4QD2A

Molecular basis for disruption of e-cadherin adhesion by botulinum neurotoxin a complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
247
structure length
224
Chain Sequence
b'ENIQEINTAISDNYTYNINNPFYILFTVNTTGIYKINAQNNLPSLKIYEAIGINYITGFDSPNAKSYLVVLLNKDKNYYIRVPQTSSNIENQIQFKREEGDLRNLMNSSVNIIDNLNSTGAHYYTRQSPDVHDYISYEFTIPGNFNNKDTSNIRLYTSYNQGIGTLFRVTETIDGYNLINIQQNLHLLNNTNSIRLLNGAIYILKVEVTELNNYNIRLHIDITN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hemagglutinin component HA33
publication title Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Cell adhesion
total genus 48
structure length 224
sequence length 247
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17993 HA70_C Haemagglutinin 70 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1090 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qd2A02
4LO7A 4LO5B 2ZS6B 4EN7B 4EN6B 4LO8A 4LO4B 2ZOEB 4QD2A 4EN8B 3WINE 4EN9B 4LO6B
chains in the Genus database with same CATH superfamily
5IK8A 4IEWA 2NPIA 3LDKA 1WCKA 3T4VA 3BIEA 3TAYA 1A34A 1LULA 5FZOA 4CUAA 2RR12 3J7LA 3ZYHA 3GZEA 1ND2B 1KS4A 2XQRA 1CR7A 2ZMKA 1VB2A 2VUCA 4S2DA 1D4M1 4P9LA 1RUC2 2YBPA 1AR83 1Q8OA 2DVBA 5JPNB 5FY9A 4CA9A 2UYBA 5K8SA 2ZEZA 5BYNA 1Q8QA 3ZN5A 3M3QA 5C9AC 4FFIA 2B42B 5LBFA 2YYOA 3HEIA 3M3IA 1H8TC 4BM8A 1AYM3 1MS1A 4QX5A 1YFXA 4QM8A 1OLMA 5E1RA 4FPGA 4COYA 1HB1A 2VCCA 1YQ8A 2EXJA 3MYXA 5GLWA 5A3WA 4OFGA 3EHKA 4B29A 4QKNA 3VKOA 2WWSA 1FOD2 4IDZA 2ZEWA 4QGNA 2YPJA 3RRDA 1V6IA 4ZXEA 2DBNA 4YSFA 4L8QA 3AMQA 1DZQA 1JU4A 1VBA1 1LEMA 4CU9A 1J83A 3N9LA 1PM7A 4FO9A 2WFF1 5A7NA 3NMBA 2JKXA 2JG9C 2VJXA 2WZR2 2ZAAA 1XNAA 4CDUC 5FJKA 4G4FA 3UYJA 4C90A 1A78A 1K5JA 2VBDA 2WNVA 4QAWA 3WCRA 1FMD1 1S2KA 3GALA 3R05A 4Y33A 5C9AB 5L7OA 3M7AA 1JYNA 2G4IA 1H8TB 2R1BA 4N43A 5JOZA 1GWKA 1ST8A 1VBC2 2PAKA 4V2VA 5KXCA 5IAVA 4XW3A 4Q4X1 4JQRA 3C7OA 4A4AA 1V6MA 3HT1A 4BQYA 4ES8A 3J4UH 1AR91 4RS5A 4CEWA 5FXVA 5A3LA 1AYN3 2XVGA 4IUGA 4JRLA 3Q8CA 1MZFA 2CNAA 2JG9B 4XMIA 3RMYA 4NWVA 4ATFA 2UURA 4YM0A 2ZTNA 1LGBA 3SITA 3K48A 1DHKB 2QNKA 5LBBA 4XTMA 4E2GA 4DY5A 4L99A 4LBQD 3FHQA 4AW7A 2OVUA 3E5QA 3ZN6B 4YM2A 4C8DA 4IE4A 2VCAA 1JN2P 2LM3A 3TEYA 5LY2A 2RM22 1A8MA 5J3UA 1O3SA 2UY8A 2QQPA 4K1YA 3VBHA 3KT4A 2XONA 5FZDA 2W1QA 3N9QA 1UY2A 1PO22 1BBT2 1CZSA 1BHGA 4BZ4A 3V65A 4GAZA 5DABA 3N36A 3I3DA 2P4EA 5FP4A 2Y60A 3NNFA 3HN1A 4NRMA 2O8OA 5CB7A 1RITA 1IHMA 3D82A 5GALA 5IHRA 1W8OA 4IEQA 2LS6A 3TEZA 1FNZA 2ORZA 3NSTA 3OBRA 2Q4SA 3GZUC 4KWLA 4XJ9A 1UPSA 3KCXA 5A7QA 3VLBB 4MYEA 3BTXA 4PF1A 4G9SB 4Z1VA 3MI8A 3ZXJA 3ME2A 2ZX4A 3T09A 2JDUA 2A3WA 4YPJA 3VZNA 1H9WA 3B9CA 2HWF1 3K4AA 1ZZCA 4IE5A 5AFBA 4QHZA 2DTWA 4FQ4A 2OUHA 1AX0A 4HN1A 2V09A 2PHDA 4JKKA 3BU7A 4IEZA 5HCAA 3I4IA 3VDDA 4C1WA 3IDCB 4UW4A 1Q5OA 2WS91 4IE7A 1ZZ6A 1VBE1 4W6YA 1C3HA 3SEEA 2GZWA 4QPGC 4BIFA 1IS4A 5LB6A 2QQNA 3JZVA 5JVVA 1TEIA 1DDLA 1OURA 4NHXA 1O5LA 4CEYA 2W1UA 2Y6LA 1POV1 3CU7A 5FV3A 3ZYPA 3A0NA 3THCA 4CCOA 1X36A 2W5FA 3W5NA 4IXLA 1ASJ2 1RUI1 3EMRA 3DECA 4Q4Y3 1ND3A 2NM1A 3TN91 1MEC2 3TYJA 2WN3A 2YPDA 2WNUA 2ZA9A 1J84A 4HZFA 4XJAA 4DXTA 4ZS3A 5JXJA 1G9CA 5FMDA 3DUIA 4BB3A 1CQ9A 2YV8A 4A41A 3I3MA 2XPJA 1NE6A 4MXVA 2XH6A 2YMZA 4H55A 3S7EA 2RHPA 4QPGB 4EN0A 4AL9A 4KU8A 1HX6A 2E53A 1RVF1 4PLNA 4I0BA 3KWVA 3OGVA 2XGXA 4GA9A 4XJZA 1GSLA 4NHYA 4FXGB 4YW2A 1QDOA 2GH8A 1OKQA 1QMJA 3NWKA 1HJGA 4JRAA 3WX5A 1YYNA 3AL6A 4COWA 5JAXA 1FX5A 3CF6E 3VBFB 5FY5A 3J8F1 4XQDA 2W2IA 5FXXA 3R4DB 3HN3A 3OOXA 1S0IA 2VECA 1DQ6A 1H0BA 2DCTA 3MBWA 1JYCA 4R4ZA 3TNPB 1RUC3 3A21A 3B00A 1COV1 1WGPA 1F5JA 5L36A 1QDCA 2BRTA 1Q56A 2J1RA 3WNNA 1OKOA 3K51A 2ZMLA 2V4VA 3LDBA 3CO2A 2JIJA 5EHDA 1K5MA 1MZEA 1EV13 1MQTB 2ZHKA 2HWC3 4XDPA 2VQUA 3WW2A 4DEVA 4UFIA 4DXRA 4JV4A 5H9RA 2ZXQA 2C5DA 3AZYA 2R071 3NVCA 2R0FA 4I30A 5IK4A 4BLIA 4WVMB 2OW4A 4YM3A 4EN8B 1IG3A 2HWE2 2LALA 2DU0A 3AZVA 5IT6A 2V73A 4JQTA 5DN2A 4BCUA 3AK0A 1ZBA1 1PVC3 1OD5A 1TMF2 2ZGPA 3R4UA 4OI4A 2WZR3 2ZGOA 4Z07A 3B5LB 4L11A 2Q30A 5FYUA 3GJBA 3PUAA 1SFYA 4FBFA 4AGVA 1FPN1 1US2A 1W9YA 4MHRA 4XF4A 3O14A 1CAUA 2VGDA 1RJ7A 1WW4A 3LIGA 1N3QA 5F5CA 4WM8A 1C8NA 3OYWA 4CCNA 3ZR6A 3UJQA 3RZLA 3ZSJA 3CHXA 1G7YA 5FPUA 3ZFGC 2P3KA 3VZMA 3VKMA 4CRQA 2RS13 5FUNA 1SBDA 4ITCA 2I2SA 4PF5A 4RFRB 2VUDA 2RJLA 3PVNA 2CWSA 3HMYA 4XILA 5FBZA 4NPMA 3POBA 3T2TA 3OGRA 3KS7A 4UW5A 2W08A 5AC91 4YVWC 2W9XA 1EUUA 1SQ4A 3DYPA 4GALA 1W2OA 5CZKA 4Q4W1 3E6BA 5FZOB 1N3OA 1AF9A 4RFT0 3A4UA 4FFFA 2ZX2A 4DUVA 3K3OA 4LLFA 4D8MA 4XFHA 4CCJA 3VHNA 3ZFGB 2VMCA 5FTTC 1XE0A 5CIRA 1NZCA 2C0ZA 4KWUA 1RMU3 3J26N 3VD5A 2NYYA 4AE2A 4QD2A 1J1TA 2C24A 4KWJA 4AQSA 1HQNA 2WNVC 3D5OA 3H42B 1UIJA 4JTNA 4Z8BA 2RS53 4CCMA 3SH3A 5FYIA 3VBUC 5K0UA 2BWAA 5BNQA 1BJQA 4MHUA 1GP6A 1H4HA 1G8WA 3IB3A 4FOYA 4GB33 5JZGC 2VL4A 5FZLA 5LWBA 1CJDA 3UL2A 4R9DA 3BU0A 4YVWB 1R092 3U4XA 1IOAA 1HRI3 4L92A 4Q27A 1X33A 4H14A 3ZKYA 5JLVA 1JZ8A 1H8VA 2ZGSA 1J3PA 1W03A 3AZWA 3HQUA 4JKLA 2ZX1A 1WWYA 2PHRA 1PIV2 1O8PA 1N1YA 4LTAA 4QXHA 1SEFA 3NL1A 4OQ9A 4UFMA 3OEAA 5D2AA 2V5YA 1MVEA 3CJIC 1AR71 5A6XA 1R081 2CSGA 2AREA 2QFEA 3RZKA 2VNRA 4I0AA 4Y1YA 1S4CA 3POIA 1MACA 3C7EA 1HDKA 2WABA 2WNVB 2Q8EA 3ZIXA 1Z7S2 5FK8A 1JZ7A 4JHZA 3RZHA 3T2OA 1XNBA 3VBUB 2VQAA 4YW4A 5EPAA 4BOWA 4ZZ5A 3VV1A 4PI0A 5JZGB 1QOSA 4QPIC 4I01A 3WV6A 4XJWA 3I49A 3S30A 1CN1A 1JYWA 3ZR5A 4K21A 4UBHA 2VY0A 3KVAA 4W6XA 3KM5A 4Y4RA 4QX0A 2CHHA 3JD72 2RE9A 3ZFEA 4DFSA 5DDJ2 5JSRA 5CG8A 3VZJA 4XIOA 1TNRA 3RMXA 2PQSA 2DCYA 5FMOL 2XOMA 3KVBA 4QB6A 3CJIB 4WM7A 2HEWF 1ZRCA 3BTZA 4B1MA 3MIEA 4BA6A 2OZJA 1WZXA 1U5YA 5LK7B 2Q1MA 2QKDA 5F8PA 3AP7A 1BK0A 1W0NA 4QPIB 4K8FA 3VZOA 2KXLA 3LZZA 4D6SA 3FMGA 5DAVA 3AXEA 1RJ8A 2JD9A 3P6BA 1WA4A 3NKGA 1QJFA 3ACGA 4CZSA 2C4XA 2EALA 2W92A 3AMMA 4PIYA 1LU2A 3ZSLA 4P9IA 1AR61 1HQWA 3OBTA 2R1DA 3R4SA 4GKYA 2Q8CA 3SCGA 5FZHA 4OZXA 2PYTA 5FYYA 2VOWA 1AL23 4XURA 1X8MA 2J1EA 1A3KA 2PHXA 1XXNA 3O0WA 5L9BA 3Q8EA 2FZ1A 5FKBA 4FFHA 1KDMA 4XF1A 3K4DA 1Y9GA 3VDDC 1JOBA 1R1ZA 4CUGA 2ZGRA 4BWOA 5FPBA 2VMEA 4GMP0 3AMPA 4Q29A 4A6OA 1F35A 1RUG2 4CPBD 3AB0A 2D6NA 4IL7A 3ZYIB 4YWAA 3W59A 3RI9A 3P5BA 1RVF3 1ULPA 4NHKA 4ARYA 5A3NA 1UU6A 1PZ9A 2JWPA 5LK5A 5IYYA 4TTGA 4M4RA 4A2UA 2EAAA 1PX4A 1TME2 3NV2A 4RGKA 1D2QA 4LBLA 1QJY3 4CSWA 1ND3C 2WNOA 3DPRA 5C3QA 5KXDA 2R043 4RD7A 5KHKA 5C9AA 3KGZA 1LOAA 2A1XA 3OD0A 3VDDB 1XYNA 1H8TA 5HCHA 5FWJA 4KNCA 1LCLA 1W6PA 2HWB1 1KFUL 2RG4A 3USUA 2VW1A 4RHV3 4IEPA 1WCQA 3ROUA 2TNFA 4MO3M 4DMIA 5FREA 2Y64A 3LE0A 3WD5A 2JE9A 3HVDA 5GLUA 1LGCA 4DNYA 1L7LA 4RQPC 1QQP2 4MV2A 1ZRFA 1ENXA 2D97A 2JG9A 4QXCA 2D40A 3AYCA 3WHUA 3PNAA 1K3IA 1BZWA 2FCVA 2PLV1 1FATA 4A6SA 3I8TA 1ND3B 1VBD3 2J22A 1PO11 5HCBA 4EV0A 4LBMA 1NX9A 2B45X 2E6VA 3GNEA 5ANNA 5JDBA 2YGMA 2DVDA 4MX3A 4Q0SA 1WD4A 1ZZBA 4QXBA 3OG2A 4Y20A 4QT6A 1O4ZA 1SG3A 4B1LA 1U5ZA 4XUNA 4EWEA 2ZGUA 2BGOA 5F3IA 1AR82 4BMEA 5JI9A 4P14A 1WW6A 1UU4A 2D3RA 3TBDA 3EBRA 2WYFA 1BKZA 4J6GA 4RQPB 1TNFA 1VE0A 4Q8KA 4OQ8A 1RUNA 1J3RA 3KT1A 3LKJA 4QWNA 5FPLA 4FI9A 1VIWB 2J1TA 1NKGA 1BEV1 4E2QA 1AYM2 1LECA 2LW8A 5T5LA 4QU2A 5FQ0B 2LUWA 3D0JA 1K12A 4JDOA 4AHWA 4UBGA 3WNOA 4MGTA 4CP0A 2BW8A 1AXKA 3GBGA 1PGW2 4D0QA 3BCWA 1OA2A 4J1WA 3AL5A 1RXGA 1ODNA 2HWD1 3BOWA 4KG8A 5DUUA 5FYCA 5FO8B 3PIJA 4COUA 2IFRA 2SBAA 1RUD1 1V6NA 4XABA 3A0KA 4WM8C 3IT8A 2HYXA 5KC6A 1J59A 2QDNA 3T08A 2Z42A 4A7KA 3RYPA 4Q4W3 4R52A 4N90A 1OLRA 4NMIA 2VMHA 2WQZC 4XBNA 5G05L 3WG3A 3ES1A 4W4ZA 1QOOA 2XJPA 5I93A 3MW3A 1CWPA 4HT1T 2YC0A 4LORA 5ACA3 4CUBA 4GKXA 2R49A 3I97A 4Y1ZA 4YFWA 4AFCA 5FBJA 1W8HA 4AHYA 2VULA 1Z0HA 4J25A 4EWAA 4YW1A 1O3QA 5LRRA 1YI9A 1QJU1 1UO9A 5FY7A 2GMPA 2K9ZA 3ZXEA 1F9KA 1O4YA 1VBB3 3ZXKA 3O1MA 1N47A 1CAUB 4ZY9A 1PMJX 1ZZ9A 2J1UA 2JE7A 3BALA 2X53S 3FJSA 2VZSA 4FXKB 5F6LB 4CCKA 1MPXA 3H8XA 5J96B 4WM8B 4BQXA 1W39A 1ZA7A 3HR9A 4LT5A 5EYYA 3JBG1 2WC2A 1EAH3 4YZ1A 4XIKA 3C8XA 3DV8A 2EXHA 3FHAA 5JSOA 4XCAA 3S7IA 1XB9A 2FD8A 4Y3OA 5A6QA 1HN0A 2PXJA 4TSVA 4AVVA 2VO5A 1LEDA 4TXWA 4DRVA 1UZ0A 4LPLA 1GV9A 1NY71 1S0JA 1XE8A 2WFPA 4LKFA 3J7MA 4SLIA 4CU7A 1QIQA 2ZABA 1ZRDA 4XFAA 4QPGA 3O1UA 1ULCA 4YNIA 3AYDA 4C0HA 5L9VA 1CESA 1ZBE3 5FJHA 5FP3A 4QXKA 1YUDA 2XHNA 1H2LA 3P3NA 5FFOC 1GBGA 2A6XA 2VUJA 4SBVA 2Y38A 3PVEA 3S6PA 3ZYGA 5I0SA 1W04A 1VRBA 2J7MA 3L2YA 2XR4A 1R1A3 5GLZA 3VBFA 4X8PA 4XUTA 3MO4A 4DZGA 1KD7A 2CGPA 3E6DA 1RUE3 1YQ5A 3VD7A 5DAXA 2B9UA 3OF1A 2BGCA 4HSJA 1LHNA 4NHLA 5FPVA 4F7ZA 2HLEA 1HLCA 3HNYM 3E5UA 3WW3A 2XJTA 3WNMA 3AVRA 2YGLA 4FT8A 1O6UA 4K7JA 4Y1XA 3RS6A 2WIIB 3IIAA 4XETA 3TB0A 2JENA 1W9SA 2ZHNA 1YFUA 2P3JA 4XTPA 4UT5A 3WZ1A 2B39A 1C8M1 3TEXA 2ZAHA 2XBO1 1V00A 1OF3A 1QNYA 3ZFEC 4Q0UA 4W65A 1O3TA 1MQTA 2UWAA 2WBKA 2AR6A 2W68A 2QQOA 2CAVA 3LPFA 1RUF3 3A7QA 5EJ3A 4DXSA 2QTWB 2XVKA 2R16A 4WVMA 2ZGTA 3RPQA 3VZKA 1DZTA 5JXHA 4P9JA 1WBFA 3OUHA 2NMNA 2VTFA 5FPAA 3C7FA 1KGYA 3OCPA 5CKQA 4OULA 4LO5B 1L7QA 3NW4A 1WLWA 2JD4A 2EIDA 2BNMA 3IIIA 5FZ4A 2QQIA 2X09A 3O1PA 1IS6A 4XZUG 1HRV1 4E9KA 1YO8A 3ZFEB 2X05A 1BMV1 1VRH1 5EP9A 3OBAA 3FE5A 4KMQA 1Q8PA 3ILNA 1RGSA 1XRUA 2E32A 2BVBA 3AYAA 5CKNA 3AVSA 1OC1A 1QJEA 4OVEA 4Q4Y2 5E6HA 5FZCA 3VL9A 1QJX3 2IXIA 5A32B 3FWEA 2UYAA 4RL7A 1QXPA 3DL3A 4CCEA 3HNMA 3PVOA 3D6EA 4PQ9A 3HD8B 1QHDA 1YQ6A 1ENRA 4AYUA 1XBFA 1RIRA 4DRRA 4FTBA 1UZWA 2EIGA 1UX6A 4P9GA 1M06G 3MGUA 1GNZA 5E88A 2X5IA 3POJA 2AACA 2RR11 2EF6A 1UQXA 1W99A 3WQBA 1FYUA 4YYOA 4LHLA 1C57A 1YFYA 3WVJA 1GZWB 5F5IA 3ZFGA 2FCTA 2UWBA 2VAUA 2JECA 2Y6GA 5IVYA 2RDRA 4NIIA 1JI6A 1BYHA 3BIWE 3KZ4C 5DUWA 3UT0A 4CUCA 1OF4A 3IMNA 4IV3B 4AQ2A 1I5PA 3ZPYA 5B2GB 3DPRC 1NE4A 3WQ1A 2PLV3 4B4PA 3FN9A 3LQCA 4NPLA 1CAWB 2Z2SB 3U75A 3U1XA 4QQ2A 3B02A 1ZREA 1NAEA 1F4AA 1EV12 5TSWA 4YVWA 2HWC2 5FO7B 3A23A 3AMNA 2R0HA 3VB9A 3RQ0A 1FOD1 1YCIA 5IJRA 3ZFFC 2NQYA 1MZ6A 2DVAA 1X7NA 1D4M2 2E26A 1NLSA 2W3JA 1WCDJ 4CP2A 4E2SA 3POGA 2IXJA 1PVC2 1W90A 2UY9A 2WRAA 5IUQA 4KQ7A 2HH9A 2HEVF 3M3CA 5AVPA 5JIAA 4Q8LA 3SEPA 3INAA 3DPRB 2Z69A 1NCQC 5HPOA 3VBUA 4V2WA 4H2AA 4LITA 4BH9A 3VBSC 3P3PA 2HKXA 4HSLA 1VBC1 4BK5A 5F9TA 5JZGA 1W6PB 2DUPA 1RHI3 1IGOA 5JCTA 3ZXGA 1XE7A 3USUB 1HXS3 4LK6A 4GMP3 1ULDA 1KXGA 1UY1A 1LR5A 1VAMA 5EYXA 3T1MA 2RS12 1XSRA 3SCHA 3ZFFB 5J1XA 1LGNA 1O59A 1VBA2 2DF7A 3THPA 4CXYA 1V9U3 3OY8B 3MV01 4UYBA 1O4TA 3B94A 2E31A 1UOFA 2ARBA 4FVVA 3TRSB 2RMU3 2W95A 3CJIA 1H2MA 1H4GA 3O1VA 4LJHA 2XKOA 4NVPA 2FHRA 1M4WA 1ZM1A 3WQ0A 3IN9A 4OI1A 4IE0A 4PIZA 2IZWA 1NCQB 2C6SA 1S2BA 2D98A 1W9TA 4MGIE 2F4PA 4Q4V3 4MSVA 4ASLA 2VMDA 4CP9B 4FTSA 1I5ZA 3VBSB 2TBVA 4ZXKA 4AXOA 1H9PA 3HWJA 1H1IA 3HNBM 4QPIA 2E51A 4Y20B 1QJU3 4MUVA 3WF1A 2QCSB 5C7GA 3MPPG 4ZHNA 5FKCA 4Y1VA 1SCRA 1S0BA 4YGEA 2RM21 3KMHA 1RMU2 2E7TA 5FZKA 1IKPA 1W8NA 5BV6A 5T3NA 2N7GA 2VZUA 4F83A 1LODA 2BV4A 2PELA 1JTZX 2Z79A 4LIVA 2RS52 4XUPA 4LO8A 2YB7A 2VCMA 1PO21 2ET1A 4URAA 1BBT1 3VN4A 1CGPA 5LBCA 1HJFA 3LEMA 3O7OA 4CE8A 4GB32 5A3UA 3WF4A 5T52A 4YZ2A 5GZGA 1BXHA 1HRI2 2DUQA 4P08A 3PMSA 1UYXA 3EJKA 1JOJA 1GP4A 4O9GA 3UJOA 1GKBA 2H6CA 5FZFA 4JDNA 2YY1A 2O0OA 4OHXA 3UV9A 1L7RA 2O1QA 4O65A 5L19A 2XUEA 2WJSA 1NQDA 1BK1A 4JGZC 3W20A 4UI9L 4ET7A 2VNOA 4K1ZA 5E16A 4XACA 2QE3A 3APBA 3CBNA 4B4RA 4AR2A 3AC0A 4GZ9A 1LTEA 3B69A 3RI8A 3FUQA 5KHGA 2DCZA 2BDRA 5H9SA 3I2FA 5F1RA 3LF7A 2WYSA 2OKXA 5I91A 2LRPA 3U07A 1GICA 5FZMA 5LZ6A 3ZDVA 2ARAA 1BVVA 1EPZA 1S0FA 1FXZA 1ULGA 4P5HA 4K3UA 4I2OA 2FZ2A 2B5HA 4H7MA 1ZRIA 3QD6A 5GKAC 4Y5SA 2VTXJ 4D7TA 1FV2A 4OUMA 3BKZA 3LEGA 4FAGA 4E4HA 2XQXA 3R0RA 2ARCA 3H50A 1XNKA 5FPXA 4JGZB 2WSUA 4IGPA 1HB3A 2XDVA 2KA3A 3M1HA 3NO8A 4LXLA 1US3A 3LPGA 3KGLA 4OUEA 4URTA 2X8KA 2BERA 4UW6A 5IFPA 1LOCA 4B7KA 3VBFC 2W39A 1JBCA 2DBIA 1RC6A 3B93A 3E5XA 5GJ6A 3WT3A 3IBMA 1LRHA 4L0PA 1MEC1 4XQ4A 5BNPC 2VOTA 4UFJA 4MG2A 1UXXX 4Z92B 4R9AA 3L2HA 2VBBA 1DGRA 2QZ2A 1PX3A 2AZ5A 3DCQA 4Y24A 4HFSA 3TWIA 2ERFA 2G19A 2GP5A 5FAXA 2PAMA 1DP0A 2GH2A 2XHKA 1Y43B 4IE6A 1CPNA 2XG3A 3AP6A 4BYYA 1AL22 1NXMA 2R061 2JJ6A 5J36A 5HBAA 1HRV3 3RVHA 5HV4A 1PMIA 3JXSA 1SLTA 3WXPA 1MQTC 1UCXA 2GALA 5D8AC 5A3OA 4BDVB 3PU3A 4XDOA 4LHSA 4RQPA 2DYCA 1X9PA 5C4WA 4ZU7A 1TE1B 3H9AA 3NJVA 2WQ8A 2ZKLA 1IKQA 1WCUA 3WDVA 1HB4A 2WT0A 5IVJA 2NLRA 4LOSA 2RJ2A 1VP6A 3AM2A 2H6BA 4K6BA 5FZ7A 5BNPB 5FQ0A 5I0UA 4IV1C 4QQLA 1RL3A 1OLQA 3RJRA 3V64A 2JDHA 1ULEA 3MW2A 1RVF2 4OZOA 2IC1A 4MGZE 2HBUA 3M3EA 4ONUA 1CIYA 3SMHA 3KQRA 4EN6B 3ZDSA 1TQ5A 3FBYA 4YG6A 4MVTA 2IXHA 4E8CA 4Y4YA 4ZU5A 1CONA 2Q1FA 5L9RA 4QHOA 1N1SA 2I07B 4AI3A 1QJY2 5D8AB 4D69A 1XSQA 3POSA 4R8HA 3UESA 4YGDA 2JDYA 2R042 1ENQA 2HBTA 3SKVA 3M2MA 4AVSA 1UWWA 2XWJB 1D4M3 2HWE1 4HPKA 4QX2A 1JZ6A 4LBNA 1TMF1 4M3CB 4NO4A 4LHNA 3ZKUA 4IV1B 1G9BA 3H8RA 4RHV2 4CVUA 1JUHA 3O0VA 4TLGA 3ZYJB 3LFMA 1EY2A 2GSYA 2VQ0A 5JI7A 1IPSA 1YIFA 3QOPA 2P37A 1WMXA 2X5IC 1B09A 3HPNA 2E33A 3FLRA 4HMZA 4FPYA 1DBNA 1KJRA 2JIGA 2OZ6A 3THTA 1URXA 3G6JB 3AX4A 1YNAA 3BODA 2Y6HA 4OHYA 2XKPA 1VBD2 4I0WB 5CKMA 3ZYBA 5JSPA 1VBA3 5EWSA 1SDWA 2WFF3 3H1MA 2H0VA 4Q2FA 3KB5A 1CZVA 2JDPA 3I2JA 1G9DA 2WZPP 2JDMA 3RZGA 1B35A 3O1OA 1DU3D 1FMD3 3OTFA 1DZRA 3MICA 3NAPC 2GAUA 3FBMA 1OPMA 4GWNA 5D21A 4YGCA 5CAZA 1ALYA 3NRUA 5JXGA 1EP0A 2VZOA 1LB2A 2X5IB 1W2NA 4D7YA 2B7YA 1GOFA 2Q5TA 1NA1A 1D4VB 1KQRA 1N1VA 2PAEA 2VUAA 3MIFA 3NNGA 4Q4X3 1FT9A 4OHVA 2A70A 1MS4A 5C33A 3O0XA 1QU0A 4FOVA 5JOWA 1AR93 5K9YA 3IM0A 1D0HA 5HI0A 3GHMA 2QQJA 2XJVA 5IFTA 3PIGA 1NUKA 3GZAA 3HQRA 1CAVA 2W91A 4UOJA 4E4ZA 1DG6A 2QZ3A 4Y1UA 1W06A 4XPVA 3UGGA 1XPWA 1CIWA 1LJ7A 5FWEA 2BNOA 4FPCA 4YZ3A 4YARA 3NAPB 3VHPA 3CNAA 1OFSA 2Y26A 1AX1A 4GULA 5ISLA 2W94A 4Q4W2 1R091 2VE1A 3PUIA 2WDBA 4U2AA 2ZZJA 2IFWA 3RZZA 1U0AA 3BOPA 5F2SA 2XJUA 4C0BA 5A70A 5ACA2 3H8OA 1F5FA 1WMFA 1PIV1 1E5SA 1DGLA 1OD3A 4QDRA 5SV5A 1O3RA 2XLAA 1OMIA 2FMYA 2WT1A 2YFUA 4I3GA 5D1IA 4CTEA 3FHIB 3MIGA 4PDWC 1V6KA 2ZBJA 4TLFA 4F3JA 4Z2WA 2GP3A 5BNOC 2ADDA 1Z7S1 5K4LA 4BISA 1VBB2 3MW4A 1UYZA 4GWJA 2MEV1 1VMJA 1REEA 2VTXA 4FPKA 2OIIA 4XDQA 1D2SA 2RDQA 4MGSA 2XJRA 2BEOA 1DFQA 3ACLA 2PFWA 3N9PA 3AP5A 1EAH2 4K40A 1FNYA 4FPLA 3OGJA 2G9FA 3DN7A 3JD71 5HXMA 1F31A 1AX2A 2A6WA 5DDJ1 3H3LA 5CEHA 1SBFA 3VD4A 3BPZA 1AR72 3NV1A 3I54A 4PQQA 4V1PA 2V4AA 4XUQA 3SH5A 1QXJA 3RJ2X 4QGLA 5A32A 2ATFA 2KM2A 3PVBB 1UW8A 2A6YA 2VZTA 3IPVB 2PQQA 3JB8A 4KU7A 3ATGA 4PDWB 2BJSA 2HWF3 3NJYA 4FPOB 4ZPIA 4ASKA 1ODMA 4F8AA 5BNOB 1GMMA 1RUJ1 4AI9A 2NMOA 3POYA 4JX0A 2Y6KA 4N9IA 4LK7A 1W0OA 1O7FA 3GHNA 4I02A 4Q1PA 3QBQA 1ZBE2 1LOBA 4LR4A 4HG6B 3WF0A 1E5HA 2WS93 4HOOA 1VBE3 3CKHA 1SMVA 1S1AA 4A3XA 5I8TA 4IEYA 4ATEA 1XYOA 2F6BA 1KITA 4XE9A 3VD3A 2JG8C 5LEKA 1R1A2 3AFGA 5T55A 2L9LA 4MH0E 3CLPA 3IDEA 4N8MA 2OA2A 4D94A 2IWGB 5EJ1B 1RUE2 4BQ5A 1GZWA 4EJRA 1O91A 3WUDA 3BVCA 3MF6A 3PLQA 1POV3 4M3CE 1J58A 3O12A 4Q0PA 2GC3A 1V6LA 4IV3A 4QB1A 2WZ8A 2W1SA 1GZTA 4EZ4A 3T30A 4LBOA 1RUI3 3JCIA 4M00A 2OPKA 2YDEA 3TN93 3ITQA 3VBRA 1CAWA 3U37A 5KXEA 3H1WA 4JGYC 1UY0A 3I2OA 4XOGA 1MZ5A 3F95A 4KGGA 4META 1RUG1 2D6OX 3HIFA 4P02B 3LA3A 5FXZA 5J7MA 1S0DA 1RUF2 2JG8B 5I0TA 2R063 1W9FA 4CP1A 3VKFC 4K8RB 4OYUA 2B46X 1KDKA 4XAEA 4QHBA 5A3PA 1QGLA 1TME1 1UYYA 3ILRA 2D44A 3BTAA 2LTNA 5FZ0A 2EICA 5GZFA 3RFRA 4Q5OA 2VZRA 3J8F3 5C8WA 2RS31 4CDQC 3VD9A 3SC7X 2GC1A 4XHBA 4ZU4A 5JIUA 1TZOA 5KC5A 1AJKA 1COV3 3UNPA 2Q8DA 1W6MB 4JGYB 4CCDA 3ZYRA 2Y0OA 4KBBA 4IEUA 4YW3A 3N7KA 1QJX2 3SCFA 3ZFFA 4AFMA 5CNAA 3AKRA 2WLQA 4AEDC 3D4KA 3OY8A 1UKGA 1WW7A 1S55A 2CL2A 5EQUA 1EYBA 2QQWA 2A3YA 3I3QA 3LSDA 1AVBA 3WG1A 4IQPA 1QQP1 2ILMA 3KT7A 5C4WC 2BU9A 3OPTA 1W2UA 2R073 1LHWA 1JYIA 4XFBA 2R32A 1NOVA 2D3SA 3KV4A 3RYKA 1GANA 3VBOC 4DUWA 2JDNA 1NCQA 4CDQB 1XNCA 1H6YA 2XXZA 3AXDA 5GZDA 4CP9A 4EROA 1VAKA 2WO2A 1ZBA3 2WAAA 3ZN4A 3VBSA 4CCLA 4TZDA 5FP9A 2XJSA 1OPOA 2JB8A 2GNTA 2ZGNA 1FPN3 3D3AA 1LKNA 4MOAA 3U14A 1OH3A 5C71A 3MFAA 2ZEXA 2PMWB 1AR81 4EWDA 3AP9A 2KD7A 3KQ4B 5FP8A 4AEDB 1YLLA 3WOGA 2BOIA 3I2HA 4LMFA 3SKJE 3C3VA 1SZBA 3CMGA 1KEXA 2PLV2 5C4WB 5JUVA 1JOPA 1EPWA 4LE3A 5BUVA 1AYM1 1OSGA 1HN1A 4CDXB 1IG0A 2VVDA 4W8JA 3VBOB 2IXCA 2OX0A 3M8LA 3DEMA 5FZ8A 4JC1A 3UKNA 3WG4A 1PK6C 4BIOA 3LFIA 3PTRB 1PGW1 4BQ3A 3ACIA 3G7DA 5B4NA 1X82A 1GFF2 2Y8KA 5DZFA 2O8QA 4E27A 2PHFA 1Y4WA 5AC93 3FFQA 3O5SA 2GN3A 3VDCA 1OUSA 3M70A 4XFCA 4YG3A 2J1AA 4AI1A 4COVA 2A75A 2P5BA 3DXUA 5E89A 2DFCA 1S0EA 4PIXA 1YC61 4I3PA 5IVBA 4AVBA 2Y34A 2JEMA 4LKDA 4YRDA 1QH6A 4A44A 4LO6B 4QGMA 3U4SA 2YU1A 5IW0A 4HPKB 4A7ZA 3U0ZA 2PN5A 2FBEA 4Y26A 3VKLA 1RHI2 1VJ2A 2YFZA 1DCSA 3FFZA 4UWDA 3WW4A 5BXXA 2BZDA 1B35C 1Q8SA 1HXS2 1QNWA 2Y6FA 4QKBA 3WY6A 1LOFC 4B4QA 1PK6B 2I45A 1I1EA 4OCTA 2ZX0A 5DAPA 4YW6A 1JMUB 1YJKA 2WR9A 2DDUA 1V9U2 3I3EA 1H30A 3IMMA 3NQHA 1JZ3A 1AYN1 1RUH1 1IS5A 3H3UA 4AVCA 2HYKA 1NA1C 2EXKA 2RMU2 3BB6A 1YQCA 1E5RA 3DKQA 3N9NA 4XBQA 4JGZA 2P6HA 4LE4A 3N7JA 3PU8A 3WCSA 4E4SA 3C2UA 3OUJA 2BPA2 5DXDA 1VR3A 3SXWA 2XUMA 3LAGA 4QX3A 3RSJA 3WDYA 4Q4V2 1WUVA 4HK8A 1YRZA 3VDBA 1PNGA 3UETA 4MGYE 1AR73 4S2FA 1R083 4AFAA 2XL9A 3GGLA 3WP3A 1QJU2 2BFUS 1OA3A 3WNXA 1B35B 4R9CA 5EJZB 2CTVA 4QX7A 4NE9A 1F15A 5FZ1A 4L2NA 4HANA 1H2NA 1W3XA 1OT5A 1X9TA 3WINE 3N35A 2D5FA 2X10A 2WWJA 3SHRA 5JOYA 1CAXB 4DQAA 3W21A 1NA1B 5C3RA 3V0BB 1RB8G 3MLKA 2VZ3A 3X29B 5EFUA 4P00B 1UMHA 3MLLA 5FK7A 3WLUA 2VW2A 3KV9A 1W6QB 2BYVE 2AUYA 2ZGMA 4QQHA 5FY0A 1VLNA 2WNEA 3S57A 3WF3A 1CJPA 4PLOA 4TYSA 5FZEA 3VUOA 1CAVB 2NZ9A 1C5IA 1WD3A 5FUPA 1JS9A 5H9PA 3WDTA 3HBZA 2ZMNA 2Y0IA 1UZZA 4QX8A 3UKVA 5BNPA 5J09A 1PGL2 1I3HA 2VXJA 4LKSA 5G04L 3NNLA 4NAOA 2W87A 4E8DA 4XJ8A 1SFPA 2R6QA 4ORFA 4JDMA 4RGGA 4HETA 1DQ0A 1DLLA 1SLAA 2K0GA 4OHZA 1JXNA 5J98B 4CXXA 4LLOA 3KF3A 4XFFA 2JB4A 3Q9OA 4AOCA 4X8NA 3OJBA 1AR63 4IERA 4NOTA 4AGRA 1GNYA 5D8AA 4M01A 2BWCA 4WVZA 1CVNA 5DAWA 4MLOA 1OH4A 3K77A 3U78A 2Z5WA 3AKSA 5FIXA 1HW5A 3T1LA 3WNLA 4AVAA 1Q8VA 1OQDA 5DAQA 1MS0A 2Q1ZB 1W05A 2VZPA 3ETPA 4KH9A 2GMMA 5A1LA 2OYZA 4TWTA 1GU3A 2ZJCA 4NPRA 5FZIA 4E4DX 1ACCA 4M3CA 1WW5A 4XXPA 4YZ5A 4IV1A 3MDPA 4UW3A 5DG1A 4ISRA 4Z2AA 4HKLA 3EQEA 1JW6A 2YROA 4JTOA 5FYBA 1OOPC 3O1RA 3DKWA 1AXYA 2OT7A 3K75B 3RDIA 1MS3A 2D6MA 2P1BA 3CDZB 5FYTA 1UYPA 4BPZA 5IAXA 5C5TA 1JYVA 1RINA 5H9QA 3I2GA 3LB9A 4A42A 4CDWC 3K46A 4KWKA 2PHLA 2W1WA 1IS3A 2CDPA 2QQVA 3WUCA 2TEPA 4MADA 4Q4Y1 3DYMA 4NIHA 4XFGA 4X6QB 1NCRA 2VOKA 3RG0A 1GZ9A 1JZ5A 4IV3C 5LW9A 2ZS6B 4QPYA 4WZCA 4LOTA 3WSOA 1HIXA 1JZ4A 4RGAA 2D6LX 2ES3A 3VBRC 2RS33 1NZIA 1HRV2 4IGOA 3WP5A 1S0GA 1OOPB 1Q3EA 1UXZA 5LA0A 1OBNA 1U5IA 3WDUA 2HWB3 3QH7A 1Y9MA 2ADEA 5F39A 3ORJA 1H2KA 2ZOEB 4XBLA 1XJAA 4CDWB 3OGSA 5IK7A 2NP0A 4EN9B 4EQVA 1HQLA 1W6OB 2JICA 4RR3A 2D5HA 3MLJA 5FZ6A 3ZSKA 3H3ZA 3LDRA 1SLIA 1RUC1 5IK5A 2C1FA 3KLSA 2IXKA 3ZYFA 3BPSA 2YBSA 4YVSC 5IVFA 3ZSMA 1QH7A 2VH9A 4XHXA 2A5ZA 4XFIA 1QOTA 3VBRB 5KWRA 1OUXA 1PO13 4FPHA 5L73A 3NAPA 1AZDA 4FPEA 5IVEA 4QU1A 3KF5A 1EV11 1Y3TA 2HWC1 3BGAA 2VOVA 2G9GA 4PCRA 4CCCA 1YHFA 5EIYB 1H1MA 4UF0B 2C9KA 4XEZA 5LA1A 3IDAA 2FDGA 1W9WA 1BLZA 2H0BA 3SNMA 2VC9A 4FPFA 1PVC1 2WZR1 2GC2A 5GLVA 4M3CF 4H7LA 4WV8A 5F3GA 4YVSB 4QPWA 1BVP1 2RVAA 1U12A 5GLTA 1W8FA 2UU8A 1BEV3 3WG2A 5FY8A 5CA6A 1AXZA 3HQXA 1RUOA 5F37A 3JQWA 2J1SA 2GNMA 3NNMA 4FP3A 4GWMA 4M0HA 1UOJA 1XC6A 2WA4A 1MS8A 1IQAA 1L3JA 1NXD1 1T6BX 1W2AX 3FZ3A 4P5YA 4PLMA 2HWD3 4XF9A 2RS11 2ZEYA 1RUD3 3IDBB 5EV7A 3E97A 4NR1A 1QXRA 2WFF2 3AKTA 1POV0 3AMHA 2E7AA 5DUVA 4WZFA 2ARXA 5F32A 1QKQA 1DGRN 3IPVA 1IPJA 4KGQA 4OHWA 1FMD2 1NYWA 1W8UA 3MF9A 4PDWA 5FCCA 2AGSA 2LROA 4PHZA 5A3MA 5BNOA 1VB4A 4B8EA 1DIWA 4AWDA 4BLJA 3CIHA 3WW1A 1JYTA 4LA3A 4PBPA 2CGOA 4Q4X2 3AYEA 1UL9A 3HOBA 5CU1A 2YBKA 4AEMA 2IUWA 2C9AA 2E7QA 3ZM8A 5BPXA 1AR92 5DZEA 4GWIA 3ZOIA 2FDJA 2C26A 4DINB 1RUH3 4OI2A 2FQPA 1RMU1 2ZGKA 4IEVA 4MZUA 5LY1A 2AENA 3WP4A 4FP2A 4BU2A 4GXLA 1V70A 5DG2A 2AC1A 4N53C 1XNTA 3K3NA 4O7XA 5CFDC 1LOGA 2RS51 3BYWA 4CDUB 3JBG3 1CZTA 2FCUA 3MIBA 1W8ZA 4GB31 4NN0A 2ZACA 3AJZA 1GQGA 5LRSA 2ETEA 2VR4A 3KCYA 3KV5A 3ZMOA 5JPMB 4X6RB 5EZWA 1HRI1 5B4XA 3SLIA 4XXAA 1RYYA 2DCKA 2VM9A 3LOBA 4IESA 5CG9A 4OI0A 4NJ4A 1F4HA 4ARXA 1DF0A 4DUXA 1EUTA 1JU3A 2WT2A 4HKWA 4LO7A 2R30A 5T54A 1R64A 2D3PA 1AUYA 1MS5A 5C8CC 4J1XA 1YQ2A 1HB2A 1UY3A 3A22A 1PVXA 2JG8A 2QQUA 4Z82A 3QACA 4COZA 1C28A 3MFCA 1WLCA 4HVRA 1HV0A 5FLIA 1G9AA 4N53B 5FYZA 5CFDB 2F17A 2WQ4A 2WL1A 1DQ4A 5T50A 2GNBA 5CFCA 3LCPA 2JDZA 3ALQA 3N7MA 3ILFA 1GZCA 2P6CA 3WQ7A 5LASA 3WEZA 3ZPOA 2W47A 2VZVA 4HLTA 1V6JA 4LBJA 1G6NA 5CVRA 5LBEA 2AYHA 5KHIA 1YEWA 4DY3A 2XB6C 5FMCA 3MUY1 4AHXA 1W6MA 4JGYA 3WHTA 5C6CA 2WLPA 3GF6A 5FXWA 5FMBA 2MNGA 4CXWA 5A33A 5C8CB 3MUZ1 4NIAA 3H1YA 4GH4C 1C8M3 3ETQA 4S2HA 2XBO3 1DQ5A 4M4PA 2YUEA 1UOBA 3D8CA 3MEPA 2HWF2 1LENA 4QMAA 2VXRA 3OEBA 4S2GA 5LA9A 4ISQA 4P9YA 3GZTB 4EE2A 3KHBA 3AJYA 5KHHA 4DEQA 1KJLA 1ASJ1 5FYMA 3V0AA 3AZXA 2WS92 4FTEA 1VBE2 1XQNA 1OVPA 4C91A 4CDQA 3N9OA 4FOWA 4GJYA 2CWMA 3K2OA 4JCKA 2BBVA 2DVFA 3RZMA 5AVAA 1WA6X 4YG0A 4LBQB 5LA2A 5SV8A 3B01A 4D3WA 1AL21 2XLFA 4GH4B 4D6RA 1C4RA 2J42A 5IVCA 4OMCA 4FSJA 4AEDA 4Q0QA 2WINB 4AHZA 1E5IA 1VRH3 2P17A 3ZXAC 1PGSA 5I8YA 3S0MA 2D6PA 2QJVA 1RUI2 2K2SA 3I59B 3CZJA 4JHTA 5FPZA 3TN92 2BUKA 4AAXA 3CQOA 4NRQA 1WBLA 5CISA 4LQRA 4UFLA 4CDXA 1G9FA 4XYXA 3VBOA 4D7SA 1JHNA 1SDDB 2WO1A 2YZ4A 2A73B 5EXOA 3UKTA 1T6GC 4N9HA 2AEZA 2PA7A 5FYSA 1Y9QA 5F6KA 1UX7A 3RZJA 1YJLA 4G3YC 2VQTA 3BN6A 3HAGA 1QY4A 2R062 4AK3A 4R4XA 3USSA 5DUXA 5FLHA 3TOJA 2P34A 4XVHA 3GBWA 4CPBA 1X8EA 2GC0A 5FZ9A 3THDA 5FLJA 5J37A 2BP6A 1H6XA 4W6WA 1VMHA 3PURA 4GIQA 1QJY1 2RR13 1NLQA 5C3SA 3T0BA 5JWPA 3J8F2 2R041 1FI2A 1NCRC 2XWBB 4LKEA 2UWCA 3GBFA 5F3CA 1ULOA 4ZZ8A 1A8DA 4CU6A 3VKNA 1COV2 5T5JA 3LSEA 4HKOA 5T5PA 4RYDA 5A3TA 4GD4A 5I0DA 5C3PA 1YIPA 2R7EB 4RHV1 2GDFA 1PK6A 5F5AA 5FYVA 3RGBA 1SPPB 4AF9A 4EN7B 5BNNC 1XU2A 1MR5A 2G1MA 5APAA 2QVSB 3LEKA 5JR2A 5CADA 4Q26A 1FV3A 2P3IA 3GCXA 1GLHA 4W50A 1PM4A 5DPNA 1FOD3 2R072 2JDKA 1WKYA 2PHWA 2QQLA 4RR3C 1VBD1 2B8MA 2VU9A 4YGBA 3N4MA 1OHFA 2HEYF 3W9AA 3ZXLA 1NCRB 5FO9B 3MZHA 1ZBA2 1LHUA 2TUNA 3ACHA 2ZPXA 1FPN2 1XYPA 1LOFA 4JAAA 5BNNB 4LIUA 3O1TA 1LHOA 3FLTA 1VBC3 2B4KA 1SLLA 1SBEA 1SLBA 3QH6A 1CAXA 3ZXDA 5FR3A 1DLCA 2YG0A 3B3QE 4LO4B 4CU8A 3V0BA 4Y22A 3IKWA 2FDFA 3OGGA 3N9MA 2IVJA 1LHVA 2VMFA 2VNGA 2Y33A 3VGIA 1X50A 4RR3B 3Q8AA 1BQPA 1K45A 1W6QA 4RN5A 2XMLA 4XCBA 1GUIA 5F5QA 4C1XA 1XNDA 1QEXA 2A7AA 2CY6A 4BQ2A 4IEOA 5JOXA 4AI0A 3D0SA 4LA2A 4QKDA 4WVVA 1OA4A 4AFDA 3J7NA 3ZSEA 1K42A 4DO0A 5AC92 2ZHMA 1OFNA 2VG9A 4IW3A 4RSUA 1LU1A 1ZVFA 3TEWA 1GNHA 3OPZA 5E8AA 4A7YA 4BMBA 4BQ4A 1RTVA 2ZHLA 4QQOA 1D0GA 4PJYA 2W46A 3MPBA 1OVSA 2Z4FA 5ACA1 1O8SA 2W52A 2YXSA 3M3OA 3AKPA 3H0OA 2RM23 3GXUA 3MV11 5FZGA 3URFA 2YHJA 4ES9A 2BFUL 1GYKA 1S0CA 5FP7A 1U5XA 5DMYA 2A71A 2AH2A 2BVVA 1JHJA 1VMFA 1REDA 2Y6JA 3LD8A 3I7DA 3PHMA 1GWLA 4KI5M 4IETA 2A6ZA 5FZ3A 4BXFA 1KFXL 5LATA 5L7OC 1JZ2A 2D93A 1PO23 1BBT3 2D7FA 5KXBA 4N43C 1VBB1 4O9EA 2OPWA 2EVXA 5HCFA 2DURA 4LEJA 3ZX7A 5KR7A 2FMDA 4LULA 2RJKA 2JXAA 4DB5A 2VVEA 3WDXA 4KL1A 5A6ZA 3U11A 3N7LA 5GZCA 1YXWA 5ABJA 4RS5C 4CEWC 1N3PA 4UFHA 5FRAA 1LESA 1EAH1 4OLLA 4I09A 3FL7A 4XF3A 3W58A 4QX1A 4IGQA 3TNQA 4BE3A 3I2DA 2ZGLA 4AFBA 1R082 3IWZA 2D43A 3U10A 3VL8A 1UOGA 5JR7B 2QBXA 4LUKA 2CAUA 3UK9A 3EB7A 2ZGQA 4XZPA 3QLQA 1CD3G 3C7HA 2YC4A 5L7OB 1SHWB 2MEV2 3EO6A 3ES4A 4LHKA 4GQ7A 3KSCA 3PL0A 4N43B 4QDQA 1F8VA 5JMOA 1PZ8A 2JX9A 2A3XA 2VNVA 1GP5A 4LUMA 4MGQA 4Y5TA 4NROA 5LCWL 1J3QA 1UZVA 3EYPA 1ZBE1 3OBZA 4NRPA 4QKFA 5FYHA 4MXWA 4O61A 1POQA 4AI2A 3HT2A 1OOPA 1SCSA 5A7WA 2CU5A 4RS5B 2EA7A 4CEWB 4NAMA 2YC2A 1ZRRA 1APNA 1XU1A 1UU5A 3J9SA 3VBHC 2SLIA 1N1TA 4CDWA 1W6NA 1R1A1 4UXAA 3JB4C 1DYPA 1W6OA 3P1IA 4AVTA 4N7UA 3T2PA 3FX3A 3MHZA 1RUE1 2Q8OA 1DQ1A 2WWUA 4BQWA 4UAPA 3WDWA 3H7JA 3SQOA 1RUJ2 5LEJA 5CFCC 1DQ2A 5ANQA 4OUSA 1W2TA 3PJQA 2YU2A 1P8JA 2AEYA 1UN1A 3ACFA 2ID4A 5A1AA 1ASJ3 4WBBA 1MEC3 3PTYA 3Q8FA 2OQ6A 2FDHA 1DGWA 3CL1A 2IVIB 1W3VA 3DF0A 1GOHA 4XMAA 2HJIA 5K7PA 3E6CC 1T2XA 4AAPA 1SACA 1UPIA 3PMEA 1GR3A 2EAKA 2BNNA 1AR62 1AJOA 5FUIA 2BOJA 2F4LA 5A7SA 4K9SA 4Q1RA 4XJUA 3ON7A 3PJYA 5A6YA 5FDBA 1RUF1 2ENRA 4UF0A 3VBHB 1ND2A 1QWRA 2WO3A 5J48A 2IXLA 3LGRA 1YI7A 4NHMA 2JKBA 4CYDA 1UMIA 3AFKA 4HBNA 5FZAA 5CFCB 4P9WA 4YVSA 4YLZA 1PZ7A 4PT6A 1JYXA 2EIBA 1ZX5A 4YZ4A 5BY5A 3JQXA 3LWCA 3MIHA 1GQPA 4D6QA 3DYOA 4PI2A 1UY4A 1QF3A 1KRIA 5F7UA 3I2IA 4ASMB 2DFBA 4AQTA 5A33B 2DWRA 3LOIA 4CEYC 3VHRA 4XF0A 1QJX1 2G9ZA 4FCAA 1W28A 2NN8A 3AZZA 1UNBA 2MPFA 1SLCA 4R9BA 1C1LA 3H8UA 4OMDA 1NG0A 2VBPA 3K4ZA 3LIHA 4DS0A 3B7MA 1MVQA 2B9VA 1GOGA 1OI6A 2RS32 2VZ1A 2WNUC 2WZEA 3WNKA 3ENRA 3T4HB 5KBFA 3V0AB 4QM9A 1XOYA 2DCJA 2QQMA 4XQWA 3DXTA 4CDXC 2HWE3 3KV6A 3KHCA 2E63A 3BI3A 2FDIA 3N3HA 3ABZA 4B7EA 2HWB2 1TMF3 3RYRA 3VHOA 1S2EA 2ZZQA 3ST7A 3UGFA 3POWA 3LEIA 5M0TA 5C70A 5KHJA 4NUBA 1GWMA 4DPNA 1UF2C 4CEYB 5FZBA 1ZYBA 3ZIWA 1JH5A 4QDSA 3IAPA 3ZO0B 2VW0A 4U36A 4AI8A 4BQ1A 1NQJA 1AHSA 2EXIA 3C7GA 4MGKE 5C5UA 3POFA 2VCBA 2Q0AA 2XVLA 4CDUA 2EIEA 2VD7A 1OQEA 1WLDA 1GQHA 3NKTA 2A6VA 1G86A 1OLME 2W0XA 1PO12 2WNUB 3IAQA 1WMDA 1DGWX 1H1AA 1I6XA 1STMA 5I0RA 4HN0A 2WA3A 3ZLIA 2ET7A 4FFGA 1JUIA 3ZN6A 3O1SA 4IEXA 1E57A 1K5MC 3F2ZA 3GJAA 4N7IA 4YM1A 1UD1A 5A1FA 4FOQA 1LAJA 1WCSA 3FC0A 3POEA 3QCWA 3OUIA 3WF2A 3T0DA 3VZLA 5IATA 1V0AA 1IPKA 2RDNA 3PUSA 3I3BA 4N53A 5CFDA 3Q8BA 1BEV2 1TG7A 5CBLA 1UIKA 1V6OA 4A45A 2FDKA 3SH4A 2ZCWA 1UKRA 1RHI1 2O14A 3CZUA 3HBKA 3ZMNA 1ZA4A 1W8TA 2VVFA 3T2QA 1HXS1 2P3YA 2PTMA 2GU9A 4GMP1 1Y7BA 4XAAA 2D6KA 5I8SA 4RA0A 2HWD2 2VZQA 4TN7A 1TVGA 1C5HA 3H7YA 1K5MB 1RUD2 1CX1A 5F2WA 1FAYA 2K46A 4YFZA 1V9U1 5AFEA 4BXSV 3JU9A 1UZYA 4LNVA 4DXZA 5C8CA 4HONA 1MS9A 1R093 2RMU1 2WKKA 3CJXA 5HXVA 2BQPA 3DGTA 4FPJA 1ENSA 2JE8A 3PUQA 4JZRA 1ZZ8A 2QDRA 1W8WA 3S5QA 1PIV3 5FY1A 3ZXFA 2MHFA 4Q4V1 3OSDA 4LBKA 2J1VA 3V56A 3GDBA 1NLRA 2CV6A 4NWWA 2XL7A 4HL0A 2WN2A 2XLGA 5GZEA 3ELNA 1PNFA 1Z7S3 2WAOA 3ZVXA 3IZOA 3WR0A 3VDAA 2MEV3 2X29A 5ERLA 1A6CA 1AYN2 1RUH2 4AG4A 3OYWB 3E1F1 4LBQA 2GN7A 1UMZA 1YWKA 1Z78A 4INDA 4ZONA 4EYUA 4Y22B 4GH4A 3JBG2 1HV1A 1IZ3A 3JD73 3MIDA 1CX4A 1JODA 5DDJ3 4GJZA 4ZS2A 1SFNA 1F2NA 3ASIA 3OB8A 3UGHA 4EZHA 4YW5A 2PHTA 1AL0G 2P2KA 3I59A 5F3EA 2BTVC 5K0UC 1RXFA 3PDQA 1NY72 3CEWA 1PGL1 2VMGA 2CGNA 1RUJ3 5A7OA 1LOEA 2WO7A 2KR2A 2VMIA 3RWNA 1UAIA 4L97A 3LA7A 1NT0A 3I2KA 4YW7A 3WP6A 2DV9A 3T0AA 5ABJC 2QUOA 1ZNPA 3RNSA 4Q0VA 4HXCA 1J1LA 5JXIA 3WNPA 4KG0A 1VALA 5JMCA 1W0PA 2CDOA 2DTYA 2V72A 3B9IA 2JDAA 1WMEA 1BCXA 5A7PA 1CPMA 4H3WA 3LA2A 3NV4A 4HK9A 2GNDA 4JKMA 1DYOA 3S5AA 3NV3A 4AGGA 1HKDA 5K0UB 3L9JT 3NJZA 5FMOS 4AZZA 3AP4A 5HV0A 5A80A 4BHPA 3KD4A 2I74A 2OUJA 4BJ0A 4L9BA 4DIQA 5T5OA 3R6SA 3HJRA 3OPWA 4KBZA 2OQ7A 1SPPA 2WSVA 1C8M2 3KCCA 4P9XA 2VOXA 2XBO2 5CYYA 3PUHA 1DYKA 3SISA 5C3OA 2GMEA 5ABJB 2OXBA 5IWFA 4A3ZA 4NIGA 1OQ1A 3FLPA 3NNJA 1RUG3 4XUOA 2ZX3A 5DQ0A 2BBAA 1D7PM 1ZZ7A 3BTYA 4M0NA 1I9RA 1OXCA 1VAVA 2OS2A 4HVOA 3AKQA 4WM7C 2XJQA 5FY4A 4HVQA 5FOJB 1ONAA 4WVWA 2VPVA 3ECQA 1PHMA 1TME3 2QQKA 3OD4A 4FAHA 4PBOA 3BUCA 1PMHX 1O5UA 2CYFA 4NIDA 4AQ6A 2RDSA 4MXWB 5BNNA 1IQDC 1REFA 4Y5Z0 5A7WB 3M4FA 1BMV2 3NJXA 1VRH2 5DZGA 4AEJA 2BGPA 4BK4A 3GCWA 5IVVA 1ULFA 2PHUA 4JVAA 2DVGA 1ND2C 1W6NB 1VPHA 2ORXA 2DU1A 2V5DA 4QB2A 1C1FA 4WM7B 1Q43A 2WUHA 1QJZA 3W5MA 1KS5A 1LNSA 5GM0A 4K20A 4FQZA 3T3YA 4B3NA 4QQPA 3FUOA 2RV9A 4XC9A 5FOBB 2DUOA 4DOUA 1QQP3 3J7HA 4UFKA 1YFWA 4AEKA 3JUUA 1WLTA 3GYDA 3GM8A 3EXUA 3RWKX 4ZKTB 2ZKNA 2E9QA
chains in the Genus database with same CATH topology
5IK8A 4IEWA 2NPIA 1WCKA 3TAYA 1LULA 2RR12 1ND2B 1KS4A 4S2DA 1CR7A 2ZMKA 1VB2A 1D4M1 4P9LA 1RUC2 1AR83 1Q8OA 2DVBA 5JPNB 2UYBA 5K8SA 5BYNA 1Q8QA 3ZN5A 3M3QA 5C9AC 2B42B 2YYOA 3M3IA 1H8TC 4BM8A 1AYM3 1MS1A 4QX5A 1YFXA 4QM8A 5E1RA 4FPGA 4COYA 3MYXA 2EXJA 5GLWA 4OFGA 3EHKA 4B29A 3VKOA 2WWSA 1FOD2 4QGNA 2YPJA 3RRDA 1V6IA 4YSFA 4L8QA 3AMQA 1DZQA 1VBA1 1LEMA 4FO9A 1PM7A 2WFF1 2JG9C 2WZR2 2ZAAA 4CDUC 4G4FA 4C90A 1A78A 2WNVA 3WCRA 1FMD1 1S2KA 3GALA 3R05A 5C9AB 5L7OA 3M7AA 2G4IA 1H8TB 2R1BA 4N43A 5JOZA 1VBC2 2PAKA 5KXCA 4XW3A 4Q4X1 4JQRA 1V6MA 3HT1A 4ES8A 3J4UH 1AR91 4RS5A 4CEWA 5A3LA 1AYN3 2XVGA 4JRLA 1MZFA 2CNAA 2JG9B 4XMIA 3RMYA 4NWVA 4ATFA 2UURA 4YM0A 2ZTNA 1LGBA 3SITA 3K48A 1DHKB 2QNKA 4XTMA 4E2GA 4DY5A 4L99A 4LBQD 4AW7A 2OVUA 3E5QA 3ZN6B 4YM2A 1JN2P 2LM3A 2RM22 1A8MA 5J3UA 1O3SA 2UY8A 2QQPA 4K1YA 3VBHA 3KT4A 1PO22 1BBT2 4BZ4A 3V65A 3N36A 3HN1A 2O8OA 5CB7A 1RITA 1IHMA 3D82A 5GALA 4IEQA 1FNZA 3NSTA 3OBRA 2Q4SA 3GZUC 4KWLA 4XJ9A 1UPSA 3KCXA 3VLBB 4MYEA 4G9SB 4Z1VA 3MI8A 3ZXJA 3ME2A 2ZX4A 2A3WA 3VZNA 1H9WA 3B9CA 2HWF1 1ZZCA 5AFBA 2DTWA 4FQ4A 2OUHA 1AX0A 4HN1A 2V09A 2PHDA 3BU7A 4IEZA 5HCAA 3I4IA 3VDDA 4C1WA 3IDCB 4UW4A 1Q5OA 2WS91 1ZZ6A 1VBE1 4W6YA 1C3HA 2GZWA 4QPGC 4BIFA 1IS4A 3JZVA 5JVVA 1TEIA 1DDLA 1O5LA 4CEYA 1POV1 3CU7A 3ZYPA 3A0NA 1X36A 4IXLA 1ASJ2 1RUI1 4Q4Y3 1ND3A 2NM1A 3TN91 1MEC2 3TYJA 2WNUA 2ZA9A 4HZFA 4XJAA 1G9CA 3DUIA 1CQ9A 2YV8A 2XPJA 1NE6A 4MXVA 2XH6A 2YMZA 4H55A 3S7EA 2RHPA 4QPGB 4EN0A 4KU8A 1HX6A 2E53A 1RVF1 4PLNA 4I0BA 2XGXA 4GA9A 4XJZA 1GSLA 4YW2A 4FXGB 1QDOA 2GH8A 1OKQA 1QMJA 3NWKA 4JRAA 3WX5A 1YYNA 4COWA 5JAXA 1FX5A 3CF6E 3VBFB 3J8F1 4XQDA 3R4DB 1S0IA 2VECA 1DQ6A 1H0BA 2DCTA 1JYCA 4R4ZA 3TNPB 1RUC3 3B00A 5L36A 1COV1 1WGPA 1F5JA 1QDCA 1Q56A 3K51A 2ZMLA 3CO2A 1K5MA 1MZEA 1EV13 1MQTB 2ZHKA 2HWC3 3WW2A 4JV4A 5H9RA 2C5DA 3AZYA 2R071 3NVCA 2R0FA 4I30A 5IK4A 4BLIA 4WVMB 2OW4A 4YM3A 4EN8B 2LALA 2HWE2 2DU0A 3AZVA 5IT6A 2V73A 4BCUA 3AK0A 1ZBA1 1PVC3 1OD5A 1TMF2 2ZGPA 3R4UA 4OI4A 2WZR3 2ZGOA 4Z07A 3B5LB 4L11A 2Q30A 1SFYA 4FBFA 4AGVA 1FPN1 4XF4A 3O14A 1CAUA 2VGDA 1RJ7A 1WW4A 1N3QA 4WM8A 1C8NA 3OYWA 3UJQA 3ZSJA 1G7YA 3ZFGC 2P3KA 3VZMA 3VKMA 4CRQA 2RS13 1SBDA 4ITCA 2I2SA 4PF5A 2RJLA 3PVNA 2CWSA 3HMYA 4XILA 5FBZA 3T2TA 3KS7A 4UW5A 2W08A 5AC91 4YVWC 1SQ4A 4GALA 4Q4W1 3E6BA 1N3OA 1AF9A 4RFT0 3A4UA 2ZX2A 4LLFA 4XFHA 3VHNA 3ZFGB 5FTTC 5CIRA 1NZCA 2C0ZA 1RMU3 3J26N 2NYYA 4AE2A 4QD2A 1J1TA 4AQSA 4KWJA 1HQNA 2WNVC 3D5OA 1UIJA 4JTNA 4Z8BA 2RS53 3SH3A 3VBUC 5K0UA 2BWAA 5BNQA 1BJQA 1H4HA 1G8WA 4GB33 4FOYA 5JZGC 1CJDA 3UL2A 4R9DA 4YVWB 1R092 3U4XA 1IOAA 1HRI3 4L92A 4Q27A 1X33A 4H14A 5JLVA 1H8VA 2ZGSA 1J3PA 3AZWA 2ZX1A 2PHRA 1PIV2 1N1YA 4LTAA 1SEFA 3NL1A 2V5YA 1MVEA 3CJIC 1AR71 1R081 2QFEA 2AREA 2VNRA 4I0AA 4Y1YA 3ZIXA 1MACA 1HDKA 2WNVB 1Z7S2 1XNBA 3VBUB 2VQAA 4YW4A 4BOWA 3VV1A 5JZGB 1QOSA 4QPIC 4I01A 3WV6A 4XJWA 3S30A 1CN1A 4K21A 4UBHA 2VY0A 4W6XA 3KM5A 3ZFEA 3JD72 4DFSA 2RE9A 5DDJ2 5CG8A 3VZJA 4XIOA 1TNRA 3RMXA 2DCYA 5FMOL 3CJIB 4WM7A 2HEWF 1ZRCA 3MIEA 4BA6A 2OZJA 1U5YA 5LK7B 2Q1MA 2QKDA 3AP7A 3VZOA 4QPIB 4K8FA 2KXLA 3LZZA 3FMGA 3AXEA 1RJ8A 1WA4A 3NKGA 4CZSA 2EALA 4PIYA 3AMMA 1LU2A 3ZSLA 4P9IA 1AR61 1HQWA 3OBTA 2R1DA 3R4SA 4GKYA 3SCGA 4OZXA 2PYTA 2VOWA 1AL23 1X8MA 1A3KA 2PHXA 1XXNA 3O0WA 2FZ1A 1KDMA 4XF1A 3VDDC 1R1ZA 2ZGRA 4BWOA 4GMP0 3AMPA 4Q29A 1RUG2 3AB0A 2D6NA 4IL7A 3ZYIB 3W59A 3RI9A 1RVF3 4NHKA 1UU6A 1PZ9A 5LK5A 4A2UA 2EAAA 1TME2 3NV2A 1D2QA 4LBLA 1QJY3 1ND3C 3DPRA 5KXDA 2R043 4RD7A 5KHKA 5C9AA 3KGZA 1LOAA 3OD0A 3VDDB 1XYNA 1H8TA 4KNCA 1LCLA 1W6PA 2HWB1 1KFUL 3USUA 2VW1A 4RHV3 4IEPA 3ROUA 2TNFA 4DMIA 5FREA 3WD5A 2JE9A 5GLUA 1LGCA 4DNYA 4RQPC 1ZRFA 1QQP2 4MV2A 1ENXA 2D97A 2JG9A 3WHUA 2D40A 3AYCA 3PNAA 1BZWA 2PLV1 1FATA 3I8TA 1ND3B 1VBD3 1PO11 5HCBA 4EV0A 4LBMA 2B45X 2E6VA 3GNEA 5JDBA 2YGMA 2DVDA 4MX3A 4Q0SA 1WD4A 1ZZBA 4Y20A 4QT6A 1O4ZA 1U5ZA 4EWEA 2ZGUA 1AR82 4BMEA 5JI9A 4P14A 1WW6A 1UU4A 2D3RA 3TBDA 3EBRA 1RUNA 1BKZA 4J6GA 4RQPB 1TNFA 4Q8KA 1J3RA 3KT1A 3LKJA 1VIWB 4E2QA 1BEV1 1AYM2 1LECA 5T5LA 4QU2A 5FQ0B 2LUWA 3D0JA 4JDOA 4AHWA 4UBGA 4CP0A 2BW8A 1AXKA 3GBGA 1PGW2 3BCWA 1OA2A 4J1WA 5FO8B 2HWD1 3BOWA 4KG8A 5DUUA 4COUA 2IFRA 2SBAA 1RUD1 1V6NA 3A0KA 4WM8C 3IT8A 5KC6A 1J59A 2QDNA 2Z42A 4A7KA 3RYPA 4Q4W3 4R52A 4N90A 1OLRA 3WG3A 2VMHA 2WQZC 4XBNA 1G9AA 3ES1A 5I93A 1QOOA 2XJPA 3MW3A 4HT1T 2YC0A 5ACA3 4GKXA 2R49A 4Y1ZA 4YFWA 4AFCA 4AHYA 2VULA 1Z0HA 4EWAA 1O3QA 4YW1A 5LRRA 1YI9A 1QJU1 2GMPA 2K9ZA 3ZXEA 1F9KA 1O4YA 1VBB3 3ZXKA 1N47A 1CAUB 2JE7A 1ZZ9A 3FJSA 3BALA 5F6LB 2X53S 4FXKB 5J96B 4WM8B 1W39A 3HR9A 4LT5A 5EYYA 3JBG1 2WC2A 1EAH3 4YZ1A 4XIKA 3DV8A 2EXHA 5JSOA 3S7IA 4TSVA 4AVVA 1LEDA 4DRVA 1GV9A 1NY71 1S0JA 1XE8A 2WFPA 4SLIA 2ZABA 1ZRDA 4XFAA 4QPGA 1ULCA 4YNIA 3AYDA 4C0HA 1CESA 1ZBE3 4QXKA 1YUDA 1H2LA 3P3NA 5FFOC 1GBGA 2A6XA 2VUJA 4SBVA 2Y38A 3PVEA 3S6PA 3ZYGA 5I0SA 3L2YA 1R1A3 5GLZA 3VBFA 4X8PA 4DZGA 1KD7A 2CGPA 3E6DA 1RUE3 2B9UA 3OF1A 2BGCA 4HSJA 1LHNA 4NHLA 4F7ZA 1HLCA 3E5UA 3WW3A 2XJTA 4Y1XA 2YGLA 4FT8A 4K7JA 3RS6A 2WIIB 3IIAA 4XETA 3TB0A 2JENA 2ZHNA 1YFUA 2P3JA 4XTPA 3WZ1A 2B39A 1C8M1 2ZAHA 2XBO1 1V00A 1QNYA 3ZFEC 4Q0UA 4W65A 1O3TA 1MQTA 2UWAA 2AR6A 2W68A 2CAVA 1RUF3 5EJ3A 2XVKA 2R16A 4WVMA 2ZGTA 3RPQA 3VZKA 1DZTA 4P9JA 1WBFA 2NMNA 3OCPA 4OULA 4LO5B 3NW4A 1WLWA 2JD4A 2BNMA 1IS6A 1HRV1 4E9KA 1YO8A 3ZFEB 1BMV1 1VRH1 3FE5A 1Q8PA 3ILNA 1RGSA 1XRUA 3AYAA 2BVBA 4OVEA 4Q4Y2 3VL9A 1QJX3 2IXIA 5A32B 3FWEA 2UYAA 4RL7A 1QXPA 3DL3A 3PVOA 3D6EA 4PQ9A 3HD8B 1QHDA 4AYUA 1ENRA 1RIRA 4DRRA 4FTBA 4P9GA 2EIGA 1UX6A 1M06G 3MGUA 1GNZA 5E88A 2X5IA 2RR11 2EF6A 1FYUA 4YYOA 4LHLA 1C57A 1YFYA 3WVJA 1GZWB 3ZFGA 2UWBA 2JECA 1BYHA 3BIWE 3KZ4C 5DUWA 3IMNA 4IV3B 4AQ2A 3ZPYA 5B2GB 3DPRC 1NE4A 3WQ1A 2PLV3 4B4PA 1CAWB 2Z2SB 4QQ2A 3B02A 1ZREA 1EV12 5TSWA 4YVWA 2HWC2 5FO7B 3AMNA 2R0HA 3RQ0A 1FOD1 1YCIA 3ZFFC 2NQYA 1MZ6A 2DVAA 1X7NA 1D4M2 1NLSA 1WCDJ 4CP2A 4E2SA 2IXJA 1PVC2 2UY9A 5IUQA 4KQ7A 2HEVF 3M3CA 5AVPA 5JIAA 4Q8LA 3INAA 3DPRB 2Z69A 1NCQC 3VBUA 4BH9A 3VBSC 3P3PA 2HKXA 4HSLA 1VBC1 5JZGA 1W6PB 2DUPA 1RHI3 1IGOA 5JCTA 3ZXGA 1XE7A 3USUB 1HXS3 4GMP3 1ULDA 1KXGA 1VAMA 1LR5A 5EYXA 3T1MA 2RS12 3SCHA 3ZFFB 1LGNA 1VBA2 2DF7A 3THPA 1V9U3 3OY8B 1O4TA 3B94A 2ARBA 4FVVA 3TRSB 2RMU3 3CJIA 1H2MA 1H4GA 2XKOA 4NVPA 2FHRA 1M4WA 1ZM1A 3WQ0A 3IN9A 4OI1A 4PIZA 2IZWA 1NCQB 1S2BA 2D98A 4MGIE 4ASLA 2F4PA 4Q4V3 4MSVA 4FTSA 1I5ZA 3VBSB 2TBVA 4ZXKA 4AXOA 1H9PA 3HWJA 1H1IA 4QPIA 2E51A 4Y20B 1QJU3 4MUVA 2QCSB 3MPPG 4Y1VA 1SCRA 1S0BA 4YGEA 2RM21 3KMHA 1RMU2 2E7TA 1IKPA 5BV6A 5T3NA 2N7GA 4F83A 1LODA 2PELA 1JTZX 2Z79A 2RS52 4LO8A 1CGPA 1PO21 2ET1A 1BBT1 3VN4A 3O7OA 4GB32 5T52A 4YZ2A 5GZGA 1BXHA 1HRI2 2DUQA 3PMSA 3EJKA 1JOJA 4O9GA 3UJOA 1GKBA 2H6CA 4JDNA 2YY1A 2O0OA 4OHXA 3UV9A 2O1QA 5L19A 2WJSA 1NQDA 1BK1A 4JGZC 2VNOA 4K1ZA 5E16A 2QE3A 3APBA 4B4RA 1LTEA 3B69A 3RI8A 3FUQA 5KHGA 2DCZA 5H9SA 5F1RA 5I91A 3U07A 1GICA 1BVVA 1EPZA 1S0FA 1FXZA 1ULGA 4P5HA 4K3UA 4I2OA 2FZ2A 2B5HA 4H7MA 3QD6A 5GKAC 4D7TA 1FV2A 4OUMA 4FAGA 3R0RA 3H50A 1XNKA 5FPXA 4JGZB 2WSUA 2KA3A 3M1HA 3NO8A 3KGLA 4URTA 2X8KA 4UW6A 1LOCA 4B7KA 3VBFC 2W39A 1JBCA 3B93A 1RC6A 3E5XA 5GJ6A 3WT3A 3IBMA 1LRHA 1MEC1 4XQ4A 5BNPC 4Z92B 4R9AA 3L2HA 1DGRA 2QZ2A 2AZ5A 4Y24A 4HFSA 3TWIA 2ERFA 5FAXA 2PAMA 2XHKA 2GH2A 1Y43B 1CPNA 2XG3A 3AP6A 4BYYA 1AL22 1NXMA 2R061 2JJ6A 5J36A 5HBAA 1HRV3 1PMIA 1SLTA 3WXPA 1MQTC 1UCXA 2GALA 5D8AC 4RQPA 2DYCA 5C4WA 4ZU7A 1TE1B 3H9AA 2ZKLA 1IKQA 3WDVA 2WT0A 2NLRA 1VP6A 3AM2A 2H6BA 4K6BA 5BNPB 5FQ0A 5I0UA 4IV1C 4QQLA 1RL3A 1OLQA 3RJRA 3V64A 1ULEA 3MW2A 1RVF2 2IC1A 4MGZE 3M3EA 4ONUA 3SMHA 3KQRA 4EN6B 3ZDSA 1TQ5A 3FBYA 4YG6A 4MVTA 2IXHA 4Y4YA 4ZU5A 1CONA 1N1SA 2I07B 4AI3A 1QJY2 5D8AB 4D69A 3POSA 4R8HA 4YGDA 2R042 1ENQA 3M2MA 2XWJB 1D4M3 2HWE1 4HPKA 4LBNA 1TMF1 4M3CB 4NO4A 4LHNA 1G9BA 4IV1B 4RHV2 1JUHA 3O0VA 3ZYJB 1EY2A 2GSYA 2VQ0A 5JI7A 1YIFA 3QOPA 2P37A 2X5IC 1B09A 3FLRA 4HMZA 4FPYA 1DBNA 1KJRA 2OZ6A 3THTA 1URXA 3G6JB 3AX4A 1YNAA 3BODA 4OHYA 2XKPA 1VBD2 4I0WB 5JSPA 1VBA3 5EWSA 1SDWA 2WFF3 3H1MA 2H0VA 4Q2FA 3KB5A 1G9DA 2WZPP 1B35A 1DU3D 1FMD3 3OTFA 1DZRA 3MICA 3NAPC 2GAUA 3FBMA 1OPMA 4GWNA 4YGCA 1ALYA 1EP0A 1LB2A 2X5IB 4D7YA 2B7YA 2Q5TA 1NA1A 2VUAA 1D4VB 1KQRA 1N1VA 2PAEA 3MIFA 4Q4X3 1FT9A 4OHVA 2A70A 1MS4A 5C33A 3O0XA 1QU0A 4FOVA 5JOWA 1AR93 5K9YA 3IM0A 1D0HA 5HI0A 3GHMA 2XJVA 3GZAA 1CAVA 4E4ZA 1DG6A 2QZ3A 4Y1UA 4XPVA 1CIWA 1LJ7A 2BNOA 4FPCA 4YZ3A 4YARA 3NAPB 3VHPA 3CNAA 1OFSA 2Y26A 1AX1A 4GULA 4Q4W2 1R091 4U2AA 2ZZJA 2IFWA 3RZZA 1U0AA 3BOPA 4C0BA 2XJUA 5ACA2 1F5FA 1WMFA 1PIV1 1DGLA 5SV5A 1O3RA 2XLAA 1OMIA 2FMYA 2WT1A 4I3GA 5D1IA 4CTEA 3FHIB 3MIGA 4PDWC 1V6KA 2ZBJA 4TLFA 4F3JA 4Z2WA 5BNOC 1Z7S1 1VBB2 3MW4A 2MEV1 1REEA 4FPKA 2OIIA 4XDQA 1D2SA 2XJRA 2BEOA 1DFQA 3ACLA 2PFWA 3AP5A 1EAH2 4K40A 1FNYA 4FPLA 3OGJA 2G9FA 3DN7A 3JD71 1F31A 1AX2A 2A6WA 5DDJ1 1SBFA 3BPZA 1AR72 3NV1A 3I54A 4V1PA 3SH5A 1QXJA 3RJ2X 4QGLA 5A32A 2ATFA 2KM2A 3PVBB 1UW8A 2A6YA 3IPVB 3JB8A 2PQQA 4KU7A 4PDWB 3ATGA 4PJYA 2HWF3 4FPOB 4F8AA 5BNOB 1RUJ1 2NMOA 3POYA 4N9IA 1W0OA 1O7FA 3GHNA 4I02A 4Q1PA 3QBQA 1ZBE2 1LOBA 4LR4A 2WS93 1VBE3 1SMVA 1S1AA 4A3XA 5I8TA 4IEYA 4ATEA 1XYOA 2F6BA 1KITA 4XE9A 5LEKA 2JG8C 1R1A2 3AFGA 5T55A 4MH0E 3CLPA 3IDEA 2OA2A 4D94A 2IWGB 1RUE2 4EJRA 1GZWA 1O91A 3WUDA 3MF6A 3PLQA 1POV3 4M3CE 1J58A 3O12A 4Q0PA 2GC3A 1V6LA 4IV3A 4LBOA 1RUI3 3JCIA 4M00A 2OPKA 2YDEA 3TN93 3VBRA 1CAWA 5KXEA 3H1WA 4JGYC 4XOGA 1MZ5A 4KGGA 4META 1RUG1 2D6OX 3HIFA 3LA3A 5J7MA 1S0DA 1RUF2 2JG8B 5I0TA 2R063 4CP1A 3VKFC 2B46X 1KDKA 4QHBA 1QGLA 1TME1 3ILRA 2D44A 3BTAA 2LTNA 5GZFA 3J8F3 5C8WA 2RS31 4CDQC 2GC1A 4XHBA 4ZU4A 5JIUA 5KC5A 1AJKA 1COV3 1W6MB 4JGYB 3ZYRA 2Y0OA 4KBBA 4IEUA 4YW3A 3N7KA 1QJX2 3SCFA 3ZFFA 4AFMA 5CNAA 3AKRA 2WLQA 4AEDC 3D4KA 3OY8A 1UKGA 1WW7A 1S55A 2CL2A 1EYBA 2A3YA 3LSDA 1AVBA 3WG1A 4IQPA 1QQP1 2ILMA 3KT7A 5C4WC 1W2UA 2R073 1LHWA 1JYIA 4XFBA 2R32A 1NOVA 2D3SA 3RYKA 1GANA 3VBOC 1NCQA 4CDQB 1XNCA 3AXDA 5GZDA 4EROA 1VAKA 1ZBA3 3ZN4A 3VBSA 4TZDA 2XJSA 1OPOA 2GNTA 2ZGNA 1FPN3 1LKNA 3MFAA 1AR81 4EWDA 3AP9A 4AEDB 1YLLA 3WOGA 3C3VA 2PLV2 5C4WB 1EPWA 4LE3A 5BUVA 1AYM1 1OSGA 4CDXB 2VVDA 3VBOB 2IXCA 3M8LA 3UKNA 4JC1A 3WG4A 1PK6C 4BIOA 1PGW1 3G7DA 1X82A 1GFF2 5DZFA 2O8QA 4E27A 2PHFA 5AC93 3FFQA 3O5SA 2GN3A 3M70A 4XFCA 4YG3A 4AI1A 4COVA 2A75A 5E89A 2DFCA 1S0EA 4PIXA 4I3PA 4AVBA 2JEMA 4YRDA 1QH6A 4LO6B 4QGMA 3U0ZA 4A7ZA 4HPKB 2PN5A 2FBEA 4Y26A 3VKLA 1RHI2 1VJ2A 3FFZA 3WW4A 4AVSA 5BXXA 4YZ5A 1B35C 1Q8SA 1HXS2 1QNWA 3WY6A 4B4QA 1LOFC 1PK6B 2I45A 1I1EA 2ZX0A 1YJKA 1V9U2 1H30A 1AYN1 1RUH1 1IS5A 3H3UA 4AVCA 2HYKA 1NA1C 2EXKA 2RMU2 3BB6A 4XBQA 4JGZA 4LE4A 3N7JA 3WCSA 2BPA2 4E4SA 3C2UA 5DXDA 1VR3A 3SXWA 2XUMA 3LAGA 3RSJA 3WDYA 4Q4V2 1WUVA 4HK8A 1YRZA 1PNGA 4MGYE 1AR73 4S2FA 1R083 4AFAA 2XL9A 3WP3A 1QJU2 2BFUS 1OA3A 3WNXA 1B35B 4R9CA 2CTVA 4L2NA 4HANA 1H2NA 3WINE 3N35A 2D5FA 5JOYA 3SHRA 1CAXB 4DQAA 1NA1B 3V0BB 1RB8G 3MLKA 3X29B 5EFUA 3WLUA 3MLLA 2VW2A 1W6QB 2BYVE 2AUYA 2ZGMA 4QQHA 1VLNA 2WNEA 1CJPA 4PLOA 4TYSA 3VUOA 1CAVB 2NZ9A 1C5IA 1WD3A 5H9PA 3WDTA 3HBZA 2ZMNA 2Y0IA 1UZZA 5BNPA 3UKVA 1PGL2 5J09A 1I3HA 4XJ8A 2R6QA 4ORFA 4JDMA 4RGGA 4HETA 1DQ0A 1DLLA 1SLAA 2K0GA 4OHZA 1JXNA 5J98B 4LLOA 4XFFA 3Q9OA 4X8NA 3OJBA 1AR63 4IERA 4NOTA 4AGRA 5D8AA 4M01A 2BWCA 4WVZA 1CVNA 4MLOA 2Z5WA 3AKSA 1HW5A 3T1LA 4AVAA 1Q8VA 1OQDA 1MS0A 2Q1ZB 4KH9A 2GMMA 2OYZA 4TWTA 2ZJCA 4NPRA 4E4DX 4M3CA 4XXPA 1WW5A 4IV1A 3MDPA 4UW3A 5DG1A 4ISRA 4HKLA 3EQEA 1JW6A 2YROA 4JTOA 1OOPC 3DKWA 1AXYA 3RDIA 1MS3A 2D6MA 4BPZA 1RINA 5H9QA 3LB9A 4CDWC 4KWKA 2PHLA 3WUCA 1IS3A 2TEPA 4Q4Y1 4XFGA 4X6QB 1NCRA 2VOKA 3RG0A 1GZ9A 4IV3C 2ZS6B 4QPYA 4WZCA 1HIXA 4RGAA 2D6LX 2ES3A 3VBRC 2RS33 1HRV2 3WP5A 1OOPB 1Q3EA 1S0GA 1U5IA 3WDUA 2HWB3 3QH7A 4CDWB 1H2KA 2ZOEB 4XBLA 5IK7A 2NP0A 4EN9B 1HQLA 1W6OB 2JICA 4RR3A 2D5HA 3MLJA 3ZSKA 3H3ZA 1SLIA 1RUC1 5IK5A 2C1FA 3KLSA 2IXKA 4YVSC 3ZSMA 1QH7A 2VH9A 4XHXA 2A5ZA 4XFIA 1QOTA 3VBRB 5KWRA 1PO13 4FPHA 5L73A 3NAPA 1AZDA 4FPEA 1EV11 1Y3TA 2HWC1 2VOVA 2G9GA 4PCRA 1YHFA 1H1MA 4XEZA 2H0BA 3SNMA 4FPFA 1PVC1 2WZR1 2GC2A 5GLVA 4M3CF 4H7LA 4WV8A 4YVSB 1BVP1 1U12A 5GLTA 5CA6A 2UU8A 1BEV3 3WG2A 1AXZA 3HQXA 1RUOA 3JQWA 2GNMA 4FP3A 4GWMA 4M0HA 2WA4A 1MS8A 1IQAA 1L3JA 1NXD1 3FZ3A 4PLMA 4XF9A 2HWD3 2RS11 1RUD3 3IDBB 5EV7A 3E97A 4NR1A 1QXRA 2WFF2 3AKTA 1POV0 3AMHA 2E7AA 5DUVA 4WZFA 2ARXA 1QKQA 1DGRN 3IPVA 1IPJA 4KGQA 4OHWA 1FMD2 1NYWA 3MF9A 4PDWA 5FCCA 2AGSA 5BNOA 5A3MA 1VB4A 4B8EA 1DIWA 4AWDA 4BLJA 3WW1A 4LA3A 4PBPA 2CGOA 4Q4X2 3AYEA 1UL9A 5CU1A 4AEMA 2C9AA 2E7QA 5BPXA 1AR92 5DZEA 4DINB 1RUH3 4OI2A 2FQPA 1RMU1 2ZGKA 4IEVA 4MZUA 2AENA 3WP4A 4FP2A 4GXLA 1V70A 5DG2A 4N53C 5CFDC 1LOGA 2RS51 4CDUB 3JBG3 3MIBA 4GB31 4NN0A 2ZACA 3AJZA 1GQGA 5LRSA 2ETEA 3KCYA 3ZMOA 5JPMB 4X6RB 5EZWA 1HRI1 3SLIA 4XXAA 2DCKA 3LOBA 4IESA 5CG9A 4OI0A 1DF0A 2WT2A 4HKWA 4LO7A 2R30A 5T54A 5C8CC 1AUYA 1MS5A 2D3PA 4J1XA 4Z82A 1PVXA 2JG8A 3QACA 4COZA 1C28A 3MFCA 1WLCA 4HVRA 1HV0A 5FLIA 4N53B 5CFDB 2WQ4A 2WL1A 1DQ4A 5T50A 2GNBA 5CFCA 3LCPA 2JDZA 3ALQA 3N7MA 3ILFA 1GZCA 3WQ7A 4HLTA 1V6JA 4LBJA 1G6NA 5CVRA 2AYHA 5KHIA 4DY3A 2XB6C 4AHXA 1W6MA 4JGYA 3WHTA 5C6CA 2WLPA 3GF6A 2MNGA 5A33A 5C8CB 3H1YA 4GH4C 1C8M3 3ETQA 4S2HA 2XBO3 1DQ5A 2YUEA 3D8CA 3MEPA 2HWF2 1LENA 4QMAA 2VXRA 4S2GA 4ISQA 4P9YA 3GZTB 3AJYA 5KHHA 1KJLA 1ASJ1 3V0AA 3AZXA 2WS92 4FTEA 1VBE2 1XQNA 4C91A 4CDQA 4FOWA 2CWMA 4JCKA 2BBVA 2DVFA 5AVAA 4YG0A 4LBQB 5SV8A 3B01A 4D3WA 1AL21 2XLFA 4GH4B 1C4RA 4FSJA 4AEDA 4Q0QA 2WINB 4AHZA 2P17A 1VRH3 3ZXAC 1PGSA 5I8YA 3S0MA 2D6PA 2QJVA 1RUI2 2K2SA 3I59B 5FPZA 3TN92 2BUKA 1WBLA 4CDXA 1G9FA 4XYXA 3VBOA 4D7SA 1JHNA 2YZ4A 5EXOA 5CAZA 2A73B 3UKTA 1T6GC 4N9HA 2PA7A 1Y9QA 5F6KA 1YJLA 4G3YC 3HAGA 1QY4A 2R062 4AK3A 4R4XA 3USSA 5DUXA 5FLHA 3TOJA 2P34A 3GBWA 1X8EA 2GC0A 5J37A 5FLJA 4W6WA 4GIQA 1QJY1 2RR13 5JWPA 3J8F2