4D7YA

Crystal structure of mouse c1ql1 globular domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
PRVAFYAGLKNPHEGYEVLKFDDVVTNLGNNYDAASGKFTCNIPGTYFFTYHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVILHLDAGDEVFIKLDGGKAHGGNSNKYSTFSGFIIYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C1Q-RELATED FACTOR
publication title Anterograde C1Ql1 Signaling is Required in Order to Determine and Maintain a Single-Winner Climbing Fiber in the Mouse Cerebellum
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 30
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d7yA00
2Q1MA 1XU1A 2JG9C 2JG9B 2JG8B 2JG8C 3TYJA 1IQAA 2OIIA 1D2QA 3QBQA 2AZ5A 3FC0A 4MXWB 4QQHA 3TWIA 4QQLA 2Q8OA 1C3HA 2WNVC 1S55A 1U5ZA 1DG6A 4G4FA 3QD6A 4DB5A 5HBAA 4HT1T 2R6QA 5TSWA 1OQEA 4E4DX 4E4SA 1A8MA 1RJ8A 4G3YC 4QPYA 2R30A 1OSGA 2QE3A 5KC5A 4GIQA 2RJLA 2TUNA 3AB0A 1XU2A 1PK6A 3V56A 3K48A 1C28A 2WNUA 3LKJA 1U5YA 2RJKA 4DOUA 1JH5A 1KD7A 2ZJCA 3ME2A 1JTZX 4OUMA 4OUSA 3B9IA 5L19A 4RSUA 2WNUB 4NN0A 1OQDA 1RJ7A 4EN0A 3ALQA 4QQOA 2E7AA 4J6GA 4OULA 2O0OA 1D4VB 1U5XA 3IT8A 1I9RA 3MI8A 1TNRA 5KC6A 2JG9A 4QQPA 4KGQA 2JG8A 2TNFA 5L36A 5BNQA 1ALYA 1DU3D 4F3JA 3L9JT 4MSVA 3B94A 4MXWA 2HEVF 1GR3A 3B93A 1PK6C 1PK6B 4MXVA 2WNVA 5CIRA 2WNUC 2Z5WA 3URFA 2QDNA 2ZPXA 4D7YA 2HEYF 1KXGA 1WCKA 2KA3A 4N90A 4TWTA 3WD5A 5KWRA 1D0GA 2HEWF 2R32A 2WNVB 4KG8A 3K51A 4QQ2A 4TSVA 1TNFA 2RE9A 4KGGA 1O91A 2X29A
chains in the Genus database with same CATH superfamily
1R091 3A4UA 4P9JA 3VBHC 4Q4Y2 5T5LA 2Q1MA 5IK4A 1SPPB 2VMDA 1XE7A 4JDNA 1CJPA 1KEXA 2WSUA 3M3EA 1LOBA 4UW4A 4C91A 2ZEXA 2VXRA 3PNAA 1H9PA 3LA3A 3POYA 2AZ5A 3FN9A 4Q26A 1TVGA 2ZHNA 2ZGNA 2GALA 3AP9A 3RI8A 4FCAA 3ZR6A 5A6QA 4TTGA 4MGTA 3ASIA 5D8AA 4YVSA 1OPOA 4TZDA 3VDDB 4HK9A 4HN1A 3U78A 3HNYM 3ILRA 2EAKA 3TRSB 5CBLA 5SV8A 4M0NA 3ZLIA 1W6PB 2EXKA 2A3XA 3UKVA 1UOJA 2IFWA 2QQPA 1KFXL 1QJX1 2YGLA 1LOEA 4RL7A 3PMSA 4Y5TA 2BTVC 1VP6A 2QJVA 2VCAA 2ZMLA 1YI7A 4XMIA 1W2OA 3P3NA 3S5QA 5FZAA 2R30A 3I2IA 1OSGA 1OF3A 1UU5A 1YQCA 4IE6A 4NRPA 3VBRB 1O8PA 2HWF1 3WG2A 4AEDB 4FQ4A 2YBKA 4WM7C 1RUF3 1ULPA 1SACA 2B46X 2P17A 3WDVA 3WNNA 4RGAA 4Y1ZA 1WLWA 3MF9A 3TEWA 2PHTA 4PQQA 1WD3A 3ZXGA 3GJBA 1BEV1 1R1ZA 2UY8A 4M00A 2KM2A 1DGWX 1XNCA 5FJKA 2ERFA 2AR6A 2ETEA 2PQQA 4HXCA 3K3OA 2E6VA 3I3MA 4OUMA 2W47A 5CFCC 5L19A 5DDJ1 2OS2A 3RMYA 1SLIA 3VHRA 4HMZA 1W8WA 2P5BA 5A1LA 4J6GA 1J3RA 4LIVA 4YM3A 4FTEA 3KS7A 2D6OX 2YBPA 4QKNA 4BQ4A 2JEMA 2B9UA 4PLMA 3WP4A 2XJQA 4Y22B 1YNAA 1Y7BA 3DGTA 5C4WA 4AQTA 2BEOA 3WW4A 1M4WA 5BNOA 3OYWB 1H2NA 3C8XA 4OI1A 3BTAA 1VBB1 3A7QA 4XTPA 2XVGA 4OHYA 1C8M3 1COV1 1LAJA 3T4VA 1W8TA 4ZY9A 4YGEA 4JGYC 3WG4A 4AEMA 4GH4C 5LZ6A 2V5DA 3LOIA 3WEZA 2RS11 3LSDA 3MIEA 2WNUC 4P9YA 4ZU7A 5FZEA 1PGL2 3CIHA 2QKDA 4L8QA 3VZOA 3N3HA 4D6SA 4IESA 1S0CA 2IVJA 3ITQA 1UWWA 4AWDA 4TWTA 1RUE3 1DQ5A 2YC4A 4B7EA 3JB4C 1ZBE1 5FY1A 1ENRA 3DYPA 2E33A 4KU7A 1PMHX 2ATFA 4CXWA 5KR7A 4KH9A 4BIFA 3U10A 2JECA 1XJAA 2Q5TA 1QH7A 2ID4A 4YZ2A 4BQWA 3AMNA 3V0AA 2YU2A 4XF4A 4KNCA 2C9AA 4WVZA 1F9KA 3HWJA 4LK6A 1B35C 4QX1A 5BV6A 4ORFA 3CLPA 5CB7A 1VRH3 5FP3A 3CF6E 1GICA 5KXEA 1W9SA 5IFPA 2A6XA 2RM23 1QKQA 1MEC2 2GC0A 3NNMA 4PQ9A 3CMGA 4I0AA 5DQ0A 1JUIA 1LEMA 3JD71 4YGCA 3KT1A 4W65A 1OMIA 5E16A 3MICA 1ND2A 3DPRA 2YHJA 3NV1A 1YFYA 5BYNA 4BIOA 1YC61 2A3YA 1QOTA 3N7JA 4NRMA 3PVNA 1WW6A 2ET1A 2W1QA 2HYKA 1SDWA 4I3GA 4NHKA 4XHBA 4CDQC 4KWLA 3VV1A 1DYKA 3THPA 1W06A 1Q3EA 4NIAA 2HJIA 2EIGA 1NAEA 4LHKA 1HRV2 2YFZA 1ND3B 2A6VA 4UFJA 1F5JA 3KVBA 1AR72 4HT1T 5TSWA 5JXHA 1WKYA 2X5IC 5FYTA 3B3QE 1Q5OA 1QWRA 2PMWB 5FZ4A 4IEQA 4LBQA 3L2HA 3ZFGC 4UT5A 2JDMA 1TME3 3OGVA 4LITA 1W8NA 2JDUA 1IPSA 3IMMA 1LKNA 1JMUB 1KQRA 1FMD1 2JB8A 2R071 3GZEA 3NV3A 3Q8BA 2BZDA 2E32A 4PJYA 4XQ4A 5LK7B 2ZGMA 1BJQA 1RUJ3 4XUNA 3V56A 1WWYA 4EN9B 2R043 3I3BA 1WW7A 5T3NA 1FNYA 5JOWA 3RZZA 4D8MA 4E2SA 1N1SA 2R063 5HXMA 5FYCA 1YJLA 5F5QA 4DPNA 1NKGA 2V4AA 2GN3A 4AI1A 5L9VA 2JE8A 2WDBA 3DV8A 3PU8A 4LLOA 5EYYA 5L7OA 1D4M3 1URXA 4QDQA 4QPIC 2HLEA 1UAIA 4B4RA 4M01A 1UPSA 2BGOA 2JDAA 4AHZA 5BNPA 1O3TA 2CGOA 3ABZA 4LBOA 3ZYJB 4IV1A 3PURA 2XL7A 1GWKA 3AMMA 1VBA2 1DGLA 4GJZA 3J8F2 4Q4Y1 4A44A 1I5PA 1V9U2 1DHKB 4XFAA 4IEOA 3RPQA 1CWPA 3ZYHA 2XJSA 2XJVA 1VBD2 2A3WA 2WKKA 4P08A 2R061 3VGIA 4AZZA 4UOJA 3LAGA 2VZ3A 3MIHA 4XF3A 4XEZA 5F3EA 4AAPA 5C5UA 5C8CA 2MEV3 4CU7A 2PTMA 2ENRA 1HB1A 1D4M1 2PAKA 2I45A 2VCCA 1AR92 3OGGA 2XVKA 3B93A 4XUTA 1LCLA 4KQ7A 3VUOA 2Z2SB 5DZFA 2O14A 2V09A 2CYFA 1HB2A 4J25A 3RYRA 4QPWA 2C26A 4Y24A 4J1XA 2W2IA 3PJQA 2GMMA 4F8AA 2PHXA 5KHIA 5H9QA 2JDNA 1PNFA 4M3CF 3VZKA 2XWBB 3I4IA 5JZGB 4L2NA 3C7GA 4YRDA 3ZIWA 1OURA 1TMF3 1UF2C 3NKTA 1VPHA 4NUBA 2BWAA 3VZLA 4HKLA 3OJBA 5FUIA 4AL9A 1HKDA 5ACA2 1JUHA 3KT4A 3LEMA 1BVVA 4NPLA 3T2QA 1NT0A 1OUXA 5IAVA 2GNMA 4E2GA 3VBOC 2WR9A 2VZSA 1PMIA 3H7JA 4FP2A 4N9IA 2XKOA 3ILFA 4LK7A 1S0IA 5HV0A 2G19A 3E6DA 4DO0A 3NJVA 1OA2A 4QD2A 2P1BA 1C1LA 2A73B 3MUY1 4DIQA 4JKLA 4ISQA 4O9EA 1CR7A 1T2XA 2WBKA 2H0BA 2YMZA 2A71A 3D0JA 4JGZC 4OQ9A 3S7EA 2DTWA 4BISA 1N3QA 4DUXA 2VZVA 2HKXA 4F7ZA 5JWPA 2E26A 2A70A 3U14A 2Y33A 4RQPA 1UOFA 3ACIA 1PIV2 4HN0A 4AK3A 5JDBA 4JVAA 1ZBA3 3WQ7A 5FYYA 5E89A 1BBT2 4E4ZA 2V5YA 2ZGRA 1VMFA 3SC7X 3KWVA 5HBAA 4K9SA 3Q8AA 5T5JA 1OLMA 3DF0A 5FP8A 1K45A 2JWPA 3BODA 1VBC2 2D3PA 5F8PA 5CFDC 2WYFA 3ZFEC 1WMFA 1SMVA 4Y1VA 1X36A 1X82A 3C7OA 1UXZA 1S0DA 2PYTA 3WUCA 1VE0A 4PHZA 4BK5A 4LEJA 3T1LA 1T6BX 2Q1ZB 1ZBA1 3AZYA 1PGL1 3PL0A 3TEXA 2B45X 2DVFA 3I59A 3ZYIB 5EV7A 2E53A 1AZDA 1JHNA 2ZJCA 5LA2A 4BQXA 2AEZA 3RRDA 4PLNA 5ERLA 3QH7A 4Q29A 5FCCA 3M2MA 4G9SB 1OBNA 3CHXA 3RWNA 4YVSC 4EWDA 3K75B 3OY8B 4XUQA 5FZCA 4MUVA 4MV2A 1J83A 3G7DA 2LROA 1DGWA 5ABJB 2J22A 2VH9A 5FZ7A 3KQ4B 4YGDA 3TNQA 2AACA 2I07B 2JD9A 5FMOS 3UKNA 2F6BA 4GB32 3I49A 1RUD2 5LBFA 3MI8A 3GYDA 4WVMB 1ZX5A 1NLRA 2FHRA 1SFYA 4Q4V3 3J9SA 2NLRA 4NAMA 5CU1A 3T08A 1MEC1 2VAUA 1RGSA 4GWJA 2PHUA 5A70A 1N1VA 3H50A 4KWKA 4E8DA 1REFA 4Y3OA 4F3JA 5JMOA 1K42A 3B94A 4OMCA 4HPKB 2B9VA 4NHYA 3U07A 4DXSA 2GN7A 1PK6B 3BIWE 4WVVA 2PA7A 3KHBA 3ZXDA 5IVEA 3PTRB 1UOGA 2D98A 2IXIA 3FHQA 4K40A 3T4HB 3S57A 2D97A 2QQOA 2ZPXA 4XTMA 4OLLA 1HRV1 4ONUA 5K0UA 2OT7A 5CAZA 3X29B 4CPBD 1AR71 4XQDA 5JXGA 1LOAA 1E5IA 4QPGA 5IYYA 2TBVA 4C1XA 3T09A 1DLCA 3WQ1A 1LGCA 2VMFA 2RE9A 4UWDA 2ADDA 1UO9A 1NX9A 2RG4A 2W92A 1FAYA 5GALA 1Q8SA 2H0VA 4IQPA 2PFWA 4AEKA 5C4WC 2BOIA 1XYNA 2TEPA 4ZPIA 5BNOC 3D0SA 4AI9A 1DF0A 3NW4A 1I1EA 1PO13 2OIIA 1DCSA 2VOXA 3PMEA 4WBBA 4OI2A 1HRI3 1YFWA 2DVGA 1UCXA 1EPZA 4WM7B 1PZ7A 2XOMA 3NAPB 4NE9A 1A3KA 4CDUB 4Q0QA 4UW3A 5C71A 1W6NA 3MF6A 4R4ZA 2RDQA 2IUWA 1XSQA 1RC6A 2WN3A 4H7MA 2BNMA 5A6XA 2WNEA 1PGSA 1V00A 2WWJA 1W6OB 1VBA1 1P8JA 3UGHA 3PUAA 4BLIA 2H6BA 3LDRA 2JE9A 2QQLA 3ACHA 1V9U1 4XE9A 3MLLA 5JR2A 3FBYA 1BZWA 1J1LA 5T50A 1DZRA 1VBD1 3THCA 4ARXA 4UAPA 4XDQA 3ACFA 4Q4W2 2WAOA 3WG3A 1S2KA 2XKPA 3PIJA 3TN92 5EJ1B 1DP0A 1FXZA 5A33B 3KV9A 4XW3A 4COVA 2ZX4A 2FQPA 1IS6A 5JUVA 3N7MA 1AR91 3I54A 1LODA 2XWJB 5A32B 1H6XA 5KXBA 3K77A 2DCTA 2ZS6B 2J1VA 1MZ5A 4IERA 5EPAA 3ZDVA 3WNLA 4AEJA 4MG2A 3ZKUA 5FZ6A 1RL3A 4BQ1A 1CZTA 4FO9A 5FZKA 4FSJA 4YARA 1KD7A 4NHLA 3DPRC 3WDTA 1YIPA 5A3PA 1W0OA 4JGYB 1C1FA 4LR4A 1S0FA 4GH4B 4PF1A 5K8SA 4EZ4A 4CEWA 1AR62 4EN6B 5KHJA 3RNSA 4RR3A 1YO8A 2PAMA 2WNUB 4UFHA 2LW8A 3JU9A 3VHPA 1RJ7A 2ZGSA 5ACA1 4MYEA 3USSA 1K5MB 3ALQA 2EIEA 3BN6A 4LA2A 5F6LB 4W6XA 5IK8A 2ZX3A 2GNBA 5E6HA 1GOHA 4M3CA 4PT6A 2FZ2A 1GZWB 4QKDA 4PLOA 4UF0B 4MOAA 2YYOA 1ZZ7A 3M3QA 4E4HA 5A7NA 1IOAA 3KB5A 2JG9A 4QQPA 2PQSA 2JD4A 1F4HA 1OH4A 2WS93 3CJIC 3M1HA 2WO1A 1NOVA 3KM5A 3DYMA 1NCQA 5GJ6A 3RQ0A 1B35B 4NAOA 3NWKA 5LBCA 3RVHA 1OOPC 1US2A 4XJUA 1UZYA 5F3CA 4CP2A 2F4PA 1UYXA 2DFBA 1EPWA 3H1MA 2SBAA 1RXGA 4BK4A 2DU1A 4N7UA 1RUC2 2HH9A 3UNPA 1UIJA 1J1TA 1PIV1 4QB2A 3ACLA 2QDNA 4DEVA 3PUQA 5FZOA 4GALA 4XUOA 2W52A 4A2UA 4YVWA 2F4LA 3POJA 1VIWB 1APNA 4CDQB 3UGFA 3I2HA 4BCUA 5A3OA 5BNPC 4V1PA 1S1AA 3OUIA 4IV1C 1AX1A 1LEDA 1GKBA 5T5PA 2R16A 1UU6A 1W28A 1IG0A 3ELNA 4FXKB 4CP9B 4MGZE 5FY9A 4HFSA 1NG0A 4AFCA 3WINE 1US3A 1DYOA 2VUAA 3OUJA 1RUD3 2JG8B 2LM3A 2X8KA 1LTEA 4CUGA 2WQ8A 3GCWA 4YM0A 3ZFGB 3C7FA 3OTFA 3KCYA 4QX0A 5C33A 1AX2A 5C8CC 2HWB2 1NQDA 1SLBA 4LUKA 1LHVA 1NZCA 4QM9A 2ZEWA 1OQ1A 1UXXX 2GDFA 2ADEA 3DCQA 5FMBA 4CDWB 4CCKA 1AXYA 2B8MA 1YCIA 3SH3A 2XONA 2Y0IA 2Y6KA 5FRAA 4LBMA 4X8NA 1SFPA 5FYUA 5C3QA 4AHXA 4CTEA 5IUQA 2XGXA 3MIFA 5A3UA 3R4SA 3O1VA 1AJOA 1CAXA 2W95A 1RUD1 2AENA 4GB31 2BP6A 2X10A 4GZ9A 4W6WA 3AMHA 1IS5A 2W1SA 1J59A 5FWJA 5I8YA 3I8TA 1GZTA 4ZZ5A 2D93A 3POFA 4I09A 1RUG2 3E5UA 3RZKA 3O7OA 1AL22 3NSTA 3ZR5A 4A45A 1RUI3 3HT2A 4GJYA 5CKQA 5EHDA 1JZ3A 1CVNA 2XUEA 2BPA2 5IVJA 2DUQA 4Q0PA 4DRRA 3BB6A 1YIFA 1U5YA 2ZACA 5IWFA 5F5AA 3VDCA 4ZKTB 1W9WA 1ZZCA 3RYKA 3OEAA 4F83A 2GC3A 1VAVA 5E8AA 3ME2A 5GKAC 5LRSA 4N9HA 3H1YA 2WQ4A 2WLQA 3Q8FA 4HKOA 1XNAA 3WF1A 2V72A 1UMZA 2VJXA 3IB3A 4RQPC 3H8OA 1CZSA 3RZGA 1H2MA 4B29A 2JE7A 4WM8A 5AFEA 4JZRA 3KGLA 4RYDA 5JOXA 1S0JA 3VDAA 1NE6A 4AG4A 4JQTA 4FT8A 4MGIE 2MHFA 1UQXA 5FIXA 3K4DA 4ZXEA 4UFMA 1WBFA 2GU9A 2VMCA 3WF2A 4CRQA 5IVCA 2TNFA 5IVFA 2W3JA 4XBQA 3VBOB 4EYUA 3O1UA 4XXAA 1ALYA 4TLGA 3VBFA 3C3VA 3CL1A 3NQHA 2WZ8A 4YZ5A 3HQUA 2N7GA 4MLOA 2OPWA 3AVSA 4LKEA 2QFEA 1FPN2 2HEVF 5A7WA 5FY4A 4UYBA 3W20A 4D6RA 4JKMA 4LPLA 4QDSA 1YXWA 4JHTA 1FV3A 5IT6A 1T6GC 1PVC3 2CGPA 1KJRA 2ZBJA 1CIYA 4JGZB 5CG9A 4D7YA 3H8XA 3FLTA 1L7QA 3WD5A 5LB6A 3W21A 1JU3A 2VQ0A 2BERA 5C9AA 1EAH3 3RZLA 2WO2A 3VBUA 3AZXA 2WT2A 4LBLA 3CO2A 3ES4A 1FX5A 3I3DA 4Q4W1 2FDGA 1QJY3 3N35A 4P5YA 4JRAA 3TN91 4KGGA 5APAA 3LEIA 3DUIA 4QQOA 4Z2WA 1W6MB 1NCRC 2BVBA 2CAUA 2PELA 2UURA 3AZZA 3CQOA 1OC1A 3DYOA 4C0BA 3IM0A 3TEZA 2F17A 2VC9A 4MZUA 1H4GA 1PMJX 1R093 3JUUA 1W2AX 2CHHA 2YG0A 3J7HA 4DNYA 3USUB 2QUOA 4IL7A 1UYYA 4P14A 4AI2A 4YLZA 1X9PA 3SKJE 1BMV2 3ZXAC 2BWCA 5I91A 3BTXA 1UZWA 1SG3A 2RDNA 5IVVA 3O0WA 2VVFA 1W03A 1YLLA 1AYM2 2HBTA 1AHSA 2VZOA 3CZUA 5DUXA 5FY7A 3ZFFA 5IVBA 5JCTA 1C3HA 5FPXA 2Q8EA 2FDKA 1DG6A 1QJY1 4DEQA 1U0AA 1ULOA 1LOFA 4COWA 1JOBA 1HN1A 3MLKA 1J3QA 2PXJA 1K12A 4BXFA 4OCTA 1PM4A 1QIQA 4NIDA 1CAWB 2RR12 3BOPA 4XIKA 5FPLA 1OQEA 3SLIA 1PGW2 3O12A 3UJOA 4RFRB 1QJX3 4GXLA 1GANA 2UU8A 4OHVA 4X6QB 3S30A 2CWSA 3OG2A 4CCNA 3WXPA 1LECA 3S0MA 3D8CA 2VOVA 3S6PA 3VD7A 1JZ4A 4AVSA 3BIEA 3NKGA 5D1IA 1LR5A 2TUNA 4AFBA 5BNNA 2EIBA 2WZEA 3NVCA 4HLTA 1MQTB 1RUH2 2HWF3 3I7DA 4E8CA 1RUC1 2Q30A 1H1MA 1K5JA 2B7YA 4P9XA 3W59A 2B4KA 2VBBA 3VKLA 2G9GA 4QDRA 2BGPA 4LHNA 4XFGA 5C3OA 4GD4A 4X8PA 1CPNA 1BEV3 3JQXA 3NNJA 3U75A 1JZ5A 3SH4A 4D3WA 4Q4X2 4MH0E 4ASKA 4NHXA 4D7SA 1OHFA 3ZYGA 4YG0A 2OW4A 3A22A 4Y1UA 2XMLA 1G9DA 2P6HA 2PAEA 5DDJ3 3GNEA 2FCUA 1AR82 2VNGA 2X09A 1H9WA 2UYBA 3ZKYA 2X53S 3QH6A 2ARAA 2DBNA 3IT8A 3U1XA 1UY1A 4AOCA 2ZGKA 5I8SA 3FBMA 1SPPA 3ILNA 3IWZA 4Y5SA 3LQCA 1JYVA 2HYXA 1KDKA 5L36A 1LU1A 2WO7A 2HWB1 4Q0UA 4AGVA 1VBB3 4HK8A 5IW0A 4BDVB 2Q1FA 2XXZA 1COV3 1RMU2 1Y4WA 1DYPA 2OX0A 2ZABA 4FPGA 5FMOL 2VUDA 5J98B 1XB9A 3KV6A 3OOXA 1KJLA 1OPMA 4KWJA 3FWEA 3E6BA 4LT5A 3CDZB 2RS13 1GFF2 4HSLA 3MW4A 4PCRA 3SHRA 3O1RA 5C3PA 3IIAA 1W6PA 3J7NA 5JR7B 3WQ0A 4CDXC 2KA3A 4CCCA 4CEWC 3CU7A 4LMFA 2R32A 5DAVA 3ZYFA 5F32A 4COUA 1ZRDA 4ET7A 2ZGOA 4AF9A 1ZBE3 1GV9A 4LOSA 1JZ6A 1I3HA 5FZ0A 2UWAA 1C4RA 2PHDA 4L97A 4FBFA 4O9GA 2OUJA 1TNFA 1ODNA 1UN1A 4NWWA 1RUG1 4OZOA 1IQDC 1QJEA 3LPFA 3VBRA 3HMYA 1W0NA 1ZZ6A 4OHWA 1AL21 2NYYA 3A0KA 4AEDA 1ST8A 2W1UA 2BFUS 1EV12 1NYWA 1IKQA 2YU1A 2D43A 3M4FA 2VY0A 2JG9C 4LNVA 2AGSA 3WY6A 3ZOIA 3I2DA 4M4RA 1UIKA 3V0AB 4MVTA 1UMHA 3N9NA 1RHI2 2MPFA 1NCQC 2WFPA 2ORZA 4FPHA 1Y9MA 5GZDA 2XBO2 1FOD2 4XHXA 4LTAA 3SCFA 4CCLA 1O5LA 5IHRA 3JD73 4MXWB 3VZJA 2ZHLA 3AJYA 4XAAA 2XQRA 2HWC2 4OI4A 2WYSA 1U5IA 3ZPOA 1XYOA 1VJ2A 4YW6A 3T0BA 1H2KA 3LFMA 5C3RA 3WDUA 3QD6A 1UL9A 3WDWA 4DB5A 3MLJA 4QGMA 5HCFA 4AQSA 2ARCA 4JC1A 1O8SA 2WJSA 4XBLA 3LCPA 4YVWC 4A41A 3LA2A 4HBNA 2XDVA 2IVIB 3OPWA 4LIUA 3WDYA 1VBE3 4MHUA 4Y22A 2FDIA 3NMBA 4QWNA 4NO4A 3WV6A 3VKNA 1ZA4A 3OYWA 2WA4A 4QPYA 5A6YA 1R1A2 5CADA 3U37A 3LOBA 2MNGA 2E7QA 2Y26A 1JYIA 4XIOA 1NLQA 4N53B 3MZHA 1REEA 1PNGA 3R0RA 5LEKA 3BALA 1PZ8A 4XURA 4B4PA 2R073 1FMD3 2Y0OA 4FFHA 1N1YA 5C7GA 5L73A 1X8EA 1QJU3 5FZ8A 3CJIB 3DEMA 5GZEA 4OZXA 2P3IA 2BV4A 2RJKA 1OOPB 4FI9A 1W9FA 3FJSA 1MPXA 5I0SA 1HJFA 2ZX2A 3CEWA 5F39A 2AUYA 2WWSA 3HVDA 1VBE1 5GLVA 5J3UA 4A7KA 3RMXA 4NPMA 4OYUA 5LCWL 4XUPA 2VCBA 1O3QA 5GZCA 4QB6A 2NQYA 3MGUA 1E5SA 3E1F1 2YFUA 5DPNA 2RMU2 3LEGA 1SBDA 4QX5A 4XJAA 4D69A 2P37A 3BYWA 2Q4SA 4AE2A 1IZ3A 4ZXKA 2XB6C 4DXZA 1EP0A 3ZYBA 4AHYA 1QJU1 1W6QB 4BLJA 1AXKA 4Q4Y3 1RYYA 3SCGA 4FPEA 3WF3A 5A7SA 2YDEA 5AC92 1BMV1 1AYN2 1CAVB 4A6OA 5JSPA 4YZ1A 3EO6A 2W46A 3P5BA 3ST7A 3ZN5A 3DN7A 1W2UA 5H9RA 3N9PA 4DXTA 2BW8A 1RIRA 2QQIA 4BOWA 2E51A 3VHNA 2WNVA 2DCYA 3GHMA 3IBMA 3URFA 3VDBA 1VMHA 2CL2A 3MPBA 1VLNA 4FP3A 3V64A 1D0GA 3CJXA 3WHUA 5F2SA 2RR11 1SHWB 5LY2A 1PGW1 2CAVA 3ATGA 4SBVA 5DN2A 1W2NA 2DFCA 2P6CA 4HG6B 4QXCA 4S2DA 1RITA 2DYCA 2EAAA 2VZTA 1XNTA 4KBZA 4FFGA 5DMYA 5K9YA 2GSYA 3FLRA 3SEPA 4CCDA 1G9AA 3RGBA 2VD7A 4AR2A 3AZVA 1DQ6A 1HIXA 2VMIA 3BOWA 5FPUA 1CAUB 1BVP1 4FFIA 3MV11 1CJDA 1SDDB 2VPVA 3BGAA 1ZZ9A 2W0XA 5JI7A 1RUH1 4XCBA 1V6MA 4HL0A 3WZ1A 2WSVA 2FD8A 2RDSA 3VBFC 3N9QA 3FC0A 4ZS3A 5JLVA 4FOYA 4Q4X1 3IAQA 4QQHA 1J84A 2GH2A 1JXNA 4EZHA 1RVF2 2CNAA 2ZCWA 1A34A 2VBDA 2VL4A 3NJZA 4G4FA 1AR81 1JZ7A 3JBG2 1W05A 4V2VA 3GZUC 3H1WA 1QNYA 5C9AC 1X7NA 3D5OA 5EJ3A 1WCDJ 2E7TA 4JTNA 4A42A 5A3TA 5IFTA 3THTA 5I0UA 3JZVA 4P5HA 3POIA 3O0XA 4FVVA 2QQUA 1LB2A 4XCAA 1GBGA 3GZAA 3ZSKA 4H14A 2WZR2 1RUOA 3HBKA 1GOFA 1H6YA 4GIQA 4IV3C 5T5OA 2LS6A 3WQBA 4OHXA 1W3VA 3UGGA 1ZRIA 1RMU1 2D5FA 5AFBA 1UYPA 5BY5A 5EFUA 1IGOA 5F37A 2G4IA 2YY1A 1S2EA 2LRPA 2PLV2 2QDRA 3T0DA 4JV4A 3V65A 1C5IA 1C28A 1OLRA 2A5ZA 2ZEYA 4ZU4A 2LUWA 3LKJA 5FZFA 1W9YA 2EVXA 2Y6HA 5CKMA 2G9FA 3H3ZA 2D40A 4NHMA 2P2KA 4SLIA 5JZGA 2R1BA 3ZFFC 4Q5OA 4PF5A 1H8VA 3VKMA 1LESA 1A78A 1X9TA 2PHLA 2PHRA 3OEBA 1X33A 1GUIA 1LOFC 2RS32 2GMPA 4CXXA 1NA1C 5LBBA 3CZJA 4P00B 4LA3A 1PHMA 1D4VB 3U0ZA 3MUZ1 1KRIA 1EV11 1TNRA 4DINB 4CEYB 3N4MA 1GQHA 3HIFA 3J7MA 1CX4A 2CWMA 4H55A 3B5LB 4Q1RA 3OUHA 2B42B 4U2AA 1HXS2 4Q1PA 5CG8A 1MEC3 1NCRB 2XBO1 2D6LX 1FOD1 3IPVA 4PDWB 4TXWA 1RXFA 5BNNC 4UW5A 5I93A 4KU8A 2VW2A 2VXJA 3L9JT 3RJ2X 1G8WA 1IHMA 3Q9OA 4BYYA 2HWC1 3POEA 5D8AC 5GZGA 5J09A 2FMDA 3EMRA 4EJRA 2UWBA 2Q8DA 2IWGB 5CYYA 2JDYA 2XLFA 4Z2AA 3OB8A 2HEYF 1KXGA 2BNOA 1CD3G 3N9OA 5F3IA 4LO4B 1XE0A 4XXPA 3KCCA 4N43B 4C8DA 1HRV3 2QZ3A 4BMEA 3JB8A 3VB9A 5L9BA 2P3YA 1AR73 4IE0A 4XJ8A 2CTVA 2VM9A 1R1A1 4CU8A 3PHMA 1WBLA 4B8EA 1QY4A 2X29A 4COZA 3VBHB 3MFCA 3ORJA 1ACCA 2RHPA 2ZZQA 1EUTA 1EYBA 5K4LA 5A3LA 5KHGA 4AFDA 3C2UA 1OVPA 4EWEA 3KCXA 5C5TA 2J1AA 1H8TA 1LHUA 3W5MA 5IJRA 2EICA 4PI0A 5ISLA 4CUBA 2NMNA 1OUSA 4HZFA 2ZEZA 4GULA 5DZEA 4UFKA 2WFF2 4AQ2A 3OY8A 3OPZA 3LZZA 4N7IA 4FAHA 1U5ZA 2D6KA 4B3NA 2R0HA 4P9WA 5GLUA 3HBZA 2HWE2 2RMU1 5ABJA 4XFFA 1H30A 2WRAA 4XVHA 4QU1A 1VBA3 1AVBA 1A8MA 4ITCA 4WVMA 3J8F3 2SLIA 3T3YA 3UYJA 1F8VA 1V9U3 3EYPA 4X6RB 5A7OA 4B4QA 2ILMA 4OQ8A 1F2NA 1V6NA 1VBD3 3ZYRA 1AYN1 3VBRC 5DAWA 3ZM8A 3ZSJA 3D82A 3OSDA 3R6SA 4FPFA 1RUNA 4CCJA 4JRLA 3KSCA 5JMCA 1NXMA 4N8MA 4LKDA 4HPKA 2JENA 1OH3A 1PK6A 3BVCA 1WW4A 2ZMNA 1AR93 1V6KA 1Q8PA 4OVEA 4QHZA 3VKFC 5A3NA 3R4UA 2WABA 4QXBA 4XFHA 5HV4A 1SBFA 3MBWA 1E5RA 1AX0A 2GNTA 3DKWA 1OFNA 2J1EA 5CFCB 3J8F1 4KWUA 1ZM1A 3O14A 1D7PM 2HBUA 5F2WA 5BUVA 5FDBA 1SQ4A 2D6MA 2BBVA 4EN0A 4Z92B 3MPPG 2NZ9A 2WQZC 2RS52 1S0BA 5CZKA 4CDXB 5ACA3 3EQEA 4OULA 2EXJA 4OI0A 3FE5A 5KXCA 3SMHA 1H2LA 3K3NA 5A3MA 2WA3A 1QQP2 4DXRA 1R082 1NY72 4FFFA 3W5NA 1LOGA 3OBTA 4AXOA 1MS0A 4M3CB 3RSJA 5IVYA 2W68A 4MADA 1O4YA 3ZYPA 4YSFA 1ND2C 3HR9A 4TLFA 5B2GB 4MSVA 1PO22 2BJSA 4EN8B 3NAPA 3PTYA 3VBSA 4CDUA 5JOYA 1RVF1 2DVDA 3IN9A 5FY5A 1NCQB 3N9MA 5I0RA 3WX5A 3JBG1 2WT1A 3MW2A 4AVCA 1PIV3 1ASJ2 3NNFA 4N90A 1C8NA 1BHGA 4RS5A 5DABA 3H42B 5HPOA 1BBT3 1JN2P 2FBEA 2JXAA 3S7IA 3RS6A 3O0VA 2FDJA 2IXJA 4Q0VA 3HJRA 1E57A 1LNSA 1OKOA 3AP5A 2O8QA 1NUKA 3K51A 2A6WA 1CESA 5DAPA 4ZS2A 3ZXLA 4DS0A 5F3GA 3KHCA 3HNMA 4Q0SA 1Q8VA 3FLPA 1VBC3 2DCJA 3RFRA 2WZR1 2G9ZA 2J1SA 5FK7A 2Y6GA 5FXWA 3AL6A 3NL1A 3ROUA 4XYXA 1HX6A 2NN8A 2HWD2 1QOOA 3NNLA 5A32A 1V6IA 4LOTA 4MHRA 1XNKA 2PLV1 4XF9A 3WF0A 1MVEA 1PZ9A 4JX0A 2JX9A 4CPBA 3F2ZA 5EWSA 4ZZ8A 5FQ0B 3AP6A 4NRQA 1I5ZA 3V0BB 3T2TA 1CN1A 1MS4A 1Y43B 1YJKA 2VVDA 1BBT1 2YC0A 2RV9A 3L2YA 1UU4A 1DQ2A 3FZ3A 3KV5A 4JGYA 4Y20B 3POSA 4GH4A 5FPBA 5L7OC 4E9KA 5LBEA 4R9BA 2BFUL 4FTSA 2WNVC 1S55A 4LO7A 5FY8A 4LJHA 3B02A 4AI3A 2QCSB 1GP6A 3A0NA 1VAKA 2R0FA 1K5MA 1PX4A 1VBC1 3AP7A 3DXUA 5FZMA 2OPKA 4NMIA 1FI2A 5FZBA 1JOPA 1S2BA 4YG6A 1AL0G 3UETA 4K1YA 3NV2A 5JPNB 2AREA 4UF0A 3J7LA 3I3QA 2X5IB 1TZOA 1UYZA 1Z7S2 2CDPA 1V0AA 2W5FA 2I74A 1O6UA 2WUHA 4GB33 4IEWA 4P9IA 5FYVA 5JXJA 3A21A 4D94A 1UZZA 1HXS1 2QE3A 4YYOA 1WGPA 1B35A 1HQLA 1CAXB 4AGRA 3AYAA 1STMA 2ZGUA 3WW2A 1G9FA 3POWA 1DBNA 3SITA 1AF9A 2Y6JA 1JH5A 4ASMB 5A6ZA 3OCPA 5FPAA 5LATA 1GZ9A 3SH5A 3ZFEA 3WR0A 2ZX0A 4PBOA 2XHKA 3N7LA 4RFT0 4QPIB 4YW3A 5FYMA 3WNMA 4CDQA 2PHFA 4NN0A 3ZO0B 1IG3A 4KG0A 1JI6A 4RN5A 1MS8A 4A3XA 1POV1 5LEJA 5FZLA 1MZFA 2VZQA 3NJXA 2V4VA 3KZ4C 2BBAA 2O1QA 2VOTA 2XLAA 4YFZA 1EUUA 1W8OA 5EJZB 1QJZA 2Z69A 4CP9A 5A3WA 1I9RA 4PIXA 1UY3A 3WNPA 5IAXA 5EIYB 2FCTA 2WO3A 4HSJA 4HANA 4KGQA 2JG8A 3P6BA 4FPOB 3ZFGA 4AGGA 3I2GA 1FATA 2P3KA 5J36A 3TB0A 4C90A 1RUF2 1O59A 4LKSA 3MFAA 5GZFA 1KS5A 2AYHA 5FUNA 3ZMNA 1GR3A 5JIUA 2D3RA 4YGBA 1KFUL 1VAMA 2XJPA 1XNBA 5CIRA 3PLQA 4CDWA 2C0ZA 4Y5Z0 1WD4A 5FV3A 4DZGA 1LHNA 1TG7A 4S2HA 3VBFB 2HWE1 5A7PA 2AH2A 5JZGC 3FUQA 4AAXA 3I2KA 2PN5A 1MACA 4WZCA 4AFMA 3LGRA 4QKBA 5J48A 1A6CA 5JVVA 1O3RA 3LE0A 2XUMA 2W1WA 1OT5A 1DQ4A 4FPCA 3OD0A 4Q4W3 3BI3A 1WMEA 3TN93 3SCHA 5EQUA 4QAWA 5H9PA 1ONAA 3LB9A 1Q56A 1IQAA 1C8M2 3TYJA 3ZXKA 4COYA 1FYUA 5GLTA 4GAZA 1D2QA 3OD4A 5F1RA 1LGNA 5FJHA 3IIIA 4IV3B 1Q43A 3POGA 4IW3A 2IXHA 1SCRA 2DDUA 1ZRRA 5C6CA 3N9LA 3TWIA 5HCAA 1BQPA 2BYVE 2VW1A 1XRUA 2VO5A 4IEXA 3WW1A 1AR63 4XJ9A 2DWRA 2VW0A 5HI0A 2UY9A 4BE3A 2YPJA 1Q8OA 1RUE2 3K46A 2BNNA 2RS51 1G7YA 2D6PA 3H3UA 3KMHA 3M3OA 5F9TA 3GHNA 2DCKA 4XABA 5DG2A 1WLTA 2R6QA 3T2PA 1QQP1 4JQRA 1L7LA 4E4DX 4E4SA 1R081 3WUDA 1ULFA 2IZWA 1NY71 5FZ1A 1CGPA 1BYHA 3RYPA 1UW8A 3EXUA 4MX3A 4BMBA 4ES8A 1NA1B 5CFDB 5FWEA 5A1FA 4FTBA 3ENRA 3MO4A 1VRH2 4UBGA 2LTNA 2CSGA 3ZFEB 4IEVA 2QZ2A 4LBNA 1X8MA 3O1PA 3VD3A 2VNOA 4NIIA 3AFKA 4B1LA 2RM22 1YUDA 2W91A 2WLPA 3I3EA 4NWVA 1YI9A 1AR61 2Q0AA 2DU0A 3O5SA 5B4XA 3SISA 3U4XA 1H8TC 2VCMA 4QKFA 3RZMA 3ZX7A 4GMP1 1RUC3 3RWKX 4DOUA 1QU0A 1GNHA 4B7KA 5K7PA 1DIWA 3EHKA 4JGZA 4QX3A 5J37A 1ASJ1 5K0UC 1AXZA 3LIHA 3TEYA 2GZWA 4IDZA 3MIGA 4OFGA 4BQ5A 5D8AB 4YVSB 2VTFA 1ODMA 2IC1A 4QPGC 2R7EB 1YQ8A 1OQDA 2CDOA 2WT0A 2NM1A 3B9CA 3OPTA 1D2SA 3WP3A 3JCIA 2R49A 2K2SA 5ABJC 2ZX1A 1KS4A 4FAGA 1W6MA 4PBPA 4I0WB 3OGRA 2HWD1 3VZNA 2JJ6A 1TME2 2UWCA 3USUA 2ZOEB 1OVSA 1E5HA 1F15A 2JKBA 2YGMA 2IXKA 2VE1A 2VZRA 2WAAA 2ZGLA 4UI9L 5FREA 2VTXA 5BNQA 1HDKA 5FYHA 1WMDA 4QT6A 5CA6A 1YEWA 2A6YA 1RUJ2 2HWB3 3D4KA 4Y1XA 2R042 3UJQA 4E27A 4OUEA 1PK6C 2J1TA 2YXSA 3C7EA 4IGOA 5J7MA 3BTYA 4HONA 2R062 3F95A 2BOJA 4QX7A 1F4AA 1SLCA 4FOWA 5KHHA 4ES9A 1SCSA 4R52A 3VL8A 4A7YA 4Z82A 1D4M2 5LA0A 1DDLA 5KWRA 5EZWA 1CX1A 1CAWA 5HCBA 4W4ZA 3WCSA 3LWCA 4BPZA 1UX6A 4JDMA 1Z7S1 4QQ2A 3N7KA 1ULEA 3RG0A 4A7ZA 4PIYA 1GNZA 4TSVA 2OYZA 5CNAA 3VN4A 4LO6B 1HLCA 1S0EA 2R1DA 4ZU5A 3TAYA 4A4AA 5F6KA 1CPMA 3E97A 3VHOA 4CCMA 2GC2A 3PU3A 1RUG3 5C4WB 4CUAA 1IS4A 1XC6A 4BQ3A 2QNKA 1XBFA 5BXXA 4CU9A 2E31A 1MQTA 2OXBA 1AL23 1W0PA 1XU1A 3KF5A 4K3UA 4L11A 4A3ZA 5BNOB 3C7HA 1V6OA 1DFQA 2G1MA 2MEV2 5DAXA 3BUCA 3VDDA 4GWIA 2Y64A 3P3PA 3ETQA 4LORA 4AFAA 4D0QA 5A1AA 1BCXA 2DURA 2ZGPA 4LBQD 4JAAA 4BA6A 1TE1B 2W9XA 5EYXA 3M8LA 3NAPC 3VBSC 4CDUC 4AI8A 3BPSA 4RR3C 2XVLA 5DAQA 3O1SA 5DUVA 4DQAA 1W90A 2VUJA 1GYKA 2KD7A 4IUGA 1F35A 3IDEA 3D3AA 4RS5C 3WHTA 1TMF2 1W8FA 3GBGA 3FUOA 4CZSA 2D6NA 4YW4A 4AVBA 3VZMA 2XJRA 4OMDA 3B7MA 4P9LA 4RA0A 4EN7B 3AKPA 2D3SA 3CKHA 1D0HA 2E9QA 4L92A 1RUF1 3AXDA 1FNZA 4LXLA 4RHV2 3AB0A 3MV01 5KHKA 5FXVA 2EXHA 3FFQA 3LIGA 4R9CA 4QGNA 1MS3A 1QXRA 1WUVA 2VR4A 3H9AA 1UKGA 3GCXA 5JIAA 3ZVXA 4I02A 1FPN3 1G9CA 3M3IA 3AVRA 1UD1A 4R9DA 4JKKA 4ZHNA 4CE8A 3KLSA 3AP4A 1HQNA 1ND2B 3DPRB 2BRTA 2VQTA 1KITA 4UW6A 3SXWA 1NLSA 2ARBA 5KBFA 4A6SA 3FMGA 4RSUA 4QGLA 5FPVA 1ZBA2 2YUEA 3ZMOA 2DF7A 3PVBB 1K5MC 1CZVA 1Q8QA 3H0OA 4WV8A 1NE4A 1DQ1A 3LEKA 2O0OA 1U5XA 3VD4A 4ISRA 1OD3A 1JZ8A 2BU9A 1BK1A 3PVOA 4ATFA 3OF1A 1FPN1 2QQNA 4IE7A 3UT0A 2DBIA 4XETA 2ZMKA 1J3PA 1LHWA 3GBFA 4IEYA 1C8M1 1POV0 5H9SA 4LBQB 3VD9A 2P4EA 3PIGA 5FYZA 4Z8BA 3AJZA 1TEIA 2YB7A 3HAGA 1M06G 1Y9GA 4EWAA 4C1WA 1ZZ8A 4NIHA 3AYDA 1WW5A 2ZZJA 1RINA 4PIZA 1ULCA 4MXWA 2BGCA 2EALA 2ET7A 2EXIA 2JIJA 4NROA 3WF4A 3ZXFA 4DY5A 1H1AA 4K7JA 1AYM3 4LBKA 1QXJA 2Z5WA 5GM0A 3SEEA 1RUE1 5D2AA 4BM8A 3I2OA 2ZGTA 2XPJA 1JYCA 1PM7A 2A6ZA 5L7OB 4ATEA 3HN3A 1Z0HA 2VBPA 2WNVB 1HV0A 1HW5A 3QLQA 1YYNA 3AX4A 5BNPB 1AJKA 1LENA 2RR13 4WZFA 3DXTA 3FFZA 4IV1B 2QQWA 3GF6A 4L9BA 1QNWA 1VMJA 4R8HA 3VL9A 2CGNA 4DRVA 1QDOA 1VRH1 3ZSMA 3TOJA 5FBZA 4N53A 2C4XA 5I0TA 1KDMA 2BQPA 3BPZA 4Q4V2 2ES3A 2RM21 2BDRA 1ZVFA 2JIGA 2ZA9A 3M3CA 4WVWA 3THDA 1AYM1 3OGSA 2JG8C 2WZPP 3EB7A 1OD5A 1RUH3 5T52A 3ZSLA 3CJIA 5EP9A 5BPXA 3WNKA 2D44A 1ENSA 5C8CB 5J96B 1OOPA 1BLZA 1V70A 4META 3K4ZA 3AC0A 1ND3A 2VTXJ 1ZYBA 2YZ4A 2Z4FA 3K4AA 4QQLA 5FP4A 4Q4X3 4CDWC 4IETA 1WA6X 1TQ5A 1ENQA 5GLZA 4I3PA 5CISA 4WM8C 3U4SA 2OKXA 4DUWA 1JYWA 1AR83 2XJUA 1XNDA 2QVSB 4BWOA 1V6LA 5FYBA 3INAA 4LE3A 4YM1A 2Y38A 3M70A 2FCVA 1W6QA 1OI6A 1TME1 4G3YC 2Y6LA 1WCQA 1QMJA 3CBNA 5FFOC 3PUIA 5FZHA 5G04L 1IPKA 3NJYA 2C24A 1HQWA 1CAVA 5JAXA 1WCUA 1REDA 2XJTA 2Q8CA 1RUJ1 4P02B 1IPJA 1PO12 1XU2A 2JDKA 2R041 3LDKA 4MGQA 1RMU3 1SZBA 1O4TA 1HRI2 4KL1A 2XR4A 4EQVA 4NIGA 2C6SA 3A23A 4KI5M 5AVPA 2CY6A 1O4ZA 1GP4A 3WP5A 1OLME 4LKFA 2XG3A 4CUCA 4YZ3A 2AEYA 5FMDA 1YQ2A 3KQRA 4UFLA 4XOGA 4I2OA 4LUMA 2K46A 3MIBA 2XQXA 3AMQA 3IAPA 4RQPB 2KR2A 1QH6A 4GMP0 3H7YA 4QM8A 4TN7A 2EIDA 5AVAA 3VBUC 3H8RA 2QQVA 4Q8KA 4KMQA 4GQ7A 5FMCA 1BK0A 3MHZA 5HXVA 1G6NA 1HJGA 5I0DA 4XILA 5JPMB 5LW9A 1HN0A 3O1TA 1CAUA 2WINB 3HQRA 5FLJA 3HNBM 4RGKA 5HCHA 2VNVA 5GLWA 3GXUA 5E1RA 1YQ5A 1SLLA 1EV13 1ZA7A 3ZPYA 2MEV1 1LGBA 4S2FA 5FR3A 3IDCB 1L3JA 1LULA 4XDPA 1RHI3 3G6JB 4K6BA 3GJAA 2XBO3 1FOD3 2JDHA 4R9AA 4RHV3 1UZVA 2C1FA 3TBDA 5CKNA 4LE4A 3AKRA 3RDIA 2HWC3 3I59B 2VVEA 3IPVB 5DXDA 1H4HA 4BJ0A 1TMF1 4LO8A 2ZTNA 4LBJA 1PX3A 3GM8A 4IEZA 2YV8A 2ZKLA 4RGGA 4D7TA 2VMEA 5FYIA 4CCEA 1W8UA 1O7FA 2YC2A 5L9RA 1YFUA 1Z78A 4XPVA 3WNXA 1RHI1 1O91A 2JDPA 1R1A3 3W9AA 4K8FA 2NMOA 4RHV1 2ZAHA 3ACGA 1GQPA 1UY0A 2WS92 3QOPA 3GDBA 3GZTB 4QX2A 2I2SA 1ZRCA 3LF7A 1YQ6A 3T0AA 3PUHA 5FO9B 1XOYA 3PJYA 5FZDA 4D6QA 4K8RB 4BQ2A 1L7RA 1XE8A 4XZPA 3T30A 3N36A 4V2WA 5DUUA 2W87A 3ZIXA 5FZGA 2RJ2A 2ZKNA 2EA7A 1OXCA 3MW3A 1K3IA 3POBA 4Q27A 4FPKA 2OUHA 1H8TB 4UBHA 2JKXA 4Q2FA 2L9LA 4XQWA 3RZJA 1W8HA 4HKWA 3E6CC 1XQNA 2QBXA 3BTZA 3IZOA 5LWBA 2CV6A 2GP5A 5K0UB 1FT9A 2VU9A 2ZHMA 3MYXA 1QOSA 3NO8A 3GBWA 2RMU3 3HQXA 2J1RA 4GWNA 1DZTA 1RTVA 2OA2A 4QPGB 2GAUA 4URTA 3AMPA 2WWUA 1JZ2A 3WLUA 4CEYA 1W39A 4QX8A 5FXXA 3WDXA 1RJ8A 1VB4A 1DQ0A 2C9KA 3W58A 1I6XA 1NCRA 2AC1A 2ORXA 4HOOA 5KC5A 4PDWA 1YFXA 3FHIB 5AC93 1AYN3 2Y60A 4LLFA 5DUWA 5LASA 5FPZA 2J7MA 1MQTC 2ZHKA 1R64A 3AM2A 3VKOA 5CEHA 2XLGA 1GP5A 4EV0A 2DVAA 3VDDC 3NRUA 1QDCA 1C5HA 1JS9A 4XJWA 4MGYE 5KXDA 4YPJA 1OA4A 4CVUA 1DLLA 4YW2A 4Y33A 3WP6A 3VD5A 1JHJA 1W3XA 3B9IA 4OUSA 3HN1A 3B01A 4N43A 1GNYA 2DVBA 1W6NB 4QXHA 4XFIA 5FAXA 5FO8B 3U11A 1OFSA 3HD8B 3HPNA 3H3LA 1W04A 1CIWA 2QQJA 5DZGA 3M7AA 4JDOA 5I8TA 3KD4A 5AC91 5JSOA 3MIDA 5LA1A 2RDRA 4FOVA 4Q4V1 3VBHA 4AEDC 4YM2A 5FOJB 1XYPA 4FPYA 4JHZA 3WSOA 4YW1A 4CA9A 1UPIA 1XPWA 2IXCA 3KT7A 4IEPA 3UKTA 1X50A 2VZ1A 2OVUA 3R05A 1DU3D 1RUI2 1VB2A 2YROA 4LULA 3D6EA 4MGSA 3EBRA 5DG1A 4Y1YA 4GWMA 3RI9A 3WOGA 2NP0A 4XF0A 4O7XA 4FOQA 4XMAA 2QQKA 3GALA 2VULA 2DUOA 3J26N 4M3CE 3RZHA 5FZ9A 4EROA 1RVF3 3I2FA 4HVRA 1WA4A 4Y4YA 5E88A 2DUPA 3BU7A 4BXSV 4GKYA 1CONA 1WCKA 4XBNA 1QHDA 2W94A 3JBG3 4CEWB 4C0HA 4YNIA 3VBSB 5B4NA 4RR3B 2VUCA 4FPLA 2ARXA 4KG8A 4Y4RA 3ZN6B 2OQ6A 1BXHA 1VRBA 2WIIB 3K2OA 4XJZA 4W50A 3UK9A 4ZONA 3BKZA 1XSRA 4RS5B 3QCWA 5FK8A 4L99A 3OBRA 2P3JA 1GSLA 1YRZA 3ETPA 3ECQA 5T55A 3LDBA 2D7FA 5FBJA 4LO5B 5LA9A 1LJ7A 3AXEA 1UZ0A 5IATA 2WZR3 3WT3A 1PO11 5JXIA 3OGJA 4WM7A 4W8JA 1OA3A 2GH8A 2JG9B 3UESA 1EY2A 3WNOA 1HRI1 3R4DB 1F5FA 1VALA 1ZNPA 5FKCA 4AVVA 1GWLA 5D21A 5F7UA 1GLHA 1W9TA 3AYEA 2PLV3 3AL5A 3O1OA 1WZXA 2A7AA 2GNDA 4E2QA 1W6OA 1YHFA 5ANNA 5C3SA 4AI0A 1JYXA 4IGPA 5CFCA 1DZQA 1PVC2 2Q8OA 1C57A 1N3OA 2IXLA 4URAA 2BUKA 1NQJA 5JOZA 4GKXA 4O61A 1Y3TA 2B5HA 5SV5A 4CDXA 5FZOB 5A33A 2RS33 1EAH2 3DECA 4YVWB 1O3SA 1W99A 3IKWA 4IEUA 2ZXQA 1DGRN 2V73A 5T54A 3ZN4A 1WLCA 1QJY2 2Z79A 3QACA 4K1ZA 5LK5A 2X05A 4JTOA 3KV4A 2YPDA 3KVAA 4HETA 2C5DA 4N53C 4U36A 1R092 2PHWA 1HXS3 3ZSEA 4BHPA 4XF1A 1UX7A 1LRHA 4HVOA 4UFIA 5F5CA 3UV9A 5FZ3A 2FMYA 3K48A 4BZ4A 4YW7A 4L0PA 2WNUA 2RVAA 1GQGA 4YZ4A 4YWAA 2FDFA 2RS31 3Q8CA 2QQMA 2Y8KA 3AFGA 3IDBB 3WCRA 4P9GA 2VNRA 4BB3A 1JTZX 2GMEA 1ND3C 4JCKA 2FZ1A 4S2GA 4HVQA 1QEXA 1GZWA 4AYUA 3NNGA 1KGYA 1JBCA 3LA7A 4K21A 3ZDSA 3LSEA 1ZZBA 1QXPA 1ULDA 1N47A 2E63A 2B39A 3EJKA 1POV3 3Q8EA 4XFBA 5M0TA 5FTTC 1QJX2 4PI2A 5CVRA 4YFWA 5FZIA 1UNBA 4XACA 2WS91 4MGKE 4NJ4A 3WW3A 3B00A 3GGLA 1J58A 4CXYA 2VMHA 1ZREA 2WC2A 3I2JA 4ASLA 4YG3A 4Y26A 2VG9A 5FQ0A 3RJRA 1MS9A 4KBBA 3V0BA 4O65A 2HWF2 2CU5A 3AKQA 4W6YA 4Y20A 3ZN6A 1JYNA 1GWMA 2Z42A 3HEIA 4H2AA 4LQRA 5FXZA 3FL7A 2GP3A 4FXGB 1BEV2 2WFF3 1XXNA 3HOBA 1SLAA 1PVXA 3DL3A 2BVVA 5F5IA 1JOJA 1UOBA 1WCSA 1AUYA 1IKPA 4Q8LA 2HWE3 1QF3A 4YW5A 2HEWF 4OHZA 3MDPA 5DDJ2 4CU6A 2UYAA 2X5IA 3OBAA 4DUVA 2VQUA 3AKTA 4WM8B 3ZXJA 2WN2A 4CP0A 5FLIA 5FLHA 1HB4A 1F31A 3APBA 5FKBA 1V6JA 3UL2A 1BKZA 3O1MA 3WG1A 3LFIA 1LHOA 3OBZA 3FHAA 4CSWA 2LALA 4DMIA 4UXAA 4BH9A 2WL1A 3ON7A 2ZAAA 3IMNA 1GOGA 4AVAA 2J42A 2WFF1 2YBSA 3MEPA 4CCOA 4XAEA 1G9BA 1VBB2 4AW7A 2EF6A 5IK5A 4K20A 1MZ6A 2D5HA 2VGDA 4Z07A 1COV2 3QBQA 1MVQA 1MR5A 2A75A 4NVPA 1W8ZA 4B1MA 3KGZA 1OF4A 5A7WB 5JI9A 4XZUG 3FX3A 4BU2A 4QPIA 2XL9A 1QGLA 2RS12 1CQ9A 2QTWB 4MO3M 4LHLA 4XDOA 1SFNA 2VQAA 5FOBB 4IE5A 3SQOA 2VMGA 3JQWA 3AK0A 3AYCA 4ARYA 5BNNB 2VOKA 4CP1A 1MZEA 4XFCA 3WVJA 4AQ6A 2RS53 2OZ6A 1A8DA 1ZBE2 2A1XA 1YWKA 5C9AB 3HT1A 3T1MA 2OZJA 1POQA 3J4UH 4I0BA 2VECA 3VBUB 4AVTA 2GC1A 1ZRFA 3AZWA 3PUSA 4H7LA 1QQP3 1R083 1GZCA 4NOTA 4BQYA 1ENXA 1LU2A 3KF3A 4M4PA 3LD8A 2NPIA 3JXSA 1RUI1 4Z1VA 2O8OA 1SEFA 2RJLA 3H8UA 4QHOA 1UKRA 4CYDA 3E5XA 3P1IA 2OQ7A 5FO7B 1NXD1 3BU0A 3AKSA 4H3WA 1SBEA 1H0BA 1PO23 5A7QA 1RB8G 1HB3A 1W2TA 4QMAA 5EXOA 2VZPA 2H6CA 5C70A 2DTYA 3JD72 2IFRA 5FP7A 2W39A 4GMP3 1JODA 2XHNA 5JSRA 2K9ZA 1HV1A 1DGRA 3ZFFB 1ASJ3 5J1XA 4I30A 3B69A 1JW6A 3DKQA 4M0HA 5ANQA 1GMMA 4AHWA 2FDHA 1N1TA 4GA9A 3SNMA 1JYTA 4XC9A 2E7AA 1ULGA 1S0GA 1N3PA 1U12A 3CNAA 4QB1A 1VBE2 3VBOA 2DCZA 4FQZA 3E5QA 1UMIA 2DV9A 1QJFA 1H1IA 3BCWA 2P34A 2JB4A 4LHSA 1UY4A 5LRRA 1PO21 1Y9QA 4CEYC 1MS5A 1B09A 5KC6A 4FPJA 5FYSA 2HWD3 1G86A 1OKQA 1IS3A 1WLDA 4R4XA 2VZUA 2Y6FA 4IE4A 4PDWC 2R072 1FMD2 1UY2A 4IV3A 1NZIA 4QHBA 3ZXEA 2KXLA 2J1UA 3T2OA 2K0GA 1LOCA 1QJU2 4INDA 1PVC1 1S4CA 1GU3A 4MXVA 1O5UA 5FUPA 5FY0A 3SKVA 3ES1A 4NR1A 5FP9A 4EE2A 3S5AA 1JU4A 3VLBB 1WMXA 5LY1A 4J1WA 1VR3A 4IGQA 1EAH1 3LPGA 1OLQA 3PVEA 4N43C 4IXLA 4DY3A 2WNOA 3IDAA 2W08A 3PDQA 4NPRA 3NV4A 1SLTA 5G05L 4TYSA 4I01A 3I97A 4RD7A 1Z7S3 4QU2A 1FV2A 1NA1A 2XH6A 2ZGQA 4QXKA 5A80A 2VOWA 5CFDA 1MS1A 2Y34A 4DFSA 5C8WA 3TNPB 5IK7A 2JICA 2JDZA
chains in the Genus database with same CATH topology
1R091 3A4UA 4P9JA 3VBHC 4Q4Y2 5T5LA 2Q1MA 5IK4A 1XE7A 4JDNA 1CJPA 2WSUA 3M3EA 1LOBA 4UW4A 4C91A 3PNAA 2VXRA 1H9PA 3LA3A 3POYA 2AZ5A 4Q26A 2ZHNA 2ZGNA 2GALA 3AP9A 3RI8A 4FCAA 3ASIA 5D8AA 4YVSA 1OPOA 4TZDA 3VDDB 4HK9A 4HN1A 3ILRA 2EAKA 3TRSB 5CBLA 5SV8A 4M0NA 1W6PB 2EXKA 2A3XA 3UKVA 2IFWA 2QQPA 1KFXL 1QJX1 2YGLA 1LOEA 4RL7A 3PMSA 2BTVC 1VP6A 2QJVA 2ZMLA 4XMIA 1YI7A 3P3NA 2R30A 1OSGA 1UU5A 3VBRB 2HWF1 3WG2A 4AEDB 4FQ4A 4WM7C 1RUF3 2B46X 1SACA 2P17A 3WDVA 4RGAA 4Y1ZA 1WLWA 3MF9A 2PHTA 3ZXGA 1WD3A 1BEV1 1R1ZA 2UY8A 4M00A 2KM2A 1DGWX 1XNCA 2ERFA 2AR6A 2ETEA 2PQQA 2E6VA 4OUMA 5CFCC 5L19A 5DDJ1 3RMYA 1SLIA 3VHRA 4HMZA 4J6GA 1J3RA 4YM3A 4FTEA 3KS7A 2D6OX 2JEMA 2B9UA 4PLMA 3WP4A 2XJQA 4Y22B 1YNAA 1Y7BA 3DGTA 5C4WA 4AQTA 2BEOA 3WW4A 1M4WA 5BNOA 3OYWB 1H2NA 4OI1A 3BTAA 1VBB1 4XTPA 2XVGA 4OHYA 1C8M3 1COV1 4YGEA 4JGYC 3WG4A 4AEMA 4GH4C 3LOIA 2RS11 3LSDA 3MIEA 2WNUC 4P9YA 4ZU7A 1PGL2 2QKDA 4L8QA 3VZOA 3N3HA 4IESA 1S0CA 4AWDA 4TWTA 1RUE3 1DQ5A 4B7EA 3JB4C 1ZBE1 1ENRA 4KU7A 2ATFA 4KH9A 4BIFA 3U10A 2JECA 2Q5TA 1QH7A 4YZ2A 3V0AA 3AMNA 4XF4A 4KNCA 2C9AA 4WVZA 1F9KA 3HWJA 5BV6A 1B35C 4ORFA 3CLPA 5CB7A 1VRH3 3CF6E 1GICA 5KXEA 2A6XA 2RM23 1QKQA 1MEC2 2GC0A 4PQ9A 4I0AA 1JUIA 1LEMA 3JD71 4YGCA 3KT1A 4W65A 1OMIA 5E16A 3MICA 1ND2A 3DPRA 2YHJA 3NV1A 1YFYA 5BYNA 4BIOA 2A3YA 1QOTA 3N7JA 3PVNA 1WW6A 2ET1A 4I3GA 2HYKA 1SDWA 4XHBA 4NHKA 4CDQC 4KWLA 3VV1A 1DYKA 3THPA 1Q3EA 2HJIA 2EIGA 4LHKA 1HRV2 1ND3B 2A6VA 1F5JA 1AR72 4HT1T 5TSWA 2X5IC 3B3QE 1Q5OA 1QWRA 4IEQA 4LBQA 3L2HA 3ZFGC 1TME3 1LKNA 1KQRA 1FMD1 2R071 3NV3A 4XQ4A 4PJYA 5LK7B 2ZGMA 1BJQA 1RUJ3 3V56A 4EN9B 2R043 1WW7A 5T3NA 1FNYA 5JOWA 3RZZA 4E2SA 1N1SA 2R063 1YJLA 5F5QA 4DPNA 2GN3A 4AI1A 3DV8A 4LLOA 5EYYA 5L7OA 1D4M3 1URXA 4QPIC 1UAIA 4B4RA 4M01A 1UPSA 4AHZA 1O3TA 5BNPA 2CGOA 4LBOA 3ZYJB 4IV1A 2XL7A 3AMMA 1VBA2 1DGLA 3J8F2 4Q4Y1 1V9U2 1DHKB 4XFAA 4IEOA 3RPQA 2XJSA 2XJVA 1VBD2 2A3WA 2WKKA 2R061 3VGIA 3LAGA 3MIHA 4XF3A 4XEZA 5C8CA 2MEV3 2PTMA 2ENRA 1D4M1 2PAKA 2I45A 1AR92 3OGGA 2XVKA 3B93A 1LCLA 4KQ7A 3VUOA 2Z2SB 5DZFA 2V09A 2CYFA 3RYRA 4Y24A 4J1XA 3PJQA 2GMMA 4F8AA 2PHXA 5KHIA 5H9QA 3VZKA 1PNFA 4M3CF 2XWBB 3I4IA 5JZGB 4L2NA 4YRDA 3ZIWA 1TMF3 1UF2C 3NKTA 2BWAA 3VZLA 4HKLA 3OJBA 5ACA2 1HKDA 1JUHA 3KT4A 1BVVA 2GNMA 4E2GA 3VBOC 3H7JA 1PMIA 4FP2A 4N9IA 2XKOA 3ILFA 1S0IA 3E6DA 1OA2A 4QD2A 1C1LA 2A73B 4ISQA 4O9EA 1CR7A 3S7EA 2H0BA 2YMZA 2A71A 3D0JA 4JGZC 2DTWA 1N3QA 5JWPA 2HKXA 4F7ZA 2A70A 4RQPA 1PIV2 4HN0A 4AK3A 5JDBA 4JVAA 1ZBA3 3WQ7A 5E89A 1BBT2 4E4ZA 2V5YA 2ZGRA 5HBAA 4K9SA 5T5JA 3DF0A 3BODA 1VBC2 2D3PA 5CFDC 3ZFEC 1WMFA 1SMVA 4Y1VA 1X36A 1X82A 1S0DA 2PYTA 3WUCA 4LEJA 3T1LA 2Q1ZB 1ZBA1 3AZYA 1PGL1 3ZYIB 2B45X 2DVFA 3I59A 5EV7A 2E53A 1AZDA 1JHNA 2ZJCA 3RRDA 4PLNA 3QH7A 4Q29A 5FCCA 3M2MA 4G9SB 3RWNA 4YVSC 4EWDA 3OY8B 4MUVA 4MV2A 3G7DA 1DGWA 5ABJB 2VH9A 4YGDA 3TNQA 3UKNA 2I07B 5FMOS 2F6BA 4GB32 1RUD2 3MI8A 3GYDA 4WVMB 1ZX5A 1NLRA 2FHRA 1SFYA 4Q4V3 3J9SA 2NLRA 5CU1A 1MEC1 1RGSA 2PHUA 1N1VA 3H50A 4KWKA 1REFA 4F3JA 3B94A 4HPKB 3U07A 2GN7A 1PK6B 3BIWE 4WVVA 2PA7A 3ZXDA 2D98A 2IXIA 4K40A 2D97A 2ZPXA 4XTMA 4OLLA 1HRV1 4ONUA 5K0UA 5CAZA 3X29B 1AR71 4XQDA 1LOAA 4QPGA 2TBVA 4C1XA 3WQ1A 1LGCA 2RE9A 5GALA 1FAYA 1Q8SA 2H0VA 4IQPA 2PFWA 4AEKA 5C4WC 1XYNA 2TEPA 5BNOC 1I1EA 3D0SA 1DF0A 3NW4A 1PO13 2OIIA 2VOXA 4WBBA 3PMEA 4OI2A 1HRI3 1YFWA 2DVGA 1UCXA 1EPZA 4WM7B 1PZ7A 3NAPB 1A3KA 4CDUB 4Q0QA 4UW3A 1W6NA 3MF6A 4R4ZA 1RC6A 4H7MA 2BNMA 2WNEA 1PGSA 1V00A 1W6OB 1VBA1 4BLIA 2H6BA 2JE9A 1V9U1 4XE9A 3MLLA 3FBYA 1BZWA 1J1LA 5T50A 1DZRA 1VBD1 4XDQA 4Q4W2 3WG3A 1S2KA 2XKPA 3TN92 5A33B 1FXZA 4XW3A 4COVA 2ZX4A 2FQPA 1IS6A 3N7MA 1AR91 3I54A 1LODA 2XWJB 5A32B 5KXBA 4IERA 2DCTA 2ZS6B 1MZ5A 4AEJA 1RL3A 4BQ1A 4FO9A 4FSJA 4YARA 1KD7A 4NHLA 3DPRC 3WDTA 1YIPA 1W0OA 4JGYB 1C1FA 4LR4A 1S0FA 4GH4B 5K8SA 1AR62 4CEWA 4EN6B 5KHJA 3RNSA 4RR3A 1YO8A 2PAMA 2WNUB 3JU9A 3VHPA 1RJ7A 2ZGSA 5ACA1 4MYEA 3USSA 1K5MB 3ALQA 4LA2A 5F6LB 4W6XA 5IK8A 2ZX3A 2GNBA 4M3CA 2FZ2A 1GZWB 4PLOA 2YYOA 1ZZ7A 3M3QA 1IOAA 3KB5A 2JG9A 4QQPA 2JD4A 2WS93 5JI9A 3CJIC 3M1HA 1NOVA 3KM5A 5GJ6A 1NCQA 3RQ0A 1B35B 3NWKA 1OOPC 4XJUA 1UZYA 4CP2A 2F4PA 2DFBA 1EPWA 3H1MA 2SBAA 2DU1A 4N7UA 1RUC2 1UIJA 1J1TA 1PIV1 3ACLA 2QDNA 4GALA 4A2UA 2W52A 4YVWA 1VIWB 1APNA 4CDQB 4BCUA 5BNPC 4V1PA 1S1AA 4IV1C 1AX1A 1LEDA 1GKBA 5T5PA 2R16A 1UU6A 3ELNA 4FXKB 4MGZE 4HFSA 1NG0A 4AFCA 3WINE 2VUAA 1RUD3 2JG8B 2LM3A 2X8KA 1LTEA 4YM0A 3ZFGB 3OTFA 3KCYA 5C33A 1AX2A 5C8CC 2HWB2 1NQDA 1SLBA 4LUKA 1LHVA 1NZCA 4QM9A 1OQ1A 2GDFA 4CDWB 1AXYA 2B8MA 1YCIA 3SH3A 2Y0IA 5FRAA 4LBMA 4X8NA 4AHXA 4CTEA 5IUQA 2XGXA 3MIFA 3R4SA 1AJOA 1CAXA 4GB31 1RUD1 2AENA 4W6WA 3AMHA 1IS5A 1J59A 5I8YA 3I8TA 2D93A 4I09A 1RUG2 3E5UA 3O7OA 1AL22 3NSTA 1RUI3 3HT2A 1CVNA 2BPA2 2DUQA 4Q0PA 4DRRA 3BB6A 1YIFA 1U5YA 2ZACA 4ZKTB 1ZZCA 4F83A 3RYKA 2GC3A 1VAVA 5E8AA 3ME2A 5GKAC 5LRSA 4N9HA 3H1YA 2WQ4A 2WLQA 4HKOA 1UMZA 4RQPC 1H2MA 4B29A 2JE7A 4WM8A 5AFEA 3KGLA 5JOXA 1S0JA 1NE6A 4AG4A 4FT8A 4MGIE 2MHFA 1WBFA 2GU9A 4CRQA 2TNFA 4XBQA 3VBOB 4XXAA 1ALYA 3VBFA 3C3VA 3CL1A 4YZ5A 2N7GA 4MLOA 2QFEA 1FPN2 2HEVF 1YXWA 1FV3A 5IT6A 1T6GC 1PVC3 2CGPA 1KJRA 2ZBJA 4JGZB 5CG9A 4D7YA 3FLTA 3WD5A 2VQ0A 5C9AA 1EAH3 3VBUA 3AZXA 2WT2A 4LBLA 3CO2A 3ES4A 1FX5A 4Q4W1 1QJY3 3N35A 4JRAA 3TN91 4KGGA 3DUIA 4QQOA 4Z2WA 1W6MB 1NCRC 2BVBA 2CAUA 2PELA 2UURA 3AZZA 3L2YA 4C0BA 3IM0A 4MZUA 1H4GA 1R093 3JUUA 4DNYA 3USUB 2QUOA 4IL7A 4P14A 4AI2A 4YLZA 1BMV2 3ZXAC 2BWCA 5I91A 3O0WA 2VVFA 1YLLA 1AYM2 1AHSA 5DUXA 3ZFFA 5JCTA 1C3HA 5FPXA 1DG6A 1QJY1 1U0AA 4COWA 1LOFA 3MLKA 1J3QA 1CAWB 2RR12 3BOPA 4XIKA 1OQEA 3SLIA 1PGW2 3O12A 3UJOA 1QJX3 4GXLA 1GANA 2UU8A 4OHVA 4X6QB 3S30A 2CWSA 3WXPA 1LECA 3S0MA 3D8CA 2VOVA 3S6PA 4AVSA 3NKGA 5D1IA 1LR5A 2TUNA 4AFBA 5BNNA 3NVCA 4HLTA 1MQTB 1RUH2 2HWF3 3I7DA 1RUC1 2Q30A 1H1MA 2B7YA 4P9XA 3W59A 3VKLA 2G9GA 4XFGA 4LHNA 4X8PA 1CPNA 1BEV3 3JQXA 3SH4A 4D3WA 4Q4X2 4MH0E 4D7SA 1OHFA 3ZYGA 4YG0A 2OW4A 4Y1UA 1G9DA 2PAEA 5DDJ3 3GNEA 1AR82 2VNGA 1H9WA 2UYBA 2X53S 3QH6A 3IT8A 2ZGKA 5I8SA 3FBMA 3ILNA 3IWZA 5L36A 1KDKA 1LU1A 2HWB1 4Q0UA 4AGVA 1VBB3 4HK8A 1COV3 1RMU2 2ZABA 1DYPA 4FPGA 5FMOL 5J98B 1KJLA 1OPMA 4KWJA 3FWEA 3E6BA 4LT5A 3SHRA 2RS13 1GFF2 4HSLA 3MW4A 4PCRA 3IIAA 1W6PA 3WQ0A 5JR7B 4CDXC 2KA3A 4CEWC 3CU7A 2R32A 4COUA 1ZRDA 2ZGOA 4AF9A 1ZBE3 1GV9A 1I3HA 2UWAA 1C4RA 2PHDA 4L97A 4FBFA 4O9GA 2OUJA 1TNFA 1UN1A 4NWWA 1RUG1 3VBRA 3HMYA 1ZZ6A 4OHWA 1AL21 2NYYA 3A0KA 4AEDA 2BFUS 1EV12 1NYWA 1IKQA 3M4FA 2D43A 4BMEA 2VY0A 2JG9C 4LNVA 2AGSA 3WY6A 3I2DA 3V0AB 1UIKA 4MVTA 1RHI2 2MPFA 1NCQC 2WFPA 4FPHA 5GZDA 2XBO2 1FOD2 4XHXA 4LTAA 3SCFA 1O5LA 3JD73 4MXWB 3VZJA 2ZHLA 3AJYA 2HWC2 4OI4A 1U5IA 1XYOA 1VJ2A 1H2KA 3WDUA 3QD6A 1UL9A 3WDWA 4DB5A 3MLJA 4QGMA 5HCFA 4AQSA 4XBLA 4JC1A 2WJSA 3LCPA 4YVWC 3LA2A 4HBNA 3WDYA 1VBE3 4Y22A 4NO4A 3WV6A 3VKNA 1ZA4A 3OYWA 2WA4A 4QPYA 5CADA 1R1A2 3LOBA 2MNGA 2E7QA 2Y26A 1JYIA 4XIOA 4N53B 3MZHA 1REEA 1PNGA 3R0RA 5LEKA 3BALA 1PZ8A 4B4PA 2Y0OA 1FMD3 2R073 1N1YA 5L73A 1X8EA 1QJU3 3CJIB 5GZEA 4OZXA 2P3IA 2RJKA 1OOPB 3FJSA 5I0SA 2ZX2A 3CEWA 2AUYA 2WWSA 1VBE1 5GLVA 5J3UA 4A7KA 3RMXA 1O3QA 5GZCA 2NQYA 3MGUA 2RMU2 1SBDA 4QX5A 4XJAA 4D69A 2P37A 2Q4SA 4AE2A 1IZ3A 4ZXKA 2XB6C 4DXZA 1EP0A 4AHYA 1QJU1 1W6QB 4BLJA 1AXKA 4Q4Y3 3SCGA 4FPEA 2YDEA 5AC92 1BMV1 1AYN2 1CAVB 5JSPA 4YZ1A 3EO6A 3ST7A 3ZN5A 3DN7A 1W2UA 5H9RA 2BW8A 1RIRA 4BOWA 2E51A 3VHNA 2WNVA 2DCYA 3GHMA 3IBMA 3URFA 2CL2A 3MPBA 1VLNA 4FP3A 3V64A 1D0GA 3CJXA 3WHUA 2RR11 1PGW1 2CAVA 3ATGA 4SBVA 4S2DA 2DFCA 1RITA 2DYCA 2EAAA 5K9YA 2GSYA 3FLRA 1G9AA 3AZVA 1DQ6A 1HIXA 2VMIA 3BOWA 1CAUB 1BVP1 1CJDA 2VPVA 1ZZ9A 2W0XA 5JI7A 1RUH1 1V6MA 4HL0A 3WZ1A 2WSVA 3VBFC 3FC0A 5JLVA 4FOYA 4Q4X1 4QQHA 2GH2A 1JXNA 1RVF2 2CNAA 2ZCWA 3NJZA 4G4FA 1AR81 3JBG2 3GZUC 3H1WA 1QNYA 5C9AC 1X7NA 3D5OA 5EJ3A 1WCDJ 2E7TA 4JTNA 3THTA 5I0UA 3JZVA 4P5HA 3O0XA 4FVVA 1LB2A 1GBGA 3GZAA 3ZSKA 4H14A 2WZR2 1RUOA 4GIQA 5J96B 4IV3C 5T5OA 4OHXA 5AFBA 1RMU1 2D5FA 5BY5A 5EFUA 1IGOA 2G4IA 2YY1A 2PLV2 2QDRA 4JV4A 3V65A 1C5IA 1C28A 1OLRA 2A5ZA 4ZU4A 2LUWA 3LKJA 2EVXA 2G9FA 3H3ZA 2D40A 4NHMA 2P2KA 4SLIA 5JZGA 2R1BA 3ZFFC 4PF5A 1H8VA 3VKMA 1LESA 1A78A 2PHLA 2PHRA 1X33A 1LOFC 2RS32 2GMPA 1NA1C 4LA3A 1PHMA 1D4VB 3U0ZA 1KRIA 1EV11 1TNRA 4DINB 4CEYB 3N4MA 1GQHA 3HIFA 1CX4A 2CWMA 4H55A 3B5LB 4Q1RA 2B42B 4U2AA 1HXS2 4Q1PA 5CG8A 1MEC3 1NCRB 2XBO1 2D6LX 1FOD1 3IPVA 4PDWB 5BNNC 4UW5A 5I93A 4KU8A 2VW2A 3L9JT 3RJ2X 1G8WA 1IHMA 3Q9OA 4BYYA 2HWC1 5GZGA 5D8AC 5J09A 2FMDA 4EJRA 2UWBA 2IWGB 2XLFA 2HEYF 1KXGA 2BNOA 1CD3G 4LO4B 4XXPA 3KCCA 4N43B 1HRV3 2QZ3A 3JB8A 1AR73 4XJ8A 2CTVA 1R1A1 3PHMA 1WBLA 4B8EA 1QY4A 2X29A 4COZA 3VBHB 3MFCA 2RHPA 2ZZQA 1EYBA 5A3LA 5KHGA 4AFDA 3C2UA 4EWEA 3KCXA 1H8TA 1LHUA 2NMNA 4HZFA 4GULA 5DZEA 2WFF2 4AQ2A 3OY8A 3OPZA 3LZZA 4N7IA 4FAHA 1U5ZA 2D6KA 4B3NA 2R0HA 4P9WA 5GLUA 3HBZA 2HWE2 2RMU1 5ABJA 4XFFA 1H30A 1VBA3 1AVBA 1A8MA 4ITCA 4WVMA 3J8F3 2SLIA 1F8VA 1V9U3 4X6RB 4B4QA 2ILMA 1F2NA 1V6NA 1VBD3 3ZYRA 1AYN1 3VBRC 3ZSJA 3D82A 3R6SA 4FPFA 1RUNA 4JRLA 3KSCA 5JMCA 1NXMA 4HPKA 2JENA 1PK6A 4OVEA 1WW4A 2ZMNA 1AR93 1V6KA 1Q8PA 3VKFC 3R4UA 4XFHA 1SBFA 1AX0A 2GNTA 3DKWA 1OFNA 5CFCB 3J8F1 1ZM1A 3O14A 5BUVA 5FDBA 1SQ4A 2D6MA 2BBVA 4EN0A 4Z92B 3MPPG 2NZ9A 2WQZC 2RS52 1S0BA 4CDXB 5ACA3 3EQEA 4OULA 2EXJA 4OI0A 3FE5A 5KXCA 3SMHA 1H2LA 5A3MA 2WA3A 1QQP2 1R082 1NY72 1LOGA 3OBTA 4AXOA 1MS0A 4M3CB 3RSJA 2W68A 1O4YA 3ZYPA 4YSFA 1ND2C 3HR9A 4TLFA 5B2GB 4MSVA 1PO22 4EN8B 3NAPA 3PTYA 3VBSA 4CDUA 5JOYA 1RVF1 2DVDA 3IN9A 1NCQB 5I0RA 3WX5A 3JBG1 2WT1A 3MW2A 4AVCA 1PIV3 1ASJ2 4N90A 4RS5A 1C8NA 1BBT3 1JN2P 2FBEA 2JXAA 3S7IA 3RS6A 3O0VA 2IXJA 4Q0VA 1E57A 3AP5A 2O8QA 3K51A 4DS0A 2A6WA 1CESA 3ZXLA 4Q0SA 1Q8VA 3FLPA 1VBC3 2DCJA 2WZR1 3ROUA 3NL1A 4XYXA 1HX6A 2NN8A 2HWD2 1QOOA 5A32A 1V6IA 1XNKA 2PLV1 4XF9A 1MVEA 1PZ9A 2JX9A 5EWSA 5FQ0B 3AP6A 1I5ZA 3V0BB 3T2TA 1CN1A 1MS4A 1Y43B 1YJKA 2VVDA 1BBT1 2YC0A 4Y20B 3ZN6B 1UU4A 1DQ2A 3FZ3A 4JGYA 3POSA 4GH4A 5L7OC 4E9KA 4FTSA 4R9BA 2BFUL 2WNVC 1S55A 4LO7A 3B02A 4AI3A 2QCSB 3A0NA 1VAKA 2R0FA 1K5MA 1VBC1 3AP7A 2OPKA 1FI2A 1S2BA 4YG6A 1AL0G 4K1YA 3NV2A 5JPNB 2AREA 2X5IB 1Z7S2 4P9IA 2I74A 4IEWA 4GB33 4D94A 1UZZA 1HXS1 2QE3A 4YYOA 1WGPA 1B35A 1HQLA 1CAXB 4AGRA 3AYAA 2ZGUA 3WW2A 1G9FA 3POWA 1DBNA 3SITA 1AF9A 1JH5A 4ASMB 3OCPA 3SH5A 1GZ9A 3ZFEA 3WR0A 2ZX0A 4PBOA 2XHKA 3N7LA 4RFT0 4QPIB 4YW3A 4CDQA 2PHFA 4NN0A 3ZO0B 4KG0A 1MS8A 4A3XA 1POV1 5LEJA 1MZFA 3KZ4C 2O1QA 2XLAA 4YFZA 1QJZA 2Z69A 1I9RA 4PIXA 4HSJA 4HANA 4KGQA 2JG8A 4FPOB 3ZFGA 4AGGA 1FATA 2P3KA 5J36A 3TB0A 4C90A 1RUF2 3MFAA 5GZFA 1KS5A 2AYHA 3ZMNA 1GR3A 5JIUA 2D3RA 4YGBA 1KFUL 1VAMA 2XJPA 1XNBA 5CIRA 3PLQA 4CDWA 2C0ZA 4Y5Z0 1WD4A 4DZGA 1LHNA 3VBFB 4S2HA 2HWE1 2AH2A 5JZGC 3FUQA 2PN5A 1MACA 4WZCA 4AFMA 3LGRA 5J48A 1A6CA 5JVVA 1O3RA 2XUMA 1DQ4A 4FPCA 3OD0A 4Q4W3 1WMEA 3TN93 3SCHA 5H9PA 1ONAA 3LB9A 1Q56A 1IQAA 1C8M2 3TYJA 3ZXKA 4COYA 1FYUA 5GLTA 1D2QA 3OD4A 5F1RA 1LGNA 4IV3B 1Q43A 2IXHA 1SCRA 1ZRRA 5C6CA 3TWIA 5HCAA 1BQPA 2BYVE 2VW1A 1XRUA 3WW1A 4IEXA 1AR63 4XJ9A 2DWRA 2VW0A 5HI0A 2UY9A 4BE3A 2YPJA 1Q8OA 1RUE2 2BNNA 2RS51 1G7YA 2D6PA 3H3UA 3KMHA 3M3OA 5F9TA 3GHNA 2DCKA 5DG2A 1WLTA 2R6QA 1QQP1 4JQRA 4E4DX 4E4SA 1R081 3WUDA 1ULFA 2IZWA 1NY71 1CGPA 1BYHA 3RYPA 1UW8A 3EXUA 4MX3A 4BMBA 4ES8A 1NA1B 5CFDB 4FTBA 3ENRA 1VRH2 4UBGA 2LTNA 3ZFEB 4IEVA 2QZ2A 4LBNA 1X8MA 2VNOA 3AFKA 2RM22 1YUDA 2WLPA 4NWVA 1YI9A 1AR61 2Q0AA 2DU0A 3O5SA 3SISA 3U4XA 1H8TC 3ZX7A 4GMP1 1RUC3 4DOUA 1QU0A 1GNHA 4B7KA 5K7PA 1DIWA 3EHKA 4JGZA 5J37A 1ASJ1 5K0UC 1AXZA 2GZWA 3MIGA 4OFGA 5D8AB 4YVSB 2IC1A 4QPGC 2WT0A 1OQDA 2NM1A 3B9CA 3WP3A 1D2SA 3JCIA 2R49A 2K2SA 5ABJC 2ZX1A 1KS4A 4FAGA 1W6MA 4PBPA 4I0WB 2HWD1 3VZNA 2JJ6A 1TME2 2UWCA 3USUA 2ZOEB 2JKBA 2YGMA 2IXKA 2ZGLA 5BNQA 5FREA 1HDKA 1WMDA 4QT6A 5CA6A 2A6YA 1RUJ2 2HWB3 3D4KA 4Y1XA 2R042 3UJQA 4E27A 1PK6C 2YXSA 5J7MA 2R062 4ES9A 4FOWA 1SLCA 5KHHA 1SCSA 4R52A 3VL8A 4A7YA 4Z82A 1D4M2 1DDLA 5KWRA 5EZWA 1CAWA 5HCBA 3WCSA 4BPZA 3LWCA 1UX6A 4JDMA 1Z7S1 4QQ2A 3N7KA 1ULEA 3RG0A 4A7ZA 4PIYA 1GNZA 4TSVA 2OYZA 5CNAA 3VN4A 4LO6B 1HLCA 1S0EA 2R1DA 4ZU5A 3TAYA 5F6KA 1CPMA 3E97A 3VHOA 2GC2A 1RUG3 5C4WB 1IS4A 2QNKA 5BXXA 1MQTA 4K3UA 1AL23 1W0PA 1XU1A 4L11A 5BNOB 1V6OA 1DFQA 2MEV2 3VDDA 3P3PA 3ETQA 4AFAA 1BCXA 2DURA 2ZGPA 4LBQD 4JAAA 4BA6A 1TE1B 5EYXA 3M8LA 3NAPC 3VBSC 4CDUC 4AI8A 4RR3C 2XVLA 5DUVA 4DQAA 2VUJA 1GYKA 3IDEA 4RS5C 3WHTA 1TMF2 3GBGA 3FUOA 4CZSA 2D6NA 4YW4A 4AVBA 3VZMA 2XJRA 3B7MA 4P9LA 4RA0A 4EN7B 3AKPA 2D3SA 1D0HA 2E9QA 4L92A 1RUF1 3AXDA 1FNZA 4RHV2 3AB0A 5KHKA 2EXHA 3FFQA 4R9CA 4QGNA 1MS3A 1QXRA 1WUVA 3H9AA 1UKGA 5JIAA 3ZVXA 4I02A 1FPN3 1G9CA 3M3IA 1UD1A 4R9DA 3KLSA 3AP4A 1HQNA 1ND2B 3DPRB 1KITA 4UW6A 3SXWA 1NLSA 2ARBA 5KBFA 3FMGA 4RSUA 4QGLA 1ZBA2 2YUEA 3ZMOA 2DF7A 3PVBB 1K5MC 1Q8QA 3H0OA 4WV8A 1NE4A 1DQ1A 2O0OA 1U5XA 4ISRA 3PVOA 1BK1A 4ATFA 3OF1A 1FPN1 4XETA 2ZMKA 1J3PA 1LHWA 3GBFA 4IEYA 1C8M1 1POV0 5H9SA 4LBQB 4Z8BA 3AJZA 1TEIA 3HAGA 1M06G 4EWAA 4C1WA 1ZZ8A 3AYDA 1WW5A 2ZZJA 1RINA 4PIZA 1ULCA 4MX