3WLUA

Crystal structure of human galectin-9 ncrd with selenolactose
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
142
structure length
142
Chain Sequence
QAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-9
publication title Expanded potential of seleno-carbohydrates as a molecular tool for X-ray structural determination of a carbohydrate-protein complex with single/multi-wavelength anomalous dispersion phasing
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 142
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wluA00
1LHOA 5E88A 3N7JA 2WQZC 1MS9A 1Q56A 1YRZA 4FP3A 5H9QA 1V6IA 3HN1A 4ASMB 4YZ2A 3NWKA 1PZ9A 2XG3A 1QMJA 2EXIA 5DUXA 2ZAAA 1Q8QA 1AZDA 4WV8A 4XBNA 3V64A 2UU8A 3W59A 1URXA 1W6MB 3LCPA 1MS3A 5IK7A 1C57A 2D6LX 2DV9A 4YG0A 4R9AA 4XZPA 2A70A 1GKBA 2A75A 2GALA 5GLZA 1GV9A 3UJOA 1IOAA 1SLLA 2ZHLA 3FBYA 1MVQA 3AX4A 2B7YA 4FOVA 4FVVA 2AR6A 1DQ5A 2Q5TA 3N7MA 4PCRA 2ARBA 4XILA 2XB6C 1G9FA 1AXYA 1CN1A 4XXPA 1GZCA 2ZGRA 3N7LA 1F9KA 1H9WA 1WLDA 1LTEA 3ASIA 3U4XA 3PMEA 3T2TA 3R4SA 2DVDA 1ENQA 1MVEA 1SACA 4UW6A 5DG1A 1BZWA 3B00A 4YW4A 2GMPA 4BLJA 5KXDA 1G9AA 1W6OA 2VH9A 1LULA 4WVVA 3HR9A 1V6NA 4LBOA 2VUAA 1LHNA 3SH4A 3WUDA 3ZYPA 4JRAA 4BM8A 4XIKA 1ULFA 4YM0A 3VKOA 3V0BA 2PHFA 3WV6A 5GLUA 4YG3A 1VAMA 3WOGA 3SITA 2WJSA 3WDTA 2JD4A 1KRIA 3A4UA 3N3HA 3NV4A 3MW4A 3ZSMA 4DRRA 2WT2A 3SLIA 1PZ7A 1SCRA 1CPMA 1DQ2A 3A0KA 5F9TA 4KBBA 4P9WA 3VKLA 1Y7BA 3ZXFA 3IM0A 3ZSJA 3ZPYA 2PHTA 1V6JA 3IKWA 2E7QA 2ERFA 4ISQA 3TAYA 1G9DA 4AYUA 4FPGA 1W6OB 1SLAA 1V6OA 2JE9A 4YZ5A 2VW2A 1S1AA 1DYKA 1PZ8A 2ZHKA 2E7TA 1N1SA 3V0BB 1HQLA 1QNYA 2YV8A 1QF3A 2DUPA 4MYEA 1F5FA 1KJLA 5JDBA 2AGSA 2YXSA 1QDOA 2R16A 2DU0A 1N47A 3FLRA 2EF6A 4FPKA 4FP2A 1QKQA 2DUQA 4FPCA 1LODA 3RMXA 1I3HA 1CESA 1ULDA 3ILFA 4GKXA 4U2AA 3VV1A 3FUQA 1WW7A 1QU0A 1LOFA 1CONA 4Q8LA 3O0WA 2P3JA 4GWNA 1TEIA 1AX1A 5IK4A 4ISRA 4FOQA 4XOGA 4LBMA 1G8WA 4YM3A 2FHRA 1ULEA 1DFQA 1O4ZA 4XJAA 3ZVXA 1GYKA 2ZGKA 2H0BA 2V5YA 2ZZJA 1DGLA 4XBQA 5T54A 5CB7A 4F83A 3UK9A 1UMZA 1LESA 3RRDA 2OUHA 4BOWA 2NMNA 4C1WA 1N1YA 5EWSA 2ARXA 3IN9A 1SBDA 2DTYA 3RQ0A 2D3SA 3AYEA 5DZGA 5T5LA 3ZXKA 4L8QA 2DVGA 2P37A 4TZDA 3OYWA 2TEPA 1LOGA 1JBCA 1UN1A 2SBAA 3ZYRA 1HQWA 3BTAA 4K1YA 2E51A 3WLUA 3AYDA 4YM1A 3OY8A 2V73A 5EYYA 1LOAA 1KQRA 1CPNA 2AYHA 3D4KA 3ILRA 3POYA 1DHKB 2W39A 1O4YA 4K1ZA 2NMOA 1LGNA 4IQPA 2KM2A 5CA6A 4Y20A 4LBKA 1AJKA 1AXZA 1LECA 1HKDA 4M3CF 3M3EA 1N1TA 1RINA 5H9RA 4R9DA 4FPYA 1CQ9A 4K20A 4NOTA 2EXJA 5JOYA 4Q1RA 2VW0A 4P9YA 2HYKA 1GZWA 3T1LA 1IS5A 2EALA 2AENA 2ZGOA 3WHUA 3WDUA 1SBFA 2PHXA 5SV8A 3WNXA 2E6VA 1QNWA 2VY0A 4D69A 4Y26A 2ES3A 3PVOA 5FREA 2ZHNA 4XHBA 1SLBA 2WT1A 3AK0A 4M00A 1WLWA 5AVAA 3OYWB 5JMCA 4DS0A 4YZ4A 4ATEA 4XJUA 4PF5A 3OY8B 3WZ1A 2VW1A 1MS4A 2PHUA 1G86A 1YO8A 2NM1A 3AXEA 4W65A 4DQAA 1AX2A 1QOSA 1LHVA 1N3QA 2UWAA 2GMEA 1KITA 4XJWA 2CTVA 4Y20B 3T1MA 4YW2A 4SLIA 1LOEA 4YM2A 5EYXA 3SH5A 1MACA 3AYCA 2P2KA 3SNMA 1BQPA 3B3QE 1UX6A 3MPPG 1S0BA 2R1DA 2ZBJA 4AVVA 1ULCA 2CL2A 1GZWB 2A7AA 4AVSA 1N3PA 1BKZA 3O0XA 1APNA 1JHNA 5JOWA 2UURA 4FPLA 1Q8PA 1U0AA 5GZFA 2JE7A 2A3YA 3GNEA 1FATA 4AGVA 1V6MA 3OGGA 1IKQA 3SH3A 1YIFA 1VALA 1ZA4A 3W58A 1LCLA 1UPSA 1CVNA 4H55A 2CNAA 3PVEA 4GWMA 1C1FA 1Q8VA 2UWCA 3JUUA 3RMYA 1GZ9A 1QDCA 1W6PA 1JYIA 2D6OX 2WKKA 1DQ1A 1H30A 5F5QA 1BXHA 3JU9A 1UL9A 2ZGQA 1FV3A 4YGEA 2P3KA 1MS5A 3WVJA 1S0JA 3AZVA 1IS6A 4XTMA 4UW3A 5T5PA 3FLTA 3DUIA 3MEPA 1RITA 3NV1A 1OKQA 1W6NA 1VLNA 4XJZA 1WW4A 5DZFA 1D0HA 1SBEA 2C5DA 4AWDA 5HCAA 2WNEA 4RL7A 3KQRA 3N35A 3APBA 1VAVA 4CZSA 3GALA 3BOPA 4Y1UA 1GBGA 3AZWA 4XHXA 1XQNA 1GNZA 2Z42A 1KJRA 2JKBA 2WSVA 5T50A 3USUA 3FLPA 2WLQA 3KM5A 3M3QA 4Y22A 1A78A 3POWA 5T5OA 2NN8A 5GZGA 1WW6A 4XMIA 2A71A 2SLIA 3IMNA 5GLTA 2ZGPA 5KXBA 2GNDA 3WG2A 1N1VA 1QGLA 1LOCA 1W6PB 3BIWE 4HANA 4XYXA 2UWBA 2P34A 2OUJA 1W6QA 3I8TA 3R05A 4OZXA 2AREA 4GXLA 1MS0A 4LBNA 1SCSA 3C2UA 3AZYA 4Y24A 5DXDA 1Q8SA 5IK5A 1DQ6A 3A0NA 5E8AA 5BYNA 1SLTA 2A6VA 2D6NA 1Z78A 1UZZA 2DVFA 4R9CA 4XMAA 1W6NB 3ZSKA 1GNHA 1JXNA 2DWRA 1F31A 4FQZA 4ATFA 1JW6A 1DBNA 1HLCA 1JN2P 1YI7A 4ZXKA 1S0EA 3UJQA 3D6EA 2D6MA 1S0DA 2W68A 3USUB 3BODA 5GLVA 3AJZA 1MZ5A 1QOOA 3O12A 4Y22B 1BYHA 1UKGA 5EXOA 3ZXJA 1G9BA 2R0FA 5H9SA 4YGBA 3WHTA 1BJQA 4BLIA 1I1EA 1LGBA 3AZZA 1FV2A 1LU1A 1S0CA 2D6KA 3B69A 3WDYA 5DUVA 2ZGLA 5GZEA 1DQ0A 1W6QB 2I2SA 1V00A 4PBOA 4FOWA 2GN3A 1YYNA 1ONAA 3AP5A 4P14A 2YY1A 4Y1XA 2A6WA 2CWSA 4FOYA 1J1TA 2WT0A 1LGCA 3Q9OA 4ITCA 2JDZA 3INAA 4Y1ZA 3ZSLA 5CBLA 4R9BA 1LEMA 5DZEA 1SFYA 2D3RA 2ZGTA 2ZGNA 2GDFA 5HCBA 2P3IA 4FPEA 2NZ9A 1MS1A 2LTNA 4C1XA 2NP0A 3AXDA 3NV3A 5H9PA 2LALA 4JC1A 1LHWA 5GM0A 4K21A 3WG3A 4XXAA 4AVTA 4PBPA 1G7YA 4Q27A 4YFWA 1G9CA 1A3KA 1LENA 3FUOA 2ZHMA 3WDWA 4YGCA 1FYUA 3CNAA 3RS6A 5IK8A 4CTEA 1UAIA 3AZXA 3MW3A 3ATGA 5FRAA 2ZGUA 4YW3A 3POSA 5KXCA 1S0FA 1H9PA 4JCKA 4WZFA 3V0AA 3DGTA 4YFZA 1D2SA 1DQ4A 1NXD1 3L2YA 3ILNA 1GSLA 4I30A 4XTPA 2C9AA 3AP4A 3I4IA 5DUWA 4XDQA 5JLVA 3ZXLA 4FPOB 1MZ6A 1MR5A 4YG6A 2ZABA 2EXKA 2GMMA 4AGGA 4BMEA 1GANA 3HMYA 3WUCA 1C4RA 2A6ZA 3N7KA 5CAZA 4FPJA 4CRQA 1LEDA 3AJYA 5JVVA 1V6LA 1SLIA 1W0PA 1S0GA 2YMZA 1IS3A 4Q26A 1DYPA 3O0VA 2DURA 1DZQA 2BQPA 4YW1A 1W0OA 4PQ9A 2EIGA 1AXKA 1ULGA 3MW2A 4TYSA 2GNTA 3B9CA 3OJBA 3V65A 3V0AB 4NO4A 2ENRA 1NLSA 1CIWA 2ZMKA 2DUOA 4XE9A 4UW5A 4AGRA 1FNYA 1Z0HA 3IPVA 4YZ1A 4FPHA 2GNBA 2A3WA 2CYFA 3AP7A 1GLHA 5GALA 5T55A 4XJ9A 3TB0A 1GICA 3OBTA 1MS8A 4LBLA 1OQ1A 4XJ8A 2VU9A 2FMDA 2A6YA 5DUUA 1KDMA 3WG4A 3AP9A 3RG0A 2EXHA 4RA0A 4M01A 3AYAA 4WVWA 3WCSA 1WBLA 4U36A 1ENRA 3ZXEA 4BMBA 5JOXA 3QLQA 2PELA 4GALA 4Y1VA 5T52A 1UZYA 1JUIA 1QOTA 4Q2FA 1B09A 3M2MA 2AUYA 2OW4A 1DLLA 1YXWA 2A6XA 2DVAA 2PHWA 2GNMA 1LU2A 2R49A 2ZACA 4P9XA 2DYCA 2A5ZA 3AP6A 1S0IA 3QCWA 1JYCA 1Q8OA 4XBLA 4DRVA 4Q8KA 3RSJA 1WD3A 1FNZA 2CWMA 1WLCA 4Y1YA 3OPZA 1LHUA 1CJPA 3AFKA 3IPVB 3WG1A 1KDKA 4BQ1A 1AX0A 5JOZA 1HDKA 5HCFA 2W08A 2E53A 4Q1PA 3ENRA 4LBQA 3FFZA 5GJ6A 2WSUA 1A8DA 4GA9A 3LSEA 5CNAA 5L73A 5LK5A 1N3OA 4FQ4A 1VIWB 1R1ZA 1WUVA 1CR7A 4M3CA 4M3CE 2JECA 5IUQA 1EPWA 1DIWA 2ZMLA 5IT6A 1IKPA 2DVBA 5T5JA 1AJOA 2D3PA 2VXRA 5DG2A 3LSDA 3M3CA 3VUOA 1LOBA 2D7FA 4ZKTB 3VKMA 1X50A 1FAYA 4DPNA 1LJ7A 4GKYA 3OBRA 2RHPA 3M1HA 4HL0A 2ZGSA 1WD4A 3VKNA 3WDXA 4DFSA 2GN7A 4YGDA 3M3OA 3WDVA 3R4UA 2DTWA 2D6PA 2W52A 2YROA 3O5SA 4LBJA 1AVBA 2D43A 3H0OA 1WCSA 3PVNA 4YLZA 1V6KA 2R1BA 4UW4A 4YW5A 5GLWA 4Z8BA 2AH2A 1W6MA 4BPZA 1SLCA 3D5OA 5E89A 4XIOA 3VKFC 1JOJA 1ZM1A 3WCRA 1WBFA 4LBQB 1C1LA 1WW5A 2PHRA 2DU1A 2R0HA 5KXEA 3SISA 2ZGMA 1FX5A 4FPFA 2A3XA 1IS4A 2NYYA 2EAKA 4YZ3A 4M3CB 1LOFC 1AF9A 3N36A 1OFSA 2ZMNA 5GZCA 3B01A 4LBQD 2ZA9A 2D44A 1RIRA 3UL2A 2OVUA 2G4IA 2CY6A 5GZDA 3NV2A 2JJ6A 2ZKNA 3PJQA 1ENSA 2YZ4A
chains in the Genus database with same CATH superfamily
3ACLA 1IQAA 3A21A 4MG2A 3AM2A 5JIUA 2WWUA 1MS9A 4XCAA 5FUIA 5A7SA 3HN1A 1L3JA 1VMFA 1ACCA 2J1AA 1Y9MA 3ZPOA 3PNAA 2HWF3 2ZAAA 2RS51 2UU8A 2BBAA 2J1TA 3HBZA 2VCMA 3POBA 1C57A 3ZXGA 5JR7B 3MF6A 3ZSEA 3OOXA 5FY8A 3UJOA 5M0TA 3T2QA 3TEZA 5F32A 3AX4A 3NNFA 1X33A 2B7YA 5JSPA 1F8VA 1D2QA 2AR6A 5C33A 3K48A 1DZRA 4N53A 4E9KA 1OF4A 1ZZ6A 4J1WA 3TNQA 1OFNA 2YBPA 3VBRB 4KU8A 1FMD1 1ZREA 2VULA 4MGTA 2RDNA 4L2NA 1OLME 2DF7A 2ZGRA 5IWFA 3U4XA 4E27A 3WP3A 3LF7A 4ZZ8A 3PL0A 4EROA 1MVEA 4KGGA 1BZWA 2IXCA 2X5IC 4N7IA 1RUOA 2VH9A 2YHJA 3HR9A 5A3PA 2ZX3A 2HWE3 3SKVA 3I97A 4J6GA 3J7HA 3FHIB 4LBOA 3UT0A 2GZWA 3WUDA 3WX5A 2WFF3 3HOBA 4BM8A 1TNRA 3ORJA 2GSYA 4DY5A 4QGLA 5CZKA 3K2OA 3IB3A 5BNOC 5FO8B 1PO13 1ST8A 2BGCA 5J36A 2ZZQA 2VCBA 5GLUA 4XFAA 4LHNA 1UY3A 5JPNB 1H8TC 2B46X 3SITA 5CADA 3WDTA 5C5UA 3N3HA 3ACFA 3T0DA 5EFUA 4KI5M 3WF3A 4N53B 5D21A 1PZ7A 1CPMA 1TMF3 3O1MA 2NPIA 1RTVA 4KBBA 4A4AA 1JODA 3JB4C 4HMZA 2Y6GA 5I91A 3ZSJA 2XLAA 3FWEA 1WCKA 2D93A 2GAUA 3CU7A 3CJXA 2E7QA 3IKWA 3KGZA 4XAEA 1HRV3 2FZ2A 5AC92 2RM22 4XF3A 4AEDA 1ZRCA 4EN0A 4S2HA 2JE9A 1ULPA 1NZIA 4GWJA 4Q4Y2 5CKQA 4XFCA 5FZKA 4CE8A 2E32A 1GP4A 1PIV2 4MH0E 2E7TA 1X7NA 4HBNA 1N1SA 2WFF1 4XVHA 2FZ1A 2WO3A 3I3DA 3RJ2X 3ZDSA 3ETPA 4ZONA 5K8SA 3EMRA 1IPJA 1H1AA 3WF4A 1PO11 1US3A 2QQJA 5FYCA 2VTFA 4O9GA 4BXSV 1F4AA 1OC1A 2WS92 5JR2A 5K9YA 1IQDC 5IVYA 1SMVA 1OMIA 2DUQA 1UU5A 2OX0A 1I3HA 1ULDA 4U2AA 5JMOA 3OBAA 3FUQA 1TMF1 1ZRIA 1GOFA 1WW7A 5FLJA 2IFRA 4XDOA 4Z2WA 1LOFA 2QQKA 5J3UA 1YFYA 3H8RA 4AEDB 1MZFA 1TQ5A 3BOWA 1KD7A 3NMBA 4ISRA 3RPQA 5LBBA 4XOGA 2HWB2 2YFZA 1D4VB 3MLJA 4J25A 4NN0A 2WABA 3J8F2 4H7MA 3I2OA 4MGYE 3S5AA 1O3QA 2ZZJA 4BIFA 5CB7A 3UK9A 1UMZA 3M3IA 1D4M3 4JDNA 3KMHA 1QQP3 1W90A 2VGDA 4DO0A 1W8UA 3HQUA 1D7PM 1UY1A 3NSTA 5DZGA 3WY6A 4B1MA 1ODNA 1FOD1 2P37A 2VMHA 2WFPA 2Y8KA 1XE7A 3IDCB 3OYWA 5LBCA 5ABJC 2VTXJ 4ASKA 3ZYRA 2WO7A 4YM1A 4UFIA 1B35C 3OY8A 3DECA 3WNKA 1LOAA 4EE2A 2AYHA 3H8XA 4K1ZA 4N90A 4BQYA 2NMOA 5CG8A 2FDFA 2HWF2 2W92A 3OUJA 3EHKA 3IMMA 1W2UA 4LOTA 5KBFA 3HNBM 4MUVA 5FZHA 4L97A 4FPYA 1NLRA 1CQ9A 2EXJA 2WQ8A 4Y5TA 4Q1RA 1SDDB 3MFCA 3I2GA 4K7JA 2XKOA 2VMFA 1Y43B 2ZGOA 1NX9A 4QB1A 4Q0VA 1QJU3 3T30A 3WHUA 1XSRA 3Q8FA 2VY0A 5ACA2 2Q8EA 1JZ2A 3PVOA 2RVAA 1MZEA 2WZ8A 2KA3A 1QQP1 1SLBA 3SCGA 3OYWB 3K4AA 3O1OA 2DCYA 4Q4X1 2VZVA 5CIRA 1HJFA 5JXJA 4Q29A 1H8VA 2X8KA 2XOMA 3OY8B 2XXZA 2PHUA 2XJSA 2OPKA 5FLHA 3PDQA 1RUC1 1QOSA 1LHVA 3HAGA 4C91A 2HWE2 2GMEA 2ET7A 5FV3A 2IXHA 3C7EA 4OUEA 1H2NA 5EPAA 2JDKA 1H0BA 5EYXA 3AYCA 3PU3A 1YJKA 2WZR1 4EZ4A 3SNMA 3U37A 1AR63 5A3UA 3GJAA 3B3QE 1C3HA 1NUKA 3C8XA 2R043 2ZX0A 2IVIB 4B7KA 2ATFA 2A7AA 3J26N 3K75B 4AFDA 1N3PA 3O0XA 3WQ0A 1JHNA 1GP6A 4PIXA 2BTVC 2YYOA 3WF1A 1Q8PA 4IEPA 2XLGA 5FBJA 2JE7A 1H2KA 1V6MA 2WNUA 3AL6A 1ZZ7A 3WP4A 1OT5A 3NAPA 5A3NA 1NAEA 1CVNA 4H55A 3O1PA 2CNAA 1HW5A 1O8SA 2Q1FA 3PVEA 4Q0QA 4URAA 4OI2A 2BGPA 4LTAA 1HRV2 1W6PA 3WW4A 4EN7B 2CGNA 3AB0A 1RC6A 3E6BA 4XFFA 1KS5A 1DQ1A 2ZEZA 1BXHA 1TZOA 1Y9GA 5FZ0A 5IJRA 1RYYA 1FV3A 4WVZA 2P3KA 1VAKA 4RHV2 1S0JA 1UZ0A 4A45A 3I2FA 4UW3A 4YYOA 1K42A 1XNAA 3DUIA 3MEPA 3NV1A 3BALA 4FBFA 2VQTA 5AVPA 3LQCA 4XJZA 1D0HA 2ETEA 4ET7A 4HKOA 3KVBA 3N35A 3APBA 5FPBA 1RUJ1 5FZBA 2PFWA 4CZSA 4HPKA 2JDMA 2IXJA 4DZGA 4XHXA 4Y33A 1WA6X 1XQNA 4P9IA 3NO8A 2WSVA 2VC9A 2WNUB 4YWAA 4NPMA 1W2AX 4W8JA 3NAPB 3POWA 1SFPA 4Y22A 2NN8A 5T5OA 2VQ0A 1ASJ1 2SLIA 1H6XA 1UCXA 3AMQA 4CCKA 3WG2A 1W2NA 1W6PB 3BIWE 4C8DA 2UWBA 2LW8A 2OUJA 2GC3A 4OZXA 5F3CA 5J09A 2HWC2 2BVBA 3GZTB 2JENA 4P9GA 4MGSA 2VMGA 1AR83 3AMPA 1NY72 1REDA 1W9TA 2XJQA 3FE5A 4LBNA 3BUCA 1UD1A 4Y24A 4QHZA 1R083 1UXXX 4AE2A 4R9CA 1Z78A 1XYOA 1D4M2 2C9KA 1F31A 2JG8A 3S5QA 1JW6A 1DBNA 4RGGA 5C71A 2I74A 3GBGA 3GZEA 3KT4A 2IC1A 3D6EA 3E5XA 4QX1A 3ZO0B 2ZCWA 1S0DA 1VPHA 2P17A 2W68A 3IAQA 4QPIA 5FPAA 4QGNA 4Y22B 2MNGA 1UKGA 5BNNC 2BBVA 1G9BA 5JCTA 4YGBA 4BLIA 4F8AA 3I54A 1T2XA 4LE4A 3VL9A 2XR4A 3B69A 4NIDA 5FCCA 1DQ0A 5GZEA 4B1LA 2I2SA 4HK8A 5FXZA 5HV0A 5BPXA 1ONAA 3ZMNA 4P14A 1OOPA 1CAVA 1O5LA 1J1TA 5CFCC 2BEOA 4Y1ZA 4ITCA 2YPDA 4SBVA 1AR81 2QUOA 2HBUA 4R9BA 3LOBA 3BKZA 3MFAA 2GDFA 1QJU2 1RUE1 5HCBA 1OQDA 2NZ9A 1SEFA 1MS1A 2LTNA 4C1XA 2NP0A 2F17A 3AXDA 3OBZA 4FTBA 4NHKA 2JG8B 1LHWA 4ES9A 4K21A 4NRPA 3T2OA 1H4HA 2XJUA 4FO9A 4CXWA 5ERLA 4O7XA 1RUG1 1G9CA 3FUOA 3MIHA 1O7FA 4LXLA 4QX2A 3WDWA 5KHKA 4YGCA 4QPIB 4NROA 4Z82A 4Z07A 3TEWA 3WNLA 3RS6A 4OUMA 2JDHA 1BBT3 1UIJA 3MW3A 3ATGA 3W5MA 2HYXA 2ZGUA 1ODMA 1F2NA 1PGW1 2R071 4V2WA 5EJ1B 4ZU7A 2J1UA 3SMHA 5C5TA 4NPRA 1J58A 1HB3A 1D2SA 4YFZA 1AR62 1OOPB 5KWRA 1CAVB 1W8OA 2R042 5FZIA 3JBG3 4ZXEA 4K8RB 3I4IA 3KD4A 3VDCA 2XL9A 2K46A 1E5SA 4FPOB 3IAPA 4GB33 4OFGA 4K3UA 5LEKA 1DZTA 2PXJA 3VBRC 5FO9B 4AHXA 2JEMA 4QDQA 5EV7A 3ZFEC 4CUAA 3K4ZA 3KCYA 4NIGA 1ZBE2 2JIJA 2A6ZA 4Y5Z0 1DLCA 4CRQA 5JVVA 3PUAA 2W2IA 1PK6A 3EBRA 1AYN2 1YLLA 4KNCA 1IS3A 2R7EB 2DURA 3THPA 2BQPA 3POIA 1JI6A 3H1MA 4XFGA 2NQYA 3W21A 2GC0A 1UYPA 1Z7S2 1BBT1 4CVUA 2W94A 3J7MA 1CAXA 2VNVA 3LEGA 2GNTA 3B9CA 1YNAA 5CEHA 3GF6A 1OHFA 4CPBA 1WMEA 5JIAA 1CIWA 1S2KA 2DUOA 2WWJA 3MIDA 3VZNA 1O6UA 3KF3A 4FPHA 4RGKA 2VVEA 4I0AA 1ZYBA 2A3WA 5T55A 4ZU5A 1W8HA 1VBB3 1WMXA 4N53C 3R6SA 4G9SB 1X9PA 4LBLA 4Y4YA 1ZZBA 3H9AA 3QACA 4LORA 5FZAA 2ZX4A 2A6YA 2VD7A 3WG4A 4KQ7A 3WD5A 1JOPA 1RUI3 1X8EA 4WVWA 1WBLA 4KWLA 2YFUA 1YFXA 4HONA 1TME3 2WIIB 3ZXEA 1PK6B 3QLQA 1FI2A 2BNNA 2JD9A 1JUIA 2XVKA 3NKTA 1RUH1 3CJIA 1B09A 2AUYA 4XF1A 2OW4A 3VD5A 2ZACA 4AWDA 1LU2A 1CAXB 3AP6A 3QCWA 5I0RA 2PLV3 2ZEYA 1R082 3K46A 3LDRA 5AFBA 4LHSA 5FZ7A 2MEV3 5LBFA 3VBHA 4CCDA 1BMV1 4COYA 1E5IA 1PVC1 2J1VA 1HDKA 3FBMA 5HCFA 2E53A 5F5AA 3ENRA 4LBQA 4CPBD 4H2AA 2ZPXA 5GJ6A 2WSUA 2C4XA 1G6NA 1X9TA 5FY1A 1A8DA 4OQ9A 2WAAA 4V1PA 1T6GC 1HN0A 1PNGA 1NG0A 5I8TA 2Q0AA 1WUVA 3MV11 5IUQA 4M3CE 4QB6A 3HJRA 4LKEA 4AEDC 3FZ3A 1UU6A 3VUOA 2G9ZA 3C7OA 3CJIB 2QE3A 4M0HA 2Y6KA 4GAZA 3FN9A 4Q0UA 1FAYA 1LJ7A 1QHDA 1WD4A 1BK1A 1YHFA 3T0BA 2GN7A 3WDXA 3PMSA 2JX9A 3SQOA 2VOKA 3HEIA 2EA7A 3R4UA 1C8NA 4AFBA 2G9GA 4LBJA 1NXMA 4H3WA 1AVBA 1QY4A 3VBHB 1YQ5A 1VRH2 3ZXDA 1POQA 4AAPA 1W6MA 1KGYA 1SLCA 4CUCA 1GU3A 5E89A 3JCIA 1WBFA 1EPZA 5FPXA 4TLFA 4LBQB 3JQXA 1C1LA 1COV2 3PVBB 4MGIE 3SISA 4AHZA 2BU9A 1XXNA 2ZGMA 5FZFA 2NYYA 2LROA 5F3GA 3U78A 1O5UA 4X8NA 5EHDA 2X05A 1LOFC 3N36A 3FHQA 2WO2A 4DUVA 1W04A 3B01A 2DBNA 3C7HA 4LBQD 5GZCA 4XDPA 2WZPP 5IHRA 2OXBA 5FY7A 1NLQA 2CY6A 2W5FA 4X6QB 1T6BX 3PJQA 2ZKNA 5JZGA 4K6BA 3RZGA 2Y6FA 1GP5A 3O1UA 3IIAA 4I2OA 4QPWA 1C8M2 1YRZA 5JXGA 1KS4A 3JBG2 1V6IA 1W9YA 3PLQA 4ASMB 4YZ2A 1PZ9A 1UY0A 1QMJA 4XACA 3WV6A 2A73B 4IE0A 1AZDA 4GB32 4WV8A 2VG9A 3V64A 3ZFFB 1URXA 1W6MB 2YC4A 2JDUA 5A6ZA 1GZTA 4YG0A 4I02A 4R9AA 1UMIA 4XZPA 1WCUA 4OQ8A 2A70A 1GKBA 1OA4A 5GLZA 4BQ5A 5F39A 3VZMA 4MXVA 1NA1A 1IOAA 1SLLA 4Q4V3 2VOWA 1MVQA 3I2DA 4DXTA 4BISA 5JUVA 2QQUA 3R4DB 2QVSB 5C6CA 2WWSA 1PO23 3DYOA 2W46A 3C3VA 1EV11 4LE3A 1G9FA 1E57A 1CN1A 4XXPA 1GZCA 1H9WA 5JZGB 1LTEA 1I5PA 3MIGA 4QKFA 2QCSB 2BNMA 3B02A 2JG9A 4QX3A 3VDDA 3MIFA 5DG1A 4UW6A 1WA4A 3B00A 4YW4A 4IGPA 3O1SA 4RFRB 1CAWA 1JYXA 4LO8A 4ONUA 4QPGC 4QHBA 1VBB2 3DEMA 1U5YA 3DYMA 3SH4A 3LE0A 5DAPA 2JE8A 4YM0A 5FZ3A 4UBGA 2PHFA 1RUI2 4XFHA 5ANQA 1VAMA 1TME2 5EIYB 1NA1B 2WJSA 1I6XA 2JDNA 2RJ2A 2FDKA 3NV4A 1KRIA 3WQBA 3MW4A 3TN92 2QZ2A 2EICA 3E6CC 4Q4V1 4UFKA 1CZSA 3VKLA 4A6OA 2PLV2 4TLGA 1GQPA 4RYDA 3Q8CA 3VDDB 2JG9B 2MEV2 1REEA 1YI9A 2VBBA 4AQ2A 4HN0A 4AYUA 3RYRA 3K51A 1VBE1 1CAWB 4FPGA 5DQ0A 1V6OA 2K0GA 3W20A 1ENXA 2VW2A 3BIEA 2Y26A 3UKVA 1VMJA 4MSVA 1DYKA 4QQ2A 4AI8A 1RUNA 2ADDA 1PZ8A 1XSQA 5FPZA 2WNUC 1VRBA 4JTNA 2YU1A 4KGQA 2XBO1 3NAPC 1QNYA 2YV8A 2PQQA 1SZBA 3LFIA 2ZKLA 1FPN3 1KJLA 3VGIA 2AGSA 3ROUA 1QDOA 4E8DA 1R093 4UAPA 4WVMA 1N47A 3FLRA 4IEZA 4QM9A 1HB2A 4XQWA 3P5BA 3WW1A 2XH6A 3RMXA 1CESA 2XKPA 3UKNA 1V0AA 4RSUA 4AEMA 5CU1A 4JX0A 1XU2A 2WRAA 4JHTA 4XEZA 5IVBA 5LW9A 2WUHA 5DAWA 5CKNA 1K12A 1CONA 4FSJA 3O0WA 4GWNA 1V9U2 4QKDA 5DABA 1TEIA 1AX1A 1NE4A 2OYZA 4DNYA 3JXSA 1R64A 1G8WA 4PF1A 3U10A 3I3QA 4YM3A 2R061 4DIQA 4CU7A 2FCUA 5A3MA 5FO7B 3S7IA 3ZVXA 1DDLA 4E8CA 1RUD2 2B45X 5FYUA 2WA3A 1OSGA 1DGLA 3OGVA 1XNKA 4F83A 1LESA 1PGL1 3ZR6A 1H6YA 2W9XA 1N1YA 1FPN1 2QTWB 3ALQA 1XC6A 2DTYA 4QX8A 5EWSA 2D3SA 3AYEA 4WVMB 3RQ0A 3T4VA 4L8QA 4Y5SA 3IDBB 3ZXKA 2QDRA 4B4RA 1QIQA 2TEPA 1JBCA 2SBAA 4MHUA 1HQWA 5A7QA 4K1YA 2E51A 3NNMA 3AYDA 5EYYA 4DY3A 1PMIA 2GH8A 3B94A 1DHKB 3GJBA 3POYA 3ZYJB 4BQXA 3DV8A 1LGNA 1W3XA 2KM2A 2ZOEB 5FZOA 4YSFA 5CA6A 5DAQA 1RJ7A 4Y20A 4HOOA 1AJKA 4M3CF 2JG8C 1HKDA 1ZBA1 2YBKA 1KEXA 3AMNA 2R32A 3H7YA 4I0WB 2XVGA 3UKTA 4AOCA 4AQSA 4NHYA 1BHGA 4CDUC 5JOYA 4AHWA 4QPIC 4P9YA 2HYKA 3T1LA 2RV9A 5CISA 3X29B 2PHXA 1HV1A 1PO22 4D69A 4TN7A 4Y26A 3AMMA 1XYPA 5FREA 5I0TA 4AI0A 1AL21 2ZHNA 5AVAA 3HNYM 4MX3A 4PIZA 4XC9A 5FYZA 4EN9B 5DDJ1 4IGQA 1OOPC 1A8MA 3AKRA 4AQTA 4CUBA 4PF5A 2XGXA 4N43A 2RDRA 1MS4A 1W8FA 3ME2A 1YO8A 3AXEA 4W65A 3BTXA 1X82A 5FZOB 4CCEA 3THTA 4Y20B 3WNOA 2WN3A 4YW2A 2VBDA 4SLIA 4JKKA 1UOBA 3FHAA 4LJHA 3SH5A 2P2KA 4O61A 3M8LA 3H8UA 4HN1A 4D3WA 4XW3A 2KXLA 1UX6A 2Y0OA 4IUGA 1NE6A 2ZBJA 3VZLA 4AVVA 1ULCA 1ULOA 2CL2A 4K9SA 4Y3OA 5JPMB 4AVSA 5KHHA 1BKZA 3NQHA 4RN5A 1APNA 2WNVA 1AR71 2PA7A 2VPVA 4R4XA 5JOWA 4FPLA 1RJ8A 3CZJA 2Y0IA 5GZFA 3IT8A 2A3YA 3LDBA 2W1WA 1PHMA 4ZS2A 1FATA 1JS9A 5FYTA 1W8ZA 2BUKA 2UY8A 4QQHA 5FYHA 4ZY9A 1RUF2 1VALA 3SXWA 3HVDA 2XL7A 1AR91 2VAUA 3JUUA 5F1RA 5L7OA 3S57A 4N43B 1QH6A 1YCIA 1GZ9A 4N7UA 1M06G 3HBKA 4OI0A 1H30A 3JD71 2BDRA 3LPFA 3JU9A 5FXVA 1MS5A 2O14A 2B8MA 3TYJA 3AZVA 1LRHA 1U12A 5T5PA 1RITA 1VLNA 3RYPA 1PK6C 2G1MA 1UYZA 1SBEA 5HCAA 4IESA 2VZPA 1R092 3ZYBA 4CCJA 5D1IA 2WNVB 1VAVA 4YW7A 3BOPA 2BGOA 3AZWA 4QT6A 2XMLA 4HXCA 1GNZA 1H2LA 1HB4A 2RDSA 3OUIA 1FOD3 3KM5A 4L9BA 2CDPA 5KHJA 4O65A 5EJZB 1WW6A 3H50A 4XMIA 2BRTA 3IMNA 5GLTA 3RWNA 4GZ9A 2XQXA 2ZGPA 5KXBA 2GNDA 2VZ1A 2YG0A 3O14A 1QGLA 4IV1A 5L7OB 4XYXA 4P08A 3R05A 2P34A 2VMEA 1XYNA 1RMU1 3FC0A 2FBEA 3ACGA 5HPOA 1HXS2 4AFMA 2RS52 5IATA 5BV6A 3URFA 1QEXA 1S4CA 4CXXA 2BFUL 1Q8SA 4BH9A 1DQ6A 2IFWA 2UYAA 2VO5A 1ND3A 3FX3A 2A6VA 4XMAA 5BYNA 4QKNA 1ZRDA 2D97A 1YEWA 4UF0A 3ZSKA 4R4ZA 4ATFA 4FQZA 4QXCA 1YI7A 1HLCA 4ZXKA 3SCFA 1C28A 5IFPA 3CJIC 4QU2A 4XUTA 2ZJCA 2D6MA 2WYSA 4CCLA 5LY2A 3ZFGA 1FMD2 3DKWA 1MZ5A 2B9UA 4CEWA 1EYBA 1JOBA 3O12A 5L9RA 4Q4X3 2MPFA 1BYHA 5EXOA 3UGHA 3ZXJA 3BU0A 2R0FA 1HRI1 4UBHA 3GHNA 1I1EA 4NAMA 3VBHC 4LQRA 1FV2A 3E1F1 1LU1A 1W2TA 4IV1B 4D7TA 1VE0A 3LOIA 1Q43A 2ZGLA 1VB2A 4W6YA 4B8EA 1RUC3 4K8FA 1V00A 4PBOA 4FOWA 1YYNA 2XUEA 4UFMA 4Y4RA 1QJY1 1LGCA 1YFWA 3H3UA 2JDZA 3ZSLA 2X10A 3AVRA 4O9EA 1J59A 4OHYA 3POEA 2WZR3 4OZOA 4YARA 3DL3A 1SFYA 5FDBA 1JYVA 1ND3B 1R1A1 1SHWB 4FPEA 5FAXA 3LGRA 1EP0A 3VZOA 3AKPA 1OD3A 1Y9QA 4UF0B 2JWPA 3NV3A 1H2MA 1NT0A 2LALA 4JC1A 5GM0A 3VHRA 5DAXA 4L11A 5FXWA 4AI2A 1HQNA 4UWDA 2R6QA 4XXAA 3TRSB 1UZVA 1OLQA 1PMHX 1OA2A 4KWJA 4YFWA 1A3KA 3L2HA 3ZFGB 2JIGA 1FYUA 1IHMA 2CAUA 1ALYA 3ZN6A 4CEWB 4LULA 2AZ5A 5T3NA 4XURA 3KCCA 4Q0PA 4RQPA 1QJX3 4OUSA 3KHCA 4LPLA 3ZFFC 4UFLA 3C7GA 4DB5A 4D8MA 3NRUA 1DCSA 1NCRA 1GFF2 3M70A 3V0AA 5C70A 1ZZCA 2YDEA 4AI3A 1EAH1 2CV6A 2WFF2 3ILNA 2D5HA 4M4PA 4RGAA 3QH7A 2C9AA 4XTPA 2YB7A 1SPPA 3CQOA 1F15A 5BY5A 5DUWA 2ZS6B 4CYDA 3ZXLA 1VBA1 4AW7A 4AFCA 1PO12 1BEV1 2FCVA 4BMEA 1RUJ3 5D8AA 2FQPA 1OKOA 1U5XA 1PMJX 1C4RA 1AHSA 3B5LB 4R52A 5JZGC 3N7KA 4LKFA 4JTOA 2VBPA 3CMGA 4N9IA 1V6LA 1TMF2 1S0GA 3ZN6B 3KWVA 3LB9A 4P00B 4Q26A 3MIEA 4BE3A 1RHI1 1ASJ3 2RR13 4RQPB 4YW1A 1TE1B 1W0OA 3K3OA 5FJHA 2HEYF 1VBD1 1OH4A 5FZCA 3U75A 5A1FA 1QJX1 3IBMA 2B9VA 3LD8A 4HZFA 4E2QA 1W8TA 1PX4A 1NCRB 1ZNPA 3QBQA 4AL9A 3V0AB 5C3OA 1UZWA 5FZ8A 4P5HA 2TBVA 3VD3A 2ENRA 4A3ZA 2XLFA 2ZMKA 3F2ZA 1VMHA 4UW5A 4AGRA 1O3RA 1NA1C 4YZ1A 3CHXA 1QXPA 2P6CA 1SPPB 2GNBA 3WQ7A 4XJ9A 1J3PA 4CP2A 4EWEA 3E6DA 5FOJB 1GICA 3OBTA 1JH5A 4CDQA 1JZ5A 4CEYA 1OQ1A 3N4MA 3OEBA 5D8AB 2E9QA 1FOD2 2HLEA 5DUUA 1ZVFA 5EZWA 3ZKYA 3AP9A 2EXHA 3VDDC 4YVSC 3RZLA 2JG9C 2XWBB 2GU9A 4DMIA 3WW3A 3ZDVA 4BMBA 4A3XA 2PELA 1C5IA 5A7WA 2QDNA 4RS5A 1UWWA 5FLIA 1SDWA 3M2MA 4NUBA 3UGFA 4I0BA 3THDA 2RR11 1DLLA 2A6XA 4QXKA 2PAEA 3IWZA 4IEUA 4BWOA 4FFHA 3HT2A 1S0IA 4CDWA 2WR9A 3AC0A 1Q8OA 2PHLA 1S55A 4XBLA 2ZEWA 5J48A 1XE0A 4LO4B 1LHUA 1W9WA 1CJPA 2EIBA 2XJRA 3AFKA 4BQ1A 4AK3A 3I2KA 1AX0A 1RUE3 5IVVA 4Q1PA 2Z2SB 3FFZA 4CDQB 4D6RA 3WP5A 4CEYB 3VDBA 3OB8A 4IV3A 4GA9A 5JI7A 1QQP2 2Y33A 5IVEA 3TWIA 4MV2A 4CU6A 1DU3D 1PM4A 1NKGA 1RUG3 2WINB 3ABZA 4P02B 4Q4X2 3HIFA 4M3CA 1R1ZA 4HPKB 2JECA 4EN6B 4LK6A 1IKPA 1MEC1 3KVAA 1K5MA 2D3PA 5A7WB 5FYMA 5FP7A 5DG2A 4RS5B 3SC7X 1RUC2 2VZRA 2J1SA 4LUKA 3VKMA 5I0DA 1BVVA 4HVRA 1DG6A 2R073 4GKYA 3M1HA 1L7LA 4I3GA 4D94A 3G7DA 3RYKA 4G3YC 4CDWB 5FK8A 2DDUA 2WZR2 3WDVA 1JU3A 2ZX2A 3O5SA 3TEYA 3POGA 5J98B 5FK7A 2D43A 4CDXA 5LRRA 3PVNA 4YLZA 1V6KA 4UW4A 1VBC3 4Z8BA 4QX5A 3ZMOA 2VZSA 3D5OA 5FZ1A 3VKFC 1JOJA 1ZM1A 3GYDA 1QJEA 4B3NA 1W03A 1MQTA 2PHRA 1UF2C 4K40A 2DU1A 4YPJA 5KXEA 2WNOA 4IV3B 4M0NA 5F6LB 4I09A 2GH2A 3BTZA 1DF0A 5FTTC 2EAKA 4YZ3A 2ZX1A 4M3CB 1AF9A 4XPVA 2P6HA 3NVCA 3S30A 2OA2A 3BB6A 2ZA9A 1K5MB 4XUPA 3UL2A 2WLPA 1CD3G 4NAOA 1CZTA 3N9LA 4QB2A 2EIEA 1J3QA 5E88A 3N7JA 2VMIA 5FZMA 4FP3A 5LCWL 2WYFA 4QX7A 5H9QA 3SEEA 3NWKA 2WZEA 3VBOA 2EXIA 1JYTA 4CDXB 3D82A 3HT1A 3W59A 3LCPA 5F3IA 4QMAA 1SG3A 2E26A 5FBZA 1RUJ2 1HJGA 1VBC1 1EY2A 2E63A 1K5JA 2A75A 1MQTB 2J22A 1GV9A 1W06A 2JDAA 2OS2A 4BIOA 3OPWA 3DXTA 3FBYA 5BNOA 4AZZA 2FDIA 2JKXA 4FVVA 1ASJ2 1S2BA 1DQ5A 2Q5TA 4QM8A 4QHOA 2RS33 1H8TA 4A41A 4PCRA 4CCMA 2ARBA 2XB6C 1L7RA 1AXYA 1RUH3 5IVFA 4QGMA 4GULA 2VM9A 1DGRA 2N7GA 1OVSA 1WLDA 4ZU4A 3PIJA 3AFGA 3PMEA 4JRLA 4P9LA 5FZDA 3T2TA 1GOGA 3R4SA 5EJ3A 2DVDA 1PX3A 1SACA 5A70A 3D3AA 2GMPA 5K0UA 1G9AA 5HBAA 3VBOB 1RXFA 2KD7A 1LB2A 2VUAA 1UY4A 4RR3A 3ZYGA 4XIKA 5FY0A 4XF9A 1PVC3 3VHNA 1O4TA 3PTRB 2YUEA 3VKOA 4JVAA 3V0BA 3LIHA 4P9JA 1AYM3 3TNPB 1W9FA 3OD4A 5F2SA 4NWVA 2PYTA 4COWA 4YG3A 3VHPA 4N43C 2K9ZA 4MGZE 1VR3A 2Y64A 3A4UA 5BNOB 3CIHA 3J9SA 4DRRA 2WT2A 3SLIA 4C0BA 3A0KA 1ND2A 1GMMA 4HVQA 4MGQA 4P9WA 2RS31 2E33A 3BVCA 4LNVA 2CAVA 4S2GA 2PHTA 2DCTA 3KT1A 5ISLA 1AR82 1YQ2A 4IEVA 4ISQA 4AFAA 5K0UB 1CGPA 2WNVC 4BXFA 4YZ5A 5A32A 5A6XA 5LRSA 3ZKUA 2JDPA 3E5QA 4BHPA 4ZHNA 4GQ7A 3H42B 4D7SA 4RR3B 2ZHKA 5CYYA 2VUCA 2Z5WA 5SV5A 3P6BA 1NCQA 3V0BB 1HQLA 1RUG2 4C90A 2V72A 4MHRA 2OKXA 4JGZA 1X8MA 4HKLA 5J7MA 1AYM1 5L7OC 1JU4A 4BQ4A 2B39A 3PIGA 4IETA 2Y6HA 5FPVA 2EF6A 4FPKA 4FP2A 3I2HA 1JZ7A 5FQ0A 4DXZA 3W5NA 1ND2B 1PGW2 1LODA 2R072 4H14A 1OUSA 2HBTA 2J42A 3ILFA 4FI9A 3VV1A 3ZN4A 4YRDA 2VQAA 1H1IA 3H7JA 1QU0A 1W2OA 1P8JA 1OH3A 5CFDA 1M4WA 5I8YA 3KLSA 3GCXA 4Q8LA 3LAGA 1WCDJ 5IK4A 3U4SA 2AC1A 4FOQA 5A32B 4QU1A 1L7QA 4GJYA 2FHRA 3MGUA 5CKMA 4CP9A 3KQ4B 1XNCA 1O4ZA 2QQWA 1HX6A 4XJAA 4AEKA 2ZGKA 2H0BA 1NCQB 3EJKA 2V4AA 3MF9A 4LITA 5F3EA 3RI8A 4XBQA 4JGZB 3RRDA 4BOWA 2NMNA 2FMYA 4IV1C 4ORFA 2D98A 3KV9A 3WQ1A 1SBDA 1NYWA 4TWTA 4F7ZA 4TZDA 3OUHA 3N9PA 1UU4A 5FQ0B 1BBT2 1LOGA 1UN1A 2VOXA 5LY1A 4GMP1 1EV13 3BTAA 5JSOA 1XOYA 4IEWA 4AVBA 2CSGA 2V73A 1KQRA 1RVF1 1Y4WA 1ND3C 2RMU3 3D4KA 2W39A 4LMFA 5FY4A 3ZM8A 5C3SA 5CFDB 5BUVA 1A6CA 4LBKA 1AXZA 1N1TA 2TUNA 1RINA 1WMFA 1UOGA 4N9HA 5H9RA 4OULA 2W1QA 4CP9B 4NOTA 1Q5OA 5HI0A 3ZFGC 5FWEA 1JZ8A 2ET1A 2VW0A 3WF2A 1GZWA 3KGLA 4CEWC 2EALA 5I8SA 2AENA 1PVXA 2HWD1 2LUWA 5FZ4A 3U1XA 5FIXA 4LLOA 4IE5A 3LEIA 5C3PA 3WNXA 3OSDA 1YQ8A 2VMCA 3F95A 2D5FA 2ES3A 1QJZA 1CIYA 2WAOA 5JMCA 1RUH2 2WT1A 4XHBA 4QKBA 1WLWA 4Z2AA 4DXRA 4DS0A 4YZ4A 4GWIA 4AVCA 5IVCA 3CL1A 4OI4A 4XQ4A 2AEZA 4HK9A 1XU1A 2Z69A 2VW1A 4XUOA 3B7MA 3IDEA 5HV4A 1AX2A 2UWAA 1N3QA 4AI1A 4OHVA 2RMU1 4INDA 3T1MA 3CO2A 2CTVA 4IEYA 4A2UA 2O1QA 2RS11 4JV4A 5JI9A 1BMV2 1VBE3 1GUIA 3OGSA 1PVC2 4NE9A 4Q4W1 3ECQA 1MACA 3IZOA 3KHBA 5LA0A 1PNFA 3M4FA 3MLLA 1OD5A 1XPWA 3K3NA 1BQPA 3MPPG 1S0BA 5I0UA 2F4PA 1S2EA 1GZWB 2XBO3 3A22A 4HG6B 2IXLA 3VLBB 4BCUA 2FDJA 4RQPC 4E4DX 5C4WA 3GCWA 4XFBA 2V09A 3GNEA 4EWDA 1O3TA 1ZZ8A 1NCRC 1IKQA 2XQRA 1YIFA 1ZA4A 1UPSA 2VQUA 2QKDA 1C1FA 1Q8VA 2E31A 3UV9A 1POV3 4BJ0A 3RMYA 1QDCA 1XNBA 4NR1A 2D6OX 1W9SA 2WKKA 4NWWA 1UX7A 4FT8A 4E2SA 4LUMA 1UL9A 2ZGQA 4EQVA 1W8NA 1YJLA 3V56A 4B7EA 5LEJA 3WVJA 5D8AC 4FAHA 1YC61 3LDKA 2R063 2V5DA 4DXSA 3J7LA 4PIYA 2XJTA 3FLTA 4LHLA 2FDGA 1OKQA 1W6NA 3VBSA 5A1LA 3J4UH 4S2DA 5A7OA 5DZFA 1WW4A 2WNEA 4KG8A 4RL7A 4IEOA 5JXHA 3GALA 5C4WB 4CSWA 2GP5A 3PURA 4ARYA 2Z42A 3USUA 1KJRA 2JKBA 1UNBA 5T50A 3USSA 1XNDA 1UPIA 4ZZ5A 3M3QA 2WLQA 5G05L 3LEMA 1A78A 4CU9A 1ZX5A 1I9RA 2A71A 2QQIA 1N1VA 3CDZB 1LOCA 3KSCA 4HANA 4BB3A 3GZUC 4PJYA 3EQEA 1POV1 1W6QA 3I8TA 3H1YA 4P5YA 3PUIA 4GXLA 5FZLA 2B4KA 2VOVA 3ACHA 3U11A 3UESA 1ZBA3 4RFT0 3RVHA 1CX1A 1IPSA 1SCSA 3AZYA 5DXDA 3A0NA 5E8AA 1OUXA 4WM7A 1PIV3 1W6NB 3VBSB 4WM8A 2DWRA 2P4EA 5DAVA 2LM3A 2PN5A 5LZ6A 4RS5C 1S0EA 2F6BA 4A7ZA 1VJ2A 2W1SA 2VZ3A 1JZ6A 2XJPA 2OIIA 4LIUA 5A7PA 4D6QA 5DMYA 4KMQA 1EV12 1OPMA 1AL23 4KG0A 5FZGA 2Y6LA 5GLVA 3USUB 1ZRFA 4CDWC 4URTA 3KB5A 3EB7A 3EXUA 3BU7A 1HB1A 2DBIA 4HT1T 2MHFA 5DDJ3 4YVWA 5H9SA 3CBNA 2HKXA 4JDMA 1LGBA 2Y60A 4YNIA 5C3QA 5C7GA 1S0CA 2D6KA 5DUVA 1W0NA 1JTZX 1W6QB 3DCQA 5KR7A 4PLMA 3I7DA 3LA7A 5KHGA 4Y1XA 4D7YA 2YY1A 2CWSA 2WT0A 3Q9OA 3VDAA 4L92A 4IV3C 5CBLA 2Z4FA 3OG2A 4LKDA 3BTYA 5AC91 2RM21 2HWB3 2D3RA 4J1XA 2VUJA 2ZGNA 4WM7B 1IGOA 1BVP1 5IW0A 2PTMA 4WM8B 1YIPA 1DP0A 4Q4Y1 1K5MC 2Q1ZB 1SQ4A 5J96B 2G19A 1PIV1 1OLRA 4QQOA 3WG3A 1AR73 3LEKA 4Q4V2 4PBPA 3LA2A 1LENA 1A34A 1XJAA 4TXWA 5BXXA 4A7KA 3I59A 4BK4A 5K7PA 5FYSA 3CNAA 3ZFEA 2W3JA 2BP6A 2VZQA 1J83A 2L9LA 2Q8CA 3DF0A 4YVWB 1AR93 5ANNA 2WS91 1UAIA 3AZXA 5F8PA 4XF4A 4CTEA 5FRAA 4MXWA 2PAMA 2W95A 3ZYFA 4CDXC 4WZCA 5LK7B 2Y6JA 3POSA 5KXCA 1K45A 1H9PA 1VBE2 2VMDA 4JCKA 3JD73 2ZAHA 1HXS1 3D0SA 5LA1A 2WBKA 1MQTC 1DQ4A 3N9QA 2QNKA 4NJ4A 1NXD1 5A3WA 3WNPA 2XHNA 3CZUA 3L2YA 2XBO2 4OYUA 1X36A 3AP4A 1YQ6A 2BYVE 2E7AA 3KZ4C 4PQQA 4XDQA 1CX4A 2HWB1 4BQ3A 3WINE 3N9OA 2C24A 1W3VA 3J8F1 2BNOA 3HMYA 2XDVA 4UT5A 2FDHA 4BQ2A 1TNFA 5ACA3 5J37A 1GQGA 4FPJA 1LEDA 3AJYA 2GC2A 3I59B 3MV01 4KL1A 1SLIA 4QXBA 5BNPA 2OT7A 3ZFEB 4CCCA 3BCWA 4LLFA 1DYPA 2VJXA 2B42B 5LBEA 1DZQA 1QXRA 4HKWA 3VBOC 3ZN5A 4MXWB 3WF0A 2VCCA 3CKHA 5DPNA 1PM7A 1RMU3 1ULGA 4JKLA 1WWYA 3V65A 4LT5A 2R062 3VD9A 3T09A 1NLSA 3GBFA 2HEWF 2HWF1 4EV0A 2H6BA 2YBSA 1US2A 1Z0HA 2OQ7A 4S2FA 2ORZA 3AP7A 1IZ3A 2CYFA 1GLHA 5GALA 1WZXA 4UXAA 1UO9A 1PGL2 4ES8A 3L9JT 3WT3A 1MS8A 1FPN2 5LB6A 2VL4A 5FY9A 2O8QA 4BYYA 5L19A 2VU9A 4BDVB 1W28A 1KDMA 3NJYA 3POFA 4NIIA 2CGPA 3ST7A 3WCSA 4M01A 3AYAA 4PI2A 2C0ZA 3ZR5A 1ENRA 4PLOA 3WXPA 4AQ6A 4OCTA 1GWMA 4JGYA 5IAVA 5ACA1 5BNPB 4Y1VA 5JOXA 4LO7A 5LWBA 1QOTA 5K0UC 5A33A 3LIGA 1CZVA 1HRI3 2JB4A 1O3SA 1BK0A 3P3PA 3MZHA 4GMP0 1ZBA2 4RR3C 2R49A 2PHWA 4P9XA 4YW3A 2GNMA 3T08A 2DYCA 3PTYA 2C6SA 3VD7A 4DRVA 2CGOA 4Q8KA 3RSJA 1WD3A 1QJY3 2R30A 2CWMA 3NW4A 1WLCA 2J7MA 3P1IA 3Q8BA 2HWE1 2WQ4A 4RHV3 3UETA 3ZYHA 1YUDA 3NJZA 5FMOL 1R1A3 4NRMA 2YZ4A 2W08A 4LOSA 3AKTA 3VBUA 3LA3A 5A6YA 5FY5A 4KBZA 4A44A 1ND2C 4HVOA 1AL22 2QQLA 1QH7A 4PI0A 2F4LA 5L73A 2Q30A 2EIDA 4UOJA 4MADA 5DDJ2 3SCHA 1VIWB 5CG9A 1CR7A 2KR2A 5IT6A 2ZMLA 2VVFA 4JGYB 2H6CA 2DVBA 3WW2A 1AJOA 3R0RA 1KFUL 3NJXA 3M3CA 5A33B 1LOBA 5D2AA 4ZKTB 3OGRA 1X50A 2UY9A 4DPNA 4IDZA 2ZGSA 3VKNA 2DCJA 4GH4A 5FPLA 4DFSA 4YGDA 2G9FA 1NCQC 1HRV1 2HWC3 3M3OA 2W52A 2YROA 1UXZA 4JGZC 4PDWA 4KH9A 1EAH3 5L9VA 3MO4A 1WCSA 2R1BA 3WSOA 4C0HA 3H8OA 1OBNA 4RHV1 3NNGA 3VBFA 1AR72 3VBUB 2PHDA 1VBA3 4M4RA 3WCRA 1BEV3 1UOJA 1XRUA 4CUGA 3OCPA 4QDSA 1LKNA 4JDOA 2VE1A 2ILMA 1FX5A 2DCKA 4AR2A 4W50A 4FTEA 1AR92 5CFDC 4OMCA 1OFSA 3U0ZA 2ZTNA 5CVRA 1DYOA 3KS7A 5LA2A 2D44A 4D6SA 1RIRA 2BZDA 1RHI3 1HV0A 3JD72 3RZKA 3H3ZA 5GZDA 5IVJA 1VBD3 1REFA 4JQTA 4QDRA 2QQPA 1LHOA 2WQZC 4GH4B 3ZOIA 2ZXQA 1Q56A 1F5JA 2WL1A 4IEXA 4JKMA 4PDWB 2HWC1 2XG3A 1WMDA 4COZA 5DUXA 4EWAA 1Q8QA 4XBNA 1NY71 1NZCA 3KCXA 3RI9A 5A1AA 3PHMA 3VBFB 1MS3A 5IK7A 2D6LX 2DV9A 3RJRA 2B5HA 1LNSA 3RFRA 1MPXA 1AL0G 4FXGB 4PLNA 4QPGA 2GALA 2YU2A 3MIBA 4ARXA 1D4M1 2ZHLA 1VB4A 4FOVA 3N7MA 5F2WA 3VD4A 1U5ZA 4XILA 5FKBA 3FJSA 1RMU2 3Q8AA 1OA3A 4DUXA 3N7LA 5KC6A 1F9KA 2JXAA 4BK5A 1DGWA 3ASIA 3DPRA 1OI6A 1ENQA 4DEVA 3O1RA 1JHJA 1POV0 4BLJA 5KXDA 1W6OA 4WVVA 1LULA 4OHZA 5JSRA 4R8HA 3D8CA 1V6NA 4NMIA 5JWPA 2VZUA 2YPJA 3ZYPA 4E2GA 1LHNA 4DEQA 4JRAA 2OPWA 5IFTA 5F37A 2W91A 3ES4A 1ULFA 3OEAA 3U07A 2X09A 4HSLA 2I07B 3ON7A 4QPGB 1QJU1 3PUHA 3T0AA 2XVLA 4OI1A 3DXUA 3GDBA 4OMDA 3WOGA 2W47A 4B29A 1RGSA 2JD4A 1ZBE3 4FAGA 2VXJA 1HRI2 2PMWB 4HSJA 5E1RA 3ZSMA 4A42A 1MEC3 4AXOA 1SCRA 1UY2A 1DQ2A 1IG3A 1AYN3 4V2VA 2QFEA 2XWJB 4BA6A 5F9TA 2HJIA 1Y7BA 3ZXFA 2QQMA 4MLOA 4NIAA 3IM0A 1Z7S3 1IG0A 1QJY2 1STMA 3E5UA 3K77A 3ZPYA 3DPRB 4CP0A 1V6JA 5BNQA 2ERFA 2VZOA 3TAYA 5FR3A 1G9DA 1JZ4A 5FP8A 2IZWA 2WN2A 4Z92B 1W6OB 1R1A2 1SLAA 4CU8A 5C4WC 1S1AA 3OPTA 4MZUA 1ZZ9A 4OHXA 1AR61 4CP1A 3HD8B 2R041 5FMCA 3MI8A 2W1UA 1RB8G 5IYYA 4ZS3A 2QQOA 3ZXAC 5C9AC 1J1LA 1QF3A 2DUPA 3MUZ1 4MYEA 1F5FA 3VZJA 5JDBA 1JYWA 5FFOC 2YXSA 2R16A 2RG4A 2DU0A 3I3MA 3PJYA 4UI9L 3E97A 4JAAA 4KWKA 1QKQA 2QZ3A 1ZBE1 3UYJA 3UNPA 4FPCA 3NNLA 4GKXA 5A3TA 5C3RA 1AYN1 3BN6A 5C8CA 3UGGA 2O8OA 3IDAA 3VBSC 1EAH2 2WO1A 1Z7S1 3NNJA 3S0MA 2P3JA 3MYXA 3QH6A 3RNSA 3GXUA 4LBMA 1VBA2 4NHXA 4XF0A 1BEV2 1ULEA 3HWJA 5HXMA 1DFQA 2Y34A 5FZ9A 1GYKA 1E5RA 3VL8A 1IPKA 2V5YA 3TBDA 4KWUA 4AEJA 3NL1A 2VUDA 4Z1VA 3SHRA 1GWLA 5T54A 4I3PA 4CDUA 3BYWA 2OUHA 3N9NA 4C1WA 4E4ZA 1J3RA 2ARXA 3IN9A 1J84A 4L0PA 5T5LA 1RHI2 1UYYA 2GP3A 2DVGA 3T4HB 4JHZA 4LA2A 4W4ZA 1VBD2 4TSVA 3AL5A 1QJX2 2WA4A 3WLUA 1CWPA 5F7UA 4QXHA 4LO6B 1W99A 4MVTA 5C8CB 3HQRA 2Y38A 3LKJA 1CPNA 3EYPA 2I45A 3ILRA 1JYNA 1O4YA 4FTSA 4WM7C 4IQPA 5K4LA 3I2IA 2CDOA 2RE9A 4WM8C 1LECA 3M3EA 1RXGA 1QWRA 4IEQA 2ID4A 4IL7A 4MGKE 3WEZA 4ASLA 4R9DA 1R081 4TTGA 4K20A 1VRH3 4L99A 3A7QA 1IS5A 3A23A 3M7AA 2ZEXA 2X5IA 4GIQA 4QAWA 1VP6A 1F4HA 4XAAA 4YVWC 3WDUA 1SBFA 2WDBA 4QQPA 5SV8A 1COV3 1AUYA 3KV6A 2E6VA 5FYVA 4CDUB 1QNWA 3AKSA 4DOUA 1NOVA 2YC0A 3AK0A 4M00A 4ATEA 2BW8A 2RR12 5B4NA 3LFMA 2XJVA 4XJUA 2D40A 1XNTA 2BV4A 3WZ1A 1G86A 4DQAA 2NM1A 1OF3A 2VNGA 4PHZA 3I2JA 5KHIA 2AACA 1KITA 4XJWA 2YGMA 4COUA 1C8M3 5FKCA 1LOEA 4YM2A 2GC1A 4AHYA 4XFIA 1FT9A 5FUNA 4AAXA 1YFUA 3PUSA 2VNOA 3ACIA 2R1DA 3HPNA 3POJA 5I0SA 3D0JA 3MBWA 5IAXA 1O59A 3KV5A 1VRH1 5E6HA 2X5IB 3T2PA 4D0QA 2UURA 2OZ6A 5FZ6A 1WLTA 1MEC2 1U0AA 3S7EA 3VZKA 3CLPA 3FMGA 1COV1 3PU8A 5A3OA 2VCAA 3SEPA 2BERA 1ZRRA 1OURA 3OGGA 3SH3A 4AGVA 4YW6A 5L9BA 3VB9A 3ZYIB 3W58A 1LCLA 3KF5A 3O7OA 4LO5B 3JB8A 4GWMA 3DN7A 2UWCA 1OXCA 1H8TB 2X29A 3AVSA 1JYIA 1KFXL 4LHKA 4LEJA 1RL3A 4IE7A 5F5QA 3MHZA 1W8WA 4YGEA 4RD7A 5LA9A 4EZHA 3ELNA 2FD8A 2OQ6A 1PGSA 1C8M1 1U5IA 3JBG1 1IS6A 4NHMA 1RUE2 2NLRA 4XTMA 3RZZA 3SKJE 3KT7A 4GB31 4X8PA 5BNPC 5EP9A 1DGWX 4HETA 4FFFA 2V4VA 2C5DA 4FXKB 3H3LA 3JQWA 5FP9A 2J1EA 2JICA 3KQRA 4F3JA 5C8WA 3MUY1 3HQXA 3ZIWA 4EN8B 4META 4Y1UA 3AKQA 3N9MA 1GBGA 2VVDA 4NRQA 4XZUG 1NQDA 4COVA 3DKQA 2XPJA 3LPGA 3P3NA 1GR3A 3FLPA 3RDIA 3TN93 1UQXA 5A7NA 1D0GA 5GZGA 3GZAA 2XONA 4GMP3 1WCQA 3S6PA 1HN1A 3HN3A 2QBXA 3GBWA 3THCA 1RVF3 2BJSA 2AREA 4IGOA 5FYBA 5C9AA 2HEVF 2QQNA 5GKAC 3B9IA 5ABJA 1MS0A 4NIHA 4OLLA 1JMUB 4HLTA 1B35A 3C2UA 3EO6A 5FWJA 3ZX7A 1VBC2 5IK5A 1WGPA 5KC5A 1XBFA 3I49A 4DUWA 1SLTA 2D6NA 2DVFA 3I3EA 1BLZA 1UZZA 1FXZA 3MLKA 5HCHA 1VBB1 4JGYC 1GNHA 1JXNA 4QX0A 5A3LA 3RZMA 5LASA 1WKYA 3RZJA 2HWD3 1JN2P 2BOJA 2P3YA 3UJQA 1TVGA 2QQVA 4CCNA 3MPBA 1RUI1 2Q8DA 4AG4A 1H1MA 4HFSA 2LS6A 3BODA 1TME1 1NQJA 3AJZA 3B93A 4N8MA 1QOOA 2IXKA 2RJLA 4Q5OA 4LA3A 2BOIA 2Q1MA 4QD2A 3TN91 5FYIA 3WHTA 1BJQA 2WC2A 5FUPA 3AZZA 1XB9A 3FL7A 1SFNA 4FFIA 1XE8A 4GJZA 3WDYA 4AF9A 3C7FA 1OVPA 3HNMA 3VBUC 1W39A 4PT6A 5C9AB 2GN3A 5ABJB 2PLV1 2BVVA 4LIVA 3AP5A 3IIIA 2RS13 2A6WA 4FOYA 3ZFFA 5B4XA 2XHKA 2JB8A 1V9U3 2MEV1 3INAA 4I01A 1B35B 4Q4W3 1LEMA 4ZPIA 5DZEA 4AI9A 2ORXA 2BPA2 2YC2A 2ZGTA 4XETA 2P3IA 1YWKA 1LR5A 1O91A 5F5CA 1UIKA 5H9PA 4W6XA 4E4SA 5HXVA 1RUD3 4G4FA 3O1VA 1H4GA 4DINB 4QPYA 1UW8A 3WNMA 4AVTA 4EYUA 1G7YA 1ZA7A 4Q27A 1QXJA 4IERA 4QQLA 2ZHMA 3QD6A 1EUTA 1E5HA 2W0XA 4GH4C 4LK7A 2C26A 2RS32 1CAUA 2ARCA 3ETQA 5I93A 2EAAA 1DGRN 5IK8A 3K4DA 1UOFA 2PQSA 4PDWC 4OVEA 3O1TA 4LKSA 3KV4A 5LATA 3J7NA 1S0FA 1HIXA 2VNRA 3TOJA 3VBFC 2LRPA 5FMDA 3CF6E 3ITQA 3DGTA 4NHLA 2J1RA 4WZFA 5AFEA 4IW3A 2RJKA 4WBBA 1GSLA 4I30A 4UYBA 5APAA 4CA9A 1V9U1 4JQRA 4XUNA 5JLVA 1UKRA 2YGLA 1AYM2 1MZ6A 1MR5A 4YG6A 2ZABA 2EXKA 2GMMA 4NPLA 5FZEA 4AGGA 1GANA 2H0VA 3I3BA 1OQEA 1JZ3A 1RUD1 2UYBA 5TSWA 2OZJA 1GQHA 3WUCA 5CAZA 2RDQA 4Q0SA 2DCZA 1CAUB 1W0PA 1GWKA 1OLMA 4EJRA 3OF1A 2YMZA 2VECA 5FMBA 1K3IA 3O0VA 4X6RB 5F5IA 3TEXA 5J1XA 4YVSA 4B4PA 1GOHA 4PQ9A 2CHHA 5B2GB 4AVAA 2EIGA 1AXKA 1QJFA 3MW2A 4TYSA 1I5ZA 2O0OA 3OJBA 2ADEA 5F6KA 4XUQA 5FXXA 2VTXA 4NO4A 4JZRA 3AMHA 2VZTA 4XE9A 2VR4A 2HH9A 1FNYA 1JUHA 3IPVA 3OGJA 5FP4A 4QWNA 1GNYA 3VHOA 4H7LA 2IXIA 1UMHA 2Q4SA 3TB0A 3OD0A 3BGAA 2K2SA 5A80A 3MDPA 4XABA 3QOPA 5E16A 4XJ8A 4IXLA 2FMDA 1F35A 3PUQA 3ZLIA 3WNNA 4CCOA 3RG0A 4RA0A 2PAKA 5DN2A 3GM8A 4CXYA 2A1XA 3G6JB 2DFBA 3DPRC 4U36A 4W6WA 2BWCA 1PO21 2P5BA 4BU2A 3GHMA 3Q8EA 4GALA 1RVF2 1RUF3 1UZYA 5T52A 4OHWA 4UFHA 4Q2FA 4FFGA 4YVSB 1YXWA 2DVAA 2ARAA 2IVJA 2A5ZA 1JYCA 2XUMA 3RGBA 5BNNA 1FNZA 4Y1YA 2Z79A 3FFQA 2W87A 3OPZA 3LWCA 4CDQC 5A6QA 3IPVB 4CEYC 3WG1A 1KDKA 1CJDA 1V70A 2RM23 3WP6A 3DYPA 5FP3A 2HWD2 5AC93 4A7YA 5JOZA 4MO3M 3RZHA 4Q4Y3 5CFCA 4BQWA 4XQDA 1C5HA 1Q3EA 5L36A 3LSEA 2AEYA 5CNAA 5LK5A 1N3OA 3CEWA 2C1FA 5FMOS 5FPUA 4FQ4A 2BFUS 4E4HA 1EUUA 1DIWA 1EPWA 3ZIXA 2X53S 5T5JA 1UYXA 2EVXA 2VXRA 5FYYA 3NJVA 2WS93 3LSDA 3OTFA 4UFJA 2D7FA 1LAJA 1RUF1 5JXIA 2RMU2 5EQUA 3ES1A 3BPZA 3BPSA 2RS12 2DFCA 2RHPA 3OBRA 4HL0A 4Q4W2 5JAXA 3T3YA 2CU5A 1HXS3 2RS53 2DTWA 1YQCA 2D6PA 5BNNB 4FCAA 1TG7A 3WR0A 4NVPA 2P1BA 3H0OA 5G04L 4YW5A 3LZZA 1BCXA 3JZVA 3RWKX 5GLWA 2TNFA 2AH2A 4BPZA 4XCBA 3GGLA 4XIOA 3W9AA 4B4QA 4KU7A 1WW5A 5CFCB 1OPOA 2R0HA 3J8F3 2BWAA 4FPFA 4A6SA 3H1WA 2A3XA 1IS4A 5C8CC 4GD4A 1W05A 3U14A 3VN4A 4BZ4A 1KXGA 1R091 2IUWA 2VOTA 5FOBB 1O8PA 1Y3TA 4MOAA 2ZMNA 3BI3A 1FMD3 3MICA 4LR4A 3VBRA 2JDYA 5FJKA 3NKGA 2Q8OA 2OVUA 2G4IA 4IE4A 3NV2A 2JJ6A 2QJVA 4IE6A 1ENSA 2IWGB 2FCTA
chains in the Genus database with same CATH topology
3ACLA 1IQAA 3AM2A 5JIUA 1MS9A 3HN1A 1L3JA 3PNAA 2HWF3 2ZAAA 2RS51 2UU8A 3HBZA 1C57A 3ZXGA 5JR7B 3MF6A 3ZSEA 3UJOA 3AX4A 1X33A 2B7YA 5JSPA 1F8VA 1D2QA 2AR6A 5C33A 3K48A 1DZRA 4N53A 4E9KA 1ZZ6A 4J1WA 3TNQA 1OFNA 3VBRB 4KU8A 1FMD1 1ZREA 2VULA 4L2NA 2DF7A 2ZGRA 3U4XA 4E27A 3WP3A 4EROA 1MVEA 4KGGA 1BZWA 2IXCA 2X5IC 4N7IA 1RUOA 2VH9A 2YHJA 3HR9A 2ZX3A 2HWE3 4J6GA 4LBOA 3FHIB 3WUDA 4BM8A 2GZWA 3WX5A 5I8YA 2WFF3 1TNRA 2GSYA 4DY5A 4QGLA 5BNOC 5FO8B 1PO13 2BGCA 5J36A 2ZZQA 5GLUA 4XFAA 4LHNA 5JPNB 1H8TC 2B46X 3SITA 5CADA 3WDTA 3N3HA 5EFUA 4N53B 1PZ7A 1CPMA 1TMF3 2NPIA 1RTVA 4KBBA 3JB4C 4HMZA 5I91A 3ZSJA 2XLAA 3FWEA 1WCKA 2D93A 2GAUA 3CU7A 3CJXA 2E7QA 3IKWA 3KGZA 1HRV3 2FZ2A 5AC92 2RM22 4XF3A 4AEDA 1ZRCA 4EN0A 4S2HA 2JE9A 4Q4Y2 4XFCA 4MH0E 1PIV2 2E7TA 1X7NA 4HBNA 1N1SA 2WFF1 3ZDSA 2FZ1A 3RJ2X 4D7SA 5K8SA 1IPJA 1H1AA 1PO11 5K9YA 4O9GA 2WS92 1SMVA 1OMIA 2DUQA 1UU5A 1I3HA 1ULDA 4U2AA 3FUQA 1TMF1 1WW7A 5FLJA 2IFRA 1LOFA 5J3UA 1YFYA 4AEDB 1MZFA 1TQ5A 3BOWA 1KD7A 4ISRA 3RPQA 4XOGA 2HWB2 1D4VB 3MLJA 4NN0A 3J8F2 4H7MA 4MGYE 1O3QA 2ZZJA 4BIFA 5CB7A 3UK9A 1UMZA 3M3IA 1D4M3 4JDNA 3KMHA 1QQP3 2VGDA 3NSTA 3WY6A 5DZGA 2VMHA 1FOD1 2P37A 2WFPA 3OYWA 5ABJC 1XE7A 3IDCB 5C9AC 3ZYRA 4YM1A 1B35C 3OY8A 1LOAA 2AYHA 4K1ZA 4N90A 5CG8A 2NMOA 2HWF2 3EHKA 1W2UA 5KBFA 4MUVA 4L97A 4FPYA 1NLRA 1CQ9A 2EXJA 4Q1RA 3MFCA 4K7JA 2XKOA 1Y43B 2ZGOA 3WHUA 4Q0VA 1QJU3 2VY0A 5ACA2 3PVOA 1MZEA 2KA3A 1QQP1 1SLBA 3SCGA 3OYWB 2DCYA 4Q4X1 5CIRA 4Q29A 1H8VA 2X8KA 3OY8B 2PHUA 2XJSA 2OPKA 5FLHA 1RUC1 1QOSA 1LHVA 3HAGA 4C91A 2HWE2 2GMEA 2ET7A 2IXHA 1H2NA 5EYXA 1H0BA 3AYCA 1YJKA 2WZR1 3SNMA 1AR63 3B3QE 1C3HA 2R043 2ZX0A 4B7KA 2ATFA 2A7AA 3J26N 4AFDA 1N3PA 3O0XA 3WQ0A 1JHNA 4PIXA 2BTVC 2YYOA 1Q8PA 4IEPA 2XLGA 2JE7A 1H2KA 1V6MA 2WNUA 1ZZ7A 3WP4A 3NAPA 1CVNA 4H55A 2CNAA 1HW5A 3PVEA 4Q0QA 4OI2A 4LTAA 1HRV2 1W6PA 3WW4A 4EN7B 2CGNA 3AB0A 1RC6A 3E6BA 4XFFA 1KS5A 1DQ1A 1BXHA 1FV3A 4WVZA 2P3KA 1VAKA 4RHV2 1S0JA 4YYOA 4UW3A 3DUIA 3MEPA 3NV1A 3BALA 4FBFA 5AVPA 4XJZA 1D0HA 2ETEA 4HKOA 3N35A 3APBA 1RUJ1 4CZSA 2PFWA 4HPKA 2IXJA 4DZGA 4XHXA 1XQNA 4P9IA 3NO8A 2WSVA 2WNUB 3NAPB 3POWA 4Y22A 5T5OA 2NN8A 2VQ0A 1ASJ1 2SLIA 1UCXA 3AMQA 3WG2A 1W6PB 3BIWE 2UWBA 2OUJA 2GC3A 4OZXA 5J09A 2HWC2 2BVBA 3GZTB 2JENA 4P9GA 2VMGA 1AR83 3AMPA 1NY72 1REDA 2XJQA 3FE5A 4LBNA 1UD1A 4Y24A 1R083 4AE2A 4R9CA 1Z78A 1XYOA 1D4M2 1F31A 2JG8A 1JW6A 1DBNA 4RGGA 2I74A 3GBGA 3KT4A 2IC1A 3D6EA 3E5XA 3ZO0B 2ZCWA 1S0DA 2P17A 2W68A 4QPIA 4QGNA 4Y22B 2MNGA 1UKGA 5BNNC 2BBVA 1G9BA 5JCTA 4YGBA 4BLIA 4F8AA 3I54A 4LE4A 3VL9A 3B69A 5FCCA 1DQ0A 5GZEA 2I2SA 4HK8A 5BPXA 1ONAA 3ZMNA 4P14A 1OOPA 1CAVA 1O5LA 1J1TA 5CFCC 2BEOA 4Y1ZA 4ITCA 4SBVA 1AR81 2QUOA 4R9BA 3LOBA 3MFAA 2GDFA 1QJU2 1RUE1 5HCBA 1OQDA 2NZ9A 1SEFA 1MS1A 2LTNA 4C1XA 2NP0A 3AXDA 4FTBA 4NHKA 2JG8B 1LHWA 4ES9A 4K21A 1H4HA 2XJUA 4FO9A 1RUG1 1G9CA 3FUOA 3MIHA 1O7FA 3WDWA 5KHKA 4YGCA 4QPIB 4Z82A 4Z07A 3RS6A 4OUMA 1BBT3 1UIJA 3MW3A 3ATGA 2ZGUA 1F2NA 1PGW1 2R071 4ZU7A 3SMHA 4NPRA 1J58A 4YFZA 1D2SA 1AR62 1OOPB 1CAVB 2R042 3JBG3 3I4IA 3KD4A 2XL9A 4OFGA 4FPOB 4GB33 4K3UA 5LEKA 1DZTA 3VBRC 5FO9B 4AHXA 2JEMA 5EV7A 3ZFEC 3KCYA 1ZBE2 4Y5Z0 2A6ZA 4CRQA 5JVVA 1PK6A 3EBRA 1AYN2 1YLLA 4KNCA 1IS3A 2DURA 3THPA 2BQPA 3H1MA 4XFGA 2NQYA 2GC0A 1Z7S2 1BBT1 1CAXA 2GNTA 3B9CA 1YNAA 3GF6A 1OHFA 1WMEA 5JIAA 1CIWA 1S2KA 2DUOA 3MIDA 3VZNA 4FPHA 2VVEA 4I0AA 1ZYBA 2A3WA 5T55A 4ZU5A 1VBB3 4N53C 3R6SA 4G9SB 4LBLA 4Y4YA 1ZZBA 3H9AA 3QACA 2ZX4A 2A6YA 3WG4A 4KQ7A 3WD5A 1RUI3 1X8EA 4WVWA 1WBLA 4KWLA 1YFXA 1TME3 2WIIB 3ZXEA 1PK6B 3QLQA 1FI2A 2BNNA 1JUIA 2XVKA 3NKTA 1RUH1 3CJIA 1B09A 2AUYA 4XF1A 2OW4A 2ZACA 4AWDA 1LU2A 1CAXB 3AP6A 3QCWA 5I0RA 2PLV3 1R082 5AFBA 2MEV3 3VBHA 1BMV1 4COYA 1PVC1 3FBMA 1HDKA 5HCFA 2E53A 3ENRA 4LBQA 2ZPXA 5GJ6A 2WSUA 1G6NA 1A8DA 4V1PA 1T6GC 1PNGA 1NG0A 5I8TA 2Q0AA 1WUVA 5IUQA 4M3CE 4AEDC 3FZ3A 1UU6A 3VUOA 4M0HA 3CJIB 2QE3A 4Q0UA 1FAYA 1LJ7A 1QHDA 1WD4A 1BK1A 1YHFA 3WDXA 2GN7A 3ZIXA 3PMSA 2JX9A 2VOKA 2EA7A 3R4UA 1C8NA 4AFBA 2G9GA 4LBJA 1NXMA 4H3WA 1AVBA 1QY4A 3VBHB 1VRH2 3ZXDA 1W6MA 1SLCA 5E89A 3JCIA 1WBFA 1EPZA 5FPXA 4TLFA 4LBQB 3JQXA 1C1LA 1COV2 3PVBB 4MGIE 3SISA 4AHZA 1XXNA 2ZGMA 2NYYA 1O5UA 4X8NA 1LOFC 3N36A 5GZCA 3B01A 4LBQD 2WZPP 2CY6A 4X6QB 3PJQA 2ZKNA 5JZGA 4K6BA 4I2OA 3IIAA 1C8M2 1YRZA 1KS4A 3JBG2 1V6IA 3PLQA 4ASMB 4YZ2A 1PZ9A 1QMJA 3WV6A 2A73B 4WV8A 1AZDA 4GB32 3V64A 2VG9A 3ZFFB 1URXA 1W6MB 4YG0A 4I02A 4R9AA 4XZPA 2A70A 1GKBA 1OA4A 5GLZA 3VZMA 4MXVA 1NA1A 1IOAA 1SLLA 4Q4V3 2VOWA 1MVQA 3I2DA 3R4DB 2QVSB 5C6CA 2WWSA 1PO23 3C3VA 1EV11 4LE3A 1G9FA 1E57A 1CN1A 4XXPA 1GZCA 1H9WA 5JZGB 1LTEA 3MIGA 3VDDA 2QCSB 2BNMA 3B02A 2JG9A 3MIFA 5DG1A 4UW6A 1WA4A 3B00A 4YW4A 1CAWA 4LO8A 4ONUA 4QPGC 4QHBA 1VBB2 1U5YA 3SH4A 4YM0A 4UBGA 2PHFA 1RUI2 4XFHA 1VAMA 1TME2 1NA1B 2WJSA 1I6XA 1KRIA 3NV4A 3MW4A 3TN92 2QZ2A 3E6CC 4Q4V1 3VKLA 2PLV2 3VDDB 2JG9B 2MEV2 1REEA 1YI9A 4AQ2A 4HN0A 4AYUA 3RYRA 3K51A 1VBE1 1CAWB 4FPGA 1V6OA 2K0GA 1ENXA 2VW2A 2Y26A 3UKVA 4MSVA 1DYKA 4QQ2A 4AI8A 1RUNA 1PZ8A 5FPZA 2WNUC 4JTNA 4KGQA 2XBO1 3NAPC 1QNYA 2YV8A 2PQQA 2ZKLA 1FPN3 1KJLA 3VGIA 2AGSA 3ROUA 1QDOA 1R093 4WVMA 1N47A 3FLRA 4IEZA 4QM9A 4XQWA 3WW1A 2XH6A 3RMXA 1CESA 2XKPA 3UKNA 4RSUA 4AEMA 5CU1A 1XU2A 4XEZA 1CONA 4FSJA 3O0WA 4GWNA 1V9U2 1TEIA 1AX1A 1NE4A 2OYZA 4DNYA 1G8WA 3U10A 4YM3A 2R061 5A3MA 5FO7B 3S7IA 3ZVXA 1DDLA 1RUD2 2B45X 2WA3A 1OSGA 1DGLA 1XNKA 4F83A 1LESA 1PGL1 1N1YA 1FPN1 3ALQA 5EWSA 2DTYA 3RQ0A 2D3SA 3AYEA 4WVMB 3ZXKA 4L8QA 3IDBB 2QDRA 4B4RA 2TEPA 1JBCA 2SBAA 1HQWA 4K1YA 2E51A 3AYDA 5EYYA 4DY3A 1PMIA 2GH8A 3B94A 1DHKB 3POYA 3ZYJB 3DV8A 1LGNA 4YSFA 2KM2A 2ZOEB 5CA6A 1RJ7A 4Y20A 4R52A 1AJKA 4M3CF 2JG8C 1HKDA 1ZBA1 3AMNA 3H7YA 4I0WB 2R32A 3UKTA 2XVGA 4AQSA 4CDUC 5JOYA 4AHWA 4QPIC 4P9YA 2HYKA 3T1LA 3X29B 2PHXA 1HV1A 1PO22 4D69A 5I0TA 4Y26A 3AMMA 1XYPA 5FREA 4AI0A 1AL21 2ZHNA 5AVAA 4MX3A 4PIZA 4EN9B 5DDJ1 1OOPC 1A8MA 3AKRA 4AQTA 4PF5A 2XGXA 4N43A 1MS4A 3ME2A 1YO8A 3AXEA 4W65A 1X82A 3THTA 4Y20B 4YW2A 4SLIA 3SH5A 2P2KA 3M8LA 3H8UA 4HN1A 4D3WA 4XW3A 2KXLA 1UX6A 2Y0OA 1NE6A 2ZBJA 3VZLA 4AVVA 1ULCA 2CL2A 4K9SA 5JPMB 4AVSA 5KHHA 1BKZA 1APNA 2WNVA 1AR71 2PA7A 2VPVA 4R4XA 5JOWA 4FPLA 1RJ8A 2Y0IA 5GZFA 3IT8A 2A3YA 1PHMA 1FATA 2BUKA 2UY8A 4QQHA 1RUF2 1VALA 3SXWA 2XL7A 1AR91 3JUUA 5F1RA 5L7OA 4N43B 1QH6A 1YCIA 1GZ9A 4N7UA 1M06G 4OI0A 1H30A 3JD71 3JU9A 1MS5A 2B8MA 3TYJA 3AZVA 1LRHA 1U12A 5T5PA 1RITA 1VLNA 3RYPA 1PK6C 1SBEA 5HCAA 4IESA 1R092 5D1IA 2WNVB 1VAVA 3BOPA 3AZWA 4QT6A 1GNZA 1H2LA 1FOD3 3KM5A 4L9BA 5KHJA 1WW6A 3H50A 4XMIA 3IMNA 5GLTA 3RWNA 2ZGPA 5KXBA 5L7OB 2GNDA 3O14A 4IV1A 1QGLA 4XYXA 3R05A 2P34A 1XYNA 1RMU1 3FC0A 2FBEA 1HXS2 4AFMA 2RS52 5BV6A 3URFA 2BFUL 1Q8SA 4BH9A 1DQ6A 2IFWA 2UYAA 1ND3A 3FX3A 2A6VA 4XMAA 5BYNA 1ZRDA 2D97A 3ZSKA 4R4ZA 4ATFA 4FQZA 1YI7A 1HLCA 4ZXKA 3SCFA 1C28A 3CJIC 4QU2A 2ZJCA 2D6MA 3ZFGA 1FMD2 3DKWA 1MZ5A 2B9UA 4CEWA 1EYBA 3O12A 4Q4X3 2MPFA 1BYHA 5EXOA 3ZXJA 2R0FA 1HRI1 4UBHA 3GHNA 1I1EA 3VBHC 1FV2A 4D7TA 1LU1A 4IV1B 3LOIA 1Q43A 2ZGLA 1VB2A 4W6YA 4B8EA 1RUC3 4K8FA 1V00A 4PBOA 4FOWA 1YYNA 1QJY1 1LGCA 1YFWA 3H3UA 2JDZA 3ZSLA 4O9EA 1J59A 4OHYA 2WZR3 4YARA 5FDBA 3DL3A 1SFYA 1ND3B 1R1A1 4FPEA 5FAXA 3VZOA 3LGRA 1EP0A 3AKPA 1Y9QA 3NV3A 1H2MA 3VHRA 2LALA 4JC1A 5GM0A 4AI2A 4L11A 1HQNA 2R6QA 4XXAA 3TRSB 1OLQA 1OA2A 4KWJA 4YFWA 1A3KA 3L2HA 3ZFGB 1FYUA 1IHMA 2CAUA 1ALYA 3ZN6A 4CEWB 4LULA 2AZ5A 5T3NA 3KCCA 4Q0PA 4RQPA 1QJX3 4OUSA 3ZFFC 4DB5A 1NCRA 1GFF2 3M70A 3V0AA 1ZZCA 2YDEA 4AI3A 1EAH1 2CV6A 2WFF2 3ILNA 2D5HA 4XTPA 4RGAA 3QH7A 2C9AA 5BY5A 5DUWA 2ZS6B 4CYDA 3ZXLA 1VBA1 4AW7A 4AFCA 1PO12 1BEV1 4BMEA 1RUJ3 5D8AA 2FQPA 1U5XA 3B5LB 1C4RA 1AHSA 5JZGC 3N7KA 4JTOA 4N9IA