2X29A

Crystal structure of human4-1bb ligand ectodomain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
167
structure length
156
Chain Sequence
DPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQMELRRVVAGEGSGSVSLALHLMPAAALALTVDLPPRNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUMOR NECROSIS FACTOR LIGAND SUPERFAMILY MEMBER 9
publication title The Structure of the Trimer of Human 4-1Bb Ligand is Unique Among Members of the Tumor Necrosis Factor Superfamily.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 25
structure length 156
sequence length 167
ec nomenclature
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2x29A00
4EN0A 3ME2A 1I9RA 3TYJA 2WNUB 4TWTA 3ALQA 2JG8C 1DG6A 3B93A 1KD7A 4G4FA 2JG8B 2RE9A 4TSVA 4MXWA 4QQHA 5TSWA 2Q1MA 4MSVA 1S55A 1RJ8A 3V56A 2AZ5A 4E4SA 1IQAA 5HBAA 2TUNA 1PK6A 2ZPXA 1U5ZA 4J6GA 4MXVA 2JG9A 3TWIA 3FC0A 4DOUA 1D2QA 4N90A 2WNVC 4NN0A 2WNVB 1XU2A 4GIQA 1ALYA 2HEVF 1DU3D 1O91A 5BNQA 4F3JA 2QE3A 2X29A 3B94A 4KG8A 1JTZX 2O0OA 1U5YA 3QD6A 1C28A 3K51A 4G3YC 5KWRA 3MI8A 4KGGA 4RSUA 4DB5A 2WNUA 1D4VB 2KA3A 2JG8A 5CIRA 4KGQA 3LKJA 2R32A 5KC5A 4QQOA 4D7YA 5L19A 2E7AA 1GR3A 2HEYF 1PK6C 3WD5A 4OULA 4HT1T 2R6QA 1RJ7A 2JG9C 1WCKA 1XU1A 3AB0A 2RJLA 5KC6A 2RJKA 2WNVA 5L36A 2QDNA 2ZJCA 2Z5WA 1OQEA 1KXGA 1U5XA 4QPYA 3K48A 4OUSA 2R30A 1A8MA 4MXWB 1OSGA 3L9JT 4QQLA 2WNUC 1TNFA 4QQPA 1C3HA 1JH5A 4OUMA 2HEWF 1PK6B 2Q8OA 2JG9B 1OQDA 1D0GA 2TNFA 3B9IA 3IT8A 3URFA 4QQ2A 1TNRA 4E4DX 2OIIA 3QBQA
chains in the Genus database with same CATH superfamily
1AR81 5LBCA 1OVPA 2C26A 3DPRB 1WA4A 2RS31 2WINB 3HR9A 3NQHA 5FMOL 4CDXA 3BALA 4XFGA 2D44A 2JIGA 4XQWA 4ES9A 1HLCA 3CIHA 4AI8A 1LODA 2W3JA 2WQZC 5JIAA 2OPKA 3ZFGB 4QKBA 1RUF1 3AFKA 3H50A 5BYNA 2WNOA 2C9KA 1JYNA 4YLZA 3OGJA 3S6PA 2CNAA 3K4ZA 4CPBA 3VD5A 1OFSA 1W8WA 4IE7A 5F6KA 3ZKYA 5DAPA 5FLJA 4OFGA 4AVVA 2P5BA 3T2QA 1ZZCA 2VCBA 1HRV2 5FP8A 1CJPA 3V64A 4CXYA 4AEDA 3H8RA 1WD3A 3IDAA 4LKEA 1MR5A 3MPBA 2WT1A 4HONA 4J25A 1RUE1 2BBVA 2EXKA 4KQ7A 1Q8SA 5GLWA 2DTYA 2VBBA 1F5JA 2J1RA 2ZHLA 3HD8B 4IGQA 5EWSA 4OZXA 3N9NA 1YNAA 2ZS6B 5C5UA 2ZX3A 2WDBA 2LM3A 2Q30A 3ETQA 2Y34A 4JCKA 3WNMA 5CYYA 5FZ7A 4KG8A 4GMP0 4GB32 3B69A 5AVPA 4EZHA 3ZYIB 1YI9A 1XJAA 4XIOA 4BB3A 2C4XA 4G3YC 2QQJA 5I8SA 4L99A 3RS6A 5JVVA 4HMZA 1NA1C 1HN1A 3RYRA 1A34A 2G4IA 2BZDA 2VAUA 1GBGA 1F2NA 5IVFA 2ZGRA 1W2UA 4EN9B 1RUG1 2XGXA 4I30A 1WLTA 4YW7A 2FZ2A 1MS9A 1XSRA 5FXXA 3C7GA 3JB8A 1RC6A 2HWC3 3LIGA 1BLZA 4M0HA 3OEBA 2W2IA 4N53B 4Q0VA 3WUCA 2E7TA 5K4LA 1PK6C 2E32A 2JDZA 3SHRA 1GQGA 1ZBA3 3O12A 5FYIA 2R061 5A3PA 1AYM1 1NE6A 1OURA 1XYOA 3AMQA 3F2ZA 2UWCA 3WDXA 4DY5A 4YW2A 1G9AA 2XBO2 4QPWA 5A7WA 1VAKA 4BQWA 3GZAA 4LO7A 3HJRA 4A2UA 2VZTA 4AFBA 4A7ZA 5FUPA 5KBFA 1OQEA 3IMMA 3SXWA 2BFUL 3OBRA 3UGHA 3K75B 1E5SA 4CDWA 5IK7A 1KRIA 1OLMA 1J3RA 2MPFA 5LY1A 2ID4A 3TOJA 4FFFA 3AKPA 1MS5A 5FQ0B 5K7PA 2CU5A 3LF7A 1OC1A 1TNFA 2HWD3 1HQWA 5FXWA 1UIJA 1UOFA 3UKNA 2Q8CA 3WY6A 3ASIA 3ZDVA 3KT1A 1P8JA 4A3XA 4QX8A 3Q8AA 4AL9A 3AXEA 4E4ZA 1QF3A 4WVMB 5JXHA 4KU8A 4K9SA 2FDJA 4JTNA 3H1MA 1DGWX 2OIIA 3DN7A 4RQPC 4XETA 1UIKA 3GDBA 3KF5A 4I01A 3POWA 2CAUA 5ANNA 5IATA 4LBLA 4BHPA 4IV3C 4Y1ZA 4E8CA 5F9TA 3Q8CA 1NT0A 1EY2A 5IVBA 5LCWL 3G7DA 5IT6A 1O3SA 3NVCA 4S2FA 2VULA 2R1BA 3E6CC 3DKQA 3WQ1A 1AL21 1ASJ3 1CJDA 1GQPA 1OBNA 2DYCA 1GFF2 2EALA 3OBZA 1Y7BA 2DCKA 2WZR1 4H7LA 4Y1VA 4QXBA 4O65A 2PHUA 3IB3A 4IEWA 3VBSC 3WQBA 5LK7B 4W6YA 4NVPA 1S55A 1YJLA 4GWJA 4FSJA 3N9LA 4QXCA 1KFUL 5CEHA 2Q8DA 1BBT2 3I54A 2ZEXA 5CFCB 3D4KA 2CWMA 2VMIA 1BMV1 2JG9A 2PLV2 2E26A 5FMOS 3WW1A 4DZGA 1C5HA 4WM8A 1H6XA 1AR61 2AH2A 1QOOA 1HX6A 4LLFA 4LKFA 4N7IA 4HKWA 4NN0A 5C3RA 3U4XA 2KXLA 1LHWA 2SLIA 1ND2C 2XJSA 4YM0A 3VBFB 4E2SA 1WBLA 4FPJA 5HV0A 1VMHA 3CL1A 4MX3A 2HWE2 3VZKA 1F4AA 5BXXA 1Z7S2 1GSLA 3JD73 4CEYA 2C0ZA 4MGKE 2VXJA 5FYTA 2X29A 5KXCA 2GC1A 1XYNA 1H8TB 1MQTA 3VDDC 3KSCA 3N9QA 4CDXC 2DTWA 4NOTA 5KWRA 5JWPA 2WNUA 2PAKA 4K7JA 2ZBJA 4MUVA 5C6CA 4LBNA 2EIGA 3P6BA 1V00A 2BGPA 5IYYA 5EJ3A 3RFRA 2PAEA 3LE0A 5DZFA 3VUOA 2OUJA 5FPUA 2ARBA 2VCMA 5C8CA 2QQKA 2PHDA 4Y1YA 1MACA 1SG3A 2GAUA 3FHQA 3AKTA 4L9BA 3ZXDA 1SLAA 2DUQA 5K0UB 4ATEA 4GMP1 4EE2A 2PYTA 4LA2A 4AI1A 1NLSA 1OD3A 3GZUC 5DDJ2 3B00A 5DUXA 4NHYA 1NKGA 4PQ9A 4AVCA 3OUJA 1J1TA 4DFSA 2B9VA 1YJKA 2W1WA 1UY2A 2I74A 2QDNA 2F17A 3PURA 1BZWA 3HEIA 4FO9A 5FZDA 2P2KA 3KS7A 2A73B 1OUSA 2WNEA 4ORFA 1YCIA 1C1LA 4XHBA 2GNDA 3GBWA 2G9ZA 4GA9A 1WKYA 5D8AA 1GZ9A 1D7PM 1GNHA 4LBKA 1JYXA 3K3NA 1UYPA 1J84A 1HW5A 5FREA 1R081 1CZVA 3WF3A 4QQPA 2A3XA 1JH5A 2RMU2 5FZMA 1VAMA 3UT0A 4META 5FYUA 4H55A 1DDLA 2BFUS 3J26N 2DCYA 3WT3A 1LB2A 3VDAA 3O1MA 3ZO0B 4QPIA 4C1WA 1RMU1 2JDHA 4CUAA 1UZVA 1LTEA 1RUH2 2RS12 1OLRA 4UBGA 5FZ0A 4CUGA 2WR9A 1EV11 1Z0HA 4K1ZA 4W6WA 5EJ1B 4UFHA 4IEUA 3X29B 5A6QA 3AP7A 5FK7A 5LRRA 2JKBA 1K3IA 1W90A 1PO23 4D6QA 1FNZA 2VZQA 4YM1A 3OSDA 3U07A 2B8MA 4TLFA 2UY8A 3O1TA 3VDCA 2PHXA 3VBHA 4XURA 4CDQB 1X8EA 5JPMB 1EUUA 1N1SA 2ZEYA 5T5OA 5T50A 4BCUA 4DXRA 5AFBA 5F5CA 3OB8A 1XNTA 3B3QE 3V0AB 1UKRA 1WW7A 1K5MC 1RVF3 1MS4A 2Q1MA 2VOTA 4QM8A 3POFA 4XDOA 4QX3A 3WV6A 5DXDA 3V56A 1H2MA 1G7YA 5T54A 1RUI2 5BNOA 1XB9A 2KM2A 1R093 3OD4A 2OT7A 1AX1A 1DGRN 3KB5A 4XJAA 1IKQA 2AUYA 3UGGA 3TN93 3A23A 2GN3A 1NCQA 1T6GC 3L2YA 4AZZA 1MZEA 3HAGA 4NAMA 5A3LA 4Q4Y3 2DU1A 4JZRA 3KF3A 1W2NA 3HNMA 4V2WA 5F5QA 1JI6A 2RDNA 4MLOA 1W9YA 1AYN3 2E63A 2VBPA 2WQ8A 1O91A 3IN9A 2D5HA 4XVHA 3AMHA 3OBTA 4D7TA 1WWYA 4KWKA 4F3JA 3NNFA 4IEPA 1UXXX 3WUDA 3C7HA 3GGLA 5IFTA 1CONA 3QCWA 4QPGB 1SCRA 1NOVA 4X6RB 3N7JA 1POV0 5FP7A 1WMFA 1ND3A 3S7EA 3ZPYA 4AVBA 2D43A 1J1LA 5LA0A 4PLNA 1S2KA 1H6YA 2QQUA 1OPMA 1O3TA 2HBUA 1WA6X 4JGYB 4E2GA 5CA6A 2DURA 4XUTA 5J3UA 4AQ6A 1GR3A 3MF6A 3KD4A 1O8SA 1IGOA 1WW6A 4OHXA 2D3RA 5JZGB 1UXZA 3N36A 4FFHA 4BQ1A 4CDUC 3NW4A 4JQRA 1QKQA 1VBB1 5FKBA 5FUNA 3RQ0A 2XUMA 5FO9B 1D4M2 1B35A 1LULA 1MEC1 3LSDA 1W6PB 2XONA 4HVRA 4B29A 2GSYA 2GZWA 1IZ3A 2WN3A 2Z5WA 3CQOA 3D82A 4LOSA 1KXGA 4OHWA 5D21A 3RWNA 3WOGA 1YHFA 1L7QA 4U2AA 1S0CA 3FX3A 1HRV3 1ZZ7A 5DUUA 3KZ4C 1HB3A 2D6MA 5G04L 3VBRB 2MEV1 4XF4A 2HBTA 3IBMA 1V6NA 1GZTA 3AYDA 4GKXA 2ENRA 4L92A 1JU4A 4P9IA 4CCJA 3WNLA 3FBYA 4UAPA 4FAGA 3SH4A 5LW9A 3S0MA 1ODMA 1T6BX 4LBMA 4BOWA 1AHSA 4A7KA 3J9SA 4MGIE 4YVSB 1K12A 3M70A 3IDCB 1QNYA 5GLTA 4AEDC 1HXS2 2CGOA 4IETA 4AK3A 4BMEA 5LBFA 1JMUB 1FT9A 1D0GA 2TNFA 1AX2A 5CVRA 2VUCA 5JOZA 1EP0A 3ZYGA 1ZREA 2P17A 1J83A 2CDOA 4LUKA 4YRDA 5EIYB 4FXGB 3FLRA 3O0WA 4QHBA 4RFRB 3ZM8A 3K4DA 3MW2A 3NV3A 4FPOB 1ZX5A 4LQRA 4C0HA 2WO7A 5FPLA 3ZN6B 2A6XA 3MIFA 4QKDA 5AC91 3EO6A 2XJRA 3LPGA 3LEIA 3HT1A 3RJRA 5HI0A 4XPVA 4ISRA 1JYCA 1PIV1 3UKTA 3LZZA 2OW4A 3VKLA 5KHIA 1DQ1A 4BXFA 2WWSA 1SQ4A 4IEYA 5E88A 3H0OA 3ELNA 5A6ZA 4MSVA 3CBNA 1WMXA 4BWOA 1Y43B 2YFUA 2G9GA 4JGZA 4Y4YA 3W9AA 3WG4A 4AQSA 1PK6A 2IUWA 3G6JB 1U5ZA 3N3HA 4Q4X1 4MXVA 4RS5A 4FBFA 2BP6A 2JEMA 3AKSA 1JU3A 1A6CA 3FC0A 3WNPA 4CA9A 4CP1A 4CP0A 5A6YA 2QJVA 5IHRA 1H8VA 1XU2A 2VBDA 3WG2A 4A3ZA 1H1IA 4S2HA 1DQ2A 1GP6A 5F3EA 3GCXA 4AW7A 2V4AA 4CDWC 1O5UA 3KMHA 1ENXA 3NAPC 2WS92 3VBUA 1QQP3 3VKOA 1G86A 1JTZX 3WW3A 4R52A 2GP3A 4RL7A 4W6XA 2GC0A 2ZACA 4AVTA 3I59A 4YW3A 1BQPA 1GICA 2RR11 2WO1A 3JXSA 1NA1B 4YFWA 1FX5A 4BDVB 4ASMB 4NWVA 1QGLA 1RITA 2R32A 1GQHA 1ULDA 1S0GA 2Z2SB 5F3CA 2Y6KA 5KC5A 3C7OA 2XBO1 2C5DA 3RZKA 1QJEA 3SCGA 1ULPA 4XCBA 2E7AA 3DYMA 2BNOA 3PIGA 5FXVA 2ZGNA 3LGRA 3W21A 4BQXA 1VLNA 1WLDA 2NQYA 2XXZA 4DUWA 2JD9A 5C71A 2OS2A 3UKVA 2BUKA 4L0PA 4CXWA 5JI9A 4DO0A 1XNAA 1ZNPA 1PMIA 1EAH3 3JBG1 3OUHA 1GWKA 4MGSA 1OLME 1PMJX 1IS4A 3ECQA 1POV1 2VTFA 4LBOA 1FPN1 1ZRIA 3LAGA 4XFFA 5FO8B 1XBFA 4AHWA 1HRI1 1TMF3 4QPYA 4FXKB 5GALA 1KDKA 1YUDA 2PHRA 1X50A 1XNDA 1XQNA 1ZBE3 3GYDA 3T08A 1CZSA 4MHUA 5C9AC 5FY8A 2R30A 2DCTA 1C8M1 5H9SA 4Y26A 4M3CE 4XUOA 1C5IA 4KBBA 2E31A 1B09A 2PTMA 3TNPB 3VD3A 4KNCA 3WNKA 1W8OA 3AK0A 4A6SA 4EZ4A 3HN1A 4JC1A 1W9WA 3T4VA 5F32A 5FYMA 4CP2A 2OX0A 3GCWA 4Q4V3 1Z7S3 3NV2A 4XYXA 2Q8OA 1Q5OA 1WGPA 2JDKA 1HV0A 2QNKA 2WLPA 1YEWA 1W6MA 2JD4A 3M3CA 4CRQA 1W6OB 4PIXA 4D3WA 5B4XA 1O59A 4DQAA 3WW4A 2W5FA 1R1A1 1UX6A 2W92A 5FZOA 1YQ2A 2N7GA 4RQPB 4QMAA 4INDA 5JIUA 2ZGLA 1D0HA 1VB2A 4ES8A 3KQ4B 2PHFA 3AKQA 1LGNA 1DQ0A 2K46A 2BRTA 2GNBA 2OZ6A 2P6CA 2VMEA 2YBKA 4FP3A 4Q0QA 3SQOA 4YARA 3KGZA 2XLFA 4EN6B 1MQTC 1RHI2 1UYXA 3AFGA 3BU7A 1BBT1 2JE8A 2JIJA 4QX1A 3U4SA 3ZXEA 3O1RA 4JTOA 3ALQA 1DLLA 5A80A 3N7KA 2HWB1 2PQSA 3AP5A 3SC7X 3ZR5A 4QQHA 1SHWB 3MLKA 1W04A 3JD72 5GZFA 3VBSB 2YC0A 3ZN4A 1ZRRA 2P3JA 2ETEA 3H3ZA 4IV1A 4K1YA 4K3UA 4CYDA 2YV8A 5C8CC 1IQDC 2PELA 4ZONA 5FZHA 4OHZA 3ZMOA 2VOKA 5A6XA 1OXCA 1ZZ9A 3I8TA 3BTZA 1DYKA 2XHNA 4AFAA 2BQPA 4AFCA 3KV6A 3AP9A 2YY1A 3ZLIA 4UI9L 2DF7A 1AXZA 2W1UA 1EPWA 3ZXJA 5M0TA 1D2QA 1MZFA 5F2WA 4NROA 2WZ8A 3ZOIA 4QDSA 3W58A 2H0BA 3HNBM 1ND2B 1OVSA 2PQQA 3FUOA 2Y0OA 1FMD1 3N35A 2RMU3 2IXLA 2TEPA 3POEA 4NPRA 4Z92B 2W94A 2YGLA 5A3MA 3B94A 4MGQA 4QB2A 1PM7A 3GJAA 5D8AC 4XF3A 2HKXA 5A33B 3VDDB 1YFWA 4F8AA 1RUH3 1RUD1 4E4HA 5A32A 2F4PA 3QLQA 4O61A 4CCMA 1RUC1 2ZKNA 3LKJA 1DQ5A 4W4ZA 1GP4A 4YM2A 5FPAA 2GH2A 5ACA1 2E51A 4QPIC 4HKLA 3AYEA 3WDYA 3J4UH 3A0KA 2XQRA 1XNCA 2HEYF 3WG1A 4B4QA 4LO5B 1DFQA 2JECA 4LBQB 2ZMLA 1A78A 1XU1A 1S0JA 1TME3 4IGPA 4RGKA 3PMEA 2WNVA 4AG4A 4BIOA 4DXSA 3LA3A 2EAAA 2IXIA 4OUEA 1K42A 2AC1A 1CPNA 2RS51 3P5BA 3HQUA 2CDPA 3NJXA 3SITA 2W1QA 3UETA 3VBHC 5SV8A 3MIEA 4EYUA 2VH9A 4Q8KA 5I0DA 2VW2A 1PZ7A 1AR93 5FZ9A 5A7QA 1IG3A 5JLVA 4GWNA 2BGOA 4BQYA 2FDHA 2DVFA 4Q29A 5EV7A 1DBNA 5C8WA 4XZPA 2VJXA 4IE6A 5LBBA 2P3KA 4TXWA 5BNOC 4Y20A 4PIZA 2WA3A 4IERA 1JYVA 2HEWF 1R64A 2JJ6A 1TG7A 1NUKA 3RYPA 5FOJB 5FMCA 4AI0A 2VR4A 1GZWB 1LU2A 3AZVA 3KCYA 5IAVA 4I0AA 5A3UA 3AYCA 3ZR6A 4W8JA 2VE1A 5FK8A 5GZEA 3USUA 4K8FA 2BJSA 1TNRA 4RN5A 4QXHA 1V9U2 3TAYA 2UURA 1AUYA 2X10A 1R092 1YIFA 2XJPA 1AXKA 2D3SA 4XZUG 3TN92 5FZ4A 4DRVA 1PVC3 2UYBA 2P1BA 3T2OA 1HKDA 3PJQA 1RUJ2 3ENRA 4MGYE 3S5AA 4YW5A 2EVXA 4NR1A 2XJQA 2D5FA 2CWSA 4AGRA 5C3OA 2VW1A 2WL1A 1AYN2 3ORJA 1OKQA 1QOTA 5EZWA 2A70A 1ND3C 3U1XA 4MG2A 1KGYA 1QXPA 2EF6A 5FP4A 1AJKA 2EIEA 2P34A 4G9SB 3EYPA 1K5MB 1REEA 1YQ5A 3WP3A 4ARYA 4AF9A 1D4M3 1H1AA 3MUZ1 1UOBA 1OA2A 3RWKX 1V70A 3D5OA 2AREA 3N7MA 3ZFFB 1YWKA 4K20A 4YG0A 1UN1A 4KI5M 2FCVA 1KJLA 2NLRA 2UWBA 4PCRA 4UF0A 4Y4RA 3VGIA 1RUF3 3PVBB 3SKVA 1G9BA 2PFWA 4UBHA 2RM22 4TTGA 2R49A 2YBSA 3NKTA 2XKPA 1ULCA 1B35C 1UF2C 5A7NA 2YU1A 3HQRA 4DMIA 1ULOA 1K45A 3PUAA 5JSPA 2B42B 3TEZA 2NMOA 5GZDA 4LJHA 3SCHA 2DVGA 2ZX2A 1HXS3 3AJZA 1TQ5A 2X09A 1QJY1 5AFEA 4KBZA 2JE7A 3ACFA 1WW5A 1M06G 1V0AA 4RHV1 4WVWA 4EROA 4RFT0 1GWMA 3RPQA 3POSA 2Q5TA 2JX9A 3WLUA 4A41A 2PA7A 2VD7A 2CY6A 1JN2P 3VL8A 2JG8A 3OOXA 1E5HA 2R071 2Y60A 1OOPA 3ZXKA 1J59A 2FDGA 5FBJA 3MO4A 2JDAA 1COV1 1VBC1 5CB7A 1OH3A 2HLEA 4HPKA 5L19A 5BPXA 2BEOA 5FZCA 3WDUA 1A8DA 4KMQA 4GJZA 3VZMA 5E1RA 3I2JA 4I3PA 2WUHA 1QMJA 4PDWB 5C3QA 3M7AA 4B8EA 4E27A 5J48A 1RTVA 3N4MA 5FTTC 4LBJA 4FAHA 4CDUB 3KGLA 4XABA 4XUQA 4XTMA 3THTA 2QQPA 4HKOA 2GN7A 4YZ2A 1CAUA 3VZLA 2ZJCA 3ZMNA 3K46A 3PL0A 4J1WA 1PGW1 2VQAA 5FAXA 4CDXB 3RJ2X 4OUSA 2R063 4D0QA 3PUHA 4WV8A 1UAIA 2XDVA 3LFIA 1DGLA 4NUBA 5FYZA 4A45A 4FOQA 2ILMA 1F5FA 1X8MA 1OSGA 2XH6A 3MIGA 4XBLA 4JGZC 2ARAA 2A6ZA 1PNFA 2B45X 1DCSA 1PO12 4OUMA 4TYSA 4BQ2A 3NJYA 4RS5C 3KVAA 2J1AA 3PDQA 1HJFA 4XAAA 2WS93 5GJ6A 2WO3A 3LB9A 1NAEA 1SZBA 1UYYA 1JUHA 1KFXL 2R0HA 4CCEA 4Q26A 3BCWA 2FQPA 2ZKLA 2YUEA 2G19A 3IDEA 4NE9A 4Y1XA 4Y22A 1ENSA 5GZGA 1I1EA 3ZPOA 1HV1A 3LEKA 3I2GA 3NAPA 4LTAA 3AL5A 3VBUC 1X33A 1QJU3 2C9AA 1V6IA 3ZN5A 2G1MA 1ZZ6A 2A7AA 4QB6A 3UNPA 3VDBA 1VRBA 4IEOA 4LT5A 4ZXEA 5C70A 3RSJA 5LASA 5C5TA 1ENRA 4XF0A 3MHZA 4OI0A 2I2SA 4UFKA 4GWMA 1DG6A 1W8NA 2O1QA 1CD3G 3JU9A 4XFHA 1CAVA 4XBNA 1QQP2 2VTXA 3R6SA 5IK4A 2CGPA 2HWC1 4R8HA 1F15A 1VBE2 4OYUA 4CCNA 1AL23 5ANQA 4UW6A 1GP5A 4FOYA 1DZQA 1AR72 1FYUA 5I0UA 1ZBA1 2WZR3 5BY5A 3FHIB 2X53S 2CTVA 3BOWA 4DOUA 1OF3A 3EXUA 1BEV1 1RL3A 1TZOA 1VRH2 2W46A 3CMGA 3JB4C 4H2AA 3UESA 1GUIA 1AZDA 2NPIA 5A7WB 1N1YA 3C3VA 1H4HA 4UFLA 3SEPA 3U75A 2ADDA 5CKMA 5ABJA 5LZ6A 4CDWB 3D0SA 1AR63 2AYHA 3FL7A 2WZPP 4I09A 2D6LX 3VBFA 1EAH2 5JUVA 3FFQA 5EFUA 5FMBA 2XOMA 3AVRA 1CAXA 3LA2A 3MI8A 1ZA4A 1JZ7A 3IAQA 2CSGA 2HWD1 2J22A 1TMF2 5DG2A 2F6BA 5FPVA 4ZS2A 5CADA 2V5DA 1SLLA 4M3CB 4BK4A 1ZBE2 2DBIA 5CKQA 4YZ1A 3ZXLA 4BQ4A 4LKDA 3I3DA 4AAPA 2YDEA 5A70A 4R9AA 3J8F2 2FMYA 1RHI3 4FT8A 4Q27A 4FFIA 4SBVA 2ZOEB 3POJA 5EXOA 4UFMA 5FOBB 4JDOA 1C1FA 2R6QA 4XF1A 5FYCA 1DIWA 4Q4V2 2NMNA 3EHKA 4XDPA 1REFA 2EXJA 2XWBB 3CKHA 3AVSA 4LO8A 1SLTA 4XFBA 4YGBA 4ZY9A 2RJKA 5DZGA 2A6WA 1G6NA 2Z69A 2B7YA 4GH4B 3DF0A 3WNXA 2XJVA 4AFDA 1S1AA 2BW8A 1QHDA 1ASJ1 1QY4A 1WBFA 2QQNA 1W6NA 5FZ8A 3H42B 2FDKA 4GMP3 3E97A 2QQVA 2WC2A 4BU2A 5T5LA 2ET7A 2Q1ZB 4GALA 1PZ8A 2QQMA 5C9AB 2HWF1 4C1XA 2PMWB 4FOWA 4XEZA 2SBAA 4O7XA 3N9MA 4JHZA 3RMYA 4CU9A 4FPYA 3OPWA 4IV1C 1JZ6A 1H4GA 5FCCA 2OPWA 5CG8A 1QXJA 3MBWA 1I6XA 2AENA 2WSVA 3T09A 5CBLA 1NG0A 4UYBA 2EIBA 4EV0A 5EJZB 2JG9B 3PNAA 4CU7A 3MPPG 4WM8B 3URFA 5JOWA 4LPLA 3DECA 3TRSB 2IZWA 3LEMA 3OY8A 2DDUA 3IAPA 1RIRA 5BV6A 1X9TA 1GLHA 1R083 4HN1A 4LOTA 3WCRA 1NXMA 2AR6A 2XJTA 5FZIA 2ZA9A 4PF5A 4CEYB 5JOXA 4L11A 1VBD1 3AL6A 2XL9A 1YO8A 2GC2A 2Q0AA 5KHJA 4TLGA 3LIHA 5T55A 1MQTB 1QIQA 2W9XA 2WBKA 5LK5A 2X5IA 3WDWA 1SDWA 1HIXA 1OFNA 2WNUB 4HVOA 4G4FA 3DYPA 1IPKA 1QNWA 4MXWA 4BYYA 2QQWA 3LDBA 1LAJA 4LHLA 2GP5A 3WCSA 5SV5A 1UY1A 4AWDA 1I5PA 3NNGA 3WF4A 1MVEA 2XUEA 4R4ZA 3THDA 1JW6A 1GANA 3HPNA 4XJWA 3M3EA 2JB4A 3PHMA 2TUNA 5HPOA 2P6HA 2DFCA 1LESA 4J6GA 2YPJA 1NY71 1PGL2 1V6OA 4NIIA 4B4RA 1QJX2 2VCAA 4JHTA 3WP5A 1Q8QA 1VBA1 2WNVC 3J7HA 2B4KA 1MS3A 2BTVC 3WHUA 1FOD3 2D6PA 1LGCA 4XOGA 3POIA 2FBEA 5DAQA 1MZ5A 2VZUA 3H1YA 3RZGA 1ODNA 3P1IA 5FIXA 1DU3D 5BNPA 1E5RA 2P3IA 2VNRA 2VOWA 4WM7A 1UCXA 3S7IA 3WSOA 4JV4A 1CAWA 1TME2 3HT2A 3OGSA 3CJIA 4S2GA 5FPBA 1SFPA 3TEWA 2BGCA 5HCBA 4K21A 1CVNA 1UD1A 1V9U3 5FZKA 1UX7A 3MIDA 4XQ4A 1E57A 3ON7A 1AF9A 1AR92 2XL7A 3U37A 3J7NA 4KH9A 3T2PA 5I0RA 1RUJ3 1SEFA 2DCZA 4QPIB 5IK8A 1G9FA 2NP0A 3IPVA 5I91A 2IXKA 1EPZA 1F9KA 4HK9A 4O9GA 5J37A 4DPNA 5ISLA 2C6SA 4HK8A 4WVVA 3RYKA 3KV4A 1LGBA 1PO21 2ZZQA 4YZ3A 5DAVA 4LMFA 1W9FA 4MVTA 4XIKA 5IK5A 1LOFA 3I49A 4LO6B 1CWPA 2R042 3V0BA 4WZCA 5T5JA 4W50A 1WCUA 1UPIA 2R7EB 3R0RA 5FBZA 3VBHB 3K48A 5FY0A 1YI7A 1KEXA 2A71A 4IXLA 1RVF1 2RM23 2ZAAA 5T5PA 1MEC3 1PVC2 3DPRC 5G05L 4P02B 1RUOA 1UWWA 4LKSA 4FTSA 3WNOA 1YXWA 2NZ9A 3H8UA 4CEWA 1Y9GA 5FUIA 4UW3A 1ULFA 1KDMA 3O1OA 3VBRA 4QXKA 3VHNA 5BNOB 3FMGA 1JYTA 2W87A 3GJBA 3RDIA 4QWNA 2JDYA 1UMIA 1Y9QA 4QB1A 1NCQB 3B5LB 3JZVA 4Q4Y1 2Y8KA 4COWA 1AR82 3H7YA 2RS32 4NIAA 3GBFA 3GM8A 2WFF1 5FPXA 1JZ2A 3SEEA 4JAAA 5KXBA 2K2SA 2EIDA 1OPOA 4AVSA 5GLVA 2BOJA 4JDMA 4WZFA 4IV3B 4PI0A 4Q0UA 3S30A 4A4AA 4XJZA 1RUF2 1U12A 1LR5A 1DGRA 1ST8A 4XAEA 2TBVA 4NRPA 4R4XA 1MS0A 4I0BA 2VNOA 3FZ3A 4PHZA 4U36A 3TYJA 3ACIA 4BA6A 1UW8A 2JG8C 1OUXA 1SLIA 1YFXA 4N43A 1ND3B 1OOPC 1RUE2 2XR4A 4LHNA 4IEVA 5LA9A 5CFDA 3VN4A 5AC93 3MDPA 3ILNA 3P3NA 5HCHA 1NLQA 3ZIXA 4FQ4A 1Y3TA 1RJ8A 5HBAA 3DKWA 4LITA 1NXD1 5FWEA 1V6LA 1DHKB 2ZPXA 3KQRA 4QU2A 4XJ8A 5ERLA 3ZYHA 2IWGB 1O4YA 4CU8A 2A5ZA 2FZ1A 5LATA 2LTNA 1S0FA 2QZ3A 2XMLA 3ACLA 2WJSA 3P3PA 3M1HA 2QQLA 2BWCA 3DXUA 2OKXA 5JXJA 5HV4A 1UZ0A 3SLIA 4BZ4A 3LOIA 4QDRA 4YM3A 1OLQA 4Q4X3 1HRV1 2VU9A 1PO13 2ZHMA 2Y26A 5EYXA 4XUNA 2E53A 2WFPA 1RUG2 1X7NA 3T2TA 4WM8C 2YG0A 4JQTA 3RZZA 3ZVXA 1Q56A 3ZXFA 4JX0A 4DEVA 2LW8A 3GNEA 3AX4A 4CVUA 3BTXA 3T0DA 1G8WA 4ZZ5A 3LDKA 3M3QA 4COZA 2ZGMA 2ATFA 1VALA 3ZXAC 3LEGA 2EA7A 1U5IA 1UOJA 2R062 2VY0A 1AYM2 5A1FA 2OQ6A 1W2AX 2ZGOA 4GB31 3L2HA 4A44A 2DFBA 1JZ5A 2W1SA 3HVDA 1LEMA 4M3CF 4YGCA 2A6YA 2YU2A 4P00B 4YVWA 3AP6A 4QAWA 2RR13 4AI3A 2DU0A 4HN0A 2W47A 4CCOA 4HG6B 1OQ1A 4LHKA 5B2GB 5H9QA 1E5IA 2OVUA 2Z42A 3OUIA 1JHJA 1W0NA 4JKLA 1N1TA 3TEYA 1QOSA 1W2OA 2XPJA 1XC6A 1BHGA 1NCRA 3DEMA 1O7FA 1CGPA 2RDRA 1VBE3 1PZ9A 2AEYA 3N7LA 3PUIA 3MGUA 5APAA 2ZABA 1AR73 2ZEWA 3VBOA 3RZJA 3UJQA 3C2UA 1LOAA 1YLLA 5LB6A 4BXSV 4FTBA 3NV1A 3JQXA 1IPJA 1BXHA 1POV3 1QJU2 1IG0A 1FPN3 1VRH3 2R16A 3VHOA 2DBNA 4Q0SA 1XE8A 1XYPA 4EWDA 2P4EA 2E33A 4JGZB 4RD7A 2RVAA 3GHMA 5DUVA 3BB6A 5T3NA 4HVQA 3WDVA 2PHLA 2V73A 2QDRA 2WO2A 1PK6B 3AC0A 3I3EA 3WVJA 5KHHA 1C8M3 3BPSA 3D0JA 4Z2AA 3GZTB 4Z82A 5C7GA 1OT5A 4AE2A 3B9IA 5FFOC 4QQ2A 5IFPA 3O1PA 1NZCA 4R9BA 4PLMA 3QH6A 2JXAA 1AL22 2JDNA 3INAA 5B4NA 2JKXA 2WZR2 3C7EA 3QBQA 2Y6GA 5ABJC 5JCTA 1N1VA 2DWRA 3E1F1 1W8HA 2OUHA 4RYDA 1ZZBA 3T4HB 1W3XA 3VBFC 3VBUB 4XXAA 4D6RA 3J8F3 5C3SA 4PIYA 4EN0A 4GULA 4LIUA 3OYWA 4LBQD 1W2TA 4M4PA 5IVEA 1A3KA 2W95A 4FPLA 3I59B 5IVJA 4COVA 1BMV2 1POQA 1VAVA 2VNVA 2ZGSA 3ZDSA 5BNNA 4M00A 4N9IA 4AGVA 2QTWB 1AR62 2WAAA 3A0NA 2K9ZA 2ORZA 4OCTA 5FZLA 4B7KA 2WZEA 4YW1A 5DMYA 1IQAA 4AQTA 4C8DA 2YYOA 3CEWA 3QH7A 3BTAA 3I2DA 3ZSJA 2J1TA 4COYA 1SLBA 3WXPA 4COUA 1CQ9A 1O4TA 3H3LA 4CCKA 5J96B 2GALA 4CP9A 1SLCA 2ZHNA 1H0BA 3LQCA 5FYSA 5D1IA 2OQ7A 2QQIA 3IWZA 1S0IA 1W6QA 1IS5A 5LA1A 2ORXA 2PLV1 4ARXA 1LENA 4HXCA 4FFGA 1DYOA 2P37A 3JQWA 5GKAC 4GQ7A 2RJ2A 4HSJA 5FJKA 2KA3A 1GU3A 2HWE1 4AI9A 5KXDA 1FV3A 1Z7S1 4DUXA 2OXBA 3ZIWA 5LRSA 4X8PA 1RYYA 2VOXA 1W9SA 3SCFA 3CLPA 1WMDA 4P9YA 4MGTA 2Y6FA 2YZ4A 3PVOA 4P9GA 1W6MB 1RUD3 3NSTA 2GMEA 2ZGQA 3E5QA 4PI2A 4LK7A 4XFAA 3A22A 2ZTNA 4OULA 1RJ7A 3DL3A 5FZOB 4BM8A 5I8YA 1PHMA 4B7EA 1SPPA 3RG0A 1UMHA 3AMNA 2VZ3A 2H0VA 2WT2A 1DZRA 2RJLA 2Z4FA 5FLIA 3AZYA 4YGEA 4B1MA 5DG1A 2ZCWA 3N9OA 3MV11 5EQUA 2ERFA 1R082 4LBQA 4OVEA 1W8ZA 3ILFA 5FZFA 2C24A 2X5IC 5KXEA 1BKZA 1ZM1A 1C57A 2IFRA 1JZ3A 4BLJA 1QJX3 3OPTA 5F7UA 5DDJ1 3LDRA 3PTYA 1RMU2 3QACA 4UW5A 3CDZB 5GLUA 4IV1B 1V6MA 4QQLA 4AHXA 3GALA 4HLTA 3LA7A 4LXLA 3KVBA 1XNKA 1EV12 5F5IA 3UJOA 3GZEA 5A7SA 2GC3A 4MGZE 5DN2A 4DXZA 1CIYA 3I97A 4FQZA 4LLOA 1F4HA 4ZU5A 1UOGA 2D6NA 1M4WA 3IMNA 3AZWA 4D6SA 1MS1A 1JODA 4CTEA 3ZFEA 3JUUA 3POBA 2VXRA 1IHMA 4E4DX 1PM4A 1GOHA 2RMU1 4UXAA 3THCA 2VTXJ 3WR0A 1SACA 5BNPC 3O1UA 4PJYA 1YFYA 4WM7C 1W3VA 3EMRA 3POYA 4KU7A 4XW3A 3ZSLA 4QDQA 1JHNA 5C4WA 1LHNA 2X8KA 3CJIC 3E6BA 2J7MA 3V65A 3WQ7A 5CISA 5A7PA 4NJ4A 5CZKA 5E8AA 4QT6A 1RUNA 2E6VA 2ZMKA 4DIQA 1FOD2 1RUH1 2RS11 2WWJA 5FO7B 5HXMA 1I9RA 5FY1A 1W28A 4LK6A 1V6KA 4QD2A 4S2DA 5A32B 1UPSA 3ZYFA 2GNMA 3OTFA 1YC61 2RE9A 4LULA 5FZ3A 1STMA 1GKBA 1MVQA 2VZPA 1JYIA 4I2OA 3ZX7A 4E9KA 2A6VA 2Y6JA 4N9HA 5D2AA 5L7OA 1GOFA 4ASKA 4F83A 4P9WA 2R043 1APNA 4FPKA 4I3GA 4NIDA 3QOPA 2YB7A 3IZOA 5FZAA 4QU1A 2VQ0A 3WDTA 1PVXA 1L7RA 3AKRA 3CJXA 4DUVA 2B39A 4NHKA 4Q4W3 2JDPA 4JKKA 4GZ9A 4QGNA 4Y5TA 1EUTA 2VQUA 2CGNA 2WNVB 3K2OA 1LOFC 4RR3A 3LSEA 5H9RA 1RUI1 1RB8G 1IKPA 1UO9A 1N47A 4MV2A 1S0EA 3AJYA 2ARXA 1AR91 2OA2A 4AYUA 4EJRA 4HETA 4AHYA 4QKFA 3O0XA 1C28A 3DPRA 1AR83 4YG3A 3RI9A 3NMBA 4RSUA 5FZGA 5FMDA 5A3WA 2RS33 4CEWC 4XFCA 4LE4A 1DP0A 3AMPA 4ITCA 5FYYA 3VBRC 3PLQA 3ZFGA 2VVFA 1CX4A 4HL0A 4Y20B 2VM9A 5DUWA 1VBB2 3J7LA 4M0NA 4PT6A 4RHV3 4AR2A 1MEC2 1TVGA 3K3OA 3SISA 2VZRA 4KG0A 2Y33A 4KWLA 4Y3OA 4ASLA 3ZSMA 3USUB 3PJYA 4FPFA 3USSA 5I0TA 3APBA 1Y9MA 2WYFA 3M3OA 4XJUA 2CYFA 2R0FA 2I45A 3WHTA 4AI2A 2VMDA 2MEV2 1YIPA 4CE8A 1RUE3 4CZSA 5FWJA 3H8XA 2VVDA 4IEXA 3WW2A 3I2IA 3NKGA 3NO8A 3ROUA 4B3NA 4BJ0A 1TE1B 2XG3A 4PDWA 4OLLA 4P5YA 4IGOA 3I4IA 5DABA 5F3IA 3I2OA 3N9PA 1CX1A 4BIFA 3AP4A 1IOAA 3I3BA 3WF2A 2A1XA 4N43C 5CFDC 1UQXA 3D6EA 3AMMA 1D4M1 4L97A 4XC9A 3HN3A 3L9JT 4XQDA 3VKNA 1ZYBA 2ZGKA 1YFUA 4AEJA 4C91A 4RA0A 2HJIA 4OQ8A 1X36A 4KWJA 2GMMA 1RUG3 1OQDA 4UF0B 5AC92 1W06A 4YPJA 1D2SA 3IT8A 1GZCA 2ARCA 4ONUA 4UWDA 4OHVA 2HYKA 4N53A 1XE7A 4IUGA 2EXHA 2FD8A 1PIV2 3BVCA 3PVNA 5JMCA 3KV9A 3Q8BA 3VZNA 3CU7A 1LOCA 1XSQA 2JWPA 3VD4A 3ZKUA 1HXS1 1AYM3 4AAXA 1GNZA 1OA3A 3U0ZA 1FV2A 2J1EA 5DQ0A 4P14A 2NM1A 2IVIB 2XVGA 3AM2A 3ME2A 1VMJA 2IXHA 1DLCA 4JRLA 1OMIA 5EPAA 3A4UA 4Q4X2 3B93A 1PX3A 2JG8B 1N3QA 2XJUA 3MLJA 1KS4A 1OF4A 1WMEA 1OOPB 1UU5A 1ZZ8A 4AEDB 2GNTA 1DZTA 5FQ0A 4XACA 4HPKB 5GLZA 2B46X 4XCAA 3NL1A 3OGRA 4R9DA 2EAKA 2PHTA 1LKNA 4XFIA 5DZEA 4YVWC 3F95A 4IE5A 3GF6A 1NE4A 3NNMA 4D69A 1SMVA 4NO4A 1Q3EA 2EICA 1MS8A 2ZAHA 4IQPA 4WBBA 2FCTA 2QZ2A 3MV01 3PU3A 4WVMA 2QVSB 3VD9A 1CESA 1AVBA 3OCPA 1NCRC 2IFWA 4XILA 1CAUB 4QHOA 5J1XA 2JENA 2RR12 3NJZA 3Q8FA 3BN6A 3VBOC 3B7MA 5A3OA 4YWAA 5FY5A 4N7UA 1JS9A 4MOAA 2QE3A 3HBZA 4DRRA 1Q8OA 4AFMA 4Q5OA 1BEV3 3HOBA 4KL1A 2J42A 1U5YA 3VZJA 4IEQA 1QEXA 1WZXA 2D93A 2Y64A 2FHRA 1HB2A 1JXNA 1O4ZA 2PXJA 5JMOA 5I0SA 1VB4A 2YMZA 3ES4A 4MADA 3WEZA 4F7ZA 5FP3A 3RI8A 4SLIA 3NNJA 3PMSA 3HBKA 4QQOA 3AZXA 1L7LA 2WS91 3JBG2 4QHZA 4XMAA 5HCFA 1HQNA 1DYPA 4XHXA 2QBXA 4PQQA 3D3AA 5IWFA 1FPN2 5CFCA 1O8PA 1HRI2 4UFIA 4M3CA 1JZ4A 3VLBB 3EQEA 4NIHA 4FP2A 2VGDA 4ZU4A 2BERA 3PVEA 4P08A 4DS0A 2IC1A 1WCKA 1LHUA 3AB0A 4Y22B 2VMCA 2XWJB 1C8M2 1LECA 1QJU1 5L73A 1YRZA 1UNBA 3NAPB 1US2A 4LEJA 2IVJA 3ZYJB 2XB6C 1Q8VA 4L2NA 1VR3A 2Z79A 4IEZA 3UK9A 5JR2A 1WW4A 4YG6A 4BLIA 5FR3A 5BNNC 5F1RA 3LCPA 3DUIA 2WQ4A 1H8TA 4GH4A 3BKZA 1A8MA 3KV5A 4EN7B 1CAVB 4Q8LA 4XUPA 1UU4A 3EJKA 4FOVA 4XMIA 1RXFA 2VQTA 2Q8EA 2XQXA 1R1A2 3U14A 4AOCA 3FJSA 4OZOA 2VZVA 2I07B 4FPGA 2HWF3 3BGAA 4E8DA 1CN1A 1UY0A 2AGSA 3ZXGA 5K0UA 2W52A 3OEAA 3WP4A 3R4UA 2HWB2 1X9PA 2D6OX 3VHRA 2AEZA 5ABJB 3WNNA 1IS6A 4YNIA 3HWJA 5IVCA 1JOPA 4JDNA 1CAXB 2V09A 1J3QA 2DVBA 3AYAA 3H8OA 3IDBB 3THPA 3BI3A 2ZGUA 4CCDA 1W8TA 1S0BA 2LALA 2VNGA 1QWRA 2VMHA 3WG3A 1VBD3 4QX7A 1UY4A 3WF1A 4MO3M 1JYWA 5JXGA 1RHI1 3O0VA 1FMD2 1RGSA 5DPNA 3VZOA 4DXTA 3ETPA 5JSRA 3LOBA 4UT5A 5FLHA 5FY4A 4ZZ8A 4URTA 3JD71 1F31A 5IAXA 2A75A 1H2NA 3ZYPA 1JOJA 4LNVA 4LUMA 5HXVA 1JOBA 1BVVA 4P9XA 1RMU3 1W8FA 1C4RA 2B9UA 2DUOA 1KS5A 1RUD2 3AZZA 3EB7A 4QGMA 1YQCA 2HEVF 2V4VA 3OJBA 3DCQA 1EV13 3SMHA 1W0PA 1RUC2 1S2EA 1W6NB 1W99A 4K8RB 3C8XA 5LA2A 1NQDA 4BMBA 1VJ2A 2BNMA 2IXCA 5FYBA 2LUWA 3DXTA 1QXRA 3MW4A 1VBA3 2GH8A 2L9LA 4Y24A 1WLWA 5ACA2 5LY2A 4Q1PA 1US3A 5F8PA 3ATGA 4AQ2A 4CDQA 5C8CB 2O8QA 3ZSKA 1JUIA 4N8MA 4Z2WA 4NHLA 5CIRA 4KGQA 4YZ5A 5KR7A 3V0AA 2LS6A 1UYZA 2F4LA 5K8SA 4I02A 1URXA 2D97A 2E9QA 1RINA 5FP9A 5IJRA 2RS52 3CF6E 3DV8A 3KCCA 3OY8B 3ZFEC 1LCLA 1W03A 2RG4A 3WX5A 1UU6A 3T0BA 1ULGA 3S57A 3B9CA 3POGA 3MFAA 1FXZA 1VP6A 4NAOA 5FXZA 5L9VA 4K40A 2W91A 1HJGA 3M2MA 3W20A 4DNYA 4Z8BA 5C4WC 1R1ZA 5F39A 4Q0PA 4ET7A 5I8TA 3C7FA 3FN9A 1NLRA 1J58A 3R4DB 4JVAA 1GWLA 5D8AB 3KWVA 2BV4A 1ZRFA 3ZYBA 1VE0A 5F5AA 5CKNA 2J1UA 2X5IB 2VMGA 3KM5A 4IE4A 2WYSA 4HOOA 2OZJA 1IPSA 2RHPA 4AHZA 1BYHA 3BOPA 4MXWB 1K5JA 4P9JA 2ZX1A 5L7OC 4LIVA 4QPGA 2W39A 1FAYA 3K77A 4BE3A 4QM9A 2UU8A 2PHWA 2GU9A 2FDFA 2XKOA 4AXOA 4XTPA 2CV6A 2VUDA 4FVVA 3VKFC 1LOEA 4BK5A 5FY7A 4JGYA 2VUAA 4BQ3A 5F2SA 5KHGA 1N3PA 2ZX0A 2ADEA 3FUQA 2WLQA 3M4FA 1UKGA 1FOD1 1V6JA 3ZFFC 4RR3C 4O9EA 1BJQA 1LJ7A 4NHMA 3TBDA 3MICA 3BIEA 4ZHNA 5JZGA 2JDUA 1DQ4A 2D7FA 1SCSA 5BNPB 2VL4A 1QH7A 4WM7B 1VBB3 4Q4W2 1CAWB 1W6PA 5LEJA 1CR7A 3CJIB 3LD8A 5F3GA 1GMMA 3NNLA 3W5NA 2WFF3 2Y38A 2QCSB 4OMDA 2YC4A 1WLCA 2V72A 4FCAA 5F6LB 1V9U1 3SH5A 4DY3A 3O14A 1FATA 1R091 3GXUA 4XXPA 3ZFGC 3IIIA 5JAXA 3HQXA 1DF0A 4GAZA 4IL7A 2MEV3 3TN91 4A42A 1LRHA 4OI4A 5I93A 4XF9A 3I7DA 5E6HA 3Q9OA 5JI7A 1AX0A 2QUOA 1JZ8A 1RUJ1 3FWEA 2AZ5A 4E4SA 4YVSA 4OQ9A 2OYZA 4D7SA 3NJVA 1QJFA 4Q1RA 1AYN1 5FZEA 1XXNA 2CHHA 4PBOA 5IVVA 5K9YA 2VUJA 3IPVB 4HFSA 2Y0IA 3FLTA 3TWIA 4EN8B 2WN2A 4LO4B 5A3NA 1LHVA 1QJY2 5FZ1A 3RZHA 5GZCA 4V2VA 3VHPA 5CG9A 3KT7A 2BU9A 3OD0A 4RHV2 3VV1A 1KQRA 5GM0A 4ATFA 3U10A 4PDWC 4BISA 2BPA2 1UMZA 1NYWA 2YHJA 3B02A 3ITQA 4MZUA 3V0BB 3ACGA 4FI9A 2WAOA 3E6DA 2R072 3RRDA 3T1LA 5A1LA 3ZN6A 4CSWA 1SBFA 1DGWA 1XPWA 2XVLA 1CZTA 5FV3A 5IUQA 4A7YA 4E2QA 1COV2 1LHOA 1VBC2 2XLGA 2RM21 1VPHA 2BBAA 4IW3A 2DUPA 3WF0A 5FRAA 1EYBA 4YW6A 2LRPA 4IESA 1O5LA 2VCCA 1H9WA 3CZJA 1PIV3 5LWBA 1D4VB 3BPZA 4CEWB 4GWIA 4A6OA 3O1VA 1QU0A 2MNGA 4YZ4A 5EP9A 3ST7A 3EBRA 2ZEZA 2RV9A 1HB1A 5JR7B 3O5SA 4N53C 2E7QA 4XDQA 1B35B 5J98B 1PGW2 4RGGA 1KJRA 2D6KA 4NMIA 4WVZA 2WA4A 3BYWA 4CXXA 5JOYA 5FPZA 4NPMA 1G9DA 1N3OA 1NQJA 1YQ8A 2GMPA 4GB33 1T2XA 4K6BA 3FFZA 4NWWA 3PIJA 1ACCA 2ZHKA 3VB9A 2CL2A 4IDZA 3WZ1A 1FI2A 1W8UA 1SBDA 4HSLA 4B1LA 5J09A 1HQLA 1CIWA 4NRQA 2XVKA 5LEKA 4CUCA 4N43B 3LFMA 3VKMA 5CFDB 4LR4A 4EQVA 5FKCA 4PLOA 3K4AA 1ZVFA 2WIIB 1NA1A 2RDQA 4CCCA 1UY3A 1C3HA 4UFJA 3AXDA 5JPNB 3WP6A 4FTEA 3H7JA 4TN7A 2A3WA 3RZMA 4Q2FA 4BQ5A 3UGFA 2XBO3 4LORA 1HN0A 2QQOA 3LWCA 4FPHA 3TB0A 2VC9A 3ES1A 1U0AA 1CPMA 2GDFA 2UYAA 4CCLA 5F37A 1S0DA 3CHXA 1UL9A 3I2FA 3OGVA 1UZYA 2ZX4A 3OG2A 1OKOA 1UZWA 3DGTA 1PO11 4M4RA 1VIWB 3BODA 3MW3A 5LBEA 5IW0A 2XHKA 3PUQA 2ZMNA 1X82A 4BPZA 1FNYA 3JBG3 5C33A 1O3QA 3O7OA 2HWC2 1F35A 4P5HA 5DAXA 3H9AA 4Z1VA 1GNYA 4XBQA 1HRI3 1WCDJ 2ZZJA 3U78A 3RZLA 1ZRCA 4OI2A 2AACA 1ZBA2 3UV9A 1KD7A 1I5ZA 2Y6LA 2YROA 1LU1A 4R9CA 5TSWA 5L9RA 4RS5B 4OHYA 1PNGA 2ES3A 3BUCA 4AEMA 2VZSA 2KD7A 2PAMA 1BEV2 2QFEA 3HIFA 3R4SA 5C3PA 5E16A 3VD7A 3KHCA 3HMYA 2UY9A 4H3WA 5CFCC 4QX2A 3T30A 4YVWB 5L9BA 3GBGA 3Q8EA 5IVYA 4YGDA 4HANA 3RMXA 4QGLA 1ZA7A 3D8CA 1W6OA 3T1MA 5FYVA 4QKNA 4D94A 2P3YA 1I3HA 1QQP1 4N90A 1VMFA 4YFZA 3TEXA 4EWEA 2NYYA 1WCQA 3OPZA 1VBE1 1NCRB 2YBPA 1R1A3 2HWD2 1YYNA 4RQPA 5FY9A 4AGGA 2DCJA 1AR71 2W08A 5A1AA 4J1XA 2JICA 5HCAA 4H7MA 1F8VA 1SFYA 4NHXA 4IV3A 3T0AA 5BNQA 1ENQA 3VBOB 4NIGA 4UOJA 1S4CA 3SNMA 3JCIA 1LOBA 1H8TC 3OBAA 2CAVA 2C1FA 4GH4C 4HBNA 3ACHA 1VRH1 1SFNA 3QD6A 4NRMA 2ET1A 1OH4A 4PBPA 5FZBA 5JXIA 2D98A 3E5UA 4KGGA 1Z78A 4OI1A 1BBT3 4JRAA 3ZSEA 2D3PA 2PLV3 5FDBA 2HWB3 1W39A 3VBSA 1XE0A 4EWAA 4IE0A 1REDA 3NWKA 4OMCA 4D7YA 1EAH1 4ZS3A 4URAA 2EXIA 1O6UA 4GD4A 3H3UA 2B5HA 5FYHA 3RVHA 2FDIA 1JBCA 3CZUA 2JE9A 2DV9A 1ASJ2 2HWE3 5K0UC 4Y33A 1TMF1 5FZ6A 4CUBA 3E5XA 3PU8A 1WD4A 2HH9A 3WD5A 2J1VA 3KT4A 2JG9C 2VOVA 4ZU7A 1ZBE1 5CNAA 2H6BA 3BU0A 1H9PA 2FMDA 4I0WB 1PGSA 1QJZA 2HWF2 2WT0A 4YSFA 3MEPA 3KLSA 4YW4A 3J8F1 1ND2A 2FCUA 2G9FA 1PMHX 2WRAA 5L36A 1KITA 3S5QA 4FPEA 3OYWB 1FMD3 1U5XA 3M3IA 2NN8A 3NV4A 2VZOA 4Q4V1 4CEYC 5AVAA 4L8QA 5BNNB 3W5MA 2O14A 2VVEA 1SDDB 2Y6HA 4M01A 5A33A 3VDDA 2A3YA 3I3MA 1Y4WA 1ULEA 2WNUC 2DVDA 2ZGPA 4X6QB 1MPXA 1MZ6A 4GKYA 4DEQA 4ZKTB 2UWAA 1RUC3 5DAWA 5A3TA 3U11A 3MIHA 5DDJ3 2D40A 3IM0A 1VBD2 2VO5A 1C8NA 5ACA3 1H2LA 5EYYA 3WINE 2J1SA 4CP9B 3PTRB 4TZDA 4C0BA 1NZIA 2O8OA 3W59A 3ABZA 1PX4A 1W6QB 3IKWA 1QH6A 3DYOA 3ILRA 2WKKA 4W65A 2JDMA 1LOGA 1H30A 2VMFA 4Z07A 3BTYA 2WSUA 3I3QA 1XRUA 3UYJA 2RS53 1LNSA 4YYOA 1QDCA 2BOIA 1Q43A 3MF9A 4CDQC 4XJ9A 3B01A 4TWTA 3MFCA 2DVAA 2X05A 3RNSA 4NPLA 4TSVA 2HYXA 1NY72 2WABA 4GXLA 3CNAA 3SKJE 5J7MA 3HNYM 5EHDA 1VBA2 1W05A 1OD5A 2RS13 5BUVA 3NRUA 2H6CA 4GJYA 1W0OA 3MYXA 1OA4A 5T52A 1BCXA 3KCXA 5CU1A 1GZWA 4DINB 4P9LA 2XLAA 3MZHA 1BVP1 1SPPB 2BYVE 3OF1A 2W0XA 4LE3A 4PF1A 1LEDA 3UL2A 4GIQA 4MH0E 1ALYA 4D8MA 3A21A 4B4PA 5CAZA 4FPCA 3TNQA 3I2KA 3T3YA 1PGL1 4MYEA 1QJX1 2Q1FA 1OI6A 4AVAA 4C90A 2O0OA 4RGAA 4BH9A 1DQ6A 2BNNA 4QPGC 3K51A 2VECA 3H1WA 1GOGA 2QKDA 3KHBA 1RUI3 4DB5A 3FBMA 3OGGA 1HB4A 1BK0A 1TEIA 2YXSA 3MIBA 2IXJA 3A7QA 4ISQA 4Y5Z0 1TME1 1K5MA 4AEKA 3O1SA 1PO22 4JGYC 1XNBA 1ZRDA 1GYKA 4CPBD 1H1MA 2KR2A 2WWUA 1BK1A 5FJHA 1Q8PA 3ZFFA 4X8NA 4ZXKA 1QDOA 3MUY1 3ZFEB 1H2KA 4LA3A 3I2HA 5JZGC 4HT1T 1SBEA 4H14A 1AL0G 3WQ0A 1NCQC 4LHSA 3MLLA 1RVF2 5JSOA 5KC6A 3PUSA 5C4WB 2YFZA 5A7OA 3FHAA 4UW4A 3GHNA 5J36A 2V5YA 2YC2A 2VW0A 5JDBA 2BWAA 1G9CA 5E89A 1RXGA 4Y1UA 3RGBA 1QJY3 2RDSA 2ZGTA 1WUVA 1W9TA 2BVBA 1NX9A 1IS3A 3R05A 4MHRA 4Q4Y2 3IIAA 3SH3A 4CU6A 5L7OB 3VL9A 1J3PA 2R041 2VPVA 1O3RA 4HZFA 4QX0A 4YVSC 3LPFA 2WFF2 2PN5A 2W68A 3BIWE 2Q4SA 3FLPA 2VG9A 1AXYA 2JB8A 4Y5SA 3J7MA 4JKMA 2R073 4ZPIA 1WCSA 3ZYRA 2LROA 4QX5A 2ZXQA 1XOYA 5KHKA 4Q4W1 1HDKA 1COV3 1VBC3 2BVVA 2R1DA 4XE9A 1PVC1 2VZ1A 1ONAA 3CO2A 5C9AA 2K0GA 1GV9A 5H9PA 4RR3B 4V1PA 1YQ6A 4CDUA 2YPDA 1OHFA 1S2BA 3FE5A 3M8LA 2YGMA 1AJOA 1L3JA 1UZZA 4KWUA 2BDRA 2MHFA
chains in the Genus database with same CATH topology
1AR81 3DPRB 1WA4A 2RS31 2WINB 3HR9A 5FMOL 4CDXA 3BALA 4XFGA 2D44A 4XQWA 4ES9A 1HLCA 4AI8A 1LODA 2WQZC 5JIAA 2OPKA 3ZFGB 1RUF1 3AFKA 3H50A 5BYNA 4YLZA 3OGJA 3S6PA 2CNAA 1OFSA 5F6KA 5FLJA 4OFGA 4AVVA 1ZZCA 1HRV2 3V64A 1CJPA 4AEDA 1WD3A 1MR5A 3MPBA 2WT1A 1RUE1 2BBVA 2EXKA 4KQ7A 1Q8SA 5GLWA 2DTYA 1F5JA 2ZHLA 3HD8B 5EWSA 4OZXA 1YNAA 2ZS6B 2ZX3A 2LM3A 2Q30A 3ETQA 4JCKA 4KG8A 4GMP0 4GB32 3B69A 5AVPA 3ZYIB 1YI9A 4XIOA 4G3YC 5I8SA 3RS6A 4L99A 5JVVA 4HMZA 1NA1C 3RYRA 2G4IA 1GBGA 1F2NA 2ZGRA 1W2UA 4EN9B 1RUG1 2XGXA 4I30A 1WLTA 2FZ2A 1MS9A 3JB8A 1RC6A 2HWC3 4M0HA 4N53B 4Q0VA 3WUCA 2E7TA 1PK6C 3SHRA 2JDZA 1GQGA 1ZBA3 3O12A 2R061 1AYM1 1NE6A 1XYOA 3WDXA 3AMQA 4DY5A 2UWCA 1G9AA 4YW2A 2XBO2 1VAKA 3GZAA 4LO7A 4A2UA 4AFBA 4A7ZA 5KBFA 1OQEA 3SXWA 5IK7A 2BFUL 3OBRA 1KRIA 4CDWA 1J3RA 2MPFA 3TOJA 3AKPA 1MS5A 5FQ0B 5K7PA 1TNFA 2HWD3 1HQWA 1UIJA 3UKNA 3WY6A 3ASIA 3KT1A 4A3XA 4E4ZA 3AXEA 1QF3A 4WVMB 4KU8A 4K9SA 4JTNA 3H1MA 1DGWX 2OIIA 3DN7A 4RQPC 4XETA 1UIKA 4I01A 3POWA 2CAUA 4LBLA 4BHPA 4IV3C 4Y1ZA 5F9TA 1EY2A 3G7DA 5IT6A 1O3SA 3NVCA 4S2FA 2VULA 2R1BA 3E6CC 3WQ1A 1AL21 1ASJ3 1CJDA 2DYCA 1GFF2 2EALA 1Y7BA 2DCKA 2WZR1 4H7LA 4Y1VA 5C9AA 3VBSC 2PHUA 4IEWA 5LK7B 4W6YA 4NVPA 1S55A 1YJLA 4FSJA 1KFUL 5CFCB 1BBT2 3I54A 3D4KA 2CWMA 2VMIA 1BMV1 2JG9A 2PLV2 5FMOS 3WW1A 4DZGA 1C5HA 4WM8A 1AR61 2AH2A 1QOOA 1HX6A 4LLFA 4N7IA 4HKWA 4NN0A 3U4XA 2KXLA 1LHWA 2SLIA 1ND2C 2XJSA 4YM0A 3VBFB 4E2SA 1WBLA 4FPJA 3VZKA 3CL1A 4MX3A 2HWE2 5BXXA 1Z7S2 1GSLA 3JD73 4CEYA 2C0ZA 4MGKE 2X29A 5KXCA 2GC1A 1XYNA 1H8TB 1MQTA 3VDDC 3KSCA 2DTWA 4NOTA 5KWRA 5JWPA 2WNUA 2PAKA 4K7JA 2ZBJA 4MUVA 5C6CA 4LBNA 2EIGA 1V00A 5EJ3A 2PAEA 5DZFA 3VUOA 2OUJA 2ARBA 5C8CA 2PHDA 4Y1YA 1MACA 3ZXDA 2GAUA 3AKTA 4L9BA 1SLAA 2DUQA 5K0UB 4ATEA 4GMP1 2PYTA 4LA2A 4AI1A 1NLSA 3GZUC 5DDJ2 3B00A 5DUXA 4PQ9A 4AVCA 1J1TA 4DFSA 1YJKA 2I74A 2QDNA 1BZWA 4FO9A 2P2KA 3KS7A 2A73B 2WNEA 4ORFA 1YCIA 1C1LA 4XHBA 2GNDA 3GBWA 4GA9A 5D8AA 1GZ9A 4LBKA 1GNHA 1HW5A 5FREA 1R081 4QQPA 2A3XA 1JH5A 2RMU2 1VAMA 4META 4H55A 1DDLA 2BFUS 3J26N 2DCYA 3WT3A 3ZO0B 4QPIA 4C1WA 1RMU1 1LTEA 1RUH2 2RS12 1OLRA 4UBGA 4K1ZA 1EV11 1Z0HA 4W6WA 4IEUA 3X29B 3AP7A 5LRRA 2JKBA 1PO23 1FNZA 4YM1A 3U07A 2B8MA 4TLFA 2UY8A 2PHXA 3VBHA 4CDQB 1X8EA 5JPMB 1N1SA 5T50A 5T5OA 4BCUA 5AFBA 3V0AB 3B3QE 1UKRA 1WW7A 1K5MC 1RVF3 1MS4A 2Q1MA 4QM8A 3WV6A 5DXDA 3V56A 1H2MA 1G7YA 5T54A 1RUI2 5BNOA 2KM2A 1R093 3OD4A 1AX1A 1DGRN 3KB5A 4XJAA 1IKQA 2AUYA 3TN93 2GN3A 1NCQA 1T6GC 3L2YA 1MZEA 3HAGA 5A3LA 4Q4Y3 2DU1A 5F5QA 4MLOA 1AYN3 2E63A 3IN9A 1O91A 2D5HA 3AMHA 3OBTA 4D7TA 4F3JA 4KWKA 4IEPA 3WUDA 1CONA 3QCWA 4QPGB 1SCRA 1NOVA 4X6RB 3N7JA 1POV0 1WMFA 1ND3A 3S7EA 3ZPYA 4AVBA 2D43A 1J1LA 4PLNA 1S2KA 1OPMA 1O3TA 4JGYB 4E2GA 5CA6A 2DURA 5J3UA 4AQ6A 1GR3A 3MF6A 3KD4A 1IGOA 1WW6A 4OHXA 2D3RA 5JZGB 4BQ1A 3N36A 4CDUC 3NW4A 4JQRA 1QKQA 1VBB1 3RQ0A 2XUMA 5FO9B 1D4M2 1B35A 1LULA 1MEC1 3LSDA 1W6PB 4HVRA 4B29A 2GSYA 2GZWA 1IZ3A 2Z5WA 3D82A 3RWNA 4OHWA 4CDXC 1KXGA 3WOGA 1YHFA 4U2AA 1S0CA 3FX3A 1HRV3 1ZZ7A 5DUUA 3KZ4C 2D6MA 3VBRB 2MEV1 4XF4A 3IBMA 1V6NA 3AYDA 4COYA 4GKXA 2ENRA 4L92A 4P9IA 4FAGA 3FBYA 3SH4A 3S0MA 4LBMA 4BOWA 1AHSA 4A7KA 3J9SA 4MGIE 4YVSB 3M70A 3IDCB 1QNYA 5GLTA 4AEDC 1HXS2 2CGOA 4IETA 4AK3A 4BMEA 1FT9A 1D0GA 2TNFA 1AX2A 5CVRA 5JOZA 1EP0A 3ZYGA 1ZREA 2P17A 4LUKA 4YRDA 4FXGB 3FLRA 3O0WA 4QHBA 3MW2A 3NV3A 4FPOB 1ZX5A 4C0HA 3ZN6B 2A6XA 3MIFA 5AC91 3EO6A 2XJRA 3HT1A 3RJRA 5HI0A 4XPVA 4ISRA 1JYCA 1PIV1 3UKTA 3LZZA 2OW4A 3VKLA 5KHIA 1DQ1A 2WWSA 1SQ4A 4IEYA 5E88A 3H0OA 3ELNA 4MSVA 4BWOA 1Y43B 2G9GA 4JGZA 4Y4YA 3W9AA 3WG4A 4AQSA 1PK6A 3G6JB 1U5ZA 3N3HA 4Q4X1 4MXVA 4RS5A 4FBFA 2JEMA 3AKSA 1A6CA 3FC0A 4CP1A 4CP0A 2QJVA 1H8VA 1XU2A 3WG2A 1H1IA 4S2HA 1DQ2A 4AW7A 4CDWC 1O5UA 3KMHA 1ENXA 3NAPC 2WS92 3VBUA 1QQP3 3VKOA 1G86A 1JTZX 3WW3A 4R52A 4RL7A 4W6XA 2GC0A 2ZACA 4AVTA 3I59A 4YW3A 1BQPA 1GICA 2RR11 4YFWA 1NA1B 1FX5A 4ASMB 4NWVA 1QGLA 1RITA 2R32A 1GQHA 1ULDA 1S0GA 2Z2SB 5KC5A 2XBO1 2C5DA 3SCGA 2E7AA 2BNOA 2ZGNA 3LGRA 1VLNA 1WLDA 2NQYA 3UKVA 2BUKA 5JI9A 1ZNPA 1PMIA 1EAH3 3JBG1 1IS4A 3ECQA 1POV1 4LBOA 1FPN1 3LAGA 4XFFA 5FO8B 4AHWA 1HRI1 1TMF3 4QPYA 4FXKB 5GALA 1KDKA 1YUDA 2PHRA 1X50A 1XNDA 1XQNA 1ZBE3 3GYDA 5C9AC 2R30A 1C8M1 2DCTA 5H9SA 4Y26A 4M3CE 1C5IA 4KBBA 3TNPB 1B09A 2PTMA 4KNCA 3AK0A 3HN1A 4JC1A 4CP2A 4Q4V3 1Z7S3 3NV2A 4XYXA 2Q8OA 1Q5OA 1WGPA 4WM8C 1HV0A 2QNKA 2WLPA 4CRQA 1W6MA 2JD4A 3M3CA 1W6OB 4PIXA 4D3WA 4DQAA 3WW4A 1R1A1 1UX6A 2N7GA 4RQPB 4QMAA 4INDA 5JIUA 2ZGLA 1D0HA 1VB2A 4ES8A 2PHFA 3AKQA 1LGNA 1DQ0A 4IV3B 4X8PA 2GNBA 2OZ6A 4FP3A 4YARA 4Q0QA 3KGZA 2XLFA 4EN6B 1MQTC 1RHI2 3AFGA 3BU7A 1BBT1 3ZXEA 4JTOA 3ALQA 1DLLA 3N7KA 2HWB1 3AP5A 4QQHA 5GZFA 3MLKA 3JD72 3VBSB 2YC0A 3ZN4A 1ZRRA 2P3JA 2ETEA 3H3ZA 4IV1A 4K1YA 4K3UA 4CYDA 2YV8A 5C8CC 2PELA 4OHZA 3ZMOA 2VOKA 3I8TA 1ZZ9A 1DYKA 4AFAA 2BQPA 4AFCA 3AP9A 2YY1A 2DF7A 1AXZA 1EPWA 3ZXJA 1D2QA 1MZFA 3W58A 2H0BA 1ND2B 2PQQA 3FUOA 2Y0OA 1FMD1 3N35A 2RMU3 2IXLA 2TEPA 4NPRA 4Z92B 2YGLA 5A3MA 3B94A 1PM7A 5D8AC 4XF3A 2HKXA 5A33B 3VDDB 1YFWA 4F8AA 1RUH3 1RUD1 5A32A 2F4PA 3QLQA 1RUC1 2ZKNA 3LKJA 1DQ5A 4YM2A 2GH2A 5ACA1 2E51A 4QPIC 4HKLA 3AYEA 3WDYA 3J4UH 3A0KA 1XNCA 2HEYF 3WG1A 4B4QA 4LO5B 1DFQA 2JECA 4LBQB 2ZMLA 1A78A 1XU1A 1S0JA 1TME3 3PMEA 2WNVA 4AG4A 4BIOA 3LA3A 2EAAA 2IXIA 1CPNA 2RS51 3SITA 3VBHC 4Q8KA 5SV8A 3MIEA 2VH9A 2VW2A 1PZ7A 1AR93 5JLVA 4GWNA 2DVFA 4Q29A 5EV7A 1DBNA 5C8WA 4XZPA 2P3KA 5BNOC 4Y20A 4PIZA 2WA3A 4IERA 2HEWF 2JJ6A 3RYPA 5FOJB 4AI0A 1GZWB 1LU2A 3AZVA 3KCYA 4I0AA 3AYCA 3USUA 5GZEA 4K8FA 1TNRA 1V9U2 3TAYA 2UURA 1AUYA 1R092 1YIFA 2XJPA 1AXKA 2D3SA 3TN92 4DRVA 1PVC3 2UYBA 1HKDA 3PJQA 1RUJ2 3ENRA 4MGYE 4YW5A 2EVXA 4NR1A 2XJQA 2D5FA 2CWSA 4AGRA 2VW1A 2WL1A 1AYN2 1OKQA 1QOTA 5EZWA 2A70A 1ND3C 2EF6A 1QXPA 1AJKA 2P34A 4G9SB 1K5MB 1REEA 3WP3A 4AF9A 1D4M3 1H1AA 1OA2A 1V70A 3D5OA 2AREA 3N7MA 3ZFFB 1YWKA 4K20A 4YG0A 1UN1A 2NLRA 1KJLA 2UWBA 4PCRA 3VGIA 1RUF3 3PVBB 1G9BA 2PFWA 4UBHA 2RM22 2R49A 3NKTA 2XKPA 1ULCA 1B35C 1UF2C 4DMIA 5JSPA 2B42B 2NMOA 5GZDA 3SCHA 2DVGA 2ZX2A 1HXS3 3AJZA 1TQ5A 1QJY1 5AFEA 2JE7A 1WW5A 1M06G 4RHV1 4WVWA 4EROA 4RFT0 3WLUA 3RPQA 3POSA 2Q5TA 2JX9A 2PA7A 2CY6A 1JN2P 3VL8A 2JG8A 2R071 1OOPA 3ZXKA 1J59A 1COV1 1VBC1 5CB7A 4HPKA 5L19A 5BPXA 2BEOA 3WDUA 1A8DA 3VZMA 5E1RA 4I3PA 4PDWB 1QMJA 3M7AA 4B8EA 4E27A 5J48A 1RTVA 3N4MA 5FTTC 4LBJA 4FAHA 4CDUB 3KGLA 4XTMA 3THTA 2QQPA 4HKOA 2GN7A 4YZ2A 1CAUA 3VZLA 2ZJCA 3ZMNA 4J1WA 1PGW1 2VQAA 5FAXA 4CDXB 3RJ2X 4OUSA 2R063 4WV8A 1UAIA 1DGLA 4FOQA 2ILMA 1F5FA 1X8MA 1OSGA 2XH6A 3MIGA 4XBLA 4JGZC 2A6ZA 1PNFA 2B45X 1PO12 4OUMA 4TYSA 4RS5C 2WS93 5GJ6A 3LB9A 1JUHA 1KFXL 2R0HA 4Q26A 3BCWA 2FQPA 2ZKLA 2YUEA 3IDEA 4Y22A 4Y1XA 1ENSA 5GZGA 1I1EA 1HV1A 4LTAA 3NAPA 3VBUC 1X33A 1QJU3 2C9AA 1V6IA 3ZN5A 1ZZ6A 2A7AA 4LT5A 4IEOA 3RSJA 1ENRA 4XF0A 4OI0A 2I2SA 4GWMA 1DG6A 2O1QA 1CD3G 3JU9A 4XFHA 1CAVA 4XBNA 1QQP2 3R6SA 5IK4A 2CGPA 2HWC1 4R8HA 1VBE2 1AL23 4UW6A 4FOYA 1DZQA 1AR72 1FYUA 5I0UA 1ZBA1 2WZR3 5BY5A 3FHIB 2X53S 2CTVA 3BOWA 4DOUA 3EXUA 1BEV1 1RL3A 1VRH2 3JB4C 1AZDA 2NPIA 1N1YA 3C3VA 1H4HA 5ABJA 4CDWB 3D0SA 1AR63 2AYHA 2WZPP 4I09A 2D6LX 3VBFA 1EAH2 3FFQA 5EFUA 1CAXA 3LA2A 3MI8A 1ZA4A 5DG2A 2HWD1 1TMF2 2F6BA 5CADA 1SLLA 4M3CB 1ZBE2 4YZ1A 3ZXLA 2YDEA 4R9AA 3J8F2 2FMYA 1RHI3 4FT8A 4Q27A 4SBVA 2ZOEB 5EXOA 5FOBB 4JDOA 1C1FA 2R6QA 4XF1A 1DIWA 4Q4V2 2NMNA 3EHKA 5SV5A 1REFA 2EXJA 2XWBB 4LO8A 4XFBA 1SLTA 4YGBA 2RJKA 5DZGA 2A6WA 1G6NA 2Z69A 2B7YA 4GH4B 3DF0A 3WNXA 2XJVA 4AFDA 1S1AA 2BW8A 1QHDA 1ASJ1 1QY4A 1WBFA 1W6NA 4GMP3 3E97A 2WC2A 5T5LA 2ET7A 2Q1ZB 4GALA 1PZ8A 5C9AB 2HWF1 4C1XA 4FOWA 4XEZA 2SBAA 3RMYA 4FPYA 4IV1C 1H4GA 5FCCA 5CG8A 1QXJA 1I6XA 2AENA 2WSVA 5CBLA 1NG0A 4EV0A 2JG9B 3PNAA 3MPPG 4WM8B 3URFA 5JOWA 3TRSB 2IZWA 3OY8A 1RIRA 5BV6A 4HN1A 1GLHA 1R083 3WCRA 1NXMA 2AR6A 2XJTA 2ZA9A 4PF5A 4CEYB 5JOXA 4L11A 1VBD1 2XL9A 1YO8A 2GC2A 2Q0AA 5KHJA 5T55A 1MQTB 5LK5A 2X5IA 3WDWA 1SDWA 1HIXA 1OFNA 2WNUB 4HVOA 4G4FA 1IPKA 1QNWA 4MXWA 4BYYA 4LHLA 3WCSA 4AWDA 1MVEA 4R4ZA 1JW6A 1GANA 4XJWA 3M3EA 3PHMA 2TUNA 2DFCA 1LESA 4J6GA 2YPJA 1NY71 1PGL2 1V6OA 4B4RA 1QJX2 3WP5A 1Q8QA 1VBA1 2WNVC 1MS3A 2BTVC 3WHUA 1FOD3 2D6PA 1LGCA 4XOGA 2FBEA 1MZ5A 3H1YA 1DU3D 5BNPA 2P3IA 2VNRA 2VOWA 4WM7A 1UCXA 3S7IA 4JV4A 1CAWA 1TME2 3HT2A 3CJIA 4S2GA 2BGCA 5HCBA 4K21A 1CVNA 1UD1A 1V9U3 3MIDA 4XQ4A 1E57A 1AF9A 1AR92 2XL7A 4KH9A 5I0RA 1RUJ3 1SEFA 2DCZA 4QPIB 5IK8A 1G9FA 2NP0A 3IPVA 5I91A 2IXKA 1EPZA 1F9KA 4HK9A 4O9GA 5J37A 4DPNA 4HK8A 4WVVA 3RYKA 1LGBA 1PO21 2ZZQA 4YZ3A 4MVTA 5IK5A 4XIKA 1LOFA 4LO6B 2R042 3V0BA 4WZCA 5T5JA 3VBHB 1UPIA 3R0RA 5FBZA 3K48A 1YI7A 2A71A 4IXLA 1RVF1 2RM23 2ZAAA 5T5PA 1MEC3 1PVC2 3DPRC 1RUOA 4FTSA 1YXWA 2NZ9A 3H8UA 4CEWA 4UW3A 1ULFA 1KDMA 3VBRA 4QXKA 3VHNA 5BNOB 3FMGA 3RDIA 1Y9QA 1NCQB 3B5LB 3JZVA 4Q4Y1 4COWA 1AR82 3H7YA 2RS32 3GBFA 2WFF1 5FPXA 4JAAA 5KXBA 2K2SA 4AVSA 1OPOA 5GLVA 4JDMA 4WZFA 4Q0UA 3S30A 4XJZA 1RUF2 1U12A 1LR5A 1DGRA 2TBVA 4R4XA 1MS0A 4I0BA 2VNOA 3FZ3A 4U36A 3TYJA 4BA6A 1UW8A 2JG8C 1SLIA 1YFXA 4N43A 1ND3B 1OOPC 1RUE2 4LHNA 4IEVA 5CFDA 3VN4A 5AC93 3MDPA 3ILNA 3P3NA 3ZIXA 4FQ4A 1Y3TA 1RJ8A 5HBAA 3DKWA 1NXD1 1V6LA 1DHKB 2ZPXA 3KQRA 4QU2A 4XJ8A 2IWGB 1O4YA 2A5ZA 2FZ1A 2LTNA 1S0FA 2QZ3A 3ACLA 2WJSA 3P3PA 3M1HA 2BWCA 3SLIA 4BZ4A 4YM3A 3LOIA 1OLQA 4Q4X3 1HRV1 2VU9A 1PO13 2ZHMA 2Y26A 5EYXA 2E53A 2WFPA 1RUG2 1X7NA 3T2TA 3RZZA 3ZVXA 1Q56A 3ZXFA 3GNEA 3AX4A 1G8WA 3M3QA 4COZA 2ZGMA 2ATFA 1VALA 3ZXAC 2EA7A 1U5IA 2R062 2VY0A 1AYM2 2ZGOA 4GB31 3L2HA 2DFBA 4M3CF 1LEMA 4YGCA 4AI3A 2A6YA 4YVWA 3AP6A 2RR13 2DU0A 4HN0A 5B2GB 1OQ1A 4LHKA 5H9QA 2Z42A 2OVUA 1N1TA 1QOSA 2XPJA 1NCRA 1O7FA 1CGPA 1VBE3 1PZ9A 3N7LA 3MGUA 2ZABA 1AR73 3VBOA 3UJQA 3C2UA 1LOAA 1YLLA 4FTBA 3NV1A 3JQXA 1IPJA 1BXHA 1POV3 1QJU2 1VRH3 1FPN3 2R16A 3VHOA 4Q0SA 1XE8A 1XYPA 4EWDA 4JGZB 4RD7A 3GHMA 5DUVA 5T3NA 3BB6A 4HVQA 3WDVA 2PHLA 2V73A 2QDRA 1PK6B 3WVJA 5KHHA 1C8M3 3D0JA 3GZTB 4Z82A 4AE2A 3B9IA 5FFOC 4QQ2A 1NZCA 4R9BA 4PLMA 3QH6A 2JXAA 1AL22 3INAA 3QBQA 2WZR2 5ABJC 5JCTA 1N1VA 2DWRA 2OUHA 1ZZBA 3VBFC 3VBUB 4XXAA 3J8F3 4PIYA 4EN0A 4GULA 3OYWA 4LBQD 1A3KA 4FPLA 3I59B 4COVA 1BMV2 1VAVA 2ZGSA 3ZDSA 5BNNA 4M00A 4N9IA 4AGVA 1AR62 3A0NA 2K9ZA 4B7KA 4YW1A 1IQAA 4AQTA 2YYOA 3CEWA 3QH7A 3BTAA 3I2DA 3ZSJA 1SLBA 3WXPA 4COUA 1CQ9A 1O4TA 5J96B 2GALA 1SLCA 2ZHNA 1H0BA 5D1IA 3IWZA 1S0IA 1W6QA 1IS5A 2PLV1 1LENA 2P37A 3JQWA 5GKAC 4GQ7A 4HSJA 2KA3A 2HWE1 5KXDA 1FV3A 1Z7S1 3ZIWA 5LRSA 2VOXA 3SCFA 3CLPA 1WMDA 4P9YA 2YZ4A 3PVOA 4P9GA 1W6MB 1RUD3 3NSTA 2GMEA 2ZGQA 3E5QA 4XFAA 4OULA 2ZTNA 4BM8A 1RJ7A 3DL3A 5I8YA 1PHMA 4B7EA 3RG0A 3AMNA 2H0VA 2WT2A 1DZRA 2RJLA 5FLIA 3AZYA 4YGEA 5DG1A 2ZCWA 2ERFA 1R082 4LBQA 4OVEA 3ILFA 2X5IC 5KXEA 1BKZA 1ZM1A 1C57A 2IFRA 4BLJA 1QJX3 5DDJ1 3PTYA 1RMU2 3QACA 4UW5A 5GLUA 4IV1B 1V6MA 4QQLA 4AHXA 3GALA 4HLTA 3LA7A 1XNKA 1EV12 3UJOA 2GC3A 4MGZE 4DXZA 4FQZA 4LLOA 4ZU5A 2D6NA 1M4WA 3IMNA 3AZWA 1MS1A 4CTEA 3ZFEA 3JUUA 2VXRA 1IHMA 4E4DX 2RMU1 4UXAA 3WR0A 1SACA 5BNPC 4PJYA 1YFYA 4WM7C 4KU7A 3POYA 4XW3A 3ZSLA 1JHNA 5C4WA 1LHNA 2X8KA 3CJIC 3E6BA 3V65A 3WQ7A 5E8AA 4QT6A 1RUNA 2E6VA 2ZMKA 1FOD2 1RUH1 2RS11 5FO7B 1I9RA 1V6KA 4QD2A 4S2DA 5A32B 1UPSA 2GNMA 3OTFA 2RE9A 4LULA 1JYIA 1GKBA 1MVQA 4I2OA 3ZX7A 4E9KA 2A6VA 4N9HA 5L7OA 4F83A 4P9WA 2R043 1APNA 4FPKA 4I3GA 3QOPA 2VQ0A 3WDTA 1PVXA 3AKRA 3CJXA 2B39A 4NHKA 4Q4W3 4QGNA 2CGNA 2WNVB 1LOFC 4RR3A 3LSEA 5H9RA 1RUI1 1RB8G 1IKPA 1N47A 4MV2A 1S0EA 3AJYA 2ARXA 1AR91 2OA2A 4AYUA 4EJRA 4HETA 4AHYA 3O0XA 1C28A 3DPRA 1AR83 4YG3A 3RI9A 4RSUA 2RS33 4CEWC 4XFCA 4LE4A 3AMPA 4ITCA 3VBRC 3ZFGA 3PLQA 2VVFA 1CX4A 4HL0A 4Y20B 5DUWA 1VBB2 4M0NA 4RHV3 1MEC2 3SISA 4KG0A 4KWLA 4ASLA 3ZSMA 3USUB 3PJYA 4FPFA 3USSA 5I0TA 3APBA 4XJUA 3M3OA 2CYFA 2R0FA 2I45A 3WHTA 4AI2A 4CZSA 2MEV2 1YIPA 1RUE3 2VVDA 4IEXA 3WW2A 4B3NA 3NKGA 3NO8A 3ROUA 1TE1B 2XG3A 4PDWA 4OLLA 3I4IA 4BIFA 3AP4A 1IOAA 4N43C 5CFDC 3D6EA 3AMMA 1D4M1 4L97A 3L9JT 4XQDA 3VKNA 1ZYBA 2ZGKA 1YFUA 4AEJA 4C91A 4RA0A 2HJIA 1X36A 4KWJA 2GMMA 1RUG3 1OQDA 5AC92 1D2SA 3IT8A 1GZCA 4ONUA 4OHVA 2HYKA 4N53A 1XE7A 2EXHA 1PIV2 3PVNA 5JMCA 3VZNA 3CU7A 1LOCA 1HXS1 1AYM3 1GNZA 1OA3A 3U0ZA 1FV2A 4P14A 2NM1A 2XVGA 3AM2A 3ME2A 2IXHA 4JRLA 1OMIA 3A4UA 4Q4X2 3B93A 2JG8B 1N3QA 2XJUA 3MLJA 1KS4A 1WMEA 1OOPB 1UU5A 1ZZ8A 4AEDB 2GNTA 1DZTA 5FQ0A 4HPKB 5GLZA 2B46X 3NL1A 4R9DA 2EAKA 2PHTA 1LKNA 4XFIA 5DZEA 4YVWC 3GF6A 1NE4A 4D69A 1SMVA 4NO4A 1Q3EA 2ZAHA 1MS8A 4IQPA 4WBBA 2QZ2A 4WVMA 2QVSB 1CESA 1AVBA 3OCPA 1NCRC 2IFWA 4XILA 1CAUB 2JENA 2RR12 3NJZA 3VBOC 3B7MA 4N7UA 2QE3A 3HBZA 4DRRA 1Q8OA 4AFMA 1BEV3 4KL1A 1U5YA 3VZJA 4IEQA 2D93A 2FHRA 1JXNA 1O4ZA 5I0SA 1VB4A 2YMZA 3ES4A 4F7ZA 3RI8A 4SLIA 3PMSA 4QQOA 3AZXA 2WS91 3JBG2 4XMAA 5HCFA 1HQNA 1DYPA 4XHXA 1FPN2 5CFCA 1HRI2 4M3CA 3VLBB 3EQEA 4FP2A 2VGDA 4ZU4A 4DS0A 3PVEA 2IC1A 1WCKA 1LHUA 3AB0A 4Y22B 2XWJB 1C8M2 1LECA 1QJU1 5L73A 1YRZA 3NAPB 4LEJA 3ZYJB 2XB6C 1Q8VA 4L2NA 1VR3A 2Z79A 4IEZA 3UK9A 1WW4A 4YG6A 4BLIA 5BNNC 5F1RA 3LCPA 3DUIA 2WQ4A 1H8TA 4GH4A 1A8MA 4EN7B 1CAVB 4Q8LA