4D7YA

Crystal structure of mouse c1ql1 globular domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
PRVAFYAGLKNPHEGYEVLKFDDVVTNLGNNYDAASGKFTCNIPGTYFFTYHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVILHLDAGDEVFIKLDGGKAHGGNSNKYSTFSGFIIYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords C1Q-RELATED FACTOR
publication title Anterograde C1Ql1 Signaling is Required in Order to Determine and Maintain a Single-Winner Climbing Fiber in the Mouse Cerebellum
pubmed doi rcsb
source organism Mus musculus
total genus 30
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d7yA00
1D4VB 3TYJA 2R6QA 4J6GA 3WD5A 4F3JA 2E7AA 4E4SA 5BNQA 1PK6A 3K48A 2JG9A 4OULA 2WNUB 4QQ2A 1RJ8A 3K51A 4GIQA 3QD6A 2WNVB 1JTZX 2KA3A 4DB5A 3FC0A 1ALYA 1U5XA 1DG6A 2Q8OA 4RSUA 1KXGA 1XU2A 2RJKA 4QQPA 1O91A 5HBAA 5TSWA 1OQEA 1OSGA 2JG8A 4D7YA 2ZJCA 2HEWF 2X29A 1KD7A 2QE3A 4E4DX 1C28A 1JH5A 3ALQA 1PK6C 4QQOA 2HEYF 4MXWA 1XU1A 2WNUA 2JG9C 4OUSA 2Q1MA 3MI8A 4MXVA 2WNVA 2RJLA 4KG8A 3IT8A 1WCKA 2R32A 4TWTA 1PK6B 3LKJA 4DOUA 2JG9B 4KGQA 3TWIA 3ME2A 1GR3A 4N90A 3B93A 1U5ZA 3URFA 1OQDA 2JG8C 2RE9A 5KC6A 2R30A 5L36A 4KGGA 1U5YA 4QQLA 2AZ5A 1I9RA 1TNFA 4OUMA 2WNUC 2QDNA 2JG8B 4HT1T 2ZPXA 4G3YC 1DU3D 2WNVC 4QPYA 5CIRA 2OIIA 2TUNA 1RJ7A 1S55A 4MXWB 3L9JT 1TNRA 1C3HA 2O0OA 5KWRA 4MSVA 3V56A 4TSVA 3B94A 1A8MA 5KC5A 1IQAA 3AB0A 2Z5WA 1D0GA 1D2QA 5L19A 4QQHA 4NN0A 3B9IA 4G4FA 2HEVF 4EN0A 2TNFA 3QBQA
chains in the Genus database with same CATH superfamily
1CZTA 3C8XA 2Y0IA 1ZBA2 4LHSA 1D4VB 5B4XA 2FD8A 5IK8A 2A71A 2WA3A 2E7AA 3AFKA 4NHYA 5LA1A 4NIHA 4CCCA 2DCJA 2CGPA 1V00A 1IKQA 5FQ0B 1OH4A 4MVTA 1WMEA 2Y34A 5FPZA 1QJZA 5ACA1 3ZSJA 4OI0A 2ZEXA 3IPVA 3WX5A 2ETEA 3I2IA 1DYOA 2V5DA 4QQ2A 4WVMB 4BA6A 4GIQA 5BY5A 1S0DA 3WF2A 2Q1ZB 2RM22 4AK3A 5IK5A 2I45A 3SXWA 2G9GA 2YDEA 1ALYA 4QPGB 1FAYA 5J09A 3C7HA 1D0HA 4LO7A 2Q8OA 1JBCA 2ZX2A 1NLSA 2GN7A 3N7LA 1MEC2 1QJX1 2ZX1A 2CYFA 3K4AA 3NNLA 5CB7A 1U0AA 2EIBA 1V9U3 3ES4A 2NZ9A 3R4UA 1X9TA 2Y6FA 3P1IA 2C1FA 2EF6A 1QJY1 3VZLA 3VBSA 1OQEA 2IWGB 1PHMA 3AYAA 4LHLA 4XURA 2MEV2 1HRV1 1L7QA 1FOD2 4HSJA 5GZFA 5EJ3A 1STMA 2QUOA 4MGYE 5CYYA 1OPOA 1HX6A 1W8TA 1CWPA 4P08A 2FCTA 5T54A 3CO2A 2B8MA 1ZZ9A 3A23A 4IEYA 2BPA2 1UY2A 4L97A 4HPKB 2OUHA 5T52A 1F2NA 3GM8A 4XFIA 1YLLA 4L0PA 4PBOA 4ASMB 2BQPA 2J1RA 3RYRA 5AFEA 2Q5TA 5BNPC 3J8F1 3KGLA 1QKQA 1MVQA 2P6CA 4HOOA 3O5SA 5CBLA 3LAGA 1AUYA 4L99A 1O3QA 1OKOA 2E7QA 5I0TA 3ZN4A 3LGRA 4BMBA 5JOWA 4XE9A 4AQ2A 1UW8A 1ZZBA 5FZ1A 2V5YA 4ARYA 3IPVB 3ST7A 3ZXFA 3WG4A 3WINE 1IS3A 4P9JA 4QMAA 3T1MA 3W58A 4BMEA 2I07B 2OVUA 2XHKA 4QGNA 3HBKA 1QQP1 1REDA 3WHTA 3RG0A 1VBB1 4YPJA 1VALA 2A3WA 3QOPA 3M7AA 1DYPA 3LDKA 5I8YA 3MV01 2HWE1 4LE4A 1NCQC 4FPHA 4IV3A 3T08A 3AMHA 1H9WA 2VNVA 3ECQA 3LQCA 1PVC1 2VNRA 4EN6B 1N3OA 4JKKA 5FCCA 5DPNA 2B39A 3Q8AA 2DCTA 1ULEA 4IEVA 4ZY9A 2ZPXA 1EV11 1AR71 2DUOA 1W9FA 4XUTA 2WT0A 2R7EB 4ZXEA 4E27A 3ITQA 3P6BA 5FZGA 5FZHA 2OIIA 1H6XA 2TUNA 4K8FA 1VJ2A 3RI8A 4DINB 2VCCA 3DCQA 4QDRA 1RUG2 4DRRA 1NOVA 1TNRA 3AZWA 4BLJA 2K0GA 5FY7A 2CGNA 4MGIE 3E97A 4QAWA 2VZOA 1ASJ1 5LEKA 5JI7A 4PI0A 3IKWA 5F5AA 5LBFA 2Y0OA 4QB1A 2VL4A 4MGZE 4QQHA 2DBIA 2BV4A 3THTA 1SLTA 2HYXA 4Q4W3 4XFCA 4N9IA 4I0BA 5KHJA 2ZEZA 2VVFA 4LBKA 3A0KA 3I3DA 2PAKA 5FUIA 4A7ZA 3FBYA 4QPIA 3KVBA 4QX0A 2DCZA 1Q8OA 5DUXA 2YU1A 3SKJE 3FL7A 5FXVA 5JPNB 2RR13 2VU9A 1GWMA 5F2WA 5C71A 2MHFA 2KXLA 1FMD2 1W90A 1ULDA 3S7IA 3VL9A 1RUC2 1GQHA 4YRDA 5FY9A 3PLQA 4PT6A 1CN1A 2BERA 1OLRA 1QMJA 4W6YA 4AI2A 3VUOA 3ASIA 5ACA3 4DB5A 3FJSA 3E5XA 1U5XA 5GLTA 4M3CE 3N7KA 1SG3A 3ZYBA 1MR5A 4XJWA 3HQXA 4FAHA 1KGYA 1BEV3 1S4CA 4RSUA 4XZPA 1SDWA 5FOBB 1WKYA 4XF0A 2CDPA 2CGOA 4FQ4A 1VBD2 4QWNA 1SDDB 2R0HA 4H7MA 2QQJA 3FN9A 3AZZA 4FFIA 4XILA 4B1LA 4A41A 4HETA 1Y43B 2PFWA 4NHLA 2A3YA 1EY2A 4MGTA 1C28A 4R4ZA 4S2HA 1QWRA 3TOJA 4WVZA 4NIGA 1QJY3 2TEPA 3H1MA 1V70A 2WQ4A 4JRAA 1N47A 4MHUA 3ZSEA 4Y1XA 1Z0HA 1HRV3 4Q4W2 1FV2A 2ZHLA 2GC3A 5EPAA 2FDGA 2R041 4JGZC 3J7LA 4RFT0 2BGPA 2J1EA 1UOJA 4TXWA 5A32A 4KG8A 4HK8A 4NR1A 5IFPA 2E53A 3BODA 1SLAA 4XETA 2R32A 1RB8G 3P3PA 3M3EA 3OGVA 4CDXA 3TB0A 2ZHKA 3NNJA 2NPIA 5FYTA 1UZWA 4FO9A 4XUNA 2RR12 3J8F3 3NKGA 4FXGB 5GKAC 3GBFA 5FIXA 4FPJA 2JKBA 4CDQB 3WZ1A 1W8NA 1N3PA 2BRTA 2KM2A 3PTRB 4IW3A 4Z82A 2PHDA 2IXKA 1U5ZA 5FYHA 4UBHA 3FZ3A 1QJU2 5JWPA 2VZRA 3E5UA 4NPMA 4URAA 4R9CA 3ZFGC 4H14A 1NA1C 3QH7A 1BEV2 3ZXEA 3KT1A 1SBFA 1QGLA 2EXKA 4QQLA 1ZRRA 3SH3A 3WNOA 3BCWA 1I9RA 1QQP3 4OFGA 3VD5A 4GMP0 4JQTA 1VBB3 2P17A 1US2A 3UL2A 4IL7A 4OUMA 3OPWA 4LTAA 4YW7A 1UZ0A 2WINB 1VAMA 4DFSA 3NJVA 5IUQA 5T55A 1ZBE1 1VRH1 2RS32 3A4UA 4K40A 3VZJA 4XCBA 4IDZA 1QH7A 5FPBA 1V6KA 4YFZA 3UJOA 5EQUA 4NMIA 4XMAA 1YI9A 2BEOA 2WQZC 3GCXA 4AVVA 4JAAA 4AEDA 1AR73 2VOKA 5A3OA 2W0XA 5KWRA 1YUDA 4AG4A 3ZDSA 3WF0A 1HQWA 2ENRA 2GSYA 4OHXA 1BYHA 4M4PA 4QX2A 4XQDA 3SHRA 4CU7A 5BNNA 2DURA 4OZXA 1SLCA 1J83A 4AI3A 1H9PA 2YV8A 2BVBA 5FZBA 3AZXA 4LBQA 2GMPA 1VMJA 1ASJ3 1TMF1 2VECA 2QBXA 3O1TA 4Q5OA 4FBFA 3ZXJA 1H1IA 2VM9A 2A73B 2XQRA 4CEWA 3J7NA 5FMDA 2BW8A 2BFUS 1HXS1 4F3JA 3DXTA 2Q30A 3JD73 3VDBA 2X5IC 3K4ZA 2A6WA 3AK0A 4LKDA 2VZQA 5FJKA 1J1TA 1FATA 2JD4A 1IKPA 4CCEA 3ZYIB 4AGGA 5AC91 2A6YA 3BYWA 1RUNA 1NLQA 2ZZQA 4Z8BA 3M3CA 1RUI2 1UY0A 1XOYA 3ORJA 4M4RA 2JE9A 4AI8A 3FLTA 4RL7A 4I2OA 4CU9A 4Z2WA 2AH2A 3OBTA 1POV3 1QHDA 4XBQA 3ZMNA 3DKWA 2A7AA 2IUWA 5LY2A 3RFRA 1SBEA 4LJHA 4PDWC 1QEXA 3AP9A 1NUKA 4NO4A 3HIFA 5IHRA 1W9TA 2E6VA 3TNPB 4H2AA 1H8TA 3MGUA 4UWDA 3DXUA 4DXSA 1JZ4A 5BNNB 2ARAA 5FPXA 3ALQA 5L7OC 5FZ9A 1G7YA 1O8PA 4JQRA 4MO3M 1JZ2A 3AZYA 4XEZA 4LBQB 1LU2A 2IC1A 3POFA 3LA3A 4OHZA 5J7MA 2WO2A 1H30A 5C8CC 4YW1A 4N7IA 1R091 3MI8A 3U37A 2ZX4A 1FPN1 3BVCA 3K77A 3AJZA 4FI9A 1UX7A 3ZYFA 4BIOA 1WCKA 1Y9MA 2PQSA 4P02B 4AAXA 2R043 2UYAA 1UQXA 3VBFC 4WZCA 3O1PA 1OLMA 4BQ5A 4AVBA 1GR3A 2VZ1A 3U07A 1UYZA 3RI9A 5FPUA 4WM7A 3NNGA 1OVSA 5A6ZA 3VKOA 2D3SA 1RXFA 5FUPA 5IAVA 2WO1A 4IV1A 5HI0A 2PXJA 2D7FA 3WUDA 4QD2A 4KH9A 5HPOA 4FTSA 5KC6A 5K9YA 3TBDA 3IDEA 3BN6A 4XJ8A 4QXBA 5GZEA 4C90A 5FZKA 1MS0A 2ZHNA 2WL1A 3PDQA 1TME2 1ZNPA 3DUIA 3NV1A 4CDUC 1H8VA 3BI3A 3VBRC 5DAPA 1MPXA 3FX3A 3BTXA 2XWBB 4QM8A 2WNVC 4CTEA 4QPYA 5CFCC 3I2KA 3QH6A 4LEJA 3MW4A 1PGL2 4QGMA 4Y5SA 2AREA 5JOZA 1PO11 3M3IA 5BNPB 4YM0A 4S2DA 3N36A 3WW1A 2P3IA 1BLZA 2FDJA 3POYA 4W8JA 5JIUA 2J22A 2WR9A 5EYYA 1CR7A 3AP5A 3P3NA 4QB2A 1YRZA 3WW4A 4AGVA 2VR4A 1UMHA 4Z1VA 3T2TA 2XXZA 2R49A 1TG7A 2CSGA 2EIGA 1NZCA 3RZLA 1SFPA 3CZUA 3LEMA 3RZMA 4JV4A 1RUH2 3HD8B 4WM7B 3RMYA 5CA6A 4Y1VA 1XRUA 2P3JA 2D97A 4MZUA 2JEMA 3PHMA 4E2GA 1UIJA 1TMF3 1CX4A 3POSA 5BNQA 1UAIA 3MPBA 1DYKA 4KWLA 4OLLA 4Z92B 5JSRA 1CAXA 4K1ZA 3CKHA 1Z78A 4ZKTB 2A6VA 3IZOA 1HXS3 4YW2A 3MLKA 3ZKYA 4DUXA 5GLVA 3POIA 4HLTA 2P37A 2XB6C 1X8EA 5A3WA 1K45A 2WC2A 5KXCA 1OFSA 4LBNA 2A75A 2DWRA 1UXZA 5A6QA 3VHRA 4CXYA 5FZAA 1AXKA 1X9PA 2WFF1 2X09A 2XVLA 2D93A 4XF1A 3BOPA 1T6GC 5FYSA 5FZLA 3B01A 4HONA 1A34A 2DUQA 4K20A 4KI5M 1D4M1 1ULPA 4ZS2A 3AP4A 1OPMA 1S0GA 2P5BA 4QKBA 5GLZA 1LKNA 4AHXA 4AW7A 1VBA2 4KG0A 1MZ5A 3B7MA 2VVDA 3ILNA 1GNYA 1O8SA 3WV6A 5IVYA 4Z07A 2HEWF 5M0TA 4LBQD 3RSJA 3VDDA 1XNBA 3JBG1 5FXWA 3UKNA 4CSWA 3VHNA 4IE6A 3NL1A 3MIHA 3AL6A 5IVVA 4URTA 2GAUA 4HXCA 4UYBA 3WQBA 3ZIXA 4QKNA 5F5QA 4FQZA 4Y20B 2FCUA 4MGKE 3NVCA 2O8QA 1GICA 4Y4RA 2VUDA 1W9SA 1AJKA 5F6LB 4CDWA 1RL3A 1ONAA 4N43A 5JXGA 3CMGA 1B35A 1D2SA 5J48A 1V6LA 5FYIA 3GNEA 5K7PA 4NIDA 1R093 3ZN6A 1LCLA 3MUY1 1CAXB 3F2ZA 3SH5A 2WQ8A 5CU1A 4GH4A 1PX3A 5A1AA 1OMIA 1I6XA 2WT1A 1H2LA 3AJYA 1HRI1 1O4ZA 4O65A 3IDCB 4LITA 1NA1A 3MZHA 1Q8VA 2DVFA 3PUHA 4AFAA 4EE2A 3OSDA 1AYN2 2C0ZA 3N9PA 4NAMA 3VBSC 5T5JA 3ZKUA 4UFMA 4AOCA 5ANNA 1F9KA 2R30A 4IE5A 3VBUC 1IOAA 2W9XA 3H3UA 3H9AA 4H3WA 3VZKA 1KJLA 2HWC3 2JB4A 4LO4B 3M3QA 3TAYA 3U11A 3O1UA 1MZ6A 1JI6A 2IFWA 3KHBA 4Q4X1 4BDVB 4KL1A 4RGGA 2EAAA 1JW6A 3LEIA 4AXOA 4FTBA 2JB8A 2PYTA 1OC1A 2WNEA 2YC2A 4UT5A 4ATFA 3ZXAC 4XAAA 1KDMA 4JGZB 1C8NA 1ZZ6A 5C33A 4P5YA 1KFXL 2YBSA 3VD9A 3L9JT 3OPZA 3E1F1 1C3HA 1GLHA 4L92A 4CDWB 1HW5A 3LA7A 5ANQA 5LATA 2BTVC 1PO13 4N43B 4KWUA 2Q8DA 5KC5A 1IQAA 4Q0VA 2ZMLA 4XHBA 3DKQA 2DYCA 1HJFA 1HN0A 5D1IA 5F2SA 1PGW2 1GWLA 4Q0UA 2DFBA 4NHMA 2EIDA 4FFFA 4IV3C 3WEZA 3ZFGB 3H3LA 3WNNA 1NA1B 3N3HA 1XJAA 3VKFC 1BMV1 4YGCA 2UWBA 2OZ6A 3WCRA 3BUCA 1Y9GA 4LHNA 4Q4Y3 2G1MA 1DZQA 3TN91 4XFHA 3DV8A 5FZ7A 2ADDA 4LO8A 3DPRC 1ZRCA 3H8UA 2BWAA 5C3RA 1XNKA 2AC1A 2HWC2 2Y60A 4R9BA 1S2EA 2YUEA 2ZGNA 5DZFA 4CU8A 2AYHA 1G9DA 2HWD2 2YHJA 2V4VA 1CAUB 4MHRA 4X8NA 2YMZA 2A1XA 2D6LX 2R073 4HN0A 4PDWA 4D0QA 5J1XA 2D5FA 4RHV3 3N7JA 3ZXGA 4ITCA 5CKNA 3FHQA 2WFF3 2WN2A 2XJUA 3D5OA 3PVEA 4K21A 2E9QA 3VN4A 4COYA 5F5CA 2RVAA 2ZOEB 3NV3A 1FOD1 1W2OA 1EPZA 1JN2P 1PO23 4QU1A 2GP3A 3ZYRA 3PU3A 4QX7A 2GH2A 4BIFA 2B42B 3FFQA 2QQOA 2R0FA 1NE4A 1D4M3 1Q8QA 2XBO2 3IM0A 2OPWA 4RS5A 2D43A 5C8CA 2JJ6A 1LULA 3KQ4B 4P00B 4QPIC 4CVUA 3RVHA 5FK8A 2BGOA 2B7YA 1EYBA 3JBG3 2DVDA 5FP9A 5FYMA 4FXKB 3VL8A 2PHXA 1N1SA 1G6NA 2VZVA 1N3QA 2X5IB 4PCRA 1VRBA 2CY6A 3M70A 5E1RA 5IT6A 2Q0AA 1AVBA 4NAOA 1WLCA 3VBFA 1G8WA 2R16A 2XKOA 1YQCA 3GF6A 2B9VA 1OXCA 2D6NA 3C7GA 3D6EA 2VZPA 5EIYB 1UL9A 4Q4Y2 4WVWA 1F8VA 2WYSA 2YC0A 4LLOA 4ES8A 1RUE3 3ME2A 1MACA 1VP6A 3B5LB 4JKLA 3WNMA 2C9AA 3A0NA 3AFGA 2DCKA 3PMSA 4XDQA 2VZ3A 1S0IA 4AQ6A 2A5ZA 3RNSA 1L7LA 3ZXKA 3AMPA 3Q8FA 2QQLA 4PDWB 2R072 3PVOA 3ZLIA 4LBOA 3AMQA 4OYUA 1YQ6A 1HRI3 5CG9A 4RHV2 4YZ5A 2D6KA 4BYYA 1GUIA 1AR83 4QDSA 5GLWA 4CDUA 1GP5A 1UYPA 2W1SA 4M00A 4GMP1 4BJ0A 5IVFA 3MIBA 1LHNA 4QB6A 3LOIA 3PU8A 5CFCA 3MLLA 5L7OB 4CCMA 1PVXA 1PO22 5DDJ1 3I2JA 5E89A 3BPSA 4G3YC 1LGNA 2O14A 4GKXA 1PIV1 5KHKA 4Q4X3 5C8CB 2LRPA 4KU7A 5LCWL 5FLJA 3WP5A 4RQPA 4CDXC 1BJQA 2YY1A 1S55A 3WDWA 2AACA 1UX6A 3E5QA 2JDKA 2VE1A 2X05A 5L9BA 1SEFA 2GC2A 4B7KA 2VUAA 4A4AA 3I4IA 3VBFB 3I3MA 3EMRA 1POQA 1AYM3 3K3OA 3NW4A 4CCDA 2VVEA 4XZUG 1D2QA 4A42A 5F9TA 1LEDA 4ARXA 1JU3A 3WNPA 4AEJA 4EN0A 2VO5A 1Y9QA 1AJOA 2HLEA 1XYOA 3PVBB 1AX2A 4JGYC 4JHZA 5FY5A 3T3YA 4WZFA 4FFHA 1DZRA 2NQYA 3CQOA 3U10A 4JZRA 1ENXA 5C3QA 1JS9A 2JG9A 4NHXA 4CDUB 1AR82 3EJKA 2R1DA 2W94A 1UNBA 2IZWA 2XR4A 3H0OA 3VBRB 2OX0A 3VKMA 5JXJA 1QU0A 5FO7B 2B5HA 4Y22A 2WNVB 5FYBA 3NJYA 3J4UH 4XOGA 3TN93 1RMU2 3ACIA 4AEDC 5CFCB 3O12A 1JZ8A 4PI2A 1DG6A 2ZGMA 1UZVA 4A3ZA 2VTXA 3H1WA 1LB2A 2OUJA 5JIAA 1W2UA 1SLLA 4YFWA 1QJFA 4DS0A 2H0VA 4DUWA 4JCKA 2W68A 4NRQA 3K4DA 4OHWA 4N8MA 2ZA9A 2PQQA 1W6PA 3ZM8A 3ZDVA 1K3IA 3O1OA 1NCRA 2ZJCA 2PLV2 3LE0A 4IETA 3DYPA 1YIPA 1VB2A 3H8XA 1AF9A 3WDYA 1AYM2 1XPWA 3G7DA 2JECA 5FZ8A 1Q5OA 1QOTA 1XSQA 1M4WA 1BBT3 2JD9A 2VNOA 2WNUA 2YGLA 5A6YA 3AX4A 3CF6E 2Q1MA 5GZGA 1U12A 4XACA 4AHYA 4EN7B 2ZS6B 3H1YA 4COZA 2OKXA 2E26A 5IVCA 4UAPA 4QHZA 2OS2A 1W8HA 1F4HA 5F1RA 3B9CA 4YGDA 4BB3A 4TWTA 3U14A 5A7OA 2WABA 4MV2A 4WBBA 4YG6A 1K5MA 4XTMA 2JG9B 2PTMA 1YNAA 2E51A 3FWEA 4HVOA 3R4SA 4ONUA 1UU4A 1E5HA 4M3CB 1O59A 1PM7A 3LSDA 5FY8A 5JR7B 3VBUA 1GOHA 2F4PA 5EHDA 4GB32 4YG3A 1XNDA 1OF4A 5APAA 2E33A 4YNIA 3UNPA 2RMU2 1I5ZA 1VE0A 1H8TC 2C5DA 3ACFA 3OOXA 2VTFA 1ZA4A 4LQRA 1C57A 3HT1A 3NSTA 5KHIA 3AZVA 2K9ZA 3RWNA 1W6PB 3O1RA 2ARCA 1LNSA 3RJ2X 3C7OA 3N9LA 4HSLA 4RR3A 5BXXA 3S0MA 2L9LA 3BGAA 2CDOA 1S1AA 4Q2FA 4AFCA 4B7EA 5C70A 5KR7A 3BIEA 3ELNA 4I0AA 3DECA 3NNMA 1E5SA 1GWKA 5DDJ3 1NX9A 4CUGA 2VQ0A 3OEAA 5IAXA 1BBT2 3THPA 1A78A 1NAEA 2GNMA 2HWF1 2PHUA 4CRQA 4WM7C 5IATA 1G9AA 1SPPA 3PNAA 1NE6A 4FPYA 3AB0A 4IV1C 4YW5A 5L19A 2O8OA 3KD4A 2VMGA 1I3HA 1K5MB 4AFBA 3LFIA 3ZYJB 1V9U2 1XB9A 2YPDA 2WJSA 3H7JA 3MF9A 5A3TA 1DHKB 2D98A 2R1BA 4AYUA 3AP7A 3VBSB 5CADA 1NG0A 1NT0A 1QXJA 3VBUB 3OYWA 4NUBA 4QXKA 3DPRA 5FZOA 4CU6A 1QXRA 4P14A 5FKCA 1RVF1 1SLIA 3Q8BA 1RINA 1YQ8A 1FV3A 1OQ1A 3MHZA 2RG4A 1APNA 4OQ9A 1ZRIA 2Q1FA 5JSOA 5F3CA 5C5TA 5FY1A 2JDUA 5H9PA 2W91A 4E4ZA 1KEXA 2KD7A 2XUEA 4XFBA 4LOTA 4OZOA 2VW0A 2X10A 1VBE1 1CZVA 3MPPG 3R6SA 5DABA 4YZ2A 1LOEA 5H9RA 3BU7A 4I02A 1UD1A 3VZNA 4ES9A 3APBA 3EXUA 5E6HA 5FZIA 1J3QA 2CL2A 2JDHA 4H7LA 5IK7A 1S0CA 5LASA 5GALA 4BE3A 2X53S 3VDAA 4CP2A 1LHOA 4D7YA 1A6CA 3TEYA 2P3YA 1DGLA 1SPPB 1RYYA 2J7MA 2R061 2RDRA 2IXCA 2X29A 2YB7A 3CEWA 1CIWA 4N53A 4XQ4A 4XQWA 3MLJA 3A7QA 4NRPA 4IV3B 4LNVA 5F3IA 5BNOA 5JPMB 3LEGA 1QJEA 2AGSA 1UOFA 1WLWA 2XDVA 3W20A 4DEQA 1J3RA 2WWJA 3T2PA 3W5NA 1UKRA 4PIYA 1LTEA 4A44A 1WCQA 3OYWB 4XJAA 3DPRB 5FZOB 1CQ9A 3JXSA 5FPAA 4L8QA 2ET7A 4ZONA 1AXYA 4ZU5A 4J25A 3ZXDA 4D6QA 1RHI1 1QJX3 1OFNA 2YROA 3IN9A 5CKMA 3KGZA 2BBVA 3JZVA 4EYUA 5LA2A 1OA3A 4MH0E 2WAOA 1EUUA 4M01A 4I3GA 5C9AA 5JUVA 4IGPA 3I59A 5CZKA 1GP4A 5DG1A 4YVWA 2ZKLA 5A6XA 1DBNA 3D4KA 4IEUA 2J1AA 3AM2A 2P4EA 3WOGA 3DEMA 1O3SA 2ORXA 1OA4A 3JB8A 4IEOA 4Y3OA 1BK1A 5GM0A 1COV1 3VDDC 3K46A 2AZ5A 3MV11 4Q4V1 4Q1PA 1GZTA 2DDUA 3OF1A 1UY1A 1WWYA 5A3PA 3ZFFA 1X7NA 2NMOA 3UK9A 2D3PA 4QPIB 4CDWC 3KCYA 2QQWA 3CJXA 1LAJA 1C8M1 1UOGA 4N43C 1B35C 4NPRA 3RDIA 2DU0A 1UY4A 4E2QA 3Q9OA 4AWDA 2V09A 2B45X 5FTTC 3I2GA 2MNGA 4FPFA 4HKWA 4GH4C 1UPSA 3KCCA 3LSEA 1X82A 3B69A 4IERA 5ACA2 3IAPA 1YJKA 4IE4A 1JXNA 2K46A 2LTNA 1Y3TA 1NQDA 1RUD1 1F5FA 1FT9A 5A3UA 3RZKA 2UURA 3LPFA 3I49A 4JGYA 2HWF3 2XJPA 4TTGA 2YYOA 2WT2A 1T2XA 4XF4A 4Y33A 2HEVF 1HIXA 1H2KA 4OQ8A 4ZZ5A 3RMXA 3N4MA 2HWE3 3DL3A 4BLIA 1DQ6A 5LA9A 1XNCA 4EJRA 3U75A 4AR2A 5T5OA 5K0UC 4DUVA 1PMHX 1PVC3 4FPOB 4KNCA 1W0NA 1FNYA 4OHYA 4DO0A 1BVVA 2IVIB 1QJY2 2ZGUA 4LK6A 4QHBA 3NAPA 5AFBA 2VUCA 1EV13 4UFLA 2VZTA 2MPFA 1HRV2 2Z42A 5EZWA 1KRIA 3K51A 3WNKA 4DXZA 1TVGA 1N1TA 1RVF3 2GU9A 3GGLA 5A32B 5FYVA 4R8HA 3B02A 3FC0A 4BQWA 2IXHA 4YM1A 4CDXB 2J1VA 2VBPA 4XBNA 2QZ3A 3D8CA 2QCSB 2VAUA 4BQ4A 2DV9A 3J8F2 1NY71 4LIUA 4PF5A 4D3WA 3GBGA 4AFDA 2KR2A 1VBE3 1J59A 5C3SA 3SCFA 4P9YA 1VLNA 4GD4A 4D6SA 2AR6A 4Q26A 2JG8A 4CXXA 3EB7A 1UYYA 4L2NA 1BVP1 4PLMA 4GZ9A 4QM9A 1O3RA 3ZSLA 1YCIA 4ZS3A 3PJQA 5H9SA 3ZYGA 2DCYA 4LKEA 4MADA 4QQOA 1QQP2 3N9QA 4JGYB 2HEYF 5JI9A 1OBNA 3LEKA 1VBB2 2R063 2VOTA 4KWKA 3THDA 1IG3A 1GMMA 2HWE2 5E8AA 5CKQA 1GKBA 1UZZA 2ERFA 2ZX0A 4F8AA 5KHGA 1OD3A 1PVC2 1VAKA 4O9EA 5HCBA 4Z2AA 1K5JA 2UWCA 1H4GA 1BZWA 1VBC1 3F95A 3K2OA 3B00A 4AEDB 1EV12 1AR72 1X33A 1W9WA 1YFUA 4XABA 2G9FA 1IPKA 3GCWA 5FV3A 3O0WA 3GXUA 3OY8A 1WW5A 1DFQA 2J42A 1L3JA 2RS11 1MQTA 1JOJA 3CHXA 3ATGA 4FPCA 1MZFA 1RHI3 3NO8A 5I0DA 5FMOL 4WV8A 1SZBA 5A3LA 4QX8A 4KGGA 1R081 2VMIA 2WNOA 4IGOA 2CV6A 1ASJ2 2RDQA 4RS5C 1F35A 5FXZA 1W2NA 2ZACA 2Q8EA 3VHPA 4HFSA 2VXRA 4LUKA 3I3QA 3ENRA 3VZOA 3ZOIA 1COV3 1EAH1 1HLCA 4QXCA 1FYUA 2JG8B 2F17A 3JD72 4Q4V3 4HT1T 4QHOA 5L73A 1ULCA 5A7NA 1GZ9A 1VMHA 4BXFA 5FLIA 4JRLA 2DTWA 3D0SA 5FKBA 1AR61 4QX5A 2AEYA 3MIDA 5SV5A 4EWEA 1UKGA 2RV9A 4B4PA 3WR0A 1RUF1 2WZ8A 4AGRA 1V6IA 5FUNA 5FJHA 1W8FA 2XLGA 4MSVA 1YFYA 4X6QB 4OHVA 1YWKA 4M0NA 1ZRFA 2FDIA 4Q29A 5FZDA 3RPQA 4NWVA 4CUBA 2BNOA 2JENA 3USUA 3PMEA 4ZU7A 4IE7A 4JDNA 2W95A 2XGXA 1LGBA 3KWVA 4NWWA 4Y26A 2UY9A 1RUD3 2YFUA 2WA4A 2WUHA 3HJRA 2ID4A 1HB4A 1SHWB 2ZAHA 2VG9A 3OY8B 3CBNA 1H8TB 4YG0A 5FPLA 3HBZA 3I97A 4FOVA 3KZ4C 5ISLA 2FCVA 2VULA 1ND2A 2ZGQA 5LRSA 4Y1ZA 2VQUA 5FREA 1ZYBA 1RIRA 4DPNA 5JOYA 4ET7A 2CWMA 1DGWA 1VRH3 1ZBE3 1JMUB 2XVKA 1Q8PA 3LIHA 1WW6A 1QOOA 2HWD1 1AR91 2ZMKA 3NWKA 3SEPA 3VZMA 2F6BA 3IWZA 5I0RA 4RQPC 2JDNA 1LRHA 4S2GA 4AAPA 1MS3A 3JUUA 4HL0A 3CDZB 3I8TA 3FBMA 1MS8A 1CPMA 3TNQA 3V64A 2R042 2W1QA 2DFCA 4RD7A 5DZGA 5DQ0A 5CAZA 1O3TA 5I8TA 1UMZA 5HV0A 1PMJX 1DLLA 5IWFA 1A3KA 1V0AA 2DF7A 2YG0A 5ERLA 2W47A 4IV1B 2JE8A 3BB6A 1DGRN 2P34A 3VBOA 3AKTA 1ST8A 2VXJA 5D8AC 3ZYPA 3IMNA 4E4DX 3L2HA 4INDA 4XXAA 1LJ7A 2XH6A 3K75B 3JU9A 3G6JB 4WVVA 4DXRA 2JIGA 2JE7A 5JR2A 2WYFA 1VR3A 3E6BA 2JG9C 1WMDA 1X8MA 3H3ZA 2WZR1 5FZCA 4W4ZA 3BTAA 1Z7S1 5AC93 1WA6X 2RJLA 1C4RA 4NVPA 2CTVA 4TLFA 3MIEA 3FUQA 4IGQA 4AVTA 1E5IA 3C3VA 1ND2B 2BP6A 4BQXA 4P9GA 1ODMA 3MBWA 1IPJA 4NPLA 1WGPA 3ES1A 1VMFA 4CCNA 4LT5A 2HWB1 4YSFA 2G4IA 1ZBE2 4MG2A 1HB2A 1OUSA 2RS51 5FXXA 4HN1A 1VIWB 5C4WC 1GNHA 1W28A 1JYIA 1UOBA 1CZSA 5FP3A 5HXVA 4P9IA 3V0AA 1F31A 1XE8A 1Q8SA 2QQMA 2XL7A 3GALA 3M1HA 4I01A 4NE9A 5SV8A 2A3XA 5FZMA 1NCRC 3QACA 3WT3A 2ZTNA 4V2VA 2D5HA 2ZMNA 1LESA 4ISQA 1ND3A 1AL21 2VBDA 3M3OA 4IEZA 4E2SA 2IXIA 3CJIA 1CIYA 4KWJA 5BPXA 2GH8A 2WNUC 3W21A 3GZEA 1TMF2 4UFJA 1FX5A 1SACA 2QDNA 3MICA 4UFHA 1YXWA 5FYUA 3VBOB 4YGEA 3FFZA 5A7SA 3T0AA 1BK0A 1FPN3 3ACGA 3C2UA 5CIRA 5CFDA 1VPHA 1PNGA 3AC0A 1UCXA 1WBFA 1EAH3 1HXS2 1KS5A 2DVBA 2XONA 2JXAA 1IZ3A 4WM8A 5FAXA 1K5MC 2XQXA 1POV0 2WN3A 2WS91 4OMCA 3AXEA 3AYCA 3OBAA 5EXOA 2HYKA 4X8PA 3T0DA 1AR63 2C9KA 3FUOA 5FMBA 5AC92 3POWA 1QXPA 1EP0A 1VB4A 3MW2A 4B8EA 4EWDA 5KXEA 1RUF3 4MUVA 4CEYC 3IB3A 4RFRB 4YZ1A 4KBBA 4PHZA 2AEZA 2VZSA 1YI7A 4DNYA 5BYNA 1HV1A 4GJZA 1H6YA 1ULGA 5CNAA 1RUJ1 1AZDA 3P5BA 1T6BX 3NKTA 3QBQA 2W5FA 5K0UA 2ZCWA 5FP7A 4R9DA 3SISA 4DY5A 3VDDB 5FOJB 1PK6A 4XC9A 3N9OA 5JZGA 4HZFA 4Y4YA 4RR3C 2VZUA 5IFTA 2PHFA 3POEA 1ENRA 2YZ4A 1JZ6A 1J3PA 2FMYA 3S5QA 3IDAA 4NOTA 2UY8A 1LR5A 4HG6B 1R1A1 2VC9A 3AKPA 1B35B 2KA3A 3AVSA 1YHFA 1WZXA 2WDBA 5F39A 3WDTA 4P9XA 4IEXA 5A1FA 3ZN6B 1ZBA1 1NLRA 1R092 2W46A 1FPN2 2WKKA 2EVXA 3LIGA 4LORA 4GH4B 4LR4A 2Q4SA 2A70A 5CFDB 4QQPA 1V6MA 4Y5Z0 1O91A 3OGGA 2JDZA 5LBCA 5FK7A 5LW9A 4GAZA 2ZBJA 5JMOA 4YARA 5TSWA 4W6XA 1XE0A 3GJAA 1KDKA 4BQ3A 4XPVA 2VOWA 4BPZA 1KD7A 3DN7A 4AHZA 4A7KA 3UESA 3LD8A 5FLHA 1UY3A 2RM21 4FPKA 3S6PA 3SC7X 3WY6A 2E7TA 1PGSA 2BDRA 3AKQA 2XJSA 4DMIA 3H42B 5FMOS 4Q0SA 2XHNA 1HB3A 1HQLA 2DUPA 4AE2A 5K0UB 1MEC1 1WUVA 4QKFA 3AKRA 1AX1A 2WO3A 2YFZA 2QQIA 3WF1A 3R0RA 1TE1B 5JLVA 1IS4A 1Q3EA 1PK6B 2WZR3 1Z7S3 4DOUA 4KU8A 2UU8A 4KGQA 1W6QA 3TWIA 4CCLA 1PMIA 2MEV1 1FXZA 2CNAA 1W8WA 1C5HA 2OXBA 3N9NA 1W05A 3B93A 4SLIA 1BKZA 4IESA 4K3UA 1PO12 5FP4A 2Y6KA 3RJRA 3I3EA 1W0PA 3USSA 1W6MA 2ZGKA 4PF1A 1OOPA 2VGDA 3LF7A 4LIVA 4L11A 3T2OA 3HWJA 1YQ2A 5ABJA 5EYXA 5L36A 1CONA 3HNYM 3T4HB 3BTYA 1U5YA 1JYXA 2D6OX 1TNFA 2ET1A 4N53C 2WSUA 4LOSA 1CD3G 3WHUA 3ETQA 2OPKA 2XJQA 4XCAA 4U36A 2I2SA 3ZFEA 5E16A 1MS4A 5DAQA 2IXJA 3ZSMA 5BNOC 4TZDA 4UXAA 4BHPA 1UPIA 3AYDA 4YYOA 4YVSA 2VNGA 4XTPA 1F5JA 2LS6A 1FI2A 3O0XA 1QNWA 1JOPA 2RHPA 2ZXQA 3EO6A 2RJ2A 3U4SA 1LODA 3UKTA 5D21A 3NQHA 3PL0A 4O61A 3ZR5A 2XPJA 1ZRDA 1WA4A 4Q1RA 4QPWA 2EXJA 1LHUA 2ZGTA 1S0JA 5K4LA 2XLAA 3ZIWA 4QX1A 2EA7A 2GALA 5C9AC 2Z5WA 2QDRA 5FZ3A 4YVWC 1DLCA 1GZCA 2LROA 3MW3A 1G86A 2WFF2 1W6QB 1XQNA 4O9GA 1Y7BA 2VTXJ 4CEWC 5F5IA 2PN5A 1ZREA 2BVVA 2R6QA 4AVCA 3OB8A 2VCMA 4Q0PA 1D4M2 4GWNA 4XF3A 3ZFFC 1RUJ3 4RS5B 1RUG1 4D7SA 1OOPB 3J9SA 4OULA 3FHAA 4B4QA 4OVEA 1G9BA 2JDMA 3RS6A 3ZPOA 3JBG2 3OTFA 1JYVA 5DZEA 2JDAA 3UT0A 5KXBA 1W6OA 2PA7A 1NZIA 3WDUA 1WCSA 3TEWA 4FVVA 3WVJA 4LBJA 4FOQA 3S5AA 4GQ7A 1DGWX 2Y26A 3PUSA 1KXGA 2LALA 2PMWB 1RUE2 2FQPA 4FPLA 4L9BA 1KJRA 1JHJA 3PJYA 5D8AA 4LHKA 3U1XA 3INAA 1KS4A 1ZBA3 1N1YA 2QTWB 3PIJA 3WW2A 3AMMA 4SBVA 5F3EA 1FMD1 1VAVA 4BXSV 3W9AA 1XNAA 1RUC1 5I91A 4R4XA 1JYNA 3OUJA 1HRI2 3UGHA 3OGRA 1PM4A 1PZ9A 1SCRA 1W06A 1IHMA 2VMHA 3W5MA 4W50A 4UFKA 1MVEA 3WW3A 4N9HA 3NAPC 5E88A 4I30A 3KF5A 2FZ1A 4WVMA 3MF6A 3OPTA 3VKLA 1GSLA 5HCFA 4MXVA 2GMMA 4EROA 4CUCA 4QPGA 4E8DA 1VBD1 3WF4A 4PQQA 1NQJA 4ATEA 3ZSKA 1QY4A 4BK5A 1MEC3 4Q4X2 5C4WA 3J7MA 3OEBA 4RQPB 3NMBA 2BWCA 3RZJA 3V0BA 2FMDA 3RWKX 4LKSA 4C8DA 3MO4A 3WNXA 1LU1A 1OT5A 3GBWA 5L9VA 3DF0A 4YLZA 2GNTA 5C7GA 3ZX7A 3FHIB 2MEV3 1HV0A 1FOD3 2XKPA 4Q4W1 2H6CA 2JG8C 4AFMA 4E8CA 2K2SA 2RE9A 4A45A 1I5PA 2IFRA 4MYEA 1GOGA 3RGBA 1UMIA 3R05A 2GP5A 4YZ4A 2UWAA 4GKYA 4AQSA 4LE3A 5D8AB 2CAVA 4HPKA 5H9QA 2PHLA 3H7YA 4ZPIA 2RR11 3WQ0A 4OCTA 1BHGA 1CAVA 3W59A 4HVQA 2DBNA 4IEPA 3UYJA 4EN8B 4HVRA 4B4RA 5J96B 1BMV2 1LOAA 3I7DA 2NN8A 3LDBA 1V6OA 4A2UA 1QJU1 3PIGA 3SEEA 2YGMA 3VDCA 1LHVA 4Y22B 1WMFA 4CEYA 1ULFA 3J26N 4C91A 3TN92 5JOXA 2VMDA 2ZEWA 3MDPA 1GV9A 4S2FA 1BEV1 4TSVA 3E6CC 4K7JA 2VPVA 4DQAA 1A8MA 4YGBA 2HKXA 2H6BA 2W87A 1YFWA 4BOWA 1TQ5A 2B46X 2ZHMA 3C7EA 1MQTC 3N35A 4NIIA 4PJYA 5A3MA 1JYCA 5C4WB 4XW3A 2TBVA 3QLQA 4UFIA 1ZZ8A 5JSPA 3V0BB 2HBTA 3IDBB 4FPGA 1CAWA 3KM5A 2JDPA 2RS31 1LOCA 4IXLA 2XJTA 2BFUL 5A7QA 1URXA 2C26A 2W1UA 1NCRB 2BBAA 3HNBM 1DQ4A 4GMP3 4J6GA 1RITA 4UW5A 3UETA 3WD5A 4Y5TA 4E4SA 1XE7A 4FP2A 3SCGA 4D7TA 4O7XA 5G05L 2Y6JA 3B3QE 3T1LA 3A22A 1HB1A 1MS9A 3KV9A 3VBHA 2ZGOA 1JZ7A 4X6RB 2WNUB 1PIV3 2OW4A 4NRMA 4XFFA 2WZPP 1RUG3 2QFEA 4UOJA 5JVVA 1E57A 1S0FA 3I54A 1IPSA 3BU0A 3T30A 4KBZA 2JDYA 2EXHA 2VY0A 2XMLA 3POGA 1W03A 3ZR6A 1CAVB 2XUMA 2X8KA 3JCIA 3RYPA 3JQXA 4GXLA 1D7PM 5DAWA 5HXMA 4LMFA 4YW3A 4XIOA 4CPBA 1NKGA 1W39A 5DN2A 4IEQA 3PVNA 2LM3A 4CEYB 2FZ2A 1SBDA 1ZVFA 4V2WA 3GZUC 3MIGA 4LKFA 4QGLA 2BUKA 2UYBA 3OJBA 2WBKA 3EQEA 1RUI1 2OYZA 2WFPA 1ND2C 2ZGLA 3DYMA 4HKLA 2PHTA 1FMD3 3VV1A 2V73A 4UI9L 5F6KA 1RUC3 2A6ZA 1CAWB 2E32A 2OQ7A 3FLPA 3GZTB 4RR3B 4LO5B 4FOWA 4MX3A 1UN1A 1UXXX 3LKJA 3RYKA 1WW4A 3WXPA 4UW6A 5JDBA 3VBHB 5DDJ2 4CA9A 4XVHA 3I2HA 3MYXA 3K3NA 1VBD3 2XWJB 1PIV2 1R1ZA 1XYNA 3MFAA 1NXD1 1O7FA 2WSVA 4KMQA 5A7WA 1U5IA 2ARBA 4XDPA 2BGCA 2P6HA 2XJRA 4YW6A 4P5HA 3HNMA 5FZFA 5GLUA 3VBOC 3O1VA 2C6SA 5I93A 3S57A 4XXPA 4AEKA 4AZZA 2W08A 2DU1A 2FBEA 3JQWA 3MIFA 1AHSA 3JD71 4GWMA 4ZU4A 1OF3A 1HQNA 1X50A 3GYDA 4DIQA 2VCBA 4LXLA 2ES3A 4XFGA 2PELA 4Y24A 3ILRA 4OI1A 3AP6A 4EN9B 5G04L 4AI1A 4IUGA 1GFF2 1GANA 4Y1YA 1RC6A 2VMEA 1POV1 4CDQA 5FWJA 3IIAA 1CJPA 3ZYHA 1L7RA 5IK4A 2WWSA 4AHWA 1QJU3 1XYPA 4Q8LA 4LPLA 1LOFA 5T5PA 4HMZA 1TME1 3NV4A 3O1SA 1S0BA 4AI9A 3VB9A 4G4FA 2BOJA 5JXIA 2TNFA 2CWSA 5AVAA 5LK5A 3C7FA 1UU6A 1ND3C 1RGSA 3TYJA 1PGL1 3BALA 5A7WB 4AEMA 4CP0A 1WLDA 3ABZA 3CJIC 4DEVA 4XDOA 2RS33 4N53B 5HCAA 5FY4A 2WAAA 2WRAA 2YBKA 5F8PA 4LO6B 1WW7A 5EV7A 5FBZA 1H2NA 3WQ7A 4UF0A 4CP1A 2VW2A 5BNOB 5CFDC 1BXHA 1RJ8A 2C4XA 3PUAA 1X36A 2FDKA 3OD4A 4JC1A 5J98B 3WDXA 4CZSA 3BKZA 2PHRA 1JTZX 2PHWA 4WM8C 3O0VA 2PAEA 4AL9A 1XSRA 2VBBA 1JZ3A 3UKVA 1JYWA 2ZEYA 2GDFA 1RUH1 2Y38A 4BQ2A 5LY1A 4ZZ8A 3CU7A 4BK4A 1QJX2 3RZGA 2QQNA 2C24A 4Q0QA 1YYNA 1Y4WA 2RDNA 5C3PA 3ON7A 5C9AB 1IS6A 3ETPA 3HVDA 3I59B 2QQVA 2ORZA 1QF3A 2BNNA 4YVWB 1G9CA 2YBPA 4NJ4A 2QE3A 1JH5A 4CEWB 1W0OA 1OLQA 1I1EA 1PK6C 4D69A 3ILFA 5FP8A 3KB5A 5A7PA 3HOBA 3J7HA 1YC61 4M0HA 5FO8B 5JZGC 3VKNA 5IVJA 3ZFFB 2P3KA 1OVPA 1RUI3 5L9RA 3CIHA 3A21A 4COUA 3KV4A 5FYCA 4ASLA 3VHOA 2Y64A 3KV6A 3AXDA 4LA2A 2W52A 2QNKA 2QQPA 1SLBA 3H50A 3PURA 1VBA1 5A3NA 1OKQA 2ADEA 1GNZA 4CCKA 4GWIA 1WLTA 4UF0B 5JAXA 4C0BA 1OUXA 1OI6A 3I2OA 2O1QA 4UW3A 3ACHA 2G9ZA 2I74A 2QQKA 5BUVA 2Z79A 2NM1A 3T0BA 1QOSA 3U4XA 3Q8EA 2JKXA 1ULOA 3POBA 1JYTA 2D44A 2CU5A 4CPBD 5A70A 2XJVA 1JZ5A 5BV6A 2HWF2 1PZ8A 1ZZCA 3RRDA 1W9YA 1NYWA 4H55A 2VMFA 3M2MA 5J37A 4FSJA 2YU2A 5F7UA 4FP3A 3AVRA 3HEIA 4QU2A 3HR9A 5EP9A 2ZGRA 4I09A 3NAPB 4JX0A 2VOVA 4QXHA 5F32A 1S2BA 5IW0A 3KQRA 2YPJA 1F4AA 3LWCA 1GQGA 3VGIA 1O6UA 2W3JA 2FHRA 1AYN1 3U78A 5FY0A 1RTVA 3T2QA 1RVF2 3E6DA 2EIEA 1H2MA 5J36A 1XBFA 4BH9A 3FLRA 1WBLA 2N7GA 1KFUL 4CE8A 5LK7B 4OI2A 1OURA 2QQUA 2RDSA 1SFNA 2XLFA 1OOPC 1OA2A 5ABJC 4XF9A 1VBE2 3M4FA 4XMIA 2A6XA 2FDHA 1UIKA 1V6NA 2XG3A 1E5RA 1TME3 1WCDJ 1H4HA 3Q8CA 3ZFEC 4LA3A 5DAXA 4C1WA 3SITA 2W92A 1O4TA 4YWAA 5EFUA 4MGSA 4YVSC 4F83A 2OT7A 1V6JA 1W2AX 3LB9A 1ZZ7A 2JWPA 1C8M3 1HJGA 2V72A 2R062 4GALA 5BNPA 2NYYA 4XJ9A 4TN7A 1MZEA 3NJXA 3ZVXA 5FZ6A 1W3XA 1GBGA 2QJVA 3BTZA 3ZO0B 1PGW1 1YQ5A 2F4LA 3IMMA 4EZ4A 4R9AA 1ENSA 3DYOA 4DRVA 2RJKA 1FNZA 2VOXA 1UYXA 4XBLA 3PTYA 5T5LA 2JIJA 1RUH3 4UBGA 1MQTB 1OSGA 1CPNA 3WP3A 1RHI2 1H0BA 2SLIA 3CZJA 4OMDA 3WCSA 5C8WA 2ARXA 3GHMA 2HWC1 1NCQA 4BQ1A 5FR3A 1C1LA 2VD7A 3VD3A 3GDBA 2XVGA 3LFMA 3PUQA 4IQPA 3LDRA 4LULA 4COWA 5B4NA 1JODA 1TZOA 3H8RA 3HN1A 1K42A 4XUPA 3X29B 1O5LA 5FYYA 1DQ1A 1CVNA 4B3NA 3GHNA 1JHNA 5DG2A 5FZEA 1LOGA 3D0JA 4YM2A 1COV2 4Q4V2 5DXDA 4AVSA 2NLRA 2HJIA 3AKSA 1QNYA 3T4VA 3OD0A 5IVEA 5LZ6A 1C8M2 3OBZA 2XBO1 1EUTA 4IEWA 3NV2A 4K6BA 5EJZB 1VBA3 4PIZA 5FRAA 3D3AA 4ZXKA 1AX0A 4CYDA 1Q43A 5LBBA 1PNFA 3O1MA 1R64A 2XL9A 4E9KA 5IJRA 3OBRA 3USUB 2Q8CA 5I0SA 2DTYA 3MEPA 1RUD2 5KXDA 4Y20A 3RZZA 5DUVA 4U2AA 5B2GB 2EALA 1A8DA 5D2AA 1G9FA 2H0BA 1SMVA 3OGJA 4Q4Y1 2OA2A 2BJSA 1GOFA 4W6WA 3SQOA 1QIQA 3WUCA 3T09A 4BCUA 4QKDA 5A1LA 2P1BA 4E4HA 1NCQB 2AUYA 2Y8KA 3MFCA 4QPGC 4XFAA 1J58A 1RJ7A 1VRH2 4FTEA 2LUWA 4MLOA 2IVJA 2R071 4M3CF 4OI4A 3SMHA 3LOBA 2O0OA 3BPZA 1SQ4A 1VBC3 2GZWA 4G9SB 4XYXA 4EZHA 1JUIA 4RHV1 5CISA 5F3GA 2WO7A 3KF3A 1AYN3 2DVGA 1D0GA 4COVA 1UWWA 2RS13 3KV5A 4GA9A 4OUEA 4PBPA 2ZX3A 4NIAA 5FO9B 4ZHNA 1UO9A 3B9IA 1PO21 2PAMA 3WG3A 1N1VA 1R083 1S0EA 3SH4A 4A7YA 1IS5A 1LOBA 3N7MA 1PZ7A 2B9UA 2IXLA 2VMCA 1NY72 1OH3A 2BYVE 3HAGA 4Q27A 3K48A 3WDVA 1W8UA 4UW4A 2W2IA 4DXTA 2QZ2A 4JGZA 2OQ6A 1GZWA 1O5UA 3L2YA 2E31A 1RXGA 2LW8A 3QD6A 4QDQA 5CEHA 1YO8A 5FZ0A 5EJ1B 1W04A 3OG2A 1NXMA 2GNDA 4FPEA 3AMNA 1RUE1 2XOMA 3CNAA 4K1YA 3ACLA 1REFA 1F15A 1XU2A 5J3UA 5CVRA 3H8OA 1XNTA 5HBAA 4EWAA 2VQTA 4Y1UA 3UV9A 4MOAA 5FPVA 4P9WA 4AI0A 2YXSA 5LA0A 3LZZA 2ATFA 2VW1A 2D40A 1VBC2 3CL1A 3EHKA 3NNFA 4HANA 2BZDA 2CAUA 5FWEA 1QH6A 3ZFGA 3V0AB 1HKDA 1SCSA 1AR81 3IIIA 3TRSB 5C5UA 3VD4A 1M06G 2J1SA 5FFOC 4ISRA 1OD5A 2RS12 1RMU1 1ND3B 2BOIA 3LA2A 1ACCA 1XU1A 1DP0A 3VBHC 2HH9A 1QDOA 3CJIB 3HT2A 4J1XA 1IG0A 1DIWA 1R082 3ROUA 3KCXA 1CGPA 2HWD3 1AR93 2ZGPA 3IT8A 5HV4A 1CAUA 3U0ZA 3HN3A 4IE0A 4AF9A 5K8SA 1W6NA 2D3RA 1EAH2 1ODNA 3OUHA 4JTNA 5KHHA 4XIKA 2PLV1 1J84A 2WWUA 4WM8B 5FBJA 3S30A 3SCHA 1DQ0A 2AENA 1GZWB 2ZGSA 4META 4CUAA 3GJBA 2D6MA 4FCAA 4N90A 1J1LA 1AYM1 1DGRA 3O14A 2HBUA 4D94A 1AR62 1OLME 1GQPA 1RUF2 1BQPA 1HN1A 4RN5A 1Q56A 2BNMA 3I2DA 2XBO3 3BOWA 2EAKA 3PUIA 1XXNA 5IVBA 4FFGA 3SNMA 1CESA 1W2TA 2GC0A 1DQ2A 1LEMA 5LWBA 4N7UA 1AL0G 4FT8A 2QVSB 1PX4A 3WP4A 1REEA 2X5IA 4BWOA 1DF0A 4LLFA 5FZ4A 4YM3A 3GZAA 3I2FA 1DU3D 1ZX5A 5JZGB 4I3PA 4LUMA 4ASKA 2JX9A 2ILMA 5GZCA 3UJQA 2BU9A 4Q8KA 4GB31 3FE5A 4P9LA 1O4YA 4PLOA 3WG1A 4DY3A 2Z69A 3HPNA 4HK9A 5EWSA 2RMU1 1MS1A 4XHXA 4FAGA 3HMYA 3V56A 1UF2C 2HWB3 4K8RB 2E63A 3B94A 2RS53 5GJ6A 5A33A 1AR92 5DUWA 3OCPA 4BM8A 3NRUA 4KQ7A 3LCPA 2ZZJA 1HDKA 5KBFA 4PLNA 4JKMA 5DUUA 1US3A 1GYKA 1W6NB 1WCUA 3CLPA 1AXZA 3KT7A 4GULA 4MGQA 4NN0A 2VCAA 4CCJA 1P8JA 1W3VA 3KLSA 4EV0A 3NJZA 1AL23 5HCHA 5L7OA 4QT6A 3MUZ1 3M8LA 1H1MA 2VJXA 3IBMA 4K9SA 5JMCA 3O7OA 1BBT1 2J1TA 1H1AA 3V65A 1JU4A 4JTOA 4C1XA 4CXWA 1WMXA 4XJUA 4BU2A 4LBMA 3KMHA 3POJA 2WZEA 3KS7A 3KSCA 4HBNA 2VQAA 4JHTA 4NHKA 3TEXA 3WSOA 5LEJA 1DDLA 3R4DB 4XUOA 1YJLA 1DZTA 4CDQC 1RUOA 1V9U1 4C0HA 2WS93 2J1UA 2WLQA 3QCWA 4A6SA 2WZR2 4I0WB 4CCOA 1IGOA 1Z7S2 2Y6GA 1LECA 5JXHA 4B29A 1XC6A 4B1MA 2Y6LA 1LOFC 3EBRA 5A80A 3FMGA 2OZJA 4LK7A 4XJZA 5I0UA 3RZHA 4JDMA 3KHCA 4HKOA 2GN3A 4GWJA 2W1WA 2HWB2 1W6MB 4XUQA 4JVAA 5DAVA 2RS52 3SKVA 4J1WA 2Y33A 5A33B 1OHFA 5ABJB 1UZYA 5LBEA 3IAQA 5IYYA 5C6CA 2DVAA 3I3BA 5AVPA 3ZPYA 4MXWA 1QDCA 3ZFEB 4CP9A 1ZM1A 1JUHA 4OUSA 5T3NA 3VBRA 3WNLA 5CG8A 2NMNA 2V4AA 4R52A 1B09A 4FOYA 2WNVA 1ZA7A 1RMU3 3THCA 4GJYA 4YVSB 5LB6A 4BISA 1AL22 1K12A 1R1A3 3OUIA 2SBAA 4QX3A 1W99A 3OGSA 2GC1A 3DGTA 5F37A 4A6OA 1DCSA 2EXIA 3RQ0A 5I8SA 5JCTA 4ORFA 1LGCA 4BQYA 4AVAA 1YIFA 3D82A 4PQ9A 4D6RA 4YZ3A 5LRRA 1EPWA 1IQDC 1TEIA 1GU3A 2PLV3 3URFA 1S2KA 3ZXLA 5FQ0A 1OQDA 1C5IA 1YFXA 2WS92 3AL5A 3WF3A 1KQRA 2G19A 4RGKA 3TEZA 3VD7A 1W8ZA 2VUJA 4TYSA 5FDBA 4AQTA 1WD4A 2NP0A 2RM23 4NROA 3ZN5A 1UU5A 1C1FA 2P2KA 3KVAA 3AYEA 4V1PA 3VLBB 1YEWA 2QKDA 2EICA 1RUJ2 2WIIB 1W8OA 5GZDA 1ENQA 2YC4A 2ZKNA 3WLUA 3WP6A 5C3OA 1DQ5A 3LPGA 4W65A 4RA0A 1JOBA 1CJDA 2FDFA 1CX1A 4DZGA 2Y6HA 4RYDA 2ZABA 3BIWE 3SLIA 1MS5A 4MXWB 3HQUA 4CP9B 1GP6A 2JICA 2Z4FA 4PIXA 4M3CA 4D8MA 2D6PA 1W6OB 3HQRA 3N9MA 4LBLA 3WQ1A 1LHWA 1BCXA 2Z2SB 3UGFA 1LENA 3KT4A 1WD3A 4RGAA 2WLPA 5T50A 3UGGA 4GB33 4EQVA 4F7ZA 4BZ4A 2VH9A 1R1A2 3EYPA 3JB4C 4TLGA 3ZMOA 2RMU3 4JDOA 2ZAAA 2CHHA 5FYZA 2W39A 2GMEA 1KITA 5DMYA 3WG2A 1SFYA 4YW4A 4XAEA 2GNBA 3S7EA 5BNNC 5FMCA 2B4KA 4A3XA
chains in the Genus database with same CATH topology
2Y0IA 1ZBA2 1D4VB 5IK8A 2A71A 2WA3A 2E7AA 3AFKA 2DCJA 2CGPA 1V00A 1IKQA 5FQ0B 4MVTA 1WMEA 5FPZA 1QJZA 5ACA1 3ZSJA 4OI0A 3IPVA 3WX5A 2ETEA 4QQ2A 4WVMB 4BA6A 4GIQA 5BY5A 1S0DA 5IK5A 2Q1ZB 2RM22 4AK3A 2I45A 3SXWA 2G9GA 2YDEA 1ALYA 4QPGB 1FAYA 5J09A 1D0HA 4LO7A 2Q8OA 1JBCA 2ZX2A 1NLSA 2GN7A 3N7LA 1MEC2 1QJX1 2ZX1A 2CYFA 5CB7A 1U0AA 1V9U3 3ES4A 2NZ9A 3R4UA 2C1FA 2EF6A 1QJY1 3VZLA 3VBSA 1OQEA 2IWGB 1PHMA 3AYAA 4LHLA 2MEV2 1HRV1 1FOD2 4HSJA 5GZFA 5EJ3A 2QUOA 4MGYE 1OPOA 1HX6A 5T54A 3CO2A 2B8MA 1ZZ9A 4IEYA 2BPA2 4L97A 4HPKB 2OUHA 5T52A 1F2NA 4XFIA 1YLLA 4PBOA 4ASMB 5BNPC 2BQPA 3RYRA 5AFEA 2Q5TA 3J8F1 3KGLA 1QKQA 3O5SA 5CBLA 3LAGA 1AUYA 4L99A 1O3QA 2E7QA 5I0TA 3ZN4A 3LGRA 4BMBA 5JOWA 4XE9A 4AQ2A 1UW8A 1ZZBA 2V5YA 3IPVB 3ST7A 3ZXFA 3WG4A 3WINE 1IS3A 4P9JA 4QMAA 3T1MA 3W58A 4BMEA 2I07B 2OVUA 2XHKA 4QGNA 1QQP1 1REDA 3WHTA 3RG0A 1VBB1 1VALA 2A3WA 3QOPA 3M7AA 1DYPA 5I8YA 2HWE1 4LE4A 1NCQC 4FPHA 4IV3A 3AMHA 1H9WA 3ECQA 4EN6B 1PVC1 2VNRA 1N3OA 5FCCA 2B39A 2DCTA 1ULEA 4IEVA 2ZPXA 1EV11 1AR71 2DUOA 2WT0A 4E27A 2OIIA 2TUNA 4K8FA 1VJ2A 3RI8A 4DINB 4DRRA 1RUG2 1NOVA 1TNRA 3AZWA 4BLJA 2K0GA 2CGNA 4MGIE 3E97A 1ASJ1 5LEKA 5JI7A 3IKWA 2Y0OA 4MGZE 4QQHA 3THTA 1SLTA 4Q4W3 4XFCA 4N9IA 4I0BA 5KHJA 2VVFA 4LBKA 3A0KA 2PAKA 4A7ZA 3FBYA 4QPIA 2DCZA 1Q8OA 5DUXA 5JPNB 2RR13 2VU9A 2MHFA 2KXLA 1FMD2 1ULDA 3S7IA 1RUC2 1GQHA 4YRDA 3PLQA 1CN1A 1OLRA 1QMJA 4W6YA 4AI2A 3VUOA 3ASIA 5ACA3 4DB5A 3FJSA 3E5XA 1U5XA 5GLTA 4M3CE 3N7KA 4FAHA 1MR5A 4XJWA 3HQXA 1BEV3 4RSUA 4XZPA 1SDWA 5FOBB 4XF0A 2CGOA 4FQ4A 1VBD2 4H7MA 2R0HA 4XILA 3AZZA 4HETA 1Y43B 2PFWA 4NHLA 2A3YA 1EY2A 1C28A 4R4ZA 4S2HA 1QWRA 3TOJA 4WVZA 1QJY3 2TEPA 3H1MA 1V70A 2WQ4A 4JRAA 1N47A 3ZSEA 4Y1XA 1Z0HA 1HRV3 4Q4W2 1FV2A 2ZHLA 2GC3A 2R041 4JGZC 4RFT0 5A32A 4KG8A 4HK8A 4NR1A 2E53A 3BODA 1SLAA 4XETA 2R32A 1RB8G 3P3PA 3M3EA 4CDXA 3TB0A 2ZHKA 2NPIA 4FO9A 2RR12 3J8F3 3NKGA 4FXGB 5GKAC 3GBFA 4FPJA 2JKBA 4CDQB 3WZ1A 1N3PA 2KM2A 4Z82A 2PHDA 2IXKA 1U5ZA 4UBHA 3FZ3A 1QJU2 5JWPA 3E5UA 4R9CA 3ZFGC 4H14A 1NA1C 3QH7A 1BEV2 3ZXEA 3KT1A 1SBFA 1QGLA 2EXKA 4QQLA 1ZRRA 3SH3A 4AI3A 3BCWA 1I9RA 1QQP3 4OFGA 4GMP0 1VBB3 2P17A 3UL2A 4IL7A 4OUMA 4LTAA 2WINB 1VAMA 4DFSA 5IUQA 5T55A 1ZBE1 1VRH1 2RS32 3A4UA 4K40A 3VZJA 1QH7A 4YFZA 1V6KA 3UJOA 4XMAA 1YI9A 2BEOA 2WQZC 4AVVA 4JAAA 4AEDA 1AR73 2VOKA 2W0XA 5KWRA 1YUDA 4AG4A 3ZDSA 1HQWA 2ENRA 2GSYA 4OHXA 1BYHA 4XQDA 3SHRA 5BNNA 2DURA 4OZXA 1SLCA 1H9PA 2YV8A 2BVBA 3AZXA 4LBQA 2GMPA 1ASJ3 1TMF1 2VECA 4FBFA 3ZXJA 1H1IA 2A73B 2BW8A 2BFUS 1HXS1 4F3JA 2Q30A 3JD73 2X5IC 2A6WA 3AK0A 1J1TA 1FATA 2JD4A 1IKPA 1RUNA 3ZYIB 4AGGA 5AC91 2A6YA 2ZZQA 4Z8BA 3M3CA 1RUI2 2JE9A 4AI8A 3FLTA 4RL7A 4I2OA 4Z2WA 2AH2A 3OBTA 1POV3 1QHDA 4XBQA 3ZMNA 3DKWA 2A7AA 1SBEA 4PDWC 3AP9A 4NO4A 3HIFA 2E6VA 3TNPB 1H8TA 3MGUA 5BNNB 5FPXA 3ALQA 5L7OC 1G7YA 4JQRA 3AZYA 4XEZA 4LBQB 1LU2A 2IC1A 3LA3A 4OHZA 5J7MA 5C8CC 1H30A 4YW1A 4N7IA 1R091 3MI8A 2ZX4A 1FPN1 3AJZA 4BIOA 1WCKA 2R043 2UYAA 3VBFC 4WZCA 4AVBA 1GR3A 3U07A 3RI9A 4WM7A 3VKOA 2D3SA 4IV1A 5HI0A 2D7FA 3WUDA 4QD2A 4KH9A 4FTSA 5KC6A 5K9YA 3TBDA 3IDEA 4XJ8A 4C90A 5GZEA 1MS0A 2ZHNA 2WL1A 1TME2 1ZNPA 3DUIA 3NV1A 4CDUC 1H8VA 3VBRC 3FX3A 2XWBB 4QM8A 2WNVC 4CTEA 4QPYA 5CFCC 3QH6A 4LEJA 3MW4A 1PGL2 4QGMA 2AREA 1PO11 3M3IA 5BNPB 4YM0A 3N36A 3WW1A 2P3IA 3POYA 5JIUA 5EYYA 1CR7A 3AP5A 3P3NA 1YRZA 3WW4A 4AGVA 4Z1VA 3T2TA 2R49A 2EIGA 1NZCA 4JV4A 1RUH2 3HD8B 4WM7B 3RMYA 5CA6A 4Y1VA 1XRUA 2P3JA 2D97A 4MZUA 2JEMA 3PHMA 4E2GA 1UIJA 1TMF3 1CX4A 3POSA 5BNQA 1UAIA 3MPBA 1DYKA 4KWLA 4OLLA 4Z92B 5JSRA 1CAXA 4K1ZA 1Z78A 4ZKTB 2A6VA 1HXS3 4YW2A 3MLKA 5GLVA 4HLTA 2P37A 2XB6C 1X8EA 2WC2A 5KXCA 1OFSA 4LBNA 2A75A 2DWRA 3VHRA 1AXKA 2WFF1 2XVLA 2D93A 4XF1A 3BOPA 1T6GC 3B01A 2DUQA 4K20A 1D4M1 3AP4A 1OPMA 1S0GA 5GLZA 4AW7A 1LKNA 4AHXA 1VBA2 4KG0A 1MZ5A 3B7MA 2VVDA 3ILNA 3WV6A 4Z07A 2HEWF 4LBQD 3RSJA 3VDDA 1XNBA 3JBG1 3UKNA 3VHNA 3NL1A 3MIHA 4URTA 2GAUA 3ZIXA 5F5QA 4FQZA 4Y20B 4MGKE 3NVCA 2O8QA 1GICA 1AJKA 5F6LB 4CDWA 1RL3A 1ONAA 4N43A 1B35A 1D2SA 5J48A 1V6LA 3GNEA 5K7PA 1R093 3ZN6A 1LCLA 1CAXB 3SH5A 5CU1A 4GH4A 1OMIA 1I6XA 2WT1A 1H2LA 3AJYA 1HRI1 1O4ZA 3IDCB 1NA1A 3MZHA 1Q8VA 2DVFA 4AFAA 3VBSC 1AYN2 2C0ZA 5T5JA 1F9KA 2R30A 3VBUC 1IOAA 3H3UA 3H9AA 4H3WA 3VZKA 1KJLA 2HWC3 3TAYA 4LO4B 3M3QA 3U11A 1MZ6A 2IFWA 4Q4X1 4KL1A 4RGGA 2EAAA 1JW6A 4AXOA 4FTBA 2PYTA 2WNEA 4ATFA 3ZXAC 1KDMA 4JGZB 1C8NA 1ZZ6A 5C33A 1KFXL 3L9JT 3OPZA 1C3HA 1GLHA 4L92A 4CDWB 1HW5A 3LA7A 2BTVC 1PO13 4N43B 5KC5A 1IQAA 4Q0VA 2ZMLA 4XHBA 2DYCA 5D1IA 1PGW2 4Q0UA 2DFBA 4NHMA 4IV3C 3ZFGB 1BMV1 1NA1B 3N3HA 3VKFC 4YGCA 2UWBA 2OZ6A 3WCRA 4LHNA 4Q4Y3 3TN91 1DZQA 4XFHA 3DV8A 4LO8A 3DPRC 1ZRCA 3H8UA 2BWAA 1XNKA 4R9BA 2HWC2 2YUEA 2ZGNA 5DZFA 2AYHA 1G9DA 2HWD2 2YHJA 4X8NA 1CAUB 2YMZA 4HN0A 2D6LX 2R073 4PDWA 2D5FA 4RHV3 3N7JA 3ZXGA 4ITCA 2WFF3 2XJUA 3D5OA 3PVEA 4K21A 3VN4A 2E9QA 4COYA 2ZOEB 3NV3A 1FOD1 1EPZA 1JN2P 1PO23 3ZYRA 2GH2A 4BIFA 2B42B 3FFQA 2R0FA 1NE4A 1D4M3 1Q8QA 2XBO2 3IM0A 4RS5A 2D43A 5C8CA 2JJ6A 1LULA 4QPIC 2B7YA 1EYBA 3JBG3 2DVDA 3VL8A 4ES9A 4FXKB 2PHXA 1N1SA 1G6NA 2X5IB 1N3QA 4PCRA 5IT6A 5E1RA 2CY6A 3M70A 2Q0AA 1AVBA 1WLCA 3VBFA 1G8WA 2R16A 2XKOA 3GF6A 2D6NA 3D6EA 1UL9A 4Q4Y2 4WVWA 1F8VA 2YC0A 4LLOA 4ES8A 1RUE3 3ME2A 1MACA 1VP6A 3B5LB 2C9AA 3A0NA 3AFGA 2DCKA 3PMSA 4XDQA 1S0IA 4AQ6A 2A5ZA 3RNSA 3ZXKA 3AMPA 4PDWB 2R072 3PVOA 4LBOA 3AMQA 5CG9A 1HRI3 4RHV2 4YZ5A 2D6KA 4BYYA 1AR83 4CDUA 5GLWA 4M00A 4GMP1 3MIBA 1LHNA 3LOIA 5CFCA 3MLLA 5L7OB 1PVXA 1PO22 5DDJ1 5E89A 4G3YC 1LGNA 4GKXA 1PIV1 5KHKA 4Q4X3 5C8CB 4KU7A 5FLJA 3WP5A 4RQPA 4CDXC 1BJQA 2YY1A 1S55A 3WDWA 1UX6A 3E5QA 1SEFA 2GC2A 4B7KA 2VUAA 3I4IA 3VBFB 1AYM3 3NW4A 2VVEA 1D2QA 5F9TA 1LEDA 4AEJA 4EN0A 1Y9QA 1AJOA 3PVBB 1XYOA 1AX2A 4JGYC 4WZFA 1DZRA 2NQYA 3U10A 1ENXA 2JG9A 4CDUB 1AR82 3EJKA 2R1DA 3VBRB 2IZWA 3H0OA 3VKMA 1QU0A 5FO7B 2B5HA 4Y22A 2WNVB 3TN93 3J4UH 4XOGA 1RMU2 4AEDC 5CFCB 3O12A 1DG6A 2ZGMA 3H1WA 1LB2A 2OUJA 5JIAA 1W2UA 1SLLA 4YFWA 4DS0A 2H0VA 4JCKA 2W68A 4OHWA 2ZA9A 2PQQA 1W6PA 1NCRA 2ZJCA 2PLV2 4IETA 1YIPA 1VB2A 1AF9A 3WDYA 1AYM2 3G7DA 2JECA 2YGLA 1Q5OA 1QOTA 2VNOA 1M4WA 1BBT3 2WNUA 3AX4A 3CF6E 2Q1MA 5GZGA 1U12A 4AHYA 4EN7B 2ZS6B 3H1YA 4COZA 5F1RA 3B9CA 4YGDA 4TWTA 4MV2A 4WBBA 4YG6A 1K5MA 4XTMA 2JG9B 2PTMA 1YNAA 2E51A 3FWEA 4HVOA 3R4SA 4ONUA 1UU4A 4M3CB 1PM7A 3LSDA 5JR7B 3VBUA 2F4PA 4GB32 4YG3A 1XNDA 4YNIA 2RMU2 1I5ZA 1H8TC 2C5DA 1ZA4A 1C57A 3HT1A 3NSTA 5KHIA 3AZVA 2K9ZA 3RWNA 1W6PB 3RJ2X 5BXXA 4HSLA 4RR3A 3S0MA 1S1AA 4Q2FA 4AFCA 4B7EA 3ELNA 4I0AA 5DDJ3 2VQ0A 1BBT2 3THPA 1A78A 2GNMA 2HWF1 2PHUA 4CRQA 4WM7C 1G9AA 3PNAA 1NE6A 4FPYA 3AB0A 4IV1C 4YW5A 5L19A 2O8OA 3KD4A 2VMGA 1I3HA 1K5MB 4AFBA 3ZYJB 1V9U2 2WJSA 3H7JA 3MF9A 1DHKB 2D98A 2R1BA 4AYUA 3AP7A 3VBSB 5CADA 1NG0A 1QXJA 3VBUB 3OYWA 4QXKA 3DPRA 1QXRA 4P14A 1RVF1 1SLIA 1RINA 1FV3A 1OQ1A 1APNA 5JSOA 5H9PA 4E4ZA 4XFBA 2VW0A 1VBE1 3MPPG 3R6SA 4YZ2A 1LOEA 5H9RA 3BU7A 4I02A 1UD1A 3VZNA 3APBA 3EXUA 1J3QA 2CL2A 4H7LA 5IK7A 1S0CA 5GALA 4BE3A 2X53S 4CP2A 1LHOA 4D7YA 1A6CA 1DGLA 2R061 2X29A 2IXCA 3CEWA 1CIWA 4N53A 4XQ4A 4XQWA 3MLJA 4IV3B 4LNVA 5BNOA 5JPMB 2AGSA 1WLWA 1J3RA 1UKRA 4PIYA 1LTEA 3OYWB 4XJAA 3DPRB 1CQ9A 4L8QA 2ET7A 1AXYA 4ZU5A 3ZXDA 1RHI1 1QJX3 1OFNA 2YROA 3IN9A 2BBVA 3KGZA 3JZVA 1OA3A 4MH0E 4M01A 4I3GA 5C9AA 3I59A 5DG1A 4YVWA 2ZKLA 1DBNA 3D4KA 4IEUA 3WOGA 3AM2A 1O3SA 3JB8A 1OA4A 4CEWA 4IEOA 3VDDC 1BK1A 5GM0A 1COV1 2AZ5A 4Q4V1 4Q1PA 3OF1A 3ZFFA 1X7NA 2NMOA 3UK9A 2D3PA 4QPIB 4CDWC 3KCYA 3CJXA 1C8M1 4N43C 1B35C 4NPRA 3RDIA 2DU0A 4E2QA 3Q9OA 4AWDA 2V09A 2B45X 5FTTC 2MNGA 4FPFA 4HKWA 4GH4C 1UPSA 3KCCA 3LSEA 1X82A 3B69A 4IERA 5ACA2 1YJKA 1JXNA 2LTNA 1Y3TA 1NQDA 1RUD1 1F5FA 1FT9A 2UURA 4JGYA 2HWF3 2XJPA 2YYOA 2WT2A 4XF4A 2HEVF 1HIXA 1H2KA 3RMXA 3N4MA 2HWE3 3DL3A 4BLIA 1DQ6A 1XNCA 4EJRA 5T5OA 5K0UC 4FPOB 1PVC3 4KNCA 4OHYA 1FNYA 1BVVA 2ZGUA 1QJY2 4QHBA 3NAPA 5AFBA 1EV13 2MPFA 1HRV2 2Z42A 5EZWA 1KRIA 3K51A 4DXZA 1N1TA 1RVF3 2GU9A 5A32B 4R8HA 3B02A 3FC0A 2IXHA 4YM1A 4CDXB 4XBNA 2QZ3A 3D8CA 2QCSB 2DV9A 3J8F2 1NY71 4PF5A 4D3WA 3GBGA 4AFDA 1VBE3 1J59A 3SCFA 4P9YA 1VLNA 2AR6A 4Q26A 2JG8A 4L2NA 1BVP1 4PLMA 4QM9A 1O3RA 3ZSLA 1YCIA 3PJQA 5H9SA 2DCYA 5JI9A 4QQOA 1QQP2 4JGYB 2HEYF 1VBB2 2R063 4KWKA 2HWE2 5E8AA 1GKBA 1UZZA 2ERFA 2ZX0A 4F8AA 5KHGA 5HCBA 1PVC2 1VAKA 4O9EA 2UWCA 1H4GA 1BZWA 1VBC1 3B00A 4AEDB 1EV12 1AR72 1X33A 1YFUA 3VL9A 2G9FA 1IPKA 3O0WA 3OY8A 1WW5A 1DFQA 1L3JA 2RS11 1MQTA 1JOJA 4FPCA 3ATGA 1MZFA 1RHI3 3NO8A 5FMOL 4WV8A 5A3LA 4KGGA 1R081 2VMIA 2CV6A 1ASJ2 4RS5C 2ZACA 3VHPA 4HFSA 2VXRA 4LUKA 3ENRA 3VZOA 1COV3 1EAH1 1HLCA 1FYUA 2JG8B 3JD72 4Q4V3 4HT1T 5L73A 1ULCA 1GZ9A 5FLIA 4JRLA 2DTWA 3D0SA 1AR61 4QX5A 3MIDA 5SV5A 4EWEA 1UKGA 4B4PA 3WR0A 1RUF1 4AGRA 1V6IA 2XLGA 4MSVA 1YFYA 4X6QB 4OHVA 1YWKA 4M0NA 1ZRFA 4Q29A 3RPQA 4NWVA 2BNOA 2JENA 3USUA 3PMEA 4ZU7A 4JDNA 2XGXA 1LGBA 4NWWA 4Y26A 2UY9A 1RUD3 2WA4A 2ZAHA 2VG9A 3OY8B 4YG0A 1H8TB 3HBZA 4FOVA 3KZ4C 2ZGQA 2VULA 1ND2A 5LRSA 4Y1ZA 5FREA 1ZYBA 1RIRA 4DPNA 5JOYA 2CWMA 1DGWA 1VRH3 1ZBE3 2XVKA 4S2DA 1Q8PA 3ZYGA 1WW6A 1QOOA 2HWD1 1AR91 2ZMKA 3NWKA 3VZMA 2F6BA 3IWZA 5I0RA 4RQPC 1LRHA 4S2GA 1MS3A 3JUUA 4HL0A 3I8TA 3FBMA 1MS8A 1CPMA 3TNQA 3V64A 2R042 2DFCA 4RD7A 5DZGA 5CAZA 1O3TA 5I8TA 1UMZA 1DLLA 1A3KA 2DF7A 4IV1B 3BB6A 1DGRN 2P34A 3VBOA 3AKTA 5D8AC 3ZYPA 3IMNA 4E4DX 3L2HA 4INDA 4XXAA 1LJ7A 2XH6A 4WVVA 3JU9A 3G6JB 2JE7A 1VR3A 3E6BA 2JG9C 1WMDA 1X8MA 3H3ZA 2WZR1 3BTAA 1Z7S1 5AC93 2RJLA 1C4RA 4NVPA 2CTVA 4TLFA 3MIEA 3FUQA 4AVTA 3C3VA 1ND2B 4P9GA 1IPJA 1WGPA 3ES1A 4LT5A 2HWB1 4YSFA 2G4IA 1ZBE2 2RS51 4HN1A 1VIWB 5C4WC 1GNHA 1JYIA 5HXVA 4P9IA 3V0AA 1F31A 1XE8A 1Q8SA 2XL7A 3GALA 3M1HA 4I01A 5SV8A 2A3XA 1NCRC 3QACA 3WT3A 2ZTNA 2D5HA 2ZMNA 1LESA 4ISQA 1ND3A 1AL21 4IEZA 3M3OA 4E2SA 2IXIA 3CJIA 4KWJA 5BPXA 2GH8A 2WNUC 1TMF2 1FX5A 1SACA 2QDNA 3MICA 1YXWA 3VBOB 4YGEA 3FFZA 1FPN3 3C2UA 5CIRA 5CFDA 1PNGA 1UCXA 1WBFA 1EAH3 1HXS2 1KS5A 2DVBA 2JXAA 1IZ3A 4WM8A 5FAXA 1K5MC 1POV0 2WS91 3AXEA 3AYCA 5EXOA 2HYKA 4X8PA 1AR63 3FUOA 5AC92 3POWA 1QXPA 1EP0A 1VB4A 3MW2A 4B8EA 4EWDA 5KXEA 1RUF3 4MUVA 4CEYC 4YZ1A 4KBBA 1YI7A 4DNYA 5BYNA 1HV1A 1ULGA 5CNAA 1RUJ1 1AZDA 5K0UA 3NKTA 3QBQA 2ZCWA 4R9DA 3SISA 4DY5A 3VDDB 5FOJB 1PK6A 5JZGA 4HZFA 4Y4YA 4RR3C 2PHFA 1ENRA 2YZ4A 1J3PA 2FMYA 4NOTA 2UY8A 1LR5A 1R1A1 3AKPA 1B35B 2KA3A 1YHFA 3WDTA 4P9XA 4IEXA 3ZN6B 1ZBA1 1NLRA 1R092 1FPN2 2WKKA 2EVXA 4GH4B 4LR4A 2Q4SA 2A70A 5CFDB 4QQPA 1V6MA 4Y5Z0 1O91A 3OGGA 2JDZA 2ZBJA 4YARA 5TSWA 4W6XA 1KDKA 4XPVA 2VOWA 4BPZA 1KD7A 3DN7A 4AHZA 4A7KA 5FLHA 4FPKA 2RM21 3S6PA 3WY6A 2E7TA 1PGSA 4DMIA 3AKQA 2XJSA 5FMOS 4Q0SA 1HQLA 2DUPA 4AE2A 5K0UB 1MEC1 1WUVA 3AKRA 1AX1A 5JLVA 3R0RA 1TE1B 1IS4A 1Q3EA 1PK6B 2WZR3 1Z7S3 4DOUA 4KU8A 2UU8A 4KGQA 1W6QA 3TWIA 1PMIA 2MEV1 1FXZA 2CNAA 1C5HA 3B93A 4SLIA 1BKZA 4IESA 4K3UA 1PO12 3RJRA 1W0PA 3USSA 1W6MA 2ZGKA 1OOPA 2VGDA 4L11A 3HWJA 5ABJA 5L36A 5EYXA 1CONA 1U5YA 2D6OX 1TNFA 2ET1A 4N53C 2WSUA 3WHUA 1CD3G 3ZFEA 3ETQA 2OPKA 2XJQA 4U36A 2I2SA 5E16A 1MS4A 2IXJA 3ZSMA 5BNOC 4TZDA 4UXAA 4BHPA 1UPIA 3AYDA 4YYOA 4YVSA 2VNGA 4XTPA 1F5JA 1FI2A 3O0XA 1QNWA 2RHPA 3EO6A 1LODA 3UKTA 2XPJA 1ZRDA 1WA4A 4Q1RA 2EXJA 1LHUA 2ZGTA 1S0JA 2XLAA 3ZIWA 2EA7A 2GALA 5C9AC 2Z5WA 2QDRA 4YVWC 1GZCA 3MW3A 1G86A 2WFF2 1W6QB 1XQNA 4O9GA 1Y7BA 4CEWC 2PN5A 1ZREA 2BVVA 2R6QA 4AVCA 4Q0PA 1D4M2 4GWNA 4XF3A 3ZFFC 1RUJ3 4RS5B 1RUG1 4D7SA 1OOPB 3J9SA 4OULA 1G9BA 4B4QA 4OVEA 3RS6A 3JBG2 3OTFA 5DZEA 5KXBA 1W6OA 2PA7A 3WDUA 1WCSA 4FVVA 3WVJA 4LBJA 4FOQA 4GQ7A 1DGWX 2Y26A 1KXGA 2LALA 1RUE2 2FQPA 4FPLA 4L9BA 1KJRA 3PJYA 5D8AA 4LHKA 3INAA 1KS4A 1ZBA3 1N1YA 3WW2A 3AMMA 4SBVA 1FMD1 1VAVA 3W9AA 1RUC1 5I91A 4R4XA 1HRI2 1PZ9A 1SCRA 1IHMA 2VMHA 1MVEA 3WW3A 4N9HA 3NAPC 5E88A 4I30A 2FZ1A 4WVMA 3MF6A 3VKLA 1GSLA 5HCFA 4MXVA 2GMMA 4EROA 4QPGA 1VBD1 4ATEA 1NQJA 3ZSKA 1QY4A 1MEC3 4Q4X2 5C4WA 4RQPB 2BWCA 3V0BA 2FMDA 3WNXA 1LU1A 3GBWA 3DF0A 4YLZA 2GNTA 3ZX7A 3FHIB 2MEV3 1HV0A 1FOD3 2XKPA 4Q4W1 2H6CA 2JG8C 4AFMA 2K2SA 2RE9A 2IFRA 4MYEA 3R05A 4YZ4A 2UWAA 4GKYA 4AQSA 4LE3A 5D8AB 2CAVA 4HPKA 5H9QA 2PHLA 3H7YA 2RR11 3WQ0A 1CAVA 3W59A 4HVQA 4EN8B 4IEPA 4HVRA 4B4RA 5J96B 1BMV2 1LOAA 3I7DA 2NN8A 4A2UA 1V6OA 1QJU1 2YGMA 5JOXA 1LHVA 4Y22B 1WMFA 4CEYA 1ULFA 3J26N 4C91A 3TN92 3MDPA 4S2FA 1GV9A 4TSVA 1BEV1 3E6CC 4K7JA 2VPVA 4DQAA 1A8MA 4YGBA 2HKXA 2H6BA 1YFWA 4BOWA 1TQ5A 2B46X 2ZHMA 1MQTC 3N35A 4PJYA 5A3MA 1JYCA 5C4WB 4XW3A 2TBVA 3QLQA 1ZZ8A 5JSPA 3V0BB 4FPGA 3IDBB 1CAWA 3KM5A 2RS31 1LOCA 4IXLA 2XJTA 2BFUL 1URXA 1NCRB 4UW5A 4J6GA 1DQ4A 4GMP3 3WD5A 1RITA 4E4SA 1XE7A 4FP2A 3SCGA 4D7TA 3B3QE 3T1LA 3VBHA 1MS9A 2ZGOA 4X6RB 2WNUB 1PIV3 2OW4A 4XFFA 2WZPP 1RUG3 2QFEA 5JVVA 1E57A 1S0FA 3I54A 2EXHA 2VY0A 1CAVB 2XUMA 2X8KA 3JCIA 3RYPA 3JQXA 4GXLA 4YW3A 4XIOA 1W39A 4IEQA 3PVNA 2LM3A 4CEYB 2FZ2A 1SBDA 1ZVFA 3GZUC 3MIGA 4QGLA 2BUKA 2UYBA 3OJBA 3EQEA 1RUI1 2OYZA 2WFPA 1ND2C 2ZGLA 4HKLA 2PHTA 1FMD3 3VV1A 2V73A 5F6KA 1RUC3 2A6ZA 1CAWB 3FLPA 3GZTB 4RR3B 4LO5B 4FOWA 4MX3A 1UN1A 3LKJA 3RYKA 1WW4A 3WXPA 4UW6A 5JDBA 3VBHB