3X29B

Crystal structure of mouse claudin-19 in complex with c-terminal fragment of clostridium perfringens enterotoxin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
117
Chain Sequence
AAATERLNLTDALNSNPAGNLYDWRSSNSYPWTQKLNLHLTITATGQKYRILASKIVDFNIYSNNFNNLVKLEQSLGDGVKDHYVDISLDAGQYVLVMKANSSYSGNYPYAILFQKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Claudin-19
publication title Structural insight into tight junction disassembly by Clostridium perfringens enterotoxin
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 23
structure length 117
sequence length 117
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1050 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3x29B00
2XH6A 3ZIWA 3X29B 5B2GB 3ZIXA 2YHJA 2QUOA 4P5HA 3AM2A
chains in the Genus database with same CATH superfamily
1UPSA 1ZBE3 5DUVA 2CDOA 2JE8A 3VBFB 1LHVA 3RFRA 1X8EA 1XYPA 2X10A 3MYXA 1N3OA 4P14A 5F6LB 2WKKA 1OMIA 2LROA 2DTYA 4K9SA 4CZSA 4CXXA 5HXMA 2R7EB 4COVA 4CUGA 1HQWA 1ALYA 1UZYA 2BP6A 2ZBJA 1BEV1 2DURA 2W87A 5GZFA 4XTPA 5DPNA 1MQTB 2DUPA 3RYKA 4PJYA 3P1IA 4WM8A 2OIIA 1H9WA 3FWEA 3H8UA 1GU3A 2B9VA 4JGYC 1IQAA 2X5IC 4LUMA 4COZA 4GMP3 3PURA 1YFUA 1FPN3 5I8TA 4FTEA 5C6CA 3GCXA 1L7LA 3ASIA 5CNAA 3K3OA 5FYTA 5GKAC 5I0RA 1UMIA 1HRI3 5GZDA 1PK6C 4GB32 3CZUA 2QKDA 1BHGA 5IVYA 2WQ8A 1J84A 1VBE3 2P3YA 5FLIA 2VJXA 1SQ4A 2V73A 4RSUA 1IPJA 4YVSC 4P08A 2JWPA 4W6WA 1H2KA 1RTVA 3H7YA 2X8KA 2H6BA 5ABJC 1CX4A 1LR5A 1OD3A 1BQPA 2YHJA 4Q4V3 3EYPA 5JSOA 3J7MA 2MEV3 3RJRA 4R9DA 3RZZA 3W5MA 1DZQA 1K5JA 1CPMA 3VZMA 2QQLA 3UGGA 4NRPA 2VY0A 4PLOA 3ZFGC 3ZN6A 1CQ9A 2WT1A 5DAQA 2DVFA 3J7HA 1OT5A 4H2AA 2V72A 4QKBA 1BVVA 3CKHA 3HN1A 4QPGA 5A7NA 2Y6LA 4Y1XA 3WDVA 4QQOA 4X6RB 4FPYA 4Y33A 4QX0A 5JVVA 4QQPA 4AEJA 2W68A 2WFF1 3ZPOA 5KXEA 2PAEA 3RYRA 2VZ1A 3J4UH 3ZN6B 2Q8DA 4JDNA 4YW3A 2VUCA 3AKSA 3NWKA 2WZ8A 4RS5B 5C3OA 1US2A 3WG3A 4QPGB 1TNFA 3AFGA 1UW8A 5FXZA 5FZ8A 4BQYA 4ZKTB 4XFBA 4NIDA 1AYN1 2CSGA 1SCSA 2JDUA 3M1HA 1LHUA 1JZ7A 3POEA 3I3QA 5EYYA 3HR9A 3GXUA 1O5UA 2YC4A 3B3QE 4BIFA 4QKFA 1F5FA 3VBOC 1RUG3 1ZZ8A 3AMHA 3AP7A 5FTTC 1T2XA 2Z42A 1XU1A 4BYYA 3WY6A 4AW7A 4C0HA 5BXXA 4GIQA 4W6XA 2VCMA 2FQPA 2WR9A 5F39A 4IGQA 1JU3A 4FPHA 4RGKA 2HWD3 3J9SA 1BJQA 2ADDA 3HWJA 1R1ZA 2XJUA 5FZEA 3BGAA 1RUI1 3R0RA 2DFCA 4G9SB 1Z0HA 1GQGA 1EUTA 1DQ0A 1O4ZA 2AR6A 3FLPA 4NHLA 4ZS3A 1OH3A 5AC92 1JZ6A 1B09A 4LPLA 1WLCA 4X8NA 5DN2A 3VB9A 4NO4A 4XYXA 5FY8A 1RUH1 5IVVA 2BWCA 1OLRA 1R083 1ASJ2 2CU5A 2OT7A 3RMXA 1OLME 3LDRA 3QCWA 4EN9B 5IVFA 2YC2A 1MEC3 1EAH3 2E63A 4XF0A 4HVQA 5JZGA 1G6NA 4PI2A 2JB8A 4GB31 5EXOA 5FP7A 4XUQA 4AG4A 2YC0A 4BLJA 1D2SA 3N9QA 1QIQA 3THCA 3ZFFC 4YW5A 2ZEZA 2HWF3 4CTEA 1LGBA 2JDNA 4PBPA 1BKZA 5A3WA 1K5MB 1RUC3 1W6PA 4QX2A 3M7AA 3WW1A 1AJOA 4JRAA 2XBO3 5BNOB 2ARAA 2D6MA 5IHRA 1WW5A 3WUCA 2G9GA 4KU8A 2XONA 1IHMA 1CJPA 5IK5A 1B35A 1NA1C 2O1QA 4QXCA 4UWDA 4XIOA 3MDPA 1POV3 5LBFA 3O1VA 1UZ0A 4Q4W2 4Y1UA 1G86A 5EJ1B 1S0EA 5FY7A 4AAXA 1RVF3 1W6PB 3LOIA 1URXA 5T50A 2JDAA 1RIRA 5DZEA 2EIEA 4RGAA 5DUWA 1HRI1 3GBFA 2NMOA 4KL1A 4GH4C 1GWKA 4RHV3 5C3SA 1UNBA 2QJVA 1AYM1 4JQRA 4NPLA 4OUMA 4LULA 3WG2A 3D5OA 1B35B 4Q4Y2 2X53S 4NROA 1UKRA 1CESA 3J8F1 4OZXA 1WGPA 3WT3A 4XQWA 2G19A 3R05A 2WIIB 3AB0A 1GZTA 4QMAA 3D6EA 1MS0A 1PVXA 4BOWA 2WZR2 1XJAA 1CR7A 2GC3A 2WDBA 4YWAA 3RVHA 3VZLA 2Q1FA 2MEV1 3WQBA 4AI2A 3NO8A 1W99A 1ND3C 2P2KA 2RMU1 3CJIA 1TMF2 5GLUA 5A7SA 1E5IA 2J1TA 3UT0A 1WBFA 4CEYA 1W9YA 4XQ4A 5CFCA 2JJ6A 4AFMA 1TG7A 2PA7A 5FOBB 1H1MA 3GM8A 4E2QA 2AC1A 4NHXA 4E2GA 3HIFA 2ZGMA 3DL3A 3CJIB 3RWKX 2QQPA 1ULDA 1Y9GA 3KVBA 4CEYB 1WA4A 2AZ5A 1C8M2 1I6XA 1YHFA 2BV4A 3MFAA 3TNQA 5CFCB 1J83A 1VAMA 3MF9A 2YBPA 1PIV3 2PELA 3NNJA 3PLQA 5FK8A 1QNWA 3GZUC 3O1SA 1DGWA 1QJU1 2CGOA 5FZHA 4AL9A 3FFZA 4XEZA 4MXVA 1DG6A 4XAAA 3V0BA 1EY2A 3IPVB 3FZ3A 3H7JA 3MUY1 5ACA2 1ASJ1 5C3RA 2VULA 2JKBA 1AVBA 3C7FA 3UGHA 3AM2A 4I30A 3VDDC 4Q0UA 1LODA 2WNUA 4IEQA 2IXCA 3D0JA 1JU4A 1C4RA 4B7KA 1FYUA 2QTWB 3HNMA 1ACCA 1QOOA 2ZMNA 3LSEA 4DPNA 4BXFA 4CRQA 2W9XA 2HWD1 5LEKA 1CJDA 4B1MA 4Q4X3 4CCEA 1W8NA 2JX9A 4KG0A 4B7EA 1CZTA 3N9PA 2WQZC 4QHZA 2WNUB 1O4YA 3B69A 1FMD2 3ACFA 2RM23 1YYNA 2PAKA 4P9IA 1LENA 5FPUA 4KWKA 1ND2C 4FAHA 1DQ4A 1H4HA 4N43C 1G9CA 4NRMA 2G1MA 1HX6A 3NJZA 4ATEA 3BKZA 2IXIA 1EAH1 1SLLA 2VECA 4BB3A 4XDPA 2Y6JA 4DUXA 3VBHC 1YWKA 1SG3A 4OHXA 1AR93 3JQWA 4FQZA 5GLVA 2J1VA 3MBWA 4XPVA 4Q4Y1 3N35A 4Y1VA 5HV4A 3L2YA 1WW4A 3POFA 4NN0A 2P17A 1IS5A 1RUC1 4IV1A 3ZN4A 2A1XA 3KCYA 1RUNA 3URFA 2VMCA 2ZGTA 4RL7A 3Q8BA 2NZ9A 1H2LA 3JB8A 3WVJA 4XF4A 1ZRIA 2O0OA 2VW1A 3H3ZA 4ISQA 1LHOA 1JH5A 1W06A 3GJAA 1EP0A 4R8HA 1VBB3 1GOHA 5GZCA 2CGPA 2D3PA 4GWMA 1DGRN 3KF5A 4BJ0A 3RZLA 1S0CA 4RR3A 5LW9A 2CL2A 1X8MA 3HPNA 1CN1A 4OZOA 5LRRA 1KDMA 4O7XA 3K4AA 3Q8FA 4OQ8A 1W2OA 2EA7A 5JPMB 2B8MA 4HSJA 4YG6A 5FZMA 1W2UA 5E88A 1HW5A 2KXLA 5F3GA 3K4ZA 4Z1VA 5L19A 3TEXA 3JD72 4ES9A 2PYTA 3SCFA 3OBTA 1JN2P 5GJ6A 1ULPA 2WNVA 5A3NA 1SFPA 1VBA3 4FOYA 4C91A 4FXGB 1OPOA 4LKDA 3W58A 2HWE3 3U4SA 2VZPA 3MIGA 3WW2A 1MS1A 1BCXA 5ACA1 3IN9A 2C0ZA 1H6YA 1K45A 3H1YA 3ZSKA 1QGLA 1QJX3 2E32A 3T08A 4FP3A 4K8RB 5FPLA 4YYOA 1NYWA 1AR62 5D8AA 3POJA 5I0UA 4CXYA 2R063 3GZAA 4XFCA 5FZIA 4ZPIA 2AGSA 2OQ6A 1I5PA 4XQDA 5FZKA 1ZBA3 2W91A 2ZEWA 2VMHA 2VM9A 2YFZA 3VZJA 3ITQA 4RYDA 2VZQA 3ZFEB 5CVRA 3USSA 1PIV1 2DWRA 2VZVA 4Q8KA 1AR73 2RDNA 5FZ3A 2ZGSA 1FMD1 5DAPA 3U78A 1A8MA 4LIUA 4HSLA 1HN1A 3TEYA 5FZ7A 4GMP0 4G4FA 4UXAA 4AI3A 1BMV2 3IKWA 5GLZA 4FXKB 1U5XA 3NKGA 5EV7A 5A32A 5F1RA 1NE6A 4N7IA 1CAWA 5EYXA 1RUE3 3ME2A 4IW3A 4D7TA 2ZS6B 1L7QA 4K3UA 4AHZA 1UYPA 5A6YA 5KHGA 2FDGA 4IXLA 1PVC3 3ZO0B 2YMZA 1OF3A 3AYAA 3VV1A 5C4WB 3OPWA 1QH6A 1PGL2 5T5PA 5A32B 4QPYA 1CAWB 1WLWA 2EXIA 4A42A 4R4ZA 1W0NA 1PK6A 4GWIA 4X8PA 1JYCA 2W08A 1XE7A 5EZWA 2CAVA 2JG9C 2BNNA 4EZHA 2ZKLA 2F4PA 2PHRA 1RUF2 2LTNA 2VUDA 4YVSA 4AFBA 4XUTA 2VG9A 1PK6B 1RXGA 4Z82A 1W8WA 1HQNA 4LKSA 1OH4A 4IL7A 1AR91 3VGIA 2B46X 3LOBA 1K42A 3VBRB 1LTEA 4CDUB 3SQOA 5F3EA 3T09A 3ZR6A 4D8MA 5FYSA 5IVBA 1IKPA 2XJSA 5HBAA 3SH4A 5HPOA 4JV4A 3RS6A 5A1AA 5LASA 1JUHA 4DXSA 5KHHA 1V9U2 4QB2A 3BB6A 3MIDA 5JXGA 1AJKA 1V0AA 4LBMA 3ZXFA 5IT6A 2VMEA 3UKTA 4IE6A 5FJKA 2ZCWA 3I3DA 1NY72 1DLLA 1W9WA 2R043 2W5FA 2Q8OA 3FHQA 1AR61 3E6DA 1VBB1 1QMJA 3CU7A 1VJ2A 3PHMA 1RHI1 2P5BA 4M0NA 1H30A 1SDWA 1ZRRA 2A3XA 1LHNA 1EV13 4OMCA 4YZ5A 5JOXA 3VN4A 4JZRA 4BWOA 4OLLA 1DHKB 1UOBA 1GQHA 1GSLA 1LKNA 1GMMA 2JKXA 2RR12 2ZZJA 4LQRA 4XF3A 3EB7A 2NN8A 5F8PA 3MPPG 3OD4A 2BFUS 5BYNA 4FFGA 4DEVA 2Y34A 3UESA 3K48A 2IUWA 3VBOA 4IERA 2D5FA 2EIGA 4QKDA 5CKMA 5FUIA 4E8DA 5FUPA 5LY1A 1SZBA 5EHDA 4FFIA 3AKTA 1DQ1A 1XNAA 4LHNA 2DVAA 3QACA 4XBNA 5F7UA 1JZ8A 4CSWA 3L2HA 4BZ4A 1H8TC 2RS33 2ZZQA 3DCQA 4N9IA 4RQPA 1GWLA 1R091 1BVP1 1QJX1 5DG1A 2HWC3 1GICA 4UFHA 1JYVA 4JVAA 1VRH3 5BNPB 3AKPA 4HETA 3HVDA 3VBSC 2IXKA 3T1MA 4WM7C 5FIXA 3O1MA 4XFHA 1AR82 4QXKA 3ZMOA 4GA9A 4A6OA 1ZBA1 2GC1A 5FMDA 5APAA 2Y26A 3WZ1A 2G4IA 4IGOA 4RQPB 3ZM8A 1S0JA 1YO8A 4EN6B 4MG2A 5J37A 3UJQA 2BEOA 4JKMA 1JZ3A 3ZFFA 1MS3A 1POV0 3E97A 1R1A1 2V4AA 5CAZA 3AYEA 5CG8A 4P9JA 2CWSA 2YPDA 3FC0A 3VZOA 4BH9A 3PMSA 1LGCA 3PMEA 2GN7A 3DGTA 1C5IA 4AHWA 1UX6A 4NPRA 5HXVA 2D3RA 1YFXA 1JYTA 1QJY3 2R49A 4KH9A 2ZACA 3ZFFB 1D0HA 5GZGA 5E8AA 1XE0A 1NUKA 2NM1A 5J09A 2B42B 1G7YA 4XAEA 1MVEA 3AFKA 1EYBA 1VBC2 2JDMA 1D7PM 1NZIA 2ZAHA 3QLQA 4P9LA 5F5IA 4NR1A 1HRV3 1CPNA 1CVNA 2IXJA 3ORJA 4LORA 4GH4A 2XB6C 4QQHA 3SKJE 1H6XA 2V5YA 2Y33A 4QX5A 1ENSA 5C3PA 1OVSA 1PO22 3RNSA 2RS53 4GXLA 3KHCA 3OCPA 5LBEA 1G9AA 2RDQA 4HKWA 2D3SA 3D4KA 5FZ4A 4Q5OA 1N1YA 3C3VA 4UFKA 4YARA 2E33A 5J7MA 3ZIXA 3MO4A 4B4RA 2QQWA 4XW3A 2BZDA 2WT0A 4GH4B 2XOMA 3IB3A 4MGKE 1BYHA 2PHDA 4PDWC 3KLSA 1ND3A 1NLQA 1Y9MA 3R4UA 4UAPA 4CDQC 1Y43B 2BGPA 1DLCA 1LOEA 2XVKA 2JG8C 5DDJ3 2WS92 4NIGA 2PQSA 3ZPYA 2EVXA 5A1FA 1ULFA 1UZVA 4JGZA 5FP3A 4MYEA 4U36A 4CVUA 2E31A 1QHDA 1QDOA 4DMIA 2PAMA 1ND3B 2XPJA 4JQTA 1ZNPA 4XC9A 3TN93 2ENRA 4C1WA 3I2IA 1IS4A 4Y5TA 4IEOA 1QDCA 3BOWA 3IBMA 3OG2A 1NXD1 2ZX4A 3C7HA 3HBKA 4L11A 3FLTA 4JGZB 2WQ4A 1JYIA 1NCRA 5FKBA 3LD8A 5IFPA 3ZXKA 4WVZA 2IFWA 4CP1A 1QQP1 2RJLA 2IWGB 1N3PA 4I3GA 4AXOA 3EJKA 4HKOA 4MSVA 2WYSA 1RUD3 5SV5A 2ET1A 1JTZX 1SFNA 5B4XA 4XJUA 5FFOC 3KM5A 3RSJA 3BUCA 3PUQA 3VDDA 2HWB3 4E4HA 1PGSA 2AACA 1NCRB 3D8CA 4H55A 1XBFA 4EYUA 5JDBA 4A7ZA 1RXFA 5T55A 5KHJA 3JU9A 5DZFA 2GSYA 1LOCA 1PX3A 5FYUA 1A8DA 1ST8A 5E1RA 3RG0A 1CAXA 4NAMA 4LO7A 5JWPA 1V70A 2X09A 2WLQA 4JX0A 5CIRA 4AEDC 2GDFA 5L7OA 1W8OA 3GYDA 4QHOA 4ZS2A 4KG8A 3VD7A 4A44A 5FPXA 4BMEA 1NCQC 2LRPA 3U10A 4CYDA 2BPA2 2VZUA 3DV8A 1ND2A 2ZHNA 2W46A 5A7WA 1V6KA 2W3JA 1W8HA 3OUJA 4XJAA 4CCCA 5J3UA 2Q0AA 4TXWA 5JSRA 5FWEA 1LEMA 3PJQA 4AOCA 3H8XA 5L7OB 2HEWF 3ZXJA 1LOAA 1IZ3A 3ILNA 5DUUA 1MZ6A 1U5IA 3VBHA 4EN7B 2VNGA 2VMDA 2W1SA 1UAIA 3ZKYA 2XJVA 4OFGA 3BU0A 1ND2B 4OHZA 3ROUA 3C7GA 4DY5A 4BXSV 3HQRA 1LHWA 1SPPB 1W05A 2BQPA 4EZ4A 3FX3A 2CGNA 2PLV1 5JOWA 5FYVA 1BLZA 2J1SA 2WAOA 4XF1A 3KV6A 4D3WA 3AL5A 2FMYA 1S55A 4Q1PA 2OKXA 3TNPB 1KS5A 3WCRA 5L9VA 4I2OA 3MEPA 4JTNA 2FMDA 4QPWA 1PO13 1VB4A 1VAVA 1WLTA 1UF2C 2DCZA 2R073 3VL9A 2AUYA 1DGRA 2X05A 3D82A 3U11A 5LEJA 2YFUA 5DG2A 3JZVA 4ARXA 4JHZA 2WWSA 2CYFA 3HOBA 2RS51 3A0KA 3PTRB 4RA0A 5FZDA 1H1IA 1C3HA 5I8YA 1UD1A 2ZEYA 3OBRA 2XUMA 5FO9B 3R4DB 1VALA 2E7AA 2LW8A 1CIWA 2WYFA 3J7NA 4M3CE 1ZRFA 1F4HA 2WFF2 2ZGLA 5FZ0A 5I8SA 2RJ2A 5KC5A 3SEEA 3TWIA 1JUIA 1S0FA 2BERA 4NVPA 5FZLA 5FY0A 5A7QA 2VD7A 3ZXDA 1PM7A 4YGEA 5DDJ1 3H1WA 4LBKA 2H6CA 1VR3A 4G3YC 3K51A 1SBEA 3P3NA 1W6QA 3T2PA 2YV8A 3NV2A 5F5QA 4XOGA 1OC1A 2A6YA 3POWA 1KFXL 3ZSLA 4XACA 5AVPA 3ELNA 1XNBA 4HL0A 4PQ9A 2QFEA 2UWAA 1ZYBA 2VOWA 3I2FA 5A3PA 3GZTB 1N3QA 4BE3A 5A70A 4LA3A 1FOD2 4YZ4A 1ZZ9A 2VVEA 3Q8AA 4Z07A 2XL9A 2ZHLA 4QU2A 4XXPA 2XKPA 1RUI2 5HCAA 1BK0A 3ZIWA 1G9BA 4Q2FA 1U5ZA 1O8PA 2A73B 3WQ7A 3QH7A 4OULA 1RUH2 2XVLA 3WNPA 3MUZ1 1W04A 4FPFA 1UU5A 1QEXA 5FPAA 1DBNA 3M8LA 5K0UC 2ZHKA 4YZ2A 4HMZA 1E5RA 3AXDA 3U07A 3WDTA 1HV0A 3CIHA 4JHTA 3ZXAC 4YVWC 3PUHA 2YDEA 4WZCA 1PM4A 2RS11 3CL1A 5FKCA 4WM8B 1KDKA 1YRZA 2WZEA 4LBLA 2PHLA 2XQXA 2GALA 4LLOA 2GMMA 2XDVA 4RD7A 4XABA 2JG9A 3UGFA 3K46A 3ZDVA 1GKBA 3SCHA 2F4LA 5CFDC 4JC1A 2BTVC 2OVUA 4IUGA 5B2GB 3ZDSA 3V65A 2A7AA 2Z69A 3NV4A 4GALA 4FSJA 4E4ZA 1OKQA 4TN7A 2VBBA 3H0OA 2LS6A 1HB2A 3OGRA 4FOQA 1FXZA 3I3EA 2Q8EA 1FPN2 2WC2A 3G6JB 2FHRA 1CAUA 4QAWA 2Y6HA 3LSDA 2A70A 1S0BA 1IPKA 1WCSA 1YI7A 3WQ1A 2CY6A 1HRI2 2K0GA 5JMOA 4YM1A 2RE9A 5C9AC 2FD8A 1F15A 1AYM2 4PQQA 4YW4A 3TYJA 4E8CA 3PVNA 5C33A 1GYKA 1W8ZA 2GP3A 3J8F2 5FUNA 2E51A 4Y4RA 1YFWA 1REDA 1A3KA 1DYKA 2O14A 1ZA4A 1PO11 2BBAA 3POYA 2FDKA 4NWVA 1VIWB 2MEV2 3K4DA 4HK9A 3WNOA 1OQEA 2RMU2 1I5ZA 1RINA 5FXXA 4B8EA 2XR4A 4C0BA 1GNZA 3I2DA 4N8MA 1AUYA 2BFUL 1DZTA 2WN2A 1HXS1 1MS4A 1WD3A 3MLKA 2HH9A 5CBLA 5DXDA 2XVGA 3WNMA 2WWUA 1J3QA 3FLRA 5FAXA 3ZSMA 1M06G 3SLIA 3VL8A 1FOD1 1VPHA 4CE8A 4A7YA 1RUJ3 4RN5A 3WF3A 5BY5A 2JDZA 4CA9A 1JODA 3T2TA 4P5YA 4CUAA 4F83A 2ZX0A 4XCAA 5K7PA 4H7LA 1QJU2 3INAA 3MLLA 4XURA 3VBSA 1Z7S3 1Q3EA 5DABA 5FPVA 4WM7A 2PHFA 1TQ5A 3ZMNA 1W8FA 5LA1A 2G9FA 4QDQA 4L0PA 2Y38A 4CDWA 4DXZA 1ZZ6A 4V1PA 2UURA 1AZDA 3NJXA 4DY3A 4LITA 4EWAA 3WOGA 4ASMB 1PZ8A 1BBT1 5FP4A 1RUG2 5ANNA 1OBNA 4LBNA 4NRQA 1D0GA 1H0BA 1ZBE1 3WUDA 5DQ0A 4M01A 5LWBA 1UYXA 3IMNA 3RI9A 3HD8B 1BK1A 5IWFA 2D43A 1GWMA 1UQXA 2N7GA 5JMCA 3WDWA 2VAUA 1PNFA 2HWD2 1XNCA 3HAGA 4CDWB 3NV3A 1WMEA 2VNVA 4F7ZA 1COV3 4I3PA 1AX0A 4XUOA 3E6CC 3A4UA 5JZGB 4BMBA 5JXHA 3ZYGA 4YW6A 1UY2A 4ZY9A 4LE3A 3CDZB 3WP4A 1I9RA 1K3IA 1OSGA 2K2SA 4CCLA 4Q4W3 3PVBB 3NNFA 4M3CF 1VMJA 4FPKA 4Y5SA 5LZ6A 4DXTA 3GBGA 4GMP1 1FPN1 3LDBA 3SEPA 2JIJA 2JE7A 4BLIA 3A22A 3NAPC 1SBDA 4QHBA 1MEC2 1EAH2 2CAUA 5FBZA 2KR2A 1NT0A 4DB5A 5J48A 2DCKA 3PNAA 3M3OA 3GF6A 1OFSA 4XF9A 4XUNA 1VBE1 5A7OA 4AVTA 2AH2A 2CV6A 2KA3A 5F2WA 2WZR3 2ZGOA 4D7YA 2ID4A 1RUC2 3S7IA 1JOBA 4EWDA 2DF7A 4Q4V1 3AL6A 4BHPA 4GD4A 1FI2A 2GNBA 4I0BA 3LEMA 2TEPA 2D6KA 2EAAA 4CPBA 4PDWA 4QX7A 3WG1A 1FATA 3HEIA 3PIJA 2JG8A 5E6HA 5FMOS 3DKWA 3AVSA 4DUVA 4KNCA 1DYPA 3JB4C 3USUA 4BISA 1W6MA 1C8M3 1UO9A 1SACA 4M0HA 5GZEA 3DEMA 4JTOA 4PDWB 3SITA 3NVCA 3N4MA 3MI8A 3W5NA 2VQTA 4IV3C 4QM8A 5L9RA 3UJOA 3E5QA 3SKVA 2W95A 3ZLIA 2JG8B 3SHRA 3RZJA 2QQOA 1D4VB 1RYYA 4QPIC 2OPWA 1FNZA 2WA4A 3AK0A 3LPGA 3QH6A 1GP5A 4UBHA 2DBNA 3UNPA 2OW4A 1W6MB 3KHBA 3BTYA 1VLNA 1J59A 3BTZA 2D93A 3DUIA 3KQ4B 4XBLA 1LOFA 3CMGA 5FZGA 4IQPA 2JIGA 4IEPA 4EJRA 4KGGA 5JI9A 5HI0A 1JXNA 2DUOA 2B39A 5T5LA 3V0BB 2NQYA 2ZAAA 2C6SA 3HT1A 1RUG1 1V6NA 3CJXA 3BVCA 1OXCA 3NNLA 2B7YA 1W9SA 1V6OA 3A21A 3MIEA 4TWTA 4GWJA 1VB2A 4W4ZA 3N3HA 5DUXA 5H9RA 4HN0A 3D3AA 3KD4A 2YUEA 3ILFA 3M3CA 2B45X 1WUVA 4ORFA 2YBKA 2WO2A 2YPJA 1AXYA 1PIV2 4BQ4A 4K1YA 3G7DA 1C57A 4AEDA 3WX5A 3WNLA 3GALA 4X6QB 4Y1ZA 1OA3A 1NCQA 2JB4A 4XZUG 4BK4A 1R081 2E7TA 5LRSA 1LEDA 4AVAA 2ZKNA 3ZYHA 1VMHA 2XH6A 1XNDA 4L99A 1MEC1 1X9TA 4NHKA 5H9PA 2Q8CA 2RG4A 3TB0A 5HCBA 5FDBA 4BA6A 1S0DA 1WA6X 4META 2VQAA 2JD9A 2RDSA 3N7JA 4XJZA 2HWF1 1H1AA 1YQCA 3AMMA 3OBZA 4QGNA 4NJ4A 4NHYA 4XBQA 1COV1 4QX8A 2IC1A 5DAXA 4Q4X2 1LRHA 4LO5B 2XBO1 1W6NA 4DUWA 3KV5A 3FUOA 4UT5A 2JDKA 3EMRA 1KXGA 2RM22 4XVHA 1YJKA 3AKRA 3TOJA 3VKFC 2GP5A 1POV1 1TE1B 2DTWA 3N7MA 1O3SA 1S2KA 3VHPA 1RVF1 4IV1B 5EFUA 3DPRA 2P3IA 3TAYA 1W6NB 2YY1A 3VD5A 1RB8G 4BQWA 2DU0A 4MOAA 4RHV1 1OLMA 1AR92 4DINB 3I97A 4Q8LA 5IATA 2A71A 4EN0A 4YRDA 1MS8A 3GDBA 3H1MA 4HONA 4IEWA 1D4M3 3VZNA 4AI1A 3VBUC 2W2IA 5KWRA 1X7NA 1TZOA 1YJLA 3RGBA 1DQ2A 2ES3A 2PMWB 3DPRB 3RQ0A 1WD4A 4YZ1A 4YSFA 2EXJA 3PUSA 4LKEA 4IEVA 4LMFA 4NIHA 5BV6A 1KJRA 2QQJA 4RR3B 1YC61 3OJBA 2W94A 2WINB 3R4SA 1OQDA 1W2AX 3LKJA 3THTA 4AQ6A 4NHMA 4I02A 1VBB2 4JKLA 1RC6A 1RHI2 4CPBD 1FX5A 3KCCA 3W9AA 2IXLA 3GCWA 1OVPA 2WNVB 4EQVA 3OGJA 2JDHA 5FYHA 4HVOA 1RGSA 4GJYA 3OSDA 1Q8OA 3ZSEA 4N53A 1I3HA 1LU2A 3JBG3 3RMYA 1UY3A 3PUIA 2W47A 3DXUA 1UIKA 4W6YA 2J7MA 2QZ3A 5D8AB 5FYMA 1TEIA 4UW4A 4WBBA 3VDBA 2J42A 3A23A 3RRDA 3MW3A 1NQDA 2RV9A 3WP6A 2BRTA 2HEYF 2TUNA 5LBBA 3VBFC 4DRVA 4OI0A 1JOPA 1NKGA 1NG0A 4N53B 4FP2A 4K20A 4BQ2A 5A6XA 1R092 1QJX2 3I2KA 3JUUA 4BU2A 1GR3A 1LU1A 5C7GA 4OHYA 4QM9A 2OUHA 1QKQA 3E1F1 3NNMA 2X5IA 4JGYA 1J58A 3FN9A 1YQ2A 1MQTC 1ZBA2 2BNOA 2XJQA 5FMBA 1L7RA 1HN0A 5K0UA 4JDOA 4DXRA 1HB4A 5CKNA 3LAGA 2C4XA 4Q4X1 1OA4A 4TLGA 2E53A 2ADEA 4YVWA 2QQKA 5IJRA 4XDQA 1W8TA 5F32A 2RM21 5DZGA 3ZN5A 4PIZA 1R1A2 4JGYB 1UU6A 2X5IB 5L73A 2BBVA 4IE5A 3BODA 4GKXA 5K0UB 4ASLA 4MHRA 2C26A 5CFDA 4YNIA 1HB3A 4LBOA 1UY0A 5JIUA 2Z4FA 2GH8A 2PQQA 5ABJA 1RUE2 2JECA 4DOUA 3HT2A 4BCUA 1ULEA 3AJZA 4YVWB 3RPQA 5EIYB 2I45A 3IDCB 1XYNA 5KHKA 3FFQA 1OD5A 4OUSA 1IS6A 1JHNA 1PVC2 4YG0A 2VOXA 4CCKA 5C5UA 1ENQA 1KD7A 1REFA 4KU7A 4S2HA 4B4PA 5KC6A 4HKLA 3ZFGA 4COUA 3ATGA 5F5AA 4OUEA 4YVSB 2ILMA 5I0TA 2HJIA 1JZ5A 2D40A 4NOTA 5ERLA 3THDA 1KRIA 5ABJB 3AZXA 5JOZA 2ARXA 1CZVA 1O5LA 2QQVA 2Y0OA 4KWUA 1OLQA 3LZZA 4LK7A 5FYCA 5FPZA 1UX7A 4FFHA 4LJHA 1AL23 2Z5WA 3NJVA 1W2TA 2CTVA 4Y24A 3V64A 3ZFGB 2Y6FA 4YM0A 3LCPA 3OGGA 3AMQA 3ILRA 3CF6E 3FMGA 4Y26A 2RR13 3U14A 3VZKA 1NAEA 3QOPA 2ZX3A 4RS5C 3FBYA 3WNXA 1KQRA 5LK7B 3VDCA 1PMHX 5FYZA 2VE1A 2OZ6A 2QVSB 2W52A 4XILA 5FLHA 4AYUA 3RYPA 1TME3 5FOJB 3KSCA 1KJLA 2ERFA 5FPBA 2WUHA 2Z79A 4S2FA 2BGOA 2H0VA 3O0WA 1C28A 4I0AA 4IEZA 4BK5A 4BDVB 3H8RA 1VBA1 2HWE1 4QGLA 3UV9A 1OOPC 4INDA 1SFYA 1KS4A 1RITA 1Q8VA 2VR4A 4YLZA 5KXCA 3LGRA 4CCOA 4UF0A 4LT5A 2DVBA 4TZDA 3VBOB 3RZGA 2BNMA 5FREA 2XQRA 4QB6A 1DCSA 1GZWA 2R061 3MIHA 1S0IA 4AE2A 2P3JA 1QQP2 1S2EA 2NMNA 3H3LA 1QU0A 4ITCA 4AHXA 2DBIA 5KXBA 3ZYPA 4LHLA 4UW3A 3JBG1 3AP4A 4UF0B 3E5XA 4PBOA 3C2UA 2SBAA 2YXSA 3J7LA 2FCTA 4BQXA 1AR71 1E5HA 1UCXA 2A6XA 1GZWB 1UOJA 3O1TA 5FXVA 4QQLA 5FO8B 4XMIA 4IEYA 1GZ9A 4TYSA 2RJKA 4WVWA 2XL7A 4JCKA 2QQIA 3S7EA 1NXMA 4CU6A 4KWJA 1O3TA 3T2QA 1RUE1 3PU3A 4DO0A 3WF1A 1VRH2 5IUQA 1AF9A 3C7EA 2DFBA 1K5MC 1QWRA 2A3WA 2D7FA 1VBC3 1V6JA 1PVC1 2W39A 4UYBA 1NA1A 1WW7A 5BNOC 3O1RA 1U5YA 4YW2A 4AF9A 4AAPA 5LY2A 2TBVA 1UY1A 1DIWA 1XOYA 4FTSA 1GOFA 1AL0G 2VO5A 3ES1A 2UU8A 1YQ5A 3NAPA 2VZSA 2ZXQA 2ZTNA 4MUVA 4Q27A 1NOVA 1V6MA 2IZWA 5D21A 4E4SA 3SXWA 4LBJA 2DVGA 2CWMA 4LUKA 1NA1B 1GP6A 4AZZA 2QCSB 2NP0A 1OHFA 5F6KA 5L9BA 5I0SA 1XSQA 4QDRA 5A3MA 1X82A 1QXRA 5JR7B 1VBD3 2VUAA 1ULGA 3AP6A 1OUSA 2Q5TA 3NAPB 2LALA 2WT2A 3NJYA 4CDXC 2PLV2 3ZYFA 4COWA 1JYNA 5IK7A 3SH5A 1MS9A 4AVCA 5JR2A 3EBRA 4A3ZA 1QJY2 3Q8CA 2HLEA 1LNSA 1F9KA 4D94A 5FMOL 3B02A 3DYPA 2BJSA 4PLMA 4CUCA 4KGQA 4UFMA 4NWWA 4CEWC 2VNOA 2C9KA 3NL1A 4I0WB 1SLBA 1HRV2 1GOGA 1S2BA 2NLRA 3F2ZA 3SISA 5FYBA 1RMU3 2PTMA 3LEGA 2WO3A 3N36A 4BQ3A 4MVTA 2JD4A 3LA2A 5DAWA 2RS52 1CIYA 1AL21 2YBSA 3IIAA 4LA2A 4AVVA 3QD6A 2C9AA 2R041 3I2OA 5FRAA 4E2SA 1LGNA 1G8WA 3LFIA 3MIBA 5I91A 4JKKA 1CGPA 4QPIA 1LOGA 4HANA 1EV11 4AQSA 4D7SA 3N9OA 1BXHA 4P9YA 5BNNC 1R64A 2BGCA 5T5OA 4KBBA 1UYZA 3SMHA 1O4TA 2J1UA 4P00B 1WCUA 3AMNA 1PGW2 3WINE 5DDJ2 3OY8A 2GN3A 4IE4A 3ZYIB 2I07B 4HK8A 2D44A 4QPIB 1UZZA 1ENXA 3JQXA 4E4DX 5FQ0A 1W3VA 4ET7A 4COYA 3WF4A 2DCTA 2ORZA 3PJYA 4BIOA 4Y22A 2ZGPA 3POIA 3TN92 2RS31 3CHXA 5G04L 3OY8B 1O3RA 2B9UA 4XUPA 4HZFA 1GUIA 3VDDB 2HWC1 2E26A 1J1TA 1VRH1 5FZCA 3B9CA 5F5CA 1V6LA 5CA6A 1PNGA 3IDBB 4Y5Z0 1BEV3 3JXSA 1H8VA 4MADA 1DF0A 4ZZ8A 2X29A 2WSVA 1YCIA 1XC6A 4N43A 2WWJA 4N9HA 1W03A 1RUD2 5EWSA 4AI8A 2DCYA 3NMBA 2VMGA 2F17A 3H3UA 4YM3A 3WNKA 1CAXB 3ETQA 1H9PA 2QDNA 1OURA 1W0PA 3S0MA 1UPIA 5K8SA 2DCJA 2OYZA 4HVRA 4NPMA 3UETA 4W50A 5GLWA 3ZOIA 4S2DA 4XETA 5LK5A 4I01A 5A7WB 2D5HA 3M70A 4N43B 4HN1A 1SBFA 4PLNA 1W90A 2ZJCA 4OI4A 3T0AA 3ZSJA 4CU9A 4PIYA 4ZXEA 5J96B 3UL2A 3O0XA 2RS12 2ZMKA 4QX1A 1HJGA 3ACLA 4UFIA 3I2GA 1WKYA 3VBHB 1QJY1 5LA9A 2OXBA 4BQ5A 4QWNA 4M4PA 4YGCA 2ZGKA 2Q4SA 3ALQA 1YXWA 2BOIA 5SV8A 2PHXA 2P6HA 1HRV1 2JDYA 1PMIA 1J3PA 2D6PA 2IXHA 3AZVA 5D2AA 5CISA 4Z8BA 2QZ2A 2OX0A 2VTXA 4DFSA 5FY4A 4QKNA 2ZX1A 3C7OA 5JOYA 1UWWA 1YNAA 4PHZA 1NLSA 2WNOA 3VBUA 4B3NA 1O3QA 1LESA 3AMPA 2WFF3 3OPZA 1N47A 4AGGA 1W6OA 5BNQA 1RUOA 4AVSA 1GZCA 3MGUA 4P5HA 4YGBA 1N1TA 4Q0QA 4I09A 5DAVA 4AFAA 4FCAA 4NE9A 4O65A 3RZKA 5ISLA 3ZXLA 1Y3TA 4Q26A 4KQ7A 4EROA 3EXUA 1AYN3 1PGW1 3ZKUA 2W0XA 3WHTA 1PO12 3S30A 2VBDA 5F37A 1WW6A 4GULA 3AXEA 2R072 4FOVA 5FBJA 4ATFA 1W6OB 5CADA 2DU1A 2VPVA 3AP9A 1POQA 1ZX5A 2XLAA 4V2VA 2P37A 2C5DA 1OQ1A 3BOPA 1X9PA 5JI7A 1HXS2 4ZU4A 4N90A 5ANQA 3TN91 2W92A 5G05L 3ACHA 3MPBA 4HOOA 1JHJA 3O0VA 4NMIA 5J98B 4AWDA 1W6QB 1RUI3 3ZFEC 5F9TA 3ETPA 4PF1A 5FZAA 4JRLA 1TNRA 3DXTA 3IT8A 3KCXA 4HT1T 5IW0A 2J22A 4O61A 5IYYA 4Q1RA 1RUD1 5FV3A 3VBFA 1GANA 4ZHNA 4AGVA 3LFMA 3LIHA 2GMEA 2VC9A 5C5TA 1GV9A 2HWB1 2AEZA 4AEMA 2XXZA 3APBA 4WVVA 4QDSA 5FY5A 3NQHA 3AJYA 2LUWA 2K46A 4GB33 1MQTA 1Z78A 3I8TA 2AREA 1O6UA 2FDHA 1UOFA 1O59A 2ZGRA 2I2SA 1BBT2 3BI3A 1QXJA 1ZBE2 2A6ZA 1KFUL 2GNMA 3I7DA 2QUOA 5C4WC 1IS3A 4AFDA 4MGIE 1KGYA 4XCBA 5HCFA 1K12A 5FLJA 1WZXA 3CQOA 1IGOA 3BIWE 4FAGA 2XG3A 2VGDA 5LA2A 4CCJA 4W8JA 3O1OA 5DMYA 4AFCA 2R30A 4ISRA 5A6ZA 1XE8A 5I93A 3I2JA 3AZZA 1QJZA 4DRRA 2KM2A 1OFNA 3DYMA 2F6BA 3O5SA 2JG9B 5T52A 1MVQA 3N7KA 5M0TA 4L9BA 1ODNA 2XJPA 1AYM3 1CAVA 2PHUA 4LIVA 4K1ZA 2VCBA 5JIAA 3KGZA 2QNKA 4UFLA 1UXZA 3OEBA 3VBRC 4BPZA 4CDUC 4M4RA 1T6BX 3J8F3 2ZA9A 3I3BA 1NQJA 1OF4A 3PVOA 1Q8SA 1VBE2 4GAZA 1PZ9A 2EALA 4YZ3A 2VBPA 3WW4A 4ZU7A 5C8CC 3IIIA 3KT4A 1DU3D 5JPNB 1CAUB 4MZUA 5FZOA 2DDUA 3WV6A 4ASKA 2RMU3 1CAVB 5IK8A 3H8OA 2YG0A 4Q4V2 5CKQA 2R071 4XFAA 4DS0A 5A80A 4A2UA 4FBFA 4RS5A 3HNBM 3OEAA 3SCGA 2JXAA 5JAXA 2HBUA 4P9WA 5JLVA 2ZGNA 5FZOB 3D0SA 1AX2A 4AI0A 4OHWA 1HLCA 4YW7A 1SLCA 3B00A 1YLLA 4JDMA 4WV8A 2D6LX 1JYXA 3OD0A 3MLJA 3PL0A 2ETEA 5C70A 3AZYA 4YFWA 1X36A 2EAKA 5AC93 3KVAA 1OOPA 5FZ9A 1QJU3 2SLIA 1UY4A 4U2AA 1H8TA 4AK3A 3GBWA 3TBDA 2HYKA 4O9GA 3X29B 4OI2A 1MACA 3H50A 4HG6B 1ZRCA 4QB1A 1ASJ3 3B93A 4R9CA 3TEWA 3P6BA 3WF0A 4TTGA 3OYWA 3HJRA 3MICA 1HQLA 5BNPC 4DIQA 1OOPB 2W1UA 3S5QA 2OUJA 1H8TB 4DQAA 3BYWA 4D0QA 4PIXA 5FR3A 3VDAA 3V0AA 4KBZA 1A78A 4J1XA 1FNYA 2Z2SB 4K8FA 3K2OA 3MW2A 4LOTA 3VBSB 5J36A 4RQPC 3BIEA 4WM7B 3OYWB 4HFSA 2WL1A 2ZOEB 1CX1A 3MHZA 1RUJ2 3HMYA 4M3CA 1J1LA 2LM3A 2QDRA 5IAVA 2DYCA 4XDOA 4D6RA 1NZCA 1SHWB 2R32A 3CO2A 3T0DA 3V0AB 4H3WA 1Z7S2 1K5MA 2VXRA 3WG4A 5BNOA 2EIBA 1STMA 3KT7A 5K9YA 1R082 3W20A 3PTYA 4M3CB 2OZJA 2V5DA 4UW6A 4Q0PA 3O14A 2E9QA 4MHUA 5T3NA 3BPSA 3WDYA 4HXCA 4Q4Y3 4F3JA 4MX3A 2HEVF 5C3QA 2IVJA 1LULA 2DV9A 4AGRA 1DFQA 5FWJA 4B29A 1YIFA 4TLFA 4SLIA 2HWF2 2HYXA 4O9EA 2CDPA 4EWEA 5CYYA 2Y0IA 3AP5A 1COV2 2A6VA 3H42B 1KITA 2XBO2 1TMF3 1OI6A 1TVGA 3DKQA 3RZHA 3T2OA 1X33A 2HKXA 4Y20A 3B5LB 3FHIB 1IG0A 1W2NA 4HLTA 4ZONA 4CDXA 4URTA 5HCHA 1UYYA 2GAUA 3WHUA 2EF6A 3N9LA 4CCMA 1Q8QA 3WCSA 4CDQA 1S4CA 5FY9A 2Y8KA 4PT6A 3I49A 1RVF2 2MPFA 3AZWA 1O7FA 4CEWA 2XLFA 4QT6A 2Y60A 2YYOA 4E9KA 4YFZA 2WJSA 4IE7A 1V00A 4Y20B 2CNAA 4CDXB 4RHV2 3B7MA 1DGWX 3RJ2X 3I3MA 2AENA 3EO6A 3HN3A 4QD2A 3WNNA 4M00A 4D6SA 2XKOA 3LA7A 4CDQB 1N1SA 2MHFA 3P5BA 3KQRA 4RFT0 3KT1A 2QQNA 1FV2A 1ZM1A 3NV1A 4NIAA 4CEWB 2Y6KA 1C8NA 2C24A 5EP9A 3USUB 2QQMA 5ACA3 3KB5A 1GBGA 4YPJA 1XNKA 1YQ8A 2WLPA 3K3NA 2WRAA 3OF1A 2GH2A 1SCRA 2JDPA 1OPMA 3FBMA 2GMPA 4JGZC 4DZGA 5BNNA 3IAQA 1WMDA 2ZGQA 4FTBA 4C90A 2TNFA 3M3IA 3IPVA 4LKFA 3VKMA 2ZGUA 5FK7A 4A6SA 1X50A 2R16A 2PXJA 4LBQA 4KWLA 4XXAA 1IPSA 2UYBA 1RL3A 5H9QA 2XLGA 1NX9A 4JAAA 4FI9A 5BNNB 1RUJ1 1U12A 1NCRC 2WAAA 3WEZA 1FMD3 3TRSB 5AC91 2EICA 3DECA 5KXDA 4W65A 3ZYRA 4FPGA 4GZ9A 4LXLA 1Z7S1 3VLBB 2Q1ZB 2VMFA 2WFPA 2XGXA 1XSRA 4LBQB 5CU1A 1JOJA 1MR5A 3BPZA 2Y6GA 4IETA 5AFBA 3BU7A 3ZR5A 1QNYA 2P6CA 1UKGA 4YGDA 4FVVA 4F8AA 4FO9A 4XE9A 3KS7A 3ACIA 4R52A 4AEDB 4AHYA 4Q29A 2PHWA 3IM0A 1NE4A 4FFFA 2O8QA 2A5ZA 2WNEA 4GQ7A 4Y3OA 1ZVFA 2P4EA 1NCQB 2VTXJ 4NIIA 5L7OC 4CXWA 1SMVA 1I1EA 3ZYBA 1MPXA 2WA3A 4XJ8A 4ES8A 2E6VA 4GJZA 1DYOA 3WW3A 1J3RA 4URAA 4XIKA 2WZPP 2H0BA 3VHNA 1HKDA 4Q4W1 5IVEA 2L9LA 4Z2WA 5EPAA 3Q8EA 1DZRA 2VCCA 1F5JA 5J1XA 2FDIA 3SNMA 1Y7BA 2VXJA 5LATA 1QOSA 2XUEA 2OQ7A 4MLOA 1F2NA 3ZXGA 2XHNA 4YG3A 1E57A 3M3QA 4P9XA 3NRUA 3HQUA 4QQ2A 3GHMA 3LQCA 4MGSA 3JD73 2WZR1 3PVEA 3PU8A 2FDJA 2VH9A 5FXWA 5C8WA 1AX1A 4B1LA 1TMF1 1A6CA 2QE3A 2VL4A 2PN5A 4EV0A 1YI9A 2D6OX 5K4LA 4GWNA 1AR63 1A34A 2B5HA 1RHI3 1UZWA 2VW2A 2ARBA 2YU2A 5FMCA 1MZ5A 1RJ8A 1H2NA 2VOKA 1EUUA 4K6BA 3N9MA 3OPTA 4LOSA 3KV4A 2VZOA 3VKOA 5EJZB 5LA0A 4MGYE 1C8M1 1PHMA 2V4VA 5JSPA 1GQPA 3K77A 5FYIA 2BVBA 5A7PA 4AQ2A 4C8DA 1D4M2 3THPA 5JCTA 3MV11 1XPWA 4NAOA 4RGGA 5CEHA 2J1RA 5BUVA 3NKTA 4K21A 2A75A 1WBLA 3RI8A 3T0BA 3U4XA 1CWPA 1VBA2 4NUBA 4L2NA 3ZFEA 1YIPA 2HWE2 1R093 1BZWA 3NNGA 3LEIA 4IEUA 2ARCA 3CNAA 1W8UA 2P34A 3VKNA 1C1FA 2ZHMA 4CUBA 1JI6A 4LO4B 5A1LA 2A3YA 3W59A 3UKVA 2WSUA 3I59A 1D2QA 1IG3A 2R062 3WDXA 2VQ0A 1ZZCA 5IAXA 4LO6B 3VD4A 3OBAA 3M4FA 3S57A 2ATFA 3CZJA 3M2MA 5E16A 3FE5A 1JS9A 4OQ9A 2R0FA 3JBG2 4IE0A 4UI9L 1R1A3 2AEYA 3KF3A 3M3EA 4LBQD 5I0DA 2WN3A 1ZRDA 1AR72 3I59B 4KI5M 4KMQA 1N1VA 5C4WA 3WXPA 5IVJA 1RUF3 3PIGA 4ZU5A 1REEA 2UWBA 3FL7A 3B01A 4FPEA 2YGLA 1W28A 2VQUA 2P3KA 3WD5A 4WM8C 2KD7A 4UOJA 4LLFA 4J1WA 5L36A 4CCDA 2YU1A 2GNDA 5E89A 5FYYA 1QY4A 2BVVA 2VTFA 5F3IA 3HNYM 4FPLA 4LR4A 3WDUA 2GZWA 4CU7A 1M4WA 4LHKA 3O7OA 3U75A 5CFDB 4XMAA 1DGLA 1V9U3 3AKQA 3OUHA 4LNVA 1GNHA 5D1IA 4H7MA 1AXKA 1H2MA 2FCUA 3VBRA 1OUXA 1ONAA 4CDUA 4OHVA 5C9AA 5A33A 3POBA 1JYWA 4OVEA 2CHHA 3S6PA 4LEJA 3AX4A 4UFJA 1SLIA 3U0ZA 2C1FA 5C8CA 2ZEXA 2WABA 3WP3A 3MZHA 3BALA 3BTAA 4A7KA 1SDDB 4XJWA 3LIGA 3N9NA 1S1AA 3OGVA 4MV2A 1F35A 1W0OA 2G9ZA 1VRBA 4MH0E 5C9AB 1UMZA 3MFCA 2FBEA 4SBVA 5A33B 1HJFA 2EIDA 4QPGC 1Q43A 4R9AA 3BTXA 4MGTA 2B4KA 4WZFA 4PF5A 1UMHA 4CP9A 1UL9A 5B4NA 1OA2A 5C8CB 1D4M1 2GC0A 1YEWA 3JD71 5C71A 4AR2A 2XMLA 4PI0A 4V2WA 5A6QA 2ZX2A 3CBNA 4R9BA 3ECQA 1G9FA 3GGLA 3H9AA 4FPCA 3MW4A 4LE4A 4QXBA 3HBZA 3RWNA 3IMMA 3MV01 1GNYA 4GKYA 5GLTA 2W1QA 1T6GC 4OCTA 1AL22 1ODMA 4Q0VA 4XFFA 1GP4A 1HDKA 1W39A 4CP9B 5FO7B 1HIXA 2D6NA 2R042 3VD9A 1QH7A 5HV0A 1AHSA 5A3TA 1QQP3 1AR83 4DEQA 1W3XA 2OA2A 3PUAA 1EV12 1P8JA 4AEKA 5FZFA 1S0GA 5CG9A 5TSWA 2BUKA 3ZYJB 1F31A 4Z92B 3IDEA 3BCWA 3IDAA 3LDKA 1TME2 4J6GA 5BNPA 2ZPXA 1KEXA 3T3YA 2BW8A 4DNYA 4QXHA 2VZTA 1LOBA 1E5SA 3N7LA 3EQEA 2VZRA 3OUIA 4FPJA 4E27A 1BMV1 3DN7A 5A3LA 1LAJA 4A3XA 2VMIA 1WMXA 2FZ2A 2UY8A 3HQXA 4P02B 4FOWA 3E5UA 3FHAA 3VHRA 2RS32 2D98A 2MNGA 3JCIA 4XHXA 1JZ2A 1FT9A 3EHKA 2HWC2 4R4XA 1WLDA 1XXNA 5FP9A 1DQ5A 4PCRA 1CZSA 4CDWC 5JXJA 1C1LA 4EN8B 1PGL1 2VVDA 5JZGC 4HBNA 2RHPA 4C1XA 1XYOA 1Y9QA 4IESA 3T4HB 1YUDA 1PO23 3AVRA 1W9FA 1ZA7A 3B9IA 1WCKA 3ZXEA 5FY1A 2ZABA 1HV1A 1RUF1 2VW0A 4ONUA 3KGLA 4RFRB 1F8VA 1ENRA 1CONA 2PLV3 3ABZA 4J25A 1SLAA 4XZPA 5IK4A 1IQDC 1B35C 5FJHA 5LBCA 2PHTA 3LWCA 2A6WA 1LECA 3F95A 3O12A 5F2SA 1APNA 2WS93 5JUVA 2ORXA 1FAYA 2DUQA 3POGA 4P9GA 2GC2A 2QQUA 3ST7A 2R1BA 3WLUA 1V9U1 3ACGA 4UW5A 5T54A 3IAPA 1LCLA 2WBKA 1WCQA 3ZVXA 3OGSA 4UBGA 2EXHA 4Z2AA 2YZ4A 4D6QA 1AXZA 3AC0A 2P1BA 2JE9A 1VE0A 1NY71 1QF3A 4ZXKA 3V56A 3VD3A 3RZMA 4K40A 1OKOA 3UKNA 2K9ZA 4IV3A 1NLRA 4MXWA 1EPWA 3CJIC 3AYDA 1YFYA 1VBD2 4LO8A 4CEYC 3BN6A 1HB1A 3E6BA 2RR11 5CFCC 3WQ0A 3GJBA 2WO7A 5GM0A 4Y1YA 3W21A 1CD3G 1JBCA 3FUQA 1LB2A 4IV3B 4TSVA 5FP8A 1TME1 4EE2A 4MXWB 3ES4A 2UYAA 4AI9A 4LTAA 1Y4WA 4A45A 1C5HA 2FZ1A 1UIJA 2OPKA 3NW4A 1XNTA 2RDRA 3OB8A 4L8QA 3VHOA 3UYJA 4BM8A 2GNTA 1RMU2 4K7JA 3B94A 2W1WA 1QJFA 3L9JT 4XFIA 3ZX7A 2HBTA 5GALA 5T5JA 2JENA 3GNEA 1US3A 2BU9A 2O8OA 2EXKA 1ULOA 1L3JA 1IOAA 5IVCA 3IWZA 5FZBA 3LEKA 1QJEA 2R1DA 3QBQA 4L92A 4WVMA 4B4QA 1AR81 1LOFC 1QXPA 3KZ4C 5JXIA 3RDIA 1MS5A 3T4VA 1GFF2 5FQ0B 4OI1A 3AYCA 3C8XA 1LJ7A 3Q9OA 5IFTA 1SLTA 3POSA 3I54A 2I74A 4Y22B 3KMHA 1WMFA 1UXXX 2WNUC 3VKLA 5FZ6A 2WO1A 3P3PA 3MF6A 5CB7A 1UU4A 4Y4YA 4MGQA 4XTMA 4CP0A 2IFRA 2Q30A 3T1LA 3WSOA 2FDFA 4LHSA 4Q0SA 1WCDJ 4WVMB 2VOVA 2HWB2 5A3OA 1JZ4A 3FJSA 3LF7A 1VP6A 4IGPA 2XHKA 1O91A 3WR0A 2XWJB 3T30A 1FV3A 3K75B 3OOXA 1RJ7A 2RS13 1ZREA 3CLPA 3MIFA 4D69A 2NYYA 4AVBA 2PFWA 4QU1A 2J1AA 1EPZA 2XWBB 2IVIB 1W9TA 2BDRA 2OS2A 5LB6A 3DF0A 1VBC1 3U1XA 2NPIA 2GU9A 1BEV2 3KV9A 1SPPA 3CEWA 3LB9A 3A7QA 2YROA 4N7UA 1XRUA 2RVAA 5H9SA 5AFEA 5AVAA 1DDLA 2XJTA 1F4AA 1PX4A 1PO21 2VNRA 3OTFA 1U0AA 1Q8PA 4XFGA 3U37A 2Q1MA 3PDQA 2R0HA 4IV1C 4LK6A 2E7QA 1WWYA 2BYVE 5EQUA 4S2GA 4YW1A 4ARYA 1O8SA 2VU9A 4L97A 1QOTA 3LE0A 2V09A 3O1UA 1IKQA 1VBD1 3SC7X 3GHNA 1MZEA 3R6SA 4H14A 1YQ6A 1V6IA 4CCNA 3WF2A 1VMFA 2YGMA 2WS91 3SH3A 2AYHA 2ZMLA 3DPRC 5KHIA 3I2HA 1PMJX 1ZZ7A 1Q56A 3ENRA 4OMDA 4RR3C 5FCCA 3DYOA 3VBUB 4CU8A 5KBFA 1G9DA 5BPXA 4IDZA 3GZEA 1DQ6A 3ON7A 2JEMA 4YM2A 1GLHA 3I4IA 4BQ1A 1HXS3 1RMU1 2BOJA 5KR7A 1UOGA 4ZZ5A 3VUOA 4FQ4A 1VAKA 1JMUB 4HPKA 4A41A 4MO3M 1XB9A 2JICA 3S5AA 2J1EA 4XHBA 4FT8A 1FOD3 2BWAA 2WNVC 2FCVA 2R6QA 5CZKA 3A0NA 4QGMA 1H4GA 1ZZBA 2D97A 3UK9A 4FPOB 1XU2A 3LPFA 2UWCA 3NSTA 2DVDA 5LCWL 2ET7A 4AQTA 2Y64A 2VOTA 1MZFA 1UN1A 2UY9A 2VCAA 3LA3A 3J26N 4XJ9A 5FZ1A 4HPKB 5D8AC 2YB7A 1PZ7A 3TEZA 1SEFA 3O1PA 4MGZE 1AYN2 1Q5OA 2VZ3A 2XJRA 5EJ3A 2QBXA 4OYUA 1RUH3 2VVFA 1XQNA 3KWVA 5A3UA 2VUJA 3IZOA 1ULCA 4N53C 4CP2A 4QX3A 5F3CA 1DP0A 1BBT3 1JW6A 4A4AA 4IEXA 3WP5A
chains in the Genus database with same CATH topology
1UPSA 1ZBE3 5DUVA 3VBFB 1LHVA 1X8EA 1XYPA 3MYXA 1N3OA 4P14A 5F6LB 2WKKA 1OMIA 4K9SA 2DTYA 4CZSA 4COVA 1HQWA 1ALYA 1UZYA 2ZBJA 1BEV1 2DURA 5GZFA 4XTPA 3RYKA 1MQTB 2DUPA 4PJYA 4WM8A 2OIIA 1H9WA 3FWEA 3H8UA 4LUMA 4JGYC 1IQAA 2X5IC 4COZA 4GMP3 1YFUA 1FPN3 5I8TA 4FTEA 5C6CA 5I0RA 5GKAC 3ASIA 5CNAA 1HRI3 5GZDA 1PK6C 4GB32 2QKDA 1VBE3 5FLIA 1SQ4A 2V73A 4RSUA 1IPJA 4YVSC 4W6WA 1H2KA 1RTVA 3H7YA 2X8KA 2H6BA 5ABJC 1CX4A 1LR5A 1BQPA 2YHJA 4Q4V3 5JSOA 3RJRA 2MEV3 3RZZA 4R9DA 1DZQA 1CPMA 3VZMA 2VY0A 4PLOA 3ZFGC 3ZN6A 1CQ9A 2WT1A 2DVFA 1BVVA 4QPGA 3HN1A 4Y1XA 3WDVA 4QQOA 4X6RB 4FPYA 5JVVA 4QQPA 4AEJA 2W68A 2WFF1 5KXEA 2PAEA 3RYRA 3J4UH 3ZN6B 4JDNA 4YW3A 3AKSA 3NWKA 4RS5B 3WG3A 4QPGB 1TNFA 3AFGA 1UW8A 4ZKTB 4XFBA 1AYN1 1SCSA 3M1HA 1LHUA 5EYYA 3HR9A 1O5UA 3B3QE 4BIFA 1F5FA 3VBOC 1RUG3 1ZZ8A 3AMHA 3AP7A 5FTTC 2Z42A 1XU1A 4BYYA 3WY6A 4AW7A 4C0HA 5BXXA 4GIQA 4W6XA 2FQPA 4FPHA 2HWD3 3J9SA 1BJQA 3HWJA 1R1ZA 2XJUA 1RUI1 3R0RA 2DFCA 4G9SB 1Z0HA 1GQGA 1DQ0A 1O4ZA 2AR6A 3FLPA 4NHLA 5AC92 1B09A 1WLCA 4X8NA 4NO4A 4XYXA 1RUH1 2BWCA 1OLRA 1R083 1ASJ2 3RMXA 3QCWA 4EN9B 1MEC3 1EAH3 2E63A 4XF0A 4HVQA 5JZGA 1G6NA 4GB31 5EXOA 4BLJA 4AG4A 2YC0A 1D2SA 3ZFFC 4YW5A 2HWF3 4CTEA 1LGBA 4PBPA 1BKZA 1K5MB 1RUC3 1W6PA 3M7AA 3WW1A 1AJOA 4JRAA 2XBO3 5BNOB 2D6MA 1WW5A 3WUCA 2G9GA 4KU8A 1IHMA 1CJPA 5IK5A 1B35A 1NA1C 2O1QA 4XIOA 3MDPA 1POV3 4Q4W2 4Y1UA 1G86A 1S0EA 1RVF3 1W6PB 3LOIA 1URXA 5T50A 1RIRA 5DZEA 5DUWA 4RGAA 1HRI1 3GBFA 2NMOA 4KL1A 4GH4C 4RHV3 2QJVA 1AYM1 4JQRA 4OUMA 4LULA 3WG2A 3D5OA 1B35B 4Q4Y2 2X53S 1UKRA 1CESA 3J8F1 4OZXA 1WGPA 3WT3A 4XQWA 3R05A 2WIIB 3AB0A 4QMAA 4BOWA 3D6EA 1MS0A 1PVXA 2WZR2 1CR7A 2GC3A 3VZLA 4AI2A 2MEV1 3NO8A 3CJIA 1ND3C 2P2KA 2RMU1 3S7IA 1TMF2 5GLUA 1WBFA 4CEYA 4XQ4A 5CFCA 2JJ6A 4AFMA 2PA7A 5FOBB 1H1MA 4E2QA 4E2GA 3HIFA 2ZGMA 3DL3A 3CJIB 2QQPA 1ULDA 4CEYB 1WA4A 2AZ5A 1C8M2 1I6XA 1YHFA 3MFAA 3TNQA 5CFCB 1VAMA 3MF9A 3PLQA 1PIV3 2PELA 1QNWA 3GZUC 1DGWA 1QJU1 2CGOA 3FFZA 4XEZA 4MXVA 1DG6A 3V0BA 1EY2A 3IPVB 3FZ3A 3H7JA 5ACA2 1ASJ1 2VULA 2JKBA 1AVBA 3AM2A 4I30A 3VDDC 4Q0UA 1LODA 2WNUA 4IEQA 2IXCA 3D0JA 1C4RA 4B7KA 1FYUA 1QOOA 2ZMNA 3LSEA 4DPNA 4CRQA 2HWD1 5LEKA 1CJDA 4Q4X3 4KG0A 2JX9A 4B7EA 2WQZC 2WNUB 1O4YA 3B69A 1FMD2 2RM23 1YYNA 2PAKA 4P9IA 1LENA 4KWKA 1ND2C 4FAHA 1DQ4A 1H4HA 4N43C 1G9CA 1HX6A 3NJZA 4ATEA 2IXIA 1EAH1 1SLLA 2VECA 3VBHC 1YWKA 4OHXA 1AR93 3JQWA 4FQZA 5GLVA 4XPVA 4Q4Y1 3N35A 4Y1VA 3L2YA 1WW4A 4NN0A 2P17A 1IS5A 1RUC1 4IV1A 3ZN4A 3KCYA 1RUNA 3URFA 2ZGTA 4RL7A 2NZ9A 1H2LA 3JB8A 3WVJA 4XF4A 2O0OA 2VW1A 3H3ZA 4ISQA 1LHOA 1JH5A 1EP0A 4R8HA 1VBB3 5GZCA 2CGPA 2D3PA 4GWMA 1DGRN 1S0CA 4RR3A 2CL2A 1X8MA 1CN1A 5LRRA 1KDMA 2EA7A 5JPMB 2B8MA 4HSJA 4YG6A 1W2UA 5E88A 1HW5A 2KXLA 4Z1VA 5L19A 3JD72 4ES9A 2PYTA 3SCFA 3OBTA 1JN2P 5GJ6A 2WNVA 1VBA3 4FOYA 4C91A 4FXGB 1OPOA 3W58A 2HWE3 3WW2A 3MIGA 1MS1A 1BCXA 5ACA1 3IN9A 2C0ZA 3ZSKA 3H1YA 1QGLA 1QJX3 4FP3A 4YYOA 1AR62 1NYWA 5D8AA 5I0UA 2R063 3GZAA 4XFCA 2AGSA 4XQDA 1ZBA3 2VMHA 3VZJA 3ZFEB 5CVRA 3USSA 1PIV1 2DWRA 4Q8KA 1AR73 2ZGSA 1FMD1 1A8MA 4HSLA 4GMP0 4G4FA 4UXAA 4AI3A 1BMV2 3IKWA 5GLZA 4FXKB 1U5XA 3NKGA 5EV7A 5A32A 5F1RA 1NE6A 4N7IA 1CAWA 5EYXA 1RUE3 3ME2A 4D7TA 2ZS6B 4K3UA 4AHZA 5KHGA 4IXLA 1PVC3 3ZO0B 2YMZA 3AYAA 3VV1A 5C4WB 1QH6A 1PGL2 5T5PA 5A32B 4QPYA 1CAWB 1WLWA 2EXIA 4R4ZA 4X8PA 1PK6A 1JYCA 2W08A 1XE7A 5EZWA 2CAVA 2JG9C 2BNNA 2ZKLA 2F4PA 2PHRA 1RUF2 2LTNA 4YVSA 4AFBA 2VG9A 1PK6B 4Z82A 1HQNA 4IL7A 1AR91 3VGIA 2B46X 3LOBA 3VBRB 1LTEA 4CDUB 1IKPA 2XJSA 5HBAA 3SH4A 4JV4A 3RS6A 1JUHA 5KHHA 1V9U2 3BB6A 3MIDA 1AJKA 4LBMA 3ZXFA 5IT6A 3UKTA 2ZCWA 1NY72 1DLLA 2R043 2Q8OA 1AR61 3E6DA 1VBB1 1QMJA 3CU7A 1VJ2A 3PHMA 1RHI1 4M0NA 1H30A 1SDWA 1ZRRA 2A3XA 1LHNA 1EV13 4YZ5A 5JOXA 3VN4A 4BWOA 4OLLA 1DHKB 1GQHA 1GSLA 1LKNA 2RR12 4XF3A 2ZZJA 2NN8A 3MPPG 3OD4A 2BFUS 5BYNA 3VBOA 3K48A 4IERA 2D5FA 2EIGA 3AKTA 1DQ1A 4LHNA 2DVAA 3QACA 4XBNA 3L2HA 4BZ4A 1H8TC 2RS33 2ZZQA 4N9IA 4RQPA 5DG1A 1R091 1BVP1 1QJX1 2HWC3 1GICA 4JVAA 1VRH3 5BNPB 3AKPA 4HETA 3VBSC 2IXKA 3T1MA 4WM7C 4XFHA 1AR82 4QXKA 3ZMOA 4GA9A 1ZBA1 2GC1A 2Y26A 3WZ1A 2G4IA 4RQPB 1S0JA 1YO8A 4EN6B 5J37A 3UJQA 2BEOA 3ZFFA 1MS3A 1POV0 3E97A 1R1A1 5CAZA 3AYEA 5CG8A 4P9JA 2CWSA 3FC0A 3VZOA 4BH9A 3PMSA 1LGCA 3PMEA 2GN7A 3DGTA 1C5IA 4AHWA 1UX6A 4NPRA 5HXVA 2D3RA 1YFXA 1QJY3 2R49A 4KH9A 2ZACA 3ZFFB 1D0HA 5GZGA 5E8AA 2NM1A 5J09A 2B42B 1G7YA 1MVEA 3AFKA 1EYBA 1VBC2 2ZAHA 3QLQA 4P9LA 4NR1A 1HRV3 1CPNA 1CVNA 2IXJA 4GH4A 2XB6C 4QQHA 2V5YA 4QX5A 1ENSA 1PO22 3RNSA 2RS53 4GXLA 3OCPA 1G9AA 4HKWA 2D3SA 3D4KA 4YARA 1N1YA 3C3VA 5J7MA 3ZIXA 4B4RA 4XW3A 2WT0A 4GH4B 4MGKE 1BYHA 2PHDA 4PDWC 3KLSA 1ND3A 3R4UA 4CDQC 1Y43B 1LOEA 2XVKA 2JG8C 5DDJ3 2WS92 3ZPYA 2EVXA 1ULFA 4JGZA 4MYEA 1QHDA 1QDOA 4DMIA 2PAMA 1ND3B 2XPJA 1ZNPA 3TN93 4C1WA 2ENRA 1IS4A 4IEOA 1QDCA 3BOWA 3IBMA 1NXD1 2ZX4A 4L11A 3FLTA 4JGZB 2WQ4A 1JYIA 1NCRA 3ZXKA 4WVZA 2IFWA 4CP1A 1QQP1 2RJLA 2IWGB 1N3PA 4I3GA 4AXOA 3EJKA 4HKOA 4MSVA 1RUD3 5SV5A 2ET1A 1JTZX 1SFNA 3RSJA 4XJUA 5FFOC 3KM5A 3VDDA 2HWB3 1PGSA 3D8CA 1NCRB 4H55A 5JDBA 4A7ZA 5T55A 5KHJA 3JU9A 5DZFA 2GSYA 1LOCA 1A8DA 5E1RA 3RG0A 1CAXA 4LO7A 5JWPA 1V70A 5CIRA 2WLQA 4AEDC 2GDFA 5L7OA 3GYDA 4KG8A 5FPXA 4BMEA 1NCQC 3U10A 4CYDA 2BPA2 3DV8A 1ND2A 2ZHNA 1V6KA 4XJAA 5J3UA 2Q0AA 5JSRA 1LEMA 3PJQA 5L7OB 2HEWF 3ZXJA 1LOAA 1IZ3A 3ILNA 5DUUA 1MZ6A 1U5IA 3VBHA 4EN7B 2VNGA 1UAIA 2XJVA 4OFGA 1ND2B 4OHZA 3ROUA 4DY5A 1LHWA 2BQPA 3FX3A 2CGNA 2PLV1 5JOWA 4XF1A 4D3WA 2FMYA 1S55A 4Q1PA 3TNPB 3WCRA 1KS5A 4I2OA 3MEPA 4JTNA 2FMDA 1PO13 1VB4A 1VAVA 1WLTA 1UF2C 2DCZA 2R073 3VL9A 2AUYA 1DGRA 3D82A 3U11A 5LEJA 5DG2A 3JZVA 2WWSA 2CYFA 4RA0A 2RS51 3A0KA 1H1IA 1C3HA 5I8YA 1UD1A 3OBRA 2XUMA 5FO9B 3R4DB 1VALA 2E7AA 4M3CE 1CIWA 1ZRFA 2WFF2 2ZGLA 5KC5A 5I8SA 3TWIA 1JUIA 1S0FA 4NVPA 3ZXDA 1PM7A 4YGEA 5DDJ1 3H1WA 4LBKA 2H6CA 1VR3A 4G3YC 3K51A 1SBEA 3P3NA 1W6QA 2YV8A 3NV2A 5F5QA 4XOGA 3POWA 2A6YA 1KFXL 3ZSLA 5AVPA 3ELNA 1XNBA 4HL0A 4PQ9A 2QFEA 2UWAA 1ZYBA 2VOWA 3GZTB 1N3QA 4BE3A 4LA3A 1FOD2 4YZ4A 1ZZ9A 2VVEA 4Z07A 2XL9A 2ZHLA 4QU2A 4XXPA 2XKPA 1RUI2 5HCAA 1G9BA 3ZIWA 4Q2FA 1U5ZA 2A73B 3WQ7A 3QH7A 4OULA 1RUH2 2XVLA 5K0UC 4FPFA 1UU5A 1DBNA 3M8LA 2ZHKA 4YZ2A 4HMZA 3AXDA 3U07A 3WDTA 1HV0A 3ZXAC 4YVWC 2YDEA 4WZCA 2RS11 3CL1A 4WM8B 1KDKA 1YRZA 4LBLA 2PHLA 2GALA 4LLOA 2GMMA 4RD7A 2JG9A 1GKBA 3SCHA 5CFDC 4JC1A 2BTVC 2OVUA 5B2GB 3ZDSA 3V65A 2A7AA 2Z69A 3NV4A 4GALA 4FSJA 4E4ZA 1OKQA 3H0OA 4FOQA 1FXZA 1FPN2 2WC2A 3G6JB 2FHRA 1CAUA 3LSDA 2A70A 1S0BA 1IPKA 1WCSA 1YI7A 3WQ1A 2CY6A 1HRI2 2K0GA 4YM1A 2RE9A 5C9AC 1AYM2 4YW4A 3TYJA 3PVNA 5C33A 1GYKA 3J8F2 2E51A 1YFWA 1REDA 1A3KA 1DYKA 1ZA4A 1PO11 3POYA 4NWVA 1VIWB 2MEV2 4HK9A 1OQEA 2RMU2 1I5ZA 1RINA 4B8EA 4C0BA 1GNZA 3I2DA 1AUYA 2BFUL 1DZTA 1HXS1 1MS4A 1WD3A 3MLKA 5CBLA 5DXDA 2XVGA 1J3QA 3FLRA 5FAXA 3ZSMA 1M06G 3SLIA 3VL8A 1FOD1 4A7YA 1RUJ3 5BY5A 2JDZA 3T2TA 4F83A 2ZX0A 5K7PA 4H7LA 1QJU2 3INAA 3MLLA 3VBSA 1Z7S3 1Q3EA 4WM7A 2PHFA 1TQ5A 3ZMNA 2G9FA 2Y38A 4CDWA 4DXZA 1ZZ6A 4V1PA 2UURA 1AZDA 4DY3A 4EWAA 3WOGA 4ASMB 1PZ8A 1BBT1 1RUG2 4LBNA 1D0GA 1H0BA 1ZBE1 3WUDA 4M01A 3IMNA 3RI9A 3HD8B 1BK1A 5JMCA 2D43A 2N7GA 3WDWA 3HAGA 1PNFA 2HWD2 1XNCA 4CDWB 4F7ZA 3NV3A 1WMEA 3E6CC 1COV3 4I3PA 1AX0A 3A4UA 5JZGB 4BMBA 3ZYGA 4LE3A 3WP4A 1I9RA 1OSGA 2K2SA 4Q4W3 3PVBB 4M3CF 4FPKA 3GBGA 4GMP1 1FPN1 2JE7A 4BLIA 3NAPC 1SBDA 4QHBA 1MEC2 1EAH2 2CAUA 5FBZA 4DB5A 5J48A 2DCKA 3PNAA 3M3OA 3GF6A 1OFSA 4XF9A 1VBE1 4AVTA 2AH2A 2CV6A 2KA3A 2WZR3 2ZGOA 4D7YA 1RUC2 4EWDA 2DF7A 4Q4V1 4BHPA 1FI2A 2GNBA 4I0BA 2TEPA 2D6KA 2EAAA 4PDWA 3WG1A 1FATA 2JG8A 5FMOS 3DKWA 4KNCA 1DYPA 3JB4C 3USUA 1W6MA 1C8M3 4M0HA 1SACA 5GZEA 4JTOA 4PDWB 3SITA 3NVCA 3N4MA 3MI8A 4IV3C 4QM8A 3UJOA 3E5QA 2JG8B 3SHRA 4U36A 1D4VB 4QPIC 1FNZA 2WA4A 3AK0A 3QH6A 4UBHA 2OW4A 1W6MB 1VLNA 1J59A 2D93A 3DUIA 4XBLA 1LOFA 4IQPA 4IEPA 4EJRA 4KGGA 5JI9A 5HI0A 1JXNA 2DUOA 2B39A 5T5LA 2NQYA 2ZAAA 3HT1A 1RUG1 1V6NA 3CJXA 2B7YA 1O3SA 1V6OA 3MIEA 4TWTA 5DUXA 5H9RA 1VB2A 3V0BB 3N3HA 4HN0A 3KD4A 2YUEA 3ILFA 3M3CA 2B45X 1WUVA 4ORFA 2YPJA 1AXYA 1PIV2 4K1YA 3G7DA 1C57A 4AEDA 3WX5A 3GALA 4X6QB 4Y1ZA 1OA3A 1NCQA 1R081 2E7TA 5LRSA 1LEDA 4AVAA 2ZKNA 2XH6A 4L99A 1XNDA 1MEC1 4NHKA 5H9PA 3TB0A 5HCBA 5FDBA 4BA6A 1S0DA 4META 2VQAA 3N7JA 4XJZA 2HWF1 1H1AA 3AMMA 4QGNA 4XBQA 1COV1 2IC1A 4Q4X2 1LRHA 4LO5B 2XBO1 1W6NA 3FUOA 1KXGA 2RM22 1YJKA 3AKRA 3TOJA 3VKFC 1POV1 1TE1B 2DTWA 3N7MA 1S2KA 3VHPA 1RVF1 4IV1B 5EFUA 3DPRA 2P3IA 3TAYA 1W6NB 2YY1A 1RB8G 2DU0A 4RHV1 1AR92 4DINB 4Q8LA 2A71A 4EN0A 4YRDA 1MS8A 3H1MA 4IEWA 3VZNA 4AI1A 1D4M3 5KWRA 3VBUC 1X7NA 1YJLA 1DQ2A 2ES3A 3RQ0A 3DPRB 4YZ1A 1WD4A 4YSFA 2EXJA 4IEVA 5BV6A 1KJRA 4RR3B 3OJBA 2WINB 3R4SA 1OQDA 3LKJA 3THTA 4AQ6A 4NHMA 4I02A 1VBB2 1RC6A 1RHI2 1FX5A 3KCCA 3W9AA 2IXLA 2WNVB 3OGJA 4HVOA 1RGSA 1Q8OA 3ZSEA 4N53A 1I3HA 1LU2A 3JBG3 3RMYA 1UIKA 4W6YA 2QZ3A 5D8AB 1TEIA 4UW4A 4WBBA 3RRDA 3MW3A 1NQDA 3WP6A 2HEYF 2TUNA 3VBFC 4DRVA 4OI0A 1NG0A 4N53B 4FP2A 4K20A 1R092 1QJX2 3JUUA 1GR3A 1LU1A 4OHYA 4QM9A 2OUHA 1QKQA 4JGYA 2X5IA 1J58A 2XJQA 1MQTC 1ZBA2 2BNOA 5K0UA 4JDOA 3LAGA 4Q4X1 1OA4A 2E53A 4YVWA 4XDQA 2RM21 5DZGA 3ZN5A 4PIZA 1R1A2 4JGYB 1UU6A 2X5IB 5L73A 2BBVA 3BODA 4GKXA 5K0UB 4ASLA 5CFDA 4YNIA 4LBOA 5JIUA 5ABJA 2GH8A 2PQQA 1RUE2 2JECA 4DOUA 3HT2A 4BCUA 1ULEA 3AJZA 4YVWB 3RPQA 2I45A 3IDCB 1XYNA 5KHKA 3FFQA 1OD5A 4OUSA 1IS6A 1JHNA 1PVC2 4YG0A 2VOXA 1ENQA 1KD7A 1REFA 4KU7A 4S2HA 4B4PA 5KC6A 4HKLA 3ZFGA 4COUA 3ATGA 4YVSB 2ILMA 5I0TA 2HJIA 2D40A 4NOTA 1KRIA 5ABJB 3AZXA 5JOZA 2ARXA 1O5LA 2Y0OA 1OLQA 3LZZA 5FPZA 1AL23 2Z5WA 2CTVA 4Y24A 3V64A 3ZFGB 4YM0A 3LCPA 3OGGA 3AMQA 3ILRA 3CF6E 3FMGA 4Y26A 2RR13 3VZKA 3QOPA 2ZX3A 4RS5C 3FBYA 3WNXA 1KQRA 5LK7B 2OZ6A 2QVSB 2W52A 4XILA 5FLHA 4AYUA 3RYPA 1TME3 5FOJB 3KSCA 1KJLA 2ERFA 2Z79A 4S2FA 2H0VA 3O0WA 1C28A 4I0AA 4IEZA 1VBA1 2HWE1 4QGLA 3UV9A 1OOPC 4INDA 1SFYA 1KS4A 1RITA 1Q8VA 4YLZA 5KXCA 4LT5A 3LGRA 2DVBA 4TZDA 3VBOB 2BNMA 5FREA 1GZWA 2R061 3MIHA 1S0IA 4AE2A 2P3JA 1QQP2 2NMNA 1QU0A 4ITCA 4AHXA 5KXBA 3ZYPA 4LHLA 4UW3A 3JBG1 3AP4A 3E5XA 4PBOA 3C2UA 2SBAA 2YXSA 1AR71 1UCXA 2A6XA 1GZWB 4QQLA 5FO8B 4XMIA 4IEYA 1GZ9A 4TYSA 2RJKA 4WVWA 2XL7A 4JCKA 3S7EA 1NXMA 4KWJA 1O3TA 1RUE1 1VRH2 5IUQA 1AF9A 2DFBA 1K5MC 1QWRA 2A3WA 2D7FA 1VBC3 1V6JA 1PVC1 2W39A 5BNOC 1NA1A 1WW7A 1U5YA 4YW2A 4AF9A 2TBVA 1DIWA 4FTSA 1AL0G 3ES1A 2UU8A 3NAPA 2ZTNA 4MUVA 4Q27A 1NOVA 1V6MA 2IZWA 4E4SA 3SXWA 4LBJA 2DVGA 2CWMA 4LUKA 1NA1B 2NP0A 2QCSB 1OHFA 5F6KA 5I0SA 5A3MA 1X82A 1QXRA 5JR7B 1VBD3 2VUAA 1ULGA 3AP6A 2Q5TA 3NAPB 2LALA 2WT2A 4CDXC 5IK7A 2PLV2 4COWA 3SH5A 1MS9A 4AVCA 3EBRA 1QJY2 1F9KA 4D94A 5FMOL 3B02A 4PLMA 4KGQA 4NWWA 4CEWC 2VNOA 4I0WB 3NL1A 1SLBA 1HRV2 1S2BA 2NLRA 3SISA 1RMU3 2PTMA 3N36A 4MVTA 2JD4A 3LA2A 2RS52 1AL21 3IIAA 4LA2A 4AVVA 3QD6A 2C9AA 2R041 5FRAA 4E2SA 1LGNA 1G8WA 3MIBA 5I91A 1CGPA 4QPIA 1LOGA 4HANA 1EV11 4AQSA 4D7SA 1BXHA 4P9YA 5BNNC 2BGCA 5T5OA 4KBBA 3SMHA 3WINE 1O4TA 3AMNA 1PGW2 5DDJ2 3OY8A 2GN3A 3ZYIB 2I07B 4HK8A 2D44A 4QPIB 1UZZA 1ENXA 3JQXA 4E4DX 5FQ0A 4COYA 2DCTA 3PJYA 4BIOA 4Y22A 2ZGPA 3TN92 2RS31 3OY8B 1O3RA 2B9UA 4HZFA 3VDDB 2HWC1 1J1TA 1VRH1 3B9CA 1V6LA 5CA6A 1PNGA 3IDBB 4Y5Z0 1BEV3 1H8VA 1DF0A 2X29A 2WSVA 1YCIA 4N9HA 4N43A 5EWSA 5F9TA 1RUD2 4AI8A 2DCYA 4YM3A 2VMGA 3H3UA 1CAXB 3ETQA 1H9PA 2QDNA 1W0PA 3S0MA 1UPIA 5K8SA 2DCJA 2OYZA 4HVRA 5GLWA 4S2DA 4XETA 5LK5A 4I01A 2D5HA 3M70A 4N43B 4HN1A 1SBFA 4PLNA 2ZJCA 4OI4A 3ZSJA 4PIYA 5J96B 3UL2A 3O0XA 2RS12 2ZMKA 3ACLA 3VBHB 1QJY1 4YGCA 2ZGKA 2Q4SA 3ALQA 1YXWA 5SV8A 2PHXA 1HRV1 1PMIA 1J3PA 2D6PA 2IXHA 3AZVA 4Z8BA 2QZ2A 4DFSA 2ZX1A 5JOYA 1YNAA 1NLSA 3VBUA 4B3NA 1O3QA 1LESA 3AMPA 2WFF3 3OPZA 1N47A 4AGGA 1W6OA 5BNQA 1RUOA 4AVSA 1GZCA 3MGUA 4P5HA 4YGBA 1N1TA 4Q0QA 4I09A 4AFAA 4FCAA 3ZXLA 1Y3TA 4Q26A 4KQ7A 4EROA 3EXUA 1AYN3 1PGW1 2W0XA 3WHTA 1PO12 3S30A 1WW6A 4GULA 3AXEA 2R072 4FOVA 4ATFA 5CADA 1W6OB 2DU1A 2VPVA 3AP9A 1ZX5A 2XLAA 2P37A 2C5DA 1OQ1A 3BOPA 5JI7A 1HXS2 4ZU4A 4N90A 3TN91 3MPBA 3O0VA 5J98B 4AWDA 1W6QB 1RUI3 3ZFEC 4JRLA 1TNRA 3IT8A 3KCXA 4HT1T 4Q1RA 1RUD1 3VBFA 1GANA 4AGVA 2GMEA 1GV9A 2HWB1 4AEMA 3APBA 4WVVA 3AJYA 2LUWA 4GB33 1MQTA 1Z78A 3I8TA 2AREA 2ZGRA 2I2SA 1BBT2 1QXJA 1ZBE2 2A6ZA 1KFUL 2GNMA 3I7DA 2QUOA 5C4WC 1IS3A 4AFDA 4MGIE 5HCFA 5FLJA 1IGOA 3BIWE 4FAGA 2XG3A 2VGDA 4AFCA 2R30A 4ISRA 5I93A 1XE8A 3AZZA 1QJZA 4DRRA 2KM2A 1OFNA 2F6BA 3O5SA 2JG9B 5T52A 1MVQA 3N7KA 4L9BA 2XJPA 1AYM3 1CAVA 2PHUA 4K1ZA 5JIAA 3KGZA 2QNKA 3VBRC 4CDUC 4BPZA 3J8F3 2ZA9A 1NQJA 3PVOA 1Q8SA 1VBE2 4YZ3A 1PZ9A 2EALA 3WW4A 4ZU7A 5C8CC 3KT4A 1DU3D 5JPNB 1CAUB 4MZUA 3WV6A 2RMU3 1CAVB 5IK8A 4Q4V2 2R071 4XFAA 4DS0A 4A2UA 4FBFA 4RS5A 3SCGA 2JXAA 5JAXA 4P9WA 5JLVA 2ZGNA 3D0SA 1AX2A 4AI0A 4OHWA 1HLCA 1SLCA 3B00A 1YLLA 4JDMA 4WV8A 2D6LX 3OD0A 3MLJA 2ETEA 3AZYA 4YFWA 1X36A 2EAKA 5AC93 4AK3A 1OOPA 1QJU3 2SLIA 4U2AA 1H8TA 3GBWA 3TBDA 2HYKA 4O9GA 3X29B 4OI2A 1MACA 3H50A 1ZRCA 1ASJ3 3B93A 4R9CA 3OYWA 3MICA 1HQLA 5BNPC 1OOPB 2OUJA 1H8TB 4DQAA 4PIXA 3V0AA 1A78A 4J1XA 1FNYA 2Z2SB 4K8FA 3VBSB 3MW2A 5J36A 4RQPC 4WM7B 3OYWB 4HFSA 2WL1A 2ZOEB 1RUJ2 3HMYA 4M3CA 1J1LA 2LM3A 2QDRA 2DYCA 1NZCA 3CO2A 2R32A 3V0AB 4H3WA 1Z7S2 1K5MA 2VXRA 3WG4A 5BNOA 3KT7A 5K9YA 1R082 3PTYA 4M3CB 2OZJA 4UW6A 4Q0PA 3O14A 2E9QA 5T3NA 3WDYA 4Q4Y3 4F3JA 4MX3A 2HEVF 1LULA 2DV9A 4AGRA 1DFQA 4B29A 1YIFA 4TLFA 4SLIA 2HWF2 4O9EA 4EWEA 2Y0IA 3AP5A 1COV2 2A6VA 1KITA 2XBO2 1TMF3 1OI6A 1X33A 2HKXA 4Y20A 3B5LB 3FHIB 4CDXA 4HLTA 4URTA 2GAUA 3WHUA 2EF6A 1Q8QA 3WCSA 4CDQA 1RVF2 2MPFA 3AZWA 1O7FA 4CEWA 2XLFA 4QT6A 2YYOA 4E9KA 4YFZA 2WJSA 1V00A 4Y20B 2CNAA 4CDXB 4RHV2 3B7MA 1DGWX 3RJ2X 2AENA 3EO6A 4QD2A 4M00A 2XKOA 3LA7A 4CDQB 1N1SA 2MHFA 3KQRA 4RFT0 3KT1A 1FV2A 1ZM1A 3NV1A 4CEWB 1C8NA 5ACA3 3USUB 3KB5A 1GBGA 1XNKA 2WLPA 3OF1A 4DZGA 2GH2A 1SCRA 4JGZC 1OPMA 3FBMA 2GMPA 5BNNA 1WMDA 2ZGQA 4FTBA 4C90A 2TNFA 3M3IA 3IPVA 3VKMA 2ZGUA 1X50A 2R16A 4LBQA 4KWLA 4XXAA 2UYBA 1RL3A