1VR3A

Crystal structure of acireductone dioxygenase (13543033) from mus musculus at 2.06 a resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
179
structure length
179
Chain Sequence
MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Acireductone dioxygenase
publication title Crystal structure of acireductone dioxygenase (ARD) from Mus musculus at 2.06 angstrom resolution.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 179
sequence length 179
ec nomenclature ec 1.13.11.54: Acireductone dioxygenase (Fe(2+)-requiring).
pdb deposition date 2005-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1vr3A00
3RYRA 3SCHA 3I54A 5KHKA 3DV8A 1VP6A 2GU9A 3I59A 1QY4A 3FX3A 3LWCA 2OZJA 5D1IA 4MV2A 5AVPA 2N7GA 4Z82A 3N4MA 2VPVA 1X8EA 2OPKA 1ZZ8A 4E2GA 4NVPA 1CAXB 4XFBA 2XLGA 4Q0SA 1XE8A 2PYTA 1I5ZA 4JVAA 4BHPA 2PFWA 2PA7A 4K8FA 1H1MA 3D82A 5LRSA 4MGZE 3SHRA 3NSTA 1ZRFA 1EY2A 3NJZA 5FLIA 2D93A 2IXHA 3RZZA 4TLFA 5I0SA 1YFWA 3KMHA 2GH2A 3D0JA 3SXWA 4LUMA 1ZNPA 4XETA 3OGJA 3CL1A 1Y3TA 1ZZBA 5FCCA 3E5QA 5KHHA 2GC3A 5I0RA 4XFHA 1WLTA 2KXLA 4MX3A 4QGLA 4KL1A 4LA3A 1YUDA 2PAEA 2ZCWA 5LEKA 4R8HA 1YHFA 3FHIB 1Y9QA 1FI2A 3BALA 4LUKA 2Q4SA 4I3PA 1IPKA 5E1RA 2IXKA 5JSPA 3LA3A 1X82A 1ZZ6A 5BPXA 3WW3A 2XL9A 2MNGA 3H1WA 2IXJA 2XKPA 4H7LA 3H7YA 1ZRDA 2ZKLA 3VHRA 1SEFA 1CAXA 1WGPA 2Z69A 3FFQA 1UW8A 4DINB 4YSFA 5LEJA 3SCGA 3USSA 2GC2A 4QMAA 5J7MA 1G6NA 2BNMA 5I0UA 4XFGA 1DZTA 2UY8A 5E16A 5KHIA 3LA2A 4WVZA 1GQGA 2ETEA 2I45A 1WA4A 3WW4A 2VQAA 2P17A 4AVBA 4LA2A 4I0AA 3RYKA 5I91A 3LZZA 1J3PA 1DGWA 4KU8A 4FT8A 1X7NA 5J3UA 2MHFA 3OCPA 3MYXA 4PIXA 3PLQA 4QX5A 1HW5A 2ET1A 2PAMA 5JR7B 2GAUA 5F1RA 1J3RA 2Q30A 3QACA 2BNNA 1UCXA 4JTOA 4YNIA 2IC1A 2PTMA 2CV6A 5FLHA 5EZWA 1PMIA 1L3JA 3HIFA 2UYBA 5BUVA 2MPFA 4L2NA 2Z2SB 4KWJA 4XF1A 3NW4A 3H3ZA 3L2HA 3ETQA 3ZDSA 3U0ZA 2FQPA 2OA2A 2GZWA 3KCCA 3KSCA 4LTAA 4KU7A 2D5FA 3BCWA 1EP0A 4XFFA 2BNOA 4AVAA 1J1LA 4E2QA 1ZX5A 2IXLA 4PIYA 4QM8A 3U10A 4QXKA 4HN0A 4XFCA 2OZ6A 2FMYA 3EO6A 4LEJA 3H9AA 1QXJA 1RUOA 4MH0E 1UIJA 5EFUA 4EWDA 4IEWA 4BIFA 3QOPA 1NZCA 1J58A 1Q43A 5FPZA 4XF9A 2F4PA 3EBRA 1Q5OA 3E97A 4N9HA 2EVXA 5I0TA 4FAGA 1YLLA 3DL3A 4MZUA 1CAVB 4O9EA 4RD7A 1NE6A 4AQ6A 4L11A 1FT9A 3LOIA 5FPXA 1FXZA 1ZRCA 4XFAA 5KBFA 2WFPA 1CAUB 2Y0OA 4Q0VA 1YFXA 1I6XA 3FE5A 4J1WA 4XEZA 3ES1A 1RUNA 3H8UA 3ES4A 4BH9A 2Q0AA 2O1QA 3HT1A 1EYBA 2QNKA 3WW2A 2K0GA 1XE7A 1YFUA 3E6DA 4MUVA 4R52A 2BGCA 5CADA 2V09A 1X8MA 1OI6A 3I7DA 4Q29A 4EWAA 1ZRRA 1EPZA 3NVCA 5JAXA 4HMZA 5I93A 4IEVA 4Q0UA 3MZHA 3M3IA 1QWRA 3IDBB 2D5HA 2BYVE 4I02A 4F8AA 5BV6A 3D0SA 2B9UA 2QCSB 4ZU4A 2ATFA 1CGPA 4IEQA 4ZU5A 4IEUA 5J48A 1U12A 3I59B 3CLPA 3ST7A 2ET7A 1SQ4A 4AQ2A 4IEPA 2XGXA 1CAWB 5I8SA 3BB6A 1DZRA 1QXRA 2O8QA 1XRUA 5C6CA 1SFNA 2GC0A 1OMIA 3H50A 1CAUA 2XLAA 3H3UA 4J1XA 4UBGA 1VR3A 2XKOA 4HN1A 3H1MA 2IXIA 1NXMA 4D7SA 4IETA 3OF1A 2VECA 4P9GA 2C0ZA 3NL1A 3MDPA 3OTFA 4XFIA 4I01A 4MGIE 1LRHA 3DN7A 1ZREA 4HLTA 1TQ5A 2EAAA 4QM9A 3DKWA 4LLOA 3C3VA 1NYWA 3TNQA 2XLFA 3PVBB 4IEOA 1UIKA 4X6RB 3GBFA 2B5HA 4LULA 1V70A 1PM7A 2IXCA 4UBHA 5LRRA 3UKNA 3LA7A 3IWZA 4HSLA 1O3QA 4I09A 2Q1ZB 4KWKA 3R6SA 4BYYA 4CYDA 3S7IA 1LR5A 3SCFA 4IERA 5CU1A 3CF6E 3IBMA 3G7DA 3S0MA 1CAWA 1OD5A 3CJXA 2CAVA 2CAUA 2PHDA 3KGZA 3FWEA 1JUHA 3O14A 5T3NA 2PHLA 4IEZA 5CVRA 1O3RA 1H1IA 3U11A 2QVSB 4MGYE 3FJSA 2BEOA 4HSJA 1Q3EA 3M70A 3RPQA 4KWLA 3ELNA 1LKNA 1RTVA 3FZ3A 1J59A 1UPIA 4IEXA 3E5XA 5BXXA 4ORFA 3RDIA 3IIAA 4HBNA 3E6CC 4HVOA 5FQ0B 4O9GA 3BU7A 3OD0A 1YFYA 4WBBA 2QDRA 2H6BA 5JSRA 3H1YA 5FDBA 1IPJA 1O5LA 3MPBA 1ZZ9A 1ZZCA 3PNAA 3UKTA 4EWEA 1J3QA 5BY5A 1OFNA 2E9QA 5KHJA 2XHKA 1YWKA 2HKXA 3HQXA 3RYPA 5HI0A 5C8WA 4XF3A 1O3SA 2CGPA 1RL3A 4B29A 3S7EA 4D7TA 3BPZA 3CEWA 2PAKA 4E2SA 5I8YA 4QGNA 4UXAA 1RC6A 4Z07A 4PJYA 4QGMA 4IEYA 2D40A 4OLLA 4YYOA 2B8MA 2EA7A 5KHGA 2QJVA 3B02A 3LAGA 1ZZ7A 5FLJA 1NE4A 1O4TA 3ACLA 2PQQA 3IDCB 4WZCA 1RGSA 3E5UA 4ONUA 1CAVA 2DCTA 3GYDA 2OYZA 4XF0A 2H0VA 1VJ2A 4Q0QA 3SMHA 1O3TA 2HJIA 3WW1A 4HZFA 4IESA 4HVRA 4XF4A 5FQ0A 4EV0A 1ZVFA 4OFGA 3TNPB 1LB2A 4MGKE 3HT2A 1GQHA 4FBFA 1UD1A 4YRDA 2UY9A 4Q0PA 4AVCA 4A2UA 4GULA 3JZVA 4META 2H6CA 1O5UA 2XL7A 3UKVA 3E6BA 4X6QB 5K8SA 5JSOA 4EROA 3EHKA 4ZU7A 4I2OA 3EQEA 5I8TA 4PIZA 2GC1A 4JTNA 3RNSA 5JCTA 2K9ZA 4YARA 3H7JA 4JV4A 4FAHA 1CX4A 1O7FA 3KGLA 4AXOA 3CO2A 3ROUA 3NKTA 4N9IA 2WC2A 4HVQA 3EJKA 4I0BA 4F7ZA 2UYAA 1DGRA
chains in the Genus database with same CATH superfamily
4GKYA 3SCHA 2HWC1 4YZ2A 3ILNA 5AC92 2GU9A 1M4WA 2GN7A 1BHGA 3FX3A 3LWCA 3NAPC 3B9CA 4GB31 3O1SA 1UZVA 4UFHA 5GZDA 1DYKA 1CZTA 3KV4A 5AVPA 2NN8A 3RJ2X 5CBLA 2R6QA 4AI9A 3OGGA 4Q4X1 3AZYA 3N4MA 2VPVA 1F4HA 1VBE3 3TBDA 5L7OC 5M0TA 4LBOA 1WA6X 3O1UA 3O7OA 2VVEA 5JI9A 3T0AA 5A7NA 2UURA 2V4AA 1PX4A 3LFMA 4JVAA 3JD71 1LU1A 1MS1A 4BHPA 2OUJA 2VBPA 4QXCA 4K8FA 4P08A 4UW6A 4D94A 2W94A 4MGZE 3LFIA 3Q8CA 3SHRA 4WM8A 3T1LA 3DXTA 2GNBA 3N9OA 3AKQA 3NSTA 1ZBE1 3DCQA 3NJZA 4FP2A 1ZRFA 5FLIA 3LEIA 2WQZC 2HWF2 3JBG1 3MBWA 3MIHA 4EN8B 1OLMA 1ENSA 2D93A 1SACA 3RZZA 3AL5A 4AI2A 1L7LA 2HWC3 4D8MA 4FPKA 5KWRA 3MW3A 2RS51 3KMHA 4OUEA 5DAVA 1GZCA 4PLOA 4AEDB 2WAOA 3QLQA 2E32A 2JG9A 3CL1A 3GDBA 4QX0A 2BOIA 1Y3TA 1MVQA 1WD3A 2W0XA 3L2YA 1W8UA 4Q4X3 3ZFGC 1A3KA 3AYDA 4NMIA 3U75A 5FTTC 3KHBA 5A3WA 1W0PA 2YU2A 4FPOB 4DFSA 4EN6B 1JYWA 1COV1 1AR91 1W05A 4QGLA 4B3NA 2WO7A 2EXKA 2CSGA 4UI9L 1HV1A 2PAEA 5LEKA 2YB7A 4CU8A 4R8HA 1W6NA 1PO23 4ASLA 2WNUB 3ZDVA 4BXSV 1H2LA 4CDXB 4BWOA 1OLQA 2Q4SA 4AEJA 3S6PA 2VM9A 4UAPA 5JR2A 1DQ6A 2JG8C 3IB3A 3SKVA 2VZUA 4N8MA 1ZBA1 3CNAA 3P6BA 4ARYA 1DGLA 5C5UA 5C3SA 3ATGA 1UKRA 1H9WA 2J1TA 1AYM2 1HIXA 1AR72 1H1AA 2XKPA 3HPNA 1URXA 3KLSA 1FAYA 2P34A 5FYTA 3VHRA 3D3AA 1SEFA 3CIHA 1OUXA 5F7UA 3SCGA 1COV3 2UWBA 3LB9A 1PZ8A 1PM4A 2GC2A 1GMMA 4H3WA 4EN0A 2VCCA 2BNMA 2YROA 3KVAA 4AZZA 1HV0A 1XNBA 3LDKA 3DYOA 3WLUA 4CXWA 5KHIA 3NV2A 3LA2A 3O1VA 1IHMA 1R092 1SCRA 2GH8A 2YMZA 1SHWB 4NIGA 2XUEA 1WA4A 5FZDA 5F32A 1NY71 2R0FA 4TXWA 4XILA 1ZBA3 4XDOA 1UF2C 3JCIA 5FK8A 3DPRC 4RGAA 4XQWA 1HB4A 2HWF1 3LZZA 3POWA 3ZVXA 2KR2A 4LOSA 2B46X 1RYYA 4CDUB 2I74A 1DGWA 5DAXA 5AC93 3BTYA 4Z92B 5K0UB 5A6ZA 3HVDA 4QX3A 5CFCA 1YQ8A 3RZKA 3PLQA 3OUJA 4LK6A 1W9FA 2XJQA 2HWB1 1HW5A 3ZFEB 2R30A 4XCBA 4K40A 1CPNA 1JOBA 1XNKA 1IQDC 4IV3C 4OUMA 2ZMLA 3VBSB 1ENXA 3WNPA 3CMGA 3RRDA 3LEMA 2ARAA 4CEYC 4SLIA 3SH4A 2BNNA 4WVWA 1PHMA 1UCXA 4IQPA 2IFRA 4H7MA 1HB3A 4AW7A 2IC1A 4CEWA 2D6LX 5C7GA 2PTMA 1NG0A 2WWJA 3A22A 2HWF3 4XJZA 5FLHA 4DPNA 2GSYA 4JZRA 1BVVA 2LALA 4AFAA 2ZS6B 2B4KA 2LM3A 3GJBA 1EV12 1H6YA 2AZ5A 2PHRA 2XXZA 1DYPA 3B93A 4JHTA 4L8QA 3WQ1A 1JZ7A 3CJIA 4Y20A 2Z2SB 1DCSA 1W2OA 1OQEA 4NOTA 2JDPA 3ETQA 1TZOA 1C28A 1HJGA 3U0ZA 3AXEA 5A3NA 1S0GA 5E88A 2ZEZA 4FTEA 1ULGA 1JH5A 2GZWA 2LW8A 2BFUS 1X50A 2VOVA 2D98A 3AP6A 4QPIA 3KT4A 3OPZA 5FK7A 4TTGA 5JOXA 1GWMA 1R091 1ACCA 1BYHA 1LHWA 3PVNA 2FDHA 3I2IA 4LPLA 2D3PA 4M00A 2DUPA 1V9U1 4E2QA 2IXLA 2VY0A 2VR4A 1W90A 1W99A 3PJQA 4GJZA 1SPPA 4BK5A 3ZOIA 3ON7A 1OOPA 2W5FA 3WG3A 1C5IA 2D43A 1AYM3 4LEJA 1N3PA 1AR73 1I5PA 3WINE 3ZYRA 1MEC2 3AL6A 4O61A 4ATFA 5DUUA 4EE2A 1C3HA 1GOGA 2YY1A 4XF9A 1ULPA 3M1HA 2ZGMA 4XJUA 1MZ5A 1Q5OA 4N9HA 3JXSA 1OC1A 4R9DA 4P5HA 2BBVA 3AMMA 3DL3A 4MZUA 4JC1A 2V5YA 1B35A 1CAVB 3DKQA 2GN3A 1R093 2WZPP 5LK5A 1ND2A 4CU9A 5H9RA 4UFKA 1YIPA 2DU0A 2CDPA 4A6SA 5FZ0A 2H0BA 3FMGA 5JXGA 4BE3A 4G9SB 2QQLA 1Z0HA 2VC9A 3OGSA 3WF1A 1N3OA 4BISA 3ZSKA 3ACFA 5KBFA 2FZ2A 5A3TA 5IVJA 3AFGA 3IPVA 3WDXA 4Q0VA 1QJEA 4Z1VA 1I6XA 4UOJA 3VDDB 5A1AA 4W8JA 3PURA 3POEA 5FYZA 3UESA 2BZDA 3ES1A 2BV4A 3H8UA 1AF9A 2Y26A 3FBMA 3WF3A 4JCKA 4BB3A 2Q0AA 1QOTA 1NCQB 2VBDA 4COWA 1OLRA 3VBUC 4CP2A 1KFXL 3WW2A 3OSDA 2CTVA 2QE3A 4P9YA 4CE8A 4CCCA 1VBA2 1XE7A 2K0GA 3IT8A 2RDNA 1QJX2 1ZRIA 4MUVA 4RR3B 3S5QA 2VO5A 1C57A 1AJOA 4AVVA 1HB2A 4E4ZA 3I7DA 4Q29A 3KWVA 1NQDA 1RITA 1UWWA 1ZRRA 1EPZA 4P9LA 5GZGA 2LS6A 3X29B 5A3UA 4XJ9A 5A33A 2XDVA 5GLTA 5FOBB 4Q0UA 4ZXEA 2WA3A 2C5DA 2X10A 4Q4W2 2QQKA 1F2NA 2BYVE 4CP9A 2VMHA 4IDZA 1AX1A 2VNVA 4M0NA 4ZU4A 4LITA 1IKPA 1A8DA 2ATFA 1EV13 4COYA 4IEQA 2XVLA 1U12A 4MHRA 3I59B 3CLPA 3SH5A 5FZ4A 5LASA 1MEC1 1O4YA 2ET7A 2BDRA 1H2NA 3ZFFB 2ZGOA 1UL9A 1YYNA 3OY8B 4R4XA 4AQ2A 5IVVA 1O4ZA 3ABZA 4IEPA 2XGXA 3T0BA 2NQYA 5I8SA 5C4WB 4LBJA 2DWRA 3H42B 3J7LA 2HBTA 4WZFA 2W68A 3KQ4B 1XRUA 3HJRA 5DABA 3USUB 3LIHA 1STMA 1W3XA 5FZEA 3H3UA 1H2MA 1LOAA 2DVDA 4UBGA 3BKZA 4HT1T 4E8CA 2VNOA 2GALA 1WW7A 1WKYA 2DCZA 2X05A 3PIJA 4CCOA 2OUHA 2TBVA 1CJPA 3SKJE 1W6PA 4IETA 4D7SA 3KHCA 1LHUA 3LDBA 1DU3D 4P9GA 1F4AA 1VB2A 2W46A 2ZHLA 5FY7A 1WLWA 2C26A 1QJZA 4QPGB 5JDBA 3OTFA 4I01A 1MEC3 4YZ3A 4MGIE 3ACGA 3DN7A 5KC6A 2PHXA 2R072 1TNFA 2GMPA 3B00A 2AR6A 3MHZA 4HLTA 5CKQA 4YM0A 5FO7B 4XUNA 3ZM8A 1Y9GA 4B1LA 4LLOA 4C8DA 3S5AA 3VBOB 3J7MA 3OYWA 4ASMB 4LK7A 5FKCA 5EXOA 2B7YA 1VBA1 1GP4A 1GZ9A 3RG0A 5F3CA 1J1TA 2HEYF 3K48A 5LATA 2FCTA 3VD5A 4A7ZA 4RQPB 1FX5A 3KV6A 3BIEA 2EXJA 1PM7A 1LTEA 4JAAA 1RJ8A 5GKAC 1S0EA 3ZN6A 4AEDC 4Q8LA 3LA7A 4HPKB 4GH4A 1PIV1 4Y22B 2KD7A 1ULCA 2R062 4W65A 4LNVA 2JE7A 1VALA 3SCFA 3AJZA 2DTYA 5E89A 2WINB 3KCYA 4B8EA 2OQ7A 1Y4WA 2VTXJ 2Y64A 1WMXA 2A6YA 1GSLA 1CAWA 3R05A 4P00B 5FYYA 1H2KA 3CJXA 3IIIA 4CCNA 5E6HA 1S2KA 1DZQA 1UZWA 1Y43B 2WNUC 1WMDA 2B9VA 3POJA 4UT5A 4XURA 4CDXC 1NA1B 2PHLA 3CZUA 5CVRA 4N43B 5DN2A 3N7KA 4IL7A 3T0DA 1VBA3 1O3RA 5FBZA 1QJX3 1H1IA 3OEAA 5IK7A 2QVSB 4MGYE 4Y4YA 2VMIA 1F5JA 1Q3EA 3M70A 3JB4C 4QB1A 1DLLA 3ELNA 1Z7S2 3V64A 3ZX7A 1W6QB 2E7AA 2ZGNA 3FZ3A 4FQ4A 2F4LA 2X5IB 3W58A 5L7OB 5LA0A 1PZ9A 2IVJA 4ISQA 4URTA 4HBNA 3ETPA 4COUA 5FQ0B 2VE1A 2IVIB 4O9GA 5EYXA 2DVBA 1RB8G 3SQOA 4Q4W3 3ZMOA 5BNPB 4KQ7A 1YFYA 2VQ0A 2LUWA 4WBBA 2H6BA 2VTFA 3H1YA 1RUF2 4GAZA 1I1EA 2ZACA 2EALA 3MLLA 2XJRA 1XPWA 4GALA 4EWEA 1J3QA 3WNMA 5BY5A 2ZGRA 2VQUA 5FKBA 5FXVA 3O1TA 2R071 2HKXA 1RHI1 3HQXA 4MGSA 5HI0A 5C8WA 1CVNA 1S4CA 4IV3A 2XVKA 1QQP1 2J1RA 3H8RA 1MVEA 2RHPA 1MACA 4IE6A 4E2SA 3ZFGB 1RC6A 3TEYA 4CDUC 5FXZA 3M3CA 3QD6A 4XJWA 3VBHC 3WD5A 1LJ7A 1HB1A 1RXGA 1W6MB 4QKDA 3ZXLA 1R1ZA 3FL7A 2VAUA 3P3NA 4AHZA 4YYOA 2D40A 2XONA 3UL2A 5FYMA 3WNOA 5C71A 5KHGA 2OT7A 3WF0A 2W47A 1AJKA 4P9XA 2QJVA 4XAAA 4JHZA 2P3JA 4PLMA 1NE4A 4IGQA 2Y8KA 1UYXA 3ACLA 3GZEA 3VBSC 3QBQA 1OBNA 3VHOA 2PQQA 2A3WA 4OHXA 3A7QA 4GWMA 2R073 4DZGA 4WZCA 2BQPA 2WLPA 1W9WA 4ONUA 2AH2A 4G3YC 2OYZA 2RR12 4XJ8A 2GMMA 4E4HA 5C8CA 1BJQA 2WT2A 4JDNA 1MS9A 1BBT2 4HVRA 3ZSMA 3AFKA 2E33A 2NZ9A 4OFGA 4V2WA 1JOJA 1W8TA 4OVEA 3W9AA 5F3EA 3WNNA 1NX9A 1QNWA 3AZVA 2R063 3BIWE 4FFHA 4AVCA 2B42B 4Z8BA 4A2UA 3VHNA 5FZLA 4NPRA 2H6CA 1REEA 4YFZA 2D6KA 2GDFA 2VMDA 4HG6B 4A42A 1RUF1 3AVRA 3R4DB 1YI7A 3LCPA 3E6BA 4UFMA 4OYUA 4AQTA 4IW3A 2E53A 2ES3A 3EQEA 5I8TA 3FLRA 3I2KA 4YW4A 2AENA 4YWAA 5JLVA 1JBCA 4MG2A 4AL9A 1VAMA 5JCTA 1IOAA 3GHNA 5GLVA 2Q8OA 5JOYA 3WUCA 2K9ZA 1KJRA 3T08A 3KGLA 3CO2A 1Z7S3 3LSDA 4UFLA 3NKTA 3MLKA 3O0XA 4E4SA 3ZYHA 4OI0A 5FMOL 2RDSA 1MZFA 2FCUA 2RM22 3RYRA 1UYYA 4CEYB 3KS7A 4MXWA 5KHKA 4AOCA 3DUIA 3GF6A 4IE5A 2QUOA 3AVSA 5HCAA 5J36A 4LJHA 1RUF3 1JYNA 1WWYA 3ZMNA 4YGEA 4Z82A 1WW5A 4BDVB 5B2GB 2OPKA 3VBUA 2ZMKA 2TEPA 1XSQA 2YBSA 4QQHA 1VRH2 1XE8A 2RDRA 3J26N 4HKWA 2QQOA 4CDWB 3VLBB 1PX3A 2RR11 4BQ4A 2PFWA 2PA7A 3THPA 3ZYJB 4K1ZA 3D82A 1XB9A 4INDA 1BBT1 1LOBA 5L9BA 1UU6A 1EY2A 1DP0A 3T30A 4QQPA 4LBNA 2IXHA 1MS5A 2QQJA 1NCQC 5F5CA 4GQ7A 1PO12 2GH2A 3SXWA 4UW3A 1ZNPA 2VTXA 5JMOA 3OGJA 2QQMA 4LE3A 4FSJA 3POSA 4RR3C 1GQPA 5ANNA 4AK3A 1OKQA 1NXD1 2PMWB 2AGSA 1LNSA 1UOJA 5BNOB 4RS5A 5KHHA 1UY3A 4NIHA 3EMRA 3APBA 3IMMA 1C1LA 1WLTA 1GWKA 2JX9A 4AHWA 2JIGA 2IWGB 4L97A 4Y24A 5DZFA 5IVFA 3LOBA 4BCUA 3WEZA 2ZCWA 4AFBA 1JZ2A 2RR13 2A3XA 3V65A 2WBKA 3J9SA 3FHIB 1UY2A 4QKNA 1JODA 1Y9QA 2VVDA 2QQPA 2DCJA 3EB7A 4I3PA 5FYIA 5E1RA 1FPN2 1W6OA 2IXKA 2PELA 4Y5SA 2A70A 3D4KA 5LY1A 5C3RA 2K2SA 5BPXA 4CDQB 1W0OA 5FZ3A 2BUKA 3ZFFC 4LO6B 3LDRA 5FWJA 3FLPA 3QH6A 2ZEWA 4LXLA 1ZRDA 1QJFA 4PT6A 5FY5A 3N9NA 5C4WC 4GB32 4AHYA 4OI4A 2IUWA 3WUDA 5FP9A 1RUI2 4Q8KA 2RVAA 1ENRA 3N36A 1JW6A 3GBGA 4BIOA 3ILRA 4URAA 1D7PM 1RJ7A 3P1IA 4DRVA 4CSWA 2A5ZA 5I0UA 3RWNA 1G9CA 2ZOEB 1DZTA 4RGGA 3JD72 4N7UA 2JJ6A 5CZKA 3FBYA 3WW4A 3VD3A 2VQAA 1JYTA 1PMJX 5FXXA 4B4RA 2BRTA 3ZYGA 4AVBA 1JZ8A 2OVUA 4QPGC 5FYBA 4AEDA 3N3HA 4BK4A 1YXWA 4R9BA 2RM23 5C9AB 1J3PA 1OPOA 5AVAA 1F31A 2RS52 2HYKA 5EWSA 1X7NA 5LA9A 5BNNB 3ZXAC 3LGRA 5KXBA 4LQRA 4P9JA 3SNMA 2MHFA 5FZIA 3OCPA 5T5LA 1R64A 2DUOA 2VULA 4COZA 3BU0A 4MHUA 4PIXA 3C7OA 3RVHA 2ET1A 1UXXX 1E5SA 4RQPC 4CDXA 2WA4A 1PGW1 3CZJA 1UPSA 3PUSA 4C0HA 3B94A 1VRH3 1J3RA 2Q30A 2R49A 3H0OA 3B7MA 4LHKA 3BTXA 4NIDA 3QACA 1JS9A 2FDGA 3NJYA 2V72A 4LLFA 5H9QA 2W1QA 5FPBA 1JTZX 3KVBA 3OEBA 2Y6GA 3GXUA 1FPN1 3OBRA 4FP3A 4AEMA 3WNXA 2YYOA 4NJ4A 1SBDA 4DQAA 1HN1A 3A0NA 5C3QA 2YZ4A 1IZ3A 1PO13 4XUOA 3VKNA 4X8NA 3NO8A 2UYBA 1NA1C 4H55A 3C7FA 1N1SA 4W50A 3GM8A 4N43C 4UF0B 2AEYA 1LOFA 5BUVA 2VMGA 1DF0A 4L2NA 4KWJA 5HV4A 1K5MA 3CKHA 4A7KA 1F5FA 2TUNA 1XNCA 2DDUA 3H3ZA 1W8FA 3VDCA 1WMEA 1RUI1 3TEXA 1IG3A 4GMP1 2FQPA 1A8MA 4X8PA 4BLIA 1D2SA 2X5IC 4XABA 3SEPA 1GNZA 3ZSLA 4LTAA 5C33A 2GMEA 3Q8BA 5AFBA 2CGOA 2D5FA 4FO9A 3HQRA 3I3MA 2BNOA 4AGGA 4AVAA 4NHMA 5BNPC 2JDKA 2NLRA 4OI1A 5HXMA 1NY72 4BQYA 4CDUA 1FPN3 2WL1A 1HDKA 3K2OA 2LRPA 4HL0A 4QM8A 5EPAA 3U10A 3C8XA 2EAKA 3RZJA 4RYDA 2WFF2 5T54A 4GKXA 1PNFA 2OZ6A 5K0UA 4OI2A 3SH3A 1B09A 1T2XA 1YIFA 1IPSA 3IMNA 2ZHMA 1APNA 3K75B 4CPBD 3BI3A 3LE0A 1ND3B 2NP0A 1QXJA 2DFCA 1FOD2 4MH0E 4AI0A 3UGFA 3ZFEA 2VZSA 1JYIA 4GB33 4EWDA 4BIFA 3OBTA 3VBSA 3WP5A 1Q43A 1RUI3 2F4PA 4GMP3 4PBOA 2WRAA 1UX7A 2HWB2 3OB8A 4YFWA 2EVXA 4QKBA 1LEDA 3GCWA 4EJRA 4HFSA 1YLLA 4U2AA 1QXPA 4O65A 5D2AA 5EP9A 2Y6HA 3WG1A 4DIQA 1LOEA 4LIVA 1NLSA 3JD73 5DDJ2 5HCHA 1EPWA 1XE0A 2YG0A 1M06G 4AQ6A 2E26A 2XG3A 1RUJ1 4LHLA 4Z2WA 2WJSA 5HCBA 5T50A 2CHHA 5FV3A 3GCXA 4COVA 1ZBE3 1ZRCA 1O8SA 1S2EA 3I3DA 2WFPA 3KZ4C 3R0RA 4OHZA 3JBG3 1CAUB 1SZBA 4CCDA 4CXYA 2VW0A 3OG2A 2A6ZA 4MLOA 4XUPA 3VD7A 3ZN4A 3S30A 2XQRA 3AK0A 3HBKA 3LEGA 2RS53 2SLIA 3AYCA 3B3QE 1IQAA 2WYSA 1VB4A 2QQNA 1N1YA 2ARBA 3ES4A 3DYPA 3MI8A 3ZXEA 1HRV1 3RJRA 4FOWA 1SLTA 2Y6KA 3VZKA 1LGNA 3B9IA 2VD7A 4LR4A 4B7EA 3RFRA 5JWPA 3J8F1 3IAPA 3K51A 1AR93 5JOWA 4UW4A 4XHXA 1QEXA 2BGCA 2W9XA 3C7HA 5FZ1A 5FY0A 4DXRA 2JE8A 1VBC1 3R4UA 4QT6A 1UN1A 3NQHA 4I3GA 4CPBA 1X8MA 1OI6A 1FNYA 1WBFA 2YBKA 2OKXA 4JDMA 4AI3A 5A70A 1G9BA 1VMJA 1V9U2 1T6GC 1HX6A 1YJLA 1GP5A 2J1VA 4LBLA 5ABJB 1H8TC 1UY4A 4HMZA 5I93A 5J09A 1XOYA 1ULEA 4GWIA 5LA1A 4CRQA 3PVOA 1S0CA 3IDBB 3UJQA 2WFF1 2D5HA 4F8AA 1FV3A 1OSGA 2DYCA 4I02A 1QHDA 4MADA 2Y60A 1CGPA 1OD3A 1REFA 2FDIA 3DECA 1FOD1 3NV3A 5JVVA 3ST7A 1DQ2A 3KV9A 3VBHB 3ZPYA 2J42A 1SQ4A 2D6OX 1L7QA 5FRAA 1Q8QA 4ATEA 1RUH1 1PVXA 3PUIA 4D7YA 4OHWA 1PZ7A 3URFA 4S2DA 3T3YA 1DZRA 3T2TA 1HRI2 5FZKA 1KDKA 2RJ2A 1US3A 1SFNA 3K3OA 2GC0A 5C6CA 4PF1A 5FMCA 3HN1A 3K77A 4XIKA 5DDJ1 5DAPA 2FHRA 4FPHA 2XOMA 3GZAA 4KNCA 3VDDA 5ANQA 1SCSA 4NRPA 2WO2A 1JOPA 1GOHA 4GIQA 4MVTA 3ZIWA 2IXIA 2WFF3 4LHNA 1V0AA 3I2HA 2JDMA 1NCQA 1ZYBA 1MPXA 1H0BA 1PGSA 5FMDA 2AREA 3MDPA 2VMEA 3BGAA 1FOD3 4YW3A 4XFIA 1C8NA 1KEXA 1RINA 2VXJA 1PK6A 2YPDA 4NPMA 1QH6A 4CDWC 5AFEA 4RR3A 3VV1A 5IVEA 2QBXA 1BXHA 2WDBA 1ZA7A 2EAAA 4QM9A 4QDQA 1GICA 2ZAHA 3C3VA 4D3WA 3H8OA 4AQSA 2DV9A 2HWB3 1QDOA 3M3QA 3FHAA 1UXZA 5CAZA 2XLFA 2R1DA 5F3GA 5F9TA 4ZKTB 4YLZA 5F2SA 1C5HA 2J1EA 1W6NB 4LULA 2JECA 3U4SA 1XNDA 3WHTA 4CA9A 1SMVA 2X29A 3UKNA 1NCRA 1O3QA 2Q1ZB 3MIGA 1S0FA 3T2OA 4DXTA 2VG9A 4CUCA 1G8WA 3R6SA 2P4EA 1HXS1 1GOFA 5BNOC 1TG7A 3RZMA 2IZWA 2VQTA 2NPIA 3OY8A 3HMYA 4S2FA 1SBEA 1U5XA 3G7DA 1H8VA 2RV9A 5C4WA 2XJVA 1S55A 1WCKA 2CAVA 2R16A 2CAUA 4P9WA 2W1SA 4WM7A 4R9AA 3WNLA 5T3NA 4XXAA 3USUA 4E4DX 1AXZA 5CB7A 3RI8A 3WT3A 4AYUA 4Y26A 4NIAA 3U11A 1HRI1 2VZQA 3AP4A 3FJSA 4M01A 4HSJA 1GANA 4M3CB 3RPQA 4CDQC 4KWLA 1OA2A 1V6NA 2VUAA 3WDUA 2J1AA 5EJ3A 4NHKA 3AMQA 5A3PA 1J59A 1V6KA 2VZ3A 3I8TA 4IEXA 1V9U3 5FO9B 4QPGA 5A7PA 2FDKA 4HANA 2JDYA 2GNTA 1JU4A 1G9FA 2ARCA 4L99A 3T2PA 3KT1A 1ZZ9A 3MPBA 3AP7A 3PNAA 4NN0A 3I3EA 3VBOA 5L19A 4GA9A 1D4M2 2E9QA 5KHJA 1GZWB 1JZ6A 2YHJA 1YWKA 4ZONA 5H9SA 5CFCB 1IG0A 1W03A 4QU1A 3RYPA 1WCDJ 1ZA4A 4RQPA 1WCQA 4IV1B 3AZZA 3WF2A 2P6HA 3MW4A 1WCSA 3JUUA 1UY0A 1HRI3 2DBNA 3ZXDA 3S7EA 5JXHA 5K4LA 3MPPG 4HPKA 3FC0A 3CEWA 5I8YA 3MV01 2OQ6A 1E57A 5C9AC 1OVPA 3B5LB 3M3EA 1JU3A 2OPWA 3SEEA 5BNNC 1AUYA 3W20A 4FPCA 1PIV2 2HH9A 4JX0A 4B4PA 2XPJA 1EUUA 2RS12 2ZBJA 1MQTA 1W2UA 2XBO1 2Q8EA 1V6LA 2VCMA 3WVJA 1OF4A 2OX0A 3HD8B 5FLJA 4Z2AA 3UGGA 1YQCA 3WCSA 1NA1A 4L9BA 3M4FA 4N43A 5A7WB 4FFGA 1AX2A 3JB8A 4D6SA 1LHNA 2W1WA 3NAPA 1TMF2 1D0GA 3TAYA 4LO8A 4Y20B 1GU3A 3E5UA 2ORXA 3HNYM 4CCMA 3E1F1 2ZGUA 4Y1XA 5FY9A 4DEVA 4FQZA 5L7OA 4CCLA 4YZ5A 1JZ5A 1CX1A 3VN4A 5CA6A 3G6JB 3TEWA 4W6XA 3WW1A 2VZPA 4IESA 3LKJA 4Y1ZA 3ZPOA 4XF4A 5FQ0A 1VBB1 1JI6A 4DO0A 1ZVFA 5ISLA 2VUJA 4MGKE 2WZR2 4RHV2 4LBQD 2ZABA 4LKFA 2D3SA 1GQHA 4FBFA 5E8AA 1LU2A 1SPPB 2Y34A 4OULA 3OPTA 4XZUG 4Q0PA 3ZXKA 3M2MA 3KD4A 3LD8A 1O5UA 2XL7A 5A6XA 5H9PA 2P1BA 2ARXA 5IFPA 3S57A 1WD4A 5FO8B 1AYN1 1YCIA 2Y38A 2JDNA 2ZGQA 1S0IA 5K8SA 1IGOA 4A6OA 1D4M1 4ZU7A 2WSUA 5CG9A 2AC1A 3ZFGA 1RHI2 1GBGA 3AKSA 3WNKA 2X53S 3AYEA 3F2ZA 4N53B 4YG6A 1W6MA 1QQP2 1O7FA 4AXOA 1R1A2 1ND2B 2JDAA 2ZHNA 1UO9A 3POBA 4OZXA 4AGVA 4N9IA 1ND3C 1U5YA 2DF7A 3EJKA 4I0BA 4F7ZA 4XPVA 1REDA 2JG8A 2CWMA 4HONA 4QX8A 5F39A 5G04L 3CHXA 4YVWC 3DV8A 4QDSA 5IYYA 1CWPA 1IS3A 3FUOA 1VMFA 1QY4A 3ENRA 2RS11 2OZJA 3WP3A 2JD4A 4LMFA 1QH7A 4K8RB 4AF9A 1IS4A 1TME1 5B4XA 4MV2A 3ZYBA 2N7GA 3EXUA 5FMBA 5L73A 1J83A 2YPJA 1DIWA 1BCXA 1D4M3 4C91A 1OF3A 1TMF1 1ZZ8A 1LHVA 4M4PA 5FP7A 4LBQA 4E2GA 4NWVA 1CAXB 2R041 4XFBA 4YVSB 4ZS2A 5DUXA 1KS4A 4FXKB 3AKRA 1I5ZA 2QQUA 3EYPA 3FFZA 2ERFA 1W9TA 2OS2A 4XDPA 1CD3G 4DY5A 2P37A 4ARXA 5LRSA 2DVAA 1AVBA 2D3RA 1H9PA 3WX5A 3KCXA 5HCFA 4XYXA 4EZHA 4W6WA 3IDAA 1DDLA 1WUVA 2RJLA 1RXFA 1OPMA 1S2BA 2WZR1 1PIV3 4RHV1 4I30A 4TLFA 5A33B 5A3LA 3OGRA 1OA3A 4DEQA 5A1LA 3DPRA 4C1WA 1OQDA 5C70A 3LIGA 3MF6A 4LUMA 2RS13 4XETA 1UYZA 5IK8A 2R1BA 5FREA 4CP9B 4CZSA 1ZZBA 3V0BA 4YW7A 5FCCA 3CU7A 5GLWA 1JHNA 1VPHA 2DURA 3E5QA 4QB6A 3F95A 3M7AA 1OQ1A 2Z42A 1TMF3 5F5AA 4HKLA 2GC3A 5A1FA 1OUSA 2C9KA 2YFUA 4CP0A 4KL1A 5KR7A 1BK0A 1YUDA 3MICA 5ABJC 3PTRB 1A78A 4RL7A 2HWE2 2ZA9A 2YUEA 1PVC2 3AJYA 4CEYA 4ES8A 2Z5WA 2Z79A 4WVVA 3AMHA 3WG4A 3LA3A 1R1A1 1X82A 2E31A 2WZR3 4QPWA 1ZZ6A 4K9SA 4RHV3 2Q1FA 2ZHKA 2XL9A 2MNGA 4Q27A 3H1WA 1GR3A 2F6BA 1OHFA 4CU6A 1XNAA 3J7HA 2XB6C 3POGA 1W6PB 4FPGA 4H7LA 5FIXA 2DVGA 5JXIA 5KXEA 2ZMNA 4YG0A 3FFQA 4DINB 1UW8A 1F15A 2BU9A 2R7EB 2YC0A 5EIYB 3VKLA 2WQ8A 3ZR6A 4YSFA 4KWUA 2VZRA 1MZEA 3RI9A 4ZHNA 1BMV1 3ECQA 1OKOA 2XQXA 1FNZA 2ZGKA 1L7RA 4QXBA 2ZGTA 3OOXA 4NROA 2DU1A 2D6NA 1W04A 2FDJA 5L36A 1RHI3 2DVFA 4XFGA 5E16A 5DG2A 4CUGA 2HWD1 2ETEA 2XJPA 4NR1A 2I45A 1QQP3 2DUQA 4KG0A 2WS92 1G9AA 1UYPA 2ZZQA 2P17A 1G7YA 4I0AA 3RYKA 4E27A 3Q8EA 5F5IA 5I91A 4RFRB 1E5RA 1XYPA 1UU5A 4JQTA 2XWBB 1WW4A 1SLBA 4KU8A 5BNOA 4FCAA 4FT8A 5T55A 1LHOA 4PI2A 1H8TB 5FJKA 5I0DA 3TB0A 1BLZA 3MYXA 5CFDB 1W06A 4GMP0 5FFOC 3J7NA 4AAXA 3RS6A 4PDWB 2UWAA 5A3MA 5F1RA 3T2QA 2O14A 4HXCA 2VBBA 2LTNA 5DQ0A 5KC5A 1ULFA 1N47A 4XJAA 2HWE1 2O0OA 1Q8VA 2WIIB 5IK4A 3I2OA 1CONA 2YBPA 1PVC1 1FYUA 1CZSA 3A4UA 4Y4RA 4OUSA 1UY1A 4YNIA 4CP1A 1XC6A 5JMCA 4FPJA 2WZ8A 4ASKA 2X09A 3NV4A 5EZWA 5FPUA 3UYJA 4R4ZA 1PMIA 5FZ8A 1L3JA 3KQRA 3WDYA 4F3JA 2MPFA 4XIOA 4JKLA 3CBNA 2BPA2 3T4HB 4JRAA 3NW4A 3J4UH 3L2HA 4BQ5A 3WP4A 5FYUA 5FZFA 5EV7A 1HQWA 2RMU2 5FY4A 2A6WA 4WVMB 2W1UA 2PHFA 2XJTA 4YM1A 1H30A 1US2A 2J7MA 3HNMA 4FFFA 4XC9A 3VZNA 4XTPA 1I3HA 2CWSA 3VDAA 3BCWA 2FZ1A 4LKSA 1S0BA 4RN5A 2HWE3 3N9QA 5FYSA 1PVC3 1DYOA 2ZEYA 4JGYB 4MGQA 4ZS3A 4B7KA 5C9AA 4PIYA 2WS91 3RQ0A 1VRBA 4QXKA 1GUIA 4FPLA 1W8NA 2J1SA 4ZPIA 5DPNA 5BNNA 4QX1A 1RVF2 5FPAA 1V6MA 2CYFA 2ZGSA 4CVUA 3WXPA 2W87A 2JDUA 2ZKNA 3C7GA 5CFCC 2D7FA 3GGLA 3ALQA 3MIEA 1RUD2 4IV1C 4DOUA 3FUQA 1X33A 1D4VB 2XH6A 3RMXA 2O8OA 1YNAA 1NLRA 3HQUA 5FPZA 3NV1A 5DUWA 2WKKA 4BOWA 3EBRA 2FMDA 4JQRA 5DUVA 1WBLA 1UX6A 3HNBM 3HWJA 2DTWA 3RSJA 2G4IA 5I0TA 1UOGA 1ONAA 1PGW2 1H4GA 5JPNB 2PHTA 3DYMA 2YDEA 2CGNA 2Y6JA 4FOYA 2CL2A 4CEWC 3AC0A 4O9EA 4RD7A 4OHVA 1QDCA 3VZJA 2VL4A 1XJAA 4EYUA 3V0AB 4L11A 1FT9A 4U36A 3LOIA 4Q5OA 4TWTA 2WS93 3U14A 5FPVA 4ZZ5A 1BBT3 2XMLA 1ST8A 3N9PA 4XFAA 1ULDA 2ADEA 4NO4A 4BZ4A 4P14A 3PTYA 4UF0A 4E8DA 4FTSA 4ET7A 4BQ3A 2C4XA 3JQXA 3FE5A 4J1WA 3KV5A 3THDA 2W2IA 1IS5A 1S0JA 4ITCA 3ZSEA 1C8M2 5B4NA 1LOGA 3WSOA 3ZN5A 1KJLA 1RUNA 4LOTA 1QOOA 2W92A 4TZDA 1QNYA 2PN5A 5CISA 4HK9A 5T52A 1K42A 1JZ4A 1NOVA 1EAH2 1GNHA 4CCKA 3U4XA 3KM5A 4DXZA 1KXGA 2P2KA 1CQ9A 1YFUA 2RG4A 2RMU1 2P3YA 4FI9A 5JZGB 2VZ1A 5CADA 3B69A 5CEHA 3R4SA 4XAEA 4EWAA 3HEIA 4EN7B 1S0DA 3NVCA 3POYA 1Q8PA 4IXLA 4XBLA 3VHPA 4Y5Z0 4DUXA 4XMAA 2WN3A 4MO3M 3TWIA 3WF4A 1ND3A 3VB9A 3VL9A 1X9PA 3MZHA 1G86A 3A0KA 4DB5A 3N7JA 1QWRA 1YC61 3I2DA 2BVBA 2YC4A 2W3JA 3LPGA 4A4AA 3UGHA 5BV6A 2E7QA 2VXRA 3D0SA 1RVF1 1O6UA 1VMHA 4MXWB 5IAXA 4IEUA 5CKNA 3MIDA 4DUVA 3WHUA 4XE9A 2XR4A 2VNGA 1RUD1 1JHJA 3GZTB 3PMEA 4N53C 1BK1A 4QKFA 5IJRA 4K3UA 5SV5A 3TN92 2KA3A 5A32B 5FAXA 4CCEA 2ILMA 2RMU3 1VBD1 3VBFB 3BB6A 5HV0A 1QXRA 1ND2C 1UU4A 4Q1PA 2O8QA 2WNUA 2WT0A 5CFDA 3VBRB 5LBEA 4FVVA 3NJXA 3ZR5A 2WO3A 2PHUA 1OMIA 3HAGA 3QCWA 3ZO0B 1CAUA 5K9YA 3T1MA 4J1XA 4FOQA 3KF5A 5IFTA 2BWAA 4PQ9A 4C0BA 3I97A 1RUJ2 5EYYA 5C3OA 1VR3A 3O12A 5FUPA 4P9IA 3ZXGA 4IE0A 5D8AB 1VAVA 1BVP1 1LULA 4N7IA 4A3ZA 4AE2A 1XU2A 1K3IA 1RVF3 2VECA 2OIIA 3OF1A 2Q8CA 2C24A 4FFIA 4NHYA 3WV6A 2XWJB 2ZEXA 4NAOA 4YVSC 4BQXA 1C8M1 1DFQA 2WWSA 1LRHA 3A23A 3A21A 3MEPA 1ZREA 1HRV2 4HETA 1TQ5A 4YW5A 2DCKA 4LBKA 3HN3A 1JYVA 1EAH1 1NKGA 4RSUA 3O1PA 4OMDA 3J8F2 4KBZA 1W2TA 3TNQA 2RJKA 3PVBB 3VZLA 4X6RB 4JKKA 3DEMA 3OGVA 4NHLA 1VBC2 4Q2FA 1C1FA 1SDDB 2B5HA 3GBFA 1DQ0A 1ENQA 1V70A 4HKOA 4UBHA 5LBFA 5LRRA 4BQWA 2VOWA 5C3PA 3IWZA 1UAIA 4DS0A 5LW9A 1W6OB 2QDNA 4KWKA 2PQSA 4BYYA 3ITQA 2D97A 3VBHA 1POQA 3ZXFA 3S7IA 3O1MA 1LR5A 4XDQA 4IERA 1TEIA 5LZ6A 3BTAA 3SISA 1AL22 2ZZJA 5C5TA 4QXHA 2JDHA 1C8M3 4FTBA 2UU8A 1SFPA 3S0MA 4XXPA 2BW8A 4FXGB 5GZCA 2E6VA 4WV8A 4CXXA 4IE4A 2IFWA 3KGZA 4ZZ8A 2ZPXA 3O14A 1LENA 4YVWB 1EAH3 5F2WA 1MZ6A 1DQ1A 1OT5A 1RUH2 2ZGLA 3Q8AA 4KBBA 4LBMA 3SLIA 3TN91 4W6YA 2E7TA 4N90A 2XJSA 1PO21 3I2JA 3P5BA 5KXCA 4NRQA 1YRZA 1R082 2EIGA 1W2AX 2C9AA 2JD9A 1RIRA 1RTVA 3TYJA 1UPIA 2VMFA 2AEZA 1HKDA 2WNEA 3E5XA 3N35A 1NQJA 4ORFA 5BXXA 3E6CC 2DBIA 4HVOA 1OLME 5FZOB 2WNVB 1O91A 2JB8A 4B4QA 3OD0A 1KRIA 2OW4A 3HBZA 3O1RA 3K4AA 1AR82 5JOZA 1N1VA 1DQ5A 1UZYA 4PF5A 1QF3A 4QQLA 3UKTA 2BWCA 4JGZB 4UW5A 1ASJ2 2JB4A 3PUQA 1S1AA 3TN93 1LAJA 4BPZA 4GWJA 4XF3A 1MR5A 1V6OA 3WY6A 1O3SA 2CGPA 4XQDA 4FOVA 3DGTA 4C90A 1K45A 1RL3A 4B29A 4D7TA 4LE4A 5DAWA 4TLGA 4LKEA 5SV8A 2PAKA 3ACIA 4NHXA 3SITA 4GH4C 4UXAA 3MV11 4QHOA 1QJY2 1CR7A 2BERA 4P5YA 1W2NA 4YGCA 4E9KA 4FPEA 1RUJ3 5CYYA 4AHXA 5GZEA 4QGMA 4DY3A 5FUNA 2B8MA 2EXIA 3HR9A 1OH4A 5AC91 1HJFA 1HXS2 5CFDC 1TVGA 3Q9OA 1QOSA 3B02A 3LAGA 4NWWA 1UKGA 1XXNA 1ODMA 4PDWC 1RUE2 3U37A 1AL21 1SLCA 3NMBA 4Y33A 4LT5A 1CPMA 2ZX3A 3N9LA 5FXWA 1HRV3 2C1FA 2ZX0A 1K5MB 1JMUB 2VOTA 4XUQA 4M3CA 3AMPA 1CAVA 2KM2A 3RZHA 1WLCA 1OA4A 4XF0A 3J8F3 3NNMA 4K21A 4M3CE 4KGQA 3SMHA 2HJIA 2WLQA 3K46A 4HZFA 2P6CA 1VBC3 1GV9A 1R081 2WSVA 2ZX4A 4FPYA 4EV0A 2TNFA 4BMEA 3USSA 3TNPB 1LB2A 3UJOA 3HT2A 2ZGPA 2HLEA 4YGBA 4WM8B 1UD1A 1NZIA 2UY9A 4GULA 3JZVA 4META 1GZWA 4W4ZA 4YG3A 5DZGA 5IUQA 3I49A 1W28A 1WMFA 1UMIA 4NAMA 1AL23 4TN7A 1CZVA 3MFCA 1OXCA 2RE9A 1AR81 3UKVA 4SBVA 1Z78A 4IV1A 3P3PA 3THTA 5LY2A 2AYHA 5JSOA 1ASJ1 2JG9B 4QU2A 3ZYFA 4QD2A 5GLUA 3ORJA 3KF3A 5LA2A 2VUDA 4DXSA 4JGYC 2B45X 1RUH3 3O5SA 1KGYA 4PIZA 2NM1A 2RS32 5IVYA 3U1XA 5JSPA 4JTNA 5APAA 3PU3A 3RNSA 1A34A 3O0WA 4AFDA 2JIJA 3IN9A 1R083 3POIA 4K7JA 3H7JA 1V6JA 5FYCA 4FAHA 2D6MA 1AX0A 1KS5A 2EIEA 3LPFA 4S2HA 1JUIA 1QJY1 2CU5A 5DDJ3 1ODNA 4HVQA 2UYAA 2WT1A 4RA0A 2VNRA 1DGRA 4PJYA 1POV1 3I54A 1AYM1 2A1XA 4V1PA 1AR71 1DHKB 5A7WA 1VP6A 5JXJA 3I59A 4HOOA 2XBO2 3OUHA 1N1TA 1XYOA 3ZFFA 1AR83 3WDWA 3C7EA 2LROA 3NNFA 1RUE1 1W39A 4LO7A 5D1IA 1CIWA 1ASJ3 2VOKA 1KITA 1X8EA 4CU7A 5C8CC 2BTVC 4NVPA 4BQ2A 2WWUA 2XLGA 4Q0SA 1SLIA 5A7OA 2PYTA 2VCAA 5F8PA 3RMYA 4MGTA 3D6EA 1UNBA 4XW3A 2ZX2A 2OXBA 3VKMA 1H1MA 2ORZA 2W52A 2QQWA 2L9LA 2VGDA 2YGMA 1W3VA 1GP6A 4AFCA 1QJY3 1VBB2 5IAVA 1JZ3A 4EN9B 3OBZA 4BLJA 1DGRN 1POV3 3MIFA 5BYNA 1LGBA 2Y6FA 3GZUC 4Y5TA 5I0SA 2FD8A 1QGLA 1YFWA 5J98B 1HXS3 3AX4A 3D0JA 4UFJA 4AWDA 1F8VA 1WLDA 2D6PA 3BUCA 2PLV2 4QHZA 1RUE3 2AUYA 3O1OA 1AYN2 5JZGC 3NNJA 4FPFA 5FWEA 1UMZA 4D69A 4EZ4A 5J37A 2HYXA 5I0RA 4XFHA 4N53A 4L92A 2P3KA 2KXLA 1XNTA 4MX3A 1W0NA 2W95A 4KMQA 4G4FA 1CN1A 2YU1A 4LA3A 5GLZA 3BTZA 1LODA 1XBFA 2WNOA 1CIYA 4D6RA 1YHFA 2MEV2 2RS31 1KQRA 5DAQA 3BOWA 4CCJA 4J25A 3BALA 1FI2A 3ASIA 4LUKA 3OJBA 5ACA2 1IPKA 4KG8A 4Y22A 3NWKA 3KB5A 5FZMA 4QB2A 2E51A 2WZEA 3JU9A 1ULOA 2JKXA 4OQ9A 4PQQA 4AFMA 3WW3A 4ES9A 3DF0A 1PGL2 1NAEA 2G9GA 4J6GA 5EHDA 1EV11 2IXJA 1GYKA 4S2GA 5FZ7A 4CEWB 3VZOA 2VJXA 3MIBA 3H7YA 2G19A 4LIUA 2ZKLA 3VBFC 2E63A 4GZ9A 1TME2 3VBRC 1CAXA 1WGPA 2Z69A 4YVSA 3POFA 1D0HA 5LEJA 5JIUA 3O0VA 5FZGA 1PK6B 4A41A 2A71A 3CJIB 3OD4A 3TOJA 1VE0A 2VMCA 4QMAA 1G6NA 1LESA 3AP5A 5J7MA 2Q5TA 5IT6A 1U5IA 2HBUA 5DG1A 5BNQA 2R042 2W08A 4H2AA 2UY8A 1RUC2 4WVZA 4YZ4A 2RS33 1GQGA 1W8ZA 2WAAA 3AZXA 4NE9A 4Q26A 1W6QA 5D8AC 3IKWA 5IVCA 2X5IA 5CKMA 1LOCA 2BFUL 5HBAA 1YQ2A 2R0HA 3ACHA 3RZGA 4QPIB 4LA2A 5TSWA 3UT0A 2I07B 2A3YA 2A73B 5BNPA 1XU1A 4JRLA 4A7YA 1NCRB 1F9KA 4YZ1A 1JYCA 3WDVA 3BVCA 4Y1YA 1UQXA 4QX7A 1Q8SA 4Q4V2 4DNYA 2R32A 1OOPB 1QKQA 2XBO3 4RS5C 3NNLA 5J3UA 2JENA 5IK5A 2NYYA 4XQ4A 2PLV1 2X8KA 4V2VA 5FP4A 1JYXA 2NMOA 2ZTNA 1X36A 4QX5A 5CIRA 2PAMA 2Y0IA 5JR7B 1UZ0A 2VW1A 4WM7B 2P5BA 4B1MA 2GAUA 1DQ4A 1AXKA 1F35A 3AP9A 1SG3A 1X9TA 2J22A 2VU9A 1OH3A 2MEV1 5LBCA 1TE1B 1AR62 4JTOA 2ZX1A 1E5HA 5GM0A 3C2UA 4XVHA 5ACA1 2ZXQA 1B35B 4XOGA 3K4ZA 4YW6A 1VBB3 3HOBA 2FDFA 2CV6A 3ZLIA 2DFBA 1MS8A 1DLCA 3UETA 5EJZB 3N7MA 1PGL1 4CUBA 3HIFA 2VUCA 2ID4A 4K1YA 2CY6A 1SBFA 2PLV3 1V00A 3IPVB 4XCAA 5IATA 4XF1A 3L9JT 5A6YA 1MS4A 1AYN3 1SLAA 5FJHA 5J96B 3ZDSA 4KI5M 4DUWA 3PJYA 1BMV2 4PBPA 5JIAA 1OFSA 1QJX1 3MGUA 3WZ1A 2OA2A 3ZKYA 1H6XA 1GNYA 4RFT0 3KCCA 3KSCA 1O8PA 3GHMA 1DG6A 4KU7A 1RUC1 3ZYIB 2HWD2 1H4HA 1EP0A 2MEV3 2NMNA 3GNEA 2PHWA 3MUY1 2WNVC 4XFFA 5ACA3 1C4RA 1WW6A 4DRRA 4F83A 1J1LA 1A6CA 1ZX5A 4M3CF 3TRSB 1YQ6A 4BXFA 4D0QA 4HN0A 4NUBA 1FMD2 4XFCA 3NJVA 4GWNA 4Q4W1 2A6XA 3IDEA 4JGZC 2VZOA 4Y1UA 3WOGA 2FMYA 4A45A 4M4RA 4MXVA 2ADDA 1H8TA 1UOBA 3EO6A 2V5DA 3H9AA 4CTEA 1Q56A 3BODA 3AKTA 4YARA 5KXDA 1KD7A 1QIQA 2VOXA 2W91A 1RUOA 3BOPA 1LCLA 1MQTB 1UIJA 4Q4V1 4PDWA 4ZXKA 5IW0A 4AEKA 5EFUA 1TME3 4IEWA 4QQOA 3QOPA 5GZFA 1NZCA 2YC2A 2BJSA 2W39A 1J58A 1BZWA 1BQPA 5FZ6A 3WCRA 3I4IA 3NAPB 3WQ0A 4LORA 3E97A 2WO1A 1PNGA 4QWNA 4YGDA 4FAGA 1YQ5A 2R043 5T5OA 1FV2A 1RUC3 3IAQA 4XHBA 1JN2P 3W5NA 1IS6A 4TYSA 1NE6A 3CDZB 4IUGA 4LKDA 4R9CA 3IZOA 2G9ZA 1AR61 5FPXA 5FMOS 2WQ4A 1FXZA 4BU2A 2WUHA 3DXUA 5FR3A 1I9RA 2QFEA 4PI0A 3BN6A 2Y0OA 4PLNA 5T5JA 2XJUA 1LOFC 1YFXA 4K6BA 1K5JA 4XEZA 1K5MC 1AL0G 2VCBA 4Q4V3 1IKQA 5GJ6A 3VKOA 2K46A 2BOJA 3ZYPA 4A3XA 1W8WA 4WVMA 4BH9A 2FCVA 3B01A 1AHSA 2VZTA 1WCUA 4OHYA 1KFUL 3T4VA 3THCA 2O1QA 3HT1A 1EYBA 3ME2A 2QNKA 4C1XA 5JI7A 3MW2A 1RMU2 5F6LB 2CDOA 4CDWA 3K4DA 3I2FA 4Q4Y2 5L9RA 3E6DA 1CESA 1LECA 3OUIA 4JGYA 3PU8A 4R52A 5FYVA 3PMSA 1U0AA 4OMCA 5G05L 5FZHA 3PL0A 2HEVF 3RZLA 2V09A 3VZMA 4AI1A 1DBNA 4RGKA 4WM8C 2JE9A 3OYWB 3UK9A 2GP3A 1AR63 3WR0A 5FY8A 2YV8A 4BQ1A 5JAXA 5K0UC 3WQ7A 3MLJA 1D2QA 5F6KA 4IEVA 2R061 1R1A3 3PUHA 1FMD1 3M3IA 1GFF2 3ZFEC 5FZ9A 3ZN6B 1T6BX 2JG8B 2B9UA 2JG9C 1XQNA 2QCSB 3CQOA 3M8LA 4GH4B 1NLQA 4QQ2A 4UWDA 5JPMB 4ZU5A 4YW2A 4XMIA 3VGIA 5J48A 2XVGA 4KH9A 3U07A 1KDMA 4YPJA 2AACA 2A75A 3N7LA 1CAWB 2V4VA 3MF9A 3V0AA 1W9SA 4LBQB 2A7AA 4ZY9A 1BKZA 1NUKA 3U78A 5A7QA 2HWD3 3LF7A 3QH7A 1Z7S1 1GLHA 1LEMA 3H50A 1W9YA 2CNAA 2XLAA 4CDQA 2D44A 1V6IA 2XKOA 4HN1A 2JEMA 1W8HA 5IVBA 2A6VA 1FMD3 2QTWB 4AAPA 4XBQA 3H1MA 4PCRA 5LK7B 1QJU2 1NXMA 3MFAA 3K3NA 2GP5A 3UV9A 2JXAA 4D6QA 3NRUA 3W21A 5FZAA 2G9FA 3AXDA 5K7PA 1HQNA 2C0ZA 2YGLA 3NL1A 3GALA 4AVTA 3DPRB 3VDBA 3VUOA 5J1XA 5D21A 1K12A 2FBEA 5FPLA 2JDZA 5JSRA 1GZTA 4GD4A 2JICA 5JZGA 3V0BB 4UFIA 2GNDA 3DKWA 2EICA 3I2GA 1NYWA 2ZAAA 3IM0A 1RMU1 5EJ1B 1N3QA 4Q4Y1 4IEOA 4AVSA 4PHZA 1UIKA 2BP6A 2EF6A 4IE7A 1QMJA 1FATA 2BGPA 3D5OA 2ZJCA 4LHSA 4CUAA 2IXCA 4IV3B 2QQVA 4LO4B 4QDRA 1O59A 5A7SA 4HSLA 3FLTA 4I09A 4UYBA 1E5IA 3UNPA 1WZXA 1SDWA 3LQCA 4CYDA 3KT7A 2Z4FA 2J1UA 1DGWX 3FHQA 1GKBA 1YEWA 4L0PA 3PIGA 1RUG2 2JWPA 5ERLA 3OBAA 5CU1A 3CF6E 5GALA 4BJ0A 1P8JA 3IBMA 3ILFA 5A32A 4EQVA 2YXSA 5FUIA 2VW2A 2Y6LA 1SLLA 1OD5A 4P02B 4NRMA 3VBFA 1OURA 3VBRA 2XUMA 1UMHA 2PHDA 3M3OA 3PDQA 5FZCA 5LCWL 3FWEA 1JUHA 3AMNA 2QZ3A 4Q1RA 3VL8A 5JUVA 1RMU3 4IEZA 1YI9A 3NKGA 3AM2A 1VBD2 4Q4Y3 1VAKA 1BEV2 3FN9A 4MSVA 4BMBA 5EQUA 2V73A 2BEOA 4MYEA 3VDDC 2I2SA 5D8AA 1LKNA 2F17A 3AYAA 1QU0A 4QHBA 3LEKA 3OPWA 1LGCA 2BBAA 4AG4A 3RWKX 5C8CB 2VZVA 3RDIA 3IIAA 3VD4A 1OVSA 1PMHX 4TSVA 3BU7A 4QX2A 2JKBA 1QJU1 4NIIA 1CJDA 2EIBA 1PK6C 2QDRA 3Q8FA 3MO4A 2RDQA 3CJIC 4GJYA 1IPJA 1O5LA 1VIWB 5F37A 5FDBA 1ZZCA 3WQBA 3VD9A 2WYFA 1HQLA 3W59A 2PXJA 3ZSJA 4AR2A 3BYWA 4XACA 1AXYA 2WR9A 3JQWA 1OFNA 4DMIA 5HPOA 5A80A 1VBE2 4K20A 2XHKA 4OZOA 5T5PA 2SBAA 1MS3A 3NNGA 3SC7X 3AKPA 3AZWA 3H8XA 5CG8A 4YW1A 4QPIC 3H3LA 3GBWA 1UZZA 1EUTA 1VLNA 3BPZA 4M0HA 1YJKA 1NCRC 1XYNA 4QGNA 4AI8A 1U5ZA 4Z07A 4IGPA 1JXNA 5FY1A 5A6QA 2QKDA 3T09A 4JKMA 5FBJA 4ISRA 1OOPC 2B39A 2HEWF 4XBNA 3RGBA 4YM3A 2RM21 3PUAA 4O7XA 5DMYA 2HWC2 2YFZA 1Y9MA 4IEYA 4OLLA 2EA7A 3WP6A 1QJU3 1UOFA 5F5QA 5FP8A 1GWLA 1ZZ7A 1RUG1 1W8OA 2EXHA 4XZPA 4YVWA 5FZBA 2ENRA 5FOJB 3ZKUA 4YM2A 1O4TA 4WM7C 5DXDA 4BA6A 4Q4X2 2EIDA 2Y33A 2P3IA 1XSRA 4BM8A 3IDCB 5IHRA 4GXLA 1RGSA 5LB6A 1VRH1 2DCTA 3GYDA 4OQ8A 3WG2A 4KGGA 1B35C 2WN2A 3LSEA 3V56A 3TEZA 2H0VA 4JDOA 1PO22 3I3BA 1VJ2A 1BEV1 4Q0QA 2Q8DA 1O3TA 3VBUB 4MOAA 2XHNA 1SFYA 1AZDA 1ZBE2 5DZEA 3PHMA 5FZOA 2WNVA 1ALYA 1Y7BA 3JBG2 5LBBA 1HLCA 3AB0A 3INAA 1POV0 4HK8A 2UWCA 4XTMA 4OCTA 4XUTA 4AGRA 1HN0A 5L9VA 4YRDA 1PO11 1ZM1A 2BGOA 4JGZA 1MS0A 5F3IA 5HXVA 2QQIA 2VVFA 3VBOC 3WDTA 1RUG3 5FYHA 5FP3A 3GJAA 1J84A 1TNRA 4H14A 1Q8OA 4I0WB 4A44A 4X6QB 1COV2 4EROA 1AR92 1RUD3 2GNMA 3EHKA 4I2OA 1VBE1 2VH9A 5IWFA 2Q1MA 3ZIXA 4QPYA 4QAWA 5A3OA 1VBD3 2G1MA 4RS5B 4IGOA 4Y3OA 1BEV3 2GC1A 2BVVA 2DCYA 3PVEA 1NT0A 5CNAA 3N9MA 4Y1VA 1YO8A 2WABA 4JV4A 2QZ2A 1CX4A 2C6SA 3BPSA 4LO5B 5ABJA 1ZBA2 3W5MA 3ROUA 3I3QA 5LWBA 4NPLA 2WC2A 3D8CA 3ZXJA 3VKFC 3MUZ1 1MQTC 1G9DA
chains in the Genus database with same CATH topology
4GKYA 3SCHA 2HWC1 4YZ2A 3ILNA 5AC92 2GU9A 1M4WA 2GN7A 3FX3A 3LWCA 3NAPC 3B9CA 4GB31 5GZDA 1DYKA 5AVPA 2NN8A 3RJ2X 5CBLA 2R6QA 3OGGA 4Q4X1 3AZYA 3N4MA 2VPVA 1VBE3 3TBDA 5L7OC 4LBOA 3O7OA 2VVEA 5JI9A 2UURA 4JVAA 3JD71 1LU1A 1MS1A 4BHPA 2OUJA 4K8FA 4UW6A 4D94A 4MGZE 3SHRA 4WM8A 3T1LA 2GNBA 3AKQA 3NSTA 1ZBE1 1ZRFA 3NJZA 4FP2A 5FLIA 2WQZC 2HWF2 3JBG1 3MIHA 4EN8B 1ENSA 2D93A 1SACA 3RZZA 4AI2A 2HWC3 4FPKA 5KWRA 3MW3A 2RS51 3KMHA 1GZCA 4PLOA 4AEDB 3QLQA 2JG9A 3CL1A 1Y3TA 1MVQA 1WD3A 2W0XA 3L2YA 4Q4X3 3ZFGC 1A3KA 3AYDA 5FTTC 1W0PA 4FPOB 4DFSA 4EN6B 1COV1 1AR91 4QGLA 4B3NA 2EXKA 1HV1A 2PAEA 5LEKA 4R8HA 1W6NA 1PO23 4ASLA 2WNUB 1H2LA 4CDXB 4BWOA 1OLQA 2Q4SA 4AEJA 3S6PA 1DQ6A 2JG8C 5JSPA 1ZBA1 3CNAA 1DGLA 3ATGA 1UKRA 1H9WA 1AYM2 1HIXA 1AR72 1H1AA 2XKPA 1URXA 3KLSA 1FAYA 2P34A 3VHRA 1SEFA 3SCGA 1COV3 2UWBA 3LB9A 1PZ8A 2GC2A 4H3WA 4EN0A 2BNMA 2YROA 1HV0A 1XNBA 3WLUA 5KHIA 3NV2A 3LA2A 1IHMA 1R092 1SCRA 2GH8A 2YMZA 1WA4A 1NY71 2R0FA 4XILA 1ZBA3 1UF2C 3JCIA 3DPRC 4RGAA 4XQWA 3LZZA 2HWF1 3POWA 3ZVXA 2B46X 4CDUB 2I74A 1DGWA 5AC93 4Z92B 5K0UB 5CFCA 3PLQA 2XJQA 2HWB1 1HW5A 3ZFEB 2R30A 4K40A 1CPNA 1XNKA 4IV3C 4OUMA 2ZMLA 3VBSB 1ENXA 3RRDA 4CEYC 4SLIA 3SH4A 2BNNA 4WVWA 1PHMA 1UCXA 4IQPA 2IFRA 4H7MA 4AW7A 2IC1A 4CEWA 2D6LX 2PTMA 1NG0A 4XJZA 5FLHA 2HWF3 4DPNA 2GSYA 1BVVA 2LALA 4AFAA 2ZS6B 2LM3A 1EV12 2AZ5A 2PHRA 3B93A 4L8QA 1DYPA 3WQ1A 3CJIA 4Y20A 2Z2SB 1OQEA 4NOTA 3ETQA 1C28A 3U0ZA 3AXEA 1S0GA 5E88A 4FTEA 1ULGA 1JH5A 2GZWA 2BFUS 1X50A 2VOVA 2D98A 3AP6A 4QPIA 3KT4A 3OPZA 5JOXA 3PVNA 1R091 1BYHA 1LHWA 4M00A 2D3PA 2DUPA 1V9U1 4E2QA 2IXLA 2VY0A 3PJQA 1OOPA 3WG3A 1C5IA 2D43A 1AYM3 4LEJA 1N3PA 1AR73 3WINE 3ZYRA 1MEC2 4ATFA 5DUUA 1C3HA 2YY1A 4XF9A 3M1HA 2ZGMA 4XJUA 1MZ5A 1Q5OA 4N9HA 4R9DA 4P5HA 2BBVA 3AMMA 3DL3A 4MZUA 4JC1A 2V5YA 1B35A 1CAVB 2GN3A 1R093 2WZPP 5LK5A 1ND2A 5H9RA 1YIPA 2DU0A 2H0BA 3FMGA 4BE3A 4G9SB 1Z0HA 1N3OA 3ZSKA 5KBFA 2FZ2A 3AFGA 3IPVA 3WDXA 4Q0VA 4Z1VA 1I6XA 3VDDB 3ES1A 3H8UA 1AF9A 2Y26A 3FBMA 4JCKA 2Q0AA 1QOTA 1NCQB 4COWA 1OLRA 3VBUC 4CP2A 1KFXL 3WW2A 2CTVA 2QE3A 4P9YA 1VBA2 1XE7A 2K0GA 3IT8A 1QJX2 4MUVA 4RR3B 1C57A 1AJOA 4AVVA 4E4ZA 3I7DA 4Q29A 1NQDA 1RITA 1ZRRA 1EPZA 4P9LA 5GZGA 3X29B 4XJ9A 5A33A 5GLTA 5FOBB 4Q0UA 2WA3A 2C5DA 4Q4W2 1F2NA 2BYVE 2VMHA 1AX1A 4M0NA 4ZU4A 4COYA 1IKPA 1A8DA 2ATFA 1EV13 4IEQA 2XVLA 1U12A 3SH5A 3I59B 3CLPA 1MEC1 1O4YA 2ET7A 1H2NA 3ZFFB 2ZGOA 1UL9A 1YYNA 3OY8B 4R4XA 4AQ2A 1O4ZA 4IEPA 2XGXA 2NQYA 5I8SA 5C4WB 4LBJA 2DWRA 4WZFA 2W68A 1XRUA 3USUB 3H3UA 1H2MA 1LOAA 2DVDA 4UBGA 4HT1T 2VNOA 2GALA 1WW7A 2DCZA 2OUHA 2TBVA 1CJPA 1W6PA 4IETA 4D7SA 1LHUA 4P9GA 1DU3D 1VB2A 2ZHLA 1WLWA 4QPGB 1QJZA 5JDBA 3OTFA 4I01A 1MEC3 4YZ3A 4MGIE 3DN7A 5KC6A 2PHXA 2R072 1TNFA 2GMPA 3B00A 2AR6A 4HLTA 4YM0A 5FO7B 4LLOA 3VBOB 3OYWA 4ASMB 5EXOA 2B7YA 1VBA1 1GZ9A 3RG0A 1J1TA 2HEYF 3K48A 4A7ZA 4RQPB 1FX5A 2EXJA 1PM7A 1LTEA 4JAAA 1RJ8A 5GKAC 1S0EA 3ZN6A 4AEDC 4Q8LA 3LA7A 4HPKB 4GH4A 1PIV1 4Y22B 1ULCA 2R062 4W65A 4LNVA 2JE7A 1VALA 3SCFA 3AJZA 2DTYA 5E89A 2WINB 3KCYA 4B8EA 5CFDA 2A6YA 1GSLA 1CAWA 3R05A 1H2KA 3CJXA 1S2KA 1DZQA 1Y43B 2WNUC 1WMDA 4CDXC 1NA1B 2PHLA 5CVRA 4N43B 3N7KA 4IL7A 1O3RA 1VBA3 5FBZA 1QJX3 1H1IA 5IK7A 2QVSB 4MGYE 4Y4YA 2VMIA 1F5JA 1Q3EA 3M70A 3JB4C 1DLLA 3ELNA 1Z7S2 3V64A 3ZX7A 1W6QB 2E7AA 2ZGNA 3FZ3A 4FQ4A 2X5IB 3W58A 5L7OB 1PZ9A 4ISQA 4URTA 4HBNA 4COUA 5FQ0B 4O9GA 5EYXA 2DVBA 1RB8G 3ZMOA 4Q4W3 5BNPB 4KQ7A 1YFYA 2VQ0A 2LUWA 4WBBA 2H6BA 3H1YA 1RUF2 1I1EA 2ZACA 2EALA 3MLLA 2XJRA 4GALA 4EWEA 1J3QA 5BY5A 2ZGRA 2R071 2HKXA 1RHI1 3HQXA 5HI0A 5C8WA 1CVNA 4IV3A 2XVKA 1QQP1 1MVEA 2RHPA 1MACA 4E2SA 3ZFGB 1RC6A 4CDUC 3M3CA 3QD6A 4XJWA 3VBHC 3WD5A 1LJ7A 1W6MB 3ZXLA 1R1ZA 3P3NA 4AHZA 4YYOA 2D40A 3UL2A 5KHGA 1AJKA 4P9XA 2QJVA 2P3JA 4PLMA 1NE4A 3ACLA 3VBSC 3QBQA 3VHOA 2PQQA 2A3WA 4OHXA 4GWMA 2R073 4DZGA 4WZCA 2BQPA 2WLPA 4ONUA 2AH2A 4G3YC 2OYZA 2RR12 4XJ8A 2GMMA 5C8CA 1BJQA 2WT2A 4JDNA 1MS9A 1BBT2 4HVRA 3ZSMA 3AFKA 2NZ9A 4OFGA 1JOJA 4OVEA 3W9AA 1QNWA 3AZVA 2R063 3BIWE 4Z8BA 4AVCA 2B42B 4A2UA 3VHNA 4NPRA 2H6CA 1REEA 4YFZA 2D6KA 2GDFA 1RUF1 3R4DB 1YI7A 3LCPA 3E6BA 4AQTA 2E53A 2ES3A 3EQEA 5I8TA 3FLRA 4YW4A 2AENA 5JLVA 1JBCA 1VAMA 5JCTA 1IOAA 3GHNA 5GLVA 2Q8OA 5JOYA 3WUCA 2K9ZA 1KJRA 3KGLA 3CO2A 1Z7S3 3LSDA 3NKTA 3MLKA 3O0XA 4E4SA 4OI0A 5FMOL 1MZFA 2RM22 3RYRA 4CEYB 3KS7A 4MXWA 5KHKA 3DUIA 3GF6A 2QUOA 5HCAA 5J36A 1RUF3 3ZMNA 4YGEA 4Z82A 1WW5A 5B2GB 2OPKA 3VBUA 2ZMKA 2TEPA 4QQHA 1VRH2 1XE8A 3J26N 4HKWA 4CDWB 3VLBB 2RR11 2PFWA 2PA7A 3THPA 3ZYJB 4K1ZA 3D82A 4INDA 1BBT1 1LOBA 1UU6A 1EY2A 4QQPA 4LBNA 2IXHA 1MS5A 1NCQC 4GQ7A 1PO12 2GH2A 3SXWA 4UW3A 1ZNPA 3OGJA 4LE3A 4FSJA 3POSA 4RR3C 4AK3A 1OKQA 1NXD1 2AGSA 5BNOB 4RS5A 5KHHA 3APBA 1C1LA 1WLTA 2JX9A 4AHWA 2IWGB 4L97A 4Y24A 5DZFA 3LOBA 4BCUA 2ZCWA 4AFBA 2RR13 2A3XA 3V65A 3J9SA 3FHIB 1Y9QA 2VVDA 2QQPA 2DCJA 4I3PA 5E1RA 1FPN2 1W6OA 2IXKA 2PELA 2A70A 3D4KA 2K2SA 5BPXA 4CDQB 1W0OA 2BUKA 3ZFFC 4LO6B 3FLPA 3QH6A 1ZRDA 5C4WC 4GB32 4AHYA 4OI4A 3WUDA 1RUI2 4Q8KA 1ENRA 3N36A 1JW6A 3GBGA 4BIOA 3ILRA 1RJ7A 4DRVA 2A5ZA 5I0UA 3RWNA 1G9CA 2ZOEB 1DZTA 4RGGA 3JD72 4N7UA 2JJ6A 3FBYA 3WW4A 2VQAA 4B4RA 3ZYGA 4AVBA 2OVUA 4QPGC 4AEDA 3N3HA 1YXWA 4R9BA 2RM23 5C9AB 1J3PA 1OPOA 5AVAA 1F31A 2RS52 2HYKA 5EWSA 1X7NA 5BNNB 3ZXAC 3LGRA 5KXBA 4P9JA 3SNMA 2MHFA 3OCPA 5T5LA 4COZA 2DUOA 2VULA 4PIXA 2ET1A 4RQPC 4CDXA 2WA4A 1PGW1 1UPSA 4C0HA 3B94A 1VRH3 1J3RA 2Q30A 2R49A 3H0OA 3B7MA 4LHKA 3QACA 4LLFA 5H9QA 1JTZX 3OBRA 1FPN1 4FP3A 4AEMA 3WNXA 2YYOA 1SBDA 4DQAA 3A0NA 2YZ4A 1IZ3A 1PO13 3VKNA 4X8NA 3NO8A 2UYBA 1NA1C 4H55A 1N1SA 5BUVA 4N43C 1LOFA 2VMGA 1DF0A 4L2NA 4KWJA 1K5MA 4A7KA 1F5FA 2TUNA 1XNCA 3H3ZA 1WMEA 1RUI1 4GMP1 2FQPA 1A8MA 4X8PA 4BLIA 1D2SA 2X5IC 1GNZA 3ZSLA 4LTAA 5C33A 2GMEA 5AFBA 2CGOA 2D5FA 4FO9A 2BNOA 4AGGA 4AVAA 4NHMA 5BNPC 2NLRA 4OI1A 1NY72 4CDUA 1FPN3 2WL1A 1HDKA 4QM8A 3U10A 4HL0A 2EAKA 2WFF2 5T54A 4GKXA 1PNFA 2OZ6A 5K0UA 4OI2A 3SH3A 1B09A 1YIFA 3IMNA 2NP0A 2ZHMA 1APNA 1ND3B 1QXJA 2DFCA 1FOD2 4MH0E 4AI0A 3ZFEA 1JYIA 4GB33 4EWDA 4BIFA 3OBTA 3VBSA 3WP5A 1Q43A 1RUI3 2F4PA 4GMP3 4PBOA 2HWB2 4YFWA 2EVXA 1LEDA 4EJRA 4HFSA 1YLLA 4U2AA 1QXPA 3WG1A 1LOEA 1NLSA 3JD73 5DDJ2 1EPWA 1M06G 4AQ6A 2XG3A 1RUJ1 4LHLA 4Z2WA 2WJSA 5HCBA 5T50A 4COVA 1ZBE3 1ZRCA 3KZ4C 2WFPA 3R0RA 4OHZA 3JBG3 1CAUB 2VW0A 4MLOA 2A6ZA 3ZN4A 3S30A 3AK0A 2RS53 2SLIA 3AYCA 3B3QE 1IQAA 1VB4A 3ES4A 1N1YA 2ARBA 3MI8A 3ZXEA 1HRV1 3RJRA 4FOWA 1SLTA 3VZKA 1LGNA 3B9IA 4LR4A 4B7EA 5JWPA 3J8F1 3K51A 1AR93 5JOWA 4UW4A 4XHXA 2BGCA 3R4UA 1VBC1 4QT6A 1UN1A 4I3GA 1X8MA 1OI6A 1FNYA 1WBFA 4JDMA 4AI3A 1G9BA 1YJLA 1V9U2 1T6GC 1HX6A 4LBLA 5ABJB 1H8TC 4HMZA 5I93A 5J09A 1ULEA 4CRQA 3PVOA 1S0CA 3IDBB 3UJQA 2WFF1 2D5HA 4F8AA 1FV3A 1OSGA 2DYCA 4I02A 1QHDA 1CGPA 1REFA 3NV3A 1FOD1 5JVVA 3ST7A 3VBHB 1DQ2A 3ZPYA 1SQ4A 2D6OX 5FRAA 1Q8QA 4ATEA 1RUH1 1PVXA 4D7YA 4OHWA 1PZ7A 3URFA 4S2DA 1DZRA 3T2TA 1HRI2 1KDKA 5C6CA 1SFNA 2GC0A 3HN1A 4XIKA 5DDJ1 2FHRA 4FPHA 3GZAA 4KNCA 3VDDA 1SCSA 4GIQA 4MVTA 3ZIWA 2IXIA 2WFF3 4LHNA 1NCQA 1ZYBA 1PGSA 1H0BA 2AREA 3MDPA 1FOD3 4YW3A 4XFIA 1C8NA 1RINA 5AFEA 1PK6A 1QH6A 4CDWC 4RR3A 3VV1A 1BXHA 2EAAA 4QM9A 1GICA 2ZAHA 3C3VA 4D3WA 4AQSA 2DV9A 2HWB3 1QDOA 3M3QA 5CAZA 2XLFA 2R1DA 5F9TA 4ZKTB 4YLZA 1C5HA 1W6NB 4LULA 2JECA 3WHTA 1XNDA 1SMVA 2X29A 3UKNA 1NCRA 1O3QA 2Q1ZB 3MIGA 1S0FA 2VG9A 1G8WA 3R6SA 1HXS1 5BNOC 2IZWA 2NPIA 3OY8A 3HMYA 4S2FA 1SBEA 1U5XA 3G7DA 1H8VA 5C4WA 2XJVA 1S55A 1WCKA 2CAVA 2R16A 2CAUA 4P9WA 4WM7A 4R9AA 5T3NA 4XXAA 3USUA 4E4DX 1AXZA 5CB7A 3RI8A 3WT3A 4AYUA 4Y26A 3U11A 1HRI1 3AP4A 3FJSA 4M01A 4HSJA 1GANA 4M3CB 3RPQA 4CDQC 4KWLA 1OA2A 1V6NA 2VUAA 3WDUA 5EJ3A 4NHKA 3AMQA 1J59A 1V6KA 4IEXA 3I8TA 1V9U3 5FO9B 4QPGA 4HANA 2GNTA 1G9FA 4L99A 3KT1A 1ZZ9A 3MPBA 3AP7A 3PNAA 4NN0A 3VBOA 5L19A 4GA9A 1D4M2 2E9QA 5KHJA 1GZWB 2YHJA 1YWKA 5H9SA 5CFCB 3RYPA 1WCDJ 1ZA4A 4RQPA 4IV1B 3AZZA 3MW4A 1WCSA 3JUUA 1HRI3 3ZXDA 3S7EA 3MPPG 4HPKA 3FC0A 3CEWA 5I8YA 1E57A 5C9AC 3B5LB 3M3EA 5BNNC 1AUYA 4FPCA 1PIV2 4B4PA 2XPJA 2RS12 2ZBJA 1MQTA 1W2UA 2XBO1 3WVJA 1V6LA 3HD8B 5FLJA 3WCSA 1NA1A 4L9BA 3M4FA 4N43A 1AX2A 3JB8A 1LHNA 3NAPA 1TMF2 1D0GA 3TAYA 4LO8A 4Y20B 3E5UA 2ZGUA 4Y1XA 4FQZA 5L7OA 4YZ5A 3VN4A 5CA6A 3G6JB 4W6XA 3WW1A 4IESA 3LKJA 4Y1ZA 4XF4A 5FQ0A 1VBB1 1ZVFA 2VUJA 4MGKE 2WZR2 4RHV2 4LBQD 2ZABA 2D3SA 1GQHA 4FBFA 5E8AA 1LU2A 4OULA 3ZXKA 4Q0PA 3M2MA 3KD4A 1O5UA 2XL7A 5H9PA 2ARXA 1WD4A 5FO8B 1AYN1 1YCIA 2Y38A 2ZGQA 1S0IA 5K8SA 1IGOA 1D4M1 4ZU7A 2WSUA 5CG9A 3ZFGA 1RHI2 1GBGA 3AKSA 2X53S 3AYEA 4N53B 4YG6A 1W6MA 1QQP2 1O7FA 4AXOA 1R1A2 1ND2B 2ZHNA 4AGVA 4OZXA 4N9IA 1ND3C 1U5YA 2DF7A 3EJKA 4I0BA 4F7ZA 4XPVA 1REDA 2JG8A 2CWMA 4YVWC 3DV8A 1IS3A 3FUOA 1QY4A 3ENRA 2RS11 2OZJA 3WP3A 2JD4A 4AF9A 1QH7A 1IS4A 1TME1 4MV2A 2N7GA 3EXUA 2YPJA 1DIWA 1BCXA 1D4M3 4C91A 1TMF1 1ZZ8A 1LHVA 4E2GA 4LBQA 4NWVA 1CAXB 2R041 4XFBA 4YVSB 5DUXA 1KS4A 4FXKB 3AKRA 1I5ZA 3FFZA 2ERFA 1CD3G 4DY5A 2P37A 5LRSA 2DVAA 1AVBA 2D3RA 1H9PA 3WX5A 3KCXA 5HCFA 4XYXA 4W6WA 1DDLA 1WUVA 2RJLA 1S2BA 1OPMA 2WZR1 1PIV3 4RHV1 4I30A 4TLFA 5A33B 5A3LA 1OA3A 3DPRA 4C1WA 1OQDA 3MF6A 4LUMA 2RS13 4XETA 5IK8A 2R1BA 5FREA 4CZSA 1ZZBA 3V0BA 5FCCA 3CU7A 5GLWA 1JHNA 2DURA 3E5QA 3M7AA 1OQ1A 2Z42A 1TMF3 4HKLA 2GC3A 4CP0A 4KL1A 1YUDA 3MICA 5ABJC 1A78A 4RL7A 2HWE2 2ZA9A 2YUEA 1PVC2 3AJYA 4CEYA 4ES8A 2Z5WA 2Z79A 4WVVA 3AMHA 3WG4A 3LA3A 1R1A1 1X82A 2WZR3 1ZZ6A 4K9SA 4RHV3 2ZHKA 2XL9A 2MNGA 4Q27A 3H1WA 1GR3A 2F6BA 1OHFA 2XB6C 1W6PB 4FPGA 4H7LA 2DVGA 5KXEA 2ZMNA 4YG0A 3FFQA 4DINB 1UW8A 2YC0A 3VKLA 4YSFA 3RI9A 1MZEA 1BMV1 3ECQA 1FNZA 2ZGKA 2ZGTA 2DU1A 2D6NA 5L36A 1RHI3 2DVFA 4XFGA 5E16A 5DG2A 2HWD1 2ETEA 2XJPA 4NR1A 2I45A 1QQP3 2DUQA 4KG0A 2WS92 1G9AA 2ZZQA 2P17A 1G7YA 4I0AA 3RYKA 4E27A 5I91A 1XYPA 1UU5A 2XWBB 1WW4A 1SLBA 4KU8A 5BNOA 4FCAA 4FT8A 5T55A 1LHOA 1H8TB 3TB0A 3MYXA 5CFDB 4GMP0 5FFOC 3RS6A 4PDWB 2UWAA 5A3MA 5F1RA 2LTNA 5KC5A 1ULFA 1N47A 4XJAA 2HWE1 2O0OA 1Q8VA 2WIIB 5IK4A 1CONA 1PVC1 1FYUA 3A4UA 4YNIA 4OUSA 4CP1A 5JMCA 4FPJA 3NV4A 5EZWA 4R4ZA 1PMIA 1L3JA 3KQRA 3WDYA 4F3JA 2MPFA 4XIOA 2BPA2 4JRAA 3NW4A 3J4UH 3L2HA 3WP4A 5EV7A 1HQWA