1VR3A

Crystal structure of acireductone dioxygenase (13543033) from mus musculus at 2.06 a resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
179
structure length
179
Chain Sequence
MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acireductone dioxygenase
publication title Crystal structure of acireductone dioxygenase (ARD) from Mus musculus at 2.06 angstrom resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 43
structure length 179
sequence length 179
ec nomenclature ec 1.13.11.54: Acireductone dioxygenase (Fe(2+)-requiring).
pdb deposition date 2005-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1vr3A00
1RGSA 1Y9QA 2Q1ZB 5BV6A 1PM7A 1O3RA 4I3PA 3RNSA 4UBHA 1OFNA 5FPZA 1CAWA 5E16A 3DV8A 4AVBA 3LA7A 4AQ6A 2UY9A 3B02A 3ES4A 2XGXA 1CAVB 1RL3A 5C6CA 3R6SA 2IXJA 3IIAA 5FQ0B 1ZRRA 4X6QB 3FFQA 3G7DA 5JCTA 4BH9A 3ELNA 4NVPA 3ST7A 1ZRCA 3HIFA 4OLLA 4ORFA 2UY8A 4HN1A 4QGNA 4QM8A 3U0ZA 3ZDSA 4MGKE 3E97A 1G6NA 2BYVE 5I0UA 4LULA 4D7TA 4LTAA 1EPZA 2CAUA 1OMIA 4XF4A 4I01A 2IXKA 2O8QA 4MV2A 5CADA 3VHRA 4MX3A 1CAUB 3H50A 2Y0OA 2Z2SB 2DCTA 1UIKA 4YNIA 2PAKA 1Q5OA 3BU7A 2Z69A 3FWEA 4XETA 5EFUA 3WW2A 1UIJA 3LA2A 4XF0A 5JR7B 5JSOA 3KGLA 2XKPA 3E6BA 3U11A 3M70A 4B29A 3KSCA 3MDPA 1J1LA 5JAXA 2VQAA 3BALA 4FBFA 2OZ6A 1ZZ9A 1NZCA 4TLFA 3IDCB 3UKNA 5LRRA 2HKXA 2XLAA 1ZRDA 4DINB 4GULA 4EWEA 2MHFA 4I0AA 1DZTA 1QXJA 2GH2A 2B9UA 2OA2A 4XFIA 3SXWA 1IPKA 3SHRA 2CV6A 4Q0VA 1ZREA 4IEVA 4A2UA 4BIFA 1WGPA 5F1RA 2Q0AA 4HMZA 4AXOA 4E2GA 1L3JA 5BY5A 1NXMA 1ZZ7A 3MYXA 2OPKA 5I8TA 3FZ3A 1O3QA 2WFPA 2PYTA 4JTOA 4META 1UCXA 1X8EA 2ATFA 3SCHA 1RUOA 3CF6E 2ZCWA 4IEYA 4WZCA 1YHFA 4E2SA 4LUKA 1LRHA 5BUVA 1XE7A 1LB2A 2Q30A 3OCPA 1SEFA 1GQGA 4XFCA 4MZUA 1PMIA 5JSRA 3GBFA 4HVRA 2PAMA 3TNPB 5E1RA 3EBRA 2V09A 2P17A 3H3UA 3NKTA 1LKNA 4WBBA 5AVPA 4O9GA 3S7IA 1VP6A 2PQQA 5LEKA 4ZU7A 4FT8A 4FAHA 2K0GA 1NYWA 3LWCA 2PHLA 1EY2A 1Q43A 3H7YA 4ONUA 3U10A 1V70A 3EQEA 3PNAA 4IEQA 3E6DA 4Q0QA 4F8AA 1RUNA 5FLJA 1H1IA 2B5HA 3HQXA 3HT1A 3H7JA 3NJZA 3H3ZA 4Q0UA 4Q29A 1SFNA 1NE6A 4LA3A 3LZZA 5C8WA 5CVRA 2QDRA 5D1IA 1J3RA 4HSLA 1Q3EA 3FHIB 2PTMA 5KHJA 2PHDA 5CU1A 2PFWA 1QY4A 2PA7A 1O5LA 4UBGA 1EP0A 4KU7A 1EYBA 1CAWB 3OD0A 5I93A 5JSPA 2C0ZA 3S7EA 3H1WA 2H6CA 1SQ4A 3EHKA 5BXXA 4YARA 4PJYA 3GYDA 5K8SA 5J7MA 5I0TA 1ZZCA 3WW4A 3I59B 1O7FA 1CAXA 3IDBB 3D0JA 1UW8A 2H0VA 4IEXA 3D82A 4WVZA 4QM9A 4EROA 1X82A 5I0RA 1ZVFA 2BEOA 2UYBA 2XL7A 4LA2A 4PIZA 1XRUA 4Q0SA 4EV0A 1WLTA 1ZZ8A 4MGZE 4QGMA 4O9EA 4D7SA 2ETEA 1RC6A 4IEWA 5I0SA 1FXZA 3FX3A 4XFFA 2EA7A 2K9ZA 3DN7A 3C3VA 2ET1A 4MH0E 1ZZ6A 4JVAA 1RTVA 2XLFA 1YFXA 3RDIA 2QVSB 1ZZBA 4JV4A 3NVCA 1YUDA 4YRDA 1I5ZA 4KU8A 5J3UA 1H1MA 2QNKA 4I0BA 2XHKA 5I8SA 2E9QA 4JTNA 4KWJA 2IC1A 4LUMA 1IPJA 3WW1A 2KXLA 1FI2A 3UKTA 1LR5A 3ROUA 3H1MA 3M3IA 3QOPA 3CO2A 5HI0A 1UPIA 3I7DA 4Z82A 3CL1A 2D93A 3RPQA 3RYKA 4H7LA 2B8MA 4L11A 2GC3A 3OTFA 1O5UA 3OF1A 5I8YA 4HZFA 2CAVA 3RZZA 3BPZA 3L2HA 1J58A 3S0MA 4CYDA 3CEWA 1YFUA 5KHIA 3EO6A 2F4PA 3HT2A 4XF9A 4I02A 1YWKA 3E5UA 5KHGA 3ETQA 2D5FA 5BPXA 2XLGA 4IEUA 1CAVA 1J3QA 4HLTA 4XFBA 5FPXA 5FQ0A 2D5HA 3E5QA 5FCCA 2OYZA 2MNGA 1GQHA 2XL9A 4LEJA 2FQPA 2BNMA 4KL1A 4QGLA 4ZU4A 3FE5A 2UYAA 3LAGA 1VJ2A 3KMHA 1X8MA 3EJKA 1CAUA 4MGYE 2IXLA 1O3TA 1WA4A 1HW5A 1YFYA 2BNOA 1XE8A 3DL3A 4QMAA 3O14A 4IEPA 4PIYA 5KBFA 3I59A 1O4TA 3BB6A 4BHPA 3E6CC 4XFGA 4FAGA 1YFWA 2BGCA 1NE4A 3E5XA 3LA3A 4LLOA 3IBMA 4E2QA 1DZRA 2EVXA 2IXCA 2GU9A 4XF1A 5T3NA 2BNNA 2GAUA 2XKOA 3USSA 2MPFA 3IWZA 5LRSA 3BCWA 2N7GA 4KWLA 1VR3A 4YSFA 4XFAA 3QACA 4XEZA 3RYRA 4YYOA 1ZX5A 1DGWA 4MGIE 4HVQA 2QJVA 4EWDA 3PVBB 3I54A 3SCGA 3SCFA 2FMYA 3H1YA 5J48A 4XFHA 3WW3A 2D40A 1J3PA 1U12A 4XF3A 2IXIA 1DGRA 1OD5A 4UXAA 1FT9A 1CAXB 3KGZA 1QXRA 1ZRFA 3PLQA 3N4MA 2ZKLA 4L2NA 5I91A 3JZVA 4X6RB 4J1WA 4IEOA 3H9AA 1J59A 2HJIA 3ES1A 4HSJA 1ZNPA 2VECA 4R52A 4HBNA 4I09A 2OZJA 4N9IA 4Z07A 3LOIA 3KCCA 5FDBA 4IESA 4QXKA 3NW4A 4R8HA 5EZWA 2GC2A 2GZWA 5LEJA 3UKVA 4MUVA 4IEZA 5KHHA 4ZU5A 4AQ2A 4IERA 4EWAA 3DKWA 4N9HA 4QX5A 3RYPA 4I2OA 3TNQA 2IXHA 4J1XA 1OI6A 1X7NA 4P9GA 4RD7A 2I45A 1QWRA 2QCSB 1O3SA 3NSTA 4AVAA 3OGJA 2Q4SA 4KWKA 4OFGA 1CX4A 2CGPA 3MPBA 2ET7A 4HN0A 2GC0A 3MZHA 4K8FA 1I6XA 2EAAA 3H8UA 3SMHA 2GC1A 3D0SA 3FJSA 3NL1A 4F7ZA 2H6BA 2VPVA 1TQ5A 4AVCA 5FLHA 1UD1A 2O1QA 2PAEA 4BYYA 3CLPA 3ACLA 1JUHA 1Y3TA 4HVOA 3CJXA 5FLIA 4PIXA 1YLLA 4Q0PA 5KHKA 1CGPA 4IETA 2WC2A
chains in the Genus database with same CATH superfamily
3ZX7A 5BV6A 2WFF3 1PM7A 1J83A 1RJ8A 1VMHA 1OFNA 4YW2A 5FPZA 3HQUA 1KQRA 1JZ5A 1WCDJ 5F2WA 2YC4A 3B00A 4FPHA 5A1LA 2QDNA 2FBEA 3ES4A 4BWOA 3C7FA 4LO4B 1S55A 2KM2A 2V4AA 1CAVB 4AGRA 2ZGPA 4B1LA 4Y26A 3JBG3 5DG1A 1XU1A 1ZRRA 5FQ0B 2Y38A 4JC1A 3WG1A 5JCTA 1MZ6A 4Y22A 1ZRCA 4ISQA 3HIFA 2NMOA 2R042 5ISLA 1YQ8A 2ZEYA 4CDXA 1RUF3 3I3QA 4HN1A 3PUQA 4Y20B 1YC61 2XUMA 1AX1A 2XVLA 3ZDSA 3U0ZA 4SBVA 3E97A 4D7TA 5JMOA 4LULA 3D5OA 3PDQA 2D7FA 5H9SA 1OSGA 3CJIA 2HWC3 4HETA 2CAUA 4LBJA 4FXGB 2ZMLA 4XE9A 4I01A 1NXD1 5DG2A 3ZOIA 2TEPA 5FR3A 3CDZB 1DDLA 1NA1C 2Y0OA 3KV9A 3U78A 2Z5WA 1S2KA 4MVTA 4YNIA 2QQKA 2PAKA 4LBNA 3WDTA 5IATA 4CUBA 1SBFA 3LF7A 3AK0A 3OYWB 4W50A 4XETA 5EFUA 3WW2A 1U5YA 1WZXA 2RS33 1UIJA 4O61A 2A5ZA 4QPIC 5JR7B 3T0AA 2UWAA 2XKPA 3B5LB 3E6BA 3INAA 1F9KA 1Q56A 2R1DA 3M70A 3U11A 3KSCA 1XNBA 2VUJA 3MDPA 4WVWA 5LBBA 3BALA 4M3CA 4MADA 4CDWA 4FBFA 3B69A 5FWJA 4TN7A 1JYNA 4OYUA 4C8DA 3THTA 3UKNA 5HCFA 2HKXA 1V6IA 4O7XA 5B2GB 2QQMA 3B9CA 2QQVA 3LD8A 2CGOA 4NUBA 4XAEA 3ZO0B 3WF2A 4GULA 3O1UA 3DGTA 2XVGA 2MHFA 1BJQA 4OMCA 1JYTA 1W06A 4I0AA 3I2GA 4YLZA 1EAH1 2W1WA 4NO4A 2A73B 1V6NA 1W90A 2ZAAA 3RZMA 1A8MA 1OHFA 5LBFA 5A6ZA 2YG0A 2VCCA 2YZ4A 1IPKA 2QBXA 3POFA 2PN5A 4TYSA 2CV6A 1DIWA 4OI1A 4IV3C 3AKRA 5J96B 1GU3A 3VZOA 1ZREA 4A2UA 3GF6A 1LGNA 2W47A 4JDMA 4YGBA 3VBUB 3V0BB 4HMZA 4AXOA 1WMXA 3BVCA 1DU3D 4OUEA 5DZEA 1ULCA 3M4FA 2HWE2 1PO23 4C0BA 5BY5A 3LSEA 2WQZC 1ZBE1 4D8MA 3SH5A 2C6SA 1FPN2 2PYTA 3KQ4B 3PVOA 1O59A 4JTOA 4QB2A 1WD4A 5IVYA 5KXDA 4ZS2A 4IQPA 3O1TA 4N43C 2OKXA 2ATFA 1RMU1 3SCHA 1RVF3 4AZZA 4IEYA 4WZCA 5FY1A 4PQ9A 5IK7A 4LBQB 4AEKA 4YGCA 3GXUA 5FMCA 1BEV1 3MIHA 4LK6A 4E27A 2RM21 2BV4A 4QX0A 4W6YA 1GQGA 1ENRA 4UFMA 3SH4A 4DUXA 4R9CA 2XR4A 5FMBA 3B01A 5JLVA 1X36A 2YBPA 2Y34A 1D2QA 3D6EA 3K2OA 4X8NA 3ZFFA 5LZ6A 1W8HA 2D3PA 2GNMA 4XDQA 2JKBA 5FZLA 1AR63 2XJSA 2IWGB 2DVAA 4QT6A 3LIHA 3J8F2 2JG8C 4JDOA 3H3UA 3WOGA 1O8SA 3ZFEC 1JW6A 2WIIB 2O14A 3IB3A 3WDWA 4YVSA 2YROA 2CYFA 4AQSA 5A6YA 2XWJB 4LKSA 4LLFA 4FAHA 2Y26A 4DUVA 5H9RA 3V0AB 4JGYC 1RUH2 4AEMA 3K75B 1EY2A 1Q43A 3FUQA 3IKWA 1BBT2 1DGLA 1ENXA 2VTXJ 4ONUA 2WDBA 1I1EA 3AMHA 4XJ9A 3KV5A 3V65A 4A4AA 1W8OA 4CP2A 3OPZA 4YW6A 3WCRA 3ZXDA 2ZGUA 2R041 4G3YC 3UJQA 3PNAA 1GQPA 4HXCA 1X50A 4Q4Y2 4Z8BA 2WNVB 4F8AA 1RUNA 5FLJA 1CQ9A 1ZM1A 2B5HA 2WZR2 3HQXA 4OVEA 3HT1A 3SQOA 4NRPA 5EYYA 3H3ZA 4NRQA 3A4UA 3HBKA 3O0XA 5JOXA 1UU4A 4LO5B 1WW6A 3EB7A 3M3QA 2BRTA 2BBVA 1Q3EA 4JKKA 5SV8A 2XHNA 2PTMA 2Z79A 3FHIB 1N1SA 2PHDA 4NPRA 3OPWA 4LOSA 5A7WB 2FCTA 2PA7A 1O5LA 3N7JA 5GJ6A 3ALQA 3DYOA 1YIPA 2W87A 3ILNA 3LPFA 5FO7B 3R4DB 5C9AC 1C5HA 1G9CA 2CL2A 4BQ5A 2K2SA 3ZIWA 3P3PA 1POV1 4BLJA 1GWLA 3ZPOA 3ACFA 1L7LA 4FOVA 4A3ZA 2RS12 4LO8A 1DHKB 4GB33 5IK8A 4PJYA 2BBAA 4WM8B 2HLEA 4DZGA 2WKKA 4ZPIA 1K5MB 2ZX1A 5I0TA 3SKJE 4Z92B 1O7FA 3IDBB 5ABJB 3ACGA 2X5IA 3LEKA 4IEXA 4WVZA 1C5IA 4CU9A 1BMV1 4CEYC 2QKDA 4EROA 2DCKA 1OLME 1GZCA 3K77A 3OGSA 2HWF2 4YPJA 3WNMA 4AI0A 4ARXA 3AMQA 1PGW1 4S2GA 5D8AC 2D3RA 1JZ4A 2WS92 4HKLA 1LOFA 3VKNA 1XRUA 4DMIA 5J37A 4B4RA 1SBDA 1V6LA 2XPJA 2JDUA 3N9LA 3WF1A 2RMU3 4YW4A 1HXS2 5C71A 2HWE1 4EZHA 2JE8A 3IZOA 1K3IA 4XJZA 4CXYA 3I2FA 5IUQA 4D7SA 4CDUA 1FPN1 4E8CA 1N3PA 1RC6A 5C3SA 1LESA 2AC1A 3EMRA 4U2AA 5G04L 1CWPA 1LGCA 1W2UA 2JD4A 5C8CA 4GWNA 1MR5A 5LA0A 2ET1A 4FQ4A 3MFAA 5GZEA 3BIEA 4Y33A 1RUI2 5IFPA 1ZZ6A 1WA6X 2Y6FA 1D4VB 1RTVA 4MO3M 3O1PA 1H2KA 1UAIA 4J6GA 3AMNA 4JV4A 2OXBA 4A44A 1YUDA 1POQA 1C8M3 1H0BA 5DAWA 1VE0A 2VOTA 1RUD2 1UMIA 2Z4FA 5FZ0A 2PHWA 5E8AA 4LHNA 4PCRA 3IN9A 4YVWA 3VBOA 5J09A 5I8SA 4XTPA 1WBLA 2ZGRA 5A1FA 2WNUC 1G86A 2IC1A 1TMF2 1GNYA 2DCYA 3AC0A 5CNAA 3OGRA 4XQWA 5FBJA 1IKQA 1FI2A 3J8F1 1NUKA 2WT1A 3M3IA 2VZRA 2XBO3 3CO2A 5HI0A 3BTXA 2YPDA 1YI7A 1VBD3 3CL1A 1QDCA 4AYUA 2F4LA 3RYKA 4L11A 1RUH1 3SC7X 1UMZA 4EE2A 1B09A 1BBT1 4O65A 5I8YA 1AJKA 1PMJX 3DECA 2A1XA 2R1BA 3WNXA 3KHCA 1QJU3 3PJQA 1FATA 1YQ2A 2CNAA 3BPZA 4Q4Y1 2YB7A 2OX0A 5K0UB 3AKTA 2G19A 1H2LA 4CYDA 1JZ3A 4AI9A 3NAPB 1YFUA 3O5SA 2WZR1 4DPNA 1PX3A 1OC1A 3EO6A 3OUIA 3NNMA 3ZYFA 2ZGNA 4RHV2 2X53S 4BK5A 1S2EA 4QKNA 2A7AA 5EPAA 1YWKA 3VZNA 2J22A 3NV1A 2VTXA 2XLGA 4D6QA 5IYYA 2WO1A 4Q4X2 1CAVA 1SLTA 2X09A 4AHYA 1LOBA 5FZFA 1DYOA 5GZCA 2YBSA 1JYIA 2D43A 4N53C 5FQ0A 4Q4W3 4LKFA 4FTEA 1OA2A 1W6MB 5FZ3A 4MGTA 1D2SA 2OYZA 5JOWA 2MNGA 1Z78A 2JWPA 2D97A 3UGGA 1QJY3 1MZ5A 3PIJA 4Y20A 2B45X 5FYZA 2OS2A 3K3NA 2BOJA 3M3CA 5F3IA 1VPHA 2VVFA 2RS11 3LAGA 1VJ2A 4V2WA 3M3OA 4K20A 1RUC3 1X8MA 1A6CA 3KMHA 4FOYA 1UYXA 1SCRA 3KVBA 1OF3A 3RG0A 3N9PA 3UGHA 3VKLA 2DFCA 2Y60A 1JBCA 4PDWC 5FMOS 1LHWA 1HW5A 5T5LA 4DXSA 3ZN5A 3AYAA 5HBAA 1F5FA 3PTYA 1BHGA 2IUWA 4PQQA 4AEJA 1XE8A 2VQ0A 3AZXA 3FUOA 3IPVB 3O14A 3ON7A 3OYWA 1F8VA 4IEPA 1CJPA 3QCWA 3LOBA 2AUYA 2VNVA 4UFKA 2HWF1 5J36A 2GALA 3QLQA 2WZEA 3HN3A 4OHYA 3CMGA 4QKDA 3P6BA 1NE4A 2WS91 4YG6A 3VBRB 1AJOA 1OBNA 2JENA 3E5XA 1R64A 3C8XA 4RGGA 4IV1C 2GU9A 4QPGB 4B4PA 1HXS1 5FK7A 2L9LA 2C4XA 3USSA 5FUIA 1OUXA 3T0DA 3RZKA 1MZFA 5FUPA 1F5JA 3BCWA 2N7GA 4Y1UA 5FZDA 3S0MA 1UXZA 1OKOA 1VR3A 2Q8OA 2BJSA 4Y5TA 5FWEA 3T3YA 3ILRA 4YW3A 4XFAA 4XABA 4XEZA 3RYRA 3LQCA 2W52A 4D6RA 4YYOA 2PMWB 2RDNA 2J1SA 1RUI1 1RINA 5LK7B 4XZUG 2HBTA 3HEIA 4LIUA 5J48A 2JDNA 1AL22 1AXZA 1UX6A 2VBDA 3I3BA 5E88A 5FYHA 4HG6B 1J3PA 1U12A 5DDJ2 3RSJA 4XBNA 3VBUA 3V0BA 1DFQA 3HWJA 1R093 1CIWA 2WO3A 1DGRA 1RUD1 1OD5A 3AJYA 5EXOA 5A3LA 4W6XA 5ERLA 2C26A 3AFKA 3DPRA 2VZPA 5FY0A 2UWCA 2ZKLA 3IAPA 3W58A 4OQ8A 2VC9A 4LR4A 4IEOA 3OJBA 4DXZA 5FOJB 1NCRB 3PTRB 5GLVA 5C3OA 2C24A 3FLTA 3T4HB 5JPMB 2Q8CA 4CCCA 1LHUA 4HBNA 3ZSJA 2YUEA 4I09A 1UMHA 4LBQA 3KCCA 3O7OA 2VG9A 4FTSA 1VMJA 2GNTA 4OHVA 1XNKA 1OVPA 1FV2A 1ODNA 1IS6A 1AX0A 4HFSA 5CKQA 3VZLA 4AG4A 1NLQA 2JIJA 3KVAA 1Z7S2 3HMYA 1GV9A 3MIEA 4MUVA 5A32B 4IEZA 2TBVA 2VCBA 1I3HA 1JYXA 4AK3A 5A7NA 1IKPA 3W59A 1YQCA 3GGLA 3NRUA 5DQ0A 4IERA 4MXWB 1HQLA 1SHWB 4EWAA 5L7OA 3ASIA 5FBZA 3ZYJB 5HV4A 2WZPP 3CIHA 4LKEA 2P4EA 5F8PA 2VM9A 5IW0A 3ZXAC 4KG0A 4QX1A 1GICA 3CU7A 2VL4A 4RHV1 4XCAA 4HK9A 2BVBA 3WLUA 4P9GA 4Z2AA 1REFA 5FUNA 5EIYB 2I45A 4GH4C 3ZR6A 1NQDA 2IZWA 2P34A 5A3NA 1OURA 4INDA 1O3SA 5IAXA 4Q4X1 3V0AA 1MEC2 1SPPB 5HPOA 4ATEA 2DU0A 2VZ3A 2WBKA 1AR83 3VHPA 1ZBA3 4Y5SA 5FMDA 4QU2A 4K1YA 3JD72 4JKMA 2X05A 2D98A 4GZ9A 1CX4A 1UQXA 2CGPA 4CEWC 1G9FA 4JGZB 1BLZA 2GC0A 5IAVA 2R6QA 3O0WA 1PO13 1W39A 2WNVA 5FZ6A 5FPUA 2GNBA 2OUJA 3SMHA 4EN9B 4YGDA 2D6PA 3FJSA 1W6QB 2HBUA 3WNOA 1TQ5A 3DEMA 5FRAA 1N1YA 1UD1A 1H9PA 1HB3A 1OPOA 1URXA 1WD3A 2O1QA 2VZSA 2WQ8A 4XZPA 4AW7A 3ACLA 3O12A 4BQYA 2JG9C 3ETPA 4Y3OA 2XDVA 5SV5A 1DF0A 3HQRA 4CCNA 4CPBD 1HQNA 4PIXA 3VD5A 1VBC2 3TOJA 2EXHA 1YLLA 2QQLA 5EJZB 2IFRA 4Y1VA 1DYPA 1WUVA 4BIOA 5A7WA 3DYPA 4K7JA 2WAOA 2Q1ZB 1I9RA 4CDQB 1O3RA 5D21A 4LHKA 3RNSA 3AMMA 1DGWX 3O1VA 1K12A 2J7MA 4UBHA 5FYSA 1NAEA 3AL5A 1YCIA 3B3QE 4HL0A 4L0PA 4QDRA 5A3OA 3LA7A 3MPPG 2JB4A 4CCDA 3NV3A 4A3XA 3GZAA 1HN0A 3ZFGB 2ZOEB 4UF0B 2RG4A 4R4XA 2XGXA 5FYIA 4BQ4A 3KV6A 3URFA 1HDKA 2A75A 3R6SA 4D6SA 2VOXA 3S6PA 3FMGA 4WM8A 1HRI3 4H7MA 1LOAA 1K5MA 3RMXA 3SISA 4CDXC 1TNRA 3POEA 3VL9A 2RE9A 1CIYA 3ST7A 1TEIA 5ABJA 5JXIA 3RZJA 5KR7A 1QJFA 1PGL2 4UT5A 2GP3A 3MLLA 1H6YA 2ZGLA 3K4AA 4HPKB 3CJIC 3DKQA 5LWBA 1W05A 1P8JA 4MGKE 5JOZA 1G6NA 2HYXA 1IQDC 2XQRA 5T5OA 1GUIA 4AWDA 3WEZA 1BEV3 2R7EB 1EPZA 4XILA 3KF3A 1DQ5A 2E33A 2VULA 1AL21 4NE9A 5F5CA 4BMBA 5JIUA 4FPOB 2ZGSA 2O8QA 4MV2A 5DDJ1 3S5QA 3OG2A 4W8JA 5ANNA 3VL8A 5A70A 2VZ1A 1KRIA 3FBMA 2XJUA 2ZPXA 3H50A 5F6LB 2Z2SB 1C4RA 2CWSA 1A8DA 3BU7A 4COYA 1VBA2 2UU8A 2Z69A 1AXYA 3LA2A 4QXBA 4FVVA 2G1MA 3KGLA 1FOD2 5AFBA 5JSOA 3A22A 4CDWC 4P9IA 5EWSA 1H8TB 1RUE2 1HV0A 2R16A 5FZ4A 1J1LA 1YO8A 1AR92 1L7RA 1GKBA 1XNCA 4B4QA 1NZCA 3CKHA 4TLFA 4FOWA 1S0CA 4QQPA 4IW3A 2RVAA 3GM8A 1MACA 2IVJA 4DINB 3IAQA 1Z7S1 3P5BA 4KG8A 5F37A 1PX4A 4EWEA 3CBNA 5FP9A 3AYCA 3K48A 3POBA 1PGSA 2DV9A 1J1TA 2GH2A 2WUHA 2WYSA 4H2AA 2YU1A 1DG6A 3J7LA 3TWIA 4XFIA 4IGPA 4S2HA 3BI3A 4MG2A 3AKQA 2VU9A 2DCJA 2XXZA 3H3LA 3WQBA 3O1MA 3SHRA 2MEV3 2NMNA 4Q0VA 1Y7BA 2DBNA 5AVAA 3WQ7A 1M4WA 4IE5A 2ZZQA 4WM7C 4BIFA 2Q0AA 2DUQA 4OUSA 3I2DA 4BQ1A 2CSGA 4LMFA 1R1ZA 4ISRA 1MEC1 5GLUA 3NV2A 1ZZ7A 4N7UA 2RJKA 2WN3A 4P14A 3FZ3A 3BTAA 2ARCA 1PK6B 3I2HA 3JD71 4AI2A 4META 4GMP1 1AR72 5K0UA 3MFCA 2ZCWA 1RUG2 4RA0A 2R073 3NAPA 3AFGA 3K46A 3GBGA 3ZSLA 2YFUA 3VDDC 3LE0A 2FD8A 4AFBA 3PHMA 2Q30A 4FP3A 4XJ8A 3VUOA 2FDHA 1XSQA 3AXEA 3GZUC 3TEXA 1QJZA 2HWB2 1ZBE2 4MZUA 4PLMA 1D4M2 3MW3A 1OPMA 4RR3B 1RUJ3 3ZFFC 2EIDA 1VBC1 3GBFA 2JDZA 4IV3B 5DUUA 5FZ7A 2PAMA 4DOUA 2A3WA 3POYA 1W6MA 1EPWA 5E1RA 2RM22 3KS7A 1A78A 4AEDB 2GH8A 2ZBJA 1YIFA 4GWJA 3H42B 2P17A 3THDA 2YC2A 5A3UA 1W0OA 4RQPB 1VP6A 1BCXA 1DZQA 1YNAA 4QX7A 4AQTA 4ZU7A 4FT8A 2P1BA 1IQAA 4YM1A 1M06G 2W1UA 2K0GA 3LWCA 2BERA 2H0BA 1R1A2 2FCUA 2GMPA 2HWE3 2PHLA 2XJQA 4CP0A 3LFIA 5CG8A 1NOVA 2EIGA 3EQEA 3TN91 1OT5A 4KI5M 4P00B 4V1PA 4YG0A 3MIFA 1PGL1 3IPVA 2YMZA 4Q0QA 3F95A 4ITCA 1H1IA 2CY6A 3ZN4A 3NQHA 2JDYA 4Q0UA 4Q29A 3VBRA 5B4NA 1ZRIA 3O1RA 5D1IA 1ODMA 2PLV2 4L9BA 1PM4A 1OLRA 4QAWA 4E4HA 2DCZA 4HSLA 2QUOA 4QPGA 5BNNC 3MV01 5KHJA 2JG8B 3I2OA 2TNFA 1YQ5A 1QY4A 3GZEA 1VBA1 3U1XA 3OY8B 4AVVA 2WQ4A 1H4HA 4NWVA 1ULFA 1FOD1 5FP3A 1EYBA 2Y8KA 3WDYA 1RUE1 2EXIA 4BZ4A 1AR91 4C1XA 1KFXL 4NPMA 1U5XA 2PXJA 4UFLA 3POGA 4K9SA 1SCSA 2WR9A 1ASJ3 4GMP0 2H6CA 4KGQA 3OUJA 3S5AA 1V9U3 1S0EA 2P2KA 2VW2A 3EHKA 5BXXA 4YARA 3J7MA 2A6YA 3PU8A 1TME2 4QXCA 5FXXA 3NNFA 3GYDA 5F5AA 2X10A 3AJZA 2X5IC 4IE0A 2DFBA 3MICA 5CYYA 3MGUA 3WV6A 1G8WA 1U5IA 1VALA 3ZN6B 1OFSA 4XXPA 4CRQA 2ZHMA 3WNLA 3TEZA 3M1HA 2H0VA 2JE7A 3N9OA 4MHRA 2Y6JA 2BFUL 2ORZA 3WUCA 4B8EA 4DIQA 5I0RA 1NCRA 1LOFC 4S2DA 2A6ZA 4BJ0A 1ND2B 4XUPA 2B4KA 2XL7A 3T30A 3UV9A 5FZOB 1YJLA 4PIZA 5FZKA 5IVEA 3C2UA 5BNOB 4LIVA 2GNDA 2DVDA 4Q0SA 1MVQA 1WLTA 1ZZ8A 4PI2A 2JEMA 1MS8A 5F7UA 4CCMA 4MGZE 3RZLA 4CDUC 2XJTA 1HN1A 5EHDA 1BMV2 1ULOA 2W39A 3E1F1 4CZSA 3VV1A 5A32A 4CXXA 1XJAA 4Z1VA 2YYOA 1PGW2 3PMEA 2DURA 3LDRA 4XMAA 4MXWA 1AR71 2JD9A 5JXGA 3JUUA 4XFFA 1NZIA 1RUG1 1VIWB 3WY6A 4AHWA 2XOMA 4B7KA 2RS52 3ORJA 3DPRB 4OHXA 5TSWA 5F32A 3RDIA 2JE9A 3ZXEA 4DEQA 3GZTB 2HWB1 1ZZBA 4M4RA 4UW3A 1VRBA 3NVCA 1D4M1 3IT8A 5FJKA 3WINE 3A21A 4RS5B 4YRDA 3VBOC 5L36A 5J3UA 4F83A 1CN1A 1H2NA 1H30A 1H1MA 1SPPA 4QKFA 3ZKUA 5GZGA 3KD4A 1XXNA 1ULEA 4CCOA 2E9QA 1VBE3 4JTNA 5FO8B 5HXVA 1OQ1A 4LUMA 5FXWA 2HEYF 4JGZA 4CPBA 2WJSA 3OB8A 4C0HA 3C7HA 2AACA 5BYNA 1W6QA 2WFF2 3M7AA 3QOPA 2OQ7A 4IE6A 1OOPB 5FYVA 2W08A 3POIA 4BK4A 1SMVA 2PHRA 1UY2A 4FP2A 3R0RA 4H7LA 2VMGA 2GC3A 2XMLA 1HXS3 1R1A1 1O5UA 3OF1A 1QOOA 3AZYA 2BP6A 1CPNA 2VZTA 3AMPA 3BN6A 4GKYA 2DVBA 4HZFA 2CAVA 2X29A 3L2YA 4LO6B 4CP9B 3RZZA 1JMUB 1SFPA 1V6KA 2Y33A 3JBG2 2ZEWA 3I3DA 4QPWA 4CDQA 2ZACA 1APNA 1FNZA 4OZXA 1SLIA 3T2PA 2F4PA 1UOJA 4DRVA 2R063 4Y5Z0 2W9XA 4NAMA 1EV12 3VZKA 1XSRA 2WNUB 2D5FA 2PLV1 4UF0A 4XJAA 5BPXA 3ZFGA 5HV0A 1UPSA 4IEUA 2HWC2 3W20A 2WSUA 1KFUL 4L99A 4XFBA 3O1SA 1ULPA 5JPNB 3WNKA 3WDUA 4DS0A 1YQ6A 1PVC3 3KT1A 2V5YA 3I2IA 4XIKA 3J9SA 4XC9A 4HPKA 4P9WA 3VDAA 1TMF3 4H55A 1QKQA 2FQPA 4QGLA 4NIAA 1YYNA 5FV3A 2P3IA 1JZ6A 1SDDB 2PHFA 2JDHA 1CONA 3SITA 2WINB 3MEPA 3RS6A 1TME1 3A0KA 3EJKA 4UOJA 4HT1T 5FXVA 1I5PA 2CHHA 5LA1A 4MGYE 1HB2A 1W6NB 5A6XA 4FTBA 3WXPA 3JB8A 5CEHA 3JQWA 4AFDA 4CSWA 1KJLA 1WLDA 2ZGQA 2SBAA 1QU0A 4BDVB 4NROA 2AGSA 1W0NA 3SKVA 5KBFA 3I59A 4IGOA 2QQNA 4PLNA 1SACA 3VBHB 5DPNA 1H8TA 1O4TA 1DLLA 1QJX2 2DDUA 2W2IA 4GKXA 4XUNA 1UU5A 2J1VA 1IS5A 1LOEA 1YFWA 2BGCA 3H0OA 4I3GA 4N53B 5CISA 5GALA 4IE7A 3LA3A 3ENRA 1HX6A 1DZRA 2EVXA 3LGRA 2IXCA 2AYHA 3G6JB 5FIXA 4AFAA 5T3NA 4LORA 4XF1A 1UY1A 5JXJA 3FFZA 5H9PA 2BNNA 2J1TA 4Q4X3 3RWKX 1JS9A 1XC6A 1JI6A 5LY2A 2V73A 2ZTNA 4YSFA 3WP3A 5BNPB 1IGOA 1PO22 3KF5A 1XU2A 4RSUA 3VKFC 1AYM3 1WMDA 2XB6C 1SG3A 4NOTA 4DXRA 1GP5A 1HKDA 5EJ3A 3LIGA 2NP0A 1Q8VA 1W8FA 2RS51 3NWKA 4UAPA 2QJVA 3AYDA 3VBUC 1NKGA 2VVDA 2JDPA 1OLQA 2B42B 1GWKA 3IDEA 1TNFA 4XFHA 2JICA 3WW3A 4EN8B 3D3AA 2VMHA 3TEWA 4KGGA 3ZXLA 2TUNA 3HR9A 4K6BA 4CUCA 1CAXB 5FP7A 2BWCA 1PNGA 5FY9A 5EV7A 5FZEA 3TAYA 4AVSA 4W6WA 3RMYA 4QX3A 4FPFA 5I91A 4X6RB 3I49A 3KLSA 1VRH2 1FMD3 1PK6A 5FXZA 3AB0A 2HJIA 2GSYA 3ES1A 4JQTA 5IHRA 2W91A 2DF7A 5T50A 2VMEA 5BNNB 1RXGA 2BWAA 3BODA 4I0WB 3VBFC 4FO9A 1AR62 2WFF1 1S4CA 2G9FA 5FDBA 2B7YA 4QXKA 3NW4A 1DQ6A 3U4XA 1QQP3 2ARAA 2GC2A 3LEMA 3N3HA 2P3YA 1QGLA 4HONA 4N8MA 5LEJA 4A42A 4XDOA 3ZVXA 4RR3A 3W5NA 2P3KA 2VQTA 3LKJA 3N9NA 1W9FA 5FYCA 2VBBA 5CFDB 5IVVA 4IV3A 3RQ0A 1NY72 4Z2WA 1DBNA 3JBG1 3LDKA 5F3EA 3BOPA 1UOGA 4QX5A 3ZKYA 2KA3A 4AEDA 4M3CE 5LATA 3MBWA 4XOGA 1AYN3 3MO4A 4J1XA 4XJWA 4L92A 2VMFA 4RQPA 4Q27A 1EV11 4H14A 4P9JA 3I97A 4Q8KA 5DDJ3 2W1QA 2FHRA 4COWA 2WO2A 2HWC1 5IK5A 3SEEA 3AX4A 2BW8A 3NO8A 2CDOA 4AVAA 5JDBA 1W8NA 2O0OA 3OGJA 4DY3A 4QB6A 2YGLA 5C4WB 1W8ZA 3ZSMA 2ZEXA 2XQXA 2WNVC 3VD7A 1SZBA 2PHTA 3OPTA 1PHMA 4OFGA 4C90A 4XURA 4A7KA 5JXHA 5LY1A 3ZYHA 4HN0A 4MHUA 1OA3A 2VZOA 1I6XA 2EAAA 4XQDA 3BKZA 3D0SA 5L73A 1VAMA 1UZ0A 4FPCA 4BMEA 4AVCA 1PIV2 3LB9A 2ZHKA 1W28A 4BYYA 5JI7A 4BA6A 2E31A 4ZHNA 2E6VA 1ZYBA 3ZYIB 4FI9A 1JUHA 4SLIA 3BU0A 2Q8EA 3UNPA 2QQPA 4DEVA 4PF5A 4TWTA 4NIGA 5JI9A 4NIDA 1GP4A 2ADEA 2DTYA 2JG8A 4IDZA 5KHKA 3UJOA 3UESA 3OY8A 4GH4B 4IETA 3UK9A 5L7OB 1RGSA 1Y9QA 3NJYA 1C28A 1VAKA 1REDA 4I3PA 4TXWA 1XNDA 4LE4A 1QH6A 3WHUA 5AC93 1QJX1 1LEMA 5FOBB 2C5DA 3DV8A 4LNVA 3T2QA 1W6PB 1LULA 2E51A 2FDIA 2UY9A 4I30A 4WM8C 4BQXA 1K5MC 1ND3B 1UXXX 3R05A 3N35A 4W65A 1RL3A 2YGMA 5ABJC 1EUTA 3ACHA 3WX5A 2JDAA 1MEC3 3KWVA 4ZXKA 1AZDA 4GIQA 4YM0A 3G7DA 4YW7A 5A3TA 3ZN6A 3ELNA 4BH9A 2QTWB 5FZ8A 1WCUA 2RMU2 3U75A 3GNEA 2UURA 1PO21 5DZGA 4DQAA 1TVGA 3N7KA 4KWUA 4P02B 1OH4A 4QGNA 4QM8A 5FZHA 1RIRA 3ZYBA 5C5TA 1KDKA 2VGDA 2BYVE 3AVSA 2YFZA 3BOWA 5APAA 5A7OA 1ND2A 1MZEA 4LTAA 1OMIA 5FZOA 4AFCA 1XBFA 4NHYA 5BNOA 1W8UA 5GZDA 1DYKA 2V72A 4QQLA 3FHQA 1JH5A 1ULGA 2VUAA 1CAUB 3VHRA 1GNZA 3POWA 2AEYA 2DCTA 1VBC3 1BXHA 3KT7A 3ZYGA 4EYUA 4XTMA 1LCLA 1Q5OA 4YFZA 4K21A 4JDNA 1RXFA 1WMFA 1VRH1 4L8QA 1LODA 2PHUA 4XF0A 3GJAA 3WP4A 1V0AA 5FPBA 1KITA 2YC0A 2YPJA 3BTZA 1GOHA 1YEWA 5JAXA 1BZWA 5F3GA 2D6MA 1AR61 5CFCB 1K45A 3PL0A 4EJRA 1JU4A 1JN2P 1ZZ9A 5T5PA 1W3VA 4BCUA 4BOWA 3IDCB 4FSJA 1HRV3 3OBAA 1GFF2 1GANA 4DXTA 2HH9A 2XBO2 5FZBA 4LPLA 4Y1YA 3KB5A 1V00A 2FDJA 4RS5A 3ZXFA 2E7QA 1VBD2 2YY1A 2WA3A 4XPVA 4XCBA 4ZS3A 1N1TA 3RVHA 1NY71 2B9UA 2OA2A 5JZGC 2LTNA 4XQ4A 2NPIA 1W8WA 4F3JA 3QH7A 5FYTA 1MVEA 2E7TA 2JDMA 2WRAA 3QBQA 5FPAA 1QJU2 3NNJA 2YHJA 1Y4WA 4BU2A 1MQTB 4E4SA 3T0BA 4IEVA 1ALYA 3U07A 1OUSA 3FBYA 4NIIA 1LECA 1OOPA 5F1RA 2VBPA 4R9DA 2CWMA 2V5DA 3FC0A 2NYYA 1L3JA 1A34A 4HOOA 4C91A 1CZTA 1NXMA 2EICA 1UYPA 4R9BA 3MYXA 2A6VA 4MSVA 5FZ1A 5A3WA 4DY5A 3EYPA 5K0UC 2WFPA 1O3QA 2QQOA 3NAPC 4CP9A 4WVVA 4YM3A 2HYKA 5KXEA 3QH6A 1RUOA 4Q4W2 3MF9A 3PUSA 1LRHA 4LUKA 2NN8A 1XE7A 1PIV1 3BUCA 1ENSA 1OF4A 1GMMA 3OCPA 1QJY2 1LNSA 2ARXA 3B9IA 3VHNA 4LBKA 4UW6A 4XFCA 3SLIA 2WNUA 4Q2FA 1PMIA 3JXSA 5JSRA 1JTZX 4BE3A 3Q9OA 1LENA 1O91A 5FMOL 3VKMA 4LBMA 1YXWA 4XAAA 4XBQA 1WBFA 1RUC2 2ZMNA 4WM7B 5T54A 3THCA 2LROA 5A33B 4M00A 1XB9A 5ACA2 4ZONA 2D6NA 1PZ8A 3EBRA 1KDMA 5CKMA 1LHNA 2ZABA 1JOBA 4LE3A 4EQVA 4CCEA 1H4GA 3NMBA 3HAGA 3NKTA 1LKNA 1MPXA 2HWD2 4WBBA 4O9GA 1B35B 5AVPA 4BXFA 4CA9A 3S7IA 3C7OA 1NCQC 1D0GA 2PQQA 5LEKA 2GN3A 4LO7A 2ZX2A 2D44A 1IS4A 3VDCA 5L9VA 1EAH3 1WCSA 2VMIA 3AYEA 5E6HA 5JVVA 4YM2A 4FXKB 5D2AA 4WVMB 2I07B 1Y9GA 1IZ3A 3U10A 3SEPA 1W6NA 4X8PA 1WKYA 2P3JA 2RMU1 3LSDA 3HNMA 3N7LA 2WWUA 3PUHA 3JB4C 2WT2A 4KQ7A 3VBSB 2NZ9A 1JOPA 4IEQA 5FY7A 3E6DA 1AR73 2J1RA 1GWMA 5FP8A 4QQHA 1S1AA 1JUIA 5GZFA 5JIAA 1RUG3 2VNGA 4PBOA 1DQ2A 2D6LX 2DU1A 3NJZA 3RI9A 3VBHA 5FYYA 1R082 3AZWA 3ZYPA 4N53A 2VAUA 3IMMA 4KH9A 4AI3A 1E5IA 2QDRA 1BVP1 2D6OX 1ZBE3 3TN92 2E53A 1V6OA 1J3RA 1D4M3 4RFT0 2BU9A 4D69A 1CZVA 1T6BX 2DUPA 1V6JA 3MV11 1TZOA 5F5IA 1RMU3 2PFWA 3ZDVA 4FPKA 4AI1A 4BISA 4UBGA 1NLRA 1R092 1HB1A 1S0FA 2QQUA 4JKLA 1EP0A 4XYXA 4DB5A 5BNPA 2RM23 4CP1A 4KU7A 1AXKA 1H2MA 3MW2A 1CAWB 3OD0A 1JZ8A 4FPJA 1XQNA 3PUAA 3MIDA 4JHTA 5JSPA 2C0ZA 1GOFA 3P3NA 4E8DA 3AP4A 4MXVA 1SQ4A 3ZSKA 3HD8B 3RGBA 1UKGA 1UL9A 2ARBA 2WNOA 3JQXA 4KNCA 2XBO1 3MLKA 4ATFA 4CXWA 2Y6GA 2DWRA 1R1A3 1ZZCA 3Q8AA 3I59B 1VBD1 4URTA 5LA9A 3WW4A 3ZXKA 1CAXA 2W46A 3WCSA 3D0JA 4CU6A 5BNQA 4TTGA 1NCRC 1UW8A 4Y24A 5FZAA 4QM9A 3B93A 2ID4A 2LM3A 4D0QA 5IFTA 1OKQA 4IV1A 2VY0A 2Y64A 1QJU1 4Q5OA 2BEOA 2ZGMA 3GBWA 4YZ4A 4YGEA 3SNMA 4BB3A 3AKSA 1GP6A 4LJHA 2UYBA 4LA2A 1OQEA 1UNBA 2P6HA 4FQZA 2XJPA 4COZA 1MS3A 1G9AA 2A70A 2PLV3 1W2AX 2R043 4B7EA 1H9WA 3M2MA 4B1MA 1NA1B 4JZRA 1FYUA 5CFDA 1AL0G 3WQ0A 2LRPA 4AI8A 4IEWA 1G9BA 4FFGA 2WNEA 1XNAA 1PZ7A 1FXZA 2EA7A 1ZBA2 3DN7A 4Q4W1 2J1AA 3C3VA 4LK7A 4MYEA 4QPIB 1US2A 5I0DA 4J25A 4LT5A 1F31A 1PO12 4PLOA 1UWWA 1QJY1 1UOFA 4NWWA 1L7QA 2A6WA 2SLIA 2VOVA 4FPGA 1LJ7A 4JQRA 3T08A 1U5ZA 1UOBA 1COV2 1I5ZA 1TME3 2VJXA 1Y43B 2VOWA 3DYMA 4IGQA 4K40A 1KXGA 2E26A 2RHPA 4I0BA 2XH6A 1GR3A 4Y4RA 1RUC1 5FFOC 4OI2A 5C4WA 2R30A 3KZ4C 4JGZC 4JCKA 2XHKA 5FZ9A 4EN7B 1H8VA 1POV3 1TE1B 2WZ8A 5ACA1 1H6XA 3Q8EA 2VMCA 1IPJA 3RFRA 1UZWA 4OHZA 1AX2A 2HWD1 3H1MA 3HJRA 2GN7A 4Q8LA 1UPIA 3I3EA 3I7DA 2ORXA 1MS0A 2D93A 4M0HA 4XXAA 2W1SA 1AVBA 4LBLA 2RDRA 1XNTA 2BTVC 4QDSA 4AOCA 5JOYA 1LEDA 4V2VA 3WD5A 2VW1A 2ZEZA 3CZJA 4YZ5A 4XHBA 3USUB 4CDQC 4YVSC 1UN1A 5L9BA 5KXBA 5LW9A 5CG9A 2EXJA 3L2HA 1GZTA 4WV8A 1AF9A 1J58A 1HRI2 2WLQA 4GH4A 4LKDA 3ZIXA 1WLCA 1MS9A 3CHXA 3ZLIA 2CTVA 2HEVF 3K3OA 1CVNA 4N43B 4WZFA 4BM8A 1RJ7A 2QZ3A 2Y6LA 4HKWA 2RS53 4IL7A 3VKOA 1R081 3ZFGC 4E9KA 4XF9A 3B7MA 1W6PA 3X29B 4I02A 4D7YA 2D3SA 2NM1A 5F9TA 1HJFA 4NR1A 4YFWA 2BOIA 1FPN3 1NQJA 1ND3A 3KT4A 4ZXEA 1GLHA 1J3QA 1DLCA 1UY4A 4HLTA 2Y0IA 5FPXA 5FO9B 3MIBA 3Q8CA 5CBLA 3RZGA 2D5HA 1R091 3E5QA 2XVKA 1DQ0A 1NLSA 3J26N 3LPGA 1AUYA 2QQIA 2XL9A 3D4KA 1WMEA 4U36A 5DAXA 1W6OB 5FZIA 3MW4A 3MIGA 5FY4A 4LEJA 1NX9A 4KL1A 1OLMA 3MUZ1 1IOAA 1HB4A 3AP9A 4MOAA 2YXSA 4ZU4A 3UGFA 1LAJA 3KM5A 5G05L 3FE5A 5C3RA 3AZVA 2BUKA 4AHZA 4YZ3A 3ZFEB 5C70A 4ZKTB 1D0HA 1VBB2 1CAUA 1UZZA 2IXLA 5DAVA 1O3TA 1WA4A 2W95A 4JGYB 1V6MA 2X8KA 1KS5A 5FZMA 5EJ1B 2W0XA 5LK5A 3OSDA 3DL3A 1WWYA 4QMAA 3J8F3 3T2OA 4DUWA 1H8TC 1IPSA 1HLCA 3TRSB 4AAXA 4EN0A 4FPLA 1O4YA 5DN2A 3A23A 4UW5A 4BHPA 2ZZJA 4FAGA 3E6CC 4N7IA 2FMDA 1CESA 1RUH3 1U0AA 3S30A 1MS4A 5CFCA 5M0TA 4LLOA 2JECA 1RHI2 1BBT3 3HNYM 1EV13 2EIEA 4QU1A 4W4ZA 4A45A 4AHXA 2MEV2 1LU1A 4UYBA 5CKNA 1Z0HA 2GAUA 2XKOA 4Q4Y3 1W0PA 3BIWE 4MGQA 3AP7A 1O6UA 1W2OA 4TLGA 4KWLA 1KGYA 2R49A 2VZUA 2WZR3 4IXLA 4XVHA 5A6QA 5JWPA 4QB1A 2J1UA 4IUGA 5LA2A 3WF4A 4LBOA 1W03A 1AR81 2CGNA 2K46A 3C7EA 1JODA 3ABZA 2JDKA 1ZBA1 2VOKA 3TBDA 3THPA 5HXMA 3KQRA 1ZX5A 1DGWA 4RYDA 3LEGA 5C9AB 4EWDA 3LEIA 1MQTA 1LHVA 4K3UA 1PO11 1YJKA 3H1YA 1LOCA 2Z42A 2R072 3M8LA 1RITA 1RB8G 1JYWA 5C8CC 1COV1 2DUOA 2VW0A 5GM0A 5K9YA 1FT9A 1SLLA 4UWDA 1PK6C 5DUVA 5FK8A 3KGZA 1QXRA 1ZRFA 3PLQA 3N4MA 4L2NA 2VCAA 3HVDA 3JZVA 4J1WA 1NG0A 1RUJ2 3CQOA 4Q4V2 1WCQA 4XIOA 3I4IA 2OIIA 3I8TA 4BXSV 1YI9A 3IDAA 2RS13 5E89A 2VECA 4CEYB 4R52A 1UO9A 2VR4A 1QJX3 4QWNA 4AR2A 3RI8A 4Z07A 3KHBA 4YVWC 1S0BA 1CX1A 2ZMKA 5D8AB 1GZ9A 2C1FA 4IESA 2RR12 4QD2A 2QZ2A 4QHZA 1WCKA 4R8HA 4RR3C 4Q1PA 2GZWA 4DFSA 1S0DA 2W94A 3UKVA 5KC6A 5HCBA 3IIIA 2HWF3 4GJZA 4AVTA 5T5JA 1W9WA 4GD4A 4AEDC 3IMNA 4WM7A 4GWMA 1Q8QA 1HRI1 2LALA 4NRMA 5A33A 2WS93 5JUVA 5GLTA 5B4XA 4OUMA 1JYVA 4XUQA 1S2BA 2ZX4A 4RQPC 4ES9A 3TNQA 3VD4A 3RJRA 3VD9A 1B35A 3WZ1A 4P9XA 3WDVA 3UT0A 1JZ7A 3WNPA 4ZZ5A 2QCSB 4BQ3A 4QDQA 4UFHA 5KWRA 2E63A 4P5YA 2BDRA 3W9AA 3VBFB 5A1AA 4WVMA 2Q4SA 5GKAC 4P9YA 3VDDA 4KWKA 2JIGA 3BTYA 1VRH3 3MPBA 1RUI3 1RUF2 3O1OA 2DTWA 2I2SA 4LBQD 3VBSA 3MZHA 4K8FA 3H8UA 4QX8A 1SBEA 2VXRA 2GC1A 2ADDA 3WSOA 1W8TA 2VPVA 5LBEA 4AE2A 2G9ZA 1W04A 1RUD3 2PAEA 5F5QA 2B9VA 3CLPA 1BK1A 3AM2A 1GBGA 1VBB1 4FCAA 1QHDA 1ASJ2 2GMMA 2I74A 1V9U2 5J98B 2BGOA 3DXTA 3JU9A 3T2TA 1HJGA 4M4PA 4RN5A 4PF1A 5FPVA 2RS32 2EAKA 3BPSA 3OBZA 1CD3G 5IVCA 2VVEA 2J1EA 3N7MA 4BQWA 1J84A 1CAWA 4BPZA 5FP4A 5E16A 2VH9A 1W9YA 2BVVA 3ATGA 4AVBA 3AP5A 4AQ6A 1RHI1 3B02A 3NV4A 2MEV1 4Q26A 3DXUA 5C6CA 4AF9A 4TZDA 2IXJA 1A3KA 3IIAA 4YG3A 5L9RA 4X6QB 3CNAA 2VUCA 3FFQA 5CZKA 4A7YA 4NVPA 5EYXA 2XUEA 4OLLA 2A3XA 4ORFA 2UY8A 4RHV3 1DGRN 1ND2C 2B46X 3I2KA 1QIQA 3JCIA 3PIGA 4H3WA 2A6XA 4FFHA 1FV3A 3SH3A 4YW5A 5BNNA 3J4UH 3OBTA 5I0UA 3WP5A 5BNOC 2BZDA 4C1WA 4CCLA 2WT0A 2AZ5A 2DVGA 3MF6A 1PIV3 4XF4A 2R071 4EN6B 1E5SA 1PZ9A 2AH2A 3DF0A 2IXKA 1CR7A 3FLRA 5ANQA 5CADA 3VB9A 4MX3A 4A6SA 2A71A 4HKOA 3AKPA 3MHZA 1UIKA 4K1ZA 3WUDA 2KD7A 1UU6A 1NA1A 3FWEA 4PDWB 4Q4V1 4M0NA 1RUJ1 3WT3A 4CU7A 5FKBA 2RDSA 3MI8A 1K42A 3A7QA 3HNBM 4G9SB 1RVF2 1XOYA 5GLWA 2NLRA 4K8RB 4UI9L 4B29A 5DUWA 4QHBA 4R9AA 5DUXA 2ES3A 2BGPA 1UYYA 4QPIA 3DPRC 2WLPA 4CCKA 1STMA 1S0GA 1VBE2 2WN2A 2VQAA 2YU2A 4JRAA 3UL2A 5C7GA 2OZ6A 5CAZA 2RR11 1FX5A 4JX0A 4RS5C 2JKXA 5LRRA 2Q5TA 5FYUA 3T4VA 2XLAA 1ZRDA 4XACA 1GSLA 3GDBA 4NHXA 2LUWA 2OW4A 4JHZA 1JZ2A 1WW7A 2R0FA 4IV1B 4P9LA 4NJ4A 2Q8DA 1SLCA 4NAOA 4XMIA 2GDFA 1DZTA 1SFYA 1W3XA 4DNYA 5HCAA 1QXJA 3BGAA 2NQYA 1QH7A 1OA4A 5A7QA 4ES8A 1QOSA 3SXWA 5DAQA 4OHWA 4TSVA 3T1MA 4NHLA 1F4AA 1OOPC 1F2NA 1PVXA 1QXPA 4IE4A 1K5JA 5DZFA 2B39A 3AZZA 3NJXA 2O8OA 2QQWA 4AAPA 4YZ2A 1XYOA 2F17A 3NNGA 1WGPA 3GCWA 1LTEA 3B94A 4E2GA 4N90A 5A7SA 2EF6A 4XJUA 2R062 5KC5A 2OPKA 3EXUA 2LS6A 4CUGA 1W9SA 5I8TA 3WR0A 1ZA7A 1O4ZA 4LOTA 2ERFA 3USUA 1UZYA 1UCXA 4CUAA 1RUF1 4FPEA 1CJDA 1X8EA 1EUUA 4OI0A 3LFMA 3CF6E 4HK8A 2ZHLA 1AL23 1YHFA 2YBKA 4DO0A 2UWBA 4E2SA 2ZKNA 1PVC2 4N43A 1QDOA 5BUVA 2FZ2A 1LB2A 3FL7A 3H8XA 1JOJA 1SEFA 5JZGB 2ZA9A 1LOGA 3LDBA 1G7YA 3KV4A 1ASJ1 4HVRA 3ZMNA 5EQUA 1V9U1 1YRZA 5K4LA 2HEWF 4A6OA 2P37A 3K4DA 3RJ2X 2RS31 3TNPB 5IT6A 1POV0 4NMIA 4LQRA 3BYWA 3HOBA 1W6OA 2E7AA 2V09A 1C57A 2XJVA 4QKBA 4DRRA 1JHJA 3DUIA 1C1LA 1W2NA 3RZHA 5LASA 1Z7S3 1WLWA 2YDEA 2FCVA 5A80A 2XONA 4GB32 1US3A 3KCXA 3ZFEA 2EXKA 4QPYA 3ME2A 5EP9A 1NYWA 5H9QA 2GP5A 1KD7A 3AP6A 5LCWL 3H7YA 4EZ4A 2ZAHA 4Y1XA 5A7PA 4CU8A 1V70A 4JGYA 3A0NA 4GWIA 4OZOA 1VB2A 2KR2A 4Q1RA 3VBHC 3T09A 4FFFA 1GZWB 3NJVA 5IVBA 4D3WA 4CEWB 3ACIA 2R32A 3H7JA 3WP6A 3P1IA 4KBZA 1AYM2 2C9AA 1REEA 1SFNA 2W68A 4LHSA 5L19A 1MS5A 1NE6A 4LA3A 1G9DA 3LZZA 5F2SA 5C8WA 5AFEA 5CVRA 3KCYA 4OI4A 5J1XA 1X9PA 3JD73 4CVUA 3Q8FA 2ZS6B 4OULA 3PJYA 2JG9B 3FN9A 4GMP3 5CU1A 5BNPC 2ZJCA 2XG3A 1UY3A 3WG2A 1NCQB 4RL7A 1CPMA 5IVFA 3OEAA 1VAVA 1RVF1 5ACA3 3OGVA 1N1VA 2E32A 2WYFA 1X33A 2XWBB 1RYYA 5FTTC 1FMD2 2RJLA 3GHMA 3MUY1 1QNYA 1VBE1 5C9AA 1D7PM 3WG4A 5I93A 2HWD3 2IVIB 2Y6KA 4MLOA 3S7EA 1AHSA 1LGBA 3H1WA 4GALA 5T52A 1N47A 1F15A 3W21A 1N3OA 4GJYA 1DP0A 3VLBB 3L9JT 1C8M2 5A3PA 5K8SA 2JJ6A 4KBBA 5J7MA 1W2TA 2WSVA 2ZX0A 4Y4YA 3J7HA 2VXJA 2F6BA 4Y22B 1QQP2 3F2ZA 3N9QA 4Y1ZA 4A7ZA 4LITA 3TB0A 2AEZA 1ST8A 1JHNA 2LW8A 4CDXB 3D82A 2BPA2 1OXCA 5C5UA 5LBCA 1X82A 4L97A 4NN0A 5JR2A 4FOQA 1ZVFA 3NNLA 4QXHA 2WL1A 1QF3A 4QHOA 4CEYA 3OOXA 4NIHA 3CJIB 1BYHA 1S0JA 4CCJA 4R4ZA 1DQ4A 1R083 2FZ1A 2BQPA 2ENRA 2QE3A 2ZGOA 1F35A 1DCSA 1UZVA 3OD4A 4MGSA 5D8AA 3WF3A 4EV0A 3H8RA 5IVJA 3TN93 3WQ1A 1AYN2 4QGMA 1OD3A 3VN4A 2GMEA 2R061 5CFDC 2G9GA 2ZGKA 5CIRA 4O9EA 4XBLA 3WG3A 3MLJA 3R4SA 2ETEA 4NPLA 3PVEA 2OUHA 1KJRA 5I0SA 3FX3A 1KS4A 2AREA 2K9ZA 3UETA 2ZGTA 1PVC1 4M3CB 1GYKA 4MH0E 4CDWB 1W99A 4JVAA 2XLFA 1YFXA 5C3PA 4NHKA 3H8OA 1TMF1 3WVJA 5FY5A 5HCHA 2QVSB 3GCXA 1VBA3 5C4WC 5C33A 4KU8A 2IFWA 3VZMA 2QNKA 3N9MA 1BKZA 1FOD3 2D6KA 3VBFA 1PMHX 1QNWA 1RUE3 3T1LA 5A3MA 1UF2C 5FYBA 1AR93 4KWJA 2EALA 3VZJA 5LB6A 4M3CF 3WW1A 2ILMA 2KXLA 3TYJA 3V64A 3HPNA 1UYZA 3K51A 4UW4A 3UKTA 1LR5A 5IJRA 3ROUA 1MS1A 2J42A 2R0HA 3OGGA 4OCTA 5F39A 4ARYA 3I3MA 1WW5A 4RGAA 4GB31 4Z82A 4AL9A 5AC92 2Y6HA 2OT7A 3TEYA 3RPQA 1PNFA 3N36A 2B8MA 4PT6A 4XDPA 3QD6A 4COVA 2VQUA 3OTFA 5L7OC 3FHAA 5FREA 4AGGA 3DCQA 2Q1MA 3RRDA 3K4ZA 1F4HA 4OMDA 1VB4A 1T2XA 1HIXA 3CEWA 5KHIA 4JRLA 2VE1A 3ECQA 3HT2A 4M01A 4P08A 1AYM1 1IG3A 4CTEA 2VD7A 3WF0A 1KEXA 1ND3C 1QJEA 4ZZ8A 3U37A 1WW4A 1XE0A 3E5UA 3VDDB 5KHGA 3AL6A 3ETQA 1VMFA 4AFMA 5FZGA 2VO5A 1OH3A 1BK0A 1COV3 2VZQA 3ZM8A 2WABA 3VGIA 3ZFFB 1OVSA 2PELA 3VBRC 3HBZA 4LHLA 1S0IA 5FCCA 2DBIA 1Q8PA 4HANA 1GQHA 4GAZA 3OBRA 1VLNA 1HQWA 4QPGC 2BNMA 5FZCA 1FMD1 2AENA 2HWB3 3I2JA 4NHMA 3GALA 4URAA 4YVSB 1TG7A 1IHMA 4YZ1A 2UYAA 1E57A 4PI0A 4B3NA 3ZYRA 3LCPA 3ILFA 2YV8A 4QX2A 2OQ6A 5KXCA 5DAPA 1C8M1 3POSA 3POJA 3U14A 1ONAA 1SDWA 2OPWA 3VD3A 1QQP1 1HRV2 1YFYA 1BQPA 2BNOA 3PUIA 4LXLA 1T6GC 2WAAA 2WWSA 1XYNA 2WA4A 4PDWA 5T55A 4G4FA 2FDFA 4PIYA 4FFIA 2RDQA 5FY8A 2XJRA 5C3QA 5FAXA 1OQDA 2P5BA 3ZMOA 1Q8SA 4A41A 1C1FA 5CFCC 2QQJA 5DXDA 3BB6A 4D94A 1FNYA 4S2FA 4XFGA 1JYCA 3OEBA 4PBPA 2FDKA 4E2QA 3IBMA 2VZVA 4GA9A 1NT0A 5K7PA 4FPYA 5CA6A 1AYN1 3D8CA 3ZSEA 2PHXA 2VCMA 2MPFA 2W5FA 3IWZA 2W92A 1X9TA 5LRSA 1BVVA 2VMDA 5F6KA 2JX9A 4XUTA 5FKCA 2VNRA 4PHZA 2ZX3A 3AVRA 3HN1A 1ZA4A 3QACA 2AR6A 1MQTC 2RJ2A 4BLIA 4JAAA 2C9KA 1Y9MA 1IS3A 4XW3A 4MGIE 4HVQA 3PVBB 3I54A 3SCGA 2VTFA 3SCFA 2FMYA 2V4VA 1QEXA 4AGVA 2Q1FA 2D40A 3GHNA 1H1AA 4XF3A 2EIBA 2DVFA 2IXIA 4COUA 3PU3A 1VBB3 3PVNA 3WDXA 4UXAA 4QQOA 4GXLA 4XUOA 5DABA 5IK4A 1AR82 1C3HA 1JXNA 1GNHA 2CDPA 2VNOA 2W3JA 3C7GA 3Q8BA 5F3CA 2X5IB 3S57A 1IG0A 2PQSA 2WO7A 3H9AA 1J59A 1O8PA 5CB7A 3RWNA 2DYCA 4UFIA 4HSJA 1ZNPA 1LHOA 3VHOA 4OQ9A 2OZJA 4N9IA 3LOIA 4UFJA 3R4UA 4ASLA 5FPLA 3U4SA 4ASKA 1RHI3 5EZWA 5AC91 2JXAA 5JZGA 1FAYA 1W9TA 3W5MA 5KHHA 1Q8OA 2CU5A 4CDUB 5JMCA 4YWAA 1EAH2 4ZU5A 4AQ2A 5FYMA 1ENQA 4QQ2A 2BFUS 4E4DX 3DKWA 2A3YA 4N9HA 5C8CB 1QMJA 4ZY9A 1B35C 2ZHNA 2QFEA 3PMSA 4RFRB 5GLZA 4E4ZA 3RYPA 3UYJA 4P5HA 4I2OA 2IXHA 3O0VA 1LU2A 1OI6A 1X7NA 3ITQA 3GJBA 4RD7A 1QWRA 3CZUA 1JU3A 1DQ1A 2ZXQA 3ZXJA 5IWFA 1E5RA 2P6CA 1ULDA 4BQ2A 3NSTA 2FDGA 2WWJA 4YVWB 3WHTA 3VBOB 3VBSC 1ACCA 1CZSA 1N3QA 4XHXA 2JB8A 4Q4V3 1E5HA 3M3EA 4YW1A 3J7NA 3ZXGA 2ET7A 1C8NA 3NKGA 1RMU2 2RV9A 4KMQA 1HV1A 1GZWA 1XYPA 1SLBA 1GOGA 3NL1A 4CE8A 2H6BA 3WNNA 4CEWA 4F7ZA 1UY0A 1BEV2 5DMYA 5FLHA 3OUHA 4ASMB 3PURA 2RR13 3V56A 3ZR5A 3AXDA 1Y3TA 4HVOA 3IM0A 1SLAA 3CJXA 5FLIA 4ET7A 5FJHA 3VDBA 2OVUA 3ZPYA 2JG9A 1HRV1 1QOTA 2G4IA 4GQ7A 4Q0PA 2VUDA 3FLPA 4RGKA 1XPWA 3APBA 1UX7A 1CGPA 1UKRA 1NCQA 2WC2A
chains in the Genus database with same CATH topology
3ZX7A 5BV6A 2WFF3 1PM7A 1RJ8A 1OFNA 4YW2A 5FPZA 1KQRA 1WCDJ 3B00A 4FPHA 2QDNA 2FBEA 3ES4A 4BWOA 4LO4B 1S55A 2KM2A 4AGRA 1CAVB 2ZGPA 4Y26A 3JBG3 5DG1A 1XU1A 1ZRRA 5FQ0B 2Y38A 4JC1A 3WG1A 5JCTA 1MZ6A 4Y22A 1ZRCA 4ISQA 3HIFA 2NMOA 2R042 4CDXA 1RUF3 4HN1A 4Y20B 2XUMA 2XVLA 1AX1A 3ZDSA 3U0ZA 4SBVA 3E97A 4D7TA 4LULA 3D5OA 2D7FA 5H9SA 1OSGA 3CJIA 2HWC3 4HETA 2CAUA 4LBJA 4FXGB 2ZMLA 4XE9A 4I01A 1NXD1 5DG2A 2TEPA 1DDLA 1NA1C 2Y0OA 2Z5WA 1S2KA 4MVTA 4YNIA 4LBNA 2PAKA 3WDTA 1SBFA 3AK0A 3OYWB 4XETA 5EFUA 3WW2A 1U5YA 2RS33 1UIJA 4QPIC 2A5ZA 5JR7B 2UWAA 2XKPA 3B5LB 3E6BA 3INAA 1F9KA 1Q56A 2R1DA 3M70A 3U11A 3KSCA 1XNBA 2VUJA 3MDPA 4WVWA 3BALA 4M3CA 4CDWA 4FBFA 3B69A 3THTA 3UKNA 5HCFA 2HKXA 1V6IA 5B2GB 3B9CA 3ZO0B 2CGOA 4GULA 3DGTA 2XVGA 2MHFA 1BJQA 4I0AA 4YLZA 1EAH1 4NO4A 2A73B 1V6NA 2ZAAA 1A8MA 1OHFA 2YZ4A 1IPKA 2PN5A 4TYSA 2CV6A 1DIWA 4OI1A 4IV3C 3AKRA 5J96B 1ZREA 3VZOA 4A2UA 3GF6A 1LGNA 4JDMA 4YGBA 3VBUB 3V0BB 4HMZA 4AXOA 1DU3D 5DZEA 1ULCA 3M4FA 2HWE2 1PO23 4C0BA 5BY5A 3LSEA 2WQZC 1ZBE1 3SH5A 1FPN2 2PYTA 3PVOA 4JTOA 5KXDA 1WD4A 4IQPA 4N43C 2ATFA 1RMU1 3SCHA 1RVF3 4IEYA 4WZCA 5IK7A 4PQ9A 4LBQB 4AEKA 4YGCA 1BEV1 3MIHA 4E27A 2RM21 4W6YA 1GQGA 1ENRA 3SH4A 4R9CA 3B01A 5JLVA 1X36A 1D2QA 3D6EA 4X8NA 3ZFFA 2GNMA 2D3PA 4XDQA 2JKBA 1AR63 2XJSA 2IWGB 2DVAA 4QT6A 3J8F2 2JG8C 4JDOA 3H3UA 3WOGA 3ZFEC 1JW6A 2WIIB 3WDWA 4YVSA 2YROA 2CYFA 4AQSA 2XWJB 4LLFA 4FAHA 2Y26A 3V0AB 5H9RA 4JGYC 1RUH2 4AEMA 1EY2A 1Q43A 3FUQA 3IKWA 1BBT2 1DGLA 1ENXA 4ONUA 1I1EA 3AMHA 4XJ9A 3V65A 3OPZA 3WCRA 3ZXDA 2ZGUA 2R041 4G3YC 3UJQA 3PNAA 4Q4Y2 4Z8BA 1X50A 2WNVB 4F8AA 1RUNA 5FLJA 1CQ9A 1ZM1A 2B5HA 2WZR2 3HQXA 4OVEA 3HT1A 5EYYA 3H3ZA 3A4UA 3O0XA 5JOXA 1UU4A 4LO5B 1WW6A 3M3QA 2BBVA 1Q3EA 5SV8A 3FHIB 2PTMA 2Z79A 4NPRA 1N1SA 2PHDA 2PA7A 1O5LA 3N7JA 5GJ6A 3ALQA 1YIPA 3ILNA 5FO7B 3R4DB 5C9AC 1C5HA 1G9CA 2CL2A 2K2SA 3ZIWA 3P3PA 1POV1 4BLJA 4FOVA 2RS12 4LO8A 1DHKB 4GB33 5IK8A 4PJYA 4WM8B 4DZGA 2WKKA 1K5MB 2ZX1A 5I0TA 4Z92B 1O7FA 3IDBB 5ABJB 2X5IA 4IEXA 4WVZA 1C5IA 1BMV1 4CEYC 2QKDA 4EROA 2DCKA 1GZCA 2HWF2 4AI0A 3AMQA 1PGW1 4S2GA 5D8AC 2D3RA 2WS92 4HKLA 1LOFA 3VKNA 1XRUA 4DMIA 5J37A 4B4RA 1SBDA 1V6LA 2XPJA 2RMU3 4YW4A 1HXS2 2HWE1 4XJZA 5IUQA 4D7SA 4CDUA 1FPN1 1N3PA 1RC6A 1LESA 4U2AA 1LGCA 1W2UA 2JD4A 5C8CA 4GWNA 1MR5A 2ET1A 4FQ4A 3MFAA 5GZEA 1RUI2 1ZZ6A 1D4VB 1RTVA 1H2KA 1UAIA 4J6GA 3AMNA 4JV4A 1YUDA 1C8M3 1H0BA 1RUD2 2PHWA 5E8AA 4LHNA 4PCRA 3IN9A 4YVWA 3VBOA 5J09A 5I8SA 4XTPA 1WBLA 2ZGRA 2WNUC 1G86A 2IC1A 1TMF2 5CNAA 2DCYA 4XQWA 1IKQA 1FI2A 3J8F1 2WT1A 3M3IA 2XBO3 3CO2A 5HI0A 1YI7A 1VBD3 3CL1A 1QDCA 4AYUA 3RYKA 4L11A 1RUH1 1UMZA 1B09A 1BBT1 5I8YA 1AJKA 3WNXA 2R1BA 1QJU3 3PJQA 1FATA 2CNAA 3BPZA 4Q4Y1 5K0UB 3AKTA 1H2LA 4CYDA 3NAPB 1YFUA 3O5SA 2WZR1 4DPNA 3EO6A 2ZGNA 4RHV2 2X53S 2A7AA 1YWKA 3VZNA 3NV1A 2XLGA 4Q4X2 1CAVA 1SLTA 4AHYA 1LOBA 5GZCA 1JYIA 2D43A 4N53C 5FQ0A 4Q4W3 4FTEA 1OA2A 1W6MB 1D2SA 2OYZA 5JOWA 2MNGA 1Z78A 2D97A 1QJY3 1MZ5A 4Y20A 2B45X 3M3CA 2VVFA 2RS11 3LAGA 1VJ2A 3M3OA 4K20A 1RUC3 1X8MA 1A6CA 3KMHA 4FOYA 1SCRA 3RG0A 3VKLA 2DFCA 4PDWC 1JBCA 5FMOS 1LHWA 1HW5A 5T5LA 3ZN5A 3AYAA 5HBAA 1F5FA 3PTYA 4AEJA 1XE8A 2VQ0A 3AZXA 3FUOA 3IPVB 3O14A 3OYWA 1F8VA 4IEPA 1CJPA 3QCWA 3LOBA 2AUYA 2HWF1 5J36A 2GALA 3QLQA 4OHYA 1NE4A 2WS91 4YG6A 3VBRB 1AJOA 3E5XA 2JENA 4RGGA 4IV1C 2GU9A 4QPGB 4B4PA 1HXS1 3USSA 1MZFA 1F5JA 3BCWA 2N7GA 4Y1UA 1VR3A 2Q8OA 3ILRA 4YW3A 4XFAA 4XEZA 3RYRA 2W52A 4YYOA 1RUI1 1RINA 5LK7B 5J48A 1AL22 1AXZA 1UX6A 5E88A 1J3PA 1U12A 5DDJ2 3RSJA 4XBNA 3VBUA 3V0BA 1DFQA 3HWJA 1R093 1CIWA 5EXOA 1DGRA 1RUD1 1OD5A 3AJYA 5A3LA 4W6XA 3AFKA 3DPRA 2UWCA 2ZKLA 3W58A 4LR4A 4IEOA 3OJBA 4DXZA 5FOJB 1NCRB 5GLVA 3FLTA 5JPMB 1LHUA 4HBNA 3ZSJA 2YUEA 4I09A 4LBQA 3KCCA 3O7OA 2VG9A 4FTSA 2GNTA 4OHVA 1XNKA 1FV2A 1IS6A 1AX0A 4HFSA 3VZLA 4AG4A 3MIEA 1Z7S2 3HMYA 1GV9A 5A32B 4MUVA 4IEZA 2TBVA 1I3HA 4AK3A 1IKPA 3W59A 4IERA 4MXWB 1HQLA 4EWAA 3ASIA 5FBZA 3ZYJB 2WZPP 3ZXAC 4KG0A 1GICA 3CU7A 4RHV1 4HK9A 2BVBA 3WLUA 4P9GA 1REFA 2I45A 4GH4C 1NQDA 2IZWA 2P34A 1O3SA 4INDA 4Q4X1 3V0AA 1MEC2 4ATEA 2DU0A 1AR83 3VHPA 1ZBA3 4QU2A 4K1YA 3JD72 2D98A 1CX4A 2CGPA 4CEWC 1G9FA 4JGZB 2GC0A 2R6QA 3O0WA 1PO13 2WNVA 1W39A 2GNBA 2OUJA 3SMHA 4EN9B 4YGDA 2D6PA 3FJSA 1W6QB 1TQ5A 5FRAA 1N1YA 1UD1A 1H9PA 1OPOA 1URXA 1WD3A 2O1QA 4XZPA 4AW7A 3ACLA 3O12A 2JG9C 5SV5A 1DF0A 1HQNA 4PIXA 1VBC2 3TOJA 2EXHA 1YLLA 2IFRA 4Y1VA 1DYPA 1WUVA 4BIOA 4K7JA 2Q1ZB 1I9RA 4CDQB 1O3RA 4LHKA 3RNSA 3AMMA 1DGWX 4UBHA 3B3QE 1YCIA 4HL0A 3LA7A 3MPPG 3NV3A 4A3XA 3GZAA 3ZFGB 2ZOEB 4R4XA 2XGXA 3URFA 1HDKA 2A75A 3R6SA 2VOXA 3S6PA 3FMGA 4WM8A 1HRI3 4H7MA 1LOAA 1K5MA 3RMXA 3SISA 4CDXC 1TNRA 3VL9A 2RE9A 3ST7A 1TEIA 5ABJA 1PGL2 3MLLA 4HPKB 2ZGLA 3CJIC 4MGKE 5JOZA 1G6NA 5T5OA 4AWDA 1BEV3 1EPZA 4XILA 1DQ5A 5JIUA 2VULA 1AL21 4BMBA 4FPOB 2ZGSA 2O8QA 4MV2A 5DDJ1 3VL8A 1KRIA 3FBMA 2XJUA 2ZPXA 3H50A 5F6LB 2Z2SB 1C4RA 2CWSA 1A8DA 3BU7A 4COYA 1VBA2 2UU8A 2Z69A 1AXYA 3LA2A 4FVVA 5JSOA 3KGLA 1FOD2 5AFBA 4CDWC 4P9IA 5EWSA 1H8TB 1RUE2 1HV0A 2R16A 1J1LA 1YO8A 1AR92 1GKBA 1XNCA 4B4QA 1NZCA 4TLFA 4FOWA 1S0CA 4QQPA 1MACA 4DINB 1Z7S1 4KG8A 4EWEA 3AYCA 3K48A 1PGSA 2DV9A 1J1TA 2GH2A 1DG6A 3TWIA 4XFIA 4S2HA 3AKQA 2VU9A 2DCJA 3SHRA 2MEV3 2NMNA 4Q0VA 1Y7BA 5AVAA 3WQ7A 1M4WA 2ZZQA 4WM7C 4BIFA 2Q0AA 2DUQA 4OUSA 3I2DA 4BQ1A 1R1ZA 4ISRA 1MEC1 5GLUA 3NV2A 1ZZ7A 4N7UA 2RJKA 4P14A 3FZ3A 3BTAA 3JD71 1PK6B 4AI2A 4META 4GMP1 1AR72 5K0UA 3MFCA 2ZCWA 1RUG2 4RA0A 2R073 3NAPA 3AFGA 3GBGA 3ZSLA 3VDDC 4AFBA 3PHMA 2Q30A 4FP3A 4XJ8A 3VUOA 3AXEA 3GZUC 1QJZA 2HWB2 1ZBE2 4MZUA 4PLMA 1D4M2 3MW3A 1OPMA 4RR3B 1RUJ3 3ZFFC 3GBFA 1VBC1 2JDZA 4IV3B 5DUUA 2PAMA 4DOUA 2A3WA 3POYA 1W6MA 1EPWA 5E1RA 2RM22 3KS7A 1A78A 4AEDB 2GH8A 2ZBJA 1YIFA 2P17A 1W0OA 4RQPB 1VP6A 1BCXA 1DZQA 1YNAA 4AQTA 4ZU7A 4FT8A 1IQAA 4YM1A 1M06G 2K0GA 3LWCA 2H0BA 1R1A2 2GMPA 2HWE3 2PHLA 4CP0A 2XJQA 5CG8A 1NOVA 2EIGA 3EQEA 3TN91 4V1PA 4YG0A 3MIFA 1PGL1 3IPVA 2YMZA 4Q0QA 4ITCA 1H1IA 2CY6A 3ZN4A 4Q0UA 4Q29A 3VBRA 5D1IA 4L9BA 2PLV2 1OLRA 2DCZA 4HSLA 2QUOA 4QPGA 5BNNC 5KHJA 2JG8B 2TNFA 1QY4A 1VBA1 3OY8B 4AVVA 2WQ4A 1H4HA 4NWVA 1ULFA 1FOD1 1EYBA 3WDYA 1RUE1 2EXIA 4BZ4A 1AR91 4C1XA 1KFXL 1U5XA 4K9SA 1SCSA 1ASJ3 4GMP0 2H6CA 4KGQA 1V9U3 1S0EA 2P2KA 2VW2A 3EHKA 5BXXA 4YARA 2A6YA 1TME2 3GYDA 3AJZA 2X5IC 2DFBA 3MICA 3WV6A 3MGUA 3ZN6B 1G8WA 1U5IA 1VALA 1OFSA 4XXPA 4CRQA 2ZHMA 3M1HA 2H0VA 2JE7A 2BFUL 3WUCA 4B8EA 5I0RA 1NCRA 1LOFC 4S2DA 2A6ZA 1ND2B 2XL7A 3UV9A 1YJLA 4PIZA 3C2UA 5BNOB 2GNDA 2DVDA 4Q0SA 1MVQA 1WLTA 1ZZ8A 2JEMA 1MS8A 4MGZE 4CDUC 2XJTA 1BMV2 2W39A 4CZSA 3VV1A 5A32A 4Z1VA 2YYOA 1PGW2 3PMEA 2DURA 4XMAA 4MXWA 1AR71 3JUUA 4XFFA 1RUG1 1VIWB 3WY6A 4AHWA 4B7KA 2RS52 3DPRB 4OHXA 5TSWA 3RDIA 3ZXEA 2JE9A 3GZTB 2HWB1 1ZZBA 4UW3A 3NVCA 1D4M1 3IT8A 3WINE 4YRDA 4RS5B 3VBOC 5L36A 5J3UA 4F83A 1CN1A 1H2NA 1H30A 1H1MA 5GZGA 3KD4A 1XXNA 1ULEA 2E9QA 1VBE3 4JTNA 5FO8B 5HXVA 1OQ1A 4LUMA 2HEYF 4JGZA 2WJSA 4C0HA 5BYNA 1W6QA 2WFF2 3M7AA 3QOPA 1OOPB 2W08A 1SMVA 2PHRA 4FP2A 3R0RA 4H7LA 2VMGA 2GC3A 1HXS3 1R1A1 1O5UA 3OF1A 1QOOA 3AZYA 1CPNA 3AMPA 4LO6B 4GKYA 2DVBA 4HZFA 2CAVA 2X29A 3L2YA 3RZZA 1V6KA 3JBG2 4CDQA 2ZACA 1APNA 1FNZA 4OZXA 1SLIA 2F4PA 4DRVA 2R063 4Y5Z0 1EV12 3VZKA 2WNUB 2D5FA 2PLV1 4XJAA 5BPXA 3ZFGA 1UPSA 4IEUA 2HWC2 2WSUA 1KFUL 4L99A 4XFBA 5JPNB 3WDUA 4DS0A 1PVC3 3KT1A 2V5YA 4XIKA 3J9SA 4HPKA 4P9WA 1TMF3 4H55A 1QKQA 2FQPA 4QGLA 1YYNA 2P3IA 2PHFA 1CONA 3SITA 2WINB 3MEPA 3RS6A 1TME1 3A0KA 3EJKA 4HT1T 4MGYE 1W6NB 4FTBA 3WXPA 3JB8A 3JQWA 4AFDA 1KJLA 1WLDA 2ZGQA 2SBAA 1QU0A 2AGSA 5KBFA 3I59A 4PLNA 1SACA 3VBHB 1H8TA 1O4TA 1DLLA 1QJX2 4GKXA 1UU5A 4N53B 1IS5A 1LOEA 1YFWA 2BGCA 3H0OA 4I3GA 5GALA 3LA3A 3ENRA 1HX6A 1DZRA 2EVXA 3LGRA 2IXCA 2AYHA 3G6JB 4AFAA 5T3NA 4XF1A 3FFZA 5H9PA 2BNNA 4Q4X3 2V73A 2ZTNA 4YSFA 3WP3A 5BNPB 1IGOA 1PO22 1XU2A 4RSUA 3VKFC 1AYM3 1WMDA 2XB6C 4NOTA 1HKDA 5EJ3A 2NP0A 1Q8VA 2RS51 3NWKA 2QJVA 3AYDA 3VBUC 2VVDA 1OLQA 2B42B 3IDEA 1TNFA 4XFHA 2JICA 3WW3A 4EN8B 2VMHA 4KGGA 3ZXLA 2TUNA 3HR9A 4K6BA 1CAXB 2BWCA 1PNGA 3TAYA 5EV7A 4AVSA 4W6WA 3RMYA 4FPFA 5I91A 4X6RB 3KLSA 1VRH2 1FMD3 1PK6A 3AB0A 2HJIA 2GSYA 3ES1A 2DF7A 5T50A 2BWAA 3BODA 4I0WB 3VBFC 1AR62 4FO9A 2WFF1 2G9FA 5FDBA 2B7YA 4QXKA 3NW4A 1DQ6A 3U4XA 1QQP3 2GC2A 3N3HA 1QGLA 5LEJA 3ZVXA 4RR3A 2P3KA 3LKJA 5CFDB 4IV3A 3RQ0A 1NY72 4Z2WA 1DBNA 3JBG1 3BOPA 4QX5A 2KA3A 4AEDA 4M3CE 4XOGA 1AYN3 4J1XA 4XJWA 4L92A 4RQPA 4Q27A 1EV11 4H14A 4P9JA 4Q8KA 5DDJ3 4COWA 2FHRA 2HWC1 5IK5A 3AX4A 2BW8A 3NO8A 4AVAA 5JDBA 2O0OA 3OGJA 4DY3A 5C4WB 2YGLA 3ZSMA 2WNVC 2PHTA 4OFGA 4C90A 1PHMA 4A7KA 4HN0A 1OA3A 1I6XA 2EAAA 4XQDA 3D0SA 5L73A 1VAMA 4FPCA 4BMEA 4AVCA 1PIV2 3LB9A 2ZHKA 4BYYA 5JI7A 4BA6A 2E6VA 1ZYBA 3ZYIB 1JUHA 4SLIA 2QQPA 4PF5A 4TWTA 5JI9A 2DTYA 2JG8A 5KHKA 3UJOA 5L7OB 3OY8A 4GH4B 4IETA 3UK9A 1RGSA 1Y9QA 1C28A 1VAKA 1REDA 4I3PA 3WHUA 1XNDA 4LE4A 1QH6A 5AC93 1QJX1 1LEMA 5FOBB 2C5DA 3DV8A 4LNVA 1W6PB 1LULA 2E51A 2UY9A 4I30A 4WM8C 1K5MC 1ND3B 4W65A 3R05A 3N35A 1RL3A 2YGMA 5ABJC 3WX5A 1MEC3 4ZXKA 1AZDA 4GIQA 4YM0A 3G7DA 3ZN6A 3ELNA 4BH9A 2RMU2 3GNEA 2UURA 1PO21 5DZGA 4DQAA 3N7KA 4QGNA 4QM8A 1RIRA 1KDKA 2VGDA 2BYVE 3BOWA 1ND2A 1MZEA 4LTAA 1OMIA 4AFCA 5BNOA 5GZDA 1DYKA 4QQLA 1JH5A 1ULGA 2VUAA 1CAUB 3VHRA 1GNZA 3POWA 2DCTA 1VBC3 1BXHA 3KT7A 3ZYGA 4XTMA 1LCLA 1Q5OA 4YFZA 4K21A 4JDNA 1WMFA 1VRH1 4L8QA 1LODA 2PHUA 4XF0A 3WP4A 1KITA 2YC0A 2YPJA 5JAXA 1BZWA 2D6MA 1AR61 5CFCB 4EJRA 1JN2P 1ZZ9A 5T5PA 4BCUA 4BOWA 3IDCB 4FSJA 1HRV3 1GFF2 1GANA 2XBO2 4Y1YA 3KB5A 1V00A 4RS5A 3ZXFA 2E7QA 1VBD2 2YY1A 2WA3A 4XPVA 1N1TA 1NY71 2B9UA 2OA2A 5JZGC 2LTNA 4XQ4A 2NPIA 4F3JA 3QH7A 1MVEA 2E7TA 3QBQA 1QJU2 2YHJA 1MQTB 4E4SA 4IEVA 1ALYA 3U07A 3FBYA 5F1RA 1LECA 1OOPA 4R9DA 2CWMA 3FC0A 2NYYA 1L3JA 4C91A 1NXMA 4R9BA 3MYXA 2A6VA 4MSVA 4DY5A 5K0UC 1O3QA 2WFPA 3NAPC 4YM3A 4WVVA 2HYKA 5KXEA 3QH6A 1RUOA 4Q4W2 3MF9A 4LUKA 1LRHA 2NN8A 1XE7A 1PIV1 1ENSA 3OCPA 1QJY2 2ARXA 3B9IA 3VHNA 4LBKA 4UW6A 4XFCA 3SLIA 2WNUA 4Q2FA 1PMIA 5JSRA 1JTZX 4BE3A 3Q9OA 1LENA 1O91A 5FMOL 3VKMA 4LBMA 1YXWA 4XBQA 1WBFA 1RUC2 2ZMNA 4WM7B 5T54A 5A33B 4M00A 5ACA2 2D6NA 1PZ8A