4D7YA

Crystal structure of mouse c1ql1 globular domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
PRVAFYAGLKNPHEGYEVLKFDDVVTNLGNNYDAASGKFTCNIPGTYFFTYHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVILHLDAGDEVFIKLDGGKAHGGNSNKYSTFSGFIIYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C1Q-RELATED FACTOR
publication title Anterograde C1Ql1 Signaling is Required in Order to Determine and Maintain a Single-Winner Climbing Fiber in the Mouse Cerebellum
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 30
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d7yA00
1U5ZA 1XU1A 5L19A 4QQHA 5CIRA 1GR3A 5KC6A 4HT1T 1C3HA 1JH5A 4OUSA 4E4DX 4G4FA 4KG8A 3AB0A 1DU3D 3K51A 2WNVC 4QQLA 3ME2A 1KD7A 2KA3A 2R6QA 4NN0A 3TYJA 3B93A 4DB5A 1D2QA 5KC5A 1O91A 1D4VB 5BNQA 2QE3A 3MI8A 3URFA 1KXGA 3IT8A 2R30A 1WCKA 4J6GA 4KGGA 1U5YA 2JG9B 5HBAA 3TWIA 1PK6C 2Q8OA 2O0OA 4DOUA 3B94A 3FC0A 2RJKA 2WNVB 1XU2A 2HEYF 2E7AA 1C28A 1OQEA 5L36A 2JG9A 2Z5WA 4TWTA 4OULA 2ZPXA 1A8MA 2QDNA 2WNUC 2ZJCA 4RSUA 1S55A 4OUMA 1JTZX 5TSWA 1ALYA 3B9IA 4MXWB 1DG6A 3ALQA 1PK6B 4GIQA 4EN0A 4QPYA 1U5XA 4N90A 2HEVF 3K48A 2JG8C 4QQ2A 1OQDA 2TNFA 3QD6A 1RJ7A 3WD5A 1IQAA 4MXWA 4MXVA 4KGQA 1PK6A 4TSVA 3V56A 2WNUB 4QQPA 1RJ8A 2OIIA 3QBQA 2AZ5A 4D7YA 2WNVA 2JG9C 2Q1MA 2R32A 4QQOA 1TNFA 2JG8B 1OSGA 2WNUA 4F3JA 5KWRA 1I9RA 2RE9A 2RJLA 3LKJA 1D0GA 4MSVA 1TNRA 4G3YC 2TUNA 4E4SA 3L9JT 2X29A 2JG8A 2HEWF
chains in the Genus database with same CATH superfamily
4PDWA 4EE2A 1RUC3 2PXJA 1O4YA 2Y60A 3D3AA 2BBVA 2XJTA 5FZFA 3FUOA 3UETA 3BOWA 4AVSA 4DUWA 1KITA 3E6DA 2GC2A 1XSQA 1BEV2 3AK0A 4YPJA 4B1LA 3J7HA 1DQ6A 1LU2A 2XLGA 1G86A 3EJKA 2X5IC 2YGMA 4CCDA 1POQA 3VBSC 2IXLA 1YFXA 4XJWA 4YVWB 1AYN3 1QJZA 2QQNA 3ENRA 5C5UA 3B93A 4BA6A 3ZKYA 4CDUB 2LW8A 1GYKA 4YNIA 2V09A 2V4AA 3O5SA 3PUQA 2ZX0A 3UK9A 2YXSA 3WNOA 4F83A 1B09A 5FPBA 5CU1A 1CPMA 4YGDA 4AI0A 2YU2A 5FUNA 4J6GA 2QDRA 1EP0A 4S2HA 3FBMA 4WVMB 4CRQA 2ZBJA 1FOD3 1C8M3 5F5AA 2GP5A 4HXCA 2VZOA 4GMP3 3OOXA 5FZOA 3LE0A 4FP2A 3VDDC 2EAKA 1DYOA 1FYUA 1ZA7A 2PHXA 4OFGA 1IGOA 2G9ZA 5CNAA 1K12A 3LPGA 4ORFA 1OF3A 1LGCA 3FHIB 4Q8LA 2VZSA 4XFGA 5E88A 5GLZA 4K40A 2C1FA 2ZGOA 3VBOB 4A6SA 4EQVA 4TWTA 2V73A 4DZGA 4XDPA 5FYVA 1E57A 1RHI3 4XFBA 2QQWA 1PVXA 4DXTA 2PQQA 5TSWA 3TNPB 3WVJA 5I8TA 3OBZA 1VAVA 4EN6B 5A3UA 2CGOA 1EY2A 2ZMLA 4GZ9A 4XQDA 5FY9A 4CCOA 3BODA 4UWDA 2IXKA 1STMA 3IIIA 2VZPA 1LULA 1SDDB 1W2UA 2PHRA 3ES4A 5FIXA 3S30A 3WHTA 4CP0A 1BQPA 5FZGA 3CHXA 5IFPA 3W5NA 5GZGA 4JHTA 1ONAA 2Q30A 3EBRA 3GCXA 4YG3A 1OF4A 1AYM3 5JXHA 1NZIA 3OYWB 5KXCA 1NCQB 3ES1A 4M3CB 5AFBA 2HWF1 2BNOA 2VQAA 2BP6A 4P5YA 2E32A 1I1EA 4TXWA 1UOFA 4HK8A 3ZOIA 1OHFA 3OUHA 5DUWA 1HXS3 3WQ0A 3QBQA 2ZS6B 1ULFA 2JDMA 1BVP1 3POSA 1WKYA 4QPGC 3UV9A 3GBWA 1SACA 3NNLA 2ZGSA 4LOSA 5BNPB 3C3VA 2WYSA 1W6MA 3IBMA 5K0UC 2HWD3 3T0DA 1QJX1 3ZFGA 1QJU1 4JKLA 2JG8B 1VMJA 4Q0QA 4AQ2A 2Z42A 4QPIC 1Q3EA 1AX2A 3WNKA 2OXBA 4CZSA 1Q5OA 2JIGA 5HCAA 3VZMA 3ZLIA 1W0NA 1MZ6A 1HDKA 3U11A 1KEXA 3UJOA 4ET7A 3IAPA 3S57A 4NJ4A 2K9ZA 1GNYA 4IV3C 3SNMA 2VNGA 1O3RA 5KHHA 3HNMA 2E63A 5I93A 3AZYA 4LUMA 5CVRA 3TNQA 2AC1A 4B7KA 5GLUA 1HRI2 4AVBA 4B29A 2PLV2 1R083 4URTA 4FBFA 2HYKA 2J1TA 2MEV2 1UKRA 3IN9A 5JOYA 1XSRA 2BVBA 5FYBA 4HN0A 4AI1A 2ZZQA 1P8JA 2BTVC 2GH8A 4MHRA 3UGHA 4GKYA 3KM5A 3NKTA 4RS5A 4MVTA 1HQNA 3LIHA 3NV4A 4NVPA 1LCLA 3WP5A 3POYA 1W6QA 5FQ0A 1YFYA 5T52A 4BIOA 1UNBA 4IE6A 1V6OA 1NG0A 3DKWA 2DTWA 1MS3A 3KLSA 2B4KA 3OG2A 3KCYA 3R4UA 2UYBA 5C3QA 1NXMA 5LY1A 2R7EB 3NWKA 1W6NB 3IB3A 3HIFA 3GM8A 3Q8EA 4KGGA 3OPTA 1OOPA 3VKOA 4BQ5A 2BERA 4BMBA 1Y4WA 1UCXA 2A5ZA 1CAWA 2C6SA 1EAH3 1ND2A 1VPHA 2BFUL 2O0OA 5F6LB 1JZ8A 3FC0A 4HZFA 2RJKA 1PGSA 5IJRA 3WNLA 5DAXA 3KCCA 3KV6A 4H55A 2JXAA 1YQ6A 3PHMA 2ZOEB 3MIBA 2ZABA 2JG9A 1GZWB 3RZJA 2XH6A 3KQ4B 2DV9A 3ZSJA 4M4RA 2N7GA 3U78A 2R043 5L9BA 4D6RA 2VMCA 1L3JA 3Q8FA 4I0AA 2ZGNA 4KWUA 2GNBA 4C1WA 2MHFA 4XUTA 4B3NA 4QM9A 3NL1A 1F4HA 2JIJA 5FK7A 3ALQA 4BDVB 1HLCA 5A6YA 2HWE2 1F8VA 3AYCA 5A6XA 2HYXA 2EXJA 3M8LA 1SLTA 2WO3A 2WLQA 1G9BA 3ILFA 1A6CA 1UO9A 5LBFA 1MEC3 4HETA 4CP9B 4GMP0 3BI3A 4CXXA 3AYAA 1RUI1 2ZA9A 5FXVA 2AEZA 4AVCA 2YHJA 4ZZ5A 4L99A 5K9YA 5LA9A 3I97A 1KS5A 4CEYA 4E4HA 1QOOA 1COV3 3POFA 1DZTA 3DGTA 1J3QA 2ZX4A 3EMRA 3MPBA 1JUHA 1K5MA 1JBCA 2XBO1 5EV7A 2D3RA 1LEDA 5EZWA 3PL0A 3DXUA 3BTXA 3X29B 1H9WA 1RUNA 2VZQA 5F6KA 3B7MA 4META 4K8RB 3I4IA 2OYZA 1T6BX 2WKKA 3K4ZA 3MW4A 1MS4A 5B4XA 3TBDA 4JDNA 1IS4A 2G1MA 4E4ZA 1ULDA 2E7QA 2RS33 4LKFA 4DRVA 1C4RA 1PMJX 2BGPA 3UYJA 4PCRA 5IVVA 4X6RB 1QOTA 1ZRIA 1MR5A 4UW3A 2ZKLA 4QXHA 4N8MA 1PVC3 5E6HA 2WS93 5FZOB 4Q4W3 3DYOA 1QH6A 1VBD3 1XC6A 2BNNA 3OGRA 4XF4A 4Y3OA 4B4QA 2Y0IA 1LR5A 4FCAA 4L97A 2QQIA 2Q0AA 1SCRA 4WVVA 1FATA 1KQRA 3JD72 1R1A2 1BMV2 2WFPA 1YC61 3WT3A 4LBQA 3ZXLA 4BK5A 1NQJA 3J7NA 3JU9A 3R6SA 2WQZC 4WVWA 3T2TA 3MEPA 5FY7A 1LECA 1LOFC 2JDYA 2VW1A 2VQ0A 3AP7A 1W8NA 2CHHA 2E26A 1PHMA 2QQMA 4GAZA 4V1PA 3VBUB 4CA9A 3I2JA 5GZFA 5C8CC 3RZHA 4D7TA 4HPKA 4C91A 5HV0A 2KA3A 1ZBE3 3GJAA 2P5BA 1D2QA 3V0BA 4Q4X3 4I2OA 1TE1B 4Q5OA 1ZZ9A 2Y6LA 3UJQA 3A21A 2QQKA 3AZWA 3TEZA 3OGSA 1AR81 1DHKB 1R64A 1OFNA 3K3NA 2P3JA 1VBE2 2RR11 1FAYA 4JQRA 1RVF3 4ZKTB 4XFHA 1GKBA 2WWJA 2CU5A 1LRHA 3HWJA 4LT5A 4DIQA 1XBFA 1YRZA 2WO7A 1VBC2 2D93A 5A3OA 3VHRA 3SCFA 3K4DA 1AR92 5FYYA 4M4PA 1BBT3 3DYPA 1X36A 1CIWA 5FMCA 2WZR2 3CZJA 5T3NA 3RJRA 2OVUA 3AXEA 4IGPA 1CJDA 5JZGB 2GNTA 5A6ZA 2Y6GA 4FTSA 2D6PA 5CKNA 1WCQA 2YC0A 4KWKA 5LK5A 4D94A 2E33A 5I0RA 4K20A 2B45X 1NE4A 1RUG3 2FMDA 3J7MA 3OUIA 1ZM1A 2D6LX 2VU9A 1GV9A 1ND3B 3H8XA 2BPA2 4QGNA 4OMCA 4M3CE 1YNAA 2HBUA 4GIQA 2RG4A 3LWCA 5FZ9A 4Q8KA 3A23A 1UY1A 2FBEA 1V9U3 4CDQA 3VBRA 3AP4A 4OCTA 2B7YA 3WZ1A 2C5DA 5IK7A 5C6CA 2A3YA 4LHLA 5A1FA 5FZ8A 3FHQA 4KBBA 5C3SA 2WQ8A 3OY8A 3LDBA 4JRLA 4BWOA 1AR62 5DDJ1 3I59A 4IXLA 4FAGA 5FZEA 2PAKA 3CF6E 4H7MA 2ZGRA 1DQ0A 2JDAA 1RMU1 2WNVA 5AVAA 3WQ7A 1RB8G 1BEV3 1W6QB 5M0TA 1U12A 3P5BA 4LBOA 3VD7A 2ADEA 3HR9A 4OLLA 3ZKUA 1T6GC 1REDA 1FNZA 2WNUA 4QGLA 4XDQA 5GLTA 4EWDA 1DYPA 4Q0UA 3SQOA 1I5PA 3POIA 1OBNA 4QU1A 1PO22 3AMQA 2VBDA 1GP6A 1NCRB 1WGPA 3N3HA 4IEZA 1UOBA 5FWEA 2EAAA 1V6LA 1WMEA 2D6OX 5F5IA 2PTMA 1UMHA 4XXPA 1CAWB 5T5JA 3MPPG 1HN1A 3PJYA 3AJZA 3WUDA 3POWA 1QJFA 3N7KA 2VUAA 3NW4A 3Q9OA 4R9DA 1XU1A 5ABJC 1DGWX 2E7TA 3E5QA 2Q8EA 2A1XA 4NIIA 3DF0A 3QH6A 2EA7A 3CJIC 4P08A 3IKWA 4DUVA 1Q8QA 1LKNA 4FAHA 4WM8A 4DINB 2AR6A 2D3SA 4OUSA 2D44A 3DEMA 5CBLA 4COZA 2YB7A 2CV6A 1SPPB 5FYMA 2F4LA 3OBRA 1AL22 3I2HA 2VUJA 4BB3A 2JB4A 1H30A 2VOKA 3B01A 4LQRA 3V65A 4QHZA 3NAPB 4A4AA 1ZBA2 2GZWA 3PUHA 2DURA 1DQ5A 3IMNA 1N47A 3THCA 3E6CC 3SKVA 1BZWA 1JZ5A 1C5HA 1D0HA 3RGBA 5KHGA 1H1MA 2ARBA 1ZZBA 1DF0A 3NJZA 2X05A 4AL9A 1ZREA 2ARCA 3DPRC 5JXJA 3GCWA 2CAVA 3U4SA 1U5YA 4Z07A 5H9SA 4FQZA 2W39A 3KF5A 4CEYB 3RNSA 2XLAA 1PGW2 4NPRA 1YQ5A 1NA1B 2QFEA 4JGZC 4JV4A 3M3IA 4V2WA 1HX6A 1LEMA 1URXA 5E8AA 3B94A 1OA3A 3ILNA 1OVPA 1TME2 4YZ3A 1OQEA 4PIXA 4Q27A 3M4FA 2ARAA 3CBNA 3KHBA 4UF0A 5FO8B 1TMF1 2WA4A 1KJRA 2IFWA 1A8MA 3T2PA 3PU3A 4OI1A 1S0EA 1KDMA 5HCHA 4QX1A 3BKZA 3RZLA 1JTZX 4P9YA 2XR4A 3NMBA 2DDUA 2GMPA 1X82A 2I45A 1ST8A 3OTFA 1ALYA 1OA4A 3RQ0A 4CTEA 5ABJB 1BLZA 2ZX1A 3PUIA 4I3GA 3RZMA 4IV1C 3AJYA 1DG6A 4AYUA 3RZZA 4CU6A 1RUD2 2Z79A 2ZAAA 1IPJA 1BCXA 2EALA 3U07A 4EZ4A 5CYYA 5IVBA 1AXKA 2W5FA 2X53S 2HEVF 3RS6A 3DN7A 1S0BA 4XOGA 3WF1A 2ID4A 4RR3B 1DDLA 1DYKA 1OLME 5E16A 4XJAA 4ZHNA 3E97A 1UQXA 3NRUA 3JUUA 1IQAA 4I30A 1RUH3 1QF3A 4XMAA 4GD4A 3RMYA 3ACIA 4Q0PA 1AHSA 1RUF2 3VBFC 1LOEA 4UFLA 4XABA 5EP9A 1HRI3 4UFIA 3U1XA 4HPKB 4GH4C 4JGYB 2RJ2A 2YPJA 4COYA 4INDA 2OZ6A 5DZFA 1ACCA 2WRAA 1JZ2A 3V0BB 2MEV3 1BJQA 4LKDA 1QHDA 3LDKA 4QKDA 1GP4A 3ZFFB 2NPIA 3U75A 2D7FA 1OD5A 2P6HA 3C7EA 4JGZB 1IOAA 1GWKA 5JPMB 1SBDA 4D3WA 4GULA 1JYVA 2XQXA 2V72A 2W91A 2ETEA 4LLFA 1H2KA 2RJLA 4Y1UA 3ZXDA 1D0GA 2PQSA 4BISA 1UY3A 3AP9A 5LY2A 1C1LA 4MHUA 4CUGA 4IEOA 2DWRA 2W2IA 4LORA 3O7OA 1CR7A 1GMMA 5I91A 2IWGB 3AZZA 3L9JT 2X29A 4OUEA 5K4LA 3WXPA 2OX0A 1ASJ1 2GDFA 4A3XA 5H9RA 4YM1A 2Y6KA 4BM8A 5BNOA 2DCZA 2RS12 4UW4A 5L19A 3ZFEB 4TLGA 4IE0A 4LK6A 1RINA 5H9QA 1UZWA 1NKGA 3O1TA 4CU7A 2IXCA 1YYNA 3ZSMA 1RUC1 1UOGA 4HONA 4YLZA 2FMYA 3PURA 3K2OA 1VIWB 2W1UA 1MVQA 4BZ4A 2OZJA 5D8AA 4XCBA 3AB0A 3Q8CA 2ZGMA 2R073 5T5OA 1AF9A 3JBG2 3QLQA 2R6QA 1RUE2 4NN0A 5IFTA 3ON7A 2F6BA 1GZ9A 3ZYBA 1HV1A 1AYN1 2UYAA 4L11A 1DQ4A 2PHWA 2W1SA 1S2KA 2Y26A 3A22A 5FYHA 3OF1A 1GBGA 2ZEWA 1W2AX 4AG4A 4AFMA 4D0QA 2Q5TA 2VTFA 4QDRA 2ZXQA 4XHBA 5I8SA 3UT0A 3D5OA 2HWE3 2XJRA 2CTVA 2D6NA 2EICA 1VMFA 4LPLA 3GGLA 3J26N 3I59B 4O65A 4QDQA 1J59A 1BYHA 1V6IA 3OJBA 1FOD1 5EQUA 1C8M1 2RVAA 2WNVB 4QPWA 2HEYF 4GMP1 3N9QA 2UY9A 1JU4A 5DZGA 5A1LA 3U4XA 2MPFA 1JYWA 1WMDA 5L36A 1ZRDA 3MLJA 2R1DA 1WW6A 1LHUA 1SHWB 1S55A 4XQWA 3N9OA 4FFGA 4Q1PA 3VBSA 2ILMA 1YIPA 4QXCA 5A3MA 1L7QA 1PM7A 4LBJA 4A6OA 1MS0A 2V5YA 3LIGA 2PFWA 5CKQA 3WV6A 1RHI1 2JD4A 4LE3A 4JQTA 1FI2A 3ZYHA 2AGSA 2D5FA 3AP5A 4HKWA 1LOGA 3RSJA 4BQ2A 2G9GA 2VE1A 1YI9A 1ZRRA 2W08A 1UF2C 2PHFA 1RJ7A 4CDWC 2Y8KA 3O1MA 3I3QA 5IVCA 3H1WA 4AOCA 3U37A 4WM8B 1Y9QA 3IDBB 2R0HA 1AR72 1AYM1 1H2LA 4H2AA 1LJ7A 4ONUA 3BOPA 4BLJA 1CPNA 3IPVB 1UZ0A 2Q8CA 4N43B 4QKNA 2A7AA 3VDDA 1R1A3 2WFF2 1QJX2 1Q56A 1MS9A 1QJU2 2CAUA 4YZ1A 2BWAA 5JSPA 1H2MA 5F39A 3SHRA 3R4DB 1HXS1 4Y22A 4ZU4A 2WJSA 2AREA 5FK8A 2R32A 3WP3A 4QQOA 1GQGA 2FHRA 2GH2A 2GC3A 2RV9A 3POJA 1S0DA 3O0XA 2I2SA 2E9QA 3B02A 1HV0A 3JQWA 2VXRA 1N1VA 4Z82A 4YVSC 5A33B 3V0AB 2HWD1 1QKQA 4AVAA 3I8TA 4YG0A 3J8F2 4G3YC 1T2XA 3WCSA 2JWPA 3BTZA 4K1YA 2VNRA 4LKEA 4CDUC 2YG0A 2W95A 4AGGA 5J96B 4CDXC 1KDKA 2XJVA 1EYBA 5C3PA 4MGYE 1VBE3 5IK5A 1W9YA 1W3VA 3K75B 4DNYA 5FYCA 3WDUA 5A3PA 1HJFA 4XF0A 2YC4A 3M3QA 4GJYA 3OD4A 1VBC3 1GR3A 1UU6A 4K8FA 1GWMA 2CY6A 1SG3A 3HJRA 1AR93 1DQ1A 2JDNA 2LS6A 1H6YA 1ENSA 4DEQA 4RGAA 2DVDA 4XVHA 4G4FA 4FPKA 2WZR3 5FLIA 4FXKB 2LUWA 4QPGA 5G04L 5FY0A 3ME2A 1ODNA 1SFNA 1XOYA 2X8KA 3AKTA 1YQ2A 4QB6A 4YGCA 1DFQA 4DUXA 5KHKA 5K0UA 2QQLA 5FZ3A 1MS8A 5KC5A 5A6QA 3L2HA 4I09A 1D4VB 4OHVA 2QQJA 3LA3A 2OUJA 4GWNA 4QPIA 1O59A 3NNGA 3EB7A 3IT8A 2R30A 2VVEA 3H9AA 4E2SA 4IL7A 2RS52 3ZDVA 1W8TA 1SLBA 3BUCA 3RI8A 5LASA 3T0AA 1RYYA 3WP6A 3TWIA 2VMHA 3WSOA 5FWJA 1VJ2A 4IV3A 4IE5A 3LD8A 1HB4A 5D2AA 2Q8OA 3ZYGA 3OPZA 1Z0HA 1YWKA 1HJGA 1NCQC 1E5IA 1GZTA 4YVSB 5CEHA 5FOBB 4YRDA 5HXMA 1NUKA 2HWC1 5JMCA 1EAH1 2AUYA 4Q4V1 5JPNB 1MQTB 3QCWA 4FPGA 1AR63 1XYOA 3M1HA 4LEJA 2ZJCA 4OUMA 4CDXB 4Y24A 4IESA 3BGAA 2XJSA 1CX1A 1W2NA 1VBB1 2OPWA 3ITQA 4A7ZA 2DFCA 4R8HA 3MDPA 5HI0A 5A3NA 1OI6A 5EYXA 4OI2A 5BNPC 4GWJA 4ES9A 1N1SA 3KT1A 1FMD3 4K21A 4JKMA 2A6YA 1G9CA 3LFMA 4QPYA 1EV12 3NJXA 1LHVA 2RDQA 4FOYA 1VBA1 2JG8C 3WP4A 1PO23 1RUI2 2PA7A 3WQBA 5J3UA 5KXBA 4ASKA 2BGOA 4HVRA 4AWDA 1QOSA 4KG0A 4WM7B 3ZYRA 4D7SA 1WD4A 5CZKA 3AKSA 5CAZA 2XBO2 3D6EA 2VC9A 1A8DA 1D7PM 4TSVA 2YPDA 1MEC1 4LIUA 1PIV2 4KU8A 4QQPA 4R52A 2GMEA 4ZU7A 2VG9A 3VZLA 4D7YA 5FDBA 1Q8VA 3CO2A 4DMIA 3VBHA 3OEBA 5FPVA 1COV1 2C24A 1JZ4A 5IVEA 3OSDA 3U10A 3ZPYA 1CAXA 2VMEA 5K7PA 3O14A 4YM3A 1UU4A 2JDZA 4F3JA 1G7YA 5FAXA 3BPZA 2E31A 1F9KA 1CAUA 1AL23 1KRIA 2VUDA 4DQAA 2O8OA 3NV1A 5FY4A 4LO6B 3LKJA 3SCHA 5JOZA 3Q8AA 1CQ9A 1ZBA3 4GQ7A 4FXGB 2B5HA 2RS31 4UOJA 3KVAA 4RGGA 1OD3A 3MW2A 4E4SA 4M0HA 4XE9A 3PVEA 2HEWF 2Y0OA 3UL2A 1A78A 3PUAA 1PVC1 4URAA 3BPSA 3WG1A 1KS4A 5A7WA 1HN0A 4ZONA 3H50A 2WS91 5F1RA 4TZDA 3I2FA 4Q4W1 1NY71 4BOWA 1JOPA 5ACA2 2V4VA 4JCKA 4YZ4A 1GQHA 1TEIA 3WLUA 4NIHA 1W9WA 2TEPA 4IETA 4MO3M 3POBA 4YARA 4OVEA 4AEDB 3VDBA 1R092 5LCWL 2CSGA 3M3CA 1TME3 5IK8A 2WINB 3LPFA 5BY5A 5LEJA 2IXJA 4PBPA 4N7UA 2ZHKA 4CSWA 2QTWB 5JSRA 5C9AB 4GXLA 4LHKA 4MGSA 1V6MA 1QDCA 3SITA 3CQOA 2RR12 3N9PA 1I6XA 1YO8A 2VZTA 3D82A 3GXUA 5E1RA 1ZBE1 5JVVA 5FOJB 3S5AA 3MICA 3KSCA 4B4RA 4Q4X1 4Y1YA 4AFAA 1EUTA 1MS1A 3B00A 5I0UA 4CCCA 1RUD3 4LMFA 1VRH2 4HG6B 4Z2AA 5FPXA 3BIWE 3MIFA 3GZEA 3WEZA 1APNA 2P17A 2AEYA 5IAXA 3LCPA 1LNSA 2LRPA 3VD4A 1RVF1 1JI6A 4GB33 4PDWC 5L7OB 2OQ6A 4LO7A 3ZX7A 1UYYA 3USUA 4QX0A 1H8TA 4Y22B 4SLIA 4GKXA 2YYOA 2CGNA 4RQPB 1RUF3 3IZOA 1DIWA 5EJZB 5FZLA 1W39A 1GSLA 1LOFA 1OMIA 1PX4A 2LTNA 2Y6JA 4AHZA 2PHTA 4FPOB 5I0SA 5C8CA 1REEA 3OBAA 2W46A 4MGKE 3UKVA 3T30A 3HOBA 3BCWA 3AMNA 4XJZA 4R9BA 1POV3 1V6JA 5C4WA 1PK6B 1S0CA 1WUVA 1RUJ2 2H0BA 3T3YA 4ARYA 1RUG1 3VZOA 3WHUA 2YV8A 1UU5A 2Y6HA 3U0ZA 2X10A 3D0SA 3H1YA 2ZACA 2Y64A 4ZXKA 1PZ9A 2VTXA 3EO6A 4LOTA 1WLCA 5E89A 3MZHA 4RFRB 3KT7A 1RXGA 4P5HA 2QQOA 1KGYA 2ZZJA 1VAKA 5FZAA 5DDJ2 4F7ZA 2D43A 1V9U1 1NXD1 1IQDC 3MF6A 3T09A 5JWPA 2VY0A 1W2TA 1W3XA 4PLNA 1LOAA 3AM2A 2RS13 5EIYB 1KFUL 1CZTA 1V6NA 1Y9GA 4XUNA 4NE9A 4XAEA 1OLQA 3VDCA 2YZ4A 2ATFA 2WNEA 1FX5A 4LBQD 4MGIE 1Y7BA 1JOJA 4BLIA 1GICA 1UXXX 2DTYA 2D5HA 2FCUA 2QBXA 4FPLA 4C90A 4PDWB 5FBZA 3GALA 3E6BA 4QU2A 2ZGQA 1ULEA 1QQP3 2PELA 3O0VA 3JBG3 3QOPA 4X6QB 5IUQA 3VBUC 4EWEA 1RUE3 5DQ0A 2V5DA 4N53A 4AE2A 3JCIA 1H6XA 3CU7A 5ANQA 3JB4C 2XPJA 4Q4Y1 1G8WA 1RITA 4X8PA 4CVUA 4D6QA 2Q1FA 5FMDA 3NO8A 4QMAA 3KQRA 3BN6A 3ZDSA 4FPFA 4H14A 2P2KA 3KT4A 4WZCA 2GP3A 4QQHA 4YWAA 3I3BA 3MUY1 2HWB3 4JTOA 5LWBA 3A0KA 4XFIA 4EWAA 1LHOA 3HNYM 3G7DA 1TG7A 3OGVA 4IEYA 5HCBA 3WQ1A 4BMEA 5F3CA 1AUYA 2QVSB 3AKQA 4Y5TA 3ETPA 1NLRA 5JI7A 1EUUA 1AX1A 2RMU2 2DCYA 2YMZA 4XUQA 4LR4A 1NLQA 2ENRA 3LSEA 5FYIA 4FPHA 4HL0A 3MO4A 3RYRA 4KG8A 2XVKA 2YDEA 4AFCA 5EYYA 3FN9A 3RRDA 3N36A 3RZGA 1CWPA 5F3EA 3H1MA 3FFQA 2ZX2A 2IZWA 1QH7A 1JMUB 5JZGC 1QU0A 5A7SA 3T4HB 1D4M2 2VH9A 3OBTA 2J42A 1HB1A 1W06A 4L9BA 4AFBA 3Q8BA 2DUPA 2ZEZA 3VHPA 2VZRA 1W03A 4TYSA 3T1LA 5CA6A 1ND3C 3NKGA 5FRAA 4PT6A 3WW3A 1ULCA 3JZVA 5IYYA 1O3QA 2K0GA 3DECA 2Q8DA 1X9PA 4BYYA 4GALA 1TMF2 5DUUA 5JXIA 2QKDA 3VBHB 3PU8A 4X8NA 3VZJA 1AR73 3B69A 2H0VA 1UY2A 3CJIA 2A3XA 2RM22 4YW2A 1CAXB 1ENRA 4AAPA 4NUBA 1HRV1 4YW7A 4CCKA 2ET7A 4KQ7A 2QDNA 4UXAA 2BBAA 1CAUB 1WLDA 2WFF3 5FV3A 1YFUA 4XW3A 1QJX3 1UKGA 1QJU3 3AVRA 3QH7A 4PQQA 3W21A 1O8SA 1ULOA 4JVAA 2VNOA 4IEWA 4JDMA 1C57A 3ZXEA 1QNYA 3VN4A 2EIDA 3TAYA 1UW8A 4HKLA 5FLHA 4NPLA 4Z8BA 3VKFC 3S7IA 1U5XA 3K48A 2AACA 2TBVA 2R062 4QQ2A 5CADA 2ZTNA 4LNVA 3S7EA 5EJ1B 3AMPA 4MLOA 1GZCA 3J8F3 5G05L 5FYTA 3WD5A 1DGWA 4ATFA 1NCRC 1K3IA 2XDVA 3CLPA 1W6MB 3G6JB 3NJYA 2VZUA 4R4XA 3N7MA 4ZY9A 3VHNA 5B4NA 3ASIA 3TEYA 1VB2A 1XNKA 3ZFGB 4DO0A 5KBFA 1XE8A 4MV2A 1RJ8A 1QXPA 4Y33A 1ZA4A 1RUH1 4LA2A 3UESA 4MYEA 3AKRA 2VPVA 5F37A 1W8FA 2JG9C 2GAUA 5A7NA 3SH4A 3EXUA 1HRI1 3E1F1 2Q1MA 3LEIA 2JDHA 1F31A 2VJXA 4P9JA 1GU3A 4QB2A 4D69A 3FL7A 2JEMA 3VL8A 2MEV1 3VLBB 5JI9A 1ZRFA 4BQ4A 4AHXA 1POV0 4KU7A 4I3PA 3EHKA 4PF1A 3VZKA 4COVA 4E27A 2RDSA 2XXZA 3ACHA 2NMOA 4IV1A 1TNRA 3AFGA 4RGKA 1J3RA 5ANNA 1Z7S3 5FP3A 1UPIA 5BUVA 5CFCA 3HEIA 3NAPC 4NHMA 4XPVA 4OYUA 3NSTA 3ZSEA 5T54A 2ZGPA 5FZ1A 3B9CA 1YJKA 3PTRB 2RS53 3RG0A 4RS5B 2G19A 4XACA 3ZMNA 3O1SA 2WBKA 4EN9B 2Z2SB 1BK1A 3MLLA 2GC0A 1WD3A 2G4IA 5FP8A 5FQ0B 3GDBA 5BNNA 4CEYC 2NQYA 3AP6A 1NA1C 4IGQA 4B4PA 3C7HA 4MGQA 4NRPA 1W28A 3MW3A 1K5MC 4AEMA 3ZN5A 3MF9A 3MFCA 4CEWA 4GH4A 1DU3D 2OKXA 1QJY2 3PUSA 4OI4A 4QQLA 1AYN2 3CKHA 5FMBA 5C4WB 1OOPB 1MS5A 1FPN2 4AI2A 5DN2A 2VGDA 3UNPA 1R1ZA 5LBCA 4N7IA 3IDCB 1F5FA 1ND2B 1RC6A 1JS9A 2R071 2WDBA 4QXBA 1KXGA 3ZSLA 4IE4A 4OZOA 4G9SB 1WCSA 2IFRA 5L9RA 3P3NA 3I2GA 4D6SA 2JG9B 4FO9A 3VL9A 1EV13 1VE0A 1VP6A 1DLCA 2P3KA 3HQRA 4BQXA 2E51A 4P9WA 1SDWA 5C7GA 4LBLA 1PO11 4XDOA 2A75A 2HWE1 4RR3C 1XU2A 3HQXA 4LE4A 4CUBA 2ZMNA 3MV11 1US2A 3BU7A 3PDQA 2XBO3 4HFSA 5F32A 2VUCA 5CFDA 2DVFA 5ISLA 4XUPA 2FD8A 2D40A 3IDEA 3RWKX 1PIV3 2KD7A 3AYEA 4Y20A 3A7QA 4XYXA 4RSUA 1H1AA 2WO2A 4Q0SA 4RA0A 4N53B 4DY3A 4JGYC 1F4AA 4M3CF 4NHXA 3S6PA 4IERA 3AFKA 2H6BA 3SCGA 2E53A 1AL0G 2H6CA 2Y38A 1GOGA 3NJVA 3ZXKA 4CP1A 4XQ4A 5LK7B 4W4ZA 1ZRCA 5FTTC 3AMMA 3ZFFC 5HPOA 4IEUA 5FJKA 2ZKNA 3ZXAC 2BGCA 5FO9B 2FZ1A 1K5MB 4J1XA 3SC7X 2QZ3A 5T50A 3BALA 5FCCA 2FDGA 1WW5A 4M00A 2FZ2A 1Y43B 1FNYA 2XQRA 4MXWA 5BXXA 4HMZA 4EJRA 2UWCA 3THTA 3V56A 5JOXA 2JENA 3GZTB 1NZCA 1SFPA 2VCAA 4O9GA 1HXS2 5ACA3 1CGPA 2XB6C 3K4AA 3KHCA 1CX4A 3W5MA 5FZ0A 2RDRA 3ZFEC 2JX9A 1F15A 2UWAA 4IEVA 3DYMA 3RDIA 3SLIA 2QQPA 5FY1A 1H4HA 1R093 3KD4A 2XOMA 5C3OA 2BUKA 4UT5A 3WG4A 3T08A 3TN91 3OGJA 4B7EA 2ARXA 1OH3A 4LBNA 1SFYA 2PHUA 4B8EA 5JSOA 2ZGUA 1LHNA 4O9EA 2RE9A 2DBNA 4XCAA 3MLKA 5LB6A 4CCEA 3RYPA 2DVGA 1XB9A 2JDPA 2NZ9A 3MGUA 4QKFA 4MSVA 4LBQB 1LGBA 4NAMA 2RR13 3ACFA 5DZEA 4RL7A 3R05A 1IS3A 3PJQA 4IDZA 4RHV1 1JYTA 3FLPA 4UAPA 1OVSA 5FR3A 4BQ3A 5LATA 4CDWA 2PLV3 1PGL2 4HANA 5BYNA 5CIRA 3ZN6A 1VRH3 1XE7A 4XF1A 2CGPA 4ATEA 1IKQA 1GP5A 4P02B 4PF5A 1VBE1 3SEEA 2CDOA 4LKSA 2QZ2A 2UY8A 1L7LA 2Z69A 3GF6A 3POGA 3ST7A 2CYFA 5A1AA 2ZX3A 3RZKA 3K46A 2WNVC 2VW0A 4YGBA 4M01A 5IW0A 1AR91 4XZUG 1QJEA 4DB5A 5IVYA 5H9PA 5LA0A 1W9FA 2DVAA 2EIBA 2WZR1 4MUVA 1O8PA 3HAGA 4IEQA 2D97A 2P1BA 1Q8PA 5FUIA 4QAWA 4CU8A 4OZXA 1XNDA 4A7YA 3CJXA 3L2YA 4YVWA 2JE9A 4JHZA 5F3IA 5F3GA 2IUWA 3J9SA 5A7OA 1RUJ3 2W68A 3DCQA 4L92A 1ZZ7A 1WLTA 5JDBA 3HBKA 4Q0VA 1B35A 2HWC2 2UURA 5I0DA 2D3PA 4Q4V2 3CMGA 3O1UA 2VM9A 4K6BA 5A7PA 2VTXJ 3VD5A 5DAWA 2IXIA 5FMOS 4PQ9A 4Y1VA 5DDJ3 3P1IA 3AL6A 1ZZ6A 4AHYA 2YC2A 5FJHA 1RL3A 4WM8C 4K3UA 3FHAA 1MZEA 1OH4A 2FDKA 4FSJA 2WN2A 1VBB2 4PLMA 5C70A 3B3QE 2DF7A 2VNVA 4N43C 3BTYA 1HQWA 2G9FA 3VBRB 2J1AA 5KHJA 4CCMA 1AR61 1S0JA 3P6BA 3WOGA 1H9PA 3MBWA 3ZO0B 3VBOA 1VBA2 2PYTA 3A0NA 1UWWA 3O1PA 2VMGA 4PI0A 1VALA 3OY8B 4LLOA 4N90A 3S5QA 2XONA 4BH9A 1CONA 3WNMA 5FZMA 3AC0A 3I3EA 2Q4SA 3AX4A 2VW2A 1UYXA 2B42B 1FMD1 3DXTA 4QDSA 1W9TA 4UYBA 5BNNB 5A3TA 1QY4A 1PO21 1GUIA 4XURA 5C5TA 3LEGA 4NIAA 3NV3A 3RVHA 2WZEA 4MGZE 2WNUB 5AVPA 1TQ5A 4CEWB 5F5QA 3VD9A 2X5IA 5IVFA 3OYWA 5K8SA 5EFUA 5J1XA 1G9AA 1C5IA 3H7YA 4M3CA 3SH3A 1JZ6A 2VBPA 3GHNA 5T55A 3MIDA 5LBBA 3C2UA 4YZ2A 3PIGA 2RMU3 4L8QA 4W50A 2EF6A 4NHKA 5DABA 3H8OA 4NO4A 2HWF2 4Q29A 2GNMA 5FPZA 4B1MA 1NQDA 5KWRA 1I9RA 1UXZA 4LITA 3C7OA 4RN5A 5GM0A 1IS6A 5LRSA 1WLWA 4IW3A 4F8AA 3BIEA 3WUCA 3ORJA 5BNPA 2ERFA 2IXHA 3WW2A 3CIHA 3KV4A 4UW6A 2J1VA 1AL21 4W65A 4BQ1A 1D4M3 1NY72 1H2NA 5GLWA 2VCCA 3C7FA 5GJ6A 4AQ6A 2JG8A 4GWMA 1J1TA 1O4TA 4V2VA 1JYXA 4IE7A 3JD73 4ZXEA 1UY0A 2WSUA 5FUPA 2J1EA 5HCFA 4CYDA 4A7KA 4DXRA 1F2NA 4LO5B 4BCUA 5CFDB 1O4ZA 4XJ9A 4O7XA 4LHNA 2C0ZA 4YW3A 4Y20B 1EPWA 2WT2A 1C3HA 2VMDA 3ABZA 3OD0A 5A7QA 3T0BA 4BXFA 4E4DX 1TMF3 5CG9A 5CISA 3RJ2X 4MH0E 1XXNA 2QQVA 4J25A 4COWA 4XETA 2RM23 2XWJB 5EHDA 1KD7A 1LTEA 3WDVA 2WIIB 2A71A 3WINE 1QDOA 2O8QA 2ZAHA 3INAA 1TME1 3JQXA 5DUVA 1MQTC 1AX0A 2FCVA 4HSJA 1YCIA 4Q4X2 3UKTA 3GNEA 2VVFA 1OURA 4NHLA 4NIGA 3IM0A 2DBIA 1NOVA 2EXIA 3MI8A 3BU0A 3B5LB 4R9AA 3T1MA 1O5LA 1N3OA 2ZEYA 1W6PA 1G9FA 1NLSA 2BJSA 2IVIB 1SBFA 3SH5A 1RVF2 1GNZA 4UF0B 2B9UA 3RWNA 2DFBA 2YBKA 2WAAA 2R063 3D4KA 1M06G 1DGRN 4YFZA 4JX0A 5BNOC 1XNAA 2BNMA 3KMHA 1R081 3VZNA 1IG0A 4R9CA 3W59A 4ES8A 4XF3A 3E5UA 1NX9A 1X33A 4W6YA 2XVLA 2E7AA 2BQPA 2WWSA 1W6NA 4WM7C 1DGRA 3N7JA 3I2DA 2BVVA 4GB31 1SMVA 4TLFA 2X09A 5DAPA 3OEAA 1YXWA 4QM8A 3WW1A 5JLVA 1J58A 1W90A 4QGMA 4XHXA 1ZYBA 5F9TA 4GJZA 2D6KA 2OUHA 5D8AC 1RUF1 1UZZA 5IT6A 1QEXA 1W6OA 3BYWA 4U36A 2EVXA 2FDJA 4Z1VA 2J1SA 3M2MA 1CZSA 1VRBA 1GZWA 2VL4A 3OPWA 2NMNA 3H7JA 4NMIA 1KJLA 1O6UA 1CAVA 3O1RA 1OQDA 1POV1 4QX7A 2YROA 3ZN6B 2ORXA 1V9U2 1CESA 4W6XA 4Y5Z0 1G6NA 4BQWA 3K3OA 1MVEA 5JAXA 1ULGA 4E8CA 2W1WA 3O1VA 4K1ZA 3I7DA 2QNKA 2WC2A 4IQPA 3M70A 4XFFA 4ZS3A 4DXSA 2BYVE 3N9MA 4WZFA 4BE3A 4ASLA 4P9LA 1VAMA 2AZ5A 4CDQB 2P3YA 2VQUA 4NROA 2WNOA 4CP9A 1L7RA 1JW6A 5F7UA 1DP0A 1MZFA 1SZBA 2O1QA 2R041 2RS11 2XMLA 1WMFA 3MV01 4HN1A 1YHFA 1PX3A 4I0BA 1TNFA 1OLMA 1W0PA 2GNDA 1AJOA 3NNMA 4XBQA 4A3ZA 3ZR6A 4AEDC 5BNOB 2FDIA 4HOOA 4Q4Y2 1QJY3 4FPEA 4KNCA 1H0BA 1V6KA 1W8UA 1W04A 1FPN3 5FZCA 5C33A 4Z2WA 2J1UA 1LOCA 1GQPA 3AL5A 5DAVA 5C9AC 3WG2A 1G9DA 3D0JA 1B35B 1QQP1 1SBEA 2ZHLA 3JBG1 4TN7A 1J1LA 5AC92 1LESA 1RUE1 1LGNA 4XBLA 3NVCA 2YBSA 4HVQA 5D8AB 2FDHA 5LEKA 5FPLA 2MNGA 4UBHA 4KWJA 5LA1A 4YM2A 1ENXA 4MADA 2XHNA 4WV8A 1ZZ8A 2DVBA 3MUZ1 5IHRA 3RI9A 3USSA 4W6WA 4MZUA 4Y26A 2HWB1 3W58A 4AGVA 5L7OC 1VLNA 1ZZCA 2WN3A 2YFUA 3AVSA 1V00A 4S2FA 3AXDA 3LA2A 2ET1A 4FOQA 4SBVA 5LBEA 2RHPA 1N3QA 2DCKA 2VECA 4RQPC 4LO8A 1OC1A 2ES3A 5BNQA 3WNPA 3JXSA 3SISA 3KF3A 3ZIWA 4EZHA 1CIYA 1DQ2A 3MIGA 3OGGA 3D8CA 3FZ3A 3KGZA 1WCKA 3UKNA 3VBUA 4DRRA 4MOAA 4CCJA 5B2GB 4H7LA 2P4EA 1VBD1 1QGLA 2XLFA 1CD3G 3PIJA 4PIYA 1PK6C 3LZZA 4M0NA 2X5IB 4Y1XA 1QMJA 3VBSB 2GN3A 1PM4A 2HBTA 2CWMA 3HBZA 3WF2A 4A2UA 1FT9A 1I5ZA 1IHMA 1HRV2 1F5JA 2ZHNA 3ZIXA 4E9KA 4YZ5A 2F4PA 3K77A 4P00B 1SLCA 2W3JA 3ZMOA 4IEPA 3H3UA 4YW5A 2Y6FA 3U14A 4RD7A 1AR82 4QB1A 1AR71 2C4XA 3ETQA 1XE0A 4L0PA 5GALA 5IWFA 2XJPA 2VOXA 3ZXGA 3WDXA 3M3OA 2WFF1 5JZGA 5JXGA 3PVBB 1FV2A 5J37A 3VDDB 3VHOA 1LAJA 5FXZA 3N7LA 1JYNA 4HLTA 1Y9MA 1HIXA 1ENQA 5F2SA 2JICA 1M4WA 1ND3A 5JMOA 5A3WA 1SLAA 1RUH2 1RXFA 5FP7A 3IWZA 4JRAA 3J8F1 1BBT1 3P3PA 5DAQA 3WDYA 1RUOA 4LULA 1BHGA 4ZS2A 5FZBA 3RPQA 1YEWA 4EN8B 4K9SA 5JOWA 1K5JA 3ROUA 2BOIA 1JXNA 3N4MA 2R0FA 2A6VA 2PHLA 2XWBB 1JZ3A 3LEMA 3LB9A 1MPXA 3FX3A 3GHMA 4IEXA 4UFMA 3WDWA 1UPSA 3NNFA 1W6PB 4FFFA 4AVVA 4GWIA 1S0GA 1SQ4A 2XJQA 3HVDA 3AKPA 5A80A 1FV3A 2JDUA 1XYPA 3MHZA 3AMHA 4OHWA 1WBFA 2WABA 4EROA 4Q2FA 1EPZA 4A45A 1RMU2 4LO4B 1Z7S1 1HB3A 4DFSA 4DPNA 4Z92B 4QPGB 5JIUA 1GNHA 5DG1A 3HMYA 1NCRA 1UOJA 2JD9A 2OA2A 1IKPA 1XYNA 4JC1A 4RYDA 5FZKA 5JIAA 5K0UB 4JDOA 4O61A 3GZAA 2FDFA 2P3IA 2RS51 2HWC3 4I01A 4YW1A 3I2OA 2ORZA 3TEWA 4Q4V3 1JH5A 4QPIB 4ARXA 1W6OB 2BV4A 2UWBA 2W9XA 3LDRA 4Q26A 1BEV1 4NAOA 1XPWA 3VBHC 3VV1A 2WO1A 2R072 2PAMA 1FXZA 3TYJA 3H0OA 3M7AA 1VBB3 4AFDA 1DBNA 2QQUA 4IV3B 4CXYA 1CAVB 3F2ZA 3ZXJA 2DU0A 2QE3A 3VDAA 1WA6X 2W92A 4WBBA 4CUCA 4FOVA 3HT1A 2R1BA 2WYFA 4YW4A 1SPPA 1VBA3 4OHYA 3QACA 2VQTA 1PO12 4YYOA 5GKAC 5HBAA 3THDA 1YQ8A 2OW4A 3NAPA 2XJUA 1UN1A 5FBJA 2BDRA 3WDTA 4E8DA 1OQ1A 3FBYA 2VCBA 5FZIA 4UI9L 2YBPA 5A70A 5J09A 1EV11 3ZSKA 2PMWB 4AXOA 2VAUA 4BJ0A 2VZ3A 2HJIA 4FI9A 5FYUA 2Y33A 2EXHA 3ZFGC 4MGTA 5FZ4A 1NA1A 1QIQA 4AW7A 3DUIA 4NWVA 1GWLA 1JHNA 1ZVFA 4KI5M 1PIV1 1S0IA 3MFAA 2GN7A 2HLEA 4AEJA 2XHKA 2HWF3 5J98B 2AENA 4COUA 1OT5A 1W2OA 4R4ZA 4UBGA 1IPKA 1WCUA 2CWSA 4P9GA 3HT2A 3KWVA 5EJ3A 2JE7A 3QD6A 3LQCA 5ABJA 4KBZA 1XNCA 1JZ7A 2XKOA 1IZ3A 2IC1A 1X50A 1JODA 1BVVA 1K45A 2BU9A 2HKXA 3N9LA 2YGLA 3DKQA 4CCLA 2A3WA 3ACLA 1VR3A 4QX2A 2O14A 2JDKA 5LW9A 1DZQA 4FVVA 5FYSA 4AHWA 1H8TC 1H4GA 3ILRA 4XFAA 1W0OA 4ZU5A 5L9VA 2A70A 4RR3A 2HH9A 4C8DA 4RS5C 1UMZA 2YY1A 4Y1ZA 5FZ7A 4KH9A 4EN7B 4L2NA 3FMGA 3TN92 2WZPP 1OPOA 4AZZA 5FFOC 1DGLA 2VO5A 3POEA 5ACA1 3OB8A 4GA9A 4XJ8A 4EV0A 4HK9A 5A7WB 3VB9A 2EXKA 2NN8A 1CZVA 1R091 2AH2A 4JGYA 2WAOA 3DPRA 1UZVA 4RHV2 4FPCA 1OOPC 1V0AA 4JKKA 1WMXA 4XFCA 5C4WC 3O1OA 3O12A 2JECA 4NWWA 5KXDA 1X8EA 5GZEA 3ZFFA 3KGLA 1VMHA 2W94A 1SEFA 2YFZA 2R16A 5CB7A 4IGOA 4AI9A 1ND2C 2DCTA 1OA2A 3KV9A 4JGZA 4AAXA 1D2SA 1U5ZA 1GOFA 1UAIA 1J84A 1W05A 5D21A 4BPZA 3T2QA 4CXWA 4Q1RA 3CNAA 1CJPA 1JYIA 2FCTA 5A32A 2ZGLA 3ZYPA 2PHDA 2GC1A 3PLQA 3AYDA 4LHSA 2UU8A 1PMHX 2PLV1 1AVBA 3OUJA 4XTMA 1VRH1 3CL1A 3H8UA 1LOBA 1OKQA 1UL9A 1W8OA 2B9VA 2XKPA 3HNBM 4QXKA 4BIFA 2ZGKA 4J1WA 1RGSA 3K51A 1AZDA 1H8VA 1S0FA 2VOTA 5DXDA 3ZPOA 1WA4A 1E5SA 4FQ4A 3V64A 3ZFEA 3R0RA 2P6CA 3LOIA 5FMOL 3T4VA 4MG2A 1ASJ2 1O91A 3C8XA 4HVOA 1QWRA 4BK4A 1HKDA 4LUKA 5APAA 3RYKA 4ASMB 3URFA 1Q8SA 3USUB 1YLLA 1H8TB 4JAAA 2RDNA 4N53C 1QXJA 2K2SA 2ZGTA 3DL3A 1RUC2 2VR4A 3IIAA 1AJKA 2WQ4A 1LHWA 4E2GA 1TZOA 4ISRA 4AI8A 4OHZA 3FFZA 4A41A 2DU1A 4OHXA 5SV5A 1HW5A 4DS0A 4PHZA 4OI0A 1U5IA 3ATGA 4H3WA 5F8PA 3VBFA 3ZYFA 1RUJ1 2C9KA 5C8CB 4Y5SA 4KWLA 2XUMA 4XXAA 5FPUA 2FQPA 2Z5WA 1US3A 3THPA 1C1FA 3I49A 1I3HA 5KHIA 3T2OA 3NQHA 5T5PA 2BW8A 5FLJA 2DUQA 3KV5A 1KFXL 3LA7A 3ZVXA 2D98A 4LIVA 1YI7A 4XUOA 3B9IA 1WWYA 1DZRA 2WSVA 1NE6A 4XIOA 1E5HA 2GU9A 5A3LA 2BFUS 2JE8A 3M3EA 1FOD2 1DCSA 2GMMA 2VMIA 1FMD2 4FFIA 1C8M2 3I54A 4XC9A 2NLRA 2CNAA 2VZVA 2WZ8A 4Q4Y3 1RUI3 1YIFA 2DYCA 1UZYA 1AXZA 1HB2A 2PN5A 3R4SA 2TNFA 1OXCA 2KR2A 2XL7A 1YUDA 3APBA 3CZUA 1E5RA 4XBNA 4TTGA 5AC93 3FUQA 3H3ZA 4NRMA 5FO7B 3S0MA 2P34A 4AK3A 2Y34A 1CN1A 4JZRA 1UYPA 4CU9A 3ZR5A 1RHI2 2OIIA 4DY5A 1TVGA 5HV4A 3WNNA 4CPBD 2WWUA 3LFIA 1N3PA 1UD1A 2EIGA 5BPXA 2R49A 4U2AA 1BKZA 1PMIA 2LM3A 1UY4A 3SXWA 1OSGA 3IPVA 1S2BA 1UX7A 4N43A 4C0HA 2A6WA 1PZ7A 3TEXA 4NR1A 1AYM2 1UIKA 2A73B 2RMU1 4QHOA 4QX5A 5I0TA 4A42A 5J36A 4P9IA 3BB6A 3HD8B 3VKNA 4N9IA 2J7MA 4YG6A 1OLRA 2XG3A 2ZCWA 4AR2A 3PVOA 3MIHA 4D8MA 1NYWA 1YQCA 3V0AA 3KB5A 3ZM8A 2BRTA 5A33A 4YFWA 1D4M1 1XNBA 3LSDA 1LB2A 3MYXA 1C8NA 1UIJA 3O0WA 2J22A 3JD71 4HT1T 1R1A1 5EXOA 1PNGA 2KXLA 3PTYA 1BMV1 1S4CA 1J3PA 2HWD2 3LEKA 2WR9A 4C0BA 4PI2A 1HRV3 3FJSA 4YW6A 1YFWA 1LODA 4HBNA 4LXLA 2WLPA 3CDZB 4S2DA 1WZXA 1AR83 3EYPA 3RMXA 2ZHMA 1VB4A 4YM0A 2VOWA 4DXZA 2VZ1A 1W8HA 5C8WA 4NIDA 4XILA 2RM21 4QWNA 4W8JA 2CDPA 4ITCA 2QUOA 2SLIA 3ECQA 3BTAA 3VBRC 1XJAA 1XQNA 3FWEA 5FY5A 4CPBA 5BV6A 5FKCA 1SLLA 3CJIB 2VD7A 5FYZA 2AYHA 4UW5A 1R082 4XTPA 1GANA 5CFCC 1LENA 4HSLA 1BK0A 4MX3A 4XF9A 4AVTA 3HN3A 2NYYA 4LJHA 1LU1A 3PMEA 1PZ8A 1OUSA 2BWCA 1H1IA 1AXYA 3GBFA 4GB32 3VD3A 5JUVA 3H8RA 2A6XA 5GZDA 4S2GA 1IS5A 2YU1A 5D1IA 1VBC1 2R061 1CVNA 3WY6A 4ZPIA 1OKOA 4NPMA 4UFJA 4XZPA 5BNNC 2WT1A 4OULA 2BZDA 2LALA 5SV8A 4LBKA 5FZ6A 1QNWA 5L73A 1WW4A 2WNUC 5KXEA 3DV8A 4FP3A 2XL9A 5EWSA 4UFKA 5J7MA 4CEWC 1REFA 4PJYA 5LA2A 1U0AA 2VCMA 2XVGA 3N9NA 3UGGA 3PNAA 3DPRB 3GBGA 4FFHA 4PIZA 4XIKA 4YVSA 1N1YA 3I3DA 4QX8A 3LOBA 4XJUA 1ZX5A 1MQTA 3BVCA 4LK7A 3WX5A 4FTEA 1JHJA 1Q43A 2DUOA 4CDUA 4LTAA 3FLTA 3J4UH 3WF4A 4EYUA 4CDXA 1EAH2 4CE8A 1MZ5A 1YJLA 2CL2A 2W52A 1O3SA 5A32B 1BXHA 2J1RA 1ZNPA 1W9SA 3LAGA 1GLHA 4WVMA 5F2WA 1JU3A 5GLVA 4PBOA 3UGFA 4CP2A 1Z78A 3WCRA 1RMU3 1QXRA 3IDAA 3WF0A 3I2KA 2R042 1HQLA 4NRQA 5LZ6A 5FP9A 3FLRA 3TOJA 4FPJA 4WM7A 1X8MA 2C9AA 1RTVA 4IV1B 5JR7B 5CFDC 1Q8OA 5CFCB 2XGXA 4UFHA 5CKMA 2A6ZA 5DMYA 4OQ9A 1JYCA 1J83A 5EPAA 2OPKA 4KMQA 5HXVA 3OCPA 5FY8A 2VMFA 5IK4A 1ULPA 4C1XA 1QQP2 3I3MA 2GALA 1O5UA 2OS2A 2W1QA 5I8YA 4A44A 5JR2A 3PVNA 3RFRA 1MEC2 2K46A 3ZXFA 2Q1ZB 1QJY1 4HKOA 2DCJA 1ODMA 1WW7A 2SBAA 1IG3A 2WL1A 4I0WB 4N9HA 2BEOA 4BQYA 1IPSA 2JB8A 1FPN1 2JJ6A 3VBFB 1UYZA 2ZEXA 5AFEA 4PLOA 5KR7A 5IVJA 4I02A 2D6MA 2OQ7A 4GH4B 1COV2 2E6VA 5DUXA 1NCQA 3W9AA 1PO13 5C3RA 2HWB2 4YSFA 4XAAA 3N35A 2IVJA 2WT0A 3HQUA 5FKBA 3ZYJB 4NHYA 2L9LA 2VVDA 5KC6A 3PMSA 1O7FA 4JTNA 5DPNA 2KM2A 1GOHA 5GZCA 5FP4A 1F35A 2XUEA 2F17A 5IATA 2NP0A 4E2QA 2RS32 4ISQA 4QX3A 3WF3A 2BOJA 1OPMA 4LA3A 4XEZA 5F5CA 3KS7A 1PVC2 1WCDJ 2VULA 2WS92 1K42A 1W99A 4Q4W2 3WW4A 1UX6A 4IUGA 1JOBA 1VBD2 4AEDA 4K7JA 1Y3TA 2WA3A 1ZBA1 4FTBA 2PAEA 1A34A 1OUXA 3AZVA 3VGIA 5C9AA 1S2EA 3GJBA 3H42B 3FE5A 4YGEA 3KCXA 3WNXA 1GFF2 4BXSV 2W47A 4AEKA 5AC91 1NAEA 2JKXA 1PNFA 4DOUA 1RIRA 3MIEA 1PGW1 5FXXA 2P37A 3WR0A 1C28A 1UMIA 4QKBA 4QHBA 1MACA 1N1TA 1ZBE2 3J7LA 2ZPXA 1JUIA 4KL1A 2JKBA 3ACGA 2W87A 4P14A 3ZN4A 3ZYIB 4BU2A 5JCTA 3VKLA 5L7OA 5ERLA 1X9TA 2LROA 1DLLA 3NV2A 3TN93 4CDQC 3SEPA 4QD2A 2OT7A 4FT8A 1X7NA 4MXWB 4FOWA 2Z4FA 1W8WA 1XRUA 4RFT0 4RQPA 4NOTA 2EIEA 4CUAA 3GYDA 3VKMA 3SMHA 4EN0A 1XNTA 3IMMA 3SKJE 4Y4YA 2I74A 3AZXA 1S1AA 4AGRA 3KZ4C 1V70A 1JN2P 1RUD1 3C7GA 3CEWA 4YVWC 2B39A 3W20A 5FZDA 3WG3A 4RHV3 1BBT2 3EQEA 2WUHA 4BHPA 4ZZ8A 4MXVA 4KGQA 1PK6A 4OQ8A 3LGRA 1B35C 5FXWA 4XMIA 4OMDA 4Y4RA 3HPNA 4LBMA 5FREA 2ADDA 2VXJA 3I2IA 2W0XA 2B8MA 3A4UA 3TRSB 2NM1A 4QT6A 3TB0A 5T5LA 1RUG2 2VOVA 3VUOA 5IAVA 4FPYA 4DEVA 5FPAA 1PGL1 5DG2A 3KVBA 2YUEA 4AQSA 4AI3A 4P9XA 5CG8A 3ELNA 1WBLA 5FZHA 2ZMKA 3LF7A 5C71A 1W8ZA 5LRRA 2C26A 3F95A 2I07B 4WVZA 4CDWB 2VBBA 3VBOC 4CCNA 1ASJ3 1OFSA 2QJVA 4AF9A 4AQTA 3IAQA 1Z7S2 2B46X 3H3LA 1A3KA 2TUNA 3E5XA 1SCSA 3NNJA 3HN1A 5J48A 2GSYA 2QCSB 1O3TA 1SLIA 3JB8A 1NT0A 3GZUC
chains in the Genus database with same CATH topology
4PDWA 1RUC3 1O4YA 2BBVA 2XJTA 3FUOA 4AVSA 3BOWA 1KITA 3E6DA 2GC2A 1BEV2 3AK0A 1DQ6A 1LU2A 2XLGA 1G86A 3EJKA 2X5IC 2YGMA 3VBSC 2IXLA 1YFXA 4XJWA 4YVWB 1AYN3 1QJZA 3ENRA 3B93A 4BA6A 4CDUB 1GYKA 4YNIA 2V09A 3O5SA 4F83A 3UK9A 2ZX0A 2YXSA 1B09A 5CU1A 1CPMA 4YGDA 4AI0A 4J6GA 2QDRA 1EP0A 4S2HA 3FBMA 4WVMB 4CRQA 2ZBJA 1FOD3 1C8M3 4GMP3 4FP2A 3VDDC 2EAKA 1FYUA 4OFGA 2PHXA 1IGOA 5CNAA 4ORFA 4Q8LA 1LGCA 3FHIB 4XFGA 5E88A 5GLZA 4K40A 2C1FA 2ZGOA 3VBOB 4TWTA 2V73A 4DZGA 1E57A 1RHI3 4XFBA 1PVXA 2PQQA 5TSWA 3TNPB 3WVJA 5I8TA 1VAVA 4EN6B 2CGOA 1EY2A 2ZMLA 4XQDA 3BODA 2IXKA 3ES4A 1LULA 1W2UA 3S30A 2PHRA 4CP0A 3WHTA 1BQPA 5GZGA 1ONAA 2Q30A 3EBRA 4YG3A 1AYM3 3OYWB 5KXCA 1NCQB 3ES1A 4M3CB 5AFBA 2HWF1 2BNOA 2VQAA 1I1EA 4HK8A 1OHFA 5DUWA 1HXS3 3WQ0A 3QBQA 2ZS6B 1ULFA 1BVP1 3POSA 4QPGC 3UV9A 3GBWA 1SACA 2ZGSA 5BNPB 3C3VA 1W6MA 3IBMA 5K0UC 2HWD3 1QJX1 3ZFGA 1QJU1 2JG8B 4Q0QA 4AQ2A 2Z42A 4QPIC 1Q3EA 1AX2A 4CZSA 1Q5OA 5HCAA 3VZMA 1MZ6A 1HDKA 3U11A 3UJOA 2K9ZA 4IV3C 3SNMA 2VNGA 1O3RA 5KHHA 2E63A 5I93A 3AZYA 4LUMA 5CVRA 3TNQA 4B7KA 5GLUA 1HRI2 4AVBA 4B29A 2PLV2 1R083 4URTA 4FBFA 2HYKA 2MEV2 1UKRA 3IN9A 5JOYA 2BVBA 4HN0A 4AI1A 2ZZQA 2BTVC 2GH8A 4GKYA 3KM5A 3NKTA 4RS5A 4MVTA 1HQNA 3NV4A 4NVPA 1LCLA 3WP5A 3POYA 1W6QA 5FQ0A 1YFYA 5T52A 4BIOA 1V6OA 1NG0A 3DKWA 2DTWA 1MS3A 3KLSA 3KCYA 3R4UA 2UYBA 1NXMA 3NWKA 1W6NB 3HIFA 4KGGA 1OOPA 3VKOA 4BMBA 1UCXA 2A5ZA 1CAWA 1EAH3 1ND2A 2BFUL 2O0OA 5F6LB 3FC0A 4HZFA 2RJKA 1PGSA 3KCCA 4H55A 2JXAA 3PHMA 2ZOEB 3MIBA 2ZABA 2JG9A 1GZWB 2XH6A 3ZSJA 2DV9A 2N7GA 2R043 1L3JA 4I0AA 2ZGNA 2GNBA 4C1WA 2MHFA 4B3NA 4QM9A 3NL1A 3ALQA 1HLCA 2HWE2 1F8VA 3AYCA 2EXJA 3M8LA 1SLTA 2WLQA 1G9BA 3ILFA 1A6CA 1MEC3 4HETA 4GMP0 3AYAA 1RUI1 2ZA9A 4AVCA 2YHJA 4L99A 5K9YA 1KS5A 4CEYA 1QOOA 1COV3 1DZTA 3DGTA 1J3QA 2ZX4A 3MPBA 3WNXA 1JUHA 1K5MA 1JBCA 2XBO1 5EV7A 2D3RA 1LEDA 5EZWA 5AC91 3X29B 1H9WA 1RUNA 5F6KA 3B7MA 4META 3I4IA 2OYZA 2WKKA 3MW4A 1MS4A 3TBDA 4JDNA 1IS4A 4E4ZA 1ULDA 2E7QA 2RS33 4DRVA 1C4RA 4PCRA 4X6RB 1QOTA 4UW3A 1MR5A 2ZKLA 1PVC3 2WS93 4Q4W3 1QH6A 1VBD3 2BNNA 4B4QA 4XF4A 2Y0IA 1LR5A 4FCAA 4L97A 2Q0AA 1SCRA 4WVVA 1FATA 1KQRA 3JD72 1R1A2 1BMV2 2WFPA 3WT3A 4LBQA 3ZXLA 1NQJA 3JU9A 3R6SA 3T2TA 2WQZC 4WVWA 3MEPA 1LECA 1LOFC 2VW1A 2VQ0A 3AP7A 1PHMA 4V1PA 3VBUB 5GZFA 5C8CC 4D7TA 4HPKA 4C91A 2KA3A 1ZBE3 1D2QA 3V0BA 4Q4X3 4I2OA 1TE1B 1ZZ9A 3UJQA 3AZWA 1AR81 1DHKB 1OFNA 2P3JA 1VBE2 2RR11 1FAYA 4JQRA 1RVF3 4ZKTB 4XFHA 1GKBA 1LRHA 3HWJA 4LT5A 1YRZA 1VBC2 2D93A 3VHRA 3SCFA 1AR92 1BBT3 1X36A 1CIWA 2WZR2 5T3NA 3RJRA 2OVUA 3AXEA 5JZGB 1CJDA 2GNTA 4FTSA 2D6PA 2YC0A 4KWKA 5LK5A 4D94A 5I0RA 4K20A 2B45X 1NE4A 1RUG3 2FMDA 1ZM1A 2D6LX 2VU9A 1GV9A 1ND3B 2BPA2 4QGNA 4M3CE 1YNAA 4GIQA 3LWCA 4Q8KA 2FBEA 1V9U3 3VBRA 3AP4A 2B7YA 3WZ1A 2C5DA 5IK7A 5C6CA 2A3YA 4LHLA 4KBBA 3OY8A 4JRLA 1AR62 4BWOA 5DDJ1 3I59A 4IXLA 4FAGA 2PAKA 3CF6E 4H7MA 2ZGRA 1DQ0A 2WNVA 1RMU1 5AVAA 3WQ7A 1RB8G 1BEV3 1W6QB 1U12A 4LBOA 3HR9A 4OLLA 1T6GC 1REDA 1FNZA 2WNUA 4QGLA 4XDQA 5GLTA 1DYPA 4Q0UA 1PO22 3AMQA 1NCRB 1WGPA 3N3HA 4IEZA 2EAAA 1V6LA 1WMEA 2D6OX 2PTMA 4XXPA 1CAWB 5T5JA 3MPPG 3PJYA 3AJZA 3WUDA 3POWA 3N7KA 3NW4A 2VUAA 3Q9OA 4R9DA 1XU1A 5ABJC 1DGWX 2E7TA 3E5QA 3DF0A 3QH6A 2EA7A 3CJIC 3IKWA 1Q8QA 1LKNA 4FAHA 4WM8A 4DINB 2AR6A 2D3SA 4OUSA 2D44A 5CBLA 4COZA 2CV6A 3OBRA 1AL22 2VUJA 2VOKA 1H30A 3B01A 3V65A 3NAPB 1ZBA2 2GZWA 2DURA 1DQ5A 3IMNA 1N47A 3E6CC 1BZWA 1C5HA 1D0HA 5KHGA 1H1MA 2ARBA 1ZZBA 1DF0A 3NJZA 1ZREA 3DPRC 2CAVA 1U5YA 4Z07A 5H9SA 4FQZA 2W39A 4CEYB 3RNSA 2XLAA 1PGW2 4NPRA 1NA1B 2QFEA 4JGZC 4JV4A 3M3IA 1HX6A 1LEMA 1URXA 5E8AA 3B94A 1OA3A 3ILNA 1TME2 4YZ3A 1OQEA 4PIXA 4Q27A 3M4FA 5FO8B 1TMF1 2WA4A 1KJRA 2IFWA 1A8MA 4OI1A 1S0EA 1KDMA 1JTZX 4P9YA 2GMPA 1X82A 2I45A 3RQ0A 3OTFA 1ALYA 1OA4A 4CTEA 5ABJB 4I3GA 2ZX1A 4IV1C 3AJYA 1DG6A 4AYUA 3RZZA 1RUD2 2Z79A 2ZAAA 1IPJA 1BCXA 2EALA 3U07A 1AXKA 2X53S 2HEVF 3RS6A 3DN7A 1S0BA 4XOGA 1DDLA 4RR3B 1DYKA 5E16A 4XJAA 3E97A 3JUUA 1IQAA 4I30A 1RUH3 1QF3A 4XMAA 3RMYA 4Q0PA 1AHSA 1RUF2 3VBFC 1LOEA 1HRI3 4HPKB 4GH4C 4JGYB 2YPJA 4COYA 4INDA 2OZ6A 5DZFA 3V0BB 2MEV3 1BJQA 1QHDA 3ZFFB 2NPIA 2D7FA 1OD5A 4JGZB 1IOAA 5JPMB 1SBDA 4D3WA 4GULA 4Y1UA 4LLFA 4BZ4A 2ETEA 4CDQA 1H2KA 2RJLA 3ZXDA 1D0GA 3AP9A 1C1LA 4IEOA 2DWRA 3O7OA 1CR7A 5I91A 2IWGB 3AZZA 3L9JT 2X29A 3WXPA 4A7ZA 1ASJ1 2GDFA 4A3XA 5H9RA 4YM1A 4BM8A 5BNOA 2DCZA 2RS12 4UW4A 5L19A 3ZFEB 1RINA 5H9QA 2IXCA 1YYNA 3ZSMA 1RUC1 4YLZA 2FMYA 1VIWB 1MVQA 2OZJA 5D8AA 3AB0A 2ZGMA 2R073 5T5OA 1AF9A 3JBG2 3QLQA 2R6QA 1RUE2 4NN0A 2F6BA 1GZ9A 1HV1A 1AYN1 2UYAA 4L11A 1DQ4A 2PHWA 1S2KA 2Y26A 3OF1A 1GBGA 4AG4A 4AFMA 2Q5TA 4XHBA 5I8SA 3D5OA 2HWE3 2XJRA 2CTVA 2D6NA 3J26N 3I59B 1J59A 1BYHA 1V6IA 3OJBA 1FOD1 1C8M1 2WNVB 2HEYF 4GMP1 3U4XA 2UY9A 5DZGA 2MPFA 1WMDA 5L36A 1ZRDA 3MLJA 2R1DA 1WW6A 1LHUA 1S55A 4XQWA 4Q1PA 3VBSA 2ILMA 1YIPA 5A3MA 1PM7A 4LBJA 1MS0A 2V5YA 2PFWA 3WV6A 1RHI1 2JD4A 4LE3A 1FI2A 2AGSA 2D5FA 3AP5A 4HKWA 1LOGA 3RSJA 2G9GA 1YI9A 1ZRRA 2W08A 1UF2C 2PHFA 1RJ7A 4CDWC 3H1WA 4WM8B 1Y9QA 3IDBB 2R0HA 1AR72 1AYM1 1H2LA 1LJ7A 4ONUA 3BOPA 4BLJA 1CPNA 3IPVB 3VDDA 4N43B 2A7AA 1R1A3 2WFF2 1QJX2 1Q56A 1MS9A 1QJU2 2CAUA 4YZ1A 2BWAA 5JSPA 1H2MA 3SHRA 3R4DB 1HXS1 4Y22A 4ZU4A 2WJSA 2AREA 2R32A 3WP3A 4QQOA 1GQGA 2FHRA 2GH2A 2GC3A 1S0DA 3O0XA 2I2SA 2E9QA 3B02A 1HV0A 3JQWA 2VXRA 1N1VA 4Z82A 4YVSC 5A33B 3V0AB 2HWD1 1QKQA 4AVAA 3I8TA 4YG0A 3J8F2 4G3YC 3WCSA 4K1YA 2VNRA 4CDUC 4AGGA 5J96B 4CDXC 1KDKA 2XJVA 1EYBA 4MGYE 1VBE3 5IK5A 4DNYA 3WDUA 4XF0A 3M3QA 3OD4A 1VBC3 1GR3A 1UU6A 4K8FA 2CY6A 1AR93 1DQ1A 1ENSA 4RGAA 2DVDA 4G4FA 4FPKA 2WZR3 5FLIA 4FXKB 2LUWA 4QPGA 3ME2A 1SFNA 2X8KA 3AKTA 4YGCA 5KHKA 1DFQA 5K0UA 1MS8A 5KC5A 3L2HA 4I09A 1D4VB 4OHVA 3LA3A 2OUJA 4GWNA 4QPIA 3IT8A 2R30A 2VVEA 3H9AA 4E2SA 4IL7A 2RS52 1SLBA 3RI8A 3WP6A 3TWIA 2VMHA 1VJ2A 4IV3A 2Q8OA 3ZYGA 3OPZA 1Z0HA 1YWKA 1NCQC 4YVSB 5FOBB 4YRDA 2HWC1 5JMCA 1EAH1 2AUYA 4Q4V1 5JPNB 1MQTB 3QCWA 4FPGA 1AR63 1XYOA 3M1HA 4LEJA 2ZJCA 4OUMA 4CDXB 4Y24A 4IESA 2XJSA 1VBB1 2DFCA 4R8HA 3MDPA 5HI0A 1OI6A 5EYXA 4OI2A 5BNPC 4ES9A 1N1SA 3KT1A 1FMD3 4K21A 1G9CA 2A6YA 4QPYA 1EV12 1LHVA 4FOYA 1VBA1 2JG8C 3WP4A 1PO23 1RUI2 2PA7A 5J3UA 5KXBA 4HVRA 4AWDA 1QOSA 4KG0A 4WM7B 3ZYRA 4D7SA 1WD4A 3AKSA 5CAZA 2XBO2 3D6EA 1A8DA 4TSVA 1MEC1 1PIV2 4KU8A 4QQPA 4R52A 2GMEA 4ZU7A 2VG9A 3VZLA 4D7YA 5FDBA 1Q8VA 3CO2A 4DMIA 3VBHA 1COV1 3U10A 3ZPYA 1CAXA 5K7PA 3O14A 4YM3A 1UU4A 2JDZA 4F3JA 1G7YA 5FAXA 3BPZA 1F9KA 1CAUA 1AL23 1KRIA 4DQAA 2O8OA 3NV1A 4LO6B 3LKJA 3SCHA 5JOZA 1CQ9A 1ZBA3 4GQ7A 4FXGB 2B5HA 2RS31 4RGGA 3MW2A 4E4SA 4M0HA 4XE9A 3PVEA 2HEWF 2Y0OA 3UL2A 1A78A 1PVC1 3WG1A 1KS4A 5F1RA 4TZDA 3H50A 2WS91 4BOWA 4Q4W1 1NY71 5ACA2 4JCKA 4YZ4A 1GQHA 1TEIA 3WLUA 2TEPA 4IETA 4YARA 4OVEA 4AEDB 1R092 3M3CA 1TME3 5IK8A 2WINB 5BY5A 5LEJA 2IXJA 4PBPA 4N7UA 2ZHKA 5JSRA 5C9AB 4GXLA 4LHKA 1V6MA 1QDCA 3SITA 2RR12 1I6XA 1YO8A 3D82A 5E1RA 5JVVA 1ZBE1 5FOJB 3MICA 3KSCA 4B4RA 4Q4X1 4Y1YA 4AFAA 1MS1A 3B00A 5I0UA 1RUD3 1VRH2 5FPXA 3BIWE 3MIFA 1APNA 2P17A 3LCPA 1RVF1 4GB33 4PDWC 5L7OB 4LO7A 3ZX7A 3USUA 1H8TA 4Y22B 4SLIA 4GKXA 2YYOA 2CGNA 4RQPB 1RUF3 1DIWA 1W39A 1GSLA 1LOFA 1OMIA 2LTNA 4AHZA 2PHTA 4FPOB 5I0SA 5C8CA 1REEA 4MGKE 3UKVA 3BCWA 3AMNA 4XJZA 4R9BA 1POV3 1V6JA 5C4WA 1PK6B 1S0CA 1WUVA 1RUJ2 2H0BA 1RUG1 3VZOA 3WHUA 2YV8A 1UU5A 3U0ZA 3D0SA 3H1YA 2ZACA 4ZXKA 1PZ9A 3EO6A 5E89A 1WLCA 3MZHA 3KT7A 4P5HA 2ZZJA 1VAKA 5DDJ2 4F7ZA 2D43A 1V9U1 1NXD1 3MF6A 5JWPA 2VY0A 4PLNA 1LOAA 3AM2A 2RS13 1KFUL 1V6NA 1OLQA 2YZ4A 2ATFA 2WNEA 1FX5A 4LBQD 4MGIE 1Y7BA 1JOJA 4BLIA 1GICA 2DTYA 2D5HA 4FPLA 4C90A 4PDWB 5FBZA 3GALA 3E6BA 4QU2A 2ZGQA 1ULEA 1QQP3 2PELA 3O0VA 3JBG3 3QOPA 4X6QB 5IUQA 3VBUC 4EWEA 1RUE3 4N53A 4AE2A 3JCIA 3CU7A 2XPJA 3JB4C 4Q4Y1 1G8WA 1RITA 4X8PA 3NO8A 4QMAA 3KQRA 3ZDSA 4FPFA 4H14A 2P2KA 3KT4A 4WZCA 4QQHA 2HWB3 4JTOA 3A0KA 4XFIA 4EWAA 1LHOA 5HCBA 3G7DA 4IEYA 3WQ1A 4BMEA 1AUYA 2QVSB 3AKQA 5JI7A 1NLRA 1AX1A 2RMU2 2DCYA 2YMZA 4LR4A 2ENRA 3LSEA 4FPHA 4HL0A 3RYRA 4KG8A 2XVKA 2YDEA 4AFCA 5EYYA 3RRDA 3N36A 3H1MA 3FFQA 2ZX2A 2IZWA 1QH7A 5JZGC 1QU0A 1D4M2 2VH9A 3OBTA 4L9BA 4AFBA 3VHPA 2DUPA 4TYSA 3T1LA 5CA6A 1ND3C 3NKGA 5FRAA 3WW3A 1ULCA 3JZVA 1O3QA 2K0GA 4BYYA 4GALA 1TMF2 5DUUA 2QKDA 3VBHB 4X8NA 3VZJA 1AR73 3B69A 2H0VA 3CJIA 2A3XA 2RM22 4YW2A 1CAXB 1ENRA 1HRV1 2ET7A 4KQ7A 2QDNA 4UXAA 1CAUB 1WLDA 2WFF3 1YFUA 4XW3A 1QJX3 1UKGA 1QJU3 3QH7A 4JVAA 2VNOA 4IEWA 4JDMA 1C57A 3ZXEA 1QNYA 3VN4A 3TAYA 1UW8A 4HKLA 5FLHA 4Z8BA 3VKFC 3S7IA 1U5XA 3K48A 2TBVA 2R062 4QQ2A 5CADA 2ZTNA 4LNVA 3S7EA 3AMPA 4MLOA 1GZCA 3J8F3 3WD5A 1DGWA 4ATFA 1NCRC 3G6JB 3CLPA 1W6MB 3VHNA 4R4XA 3N7MA 3ASIA 1VB2A 1XNKA 3ZFGB 5KBFA 1XE8A 4MV2A 1RJ8A 1QXPA 1ZA4A 1RUH1 4LA2A 4MYEA 3AKRA 2VPVA 2JG9C 2GAUA 3SH4A 3EXUA 1HRI1 2Q1MA 1F31A 4P9JA 4D69A 2JEMA 3VL8A 2MEV1 3VLBB 5JI9A 1ZRFA 4AHXA 1POV0 4KU7A 4I3PA 3EHKA 3VZKA 4COVA 4E27A 4EWDA 2NMOA 4IV1A 1TNRA 3AFGA 5BUVA 1J3RA 1Z7S3 1UPIA 5CFCA 3NAPC 4NHMA 4XPVA 3NSTA 3ZSEA 5T54A 2ZGPA 3B9CA 1YJKA 2RS53 3RG0A 4RS5B 3ZMNA 4EN9B 2Z2SB 1BK1A 3MLLA 2GC0A 1WD3A 2G4IA 5FQ0B 5BNNA 4CEYC 2NQYA 3AP6A 1NA1C 4B4PA 3MW3A 1K5MC 4AEMA 3ZN5A 3MF9A 3MFCA 4CEWA 4GH4A 1DU3D 1QJY2 4OI4A 4QQLA 1AYN2 5C4WB 1OOPB 1MS5A 1FPN2 4AI2A 2VGDA 1R1ZA 4N7IA 3IDCB 1F5FA 1ND2B 1RC6A 2R071 1KXGA 3ZSLA 4G9SB 1WCSA 2IFRA 3P3NA 2JG9B 4FO9A 3VL9A 1EV13 1VP6A 2P3KA 2E51A 4P9WA 1SDWA 4LBLA 1PO11 2A75A 2HWE1 4RR3C 1XU2A 3HQXA 4LE4A 2ZMNA 4HFSA 3BU7A 2XBO3 5CFDA 2DVFA 2D40A 3IDEA 1PIV3 3AYEA 4Y20A 4XYXA 4RSUA 1H1AA 4Q0SA 4RA0A 4N53B 4DY3A 4JGYC 4M3CF 3S6PA 4IERA 3AFKA 2H6BA 3SCGA 2E53A 1AL0G 2H6CA 2Y38A 3ZXKA 4CP1A 5LK7B 4XQ4A 1ZRCA 5FTTC 3AMMA 3ZFFC 4IEUA 2ZKNA 3ZXAC 2BGCA 5FO9B 2FZ1A 1K5MB 4J1XA 2QZ3A 5T50A 3BALA 5FCCA 1WW5A 4M00A 2FZ2A 1Y43B 1FNYA 4MXWA 5BXXA 4HMZA 4EJRA 2UWCA 3THTA 3V56A 5JOXA 2JENA 3GZTB 1NZCA 4O9GA 1HXS2 5ACA3 1CGPA 2XB6C 1CX4A 3ZFEC 2JX9A 4IEVA 2UWAA 3RDIA 3SLIA 2QQPA 1H4HA 1R093 3KD4A 2BUKA 3WG4A 3TN91 3OGJA 4B7EA 2ARXA 4LBNA 1SFYA 2PHUA 4B8EA 5JSOA 2ZGUA 1LHNA 4O9EA 2RE9A 3MLKA 3RYPA 2DVGA 2NZ9A 3MGUA 4MSVA 4LBQB 1LGBA 2RR13 5DZEA 4RL7A 3R05A 1IS3A 3PJQA 4RHV1 3FLPA 4CDWA 2PLV3 1PGL2 4HANA 5BYNA 5CIRA 3ZN6A 1VRH3 1XE7A 4XF1A 2CGPA 4ATEA 1IKQA 4PF5A 1VBE1 2QZ2A 2UY8A 2Z69A 3GF6A 3ST7A 2CYFA 2ZX3A 2WNVC 2VW0A 4YGBA 4M01A 1AR91 4DB5A 5H9PA 2DVAA 2WZR1 4MUVA 3HAGA 4IEQA 2D97A 1Q8PA 4OZXA 1XNDA 4A7YA 3CJXA 3L2YA 4YVWA 2JE9A 3J9SA 1RUJ3 2W68A 4L92A 1ZZ7A 1WLTA 5JDBA 4Q0VA 1B35A 2HWC2 2UURA 2D3PA 4Q4V2 4K6BA 2IXIA 5FMOS 4PQ9A 4Y1VA 5DDJ3 1ZZ6A 4AHYA 1RL3A 4WM8C 4K3UA 1MZEA 4FSJA 1VBB2 4PLMA 3B3QE 2DF7A 4N43C 1HQWA 2G9FA 3VBRB 5KHJA 1AR61 1S0JA 3WOGA 1H9PA 3ZO0B 3VBOA 1VBA2 2PYTA 3A0NA 2VMGA 1VALA 3OY8B 4LLOA 4N90A 4BH9A 1CONA 2Q4SA 3AX4A 2VW2A 2B42B 1FMD1 5BNNB 1QY4A 1PO21 3NV3A 4MGZE 2WNUB 5AVPA 1TQ5A 4CEWB 5F5QA 2X5IA 3OYWA 5K8SA 5EFUA 1G9AA 1C5IA 3H7YA 4M3CA 3SH3A 3GHNA 5T55A 3MIDA 3C2UA 4YZ2A 4L8QA 2RMU3 2EF6A 4NHKA 4NO4A 2HWF2 4Q29A 2GNMA 5FPZA 5KWRA 1NQDA 1I9RA 5GM0A 5LRSA 1IS6A 1WLWA 4F8AA 3WUCA 5BNPA 2ERFA 2IXHA 3WW2A 4UW6A 1AL21 4W65A 4BQ1A 1D4M3 1NY72 1H2NA 5GLWA 5GJ6A 4AQ6A 2JG8A 4GWMA 1J1TA 1O4TA 3JD73 2WSUA 4CYDA 5HCFA 4A7KA 1F2NA 4LO5B 4BCUA 5CFDB 1O4ZA 4XJ9A 4LHNA 2C0ZA 4YW3A 4Y20B 1EPWA 2WT2A 1C3HA 3OD0A 4E4DX 1TMF3 5CG9A 3RJ2X 4MH0E 1XXNA 4COWA 4XETA 2RM23 2XWJB 1KD7A 1LTEA 3WDVA 2WIIB 2A71A 3WINE 1QDOA 2O8QA 2ZAHA 3INAA 1TME1 3JQXA 5DUVA 1MQTC 1AX0A 4HSJA 4Q4X2 1YCIA 3UKTA 3GNEA 2VVFA 4NHLA 3IM0A 2EXIA 1NOVA 3MI8A 3B5LB 4R9AA 3T1MA 1O5LA 1N3OA 1W6PA 1G9FA 1NLSA 1SBFA 3SH5A 1RVF2 1GNZA 2B9UA 3RWNA 2DFBA 2R063 3D4KA 1M06G 1DGRN 4YFZA 5BNOC 2BNMA 3KMHA 1R081 3VZNA 4R9CA 3W59A 4ES8A 4XF3A 3E5UA 1X33A 4W6YA 2XVLA 2E7AA 2BQPA 2WWSA 1W6NA 4WM7C 1DGRA 3N7JA 3I2DA 2BVVA 4GB31 1SMVA 4TLFA 1YXWA 4QM8A 3WW1A 5JLVA 1J58A 4QGMA 4XHXA 1ZYBA 5F9TA 2D6KA 2OUHA 5D8AC 1RUF1 1UZZA 5IT6A 1W6OA 4U36A 2EVXA 4Z1VA 3M2MA 1GZWA 2NMNA 3H7JA 1KJLA 1CAVA 1OQDA 1POV1 2YROA 3ZN6B 1V9U2 1CESA 4W6XA 4Y5Z0 1G6NA 1MVEA 5JAXA 1ULGA 4K1ZA 3I7DA 2QNKA 2WC2A 4IQPA 3M70A 4XFFA 2BYVE 4WZFA 4BE3A 4ASLA 4P9LA 1VAMA 2AZ5A 4CDQB 1JW6A 2O1QA 1MZFA 2R041 2RS11 4HN1A 1WMFA 1YHFA 4I0BA 1TNFA 2GNDA 1W0PA 1AJOA 4XBQA 4AEDC 5BNOB 4Q4Y2 1QJY3 4FPEA 4KNCA 1H0BA 1V6KA 1FPN3 5C33A 4Z2WA 1LOCA 5C9AC 1G9DA 3WG2A 3D0JA 1B35B 1QQP1 1SBEA 2ZHLA 3JBG1 5AC92 1J1LA 1LESA 1RUE1 1LGNA 4XBLA 3NVCA 4HVQA 5D8AB 5LEKA 2MNGA 4UBHA 4KWJA 4YM2A 1ENXA 4WV8A 1ZZ8A 2DVBA 3RI9A 3USSA 4W6WA 4MZUA 4Y26A 2HWB1 3W58A 4AGVA 5L7OC 1VLNA 1ZZCA 1V00A 4S2FA 3AXDA 3LA2A 2ET1A 4FOQA 4SBVA 2RHPA 1N3QA 2DCKA 2VECA 4RQPC 4LO8A 2ES3A 5BNQA 3SISA 3ZIWA 1DQ2A 3MIGA 3OGGA 3D8CA 3FZ3A 3KGZA 1WCKA 3UKNA 3VBUA 4DRRA 5B2GB 4H7LA 1VBD1 1QGLA 2XLFA 1CD3G 4PIYA 1PK6C 3LZZA 4M0NA 2X5IB 4Y1XA 1QMJA 3VBSB 2GN3A 4A2UA 3HBZA 2CWMA 1FT9A 1I5ZA 1IHMA 1HRV2 1F5JA 2ZHNA 3ZIXA 4E9KA 4YZ5A 2F4PA 1SLCA 3ZMOA 4IEPA 3H3UA 4YW5A 4RD7A 1AR82 1AR71 3ETQA 5GALA 2XJPA 2VOXA 3ZXGA 3WDXA 3M3OA 2WFF1 5JZGA 3PVBB 1FV2A 5J37A 3VDDB 3VHOA 3N7LA 4HLTA 1HIXA 1ENQA 2JICA 1M4WA 1ND3A 1SL