4D7YA

Crystal structure of mouse c1ql1 globular domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
b'PRVAFYAGLKNPHEGYEVLKFDDVVTNLGNNYDAASGKFTCNIPGTYFFTYHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVILHLDAGDEVFIKLDGGKAHGGNSNKYSTFSGFIIYSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C1Q-RELATED FACTOR
publication title Anterograde C1Ql1 Signaling is Required in Order to Determine and Maintain a Single-Winner Climbing Fiber in the Mouse Cerebellum
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 30
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d7yA00
4N90A 2QE3A 4MSVA 4RSUA 2WNUC 3WD5A 2R6QA 3IT8A 1JH5A 3V56A 3K51A 4HT1T 2Q8OA 1O91A 2JG9C 1PK6A 2R32A 3B9IA 4NN0A 1I9RA 4DOUA 4OUMA 5KC6A 2WNVA 3MI8A 4KGGA 4E4DX 4D7YA 2TNFA 1C28A 2KA3A 4GIQA 4QQPA 1KD7A 5KWRA 1C3HA 4OULA 5TSWA 1PK6B 1D0GA 2Q1MA 2RJKA 2JG9A 4EN0A 5HBAA 2WNVB 4QQLA 1WCKA 1DG6A 2HEWF 4QQHA 1ALYA 2JG8B 2X29A 1XU1A 5BNQA 1U5XA 4QQ2A 3TWIA 4TWTA 1DU3D 2WNUB 2R30A 1KXGA 4QPYA 1RJ8A 3TYJA 4OUSA 4J6GA 2JG9B 3L9JT 5L36A 3AB0A 2OIIA 2HEYF 4G4FA 5KC5A 4TSVA 3LKJA 3K48A 1U5YA 2HEVF 2TUNA 1RJ7A 2QDNA 2RJLA 4MXVA 3ALQA 2ZJCA 3URFA 4MXWA 1TNFA 3QD6A 5L19A 1GR3A 2ZPXA 4F3JA 1TNRA 3B94A 1OQEA 4QQOA 3ME2A 2AZ5A 4DB5A 3FC0A 1D2QA 2RE9A 4KG8A 1S55A 1U5ZA 1PK6C 4KGQA 1OQDA 1JTZX 4G3YC 1D4VB 2JG8A 3QBQA 2WNVC 4MXWB 4E4SA 1OSGA 1A8MA 2O0OA 2Z5WA 1IQAA 2JG8C 2E7AA 2WNUA 5CIRA 3B93A 1XU2A
chains in the Genus database with same CATH superfamily
2RJ2A 2NMOA 3DPRB 3VL9A 2QE3A 4MSVA 1HJFA 4KWUA 3SCGA 4PDWC 1NUKA 3WQBA 4HPKB 1HN1A 4YPJA 3UJQA 4CXYA 1J58A 1W8WA 3R4UA 5BNPB 1BKZA 1WMEA 1UU5A 4LE4A 1SDWA 2GZWA 4Q0VA 2B8MA 2FDHA 4ONUA 1HB1A 1W8TA 3B9IA 4XVHA 1LU1A 3CIHA 4CP9B 5LASA 3NNFA 1UX6A 1HRI1 4C1WA 1BVVA 3D6EA 2VUCA 2RMU1 3ZYHA 1PM4A 2GH8A 1H4HA 1POV0 3ZYRA 2HWD2 5LY1A 2XL7A 5A70A 2YFUA 1W9WA 3ACGA 4GMP3 1OOPC 2IXCA 2BW8A 4CUBA 1R64A 2R1BA 1MS5A 1FMD1 3VDDC 4AEJA 2BFUS 4AXOA 5TSWA 1PK6B 1NCQA 3WW1A 3I4IA 3H7YA 4K40A 4IE7A 3I2IA 3HWJA 4BDVB 3HAGA 4AVSA 5A3WA 3ZKUA 1AX1A 1VALA 1Y3TA 4MX3A 3GBFA 2K9ZA 5SV5A 2D5FA 5FQ0B 3ZO0B 3TNQA 2OKXA 1QHDA 4AAXA 1X82A 1UZVA 2WNUB 5FYZA 2A3YA 2FCVA 2OT7A 3AP9A 3M4FA 1XSQA 4QM8A 4K20A 5IJRA 3HNMA 5IK5A 4BQXA 1XNKA 2UURA 2OQ7A 3POWA 3CJXA 3RPQA 2JG9B 3CJIB 2PLV3 1QXPA 4IGOA 4LT5A 3L9JT 5F32A 2QTWB 1W3VA 2BTVC 3Q8AA 1AL0G 1BBT2 3DKWA 4G4FA 2PAEA 4EE2A 1COV1 2XB6C 1O5UA 3Q8CA 2I74A 5FCCA 2J1EA 2I2SA 3VGIA 3A0KA 1MS8A 1VBE3 4GD4A 5LA9A 1V9U2 1CX4A 1OI6A 5EWSA 3RRDA 2IXJA 3AXDA 4AHZA 3VHOA 4YNIA 5GZCA 3IWZA 4V2VA 1SEFA 1UYPA 1ND3C 2D3SA 5CG8A 3BALA 1N1TA 5BYNA 4LKFA 2Y6KA 2P6CA 2WC2A 2ZX4A 4CRQA 4EWEA 2VNGA 3UJOA 2HWC2 2QQKA 1UU4A 2ZXQA 3ZYPA 4DFSA 3HBZA 1JYIA 2HWE3 1S1AA 1JHNA 1NAEA 2V5YA 2VMGA 3E6DA 2ZPXA 4K6BA 3RDIA 4WBBA 3VZMA 1SFNA 3RSJA 1ACCA 5JVVA 3C7GA 5A1FA 3FC0A 4BIOA 4DEQA 2YHJA 4XTMA 1YI9A 1JMUB 2I07B 1LHVA 3OBZA 1LTEA 5A7QA 3OUJA 2XJSA 1YUDA 2WABA 3MV01 3DL3A 2WSUA 3M3OA 5DN2A 3POJA 5FV3A 5D8AB 4IQPA 3ZVXA 4BLIA 2BU9A 4CDWB 3RYPA 1VB4A 3VBRB 4AR2A 5CISA 1JBCA 1SBFA 2RS31 4Y4RA 4CA9A 3B3QE 1WW6A 2VJXA 2GP5A 1DQ6A 1GU3A 1YFWA 3WW3A 1K5MC 2WS91 3AZZA 3WG2A 5FXXA 1H2KA 5A32A 5LA0A 4P9WA 1HIXA 3N9OA 4PQQA 2HWB3 4FXGB 4Q4W1 5ANQA 5LB6A 1DQ5A 3H1WA 3WDVA 4QX7A 4ZU7A 1MQTC 3UESA 4B4PA 2C6SA 2QZ3A 4BHPA 4EV0A 5FOJB 1UNBA 2WNVA 3HNYM 4FOQA 4IV3C 2DVDA 1R092 2JE8A 3O14A 1F9KA 5JAXA 2WN2A 5IVCA 3TEZA 2D6PA 1QU0A 4AW7A 1H2NA 1NZCA 2ZZQA 4OLLA 3I7DA 1DZTA 2Y60A 1DQ2A 1N3QA 2VCCA 2P3YA 2ZHMA 1ZBE2 3IZOA 4I02A 1DZQA 1ASJ3 3VBSB 2D6MA 4KI5M 1VAVA 4GJZA 1NE4A 3CHXA 4QPIA 4JKLA 4XETA 5FKBA 3FHQA 2VBDA 5I0SA 2Y26A 3LSEA 4ARYA 2DYCA 5LW9A 4FCAA 1RUNA 4QKDA 1IS3A 1OH4A 1VBC1 2ZGNA 4MV2A 1EAH3 4J1XA 1WMXA 4YVSB 5J7MA 2VQTA 1RUG1 1TEIA 2R061 2VQAA 3T4VA 3WUDA 4UOJA 2VUAA 4MUVA 1PVC1 4OUSA 5FO8B 3SHRA 4Y1XA 3KCXA 1VIWB 2JDAA 2MEV3 3J7LA 4IV1C 2WFF2 4KMQA 1ULCA 3I3DA 3GALA 2VNOA 4NIDA 2BERA 3S7EA 3VBHA 2FMDA 1AYM1 1XYOA 4DINB 2HEVF 4CDQB 3K3NA 1UMZA 4QHZA 1OFNA 4WM8A 4Y5TA 3SH3A 2A3WA 2G4IA 2R073 2JKXA 1ZZ8A 3ZSEA 1QJFA 1TG7A 1VMHA 3C7HA 3J7NA 5JOYA 1VBA2 4TN7A 5K7PA 1DLCA 1W2NA 3P1IA 4CEWA 1UXXX 2JDYA 5C8WA 4YW3A 5A1LA 1CWPA 5D2AA 4FFHA 4HVQA 4L97A 2E31A 4K1ZA 2X53S 1W9FA 2XJUA 3MLKA 1WLTA 4ISRA 1AXKA 4LK6A 2VU9A 4YG0A 2BVBA 1W03A 3ZYGA 4LUMA 3T4HB 4XEZA 1D2QA 2PHLA 3HIFA 3PDQA 3ZSJA 4I2OA 2WNEA 5A6ZA 4HPKA 4NWVA 3BIEA 3CZJA 4K8RB 5JOXA 3ZXAC 3U0ZA 3KD4A 2CY6A 3GF6A 3I59B 1EPWA 3NAPC 4G3YC 3WUCA 1SCRA 2Y0IA 4JC1A 2YY1A 4LBOA 4CDXB 4H14A 1UZWA 4FAHA 1O6UA 4CP9A 2WWJA 1BMV2 3CNAA 4XF0A 1YJLA 3ECQA 3MBWA 1OLQA 1QJY3 2BGCA 2NN8A 3BODA 1YYNA 4NE9A 4PDWA 3IMMA 5E88A 2WQZC 1OQ1A 3M70A 4QPGB 3NWKA 2W47A 2A71A 3VLBB 1JYVA 4RSUA 3T2QA 1WA6X 1SHWB 1AR93 3OSDA 2ET1A 4QT6A 4RL7A 2H6BA 1VR3A 3AKQA 4MLOA 5DAXA 4Q4X3 1PK6A 2R32A 2XBO2 1DF0A 3E5QA 3I2HA 3O1UA 4LBKA 2CWSA 3O1RA 3I8TA 4RQPB 3U75A 2LUWA 3LGRA 3NKTA 5F7UA 1HN0A 2WJSA 4BISA 3KSCA 3LPFA 1I5PA 1OOPA 4UYBA 2ZCWA 4LBMA 1JI6A 2GMEA 4MGSA 4XUPA 1UW8A 3VHRA 5KHJA 1JUHA 1TZOA 2BNOA 2BP6A 3LIHA 2ZX1A 1OURA 3K46A 4NWWA 1OXCA 1UZYA 4FXKB 2PHTA 2ADDA 3GGLA 5CB7A 1UIKA 2WZR3 4QXKA 2QQJA 2XVKA 1GP6A 1X9TA 2JG9A 5L7OB 2YC4A 3CJIA 5LY2A 2AACA 4CCEA 4QQLA 1ODMA 1U0AA 1WCKA 5CBLA 4M3CE 4G9SB 3W21A 5FYHA 2RDRA 1HRV2 3MYXA 3ZYFA 3POBA 2FZ1A 5FPAA 3LIGA 1U5IA 4LIVA 2ZBJA 2VTXA 4FBFA 5FYYA 1MZEA 1WBFA 4QPYA 1N3PA 2QQWA 5F5QA 3TB0A 5JR2A 2VW2A 2WYSA 2QQUA 5FMOL 1PO23 2BNMA 2QJVA 3WNMA 3HT2A 4L11A 4PBPA 4HKWA 1RYYA 3I2DA 3AM2A 2HEYF 1LHNA 4ORFA 2WAOA 1U5YA 5ACA1 4K9SA 1F8VA 1O3TA 3OEAA 1RVF1 3MUZ1 3G7DA 2VOXA 5FP9A 2B9UA 4QHOA 4XJWA 4KH9A 4NIAA 1IPJA 4HK9A 1ND3A 2BBVA 3WLUA 3NNGA 1WCDJ 3VZOA 5FFOC 4E8DA 2ZACA 3JQWA 2B45X 2ZEWA 2XLGA 2A5ZA 2HJIA 2OW4A 5KXBA 3NJVA 4N43C 1AYN3 1SQ4A 1VBD1 1R082 2JWPA 5A1AA 1AR73 1JOPA 1LOAA 1ZZ9A 2QQLA 2BNNA 5A7SA 2ARCA 4GWNA 3LA2A 5IHRA 3RNSA 1UWWA 2PAMA 1W9SA 1EYBA 2X10A 4CDWA 3TEXA 2XH6A 4CE8A 4YYOA 3WW2A 1PMIA 2EIGA 3ME2A 1W6OB 4D69A 4I0BA 5HI0A 1CD3G 3PUAA 2E63A 1EP0A 5DAVA 3AJYA 1QMJA 4K7JA 2AYHA 4NRPA 4AI0A 1XYPA 4YSFA 5FMCA 1DQ1A 1ZRRA 5G05L 4OZXA 2A6YA 4PQ9A 5LEKA 3A7QA 4CUGA 5ABJC 5C8CB 3NRUA 2NM1A 3W5MA 1ENQA 4RR3B 1RUJ3 1JS9A 4EJRA 5CG9A 4BA6A 2W91A 1R1ZA 4NIGA 1IKPA 4GB32 5F5CA 4AHYA 2VOTA 2G9ZA 5FY0A 1BEV3 1Y43B 1PGL1 2VGDA 3T0AA 3EXUA 5T52A 1DHKB 3IAPA 1QJU1 4LULA 4Z1VA 4YZ2A 3VD9A 5FZIA 3GZEA 4JV4A 4BQ1A 1T2XA 4ES9A 2JX9A 5C33A 1AYN2 1ODNA 5ANNA 3VBSA 1AR72 5IT6A 1Q8QA 5LEJA 4JDMA 3LA3A 2MHFA 4BCUA 5CYYA 1JZ7A 1Q43A 3JBG2 4GH4B 5BNNB 2WO2A 3I97A 2E9QA 4FAGA 4R8HA 4AHWA 1OPMA 1H8TC 1K45A 2ZHNA 4H3WA 2IFWA 2Q1MA 1UOGA 5ISLA 3INAA 3V64A 1HKDA 1RC6A 3WF1A 3H3ZA 4CU9A 5SV8A 3THCA 3WEZA 1WW4A 1PHMA 2VOVA 1QXJA 4YVWC 5EZWA 4COYA 3M3IA 3RYKA 2ET7A 4D6QA 1YQCA 5J09A 4XQDA 2XPJA 2P34A 1YO8A 5F2WA 4RS5C 3FHAA 3KT7A 1S0IA 4B8EA 1NOVA 1GBGA 3E1F1 3IM0A 5LBFA 4CDQA 4D0QA 1N3OA 1ZZCA 2NZ9A 2FHRA 5DDJ3 4R9CA 1JU3A 2XWBB 2CTVA 3K4ZA 1W6NA 2W46A 4IV1A 2VTFA 4XQ4A 5E6HA 3SMHA 4CU7A 2C5DA 2KR2A 4X6QB 2P6HA 1FPN3 1Z7S1 3NV4A 1RUF2 1SBEA 2ES3A 1QJEA 3AB0A 4AGVA 4P14A 5I0UA 2DTWA 1QGLA 5LRSA 4K3UA 4IE6A 3VZJA 4Y33A 5FK8A 5JWPA 2WUHA 4GWIA 2TUNA 2DV9A 4ZZ5A 1YLLA 4AGGA 1F15A 4S2DA 2QDNA 1SZBA 1V70A 5JSOA 2VXRA 1O5LA 4YGDA 5FPZA 1MACA 3H42B 4BK4A 5LZ6A 5FO9B 2FCUA 1BXHA 3F2ZA 4LHLA 2HBUA 4QKBA 1KQRA 1GZWB 3WZ1A 1W99A 1T6BX 2RR13 2FDKA 1YQ8A 4XPVA 1GICA 5JOWA 3I59A 5BNOB 3WXPA 5JMOA 1RXGA 5M0TA 3BTXA 1UMIA 1QH7A 2A6WA 4CDXA 4RHV2 1ULOA 3AMQA 1W8NA 1DDLA 4JGZB 4NAOA 1IG0A 2ZGLA 1GMMA 1Y4WA 1H1AA 3B94A 4QQOA 1QOSA 5GZDA 1C8M2 2RHPA 1E5HA 4QPGA 2X5IC 2WZR1 4DB5A 3D0SA 2DFCA 1WUVA 1H6XA 4CEYC 1X50A 3NAPA 2JIGA 5JZGB 4XF3A 5K0UC 3DUIA 5IW0A 5I8SA 5KXDA 1HRI3 5L9BA 2C24A 2VR4A 5T5PA 1IS6A 1US3A 5B4NA 4NRQA 2EXJA 3FJSA 3AK0A 3QBQA 4BH9A 1PZ8A 4JZRA 1ZA7A 2E26A 3DV8A 5JIUA 2GC0A 2O0OA 1FPN2 1ENSA 3JD71 4JQTA 1UAIA 3VUOA 4TLGA 3POSA 1VP6A 1FMD3 1W39A 3ABZA 2DCZA 4N9IA 3USUB 1T6GC 3TN93 1PO21 4JCKA 1F4AA 1I5ZA 5D21A 4TTGA 4OCTA 1CQ9A 1AHSA 3IT8A 2DUPA 4NO4A 4A3ZA 3O1TA 1NA1B 4IE0A 1D4M1 1WW5A 4IEXA 1CGPA 5K8SA 1OA3A 2IZWA 2FQPA 3ATGA 5KR7A 3S0MA 3I3EA 5L7OA 4JDNA 4LLFA 1A78A 2VVDA 3RS6A 5JXGA 2OX0A 2A1XA 2A6VA 5GKAC 3ZFGC 3VBOC 2UWCA 4H2AA 4QDSA 3W58A 4D7YA 2QVSB 2WZPP 3JCIA 2JECA 1DLLA 3NKGA 4Q8KA 5JCTA 5JMCA 1TME1 5A7NA 1GWMA 4XUTA 2RS53 3K77A 3KHCA 1ZBA2 1OKOA 1JU4A 2RDSA 2NPIA 1O7FA 2DWRA 2VCAA 1OF3A 5FTTC 1J3QA 1COV3 1I6XA 1JZ2A 4KU7A 1UY3A 4UW4A 1JW6A 2VQ0A 2RMU2 5FPLA 2VBBA 2CU5A 5LK5A 2AH2A 2DCJA 3ITQA 3SEPA 1H2MA 3MW2A 4QGMA 1SBDA 1A3KA 4Y5Z0 3N3HA 2A75A 3DEMA 3IIAA 5F5AA 4E4ZA 4N7UA 4OYUA 1QJX2 4XF4A 2W1QA 5DUWA 1YCIA 2AEZA 3D8CA 2ILMA 4XACA 3N9PA 1AXYA 3IIIA 5APAA 5FUPA 3R4SA 1JYWA 2VMEA 1UYXA 2EXKA 1DYOA 2VCMA 5CFCC 1LRHA 1XNCA 2EXHA 2OIIA 2ZGRA 4GALA 4A2UA 5FZBA 1IQDC 1RTVA 3K75B 1XB9A 1C57A 2HYXA 5AFEA 2E51A 4N53C 2BQPA 3HNBM 4Q8LA 1W6OA 2J7MA 1AXZA 4W8JA 4MHRA 3FN9A 3NQHA 4CXWA 2JDUA 5CFCB 3AFKA 3WF4A 4F8AA 5J48A 1Z0HA 1DFQA 1OKQA 2RS33 1LJ7A 3KGLA 4HVOA 5DAQA 5FYBA 3MGUA 4ASMB 5F6KA 2PN5A 1COV2 5T54A 2CGPA 2E7QA 4QX5A 4FSJA 5GLZA 1FOD1 4AQ2A 1S0FA 2Q5TA 3KS7A 5C8CA 5DPNA 2WS93 4BQ4A 3ZMOA 4RR3A 5FZ1A 2JICA 2YV8A 3AZYA 4MOAA 4N8MA 1O8PA 5I0RA 4AYUA 1GOGA 2AZ5A 3B9CA 3ZR5A 4HSLA 4FTSA 1RB8G 1ND2C 5GLVA 3GJBA 1VRH2 2ZGTA 3POIA 3WDWA 1W6QA 3ES1A 4BWOA 2XR4A 5ABJA 2CDOA 3BTYA 1AR62 2RDNA 3MLLA 4HMZA 1RUOA 5C3QA 3AZVA 2P17A 2XVGA 5FYTA 5A7WA 2IXIA 5D1IA 4KBZA 4KNCA 4IESA 5FIXA 5FZAA 4YW2A 1OD3A 3E6CC 5DDJ1 3SITA 5A7PA 3ZSMA 5JXJA 4AI1A 1XU2A 2ORZA 5C5TA 4BZ4A 2W52A 2DBNA 4HETA 2ARXA 3HQXA 3ACIA 3ZFFC 4AFMA 4ZXEA 3J8F1 2R6QA 4ZHNA 1XXNA 3USSA 3ZYJB 1LHOA 4ITCA 2Y8KA 4WM8B 4YFWA 4YW1A 2WKKA 1O91A 4FP3A 4FPHA 3MV11 4FQ4A 3J9SA 4DOUA 2ZEZA 5C3OA 2QBXA 4A4AA 5CA6A 1CIYA 1VBC3 5LRRA 4GAZA 1CN1A 5I0DA 2VBPA 3NV2A 3MF6A 4QXCA 1RUG3 2R063 2C9AA 2DTYA 3OCPA 5FZOB 3HBKA 4AZZA 2ZGKA 2WS92 1PVC3 3UL2A 4X6RB 2W39A 1OA4A 1QJZA 4Q4W2 2WSVA 1R1A2 2HWF1 4ZPIA 3E5XA 3WCRA 5IVEA 2EAAA 4LOTA 3L2HA 4IXLA 1H2LA 1O4YA 1X36A 3UGGA 4CCNA 1AYM3 4GA9A 2R1DA 3FLRA 2JE9A 4P9YA 5T55A 1DG6A 4XF1A 4QQHA 5JXIA 1C1LA 2YPJA 1W8OA 1XU1A 4XFBA 4C90A 4FPFA 1YXWA 2WQ4A 1BCXA 1YWKA 4CP2A 4KWKA 4NHKA 4LITA 3RMXA 2DVFA 3W20A 4CPBD 3WP4A 4PDWB 3VDAA 1XBFA 4PLNA 3R05A 4N7IA 2YFZA 4U2AA 2GN7A 2E33A 1V6KA 2Y33A 2NP0A 1GZWA 3BN6A 2L9LA 2YBSA 4NRMA 4RGKA 1DGLA 4UFMA 5BNOA 4Q4V3 3ENRA 4AQ6A 2I45A 3OGGA 2EIBA 2F6BA 1V6LA 2WDBA 4FP2A 1SMVA 3TN91 4ET7A 5FPXA 2JXAA 4JGZA 3HR9A 1QQP1 1VBC2 2Y64A 2Y6JA 3H8XA 1KRIA 4JQRA 1REDA 3J7MA 3UV9A 1RJ7A 3J4UH 1OOPB 2JENA 3KGZA 3O1SA 4OQ8A 3C8XA 1PVC2 2GU9A 3IKWA 4LHSA 4PLOA 4XMAA 5JZGA 5L9VA 1J83A 4ZZ8A 3VDDB 4COWA 5DMYA 1S0JA 3M7AA 4FPEA 1LENA 2AUYA 3FBYA 2JKBA 3OPZA 4QB6A 5A3NA 1VAMA 4Q27A 4RFRB 4LR4A 5HPOA 1F5JA 3FBMA 2UY8A 2RS51 1W2UA 1YC61 3ZOIA 1J3RA 3LDBA 4BXSV 5K0UA 3CLPA 4Q0SA 2BEOA 3PNAA 4CEYA 1OFSA 1MEC3 3USUA 5KHKA 2DVGA 1OPOA 3E5UA 1KDKA 2YZ4A 1KGYA 2EALA 2ERFA 2RM21 3N35A 4TXWA 5JR7B 3SKJE 3VD7A 1GNYA 2Q1FA 1MS4A 4R52A 1NA1A 4AAPA 1OQDA 2J22A 1JTZX 5JSRA 1BYHA 4A6OA 1Z78A 4DMIA 5AC91 2W1WA 1OH3A 2Q4SA 3AP5A 2BVVA 3SH5A 1WGPA 5F6LB 1S0CA 1K12A 2Z5WA 1YEWA 5T5OA 3PMEA 2BGPA 4XOGA 4UW5A 5JLVA 4XC9A 3EJKA 3ZN4A 1LEDA 2CWMA 5I0TA 2E6VA 4D6SA 1FV3A 2ENRA 2VVEA 3OTFA 5H9PA 4FT8A 1G6NA 5I93A 3T0DA 1ND3B 2CAVA 3D3AA 3DCQA 3O1MA 4W6XA 3ZFGA 1BK0A 2YXSA 1RUE3 5FDBA 4L9BA 2VVFA 4KQ7A 5GZEA 2Y6LA 5BUVA 5IK4A 2DVBA 1C4RA 2VMHA 3OUHA 2ADEA 4Y1VA 3ETPA 3MZHA 4XAAA 3UGFA 3T0BA 3ZLIA 4QM9A 2PLV2 5A33B 2W3JA 4LO7A 1W8UA 3MIGA 3KWVA 5EHDA 3PTYA 2Z42A 1L7QA 4XDOA 5FRAA 1LB2A 5KWRA 4DO0A 4IEZA 1RUI1 3HEIA 1OT5A 2C26A 4E2SA 1VBE2 2OVUA 3OBTA 3Q8EA 5FBZA 3VN4A 2VZPA 5DG2A 4RFT0 2WT0A 2J1AA 2KM2A 3AYDA 4BQWA 5ACA3 2H0BA 1RVF3 4PT6A 1NX9A 4XJAA 2VECA 1US2A 5H9RA 2DCKA 4HZFA 3ZSLA 2VZUA 2Y6FA 5BNQA 3T2OA 1JHJA 4CCCA 1QY4A 4COZA 3X29B 2D44A 4K1YA 3O5SA 5FYSA 4KWJA 2OPWA 1HXS1 1VBD3 1K5MB 2SBAA 2DF7A 3PVBB 4Y26A 1E5SA 1JZ8A 2HWE2 3S30A 4B4RA 4DEVA 3O1OA 5EJ3A 3SXWA 5CFCA 2V4VA 2OS2A 2LRPA 1Q5OA 5EFUA 3AMNA 1MQTB 5FMOS 4Z2WA 3LDKA 5IK7A 1A34A 4FOYA 3ZYBA 4P9LA 4R4XA 1W0OA 2VMCA 4HK8A 4N53A 4EN6B 1XPWA 1WD3A 4IEVA 2SLIA 4O61A 2P37A 4UW3A 1S0BA 2EIEA 2WA4A 4IV3B 1GNZA 2GNBA 4JDOA 4OI2A 1ZZBA 1K42A 2QCSB 2V5DA 4IEYA 1H1MA 4QKNA 3TBDA 3FL7A 3AVRA 2XQXA 2PAKA 5JOZA 3WDYA 3RZLA 4A6SA 3HPNA 5LBBA 5AVAA 5FP7A 1PNGA 2B42B 5KHIA 1PMHX 5KXEA 3VKNA 4YG6A 4AHXA 4QDQA 3ZIXA 5EIYB 1UOBA 4IE5A 4AFAA 5CVRA 2ZX2A 3T2PA 1ULFA 2IWGB 4XXPA 5CFDC 4BB3A 1RVF2 2HWD1 3U4XA 2HWB2 3KQRA 2QKDA 3WG1A 5J36A 5A3OA 1H0BA 4NOTA 3ACLA 1C5IA 3A23A 1QJU3 4PIYA 3NNMA 2IVJA 1G9FA 4M4PA 2GH2A 2F4LA 4HSJA 4QPWA 4O65A 3ZXGA 1G9BA 4XZUG 1S55A 5E16A 1ENRA 4Y1YA 2VMFA 4GULA 4UFIA 2VL4A 1GZTA 1OC1A 3VHPA 4NHMA 5CNAA 1VLNA 1MPXA 1W6NB 1W6MB 4IV1B 3OOXA 3IBMA 4NMIA 3ES4A 4AFDA 2XJPA 3GBWA 4MGYE 1O3SA 3BKZA 1SLTA 3FMGA 4E9KA 1L7LA 2BFUL 3LQCA 5H9SA 1CIWA 3ZFFA 5CAZA 3R4DB 3CEWA 4N90A 5FZOA 3BB6A 2WNOA 2ZAAA 1ASJ2 4O7XA 1WMFA 3ZFEC 2CGNA 2PYTA 2WAAA 4Q4V1 3K51A 2WBKA 1W6PB 3ZKYA 2ARBA 1LOBA 2K2SA 3B7MA 3WDTA 3GBGA 1BBT1 1OMIA 1EAH2 3DXUA 4AK3A 1BQPA 3U37A 4LBQB 3V65A 3RMYA 2FD8A 1FX5A 2TNFA 4KG0A 4WVWA 4RGGA 3VBFC 2VE1A 4XCAA 1HV0A 5FY8A 4AVCA 2MEV2 3OGSA 3MPPG 2PQSA 1PGL2 3BTZA 3GYDA 3H8RA 1IKQA 1YIPA 4XURA 1Z7S3 2VULA 3LB9A 4HONA 3MW3A 4HKLA 1UKGA 3KV6A 4P9JA 2OA2A 2FDIA 4HBNA 5EQUA 3P6BA 5JPNB 2BOJA 4LXLA 1CAVA 2ZGMA 1M4WA 2ZGPA 3NAPB 3P3NA 4UWDA 3FHIB 1AL21 4V1PA 3W5NA 2JEMA 3ASIA 5FZ7A 1JZ5A 2TEPA 3PMSA 1MEC1 2R072 4Y1UA 4LMFA 1J1LA 3SCHA 4XZPA 2EXIA 2X29A 2NYYA 4XUNA 2WT2A 4ASKA 1K3IA 4M3CA 3AX4A 5FZ3A 4M00A 3AYEA 3DF0A 4EROA 1D7PM 5FZ6A 1OUXA 4IDZA 2GNTA 1OVSA 2W68A 1BJQA 4LQRA 3VDDA 3M1HA 5CZKA 1XNTA 3KVBA 4JKMA 3WY6A 2R16A 2PELA 4B7KA 2JDKA 3VDCA 3NO8A 1EY2A 2GNMA 1Q8PA 4OHXA 2ZHKA 2WLPA 4QWNA 4AEDC 2NQYA 3Q8BA 2Z4FA 4JGYC 5FZKA 1GWLA 4R9DA 4R9AA 3OY8A 1W8HA 4YZ5A 5DAPA 1ONAA 3WNLA 2B5HA 5EJ1B 4Q4Y2 1RUE1 3HN1A 3FUOA 2XXZA 3AYAA 2YROA 2C4XA 3JD73 1QJY2 1Z7S2 3RFRA 1V0AA 4RGAA 4TYSA 1RINA 5EXOA 3IAQA 1DYPA 2CHHA 4URAA 1AR92 1RUC3 1WLDA 3K3OA 3VZLA 2OZJA 3I3MA 3ON7A 4UI9L 4D8MA 1H8VA 1ULGA 5FZGA 1R091 5L19A 2R0HA 4XFIA 4META 4Q4X2 4XJUA 4CZSA 1D4M3 1LCLA 3S57A 4QDRA 4AL9A 3RZJA 4EZ4A 3RI8A 1LULA 4GZ9A 3WF0A 5A7OA 4KG8A 1LOFC 3KB5A 3PVNA 4CDUC 5F9TA 1ZRFA 3FFQA 5LBCA 5C5UA 3SEEA 2WZEA 3KT1A 2JDMA 2HLEA 1OLME 3CKHA 1BHGA 1O8SA 5FP4A 1J59A 1A8MA 1TME3 2UYBA 1YHFA 3R6SA 3WQ1A 2JG8C 3H0OA 3ZXLA 3J26N 3B93A 1DGWA 2QDRA 2WZR2 4LOSA 1W3XA 4FFIA 4LNVA 2WT1A 3AYCA 1MZ5A 5A33A 5A6XA 4BE3A 4S2HA 4DZGA 1LOGA 3NL1A 2PTMA 4A42A 4E27A 2WN3A 1MVEA 3WP5A 3QCWA 5JIAA 2F4PA 2OXBA 1ULDA 1EV11 2V73A 4N43B 3RZGA 2ZGOA 1WCSA 2ZZJA 4YFZA 1ZM1A 3MI8A 2QQOA 5FZ8A 4FQZA 5F3CA 2FDJA 4Z2AA 1WCUA 2CV6A 3KCYA 1PO22 2K46A 3MLJA 4IEWA 1GWKA 3MEPA 3TAYA 3ZX7A 3C7FA 1AR83 2WFPA 3VZKA 2RVAA 3IPVB 3ZDVA 5H9QA 4BQ2A 1K5MA 4I0AA 4B4QA 1C3HA 1WD4A 5CKMA 1MR5A 3IMNA 1VBA1 1D0GA 4LO5B 3AKTA 3QLQA 4YW6A 4NIHA 2C0ZA 1MQTA 2WA3A 3LWCA 1W6QB 2DURA 5ABJB 5LCWL 1POV1 1VMJA 1W2AX 2BRTA 2PXJA 3I2KA 4M4RA 4EN9B 5J37A 5A7WB 2ZMLA 4A7KA 4DXRA 4AVVA 4IV3A 3GZAA 3T30A 2AC1A 4CCDA 3RZMA 5LA1A 4PJYA 4IERA 5FXVA 1H4GA 2OQ6A 2R30A 1YRZA 2RDQA 4CUCA 1UU6A 4NHLA 4Z82A 3WP6A 5FXZA 4LBLA 5KBFA 3AZWA 5A3LA 1JZ3A 2ORXA 1FOD3 5GALA 4NVPA 4AWDA 4DRVA 3OPWA 4FI9A 4UXAA 3MO4A 1IGOA 3WQ7A 4OMCA 4CP1A 2W87A 1MZ6A 1BMV1 5C4WC 2AR6A 1B35C 1WWYA 3WDXA 5F5IA 4OI0A 4TSVA 1KITA 1UYYA 5FZLA 4JX0A 2WO7A 2RS11 1PVXA 2ZGUA 1MS1A 1YNAA 5AVPA 5JI9A 4CP0A 4QAWA 3FLPA 5A3MA 1PMJX 1TMF1 5HCFA 2XBO1 1VJ2A 1H8TB 1O4TA 1RUJ2 4HFSA 2D5HA 1B35B 3ALQA 4IEQA 2ZJCA 1IZ3A 2XJTA 4LKDA 1HQNA 3MUY1 3AMPA 1MS9A 1QKQA 4Q0QA 4M01A 1W6MA 3S5QA 4AFCA 2A6ZA 4YVWB 3U07A 1BEV2 3EHKA 3JQXA 2WZ8A 3J8F3 1GR3A 1QIQA 4RS5B 3W59A 3WHTA 1GLHA 3RI9A 2YPDA 2W95A 2VZSA 2WYFA 2Z69A 2FZ2A 1NYWA 4LBJA 5DQ0A 2ZHLA 2JE7A 4OHYA 1NE6A 1RMU3 1W6PA 4FPKA 5FY5A 1OSGA 3ILNA 2OUHA 1LOCA 2AENA 1XE0A 3MW4A 5CIRA 2YBPA 2HWF3 4LBQA 3AKPA 2BUKA 4C0HA 5HCAA 3KQ4B 2D43A 1SLLA 2DUQA 3KF5A 3ZFEA 1W2TA 2WWUA 1DP0A 1VRBA 4HKOA 3M3CA 4XHXA 2BGOA 5I8TA 2PHDA 5LA2A 4Y22B 4A45A 4QHBA 2GMMA 4WV8A 1RUH1 1Q3EA 2LROA 3OYWA 2XHNA 3BIWE 1OLRA 5FZFA 3I2JA 2N7GA 3DGTA 5F39A 5DDJ2 1ENXA 1JZ4A 2OZ6A 4FPJA 2V72A 4OFGA 5IFTA 4H55A 1ZZ6A 4Q4Y1 5G04L 3LEMA 2Z2SB 1JUIA 4ES8A 3HD8B 1SLIA 3Q8FA 2X5IB 3HMYA 5HBAA 3WNKA 2BBAA 2DU0A 2VTXJ 1IPSA 4FVVA 5T5JA 3E6BA 3NMBA 5C9AC 5K0UB 2D6OX 1RUC1 1KD7A 4CEYB 3OUIA 5GLWA 5C71A 3L2YA 2HBTA 3PJQA 4FPGA 3O1VA 2RJKA 2BZDA 4NHYA 1UF2C 3AC0A 3KT4A 3PIGA 3PVEA 4BMBA 1QQP3 4AQTA 1W28A 1VBB1 3IN9A 5IATA 1BK1A 2BJSA 4AF9A 4MHUA 4I3GA 3IB3A 3M3EA 4MGTA 1F35A 2RR12 2P1BA 4LPLA 4YZ3A 1AX0A 4DIQA 3RJRA 3VBUC 3BCWA 3TWIA 3H3UA 1UMHA 1W06A 4YWAA 5EJZB 4BIFA 5AFBA 3GZUC 2D7FA 2VNVA 1CPNA 4MGZE 2ZABA 4LORA 4L8QA 2GC2A 4CCMA 4IL7A 3I54A 4I01A 3WF2A 2VW1A 3PURA 4URTA 3KZ4C 3WHUA 2GP3A 1MS0A 1CZVA 4HVRA 2VAUA 3POGA 2JDPA 4JGYA 3U1XA 4FFGA 3ZFGB 2H6CA 2RM23 3AMMA 2R7EB 3DECA 1HRI2 3OGJA 4JHTA 4GMP0 4HOOA 1LECA 4I3PA 4LK7A 2K0GA 3N7JA 2A73B 4GB31 1HQWA 1NCRC 4QX1A 4IE4A 2BYVE 4IGQA 1DGWX 4BQ5A 2ZEXA 2W1SA 3LEIA 5AC93 1SFYA 4P9IA 1YQ2A 4L99A 5J1XA 2JDHA 1G86A 1Q8OA 2QQPA 1PZ7A 5EYXA 4D94A 1FMD2 2GN3A 5L73A 4BJ0A 3TN92 1RITA 3N7MA 2PA7A 3KF3A 4GJYA 4B3NA 2W2IA 1AR81 2ZKLA 1QEXA 1TNFA 1QQP2 2A7AA 5FR3A 1QDOA 1ZA4A 4LUKA 4I30A 1XNAA 1CAWB 5JDBA 3JBG1 5FO7B 1VE0A 3ZN6A 1LOFA 4OHWA 4CDUA 1LESA 3PUHA 5GLTA 1M06G 4UT5A 4WVVA 1EUUA 4GKYA 1Y9QA 4UAPA 2ZTNA 4FPLA 2GMPA 3OJBA 1KEXA 4HXCA 4U36A 3GDBA 4KL1A 2JG8A 4MXWB 2WNVC 4N43A 2RS52 2D97A 2X8KA 3WG3A 3BPSA 1Q8SA 1HB4A 4XABA 1SLCA 2XQRA 5FY9A 2DFBA 4Q0UA 3OEBA 4PI0A 4LLOA 3SLIA 3WNOA 3V0AB 4N53B 1RUI3 5HCHA 5FZMA 3IPVA 3H3LA 3ZPYA 1RIRA 3QH6A 3WD5A 5CKQA 3BI3A 3S7IA 1JYTA 4R9BA 4E2GA 3LZZA 5FZ9A 4NN0A 4XFAA 5KC6A 4KGGA 1KDMA 1WMDA 4QPIC 4XUQA 1PIV1 4BOWA 1IPKA 1CONA 1HXS3 1V6OA 1L3JA 2CGOA 4JVAA 5CKNA 5EYYA 4NAMA 4P02B 1X9PA 1XJAA 1NLRA 2VZRA 4PLMA 5K4LA 1F31A 1NZIA 3ZXEA 5C3RA 4LEJA 1ND2B 4EZHA 2YB7A 3HQUA 2J1VA 2WLQA 4J1WA 5CEHA 1YFXA 3U14A 2VQUA 3CF6E 4CYDA 4XE9A 4YM0A 4EN0A 4RHV1 5FJHA 3IDAA 3MIFA 1G9DA 4H7MA 5KXCA 3VBHC 4XILA 4W4ZA 2YMZA 1ZZ7A 1LEMA 1RL3A 1CPMA 5C70A 4JHZA 1ZRDA 4MADA 1XC6A 4D7SA 4DY3A 2Q8DA 2RS32 1RHI1 5F3IA 3PL0A 4YZ4A 1RMU1 1NY71 2VUJA 3RZHA 3ZFFB 3EO6A 2NMNA 5IVBA 1RJ8A 4P9XA 2Q1ZB 3TYJA 1H8TA 3NJYA 3AXEA 4S2GA 1B35A 1V6MA 2HWD3 1Y9GA 3UT0A 2VZ3A 5BPXA 2OYZA 4CEWC 2D6KA 1E5IA 2XJVA 4FTEA 3PUSA 5FREA 2BDRA 5KC5A 4YVWA 3WV6A 3K48A 3ETQA 3JU9A 4RS5A 3DPRC 5IVFA 3RG0A 5C3SA 3PHMA 3FUQA 2R041 5T3NA 2PHFA 5E1RA 4AQSA 3SNMA 1PX4A 5BNPC 3T3YA 2B9VA 4Q5OA 3WSOA 1UO9A 1VB2A 1QXRA 5J96B 1PNFA 1POQA 2ATFA 3UK9A 1PO11 3SH4A 1CAVB 2FCTA 2VZTA 2GC1A 1WBLA 4COVA 3AKRA 4UFKA 4P5HA 5A3UA 1UOFA 1ZBA1 4A41A 3N9NA 4AVBA 4C1XA 3AFGA 1BBT3 4M3CB 3D5OA 4Y22A 5F1RA 1W0PA 1AX2A 1PK6C 1RUG2 2D93A 2R062 3CMGA 4YGEA 5DXDA 3ST7A 3DYPA 1FAYA 1V9U3 4L2NA 4AEKA 4W50A 3T1MA 5JXHA 1X33A 4XQWA 4A7YA 1V6JA 4P9GA 2Q8EA 1GNHA 2AGSA 1UZZA 2H0VA 3QH7A 3ZXKA 5C6CA 3GNEA 5LATA 2XHKA 3B00A 1QJX1 1WW7A 2XGXA 1S0GA 4CTEA 1RGSA 2EVXA 4FOVA 1AYM2 3AZXA 4LE3A 2WNUC 1LHUA 1AVBA 1SDDB 2HWC3 1UD1A 2X5IA 1AL23 3WDUA 1YJKA 4Y20A 4HLTA 1JH5A 1JXNA 2R0FA 3OY8B 4HT1T 1XNBA 4X8NA 2VPVA 1S2EA 5C7GA 4YARA 5GZGA 3AP7A 2JG9C 4YZ1A 3CJIC 4Z8BA 4YGBA 3CZUA 1Y9MA 1CX1A 1FT9A 2QQIA 3K2OA 4OUMA 3A21A 3A4UA 4KU8A 1H6YA 4CCKA 5DAWA 1SLBA 1ZRIA 2P2KA 3M8LA 1N1VA 4KBBA 1BLZA 1UL9A 1QOTA 3OGRA 1W8ZA 4ASLA 2J1UA 3WX5A 5C9AA 1RUD1 4Q4V2 4YM2A 5FZ0A 4E4HA 3RVHA 1QF3A 4QQPA 2JIJA 5FY4A 4TLFA 4MGIE 2IXLA 1V6IA 5FMDA 1XOYA 3TRSB 1EUTA 1QDCA 3LEKA 3T08A 3H50A 1CR7A 4HG6B 2LTNA 5EP9A 3PUQA 4GWJA 3VBUA 1ALYA 1H30A 5FZHA 2CNAA 2VUDA 4A7ZA 3VBOA 1U5XA 2IUWA 1W8FA 2VMIA 1HV1A 3ACFA 4S2FA 4Y4YA 3TOJA 4INDA 5IK8A 4OHVA 2JB4A 2VH9A 5FMBA 5FYMA 1H9PA 2VG9A 5FJKA 4AEMA 2MPFA 1VRH1 2PQQA 1ZX5A 1PGW1 3JB8A 4JTOA 4QB2A 3WW4A 3WINE 1AL22 1AR61 3C2UA 1I1EA 1R093 2HYKA 3H8UA 4PF5A 2YBKA 1MEC2 2E53A 1ZREA 1DQ0A 5D8AC 3A0NA 1YQ5A 4XXAA 1APNA 2DUOA 1LGBA 3ILFA 4P08A 5DUVA 3WCSA 1NCRA 4CDWC 4YW5A 3VBRC 3JB4C 3LKJA 4ZXKA 4HN0A 4AI9A 4FFFA 4NIIA 4YM3A 1YIFA 3JZVA 4WZCA 1CAWA 2G9FA 4QX2A 2C1FA 1ZBE3 2ZEYA 4RN5A 2TBVA 1XNDA 1KJRA 5FYIA 3HN3A 2BOIA 1E5RA 2Y34A 2DBIA 1HQLA 2P3JA 4XFHA 4CUAA 3B01A 3VKLA 1ZNPA 3MPBA 4MXWA 5DZFA 2D3PA 3LFIA 5FK7A 2HKXA 4XMIA 3K4DA 2E7TA 1H1IA 4Y1ZA 3A22A 1WLWA 3VD3A 3RWKX 1EPZA 4R4ZA 2XLAA 3WNXA 1RUE2 3V0AA 1R1A1 4I09A 2WFF3 2EA7A 1EV13 2ZAHA 4GXLA 4RD7A 4NROA 4D6RA 5KHHA 3I2GA 1UXZA 3LPGA 4Q1RA 1U5ZA 3H1MA 1E57A 4MG2A 3U78A 5FZ4A 2B39A 2P3KA 4C8DA 5T50A 3TEYA 5IYYA 3HJRA 3VZNA 2B4KA 1A6CA 3VBSC 3RZKA 4ATFA 3THTA 3R0RA 4XIKA 1S0EA 2E7AA 2W9XA 1REFA 3VV1A 1QNYA 3ZMNA 4WVMA 3LF7A 1STMA 2QQMA 3RYRA 5BY5A 4I0WB 1WA4A 1OD5A 1VBA3 5ACA2 3LSDA 4YVSC 4DY5A 1IHMA 1KJLA 1W2OA 3AL6A 4ZS3A 4CVUA 4UF0B 2D3RA 1ND2A 4BU2A 2VOWA 5LK7B 1UKRA 2DU1A 2V4AA 1UY1A 1POV3 4HN1A 1DGRA 4Q26A 5A80A 4NPRA 4CSWA 2XJQA 1KFXL 1LHWA 2Z79A 4XW3A 4TZDA 3LCPA 1VBD2 1DIWA 1FNYA 2XMLA 3AP6A 4MYEA 4QU1A 2BWCA 3I2FA 4XBQA 2Q8CA 3SQOA 3T1LA 3ZN5A 5CFDB 2JJ6A 1OBNA 3NNLA 2UWAA 4CDQC 2Y6GA 2KA3A 1NKGA 1UX7A 4E8CA 3EYPA 3UYJA 3KLSA 4NJ4A 3O0XA 4YG3A 1EV12 3T2TA 4MH0E 1AF9A 3LDRA 5A6YA 4OVEA 2AEYA 1I3HA 2VZOA 4W6WA 1UZ0A 2WIIB 2XOMA 3JXSA 1NT0A 1VMFA 5FY1A 2ZGSA 1X7NA 3VDBA 2E32A 2LS6A 3O0VA 2WL1A 2RS13 1HB2A 2HEWF 4J25A 4BYYA 4L0PA 4BPZA 1FXZA 1ULEA 1XE7A 2ID4A 5A3PA 5A6QA 3ZYIB 1HX6A 5DUXA 2GSYA 3LA7A 4BMEA 1TMF3 2XBO3 2Y0OA 3B69A 4WM7C 1O4ZA 4IW3A 3GZTB 4Q0PA 3D4KA 3NNJA 4QXHA 4UFLA 2RV9A 3V0BB 1V9U1 3ZFEB 4QX8A 4B29A 3EB7A 4OHZA 2VCBA 3FZ3A 1UN1A 2EAKA 4GMP1 1TQ5A 3ELNA 1N47A 1OVPA 5ERLA 1Y7BA 5GZFA 1QJU2 1CVNA 4CDXC 2VXJA 5FY7A 1F2NA 3ILRA 3UGHA 2IVIB 1REEA 4JRLA 2R49A 3OYWB 2A6XA 3DPRA 4H7LA 4M0NA 4WM7B 3OPTA 4CCJA 2HWC1 1C8NA 2ZA9A 4GKXA 4LJHA 1QH6A 1IS4A 2A3XA 3PU8A 4QPGC 3VBFB 2ZMNA 3FWEA 1CJDA 5BNPA 1SPPB 3VBOB 4ARXA 4XFCA 2XLFA 1DCSA 3GCXA 3WNPA 4ZKTB 2ZX3A 1FATA 1AZDA 2JB8A 4IETA 4L92A 3BUCA 1GP5A 1HRV3 1UPSA 5J3UA 2KXLA 2AREA 2YUEA 4K8FA 3URFA 3VKMA 4RQPC 2O14A 4EWDA 1DZRA 1W9YA 3D0JA 4NR1A 4FO9A 3N7KA 1W9TA 2PLV1 4PIZA 2RS12 3DYMA 3MDPA 3IDCB 3THDA 1V00A 1J3PA 4WVZA 4XJZA 5B4XA 1RUH3 1IS5A 3BPZA 1HB3A 1TMF2 1KFUL 2XWJB 1L7RA 3N9LA 3C3VA 5FAXA 5FP8A 4COUA 3Q9OA 4O9EA 3UNPA 1VBE1 5FBJA 5I91A 3C7EA 1HLCA 2GDFA 3POFA 4KGQA 4QGLA 2EIDA 3MIEA 4DXSA 5L7OC 2XDVA 4E4SA 4Q4Y3 2D40A 2UYAA 1W90A 2VM9A 4P5YA 2XONA 5FQ0A 3ORJA 5FOBB 3KV9A 1N1YA 2WWSA 1DGRN 1OLMA 1VPHA 2WNUA 5DABA 4AEDB 4JGYB 1F4HA 1GUIA 1R083 1C5HA 1UPIA 3HT1A 3FE5A 3H7JA 2HWE1 2YC2A 2QFEA 4OZOA 4DXZA 2X09A 5FPUA 5T5LA 3RWNA 4IEUA 3ROUA 1VBB3 1YI7A 3RJ2X 4YGCA 2Q8OA 3BOPA 4ZONA 1PGSA 3ZXDA 4PF1A 1JODA 4ZS2A 3ZXJA 3B5LB 3CBNA 5FUIA 4F7ZA 4Y24A 3FLTA 5IFPA 4PI2A 5CADA 3APBA 1ZBE1 5IWFA 3GHNA 1WLCA 2IC1A 3MF9A 4MGQA 2CL2A 2CDPA 1JN2P 2ARAA 4ZU4A 5IVJA 2PMWB 4A3XA 4Y3OA 3LEGA 4GWMA 1CAUB 5HV4A 3AJZA 1RUH2 3ZN6B 1O3RA 4CDUB 3SKVA 4UBHA 2JD4A 4XBLA 3NJXA 4W6YA 3EMRA 4UBGA 4GB33 1X8MA 4LA2A 4AFBA 2DCYA 1WZXA 2HWB1 2QQVA 2VNRA 2W1UA 2WFF1 3ACHA 2JG8B 1NQJA 3FX3A 3JD72 3NSTA 4QX3A 1MZFA 4XHBA 2YGLA 4F83A 1CZSA 2W0XA 2O1QA 4MVTA 4E2QA 5A3TA 2FMYA 1JZ6A 2WR9A 3WQ0A 1UY0A 1GYKA 1RUC2 4HANA 4NHXA 2P3IA 5FZEA 5I8YA 4A44A 4XAEA 1GOFA 1KXGA 1SACA 5DUUA 5D8AA 4IGPA 4DUVA 4BQ3A 1CZTA 3TEWA 2QUOA 4YW4A 3BVCA 4ZY9A 1D4M2 1VBB2 3OD0A 3VBRA 5HV0A 3PTRB 3JBG3 3KVAA 4XUOA 4B7EA 4SBVA 3G6JB 4AI3A 3C7OA 5C8CC 2XJRA 1GANA 4AVAA 2QNKA 5FLIA 3WOGA 4BLJA 4RR3C 1UIJA 3ZIWA 1GFF2 1Q56A 3VB9A 1ASJ1 4OI4A 1MS3A 2FDFA 4KWLA 1QNWA 3GCWA 4LBNA 4QMAA 4YRDA 1TME2 3OGVA 3UKTA 4CCOA 1H9WA 3DKQA 1FYUA 2YG0A 3IDEA 4EN8B 4MO3M 3VHNA 3PJYA 2VZVA 4UFJA 3OBRA 3O1PA 1FNZA 2Q0AA 1EAH1 4BM8A 5F8PA 3U11A 1G7YA 1HJGA 1GQHA 2VW0A 4RA0A 3VKOA 2B46X 3VD4A 1GQGA 4AOCA 1DBNA 3QD6A 2J1RA 4P00B 5IVVA 5K9YA 4LHNA 2MEV1 4LIUA 4Z92B 2CYFA 2VZ1A 5HXVA 3I49A 3BU0A 3MFAA 1OQEA 3NVCA 3P5BA 2O8OA 3N7LA 1JYCA 1RUF3 3N36A 1UYZA 2XL9A 4ISQA 4GH4C 2DDUA 4HL0A 5BNNC 5FZDA 2RE9A 1PM7A 3AKSA 3UKVA 4UF0A 1BZWA 2QQNA 4BK5A 1PIV3 1W04A 2CAUA 3THPA 4JKKA 1AR82 5FLJA 2R071 3SISA 5DZEA 3AMHA 5C4WB 1CAXB 3BU7A 3CDZB 3WP3A 3IDBB 3WR0A 5CFDA 1G8WA 4YVSA 2G19A 3LFMA 1W05A 3PLQA 4JTNA 4W65A 2YDEA 3I3QA 4M0HA 2HH9A 4PBOA 5L9RA 2DCTA 2PFWA 4RHV3 3SCFA 1AJOA 1NXMA 1GZ9A 3NV1A 3V56A 1WCQA 3E97A 3AVSA 3PUIA 4UW6A 2RG4A 3KMHA 1B09A 2YYOA 1C8M3 3VD5A 1I9RA 1YFYA 4QX0A 4XCBA 1RHI3 4E4DX 1XYNA 3BTAA 3KV5A 4DNYA 3AL5A 1FOD2 1WKYA 4D3WA 1AJKA 2ZS6B 2LALA 1HRV1 3M3QA 2BV4A 3CL1A 4LKSA 4XDPA 4CXXA 3H1YA 5FLHA 3LAGA 4DPNA 2BWAA 1QJY1 2VMDA 2YGMA 4XJ8A 3V0BA 2V09A 3KCCA 4EYUA 2WO3A 4OULA 4K21A 1GZCA 4NUBA 1AR91 2UY9A 3JUUA 1GP4A 5GM0A 5BNOC 3SC7X 1JYXA 1PIV2 2XKPA 3MIDA 2MNGA 4EN7B 1JOJA 1NCQC 4EQVA 4MZUA 2ZX0A 2OPKA 5J98B 4JGZC 4Q4X1 4WM7A 2X05A 3DYOA 2LW8A 2R043 1LODA 3NV3A 3GXUA 3OF1A 3WG4A 2VOKA 3LOBA 1TVGA 1G9AA 4QQ2A 1GV9A 4TWTA 3VBFA 1DU3D 3T09A 3ZPOA 1BVP1 1JOBA 3LE0A 4AVTA 3BGAA 1SPPA 1GKBA 2IFRA 4MGKE 1DQ4A 1UQXA 3MIHA 5B2GB 5JZGC 4AI8A 2NLRA 1DYKA 1QWRA 2A70A 3CQOA 1PO13 3J8F2 1NCQB 1LOEA 1UOJA 4J6GA 1XRUA 4Y20B 2J42A 3GHMA 2OUJA 4XBNA 3VKFC 5L36A 1NQDA 1NXD1 1ZBA3 2Y38A 5FXWA 3N9QA 1ZRCA 1R081 5E89A 5FPVA 5DZGA 1S2BA 2D6LX 1RHI2 2P5BA 4PIXA 1RMU2 1NY72 1CJPA 2UU8A 2GNDA 3KV4A 4DRRA 3ZXFA 4PCRA 3RGBA 5E8AA 1A8DA 1LGNA 2PHRA 2RJLA 2RMU3 4XJ9A 4XTPA 5C9AB 3U4SA 4MXVA 1NA1C 2QZ2A 3O0WA 2HWF2 3OG2A 3PIJA 4FPYA 1LKNA 3HVDA 4RQPA 4YW7A 5FUNA 3LOIA 4LKEA 4DUXA 3S5AA 1QJX3 4B1LA 5IAXA 2BPA2 1KS5A 1J1TA 2EF6A 1XQNA 4Q2FA 5FPBA 5IUQA 1Q8VA 3MFCA 4LO8A 1NG0A 5FWEA 2WQ8A 3M2MA 2VY0A 5IVYA 2YC0A 2R042 3VBUB 4AEDA 4UFHA 2D6NA 4QKFA 4CU6A 4QB1A 3BOWA 3I2OA 3UKNA 1C1FA 2ETEA 1FI2A 2W5FA 3MHZA 1LAJA 4AI2A 2F17A 1D4VB 1PO12 2XUEA 3OD4A 1FV2A 1RUD3 5FZCA 3U10A 1IQAA 2EICA 2ZMKA 1X8EA 4N9HA 4RYDA 4CCLA 2VD7A 1UY4A 1AYN1 4AE2A 1AR71 3PVOA 1JYNA 2JD9A 4DUWA 2XUMA 1NCRB 4LA3A 3BYWA 1OHFA 1N1SA 1KS4A 3B02A 5FYVA 4OI1A 3H9AA 2G9GA 4C0BA 3WT3A 1LU2A 1CAUA 1UCXA 4OQ9A 2JDZA 1GOHA 1NLSA 5BV6A 4LBQD 1SG3A 1HW5A 4LHKA 4O9GA 4OUEA 1D2SA 3GJAA 4YM1A 4QU2A 4NPMA 4CU8A 3J7HA 5F2SA 4QD2A 5LWBA 3EQEA 5GJ6A 4Z07A 2JDNA 5JPMB 5EV7A 4LTAA 2XVLA 4XF9A 4AG4A 1YFUA 2P4EA 3WF3A 4C91A 4CPBA 1CESA 2KD7A 5LBEA 1VRH3 3VL8A 1QOOA 1UY2A 4JAAA 1C28A 2IXHA 1HDKA 1AR63 4GIQA 4LO6B 5EPAA 2ZGQA 4XYXA 1D0HA 3WVJA 3N4MA 2G1MA 1RUJ1 2VC9A 5A32B 1S4CA 2VZQA 4D7TA 3K4AA 2RM22 1XSRA 2ZKNA 1VAKA 1SLAA 3GM8A 4IEPA 2B7YA 3N9MA 1GSLA 3AP4A 1LNSA 4V2WA 4ATEA 5C3PA 2WNVB 5JSPA 1BEV1 2J1SA 4XDQA 5AC92 3EBRA 2D98A 1RUF1 1W0NA 2W94A 3HOBA 3O7OA 3MICA 3OBAA 1O59A 1RUD2 2GC3A 4XFGA 5GLUA 2YU1A 3ZSKA 1ST8A 1AUYA 5FYUA 3FFZA 3CU7A 5F37A 4WVMB 3F95A 2W08A 4QXBA 3RQ0A 1S0DA 1IOAA 1LR5A 4XFFA 1YQ6A 2WINB 1K5JA 3QOPA 1G9CA 1ZVFA 1ZYBA 4EWAA 1V6NA 4ZU5A 2Y6HA 5FP3A 4XIOA 3MIBA 2ZOEB 4Q4W3 1R1A3 4QPIB 4X8PA 5JUVA 3O12A 4OMDA 2PHWA 5F3GA 1U12A 3POEA 3NW4A 5FYCA 5FWJA 4DS0A 3PU3A 4FTBA 4FOWA 4JRAA 1RXFA 3QACA 1PGW2 1NLQA 2FDGA 1TE1B 1C8M1 5HXMA 4LO4B 4DQAA 3DN7A 1MVQA 1OUSA 4WM8C 3H8OA 1GQPA 2O8QA 4NPLA 4YLZA 3KM5A 4PHZA 1PZ9A 1RUI2 2W92A 1PX3A 2WRAA 3D82A 3P3PA 4B1MA 3ZDSA 4BXFA 5KHGA 3KHBA 1S2KA 3S6PA 3RZZA 2FBEA 2GALA 3VBHB 2GAUA 1CAXA 2C9KA 1SFPA 5C4WA 3WNNA 1OF4A 1OA2A 2PHUA 4QGNA 5BXXA 4DXTA 5FKCA 1FPN1 4GH4A 3W9AA 4F3JA 3POYA 5BNNA 3ZM8A 1TNRA 4AGRA 1SCSA 1P8JA 1ULPA 2YU2A 3LD8A 1LGCA 5IAVA 1J84A 2Q30A 2XKOA 4Q29A 3DXTA 5HCBA 1HXS2 1URXA 1XE8A 2VO5A 2XG3A 4IEOA 4FPCA 4BQYA 2CSGA 4IUGA 4SLIA 5DG1A 3ZR6A 2J1TA 4Y5SA 3UETA 3OB8A 1F5FA 4GQ7A 4CEWB 2DVAA 2WO1A 1IG3A 2PHXA 2UWBA 3HQRA 3NJZA 5F3EA 3TNPB 2RR11 2IXKA 3CO2A 4FPOB 4Q1PA 1O3QA 4WZFA 2LM3A 3I3BA 4M3CF 5CU1A 5JI7A
chains in the Genus database with same CATH topology
3DPRB 2NMOA 3VL9A 2QE3A 4MSVA 3SCGA 4PDWC 4HPKB 3UJQA 1J58A 3R4UA 5BNPB 1BKZA 1WMEA 1UU5A 4LE4A 1SDWA 2GZWA 4Q0VA 2B8MA 4ONUA 3B9IA 1LU1A 1UX6A 1HRI1 4C1WA 1BVVA 3D6EA 2RMU1 2GH8A 1H4HA 1POV0 3ZYRA 2HWD2 2XL7A 4GMP3 1OOPC 2IXCA 2BW8A 2R1BA 1MS5A 1FMD1 3VDDC 4AEJA 2BFUS 4AXOA 5TSWA 1PK6B 1NCQA 3WW1A 3I4IA 3H7YA 4K40A 3HWJA 3HAGA 4AVSA 1AX1A 1VALA 1Y3TA 4MX3A 3GBFA 2K9ZA 5SV5A 2D5FA 5FQ0B 3ZO0B 3TNQA 1QHDA 1X82A 2WNUB 2A3YA 3AP9A 4QM8A 3M4FA 4K20A 5IK5A 1XNKA 2UURA 3POWA 3CJXA 3RPQA 2JG9B 3CJIB 2PLV3 1QXPA 4LT5A 3L9JT 2BTVC 1AL0G 1BBT2 3DKWA 4G4FA 2PAEA 1COV1 2XB6C 1O5UA 2I74A 5FCCA 2I2SA 3VGIA 3A0KA 1MS8A 1VBE3 1V9U2 1CX4A 1OI6A 5EWSA 3RRDA 2IXJA 3AXDA 4AHZA 3VHOA 4YNIA 5GZCA 3IWZA 1SEFA 2D3SA 1ND3C 5CG8A 3BALA 1N1TA 5BYNA 2WC2A 2ZX4A 4CRQA 4EWEA 2VNGA 3UJOA 2HWC2 1UU4A 3ZYPA 4DFSA 3HBZA 1JYIA 2HWE3 1S1AA 1JHNA 2V5YA 2VMGA 3E6DA 4K6BA 2ZPXA 3RDIA 4WBBA 3VZMA 1SFNA 3RSJA 5JVVA 3FC0A 4BIOA 2YHJA 4XTMA 1YI9A 2I07B 1LHVA 1LTEA 2XJSA 1YUDA 3DL3A 2WSUA 3M3OA 5D8AB 4IQPA 3ZVXA 4BLIA 4CDWB 3RYPA 1VB4A 3VBRB 1JBCA 1SBFA 2RS31 3B3QE 1WW6A 1DQ6A 1YFWA 3WW3A 1K5MC 2WS91 3AZZA 3WG2A 1H2KA 5A32A 4P9WA 1HIXA 4Q4W1 2HWB3 4FXGB 3WDVA 1DQ5A 3H1WA 4ZU7A 1MQTC 4B4PA 4EV0A 2QZ3A 4BHPA 5FOJB 2WNVA 4FOQA 4IV3C 2DVDA 1R092 3O14A 1F9KA 5JAXA 2D6PA 1QU0A 4AW7A 1H2NA 1NZCA 2ZZQA 4OLLA 3I7DA 1DZTA 1DQ2A 1N3QA 2ZHMA 4I02A 1ZBE2 1DZQA 1ASJ3 3VBSB 2D6MA 1VAVA 1NE4A 4QPIA 4XETA 5I0SA 2Y26A 3LSEA 2DYCA 4FCAA 1RUNA 1IS3A 1VBC1 2ZGNA 4MV2A 4YVSB 1EAH3 4J1XA 5J7MA 1RUG1 1TEIA 2R061 2VQAA 3WUDA 2VUAA 4MUVA 1PVC1 4OUSA 5FO8B 3SHRA 4Y1XA 3KCXA 1VIWB 4IV1C 2MEV3 2WFF2 1ULCA 3GALA 2VNOA 3S7EA 3VBHA 2FMDA 1AYM1 1XYOA 4DINB 2HEVF 4CDQB 1UMZA 1OFNA 4WM8A 3SH3A 2A3WA 2G4IA 2R073 1ZZ8A 3ZSEA 5JOYA 1VBA2 5K7PA 4CEWA 5C8WA 4YW3A 4HVQA 4L97A 4K1ZA 2X53S 2XJUA 3MLKA 1WLTA 4ISRA 1AXKA 2VU9A 4YG0A 2BVBA 3ZYGA 4LUMA 4XEZA 1D2QA 2PHLA 3HIFA 3ZSJA 4I2OA 2WNEA 4HPKA 4NWVA 5JOXA 3ZXAC 3U0ZA 3KD4A 2CY6A 3GF6A 3I59B 1EPWA 3NAPC 4G3YC 3WUCA 1SCRA 2Y0IA 4JC1A 2YY1A 4LBOA 4CDXB 4H14A 4FAHA 1BMV2 3CNAA 4XF0A 1YJLA 3ECQA 1OLQA 1QJY3 2BGCA 2NN8A 3BODA 1YYNA 4PDWA 5E88A 2WQZC 1OQ1A 3M70A 4QPGB 3NWKA 3VLBB 2A71A 4RSUA 1AR93 4RL7A 2ET1A 4QT6A 2H6BA 1VR3A 3AKQA 4MLOA 4Q4X3 1PK6A 2R32A 2XBO2 1DF0A 3E5QA 4LBKA 2CWSA 3I8TA 4RQPB 2LUWA 3LGRA 3NKTA 2WJSA 3KSCA 1OOPA 2ZCWA 4LBMA 2GMEA 3VHRA 1UW8A 1JUHA 2BNOA 2ZX1A 4NWWA 1UZYA 4FXKB 2PHTA 5CB7A 1UIKA 2WZR3 4QXKA 2XVKA 2JG9A 5L7OB 3CJIA 4QQLA 1U0AA 5CBLA 1WCKA 4M3CE 4G9SB 1HRV2 3MYXA 2FZ1A 1U5IA 2ZBJA 4FBFA 1MZEA 1WBFA 4QPYA 1N3PA 5F5QA 3TB0A 2VW2A 5FMOL 1PO23 2BNMA 2QJVA 3HT2A 4L11A 4PBPA 4HKWA 3I2DA 3AM2A 2HEYF 1LHNA 4ORFA 1U5YA 5ACA1 4K9SA 1F8VA 1O3TA 1RVF1 3G7DA 2VOXA 2B9UA 4XJWA 4KH9A 1IPJA 4HK9A 1ND3A 2BBVA 3WLUA 1WCDJ 3VZOA 5FFOC 2ZACA 3JQWA 2B45X 2XLGA 2A5ZA 2HJIA 2OW4A 5KXBA 4N43C 1AYN3 1SQ4A 1VBD1 1R082 1AR73 1LOAA 1ZZ9A 2BNNA 4GWNA 3LA2A 3RNSA 2PAMA 4CDWA 1EYBA 2XH6A 4YYOA 3WW2A 1PMIA 2EIGA 3ME2A 1W6OB 4D69A 4I0BA 5HI0A 1CD3G 2E63A 1EP0A 3AJYA 1QMJA 4K7JA 2AYHA 4AI0A 1XYPA 4YSFA 1DQ1A 1ZRRA 4OZXA 2A6YA 4PQ9A 5LEKA 5ABJC 5C8CB 2NM1A 1ENQA 4RR3B 1RUJ3 5CG9A 4EJRA 4BA6A 1R1ZA 1IKPA 4GB32 4AHYA 1BEV3 1Y43B 1PGL1 2VGDA 3EXUA 5T52A 1DHKB 1QJU1 4LULA 4Z1VA 4YZ2A 4JV4A 4BQ1A 4ES9A 2JX9A 5C33A 1AYN2 3VBSA 1AR72 5IT6A 1Q8QA 5LEJA 4JDMA 3LA3A 2MHFA 4BCUA 1Q43A 3JBG2 4GH4B 5BNNB 2E9QA 4FAGA 4R8HA 4AHWA 1OPMA 1H8TC 2ZHNA 4H3WA 2IFWA 2Q1MA 3INAA 3V64A 1HKDA 1RC6A 3H3ZA 5SV8A 2VOVA 1WW4A 1PHMA 1QXJA 4YVWC 5EZWA 4COYA 3M3IA 3RYKA 2ET7A 5J09A 4XQDA 2XPJA 2P34A 1YO8A 4RS5C 3KT7A 1S0IA 4B8EA 1NOVA 1GBGA 3IM0A 4CDQA 1N3OA 1ZZCA 2NZ9A 2FHRA 5DDJ3 4R9CA 2XWBB 2CTVA 4IV1A 1W6NA 4XQ4A 3SMHA 2C5DA 4X6QB 1FPN3 1Z7S1 3NV4A 1RUF2 1SBEA 2ES3A 3AB0A 4AGVA 4P14A 5I0UA 2DTWA 1QGLA 5LRSA 4K3UA 3VZJA 5JWPA 2TUNA 2DV9A 1YLLA 4AGGA 4S2DA 2QDNA 1V70A 5JSOA 2VXRA 1O5LA 4YGDA 5FPZA 1MACA 5FO9B 1BXHA 4LHLA 1KQRA 1GZWB 3WZ1A 2RR13 4XPVA 1GICA 5JOWA 3I59A 5BNOB 3WXPA 1QH7A 2A6WA 4CDXA 4RHV2 3AMQA 1DDLA 4JGZB 2ZGLA 1H1AA 3B94A 4QQOA 1QOSA 5GZDA 1C8M2 2RHPA 4QPGA 2X5IC 2WZR1 4DB5A 3D0SA 2DFCA 1WUVA 5JZGB 4CEYC 1X50A 3NAPA 5K0UC 4XF3A 3DUIA 5I8SA 5KXDA 1HRI3 5T5PA 1IS6A 2EXJA 3FJSA 3AK0A 3QBQA 4BH9A 1PZ8A 3DV8A 5JIUA 2GC0A 2O0OA 1FPN2 1ENSA 3JD71 1UAIA 3VUOA 3POSA 1VP6A 1FMD3 1W39A 2DCZA 4N9IA 3USUB 1T6GC 3TN93 1PO21 4JCKA 1I5ZA 1CQ9A 1AHSA 3IT8A 2DUPA 4NO4A 1NA1B 1D4M1 1WW5A 4IEXA 1CGPA 5K8SA 1OA3A 2IZWA 2FQPA 3ATGA 3S0MA 5L7OA 4JDNA 4LLFA 1A78A 2VVDA 3RS6A 2A6VA 5GKAC 3ZFGC 3VBOC 2UWCA 4D7YA 3W58A 2QVSB 2WZPP 3JCIA 2JECA 1DLLA 3NKGA 4Q8KA 5JCTA 5JMCA 1TME1 2RS53 1ZBA2 2NPIA 1O7FA 2DWRA 5FTTC 1J3QA 1COV3 1I6XA 4KU7A 4UW4A 1JW6A 2VQ0A 2RMU2 5LK5A 2AH2A 2DCJA 1H2MA 3MW2A 4QGMA 1SBDA 1A3KA 4Y5Z0 3N3HA 2A75A 3IIAA 4E4ZA 4N7UA 1QJX2 4XF4A 5DUWA 1YCIA 3D8CA 2ILMA 1AXYA 3R4SA 2EXKA 5CFCC 1LRHA 1XNCA 2EXHA 2OIIA 2ZGRA 4GALA 4A2UA 1RTVA 1C57A 5AFEA 2E51A 4N53C 2BQPA 4Q8LA 1W6OA 1AXZA 5CFCB 3AFKA 4F8AA 5J48A 1Z0HA 1DFQA 1OKQA 2RS33 1LJ7A 3KGLA 4HVOA 4ASMB 3MGUA 5F6KA 2PN5A 1COV2 5T54A 2CGPA 2E7QA 4QX5A 4FSJA 5GLZA 1FOD1 4AQ2A 1S0FA 2Q5TA 3KS7A 5C8CA 2WS93 3ZMOA 4RR3A 2JICA 2YV8A 3AZYA 5I0RA 4AYUA 2AZ5A 3B9CA 4HSLA 4FTSA 1RB8G 1ND2C 5GLVA 1VRH2 2ZGTA 3WDWA 1W6QA 3ES1A 4BWOA 5ABJA 1AR62 3MLLA 4HMZA 1RUOA 3AZVA 2P17A 2XVGA 2IXIA 5D1IA 4KNCA 4IESA 4YW2A 3E6CC 5DDJ1 3SITA 3ZSMA 4AI1A 1XU2A 4BZ4A 2W52A 4HETA 2ARXA 3HQXA 3ZFFC 4AFMA 3J8F1 2R6QA 1XXNA 3USSA 3ZYJB 1LHOA 4ITCA 4WM8B 4YFWA 4YW1A 2WKKA 1O91A 4FP3A 4FPHA 4FQ4A 3J9SA 4DOUA 5CA6A 1VBC3 5LRRA 1CN1A 3NV2A 3MF6A 1RUG3 2R063 2C9AA 2DTYA 3OCPA 2ZGKA 2WS92 1PVC3 3UL2A 4X6RB 2W39A 1OA4A 1QJZA 4Q4W2 2WSVA 1R1A2 2HWF1 3E5XA 3WCRA 2EAAA 3L2HA 4IXLA 1H2LA 1O4YA 1X36A 1AYM3 4GA9A 2R1DA 3FLRA 2JE9A 4P9YA 5T55A 1DG6A 4XF1A 4QQHA 1C1LA 2YPJA 4XFBA 1XU1A 4C90A 4FPFA 1YXWA 2WQ4A 1BCXA 1YWKA 4CP2A 4KWKA 4NHKA 3RMXA 2DVFA 3WP4A 4PDWB 4PLNA 3R05A 4N7IA 4U2AA 2GN7A 1V6KA 2NP0A 1GZWA 1DGLA 5BNOA 4Q4V3 3ENRA 4AQ6A 2I45A 3OGGA 2F6BA 1V6LA 4FP2A 1SMVA 3TN91 5FPXA 2JXAA 4JGZA 3HR9A 1QQP1 1VBC2 1KRIA 4JQRA 1REDA 3UV9A 1RJ7A 3J4UH 1OOPB 2JENA 3KGZA 3IKWA 1PVC2 2GU9A 4PLOA 4XMAA 5JZGA 3VDDB 4COWA 1S0JA 3M7AA 4FPEA 1LENA 2AUYA 3FBYA 2JKBA 3OPZA 1VAMA 4Q27A 4LR4A 1F5JA 3FBMA 2UY8A 2RS51 1W2UA 1J3RA 5K0UA 3CLPA 4Q0SA 2BEOA 3PNAA 4CEYA 1OFSA 1MEC3 3USUA 5KHKA 2DVGA 1OPOA 3E5UA 1KDKA 2YZ4A 2ERFA 2EALA 2RM21 3N35A 5JR7B 1MS4A 4R52A 1NA1A 1OQDA 1JTZX 5JSRA 1BYHA 4DMIA 1Z78A 5AC91 2Q4SA 3AP5A 2BVVA 3SH5A 1WGPA 5F6LB 1S0CA 2Z5WA 5T5OA 3PMEA 4XOGA 4UW5A 5JLVA 3ZN4A 3EJKA 1LEDA 2CWMA 5I0TA 2E6VA 1FV3A 2ENRA 2VVEA 3OTFA 5H9PA 4FT8A 1G6NA 5I93A 1ND3B 2CAVA 4W6XA 3ZFGA 2YXSA 1RUE3 5FDBA 4L9BA 2VVFA 4KQ7A 5GZEA 5BUVA 5IK4A 2DVBA 1C4RA 2VMHA 4Y1VA 3MZHA 4QM9A 2PLV2 5A33B 4LO7A 3MIGA 3PTYA 2Z42A 5FRAA 1LB2A 5KWRA 4IEZA 1RUI1 4E2SA 1VBE2 2OVUA 3OBTA 5FBZA 3VN4A 5HBAA 5KHJA 5DG2A 4RFT0 2WT0A 2KM2A 3AYDA 5ACA3 2H0BA 1RVF3 4XJAA 2VECA 5H9RA 2DCKA 4HZFA 3ZSLA 5BNQA 1QY4A 4COZA 3X29B 2D44A 4K1YA 3O5SA 4KWJA 1HXS1 2SBAA 1K5MB 1VBD3 2DF7A 3PVBB 4Y26A 2HWE2 3S30A 4B4RA 5EJ3A 3SXWA 5CFCA 1Q5OA 5EFUA 3AMNA 1MQTB 5FMOS 4Z2WA 5IK7A 4FOYA 4P9LA 4R4XA 1W0OA 4HK8A 4N53A 4EN6B 1WD3A 4IEVA 2SLIA 4UW3A 2P37A 1S0BA 2WA4A 4IV3B 1GNZA 2GNBA 4JDOA 4OI2A 1ZZBA 2QCSB 3TBDA 4IEYA 1H1MA 2PAKA 5JOZA 3WDYA 5AVAA 1PNGA 2B42B 5KHIA 5KXEA 3VKNA 4YG6A 4AHXA 3ZIXA 4AFAA 5CVRA 2ZX2A 1ULFA 2IWGB 4XXPA 5CFDC 1RVF2 2HWD1 3U4XA 2HWB2 3KQRA 2QKDA 3WG1A 5J36A 1H0BA 4NOTA 3ACLA 1C5IA 1QJU3 4PIYA 1G9FA 2GH2A 4HSJA 3ZXGA 1G9BA 1S55A 5E16A 1ENRA 4Y1YA 4GULA 3VHPA 4NHMA 5CNAA 1VLNA 1W6MB 1W6NB 4IV1B 3IBMA 3ES4A 4AFDA 2XJPA 3GBWA 4MGYE 1O3SA 1SLTA 3FMGA 4E9KA 2BFUL 5H9SA 3ZFFA 1CIWA 5CAZA 3R4DB 3CEWA 4N90A 3BB6A 2ZAAA 1ASJ2 1WMFA 3ZFEC 2CGNA 2PYTA 4Q4V1 3K51A 1W6PB 2ARBA 1LOBA 2K2SA 3B7MA 3WDTA 3GBGA 1BBT1 1OMIA 1EAH2 4AK3A 1BQPA 4LBQB 3V65A 3RMYA 1FX5A 2TNFA 4KG0A 4WVWA 4RGGA 3VBFC 1HV0A 4AVCA 2MEV2 3MPPG 1PGL2 3GYDA 1IKQA 1YIPA 1Z7S3 2VULA 3LB9A 3MW3A 4HKLA 1UKGA 4P9JA 2OA2A 4HBNA 5JPNB 1CAVA 2ZGMA 1M4WA 2ZGPA 3NAPB 3P3NA 4V1PA 3FHIB 1AL21 2JEMA 3ASIA 2TEPA 3PMSA 1MEC1 2R072 4Y1UA 1J1LA 3SCHA 4XZPA 2EXIA 2X29A 2NYYA 2WT2A 4M3CA 3AX4A 4M00A 3AYEA 3DF0A 4EROA 2GNTA 2W68A 1BJQA 3VDDA 3M1HA 3WY6A 2R16A 2PELA 4B7KA 3NO8A 1EY2A 2GNMA 1Q8PA 4OHXA 2ZHKA 2WLPA 4AEDC 2NQYA 4JGYC 4R9DA 4R9AA 3OY8A 4YZ5A 1ONAA 2B5HA 1RUE1 3HN1A 3FUOA 3AYAA 2YROA 3JD73 1QJY2 1Z7S2 4TYSA 4RGAA 1RINA 5EXOA 1DYPA 1AR92 1RUC3 1WLDA 3VZLA 2OZJA 1H8VA 1ULGA 1R091 5L19A 2R0HA 4XFIA 4META 4Q4X2 4XJUA 4CZSA 1D4M3 1LCLA 3RI8A 1LULA 4KG8A 1LOFC 3KB5A 3PVNA 4CDUC 5F9TA 1ZRFA 3FFQA 3KT1A 1J59A 1A8MA 1TME3 2UYBA 1YHFA 3R6SA 3WQ1A 2JG8C 3H0OA 3ZXLA 3J26N 3B93A 1DGWA 2QDRA 2WZR2 4LNVA 2WT1A 3AYCA 1MZ5A 5A33A 4BE3A 4S2HA 4DZGA 1LOGA 3NL1A 2PTMA 4E27A 1MVEA 3WP5A 3QCWA 5JIAA 2F4PA 1ULDA 1EV11 2V73A 4N43B 2ZGOA 1WCSA 2ZZJA 4YFZA 1ZM1A 3MI8A 4FQZA 2CV6A 3KCYA 1PO22 3MLJA 4IEWA 3MEPA 3TAYA 3ZX7A 3VZKA 1AR83 2WFPA 3IPVB 5H9QA 1K5MA 4I0AA 4B4QA 1C3HA 1WD4A 1MR5A 3IMNA 1VBA1 1D0GA 4LO5B 3AKTA 3QLQA 2C0ZA 1MQTA 2WA3A 3LWCA 1W6QB 2DURA 5ABJB 1POV1 5J37A 4EN9B 2ZMLA 4A7KA 4AVVA 4IV3A 3GZAA 4PJYA 4IERA 1H4GA 2R30A 1YRZA 1UU6A 4NHLA 4Z82A 3WP6A 5KBFA 4LBLA 3AZWA 5A3LA 4DRVA 1FOD3 5GALA 4NVPA 4AWDA 4UXAA 1IGOA 3WQ7A 1BMV1 4CP1A 1MZ6A 5C4WC 2AR6A 1B35C 3WDXA 4OI0A 4TSVA 1KITA 2RS11 1PVXA 2ZGUA 1MS1A 1YNAA 5AVPA 5JI9A 4CP0A 3FLPA 5A3MA 1TMF1 5HCFA 2XBO1 1VJ2A 1H8TB 1O4TA 1RUJ2 4HFSA 2D5HA 1B35B 3ALQA 4IEQA 2ZJCA 1IZ3A 2XJTA 1HQNA 3AMPA 1MS9A 1QKQA 4Q0QA 4M01A 1W6MA 4AFCA 2A6ZA 4YVWB 3U07A 1BEV2 3EHKA 3JQXA 3J8F3 1GR3A 4RS5B 3W59A 3WHTA 1GLHA 3RI9A 2Z69A 2FZ2A 1NYWA 4LBJA 2ZHLA 2JE7A 4OHYA 1NE6A 1RMU3 1W6PA 4FPKA 1OSGA 3ILNA 2OUHA 1LOCA 2AENA 3MW4A 5CIRA 2HWF3 4LBQA 3AKPA 2BUKA 4C0HA 5HCAA 2D43A 1SLLA 2DUQA 3ZFEA 4HKOA 3M3CA 4XHXA 5I8TA 2PHDA 4Y22B 4QHBA 2GMMA 4WV8A 1RUH1 1Q3EA 3OYWA 3BIWE 1OLRA 2N7GA 3DGTA 5DDJ2 1ENXA 2OZ6A 4FPJA 4OFGA 4H55A 1ZZ6A 4Q4Y1 2Z2SB 1JUIA 4ES8A 3HD8B 1SLIA 2X5IB 3HMYA 2DU0A 4FVVA 5T5JA 3E6BA 5C9AC 5K0UB 2D6OX 1RUC1 1KD7A 4CEYB 5GLWA 3L2YA 3PJQA 4FPGA 2RJKA 1UF2C 3KT4A 3PVEA 4BMBA 1QQP3 4AQTA 1VBB1 3IN9A 1BK1A 4AF9A 4I3GA 3M3EA 2RR12 4YZ3A 1AX0A 3RJRA 3VBUC 3BCWA 3TWIA 3H3UA 4BIFA 5AFBA 3GZUC 2D7FA 4MGZE 1CPNA 2ZABA 4L8QA 2GC2A 4IL7A 3I54A 4I01A 2VW1A 4URTA 3KZ4C 3WHUA 1MS0A 4HVRA 4JGYA 3ZFGB 2H6CA 2RM23 3AMMA 3OGJA 3VBOB 1HRI2 4GMP0 4I3PA 1LECA 2K0GA 3N7JA 2A73B 4GB31 1HQWA 1NCRC 2BYVE 1DGWX 5AC93 1SFYA 4P9IA 4L99A 1G86A 1Q8OA 2QQPA 1PZ7A 5EYXA 4D94A 1FMD2 2GN3A 5L73A 3TN92 1RITA 3N7MA 2PA7A 4B3NA 1AR81 2ZKLA 1TNFA 1QQP2 2A7AA 1QDOA 1ZA4A 4LUKA 4I30A 5JDBA 1CAWB 3JBG1 5FO7B 3ZN6A 1LOFA 4OHWA 4CDUA 1LESA 5GLTA 1M06G 4WVVA 4GKYA 1Y9QA 2ZTNA 4FPLA 2GMPA 3OJBA 4U36A 4KL1A 2JG8A 4MXWB 2WNVC 4N43A 2RS52 2D97A 2X8KA 3WG3A 1Q8SA 1SLCA 2DFBA 4Q0UA 4LLOA 3SLIA 3V0AB 4N53B 1RUI3 3IPVA 3ZPYA 1RIRA 3QH6A 3WD5A 3S7IA 4R9BA 4E2GA 3LZZA 4NN0A 4XFAA 5KC6A 4KGGA 1KDMA 1WMDA 4QPIC 1PIV1 4BOWA 1IPKA 1CONA 1HXS3 1V6OA 1L3JA 2CGOA 4JVAA 5EYYA 1NLRA 4PLMA 1F31A 3ZXEA 4LEJA 1ND2B 2WLQA 4J1WA 1YFXA 3CF6E 4CYDA 4XE9A 4YM0A 4EN0A 4RHV1 3MIFA 1G9DA 4H7MA 5KXCA 3VBHC 4XILA 2YMZA 1ZZ7A 1LEMA 1RL3A 1CPMA 1ZRDA 4DY3A 4D7SA 2RS32 1RHI1 4YZ4A 1RMU1 1NY71 2VUJA 3ZFFB 3EO6A 2NMNA 1RJ8A 4P9XA 2Q1ZB 3TYJA 1H8TA 3AXEA 4S2GA 1B35A 1V6MA 2HWD3 5BPXA 2OYZA 4CEWC 2D6KA 2XJVA 4FTEA 5FREA 5KC5A 4YVWA 3WV6A 3K48A 3ETQA 3JU9A 4RS5A 3DPRC 3RG0A 3PHMA 3FUQA 2R041 5T3NA 2PHFA 5E1RA 4AQSA 3SNMA 5BNPC 1VB2A 1QXRA 5J96B 1PNFA 2ATFA 3UK9A 1PO11 3SH4A 1CAVB 2GC1A 1WBLA 4COVA 3AKRA 4P5HA 1ZBA1 4AVBA 4C1XA 3AFGA 1BBT3 4M3CB 3D5OA 4Y22A 5F1RA 1W0PA 1AX2A 1PK6C 1RUG2 2D93A 2R062 4YGEA 5DXDA 3ST7A 1FAYA 1V9U3 4L2NA 4AEKA 3T1MA 1X33A 4XQWA 4A7YA 1V6JA 4P9GA 1GNHA 2AGSA 1UZZA 2H0VA 3QH7A 3ZXKA 5C6CA 3GNEA 2XHKA 3B00A 1QJX1 1WW7A 2XGXA 1S0GA 4CTEA 1RGSA 2EVXA 4FOVA 1AYM2 3AZXA 4LE3A 2WNUC 1LHUA 1AVBA 2X5IA 1UD1A 2HWC3 3WDUA 1AL23 1YJKA 4Y20A 4HLTA 1JH5A 1JXNA 2R0FA 3OY8B 4HT1T 1XNBA 4X8NA 2VPVA 5GZGA 4YARA 3AP7A 2JG9C 4YZ1A 3CJIC 4Z8BA 4YGBA 1FT9A 4OUMA 3A4UA 4KU8A 1SLBA 2P2KA 3M8LA 4KBBA 1N1VA 1UL9A 1QOTA 4ASLA 3WX5A 5C9AA 1RUD1 4Q4V2 4YM2A 1QF3A 4QQPA 4TLFA 4MGIE 2IXLA 1V6IA 3TRSB 1QDCA 3H50A 1CR7A 2LTNA 3VBUA 1ALYA 1H30A 2CNAA 4A7ZA 3VBOA 1U5XA 4Y4YA 2VMIA 4S2FA 1HV1A 3TOJA 4INDA 5IK8A 4OHVA 2VH9A 1H9PA 2VG9A 4AEMA 2MPFA 1VRH1 2PQQA 1ZX5A 1PGW1 3JB8A 4JTOA 3WW4A 3WINE 1AL22 1AR61 3C2UA 1I1EA 1R093 2HYKA 3H8UA 4PF5A 1MEC2 2E53A 1ZREA 1DQ0A 5D8AC 3A0NA 4XXAA 1APNA 2DUOA 1LGBA 3ILFA 5DUVA 3WCSA 4CDWC 1NCRA 4YW5A 3VBRC 3JB4C 3LKJA 4ZXKA 4HN0A 4YM3A 1YIFA 3JZVA 4WZCA 1CAWA 2G9FA 2C1FA 1ZBE3 2TBVA 1XNDA 1KJRA 1HQLA 2P3JA 4XFHA 3B01A 3VKLA 1ZNPA 3MPBA 4MXWA 5DZFA 2D3PA 2HKXA 4XMIA 2E7TA 1H1IA 4Y1ZA 1WLWA 1EPZA 4R4ZA 2XLAA 3WNXA 1RUE2 3V0AA 1R1A1 4I09A 2WFF3 2EA7A 1EV13 2ZAHA 4GXLA 4RD7A 5KHHA 4Q1RA 1U5ZA 3H1MA 1E57A 2B39A 2P3KA 5T50A 3VZNA 1A6CA 3VBSC 4ATFA 3THTA 3R0RA 4XIKA 1S0EA 2E7AA 3VV1A 1REFA 1QNYA 3ZMNA 4WVMA 3RYRA