4QD2A

Molecular basis for disruption of e-cadherin adhesion by botulinum neurotoxin a complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
247
structure length
224
Chain Sequence
ENIQEINTAISDNYTYNINNPFYILFTVNTTGIYKINAQNNLPSLKIYEAIGINYITGFDSPNAKSYLVVLLNKDKNYYIRVPQTSSNIENQIQFKREEGDLRNLMNSSVNIIDNLNSTGAHYYTRQSPDVHDYISYEFTIPGNFNNKDTSNIRLYTSYNQGIGTLFRVTETIDGYNLINIQQNLHLLNNTNSIRLLNGAIYILKVEVTELNNYNIRLHIDITN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Hemagglutinin component HA33
publication title Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
pubmed doi rcsb
source organism Clostridium botulinum
total genus 48
structure length 224
sequence length 247
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17993 HA70_C Haemagglutinin 70 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1090 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qd2A02
4EN8B 4EN6B 4LO6B 2ZOEB 4LO7A 4LO5B 3WINE 2ZS6B 4EN7B 4QD2A 4LO4B 4EN9B 4LO8A
chains in the Genus database with same CATH superfamily
3DPRC 2R062 2VCBA 1QMJA 1WLDA 3LFMA 2K2SA 1BBT3 5I93A 2PA7A 3ZXDA 5KHGA 5FPZA 1OA3A 2VVDA 5KXDA 2VZSA 5FMOL 4B29A 3PVOA 4GAZA 3TNQA 1JYXA 3D5OA 3IPVA 2HWB1 5FAXA 1WA6X 4NWWA 1DLCA 2OX0A 1RUD1 1O3SA 2QQNA 3WDTA 3QOPA 1APNA 1JYIA 1WLTA 3DEMA 4Q0SA 4AVBA 1FPN3 4FCAA 2WNEA 2VPVA 4UW3A 4W4ZA 3FJSA 3VBRB 2H0VA 4I09A 5FYVA 4YARA 3O1SA 2EXHA 1J1TA 3BI3A 1UW8A 3GNEA 3C7OA 5LA1A 4UOJA 1FV2A 2W0XA 5ANNA 3D8CA 3POEA 4ZZ5A 3AFGA 2C4XA 4ZS2A 2CWSA 3WOGA 5AC93 4CDWB 5LY1A 1J59A 2ZAHA 1AXKA 5LB6A 5IAVA 2G9FA 5FY7A 1AX0A 3OBTA 3CF6E 5FZ8A 3SEPA 2ZGSA 2R0FA 5JOXA 3S57A 5D2AA 3VKNA 5HXMA 4BXSV 3EMRA 4QXBA 2QZ2A 1LHWA 1I6XA 1ONAA 4UW6A 4OI1A 4XFCA 3OCPA 4CEYA 1H2KA 3NJXA 3QH7A 1ZBE3 2O8QA 4IUGA 2BW8A 4I0AA 4MV2A 5FYHA 4B4QA 1V00A 4CCJA 2WQ4A 4Y4RA 4QKNA 5C9AB 5LCWL 3S5AA 2BNOA 1SFYA 2BVVA 2JX9A 2ZMLA 2CSGA 1RUG2 3ZFEA 4AEDC 1JYTA 4V2VA 1GOFA 1SBFA 1VBD3 2DYCA 2RR13 3BTAA 4XJWA 5BV6A 1GSLA 2GH8A 1FOD2 4PIYA 2DUPA 1D2QA 3AB0A 3GCWA 3M3OA 3ZSEA 1SLCA 2ADEA 2EXKA 4N7IA 3RFRA 3FFQA 3O14A 2DFCA 5LBFA 1VBD1 2ORXA 3KZ4C 5H9RA 2YBKA 5JVVA 4M4RA 2LALA 4RQPC 2ZHMA 1GZWA 1S2EA 2XUEA 3RZLA 4AHXA 5JSOA 1OVSA 3N9MA 4XXPA 1QNWA 2BOIA 5AVAA 1Q8VA 4AFMA 1PMIA 1CONA 3U75A 1OPOA 4Q27A 1YQ6A 2XKPA 1HN0A 4N7UA 3JD71 1DQ2A 4HKLA 5FJHA 2D6LX 1KD7A 3LF7A 3WW2A 2R043 3K75B 4BOWA 2DV9A 3I7DA 1W0OA 3EHKA 5IT6A 2QQOA 4LA2A 3NJYA 2XKOA 3IT8A 4MG2A 2XMLA 2RM22 5E89A 1GKBA 4IEYA 2FDHA 4LIVA 4M0NA 3KV9A 4Q0VA 1YXWA 1GR3A 1C5HA 3ETPA 3ZSJA 3L2HA 3O0VA 5LZ6A 2R16A 5J1XA 1W8FA 4BIFA 2RMU2 5B4NA 3OGJA 2FDGA 4UW4A 3ACHA 5B2GB 2WR9A 2XJQA 4R8HA 1UF2C 4DOUA 2JDPA 4Y1VA 2ARXA 1GP4A 3WDUA 3WT3A 4M0HA 4UF0B 2WSUA 1IS5A 1NCQC 2HWC1 3NKGA 4CPBD 2HKXA 2DVGA 5FZ0A 1O4ZA 1OFNA 3AP6A 1BK0A 4MGKE 1J3RA 3OJBA 3CKHA 4Y5Z0 5FZDA 5FZOB 1VIWB 5CISA 1BJQA 2W91A 2DBNA 1S0EA 4LHLA 5JIAA 4AEKA 3O1MA 1W39A 3JB4C 3MLLA 2R1DA 4XXAA 2WSVA 4XABA 5FY0A 4UBHA 5FOJB 1PGW1 2OUHA 2VZVA 2XBO2 1W6OA 3LE0A 4XBQA 5L7OC 2B45X 2PQSA 1SACA 4C0HA 2BPA2 2BV4A 4WVVA 4OLLA 3KB5A 1QDCA 2HWB2 5DZEA 1YJKA 4NHXA 3WF1A 5FDBA 1MQTC 2ZS6B 4DZGA 4AGRA 1JOBA 3S30A 2FCUA 1UYZA 1BBT2 1W6NA 1ND2B 2Z5WA 3IAPA 3OOXA 1NAEA 2R073 2WZR3 2ARCA 1WCKA 2VTXA 1D4VB 4XBNA 5LBEA 1IPKA 2OT7A 4CCLA 3I2JA 1J3PA 1IQDC 3T2TA 3GBFA 3WDXA 2C9KA 3KT4A 1FPN2 3ITQA 5KXEA 2VOWA 3HN1A 1QJEA 3HVDA 4KMQA 1K12A 5G05L 1W2UA 1XC6A 5C71A 5HPOA 5LK5A 2R071 5FZ4A 1KDMA 2EALA 4OUMA 1KJLA 1H4HA 2V5DA 1HJFA 3UV9A 3I4IA 3OEBA 5C4WA 3KCXA 3HWJA 3BTXA 2ZGNA 1RUE1 1V6IA 2CDOA 5AC92 1UD1A 1DQ1A 1JU4A 1MZFA 2J22A 2TEPA 4CUBA 4LIUA 2IXLA 2WUHA 1COV1 5J09A 4Y33A 4YSFA 4WZFA 5FY1A 3D3AA 4N8MA 3CEWA 4GMP0 3IIIA 1WD4A 2R7EB 1PIV3 4HONA 4YW5A 5A7WA 4D7TA 3UNPA 3F2ZA 4AVTA 3ZIWA 1UZZA 1ZRRA 1JODA 2GC0A 1OFSA 2DF7A 1FNYA 1NXMA 1NZIA 1UL9A 2WS93 3AZYA 1W2AX 3DN7A 4GQ7A 3H1YA 4XFBA 2VUDA 1SLAA 4FFHA 5T5LA 3WP5A 2WA3A 4E2QA 5HCBA 2QZ3A 3M3QA 3OBRA 1GANA 1LR5A 4LPLA 5GJ6A 4UWDA 2AR6A 1RUJ1 1W8OA 2PHDA 3TN93 3NNLA 5FYYA 5T55A 4LOTA 2WS91 4XMIA 1VBD2 2RR12 3J9SA 4ATEA 2YC2A 4XEZA 4BHPA 1D2SA 2WFF3 1UXZA 2NLRA 3UGFA 1PM4A 4WM8C 4DXRA 1XYOA 2ZGKA 5A80A 3AP4A 2OQ6A 2ZPXA 3JBG3 1PZ9A 3QCWA 4GXLA 3DKQA 1C8M3 1HXS3 4RL7A 1UY2A 3ZXGA 4DIQA 1BK1A 3O0WA 2VQAA 3IMNA 4K1ZA 4TTGA 1S4CA 2ZTNA 1AR83 4YW2A 1NE6A 3MO4A 1YO8A 4MGQA 1ZRFA 4EYUA 2E9QA 1ODMA 2VMCA 1AUYA 4XCBA 4QKFA 4JGYA 3ROUA 5FK7A 1V70A 3VKLA 2VGDA 3RRDA 1FV3A 3ZYRA 5DQ0A 4BISA 1ZM1A 4UW5A 1EAH3 1HXS1 1LRHA 2HEVF 5F39A 4RGKA 4RFT0 4HVRA 4YZ1A 1QQP3 3UYJA 2LTNA 1RUI3 3VZNA 5J36A 4CA9A 1JMUB 2W3JA 1UYPA 4BB3A 4FPYA 3RG0A 4F83A 2VQ0A 4OMDA 4DUWA 3QD6A 1CESA 5FZ7A 1ZX5A 3K4AA 4FBFA 5F7UA 4FVVA 4MYEA 4J1WA 4LJHA 3RZHA 2VG9A 2BBVA 3K77A 2AACA 2ZXQA 1GV9A 4O61A 4BDVB 2HWC2 2HWE3 2J1TA 1RUI1 2PELA 2OXBA 3HJRA 2VECA 5CVRA 3VDDC 2JENA 1HW5A 3AKPA 4EN6B 2FQPA 4YM3A 4ISQA 4JAAA 2QBXA 4NE9A 3CBNA 3ZXAC 2W87A 5JXJA 4COYA 4QX5A 1POV1 1LHNA 4XACA 3WNOA 1UAIA 1PGW2 4AEJA 2HYXA 1JYVA 4XJ8A 4IEVA 5GLUA 3OPTA 1ULPA 3BPSA 1V6NA 2VUAA 4QX8A 3GJBA 5KXBA 2UYBA 4Y4YA 4DXZA 3ON7A 3RGBA 2RS31 4AEDA 1OC1A 5LA2A 5F6LB 4CDXB 1VBC3 1VLNA 4LUKA 4D0QA 2E26A 4BQ4A 1GNYA 2C0ZA 2BFUS 2J1UA 2O0OA 3J4UH 5ACA3 5LW9A 1IZ3A 1FATA 2CU5A 5APAA 1NCRB 3LSDA 5JDBA 1SEFA 1J1LA 1TVGA 4RR3C 3M4FA 5CFCC 2DWRA 1E5SA 2CV6A 1CAUB 3AYEA 4IV3C 5J48A 5CADA 3GYDA 1I5PA 3LKJA 3M7AA 5ACA1 4RQPA 1QNYA 2HWD1 1A34A 4R9AA 3ZN6A 2R072 2WZR2 4GULA 3SC7X 4DXTA 2LUWA 2JIJA 2X09A 3MLKA 5BPXA 4NPRA 3B3QE 4OCTA 5C7GA 1F5JA 1IS6A 3AKRA 4YM2A 3D0SA 4P9YA 3ZLIA 5I0DA 1BEV1 3MIGA 3H7JA 4E27A 2A70A 4BK5A 1OD3A 3Q8BA 4B8EA 1Y3TA 1LESA 1W9SA 2VO5A 2KR2A 2JKBA 1V9U1 4G4FA 5DXDA 1COV2 2EIEA 2PHLA 4QX3A 3VBOC 2V73A 3M3CA 2AGSA 4XUPA 4BE3A 3VHNA 2WN2A 2FDIA 3PUSA 2ATFA 1JH5A 2SBAA 1UOBA 1WBFA 1BVVA 1W6MB 2PMWB 3GZTB 4HETA 3WUCA 3WW4A 5HBAA 3TEYA 2VZPA 4MHRA 4QGLA 5GALA 5AVPA 3VBHC 2E63A 3HQUA 3H7YA 2OKXA 3CJIC 1PGL1 1U12A 4XQWA 2D98A 3BU0A 2BVBA 1CPMA 1NCQA 2DVFA 4J1XA 4LNVA 4W50A 2ZGOA 1PIV2 3I2OA 1RUJ2 2IVJA 1G8WA 4AL9A 1D4M1 4JQRA 3X29B 1S0DA 4BMEA 1TEIA 2Y33A 2UU8A 2GALA 4YYOA 4GIQA 4YGCA 2WS92 5EIYB 1W8HA 1QGLA 1LENA 5JWPA 1VMJA 1KFUL 3T0AA 2JWPA 1WMEA 1YFYA 1ASJ3 1H30A 5L7OA 1K5MC 3FE5A 4NO4A 4RYDA 3UESA 1QJZA 3ZSKA 1R081 4CEYB 1HN1A 1XYPA 3TN92 1YHFA 3NW4A 1XE0A 3B5LB 1VB2A 1MQTA 3BN6A 4AR2A 2ZX1A 5FXXA 2A6ZA 3GDBA 5CFDC 1ASJ1 1UOGA 5FMBA 3WW1A 4Z1VA 4ZHNA 4ET7A 5A7OA 5BYNA 1LCLA 4WV8A 5JI9A 3JBG2 2R30A 4DXSA 3ZFEB 2HH9A 1HXS2 4Q4Y1 4XW3A 5JR2A 1HB3A 1AXYA 2DVAA 1V0AA 2I45A 1AR82 1VB4A 2DCYA 3E5UA 4FPEA 2JJ6A 5FZHA 3ZYGA 2H0BA 2V4AA 1DFQA 2P6HA 2FMYA 1ULEA 3MIFA 3FLRA 3I3BA 5DDJ3 3VDAA 1G86A 3LCPA 1QH6A 2P2KA 1OLRA 1Q8OA 4HANA 3I97A 4WVMA 2CL2A 3VDBA 1SLTA 4Y22A 3AKTA 1W9WA 4QWNA 1QQP2 4HLTA 5CA6A 1RUI2 5FZ9A 3A23A 3MIDA 2BERA 4LLOA 3LB9A 3RMYA 1GZWB 4HPKA 4P9XA 2ZGLA 2YMZA 3RQ0A 4OQ9A 4YFZA 5FPXA 3GHMA 1DP0A 4JKKA 1WW7A 3ASIA 4XDOA 3RS6A 1QJX3 5DDJ1 1LEMA 4FFFA 4Z07A 2WBKA 3H3UA 1NE4A 2RDQA 3IB3A 3IN9A 4LXLA 5J7MA 2W39A 5FPVA 4J6GA 1JZ7A 2BEOA 2CHHA 3H42B 1CJDA 2GMMA 2GU9A 3HT1A 3KHBA 4A44A 2RS32 4AXOA 4HK8A 1W2OA 3B7MA 4COVA 3W20A 3VD7A 3NAPC 2C1FA 3ME2A 1GP6A 1PVC3 4XFHA 5GKAC 3ATGA 1OXCA 3RZMA 3NL1A 1EY2A 4LTAA 3QH6A 5FUNA 1ENSA 4BCUA 2JICA 2W1QA 2ZGUA 5EPAA 4BQ5A 5KWRA 2Z69A 4GJZA 1LGBA 5I8YA 5FV3A 2C6SA 1RUF3 3WF2A 4J25A 3NRUA 5I91A 2WNUC 1ZBA3 3N9LA 1XXNA 4RA0A 2QQVA 4KBBA 5ACA2 4IXLA 3AJYA 3CZJA 1W6PA 2W52A 2XJVA 4WM8A 3SCFA 1JZ2A 2IXKA 3CZUA 4MHUA 4UFMA 1Y9MA 1RMU1 4CP1A 1YQ5A 2OQ7A 1PX4A 1BEV2 2ZGPA 4DS0A 2X53S 3USUA 1ZBA1 4PIXA 4X6QB 1W6OB 2ZKLA 4K1YA 1E57A 2BQPA 2QNKA 2E7QA 1QJY1 2LROA 5DN2A 4DNYA 5BNPC 2KA3A 1V9U2 2WFPA 4MXWA 4YPJA 2XWBB 4MGYE 4ZU4A 1DGRN 1ZZ8A 2MEV3 5FFOC 3GXUA 4N53C 4A2UA 1QJU3 4C91A 1OF3A 4K3UA 4XF1A 1GUIA 3I3MA 2QQPA 1W6NB 5A6YA 1QU0A 1ZYBA 4LOSA 2W1SA 4KU8A 4Y20A 4A7ZA 3C3VA 1H4GA 3OUHA 2QFEA 4HMZA 4GMP1 4CU8A 5BUVA 4Z2WA 4DEVA 4QPGC 4BQ1A 4Q4W1 4CCKA 5JPMB 3VDDA 4META 5IVCA 1HRV1 1EV11 3SXWA 2V5YA 1GZ9A 1OLMA 1R091 4IQPA 5FP7A 1I5ZA 1QOOA 1K42A 5C4WB 5FZAA 5FZ3A 4QAWA 5FP4A 3ES1A 2HEYF 5FYTA 1W8WA 1R082 2B5HA 1LODA 1OUSA 2PFWA 2QQMA 5I8TA 2X5IB 1AHSA 2ERFA 2V72A 2YDEA 1AYN1 1RUG3 3FUQA 4CXWA 1RUNA 1NXD1 4MGIE 4QB6A 1ASJ2 1RUH3 1SLLA 4JVAA 5A7WB 1FOD3 1VBE3 4X6RB 2Q8DA 5IK7A 4H7MA 2O1QA 5K4LA 4RR3A 1Y9GA 5CFCA 3B02A 4Q4Y2 3H1MA 1GFF2 2V09A 3KF5A 4D7YA 3TAYA 4IV3A 4Y1XA 4EZ4A 1PNGA 4GJYA 4AI0A 1W90A 3KQRA 3WCRA 1RUH1 3CNAA 2E33A 4KWKA 4OFGA 3SCHA 5FCCA 5FZFA 4YWAA 2BNNA 3KGLA 1PK6C 1X36A 1G9BA 4XHBA 4JX0A 1FXZA 4BWOA 4EZHA 2ZKNA 4ORFA 3RYPA 4EWDA 3DPRB 1H9WA 4LO7A 4C0BA 2G19A 5CB7A 5IK4A 1Y4WA 4HG6B 3MICA 3G7DA 3ZYJB 4AOCA 4K6BA 1MS0A 2XQRA 4P5YA 4BQ3A 5I0RA 4XQDA 3MI8A 1RXFA 3D4KA 4R9BA 5DDJ2 2EA7A 2YB7A 3M1HA 3GM8A 4QQOA 1YQ2A 2JDMA 3NV4A 3LPFA 1PM7A 1LB2A 2WO7A 5IVYA 5FY8A 4CP2A 1UYYA 5E88A 4AHYA 1UCXA 1WCQA 2OVUA 2RM23 1G9AA 4JKLA 4AWDA 1G9CA 2P6CA 3AP9A 4RS5C 2ID4A 4XAAA 3RWKX 4B7KA 5FMCA 1AL21 2VNOA 1MS8A 2DUOA 2XL7A 1CZTA 3VBHA 1HQWA 2D6PA 3CJIA 1R1ZA 3MW3A 4M4PA 3P3NA 2DBIA 4HFSA 4QXHA 4QX1A 4R4ZA 4N90A 5SV5A 4CEWC 5IK5A 1NY71 4CUCA 2K0GA 5B4XA 2W2IA 2F6BA 1DHKB 1SMVA 2UURA 2VMHA 5FYBA 4DY5A 3CJXA 4CDQC 4LKFA 1CJPA 5EQUA 3IAQA 4W6WA 5LBCA 1RL3A 1W8ZA 4QPIC 3WINE 1PZ7A 2QQKA 2WO2A 1DYPA 2RJKA 1W9TA 4BMBA 1AYM3 1CAUA 1P8JA 1DDLA 2BJSA 3IWZA 1K5MA 4D8MA 1H1IA 3VD4A 2VTFA 2LS6A 2RVAA 4YZ5A 3AXDA 3W5MA 4H14A 3ZKUA 1RUF2 2HBTA 3PHMA 1BVP1 1LOGA 1NX9A 5FYSA 4KNCA 1RUD3 1ZBA2 4GKXA 1Q56A 1UY4A 5CFDA 1QJFA 4NWVA 4PQ9A 1AYM1 1TME1 4QQLA 1QJY2 1QXPA 4PT6A 5FR3A 1YRZA 5IFPA 4D6QA 1MPXA 2IFWA 3O5SA 4U2AA 5ISLA 4XJZA 5A6ZA 2XH6A 3OYWA 2A6YA 1DYOA 2B8MA 4FP2A 3FWEA 4AEDB 3HT2A 4OZXA 2YY1A 2G1MA 1OPMA 1O3TA 3H0OA 1VBA1 1Y9QA 1VJ2A 3A0NA 2CGPA 2LW8A 2XQXA 3I2KA 3A21A 5JUVA 1F4HA 5A32A 1LGNA 4YW6A 4NHMA 3EQEA 5EP9A 3OTFA 1H8VA 1W6MA 2XLFA 2W46A 4YZ3A 5EWSA 3H8XA 1SLIA 2MEV2 3BYWA 2WYSA 4GH4C 3PVBB 4PLOA 5GLWA 5F3IA 3FBYA 4NPLA 4QD2A 1QJU2 4FAHA 2ZHLA 1DF0A 4CXYA 4YVWC 5IVJA 4CU6A 4LO6B 2ZOEB 1DQ4A 4RQPB 1LTEA 4XILA 3ZN6B 3Q8FA 4L8QA 2FCTA 3TBDA 5JZGC 3A4UA 1W9YA 1O8SA 2EXJA 4D94A 1AVBA 2BWAA 4LMFA 4AI2A 4FXKB 3ZO0B 2VW1A 3BU7A 4BQYA 2IFRA 1UOFA 3EB7A 5C3OA 5C3QA 3T0DA 3LOIA 5F2WA 4PJYA 3DXTA 4B1LA 2ET1A 4KH9A 3BUCA 1RIRA 1N47A 3ZYFA 3AMMA 2WT0A 2VY0A 3HBKA 1W8TA 2GP5A 2AUYA 3BVCA 5FREA 1S55A 1NA1C 3G6JB 2IXHA 4FOQA 2WRAA 2JDAA 4N43C 3KWVA 4XCAA 3NAPA 3SNMA 1OH4A 3VZLA 4AEMA 3WX5A 4LHSA 4ZPIA 4BA6A 4CE8A 3H8OA 4OULA 3VBUC 3LDKA 2IC1A 2WZEA 1W05A 5FZIA 3ZFGC 1ACCA 4DRRA 2ILMA 1V6OA 5FK8A 4LA3A 3L2YA 5F9TA 4M00A 4CCNA 5FYUA 4Q0UA 4W8JA 3TRSB 4P5HA 5FJKA 2RJLA 2VD7A 2WNUA 4P9WA 2A71A 3HD8B 1JHJA 5E6HA 5J98B 1NCQB 1UPIA 1RUH2 2TBVA 1N3QA 2PHRA 4QQ2A 4A6OA 3RZKA 3OY8A 1VBE2 2JB8A 2PHWA 5FLIA 5FXZA 3WEZA 4A42A 5EFUA 1W04A 1REDA 5CEHA 4TSVA 2JG8C 1A78A 1GZTA 2Y6FA 3ILNA 3ZSLA 1NYWA 4CSWA 4AQSA 5FWJA 4AVSA 5KHHA 3JD73 5L7OB 2G9ZA 3PTRB 5BNPA 3R4DB 4Y5TA 3SH4A 2DTYA 4NN0A 1OKQA 4FOVA 2XL9A 1VRH1 5A33A 4N53A 1MQTB 5A3TA 4IV1C 2CNAA 1MS3A 1XBFA 3N9PA 4XF3A 3TWIA 3NKTA 5F3GA 2VNVA 5A3LA 3U4XA 4AI8A 4AFDA 5JSRA 2RS11 2VW0A 4COUA 3UGHA 4DQAA 1H0BA 4MGTA 4Q4V1 3RI9A 1NLQA 3U14A 4QPGA 2Z4FA 5FPLA 4IE4A 5C6CA 1U5ZA 2Q0AA 2ZX0A 2HWC3 3FHAA 1GNHA 5FYZA 1JYCA 5FP9A 3WDVA 3VZKA 3IIAA 1FMD3 2A73B 1TQ5A 3AJZA 5FP3A 3ILRA 1UZWA 4K9SA 4WVMB 5M0TA 4L92A 3VL9A 3MUY1 3FLPA 4KWUA 4Y22B 1H1MA 1WLWA 3MV11 3KMHA 3UT0A 3E6CC 2F4PA 4NRMA 1Y43B 1ZZCA 5DG1A 3I49A 4HPKB 3KSCA 3ZXKA 1CZSA 2WQ8A 2YGLA 4H55A 1QH7A 3AMQA 2WWUA 1FMD1 2WYFA 3ECQA 2VMDA 4Q1PA 5FY4A 2VZ1A 2VL4A 3T2QA 1VBB1 1CD3G 2J1AA 2Q4SA 2VNRA 1AYM2 1TME2 3S5QA 3ZN4A 3KCYA 3OBAA 1IS3A 1QXJA 2JDNA 4MLOA 4BLIA 1I3HA 2ZAAA 4RFRB 1XNKA 1X8MA 3H8UA 4E4HA 5IAXA 1VAMA 2ZMKA 4XF4A 4CDUC 1UY3A 2Y0OA 1WW4A 4IETA 4LBOA 1RUD2 4Q0QA 4HOOA 3H8RA 2A75A 1XYNA 1KS4A 3V64A 1ZZ6A 3WQ1A 5LK7B 1E5IA 2XJPA 4CCMA 4IE7A 4LK7A 2P5BA 2C26A 5T50A 4O65A 3T1MA 3LA7A 2Q1MA 1PVXA 5EXOA 3K46A 3SH5A 3B01A 4N9HA 5C3SA 3W5NA 4FPFA 2Q8OA 2W92A 1BQPA 4IGQA 4OHXA 4XFFA 1W6PB 4WM8B 1XB9A 4ARYA 1RUE3 4Q2FA 3ZXLA 1KGYA 5IVEA 2Q1ZB 4S2DA 1G9DA 3I2FA 2F17A 5A3OA 5LASA 3GBWA 1WCDJ 1HJGA 3BALA 4XTMA 1O5UA 1COV3 2VOTA 1S0IA 4KG0A 4IE6A 3USUB 4S2GA 4XZPA 3KT1A 1A8DA 3HBZA 4YZ2A 1QOSA 1H2LA 2RDNA 2Y6GA 4MXWB 3T09A 4QHOA 4RS5A 1TNRA 4EV0A 1AL0G 2OS2A 5JOZA 4FSJA 1F8VA 1XQNA 2WLPA 3S6PA 5C33A 1OI6A 3E97A 1XNCA 2X5IA 4CEWA 3AMNA 2NP0A 4GWNA 1ENRA 1C57A 1YQ8A 4LBNA 4UBGA 1AJKA 2P4EA 4QPYA 4XQ4A 3VUOA 4Y20B 4CDQA 1RUJ3 4U36A 4NMIA 4XZUG 1VAVA 2JDYA 5F6KA 3LIGA 5T3NA 4QPIA 1A6CA 3WQ7A 2A3WA 2JE9A 5FUPA 3ACFA 4E2GA 3RJ2X 4EN0A 3JQWA 1DZQA 1YJLA 5FZGA 1ZRIA 3O1PA 3RI8A 1H8TC 5DAVA 3VDDB 2PLV1 2YC0A 5DAXA 3WP3A 3POJA 5IK8A 1YFXA 4R52A 4DEQA 1ZVFA 3IDCB 4IEZA 3UJOA 4O9EA 2YYOA 2N7GA 4H3WA 3U1XA 1BXHA 4A3XA 4L9BA 3T2OA 3DPRA 1UNBA 3JCIA 3GF6A 3ZM8A 1HB1A 3E6BA 3OUJA 1RVF1 2JKXA 2VOXA 1KDKA 1US3A 3WG3A 4XTPA 2VZUA 5LY2A 1SQ4A 1OVPA 2VCCA 4QX0A 1LHUA 5A3MA 4PI2A 3OPWA 4L0PA 1RGSA 2VZQA 5KHKA 4A4AA 3FLTA 4JCKA 5FZCA 3V65A 1YFUA 1ZZBA 3B94A 4JQTA 3JD72 2ZX2A 3NMBA 3VHRA 4WM7C 1GLHA 3ST7A 2Z2SB 3VZMA 1UZYA 2NQYA 4YRDA 2RS12 4Q1RA 4RR3B 5CFCB 1IOAA 2B9VA 1TG7A 1HKDA 1UN1A 3VKOA 1X50A 3V0AA 1NLRA 1QOTA 2WAOA 4Q0PA 1IKPA 2ZCWA 3AZVA 4IV3B 4DPNA 1DBNA 2C5DA 1JXNA 4YVWA 4D6SA 4NPMA 1PNFA 5T54A 3J26N 1IPSA 1LOFC 4OUSA 2IZWA 2Q8EA 4PDWC 2WNOA 1EUTA 3CO2A 5JZGA 5HXVA 1ULDA 1JYWA 1IPJA 1EP0A 4OMCA 2WO1A 2Y6JA 1KXGA 1OOPC 2VZRA 2BGCA 1C1LA 1POV3 4BM8A 2WT1A 1HQLA 3FN9A 3KS7A 2PHTA 3DF0A 1H2MA 5KC6A 1VMFA 3HQXA 4UXAA 4URAA 5GLVA 4IEQA 1FMD2 3H1WA 3DYPA 4JC1A 4JGZC 3VBOB 1XE8A 1VBB2 2RS33 4N43A 3ZR5A 2IWGB 4H7LA 4LK6A 4EQVA 3VBUA 3NNFA 3OGVA 4SBVA 2OA2A 1L7LA 1O7FA 2BGOA 2HJIA 2QVSB 2XXZA 2ZHKA 4FFIA 4LBJA 5FYCA 2ZX3A 4TLFA 3VBHB 1Z7S1 5A1AA 4LBKA 3OD0A 3CJIB 1IKQA 2LRPA 2W94A 1C8NA 2VZOA 1DYKA 1PO21 2IVIB 2HYKA 3DUIA 1REFA 5CU1A 3O1OA 4FPCA 4ZXEA 1T6BX 1AX2A 2HWD3 1W0PA 3WW3A 5BNOC 2Y0IA 2QE3A 3K3OA 4OHZA 2WA4A 3TYJA 1HRI3 5FZLA 1UWWA 3R6SA 4LBQD 1F15A 5HCHA 4CUAA 3RZZA 1BEV3 1HLCA 4LBQA 3E6DA 5FMOS 1K5MB 2I2SA 2JG9C 3MFAA 4CXXA 3RZGA 3POGA 4KGGA 2WN3A 5DAQA 3BB6A 3PVNA 3K4DA 2D6NA 5FLHA 2AC1A 4PQQA 1PO11 1K5JA 1V9U3 4AVCA 4RHV3 3WP4A 5LWBA 1HRI1 3POIA 5BNNC 1WCSA 1WMXA 4IV1A 5CFDB 5F3CA 3O12A 2PN5A 1ULFA 4UI9L 1TMF1 3RSJA 5KXCA 4ES8A 4CVUA 2PXJA 2W5FA 3T4HB 2NM1A 1RUE2 3D82A 3ZKYA 2D6OX 4ARXA 1HV0A 3OYWB 5GZDA 3S7EA 3PTYA 5A3NA 3UETA 4EWEA 1ZRDA 3LPGA 3VBSC 1M06G 2QJVA 4RHV1 1XSQA 2H6BA 1N1YA 1SLBA 2BNMA 1NKGA 2O14A 2IXJA 1PX3A 3OEAA 3WQBA 1XNBA 4XBLA 1LOEA 1ST8A 1SCRA 2B9UA 3QLQA 2XJSA 5A32B 5CBLA 4GWMA 1S2KA 2WINB 2RS51 4LO8A 1D4M3 3C8XA 3VZOA 4EN9B 4NIHA 4JRLA 5ABJC 2VMEA 3WDYA 2QQLA 1L3JA 3C2UA 4LT5A 2B42B 4C1WA 2J1SA 3MYXA 3POSA 5JPNB 4IEWA 2EIDA 3WUDA 4XF0A 5J3UA 2D6MA 2OPKA 2VU9A 4HVQA 1R083 1OD5A 1DQ5A 4YGDA 3ACLA 1ZZ7A 1STMA 3Q8CA 4AVAA 1O5LA 1E5HA 1HV1A 4YW4A 4DINB 2BP6A 5L36A 1MZ5A 2QTWB 2A3YA 2Y6KA 1ZZ9A 1ZA7A 3LDBA 1JOJA 1JS9A 3V56A 2KM2A 2PHUA 5FPUA 2EAKA 1ZRCA 5EHDA 4A6SA 1BHGA 4FTSA 4LLFA 3E1F1 3MIEA 5JOYA 4CDUA 4L11A 4RGAA 3SISA 2ZGQA 3AZZA 4Q4Y3 3NAPB 3PLQA 4JTNA 4AHWA 2EIBA 1V6KA 1LJ7A 3CU7A 3NNGA 1U5IA 3BCWA 1XRUA 3FHIB 5DABA 4G9SB 3R4SA 1RB8G 1ULGA 4PIZA 3ZFFC 1UZVA 2ZGTA 2XJTA 1YIPA 3ZYHA 1SHWB 1AXZA 2WNUB 4Q29A 1NG0A 3GALA 2RV9A 5SV8A 2GNTA 4L97A 1POQA 3LZZA 5IVVA 5FKBA 3OY8B 1VPHA 5GM0A 4EE2A 3B9IA 2XVGA 4JDMA 4P9GA 3CQOA 1W6QA 5D21A 3WG2A 1UU6A 4FOWA 4AVVA 2GMEA 3AK0A 1UPSA 2ARBA 3AL5A 5IVFA 4YVSC 5GZFA 4JV4A 5BNPB 3VHOA 5J37A 3MF6A 3CMGA 3ZMOA 5C70A 4R9DA 5A33B 4N53B 4S2HA 3R05A 5LEJA 1X82A 3VL8A 2YFZA 2E51A 1RJ8A 3IDAA 4HKWA 3AVSA 2TNFA 2YU1A 2CY6A 3LEMA 5DUUA 1CAWA 1WGPA 3WF4A 5EJZB 3M70A 5L9VA 1NQDA 1Z7S2 2D7FA 2W08A 5I0UA 4K21A 1OURA 2Z79A 1PO22 1S0CA 2UWBA 2BGPA 3LDRA 4AQ6A 4QPGB 5ANQA 5GZEA 3ZDSA 1DGWX 1H8TA 4IEUA 1B35C 1QDOA 1R1A1 4MO3M 4PCRA 2Y8KA 2BUKA 4FXGB 4OHYA 3FC0A 3EXUA 2WL1A 4QDRA 3H3LA 1UIKA 4ZU7A 3AYDA 1RMU3 4KWJA 1C5IA 4FQ4A 4MGZE 1DCSA 3OB8A 2QKDA 4FPOB 4ZZ8A 4LHKA 2R6QA 2DCZA 1CIWA 4QM8A 2GNMA 2V4VA 3PUAA 2JD4A 1JW6A 1Z78A 3PUIA 4JRAA 2HWD2 1WWYA 1C28A 1QJY3 5EV7A 1JTZX 1F4AA 2Q8CA 3D6EA 4BU2A 2FZ1A 1HRI2 3HEIA 4L2NA 1GWMA 1F31A 2FHRA 4PBOA 3BKZA 3SLIA 3FX3A 2WIIB 4WM7A 5CKNA 4XJ9A 4P9LA 1AR91 4INDA 2DU0A 2CGOA 4HZFA 4E2SA 5DUVA 5CYYA 4LR4A 4MZUA 3T30A 4BZ4A 4RHV2 3T2PA 1S1AA 2DURA 4AW7A 3ELNA 5LRRA 2MNGA 4GMP3 1AR61 1GWLA 4AHZA 4QU1A 1NT0A 5FO7B 3WD5A 3PJQA 3Q8AA 1YQCA 1LOFA 4GKYA 1B09A 4Q4W3 3VKFC 3WG4A 2RHPA 2RS52 4PDWA 1PK6B 4A7KA 3A22A 3SKJE 1H2NA 1EV13 1HRV3 5JXIA 2GH2A 2OIIA 1OBNA 3KCCA 1R093 1FT9A 1OOPA 2DCKA 1Q8SA 3KD4A 5IJRA 1PGL2 3T08A 1RINA 3KVBA 1NUKA 4P14A 1DGLA 5T5PA 5K0UC 1MVQA 4PI0A 5IVBA 4MADA 2R061 1VE0A 3OGRA 3AMHA 2XDVA 4ZU5A 2ZABA 4BQ2A 3HNBM 3O1UA 1CGPA 1D4M2 4JGZA 3CHXA 4Y3OA 3CIHA 3IMMA 2BBAA 2WNVC 2ZZQA 1TE1B 1JZ3A 1XSRA 4TLGA 3NV1A 2FD8A 1AYN3 4UFJA 1AF9A 4LKDA 2XJUA 3H50A 3H9AA 2VAUA 1YNAA 5JCTA 2HWF3 1KQRA 4RS5B 5C5UA 1H1AA 1SPPA 4IL7A 4UAPA 3RDIA 3AP7A 1NQJA 4B7EA 1C3HA 4YFWA 1KFXL 4IGPA 1MS1A 2BOJA 3VGIA 2FDFA 1GP5A 1W06A 4CEWB 5JSPA 3LIHA 1RXGA 1FI2A 1O91A 1X7NA 3OPZA 4FQZA 4XIOA 3ZXFA 5L9BA 3U11A 4QKBA 2HWF1 5T5OA 4CDQB 4I0BA 3WR0A 4FO9A 1W3XA 2DU1A 1QXRA 1ENQA 3ACGA 5I0SA 2HBUA 4TXWA 1SFNA 4QPIB 4ITCA 1PHMA 2VE1A 5JR7B 3W9AA 1C4RA 3OD4A 2E31A 2ZZJA 4DUXA 3HN3A 1KJRA 2JG9A 1AX1A 3KV5A 2D43A 3A0KA 2CAVA 3JUUA 3PNAA 4LE4A 3RVHA 3NNJA 3WV6A 3WZ1A 4AQTA 4R4XA 1JI6A 3JXSA 1IS4A 3MW2A 4K8RB 1ALYA 1LOBA 4NAMA 1L7QA 4XUOA 3VD5A 4IERA 4OVEA 3P1IA 5EYXA 4BQWA 3NVCA 1ZREA 1J83A 4P9IA 1N1SA 3UKTA 3USSA 3RYKA 3NJVA 3WNXA 4P08A 1CN1A 4FPLA 5A3PA 4YM1A 2AEYA 1EPWA 2D3SA 2JXAA 3VKMA 1AR71 1H6XA 1AL23 3VBSA 3U07A 3VBOA 2EIGA 2JD9A 4OQ8A 1ODNA 3DL3A 4FPKA 4URTA 4QKDA 5I0TA 3DXUA 2Y60A 4RD7A 1KITA 2GC2A 3LEIA 4K8FA 2CDPA 3A7QA 1OKOA 4GH4B 4XIKA 5ABJA 3V0AB 1RUC1 3ACIA 1US2A 3NV2A 2WWSA 4EN7B 5KR7A 3WNLA 3N7KA 5FMDA 2VR4A 4YVWB 4KL1A 2ZEYA 3OGGA 4EN8B 3WNKA 1LOCA 5GZGA 1R1A2 2XB6C 5KBFA 2P37A 2PAEA 2XGXA 2WKKA 2WZPP 1GMMA 1J3QA 1LHVA 3TOJA 5F5QA 3C7HA 3LQCA 1GYKA 2YGMA 2YXSA 5JZGB 1OQEA 3MEPA 2PQQA 4WZCA 3WNPA 4BK4A 1CAXA 5C8CC 5FBZA 4FT8A 5FQ0B 4HN1A 2WDBA 3TEXA 3HAGA 1RJ7A 2AEZA 2A1XA 5JMCA 2VCAA 4NVPA 4WVWA 3AYCA 3K4ZA 1X8EA 3P6BA 3SMHA 5GZCA 1CX1A 4YG0A 1F2NA 1SBEA 3T3YA 2XHKA 3FHQA 1N1TA 1TME3 4BLJA 5LA0A 2XLAA 4O9GA 4GD4A 2EICA 1PMJX 2VW2A 5IUQA 1MZ6A 5D1IA 1RMU2 1NA1B 4N43B 3FBMA 2J1EA 1IG0A 1CWPA 4YNIA 1QEXA 1VBA3 2BTVC 3S7IA 4AFAA 4AF9A 4TZDA 1MEC3 4GALA 3VBUB 2R32A 4QGMA 2CGNA 4Y1YA 2P3YA 1LKNA 1MS9A 3HOBA 3O0XA 4XUTA 3RJRA 3ZFGB 2D93A 4NR1A 4AG4A 4CP9A 2OUJA 2XR4A 5A7QA 3ZFFA 4YW1A 2XONA 5A1FA 3CL1A 4CYDA 5FPAA 5D8AC 2RMU1 1NOVA 1QY4A 1AR62 2JDUA 1XNAA 5H9PA 2VBPA 3ZYBA 4ZXKA 1VALA 5F2SA 4F8AA 3GZAA 1MEC1 5A6XA 2GN3A 1EUUA 2L9LA 3GCXA 1RC6A 2OZ6A 3UKNA 2HEWF 3KV6A 2XLGA 2GNDA 3P5BA 4DMIA 1TNFA 1O3RA 2JG8B 2BFUL 1UO9A 2FCVA 2NPIA 4QPWA 4QU2A 1JZ4A 4LBQB 1ZNPA 2D5FA 4MSVA 1GQHA 4NRPA 2QQUA 4SLIA 3ENRA 4FPGA 3J8F1 4YVSA 1AZDA 4Q4W2 1V6MA 2XBO1 3WP6A 4MOAA 4DFSA 4NIDA 1HRV2 1EV12 1WD3A 2ZJCA 3VBFC 1MZEA 1ND3C 3NV3A 4E4ZA 2X10A 1R092 3NWKA 1DGWA 3PJYA 4DB5A 4IV1B 3J7MA 4IGOA 4I30A 2IUWA 5KHJA 1VMHA 3BODA 5BY5A 1BBT1 4NUBA 3D0JA 3U78A 3PL0A 2JE7A 2QQWA 3J7HA 4ZY9A 4Z92B 4JGYC 5DZFA 4KI5M 4AI3A 4F7ZA 1A8MA 4AE2A 1FAYA 4NIAA 4YLZA 2K46A 3QACA 1AYN2 2DDUA 4CP0A 1B35A 1VP6A 2HWF2 3PMEA 1FPN1 2FDKA 4OHVA 3PUHA 5H9QA 3LOBA 3GBGA 4FPJA 2UWCA 2D97A 4I3PA 3N7LA 3TEWA 2D3PA 4YM0A 4CTEA 2VH9A 1ULOA 1UQXA 3V0BA 2VMGA 3OG2A 4MGSA 2VZ3A 2Y6LA 2VTXJ 4XAEA 1GICA 2YZ4A 5F3EA 4CU7A 4X8NA 3SQOA 5AC91 3B00A 1RTVA 1UMHA 3SCGA 1YI7A 5F5IA 3P3PA 1W9FA 3WSOA 3LEGA 4K7JA 1GQGA 1VRH3 5L73A 2O8OA 2W9XA 1G6NA 3F95A 3OSDA 4LITA 3ZN5A 1LAJA 4QQPA 4Y26A 1UKGA 2QUOA 4M3CE 3I3EA 2QDRA 2WZ8A 3MGUA 2VC9A 4HKOA 1JZ5A 4W65A 4IEOA 1MR5A 4D7SA 1NLSA 1AR72 4NOTA 2A6XA 2Q1FA 3RYRA 4CDUB 5A7PA 2RS13 4NIIA 1JN2P 2D40A 1ZBE1 4Q4V3 4HSLA 3M2MA 4KWLA 3HMYA 5HCAA 3TEZA 3K2OA 5LA9A 2J1RA 5HCFA 2RE9A 3PDQA 3PIJA 4AI9A 4RSUA 1H6YA 5LBBA 4UFHA 4K20A 4NHLA 5FYMA 1RUC2 4YG6A 1DQ0A 2PYTA 4RGGA 3UGGA 1AL22 3VBRC 3WHUA 4A45A 3Q9OA 3SEEA 3N9OA 5DUXA 2Q5TA 1JUHA 3DV8A 5K0UA 1A3KA 2VBBA 2JDKA 1UKRA 1XJAA 2A6VA 4QT6A 2RR11 3VV1A 1NY72 1WMDA 4CCOA 3T0BA 4AGVA 4KQ7A 1O8PA 4PF1A 1DGRA 1W6QB 4CDWC 2P34A 3IDEA 5CAZA 4NIGA 3WF0A 2YHJA 2WNVA 4NRQA 4OI2A 1Z0HA 2FMDA 1VBB3 1L7RA 3I2HA 1WMFA 2KD7A 1SFPA 3BGAA 4S2FA 3C7EA 2P17A 4D3WA 1E5RA 3WLUA 3RPQA 5CZKA 5A1LA 4ASKA 3M8LA 1D0GA 1V6LA 1LU2A 5GLZA 3O1VA 4Q8LA 2A5ZA 1IQAA 1DG6A 3LA3A 2ZX4A 5KHIA 2A6WA 4N9IA 5K7PA 5CKMA 3O1RA 5CKQA 3KM5A 1CAWB 2VQUA 3J7LA 3Q8EA 3I54A 2R041 4OHWA 3N7JA 3ZXJA 4B3NA 3ZSMA 1JHNA 5C9AC 2VVFA 5EYYA 4COZA 1VBA2 3NJZA 3POBA 4HT1T 1PGSA 1CAVA 1MEC2 4I02A 1YYNA 1H8TB 4UFKA 4MH0E 5LATA 2QQJA 2SLIA 4GA9A 5K9YA 4QMAA 4JTOA 2VQTA 1OQ1A 5F5AA 4CPBA 3SKVA 5F32A 1PK6A 3HNMA 4JKMA 1YUDA 2I74A 2W95A 4TYSA 2W1WA 1S0GA 3J8F2 2Y6HA 4ASLA 5BNQA 4A3ZA 5FXVA 4OYUA 4ZKTB 3ZMNA 4WVZA 3KF3A 3U4SA 5E8AA 3ZYPA 1GBGA 4JHZA 4IDZA 3S0MA 4C8DA 3UL2A 3VHPA 3PU8A 3JU9A 5DAPA 3WXPA 3DCQA 1IHMA 3L9JT 4I2OA 4XMAA 4WM7B 1UIJA 4UT5A 4Q26A 5FZ6A 1RITA 1WUVA 1OQDA 2YROA 3LD8A 4CZSA 1UY0A 2X05A 4P02B 5DG2A 1VRBA 3AFKA 3NSTA 4M3CF 2XHNA 3HR9A 1DLLA 2C24A 1YI9A 2XJRA 3HNYM 3ZVXA 1GOHA 2ZEZA 3IDBB 2B4KA 1W99A 3RNSA 1MACA 2B39A 4PDWB 5FTTC 2PLV3 3OGSA 2WQZC 4CUGA 5FO9B 2MHFA 3FFZA 2WZR1 2ZEWA 5C8CA 3ZPOA 1OOPB 1HQNA 1KRIA 4QM9A 2YV8A 4K40A 1JZ6A 3HIFA 5FIXA 4I01A 3ZX7A 2JDZA 2TUNA 1Q3EA 1ULCA 5F5CA 1JUIA 1D0HA 3T4VA 4AYUA 5DPNA 1QF3A 1RVF3 2OPWA 4IE0A 1XNTA 3I2DA 4JGZB 4E9KA 3POYA 1SG3A 2J42A 1BKZA 5FBJA 1LGCA 1S2BA 4IEXA 4XC9A 1YC61 1WCUA 2J1VA 4XFIA 5FKCA 4D69A 1KEXA 2I07B 2D6KA 5KC5A 2HLEA 2IXIA 2WABA 3WNMA 1UMZA 1T6GC 3AMPA 4MX3A 4H2AA 1NZCA 1SPPB 4E8DA 1UX7A 2BZDA 4ES9A 4QGNA 4Q4X3 1CX4A 3KHCA 3POFA 1YWKA 3JQXA 3ETQA 5D8AA 2E53A 4AAPA 1ZBE2 1VRH2 4QDSA 2OW4A 4E8CA 1FNZA 3BTZA 1OMIA 5HV4A 1GWKA 1XU1A 2BDRA 4FOYA 4YW3A 4FPHA 4MUVA 2NYYA 3I59A 3N4MA 3U10A 2D3RA 3I3QA 5BNOB 3E5XA 1PIV1 2KXLA 1ND2C 4CCDA 4Q4X1 4W6YA 4XJUA 5F1RA 1QHDA 2R0HA 2UY9A 3KLSA 5IHRA 2JB4A 2XVKA 5AFBA 2VNGA 5FYIA 4GH4A 3MLJA 1OF4A 4Q4V2 5BNNA 2JG9B 2WC2A 3N3HA 4IE5A 3AL6A 4QXKA 1HIXA 3CLPA 2RDRA 4E4SA 4FAGA 2LM3A 5JXHA 3PIGA 2PTMA 3MIBA 4W6XA 1ND3A 3VBFA 3TN91 5FQ0A 3FUOA 1XPWA 1REEA 3LSEA 4HL0A 2XG3A 2Y26A 4R9CA 1I9RA 2OYZA 2Z42A 3VB9A 4HBNA 2XUMA 3KVAA 2WFF1 3WDWA 2ZGMA 5JIUA 1OA4A 1W8NA 4XHXA 1YIFA 4CCEA 1GZCA 3DGTA 4TN7A 1HX6A 1JU3A 1Z7S3 3JBG1 2WJSA 3VBSB 4G3YC 2EVXA 2MPFA 2WT2A 1C8M1 2CAUA 1NA1A 2FBEA 5I8SA 1PO23 3GGLA 3C7FA 1AR81 4AFBA 3LA2A 3EJKA 1Q8QA 2R042 4IEPA 1V6JA 3N35A 3ZFGA 1X9PA 2OZJA 5ABJB 4GZ9A 3EO6A 4PLMA 3M3EA 5FLJA 2B46X 5FRAA 3AZWA 1OHFA 2Y34A 4XURA 1EAH1 3MFCA 2VJXA 3GZEA 4UFLA 5G04L 1WKYA 4BXFA 2P3IA 1QQP1 3FL7A 1Q8PA 3WG1A 4NROA 3U37A 3GZUC 3MIHA 1CAXB 1PO13 1HDKA 1QKQA 1Y7BA 5FOBB 4CU9A 1SBDA 2JG8A 3KV4A 3THPA 1BYHA 2EXIA 3ZR6A 1DZTA 4XE9A 4QX7A 1OUXA 1TMF3 4ISRA 1MS5A 1OT5A 2HWE1 4LKSA 3QBQA 3APBA 4GWIA 5L19A 1SZBA 2BWCA 3MBWA 3ILFA 2Y38A 2E32A 1JOPA 2ZEXA 1OSGA 4YGBA 4B1MA 3HPNA 1W2TA 4LBLA 1UYXA 1VR3A 3AKQA 1BLZA 4GB33 4M3CB 4CP9B 3ZFFB 2FZ2A 2VCMA 1HB4A 5IWFA 2W47A 4DO0A 2RS53 1YCIA 3BIWE 1LEDA 4A7YA 3VBRA 4KGQA 5CNAA 1WZXA 1XU2A 1VBC1 3INAA 2G9GA 2ZBJA 3KQ4B 3PVEA 3EBRA 1LNSA 4QDQA 5FWEA 5JI7A 1OA2A 4IESA 1O4TA 2YFUA 4GB31 3N7MA 5FZKA 2BU9A 3W59A 2DCTA 4P9JA 4CDWA 4NHYA 4PLNA 2F4LA 2K9ZA 3ZOIA 1O6UA 3AZXA 5H9SA 5JMOA 4YVSB 3O7OA 2VZTA 4PBPA 3WCSA 2E6VA 5C3PA 4LKEA 2PLV2 2NMOA 2ARAA 5FUIA 2VOVA 5E1RA 2D5HA 3OF1A 3IPVB 1QIQA 3VLBB 2ES3A 1DIWA 1C1FA 2NZ9A 5C3RA 1RVF2 4Q5OA 3TB0A 3E5QA 4BH9A 2JIGA 4A41A 4JDOA 1CVNA 4XFAA 5C9AA 1YLLA 3MW4A 3BPZA 2NMNA 4MXVA 2GSYA 3LFIA 5A3WA 1BCXA 1S0BA 3NO8A 4CDXC 1J84A 3GHNA 1B35B 2QDNA 1CPNA 4MVTA 4XFGA 2VOKA 5CIRA 5EJ3A 4QXCA 4LE3A 4Q4X2 4XPVA 1LECA 4TWTA 2R1BA 4LHNA 3VD3A 2RDSA 4EJRA 3VD9A 1NCRC 1RHI3 2GMPA 3AX4A 5IATA 3V0BB 1SDWA 3KT7A 4YG3A 1PZ8A 4QB2A 4Y24A 2CYFA 2JDHA 1ZA4A 1R64A 5A7SA 3AC0A 1WW5A 4AK3A 3SITA 1DU3D 3OUIA 3MHZA 5K8SA 1KS5A 1UU4A 1RHI1 4DUVA 4UFIA 1FX5A 1J58A 1YEWA 2WFF2 3K51A 4B4RA 3IBMA 3ES4A 3UK9A 1WW6A 3DECA 2Q30A 4RN5A 2AYHA 4C90A 1PMHX 4KU7A 5A6QA 2ETEA 2XVLA 2QQIA 3FZ3A 2YC4A 1C8M2 4FFGA 1JZ8A 3PUQA 1G9FA 3BTYA 4QX2A 5FZBA 2A3XA 1HB2A 2VMFA 2AREA 1H9PA 5DAWA 1N1VA 1R1A3 4Q8KA 3BIEA 2RJ2A 2CWMA 1W03A 4NJ4A 1GU3A 2DCJA 2ZMNA 1JYNA 2XPJA 3ZYIB 1CR7A 1WA4A 4LUMA 4CCCA 4DY3A 2Y64A 1EAH2 5HV0A 5K0UB 1UX6A 4XVHA 5JXGA 2YU2A 4LQRA 2CTVA 2VULA 1F9KA 1CQ9A 5LEKA 3POWA 5CG8A 4AQ2A 1X9TA 4UF0A 3AYAA 4FTEA 3N9NA 1EPZA 4Z2AA 5LRSA 1IG3A 2EF6A 5L9RA 1S0JA 2WNVB 5FZOA 3J7NA 5IYYA 4AZZA 1BZWA 1LU1A 1W0NA 4XETA 1N3OA 3MV01 2HWE2 1BMV1 3OBZA 4FP3A 1SDDB 2C9AA 1AR93 3DKWA 5JLVA 3WHTA 4ATFA 3I3DA 3WVJA 1PO12 1MS4A 3THTA 3B69A 2X29A 1QJX1 3PURA 4I0WB 4CEYC 2XWJB 1AR63 3EYPA 1TMF2 5EZWA 4V2WA 3TNPB 5HI0A 3WNNA 4QB1A 4XUQA 4YGEA 3WQ0A 4ZS3A 5IFTA 2DVBA 1ND2A 3H3ZA 4BIOA 4NAOA 2VXJA 1MVEA 1Q5OA 3LEKA 1O59A 5DUWA 3RWNA 3ZPYA 2ZGRA 3B9CA 5E16A 2P3KA 5J96B 1VBC2 3ZFEC 1CAVB 2GC1A 5FY5A 3I2GA 1WBLA 4BYYA 4DRVA 1PVC1 4HVOA 2R063 4BPZA 4GB32 4PHZA 5FY9A 4XDQA 4Z82A 2JE8A 3VZJA 5FZ1A 4AAXA 1RUF1 4AI1A 4XOGA 3LAGA 3ZIXA 5FZMA 3VDCA 3DYOA 3MPPG 3DYMA 4AFCA 1FYUA 5FXWA 3ZXEA 5A3UA 5C8WA 3UKVA 2P1BA 3LWCA 2DVDA 5A7NA 1WLCA 3AKSA 3JZVA 1LOAA 3MPBA 3ABZA 4QQHA 5T5JA 4EROA 1UY1A 1M4WA 1O4YA 1ENXA 3ALQA 1DQ6A 1GOGA 1Q43A 1X33A 2ZA9A 4LORA 2WO3A 3RZJA 3THDA 2UYAA 5GLTA 2ET7A 5FZEA 3C7GA 2DUQA 2MEV1 2PAKA 4QHBA 3JB8A 2GN7A 2JECA 1XOYA 1TZOA 2B7YA 4V1PA 2G4IA 4XDPA 5F8PA 1QJU1 5C5TA 4JDNA 4KBZA 4JZRA 5TSWA 3B93A 4HXCA 2XOMA 2D44A 3RMXA 4YZ4A 2QCSB 2VXRA 2W68A 5C8CB 4QHZA 3BOWA 2UWAA 5FPBA 5BNOA 2GZWA 2WAAA 2YPJA 4JHTA 4WBBA 3PMSA 1G7YA 3IZOA 4LO4B 2EAAA 4OZOA 4F3JA 3N9QA 1U5XA 3W21A 4XJAA 1D7PM 3HQRA 5EJ1B 2DTWA 4XF9A 2AZ5A 2PHFA 1U5YA 2GP3A 5AFEA 2PHXA 5CG9A 2YUEA 1AR73 5IW0A 5FP8A 1RHI2 2YBSA 4I3GA 1QWRA 2YG0A 4O7XA 4UYBA 5BXXA 2R49A 3ZDVA 2ZHNA 5FO8B 3ORJA 2DFBA 1N3PA 3MDPA 1DZRA 2VUCA 3KGZA 5JAXA 1UZ0A 4FTBA 2WWJA 1OH3A 3MUZ1 3FMGA 4Y1ZA 5D8AB 3MF9A 4KG8A 5DMYA 2E7TA 1RUC3 2VM9A 3AXEA 5A70A 4LBMA 4LULA 5ERLA 3URFA 2ORZA 2VUJA 1LULA 1GNZA 1F35A 1RUG1 3NQHA 3W58A 5JOWA 1F5FA 2AH2A 2GDFA 3CDZB 2E7AA 2RG4A 3I59B 3T1LA 1CIYA 4OUEA 4D6RA 3GJAA 2YPDA 3LGRA 3SHRA 2H6CA 1FOD1 1VBE1 2GAUA 2ZACA 2WLQA 4FI9A 1U0AA 4YW7A 5BNNB 1W2NA 1O3QA 4EWAA 4CRQA 3MZHA 3M3IA 1GQPA 4X8PA 3AM2A 4NHKA 1YFWA 4IW3A 4Z8BA 3BOPA 3VBFB 1ND3B 1UXXX 4Y1UA 3IKWA 4XYXA 3I2IA 1UU5A 2GC3A 1XNDA 4ONUA 1SCSA 3K3NA 4LEJA 4HN0A 2ADDA 4GWJA 4ZONA 3THCA 1OLQA 1BMV2 3U0ZA 4M01A 5C4WC 3WY6A 3PU3A 2BRTA 1RYYA 1W28A 1RUOA 1VAKA 4JGYB 4OI4A 1S0FA 1K45A 3NNMA 4E4DX 2VBDA 1QJX2 2J7MA 2X8KA 2NN8A 2RMU3 2YBPA 3K48A 4LO5B 5DZGA 3WF3A 4BJ0A 1K3IA 2X5IC 1JBCA 2JEMA 4CDXA 3IM0A 2W1UA 2UY8A 3AVRA 3R4UA 1UMIA 2RM21 1I1EA 4B4PA 1CZVA 1AR92 2GNBA 3VN4A 1LHOA 2IXCA 1OLME 2P3JA 4M3CA 5T52A 1W3VA 1IGOA 1EYBA 2FDJA 1URXA 4Y5SA 1NCRA 3SH3A 2BYVE 3UJQA 4PF5A 4L99A 1AJOA 3R0RA 1PVC2 4C1XA 4HSJA 3J8F3 4OI0A 2XBO3 1POV0 2VMIA 3I8TA 4XUNA 2ENRA 4HK9A 4AGGA 2PAMA 4ASMB 4BQXA 1UOJA 2AENA 2HWB3 3O1TA 4COWA 4P00B 3N36A 1W8UA 2VVEA 5F37A 2A7AA 1XE7A 1T2XA 3AP5A
chains in the Genus database with same CATH topology
3DPRC 2R062 1QMJA 1WLDA 2K2SA 1BBT3 5I93A 2PA7A 3ZXDA 5KHGA 5FPZA 1OA3A 2VVDA 5KXDA 5FMOL 4B29A 3PVOA 3TNQA 3D5OA 3IPVA 2HWB1 5FAXA 4NWWA 1O3SA 1RUD1 3WDTA 3QOPA 1APNA 1JYIA 1WLTA 4Q0SA 4AVBA 1FPN3 4FCAA 2WNEA 2VPVA 4UW3A 3FJSA 3VBRB 2H0VA 4I09A 4YARA 2EXHA 1J1TA 1UW8A 3GNEA 1FV2A 2W0XA 3D8CA 3AFGA 2CWSA 3WOGA 5AC93 4CDWB 1J59A 2ZAHA 1AXKA 2G9FA 1AX0A 3OBTA 3CF6E 2ZGSA 2R0FA 5JOXA 3VKNA 2QZ2A 1LHWA 1I6XA 1ONAA 4UW6A 4OI1A 4XFCA 3OCPA 4CEYA 1H2KA 3QH7A 1ZBE3 2O8QA 2BW8A 4I0AA 4MV2A 4B4QA 1V00A 2WQ4A 5C9AB 2BNOA 1SFYA 2BVVA 2JX9A 2ZMLA 3ZFEA 1RUG2 4AEDC 1SBFA 1VBD3 2DYCA 2RR13 3BTAA 4XJWA 5BV6A 1GSLA 2GH8A 1FOD2 4PIYA 2DUPA 1D2QA 3AB0A 3M3OA 3ZSEA 1SLCA 2EXKA 4N7IA 3FFQA 3O14A 2DFCA 1VBD1 3KZ4C 5H9RA 5JVVA 2LALA 4RQPC 2ZHMA 1GZWA 4AHXA 5JSOA 4XXPA 1QNWA 5AVAA 1Q8VA 4AFMA 1PMIA 1CONA 1OPOA 4Q27A 2XKPA 4N7UA 3JD71 1DQ2A 4HKLA 2D6LX 1KD7A 3WW2A 2R043 4BOWA 2DV9A 3I7DA 1W0OA 3EHKA 5IT6A 4LA2A 2XKOA 3IT8A 2RM22 5E89A 1GKBA 4IEYA 4M0NA 4Q0VA 1YXWA 1GR3A 1C5HA 3ZSJA 3L2HA 3O0VA 2R16A 4BIFA 2RMU2 3OGJA 4UW4A 5B2GB 2XJQA 4R8HA 1UF2C 4DOUA 4Y1VA 2ARXA 3WDUA 3WT3A 4M0HA 2WSUA 1IS5A 1NCQC 2HWC1 3NKGA 2HKXA 2DVGA 1O4ZA 1OFNA 3AP6A 4MGKE 5LEKA 1J3RA 3OJBA 4Y5Z0 1VIWB 1BJQA 4LHLA 1S0EA 5JIAA 4AEKA 1W39A 3JB4C 3MLLA 2R1DA 4XXAA 2WSVA 4UBHA 5FOJB 1PGW1 2OUHA 2XBO2 1W6OA 4XBQA 5L7OC 2B45X 1SACA 4C0HA 2BPA2 4WVVA 4OLLA 3KB5A 1QDCA 2HWB2 5DZEA 1YJKA 5FDBA 1MQTC 2ZS6B 4DZGA 4AGRA 3S30A 1W6NA 1BBT2 2Z5WA 1ND2B 2R073 2WZR3 1WCKA 1D4VB 4XBNA 1IPKA 1J3PA 3T2TA 3GBFA 3WDXA 3KT4A 1FPN2 5KXEA 2VOWA 3HN1A 1W2UA 5LK5A 2R071 1KDMA 2EALA 4OUMA 1KJLA 1H4HA 3UV9A 3I4IA 5C4WA 3KCXA 3HWJA 2ZGNA 1RUE1 1V6IA 5AC92 1UD1A 1DQ1A 1MZFA 2TEPA 2IXLA 1COV1 5J09A 4YSFA 4WZFA 3CEWA 4GMP0 1WD4A 1PIV3 4YW5A 4D7TA 4AVTA 3ZIWA 1UZZA 1ZRRA 1OFSA 2DF7A 2GC0A 1FNYA 1NXMA 2WS93 1UL9A 3AZYA 3DN7A 4GQ7A 4XFBA 3THPA 3WCRA 3H1YA 1SLAA 5T5LA 3WP5A 2WA3A 4E2QA 5HCBA 2QZ3A 3M3QA 3OBRA 1GANA 1LR5A 5GJ6A 2AR6A 1RUJ1 2PHDA 3TN93 5T55A 2WS91 4XMIA 1VBD2 2RR12 3J9SA 4ATEA 4XEZA 4BHPA 1D2SA 2WFF3 2NLRA 4WM8C 1XYOA 2ZGKA 3AP4A 2ZPXA 3JBG3 1PZ9A 3QCWA 4GXLA 1C8M3 1HXS3 4RL7A 3ZXGA 1BK1A 3O0WA 2VQAA 3IMNA 4K1ZA 2ZTNA 1AR83 4YW2A 1NE6A 1ZRFA 1YO8A 2E9QA 1AUYA 4JGYA 3ROUA 1V70A 3VKLA 2VGDA 3RRDA 1FV3A 3ZYRA 1ZM1A 4UW5A 1EAH3 1HXS1 1LRHA 2HEVF 4YZ1A 4RFT0 4HVRA 1QQP3 3VZNA 2LTNA 1RUI3 5J36A 4FPYA 3RG0A 4F83A 2VQ0A 3QD6A 1CESA 1ZX5A 4FBFA 4FVVA 4MYEA 4J1WA 2BBVA 2VG9A 1GV9A 2HWC2 2HWE3 1RUI1 2PELA 2VECA 5CVRA 3VDDC 2JENA 1HW5A 3AKPA 4EN6B 2FQPA 4YM3A 4ISQA 4JAAA 3ZXAC 4COYA 4QX5A 1POV1 1LHNA 1UAIA 1PGW2 4AEJA 4XJ8A 4IEVA 5GLUA 1V6NA 2VUAA 5KXBA 2UYBA 4Y4YA 4DXZA 2RS31 4AEDA 5F6LB 4CDXB 1VBC3 1VLNA 4LUKA 2O0OA 2C0ZA 2BFUS 3J4UH 5ACA3 1IZ3A 1FATA 1NCRB 3LSDA 5JDBA 1SEFA 1J1LA 4RR3C 3M4FA 5CFCC 2DWRA 2CV6A 1CAUB 3AYEA 4IV3C 5J48A 5CADA 3GYDA 3LKJA 3M7AA 5ACA1 4RQPA 1QNYA 2HWD1 4R9AA 3ZN6A 2R072 2WZR2 4GULA 2LUWA 3MLKA 5BPXA 4NPRA 3B3QE 1F5JA 1IS6A 3AKRA 4YM2A 3D0SA 4P9YA 1BEV1 3MIGA 3H7JA 4E27A 2A70A 4B8EA 1Y3TA 1LESA 2JKBA 1V9U1 4G4FA 5DXDA 1COV2 2PHLA 3VBOC 2V73A 3M3CA 2AGSA 4BE3A 3VHNA 2ATFA 1JH5A 2SBAA 1WBFA 1BVVA 1W6MB 3GZTB 4HETA 3WUCA 3WW4A 5HBAA 4QGLA 5GALA 5AVPA 3VBHC 2E63A 1PGL1 3H7YA 3CJIC 1U12A 4XQWA 2D98A 2BVBA 1CPMA 1NCQA 2DVFA 4J1XA 4LNVA 2ZGOA 1PIV2 1RUJ2 1G8WA 1D4M1 4JQRA 3X29B 1S0DA 4BMEA 1TEIA 2UU8A 2GALA 4YYOA 4GIQA 4YGCA 2WS92 1QGLA 1LENA 5JWPA 1KFUL 1WMEA 1YFYA 1ASJ3 1H30A 5L7OA 1K5MC 3FE5A 4NO4A 1QJZA 3ZSKA 1R081 4CEYB 1XYPA 3TN92 1YHFA 3NW4A 3B5LB 1VB2A 1MQTA 2ZX1A 2A6ZA 5CFDC 1ASJ1 3WW1A 4Z1VA 5BYNA 1LCLA 4WV8A 5JI9A 3JBG2 2R30A 3ZFEB 1HXS2 4Q4Y1 4XW3A 1AXYA 2DVAA 2I45A 1AR82 1VB4A 2DCYA 3E5UA 4FPEA 2JJ6A 3ZYGA 2H0BA 1DFQA 2FMYA 1ULEA 3MIFA 3FLRA 5DDJ3 1G86A 3LCPA 1QH6A 2P2KA 1OLRA 1Q8OA 4HANA 4WVMA 2CL2A 1SLTA 4Y22A 3AKTA 5CA6A 1QQP2 4HLTA 1RUI2 3MIDA 4LLOA 3LB9A 3RMYA 1GZWB 4HPKA 4P9XA 2ZGLA 2YMZA 3RQ0A 4YFZA 5FPXA 3GHMA 3RS6A 1WW7A 3ASIA 1QJX3 5DDJ1 1LEMA 4Z07A 5J7MA 3H3UA 1NE4A 3IN9A 2W39A 4J6GA 2BEOA 1CJDA 2GMMA 2GU9A 3HT1A 2RS32 4AXOA 4HK8A 3B7MA 4COVA 3NAPC 2C1FA 3ME2A 1PVC3 4XFHA 5GKAC 3ATGA 3NL1A 1EY2A 4LTAA 3QH6A 4BCUA 1ENSA 5KWRA 2JICA 2ZGUA 2Z69A 1LGBA 5I8YA 1RUF3 5I91A 2WNUC 1ZBA3 1XXNA 4RA0A 4KBBA 5ACA2 4IXLA 3AJYA 1W6PA 2W52A 2XJVA 4WM8A 3SCFA 2IXKA 4CP1A 1RMU1 1BEV2 2ZGPA 4DS0A 2X53S 3USUA 1ZBA1 4PIXA 4X6QB 1W6OB 2ZKLA 4K1YA 1E57A 2BQPA 2QNKA 2E7QA 1QJY1 4DNYA 5BNPC 2KA3A 1V9U2 2WFPA 4MXWA 2XWBB 4MGYE 4ZU4A 1DGRN 1ZZ8A 2MEV3 5FFOC 4N53C 4A2UA 1QJU3 4C91A 4K3UA 4XF1A 2QQPA 1W6NB 1QU0A 1ZYBA 4KU8A 4Y20A 4A7ZA 3C3VA 1H4GA 4HMZA 2QFEA 4GMP1 5BUVA 4Z2WA 4QPGC 4BQ1A 4Q4W1 5JPMB 3VDDA 4META 1HRV1 1EV11 3SXWA 2V5YA 1GZ9A 1R091 4IQPA 1I5ZA 1QOOA 5C4WB 3ES1A 2HEYF 1R082 2B5HA 1LODA 2PFWA 5I8TA 2X5IB 1AHSA 2ERFA 2YDEA 1RUNA 1AYN1 1RUG3 3FUQA 1NXD1 4MGIE 1ASJ2 1RUH3 1SLLA 4JVAA 1FOD3 1VBE3 4X6RB 5IK7A 4H7MA 2O1QA 4RR3A 5CFCA 3B02A 4Q4Y2 3H1MA 1GFF2 2V09A 4D7YA 3TAYA 4IV3A 4Y1XA 1PNGA 4AI0A 3KQRA 1RUH1 3CNAA 4KWKA 4OFGA 3SCHA 5FCCA 2BNNA 3KGLA 1PK6C 1X36A 1G9BA 4XHBA 1FXZA 4BWOA 2ZKNA 4ORFA 3RYPA 4EWDA 3DPRB 1H9WA 4LO7A 4C0BA 5CB7A 5IK4A 3ZYJB 3MICA 3G7DA 4K6BA 1MS0A 5I0RA 4XQDA 3MI8A 3D4KA 4R9BA 5DDJ2 2EA7A 3M1HA 4QQOA 3NV4A 1PM7A 1LB2A 4CP2A 5E88A 4AHYA 1UCXA 2OVUA 2RM23 1G9AA 4AWDA 1G9CA 3AP9A 4RS5C 4B7KA 1AL21 2VNOA 1MS8A 2DUOA 2XL7A 3VBHA 1HQWA 2D6PA 3CJIA 1R1ZA 3MW3A 5SV5A 3P3NA 4HFSA 4R4ZA 4N90A 4CEWC 5IK5A 1NY71 2K0GA 2F6BA 1DHKB 1SMVA 2UURA 2VMHA 4DY5A 3CJXA 4CDQC 1CJPA 4W6WA 1RL3A 4QPIC 3WINE 1PZ7A 4BMBA 2RJKA 1DYPA 1AYM3 1CAUA 1DDLA 3IWZA 1K5MA 1H1IA 4YZ5A 3AXDA 4H14A 1RUF2 3PHMA 1BVP1 1LOGA 4KNCA 1RUD3 1ZBA2 4GKXA 1Q56A 5CFDA 4NWVA 4PQ9A 1AYM1 1TME1 4QQLA 1QJY2 1QXPA 1YRZA 2IFWA 3O5SA 4U2AA 4XJZA 2XH6A 3OYWA 2A6YA 2B8MA 4FP2A 4AEDB 3FWEA 3HT2A 4OZXA 2YY1A 1O3TA 1OPMA 3H0OA 1VBA1 1Y9QA 1VJ2A 3A0NA 2CGPA 5A32A 1LGNA 4NHMA 3EQEA 3OTFA 1H8VA 1W6MA 2XLFA 4YZ3A 5EWSA 1SLIA 2MEV2 4GH4C 4PLOA 3PVBB 5GLWA 3FBYA 4FAHA 4QD2A 1QJU2 2ZHLA 1DF0A 4YVWC 4LO6B 2ZOEB 1DQ4A 4RQPB 1LTEA 4XILA 3ZN6B 4L8QA 3TBDA 5JZGC 3A4UA 2EXJA 4D94A 1AVBA 2BWAA 4AI2A 4FXKB 3ZO0B 2VW1A 3BU7A 2IFRA 3LOIA 4PJYA 2ET1A 4KH9A 1RIRA 1N47A 3AMMA 2WT0A 2VY0A 2AUYA 5FREA 1S55A 1NA1C 3G6JB 2IXHA 4FOQA 4N43C 3VZLA 3SNMA 3NAPA 4AEMA 4BA6A 3WX5A 4OULA 3VBUC 2IC1A 3ZFGC 4DRRA 2ILMA 1V6OA 4LA3A 3L2YA 5F9TA 4M00A 4Q0UA 3TRSB 4P5HA 2RJLA 2WNUA 4P9WA 2A71A 3HD8B 5J98B 1NCQB 1UPIA 1RUH2 2TBVA 1N3QA 2PHRA 4QQ2A 3OY8A 1VBE2 2PHWA 5FLIA 5EFUA 1REDA 4TSVA 2JG8C 1A78A 3ILNA 3ZSLA 1NYWA 4AQSA 4AVSA 5KHHA 3JD73 5L7OB 5BNPA 3R4DB 3SH4A 2DTYA 4NN0A 1OKQA 4FOVA 2XL9A 1VRH1 5A33A 4N53A 1MQTB 4IV1C 2CNAA 1MS3A 4XF3A 3TWIA 3NKTA 5A3LA 3U4XA 4AI8A 4AFDA 5JSRA 2RS11 2VW0A 4COUA 4DQAA 1H0BA 4Q4V1 3RI9A 4QPGA 5C6CA 1U5ZA 2Q0AA 2ZX0A 2HWC3 1GNHA 3WDVA 1JYCA 3VZKA 3IIAA 1FMD3 2A73B 1TQ5A 3AJZA 3ILRA 4K9SA 4WVMB 4L92A 3VL9A 3FLPA 4Y22B 1H1MA 1WLWA 3KMHA 3E6CC 2F4PA 1Y43B 1ZZCA 5DG1A 4HPKB 3KSCA 3ZXKA 2YGLA 4H55A 1QH7A 3AMQA 3ECQA 1FMD1 4Q1PA 1VBB1 1CD3G 2VNRA 2Q4SA 1AYM2 1TME2 3ZN4A 3KCYA 1IS3A 1QXJA 4MLOA 4BLIA 1I3HA 2ZAAA 1XNKA 1X8MA 3H8UA 1VAMA 2ZMKA 4XF4A 4CDUC 2Y0OA 1WW4A 4IETA 4LBOA 1RUD2 4Q0QA 2A75A 1XYNA 1KS4A 3V64A 1ZZ6A 3WQ1A 5LK7B 2XJPA 5T50A 3T1MA 3LA7A 2Q1MA 1PVXA 5EXOA 3SH5A 3B01A 4N9HA 4FPFA 2Q8OA 1BQPA 4OHXA 4XFFA 1W6PB 4WM8B 1RUE3 4Q2FA 3ZXLA 2Q1ZB 4S2DA 1G9DA 3GBWA 1WCDJ 3BALA 4XTMA 1O5UA 1COV3 1S0IA 4KG0A 3USUB 4S2GA 4XZPA 3KT1A 1A8DA 3HBZA 4YZ2A 1QOSA 1H2LA 4MXWB 4RS5A 4EV0A 1TNRA 1AL0G 5JOZA 1F8VA 4FSJA 1XQNA 2WLPA 3S6PA 5C33A 1OI6A 3E97A 1XNCA 2X5IA 4CEWA 3AMNA 2NP0A 4GWNA 1ENRA 1C57A 4LBNA 4UBGA 1AJKA 4XQ4A 4QPYA 3VUOA 4Y20B 4CDQA 1RUJ3 4U36A 1VAVA 5F6KA 5T3NA 4QPIA 1A6CA 3WQ7A 2A3WA 2JE9A 4E2GA 3RJ2X 4EN0A 3JQWA 1DZQA 1YJLA 3RI8A 1H8TC 3VDDB 2PLV1 2YC0A 3WP3A 5IK8A 1YFXA 4R52A 1ZVFA 3IDCB 4IEZA 3UJOA 4O9EA 2YYOA 2N7GA 4H3WA 1BXHA 4A3XA 4L9BA 3DPRA 3JCIA 3GF6A 3E6BA 1RVF1 2VOXA 1KDKA 3WG3A 4XTPA 1SQ4A 1LHUA 5A3MA 1RGSA 5KHKA 3FLTA 4JCKA 3V65A 1YFUA 1ZZBA 3B94A 3JD72 2ZX2A 3VHRA 4WM7C 1GLHA 3ST7A 2Z2SB 3VZMA 1UZYA 2NQYA 4YRDA 2RS12 4Q1RA 4RR3B 5CFCB 1IOAA 3VKOA 1HKDA 1UN1A 3V0AA 1X50A 1NLRA 1QOTA 4Q0PA 1IKPA 2ZCWA 3AZVA 4IV3B 4DPNA 1DBNA 2C5DA 1JXNA 4YVWA 1PNFA 5T54A 3J26N 1LOFC 4OUSA 2IZWA 4PDWC 3CO2A 5JZGA 5HXVA 1ULDA 1IPJA 1EP0A 1KXGA 1OOPC 2BGCA 1C1LA 1POV3 4BM8A 2WT1A 1HQLA 3KS7A 2PHTA 3DF0A 1H2MA 5KC6A 3HQXA 4UXAA 5GLVA 4IEQA 1FMD2 3H1WA 4JC1A 4JGZC 3VBOB 1XE8A 1VBB2 2RS33 4N43A 2IWGB 4H7LA 3VBUA 4SBVA 2OA2A 1O7FA 2HJIA 2QVSB 2ZHKA 4LBJA 2ZX3A 4TLFA 3VBHB 1Z7S1 4LBKA 3OD0A 3CJIB 1IKQA 1C8NA 1DYKA 1PO21 2HYKA 3DUIA 1REFA 5CU1A 4FPCA 1AX2A 2HWD3 1W0PA 3WW3A 5BNOC 2Y0IA 2QE3A 4OHZA 2WA4A 3TYJA 1HRI3 3R6SA 4LBQD 3RZZA 1BEV3 1HLCA 4LBQA 3E6DA 5FMOS 1K5MB 2I2SA 2JG9C 3MFAA 4KGGA 3BB6A 3PVNA 2D6NA 5FLHA 1PO11 1V9U3 4AVCA 4RHV3 3WP4A 1HRI1 1WCSA 4IV1A 5CFDB 3O12A 2PN5A 1ULFA 1TMF1 3RSJA 5KXCA 4ES8A 2NM1A 1RUE2 3D82A 2D6OX 1HV0A 3OYWB 5GZDA 3S7EA 3PTYA 4EWEA 1ZRDA 3VBSC 1M06G 2QJVA 4RHV1 2H6BA 1N1YA 1SLBA 2BNMA 2IXJA 1XNBA 4XBLA 1LOEA 1SCRA 2B9UA 3QLQA 2XJSA 5A32B 5CBLA 4GWMA 1S2KA 2WINB 2RS51 4LO8A 1D4M3 4EN9B 3VZOA 4JRLA 5ABJC 3WDYA 1L3JA 3C2UA 4LT5A 2B42B 4C1WA 3MYXA 3POSA 5JPNB 4IEWA 3WUDA 4XF0A 5J3UA 2D6MA 2OPKA 2VU9A 4HVQA 1R083 1OD5A 1DQ5A 4YGDA 3ACLA 1ZZ7A 4AVAA 1O5LA 1HV1A 4YW4A 4DINB 5L36A 1MZ5A 2A3YA 1ZZ9A 1JOJA 3V56A 2KM2A 2PHUA 2EAKA 1ZRCA 4FTSA 4LLFA 3MIEA 5JOYA 4CDUA 4L11A 4RGAA 3SISA 2ZGQA 3AZZA 4Q4Y3 3NAPB 3PLQA 4JTNA 4AHWA 1V6KA 1LJ7A 3CU7A 1U5IA 3BCWA 1XRUA 3FHIB 4G9SB 3R4SA 1RB8G 1ULGA 4PIZA 3ZFFC 2ZGTA 2XJTA 1YIPA 1AXZA 2WNUB 4Q29A 1NG0A 3GALA 5SV8A 2GNTA 4L97A 3LZZA 3OY8B 5GM0A 3B9IA 2XVGA 4JDMA 4P9GA 1W6QA 3WG2A 1UU6A 4FOWA 4AVVA 2GMEA 3AK0A 1UPSA 2ARBA 4YVSC 5GZFA 4JV4A 5BNPB 3VHOA 5J37A 3MF6A 3ZMOA 4R9DA 5A33B 4N53B 4S2HA 3R05A 5LEJA 1X82A 3VL8A 2E51A 1RJ8A 4HKWA 2TNFA 2CY6A 5DUUA 1CAWA 1WGPA 3M70A 1NQDA 1Z7S2 2D7FA 2W08A 5I0UA 4K21A 2Z79A 1PO22 1S0CA 2UWBA 4AQ6A 4QPGB 5GZEA 3ZDSA 1DGWX 1H8TA 4IEUA 1B35C 1QDOA 1R1A1 4PCRA 2BUKA 4FXGB 4OHYA 3FC0A 3EXUA 2WL1A 1UIKA 4ZU7A 3AYDA 1RMU3 4KWJA 1C5IA 4FQ4A 4MGZE 4FPOB 2QKDA 4LHKA 2R6QA 2DCZA 1CIWA 4QM8A 2GNMA 2JD4A 1JW6A 1Z78A 4JRAA 2HWD2 1C28A 1QJY3 5EV7A 1JTZX 3D6EA 2FZ1A 1HRI2 4L2NA 1F31A 2FHRA 4PBOA 3SLIA 3FX3A 2WIIB 4WM7A 4XJ9A 4P9LA 1AR91 4INDA 2DU0A 2CGOA 4HZFA 4E2SA 5DUVA 4LR4A 4MZUA 4BZ4A 4RHV2 1S1AA 2DURA 4AW7A 3ELNA 5LRRA 2MNGA 4GMP3 1AR61 4AHZA 5FO7B 3WD5A 3PJQA 4GKYA 1LOFA 4Q4W3 1B09A 3VKFC 3WG4A 2RHPA 2RS52 4PDWA 1PK6B 4A7KA 1H2NA 1EV13 1HRV3 2GH2A 2OIIA 3KCCA 1R093 1FT9A 1OOPA 2DCKA 1Q8SA 3KD4A 1PGL2 5K0UC 1RINA 5T5PA 4P14A 1DGLA 1MVQA 2R061 3AMHA 4ZU5A 2ZABA 1CGPA 1D4M2 4JGZA 2WNVC 2ZZQA 1TE1B 3NV1A 1AYN3 1AF9A 2XJUA 3H50A 3H9AA 5JCTA 1YNAA 2HWF3 1KQRA 4RS5B 1H1AA 4IL7A 3RDIA 3AP7A 1NQJA 4B7EA 1C3HA 4YFWA 1KFXL 1MS1A 3VGIA 4CEWB 5JSPA 1FI2A 1O91A 1X7NA 3OPZA 4FQZA 4XIOA 3ZXFA 3U11A 2HWF1 5T5OA 4CDQB 4I0BA 3WR0A 4FO9A 2DU1A 1QXRA 1ENQA 5I0SA 1SFNA 4QPIB 4ITCA 1PHMA 5JR7B 3W9AA 1C4RA 3OD4A 2ZZJA 1KJRA 2JG9A 1AX1A 3PNAA 2D43A 3A0KA 2CAVA 3JUUA 4LE4A 3WV6A 4AQTA 3WZ1A 4R4XA 1IS4A 3MW2A 1ALYA 1LOBA 4IERA 4OVEA 5EYXA 3NVCA 1ZREA 4P9IA 1N1SA 3UKTA 3USSA 3RYKA 3WNXA 1CN1A 4FPLA 4YM1A 1EPWA 2D3SA 2JXAA 3VKMA 1AR71 1AL23 3VBSA 3U07A 3VBOA 2EIGA 3DL3A 4FPKA 4URTA 5I0TA 4RD7A 1KITA 2GC2A 4K8FA 4GH4B 4XIKA 5ABJA 3V0AB 1RUC1 3NV2A 4EN7B 2WWSA 3N7KA 4YVWB 4KL1A 4EN8B 3OGGA 5GZGA 1LOCA 1R1A2 2XB6C 5KBFA 2P37A 2PAEA 2XGXA 2WKKA 2WZPP 1LHVA 1J3QA 3TOJA 5F5QA 1GYKA 2YGMA 2YXSA 5JZGB 1OQEA 3MEPA 2PQQA 4WZCA 1CAXA 5C8CC 5FBZA 4FT8A 5FQ0B 4HN1A 3HAGA 1RJ7A 5JMCA 4NVPA 4WVWA 3AYCA 1X8EA 3SMHA 5GZCA 4YG0A 1F2NA 1SBEA 2XHKA 1N1TA 1TME3 4BLJA 2XLAA 4O9GA 2VW2A 5IUQA 1MZ6A 5D1IA 1RMU2 1NA1B 4N43B 3FBMA 4YNIA 4AFAA 1VBA3 2BTVC 3S7IA 4AF9A 4TZDA 1MEC3 4GALA 3VBUB 2R32A 4QGMA 2CGNA 4Y1YA 3ZFGB 1LKNA 1MS9A 3O0XA 3RJRA 2D93A 4NR1A 4AG4A 2OUJA 3ZFFA 4YW1A 3CL1A 4CYDA 5D8AC 2RMU1 1NOVA 1QY4A 1AR62 5H9PA 4ZXKA 1VALA 4F8AA 3GZAA 1MEC1 2GN3A 1RC6A 2OZ6A 3UKNA 2HEWF 2XLGA 2GNDA 4DMIA 1TNFA 1O3RA 2JG8B 2BFUL 2NPIA 4QU2A 4LBQB 1ZNPA 2D5FA 4MSVA 1GQHA 4SLIA 5BNNC 3ENRA 4FPGA 3J8F1 4YVSA 1AZDA 4Q4W2 1V6MA 2XBO1 3WP6A 4DFSA 1HRV2 1EV12 1WD3A 2ZJCA 3VBFC 1MZEA 1ND3C 3NV3A 4E4ZA 3PJYA 1R092 3NWKA 1DGWA 4DB5A 4IV1B 4I30A 5KHJA 3BODA 5BY5A 1BBT1 3D0JA 2JE7A 4Z92B 4JGYC 5DZFA 4AI3A 4F7ZA 1A8MA 4AE2A 1FAYA 4YLZA 3QACA 1AYN2 4CP0A 1B35A 1VP6A 2HWF2 3PMEA 1FPN1 4OHVA 5H9QA 3LOBA 3GBGA 4FPJA 2UWCA 2D97A 4I3PA 3N7LA 2D3PA 4YM0A 4CTEA 2VH9A 3V0BA 2VMGA 1GICA 2YZ4A 4X8NA 5AC91 3B00A 1RTVA 3SCGA 1YI7A 3P3PA 4K7JA 1GQGA 1VRH3 5L73A 2O8OA 1G6NA 3ZN5A 4QQPA 4Y26A 1UKGA 2QUOA 4M3CE 2QDRA 3MGUA 4HKOA 4W65A 4IEOA 1MR5A 4D7SA 1NLSA 1AR72 4NOTA 2A6XA 3RYRA 4CDUB 2RS13 1JN2P 2D40A 1ZBE1 4Q4V3 4HSLA 3M2MA 4KWLA 3HMYA 5HCAA 5HCFA 2RE9A 4RSUA 4K20A 4NHLA 1RUC2 4YG6A 1DQ0A 2PYTA 4RGGA 3WHUA 1AL22 3VBRC 3Q9OA 5DUXA 2Q5TA 1JUHA 3DV8A 5K0UA 1A3KA 1UKRA 2A6VA 4QT6A 2RR11 3VV1A 1NY72 1WMDA 4AGVA 4KQ7A 1DGRA 1W6QB 4CDWC 2P34A 3IDEA 5CAZA 2YHJA 2WNVA 4OI2A 1Z0HA 2FMDA 1VBB3 1WMFA 4S2FA 2P17A 4D3WA 3WLUA 3RPQA 3M8LA 1D0GA 1V6LA 1LU2A 5GLZA 4Q8LA 2A5ZA 1IQAA 1DG6A 3LA3A 2ZX4A 5KHIA 2A6WA 4N9IA 5K7PA 3KM5A 1CAWB 3I54A 2R041 4OHWA 3N7JA 3ZXJA 4B3NA 3ZSMA 1JHNA 5C9AC 2VVFA 5EYYA 4COZA 1VBA2 3NJZA 4HT1T 4I02A 1PGSA 1CAVA 1MEC2 1YYNA 1H8TB 4MH0E 5K9YA 4GA9A 2SLIA 4QMAA 4JTOA 1OQ1A 1PK6A 1YUDA 2I74A 4TYSA 1S0GA 3J8F2 4ASLA 5BNQA 4ZKTB 3ZMNA 4WVZA 3ZYPA 5E8AA 1GBGA 3S0MA 3UL2A 3VHPA 3JU9A 3WXPA 3L9JT 1IHMA 4I2OA 4XMAA 4WM7B 1UIJA 4Q26A 1RITA 1WUVA 1OQDA 2YROA 4CZSA 5DG2A 3AFKA 3NSTA 4M3CF 3HR9A 1DLLA 1YI9A 2XJRA 3ZVXA 3IDBB 3RNSA 1MACA 2B39A 4PDWB 5FTTC 2PLV3 5FO9B 2WQZC 2MHFA 3FFZA 2WZR1 5C8CA 1OOPB 1HQNA 1KRIA 4QM9A 2YV8A 4K40A 3HIFA 4I01A 3ZX7A 2JDZA 2TUNA 1Q3EA 1ULCA