3X29B

Crystal structure of mouse claudin-19 in complex with c-terminal fragment of clostridium perfringens enterotoxin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
117
Chain Sequence
b'AAATERLNLTDALNSNPAGNLYDWRSSNSYPWTQKLNLHLTITATGQKYRILASKIVDFNIYSNNFNNLVKLEQSLGDGVKDHYVDISLDAGQYVLVMKANSSYSGNYPYAILFQKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Claudin-19
publication title Structural insight into tight junction disassembly by Clostridium perfringens enterotoxin
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 23
structure length 117
sequence length 117
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1050 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3x29B00
3ZIXA 2QUOA 3AM2A 3X29B 3ZIWA 2YHJA 5B2GB 4P5HA 2XH6A
chains in the Genus database with same CATH superfamily
2ZGLA 1SPPB 2C26A 3ACGA 1H4HA 5IFPA 1J58A 1J84A 1OVPA 4YZ5A 3KSCA 4MGKE 5FZ4A 1F4HA 2AUYA 4QAWA 3I7DA 1ULEA 4RN5A 3N9OA 2WZPP 2B8MA 3ZX7A 2TNFA 2PXJA 2WBKA 2W1QA 1OVSA 2JG9C 4IV3A 4F83A 5FOJB 1W8OA 1HW5A 4AHZA 4CDXC 2FDHA 5T54A 4MXWB 2ORXA 1POV3 3JD72 1PVC3 3NKGA 3NNLA 4CPBD 1GFF2 3H1WA 1SLBA 1DDLA 1NLQA 1ASJ3 4N9HA 4XHXA 2IUWA 4DUWA 5HXVA 3ACFA 3SISA 3AJYA 2J7MA 4FAHA 1CAUB 2HWE2 4M3CF 4Q4X3 1UXZA 3OEBA 1LOCA 2EIBA 1H2MA 2C24A 4XF0A 4C1WA 1JYTA 5CAZA 1YQ5A 5H9RA 2JB4A 3M3OA 3WR0A 1KEXA 4RQPC 2VG9A 3E5QA 3JXSA 1IZ3A 4A7ZA 2RDNA 3LEGA 4ET7A 1WCQA 5DZEA 2MEV1 4YFZA 4QXHA 2WR9A 3ETQA 2A1XA 3NAPB 4M0NA 2VVEA 5FZKA 1AR62 3GJBA 2HBTA 1UPSA 4RHV3 3VZJA 3OSDA 3DYPA 4K9SA 1RVF1 5F6LB 5FY4A 3I49A 3PVOA 2I2SA 1QDOA 2VMCA 1RUNA 4LO7A 2CNAA 2HWC2 4C91A 5A7WB 3UNPA 1W8FA 1FMD1 3VBOB 1APNA 1COV3 1MQTA 1R082 4BM8A 2E7AA 1OD3A 2WS93 1JZ4A 4AK3A 1H8TA 3JBG2 2WC2A 1BQPA 1DLCA 3I2JA 2JDAA 3VZNA 1IS5A 1JN2P 2P4EA 1KS5A 3F95A 4GQ7A 3K51A 4YW6A 3H8XA 1RUF3 1FPN3 1RUC3 2EIDA 2RMU1 2BTVC 3O12A 1FXZA 3C7HA 4Q0QA 1OD5A 5FZDA 2BYVE 3AX4A 4LE3A 1WZXA 3HBZA 1W6QB 3QH7A 3C8XA 3DCQA 4BCUA 3I3EA 4ZKTB 2DCTA 4WM7B 5J96B 1A8DA 5AVAA 1RHI3 1FI2A 4B29A 2BBVA 2DVBA 4LK7A 5HCBA 4XFGA 2E26A 3AFKA 5DDJ1 3VL8A 2ZMKA 2D3PA 2YDEA 3WDVA 2Q30A 4LKDA 4B4PA 4DY5A 3CL1A 4O61A 1EPZA 1H9WA 1Q8VA 1WA4A 2IC1A 1WW5A 2LS6A 4CDUB 4LBMA 5I0UA 1B35A 2X09A 1KDKA 3VKLA 4GWIA 2HWD3 4PF5A 4JZRA 4QWNA 1QU0A 1ALYA 3ZIWA 2CAUA 2VCCA 4IGPA 2VMEA 1AXZA 5DQ0A 3BOWA 3K2OA 1WMXA 3UGHA 5A33B 3FLPA 5JOYA 1KS4A 4LHLA 3I3QA 3WNMA 2XL7A 1SFYA 5HCFA 1UYPA 4I0AA 5LA9A 4XCBA 1OBNA 1FNYA 3VHOA 1OA2A 4D6RA 3VBFA 5KR7A 2P5BA 2W1WA 4XOGA 4KMQA 2VNVA 4NIDA 2XJVA 2MEV2 1UCXA 4ORFA 3WQ1A 1TE1B 3ZVXA 4GXLA 2VZQA 5I8TA 2NQYA 2W08A 1W9WA 4FPFA 1GP4A 1PGSA 1QXRA 4YVSC 1F2NA 1AX1A 1VBC1 2VTXJ 3KQ4B 1KFXL 3SCFA 1I9RA 2X29A 5CFDA 3C2UA 5FQ0B 2PHDA 1RVF2 3BPZA 1WCKA 4BK5A 4LIUA 2ARXA 1HB1A 2AEYA 2JJ6A 2K2SA 1RMU1 5C9AB 2XLFA 1FMD2 3QBQA 3I2IA 4YFWA 3KZ4C 1IS4A 3CDZB 1RUJ3 3AMQA 1UXXX 4N90A 2DCKA 4XAEA 3W59A 4A3ZA 4D7SA 1F9KA 1NZIA 2GU9A 2HJIA 1DGLA 4CUCA 2WLPA 1JZ3A 4YWAA 4K8FA 5LBEA 1UO9A 5BV6A 3OYWA 3WDTA 4A44A 1Y4WA 4N43C 3ZFEA 1YJKA 2XG3A 4Q5OA 2WABA 1D2SA 1FNZA 3A4UA 2E6VA 3ILFA 3NNGA 3AL6A 1NLSA 4IE5A 2RMU2 5KWRA 5EV7A 5E8AA 3J7LA 5J3UA 1I6XA 5D1IA 2H0VA 1SLIA 1OFSA 4ZPIA 3J9SA 3UYJA 4I2OA 1G9DA 1V70A 3GDBA 2KR2A 3WZ1A 5AFEA 2VW2A 2UYAA 4XMAA 5JOXA 3VD3A 4P9IA 3U10A 2WNEA 1IS6A 5K8SA 2JG8C 3PU3A 3OPWA 2Y6KA 1OLRA 5FZCA 2C6SA 5DDJ2 4B7EA 4W65A 1JZ5A 3MPPG 1MEC3 2AC1A 4LBKA 2P3KA 2WZEA 5JPMB 4S2GA 2B39A 4PDWA 4IEYA 2PLV3 3B00A 2PFWA 5F37A 1ENSA 2XOMA 4IXLA 1OXCA 1XNDA 5FIXA 4QB1A 1UU4A 1PK6B 5IVYA 3ZFFA 2RS53 4AE2A 2GSYA 2D6MA 1O3TA 2LRPA 2V09A 4AF9A 2VMHA 2YBSA 1HB2A 2A70A 1VBE2 2JE9A 4E2SA 1JH5A 4XETA 4TWTA 3UGFA 3LD8A 2VOTA 2OIIA 4IV1C 4TN7A 4W50A 3EJKA 5FTTC 1SHWB 2P6CA 3DGTA 2HWF2 5C3SA 3K4DA 3ME2A 4I02A 2ZKNA 4CDWB 4PF1A 3AZVA 4CA9A 4WVVA 2DCZA 3BTXA 3WCRA 1LRHA 2XJRA 5A3WA 4IESA 2PHTA 1ZX5A 1AYM1 1NG0A 1QQP3 1VBC2 2W1UA 2XH6A 3KMHA 4LXLA 3RI9A 3BUCA 1NT0A 1MS9A 2VVDA 2R30A 4OLLA 3MGUA 1UWWA 4FT8A 4C0BA 2DCJA 4AVAA 3GYDA 2YY1A 4H7LA 3H7JA 1HDKA 3RFRA 2BOIA 1W6PB 2WNUB 3AM2A 5JMCA 4BISA 1MPXA 2VXRA 1ODMA 3LSDA 4UFIA 2OZJA 3BU7A 2NP0A 2ZPXA 4NROA 1QEXA 1MS5A 3AMHA 1XBFA 3BB6A 5LCWL 4KGGA 5BNPC 4DZGA 4OCTA 5C4WB 1C3HA 5FO7B 1H6YA 3PTYA 4FPLA 2EIGA 1UKGA 3WNNA 2OA2A 1G8WA 2RS11 2IXHA 5DZGA 2KXLA 3T2PA 4LBQA 3H8RA 1H8TB 2VNGA 4BQ2A 3AMMA 2FD8A 1UMZA 4LKFA 2FCVA 4JCKA 2WNVC 3HQRA 3WV6A 2OXBA 3ZYIB 5BY5A 1BEV1 5C8CA 4ZU5A 4P9GA 2WAOA 5I0SA 2G9GA 2NMNA 4RR3B 1WBLA 3I8TA 1W9FA 4L8QA 3GF6A 2F4LA 2QDRA 5DPNA 3M2MA 5FYYA 5BPXA 4COVA 3JU9A 2ZAHA 2XGXA 5JMOA 5LY1A 3J4UH 2J1RA 2D93A 3KHBA 3NSTA 4AHXA 3CBNA 1XYOA 2G4IA 5IWFA 5BNOC 4UW4A 2JIJA 3T2OA 4JRLA 5GZFA 1GZCA 3AZWA 3OBRA 4XILA 5A70A 3O1PA 5BXXA 2LW8A 2CWMA 2W1SA 1UL9A 2XR4A 1O5UA 2Y60A 2AYHA 4UBGA 3ZFGB 4E2QA 4E8DA 1QH6A 4GMP1 3DEMA 5IYYA 3V56A 1ZRCA 3OUHA 4DXSA 2VMIA 3DKQA 3FBMA 2WFPA 2JB8A 1D4M3 3I59B 1UZYA 1STMA 5T5PA 2CYFA 3T0AA 5LRSA 4LO8A 1JHNA 4QGNA 4E4ZA 2EIEA 4PQ9A 1GICA 4XZUG 1M06G 2VZVA 3NAPC 4NMIA 3UESA 3LIHA 5EHDA 5JI7A 1PO13 2AENA 2R041 1XNCA 4XBQA 1L7QA 2WRAA 4YGEA 5FZGA 5EYYA 2JD9A 3K75B 1LR5A 3VKOA 1ST8A 3FFQA 3HQXA 5FYUA 3WW4A 1W2OA 1ULGA 2QVSB 3OUIA 3WNOA 1HRI3 2ZGSA 5C3OA 1OF4A 5J1XA 3IDCB 5IVEA 4CCLA 3VDDA 5IVFA 5GZGA 2VQUA 1AYM2 1SLCA 1MACA 4Q4Y3 5FUNA 3VBOC 4PBOA 1XE0A 3MFAA 2JDUA 1AYN1 3TN93 2MPFA 3DN7A 3ILRA 4YGBA 4CEWA 4IERA 5DAQA 5FYIA 5TSWA 4ZU7A 4XJ8A 4YGDA 3D82A 4FCAA 1LHOA 3C7FA 2VQTA 1C1LA 4WVMA 1HX6A 4C0HA 1AR91 4XABA 3SKJE 5IVCA 1KXGA 3T0DA 4E27A 4F7ZA 3RGBA 1BBT1 4INDA 4NIAA 3WDUA 2VW1A 3IMNA 5FO9B 3SKVA 3SEPA 1TG7A 4LE4A 4B3NA 2RDRA 2C4XA 1U5YA 2DFCA 2ZGRA 3VD7A 2IWGB 1VBB3 3MF6A 3WNXA 2Y6FA 4WM7C 2RS12 2W46A 3JZVA 2AH2A 3U75A 2X5IB 4AHYA 3O1RA 4JDOA 2E63A 3VHNA 5CZKA 4ONUA 4QXBA 2A3XA 2RJ2A 1BEV2 3C7GA 4XIKA 4ATEA 4QDRA 3RYKA 1F5FA 1NXD1 4AR2A 1RL3A 4GH4B 4HVOA 3BTYA 3LA2A 4O9GA 3HN1A 4Y1UA 1A3KA 1FYUA 1OSGA 4BH9A 5L19A 2DBIA 5GZDA 1N47A 2D40A 1NA1A 2QQMA 5GM0A 1RUD1 2AR6A 1GZWA 4Q2FA 3GBGA 1W8TA 3THCA 4AQSA 4ISRA 1REEA 4QPGB 2PMWB 5LATA 4RYDA 1LJ7A 1REFA 3EHKA 1KGYA 2EXIA 1YIPA 1XOYA 2Q4SA 1K5MA 2GNBA 5JVVA 5JAXA 3RJRA 2ZAAA 4DRVA 1P8JA 1CD3G 1TQ5A 5EP9A 3T1LA 1SQ4A 1SZBA 2XHNA 2XXZA 3R6SA 3C3VA 3WLUA 2DUPA 2DBNA 1JYNA 4COYA 4FPGA 1K42A 1ZZBA 3EQEA 2VW0A 1XU1A 3DXTA 2WQ4A 2R042 3UKTA 2XVKA 4Q4W3 2Q8OA 4ZZ5A 3ZOIA 2WAAA 2WWSA 4QHBA 1ZRRA 5LBCA 4LO4B 5F3EA 1LB2A 3AB0A 1O4ZA 3T2QA 4KG8A 4IEQA 2EXJA 1VAKA 3IPVB 5C9AC 1AUYA 1OT5A 3WNKA 3HNBM 1EAH1 1VRH1 1CGPA 2NPIA 1AYN2 4HANA 5FYHA 1CAWA 1JOPA 1HXS3 3POGA 3WNPA 5EYXA 4CCKA 4AGVA 1QWRA 1FT9A 2YFZA 3CMGA 3AVSA 4YW2A 3DF0A 1KJRA 5FMOS 3ZMOA 3HR9A 1AR92 1Y9GA 2R073 1R091 4RQPB 1W6MA 4AEDB 4OHZA 1BBT2 3K4ZA 1YQ2A 4CDQC 3AYAA 5D21A 5A7WA 5FZ8A 1DZQA 3NJXA 1GR3A 4DUVA 3CKHA 1PIV3 2C9KA 3GALA 3I2KA 2P3YA 4ARXA 4BQ3A 4QKBA 1UY4A 3OPTA 1K3IA 1XNKA 3ECQA 5F3IA 4AHWA 2EVXA 5F1RA 4B7KA 1H2NA 4GULA 4CEYB 1JU4A 1W90A 2QQOA 5FFOC 2VZOA 3WNLA 3D6EA 4YVWA 5FZEA 4L0PA 1NX9A 2JXAA 3TBDA 3GM8A 2KM2A 5LWBA 3TWIA 3ZR6A 3VBRA 2VECA 5HI0A 2PHRA 3WDWA 4Y1XA 2J22A 3ES1A 1RUD2 1QJFA 3N9QA 2JIGA 1WD3A 4AI2A 4RD7A 2JENA 2VBPA 1SBEA 3O0XA 3KM5A 1C28A 2WT2A 4JDMA 1GNHA 2D6OX 3BTAA 3OGSA 4GJYA 5FPLA 1Q43A 1K5JA 2OX0A 2WN2A 4P5YA 3SEEA 4BQWA 5JWPA 2VTFA 3ELNA 5FK8A 5FPAA 5FZ6A 3RNSA 3B01A 1CWPA 1KITA 3B9IA 4D7YA 2RV9A 3A22A 4CDWC 4EQVA 3HT1A 5LZ6A 2BP6A 1G9FA 1QXJA 3NJZA 1UX6A 2F4PA 3GBFA 4JX0A 3AKSA 4UF0B 5EJZB 4BWOA 1H2LA 3ATGA 2H0BA 2VCMA 1POQA 2WL1A 4LA2A 1I5PA 3SH4A 3D8CA 1UMHA 1DIWA 4ZXKA 1UD1A 4WVWA 3IB3A 3USUB 3WQ0A 3LAGA 4FP3A 2WNUC 3ZXAC 2A3YA 2YU1A 1GP6A 5CBLA 4DIQA 2PAEA 2I74A 2Y64A 1EAH2 4A6OA 2PN5A 3WHTA 1OPOA 1VRH2 4B8EA 2XONA 1GV9A 1VBD3 2NLRA 1LEDA 1UU6A 3VKMA 4CP0A 5L9VA 4D7TA 1GP5A 2QJVA 3IIIA 4AQTA 1Y9MA 4D6SA 4XF3A 2BVVA 1S0DA 2RDSA 2XJPA 3FZ3A 3OGVA 2AGSA 3V0BA 1R092 1H8TC 5JLVA 3APBA 4QX2A 1QDCA 3BVCA 1NCQA 2IXIA 2Q0AA 1ND3B 2J1AA 2Y0OA 4P00B 4R4XA 1X50A 5FREA 4MGQA 1TEIA 3DYMA 4FFHA 3BU0A 4LUKA 3MW4A 3FX3A 1LHWA 3ORJA 4Y20A 4YVSB 3KT4A 1O8SA 1QJY3 2VQ0A 4NWVA 2TUNA 5CB7A 2AEZA 4OQ8A 4JVAA 3TAYA 5M0TA 4GMP0 5IT6A 4B4RA 4G3YC 5GZCA 1TME1 3VBHB 1DQ2A 5T3NA 1VLNA 2FQPA 3H9AA 3L2YA 3VB9A 3AYCA 3ZFGC 3KV4A 3T3YA 5A3NA 3ZIXA 2WA4A 2GC2A 3RWNA 4BMEA 5IVJA 4Z92B 2X05A 1IPKA 4UAPA 4AEKA 2RHPA 1MS4A 3ABZA 1TMF1 2SBAA 4N9IA 3FJSA 3KLSA 5HPOA 4N43B 2UY8A 4OI4A 3OBZA 2HBUA 4Q1RA 4H2AA 3CF6E 1PO21 4FVVA 4DUXA 3NJYA 4YW3A 4RA0A 2B7YA 4FOYA 3M3CA 4HN0A 1OOPB 3JCIA 2H6CA 5CG9A 2QQLA 1C57A 2ENRA 5C3QA 4BIFA 1IPSA 1GQPA 1OKQA 3FHQA 3M4FA 3WG2A 1F15A 3TEXA 1S0JA 2ADEA 1H1MA 5AFBA 1I3HA 1V6IA 4LHSA 3LPFA 5DN2A 4CZSA 2CTVA 1POV1 4NAMA 3HD8B 1CZTA 3X29B 1JZ8A 1UY0A 4C8DA 1D2QA 4DY3A 1HRV3 4Y22B 5JXGA 1OH4A 2DVFA 4URTA 4P9WA 3J8F3 4S2FA 1G86A 2VZSA 4NUBA 4D94A 4QX5A 3N9LA 4IGQA 1JYWA 2OQ6A 5FO8B 4LQRA 5KXDA 2V4VA 4XQWA 2YV8A 4DFSA 5A80A 1QGLA 2Y6GA 4XF1A 2GH8A 2D98A 1PNFA 2QQWA 1QJU3 3HEIA 1NCRA 1RB8G 4OI2A 4A41A 1UNBA 4OZOA 3LOBA 1YI7A 3AL5A 2BZDA 1ZVFA 1PZ8A 5FPUA 3NKTA 1ACCA 4KU8A 4YW5A 2YGLA 4A3XA 4D69A 1L7RA 1VR3A 2BFUS 3JB8A 2X5IC 1QJZA 4RHV1 4UWDA 1AR71 1ZRFA 2ZHKA 5GLWA 4UYBA 1KFUL 4YW4A 3D0SA 4LT5A 3Q8CA 1U5ZA 1ULPA 2PAMA 3Q8EA 4GZ9A 2YC2A 4XFIA 2VZPA 3B02A 4GH4C 5ANQA 1XC6A 2WWUA 4S2DA 2ZEXA 4WBBA 4YM0A 5FLHA 1LOBA 2D7FA 1W6NA 3WF2A 4QXKA 3W5MA 1W05A 2PAKA 4Q4V3 1C8M3 1TME2 1SFNA 2VZUA 1U12A 3NO8A 5D8AA 3ZN6B 3IIAA 5K0UA 5SV8A 1RUF1 4QPGC 4X6RB 4XJWA 3TNQA 1LKNA 3FHAA 4XJZA 1JBCA 1RUC1 2Q1MA 3IWZA 4HSLA 5A32A 3LDKA 4COUA 1URXA 5BNPB 4BDVB 1X8EA 4EWAA 1KDMA 1X9PA 1TMF2 3SCGA 4FI9A 3JQWA 2ORZA 1FOD3 1O59A 4B1LA 1PO22 4CP1A 2WQZC 5CISA 1WLWA 3P3PA 4BA6A 4OUEA 4Y1YA 1V9U3 1WKYA 3QLQA 2WNVB 4QMAA 5C5UA 1QJX3 4QGMA 2GNDA 4HT1T 1IQAA 4TYSA 1CAXA 1PVXA 3VBUA 5FR3A 2CSGA 1LOFA 2Y6HA 1HV1A 4AYUA 4EWEA 5LA2A 2HWD1 2OS2A 5FZMA 2WO3A 1WA6X 3IAPA 3OGGA 1Q8QA 2YB7A 1UY3A 4CU8A 4OFGA 5BNOB 3FLTA 4DEVA 3IDEA 1DLLA 3LSEA 3UK9A 2OUJA 4CVUA 2C9AA 3MV11 4I0BA 3RZKA 3O7OA 1GU3A 4BPZA 3OBTA 5BYNA 4BHPA 4MGTA 3E6DA 5LEKA 5A3UA 5CU1A 5IJRA 2RDQA 2E7TA 2DDUA 3DPRA 1V6MA 4WM8B 4Y4YA 4AEDC 2TBVA 4M4RA 4QB6A 1C5IA 4BJ0A 1DCSA 1YYNA 4I3GA 3WDXA 3GBWA 5FP7A 5A3LA 4BE3A 5J7MA 5LA0A 3KHCA 4JKMA 3VGIA 1WW6A 1CVNA 2ET7A 1REDA 1BMV1 3VHPA 1EUUA 2KA3A 2IFWA 4H3WA 5KXBA 3V0AA 4IEPA 3ZKUA 4O7XA 1UN1A 1QH7A 2HWE3 1PX4A 3HQUA 1IPJA 3MW2A 1DGRA 4RHV2 2VCBA 1AR72 4CEYC 4CUAA 3LA3A 3GZTB 4X6QB 1X7NA 3DECA 5FCCA 2LALA 4KGQA 1LHUA 3N7MA 3PUAA 3WOGA 5KXEA 5C70A 4Y33A 4JQRA 3BALA 3A0KA 4M00A 2YXSA 5FKBA 4MH0E 5FRAA 3GCXA 4E4DX 3WSOA 3CEWA 2QKDA 4QGLA 3BOPA 1VMHA 4QKNA 3FE5A 5T5LA 2FHRA 3WG4A 2C5DA 1RUF2 3MIHA 4W4ZA 2ET1A 4W6YA 4Q29A 1ZBE3 3ZPYA 4XFAA 4J1XA 1PGW1 1RUC2 4F8AA 4XJAA 1ZZ6A 3AP7A 1OURA 2D3RA 2E33A 3PUQA 3ZSEA 1IS3A 3IKWA 5FP8A 1YHFA 5F5AA 4A6SA 1UKRA 1RUG1 4CP9A 5IK8A 5A3PA 2XKOA 3SQOA 1O8PA 1R083 1FV3A 2GMEA 4D6QA 4YSFA 4Q8KA 5L9RA 4XF9A 5CA6A 1BKZA 3JBG3 1DZRA 5DAVA 3O1SA 4JGYA 2Y38A 4QPWA 3SITA 1PMHX 3SC7X 3Q8FA 4UFJA 2D5HA 3NQHA 1H30A 2ZHLA 1MEC1 2VMDA 4QX1A 1PMIA 2FZ1A 4ARYA 4YNIA 1BJQA 1J1LA 4JAAA 1ZREA 1R64A 5DAPA 3ZLIA 2VVFA 4ASMB 5FZOA 2HWD2 4XCAA 4PIYA 1YLLA 3SLIA 1HV0A 2DCYA 2JDZA 1WW4A 4L11A 2ZMLA 3S57A 1W9SA 2BGOA 2OPKA 4YM1A 3PVNA 3VDDC 5FYBA 1C1FA 2HEYF 4AFBA 3ROUA 2PHLA 1VJ2A 2W94A 2XL9A 4XAAA 2W47A 4FOQA 4Y1VA 1ND3C 1F35A 3URFA 4PQQA 3U11A 5FUIA 3T4HB 3VD9A 1BMV2 1W6OA 4YG6A 1DZTA 1N3OA 2F6BA 1CX4A 2R7EB 4GKYA 4XYXA 3S5AA 5ABJA 4NPLA 1VPHA 3RZZA 2QNKA 3SH3A 4QPYA 3RJ2X 4D3WA 3WHUA 3PTRB 1DQ6A 1K45A 3WF0A 3ZSJA 4K1YA 1NCRB 2Q8DA 5C33A 5F7UA 3AMNA 1ZNPA 2IFRA 5FY0A 2IXCA 1CZSA 1S0BA 2ZGKA 5T5JA 2ZEZA 3VBHC 5CFCB 3LPGA 4IQPA 1Q8PA 3CJIB 3B7MA 4FBFA 2CGOA 4LIVA 2HLEA 4LOTA 3OCPA 5FYSA 2P1BA 4N53B 2XLGA 4WVZA 2VBDA 2ZGPA 5LASA 3TNPB 2RJLA 1MS3A 4NRMA 1S1AA 1OHFA 1RVF3 5FXZA 3WG1A 3RYRA 3O1MA 3GNEA 1PGW2 1GKBA 3JUUA 1OOPC 1AX2A 2A6WA 5K7PA 4CDQB 1POV0 4FPEA 1VRBA 3N4MA 3THPA 1QXPA 1RUG2 2XB6C 3MIBA 3O0VA 4LTAA 4Y4RA 5ERLA 3H3UA 1VMFA 5FY8A 2Z2SB 3VBSA 4V2VA 4XC9A 4KU7A 2JX9A 1QJEA 4XIOA 4CE8A 4IL7A 2JECA 5EZWA 1Y9QA 3UJOA 3NV2A 1MEC2 4QPIA 2VNOA 2XMLA 2YFUA 4QM9A 3ZYBA 4ASLA 5J09A 4DMIA 4HPKA 5KC6A 5JZGA 2RMU3 4AOCA 1DG6A 2VMFA 3AKRA 3PJYA 4XACA 2GNTA 4KQ7A 1J3QA 1UX7A 3ZXLA 3HNYM 3DKWA 5CYYA 2WZR1 1JYCA 1LHVA 2YZ4A 4IV3B 4JHZA 2P6HA 5F8PA 5L73A 4IE4A 5HCHA 4YZ4A 3C7EA 5A1FA 5HV0A 3V64A 4K1ZA 4BB3A 2P37A 1DFQA 3M3QA 4LHKA 3KT1A 1XE8A 4CXYA 2NN8A 3AXDA 1E5IA 4QQLA 4I3PA 1PO11 1CZVA 3KF5A 5K4LA 1LHNA 3M7AA 1E57A 1WMEA 5DUXA 1ULCA 1X33A 2O8QA 1AXYA 1W9YA 3I2GA 4YZ1A 1OQEA 4DEQA 4YGCA 3H1YA 4KWLA 5IVBA 4K3UA 3M8LA 4Q4Y1 4JV4A 3LE0A 5FYCA 1VBE3 4CCJA 1TZOA 4YW1A 1VB4A 2D43A 1H6XA 2ZZQA 4H14A 1XYPA 1ENQA 4ZXEA 3ST7A 1YEWA 2JG9A 4BYYA 1A6CA 1RMU2 3K48A 4CDXA 5IK5A 3IBMA 1WLTA 1GWMA 1HN0A 2Y26A 1T6BX 4LJHA 5B4XA 4A45A 2HWF3 2R0HA 1RUH1 1QF3A 3POBA 1V6KA 1EPWA 1OKOA 2K46A 4XFHA 5E88A 2ZGUA 4A4AA 3AMPA 5LY2A 1VBC3 1O91A 1UPIA 1IKPA 2JKXA 3MIDA 5JXIA 1VBB1 1MQTB 4LK6A 4LR4A 3BPSA 1DYPA 1Q8OA 5FBZA 3VBRC 1X9TA 2V5YA 2EAAA 1F5JA 3I2HA 4NAOA 2XVLA 4U2AA 5C7GA 1GBGA 3WEZA 1JHJA 1DGWX 2DURA 2XHKA 2XJUA 3P3NA 4HK8A 2JDNA 1BVP1 1XQNA 3PIGA 4GKXA 4RS5A 1DU3D 4FFGA 3UJQA 4XFBA 3VDAA 1S0CA 3PL0A 4FQZA 2J1UA 2XJTA 2O8OA 2ETEA 4X8PA 1US3A 4AGGA 2ZGOA 5J48A 3AYEA 4FQ4A 4LUMA 4Q0SA 3VZMA 2BV4A 4OHWA 3AK0A 2ZGQA 1DQ0A 4EZ4A 3ZN6A 2RM23 4DINB 1CQ9A 1YFXA 2ARCA 2E32A 3OTFA 4G9SB 3H42B 4LA3A 2D6LX 2WT1A 2FZ2A 4WM8C 3ACIA 1AHSA 2WZR2 1HB4A 2DU1A 3B93A 2EA7A 2YC4A 4SLIA 2YYOA 5E16A 1B35B 2Y6JA 5KBFA 1YI9A 5BNQA 5GKAC 5C3RA 3M1HA 1QHDA 4PIXA 4QB2A 2OZ6A 1H9PA 1DQ4A 2A6ZA 2PTMA 2QDNA 4I09A 4Y5Z0 2OUHA 4AAPA 4MZUA 3WVJA 3KVBA 1ZYBA 4UT5A 4AEMA 5FKCA 2FCTA 4YPJA 1W06A 2NM1A 2FDJA 3S30A 5FWJA 1ND2A 3RZJA 2FBEA 4AVBA 1QY4A 3VBFB 1VMJA 5E89A 3ZYRA 4Q4Y2 4Q1PA 2CL2A 4FFFA 1VE0A 2DUOA 2WFF1 1CPMA 2QQNA 4AAXA 4X8NA 2W87A 4OYUA 1HXS1 2B4KA 4XMIA 4BQYA 4BLIA 2ZGMA 3W5NA 3F2ZA 4Z2WA 4PBPA 3LFIA 1NE4A 1M4WA 2Q8CA 3VL9A 5CFDB 1RUH2 3P6BA 1Z7S3 2R071 3KCCA 4KWJA 2PA7A 5DAXA 4AFDA 2UYBA 3RI8A 4BZ4A 1GOGA 2GH2A 1J3PA 1LOAA 2P3JA 5A6ZA 1LAJA 1VBB2 3W9AA 4CCOA 2DYCA 4D8MA 3I97A 1CJDA 1CJPA 1W39A 2IXKA 3I2DA 1BLZA 1UMIA 2FMYA 1XB9A 3E5XA 3GHNA 1JOJA 3MW3A 4RSUA 2TEPA 3OYWB 4V2WA 2W9XA 4FPCA 3ZFEB 2JDYA 3FFZA 5F9TA 1ODNA 3E6CC 1GNZA 1N1VA 5BNNA 3MHZA 3E6BA 3OG2A 4K7JA 5FMOL 3VHRA 2V73A 3GJAA 5DXDA 3U07A 2IVIB 2GZWA 4LHNA 1J83A 4NPMA 2RS13 3WD5A 2XBO1 5A6QA 4IDZA 5EPAA 1F8VA 4M3CA 3WT3A 2HYXA 4UOJA 4HLTA 2LM3A 3IZOA 2BRTA 3U4XA 1UZ0A 3W58A 1NY71 1NZCA 4NR1A 1CAVA 3T09A 3HMYA 5IVVA 4PDWB 1BYHA 3ZR5A 4EN6B 2Z4FA 1OFNA 1Q5OA 1LGBA 1UYYA 5CVRA 3CQOA 4J25A 3DV8A 4DXRA 2EXHA 1HQNA 1EUTA 3N7JA 3PVBB 4UXAA 3ZFFB 4AEJA 3B9CA 3T30A 4R9BA 5FZAA 4NN0A 3MICA 2BJSA 3K3NA 4HK9A 2ZGTA 1NCRC 1UZWA 2D6NA 2VOWA 3LB9A 4OHVA 3RMYA 5F32A 1W0PA 3ENRA 2YBKA 4GMP3 5CFCC 4PCRA 1V00A 1XSQA 3P5BA 3CJIC 4CPBA 2JG8A 1HQLA 1L7LA 2F17A 4L99A 3UKNA 2WA3A 1R1ZA 5L7OA 2WFF2 3S7EA 3CZUA 2R6QA 5LK7B 5A7QA 3NVCA 1GYKA 4N53C 2GC3A 1HXS2 2BDRA 1CONA 1UF2C 1U5IA 5AVPA 3ZYPA 1UOBA 5IW0A 1CX1A 2PQQA 4NJ4A 4HN1A 4NHLA 3U37A 4ES9A 1ZBA1 5KHIA 2J1TA 1FV2A 1GQHA 4CU9A 1SEFA 1ZZ8A 2R072 4RGAA 1I1EA 4FPHA 4Z2AA 2VOXA 3HOBA 1W3VA 2E7QA 1XE7A 1EYBA 1Q8SA 1DP0A 4KWUA 3RSJA 2UY9A 1AYN3 2QCSB 1SLLA 2D6PA 2P2KA 2ZOEB 2HWB1 4XDQA 2ZKLA 1G9CA 4XVHA 1GMMA 1QOOA 3N9NA 1V6JA 4AFCA 1QJY1 4IV1A 3BTZA 4GAZA 4HFSA 1UW8A 4OI1A 4MOAA 1CPNA 4AXOA 5HV4A 4FXGB 1BXHA 2VUCA 4MADA 3FN9A 4QX3A 4LBQB 3PURA 5I93A 2W0XA 1BBT3 4HBNA 3NMBA 1YFUA 1YO8A 3VUOA 2ZA9A 4AQ6A 3B3QE 3EB7A 4QKFA 1W2AX 4KBBA 5HBAA 2Z79A 2R32A 5C8CB 4IV3C 5J98B 2XBO2 2ZGNA 5KXCA 3PMEA 3KT7A 1PM4A 1S4CA 5CKQA 3MLJA 3ZSKA 1IKQA 3ZXJA 2D3SA 1NY72 2P3IA 2P34A 1AR83 4YYOA 4MGIE 2WT0A 4DQAA 2FDFA 1R1A3 3FUOA 4ISQA 1QOSA 3UETA 5FBJA 2WIIB 3P1IA 4BXFA 1Y3TA 3POYA 2X8KA 5DUWA 3MV01 1MVQA 3VLBB 4LKSA 1ZZ9A 4HXCA 3WF3A 1SPPA 5JOWA 3WP6A 4LMFA 1LTEA 4MVTA 3H3ZA 1AL21 2YC0A 1WW7A 3MZHA 1WMDA 5G05L 4NHKA 5DAWA 1AXKA 2BWAA 2KD7A 2XUEA 2RVAA 1O4YA 2FMDA 5KHHA 4MXWA 4AL9A 4LBJA 1EP0A 4AQ2A 4K8RB 4M0HA 1CAUA 2XWJB 4XQDA 1J1TA 4Y26A 5A3MA 3VD4A 2QQIA 1N1SA 2VL4A 3VDDB 4NWWA 1SFPA 4IE6A 4P5HA 2RR13 4COZA 2BPA2 1ZBA2 1MQTC 2PYTA 4XJ9A 5JUVA 2HH9A 4IEXA 3AC0A 1VBA1 1LOEA 4CEWB 1XNTA 4UFLA 4JHTA 1RUE3 3OPZA 3O1TA 1VIWB 2JE8A 1GZ9A 1W0OA 2O1QA 2W5FA 3OB8A 5CNAA 2DTYA 4WVMB 3TEYA 4TZDA 4EWDA 1EAH3 4DXZA 4P14A 1ZRDA 1JMUB 1VRH3 3ZN4A 3BGAA 3KD4A 4XTPA 5L36A 1OI6A 1H8VA 2HWB2 3NAPA 3PUSA 5JDBA 5A6XA 5AC93 1QJY2 3AP5A 5D2AA 1HQWA 3VDCA 1MS1A 5IAVA 3O1VA 3GHMA 5CKMA 1BK1A 5B4NA 2MNGA 3OF1A 2ZX0A 2XLAA 5ACA3 1UAIA 3WXPA 4JQTA 1EV13 1JXNA 2JDKA 4MGSA 2BVBA 3ES4A 1UIKA 3VBOA 1C8NA 2JKBA 4QQPA 1D4VB 5FY1A 5I91A 5A7SA 2FCUA 4A2UA 2CDPA 2RS33 3J7NA 4K21A 5BNNB 3TEZA 1B35C 4YW7A 3FL7A 3CLPA 4Z82A 4A7KA 3N35A 4AGRA 4FTSA 2A6XA 2FDIA 1W8UA 3BI3A 4L92A 1LEMA 2Y0IA 1NA1B 1I5ZA 4N8MA 3KF3A 4DRRA 5FY7A 1MZ5A 1XNAA 2WINB 2XJQA 1V9U1 4AFAA 1W6QA 1QNWA 1GZWB 4AFMA 2BW8A 2VC9A 1GOHA 1QJX1 4QQOA 4CU7A 2OQ7A 1JYIA 2R1BA 2RG4A 1AJOA 1OLMA 5FPXA 1RTVA 2IVJA 1QMJA 4GWMA 3VBFC 2VPVA 1UZVA 2QBXA 4CP2A 1PVC1 1K5MB 1AL22 1RGSA 2A73B 3VKNA 1ASJ1 1OC1A 2R063 2JDMA 2XQRA 3ITQA 4XUQA 3CJXA 3OD4A 5EXOA 4K40A 4Q4X1 4CDUA 4PI0A 2EF6A 4I0WB 4BMBA 5CFDC 4COWA 1OF3A 2IXLA 4TLFA 5I0DA 1GNYA 4GB33 4ZONA 5IFTA 1UZZA 4XFFA 3LEKA 5J36A 1YFWA 4AWDA 3G7DA 2AACA 3POJA 5F5CA 3ZM8A 5FZ3A 5LK5A 1JU3A 1AZDA 3C7OA 3PUHA 4P9XA 5A33A 4AI8A 1SCRA 5DMYA 1K12A 3MFCA 3NW4A 1SDDB 5FMCA 2UWCA 3POIA 4TLGA 1ULFA 5L9BA 1CAWB 1VBA2 5FP4A 2A6YA 3U14A 3ZXEA 3KQRA 5JR7B 3GZUC 4LKEA 4EROA 2A5ZA 1FAYA 2BOJA 3ZFEC 1W8NA 2GNMA 1W03A 5K9YA 2D6KA 3AP4A 1W6MB 3THDA 2YROA 5T50A 1NQJA 4QDSA 2SLIA 3AYDA 2J1VA 4YG0A 3WW2A 1LOGA 1HB3A 2VULA 2VE1A 3QCWA 1COV1 2VCAA 4QDQA 4WZCA 5FZLA 4QHZA 2WS91 5FQ0A 3HT2A 2DTWA 4MV2A 3RDIA 3N3HA 4OHYA 1DYOA 4XPVA 2J1SA 1RYYA 2ZABA 5C9AA 4Y5SA 3ZMNA 4O9EA 4CCEA 2BU9A 2Y6LA 1BCXA 4RGKA 5F2SA 4Y1ZA 3MF9A 4HETA 1FPN1 2VY0A 4M01A 1ZBE1 4XDOA 4PDWC 5FK7A 2VZTA 5FZBA 3I3DA 3HWJA 1ULDA 2AREA 4HSJA 5DABA 1H1IA 4YVWB 1FX5A 1LODA 4META 4BOWA 4UBHA 5IK7A 3OGRA 1R081 1WBFA 4FPJA 1G9BA 3ZFFC 3ILNA 3VBRB 1YWKA 1RHI1 3A21A 2W68A 1QKQA 3LCPA 4JDNA 5I0TA 3HN3A 3LF7A 1TME3 4W6XA 3Q8AA 5CG8A 2W95A 2VZ1A 1PHMA 1QJX2 1S2EA 2QZ3A 2WQ8A 1U5XA 3AJZA 4B4QA 4JTOA 1RUI3 5EJ1B 3IT8A 5CADA 2ILMA 2YUEA 3CIHA 4BK4A 2GC0A 1PVC2 2EALA 4LEJA 1TMF3 4EV0A 3H0OA 4QXCA 4NIHA 1HKDA 1ASJ2 3CZJA 2J1EA 4OVEA 4Y24A 5GALA 4XBNA 1PO23 3K46A 3ZN5A 2ADDA 1V6LA 1AX0A 4Q4X2 5EFUA 3SXWA 3WY6A 3RZGA 5CFCA 4OULA 1S2KA 2VU9A 1H1AA 4P9YA 2YHJA 1OQ1A 1ZM1A 5JIAA 3W20A 5IATA 3NL1A 2K9ZA 1H2KA 3I2OA 4Z1VA 2VR4A 3LEIA 3MLLA 4R4ZA 4EE2A 1PK6A 1W8HA 4IUGA 3O1OA 2JDPA 5FY9A 1UOJA 3SMHA 1JYVA 4XXPA 3RZLA 4RL7A 3FLRA 4FSJA 2Q1FA 4Q27A 3WINE 3JD73 1ENXA 4MLOA 2GC1A 1O6UA 1WGPA 1JODA 2C0ZA 3EXUA 5FUPA 1S0GA 1JTZX 1DGWA 1B09A 4AG4A 2W2IA 1G9AA 3J7MA 3VZOA 1S2BA 5IHRA 3Q8BA 4XXAA 2XDVA 3IDBB 3INAA 4MHRA 2NZ9A 2W52A 1HLCA 4CDWA 3I3MA 1ZZ7A 3HVDA 2ZJCA 5GJ6A 5JPNB 3V0BB 1RXFA 4LOSA 1NCQB 5JR2A 1CR7A 1YCIA 1N3QA 2BEOA 1COV2 1RUJ1 2WLQA 2A7AA 5I8SA 2WS92 3S5QA 5C8CC 2BWCA 2VD7A 1IGOA 3VV1A 4BQXA 1YXWA 4RS5C 4DB5A 3TEWA 4NE9A 4Y20B 1W6PA 2WNUA 1AR63 4FAGA 1SG3A 4BQ1A 1X82A 1NOVA 2EICA 3WDYA 2HYKA 3TOJA 4QU2A 1H0BA 1WD4A 1AR73 1F4AA 1HIXA 2IXJA 3GZEA 1FPN2 3WQ7A 1LECA 1ZBE2 1SCSA 2HWC3 2GMMA 5JOZA 5F6KA 5I0RA 4NPRA 4PHZA 5C4WA 4M4PA 4QQ2A 5IK4A 3UL2A 4OI0A 1LGCA 1SLTA 2DF7A 3T0BA 3D3AA 2IZWA 4I01A 4AI9A 5C3PA 1DQ1A 1AJKA 4IEOA 2YG0A 1RHI2 5H9SA 3O1UA 1LULA 1OUXA 1MS0A 1YQ6A 4AI0A 4ZZ8A 4FPKA 3POWA 1JZ6A 4KG0A 4QX8A 2BNOA 4URAA 2OW4A 2PLV1 3SCHA 4CCCA 5FXXA 1W8WA 4RR3A 3LDRA 5FXVA 4BQ5A 1OPMA 4R8HA 1WWYA 1LNSA 4ES8A 4F3JA 3VKFC 2ZZJA 5DZFA 2W91A 2ZACA 3O14A 4FOVA 3RMXA 2ATFA 1LCLA 2RS51 1ND2C 2W3JA 4LNVA 3TYJA 1OH3A 1UY1A 3PU8A 3S7IA 1W8ZA 4L9BA 2GDFA 3LWCA 3ZFGA 3L2HA 1WUVA 4CEWC 3MIEA 5KHJA 2VZRA 2B9VA 3UGGA 3D5OA 1LGNA 1OQDA 2UWBA 3WQBA 1GWKA 3I59A 3MIGA 3U78A 5BUVA 3DYOA 1SLAA 4CUGA 4JGZA 4EN0A 1J59A 3LKJA 4I30A 4NRQA 1DGRN 5E6HA 3H50A 1QQP1 4AW7A 5FMBA 3KCXA 4J1WA 3VN4A 4BXSV 1VBE1 3MDPA 1NLRA 1PGL1 4LITA 5C5TA 1CIYA 1GLHA 3E1F1 2RJKA 3KV6A 4A42A 1XU2A 2D97A 4CCDA 1LENA 1GWLA 2P17A 3OGJA 4NHMA 2CGPA 3KV5A 1JI6A 3L9JT 4P9LA 2EXKA 1VALA 1WCUA 2MEV3 5FLJA 4N7UA 2HWF1 4NOTA 1RUJ2 3K3OA 1JOBA 4B1MA 4K6BA 2QTWB 1GSLA 5BNNC 2DVAA 2Q5TA 5F5IA 2BNNA 3OY8A 1KJLA 5C71A 2GN7A 4MX3A 4XE9A 1H4GA 2V4AA 1IOAA 4MG2A 2HKXA 4ASKA 4PLNA 1NA1C 1JZ2A 1W6NB 2VUJA 3EO6A 3B5LB 4EJRA 5IAXA 3POEA 1T6GC 4R9AA 2VAUA 1VAMA 4OZXA 1FMD3 3BYWA 5D8AB 5K0UB 3MLKA 4KNCA 1MZ6A 1OLME 2NYYA 4H55A 3FUQA 3B94A 5A32B 3R4DB 4DO0A 2GN3A 3ZYJB 3RZMA 1S55A 2X5IA 1K5MC 4W6WA 2XQXA 4XEZA 3EBRA 5FYZA 2BGPA 4LO5B 2ZCWA 3OD0A 2ARBA 3GZAA 5FY5A 2PLV2 2YMZA 4HKOA 2HEWF 2RM21 3R4SA 1W9TA 1RUOA 3I2FA 3N7LA 4GH4A 1OA4A 2WSVA 2OT7A 4MXVA 2ZX1A 1O3RA 1PM7A 2DUQA 3CU7A 3T08A 1RUG3 3CNAA 3K77A 3R0RA 3WCSA 2RS52 4JRAA 1CIWA 1CAXB 4LBLA 1D4M1 3VBUB 2V72A 1SBFA 3DL3A 1W28A 5DDJ3 3POFA 2XUMA 1S0EA 1YFYA 4QPGA 4CUBA 5L7OC 1D7PM 3PNAA 3NRUA 3BIEA 4P08A 4CXXA 2VMGA 4FTEA 3A23A 3T1MA 1KQRA 2WYFA 3GXUA 1HRI1 2ERFA 3DPRB 3EMRA 2B46X 5JXHA 3FWEA 1XNBA 2ZX4A 1QQP2 2BBAA 2BGCA 2DFBA 2E53A 2VH9A 3WG3A 4AI1A 4CCMA 1WCSA 1W99A 3TN91 3J26N 3IM0A 1PGL2 5LRRA 4JC1A 3OBAA 4XZPA 4KBZA 3V0AB 1E5SA 3IPVA 4UFKA 5FWEA 4XUOA 1AL0G 3OEAA 1WCDJ 1XRUA 1Z7S1 3VDBA 2VUDA 3M3IA 1FATA 1ZA7A 1QIQA 2WYSA 4HONA 4QHOA 4CYDA 3H3LA 4YVWC 4OQ9A 3RS6A 1TVGA 3UV9A 1HN1A 2CHHA 3WP3A 4P9JA 4AVSA 5JI9A 1TNRA 4RQPA 4AEDA 3E97A 3A7QA 1RMU3 4FOWA 1BHGA 4Y5TA 1T2XA 3BIWE 4WZFA 2CGNA 3SNMA 5FZFA 1O3SA 4IEUA 4NRPA 2QQKA 3ZXGA 2FDKA 1IQDC 1PZ7A 2DVGA 1ENRA 4FO9A 5H9PA 3ZYGA 4CTEA 1RJ7A 5A1AA 2UWAA 1S0IA 3QOPA 4NIGA 2O14A 2CU5A 5APAA 2Q8EA 4DNYA 4CP9B 3M3EA 2VQAA 2H6BA 4CEYA 5JSOA 4IEWA 1NE6A 4QU1A 4ZS3A 2PHFA 2RM22 4JGYB 4L97A 5FPVA 5E1RA 2CV6A 3D4KA 3AKTA 4FXKB 5JIUA 1JUIA 4NHXA 3UKVA 2XPJA 2VBBA 3KGZA 3U1XA 3ZXDA 3WW3A 1D4M2 1YC61 5GZEA 3ZXKA 2RE9A 5LB6A 4GD4A 1A8MA 2WZ8A 1BZWA 1RITA 4LLFA 5LEJA 3ACHA 5FZOB 3I3BA 2WO7A 2CAVA 2LUWA 2ZXQA 2JD4A 3MYXA 1UYXA 2YGMA 3RQ0A 3JB4C 2I07B 3PLQA 1PO12 2Y34A 4UFMA 4ZU4A 4Q4W1 3SH5A 4HOOA 4DOUA 3NV3A 3HAGA 3N36A 1DYKA 2BNMA 1HRI2 1JYXA 3LZZA 1O3QA 2WZR3 2ZBJA 1G7YA 2GMPA 1NAEA 1NCQC 4U36A 3N9PA 3AZZA 4UF0A 5F5QA 4HL0A 2WWJA 3TN92 1D0HA 4XUNA 3ZPOA 3BN6A 2JE7A 1W6OB 4IE7A 4JGZB 4FP2A 4C90A 4E8CA 5ABJB 3USUA 1QOTA 2ES3A 1UQXA 2XJSA 1SMVA 3ASIA 2VNRA 5A7NA 1X8MA 1GUIA 4FPYA 1CESA 4MSVA 4Y3OA 3FBYA 1Z7S2 3DXUA 3T2TA 2OYZA 5FYMA 4PJYA 5A3OA 2BUKA 4N7IA 4AVTA 2YU2A 2HEVF 4HVRA 2QZ2A 4XHBA 3E5UA 4QX0A 1AYM3 4Z07A 1A34A 5CKNA 1HJFA 4BIOA 2G9FA 1E5HA 1PIV1 2B9UA 3LQCA 4XBLA 3N9MA 2X53S 5FLIA 2W92A 5DG1A 4UW3A 2D44A 1ND3A 4JKKA 1YNAA 2G19A 5C8WA 3OY8B 5HCAA 3IMMA 4L2NA 3THTA 1W3XA 1RUH3 1YUDA 2W39A 1U0AA 4GWNA 4YVSA 4CXWA 4Z8BA 1PX3A 5FP3A 2R16A 3R05A 3MBWA 4JKLA 3ZO0B 2VGDA 5JSPA 5A7PA 2V5DA 3NNFA 4UW6A 3NWKA 2GP3A 2BERA 1KRIA 3OOXA 2E31A 3SHRA 4LBOA 1VAVA 3VBHA 5J37A 3VBSB 2GAUA 2Q1ZB 3MEPA 3KWVA 3QACA 3WP5A 2ZMNA 4EN8B 5T52A 3RPQA 3AZXA 5GLUA 1BEV3 4QPIB 1AR81 2CY6A 3LEMA 5ANNA 4HPKB 5JXJA 3CHXA 5JZGB 1GQGA 3BKZA 1R1A1 4CDUC 4XQ4A 1V6OA 1VB2A 3PDQA 3LDBA 1SBDA 5DG2A 3RWKX 2EAKA 4N43A 2QFEA 1Q3EA 3R4UA 4Q0PA 1KD7A 1RIRA 2YBPA 3RVHA 4H7MA 1J3RA 1X36A 5A6YA 2WO2A 1OOPA 5FV3A 2PHXA 3DUIA 2ZHNA 3H8UA 3EYPA 4Q4W2 5DUVA 1YQ8A 2ZX2A 5EJ3A 2Y8KA 2ZEWA 3ZKYA 4FTBA 4BLJA 2YPDA 4MUVA 3CO2A 4ZHNA 4UI9L 2XKPA 5EQUA 4PLOA 2WO1A 1DF0A 1C5HA 1DBNA 5H9QA 4Q26A 1LESA 5FZ7A 4RFT0 3ZSMA 4BQ4A 1ONAA 1VBD1 4CRQA 2QQPA 1WLCA 2D5FA 4Y22A 2K0GA 4K20A 4OUSA 4YLZA 2ZS6B 1NUKA 5GLTA 2CWSA 3A0NA 2R043 2DVDA 1RJ8A 1XYNA 2WKKA 1PZ9A 3AP6A 2RR11 5IUQA 2ZX3A 4OMDA 1ZA4A 4JTNA 4XTMA 1RUE1 3B69A 1GOFA 2JG9B 1SDWA 1N3PA 4CDXB 1O7FA 3KGLA 2ZEYA 5D8AC 2DWRA 5FZ0A 1C4RA 3LOIA 5K0UC 3BCWA 4YARA 1A78A 5G04L 1PNGA 2WFF3 2XWBB 1PIV2 2WN3A 4MGYE 4GJZA 2R1DA 5FP9A 3PIJA 3W21A 5AC91 4KI5M 3ZYHA 3NNJA 5T5OA 4KH9A 3S0MA 1YRZA 5ACA1 1AR93 4XJUA 1LU2A 1GANA 5HXMA 1XXNA 1S0FA 1EV11 2A71A 4YRDA 5JCTA 2R0FA 2Z69A 5FDBA 1D0GA 2WUHA 2VZ3A 1GZTA 3VD5A 2ARAA 3AKPA 1W2TA 5LA1A 3HPNA 3AFGA 4RS5B 2J42A 2RS31 2G9ZA 3KCYA 4HG6B 3VBUC 1YQCA 1LOFC 2QQVA 3G6JB 1IHMA 3LA7A 1UOGA 1W2NA 1Z0HA 4IW3A 4O65A 4V1PA 4WV8A 3KV9A 3OJBA 3QD6A 3RYPA 1LU1A 1JZ7A 3HNMA 4QX7A 1UU5A 4YZ2A 1AR82 4BU2A 5FMDA 2VM9A 4XURA 2PELA 3IN9A 5BNPA 5KHKA 5A7OA 1R1A2 5FPBA 1Y7BA 3PUIA 4UFHA 4NIIA 1OA3A 4EN9B 4Q8LA 5FPZA 5FYVA 3DPRC 4PLMA 3WX5A 2PHUA 3H7YA 2ID4A 2Z5WA 1PK6C 2LROA 4IE0A 5F2WA 4CSWA 3LFMA 2XBO3 3K4AA 1RUD3 2UURA 1DHKB 1E5RA 2A75A 2WNVA 2G1MA 4MGZE 3RRDA 4AVCA 1HRV1 2OKXA 4EYUA 2DU0A 2R061 5LBBA 1OUSA 1UOFA 5GLVA 5FZ9A 3FC0A 2Y33A 3J8F1 4XUTA 5ISLA 3O0WA 1XJAA 1MZFA 3NV1A 5EIYB 1IG0A 5B2GB 2QE3A 4GB31 4YZ3A 1VBD2 3MUY1 2OVUA 3POSA 3TRSB 1ND2B 5BNOA 4PI2A 4R52A 1MR5A 2O0OA 1QJU1 1F31A 2OPWA 4UW5A 5T55A 4G4FA 2JWPA 4KL1A 2RR12 4QKDA 1W0NA 1BK0A 5FYTA 4XDPA 1PMJX 4TSVA 3WUCA 1BVVA 4WM8A 4W8JA 1QNYA 1RUE2 3MI8A 1DQ5A 3O5SA 3BODA 3H8OA 4R9DA 5GLZA 2B5HA 3LIGA 3VZLA 1ZRIA 2PHWA 4EZHA 2X10A 3MPBA 4LPLA 4R9CA 2I45A 2QUOA 1YJLA 3USSA 2WNOA 2QQUA 3HIFA 1G6NA 4YM3A 5AC92 3ZSLA 5C4WC 1NQDA 1NXMA 3S6PA 2A6VA 4MHUA 1ZBA3 4IETA 4E4HA 5ACA2 3GGLA 1R093 4LBQD 4Q4V1 4EN7B 1EV12 1C8M1 2WSUA 4JGYC 2N7GA 4PIZA 1V6NA 3HJRA 1EY2A 3IAQA 5F3GA 1Q56A 3MO4A 2LTNA 2BFUL 2L9LA 3AP9A 4HKLA 4AVVA 3LGRA 4P02B 3I54A 4QM8A 5FZHA 2HWB3 2JDHA 3RG0A 5KC5A 2RS32 1RXGA 2Z42A 3AXEA 3J7HA 3PJQA 4RR3C 4XW3A 4RFRB 5FZIA 5FXWA 1TNFA 3WF1A 3WUDA 4CCNA 3TB0A 1FOD1 2VOVA 3JQXA 3KB5A 4CU6A 1O5LA 1MZEA 1WMFA 3NV4A 2VXJA 1NYWA 3ZXFA 1AVBA 4AZZA 5FOBB 3QH6A 4YM2A 2NMOA 2R49A 1JUHA 4M3CB 4GA9A 3V65A 3UT0A 1NKGA 5FZ1A 4S2HA 4WM7A 1W04A 4QQHA 1CAVB 4QT6A 2CDOA 3AVRA 1WLDA 2B45X 1RUI1 3T4VA 4OMCA 2E9QA 2WJSA 2YPJA 5I8YA 1O4TA 4NVPA 2WDBA 3PMSA 1OLQA 4DS0A 1RINA 4JGZC 1HRV2 1UIJA 1MS8A 5CEHA 2JICA 2R062 4Q0UA 5ABJC 4PT6A 2VO5A 3I4IA 1JW6A 3AKQA 3J8F2 4C1XA 5SV5A 4IEZA 1AF9A 4LO6B 1N1YA 3GCWA 4GB32 5F3CA 3U0ZA 4NHYA 4GALA 3IDAA 4XUPA 2MHFA 1IG3A 4NO4A 4FPOB 5EWSA 1QJU2 1ZZCA 2JG8B 3JD71 3KS7A 4LLOA 4OHXA 4E9KA 3ETPA 3WP4A 1AL23 2PQSA 5L7OB 2VTXA 5C6CA 4E2GA 4Q0VA 3WF4A 2HWE1 3KVAA 4ITCA 4HVQA 5JSRA 5FJHA 2A3WA 1CN1A 2JEMA 3PHMA 1W2UA 4ZY9A 4ATFA 2VUAA 4KWKA 5FJKA 5LBFA 5A3TA 4A7YA 4MYEA 5LW9A 3M70A 4TTGA 2XVGA 4GIQA 4IEVA 3NJVA 4TXWA 4QD2A 4MO3M 2FDGA 1Y43B 2ZTNA 2E51A 5DUUA 4E4SA 3OUJA 2VJXA 5A1LA 1US2A 1VBA3 4DPNA 3HBKA 4HZFA 1XPWA 2UU8A 4Q4V2 1C8M2 3VBSC 1AR61 4M3CE 1ULOA 4IV1B 5F39A 3CJIA 4DXTA 3Q9OA 3RZHA 4LORA 2C1FA 2AZ5A 2BQPA 1YIFA 4QPIC 3WW1A 3ZDSA 1SACA 1V0AA 3FHIB 3AZYA 4N53A 5JZGC 2HWC1 4GWJA 4SBVA 1OMIA 3MIFA 1MVEA 1RC6A 4HMZA 1FOD2 4IGOA 1JS9A 4HKWA 4LULA 4OUMA 2DV9A 4LBNA 3JBG1 3H1MA 4RGGA 3ON7A 1UY2A 1XSRA 1L3JA 1V9U2 3ACLA 3NNMA 4CDQA 3MUZ1 5KHGA 4YG3A 1Z78A 2ZHMA 3ALQA 3FMGA 4AI3A 1UYZA 2GP5A 4XF4A 3N7KA 3U4SA 4D0QA 1N1TA 2QQJA 3D0JA 5FAXA 1HJGA 1RUI2 4XFCA 3ZDVA 4FFIA 2GALA 5CIRA 3PVEA 2B42B 1VP6A 3VZKA 4J6GA 4ZS2A 2VOKA 3ZYFA
chains in the Genus database with same CATH topology
2ZGLA 1H4HA 1J58A 4YZ5A 3KSCA 4MGKE 2AUYA 3I7DA 1ULEA 2WZPP 2B8MA 3ZX7A 2TNFA 4F83A 2JG9C 4IV3A 5FOJB 1HW5A 4AHZA 4CDXC 5T54A 4MXWB 3NKGA 1POV3 3JD72 1PVC3 1GFF2 3H1WA 1SLBA 1DDLA 1ASJ3 4N9HA 4XHXA 5HXVA 3SISA 3AJYA 4FAHA 1CAUB 2HWE2 4M3CF 4Q4X3 4C1WA 1LOCA 1H2MA 4XF0A 5CAZA 5H9RA 3M3OA 3WR0A 4RQPC 2VG9A 3E5QA 1IZ3A 4A7ZA 5DZEA 2MEV1 4YFZA 3ETQA 3NAPB 4M0NA 2VVEA 1AR62 1UPSA 4RHV3 3VZJA 4K9SA 1RVF1 5F6LB 3PVOA 2I2SA 1QDOA 1RUNA 4LO7A 2CNAA 2HWC2 4C91A 1FMD1 3VBOB 1APNA 1COV3 1MQTA 1R082 4BM8A 2E7AA 2WS93 4AK3A 1H8TA 3JBG2 2WC2A 1BQPA 3VZNA 1IS5A 1JN2P 4GQ7A 1KS5A 3K51A 1RUF3 1FPN3 1RUC3 3O12A 2RMU1 2BTVC 1FXZA 4Q0QA 1OD5A 2BYVE 3AX4A 4LE3A 3HBZA 1W6QB 3QH7A 4BCUA 4ZKTB 2DCTA 4WM7B 5J96B 1A8DA 5AVAA 1RHI3 1FI2A 4B29A 2BBVA 2DVBA 5HCBA 3VL8A 4XFGA 3AFKA 5DDJ1 2ZMKA 2D3PA 2YDEA 3WDVA 2Q30A 4B4PA 4DY5A 3CL1A 2IC1A 1EPZA 1H9WA 1Q8VA 1WA4A 1WW5A 4CDUB 4LBMA 5I0UA 1B35A 1KDKA 3VKLA 2HWD3 4PF5A 1QU0A 1ALYA 3ZIWA 2CAUA 1AXZA 3BOWA 5A33B 3FLPA 5JOYA 1KS4A 4LHLA 2XL7A 1SFYA 5HCFA 4I0AA 3VHOA 1FNYA 1OA2A 3VBFA 4XOGA 2XJVA 2MEV2 1UCXA 4ORFA 3WQ1A 1TE1B 3ZVXA 4GXLA 5I8TA 2NQYA 2W08A 4FPFA 1PGSA 1QXRA 4YVSC 1F2NA 1AX1A 1VBC1 1KFXL 3SCFA 1I9RA 2X29A 5CFDA 3C2UA 5FQ0B 2PHDA 1RVF2 3BPZA 1WCKA 2ARXA 2JJ6A 2K2SA 1RMU1 5C9AB 2XLFA 1FMD2 3QBQA 4YFWA 3KZ4C 1IS4A 1RUJ3 3AMQA 4N90A 2DCKA 3W59A 4D7SA 1F9KA 2HJIA 2GU9A 1DGLA 2WLPA 4K8FA 5BV6A 3OYWA 3WDTA 4N43C 3ZFEA 1YJKA 2XG3A 1D2SA 1FNZA 3A4UA 2E6VA 3ILFA 1NLSA 2RMU2 5KWRA 5EV7A 5E8AA 5J3UA 1I6XA 5D1IA 2H0VA 1SLIA 1OFSA 3J9SA 4I2OA 1G9DA 1V70A 3WZ1A 5AFEA 2VW2A 2UYAA 4XMAA 5JOXA 4P9IA 3U10A 2WNEA 1IS6A 5K8SA 2JG8C 1OLRA 4B7EA 5DDJ2 4W65A 3MPPG 1MEC3 4LBKA 2P3KA 5JPMB 4S2GA 2B39A 4PDWA 4IEYA 2PLV3 3B00A 2PFWA 1ENSA 4IXLA 1XNDA 1UU4A 1PK6B 3ZFFA 4AE2A 2RS53 2GSYA 2D6MA 1O3TA 2V09A 4AF9A 2VMHA 2A70A 1VBE2 2JE9A 4E2SA 1JH5A 4XETA 4TWTA 2OIIA 4IV1C 5FTTC 3EJKA 3DGTA 2HWF2 3ME2A 4I02A 2ZKNA 4CDWB 3AZVA 4WVVA 2DCZA 3WCRA 1LRHA 2XJRA 4IESA 2PHTA 1ZX5A 2XH6A 1AYM1 1NG0A 1QQP3 1VBC2 3KMHA 3RI9A 2VVDA 1MS9A 2R30A 4OLLA 3MGUA 4FT8A 4C0BA 2DCJA 4AVAA 3GYDA 2YY1A 4H7LA 3H7JA 1HDKA 1W6PB 2WNUB 3AM2A 5JMCA 2VXRA 3LSDA 2OZJA 3BU7A 2NP0A 2ZPXA 1MS5A 3AMHA 3BB6A 4KGGA 5BNPC 4DZGA 5C4WB 1C3HA 5FO7B 3PTYA 4FPLA 2EIGA 1UKGA 2OA2A 1G8WA 2RS11 2IXHA 5DZGA 2KXLA 4LBQA 1H8TB 2VNGA 3AMMA 1UMZA 4JCKA 2WNVC 5BY5A 3WV6A 3ZYIB 1BEV1 5C8CA 4ZU5A 4P9GA 5I0SA 2G9GA 2NMNA 4RR3B 1WBLA 3I8TA 4L8QA 3GF6A 2QDRA 5BPXA 4COVA 3M2MA 3JU9A 2ZAHA 2XGXA 3J4UH 2D93A 4AHXA 3NSTA 1XYOA 2G4IA 5BNOC 4UW4A 4JRLA 5GZFA 1GZCA 3AZWA 3OBRA 4XILA 5BXXA 2CWMA 4UBGA 1UL9A 3ZFGB 1O5UA 2AYHA 4E2QA 1QH6A 4GMP1 1ZRCA 3V56A 2VMIA 3FBMA 2WFPA 1D4M3 3I59B 1UZYA 5T5PA 2CYFA 5LRSA 4LO8A 1JHNA 4QGNA 4E4ZA 4PQ9A 1GICA 1M06G 3NAPC 5JI7A 1PO13 2AENA 2R041 1XNCA 4XBQA 4YGEA 5EYYA 3VKOA 1LR5A 3FFQA 3HQXA 3WW4A 1ULGA 2QVSB 1HRI3 2ZGSA 3IDCB 3VDDA 5GZGA 1AYM2 1SLCA 1MACA 4Q4Y3 3VBOC 4PBOA 3MFAA 1AYN1 3TN93 2MPFA 3DN7A 3ILRA 4YGBA 4CEWA 4IERA 5TSWA 4ZU7A 4XJ8A 4YGDA 3D82A 4FCAA 1LHOA 4WVMA 1C1LA 1HX6A 4C0HA 1AR91 1KXGA 4E27A 4F7ZA 1BBT1 4INDA 3WDUA 2VW1A 3IMNA 5FO9B 4LE4A 4B3NA 2DFCA 1U5YA 2ZGRA 2IWGB 1VBB3 3MF6A 3WNXA 4WM7C 2RS12 3JZVA 2AH2A 2X5IB 4AHYA 4JDOA 2E63A 3VHNA 4ONUA 2A3XA 1BEV2 4XIKA 4ATEA 3RYKA 1F5FA 1NXD1 1RL3A 4GH4B 4HVOA 3LA2A 4O9GA 3HN1A 4Y1UA 1A3KA 1FYUA 1OSGA 4BH9A 5L19A 5GZDA 1N47A 2D40A 1NA1A 5GM0A 1RUD1 2AR6A 1GZWA 4Q2FA 3GBGA 4AQSA 4ISRA 1REEA 4QPGB 1LJ7A 1REFA 3EHKA 2EXIA 1YIPA 2Q4SA 1K5MA 2GNBA 5JVVA 5JAXA 3RJRA 2ZAAA 4DRVA 1CD3G 1TQ5A 3T1LA 1SQ4A 3R6SA 3WLUA 3C3VA 2DUPA 4COYA 4FPGA 1ZZBA 3EQEA 2VW0A 1XU1A 2WQ4A 2R042 3UKTA 2XVKA 4Q4W3 2Q8OA 2WWSA 4QHBA 1ZRRA 4LO4B 1LB2A 3AB0A 1O4ZA 4KG8A 4IEQA 2EXJA 1VAKA 3IPVB 5C9AC 1AUYA 1EAH1 1VRH1 1CGPA 2NPIA 1AYN2 4HANA 1CAWA 1HXS3 5EYXA 4AGVA 1QWRA 1FT9A 4YW2A 3DF0A 1KJRA 5FMOS 3ZMOA 3HR9A 1AR92 2R073 1R091 4RQPB 1W6MA 4AEDB 4OHZA 1BBT2 4CDQC 3AYAA 1DZQA 1GR3A 1PIV3 3GALA 1XNKA 3ECQA 4AHWA 2EVXA 5F1RA 4B7KA 1H2NA 4GULA 4CEYB 5FFOC 3D6EA 4YVWA 2JXAA 3TBDA 2KM2A 3TWIA 5HI0A 3VBRA 2VECA 2PHRA 3WDWA 4Y1XA 3ES1A 1RUD2 1WD3A 4AI2A 4RD7A 2JENA 1SBEA 3O0XA 3KM5A 1C28A 2WT2A 4JDMA 1GNHA 2D6OX 3BTAA 3SLIA 1Q43A 5JWPA 3ELNA 3RNSA 3B01A 1KITA 3B9IA 4D7YA 4CDWC 3HT1A 1G9FA 1QXJA 3NJZA 1UX6A 2F4PA 3GBFA 3AKSA 4BWOA 1H2LA 3ATGA 2H0BA 2WL1A 4LA2A 3SH4A 3D8CA 1DIWA 4ZXKA 1UD1A 4WVWA 3USUB 3WQ0A 3LAGA 4FP3A 2WNUC 3ZXAC 2A3YA 5CBLA 2PAEA 2I74A 1EAH2 2PN5A 3WHTA 1OPOA 1VRH2 4B8EA 1GV9A 1VBD3 2NLRA 1LEDA 1UU6A 3VKMA 4CP0A 4D7TA 2QJVA 4AQTA 4XF3A 2BVVA 1S0DA 3FZ3A 2XJPA 2AGSA 3V0BA 1R092 1H8TC 5JLVA 3APBA 1QDCA 1NCQA 2IXIA 2Q0AA 1ND3B 2Y0OA 4R4XA 1X50A 5FREA 1TEIA 4LUKA 3MW4A 3FX3A 1LHWA 4Y20A 4YVSB 3KT4A 1QJY3 2VQ0A 4NWVA 2TUNA 5CB7A 4JVAA 3TAYA 4GMP0 5IT6A 4B4RA 4G3YC 5GZCA 1TME1 3VBHB 1DQ2A 5T3NA 1VLNA 2FQPA 3H9AA 3L2YA 3AYCA 3ZFGC 3ZIXA 2WA4A 2GC2A 3RWNA 4BMEA 4Z92B 1IPKA 4AEKA 2RHPA 1MS4A 4N9IA 1TMF1 2SBAA 3FJSA 3KLSA 4N43B 2UY8A 4OI4A 4Q1RA 3CF6E 1PO21 4FVVA 4YW3A 4RA0A 2B7YA 4FOYA 3M3CA 4HN0A 1OOPB 3JCIA 2H6CA 5CG9A 1C57A 2ENRA 4BIFA 1OKQA 3M4FA 3WG2A 1S0JA 1H1MA 5AFBA 1I3HA 1V6IA 4CZSA 2CTVA 1POV1 3HD8B 3X29B 1D2QA 4DY3A 1HRV3 4Y22B 2DVFA 4URTA 4P9WA 3J8F3 4S2FA 1G86A 4D94A 4QX5A 5FO8B 5KXDA 4XQWA 2YV8A 4DFSA 1QGLA 4XF1A 2GH8A 2D98A 1PNFA 1QJU3 1NCRA 1RB8G 4OI2A 3LOBA 1YI7A 1ZVFA 1PZ8A 3NKTA 4KU8A 4A3XA 4YW5A 2YGLA 4D69A 1VR3A 2BFUS 3JB8A 2X5IC 1QJZA 4RHV1 1AR71 2ZHKA 5GLWA 4LT5A 1KFUL 4YW4A 3D0SA 1U5ZA 2PAMA 4XFIA 3B02A 4GH4C 4WBBA 4S2DA 4YM0A 5FLHA 1LOBA 2D7FA 1W6NA 4QXKA 2PAKA 4Q4V3 1C8M3 1TME2 1SFNA 3NO8A 1U12A 5D8AA 3ZN6B 3IIAA 5K0UA 5SV8A 1RUF1 4QPGC 4X6RB 4XJWA 3TNQA 1LKNA 4XJZA 1JBCA 1RUC1 2Q1MA 3IWZA 4HSLA 5A32A 4COUA 5BNPB 1URXA 1X8EA 4EWAA 1KDMA 1TMF2 3SCGA 3JQWA 1FOD3 1PO22 4CP1A 2WQZC 1WLWA 3P3PA 4BA6A 4Y1YA 1V9U3 3QLQA 2WNVB 4QMAA 1QJX3 4QGMA 2GNDA 4HT1T 1IQAA 4TYSA 1CAXA 1PVXA 3VBUA 1LOFA 1HV1A 4AYUA 4EWEA 2HWD1 3OGGA 1Q8QA 4OFGA 5BNOB 3FLTA 3IDEA 1DLLA 3LSEA 3UK9A 2OUJA 2C9AA 4I0BA 3O7OA 4BPZA 3OBTA 5BYNA 4BHPA 3E6DA 5LEKA 5CU1A 2E7TA 3DPRA 1V6MA 4WM8B 4Y4YA 4AEDC 2TBVA 1C5IA 1YYNA 4I3GA 3WDXA 3GBWA 5A3LA 4BE3A 5J7MA 3VGIA 1WW6A 1CVNA 2ET7A 1REDA 1BMV1 3VHPA 2KA3A 2IFWA 4H3WA 5KXBA 3V0AA 4IEPA 1UN1A 1QH7A 2HWE3 3MW2A 1IPJA 1DGRA 4RHV2 1AR72 4CEYC 3LA3A 3GZTB 4X6QB 1X7NA 5FCCA 2LALA 4KGQA 1LHUA 3N7MA 3WOGA 5KXEA 4JQRA 3BALA 3A0KA 4M00A 2YXSA 4MH0E 5FRAA 4E4DX 3CEWA 2QKDA 4QGLA 3BOPA 3FE5A 5T5LA 2FHRA 3WG4A 2C5DA 1RUF2 3MIHA 2ET1A 4W6YA 4Q29A 1ZBE3 3ZPYA 4XFAA 4J1XA 1PGW1 1RUC2 4F8AA 4XJAA 1ZZ6A 3AP7A 2D3RA 3ZSEA 1IS3A 3IKWA 1YHFA 5IK8A 1UKRA 1RUG1 2XKOA 1R083 1FV3A 2GMEA 5CA6A 4YSFA 4Q8KA 4XF9A 1BKZA 3JBG3 1DZRA 4JGYA 2Y38A 3SITA 2D5HA 1H30A 2ZHLA 1MEC1 1PMIA 2FZ1A 4YNIA 1BJQA 1J1LA 4JAAA 1ZREA 2VVFA 4ASMB 2HWD2 4PIYA 1YLLA 1HV0A 2DCYA 2JDZA 1WW4A 4L11A 2ZMLA 2OPKA 4YM1A 3PVNA 3VDDC 1C1FA 2HEYF 4AFBA 3ROUA 2PHLA 1VJ2A 2XL9A 4FOQA 4Y1VA 1ND3C 3URFA 3U11A 1BMV2 1W6OA 4YG6A 1DZTA 1N3OA 2F6BA 1CX4A 4GKYA 4XYXA 5ABJA 3RZZA 2QNKA 3SH3A 4QPYA 3RJ2X 4D3WA 3WHUA 1DQ6A 3ZSJA 4K1YA 1NCRB 5C33A 3AMNA 1ZNPA 2IFRA 2IXCA 1S0BA 2ZGKA 5T5JA 5CFCB 3VBHC 4IQPA 1Q8PA 3CJIB 3B7MA 4FBFA 2CGOA 3OCPA 4N53B 2XLGA 4WVZA 2ZGPA 3TNPB 2RJLA 1MS3A 1S1AA 1OHFA 1RVF3 3WG1A 3RYRA 3GNEA 1PGW2 1GKBA 3JUUA 1OOPC 1AX2A 2A6WA 5K7PA 4CDQB 1POV0 4FPEA 3N4MA 3THPA 1QXPA 1RUG2 2XB6C 3MIBA 3O0VA 4LTAA 3H3UA 2Z2SB 3VBSA 4KU7A 2JX9A 4XIOA 4IL7A 2JECA 5EZWA 1Y9QA 3UJOA 3NV2A 1MEC2 4QPIA 2VNOA 4ASLA 4QM9A 5KC6A 5J09A 4DMIA 4HPKA 5JZGA 2RMU3 1DG6A 3AKRA 3PJYA 2GNTA 4KQ7A 1J3QA 3ZXLA 3DKWA 2WZR1 1JYCA 1LHVA 2YZ4A 4IV3B 5L73A 4YZ4A 3V64A 4K1ZA 2P37A 1DFQA 3M3QA 4LHKA 3KT1A 1XE8A 2NN8A 3AXDA 4QQLA 4I3PA 1PO11 1LHNA 3M7AA 1E57A 1WMEA 5DUXA 1ULCA 1X33A 2O8QA 1AXYA 4YZ1A 1OQEA 4YGCA 3H1YA 4KWLA 4K3UA 3M8LA 4Q4Y1 4JV4A 1VBE3 4YW1A 2D43A 1VB4A 2ZZQA 4H14A 1XYPA 1ENQA 3ST7A 2JG9A 4BYYA 1A6CA 1RMU2 3K48A 4CDXA 5IK5A 3IBMA 1WLTA 2Y26A 2R0HA 2HWF3 1RUH1 1QF3A 1V6KA 1EPWA 4XFHA 5E88A 2ZGUA 3AMPA 1VBC3 1O91A 1UPIA 1IKPA 3MIDA 1VBB1 1MQTB 4LR4A 1DYPA 1Q8OA 5FBZA 3VBRC 2V5YA 2EAAA 1F5JA 2XVLA 4U2AA 1GBGA 2XHKA 1DGWX 2DURA 2XJUA 3P3NA 4HK8A 1BVP1 1XQNA 4GKXA 4RS5A 1DU3D 3UJQA 4XFBA 1S0CA 4FQZA 2XJTA 2O8OA 2ETEA 4X8PA 4AGGA 5J48A 2ZGOA 3AYEA 4FQ4A 4LUMA 4Q0SA 3VZMA 4OHWA 3AK0A 2ZGQA 1DQ0A 2RM23 4DINB 1CQ9A 1YFXA 3OTFA 4G9SB 4LA3A 2D6LX 2WT1A 2FZ2A 4WM8C 1AHSA 2WZR2 2DU1A 3B93A 2EA7A 4SLIA 2YYOA 5E16A 1B35B 5KBFA 1YI9A 5BNQA 5GKAC 3M1HA 1QHDA 4PIXA 2OZ6A 1H9PA 1DQ4A 2A6ZA 2PTMA 2QDNA 4I09A 4Y5Z0 2OUHA 4MZUA 3WVJA 1ZYBA 4AEMA 2NM1A 3S30A 1ND2A 2FBEA 4AVBA 1QY4A 3VBFB 5E89A 3ZYRA 4Q4Y2 4Q1PA 2CL2A 2DUOA 2WFF1 1CPMA 4X8NA 1HXS1 4XMIA 4BLIA 2ZGMA 4Z2WA 4PBPA 1NE4A 1M4WA 5CFDB 3VL9A 1RUH2 1Z7S3 2R071 3KCCA 4KWJA 2PA7A 4AFDA 2UYBA 3RI8A 4BZ4A 2GH2A 1J3PA 1LOAA 2P3JA 1VBB2 3W9AA 2DYCA 1CJDA 1CJPA 1W39A 2IXKA 3I2DA 2FMYA 3MW3A 3GHNA 4RSUA 3E5XA 1JOJA 2TEPA 3OYWB 4FPCA 3ZFEB 3FFZA 5F9TA 3E6CC 1GNZA 1N1VA 5BNNA 4K7JA 3E6BA 5FMOL 3VHRA 2V73A 5DXDA 3U07A 2GZWA 4LHNA 3WD5A 2RS13 2XBO1 1F8VA 4M3CA 3WT3A 4HLTA 2LM3A 3U4XA 3W58A 1NY71 1NZCA 4NR1A 1CAVA 3HMYA 4PDWB 1BYHA 4EN6B 1OFNA 1Q5OA 1LGBA 5CVRA 3DV8A 2EXHA 1HQNA 3N7JA 3PVBB 3ZFFB 4UXAA 4AEJA 3B9CA 4R9BA 4NN0A 3MICA 4HK9A 2ZGTA 1NCRC 2D6NA 2VOWA 3LB9A 4OHVA 3RMYA 1W0PA 3ENRA 4GMP3 5CFCC 4PCRA 1V00A 3CJIC 2JG8A 1HQLA 4L99A 3UKNA 2WA3A 1R1ZA 5L7OA 2WFF2 3S7EA 2R6QA 5LK7B 3NVCA 1GYKA 4N53C 1HXS2 2GC3A 3ZYPA 1CONA 1UF2C 1U5IA 5AVPA 2PQQA 4HN1A 4NHLA 4ES9A 5KHIA 1ZBA1 1FV2A 1GQHA 1SEFA 1ZZ8A 2R072 4RGAA 1I1EA 4FPHA 2VOXA 2E7QA 1XE7A 1EYBA 1Q8SA 3RSJA 2UY9A 1AYN3 2QCSB 1SLLA 2D6PA 2P2KA 2ZOEB 2HWB1 4XDQA 2ZKLA 1G9CA 4AFCA 1QOOA 1V6JA 1QJY1 4IV1A 4HFSA 4OI1A 1UW8A 4AXOA 1CPNA 4FXGB 1BXHA 4LBQB 5I93A 2W0XA 1BBT3 4HBNA 1YFUA 1YO8A 3VUOA 2ZA9A 4AQ6A 3B3QE 4KBBA 5HBAA 2Z79A 2R32A 5C8CB 4IV3C 5J98B 2XBO2 2ZGNA 5KXCA 3PMEA 3KT7A 3MLJA 3ZSKA 1IKQA 3ZXJA 2D3SA 1NY72 2P3IA 2P34A 1AR83 4YYOA 4MGIE 2WT0A 4DQAA 1R1A3 3FUOA 4ISQA 1QOSA 2WIIB 1Y3TA 3POYA 2X8KA 5DUWA 3VLBB 1MVQA 1ZZ9A 5JOWA 3WP6A 4MVTA 1LTEA 3H3ZA 1AL21 2YC0A 1WW7A 3MZHA 1WMDA 4NHKA 1AXKA 2BWAA 1O4YA 2FMDA 5KHHA 4MXWA 4LBJA 1EP0A 4AQ2A 4M0HA 1CAUA 2XWJB 4XQDA 1J1TA 4Y26A 5A3MA 3VDDB 1N1SA 4NWWA 4P5HA 4COZA 2RR13 2BPA2 1ZBA2 1MQTC 2PYTA 4XJ9A 4IEXA 1VBA1 1LOEA 4CEWB 1RUE3 3OPZA 1VIWB 1GZ9A 1W0OA 2O1QA 5CNAA 4TZDA 2DTYA 4WVMB 4EWDA 1EAH3 4DXZA 4P14A 1ZRDA 1VRH3 3ZN4A 3KD4A 5L36A 4XTPA 1OI6A 1H8VA 2HWB2 3NAPA 5JDBA 5AC93 1QJY2 3AP5A 1HQWA 1MS1A 3GHMA 1BK1A 2MNGA 3OF1A 2ZX0A 2XLAA 5ACA3 1UAIA 3WXPA 1EV13 1JXNA 2BVBA 3ES4A 1UIKA 3VBOA 1C8NA 2JKBA 4QQPA 1D4VB 5I91A 4A2UA 4K21A 2RS33 5BNNB 1B35C 4A7KA 3CLPA 4Z82A 3N35A 4AGRA 4FTSA 2A6XA 4L92A 1LEMA 2Y0IA 1NA1B 1I5ZA 4DRRA 1MZ5A 2WINB 2XJQA 1V9U1 4AFAA 1QNWA 1GZWB 1W6QA 4AFMA 2BW8A 1QJX1 4QQOA 1JYIA 2R1BA 5FPXA 1AJOA 1RTVA 1QMJA 4GWMA 3VBFC 2VPVA 4CP2A 1PVC1 1K5MB 1AL22 1RGSA 2A73B 3VKNA 1ASJ1 2R063 3CJXA 3OD4A 5EXOA 4K40A 4Q4X1 4CDUA 2EF6A 4I0WB 4BMBA 5CFDC 4COWA 2IXLA 4TLFA 4GB33 1UZZA 4XFFA 5J36A 1YFWA 4AWDA 3G7DA 5LK5A 1AZDA 5A33A 4P9XA 4AI8A 1SCRA 3MFCA 3NW4A 2UWCA 1ULFA 1CAWB 1VBA2 2A6YA 3ZXEA 3KQRA 5JR7B 3GZUC 4EROA 2A5ZA 1FAYA 3ZFEC 2GNMA 5K9YA 2D6KA 3AP4A 1W6MB 2YROA 5T50A 1NQJA 2SLIA 3AYDA 4YG0A 3WW2A 1LOGA 2VULA 3QCWA 1ZRFA 1COV1 4WZCA 5FQ0A 2WS91 3HT2A 2DTWA 4MV2A 3RDIA 3N3HA 4OHYA 4XPVA 2ZABA 5C9AA 3ZMNA 4O9EA 1BCXA 4Y1ZA 3MF9A 4HETA 1FPN1 2VY0A 4M01A 1ZBE1 4PDWC 3HWJA 1ULDA 2AREA 4HSJA 4YVWB 1H1IA 4BOWA 1FX5A 1LODA 4META 4UBHA 5IK7A 1R081 1WBFA 4FPJA 1G9BA 3ZFFC 3ILNA 3VBRB 1YWKA 1RHI1 2W68A 1QKQA 3LCPA 4JDNA 5I0TA 1TME3 4W6XA 5CG8A 1PHMA 1QJX2 2QZ3A 1U5XA 3AJZA 4B4QA 4JTOA 1RUI3 3IT8A 5CADA 2ILMA 2YUEA 2GC0A 1PVC2 2EALA 4LEJA 1TMF3 4EV0A 3H0OA 1HKDA 1ASJ2 4OVEA 4Y24A 5GALA 4XBNA 1PO23 3ZN5A 1V6LA 1AX0A 4Q4X2 5EFUA 3SXWA 3WY6A 4OULA 1S2KA 2VU9A 1H1AA 4P9YA 2YHJA 1OQ1A 1ZM1A 5JIAA 3NL1A 2K9ZA 1H2KA 4Z1VA 3MLLA 4R4ZA 1PK6A 3SMHA 4XXPA 4RL7A 3FLRA 4FSJA 4Q27A 3WINE 3JD73 1ENXA 4MLOA 2GC1A 1WGPA 2C0ZA 3EXUA 1S0GA 1JTZX 1DGWA 1B09A 4AG4A 1G9AA 3VZOA 1S2BA 4XXAA 3IDBB 3INAA 2NZ9A 2W52A 1HLCA 4CDWA 1ZZ7A 2ZJCA 5GJ6A 5JPNB 3V0BB 1NCQB 1CR7A 1YCIA 1N3QA 1COV2 1RUJ1 2WLQA 2BEOA 2A7AA 5I8SA 2WS92 5C8CC 2BWCA 3VV1A 1IGOA 4DB5A 1YXWA 4RS5C 4Y20B 1W6PA 2WNUA 1AR63 4FAGA 4BQ1A 1X82A 1NOVA 3WDYA 2HYKA 3TOJA 4QU2A 1H0BA 1AR73 1HIXA 1WD4A 2IXJA 3WQ7A 1FPN2 1LECA 1ZBE2 1SCSA 2GMMA 2HWC3 5JOZA 5F6KA 5I0RA 4NPRA 5C4WA 4QQ2A 5IK4A 3UL2A 4OI0A 1LGCA 1SLTA 2DF7A 4I01A 2IZWA 1DQ1A 1AJKA 4IEOA 1RHI2 5H9SA 1LULA 1MS0A 4AI0A 4FPKA 3POWA 4KG0A 2BNOA 2OW4A 2PLV1 3SCHA 4RR3A 1OPMA 4R8HA 4ES8A 4F3JA 3VKFC 2ZZJA 5DZFA 2ZACA 3O14A 4FOVA 3RMXA 2ATFA 1LCLA 2RS51 1ND2C 4LNVA 3TYJA 3S7IA 4L9BA 2GDFA 3LWCA 3ZFGA 3L2HA 1WUVA 4CEWC 3MIEA 5KHJA 3D5OA 1LGNA 1OQDA 2UWBA 3MIGA 3I59A 5BUVA 1SLAA 4JGZA 4EN0A 1J59A 3LKJA 4I30A 1DGRN 3H50A 1QQP1 4AW7A 3KCXA 4J1WA 3VN4A 1VBE1 3MDPA 1NLRA 1PGL1 1GLHA 2RJKA 1XU2A 2D97A 1LENA 2CGPA 2P17A 3OGJA 4NHMA 3L9JT 4P9LA 2EXKA 1VALA 2MEV3 5FLJA 4N7UA 2HWF1 4NOTA 1RUJ2 4K6BA 1GSLA 5BNNC 2DVAA 2Q5TA 2BNNA 3OY8A 1KJLA 2GN7A 4MX3A 4XE9A 1H4GA 1IOAA 2HKXA 4PLNA 1NA1C 1W6NB 2VUJA 3EO6A 3B5LB 4EJRA 1T6GC 4R9AA 1VAMA 4OZXA 1FMD3 5D8AB 5K0UB 3MLKA 4KNCA 1MZ6A 2NYYA 4H55A 3FUQA 3B94A 5A32B 3R4DB 2GN3A 3ZYJB 1S55A 2X5IA 1K5MC 4W6WA 4XEZA 3EBRA 4LO5B 2ZCWA 3OD0A 2ARBA 3GZAA 2PLV2 2YMZA 4HKOA 2HEWF 2RM21 3R4SA 1RUOA 3N7LA 4GH4A 1OA4A 2WSVA 4MXVA 1O3RA 2ZX1A 1PM7A 2DUQA 3CU7A 1RUG3 3CNAA 3R0RA 3WCSA 2RS52 4JRAA 1CIWA 1CAXB 4LBLA 1D4M1 3VBUB 1SBFA 3DL3A 5DDJ3 2XUMA 1S0EA 1YFYA 4QPGA 5L7OC 3PNAA 2VMGA 4FTEA 3T1MA 1KQRA 1HRI1 2ERFA 3DPRB 2B46X 3FWEA 1XNBA 2ZX4A 1QQP2 2BGCA 2E53A 2DFBA 2VH9A 3WG3A 4AI1A 1WCSA 3TN91 3J26N 3IM0A 1PGL2 5LRRA 4JC1A 4XZPA 3V0AB 3IPVA 1AL0G 1WCDJ 1XRUA 1Z7S1 3M3IA 1FATA 4CYDA 4YVWC 3RS6A 3UV9A 3WP3A 4P9JA 4AVSA 5JI9A 1TNRA 4RQPA 4AEDA 3E97A 1RMU3