O65A 1O7FA 1YWKA 1VP6A 3AZWA 5GKAC 4WM8B 4AZZA 2JDAA 1GZWB 1N3PA 1AJKA 1C8M3 2D5FA 3M3QA 4A4AA 1CESA 1EV13 4CDWB 2QQNA 4P14A 1VBA3 2XJPA 3MPBA 1OF4A 1LOAA 3RZZA 3WP3A 4GH4B 1Z0HA 4YW7A 2RM23 2G9ZA 4XIOA 2W68A 1POQA 4U36A 2D7FA 2YY1A 2N7GA 3MW4A 4LIVA 1UYPA 1KRIA 1I5ZA 4COZA 5JPMB 4IERA 3WNMA 1H2KA 4OI1A 3SKJE 4RGAA 1NCRA 1FMD2 2IZWA 3D0SA 2CTVA 2D6OX 4FQZA 4XFCA 5FMOL 5FBZA 3RI9A 4QX0A 4CSWA 2V4AA 4EN6B 1NUKA 1ZA4A 1RUH2 4ZXEA 1JZ3A 4EWEA 4LO7A 5FY8A 3LWCA 1ASJ3 1GQHA 1MEC2 2GMEA 3DEMA 1YQ2A 5HV0A 3S7IA 1GICA 1JW6A 2X5IC 3EB7A 4Y5TA 1K42A 4UI9L 4YWAA 1AL22 3GJBA 3ZMNA 4QPGB 3H7YA 3EO6A 1TME2 2VMEA 2XBO3 3H3LA 2CU5A 3T4HB 1I3HA 5CADA 1UYXA 4YZ3A 1H30A 1RUG2 2HWE2 1SEFA 4YSFA 1L7QA 5LA2A 4XFIA 1ENSA 3MF9A 2GP3A 4W6XA 3BN6A 4Y26A 3M1HA 3RNSA 2VZQA 1JHNA 2EIDA 1ULDA 4DB5A 1IS4A 1OSGA 4OQ9A 1JBCA 1WCKA 4UW3A 1US3A 4I01A 4CA9A 4KG8A 1X33A 2Q8CA 4LK7A 1R1A1 2D6LX 3ZSEA 2BZDA 2Q8DA 5C4WA 3NW4A 4XE9A 4GKXA 1CWPA 3AMPA 1AR72 2VQ0A 4Y22B 1K45A 2DCJA 5LASA 1HXS2 1QOOA 4CP2A 1W2NA 1A6CA 3GCWA 3Q8FA 3UKVA 5FJHA 1XJAA 2B8MA 3SMHA 3B5LB 1RUF2 5CBLA 1VBD1 2P5BA 3B01A 3KSCA 1JHJA 5FZDA 1W9TA 4QU2A 3WQ7A 2HH9A 1TMF1 1WW7A 1BBT3 1IOAA 1LOEA 5LA9A 1UWWA 1EAH3 4PIXA 3Q8AA 4M00A 4PDWB 2VZ1A 3SEPA 4XQWA 3NSTA 5FZIA 3RZGA 5EPAA 3ZXAC 2QQUA 4BWOA 1AYM3 2D97A 4I0BA 2VW1A 1RXFA 1W6QB 2IXKA 4M01A 2ARBA 2PQSA 1LOBA 1PGSA 4XTMA 5C71A 1O91A 3VDCA 4U2AA 4JHZA 1Z7S2 2B9UA 3R4UA 4RFRB 1SFPA 5FWJA 3KCYA 4NIIA 1UL9A 3OEBA 1RUNA 2BGPA 5FYUA 4F3JA 1JXNA 2AACA 4B7EA 4BE3A 1V0AA 4M0HA 1HRV1 3NV1A 2VOVA 2ZHKA 3O5SA 1QJU3 2PHLA 1GZCA 1OD3A 4N53C 4KWKA 1W8FA 1VAKA 4DY3A 2VL4A 4QB6A 1KITA 1FX5A 4TLGA 3TNPB 1C1FA 1L3JA 5EJ1B 3ETQA 4E2QA 4LBQB 1VRBA 4PIZA 5IJRA 1K5JA 4OZXA 1RUI2 3AMHA 4IW3A 4FOYA 1FNYA 2A3WA 1BK0A 1W39A 2HWD1 4L0PA 3N7MA 3GZEA 2VVFA 2VMGA 3ILFA 2D6KA 4XBQA 3AKPA 3PL0A 4QX1A 1D7PM 4M3CF 4A3ZA 3PUSA 2W1WA 4QHBA 4GWNA 4BM8A 5C5UA 1E5HA 1E5RA 1LODA 5ACA3 2GH8A 3AL5A 3MGUA 4LKFA 5BV6A 2B46X 4RSUA 1Q3EA 2A6WA 1N47A 4CCDA 1HN0A 2YBPA 4Z07A 1CAUA 3NV2A 1WMDA 4P08A 1GOFA 3VHNA 4Q27A 4Y4RA 1PGW1 3AZZA 4S2HA 1D2QA 5FJKA 4AK3A 4DIQA 5C8WA 4NROA 2D93A 4AVAA 3E5UA 1IPKA 4AI8A 3WP4A 2MPFA 3N7KA 4I3GA 5JWPA 1QJX3 2YBKA 2VXJA 2UURA 4INDA 3OPWA 1AVBA 3ROUA 4ET7A 5LY2A 4CEWA 3H8XA 4FFHA 1QOSA 3GM8A 4PBPA 1BKZA 4PQ9A 4AI9A 1UYYA 2E7TA 5CKMA 4FP3A 1S1AA 3RI8A 3KD4A 3K2OA 2P6CA 1JOPA 1OVSA 1NAEA 4IGQA 4Z1VA 4E8DA 3H8RA 5CZKA 2OQ7A 1YIPA 2A6VA 4PBOA 5JSOA 1QXRA 4XFBA 2PN5A 4K8RB 2VNRA 1MZ6A 4AW7A 4LO4B 3OCPA 4MGTA 4E4ZA 2R043 1AYN3 4BQ1A 2J1EA 5FLHA 4RN5A 4OZOA 3U11A 3VV1A 5BNPB 2R1BA 1UQXA 3N9LA 1C8M1 3NWKA 3OUIA 2HLEA 1EV11 5FZGA 2QQWA 4QPIB 4UFLA 4XW3A 3WX5A 1J58A 1D4M2 1VBA1 1CAXA 1VLNA 1GBGA 1F5FA 2C26A 4LIUA 4IQPA 5FZ6A 3BKZA 4OI2A 3AYDA 4TLFA 2QCSB 4UF0B 1GQPA 2RM21 3AFGA 4MYEA 4ZXKA 4EWAA 3EQEA 3GBGA 2BBVA 5KHIA 3U4SA 3KT7A 5FMOS 1QOTA 2K9ZA 4MADA 5A7WB 1ZM1A 1SHWB 2ZHNA 3NV4A 1NA1B 1XE0A 5A7NA 1VBD2 4RYDA 3RGBA 4CCEA 2WZR3 1NLSA 4FAHA 3DYMA 3THCA 2ET1A 3W59A 3O1RA 2OYZA 5I8YA 3K46A 1G9BA 3IWZA 1VJ2A 5FWEA 1OLRA 1R083 1ASJ1 4J25A 4NHLA 2DCKA 3UESA 3MW3A 2Y6JA 2YBSA 2XBO1 2WAAA 1HB1A 3HNMA 4XHXA 3POBA 5CFDA 3WNOA 5CFDC 2BTVC 1LGNA 2VCMA 1HKDA 3LA2A 1LU2A 4Y20A 2BYVE 2ZGQA 4CDXA 3POSA 4CDXC 1JYWA 5IVJA 5JMOA 1JZ8A 3C7OA 1O4YA 3U0ZA 2DBNA 4IE4A 4FPOB 1PZ7A 1BJQA 3ST7A 3ACFA 4J1WA 2IUWA 1PX4A 1HDKA 1RUD3 1W8OA 4QQHA 4XUPA 3UV9A 3EHKA 4KMQA 5L9RA 4XVHA 3V0AA 1AXZA 3M3OA 2JB4A 4JDOA 2EIEA 4LJHA 2ZGUA 4P9JA 3WNKA 4AQSA 4AFDA 4LE3A 5CB7A 3MFAA 1CGPA 1YI7A 5FYCA 4Z8BA 2ZKLA 4IEXA 5J37A 2DU1A 3RVHA 3EBRA 3J7NA 5EIYB 2Y6FA 1CX4A 4K20A 1SG3A 2XKPA 3V0BB 1XRUA 1WD3A 1K5MB 2RJ2A 4HKLA 4KQ7A 5FO8B 4AI2A 2ZACA 4QWNA 2WA3A 4MX3A 1G9AA 3PUHA 4LR4A 3E5XA 3NAPB 4UBHA 3T1MA 2JDNA 4AVTA 1CIYA 3ZYJB 5CFCB 5K7PA 1U0AA 1MQTC 1BBT1 1UAIA 5JOYA 1EAH1 4PF5A 3IDBB 3UL2A 1W6MB 2BV4A 1NQJA 5J48A 1TNRA 1PGW2 1AYM1 5FZ7A 3FMGA 1LTEA 3MUZ1 4UFMA 3SQOA 4CEYA 4UOJA 1YFYA 4NUBA 2ZOEB 2JDKA 2BUKA 5DAXA 2BNNA 3ZFEA 4Q2FA 2XJSA 1CN1A 1OFSA 1PK6B 4UFKA 1WLDA 3ELNA 1HX6A 3HEIA 5JR7B 4XUTA 3VBSB 5LWBA 3LA3A 3USSA 2PHTA 4QXKA 1N1SA 5BNOB 3ZDVA 2HWB3 2DTWA 5CG9A 1OH3A 1QJU1 3WZ1A 1JYTA 2Q5TA 1KJRA 4Q1PA 2VGDA 5GLVA 2KA3A 2CGPA 1LJ7A 2QZ3A 4JAAA 2IVIB 5IVEA 3VZNA 4LO5B 5ERLA 2HWC3 3WG3A 2XL9A 3URFA 3U37A 3IZOA 5FZ3A 1PZ9A 5LA1A 5A3UA 4GAZA 4LO6B 1Y9QA 2KD7A 1V70A 3MLKA 5D2AA 1L7LA 4OHZA 4QDQA 2EA7A 2I74A 4ISRA 1C8M2 1GP4A 4FPGA 2W0XA 1EV12 5A1FA 2Z4FA 5FY5A 2V5YA 5C3PA 1VBA2 4IEVA 3POGA 4LBMA 3N9QA 5ACA1 1RYYA 3KVBA 2RM22 4UW6A 1RJ8A 2Q30A 4FTBA 2VMCA 3ACGA 3APBA 3FHAA 3IM0A 3U07A 4D8MA 1DZQA 4ZU4A 3TEYA 4K7JA 4CRQA 2J42A 3PU3A 4MZUA 5F3EA 3ZMOA 2GN3A 4AEDA 4AEDC 4H7MA 5GZFA 3T4VA 3KT4A 5C8CB 5JVVA 1S2BA 5K9YA 3DYPA 1A8MA 3D6EA 1STMA 1N3QA 1OVPA 4D94A 1NCQB 1YUDA 2IXHA 2UY9A 3C2UA 3HMYA 2YROA 3AP9A 1QJX1 4LHSA 2RDRA 1NXD1 1PO23 1URXA 2YMZA 1WD4A 1T2XA 2L9LA 2O8OA 1DGRA 1R64A 1G8WA 1X50A 1ASJ2 2W91A 2WLPA 3MW2A 3AKQA 4H3WA 4UW4A 4AFAA 3KQRA 3LFMA 4NVPA 2E32A 3ZN5A 1OHFA 1UKGA 5JZGB 4R4XA 3RZKA 2HBTA 2XBO2 1JZ6A 5DAQA 5IVVA 4JRAA 1GUIA 3HN1A 4FPEA 4CDUA 3ME2A 4JTOA 1F4HA 4CDUC 1UOJA 2A73B 4UFJA 3ACLA 4XACA 3I2JA 5M0TA 5C9AA 4XJ8A 5C9AC 2QQIA 2QQVA 2VM9A 5FK8A 4G4FA 1YNAA 1JYIA 1UCXA 2P3YA 4FOQA 1H8VA 1W8WA 2R041 1AYN1 1F5JA 3QH7A 4OUEA 3HWJA 5K0UA 4PQQA 3PUAA 4D3WA 3LOBA 1VB2A 3FFQA 5K8SA 4AFMA 4UFHA 5JOWA 1ZZ8A 3PVOA 1DLLA 1IZ3A 4GA9A 2YGLA 3UYJA 1MS9A 4X6QB 3AVSA 5H9QA 4ZY9A 1ZBE2 2WNVB 2Y6GA 2OPWA 3CJIC 4QGMA 4ZPIA 3FX3A 3LCPA 3CZUA 5FY0A 4BA6A 2WZR1 5K0UC 1J1LA 2CHHA 2SLIA 5FP8A 3SC7X 3CF6E 1FAYA 2WO1A 1GYKA 3CIHA 4NPLA 5EYXA 3W5NA 5FYSA 3O1MA 3IDEA 3UGHA 4P02B 5F5CA 1R081 1LR5A 3M7AA 1SFNA 1EAH2 5C3QA 5A33A 1ENXA 2FDFA 4M3CA 2E63A 2E31A 2VUAA 4CXYA 2ZPXA 1W03A 2G9GA 2P34A 2R1DA 4HFSA 3WG4A 1AYM2 5FZ0A 4IDZA 4NO4A 4R52A 1OMIA 3ZM8A 3ZSKA 5F1RA 2WYFA 3I97A 2PAKA 3WQ1A 5FPXA 5FQ0A 2E7AA 2VJXA 3A0KA 2VBPA 3CBNA 3M8LA 1RHI2 3KT1A 2R063 1X8EA 4FPHA 2QBXA 3B93A 4EJRA 4HBNA 3KCCA 5FP7A 3ITQA 2QUOA 4TWTA 4YZ5A 4HK9A 1EPWA 2XJVA 4BMEA 4YZ1A 3M3CA 1NLQA 1RUD1 4XURA 3DN7A 3WD5A 4OI0A 1JUIA 4MXVA 3HQRA 4QGNA 2Z5WA 4P9IA 5IK8A 3P3NA 3SHRA 1W05A 2ZGNA 5FKCA 3W58A 2DUQA 2JECA 3I59B 5IK5A 2CV6A 3QBQA 4MH0E 2XDVA 4QXCA 3WHUA 2QE3A 1AR63 3WF1A 1W3VA 5C7GA 2JIGA 3POYA 1FATA 5A3TA 1B35B 2A7AA 2AC1A 3U75A 2EIGA 3AVRA 1NLRA 5FUPA 3L2YA 4QM8A 2FHRA 2VUDA 1ZZ7A 3I4IA 1ND2A 4ES9A 1ND2C 4G3YC 5JIUA 5A3NA 2VUJA 1XNTA 5F3IA 5JOZA 1SCSA 5LY1A 4Q4Y3 4I09A 5FZ1A 3PMEA 3SCGA 3O12A 4JGZA 4TSVA 3C3VA 4JGZC 1ZZBA 1AR83 2R0HA 4AVBA 1WUVA 2X5IB 1DQ6A 3ZYIB 1OD5A 3VDDA 4EWDA 1UY1A 4URAA 5GALA 4PLNA 1V6JA 3WW4A 1C4RA 4NN0A 4XFGA 5A80A 4WM7A 3V56A 4WM7C 3OEAA 4EV0A 5DZFA 3U78A 1OA4A 2HWB1 2EXJA 2RS52 4W8JA 4P5YA 3PURA 1UKRA 1VMJA 2DFCA 1UY2A 2CL2A 5JIAA 5I0TA 5T50A 1ZZ9A 1LOFA 1LOFC 3M3IA 1BK1A 2GC3A 2WQZC 4JZRA 4BZ4A 5KHKA 1OKOA 1X9TA 2WS93 3MFCA 3NNGA 2Y0IA 2HWC1 3BTXA 4D7SA 3IDAA 3BTZA 2CDOA 3QD6A 4F83A 5F7UA 3KV6A 1YQCA 4O7XA 1LESA 1LKNA 4C1WA 2CNAA 4YW3A 3FWEA 4OHVA 1SLCA 2WN3A 2VOXA 5FUIA 4E2GA 4AGVA 5BXXA 5FZKA 2NM1A 1H8TA 4QDRA 2R073 2Y33A 4B1LA 3GBWA 4COVA 3FUQA 3AKRA 1W0NA 3P5BA 1QQP3 4C1XA 1O6UA 3E1F1 4HG6B 1NT0A 5DPNA 5FPLA 5I0RA 1F8VA 4P5HA 3ABZA 3ILNA 2K46A 1NY71 1U5IA 2PFWA 1W6OA 5EFUA 5FFOC 3ECQA 4FP2A 4DQAA 2HEVF 4XQDA 2WZR2 5KWRA 5L7OA 2DVDA 5C3OA 4CP9A 3I2FA 4GJZA 1J3RA 1GR3A 1OOPA 1OOPC 2UY8A 1PO21 1H2NA 1XQNA 2YHJA 4LOSA 4NMIA 5IVCA 1R082 2FCVA 1ZBA3 3N3HA 4HOOA 3SNMA 1YO8A 3OBRA 2JG8C 5BNQA 1XXNA 5ACA2 4M4PA 4LEJA 5FMDA 4XAEA 3PTYA 1W99A 1JS9A 3FBYA 3NNJA 4I30A 3TN93 3FHQA 2A6YA 4LBNA 1Q56A 2DCYA 2PLV3 3KV4A 4JC1A 1DYOA 4HZFA 2YC2A 2PA7A 3J9SA 3VBUA 1RIRA 3H1WA 3ZXJA 4CYDA 1Q43A 4N53B 5ABJA 4Q0VA 5ABJC 1EUUA 3WDYA 1MS0A 3LAGA 3BPSA 3PVBB 2W1SA 3I3MA 3B9IA 4Q8LA 1RUD2 4NHXA 3HBZA 1H9WA 1UOGA 2VNVA 1OQEA 1VIWB 3CJXA 1UZVA 3WV6A 4YW4A 1VR3A 4YGCA 3RFRA 3KHCA 1DQ2A 1BCXA 1IS5A 3RMXA 5FYIA 3VBOB 1W04A 4AI1A 2W3JA 5L9BA 4XBNA 5E16A 1CONA 1DGLA 1E5SA 1DP0A 4A2UA 1R1ZA 2D98A 3RYKA 2BWCA 3WDVA 2XWJB 3AKTA 1CAWB 1TZOA 5FXZA 3ZSLA 3O1TA 4YZ2A 3I3QA 2WSVA 2H6CA 3N9NA 4OI4A 4N43C 5DZGA 1ACCA 1O4ZA 2CWMA 1GP5A 2E6VA 4FI9A 1W0OA 2Y8KA 2QQKA 3WUCA 2BNMA 2UWBA 3K4DA 2LALA 5A6XA 2JKXA 1S0CA 2VBDA 3VZMA 3PIGA 4IV3A 1NG0A 4IV3C 1T6BX 3WR0A 5FZEA 5T3NA 2ZA9A 2WYSA 4HXCA 3VZJA 2PMWB 4P9XA 4UW5A 2BGCA 1S0EA 3J26N 1F9KA 1WW6A 1DZRA 5FMCA 2R061 2ZGOA 1J1TA 1JH5A 3LEKA 4MXWB 5GZEA 1RC6A 3LKJA 3U1XA 1ND3A 3R4DB 1ND3C 2J7MA 1KJLA 3DV8A 4GULA 4JX0A 2PHFA 2HWB2 4HVQA 1ZVFA 1FOD3 2GMMA 2PAEA 5JR2A 3AJYA 4Y4YA 4J1XA 4RGGA 4META 2PHXA 2D6NA 2C6SA 2XVLA 4HT1T 1NCRC 1HJGA 1W8UA 4QM9A 3D8CA 2HEWF 2VNGA 3UETA 2HWC2 4DINB 2BOJA 1UOFA 4NIHA 1S0BA 3LEIA 4QHZA 1CAXB 1H2LA 1QU0A 1AR61 2Y0OA 5C33A 1WGPA 4C0BA 3H0OA 5CAZA 1BQPA 3AP5A 4NHMA 3T0DA 3DYOA 3ZN6B 4YVWA 4YVWC 3AYAA 3ZYHA 3IAPA 3WHTA 1OA3A 3ON7A 5F6LB 1UO9A 2QTWB 4FOVA 4CP0A 4BQ2A 3OBTA 2F4LA 1V6NA 2FBEA 3AMMA 3VZOA 4Q5OA 4IE6A 1US2A 3I2DA 2WT1A 4XPVA 1JZ5A 2ZKNA 3Q8BA 2JG9A 2JG9C 4HPKB 3T08A 1NE6A 2JENA 3H9AA 1RUOA 3AM2A 4Q4Y1 3I49A 4FBFA 3W20A 4YVSA 2BPA2 2MEV3 1MPXA 2AYHA 2OKXA 1YEWA 4A42A 1AR81 4HSJA 4NHYA 4O9GA 3ZPOA 5HBAA 4XCAA 2ADDA 4XUOA 4OHXA 1F2NA 1UW8A 1CJPA 4WBBA 1AR92 1AF9A 5C4WC 3O1VA 3H42B 2ZX2A 3BU7A 4K1ZA 1JZ2A 1JN2P 2VOKA 5CFDB 1O3QA 3OGGA 1MZ5A 2V4VA 2D40A 3AB0A 4XUNA 1BEV3 2ADEA 3GHMA 4MHUA 5A7PA 2PHWA 4BOWA 2HJIA 2TEPA 2XQXA 3VBHB 2ZS6B 3K3NA 3UT0A 4A3XA 4XFFA 4IETA 2WWUA 1QKQA 1VBB3 2FZ2A 3V0BA 2GC2A 2R49A 5F39A 4BHPA 1N1VA 1SBDA 1VAMA 1V6KA 2WS91 5E89A 4GMP3 5FZ4A 4Y1ZA 3O0WA 3WP5A 1PHMA 1RUE2 1DYPA 5FYMA 4CE8A 4TZDA 3E6CC 1V6LA 4RGKA 5J7MA 3KQ4B 1E57A 2PXJA 4F7ZA 3O1UA 4A6OA 2QQJA 3ZSMA 3F95A 5H9SA 1UY4A 2RJKA 2XJTA 4UFIA 1AL0G 3M3EA 4PF1A 2EVXA 4HN0A 2R071 4MVTA 2WJSA 4IV1A 1YJKA 4IV1C 4L9BA 4LK6A 5C5TA 5FOJB 3PU8A 1ZRIA 3N9MA 2CDPA 2ET7A 5KXBA 1QIQA 1JMUB 1ULOA 3VZKA 3ZYFA 4IEOA 4AQTA 4QXHA 1QQP1 4W50A 3USUB 3I3EA 1KS5A 3TAYA 3WW1A 4X6RB 3VBRB 4TXWA 1MQTB 4JKLA 4GQ7A 3BCWA 4GB33 2ZX0A 1UY0A 4RHV3 2WO2A 3JD72 5IW0A 5A1LA 2G19A 2YGMA 3UKTA 2XHKA 1ZBA1 2WT0A 4K9SA 4Y5SA 1GNZA 3SKVA 2J1AA 1OKQA 1WA4A 1DU3D 2FD8A 5KHHA 3NJVA 3H7JA 4LO8A 4AGGA 1HRI3 5FYVA 3TEWA 1LAJA 4EE2A 1JYVA 2VOWA 3VHPA 1DG6A 1L7RA 4M0NA 3TN91 3IB3A 2W08A 3NKGA 1U5XA 4QT6A 2PLV1 4QHOA 5FY7A 3KS7A 3O7OA 3K48A 3OYWB 4BIOA 1LENA 2VW0A 2WFF3 2XLAA 1JUHA 3JZVA 1MVQA 4H14A 3VD3A 2FCUA 2BJSA 4CCOA 4AF9A 3V64A 5TSWA 3AKSA 3AZYA 1IKQA 4DRRA 4S2FA 3FBMA 4BQ3A 2P3KA 4CCCA 3OY8A 3BOPA 4I0WB 3WF2A 2WC2A 3RMYA 2CY6A 2D3PA 2XJRA 3NQHA 5DQ0A 4AEMA 4YG0A 1GZTA 3LIHA 1SCRA 1F35A 2VXRA 3IIAA 5AVPA 4ATEA 4GD4A 4WZFA 2Y34A 4E4HA 3ZKUA 5IT6A 2WWJA 1APNA 4KWLA 1AR62 2C1FA 4DY5A 3WG2A 1I9RA 3BIWE 4DEVA 4GWMA 4QD2A 1HV0A 3ZFFA 4MGYE 5JMCA 2B39A 3QACA 2R0FA 4UT5A 4A7ZA 1WLCA 5I0SA 3HD8B 3ILRA 3HT1A 1XYNA 4XTPA 4URTA 4AEDB 3DXTA 1QJZA 4WZCA 2TUNA 1S0JA 1VBE3 2IFRA 2HBUA 2NP0A 5F5QA 5FXWA 5DMYA 5BNNA 5BNNC 4YYOA 1Y3TA 2QNKA 4AL9A 2ERFA 4GWIA 3OF1A 2RMU3 1RUC3 5A32B 3H1MA 3LE0A 4ISQA 2OPKA 1R1A2 4IESA 4WM8A 1YFWA 2DCTA 1GZWA 3WNPA 4B7KA 5HCAA 5JSPA 3OPTA 3I2OA 4LHKA 1IQDC 4CDWA 2EXHA 4CDUB 4XDOA 1HB4A 3AP7A 4QU1A 3WDUA 5C9AB 4IEPA 1UN1A 4PT6A 4WVWA 2D6PA 3LIGA 4QAWA 4Q0QA 4RQPA 2VQTA 1UU6A 4RQPC 4XJZA 1ALYA 1X8MA 4DEQA 5AC93 3HAGA 4LBQD 4XBLA 3H3ZA 1G7YA 5JLVA 1RTVA 4Z2AA 5K0UB 2EIBA 3AK0A 5I8TA 4LBJA 2GDFA 1W9WA 1DCSA 1XSQA 5FP4A 1FXZA 1WMEA 3PNAA 3NJZA 1XYPA 2JDZA 2B9VA 2VCAA 2VZOA 1SBEA 1TMF2 3HJRA 5F3GA 4JRLA 4AAPA 3H8OA 5FY9A 3Q8CA 2GALA 3I3DA 2RR13 2J1VA 1COV3 2HEYF 4XOGA 1KXGA 4EN9B 1GKBA 3LF7A 3FJSA 1KS4A 2DVGA 2XL7A 1NOVA 4NWVA 3T2PA 3CJIB 4QPGA 3IIIA 4QPGC 1ONAA 3H50A 2WNUB 1SLBA 2G1MA 1K3IA 3BALA 3IPVB 2ORZA 4G9SB 1IPJA 1HV1A 4FT8A 4BCUA 5T54A 2WINB 1XC6A 2PELA 2Y38A 5BPXA 3I2GA 4V1PA 2ZGLA 2MEV1 3Q9OA 2EAKA 3KWVA 2BW8A 4CVUA 5HXMA 1HRV2 2HWF3 3A7QA 4LE4A 3RS6A 2VTXA 4Q0PA 3KCXA 1Q8SA 5EJ3A 2ZEZA 1BVP1 1OLME 3N36A 3M4FA 4Y3OA 4FQ4A 1NE4A 3BUCA 1UZ0A 2Y64A 5GLTA 1ZBA2 3RYPA 1OH4A 1BEV1 2WIIB 4COYA 5FPUA 1QJFA 4CCKA 4RR3A 4RR3C 3WT3A 1BYHA 1DF0A 4LA3A 1QNWA 1SMVA 4YW6A 2LTNA 2UU8A 2CYFA 2HWD2 1VBB1 1YXWA 1LB2A 2PLV2 1EPZA 1PO13 1ZYBA 3DXUA 4XCBA 4DPNA 3JBG3 4GMP1 4AEJA 5A1AA 1DFQA 4PI0A 1AX0A 4BXFA 4DRVA 1M06G 1RUJ3 4YM1A 2WNEA 2YC4A 2OZJA 2SBAA 1PVXA 4LLOA 1VAVA 1HLCA 4ZS2A 5LA0A 4LQRA 2C5DA 1V00A 4BQ4A 4PDWA 3UJQA 3R4SA 5BY5A 3JXSA 4DXSA 3B02A 3WNXA 1FI2A 3E97A 3OGVA 4WVMB 1PMJX 2DUPA 2R6QA 2DTYA 5CVRA 1GSLA 4CEYC 3KGZA 3S7EA 4ZKTB 3OUHA 4ORFA 5I91A 1ZRDA 5DN2A 1I5PA 1UD1A 2ZGRA 3AMQA 3ZFEC 2DU0A 5JUVA 2E7QA 4DXTA 3LPFA 5A3WA 4N9IA 2R32A 4ES8A 1J59A 2AENA 4GB31 3IDCB 4QQPA 4MOAA 4PIYA 5IK4A 4GZ9A 4RHV1 1KEXA 5F5AA 4NHKA 3POJA 4Q8KA 1GWLA 3OPZA 1GU3A 4CU9A 1VB4A 3ZYRA 3TEXA 4HMZA 1UXZA 5IK7A 2JDHA 2VZRA 2WWSA 4MGSA 2VE1A 3LSDA 3IT8A 5DAWA 2FZ1A 3ZYBA 1A8DA 4OMDA 5APAA 5A6ZA 3BB6A 1HRI1 1LECA 4RS5A 4LBQA 4RS5C 1X7NA 4ZONA 5EQUA 5CA6A 4FFFA 1PZ8A 2XWBB 2ID4A 4D0QA 3H8UA 4CZSA 1YCIA 5IAVA 3WQ0A 3ENRA 4I0AA 1S55A 1XU2A 5GZDA 2DYCA 5J96B 2WFF1 4BMBA 1UIKA 4CP1A 4K8FA 3N9PA 1XNDA 4YGBA 2OUJA 1Z78A 2ARXA 4GIQA 4UXAA 4P9GA 4YNIA 3OGSA 5FR3A 2BP6A 5T55A 4CXWA 4R9CA 5FPAA 1IPSA 4DXRA 5JCTA 3TEZA 3DL3A 4BQ5A 4W4ZA 1QWRA 1CPNA 2EAAA 2FDIA 1I6XA 4AGRA 1YJLA 1PNGA 4CU8A 2Q0AA 2OQ6A 4H7LA 1DDLA 3RQ0A 2BNOA 2JE7A 5KXEA 5DXDA 4YG6A 4QPWA 4QXBA 1AL23 3I2IA 1N3OA 5KR7A 4MV2A 3D5OA 1TME3 1SACA 2GNDA 2ZBJA 1RUG3 2HWE3 2W1QA 4JCKA 4JHTA 4UBGA 1QH6A 1JI6A 3BGAA 5AVAA 5LCWL 4MGIE 1LOGA 2ARAA 4N9HA 3FHIB 5HCHA 1H6YA 2YYOA 5A6QA 2KR2A 3LFIA 4L92A 1VBE1 4FOWA 2DUOA 3OD0A 1W6NB 4XMIA 2ENRA 3WDTA 4B3NA 3AFKA 4Y33A 4YW5A 5FO7B 1OOPB 3TWIA 2XB6C 3D4KA 5J98B 3OSDA 1PM4A 3BODA 3ZKYA 1BMV1 2MEV2 4Q4X3 4RD7A 5FRAA 1RUC1 2JG8B 1OPMA 4LA2A 1PGL1 1NYWA 5BYNA 1HXS3 4K1YA 2WQ4A 3OBAA 3TRSB 1JYXA 3VDBA 5JXHA 3VLBB 4QPIA 4QPIC 5GLZA 1XNAA 3BPZA 3BOWA 1BEV2 4PLOA 2YZ4A 5FP3A 2PHRA 4GKYA 4CUAA 4NAMA 1GANA 2Y6KA 3WW3A 1C28A 1GLHA 1KQRA 4KU7A 5AC91 2HYXA 2RHPA 1GP6A 4YGDA 3FL7A 4GMP0 4YRDA 5A7WA 1VBB2 3UGGA 1R093 2A3YA 2YFZA 5FXVA 5FZOB 4LBOA 3A21A 3NJYA 4OLLA 5GZCA 1EP0A 3VKNA 2RV9A 1KD7A 3AZVA 2VU9A 1BBT2 4UWDA 1LHNA 2RR11 1COV1 1XB9A 4BK4A 1J3PA 2P3IA 2GMPA 2I2SA 1SBFA 5HPOA 5F2SA 1W28A 1CAVB 2GNTA 2VOTA 2K2SA 1BLZA 3K3OA 1SLTA 5SV8A 4IE7A 4IE5A 1X9PA 2Q4SA 1G9CA 5LRSA 3WDWA 4YW1A 4N43B 4EZHA 3ZOIA 4BQWA 3CL1A 5JXGA 3E6BA 5FK7A 1W8NA 2XHNA 5FZHA 5FZBA 1S2EA 3P6BA 2Q1FA 4K6BA 1QEXA 1FV3A 3ZDSA 1LOCA 3K4AA 1AXYA 3UJOA 4LMFA 4QGLA 3LDBA 5FZ8A 3ZR6A 3BU0A 2DDUA 2HWF1 1QJU2 4RHV2 1PNFA 4IV3B 3PDQA 2WZ8A 3A23A 3QOPA 3I7DA 4QKNA 5FOBB 3GCXA 4ZU7A 4Z92B 5LB6A 4I02A 4JDNA 3VZLA 1JTZX 4LORA 2ZX1A 4F8AA 3KV9A 2ARCA 5J36A 5DAPA 5KHGA 3OTFA 4BPZA 1Y4WA 3KF5A 1B09A 5FCCA 1PO11 2VBBA 3J8F3 1MZEA 3MEPA 1GMMA 5FV3A 3DGTA 3JBG1 1LEMA 2WFF2 4QX3A 5D8AA 5GLUA 2Q8OA 3B69A 4YLZA 4BB3A 1LCLA 3CHXA 1NCRB 1RUJ1 1CZTA 4H55A 2XGXA 3NAPA 3NAPC 1TQ5A 1D4VB 4IEYA 4LKSA 5FPVA 5CFCA 5CFCC 1SQ4A 1D0GA 3IAQA 5IYYA 1SDDB 1S0FA 1C8NA 3ZXFA 1W6MA 2XUEA 1Y43B 2QFEA 3KF3A 5AFBA 1MS3A 1VMFA 3T30A 4XDQA 1N1YA 2DBIA 5FXXA 2HKXA 3AXEA 3VDDC 1ENRA 2VQUA 3JQXA 3AYCA 3VKLA 5C70A 1QJX2 3MV11 3B7MA 5I93A 3GYDA 5HCBA 5A6YA 1PM7A 2D3RA 4LXLA 3B94A 1ZZ6A 3MLLA 2X05A 1PK6A 1PK6C 4R9DA 2Q1MA 4IE0A 3VBSA 3KGLA 3PJYA 2A6ZA 3THPA 1PMIA 4R9BA 4XUQA 1MACA 2ZAHA 4A7KA 3D3AA 5BNOC 5BNOA 2VH9A 3S57A 1XE8A 4ZS3A 3ES4A 2WAOA 4ZU5A 5FZLA 1SLAA 3GALA 4DS0A 3ALQA 1DQ1A 4N8MA 3WW2A 1AX2A 1Q8VA 1G6NA 1DQ0A 4YM2A 4BYYA 5IVBA 2P37A 2F17A 4C91A 1OXCA 2JD4A 4M4RA 3VBFC 3VBFA 2QJVA 5C4WB 1ZRCA 4FTSA 4KNCA 1D4M3 2GNMA 1BMV2 4CUBA 2R042 3VN4A 1AYN2 1RUC2 4L11A 4OCTA 4QPYA 1O3SA 1W06A 2FCTA 2CWSA 3MBWA 4LHLA 1H8TC 1VALA 2X53S 3EXUA 4L99A 4XDPA 4SBVA 4ZZ8A 3LEGA 3O1PA 1GOGA 2CAUA 1KFUL 2VTFA 1K12A 3NVCA 5LK5A 3MPPG 2WQ8A 2QKDA 1TG7A 2R7EB 5AC92 4GALA 2OX0A 4JV4A 3MO4A 4QQLA 5KXDA 4EZ4A 5IVFA 2AREA 3TNQA 1CZVA 5C8CA 5C8CC 5L7OC 5IVYA 2V5DA 3WP6A 3SISA 4NAOA 2LRPA 2VZ3A 1NCQA 1WCQA 5GZGA 1XE7A 4CXXA 4AHXA 1TME1 1GWKA 4MO3M 1WLWA 2RR12 2ZTNA 1COV2 2HWE1 3LPGA 1UZZA 4FFIA 1QDOA 5ANNA 3RZLA 1I1EA 2P17A 3S5QA 1JZ7A 5JZGA 2XPJA 5JZGC 4D7TA 5DUUA 3CNAA 3VD5A 2XVGA 3GZAA 2QQOA 3GZTB 1Q8PA 1ZZCA 4BK5A 1PIV3 1TVGA 2RE9A 2YC0A 3ACIA 5LBFA 4CCJA 5FLJA 3VBUC 5FY1A 2XVKA 1GWMA 1IG0A 2Q1ZB 1VPHA 2XJUA 4Q4X1 2W47A 4JKMA 4YFWA 2PHDA 4LULA 2IC1A 1W2AX 4FFGA 1JOBA 2JDYA 1HXS1 2Y6LA 3K4ZA 4XMAA 1YI9A 4AYUA 1EY2A 4N7IA 1UMZA 4A7YA 4YM3A 5CEHA 3S0MA 3J7LA 3ZO0B 1EYBA 2V73A 1ULPA 1RINA 3GJAA 2EXKA 1X82A 2V09A 1TE1B 4LHNA 2YU1A 1U5ZA 3I54A 2WO3A 4BLJA 4CUCA 4BQYA 4S2DA 3WOGA 3RZMA 2WNVA 2WNVC 3VKFC 5JXJA 3GBFA 1R091 2ZX3A 2J1RA 1XNCA 2G4IA 1CAUB 3ZIXA 4COWA 3O0VA 5A7SA 1WWYA 4YGEA 3DPRA 3DPRC 4AHZA 4LKDA 2W2IA 3CMGA 1RUJ2 4KU8A 1F4AA 3MIDA 4PCRA 3ZFGA 3ZFGC 5JSRA 2H6BA 3J7MA 1RL3A 3POIA 3VD7A 4BDVB 3BVCA 5IATA 5FYBA 2IXLA 4BIFA 4LBLA 4X8PA 5DABA 1OPOA 1RGSA 2AEYA 1NXMA 2ZMNA 5D21A 2FDHA 1D0HA 2IVJA 3ZYPA 4MG2A 4JKKA 4P00B 4HK8A 2AEZA 1REDA 2JICA 2W95A 4B8EA 4CEWB 5C6CA 2C4XA 3OUJA 1OURA 1W8TA 5A7OA 1QXPA 2A70A 1UOBA 1WBFA 1MS1A 4OYUA 1POV0 5T5OA 1F31A 4FPYA 3KB5A 2YPJA 4AR2A 3EYPA 4NPRA 1QHDA 5BNNB 3I3BA 3VKMA 1WCSA 2NPIA 4ARXA 1KDMA 2ILMA 3GHNA 1GNHA 3JB8A 1XSRA 4LBKA 2ZEXA 4HKOA 1BZWA 2OIIA 2ZGTA 2A75A 2QQLA 3HQUA 5B4XA 4DOUA 1V9U3 1IHMA 1LHWA 4KWJA 1UIJA 3I59A 4UAPA 2GC1A 3T1LA 4OVEA 2VMIA 1W9YA 5FMBA 5KC5A 1TEIA 3HR9A 2JE9A 1O3RA 3J4UH 3NL1A 1JODA 1LU1A 2Q8EA 5FIXA 2D3SA 2ZAAA 2H0BA 1W0PA 4IEWA 3RYRA 2A6XA 2QZ2A 1XNKA 1ST8A 2QDRA 3NJXA 3U14A 4RQPB 1B35A 2FDJA 1B35C 2BQPA 2PTMA 3J8F1 3OB8A 5D1IA 5D8AC 2PYTA 3MF6A 4IEQA 5HXVA 2WZEA 4Q4V3 1XPWA 3K75B 1CQ9A 4QX5A 5DG1A 2BOIA 1QGLA 1SPPA 4I3PA 1VRH3 3IKWA 4RFT0 3WCSA 1C1LA 1Q8OA 3GF6A 2VAUA 1NY72 3IN9A 2PHUA 3BTAA 4YVSC 3L2HA 4CCLA 3O1SA 5FZFA 1N1TA 1XNBA 5FZCA 3SCFA 1OLQA 3VKOA 2Z79A 3WY6A 2X5IA 4XIKA 4ASLA 4TYSA 1G9DA 1WMFA 1SLLA 3WDXA 2IFWA 4JGYA 2X29A 3NNLA 4JGYC 1PO22 2OS2A 5CU1A 5FREA 4E2SA 4KBZA 4FVVA 4HANA 2G9FA 3FLPA 1W6PA 4FPCA 4XF4A 3HT2A 1A78A 1FV2A 1RJ7A 2BERA 2WDBA 4Y20B 4D6SA 2XKOA 4CDXB 1S0GA 5LBCA 3MDPA 1F15A 2WFPA 2P4EA 1UXXX 1YRZA 2TBVA 1IS3A 2O14A 1BXHA 5EP9A 2D5HA 4V2VA 3VB9A 2ZGMA 2ZMLA 3T2OA 1W2OA 5LW9A 5LATA 3JU9A 1ZRFA 3C8XA 1OUSA 4E4SA 2WABA 1DBNA 1V6IA 2NQYA 4Z2WA 2FMYA 1MS4A 2WKKA 3MHZA 1D4M1 2C9AA 3V0AB 2EICA 4Q4X2 2MNGA 4LOTA 4CTEA 3OJBA 2OVUA 4OUMA 4RR3B 3WQBA 3G6JB 4R9AA 4ONUA 1ZBE3 3DKWA 4IGOA 5DG2A 3ZYGA 2CAVA 5A3PA 4MLOA 1QJY3 2ATFA 5B2GB 1QDCA 2Z69A 2WRAA 1S0DA 1O4TA 2XQRA 4EYUA 3MICA 4PHZA 4Q26A 3H1YA 1LEDA 2JKBA 1GV9A 3SEEA 4QB1A 4BJ0A 4K3UA 1WZXA 1VE0A 2LUWA 1RVF3 3T09A 1R092 3CEWA 2BVBA 2RDNA 4OHWA 3IMNA 4R4ZA 5DUXA 4ASMB 4DUXA 2BFUS 4LITA 1QNYA 5EJZB 2BWAA 4CEYB 4Y1XA 4N7UA 4OUSA 1UZYA 3HPNA 3OOXA 2VMFA 1NX9A 3AX4A 4QKDA 3PHMA 3PLQA 5F9TA 3ZFEB 2C24A 3KLSA 4C8DA 1RHI3 1OUXA 5LK7B 2J1SA 1GZ9A 2J1UA 1SFYA 1UZWA 1YYNA 4NR1A 2JDMA 2RS13 4WV8A 2QQMA 3R05A 2JX9A 2DWRA 3LA7A 2WR9A 3FC0A 1PIV1 2R062 4UYBA 1IG3A 4LUMA 1BVVA 2NLRA 2VVDA 3AC0A 1PMHX 2ZEYA 1HN1A 2RG4A 4HN1A 4XHBA 5DUWA 5IAXA 4HL0A 4N53A 1VBC3 1XYOA 1WLTA 4XEZA 3PVNA 4XXPA 4XFHA 4LNVA 3KM5A 5HI0A 5E6HA 4RS5B 4C90A 5HV4A 5IFPA 4BLIA 1UMIA 4FAGA 2XLGA 2VC9A 4IL7A 2QDNA 4IEUA 2VMHA 4LPLA 1IS6A 3M70A 2VZPA 2DCZA 1ZNPA 4XJWA 5GJ6A 1BHGA 3VBOA 3VBOC 5IHRA 1H2MA 1H4GA 4DFSA 3P3PA 4BU2A 4ZZ5A 1CPMA 5FBJA 4QX2A 4O61A 3ZFFC 2JB8A 3NO8A 2CGNA 1CAWA 5JI7A 4NIAA 3ZPYA 1RMU3 2FMDA 3J8F2 3RZHA 4AWDA 4FPKA 1OI6A 1IQAA 2YDEA 3C7EA 3RG0A 4AOCA 4KWUA 4RL7A 4K21A 4P9WA 1HQNA 3AMNA 4CDQA 2HYKA 3HQXA 4CDQC 1LGCA 2VZSA 2B5HA 3RJ2X 3T2QA 3IBMA 1DGWX 4Q4Y2 2E26A 3WG1A 2OW4A 3ZIWA 1W2TA 2XOMA 1S4CA 5KXCA 3MIGA 1AR82 3PUIA 3POFA 4Q0UA 1P8JA 5T5JA 4RA0A 4WM8C 1MS5A 2W94A 4CU7A 2RS53 1ZRRA 4OHYA 4XZUG 4YPJA 3WF3A 4CDWC 3ES1A 3HN3A 4FXKB 3LEMA 4MXWA 5EXOA 4FPJA 4WVVA 5L9VA 4MGKE 4GH4A 4GH4C 3SH3A 1JYNA 4FTEA 4EQVA 1FOD1 3GZUC 1W8HA 1CIWA 3UKNA 3ZXEA 3S6PA 2LM3A 3LQCA 1SDWA 3A22A 1HQWA 1ODNA 1MR5A 2XMLA 4JVAA 4X8NA 4DUVA 1H1AA 1RITA 4YARA 4GJYA 4CEWC 4XC9A 1V9U1 1V6OA 2WS92 2K0GA 2F4PA 3LD8A 4XF9A 4HKWA 3HIFA 1WW5A 3OD4A 1LRHA 3WXPA 1JYCA 5T52A 1OC1A 3ZXKA 2WT2A 3F2ZA 1DGWA 1GOHA 1IGOA 2DVBA 4MSVA 1WBLA 4P9YA 3ZN6A 3OBZA 1OF3A 2OZ6A 2R072 4D69A 5FKBA 1OFNA 1W3XA 3LOIA 5LBBA 4TTGA 1W9FA 3N7LA 4Q4V1 2E9QA 3GNEA 5FP9A 1PVC3 1S0IA 1VRH1 4OMCA 1QQP2 1ULEA 2WSUA 3FE5A 4AHWA 1J83A 1W90A 2GNBA 4HPKA 5FPZA 5DDJ3 1OQDA 2ZHMA 3HBKA 2RS33 2EF6A 1MS8A 4XILA 1JU3A 3WF0A 5T5PA 4BH9A 4QQ2A 5J3UA 5A33B 4M3CB 2WNOA 3JUUA 5FZ9A 4O9EA 2VQAA 4AI3A 4A44A 4PJYA 1QH7A 2EXIA 1OA2A 1Y9GA 4MHRA 4A45A 4KG0A 1UX6A 3KV5A 4Q4W3 3OG2A 3J7HA 4QX8A 3AP4A 4Y22A 5FQ0B 4WVZA 3AZXA 3LDKA 1H1IA 1RXGA 2UWCA 1ENQA 3N35A 5L36A 4CPBD 4Y1VA 3VBHA 3VBHC 5FPBA 3TN92 3ORJA 1FPN3 3LB9A 2VTXJ 3WNLA 4NE9A 1DQ5A 2YPDA 1PIV2 3DUIA 2C9KA 2OA2A 3NV3A 3POEA 2XONA 4XJAA 5FYTA 3EMRA 3MV01 2DVAA 5B4NA 3WVJA 4KH9A 3DECA 4QDSA 4E27A 4ARYA 1Q5OA 2YV8A 3CLPA 4P9LA 1LHVA 2WZPP 4AQ6A 3QH6A 3INAA 3PJQA 4PDWC 2DF7A 1LNSA 2NYYA 3GDBA 1ULCA 2BU9A 4GWJA 4W65A 1ZBE1 1OBNA 3RDIA 5C3RA 1QJY1 4DNYA 1XU1A 3DCQA 1A3KA 4HSLA 2I07B 1W6QA 2Y26A 1VMHA 5A3MA 3ZLIA 5L19A 3CZJA 1QF3A 3USUA 1T6GC 2ZZJA 5I8SA 4M3CE 4XQ4A 3RWNA 3VBRA 3VBRC 4DZGA 1RVF1 1JU4A 1MQTA 1GQGA 1ND2B 1POV3 5EHDA 4AVVA 5F37A 4CCNA 4TN7A 5CNAA 4B29A 4E9KA 5I0DA 3D82A 4QQOA 1IKPA 5FTTC 4AE2A 1EUTA 2GC0A 3CO2A 3MIBA 4JGZB 3WUDA 1FT9A 3JCIA 3JB4C 4FPFA 4JQRA 3VDDB 4DO0A 1G86A 3PUQA 4AXOA 2DV9A 2ZJCA 3B00A 1UU5A 2ZGPA 1RHI1 4D6QA 3ETPA 1JZ4A 4XF1A 4WM7B 4J6GA 1REFA 2DVFA 1C5HA 2X10A 2RS11 2VECA 4AEKA 5FLIA 3MZHA 2VZVA 3NKTA 2GU9A 1CR7A 3OYWA 2VVEA 4S2GA 1CZSA 3E6DA 4FSJA 1CX1A 4KGQA 2W52A 5CISA 1FMD3 2RDQA 1VBC1 4HONA 1FOD2 1WCUA 2ZEWA 4NJ4A 3SLIA 2JXAA 3VBFB 1RUH3 4NIGA 4KI5M 4YFZA 2JIJA 5A3OA 4EN8B 3SITA 3WLUA 3N4MA 3T3YA 4NRQA 3THTA 1MEC3 2NMOA 3A4UA 1H4HA 4YM0A 2UYBA 1V9U2 3QLQA 4IEZA 4LTAA 2BRTA 1H8TB 3GGLA 5FUNA 2YXSA 1QY4A 3AXDA 2W1UA 2XLFA 2IXCA 3S30A 1C3HA 3ZR5A 1FYUA 4QX7A 4L97A 5FZMA 3TBDA 1NZCA 2VR4A 5KC6A 1WCDJ 1YIFA 2VD7A 2ORXA 3W9AA 1W8ZA 1XBFA 3WCRA 5J09A 4A41A 1HJFA 3VHRA 1RMU1 2OT7A 2GAUA 3VD9A 3T2TA 1W6OB 4Q4V2 3TOJA 4NWWA 4HVRA 3WEZA 3MUY1 5L7OB 2FDKA 1UU4A 2VY0A 1VRH2 4CP9B 3G7DA 5LZ6A 1SLIA 4XYXA 4XFAA 2W46A 4CPBA 1DHKB 1AR93 1WKYA 2JJ6A 2NZ9A 2IXJA 2A1XA 4DXZA 3S5AA 1AR73 1H9PA 2RMU1 1UYZA 5JOXA 1NKGA 4LLFA 5LRRA 3CDZB 3MLJA 4XZPA 5A32A 2JDUA 1AXKA 1C57A 3R6SA 3PIJA 2B7YA 1LGBA 2RS51 2PAMA 3Q8EA 4N90A 4XJUA 5BNPA 5BNPC 2GSYA 1KDKA 3HNBM 2P3JA 1REEA 4H2AA 1RUF3 4JTNA 3SCHA 4UF0A 5BUVA 2W87A 1OLMA 2XH6A 1J3QA 4AFBA 5GM0A 5F32A 3X29B 3PMSA 3VBUB 3SH5A 1A34A 2VW2A 2ZZQA 3ZSJA 4Q0SA 1ULFA 1RUE3 4EN0A 5ABJB 2C0ZA 3CQOA 2JE8A 4B4QA 5CKNA 1NA1A 4NPMA 1NA1C 1H6XA 5AFEA 4NRPA 5EV7A 2VUCA 4B4PA 4OULA 2O8QA 4KL1A 2WO7A 2NMNA 2D6MA 2X09A 4CUGA 3K51A 2AGSA 2OXBA 3WSOA 2WN2A 1LULA 2H0VA 2UWAA 5DZEA 5A3LA 1Z7S3 2ZGSA 5FYHA 4LUKA 2AH2A 2ETEA 1O59A 4V2WA 2VZUA 3UNPA 1QJY2 2D44A 3CJIA 3BI3A 4Q29A 3E5QA 2YG0A 3C7FA 3KHBA 2WNUA 5LBEA 2WNUC 4QKFA 1PVC1 3HNYM 5FO9B 3IPVA 5E1RA 4XF0A 1AJOA 3DPRB 2CGOA 5DDJ1 2GZWA 1YQ6A 2RS31 3HVDA 3ZFGB 5H9RA 5JDBA 3JD73 3C7GA 2JEMA 5CYYA 4CCMA 2WA4A 5JAXA 1RVF2 2E51A 3IMMA 3L9JT 3PVEA 5E8AA 2WUHA 4GB32 5CIRA 3FLRA 3UK9A 4XABA 3LGRA 1DQ4A 3ACHA 3MI8A 2ZX4A 3VGIA 3VL8A 3OGRA 2XUMA 1ULGA 2W9XA 5FY4A 4QKBA 1RUI3 5C3SA 3VD4A 4D6RA 2WLQA 4Q4W1 2F6BA 3BIEA 5CG8A 4KGGA 3EJKA 4DUWA 4W6YA 3I2KA 5ISLA 5EWSA 3ATGA 3K77A 5FYYA 5FYZA 4AFCA 2ZGKA 3TB0A 4ZHNA 2NN8A 1HRI2 1OT5A 3JQWA 1ND3B 3O1OA 3I2HA 2BEOA 2AUYA 5LEJA 1UX7A 1Q8QA 4ASKA 3W5MA 3RZJA 4LT5A 2OUHA 1O8PA 1ZA7A 2BDRA 2GN7A 3VDAA 2RS12 1KGYA 2VCBA 2YU2A 1FPN1 3AYEA 3FUOA 1YC61 1NZIA 3N7JA 1K5MA 3DKQA 1K5MC 1M4WA 2VMDA 1WA6X 4YW2A 1YHFA 2B4KA 3RWKX 3R0RA 3H3UA 4E8CA 4MGQA 1O8SA 3N9OA 1O5LA 3SXWA 1DYKA 1VBC2 2TNFA 5F5IA 5LEKA 2ZXQA 2J22A 3WINE 2XG3A 3NMBA 3ZN4A 4HVOA 3B3QE 1H1MA 1HB3A 3V65A 1YFXA 3CU7A 4YVWB 3ZX7A 3RJRA 3I8TA 3AL6A 1W9SA 4WVMA 5J1XA 2W5FA 5D8AB 4AAXA 3MIHA 5EYYA 5DUVA 1GNYA 2QVSB 2W92A 2RJLA 5FAXA 3T0AA
chains in the Genus database with same CATH topology
1V6MA 3MIEA 3VBSC 1AX1A 4K40A 1POV1 2JG9B 1HW5A 3A0NA 1RMU2 4AHYA 4YVSB 3D0JA 4MGZE 1UPSA 1VBE2 5IUQA 3ZXLA 4Y1YA 1YFUA 3AP6A 3TYJA 3KMHA 1R1A3 4D7YA 4JGYB 2IXIA 5KBFA 4NOTA 1WW4A 1W6PB 4XXAA 2RMU2 5JI9A 2ZABA 1PGL2 3M2MA 2ES3A 2R30A 2BVVA 3VHOA 1OQ1A 1VBD3 5FDBA 1U5YA 2YUEA 1FMD1 1U12A 3FLTA 2B45X 4SLIA 2VULA 5JPNB 3O14A 2GH2A 4I2OA 1AUYA 1RUH1 1TMF3 1QXJA 4XJ9A 4PLMA 1MEC1 4Y24A 2ZMKA 4FO9A 3MIFA 4AG4A 2O1QA 3LZZA 1O5UA 4OFGA 4B4RA 1AHSA 4IV1B 1AL21 1NCQC 1CJDA 2KM2A 2O0OA 4EN7B 2DFBA 2WL1A 4ITCA 2BFUL 1RUG1 1X36A 5E88A 4EROA 1KFXL 3KZ4C 2R16A 2VNOA 4Y5Z0 2P2KA 2Z42A 5T5LA 4W6WA 2MHFA 4XETA 3RRDA 1DZTA 3RPQA 4Q1RA 4ATFA 4GXLA 1PVC2 3AJZA 1ZREA 1HRV3 3U4XA 4JDMA 1W6NA 5DDJ2 2AZ5A 1ZX5A 2RS32 3O0XA 1QMJA 1AR91 1AR71 5I0UA 4L8QA 1YLLA 2B42B 2HWF2 2JG8A 2KXLA 1CD3G 5F6KA 1DIWA 3QCWA 4IXLA 1MVEA 4XF3A 4Z82A 1HIXA 3ZXDA 5KHJA 1D2SA 1UPIA 1G9FA 4FCAA 4Q4W2 2W39A 2X8KA 5EZWA 1RUF1 2HWD3 2E53A 4COUA 1FNZA 1C5IA 5GLWA 1TNFA 5L73A 4HETA 1RUE1 1MZFA 1RB8G 2IWGB 1FPN2 2ZCWA 4FPLA 4AQ2A 1PO12 4YZ4A 4Y1UA 3OY8B 3FZ3A 3JBG2 3VL9A 4AVCA 4YG3A 2AR6A 2I45A 2VG9A 1LHOA 1LHUA 1AZDA 1O3TA 2A5ZA 5HCFA 1UF2C 2Z2SB 3MYXA 2EALA 4L2NA 2ZHLA 1W2UA 3DF0A 3B9CA 4KBBA 1Z7S1 4FXGB 3ZVXA 4R8HA 2A3XA 1CAVA 3ASIA 4MUVA 2FQPA 2UYAA 4E4DX 3ZFFB 1DGRN 1S2KA 2D43A 3ZXGA 2QQPA 5SV5A 3VUOA 4N43A 4DMIA 3POWA 2DURA 1JOJA 2A71A 2VPVA 3JD71 4AI0A 4CDQB 3FFZA 2XJQA 1CVNA 2PQQA 3OGJA 5H9PA 1H0BA 4AVSA 1GFF2 3U10A 4C0HA 3LSEA 3SH4A 1Y7BA 1HQLA 1NQDA 1RUI1 4QMAA 3RSJA 4HLTA 1O7FA 1YWKA 1VP6A 3AZWA 5GKAC 4WM8B 1GZWB 1N3PA 1AJKA 1C8M3 2D5FA 3M3QA 1CESA 1EV13 4CDWB 4P14A 1VBA3 2XJPA 3MPBA 1LOAA 3RZZA 3WP3A 4GH4B 1Z0HA 2RM23 4XIOA 2W68A 4U36A 2D7FA 2YY1A 2N7GA 3MW4A 1KRIA 1I5ZA 4COZA 5JPMB 4IERA 1H2KA 4OI1A 4RGAA 1NCRA 1FMD2 2IZWA 3D0SA 2CTVA 2D6OX 4FQZA 4XFCA 5FMOL 5FBZA 3RI9A 4EN6B 1ZA4A 1RUH2 4EWEA 4LO7A 3LWCA 1ASJ3 1GQHA 1MEC2 2GMEA 3S7IA 1GICA 1JW6A 2X5IC 1AL22 3ZMNA 4QPGB 3H7YA 3EO6A 1TME2 2XBO3 1I3HA 5CADA 4YZ3A 1H30A 1RUG2 2HWE2 1SEFA 4YSFA 4XFIA 1ENSA 3MF9A 4W6XA 4Y26A 3M1HA 3RNSA 1JHNA 1ULDA 4DB5A 1IS4A 1OSGA 1JBCA 1WCKA 4UW3A 4I01A 4KG8A 1X33A 1R1A1 2D6LX 3ZSEA 5C4WA 3NW4A 4XE9A 4GKXA 3AMPA 1AR72 2VQ0A 4Y22B 2DCJA 1HXS2 1QOOA 4CP2A 1A6CA 3UKVA 2B8MA 3SMHA 3B5LB 1RUF2 5CBLA 1VBD1 3B01A 3KSCA 4QU2A 3WQ7A 1TMF1 1WW7A 1BBT3 1IOAA 1LOEA 1EAH3 4PIXA 4M00A 4PDWB 4XQWA 3NSTA 3ZXAC 4BWOA 1AYM3 2D97A 4I0BA 2VW1A 1W6QB 2IXKA 4M01A 2ARBA 1LOBA 1PGSA 4XTMA 1O91A 4U2AA 1Z7S2 2B9UA 3R4UA 3KCYA 1UL9A 1RUNA 4F3JA 1JXNA 4B7EA 4BE3A 4M0HA 1HRV1 3NV1A 2VOVA 2ZHKA 3O5SA 1QJU3 2PHLA 1GZCA 4N53C 4KWKA 1VAKA 4DY3A 1KITA 1FX5A 3TNPB 1C1FA 1L3JA 4E2QA 3ETQA 4LBQB 4PIZA 4OZXA 1RUI2 3AMHA 4FOYA 1FNYA 2A3WA 1W39A 2HWD1 3N7MA 2VVFA 2VMGA 3ILFA 2D6KA 4XBQA 3AKPA 4M3CF 4QHBA 4GWNA 4BM8A 1LODA 5ACA3 2GH8A 3MGUA 5BV6A 2B46X 4RSUA 1Q3EA 2A6WA 1N47A 4Z07A 1CAUA 3NV2A 1WMDA 3VHNA 4Q27A 1PGW1 3AZZA 4S2HA 1D2QA 4AK3A 5C8WA 2D93A 4AVAA 3E5UA 1IPKA 4AI8A 3WP4A 2MPFA 3N7KA 4I3GA 5JWPA 1QJX3 2UURA 4INDA 1AVBA 3ROUA 4CEWA 4CEWC 1QOSA 4PQ9A 4PBPA 1BKZA 2E7TA 4FP3A 1S1AA 3RI8A 3KD4A 4Z1VA 1YIPA 2A6VA 4PBOA 5JSOA 1QXRA 4XFBA 2PN5A 2VNRA 1MZ6A 4AW7A 4LO4B 3OCPA 4E4ZA 2R043 1AYN3 4BQ1A 5FLHA 3U11A 3VV1A 5BNPB 2R1BA 1C8M1 3NWKA 1EV11 3WX5A 4QPIB 4XW3A 1J58A 1D4M2 1VBA1 1CAXA 1VLNA 1GBGA 1F5FA 4IQPA 4OI2A 3AYDA 4TLFA 2QCSB 4ZXKA 2RM21 3AFGA 4MYEA 4EWAA 3EQEA 3GBGA 2BBVA 5KHIA 3KT7A 5FMOS 1QOTA 2K9ZA 1ZM1A 2ZHNA 3NV4A 1NA1B 1VBD2 2WZR3 1NLSA 4FAHA 2ET1A 3W59A 2OYZA 5I8YA 1G9BA 3IWZA 1VJ2A 1OLRA 1R083 1ASJ1 4NHLA 2DCKA 3MW3A 4XHXA 2XBO1 5CFDA 5CFDC 2BTVC 1LGNA 3LA2A 1HKDA 1LU2A 4Y20A 2BYVE 2ZGQA 4CDXA 3POSA 4CDXC 1O4YA 3U0ZA 4FPOB 1PZ7A 1BJQA 3ST7A 4J1WA 1HDKA 1RUD3 4QQHA 3UV9A 3EHKA 3V0AA 1AXZA 3M3OA 4JDOA 4P9JA 4AQSA 2ZGUA 4AFDA 4LE3A 5CB7A 3MFAA 1CGPA 1YI7A 4Z8BA 2ZKLA 4IEXA 5J37A 2DU1A 3EBRA 1CX4A 4K20A 2XKPA 3V0BB 1XRUA 1WD3A 1K5MB 4HKLA 4KQ7A 5FO8B 4AI2A 2ZACA 2WA3A 4MX3A 1G9AA 4LR4A 3E5XA 3NAPB 4UBHA 3T1MA 4AVTA 5CFCB 3ZYJB 5K7PA 1U0AA 1MQTC 1BBT1 1UAIA 5JOYA 1EAH1 4PF5A 3IDBB 3UL2A 1W6MB 5J48A 1NQJA 1TNRA 1PGW2 1AYM1 3FMGA 1LTEA 4CEYA 1YFYA 2ZOEB 2BUKA 2BNNA 3ZFEA 4Q2FA 2XJSA 1CN1A 1OFSA 1PK6B 1WLDA 3ELNA 1HX6A 5JR7B 3VBSB 3LA3A 3USSA 2PHTA 4QXKA 1N1SA 5BNOB 2HWB3 2DTWA 5CG9A 1QJU1 3WZ1A 2Q5TA 1KJRA 4Q1PA 2VGDA 5GLVA 2KA3A 2CGPA 1LJ7A 2QZ3A 4JAAA 3VZNA 4LO5B 2HWC3 3WG3A 2XL9A 3URFA 1PZ9A 4LO6B 1Y9QA 1V70A 3MLKA 4OHZA 2EA7A 2I74A 4ISRA 1C8M2 4FPGA 2W0XA 1EV12 2V5YA 1VBA2 4IEVA 4LBMA 5ACA1 2RM22 4UW6A 1RJ8A 2Q30A 4FTBA 3APBA 3IM0A 3U07A 1DZQA 4ZU4A 4K7JA 4CRQA 4MZUA 3ZMOA 2GN3A 4AEDA 4AEDC 4H7MA 5GZFA 5C8CB 3KT4A 5JVVA 1S2BA 5K9YA 1A8MA 3D6EA 1N3QA 4D94A 1NCQB 1YUDA 2IXHA 2UY9A 3C2UA 3HMYA 2YROA 3AP9A 1QJX1 1NXD1 1PO23 1URXA 2YMZA 1WD4A 2O8OA 4META 1DGRA 1X50A 1G8WA 3MW2A 1ASJ2 2WLPA 4H3WA 3AKQA 4UW4A 4AFAA 3KQRA 4NVPA 3ZN5A 1OHFA 1UKGA 5JZGB 4R4XA 2XBO2 4JRAA 3HN1A 4FPEA 4CDUA 3ME2A 4JTOA 4CDUC 2A73B 3ACLA 5C9AA 4XJ8A 5C9AC 4G4FA 1YNAA 1JYIA 1UCXA 4FOQA 5K0UA 1H8VA 2R041 5K0UC 1AYN1 1F5JA 3QH7A 4D3WA 3HWJA 3LOBA 1VB2A 3FFQA 5K8SA 4AFMA 5JOWA 1ZZ8A 3PVOA 1DLLA 1IZ3A 4GA9A 2YGLA 1MS9A 4X6QB 5H9QA 1ZBE2 2WNVB 4QGMA 3CJIC 3FX3A 3LCPA 4BA6A 2WZR1 1J1LA 2SLIA 3CF6E 1FAYA 5EYXA 1GYKA 3IDEA 1R081 1LR5A 3M7AA 1SFNA 1EAH2 5A33A 1ENXA 4M3CA 2E63A 2VUAA 2ZPXA 2G9GA 2P34A 2R1DA 4HFSA 3WG4A 1AYM2 4R52A 4NO4A 1OMIA 3ZSKA 5F1RA 5FPXA 2PAKA 3WQ1A 5FQ0A 2E7AA 3A0KA 3M8LA 1RHI2 3KT1A 2R063 1X8EA 4FPHA 3B93A 4EJRA 4HBNA 3KCCA 2QUOA 4TWTA 4YZ5A 4HK9A 1EPWA 2XJVA 4BMEA 4YZ1A 3M3CA 1RUD1 3WD5A 3DN7A 4OI0A 1JUIA 4MXVA 4QGNA 2Z5WA 4P9IA 5IK8A 3P3NA 3SHRA 2ZGNA 3W58A 2DUQA 2JECA 3I59B 5IK5A 2CV6A 3QBQA 4MH0E 3WHUA 2QE3A 1AR63 3POYA 1FATA 1B35B 2A7AA 2EIGA 1NLRA 3L2YA 4QM8A 2FHRA 3I4IA 1ZZ7A 1ND2A 4ES9A 1ND2C 4G3YC 5JIUA 2VUJA 5JOZA 1SCSA 4Q4Y3 4I09A 3PMEA 3SCGA 3O12A 4JGZA 4TSVA 3C3VA 4JGZC 1ZZBA 1AR83 2R0HA 4AVBA 1WUVA 2X5IB 1DQ6A 3ZYIB 1OD5A 3VDDA 4EWDA 5GALA 4PLNA 1V6JA 3WW4A 1C4RA 4NN0A 4XFGA 4WM7A 3V56A 4WM7C 4EV0A 5DZFA 1OA4A 2HWB1 2EXJA 2RS52 1UKRA 2DFCA 2CL2A 5JIAA 5I0TA 5T50A 1ZZ9A 1LOFA 1LOFC 3M3IA 1BK1A 2GC3A 2WQZC 4BZ4A 5KHKA 2WS93 3MFCA 2Y0IA 2HWC1 4D7SA 4F83A 3QD6A 1LESA 1LKNA 4C1WA 2CNAA 4YW3A 3FWEA 4OHVA 1SLCA 4E2GA 2VOXA 4AGVA 5BXXA 2NM1A 1H8TA 2R073 3GBWA 4COVA 3FUQA 3AKRA 1QQP3 4C1XA 5I0RA 1F8VA 4P5HA 5EFUA 3ILNA 1NY71 1U5IA 2PFWA 1W6OA 5FFOC 3ECQA 4FP2A 4DQAA 2HEVF 4XQDA 2WZR2 5KWRA 5L7OA 2DVDA 1J3RA 1GR3A 1OOPA 1OOPC 2UY8A 1PO21 1H2NA 1XQNA 2YHJA 1R082 3N3HA 1ZBA3 3SNMA 1YO8A 3OBRA 2JG8C 5BNQA 1XXNA 5ACA2 4LEJA 3PTYA 3FBYA 4I30A 3TN93 2A6YA 4LBNA 1Q56A 2DCYA 2PLV3 4JC1A 4HZFA 2PA7A 3J9SA 3VBUA 1RIRA 3H1WA 3ZXJA 4CYDA 1Q43A 4N53B 5ABJA 4Q0VA 5ABJC 3WDYA 1MS0A 3LAGA 3PVBB 3B9IA 4Q8LA 1RUD2 3HBZA 1H9WA 1OQEA 1VIWB 3CJXA 3WV6A 4YW4A 1VR3A 4YGCA 1DQ2A 1BCXA 1IS5A 3RMXA 3VBOB 4AI1A 4XBNA 5E16A 1CONA 1DGLA 4A2UA 1R1ZA 2D98A 3RYKA 2BWCA 3WDVA 2XWJB 3AKTA 1CAWB 3ZSLA 4YZ2A 4OI4A 2WSVA 2H6CA 5DZGA 4N43C 1O4ZA 2CWMA 2E6VA 1W0OA 3WUCA 2BNMA 2UWBA 2LALA 1S0CA 3VZMA 4IV3A 1NG0A 4IV3C 3WR0A 2ZA9A 3VZJA 4P9XA 4UW5A 2BGCA 1S0EA 3J26N 1F9KA 1WW6A 1DZRA 2R061 2ZGOA 1J1TA 1JH5A 4MXWB 5GZEA 1RC6A 3LKJA 1ND3A 3R4DB 1ND3C 1KJLA 3DV8A 4GULA 2PHFA 2HWB2 4HVQA 1ZVFA 1FOD3 2GMMA 2PAEA 3AJYA 4Y4YA 4J1XA 4RGGA 2PHXA 2D6NA 2XVLA 4HT1T 1NCRC 4QM9A 3D8CA 2HEWF 2VNGA 2HWC2 4DINB 1S0BA 1CAXB 1H2LA 1QU0A 1AR61 2Y0OA 5C33A 1WGPA 4C0BA 3H0OA 5CAZA 1BQPA 3AP5A 4NHMA 3ZN6B 4YVWA 4YVWC 3AYAA 3WHTA 1OA3A 5F6LB 4FOVA 4CP0A 3OBTA 1V6NA 2FBEA 3AMMA 3VZOA 3I2DA 2WT1A 4XPVA 2ZKNA 2JG9A 2JG9C 4HPKB 1NE6A 2JENA 3H9AA 1RUOA 3AM2A 4Q4Y1 4FBFA 4YVSA 2BPA2 2MEV3 2AYHA 1AR81 4HSJA 4O9GA 5HBAA 4OHXA 1F2NA 1UW8A 1CJPA 4WBBA 1AR92 1AF9A 5C4WC 2ZX2A 3BU7A 4K1ZA 1O3QA 1JN2P 2VOKA 5CFDB 3OGGA 1MZ5A 3AB0A 2D40A 1BEV3 3GHMA 2PHWA 4BOWA 2HJIA 2TEPA 3VBHB 2ZS6B 4A3XA 4XFFA 4IETA 1QKQA 1VBB3 2FZ2A 2GC2A 2R49A 4BHPA 1N1VA 1SBDA 1VAMA 1V6KA 2WS91 5E89A 4GMP3 4Y1ZA 3O0WA 3WP5A 1PHMA 1RUE2 1DYPA 3E6CC 4TZDA 1V6LA 5J7MA 1E57A 4F7ZA 3ZSMA 5H9SA 2RJKA 2XJTA 1AL0G 3M3EA 2EVXA 4HN0A 2R071 4MVTA 2WJSA 4IV1A 1YJKA 4IV1C 4L9BA 5FOJB 2ET7A 5KXBA 3VZKA 4IEOA 4AQTA 1QQP1 3USUB 1KS5A 3TAYA 3WW1A 4X6RB 3VBRB 1MQTB 4GQ7A 3BCWA 4GB33 2ZX0A 4RHV3 3JD72 2YGMA 3UKTA 2XHKA 1ZBA1 2WT0A 4K9SA 1GNZA 1OKQA 1WA4A 1DU3D 5KHHA 4LO8A 3H7JA 4AGGA 1HRI3 2VOWA 3VHPA 1DG6A 4M0NA 3TN91 2W08A 3NKGA 1U5XA 4QT6A 2PLV1 3KS7A 3O7OA 3K48A 3OYWB 4BIOA 2VW0A 2XLAA 1LENA 2WFF3 1JUHA 3JZVA 1MVQA 4H14A 4AF9A 3V64A 5TSWA 3AKSA 3AZYA 1IKQA 4DRRA 4S2FA 3FBMA 2P3KA 3OY8A 3BOPA 4I0WB 2WC2A 3RMYA 2CY6A 2D3PA 2XJRA 4AEMA 4YG0A 1SCRA 2VXRA 3IIAA 5AVPA 4ATEA 4WZFA 5IT6A 1AR62 1APNA 4KWLA 2C1FA 4DY5A 3WG2A 1I9RA 3BIWE 4GWMA 4QD2A 1HV0A 3ZFFA 4MGYE 5JMCA 2B39A 3QACA 2R0FA 5I0SA 4A7ZA 1WLCA 3HD8B 3ILRA 3HT1A 1XYNA 4XTPA 4URTA 4AEDB 1QJZA 4WZCA 2TUNA 1S0JA 1VBE3 2IFRA 2NP0A 5F5QA 5BNNA 5BNNC 4YYOA 1Y3TA 2QNKA 2ERFA 3OF1A 2RMU3 1RUC3 5A32B 3H1MA 4ISQA 2OPKA 1R1A2 4IESA 4WM8A 1YFWA 2DCTA 1GZWA 5HCAA 4B7KA 5JSPA 4LHKA 4CDWA 2EXHA 4CDUB 3AP7A 3WDUA 5C9AB 4IEPA 1UN1A 4WVWA 2D6PA 4XJZA 4Q0QA 4RQPA 1UU6A 4RQPC 5AC93 1ALYA 1X8MA 5JLVA 3HAGA 4LBQD 4XBLA 3H3ZA 1G7YA 1RTVA 5K0UB 3AK0A 5I8TA 4LBJA 2GDFA 1FXZA 1WMEA 3PNAA 3NJZA 1XYPA 2JDZA 1SBEA 1TMF2 4JRLA 2GALA 2RR13 1COV3 2HEYF 4XOGA 1KXGA 4EN9B 1GKBA 3FJSA 1KS4A 2DVGA 2XL7A 1NOVA 4NWVA 3CJIB 4QPGA 4QPGC 1ONAA 3H50A 2WNUB 1SLBA 3IPVB 3BALA 4G9SB 1IPJA 1HV1A 4FT8A 4BCUA 5T54A 2WINB 2PELA 5BPXA 2Y38A 4V1PA 2ZGLA 2MEV1 3Q9OA 2EAKA 2BW8A 1HRV2 2HWF3 4LE4A 3RS6A 4Q0PA 3KCXA 1Q8SA 5EJ3A 1BVP1 3N36A 3M4FA 4FQ4A 1NE4A 5GLTA 1ZBA2 3RYPA 2WIIB 1BEV1 4COYA 4RR3A 4RR3C 3WT3A 1BYHA 1DF0A 4LA3A 1QNWA 1SMVA 2LTNA 2UU8A 2CYFA 2HWD2 1VBB1 1YXWA 1LB2A 2PLV2 1EPZA 1PO13 1ZYBA 4DPNA 3JBG3 4GMP1 4AEJA 1DFQA 1AX0A 4DRVA 1M06G 1RUJ3 4YM1A 2WNEA 2OZJA 2SBAA 1PVXA 4LLOA 1VAVA 1HLCA 2C5DA 1V00A 4PDWA 3UJQA 3R4SA 5BY5A 3B02A 3WNXA 1FI2A 3E97A 4CEYC 4WVMB 2DUPA 2R6QA 5CVRA 2DTYA 1GSLA 1ZRDA 3KGZA 3S7EA 4ZKTB 4ORFA 5I91A 1UD1A 2ZGRA 3AMQA 3ZFEC 2DU0A 2E7QA 4N9IA 2R32A 4ES8A 1J59A 2AENA 4GB31 3IDCB 4QQPA 4PIYA 5IK4A 4RHV1 4NHKA 4Q8KA 3OPZA 1VB4A 3ZYRA 4HMZA 5IK7A 2WWSA 3LSDA 3IT8A 2FZ1A 1A8DA 3BB6A 1HRI1 1LECA 4RS5A 4LBQA 4RS5C 1X7NA 5CA6A 1PZ8A 2XWBB 3H8UA 4CZSA 1YCIA 3WQ0A 3ENRA 4I0AA 1S55A 1XU2A 5GZDA 2DYCA 5J96B 2WFF1 4BMBA 1UIKA 4CP1A 4K8FA 1XNDA 4YGBA 2OUJA 1Z78A 2ARXA 4GIQA 4UXAA 4P9GA 4YNIA 5T55A 4R9CA 5JCTA 3DL3A 1QWRA 1CPNA 2EAAA 1I6XA 1YJLA 1PNGA 1DDLA 2Q0AA 4H7LA 3RQ0A 2BNOA 2JE7A 5KXEA 5DXDA 4YG6A 1AL23 1N3OA 4MV2A 3D5OA 1TME3 1SACA 2GNDA 2ZBJA 1RUG3 2HWE3 4UBGA 4JCKA 1QH6A 5AVAA 4MGIE 1LOGA 4N9HA 3FHIB 2YYOA 4L92A 1VBE1 4FOWA 2DUOA 3OD0A 1W6NB 4XMIA 2ENRA 3WDTA 4B3NA 3AFKA 4YW5A 3TWIA 5FO7B 1OOPB 2XB6C 3D4KA 5J98B 3BODA 1BMV1 2MEV2 4Q4X3 4RD7A 5FRAA 1RUC1 2JG8B 1OPMA 4LA2A 1PGL1 1NYWA 5BYNA 1HXS3 4K1YA 2WQ4A 3TRSB 3VLBB 4QPIA 4QPIC 5GLZA 3BPZA 3BOWA 1BEV2 4PLOA 2YZ4A 2PHRA 4GKYA 1GANA 3WW3A 1C28A 1GLHA 1KQRA 4KU7A 5AC91 2RHPA 4YGDA 4GMP0 4YRDA 1VBB2 1R093 2A3YA 4LBOA 4OLLA 5GZCA 1EP0A 3VKNA 1KD7A 3AZVA 2VU9A 1BBT2 1LHNA 2RR11 1COV1 1J3PA 2P3IA 2GMPA 2I2SA 1SBFA 1CAVB 2GNTA 2K2SA 1SLTA 5SV8A 2Q4SA 1G9CA 5LRSA 3WDWA 4YW1A 4N43B 3CL1A 3E6BA 4K6BA 3ZDSA 1FV3A 1LOCA 1AXYA 3UJOA 4QGLA 2HWF1 1QJU2 4RHV2 1PNFA 4IV3B 3QOPA 3I7DA 5FOBB 4ZU7A 4Z92B 4I02A 4JDNA 3VZLA 1JTZX 2ZX1A 4F8AA 5J36A 5KHGA 3OTFA 4BPZA 1B09A 5FCCA 1PO11 3J8F3 3MEPA 1MZEA 5GLUA 3DGTA 3JBG1 1LEMA 2WFF2 2Q8OA 3B69A 4YLZA 1LCLA 1NCRB 1RUJ1 4H55A 4IEYA 2XGXA 3NAPA 3NAPC 1TQ5A 1D4VB 4WVZA 5CFCA 5CFCC 1SQ4A 1D0GA 1S0FA 1C8NA 3ZXFA 1W6MA 1Y43B 2QFEA 5AFBA 1MS3A 4XDQA 1N1YA 2HKXA 3AXEA 3VDDC 1ENRA 3JQXA 3AYCA 3VKLA 1QJX2 5I93A 3B7MA 3GYDA 5HCBA 1PM7A 2D3RA 3B94A 1ZZ6A 3MLLA 1PK6A 1PK6C 4R9DA 2Q1MA 3VBSA 3KGLA 3PJYA 2A6ZA 3THPA 1PMIA 4R9BA 5BNOA 1MACA 2ZAHA 4A7KA 5BNOC 2VH9A 1XE8A 3ES4A 4ZU5A 1SLAA 3GALA 4DS0A 3ALQA 1DQ1A 3WW2A 1AX2A 1Q8VA 1G6NA 1DQ0A 4YM2A 4BYYA 2P37A 4C91A 3VBFA 2JD4A 3VBFC 5C4WB 1ZRCA 2QJVA 4FTSA 4KNCA 1D4M3 2GNMA 1BMV2 2R042 3VN4A 1AYN2 1RUC2 4L11A 4QPYA 1O3SA 2CWSA 4LHLA 1H8TC 1VALA 2X53S 3EXUA 4L99A 4SBVA 2CAUA 1KFUL 3NVCA 5LK5A 3MPPG 2QKDA 5AC92 4GALA 4QQLA 4JV4A 5KXDA 2AREA 3TNQA 5C8CA 5C8CC 5L7OC 3WP6A 3SISA 1NCQA 5GZGA 1XE7A 4AHXA 1TME1 1WLWA 2RR12 2ZTNA 1COV2 2HWE1 1UZZA 1QDOA 1I1EA 2P17A 5JZGA 2XPJA 5JZGC 4D7TA 5DUUA 3CNAA 2XVGA 3GZAA 3GZTB 1Q8PA 1ZZCA 1PIV3 2RE9A 2YC0A 5FLJA 3VBUC 2XVKA 2Q1ZB 2XJUA 4Q4X1 4YFWA 2PHDA 4LULA 2IC1A 1HXS1 4XMAA 1YI9A 4AYUA 1EY2A 4N7IA 1UMZA 4A7YA 4YM3A 3S0MA 3ZO0B 1EYBA 2V73A 1RINA 2EXKA 1X82A 2V09A 1TE1B 4LHNA 1U5ZA 3I54A 4BLJA 4S2DA 3WOGA 2WNVA 2WNVC 3VKFC 3GBFA 1R091 2ZX3A 1XNCA 2G4IA 1CAUB 3ZIXA 4COWA 3O0VA 4YGEA 3DPRA 3DPRC 4AHZA 1RUJ2 4KU8A 3MIDA 3ZFGA 4PCRA 3ZFGC 5JSRA 2H6BA 1RL3A 2IXLA 4BIFA 4LBLA 4X8PA 1OPOA 1RGSA 1NXMA 2ZMNA 1D0HA 3ZYPA 4HK8A 1REDA 2JICA 4CEWB 4B8EA 5C6CA 1QXPA 2A70A 1WBFA 1MS1A 1POV0 5T5OA 1F31A 4FPYA 3KB5A 2YPJA 4NPRA 1QHDA 5BNNB 3VKMA 1WCSA 2NPIA 1KDMA 2ILMA 3GHNA 1GNHA 3JB8A 4LBKA 4HKOA 1BZWA 2OIIA 2ZGTA 2A75A 4DOUA 1V9U3 1IHMA 1LHWA 4KWJA 1UIJA 3I59A 3T1LA 2GC1A 4OVEA 2VMIA 5KC5A 1TEIA 3HR9A 2JE9A 1O3RA 3J4UH 3NL1A 1LU1A 2D3SA 2ZAAA 2H0BA 1W0PA 4IEWA 3RYRA 2A6XA 2QZ2A 1XNKA 2QDRA 4RQPB 1B35A 2PTMA 1B35C 2BQPA 3J8F1 5D1IA 5D8AC 5D8AA 5T3NA 2PYTA 3MF6A 4IEQA 5HXVA 4QX5A 4Q4V3 1CQ9A 5DG1A 1QGLA 4I3PA 1VRH3 3IKWA 4RFT0 3WCSA 1C1LA 1Q8OA 3GF6A 1NY72 3IN9A 2PHUA 3BTAA 4YVSC 3L2HA 1N1TA 1XNBA 3SCFA 1OLQA 3VKOA 2Z79A 3WY6A 2X5IA 4XIKA 4ASLA 4TYSA 1G9DA 1WMFA 1SLLA 3WDXA 2IFWA 4JGYA 2X29A 4JGYC 5CU1A 1PO22 5FREA 4E2SA 4FVVA 4HANA 2G9FA 3FLPA 1W6PA 4FPCA 4XF4A 3HT2A 1A78A 1FV2A 1RJ7A 4Y20B 2XKOA 4CDXB 1S0GA 3MDPA 2WFPA 1YRZA 2TBVA 1IS3A 1BXHA 2D5HA 2ZGMA 2ZMLA 3JU9A 1ZRFA 4E4SA 1DBNA 1V6IA 2NQYA 4Z2WA 2FMYA 1MS4A 2WKKA 1D4M1 2C9AA 3V0AB 4Q4X2 2MNGA 4CTEA 3OJBA 2OVUA 4OUMA 4RR3B 3G6JB 4R9AA