2X29A

Crystal structure of human4-1bb ligand ectodomain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
167
structure length
156
Chain Sequence
DPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQMELRRVVAGEGSGSVSLALHLMPAAALALTVDLPPRNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords TUMOR NECROSIS FACTOR LIGAND SUPERFAMILY MEMBER 9
publication title The Structure of the Trimer of Human 4-1Bb Ligand is Unique Among Members of the Tumor Necrosis Factor Superfamily.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 156
sequence length 167
ec nomenclature
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2x29A00
3AB0A 4J6GA 1GR3A 2JG8C 4N90A 2KA3A 1D2QA 4MSVA 4RSUA 2JG9C 2JG8A 5KC5A 1RJ8A 2Q1MA 1DU3D 1JTZX 2R30A 4DOUA 2JG9A 3QD6A 5BNQA 2HEVF 3K51A 2JG9B 4QQ2A 2ZPXA 1I9RA 1D4VB 1KD7A 3B94A 3MI8A 3WD5A 1A8MA 1KXGA 1XU2A 2QE3A 2E7AA 4F3JA 2R6QA 3LKJA 3K48A 4OUSA 5CIRA 4QQHA 4OULA 2TNFA 4KG8A 1OSGA 4KGQA 2JG8B 3V56A 4E4DX 4G4FA 4HT1T 2RJKA 3TWIA 3B93A 1TNRA 4EN0A 1WCKA 1TNFA 2RJLA 4MXWA 3QBQA 4OUMA 4KGGA 2TUNA 4MXWB 1XU1A 1PK6C 4QQOA 1U5YA 1IQAA 2O0OA 1DG6A 1S55A 1OQEA 1PK6A 4QQPA 3URFA 2Z5WA 1U5ZA 2AZ5A 1PK6B 3L9JT 2Q8OA 4QQLA 1U5XA 3TYJA 5KWRA 3B9IA 4GIQA 1C28A 2RE9A 1D0GA 4DB5A 4QPYA 2ZJCA 1JH5A 5L19A 4TWTA 4MXVA 1ALYA 1C3HA 2R32A 5HBAA 1OQDA 5L36A 4G3YC 3ME2A 5TSWA 4NN0A 3FC0A 2WNVC 2HEWF 3ALQA 2QDNA 2OIIA 2HEYF 2WNUC 3IT8A 2WNVA 4TSVA 2X29A 2WNUA 2WNVB 4D7YA 1RJ7A 4E4SA 1O91A 5KC6A 2WNUB
chains in the Genus database with same CATH superfamily
3M3QA 2XJTA 4WBBA 2VU9A 5A3PA 2WDBA 1IKPA 1LOAA 1MVEA 3IDBB 2HWF3 2XMLA 3IM0A 4Z2WA 5T5PA 2VCBA 4AFMA 2H0VA 2PAEA 3AMNA 5KC5A 5FOJB 1JTZX 1QMJA 3HBKA 1RUI3 3PIJA 1MPXA 3DPRA 3O5SA 3M3EA 1N3OA 4YFWA 1G9AA 1NA1C 5FZAA 3PMSA 1LOFA 1QNWA 1GZWA 1UXZA 3PHMA 4PJYA 4BLIA 1BZWA 5CG8A 4FTEA 4F3JA 2E7AA 1F35A 1V9U3 1LOGA 3DYPA 4FFHA 2DCZA 1D4M2 1ACCA 3T0BA 4R9CA 1H9PA 1QJU2 4G9SB 5LBBA 1C5IA 4HKOA 3WNKA 3OCPA 3I2FA 4QD2A 3WNXA 1FPN1 1W2TA 2TNFA 4S2DA 3U1XA 5CFCC 5DAVA 2UU8A 1U12A 2BWAA 4QHOA 4JGYC 1OVSA 4K1ZA 4IGPA 5D1IA 2B45X 3IPVB 4P9JA 4MGTA 4JHTA 4IESA 4AHXA 1NCRA 4CEWB 4LHKA 3UYJA 5AC93 5IWFA 1JOBA 3DUIA 3LPFA 3ZOIA 4EWEA 5FQ0A 4NR1A 5FP8A 2MPFA 2D6KA 5I8TA 4X8NA 2RR13 3K75B 3VKOA 2R0FA 1ZZ6A 3MDPA 4COWA 2IXCA 1O4YA 2BGCA 3BYWA 1MS8A 1YJKA 5BNOC 2Q30A 3ZMNA 2X5IA 1Q43A 1W3XA 1UF2C 1PO21 4AVAA 2ZGUA 1L7LA 3S5QA 2WRAA 4GZ9A 1T6BX 4QHBA 3ZO0B 1NG0A 4DINB 1D4M1 1AZDA 2GN7A 4JDNA 1Y4WA 3POJA 3KF3A 1RXGA 3IAQA 4B4PA 3MLJA 1HDKA 4YVSB 4BMEA 1N1SA 2AACA 1U5IA 1YO8A 2WSVA 1E5SA 2RG4A 2V5YA 5FPVA 5JOYA 5FDBA 2Y60A 1GZCA 5FZIA 1C28A 1PIV2 1V6OA 3FLPA 5LK7B 1GICA 4X6RB 1MQTA 5FPUA 1WCDJ 1QOOA 3GF6A 5FXZA 1RUE1 4XEZA 3NSTA 5EYYA 5I91A 4IE7A 1AUYA 3KV6A 1UY1A 2Q8DA 5C9AC 1FV3A 3GZTB 2J22A 4G3YC 5FZOA 5IK7A 1C8M2 2DVFA 2IXJA 5JUVA 1RUD3 3PMEA 4D69A 2XOMA 1DQ1A 4KWKA 4Q8LA 2ET1A 2RMU2 2HEYF 3IZOA 4OUEA 3VBOC 4GMP3 1VBA2 3Q8AA 3J8F2 4XUNA 3CZJA 5EJ1B 1ULCA 5T55A 4CVUA 2H6BA 2W87A 3B9CA 1JMUB 5FPXA 2NLRA 1XSRA 2Y6KA 4NO4A 4RQPC 2D97A 1WCQA 3WG4A 5FYBA 5JXJA 4IEZA 1OKQA 4ASLA 2VUAA 2BOIA 2XKPA 2ZBJA 3I3EA 1PNFA 1RVF3 5HCBA 5LK5A 3RMXA 4LORA 1Q8QA 3SHRA 5A6YA 3NVCA 3ZPOA 3OUIA 4O61A 5HI0A 1YIPA 2BGPA 2WC2A 2X53S 4P9XA 5LBCA 4E4ZA 2DCTA 2IUWA 2DVGA 2EXIA 3LIHA 4NUBA 2PN5A 2XQXA 3JQWA 4GJZA 3AZZA 5CB7A 1J1LA 1W8UA 5KHIA 2D3PA 1ODNA 2ARCA 1J1TA 1W9WA 1D4VB 2V4AA 4LBLA 5HV0A 2YBPA 2WT0A 2MEV3 3EJKA 3DYOA 3H50A 4AAPA 2RMU1 3ILFA 3ZXJA 1BLZA 1VBA1 3J8F1 2XJPA 1IPJA 4QXBA 4QM9A 3POWA 4XFIA 5CIRA 4Y20A 5IVEA 4IV3A 4FT8A 5EYXA 3H8OA 4ET7A 3AX4A 4OULA 3PURA 2FCTA 3JD73 2CAUA 1YEWA 2ZX4A 1S2KA 1LHVA 2IXHA 5I0SA 4MADA 2JG8B 2P2KA 1FYUA 2XHNA 5A3TA 4HT1T 2WQZC 5EHDA 4ZKTB 1VAVA 4W6XA 1RB8G 3RYKA 2DU1A 4FP3A 1EUUA 1QDOA 1VBE3 4YGCA 3C7GA 3VKNA 3ITQA 1TMF2 3WNNA 1CESA 2VTXA 3FBMA 3RYRA 5FQ0B 1JU4A 5FZCA 2D5FA 4NE9A 1RUC2 2CGNA 1L7QA 4Q4X3 2WO2A 1O3SA 5FWEA 2B39A 2TUNA 3NV3A 1XU1A 5DDJ3 3U4SA 1ZBA2 1VLNA 2C9KA 1RHI1 4XDOA 1AJKA 1W8ZA 2CHHA 5GZEA 4P5HA 4CDWA 2X5IB 1OQEA 3H9AA 3R4DB 1I5PA 1PK6A 2KR2A 1PO13 4RS5C 3E1F1 1ZZ9A 5FFOC 1DP0A 4I0AA 5FMBA 4D7SA 1HQLA 4CCOA 1CN1A 4NIAA 4GQ7A 3UL2A 3O1PA 2E63A 5ANNA 1QQP1 4ATFA 1OUSA 1C1LA 5JOWA 1KJLA 2WN3A 4ES8A 2E53A 4YG3A 4I3GA 3M4FA 4K6BA 1OHFA 3R6SA 4B1LA 3UESA 2X05A 1TMF1 4BMBA 1MQTB 1QHDA 2PQQA 3KVBA 5HBAA 1LU2A 2D3RA 2F6BA 2ARAA 5I8SA 1RUC1 3CLPA 3J26N 3T2QA 2XJSA 2WT2A 1HX6A 2NMOA 4W65A 1ZBA1 5FY9A 1F5JA 1F2NA 4PT6A 5FZOB 3WQ0A 1XJAA 4HONA 3S7EA 3WDVA 1CONA 2E31A 4PF5A 2VOXA 3KWVA 4MHRA 5C3QA 1EUTA 4Q0PA 5LEJA 1WMXA 2HWF2 1URXA 2F4PA 1FOD2 3FLRA 2YC2A 3U78A 5JPNB 2WNUA 3EQEA 1W04A 1T6GC 1WBLA 3KZ4C 3WQ7A 4DXRA 3ZR6A 5CBLA 1GNHA 4XHXA 2SLIA 4E4HA 1SDWA 2JG8C 2ORZA 3QCWA 2PA7A 2W9XA 3JB8A 4UYBA 2A75A 3U75A 4EZHA 2WO3A 4C0BA 2GC3A 2Q1FA 4QHZA 3WY6A 3WUCA 1YCIA 2E51A 2VNRA 4RYDA 1AL23 3LGRA 2VMEA 1VRH3 3JBG2 1MVQA 3KCCA 3BKZA 4LKEA 1WMFA 2TBVA 4LPLA 1MR5A 3GBGA 4XAEA 3S30A 3ZFGC 4L8QA 1AX0A 5KHKA 2WA4A 2UYBA 4MLOA 4LKDA 1W2UA 3RS6A 2P17A 1PGW2 1UPSA 1W39A 3B5LB 5FZ3A 2WQ8A 4CCLA 2HWF1 4IDZA 3TNQA 1EY2A 5JIUA 2WWJA 3PL0A 3B69A 3OTFA 2F4LA 1MZEA 4Y20B 2XBO2 2HYXA 4IV3B 1RUI1 4FCAA 4MZUA 3ZXFA 1HN1A 4EN6B 2IXIA 2VBDA 2RR12 2D6PA 1Z0HA 1W8WA 3ZFEA 2VMGA 4FPLA 4AHZA 3H1YA 3VHPA 3HEIA 2VC9A 3DEMA 1LOCA 5FZFA 5A33A 1KS5A 3T4VA 3WP4A 1UNBA 3BPZA 3TWIA 3VZKA 2V73A 1DDLA 1YI9A 2VZRA 3ZIXA 4AVVA 5F32A 1V6JA 3NV4A 2E33A 4EN9B 5JMCA 2FDKA 5DPNA 4QPGA 3OGJA 4IEOA 1RMU3 2VQAA 1PGW1 2WQ4A 1JUIA 4RA0A 5C3PA 2CY6A 3OGVA 4BQWA 2Q5TA 1IQAA 2YC0A 4FOQA 1R1ZA 2WNOA 4ZU5A 3MW3A 1RUG3 2WZ8A 5FXWA 4XHBA 4DUXA 5FKCA 3N9LA 2DYCA 1UQXA 4BH9A 4CDWB 1COV2 4Q26A 1LOBA 2QQKA 2X10A 1PK6B 2DUPA 2XBO1 4A3XA 4LO8A 3LDBA 1OI6A 2RR11 1OH3A 3M1HA 4ZHNA 3W59A 3NJYA 1AYM2 4LNVA 4DUWA 4Z2AA 1W2NA 4LULA 1MZ5A 4D7TA 1D0GA 4ITCA 4H7LA 4XVHA 3VBHC 1ENQA 3VDCA 4AZZA 1UKRA 5KHGA 1O3TA 3VUOA 4P9GA 2YZ4A 5LB6A 3UGGA 3SCGA 4X6QB 1ZYBA 4K20A 4GXLA 2VZQA 4QGMA 1GBGA 4OHXA 2DFBA 1WCUA 2ZHMA 4Y5SA 4NWVA 4O7XA 2FCVA 4AR2A 2VNGA 4LO5B 3G7DA 5L36A 2YGMA 5FLJA 5E88A 2V09A 3SEPA 4DXSA 3Q8BA 3I2OA 3IMNA 2P3IA 3O0VA 5GJ6A 1LU1A 2ZOEB 3ACHA 3OEBA 1W6MB 2BERA 1JZ6A 4XBQA 5DG2A 4AI8A 4Q4W2 1CJDA 1W99A 1WUVA 2VNOA 1LGCA 4JV4A 3DV8A 4QDQA 4CDXA 2C24A 1COV1 3B7MA 4YPJA 5ABJA 5C4WC 5EIYB 5LCWL 5IK5A 4BJ0A 5FMOS 2BNOA 3AMPA 5JOZA 4IEWA 3KB5A 4UW3A 3KHCA 2PAKA 2WNUB 4AGVA 3WCRA 2ZHKA 4JTNA 3AZXA 1OVPA 4MGQA 3VBUA 3MIGA 1V6IA 4KBZA 4LKFA 2ZGPA 3NAPC 5BUVA 1CX4A 3VBRC 4LOSA 5L9VA 4XABA 4DY5A 4HBNA 4PDWC 1AX1A 4R9BA 4NIHA 4LE4A 3EMRA 4IW3A 1PMJX 2ZPXA 1I9RA 1BJQA 2Z69A 3JD72 1ULPA 4KQ7A 4P9WA 4CUCA 1VMFA 3SH5A 4P9IA 4Q4W1 5FZKA 4XE9A 4Q29A 2CSGA 2QE3A 5A1FA 5FTTC 4YGEA 3D0JA 1RVF1 2Y0OA 1R64A 1BK1A 1W9FA 2W92A 2LUWA 5AVPA 4OI2A 3ACIA 5HXVA 5C6CA 1FATA 1UOFA 5CNAA 3EXUA 1US2A 1DLLA 5EPAA 4RR3A 4XQWA 5BV6A 2YG0A 4FFIA 5FBJA 3ZXEA 5F2WA 2YGLA 4EYUA 4PBPA 1F4AA 3SC7X 3EB7A 3CJXA 2D93A 4B8EA 2WS93 2PHRA 3GBWA 1UY0A 2BGOA 2OXBA 3PVEA 5CU1A 4Z07A 1SLIA 2NM1A 3ZFEB 1XXNA 3H3LA 2QFEA 3O0WA 1GSLA 4BQYA 5CKQA 1VP6A 4CZSA 2CGOA 1W9TA 1ND2B 3A21A 1ONAA 1LECA 2WAOA 3H7JA 3IB3A 3JD71 4UFJA 1JYWA 3NNJA 1OFSA 2VD7A 1HJFA 3D8CA 3AKTA 4YZ5A 2PHDA 3A0NA 3RGBA 1H30A 1Y9MA 4HXCA 4LHSA 4WZCA 1GQGA 4BXSV 2Z42A 1OPMA 1ULDA 2JECA 3AFKA 2Z5WA 4DQAA 1K5MC 5LW9A 4AWDA 1E57A 1MZFA 1RC6A 5A80A 4BQ1A 3HQUA 4FPKA 3PVNA 2K2SA 2VOTA 3HQRA 1D4M3 4JRLA 2R49A 4JZRA 1QJU3 1JYXA 1XC6A 3O1MA 5CEHA 2W1WA 4C90A 4FP2A 2QQUA 3LF7A 4HZFA 2NQYA 3QLQA 1MS0A 2A3XA 4HG6B 4Y33A 2XDVA 5C8WA 4AW7A 3P3NA 1OOPB 4IEPA 3WNPA 4MUVA 4OHZA 4HPKB 3WEZA 3MZHA 1GZ9A 2Y34A 4I02A 4QMAA 5T50A 5JXGA 1A3KA 4HK8A 3MUY1 2FDHA 3R4SA 4HETA 1ZZBA 4K9SA 1I6XA 3MHZA 2DWRA 2VPVA 2WN2A 1LHNA 4LUKA 1O7FA 4KMQA 4XMIA 4AEDA 3OF1A 3KHBA 1HW5A 1W8TA 5F37A 3WQBA 1VB4A 4M3CB 1VRBA 4BWOA 5GLTA 1WZXA 1SBDA 2OUHA 3ETPA 3INAA 4LMFA 1TZOA 4CDXB 5ABJB 4LT5A 3RZZA 1AL22 5FLHA 3TEXA 2QKDA 4FO9A 2ETEA 4XIKA 3SH3A 4BM8A 4CUBA 1LJ7A 5AFEA 3HJRA 2JG9C 1C5HA 2QQLA 2QDRA 2VW2A 3EHKA 3KLSA 4ZPIA 1GWLA 4JVAA 3S7IA 3VBUB 3VD3A 1OBNA 3OGGA 1DU3D 1PIV3 4AHYA 4B3NA 1W8HA 2XKOA 2Z2SB 1BYHA 4DMIA 2R30A 3ZXLA 5JSOA 4BQ4A 1ND2C 5BNQA 3MLLA 2WA3A 4AXOA 4E9KA 1XYOA 5GZDA 4ZXKA 1ND3C 1F4HA 5JOXA 3NV2A 4BQ5A 3UV9A 1E5HA 1S0BA 2A6WA 1C8M3 4WM7C 5K0UC 3IIAA 3TAYA 3KV9A 2LS6A 1H4HA 4R9DA 5GM0A 4ASMB 3K48A 2RDSA 4AVCA 4COYA 1R1A3 2RMU3 3NKGA 4GWMA 3M8LA 3UK9A 1VBA3 3J8F3 1AL21 3CIHA 5FZEA 3WDYA 4X8PA 3HMYA 3ZYIB 2GMPA 3POBA 2KD7A 1SPPA 4RR3B 1Q8SA 1DCSA 2CGPA 1NAEA 3LSDA 4P08A 1LRHA 1OOPC 1XNBA 2VCAA 1W0PA 2YU1A 4GH4C 4D94A 2TEPA 3Q8EA 2UWBA 2Q4SA 3K2OA 3VZLA 3N3HA 3OY8A 2HWB2 1TNRA 3ZFFA 2A73B 2JWPA 4RGKA 2QQOA 2VMIA 5K4LA 3JB4C 2GMEA 5J98B 4A6OA 3TEZA 2Q8EA 3C7FA 5C4WB 1O6UA 1OLQA 5EQUA 1K12A 3Q9OA 1W05A 3CDZB 4AVSA 1BXHA 1OD3A 1AR92 5A32A 3ORJA 5F39A 1KEXA 3AC0A 4CP0A 1AYN2 2K46A 5JZGB 3PUHA 2DF7A 3THTA 1W0NA 2D6OX 2X09A 2C4XA 1IKQA 3KGLA 5M0TA 4J25A 4AVTA 2W3JA 3WW2A 3O1SA 5EWSA 2WLQA 5F3EA 4B7KA 1W6PA 1NE4A 2HJIA 2WFF2 3MPPG 3ZYJB 1WA6X 3IBMA 4QXKA 4XJ8A 4YM0A 3J7NA 2OYZA 2RE9A 3VBFC 4WZFA 4KNCA 2YU2A 1QJY2 1S0GA 2GC1A 3BALA 5D8AA 4B29A 4FQZA 2Y6FA 3RFRA 3I3QA 4XACA 1N1VA 2Y6GA 2EXJA 2H6CA 2PFWA 2V72A 5F5QA 4DO0A 3A22A 2CYFA 1UZ0A 2WL1A 4XXAA 3VKFC 1R082 2QBXA 5FP4A 1TMF3 5A3OA 1UW8A 3HR9A 5BNPC 4Y1ZA 1OKOA 2AH2A 1UU5A 4F7ZA 1E5RA 1RUC3 3VDDC 3FLTA 2R072 4PLMA 4XBNA 1FMD2 3SXWA 4Q8KA 4AEDB 1Z7S3 3OB8A 1ZBA3 4DXTA 1ZRDA 4RFT0 1LODA 4YZ1A 2EALA 4BA6A 4HSLA 4Q27A 1GANA 3AL6A 1NOVA 4V2VA 4CU7A 2WFF1 3PIGA 2YROA 4BDVB 2WUHA 4M0HA 1VPHA 5IHRA 1QJY1 2PMWB 4B4RA 3PDQA 5FZ4A 1QJFA 2R042 4K3UA 5F9TA 5BYNA 2RV9A 4JQRA 4LTAA 3APBA 1JOPA 3TB0A 3FHIB 2V4VA 4KU7A 4QXHA 1R081 1H0BA 2N7GA 4XF3A 2CV6A 2GNDA 4EE2A 3ZDVA 1W28A 5FV3A 3RZLA 4DRVA 1YXWA 1WW5A 4CP1A 2ZGRA 3KM5A 2R071 4DRRA 1ZREA 2VULA 1YHFA 1FMD1 1LENA 2VOKA 5JZGC 4FXKB 2JKXA 1IG0A 5FP3A 5IW0A 4PIXA 4A41A 1UYPA 1TE1B 2XPJA 2WS92 1UOJA 3HIFA 4NPLA 5F6LB 2PHLA 1SLAA 2E6VA 1JYVA 2G19A 2VMCA 3TEYA 2FD8A 2QQJA 1Q8OA 2O1QA 4YW3A 3ZXGA 1G8WA 1FOD3 5IVYA 5FRAA 2DTYA 5IVFA 3RMYA 3O1OA 2XL9A 3VD7A 4M4RA 2BYVE 3BODA 3BOWA 4WVZA 3NNFA 2BTVC 4LE3A 1X7NA 1SPPB 2W1UA 4Y4YA 4YYOA 4G4FA 4JHZA 3WHTA 1UIJA 1AR62 5ANQA 1OF4A 1E5IA 4R52A 2EVXA 4GULA 1N47A 4QPIA 3ZYHA 2GH8A 3TEWA 1LULA 2BRTA 5KXCA 1WCKA 3VV1A 4N53C 1JZ3A 2PHWA 3E6BA 3C8XA 2VMDA 3ZFFB 3NJVA 3JBG3 3HBZA 2YBSA 3TN92 2JDMA 4FAHA 3PUQA 3AKRA 2I74A 5FY0A 4QAWA 1D2SA 4YW7A 4BPZA 3ACGA 1CAVA 1VJ2A 5A32B 1NXMA 3AKSA 4A7KA 2WS91 3AZVA 3KV5A 1NT0A 5L9RA 1LAJA 4E8CA 4GB32 5JAXA 4JC1A 3DF0A 1VBD2 1Y43B 1GLHA 3FUQA 4P9LA 1CX1A 3USSA 4CU8A 3ECQA 2AREA 2JJ6A 1XNKA 1ZA7A 3AP7A 3P6BA 4K1YA 1DGRA 5LEKA 1BHGA 2XBO3 4L99A 1BVP1 4XUQA 1W6PB 4BE3A 1JH5A 2IXLA 1QJEA 1CAWA 4NRMA 3ZM8A 2R7EB 3S6PA 2BZDA 4N43A 5D8AB 1QU0A 1W6NA 2A6VA 3MW2A 3ZXDA 4IV1C 5L7OC 4MGYE 4YG0A 5FZ8A 3GNEA 3J7HA 5EJ3A 3TN91 3VD5A 1DGLA 1RUF2 3VDAA 4YSFA 1N1YA 1XNCA 4TZDA 1SEFA 4AFAA 1C8NA 4YW5A 2ZGLA 1IS5A 3H1WA 5TSWA 3H1MA 1APNA 1QJU1 5IFPA 4FOYA 1W0OA 1DIWA 1ST8A 3WNOA 4CDQC 2J1UA 2C5DA 3BB6A 1VBD1 3FL7A 2EF6A 1OPOA 4CXYA 3OJBA 2VMFA 4QX7A 4O65A 1HRI2 2BJSA 1NQJA 1XRUA 3OOXA 1QNYA 5IAVA 1COV3 1SQ4A 4LA3A 1GWKA 3AB0A 3C3VA 4OMDA 5BNNA 1BEV2 4MV2A 2VTXJ 2WYFA 1JYCA 2P6HA 1A6CA 1AYM3 3C7EA 3I97A 3MW4A 2QZ2A 2CDOA 4GALA 1XPWA 1JZ7A 1NY72 2WNEA 1EP0A 2A70A 2P5BA 4FFGA 2BBVA 2HBTA 5CFDB 1RUF1 1R1A2 1RTVA 2G9GA 2ZMNA 1HXS2 2J1EA 2ZGQA 3G6JB 3SMHA 3A4UA 1UOGA 3N36A 1NCQA 3ON7A 4L0PA 3B94A 1UMIA 1YQCA 3PJYA 1AR83 1SLBA 2QQNA 1CD3G 1GP6A 3RNSA 3CL1A 5BXXA 2HBUA 1UIKA 1DGWA 3OYWA 3LKJA 5FY8A 3TOJA 1FAYA 1NE6A 3CJIA 3OD4A 3IKWA 1IOAA 3AJYA 3ZKYA 4FVVA 1HRI1 4Q4W3 3BI3A 2R062 2WWUA 1PIV1 5F6KA 4CEWC 2ZX3A 1BEV1 2BNMA 1J3PA 1LEDA 1G9FA 1OSGA 1QOTA 1PGL2 2VR4A 1KRIA 2A6XA 4K7JA 1LGNA 1QF3A 2YBKA 3CHXA 2VUCA 2ZEXA 1WBFA 1C8M1 3WLUA 3CZUA 3MGUA 1PZ8A 3T2TA 4P00B 3DPRB 2RS12 1AL0G 2VH9A 3BOPA 3MIEA 5AVAA 4QPIB 5IVVA 1R1A1 1M4WA 4LUMA 1NLRA 1QXJA 2QQPA 2ZHLA 1GZWB 3WR0A 1VE0A 3GXUA 4CDUA 3J4UH 3QBQA 4GAZA 4WVMA 3T0AA 2Y6JA 2VTFA 4ARXA 4EV0A 5KXEA 2ADDA 4IEXA 4YVSC 1U5YA 3NW4A 2IFWA 1V0AA 3DN7A 1YFXA 4HK9A 2XH6A 4WM8A 4YNIA 1ZX5A 5FYUA 1ENSA 5LZ6A 1GV9A 1QJX2 5GLZA 1CAVB 1F31A 2E26A 2XUEA 2ZXQA 3K77A 1GU3A 3U4XA 4TXWA 2WZEA 5DAXA 4LIUA 2WO7A 3KVAA 2Q8OA 1X8EA 1W8NA 1W8OA 4K8RB 1NUKA 1UY2A 2D40A 2MNGA 3Q8CA 1IGOA 2VOVA 3AZWA 1V6KA 1ZA4A 2ZZQA 1NYWA 1OA3A 3IAPA 3POGA 1NCRB 3LAGA 2NP0A 3VZMA 4CXXA 4YZ3A 5C70A 1YI7A 1UU4A 1WW7A 4TTGA 1C3HA 2YYOA 3LE0A 2R32A 4LBQD 1CJPA 5CFDC 4ZS3A 3ZSJA 2K0GA 1JS9A 4LO7A 4C1XA 2XWBB 4IXLA 1CAWB 1Z7S2 4AF9A 3S57A 2W68A 3DXTA 4XTPA 2YFUA 1V6MA 3A7QA 3NO8A 3LIGA 4N43B 1T2XA 4W8JA 4AI3A 4OHYA 2BEOA 4OCTA 2D43A 3HPNA 3N9NA 3OBTA 4QGLA 1GP4A 2R1DA 4BIFA 1OF3A 2OIIA 4NVPA 3AZYA 4XF4A 2RDQA 1QJX1 3LFIA 1UZYA 4O9GA 4OLLA 2WBKA 2VGDA 1LGBA 4ZY9A 4D7YA 4N8MA 3LA7A 2XLFA 3RRDA 2IC1A 1BQPA 3WDTA 1W9YA 2VQTA 3OG2A 4KWUA 3T0DA 1H2MA 5A3MA 2DU0A 1PVXA 1GZTA 2JDAA 1G9CA 2ZGNA 5BNNB 1REEA 5FREA 3BU0A 2ES3A 3RZJA 4OYUA 5A6QA 1OMIA 2Q1MA 3DPRC 5FBZA 5FZMA 2YXSA 1W8FA 3K4DA 4IERA 1Z7S1 4KBBA 1LOFC 5CADA 1VBB2 3RZKA 5LA0A 4QB1A 1UYZA 2O14A 3D6EA 4CSWA 4V1PA 2BOJA 4YW4A 4RHV2 2Y8KA 2AUYA 3V64A 3OPZA 1RINA 3ILRA 3OBZA 2DURA 3RVHA 1NLQA 4AEMA 5JDBA 1QH6A 1RUNA 1ULEA 1F15A 2ZGSA 3AJZA 1KQRA 2W1SA 1H8VA 2WFPA 3LOIA 5T5OA 5FK8A 1UWWA 1JW6A 2I2SA 5LA1A 3BU7A 3GGLA 4AOCA 5G04L 4AEJA 4Y24A 5HXMA 2VZTA 3IN9A 1H1IA 3DCQA 2C26A 3O1TA 3S0MA 5CKMA 1ODMA 3O0XA 2GMMA 4M00A 1NCRC 3WSOA 5C3OA 5CKNA 2O8OA 1AXKA 1N3QA 2EIEA 5FUPA 4LKSA 2GAUA 2DV9A 1X8MA 3IWZA 5LA2A 1DBNA 3B93A 3MIHA 3T09A 4ISRA 3U0ZA 2ZGOA 1B35A 3AKQA 3GM8A 1VBB1 3WINE 4EN0A 4FPHA 5HCAA 3BGAA 4IETA 4IE0A 4LK7A 5A3WA 5A7PA 2X5IC 4MXWA 5GKAC 4CE8A 2VOWA 4LBNA 4RHV1 4COZA 3ZYGA 4L2NA 4XCBA 1Z78A 1FOD1 1LHOA 4BXFA 4CEYA 4BCUA 2VL4A 4C0HA 2DUOA 5FZGA 2DUQA 4WVMB 2O0OA 3I2IA 2PHFA 4HANA 2BPA2 3K3OA 4NRPA 2VBBA 3WQ1A 1OH4A 4ZU7A 4Q4V3 4WM8B 4QX8A 4UFIA 1F5FA 2DDUA 4NRQA 1ZNPA 4UI9L 4XPVA 3H3ZA 2ERFA 1Y3TA 1MQTC 2QCSB 5IAXA 3JBG1 3OEAA 2HWD2 4LBQA 3E5QA 4Q1RA 4JX0A 4DUVA 4TWTA 4MXVA 1LHWA 4XAAA 5CZKA 3VGIA 2HWC3 2UYAA 1WW4A 5SV8A 2DBIA 4YRDA 5I93A 4AAXA 2QZ3A 4CPBD 1ZRFA 2VVFA 1OA2A 2HWB3 1FNYA 4DNYA 4LHNA 5LRSA 3FZ3A 3WF3A 3T2PA 1YFWA 5JXHA 3LEKA 4TYSA 1GOFA 4E2SA 1G9BA 3AP5A 4K40A 3ZSMA 3CEWA 1AR93 2AR6A 2RHPA 1W3VA 4FQ4A 2VVEA 2LRPA 1QWRA 3I2JA 4MOAA 2A1XA 4TSVA 5E6HA 5F5IA 3X29B 1AYN3 1YJLA 1S0CA 4Z92B 1DQ6A 5A7NA 2GZWA 5EXOA 4INDA 2YFZA 2E32A 2WINB 1PMHX 5LASA 3AYCA 4QWNA 5FYIA 1S2BA 1WWYA 2IFRA 3I3BA 5APAA 3ZMOA 5J36A 2HWD1 4LK6A 4Q5OA 4NOTA 5E8AA 1H8TA 3E6DA 4GWIA 5JI9A 4FTSA 2WFF3 2EAAA 2VXRA 5GALA 2UY8A 1PX4A 3I7DA 1XB9A 1AR82 3HNYM 4ISQA 4V2WA 1X9TA 3U10A 4DOUA 1QJY3 1RYYA 1HJGA 1JUHA 2HEVF 4A2UA 1EAH2 4DEQA 3HN3A 5DZFA 4MVTA 2BWCA 4R4ZA 2YB7A 1O5LA 1REFA 1R092 4TLGA 3UGHA 1WW6A 1R083 3AK0A 3KV4A 3THPA 2JDYA 4IV3C 2ZGKA 1HB3A 3VHNA 4FPFA 2RS52 2P3JA 3JCIA 1UPIA 1AYM1 2B9UA 1DZQA 3BTYA 5DZEA 2R073 1JZ2A 1FMD3 3ZX7A 2GU9A 4IEQA 1UX7A 3VBSA 2E7QA 3LSEA 2P4EA 5I8YA 5FZ7A 1J83A 1GP5A 5DMYA 5F3IA 1DLCA 2HWE2 1PMIA 2BUKA 4YW6A 4U36A 5LWBA 1AJOA 4XMAA 4XZPA 1AR81 2RJKA 4RFRB 2EXKA 1V6LA 4H3WA 5FAXA 4L97A 1W6QA 5J48A 5JPMB 4H14A 3SITA 2R043 1EAH1 1HV0A 1WLWA 2B42B 2JDKA 3ES1A 2ZACA 1B35B 2XXZA 3HQXA 2EA7A 5KXDA 2MHFA 1QY4A 3OUJA 4CDWC 2Y33A 5D2AA 1Q8VA 3CO2A 4MXWB 1PK6C 4BHPA 2ZX2A 4XURA 4XCAA 4CTEA 5E16A 2XGXA 4HKLA 4CEYB 5HPOA 1TEIA 2WZPP 3URFA 4BK4A 3WP6A 5FZ0A 5FZDA 1CIYA 2BNNA 2W5FA 2LM3A 1AHSA 5DN2A 3ST7A 3UKNA 2RM22 3VL9A 2P37A 2VG9A 2HWE1 1U5XA 2C9AA 4AE2A 1DYPA 1IZ3A 1NX9A 5A33B 4OQ9A 4W6YA 1NLSA 2AEYA 4CPBA 5L19A 3MPBA 2DFCA 1Q3EA 4GJYA 4LBQB 5I0RA 1JZ4A 1BMV2 2JD9A 3M3CA 5E1RA 1AR63 1UY4A 3JUUA 4QPGB 3N9OA 4E27A 2ARBA 4ZU4A 2WKKA 5GLUA 3KCXA 3GZUC 1VBC2 3HOBA 4XUPA 2YV8A 3A0KA 1IS3A 1RL3A 1OD5A 3GHNA 5CYYA 5FUIA 2OW4A 5FYZA 3MEPA 3ZLIA 3ALQA 3TN93 4C91A 2WNUC 3BVCA 1HLCA 3USUA 1CZTA 4JGZA 2WNVA 4UBGA 3U14A 1YQ2A 3LZZA 4BK5A 3WDWA 5JMOA 2JDZA 4YVWA 2RM21 3CF6E 4H55A 2VZ3A 4CP9A 4DXZA 4GB33 3EYPA 3FWEA 5C8CA 1VBD3 4K21A 1MEC2 4AGGA 1UZZA 3WHUA 3LOBA 2W47A 4QXCA 3RI8A 2YUEA 4UFMA 2VO5A 3N35A 3I2DA 3VKMA 2F17A 2FCUA 4I09A 4QDRA 1AXZA 1BMV1 3HD8B 1H8TB 2BW8A 1NZIA 4CU9A 4MGIE 5DAPA 4AI9A 4U2AA 2BFUL 1W90A 1ENRA 1OLRA 4GWJA 4YZ4A 5KR7A 3WUDA 1YFUA 3RWKX 4AFDA 5A3UA 5KHHA 3AMHA 3RSJA 3QH7A 2B9VA 2RDRA 1F8VA 1OXCA 1JHJA 1RUF3 1SMVA 1NA1A 3N7LA 3B00A 4AVBA 2ZAAA 3W5NA 4XDPA 1CVNA 3LA3A 2NMNA 4OUSA 3GHMA 4OI1A 1W06A 2WR9A 4PF1A 1QXPA 2NPIA 1PHMA 1Q56A 4AGRA 1MEC1 4XILA 5E89A 3WF1A 3ZFEC 4QM8A 5J37A 1HRI3 2Y64A 4DS0A 1QDCA 5FZ1A 5FMDA 1JI6A 3CU7A 4META 1XNTA 4FPYA 5FY7A 4E4DX 1DGRN 3N4MA 1JYIA 5CFCA 4COVA 1H6YA 3AL5A 1AX2A 4O9EA 1BEV3 3K4ZA 3PNAA 5FYYA 4JGYA 5H9RA 3NMBA 2I07B 4QPGC 4QDSA 2C1FA 2PELA 3O1RA 3THDA 4XJUA 1H6XA 1W6QB 1VR3A 2Z4FA 3CKHA 1LKNA 3MIDA 5IVCA 4SBVA 5I0DA 5EP9A 4Q4V2 3RZMA 1NQDA 2ZCWA 2WWSA 2VW1A 5FYSA 3NNMA 4KGGA 2EICA 2UURA 5B4XA 2XVKA 4LBJA 3KT1A 1DYKA 5FYVA 1HXS3 3UNPA 2IZWA 2ZABA 4A4AA 5IUQA 5LRRA 2GP3A 1SFPA 3HNBM 3NV1A 3PUIA 5JIAA 5L9BA 2P34A 1IHMA 1U5ZA 2VZSA 4UFLA 4IEUA 1CPMA 3I54A 4OI4A 2PYTA 2HWC2 2OZ6A 3L9JT 1VIWB 3E5UA 4UAPA 2R063 4F83A 2VCCA 1PGSA 4NPMA 4OMCA 3GJAA 3SLIA 5CA6A 5F5AA 2A3YA 2OZJA 2XVLA 3NNLA 3BTAA 4IEVA 2DBNA 4IE4A 3AFGA 1H2LA 4C1WA 2YHJA 3VD4A 3K4AA 2Z79A 1LESA 3D3AA 3ELNA 1HB2A 4Q4V1 1J58A 3WW4A 2GNBA 1J59A 2RS13 4XFHA 4HSJA 3MF6A 5C9AA 1GQHA 1RUJ2 1MS9A 1SHWB 1ZBE2 1SLCA 1UD1A 4CDXC 5ABJC 2W91A 4NWWA 3SH4A 1NXD1 1JYTA 2Q8CA 3IT8A 3VZJA 1PVC2 2ZTNA 3LEGA 2YY1A 2SBAA 2GH2A 3VBOA 1JU3A 1EV12 2HWC1 3WXPA 4JGZB 2WNVB 4AQTA 1DFQA 2W2IA 1QJX3 3EBRA 3PU8A 3L2YA 2QJVA 4NHXA 4Q1PA 4GMP0 3VBUC 2ZEYA 4XF9A 2BP6A 2R1BA 3UJQA 1BBT2 2H0BA 4YVWB 4UW4A 2WO1A 1YWKA 2HWB1 3MF9A 5T5JA 4UF0A 3W9AA 2WIIB 3HT2A 4YLZA 5C8CB 1D2QA 5KHJA 2FDJA 4RQPA 3JU9A 3SKVA 4CXWA 4YGDA 1IPSA 4XQDA 3FBYA 2A3WA 1LEMA 1LHUA 1OC1A 1U0AA 5EFUA 5CAZA 1AR91 4KG0A 4M01A 2NZ9A 1UMZA 3PUSA 4A3ZA 1AYN1 1H4GA 2FDIA 1JN2P 1AF9A 2P1BA 2IVJA 1QH7A 3ZSEA 1RUJ1 2ZKNA 1ZBE1 1XE0A 3NWKA 4HL0A 3ZVXA 1YFYA 3WD5A 2PAMA 3MIFA 1MZ6A 3M70A 1PVC1 5FO7B 4CUAA 5KBFA 2W39A 3PVBB 2Q0AA 4LO6B 4RR3C 5FZ6A 1NA1B 5JXIA 4JDOA 5C5TA 4SLIA 3WNLA 1O8PA 2OPWA 4ATEA 2D6MA 4ZZ8A 2JE7A 3AKPA 3T2OA 5ISLA 4AI0A 1FV2A 4IUGA 5GLWA 4KGQA 2PHUA 1RUH2 1F9KA 5FMCA 4QB2A 2GP5A 2KXLA 1KITA 2ET7A 1GUIA 3RJRA 5FO8B 2DVBA 2X8KA 4N7IA 1CIWA 5C3SA 3L2HA 5CFCB 1UX6A 1DYOA 3PLQA 4JGYB 4XDQA 1MACA 3DYMA 4NIGA 4XBLA 2RJLA 4HN0A 3UKVA 5I0TA 2OUJA 4OUMA 1YRZA 3MLKA 3LPGA 4HVOA 4WVVA 1VBB3 4DEVA 3AM2A 2W94A 3WV6A 3WG3A 3MFCA 1UYYA 5IATA 1XYPA 2UWAA 4RHV3 5DUWA 2OS2A 2VXJA 4EN8B 4JQTA 2ZHNA 1YC61 3P3PA 5FP7A 3UKTA 4DFSA 3SKJE 1O4ZA 1SBFA 4URTA 1L3JA 4PCRA 5C7GA 3VDBA 1LOEA 1KFUL 1X33A 3PJQA 4RS5A 5LY2A 3W20A 4QQLA 4EZ4A 2R041 5IYYA 4Y3OA 3QOPA 1YUDA 3AYEA 2JEMA 3OPWA 3FX3A 4LR4A 4IL7A 5GZCA 1ZRRA 2FDFA 5DAQA 4CUGA 1FPN2 3OY8B 3NJZA 3LQCA 3SCHA 4XYXA 2XQRA 2CNAA 4YARA 3FUOA 4PI2A 3OUHA 1GOGA 1XNDA 1HIXA 2ZX0A 5DZGA 4LXLA 5FY5A 2J1SA 2D5HA 3D0SA 5DUUA 3I2KA 3BPSA 1SACA 4QB6A 5FPZA 4OQ8A 4KH9A 4AEDC 3DECA 3HT1A 4IGQA 3E97A 5F3GA 2GC0A 5FPBA 4ES9A 3POEA 5LATA 1NKGA 5C9AB 4JAAA 3WF0A 2VE1A 3WW3A 3ES4A 5IT6A 4YM1A 3TBDA 3M7AA 1PNGA 1POV0 5FKBA 1OT5A 2J7MA 1VALA 3QACA 3VD9A 3AP6A 3SEEA 4NAOA 4Q4Y2 1A78A 4D3WA 3T3YA 1PO22 1AR61 2CAVA 1HQWA 1GWMA 1O91A 1RIRA 1GNZA 4XFCA 3VBOB 4CCMA 3PUAA 3ZXAC 1I1EA 5G05L 3C7HA 4XC9A 3FFZA 5EJZB 2FMYA 2E7TA 2ID4A 2ATFA 1S0IA 2JG8A 2VUJA 3FHQA 4UF0B 2YPDA 3ZYPA 4CU6A 4RQPB 1RJ8A 2HWD3 4B7EA 2ZGTA 3ACLA 4I01A 5T54A 3KMHA 3MYXA 2Y6HA 3OD0A 4FBFA 2B46X 3GYDA 4RGGA 4XFFA 1UY3A 4QQ2A 1RUE2 1SBEA 2WT1A 4WVWA 4GB31 1XE8A 2C0ZA 3ZFGA 3LWCA 1XOYA 1KD7A 3RYPA 3IMMA 1Y9GA 3FE5A 2ILMA 1OURA 3V65A 4PIYA 1J3RA 3K46A 1JYNA 1IS4A 4M4PA 4F8AA 1VAKA 5J7MA 4Q4Y1 3WG2A 4UFKA 1BVVA 2VJXA 5C5UA 4FI9A 4DIQA 2XONA 4HKWA 3WG1A 4ONUA 2FZ2A 2GSYA 2A5ZA 3FFQA 1OQ1A 3KD4A 2BBAA 3LEIA 4XZUG 5FPLA 3SISA 1ASJ2 2JICA 5FPAA 3V56A 4AFBA 4Q0QA 3ZFFC 4EQVA 2JB8A 4GKXA 5T3NA 4LEJA 1LTEA 3PTRB 1S1AA 1Q8PA 3ZYRA 1O3RA 1G6NA 3TRSB 1JODA 4ORFA 3UGFA 4KWLA 2B5HA 4ZS2A 1TNFA 4I0BA 2RS32 2JDHA 2D7FA 1HB4A 4NIIA 4S2HA 3BIWE 4M0NA 3VB9A 1EAH3 2CTVA 5JSPA 2J1RA 4TLFA 3E5XA 3WP5A 1S55A 3H3UA 4QPWA 1JZ5A 1SCRA 4QX5A 3Q8FA 1R093 3P1IA 2QTWB 4DZGA 1C1FA 2LW8A 2AZ5A 3LDKA 1STMA 5JR2A 2RS53 5FZHA 3N9MA 2JX9A 5LA9A 4P14A 1NY71 1ZRIA 3ZPYA 4CCDA 5FOBB 1QJZA 1ASJ1 5ACA2 4RS5B 5KWRA 1I5ZA 5D8AC 5T52A 1P8JA 2OVUA 4DPNA 1WA4A 3BUCA 4Q0SA 4P9YA 1JHNA 2HWE3 1HXS1 2WYSA 4IE6A 2J42A 1ALYA 1HV1A 3ATGA 1HKDA 3LEMA 5FJKA 3VBHA 3VN4A 1XE7A 4HN1A 4CA9A 2XJVA 2PXJA 5F3CA 3O7OA 4BOWA 2RS31 1K42A 3MBWA 4QX2A 4OHVA 4FOVA 1UXXX 1S0EA 1VMHA 2AENA 4BU2A 4DY3A 2A71A 2R061 2C6SA 4A6SA 4AI1A 1SFNA 1CZSA 5D21A 3AP9A 4QX3A 2HEWF 4A7ZA 1W2OA 2G9FA 3ZR5A 5FXXA 4Y5Z0 2BVBA 4AHWA 5FUNA 3R0RA 5JR7B 2Y6LA 3DXUA 4XF0A 5IFTA 4UW6A 1PGL1 2BV4A 1G86A 2VY0A 1X82A 2ZEZA 3KT7A 5FJHA 2XB6C 2DVDA 2A6ZA 5C4WA 4IQPA 1RJ7A 1RHI2 2VZUA 2LTNA 4P5YA 3WVJA 2VZOA 5FZBA 5ACA1 2QUOA 1XQNA 2W1QA 3N7KA 4J6GA 4AQSA 2RS11 1HRV2 1KDMA 2RM23 3J7LA 4L9BA 1RITA 4PI0A 3GDBA 2WLPA 4JRAA 3WNMA 3N7JA 4R4XA 1C4RA 4XUOA 2KM2A 3H8RA 5JSRA 4BISA 3OSDA 4NHLA 4XJ9A 1W6NB 1QQP2 3LA2A 3NAPA 3RPQA 3VBRA 4XJZA 1WKYA 3R4UA 4NHKA 1CAUA 4UBHA 4PDWA 4Y1XA 3W58A 3RZHA 1TME2 4GWNA 1AR72 2FDGA 4LO4B 1VBC3 4PHZA 3F2ZA 3DGTA 3I2GA 3PVOA 4P02B 2XLAA 3J9SA 4IEYA 3ZFGB 3W5MA 1WLTA 4XJWA 3HWJA 3DKQA 4LIVA 4M3CF 4ARYA 2D98A 4LLFA 2EIGA 2XJUA 4Z8BA 2QQMA 4PQ9A 1CQ9A 1YQ5A 3WDXA 4NROA 4PLNA 3PTYA 2LROA 1FT9A 3MFAA 2ZMLA 4CCJA 5K9YA 3K3NA 1HRV1 5FLIA 4URAA 1V70A 4QPIC 1UN1A 1MEC3 3T1LA 2P6CA 3BN6A 3I49A 2K9ZA 2WZR2 1KFXL 2HYKA 1D7PM 5F2SA 3F95A 3N9QA 1UO9A 4XQ4A 4BZ4A 3WDUA 1NCQB 1TME1 3LB9A 3C7OA 1AR71 3AYDA 5HCHA 1SLTA 2ZAHA 3BIEA 2W0XA 1SLLA 2WAAA 3OYWB 2ZMKA 3C2UA 5DXDA 1GQPA 4Z82A 3CJIB 4CRQA 4XIOA 4MYEA 1W6MA 2EIDA 1POV3 2B8MA 2J1TA 4XOGA 1L7RA 4I0WB 1A8DA 4I2OA 3J7MA 2ARXA 4YW1A 2BQPA 3B02A 1K5MA 3ZYBA 3IDCB 2JXAA 1J84A 3MV11 4XW3A 4Y22A 1V00A 3NQHA 1FX5A 2FQPA 2JIJA 2JKBA 5KXBA 4DB5A 1EPWA 3AXDA 3GBFA 4MX3A 1AXYA 4QPYA 2WZR1 4N43C 4CCEA 5B2GB 1REDA 1RUI2 3GCWA 4IGOA 4LA2A 5A70A 4YW2A 3H7YA 3LCPA 2A6YA 2EXHA 3RZGA 2QVSB 3KS7A 4FPOB 4LJHA 4CDUB 3ASIA 3VBHB 4I30A 1GOHA 4W4ZA 2ZA9A 1QEXA 4E2GA 4B4QA 2ZX1A 5DUXA 2EIBA 2HH9A 5L73A 1KGYA 1V9U2 3KGZA 3ZN6A 1LCLA 2PHXA 3I59A 4FPEA 2RDNA 3RDIA 4HFSA 4L92A 3T08A 3WZ1A 2ORXA 1UL9A 1Y9QA 3RG0A 3RI9A 4NJ4A 3WP3A 3AXEA 4BQ3A 1N3PA 1GNYA 5BNNC 1JZ8A 2AGSA 5AFBA 1TQ5A 1UAIA 1TVGA 2LALA 3D5OA 4KWJA 5GZGA 1SZBA 3S5AA 5FYCA 4FPJA 3OPTA 4N7UA 4LHLA 4QKBA 5KC6A 1GR3A 3P5BA 1IPKA 2Y26A 2KA3A 3GZAA 2PLV3 4N90A 4NHMA 3D4KA 3ROUA 2DTWA 5A1LA 2D6NA 1OFNA 5AC92 1WLCA 1HN0A 1ZM1A 5A6ZA 1UOBA 3WCSA 1YYNA 3AVSA 4RGAA 1LR5A 4NIDA 3VZOA 2JIGA 5JI7A 1QKQA 1ZZ8A 2VZPA 2R0HA 2JG9A 1CPNA 3ZIWA 1NCQC 3CNAA 1CGPA 1K45A 3NAPB 1V9U1 5LBFA 4EWDA 3WX5A 1ND2A 3VBRB 1BKZA 3QH6A 3DKWA 3UJOA 4AL9A 3CJIC 1CAUB 1A8MA 1SDDB 2D6LX 3PU3A 4PDWB 1KXGA 1XU2A 1H1AA 5DABA 1ND3A 1W6OA 4MGKE 4QU1A 1RUJ3 1KDKA 1W03A 1ZBE3 3T1MA 1XBFA 4JDMA 3O1VA 1YLLA 4HVQA 5K0UA 4WM7A 4JKMA 1A34A 4R8HA 5A6XA 1ULOA 2BFUS 3WF2A 1PVC3 5FK7A 1XNAA 4YZ2A 1POQA 3NRUA 1B09A 1EV13 4ZZ5A 2ZS6B 5AC91 3CMGA 4UW5A 1XSQA 3U37A 3V0BA 1BBT3 5FYMA 4N9HA 4FXGB 3GZEA 3HNMA 3RJ2X 4CYDA 1YQ8A 5J3UA 1MS1A 3B01A 2VQ0A 4TN7A 2ZZJA 2A7AA 1OOPA 4GH4A 3OGRA 4FPCA 3THCA 4RN5A 4GKYA 3WW1A 2VMHA 4CDUC 5B4NA 1RUD2 5F7UA 3M3IA 3DL3A 3ZSLA 2R16A 3AMMA 4HPKA 5FZ9A 4AQ2A 5A1AA 3R05A 1VAMA 1AVBA 3U11A 4WM8C 2QNKA 5BY5A 1GMMA 3OBAA 4HOOA 4H7MA 2PHTA 3VL8A 1WMDA 2VUDA 5J1XA 3BTZA 3VZNA 1DQ2A 3SQOA 4FOWA 2VAUA 1US3A 3V0AA 3FHAA 3B3QE 4M3CA 1DGWX 1ZZCA 1D0HA 3H42B 2ZKLA 4YWAA 5IVJA 4QU2A 3I2HA 2V5DA 1LB2A 1BK0A 1RVF2 2GNTA 4I3PA 3ZDSA 4YGBA 1K5MB 4GIQA 1UZWA 4J1XA 5HCFA 4A42A 1WD3A 2ZJCA 4Y22B 4A7YA 4QKNA 1WMEA 2IWGB 1RUH3 4QX1A 1PM4A 2HLEA 4JKKA 4UFHA 3NKTA 3VBFA 4D6SA 3BCWA 2W46A 3GJBA 4J1WA 1R091 1RUD1 2NYYA 2P3KA 1JOJA 2MEV2 4UWDA 5DUVA 4EWAA 1S4CA 1Y7BA 2RS51 4PBOA 4HVRA 2JENA 5SV5A 2HKXA 3JZVA 4GMP1 4JTOA 1G7YA 1Q5OA 4MH0E 4Y1YA 5A7WA 4XXPA 1IS6A 4Z1VA 2OKXA 3VLBB 2CDPA 3ACFA 3I4IA 4D0QA 4IE5A 1EPZA 3ZN6B 5FR3A 1DQ4A 1CZVA 3I59B 2YC4A 4M3CE 5BNPA 1YIFA 4UT5A 5CVRA 2JB4A 3VDDA 2OPKA 2OQ6A 4PQQA 1S0DA 4LQRA 2G1MA 1JBCA 2UWCA 4OI0A 4CCNA 2XJRA 4RD7A 3AVRA 1NZCA 2AYHA 3SCFA 4FSJA 2XVGA 2W52A 2L9LA 5T5LA 5A3LA 1WGPA 2OA2A 5GLVA 1VBE2 3HN1A 2QQVA 1K5JA 2ADEA 3UT0A 4OVEA 3U07A 3WOGA 4PLOA 5IVBA 1FPN3 2MEV1 1SFYA 4Q4X2 1YQ6A 1DQ0A 1UYXA 5J09A 3K51A 4W50A 4BLJA 2JG9B 5DDJ2 5CISA 1PZ7A 1N1TA 4Y1VA 1QXRA 3LDRA 4YFZA 3AMQA 3H8UA 4Y1UA 2Y0IA 3AP4A 3FN9A 5FIXA 1PO12 3MICA 4B1MA 1H1MA 2R6QA 1KS4A 3VKLA 3ILNA 4XTMA 3N7MA 5C33A 5JZGA 1ND3B 1W6OB 2CWSA 3KF5A 3SNMA 3MO4A 4BB3A 4WM7B 5K0UB 1O3QA 2ZEWA 3JQXA 4KG8A 4KU8A 3ENRA 4Q4Y3 5CG9A 3ABZA 1BCXA 2RVAA 5EZWA 4XJAA 1PO23 3M2MA 2YDEA 4MG2A 1VBE1 1IG3A 3ETQA 4GD4A 1QGLA 4LLOA 1B35C 1VBC1 1MS4A 4GA9A 3OBRA 2IXKA 4NAMA 3V0BB 2VCMA 4LITA 5FP9A 4Q4X1 4CCKA 2FHRA 5DQ0A 5DDJ1 1DZRA 5H9PA 4CEYC 3N9PA 2G9ZA 1H9WA 4GH4B 4D8MA 5IK8A 1O5UA 3JXSA 5F1RA 2ENRA 4E2QA 4N53A 4XF1A 1K3IA 1PO11 4QX0A 1H2KA 1W2AX 2QQWA 2XR4A 2AEZA 3D82A 4ZXEA 1RUE3 2XJQA 1DG6A 1XYNA 2GC2A 3POFA 1CR7A 4HMZA 1ZVFA 4LBMA 4C8DA 2GDFA 5JWPA 4QQPA 1ENXA 4XFAA 1OLMA 1DQ5A 2VZ1A 4YM2A 5HV4A 4QKFA 5FXVA 3VBSB 1DZTA 1SCSA 3V0AB 2J1VA 4CCCA 3ZN5A 1RUOA 1ULGA 5FY1A 3TYJA 4MGZE 2YPJA 5FYTA 1JXNA 2JD4A 3ZN4A 2WSUA 3TNPB 4JCKA 1VRH2 5FZLA 2XWJB 1ASJ3 2DCJA 2FMDA 2I45A 3T30A 2CL2A 4BQXA 5C71A 1POV1 5FMOL 1CAXA 3KQ4B 2B7YA 1UZVA 4UOJA 3IDEA 3VBFB 3W21A 4KL1A 4LBKA 5BNOA 5L7OA 5A7OA 4IV1A 5I0UA 1HB1A 4COUA 2RS33 4ZONA 5H9SA 5A7WB 1C57A 3GCXA 2QDNA 1OLME 2PLV2 3NL1A 2VVDA 5FYHA 4Y5TA 2X29A 3CBNA 4R9AA 2OQ7A 5BNPB 2RJ2A 5FWJA 4CDQA 1QIQA 2EAKA 1S2EA 3ZKUA 3VDDB 2DVAA 2BDRA 1H8TC 3O12A 4XETA 1LNSA 2CU5A 4MGSA 5JLVA 4EJRA 1J3QA 2AC1A 3A23A 1FNZA 3POYA 5JVVA 3I3MA 4MSVA 1FI2A 1VRH1 1O8SA 2VNVA 3LFMA 4RSUA 3H0OA 2D44A 3CQOA 3POSA 5ACA3 2G4IA 2QQIA 4A45A 3ZSKA 3WT3A 2B4KA 1V6NA 3H8XA 2BVVA 2W95A 5K7PA 3QD6A 4MO3M 1RMU2 4RL7A 4AFCA 1UU6A 5JCTA 2GALA 3WF4A 3KSCA 5GZFA 3MUZ1 5F8PA 2PQSA 1RUG2 3MI8A 2XUMA 2D3SA 1PX3A 1UKGA 2VBPA 1HQNA 2PLV1 3USUB 1PZ9A 4MHUA 4XUTA 2JDPA 3I3DA 1KJRA 3LD8A 3VBSC 4AYUA 1G9DA 1SG3A 4FAGA 5A3NA 3VHRA 1IQDC 2FBEA 4CP9B 5IK4A 4QGNA 3MV01 3I8TA 4QQHA 1DHKB 4JKLA 4YM3A 1RGSA 3IPVA 4NMIA 3POIA 4D6QA 1X36A 3E6CC 5A7SA 2JDUA 1RHI3 4Y26A 4Q0VA 4CEWA 3UETA 5C3RA 1ZRCA 1CWPA 1X9PA 4HLTA 1HRV3 1O59A 1TG7A 3T4HB 3IDAA 4A44A 5FO9B 1YNAA 4QKDA 1H2NA 1RMU1 4KI5M 4FFFA 2ZGMA 3FJSA 2PTMA 1WLDA 2XG3A 4D6RA 4XFGA 5LY1A 3BTXA 1QQP3 3NNGA 1RUG1 4FPGA 2IVIB 3VHOA 5IJRA 4AI2A 3NJXA 2OT7A 1EV11 1OA4A 2YMZA 4H2AA 4QQOA 3KQRA 2DCYA 1I3HA 4NPRA 4N53B 2JDNA 2Q1ZB 1TME3 2VM9A 1AR73 2BU9A 3MIBA 5FCCA 1BBT1 2GN3A 4YVSA 1PM7A 1VMJA 1RXFA 3ZYFA 4XFBA 1WD4A 2Y38A 1UCXA 5K8SA 2WABA 5DAWA 5ERLA 1FXZA 4YG6A 2CWMA 4OZXA 3KCYA 4AQ6A 2NN8A 4LBOA 4NHYA 4W6WA 4EROA 5H9QA 3RQ0A 2VW0A 5FY4A 4E8DA 1S0FA 5A7QA 1ZZ7A 3M3OA 4UXAA 4WV8A 1ULFA 3B9IA 4AEKA 2XLGA 4OHWA 1X50A 3HAGA 4BIOA 4EN7B 3GALA 2JE9A 2W08A 5F5CA 4BYYA 3HVDA 1W9SA 3KT4A 4Q2FA 5DG1A 3AYAA 3O14A 2VECA 2XL7A 4S2FA 4ASKA 1OQDA 4CP2A 4K8FA 5EV7A 2JE8A 3ZXKA 4Y4RA 3RWNA 5J96B 2WZR3 2DCKA 3IIIA 2P3YA 1EYBA 1GFF2 1S0JA 3ME2A 4LOTA 5CFDA 1CAXB 1QOSA 2VQUA 4AK3A 4FTBA 1MS3A 1OUXA 2VZVA 3EO6A 5LBEA 4OZOA 1GKBA 1GYKA 4NN0A 3FC0A 1WCSA 1O4TA 2WNVC 2XHKA 3FMGA 4JGZC 4PIZA 4QT6A 4Q0UA 3OGSA 5BPXA 1DF0A 5BNOB 4IV1B 5L7OB 1M06G 4YVWC 2E9QA 2UY9A 3O1UA 2OX0A 1VB2A 1UMHA 4OFGA 2FZ1A 5C8CC 1RUH1 2GNMA 4N9IA 4L11A 1MS5A 2O8QA 4S2GA 2J1AA 4AG4A 4E4SA 2WJSA 4BQ2A 4CDQB
chains in the Genus database with same CATH topology
3M3QA 2XJTA 4WBBA 2VU9A 1IKPA 1LOAA 1MVEA 3IDBB 2HWF3 3IM0A 4Z2WA 5T5PA 4AFMA 2H0VA 2PAEA 3AMNA 5KC5A 5FOJB 1JTZX 1QMJA 1RUI3 3DPRA 3O5SA 3M3EA 1N3OA 4YFWA 1G9AA 1NA1C 3PMSA 1LOFA 1QNWA 1GZWA 3PHMA 4PJYA 4BLIA 1BZWA 5CG8A 4FTEA 4F3JA 2E7AA 1V9U3 1LOGA 2DCZA 1D4M2 4R9CA 1H9PA 1QJU2 4G9SB 1C5IA 4HKOA 3OCPA 4QD2A 3WNXA 1FPN1 2TNFA 4S2DA 5CFCC 2UU8A 1U12A 2BWAA 5D1IA 4JGYC 4K1ZA 2B45X 3IPVB 4P9JA 4IESA 4AHXA 1NCRA 4CEWB 4LHKA 5AC93 5FQ0A 4EWEA 3DUIA 4NR1A 2MPFA 2D6KA 5I8TA 4X8NA 2RR13 3VKOA 2R0FA 1ZZ6A 3MDPA 4COWA 2IXCA 1O4YA 2BGCA 1MS8A 1YJKA 5BNOC 2Q30A 3ZMNA 2X5IA 1Q43A 1UF2C 1PO21 4AVAA 2ZGUA 3ZO0B 4QHBA 1NG0A 4DINB 1D4M1 1AZDA 2GN7A 4JDNA 4B4PA 3MLJA 1HDKA 4YVSB 4BMEA 1N1SA 1U5IA 1YO8A 2WSVA 5JOYA 2V5YA 5FDBA 1GZCA 1C28A 1PIV2 1V6OA 3FLPA 5LK7B 1GICA 4X6RB 1MQTA 1WCDJ 1QOOA 3GF6A 1RUE1 4XEZA 3NSTA 5EYYA 5I91A 1AUYA 5C9AC 1FV3A 3GZTB 4G3YC 5IK7A 1C8M2 2DVFA 2IXJA 1RUD3 3PMEA 4D69A 1DQ1A 4KWKA 4Q8LA 2ET1A 2RMU2 2HEYF 3VBOC 4GMP3 1VBA2 3J8F2 1ULCA 5T55A 2H6BA 3B9CA 5FPXA 2NLRA 4NO4A 4RQPC 2D97A 3WG4A 4IEZA 1OKQA 4ASLA 2VUAA 2XKPA 2ZBJA 5HCBA 1PNFA 1RVF3 5LK5A 3RMXA 1Q8QA 3SHRA 3NVCA 5HI0A 1YIPA 4P9XA 2WC2A 2X53S 4E4ZA 2DCTA 2DVGA 2EXIA 2PN5A 3JQWA 5CB7A 5KHIA 3AZZA 1J1LA 2D3PA 1J1TA 1D4VB 4LBLA 2WT0A 2MEV3 3EJKA 3H50A 2RMU1 3ILFA 3ZXJA 1VBA1 3J8F1 2XJPA 1IPJA 4QM9A 3POWA 4XFIA 5CIRA 4Y20A 4IV3A 4FT8A 5EYXA 3AX4A 4OULA 3JD73 2CAUA 2ZX4A 1S2KA 1LHVA 2IXHA 5I0SA 2JG8B 2P2KA 1FYUA 4HT1T 2WQZC 4ZKTB 1VAVA 4W6XA 1RB8G 3RYKA 2DU1A 4FP3A 1QDOA 1VBE3 4YGCA 3VKNA 1TMF2 1CESA 3FBMA 3RYRA 5FQ0B 2D5FA 1RUC2 2CGNA 4Q4X3 1O3SA 2B39A 2TUNA 3NV3A 1XU1A 5DDJ3 1ZBA2 1VLNA 1RHI1 1AJKA 4CDWA 5GZEA 4P5HA 2X5IB 1OQEA 3H9AA 3R4DB 1PK6A 4RS5C 1PO13 1ZZ9A 5FFOC 4I0AA 4D7SA 1HQLA 1CN1A 4GQ7A 3UL2A 2E63A 1QQP1 4ATFA 1C1LA 5JOWA 1KJLA 4ES8A 2E53A 4YG3A 4I3GA 3M4FA 4K6BA 1OHFA 3R6SA 1TMF1 4BMBA 1MQTB 1QHDA 2PQQA 5HBAA 1LU2A 2D3RA 2F6BA 5I8SA 1RUC1 3CLPA 3J26N 2XJSA 2WT2A 1HX6A 2NMOA 4W65A 1ZBA1 1F5JA 1F2NA 3WQ0A 3S7EA 3WDVA 1CONA 4PF5A 2VOXA 4Q0PA 5LEJA 2HWF2 1URXA 2F4PA 1FOD2 3FLRA 5JPNB 2WNUA 3EQEA 1T6GC 1WBLA 3KZ4C 3WQ7A 5CBLA 1GNHA 4XHXA 2SLIA 1SDWA 2JG8C 3QCWA 2PA7A 3JB8A 2A75A 4C0BA 2GC3A 3WY6A 3WUCA 1YCIA 2E51A 2VNRA 1AL23 3LGRA 3KCCA 1VRH3 3JBG2 1MVQA 1WMFA 2TBVA 3S30A 1MR5A 3GBGA 3ZFGC 4L8QA 1AX0A 5KHKA 2WA4A 2UYBA 4MLOA 1W2UA 3RS6A 2P17A 1PGW2 1UPSA 1W39A 3B5LB 2HWF1 3TNQA 1EY2A 5JIUA 3B69A 3OTFA 1MZEA 4Y20B 2XBO2 4IV3B 4MZUA 1RUI1 4FCAA 3ZXFA 4EN6B 2IXIA 2RR12 2D6PA 1Z0HA 3ZFEA 2VMGA 4FPLA 4AHZA 3H1YA 3VHPA 1LOCA 5A33A 1KS5A 3WP4A 3BPZA 3TWIA 3VZKA 2V73A 1DDLA 1YI9A 3ZIXA 4AVVA 5JMCA 1V6JA 3NV4A 4EN9B 4QPGA 3OGJA 4IEOA 1RMU3 2VQAA 1PGW1 2WQ4A 1JUIA 4RA0A 2CY6A 2Q5TA 2YC0A 1IQAA 4FOQA 1R1ZA 4ZU5A 3MW3A 1RUG3 4XHBA 2DYCA 4BH9A 4CDWB 1COV2 4Q26A 1LOBA 1PK6B 2DUPA 2XBO1 4A3XA 4LO8A 1OI6A 2RR11 3M1HA 3W59A 4LNVA 1AYM2 4LULA 1MZ5A 4D7TA 1D0GA 4ITCA 4H7LA 3VBHC 1ENQA 1UKRA 5KHGA 1O3TA 3VUOA 4P9GA 2YZ4A 3SCGA 4X6QB 1ZYBA 4K20A 4GXLA 4QGMA 1GBGA 4OHXA 2DFBA 2ZHMA 4NWVA 2VNGA 4LO5B 3G7DA 5L36A 2YGMA 5FLJA 5E88A 2V09A 3IMNA 2P3IA 3O0VA 5GJ6A 1LU1A 2ZOEB 1W6MB 4XBQA 5DG2A 4AI8A 4Q4W2 1CJDA 1WUVA 2VNOA 1LGCA 4JV4A 3DV8A 4CDXA 3B7MA 1COV1 5ABJA 5C4WC 5IK5A 5FMOS 2BNOA 3AMPA 5JOZA 4IEWA 3KB5A 4UW3A 2PAKA 2WNUB 4AGVA 3WCRA 2ZHKA 4JTNA 3AZXA 3VBUA 3MIGA 1V6IA 2ZGPA 3NAPC 5BUVA 1CX4A 3VBRC 4DY5A 4HBNA 4PDWC 1AX1A 4R9BA 4LE4A 2ZPXA 1I9RA 1BJQA 2Z69A 3JD72 4KQ7A 4P9WA 3SH5A 4P9IA 4Q4W1 4XE9A 4Q29A 2QE3A 5FTTC 4YGEA 3D0JA 1RVF1 2Y0OA 1BK1A 2LUWA 5AVPA 4OI2A 5HXVA 5C6CA 1FATA 5CNAA 3EXUA 1DLLA 4RR3A 4XQWA 5BV6A 3ZXEA 2YGLA 4PBPA 3CJXA 2D93A 4B8EA 2WS93 2PHRA 3GBWA 5CU1A 3PVEA 4Z07A 1SLIA 2NM1A 3ZFEB 1XXNA 2QFEA 3O0WA 1GSLA 1VP6A 4CZSA 2CGOA 1ND2B 1ONAA 1LECA 3H7JA 3JD71 1OFSA 3D8CA 3AKTA 4YZ5A 2PHDA 3A0NA 1H30A 4WZCA 1GQGA 2Z42A 1OPMA 1ULDA 2JECA 3AFKA 2Z5WA 4DQAA 1K5MC 4AWDA 1E57A 1MZFA 1RC6A 4BQ1A 4FPKA 3PVNA 2K2SA 4JRLA 1D4M3 2R49A 1QJU3 4C90A 4FP2A 4HZFA 2NQYA 3QLQA 1MS0A 2A3XA 5C8WA 4AW7A 3P3NA 1OOPB 4IEPA 4MUVA 4OHZA 4HPKB 3MZHA 1GZ9A 4I02A 4QMAA 5T50A 1A3KA 4HK8A 3R4SA 4HETA 1ZZBA 4K9SA 1I6XA 2DWRA 2VPVA 4LUKA 1LHNA 4XMIA 1O7FA 4AEDA 3OF1A 1HW5A 1VB4A 4M3CB 4BWOA 5GLTA 1SBDA 2OUHA 3INAA 4CDXB 5ABJB 4LT5A 3RZZA 1AL22 5FLHA 2QKDA 4FO9A 2ETEA 4XIKA 3SH3A 4BM8A 1LJ7A 5AFEA 2JG9C 1C5HA 3KLSA 2QDRA 2VW2A 3EHKA 3S7IA 4JVAA 3VBUB 4AHYA 3OGGA 4B3NA 1DU3D 1PIV3 4DMIA 2XKOA 2Z2SB 1BYHA 2R30A 3ZXLA 5JSOA 5BNQA 1ND2C 3MLLA 2WA3A 4AXOA 4E9KA 1XYOA 5GZDA 4ZXKA 1ND3C 5JOXA 3NV2A 3UV9A 1S0BA 2A6WA 1C8M3 4WM7C 5K0UC 3IIAA 3TAYA 1H4HA 4R9DA 5GM0A 4ASMB 3K48A 4AVCA 4COYA 1R1A3 2RMU3 3NKGA 4GWMA 3M8LA 3UK9A 1VBA3 3J8F3 1AL21 3WDYA 4X8PA 3HMYA 3ZYIB 2GMPA 4RR3B 1Q8SA 2CGPA 3LSDA 1LRHA 1OOPC 1XNBA 4GH4C 1W0PA 4D94A 2TEPA 2UWBA 2Q4SA 3VZLA 3N3HA 3OY8A 2HWB2 1TNRA 3ZFFA 2A73B 2VMIA 3JB4C 2GMEA 5J98B 1OLQA 3Q9OA 5A32A 4AVSA 1BXHA 1AR92 4CP0A 1AYN2 5JZGB 2DF7A 3THTA 2D6OX 1IKQA 3KGLA 4AVTA 3WW2A 5EWSA 2WLQA 4B7KA 1W6PA 1NE4A 2HJIA 2WFF2 3MPPG 3ZYJB 4QXKA 3IBMA 4XJ8A 4YM0A 2OYZA 2RE9A 3VBFC 4WZFA 4KNCA 1QJY2 1S0GA 2GC1A 3BALA 5D8AA 4B29A 4FQZA 1N1VA 2EXJA 2H6CA 2PFWA 5F5QA 2CYFA 2WL1A 4XXAA 3VKFC 1R082 1TMF3 1UW8A 3HR9A 5BNPC 4Y1ZA 2AH2A 4F7ZA 1UU5A 1RUC3 3VDDC 3FLTA 2R072 4PLMA 4XBNA 1FMD2 3SXWA 4Q8KA 4AEDB 1Z7S3 1ZBA3 1ZRDA 4RFT0 1LODA 4YZ1A 2EALA 4BA6A 4HSLA 4Q27A 1GANA 1NOVA 2WFF1 2YROA 4M0HA 1QJY1 4B4RA 2R042 4K3UA 5F9TA 5BYNA 4JQRA 4LTAA 3APBA 3TB0A 3FHIB 4KU7A 1R081 1H0BA 2N7GA 4XF3A 2CV6A 2GNDA 4DRVA 1YXWA 1WW5A 4CP1A 2ZGRA 3KM5A 2R071 4DRRA 1ZREA 2VULA 1FMD1 1YHFA 1LENA 2VOKA 5JZGC 4FXKB 4PIXA 1TE1B 2XPJA 2WS92 3HIFA 5F6LB 2PHLA 1SLAA 2E6VA 4YW3A 1Q8OA 2O1QA 3ZXGA 1G8WA 1FOD3 5FRAA 2DTYA 3RMYA 2XL9A 2BYVE 3BODA 3BOWA 4WVZA 2BTVC 4LE3A 1X7NA 4YYOA 4Y4YA 4G4FA 3WHTA 1UIJA 1AR62 4R52A 2EVXA 4GULA 1N47A 4QPIA 2GH8A 1LULA 5KXCA 1WCKA 3VV1A 4N53C 2PHWA 3E6BA 3ZFFB 3JBG3 3HBZA 3TN92 4FAHA 3AKRA 2I74A 1D2SA 4BPZA 1CAVA 1VJ2A 5A32B 1NXMA 3AKSA 4A7KA 2WS91 3AZVA 4GB32 5JAXA 4JC1A 3DF0A 1VBD2 1Y43B 1GLHA 3FUQA 4P9LA 3USSA 3ECQA 2AREA 2JJ6A 1XNKA 4K1YA 3AP7A 1DGRA 5LEKA 2XBO3 4L99A 1BVP1 1W6PB 4BE3A 1JH5A 2IXLA 1CAWA 3S6PA 4N43A 5D8AB 1QU0A 1W6NA 2A6VA 3MW2A 3ZXDA 4IV1C 5L7OC 4MGYE 4YG0A 3GNEA 5EJ3A 3TN91 1DGLA 1RUF2 4TZDA 4YSFA 1N1YA 1XNCA 1SEFA 4AFAA 1C8NA 4YW5A 2ZGLA 1IS5A 3H1WA 5TSWA 3H1MA 1APNA 1QJU1 4FOYA 1W0OA 1DIWA 4CDQC 2C5DA 3BB6A 1VBD1 2EF6A 1OPOA 3OJBA 1HRI2 1NQJA 1XRUA 1QNYA 1COV3 1SQ4A 4LA3A 3AB0A 5BNNA 3C3VA 1BEV2 4MV2A 1JYCA 1A6CA 1AYM3 3MW4A 2QZ2A 4GALA 1NY72 2WNEA 1EP0A 2A70A 5CFDB 1RUF1 1R1A2 1RTVA 2G9GA 2ZMNA 1HXS2 2ZGQA 3G6JB 3SMHA 3A4UA 3N36A 1NCQA 3B94A 3PJYA 1AR83 1SLBA 1CD3G 3RNSA 3CL1A 5BXXA 3TOJA 1UIKA 1DGWA 3OYWA 3LKJA 1FAYA 1NE6A 3CJIA 3OD4A 3IKWA 1IOAA 3AJYA 4FVVA 1HRI1 4Q4W3 2R062 1PIV1 5F6KA 4CEWC 2ZX3A 1BEV1 2BNMA 1J3PA 1LEDA 1G9FA 1OSGA 1QOTA 1PGL2 1KRIA 2A6XA 4K7JA 1LGNA 1QF3A 1WBFA 1C8M1 3WLUA 3MGUA 1PZ8A 3T2TA 3DPRB 2RS12 1AL0G 2VH9A 3BOPA 3MIEA 5AVAA 4QPIB 1R1A1 1M4WA 4LUMA 1NLRA 1QXJA 2QQPA 2ZHLA 1GZWB 3WR0A 4CDUA 3J4UH 3QBQA 4EV0A 4WVMA 5KXEA 4IEXA 4YVSC 1U5YA 3NW4A 2IFWA 3DN7A 1YFXA 4HK9A 2XH6A 4WM8A 4YNIA 1ZX5A 1ENSA 1GV9A 1QJX2 5GLZA 1CAVB 1F31A 3U4XA 2Q8OA 1X8EA 2D40A 2MNGA 1IGOA 2VOVA 3AZWA 1V6KA 1ZA4A 2ZZQA 1NYWA 1OA3A 1NCRB 3LAGA 2NP0A 3VZMA 4YZ3A 1YI7A 1UU4A 1WW7A 1C3HA 2YYOA 2R32A 4LBQD 1CJPA 5CFDC 3ZSJA 2K0GA 4LO7A 4C1XA 2XWBB 4IXLA 1CAWB 1Z7S2 4AF9A 2W68A 4XTPA 1V6MA 4N43B 3NO8A 4AI3A 4OHYA 2BEOA 2D43A 3OBTA 4QGLA 2R1DA 2OIIA 4NVPA 3AZYA 4XF4A 1QJX1 1UZYA 4O9GA 4OLLA 2VGDA 1LGBA 4D7YA 3LA7A 2XLFA 3RRDA 2IC1A 1BQPA 3WDTA 1H2MA 5A3MA 2DU0A 1PVXA 1G9CA 2ZGNA 5BNNB 1REEA 5FREA 2ES3A 1OMIA 2Q1MA 3DPRC 5FBZA 2YXSA 4IERA 1Z7S1 4KBBA 1LOFC 5CADA 1VBB2 3D6EA 4V1PA 4YW4A 4RHV2 2AUYA 3V64A 3OPZA 1RINA 3ILRA 4AEMA 2DURA 1RUNA 5JDBA 1QH6A 1ULEA 2ZGSA 3AJZA 1KQRA 2WFPA 1H8VA 5T5OA 3LOIA 1JW6A 2I2SA 3BU7A 4AEJA 4Y24A 3IN9A 1H1IA 3S0MA 3O0XA 2GMMA 4M00A 1NCRC 2O8OA 1AXKA 1N3QA 2GAUA 1X8MA 2DV9A 3IWZA 1DBNA 3B93A 3MIHA 4ISRA 3U0ZA 2ZGOA 1B35A 3AKQA 3WINE 1VBB1 4EN0A 5HCAA 4FPHA 4IETA 2X5IC 4MXWA 5GKAC 2VOWA 4LBNA 4RHV1 4COZA 3ZYGA 4L2NA 1Z78A 1FOD1 1LHOA 4CEYA 4BCUA 4C0HA 2DUOA 2BPA2 2DUQA 4WVMB 2O0OA 4HANA 2PHFA 3WQ1A 4ZU7A 4Q4V3 4WM8B 1F5FA 1ZNPA 4XPVA 3H3ZA 2ERFA 1Y3TA 1MQTC 2QCSB 3JBG1 2HWD2 4LBQA 3E5QA 4Q1RA 4TWTA 4MXVA 1LHWA 3VGIA 2HWC3 2UYAA 1WW4A 5SV8A 4YRDA 5I93A 2QZ3A 1ZRFA 2VVFA 1OA2A 2HWB3 1FNYA 4DNYA 4LHNA 5LRSA 3FZ3A 1YFWA 4TYSA 1G9BA 4E2SA 3AP5A 4K40A 3ZSMA 3CEWA 1AR93 2AR6A 2RHPA 4FQ4A 2VVEA 1QWRA 4TSVA 4BIFA 3X29B 1AYN3 1YJLA 1S0CA 4Z92B 1DQ6A 2GZWA 5EXOA 4INDA 2WINB 3AYCA 1S2BA 2IFRA 3ZMOA 5J36A 2HWD1 4NOTA 5E8AA 1H8TA 3E6DA 5JI9A 4FTSA 2WFF3 2EAAA 2VXRA 5GALA 2UY8A 3I7DA 4ISQA 1AR82 3U10A 4DOUA 1QJY3 1JUHA 2HEVF 4A2UA 1EAH2 5DZFA 4MVTA 2BWCA 4R4ZA 1O5LA 1REFA 1R092 1WW6A 1R083 3AK0A 3THPA 4IV3C 2ZGKA 3VHNA 4FPFA 2RS52 2P3JA 3JCIA 1UPIA 1AYM1 2B9UA 1DZQA 5DZEA 2R073 1FMD3 3ZX7A 2GU9A 4IEQA 3VBSA 2E7QA 3LSEA 5I8YA 2HWE2 1PMIA 2BUKA 4U36A 1AJOA 4XMAA 4XZPA 1AR81 2RJKA 2EXKA 1V6LA 4H3WA 5FAXA 4L97A 1W6QA 5J48A 5JPMB 4H14A 3SITA 2R043 1EAH1 1HV0A 1WLWA 2B42B 3ES1A 2ZACA 1B35B 3HQXA 2EA7A 5KXDA 2MHFA 1QY4A 4CDWC 1Q8VA 3CO2A 4MXWB 1PK6C 4BHPA 2ZX2A 4CTEA 5E16A 2XGXA 4HKLA 4CEYB 1TEIA 2WZPP 3URFA 3WP6A 2BNNA 2LM3A 1AHSA 3ST7A 3UKNA 2RM22 3VL9A 2P37A 2VG9A 2HWE1 1U5XA 2C9AA 4AE2A 1DYPA 1IZ3A 5A33B 4W6YA 1NLSA 5L19A 3MPBA 2DFCA 1Q3EA 4LBQB 5I0RA 1BMV2 3M3CA 5E1RA 1AR63 3JUUA 4QPGB 4E27A 2ARBA 4ZU4A 2WKKA 5GLUA 3KCXA 3GZUC 1VBC2 2YV8A 3A0KA 1IS3A 1RL3A 1OD5A 3GHNA 2OW4A 3MEPA 3ALQA 3TN93 4C91A 2WNUC 1HLCA 3USUA 4JGZA 2WNVA 4UBGA 3LZZA 3WDWA 2JDZA 4YVWA 2RM21 3CF6E 4H55A 4DXZA 4GB33 3FWEA 5C8CA 1VBD3 4K21A 1MEC2 4AGGA 1UZZA 3WHUA 3LOBA 3RI8A 2YUEA 3N35A 3I2DA 3VKMA 4I09A 1AXZA 1BMV1 3HD8B 1H8TB 2BW8A 4MGIE 4U2AA 2BFUL 1ENRA 1OLRA 4YZ4A 3WUDA 1YFUA 4AFDA 5KHHA 3AMHA 3RSJA 3QH7A 1F8VA 1RUF3 1SMVA 1NA1A 3N7LA 3B00A 4AVBA 2ZAAA 1CVNA 3LA3A 2NMNA 4OUSA 3GHMA 4OI1A 1QXPA 2NPIA 1PHMA 1Q56A 4AGRA 1MEC1 4XILA 5E89A 3ZFEC 4QM8A 5J37A 1HRI3 4DS0A 1QDCA 3CU7A 4META 4FPYA 4E4DX 1DGRN 3N4MA 1JYIA 5CFCA 4COVA 1AX2A 4O9EA 1BEV3 3PNAA 4JGYA 5H9RA 2I07B 4QPGC 2C1FA 2PELA 4XJUA 1W6QB 1VR3A 1LKNA 3MIDA 4SBVA 4Q4V2 1NQDA 2ZCWA 2WWSA 2VW1A 4KGGA 2UURA 2XVKA 4LBJA 3KT1A 1DYKA 1HXS3 2IZWA 2ZABA 5IUQA 5LRRA 3NV1A 5JIAA 2P34A 1IHMA 1U5ZA 4IEUA 1CPMA 3I54A 4OI4A 2PYTA 2HWC2 2OZ6A 3L9JT 1VIWB 3E5UA 2R063 4F83A 1PGSA 3SLIA 5CA6A 2A3YA 2OZJA 2XVLA 4IEVA 3BTAA 3AFGA 1H2LA 4C1WA 2YHJA 2Z79A 1LESA 3ELNA 4Q4V1 1J58A 3WW4A 2GNBA 1J59A 2RS13 4XFHA 4HSJA 3MF6A 5C9AA 1GQHA 1RUJ2 1MS9A 1ZBE2 1SLCA 1UD1A 4CDXC 5ABJC 4NWWA 3SH4A 1NXD1 3IT8A 3VZJA 1PVC2 2ZTNA 2YY1A 2SBAA 2GH2A 3VBOA 1EV12 2HWC1 3WXPA 4JGZB 2WNVB 4AQTA 1DFQA 1QJX3 3EBRA 3L2YA 2QJVA 4Q1PA 4GMP0 3VBUC 4XF9A 3UJQA 2R1BA 1BBT2 2H0BA 4YVWB 4UW4A 5T5JA 1YWKA 2HWB1 3MF9A 3W9AA 2WIIB 3HT2A 4YLZA 5C8CB 1D2QA 5KHJA 4RQPA 3JU9A 4YGDA 4XQDA 3FBYA 2A3WA 1LEMA 1LHUA 1U0AA 5EFUA 5CAZA 1AR91 4KG0A 4M01A 2NZ9A 1UMZA 1AYN1 1H4GA 1JN2P 1AF9A 1QH7A 3ZSEA 1RUJ1 2ZKNA 1ZBE1 3NWKA 4HL0A 3ZVXA 1YFYA 3WD5A 2PAMA 3MIFA 1MZ6A 3M70A 1PVC1 5FO7B 5KBFA 2W39A 3PVBB 2Q0AA 4LO6B 4RR3C 1NA1B 4JDOA 4SLIA 4ATEA 2D6MA 2JE7A 3AKPA 4AI0A 1FV2A 5GLWA 4KGQA 2PHUA 1RUH2 1F9KA 2KXLA 1KITA 2ET7A 3RJRA 5FO8B 2DVBA 2X8KA 4N7IA 1CIWA 5CFCB 3L2HA 1UX6A 3PLQA 4JGYB 4XDQA 1MACA 4XBLA 2RJLA 4HN0A 3UKVA 5I0TA 2OUJA 4OUMA 1YRZA 3MLKA 4HVOA 4WVVA 1VBB3 3AM2A 3WV6A 3WG3A 3MFCA 1XYPA 2UWAA 4RHV3 5DUWA 4EN8B 2ZHNA 3P3PA 3UKTA 4DFSA 1O4ZA 1SBFA 4URTA 1L3JA 4PCRA 1LOEA 1KFUL 1X33A 3PJQA 4RS5A 4QQLA 2R041 3QOPA 1YUDA 3AYEA 2JEMA 3FX3A 4LR4A 4IL7A 5GZCA 1ZRRA 1FPN2 3OY8B 3NJZA 3SCHA 4XYXA 2CNAA 4YARA 3FUOA 1XNDA 5DZGA 1HIXA 2ZX0A 3D0SA 2D5HA 5DUUA 5FPZA 1SACA 4KH9A 4AEDC 3HT1A 3E97A 2GC0A 4ES9A 5C9AB 4JAAA 3WW3A 3ES4A 5IT6A 4YM1A 3TBDA 3M7AA 1PNGA 1POV0 1VALA 3QACA 3AP6A 4Q4Y2 1A78A 4D3WA 1PO22 1AR61 2CAVA 1HQWA 1O91A 1RIRA 4XFCA 1GNZA 3VBOB 3ZXAC 1I1EA 3FFZA 2FMYA 2E7TA 2JG8A 2ATFA 1S0IA 2VUJA 3ZYPA 4RQPB 1RJ8A 2HWD3 4B7EA 2ZGTA 3ACLA 4I01A 5T54A 3KMHA 3MYXA 3OD0A 4FBFA 2B46X 3GYDA 4RGGA 4XFFA 4QQ2A 1RUE2 1SBEA 2WT1A 4WVWA 4GB31 1XE8A 2C0ZA 3ZFGA 3LWCA 1KD7A 3RYPA 3FE5A 2ILMA 3V65A 4PIYA 1J3RA 1IS4A 4F8AA 1VAKA 5J7MA 4Q4Y1 3WG2A 1BVVA 4HKWA 3WG1A 4ONUA 2FZ2A 2GSYA 2A5ZA 3FFQA 1OQ1A 3KD4A 2BBVA 3SISA 1ASJ2 2JICA 3V56A 4AFBA 4Q0QA 3ZFFC 4GKXA 5T3NA 4LEJA 1LTEA 1S1AA 1Q8PA 3ZYRA 1O3RA 1G6NA 3TRSB 4ORFA 4KWLA 2B5HA 1TNFA 4I0BA 2RS32 2D7FA 4S2HA 3BIWE 4M0NA 1EAH3 2CTVA 5JSPA 4TLFA 3E5XA 3WP5A 1S55A 3H3UA 1SCRA 4QX5A 1R093 4DZGA 1C1FA 2AZ5A 2RS53 2JX9A 4P14A 1NY71 3ZPYA 5FOBB 1QJZA 1ASJ1 5ACA2 4RS5B 5KWRA 1I5ZA 5D8AC 5T52A 4DPNA 2OVUA 1WA4A 4Q0SA 4P9YA 1JHNA 2HWE3 1HXS1 3VBHA 1ALYA 1HV1A 3ATGA 1HKDA 3VN4A 1XE7A 4HN1A 2XJVA 3O7OA 4BOWA 2RS31 4OHVA 4FOVA 1S0EA 2AENA 4DY3A 2A71A 2R061 4AI1A 1SFNA 3AP9A 4A7ZA 2HEWF 2G9FA 4Y5Z0 2BVBA 4AHWA 3R0RA 5JR7B 4XF0A 4UW6A 1PGL1 1G86A 2VY0A 1X82A